4TSVA

High resolution crystal structure of a human tnf-alpha mutant
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
148
Chain Sequence
DKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lymphokine
molecule keywords TUMOR NECROSIS FACTOR-ALPHA
publication title High resolution crystal structure of a human tumor necrosis factor-alpha mutant with low systemic toxicity.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1997-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4tsvA00
2JG9B 2WNUB 4OULA 1XU1A 2R6QA 2O0OA 3ALQA 1XU2A 1U5XA 3QBQA 1U5YA 1ALYA 2JG8A 1RJ8A 2JG8C 5CIRA 2QE3A 3ME2A 2OIIA 1OQDA 1IQAA 2X29A 1C3HA 3TWIA 4E4SA 1OQEA 2WNVA 2R30A 3AB0A 2ZJCA 4MSVA 2Q1MA 5L19A 4QQ2A 1U5ZA 4J6GA 4MXWA 3MI8A 1D4VB 2JG9C 4QPYA 3IT8A 1OSGA 1D0GA 4NN0A 4DOUA 1TNFA 1O91A 2RJKA 4EN0A 1WCKA 2AZ5A 2HEWF 5KC6A 1KD7A 4DB5A 2HEVF 4RSUA 4HT1T 1PK6A 1PK6C 3WD5A 1JTZX 4F3JA 1A8MA 4N90A 5TSWA 4KGQA 1D2QA 1TNRA 2JG8B 2JG9A 2WNUA 1C28A 2WNUC 4QQPA 3B93A 4TSVA 5HBAA 4D7YA 2QDNA 3K51A 1DU3D 4MXVA 2R32A 5BNQA 2WNVB 5L36A 4TWTA 1S55A 4KGGA 2TNFA 1KXGA 3LKJA 4KG8A 4OUMA 4GIQA 3QD6A 3B94A 4G3YC 2HEYF 3TYJA 4OUSA 4MXWB 3B9IA 2E7AA 1JH5A 2Q8OA 1I9RA 5KWRA 2KA3A 4E4DX 1GR3A 2ZPXA 2Z5WA 3FC0A 3V56A 2WNVC 4QQHA 2RJLA 1PK6B 4G4FA 2TUNA 3K48A 3L9JT 2RE9A 4QQOA 3URFA 4QQLA 1RJ7A 5KC5A 1DG6A
chains in the Genus database with same CATH superfamily
2JG9B 2WNUB 1IGOA 1DQ4A 2VOXA 5KBFA 2O0OA 4GH4C 2ZEZA 4QPGA 1UX6A 3NW4A 4R8HA 4N53C 2TEPA 2G9GA 2FQPA 1RJ8A 5GZDA 4UFIA 3DEMA 2QE3A 3SH5A 1SDDB 2MNGA 4CDUC 1JYTA 1QQP3 1LECA 1OQDA 2JDNA 2WFF3 1YRZA 2VTFA 3JD73 1NXMA 2QUOA 3ACIA 3O7OA 1GWLA 1XJAA 3NNMA 4A6SA 3ZYHA 4XTPA 2XJPA 3RG0A 3OYWB 3O12A 1W06A 1N1TA 1H8TA 4V1PA 2BRTA 1T6GC 4JHZA 5IVVA 5FFOC 1DLCA 1MVEA 2G19A 4JTOA 2A3YA 3WDYA 4FQ4A 1IPKA 1J3QA 2JIGA 1W8FA 2VQ0A 3WG1A 1WCQA 1XB9A 4CCOA 1RB8G 3ORJA 4HN0A 5C8CB 4Y22B 1NZIA 5GJ6A 1L7LA 5T5JA 2C9KA 3MIHA 2P5BA 5F32A 1VBD3 1Y7BA 2D5HA 4PF1A 5A3OA 5T3NA 4CVUA 3EHKA 2RS11 1KJLA 3VZLA 5LA0A 4AVAA 4DB5A 1K3IA 1URXA 4I3PA 4N9HA 4QKNA 5FZGA 1JYWA 3VBUC 4Q4V1 4LBNA 3MBWA 1MZEA 5IATA 3ZSMA 1XNKA 3SCHA 5FBZA 5A7WB 5A7NA 3J7HA 4AHYA 4HG6B 1PGL1 4NUBA 1IZ3A 2DVBA 4KGQA 4NRQA 5FMBA 2BNMA 1JYVA 2CDOA 3HVDA 4K6BA 1KS4A 2F4PA 4XTMA 4WZFA 4K7JA 4A3ZA 1APNA 2JJ6A 1S2BA 3BCWA 4KWUA 1LB2A 2RS12 4K1YA 4RHV2 1Z78A 4LTAA 1EV13 4INDA 3X29B 2WNVB 4Q4V2 3A23A 4BPZA 5BNQA 2TNFA 1PO12 2JDKA 4XJ8A 2V73A 2FDFA 4MGIE 1XRUA 3D3AA 4GA9A 4I2OA 3VKLA 3IPVA 4AWDA 1PGL2 3OJBA 5FY7A 3WP5A 2WZ8A 3LA3A 1F5JA 3OBTA 2D3SA 2D6MA 5F39A 4YW1A 4BM8A 3PTRB 2HWB3 4RQPB 5FMDA 4OHXA 4WM8A 3B9IA 5FXZA 2HWF3 4IXLA 3BU0A 1TVGA 2X10A 1HRV2 1RXFA 2P6HA 4EWAA 4BLIA 4Q5OA 2W1WA 1OLRA 2GN7A 1ENRA 4YM0A 3UETA 4JKLA 1MS3A 2QQUA 4PDWA 1TQ5A 3FC0A 3C3VA 3KQRA 4OMDA 2WAOA 1Y4WA 3O0WA 1IHMA 1LHNA 2IUWA 2QQOA 1DYOA 5KHIA 2RE9A 1ZRIA 1NZCA 5DDJ1 2LM3A 1MZ5A 1PIV3 1PO23 1R64A 1NLRA 2FBEA 2XLFA 4OMCA 1D2SA 4W65A 4CTEA 1AYM2 4QQLA 4XAAA 3AYAA 1QJU3 5FTTC 1XOYA 2D6NA 3AZXA 4LUMA 1HX6A 2XG3A 4L9BA 2ZGQA 5IAVA 5BNOC 3S5QA 2D44A 1X8MA 3VZJA 2XQRA 3OY8B 1AR73 1YNAA 5FLJA 4CXWA 4EZ4A 2YC2A 2ENRA 5C7GA 5GLTA 2VOKA 2WZR3 4XVHA 3VBSC 3WEZA 1DP0A 5HCHA 1W9YA 3U14A 4JTNA 2ZMKA 1COV1 4S2FA 4M00A 2XWJB 4FOYA 2CDPA 5DDJ2 4LLOA 5EP9A 4Y4RA 4B1MA 1LR5A 3IDCB 1HQLA 3KWVA 1S2KA 2BU9A 1DBNA 3T2TA 4C0BA 2JKXA 2P2KA 5ANQA 4AHXA 5F3IA 1SFPA 3R4SA 2X09A 2A6WA 1IG0A 3WDWA 1CJDA 1WGPA 3MUY1 4AAXA 3S0MA 3ZFFB 1Y9GA 2ZEXA 2WS91 3SLIA 3ZFEA 3IIAA 3UNPA 3ACGA 4Z2WA 5FIXA 4M3CE 2ZHMA 5F5QA 1COV2 1UOGA 2IXIA 4MV2A 1WA4A 1OLME 4JHTA 3RZKA 4UFKA 1MQTC 5JZGB 5ACA3 1JXNA 3LQCA 4Z82A 5FO9B 2P6CA 4EN7B 2CYFA 3J8F3 4ZONA 3WVJA 4YVWC 2X5IA 1AR63 4UOJA 3IM0A 1OVPA 2ILMA 3IWZA 1YQ5A 2IFRA 4GMP3 4RR3B 5FCCA 5FY0A 5IJRA 2EF6A 3BTZA 2D6OX 1Q8OA 5A32A 3MLLA 5FY1A 4FTEA 1TMF2 1O8SA 2VZUA 2ZHKA 5JXIA 2R073 1RUH1 2JD9A 5J3UA 1REFA 3M3EA 2PHXA 2FDGA 1YFUA 3N3HA 2Z2SB 2PAKA 4YW7A 4XFBA 2R041 4LE4A 1W39A 5FZAA 3MEPA 3N9LA 2D7FA 3GDBA 3I59A 1RUD1 2YGMA 2W9XA 3T0BA 2HWC2 4DRRA 4AVCA 4ORFA 1O59A 3RMYA 1FPN1 1B35B 2VECA 2BW8A 4DNYA 1XYPA 2VW2A 4D6RA 1HLCA 1UZ0A 2Y6FA 2XUMA 2VNGA 2QBXA 4IEQA 1BBT3 4LKSA 1RUH2 3SMHA 4AVTA 5A6YA 3PUQA 3SISA 4CE8A 1NA1A 1PMHX 1UYYA 1H1AA 2BEOA 3IDBB 3OD0A 3RFRA 1H1MA 1GSLA 4Y24A 2R042 4P00B 3ZXKA 3ZIXA 1ODMA 2JDPA 5ABJC 2XKPA 3AC0A 4Q4X3 5BNPB 2FCVA 2IXLA 4MO3M 5FQ0A 4Y3OA 2JIJA 1FPN2 4XMAA 2WKKA 1L7RA 3DN7A 5KWRA 3AKTA 5J96B 3AYEA 1ENXA 4YW2A 5JCTA 2NN8A 3U10A 4E4DX 1SACA 1BXHA 2ZZJA 2ZGKA 1QDOA 3AMPA 4JGYA 4SBVA 1RUOA 2AUYA 1AYN1 2WINB 1BJQA 1R091 4LBJA 5G05L 2ZHLA 1AR92 2EALA 3AKSA 4CZSA 1AJKA 4YZ2A 3URFA 1UKRA 4MUVA 4UT5A 3H9AA 4NIHA 1F2NA 3MW2A 1JN2P 1NX9A 1JS9A 2RG4A 3VDDA 4CDQB 1QNYA 4B4QA 5FZOA 5M0TA 1W6NA 2C5DA 2E51A 4AEMA 3N7LA 3R0RA 3W21A 1LOBA 4BIOA 5IFTA 4JDOA 2GALA 2A3WA 2GH2A 3PTYA 2E26A 3U37A 3GZAA 2ZGMA 4IEZA 3NAPA 3RSJA 4AEDB 1UU4A 4LO6B 2W92A 5F3GA 4YW4A 4AI2A 2DVGA 1CGPA 3D4KA 3NL1A 1YYNA 5F7UA 1RUJ1 3EMRA 1RVF2 3PJYA 5JPMB 2OQ6A 1ZNPA 4CP9A 2E33A 1ZYBA 4UW4A 3HNYM 3NO8A 4YYOA 3I3BA 