1YJKA

Reduced peptidylglycine alpha-hydroxylating monooxygenase (phm) in a new crystal form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
306
structure length
303
Chain Sequence
TIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title The Catalytic Copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also Plays a Critical Structural Role.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 65
structure length 303
sequence length 306
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yjkA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yjkA01
3PMSA 3MIGA 3MLLA 1OPMA 3MIHA 3MIDA 3MLJA 1PNFA 1PHMA 3MIFA 3MLKA 1YJKA 1PGSA 1SDWA 4E4ZA 3MICA 3PHMA 1YI9A 4R4XA 1YIPA 4R4ZA 1PNGA 3KS7A 4QHBA 3MIEA 3MIBA 1YJLA
chains in the Genus database with same CATH superfamily
3VBSB 5BNQA 2RS13 1SFYA 2HWB3 4Y1XA 3ZXAC 1O3TA 3OEAA 1COV2 3DUIA 2AUYA 2VMIA 4HN0A 3E5XA 1H9PA 1DLLA 5HPOA 1W6PA 1QHDA 5D8AA 1CJDA 1HJFA 1UX7A 1Y3TA 2JDMA 3WLUA 2XGXA 5I0RA 2B46X 3B7MA 4AVCA 2XKOA 4BXSV 4AAXA 2VNVA 1C8NA 5GZDA 1O3RA 5FO7B 1A3KA 1H8TC 3H7YA 1VBB2 4ARXA 5KHIA 4MG2A 4IETA 2VVFA 1XQNA 5LW9A 4HSLA 2UWBA 2UWAA 3GJBA 4OHWA 1NG0A 1DLCA 3DXTA 3VD7A 1ZBA3 2ZEYA 5J98B 1YFWA 1DYOA 5ACA1 1L7QA 2NYYA 4TYSA 3U4SA 1AR71 2HWE1 3O1SA 2BPA2 1W2TA 1ENXA 1GYKA 1LU2A 4CEWC 5CG8A 1UN1A 2WNVC 2JECA 4FP2A 3POIA 2BV4A 1O3QA 1OBNA 4XIOA 5GLVA 2WAOA 3V0AB 2WZEA 3WCSA 3SNMA 2R073 2D97A 2YPDA 3LSEA 5DDJ3 4Y20B 4XFCA 4E8CA 3T0AA 4LEJA 2FZ1A 4XBQA 1MEC2 4XEZA 3AKSA 5FPVA 4QKFA 3SH4A 1C57A 2XJVA 5FMOS 3AZYA 3GF6A 4XE9A 2OVUA 1QU0A 1JUHA 1OA3A 2ZGOA 5CU1A 2NP0A 5FP4A 3SCFA 3DPRC 2G19A 3T08A 3HD8B 3LF7A 4QMAA 3O0VA 3BALA 1OH3A 1PVC1 2RDNA 2HYXA 1QGLA 3HQRA 2EIEA 2G9FA 2JX9A 3ELNA 2XONA 4Q4W1 4Y1VA 4L9BA 3WQ1A 4BPZA 4DRVA 3R4UA 1RUC1 2FCVA 1NE4A 2R042 1D2SA 4RFRB 4RHV2 1UIJA 3UV9A 3MUY1 1CAVB 2B4KA 4R8HA 3THDA 3LD8A 4HFSA 5FPAA 1PM4A 2Q1ZB 1NX9A 3ZMOA 2WIIB 3S5QA 1JXNA 5FZ1A 4N9IA 5CZKA 3IMNA 5IVFA 1TVGA 5AVAA 1PO12 4B4PA 2ZGUA 4Y24A 2VZ3A 5CFCA 1PK6B 1YQ8A 3OPTA 2YBSA 4H7LA 2A3WA 2RDRA 1UY0A 3WG2A 2PHUA 2RS33 1BHGA 3ABZA 4IV1A 1AXYA 2D98A 3ZN4A 5L7OB 3VDBA 3ZFGC 2W1WA 2GALA 3KLSA 4MZUA 2QQUA 5SV8A 4HANA 4Q8LA 2D6KA 1SBEA 3USUB 1CONA 1VIWB 3RS6A 3UESA 3GHMA 5T52A 1MZ6A 2DDUA 1RUE3 3PNAA 5I8SA 2BNNA 1KS5A 4XURA 4OYUA 3POEA 1RUG2 2ZJCA 4P9XA 3LGRA 1YI9A 1F5JA 4WVWA 3J26N 4PI2A 4XFHA 3F2ZA 2YUEA 3OCPA 5BPXA 3WY6A 5JPMB 3T30A 2IWGB 5FPUA 5KXEA 2HWF1 4S2HA 3JBG2 5JIUA 1LAJA 2CDPA 3VKFC 1US3A 1ND3A 4LHSA 4XXAA 5ABJA 1EV12 4QQ2A 5FO9B 4NPMA 2HKXA 4XF3A 2BGOA 1PZ8A 2RM21 5FZBA 1IKPA 2DTWA 4GKYA 4QPIC 1F35A 1U5YA 2OQ7A 3Q9OA 4IGOA 2BVBA 3S30A 4V1PA 4FXKB 4Q4X3 4AQSA 5I0SA 1SLBA 4YVWC 1ND2C 3TEYA 1VBA2 2A6YA 4LHLA 3FLPA 4P9WA 1RJ7A 2DUPA 2QQJA 3KMHA 4Q4Y1 4XMIA 3KSCA 2RS11 2GC2A 1HX6A 1T6GC 4K1ZA 4MH0E 3ZXLA 5L9RA 4BMEA 5J36A 1VJ2A 3ZYBA 2IXKA 2WINB 3OBTA 4G4FA 5FWJA 2E53A 1UMHA 5FMOL 4AI1A 2WAAA 2YV8A 4FFFA 4FOWA 2WR9A 3A0KA 1YJLA 2BGPA 3IDBB 1O4TA 3KB5A 5LY1A 2Q4SA 3WDTA 3HQXA 2W52A 3PVOA 5FZAA 5A3MA 4NPRA 4CCOA 1OT5A 2GH2A 5FXXA 4L99A 1HXS2 1MQTA 5CA6A 2O14A 1RXFA 1X33A 3ZN6A 5JOZA 5F5QA 3AYEA 4YGCA 3VBHA 3MV11 5JXIA 3KT1A 3Q8CA 4CXXA 4ZU7A 3OD0A 2XDVA 5KHHA 1OVSA 1XU1A 2ZGQA 1FPN3 1RUF2 5EXOA 3WZ1A 1UOJA 3CZJA 3MW3A 4Q26A 4ZONA 5JR7B 1GQHA 2EAAA 5IVJA 3CDZB 1EP0A 3JD73 4XZPA 1QF3A 4QKDA 4CVUA 2OUHA 5DAQA 4YSFA 1H4HA 1S0BA 2V09A 3I3BA 2P4EA 3ZSLA 1WBFA 3ZXGA 4EE2A 1QMJA 3BTZA 3PUQA 4O61A 4UFIA 1TZOA 1LHWA 1ZVFA 1XNCA 4PDWB 5CAZA 4BDVB 3ALQA 2HWD1 2VU9A 3GNEA 1KJLA 1QXJA 3JZVA 4ATEA 2GU9A 3KWVA 3RDIA 1YQCA 1RUI1 1VBD2 4JQRA 4EWEA 3Q8EA 3SKJE 2VOXA 4YZ3A 3I59A 5F5IA 5JIAA 1OI6A 2DBIA 3EBRA 4FVVA 2Y6FA 2AZ5A 3LFMA 4AI3A 3ITQA 4ISRA 2Z79A 4GWMA 2MEV1 2QQPA 4AFBA 4QWNA 3MFAA 1X36A 4K21A 4Z8BA 3RZHA 5K9YA 4NUBA 4GKXA 1C5HA 1H2NA 2VZTA 4LOSA 4XJUA 3PMEA 4L11A 2RS53 4OHZA 2R0HA 4W4ZA 4XJZA 3WG4A 1W8FA 2WO1A 4HG6B 2TNFA 3AP6A 1EAH1 4LHKA 4XUOA 4CDUB 4EYUA 3TEWA 1BYHA 2W5FA 3LQCA 4NIHA 4XCAA 3WQBA 1LU1A 5JXHA 5IAVA 4AVBA 4XILA 4YM1A 1ODNA 1RUJ3 4AHYA 2X5IA 3IDAA 1S0EA 4DUXA 5JLVA 5B4NA 4UXAA 1D4M3 1DYKA 2YZ4A 4GD4A 1RMU2 2GZWA 2Q8OA 1QJY3 1OLQA 1UXXX 1AR83 4L8QA 1B35B 2HYKA 5L7OC 2OIIA 3DCQA 3FHAA 1BJQA 2Z42A 3SXWA 1C4RA 5DZGA 4CCLA 5C9AA 3VBFA 5CEHA 4JGZB 1STMA 2DWRA 2J1UA 4P9YA 5FQ0A 1YCIA 2ZHNA 4AVAA 1UD1A 5KC6A 2PQSA 1AF9A 2D5HA 3OB8A 1J3PA 2JG9B 4K8RB 3IT8A 5KWRA 4FOVA 3ZPOA 2WA4A 5A33A 4TZDA 4AK3A 4YW7A 4CCNA 2VCBA 2JIGA 4ZPIA 1XU2A 5FYUA 1NOVA 1SQ4A 1ZZCA 5IK7A 5FV3A 1GNYA 2C1FA 1GBGA 1HQWA 3N9QA 2RR11 4SBVA 5FYMA 1J58A 3B3QE 3NJVA 5IHRA 4HSJA 3VZLA 1OMIA 5I91A 3SCGA 3HJRA 4FO9A 5CKMA 5JUVA 1O3SA 3O0XA 1D4VB 2DFCA 2PXJA 3HNYM 1YLLA 4CUCA 4RQPB 2ZA9A 3LIGA 4JKLA 3UJOA 5FY5A 3D0SA 2OYZA 5J96B 1JYNA 3P1IA 1BK0A 1VP6A 3MZHA 4NPLA 4UWDA 2W46A 4E4DX 3BTAA 5FK8A 2GP5A 2D7FA 5CIRA 1AJKA 4F83A 1APNA 1X82A 4LLOA 2XUMA 1AYM1 2BQPA 1COV3 2Z5WA 3AMNA 1Q8OA 4WM7C 4GB31 2JDAA 1GANA 5ANNA 1W6NB 5IAXA 1F31A 4YW2A 5FZOB 4LBQD 1OFSA 5I8TA 1D2QA 3VD4A 2WFF1 3C3VA 5I0TA 4AGRA 2NPIA 3FLRA 3POBA 1VBB3 1S4CA 