2WQZC

Crystal structure of synaptic protein neuroligin-4 in complex with neurexin-beta 1: alternative refinement
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
177
structure length
177
Chain Sequence
HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Synaptic Protein Neuroligin and its Beta-Neurexin Complex: Determinants for Folding and Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords NEUROLIGIN 4, X-LINKED
total genus 34
structure length 177
sequence length 177
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wqzC00
2B7YA 1MR5A 3AK0A 1IKPA 1QNYA 2ZGRA 3M1HA 3OGGA 3QLQA 3NV2A 3OBRA 4UW5A 2DVAA 1SBDA 2ZABA 1FX5A 3AP7A 1MS1A 5KXCA 1BXHA 4C1XA 5FREA 2VUAA 2WJSA 5H9PA 1BJQA 4DQAA 4ISQA 4IQPA 2GN7A 1N1SA 2GNMA 3FUOA 1DBNA 4XTPA 4M3CB 3O0XA 4P14A 3SH4A 1WW7A 3N7MA 2R1DA 5F9TA 2JDZA 3DUIA 1LOAA 2EXJA 5GZEA 1DQ0A 5T5LA 3TB0A 1ENSA 1C1LA 1HLCA 2DV9A 4YGEA 2RHPA 3ASIA 2NN8A 1A3KA 1G8WA 1U0AA 4XTMA 4YGDA 1NXD1 4FPOB 2CTVA 3UK9A 3RMXA 4LBQD 1N3PA 2A71A 2AENA 4D69A 1MS0A 3MW4A 4R9DA 3AFKA 3RG0A 1DQ5A 1YO8A 1LOGA 2UWBA 2OUHA 4JC1A 4BQ1A 1V6JA 4M3CA 3VKMA 4GKXA 4L8QA 4YZ1A 3ENRA 2VH9A 3BODA 2ZA9A 4NOTA 2WT0A 5T5PA 2ZMKA 1JUIA 3I4IA 4K1ZA 3AZXA 5DG2A 4UW4A 3V0AB 1GNHA 3W59A 2ZGQA 5HCFA 4ZXKA 2GN3A 1W6QA 1SBEA 4YM1A 1C1FA 5JDBA 3IMNA 2YROA 1ZA4A 3A0KA 1SACA 2G4IA 2OW4A 4FP2A 4AYUA 1S0FA 4Y20B 5T5OA 1QDCA 2ZGPA 4UW6A 3LSEA 4HL0A 2PHUA 2AREA 2E53A 4YW4A 1DZQA 1EPWA 2YXSA 4Q2FA 4YW2A 4FPEA 1HQWA 1D2SA 4CZSA 3MEPA 4JCKA 3GNEA 4XIKA 1G9DA 1DGLA 1JN2P 1LGCA 1LODA 1Y7BA 5DUVA 3AXEA 4YW5A 1WBLA 5GZDA 3AP5A 1WLWA 3WUDA 4LBOA 4AVVA 3D4KA 1NLSA 4PF5A 1AX2A 2P3JA 4XHXA 4YZ2A 1GKBA 1KDKA 1PZ9A 1S0BA 2E7QA 3APBA 5GLTA 4BLIA 2D6LX 3AJYA 1SLBA 2LALA 3FBYA 2ES3A 1GLHA 2EXKA 2ZGMA 4XJAA 1HDKA 4Y1ZA 2EXIA 2PHXA 4M01A 4DRRA 3BIWE 2ZGSA 2D6OX 1DQ6A 2CYFA 2JECA 1LEMA 1TEIA 5IK4A 4R9BA 5H9QA 1JYCA 1N1YA 2A5ZA 1LEDA 1JYIA 2CY6A 1QGLA 2CNAA 4FOWA 3N7KA 2KM2A 4M3CF 3WVJA 3SISA 1GNZA 4FPLA 2PHFA 1N1TA 3WNXA 5EWSA 1Q8PA 3O0WA 2R16A 3POSA 4YW1A 1PZ8A 1BZWA 5GALA 5GJ6A 3USUA 2ZBJA 1CJPA 4ATEA 1GICA 1J1TA 4FPGA 2DUOA 1RINA 2WLQA 3OPZA 4WV8A 1A8DA 3WDXA 1F31A 2DYCA 2EIGA 2ZKNA 5IT6A 3WG3A 3WUCA 4CRQA 1LULA 2HYKA 4Z8BA 1BKZA 1SLTA 2PHWA 3VKNA 2D44A 3OY8B 3V65A 3M2MA 1D0HA 4LBQA 1WD3A 3JU9A 4U36A 1LGBA 1AXYA 1LHNA 1IKQA 4YM3A 1I1EA 1SLLA 3M3EA 1F9KA 2UURA 3Q9OA 4GWMA 1ULEA 2D43A 2DVGA 2GMPA 3FLRA 1G9AA 2D6KA 1VLNA 4CTEA 5HCAA 1MS5A 1S0CA 3VV1A 1JBCA 4XBNA 3LSDA 1AZDA 3WG1A 3WCRA 1Q8VA 1GZWA 5T54A 3NV3A 4BMBA 4PBOA 4Y1UA 3O12A 3UJOA 3V0BA 1RIRA 4DPNA 2EXHA 1GYKA 3PVNA 2D7FA 1QOOA 2FHRA 2PHTA 2FMDA 3B00A 4DFSA 1AJKA 1YXWA 2W08A 3SNMA 1DQ1A 3SITA 1YI7A 2A3YA 1QMJA 4MYEA 2DVBA 2ZHNA 4XHBA 3WV6A 2AH2A 1HKDA 3B3QE 3OYWB 1PZ7A 2ZGOA 2I2SA 1KRIA 3WOGA 4Q8KA 1LHVA 3HN1A 1KJRA 3IKWA 2NM1A 1MVQA 2VW1A 5DG1A 2XB6C 5KXDA 1I3HA 2AYHA 2VY0A 5E89A 4P9YA 2TEPA 4WVWA 1G7YA 3ZXLA 1GV9A 4OZXA 1MVEA 2AGSA 4K21A 4R9AA 3WDVA 3ILFA 1V6IA 2DURA 3B9CA 5T50A 2WQZC 3R4UA 2WSVA 3B01A 3RS6A 3OJBA 4YFWA 3WZ1A 1JXNA 3M3QA 3L2YA 2LTNA 5DXDA 2EF6A 5H9RA 1FNYA 5HCBA 1HQLA 1N1VA 2R0HA 1S0GA 1W6NB 1G9BA 5E8AA 3INAA 1B09A 1LECA 1LESA 2R0FA 2WT2A 3IM0A 3POWA 4Q26A 2R1BA 1GANA 4JRAA 4Y1YA 1WBFA 3AYEA 4Y22A 3KQRA 1LCLA 1OFSA 1Z0HA 1GSLA 4BPZA 4ZKTB 4PBPA 1WUVA 2UWAA 2V5YA 1APNA 2D3RA 3M3OA 4YLZA 1MS4A 4YGCA 5JOYA 4PQ9A 3JUUA 2NMOA 2XG3A 1LOCA 1V6LA 1OKQA 2SBAA 4ASMB 5JOZA 1KQRA 1WW4A 2YMZA 5JOWA 3MW2A 1FATA 4FPHA 3ZYRA 1AX1A 2YV8A 4C1WA 3ZXFA 5CA6A 3WLUA 4RA0A 1FNZA 4Y1XA 3ZXJA 2W68A 4LBJA 4YM2A 2UWCA 1URXA 2P37A 4AVTA 3RRDA 1UMZA 1ENQA 1LJ7A 1LOFC 2JD4A 2GDFA 1LTEA 2JKBA 3OYWA 5T52A 3SH5A 3SLIA 1ONAA 3FUQA 4YZ3A 1QKQA 1VIWB 4KBBA 1CIWA 5KXEA 3HMYA 4XMIA 4YG3A 1WW6A 5BYNA 2WT1A 5T55A 5EXOA 1SLAA 2DWRA 2EAKA 4WVVA 1V6KA 2GNDA 1MS9A 1OQ1A 4YM0A 2A75A 1MACA 3AZVA 2YZ4A 1IS3A 1V00A 1GBGA 1YYNA 1Q56A 2A6ZA 1LGNA 1LOEA 1W6PA 3IPVB 1AXZA 3O0VA 4FQZA 5GZCA 4XJ9A 3PVEA 5EYXA 2A6XA 1LOFA 2ZHMA 4LBKA 1WCSA 4M3CE 5GLZA 3VUOA 1V6OA 1MS8A 3WHTA 4LBMA 1V6MA 2WNEA 3N3HA 4AGRA 3PVOA 2P34A 3W58A 1AXKA 4Y20A 2DU1A 3PMEA 1LHWA 4XJZA 3WG4A 5JLVA 3LCPA 2ZHKA 5JVVA 3I8TA 3MPPG 3DGTA 4XDQA 3OBTA 4XE9A 1FV3A 2SLIA 1QNWA 3ILRA 2BQPA 3VKFC 1ULDA 4H55A 3WDWA 1SCRA 3ZYPA 1UPSA 1DLLA 2DU0A 3IPVA 1UZYA 4RL7A 4GWNA 3V0AA 4P9WA 1UN1A 2PELA 2A6VA 3R05A 3FFZA 4BMEA 3BTAA 4XJ8A 1S0JA 5IK8A 2PHRA 3AP6A 1IS6A 5CAZA 3M3CA 1S0EA 4XOGA 1KITA 3WHUA 3IN9A 3TAYA 1DYPA 2NMNA 3FLTA 1CPMA 1W0OA 1WLCA 1H9PA 2CL2A 3AYCA 3RQ0A 3USUB 1JW6A 4I30A 3WCSA 1WW5A 3RMYA 3SH3A 1FYUA 4FPJA 4R9CA 3U4XA 4FPFA 4F83A 2ARXA 2JE9A 4FOYA 1DIWA 1ULCA 1S1AA 1FAYA 2ZAAA 2W39A 3D5OA 4NO4A 3WDTA 1W6MB 1CPNA 2CWMA 1CONA 3N7LA 1LHOA 4XBLA 1LU1A 1S0DA 1X50A 2D3SA 4XXPA 3ZSMA 3ATGA 1ENRA 2A3WA 2E51A 4Y22B 3AZWA 1CN1A 2CWSA 2GNBA 3AXDA 2NP0A 4XIOA 5SV8A 1Q8OA 3WDYA 2ZGKA 4XYXA 5DZGA 2DUPA 4GALA 1CVNA 2GMEA 2ZHLA 4K20A 4LBNA 5DZEA 3T1MA 4ITCA 2VU9A 4PCRA 1SLIA 1QDOA 2A6WA 2P2KA 2P3IA 3NWKA 4GA9A 1DQ4A 4Q27A 1VAVA 3ZSJA 3AZZA 3RSJA 1QU0A 5GLUA 3V64A 2E7TA 4FQ4A 2AR6A 1QOSA 1UZZA 