4D6QA 1WWYA 5LBFA 1H6YA 1ND3B 2RR12 2WT0A 3I54A 4MSVA 4N9IA 3SITA 3GALA 3N35A 2D98A 1F5FA 3LA2A 1KQRA 1ULPA 1WMXA 5IUQA 2LALA 3G7DA 4QMAA 1RL3A 3UYJA 5A33A 1UOFA 2GU9A 2B45X 2ZXQA 3RJRA 4TLFA 4I0BA 2EXKA 3ILFA 1CN1A 1VLNA 1MR5A 1OSGA 3AKQA 2Q8DA 2VUCA 5GALA 5EYYA 2BVVA 3T2OA 1O91A 2C1FA 5F3EA 3E6CC 2WYFA 1US2A 4N8MA 5JSOA 3RYKA 5LY2A 2VMEA 4OFGA 2P4EA 3ECQA 4WV8A 4ZU5A 3KT4A 2YBPA 2OUJA 2RJ2A 4KI5M 1RTVA 4YW6A 4BJ0A 1S0EA 3K77A 1WLTA 1ULDA 3E1F1 4WM7C 1ND2C 4RHV3 2WO3A 1RYYA 4AVBA 3T2QA 4FPGA 4QPGB 4EN6B 5AFEA 5I0DA 1PO13 2V5YA 4A7YA 1FOD2 2Y6KA 3LFIA 5J7MA 3HN1A 2QZ2A 4CU9A 2VQAA 4B7EA 3N9MA 4XF3A 3H3ZA 1ZZ8A 1DU3D 5FMCA 1VR3A 5D1IA 3CJIA 4YG3A 3KV9A 3VL9A 3EQEA 1WMDA 5C5TA 1J58A 3ETQA 5J48A 4XFHA 2YU1A 2W94A 1IPSA 1HRV3 1H8TB 2CWSA 2EAKA 4AVSA 1NOVA 4IEPA 3EB7A 2DCKA 2IXCA 4G3YC 4OUSA 4UXAA 1GV9A 3POFA 4AE2A 2FMYA 1XE0A 3CO2A 4KBZA 5HV0A 4QWNA 1WW6A 1HRI1 3N9NA 3W58A 3HJRA 3MLJA 2YPJA 2DVDA 5E16A 1G86A 4ISRA 4Q8LA 1BLZA 1AYM3 3OGSA 2NPIA 4MADA 4IE4A 4KWLA 2UWCA 2J1VA 3KMHA 3FFZA 2A7AA 4HANA 4BYYA 2VW1A 1SBFA 3TB0A 1X82A 2MHFA 2X53S 3L9JT 3VBOC 2OVUA 1E5RA 4QX2A 4AQSA 5KHGA 2CAUA 3LPGA 1S0CA 2C24A 2YFUA 3H7YA 1UF2C 1ZREA 1MVQA 2WABA 1JZ3A 1ZBA2 4D6SA 3CLPA 2QQIA 4MGQA 2YU2A 4XJAA 5DDJ3 3ALQA 3M4FA 3MIGA 3M3IA 1J59A 4IV1A 2ZGSA 2ZACA 1S0IA 5KXCA 2OW4A 2Y6HA 1J83A 4LQRA 1W8ZA 5DAVA 3I3QA 3B02A 1C5IA 5F2WA 3WF2A 1SLIA 2RMU1 2QFEA 4GKYA 4QX1A 4UFJA 3TWIA 2BPA2 3AMMA 3IPVB 1MPXA 2UU8A 4A45A 2BGPA 3B7MA 1AR82 2JDHA 4XOGA 4COYA 5I8TA 1Z7S2 5FPBA 3N4MA 2ZJCA 3ILRA 4AHWA 2WN3A 4PIXA 3WNXA 3OEAA 4QDQA 2VMCA 4WM8B 3OGVA 2VU9A 3LDBA 1GZWB 1XYNA 5DUXA 3APBA 4IEUA 4JGZA 4L0PA 1QQP1 2WFF1 5FY9A 4LEJA 1H2NA 3UL2A 3JD71 4JQRA 5JSPA 2RMU2 2BZDA 2WA4A 3C2UA 4DQAA 3WDXA 4GULA 4PDWB 1NYWA 2LUWA 5F5AA 3I2HA 4HBNA 1PZ8A 1SHWB 4BHPA 1Q8SA 4HVQA 1ACCA 2XWBB 3O0VA 4AI1A 5JDBA 3FHIB 1TMF3 4F7ZA 3H50A 2JDAA 1KD7A 1UMZA 2PYTA 4HZFA 3O1MA 5FZ9A 3WF4A 3I2OA 3I49A 5BNNA 4CUAA 2NLRA 2A3XA 1DGRN 1PK6C 4CCEA 3W20A 1UWWA 1KITA 1JTZX 1W2NA 2WFF2 3AFKA 3VZNA 2VM9A 2RM22 3PIGA 2HWC3 4UFMA 3QACA 4H3WA 1E5SA 4Y1YA 1TNRA 1VBD1 2CTVA 3ACHA 5FOJB 4IE5A 3UKTA 1LHWA 2O8QA 5EJ3A 4YFZA 3I4IA 2BNOA 3LE0A 4LE3A 4CEYA 1PHMA 2C26A 1RUH3 3D6EA 4OHYA 1MS8A 1V6NA 3T1LA 5IK8A 2WRAA 3MIFA 4KGGA 5FLHA 3ABZA 3EJKA 4YZ4A 5IVEA 4XFFA 3ENRA 2A5ZA 1WD3A 1CZTA 1O8PA 2Y8KA 1ST8A 3IB3A 3JZVA 1FPN3 3ZFEB 4XBQA 2Y0IA 3JBG2 4E2SA 1EYBA 4QPIA 1NLQA 3BTAA 1W8OA 4Q4Y3 2WZEA 3WW4A 3ZFGA 2K0GA 3PUSA 2VZ3A 4FPYA 3J4UH 4DXZA 2EICA 3H1YA 1AR93 1I9RA 4A41A 3H8OA 3AZYA 3GHMA 1QJX1 2PXJA 3ES4A 2X5IB 4N7UA 3E6BA 4LKDA 1OF4A 3IZOA 3P1IA 5A6XA 3BKZA 2R063 3UV9A 3THPA 2DVAA 2PHRA 1DQ6A 3M7AA 5CG9A 2VBPA 3MHZA 4NIIA 3DPRA 4AGGA 1S4CA 3KLSA 3AZWA 2YHJA 2B42B 2A73B 2BUKA 4K8FA 5FPVA 3WUDA 4AFBA 5C3RA 4G4FA 5FRAA 2QQLA 5A32B 1X7NA 2HWB1 1W9SA 2JDUA 2ZTNA 4CA9A 5L7OC 1GQPA 3H8RA 4LK6A 2HWF1 4CUGA 1AZDA 4RGAA 5DAQA 2RS31 5LRRA 1F4HA 3KF5A 5D2AA 2A6XA 4Q26A 3TNPB 4CCJA 2PHUA 1QJX2 3M3QA 4GH4A 3UJOA 1J3RA 3DYPA 5EV7A 1AX0A 5A80A 4X8NA 4MG2A 1RVF3 3I59B 2DCYA 3VV1A 3VD7A 5FP7A 4ZZ5A 1S0FA 5CISA 1C4RA 3WDVA 4IESA 1VB4A 2ZX0A 2ET7A 2RR13 1C3HA 1C57A 4XPVA 4L8QA 3WQ1A 2OPWA 2HWF2 3GBGA 3BU7A 1ZZ6A 4BQXA 5I93A 2RS32 3MFAA 2NM1A 3OUHA 2W39A 1NA1B 3AB0A 2XR4A 4GD4A 4XBNA 2ZMLA 4DZGA 2YY1A 1FT9A 5FY8A 1JZ7A 1AR71 3AYCA 4AFDA 1V9U1 1UMIA 1VRBA 1W9FA 2WZR1 3KS7A 4R9AA 3C7GA 4LA3A 5FQ0B 3WQ0A 3MV11 3ZPOA 3FLPA 2I74A 2JG9C 4UAPA 5IAXA 1UAIA 4S2DA 1UYPA 5IVYA 4BLJA 1BMV1 2WAAA 1W6QA 4XF1A 2NZ9A 5A3WA 1PX4A 4ITCA 1ZBE2 4GZ9A 4JGYB 4UFHA 3POEA 4GJYA 5B4XA 2G4IA 1ULGA 3O1TA 1EUUA 1GNYA 1H0BA 3KVBA 4AEKA 3FUQA 4RFT0 2Q1FA 3SNMA 1V9U2 2P1BA 3VDDB 2WZR2 3OPWA 4GWJA 1FOD3 1AX1A 1HN1A 3ZSJA 1OUXA 1KS5A 1UOBA 2WWSA 3CDZB 1WCDJ 5FZOB 2VW0A 4DMIA 1W6NB 4F3JA 3HBKA 1RUE2 5FPXA 5EHDA 5EJ1B 5FPUA 4B29A 1BMV2 5ACA1 2XMLA 3J8F1 3M1HA 2JEMA 2VZRA 1AR61 2PMWB 1A34A 3AL6A 2Y64A 3NAPB 2JE7A 2Y0OA 4QKFA 1HB3A 4NHKA 4GMP1 5FY5A 1AVBA 2WUHA 2LRPA 4LBQD 5FZ3A 3TEWA 5JI7A 3GGLA 3WW1A 4CP9B 5HV4A 2JDZA 4JDMA 3EYPA 4R9DA 5FKCA 1F8VA 3SKJE 3WY6A 1AXKA 2VTXA 4HVRA 1JYNA 4IEYA 3LOIA 2YPDA 3J8F2 1IS3A 5FYZA 3VBHC 3BUCA 1XE8A 3WNOA 3VGIA 2GAUA 1AR62 2H0BA 4R52A 4Q0SA 5A33B 1IOAA 2OYZA 1RXGA 4NAMA 5LEJA 1M06G 2VQTA 1JH5A 5FJHA 3WDUA 2V4VA 2W5FA 2R0FA 4QB1A 5JOZA 5DG2A 4W6WA 1OURA 4OHZA 1XBFA 1LGBA 4RS5C 1CQ9A 3V65A 1BBT1 4P5YA 1GQGA 4Y33A 1NY72 5I8SA 2JDMA 1ZBA3 5BPXA 2WNVC 4QQHA 4LA2A 1CAUA 1CVNA 3SXWA 2YC0A 3DXTA 3H0OA 4AEJA 4DPNA 3MPPG 1C8M3 3ZYPA 5CBLA 1RUG3 2E6VA 4Q4X1 1LTEA 5E8AA 3K3NA 1VBA2 2WIIB 4LR4A 2VMDA 1HKDA 4JKKA 4RQPC 4COVA 1XU2A 1U5XA 5FZ8A 2CGOA 3QBQA 1WMEA 1BBT2 2HWD3 1AR83 1SQ4A 1Z7S3 4IEOA 3CJIB 2QKDA 3BIEA 1DIWA 4GWNA 1POV3 2DURA 5FZMA 5FZKA 2BWCA 4WVMA 3AMNA 4TTGA 2G1MA 3AXEA 3T1MA 1W0OA 1JZ5A 2RS52 1YFWA 1PMJX 4FTBA 1SFNA 1HQNA 5JIAA 5IVBA 1TE1B 2VO5A 5DAPA 2WFPA 1H2MA 5CG8A 3GNEA 5AC92 1Q43A 2DUOA 5DUUA 1OH4A 2R7EB 1I1EA 1D4VB 1SFYA 1ZA4A 3MW4A 4GQ7A 4QU1A 1Q3EA 3NQHA 1MQTA 4KQ7A 3AL5A 4M3CA 3PU8A 2PFWA 2A1XA 2CY6A 2JENA 1OLMA 3DCQA 3N7JA 