1YJKA

Reduced peptidylglycine alpha-hydroxylating monooxygenase (phm) in a new crystal form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
306
structure length
303
Chain Sequence
TIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title The Catalytic Copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also Plays a Critical Structural Role.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 65
structure length 303
sequence length 306
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yjkA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yjkA01
1PGSA 3MLLA 3MICA 1YJKA 1PNFA 3MIFA 3MLKA 1PHMA 3MIDA 4QHBA 4E4ZA 1YJLA 3MIBA 4R4ZA 3MIGA 3MLJA 4R4XA 1PNGA 3PHMA 3PMSA 1SDWA 1YIPA 3KS7A 1YI9A 1OPMA 3MIHA 3MIEA
chains in the Genus database with same CATH superfamily
2WQZC 1PO11 1W06A 3NWKA 1KEXA 2CL2A 1VRH1 4ZHNA 4P9GA 1RUG1 3G7DA 4IV1C 1VLNA 5FZKA 1HRI2 3OD0A 2ZEYA 2IZWA 1A6CA 1C4RA 3KV4A 1C8M3 1WA6X 5LA9A 4CCDA 1H1MA 3U0ZA 3D3AA 1YLLA 1I3HA 3UL2A 3OGVA 4P9LA 4A4AA 1S0IA 1QXJA 2VBBA 3C7EA 1G9BA 4Q0PA 5IWFA 2CWSA 1VAKA 1HRV2 4HN1A 5FMOS 5IFTA 5JVVA 4IV3B 3RMXA 2GDFA 2WQ4A 1FNYA 1F8VA 2R1DA 2Y26A 4AVBA 4BA6A 1A8DA 4GH4B 1HN1A 3AL5A 2WT1A 4XDQA 5FY4A 4YNIA 5I8SA 1EAH3 2JICA 1TMF2 4KGGA 5FKCA 4R52A 4A3XA 3HJRA 1JYIA 4MG2A 1H6XA 1UX6A 3AVSA 1VE0A 3AMPA 1S0JA 3VZMA 2JDMA 2WABA 5IATA 2MEV1 3MW2A 5FY9A 3TEXA 2VQTA 4YFZA 5EWSA 5DUUA 1AYM1 1S2KA 1OUXA 4S2DA 4RR3C 5FPUA 1W8TA 3MW4A 1NCQC 3SMHA 2PQSA 3NAPC 3WOGA 4E4ZA 3THDA 4BQ4A 3UGFA 1YFYA 2PTMA 3RZHA 1LGNA 3MLJA 2YXSA 4JDMA 1BHGA 1L3JA 1CZVA 5FYUA 3MO4A 5SV5A 4AFMA 4UFLA 2DBIA 2IVJA 2OKXA 4XZPA 3ZSJA 4XEZA 3HOBA 1J3RA 2HEYF 2QJVA 1GICA 1Q8PA 1NLRA 1V6JA 1JOJA 2VE1A 3CIHA 2FDKA 1Y43B 3O1MA 3UKNA 3OYWA 4F7ZA 3O0VA 4XZUG 1OD3A 5DZFA 5J37A 1QJX1 3UKTA 2JB4A 4LEJA 5C4WC 2B42B 3FWEA 5ABJA 2EXJA 4HLTA 5A6XA 1XB9A 3TOJA 4D6RA 5A1FA 4R4ZA 2YHJA 4EYUA 5EJ3A 4I02A 1V6KA 3MIGA 5CFCA 4MGQA 4AQ6A 2DFCA 1JZ4A 1NG0A 1WLDA 2V09A 3POYA 2P3KA 1POQA 1XNKA 1E5SA 1ZX5A 4FFIA 2QQUA 4CXWA 2J1VA 2RS52 1J59A 3CJIB 4KU8A 3EHKA 2GN7A 3EYPA 3ZN6A 2W94A 1OVPA 2DWRA 3NJXA 4QQHA 4XF3A 4XJ9A 2UY9A 2D6PA 1VBB1 3CEWA 3LEGA 5DAXA 2R7EB 4OHVA 5FYCA 3U37A 3PU8A 4E8DA 2WWUA 3IMNA 4Y5SA 1SLCA 1YWKA 5J36A 1LOGA 4HN0A 2JEMA 3ITQA 3SCHA 3ALQA 4BQXA 4QKNA 1WCDJ 1R083 4XVHA 1OVSA 5I0UA 1UY1A 1RHI2 4OQ8A 1TME1 3OBAA 4PQ9A 2D3RA 3IDAA 3WUDA 4JHZA 1GFF2 4K40A 3I2IA 5F1RA 4AVVA 1OPOA 5HCFA 4A45A 4LUMA 2UYAA 3CDZB 3I7DA 3WNMA 1LHOA 3M3IA 1UZVA 5IAXA 1YQ2A 4LTAA 3POGA 1AUYA 4Y22B 2GZWA 2XBO2 2VMCA 4EJRA 2HEWF 4L97A 3BB6A 4BCUA 2IC1A 2RS13 5D8AB 3O1VA 3OOXA 2YROA 1ZA4A 3OB8A 2JDUA 1BYHA 2AZ5A 3KF3A 3RVHA 1RINA 2VY0A 2WLPA 1SHWB 4Q27A 2HJIA 1QH7A 1ND2B 4XCAA 5FV3A 4R8HA 5GZEA 2RVAA 5GZFA 1JU4A 2PFWA 2VMDA 2CNAA 5FMOL 4LBLA 3H3LA 3D4KA 3OGGA 3RYPA 4N8MA 1BVP1 1BBT1 4KG0A 2PAKA 1PVC3 2E7AA 4LKSA 4O65A 5FP7A 1V9U2 2C9AA 2KD7A 3QH6A 5GLWA 3WDVA 5C8CC 1J3PA 5F5QA 3MYXA 1XBFA 3MV11 4Z07A 1ZRDA 3B94A 1CAUB 4BXSV 4K20A 1S1AA 1AYN3 4LUKA 1XE8A 3VZKA 2X09A 1ULOA 2VW0A 3NO8A 4YM1A 2WWSA 1VAMA 4CDUA 1ULFA 1QKQA 2PHWA 3R4DB 5KXCA 5GLVA 2ARBA 1LKNA 2BPA2 4DRRA 5JIUA 1PNGA 3B02A 2B5HA 3RDIA 3AP4A 2RR13 1AL23 4MHRA 4NO4A 1AR83 2WYSA 4K8RB 5K8SA 3JD71 2YV8A 3VBSB 4A3ZA 2BFUL 2E63A 3LA7A 1HX6A 2OYZA 1KFXL 1EP0A 1W6OA 3SLIA 3T0DA 3BVCA 1YFUA 2RG4A 3ME2A 5CEHA 4P9YA 4CRQA 1CPNA 1UYXA 5K0UA 4XW3A 2R072 2YDEA 3CHXA 1L7RA 3K4DA 3O1SA 2XG3A 2EAAA 4BLJA 1V6MA 3C7OA 3OY8A 4QPIB 1ULPA 4OMDA 4ZXEA 4XAEA 2YBPA 1T6BX 2DBNA 4GJYA 5BNOC 5J7MA 3PJQA 2D7FA 4HL0A 3FZ3A 3PIJA 3ZPOA 4HKLA 2YGMA 1ASJ3 2LROA 4OZXA 4NHYA 4Q4X3 2WC2A 3BUCA 3T4HB 2VZTA 2R061 1O8SA 2Z4FA 3UESA 1JHNA 3CF6E 2NZ9A 1W3XA 4CDXB 2FDIA 4RS5A 2HWC2 4I2OA 1C28A 1TG7A 1Z7S2 2LRPA 3ENRA 4GMP3 4Z1VA 4XUOA 3K75B 1D4M3 2VVDA 1OXCA 4I09A 2VJXA 1IG3A 2X10A 2WFF2 2ZGQA 4PLOA 5CNAA 1W0OA 1H1AA 1NY72 5KWRA 1CWPA 3OSDA 4TLGA 1MS5A 5FO7B 1GYKA 3GJAA 1UKRA 3J9SA 5ISLA 1C1FA 3L9JT 1KJLA 5GLUA 4CEWA 1SG3A 1H2KA 1QOOA 4QT6A 2JG9A 3J7LA 1ZBE2 4PF1A 1FPN3 2BTVC 4QX0A 1ZRIA 4IEPA 1O91A 3S0MA 5H9PA 1YQ6A 2WNUC 4QPGC 4NMIA 4PIYA 5A7WB 1YO8A 3SXWA 4WM7C 3RWKX 4QB1A 4NHXA 2ID4A 3ETPA 3BN6A 3E1F1 2ZGLA 5JCTA 5T50A 1HB2A 3ELNA 2UY8A 2LM3A 3POSA 4Q1PA 3PVNA 1RUJ2 1BKZA 3K4AA 3ETQA 1KFUL 5LATA 3S7EA 2ZCWA 1MS3A 2ZGNA 1OA4A 1HXS2 4AL9A 1PM4A 2VH9A 1SEFA 3NVCA 4N43C 4QQOA 5JXJA 2KM2A 2WZR2 2V4AA 4RHV1 1W8HA 4GMP0 5E6HA 5JZGB 3BTAA 1IS4A 2XONA 5BXXA 4CCJA 3NW4A 2ZX1A 4CTEA 5A6QA 3H8RA 2BU9A 4V2VA 4YW7A 1PGW1 3ZYJB 3Q9OA 3WQ0A 2VMIA 3ZFFA 3USUA 5KHIA 2V4VA 5C3SA 4YARA 2A3YA 1Q8QA 2XUMA 5IVCA 4Q4W2 1URXA 4LIUA 1AR61 2DURA 5FP4A 4BOWA 3ZPYA 1QMJA 1UL9A 5DAPA 3NNGA 4AEDB 4OZOA 1LHNA 1W2UA 4AVCA 3I3MA 1XE7A 5FPZA 3VKFC 4MLOA 3AMMA 3RWNA 4CZSA 3P3PA 4XF1A 5JXGA 1CPMA 4KG8A 3P1IA 5CFDC 1ULCA 2O14A 3TAYA 3IKWA 3VD7A 1GU3A 3LA3A 4MX3A 5L36A 3WV6A 5BY5A 3BOWA 3I2JA 2GNDA 4BK4A 3KS7A 1PMIA 3T0AA 4WVVA 1RC6A 4P14A 2AEYA 1XSRA 1BVVA 3ZFGA 1PO13 2WO7A 3BTXA 1VRH3 4LLFA 1RUG3 1WMXA 1H8VA 4H14A 3EMRA 3JQWA 4X6QB 2PHDA 1V6IA 3WG3A 5F37A 1YC61 