2WQZC

Crystal structure of synaptic protein neuroligin-4 in complex with neurexin-beta 1: alternative refinement
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
177
structure length
177
Chain Sequence
HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROLIGIN 4, X-LINKED
publication title Structural Analysis of the Synaptic Protein Neuroligin and its Beta-Neurexin Complex: Determinants for Folding and Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 34
structure length 177
sequence length 177
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wqzC00
3MEPA 3IKWA 1QMJA 1DQ5A 1SCSA 3FUOA 4RL7A 1MS1A 4AVSA 1WW6A 3ENRA 1RITA 1V6NA 2P3IA 2A5ZA 5DZFA 5EXOA 5T55A 3WDUA 2PHWA 2NYYA 3AP6A 4XYXA 2D3PA 1CPNA 3OBTA 3RMYA 1V6MA 2HYKA 3DUIA 3HN1A 4XMIA 1SFYA 1SBDA 3OY8B 4FPYA 1G7YA 1G9BA 2R1DA 4FQ4A 1PZ8A 2CL2A 1RIRA 2OW4A 4CZSA 1MS3A 2D7FA 1MR5A 3O12A 4MYEA 2NM1A 4GWMA 2CWMA 2ZMNA 5GLTA 1YI7A 5CA6A 5GZEA 4K1ZA 4XTMA 3V0AA 4LBMA 1WLDA 3FBYA 1GZ9A 2I2SA 5GLWA 1LHNA 1UKGA 3HR9A 4PBOA 4LBNA 4U2AA 2XG3A 2P2KA 3ZYRA 4LBQB 4ISRA 4YZ1A 4YFWA 1JYCA 1I3HA 2W52A 4Q8LA 2JDZA 3ZXEA 5BYNA 4YGDA 1ZM1A 5H9PA 5IK5A 1YO8A 2DTYA 3LCPA 1AXKA 3UJOA 1Q8QA 2P3JA 3D5OA 2DWRA 2EXIA 2YY1A 3M3CA 2FHRA 3GALA 1H9WA 4ATEA 1AJOA 2DUPA 3LSDA 1C57A 1F5FA 1ULEA 4K21A 2P34A 2YZ4A 1U0AA 1DIWA 1GANA 4DFSA 1C4RA 1N1VA 3H0OA 3VKOA 2A6ZA 2NP0A 5EWSA 2R0HA 2DVFA 1W6PA 4R9DA 1QOSA 4D69A 1GSLA 1VLNA 1W6OA 4DRVA 2ZGUA 4GKYA 5E89A 3WDVA 2JECA 1LOBA 2ZGRA 2OUHA 2AENA 1LHVA 4XJUA 5T5PA 5GJ6A 4FVVA 4P9YA 3ATGA 3AJZA 3NV3A 4R9BA 4BMEA 1HKDA 2UU8A 2A6XA 4BPZA 1Q8OA 2EAKA 3AFKA 1CONA 1LCLA 2R1BA 3C2UA 3OYWA 3VV1A 1FNZA 5DUXA 1BZWA 5KXDA 1A8DA 2ENRA 2PHUA 1WW5A 2PHXA 4FPHA 3WHTA 1CESA 3ZSMA 2DVBA 1JHNA 3A0KA 1LEMA 1DQ6A 3IPVA 3CNAA 3ZPYA 1O4YA 5T5LA 4Q8KA 2SLIA 1S0DA 4R9CA 4Y1UA 1BXHA 1LOAA 4ITCA 2A71A 4Y22A 1BYHA 3BODA 1MACA 3NV4A 1DYKA 3VUOA 2EALA 4YW3A 3MPPG 3WDYA 1ENSA 4Y24A 3SLIA 3T1LA 1MS4A 1LENA 1JUIA 4XJWA 5CNAA 3RG0A 4ZKTB 2VU9A 2E53A 4XHXA 3WG4A 4BLIA 4Y20B 1W6QB 1ULFA 2SBAA 4XJZA 5EYXA 2GNTA 2YV8A 2RHPA 4XDQA 5FRAA 2B7YA 2AREA 1GICA 1PZ9A 2DURA 4YZ5A 3OJBA 3PVEA 3SNMA 2JJ6A 1GKBA 4XILA 1KJLA 1N1TA 3N7JA 3WUDA 4GALA 2G4IA 3M3QA 1W6MA 1FV3A 4Z8BA 1NLSA 5GM0A 5H9RA 2GMEA 4PQ9A 1YYNA 2AR6A 3AXDA 3ZYPA 4FPJA 1TEIA 1V6JA 2JE7A 3BIWE 1LOEA 4I30A 3RSJA 1S0EA 1FYUA 1MS9A 1VAVA 2D6LX 4LBOA 5T5JA 3WG1A 2YXSA 1I1EA 4DRRA 3FFZA 4LBJA 2WLQA 3B69A 1LGNA 2UWCA 4BLJA 2WT0A 4FOWA 1FX5A 4XBNA 2VUAA 2WQZC 3T2TA 1DLLA 2ZACA 5H9SA 5KXEA 3PVNA 3AZZA 5AVAA 2E6VA 2VW1A 4YGCA 4AGGA 3VKFC 1VIWB 1ONAA 3AYAA 3USUB 2ZHLA 1YXWA 1SLCA 4YM2A 5JMCA 1A3KA 1SLIA 3R4SA 1H9PA 1AX0A 4LBQD 1QGLA 2GMPA 3N7KA 2WT2A 4SLIA 5SV8A 3W58A 3R05A 1FNYA 1QU0A 3AXEA 1MS8A 1FV2A 1QDOA 1QNYA 4K1YA 4LBQA 1G8WA 2WNEA 5JLVA 3R4UA 5T52A 1UMZA 2ZMLA 2C5DA 5HCAA 1Q8SA 1BKZA 3BTAA 4BM8A 4FPFA 4XZPA 2ZA9A 1LU1A 1N3PA 3N7LA 1MS0A 1R1ZA 2VW2A 2VH9A 4FPGA 1J1TA 2R49A 1YIFA 3AX4A 4DPNA 4FPCA 4BQ1A 3INAA 2CNAA 2BQPA 1ULCA 3UK9A 3POWA 1O4ZA 1GV9A 2AYHA 2WSUA 2CYFA 2A6WA 1JN2P 3V0BB 4JRAA 1IS4A 3AZXA 1W6NB 2E51A 1WW4A 4CRQA 1Q56A 1LU2A 1UPSA 2JE9A 3B3QE 4BOWA 3MW4A 1VALA 3AP7A 4Q2FA 2ZGNA 3O0XA 2DUOA 4XJ9A 1KITA 1N47A 1WBFA 3ILRA 2DTWA 3ZVXA 1Q8PA 3I4IA 4WVWA 5GZFA 1IKPA 3WOGA 2AUYA 5T50A 2NMNA 1GZWA 1Z0HA 2A70A 1S0IA 4PBPA 4YW5A 1QNWA 2DVGA 4Y1ZA 3TAYA 5JOZA 1JYIA 1V6IA 2D6KA 4P14A 1JXNA 1OQ1A 5JOWA 4WZFA 2GMMA 2R16A 2ZGMA 4M3CA 3RMXA 3W59A 1IS5A 1MVQA 4OZXA 4XXPA 5GZDA 2D6NA 4GA9A 4YW1A 3V65A 2VY0A 5T5OA 4U36A 3KQRA 3NV1A 3WV6A 1LOFC 4UW6A 1SLAA 4UW4A 4YW2A 1QOOA 2R0FA 2JD4A 2ZHKA 2VXRA 1N1SA 4AVTA 1UZYA 5GLZA 2GDFA 3ZXJA 4JCKA 5F5QA 3POYA 3SH5A 4BMBA 4XTPA 1WCSA 3T1MA 1N1YA 1GBGA 2E7QA 2V5YA 2DVAA 1RINA 5FREA 3D4KA 3N7MA 4XBLA 1PZ7A 4XMAA 1AVBA 1DQ0A 3HMYA 1AZDA 1DGLA 5HCBA 3WCSA 2ZKNA 4FP2A 5CB7A 4YZ2A 3M1HA 1WBLA 2GN3A 3BOPA 3NV2A 1GNZA 3PVOA 4FQZA 2GNBA 1IKQA 3IMNA 3Q9OA 4Q1RA 5GLVA 1IS3A 1DQ2A 1LGBA 1S0JA 1WD3A 4YG3A 1WD4A 5GZGA 4RA0A 3JUUA 2H0BA 1CR7A 1GLHA 5DG1A 3ILFA 4FPOB 4P9WA 1BJQA 1W6PB 4R9AA 2AGSA 3SH3A 3AYCA 3VKNA 5CAZA 1W6OB 1CVNA 1SLTA 4DS0A 4F83A 3PMEA 1OFSA 3NWKA 3WNXA 2ES3A 5DUVA 2LTNA 1D0HA 1KJRA 3AYDA 3TB0A 4XIOA 3ZSJA 4XXAA 5DZGA 3ZXLA 3I8TA 2DVDA 1V6LA 1AJKA 2ZAAA 1LOFA 3MW2A 4YM3A 1UL9A 2ZBJA 1DYPA 1ZA4A 2ARXA 4AWDA 1FAYA 4Y1VA 5EYYA 5JDBA 4K20A 2EIGA 4ATFA 1N3OA 2KM2A 1F9KA 3RQ0A 5DUWA 3ZSLA 4YM1A 1XQNA 3ILNA 2EF6A 1D2SA 3LSEA 3USUA 3O0VA 2P37A 3M2MA 2WT1A 5GZCA 1HLCA 3ASIA 5DUUA 4Y22B 1ULDA 3OY8A 3FLTA 4Q1PA 1S0GA 1N3QA 4JC1A 4W65A 2CY6A 5IT6A 1SLLA 1DQ4A 3AP5A 1V6OA 3FLPA 4ZXKA 4XE9A 5KXBA 1G9FA 2PHFA 2WSVA 5H9QA 1W0OA 2Z42A 1CPMA 1QDCA 3WG3A 1LHWA 4LBLA 4YLZA 4WVVA 1URXA 1DQ1A 1WUVA 3APBA 1AX1A 3UJQA 1LEDA 2W39A 3D6EA 1DZQA 2PHTA 4Y26A 5IUQA 3AZVA 4UW5A 4C1WA 1DFQA 3AZWA 3GNEA 1SLBA 2D44A 4XIKA 2D3RA 2A6VA 1UZZA 1DHKB 2ZGQA 2E7TA 4H55A 4ASMB 2ZABA 1SBEA 4Q27A 3ZXFA 1WW7A 1B09A 2W08A 3WCRA 1KDKA 3N3HA 4LBKA 1LHUA 3ZSKA 1LHOA 1GNHA 1SBFA 1FATA 4FP3A 1ULGA 3UL2A 3WDWA 1HDKA 2NMOA 1VAMA 1W0PA 3M3EA 2WJSA 4YW4A 1F31A 