1YJKA

Reduced peptidylglycine alpha-hydroxylating monooxygenase (phm) in a new crystal form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
306
structure length
303
Chain Sequence
b'TIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title The Catalytic Copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also Plays a Critical Structural Role.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 65
structure length 303
sequence length 306
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yjkA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yjkA01
3MIBA 3MIHA 3MLKA 3MIGA 1YI9A 4E4ZA 1YJKA 3MIEA 1PHMA 3MIDA 1OPMA 3MLJA 1YIPA 3KS7A 1PNGA 4QHBA 4R4XA 3MICA 1YJLA 1PNFA 3PMSA 1PGSA 3MLLA 1SDWA 3MIFA 3PHMA 4R4ZA
chains in the Genus database with same CATH superfamily
1ONAA 3LKJA 1X82A 2WSVA 1SFPA 1UXXX 2VNOA 5JSPA 1OA3A 2OXBA 3ZPYA 2BWAA 2BNOA 2J1TA 2JDZA 4GAZA 1RUG3 3SQOA 3PVBB 3H1MA 1BKZA 4XF1A 5LWBA 5FZAA 4ARXA 4BYYA 1STMA 1UZVA 1C4RA 1SQ4A 1FPN3 3I54A 1RB8G 2K0GA 2W0XA 3W21A 3WW4A 4HKLA 4RHV1 3BGAA 3ZOIA 3ZKYA 3POSA 2RDNA 1DQ6A 5K0UA 2VM9A 3LOIA 5FAXA 1VBC3 4BE3A 2FHRA 5K0UB 1OQEA 1PO21 5T5PA 5FRAA 3ZLIA 4XILA 3BKZA 3ILNA 1CD3G 2XLGA 4XYXA 3RJRA 1JI6A 4ZU7A 1FATA 3VZKA 3MLKA 4TYSA 2FDFA 5IVBA 2FMYA 2VXJA 4META 2W9XA 3IAQA 1VB4A 1YJKA 3LFIA 2LUWA 2A6XA 5F39A 1AX1A 1UMHA 3V56A 3ZO0B 1LOGA 2ZKNA 3T4VA 3ZIWA 3ZSEA 1S0GA 2VCBA 1N1TA 2VQTA 1O7FA 1YIFA 4XUNA 3S0MA 4K8FA 3N3HA 1H0BA 4MX3A 4OCTA 4Z2AA 5HPOA 1JBCA 1QJX2 3OUJA 2WA4A 2WABA 4XIKA 2WN2A 1X9TA 4WM8A 5D1IA 4DUXA 3BIEA 5A3WA 1ULPA 4DS0A 4WM8B 3OEAA 2CV6A 2BGCA 3I2OA 4EN8B 4RN5A 2J1RA 3RVHA 4P14A 4N53C 1O91A 5I0SA 2HWB1 3Q8BA 3E97A 1CIWA 1R091 3I2JA 3MIGA 4YZ4A 4LBQD 3AZVA 4PJYA 4CXWA 2BEOA 2JDAA 1GWLA 4LKSA 1UU6A 5GLUA 1AR72 4C0HA 2F6BA 1D4M3 2VZUA 2RG4A 1W6QA 2WBKA 3UKVA 1GICA 2P6HA 2X09A 2AC1A 3UETA 5ANNA 1W6QB 3FBMA 4AYUA 5I0DA 1UZYA 2JDYA 3VKOA 3UYJA 4LULA 4P9XA 4XFBA 5CYYA 2XWBB 1AUYA 3A0NA 2BQPA 5GLVA 1UOJA 3SKJE 2GC2A 3ENRA 4XUQA 4QU2A 1OXCA 5A6XA 1DLLA 3DXTA 3VBFC 4DQAA 2RDSA 1LHNA 3RGBA 1UD1A 5A3PA 2FD8A 5FMOS 4Q4Y1 3VN4A 4GWMA 4FTBA 2XONA 2PELA 2JEMA 4KBBA 2RR13 1ZA4A 1RXFA 2PHTA 3IZOA 4MOAA 3O0WA 4TLGA 5IUQA 3I59A 3ZXDA 2VOXA 3PDQA 1Q5OA 3U37A 4DNYA 1OKQA 4E8DA 1R093 4CU9A 3I59B 1JN2P 1XNBA 2YMZA 4Q4W1 5AC92 1NQJA 4DOUA 1AR82 1SCRA 5A7OA 5SV8A 1LU1A 4PDWC 5J36A 3ZYPA 5IHRA 1QXPA 1DG6A 5FY1A 4W6XA 1F35A 4IW3A 5JXIA 3AP7A 4FOQA 1OA4A 3LF7A 3URFA 4ITCA 2JJ6A 4K1ZA 4M4RA 1RUJ1 2HEVF 3PUIA 1IS3A 2H6BA 3S5AA 4FPEA 1M06G 5DN2A 2GMEA 4LT5A 3I8TA 3R0RA 2AREA 4JKLA 2XVKA 1HB3A 1NKGA 2O1QA 3VKFC 1HQLA 5FDBA 5HCHA 2VXRA 1Q56A 3TEZA 2W1WA 4COUA 4ZU4A 3NMBA 2OYZA 4SBVA 2W68A 2ZX0A 3OUIA 4BQWA 4MVTA 1GZ9A 1DQ5A 2JDMA 3VB9A 1D2SA 3Q8FA 1DHKB 1JUIA 4Y1VA 2QJVA 2D7FA 2B5HA 2DCKA 5EJZB 4BCUA 2ZHLA 5FP7A 4MGIE 1PM7A 1YFXA 2VR4A 2Y6KA 5FMDA 3KT4A 4K6BA 1QXRA 3WQ0A 4D6QA 5F32A 2ZGKA 5LASA 2E9QA 1JU3A 1YCIA 1RUJ3 1YLLA 3H42B 2AEZA 1REEA 1Q3EA 3FE5A 4RS5C 5CBLA 1KJLA 1ZZ9A 3AFKA 4YYOA 2E53A 4DRRA 5A1AA 1HLCA 4NPLA 4MUVA 4BK5A 4EE2A 3VHPA 4MADA 2HWD2 2ZMNA 1V9U1 1HW5A 2VO5A 4Y1ZA 2WO7A 1OQDA 2X29A 3M8LA 1POV0 3POFA 2IC1A 5FYBA 4QKFA 2ADEA 3DN7A 4AHXA 2HWF1 3LA7A 1VAVA 3NW4A 4MV2A 1QQP3 1VMJA 4AFCA 1VBA1 4AQTA 5IVFA 4Q1PA 5IVVA 2VQUA 1CAWA 5LK5A 1CX1A 5T5JA 4JC1A 2RHPA 1YI9A 1CAWB 1SLIA 2VTXA 1MPXA 3S7EA 5BY5A 3H8RA 4AFAA 3RZZA 2R0FA 4M0NA 4UF0A 4MGQA 5E89A 2HJIA 5LBEA 4R9BA 3D0SA 5T5OA 4UF0B 3NJZA 3VDBA 1GNHA 5H9SA 1APNA 4XMIA 1WLTA 3HJRA 3A4UA 5FZMA 2TNFA 2VQ0A 3IDEA 1OLME 4GD4A 3OD4A 3SITA 2HYKA 2BW8A 2XG3A 2P1BA 3CKHA 3BOWA 4ZXKA 2SLIA 3DYOA 3LEKA 4ASKA 1PMJX 4BISA 3LOBA 3ZYHA 1F5JA 3ZX7A 1VLNA 5DMYA 2E32A 2LS6A 3WUDA 1JZ5A 4AK3A 2HWF3 3VBRC 4IQPA 4HVOA 4FI9A 4UW3A 4IL7A 4JGZA 1HV1A 3VV1A 4IERA 2X5IA 4RGKA 4JGZB 2QQKA 2X5IB 5ISLA 2Y6HA 2VZVA 1POV1 4J1XA 1SLAA 4QHOA 2EXIA 1WUVA 2KR2A 2OQ6A 4GWNA 1EP0A 4AHZA 1LTEA 2WUHA 2XJSA 2Y26A 3PTRB 3T08A 1ZRFA 3CDZB 4E4SA 5L9BA 3ZN5A 2QDRA 3MIFA 4XFGA 3THTA 3NL1A 1V6OA 5A33A 3UL2A 1C8NA 4IDZA 2R042 4M3CE 3VBUA 5A33B 1CZSA 5FY7A 3VBUB 1ODNA 1IZ3A 2TUNA 1HDKA 3LPFA 5FYTA 2DBNA 3T3YA 3WW3A 1W8TA 4OFGA 2UURA 4D7YA 3OGVA 4PBOA 3TBDA 2XJVA 4CZSA 3V0BA 4A6SA 4XTPA 3WDVA 3V0BB 1QOSA 1UX7A 4UFMA 5DUWA 3WG4A 3V0AA 3OPZA 3ACIA 2JE8A 4GH4A 4BK4A 1NXD1 1V6JA 4AR2A 5C5UA 3QACA 4QQPA 3WNKA 4ES8A 5FOBB 3V0AB 4GH4B 1ZA7A 4CSWA 5BNOA 1C57A 1DQ0A 3NNFA 4L8QA 1GZCA 2BOIA 4UBHA 4Y26A 5FZ3A 3THCA 3VKLA 5AC93 5BNOB 1JZ3A 3H50A 4HVRA 3HT2A 4B7EA 4L2NA 4XOGA 4XDOA 2XGXA 1W9WA 2PA7A 4WVZA 1MEC2 1IHMA 2QQJA 5FBZA 2DU0A 1US2A 1W3XA 3GNEA 4X8PA 1MACA 1NLQA 1PX4A 5A6QA 1K5MC 2UY9A 2DCTA 3BB6A 3VHOA 3PTYA 4L92A 1W8WA 4RQPC 1QJY2 4CCJA 1C5IA 2LROA 1H4GA 2XOMA 4K8RB 1GBGA 1W9SA 1WMXA 2OIIA 1D7PM 1LECA 2V09A 3NSTA 3QCWA 2Q8OA 3RYPA 2EXJA 3VDDA 3K4AA 4YARA 4W65A 1PZ7A 5LW9A 3QLQA 3H9AA 4FPKA 4LO4B 3VDDB 1YHFA 3GJBA 3MYXA 4BQ5A 3O1MA 2HH9A 1PGW1 1W39A 4OI4A 4B7KA 2VW1A 5JSOA 2VZ1A 4WVWA 4NMIA 3ZYGA 2AUYA 1TNRA 4HN0A 3RZKA 3U07A 1GLHA 2JB8A 3E5QA 3K48A 4HVQA 5C5TA 2IVIB 2J1UA 