2WQZC

Crystal structure of synaptic protein neuroligin-4 in complex with neurexin-beta 1: alternative refinement
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
177
structure length
177
Chain Sequence
HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords NEUROLIGIN 4, X-LINKED
publication title Structural Analysis of the Synaptic Protein Neuroligin and its Beta-Neurexin Complex: Determinants for Folding and Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 177
sequence length 177
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wqzC00
1WLCA 2ES3A 3ILFA 1G9DA 4YFZA 3BODA 2NMOA 2CTVA 3V65A 4DFSA 2GMPA 2ENRA 3W58A 2AYHA 4XMAA 2E7QA 1WCSA 1ZM1A 1LGCA 3WHUA 3ZVXA 4R9CA 4GWMA 2VXRA 1N3OA 4FOVA 4YGDA 3SISA 3WG3A 3AJZA 4LBLA 1MR5A 1MS0A 2ZGNA 3NV3A 1MVEA 2TEPA 1ULCA 3OGGA 1LGNA 2DUQA 3RS6A 2ARBA 1N1SA 3ILNA 5GLUA 2OVUA 2VU9A 1MZ5A 4IQPA 4Q2FA 3I8TA 1LHVA 1FATA 2ZHLA 3UL2A 4K20A 2V5YA 5DUXA 1DZQA 1SBEA 4CTEA 2UWCA 3ZXJA 4YW2A 1Q8SA 4BMEA 2BQPA 3SITA 5GZCA 1UZZA 1GZ9A 1R1ZA 5T5JA 3O12A 3VKOA 3WDTA 1CN1A 3I4IA 3KM5A 3VKNA 2P3IA 2WLQA 4AVVA 1VAVA 3WCSA 2ZGPA 2H0BA 4XMIA 3INAA 4DRRA 2ZMNA 2VW1A 1ZA4A 3AZZA 5L73A 3V0AA 2ZAAA 1LU1A 1SBDA 1C1FA 3DUIA 1VIWB 3ZSMA 5JMCA 1MS8A 1GZWA 1W6MB 1I3HA 1QF3A 1S1AA 1X50A 1YI7A 1APNA 2GNMA 1KDMA 2ZGTA 1LEDA 2WKKA 1AF9A 2VUAA 5E88A 2ZGKA 3UJOA 1UZYA 3WDUA 4C1XA 1GYKA 4FPYA 4JCKA 4M3CA 3IN9A 4XTMA 5H9PA 1DGLA 5IUQA 2GDFA 3R05A 1IOAA 3B3QE 1AZDA 3AP5A 4Q27A 4LBQD 4XIKA 5DZFA 4YW5A 1RITA 3LSEA 5DZEA 4YW1A 3VKLA 2A3XA 4XYXA 4Q1RA 2E6VA 4XBNA 2YROA 2WSUA 1ENSA 4FPHA 4DRVA 1HDKA 3GALA 2VY0A 3AP9A 3WDVA 2A6ZA 5F9TA 1LULA 1FX5A 4Q8LA 1QU0A 1SFYA 2EXHA 3ENRA 3NV4A 2Q5TA 2P37A 2ZGQA 3POYA 2E7TA 2VW0A 4MYEA 4AGVA 1BZWA 1GZCA 1CPNA 1GICA 3HMYA 2A6WA 2ZGLA 1UMZA 4Y22B 1PZ8A 3PJQA 2AR6A 1SCRA 1D2SA 1LHOA 2KM2A 3ATGA 3WZ1A 3POSA 1U0AA 1ONAA 2EAKA 2WJSA 2WSVA 1LOGA 1QMJA 5CA6A 1DQ4A 1Q56A 2WNEA 2ZGOA 4XIOA 3WLUA 1N1VA 1VALA 3WDWA 1LEMA 4Y1UA 4YM0A 4Q1PA 5DXDA 3N7JA 4GWNA 3B01A 2E53A 4H55A 5CBLA 2ZHKA 1URXA 4LBQA 4PF5A 4YG6A 5GM0A 4ATEA 2PELA 2RHPA 2ZA9A 1N1TA 5IK4A 1AXZA 4FQZA 4Y24A 3R4UA 4FPCA 1OKQA 4FVVA 4LBNA 1YRZA 3USUB 4YZ2A 1WLWA 3AZXA 1AX1A 1WLDA 2P2KA 1WD4A 1DQ5A 1UPSA 2JE7A 2YMZA 3A4UA 4FPKA 1RIRA 3FLRA 4Q8KA 4ZKTB 1LOCA 4R9BA 2P3JA 1SCSA 1CPMA 3MW2A 4FOYA 1AXYA 1G9CA 5F5QA 5GALA 1W6OB 1LTEA 1Y7BA 2XB6C 1CQ9A 2JD4A 4XJZA 2JDZA 1G86A 1IS3A 2A3YA 3OBRA 1LHWA 1DHKB 2PHTA 3GNEA 4GA9A 1IS5A 3C2UA 5GZFA 3DGTA 5T50A 3B9CA 2R16A 3U4XA 3RMXA 3A0NA 3BIWE 4L8QA 1J1TA 4FPLA 1FV3A 4YZ3A 1WD3A 3ASIA 1UKGA 1BQPA 2DTYA 2NN8A 4D69A 1TEIA 1FYUA 1DQ1A 3RG0A 2R1BA 1W6PA 3M3OA 1G9BA 3OYWA 5GZDA 1UX6A 4DS0A 4Q26A 4LBKA 3SH5A 4XHBA 3N3HA 2ZGSA 5EYXA 1Q8OA 3WNXA 4XE9A 4ISRA 4AYUA 4CRQA 1ULFA 1EPWA 1V00A 2LTNA 2OW4A 4ISQA 3SNMA 3FLPA 3OBTA 4FP3A 1KJRA 4Y20A 5DUVA 2B7YA 4PBOA 4YZ4A 1SACA 4FPJA 1SBFA 3WG4A 2GALA 3RRDA 2DV9A 4R9DA 5FRAA 1O4YA 1LOFC 4HANA 3AXEA 1YO8A 5H9RA 1JUIA 3PVOA 5JOYA 3V0BA 2CL2A 4BOWA 2JKBA 1V6JA 5JOXA 4F83A 2AREA 2ERFA 3WDXA 1ENQA 1HQLA 1MS9A 1F31A 2I2SA 1DFQA 4XXPA 3IKWA 1H9WA 3MW3A 