3AZYA 3OYWB 2ZHNA 3VKLA 1WLWA 1LESA 4YGEA 2A6YA 4FPKA 1ENRA 2PELA 4TYSA 2PHRA 2YMZA 4UW3A 4M3CF 1JBCA 1LODA 1LECA 4XOGA 2ZHMA 2ZGPA 2D6MA 1G9AA 1JW6A 1GYKA 2UURA 2CWSA 1S0BA 2GNDA 1LOGA 3KM5A 3WZ1A 4HANA 4CTEA 1UN1A 1EPWA 5IK4A 1MZ6A 1G9DA 3FLRA 3B01A 1S0FA 1QF3A 3SISA 3AYEA 4FOQA 5DG2A 2OUJA 3U4XA 3O5SA 3L2YA 3MW3A 3V0AB 1MVEA 3A0NA 2EXJA 1UAIA 1V00A 3WDTA 2VW0A 1C1LA 4XJAA 4TZDA 2ZGKA 3QCWA 1QKQA 2GN7A 4AGRA 3AP4A 5KXCA 2WKKA 2D6PA 1X50A 4PCRA 2A75A 4PF5A 3POSA 1KQRA 1DBNA 3IM0A 1IS6A 5HCFA 5JOXA 3IN9A 2TEPA 2DU0A 2DV9A 5IK8A 1CJPA 1NXD1 3SITA 4YGBA 4Y20A 2A3WA 1W6QA 1IOAA 2OVUA 2Q5TA 4AYUA 1A78A 1H30A 4WV8A 1HQLA 5E88A 5LK5A 3SH4A 4YZ4A 3QLQA 1HQWA 2A3YA 1AXYA 3JU9A 1GZWB 2EXHA 1G86A 5T54A 2P3KA 2D43A 4L8QA 3WHUA 4C1XA 2NZ9A 5E8AA 2V73A 1V6KA 2CTVA 1SCRA 1S0CA 2EXKA 2ERFA 4FOYA 4M3CB 3PJQA 1OKQA 1WLCA 4NO4A 1KRIA 2ZGOA 3B00A 4GXLA 4YFZA 1SACA 1AXZA 1KDMA 2ZGTA 4FPLA 5GALA 4M3CE 1LTEA 2ZGSA 4Q26A 4XHBA 2C9AA 5DZEA 5DXDA 1UX6A 5IK7A 1C1FA 5CBLA 2XB6C 2GNMA 4YZ3A 1QOTA 4KBBA 4Y1YA 2NN8A 3VKMA 1Y7BA 1CN1A 2UWBA 1CIWA 4HL0A 3FUQA 4YG6A 3AK0A 2AH2A 3DGTA 2DUQA 1Z78A 3OBRA 4IQPA 3WUCA 2YROA 1Q8VA 4XJ8A 1YRZA 3AJYA 3IPVB 1ENQA 1LJ7A 5GLUA 1CQ9A 4DQAA 4M01A 4P9XA 1S1AA 3M3OA 5JOYA 2ARBA 4FPEA 4XBQA 3ZXKA 3WG2A 1AX2A 2A3XA 4ISQA 2D6OX 4M00A 5L73A 4FOVA 4GWNA 4YM0A 2DYCA 1LOCA 1LULA 3OGGA 3N35A 5F9TA 1GZCA 3RRDA 5JVVA 2ZZJA 1MS5A 3WVJA 2JKBA 3AP9A 3N36A 1AF9A 2FMDA 4GKXA 3B9CA 2D3SA 1MZ5A 2DU1A 2W68A 4YG0A 1LGCA 2A7AA 3V64A 3WLUA 1BQPA 4AVVA 3OPZA 3RS6A 3V0BA 3O0WA 1APNA 4Y1XA 4AGVA 2UWAA 2ZGLA 3WDXA 1G9CA 1W6MB 1W6NA 2GALA 2LALA 2ZMKA 3A4UA 4NOTA 1JOJA
chains in the Genus database with same CATH superfamily
3E5QA 1RUJ3 2JG8B 1Y43B 3MEPA 3AKSA 1SCSA 2YFZA 3LPGA 4RL7A 5JPMB 2WAAA 4UBGA 1V6NA 3QACA 2P3IA 2A5ZA 2WFF2 4P9LA 5DZFA 3O1OA 4RFT0 2PHWA 2BNMA 3AP6A 4WVMA 4J25A 1CPNA 3VBOA 2HYKA 5FXWA 4EN7B 4FPYA 2YBKA 4K8RB 2CL2A 2X10A 4QKFA 4CZSA 1MS3A 3B5LB 4A45A 3OD4A 2Q8DA 4BQ3A 4BQ2A 2GAUA 1MZEA 1ASJ1 1HV0A 1GWKA 5JZGC 1TMF1 4GWMA 2CWMA 1HQNA 1NA1C 4QPIC 5FYIA 2PXJA 5LEKA 1SMVA 5E1RA 5FMBA 1OC1A 3V0AA 3SQOA 1VBD1 2V4VA 1WLDA 3PTRB 4H7MA 3MDPA 3KT7A 2J1AA 4HZFA 5GLWA 3VDBA 4PBOA 2P2KA 4NHXA 1OOPC 5A7WB 4YZ1A 1JYCA 1I3HA 4Q8LA 1UQXA 4YGDA 5BYNA 1ZM1A 2GP5A 5H9PA 1XC6A 3ZXDA 1OVPA 2B9VA 1PVC1 3P1IA 1PM4A 2DTYA 1AXKA 2DFCA 1Q8QA 3D5OA 3EMRA 3UJOA 2EXIA 3M3CA 2FHRA 3UKTA 4MHRA 1NCRC 4QKNA 3JB4C 1HW5A 3ZMNA 1AJOA 3LSDA 4ATEA 4K21A 5IAXA 5IFTA 1S2BA 2BU9A 4XCBA 4WVZA 4B1LA 3IT8A 4LA3A 3JBG3 2D98A 1GANA 2WNUB 3PUIA 1C4RA 1OH3A 1PK6C 3CF6E 1W90A 2VCMA 3AC0A 4DY3A 2R0HA 1W6PA 4FFGA 4XAEA 3K4ZA 1OLMA 1W9TA 1V9U2 2ZGUA 5E89A 3SCHA 1LOBA 2VVEA 3P3PA 3OGVA 3H7JA 3KD4A 3ZYHA 1UY4A 4IV1C 4PI0A 1PGSA 4P9YA 3AMNA 4HVRA 3WX5A 4HBNA 3AJZA 1VRH1 4AFMA 3FHAA 1XNDA 4ARXA 2EIDA 5LB6A 2VBPA 2RS53 3VL9A 3I2DA 5FY9A 2JG8C 1RB8G 3PJYA 3KV6A 5FAXA 2PN5A 1LCLA 5C33A 2R1BA 5AC92 1NLQA 4E8DA 2WYSA 1RUOA 2PAKA 5DUXA 4FPHA 3T4VA 5BNQA 1QEXA 4URAA 1TNFA 4QX0A 5FY5A 1ND3A 3A0KA 1DQ6A 3IPVA 1NX9A 1SZBA 1XJAA 3WQBA 4LO5B 2SLIA 3HVDA 1RUH2 3K51A 4GZ9A 2V5DA 2EAAA 1EAH2 1BXHA 3UKVA 5F3EA 5ABJA 4XQDA 4OYUA 5I93A 1PO12 2BYVE 1PMIA 2Y0OA 5KHKA 1W9FA 4YW3A 2VMCA 2WS93 2NLRA 1MS4A 2XOMA 3ON7A 1LENA 2QTWB 3I2HA 3NNMA 1IQAA 5DDJ1 3ZSEA 1UY2A 2R073 1GUIA 4MX3A 4QWNA 3WG4A 4BLIA 4Y20B 2ILMA 3PHMA 3GZTB 2GNTA 2YV8A 3L9JT 2QKDA 2AREA 2RDSA 5C9AA 1OPOA 1I9RA 3LEIA 3KMHA 3OJBA 2HWC3 3PVEA 3W9AA 1D4M3 5CU1A 4C0HA 4J6GA 2XONA 3N7JA 4HKWA 4MLOA 2Q1FA 4UI9L 3W5NA 3K46A 4XEZA 4QU1A 5JMOA 1PX4A 2QQLA 4CP9A 4JGYB 5KHIA 4EROA 3ZYPA 1LOEA 2J42A 5FMOS 1S0EA 2WNUC 3T30A 2EIEA 1RUI1 3DEMA 3AKPA 4UF0B 3ZDSA 1UYZA 2R7EB 3WG1A 1TMF2 2VZTA 3LIHA 4XFGA 3RZMA 2YXSA 1BMV1 1K45A 4XFIA 1FMD1 1FPN1 4NHMA 1W2TA 2WN2A 4JDOA 1VBD2 3B69A 4I0WB 1AR93 4BLJA 3I59A 5FOJB 1MQTC 3VHRA 4FAHA 1DLLA 1ZBE3 4OULA 3AZZA 2BOJA 5BNOA 2VW1A 1VBA2 1OA2A 1ODNA 4AGGA 2X5IB 5CFDB 1VIWB 2IXLA 3AYAA 3CKHA 5JMCA 1PVXA 4FCAA 3DV8A 1H9PA 1PVC2 1W99A 3MGUA 4LBQD 1H6YA 3GCWA 4SLIA 1FNYA 5F6KA 2I45A 2VOWA 1XNCA 5TSWA 1ZYBA 5JLVA 3PDQA 4LTAA 3F2ZA 2ZMLA 2BERA 2XLFA 3OUHA 2TUNA 2JEMA 4TWTA 1BKZA 1US3A 3BUCA 3EO6A 5FXVA 4LIVA 4X6QB 1J1TA 3H9AA 3UETA 4B4RA 1X8EA 3AX4A 4FPCA 1OSGA 4CP0A 4CEWA 1G6NA 3GBWA 4OHZA 1IZ3A 2VE1A 2WSUA 1R091 2CYFA 1JN2P 2ORZA 4QKDA 1OKOA 2B45X 2IXKA 4DY5A 1OI6A 1XNTA 3IBMA 4CRQA 2WO1A 3P5BA 2LM3A 5ISLA 1OT5A 2WFF3 2YGMA 3B3QE 1LAJA 3HQUA 3KHBA 2UYBA 3AP7A 3CJIA 3PU3A 4OI2A 2FDIA 2ZGNA 2ADEA 2DUOA 4XABA 4A41A 1RHI1 1Q8PA 4PI2A 2E31A 3MV11 5FPAA 3U11A 2AUYA 1JZ4A 4NN0A 4LNVA 3U0ZA 4YW5A 2K2SA 3PUHA 5B4NA 4P14A 4CXXA 3POBA 2GMMA 5FZBA 4M3CA 2EA7A 3W59A 1Y4WA 4DZGA 3IAQA 2Y8KA 1JZ2A 3N4MA 4PDWB 1EPZA 2WO2A 2WZEA 4JKKA 4Y4YA 2BNNA 1ZRDA 4DXRA 3KQRA 2RG4A 4RQPA 5A80A 1PGL1 5LRSA 4OLLA 2JD4A 4YRDA 2VXRA 1O3QA 1N1SA 5FUPA 2VUDA 2RR11 5DDJ2 3GZAA 3ZXJA 4PHZA 2GDFA 3WQ7A 4JCKA 1LB2A 4NHKA 4EWEA 4XTPA 1A34A 3C7FA 3LEGA 5BUVA 3LZZA 1JZ7A 2V5YA 3NVCA 1CAXB 2DVAA 1RINA 3NNGA 2X5IC 4O9EA 1AVBA 1DQ0A 1AZDA 1DGLA 1WA4A 2B9UA 2FBEA 2VMHA 2PFWA 3M1HA 