1T6BX 2I45A 4YM2A 5C9AA 1C1FA 1AR63 1HIXA 2XUMA 4QXCA 1GR3A 1MS9A 5C9AB 1NCRC 5FK7A 5KR7A 3RI9A 4XXPA 1EV11 2XKOA 1PIV1 2YBPA 3CF6E 5FYCA 4TXWA 2N7GA 2JD9A 1B35A 3DUIA 4SLIA 3ZMNA 5CG8A 3DYPA 3VZMA 1UIJA 1B35B 1KS4A 3I2DA 5B4XA 1W3VA 1UW8A 5IK8A 5BPXA 5D2AA 4YW1A 3WSOA 2H0BA 3C3VA 2XWJB 1LHWA 3KCYA 1ZBE1 2DWRA 2ORXA 3AZYA 5JPMB 1R081 2WR9A 2D5FA 5BNPC 4UYBA 3WQBA 2JECA 4AVAA 5JDBA 3BCWA 3N7JA 4PQ9A 4FQZA 4B4RA 1H9WA 1WBFA 2DCYA 2Y38A 4RYDA 5D8AC 4N7UA 3N4MA 4GMP1 2Z4FA 1UIKA 1AX0A 2YC2A 4F3JA 1JODA 2HYXA 3B02A 1OPOA 2AYHA 5IW0A 2GH8A 2OA2A 3Q8CA 1SFYA 5FZ6A 3VD7A 1WZXA 4L97A 1RUC2 1EV13 2DV9A 2MEV1 5AVPA 4QHZA 2GC1A 5EJ1B 2WA3A 1FOD1 2ADDA 4GIQA 4K1YA 3WV6A 5FZDA 1PO11 5LY2A 1CONA 2QQIA 3P6BA 2GMMA 1FX5A 3MDPA 4LE3A 5F9TA 3P1IA 5KHKA 3C7HA 2W87A 2ZHNA 4P9JA 4ATFA 2PAEA 1ASJ2 3DPRA 2ZCWA 3S6PA 3WNNA 4CDUC 3ACGA 5DDJ1 3DPRB 2P37A 4URTA 3LPGA 1XSQA 3B69A 3MEPA 3BVCA 5FP3A 1GNZA 4CDWA 1US3A 3K4ZA 5ANQA 2C0ZA 1XE7A 3T1LA 4CDWB 2WT1A 1JOJA 3NAPA 2Q4SA 1V6LA 4YM1A 2JE7A 1VBE1 4XXAA 3CLPA 1RUE2 3NAPB 4AQSA 4CCCA 3ABZA 1O8PA 3L2YA 3N9LA 4BIFA 4AZZA 1XC6A 4R8HA 2FDIA 2VUJA 1CAVA 3LAGA 3J26N 4BQ4A 4F8AA 1CAVB 3GCXA 3KS7A 5BNNC 5C3OA 1SDDB 5FYSA 4Q27A 5HBAA 2VNRA 3LSEA 3PVEA 4BXFA 1QDCA 5JSRA 1HRV2 1W8OA 4FT8A 4N9IA 4FQ4A 1ULFA 3DXUA 2D6MA 4RFRB 3MUY1 1XJAA 1Y43B 3B5LB 3PUHA 4BDVB 3BUCA 3KB5A 5DDJ3 5L7OA 2IXLA 2ZGTA 2O0OA 2B4KA 5C3SA 5J3UA 5L7OB 2RM23 2YFZA 1W04A 2JD4A 2BDRA 3ZKUA 1O8SA 4BMEA 5JXGA 5GLWA 1YQ5A 4D3WA 1RUF2 2F4LA 4LK6A 2DUOA 3PIGA 3C7EA 4I0BA 1KFXL 4K40A 4QDQA 1UY3A 1OLRA 3C7OA 1BLZA 2FMDA 2VCMA 3H3UA 2AEYA 3LDBA 2CY6A 2FCTA 2WKKA 3KWVA 4LBQA 3AKQA 1S0FA 1ZZ6A 3AMNA 4B1MA 1R1A2 4LBQB 3QD6A 1S2KA 2Y8KA 2XJPA 5CFCA 1A8MA 4IE4A 3M3CA 1YXWA 4P9YA 4I3PA 4AI3A 5CFCB 4RSUA 2VMHA 2BTVC 3T30A 4ZZ5A 4EWEA 4YG0A 3H3ZA 5FOJB 3FLPA 4L99A 4JAAA 1YWKA 4NPRA 3RZMA 1QDOA 4P9GA 1UL9A 3IWZA 4AHYA 2HWC1 1A3KA 1QOOA 5GALA 4CEWA 5F37A 2Q5TA 4CEWB 2WS91 4LPLA 2P5BA 3U14A 1CIYA 3HNMA 4UFKA 1VALA 2PLV1 4UT5A 4NIDA 4IEZA 2I2SA 4OZOA 4LNVA 5HXVA 1VAKA 1X7NA 1DGLA 2WAOA 3ZFGC 4EJRA 2D40A 4RL7A 4IGQA 3W59A 4XJZA 2OUJA 2PAMA 2ZGLA 1TQ5A 4PBPA 2RS52 3EB7A 2AGSA 2QQUA 3H1WA 4H2AA 2DVGA 2X53S 4HXCA 4LHSA 4FPOB 4PIYA 1QJU1 1FYUA 3OY8A 4PIXA 5FJKA 3VD3A 1GNYA 2PQSA 3OY8B 4BQ2A 3ZSMA 2UWAA 1TMF3 2CHHA 2FCVA 5IAXA 1OH3A 4QU1A 5EQUA 1WCQA 1QU0A 2QBXA 1G86A 4F7ZA 1G9CA 4CXYA 1KS5A 5LY1A 1XNDA 1W9TA 3B3QE 1RUH2 3AKSA 4DUVA 3ACHA 2HKXA 5KHHA 4LIUA 3H0OA 4JDMA 5EWSA 4YFZA 1YFWA 2WS93 1OMIA 2W1QA 1VJ2A 4QX3A 4BMBA 4Q4V1 2JB4A 3JD72 4NWWA 4XQWA 3SH4A 3TRSB 4AL9A 1U5YA 1C8M2 2ZHKA 1UY1A 5JWPA 4AI1A 1H2MA 5DXDA 1J3QA 3IT8A 4K3UA 4S2GA 4XURA 1R64A 5CA6A 1LJ7A 4CUCA 2ZX3A 5CVRA 1JS9A 5FY5A 4O9GA 1MS1A 5CFDC 1L3JA 3ES4A 1LOFA 2MPFA 5L36A 1TNFA 2R061 4GXLA 2UU8A 3KV9A 5DUVA 3AMQA 2FQPA 1OLMA 3IAPA 3MZHA 3AKPA 1NZCA 4A41A 1UXZA 2A71A 3M3IA 4QKNA 2OUHA 2ETEA 3ZSKA 4E2QA 4NHYA 4NRPA 1FV2A 1X8EA 4UI9L 1PGSA 1CX4A 3OOXA 1OOPC 3UGHA 1RITA 2I74A 4YZ3A 3AYCA 1K45A 1AYN2 5M0TA 1JHJA 1YFUA 1GQGA 1H8VA 1L7LA 1ASJ3 5F5CA 1Y7BA 4Q4X1 4AEDC 2VBPA 3WNMA 4OHYA 4ES9A 1NZIA 2Z79A 1BEV2 5J1XA 4RHV2 3MIEA 2D6PA 3NNMA 3DYMA 1BMV2 1OFNA 4N7IA 2CTVA 1MZ5A 1F4HA 3ELNA 4N9HA 2CGPA 1N3QA 1YEWA 2YPDA 1OT5A 1X33A 2ILMA 3I2HA 1W9YA 4PLOA 1QF3A 4IE0A 2ZZJA 4RFT0 1A78A 1RUI1 2VL4A 3HD8B 2OKXA 5AFBA 3UNPA 3BTYA 1RHI1 4TLFA 1OC1A 2A73B 3C7FA 1I1EA 5IYYA 4XUPA 4YVSC 3X29B 4RD7A 1SBDA 4CUBA 4CDXC 2B9UA 4MYEA 3MUZ1 3TNPB 4AI9A 5J37A 2WAAA 4JX0A 4LBOA 4YGCA 2SBAA 2VMCA 4KBZA 1JYVA 1V00A 4UXAA 2E63A 3UJOA 4LQRA 4GB32 5BNQA 2A6VA 3EQEA 4XFIA 1SHWB 4JRLA 4OVEA 5F5AA 2DYCA 2C26A 4QT6A 2YC0A 5JR7B 3A21A 4GWJA 4JV4A 2VVFA 4QX1A 5IAVA 3SH5A 5JR2A 1DIWA 1IOAA 1DGWX 2B42B 3ZYBA 4DRVA 1MS3A 3PVOA 2QKDA 4QB2A 1F8VA 5T5LA 2P3KA 4U2AA 1HRI1 3J7NA 2D98A 5ACA2 3W58A 2XJQA 2RS11 4WVMA 4C1WA 2VOTA 1QJZA 4L9BA 1WLWA 2A3YA 4WVMB 3U1XA 1DP0A 5APAA 1H2NA 1RUG1 3N36A 3ASIA 5CG9A 1SLLA 1URXA 1MVQA 3PU8A 4EN0A 3VBHA 1VBD2 1WD3A 4CDQA 5LA0A 1FPN1 1GZWA 3VBHB 4JHTA 1JZ2A 4CDQB 4DXTA 1GZWB 5JOYA 5ABJC 1IPSA 2WNOA 5E88A 1QIQA 4YWAA 3IIIA 2EA7A 4A44A 5CKNA 4NE9A 1H6YA 1VBC1 2G19A 3OPWA 1FMD1 1ZBA2 2P3IA 1RYYA 1XYNA 3AVRA 1TG7A 2W5FA 1BK1A 4IEXA 4HOOA 4Q4Y2 1SDWA 2YBSA 1V6KA 5C4WA 3DECA 3ZYJB 3OD0A 1CR7A 2HWE2 5C4WB 2BRTA 1CJPA 1E57A 5BYNA 4S2HA 3CQOA 5E8AA 3O1RA 3KLSA 1ACCA 5FBJA 1HRI3 1HN1A 4QPWA 2JG9C 1MS8A 3WG3A 2RS13 4OQ9A 1J59A 1J3PA 2BNMA 4DFSA 3I3DA 3J9SA 5FP4A 4GJZA 1J84A 4NAMA 2A1XA 2CWMA 4AGRA 1RJ8A 4UW5A 3A0KA 3U4SA 2VZTA 2R6QA 1AJKA 3KGZA 2Q8EA 2RMU2 2D93A 4YM3A 3VZJA 4Q29A 4YW6A 1UO9A 2DTWA 3AJZA 2IXHA 1KGYA 4P9LA 4YZ2A 4ZXEA 1JW6A 4R9DA 4HSLA 4QQHA 3SLIA 1FMD3 5T50A 3KZ4C 3RZLA 3FC0A 2E7TA 4FSJA 3N7MA 1DFQA 1DF0A 2JIGA 3RWNA 2W2IA 1PMIA 1D4M1 2VPVA 3J8F2 5HCBA 1VRH2 4XJUA 5IWFA 5JUVA 3TNQA 3O1SA 3W5MA 3ETPA 4A6OA 3GZTB 2XVLA 4INDA 4KWUA 1DGRN 2QQLA 3EJKA 3PJYA 3JD73 3JUUA 4WM7A 2R1DA 1UOFA 1AL22 1C8M3 4LBNA 3NVCA 5FZCA 5FZ4A 4KU8A 4WM7B 1RUD3 2E51A 3ZFEA 1K5JA 4DEVA 2W47A 3AZWA 4BIOA 3ZFEB 2YXSA 1Y9GA 2DURA 2VUAA 1PVC3 1W99A 4DY5A 