2DUOA 3K4ZA 1W9YA 2R0FA 1KDMA 3G6JB 3I2HA 4DFSA 4HXCA 4IV1C 2TEPA 3MPPG 2VMCA 4CRQA 4DXZA 4XFAA 4B8EA 3Q8BA 2FDIA 3CBNA 4HKWA 2ID4A 3BTXA 4Y33A 4CDWB 3TRSB 1NCRA 1GQPA 2J22A 3GBGA 3IAPA 1QJU2 5JPNB 3POJA 3FHIB 4PDWC 2A7AA 2JE8A 3O7OA 5F9TA 3B9IA 1NE6A 1MEC3 4LR4A 5DAVA 1W06A 2WWSA 1IPSA 1I5ZA 1N1TA 1YFUA 3BPZA 4NHYA 5FJHA 4CDQC 4WVMA 5F7UA 5JSRA 4AGVA 4GMP3 4LO5B 2WA3A 1FI2A 5FZIA 2BWCA 4XHXA 1OQEA 2QKDA 3THPA 1TQ5A 4YGDA 5IW0A 4EROA 3TN92 4FXGB 3HQUA 2JD9A 4L97A 1H1MA 1NQDA 5CYYA 2WKKA 5BNNA 5IYYA 2CDOA 1AL22 2XB6C 2HWB2 2GNDA 2VCAA 4IEQA 1CQ9A 4N7IA 1O6UA 1Q3EA 3EB7A 4L92A 1GOHA 4RHV3 5CFDB 1JZ3A 1JYWA 3UKNA 1IQAA 1WUVA 3BPSA 3PURA 1A8MA 4DXRA 2SBAA 4JDMA 2F17A 2WO7A 5FZ0A 1W9TA 1OUSA 4R9BA 3LWCA 3T2PA 2VUJA 2O0OA 2XJUA 4QX0A 5A1AA 4BQ2A 1S1AA 2VG9A 1WD4A 3HMYA 2XXZA 4P9GA 4AYUA 4FTBA 4UBHA 1PNFA 1W99A 1UX6A 4PIZA 5IFPA 3GYDA 3POWA 2WO2A 3ZR5A 2PHXA 4FPGA 1POV3 4MGKE 2Q30A 2WS91 1LHNA 1ZBA2 1UOGA 4BLIA 1H9WA 1FMD2 5FXWA 3SH3A 2PLV2 3EO6A 4FPOB 4E4HA 1ZRRA 1PO21 2CGNA 4BQWA 2HWC2 1HKDA 2WZR2 4RR3B 1WZXA 2YPJA 2VECA 3KCYA 3S0MA 1H0BA 1Z7S2 2LUWA 4YVSA 3NNGA 5GLTA 1N47A 2W47A 4JGZC 3WHTA 1RUH2 2E63A 1GKBA 3SEEA 5KR7A 4IGPA 5DDJ2 1H6XA 1GWLA 1RUG3 2WABA 4W6WA 1QH6A 3CHXA 4AWDA 2LALA 3MIGA 2JG9C 4MXWB 3BKZA 1ZNPA 3ZVXA 3THTA 3M4FA 5A7SA 4IEOA 4YG3A 4QD2A 5FWEA 3JBG3 5FLHA 2FBEA 3PUIA 5LEKA 4MGTA 1EV13 1SPPB 2AREA 2ZZQA 3IM0A 5K7PA 1YI7A 4XF9A 5FAXA 1CAUB 1YQ5A 4KWJA 4HN1A 2BERA 3C7OA 4XUTA 3E6CC 1N1SA 3H1WA 4UFJA 3I3DA 4UF0A 3ILRA 4LBQB 3V64A 4UFLA 3O0WA 2JWPA 4XZUG 1VBA3 3VBOA 3MYXA 2UU8A 1DQ2A 1H2MA 3OYWB 1GUIA 3UJQA 2WNUA 1ZZBA 1SBFA 3DGTA 3KV6A 3NWKA 4JAAA 5FYTA 2CGOA 4OHVA 1RVF1 4BJ0A 2ZGRA 1OSGA 3D3AA 4JRAA 1O8PA 2OT7A 3DEMA 3ZYFA 4LA3A 4I01A 3ZYGA 3KHCA 1G86A 3GCWA 4UW6A 5FZ7A 3T0DA 4YZ2A 2ZPXA 3CF6E 1I5PA 3I4IA 4Y1UA 1CJPA 1XC6A 2QNKA 1KD7A 1HXS3 2VC9A 1CVNA 1GWMA 3HAGA 2BZDA 1NYWA 5F5AA 2VW1A 2XLGA 4QDQA 5FPBA 2GN7A 1QIQA 2VZRA 2X5IC 5FY1A 4XAEA 2X05A 4AEMA 5FZ3A 3CMGA 1RUF3 3K77A 1XNAA 1OLME 1V6KA 3JB4C 4Y4YA 5IVVA 4LK6A 2DTYA 5GALA 4PLNA 4UOJA 1CESA 3CJIA 5FUPA 5FZMA 3OUHA 4FOQA 1U5IA 2JENA 2R1DA 2YG0A 2XVGA 5A3OA 2OX0A 4B29A 1HRV3 5HCAA 2ZKNA 3WX5A 3VBFC 3AYDA 5JOYA 4MX3A 4MHRA 5A7PA 4CDWC 4RGGA 2ZKLA 5FBZA 2PAMA 1FOD1 4IV3A 2Y34A 3L9JT 3URFA 5K0UB 4H3WA 4LIUA 1S0IA 4DEVA 3ZSKA 3VLBB 1VBD3 3GZAA 1UZVA 2XUEA 3HN3A 3NJXA 5FMBA 3J7MA 4FAHA 1RUNA 2GMPA 1E5RA 4X8PA 3E5UA 1K45A 3VBRB 5F3CA 1F8VA 4ASMB 5C4WB 3GGLA 1PIV2 4PIYA 2R041 3ACGA 1IS4A 3M8LA 4Q0UA 4AAPA 3N9NA 3B94A 2O8QA 2YB7A 4OCTA 2XHKA 1ULGA 3ENRA 3IDEA 2EIBA 4DPNA 2E6VA 4QX7A 3VN4A 3TEZA 4D6SA 1J84A 2JE9A 1BEV2 1TG7A 2H0VA 2H0BA 4H7MA 4XFIA 3ZFFB 1PO11 3SLIA 2G9GA 2JDYA 4QT6A 1L7RA 1JU4A 2BFUS 3H1MA 1FAYA 2EXIA 1CIYA 3H8UA 4AEJA 3VBUC 3LA7A 3WF0A 3WNNA 2XQRA 1RMU3 2MNGA 3QBQA 5LA2A 2WWJA 3VDDA 1GP4A 1JHNA 2I2SA 3MLKA 3JD72 3CZUA 1PGW1 3OY8B 4HKLA 5F3GA 2VMDA 2WNVB 1LEDA 1F9KA 3S7IA 2VW0A 4LIVA 5FKBA 4Q1RA 1W6QA 2KD7A 3KQ4B 3UK9A 1UOBA 3WDVA 3ATGA 3AZXA 4RR3C 1JZ5A 2D43A 2VUAA 4FBFA 4DMIA 1PMJX 4GAZA 5D1IA 4NWVA 5CVRA 3N9LA 2Y38A 4OI1A 4QKNA 4W8JA 4RGAA 2UY8A 1XXNA 1YFXA 3RJ2X 4OQ8A 5EJ3A 1W9WA 3ZFEB 1RJ8A 5FCCA 2BJSA 4ET7A 3VHPA 4K1YA 4EZHA 4QDSA 1PMIA 4JHZA 3BIWE 3NKTA 3MDPA 3V65A 3VZMA 2ZEXA 2XHNA 3MEPA 1OQDA 1R082 5J48A 3EYPA 4BA6A 1SG3A 1Z0HA 5DABA 3KD4A 1VMFA 2W91A 3ZIWA 1BKZA 2YC0A 3SEPA 3S7EA 2W39A 2UYBA 3IB3A 3LOBA 1CPMA 1XYPA 2W9XA 3FE5A 3KV9A 3ILNA 2VZPA 4B3NA 4URAA 3SMHA 4XABA 3RI9A 1O5UA 2J1EA 4QGNA 5FY8A 4UBGA 1GZWB 2D93A 3M7AA 3L2YA 4R9DA 5IK4A 3R4DB 1VRH1 4M0HA 3E5QA 3S5AA 2AGSA 5IUQA 2BNMA 4QM9A 5T5JA 3J8F1 1QJY2 3N36A 3CLPA 3PU8A 1LECA 1GSLA 1MZEA 4JX0A 4D7YA 3VBSA 4OMCA 3ZSJA 4C0HA 3I2GA 2WNOA 3M3OA 5FY0A 5F39A 3J7LA 2RMU2 3BU0A 1DGWA 3H7JA 2P6CA 4LKFA 2VZVA 3DF0A 2BEOA 1SLAA 1NLQA 2ZHKA 2ZABA 1C8M1 3FHQA 3TEXA 2YU1A 5DUXA 4IEYA 2VMFA 3I8TA 2Y64A 4OLLA 4AEDB 2NM1A 1NY71 4AEKA 5LRSA 1DGWX 1H6YA 1QWRA 3PU3A 4UW3A 4YW6A 4P00B 5DUVA 5F2SA 4Q0PA 2LRPA 4EV0A 4Q0VA 4QPIB 1AUYA 4HVQA 1CN1A 4NJ4A 5FTTC 1T6BX 1QJU3 1UPIA 2BUKA 1ASJ2 2WLPA 1K5MA 1RHI3 3P5BA 4LE3A 4Q4V1 4E4ZA 5KHKA 1JN2P 3OF1A 1PX3A 2DCJA 3WG3A 1FV2A 2E26A 4YVWB 5CISA 1ND2B 1QDOA 1WMEA 4YG0A 4CXYA 5FP9A 1YQ6A 2ET7A 1N3OA 1ODMA 1ZZ6A 1OLRA 1F15A 2RJLA 1G8WA 4FPEA 1FT9A 4PBOA 4RN5A 1EUTA 3WEZA 3SC7X 3VZOA 3RZZA 3TN93 1KEXA 2EXJA 4AQTA 4EN7B 4A7YA 3MW2A 4LBLA 4MVTA 2BBAA 4XYXA 1AL23 2Y6JA 2EF6A 1ZM1A 1JODA 1HRI1 4I2OA 4QB2A 4NIIA 5I0DA 1YUDA 3WP6A 1WMXA 3AL6A 4MGSA 4KWUA 3MBWA 4Z82A 4K9SA 3NO8A 3NVCA 3ZFFC 3W9AA 5FREA 4Q27A 4GJYA 1CAVA 4BK5A 3AYAA 4JQTA 1ZRFA 1SCRA 4ZHNA 1W8OA 2X29A 4LUMA 4N53A 3N7JA 1V9U3 1PGL2 4E2SA 4NN0A 1W6MB 1UKRA 2ZXQA 3O1VA 1AR61 3OUIA 4BQXA 1FMD3 2PLV3 1XOYA 1WD3A 3IZOA 3K3NA 1G9AA 1DU3D 3R05A 3WHUA 5BYNA 2GC1A 4JGYA 1IQDC 2HWC3 1WCQA 2WZR3 4M01A 2CY6A 3WNLA 1SLLA 3RYPA 1VR3A 1KS4A 1Z7S3 2BDRA 1I1EA 1YC61 1WGPA 1RUH3 1SDWA 3JB8A 3USUA 3AMPA 1NA1B 2F6BA 2WJSA 1NKGA 4P08A 1MVEA 1QJX2 2VZSA 4V2VA 4HVRA 3JCIA 4QPGC 1OF4A 2IUWA 2J1AA 5KXCA 3ACHA 4I0BA 3I2KA 2R6QA 3ZFEC 3U75A 1W9SA 