3U1XA 3HMYA 1TNRA 3KGLA 1K12A 3DXUA 4W65A 4HSJA 2DUQA 1FYUA 3HAGA 2Q1MA 4PIXA 4ZS3A 5FZ7A 2QQJA 1AR73 1LOCA 3GBGA 3IPVB 5DQ0A 5FOBB 1BMV2 3FLPA 3WP4A 1DF0A 3K2OA 1S0FA 2CU5A 3LIHA 1GNYA 3AYEA 4MGZE 4OUSA 1PGL2 5KXEA 2GC1A 1QGLA 4Q0SA 5LASA 2PAMA 5H9RA 1Q3EA 1ZNPA 2WZPP 2Y6JA 1BLZA 1U5IA 2MEV3 3ORJA 5C33A 3P5BA 2QCSB 1G86A 3NNJA 4GALA 4K3UA 3WF2A 3W58A 5FXXA 3KD4A 4CCCA 3ACFA 1JN2P 4BU2A 1BCXA 2VZPA 4RA0A 1O5LA 4FPEA 1OH4A 2WSUA 1VAVA 4RGKA 4U2AA 4YG0A 2X53S 5CADA 1YFWA 4B1MA 4LORA 1WLCA 4UFHA 1GOHA 5FOJB 5D21A 3U4XA 1A3KA 2ZMLA 3NL1A 3T3YA 2E51A 4PDWA 5LWBA 2RDRA 3CJXA 3HQUA 4LBJA 1PK6B 2VOKA 3ZO0B 1EAH1 4XUQA 4BISA 3DUIA 3A7QA 2BV4A 4LE3A 2VAUA 4RSUA 5C3QA 2ARXA 3KQRA 2J1RA 1ULGA 1W9SA 1QJX3 1VBA2 2OPKA 2PLV2 2OX0A 4SLIA 2O8QA 3VD3A 4E4DX 1NA1C 4WBBA 4FP3A 4ASKA 1A78A 1MQTB 2RE9A 4AFCA 4LPLA 3H8XA 1QJEA 3FX3A 3X29B 4AOCA 2G9FA 2JDHA 4DMIA 1NT0A 1OI6A 4HOOA 3OBRA 3WW1A 4Q4V2 5FP8A 4K6BA 2A6ZA 5IVYA 1JUHA 2PXJA 1ENXA 1O8PA 3N9QA 2TBVA 2Q8DA 4A2UA 5FXWA 3KCXA 4Y4RA 1CD3G 3FLRA 5FJKA 2C5DA 5D1IA 2R0FA 3BALA 2VU9A 3VZOA 2Y33A 4Z82A 1FT9A 1GZWB 1V00A 1VBB3 1COV2 3AC0A 4L92A 2VZOA 4BDVB 2WBKA 4IE0A 1JZ7A 1UF2C 1XC6A 1NCRC 4QX8A 1AZDA 4ASMB 2ZX4A 3KT7A 4YLZA 5FYYA 3ATGA 4JGYC 2JWPA 1WW4A 4YVWC 4WM8A 2BOIA 3AP6A 1DQ0A 2VUJA 3VGIA 4AHWA 2ZACA 1LHVA 1WMFA 2C6SA 1H30A 4PJYA 1QU0A 3DYMA 3ZFEB 1CJPA 5FZ1A 4KI5M 1ZZCA 2A71A 3GCXA 1GQPA 1AXYA 1AJKA 1DCSA 2WSVA 4COYA 2VOWA 4QXHA 4XFBA 4LKFA 4ZPIA 2GP5A 2Y6LA 5EYXA 3HR9A 1IS3A 1SLBA 3ZSLA 2RDSA 3VBUA 4LE4A 2ET1A 4X8PA 2H6CA 1AXKA 1LR5A 5F8PA 4DY5A 5HV4A 4HKWA 1Y3TA 4D8MA 3ZX7A 4YVSA 1W6PA 4E4SA 5F3IA 5A80A 5ABJB 2ZBJA 4CUGA 3J7HA 2P6HA 4MXWA 2YZ4A 5J96B 2O1QA 5BNPA 2SLIA 4XCBA 5J48A 1H2MA 2W92A 2JIJA 4B4PA 1UCXA 4E2GA 3VBSA 5CFCB 3N7MA 5BNQA 2FD8A 1JHJA 1SLAA 2Q8CA 1VBC2 4LK7A 1IPSA 1BBT3 4QB2A 1ULDA 1KITA 4WVWA 1TQ5A 3LB9A 4AFAA 2E6VA 1UMHA 4ZU5A 5BUVA 3T2QA 1JYTA 4XABA 5FZEA 2PELA 3ZN6B 5FZ3A 1RUE2 3L2YA 3GF6A 1A8MA 1UMZA 4OUMA 4FPYA 3W9AA 3NRUA 5L9BA 4M00A 1IPJA 4GH4C 4Q29A 1W8ZA 1YRZA 3AYAA 1KDMA 1RMU2 4FFGA 4AK3A 3ZYPA 2FMDA 4Q4Y1 5CA6A 4A7ZA 4URAA 2XJQA 3MBWA 4NRPA 5AC93 3RZGA 1AR93 2B4KA 3IN9A 2Q8EA 4CDXA 3NV4A 2BJSA 3AKQA 5JOZA 1DYKA 1RUH2 4EN6B 3VD9A 4Y1XA 1JYWA 1BEV2 3LPGA 2CGOA 3AKRA 5L73A 2P3YA 2VOTA 1ONAA 2AREA 4Q0UA 1HB4A 1KD7A 3LQCA 2EA7A 2ZX2A 3O0XA 2SBAA 3VBOC 1K5MB 1FX5A 2YU2A 4IV1A 1YUDA 5DABA 5LY1A 1DIWA 2CSGA 4K1YA 3TEYA 2XVGA 2FQPA 4XJZA 2RR11 3E5XA 1X7NA 2XHNA 3H42B 4N53C 2WN3A 4RGGA 2QZ2A 2R063 4XUNA 1SCSA 2VMEA 5JOYA 5CKNA 4GJZA 4P5HA 2IXIA 3POJA 4P02B 4NHLA 4AI3A 1QJU2 1Z0HA 2I74A 2WA3A 4YM0A 5FK7A 4ZY9A 3V65A 3ZXGA 3K51A 3VKLA 3SH5A 1AHSA 5ERLA 1GLHA 3TN91 1AYM2 4XJWA 2DUPA 5GZDA 3VBHA 1LOBA 1ASJ1 3OPZA 4DXTA 3MZHA 4EWDA 2VTXJ 4XTMA 2QVSB 1QWRA 3K3OA 2RMU1 4NE9A 5LA1A 3RMYA 2HWD3 1UYYA 1FOD3 2RM22 4RR3A 1CZSA 5DG1A 4CP9B 1NCQA 5A1AA 4MUVA 2VULA 3M2MA 2Y38A 1G9DA 5I0DA 1C5HA 5EV7A 2BERA 5L7OC 1VMFA 1QIQA 1W6OB 2ZGTA 2HKXA 4ZKTB 4IE7A 3MICA 5K0UB 4CDWA 2AC1A 4ZONA 3OY8B 5JOXA 1R1A2 5DAVA 3AFGA 3KT1A 3I3QA 1MEC2 2DVFA 1UU6A 2P37A 1DHKB 4XMIA 4B8EA 2WFPA 3HIFA 4CP2A 3FHAA 5IVFA 1VBE2 2LTNA 3QCWA 2HH9A 1UY4A 4K1ZA 1HW5A 1BZWA 4RHV3 1CVNA 5C4WA 3O1TA 3PTRB 4AWDA 2XJTA 2TEPA 3D82A 1FPN1 2X5IC 1MS0A 4B4QA 5FZAA 5KC5A 3LOBA 3TYJA 2RV9A 1D0HA 4XFHA 1AR63 3RRDA 4AVSA 5LRSA 1ND2C 3LFMA 4RS5B 3WCSA 4BIFA 1LECA 2PA7A 4XUTA 3WQ7A 4B29A 5EHDA 2R16A 4LHNA 3ZN4A 3O7OA 3FJSA 4AQTA 3EQEA 4RQPC 5LBFA 3MUY1 5A3LA 1H8TC 4IGQA 3SCGA 4RD7A 2LUWA 4TSVA 4UW4A 1KXGA 2ZTNA 3ACGA 3GYDA 4LBMA 4L0PA 5FPAA 4DRVA 5GZGA 4CEWB 1UZWA 2C4XA 4B7EA 2YU1A 1R092 3I49A 4MXVA 1TME2 1X50A 3NQHA 4JTNA 1BK0A 2F4PA 1PIV1 2WT2A 3E5QA 4Y1YA 4YW3A 2QQLA 2VCBA 4DS0A 3N9MA 5DN2A 3AKPA 4HK9A 4HONA 4Q26A 5J09A 2XOMA 4OHXA 2EICA 2WDBA 4HXCA 3SNMA 3OD4A 1GANA 1FAYA 3ZYFA 3O1RA 3M3EA 1PO22 1X82A 4ZXKA 1LEMA 1WZXA 5FWEA 4COWA 1V0AA 1IHMA 1CZTA 3UKVA 4FPKA 1EV11 3LAGA 3E97A 2EXIA 4XDPA 3KSCA 3CL1A 4GQ7A 2DFBA 2R32A 3WF1A 4MV2A 2W9XA 2XL9A 3T08A 4QGNA 5JPNB 2HWB1 1RUC2 1U5XA 3ZFFB 3DN7A 3T4VA 3USUB 1I5ZA 4JKKA 3WNKA 2EIGA 2I45A 3GALA 1XNCA 4JKLA 1GNHA 2JD4A 1GNZA 3MGUA 1LOFA 3KV6A 3NV1A 3M1HA 3A0NA 3BPSA 2IUWA 5E89A 4NIGA 2ZMNA 1O4ZA 4FAGA 2YC2A 4GKXA 5ANNA 4FPJA 4LBQB 3KT4A 4XURA 5C8CA 1MQTA 3U75A 5I0TA 4P08A 5CISA 2XWJB 4YZ3A 1KDKA 4CCLA 2A6XA 3LF7A 1A34A 1AR71 1JYVA 2GNMA 2J1TA 3G6JB 1LESA 4XACA 4DZGA 4GB31 2IXKA 3NV2A 3JD72 3B3QE 3KWVA 1W9FA 5ACA2 1SZBA 2V5YA 1FMD3 1VBD1 3ILNA 3MF6A 4P9IA 5A7OA 1Y9GA 1VP6A 3K48A 1DGWA 1OQDA 5JR2A 2NM1A 1SFPA 2QQOA 4Q8LA 4LBOA 5KHJA 4W8JA 1GZWA 3ZFGB 4CCMA 1JZ8A 3R4UA 3DPRA 1S0EA 3H8UA 2VCAA 1W3VA 3NMBA 3VDBA 2XUEA 4KBZA 2DYCA 3PVBB 2CAUA 3UGGA 1UZZA 1KJRA 2OQ7A 3LGRA 3PIGA 2F6BA 1XPWA 4IDZA 4R9AA 4LOSA 1UIJA 3H1WA 2VZ1A 3PUHA 4UXAA 2IXJA 5FZHA 3WD5A 5IHRA 3ZFEA 5F9TA 1SBEA 4KWLA 1OBNA 5F7UA 4UFKA 5EQUA 1WMEA 2BNNA 1G7YA 3HQXA 2ZGOA 2HWF1 4KL1A 1E57A 5EXOA 4PI2A 4AHYA 3ZMOA 5HCBA 4UFJA 2VUCA 2WO1A 3PU3A 1GP6A 5HV0A 4AGVA 5HPOA 1DQ4A 1IPKA 2QTWB 1RUD3 5FRAA 3USSA 3GZEA 1ZYBA 2JECA 3IB3A 2K9ZA 2VQUA 