4TSVA

High resolution crystal structure of a human tnf-alpha mutant
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
148
Chain Sequence
DKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of a human tumor necrosis factor-alpha mutant with low systemic toxicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lymphokine
molecule keywords TUMOR NECROSIS FACTOR-ALPHA
total genus 22
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1997-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4tsvA00
3URFA 2RE9A 4MXWB 2WNUA 4E4DX 4OUSA 1IQAA 1PK6C 1ALYA 1D4VB 1OSGA 2E7AA 2ZPXA 4MXWA 4EN0A 4OUMA 1U5XA 1TNFA 1DU3D 4QPYA 2TNFA 2AZ5A 2RJKA 5KWRA 4GIQA 4QQHA 1I9RA 2HEWF 1O91A 3ME2A 2Q8OA 3K51A 5HBAA 2JG8C 2JG8B 2Z5WA 5KC6A 2WNUB 2JG9C 4DB5A 1D0GA 1TNRA 4J6GA 2QDNA 4KGQA 1PK6B 5CIRA 4RSUA 4QQPA 1JTZX 4TSVA 3QBQA 1A8MA 3ALQA 1GR3A 3MI8A 1U5ZA 2WNVB 5L19A 3TYJA 5TSWA 2KA3A 2JG9B 4E4SA 2ZJCA 3L9JT 1OQDA 4HT1T 2R30A 3B94A 3QD6A 5BNQA 3TWIA 4MSVA 1C28A 3V56A 3K48A 1D2QA 2HEYF 1OQEA 1RJ7A 2OIIA 2R6QA 1PK6A 4QQ2A 1KD7A 1U5YA 2HEVF 2Q1MA 4D7YA 4G3YC 4KG8A 1XU1A 4OULA 4QQOA 3WD5A 5L36A 2TUNA 3IT8A 2JG8A 4NN0A 4N90A 2WNVA 1JH5A 2WNVC 1KXGA 3B9IA 5KC5A 3LKJA 3FC0A 4G4FA 2QE3A 2R32A 1DG6A 3B93A 4TWTA 4QQLA 4MXVA 4KGGA 1S55A 4DOUA 2RJLA 2WNUC 2X29A 2JG9A 1C3HA 1XU2A 4F3JA 2O0OA 1WCKA 3AB0A 1RJ8A
chains in the Genus database with same CATH superfamily
2JDNA 2UY8A 4MGIE 5KXBA 2XVLA 5DQ0A 2P6CA 2NN8A 1X9TA 3BYWA 4GULA 1PVXA 5T55A 3U78A 3H8OA 1GNHA 4M3CE 2VM9A 1W6QA 3DPRB 2Y0OA 4A45A 1SBFA 2A6XA 1W2TA 1W0OA 4B7EA 2VO5A 4HK9A 4E4DX 1ZZ9A 2FQPA 3NJYA 3R4UA 4GMP3 5DZGA 3EYPA 2NYYA 4DQAA 4A4AA 5FPXA 4XCAA 2FDKA 1OSGA 1UN1A 1K5MC 4Q26A 3J7HA 4TXWA 2XH6A 5FZ4A 4FSJA 3RZHA 2JXAA 4PI0A 4OQ9A 4V1PA 4HXCA 1TNFA 1DU3D 2E51A 3W5MA 1OI6A 3TBDA 3MV01 1J59A 1UMZA 1D4M3 2V4VA 2TBVA 3BOWA 4XFCA 3WDWA 1KDMA 3AZZA 3DUIA 2JG8C 1YHFA 3FUOA 3ZXJA 1ASJ3 1VP6A 4FPKA 4Y5Z0 2IXLA 4K40A 3MFCA 2J1VA 5ABJC 4IV1A 4CXWA 3E5XA 1UOJA 5FXVA 1YYNA 3ZXAC 2YGLA 3PU8A 5EPAA 5F9TA 4D6SA 3H8XA 4PF5A 4HVQA 3HAGA 3NWKA 3NNMA 5HCBA 4CPBA 2ZEZA 4GMP1 3T3YA 3AXEA 5LRRA 1LRHA 5JOWA 1W05A 3GM8A 3VN4A 2O1QA 1L7QA 3MI8A 1UXZA 1VALA 2HBUA 4LIVA 1VB4A 5CFCA 5AFBA 3IDCB 4YGDA 4LBNA 4MX3A 1XPWA 2WFF3 4C8DA 2V5DA 2ZX0A 3AYEA 5ACA1 3FZ3A 4AVSA 1LTEA 4ZU5A 4O61A 5A33A 2LRPA 2VZQA 1QJX3 4XXAA 3VD9A 3GZAA 3ELNA 3BOPA 2XKOA 2ZAHA 3IDEA 2PFWA 1CIWA 4E4HA 2DURA 2VTFA 4A7YA 4QPIA 3O1SA 1H8TB 2JDZA 1U5YA 2RHPA 3MW2A 4I09A 4DY3A 2CNAA 2NPIA 2WZR2 1XU1A 2P3KA 2VVDA 4NIDA 3WW3A 3AP5A 2IXCA 4KU7A 5AVAA 5FZMA 5JIUA 5SV8A 1W8WA 5K0UA 3ZN6A 1QJY2 4FAGA 3PURA 1NYWA 3VBHA 3I3EA 3IWZA 5EFUA 3HMYA 1UXXX 4E2SA 5BNNC 4EYUA 4BQWA 3BPZA 2YC0A 2A5ZA 2HWC2 1TVGA 1VBC2 4R9AA 5FYMA 3ZYRA 4LHSA 4NPRA 2R042 5D2AA 4DEQA 4YM3A 2FDGA 4F83A 2A3WA 1NCRC 2BUKA 3GDBA 3NMBA 1W28A 5L9BA 4CEWA 2ZKLA 4QQLA 1N3QA 4D3WA 3A4UA 1UMHA 1PIV1 3QH6A 1YQCA 3ZMOA 4DXRA 4ZU4A 2X29A 4FPGA 2MEV1 2BVVA 4GKYA 4XBQA 4XZUG 2VZTA 1CIYA 3PUQA 4V2VA 1MVQA 3MLLA 4AR2A 5CBLA 1TG7A 2GNMA 4LUMA 4CDWC 5BYNA 3EBRA 2WINB 3KM5A 4AHXA 1W3XA 4W8JA 1I5ZA 3ZKUA 4FPCA 2VULA 3LFMA 3M3EA 1R1A1 1DLLA 2I2SA 3SXWA 5IATA 1G9CA 1ZREA 2Z69A 2HYXA 4Z1VA 1VMFA 2GZWA 4HN1A 4XHXA 5T5LA 2ZEWA 2W91A 1J1TA 1RXFA 4NWWA 4WM7C 2ENRA 5BNPB 1YFUA 4LLOA 1Q56A 2YGMA 3IZOA 3MPBA 2CU5A 1QMJA 2WL1A 4P9LA 2ZGNA 4QX3A 1PO22 4NMIA 1S0FA 3CEWA 1FT9A 4UXAA 3WSOA 1AR73 1RGSA 3VHOA 4BJ0A 4CDQA 3WUCA 1FPN2 4QPYA 2R16A 3PIGA 5FQ0B 1TEIA 3DXUA 2YZ4A 4GB33 3SCGA 5DN2A 4I30A 5KWRA 3OG2A 2VNGA 3QCWA 1I5PA 4XUOA 1W6OA 2VMFA 4H2AA 5KC6A 1BK1A 2QCSB 2XDVA 2EICA 3KLSA 3IPVA 1QJY3 1U0AA 2ZTNA 5IVVA 1IPSA 1JN2P 1QJX2 3GBWA 3I2IA 3DF0A 4I0AA 5FXXA 3ZYBA 2BZDA 1EUUA 1CZSA 2UURA 3B00A 4CCKA 4QPIB 4Q4W2 4FOQA 1YQ5A 1Q8SA 1GWMA 3ACGA 3Q8AA 5A80A 4CXXA 2E26A 3NL1A 5AC92 1ULEA 4N9HA 4QQPA 2UWBA 3BKZA 1DZQA 2YY1A 3WW2A 1VBD3 4YW7A 3AMQA 4AZZA 2WSVA 1RUF3 1CPMA 3J7MA 3VKOA 4Y5SA 5TSWA 2YXSA 2JG9B 3ZSMA 4AFBA 2LROA 2ZJCA 4IV3C 4IERA 3HD8B 2IUWA 3KQRA 3I2GA 1HRV1 4HT1T 3B94A 4IUGA 4N53B 3JXSA 4FPOB 3VBFB 5FUPA 4GXLA 4NVPA 5AC93 4M4PA 2VMGA 1PGW1 1ZBA1 2VR4A 1JYNA 1I1EA 5A3LA 3KCCA 4K1ZA 4P9XA 1DQ1A 4UT5A 2Y6GA 4UFKA 3AYDA 3O14A 4AE2A 1T6BX 4AFCA 5FMCA 5IVFA 2OVUA 5I0DA 2IFRA 3AKSA 4FFFA 3IT8A 2H6BA 5CYYA 1O8SA 4IV1B 1REDA 3H8RA 5FY5A 3VBSA 1DP0A 2XQXA 2PA7A 2Z4FA 4RHV2 1C57A 2K2SA 3GHMA 2ZGLA 2YC4A 1UU6A 1D4M2 1RUF1 1V70A 2Y34A 4G4FA 4TTGA 3AL5A 5F32A 3VBUB 1FMD3 5FMBA 1AYM1 5GLZA 3ZFEA 1DG6A 1VRH1 3T2QA 2YB7A 4X6RB 4BCUA 4TYSA 4UOJA 5F37A 4AI2A 3R4DB 4FPLA 4MXVA 5H9PA 2JIJA 4KGGA 4A6SA 1R092 2RMU2 2HWB1 2V72A 1UMIA 1GOFA 2DF7A 2VNOA 4KBZA 4PLOA 3LDRA 3M2MA 1X7NA 2I74A 1COV2 1PX4A 1Q8PA 2XWJB 2BNMA 3I97A 5FZFA 5H9SA 3AK0A 4Y22B 1NX9A 2VQUA 4Q27A 4LR4A 2XUEA 1OURA 2YBPA 2VUDA 3VBUC 3ZR6A 4S2GA 4A44A 4EV0A 1W06A 1VBD2 4XJUA 3RZKA 2DVBA 4ZONA 3PNAA 5A1FA 1GQPA 1MQTA 1HJFA 2BRTA 2X5IB 1IZ3A 2DFBA 4M3CB 4AW7A 3NKTA 4OI2A 1Q43A 3U0ZA 4IESA 2VE1A 1VR3A 3I2KA 3JD72 1NA1A 4RHV3 4BYYA 4Q4W3 1PGSA 1WW4A 2BOJA 1NLSA 1R64A 5IJRA 1JODA 1SEFA 