3FBYA 5JOZA 3H0OA 2LALA 4FPEA 4BQ1A 1O4ZA 2ZGRA 1DBNA 3VKMA 2AUYA 2P3KA 1HQWA 5T55A 1N1YA 1JW6A 5BYNA 1GANA 3V0AB 4AVTA 4K1ZA 1LENA 5CNAA 1SLTA 4RL7A 2WT2A 1LCLA 1WBFA 1IS6A 4UW6A 4K21A 4BPZA 2CNAA 2XG3A 2NM1A 4YG3A 4Y1XA 4XBLA 1QOOA 2ARXA 3FFZA 3B69A 1V6LA 1C57A 5T5PA 2DVGA 3L2YA 1W6QB 4ITCA 3M3QA 2D6PA 3AXDA 1C4RA 2WT1A 2GNTA 4RA0A 5GZEA 3LCPA 4XBQA 4P9XA 4OZXA 1WW5A 5H9QA 1KDKA 3V64A 4K1YA 2D6KA 5HCBA 5JOWA 2A3WA 3TB0A 1WBLA 1A8DA 4WVVA 5T54A 3WUDA 5AVAA 4W65A 1W6MA 2PHUA 5HCAA 4FOQA 4GALA 4M00A 4Z8BA 2R1DA 1MS5A 1SLLA 2W68A 4XTPA 2SLIA 3PMEA 4BM8A 1DQ0A 3WCRA 3AZVA 3M2MA 3R4SA 4I30A 5KXCA 4GKXA 1GLHA 3OPZA 5JVVA 3WG2A 3JU9A 2PHWA 1S0EA 4YW4A 4WZFA 5KXBA 1BJQA 1UAIA 1LODA 3B00A 1QDOA 1SLIA 2EXKA 2EF6A 1N3PA 4UW3A 4XJAA 3Q9OA 3FUOA 2GN3A 3O5SA 1LOAA 2JJ6A 2ZHMA 1W6NA 3IM0A 1JXNA 2JECA 4YM3A 4LBQB 1LU2A 1YYNA 3M3EA 1BXHA 2V73A 1WW4A 4DQAA 1KRIA 2WT0A 3ZYPA 4Y22A 4Y26A 2GN7A 2DUOA 4GXLA 1AX0A 1LOEA 4P14A 1OQ1A 2DVBA 1UN1A 4YG0A 3O0XA 2PHXA 1SLAA 3NV2A 3SH4A 3WOGA 3ZYRA 2VH9A 4Y1YA 2EALA 2W52A 4YM2A 5IK5A 2CY6A 2ZGMA 3ZXFA 3LSDA 3W59A 1AX2A 3FLTA 1DQ2A 5EXOA 2UWBA 2YV8A 4TYSA 1Q8PA 1UL9A 1PZ9A 5LK5A 3RSJA 2P34A 2GMMA 1JN2P 4NOTA 4XHXA 4FQ4A 1S0GA 1S0IA 1V6KA 2GNDA 3AYAA 1A3KA 4FOWA 3ZXKA 2WQZC 1JYIA 2GMEA 1LJ7A 2C9AA 1AVBA 4NO4A 3AP7A 2EXIA 5IK8A 1QOSA 2NYYA 4FPOB 2D44A 3USUA 2A6VA 4FPFA 5H9SA 3SH3A 4AGGA 1GNHA 3IPVB 5T52A 1PZ7A 2D6MA 1MVQA 3OY8A 4SLIA 3BOPA 3WHTA 3WV6A 1GKBA 1C1LA 2D7FA 3PVNA 3KQRA 3M1HA 5DG2A 4AWDA 4M3CF 2ZMKA 1WW7A 1DYKA 3HN1A 2OUJA 4XDQA 1H30A 3OYWB 3UJQA 1FNYA 4C1WA 1LGBA 4YLZA 5FREA 1FNZA 1I1EA 1MS3A 2EIGA 2ZACA 1FAYA 3OJBA 3RMYA 2DURA 5T5OA 3QCWA 1HLCA 4ZXKA 3WVJA 1N3QA 4KBBA 3VV1A 1SLCA 2A6YA 3ZSLA 3ZPYA 2AH2A 1AJKA 2NMNA 3ZSJA 5GJ6A 1QDCA 2DWRA 5EYYA 5GZGA 1BKZA 4BLIA 1V6OA 1W0OA 1DYPA 2A5ZA 4M01A 2UU8A 3V0BB 2CWSA 1WW6A 4Y1ZA 2JE9A 3JUUA 2AGSA 1S0CA 4R9AA 1NLSA 1OFSA 2CWMA 5DG1A 1CJPA 3AJYA 4PBPA 1IS4A 4JC1A 2UWAA 3CNAA 4M3CE 2OUHA 3FUQA 2FHRA 1QKQA 3QLQA 1A78A 1F9KA 3SLIA 4ASMB 5DUWA 1NXD1 1G9FA 3N7LA 5EWSA 3O0VA 3ILRA 3ZXEA 1MS4A 2R0HA 1LECA 2HYKA 4XJWA 2A6XA 2UURA 4YGCA 1CESA 1GZWB 2DU1A 5IK7A 3AYEA 2W39A 3AX4A 5GLWA 1RINA 4AGRA 3HR9A 3WUCA 2DVAA 3N7KA 1V6NA 4M3CB 2Z42A 2PHRA 1GNZA 4LBJA 1GSLA 4YW3A 1HKDA 1QGLA 3POWA 2C5DA 3T1MA 4YZ5A 1Z78A 2G4IA 4FPGA 2ZZJA 1VAMA 1XQNA 4XZPA 3ZXLA 1BYHA 1B09A 4P9YA 5SV8A 3O0WA 1GBGA 2D3SA 4YFWA 1LOFA 1S0DA 4BLJA 1S0JA 5GLTA 3N7MA 2D6LX 5GLZA 1IKQA 3AYDA 3MPPG 2ZGUA 3N36A 1JYCA 4JRAA 1GV9A 1QOTA 2W08A 3MW4A 2A70A 1CIWA 2PHFA 3WDYA 1W6QA 4GKYA 2DVDA 4HL0A 4AVSA 5KXEA 2EXJA 4XJ9A 3IMNA 1N47A 1H9PA 2E51A 1AJOA 4CZSA 1QNYA 3N35A 4U2AA 3D5OA 4Y1VA 1LHNA 2ZABA 1W6NB 3T1LA 1LOBA 3M3CA 3NWKA 4XOGA 5CB7A 4P9WA 2D6OX 5HCFA 4WV8A 1QNWA 3T2TA 2SBAA 4LBMA 1D0HA 2NP0A 3ZSKA 4PCRA 5JLVA 3AK0A 1KITA 1V6MA 1G7YA 2GNBA 3RQ0A 1JHNA 1S0FA 5E89A 3APBA 2ZMLA 2D3PA 2DVFA 2ZKNA 1Z0HA 1MZ6A 4YGEA 2ZBJA 3AZWA 1ULGA 1V6IA 1YXWA 3MEPA 1Q8QA 4DPNA 1CONA 4TZDA 1FV2A 2ZHNA 4PQ9A 5E8AA 4YM1A 3UK9A 1VLNA 1F5FA 1Q8VA 3AP4A 1G9AA 1KQRA 3A0KA 3BTAA 1DLLA 3D4KA 2NZ9A 3VKFC 4U36A 2R0FA 