1PZ7A 4JV4A 5A33A 4XJ8A 3WG1A 4IEOA 1JOBA 2ADDA 4OYUA 5DDJ1 5FZ4A 4EWEA 3QOPA 3HN1A 4FPOB 4NROA 3IDCB 2X29A 5CIRA 5FXVA 4NIHA 1W8NA 2OPWA 1G9AA 4L9BA 1GMMA 4HANA 4PDWB 2BQPA 4JGZC 2IFRA 2G9GA 1BQPA 1QDOA 1UXZA 2GMEA 4JAAA 4XFIA 4Y33A 3VL8A 3T1MA 5FMDA 2WNUA 1PX3A 1UO9A 3BOPA 2BWCA 1FI2A 3PNAA 4O61A 3O1PA 4FOWA 4COZA 2VUAA 2XJPA 4BB3A 1UAIA 1PZ8A 4PBPA 1ND3B 4YYOA 3RG0A 5JOWA 5JUVA 3VV1A 4FPGA 4X6RB 3WINE 3C7HA 5FP3A 2XMLA 3EXUA 2Q4SA 1CAWA 4P9XA 1YYNA 3GDBA 3F95A 1PGW2 1RUI2 3AYDA 4MVTA 2YB7A 5IAVA 5I91A 3JBG2 4ZU4A 5KHHA 2XVLA 2WR9A 4QKBA 3RFRA 5LA0A 4IEQA 3O1UA 5FY1A 5JSRA 1EPZA 5JXHA 4NIAA 5CG9A 4GD4A 2BYVE 2XLAA 2EIDA 1ACCA 5M0TA 1U0AA 1QF3A 1K5MA 1WMDA 4GWIA 4LA3A 4MO3M 5FY7A 3ZSEA 4C0BA 3T2OA 2MNGA 4QD2A 3WDWA 5A3UA 3FLTA 2QE3A 2RJLA 2DVDA 4Q4Y3 4A7KA 2FDJA 4W6XA 3E6DA 4NWVA 4WM8B 2D6MA 4XFFA 4YGCA 1XNTA 2D3PA 5CFDA 2HLEA 3AVRA 5A3WA 5BNNB 3OG2A 1RUF3 2JG8C 1GP4A 2XJRA 3LSEA 4P00B 1Q43A 2QQMA 4E2QA 2XJUA 2EF6A 3OEBA 4IQPA 3UJOA 4MYEA 5CKQA 1D0GA 5F6LB 1LODA 3VBUB 3MIFA 4OHZA 3ZXJA 5GKAC 1GR3A 1NQDA 3HD8B 1H1IA 1QJY1 4YVSB 4TWTA 1JS9A 2VNGA 1W6PB 4R9CA 4M3CF 1UWWA 1XXNA 1OKOA 3K77A 2ZGKA 3AZXA 3VDDA 4MXWB 4CP9A 3CNAA 3PUQA 3DKWA 3H7JA 3WR0A 5BNPB 5GZCA 3BI3A 2LALA 2ZKLA 3I54A 1GZTA 3GBFA 4K8FA 5DUVA 5AC91 4LT5A 1AR91 3FUQA 2ZGRA 2JD9A 5FYTA 3C7GA 2OA2A 5LK5A 5C70A 4GIQA 3I2GA 1HRI1 3MLLA 1WGPA 4DQAA 2R49A 5FZOA 1NUKA 1CX4A 3H1YA 4PCRA 4QU1A 4DY3A 2ES3A 4JRLA 5C5UA 1PVXA 3IM0A 4XFAA 3ZYHA 1RTVA 3W21A 1X9PA 5CVRA 5G05L 3FC0A 3B5LB 2VBDA 1C8M2 4IETA 3T0BA 1US3A 4QQPA 1IKPA 5DAWA 1W04A 3TN93 2C26A 4FSJA 3T2PA 1GWLA 4BM8A 3MFCA 5FZGA 4BYYA 3AP5A 5GM0A 3VDAA 1IZ3A 1WA4A 4LK6A 4XFGA 3AP7A 1NXD1 2RMU3 2J42A 3PMEA 3PURA 1MZEA 4JDNA 5F6KA 5KC6A 4EN9B 1O59A 2PHRA 4LITA 4P9JA 4O9EA 5JI7A 1LU1A 5C71A 1TMF1 1DZRA 4I0AA 3WW2A 2RS33 4YRDA 3AZYA 3NNFA 4IESA 4QXBA 1MS9A 3IBMA 2W39A 2R6QA 2JDPA 2V72A 3AB0A 3KZ4C 2JXAA 1EAH2 4UF0B 3ZSMA 5DZEA 1MS1A 2A70A 3DEMA 3DF0A 3D0JA 5AFEA 3ACIA 2W95A 3N35A 4QGLA 1E5IA 1EY2A 1AF9A 1W6QA 2W91A 2VBPA 1YNAA 2Q0AA 4AE2A 2YGLA 2IXHA 4XF9A 2R043 4IV1B 2RHPA 4QDQA 1N1SA 2HWD1 1UY0A 3ZYGA 1FOD1 3HBKA 2A5ZA 1W8FA 1ZZ9A 2ILMA 2KR2A 1NLQA 1OFNA 4OI2A 2ZOEB 2WS93 3THPA 5ABJC 1OLRA 4WZFA 4QM8A 1MS8A 1MZ6A 3LA2A 5FUIA 5GJ6A 4CU6A 2JE7A 2VQ0A 3HQRA 2BVVA 1AX1A 2ZMKA 4BMEA 1YJKA 2GN3A 1OA3A 3WP3A 4NJ4A 4QX7A 5E88A 1W6NA 4XQDA 1NX9A 3W5MA 2ZX0A 2D97A 3ILRA 2BNOA 1UD1A 2YC4A 1RVF3 5KR7A 2VCMA 1H6YA 1FATA 3VBHB 4CEYA 1HQNA 1QH6A 2BP6A 2WA4A 2WNVC 5B2GB 1MZFA 1NCRA 1JXNA 2RS51 1SBFA 1AX0A 2VC9A 1Q56A 4JGYA 1F4AA 4RR3B 5AVAA 4CPBA 5CBLA 1NCQB 1PIV3 2JB8A 4YVWA 3C2UA 3NAPB 4CUBA 1NQJA 5BPXA 3V64A 1ZREA 1HN0A 1VB4A 3IAPA 2YG0A 1SPPB 1R64A 3L2HA 3RZKA 3FUOA 4HZFA 4HPKA 4NRQA 1WD4A 4CDWB 5ANQA 3ZM8A 3FE5A 4LBQA 5FUNA 3T2TA 3MW3A 5A32A 1ALYA 4D94A 3GZAA 4QXCA 1EV13 2XL7A 5DMYA 2GC2A 2HWE3 2V73A 3J26N 3M3OA 4QX2A 5E8AA 1QQP3 4NHKA 1OF3A 5A7NA 3ZLIA 5HI0A 1OLME 4UFIA 1R082 1CGPA 2G1MA 5C4WB 2ZEXA 4KMQA 4AHXA 1GZ9A 5FZCA 2AGSA 2HWB3 2VNRA 3M8LA 5JLVA 1OOPC 3LZZA 5G04L 3WCRA 5C3RA 1Z78A 1GV9A 5K4LA 2MPFA 4XTPA 4JKMA 1GOGA 4F8AA 4JQTA 1CONA 2VG9A 3B9IA 2XB6C 2NP0A 1WUVA 4HKOA 3H50A 3IZOA 4AI9A 5F3GA 1MZ5A 5JDBA 2RS12 3QACA 5LBCA 4J1XA 4EN8B 5JSPA 5D2AA 2VTFA 1AVBA 5LZ6A 5A7SA 1UQXA 1UYZA 3ZDSA 2Y34A 3PHMA 2I2SA 4AW7A 5HCAA 1OMIA 4BJ0A 1ZA7A 1IOAA 3ACLA 1M06G 4LA2A 2PQQA 5A7PA 4CDQC 1H4HA 4FT8A 4GB33 2XPJA 1W2TA 3KB5A 4IEUA 4E4HA 5LY2A 3NJVA 2WN2A 2J7MA 3UK9A 1Y9MA 4CDUC 1C57A 1PVC2 1VBD3 4ASLA 5DG2A 2BW8A 3BIWE 4AF9A 1DU3D 3AKSA 2P3JA 5LW9A 2BOJA 2D93A 3JUUA 1AYN2 1XNBA 5FZ8A 4V1PA 2E26A 2CDPA 3AZZA 3ZOIA 2OIIA 4XHBA 1S0GA 4D7SA 2AUYA 1O6UA 3EO6A 3VBFC 3WXPA 1MPXA 2QKDA 5K0UC 1NAEA 5LB6A 4OI1A 4PLNA 3ZDVA 1YIPA 3VBOA 2RR12 2Z5WA 1AL22 1B35A 1SACA 1LHWA 2A6VA 1AR82 1F15A 2A7AA 1HKDA 2R071 3POWA 4JCKA 5F2WA 5L9RA 2JKBA 4E9KA 3N9LA 1RUNA 3U14A 3OBZA 3F2ZA 4TZDA 1FMD1 2WKKA 2HWF3 3ES4A 3W5NA 1XRUA 1REFA 3Q8FA 2EAKA 3Q8EA 1UYPA 3VBRC 4UAPA 3WVJA 4MZUA 3M4FA 1S0DA 5C3PA 3I3BA 5T55A 2VXRA 4O9GA 4UWDA 1BJQA 1ZRRA 4Q1RA 4IL7A 2YFUA 2K46A 1ND3A 1Q5OA 3MIDA 2J1AA 2NMOA 5C8CB 3ST7A 4QMAA 5DDJ3 3OPWA 1ASJ2 5FZ0A 4AI0A 2A3WA 5FKBA 4XMAA 3AZVA 4C1WA 1LRHA 4N9HA 4O7XA 1JODA 4XQ4A 3ZXFA 4OULA 4Q4X2 4JZRA 2HWC1 4OCTA 5JMOA 1Z7S1 2IFWA 2ZJCA 3WF4A 1I9RA 5F2SA 3ZXLA 1X36A 2VMGA 4YG3A 2R0HA 3DYOA 2R30A 2WFF1 1RYYA 2F17A 2P5BA 2VZUA 3GHNA 1TNFA 4WV8A 3N9NA 2WAAA 3WNNA 2FDFA 1UIKA 3WSOA 2W52A 3SITA 2JG9C 1DGRA 1D4M2 1CESA 1IGOA 3WDXA 5L7OA 1RUD1 1W8WA 3M7AA 3DPRB 4BQWA 3AMHA 3BKZA 1NZCA 1UNBA 2FZ2A 2E7QA 4AEJA 4BE3A 1CAXA 1DQ2A 1V6NA 2W1WA 2WINB 1ZBE1 4LBNA 2QQPA 2K0GA 4PI0A 3NV3A 3O1OA 2W1UA 2WO2A 4LO8A 3U10A 4FPFA 4OMCA 1LTEA 1CAVA 1T6GC 1VB2A 2OQ6A 5BNOB 1JOPA 5DZGA 4XIKA 2D6LX 4FQ4A 4LKDA 4DO0A 5C9AC 3WQ1A 1FPN2 3VHPA 4B1LA 1GQGA 5BNNA 3H1MA 4M3CE 1OF4A 3GJBA 3O0WA 2A1XA 5FLIA 5CKMA 1N1YA 5F3CA 1PX4A 1RUJ1 4UT5A 4LULA 3WNPA 1RXFA 4NUBA 4CCOA 4Y20A 4W6YA 1HXS1 4XXPA 3WNLA 5HCHA 3OGRA 5K9YA 2WZR1 2BBAA 2NLRA 3KCYA 5T52A 4MGSA 5A33B 1G8WA 3SQOA 3KF5A 4KH9A 1NE4A 