1WBLA 4YZ2A 4RN5A 3PVOA 4FQZA 4WM8B 3RZKA 2GNBA 1IKQA 3IMNA 4Q1RA 1CAUA 5C70A 3VN4A 4YSFA 3VD3A 1NCRA 1RUNA 2Q4SA 5BNPB 4BQ4A 5GZGA 1V9U3 2WA4A 3ZFFC 4QDQA 4N43A 1GLHA 1LR5A 1YFYA 4QD2A 1RUI2 1BJQA 1BK0A 4R9AA 4CDXB 5A3TA 5JUVA 1PK6A 1CVNA 4DS0A 3PMEA 4XURA 1OFSA 3C3VA 4QMAA 5CZKA 4IEOA 3KQ4B 2ES3A 3RDIA 3TYJA 1VBE1 2XJVA 1HXS2 4JTOA 1AR71 4IE4A 3U4SA 3AYDA 4XIOA 1WLTA 1S4CA 4XXAA 4ZU7A 3LB9A 5AC93 3I8TA 3JB8A 4BDVB 1E57A 4Y4RA 2KXLA 1KFXL 1CGPA 3TEZA 2W5FA 2ZBJA 1ZA4A 1CAVA 4AWDA 1XE8A 5FZ8A 2W9XA 4A7ZA 2XUEA 2JG8A 5CFCA 4AEDA 2EIGA 1N3OA 1RUH3 2HBTA 3AMQA 1EAH3 1PO13 1D2SA 3LSEA 3AL6A 3O0VA 4OI1A 3USUA 4YVWB 1HLCA 2WUHA 2EICA 5DUUA 4Y22B 2XBO1 5LWBA 2XQXA 3BI3A 3OCPA 3NJVA 1N3QA 3BU0A 3NSTA 3I3DA 1NZIA 4NUBA 1SLLA 4PDWC 3FLPA 3GYDA 2JIGA 3MF6A 4IL7A 2P5BA 4LMFA 4XE9A 2WWJA 2ZAHA 3SEPA 4CCNA 5F6LB 1W0OA 2Z42A 4HN1A 1PNFA 1S2KA 3KLSA 2BP6A 4AFAA 3HT1A 4IEZA 5J96B 1PIV2 1JYNA 1DQ1A 4Q4V1 3DN7A 3AMHA 2K9ZA 3B93A 1X82A 4QXBA 3UJQA 1GMMA 3ZYIB 1UPIA 4LHSA 4B3NA 2CV6A 2GP3A 4XDOA 3IIIA 1VBC1 2BWCA 4QGNA 2D44A 2O8QA 2F17A 3BTYA 1SFPA 3PIJA 4WM8C 4AHXA 1RGSA 1SBEA 4KL1A 4OUMA 4Q27A 5FZAA 4E2QA 4CPBA 1O5LA 1TMF3 5T3NA 2J1TA 3WNKA 3NNFA 3MLJA 4LBKA 2J22A 3AB0A 4AI2A 3QBQA 1SBFA 1VBD3 1DGRN 1HN0A 1ULGA 3CZUA 3M70A 4GMP1 3UL2A 3WDWA 4CDXC 1KS4A 2VUJA 4PIYA 1VAMA 5FYHA 5BPXA 5HCHA 4F8AA 2XH6A 2BUKA 3WF0A 1JU3A 1ZRRA 1QJY2 4COVA 1VBA3 4I2OA 1COV1 4Y5SA 2A6YA 4FPKA 3WNLA 5FJKA 3RYKA 2YMZA 1PVC3 4M3CF 1E5SA 1UF2C 2CSGA 4WVMB 4XOGA 2ZGPA 5FOBB 4META 3VBOB 3U75A 5LK7B 3VD9A 2CWSA 1QH6A 4HSLA 1S0BA 4MSVA 3GCXA 1YQ6A 1RUG1 3WZ1A 4HK9A 4CCLA 1UN1A 4QQOA 4CTEA 5IK4A 1MZ6A 3WEZA 4CP1A 3FLRA 4M0NA 1S0FA 4AI0A 2ETEA 5DG2A 2BVBA 1DZTA 2TNFA 3U10A 2QQPA 3C7OA 3L2YA 4YVWC 3V0AB 2EXJA 2RVAA 3VHOA 4L0PA 3POGA 1UAIA 3WT3A 2E33A 3WXPA 3WDTA 2VW0A 1C1LA 1RJ7A 4QAWA 3QCWA 1WMXA 2WL1A 4TZDA 3KCYA 4AGRA 1VBE2 4MVTA 5KXCA 1J1LA 2IXIA 3J7HA 1AR72 3GZEA 4FAGA 1NCQC 2A75A 4IUGA 5HCFA 4OFGA 2J1VA 2Z5WA 5JOXA 3HNMA 4QGLA 4WM7B 5FZ0A 2I07B 3K77A 1EP0A 4MGSA 2W1SA 4YGBA 4Y20A 3LWCA 2OVUA 4AYUA 3I3MA 4HXCA 1A78A 5BNNC 1HQLA 5IATA 4UAPA 1IHMA 3QLQA 4YYOA 1HQWA 2A3YA 3VZKA 1ODMA 2ARCA 4C1XA 2ZEXA 3D0SA 2NZ9A 2Y0IA 3C7EA 3U78A 2RE9A 5D8AA 3VZMA 1OURA 5F32A 1WLCA 3MI8A 5FZGA 1KRIA 2ZGOA 4JGYA 2HEYF 1O3TA 5JIUA 1NAEA 1C8NA 5GALA 2VD7A 3U14A 5FR3A 4LT5A 4H14A 5DDJ3 5DXDA 4KWKA 4RGAA 2R30A 4UF0A 1NLRA 2GNMA 1QOTA 2YBPA 4OUEA 4Y1YA 4IE7A 5FPVA 3ES4A 4D7SA 1CN1A 4MGQA 1Z7S2 2BJSA 2O8OA 4IERA 4JTNA 4O7XA 3NNLA 2AH2A 2R6QA 1CX1A 2DUQA 4J1XA 1Z78A 3OBRA 4Y3OA 3IPVB 3LD8A 1ENQA 2GU9A 5CFDA 3VBOC 1W8OA 4NROA 4DQAA 4W65A 4B29A 1ZZBA 3JQWA 1GOFA 4EN8B 1RUI3 1HRV1 2ARBA 3ZXKA 1AX2A 4UFMA 2OZJA 5FZOB 4FFIA 4S2DA 3WR0A 4ISQA 4BJ0A 3AL5A 3LPFA 5C4WA 4AFBA 2RMU1 2DYCA 1LOCA 3E5XA 1LULA 2BOIA 1HXS3 4RR3B 1W8TA 2ZPXA 5JVVA 4N9IA 4MV2A 2MEV1 1YQ5A 3SMHA 3TOJA 2JKBA 3AP9A 3ZKUA 2QFEA 2QCSB 1COV2 2VAUA 1MZ5A 4Z07A 2LRPA 1NYWA 1L3JA 2GSYA 5C9AB 3POJA 5C3PA 3RS6A 2XQRA 4QPGA 4AGVA 3TNPB 2UWAA 2ZGLA 3HNBM 2QQJA 3M7AA 4P9GA 4ZKTB 1W8FA 3WP6A 5DAQA 3M3IA 2HEWF 1DQ5A 3FUOA 5FLHA 1WCDJ 2G1MA 5IVEA 5L9VA 3NJYA 4NHYA 4NHLA 4S2HA 5L7OB 5IWFA 1SQ4A 5T55A 3EHKA 2NYYA 3GGLA 4XFBA 2RDRA 2CU5A 5FBJA 4C0BA 5EQUA 1EV11 3OBTA 1H4GA 1DYOA 1V6MA 1J83A 2Z79A 4LE4A 1WMDA 4Q0QA 4XMIA 5CADA 3OY8B 4CCMA 1G9BA 2R1DA 4FQ4A 2YUEA 2OW4A 2K46A 1MR5A 4XFCA 2HWE1 1PIV3 2B46X 2MPFA 2NM1A 4PDWA 4N7IA 5GLTA 4W6WA 5FZ7A 5CG8A 1YFWA 3S7IA 1VE0A 4HVQA 4Z82A 4XTMA 1H6XA 4JZRA 4KG0A 4E4SA 5FO9B 1RC6A 3ZFGB 4XUTA 3VLBB 3ZYRA 4EZHA 3GZUC 3VHPA 1IG0A 3OUJA 1ND3C 3ZXEA 1CAXA 5I8TA 2DBIA 2UY9A 4XF9A 4AE2A 5IK5A 5LASA 2QJVA 1W39A 3GALA 3ZN4A 4LO7A 3IIAA 3TNQA 1CX4A 1NE6A 2WZ8A 1U12A 1ULEA 4CEWB 3D82A 3N9PA 3WNPA 3T08A 4BQYA 4XF1A 5J36A 2YZ4A 1U0AA 1DIWA 4DFSA 5LW9A 1QJY3 3BPSA 3H0OA 4HN0A 3BVCA 4COZA 5BNPA 4V2VA 3NAPA 2NP0A 4RR3C 5EWSA 3VL8A 2DVFA 2ET7A 4D69A 3ZMOA 1QWRA 5FZ6A 2HWF1 3A23A 3JZVA 4DRVA 2JECA 4MHUA 2G9GA 2OUHA 2Y6HA 2AENA 3MFCA 1LHVA 5K9YA 5T5PA 5C9AC 5DAPA 2VM9A 2PA7A 3NKTA 2W2IA 1W8UA 1NY71 3NV3A 4R9BA 4R52A 1IPSA 2A6XA 1RMU1 1Q8OA 1UOJA 3LDBA 5GKAC 3RWNA 2FZ2A 4YPJA 1AYN2 2W92A 2VCBA 1GZTA 3BN6A 3C2UA 4IEVA 3VV1A 1E5RA 1FNZA 3OB8A 1BZWA 1TE1B 1F5JA 4BQWA 2PHUA 2HWD1 1HRV2 2PHXA 2XKOA 3HOBA 1QXRA 4GIQA 3ZR5A 2DVBA 5F3CA 1JHNA 1HB1A 4E4DX 3ZPYA 1O4YA 4X8PA 2IZWA 3T3YA 3WF3A 1S0DA 1VBE3 1PGW2 4JHZA 4URTA 2YC0A 1AR73 4YVWA 5LA0A 3Q8FA 1W9WA 1LOAA 5JXHA 4ITCA 2A71A 5JWPA 4Y22A 3TBDA 1MZFA 3CEWA 4KU7A 1YC61 2MEV2 1QHDA 2EALA 3WP5A 1J3RA 4AK3A 3WDYA 3OF1A 4UFJA 3SLIA 5BNOC 1NG0A 3T1LA 1UU6A 1XXNA 1A6CA 4CDUB 2I74A 1JUIA 4EWAA 1C28A 4CDQB 3LEKA 1W2OA 3KGZA 2SBAA 2WINB 4UFLA 1CAUB 1RVF1 1XSQA 2A73B 3AMPA 5FRAA 4OMDA 4XDQA 2WO3A 1GWLA 4BIFA 1PZ9A 3EQEA 2BPA2 1UNBA 3EB7A 2FQPA 3WNNA 4JGZB 3ACLA 1KJLA 4HKLA 4HLTA 3MIFA 2DCTA 2G4IA 4GALA 4RS5B 1TME1 1W6MA 4Z8BA 2ZX3A 1NLSA 4CUGA 5H9RA 4CCCA 3BTXA 1NQJA 1W8NA 5JPNB 4KWJA 4CEWC 1JYWA 5IVVA 2G9FA 1TEIA 1V6JA 4M0HA 2CGOA 3POFA 3VGIA 4NR1A 5A7SA 1MS9A 1VAVA 3R6SA 1H1AA 4LBOA 1JYVA 5T5JA 4GH4B 1Z7S3 2Q8OA 