1ST8A 2KR2A 1R64A 2A75A 1H1AA 2A6VA 3A4UA 3ZSMA 5EPAA 4KBBA 1G9BA 3WNMA 4IV3C 2VQ0A 3FBMA 5FY4A 4WM8A 1FNYA 3ZYIB 4BB3A 4LBMA 2W68A 4LBKA 3N7KA 4YW1A 2Q5TA 1PMHX 1G7YA 5T54A 3HEIA 5CBLA 3OGGA 4YM2A 3L2HA 4M00A 4MGYE 4BE3A 4CXWA 5GZGA 3AB0A 1BLZA 3AP7A 1DQ5A 2R061 4R4ZA 4FFHA 1JYXA 4W6YA 4KG8A 1DP0A 4Y5TA 1W6PB 3RMYA 3KF5A 5D8AB 2A1XA 1QQP1 1VBE1 2VPVA 2VQTA 2E7TA 2Z69A 4YW5A 2D3SA 4XHBA 4WV8A 2XWJB 3KVBA 3DKWA 3T0BA 1YJKA 2HBTA 1G9DA 2WT2A 5LA9A 2N7GA 1LKNA 3FUQA 4CUGA 1RITA 3OGVA 1U0AA 1J83A 2D6PA 2FHRA 3UGHA 4D3WA 1XB9A 5FYSA 3O1OA 1M4WA 2R49A 1R093 4HPKA 4E9KA 3D8CA 3K46A 2GDFA 2GMMA 4MOAA 1HB1A 3QOPA 3WP4A 3WF3A 4AEDC 2CTVA 3V56A 5A32A 2C9KA 3NAPA 2KA3A 4FFGA 3RVHA 4FPYA 2XLAA 2Y60A 3IPVB 5F2WA 4B7KA 2L9LA 1A34A 4ZU4A 1BVP1 1VBC1 4XPVA 5EFUA 3LB9A 2W94A 1BBT2 1TME2 2NQYA 3WW1A 3W5MA 3VHOA 3AJYA 3OGSA 1QOTA 3FN9A 4QAWA 2HWB1 1S55A 1PIV3 2ERFA 4XF4A 4YWAA 5KXDA 2WUHA 4U36A 3A21A 1EPWA 3NSTA 4XC9A 2VD7A 4D7TA 2V5YA 4YZ4A 3EHKA 3IKWA 1TMF3 1L3JA 2J1SA 4WM7B 3C8XA 1BEV3 3GZTB 2AC1A 1C1LA 2OA2A 3INAA 4P14A 4KNCA 4PJYA 4FI9A 5DAXA 2W95A 3RI8A 5C5TA 5C6CA 1HQNA 1H1IA 3ZXFA 1D0HA 1UO9A 1S0FA 1W8TA 1RXGA 1X8EA 3OBZA 2XJRA 1ZBA1 2H6CA 3DYOA 3HBKA 5GLWA 3T2TA 5JZGA 3IBMA 4LO8A 4CU9A 3WNPA 2ZAAA 2BOIA 4ZY9A 3ZYHA 4IV1B 4I0AA 3VKNA 4IDZA 3HVDA 1Q8SA 4YARA 3WP3A 2C26A 4FPLA 4COVA 4BK4A 2VCCA 2VQUA 1DGLA 4XVHA 2D3PA 2XMLA 4EWAA 5F3IA 3DKQA 4AVTA 5T3NA 5K4LA 2WLQA 2R071 5F3EA 1HRV2 1QY4A 2D3RA 3C2UA 4NOTA 5DDJ1 4LQRA 4ZU5A 4YFZA 3O1TA 1Y4WA 4GXLA 1AR92 5JMOA 3J9SA 3I3EA 5E16A 2DV9A 4ASKA 5HXMA 1BQPA 1KDKA 4A41A 1AX0A 4OHYA 2G1MA 1UYYA 1ZBE2 4LUKA 4XQDA 4CDQB 4EQVA 1NA1C 3LDKA 4ITCA 1VAMA 4DNYA 3OTFA 3CJXA 4CCJA 2Y0OA 2P5BA 5DQ0A 5ABJB 1OD3A 4LPLA 2P3IA 4DXSA 4TXWA 4Y22A 3ME2A 1C3HA 2VTFA 2WFPA 1R083 5A6ZA 4TTGA 5L9VA 2YY1A 2J42A 3N9OA 2X53S 4JKMA 1Y9GA 1F4HA 3JU9A 1CPNA 4HBNA 5FYVA 3R6SA 3VD3A 1NCQA 1VPHA 1W3XA 2VJXA 3LA2A 4IEUA 1W0OA 4OQ9A 2EAKA 3WNXA 4IEZA 5FP3A 3PIJA 4Z2AA 2FCUA 5FUIA 1D0GA 5T5OA 2DVGA 4GALA 4XIKA 1IPJA 1OD5A 5GZFA 1JYVA 1DDLA 4L2NA 4MUVA 2IXIA 5C5UA 1CIWA 1TEIA 5FZKA 2RS31 2W87A 2E33A 3RMXA 5A6XA 2FDJA 4SLIA 5FY9A 5DMYA 4RQPA 1UU6A 4K40A 1R1ZA 1S2BA 1OA4A 3MV01 4ZXEA 3AVRA 2QZ3A 2A6XA 1W8ZA 5D8AC 3RPQA 3RG0A 1MQTB 1RUE1 1UY1A 5EP9A 3RZMA 1PVXA 3ZN6B 1IS3A 3VBHB 3PL0A 2RMU3 4P5HA 5JXGA 1QJEA 5BNPA 2K2SA 5B4XA 5EJZB 3LA3A 3AK0A 5FP7A 5LA1A 5FXVA 4B1MA 2VBPA 4CDXA 1AYN3 1E5IA 2E31A 1W8HA 1Q43A 4ZS3A 4LKDA 2JG8A 2YYOA 2GNTA 2JDNA 1UZYA 3EJKA 5APAA 4YYOA 4JGYC 1V6JA 1OHFA 1V6LA 1YYNA 1LHOA 2ZMLA 4JZRA 3T1MA 2E51A 2OPKA 3B00A 2PMWB 1AXKA 2VNGA 3KHBA 3IIAA 2JDUA 5FYYA 2RDSA 3I97A 4Q4X1 5A3TA 5ACA2 1ASJ3 1UMIA 3N3HA 2HWE2 4XETA 3VZKA 3VHRA 3FLTA 4XJAA 3DECA 2WNEA 4ZZ5A 2V72A 4MV2A 4RD7A 5LY2A 3I59B 3D6EA 3VKOA 4YZ5A 2B8MA 2CAVA 2JKXA 4BQYA 4DY3A 4N43A 3SKVA 1MACA 4D69A 1KFUL 3RFRA 5E1RA 3ZX7A 5HV4A 3LCPA 4NIAA 4AHXA 3FBYA 2YGMA 1HLCA 4Y5Z0 4QQPA 3OPZA 3MICA 3TNPB 1J3RA 3KT7A 1CAWA 4I09A 1ONAA 5EIYB 1O91A 2VE1A 3BYWA 2VNRA 1BMV2 2HBUA 5F5CA 1E5SA 2UYAA 3CIHA 1KITA 1GU3A 2ZAHA 3AMMA 1BXHA 1GWKA 3OPWA 3OG2A 1PVC2 1DFQA 5FZLA 2GAUA 3OUJA 1JH5A 2QDRA 1NQJA 2YGLA 5LA0A 2CYFA 4YG6A 1Q8VA 3ACLA 4ZS2A 1FPN1 2HEWF 2ZGTA 3I3QA 4Q4W2 3K4AA 5CFDA 2MPFA 4AQ6A 2X5IB 1RUC2 5DUWA 5CFCC 5FMDA 1XYNA 3MIFA 3U11A 4GWNA 5DPNA 5F8PA 4PF5A 1HN0A 3JD71 1GNHA 4AW7A 5C71A 4NMIA 1UZZA 4UW5A 4N90A 3NKGA 3LPFA 4DOUA 1FXZA 4OI4A 2CGPA 4JRLA 3X29B 5C9AB 3VBFB 4QX5A 3A7QA 1EYBA 3FWEA 4R9AA 2FMDA 5FQ0B 2QQWA 5BNOA 1DG6A 4BU2A 1JOBA 3AL5A 3W58A 1DQ1A 3PVNA 3VKMA 1AXZA 1RHI2 2ZGMA 4NE9A 4CE8A 3NJYA 2TBVA 2X8KA 5A33B 2VQAA 5FBJA 1QJX3 3AFKA 5H9QA 3AKRA 3DV8A 1RUD3 1NUKA 4FPCA 5FZFA 2BP6A 1JU3A 1UY3A 3C7FA 4UFMA 4D7SA 1ND3C 3LZZA 3WNOA 2GH8A 5DG2A 5ABJC 2X09A 4FPJA 4M3CA 4AG4A 2OZJA 1D7PM 3M70A 3NAPC 1GQGA 2RS51 2WYSA 2OZ6A 5LCWL 4X8NA 5GJ6A 4XW3A 1I9RA 4UI9L 5L9BA 1K12A 1SPPA 3H3UA 2OW4A 3WW4A 3BI3A 4FFIA 5FLJA 1XRUA 4OI2A 1XE8A 1VRBA 3ES4A 4IE4A 4UYBA 2IXJA 4C1XA 1RUJ1 1DIWA 4K3UA 2ZEZA 4J25A 2QE3A 5FRAA 1D4M1 3LAGA 4UFHA 4BISA 3MIDA 3RZJA 5CG9A 3OD4A 2W1SA 1QJY1 3E6DA 3P3NA 4QXCA 3ON7A 3WG1A 3Q8AA 2R32A 3LSDA 1AR81 1REDA 1O7FA 2EALA 1V9U2 3VBUB 4NRMA 2AYHA 2XL9A 5IVCA 3WUCA 2JEMA 4BXFA 3CU7A 1ZRIA 1IG3A 1OF3A 2DVFA 3AKTA 4PCRA 1X50A 4A45A 2W08A 1MQTC 2PAKA 4QB1A 2XJPA 3CKHA 5DXDA 4BIOA 1HQLA 1YHFA 2ENRA 2I07B 4O9GA 4RFT0 3VBHC 4BQ4A 4KBZA 4LKSA 1G9CA 4Z07A 5ISLA 5F6LB 3GZUC 1PZ7A 1UY2A 4OFGA 3ZM8A 3HT1A 5FIXA 2VGDA 1KFXL 4IUGA 1MS3A 4W6XA 5FYCA 3ZPYA 2P17A 4YZ1A 3M3EA 2VZQA 2EA7A 5JXJA 3PIGA 1V6NA 4AXOA 4KU7A 3V0BA 1NCRB 3C7HA 2EVXA 2VBDA 3RWNA 2OS2A 2CV6A 5JDBA 2VZ1A 1QOOA 3H3LA 4YGBA 4CCMA 4QXBA 1JZ8A 1IPKA 1UL9A 4QQLA 3FFZA 3RRDA 1Q8QA 5F1RA 4QHZA 4I02A 2P3JA 1RYYA 1YQ2A 1QDCA 3M3QA 4WVMB 4WZCA 4RS5A 1IS6A 4FTEA 4IEWA 3O1MA 1RGSA 1BBT3 1TME3 1XNBA 2RV9A 1N3QA 3ZO0B 3WXPA 4JKKA 4QX3A 4ASLA 2ZTNA 4NRQA 5FYHA 4IEPA 3VL9A 1WMFA 2HWD2 3PJYA 4M0NA 3ZXJA 2DU0A 4CTEA 2ZBJA 2DCTA 5FZGA 2CWSA 1COV1 4AI8A 1RUI2 3ASIA 5J7MA 5IK5A 2ZEWA 4CYDA 5LBFA 4BIFA 2WYFA 1C5IA 3BOPA 4XJ9A 