3S57A 1TVGA 2VXJA 1REDA 4A7YA 4DOUA 2BBVA 1F5JA 5APAA 4Q4W1 1XU1A 1J58A 1XNAA 3MV01 2WZEA 3ZXEA 5FLJA 4R9DA 3VD5A 4Q5OA 3HNMA 4LIVA 1TE1B 2YC0A 5AVPA 2GU9A 3Q8CA 4XBNA 1VJ2A 5FTTC 3EBRA 2W46A 2UYBA 3KVBA 2E53A 2Z79A 1Y9QA 4IV3C 2A73B 4XIOA 4QPGB 2WNUB 3NSTA 4N9IA 3RQ0A 5L9VA 4WM7B 4AGGA 4YW6A 5IK7A 1QJY3 5FFOC 4JVAA 2ET7A 2DCZA 4JRAA 1K3IA 2CV6A 1SDWA 3OGSA 5F5IA 3DYPA 3N36A 4M4RA 1ZBA3 5FY0A 1TZOA 1ODMA 4AI8A 4GWMA 1CAWB 3KHCA 1DGLA 4N43B 4Y26A 1RUF1 4XXAA 3LKJA 1HRI3 5IUQA 4HG6B 4UF0A 3VKNA 4AI1A 4TTGA 1AXZA 4CA9A 4ISQA 1UY2A 2WNOA 1PO12 1F9KA 2PHUA 4XBQA 3LDBA 1VRH2 4CYDA 3VHOA 1RUG2 3CBNA 4EZ4A 4DFSA 3CZUA 1DZTA 3RZJA 2EALA 5LEKA 2J1SA 4RYDA 2VZVA 1ZVFA 1HRV3 1W9YA 5FAXA 4QX5A 2YY1A 3SISA 1YI7A 5C8WA 5IVBA 2Q1FA 2JDZA 2WNEA 3M3CA 1VMJA 3AM2A 3TNQA 5A3NA 2VVEA 1LGCA 2ZHLA 1AR72 4FFFA 4DB5A 1PGL1 1TMF3 4N90A 3S30A 3DL3A 4BMBA 5CFDB 1O3SA 4AXOA 5FO8B 1SLLA 3N9OA 5F5CA 1L7LA 2GC3A 2Z69A 2WIIB 2QBXA 2CYFA 2ARAA 2WL1A 4HFSA 3P3NA 2GNTA 2K2SA 4Q2FA 2EXHA 4FQZA 5BYNA 3LCPA 4QXKA 1ENRA 1XYOA 1SFNA 2JENA 2MEV2 1RJ8A 4DINB 5B4NA 4ARYA 2WWJA 3CJIC 4BIOA 5A3PA 1X8EA 1OUSA 1UOFA 5LBEA 4YW1A 4AZZA 1Q8VA 1DG6A 1FNZA 1MACA 2RDQA 3FBYA 4K7JA 4NOTA 3SEPA 2CGNA 1JMUB 3DCQA 3R0RA 4XF4A 3VDDB 3ECQA 4YSFA 4FOQA 4GZ9A 2VCCA 5I0SA 4L8QA 3NAPA 2WQ8A 2BGOA 4B7KA 4BH9A 1OPMA 1UPSA 2E31A 2RS31 4UI9L 4XDOA 4CU8A 4MGTA 2DDUA 1SPPA 5LA2A 2BWAA 2DCKA 5FYVA 3PUSA 4I3PA 4BWOA 2WUHA 2ZZQA 2VD7A 4MADA 5FZIA 3QLQA 5HXVA 3ZR6A 2GMPA 5FZOB 3WNXA 5FREA 2ETEA 1JYNA 2YYOA 2VQAA 4MOAA 4A42A 2AYHA 2B46X 5FCCA 3B7MA 5JR7B 1QJX2 4H7LA 2BEOA 1POV3 3JZVA 3LD8A 1C5IA 2R041 4LHKA 4CVUA 2OUHA 3FHIB 2RS53 4YFWA 3U07A 5D8AC 4NHMA 3OCPA 2ATFA 3AFKA 4AGRA 1JU3A 2WS91 4H2AA 4M0NA 4CCKA 3FFQA 2ZABA 3I4IA 3P6BA 4Z92B 1LB2A 3DGTA 5C5TA 2BNMA 2WRAA 2ZZJA 4QPWA 2VNVA 5FZBA 2D43A 2QNKA 3H0OA 3M3QA 1QXPA 1RJ7A 1DGRN 3S6PA 1HQLA 4ITCA 1C1LA 5FR3A 4JGZA 5IFPA 1VBB2 1HIXA 1QOTA 1P8JA 4E27A 1US2A 1PMHX 1W6QB 1RVF1 4E8CA 4WVMA 1RHI3 4ES8A 4AAPA 3PJYA 5DPNA 1SMVA 2DF7A 1U5ZA 1SLIA 3GCWA 3OUIA 5GLTA 5FYIA 3RS6A 3SH4A 1NA1B 3VD4A 4RL7A 2ADEA 4YVSC 2XBO3 4IW3A 3SEEA 1DQ1A 2EVXA 2UU8A 2WYFA 3ZSKA 1QXRA 2XKOA 1LCLA 1JUIA 3WX5A 2VOXA 5FYBA 3ZKYA 2P6CA 1HV1A 5H9SA 1J1LA 1LENA 2EIBA 3VBSC 3HNYM 1VMHA 3VDCA 3LDRA 1UW8A 1WCUA 2NN8A 3BU0A 1W6NB 5FZ9A 2Y6GA 4GKYA 1OSGA 3DV8A 3WDUA 2HWE1 4DXRA 3LDKA 1QQP1 2VMHA 4CEYB 4AQSA 4QPIC 4GULA 3T1LA 2J22A 4PIZA 5C6CA 1NCRB 1GZCA 1V9U3 3ES1A 4RFT0 2Y8KA 4FTEA 2VR4A 4B4RA 4G9SB 3MIEA 3BIEA 2DCYA 3AZWA 3GNEA 4JGYB 4JX0A 4CP1A 1W6MA 1WCQA 1RUE1 2DUOA 3N9PA 1BBT2 4QKDA 4YVWB 5IVJA 3GM8A 3MDPA 1WBFA 4H55A 5C7GA 2XDVA 3I97A 4HPKB 3LPFA 2Y6KA 2JG8A 2Z42A 3B9CA 4PBOA 1N47A 3I59A 3PDQA 4CDXC 5A32B 2VOVA 3W20A 4AHZA 1E5RA 3FL7A 4ZU7A 1I1EA 2G19A 3KV9A 3S5AA 3O12A 3WLUA 1W0PA 4UW3A 1MVEA 4YM2A 3RSJA 4FFHA 1V70A 4FPCA 4X8NA 1RUH1 2VZ3A 4DXSA 2R073 5FQ0A 4P9WA 1JYCA 5LK7B 2FCVA 3PUIA 3WHUA 1BEV1 4BLIA 1AR92 2XVKA 5AC92 3JB4C 1XSQA 3R05A 3FHQA 2UWAA 2WT0A 4IEZA 3K3NA 1WBLA 2ZHMA 4OI0A 2GP3A 5JWPA 4DUWA 2QQIA 1J84A 4G4FA 4AAXA 2UURA 3ZXKA 2H0BA 4CPBD 1ZRCA 3I3EA 2O8OA 4LJHA 1UMIA 4QX1A 2B45X 1O7FA 5IVVA 1J3QA 3A23A 2P1BA 3GHMA 5BNOA 4DUXA 1HV0A 3URFA 2VECA 5FYZA 3FFZA 4HVQA 2HWC3 1QJU1 2Z2SB 1Z7S3 4UYBA 4LBQD 1UX7A 3QD6A 2R062 1ODNA 4GAZA 3WG2A 1G9FA 3VBHC 1OFSA 4EQVA 2WFF3 3AYCA 2E7TA 1S55A 2XJVA 4NR1A 3IWZA 1D2SA 1V6OA 2P17A 5JZGC 4YZ2A 5T3NA 4AEKA 3I2KA 4IUGA 4FTSA 4IE5A 2ORZA 1GQHA 2D5FA 1CR7A 3I2DA 1DZQA 2C1FA 4LMFA 1H9WA 4YGBA 1O3TA 1ZZ8A 2JDKA 1ZBE3 2O0OA 4Y5Z0 2RJ2A 1KS4A 2RM21 4QDSA 1JI6A 2BFUS 4AEDC 1OLQA 2HYXA 4LQRA 3WQBA 4E2SA 4EV0A 4CDWC 2P34A 3HEIA 3ZXDA 3OEAA 4YM3A 5JMCA 1CX1A 2HWD2 2QDRA 4A41A 4Z8BA 1FOD2 4KBBA 3HT2A 1SCRA 4XFCA 3MIHA 2PHFA 3VBOB 2NQYA 1B35B 1AX2A 3MF9A 1W8UA 2GSYA 1N1TA 3R4SA 3C3VA 2NMNA 1RUJ3 1G6NA 1W0NA 4D3WA 4F3JA 3WUCA 3ZYRA 2PAEA 1R1A1 2QUOA 4N53B 4Z2AA 1HDKA 1MEC1 1WW7A 4QPGA 5JPMB 2VVFA 3RZLA 1OLMA 1HXS3 1WWYA 3OGJA 4WM7A 1VBE1 3TWIA 5KXDA 2B8MA 2WZR3 2X8KA 4CU7A 4KU7A 2BUKA 5GALA 4NAOA 2CY6A 3B93A 3WEZA 4GA9A 4J1WA 1O5UA 5HBAA 4RHV2 1G9CA 4Q4W3 5FZDA 1V6LA 4HK8A 2B9UA 5J98B 2DU1A 4Y4YA 2WJSA 2NYYA 5T5LA 4N43A 4Y1ZA 3V0AA 2WNVA 2ERFA 4YZ4A 4JC1A 3Q8AA 3GGLA 4FPHA 3TRSB 4KWUA 4Y1VA 5EYYA 1JYXA 1FV3A 2ARCA 1AR62 4AVTA 4EROA 4BQ5A 3ZXAC 1WW6A 3D6EA 4MHUA 5FPBA 4L11A 3KHBA 5L19A 1S2EA 1ZZBA 3SCFA 2PMWB 2IVIB 4D6QA 5L7OB 3ZIXA 4A6OA 3OPTA 2DTYA 2GH2A 3C8XA 3H3UA 2C0ZA 3APBA 4P5YA 4BXFA 5JAXA 1CAXB 1R091 3CQOA 4HVRA 2PHXA 4GXLA 1SBDA 3BYWA 4BZ4A 5FZMA 1YHFA 2HBUA 4LBKA 4EE2A 3HWJA 1CAVB 1UOBA 2IXCA 3J8F1 2OW4A 3HNBM 4TLFA 3UT0A 4AI2A 4AYUA 2Y60A 3ILFA 5A6ZA 1PGSA 1W9TA 2D3SA 1H2LA 1CIWA 2LS6A 3WP5A 5TSWA 1PO21 3TEWA 4HMZA 3MPPG 3NKTA 5A6YA 2PN5A 4UW5A 4FCAA 3MI8A 2X5IB 3H7YA 4MH0E 2VZRA 5FZ6A 1LOAA 1OOPA 2JDYA 1Y7BA 1EPWA 5CB7A 4ZS2A 3U78A 3H8OA 4Y20B 1QOSA 3S7IA 1HB1A 2VUDA 4CXYA 3AJZA 3POEA 4FXGB 1PK6C 4HT1T 3THCA 2ZA9A 3M70A 5A3MA 4R4XA 1HQWA 2W0XA 4XF0A 5LEJA 1RUC1 4QHOA 3D5OA 1LOFC 4OHYA 3ZKUA 1ZBA1 4LLOA 4RQPB 3AXDA 3MEPA 3IDEA 1H8TB 2FCUA 2QZ3A 