5CAZA 1WUVA 3VUOA 3AYCA 2YZ4A 2YXSA 3AFKA 3AP6A 3OY8B 1DIWA 2AENA 2R49A 4FP2A 1ULEA 1W0PA 4XJ8A 1S0BA 1W6PB 4ATFA 4UW5A 4BMBA 1ENRA 1LHUA 2D43A 1SLBA 3AZYA 1W6OA 4YZ1A 3WG1A 3D6EA 1YIFA 1ULDA 4XILA 5GLVA 1G8WA 4UW4A 3TAYA 2FMDA 1KJLA 1AXKA 1DQ6A 1CR7A 2A75A 2YY1A 3IPVA 4XXAA 3NV1A 2A7AA 5IT6A 2VW2A 2D6NA 1JOJA 4Y20B 2DU0A 5T5LA 2CYFA 1LESA 1MS1A 4WVWA 4XJUA 4YGBA 5DUUA 5KXDA 1CVNA 2A71A 2D3RA 4LBOA 1IKPA 2DYCA 5JDBA 2DUPA 5DZGA 1MACA 1JBCA 3PVEA 2DTWA
chains in the Genus database with same CATH superfamily
3POBA 5E6HA 4YFZA 3BODA 4P9LA 5C4WB 1VBA1 4COZA 2KD7A 2GMPA 4XW3A 1EYBA 2ENRA 4D6RA 4N8MA 5JPNB 1OD5A 3OB8A 3U07A 1WCSA 3WHUA 3THCA 2Y6GA 3ZVXA 1HRI2 2FDFA 2VL4A 4LBLA 3CQOA 2ZGNA 1MVEA 1OLQA 1STMA 4NN0A 2CDOA 4R4XA 5AC92 1WMEA 5F6LB 3ST7A 2OVUA 5J7MA 2XJRA 2YC4A 3LDBA 1RUI2 1LHVA 1ODMA 1DF0A 1KEXA 2W1SA 2V5YA 4UOJA 5DAXA 5JWPA 2XLAA 4QPYA 1W90A 3ZXJA 4BK4A 5FPBA 1CAXB 1UZZA 1RVF3 4PI2A 4JGZA 1GZ9A 1HRV3 4XUNA 4MSVA 2YG0A 4AQSA 3KM5A 4G3YC 2P3IA 5FYHA 4QDRA 1DLCA 3POFA 4Z82A 2ZGPA 4XMIA 2DCTA 3WW2A 2ZMNA 5A70A 2VW1A 1ZA4A 2HWC2 3KMHA 3AZZA 5JXGA 2PLV2 4B1LA 2ZAAA 1RMU1 3HNBM 1SBDA 3J7NA 4J1XA 4B4RA 4L99A 3NW4A 1I3HA 5D2AA 5A6ZA 1APNA 1TNRA 4QPGA 2VCBA 3AB0A 4PQQA 1D4M2 2BV4A 3O1MA 1GYKA 1H8TB 3KCXA 5IUQA 3ZN6B 1DGLA 3UT0A 4XIKA 4QM8A 4LA3A 4NWVA 2G19A 5ABJC 2A3XA 4XZUG 3WQ0A 5C8CA 4H2AA 3GALA 2RG4A 2RJKA 4OVEA 5F9TA 1HB3A 3J8F1 1I5PA 2XLGA 1J83A 2EXHA 3WF4A 2Q5TA 4Q4X1 1SQ4A 2E7TA 4AGVA 4DIQA 2JIJA 1GZCA 4C0HA 5FY1A 1OUXA 1ZBE3 2A6WA 2BJSA 2ZGLA 4RFT0 5FP3A 4DO0A 3I2IA 3LEGA 3K3OA 1SCRA 2MEV3 4AHZA 3LF7A 3ATGA 4JTOA 3GDBA 3WZ1A 3GBGA 3KS7A 4N7UA 2WJSA 2WSVA 3VBHC 1AYM2 1HJGA 3CHXA 2HEWF 2WNEA 2WDBA 3WLUA 4CXYA 5FUIA 4NIGA 4DEQA 3QOPA 1UIJA 4RSUA 3FX3A 4XEZA 4GWNA 5CKQA 2ZX0A 2E53A 4WVMB 5A7NA 2ETEA 1CJDA 3EHKA 2YUEA 2C6SA 4O9GA 2EIEA 5A7WA 4PF5A 5JR7B 5AC93 3FHQA 4CP9A 1PNGA 5IVBA 4LTAA 1RL3A 1K3IA 3MLJA 5IVJA 2BPA2 3MICA 1AXZA 2ORZA 3C7OA 4Y24A 4NHYA 4AEMA 2O1QA 2QTWB 4Q0QA 1FMD2 1RGSA 2C24A 2FBEA 5EPAA 1AX1A 2XVLA 2HYXA 1W9YA 2PTMA 4KG0A 3H42B 1DQ5A 5FKBA 3M3IA 5L19A 1UPSA 2JE7A 4IV1B 3TN91 4OHVA 4M4PA 1HV0A 1NA1A 2BW8A 2VNRA 4FPKA 1X9TA 1OA4A 5C3SA 5CEHA 2P3JA 2HWC3 4QDQA 1TMF2 1G9CA 1IPJA 2XB6C 1CQ9A 2WN2A 1UF2C 2WNVB 3VBFB 4HSLA 1RJ8A 3GHMA 4DMIA 2GC3A 2PHTA 4PLMA 4CEYC 4A7YA 4W6YA 3B9CA 2VZ3A 3LA3A 3PIJA 4ONUA 4QX3A 4R52A 3D8CA 2OQ6A 4UWDA 3U4XA 4Z07A 4QPIA 1FV3A 1ZRRA 3ASIA 4OHZA 2XL9A 2ZEWA 2AACA 2JDMA 4IE4A 5LATA 2R1BA 5JCTA 1UU6A 2W87A 5KHJA 2J1UA 3JQWA 3ACGA 1SPPB 3P3NA 4Q26A 3KHBA 4XQWA 2VOXA 2ZGSA 4URAA 4IGPA 3WNLA 3K46A 2P4EA 1R1A2 4L97A 1UYPA 3SKJE 3CF6E 5F5AA 3WQ1A 4KBZA 1KJRA 1DU3D 5FY4A 3NJVA 4MADA 2QUOA 4FPJA 4CDUC 1SBFA 3RZLA 4LKSA 2DV9A 3E6DA 5A7PA 2VNVA 1AYM3 4K9SA 4XFBA 4Z2WA 3S5AA 1JU3A 1RJ7A 1MEC2 2MPFA 1YO8A 3VL9A 4YVWC 1JUIA 2QQKA 2VXJA 3PUQA 4PJYA 1ACCA 5JOYA 2JKBA 1QJZA 3AKSA 3I49A 3J4UH 3HN3A 1BCXA 2RM22 3LIGA 1MS9A 1DFQA 3GCWA 1NCRC 2W3JA 2LALA 1O4ZA 3IAQA 1XJAA 4HT1T 5JAXA 2X5IC 4YW6A 3DXUA 2GH2A 2XBO3 4MUVA 4N43A 4MXWA 1NY72 3VZKA 4DUVA 2FDGA 4AVTA 3HNMA 2VVDA 5CFDA 2LUWA 