2GDFA 4I0WB 4NPRA 1UL9A 5A7OA 3INAA 3VBFB 3D5OA 2IFWA 1VAVA 4EN0A 4CRQA 2RM23 4Y1XA 3FE5A 4HT1T 2W68A 1JOPA 2YGLA 2Q8EA 2BGOA 3BOWA 4TYSA 2ZX3A 5FYYA 1O3RA 4Q0UA 4UW5A 5E6HA 1IG3A 2W95A 2XJSA 2VOVA 4IV1B 4LHKA 5CFCC 3J7MA 1TEIA 2B7YA 4Y5SA 1PX3A 1MEC2 2R1DA 3DUIA 5C4WA 4XFIA 1CX1A 3WG3A 4HPKA 1YI7A 3B93A 2TBVA 1UY2A 2H0VA 2EIEA 1XQNA 4XCAA 3RJ2X 5T5OA 1UZZA 4FFGA 1WBLA 4EROA 3JBG3 1QH6A 2P3JA 3JUUA 1OF3A 4FFFA 5FYSA 2DYCA 2WWUA 2B8MA 4FPOB 1OKOA 3P6BA 3U75A 4RHV1 2ZMNA 1S0JA 3N36A 3BGAA 5FXWA 1Y3TA 1V6JA 3V64A 1GZTA 2P3KA 4RR3C 5G04L 4BK5A 5JSRA 3FLTA 3B94A 3NSTA 1PO11 4JGZB 3LEKA 4M4RA 4XDOA 1XNCA 2OXBA 4Y26A 4ZU4A 3UGFA 2A6ZA 3OUIA 2IWGB 4QX3A 4QX8A 4R4XA 3LB9A 4WVZA 5ABJA 3OBZA 3AZZA 1DQ5A 1YXWA 1F15A 1W6PA 1GP6A 3IKWA 4LMFA 2VNRA 2Q8OA 5JOXA 4NHYA 1O5LA 3UESA 1LNSA 3SH4A 1DGRA 4XF0A 3U4XA 4XACA 5FO8B 2HBTA 1GR3A 1HRV1 2VE1A 4FFHA 4O9GA 4XILA 1REEA 2Y6JA 4WVVA 4AF9A 3FFQA 2PHFA 4WVWA 2XPJA 1QEXA 1QJX3 3I7DA 5BNNB 3I3EA 1FMD2 5C3QA 4QQOA 5FLIA 4AQ6A 5F37A 2ETEA 3LIGA 4QXHA 3IAPA 4KH9A 4COWA 5FZDA 3NRUA 3ST7A 1HB4A 1OA3A 3K46A 2DCZA 2X8KA 1B09A 2J1UA 4JZRA 4QXBA 4JX0A 1VBC2 1EUTA 3IAQA 1GZWA 4CEYB 5GZCA 1AYM1 5E89A 4ZKTB 1ZZCA 2RS33 4QGLA 4N43A 1SMVA 3AVRA 4J1XA 3ZYFA 1W04A 1IQAA 2X29A 1X50A 2XQXA 3FJSA 1NLSA 3L2YA 5CEHA 2DDUA 2UYBA 4XZPA 3O1RA 4RGGA 4OQ8A 3ZVXA 4AYUA 2O14A 1WA6X 2YC4A 1X8EA 2WO7A 3I2JA 1HB2A 4QPIB 4PCRA 3FZ3A 5T54A 4OYUA 3ZFGB 1ZBE3 1EPWA 3WHTA 3RPQA 2AYHA 2BGCA 4GJZA 3IT8A 4KU8A 2XL9A 2GC0A 3H1MA 1V9U3 4BQWA 1QXJA 3VD4A 4AK3A 2PAEA 4ZU7A 3DPRB 3J7LA 5DQ0A 5B4NA 5C3OA 4XFAA 1BKZA 2PHTA 4IEXA 1RUE3 4AEDC 2ZGPA 1YCIA 2UY8A 3B01A 2BBAA 1NCRA 2VCCA 4P5HA 5IK5A 1ZZ7A 1K12A 2VUDA 4XZUG 4UI9L 3PUAA 1GICA 4NR1A 3D0SA 4V2WA 5FYUA 3MF6A 1DF0A 1LULA 4NVPA 1QDCA 1ND2A 4WM7A 1A8MA 4CEWA 4GH4B 4D0QA 2A75A 4BZ4A 1KGYA 1G7YA 1H9PA 5TSWA 1UO9A 1ULCA 2ZGNA 4XJWA 5IT6A 5LRSA 4CP0A 3ZSLA 5T55A 3E5UA 1ASJ2 1TMF1 1LOFC 4LHNA 2OKXA 3UJQA 1VPHA 1JZ4A 2VC9A 5DMYA 2VCAA 3I2KA 1UIKA 1HV0A 3HT2A 2JE9A 2ZX1A 1BK1A 1NXD1 4AL9A 4CDWA 1SLTA 1JU4A 2G9ZA 3LFMA 5JUVA 3MO4A 4FI9A 1J3PA 1NQDA 3QCWA 3THTA 4E9KA 4X6QB 2RDQA 1YLLA 3QOPA 2ZCWA 2V72A 3LWCA 1CIWA 2HWC1 1VBE2 5LA2A 1OH3A 3T4VA 4DEQA 5C6CA 2ADEA 3PMSA 3BOPA 1LRHA 4J1WA 2E7AA 4CP1A 1ZZ9A 1CZVA 4NRPA 4DEVA 1W6QB 3ZO0B 1QOOA 3VKOA 1W3VA 3BALA 5IVJA 3A0KA 2J1RA 3HQRA 2QQJA 3Q8AA 2DVFA 3VBRC 1S0DA 2KA3A 3AKPA 5ANNA 3ZR6A 4EQVA 5A1FA 5FXXA 3O1PA 3IN9A 5DZEA 1GP4A 1LJ7A 2FDIA 4JC1A 1F4AA 1GZ9A 1VBA3 2ZX2A 1SLAA 2HBUA 4OI2A 4P9GA 4R4ZA 2G9FA 5IFPA 4JVAA 4LOSA 2VL4A 5JXGA 3O0XA 4HONA 4TN7A 4OQ9A 4Q4Y1 3WQ7A 3WF1A 3GJAA 4BQ2A 5KXEA 5HPOA 2VZOA 4TLGA 3TEZA 2CAVA 1H8TC 2VZQA 1QOTA 5KC5A 1EY2A 1AR91 2HYKA 3U1XA 4QB6A 3PVNA 1W03A 3VHNA 4DINB 1K45A 2R061 2W91A 2CNAA 3KV4A 1LAJA 2VGDA 1OVSA 5JR7B 1UD1A 3ZOIA 2PA7A 1QU0A 2RS53 1O6UA 4P14A 2E32A 1UY4A 2DV9A 2PHWA 2AC1A 4TZDA 4ZXKA 3ME2A 2XVKA 3ZSKA 1V6KA 4JRLA 2OX0A 4QX0A 1REDA 4Q4Y2 4XETA 5F5IA 4B4RA 4QB2A 1BQPA 5I0UA 4MZUA 4A4AA 5AC93 3ZMOA 3TAYA 3ZN4A 2XJRA 2W52A 1K5MC 1VB2A 2R062 3PUIA 4LKEA 1GOFA 1QXRA 1HJGA 3B69A 4XUTA 3UGGA 1RVF1 5JOYA 2AR6A 1LENA 1VJ2A 2R49A 3RVHA 3BVCA 3WNNA 4LJHA 2ZGLA 2Y33A 2OQ7A 4QHOA 5I8YA 5FR3A 1V6MA 4FPLA 2RR11 4EV0A 1W8NA 3CU7A 3BODA 3FN9A 3N7KA 1V70A 3ZXAC 4P02B 2D97A 4MLOA 1TNFA 1QJY1 2GP3A 4NRMA 2W47A 3ES1A 4CXYA 3H8UA 1G9BA 5FZ7A 3DF0A 1CAUB 2O1QA 2WO2A 1LU2A 2NMNA 4OI4A 1DQ1A 2Q8CA 3RZJA 1QXPA 1RUC2 1MEC3 5GZEA 4XDPA 1PK6A 3K4AA 2C0ZA 3WP4A 4QPWA 2HWE2 5A70A 1J84A 4BK4A 1UPSA 4HSLA 3FMGA 1R1ZA 1G9FA 1SCSA 1QJY2 5FZCA 1FI2A 4IGPA 3NV2A 2PQSA 1UU6A 3AP5A 1CIYA 4Y5TA 2IVJA 1IS4A 4FPKA 3TN92 4AVVA 1JYXA 3BYWA 5LEKA 4D7YA 3WZ1A 4EZHA 4KMQA 4HKOA 2XJTA 3HOBA 4PDWC 4WVMB 2ZGUA 4YPJA 4CDXC 1KDKA 1UCXA 2ZKNA 2RVAA 3CL1A 1FOD1 3LDKA 1GQHA 2YB7A 3SEEA 3FHQA 3THCA 1W05A 2VVDA 4Z92B 4YRDA 4FAGA 5C33A 2BVBA 2RDNA 1E5HA 4GIQA 5L73A 1LEMA 4NE9A 3ZR5A 3QD6A 4IEWA 4MYEA 1QGLA 2B9VA 4XJ9A 5JPNB 3VLBB 3I2IA 3ROUA 4PQQA 4DS0A 2WLQA 4D7TA 4QGMA 1UMHA 2EIBA 4IV3C 5JOWA 4XURA 1ZRCA 1MQTB 1H4GA 3AMHA 3D82A 4XUPA 2IXKA 2EAAA 4M3CB 3I2FA 1QJFA 3MF9A 4W6YA 1FMD3 1BCXA 4FCAA 3HWJA 1XSRA 2L9LA 1S0BA 2VNVA 5FZBA 1Y9MA 2R1BA 2KD7A 4Q2FA 2ZPXA 4MH0E 2Z5WA 4LOTA 3MV01 1R081 5D8AC 2GNDA 3CZUA 2ORZA 3OBAA 4K1ZA 4Y4YA 3ZXDA 1ENSA 1VBC3 4XABA 4XHBA 2JB4A 5L7OA 3LD8A 3VD9A 4LT5A 4LBQA 5D21A 5FP4A 4B1LA 5H9RA 1YI9A 3D8CA 2GC1A 3PIJA 4LULA 3R4DB 3ZXJA 5C4WB 1RITA 3ZYRA 1WKYA 4L2NA 3KM5A 4QDSA 5I0TA 4HPKB 4L97A 5T5LA 1XU1A 1X36A 3LA7A 1U0AA 2WA3A 3I2DA 5JXHA 1Q5OA 1PGSA 3LSDA 3R05A 1XXNA 3ZKYA 1ZBA1 1R082 3DECA 2Y60A 3J9SA 3JCIA 3QH7A 2AGSA 3MIBA 4YVSC 2XBO2 1LCLA 2Z69A 4Y1UA 2BERA 4OLLA 1JOBA 1C8M1 1IS6A 5JI9A 1MS9A 2E7TA 3VBFA 2ZX4A 1RUG1 1ULOA 2Q1ZB 4LHLA 5J37A 3LOBA 1T2XA 3C7HA 1WCSA 2PN5A 2VZSA 3T08A 1NCQC 3BTXA 1YQ8A 1OI6A 2VQUA 5ABJB 1FYUA 2HWD1 3PNAA 1AR81 1N3QA 1JBCA 1W6PB 2VD7A 1Z7S1 4KNCA 4AGVA 1GNZA 4COZA 2P3YA 4CUBA 5I0SA 1POV1 4BE3A 3N9OA 4KG0A 2QVSB 5L36A 5K8SA 1SBDA 1WMFA 2JICA 2P34A 1C8M2 3KF3A 3T30A 1V0AA 3VDAA 3ZDSA 4CU8A 1G9CA 3CEWA 1RUG2 5A3LA 