1RUJ3 3I3QA 3I2DA 5LASA 4AVTA 1DQ0A 3APBA 4P02B 4YZ3A 2OYZA 2TNFA 3FWEA 1MEC2 2ARBA 2VH9A 4IE4A 3I3MA 2DBNA 5F7UA 4FTBA 2UU8A 4OMDA 4EROA 1R1ZA 1UZWA 4IE6A 5CNAA 2HWE2 4RS5B 3JBG1 1GZWB 4XW3A 4AFAA 1UIKA 3I49A 3CDZB 2C4XA 5DG1A 4MHRA 1AR92 4MGSA 4B3NA 3WDTA 2PXJA 1RUG3 1JUIA 3SHRA 2NZ9A 5FLJA 4M0HA 5JOYA 1ULPA 5A3WA 1BMV2 2CGPA 2A3YA 1V6NA 1WZXA 3OPTA 1A8MA 2V4AA 4AK3A 4DXSA 1GR3A 5J09A 3V0AB 3MIEA 2IXIA 5GLWA 1ZZ8A 3J7LA 1RMU2 4LMFA 2B42B 4GJZA 1CAWB 3OJBA 5FY8A 3FMGA 1I3HA 2OQ6A 3T4HB 1FYUA 3U10A 4AI3A 2AACA 5FAXA 1ENQA 1H1MA 4AVCA 4Y1UA 2HWD2 3FL7A 4A42A 5BNQA 2Q30A 3K48A 2SLIA 5DDJ3 4KQ7A 1X82A 1OQEA 3KV9A 1VBB1 4WZCA 4QKBA 4IEQA 2ES3A 1MZEA 2HEVF 1N1TA 2Q1MA 2QQWA 1FPN1 1J3QA 2A6ZA 3OGSA 4G3YC 4LHKA 3VBHB 1VMHA 3GBFA 4INDA 4YW1A 1V6KA 3OGJA 4O7XA 4NRPA 4WM8C 2XL7A 4XDOA 4NN0A 4AYUA 2VCBA 1J1LA 3ZYFA 1VBE3 1MVEA 3LKJA 3GNEA 4BM8A 3Q8CA 2VJXA 5A7QA 3C7FA 3BU0A 3O1VA 4K21A 3MEPA 1PZ8A 4HPKB 2W47A 1HQLA 1W9TA 5DUWA 4YVSA 3R6SA 5J1XA 1VJ2A 2BPA2 3VHNA 1IPKA 4DY5A 3LDBA 3WLUA 1LGCA 1GYKA 4QXHA 1DGWX 2Q4SA 2AEZA 1MS9A 2VXRA 3WP5A 1NA1B 4QB2A 3J7NA 1QH6A 1ASJ2 4AGVA 1AJOA 1C3HA 1G8WA 5I93A 2DU0A 2HJIA 3H9AA 1LOAA 5FYTA 5C9AB 4IEXA 1VIWB 5AC91 2DVGA 2I45A 2WO1A 3K2OA 4B29A 4CCEA 2XPJA 4CU8A 3OBTA 2QQOA 5JPMB 3VD3A 4CU7A 1JXNA 2PELA 1ZVFA 2ZGKA 5K8SA 4UF0A 3O1UA 1DYPA 5KR7A 4HK8A 4QGNA 1UZVA 4GD4A 2JICA 4M4RA 3ZYHA 4BQ5A 1NZCA 2RM23 4LK6A 3LPFA 1RHI3 4Q4V2 2V09A 4BQ2A 4YG3A 3NKGA 4K7JA 2WA3A 1N1YA 5CFDC 1QGLA 3H1YA 5FZOA 2VZPA 4HMZA 1S2EA 1S4CA 3DYPA 2DUQA 5FZ3A 3WDUA 2AREA 3OD4A 1ZRDA 3DKWA 4NR1A 1CAUA 4Y26A 4ZY9A 1LGNA 4LOTA 2I07B 1OLQA 3LEMA 3KWVA 3VBFA 4HONA 4DUWA 4AXOA 2B9VA 3WNXA 5K4LA 2JG9C 4IDZA 1H1AA 4CU6A 4DXTA 3LSEA 4GB31 4K8FA 3S57A 1LESA 1ND2A 5G04L 4C0BA 1HRV3 2OPKA 1JYCA 1MS8A 1WLTA 2RR12 3AKTA 3IM0A 5EV7A 1RIRA 1JI6A 3OBZA 1RITA 3ES4A 3GZUC 4LBKA 2WZPP 1OOPC 3I3BA 5IVBA 4WVMA 3LE0A 3VDDB 2HH9A 3VBOC 2R1DA 4SBVA 3VZLA 3MF9A 4QWNA 1ZRRA 1O3QA 1SCRA 3T0AA 3WW4A 2Y6JA 1OFNA 1UZ0A 4J1WA 1RB8G 3KVBA 4JQRA 1F2NA 1D2SA 3AJYA 2KM2A 2JECA 4N53A 2GMMA 3T2TA 4I2OA 3LFIA 5JXGA 3ZYGA 1TMF3 5DXDA 1OQDA 1W6OB 3VDBA 1H6YA 4XABA 5C3RA 1R091 2RMU1 4QHZA 2VECA 4JKMA 3EQEA 4FPEA 5BNNB 2BOIA 3ACIA 3WF3A 4EWDA 4DUVA 2LS6A 2VUCA 1NKGA 4QXCA 2RS11 4XPVA 1XB9A 3WQ0A 2W87A 5FP3A 1QXJA 1OH3A 4Q0QA 4Q4X1 3NRUA 2PQQA 1Y9GA 2YROA 5F8PA 5SV5A 5IFPA 2WAOA 1V6MA 2VZ3A 3LD8A 1V6OA 4ORFA 1BK0A 1GOHA 1W04A 2F6BA 2VOXA 1IPJA 1UWWA 2JJ6A 4IE5A 2WNVA 4QGMA 1JH5A 3U14A 3WV6A 3OCPA 3ILNA 2OS2A 4FFHA 2VAUA 3VD7A 3S0MA 3TEWA 2HWE1 2AUYA 2JWPA 4J25A 4YVWC 1WBFA 2D3PA 4PT6A 4D7SA 5GJ6A 4FTSA 1O59A 1XE7A 3HNYM 4UW6A 4EZHA 4L11A 4AI8A 1JZ4A 3Q8EA 2YFUA 5FZLA 4HANA 4XE9A 2GSYA 3CLPA 4LO8A 2D3SA 1RUI1 4XAAA 3AXDA 3J4UH 5IUQA 2ETEA 4YGCA 2YUEA 4Y24A 1LECA 2QQJA 2O0OA 1T2XA 4D6QA 4E4ZA 2D98A 2C9AA 1FAYA 1H30A 2JDYA 3WG1A 1V9U3 4X8PA 2EIDA 3NO8A 5BNOB 2WWJA 1C5HA 3WQ1A 1HIXA 2VW1A 4DIQA 4L2NA 4QPGC 3ZXEA 2IVJA 5DAQA 1CN1A 1QJU1 2Q5TA 3AMHA 4XFBA 4FTEA 5FZAA 2L9LA 1F4AA 3L2HA 5FJHA 1PO21 3D82A 5CKMA 1GKBA 1W8TA 2WJSA 2W68A 5E6HA 4LO4B 4ZS3A 3UGHA 3PU3A 1OQ1A 5J48A 4XYXA 4QM8A 2GNTA 5CU1A 5JZGC 4JC1A 3ZN5A 1RHI1 1RUE2 1S0DA 4BMEA 3OY8A 3ETPA 3D6EA 5J37A 4F7ZA 2CHHA 3GXUA 2FDHA 4CDWA 4XTMA 5I0TA 3S6PA 3ZVXA 5C5TA 4IEVA 4PBOA 2HEWF 4MO3M 3VHRA 5FZEA 4BK5A 3WX5A 2VVEA 2VCCA 1CGPA 4NPMA 1O3TA 2YBSA 4H55A 2WO2A 2Q8CA 4YYOA 1C8M1 3KZ4C 4D69A 2ZGQA 3V64A 4FBFA 2C24A 1ND2C 3LA3A 4UFIA 1AYN2 1UO9A 2A73B 2W9XA 1UU5A 3A22A 3LQCA 1JS9A 2Y6LA 2BGPA 5L19A 3BI3A 3QACA 4Z2WA 1A34A 1S0BA 1XNAA 4E4SA 5K0UC 2CV6A 5DZEA 3AL6A 3O1PA 3MFAA 2R30A 2WSUA 1PNGA 1W6PB 4QU2A 4XHBA 1BHGA 4FPJA 1BJQA 3RQ0A 1ASJ1 2LW8A 1OF4A 2JE8A 4PF1A 2EXJA 3ASIA 1YJLA 3SEPA 4GWNA 4QXBA 3LAGA 4PDWB 2ZX2A 1ULOA 4GKXA 4Y22A 3U75A 3U4XA 1DGWA 4LPLA 2PMWB 1KJRA 1NE4A 3KMHA 1LOBA 4YW4A 3TEXA 4BU2A 3Q9OA 4MHUA 2ZGUA 2JG8A 4Q4V1 3UGGA 5BUVA 3KF3A 2VL4A 2OZ6A 2GN3A 2ARCA 2D6LX 2IFWA 2RS53 4JGZB 4ATEA 5BV6A 1CONA 1DHKB 2VOTA 3POSA 1RUNA 1NLQA 4HETA 3ZFEB 4ZXKA 1VRBA 5FY0A 1JYIA 2B45X 1CESA 3C8XA 1NA1C 2CAVA 2R072 1V00A 5T5PA 2VU9A 4XFFA 5DUUA 2PLV2 4BIOA 3ZLIA 1ENSA 2VW2A 4Y1VA 2RR13 2YFZA 5F2SA 3VV1A 4AGRA 3M70A 3DEMA 2YDEA 3DYOA 4I0BA 2XG3A 1YNAA 5FYUA 3WG2A 5FP7A 1GFF2 2EVXA 1X9PA 2H0BA 2JG9A 2QQIA 4R4XA 1HRI3 4XJZA 5F3EA 3VKMA 5FY4A 1RUF2 4C1XA 4KNCA 1AR71 4B1MA 1IG0A 3ZSJA 4CUAA 4XFIA 4XUQA 1ULGA 4MOAA 2JB8A 1PM4A 3SH4A 4LHNA 5FP4A 2D6NA 4LK7A 3DYMA 3ZSKA 3OYWA 4WVWA 3WHUA 1VAVA 5FUNA 3THDA 1ND3C 2XBO2 2WNUA 3D0JA 5BXXA 4P9WA 3USUA 1IQAA 2D7FA 1KS5A 1ZM1A 1D4VB 2XBO1 1RVF2 3OBRA 4P9GA 3MDPA 1PM7A 2ZS6B 3BB6A 4LLFA 2Y60A 2EALA 1OMIA 1AR93 2Y6HA 3BGAA 4Q4W1 3VBOB 3H7JA 2RDSA 4L0PA 2AEYA 1FPN3 1PMIA 2XBO3 5D21A 2XVKA 3L2YA 1FI2A 1LODA 2YU1A 4FI9A 1EAH3 1ODMA 2QQUA 4KWJA 5FXZA 3RG0A 1AYM3 5AVPA 3RFRA 3RRDA 5JZGA 1OHFA 3KB5A 3ME2A 3UJOA 5BNPA 2D44A 5DAPA 3I54A 4H14A 2WNUB 4Y1ZA 2PHXA 3W58A 5D8AA 2EIBA 3A21A 3B01A 4FPFA 3ZFFA 5JMCA 5L7OB 4LKEA 5K7PA 2FDFA 1H9WA 2GC2A 1W0PA 2QNKA 1VBA3 4CDUC 4IEUA 4YW6A 4YM2A 5LA9A 4OVEA 1GOGA 1SQ4A 