3MF6A 1FMD3 1CGPA 1SLTA 2QZ2A 2RS51 3HQUA 1WBFA 1IS6A 4LITA 4BPZA 4XFCA 1IG0A 4QQOA 3SEPA 2ARXA 2TNFA 3FFZA 5FYTA 4CXWA 1V6LA 4XUTA 5T5PA 1O7FA 5A3TA 1WKYA 1S55A 4IUGA 4C8DA 4IETA 4GZ9A 4ITCA 3AXDA 5GZEA 1LKNA 5TSWA 5DMYA 5FPXA 1G6NA 1PIV3 1TMF3 1VBD1 4HONA 4P9JA 3SC7X 5BNOC 2NPIA 3MUY1 3DF0A 3ZYJB 5HCBA 5JOWA 4QQ2A 1QY4A 4RN5A 5C9AC 1W6MA 1V70A 4GALA 4RR3B 2JDPA 1RVF1 4RS5C 5F3EA 1SLLA 2ZS6B 1DQ0A 3MGUA 2QJVA 2HWE2 2QKDA 3OPZA 3JU9A 4YW4A 4WZFA 5KXBA 3E97A 1W06A 1UAIA 2FMYA 2QVSB 5LEKA 3NNJA 5C7GA 4IEPA 5LRRA 5FLJA 3IM0A 2QBXA 4PIXA 1JXNA 3CJIA 5A7WB 2V73A 1TME1 1W8WA 4NVPA 5E16A 1PVC3 2WT0A 1BK0A 4Y22A 2B5HA 3ZYPA 2GN7A 5JSOA 3MV01 1UY2A 2DVBA 5DDJ1 1AR92 3HOBA 3TEXA 3L9JT 2WFPA 3OTFA 5FMDA 4DUWA 1QJX1 4NMIA 4HVRA 3ZMOA 2D93A 2B46X 4MGTA 3ITQA 2C26A 2ZGMA 4G4FA 5LB6A 3ZXFA 4ES9A 2RM23 4DXZA 2NLRA 1R092 3FLTA 1DQ2A 5EXOA 3BUCA 1NA1B 4FTSA 1T2XA 4JHTA 3LPGA 5DN2A 5FZ1A 4AQ2A 1YQ6A 4FQ4A 4Q4Y2 1S0IA 1NE6A 1SEFA 1PHMA 1A3KA 3PUIA 4CEWB 5C8WA 2C9AA 2WRAA 4QX1A 4D0QA 2EXIA 2RMU2 1U5YA 3WF1A 3USUA 5J48A 3ZFFC 5LK7B 4IXLA 4FPFA 1JTZX 3W21A 2VZPA 3IPVB 5T52A 3BN6A 1X82A 1OA3A 1HRI1 4Y4YA 3ZIWA 3OF1A 4SLIA 4XURA 3WHTA 3WV6A 3U37A 1X8MA 1H1MA 2OA2A 3PVNA 1PO22 2R30A 3Q8EA 1IQDC 1DYKA 2Y38A 4Y5Z0 3S0MA 2R042 3O14A 1VBE1 4UBGA 4YVSB 5FTTC 3NNFA 1SG3A 4K7JA 1RUI1 4YLZA 3WW4A 2WS92 5FO8B 3VD3A 1SZBA 2EIGA 3WP3A 2ZACA 3LA7A 4CDQC 2VZUA 5T3NA 3RMYA 5F8PA 2XUEA 5T5OA 4RHV3 4ZXKA 3WVJA 1N3QA 2YDEA 4KBBA 2V72A 4LK7A 5G04L 3GF6A 5K4LA 3S57A 1ZRCA 3ZSJA 2BGOA 1OH3A 2HWE3 3KVAA 3C3VA 3N9QA 4CU6A 2ILMA 1BKZA 2PLV1 4DXSA 1V6OA 3O1SA 3VBRC 1WW6A 3F95A 3ZFGA 4N90A 2AGSA 2H6CA 4EV0A 4RQPC 4A7ZA 2ZKLA 3BVCA 1WCKA 1F35A 4XF0A 3ZXAC 1C8M3 4QXCA 1D4M1 4IE5A 5DG1A 1OLRA 5FZOA 3ZN5A 4CSWA 4DNYA 1AR62 3PLQA 1NQJA 2W91A 3CNAA 1H6YA 2VQUA 1Y9QA 2Q30A 3CZUA 3N9LA 4LOSA 3Q8FA 1F15A 4NHKA 2FHRA 1QKQA 3E5XA 1A78A 2BOIA 3N7LA 2XDVA 2B42B 4LXLA 4MXWB 5JR2A 3ZXEA 2R0HA 4MOAA 4CCCA 5LA0A 2BP6A 5CFDB 3NAPC 4ZZ5A 4YGCA 3OEBA 5GKAC 4A3XA 5FPAA 1R093 3DN7A 3DPRC 3TRSB 2WABA 2DVAA 3OBAA 1OF4A 1OOPC 2RS13 3OG2A 4M3CB 2VR4A 5IW0A 1UOGA 2D98A 3T2PA 4AI3A 4CDXB 4DY3A 1DGRN 5LWBA 4Q4Y3 4B7EA 1NCQA 5JXJA 2C5DA 3LD8A 2G4IA 2WFF3 1JZ8A 3PUHA 4XZPA 5D8AC 1E5RA 1O5LA 2RMU3 1X8EA 3AKQA 1GBGA 2D3SA 5FY9A 1C5HA 1S2BA 1VBC1 1W3VA 3H50A 1CAWA 3OD0A 5C5TA 2ET1A 4HLTA 4E4HA 3D3AA 1KS4A 3BPZA 1ND3A 1JYCA 3N36A 4B1MA 2OX0A 1QOTA 5FYSA 1OXCA 1PX4A 2DFBA 2W08A 3NJXA 4AEJA 4A3ZA 3G6JB 4MG2A 3WDYA 1W6QA 1J3QA 4BCUA 4QX2A 2W92A 1W99A 3GJAA 3VZLA 2VCAA 3TOJA 4XJ9A 3UGHA 1HW5A 1H9PA 1FMD1 1YFUA 1DZRA 2PHDA 4BQ5A 4CZSA 2X8KA 5FZBA 3N35A 1I6XA 4QQPA 1RUD3 4U2AA 3VZNA 3G7DA 3T1LA 1LOBA 4QWNA 5IVYA 4UYBA 3T2TA 1P8JA 4ZU7A 4JKLA 4H7MA 2NP0A 3MUZ1 4BQWA 1XPWA 5ISLA 2IVJA 5JLVA 5CVRA 4I02A 5LA1A 1XE8A 1KFUL 3E5QA 3WINE 3BTXA 1O91A 4EN0A 1A34A 3WNNA 5J36A 3QD6A 1ZRDA 5CG8A 4QD2A 4XC9A 4AFCA 2WWSA 2VZSA 4V1PA 1AR63 4NHXA 5A32A 5I8YA 2ZKNA 1Z0HA 1CIYA 1UKRA 3VHRA 1MZ6A 1DCSA 5A3NA 2WR9A 3JXSA 1YXWA 4RYDA 1TNFA 1Q8QA 2IC1A 2N7GA 4XDOA 2BERA 4C0BA 3VBOB 3HT1A 4YM1A 1IZ3A 4UFHA 1ZX5A 1MQTB 1U5XA 