1SEFA 4XJ8A 3RYRA 2Q0AA 2D6MA 3MPBA 3ZSEA 2BTVC 1CGPA 1MS4A 1HIXA 1ZA7A 3U14A 2MEV2 3N4MA 4LO4B 5C3RA 2ET1A 3RNSA 5IK8A 1VBB1 1JYIA 1BVVA 2VZOA 4O65A 1POQA 1ENSA 4JV4A 3AC0A 1PNGA 1UMZA 2R1BA 5FZ9A 1UYXA 4KGQA 4CZSA 1AJOA 3OGJA 3LDBA 1R1A3 1SFNA 4Y4RA 4LA2A 4RYDA 1X8MA 2WN2A 2ADEA 1JW6A 2BU9A 3MLLA 4LE4A 1H8TA 1OXCA 3ILFA 2C5DA 2JIJA 5BV6A 3HOBA 3J4UH 2BOJA 1QNYA 1R092 5LB6A 4ONUA 3N35A 5L73A 3KCCA 1WW7A 5GZEA 4ES9A 4I3PA 5C9AC 5LBEA 4YVSB 5E88A 5BNPC 4MGIE 1N1YA 1AR93 4M3CE 1MEC1 1GZTA 2VTXA 2IZWA 4CEWA 1GV9A 4IE7A 1UQXA 2WSUA 2NLRA 4JTOA 4MADA 5C3SA 3ES1A 4CDXC 2YFUA 1ZBE3 4LULA 5C8CA 4GMP1 3B02A 2HJIA 5A7WA 2JG8C 1LOBA 3WT3A 4GWIA 4HL0A 1HB4A 1UXZA 4CP0A 5A6YA 4OI0A 5HCHA 5G04L 2OPWA 1MS0A 2VULA 2C4XA 4CCEA 1UU4A 5FK7A 3VL8A 1E57A 1J1LA 1DQ4A 4GH4A 4BHPA 1Y7BA 2IC1A 4RHV1 3O14A 2VUCA 3DPRA 3GJAA 3CQOA 4UF0B 4PLOA 3HBZA 1WLDA 4E4SA 5E8AA 1TMF2 2AR6A 2B5HA 4G9SB 3U07A 4Z92B 1H8VA 3VBOB 1U5ZA 1UWWA 4N43C 5JVVA 4A6SA 3NNJA 4H55A 4CUBA 2WNUB 4X6RB 3C7EA 4CEYA 1URXA 2VMGA 2RR12 3BGAA 4QB6A 4FSJA 1QH7A 4META 4QX2A 1QXPA 2LROA 3I3MA 1POV1 5FZHA 2VCMA 4GWJA 3WSOA 4ATFA 5LEJA 2G4IA 1XBFA 1SBDA 3PLQA 3POGA 1MPXA 4LMFA 4P9IA 1X7NA 1W2NA 2ZGNA 4DUWA 5A6QA 3VD9A 2K0GA 1YRZA 3ZFGA 5DZEA 1FATA 1RUG1 2WWUA 2VY0A 3RJRA 2E32A 1AYM2 4JDOA 1MZ5A 2YBPA 1JMUB 4GQ7A 2WBKA 3IWZA 3AMQA 2C6SA 3WDWA 3JBG1 3ZYRA 3CJIB 1VMJA 4QPGB 2JDZA 1OOPA 2C0ZA 1S0GA 1EV11 1I6XA 2YMZA 3T4VA 4HOOA 5EHDA 2DVBA 1B09A 2VW2A 1OFNA 3H3ZA 1NCRC 3LEGA 3WVJA 3MO4A 4I0WB 5AFBA 1V70A 2ZGSA 4IV3B 5T5PA 2A3XA 1XSQA 1ZREA 5ACA3 4XXPA 4EN6B 1ZZ7A 1RINA 5FDBA 1W6OA 2HWE3 1NLSA 1UAIA 1VBA1 4YPJA 4AVVA 3CL1A 1S2KA 3SCHA 2XLFA 4QPIA 2IVIB 2QUOA 3AYCA 4IL7A 4NO4A 1SLIA 4ARYA 4DIQA 3GCXA 4AI0A 4Z1VA 1ULDA 5H9SA 5BUVA 1GP5A 2VO5A 2P34A 4CSWA 2AENA 4HMZA 4AFCA 1EPZA 1LOGA 2FDGA 3PVBB 4LKEA 1DZTA 5ERLA 4MHUA 5BNNC 4COWA 1GR3A 3POSA 4Q0QA 2R7EB 3POYA 4QQOA 4DS0A 5GKAC 2A71A 2JICA 2ZX1A 1W0PA 2PFWA 1IKQA 1CAXA 1HXS1 3J7HA 2J7MA 3I2IA 3ZLIA 1REFA 5A7QA 2ARBA 3TBDA 2NMOA 2WL1A 2FQPA 1QKQA 1PVC3 2YBKA 3AX4A 4Y5SA 1N3PA 3NNMA 4LHNA 3R4SA 3ZXKA 1RUF1 2H6BA 2HLEA 1A78A 4Q4W3 2XG3A 1QNWA 3AM2A 3AKQA 1H4GA 1RUC3 4KI5M 5FZDA 4A7ZA 1F2NA 3H50A 1AX2A 4AE2A 2PELA 4Q0SA 3LOIA 4LBOA 5SV5A 4EN9B 1M06G 3M1HA 4C90A 4N8MA 3VDDB 4XTPA 4JCKA 3TYJA 1RUOA 1AYN2 3VDAA 1HRV1 4RGKA 4AGGA 1I3HA 2XVLA 2IXCA 4QU2A 5FOBB 2KXLA 3LE0A 4ORFA 2BFUL 3TNQA 3D0JA 4TN7A 2YFZA 5LWBA 4XF0A 3VDCA 2XH6A 5A70A 4XBLA 1XYOA 4LORA 4YVSC 2WS92 5FUNA 4S2FA 4GULA 4XUQA 2Y33A 3RZGA 4ISQA 1VBD1 4XQ4A 4Q2FA 2XBO2 2Y0IA 3JQWA 3UGFA 1PO22 4K6BA 4DUVA 1GZ9A 2PA7A 5FZCA 4NIGA 3FFQA 4COYA 2YU2A 3V0AA 1WMDA 1OKQA 2B9VA 2PHRA 3SHRA 3TAYA 4COUA 2GMEA 5DUUA 3J7NA 4Y20A 1LOAA 1C28A 1JI6A 1Y9QA 2E7AA 2PTMA 1DHKB 4QHBA 3WQ7A 3OOXA 2PHFA 4OMDA 4MXVA 4D6QA 5IATA 1JZ4A 3M3CA 5BY5A 3OJBA 4HZFA 1BZWA 3WDYA 4FT8A 4A6OA 4CPBA 1S2EA 5ANQA 3AP4A 3B01A 3QH6A 5T55A 2HWF3 2WZ8A 4PF1A 4FPHA 4Y1ZA 1LOEA 2P6HA 5KBFA 1LOFA 3VBOC 3WUDA 5A3PA 3ZKYA 3LPGA 1MR5A 4CA9A 2RM23 2XR4A 2WNUC 4EWDA 1UYPA 4YW3A 3W20A 5C8WA 1ZRCA 1W39A 1AVBA 4NVPA 5FYZA 1ZX5A 2GNMA 1RMU1 1XNTA 1WW5A 4TSVA 4XUNA 1OURA 3T3YA 4LK7A 1LGNA 5L36A 3I7DA 1HB2A 2B7YA 4J1XA 2EXKA 4W65A 1XE7A 1NLRA 2B42B 1W8WA 4Q4Y3 2O1QA 1DQ0A 3B5LB 1IG0A 3ACFA 4K20A 1PX4A 3OSDA 2LTNA 1BCXA 1IS5A 4J6GA 1PK6A 1RVF2 4DY5A 1ENRA 4QGMA 4XFGA 4DXTA 1HDKA 3AJZA 2Q1MA 5FJKA 2JDKA 4KH9A 5L7OA 4A44A 5GM0A 1ZZ8A 4FQ4A 1MS9A 1SHWB 3WF2A 4B4QA 3ZMNA 2BVVA 5FPZA 3UKVA 1LHUA 1W03A 4A42A 3AKPA 3T2QA 2JDPA 1S0CA 3HWJA 2K9ZA 2R30A 3VHNA 1RUD2 1X9PA 2NZ9A 2Y6KA 3CJIC 3K48A 4GMP0 3RSJA 1IZ3A 5DZFA 4RA0A 3C7GA 1NXMA 4I3GA 2OXBA 2RJKA 4XOGA 1NAEA 2YHJA 3NNLA 2P1BA 1K5MB 5C7GA 2W3JA 4C1WA 3ETPA 4XJWA 3WNKA 5C8CC 1EUUA 5AC92 5JAXA 4K7JA 4CP9B 3EMRA 4TWTA 3ZN5A 2QQNA 3WCRA 2XOMA 4BCUA 1JBCA 1Q56A 2D6OX 2VOVA 3AP9A 3IPVA 1FOD2 4AI9A 5FXZA 2HWD3 3KCXA 5AC91 1AL0G 4GH4C 1WCUA 1LOCA 1BMV1 2WSVA 1RUI3 4YM0A 4Z2WA 2ARCA 1H30A 2I74A 2PYTA 1POV0 1W05A 3ZXDA 4DQAA 4XMAA 3DXUA 3SH5A 2LS6A 4U2AA 1F5FA 3AMHA 1A6CA 5E6HA 4A7KA 5B2GB 5HV0A 2MEV3 3I2JA 4QPWA 4BM8A 1IOAA 1GP6A 1TNFA 4IXLA 4CEYC 4LNVA 1SLTA 3MGUA 1XNKA 2P37A 3D82A 1C1FA 4FCAA 4WM7A 4MGZE 1LEMA 5BXXA 2XPJA 4N53B 2JDHA 2GC3A 2HEYF 4LXLA 2WRAA 1EAH3 1UOFA 3MUZ1 1ULCA 1J59A 1DCSA 3JQXA 1ULPA 4YW4A 1ULEA 3VDDC 1RIRA 1W2AX 2VOKA 1W0NA 3POFA 1JHJA 5I0UA 4JGYB 1K42A 3N9MA 4C0BA 3E6BA 5CB7A 3PUHA 1QJU1 4HT1T 2V73A 2XJQA 1RHI1 2JB4A 5HI0A 2Y6HA 2OUJA 2ADDA 5JCTA 3E97A 3KGZA 2DBNA 3NJZA 4AOCA 5A3UA 2ZMNA 1Z78A 5LASA 4D0QA 1G6NA 3DYPA 1ACCA 1PGW2 4XTMA 4AR2A 1ZRDA 2A5ZA 3IN9A 1OOPC 2QFEA 3D5OA 1UKGA 3NV2A 4L0PA 4PHZA 3WR0A 3F95A 3PVEA 4PDWA 1UYZA 4NAMA 3ACIA 4QXHA 3TN91 4CU8A 4AF9A 5GZCA 4CDQA 4E8DA 1AL21 5C3PA 5CKQA 5LBBA 4BZ4A 3AZVA 1JZ7A 4OUMA 1IHMA 5IFTA 4LOTA 4WM8B 4BWOA 4DEQA 2VM9A 1FX5A 2DCKA 5IJRA 5LATA 3H8RA 2ZHMA 5A3LA 5CNAA 3A0NA 2XKPA 3BB6A 1OPMA 4LLFA 3I54A 3PUAA 2V4VA 3OBAA 1VMHA 2RR13 4V2WA 1V9U1 2FCTA 2QQIA 1W8UA 4UW4A 1E5HA 3WINE 2KM2A 4QQHA 3K51A 1SDDB 5CFCB 1SACA 3AXDA 4OULA 5AVPA 4CDUA 3NW4A 