4COYA 5CZKA 3U78A 2PYTA 2Y0OA 3SCHA 5CKMA 4WV8A 4QXKA 1OURA 2R1BA 3KCCA 2RR11 4X6RB 4B4PA 5A1LA 4XIOA 2DVFA 3ON7A 2D3PA 4H55A 3IN9A 4AEKA 3K51A 1LAJA 1V9U2 5DUXA 4MGSA 4NRMA 3TN92 2X5IC 1AYN3 4HSJA 2XBO3 1Q8OA 4B8EA 3RZGA 3ZM8A 4AVCA 3LIHA 4JCKA 1PGL1 1J83A 4AQ6A 2WNUC 4KI5M 4GULA 4DIQA 4FAGA 4OI0A 2ZHMA 2WZPP 3NJXA 4QGLA 1OUSA 2WJSA 3ALQA 4CUAA 1JYNA 1G9AA 4CTEA 1BEV3 1O3TA 2WNVA 5IJRA 3ZN6A 4V2VA 5JXJA 2WNVB 1YUDA 2OT7A 3RQ0A 2B45X 1O4YA 5EJ3A 3ZN6B 3O1UA 2P34A 2Y6GA 2CL2A 3U11A 2VOWA 1ZRCA 1W90A 1RIRA 1BZWA 3SKVA 2DUPA 5FZHA 1KITA 1TME2 5FZ7A 3RI8A 1V6NA 4QQ2A 5C8CA 3M1HA 5GLTA 5D21A 4CVUA 5C8CB 4BJ0A 1YIPA 3K3OA 4LO7A 4J25A 2WL1A 3C2UA 1ZX5A 1YJLA 3M3QA 4YZ1A 3UJQA 3ZN4A 3GCWA 3LIGA 1GSLA 4GB33 4XFAA 5BV6A 2BPA2 3MLLA 1F15A 3QOPA 3ZR6A 1WA6X 4Q2FA 3AP9A 2WWSA 3I3QA 4GH4C 4XVHA 1WMFA 3RFRA 3UKNA 4PCRA 3CJIC 3OGRA 4RGGA 3I3BA 5H9RA 5C33A 3G7DA 5C3RA 3H8OA 3QH7A 4R4ZA 4FFFA 1I3HA 4HPKA 2WO3A 1P8JA 1IG3A 3HQUA 4HPKB 4LKFA 4OHWA 1W28A 1G8WA 1JTZX 1W6NA 1BK0A 3B00A 1Y4WA 3WF1A 3BOPA 1W6NB 4Q0VA 4X6QB 4G9SB 4KU7A 3MV01 3J4UH 5A3MA 1A6CA 1CZVA 3O1VA 1NXMA 4OUEA 1PNFA 2NQYA 3PMEA 1LOBA 4C0BA 1NA1A 1NG0A 3S57A 2TBVA 1QQP1 1UYYA 2ORZA 3Q8EA 1VBD3 3ZXLA 5F5QA 1NA1B 1WMEA 3IM0A 3VDDC 3J7HA 4YVWC 2AH2A 5FY0A 1K12A 1RMU3 4ASLA 4D94A 4IV3A 4O9EA 5LEJA 2WWJA 3HR9A 2LW8A 2W95A 4M0HA 5F8PA 4IV3B 4N43A 3POYA 3AP4A 1CJDA 1Y3TA 3N9QA 4IV1A 4N43B 5FPZA 1ZBA3 2VE1A 2HBUA 2NMOA 2QQWA 4IV1B 4AI8A 2CDPA 1E5SA 1RTVA 3C7GA 4PQQA 5FPXA 4UFJA 2HWE3 2W94A 2NN8A 2V73A 4QDSA 1QH6A 2A3WA 5B4NA 5EHDA 5KXEA 4ORFA 1AYM2 4QPGA 4WBBA 5FYYA 2V72A 4QPGB 3BTZA 1HJFA 2A6WA 3AZXA 4QX5A 1B35C 3VZOA 1W2OA 5FY4A 1HKDA 3PHMA 3WDUA 3HAGA 5JVVA 4I09A 1CAUA 2VQAA 1KDMA 1UPIA 5T3NA 2VVEA 3N7KA 3OF1A 3ZVXA 3PIJA 1CAUB 4IGOA 5LBFA 3KVBA 5GZCA 1UYPA 4HBNA 1SEFA 3MFCA 4Y5Z0 2GALA 2FDHA 1JOBA 2OZ6A 4O7XA 1DZTA 3WX5A 2ET7A 3O14A 2BBAA 3BPSA 5DZEA 5GM0A 5B2GB 2GH2A 4NVPA 4COVA 2HEWF 4FTEA 4HT1T 3GZUC 2VZRA 2YPJA 4KGQA 3B94A 1O3QA 1HXS2 1AR71 2BP6A 3UK9A 4IEUA 2XH6A 1S2EA 3S5QA 1VRH3 4ATEA 1SZBA 2PHUA 3BU7A 1OSGA 3JBG2 4EV0A 3WG2A 1ZZ7A 4ONUA 3I49A 1LEDA 2D3RA 3VBOC 4QD2A 4AAXA 4D8MA 3IKWA 5LEKA 4HLTA 3TEXA 1W05A 4G3YC 4QGMA 1FV3A 2GNDA 1QH7A 1NAEA 2GMPA 1H30A 1QJX3 2VNVA 4GJYA 2C24A 2F4PA 2UY8A 5DAXA 3WT3A 5H9QA 3OBRA 2BBVA 1J1TA 3TEYA 2G9FA 1ZZCA 4OHZA 4XW3A 3R4UA 5BXXA 2ZGSA 3N9OA 1KFUL 2XDVA 3DPRC 3PLQA 4XCBA 4AEJA 2BNNA 1KDKA 4P00B 3CIHA 3M3OA 4JGYC 5I8YA 3M7AA 2VCCA 2RVAA 4JDOA 3R4SA 5AC91 4AVVA 4FPGA 3TN93 1AR81 1ZBE2 1AR73 1H1AA 2RJLA 3NAPC 5KC6A 4HKOA 5LBCA 2GC3A 1MQTC 3N9PA 4J6GA 4LO5B 2Q1FA 2KD7A 1V6MA 2YV8A 2PFWA 3HBZA 3SMHA 1KJRA 3BPZA 5KBFA 3WVJA 2IZWA 4FPYA 2DF7A 4IGPA 4LBLA 1VE0A 4I01A 5T55A 3BIWE 4CEYA 1S2BA 3UKTA 1DCSA 3IDAA 1FOD2 2K9ZA 4BQYA 1QJFA 4HETA 4CEYB 5FLHA 2JX9A 4LHLA 3D0JA 3L9JT 4OUSA 1OVSA 1FI2A 2Z5WA 1BBT2 1OBNA 3VBFA 4WVVA 4BQ1A 3VBFB 1NCQA 2VW0A 4KNCA 4AGGA 2XKPA 1QOTA 1FNZA 1AR61 1NCQB 1WMDA 1AR83 4L11A 4LKEA 4GALA 3BU0A 4GQ7A 4C91A 4NAOA 2WC2A 3VKMA 1VMFA 3GZAA 2XJUA 1UZZA 1DYKA 1GOGA 1LCLA 4KGGA 2ZS6B 3DL3A 4AW7A 3FWEA 1J1LA 3MPBA 3OGGA 4PDWA 4YM0A 3WG1A 5CISA 1VBE2 1XU2A 4YGBA 2QQPA 1N3OA 2Y33A 4PDWB 3N7LA 3ILFA 2EIDA 3JXSA 1VIWB 3M70A 4CRQA 2EXKA 5I8SA 3DEMA 4LUMA 1WWYA 3LEIA 4KWKA 4FTSA 2HWD1 1UZWA 2Y60A 1W06A 5FXXA 3CNAA 1DQ1A 2EXHA 3MBWA 5E6HA 1NE4A 4LIVA 5J96B 2D43A 3AXEA 3QH6A 4U36A 4XCAA 5IT6A 2RS32 2A5ZA 4JZRA 2B46X 2NM1A 1NE6A 4QAWA 4EYUA 1HX6A 4HONA 4OMDA 2J42A 3M2MA 4LXLA 1UWWA 1VBB2 5HCAA 4HL0A 1RUOA 3LEGA 2ZGUA 1X8MA 3EO6A 4FP3A 3IB3A 3WDYA 3GHMA 4DMIA 1SPPA 3ITQA 3K77A 4H3WA 1OF3A 1NY72 4ZONA 4JKKA 1LENA 2DTYA 1SPPB 2V4VA 4TSVA 4JRAA 3I97A 1HB1A 2ZMKA 2EIBA 3OBAA 5JOWA 4P02B 4LITA 2W1SA 3HMYA 4YSFA 3OEBA 3C8XA 3GYDA 2PMWB 4HK9A 2AZ5A 3CZJA 3HNBM 4OI2A 5CIRA 1AYM3 4MSVA 2CYFA 3ZXEA 2HWD3 4IE6A 4RS5A 5KXDA 3GM8A 3G6JB 2PQQA 4FFIA 4RS5B 4B29A 3EBRA 2ZOEB 2F17A 3SHRA 5T52A 2E6VA 3ACFA 3KVAA 4KMQA 4X8NA 3TAYA 3U10A 1EYBA 3WHTA 2GU9A 3O0VA 3E1F1 1H9PA 3O12A 1U0AA 2IWGB 2PXJA 4OHXA 3SC7X 3MV11 1COV2 1ULDA 2O8OA 1CPNA 1YO8A 2Q1MA 2X8KA 4EN7B 3F2ZA 4LORA 3IDBB 5K9YA 2HEYF 5HCFA 1IKPA 4FOWA 5FPVA 1UMIA 4KQ7A 4IETA 5JLVA 1HXS3 4QPYA 4YRDA 3AL5A 5C3PA 2G1MA 4BH9A 4LHKA 2A6ZA 2E7QA 3T2OA 1VP6A 4XBLA 2QQOA 1LOFC 5F3GA 2VY0A 2NYYA 5I8TA 3WP5A 5GZEA 2XL7A 5LA9A 4XMAA 4FP2A 2YDEA 4QQLA 5FZBA 4DXRA 4DXSA 1BHGA 1SFNA 3KM5A 2DFBA 1UKGA 1Y9QA 4Q0SA 2ZAHA 1LEMA 1S0EA 4QKDA 2WFF2 3MPPG 2RM21 2W46A 3POEA 4XJ9A 4QPIA 4A42A 3ZFFA 1GANA 4NIHA 4QPIB 4PF1A 4K9SA 4LE4A 1ULEA 2VNGA 3ZFFB 1XNAA 1CN1A 3VBRA 2JENA 1VR3A 5DQ0A 3VD5A 2ZEYA 3ZDVA 3VBRB 2ZMLA 2CGNA 3FJSA 2ZA9A 2WQZC 1ND3A 3POJA 4P9IA 1Z7S2 3P3PA 3R4DB 1S0BA 1GFF2 1LGNA 4LLFA 4Y1XA 1JZ4A 1ND3B 1ULGA 5EXOA 4OZXA 2Q8DA 1XQNA 2UYBA 3GBFA 4Q4V2 3ZXAC 5DAWA 2Y34A 2GP3A 5C6CA 4UW6A 1LULA 5FO8B 2LM3A 3KQRA 2R043 5FY8A 2VC9A 2VVDA 3CHXA 3ACLA 3GDBA 4BQXA 1VAMA 3WCRA 4QX2A 3LA2A 4AFBA 5FIXA 4F83A 1QJY1 2WZR2 3S7IA 4QB6A 1O6UA 2JIJA 5FK8A 3AX4A 1EUUA 1YQ8A 3JZVA 3OTFA 1OD5A 3WQ1A 4DEQA 2VCAA 3HQRA 2CAUA 2JXAA 3LZZA 