4I09A 3ABZA 4KGQA 1R1A1 3BTAA 4OI1A 1WGPA 3AMPA 4IE6A 5JPMB 4LE4A 4KGGA 1ASJ2 3VUOA 3AFKA 3IZOA 3POJA 5A7QA 5K0UB 3IDCB 4XJ8A 1S0BA 4OUEA 1C28A 4AR2A 3HWJA 2VQ0A 2CHHA 4N9IA 1PK6A 3D0JA 1YC61 2PXJA 2CU5A 1MEC1 2D43A 3JB4C 3AZYA 1UIKA 5KHIA 1W6OA 4XACA 1FOD2 2Y6FA 4AHXA 5CFCA 3UKVA 4UW4A 3TAYA 3JBG1 4MGYE 2FMDA 2YY1A 4XXAA 5FY8A 1CR7A 2A75A 2CV6A 2Y64A 4FFIA 3NV1A 4UI9L 3URFA 3VBUB 4JQRA 4DZGA 3C7EA 1UY4A 3ZPOA 2RDQA 2VCCA 1ZZ7A 3IAPA 4K40A 1EUTA 4XPVA 1Q43A 2ARAA 5FAXA 4NAOA 1BK1A 4E2SA 1NY71 3W20A 1SDDB 1ZRFA 2DYCA 5A1LA 1JU4A 1WLCA 5BNNB 5FZEA 5FYIA 3SXWA 4DUXA 5M0TA 3ZFGB 2VUJA 4LLOA 5I93A 3VB9A 1RUF2 3W58A 2AYHA 4HSJA 3FMGA 3CBNA 4X8NA 5FZOB 2E7QA 3A7QA 1JHJA 1H1AA 2E63A 2W1WA 4R9CA 1OURA 4YGDA 3SISA 5KC5A 5A33A 3THDA 3AJZA 4GH4B 4E2GA 4AVCA 3NV3A 2TEPA 4EWDA 4PDWB 2BVVA 3FJSA 3OGGA 5K9YA 1LGNA 1VR3A 1RUE2 2DUQA 2XKPA 2XONA 3RS6A 1SFNA 3ILNA 5FQ0B 1O3TA 2XQXA 3H3LA 2DCYA 3I8TA 4IW3A 3KT7A 1GOGA 1FATA 2YU2A 3HIFA 1AR82 1Y43B 1AR71 2RDRA 2JDYA 4BMEA 4ZS3A 5C33A 3SITA 4LHKA 4IE7A 3MBWA 1IHMA 3AMQA 4N9HA 1Z7S2 2VOTA 3VKOA 1HV1A 1CN1A 4KU8A 4MGSA 3VDDB 4DRRA 4B7KA 3KV5A 3IWZA 3RNSA 1R082 1NQDA 2Y26A 1LU1A 3SKVA 4A7KA 3DUIA 1VIWB 2BGCA 1BVP1 4XCAA 1AL23 1QF3A 5IFPA 1ND2C 2DF7A 1JUHA 2JG8C 1H4HA 5FY7A 1KDMA 1QJU2 2ZGTA 4AE2A 4A6OA 5ACA2 1ND3B 3OGSA 1VMHA 2VZVA 4IGQA 4FPYA 4PT6A 4JCKA 4XTMA 2VZTA 3IN9A 4QU1A 5H9PA 5FZ4A 1IOAA 5FYVA 1AZDA 3AP5A 4Q27A 2WWJA 5DZFA 3VKLA 1AR91 4I3GA 5DZEA 4CUAA 1QJY2 4XYXA 4Q1RA 2YROA 5FPLA 5A6YA 4FPHA 4BK5A 1NZIA 3MIGA 4IV3A 1FOD3 2Y0IA 3MYXA 4O9EA 2A6ZA 1HB2A 4BXFA 1LULA 4Q8LA 5A3WA 4A42A 1EP0A 1QU0A 1DP0A 4OYUA 3ZKUA 1M4WA 3ZDSA 2R061 2ZGQA 3POYA 2ZJCA 4MYEA 4HKWA 1KXGA 1PM4A 3HMYA 3FFQA 1PZ8A 4BIFA 2AR6A 3ACFA 2JE8A 3GGLA 3KV4A 1GQPA 4LNVA 1ONAA 1O3QA 1WMXA 2XR4A 3GZEA 3R6SA 5LBBA 5CA6A 1Q56A 2ZGOA 1EV13 1N1VA 1VALA 1RUF3 1OT5A 2XMLA 4XUOA 1UWWA 5DXDA 4HPKA 2CGNA 1QQP1 4XFIA 1HN0A 1PNFA 5LEJA 4LQRA 1PO21 1XBFA 1HRV2 2CDPA 4YARA 1V9U3 4YG6A 5GM0A 2R041 3WY6A 2VOVA 2WS91 3HPNA 4JGYC 4FVVA 4YZ2A 1W9FA 3OUIA 1WLWA 3AZXA 4QAWA 2ET7A 2P2KA 1OQEA 2J1EA 2XKOA 3S7EA 5IVFA 1HB4A 1ZNPA 3NRUA 3ZOIA 2RJLA 3EQEA 1WCQA 2OZJA 3DL3A 2JDKA 3ECQA 2YC0A 3M4FA 4HN1A 2VGDA 3LFMA 1Z7S3 4LOTA 2JDNA 4Q8KA 3O1VA 3WF3A 3UKTA 1J59A 3ES4A 1SCSA 4YRDA 1FT9A 4X6QB 1PK6B 2BU9A 1REDA 2CAVA 5EFUA 3T2OA 3WP4A 1R083 5C4WC 4UF0A 5GALA 1W6OB 5CFCB 4BYYA 1D2QA 2XWBB 3VBHA 5BNPC 4GA9A 5FZIA 5GZFA 1LHWA 2VD7A 3GNEA 5I0UA 2ZX2A 1IS5A 2VQTA 3C2UA 3DGTA 2RJ2A 2R16A 1AR61 5ACA3 2IUWA 3UYJA 3A0NA 3BIWE 3LGRA 5J37A 3ZXDA 1WD3A 1O4TA 1UKGA 3O1PA 1PGL2 1NUKA 4D69A 2NN8A 1VBB2 1W0NA 3GBFA 2MEV2 4UFMA 4XF3A 3U14A 1QJY3 3I97A 2LROA 3LA2A 1XSQA 4PLOA 1O3RA 4CVUA 1BBT1 1QJFA 5ANNA 3ZSEA 3M3OA 3OYWA 3VN4A 2HWF2 4M4RA 1UX6A 5GZDA 4BQ3A 3HQXA 3VBSA 4LBKA 1WA6X 4D6SA 4AFDA 5EYXA 1CWPA 1Q8OA 4HVOA 4XE9A 2UYBA 2Q8DA 1SMVA 1W05A 2PAEA 1ULFA 2XHKA 1EPWA 2RS31 2OW4A 3FLPA 3ZR6A 4CCEA 2B7YA 2RDSA 1F2NA 1NXMA 4MVTA 4YZ4A 5FXVA 5A33B 3VD4A 2J1RA 3RRDA 4ET7A 1CZTA 1B35B 2DBNA 2QDRA 3RYKA 4GMP3 4COVA 3WT3A 4HANA 1GWLA 4HN0A 3H7YA 3PVOA 2GU9A 1FXZA 