3HN3A 1GUIA 3KM5A 4QU2A 3OBTA 1MQTC 1J1TA 3V0BA 5FDBA 4CDQA 3ZVXA 4J6GA 2W47A 1CIYA 4DXZA 3OUHA 3PVEA 2ZKNA 4NAMA 3OJBA 1UU4A 4AQ2A 2B7YA 4RFRB 4CCNA 2GALA 1HRV1 1R1ZA 1IQAA 2UWCA 4RN5A 5LBBA 2WLQA 2W08A 4DPNA 2KA3A 3VL9A 2FBEA 1WCKA 3KVAA 5ACA1 1OQ1A 3ASIA 2ZGPA 3DPRC 2OZJA 1MR5A 1WKYA 3KGZA 3KQ4B 3NJZA 5EFUA 3VBFA 4D7TA 1O3QA 3JQXA 1BK1A 4FPLA 4EWAA 4QDRA 1IQDC 1LHUA 3N7JA 2B39A 1FMD2 2PLV3 1VBA3 3BODA 1NZIA 1XJAA 4N7IA 4FBFA 3HBZA 1ST8A 4LXLA 3ZFEC 2VPVA 5EZWA 2Y6FA 3DECA 3RZZA 3WW3A 5J3UA 3I2OA 3LWCA 3UGHA 3K46A 4KWJA 4MGYE 4DEVA 3VBRA 1UOJA 4M3CA 4ZZ5A 5IVEA 4Q4V3 4XE9A 4NWWA 5FPLA 4HVOA 2DVGA 3AKTA 5FZFA 5T5PA 2DU0A 3VZNA 3PMSA 1W28A 1MVQA 3DKQA 3DXTA 1NA1A 2W1QA 2VNOA 4IGOA 5EJZB 3T30A 1H4GA 1NXMA 3A21A 2YFZA 3LE0A 4ONUA 4R9BA 1CN1A 2R1BA 3AXEA 1AL0G 3VB9A 5I93A 1COV3 5FPXA 1IS5A 1F5FA 1O3RA 2Y0IA 1J83A 3ZIWA 5CFCC 2W3JA 2N7GA 3MUZ1 2FDGA 1RUD2 4IERA 2P4EA 2XXZA 2JE9A 3WF3A 5DAQA 2AEZA 3WY6A 1GOFA 1POV1 2BVBA 4HETA 5KXBA 1O4TA 4KGQA 2FDHA 2QQKA 2XLGA 1ZRFA 1GP5A 2Q5TA 3OTFA 3IIIA 1GKBA 4LNVA 4D6SA 1W39A 3A22A 3Q8BA 1YI9A 2VW2A 3SC7X 5KHGA 4I30A 2Q1ZB 1BXHA 3AP9A 4Y5TA 3LEKA 4EZHA 4YWAA 3RI9A 1IKQA 2VM9A 2NPIA 4F83A 2E32A 4CUCA 2OUJA 1L7QA 4NIDA 5C9AA 3J7NA 4META 1I6XA 4GWNA 1W8OA 2B9VA 2IWGB 2Y64A 1UKGA 5T5JA 2F4LA 3VKOA 4C90A 3I2HA 1S0BA 3KCCA 1D7PM 2VMFA 4QHBA 4FTBA 4H3WA 1NE6A 3FN9A 2XH6A 4IGPA 1RHI1 2GMMA 4XBLA 4NRMA 2ZGSA 5CZKA 1N3OA 2ZPXA 5E16A 2QDNA 1ZM1A 1RUI1 2JKXA 1DGWX 1VBC3 2TUNA 2BDRA 5FY5A 1JBCA 1QNWA 1X33A 3JBG1 4MGIE 5SV8A 3SKJE 3S5QA 1NLSA 1N3PA 3WT3A 4AFBA 1OA2A 2RJKA 2XBO1 4M4PA 4XC9A 5IYYA 2VZSA 1K5MC 1RUE3 4EN0A 1RIRA 2CTVA 3IT8A 1W2NA 4JDOA 3LOIA 1RMU3 4L2NA 4YG6A 3AMNA 4FI9A 1SQ4A 4COVA 5A3TA 3A0KA 2PHLA 2WZ8A 4JGZB 4QWNA 4JHTA 4W6WA 3PL0A 5LCWL 1HJGA 4CP0A 4IV3A 1VRBA 2D5HA 3SKVA 4CXXA 4WVMB 1KRIA 4C1XA 4XUPA 4Q4Y2 4GH4A 1DLLA 2D6KA 3WF0A 1DQ6A 1N3QA 1V9U1 4LKEA 1RUH3 1TEIA 2YPJA 3WDYA 1LOEA 1XQNA 1BEV3 2X05A 2HYKA 3UETA 1RUF2 2GAUA 1EYBA 3AL6A 5IW0A 4YPJA 3B01A 3UJQA 1NYWA 1HLCA 2A6YA 3QBQA 3VDDC 4Z2WA 1QJFA 3AJYA 4JQRA 1UZ0A 4XYXA 1W2AX 3U4SA 2JJ6A 2BZDA 4FXKB 4ES9A 5T5OA 1OURA 3H3ZA 2KXLA 1UOGA 1YJLA 4XILA 3NNLA 3RI8A 2DTWA 1NOVA 4LOTA 5A70A 3WW4A 5FZLA 1NKGA 4KNCA 4QHZA 1RXGA 1JH5A 1YFXA 4I3GA 3NKGA 1RB8G 3NNMA 2XGXA 3IMMA 4AVAA 1PZ9A 1FXZA 5K7PA 5EPAA 4NIIA 1QJU3 4I01A 4LHSA 1F4HA 1UY3A 2CAVA 4M0HA 1CJDA 5F32A 4BK5A 3GBWA 4UFMA 5FUPA 1KQRA 3D0SA 4UBHA 3ZN5A 4C8DA 1T2XA 1X8MA 2DV9A 3MPBA 1W6MB 4N53A 4FAHA 1MS4A 5GLZA 2FMYA 1AJOA 1JZ3A 3HT1A 5F5AA 1C8M1 5FBZA 4FOYA 1AYM3 5JIAA 2BRTA 2XQXA 3V56A 5T54A 1PHMA 4S2FA 2AR6A 3ZYIB 5C3OA 3INAA 1UXXX 1QHDA 2JG8B 2A3XA 1DLCA 4XOGA 1RUOA 3I59B 2HEVF 3TN92 2W5FA 2RM23 1F31A 4RS5C 4YW5A 4OQ9A 3E6CC 4ATFA 4QAWA 5A1LA 4IEYA 1F2NA 2J1EA 2RMU2 3B69A 3CJIA 3K4ZA 3RPQA 1PM7A 4YW2A 4DNYA 1RL3A 4YZ5A 1C8NA 5KBFA 4OLLA 3UYJA 4Q0VA 5CAZA 1LAJA 5FQ0B 4S2GA 1DBNA 2RS32 4XAAA 3LEMA 3SHRA 2J1UA 5DUWA 5IT6A 2OXBA 3WG4A 4PQQA 4UW6A 3IDBB 1NY71 1R1A3 4CEWC 1MEC3 2D98A 4BHPA 4D69A 2QQWA 2PYTA 3EB7A 1ZZ7A 4Y24A 2W68A 3VUOA 4TXWA 1LULA 1VBE3 4L99A 4K9SA 4BQ2A 4PHZA 3MIBA 3CO2A 5FYMA 5LRRA 3VKMA 4OVEA 4COUA 1D2QA 3PTYA 2VTXA 5A3OA 1QDCA 3WZ1A 2XLFA 5FWJA 1QY4A 2R042 4J25A 3CZJA 1S4CA 1Q8OA 4I0WB 2P2KA 1CQ9A 4Y22A 2E9QA 2VL4A 4RGAA 4WVZA 3VHRA 4PT6A 2L9LA 3JXSA 1DQ5A 3FBMA 2WS92 3MHZA 4AR2A 4H7MA 5I8TA 1LJ7A 1WLTA 2X5IA 2D40A 5D8AA 5EJ1B 4C0HA 5B4XA 4CEYC 4CUAA 4B3NA 2ORXA 5JSOA 3BTYA 4IE4A 3N7KA 2CGPA 2JDAA 3WHTA 2VZQA 5JXIA 1O4YA 3RZMA 1ENQA 1ND2A 3ZFFC 1DFQA 3PUAA 3KMHA 2DVAA 4URTA 4BQYA 4I0BA 4LO7A 3VZLA 3FMGA 3RJ2X 1RVF2 2Y0OA 1R093 5F39A 2BGCA 1EUUA 1QNYA 1TME3 3O14A 4A44A 3TEZA 2DVBA 2CWMA 4OUEA 1K45A 3W59A 4RQPA 3GZTB 1H8TA 3J8F3 4INDA 1E5HA 1YIFA 2A6WA 1FV2A 3CKHA 1REEA 1CAUA 1PIV2 2G9ZA 3OUJA 3RYKA 5DXDA 1PO23 4QKFA 2YPDA 1SDDB 5CYYA 2FCTA 3OYWB 4OHWA 1Y4WA 5EIYB 3VZJA 2XJSA 4NPMA 3LFIA 4FVVA 5IJRA 5KHKA 1S2BA 4LO5B 4W50A 4V2WA 1APNA 1D4VB 1UN1A 1R081 3I2FA 4K21A 1WCSA 1EV12 2H0VA 2W87A 2HWE2 2ZS6B 3GZUC 1DYOA 4YW4A 3ZFGC 1QQP2 4DUVA 4UBGA 1RUC3 3EJKA 4PF5A 4QM9A 2MHFA 1HJFA 1U5YA 4MGKE 2GNBA 1F35A 1ULEA 2GH8A 3HPNA 4XJAA 3PLQA 1W03A 2EIEA 1EUTA 5FYSA 4G3YC 3V0AB 2ZAAA 2HWB2 3BU7A 2WNVB 3ON7A 4QPIA 4QB6A 2YMZA 2YUEA 4YZ1A 3ACHA 5FLHA 3BGAA 2OVUA 4QPYA 4D7YA 2RS11 1PNFA 3E6BA 5IK5A 5FYHA 4NN0A 1XU2A 3ZYBA 1W9WA 5FK8A 3MLKA 4ISRA 1JW6A 1YEWA 5FXZA 4AEMA 1QJZA 4BQ1A 1GBGA 5BV6A 1YXWA 3KV5A 4FO9A 1VPHA 1BMV1 4W4ZA 1OKQA 3AX4A 3TB0A 3OF1A 4WZCA 3JD73 2CDOA 3KLSA 2XKPA 2JDNA 4DIQA 2XR4A 5ACA3 1W05A 1OD5A 4OI4A 1PVC1 2ZAHA 2ZHNA 2HBTA 4GB32 1LU2A 4SBVA 2BGPA 5CU1A 3LEIA 3RJRA 4IE6A 1XYPA 1W90A 4FOVA 2C24A 1AYN1 1VBD2 3WP6A 4QQ2A 3ZMNA 4KQ7A 4UOJA 1DDLA 2Q30A 1I5PA 4ET7A 1OT5A 1Q8SA 3WNOA 4CSWA 1OOPB 1B35C 4TYSA 5H9QA 1U12A 1IS6A 1PMJX 1WD3A 2AACA 4PDWC 5J1XA 2ZXQA 4NVPA 1SLTA 2VW1A 4LHLA 2EXKA 3HVDA 1AL21 5DUXA 5E1RA 1AR81 1GWMA 1UU5A 2D6OX 2JE8A 3J4UH 2V5DA 4QGMA 5A7WA 1KGYA 4XETA 4TN7A 4Q8KA 1W99A 3RNSA 1IG0A 1C3HA 3WDTA 3NJYA 2W1SA 2PHTA 1QEXA 4Q0QA 4XPVA 2Y6HA 1ND3C 3BPZA 