5JOXA 3POYA 2EALA 1BYHA 1AX0A 1UL9A 2NZ9A 1G9CA 5GLWA 1QF3A 2AUYA 1H30A 3B69A 5JMCA 1GZWB 1Q8QA 5EYYA 2H0BA 3CNAA 1QOTA 3ILNA 3AJZA 1ULFA 1CR7A 1A78A 3HR9A 4YG0A 2E6VA 2GMMA 5CBLA 4GXLA 3ZSLA 3O5SA 4XXAA 3H0OA 1W6OB 4Q8LA 4YZ5A 4XJUA 1W6OA 4Y1VA 2W52A 2YY1A 5T5JA 3T2TA 2V73A 1R1ZA 4BOWA 1WLDA 3UJQA 1DQ2A 5LK5A 5GZFA 4Y24A 5DZFA 1KJLA 1V6NA 1MZ6A 1CESA 2A70A 5DUWA 1YRZA 2ZGUA 2UU8A 3KM5A 1GZCA 5IUQA 3VKOA 4ATFA 4BLJA 1W0PA 5FRAA 1CQ9A 3AP9A 1YIFA 2D6PA 3WG2A 1Q8SA 3C2UA 4HANA 1S0IA 1SLCA 2DUQA 5CB7A 3AYDA 1W6PB 3D6EA 3OY8A 1AF9A 4LBQB 5DUUA 5GM0A 2Q5TA 3MW3A 1MZ5A 4XMAA 1ULGA 2P3KA 3ZPYA 4TZDA 2ENRA 1C57A 3NV1A 3QCWA 4K1YA 2WSUA 2ZMNA 4XBQA 1G9FA 1LU2A 3T1LA 2GALA 3UL2A 2DTYA 3AP4A 5E88A 3PJQA 2ARBA 4Y26A 1LENA 1LHUA 1UX6A 4BM8A 2A6YA 4Q1RA 4W65A 2VW0A 1BQPA 2A7AA 1C4RA 4WZFA 1O4YA 1N3OA 4DRVA 1MS3A 5GLVA 3ZXEA 2OVUA 2D3PA 1SCSA 4FOVA 1N3QA 3FLPA 4FVVA 1ZM1A 5CNAA 3AX4A 4ISRA 1JHNA 1H9WA 1LOBA 2D6MA 2ZGNA 2JE7A 2R49A 4GKYA 4XZPA 1SBFA 1XQNA 3ZXKA 3N36A 2GNTA 5KXBA 5AVAA 5H9SA 4YFZA 4U2AA 4M00A 4YW3A 4AVSA 4YGBA 2D6NA 1UKGA 1Z78A 1DHKB 1W6QB 2WKKA 4FPKA 4Q1PA 5L73A 3NV4A 1GZ9A 5DUXA 1W6NA 4XJWA 2JJ6A 4LBLA 2NYYA 3V0BB 4AWDA 1N47A 2ZZJA 1IS5A 3N35A 1IOAA 2VXRA 4UW3A 5F5QA 2Z42A 2ZGTA 2ZMLA 1JOJA 4P9XA 2VW2A 3WDUA 3ZVXA 1AJOA 4SLIA 1VAMA 1AVBA 4XILA 2OUJA 3AYAA 4AGGA 2DVFA 1DYKA 1G86A 2ERFA 2ZGLA 1RITA 1DFQA 2DVDA 4FPCA 2ZACA 4FP3A 4YG6A 4DS0A 5IK5A 2C5DA 1UAIA 4YZ4A 3AZYA 4FOQA 3ZSKA 5GZGA 1SFYA 1WD4A 1W6MA 3N7JA 4FPYA 2A3XA 3VKLA 1VALA 1F5FA 3A4UA 3GALA 4TYSA 4AGVA 1FV2A 1IS4A 3BOPA 5IK7A 1O4ZA 3R4SA 2C9AA 3A0NA 2DTWA 1KDMA
chains in the Genus database with same CATH superfamily
1VBE2 5IVVA 2R6QA 3KWVA 4ZHNA 2YBKA 3BTXA 2XQXA 1IKPA 1QNYA 2YBSA 3ACIA 3KHCA 4PQQA 3NV2A 4URAA 5FYMA 2W3JA 1GP5A 5KXCA 3KB5A 4CYDA 4A44A 1RGSA 2FDJA 2GNMA 1VB2A 1DBNA 1PO23 4RSUA 4QB6A 4XTPA 2LROA 3POIA 1FXZA 2X09A 4Q0PA 1NAEA 3VZMA 3KQ4B 5FYIA 2J1SA 3VDDB 2R1DA 3WEZA 2JDZA 5BNQA 2D97A 2EXJA 2W1SA 2VQ0A 5F9TA 1CWPA 4S2GA 2WIIB 5T5LA 2XONA 3DF0A 1X33A 2XBO1 2BEOA 2X10A 3ASIA 3OUIA 4YGEA 4CUAA 3BALA 1AR91 1OA3A 2VNVA 1NXD1 2ORZA 4IE5A 2CTVA 4YGDA 1NA1A 2JDHA 2QQVA 2YDEA 4M0HA 4UFKA 2G9FA 4XQWA 3MW4A 4R9DA 2GP5A 3AFKA 3RG0A 3MDPA 1LAJA 4CEWB 1GFF2 1LOGA 3X29B 1KXGA 4RHV1 4OCTA 2WYFA 2PXJA 2XWBB 4BQ1A 1J3RA 1IGOA 1RUH1 3GBWA 2QQMA 5DAPA 3E5QA 5JSRA 5FZ1A 2E7AA 2VH9A 3KVAA 2WT0A 1WMXA 5FZHA 2RM21 5HCFA 1QHDA 3DECA 1GWLA 1OMIA 1SBEA 4JAAA 4YM1A 1S2KA 1TQ5A 5FFOC 2JE8A 4FP2A 3A21A 1CAVB 3OGRA 1S0FA 4AYUA 1SFNA 1UO9A 2X29A 1W2AX 1X9PA 4HL0A 5LA2A 5FXXA 3J8F1 1MQTB 1BVVA 1RUD1 1EPWA 2RS51 2YXSA 5CKMA 1WCKA 4B29A 5JCTA 1HQWA 1PVXA 2TUNA 4OFGA 1F8VA 2VULA 1F5JA 4LO8A 2VTFA 2WZEA 4XDOA 1JN2P 4N53A 1ZZ9A 1LGCA 1LODA 1Y7BA 3KF5A 3T0AA 3UGFA 4YW5A 1WBLA 4ZONA 3I2OA 3VD7A 2LUWA 1WLWA 5BNPB 4QPWA 4BQ3A 5J7MA 2VC9A 3WQ1A 4AVVA 3VBHA 4HETA 4GJYA 4PF5A 4YSFA 5FKCA 4G4FA 2BNNA 2DCKA 4QKDA 3W5NA 3GHMA 5GLTA 3NKTA 3BIEA 4CXWA 5JR2A 3FBYA 4KG8A 2EXKA 4RR3B 2Q8DA 5JZGB 2XJRA 1ZZ8A 3A7QA 2HLEA 4M01A 1W39A 4DRRA 5IWFA 1CZSA 2JG9B 2ADEA 4K6BA 4XFIA 5IK4A 1NCQB 2Q1ZB 4IV1A 4WM7B 4CUGA 4JGZB 1N1YA 4MGYE 2W1QA 4Z92B 2JD9A 1QGLA 1M06G 2CNAA 2HWB1 4C0BA 4IL7A 2RM22 4J25A 1S55A 2PHFA 1N1TA 1UU4A 1OI6A 5EWSA 1JYVA 1Q8PA 1HJFA 3POSA 4LUMA 4IE6A 1G9BA 3H8UA 3RZLA 1ZX5A 2WR9A 3AMMA 2VMEA 1OF4A 2C6SA 4R8HA 4RQPA 5FK7A 2HWB3 3HBZA 3PJYA 3WQ0A 4DUVA 2OQ6A 5J36A 4FPGA 5F3GA 2VXJA 2FCVA 3VHRA 4EJRA 1R093 2JWPA 2WZR3 4P9LA 5DAVA 2E32A 5FZAA 3ZLIA 5KHJA 4TTGA 2GC0A 3VBHB 2W47A 4LKDA 3NNGA 4B1LA 4Z8BA 3IAPA 1BKZA 2YGMA 4URTA 1OXCA 5BY5A 1E5IA 4LBQA 5FR3A 3JU9A 1KD7A 4IGPA 4M0NA 1MEC3 2UURA 3NL1A 3O1MA 3EQEA 1L3JA 2DVGA 1L7QA 1WKYA 5LBBA 3PU3A 4A7KA 5FPXA 5HCAA 1MS5A 1K42A 4MZUA 5FZKA 1H1IA 4LORA 4W50A 3WG1A 4OHZA 3WCRA 4HOOA 4Y1UA 4F7ZA 1VBA3 3LZZA 3HQRA 2EXHA 3PVNA 5I0UA 4KNCA 3B00A 2CDOA 3CJXA 2RS53 3ZN5A 2A3YA 1PHMA 2IXLA 5FMDA 3DYMA 5FP7A 3T2PA 1HKDA 2H0VA 4IV3B 2QNKA 1PZ7A 4BQXA 3HN3A 3HN1A 1KJRA 2V4VA 2F17A 4JGZC 4N9HA 4ZPIA 4G3YC 1I3HA 4WM8C 5E89A 5FZ4A 4P9YA 4QQLA 1RVF2 4WVWA 1G7YA 1VB4A 1NLQA 4OZXA 1MVEA 1RTVA 4R9AA 1BCXA 3ILFA 2VZVA 2HH9A 4S2DA 3DYPA 1RUH3 1O59A 3R4UA 4AFDA 2WSVA 5A7NA 5FYHA 5LWBA 3OJBA 4GH4B 1RXFA 4NRMA 5DXDA 1UOFA 1ZRIA 5FZ3A 4ZU7A 1NCRC 3ETPA 3H3ZA 4V1PA 2WS93 4BQ5A 4XUNA 3O1OA 4FTBA 1Z7S3 3PHMA 1S0GA 1C5HA 1W6NB 1IG0A 5E8AA 3NW4A 3INAA 1B09A 1J83A 1UIJA 1LESA 2R0FA 4HK9A 4IUGA 4Q26A 5JSOA 5FY9A 1U5XA 2VZSA 2WA4A 1QQP1 3ITQA 2MEV1 1WBFA 4PDWC 4ARYA 4CCKA 4ES8A 1PO21 4CDWB 3E6CC 4XAEA 1OFSA 4BPZA 3I7DA 4IE7A 4OLLA 2UWAA 3ZYBA 5F5AA 1Z7S1 3DPRB 3OG2A 4HKLA 4NHLA 4BK4A 2J7MA 3JUUA 1GOGA 3DEMA 1AR73 4ASMB 1KQRA 3VBRB 5F39A 4FPHA 2YV8A 3WW4A 1YQ2A 5F37A 3H50A 4GQ7A 3PUIA 2YG0A 4Y1XA 3ZXJA 3KT7A 3BCWA 5TSWA 4GMP1 4AVTA 1W8WA 2ORXA 3RRDA 2RR13 1ENQA 3GBGA 2JD4A 3FE5A 1OC1A 5L9VA 4AVCA 5J98B 5LK7B 5JZGA 4XUPA 4COZA 1MPXA 1QJU1 4BQYA 3S57A 1QJFA 1B35C 3PL0A 1O4TA 4DUXA 1WW6A 1YQ6A 2WT1A 2DWRA 5DPNA 5FMBA 3DYOA 4WVVA 1V6KA 2GNDA 2JDKA 1MS9A 2Q8EA 4Q4Y1 4KQ7A 3AZVA 1S2EA 1W04A 3QH7A 3O0VA 