2AREA 2ERFA 1W39A 3LB9A 3WDXA 2I2SA 4H3WA 4K8RB 1H8TC 1WLTA 3ETPA 3IKWA 3MW3A 4CEYA 3FBYA 2FCVA 3H0OA 4QM9A 4FPEA 5ERLA 2XJVA 4BQ1A 5HCHA 1CAUA 1WMDA 5FZLA 1HN1A 4JTNA 3RYRA 4WM8B 4NIIA 3KD4A 4HK9A 1HQWA 1TQ5A 2WLPA 1SFPA 5KHHA 1JW6A 2JEMA 4OUSA 1GANA 3GCXA 3M70A 1DYOA 4K1ZA 4BISA 2BNMA 5CNAA 5FBZA 2XOMA 4B8EA 2WT2A 4K21A 2CNAA 4LO7A 4YG3A 1A8MA 2JWPA 4PIYA 5FMOS 4OMDA 4JRLA 3B69A 4LKEA 3OSDA 2WYFA 4QXKA 1QWRA 3AVSA 5FZFA 3L2YA 2R6QA 3M3QA 2WT1A 4AF9A 4CDUA 4XBQA 4P9XA 5FBJA 3WF2A 1WW5A 1RUG2 3HBKA 4IV3B 2D40A 4L11A 3V64A 4D3WA 5CYYA 3ZO0B 5IHRA 3RPQA 4AVBA 1WBLA 4WVVA 3KVBA 2R32A 2QQUA 4W65A 2PHUA 4YVWA 3I2JA 2WZ8A 2O8QA 5IATA 4M00A 3J7HA 1J84A 3HD8B 5J98B 1MS5A 1R64A 3WX5A 4XTPA 3T3YA 4CDWB 4BM8A 1VBB3 2WZR1 3AZVA 1K5MB 4Q0SA 1OH4A 3M2MA 2B45X 3R4SA 4I30A 1VJ2A 3TYJA 1UYYA 5FWJA 1GLHA 2X5IA 2HWF3 3WG2A 2JB4A 2GZWA 2PHWA 1YUDA 4LLFA 4ASKA 3NKGA 5FZ6A 4LO8A 1E57A 3WNMA 3ZFEA 2B8MA 3B00A 4IV1C 2EXKA 3JZVA 1ASJ1 4XJAA 3Q9OA 5L9VA 2GN3A 3LEMA 3I2FA 5LASA 4QKFA 4YM3A 1JZ4A 1YYNA 2Z4FA 1W8FA 4DQAA 3P6BA 4FT8A 1YQ8A 3UV9A 5I0TA 4P14A 2VZQA 1OQ1A 2XBO2 3ORJA 1SDWA 3O0XA 1TVGA 4DB5A 2QQPA 3QH6A 4QT6A 3SH4A 2WNVC 3VBFC 2WYSA 5FYBA 2VH9A 2XXZA 3MV11 4PF1A 5IK5A 4YM2A 4JQTA 2QQNA 1VB2A 5BNOA 3IDBB 4YPJA 3BU7A 1RUNA 1F4AA 2H6BA 2UWBA 1Q8PA 1UL9A 4NROA 1H4GA 3RSJA 2P34A 5C9AA 2GMMA 3ZXGA 2G9FA 5IT6A 4P00B 1VMFA 1V6KA 2GNDA 1VRH2 4GB32 1POV3 4GD4A 4KI5M 4C91A 1PIV2 2Q1MA 1E5SA 3H7JA 3M7AA 2PFWA 3ES1A 4UF0B 1JZ5A 2FCTA 5JUVA 1QOSA 2NYYA 4FPOB 1PO11 2BUKA 2D44A 1WCUA 3ZYHA 1VRBA 2A6VA 1XYNA 4GIQA 5H9SA 5FXXA 1GNHA 3MFAA 2O0OA 4LJHA 4XABA 1PZ7A 3M8LA 4D94A 3DYMA 5A6QA 1MVQA 2WA4A 1AYN2 3BOPA 3VHNA 1ZZ6A 1YIPA 1ZBA2 1GKBA 1HXS3 2D7FA 5DAPA 2YHJA 2YPJA 1RC6A 1L7RA 2ZEYA 2ZMKA 1RUE1 1WW7A 3B7MA 2RVAA 3HN1A 4Q4V2 1RUG3 3OYWB 2H0VA 3UJQA 4BDVB 3VBSB 1NKGA 4C1WA 1W2AX 2XQRA 5FREA 1AR81 4Y5TA 1I1EA 4W4ZA 4XF1A 3VZOA 1AL0G 3RJ2X 2J1AA 4O61A 2VNGA 3S30A 3RZJA 3PJYA 4OZOA 3VD7A 3QCWA 1JYWA 3H8RA 4IGOA 1U5ZA 5FJKA 3TEYA 1UMIA 1SLCA 2A6YA 4AZZA 3ZPYA 3UNPA 4AAPA 2YYOA 1PVC2 3O1UA 5GJ6A 5A1FA 1QIQA 2DWRA 3VLBB 5J1XA 5EHDA 5EYYA 5GZGA 1DYPA 2HWD1 3QH7A 4M01A 2UU8A 2YBPA 1JYXA 4OI4A 2W0XA 2K9ZA 3JUUA 4MH0E 1GWKA 1QJU1 4R9AA 1NLSA 1OFSA 1WWYA 3ZFFA 1UX7A 2IXCA 2Y33A 3AVRA 2UWAA 2OT7A 4JGZB 4M3CE 2OUHA 1CAUB 1JOBA 3TNPB 3FUQA 3QLQA 2Z5WA 1G9FA 4CP1A 1MS4A 2IXLA 1LECA 2HYKA 4I3PA 2MHFA 1CESA 2DU1A 1IGOA 4OHWA 4QPGB 4RR3C 2OXBA 5GLWA 3HR9A 2K0GA 1BEV2 1V6NA 5FP8A 3NNLA 1Y9GA 4LBJA 2GC2A 3ON7A 1CZSA 3KWVA 4QB1A 1VRH3 3POWA 4GB33 1OA2A 1YFWA 3C7FA 3T1MA 4YZ5A 5C8CB 3RZKA 4CDUB 3WP5A 5CKNA 3T08A 5L36A 1BYHA 4P9YA 5SV8A 1NX9A 4LE3A 4NR1A 1O8SA 1LOFA 2X09A 1S0DA 3CIHA 3KZ4C 4BLJA 3VBRA 2WO7A 4BZ4A 2QQWA 2O8OA 2Q0AA 2WNUC 2W9XA 3DCQA 3IT8A 3MLLA 1COV2 2D6LX 5FZ8A 1AYN3 3AYDA 3ZKYA 3FL7A 4JRAA 4RHV2 4RQPA 3ZYIB 1ZBA3 1HRV1 4EE2A 3AFGA 4P9IA 1XNAA 2A70A 1CIWA 1V0AA 2VTFA 2ZOEB 3UETA 5HPOA 4OI0A 1TG7A 4Q4V3 5EIYB 1ZZ9A 3P5BA 5F5IA 4GQ7A 2OKXA 2E51A 1AJOA 3ZFEB 1YCIA 3RZHA 1O5UA 3NAPA 3D5OA 2W46A 4LMFA 1VB4A 3RFRA 3WEZA 1C8M2 4A45A 2ZABA 3I2OA 3O1RA 4XOGA 