3AZYA 1PIV2 1W6NA 2VNRA 1WCDJ 2ZMLA 3A0NA 3VGIA 1LHVA 1MEC3 2LALA 2ZGOA 3EMRA 3IMMA 5FZOB 4BLIA 5BNPC 4Q5OA 3VL8A 3W5NA 4NHLA 3I2FA 3O1TA 1QJU2 4Q1PA 3CJIB 4R9DA 4FOWA 3ZX7A 4K8RB 2XJVA 4AQ6A 1WA6X 2W5FA 4FOYA 3V56A 3E97A 5F39A 1LB2A 3KCXA 3K4ZA 1ZX5A 3QLQA 4PBPA 4OQ8A 4XXPA 4PLNA 1RUC2 3AKRA 3VBUA 4I01A 1RMU1 2ZZQA 2P3YA 1REEA 1QOOA 3K3OA 4R9BA 5FIXA 3I2OA 5DABA 4WVZA 5T54A 5A3OA 5IK8A 1PNFA 4XF9A 3T1MA 4EJRA 3ZN6B 1H2LA 3OGVA 4CCOA 4A3ZA 1FOD1 1XE0A 2W52A 2VG9A 4QB1A 3B3QE 1DZRA 1H8TA 2R49A 2ZX4A 4D8MA 5KHIA 5LA1A 3GJBA 1B35C 2Z79A 3GCXA 3UGFA 3A7QA 3IB3A 1UYXA 4PQ9A 4RFT0 5FPVA 5JDBA 1CAVA 2E63A 1EAH1 5FBZA 1FV3A 3NSTA 3H1MA 2BGOA 1WUVA 2DDUA 3IIAA 4FQ4A 1HXS1 4WVVA 2JD9A 4YFZA 1W03A 2G1MA 1KRIA 2XJSA 1OKOA 2B8MA 4MYEA 4F3JA 4IV3A 2VQ0A 1PO23 3WP3A 2WFF1 1S0GA 3VL9A 4XIKA 1UOBA 4XOGA 2WWUA 5CEHA 1RL3A 2BERA 4O65A 2JKBA 4BE3A 1WWYA 2WQZC 2P34A 3TOJA 1ZZ6A 2ZZJA 3I2JA 3AX4A 4NIAA 2WYFA 3TN93 5JSOA 1AL0G 2VBDA 2C0ZA 1MS0A 1JYVA 4IV1C 4JX0A 5IFTA 2MHFA 1ZA4A 4XZPA 1CAXB 1O5LA 1EPZA 1XSRA 2CWSA 3LCPA 1NXMA 4OCTA 5EJ1B 5GLUA 3KF5A 3JD73 1PX3A 1DQ2A 5FY1A 5FWEA 4UBHA 1Y3TA 1XC6A 2AENA 3VZNA 5HV0A 3POGA 3GBGA 3PVNA 5JR7B 5GLVA 4WV8A 3T0DA 4GALA 2R061 4XJ8A 3OEBA 2VOWA 1OA2A 3WQBA 5JXJA 2WUHA 1I9RA 2D40A 4BZ4A 1IKPA 3RMXA 3R05A 1Q8QA 5JR2A 2DWRA 4IGPA 2HWE3 1D0GA 1CAWA 4LBJA 5DMYA 2JD4A 3FX3A 3SEEA 4BLJA 4META 4PQQA 3K75B 2WS93 1HKDA 4CUCA 2Z42A 1WCUA 5A1LA 1URXA 1JZ8A 2ARAA 5T50A 1JOBA 3HIFA 3OOXA 5EIYB 2D5FA 3WUDA 5KBFA 3PVOA 4Q1RA 4YVWA 4COZA 3QBQA 4C90A 1POV0 5C6CA 1JMUB 3ZIWA 3ZXFA 1K12A 3BTXA 1GWKA 2ZHMA 1COV3 1LOEA 5FREA 1H2KA 3PTRB 2VY0A 1JZ5A 2XXZA 4DEVA 4GH4C 5IAVA 3ZYPA 1BXHA 2EAAA 2G9ZA 1VB2A 3N4MA 1C4RA 2R1BA 1GSLA 1H4GA 2PYTA 2RS51 5FZ1A 2VBPA 2YU2A 3N7KA 2OQ7A 1OA4A 5GKAC 4XBLA 4NIGA 4P14A 2WLPA 4TLFA 3HT1A 1UOGA 5CFCB 1BEV2 3CO2A 3VDAA 2FDJA 1LAJA 3ZFFB 4D0QA 1HLCA 2WWSA 2WZR1 3LEKA 1AR81 2CL2A 3ACLA 2W3JA 4E8CA 4HFSA 4QDSA 5KC5A 4ZZ8A 5F2WA 3HNMA 1BVVA 1OH4A 5C8WA 3KS7A 3S30A 3LB9A 2VD7A 1MEC1 3WQ7A 2GMEA 4ARYA 1HQNA 1KDKA 1ZZ7A 2E7TA 1VBB3 2P4EA 2ZXQA 1NCRA 3OBAA 3ZKYA 5JSPA 4QMAA 1QNWA 1GQGA 2R0HA 2XHKA 5G05L 1IQDC 2BBAA 3VZKA 4AI1A 1NT0A 4Y1YA 5LEKA 1XYNA 1UKRA 3ZMNA 4BPZA 2WZEA 2RM21 1PGL1 2HWC3 4R4ZA 3C2UA 1XYPA 3WDYA 4ONUA 3NVCA 4FPYA 1QXPA 1DFQA 2QJVA 1OVPA 1LHNA 3CQOA 1TMF2 4A41A 4GWJA 1OLME 3FHIB 2W1QA 1W9FA 5FKCA 1E57A 5BNOA 3FE5A 4XMIA 5I8YA 1HRI1 4QPGB 3ATGA 1K5MA 5EJZB 1F9KA 1N1VA 3LGRA 3O12A 4KBBA 2G9FA 2XLGA 2UY9A 3HBKA 5FZ8A 3WNKA 4H7MA 2K9ZA 1J58A 4FXGB 4JGYB 4XMAA 2WA4A 5A7WA 3RNSA 3QH7A 3VBRA 4EN0A 2JEMA 3POJA 5JZGB 4C0HA 1OA3A 4TLGA 1XNBA 2DYCA 4DRVA 3O1MA 3SITA 5L9RA 4YGBA 3UESA 4DXZA 2WBKA 3NJVA 1SFNA 2VMCA 4HG6B 5IW0A 3O1OA 4LBQB 4MLOA 3JU9A 4JRAA 4QQHA 5GZFA 2VQAA 4FFGA 5FR3A 2ZGPA 5HBAA 1CD3G 3E6CC 4NROA 3VBSC 4FOVA 2Q8DA 1XNDA 4E2GA 1Z78A 2ERFA 4X8NA 4AAXA 5K0UB 1XE8A 2BU9A 1OBNA 3O7OA 5HCFA 3RS6A 2DCKA 5C3PA 2JKXA 3N7LA 4B4RA 2VOVA 4CEYC 1E5RA 1NCRB 5J98B 4AI0A 2XJQA 5CIRA 3IN9A 3PUHA 4RQPB 1C8M2 1FOD2 1OPOA 4RSUA 4RR3A 4Y4YA 2VMHA 4ZXEA 3ZFGC 1UX6A 5CAZA 1H8TC 3GF6A 2VCMA 4E27A 2ORZA 3SCFA 2C6SA 3JB4C 2GH2A 2OT7A 2XGXA 2WKKA 5FXWA 5F6KA 2GH8A 4L97A 3MZHA 2KA3A 4LOSA 2W46A 4AEJA 1PO11 2DVFA 2ATFA 4F8AA 3WP4A 1SPPA 3LA2A 2A1XA 4LE4A 1K5JA 4M01A 4MSVA 1C28A 4W65A 3TNPB 5I0SA 1WBLA 2P3JA 1D2QA 3AM2A 4XF4A 1OPMA 1V0AA 3MBWA 5CFDB 1AR61 1RJ7A 1XXNA 1EYBA 1POQA 3HWJA 4CP9A 1O3RA 2BBVA 2HYKA 2R6QA 3OPWA 2CAUA 2ZHKA 3RWNA 2WZR3 5LY2A 1FMD1 2HKXA 3N7MA 1PVC3 3H7YA 4N43C 3AFGA 3AMMA 1N3OA 2EF6A 4JDMA 5L73A 4WBBA 1SBDA 2DTYA 4IXLA 3FLPA 2XJUA 3C7OA 3IDBB 1PHMA 3KT4A 4OMCA 3VZOA 5CFCC 1XQNA 3NNGA 3JBG3 1QQP3 1TZOA 3SISA 4BQ3A 1OC1A 3S7IA 3UYJA 4OHYA 1BBT2 3ZFGB 4LBQA 2R043 2Q8EA 2R32A 2DBIA 3O0WA 3ROUA 1US2A 3WOGA 1MZ5A 2Y0IA 3TN92 2A3XA 3NNFA 2LUWA 3HNBM 3ZXKA 1AYM2 1UZYA 1KS4A 2VW0A 2V5YA 1VE0A 2QZ3A 3HJRA 1S55A 1RUJ1 3ZSEA 1MPXA 5A7WB 3PIJA 3ZXLA 1NLRA 4YZ5A 5IVCA 4RHV1 1H4HA 4HZFA 3TEYA 4BQXA 5ACA3 2HWD3 3N9PA 3J8F1 1NZIA 2YC2A 4CE8A 2WNEA 3LZZA 1X33A 1UD1A 3LF7A 4QDQA 4LUKA 3DECA 1G9DA 3M3QA 4YRDA 2UYAA 1QHDA 4CYDA 1W39A 2C5DA 1W2UA 2UYBA 3THPA 4QT6A 1LOCA 1W99A 4Z82A 5E89A 1LU2A 4IV3B 2WT2A 4GZ9A 1SPPB 4Y3OA 5C9AA 1FNYA 1RUI3 2ZBJA 3FUQA 2OW4A 1N1SA 4LBQD 2BV4A 2OKXA 2WLQA 2WN3A 3WR0A 2VBBA 1SG3A 2XB6C 1XRUA 1W6MA 4CSWA 3UT0A 2ZPXA 1C5IA 1RXGA 3NV1A 3KSCA 4XJ9A 5E88A 4IEWA 2RJ2A 4QHBA 1AXKA 3MYXA 1O5UA 4NHMA 3Q8FA 4P08A 1RUE3 2ZEXA 3AVSA 4LO6B 1OT5A 1AR83 4Z8BA 2RS12 4H7LA 3ZYJB 1V9U1 1TE1B 2ET1A 3N9LA 5CISA 1PIV3 1QKQA 3OPZA 1GNZA 2QQPA 4EQVA 4AAPA 4QDRA 4BXSV 3AFKA 4W6XA 4XUTA 2D43A 2IXHA 3B02A 3ZR5A 4AVAA 4R8HA 5KXEA 2PHFA 4LHLA 1PZ9A 1C1FA 1H1IA 5CG8A 4CU9A 1GMMA 1PMJX 2O8OA 5I91A 1DGLA 4GA9A 2ZOEB 2OX0A 2Y8KA 1AHSA 3MF6A 1UY1A 2BYVE 1HB4A 3RJRA 4OZOA 4HVOA 3KV6A 3U4SA 4P9IA 4YZ1A 1PO13 4Y1XA 5DAWA 1QXRA 4XUPA 4GMP0 4YW2A 5JUVA 5FYIA 4GWIA 2FBEA 1W0NA 1HV0A 2H0VA 3TYJA 1DCSA 1UYZA 3K77A 1GV9A 3KD4A 1YFYA 2WO7A 5FPZA 2FMDA 1Q8VA 1POV1 1DYKA 4N53C 3QD6A 4XAEA 4YW3A 2XJPA 1QJFA 3D4KA 1LEMA 2UWCA 4UBGA 