3A22A 1REDA 3MIDA 4LUKA 2UWBA 3I4IA 4W6WA 4YGEA 1BJQA 1N1SA 2P6CA 2PTMA 3HN1A 1EAH2 1RXGA 4ARYA 2YGMA 2EF6A 1KEXA 4I0AA 2GSYA 2QTWB 2ZEXA 3V65A 4Y5TA 1GWMA 4IEWA 5K8SA 1AVBA 4PHZA 1ENXA 1RVF2 4Q4X2 3T0AA 3KGLA 3FFQA 5FZFA 3ZSJA 1MEC3 2R072 1I6XA 3ME2A 4YLZA 5I0UA 2B9VA 2Q8CA 1GV9A 3RZHA 3CU7A 3ZR5A 1TMF1 4A7YA 2PN5A 4XZUG 4XQ4A 3VL8A 3B01A 1GMMA 1QJY3 4KWLA 1YNAA 1RUI2 1K5MA 2WYSA 4YZ5A 1SMVA 1F31A 2GN3A 1K5MB 1UCXA 3MLJA 4XDPA 4RQPA 2VMGA 4NR1A 1YQCA 2J7MA 4RQPB 4BOWA 5JZGC 1LHOA 3RYKA 1AR92 3EMRA 1ZM1A 2ARCA 2VOVA 2ZBJA 1QJEA 2RS33 3KT1A 4JTOA 3WOGA 3ZXFA 4CU6A 2AENA 4NROA 4ET7A 1UU5A 1JZ7A 2G9ZA 1MZ6A 1V0AA 3NKGA 3HVDA 5E1RA 1VBB3 3MI8A 3TB0A 2Q30A 3MIBA 2EIGA 4ZY9A 4DPNA 1W8UA 2CGOA 1RUC1 2VW2A 4XUTA 3POIA 4XUOA 4D6RA 4TTGA 1UNBA 4K20A 5EFUA 3O5SA 4FPHA 4V1PA 2O14A 4QM8A 5FZ9A 1X50A 4NUBA 3HN3A 4XHXA 1OVPA 3FHIB 2VU9A 1NCRA 4OQ8A 4Z92B 5EZWA 3RMYA 2ES3A 1NCRB 2ZX4A 4AQ2A 1HB4A 4FFHA 1Q8VA 4P5HA 5FPAA 2OS2A 1R1ZA 2WN3A 3WP3A 5LRSA 3ZYRA 4D7TA 2ZABA 4FPCA 2WLQA 4CYDA 5FPLA 1ASJ1 1W2TA 4LHNA 2FBEA 5FUPA 2Z69A 4LA3A 5K0UC 3AYEA 4MGTA 3I3MA 1NOVA 3P3NA 1VMHA 5FZOA 4AE2A 2ARBA 4O65A 2BJSA 3JU9A 4FOYA 5FZOB 4DXZA 2QDNA 2BGOA 1HV0A 1JYTA 1AJOA 5BNPA 1LGCA 1PK6A 1OF4A 1COV3 2NLRA 3LSDA 5BNPB 1RUE1 1NT0A 1UU4A 1PK6B 4NWVA 4XFCA 4CP1A 1RUC3 1KXGA 3KSCA 1W6OA 3RG0A 3RSJA 1PNGA 1TE1B 3VDCA 1AF9A 1W6OB 5FYHA 2CWSA 2ZGPA 3ZSLA 2JG8A 4Z82A 4CCNA 1JOPA 3OGSA 1FT9A 2JG8B 2FZ2A 3GBGA 2YYOA 4NO4A 4XBQA 3OBTA 2X05A 3RS6A 4XJAA 2Q0AA 3WDXA 4P5YA 4WM8C 2DCJA 4XF0A 4DZGA 1J58A 1PZ9A 2VD7A 5C71A 1HRV1 2QNKA 4WZFA 4IEQA 3MIHA 5FMCA 3SEPA 1Q8PA 1O4ZA 2E26A 5FWJA 4J1WA 2WFF3 3PJQA 3HOBA 2VZSA 3VDAA 1N47A 3K75B 3CO2A 2ZAAA 3KT7A 3SCFA 4DY3A 1LKNA 1YYNA 4CDUA 1EPZA 1RUF1 4Z2WA 3H1YA 1PO22 2XB6C 3EHKA 4CDUB 2NP0A 3VD9A 1RUE3 3I2FA 4BU2A 2FDGA 2GAUA 1GQHA 2VMEA 1KRIA 3GF6A 4XQDA 5F5IA 5FXWA 5A3OA 4LOSA 3T4HB 4NHMA 1UAIA 4A3ZA 1Z7S3 2I07B 4KG0A 2VULA 1HN0A 1YC61 2FZ1A 3PUQA 4OHVA 5L9RA 3PUSA 3KD4A 1R1A1 4A7ZA 5KWRA 3ES1A 3ZMOA 1W8HA 3E5UA 3CBNA 5J7MA 3D82A 4JVAA 1LU2A 2UYAA 3OYWA 1H1MA 1HRV3 2WRAA 4XFHA 2ENRA 4CP2A 5LATA 3VBSA 4CPBD 3OYWB 4EZ4A 3WD5A 5JCTA 1JU4A 2WZR3 5DG2A 3MO4A 1PZ8A 3VBSB 5J09A 2ARAA 1WLDA 1UZ0A 3NWKA 4YGDA 3W20A 3WF4A 5F3EA 1WKYA 3SNMA 5I0TA 2D6LX 3W5NA 4JKMA 1KQRA 2WQ4A 1BXHA 2OQ7A 1RUF3 1CWPA 3T2PA 1OFSA 5FJHA 5IVEA 2HWB2 1IS5A 1A8DA 1NYWA 1R092 4OUMA 4CU8A 1ENQA 1EAH3 2CNAA 3ZXJA 3H8XA 1CPMA 3AZZA 2J1AA 3KV4A 3PNAA 3P5BA 2IUWA 2JDKA 4H7MA 1D2QA 3NO8A 2D44A 2XPJA 1RVF3 4AVTA 1R1A3 4ZZ8A 1AX2A 3DKWA 5C70A 2R073 3D5OA 4AF9A 5F2WA 1I5PA 4NRQA 2DCZA 4UFLA 5FZGA 2XLAA 2ZGQA 3GZEA 2WFPA 4WZCA 1GP5A 4FAHA 3TOJA 4BLIA 5A3LA 1GU3A 3WR0A 4A2UA 1RJ7A 1ALYA 2J1SA 3FL7A 3O1OA 3FUOA 4D69A 3HBKA 4CE8A 4A45A 4Y24A 2NZ9A 5CNAA 1RUH1 4QX7A 1GP6A 2AR6A 4BQ3A 4LK7A 5IK5A 3UGGA 3THPA 2W91A 3MF9A 1UX6A 4MGKE 4N43C 1H2LA 1ST8A 1Z0HA 1AR93 2EALA 3BODA 3JD71 4Q4W2 5GLZA 1W6PA 3POBA 3AKTA 1C8M1 3DF0A 1G6NA 2PHXA 1W6PB 1RUD1 3FN9A 2VUDA 1WW5A 3KHBA 2RS53 2ARXA 5FKBA 3ZFGA 1PVC1 1IPJA 3F95A 1RUJ2 1AL0G 2YGLA 4NN0A 2ZJCA 3ZFGB 5HI0A 5GZDA 3WNLA 4NJ4A 4Q8KA 2QE3A 2QQNA 3AMHA 2C1FA 4MHUA 4OULA 1OH4A 5C7GA 3APBA 5IVJA 4QKBA 4BA6A 4EWDA 3O0XA 3AYAA 1JYIA 4IEVA 4Z1VA 3E5XA 4BPZA 1IS4A 2ID4A 4Y4RA 2CAVA 3I3EA 5IATA 3BTAA 3VLBB 1AYN1 3N9NA 2XBO1 1RUH3 1OQ1A 5DUUA 3WXPA 2A7AA 2DVBA 3JB8A 4FPLA 4K21A 1QQP2 3WW2A 1BEV1 2EICA 4IEYA 5FO7B 1C28A 3CL1A 2MHFA 1BMV1 5LA2A 4QQOA 1BCXA 1D0HA 1LRHA 1XPWA 4AGVA 5GZFA 2WZ8A 3VKNA 4G4FA 2Y6JA 4R9AA 3WINE 1SCSA 2RJ2A 4ISQA 1AXYA 2ZGNA 4ZS2A 5FTTC 3VHRA 1OUXA 4D7SA 5FMOL 4Y20A 1GWKA 4FVVA 5EV7A 4XF3A 1C5HA 4Y20B 3I7DA 4CCDA 5CFDA 5ERLA 5FWEA 1PX3A 1XNTA 4PI0A 2XR4A 1CVNA 1YQ2A 3KF3A 5CFDB 4JGZC 5FP8A 1DZQA 3ZXKA 2YHJA 2JDHA 3EYPA 2B7YA 4GB31 3I2IA 2A75A 1DLCA 2HWF2 2YUEA 2XQXA 4FO9A 4KWJA 5F6KA 1MVEA 1WW4A 1LESA 1OOPA 1VBA2 5FCCA 2JDNA 2DVAA 2GZWA 4UBGA 1OOPB 2ZGOA 4XACA 4RHV3 3A23A 1W8NA 4P08A 1OKOA 1RL3A 1IQAA 3AM2A 5FKCA 5JOZA 3AMMA 3B93A 2WLPA 3AXDA 4AHWA 3FUQA 3JQXA 3ZIXA 4AEDA 1D0GA 3RJ2X 1JYWA 4NHXA 1PO23 4AEDB 2VMIA 1YI7A 3VBUC 5ACA1 2BUKA 4RR3A 3SXWA 2A70A 3FLRA 1I5ZA 2J22A 2ZX1A 4RR3B 2VTXJ 2VGDA 2DVDA 1G9DA 4CCLA 4Q26A 4LJHA 4Q8LA 5FXVA 1LNSA 5HV0A 1ZZ8A 1VBD1 1XBFA 2QQVA 2OW4A 4JQRA 3WHUA 3R05A 4CEYC 1H4HA 3WEZA 5JOXA 1RMU1 2IXCA 4YVSA 3IMMA 4IE7A 5FREA 5FMBA 1QKQA 2WINB 2WQ8A 4YVSB 4Z8BA 4CDXA 2B39A 1JH5A 2WSUA 1H6XA 4CDXB 1NX9A 1ZBA1 5BNOC 3O7OA 4HFSA 3VD4A 1ND2A 1NCQC 2VUCA 3AFGA 5KHGA 5JI7A 4JDNA 2R16A 3GALA 5FUIA 5FZ1A 1F5FA 3KQ4B 2GDFA 1ND2B 1OHFA 1FXZA 1SLTA 2RDRA 2HWE1 4PLNA 5EP9A 4EWAA 2RJKA 1AZDA 5A7QA 4MXWA 4R9CA 1DBNA 2HWB3 4YW2A 2V5YA 4MXWB 1XE0A 4MHRA 4W50A 5ACA3 2R30A 2V5DA 5FP9A 5FYMA 4MZUA 1NQDA 2QZ3A 3LQCA 5JMOA 3POGA 2ZEZA 1PVXA 2D6KA 1DYOA 3WLUA 1Z78A 3OPTA 1X9PA 2RMU1 1WBLA 3MW2A 5DPNA 1CESA 3VZNA 3QBQA 1QMJA 4E8CA 1OA2A 5JIUA 2D97A 4M3CF 1S0JA 1H8TA 1RGSA 1X36A 4I0WB 2IFWA 5FR3A 2CU5A 4AEMA 5ABJA 1BVVA 1H8TB 4IEPA 4Q4Y3 2ZXQA 3A7QA 1W2AX 2X10A 3AJYA 2RV9A 2YU2A 3AP5A 3J8F1 3RDIA 4AFMA 1VRH1 5C9AC 5ABJB 1JUHA 