4CCNA 5HCFA 3EB7A 2ZX4A 4LBMA 3GYDA 4LA2A 3DPRA 3VDBA 4CEWC 1XC6A 2VMHA 4QU2A 1OOPA 4GWIA 4PCRA 4CP9B 4AXOA 5FO9B 4AI8A 1UYZA 1KITA 5FZ3A 1G7YA 4ZXEA 5L7OA 4E4ZA 3MPBA 1W3XA 2BBAA 2ZTNA 4ZY9A 5CG9A 2KR2A 5D8AA 2VOKA 4XUPA 1OLMA 2OYZA 4RGKA 2DVFA 1RUJ2 4P02B 2HKXA 1ZBE1 2RS12 3MIFA 4HBNA 5FZ7A 3H9AA 1REFA 1UOBA 3AZWA 2MEV1 3MEPA 4JAAA 4W8JA 5F37A 1X33A 3LE0A 2R073 1W04A 2J1TA 3ACLA 4YVSC 2YU1A 2WFF2 4PQ9A 1KGYA 5FMOL 2Q4SA 2VMFA 5I0DA 4XQDA 3BTYA 1Q8VA 3AP4A 4DXTA 2E9QA 5FCCA 3A0KA 3OPTA 4EROA 4F8AA 1G9AA 1DLLA 2VMDA 4IEOA 2NZ9A 3VKFC 5CAZA 2R0FA 1BEV3 3AYCA 3P3PA 2YXSA 4QPIB 2QQMA 1DIWA 1UO9A 1US2A 4Y3OA 1QH7A 2R7EB 4IDZA 2WA3A 5AC91 1QJEA 4GMP0 4ATFA 1GZTA 4UW5A 1ENRA 4D8MA 1BVVA 5FDBA 1SLBA 1W8NA 3ZIXA 4YZ1A 1OI6A 3D6EA 1ZZCA 4ARYA 1YIFA 1ULDA 4XILA 5GLVA 4EN6B 2HLEA 1RUD2 5FP4A 1AXKA 1COV3 2A7AA 2IXIA 2D6NA 5BV6A 1KS5A 4W6WA 4CCJA 1JS9A 2A73B 1LESA 2E31A 3JD73 5FWEA 4YGBA 4YYOA 1UPIA 1CVNA 2A71A 4LBOA 2HWC1 1GMMA 5CFDC 2DUPA 5DZGA 2DTWA 1QXJA 2ES3A 5LW9A 3ILFA 1G9DA 4AFAA 4AI0A 2NMOA 4NRPA 4EN8B 2CTVA 5EV7A 3GZUC 1NLQA 3I3DA 3VDAA 3VD9A 4CCMA 1YJKA 4CDXC 3O1OA 4Z2AA 1ZRIA 4J1WA 5C3PA 2BBVA 4GWMA 2VXRA 1N3OA 2WO3A 5DAQA 3KT4A 2Q8CA 3WG3A 3EBRA 4Q4W3 1RTVA 1ULCA 2IWGB 4N43B 5HXMA 1XE7A 3AKTA 1H2LA 2V4AA 5LY1A 2ARBA 1N1SA 1U5IA 3UESA 2VU9A 3KF3A 4IQPA 4Q2FA 1MPXA 3I7DA 2ZHLA 3UL2A 3H3ZA 4RGGA 1DZQA 5DUXA 2HJIA 1I9RA 1SBEA 1RUJ3 4CTEA 4DOUA 1Q8SA 3TWIA 2B4KA 4OMCA 1R1ZA 2G9GA 2GC0A 4TWTA 3NVCA 5T5JA 3WDTA 3VKNA 1W2OA 2WLQA 4AVVA 2VECA 1AYM1 2W1QA 1XNBA 4BQYA 3RZMA 4XCBA 1MZEA 3OGVA 1X50A 1GZWA 1W6MB 1RUH3 1VBA2 4B4QA 2GNMA 1O6UA 4QHOA 4LK6A 4S2GA 2VNOA 4V2VA 1OF3A 5JZGA 2WKKA 2VUAA 4RQPB 4N7IA 3UJOA 1UZYA 1S2EA 2VCMA 4I0WB 1UU5A 3WSOA 1FPN3 2GDFA 4S2DA 3GZTB 3TBDA 2XBO1 1F8VA 4YW5A 4XQ4A 3LSEA 4YW1A 3PU8A 3BU0A 2WNOA 2IZWA 2E6VA 2WSUA 4NWWA 3WD5A 4DRVA 1HDKA 4AL9A 3AP9A 3MF9A 5I0SA 3KGLA 3KCCA 3BOWA 2A1XA 3C8XA 1UXXX 3PMSA 3RI9A 1W9WA 2P37A 4LKFA 3MLKA 3I59A 4N53C 2VW0A 3CJIB 2BDRA 1CPNA 1GICA 3B9IA 1A6CA 1JH5A 4Y22B 1POV0 3WQ7A 1XYPA 4HETA 3VBOC 1LHOA 2KM2A 1UQXA 1PIV1 1TMF1 2MNGA 2JD9A 1U0AA 1MQTC 3KSCA 3E6BA 1LOGA 4FXGB 4O7XA 1QMJA 4QHBA 5L7OB 3W5NA 1DQ4A 2OIIA 2RR13 4BIOA 3BTZA 2C4XA 5D8AB 1RMU2 3WDWA 1J3PA 4IEUA 4Q1PA 4YM0A 5FPUA 1OPOA 5JSRA 1PGSA 2EIBA 3BPSA 3J9SA 4UFJA 5JMCA 3VGIA 2VMCA 1ND2A 5K0UC 5CBLA 1URXA 4LBQA 1OBNA 3VDCA 1W28A 3AKRA 4NPRA 4CUCA 5IAXA 2YFUA 3DYPA 1K45A 3BKZA 4ATEA 2VO5A 2RHPA 2ZA9A 1N1TA 5IK4A 1JZ3A 5LRSA 4K8FA 4ZS2A 2XJPA 3E5UA 2I45A 4LBNA 1OKQA 3USUB 4GAZA 1US3A 1YRZA 4LEJA 1QXRA 1WLDA 3THTA 3VBUC 1AL22 3SMHA 1WD4A 3I54A 1OVPA 1U12A 2OZ6A 4H14A 4CCDA 2YMZA 4R4ZA 3A4UA 1I5ZA 1RIRA 4Q4X2 1PVC1 4Q0VA 4J25A 3J7MA 5APAA 3N4MA 4R9BA 4DEVA 4EJRA 2WQ8A 4CP0A 2XJUA 5IVVA 5BNNC 3MW2A 1YWKA 4IL7A 4MHUA 5C71A 1UW8A 4RFRB 1BLZA 4YNIA 5F5QA 1EY2A 2I74A 3SCGA 1Y7BA 3ZN4A 2HEVF 2JD4A 4XJZA 2JDZA 1G86A 1IS3A 1VBA3 2A3YA 2FDJA 1FI2A 2RM21 3IIIA 1XU1A 2ADDA 1H8VA 5T50A 2Q1FA 4FXKB 3RMXA 1REEA 4LHLA 1OPMA 5I8TA 1J1TA 4B4PA 2XJTA 4GH4C 4RD7A 2X05A 3ME2A 2CAUA 1BQPA 4PDWC 2FDKA 5IAVA 2DTYA 4EWAA 1FYUA 