1RTVA 3J8F3 1VBE1 2P3IA 1X8EA 1WKYA 2D6MA 3P3PA 1CX4A 4QQ2A 3AP4A 3N9MA 5FRAA 1VRH2 3MO4A 1AR63 2VQTA 2Y6FA 1ND2B 2G4IA 4P00B 2RR11 1WMXA 4V2WA 1B35A 3SLIA 4K3UA 5E8AA 3PLQA 2DV9A 1H0BA 2D3RA 2HWB2 4WM7B 5DPNA 5C4WA 3X29B 5AFEA 2WC2A 5GZGA 5F3IA 4PI2A 1GQHA 2DVAA 2XHNA 4JKKA 2JDHA 3ACFA 5T5JA 4CUGA 3FLRA 1XNKA 4QKNA 2CTVA 4N43A 4AHZA 1COV1 1APNA 1RUOA 2VCAA 3ON7A 1EUTA 4YARA 2AH2A 4NE9A 3LSDA 3I8TA 1G9AA 4NPLA 3LEIA 2IXKA 1YLLA 4YLZA 1UYPA 5A3TA 1C1LA 2B46X 3EO6A 5B4XA 1VBD1 2WFF2 4IE0A 5FPAA 3J9SA 2GNDA 5DUXA 4A7ZA 3OEAA 3AKQA 2VMIA 3GCWA 3N9OA 3GHNA 4XJWA 4AOCA 2B7YA 2PQSA 3R0RA 3B7MA 3T08A 4LQRA 1NY71 1W9YA 1GICA 1S0CA 1UX7A 2WQ4A 3AYAA 4BIFA 4DUXA 2J1TA 3KV4A 1JU4A 4CP9B 1AZDA 2BP6A 2OUJA 2BQPA 1GWLA 3A0KA 3MPPG 4RR3C 3MHZA 1NCQB 1ZA7A 2GAUA 5FZGA 5JOZA 5K9YA 1LNSA 1L7RA 1AR62 2FMYA 3MW3A 4KWKA 1W2NA 3URFA 2ZHNA 3USSA 5F6LB 5E1RA 2OUHA 5FYVA 3SKVA 3PMEA 3WT3A 4CCJA 5HXMA 3WNMA 1JU3A 2DTWA 2ORXA 1X8MA 4CTEA 4XEZA 4JAAA 1EY2A 1MQTB 5D8AC 3RI8A 2XVGA 4NAOA 5FO8B 1K45A 1J83A 3MLKA 5LW9A 2AYHA 4MXWA 2YBKA 1Y7BA 4XACA 1BVP1 1SCSA 3DN7A 3OGRA 1N47A 3MIGA 1ZRFA 3TB0A 1GBGA 4QPWA 4Y4RA 3RDIA 1VRH3 4LO7A 2W92A 4DO0A 1Z7S1 2Q1ZB 4Z92B 3ZPYA 4GIQA 1T6GC 2JE7A 4DZGA 2UWAA 4B8EA 2F4LA 2JG8B 1DDLA 4WM8A 3FFZA 3PJYA 3M7AA 2XJRA 4MH0E 4DB5A 1B09A 3O0XA 4NIHA 1VPHA 2HBTA 4OHXA 3D8CA 1RVF3 2W08A 3V0BB 1ZYBA 4P5HA 4CDWB 5B4NA 2P5BA 2X10A 3FJSA 3LEGA 5GM0A 4OZXA 3H50A 5KHHA 1YO8A 3AZXA 5IYYA 1JTZX 5JWPA 2GP5A 5HCAA 1J84A 2PHRA 4K20A 2FCTA 2K0GA 2Y26A 1U5ZA 5FTTC 3VBHC 1GLHA 2WNVB 2F4PA 5HCHA 1QJU3 1JBCA 4OYUA 2DCTA 3VUOA 4WM8B 4BQYA 2FD8A 3O5SA 1X50A 2RS52 5DAXA 2NM1A 4D94A 4A3XA 5H9RA 3PL0A 1UF2C 2NQYA 1WA4A 3ZPOA 5LK7B 3N35A 2VZUA 1W6NB 3U07A 4BDVB 3PJQA 3HN3A 4B7KA 1O4YA 1POV3 1CZTA 3BCWA 3J8F2 2YPJA 1OUSA 2PLV3 4Q4Y3 5IK5A 2W1SA 2VTXA 3ILRA 5J96B 1W6PA 2BFUS 3UL2A 1DF0A 5L36A 1L7LA 2VGDA 5ACA2 1O4TA 4UFHA 3SQOA 3USUB 4LA3A 4CXYA 4LEJA 5FLHA 1IGOA 2RS31 1UOFA 3WCRA 4YFWA 2BDRA 4E8DA 1ZBA3 2WABA 4MG2A 1BCXA 5FJKA 1AR82 4MGQA 2C9KA 1OKQA 2JDPA 5CZKA 3VBOA 5FYCA 4CZSA 1AJKA 2E32A 3M3IA 3U1XA 1NUKA 1YQ6A 3POEA 1RUH1 1YI9A 1W6MB 2YHJA 4MVTA 3MW4A 4TWTA 5FZ6A 5HPOA 2PHWA 5EHDA 3E5QA 3EB7A 1JZ3A 1WCQA 4Q0SA 4XF0A 4LA2A 4XVHA 1YFWA 2YG0A 3HOBA 5C3SA 1QU0A 3I59A 1RUD3 2B9UA 1RUI2 3VBFC 2HWC1 3I4IA 1A8DA 1W8FA 2VUAA 2EAKA 1E5IA 2GDFA 3ZM8A 5CADA 3ZIXA 5DUVA 4XUNA 4DMIA 4TN7A 1YQ2A 4S2FA 1RUH3 5LBEA 3ZFGA 4OLLA 1GZCA 4FXKB 3WZ1A 5LATA 2E31A 5LWBA 1YQ8A 4PDWC 1WMEA 4UFJA 1Q8OA 1YIFA 4MZUA 1W9WA 1HXS3 3BTAA 4HBNA 1GU3A 2EXIA 2JDUA 1BZWA 1SZBA 3M8LA 3E1F1 3KVAA 2ET7A 3ZN4A 1MS5A 1U5XA 5GZEA 1S2BA 4UYBA 1WMFA 5J3UA 2QKDA 4KG0A 1F35A 3VDDC 2HWD1 5FKBA 2WFPA 1SLAA 4JHZA 4UW5A 5C7GA 1W9SA 4FCAA 5IK4A 2CYFA 4HLTA 4COVA 2JDKA 1AL23 2WT1A 5ISLA 1UL9A 1MS4A 4KI5M 4LXLA 2TEPA 4AQTA 3I7DA 4QXKA 2VVFA 4RD7A 4GWMA 1ODNA 1RMU3 4XQ4A 5LBFA 3NW4A 4DS0A 4ITCA 3BUCA 4XJAA 2QDNA 1A6CA 4JTNA 2BVBA 1RHI2 2IZWA 3FBYA 3SKJE 1CAVB 2JE9A 4QGLA 3SC7X 3TEZA 3NAPA 5T5OA 2BW8A 4QX1A 2XUMA 5A1AA 5FOBB 1YEWA 5A6QA 2MEV3 3IMNA 5A32A 1ZRCA 3CU7A 3MLJA 5A33B 4ZPIA 3D3AA 2AGSA 3POFA 4COYA 3E5UA 1QNYA 3RZMA 3PMSA 4URTA 1LU1A 1E5HA 3RJ2X 3NJXA 3D0SA 3AC0A 3MIBA 5T3NA 2J1EA 5LA0A 3EJKA 3OF1A 4UF0B 5IHRA 1UAIA 5LZ6A 3PVEA 4Q4V3 1BYHA 1OLMA 3S5QA 3AP7A 4QB6A 4XFGA 4RGGA 5LY1A 2HEYF 1EP0A 2ADDA 1OOPA 1UNBA 3ACHA 3O1RA 4NJ4A 3UK9A 2W0XA 3W9AA 5A3MA 2Q0AA 4ATFA 1I6XA 5JI9A 3VB9A 1BQPA 2P2KA 1O4ZA 1V6LA 4CRQA 4WVMB 1WCSA 2FZ2A 1H2NA 2X09A 1QJY1 3MIDA 4KG8A 1CPNA 1F31A 2Z2SB 3ZDVA 5BY5A 1CVNA 3IPVB 3VBSB 2BWAA 2CDOA 1WW6A 2D93A 5CA6A 4JRLA 3AMNA 2AR6A 4FFIA 4B1LA 4XDPA 1LGBA 1PMHX 4LT5A 1SLCA 4BQ1A 2RM22 1XJAA 2HLEA 4EN6B 2QVSB 3H3UA 3FC0A 1FX5A 1UU4A 3WF4A 2HWF1 2ZGSA 4MGTA 2VZ1A 2ZCWA 3H3LA 1JW6A 5FZ9A 1FMD2 4RR3B 4CCDA 4PIZA 4CP1A 2A71A 4QKDA 1S0EA 4KWLA 5FMDA 3HQRA 4OFGA 3GZEA 3I59B 3M4FA 2VTXJ 2CGOA 1W90A 2Y6KA 4Y20B 1U5IA 2RJLA 5HXVA 4M3CF 4P9JA 2XJTA 1IKQA 1IS6A 3RYPA 4AEDB 1ZBE1 3BTZA 1ONAA 5FPUA 3EHKA 3POWA 4MGYE 4KWUA 1HN1A 1XBFA 3C7EA 3HT2A 4LKFA 4ASLA 1H8VA 4GB32 3OSDA 3T2PA 1ND3B 2A6WA 3AJZA 5CFDA 1BBT3 5FY7A 4BQ4A 1AF9A 1VBB2 3HQUA 2NMNA 3IDAA 4MXWB 4NHXA 5D8AB 3THTA 2PTMA 4OI1A 1H9PA 3RSJA 4JV4A 3ST7A 3LA7A 1LOGA 3OB8A 3ZFFC 5FUIA 3UJQA 4C1WA 2DCJA 1UQXA 5A6YA 4RN5A 4BOWA 4YPJA 3VZJA 1DBNA 1EV11 5F5QA 5ANQA 4AGGA 2RDQA 2WIIB 4CEWC 1OUXA 3MUY1 3PVBB 4RFRB 3UNPA 4H3WA 2WN2A 2IWGB 4ZZ5A 4L99A 1ENXA 2GMPA 1A78A 1V9U2 1GP5A 1QQP2 2CDPA 3KQ4B 1Y9QA 4NHKA 2AZ5A 2W1WA 2KD7A 4A6OA 5FCCA 1NQDA 4HVRA 2Q8OA 2DFCA 3VZMA 2WYSA 5ERLA 1LHOA 1DZTA 4RS5C 2MPFA 4JGZC 4CDUB 4TZDA 3K3NA 1YXWA 2AC1A 1SDDB 3OYWB 1LCLA 4JKLA 2IC1A 5CKNA 1FXZA 3UETA 3VKNA 5C9AC 2RVAA 2W1UA 1UY3A 2WR9A 3GGLA 4NOTA 1WGPA 3ZXDA 2VMEA 1AUYA 1F5JA 3WW1A 5LBBA 4C91A 4W6WA 1S2KA 3CL1A 2GC3A 4CDXC 4D7TA 4HKWA 3SCHA 4ASKA 2VXJA 1TME3 4B4PA 5LRSA 5ANNA 3O0VA 4AEDA 5FYZA 1Q5OA 3E6DA 1UYYA 1W8ZA 4L9BA 1W8HA 3LWCA 1WMDA 2BWCA 4M3CA 2BNOA 4JGYC 1GP6A 2ZEYA 1O8PA 1H6XA 2YYOA 5IVEA 1HB1A 1A3KA 3B9CA 2NP0A 2P1BA 4JCKA 2J1UA 3TNQA 2BJSA 2ZGRA 5LK5A 