1FMD1 1R1A2 4O9EA 4TLFA 2PLV1 4P9LA 4MO3M 3PTYA 2ZGLA 4TLGA 2D6LX 4LBNA 3W59A 2HWC1 5EYYA 3THCA 2NMNA 1VB2A 2WZR1 3ETQA 4RSUA 3VBSC 1Z7S1 4R52A 3P6BA 5I93A 3I2DA 1RUH1 2D44A 1VRH2 1OC1A 1U5XA 3KVAA 5FKCA 4C8DA 1LULA 5FOJB 5IT6A 1AYM3 1B35A 5FLIA 3RGBA 2QQVA 3J8F2 2ATFA 3BIEA 1S0DA 2DCYA 2VUDA 1T2XA 2ES3A 2Z4FA 4GB33 3K2OA 2VVDA 1JOJA 4IE0A 5EV7A 3N7LA 3ST7A 2VOWA 4AHWA 4BQ3A 4HPKB 1SFPA 5L19A 4JGZA 2FDHA 3U78A 2B45X 3GBFA 2DF7A 1LR5A 2WFF3 4DB5A 4PQQA 1LGCA 1QOSA 3CO2A 5A7NA 1ND3B 4XQWA 4PBPA 2JG9A 1UZ0A 4PQ9A 2BW8A 5FPLA 3ZKUA 5A32B 4BQ5A 4IGQA 4N9HA 4EN8B 4DINB 3NAPB 2DVDA 1C8M2 1KQRA 3WOGA 3PTRB 1SCSA 1K5MC 3PUSA 4QDRA 4YLZA 1DF0A 1Q5OA 1ALYA 1CWPA 5F37A 1NY72 4Y1YA 1JTZX 2IFRA 5JWPA 3CEWA 2XVKA 3GALA 2A6ZA 4KG0A 4AFAA 4Q4V2 5FO8B 1TNRA 3BVCA 3UNPA 1OKOA 1UCXA 4EN0A 5FP8A 4A4AA 5C33A 2QBXA 1FV3A 4PIXA 1A8DA 4GIQA 4S2DA 1FNZA 3DL3A 1LOFC 5TSWA 5H9RA 4KL1A 2Q8EA 5F32A 2BNOA 3QACA 5DAWA 1OUXA 2EXHA 3EXUA 3GM8A 4Q8KA 5JZGB 4QX8A 1HRI2 2ZACA 2BRTA 4N53C 1UZWA 1W6NA 2FD8A 2EIGA 1CX4A 5AFEA 1PM7A 1R091 3QH7A 5FZOA 1PGSA 5A80A 1YFYA 3MFCA 4AI2A 2IVJA 4KGGA 5EYXA 3O1PA 1XJAA 1QJZA 1PK6C 4YRDA 3T09A 1V6IA 2ZGKA 3KQRA 4H2AA 2RHPA 2VOTA 3IIIA 4A3XA 2VBBA 4URTA 2A73B 3WP5A 2J1VA 2Y26A 1VB4A 2WN3A 4O7XA 4E2GA 3ROUA 5J1XA 1W28A 2WS93 4LTAA 1AR62 1ZZ9A 1NXD1 3KS7A 5C70A 4YNIA 2XBO3 1AR72 2BYVE 5FZ4A 5HCFA 3UGGA 2DU1A 1PO23 4CDWA 4CU6A 1LENA 4YM3A 1V0AA 1UPSA 2WQZC 2EIDA 5IWFA 5LK5A 1OVPA 2ZS6B 2IXLA 1PIV1 4LITA 2A3YA 4PT6A 5FMCA 3T1LA 1W2UA 4Y22B 1GICA 4XCBA 4XDQA 1KRIA 3LEMA 5DN2A 1TMF1 1W90A 5IVEA 1BEV1 2R16A 4X6QB 4ZZ8A 1NCQB 4LJHA 4WM8C 2QJVA 5GLUA 3VKLA 3WD5A 4EZ4A 5KHJA 3HIFA 1DGRN 1TE1B 2LM3A 2VVEA 3FL7A 3VZNA 2CHHA 5H9PA 1WW4A 2SLIA 3AVSA 3O12A 1JZ2A 4BMBA 4WVVA 5JSOA 2HEVF 2J1TA 5E89A 4MLOA 1OPOA 1Q8PA 2YROA 4BYYA 2XJSA 5EQUA 4JVAA 4DO0A 3UT0A 2RDQA 2D5FA 3H0OA 2BGCA 1QJFA 3WDXA 1MZFA 4KU8A 4C91A 4HKOA 1JZ6A 3HNMA 4W50A 5EZWA 2PHDA 3O1UA 5DAPA 3WF4A 2X10A 3KV4A 1SMVA 4FTSA 2ARXA 3PJQA 3VBUA 1CR7A 1RVF3 2JD4A 3H8OA 3H8XA 3RZKA 4NIDA 4NR1A 3WF1A 1HJGA 4PLMA 1DZRA 2R062 2RE9A 4YGEA 1GLHA 5EWSA 5BNPB 3W5NA 3JUUA 5LBCA 3SISA 4A3ZA 3H1YA 3H42B 3M2MA 4XBNA 1UNBA 5DG1A 4CDXB 1JOPA 5KC5A 1QQP2 1VBE2 2NN8A 4IEXA 3O1RA 1HV0A 4R9CA 4RR3A 5C3OA 4XFFA 2JG8B 2K46A 2PHWA 4QKBA 3B9CA 3WW2A 1F4AA 4XACA 1R081 1DQ6A 3WQ0A 2ZX0A 1LNSA 2AEZA 3BU7A 2A6WA 4XUPA 5IVBA 5GLZA 4MXWA 5A7OA 4ES8A 1PZ9A 2CU5A 2FMYA 2VH9A 3U4XA 5FFOC 1BK1A 5JI9A 3QLQA 3VD5A 5AC93 5FY7A 3AZZA 1ENQA 1MS1A 2WO3A 3FUOA 3OEBA 2HWF2 4S2GA 5FPXA 1XNDA 3APBA 4N43B 1LJ7A 4Q29A 1OLMA 2CSGA 1CAUA 1YNAA 4B4RA 1P8JA 1VAKA 4D94A 1NZIA 3OGRA 3K75B 2RM22 1LCLA 2VL4A 3O5SA 1FOD3 3SITA 4PI0A 2ZMKA 1OH4A 4LBQA 2FDKA 2GN3A 3BOWA 2D6NA 3U0ZA 1CAWB 2E7QA 1S0JA 4FPKA 1VBC2 2XL7A 3MF6A 4HVOA 4AZZA 3OYWA 4ZXKA 1XPWA 5D21A 4AFDA 3QD6A 4FOYA 4Q4Y2 2YC4A 2CWMA 2BBVA 2E9QA 2RS12 2VXRA 3MHZA 1HB3A 1W2OA 4FPFA 3ZR6A 2RMU1 1WLCA 3WW3A 2R043 4J1WA 2FZ2A 4INDA 1DBNA 1ZYBA 2CAUA 5JZGC 4DRRA 4CDUC 1AYN1 2BWAA 1O59A 3MIEA 4OZOA 2W1UA 4OZXA 1U12A 3LKJA 2Q8DA 2D40A 1PO13 3NNFA 4CCKA 3CNAA 5J09A 1W8NA 2QDNA 4QXKA 3FX3A 5JR2A 1VE0A 2QTWB 5D2AA 1HW5A 1VALA 5BNOB 1JYTA 1ASJ1 2XBO1 4OUEA 4IE5A 5FYIA 2CNAA 4AQ2A 1B35C 3PDQA 2J1RA 3FZ3A 1LGBA 4UFKA 3LDRA 3N9PA 4QX1A 2VMEA 1RB8G 1WA6X 3NV1A 4HLTA 4FP3A 2Y8KA 2JE7A 2R072 1XSRA 2VXJA 4I30A 4BLJA 2QCSB 3VZJA 5JMCA 2CL2A 3PMSA 5JOWA 4M3CB 3VB9A 1RL3A 5K0UA 1WLTA 2F4PA 4COZA 4QPYA 2DCZA 4MGQA 1ZA4A 1SLCA 5BNNB 3IMMA 1YEWA 2JXAA 3BTYA 1G9FA 2PN5A 1GZCA 1NCQC 2QVSB 1K5JA 3VBRA 2UY9A 5FR3A 5C4WA 5I8YA 3DYMA 1HN1A 2ZCWA 4MSVA 1WCDJ 4IESA 3NQHA 4XDPA 2IXHA 4IEVA 3QCWA 2EICA 3BODA 4H14A 4QGLA 3GZEA 5KXBA 2Q8CA 1PGL1 2WC2A 1OQ1A 3K3OA 2ORZA 1WLWA 2RG4A 3U10A 3VGIA 3ZFFA 5T50A 5A3WA 4RQPC 3NMBA 5G05L 3RWKX 1WW6A 1US2A 1EAH2 2ILMA 2DYCA 2DUQA 2W0XA 4G3YC 2WT1A 1FYUA 4KMQA 2DURA 1JS9A 1O4YA 3DN7A 4KWKA 1LESA 2RS32 2XJTA 3HNBM 3K4DA 1J1TA 3R0RA 4F7ZA 2ETEA 5A3NA 1VRH3 2WDBA 1KXGA 3GHNA 1RTVA 5J37A 1UIKA 2VTXJ 1GMMA 3MI8A 4WBBA 3RZLA 4WZFA 3TOJA 4EJRA 1LB2A 2B39A 2ZZJA 1QJX1 2QQKA 3J8F3 2A70A 2ZX4A 1RUD1 3AZWA 1UF2C 1YIPA 2WNVA 3OY8A 3WDUA 1RUE2 3GXUA 3KZ4C 1GOGA 4Q1PA 3TB0A 5A1FA 1HV1A 4M4RA 1UU5A 1J3QA 3SQOA 4CU7A 2PQQA 3V0BB 1UY4A 4ZKTB 2QQOA 1SZBA 5KHGA 4IQPA 3MIHA 1AHSA 2LW8A 4CP1A 2WT0A 3VV1A 3HT2A 4QPGA 5C3QA 4NWWA 5A1LA 4WVZA 3TWIA 1WCSA 2MHFA 1C8M3 4XDOA 1DZQA 2HH9A 2XQXA 3IAQA 4LO7A 4N7UA 3U1XA 3ZFEA 1NT0A 1OA2A 4RS5B 3S57A 2JB8A 3ECQA 3ZIXA 2GSYA 4LBJA 1W3VA 3S6PA 3KT4A 4B7EA 1ULFA 4JDNA 4F8AA 3I49A 2OQ6A 4KQ7A 3LEKA 4CCDA 2DVAA 2W1QA 3N7MA 3FC0A 4Q4X2 3T2OA 2FDFA 4IW3A 4NHKA 2C9AA 3RYKA 4Q4V3 5F6KA 2YXSA 3ZYJB 4BOWA 3AFGA 4AL9A 3P3PA 4XAAA 3HPNA 1YWKA 2UWCA 2B9UA 1LTEA 4AFMA 4GA9A 4KWLA 1GZWA 5K8SA 5LK7B 1K3IA 3USSA 4YFWA 3M3IA 4XFBA 4NHLA 3ZOIA 5M0TA 3B69A 4D6RA 4IERA 4E27A 2V5DA 5CFDC 1CZTA 2ZX2A 3B93A 1LHVA 3EQEA 3A22A 2YDEA 4GZ9A 4NRPA 1HRI3 2Y6LA 4Y3OA 3IDCB 3U37A 1H8TB 4GB32 5LZ6A 5FZ6A 3AP5A 2VZUA 2V4AA 3BCWA 2ZGPA 1Y9MA 3MIBA 2ZOEB 2GP3A 1FPN2 1KJRA 1GOFA 2JKBA 1YIFA 2WFF2 4FAGA 