1LOEA 1W6PA 4LKFA 3VBFA 4B4QA 5GZCA 1UU6A 5AFEA 4PLNA 4HBNA 4A41A 1FPN1 1TMF1 2RDQA 4LBMA 2JDMA 2WNEA 2QQIA 2VPVA 4HVRA 4JDOA 3VHOA 4AEDC 3AM2A 2P1BA 3VBSA 5JIAA 5F3CA 2E63A 4B1MA 1ZBE1 5J1XA 3PMEA 4FCAA 4XJZA 2RMU3 1FOD2 1O6UA 3SCFA 1C28A 2B45X 2P6CA 5JVVA 5C8CA 3HQXA 3I8TA 2WS92 4XDQA 5FZOB 2VOKA 2PAMA 4H55A 4CEYC 3ZYPA 3UETA 1SPPB 1UPSA 2DU0A 3IPVA 1UZYA 1YJLA 4GWNA 4RL7A 4DXZA 4DXSA 2BRTA 3BU7A 1UN1A 3MLKA 5FBJA 2A6VA 3R05A 4BMEA 2Z4FA 3BTAA 4N7UA 4YVSC 1R091 2WZR1 4BK5A 5JXGA 3C7EA 5L36A 5IK8A 4L0PA 2PHRA 4NIIA 1PGW2 2G19A 4BQWA 2DFBA 1IS6A 5A32A 1XNTA 5CAZA 1JYWA 2ZX1A 3ACHA 2YHJA 1K5MC 1JU3A 2QJVA 4QKFA 2CHHA 4CU9A 2FQPA 1XSRA 1X8MA 3PTRB 4XF3A 2CL2A 1J3PA 4OUMA 1UX7A 4LLFA 3RQ0A 5CKNA 3WCSA 4AOCA 1WW5A 3WW3A 4J6GA 1DYOA 1GNYA 5FZCA 3VDDA 5A1AA 1W05A 4F83A 3AVRA 4CDXA 3HBKA 4NRQA 3LQCA 3VZJA 4MUVA 2PLV1 1HXS1 3O1RA 2R073 5AVPA 1S1AA 4NO4A 1Y9QA 1ULOA 3QH6A 1OUXA 1K5MA 1SEFA 1ZRRA 1LU1A 1CGPA 4CCDA 2D3SA 2VMGA 3OF1A 4QDSA 3KV5A 1ASJ1 4XXPA 2YGLA 2QQOA 4Y22B 3ZSMA 1CN1A 2CWSA 2Y6LA 4CEWC 2VTXA 2NP0A 5BPXA 1ZBE2 3NRUA 4ET7A 1EUUA 3RZJA 2JG9A 1RUJ3 2WUHA 2ZGKA 1MEC2 4XYXA 1W3XA 1H8TB 3MF9A 4RQPC 2XLFA 2R063 3HNMA 2ZXQA 1H0BA 3I3MA 4HG6B 3FHAA 3KMHA 1XU1A 1QDOA 3OGVA 4GA9A 2V4AA 4CCMA 1DQ4A 1HX6A 2KD7A 3AZZA 1C8NA 1K5JA 4Z2AA 1AYN2 3T0BA 1O3SA 5D8AB 2J1VA 1RUD3 2WINB 1PGW1 4QM9A 2ZEYA 1F35A 1VBC3 4XCAA 3W5MA 1QOSA 2JG9C 3G7DA 2OPKA 2HWE2 4KGQA 3ZDVA 3POYA 4UFJA 2VMIA 3FFQA 4CDUA 1RUE1 1PGL2 4RS5C 5KC5A 5GLWA 2DBNA 4D3WA 1Q8QA 1W90A 3NJXA 4DZGA 3MUY1 5DAXA 1HV1A 1FMD2 1ULFA 2XJQA 2JIGA 3HR9A 4BDVB 3ZXAC 5C4WA 3ZSEA 4IEVA 4RHV3 1W6OB 2BGPA 4Q8LA 3U07A 3ZIXA 4CU8A 3E97A 3WY6A 1W6OA 3I3DA 3HJRA 3PUAA 4W4ZA 4BOWA 4L2NA 5A33B 5GZFA 3DN7A 3Q8EA 1KJLA 5CA6A 5DUWA 1YRZA 3KM5A 2UU8A 2TNFA 4WM7A 4BLJA 1RUNA 1OOPA 3IBMA 5C9AB 1YIFA 4LE4A 4HANA 1NG0A 4QXCA 1I9RA 2XBO2 2C24A 3AYDA 2JDUA 3OY8A 4Q29A 1T6GC 3VBUA 5C3SA 2Q5TA 1O3RA 1JMUB 1MZ5A 3QACA 2P3KA 2HWF1 3ME2A 4Y33A 4TZDA 2C4XA 4I02A 2GALA 2RG4A 4JKKA 2JXAA 3OB8A 4NHYA 3PJQA 4DB5A 5DDJ2 1XXNA 5DQ0A 4BCUA 1I5ZA 2VW0A 1R083 1BQPA 2A7AA 5A1FA 1U5IA 5ACA2 5I91A 1RUE2 4PJYA 3RZGA 1O4YA 3HT2A 2DFCA 4AI8A 4AL9A 5I8YA 1UYPA 4W6YA 2D3PA 2P3YA 4FOVA 2IXJA 1SMVA 1JHNA 3D0JA 2ZGNA 2D6MA 1TVGA 1RJ8A 2R49A 1Y43B 3J7LA 3NMBA 3NVCA 4D94A 2LS6A 4JGYB 3NSTA 4RS5B 5AVAA 1W0NA 4YFZA 4LE3A 4U2AA 4M00A 4KG0A 1YWKA 2WKKA 1DHKB 4FPKA 5FYUA 4UAPA 3CU7A 5DUXA 4AEJA 5M0TA 1W6NA 4XJWA 4QX5A 5EIYB 5SV5A 1W99A 1PX3A 1WMFA 4EN7B 2PFWA 3N35A 1W9SA 5FZ9A 5F5QA 1JOJA 2BNOA 5FOBB 2IWGB 4IEPA 4WVZA 4RR3C 4GH4A 3H3LA 4LOTA 2PN5A 3D0SA 5D21A 3U0ZA 1K45A 4XC9A 4XILA 3AYAA 1UYXA 1VP6A 1JS9A 2ERFA 1O5UA 4IXLA 2DVDA 5JR7B 4SBVA 4B4PA 2C5DA 4RFRB 3AZYA 4FOQA 4FPYA 2QFEA 1W6MA 5CFCC 4CDWC 1NX9A 2A3XA 5IFTA 3S5AA 3LDBA 3LEGA 4YYOA 3A4UA 1RUC1 2Y8KA 5FYVA 4LPLA 1DGRN 4RD7A 3A0NA 3O1PA 3ZMOA 4DXTA 2B7YA 3KGLA 3PTYA 4HZFA 4QQPA 4QX3A 2QDRA 4IV1C 3WW1A 3QLQA 4IV1B 1M4WA 3OBRA 4LUKA 2Q0AA 3K48A 4QXKA 3RYPA 3TN91 4HONA 4B7KA 5FREA 2VUAA 4DQAA 2WNVC 4ISQA 4Y3OA 1E5RA 1N1SA 4LKEA 1VBE1 3OUHA 5EV7A 3O0XA 4P14A 3SH4A 1WW7A 3J9SA 3I2KA 3N9OA 4B3NA 2ZX2A 1PIV2 4GB31 4DUWA 4HSJA 1LB2A 1LOAA 2P6HA 4NIDA 5GZEA 1DQ0A 1GR3A 1NOVA 2DV9A 2VNOA 2VCBA 2RHPA 2YC0A 5F8PA 5KBFA 2NN8A 2Z79A 4FPOB 5FLHA 1EAH3 5I0SA 3VDCA 2F4LA 2ET1A 2A71A 2ZEWA 4QGMA 5AC91 2J1EA 2CSGA 5EQUA 1CAUA 2JENA 4XEZA 5FPAA 2HWC2 1XC6A 3VBRC 4DOUA 4HXCA 2QQNA 4XFCA 2PYTA 4JTNA 4GKXA 5FY5A 4YZ1A 1CX4A 5C4WB 2VG9A 1GUIA 2W94A 1ASJ3 3VD3A 1ZZ7A 5T5PA 3K77A 3ZM8A 3I4IA 4K1ZA 4D7TA 3AZXA 2RS11 4UW4A 5IFPA 1VRH2 2ZGQA 2ZKLA 5A3WA 1W6QA 3NAPB 4CE8A 2C1FA 4INDA 4YVWA 2BP6A 1RUC2 4DO0A 2B4KA 1ZA4A 1XU2A 2Y6HA 2G4IA 2OW4A 3A0KA 4XFBA 4AR2A 2QVSB 5FWJA 4GZ9A 5FZMA 4A6OA 1QDCA 3K3NA 4LHLA 4UW6A 3KT4A 1WCDJ 2MNGA 2AREA 3CLPA 1TME3 2W1UA 3AL5A 4Q2FA 4QQHA 4Q4W1 2MPFA 4CPBD 4FPEA 1DGWA 4AQTA 2QBXA 1DGWX 3TN92 5L7OC 3B93A 5FZDA 1CZVA 2RS33 3UKNA 3MZHA 2VNRA 2XJSA 2E9QA 1GQGA 3PLQA 2ZAHA 2WC2A 4X8PA 5GZDA 4YVWC 4BIOA 3AP5A 4KH9A 3RYRA 1YFYA 1YQ5A 2R061 1HRI1 1Y9GA 3D4KA 4LBOA 1NLSA 2YPDA 4MGTA 4XHXA 4MHUA 2W91A 1PZ9A 1JZ5A 5A7WB 3TEYA 4K7JA 4IDZA 2D6LX 1TZOA 2ZX4A 1SLBA 3JB8A 3POEA 1JZ2A 5A3PA 3MIHA 3OEAA 1NY71 1TE1B 2PAKA 5AC92 2EXIA 4E2SA 2PHXA 3BIWE 2ZGSA 4NJ4A 1D4M2 2WA3A 3GJAA 3OEBA 3TYJA 2JDNA 5FZ7A 1LEMA 1QY4A 2JICA 3MV01 1LEDA 2VZUA 4FOWA 2KM2A 4CCEA 3WVJA 3BOWA 3UKVA 4FSJA 3M7AA 1GNZA 1VRH1 4OMCA 2BW8A 3C8XA 3U11A 3WNXA 3H1WA 3MLJA 3O0WA 1OD3A 2R16A 2VAUA 3GZUC 5C4WC 4YARA 5ABJA 1ZRCA 3QBQA 4O65A 2X8KA 4PI0A 4CCLA 2R32A 4IEXA 3T2QA 4ATEA 1JUHA 3S7EA 2HWD2 2YC2A 1QWRA 4EZ4A 2WYSA 5JUVA 2R041 4AHWA 3USSA 4EN6B 4ZZ8A 4WV8A 3VZKA 3NNFA 5F32A 5BNNC 4YW7A 1OURA 2DYCA 4IGOA 2ZKNA 4NROA 5IT6A 3WG3A 1JTZX 2HYKA 3JZVA 5F5CA 1C8M3 2RVAA 4K9SA 4DY5A 4TN7A 2PHWA 4PF1A 3VKNA 2D44A 2VZTA 2XMLA 3M2MA 1ZZCA 5FY1A 1WD3A 2R062 3C7FA 1YLLA 3SISA 3ZFEA 4HVOA 4YM3A 4XCBA 2BWAA 2Q30A 1J58A 2RMU1 3POFA 4JGYC 3M8LA 3FLRA 3U10A 2D6KA 5CKQA 3LGRA 4CTEA 4YVSA 3CDZB 2JDAA 5BNNA 1W9FA 2HEWF 1Q8VA 2IXKA 2VCAA 3NV3A 4BMBA 1D4M1 