5F3IA 1LOEA 1XNKA 5I0RA 1Y9MA 3VGIA 4FBFA 1UF2C 3THDA 3KV6A 4CP0A 2R32A 2DBIA 4L0PA 1UPSA 4Q4W3 2JDUA 2R0HA 1AR62 3AVSA 4XFFA 1AL21 2K46A 4KH9A 5LRRA 1F4AA 2ERFA 4A7KA 1S1AA 2VZOA 1QJX1 1UKRA 5BUVA 3S30A 2JG9A 3B9IA 5CADA 1OD3A 2JG9B 1XYPA 3CJXA 1GP4A 1QWRA 1UY4A 1XB9A 2RMU3 4CCKA 3NRUA 5A7WA 1ZRDA 3FLTA 1VRBA 1ENRA 4PI2A 1OPMA 5A7WB 1FNYA 3FX3A 2GNTA 5G05L 4Q5OA 4IEOA 1AHSA 1IGOA 4GKXA 4OLLA 4XC9A 5JIAA 4NPMA 3TN91 1PGW2 3PVNA 3J8F3 2VBBA 4R52A 1W2UA 3WQ7A 1QGLA 4Y5SA 1Q43A 2VECA 4QXBA 5J98B 4LA2A 1GQPA 5C8WA 1HB2A 3DGTA 4YW4A 1AL23 1J3RA 1E5RA 5FZLA 5KXBA 2B8MA 3IBMA 3HPNA 4Y33A 3SISA 1EV12 4B1LA 1PIV2 2BFUL 3WNXA 4AOCA 1V6IA 1DDLA 4I30A 2YY1A 4FFGA 4IE5A 1TME1 1SBFA 4LO6B 5KHJA 1IPKA 1QNWA 1W6MA 3K2OA 3WDWA 1C3HA 5CU1A 1W6MB 3ORJA 4FXGB 5L19A 1V9U3 4CDWC 5FO9B 2DU1A 2WO2A 2EIEA 4KL1A 4QPIC 2LTNA 3I2KA 4YG3A 4E9KA 3UV9A 3ZFFC 1TEIA 1R082 4IESA 2XQRA 2VZQA 4N53A 5A3UA 3RPQA 5IK7A 5E16A 1U12A 4N53B 1VBA3 4CCOA 4HANA 4ZHNA 1A34A 3FFZA 3NV2A 2IXIA 3UT0A 3R6SA 1WCDJ 1ND3C 3IMNA 4UOJA 5FXZA 3BYWA 3PUAA 2WNUA 5FYIA 3PURA 2WNUB 2MEV2 3PU3A 3T2TA 1NLRA 2DUQA 4QXHA 5FV3A 3O1TA 5LA1A 1EUTA 3WNPA 1S55A 3DKQA 3RNSA 1SLBA 4XJ8A 3FZ3A 1TME3 5DAQA 1PO12 2P3YA 1V70A 2VTFA 4MXVA 5A70A 5KC5A 1WA4A 3BI3A 1XOYA 4H14A 4H7LA 5JMCA 1PM4A 4BWOA 3RWKX 5FFOC 2QCSB 5L7OC 2C9AA 4CA9A 3T2QA 4LO8A 2JDPA 2PAKA 1BQPA 2JKXA 3HT1A 3MFAA 1WW7A 3OGJA 4OMCA 5AFEA 3N35A 5IK4A 2C9KA 2Z42A 5DDJ2 2XUEA 5FZ8A 2W52A 2VAUA 4BM8A 2BFUS 1E5HA 2CSGA 4EN9B 2RM22 2TEPA 3NNGA 2ZTNA 2D6NA 5DG1A 4BB3A 4LMFA 5DABA 1AXKA 4MH0E 3PL0A 1POV3 4QWNA 4NIIA 3CJIA 2V4AA 1WCKA 1ULCA 1DU3D 5CFCC 2YBKA 4I3GA 3CJIB 2YU1A 1AYM1 2FDJA 3O1PA 1WCSA 3K4DA 3M4FA 2YZ4A 1U5IA 3CMGA 3HIFA 3MGUA 3NKTA 4GKYA 3KF5A 4ISRA 2KXLA 2QFEA 5G04L 1ZVFA 2PHDA 2XMLA 1XRUA 1UOBA 1PHMA 1W9FA 4BHPA 2PHWA 2XJRA 3OCPA 1O4TA 4ZS3A 2BYVE 4CEWC 3CEWA 1CAXA 2ZGRA 1F9KA 3JCIA 3OSDA 5JI9A 1EPWA 2BWCA 5C3QA 5CEHA 3WCSA 2C4XA 5A32A 3AKRA 1CAXB 1DYPA 3NNJA 4Y1UA 2QZ2A 3SEEA 4V2WA 5A32B 4CPBA 4A3XA 1EY2A 1JYCA 4W4ZA 2YC4A 4YVWA 4B4QA 4MGYE 4GMP0 3USSA 4AWDA 5F7UA 5KXCA 4YVWB 3OB8A 4UAPA 1HXS1 2BVBA 2WDBA 4FPFA 4JQTA 4AI2A 3LFMA 4M4PA 2WNEA 3JBG1 4Y1YA 5L9VA 1IKQA 3BN6A 4QMAA 2KM2A 5CKQA 4CU7A 2G9GA 3HWJA 4E4ZA 4AXOA 1ZREA 1B09A 5FUNA 2QUOA 4K7JA 5K4LA 2JKBA 3USUA 2W08A 4MGZE 4XAAA 5T54A 1KD7A 5FYZA 5I93A 3E6CC 3USUB 1JXNA 2KA3A 2XL9A 2ZZQA 2OPWA 2CDOA 4Y22A 4Y4YA 4EQVA 4Y22B 1TMF2 3U4XA 2YROA 3OG2A 1QY4A 5K7PA 2A3XA 4XTMA 1T2XA 1LHVA 1VPHA 3HEIA 4ZKTB 3KCXA 4I02A 4LTAA 3MW4A 4MLOA 3ZXGA 3Q9OA 3J7MA 2GNMA 2IXJA 1PMHX 4OI1A 2HWC2 2D6OX 3ZYFA 1QEXA 2VJXA 2XVGA 1LR5A 3SCGA 4AG4A 4PIZA 4Q0UA 3RZJA 2WS92 4PF5A 1OLQA 2DDUA 4P9WA 2PLV2 2P2KA 1PK6C 4Z07A 4UW4A 4YG6A 3HQXA 3JBG3 3ZYIB 4BLJA 1Q8QA 1Q8SA 2R041 2VBDA 3VHNA 1IS6A 1D4VB 2ZPXA 2MNGA 5A3TA 2H0VA 5HXMA 2O8QA 4CUGA 1MZFA 4AAPA 1S0DA 2JG8C 1QJU2 1LGBA 2W3JA 4GA9A 3W9AA 5KHIA 4A4AA 1GOHA 3OUHA 3VBOA 1SBEA 1PIV3 4HKWA 2Y0IA 4ZPIA 4BZ4A 1G7YA 4Q1RA 4LR4A 5EYXA 3VBOB 1W8ZA 2OPKA 4E27A 5A6ZA 3ATGA 3B7MA 2C6SA 1F2NA 4COZA 4GWIA 1BBT1 1JMUB 5FZIA 5F1RA 1GZTA 3BTXA 2WT2A 4ZU5A 2NMNA 2R7EB 4E2SA 2VZ3A 1ZBE3 1AXZA 1GUIA 3INAA 1R083 2ZACA 4XETA 3TYJA 4HG6B 3ZDSA 1MEC1 4JGYA 1S4CA 4LBMA 1W2NA 4XAEA 3T09A 2IXKA 4JGYB 4YW5A 3MHZA 1ZRRA 4YW3A 5FQ0A 3LA3A 4LEJA 2DFCA 4GMP3 4NOTA 3WDTA 3NV1A 2YG0A 1XXNA 2XLFA 5FQ0B 3T0DA 2WO1A 3VZLA 3WF3A 4BXSV 3MF6A 5DAPA 3RMXA 4I2OA 1MQTA 5GKAC 2R062 3DV8A 4QB1A 1OI6A 4HK8A 1MZEA 2LALA 2MEV3 4FPJA 3LCPA 1MQTB 1W0NA 2W92A 2J1VA 4TZDA 4YNIA 4IUGA 1FOD3 3K46A 1L7RA 1UYZA 1PO13 3ROUA 1E5IA 3VBSC 1DQ2A 3ECQA 4MG2A 4NHLA 2Q1ZB 1BBT3 2JICA 3FMGA 2RS31 4E4DX 4W8JA 4Q0QA 5FZEA 2OZJA 3ILRA 4YFWA 4XEZA 4XF9A 3NV4A 5DZFA 4E2GA 1MS4A 4URAA 2GP5A 4JHZA 5FYUA 4QX8A 1VBB1 2Y6FA 3IDCB 4HN1A 5LBBA 1S0IA 3AYDA 2P3JA 3LDKA 3LD8A 1LODA 3ZPOA 4N8MA 4PT6A 1LOCA 1NY71 5LZ6A 4QDRA 1IQDC 5EPAA 3B9CA 2VMDA 1ENSA 3T0BA 4CP9A 1VBE3 4CP9B 3VBHC 4CDQC 1SACA 1JZ6A 1HQNA 1SG3A 3GXUA 1RHI2 4Q0PA 4FOVA 1CQ9A 1ZZBA 5JXHA 2BVVA 4XPVA 3I2GA 3MICA 3VL9A 4TN7A 1MR5A 1U5ZA 2UWCA 2XXZA 4DUWA 3L2HA 2Z2SB 3DCQA 3AB0A 1CGPA 1O3RA 1L7QA 4O61A 2WZEA 4D6SA 4LBKA 3OJBA 4EN6B 5DZGA 5C4WC 4FXKB 1RC6A 2ZX2A 3U0ZA 3GBWA 3IPVA 2BOJA 1UY0A 1COV1 3LEMA 2BV4A 5LCWL 3IPVB 3LE0A 1CZTA 4Y3OA 3UGFA 4KG8A 4DINB 2IVJA 3WW1A 3HNYM 3JB4C 1G9BA 4HMZA 2P4EA 5FY9A 1W8FA 2VOKA 4XE9A 2ZGMA 5GJ6A 3D8CA 1HRI2 1SLCA 2XHKA 3E6DA 3WNOA 5F3CA 2R49A 2RS12 4QGNA 5DAVA 2W1UA 1H1IA 4C90A 5JPNB 4B3NA 3WY6A 3AP6A 2QQMA 1RUG2 3M3EA 2RE9A 2C5DA 1XSRA 5EIYB 1UQXA 2YFUA 2ZKLA 1WCUA 4ASMB 1DGWA 2HBTA 1FPN2 5TSWA 1DGRA 4E4HA 1N3PA 1RINA 2GC0A 2WFF1 1XYOA 1G9FA 2A6YA 3KHCA 2AACA 5H9PA 4M00A 2D5HA 1U5XA 2WYFA 1XNCA 1VBC2 2BU9A 2NPIA 5A1FA 3D6EA 3LDRA 1FMD2 5AVAA 1WLCA 5D8AA 2GNBA 2HWC3 4WM7C 1ZRIA 3H8UA 5J48A 2WWUA 1Z7S1 2E31A 1GOFA 2Y6LA 3AMPA 4FCAA 4S2FA 3PMSA 5D8AB 1N1YA 5FPBA 3ZFEC 4AI0A 1M4WA 5IVCA 1JYXA 2PHLA 5FPUA 2PLV3 3V64A 3NNLA 5A80A 1WW6A 1TVGA 3AL6A 3U75A 3FHQA 2E7AA 4RA0A 5A7PA 1RUD2 1HJGA 2D3SA 3WF2A 5L73A 1QNYA 1UOGA 1BYHA 1PVC2 2E33A 2WZR1 