1ZZ6A 1W2OA 3IIAA 5FBJA 4EN7B 1UZYA 3V0BB 2FZ1A 2HWF2 2PLV1 1VBA1 5FO9B 1XE0A 3LIGA 2QQNA 2OS2A 1JZ2A 4CDQB 2DCJA 1YQ5A 1LEDA 5IK8A 3ZR5A 3C7FA 4BPZA 2D44A 1YQ8A 3A4UA 3I8TA 3POFA 4IEWA 4CDUB 5JZGA 3RGBA 1JZ6A 2ZEZA 1OH3A 4Q4V1 3TBDA 4Q4X1 4ARXA 3JB8A 2IXLA 1GWKA 2W2IA 5DDJ2 4CCEA 1LNSA 2E33A 2JIGA 2XQRA 5CG8A 3J7MA 4Y1UA 4AEDA 2D6NA 4GMP1 3VBFB 4Y3OA 4IEVA 3B00A 1JTZX 1D4M1 1COV1 3AMQA 1K42A 1UPIA 2AH2A 4N7UA 4WM8C 3D8CA 4KWKA 2A75A 2CHHA 4HSLA 4OFGA 1KS5A 2QFEA 3ABZA 2P3IA 3E5UA 4BQ3A 4YGEA 3THTA 5BNNC 4JTOA 4XHXA 2H6BA 3VBRB 3AK0A 2YBKA 2JX9A 4M3CB 4AFDA 3CMGA 5FP9A 3N7LA 1RUI3 5F3EA 3VBUC 4DEQA 2FHRA 3T09A 2ZX3A 4CU9A 5I0RA 1VALA 2OT7A 3CU7A 2ZGUA 1WLWA 2YBSA 3JBG3 2G4IA 4LO6B 4ORFA 4U36A 3VHNA 5FIXA 3SH3A 5EP9A 1SFYA 1HB3A 2AENA 3N4MA 1XOYA 2C9KA 4M01A 2UWBA 1DP0A 3PVOA 2DCTA 1GSLA 2VGDA 4PLMA 1POV0 5FMCA 4C91A 3BTZA 3VLBB 5BNPC 3POIA 3JU9A 2WO3A 1N1VA 3BCWA 3QH7A 5IK4A 2TNFA 5JI9A 1VIWB 3RYRA 4QX3A 3UNPA 3I3DA 4A6SA 4MSVA 5AFBA 3IPVA 1H0BA 1K5JA 2GC0A 5A7QA 5HXMA 2WAOA 2JG9B 1OC1A 5FPVA 1WW5A 3TNPB 2XHKA 1DYPA 4NPLA 1VBC1 2ENRA 2Q8OA 4AG4A 3JCIA 1ENSA 4XJUA 4XQWA 3ROUA 3R6SA 3VN4A 2I07B 4D0QA 2LW8A 2VO5A 3J8F2 1JZ5A 3LSDA 5FJHA 3U11A 2ZEWA 4FP2A 4CE8A 1B09A 5FY8A 1YCIA 4S2HA 1RITA 1XNDA 1YQCA 4YGDA 2QQVA 5C9AB 1STMA 1XYNA 3MFAA 3POBA 4IEXA 5FMBA 1RMU1 4GWJA 4QQLA 2ZHKA 1OHFA 2XWBB 2ZGMA 1LGBA 3CLPA 1OQEA 4LR4A 4NPRA 1H9PA 1QJY2 4ATEA 4ZZ8A 5I8YA 2RDNA 1VR3A 4IXLA 1X9TA 2OZ6A 4LO4B 1M4WA 1PK6A 3O5SA 3H9AA 1RGSA 3GXUA 3N3HA 1ZBA2 3UV9A 4HBNA 3IAQA 1S0CA 1H2NA
chains in the Genus database with same CATH topology
2WQZC 1PO11 3NWKA 2CL2A 1VRH1 4P9GA 1RUG1 3G7DA 4IV1C 1VLNA 1HRI2 3OD0A 2IZWA 1A6CA 1C4RA 1C8M3 1H1MA 3U0ZA 1YLLA 1I3HA 3UL2A 4P9LA 1S0IA 1QXJA 1G9BA 4Q0PA 2CWSA 1VAKA 1HRV2 4HN1A 5FMOS 5JVVA 4IV3B 3RMXA 2GDFA 2WQ4A 1FNYA 1F8VA 2R1DA 2Y26A 4AVBA 4BA6A 1A8DA 4GH4B 4XDQA 2WT1A 4YNIA 5I8SA 1EAH3 2JICA 1TMF2 4KGGA 4A3XA 4R52A 1JYIA 1UX6A 3AMPA 1S0JA 3VZMA 1ZREA 2MEV1 3MW2A 4YFZA 5EWSA 5DUUA 1AYM1 1S2KA 4S2DA 4RR3C 3MW4A 1NCQC 3SMHA 3NAPC 3WOGA 4E4ZA 1YFYA 2PTMA 1LGNA 3MLJA 2YXSA 4JDMA 1L3JA 5SV5A 4AFMA 3ZSJA 4XZPA 4XEZA 1J3RA 2HEYF 2QJVA 1GICA 1Q8PA 1NLRA 1V6JA 1JOJA 1Y43B 3UKNA 3OYWA 4F7ZA 3O0VA 5DZFA 5J37A 1QJX1 3UKTA 4LEJA 5C4WC 2B42B 3FWEA 5ABJA 2EXJA 4HLTA 3TOJA 4R4ZA 2YHJA 5EJ3A 4I02A 1V6KA 3MIGA 5CFCA 4AQ6A 2DFCA 1NG0A 1WLDA 2V09A 3POYA 2P3KA 1XNKA 1ZX5A 1J59A 2RS52 3CJIB 4KU8A 3EHKA 2GN7A 3ZN6A 2DWRA 4QQHA 4XF3A 4XJ9A 2UY9A 2D6PA 1VBB1 3CEWA 4OHVA 3IMNA 1SLCA 1YWKA 5J36A 1LOGA 4HN0A 2JEMA 3SCHA 3ALQA 1WCDJ 1R083 5I0UA 1RHI2 1TME1 4PQ9A 2D3RA 3WUDA 1GFF2 4K40A 5F1RA 4AVVA 1OPOA 5HCFA 4LUMA 2UYAA 3I7DA 1LHOA 3M3IA 4LTAA 4Y22B 1AUYA 2GZWA 2XBO2 4EJRA 2HEWF 4L97A 3BB6A 4BCUA 2IC1A 2RS13 5D8AB 2YROA 1ZA4A 1BYHA 2AZ5A 1RINA 2VY0A 2WLPA 4Q27A 2HJIA 1QH7A 1ND2B 4R8HA 5GZEA 5GZFA 2PFWA 2CNAA 5FMOL 4LBLA 3D4KA 3OGGA 3RYPA 1BVP1 1BBT1 4KG0A 2PAKA 1PVC3 2E7AA 1V9U2 2C9AA 3QH6A 5GLWA 3WDVA 5C8CC 1J3PA 5F5QA 3MYXA 1ZRDA 4Z07A 3B94A 1CAUB 4K20A 1S1AA 1AYN3 4LUKA 1XE8A 3VZKA 2VW0A 3NO8A 4YM1A 2WWSA 1VAMA 4CDUA 1ULFA 1QKQA 2PHWA 3R4DB 5KXCA 5GLVA 2ARBA 1LKNA 2BPA2 4DRRA 5JIUA 1PNGA 3B02A 2B5HA 3RDIA 3AP4A 2RR13 1AL23 4NO4A 1AR83 5K8SA 3JD71 2YV8A 3VBSB 2BFUL 2E63A 3LA7A 1HX6A 2OYZA 1KFXL 1EP0A 1W6OA 3SLIA 1YFUA 3ME2A 4P9YA 4CRQA 1CPNA 5K0UA 4XW3A 2R072 2YDEA 2XG3A 2EAAA 4BLJA 1V6MA 3OY8A 4QPIB 5J7MA 5BNOC 3PJQA 2D7FA 4HL0A 3FZ3A 4HKLA 2YGMA 1ASJ3 4OZXA 4Q4X3 2WC2A 2R061 1JHNA 3CF6E 2NZ9A 4CDXB 4RS5A 2HWC2 4I2OA 1C28A 1Z7S2 3ENRA 4GMP3 4Z1VA 1D4M3 2VVDA 4I09A 2WFF2 2ZGQA 4PLOA 5CNAA 1W0OA 1H1AA 1NY72 5KWRA 1MS5A 5FO7B 1GYKA 1UKRA 3J9SA 1C1FA 3L9JT 1KJLA 5GLUA 4CEWA 1H2KA 1QOOA 4QT6A 2JG9A 1ZBE2 1FPN3 2BTVC 4IEPA 1O91A 3S0MA 5H9PA 4QPGC 2WNUC 4PIYA 1YO8A 3SXWA 4WM7C 2ZGLA 5JCTA 5T50A 3ELNA 2UY8A 2LM3A 3POSA 4Q1PA 3PVNA 1RUJ2 1BKZA 3ETQA 1KFUL 3S7EA 2ZCWA 1MS3A 2ZGNA 1OA4A 1HXS2 2VH9A 1SEFA 3NVCA 4N43C 4QQOA 2KM2A 2WZR2 4RHV1 4GMP0 5JZGB 3BTAA 1IS4A 5BXXA 4CTEA 3NW4A 2ZX1A 3ZYJB 1PGW1 5KHIA 3Q9OA 3WQ0A 2VMIA 3ZFFA 3USUA 4YARA 2A3YA 1Q8QA 2XUMA 4Q4W2 1URXA 1AR61 2DURA 4BOWA 3ZPYA 1QMJA 1UL9A 4AEDB 1LHNA 1W2UA 4AVCA 1XE7A 5FPZA 3VKFC 4MLOA 3AMMA 3RWNA 4CZSA 3P3PA 4XF1A 1CPMA 4KG8A 5CFDC 1ULCA 3TAYA 3IKWA 3LA3A 4MX3A 5L36A 3WV6A 5BY5A 3BOWA 2GNDA 3KS7A 1PMIA 4WVVA 1RC6A 4P14A 1BVVA 3ZFGA 1PO13 1VRH3 4LLFA 1RUG3 1H8VA 4H14A 3JQWA 4X6QB 2PHDA 1V6IA 3WG3A 3HMYA 1TNRA 3KGLA 4W65A 4HSJA 2DUQA 1FYUA 3HAGA 2Q1MA 4PIXA 5FOBB 1AR73 1LOCA 3GBGA 3IPVB 1BMV2 3FLPA 3WP4A 1DF0A 1S0FA 3AYEA 4MGZE 4OUSA 1PGL2 5KXEA 2GC1A 1QGLA 4Q0SA 2PAMA 5H9RA 1Q3EA 1ZNPA 2WZPP 1U5IA 2MEV3 5C33A 2QCSB 1G86A 4K3UA 4GALA 3W58A 3KD4A 1JN2P 1BCXA 4RA0A 1O5LA 4FPEA 2WSUA 1VAVA 4U2AA 4YG0A 2X53S 5CADA 1YFWA 1WLCA 5FOJB 3U4XA 1A3KA 2ZMLA 3NL1A 2E51A 4PDWA 3CJXA 4LBJA 1PK6B 2VOKA 3ZO0B 1EAH1 3DUIA 4LE3A 4RSUA 2ARXA 3KQRA 1ULGA 2OPKA 1QJX3 1VBA2 2PLV2 4E4DX 4SLIA 2O8QA 1NA1C 4WBBA 4FP3A 1A78A 1MQTB 2RE9A 4AFCA 3FX3A 3X29B 2G9FA 4DMIA 1OI6A 3OBRA 3WW1A 4Q4V2 4K6BA 2A6ZA 1JUHA 1ENXA 