3O12A 1AR83 2VBDA 1RIRA 3UJOA 3OOXA 1GYKA 1E5SA 3UT0A 3IDAA 1ND3A 4DFSA 1YXWA 4P9GA 4WVMA 2MEV3 3SITA 3WV6A 4MYEA 2DVBA 2ZHNA 4XHBA 1W2UA 3VBFB 4JGYA 2VBPA 3OYWB 3RNSA 1W03A 2I2SA 4BISA 2BFUS 4CDQC 1LHVA 3FN9A 3TOJA 2JIJA 1MVQA 5DG1A 4XDPA 2WS91 5C5UA 1XYOA 3GHNA 3E5UA 2HKXA 2VY0A 2DCZA 5FV3A 5IVJA 2OA2A 4W8JA 4W6WA 2FZ1A 4N43B 2P4EA 5IAVA 3LPGA 3PU8A 1X36A 3RJ2X 4Y4RA 4GMP3 4CEYA 4H3WA 3ABZA 3H9AA 2XJVA 2JDYA 3CJIC 4C90A 3O14A 4QKBA 3AKQA 3CJIB 1XOYA 1JXNA 3M3QA 4GH4C 2LTNA 1KS5A 1RVF1 1FNYA 2AACA 2EF6A 3ACFA 4Q4V3 1N1VA 3LEMA 4I0AA 4FFIA 4IEYA 4AI2A 4P5YA 4K8RB 3VL9A 4COUA 3H8RA 2JG8B 2B5HA 1AR61 2PAEA 1QJEA 2ATFA 4ZZ5A 2FCTA 1UXXX 2XR4A 3RDIA 4JRAA 1QQP3 4QGNA 4Y22A 1BBT2 4DEQA 3SXWA 2QQJA 4TSVA 4MGQA 2V5YA 2VUCA 3M3OA 2D3RA 2HJIA 4OHVA 4YLZA 2XLGA 2JX9A 1YUDA 2VVFA 3SEPA 4YGCA 4IV3A 5FTTC 1C3HA 1KFXL 1LOCA 4IESA 5FMOL 1RC6A 1PO22 4AFCA 1UNBA 2LRPA 3BI3A 5A3OA 4MX3A 4RA0A 1FNZA 1CAVA 1OLME 5K9YA 4LBJA 5LBFA 1MEC1 2D5FA 2P37A 1BMV1 2XL7A 2JKBA 1LJ7A 2XKOA 1HRV1 2GDFA 1LTEA 3I2DA 3OYWA 5T52A 3KV4A 2GSYA 1F4HA 3FUQA 5F3EA 4YZ3A 5A33A 4E8DA 1EAH1 4KBBA 4D6SA 4IV3C 2RR12 5A32B 3HMYA 5D1IA 5BYNA 3THDA 2VZQA 4N8MA 1OQ1A 3I54A 3RZMA 3MIEA 5KR7A 1MACA 2YZ4A 1V00A 4RGAA 3Q8AA 2A6ZA 2XVGA 1LGNA 3MI8A 4R52A 1AXZA 2Y6GA 4FQZA 3BGAA 5EZWA 1KGYA 1UYYA 1WCSA 3MF6A 1EV11 3VUOA 1V6OA 1MS8A 3TN93 5FWEA 1RUOA 1VRH3 4GWJA 2V72A 2OKXA 2P34A 2RJKA 3NQHA 2YBPA 3D8CA 3SQOA 1OLRA 3O1SA 2CGPA 3M4FA 2FBEA 4QX7A 4CA9A 2B46X 2DU1A 1LHWA 1XBFA 5FK8A 2GH2A 5CFDA 1HQNA 4AHYA 5FAXA 1ULDA 4CU6A 3WDWA 4B4RA 1Q5OA 2GC2A 3WR0A 1DLLA 1F4AA 3ON7A 5FLIA 4S2HA 3T09A 1PGSA 1PO11 2PELA 3VHPA 4CDXB 3KCYA 4OHYA 4V2WA 3ZFFA 4OYUA 4LIUA 4AW7A 3AP6A 5JSPA 1RHI3 1MZEA 2IUWA 1JOPA 3IN9A 4QB1A 5FZFA 5J37A 3GZTB 1DYPA 5A7QA 1CPMA 1W0OA 1DF0A 2RS31 3AYCA 4D7SA 1EUTA 3NNJA 2ZZQA 3VBUC 1IQDC 3R0RA 5CFDB 3IMMA 3O1VA 3H1MA 1OFNA 3RMYA 2YC4A 3J8F3 4QPIC 3U4XA 2WWUA 1I5PA 3P3PA 3OD0A 3Q8FA 5FYSA 1JI6A 3S5QA 4N53B 2FMYA 2ETEA 5A6YA 5IVCA 1G6NA 1SZBA 1SHWB 1XYPA 3TNQA 4FOYA 3ZFGB 1DDLA 1IQAA 3THCA 4XFHA 4FXGB 4EYUA 2OYZA 5LA9A 1O3TA 5FPLA 3SCGA 1ZZ6A 1CONA 2OIIA 3N7LA 4XF1A 4AQ2A 1LHOA 3EYPA 1H1MA 1WWYA 1US2A 2RS13 1WCUA 1X50A 2FDHA 3ATGA 1ENRA 2A3WA 2D98A 3HD8B 3AZWA 2ZTNA 3IB3A 4OVEA 1R081 3AXDA 4CDWA 4DNYA 5FPUA 2PLV2 5SV8A 1Q8OA 3CIHA 3V56A 3K75B 3I2GA 4CP1A 3R6SA 2DUPA 1RUF2 3KHBA 1XE8A 1CVNA 3LDRA 4LBNA 3BVCA 1UMIA 4QT6A 3T1MA 5BNOB 3O1TA 3JBG2 1WLTA 2EICA 2KXLA 4HKWA 4LO5B 5L9RA 2A6WA 4G9SB 4LEJA 2WAAA 4Q27A 1V70A 1VAVA 1KFUL 3ZSJA 2WNVA 3I2HA 4Z07A 5LRRA 3RSJA 5A6XA 3F2ZA 4XQ4A 2EIEA 2Z5WA 1F15A 3VBFC 1IPJA 1JYNA 3VD4A 4N9IA 5GLUA 3V64A 4S2FA 4AFMA 3C3VA 4GD4A 4E2GA 1YEWA 1EPZA 4RR3A 1JU4A 4LHKA 2D93A 4JZRA 1AX0A 4QX2A 2VR4A 1G9CA 4I3PA 2QZ3A 2AUYA 2BYVE 4LNVA 2BVBA 3B69A 3VZOA 1REDA 1F2NA 3ES4A 4NPLA 5EYYA 3P1IA 1D7PM 2RM23 1OLMA 3C7OA 3OGJA 4WZCA 5CFCA 1CR7A 1BK0A 2E6VA 1UZ0A 5J96B 1PGL1 5HV4A 2GZWA 3ZSLA 4MADA 3HIFA 3H0OA 3FWEA 4XFFA 4Y1VA 2YY1A 1CAWA 4AEKA 1AYN3 4DIQA 1PVC2 1W8FA 2QKDA 4TLFA 3T2TA 1R1ZA 1REFA 1RUE3 1WLDA 3NJVA 3UJQA 1AR93 1DQ2A 1R082 4Y24A 5DZFA 4IERA 1V6NA 1CESA 4JVAA 5IUQA 5HPOA 1GZCA 1UPIA 3EBRA 1UW8A 1GWMA 1PIV1 3AP9A 4OHXA 2W5FA 4QPYA 4CXXA 1I6XA 4KU8A 1S0IA 1FI2A 3P3NA 1AF9A 4LBQB 3WNLA 1VR3A 3SKJE 4KL1A 2WWSA 1RHI1 1UY3A 2VMDA 4K1YA 2RDNA 3NV1A 3QCWA 1AL23 2JB4A 3I3BA 3UL2A 5BNPC 4NRPA 5FIXA 2QE3A 3AP4A 5E88A 2W1WA 2BUKA 4BXFA 2ARBA 4RFT0 2Q1FA 4DMIA 3W20A 3RZHA 1GP4A 1LHUA 1OUSA 1ACCA 1OT5A 1UX6A 2A6YA 1QXRA 1YNAA 2D5HA 2IFWA 2ZX3A 3NAPC 4I3GA 4Q1RA 4W65A 4OZOA 4EN9B 2PQSA 2HWF2 4KI5M 4WZFA 3IWZA 4UFIA 4RN5A 1MS3A 2IXHA 3WW2A 4FVVA 1TNFA 1N3QA 5EJZB 1SFPA 4FTSA 1H9WA 3LE0A 1O5LA 4GKYA 2R071 3TB0A 1H6YA 1QJX2 1SBFA 1REEA 5FPZA 3ZXKA 2GNTA 3JB4C 3UGGA 1DU3D 4M4PA 4AXOA 5KXBA 4FFHA 4Y5TA 3ZIWA 4LT5A 2YFUA 3I2IA 2IVJA 4A45A 4Q4W2 4YVWB 1H2KA 1GZ9A 4OHWA 4GIQA 4E4DX 2VZOA 4FAGA 2HWF3 1EV13 2JJ6A 2IFRA 2VZRA 2NYYA 4LBLA 4CXYA 4JDMA 2NLRA 4C91A 3ZFFB 4Q4V2 1IS5A 4Z2WA 4D8MA 5L7OA 4J1WA 2ZGTA 2ZMLA 4LULA 5JXJA 1IZ3A 1W2TA 1GQPA 1HRI2 1GQHA 4JHTA 3HWJA 2B9VA 4SLIA 1VAMA 2OXBA 2V09A 3GF6A 1OH3A 1AYM3 2O1QA 1ZBA2 2OUJA 3H7YA 1H1AA 3WNOA 1A34A 1PO13 3EMRA 4COVA 1DFQA 2JDPA 2VL4A 4YG6A 5C9AC 3HPNA 4LO7A 5IATA 5CU1A 3J7HA 1HRV3 1SFYA 3K4AA 1J59A 1AL22 5JI9A 4TYSA 2ET7A 2R7EB 1O7FA 4Z1VA 1ZBE3 5HV0A 1NXMA 1AX2A 5ERLA 2WBKA 2WO7A 4O9EA 5ANQA 5FXZA 4L11A 1MR5A 5LY1A 4RQPB 2WNUB 3T4HB 3K51A 4YNIA 1LR5A 1CAUB 2VCMA 4RHV2 1O91A 4UW5A 1ZZBA 1YIPA 2ZABA 1COV3 1FX5A 3NJZA 1OOPB 1XB9A 3K2OA 3ES1A 4NR1A 5C9AA 4DEVA 1OOPC 2WJSA 1W2NA 1JOBA 1DZRA 4PIZA 4BQ4A 5CFDC 3FUOA 1YFXA 4LXLA 4P02B 2HEVF 4M3CB 1U12A 3WXPA 4Q4Y3 2HWD1 2FDGA 1Q3EA 1YCIA 4EZHA 4L99A 3WF2A 4Y5SA 2L9LA 1ENSA 1NCQC 1OVSA 3CZJA 1NQDA 2VM9A 2WZ8A 2CV6A 4KWUA 1G8WA 4Q4V1 1UKRA 3UK9A 4LBQD 1OKOA 4D69A 3WINE 3T4VA 3GCWA 4GB32 3CHXA 3VN4A 3MGUA 1J3QA 5FZLA 4A3XA 2UWBA 4HT1T 2G1MA 4N7IA 1V6JA 3M70A 3FJSA 1ZBA1 4M3CA 3VKMA 4QX1A 2VMHA 4X6RB 4L8QA 3ZFEC 3ENRA 4UFLA 3BODA 2W95A 2ZA9A 4LMFA 4PHZA 5LB6A 3ZYHA 2BWCA 2B39A 2ZMKA 