2D93A 3F2ZA 5CFDA 4QM9A 2VVFA 4QHBA 2VCBA 2D6LX 2WR9A 1ODNA 4BQYA 4M0NA 2HEVF 1CAVA 3O1VA 1QHDA 2HWD2 1V00A 4R9BA 4UW3A 4AW7A 1ASJ3 3HNBM 4QXCA 2UWBA 4QX5A 3K3OA 4JCKA 1XNTA 4BMEA 3HR9A 5EPAA 3HT1A 1Q8QA 1WW7A 2ATFA 3RNSA 3T2PA 3BN6A 4N43B 3AKRA 2XGXA 1HV1A 1LOAA 2Y34A 5T52A 4IQPA 3V0AA 2RM21 1VBE3 4DY3A 2FHRA 4KWKA 1YIFA 2XL7A 1SCRA 5FYTA 4HETA 2H6BA 2ADDA 3LGRA 2WT1A 1S55A 1AXYA 1D4M2 1DZRA 1UY3A 3EO6A 1QNWA 2VBDA 3KZ4C 4KG8A 4QX7A 5F5CA 5HCFA 4AGRA 1JU3A 4FSJA 2QQVA 4A3XA 1MZFA 3H7JA 1A6CA 1UU5A 2WYSA 3DYMA 3NNJA 3VDDC 3VBHA 3WNMA 1JHNA 2HEYF 5JR2A 5LW9A 4V2VA 5FOBB 5GLVA 3HQUA 4Q27A 3TEXA 1ZX5A 3KV6A 1DHKB 3BPZA 1T6BX 4PI0A 5C9AA 4KU7A 4C1XA 2BFUS 4YARA 4HMZA 5DXDA 3CF6E 5HCBA 1GUIA 3JBG1 4OUEA 1O5UA 1GYKA 2C9AA 1N1YA 3KQ4B 1VAMA 2ZKLA 4RS5A 3A0NA 2Q30A 2UYAA 3VN4A 1NCRB 3FHAA 2P3IA 3DKWA 2KXLA 3GJBA 1UYXA 4O65A 4BIFA 4FPJA 5E88A 2LROA 5F8PA 4UW6A 1TG7A 5JLVA 2Z42A 2FZ1A 4I09A 4WM7B 1ND2B 1UZYA 2XVLA 3PDQA 4CEWB 1H4HA 4KL1A 4RYDA 3NKTA 5LK5A 2LS6A 1CWPA 1H2KA 3NJVA 4DUXA 1DG6A 3OCPA 1JUHA 3N9QA 3PMEA 2C4XA 4GKXA 2PHDA 1U12A 4YM3A 1ZM1A 1YWKA 2J1SA 3A21A 3BPSA 2VXRA 3O1SA 3KCXA 5FPZA 1SDWA 2K2SA 1GMMA 2JG8C 2BJSA 4C0HA 4GB32 1BZWA 4CDWB 4UYBA 4H2AA 1SLCA 3L2HA 1UY1A 1QIQA 4PBPA 3H8XA 3OSDA 2W1UA 2K46A 3KCYA 2W08A 1AJOA 2J42A 1LOCA 2GNMA 3O5SA 3RQ0A 4UFLA 1EP0A 2JWPA 5L9BA 5LWBA 3ZYGA 4CP2A 2DCJA 4XHXA 5FK8A 5A6QA 5K7PA 2VZVA 5CKMA 3VKMA 1LGCA 3WP3A 1YIPA 1CESA 1HXS2 2AENA 2OZ6A 2ID4A 2NMOA 2QQMA 3FUOA 1SEFA 4J6GA 1A8DA 3E97A 4JV4A 1OFSA 1L7QA 3B3QE 4QPYA 2DTYA 2JX9A 3KT1A 4N53A 1RUC3 2PTMA 3AP9A 3LEGA 4NN0A 4CDUA 4IE6A 2BOJA 4QKDA 3ZM8A 1LHOA 1OOPC 2HWE3 4Q0PA 3WG4A 4XUQA 3WF3A 5LBBA 4ES9A 4XC9A 2HEWF 5K0UC 1CR7A 4H55A 4K9SA 5FWEA 1UZVA 4HL0A 4I01A 1QJY3 1ZBE1 3WCRA 1RHI2 4C90A 3CJXA 3ELNA 1RUF2 2ZEWA 3JB4C 3TN93 4AI9A 4AQTA 3JQWA 4W50A 5CVRA 3MLKA 2HKXA 1LKNA 4LPLA 1FNZA 2VBBA 3PVEA 3POIA 2D43A 4P9YA 5CFCA 5FKBA 3C7EA 4DUVA 1MACA 3HBZA 1DZTA 5CKNA 1H9WA 5A1AA 2E9QA 1RUE1 2WNUC 4FT8A 3WXPA 3NJXA 3WOGA 1JHJA 1XNAA 4IL7A 3AP7A 1UXXX 3K4ZA 1NAEA 3IMMA 2R32A 3HQXA 1H8VA 2Y6GA 4MHRA 3IDEA 1W28A 5I91A 4OHVA 3BTYA 2WJSA 3K2OA 1OFNA 4MGSA 2VAUA 3C8XA 3IMNA 3VBUA 4DRVA 5FREA 1V6IA 5DZGA 4FP3A 4HKLA 5CB7A 3D0JA 3RS6A 3I97A 3WUCA 5JWPA 2DUQA 1A3KA 3B9CA 2FZ2A 3VD5A 1DZQA 1HW5A 4OCTA 3UK9A 4NHLA 4GWMA 1QH7A 3JB8A 2PQQA 3QLQA 4IV1C 1IS5A 3UKVA 3VD3A 1GU3A 3RZGA 2F6BA 4IE7A 3AZVA 1GWMA 2VOTA 1AXZA 1O4TA 5C8CC 3ZYBA 1OD3A 4YFWA 3WSOA 3FLRA 3W59A 5BYNA 3T4HB 4BQ5A 4NIDA 4XW3A 2A71A 1I3HA 1AL0G 1PK6B 5GKAC 1FX5A 5J98B 3E6DA 3LAGA 1FAYA 1OBNA 1NY71 3E5QA 2RHPA 4NIGA 1R083 3GCWA 1PVC2 1R1A3 3WW3A 2A6YA 2XBO3 1MS5A 3H42B 2GH8A 3P5BA 2BDRA 5FYBA 1VRH2 2AREA 4XF9A 4YGEA 4LLFA 1C1LA 2VULA 3PVOA 3QH6A 3M70A 4UF0A 2X05A 1VBA1 2UWAA 4MGYE 4ZS3A 3T3YA 3U0ZA 2OIIA 4RN5A 3U78A 2VPVA 4LO4B 4JDNA 1RGSA 3MICA 1F9KA 4GALA 3O1UA 3AMQA 5CYYA 4P9JA 4GAZA 2DU0A 4QHZA 1NE4A 4XQDA 3VHOA 1VE0A 4YM1A 1X9PA 2YUEA 4ASKA 2CSGA 1G9AA 1J1LA 1UX7A 1Q8VA 5T50A 5FYIA 5IVFA 3SH3A 2GC2A 2Q1MA 1CAXA 3C7FA 5A7QA 2MPFA 2RS51 4YNIA 5DG1A 4AFAA 5CAZA 2VJXA 4QQ2A 3WNLA 5BNOA 3MPBA 5F6LB 4E2GA 4MGTA 1RMU2 4CCNA 4Y20A 1PZ9A 1FNYA 3VB9A 1TME2 3VBSA 4PIZA 5AC91 4BOWA 3AJZA 1W2OA 3NV4A 4XF4A 5FZLA 2YFZA 2RJKA 3USUA 4HXCA 1GOGA 1QJZA 4EWEA 3W5MA 1WCKA 5L7OB 2KM2A 4CCMA 2XDVA 1BVVA 4QAWA 4LBQB 1UNBA 2FDHA 1JOJA 1VMJA 3Q9OA 1YHFA 3I2GA 2GMEA 3ZKUA 4NAOA 4FXGB 4Q4W1 1NQJA 2BYVE 4QXKA 3WD5A 2Q4SA 3GM8A 4ZZ8A 4QU2A 3HAGA 4L92A 2WQ4A 5FZ4A 4BU2A 1C5HA 1BEV3 1D2QA 3KHBA 2B9UA 3AYDA 3POWA 4AI0A 4NPLA 1FV2A 2MEV3 1D4M3 2WO1A 4LKFA 3VZOA 1S0GA 3KD4A 4H7LA 3WF0A 2IZWA 5KR7A 4B3NA 3IBMA 3OPTA 3ZXLA 2DCTA 3KGLA 4XJZA 3VDBA 1GFF2 4GMP0 4ET7A 4YVWA 1MEC1 2W0XA 3VL8A 1W0NA 5EQUA 2OUHA 5FP8A 2WN2A 4Q4W2 3GCXA 3FX3A 4IE0A 1W9WA 5L9RA 3VDCA 2YZ4A 2EIGA 2D6KA 1HJFA 1WLCA 5JAXA 1HN0A 1S2EA 1UOJA 4MVTA 1GBGA 1GANA 1OKQA 1GP5A 1QOSA 4Z07A 5EFUA 3ZYIB 2VZTA 3USSA 3RMXA 1WCUA 4A6OA 4TXWA 1OD5A 5H9PA 3ZFFC 3T09A 2WL1A 5DAWA 2QJVA 3HNMA 4EWDA 4L11A 4ZPIA 4CPBD 3W5NA 4FO9A 4GXLA 5GLWA 2WSUA 5CFDB 3VBRA 5FK7A 1WUVA 4CCLA 2DBNA 1JZ8A 5JZGC 2ZBJA 1CAWA 1CAVB 5FUPA 4RFRB 2PLV2 2EXHA 4IGOA 1VBB1 5KHHA 4DFSA 3POBA 3WR0A 2WT2A 4XFCA 4E8DA 1K42A 2JECA 2HJIA 2UY9A 1DGWX 3VZMA 5KHKA 2VZPA 4FQZA 4AAPA 3H3LA 1TZOA 2XOMA 2ZA9A 3PL0A 4GB33 5FWJA 1FMD1 1GKBA 3U4SA 5FYCA 4F83A 1AX2A 1JI6A 4AR2A 2N7GA 2B4KA 3CBNA 5DAXA 4Z2AA 5J09A 4XIKA 3NNLA 5K4LA 3LSEA 3V0AB 1EPZA 4FOQA 3KGZA 1QY4A 2WC2A 4FPFA 4PQ9A 1VBB2 5FMOS 4E4HA 1IQDC 1VBC1 5JMOA 1ONAA 1UW8A 2B5HA 1E5IA 4K3UA 5CADA 1HXS3 5H9QA 4D7SA 5AVAA 4ZHNA 4EJRA 2XH6A 4S2HA 3VBHB 1K5MA 1W2TA 1B35C 2ERFA 5IYYA 2XHNA 3MYXA 1YC61 3ASIA 2W2IA 2EA7A 5LBEA 4LUKA 1VP6A 3CIHA 3IDAA 2A70A 1UYZA 5CNAA 1N3PA 5A3UA 5C9AB 4QT6A 1F35A 4RGKA 4F8AA 2VMGA 3HEIA 4JRAA 2FDKA 4K40A 2XLAA 3AM2A 2I07B 4FPCA 3JQXA 1RHI3 1S1AA 4RS5B 4XJUA 4A2UA 1RUF3 2Y26A 3WQBA 2GSYA 3N9PA 4MHUA 5BNPC 4CU7A 2WNOA 3MGUA 2VMIA 2AZ5A 2BTVC 4NWVA 3U07A 5FYMA 1JYCA 4NHXA 4WBBA 5C5UA 5B2GB 1RUI3 1POQA 1UQXA 4URTA 2I45A 1JYIA 1ENQA 