1O4ZA 2G9ZA 2GC0A 1XE0A 3G7DA 4M3CF 5BNOC 1O5LA 1PHMA 4AHZA 4CEWB 1LODA 2JJ6A 4M4PA 2WQ8A 5FYBA 1ULOA 5JSPA 1AR63 3LFIA 4JC1A 4B1LA 5C8CB 5FZEA 2I45A 1AR73 1BBT1 1TME1 4AEDA 5A7WB 4QM8A 2IFWA 2QQMA 4D8MA 1JUIA 3LIHA 2AEYA 2W92A 3FMGA 4HONA 5JI7A 3OBRA 2VNOA 1WCKA 2ORXA 3FJSA 1MS8A 2F4LA 4OHXA 4DZGA 4GH4B 1O8SA 4YVWA 1ND2A 5LRRA 3DPRB 2OKXA 4LO6B 1GNZA 4MYEA 1CZSA 4BQ1A 4OVEA 2P2KA 1V6OA 2ARAA 4Q5OA 3KF3A 1DYPA 2Y6GA 4HK9A 3HN1A 3E1F1 1AX1A 3Q8FA 4Y26A 3BN6A 4LT5A 4QHOA 4JHTA 3UYJA 4CEYB 2XWBB 3GBWA 4BH9A 3W21A 3ZDVA 5FZ8A 1R1A1 3D4KA 3H9AA 3NV4A 3BUCA 1GFF2 2RS52 4FQZA 3PHMA 4HK8A 1VAVA 4K8FA 2YC2A 2VR4A 3ZDSA 2VMHA 3VUOA 1X9TA 1REEA 2W2IA 2Z2SB 3KGLA 3GDBA 4JTNA 1RUJ2 3KV5A 4GJZA 4CPBD 1H2LA 4RL7A 1MVQA 1D4M2 1UW8A 3A23A 1AR91 3HR9A 4NHXA 3UL2A 1KGYA 3ZFGB 1W6QB 1YXWA 3MLJA 1W6MA 5T5LA 3UETA 2P3YA 1AR82 2R063 1EY2A 1WA4A 1ZBE1 4XF1A 3KM5A 3RQ0A 4E2QA 5HXVA 1IGOA 4NAOA 1YO8A 4UT5A 1CD3G 1QQP3 1VBE3 1VLNA 1NZCA 3AXEA 4HETA 2O8OA 1OOPB 3NV3A 3ORJA 3NL1A 2VAUA 4QU1A 2WZPP 4NHMA 2QZ2A 2Q1FA 3WV6A 4P5YA 4UAPA 4CCCA 2AH2A 2RJ2A 1MS5A 3MF9A 1WKYA 1WWYA 1AZDA 1N1VA 1WBLA 2AACA 1NA1A 2PHLA 1CZVA 3ZXEA 3T4HB 1L7LA 3NRUA 2ZX3A 1W6OB 4F3JA 5JOXA 4NROA 1W9FA 2C24A 2DFBA 2QQLA 5HCBA 3JXSA 5J3UA 2GNBA 3I2OA 4P9JA 1H2KA 3MW4A 1DGRA 4A2UA 1RC6A 1QEXA 3I2FA 3ZYPA 2ZHLA 4RS5C 1Y43B 5IVYA 4AVSA 5CADA 5HBAA 4OUSA 4IE6A 2UURA 2PHTA 1V00A 2PAEA 2RVAA 1W04A 1V6MA 5CKNA 5K0UC 4CP9A 1JYCA 4CUAA 4R4XA 2WQ4A 1CX1A 5EJ1B 1VBC3 4P02B 2TUNA 3LEIA 1CAXB 1QXRA 3VBRC 3UKTA 1LRHA 5C4WC 4CP2A 2P3KA
chains in the Genus database with same CATH topology
3VBSB 5BNQA 2RS13 1SFYA 2HWB3 4Y1XA 3ZXAC 1O3TA 1COV2 3DUIA 2AUYA 2VMIA 4HN0A 3E5XA 1H9PA 1DLLA 1W6PA 1QHDA 5D8AA 1CJDA 1Y3TA 3WLUA 5I0RA 2XGXA 2B46X 3B7MA 4AVCA 2XKOA 1C8NA 5GZDA 1O3RA 5FO7B 1A3KA 1H8TC 3H7YA 1VBB2 5KHIA 4IETA 2VVFA 1XQNA 4HSLA 2UWBA 2UWAA 4OHWA 1NG0A 1ZBA3 5J98B 1YFWA 5ACA1 2NYYA 4TYSA 2BPA2 1AR71 2HWE1 1ENXA 1GYKA 1LU2A 4CEWC 5CG8A 1UN1A 2WNVC 2JECA 4FP2A 1O3QA 4XIOA 5GLVA 3V0AB 3WCSA 3SNMA 2R073 2D97A 3LSEA 5DDJ3 4Y20B 4XFCA 4LEJA 2FZ1A 4XBQA 1MEC2 4XEZA 3AKSA 3SH4A 1C57A 2XJVA 5FMOS 3AZYA 3GF6A 4XE9A 2OVUA 1QU0A 1JUHA 1OA3A 2ZGOA 5CU1A 2NP0A 3SCFA 3DPRC 3HD8B 4QMAA 3O0VA 3BALA 1PVC1 1QGLA 2G9FA 2JX9A 3ELNA 4DRVA 4Q4W1 4Y1VA 4L9BA 3WQ1A 4BPZA 3R4UA 1RUC1 1NE4A 2R042 1D2SA 4RHV2 3UV9A 1UIJA 1CAVB 4R8HA 4HFSA 3ZMOA 2Q1ZB 2WIIB 1JXNA 4N9IA 3IMNA 5AVAA 1PO12 4B4PA 2ZGUA 4Y24A 5CFCA 1PK6B 4H7LA 2A3WA 3WG2A 2PHUA 2RS33 4IV1A 1AXYA 2D98A 3ZN4A 5L7OB 3ZFGC 2GALA 3KLSA 4MZUA 5SV8A 4HANA 4Q8LA 2D6KA 1SBEA 3USUB 1CONA 1VIWB 3RS6A 3GHMA 5T52A 1MZ6A 1RUE3 3PNAA 5I8SA 2BNNA 1KS5A 1RUG2 2ZJCA 4P9XA 3LGRA 1YI9A 1F5JA 4WVWA 3J26N 4XFHA 5BPXA 3WY6A 2YUEA 3OCPA 5JPMB 2IWGB 5KXEA 2HWF1 4S2HA 3JBG2 5JIUA 3VKFC 1ND3A 4XXAA 5ABJA 1EV12 4QQ2A 5FO9B 4XF3A 2HKXA 1PZ8A 2RM21 1IKPA 2DTWA 4GKYA 4QPIC 1U5YA 3Q9OA 2BVBA 3S30A 4V1PA 4FXKB 4Q4X3 4AQSA 5I0SA 1SLBA 4YVWC 1ND2C 1VBA2 2A6YA 4LHLA 3FLPA 4P9WA 1RJ7A 2DUPA 3KMHA 4Q4Y1 4XMIA 3KSCA 2RS11 2GC2A 1HX6A 1T6GC 4K1ZA 4MH0E 3ZXLA 4BMEA 5J36A 1VJ2A 2IXKA 2WINB 3OBTA 4G4FA 2E53A 5FMOL 4AI1A 2YV8A 4FOWA 3A0KA 1YJLA 3IDBB 1O4TA 3KB5A 2Q4SA 3WDTA 3HQXA 2W52A 3PVOA 5A3MA 4NPRA 2GH2A 4L99A 1HXS2 1MQTA 5CA6A 1X33A 3ZN6A 5JOZA 5F5QA 3AYEA 4YGCA 3VBHA 3KT1A 4ZU7A 3OD0A 5KHHA 1XU1A 2ZGQA 1FPN3 1RUF2 5EXOA 3WZ1A 3MW3A 4Q26A 5JR7B 1GQHA 2EAAA 1EP0A 3JD73 4XZPA 1QF3A 2OUHA 4YSFA 1H4HA 1S0BA 2V09A 3ZXGA 3ZSLA 1WBFA 1QMJA 1LHWA 1ZVFA 1XNCA 4PDWB 5CAZA 3ALQA 2HWD1 2VU9A 3GNEA 1KJLA 1QXJA 3JZVA 4ATEA 2GU9A 3RDIA 1RUI1 1VBD2 4JQRA 4EWEA 2VOXA 4YZ3A 3I59A 5JIAA 1OI6A 3EBRA 4FVVA 2AZ5A 4AI3A 4ISRA 2Z79A 4GWMA 2MEV1 2QQPA 4AFBA 3MFAA 1X36A 4K21A 4Z8BA 5K9YA 4GKXA 1C5HA 1H2NA 4XJUA 3PMEA 4L11A 2RS53 4OHZA 2R0HA 4XJZA 3WG4A 4LHKA 2TNFA 3AP6A 1EAH1 4CDUB 1BYHA 1LU1A 4AVBA 4XILA 4YM1A 1RUJ3 4AHYA 2X5IA 1S0EA 5JLVA 4UXAA 1D4M3 1DYKA 2YZ4A 1RMU2 2GZWA 2Q8OA 1QJY3 1OLQA 1AR83 4L8QA 1B35B 2HYKA 5L7OC 2OIIA 1BJQA 2Z42A 3SXWA 1C4RA 5DZGA 5C9AA 3VBFA 4JGZB 2DWRA 4P9YA 5FQ0A 1YCIA 2ZHNA 4AVAA 1UD1A 5KC6A 1AF9A 2D5HA 1J3PA 2JG9B 3IT8A 5KWRA 4FOVA 2WA4A 5A33A 4TZDA 4AK3A 1XU2A 1NOVA 1SQ4A 1ZZCA 5IK7A 2C1FA 1GBGA 1HQWA 2RR11 4SBVA 1J58A 3B3QE 4HSJA 3VZLA 1OMIA 5I91A 3SCGA 4FO9A 1O3SA 3O0XA 1D4VB 2DFCA 1YLLA 4RQPB 2ZA9A 3UJOA 3D0SA 2OYZA 5J96B 1VP6A 3MZHA 4E4DX 3BTAA 2D7FA 5CIRA 1AJKA 4F83A 1APNA 1X82A 4LLOA 2XUMA 1AYM1 1COV3 2BQPA 2Z5WA 3AMNA 1Q8OA 4WM7C 4GB31 1GANA 1W6NB 1F31A 4YW2A 4LBQD 1OFSA 5I8TA 1D2QA 2WFF1 3C3VA 5I0TA 4AGRA 2NPIA 3FLRA 1VBB3 2DUOA 2R0FA 1KDMA 3G6JB 4DFSA 4IV1C 2TEPA 3MPPG 4CRQA 4DXZA 4XFAA 4B8EA 4HKWA 4CDWB 3TRSB 1NCRA 3GBGA 1QJU2 5JPNB 3FHIB 4PDWC 2A7AA 5F9TA 3O7OA 3B9IA 1NE6A 1MEC3 4LR4A 4EROA 2WWSA 3BPZA 1I5ZA 1N1TA 1YFUA 4CDQC 4WVMA 5JSRA 4AGVA 4GMP3 4LO5B 2WA3A 1FI2A 2BWCA 4XHXA 1OQEA 2QKDA 3THPA 1TQ5A 4YGDA 3TN92 4FXGB 4L97A 1H1MA 1NQDA 5BNNA 2WKKA 1AL22 2XB6C 2HWB2 2GNDA 4IEQA 1CQ9A 4N7IA 1Q3EA 4L92A 4RHV3 5CFDB 3UKNA 1IQAA 1WUVA 1A8MA 2SBAA 4JDMA 4R9BA 3LWCA 2VUJA 2XJUA 2O0OA 1S1AA 2VG9A 