5DG2A 3V0AB 1NCQA 4QPIA 1GNHA 2Q1MA 1DG6A 1H2NA 1O3QA 3CL1A 3BTZA 4ZXKA 2GN3A 3B7MA 3Q8BA 5FPVA 4AEDA 5C7GA 3HVDA 4XACA 1NA1C 2WQ4A 2YB7A 2YROA 2JB8A 3IMNA 3EO6A 1NA1B 1SACA 5F6KA 3VBHC 4Y20B 4Z82A 5C6CA 5FUNA 3LSEA 4LHSA 2VNGA 2RS12 2E53A 1PX4A 2WZPP 3N9LA 5G05L 3CO2A 1DZQA 1WA6X 1W9WA 4PDWB 3N4MA 4YW2A 4OI2A 5FZ6A 4AFBA 5A3LA 2C0ZA 1PMJX 4JCKA 4XIKA 1RUH2 2BERA 1G9DA 1A6CA 5DUVA 3FC0A 3AXEA 2BZDA 3KGZA 3VBOA 4FAHA 1RUI2 1S4CA 1VBD3 4YW6A 4D6QA 3WUDA 5FO9B 4QU2A 3LFMA 3WNPA 5FP3A 5B2GB 1K5MB 1XNDA 3LPFA 3KT1A 5DAQA 3OTFA 4IEZA 5LASA 3W21A 3WX5A 2J1RA 5C70A 1GKBA 2QQPA 1S0BA 5FPBA 4AVAA 4BLIA 3AJYA 5FZBA 3U1XA 4AF9A 2LALA 1BEV1 2GC1A 2QUOA 1RL3A 1GLHA 2ES3A 2VE1A 2ZGMA 3ZR6A 4XJAA 4MXWA 3RJRA 3SHRA 3FHIB 3AKPA 3POBA 4Y1ZA 3LKJA 5FJKA 2BJSA 4AAXA 4WVMB 3VDDC 4DY3A 1ULPA 2QTWB 4N53C 5C3QA 4IEQA 1PK6B 3ZFGC 5LZ6A 3ACLA 3VBOC 4E4HA 1ALYA 1QJZA 1X7NA 1TEIA 2JECA 2TBVA 5A7SA 3MBWA 5H9QA 3MIFA 2A5ZA 2WQ8A 2CY6A 3N7KA 4M3CF 2XPJA 5FYCA 4HFSA 1WGPA 2WN3A 2W0XA 3LAGA 5K0UB 4EN8B 2BOIA 2LW8A 1OH4A 2EA7A 3LOBA 1GZTA 1QEXA 2H6CA 1BZWA 1NT0A 5GJ6A 1HW5A 3USUA 5IVFA 3RGBA 3LEIA 3VD9A 1RXGA 4NHXA 2PQQA 2WABA 2ZBJA 3NO8A 3PUSA 5FO7B 3HAGA 1J1TA 3NNLA 2DUOA 1W9TA 4XFAA 3KV9A 4QQ2A 5I8SA 3UGHA 3ZYIB 3OPZA 4CP2A 5F7UA 2BGCA 2IC1A 3WDXA 3E5XA 5FJHA 2BTVC 2RE9A 3WD5A 1QJU3 2I07B 3H3UA 1LULA 2Y0IA 4X6QB 3WUCA 4FBFA 5JIUA 3N9QA 2VUDA 2HWB2 3UKTA 1EAH2 1C8M1 2YYOA 5CFCB 4QX0A 3J4UH 2QQKA 2RR11 4AHZA 1AXYA 1LHNA 1IKQA 4CP0A 5ABJB 2R042 3HOBA 3I59A 3Q9OA 3PUHA 2ILMA 3DKWA 2XXZA 2D43A 2XLAA 2GMPA 4NWWA 1JYXA 5LEJA 1VLNA 1BEV2 4YRDA 1VBD1 3I3QA 3VV1A 3JCIA 4XBNA 4LO4B 1AR71 1AZDA 5EFUA 4TWTA 4MXVA 1OA4A 1YQCA 2DCJA 2NPIA 4PIYA 2ZEZA 4WBBA 3V0BA 4HPKB 1W2OA 4DPNA 4HPKA 2YU1A 4QU1A 3H42B 2DDUA 2FHRA 5LBEA 4MVTA 5FY8A 4JRLA 1UXZA 2B8MA 4QDQA 4ZU4A 3SNMA 5JMCA 3ZN6B 1QMJA 3OPWA 4EWAA 4L9BA 4H7LA 2AH2A 2NQYA 1U5YA 4MSVA 1QJY2 3AFGA 4I0WB 4LR4A 4UT5A 2ZGOA 4IEOA 3WOGA 1PM7A 4A6SA 5ANNA 5LY2A 2NM1A 1ND2B 2R30A 2XB6C 3VLBB 5KXDA 2Y33A 4XZUG 5DABA 4N43A 1QQP2 2WDBA 3ECQA 4UOJA 2J42A 5JPMB 5K0UC 3UESA 2I74A 1GV9A 1XPWA 2EIDA 3WDVA 1V6IA 2DURA 3B9CA 1AYM2 1EY2A 3T08A 1JHJA 1Z7S2 4XURA 4CP9B 3HEIA 3B01A 4HKOA 5FOJB 3RS6A 4BWOA 5A3MA 1V9U2 1BBT3 4HMZA 3L2YA 5ISLA 4XFGA 5H9RA 5HCBA 1HQLA 5BNOA 3HQUA 1VMFA 3PURA 5HBAA 1DGRA 2K9ZA 4AQ6A 5B4NA 4EQVA 5C8WA 1OA2A 4AG4A 4UBHA 4QD2A 1H4GA 3IM0A 4JX0A 3POWA 3K4DA 5K0UA 5HXMA 2JG8C 1ST8A 1GP6A 3KF3A 2HWD3 1PM4A 2R1BA 3PIJA 1TME1 2Y0OA 2BVVA 4I0BA 4JDNA 1RB8G 1OQEA 3AYEA 3LOIA 5BXXA 3AMQA 1Z0HA 5ABJC 1GSLA 3GZAA 3WF4A 3WNMA 4CCJA 1W8TA 5CISA 3O1UA 2Y34A 5A6QA 3ZYFA 4FXKB 5D2AA 3J26N 1YFWA 3LF7A 5JOYA 5A7OA 4AQSA 1SG3A 2XG3A 3DKQA 1V6LA 4IW3A 1OKQA 4Q4Y2 2EIBA 1P8JA 4CUBA 5BV6A 1H8TC 1WW4A 3VHNA 4COYA 5JOZA 2JEMA 1FATA 3MW2A 4K3UA 3ZYRA 1AX1A 4C1WA 4OI0A 1JYTA 4CCCA 2DCTA 3WLUA 1ODMA 3KD4A 4XVHA 4YM2A 1URXA 4HLTA 1UMZA 2PHLA 4CU7A 3SLIA 5I0DA 3SEEA 1XNKA 5AC93 1ONAA 2WRAA 1QKQA 3L2HA 4AI3A 1VIWB 2V5DA 4Q5OA 4CDQB 3RZZA 4EE2A 1CIWA 3ZKUA 2VMFA 5KXEA 1HB1A 1OHFA 2PA7A 1AYM1 4CVUA 4YG3A 2XBO3 4HSLA 1H8TA 5KHGA 3NNMA 4E9KA 4JKMA 2RJ2A 1W9YA 3GGLA 4KWLA 2N7GA 2EAKA 1UY0A 1V9U1 4YM0A 4PLOA 1YYNA 1GBGA 1CAXA 1Q56A 2W9XA 4LK6A 1ND3C 4M3CE 2ZHMA 4LBKA 5GLZA 4AI1A 5F3IA 5CG8A 5B4XA 2VZ3A 4QHZA 3WHTA 2D40A 3N3HA 4B8EA 4NIAA 1KS4A 3SMHA 5KHIA 4BB3A 3DCQA 1E5HA 1IPKA 1YC61 4IE0A 1AXKA 2XQRA 1Y3TA 4IEUA 4RGKA 5FBZA 2IVIB 4FTEA 1QJU2 1VMJA 4Y20A 1FMD3 3MIDA 1ENXA 1PNFA 2FDKA 4XF0A 5JLVA 3ETQA 2XHKA 3LCPA 3MPPG 3DGTA 4CPBA 5C3RA 2RDRA 4XE9A 1FV3A 4CP9A 2SLIA 1QNWA 3VKFC 1QXJA 4LOSA 2VQTA 5FMOS 3V0AA 3CJIA 1E57A 3FX3A 3CBNA 1NZIA 1HJGA 4EWDA 3FFZA 2Q4SA 4CDXC 3VGIA 4K40A 4XJ8A 1S0JA 1TMF2 1EP0A 4D7YA 5A3NA 1S0EA 3AMHA 1KITA 3OGSA 3VD5A 3WHUA 3MIBA 4BE3A 3OUJA 4I2OA 1UF2C 2ARCA 2NMNA 1GMMA 2XVLA 1H9PA 1XRUA 5FYBA 1JW6A 5FMCA 3PIGA 3CMGA 3DXTA 2Y38A 4I09A 1FYUA 1QJY3 2WNUA 1RUJ2 4R9CA 3VZNA 4FPFA 3A22A 5KWRA 5E6HA 3ZFGA 3ZYJB 4NIHA 1VE0A 2WL1A 3GCXA 4Q4X3 2XJTA 2RS32 1DIWA 1ULCA 4QHOA 1AYN1 1FAYA 1UOJA 2W39A 4I01A 1ND2A 3WDTA 5CADA 2VBBA 2Z2SB 3LD8A 5D8AA 3MHZA 4KWJA 5EHDA 3RYKA 2HWE1 4RGGA 2VO5A 2GNBA 3AVSA 4XIOA 3WDYA 1H4HA 1ZRDA 3SKVA 4P9JA 1PK6A 3ZFFC 3M3IA 4FO9A 1HB4A 4X8NA 3BPSA 3DPRA 2ZHLA 4K20A 4NHMA 4QXBA 1A8MA 3BU0A 4ITCA 1XJAA 3MYXA 4PCRA 5HXVA 3KCXA 1SLIA 5CVRA 2P3IA 1DZTA 4OMDA 2C26A 4P9IA 2BBVA 1HXS2 1TG7A 1VBC1 1H2LA 2HWC3 3A23A 1RUF1 1L7LA 3FZ3A 1JZ7A 4XUQA 1QU0A 4XF9A 3T3YA 3EHKA 4BYYA 1RMU1 3S30A 5JPNB 3LIGA 3JBG1 2AR6A 2CAVA 1PK6C 3BKZA 2CU5A 1ASJ2 4H2AA 2P5BA 2Y6JA 4GWIA 3AMPA 5JI7A 5JOXA 2EALA 4QKNA 1BYHA 2QDNA 3K4ZA 3RI9A 4MGKE 1CX1A 5G04L 1QF3A 1UWWA 1H30A 1EYBA 4JV4A 3VDBA 3N9MA 2H0BA 1JZ8A 3CNAA 1RUJ1 3ILNA 3QOPA 4LKSA 3WSOA 2VTXJ 1IG3A 1ZNPA 1FT9A 3AJZA 4NPRA 5FZEA 3TNPB 2OZ6A 1A78A 2XHNA 4YG0A 1X82A 3BPZA 5JXIA 4F3JA 3O5SA 5LCWL 4XXAA 1DP0A 4QPGC 3ZO0B 4QPIB 2YFZA 2QQWA 2XOMA 3LFIA 5DDJ1 4UI9L 5T5JA 1OBNA 2RJLA 5BNNB 1HXS3 2PLV3 2A1XA 3MFCA 5FKBA 1HIXA 4UXAA 4XAAA 5FYYA 5ACA1 5LEKA 2BNMA 1UZVA 3EXUA 3VKOA 4ORFA 4WM8A 1W0PA 4A3ZA 