5GLZA 4Z1VA 3KV5A 5FZIA 1SLBA 1RIRA 3NV1A 1M4WA 5FO7B 4CDQC 3O1OA 1OA2A 2W87A 5HI0A 1DCSA 1JUIA 2DF7A 5HBAA 2NQYA 2YXSA 4LBMA 2JDYA 3K51A 4CDXA 2V4AA 5K9YA 4ASLA 4XQ4A 1LEDA 1ASJ1 4P9WA 4BQ3A 1KXGA 1YJKA 3K75B 1UN1A 3U11A 4I3GA 3WT3A 2V09A 1QKQA 1SG3A 4P9XA 4OUMA 1K5JA 2XJQA 2VMHA 3ATGA 4XYXA 2D5FA 5H9SA 1O3TA 3SCGA 1I6XA 5A1LA 3UKNA 2VR4A 1OUSA 4IV3A 3T0AA 2CHHA 1OLQA 1ND3C 1VBE1 2XHKA 3OTFA 4I02A 3AP4A 4N53B 5EXOA 3RWKX 1XNBA 1O4ZA 4CDUB 3OPZA 5FZ1A 4I30A 1LU1A 3A22A 1AUYA 3ZX7A 3HIFA 3A4UA 2CWMA 2XXZA 3S6PA 3POJA 2QQNA 1PVC3 4R9CA 1XNDA 4NWWA 4S2GA 5D8AA 5J1XA 4Y5Z0 4YG6A 3V56A 3J26N 2CL2A 5FZ0A 5IW0A 3SQOA 3UT0A 3WW2A 1H6XA 2NYYA 3BI3A 1JW6A 3BIWE 3OG2A 2DTWA 3PHMA 1VRH3 2W46A 2XJVA 3ZPYA 4KBBA 3POGA 5FYVA 4D69A 5T5PA 1ZVFA 5CFCB 2VOWA 3PJQA 1RJ7A 4XIOA 1ZRDA 4NHMA 3ZIWA 4BDVB 4SLIA 1VAKA 3KSCA 3OF1A 4P9IA 1IKPA 3MFCA 1XE7A 4WZCA 3WDTA 2DBIA 4QM8A 5LB6A 4NO4A 4QPGC 1U5YA 5KXDA 5CIRA 2FMDA 4LO8A 4C91A 5FDBA 2ES3A 4YVSA 1IKQA 4HN1A 1W6MA 4Q0QA 3THDA 4FTSA 1FXZA 5FP3A 3AP6A 2UURA 4B4PA 3LCPA 1OQEA 2ZEYA 1BVP1 3VBUB 2OS2A 4K8RB 2WS92 3AVSA 5AVPA 3VBOA 1NCQA 3LDRA 4OI0A 1RMU3 3S7IA 2DFBA 3E5XA 4AI8A 1TME3 3RI8A 4DUWA 1W2AX 4BXFA 1GLHA 2DWRA 3GZEA 4PJYA 5FZEA 5SV5A 4G9SB 5C8WA 1U5ZA 4NIAA 1UPIA 5C3PA 4I0AA 5SV8A 5C4WC 1FV3A 2FDJA 1CPMA 1UY0A 4LITA 3AJYA 3K4DA 4HVOA 2FCTA 2D6PA 3GBWA 3POSA 2R16A 4O61A 3TOJA 2VXJA 1ZZBA 4OZXA 4BISA 1HIXA 4MGZE 2QZ3A 2QQPA 1O4YA 2YDEA 4RSUA 2J1EA 4K21A 4UWDA 1W6OA 1YUDA 1IPJA 4FP2A 3WLUA 2BBVA 1KFXL 4YM2A 1XYOA 2PAMA 2P37A 1DQ0A 5FBJA 4MGKE 3M3CA 1RUC1 4HSJA 4XEZA 2WQ8A 1N47A 1RUD2 2FCUA 4NROA 1SPPA 3I8TA 5KHJA 4UF0B 1ULFA 4Q4W3 2ET1A 1CONA 2HWE1 2WBKA 5DABA 4HK9A 4XBLA 4M0HA 5EZWA 4FPEA 5JMCA 4M01A 4ARXA 2XVGA 1W2UA 4TWTA 4BB3A 3TN91 4QKBA 5A3MA 3FWEA 4P08A 3KT7A 4LBOA 4QD2A 2AACA 2P17A 3WV6A 3OGGA 1ZRFA 1CAXB 2IC1A 4LIVA 1V6LA 3H1WA 1YO8A 3TYJA 4Q0VA 4X6RB 5CU1A 5BNOB 1AL21 1BYHA 2ZABA 4YW5A 2DFCA 1HDKA 3CKHA 3OBRA 3GBFA 3GF6A 4WM8C 4Y20B 3S7EA 2PLV3 5F3CA 3N7MA 2WDBA 3VBSB 1AYN2 4LXLA 4E2QA 1V6OA 1D0HA 4YZ1A 4N43C 4LO5B 1R092 3USUB 5F1RA 2PHLA 5BXXA 4Q1PA 4HK8A 1W99A 3NNGA 1N3OA 4W4ZA 4ZY9A 4OZOA 4C8DA 3KHCA 4D3WA 5BUVA 2TUNA 3PVBB 1LODA 1AL22 2F4LA 3ON7A 1OMIA 2QCSB 4HKWA 4E4ZA 1US3A 4EN9B 2CGPA 3KVAA 4QGNA 1VBB3 2RDSA 4LO7A 4MX3A 5EJZB 2QTWB 2CU5A 3A7QA 4X8PA 4DIQA 4XXAA 3VZKA 3MZHA 2JG8A 2YV8A 3AK0A 1OXCA 1RUJ2 3DL3A 3HD8B 4YVWB 1PM7A 3RWNA 3VKFC 3ZXGA 5FPLA 2BFUL 2EXIA 3I3DA 4CXXA 1CJPA 3RZHA 3ZYJB 3T0DA 4ASMB 2BOIA 1JODA 1NCRC 4L99A 3ZMNA 1R1A1 4LBLA 3GHNA 5LK7B 2XBO1 1GNHA 2VUJA 1XC6A 2RS13 1JZ6A 3AFGA 3LEMA 2BWAA 4XE9A 1G9DA 4AI3A 4CEWC 3EXUA 5IVCA 4Q4V3 2OT7A 2DU1A 5FV3A 3P3NA 4FVVA 3ZFEC 3KB5A 3ZN5A 3CMGA 1KDMA 4MXWA 5FP9A 2GP5A 1MS0A 3VBRB 1NUKA 2Y38A 2AEYA 5LA1A 3OOXA 3RYRA 2Z79A 4PLOA 5EIYB 1CAWB 2ARAA 1OOPA 1R1A2 2VH9A 1EAH1 2WZPP 2Q0AA 3O14A 3RDIA 4ONUA 1J1TA 2X5IC 4AHZA 5K0UA 4CDWC 1XSQA 2OZJA 3WP6A 1N1SA 3WCSA 1BHGA 4CCDA 3V0BB 2HYXA 3WNKA 1SBEA 3ZN6A 1O3SA 3LZZA 3CNAA 5GM0A 4AXOA 5FPAA 3PURA 4UBGA 4BMBA 4XUNA 2QQKA 1GOHA 1F31A 4XCBA 1OPOA 5J36A 4BXSV 5EWSA 4Y1VA 5LCWL 3BB6A 3DKQA 2JG9A 2WNUA 1EAH2 1C28A 2I2SA 3MIEA 2VY0A 3IIIA 4TSVA 4W8JA 5FJKA 5FAXA 4QDRA 4MXVA 5BV6A 3FBYA 2IVIB 3VKNA 4LBKA 1K5MB 2RV9A 4YGCA 5DUWA 4META 2HLEA 1JMUB 3S5AA 4OHWA 1BEV1 5IK4A 1VIWB 4B8EA 3WHUA 2VG9A 2SLIA 1HRI2 3MW3A 1OQ1A 3TRSB 2MEV1 2B46X 1D4M1 1NA1C 2E53A 2VMFA 3NNFA 3OYWA 4AQ2A 2YMZA 1KJRA 2DUPA 4PIYA 1OPMA 4GWIA 1NE6A 2HH9A 1RINA 3POYA 1PM4A 1KRIA 3VUOA 5HCAA 3HMYA 2PELA 3ETPA 1Q8PA 2XKOA 4M3CF 4UBHA 4YGDA 3RGBA 5A7PA 5C8CA 4XXPA 1SZBA 4Y22A 4YLZA 3RRDA 5L9VA 3PU3A 1JZ2A 1DLLA 1BEV2 2YBSA 3S57A 4JGYC 4Q8KA 2RJLA 2WWJA 1RC6A 2MEV2 3FBMA 1G6NA 3R6SA 1COV3 5FZHA 5HXMA 5KXBA 2ZZQA 3Q8FA 4NMIA 4HFSA 4EYUA 2OPKA 4DXRA 5A7WA 5DZFA 1PVXA 4OULA 2YROA 2R6QA 4AZZA 5DPNA 3SHRA 2JD4A 1Z0HA 1YQ2A 2GMMA 5ISLA 3G6JB 4ARYA 4CSWA 2WS93 4CDXB 2GMPA 1SLLA 4YW3A 5ERLA 5CA6A 3WG2A 4XDQA 1Y43B 3ZLIA 3NAPC 3PUHA 1ZA7A 3B00A 5HXVA 3LEIA 5F2SA 3LIHA 3Q8CA 5FZFA 4E4SA 4CPBA 5JIUA 3R4UA 4E27A 2WNVA 4PT6A 4GB31 2ZS6B 5C70A 4Q1RA 3MDPA 1X33A 2J22A 3Q8EA 3ZXEA 2BV4A 3OD4A 1QQP2 2W3JA 3VHRA 4IV3B 3JD72 1ULEA 1W90A 2H6CA 2YG0A 5C3SA 2FD8A 3ZXFA 4PLMA 4YZ3A 1NT0A 2ZGTA 5L19A 3DXUA 5FUNA 4PLNA 3FL7A 4FPHA 1X9TA 4RQPA 1W3XA 2ZAAA 1OHFA 3MI8A 1POV0 3NKGA 3VHPA 2XUEA 2XLGA 2YYOA 1PMIA 5AFBA 1HXS1 1D0GA 3ITQA 5FZ6A 3RI9A 5APAA 3SCFA 3OB8A 2E7QA 4LK7A 5D8AB 2VZ1A 2BP6A 2JE8A 2GC3A 1UZWA 2R043 2CV6A 4IEVA 1STMA 3OEBA 5A3TA 1RUD3 4XQWA 2E63A 3EBRA 4LNVA 2ZAHA 4YSFA 1DDLA 1H30A 1VBD2 3LPFA 5LBCA 1O7FA 2J1TA 4LORA 2JB8A 3H3UA 4W6XA 5IHRA 4E8CA 3M3OA 1MZ6A 4K20A 4NJ4A 3ZDVA 3MIDA 4JKMA 4NOTA 1RHI1 2GZWA 2EVXA 1A78A 1RUF1 2WSVA 1EV11 3CQOA 4FOVA 1G8WA 4RA0A 5DUVA 4YVSB 4URAA 1W6MB 3OY8A 4XFGA 1LHVA 3SC7X 4LHSA 5I0RA 5A6ZA 5JXJA 1PNGA 2CGNA 1W0PA 4HLTA 1RUI1 5LATA 3SKVA 2VNOA 1CD3G 3NJYA 4YG0A 4BA6A 3CJIC 2D3PA 2VCMA 5FUIA 1UXZA 4BH9A 2YBKA 1YFYA 1CPNA 1NCQB 3LKJA 3VBOB 4YGBA 5C71A 1P8JA 4FFIA 2D3RA 3KCCA 4U2AA 4H14A 4IERA 3WINE 1AYN3 4A7ZA 1YQ6A 