1QJU3 4TWTA 2OVUA 4XDQA 1VB2A 2G4IA 4LOTA 4DO0A 5FLIA 3E6BA 3AK0A 1UYXA 1JHNA 2GN7A 3GHNA 1WGPA 4NHKA 1MS5A 5FLJA 3UESA 5A7SA 5LK7B 3AC0A 3NJVA 1REFA 5GZGA 1EAH1 2FCUA 5JAXA 1XU1A 1O5UA 2XBO2 1D4M2 4LBJA 2BERA 2WNVC 5FZ0A 3T1MA 1O3SA 2ET1A 3GJAA 1RVF1 2L9LA 3IIAA 3Q8AA 4Q4V3 1YQ6A 2VH9A 3WP6A 1NUKA 2OX0A 2R071 2EAAA 5A3NA 1FAYA 1IG0A 3KMHA 5LB6A 1YFYA 2PHRA 1XE8A 4RR3C 4YPJA 1WD4A 2EAKA 4CCEA 4UFHA 1JZ8A 1QXJA 3TWIA 3ETQA 2JE9A 5C8CC 5BNNA 1S0CA 3NQHA 1UN1A 4R4XA 2BGPA 4JTNA 1BVP1 1H2KA 4C1XA 5BNNB 2R063 2XJTA 5IVYA 3TEWA 2FDKA 5HV4A 3FHAA 4N90A 4XF4A 2EVXA 3D4KA 3NJYA 2JWPA 3RYRA 4XBNA 2ATFA 2IFRA 2RR12 4M3CA 4IXLA 4M01A 4S2DA 2K2SA 1O59A 2WIIB 5A7NA 1YRZA 4M3CB 4XJWA 5CAZA 3MW3A 1HQWA 1GKBA 1AR91 2H6CA 3FBYA 3LB9A 4LKDA 4PLMA 2RDQA 3POWA 2BZDA 3GGLA 1ND2C 3RRDA 1PGL2 4GZ9A 2W39A 2P17A 1LHUA 1TZOA 1ZYBA 3OBZA 4C8DA 1T6GC 1W0PA 2ZEWA 2RS51 4Q4X3 3WZ1A 4DB5A 2J1EA 3CZUA 1UMZA 4EZHA 5F2SA 1UY2A 1C1LA 5FYVA 4COWA 4QHBA 4QM9A 1MS0A 1W0OA 5CB7A 1POQA 4OYUA 3EXUA 3J7LA 3NV3A 4XZPA 1W03A 1ODMA 5EYYA 3WUCA 1NA1C 2WT0A 2PHFA 3K3NA 1RUNA 1RUI3 1LOAA 2VG9A 4W6YA 1RHI3 5IFPA 2VMFA 4AVBA 4QX0A 4NIGA 4IV3C 4NIAA 1NLSA 4CCMA 4YW7A 5IFTA 1K3IA 4LLOA 4XABA 5FZKA 2YB7A 4IV1C 3ST7A 1H8TC 1I9RA 2HLEA 1O5LA 3H3LA 3WP4A 3WF0A 1RMU2 3LGRA 5I91A 4EROA 3VUOA 4CXXA 4RGAA 2Y64A 1N1VA 4D0QA 3D3AA 4UWDA 5F6LB 3H7JA 4HZFA 3JQWA 4AVSA 2XHNA 5JZGA 3BALA 3SH3A 1DQ4A 1LB2A 3LWCA 4XHBA 1DZRA 4AFDA 5JZGB 2LRPA 4QPGC 3KV5A 2QVSB 1GYKA 1ZNPA 3N9MA 1ULOA 1QHDA 5A6YA 1K42A 5SV5A 3H7YA 2VZPA 4MO3M 4UFIA
chains in the Genus database with same CATH topology
1ONAA 3LKJA 1X82A 2WSVA 2VNOA 5JSPA 1OA3A 3ZPYA 2BWAA 2BNOA 2JDZA 1RUG3 3PVBB 3H1MA 1BKZA 4XF1A 4BYYA 3I54A 1C4RA 1SQ4A 1FPN3 1RB8G 2K0GA 2W0XA 3WW4A 4HKLA 4RHV1 3POSA 5K0UA 1DQ6A 3LOIA 5FAXA 1VBC3 4BE3A 2FHRA 5K0UB 1OQEA 1PO21 5T5PA 5FRAA 4XILA 3ILNA 1CD3G 2XLGA 4XYXA 3RJRA 4ZU7A 1FATA 3VZKA 3MLKA 4TYSA 2FMYA 4META 1VB4A 1YJKA 2LUWA 2A6XA 3V56A 1AX1A 3ZO0B 1LOGA 2ZKNA 3ZIWA 3ZSEA 1S0GA 1N1TA 1O7FA 1YIFA 3S0MA 4K8FA 3N3HA 1H0BA 4MX3A 1JBCA 1QJX2 2WA4A 4XIKA 4WM8A 5D1IA 4DS0A 4WM8B 2CV6A 2BGCA 4EN8B 4P14A 4N53C 1O91A 5I0SA 2HWB1 3E97A 1CIWA 1R091 3MIGA 4YZ4A 4LBQD 3AZVA 4PJYA 2BEOA 5GLUA 1UU6A 1AR72 4C0HA 2F6BA 1D4M3 1W6QA 3UKVA 1GICA 1W6QB 3FBMA 4AYUA 1UZYA 3VKOA 4LULA 4P9XA 4XFBA 2XWBB 1AUYA 3A0NA 2BQPA 5GLVA 2GC2A 3ENRA 4QU2A 1DLLA 3VBFC 4DQAA 1LHNA 1UD1A 5FMOS 4Q4Y1 3VN4A 4GWMA 4FTBA 2PELA 2JEMA 4KBBA 2RR13 1ZA4A 2PHTA 3O0WA 5IUQA 3I59A 3ZXDA 2VOXA 4DNYA 1Q5OA 1OKQA 1R093 5AC92 3I59B 1JN2P 1XNBA 2YMZA 4Q4W1 1NQJA 4DOUA 1AR82 1SCRA 5SV8A 1LU1A 4PDWC 5J36A 3ZYPA 1QXPA 1DG6A 4W6XA 3AP7A 4FOQA 1OA4A 3URFA 4ITCA 2JJ6A 4K1ZA 1RUJ1 2HEVF 1IS3A 2H6BA 4FPEA 1M06G 2GMEA 4LT5A 3I8TA 3R0RA 2AREA 2XVKA 2O1QA 3VKFC 1HQLA 5FDBA 2VXRA 1Q56A 4COUA 4ZU4A 2OYZA 4SBVA 2W68A 2ZX0A 4MVTA 1GZ9A 1DQ5A 1D2SA 1DHKB 1JUIA 4Y1VA 2QJVA 2D7FA 2B5HA 2DCKA 4BCUA 2ZHLA 4MGIE 1PM7A 1YFXA 3KT4A 4K6BA 1QXRA 3WQ0A 2ZGKA 2E9QA 1YCIA 1RUJ3 1YLLA 1REEA 1Q3EA 3FE5A 4RS5C 5CBLA 1KJLA 1ZZ9A 3AFKA 4YYOA 2E53A 4DRRA 1HLCA 4MUVA 3VHPA 2HWD2 2ZMNA 1V9U1 1HW5A 4Y1ZA 1OQDA 2X29A 3M8LA 1POV0 2IC1A 3DN7A 4AHXA 2HWF1 3LA7A 1VAVA 3NW4A 4MV2A 1QQP3 4AFCA 1VBA1 4Q1PA 1CAWA 5LK5A 5T5JA 4JC1A 2RHPA 1YI9A 1CAWB 1SLIA 3S7EA 5BY5A 4AFAA 3RZZA 2R0FA 4M0NA 5E89A 2HJIA 4R9BA 3D0SA 5T5OA 3NJZA 1GNHA 5H9SA 1APNA 4XMIA 1WLTA 3A4UA 2TNFA 2VQ0A 3IDEA 3OD4A 3SITA 2HYKA 2BW8A 2XG3A 4ZXKA 3BOWA 2SLIA 3LOBA 1F5JA 3ZX7A 1VLNA 3WUDA 4AK3A 2HWF3 3VBRC 4IQPA 4HVOA 4UW3A 4IL7A 4JGZA 1HV1A 3VV1A 4IERA 2X5IA 4JGZB 2X5IB 1POV1 4J1XA 1SLAA 2EXIA 1WUVA 4GWNA 1EP0A 4AHZA 1LTEA 2XJSA 2Y26A 1ZRFA 4E4SA 3ZN5A 2QDRA 3MIFA 4XFGA 3NL1A 1V6OA 5A33A 3UL2A 1C8NA 2R042 4M3CE 3VBUA 5A33B 3VBUB 1IZ3A 2TUNA 1HDKA 3WW3A 4OFGA 2UURA 4D7YA 4PBOA 3TBDA 2XJVA 4CZSA 3V0BA 4XTPA 3WDVA 3V0BB 1QOSA 5DUWA 3WG4A 3V0AA 3OPZA 4GH4A 1NXD1 1V6JA 3V0AB 3QACA 4QQPA 4ES8A 5FOBB 4GH4B 5BNOA 1C57A 1DQ0A 4UBHA 4L8QA 1GZCA 4Y26A 3VKLA 5AC93 5BNOB 3H50A 4HVRA 3HT2A 4B7EA 4L2NA 4XOGA 2XGXA 2PA7A 4WVZA 1MEC2 1IHMA 5FBZA 2DU0A 3GNEA 4X8PA 1MACA 1K5MC 2UY9A 2DCTA 3BB6A 3VHOA 3PTYA 4L92A 4RQPC 1QJY2 1C5IA 1H4GA 1GBGA 3NSTA 2OIIA 2V09A 3QCWA 1LECA 3RYPA 3VDDA 5JOZA 2Q8OA 2EXJA 4YARA 4W65A 1PZ7A 3QLQA 3H9AA 4FPKA 4LO4B 3VDDB 1YHFA 3MYXA 1PGW1 1W39A 4OI4A 4B7KA 2VW1A 5JSOA 4WVWA 3ZYGA 2AUYA 1TNRA 4HN0A 3U07A 1GLHA 3E5QA 3K48A 4HVQA 4YM2A 2I45A 5C9AA 1C1FA 1AR63 1HIXA 2XUMA 1GR3A 1MS9A 5C9AB 1NCRC 3RI9A 4XXPA 1EV11 2XKOA 1PIV1 3CF6E 2N7GA 1B35A 3DUIA 4SLIA 3ZMNA 5CG8A 3VZMA 1UIJA 1B35B 1KS4A 3I2DA 1UW8A 5IK8A 5BPXA 4YW1A 2H0BA 3C3VA 2XWJB 1LHWA 3KCYA 1ZBE1 2DWRA 5JPMB 3AZYA 1R081 5BNPC 2D5FA 2JECA 4AVAA 5JDBA 3BCWA 3N7JA 4PQ9A 4FQZA 4B4RA 1H9WA 1WBFA 2DCYA 2Y38A 5D8AC 4N7UA 3N4MA 4GMP1 1UIKA 1AX0A 4F3JA 3B02A 1OPOA 2AYHA 2GH8A 2OA2A 1SFYA 4L97A 1RUC2 1EV13 2DV9A 2MEV1 5AVPA 2GC1A 2WA3A 1FOD1 4GIQA 4K1YA 3WV6A 1PO11 1CONA 2GMMA 1FX5A 3MDPA 4LE3A 5F9TA 5KHKA 2ZHNA 4P9JA 4ATFA 2PAEA 1ASJ2 3DPRA 2ZCWA 3S6PA 4CDUC 5DDJ1 3DPRB 2P37A 4URTA 3B69A 3MEPA 