1RXFA 1XNKA 5LA1A 4OI0A 4M4PA 5LY1A 4LE3A 4BU2A 4LBJA 2WLQA 4NIAA 3CJIC 3LEMA 5CFCB 3I2KA 4AEDB 5C8CB 4XBNA 1YFUA 2BGOA 1QJU1 2VUAA 2D5FA 4MH0E 5H9SA 4AQSA 4FTBA 2E6VA 5FXXA 5LZ6A 4ZS2A 3VKFC 1ONAA 4UFIA 3USUB 2ZHLA 4YM2A 4L9BA 2D40A 2R061 2HWB1 3FJSA 3R4SA 4HFSA 5IW0A 1AX0A 4QKBA 2IVIB 2WT2A 1JZ6A 4GMP3 3AXEA 4XF3A 2Y6GA 2P6CA 4K1YA 3ACHA 2YDEA 2IXCA 3A7QA 1JYXA 2WLPA 2XVGA 1OF4A 1UMZA 4RQPC 5FPZA 3OTFA 2KR2A 3CU7A 5ACA2 4K8FA 3MBWA 3KSCA 1W8WA 4FPFA 4BM8A 2XVKA 5HCAA 1COV3 1R1ZA 2HH9A 2D97A 4K7JA 1O91A 2R49A 5A3LA 1YIFA 2W91A 2IFRA 3POEA 1W06A 3INAA 4B7KA 4AZZA 5C3QA 4QHOA 4DOUA 1O4ZA 4N90A 4AOCA 2AYHA 3CHXA 2A6WA 2Y33A 2VZRA 4EWDA 4LQRA 2OQ7A 4AI9A 4CDUC 5FXZA 2E51A 1WW4A 1GOGA 1NY72 3A22A 3WNMA 4XVHA 4BIOA 1RMU2 4WM7A 1MEC1 3ACIA 3ZO0B 5FP3A 4BOWA 3RYPA 3V56A 2ZEWA 3LF7A 4W6YA 1OMIA 5FK7A 4Q2FA 2IVJA 2WDBA 1HIXA 1KITA 3ZVXA 2YU1A 5IAVA 3I4IA 1OF3A 4K40A 1AYM1 2HWD2 2H6CA 2J1EA 3C7GA 4JGZC 4N43C 1IKPA 2VULA 3GJAA 1HN1A 3WOGA 4AF9A 2NMNA 4RS5C 4AAXA 1Z0HA 2JB8A 2DVGA 5EJ1B 5KHHA 3J8F2 4IGOA 4HG6B 5JOWA 2JG9A 4G3YC 4QX1A 4KGQA 1AR61 5LBFA 5GZDA 4XXPA 4GA9A 4LEJA 4YW1A 3S5AA 4CU6A 2VY0A 1W3VA 1AL0G 4U36A 3LOIA 5EPAA 5T5OA 1X7NA 3O1PA 3N9QA 3NV1A 1XYNA 1UOBA 2WFPA 3P3NA 4YW2A 4AR2A 2R0FA 3KT1A 3M8LA 2XJPA 4AG4A 4AVTA 1UZYA 1W8ZA 1OQDA 5GLZA 5CFCC 3T0DA 5F5QA 4RD7A 4TSVA 4G9SB 4BMBA 4AEDC 5C8CC 1N1YA 1GBGA 1RVF2 1UMIA 4LJHA 5F5CA 2ORXA 2WABA 4XBLA 4H7LA 1RUE1 3OGRA 2X53S 3HMYA 4XMAA 3WCSA 3JD72 4FP2A 5C3SA 3BOPA 2JDMA 2JD9A 3J26N 1GNZA 5FZKA 3M4FA 2XL7A 1TME2 4RGGA 1QH7A 2XJUA 3KCXA 5EJZB 1DQ2A 1LGBA 4I09A 4YG3A 4YFZA 3ZLIA 1O3RA 5FZOA 2VOVA 3ILFA 4P9WA 3OOXA 4CUCA 1OLQA 3AYCA 1U5YA 1W6OB 2PTMA 3EJKA 2FMYA 2EIBA 4F83A 2GC1A 5FO7B 4RR3A 3VBSB 3WNXA 1M06G 4LHNA 3BALA 2XR4A 1PO21 1QJZA 1RUF1 4QGMA 1AYN3 2BFUL 2JWPA 4HONA 4UBHA 4AHYA 1QJU2 5LBBA 1XU1A 2ZCWA 3AVSA 1AJKA 2ZAAA 1OVSA 3WP3A 1R1A1 2V09A 3LKJA 4PQQA 1HRV3 4A7KA 5D8AB 5IVFA 4FSJA 2R062 1F8VA 2ARXA 3DECA 5FYMA 2VNOA 2YC2A 1OA4A 4K20A 2IXJA 2RS11 4OI4A 2JE8A 2XWJB 5DUWA 1K5JA 4A4AA 5L7OA 2RM21 5EJ3A 1TG7A 1ZVFA 1ASJ2 1VP6A 2MEV3 3B7MA 5GZCA 4FT8A 3ASIA 4P00B 2VZPA 1SFNA 3CIHA 1O7FA 3FLTA 3OY8A 2XJRA 4AAPA 1S0GA 4JC1A 2HBUA 2ZXQA 1W2NA 2QBXA 3TWIA 1DQ4A 4ZXKA 1AUYA 4Y33A 5H9QA 1CPMA 4F3JA 5C8WA 4YWAA 1LHWA 3RGBA 3E6BA 4LBLA 2C6SA 1NUKA 3APBA 5AVPA 1C3HA 3VB9A 4GWIA 4GAZA 4QXKA 1GP4A 4TLFA 4JQTA 4LOTA 5DQ0A 2YU2A 3AZVA 5BV6A 3GBGA 4UW5A 3MIGA 2VMGA 3ZDVA 3H8OA 3Q8BA 1DFQA 2JDPA 4ZY9A 4KU8A 5C4WB 4LORA 3AFGA 4YW6A 1H2NA 1W8HA 2ZABA 4J1WA 4IXLA 1JH5A 1E5HA 2OKXA 1B09A 1RUD1 4ASKA 2WQ4A 4PIZA 3WCRA 1UO9A 3ZYGA 2QE3A 1AR62 3VZNA 3ZSKA 1LHOA 1POV3 3DXTA 3KHCA 1GNHA 4FP3A 2VZSA 4Q4W1 4QPGB 1YQ8A 2NMOA 1W0PA 3M3EA 1K42A 2WJSA 1OA3A 1VRH2 2ZHNA 3KT4A 3GHMA 3JQXA 1WLWA 4YGEA 4IEUA 1H8TB 1ENRA 1JTZX 1Q43A 3DXUA 4TYSA 2IFWA 4TTGA 1AL21 3UYJA 2BWAA 4NVPA 1LODA 1D4VB 4LKFA 2FDGA 5D8AC 1RUE2 5G04L 1G9AA 1JW6A 4MGZE 3AKRA 2J1RA 3I2IA 4NJ4A 3KM5A 5ACA3 4JGYC 1JU4A 1EPWA 1TVGA 4K6BA 1OUXA 2RJKA 4KBZA 1GP6A 4IW3A 3B01A 5E6HA 5FYZA 3AYEA 1H2KA 2UY8A 3RNSA 1ALYA 3OEBA 4AEJA 5FDBA 4LLFA 5DABA 4BISA 1D7PM 4FFHA 1DGWX 5D2AA 3AKTA 4W6XA 1QKQA 4XW3A 4CXWA 3AP4A 1RMU3 1E5IA 4NPMA 2D6PA 4ZZ5A 5A3OA 2ARAA 3EXUA 5CFDC 1KQRA 4CDUA 5J48A 3N9NA 1R1A2 4CDQA 2HWD3 2VNGA 1B35B 4AFCA 3SITA 5A3MA 3DF0A 5FWEA 2O0OA 3GXUA 5E88A 3SH4A 1ZZCA 3J8F3 3KVAA 4YZ4A 2WZR1 4W8JA 4OHYA 1AXYA 5T54A 5C4WC 2D43A 2RS12 3NAPB 3ECQA 5E8AA 4JGZA 2CTVA 1YUDA 2EXKA 1S0CA 2OIIA 3E1F1 2W94A 3J7NA 4N9HA 4HKOA 4RS5A 4WZCA 4XQWA 3OEAA 5SV5A 1Q3EA 1CAWA 3VBUB 5CEHA 1BMV2 3B00A 3WSOA 1FMD2 1FPN2 2VZUA 1SACA 5FFOC 4OQ9A 3WF1A 4B7EA 2V4AA 1AXZA 1KDMA 2ZGTA 4FPLA 3O1SA 4XHBA 2C9AA 1ULOA 3ACGA 1POQA 4QPGC 5IK7A 3KVBA 4YZ3A 4GH4A 3S57A 1RVF3 2NN8A 4MXWA 3VKMA 1QJX1 3RVHA 2Y38A 2DDUA 1CD3G 5FZ3A 4AW7A 2Q8EA 2XHNA 3JD73 3WW4A 4QPWA 3X29B 1TNRA 3DGTA 4DIQA 5C8CA 1TME3 3OBZA 3HN3A 1F4HA 3VDAA 4M01A 2VTFA 1REEA 1YJKA 4P9XA 3G6JB 3ZYBA 4COWA 4NAMA 5FMOL 4FPEA 4RYDA 4B4PA 3K4AA 4I0AA 2CGPA 3ITQA 4AVCA 4JX0A 3RJ2X 1JOBA 5CKMA 2RJLA 3CL1A 2VVDA 5F39A 1R092 4Q4W2 3RRDA 3I2OA 2WR9A 3TEXA 4EN9B 2GC3A 3MICA 5F5IA 3K48A 1QJU3 1MS5A 3SKVA 5HPOA 4LO4B 3IDAA 5DMYA 1VBB1 1CZSA 3DPRA 2D3SA 4L99A 4QQPA 3V64A 3WLUA 4CXYA 1H1MA 2R063 3OPZA 1K3IA 5FCCA 1J59A 3SEEA 5FUNA 1AL22 5I8SA 1RHI2 4N53A 3WDXA 1ZA7A 1W6MB 2HKXA 2YROA 2LALA 4GQ7A 1VMHA 2XMLA 3OYWA 4XJAA 5FMCA 2ZX0A 3ROUA 3NNJA 4AVBA 1PMJX 3IKWA 1UZVA 2LS6A 3THCA 1YEWA 1ASJ3 2XJTA 4Y5Z0 1WW6A 3ENRA 4FBFA 5FY8A 5EXOA 4E8CA 3WDUA 5BNPC 4NAOA 3NAPC 4MGKE 1PX3A 4XYXA 3WY6A 2ZS6B 4COYA 2XKPA 3DUIA 3HN1A 4R4ZA 1SFYA 1SBDA 3ZKYA 3I3BA 1PGL2 4HSJA 3ZN6A 1PZ8A 1NKGA 1ZZ7A 3MUZ1 4XC9A 1QQP1 1UXZA 4ZXEA 3SC7X 3O12A 4MYEA 2RR12 3CJXA 4G4FA 1YNAA 3BU7A 3IMMA 5FMDA 3HBKA 4DUWA 3J7LA 4K1ZA 4DINB 4LBMA 2AZ5A 1XBFA 2YHJA 3MFAA 4UFHA 4XUNA 3FBMA 2DCJA 1GZ9A 2I2SA 3EYPA 1LHNA 5FZLA 4U2AA 2XG3A 3FZ3A 4YFWA 3I2JA 3SCFA 2C26A 2ZEZA 3NL1A 4PT6A 2VQTA 2X29A 5FZHA 5K0UA 1AR63 5F37A 5HI0A 2P3JA 2BV4A 2DWRA 2YY1A 2CHHA 1VRBA 1H9WA 1DG6A 4D6QA 3PL0A 1OLRA 