1KEXA 1PNFA 2QNKA 1E57A 1EV12 1R093 4AFCA 3TEYA 5FYHA 1UKGA 3ACFA 5FXVA 4OI1A 1YEWA 1WLWA 1BK0A 3ZFFA 3WX5A 1GZCA 1CX4A 2BNNA 4DY5A 1N1VA 1RUI2 2JKBA 4CYDA 2WNEA 1W8HA 1QMJA 2W1SA 4YWAA 2GN3A 1AL23 2Q5TA 1U5IA 4DO0A 1DFQA 1VMFA 2F17A 2HWB2 4U36A 5JZGA 1PIV1 1PO21 3M8LA 1HQWA 4XMIA 1MS1A 1QJEA 2D40A 1WBFA 3TBDA 1W6OB 5F6KA 5LY1A 4DXTA 2GNBA 3VBFC 1FATA 4PBOA 1QJU1 3JU9A 1VMHA 4ATFA 3K48A 2ZHNA 2AEZA 3NVCA 1RUNA 3M2MA 4CUCA 4RR3A 1I5ZA 2QDRA 5CZKA 1RUJ3 2E31A 2EXJA 1LOEA 1SPPB 3F95A 3RZMA 5IWFA 2GNTA 2C6SA 5E1RA 2ARBA 2K9ZA 4Q29A 4JQTA 1PIV2 1PO22 1NG0A 1PVC1 4NPMA 4PHZA 1ALYA 2IXJA 1HB1A 2ARXA 3AXDA 4JAAA 3OGRA 1QJU2 3NMBA 1Y9QA 2ZGOA 3ILNA 1DGLA 1DYPA 1VRH1 2AH2A 4AFMA 5CFDC 4AG4A 2ZOEB 2VVEA 5GLUA 3DGTA 2J1AA 5CKQA 1C8NA 2ORXA 1D7PM 1AR72 2J7MA 3J7NA 4ISQA 2R30A 4RL7A 1B35A 2A6VA 1NKGA 2LTNA 1WLDA 3ACLA 4CCKA 4IUGA 3V0BA 2KR2A 2SBAA 1Q56A 4IDZA 1UIJA 3RYPA 3CZJA 3PLQA 2OA2A 1DGWA 4JGZC 5JVVA 1PZ7A 2RDRA 2VTXJ 4Y1ZA 3OGJA 4DOUA 5BNPA 3LF7A 4O7XA 1W8UA 1AHSA 4COUA 3P3PA 1H2LA 4O9EA 1AF9A 4IGQA 4CU6A 1OC1A 1RMU1 1L3JA 3DV8A 4PF5A 1H1IA 5KC6A 1MS4A 3AX4A 1TME1 2XONA 4KWJA 3NWKA 5FMOL 4A42A 1W9TA 4CCCA 5LA9A 1DYKA 2JXAA 3S30A 3WNPA 4AOCA 2R071 5ACA2 4N7IA 1EAH3 1WW5A 2VUAA 3GYDA 4IW3A 5LASA 3GZUC 4BCUA 5BNNC 5DN2A 1YQCA 3Q8BA 4FOWA 4OVEA 4N90A 3NV3A 4B7KA 4H7MA 4CDQA 1I5PA 4LIUA 4ATEA 4BQ1A 5IK7A 5C9AC 2JG8B 1CZSA 4RD7A 4XAEA 4Z8BA 4ZS2A 1WW4A 3HN3A 1OA4A 2XJUA 4QQPA 4FBFA 4D94A 2Z4FA 3OUJA 2XB6C 4CEYC 5A7SA 1OT5A 4XUOA 2O8OA 2QDNA 2ARCA 2QQWA 4YZ5A 1GWKA 1HRI3 1W8TA 2R072 3I3MA 2LW8A 4C1WA 1LGNA 5LZ6A 4BQ4A 4PI2A 2Y6LA 2V5DA 1DQ2A 1LESA 3DYOA 3TNQA 4AEDA 3W9AA 1VALA 2W1QA 4HOOA 4J25A 4A44A 4P9LA 5GZFA 4MOAA 4EE2A 5BY5A 1C1FA 1XPWA 1YFXA 4MXWB 1ND3A 4QPIC 1PGW1 5F9TA 2WQZC 1W8WA 3GZTB 1QF3A 2NP0A 3ZFGC 3RZLA 2BQPA 3HPNA 2ZGRA 1LOFA 5GZGA 2IXHA 5A3NA 4ES8A 4FXKB 1OOPB 3C7OA 1LOGA 3NJZA 4FAHA 4EN8B 5K0UB 2R0HA 3RZZA 2WLPA 4IETA 1QWRA 1LHUA 1WD4A 5FY4A 1O3QA 3DPRC 1YJLA 4Q4X2 3ZSEA 3B5LB 3JXSA 3ZN6B 5A3PA 4M4PA 2RMU3 1KFUL 1PGW2 4A7KA 4ZXEA 3GXUA 1WZXA 2PLV1 3UGHA 4DXSA 2B39A 3CHXA 5EYXA 3SEPA 4BWOA 4D8MA 3MUZ1 2EIDA 1ZRRA
chains in the Genus database with same CATH topology
2JG9B 2WNUB 1IGOA 1DQ4A 2VOXA 5KBFA 2O0OA 4GH4C 4QPGA 1UX6A 3NW4A 4R8HA 4N53C 2TEPA 2G9GA 2FQPA 1RJ8A 5GZDA 3SH5A 2QE3A 4CDUC 2MNGA 1QQP3 1LECA 1OQDA 2WFF3 1YRZA 3JD73 1NXMA 2QUOA 3O7OA 4XTPA 2XJPA 3RG0A 3OYWB 3O12A 1N1TA 1H8TA 4V1PA 1T6GC 5FFOC 1MVEA 3WDYA 4JTOA 2A3YA 4FQ4A 1IPKA 1J3QA 2VQ0A 3WG1A 1RB8G 4HN0A 5C8CB 4Y22B 5GJ6A 5T5JA 3MIHA 1VBD3 1Y7BA 2D5HA 5T3NA 3EHKA 2RS11 1KJLA 3VZLA 4AVAA 4DB5A 1URXA 4I3PA 4N9HA 3VBUC 4Q4V1 4LBNA 1MZEA 3ZSMA 1XNKA 3SCHA 5FBZA 4AHYA 1PGL1 1IZ3A 2DVBA 4KGQA 2BNMA 4K6BA 1KS4A 2F4PA 4XTMA 4WZFA 4K7JA 1APNA 2JJ6A 1S2BA 3BCWA 1LB2A 2RS12 4K1YA 4RHV2 1Z78A 4LTAA 1EV13 4INDA 3X29B 2WNVB 4Q4V2 4BPZA 5BNQA 2TNFA 1PO12 4XJ8A 2V73A 4MGIE 1XRUA 4GA9A 4I2OA 3VKLA 3IPVA 4AWDA 1PGL2 3OJBA 3WP5A 3LA3A 3OBTA 1F5JA 2D3SA 2D6MA 4YW1A 4BM8A 2HWB3 4RQPB 4OHXA 4WM8A 3B9IA 2HWF3 4IXLA 1HRV2 4EWAA 4BLIA 1OLRA 2GN7A 1ENRA 4YM0A 1MS3A 4PDWA 1TQ5A 3FC0A 3C3VA 3KQRA 3O0WA 1IHMA 1LHNA 5KHIA 2RE9A 1NZCA 5DDJ1 2LM3A 1MZ5A 1PIV3 1PO23 2FBEA 1NLRA 2XLFA 4W65A 1D2SA 4CTEA 1AYM2 4QQLA 3AYAA 1QJU3 5FTTC 2D6NA 3AZXA 4LUMA 1HX6A 2XG3A 4L9BA 2ZGQA 5BNOC 2D44A 1X8MA 3VZJA 3OY8B 5FLJA 1AR73 1YNAA 2ENRA 5GLTA 2VOKA 2WZR3 3VBSC 4JTNA 2ZMKA 1COV1 4S2FA 4M00A 2XWJB 4FOYA 5DDJ2 4LLOA 1LR5A 3IDCB 1HQLA 1S2KA 1DBNA 3T2TA 4C0BA 2P2KA 4AHXA 3R4SA 2A6WA 3WDWA 1CJDA 1WGPA 3S0MA 3ZFFB 2WS91 3SLIA 3ZFEA 3IIAA 4Z2WA 4M3CE 2ZHMA 5F5QA 1COV2 2IXIA 4MV2A 1WA4A 1MQTC 5JZGB 5ACA3 1JXNA 4Z82A 5FO9B 4EN7B 2CYFA 3J8F3 3WVJA 4YVWC 2X5IA 1AR63 3IM0A 2ILMA 3IWZA 2IFRA 4GMP3 4RR3B 5FCCA 2EF6A 2D6OX 1Q8OA 5A32A 3MLLA 4FTEA 1TMF2 2ZHKA 2R073 1RUH1 5J3UA 1REFA 3M3EA 2PHXA 1YFUA 3N3HA 2Z2SB 2PAKA 4XFBA 2R041 4LE4A 1W39A 3MEPA 2D7FA 3I59A 1RUD1 2YGMA 4DRRA 2HWC2 4AVCA 4ORFA 3RMYA 1FPN1 1B35B 2VECA 2BW8A 4DNYA 1XYPA 2VW2A 1HLCA 3V0BB 2XUMA 2VNGA 4IEQA 1BBT3 4AVTA 1RUH2 3SMHA 3SISA 1NA1A 2BEOA 1H1AA 3IDBB 3OD0A 1H1MA 1GSLA 4Y24A 2R042 3ZXKA 3ZIXA 5ABJC 2XKPA 4Q4X3 5BNPB 2IXLA 5FQ0A 1FPN2 4XMAA 2WKKA 3DN7A 5KWRA 3AKTA 5J96B 3AYEA 1ENXA 4YW2A 5JCTA 2NN8A 3U10A 4E4DX 1SACA 1BXHA 2ZZJA 2ZGKA 1QDOA 3AMPA 4JGYA 4SBVA 1RUOA 2AUYA 1AYN1 2WINB 1BJQA 1R091 4LBJA 2ZHLA 1AR92 2EALA 3AKSA 4CZSA 1AJKA 4YZ2A 3URFA 1UKRA 4MUVA 3H9AA 1F2NA 3MW2A 1JN2P 3VDDA 4CDQB 1QNYA 4B4QA 1W6NA 2C5DA 2E51A 4AEMA 3N7LA 3R0RA 4BIOA 1LOBA 4JDOA 2GALA 2A3WA 2GH2A 3PTYA 3GZAA 2ZGMA 4IEZA 3NAPA 3RSJA 4AEDB 1UU4A 4LO6B 4YW4A 4AI2A 2DVGA 1CGPA 3D4KA 3NL1A 1YYNA 5JPMB 1RUJ1 1RVF2 3PJYA 1ZNPA 4UW4A 1ZYBA 3NO8A 4YYOA 1ND3B 3SITA 2RR12 2WT0A 3I54A 4MSVA 4N9IA 3GALA 3N35A 2D98A 1F5FA 3LA2A 1KQRA 5IUQA 2LALA 3G7DA 4QMAA 1RL3A 5A33A 2GU9A 3RJRA 2B45X 4TLFA 4I0BA 2EXKA 3ILFA 1CN1A 1VLNA 1MR5A 1OSGA 3AKQA 5GALA 5EYYA 2BVVA 1O91A 2C1FA 3E6CC 5JSOA 3RYKA 4OFGA 3ECQA 4WV8A 4ZU5A 3KT4A 1RTVA 1S0EA 1WLTA 1ULDA 4WM7C 1ND2C 4RHV3 4AVBA 4FPGA 4QPGB 4EN6B 