1GNZA 4CDWA 2C0ZA 1XE7A 3T1LA 4CDWB 2WT1A 1JOJA 3NAPA 2Q4SA 1V6LA 4YM1A 2JE7A 1VBE1 4XXAA 3CLPA 1RUE2 3NAPB 4AQSA 3L2YA 4BIFA 4R8HA 2VUJA 1CAVA 3LAGA 3J26N 4F8AA 1CAVB 3KS7A 5BNNC 4Q27A 5HBAA 2VNRA 3LSEA 3PVEA 1QDCA 5JSRA 1HRV2 4FT8A 4N9IA 4FQ4A 1ULFA 2D6MA 1Y43B 3B5LB 3KB5A 5DDJ3 5L7OA 2IXLA 2ZGTA 2O0OA 5J3UA 5L7OB 2RM23 2JD4A 4BMEA 5GLWA 4D3WA 1RUF2 2DUOA 4I0BA 1KFXL 4K40A 1OLRA 2FMDA 3H3UA 2CY6A 2WKKA 4LBQA 3AKQA 1S0FA 1ZZ6A 3AMNA 1R1A2 4LBQB 3QD6A 1S2KA 2XJPA 5CFCA 1A8MA 3M3CA 1YXWA 4P9YA 4I3PA 4AI3A 5CFCB 4RSUA 2VMHA 2BTVC 4EWEA 4YG0A 3H3ZA 5FOJB 3FLPA 4L99A 4JAAA 1YWKA 4NPRA 1QDOA 4P9GA 1UL9A 3IWZA 4AHYA 2HWC1 1A3KA 1QOOA 5GALA 4CEWA 2Q5TA 4CEWB 2WS91 1VALA 2PLV1 4IEZA 2I2SA 4LNVA 5HXVA 1VAKA 1X7NA 1DGLA 3ZFGC 4EJRA 2D40A 4RL7A 3W59A 4XJZA 2OUJA 2PAMA 2ZGLA 1TQ5A 4PBPA 2RS52 3H1WA 2AGSA 2DVGA 2X53S 4PIYA 4PIXA 4FPOB 1QJU1 1FYUA 3OY8A 3OY8B 3ZSMA 2UWAA 1TMF3 1QU0A 1G86A 4F7ZA 1G9CA 1KS5A 1XNDA 3B3QE 1RUH2 3AKSA 2HKXA 5KHHA 3H0OA 4JDMA 5EWSA 4YFZA 1YFWA 2WS93 1OMIA 1VJ2A 4BMBA 4Q4V1 3JD72 4NWWA 4XQWA 3SH4A 3TRSB 1U5YA 1C8M2 2ZHKA 5JWPA 4AI1A 1H2MA 5DXDA 1J3QA 3IT8A 4K3UA 4S2GA 5CA6A 1LJ7A 2ZX3A 5CVRA 4O9GA 1MS1A 5CFDC 1L3JA 3ES4A 1LOFA 2MPFA 5L36A 1TNFA 2R061 4GXLA 2UU8A 5DUVA 3AMQA 2FQPA 3MZHA 3AKPA 1NZCA 2A71A 3M3IA 2OUHA 2ETEA 3ZSKA 4E2QA 1FV2A 1X8EA 1PGSA 1CX4A 1OOPC 1RITA 2I74A 4YZ3A 3AYCA 1AYN2 1YFUA 1GQGA 1H8VA 1ASJ3 1Y7BA 4Q4X1 4AEDC 4OHYA 4ES9A 2Z79A 1BEV2 4RHV2 3MIEA 2D6PA 1BMV2 1OFNA 4N7IA 2CTVA 1MZ5A 3ELNA 4N9HA 2CGPA 1N3QA 4PLOA 1X33A 2ILMA 1QF3A 2ZZJA 4RFT0 1A78A 1RUI1 3HD8B 5AFBA 1RHI1 4TLFA 2A73B 1I1EA 4YVSC 3X29B 4RD7A 1SBDA 4CDXC 2B9UA 4MYEA 5J37A 3TNPB 4YGCA 4LBOA 2SBAA 1V00A 4UXAA 2E63A 3UJOA 5BNQA 4GB32 2A6VA 3EQEA 4XFIA 4JRLA 4OVEA 2DYCA 4QT6A 2YC0A 5JR7B 4JV4A 2VVFA 3SH5A 1DIWA 1IOAA 1DGWX 2B42B 4DRVA 1MS3A 3PVOA 2QKDA 1F8VA 5T5LA 2P3KA 4U2AA 1HRI1 2D98A 5ACA2 3W58A 2XJQA 2RS11 4WVMA 4C1WA 1QJZA 4L9BA 1WLWA 2A3YA 4WVMB 1H2NA 1RUG1 3N36A 3ASIA 5CG9A 1SLLA 1URXA 1MVQA 4EN0A 3VBHA 1VBD2 1WD3A 4CDQA 1FPN1 1GZWA 3VBHB 4CDQB 1GZWB 5JOYA 5ABJC 5E88A 2EA7A 1VBC1 1FMD1 1ZBA2 2P3IA 1XYNA 1BK1A 4IEXA 4Q4Y2 1SDWA 1V6KA 5C4WA 3ZYJB 3OD0A 1CR7A 2HWE2 5C4WB 1CJPA 1E57A 5BYNA 4S2HA 5E8AA 3KLSA 1HRI3 2JG9C 1MS8A 3WG3A 2RS13 1J59A 1J3PA 2BNMA 4DFSA 3J9SA 2CWMA 4AGRA 1RJ8A 4UW5A 3A0KA 2R6QA 1AJKA 3KGZA 2RMU2 2D93A 4YM3A 3VZJA 4Q29A 2DTWA 3AJZA 2IXHA 4YZ2A 4P9LA 1JW6A 4R9DA 4HSLA 4QQHA 3SLIA 1FMD3 5T50A 3KZ4C 3FC0A 2E7TA 4FSJA 3N7MA 1DFQA 1DF0A 3RWNA 1PMIA 1D4M1 2VPVA 3J8F2 5HCBA 1VRH2 4XJUA 3TNQA 3GZTB 2XVLA 4INDA 1DGRN 3EJKA 3PJYA 3JD73 3JUUA 4WM7A 2R1DA 1AL22 1C8M3 4LBNA 3NVCA 4KU8A 4WM7B 1RUD3 2E51A 3ZFEA 3AZWA 4BIOA 3ZFEB 2YXSA 2DURA 2VUAA 1PVC3 4DY5A 4COYA 2PYTA 2Y0OA 3SCHA 4WV8A 4QXKA 2R1BA 3KCCA 2RR11 4X6RB 4B4PA 4XIOA 2DVFA 2D3PA 4H55A 3IN9A 4AEKA 3K51A 1V9U2 5DUXA 3TN92 2X5IC 1AYN3 4HSJA 2XBO3 1Q8OA 4B8EA 4AVCA 1PGL1 4JCKA 4AQ6A 2WNUC 4GULA 4FAGA 4OI0A 2ZHMA 2WZPP 4QGLA 2WJSA 3ALQA 1G9AA 4CTEA 1BEV3 1O3TA 2WNVA 3ZN6A 2WNVB 1YUDA 3RQ0A 2B45X 1O4YA 5EJ3A 3ZN6B 2P34A 2CL2A 3U11A 2VOWA 1ZRCA 1RIRA 1BZWA 2DUPA 1KITA 1TME2 3RI8A 1V6NA 4QQ2A 5C8CA 3M1HA 5GLTA 5C8CB 1YIPA 4LO7A 2WL1A 3C2UA 1ZX5A 1YJLA 3M3QA 4YZ1A 3UJQA 3ZN4A 1GSLA 4GB33 4XFAA 5BV6A 2BPA2 3MLLA 3QOPA 4Q2FA 3AP9A 2WWSA 4GH4C 3UKNA 1WMFA 4PCRA 3CJIC 4RGGA 5H9RA 5C33A 3G7DA 3QH7A 4R4ZA 1I3HA 4HPKA 4HPKB 4OHWA 1G8WA 1JTZX 1W6NA 3B00A 3BOPA 1W6NB 4Q0VA 4X6QB 4G9SB 4KU7A 3J4UH 5A3MA 1A6CA 1NXMA 1PNFA 2NQYA 3PMEA 1LOBA 4C0BA 1NA1A 1NG0A 2TBVA 1QQP1 3ZXLA 1VBD3 5F5QA 1NA1B 1WMEA 3IM0A 3VDDC 4YVWC 2AH2A 1RMU3 4D94A 4ASLA 5LEJA 4IV3A 4O9EA 3HR9A 4M0HA 4IV3B 4N43A 3POYA 3AP4A 1CJDA 1Y3TA 5FPZA 4IV1A 4N43B 1ZBA3 2NMOA 4IV1B 4AI8A 1RTVA 5FPXA 2HWE3 2NN8A 2V73A 1QH6A 2A3WA 5KXEA 4ORFA 1AYM2 4QPGA 4WBBA 4QPGB 2A6WA 3AZXA 4QX5A 1B35C 3VZOA 1HKDA 3PHMA 3WDUA 3HAGA 5JVVA 4I09A 1CAUA 2VQAA 1KDMA 1UPIA 5T3NA 2VVEA 3N7KA 3OF1A 3ZVXA 1CAUB 5GZCA 4HBNA 1SEFA 3MFCA 4Y5Z0 2GALA 2OZ6A 1DZTA 3WX5A 2ET7A 3O14A 5DZEA 5GM0A 5B2GB 2GH2A 4NVPA 4COVA 2HEWF 4FTEA 4HT1T 3GZUC 2YPJA 4KGQA 3B94A 1O3QA 1HXS2 1AR71 3UK9A 4IEUA 2XH6A 4ATEA 1VRH3 2PHUA 3BU7A 1OSGA 3JBG2 4EV0A 3WG2A 1ZZ7A 4ONUA 1LEDA 2D3RA 3VBOC 4QD2A 5LEKA 3IKWA 4HLTA 4G3YC 4QGMA 1FV3A 2GNDA 1QH7A 2GMPA 1H30A 1QJX3 2F4PA 2UY8A 3WT3A 5H9QA 3OBRA 2BBVA 1J1TA 2G9FA 1ZZCA 4OHZA 4XW3A 3R4UA 5BXXA 2ZGSA 4AEJA 1KFUL 3DPRC 3PLQA 2BNNA 1KDKA 3M3OA 4JGYC 5I8YA 3M7AA 4JDOA 3R4SA 5AC91 4AVVA 4FPGA 3TN93 1AR81 1ZBE2 1AR73 1H1AA 2RJLA 3NAPC 5KC6A 4HKOA 2GC3A 1MQTC 4J6GA 4LO5B 1V6MA 2YV8A 2PFWA 3HBZA 3SMHA 1KJRA 3BPZA 5KBFA 3WVJA 2IZWA 4FPYA 2DF7A 4LBLA 4I01A 5T55A 3BIWE 4CEYA 1S2BA 3UKTA 1FOD2 2K9ZA 4HETA 4CEYB 5FLHA 2JX9A 4LHLA 3D0JA 3L9JT 4OUSA 1FI2A 2Z5WA 1BBT2 3VBFA 4WVVA 4BQ1A 3VBFB 1NCQA 2VW0A 4KNCA 4AGGA 2XKPA 1QOTA 1FNZA 1AR61 1NCQB 1WMDA 1AR83 4L11A 4GALA 4GQ7A 4C91A 2WC2A 3VKMA 3GZAA 2XJUA 1UZZA 1DYKA 1LCLA 4KGGA 2ZS6B 3DL3A 4AW7A 3FWEA 1J1LA 3MPBA 3OGGA 4PDWA 4YM0A 3WG1A 1VBE2 1XU2A 4YGBA 2QQPA 1N3OA 4PDWB 3N7LA 3ILFA 4CRQA 1VIWB 