3MIFA 3RZGA 1STMA 2JENA 2B5HA 3MIHA 2MEV2 4ISQA 1JOPA 3JUUA 4UW3A 4YG6A 3CKHA 3WNNA 1P8JA 1US3A 1W2AX 3H8UA 4Q0PA 1QOSA 1HV1A 4JQTA 4OHVA 2PHUA 3NNJA 3PTYA 4YNIA 3FFQA 1SFYA 2J1AA 1X36A 3H0OA 5IAXA 4JGYA 4IETA 3KT1A 4XDQA 1RUG1 5GZCA 1RUJ2 3LOIA 4PIXA 1R1A2 4X6QB 4MGZE 5FZHA 4SLIA 1DGRA 3W59A 1HX6A 1KXGA 3B9IA 3K4AA 4XQDA 3H42B 4HKOA 4N7IA 2G9GA 3A23A 3JQXA 3H3ZA 1RUC1 2QE3A 2WS91 1AR72 1ULFA 1K3IA 4QX5A 1UCXA 4XTPA 3ITQA 3VLBB 4CP2A 5FO7B 4KU8A 1NAEA 3NV3A 1K42A 2CSGA 1J3PA 1GZTA 3AVRA 3LIHA 3U37A 1M4WA 4Q29A 1M06G 1S0JA 1HB3A 4Y5TA 3BTYA 1XU2A 2R063 3U11A 5F1RA 4YZ4A 3NNLA 3UKTA 3RPQA 1QY4A 4WZFA 4N9IA 4DNYA 2EIGA 5FFOC 4RQPA 4Y33A 1DLCA 5FZCA 4AL9A 5KHKA 4ES8A 3DGTA 2XL9A 3P6BA 4QM9A 3MV11 1VBC3 1XOYA 1ULDA 3NAPC 4UW4A 5EXOA 2PN5A 5JMOA 5FMOL 2ARXA 1RINA 3SMHA 1PVC2 4NRQA 4RGAA 4CDUA 1J3RA 2DVDA 1JZ7A 4CCNA 1HJGA 3NV4A 1RUC3 3FLTA 1UIJA 1UY2A 5JOXA 4QU1A 4CP0A 1R082 3HR9A 5A3UA 1MR5A 2PHTA 1LR5A 3OD0A 4OHWA 4QPGA 5A32B 3N7JA 2QZ2A 5E16A 3BU7A 3WVJA 1EV13 4KL1A 1IS5A 1L3JA 2ZACA 3T2OA 2RJKA 2E7QA 2ZKNA 3KCYA 3KV5A 3ZYIB 4DFSA 1JUHA 3VBRB 5IVYA 4FAHA 5JPNB 4LBOA 3PUIA 2NLRA 5GZDA 2R0FA 3WNOA 5HI0A 4BWOA 1Z7S2 1LEDA 3W20A 1B35B 2X05A 3LIGA 1BBT1 3ZO0B 4I02A 2GNBA 4IQPA 4HOOA 2W94A 4LKDA 5FBJA 3VKLA 4A7KA 4QAWA 2WNOA 4N7UA 3ZFEC 3RYKA 5BNOC 5C33A 1KITA 2K46A 2WRAA 2CY6A 2J1SA 3AP6A 1QDCA 3FN9A 5C3OA 1SLIA 3CF6E 2XLFA 1IG3A 5FZKA 4QD2A 2KXLA 1R1A3 1DYOA 1SACA 1RUD1 2PAMA 3L9JT 4P9YA 5C4WC 5FDBA 1OLRA 3AZWA 3OUHA 1QOTA 4AEMA 4AWDA 5JSRA 2OXBA 2VZVA 3ZSLA 5A6XA 4XQWA 1ULCA 3V0AA 1EV12 2E53A 2EXKA 1E5SA 5FZDA 2BTVC 2FCVA 5CVRA 3BN6A 2W2IA 1N3PA 1TQ5A 3WINE 3WP6A 1EAH2 2N7GA 2E6VA 3Q8BA 2W39A 2RS13 4EN8B 3WD5A 1AVBA 3CZJA 4OHZA 4YWAA 3C7GA 2CGNA 3WEZA 5M0TA 1HXS2 2FDIA 4UFMA 4YW5A 4AEKA 1HW5A 3KHBA 2IXJA 1MACA 2ZX3A 4LBLA 4JZRA 4IGOA 4O9EA 4S2HA 4CDQC 2XWBB 1QQP1 5LB6A 1HQWA 5A6ZA 1RVF1 1AL21 5EWSA 3JD71 4LORA 4CDXA 4D6RA 1JYXA 3AKPA 1BKZA 5A70A 4CEYB 4AI9A 1OOPB 1BEV3 2GU9A 1EPWA 4LITA 2A6YA 4QX0A 3V65A 1AL22 4FQZA 4AFMA 1AYN1 3HPNA 4FVVA 5C5UA 1WW5A 1VLNA 3VDCA 3WG3A 5EP9A 4EWAA 4DOUA 1LOFA 2MNGA 5FK8A 4HL0A 4NHYA 3WF2A 2WNUC 1JHJA 1FV2A 1VAMA 2GC0A 2QUOA 2RV9A 3ECQA 4IEZA 3ILFA 4NWVA 4XCBA 4XBNA 2NMOA 1KFUL 4XC9A 4YVWB 1JHNA 3N3HA 4YSFA 2ZHLA 4M0NA 5A7NA 5FV3A 5FZBA 4NO4A 3ORJA 2R7EB 4CDQB 1TMF1 5KHGA 4PHZA 1OXCA 1UKGA 1DQ4A 1RC6A 3WF1A 1VBA1 1BMV1 2G19A 4J1XA 2B39A 2WAAA 2HWF3 1HRI2 2EIEA 3KGZA 5JAXA 2A70A 1PGL2 3HQXA 2LTNA 5DG2A 2XOMA 5FLIA 2VC9A 3OUIA 4OUSA 4QPIC 4COWA 1ALYA 4G9SB 4EZ4A 1YIPA 1F8VA 2E7AA 2DU1A 4IEYA 4LULA 1CAUB 1QWRA 3IAPA 3POIA 4QX2A 1C8NA 3C7HA 3CJXA 1SLTA 3MUZ1 1KGYA 4OUEA 3WDXA 5FPLA 4EWEA 4MADA 2VUJA 3MICA 5CB7A 5FOJB 1FATA 1QIQA 5JLVA 1OD3A 1UPIA 2FZ1A 2ID4A 3UKNA 2VZOA 3JZVA 1NCQC 5LA2A 5IWFA 4EN9B 4LJHA 3I2HA 4LNVA 3CJIA 1GZWA 2RDNA 2WQ8A 1LOFC 1IHMA 3GALA 2H6CA 2DCYA 3N9QA 4PCRA 3CNAA 4BMBA 5C3QA 2Y64A 4GH4B 3IAQA 1ST8A 1K5MB 1R093 2RMU3 1O7FA 3PUSA 4FP3A 2WS92 2JDMA 4ET7A 2VOKA 1JYTA 4LKSA 4CEYA 1SLLA 4PDWA 3J26N 4ES9A 4IE7A 2DCZA 5FWJA 1NCQA 1NE6A 4QHOA 4YGEA 2D6KA 4U36A 5ABJA 4ZU7A 1XYOA 3PUAA 4FO9A 4K1YA 4AVBA 1CWPA 4HSJA 4TSVA 1SFPA 2QDRA 3ALQA 4LBMA 4KMQA 1MS3A 2XONA 4W4ZA 5FYBA 5LEJA 3HVDA 5BNNA 1XNCA 1YRZA 1PVC1 1RYYA 1QJX1 2A6VA 2X5IA 3C3VA 4UAPA 2P6HA 4PIYA 2O14A 3H1WA 1WD3A 1F15A 1QF3A 1UPSA 3N36A 3MGUA 2WT0A 5FO9B 3TWIA 2ZMNA 2Y33A 4JTOA 3JCIA 5IT6A 1G9BA 2J22A 5FQ0A 3AZVA 4JVAA 3OY8B 2R073 1CJDA 4AFDA 2GALA 1NY72 4I3GA 1YC61 3THCA 5C8CC 5IVJA 2R041 2J7MA 4DPNA 1Y9MA 1UW8A 3DL3A 3I3DA 4OULA 3RYRA 2VZSA 3SNMA 2X5IC 5GALA 4Q0UA 4YG0A 1REFA 4N90A 1SHWB 3ZDSA 2VZRA 4AHYA 2WNVC 1O3SA 5EYYA 2E9QA 3LDKA 5A7PA 1KQRA 4OI0A 2P17A 2B4KA 3GJAA 4NIIA 1ZBA2 1PGW2 4N8MA 1MZFA 4GQ7A 1AR91 2R062 4U2AA 5EZWA 2QTWB 3BIEA 1V6IA 4M00A 5FZ0A 3NAPB 4R52A 3B93A 1UY4A 1OF3A 3LOBA 4QX8A 1YI7A 4AVVA 5JI7A 5FP8A 4BB3A 5FYSA 4AQ2A 5L7OA 4Q4X3 2QFEA 1KJLA 4RA0A 2WO3A 1W8UA 1W6QB 3DPRA 1RUD2 5FMOS 3CMGA 4CEWB 4UWDA 4GAZA 4L92A 1RJ8A 4RL7A 5FYYA 1W8OA 2QQKA 1ZBE2 3G7DA 3VHPA 4AG4A 1TME1 4LO5B 1NG0A 1CJPA 3F2ZA 5EYXA 3VD4A 4YM0A 1WLCA 3VBRC 1DQ6A 3CHXA 5FZ7A 2C1FA 4COUA 1CR7A 1MZ6A 2HWB3 5CG9A 2ZMKA 1HDKA 3SH5A 1KEXA 1ENRA 1GZ9A 3BVCA 4OUMA 3BIWE 2D97A 4IGQA 3FBMA 1SBEA 1AXYA 1O6UA 1QDOA 2WDBA 1AYN3 4ASMB 3M1HA 4MGKE 3S7EA 4RQPC 4HPKA 3M3CA 1S1AA 2ZA9A 2EXHA 4FP2A 1HN0A 3QOPA 1DQ5A 2RS32 3K51A 4YZ2A 5DDJ1 4Q4X2 1G7YA 2QQNA 5H9QA 3TAYA 4I3PA 1W2OA 1TNRA 3GZTB 5HV4A 1NXD1 2GN7A 4ISRA 5C8CA 5DDJ2 4JHTA 4W50A 1JOJA 5DZFA 1JZ6A 4NUBA 5ABJB 2LM3A 5JIAA 4P5YA 3RWKX 3CZUA 2PAEA 2XR4A 2ILMA 2OPWA 2X53S 1IS4A 1CQ9A 4QX7A 1G86A 1GP4A 5FZIA 4UI9L 2JB4A 3HBZA 3T4VA 1OD5A 4MV2A 2C26A 1GANA 2O8QA 1LJ7A 1QJEA 4AF9A 2P37A 1IS3A 1D0HA 1ZZBA 2PHLA 3T1LA 3TRSB 1VBA2 4LTAA 5DAVA 3WXPA 3FHAA 2GP3A 1G6NA 4LE3A 3UV9A 4I0WB 3INAA 5B2GB 2F17A 3M3OA 3WG4A 1H2MA 4DINB 1G9FA 4IL7A 1MQTC 5FPBA 4S2DA 1AX2A 4Q8KA 5CKQA 2OA2A 4O9GA 1GNYA 2JDAA 2OIIA 2YV8A 2HWF2 4B4QA 1C8M3 4YVSC 1PK6A 1AXZA 4IEPA 3HEIA 1KD7A 2E33A 2R071 3JQWA 2XMLA 4MUVA 5D1IA 4CCCA 1CX1A 