5AFEA 1PO13 2V5YA 4A7YA 1FOD2 5J7MA 3HN1A 2QZ2A 2VQAA 4B7EA 4XF3A 3H3ZA 1ZZ8A 1DU3D 1VR3A 5D1IA 3CJIA 4YG3A 3VL9A 3EQEA 1WMDA 1J58A 3ETQA 5J48A 4XFHA 1HRV3 1H8TB 2CWSA 2EAKA 4AVSA 1NOVA 4IEPA 2DCKA 2IXCA 4G3YC 4OUSA 4UXAA 1GV9A 4AE2A 2FMYA 3CO2A 1WW6A 1HRI1 3W58A 3MLJA 2YPJA 2DVDA 5E16A 1G86A 4ISRA 4Q8LA 1AYM3 2NPIA 4KWLA 2UWCA 3KMHA 3FFZA 2A7AA 4HANA 4BYYA 2VW1A 1SBFA 3TB0A 1X82A 2MHFA 2X53S 3L9JT 3VBOC 2OVUA 4AQSA 5C33A 5KHGA 2CAUA 1S0CA 3H7YA 1UF2C 1ZREA 1MVQA 1ZBA2 3CLPA 4XJAA 5DDJ3 3ALQA 3M4FA 3MIGA 3M3IA 1J59A 4IV1A 2ZGSA 2ZACA 1S0IA 5KXCA 2OW4A 3B02A 1C5IA 1SLIA 2RMU1 2QFEA 4GKYA 3TWIA 2BPA2 3AMMA 3IPVB 2UU8A 3B7MA 1AR82 4XOGA 4COYA 5I8TA 1Z7S2 3N4MA 2ZJCA 3ILRA 4AHWA 4PIXA 3WNXA 4WM8B 2VU9A 1GZWB 1XYNA 5DUXA 3APBA 4IEUA 4JGZA 1QQP1 2WFF1 5JSPA 4LEJA 1H2NA 3UL2A 3JD71 4JQRA 2RMU2 2WA4A 3C2UA 4DQAA 3WDXA 4GULA 4PDWB 1NYWA 2LUWA 4HBNA 1PZ8A 4BHPA 1Q8SA 4HVQA 2XWBB 3O0VA 5JDBA 4AI1A 3FHIB 1TMF3 4F7ZA 3H50A 1KD7A 1UMZA 2PYTA 4HZFA 5BNNA 2NLRA 2A3XA 1DGRN 1PK6C 1KITA 1JTZX 2WFF2 3AFKA 3VZNA 2RM22 2HWC3 3QACA 4H3WA 4Y1YA 1TNRA 1VBD1 2CTVA 5FOJB 5FO8B 3UKTA 1LHWA 2O8QA 5EJ3A 4YFZA 3I4IA 2BNOA 4LE3A 4CEYA 1PHMA 1RUH3 3D6EA 4OHYA 1MS8A 1V6NA 3T1LA 5IK8A 3MIFA 4KGGA 5FLHA 3EJKA 4YZ4A 4XFFA 3ENRA 2A5ZA 1WD3A 3JZVA 1FPN3 3ZFEB 4XBQA 2Y0IA 3JBG2 4E2SA 1EYBA 4QPIA 3BTAA 4Q4Y3 3WW4A 3ZFGA 2K0GA 4FPYA 3J4UH 4DXZA 3H1YA 1AR93 1I9RA 3AZYA 3GHMA 1QJX1 4N7UA 3ES4A 2X5IB 3E6BA 2R063 3UV9A 3THPA 2DVAA 2PHRA 1DQ6A 3M7AA 5CG9A 3DPRA 4AGGA 3KLSA 3AZWA 2YHJA 2B42B 2A73B 2BUKA 4K8FA 3WUDA 4AFBA 4G4FA 5FRAA 5A32B 1X7NA 2HWB1 2ZTNA 5L7OC 2HWF1 1AZDA 4RGAA 2RS31 5LRRA 2A6XA 4Q26A 3TNPB 2PHUA 1QJX2 3M3QA 4GH4A 3UJOA 1J3RA 5EV7A 1AX0A 4X8NA 1RVF3 3I59B 2DCYA 3VV1A 1S0FA 1C4RA 3WDVA 4IESA 1VB4A 2ZX0A 2ET7A 2RR13 1C3HA 1C57A 4XPVA 4L8QA 3WQ1A 2HWF2 3GBGA 3BU7A 1ZZ6A 5I93A 2RS32 3MFAA 2NM1A 2W39A 1NA1B 3AB0A 4XBNA 2ZMLA 4DZGA 2YY1A 1FT9A 1AR71 3AYCA 4AFDA 1V9U1 2WZR1 3KS7A 4R9AA 4LA3A 5FQ0B 3WQ0A 3FLPA 2I74A 2JG9C 1UAIA 4S2DA 4BLJA 1BMV1 1W6QA 4XF1A 2NZ9A 4ITCA 4JGYB 1ZBE2 2G4IA 1ULGA 1H0BA 4AEKA 3FUQA 4RFT0 3SNMA 1V9U2 3VDDB 2WZR2 3ZSJA 1FOD3 1AX1A 2WWSA 1KS5A 1WCDJ 2VW0A 4DMIA 1W6NB 4F3JA 1RUE2 5FPXA 4B29A 1BMV2 5ACA1 3J8F1 3M1HA 2JEMA 1AR61 3NAPB 2JE7A 2Y0OA 4NHKA 4GMP1 1AVBA 4LBQD 5JI7A 3WW1A 2JDZA 4JDMA 4R9DA 1F8VA 3WY6A 1AXKA 4HVRA 4IEYA 3LOIA 3J8F2 1IS3A 3VBHC 1XE8A 1AR62 3VGIA 2GAUA 2H0BA 4R52A 4Q0SA 5A33B 1IOAA 2OYZA 5LEJA 1M06G 1JH5A 3WDUA 2R0FA 5JOZA 5DG2A 4W6WA 4OHZA 1LGBA 4RS5C 1CQ9A 3V65A 1BBT1 1GQGA 1NY72 5I8SA 1ZBA3 5BPXA 2WNVC 4QQHA 4LA2A 1CAUA 1CVNA 3SXWA 2YC0A 3H0OA 4AEJA 4DPNA 3MPPG 1C8M3 3ZYPA 5CBLA 1RUG3 2E6VA 4Q4X1 1LTEA 5E8AA 1VBA2 2WIIB 4LR4A 1HKDA 4RQPC 4COVA 1XU2A 1U5XA 2CGOA 3QBQA 1WMEA 1BBT2 2HWD3 1AR83 1SQ4A 1Z7S3 4IEOA 3CJIB 2QKDA 1DIWA 4GWNA 1POV3 2DURA 2BWCA 4WVMA 3AMNA 3AXEA 3T1MA 1W0OA 2RS52 1YFWA 4FTBA 1SFNA 1HQNA 5JIAA 1TE1B 2WFPA 1H2MA 5CG8A 3GNEA 5AC92 1Q43A 2DUOA 5DUUA 1I1EA 1D4VB 1SFYA 1ZA4A 3MW4A 4GQ7A 1Q3EA 4KQ7A 1MQTA 4M3CA 2PFWA 2CY6A 2JENA 3VBFB 3N7JA 2GDFA 4I0WB 4NPRA 1UL9A 4EN0A 3INAA 3D5OA 2IFWA 1VAVA 4CRQA 2RM23 4Y1XA 3FE5A 4HT1T 2W68A 2YGLA 3BOWA 4TYSA 2ZX3A 1O3RA 4Q0UA 4UW5A 2XJSA 2VOVA 4IV1B 4LHKA 5CFCC 1TEIA 2B7YA 3DUIA 1MEC2 2R1DA 5C4WA 4XFIA 3WG3A 4HPKA 1YI7A 3B93A 2TBVA 2H0VA 1XQNA 3RJ2X 5T5OA 1UZZA 1WBLA 4EROA 3JBG3 1QH6A 2P3JA 3JUUA 2DYCA 2B8MA 4FPOB 4RHV1 2ZMNA 1S0JA 3N36A 5JSRA 1Y3TA 1V6JA 3V64A 4RR3C 2P3KA 3FLTA 3B94A 3NSTA 1PO11 4JGZB 1XNCA 4Y26A 4ZU4A 2A6ZA 4WVZA 2IWGB 4R4XA 1DDLA 5ABJA 3LB9A 3AZZA 1DQ5A 1YXWA 1W6PA 2Q8OA 3IKWA 2VNRA 5JOXA 1O5LA 3SH4A 1DGRA 4XF0A 3U4XA 1GR3A 1HRV1 4O9GA 4XILA 1REEA 4WVVA 4AF9A 3FFQA 2PHFA 4WVWA 2XPJA 1QJX3 3I7DA 5BNNB 1FMD2 4QQOA 5FLIA 4AQ6A 2ETEA 4KH9A 4COWA 3ST7A 1OA3A 2DCZA 2X8KA 1B09A 1VBC2 1GZWA 4CEYB 5GZCA 1AYM1 5E89A 4ZKTB 1ZZCA 2RS33 4QGLA 4N43A 1SMVA 4J1XA 1IQAA 2X29A 1X50A 3FJSA 1NLSA 3L2YA 2UYBA 4XZPA 4RGGA 3ZVXA 4AYUA 1X8EA 4QPIB 4PCRA 3FZ3A 5T54A 3ZFGB 1ZBE3 1EPWA 3WHTA 3RPQA 2AYHA 2BGCA 3IT8A 4KU8A 2XL9A 2GC0A 3H1MA 1V9U3 1QXJA 4AK3A 2PAEA 4ZU7A 3DPRB 4XFAA 1BKZA 2PHTA 4IEXA 1RUE3 4AEDC 2ZGPA 1YCIA 2UY8A 3B01A 1NCRA 4P5HA 5IK5A 1ZZ7A 1GICA 4NR1A 3D0SA 3MF6A 1DF0A 1LULA 4NVPA 1QDCA 1ND2A 4WM7A 1A8MA 4CEWA 4GH4B 2A75A 4BZ4A 5TSWA 1G7YA 1H9PA 1ULCA 2ZGNA 4XJWA 5IT6A 5LRSA 4CP0A 3ZSLA 5T55A 3E5UA 1ASJ2 1TMF1 1LOFC 4LHNA 3UJQA 1UIKA 1HV0A 3HT2A 2JE9A 2ZX1A 1BK1A 1NXD1 4CDWA 1SLTA 1J3PA 1NQDA 3QCWA 3THTA 4E9KA 4X6QB 3QOPA 1YLLA 2ZCWA 3LWCA 1CIWA 1VBE2 2HWC1 5C6CA 3PMSA 3BOPA 1LRHA 4J1WA 2E7AA 4CP1A 1ZZ9A 5BV6A 1W6QB 3ZO0B 1QOOA 3VKOA 3BALA 3A0KA 2DVFA 3VBRC 1S0DA 2KA3A 3AKPA 3IN9A 5DZEA 1LJ7A 4JC1A 1GZ9A 2ZX2A 1VBA3 4OI2A 1SLAA 4P9GA 4R4ZA 2G9FA 4JVAA 3O0XA 3WQ7A 5KXEA 4Q4Y1 2CAVA 1H8TC 1QOTA 5KC5A 1EY2A 1AR91 2HYKA 3PVNA 3VHNA 4DINB 2R061 2CNAA 2VGDA 5JR7B 1UD1A 2PA7A 1QU0A 2RS53 4P14A 2DV9A 2PHWA 4TZDA 4ZXKA 3ME2A 2XVKA 3ZSKA 1V6KA 4JRLA 1REDA 4Q4Y2 4XETA 4B4RA 1BQPA 5I0UA 4MZUA 5AC93 3ZMOA 3TAYA 3ZN4A 2XJRA 2W52A 1K5MC 1VB2A 2R062 1QXRA 3B69A 1RVF1 