2TBVA 4A2UA 4DOUA 3KCXA 1CD3G 3FLRA 2C5DA 5D1IA 2R0FA 3BALA 2VU9A 3VZOA 4Z82A 1FT9A 1GZWB 1V00A 1VBB3 1COV2 4L92A 1UF2C 1NCRC 1AZDA 4ASMB 2ZX4A 3KT7A 4YLZA 3ATGA 4JGYC 1WW4A 4YVWC 4WM8A 3VGIA 3AP6A 1DQ0A 2VUJA 4AHWA 2ZACA 1LHVA 1WMFA 4PJYA 1H30A 1QU0A 3ZFEB 1CJPA 1ZZCA 2A71A 2WSVA 1AXYA 1AJKA 4COYA 2VOWA 4XFBA 5EYXA 3HR9A 1IS3A 1SLBA 3ZSLA 3VBUA 4LE4A 2ET1A 4X8PA 2H6CA 1AXKA 1LR5A 4DY5A 4HKWA 1Y3TA 3ZX7A 4YVSA 1W6PA 4E4SA 5ABJB 2ZBJA 4MXWA 2YZ4A 5J96B 2O1QA 5BNPA 2SLIA 5J48A 1H2MA 4B4PA 4E2GA 1UCXA 5CFCB 3VBSA 3N7MA 5BNQA 1SLAA 1VBC2 1BBT3 1ULDA 1KITA 4WVWA 1TQ5A 3LB9A 4AFAA 2E6VA 4ZU5A 5BUVA 2PELA 3ZN6B 1RUE2 3L2YA 3GF6A 1A8MA 1UMZA 4OUMA 4FPYA 3W9AA 4M00A 1IPJA 4GH4C 4Q29A 1YRZA 3AYAA 1KDMA 1RMU2 4AK3A 3ZYPA 2FMDA 4Q4Y1 5CA6A 4A7ZA 2XJQA 5AC93 1AR93 3IN9A 4CDXA 3NV4A 3AKQA 5JOZA 1DYKA 1RUH2 4EN6B 4Y1XA 1BEV2 2CGOA 3AKRA 5L73A 1ONAA 2AREA 4Q0UA 1KD7A 2EA7A 2ZX2A 3O0XA 2SBAA 3VBOC 1K5MB 1FX5A 4IV1A 1YUDA 1DIWA 4K1YA 2XVGA 2FQPA 4XJZA 2RR11 3E5XA 1X7NA 4N53C 4RGGA 2QZ2A 2R063 1SCSA 5JOYA 4P5HA 2IXIA 4NHLA 4AI3A 1QJU2 1Z0HA 2I74A 2WA3A 4YM0A 3ZXGA 3V65A 3K51A 3VKLA 3SH5A 1AHSA 1GLHA 3TN91 1AYM2 4XJWA 2DUPA 5GZDA 3VBHA 1LOBA 1ASJ1 3OPZA 3MZHA 4EWDA 4XTMA 2QVSB 1QWRA 2RMU1 3RMYA 2HWD3 1FOD3 2RM22 4RR3A 5DG1A 1NCQA 4MUVA 2VULA 3M2MA 2Y38A 1G9DA 1C5HA 5EV7A 5L7OC 1W6OB 2ZGTA 2HKXA 4ZKTB 3MICA 5K0UB 4CDWA 3OY8B 5JOXA 1R1A2 3AFGA 3KT1A 1MEC2 2DVFA 1UU6A 2P37A 1DHKB 4XMIA 4B8EA 2WFPA 3HIFA 4CP2A 1VBE2 2LTNA 3QCWA 4K1ZA 1HW5A 1BZWA 4RHV3 1CVNA 5C4WA 4AWDA 2XJTA 2TEPA 3D82A 1FPN1 2X5IC 1MS0A 4B4QA 5KC5A 3LOBA 3TYJA 1D0HA 4XFHA 1AR63 3RRDA 4AVSA 5LRSA 1ND2C 4RS5B 3WCSA 4BIFA 1LECA 2PA7A 3WQ7A 4B29A 2R16A 4LHNA 3ZN4A 3O7OA 3FJSA 4AQTA 3EQEA 4RQPC 5A3LA 1H8TC 3SCGA 4RD7A 2LUWA 4TSVA 4UW4A 1KXGA 2ZTNA 3GYDA 4LBMA 4DRVA 5GZGA 4CEWB 4B7EA 1R092 4MXVA 1TME2 1X50A 4JTNA 4Y1YA 2F4PA 3E5QA 1PIV1 2WT2A 4YW3A 4DS0A 1M06G 3AKPA 4HK9A 4Q26A 5J09A 4OHXA 3SNMA 3OD4A 1GANA 1FAYA 3M3EA 1PO22 1X82A 4ZXKA 1LEMA 4COWA 1IHMA 3UKVA 4FPKA 1EV11 3LAGA 3E97A 2EXIA 3KSCA 3CL1A 4GQ7A 2DFBA 2R32A 4MV2A 2XL9A 4QGNA 5JPNB 2HWB1 1RUC2 1U5XA 3ZFFB 3DN7A 3USUB 1I5ZA 2EIGA 2I45A 3GALA 1XNCA 1GNHA 2JD4A 1GNZA 3MGUA 1LOFA 3NV1A 3M1HA 3A0NA 5E89A 2ZMNA 1O4ZA 4FAGA 4GKXA 4FPJA 4LBQB 3KT4A 5C8CA 1MQTA 5I0TA 2XWJB 4YZ3A 1KDKA 2A6XA 1AR71 2GNMA 3G6JB 1LESA 4DZGA 4GB31 2IXKA 3NV2A 3JD72 3B3QE 5ACA2 2V5YA 1FMD3 1VBD1 3ILNA 3MF6A 4P9IA 3K48A 1VP6A 1DGWA 1OQDA 2NM1A 4Q8LA 4LBOA 5KHJA 1GZWA 3ZFGB 3R4UA 3DPRA 1S0EA 3H8UA 2DYCA 3PVBB 2CAUA 1UZZA 1KJRA 3LGRA 2F6BA 4R9AA 1UIJA 3H1WA 4UXAA 2IXJA 3WD5A 3ZFEA 5F9TA 1SBEA 4KWLA 1WMEA 2BNNA 1G7YA 3HQXA 2ZGOA 2HWF1 4KL1A 1E57A 5EXOA 4AHYA 3ZMOA 5HCBA 4AGVA 1DQ4A 1IPKA 1RUD3 5FRAA 3USSA 1ZYBA 2JECA 2K9ZA 4JV4A 1PZ7A 5A33A 4XJ8A 3WG1A 4IEOA 5DDJ1 4EWEA 3QOPA 3HN1A 4FPOB 5CIRA 3IDCB 2X29A 4L9BA 4HANA 4PDWB 2BQPA 4JGZC 2IFRA 2G9GA 1BQPA 1QDOA 2GMEA 4XFIA 4JAAA 3VL8A 3T1MA 2WNUA 3BOPA 2BWCA 1FI2A 3PNAA 4FOWA 4COZA 2VUAA 2XJPA 1UAIA 1PZ8A 4PBPA 1ND3B 4YYOA 3RG0A 5JOWA 3VV1A 4FPGA 4X6RB 3WINE 3EXUA 2Q4SA 1CAWA 4P9XA 1YYNA 1PGW2 1RUI2 3AYDA 4MVTA 5I91A 3JBG2 4ZU4A 5KHHA 2XVLA 4IEQA 5JSRA 1EPZA 5CG9A 2BYVE 2XLAA 1U0AA 1QF3A 1K5MA 1WMDA 4LA3A 3ZSEA 4C0BA 2MNGA 4QD2A 3WDWA 3FLTA 2QE3A 2RJLA 2DVDA 4Q4Y3 4A7KA 4W6XA 3E6DA 4NWVA 4WM8B 2D6MA 4XFFA 4YGCA 2D3PA 5CFDA 5BNNB 1RUF3 2JG8C 3LSEA 2XJRA 1Q43A 4E2QA 2XJUA 2EF6A 4IQPA 3UJOA 4MYEA 3VBUB 1D0GA 5F6LB 1LODA 3ZXJA 3MIFA 4OHZA 5GKAC 1GR3A 1NQDA 3HD8B 1H1IA 1QJY1 4YVSB 4TWTA 2VNGA 1W6PB 4R9CA 4M3CF 1XXNA 2ZGKA 3AZXA 3VDDA 4MXWB 3CNAA 3WR0A 3DKWA 3H7JA 5BNPB 5GZCA 2LALA 2ZKLA 3I54A 3GBFA 4K8FA 5DUVA 5AC91 4LT5A 1AR91 3FUQA 2ZGRA 5LK5A 2OA2A 4GIQA 1HRI1 3MLLA 1WGPA 4DQAA 2R49A 1CX4A 3H1YA 4PCRA 4DY3A 2ES3A 4JRLA 1PVXA 3IM0A 4XFAA 1RTVA 5CVRA 3FC0A 3B5LB 4IETA 1C8M2 3TN93 1G9AA 4QQPA 1IKPA 4FSJA 4BM8A 3MFCA 4BYYA 3AP5A 5GM0A 1IZ3A 1WA4A 4XFGA 3AP7A 1NXD1 2RMU3 3PMEA 5F6KA 1MZEA 4JDNA 5KC6A 4EN9B 2PHRA 4P9JA 4O9EA 5JI7A 1LU1A 1TMF1 1DZRA 4I0AA 3WW2A 2RS33 4YRDA 3AZYA 4IESA 1MS9A 3IBMA 2W39A 2R6QA 3AB0A 3KZ4C 2JXAA 1EAH2 3ZSMA 5DZEA 1MS1A 2A70A 3DF0A 3D0JA 5AFEA 3N35A 4QGLA 1EY2A 1AF9A 1W6QA 1YNAA 2Q0AA 4AE2A 2YGLA 2IXHA 4XF9A 2R043 4IV1B 2RHPA 1N1SA 2HWD1 3ZYGA 1FOD1 2A5ZA 1ZZ9A 2ILMA 1OFNA 4OI2A 2ZOEB 2WS93 3THPA 5ABJC 1OLRA 4WZFA 4QM8A 1MS8A 1MZ6A 3LA2A 5GJ6A 2VQ0A 2JE7A 2BVVA 1AX1A 2ZMKA 4BMEA 1YJKA 2GN3A 1OA3A 3WP3A 5E88A 1W6NA 4XQDA 2ZX0A 2D97A 3ILRA 2BNOA 1UD1A 1RVF3 1FATA 3VBHB 4CEYA 1HQNA 1QH6A 2WA4A 2WNVC 5B2GB 1MZFA 1NCRA 1JXNA 2RS51 1SBFA 1AX0A 1Q56A 4JGYA 4RR3B 5AVAA 5CBLA 1NCQB 1PIV3 4YVWA 3C2UA 3NAPB 1NQJA 5BPXA 3V64A 1VB4A 3L2HA 3FUOA 4HZFA 4HPKA 1WD4A 4CDWB 3FE5A 4LBQA 3T2TA 3MW3A 5A32A 1ALYA 4D94A 3GZAA 1EV13 2XL7A 2GC2A 2HWE3 2V73A 3J26N 3M3OA 5E8AA 1QQP3 4NHKA 5HI0A 1R082 1CGPA 5C4WB 4AHXA 1GZ9A 2AGSA 2HWB3 2VNRA 3M8LA 5JLVA 1OOPC 3LZZA 3WCRA 1Z78A 1GV9A 2MPFA 4XTPA 4F8AA 1CONA 2VG9A 3B9IA 2XB6C 2NP0A 1WUVA 4HKOA 3H50A 1MZ5A 5JDBA 2RS12 3QACA 4J1XA 4EN8B 5JSPA 1AVBA 3ZDSA 3PHMA 2I2SA 4AW7A 5HCAA 1OMIA 