3C2UA 1SLCA 5C8CB 2DUQA 4J1XA 5CB7A 1VBB3 3D6EA 4NIGA 2E33A 3WP4A 1DCSA 3KSCA 5DUUA 4NN0A 4TLGA 1XNBA 2W92A 2VOWA 3MW3A 5GM0A 3DV8A 4QPGA 4XMAA 3WQBA 1ULGA 1AUYA 4XABA 1C57A 1COV1 3P5BA 1J1LA 1LU2A 3IAQA 5FUIA 3WF1A 4AHXA 4HN0A 4EWEA 5BNOC 1RMU2 3E6BA 4ASLA 4AEDB 2VZPA 5HI0A 3WNNA 4NAMA 2FDFA 3H7JA 1LENA 5CZKA 4BM8A 3TWIA 4BHPA 4BJ0A 3N9PA 2DF7A 4FT8A 3B9IA 2BGOA 1R1A2 1RHI2 1U5ZA 2XKPA 1C4RA 1XE7A 5FZOA 1N3OA 2WWJA 4QB2A 2VCCA 3D82A 1SCSA 2GAUA 3FLPA 4LIVA 1ZM1A 2MHFA 5CNAA 2AEZA 1HV0A 2XJPA 3AX4A 3GDBA 4ISRA 1LOBA 3MO4A 1LRHA 4E4ZA 2J22A 2PHDA 4Q0VA 3ST7A 2XGXA 1LKNA 3N36A 1QH6A 1OSGA 5F2WA 4YW3A 4YGBA 4XPVA 5FY0A 3GXUA 4MGZE 2B9UA 1WMDA 2F4PA 3NV4A 4W6XA 4UFHA 4YWAA 1SDDB 4BZ4A 4QMAA 5LW9A 4AWDA 1NZCA 2WO1A 4QWNA 5FY7A 1NYWA 1QJX3 1POV3 4UW3A 2W87A 1Y9MA 1RUI1 2W2IA 2Z42A 3GYDA 3MFAA 3R4DB 5T3NA 3U14A 4EROA 3ZVXA 1CJDA 2VOVA 1AVBA 2XH6A 2E31A 3LA7A 1T6BX 4AGGA 1YHFA 2DVFA 3E1F1 3BN6A 5ACA3 5IHRA 3THPA 4CUCA 1RITA 4Q0UA 1ZRFA 3IIIA 2H6BA 4FPCA 2ZACA 4E4SA 3JQXA 4QGLA 5DDJ3 1COV2 1UAIA 1MQTC 4FFFA 4YZ4A 3ZSKA 4AAPA 3U37A 5I8TA 5FYTA 5FZ8A 1VALA 5F1RA 5A1LA 3GALA 5IK7A 1FV2A 3BOPA 3U78A 4QDRA 1RUG1 3ACGA 3WF0A 4JC1A 2DTWA 3AL6A 1KDMA 1PMHX 5C71A 4AEMA 1W3VA 3AK0A 3QD6A 2ZGRA 1K3IA 3OGGA 2AC1A 3ZMNA 4NHKA 2DVAA 1SBDA 3AP7A 3PNAA 1UYZA 1MS1A 4F8AA 3IDBB 1BXHA 4C1XA 1X8EA 4CCNA 5H9PA 2Q8CA 1BJQA 3IIAA 4COWA 4IQPA 1MQTA 3THTA 1W8UA 2GN7A 2CGNA 4NVPA 1AR92 2GC3A 3MIGA 4QAWA 5FCCA 4QHBA 3WT3A 2Y6FA 1VBB1 1PVC3 3N7MA 2VMCA 1AR63 3GM8A 3DUIA 2VZ1A 1UOBA 1XSQA 4UWDA 5LBCA 1C1LA 1HLCA 2ZS6B 4P00B 1OPMA 5JXHA 4IEWA 4XTMA 1A3KA 1U0AA 3I49A 1D4VB 1YJKA 4YVSB 1L7RA 2X5IA 3RMXA 1HN1A 2Y6KA 1C8M2 1N3PA 3AB0A 2AENA 1D2QA 1MS0A 3HNYM 3OCPA 4YPJA 3P6BA 4N43C 4NE9A 1CD3G 1DQ5A 1KEXA 1YO8A 2OUHA 3OBAA 2I45A 2BOJA 3OD4A 3LWCA 2C9KA 2WFPA 2J1TA 3ZR5A 3WNKA 2VOTA 2OQ7A 2HWE3 4NOTA 4ONUA 5LA0A 1JUIA 3LDKA 1IPSA 3W59A 3KVBA 2O14A 3AKSA 1RUD2 4Q0SA 1S2BA 2OZJA 1AL0G 1C1FA 5JDBA 2X5IC 2K2SA 4AK3A 2X5IB 2YUEA 2XUEA 1RUG2 2RV9A 2YPJA 5T5OA 1ND2C 3OPTA 5IVEA 2ZGPA 1NQJA 4LQRA 1BVP1 4C8DA 2PHUA 3JBG3 5JMOA 1QJY1 3Q8CA 4YW4A 3VL8A 2K0GA 5K8SA 5KHKA 4PDWA 2HWC1 1D2SA 3MPBA 5KHHA 3VZLA 3S6PA 4LITA 3MEPA 4CZSA 3GNEA 4ARXA 1D4M3 2OPWA 1DGLA 5EJ3A 3FHQA 1HB2A 4ZY9A 3L9JT 2J1UA 3SC7X 3K46A 2ZEXA 2OT7A 5GKAC 4XETA 5IAXA 2P3JA 4YZ2A 1VJ2A 3RFRA 1KDKA 4UYBA 2VVDA 5LRSA 3PVBB 2E7QA 1JODA 3APBA 1UCXA 1MZFA 3U4SA 1T2XA 1W28A 4TXWA 4BU2A 5I0TA 1HDKA 4XUTA 2HEYF 1ZREA 2D6OX 3MV11 4AZZA 4H14A 1DQ6A 2CYFA 2R043 3K3OA 4MLOA 4R9BA 4Q4X1 3RZKA 1JYCA 2ARAA 2QZ2A 3NJYA 1JYIA 4P5HA 4AI9A 1TME2 3LIHA 3T30A 3B02A 4HVQA 4AFAA 5F2SA 1OPOA 1UY2A 3D3AA 2HBTA 2JG8A 3LA3A 4FPLA 1X9TA 1CZTA 2O0OA 2RMU2 2KA3A 3RPQA 1VBA1 4YW1A 1PZ8A 4GMP0 1NE4A 5GALA 2RDSA 2WFF1 4QXHA 1R64A 1CJPA 3CQOA 5I0RA 1NY72 3CKHA 5C3PA 1V9U3 4OUSA 1GICA 1NCRB 2CDPA 1ZVFA 1RINA 2WLQA 4IE4A 3RI8A 3VB9A 3ZXGA 5AFBA 2LM3A 5A7PA 1GWKA 2P17A 1A8DA 3J7NA 1F31A 2EIGA 4CRQA 5JWPA 4GAZA 2DBIA 3S0MA 5CEHA 1SLTA 1Y4WA 3OY8B 3V65A 4PT6A 4U36A 1D0HA 2WO3A 1I1EA 1LGBA 3IT8A 4JKLA 1SLLA 3M3EA 1F9KA 4BA6A 2WNOA 4GWMA 1ULEA 5FLJA 3I59B 5FYZA 1G9AA 4CDQA 2HBUA 3EJKA 5A3UA 4A7ZA 2K46A 1S0CA 1JBCA 1UD1A 4Y5Z0 2UYBA 3LSDA 3WP6A 2XJUA 3GJBA 1POV0 1GZWA 2CAUA 2WFF3 5T54A 5J48A 4PBOA 2O8QA 5APAA 2D7FA 1QOOA 2QCSB 5FP4A 4UF0B 1WCQA 2FMDA 2PHTA 1UU5A 1AJKA 1VBD2 2W08A 1DQ1A 1YI7A 1AR72 1H8VA 4CCOA 1H6XA 2QQUA 3B3QE 3J8F2 5DAWA 4JHZA 5I93A 4H7MA 2RS52 1RJ7A 4MOAA 1KRIA 1O8PA 4Q8KA 1B35B 3AMNA 3IKWA 3ZKYA 1TNRA 2VW1A 3VBSC 1VBA2 4MO3M 2XUMA 2X05A 2AYHA 2WFF2 4UBGA 2YU2A 3E6DA 4D0QA 5C8CC 3GBFA 2TEPA 3KS7A 1BBT1 1OD5A 4HK8A 2BV4A 3ZXLA 1PNGA 2AGSA 4K21A 1BK1A 3C7HA 4CEWA 2VOXA 5T50A 4JQTA 2WQZC 2CGOA 4KMQA 2UY8A 4YFWA 3PDQA 3WZ1A 1D0GA 1SPPA 3NKGA 4NUBA 4QPGB 5C3OA 2ADDA 2AZ5A 2W46A 2Y26A 1QIQA 4A2UA 1JZ6A 4MV2A 2R0HA 4E8CA 5K7PA 1BMV2 2Y60A 3O7OA 2PTMA 4AVBA 1LECA 3BTYA 1JH5A 2UYAA 2WT2A 2ZOEB 4L97A 4GB33 5HCHA 2IZWA 4ES9A 1UQXA 4MGIE 3RWNA 1GANA 4CSWA 4Y1YA 1VRBA 3LEKA 5C5TA 3KQRA 1LCLA 4ZKTB 4PBPA 1WUVA 3JD72 1APNA 3WP5A 1W06A 1MS4A 4PQ9A 1CIYA 3EB7A 5LA1A 2NMOA 4RS5A 3BYWA 2SBAA 1RVF3 2YMZA 5CIRA 3IDEA 3W9AA 4A7YA 5JOWA 1UIKA 2WO2A 3ZXFA 5LATA 4PI2A 3ZPOA 5A7WA 3T2OA 3VBUB 2W68A 2WAOA 4A42A 2UWCA 1YFUA 1WMEA 2BPA2 5DN2A 1LOFC 1AR62 3ALQA 3SH5A 2DCYA 4GJZA 3KLSA 5IVYA 4ZS3A 3LB9A 4META 1C5IA 4JQRA 4PIXA 5FXVA 4XMIA 3BB6A 3H1YA 3HNBM 5T55A 5EXOA 1SLAA 4QM8A 4WM7C 5FP9A 3AKTA 2A75A 3VBRA 5EPAA 1IS3A 3IPVB 3M1HA 3PUQA 4DXRA 1US3A 1PMIA 1PO12 2A73B 3PVEA 2KR2A 2A6XA 1LOFA 4O7XA 1Q43A 4XJ9A 5EYXA 3ZN6A 3UNPA 4LA2A 1AR81 1CAWB 2EAAA 4NWVA 5FQ0A 1YQ8A 4LHNA 1V6MA 4L92A 4AGRA 4CDUC 3PVOA 1HRV2 3ROUA 4RYDA 3W58A 4CDUB 5F6LB 3JQWA 2GH8A 2E26A 3GZEA 4Q0QA 1RUG3 3WG4A 4OI1A 3JD71 2ZHKA 1R092 1XE0A 2WZR2 4V2VA 2GU9A 1DLCA 3OBTA 3WP3A 4AI0A 4MGSA 2FZ2A 3ILRA 2BQPA 4CEYB 1SCRA 3POJA 5A6ZA 5C33A 4P9WA 3CF6E 3JXSA 1NKGA 1W8NA 1EV12 1XYNA 5CYYA 4BXSV 1OF3A 4PLMA 4E2QA 3TRSB 3CEWA 5IJRA 2J1AA 3BUCA 3RVHA 4LK7A 2VGDA 3M3CA 1W8HA 3T0DA 3IDCB 5L19A 1LNSA 4XOGA 2OX0A 1POV1 