3LDRA 1VRH3 3DL3A 1J3PA 1F4AA 2C4XA 1ZRIA 3WF4A 4HVOA 3R0RA 3VKOA 1V70A 4HETA 2BEOA 4OMCA 4R9DA 1GSLA 1AR81 1VLNA 3ZM8A 1W6OA 3WDVA 1QJX2 2VMIA 2ZGRA 4JDNA 5FP8A 4XJUA 3VBSA 4IE0A 4E2SA 5GJ6A 1RUE3 4FVVA 1BHGA 3AVRA 3LIGA 3WW1A 2WNVA 3JBG1 5A70A 3MPBA 4O61A 1W9SA 2UU8A 5FZ4A 4IDZA 2R041 5M0TA 2OXBA 4CU7A 1LRHA 2JG9B 4MGTA 3D3AA 5C5UA 1C8M1 5KXDA 2C1FA 1WW5A 5LA2A 3VZOA 3WHTA 1VAKA 1CESA 2XBO2 2BRTA 4MOAA 3ZSMA 3KV4A 3WF2A 2HYXA 1UY3A 5IHRA 5FYTA 4NIHA 2E7AA 1LEMA 3T4HB 4XFFA 3L2HA 4MADA 3VZLA 4Q8KA 5I91A 3H8XA 2RS51 4KGGA 1ZBA1 4B4QA 3USSA 3CMGA 1OXCA 1BYHA 3KGLA 3BODA 3NV4A 4Q4V2 1QIQA 2KA3A 4A42A 4YARA 5K7PA 1VBB2 1XPWA 1ENSA 1R1A3 3TN91 4XPVA 2H6BA 1D0GA 1RUC1 4B1MA 5FO8B 5FYVA 5CNAA 1OH4A 3OG2A 4R8HA 5IVYA 1VBC2 2IUWA 2VU9A 3S7EA 5CKQA 1UYYA 2E53A 1D2QA 1NE4A 3ZFEB 4CE8A 2VG9A 5C71A 1PHMA 2YBSA 5FWJA 5C6CA 2PAMA 2RS13 3FL7A 5I8YA 3PUSA 2FCTA 2WC2A 2VVFA 3FMGA 3Q8AA 4IESA 4UFKA 3BOWA 4QX8A 3SCGA 3BTZA 1W03A 2VQAA 2VMEA 3CO2A 4QXCA 4YZ5A 3EBRA 1GKBA 2WS91 5FP9A 3WUDA 5FYCA 1DGRA 1FMD3 1FPN3 2Y6FA 1IPKA 1FV3A 2P6HA 5FYSA 1F35A 3NQHA 4D7TA 3ZYJB 4PQ9A 2AR6A 3AXDA 3K75B 4Q4Y1 4ES9A 2JE7A 2ZKLA 1QQP2 3BIWE 3CQOA 4I30A 4V2WA 3RSJA 3HJRA 5J98B 3H3ZA 3KZ4C 1I1EA 3ETPA 2J1UA 5FK8A 5I0TA 4DRRA 4WM7C 1FT9A 2XLAA 4D94A 1LGNA 2UWCA 2WT0A 4DEVA 1FX5A 3T2TA 1H8TA 4D0QA 3PVNA 1RUG2 4YGCA 4R4XA 2WRAA 4QPYA 5A32B 1JODA 4QHZA 1YXWA 1SLCA 2VZ1A 2VO5A 3U1XA 4IEXA 2BNOA 2Q1MA 5A6QA 2JG9C 5FQ0A 2GMPA 1VR3A 5SV8A 4SBVA 4W50A 3R05A 2JDAA 2JX9A 1YJLA 2QQMA 3CBNA 5F2SA 1R093 1AR91 3OBAA 4GB31 1FV2A 1QDOA 1X9TA 4LBQA 4LHLA 2C0ZA 2WNEA 5J3UA 2ZX2A 4YVSB 3I49A 4KQ7A 1O4TA 5L19A 1ZBE1 4IE5A 1Q8SA 3BTAA 3ACFA 4XACA 3AMMA 4O9GA 4V1PA 4XZPA 2ZA9A 1LU1A 1X33A 2VGDA 1MS0A 1XNAA 3H7YA 2VH9A 3N7LA 2WBKA 3PURA 1QXJA 2PYTA 4ZU5A 5FZFA 4COUA 5A6YA 4FTEA 1JYTA 1SEFA 1AR82 3NKGA 1AL23 1K5MA 4BQ1A 2CNAA 4AL9A 4D8MA 1RHI3 3C8XA 3OUIA 1UKRA 3UK9A 4LUMA 5FP7A 1CZTA 4BZ4A 1ZREA 1IS4A 3QH7A 5IVBA 3AZXA 2JDKA 4DXZA 4BK4A 2OA2A 5K8SA 4A7YA 4QT6A 2IXHA 1Q56A 3IDEA 1LU2A 2W3JA 1W2UA 1BBT1 1X36A 2JE9A 3OPTA 2R042 3HEIA 3MW4A 4NPRA 2OYZA 3B9IA 1B35A 4H3WA 5FY1A 3O0XA 4XJ9A 1N47A 1WBFA 1C8M2 4OCTA 4CCEA 4NPLA 4WVWA 3UESA 1XE0A 5GZFA 2VZ3A 4BHPA 2A70A 3Q8EA 1QNWA 3TAYA 1P8JA 2RR13 1ZZ9A 1CZVA 2D6KA 2D5HA 1OQ1A 4WZFA 3VBUA 3IB3A 1US2A 2R16A 1ZBA2 2ZGMA 2ZOEB 4I3GA 1IS5A 5F3GA 1XSRA 1R081 2D6NA 4FI9A 1OD3A 4IEPA 3MLLA 3TN92 4UW6A 3ALQA 2XXZA 4UW4A 1XYPA 1QY4A 1QOOA 1RUC2 2Z69A 4TLGA 5DPNA 4CUBA 5KR7A 4CDWB 2QZ2A 4RGKA 3D8CA 3LAGA 3T1MA 2E7QA 1RL3A 5A3UA 5FREA 5L7OC 3ZPOA 1OFNA 3E97A 3N7MA 1PZ7A 3PTYA 4QB1A 4PIXA 5FKBA 1SHWB 3O14A 5HCBA 5CB7A 3NV2A 4F7ZA 2W95A 2RMU2 4LXLA 3ZFGC 3ZXAC 3LGRA 3Q9OA 4CP2A 5GLVA 1IS3A 3N9LA 3T2OA 1BVVA 1S0JA 4JKLA 4Q0SA 4Q4Y2 4L97A 5L9RA 3BB6A 4YVSC 2Q8CA 4Q5OA 3GBFA 4RA0A 3RZZA 4QU2A 1I5PA 3LA2A 3H1MA 2BGPA 1QJX3 2XL9A 4FPOB 2BDRA 3TEWA 3VKNA 1KEXA 2AGSA 3KV9A 5CAZA 4JV4A 4OHXA 4OHWA 4XF4A 2QQNA 1SLTA 4K3UA 5G05L 3H1YA 4QQHA 3NWKA 5A33A 2VPVA 2WO7A 4K9SA 1OLME 3I3QA 5A1LA 1DDLA 4CCJA 5KC6A 3IZOA 1D0HA 5FPLA 4AHWA 1NA1B 5FPBA 3TB0A 3UKNA 5KHJA 1UW8A 1UU5A 3ZXLA 3RZLA 2PMWB 1V9U1 4YW7A 1O5UA 1LOFA 5A7OA 4YM3A 2P3YA 2VBBA 2XJSA 2XBO3 1UZ0A 2CGNA 3PMSA 1CAWB 2ET1A 1EV12 4LK6A 3VBFA 1S55A 1UY1A 5EYYA 1XB9A 5JDBA 4ATFA 4BK5A 2YPJA 2KM2A 4GB32 1OD5A 4QX5A 3RQ0A 1WCQA 4XCAA 4LIUA 4YM1A 3UT0A 3ZSLA 4A3ZA 2HWE2 1O8SA 2EF6A 4JKMA 3VDDB 4DUVA 4Q4V3 2P37A 4MXWB 2QQKA 1VBB3 4AQTA 3VBRB 4Q1PA 5I0UA 4XAAA 2P17A 4PLMA 1VBC3 2CY6A 2QZ3A 1STMA 3PU8A 1QJFA 5KXBA 4HOOA 3G7DA 2VZOA 2PHFA 2YG0A 1MPXA 2AACA 1QDCA 1RUH1 2VECA 1EAH1 4WVVA 1PO11 4XQ4A 5A3PA 1WUVA 1AX1A 3KWVA 4LUKA 4S2GA 3GDBA 2DCKA 2QQWA 3D6EA 3ORJA 2WZPP 3URFA 2RV9A 3K3NA 4AEKA 4QB2A 5DAVA 4ASLA 3RWKX 4IV3A 4JDMA 1CWPA 4IGPA 2TBVA 4AFDA 4X8NA 4C1WA 3MIBA 1OHFA 1FOD1 2HLEA 4LK7A 3AZWA 5LBCA 3GNEA 4WBBA 4XIKA 2JDHA 2O1QA 4CPBD 2A6VA 1QQP3 1DHKB 1UZZA 2E7TA 4H55A 2JKXA 3IDBB 4ASMB 2F4LA 4P02B 1JZ8A 2ADDA 3N9MA 4A3XA 1K12A 4KI5M 2HWF2 2VCAA 3DPRB 4CSWA 1LHUA 3BIEA 2FDFA 2WAOA 1R082 1FATA 3UGGA 1HDKA 2RDQA 5KC5A 4N53B 3DYPA 4Q4W3 1F31A 3HPNA 3AZYA 2X09A 3OYWB 5EZWA 4CDQC 3VKLA 1RUG3 3J7MA 4OQ8A 2XDVA 2XVLA 4ZU4A 3T09A 3VD4A 4JVAA 2BGCA 4P5YA 2AC1A 2Y60A 2PELA 3POIA 2PHRA 5FIXA 4UW3A 1V0AA 1XU2A 1YLLA 4TXWA 5FYBA 5A6ZA 1WKYA 5J7MA 1UOFA 4PLNA 3ZX7A 1ZNPA 3MF9A 5FY4A 3I54A 4XDPA 1GYKA 1GP5A 3ZN6B 2GNDA 1HB3A 1Q5OA 3H3UA 5DAXA 3U07A 5CYYA 1VBA1 4HANA 1H0BA 1IG3A 2KD7A 4C90A 1ZZ8A 1T6BX 1G9DA 2HEVF 1AR83 4FOQA 2Y6LA 1WZXA 2WYFA 3VDDC 3OD0A 4GH4C 3O5SA 5CISA 3MW3A 4EJRA 4NRPA 5A7PA 3A0NA 4CU9A 3BYWA 3VBRC 1V00A 4BYYA 1WMFA 1FI2A 1UIKA 4ZS3A 2ZGKA 2B8MA 1YI9A 3JXSA 2GN7A 5HBAA 4OUSA 2X8KA 2WKKA 5BXXA 1X50A 5EP9A 2R043 1HJFA 4N8MA 1GU3A 4PF5A 5IJRA 3IM0A 1IS6A 4FXGB 5K0UB 3H8RA 2DU0A 2FZ1A 5IK8A 5IVCA 1C8M3 4JAAA 1ACCA 1KFUL 5JAXA 3ZFEA 3PLQA 4AVAA 1OUSA 2A3WA 2Q5TA 1MQTB 3VZJA 1H30A 1O6UA 4WV8A 3PUQA 4NIIA 4ET7A 5LK5A 5FYUA 4MG2A 4DXSA 1GZWB 2EXHA 2P3KA 4L8QA 4LULA 1ZBA3 2OZ6A 2WN3A 4KG8A 2V73A 1V6KA 4ORFA 5EIYB 3LFIA 1SCRA 2ERFA 