1IOAA 3ACLA 4LA2A 2PQQA 4CDQC 2XPJA 1H4HA 4FT8A 4GB33 3KB5A 4IEUA 3UK9A 4CDUC 1C57A 1PVC2 1VBD3 4ASLA 5DG2A 2BW8A 3BIWE 4AF9A 1DU3D 3AKSA 2P3JA 2D93A 3JUUA 1AYN2 1XNBA 4V1PA 3AZZA 2OIIA 4XHBA 1S0GA 4D7SA 2AUYA 3EO6A 3VBFC 3WXPA 2QKDA 5K0UC 4OI1A 4PLNA 1YIPA 3VBOA 2RR12 2Z5WA 1AL22 1B35A 1SACA 1LHWA 2A6VA 1AR82 2A7AA 2R071 1HKDA 3POWA 4JCKA 4E9KA 2JKBA 1RUNA 4TZDA 1FMD1 2WKKA 2HWF3 3ES4A 1XRUA 1REFA 2EAKA 3WVJA 3VBRC 4MZUA 3M4FA 1S0DA 5T55A 2VXRA 4O9GA 1BJQA 1ZRRA 4Q1RA 4IL7A 1ND3A 1Q5OA 3MIDA 2NMOA 5C8CB 3ST7A 4QMAA 5DDJ3 4AI0A 1ASJ2 2A3WA 4XMAA 3AZVA 4C1WA 1LRHA 4N9HA 4XQ4A 3ZXFA 4OULA 4Q4X2 2HWC1 1Z7S1 2IFWA 2ZJCA 1I9RA 3ZXLA 1X36A 2VMGA 4YG3A 2R0HA 2R30A 2WFF1 3GHNA 4WV8A 1TNFA 1UIKA 2W52A 3SITA 2JG9C 1DGRA 1D4M2 1CESA 1IGOA 3WDXA 5L7OA 1RUD1 3M7AA 3DPRB 3AMHA 1NZCA 2FZ2A 2E7QA 4AEJA 4BE3A 1CAXA 1DQ2A 1V6NA 2WINB 4LBNA 1ZBE1 2QQPA 2K0GA 3NV3A 4LO8A 3U10A 4FPFA 1LTEA 1CAVA 1T6GC 1VB2A 5BNOB 5DZGA 4XIKA 2D6LX 4FQ4A 5C9AC 3WQ1A 1FPN2 3VHPA 5BNNA 1GQGA 3H1MA 4M3CE 3O0WA 5FLIA 1N1YA 1RUJ1 4LULA 4Y20A 4W6YA 1HXS1 4XXPA 5K9YA 2WZR1 2NLRA 3KCYA 5T52A 5A33B 1G8WA 4KH9A 1NE4A 4A7YA 1REDA 2BBVA 1F5JA 4Q4W1 1XU1A 1J58A 3ZXEA 5FLJA 4R9DA 1TE1B 2YC0A 5AVPA 2GU9A 4XBNA 1VJ2A 5FTTC 3EBRA 2UYBA 2E53A 2Z79A 1Y9QA 4IV3C 2A73B 4XIOA 4QPGB 2WNUB 3NSTA 4N9IA 3RQ0A 4WM7B 4AGGA 5IK7A 1QJY3 5FFOC 4JVAA 2ET7A 2DCZA 4JRAA 2CV6A 1SDWA 3N36A 4AI8A 1ZBA3 4GWMA 1CAWB 1DGLA 4N43B 4Y26A 1RUF1 4XXAA 3LKJA 1HRI3 5IUQA 3VKNA 4AI1A 1AXZA 4ISQA 1PO12 1F9KA 2PHUA 4XBQA 4CYDA 1VRH2 3VHOA 1RUG2 4DFSA 1DZTA 2EALA 5LEKA 1ZVFA 1HRV3 5FAXA 4QX5A 2YY1A 3SISA 1YI7A 5C8WA 2WNEA 2JDZA 3M3CA 3AM2A 3TNQA 2VVEA 1LGCA 2ZHLA 1AR72 4DB5A 1PGL1 1TMF3 4N90A 3S30A 3DL3A 4BMBA 5CFDB 1O3SA 4AXOA 5FO8B 1SLLA 2GC3A 2Z69A 2WIIB 2CYFA 2WL1A 4HFSA 3P3NA 2GNTA 2K2SA 4Q2FA 2EXHA 4FQZA 5BYNA 3LCPA 4QXKA 1ENRA 1XYOA 1SFNA 2JENA 2MEV2 1RJ8A 4DINB 3CJIC 4BIOA 1X8EA 4YW1A 1Q8VA 1DG6A 1FNZA 1MACA 3FBYA 4K7JA 4NOTA 2CGNA 4XF4A 3R0RA 4YSFA 3VDDB 3ECQA 4FOQA 5I0SA 4L8QA 3NAPA 4B7KA 4BH9A 1OPMA 1UPSA 2RS31 2BWAA 2DCKA 4I3PA 4BWOA 2ZZQA 5HXVA 3QLQA 2GMPA 3WNXA 5FREA 2ETEA 2YYOA 2VQAA 2AYHA 2B46X 5FCCA 3B7MA 5JR7B 1QJX2 4H7LA 2BEOA 1POV3 3JZVA 1C5IA 2R041 4LHKA 2OUHA 3FHIB 2RS53 4YFWA 3U07A 5D8AC 4NHMA 3OCPA 2ATFA 3AFKA 4AGRA 2WS91 4M0NA 3FFQA 2ZABA 3I4IA 4Z92B 1LB2A 3DGTA 2BNMA 2ZZJA 2D43A 2QNKA 3H0OA 3M3QA 1QXPA 1RJ7A 1DGRN 3S6PA 1HQLA 4ITCA 1C1LA 4JGZA 1VBB2 1HIXA 1QOTA 4E27A 1W6QB 1RVF1 4WVMA 1RHI3 4ES8A 3PJYA 1SMVA 2DF7A 1U5ZA 1SLIA 5GLTA 3RS6A 3SH4A 1NA1B 4RL7A 4YVSC 2XBO3 1DQ1A 2EVXA 2UU8A 3ZSKA 1QXRA 2XKOA 1LCLA 1JUIA 3WX5A 2VOXA 1HV1A 5H9SA 1J1LA 1LENA 3VBSC 1UW8A 2NN8A 1W6NB 4GKYA 1OSGA 3DV8A 3WDUA 2HWE1 1QQP1 2VMHA 4CEYB 4AQSA 4QPIC 4GULA 3T1LA 4PIZA 5C6CA 1NCRB 1GZCA 1V9U3 3ES1A 4RFT0 4FTEA 4B4RA 4G9SB 3MIEA 2DCYA 3AZWA 3GNEA 4JGYB 4CP1A 1W6MA 1RUE1 2DUOA 4YVWB 1BBT2 3MDPA 1WBFA 4H55A 4HPKB 2JG8A 2Z42A 3B9CA 4PBOA 1N47A 3I59A 4CDXC 5A32B 2VOVA 1I1EA 4AHZA 4ZU7A 3O12A 3WLUA 1W0PA 4UW3A 1MVEA 4YM2A 3RSJA 1V70A 4FPCA 4X8NA 1RUH1 2R073 5FQ0A 4P9WA 1JYCA 5LK7B 3WHUA 1BEV1 4BLIA 1AR92 2XVKA 5AC92 3JB4C 3R05A 2UWAA 2WT0A 4IEZA 1WBLA 2ZHMA 4OI0A 5JWPA 4G4FA 2UURA 3ZXKA 2H0BA 1ZRCA 2O8OA 2B45X 1O7FA 1J3QA 3GHMA 5BNOA 1HV0A 3URFA 2VECA 3FFZA 4HVQA 2HWC3 1QJU1 2Z2SB 1Z7S3 4LBQD 3QD6A 2R062 3WG2A 1G9FA 3VBHC 1OFSA 2WFF3 3AYCA 2E7TA 1S55A 2XJVA 4NR1A 3IWZA 1D2SA 1V6OA 2P17A 5JZGC 4YZ2A 5T3NA 4AEKA 4FTSA 1GQHA 2D5FA 1CR7A 3I2DA 1DZQA 2C1FA 4YGBA 1H9WA 1O3TA 1ZZ8A 1ZBE3 2O0OA 4Y5Z0 2RM21 1KS4A 4AEDC 2BFUS 1OLQA 4E2SA 4EV0A 4CDWC 2P34A 3ZXDA 4YM3A 5JMCA 2HWD2 2QDRA 4Z8BA 1FOD2 4KBBA 3HT2A 1SCRA 4XFCA 3MIHA 2PHFA 3VBOB 2NQYA 1B35B 1AX2A 3MF9A 2GSYA 1N1TA 3R4SA 3C3VA 2NMNA 1RUJ3 1G6NA 4D3WA 4F3JA 3WUCA 3ZYRA 2PAEA 1R1A1 2QUOA 4N53B 1HDKA 1MEC1 1WW7A 4QPGA 5JPMB 2VVFA 1HXS3 3OGJA 4WM7A 1VBE1 3TWIA 5KXDA 2B8MA 2WZR3 2X8KA 4KU7A 2BUKA 5GALA 2CY6A 3B93A 4GA9A 4J1WA 1O5UA 5HBAA 4RHV2 1G9CA 4Q4W3 1V6LA 4HK8A 2B9UA 5J98B 2DU1A 4Y4YA 2WJSA 2NYYA 5T5LA 4N43A 4Y1ZA 3V0AA 2WNVA 2ERFA 4YZ4A 4JC1A 4FPHA 3TRSB 5EYYA 4Y1VA 1FV3A 1AR62 4AVTA 4EROA 3ZXAC 1WW6A 3D6EA 4L11A 5L19A 1ZZBA 3SCFA 5L7OB 3ZIXA 2DTYA 2GH2A 3H3UA 2C0ZA 3APBA 5JAXA 1CAXB 1R091 4HVRA 2PHXA 4GXLA 1SBDA 4BZ4A 1YHFA 4LBKA 3HWJA 1CAVB 2IXCA 3J8F1 2OW4A 4TLFA 4AI2A 4AYUA 3ILFA 1PGSA 2D3SA 1H2LA 1CIWA 3WP5A 5TSWA 1PO21 4HMZA 3MPPG 3NKTA 2PN5A 4UW5A 4FCAA 3MI8A 2X5IB 3H7YA 4MH0E 1LOAA 1OOPA 1Y7BA 1EPWA 5CB7A 4Y20B 1QOSA 3S7IA 3AJZA 4FXGB 1PK6C 4HT1T 2ZA9A 3M70A 5A3MA 4R4XA 1HQWA 2W0XA 4XF0A 5LEJA 1RUC1 3D5OA 1LOFC 4OHYA 1ZBA1 4LLOA 4RQPB 3AXDA 3MEPA 3IDEA 1H8TB 3KM5A 2QZ3A 4QU2A 3OBTA 1MQTC 1J1TA 3V0BA 5FDBA 4CDQA 3ZVXA 4J6GA 4DXZA 3PVEA 2ZKNA 3OJBA 1UU4A 4AQ2A 2B7YA 2GALA 1HRV1 1R1ZA 1IQAA 2UWCA 2WLQA 2W08A 4DPNA 2KA3A 3VL9A 2FBEA 1WCKA 5ACA1 1OQ1A 3ASIA 2ZGPA 3DPRC 2OZJA 1MR5A 3KGZA 3NJZA 5EFUA 3VBFA 4D7TA 1O3QA 3JQXA 1BK1A 4FPLA 4EWAA 1LHUA 3N7JA 2B39A 1FMD2 2PLV3 1VBA3 3BODA 4N7IA 4FBFA 3HBZA 3ZFEC 2VPVA 5EZWA 3RZZA 3WW3A 5J3UA 3LWCA 4KWJA 4MGYE 3VBRA 4M3CA 4Q4V