1WD4A 3HMYA 4P9GA 4AYUA 4FTBA 4UBHA 1PNFA 1UX6A 4PIZA 3GYDA 3POWA 2PHXA 4FPGA 1POV3 4MGKE 2Q30A 2WS91 1LHNA 1ZBA2 4BLIA 1H9WA 1FMD2 3SH3A 2PLV2 3EO6A 4FPOB 1ZRRA 1PO21 2CGNA 2HWC2 1HKDA 2WZR2 4RR3B 2YPJA 2VECA 3KCYA 3S0MA 1H0BA 1Z7S2 2LUWA 4YVSA 5GLTA 1N47A 4JGZC 3WHTA 1RUH2 2E63A 1GKBA 5DDJ2 1RUG3 4W6WA 4AWDA 1QH6A 2LALA 3MIGA 2JG9C 4MXWB 1ZNPA 3ZVXA 3THTA 3M4FA 4IEOA 4YG3A 4QD2A 3JBG3 5FLHA 2FBEA 5LEKA 1EV13 2AREA 2ZZQA 3IM0A 5K7PA 1YI7A 4XF9A 5FAXA 1CAUB 4KWJA 4HN1A 3E6CC 1N1SA 3H1WA 3ILRA 4LBQB 3V64A 3O0WA 1VBA3 3VBOA 3MYXA 2UU8A 1DQ2A 1H2MA 3OYWB 3UJQA 2WNUA 1ZZBA 1SBFA 3DGTA 3NWKA 4JAAA 2CGOA 4OHVA 1RVF1 2ZGRA 1OSGA 4JRAA 3ZYGA 4LA3A 4I01A 1G86A 4UW6A 4YZ2A 2ZPXA 3CF6E 3I4IA 4Y1UA 1CJPA 2QNKA 1KD7A 1HXS3 1CVNA 3HAGA 1NYWA 2VW1A 2XLGA 2GN7A 2X5IC 4AEMA 1RUF3 1V6KA 3JB4C 4Y4YA 2DTYA 5GALA 4PLNA 1CESA 3CJIA 4A7ZA 5AC91 4FOQA 1U5IA 2JENA 2R1DA 2XVGA 4B29A 1HRV3 5HCAA 2ZKNA 3WX5A 3VBFC 3AYDA 5JOYA 4MX3A 4CDWC 4RGGA 2ZKLA 5FBZA 2PAMA 1FOD1 4IV3A 3L9JT 3URFA 5K0UB 4H3WA 1S0IA 3ZSKA 3VLBB 1VBD3 3GZAA 4FAHA 1RUNA 2GMPA 4X8PA 3E5UA 3VBRB 1F8VA 4ASMB 5C4WB 1PIV2 4PIYA 2R041 1IS4A 3M8LA 4Q0UA 3B94A 2O8QA 2XHKA 1ULGA 3ENRA 3IDEA 4DPNA 2E6VA 3VN4A 2JE9A 1BEV2 2H0VA 2H0BA 4H7MA 4XFIA 3ZFFB 1PO11 3SLIA 2G9GA 4QT6A 2BFUS 3H1MA 1FAYA 2EXIA 3H8UA 4AEJA 3VBUC 3LA7A 1RMU3 2MNGA 3QBQA 3VDDA 2I2SA 1JHNA 3MLKA 3JD72 1PGW1 3OY8B 4HKLA 2WNVB 1LEDA 1F9KA 3S7IA 2VW0A 4Q1RA 1W6QA 3UK9A 3WDVA 3ATGA 3AZXA 4RR3C 2D43A 2VUAA 4FBFA 4DMIA 5D1IA 4NWVA 5CVRA 2Y38A 4OI1A 4RGAA 2UY8A 1XXNA 1YFXA 3RJ2X 5EJ3A 3ZFEB 1RJ8A 5FCCA 3VHPA 4K1YA 1PMIA 3BIWE 3NKTA 3MDPA 3V65A 3VZMA 5J48A 3MEPA 1OQDA 1R082 4BA6A 1Z0HA 3KD4A 3ZIWA 1BKZA 2YC0A 3S7EA 2W39A 2UYBA 3LOBA 1CPMA 1XYPA 3FE5A 3ILNA 4B3NA 3SMHA 3RI9A 1O5UA 4QGNA 4UBGA 1GZWB 2D93A 3M7AA 3L2YA 4R9DA 5IK4A 3R4DB 1VRH1 4M0HA 3E5QA 2AGSA 5IUQA 2BNMA 4QM9A 5T5JA 3J8F1 1QJY2 3N36A 3CLPA 1LECA 1GSLA 1MZEA 3VBSA 3ZSJA 4C0HA 3M3OA 2RMU2 1DGWA 3H7JA 3DF0A 2BEOA 1SLAA 2ZHKA 2ZABA 1C8M1 5DUXA 4IEYA 3I8TA 4OLLA 4AEDB 2NM1A 1NY71 4AEKA 5LRSA 1DGWX 4D7YA 1QWRA 4UW3A 5DUVA 4EV0A 4Q0PA 4Q0VA 4QPIB 1AUYA 4HVQA 1CN1A 5FTTC 1UPIA 1QJU3 2BUKA 1ASJ2 2WLPA 1K5MA 1RHI3 4LE3A 4Q4V1 4E4ZA 5KHKA 1JN2P 3OF1A 3WG3A 2DCJA 1FV2A 4YVWB 1ND2B 1QDOA 1WMEA 4YG0A 2ET7A 1N3OA 1ZZ6A 1OLRA 2RJLA 1G8WA 4FPEA 1FT9A 4PBOA 3VZOA 3RZZA 3TN93 2EXJA 4AQTA 4EN7B 4A7YA 3MW2A 4LBLA 4MVTA 4XYXA 1AL23 2EF6A 1ZM1A 1HRI1 4I2OA 1YUDA 3WP6A 4Z82A 4K9SA 3NO8A 3NVCA 3ZFFC 3W9AA 5FREA 4Q27A 1CAVA 3AYAA 1ZRFA 1SCRA 2X29A 4LUMA 4N53A 3N7JA 1V9U3 1PGL2 4E2SA 4NN0A 1W6MB 1UKRA 1AR61 1FMD3 2PLV3 1WD3A 1DU3D 3R05A 3WHUA 5BYNA 2GC1A 4JGYA 2HWC3 4M01A 2WZR3 2CY6A 1SLLA 3RYPA 1VR3A 1KS4A 1Z7S3 1I1EA 1WGPA 1RUH3 1SDWA 3JB8A 3USUA 3AMPA 1NA1B 2F6BA 2WJSA 1MVEA 1QJX2 4HVRA 3JCIA 4QPGC 5KXCA 4I0BA 2R6QA 3ZFEC 2A75A 1H1AA 2A6VA 3A4UA 3ZSMA 1G9BA 4KBBA 4IV3C 2VQ0A 3FBMA 4WM8A 1FNYA 3ZYIB 4LBMA 2W68A 4LBKA 3N7KA 4YW1A 2Q5TA 1G7YA 5T54A 5CBLA 3OGGA 4YM2A 3L2HA 4M00A 4MGYE 4BE3A 5GZGA 3AB0A 3AP7A 1DQ5A 2R061 4R4ZA 4W6YA 4KG8A 1W6PB 3RMYA 5D8AB 1QQP1 1VBE1 2VPVA 2E7TA 2Z69A 4YW5A 2D3SA 4XHBA 4WV8A 2XWJB 1G9DA 3DKWA 1YJKA 2WT2A 2N7GA 1LKNA 3FUQA 1RITA 1U0AA 2D6PA 2FHRA 4D3WA 1M4WA 2R49A 1R093 4HPKA 4E9KA 3D8CA 2GDFA 2GMMA 3WP4A 3QOPA 4AEDC 2CTVA 3V56A 5A32A 3NAPA 2KA3A 4FPYA 2XLAA 3IPVB 4B7KA 4ZU4A 1BVP1 1VBC1 4XPVA 5EFUA 3LB9A 1BBT2 1TME2 2NQYA 3WW1A 3VHOA 3AJYA 1QOTA 2HWB1 1S55A 1PIV3 2ERFA 4XF4A 5KXDA 4U36A 1EPWA 3NSTA 4D7TA 2V5YA 4YZ4A 3EHKA 3IKWA 1TMF3 1L3JA 4WM7B 1BEV3 3GZTB 1C1LA 2OA2A 3INAA 4P14A 4KNCA 4PJYA 3RI8A 5C6CA 1HQNA 1H1IA 3ZXFA 1D0HA 1S0FA 1X8EA 2XJRA 1ZBA1 2H6CA 5GLWA 3T2TA 5JZGA 3IBMA 4LO8A 2ZAAA 4IV1B 4I0AA 3VKNA 1Q8SA 4YARA 3WP3A 4FPLA 4COVA 1DGLA 2D3PA 4EWAA 4AVTA 5T3NA 2WLQA 2R071 1HRV2 1QY4A 2D3RA 3C2UA 4NOTA 5DDJ1 4ZU5A 4YFZA 4GXLA 1AR92 3J9SA 5E16A 2DV9A 1BQPA 1KDKA 1AX0A 4OHYA 4XQDA 1ZBE2 4LUKA 4CDQB 1NA1C 4ITCA 1VAMA 4DNYA 3OTFA 3CJXA 2Y0OA 5ABJB 2P3IA 4Y22A 3ME2A 1C3HA 2WFPA 1R083 2YY1A 2X53S 3R6SA 3JU9A 1CPNA 4HBNA 1NCQA 4IEUA 3LA2A 1W0OA 2EAKA 3WNXA 4IEZA 1D0GA 5T5OA 2DVGA 4GALA 4XIKA 1IPJA 1OD5A 5GZFA 1DDLA 4L2NA 4MUVA 2IXIA 1CIWA 1TEIA 2RS31 3RMXA 4SLIA 4RQPA 1UU6A 4K40A 1R1ZA 1S2BA 1OA4A 2QZ3A 2A6XA 5D8AC 3RPQA 3RG0A 1MQTB 1RUE1 1PVXA 3ZN6B 1IS3A 3VBHB 2RMU3 4P5HA 5BNPA 2K2SA 3LA3A 3AK0A 4CDXA 1AYN3 1Q43A 2JG8A 2YYOA 2GNTA 3EJKA 1UZYA 4YYOA 4JGYC 1V6JA 1OHFA 1V6LA 1YYNA 1LHOA 2ZMLA 3T1MA 2E51A 2OPKA 3B00A 1AXKA 2VNGA 3IIAA 4Q4X1 5ACA2 1ASJ3 3N3HA 2HWE2 4XETA 3VZKA 3VHRA 3FLTA 4XJAA 2WNEA 4MV2A 4RD7A 3I59B 3D6EA 3VKOA 4YZ5A 2B8MA 2CAVA 4DY3A 4N43A 4D69A 1MACA 1KFUL 5E1RA 3ZX7A 3LCPA 4AHXA 3FBYA 2YGMA 1HLCA 4Y5Z0 4QQPA 3OPZA 3MICA 3TNPB 1J3RA 3KT7A 1CAWA 4I09A 1ONAA 1O91A 2VNRA 1BMV2 2UYAA 1KITA 2ZAHA 3AMMA 1BXHA 1PVC2 1DFQA 2GAUA 1JH5A 2QDRA 1NQJA 2YGLA 2CYFA 4YG6A 1Q8VA 3ACLA 5CFDA 1FPN1 2HEWF 2ZGTA 4Q4W2 4AQ6A 2MPFA 2X5IB 1RUC2 5DUWA 5CFCC 1XYNA 3MIFA 3U11A 4GWNA 4PF5A 3JD71 1GNHA 4AW7A 1UZZA 4UW5A 4N90A 3NKGA 4DOUA 1FXZA 4OI4A 2CGPA 4JRLA 3X29B 5C9AB 3VBFB 