4QQOA 2D6OX 3DXTA 3F95A 2TUNA 4ZHNA 4E2QA 3CJIC 1SMVA 3KT7A 3RVHA 4Q8LA 1V6JA 2XLAA 4GH4A 1D4M1 4YM1A 2BGCA 4BH9A 1LHUA 1ZRIA 4HKLA 2ZABA 1YJKA 3IBMA 3S5AA 1RUG2 5F5CA 3KHCA 4DRRA 1VBE2 4A2UA 4XETA 4OI4A 5EJ3A 4EE2A 2Y38A 5KXDA 1FOD3 1UY0A 1LENA 3BODA 3ZXGA 5EQUA 1WW7A 4RYDA 2BNNA 2PAKA 5J7MA 2RG4A 3ES1A 3K4DA 4RS5A 1QJZA 3E6BA 4Q0VA 3PDQA 1VMJA 5JCTA 3RZJA 3AP9A 3BPSA 4AQSA 3T0BA 4BXFA 4KH9A 1WCKA 3B69A 2JIGA 4K9SA 3AB0A 1JYWA 1R083 1DIWA 4YVSB 3RZZA 2OZJA 3NQHA 3POBA 1ZZCA 2FCUA 1OVSA 2DUOA 4L8QA 3RGBA 1FNZA 1XNTA 3AYCA 3P5BA 4W6YA 2YMZA 2J1RA 2RE9A 1NOVA 5A7SA 1IOAA 1W8NA 1Z0HA 1U12A 1R081 3K46A 1JZ2A 3RI9A 1CAXA 3WCSA 3BALA 4AHWA 3OUJA 3RMYA 2V73A 3ENRA 1PK6C 2J42A 1VAKA 2QQVA 1ZBE3 2ZX1A 1BEV1 1ACCA 3NJZA 3P3NA 1D7PM 4XIOA 2QBXA 3T09A 1YCIA 4IW3A 4UFLA 5I8TA 4R9CA 2QQLA 5GLTA 5I0RA 1YUDA 1RUH2 5F5IA 3AMPA 2A75A 1SLBA 4Z2AA 1YWKA 5KHJA 3DCQA 3T30A 4XFHA 3EXUA 3SH3A 3LPGA 5J36A 1KFXL 4IEOA 2W95A 2BFUL 4N43B 1O91A 5BPXA 3WHTA 4AEDC 1F5FA 1AX0A 2Z5WA 1W3VA 5A3PA 1F4HA 5A7OA 4CVUA 1AX1A 4URAA 1HB2A 4WM7A 4QKFA 3WDVA 5C4WB 5IK7A 1VBC1 1LKNA 4J6GA 3W21A 4CA9A 5KXCA 4KGQA 4E9KA 3JBG2 2ZAAA 1PK6B 3R4SA 1Y43B 1ND3A 1NQJA 1YFXA 2ADEA 2JX9A 3ETQA 4HSLA 5F5AA 3TN91 5JXHA 1LHWA 5FP9A 3GYDA 4BISA 5APAA 1S0IA 2RS33 2SBAA 4JGZA 2D5HA 3WY6A 3IKWA 5A3NA 3V0BA 3KGLA 2XKPA 3FHQA 3JB8A 2RDRA 4XILA 5F3GA 4Y20A 2FHRA 3PHMA 1ZNPA 4NAMA 4JDNA 4CPBD 3HN1A 3NV2A 3OGGA 4ZKTB 1QEXA 4EN7B 5LCWL 2PLV1 3N9NA 5I0UA 4PJYA 4ARXA 4Z07A 5FK7A 4BK4A 3VKFC 1XSQA 1QH7A 5FY9A 5T52A 2WZ8A 3ZOIA 4ZS2A 3G6JB 3POYA 5JVVA 4XF3A 4XURA 1WLWA 2D6PA 3P1IA 4RGKA 5I8SA 3RZLA 3IIIA 1UZZA 2VPVA 4D7YA 1DGRN 1RUE1 1WLDA 2ZGTA 4GJYA 4BA6A 1TME2 4CCLA 5C71A 2X8KA 2Q1FA 2DUPA 1LULA 3DKQA 2YPDA 3CIHA 1OFSA 1GUIA 4FPHA 3DPRC 3WNPA 2XQRA 3WNLA 3VD5A 4JDOA 2VMDA 1MS1A 3UKVA 4CCMA 2GC1A 4Q4Y2 3WF0A 4XF1A 5L9VA 5F3CA 2KR2A 4CDXB 4K6BA 3D5OA 4Q4Y1 2VNVA 3DV8A 3B5LB 5C8CB 1PO12 3CBNA 4Q2FA 3OTFA 1HRV2 4PLMA 1PZ7A 5L7OC 4FT8A 4BHPA 2PHDA 1BLZA 5C70A 2A7AA 1Z7S3 2EA7A 5FYHA 1Q3EA 2QQMA 3ABZA 1WD4A 4HN0A 2IVIB 1Y4WA 2CWMA 5LBCA 4CUBA 2BEOA 4XFAA 4LIUA 3VDDA 1CZVA 4NRMA 5JXIA 1SDWA 2ZGMA
chains in the Genus database with same CATH topology
2UY8A 4MGIE 5KXBA 2XVLA 2NN8A 4GULA 5T55A 1PVXA 1GNHA 4M3CE 1W6QA 3DPRB 2Y0OA 1SBFA 2A6XA 1W0OA 4B7EA 4HK9A 4E4DX 1ZZ9A 2FQPA 4DQAA 3R4UA 4GMP3 5DZGA 5FPXA 2NYYA 1OSGA 1UN1A 1K5MC 4Q26A 4FSJA 2XH6A 2JXAA 4V1PA 1TNFA 1DU3D 2E51A 1OI6A 3TBDA 1J59A 1UMZA 1D4M3 2TBVA 3BOWA 4XFCA 3WDWA 1KDMA 3AZZA 3DUIA 2JG8C 1YHFA 3FUOA 3ZXJA 1ASJ3 1VP6A 4FPKA 4Y5Z0 2IXLA 4K40A 3MFCA 5ABJC 4IV1A 3E5XA 1YYNA 3ZXAC 2YGLA 5F9TA 4PF5A 4HVQA 3HAGA 3NWKA 5HCBA 4GMP1 3AXEA 5LRRA 1LRHA 5JOWA 3VN4A 2O1QA 3MI8A 1VALA 1VB4A 5CFCA 5AFBA 3IDCB 4YGDA 4LBNA 4MX3A 2WFF3 2ZX0A 3AYEA 5ACA1 3FZ3A 4AVSA 1LTEA 4ZU5A 5A33A 1QJX3 4XXAA 3GZAA 3ELNA 3BOPA 2ZAHA 2XKOA 3IDEA 2PFWA 1CIWA 2DURA 4A7YA 4QPIA 1H8TB 2JDZA 1U5YA 2RHPA 3MW2A 4I09A 4DY3A 2CNAA 2NPIA 2WZR2 1XU1A 2P3KA 2VVDA 3WW3A 3AP5A 2IXCA 4KU7A 5AVAA 5SV8A 5K0UA 3ZN6A 4FAGA 1QJY2 1NYWA 3VBHA 3IWZA 5EFUA 3HMYA 4E2SA 5BNNC 3BPZA 2YC0A 2A5ZA 2HWC2 1VBC2 4R9AA 3ZYRA 4NPRA 2R042 4YM3A 4F83A 2A3WA 1NCRC 2BUKA 4CEWA 2ZKLA 4QQLA 1N3QA 4D3WA 3A4UA 1PIV1 3QH6A 3ZMOA 4ZU4A 2X29A 4FPGA 2MEV1 2BVVA 4GKYA 4XBQA 1MVQA 3MLLA 5CBLA 2GNMA 4LUMA 4CDWC 5BYNA 3EBRA 2WINB 3KM5A 4AHXA 1I5ZA 4FPCA 2VULA 3M3EA 1R1A1 1DLLA 2I2SA 3SXWA 1G9CA 1ZREA 2Z69A 4Z1VA 2GZWA 4HN1A 4XHXA 5T5LA 1J1TA 4WM7C 4NWWA 2ENRA 5BNPB 1YFUA 4LLOA 1Q56A 2YGMA 3MPBA 1QMJA 2WL1A 4P9LA 2ZGNA 1PO22 1S0FA 3CEWA 1FT9A 4UXAA 1AR73 1RGSA 3VHOA 4CDQA 3WUCA 1FPN2 4QPYA 2R16A 5FQ0B 1TEIA 4GB33 2YZ4A 3SCGA 4I30A 5KWRA 2VNGA 3QCWA 1W6OA 5KC6A 1BK1A 2QCSB 3KLSA 3IPVA 1QJY3 1U0AA 2ZTNA 1JN2P 1QJX2 3GBWA 3DF0A 4I0AA 2UURA 3B00A 4QPIB 4Q4W2 4FOQA 1Q8SA 3NL1A 5AC92 1ULEA 4N9HA 4QQPA 2UWBA 1DZQA 2YY1A 3WW2A 1VBD3 3AMQA 2WSVA 1RUF3 1CPMA 3VKOA 5TSWA 2YXSA 2JG9B 3ZSMA 4AFBA 2ZJCA 4IV3C 4IERA 3HD8B 3KQRA 1HRV1 4HT1T 3B94A 4N53B 4FPOB 3VBFB 4GXLA 4NVPA 5AC93 2VMGA 1PGW1 1ZBA1 1I1EA 5A3LA 3KCCA 4K1ZA 4P9XA 1DQ1A 3AYDA 3O14A 4AE2A 4AFCA 2OVUA 2IFRA 3AKSA 3IT8A 2H6BA 4IV1B 1REDA 3VBSA 2PA7A 4RHV2 1C57A 2K2SA 3GHMA 2ZGLA 1UU6A 1D4M2 1RUF1 1V70A 4G4FA 3VBUB 1FMD3 1AYM1 5GLZA 3ZFEA 1DG6A 1VRH1 4X6RB 4BCUA 4TYSA 4AI2A 3R4DB 4FPLA 4MXVA 5H9PA 4KGGA 1R092 2RMU2 2HWB1 2DF7A 2VNOA 4PLOA 3M2MA 1X7NA 2I74A 1COV2 2XWJB 1Q8PA 5H9SA 2BNMA 3AK0A 4Y22B 4Q27A 4LR4A 3VBUC 4EV0A 4S2GA 1VBD2 4XJUA 2DVBA 3PNAA 1MQTA 2X5IB 1IZ3A 2DFBA 4M3CB 4AW7A 3NKTA 4OI2A 1Q43A 3U0ZA 4IESA 1VR3A 3JD72 4RHV3 1NA1A 4BYYA 4Q4W3 1PGSA 1WW4A 1NLSA 1SEFA 1RUJ3 4AVTA 3I2DA 1DQ0A 3APBA 4YZ3A 2OYZA 2TNFA 3FWEA 1MEC2 2ARBA 2VH9A 4FTBA 2UU8A 4EROA 1R1ZA 5CNAA 2HWE2 4RS5B 3JBG1 1GZWB 4XW3A 4AFAA 1UIKA 5DG1A 1AR92 4B3NA 3WDTA 1RUG3 1JUIA 3SHRA 2NZ9A 5FLJA 4M0HA 5JOYA 1BMV2 2CGPA 2A3YA 1V6NA 1A8MA 5J09A 4AK3A 3V0AB 1GR3A 3MIEA 2IXIA 5GLWA 1ZZ8A 1RMU2 2B42B 1CAWB 3OJBA 3FMGA 1I3HA 3U10A 1FYUA 4AI3A 5FAXA 1ENQA 1H1MA 4AVCA 4Y1UA 2HWD2 5BNQA 2Q30A 3K48A 2SLIA 5DDJ3 4KQ7A 1X82A 