4IETA 4JTOA 3TAYA 1SQ4A 3CZUA 3FLTA 4EV0A 4OQ8A 3ZYGA 1WLCA 4OULA 3USUB 4MHRA 4I30A 3U75A 4BH9A 3SH3A 4FPJA 2VQUA 4LJHA 4KGGA 4FI9A 2ID4A 4MH0E 4ASKA 2ARXA 2MEV2 2XDVA 1R1A3 2JE9A 2AEYA 2HYXA 2ZAAA 3D5OA 3I2FA 1AR82 1W6MB 3ORJA 1CPNA 2CWMA 1POQA 2ZJCA 5CG9A 2XL9A 4XBLA 1VMHA 1S0DA 4WM8B 5J3UA 1ZYBA 3WF3A 2E51A 1W8OA 1BEV3 4KBZA 5FO8B 1BHGA 1NE6A 1ND3B 1ZBA3 5FP8A 4UFMA 1GOFA 5DZGA 1AHSA 3DXUA 1IHMA 2Q8OA 1W8ZA 2ZPXA 1HRI3 2ZX0A 4GALA 3TBDA 3WQ7A 2GMEA 1JZ4A 3URFA 5DZEA 1VPHA 2VVEA 3C7GA 2VU9A 3OSDA 4E27A 3FL7A 2P2KA 3NWKA 4A4AA 5KC6A 3ZOIA 1J84A 1ZA7A 4Q4W3 3AC0A 3H8XA 2VJXA 4XF4A 1XNCA 2Y64A 1PVC1 5K4LA 5BUVA 2GP3A 2E7TA 4FQ4A 3B5LB 3FMGA 1UZZA 3H8OA 3VBSB 2XWJB 4R4ZA 4M4RA 1VBC2 1UL9A 2NZ9A 5FXWA 1OVPA 4ZS2A 5FZGA 1FPN2 2XVKA 1GZWB 4O9GA 3KCCA 2FDIA 4XUOA 5F5IA 1FOD3 1QOTA 4LA3A 4AE2A 1NUKA 1STMA 1UOGA 2VECA 2GMMA 2FCUA 5CBLA 2X53S 4FFGA 4GXLA 1FOD1 3OBZA 4YZ5A 4XJUA 5JZGC 3ELNA 2W52A 2OS2A 1B35A 4D6RA 2F6BA 2V73A 3RWKX 2PMWB 4NPMA 5LK5A 4P08A 3TEZA 5L9BA 3PMSA 2A70A 4GULA 1MZ6A 3F95A 4C0HA 5IYYA 1VBB2 2VQAA 2ZGUA 2B42B 3MICA 1YI9A 4XW3A 4ATFA 3SCHA 2FD8A 5FRAA 1CQ9A 1RMU3 3I97A 1GU3A 2D6PA 4NMIA 4UF0A 1Q8SA 1HN0A 3WG2A 1V0AA 4KU7A 4ZU5A 5A70A 1RUF3 2UY9A 3I3EA 1RUI3 3HT1A 1W6PB 4N90A 3FBMA 4XQDA 2R072 1GOHA 1ODNA 1QJX1 1VAKA 1VBE3 3AKRA 1UZWA 4O61A 4BQ2A 4B7EA 2IXCA 3J7MA 1UMHA 1SDWA 5E1RA 3MLLA 1O8SA 2WNUC 3ZPYA 2ENRA 2WSUA 2ZMNA 4HN1A 1QH7A 4XBQA 1G9FA 2G9ZA 5EP9A 3T1LA 4IGQA 5J09A 2VD7A 2DTYA 2ZCWA 3G6JB 4ZXEA 1NLRA 3DL3A 4OQ9A 2BBAA 2WNVB 3POGA 2EVXA 2Z69A 3MUZ1 1RUC3 4OI4A 3B94A 3TEWA 4KWKA 4DRVA 3KZ4C 3ZXDA 5GLVA 3ZXEA 2OVUA 1RYYA 3ZDSA 3LA2A 1OQDA 3JD73 5FUPA 5A3TA 4Y26A 4XZPA 2JE7A 5IW0A 1OLQA 1XQNA 5BNPA 2O8OA 1R1A1 2WN2A 1JZ3A 5H9SA 3DPRC 4JGZA 3ZX7A 4LLOA 1WA4A 3I2JA 5FZ0A 5FZIA 4AVSA 4BIFA 2D6NA 1UKGA 1Z78A 1W6QB 3NAPA 4Q1PA 5L73A 1AL21 1TMF3 3N9NA 1FPN3 1QXPA 4Y4YA 5E16A 3ZN4A 5JAXA 2BFUL 4LTAA 3S7IA 1XNAA 3ZFEB 4DINB 3V0BB 5A80A 4OUEA 1N47A 2ZZJA 1IOAA 2VXRA 4P9XA 3WDUA 2VW2A 3TEXA 4MG2A 1AJOA 1PIV3 5IVBA 2JKXA 2VUJA 1NCRA 4LO6B 3IZOA 1UY4A 2IXIA 1DYKA 1G86A 2QQLA 1HB3A 2ZGLA 3UYJA 4QQOA 3KV6A 1CAXB 3VBOB 1H2MA 4FP3A 5D8AC 4DS0A 5IK5A 2BDRA 4K8FA 1WZXA 2G9GA 1K12A 5GZGA 4R4XA 1WD4A 3N7JA 5FDBA 3VKLA 5FQ0B 4EN0A 1F5FA 4QX8A 1UY1A 3VDAA 4AGVA 4MXWB 1IS4A 5EJ1B 5DMYA 5L7OB 1O4ZA 4Q4X2 2BU9A 1FMD1 3R4SA 4NAOA 5FY4A 2C9AA 1BLZA 3UV9A 2WLPA
chains in the Genus database with same CATH topology
1VBE2 2R6QA 1IKPA 1QNYA 3NV2A 3KB5A 4CYDA 1RGSA 2GNMA 1VB2A 1DBNA 1PO23 4RSUA 4XTPA 1FXZA 4Q0PA 3VZMA 3VDDB 2R1DA 5BNQA 2JDZA 5F9TA 2D97A 2EXJA 2VQ0A 4S2GA 2WIIB 5T5LA 3DF0A 1X33A 2XBO1 2BEOA 4YGEA 3ASIA 3BALA 1AR91 1OA3A 4YGDA 1NXD1 2CTVA 1NA1A 2YDEA 4M0HA 2G9FA 4XQWA 3MW4A 4R9DA 3AFKA 3RG0A 3MDPA 4CEWB 1GFF2 1LOGA 3X29B 1KXGA 4RHV1 4BQ1A 2XWBB 4EN9B 5LK7B 1J3RA 1IGOA 1RUH1 3GBWA 3E5QA 5JSRA 2E7AA 2VH9A 2WT0A 2RM21 5HCFA 1QHDA 1SBEA 1OMIA 4JAAA 4YM1A 1S2KA 1TQ5A 5FFOC 4FP2A 4AYUA 1CAVB 1S0FA 1SFNA 2X29A 4HL0A 3J8F1 1MQTB 1BVVA 1RUD1 1EPWA 2RS51 2YXSA 4B29A 1WCKA 1F8VA 5JCTA 1HQWA 1PVXA 2TUNA 4OFGA 2VULA 1F5JA 4LO8A 1JN2P 4N53A 1ZZ9A 1LGCA 1LODA 1Y7BA 4YW5A 1WBLA 2LUWA 1WLWA 5BNPB 5J7MA 3WQ1A 4AVVA 3VBHA 4HETA 4PF5A 4YSFA 4G4FA 2BNNA 2DCKA 3GHMA 5GLTA 3NKTA 3FBYA 4KG8A 2EXKA 4RR3B 5JZGB 2XJRA 1ZZ8A 4M01A 1W39A 4DRRA 2JG9B 4K6BA 4XFIA 5IK4A 1NCQB 2Q1ZB 4IV1A 4WM7B 4JGZB 1N1YA 4MGYE 4Z92B 1M06G 1QGLA 2CNAA 2HWB1 4C0BA 4IL7A 2RM22 1S55A 2PHFA 1N1TA 1UU4A 1OI6A 5EWSA 1Q8PA 3POSA 4LUMA 3H8UA 1ZX5A 3AMMA 4RQPA 4R8HA 2HWB3 3HBZA 3PJYA 3WQ0A 5J36A 4FPGA 4EJRA 3VHRA 1R093 2WZR3 4P9LA 5KHJA 2GC0A 3VBHB 4Z8BA 1BKZA 2YGMA 4URTA 5BY5A 4LBQA 3JU9A 1KD7A 4M0NA 1MEC3 2UURA 3NL1A 3EQEA 1L3JA 2DVGA 4A7KA 5FPXA 5HCAA 1MS5A 4MZUA 1H1IA 3WG1A 4OHZA 3WCRA 4Y1UA 4F7ZA 1VBA3 3LZZA 5I0UA 2EXHA 3PVNA 4KNCA 3B00A 3CJXA 2RS53 3ZN5A 2A3YA 1PHMA 2IXLA 1HKDA 2H0VA 4IV3B 2QNKA 1PZ7A 3HN1A 1KJRA 4JGZC 4N9HA 4G3YC 1I3HA 4WM8C 5E89A 4P9YA 4QQLA 1RVF2 4WVWA 1G7YA 1VB4A 4OZXA 1MVEA 1RTVA 4R9AA 1BCXA 3ILFA 4S2DA 1RUH3 3R4UA 4AFDA 2WSVA 3OJBA 4GH4B 5DXDA 4ZU7A 1NCRC 3H3ZA 4V1PA 2WS93 4FTBA 1Z7S3 3PHMA 1S0GA 1C5HA 1W6NB 5E8AA 1G9BA 3NW4A 3INAA 1B09A 1UIJA 2R0FA 1LESA 4HK9A 4Q26A 5JSOA 1U5XA 2WA4A 1QQP1 2MEV1 1WBFA 4PDWC 3E6CC 4ES8A 1PO21 4CDWB 1OFSA 4BPZA 3I7DA 4OLLA 2UWAA 1Z7S1 3DPRB 4HKLA 4NHLA 3JUUA 1AR73 4ASMB 1KQRA 3VBRB 4FPHA 2YV8A 3WW4A 3H50A 4GQ7A 4Y1XA 3ZXJA 3KT7A 3BCWA 5TSWA 4GMP1 4AVTA 3RRDA 2RR13 1ENQA 3GBGA 2JD4A 3FE5A 4AVCA 5J98B 5JZGA 4COZA 1QJU1 1B35C 1O4TA 1WW6A 2WT1A 2DWRA 4WVVA 1V6KA 2GNDA 1MS9A 4Q4Y1 4KQ7A 3AZVA 3QH7A 3O0VA 1LOEA 1W6PA 3VBFA 4B4QA 5GZCA 1UU6A 5AFEA 4PLNA 4HBNA 1FPN1 1TMF1 4LBMA 2WNEA 2VPVA 4HVRA 4JDOA 3VHOA 4AEDC 3AM2A 3VBSA 5JIAA 2E63A 1ZBE1 3PMEA 4FCAA 4XJZA 2RMU3 1FOD2 3SCFA 1C28A 2B45X 5JVVA 5C8CA 3HQXA 3I8TA 2WS92 4XDQA 2VOKA 2PAMA 4H55A 4CEYC 3ZYPA 1UPSA 3IPVA 2DU0A 4DXZA 1UZYA 1YJLA 4GWNA 4RL7A 3BU7A 3MLKA 1UN1A 2A6VA 3R05A 4BMEA 3BTAA 4N7UA 4YVSC 1R091 2WZR1 5L36A 5IK8A 2PHRA 1PGW2 2DFBA 1IS6A 5A32A 5CAZA 2ZX1A 2YHJA 1K5MC 2QJVA 