4QX5A 1EYBA 3FWEA 4R9AA 2FMDA 5FQ0B 5BNOA 1DG6A 3W58A 1DQ1A 3PVNA 3VKMA 1AXZA 1RHI2 2ZGMA 5A33B 2TBVA 2X8KA 2VQAA 1QJX3 3AFKA 5H9QA 3AKRA 3DV8A 1RUD3 4FPCA 4D7SA 1ND3C 3LZZA 2GH8A 5DG2A 5ABJC 4M3CA 4FPJA 4AG4A 2OZJA 3M70A 3NAPC 1GQGA 2RS51 2OZ6A 4X8NA 5GJ6A 4XW3A 1I9RA 3H3UA 2OW4A 3WW4A 5FLJA 1XRUA 4OI2A 1XE8A 3ES4A 4C1XA 2IXJA 1RUJ1 1DIWA 4K3UA 5FRAA 2QE3A 1D4M1 3LAGA 5CG9A 3MIDA 3OD4A 1QJY1 3E6DA 3P3NA 3WG1A 2R32A 3LSDA 1AR81 1REDA 1O7FA 2EALA 1V9U2 3VBUB 2AYHA 2XL9A 3WUCA 2JEMA 3CU7A 2DVFA 3AKTA 4PCRA 1X50A 2W08A 1MQTC 2PAKA 2XJPA 5DXDA 4BIOA 1HQLA 1YHFA 2ENRA 2I07B 4O9GA 4RFT0 3VBHC 1G9CA 4Z07A 5F6LB 3GZUC 1PZ7A 4OFGA 3HT1A 2VGDA 1KFXL 1MS3A 4W6XA 3ZPYA 4YZ1A 2P17A 3M3EA 2EA7A 1V6NA 4AXOA 4KU7A 3V0BA 1NCRB 2EVXA 3RWNA 5JDBA 2CV6A 1QOOA 4YGBA 1IPKA 1UL9A 4QQLA 3FFZA 3RRDA 1Q8QA 5F1RA 4I02A 2P3JA 1QDCA 3M3QA 4WVMB 4WZCA 4RS5A 1IS6A 4FTEA 4IEWA 1RGSA 1BBT3 1TME3 1XNBA 3ZO0B 1N3QA 3WXPA 4ASLA 2ZTNA 4IEPA 3VL9A 1WMFA 2HWD2 3PJYA 4M0NA 3ZXJA 2DU0A 4CTEA 2ZBJA 2DCTA 2CWSA 1COV1 4AI8A 1RUI2 3ASIA 5J7MA 5IK5A 4CYDA 4BIFA 1C5IA 3BOPA 4XJ9A 1SEFA 4XJ8A 3RYRA 2Q0AA 2D6MA 3MPBA 3ZSEA 2BTVC 1CGPA 1MS4A 1HIXA 2MEV2 3N4MA 4LO4B 5IK8A 2ET1A 3RNSA 1VBB1 1JYIA 1BVVA 1ENSA 4JV4A 1PNGA 1UMZA 2R1BA 4KGQA 4CZSA 1AJOA 3OGJA 1R1A3 1SFNA 4LA2A 1X8MA 1JW6A 3MLLA 4LE4A 1H8TA 3ILFA 2C5DA 5BV6A 3J4UH 1QNYA 1R092 4ONUA 3N35A 5L73A 3KCCA 1WW7A 5GZEA 4ES9A 4I3PA 5C9AC 4YVSB 5E88A 5BNPC 4MGIE 1N1YA 1AR93 4M3CE 1MEC1 2IZWA 4CEWA 1GV9A 4JTOA 2WSUA 2NLRA 3ES1A 4CDXC 1ZBE3 4LULA 5C8CA 4GMP1 3B02A 2HJIA 2JG8C 1LOBA 3WT3A 4HL0A 4CP0A 4OI0A 1MS0A 2VULA 1UU4A 3VL8A 1E57A 1J1LA 1DQ4A 4GH4A 4BHPA 1Y7BA 2IC1A 4RHV1 3O14A 3DPRA 4PLOA 3HBZA 1WLDA 4E4SA 5E8AA 1TMF2 2AR6A 2B5HA 4G9SB 3U07A 4Z92B 1H8VA 3VBOB 1U5ZA 4N43C 5JVVA 4H55A 2WNUB 4X6RB 4CEYA 1URXA 2VMGA 2RR12 4FSJA 1QH7A 4META 1QXPA 1POV1 4ATFA 5LEJA 2G4IA 1SBDA 3PLQA 4P9IA 1X7NA 2ZGNA 2K0GA 1YRZA 3ZFGA 5DZEA 1FATA 1RUG1 2VY0A 3RJRA 4JDOA 1AYM2 1MZ5A 4GQ7A 3IWZA 3AMQA 3WDWA 3JBG1 3ZYRA 3CJIB 4QPGB 2JDZA 1OOPA 2C0ZA 1S0GA 1EV11 1I6XA 2YMZA 2DVBA 1B09A 2VW2A 1OFNA 3H3ZA 1NCRC 3WVJA 4I0WB 5AFBA 1V70A 2ZGSA 4IV3B 5T5PA 2A3XA 1ZREA 5ACA3 4XXPA 4EN6B 1ZZ7A 1RINA 5FDBA 1W6OA 2HWE3 1NLSA 1UAIA 1VBA1 4AVVA 3CL1A 1S2KA 3SCHA 2XLFA 4QPIA 2QUOA 3AYCA 4IL7A 4NO4A 1SLIA 4AI0A 4Z1VA 1ULDA 5H9SA 5BUVA 2P34A 2AENA 4HMZA 4AFCA 1EPZA 1LOGA 3PVBB 1DZTA 5BNNC 4COWA 1GR3A 3POSA 4Q0QA 3POYA 4QQOA 4DS0A 5GKAC 2A71A 2JICA 2ZX1A 1W0PA 2PFWA 1IKQA 1CAXA 1HXS1 1REFA 2ARBA 3TBDA 2NMOA 2WL1A 2FQPA 1QKQA 1PVC3 3AX4A 1N3PA 4LHNA 3R4SA 3ZXKA 1RUF1 2H6BA 4Q4W3 1A78A 1G9AA 2XG3A 1QNWA 3AM2A 3AKQA 1H4GA 1RUC3 1F2NA 3H50A 1AX2A 4AE2A 2PELA 4Q0SA 3LOIA 4LBOA 5SV5A 4EN9B 1M06G 3M1HA 4C90A 3VDDB 4XTPA 4JCKA 3TYJA 1RUOA 1AYN2 1HRV1 4AGGA 1I3HA 2XVLA 2IXCA 4QU2A 5FOBB 2KXLA 4ORFA 2BFUL 3TNQA 3D0JA 4XF0A 2XH6A 4XBLA 1XYOA 4YVSC 2WS92 4S2FA 4GULA 4ISQA 1VBD1 4XQ4A 4Q2FA 2XBO2 2Y0IA 3JQWA 1PO22 4K6BA 1GZ9A 2PA7A 3FFQA 4COYA 3V0AA 1WMDA 1OKQA 3TAYA 2PHRA 3SHRA 4COUA 2GMEA 5DUUA 4Y20A 1LOAA 1C28A 1Y9QA 2E7AA 2PTMA 3WQ7A 1DHKB 4QHBA 2PHFA 4MXVA 3M3CA 5BY5A 3OJBA 4HZFA 1BZWA 3WDYA 4FT8A 3AP4A 3B01A 3QH6A 5T55A 2HWF3 4FPHA 4Y1ZA 1LOEA 5KBFA 1LOFA 3VBOC 3WUDA 1MR5A 2RM23 2WNUC 4EWDA 4YW3A 5C8WA 1ZRCA 1W39A 1AVBA 4NVPA 1ZX5A 2GNMA 1RMU1 1WW5A 4TSVA 1LGNA 5L36A 3I7DA 2B7YA 4J1XA 2EXKA 4W65A 1XE7A 1NLRA 2B42B 4Q4Y3 2O1QA 1DQ0A 3B5LB 4K20A 2LTNA 1BCXA 1IS5A 4J6GA 1PK6A 1RVF2 4DY5A 1ENRA 4QGMA 4XFGA 1HDKA 3AJZA 2Q1MA 4KH9A 5L7OA 5GM0A 1ZZ8A 4FQ4A 1MS9A 4B4QA 3ZMNA 2BVVA 5FPZA 3UKVA 1LHUA 3AKPA 1S0CA 3HWJA 2K9ZA 2R30A 3VHNA 1RUD2 2NZ9A 3CJIC 4GMP0 3K48A 3RSJA 1IZ3A 5DZFA 4RA0A 1NXMA 4I3GA 4XOGA 2RJKA 2YHJA 1K5MB 4C1WA 4XJWA 5C8CC 5AC92 5JAXA 4K7JA 4TWTA 3ZN5A 3WCRA 4BCUA 1JBCA 1Q56A 2D6OX 2VOVA 3AP9A 3IPVA 1FOD2 2HWD3 3KCXA 1AL0G 4GH4C 1LOCA 1BMV1 2WSVA 1RUI3 4YM0A 4Z2WA 1H30A 2I74A 2PYTA 1POV0 3ZXDA 4DQAA 4XMAA 3SH5A 4U2AA 1F5FA 3AMHA 1A6CA 4A7KA 5B2GB 2MEV3 4BM8A 1IOAA 1TNFA 4IXLA 4CEYC 4LNVA 1SLTA 3MGUA 1XNKA 2P37A 3D82A 1C1FA 4FCAA 4WM7A 4MGZE 1LEMA 5BXXA 2XPJA 4N53B 2GC3A 2HEYF 1EAH3 1ULCA 1J59A 4YW4A 3JQXA 1ULEA 3VDDC 1RIRA 2VOKA 5I0UA 4JGYB 4C0BA 3E6BA 5CB7A 1QJU1 4HT1T 2V73A 2XJQA 1RHI1 5HI0A 2OUJA 5JCTA 3E97A 3KGZA 3NJZA 2ZMNA 1Z78A 1G6NA 1PGW2 4XTMA 1ZRDA 2A5ZA 3IN9A 1OOPC 2QFEA 3D5OA 1UKGA 3NV2A 3WR0A 3PVEA 4PDWA 3TN91 4AF9A 5GZCA 4CDQA 1AL21 4BZ4A 3AZVA 4OUMA 1IHMA 4WM8B 4BWOA 1FX5A 2DCKA 2ZHMA 5A3LA 5CNAA 3A0NA 2XKPA 3BB6A 1OPMA 4LLFA 3I54A 2RR13 1V9U1 4UW4A 3WINE 2KM2A 4QQHA 3K51A 5CFCB 1SACA 3AXDA 4OULA 5AVPA 4CDUA 3NW4A 1FMD1 1R1A2 4O9EA 4TLFA 2PLV1 4P9LA 3PTYA 2ZGLA 2D6LX 4LBNA 3W59A 2HWC1 5EYYA 2NMNA 1VB2A 2WZR1 3ETQA 4RSUA 3VBSC 1Z7S1 4R52A 5I93A 3I2DA 1VRH2 2D44A 1RUH1 1U5XA 1LULA 5FOJB 5IT6A 1AYM3 1B35A 5FLIA 3J8F2 2ATFA 1S0DA 2DCYA 2ES3A 4GB33 2VVDA 1JOJA 5EV7A 3N7LA 3ST7A 2VOWA 4AHWA 4HPKB 5L19A 4JGZA 2B45X 3GBFA 2DF7A 1LR5A 2WFF3 4DB5A 1LGCA 1QOSA 3CO2A 1ND3B 4XQWA 4PBPA 2JG9A 4PQ9A 2BW8A 5A32B 4EN8B 4N9HA 4DINB 3NAPB 2DVDA 1C8M2 1KQRA 3WOGA 1SCSA 1K5MC