4OHVA 4FOYA 1ND2A 3PJQA 1GOHA 1UZWA 3BGAA 3N9OA 4NO4A 3TN93 4BA6A 3ST7A 3DPRC 3T0AA 1RUC3 2DFBA 4QHBA 4BQXA 1REDA 4M3CE 1LTEA 2ZGSA 4Q26A 1RJ8A 5DZEA 1EUTA 3TEYA 2VR4A 2WNVB 3LOBA 4MXVA 1JHJA 4Z92B 4I0BA 1CIYA 1C1FA 3I3EA 2XB6C 4N53C 3THDA 4C91A 4O65A 4QXHA 5CBLA 2VL4A 1DCSA 3LE0A 3WP4A 5FTTC 5JXJA 3E6DA 2HWB2 4DXTA 3FUQA 2E63A 5J1XA 2RMU3 1A8MA 4IQPA 5CVRA 4LR4A 1Q8VA 1UYXA 1YRZA 4EN0A 3SHRA 5C3OA 4ES8A 1ST8A 1FOD2 1GQHA 3W21A 5A32A 4BXFA 4Q4Y3 1C5IA 2GH2A 4QQLA 1O3SA 1S1AA 4A2UA 2DBNA 2PQSA 1LNSA 3H1WA 4DNYA 2QDRA 3D0JA 5JOYA 4EV0A 1SDDB 4QM9A 3I2GA 3ZFGA 3R4DB 4OZOA 5A3WA 4LLOA 3FN9A 4JQRA 3CLPA 3HT2A 4FOVA 2VTXJ 4M00A 4YVSA 5L73A 3LFMA 3DKWA 3IAPA 3OGGA 2OX0A 3N35A 3W20A 2ATFA 2Q30A 3THPA 1X9PA 4DO0A 2P4EA 1XOYA 3WVJA 2LW8A 4RSUA 3DYOA 1S2EA 3VUOA 2FMDA 1MEC2 3NJXA 2DU1A 2W68A 4FFFA 1LGCA 4KMQA 5LATA 4PJYA 3RPQA 4AVVA 5LBEA 2O14A 1EV13 5FY0A 1IGOA 1APNA 3KB5A 4Y1XA 5A6XA 1L7RA 5K0UC 3ES1A 1G9CA 1AYM2 2HJIA 4QM8A 4DB5A 1EYBA 2ZMKA 1HXS1 4GB33 5FZCA 2QUOA 5AFEA 4ZPIA 1GWMA 1QMJA 1VB4A 2HWE3 4HT1T 1MS1A 1LKNA 2YPDA 4AVSA 4A44A 1FXZA 1RITA 5EV7A 3WINE 3PIGA 4XUQA 1M4WA 4XFHA 2D3PA 1CJDA 3RMYA 1I6XA 1ZZ6A 4QX3A 5FJHA 3THTA 5LEJA 1G7YA 2VC9A 5HV0A 3NRUA 5BY5A 1RIRA 3VBSC 1SPPA 2D7FA 4LKDA 3LA3A 3ZFFB 4P9JA 2WNVC 3MO4A 4IETA 1BEV1 2JICA 1BBT3 1YI7A 2W46A 2ZMNA 3LA7A 4NRMA 4QQ2A 5CA6A 5GZEA 2VZVA 5EFUA 4XETA 4LKSA 4CP9B 3FBYA 1C5HA 5FQ0B 5F2WA 4CYDA 4D6SA 4CDWA 4NWWA 4QX7A 1UKGA 1VPHA 3HR9A 5I0DA 4LBNA 3SKJE 4EYUA 4LBQB 4ISRA 3B02A 5EHDA 2BVVA 4P08A 2W52A 2JDZA 4QDRA 1PIV1 4Q0VA 2Y6JA 3VBHA 1T2XA 5FZDA 4BH9A 2HWF3 4P9IA 1YO8A 2OPKA 5FKCA 3LCPA 5IVJA 4NWVA 1R083 4I3PA 2X05A 2E26A 2YYOA 5JXIA 1K5MB 2DUPA 1C57A 1F5FA 4UOJA 1UX7A 2P34A 3UGFA 1N1VA 5LCWL 1PO22 3I97A 4GJZA 1VJ2A 4H2AA 4Q4X1 1RUF2 2A6ZA 5C5TA 4JHTA 1QOSA 4PF1A 5JXGA 2VQ0A 4GKYA 2E32A 4AI8A 4LA2A 1ULPA 5FZ9A 3ZYFA 4EE2A 4UT5A 1DP0A 4RHV1 4LO8A 2VXJA 3JCIA 2QNKA 3ATGA 4HPKB 1YQCA 5JZGA 1DLCA 4QPIA 1NA1A 4BMEA 2IC1A 1QJY1 1HKDA 4EQVA 1Y9QA 1JI6A 4BPZA 2EAKA 1UU4A 1KXGA 3HQXA 5HXMA 3T2QA 2RM22 2QVSB 3AFKA 1CONA 4UXAA 5JSRA 2FD8A 1H8VA 1W0NA 3A21A 3OSDA 4ARYA 2ZTNA 5DN2A 2W0XA 1A8DA 2ENRA 2QQOA 1H1IA 1OOPA 3ZOIA 2YB7A 5KBFA 2MNGA 3I2FA 4FO9A 3O1UA 3CNAA 4QB6A 3S0MA 2RS31 2XLGA 5T5LA 3SXWA 4CU8A 4R9CA 3VDDA 4ONUA 1QXPA 3MIDA 4Y1UA 1T6GC 1UWWA 5KWRA 5LRRA 1KD7A 3VBRA 1MACA 1DYKA 1UMHA 1H8TC 3MPPG 4Y24A 2F6BA 1JUHA 4AQ2A 2CDOA 3AKQA 4XJWA 3RG0A 3WNOA 4I02A 4A6OA 1UYPA 4XHXA 1HRI1 1W6QB 1ULFA 4OVEA 4XJZA 5F3IA 3ZXGA 4E4HA 5EYXA 3MIHA 2PAEA 4Z1VA 1GQPA 2EVXA 2RHPA 3NW4A 5FZMA 5CG9A 2B7YA 2PLV1 1PMHX 4IV1A 2DURA 1GICA 2J1SA 4X6RB 1RUD2 4XUPA 2AEYA 4CVUA 3SNMA 2JJ6A 2VTXA 2Y26A 3H8UA 1N1TA 4XILA 4KWLA 5FBZA 3K4DA 3M3QA 2VBDA 3WD5A 5I0RA 1JMUB 4GWJA 2IWGB 5GM0A 4L2NA 2GMEA 5A33B 1YYNA 1J84A 1K5MC 2DCZA 2VMDA 3K2OA 1GQGA 2XHKA 2JDNA 4FPJA 3U37A 4CEYB 4Q0UA 3S6PA 3RZGA 2JIJA 2Q1ZB 1FYUA 1J3QA 4TN7A 3B94A 5JR7B 2D6LX 3RZHA 3MV01 1L7LA 4DEQA 2WNOA 1O59A 4LHKA 3W5MA 2HWB3 5LY2A 3KF5A 1BEV2 2WA3A 4A6SA 3KCCA 3PNAA 1DF0A 4RFRB 2GZWA 3FFZA 4N7UA 2QDNA 1REFA 3VBFB 2XGXA 1F2NA 1B35C 4LPLA 1FOD3 4FOWA 4L92A 4ZHNA 2WQZC 2ZACA 3PVBB 4BE3A 5KXEA 1UIJA 2Y34A 1NCQB 5AVAA 5A3NA 3GJBA 3FX3A 4DUXA 2XJQA 1Z7S1 1A3KA 1SDWA 1SLIA 2P1BA 2VNRA 1QGLA 3VBUC 5JI9A 4CUAA 3N7KA 3W58A 1JZ5A 4FTSA 4GJYA 5BNNB 1QU0A 1MS8A 1QNYA 1RUJ1 2G9ZA 1DZRA 1G8WA 3DKQA 3GHNA 3R4UA 4LOSA 4P5HA 5A7WA 5F7UA 5T52A 3FHIB 1JOJA 2C5DA 5JR2A 5FZIA 3UGHA 3RYRA 3T0BA 2PHDA 1N3PA 1MEC3 4AQ6A 1UD1A 1WWYA 2VW2A 4Q4X2 4FPGA 3HIFA 3OPWA 5JSOA 1HB4A 1RYYA 1U5IA 3TRSB 4DPNA 2W1UA 3FFQA 2BQPA 2Z2SB 3LQCA 1EY2A 1ULCA 3MHZA 3POWA 1AYM3 1GV9A 2BW8A 4IV3B 3V0BB 5KHGA 2WNUA 4RHV2 4JRAA 2XPJA 4LITA 4MGIE 2BBVA 1W6NB 3QOPA 3NJZA 2WZR2 2F4PA 5FY7A 1UPSA 1J58A 2PQQA 1H2LA 2YGLA 5AFBA 1VALA 4HK8A 3RI9A 5L36A 1XRUA 2YFUA 2BZDA 3ILRA 2DTWA 1MQTA 2BBAA 1HX6A 3NMBA 3KS7A 2JDYA 4NMIA 2B39A 2VJXA 1HJGA 3QH6A 5T50A 1GZWA 3VDCA 1S0IA 4PBPA 5JOZA 1JYIA 4Y1ZA 2RS32 1V6IA 1WCUA 4L11A 1JXNA 3K3OA 3RFRA 3PUAA 5C7GA 4CEYC 4NIGA 3WQ0A 3RMXA 1MVQA 4OZXA 4Q0PA 4XUOA 3V65A 3KV5A 2K0GA 2VUCA 4AHZA 3WV6A 1LOFC 2FDHA 1SLAA 2ZHKA 3E6CC 3VBFC 1ZRFA 2W1WA 2Y64A 1WCKA 4AI1A 1HRI2 1VMJA 3POYA 3SH5A 3ETQA 1WCSA 1HV1A 5FLIA 2R32A 3MUY1 5FUIA 5L9BA 4Z2AA 2PLV2 3D4KA 3WW3A 1H2MA 5A7NA 4Y5TA 1OQEA 2ZKNA 2GN3A 2OT7A 5FPUA 3O1TA 1PO23 2JXAA 1RUF3 3WW2A 4GMP0 1WD3A 5A7QA 2GC2A 1WD4A 3CDZB 4NIDA 3JUUA 1YCIA 2H0BA 1CR7A 5DG1A 5IFPA 3SH3A 1W6PB 3KF3A 1F15A 4GULA 1BK1A 5HXVA 5JSPA 2AEZA 4B8EA 2QQUA 4PLOA 3O1MA 3HNYM 5DUVA 1ENXA 2ZX4A 2LTNA 4IV3C 4MGYE 1KJRA 3ABZA 2RM23 4YNIA 1W9YA 3ZSJA 5DZGA 3O1RA 1YHFA 1V6LA 2DVDA 3BPZA 4E4ZA 1Y9GA 3MW2A 3ZIXA 3OGSA 4LO6B 1UL9A 2Q0AA 1RXGA 3O1VA 1DYPA 1TZOA 1ND2B 4E2GA 2JDUA 5F5AA 4MO3M 1FAYA 2R071 4Y1VA 4INDA 1GFF2 2VZQA 2YC4A 1ND3B 2PHLA 3MIEA 1F9KA 2UYAA 4CA9A 2QQVA 1RUJ2 2W87A 1IQDC 2WIIB 1AYN1 1XQNA 2X5IA 2ZEYA 3ILNA 3LDKA 5DAWA 2NPIA 3M2MA 4IEYA 4W4ZA 2HWC1 2WT1A 3RJRA 1D4M1 1NOVA 3S5QA 4DMIA 3UNPA 5ABJB 3Q8CA 2VCCA 1ULDA 4XF0A 5APAA 1JZ3A 1DGWA 5IT6A 4JRLA 5JI7A 