2FQPA 1X8MA 4XF3A 2CL2A 1J3PA 4OUMA 3RQ0A 4LLFA 3WCSA 1WW5A 3WW3A 4J6GA 3VDDA 4F83A 4CDXA 3VZJA 4MUVA 2PLV1 1HXS1 2R073 5AVPA 1S1AA 4NO4A 1Y9QA 3QH6A 1K5MA 1SEFA 1ZRRA 1LU1A 1CGPA 2D3SA 2VMGA 3OF1A 4XXPA 3ZSMA 1ASJ1 2YGLA 4CEWC 4Y22B 1CN1A 2CWSA 2NP0A 5BPXA 1ZBE2 2JG9A 1RUJ3 2ZGKA 1MEC2 4XYXA 4RQPC 1H8TB 3MF9A 2XLFA 2R063 1H0BA 3KMHA 1XU1A 1QDOA 4GA9A 1DQ4A 1HX6A 3AZZA 1C8NA 1AYN2 1O3SA 5D8AB 1RUD3 2WINB 1PGW1 4QM9A 1VBC3 1QOSA 2JG9C 3G7DA 2OPKA 2HWE2 4KGQA 3POYA 2VMIA 3FFQA 4CDUA 1RUE1 1PGL2 4RS5C 5KC5A 5GLWA 4D3WA 1Q8QA 4DZGA 1HV1A 1FMD2 1ULFA 2XJQA 3HR9A 3ZXAC 5C4WA 3ZSEA 4IEVA 4RHV3 1W6OB 4Q8LA 3ZIXA 3U07A 3E97A 3WY6A 1W6OA 4BOWA 4L2NA 5A33B 5GZFA 3DN7A 1KJLA 5CA6A 5DUWA 1YRZA 3KM5A 2UU8A 2TNFA 4WM7A 4BLJA 1RUNA 1OOPA 3IBMA 5C9AB 1YIFA 4LE4A 4HANA 1NG0A 1I9RA 2XBO2 3AYDA 4Q29A 3VBUA 3OY8A 1T6GC 1O3RA 2Q5TA 1MZ5A 3QACA 2P3KA 2HWF1 3ME2A 4TZDA 4I02A 2GALA 2JXAA 3PJQA 4DB5A 5DDJ2 1XXNA 4BCUA 2VW0A 1I5ZA 1R083 1BQPA 2A7AA 1U5IA 5ACA2 5I91A 1RUE2 4PJYA 1O4YA 3HT2A 2DFCA 4AI8A 5I8YA 4W6YA 2D3PA 4FOVA 2IXJA 3D0JA 1SMVA 1JHNA 2ZGNA 2D6MA 2R49A 1RJ8A 1Y43B 3NVCA 4D94A 4JGYB 3NSTA 4RS5B 5AVAA 4YFZA 4LE3A 4U2AA 4M00A 4KG0A 1YWKA 2WKKA 1DHKB 4FPKA 3CU7A 5DUXA 4AEJA 1W6NA 4XJWA 4QX5A 5SV5A 1WMFA 4EN7B 2PFWA 3N35A 5F5QA 1JOJA 2BNOA 5FOBB 2IWGB 4IEPA 4WVZA 4RR3C 4GH4A 2PN5A 3D0SA 3U0ZA 4XILA 3AYAA 1VP6A 2ERFA 1O5UA 4IXLA 2DVDA 5JR7B 4SBVA 4B4PA 2C5DA 3AZYA 4FOQA 4FPYA 2QFEA 1W6MA 5CFCC 4CDWC 2A3XA 4YYOA 3A4UA 1RUC1 1DGRN 4RD7A 3A0NA 3ZMOA 2B7YA 3KGLA 3PTYA 4HZFA 4QQPA 2QDRA 4IV1C 3WW1A 3QLQA 4IV1B 1M4WA 3OBRA 4LUKA 2Q0AA 3K48A 4QXKA 3RYPA 3TN91 4B7KA 5FREA 2VUAA 4DQAA 2WNVC 4ISQA 1N1SA 1VBE1 5EV7A 3O0XA 4P14A 3SH4A 1WW7A 3J9SA 4B3NA 2ZX2A 1PIV2 4GB31 1LB2A 4HSJA 1LOAA 5GZEA 1DQ0A 1GR3A 1NOVA 2DV9A 2VNOA 2RHPA 2YC0A 5KBFA 2NN8A 2Z79A 4FPOB 5FLHA 1EAH3 5I0SA 2ET1A 2A71A 4QGMA 5AC91 1CAUA 2JENA 4XEZA 3VBRC 2HWC2 4DOUA 4XFCA 2PYTA 4JTNA 4GKXA 4YZ1A 1CX4A 5C4WB 2VG9A 1ASJ3 1ZZ7A 5T5PA 4D7TA 3I4IA 4K1ZA 3AZXA 2RS11 4UW4A 1VRH2 2ZGQA 2ZKLA 1W6QA 3NAPB 2C1FA 4INDA 4YVWA 1RUC2 4XFBA 1ZA4A 1XU2A 3A0KA 2G4IA 2OW4A 2QVSB 1QDCA 4LHLA 4UW6A 3KT4A 1WCDJ 2MNGA 2AREA 3CLPA 1TME3 4Q2FA 4QQHA 4Q4W1 2MPFA 4FPEA 1DGWA 4AQTA 1DGWX 3TN92 5L7OC 3B93A 3UKNA 2RS33 3MZHA 2VNRA 2XJSA 2E9QA 1GQGA 3PLQA 2ZAHA 2WC2A 4X8PA 5GZDA 4YVWC 4BIOA 3AP5A 4KH9A 3RYRA 1YFYA 4LBOA 2R061 1HRI1 3D4KA 1NLSA 4XHXA 1PZ9A 4K7JA 2D6LX 2ZX4A 1SLBA 3JB8A 3MIHA 1NY71 1TE1B 2PAKA 5AC92 2EXIA 4E2SA 2PHXA 3BIWE 2ZGSA 1D4M2 2WA3A 3TYJA 1LEMA 1QY4A 2JICA 1LEDA 4FOWA 2KM2A 3WVJA 3BOWA 3UKVA 4FSJA 3M7AA 1GNZA 1VRH1 2BW8A 3U11A 3WNXA 3H1WA 3MLJA 3O0WA 2R16A 5C4WC 3GZUC 1ZRCA 4YARA 5ABJA 3QBQA 2X8KA 2R32A 4IEXA 4ATEA 1JUHA 3S7EA 2HWD2 1QWRA 2R041 4AHWA 3USSA 4EN6B 5BNNC 4WV8A 3VZKA 2DYCA 2ZKNA 5IT6A 3WG3A 1JTZX 2HYKA 3JZVA 1C8M3 4K9SA 4DY5A 2PHWA 3VKNA 2D44A 3M2MA 1ZZCA 3SISA 1WD3A 2R062 3ZFEA 1YLLA 4HVOA 4YM3A 2BWAA 2Q30A 1J58A 2RMU1 4JGYC 3M8LA 3FLRA 3U10A 2D6KA 3LGRA 4CTEA 4YVSA 5BNNA 2HEWF 1Q8VA 2IXKA 3NV3A 4BMBA 1D4M1 3O12A 1AR83 3UJOA 1RIRA 1GYKA 1ND3A 4DFSA 1YXWA 4P9GA 4WVMA 2MEV3 3SITA 3WV6A 4MYEA 2DVBA 2ZHNA 4XHBA 1W2UA 3VBFB 4JGYA 3OYWB 3RNSA 2I2SA 4CDQC 2BFUS 1LHVA 3TOJA 1MVQA 5DG1A 2WS91 1XYOA 3GHNA 3E5UA 2HKXA 2VY0A 2DCZA 2OA2A 4W6WA 2FZ1A 4N43B 1X36A 3RJ2X 4GMP3 4CEYA 4H3WA 3H9AA 2XJVA 3CJIC 4C90A 3O14A 3AKQA 3CJIB 1JXNA 3M3QA 4GH4C 2LTNA 1KS5A 1RVF1 1FNYA 2EF6A 4Q4V3 1N1VA 4I0AA 4IEYA 4AI2A 3VL9A 4COUA 2JG8B 2B5HA 1AR61 2PAEA 2ATFA 3RDIA 4JRAA 1QQP3 4QGNA 4Y22A 1BBT2 3SXWA 4TSVA 4OHVA 2V5YA 3M3OA 4YLZA 2D3RA 2HJIA 2XLGA 2JX9A 1YUDA 2VVFA 4YGCA 4IV3A 5FTTC 1C3HA 1KFXL 1LOCA 4IESA 5FMOL 1RC6A 1PO22 4AFCA 4MX3A 4RA0A 1FNZA 1CAVA 5K9YA 4LBJA 1MEC1 2D5FA 2P37A 1BMV1 2XL7A 2JKBA 1LJ7A 2XKOA 1HRV1 2GDFA 1LTEA 3I2DA 3OYWA 5T52A 2GSYA 3FUQA 4YZ3A 5A33A 1EAH1 4KBBA 4IV3C 2RR12 5A32B 3HMYA 5D1IA 5BYNA 1OQ1A 3I54A 3MIEA 1MACA 2YZ4A 1V00A 4RGAA 2A6ZA 2XVGA 1LGNA 3MI8A 4R52A 1AXZA 4FQZA 5EZWA 1WCSA 3MF6A 3VUOA 1EV11 1V6OA 1MS8A 3TN93 1RUOA 1VRH3 2P34A 2RJKA 3D8CA 1OLRA 2CGPA 3M4FA 2FBEA 2B46X 2DU1A 1LHWA 2GH2A 5CFDA 1HQNA 4AHYA 5FAXA 1ULDA 3WDWA 4B4RA 1Q5OA 2GC2A 3WR0A 1DLLA 5FLIA 4S2HA 1PGSA 1PO11 2PELA 3VHPA 4CDXB 3KCYA 4OHYA 3ZFFA 4AW7A 3AP6A 5JSPA 1RHI3 1MZEA 3IN9A 5J37A 3GZTB 1DYPA 1CPMA 1W0OA 1DF0A 2RS31 3AYCA 4D7SA 3VBUC 2ZZQA 3R0RA 5CFDB 3H1MA 1OFNA 3RMYA 3J8F3 4QPIC 3U4XA 3P3PA 3OD0A 4N53B 2FMYA 2ETEA 1G6NA 1XYPA 3TNQA 3ZFGB 1DDLA 4FOYA 1IQAA 4XFHA 4FXGB 2OYZA 1O3TA 3SCGA 1ZZ6A 1CONA 2OIIA 3N7LA 4XF1A 4AQ2A 1LHOA 1H1MA 2RS13 1X50A 3ATGA 1ENRA 2A3WA 2D98A 3HD8B 3AZWA 2ZTNA 4OVEA 4CDWA 1R081 3AXDA 4DNYA 2PLV2 5SV8A 1Q8OA 3V56A 4CP1A 3R6SA 2DUPA 1RUF2 1XE8A 1CVNA 4LBNA 4QT6A 3T1MA 5BNOB 3JBG2 1WLTA 2KXLA 4HKWA 4LO5B 2A6WA 4G9SB 4LEJA 4Q27A 1V70A 1VAVA 1KFUL 3ZSJA 2WNVA 4Z07A 5LRRA 3RSJA 4XQ4A 3VBFC 1IPJA 4N9IA 5GLUA 3V64A 4S2FA 4AFMA 3C3VA 4E2GA 1EPZA 4RR3A 4LHKA 2D93A 1AX0A 1G9CA 4I3PA 2QZ3A 2AUYA 2BYVE 4LNVA 2BVBA 3B69A 3VZOA 1REDA 1F2NA 3ES4A 5EYYA 2RM23 3OGJA 4WZCA 5CFCA 1CR7A 2E6VA 5J96B 1PGL1