1OQEA 1VBB1 4WZCA 4IEQA 2ES3A 1MZEA 2HEVF 1N1TA 2Q1MA 3VBHB 1FPN1 1J3QA 2A6ZA 4G3YC 4LHKA 3GBFA 4INDA 4YW1A 1V6KA 3OGJA 4WM8C 2XL7A 4NN0A 4AYUA 1J1LA 1VBE3 1MVEA 3LKJA 3GNEA 4BM8A 4K21A 3MEPA 1PZ8A 4HPKB 3R6SA 1HQLA 5DUWA 4YVSA 2BPA2 1VJ2A 3VHNA 1IPKA 4DY5A 3WLUA 1LGCA 1GYKA 1DGWX 2Q4SA 3WP5A 1MS9A 2VXRA 1NA1B 1QH6A 1ASJ2 4AGVA 1AJOA 1C3HA 1G8WA 5I93A 2DU0A 2HJIA 3H9AA 1LOAA 5C9AB 4IEXA 1VIWB 5AC91 2DVGA 2I45A 2XPJA 3OBTA 5JPMB 1JXNA 2PELA 1ZVFA 2ZGKA 5K8SA 1DYPA 4HK8A 4QGNA 2JICA 1NZCA 2RM23 4Q4V2 1RHI3 2V09A 4YG3A 3NKGA 4K7JA 2WA3A 1N1YA 5CFDC 1QGLA 3H1YA 4HMZA 1ZRDA 3WDUA 2DUQA 2AREA 3OD4A 3DKWA 4NR1A 1CAUA 4Y26A 1LGNA 3VBFA 2I07B 1OLQA 4AXOA 3WNXA 2JG9C 1H1AA 3LSEA 4GB31 4K8FA 1LESA 1ND2A 5JIUA 4C0BA 1HRV3 2OPKA 2RR12 3AKTA 1JYCA 1MS8A 1WLTA 3IM0A 5EV7A 1RIRA 1RITA 3ES4A 3GZUC 4LBKA 2WZPP 1OOPC 4WVMA 3VDDB 3VBOC 2R1DA 4SBVA 3VZLA 3MF9A 1ZRRA 1O3QA 1SCRA 3WW4A 1RB8G 1OFNA 4J1WA 4JQRA 4N53A 1F2NA 1D2SA 3AJYA 2KM2A 2JECA 2GMMA 3T2TA 4I2OA 3ZYGA 1TMF3 5DXDA 1OQDA 1W6OB 1R091 2RMU1 2VECA 3EQEA 4FPEA 5BNNB 4EWDA 4XPVA 2RS11 3WQ0A 1QXJA 4Q0QA 4Q4X1 2PQQA 5SV5A 2YROA 1V6MA 1V6OA 4ORFA 2VOXA 2F6BA 1IPJA 2JJ6A 2WNVA 4QGMA 1JH5A 3WV6A 3S0MA 3OCPA 3ILNA 2HWE1 2AUYA 4YVWC 1WBFA 2D3PA 5GJ6A 4FTSA 1XE7A 4UW6A 4L11A 4AI8A 4HANA 4XE9A 2GSYA 3CLPA 4LO8A 2D3SA 1RUI1 3AXDA 3J4UH 5IUQA 2ETEA 4YGCA 2YUEA 4Y24A 1LECA 2O0OA 4E4ZA 2D98A 2C9AA 1FAYA 1H30A 3WG1A 1V9U3 4X8PA 3NO8A 5BNOB 1C5HA 3WQ1A 1HIXA 2VW1A 4L2NA 4QPGC 3ZXEA 1CN1A 1QJU1 2Q5TA 3AMHA 4XFBA 4FTEA 3L2HA 1PO21 3D82A 1GKBA 2WJSA 2W68A 4LO4B 1OQ1A 5J48A 4XYXA 4QM8A 2GNTA 5CU1A 5JZGC 4JC1A 3ZN5A 1RHI1 1RUE2 1S0DA 4BMEA 3OY8A 3D6EA 5J37A 4F7ZA 4CDWA 4XTMA 5I0TA 3S6PA 3ZVXA 4IEVA 4PBOA 2HEWF 3VHRA 3WX5A 2VVEA 1CGPA 1O3TA 4H55A 4YYOA 1C8M1 3KZ4C 4D69A 2ZGQA 3V64A 4FBFA 1ND2C 3LA3A 1AYN2 2A73B 1UU5A 5L19A 3QACA 4Z2WA 1S0BA 4E4SA 5K0UC 2CV6A 5DZEA 3MFAA 2R30A 2WSUA 1PNGA 1W6PB 4QU2A 4XHBA 4FPJA 1BJQA 3RQ0A 1ASJ1 2EXJA 3ASIA 1YJLA 4GWNA 3LAGA 4PDWB 2ZX2A 4Y22A 4GKXA 3U4XA 1DGWA 1KJRA 1NE4A 3KMHA 1LOBA 4YW4A 3Q9OA 2ZGUA 2JG8A 4Q4V1 5BUVA 2OZ6A 2GN3A 2D6LX 2IFWA 2RS53 4JGZB 4ATEA 5BV6A 1CONA 1DHKB 3POSA 1RUNA 4HETA 3ZFEB 4ZXKA 1JYIA 2B45X 1CESA 1NA1C 2CAVA 2R072 1V00A 5T5PA 2VU9A 4XFFA 5DUUA 2PLV2 4BIOA 4AGRA 1ENSA 2VW2A 4Y1VA 2RR13 3VV1A 3M70A 2YDEA 4I0BA 2XG3A 1YNAA 3WG2A 1GFF2 2EVXA 2H0BA 2JG9A 4R4XA 1HRI3 4XJZA 3VKMA 4C1XA 1RUF2 4KNCA 1AR71 3ZSJA 4XFIA 1ULGA 3SH4A 4LHNA 2D6NA 3ZSKA 3OYWA 4WVWA 3WHUA 1VAVA 1ND3C 2XBO2 2WNUA 3D0JA 5BXXA 4P9WA 3USUA 1IQAA 2D7FA 1KS5A 1ZM1A 1D4VB 2XBO1 1RVF2 3OBRA 4P9GA 3MDPA 1PM7A 2ZS6B 3BB6A 4LLFA 2EALA 1OMIA 1AR93 4Q4W1 3VBOB 3H7JA 1FPN3 1PMIA 2XBO3 2XVKA 3L2YA 1FI2A 1LODA 3RG0A 4KWJA 1EAH3 3VBSC 3RRDA 5JZGA 1AYM3 5AVPA 1OHFA 3KB5A 3ME2A 3UJOA 5BNPA 2D44A 3I54A 4H14A 2WNUB 4Y1ZA 2PHXA 3W58A 5D8AA 3B01A 4FPFA 3ZFFA 5JMCA 5L7OB 5K7PA 1H9WA 2GC2A 1W0PA 2QNKA 1VBA3 4CDUC 4IEUA 4YM2A 4OVEA 1SQ4A 3AZYA 1PIV2 1W6NA 2VNRA 1WCDJ 2ZMLA 3A0NA 3VGIA 1LHVA 1MEC3 2LALA 2ZGOA 4BLIA 5BNPC 3VL8A 4NHLA 1QJU2 4Q1PA 3CJIB 4R9DA 4FOWA 3ZX7A 2XJVA 4AQ6A 4FOYA 3V56A 3E97A 1LB2A 3KCXA 1ZX5A 3QLQA 4PBPA 4XXPA 4PLNA 1RUC2 3AKRA 3VBUA 4I01A 1RMU1 2ZZQA 1REEA 1QOOA 4R9BA 4WVZA 5T54A 5IK8A 1PNFA 4XF9A 3T1MA 4EJRA 3ZN6B 1H2LA 1FOD1 2W52A 2VG9A 5KHIA 3B3QE 1DZRA 1H8TA 2R49A 2ZX4A 1B35C 2Z79A 4PQ9A 4RFT0 5JDBA 1CAVA 2E63A 1EAH1 5FBZA 1FV3A 3NSTA 3H1MA 1WUVA 3IIAA 4FQ4A 1HXS1 4WVVA 4YFZA 1KRIA 2XJSA 2B8MA 4MYEA 4F3JA 4IV3A 2VQ0A 1PO23 3WP3A 2WFF1 1S0GA 3VL9A 4XIKA 4XOGA 1RL3A 2JKBA 4BE3A 2WQZC 2P34A 3TOJA 1ZZ6A 2ZZJA 3AX4A 3TN93 5JSOA 1AL0G 2C0ZA 1MS0A 4IV1C 2MHFA 1ZA4A 4XZPA 1CAXB 1O5LA 1EPZA 2CWSA 3LCPA 1NXMA 5GLUA 3JD73 1DQ2A 4UBHA 1Y3TA 2AENA 3VZNA 3PVNA 3GBGA 5JR7B 5GLVA 4WV8A 4GALA 2R061 4XJ8A 2VOWA 1OA2A 1I9RA 2D40A 4BZ4A 1IKPA 3RMXA 3R05A 1Q8QA 2DWRA 2HWE3 1D0GA 1CAWA 4LBJA 2JD4A 3FX3A 4BLJA 4META 2WS93 1HKDA 2Z42A 1URXA 5T50A 3HIFA 2D5FA 3WUDA 5KBFA 3PVOA 4Q1RA 4YVWA 4COZA 3QBQA 4C90A 1POV0 5C6CA 3ZIWA 3ZXFA 2ZHMA 1COV3 1LOEA 5FREA 1H2KA 2VY0A 4GH4C 3ZYPA 1BXHA 2EAAA 1VB2A 3N4MA 1C4RA 2R1BA 1GSLA 1H4GA 2PYTA 2RS51 3N7KA 1OA4A 5GKAC 4XBLA 4P14A 2WLPA 4TLFA 3HT1A 1BEV2 3CO2A 3ZFFB 1HLCA 2WWSA 2WZR1 1AR81 2CL2A 3ACLA 4HFSA 5KC5A 1BVVA 3KS7A 3S30A 3LB9A 3WQ7A 1MEC1 2GMEA 1HQNA 1KDKA 1ZZ7A 2E7TA 1VBB3 5JSPA 1NCRA 4QMAA 2XHKA 1QNWA 1GQGA 2R0HA 4AI1A 3VZKA 4Y1YA 5LEKA 1XYNA 1UKRA 3ZMNA 4BPZA 2RM21 1PGL1 2HWC3 4R4ZA 3C2UA 1XYPA 3WDYA 4ONUA 3NVCA 4FPYA 1QXPA 1DFQA 2QJVA 1LHNA 1TMF2 3FHIB 5BNOA 1E57A 3FE5A 4XMIA 5I8YA 1HRI1 4QPGB 3ATGA 1K5MA 1F9KA 1N1VA 3LGRA 3O12A 4KBBA 2G9FA 2XLGA 2UY9A 4H7MA 2K9ZA 1J58A 4FXGB 4JGYB 4XMAA 2WA4A 3RNSA 3QH7A 3VBRA 4EN0A 2JEMA 5JZGB 4C0HA 1OA3A 1XNBA 2DYCA 4DRVA 3SITA 4DXZA 4YGBA 1SFNA 4LBQB 4MLOA 3JU9A 4JRAA 4QQHA 5GZFA 2VQAA 2ZGPA 5HBAA 1CD3G 3E6CC 4FOVA 4E2GA 1XNDA 1Z78A 2ERFA 4X8NA 5K0UB 1XE8A 5HCFA 3O7OA 3RS6A 2DCKA 3N7LA 4B4RA 2VOVA 4CEYC 5J98B 1NCRB 4AI0A 2XJQA 5CIRA 3IN9A 4RQPB 1C8M2 1FOD2 1OPOA 4RSUA 4RR3A 4Y4YA 2VMHA 3ZFGC 1UX6A 5CAZA 1H8TC 3GF6A 4E27A 3SCFA 