3M70A 2EXKA 5I8SA 4LUMA 4KWKA 4FTSA 2HWD1 3CNAA 1DQ1A 2EXHA 1NE4A 5J96B 2D43A 3AXEA 3QH6A 4U36A 5IT6A 2RS32 2A5ZA 2B46X 2NM1A 1NE6A 1HX6A 3M2MA 1VBB2 5HCAA 4HL0A 1RUOA 2ZGUA 1X8MA 3EO6A 4FP3A 3WDYA 3GHMA 4DMIA 4H3WA 1NY72 1LENA 2DTYA 4TSVA 4JRAA 2ZMKA 5JOWA 3HMYA 4YSFA 3GYDA 4HK9A 2AZ5A 4OI2A 5CIRA 1AYM3 4MSVA 2CYFA 3ZXEA 2HWD3 4RS5A 5KXDA 3G6JB 2PQQA 4RS5B 4B29A 3EBRA 2ZOEB 3SHRA 5T52A 2E6VA 3WHTA 3TAYA 4X8NA 3U10A 1EYBA 2GU9A 3O0VA 1H9PA 3O12A 1U0AA 2IWGB 4OHXA 1COV2 1ULDA 2O8OA 1CPNA 1YO8A 2Q1MA 2X8KA 4EN7B 3IDBB 5K9YA 2HEYF 5HCFA 1IKPA 4FOWA 4KQ7A 5JLVA 4IETA 1HXS3 4QPYA 4YRDA 4BH9A 4LHKA 2A6ZA 2E7QA 1VP6A 4XBLA 1LOFC 2VY0A 2NYYA 5I8TA 3WP5A 5GZEA 2XL7A 4XMAA 4FP2A 2YDEA 4QQLA 1SFNA 3KM5A 2DFBA 1UKGA 1Y9QA 4Q0SA 2ZAHA 1LEMA 1S0EA 2WFF2 3MPPG 2RM21 4XJ9A 4QPIA 3ZFFA 1GANA 4QPIB 4K9SA 4LE4A 1ULEA 2VNGA 3ZFFB 1CN1A 3VBRA 2JENA 1VR3A 3VBRB 2ZMLA 2CGNA 3FJSA 2ZA9A 2WQZC 1ND3A 4P9IA 1Z7S2 3P3PA 3R4DB 1S0BA 1GFF2 1LGNA 4LLFA 4Y1XA 1ND3B 1ULGA 5EXOA 4OZXA 1XQNA 2UYBA 3GBFA 4Q4V2 3ZXAC 5C6CA 4UW6A 1LULA 5FO8B 2LM3A 3KQRA 2R043 2VVDA 3ACLA 1VAMA 3WCRA 3LA2A 4AFBA 4F83A 1QJY1 2WZR2 3S7IA 3AX4A 3JZVA 3OTFA 1OD5A 3WQ1A 2CAUA 2JXAA 3LZZA 1REDA 3MIDA 4LUKA 2UWBA 3I4IA 4W6WA 4YGEA 1BJQA 1N1SA 2PTMA 3HN1A 1EAH2 2YGMA 2EF6A 4I0AA 2GSYA 3V65A 4IEWA 5K8SA 1AVBA 1ENXA 1RVF2 4Q4X2 3KGLA 3FFQA 3ZSJA 1MEC3 2R072 1I6XA 3ME2A 4YLZA 5I0UA 1GV9A 3CU7A 1TMF1 4A7YA 2PN5A 4XQ4A 3VL8A 3B01A 1QJY3 4KWLA 1YNAA 1RUI2 1K5MA 4YZ5A 1SMVA 1F31A 2GN3A 1K5MB 1UCXA 3MLJA 4RQPA 2VMGA 4NR1A 4RQPB 4BOWA 5JZGC 1LHOA 3RYKA 1AR92 1ZM1A 3WOGA 2VOVA 2ZBJA 2RS33 3KT1A 4JTOA 3ZXFA 2AENA 1UU5A 1MZ6A 3NKGA 5E1RA 1VBB3 3MI8A 3TB0A 2Q30A 3MIBA 2EIGA 4DPNA 2CGOA 1RUC1 2VW2A 4K20A 5EFUA 3O5SA 4FPHA 4V1PA 4QM8A 1X50A 4XHXA 3FHIB 2VU9A 1NCRA 4Z92B 5EZWA 3RMYA 2ES3A 1NCRB 2ZX4A 4AQ2A 1Q8VA 4P5HA 3WP3A 1R1ZA 5LRSA 3ZYRA 4D7TA 2ZABA 4FPCA 2WLQA 4CYDA 1ASJ1 4LHNA 2FBEA 5K0UC 2Z69A 4LA3A 3AYEA 1NOVA 3P3NA 4AE2A 2ARBA 3JU9A 4FOYA 4DXZA 2QDNA 1HV0A 1AJOA 5BNPA 1LGCA 1PK6A 1COV3 2NLRA 3LSDA 5BNPB 1RUE1 1UU4A 4NWVA 1PK6B 4XFCA 4CP1A 1RUC3 1KXGA 3KSCA 1W6OA 3RG0A 3RSJA 1PNGA 1TE1B 1AF9A 1W6OB 2CWSA 2ZGPA 3ZSLA 2JG8A 4Z82A 1FT9A 2JG8B 2FZ2A 3GBGA 2YYOA 4NO4A 4XBQA 3OBTA 3RS6A 3WDXA 4XJAA 2Q0AA 4WM8C 2DCJA 4XF0A 4DZGA 1J58A 1PZ9A 1HRV1 2QNKA 4WZFA 4IEQA 3MIHA 1Q8PA 1O4ZA 4J1WA 2WFF3 3PJQA 1N47A 3CO2A 2ZAAA 3KT7A 3SCFA 4DY3A 1LKNA 1YYNA 4CDUA 1EPZA 1RUF1 4Z2WA 3H1YA 1PO22 2XB6C 3EHKA 4CDUB 2NP0A 1RUE3 2GAUA 1GQHA 1KRIA 3GF6A 4XQDA 4NHMA 1UAIA 1Z7S3 2I07B 4KG0A 2VULA 2FZ1A 4OHVA 3KD4A 1R1A1 4A7ZA 5KWRA 3ES1A 3ZMOA 3E5UA 5J7MA 3D82A 4JVAA 1LU2A 2UYAA 3OYWA 1H1MA 1HRV3 4CP2A 4XFHA 2ENRA 3VBSA 3OYWB 5JCTA 3WD5A 2WZR3 5DG2A 3VBSB 1PZ8A 5J09A 1WLDA 4YGDA 3NWKA 3SNMA 5I0TA 2D6LX 1KQRA 2WQ4A 1BXHA 1RUF3 1OFSA 2HWB2 1IS5A 1A8DA 1NYWA 1R092 4OUMA 1ENQA 1EAH3 2CNAA 3ZXJA 1CPMA 3AZZA 3PNAA 2XPJA 4H7MA 1D2QA 3NO8A 2D44A 1RVF3 4AVTA 1R1A3 1AX2A 3DKWA 2R073 3D5OA 4AF9A 2DCZA 2XLAA 2ZGQA 2WFPA 4WZCA 4FAHA 3TOJA 4BLIA 5A3LA 3WR0A 4A2UA 1RJ7A 1ALYA 3FUOA 4D69A 4Y24A 2NZ9A 5CNAA 1RUH1 2AR6A 5IK5A 3THPA 3MF9A 1UX6A 4MGKE 4N43C 1H2LA 1Z0HA 1AR93 2EALA 3BODA 3JD71 4Q4W2 5GLZA 1W6PA 3AKTA 1C8M1 3DF0A 1G6NA 2PHXA 1W6PB 1RUD1 1WW5A 2RS53 2ARXA 3ZFGA 1PVC1 1IPJA 1RUJ2 1AL0G 2YGLA 4NN0A 2ZJCA 3ZFGB 5HI0A 5GZDA 4Q8KA 2QE3A 3AMHA 4OULA 2C1FA 3APBA 4BA6A 4EWDA 3O0XA 3AYAA 1JYIA 4IEVA 4Z1VA 3E5XA 4BPZA 1IS4A 2CAVA 3BTAA 3VLBB 1AYN1 3WXPA 2XBO1 1RUH3 1OQ1A 5DUUA 2A7AA 2DVBA 3JB8A 4FPLA 4K21A 1QQP2 3WW2A 1BEV1 4IEYA 5FO7B 1C28A 3CL1A 2MHFA 1BMV1 4QQOA 1BCXA 1D0HA 1LRHA 4AGVA 5GZFA 3VKNA 4G4FA 4R9AA 3WINE 1SCSA 4ISQA 1AXYA 2ZGNA 5FTTC 3VHRA 4D7SA 5FMOL 4Y20A 5EV7A 4FVVA 4XF3A 1C5HA 4Y20B 3I7DA 5CFDA 1CVNA 5CFDB 4JGZC 1DZQA 3ZXKA 2YHJA 2B7YA 4GB31 2A75A 2HWF2 2YUEA 4FO9A 4KWJA 5F6KA 1MVEA 1WW4A 1LESA 1OOPA 1VBA2 5FCCA 2DVAA 2GZWA 4UBGA 1OOPB 2ZGOA 4RHV3 1RL3A 1IQAA 3AM2A 3AMMA 3B93A 2WLPA 3AXDA 4AHWA 3FUQA 3JQXA 3ZIXA 4AEDA 1D0GA 3RJ2X 1PO23 4AEDB 2VMIA 1YI7A 3VBUC 5ACA1 2BUKA 4RR3A 3SXWA 2A70A 3FLRA 1I5ZA 2ZX1A 4RR3B 2VGDA 2DVDA 1G9DA 4Q26A 4Q8LA 1ZZ8A 1VBD1 2OW4A 4JQRA 3WHUA 3R05A 4CEYC 1H4HA 5JOXA 1RMU1 2IXCA 4YVSA 5FREA 1QKQA 2WINB 4YVSB 4Z8BA 4CDXA 2B39A 1JH5A 2WSUA 4CDXB 1ZBA1 5BNOC 3O7OA 4HFSA 1ND2A 1NCQC 3AFGA 5KHGA 5JI7A 4JDNA 2R16A 3GALA 3THTA 1F5FA 2GDFA 1ND2B 1OHFA 1FXZA 1SLTA 4PLNA 2HWE1 4EWAA 2RJKA 1AZDA 4MXWA 4R9CA 1DBNA 2HWB3 4YW2A 2V5YA 4MXWB 5ACA3 2R30A 4MZUA 1NQDA 2QZ3A 1PVXA 2D6KA 3WLUA 1Z78A 2RMU1 1WBLA 3MW2A 1CESA 3VZNA 3QBQA 1QMJA 1OA2A 5JIUA 2D97A 4M3CF 1S0JA 1H8TA 1RGSA 1X36A 4I0WB 2IFWA 4AEMA 5ABJA 1BVVA 1H8TB 4IEPA 4Q4Y3 3AP5A 3AJYA 5C9AC 3RDIA 5ABJB 3J8F1 4AFMA 1VRH1 1JUHA 1LOEA 1XNKA 5I0RA 3VGIA 4FBFA 1UF2C 4CP0A 2R32A 1UPSA 4Q4W3 2R0HA 1AR62 4XFFA 1AL21 5LRRA 4KH9A 2ERFA 4A7KA 1S1AA 5BUVA 1QJX1 1UKRA 3S30A 2JG9A 3B9IA 5CADA 2JG9B 1XYPA 3CJXA 1QWRA 2RMU3 1ZRDA 3FLTA 1ENRA 1OPMA 1FNYA 3FX3A 2GNTA 4IEOA 1AHSA 1IGOA 4GKXA 4OLLA 5JIAA 3TN91 1PGW2 3PVNA 3J8F3 4R52A 1W2UA 3WQ7A 1QGLA 1Q43A 2VECA 5J98B 4LA2A 5C8WA <