5JOYA 2AR6A 1LENA 1VJ2A 2R49A 2ZGLA 5I8YA 1V6MA 4FPLA 2RR11 4EV0A 3CU7A 3BODA 3N7KA 1V70A 3ZXAC 2D97A 4MLOA 1TNFA 1QJY1 3ES1A 3H8UA 1G9BA 3DF0A 1CAUB 2O1QA 1LU2A 2NMNA 4OI4A 1DQ1A 1QXPA 1RUC2 1MEC3 5GZEA 1PK6A 2C0ZA 3WP4A 2HWE2 1UPSA 4HSLA 3FMGA 1R1ZA 1G9FA 1SCSA 1QJY2 1FI2A 3NV2A 1UU6A 3AP5A 4AVVA 3TN92 1IS4A 4FPKA 5LEKA 4D7YA 3WZ1A 4HKOA 2XJTA 4CDXC 4PDWC 4WVMB 2ZGUA 5C8WA 5L36A 1KDKA 1UCXA 2ZKNA 3CL1A 1FOD1 1GQHA 2VVDA 4Z92B 4YRDA 4FAGA 2BVBA 4GIQA 5L73A 1LEMA 3QD6A 4IEWA 4MYEA 1QGLA 4XJ9A 5JPNB 3VLBB 3ROUA 4DS0A 2WLQA 4D7TA 4QGMA 4IV3C 5JOWA 1ZRCA 1MQTB 1H4GA 3AMHA 3D82A 2IXKA 2EAAA 4M3CB 3MF9A 4W6YA 1FMD3 1BCXA 4FCAA 3HWJA 1S0BA 2R1BA 4Q2FA 2ZPXA 4MH0E 2Z5WA 1R081 5D8AC 2GNDA 4K1ZA 4Y4YA 3ZXDA 1ENSA 1VBC3 4XHBA 5L7OA 4LT5A 4LBQA 5H9RA 1YI9A 3D8CA 2GC1A 3ZXJA 4LULA 3R4DB 5C4WB 1RITA 3ZYRA 5I0TA 4L2NA 3KM5A 5T5LA 4HPKB 4L97A 1XU1A 1X36A 3LA7A 1U0AA 2WA3A 3I2DA 1Q5OA 1PGSA 3LSDA 3R05A 1XXNA 1ZBA1 1R082 3J9SA 3JCIA 3QH7A 2AGSA 3MIBA 4YVSC 2XBO2 1LCLA 2Z69A 4Y1UA 4OLLA 1C8M1 1IS6A 5JI9A 1MS9A 2E7TA 3VBFA 2ZX4A 1RUG1 2Q1ZB 4LHLA 5J37A 3LOBA 1WCSA 2PN5A 1NCQC 1OI6A 5ABJB 1FYUA 2HWD1 3PNAA 1AR81 1N3QA 1JBCA 1W6PB 4KNCA 1Z7S1 4COZA 4AGVA 1GNZA 5I0SA 1POV1 4BE3A 4KG0A 2QVSB 5K8SA 1SBDA 1WMFA 2JICA 2P34A 1C8M2 3ZDSA 1G9CA 3CEWA 1RUG2 5A3LA 2D93A 5CFDA 4QM9A 2VVFA 4QHBA 2D6LX 4M0NA 2HEVF 1CAVA 1QHDA 2HWD2 1V00A 4R9BA 4UW3A 4AW7A 1ASJ3 2UWBA 4QX5A 4JCKA 4BMEA 3HR9A 3HT1A 1Q8QA 1WW7A 2ATFA 3RNSA 4N43B 3AKRA 2XGXA 1HV1A 1LOAA 5T52A 4IQPA 3V0AA 2RM21 1VBE3 4DY3A 2FHRA 4KWKA 1YIFA 2XL7A 1SCRA 4HETA 2H6BA 3LGRA 2WT1A 1S55A 1AXYA 1D4M2 1DZRA 3EO6A 4KG8A 1QNWA 3KZ4C 5HCFA 4FSJA 4AGRA 4A3XA 1MZFA 3H7JA 1A6CA 1UU5A 3VBHA 3VDDC 1JHNA 2HEYF 5FOBB 5GLVA 4Q27A 1ZX5A 1DHKB 3BPZA 5C9AA 4KU7A 4C1XA 2BFUS 4YARA 4HMZA 5DXDA 3CF6E 5HCBA 3JBG1 1O5UA 1GYKA 2C9AA 1N1YA 1VAMA 2ZKLA 4RS5A 3A0NA 2Q30A 2UYAA 3VN4A 1NCRB 2P3IA 3DKWA 2KXLA 4BIFA 4FPJA 5E88A 5JLVA 4UW6A 2Z42A 2FZ1A 4I09A 4WM7B 1ND2B 1UZYA 2XVLA 4CEWB 1H4HA 4KL1A 5LK5A 3NKTA 1H2KA 1DG6A 3OCPA 1JUHA 3PMEA 4GKXA 2PHDA 1U12A 4YM3A 1ZM1A 1YWKA 2VXRA 3KCXA 5FPZA 1SDWA 2K2SA 2JG8C 4C0HA 4GB32 1BZWA 4CDWB 1SLCA 3L2HA 4PBPA 3KCYA 2W08A 1AJOA 1LOCA 2GNMA 3O5SA 3RQ0A 1EP0A 3ZYGA 4CP2A 2DCJA 4XHXA 5K7PA 3VKMA 1LGCA 3WP3A 1YIPA 1CESA 1HXS2 2AENA 2OZ6A 2NMOA 3FUOA 1SEFA 4J6GA 1A8DA 3E97A 4JV4A 1OFSA 3B3QE 4QPYA 2DTYA 2JX9A 3KT1A 4N53A 1RUC3 2PTMA 3AP9A 4NN0A 4CDUA 1LHOA 1OOPC 2HWE3 4Q0PA 3WG4A 4ES9A 2HEWF 5K0UC 1CR7A 4H55A 4K9SA 4HL0A 4I01A 1QJY3 1ZBE1 3WCRA 1RHI2 4C90A 3CJXA 3ELNA 1RUF2 3JB4C 3TN93 4AQTA 3JQWA 5CVRA 3MLKA 2HKXA 1LKNA 1FNZA 3PVEA 4P9YA 2D43A 5CFCA 1MACA 3HBZA 1DZTA 1H9WA 2E9QA 1RUE1 2WNUC 4FT8A 3WXPA 3WOGA 4IL7A 3AP7A 2R32A 3HQXA 1H8VA 3IDEA 5I91A 4OHVA 2WJSA 1OFNA 3IMNA 3VBUA 4DRVA 5FREA 1V6IA 5DZGA 4FP3A 4HKLA 5CB7A 3D0JA 3RS6A 3WUCA 5JWPA 2DUQA 1A3KA 3B9CA 2FZ2A 1DZQA 1HW5A 3UK9A 4NHLA 4GWMA 1QH7A 3JB8A 2PQQA 3QLQA 4IV1C 1IS5A 3UKVA 2F6BA 3AZVA 1AXZA 1O4TA 5C8CC 4YFWA 3FLRA 3W59A 5BYNA 4XW3A 2A71A 1I3HA 1AL0G 1PK6B 5GKAC 1FX5A 5J98B 3E6DA 3LAGA 1FAYA 1NY71 3E5QA 2RHPA 1R083 1PVC2 1R1A3 3WW3A 2A6YA 2XBO3 1MS5A 2GH8A 1VRH2 2AREA 4XF9A 4YGEA 4LLFA 1C1LA 2VULA 3PVOA 3QH6A 3M70A 1VBA1 2UWAA 4MGYE 3U0ZA 2OIIA 2VPVA 4LO4B 4JDNA 1RGSA 3MICA 1F9KA 4GALA 3AMQA 4P9JA 3VHOA 2DU0A 1NE4A 4XQDA 4YM1A 2YUEA 1G9AA 1J1LA 1Q8VA 5T50A 3SH3A 2GC2A 2Q1MA 1CAXA 4AFAA 5CAZA 2MPFA 2RS51 4YNIA 5DG1A 4QQ2A 5BNOA 3MPBA 5F6LB 4E2GA 1RMU2 4Y20A 1PZ9A 1FNYA 1TME2 3VBSA 4PIZA 5AC91 4BOWA 3AJZA 3NV4A 4XF4A 2RJKA 3USUA 1QJZA 4EWEA 1WCKA 5L7OB 2KM2A 1BVVA 4LBQB 1JOJA 3Q9OA 1YHFA 2GMEA 4FXGB 4Q4W1 1NQJA 2BYVE 4QXKA 3WD5A 2Q4SA 4QU2A 3HAGA 4L92A 2WQ4A 1C5HA 1BEV3 1D2QA 2B9UA 3AYDA 3POWA 4AI0A 1FV2A 2MEV3 1D4M3 3VZOA 1S0GA 3KD4A 4H7LA 2IZWA 4B3NA 3IBMA 3ZXLA 2DCTA 3KGLA 4XJZA 1GFF2 4GMP0 4YVWA 1MEC1 2W0XA 3VL8A 2OUHA 4Q4W2 3FX3A 2YZ4A 2EIGA 2D6KA 1WLCA 5JAXA 4MVTA 1GBGA 1GANA 1OKQA 1QOSA 4Z07A 5EFUA 3ZYIB 3USSA 3RMXA 1OD5A 5H9PA 3ZFFC 2WL1A 2QJVA 4EWDA 4L11A 4FO9A 4GXLA 5GLWA 2WSUA 5CFDB 3VBRA 1WUVA 5JZGC 2ZBJA 1CAWA 1CAVB 2PLV2 2EXHA 1VBB1 5KHHA 4DFSA 3WR0A 2WT2A 4XFCA 2JECA 2HJIA 2UY9A 1DGWX 3VZMA 5KHKA 4FQZA 2ZA9A 4GB33 1FMD1 1GKBA 4F83A 1AX2A 2N7GA 5J09A 4XIKA 3LSEA 3V0AB 1EPZA 4FOQA 3KGZA 1QY4A 2WC2A 4FPFA 4PQ9A 1VBB2 5FMOS 1VBC1 1ONAA 1UW8A 2B5HA 5CADA 4K3UA 1HXS3 5H9QA 4D7SA 5AVAA 4EJRA 2XH6A 4S2HA 3VBHB 1K5MA 1B35C 2ERFA 3MYXA 3ASIA 2EA7A 4LUKA 1VP6A 2A70A 5CNAA 1N3PA 5C9AB 4QT6A 4F8AA 2VMGA 4JRAA 4K40A 2XLAA 3AM2A 2I07B 4FPCA 3JQXA 1RHI3 1S1AA 4RS5B 4XJUA 4A2UA 1RUF3 2Y26A 5BNPC 2GSYA 3MGUA 2VMIA 2AZ5A 2BTVC 4NWVA 3U07A 1JYCA 4WBBA 5B2GB 1RUI3 4URTA 2I45A 1JYIA 1ENQA 5GLZA 4Z1VA 1SLBA 1RIRA 3NV1A 1M4WA 5FO7B 4CDQC 1OA2A 5HI0A 1JUIA 2DF7A 5HBAA 2NQYA 2YXSA 4LBMA 4CDXA 3K51A 5K9YA 4ASLA 4XQ4A 1LEDA 1ASJ1 4P9WA 1KXGA 1YJKA 1UN1A 3U11A 4I3GA 3WT3A 2V09A 1QKQA 4P9XA 4OUMA 2XJQA 2VMHA 3ATGA 4XYXA 2D5FA 5H9SA 1O3TA 3SCGA 1I6XA 3UKNA 4IV3A 1OLQA 1ND3C 1VBE1 2XHKA 3OTFA 4I02A 3AP4A 4N53B 5EXOA 1XNBA 1O4ZA 4CDUB 3OPZA 4I30A 1LU1A 1AUYA