3JB4C 2GH2A 2XGXA 2WKKA 5F6KA 2GH8A 4L97A 3MZHA 2KA3A 4AEJA 1PO11 2DVFA 2ATFA 4F8AA 3WP4A 3LA2A 4LE4A 4M01A 4MSVA 1C28A 4W65A 3TNPB 5I0SA 1WBLA 2P3JA 1D2QA 3AM2A 4XF4A 1OPMA 5CFDB 1AR61 1RJ7A 1XXNA 1EYBA 3HWJA 1O3RA 2BBVA 2HYKA 2R6QA 3RWNA 2CAUA 2ZHKA 2WZR3 1FMD1 2HKXA 3N7MA 1PVC3 3H7YA 4N43C 3AFGA 3AMMA 1N3OA 2EF6A 4JDMA 5L73A 4WBBA 1SBDA 2DTYA 4IXLA 3FLPA 2XJUA 3IDBB 1PHMA 3KT4A 3VZOA 5CFCC 1XQNA 3JBG3 1QQP3 3SISA 3S7IA 4OHYA 1BBT2 3ZFGB 4LBQA 2R043 2R32A 3ROUA 3O0WA 3WOGA 1MZ5A 2Y0IA 3TN92 2A3XA 2LUWA 3ZXKA 2VW0A 1AYM2 1UZYA 1KS4A 2V5YA 2QZ3A 3ZSEA 4B29A 1S55A 1RUJ1 3ZXLA 1NLRA 4YZ5A 4RHV1 1H4HA 4HZFA 2HWD3 3J8F1 2WNEA 3LZZA 1X33A 1UD1A 4LUKA 1G9DA 3M3QA 4YRDA 2UYAA 1QHDA 4CYDA 1W39A 2C5DA 1W2UA 2UYBA 3THPA 4QT6A 1LOCA 4Z82A 5E89A 1LU2A 4IV3B 2WT2A 5C9AA 1FNYA 1RUI3 2ZBJA 3FUQA 2OW4A 1N1SA 4LBQD 3WR0A 2WLQA 2XB6C 1XRUA 1W6MA 2ZPXA 1C5IA 3NV1A 3KSCA 4XJ9A 5E88A 4IEWA 4QHBA 1AXKA 3MYXA 1O5UA 4NHMA 1RUE3 4LO6B 1AR83 4Z8BA 2RS12 4H7LA 3ZYJB 1V9U1 1TE1B 2ET1A 2QQPA 1PIV3 1QKQA 3OPZA 1GNZA 3AFKA 4W6XA 2D43A 2IXHA 3B02A 4AVAA 4R8HA 5KXEA 2PHFA 4LHLA 1PZ9A 1C1FA 1H1IA 5CG8A 2O8OA 5I91A 1DGLA 4GA9A 2ZOEB 1AHSA 3MF6A 2BYVE 5C8WA 3RJRA 4HVOA 4P9IA 4YZ1A 1PO13 4Y1XA 1QXRA 4GMP0 4YW2A 2FBEA 1HV0A 2H0VA 3TYJA 1GV9A 3KD4A 1YFYA 5FPZA 2FMDA 1Q8VA 1POV1 1DYKA 4N53C 3QD6A 4YW3A 2XJPA 3D4KA 1LEMA 2UWCA 4UBGA 1RTVA 3J8F3 1VBE1 2P3IA 1X8EA 2D6MA 3P3PA 1CX4A 4QQ2A 3AP4A 5FRAA 1VRH2 1AR63 1ND2B 2G4IA 2RR11 1B35A 3SLIA 4K3UA 5E8AA 3PLQA 2DV9A 1H0BA 2D3RA 2HWB2 4WM7B 5C4WA 3X29B 5AFEA 2WC2A 5GZGA 1GQHA 2DVAA 5T5JA 3FLRA 1XNKA 2CTVA 4N43A 4AHZA 1COV1 1APNA 1RUOA 4YARA 2AH2A 3LSDA 3I8TA 1G9AA 2IXKA 1YLLA 4YLZA 1C1LA 2B46X 3EO6A 1VBD1 2WFF2 3J9SA 2GNDA 5DUXA 4A7ZA 3AKQA 2VMIA 3GHNA 4XJWA 2B7YA 3R0RA 3B7MA 1NY71 1GICA 1S0CA 3AYAA 2WQ4A 4BIFA 1AZDA 2OUJA 4D7SA 2BQPA 3A0KA 3MPPG 4RR3C 1NCQB 5JOZA 2GAUA 5K9YA 1AR62 2FMYA 3MW3A 4KWKA 3URFA 2ZHNA 3USSA 5F6LB 5E1RA 2OUHA 3PMEA 3WT3A 2DTWA 1X8MA 4CTEA 4XEZA 4JAAA 1EY2A 1MQTB 5D8AC 3RI8A 2XVGA 5FO8B 3MLKA 2AYHA 4MXWA 1Y7BA 1BVP1 1SCSA 3DN7A 1N47A 3MIGA 1ZRFA 3TB0A 1GBGA 3RDIA 1VRH3 4LO7A 1Z7S1 2Q1ZB 4Z92B 3ZPYA 4GIQA 1T6GC 2JE7A 4DZGA 2UWAA 4B8EA 2JG8B 1DDLA 4WM8A 3FFZA 3PJYA 3M7AA 2XJRA 4MH0E 4DB5A 1B09A 3O0XA 4OHXA 3D8CA 1RVF3 2W08A 3V0BB 1ZYBA 4P5HA 4CDWB 3FJSA 5GM0A 4OZXA 3H50A 5KHHA 1YO8A 3AZXA 5JWPA 1JTZX 5HCAA 4K20A 2PHRA 2Y26A 2K0GA 1U5ZA 5FTTC 3VBHC 1GLHA 2WNVB 2F4PA 1QJU3 1JBCA 2DCTA 3VUOA 4WM8B 3O5SA 1X50A 2RS52 2NM1A 4D94A 4A3XA 5H9RA 1UF2C 2NQYA 1WA4A 5LK7B 3N35A 1W6NB 3U07A 3PJQA 4B7KA 1O4YA 1POV3 3BCWA 3J8F2 2YPJA 2PLV3 4Q4Y3 5IK5A 3ILRA 5J96B 1W6PA 2BFUS 3UL2A 1DF0A 5L36A 2VGDA 5ACA2 1O4TA 3USUB 4LA3A 4LEJA 5FLHA 1IGOA 2RS31 3WCRA 4YFWA 1ZBA3 1BCXA 1AR82 1OKQA 3VBOA 4CZSA 1AJKA 3M3IA 5ACA3 4MVTA 1RUH1 1YI9A 1W6MB 2YHJA 4TWTA 3MW4A 2PHWA 3E5QA 4Q0SA 4XF0A 4LA2A 1YFWA 1QU0A 3I59A 1RUD3 2B9UA 1RUI2 3VBFC 2HWC1 3I4IA 1A8DA 2VUAA 2EAKA 2GDFA 5CADA 3ZIXA 5DUVA 4DMIA 4S2FA 1RUH3 3ZFGA 4OLLA 1GZCA 4FXKB 3WZ1A 4PDWC 1WMEA 1Q8OA 1YIFA 4MZUA 1HXS3 3BTAA 4HBNA 2EXIA 1BZWA 3M8LA 2ET7A 3ZN4A 1MS5A 1U5XA 5GZEA 1S2BA 1WMFA 5J3UA 2QKDA 4KG0A 3VDDC 2HWD1 2WFPA 1SLAA 4UW5A 4FCAA 5IK4A 2CYFA 4HLTA 4COVA 1AL23 2WT1A 1UL9A 1MS4A 2TEPA 4AQTA 3I7DA 4QXKA 2VVFA 4RD7A 4GWMA 1RMU3 4XQ4A 3NW4A 4DS0A 4ITCA 4XJAA 2QDNA 1A6CA 4JTNA 2BVBA 1RHI2 2IZWA 3FBYA 1CAVB 2JE9A 4QGLA 3NAPA 5T5OA 2BW8A 2XUMA 5FOBB 2MEV3 3IMNA 5A32A 1ZRCA 3CU7A 3MLJA 5A33B 4COYA 2AGSA 3E5UA 1QNYA 3PMSA 4URTA 1LU1A 3RJ2X 3D0SA 5T3NA 3MIBA 3EJKA 3OF1A 1UAIA 3PVEA 4Q4V3 1BYHA 3AP7A 4XFGA 4RGGA 2HEYF 1EP0A 1OOPA 3UK9A 2W0XA 3W9AA 5A3MA 2Q0AA 4ATFA 1I6XA 5JI9A 1BQPA 2P2KA 1O4ZA 1V6LA 4CRQA 4WVMB 1WCSA 2FZ2A 1H2NA 4KG8A 1QJY1 3MIDA 1CPNA 1F31A 2Z2SB 5BY5A 1CVNA 3IPVB 3VBSB 2BWAA 1WW6A 2D93A 5CA6A 4JRLA 3AMNA 2AR6A 1LGBA 4LT5A 1SLCA 4BQ1A 2RM22 4EN6B 2QVSB 3H3UA 3FC0A 1FX5A 1UU4A 2HWF1 2ZGSA 2ZCWA 1JW6A 1FMD2 4RR3B 4PIZA 4CP1A 2A71A 1S0EA 4KWLA 4OFGA 3I59B 3M4FA 2CGOA 4Y20B 1U5IA 2RJLA 5HXVA 4M3CF 4P9JA 2XJTA 1IKQA 1IS6A 3RYPA 4AEDB 1ZBE1 1ONAA 3EHKA 3POWA 4MGYE 3HT2A 4ASLA 1H8VA 4GB32 1ND3B 2A6WA 3AJZA 5CFDA 1BBT3 1AF9A 1VBB2 2NMNA 4MXWB 5D8AB 3THTA 2PTMA 4OI1A 1H9PA 3RSJA 4JV4A 3ST7A 3LA7A 1LOGA 3ZFFC 3UJQA 4C1WA 2DCJA 4BOWA 3VZJA 1DBNA 1EV11 5F5QA 4AGGA 4CEWC 2WIIB 3PVBB 4H3WA 2IWGB 4L99A 1ENXA 2GMPA 1A78A 1V9U2 1QQP2 1Y9QA 4NHKA 2AZ5A 5FCCA 1NQDA 4HVRA 2Q8OA 2DFCA 3VZMA 1LHOA 1DZTA 4RS5C 2MPFA 4JGZC 4CDUB 4TZDA 1YXWA 3OYWB 1LCLA 2IC1A 1FXZA 3VKNA 5C9AC 4NOTA 1WGPA 3ZXDA 1AUYA 1F5JA 3WW1A 4C91A 4W6WA 1S2KA 3CL1A 2GC3A 4CDXC 4D7TA 4HKWA 3SCHA 1TME3 4B4PA 5LRSA 3O0VA 4AEDA 1Q5OA 3E6DA 4L9BA 3LWCA 1WMDA 2BWCA 4M3CA 2BNOA 4JGYC 2YYOA 1A3KA 3B9CA 2NP0A 4JCKA 3TNQA 2ZGRA 5LK5A 3MIFA 2JENA 3MIHA 2B5HA 4ISQA 2MEV2 4UW3A 3JUUA 4YG6A 3H8UA 4Q0PA 1QOSA 1HV1A 4OHVA 2PHUA 3PTYA 4YNIA 3FFQA 1SFYA 1X36A 3H0OA 4JGYA 4IETA 3KT1A 4XDQA 1RUG1 5GZCA 1RUJ2 3LOIA 4PIXA 1R1A2 4X6QB 4MGZE 4SLIA 1DGRA 3W59A 1HX6A 1KXGA 3B9IA 4XQDA 4HKOA 4N7IA 2G9GA 3JQXA 3H3ZA 1RUC1 2QE3A 2WS91 1AR72 1ULF<