The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
306
|
structure length |
303
|
Chain Sequence |
TIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Catalytic Copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also Plays a Critical Structural Role.
pubmed doi rcsb |
| molecule tags |
Oxidoreductase
|
| source organism |
Rattus norvegicus
|
| molecule keywords |
Peptidyl-glycine alpha-amidating monooxygenase
|
| total genus |
65
|
| structure length |
303
|
| sequence length |
306
|
| ec nomenclature |
ec
1.14.17.3: Peptidylglycine monooxygenase. |
| pdb deposition date | 2005-01-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01082 | Cu2_monooxygen | Copper type II ascorbate-dependent monooxygenase, N-terminal domain |
| A | PF03712 | Cu2_monoox_C | Copper type II ascorbate-dependent monooxygenase, C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls | ||
| Mainly Beta | Sandwich | Jelly Rolls | Copper type II, ascorbate-dependent monooxygenase, N-terminal domain |