3AP5A 4GD4A 1V6OA 2VOTA 1G9FA 2WSVA 3HWJA 1PGW1 4KNCA 2LROA 3ZFFA 4E27A 3WG3A 3DCQA 4AI3A 4YLZA 2Z4FA 1URXA 2NQYA 1RUD3 2Y6KA 1GNYA 2W47A 3HD8B 1LEDA 2E9QA 2W39A 3HBZA 1DZQA 2PHTA 3HAGA 2FCUA 2H0VA 3IWZA 3P6BA 4Y26A 5IUQA 3ZIWA 1JS9A 3GM8A 2V72A 3BCWA 4EN6B 2ZJCA 4CCOA 3FWEA 3VD7A 4D6RA 2DF7A 3H42B 5K4LA 2D93A 1X8MA 1SLBA 2ID4A 5D1IA 2D3RA 2ZGQA 2J7MA 2W1QA 4NE9A 1KS5A 4IE6A 1O8PA 4S2FA 3ZXFA 1WW7A 2W08A 2C24A 4BXSV 5HV4A 1W28A 1BEV3 1KDKA 2CAUA 3N3HA 4UWDA 1I5ZA 5JIAA 1XNBA 1H4HA 3AM2A 1WMEA 4MUVA 1SG3A 1W04A 4YW4A 3FHQA 5FZ1A 2LUWA 1QJEA 4QDSA 3S30A 4AEMA 4BQ5A 5A1AA 3JBG2 3CZJA 5ANQA 1OBNA 2QQIA 5FYYA 3ZFEC 5F1RA 1PNGA 3I59B 1LESA 2GC0A 3UV9A 4UYBA 1PM7A 1W2AX 2XWBB 2GH8A 4KWUA 5BNOB 4Z2WA 3VD5A 2DCYA 1UY0A 1POV1 1JBCA 4HPKA 1BVP1 2A1XA 4NRQA 1LECA 2ZHMA 2D6MA 2VQUA 3ME2A 5JCTA 1EUUA 3HQRA 2UURA 1ND2C 3T2PA 4AXOA 1LOGA 5FV3A 1SPPB 1UOGA 2C9KA 2RS52 2WFF1 1VB2A 4Q4X3 3RZJA 1ZX5A 1QF3A 3SISA 3FE5A 3WQ1A 5CIRA 2OUJA 5C3RA 2VOXA 3U4XA 4M4RA 1MVEA 3H50A 5ABJC 2XUMA 4WM8A 5CKNA 4RHV3 1Y3TA 2OS2A 2ZX1A 4IEQA 4BWOA 1ZRCA 2JENA 3MLKA 4XFAA 4MZUA 2WZR3 1U5ZA 5ACA1 2B5HA 2WQ8A 3OGJA 5F8PA 4E9KA 5ERLA 1IPJA 2B42B 4PCRA 3DYMA 4CDXA 1WA6X 2VMFA 1W3XA 1DBNA 1GR3A 3POSA 3VBHB 4CCKA 3IN9A 4CCDA 2TEPA 2DV9A 2VNVA 2WS92 4BB3A 3GF6A 3CJIB 1CJPA 5J09A 2N7GA 1NXD1 1UXXX 2FDKA 1L7QA 2G19A 1W6QA 2FCVA 1IOAA 4ZZ8A 2R072 1KGYA 2RS33 2ZZQA 3JU9A 1G86A 3WHUA 2L9LA 1YQ2A 5A1FA 1HB2A 4XZUG 4IGQA 3J4UH 2HWC2 3C7HA 4M3CB 1D4M2 1OKQA 4D3WA 3MZHA 4GXLA 1NT0A 4CEYA 3BKZA 4LKEA 1POV0 4RQPB 5JZGB 1UX6A 3J8F1 4QPIB 1HRI3 3E5UA 4KBBA 2PLV3 1Y7BA 2UWBA 1CIWA 4HL0A 5I0SA 1YWKA 4YG6A 2VOKA 3AK0A 4HMZA 1OOPB 1R64A 3WUCA 4XJ8A 1XYOA 3H3LA 1AR92 3AJYA 1OPMA 4I01A 1LJ7A 1NCQA 2BFUS 5GLUA 1CQ9A 1NQDA 5FLJA 5FP4A 5D21A 5ANNA 5AC91 1ZBE2 3M3OA 2CDPA 1TQ5A 1BLZA 4KH9A 2OPWA 2MHFA 1NCRB 2CAVA 4XBQA 3WG2A 1JOPA 5BNNA 1XE7A 2BTVC 2FDJA 4N43B 3JD71 2A3XA 5FZEA 3VHNA 1BCXA 5B4XA 4QX2A 2D6OX 1W05A 2B4KA 4GWNA 2RDNA 1PK6B 3J9SA 3MYXA 3F95A 2WWUA 4YM0A 4C8DA 5J37A 5IYYA 1RTVA 5F9TA 1GZCA 4BCUA 3IDCB 3RI8A 2WWSA 3NO8A 4ZONA 3ZN5A 1VMFA 1NZCA 1UCXA 2ZZJA 5LA9A 1NXMA 1AHSA 1WGPA 5E16A 4CDWC 2JB4A 3ELNA 2OQ6A 4FXKB 4IEWA 1U5XA 3N36A 5B2GB 1AF9A 1BBT2 3O7OA 2RJ2A 3B9CA 3FC0A 4GKXA 4IV1B 4YG0A 3ZR6A 2A7AA 5FPXA 1YIPA 1BQPA 3I7DA 3V0BA 3O0WA 3VBHC 3QD6A 1DU3D 1YFXA 4Q29A 4D7YA 1W6NA 2GALA 1CAVB 3A4UA 4NOTA 4EZ4A 1Y9MA
chains in the Genus database with same CATH topology
3E5QA 1RUJ3 2JG8B 1Y43B 3MEPA 3AKSA 1SCSA 4RL7A 5JPMB 4UBGA 1V6NA 3QACA 2P3IA 2A5ZA 2WFF2 4P9LA 5DZFA 4RFT0 2PHWA 2BNMA 3AP6A 4WVMA 1CPNA 3VBOA 2HYKA 4EN7B 4FPYA 2CL2A 4CZSA 1MS3A 3B5LB 3OD4A 2GAUA 1MZEA 1ASJ1 1HV0A 5JZGC 1TMF1 4GWMA 2CWMA 1HQNA 1NA1C 4QPIC 5LEKA 1SMVA 5E1RA 3V0AA 1VBD1 1WLDA 4H7MA 3MDPA 3KT7A 4HZFA 5GLWA 4PBOA 2P2KA 1OOPC 4YZ1A 1JYCA 1I3HA 4Q8LA 5BYNA 4YGDA 1ZM1A 5H9PA 3ZXDA 1PVC1 2DTYA 1AXKA 2DFCA 1Q8QA 3D5OA 3UJOA 2EXIA 3M3CA 2FHRA 3UKTA 1NCRC 3ZMNA 3JB4C 1HW5A 4ATEA 1AJOA 3LSDA 4K21A 1S2BA 4WVZA 3IT8A 4LA3A 3JBG3 2D98A 1GANA 2WNUB 1C4RA 1PK6C 3CF6E 4DY3A 2R0HA 1W6PA 1V9U2 2ZGUA 5E89A 3SCHA 1LOBA 2VVEA 3P3PA 3H7JA 3KD4A 4IV1C 1PGSA 4P9YA 3AMNA 4HVRA 3WX5A 4HBNA 3AJZA 1VRH1 4AFMA 1XNDA 2RS53 3VL9A 3I2DA 2JG8C 1RB8G 3PJYA 5FAXA 2PN5A 1LCLA 5C33A 2R1BA 5AC92 1RUOA 2PAKA 5DUXA 4FPHA 5BNQA 1TNFA 1ND3A 3A0KA 1DQ6A 3IPVA 4LO5B 2SLIA 1RUH2 3K51A 2EAAA 1EAH2 1BXHA 3UKVA 5ABJA 4XQDA 5I93A 1PO12 1PMIA 2BYVE 2Y0OA 5KHKA 4YW3A 2WS93 2NLRA 1MS4A 1LENA 1IQAA 5DDJ1 3ZSEA 2R073 4MX3A 3WG4A 4BLIA 4Y20B 2ILMA 3PHMA 3GZTB 2GNTA 2YV8A 3L9JT 2QKDA 2AREA 5C9AA 1OPOA 1I9RA 4C0HA 3KMHA 3OJBA 2HWC3 3PVEA 3W9AA 1D4M3 5CU1A 4J6GA 3N7JA 4HKWA 4MLOA 4XEZA 4JGYB 5KHIA 4EROA 3ZYPA 1LOEA 5FMOS 1S0EA 2WNUC 1RUI1 3AKPA 3ZDSA 3WG1A 1TMF2 4XFGA 2YXSA 1BMV1 4XFIA 1FMD1 1FPN1 4NHMA 4JDOA 1VBD2 3B69A 4I0WB 1AR93 4BLJA 3I59A 5FOJB 1MQTC 3VHRA 4FAHA 1DLLA 1ZBE3 4OULA 3AZZA 5BNOA 2VW1A 1VBA2 1OA2A 4AGGA 5CFDB 2X5IB 1VIWB 2IXLA 3AYAA 5JMCA 1PVXA 4FCAA 3DV8A 1H9PA 1PVC2 3MGUA 4LBQD 4SLIA 1FNYA 5F6KA 2I45A 2VOWA 1XNCA 5TSWA 1ZYBA 5JLVA 4LTAA 2ZMLA 4TWTA 2XLFA 2TUNA 2JEMA 1BKZA 3EO6A 4X6QB 1J1TA 3H9AA 4B4RA 1X8EA 3AX4A 4FPCA 1OSGA 4CP0A 4CEWA 1G6NA 3GBWA 4OHZA 1IZ3A 2WSUA 1R091 2CYFA 1JN2P 2B45X 2IXKA 4DY5A 1OI6A 3IBMA 4CRQA 2LM3A 2WFF3 2YGMA 3B3QE 2UYBA 3AP7A 3CJIA 4OI2A 2ZGNA 2DUOA 1RHI1 1Q8PA 3U11A 2AUYA 4NN0A 4LNVA 3U0ZA 4YW5A 2K2SA 4P14A 2GMMA 4M3CA 2EA7A 3W59A 4DZGA 3N4MA 4PDWB 1EPZA 4Y4YA 2BNNA 1ZRDA 3KQRA 4RQPA 1PGL1 5LRSA 4OLLA 2JD4A 4YRDA 2VXRA 1O3QA 1N1SA 2RR11 5DDJ2 3GZAA 3ZXJA 1LB2A 2GDFA 3WQ7A 4JCKA 4NHKA 4EWEA 4XTPA 5BUVA 3LZZA 2V5YA 3NVCA 1CAXB 2DVAA 1RINA 2X5IC 4O9EA 1AVBA 1DQ0A 1AZDA 1DGLA 1WA4A 2B9UA 2FBEA 2VMHA 2PFWA 3M1HA 1WBLA 4YZ2A 3PVOA 4FQZA 4WM8B 2GNBA 1IKQA 3IMNA 4Q1RA 1CAUA 3VN4A 4YSFA 1NCRA 1RUNA 2Q4SA 5BNPB 5GZGA 1V9U3 2WA4A 3ZFFC 4N43A 1GLHA 1LR5A 1YFYA 4QD2A 1RUI2 1BJQA 4CDXB 4R9AA 1PK6A 1CVNA 4DS0A 3PMEA 1OFSA 3C3VA 4QMAA 4IEOA 2ES3A 3RDIA 3TYJA 1VBE1 2XJVA 1HXS2 4JTOA 1AR71 3AYDA 4XIOA 1WLTA 4XXAA 4ZU7A 3LB9A 5AC93 3I8TA 3JB8A 1E57A 2KXLA 1KFXL 1CGPA 2ZBJA 1ZA4A 1CAVA 4AWDA 1XE8A 4A7ZA 5CFCA 2JG8A 4AEDA 2EIGA 1N3OA 1RUH3 3AMQA 1EAH3 1PO13 1D2SA 3LSEA 3USUA 3O0VA 4OI1A 4YVWB 1HLCA 5DUUA 4Y22B 2XBO1 3OCPA 1N3QA 3NSTA 4PDWC 4W65A 4WBBA 1SLLA 3FLPA 3GYDA 3MF6A 4IL7A 4XE9A 2ZAHA 5F6LB 1W0OA 2Z42A 4HN1A 1PNFA 1S2KA 3KLSA 4AFAA 3HT1A 4IEZA 5J96B 1PIV2 1DQ1A 4Q4V1 3DN7A 3AMHA 2K9ZA 3B93A 1X82A 3UJQA 3ZYIB 1UPIA 4B3NA 2CV6A 1VBC1 2BWCA 4QGNA 2D44A 2O8QA 4WM8C 4AHXA 1RGSA 1SBEA 4KL1A 4OUMA 4Q27A 4E2QA 1O5LA 1TMF3 5T3NA 3MLJA 4LBKA 3AB0A 4AI2A 3QBQA 1SBFA 1VBD3 1DGRN 3M70A 1ULGA 4GMP1 3UL2A 3WDWA 4CDXC 1KS4A 2VUJA 4PIYA 1VAMA 5BPXA 4F8AA 2XH6A 2BUKA 1ZRRA 1QJY2 4COVA 1VBA3 4I2OA 1COV1 2A6YA 4FPKA 3RYKA 2YMZA 1PVC3 4M3CF 1UF2C 4WVMB 4XOGA 2ZGPA 5FOBB 4META 3VBOB 5LK7B 2CWSA 1QH6A 4HSLA 1S0BA 4MSVA 1RUG1 3WZ1A 4HK9A 4CTEA 1UN1A 4QQOA 5IK4A 1MZ6A 4CP1A 3FLRA 4M0NA 1S0FA 4AI0A 2ETEA 5DG2A 2BVBA 1DZTA 2TNFA 3U10A 2QQPA 4YVWC 3L2YA 3V0AB 2EXJA 3VHOA 1UAIA 3WT3A 3WXPA 3WDTA 2VW0A 1C1LA 1RJ7A 4TZDA 3QCWA 2WL1A 3KCYA 4AGRA 1VBE2 4MVTA 5KXCA 1J1LA 2IXIA 1AR72 4FAGA 1NCQC 2A75A 5HCFA 4OFGA 2Z5WA 5JOXA 4QGLA 4WM7B 2I07B 1EP0A 4YGBA 4Y20A 3LWCA 2OVUA 4AYUA 1A78A 5BNNC 1HQLA 4YYOA 1IHMA 3QLQA 1HQWA 2A3YA 3VZKA 4C1XA 3D0SA 2NZ9A 2Y0IA 2RE9A 5D8AA 3VZMA 1WLCA 3MI8A 1KRIA 2ZGOA 4JGYA 2HEYF 1O3TA 5JIUA 4LT5A 1C8NA 5GALA 4H14A 5DDJ3 5DXDA 4KWKA 4RGAA 2R30A 1NLRA 2GNMA 1QOTA 4Y1YA 4D7SA 3ES4A 1CN1A 1Z7S2 2O8OA 4IERA 4JTNA 2AH2A 2R6QA 2DUQA 4J1XA 1Z78A 3OBRA 3IPVB 1ENQA 2GU9A 5CFDA 3VBOC 4DQAA 4B29A 1ZZBA 3JQWA 4EN8B 1RUI3 1HRV1 2ARBA 3ZXKA 1AX2A 2OZJA 4S2DA 3WR0A 4ISQA 4AFBA 5C4WA 2RMU1 2DYCA 1LOCA 3E5XA 1LULA 1HXS3 4RR3B 2ZPXA 5JVVA 4N9IA 4MV2A 2MEV1 3SMHA 3TOJA 2JKBA 3AP9A 2QFEA 2QCSB 1COV2 1MZ5A 4Z07A 1NYWA 1L3JA 2GSYA 5C9AB 3RS6A 4QPGA 4AGVA 3TNPB 2UWAA 2ZGLA 3M7AA 4P9GA 3WP6A 3M3IA 2HEWF 1DQ5A 3FUOA 5FLHA 1WCDJ 4NHLA 4S2HA 5L7OB 1SQ4A 5T55A 3EHKA 2NYYA 4XFBA 4C0BA 1EV11 3OBTA 1H4GA 1V6MA 2Z79A 4LE4A 1WMDA 4Q0QA 4XMIA 5CADA 3OY8B 1G9BA 2R1DA 4FQ4A 2YUEA 2OW4A 1MR5A 4XFCA 2HWE1 1PIV3 2B46X 2MPFA 2NM1A 4PDWA 4N7IA 5GLTA 4W6WA 5CG8A 1YFWA 3S7IA 4HVQA 4Z82A 4XTMA 4KG0A 5FO9B 4E4SA 1RC6A 3VLBB 3ZYRA 3GZUC 3VHPA 3ZXEA 1ND3C 1CAXA 5I8TA 2UY9A 4XF9A 4AE2A 5IK5A 2QJVA 1W39A 3GALA 3ZN4A 4LO7A 3IIAA 3TNQA 1CX4A 1NE6A 4CEWB 1U12A 1ULEA 3D82A 4XF1A 5J36A 2YZ4A 1U0AA 1DIWA 4DFSA 1QJY3 4COZA 3H0OA 4HN0A 5BNPA 3NAPA 2NP0A 4RR3C 5EWSA 3VL8A 2DVFA 2ET7A 4D69A 3ZMOA 1QWRA 2HWF1 3JZVA 4DRVA 2JECA 2G9GA 2OUHA 3MFCA 2AENA 5K9YA 1LHVA 5T5PA 5C9AC 3NKTA 2PA7A 1NY71 3NV3A 4R9BA 4R52A 2A6XA 1RMU1 1Q8OA 3RWNA 2FZ2A 5GKAC 1AYN2 3C2UA 4IEVA 3VV1A 1FNZA 1BZWA 1TE1B 1F5JA 2PHUA 2HWD1 1HRV2 2PHXA 2XKOA 1QXRA 4GIQA 2DVBA 1JHNA 4E4DX 3ZPYA 1O4YA 4X8PA 2IZWA 1S0DA 1VBE3 1PGW2 4URTA 2YC0A 1AR73 4YVWA 1LOAA 4ITCA 2A71A 5JWPA 4Y22A 3TBDA 1MZFA 3CEWA 4KU7A 2MEV2 1QHDA 2EALA 3WP5A 1J3RA 4AK3A 3WDYA 3OF1A 3SLIA 5BNOC 1NG0A 3T1LA 1UU6A 1XXNA 1A6CA 4CDUB 2I74A 1JUIA 4EWAA 1C28A 4CDQB 3KGZA 2SBAA 2WINB 1CAUB 1RVF1 2A73B 3AMPA 5FRAA 4XDQA 4BIFA 1PZ9A 3EQEA 2BPA2 2FQPA 4JGZB 3ACLA 1KJLA 4HKLA 4HLTA 3MIFA 2DCTA 2G4IA 4GALA 4RS5B 1TME1 1W6MA 4Z8BA 2ZX3A 1NLSA 5H9RA 1NQJA 5JPNB 4KWJA 4CEWC 2G9FA 1TEIA 1V6JA 4M0HA 2CGOA 3VGIA 4NR1A 1MS9A 1VAVA 3R6SA 1H1AA 4LBOA 5T5JA 4GH4B 1Z7S3 2Q8OA 1XNKA 4OI0A 4LE3A 4LBJA 2WLQA 3CJIC 5CFCB 4AEDB 5C8CB 4XBNA 1YFUA 2VUAA 1QJU1 4FTBA 2D5FA 4MH0E 5H9SA 4AQSA 2E6VA 3VKFC 1ONAA 3USUB 2ZHLA 4YM2A 4L9BA 2D40A 2R061 2HWB1 3FJSA 3R4SA 4HFSA 1AX0A 2WT2A 4GMP3 3AXEA 4XF3A 4K1YA 2YDEA 2IXCA 2WLPA 2XVGA 1UMZA 4RQPC 5FPZA 3OTFA 3CU7A 5ACA2 5HCAA 4K8FA 3KSCA 4BM8A 4FPFA 2XVKA 1COV3 1R1ZA 2D97A 4K7JA 1O91A 2R49A 5A3LA 1YIFA 2IFRA 3INAA 4B7KA 4DOUA 1O4ZA 4N90A 2AYHA 2A6WA 4CDUC 2E51A 1WW4A 1NY72 4BIOA 1RMU2 4WM7A 1MEC1 3ZO0B 4BOWA 3RYPA 3V56A 4W6YA 1OMIA 4Q2FA 1HIXA 1KITA 3ZVXA 3I4IA 4K40A 1AYM1 2HWD2 2H6CA 4JGZC 4N43C 5JAXA 3WOGA 1IKPA 2VULA 4AF9A 2NMNA 4RS5C 1Z0HA 2DVGA 5KHHA 3J8F2 5JOWA 2JG9A 4G3YC 4KGQA 1AR61 5GZDA 4XXPA 4GA9A 4LEJA 4YW1A 2VY0A 5T5OA 1AL0G 4U36A 3LOIA 1X7NA 3NV1A 1XYNA 2WFPA 3P3NA 4YW2A 2R0FA 3KT1A 3M8LA 2XJPA 4AG4A 4AVTA 1UZYA 5GLZA 1OQDA 5CFCC 5F5QA 4RD7A 4TSVA 4G9SB 4BMBA 4AEDC 5C8CC 1N1YA 1GBGA 1RVF2 4XBLA 4H7LA 1RUE1 4XMAA 2X53S 3HMYA 3WCSA 3JD72 4FP2A 3BOPA 3J26N 1GNZA 3M4FA 2XL7A 1TME2 4RGGA 1QH7A 2XJUA 3KCXA 1DQ2A 1LGBA 4I09A 4YG3A 1O3RA 2VOVA 3ILFA 4P9WA 1OLQA 3AYCA 1U5YA 1W6OB 2PTMA 3EJKA 2FMYA 4F83A 2GC1A 5FO7B 4RR3A 3VBSB 3WNXA 1M06G 4LHNA 3BALA 1PO21 1QJZA 1RUF1 4QGMA 1AYN3 2BFUL 4UBHA 4AHYA 1QJU2 1XU1A 2ZCWA 1AJKA 2ZAAA 3WP3A 1R1A1 2V09A 3LKJA 4A7KA 1HRV3 5D8AB 4FSJA 2R062 1F8VA 2ARXA 2VNOA 1OA4A 4K20A 2IXJA 2RS11 4OI4A 2XWJB 5DUWA 5L7OA 2RM21 5EJ3A 1ZVFA 1ASJ2 1VP6A 2MEV3 3B7MA 5GZCA 4FT8A 3ASIA 1SFNA 1O7FA 3FLTA 3OY8A 2XJRA 1S0GA 4JC1A 3TWIA 1DQ4A 4ZXKA 1AUYA 5H9QA 1CPMA 4F3JA 5C8WA 1LHWA 3E6BA 4LBLA 3APBA 5AVPA 1C3HA 4QXKA 4TLFA 3AZVA 5BV6A 3GBGA 4UW5A 3MIGA 2VMGA 1DFQA 4KU8A 5C4WB 3AFGA 1H2NA 4J1WA 2ZABA 4IXLA 1JH5A 1B09A 1RUD1 2WQ4A 4PIZA 3WCRA 3ZYGA 1AR62 2QE3A 3VZNA 3ZSKA <