3WP6A 1W6PA 5BXXA 3HNYM 4QPWA 3KV9A 4BB3A 2BEOA 1G9BA 4MGQA 4KL1A 3FBMA 4DS0A 3ETQA 4QXBA 4XHBA 1EV12 3LEIA 1HX6A 2BWAA 4A6SA 4GJZA 3WNXA 4JGYA 3JB8A 2TBVA 3Q8CA 4AYUA 4CRQA 2VBBA 1W9SA 2AC1A 4HVQA 5EZWA 2Y60A 3OBTA 4FP3A 5DUVA 4Y20A 5A6XA 1OHFA 2ZZQA 4PBOA 1SACA 3K2OA 1V9U2 2B9VA 3VDDC 2GALA 3USSA 3FC0A 4R9DA 5FRAA 4ZZ8A 1O4YA 2VJXA 3OUJA 3ROUA 4WM7A 4MGKE 5H9RA 5LA2A 1RMU3 3PU3A 2JX9A 5JOXA 2PHLA 1O59A 2NQYA 1JMUB 4FO9A 1LB2A 1ND3C 2EAAA 1GOFA 1HQLA 4XXPA 5BNPA 4RHV1 5FK7A 1H9WA 5FZDA 4EN9B 2PQQA 3E1F1 2W1UA 3HJRA 4NE9A 3W9AA 1NCQB 1C3HA 2HWE1 2ZGRA 3SHRA 3VKMA 2P3KA 5T55A 5IYYA 1JYNA 2WO1A 5FZHA 5BYNA 4MGIE 4W50A 4AEDA 1LENA 2G1MA 2CGOA 1DGWX 1LCLA 4QX5A 1CAWB 3HQRA 1EAH2 2NM1A 1UY1A 1C8M1 3J8F3 4NHLA 4Y1XA 5FUPA 5K8SA 4XBLA 1QOOA 2E33A 5IFTA 5JZGB 4MHRA 1C57A 3T09A 5C3RA 4Q4X3 5HBAA 5E1RA 4JHZA 2VULA 3FHAA 1W6QB 1XYOA 2ID4A 2D6PA 1C4RA 3THPA 3LCPA 1KDKA 3OCPA 3PL0A 2FZ2A 2D6KA 3O7OA 4A2UA 2W5FA 1YNAA 3HT2A 3BI3A 1A8DA 4P5YA 3RZGA 1R091 5AVAA 5HCAA 4FOQA 2QQIA 1K5JA 4BU2A 1W2NA 2RS11 1ULPA 1OSGA 2R1DA 4Z8BA 4KQ7A 2W68A 4Q4Y1 3PMEA 5B4NA 1H8TA 3ZN6A 3WCRA 5A80A 4XFAA 4EQVA 2WFF1 4G9SB 3U0ZA 4OHXA 2BNNA 2DCJA 4UFLA 2RMU1 2JG9C 4XF9A 1J1LA 5JVVA 4EN7B 5EP9A 2YPDA 2VMEA 2QDNA 2VVEA 5DPNA 2EF6A 2VQAA 1N3PA 4L92A 5FP7A 3NKTA 5A32B 1O8PA 4A41A 3O5SA 2ZHMA 3TN93 1OUSA 2PN5A 2VUDA 3K75B 2JECA 3FE5A 4LBQB 1LU2A 1KRIA 3DECA 3M3EA 4D7YA 1CAVA 5I91A 5FO7B 2GP5A 5A7SA 1PK6C 4Y26A 4KWKA 1UNBA 2DUOA 4GXLA 4LR4A 3S6PA 1AX0A 3PTYA 5D21A 1UN1A 3WNKA 4YG0A 5CFCC 3E6CC 1HQNA 1SLAA 1Y9MA 2K2SA 2ZEXA 1ST8A 1VP6A 3H1WA 3LZZA 5FLIA 3RWKX 3WOGA 3ZYFA 5ABJA 2EALA 2CY6A 1RUD1 2HBUA 3LSDA 5F39A 2Y8KA 2QFEA 1AX2A 3NSTA 2FCUA 4TYSA 4GWJA 5C3QA 4XETA 5LK5A 1PZ9A 4OLLA 1JN2P 4NOTA 3R4DB 3H1YA 3T2QA 5LCWL 3H8UA 1GOHA 4XHXA 4OI2A 1CD3G 3AYAA 3WNPA 3ZXKA 5FP9A 4DINB 1JYIA 5F3IA 3BGAA 2GMEA 1LJ7A 1AVBA 4D6QA 2UY8A 4TXWA 2OS2A 2VTXJ 5EJZB 5IK8A 1RXFA 3GHNA 3GJBA 5FMCA 3KB5A 1EAH3 1YFYA 3AKPA 1LAJA 3SH3A 4AGGA 4QXHA 3IB3A 4IV1A 1GP5A 5FK8A 4HG6B 2QZ3A 1JOPA 4ZONA 1B35C 3KQRA 1YEWA 2GH8A 5DG2A 4NUBA 1UD1A 5LBCA 1PGW2 3KT1A 1FNYA 5DDJ2 2Q1ZB 4LUMA 1FNZA 1UZWA 4M0HA 1E5IA 1MS3A 4B29A 5DQ0A 4LULA 4JGYB 4URTA 1XNCA 2KXLA 1FAYA 3D82A 2ZX1A 4IEQA 5FOJB 3AMNA 4OHYA 2PAKA 4WM8C 5KWRA 3DXTA 4XUQA 2NMNA 2F6BA 1QDCA 5JXIA 4E4DX 2RE9A 5IJRA 5JI7A 3UKNA 2WAOA 4JDNA 5CIRA 1SPPA 4YSFA 4WM7B 5K7PA 1NE4A 2CWSA 4Y1ZA 2YGLA 4FFHA 2JE9A 2RS53 1UYXA 4LHSA 4UBHA 1S0CA 2WBKA 1UY3A 4QKDA 2HH9A 5BNPB 4KWJA 1ZREA 1CJPA 3AJYA 4PBPA 4S2HA 3R0RA 5IWFA 2ARCA 2EICA 2VC9A 4FI9A 4MV2A 2LW8A 5FPZA 1YQ2A 2JICA 3I2DA 4ASMB 5DUWA 4S2FA 1K12A 4IV3C 2XPJA 4XF4A 4GULA 2F4PA 3ILRA 2WC2A 5DAVA 4UAPA 1W03A 2BNOA 1VBD3 4PIZA 4AEDB 5FZAA 4XJWA 2UURA 2P6CA 2XL7A 5CU1A 1VBE2 5IK7A 3AYEA 2W39A 5CADA 3T4VA 1RINA 3EYPA 1T6BX 3LDRA 3WUCA 4CDWC 3N7KA 2PHRA 1K5MC 4ES8A 4FFGA 1GNZA 1HXS2 1GSLA 3POEA 4YW3A 3ELNA 1HKDA 1QGLA 3ZM8A 1D0GA 1Z78A 2ZZJA 4JVAA 3J26N 1VAMA 3ZXLA 1B09A 3CO2A 3ACHA 3HAGA 3O0WA 3WNOA 4OUMA 4YFWA 2PYTA 4EZHA 1S0JA 4WBBA 5LA9A 1XB9A 1UU4A 1NG0A 3N7MA 5GLTA 4D7TA 3H8XA 1IKQA 3MPPG 4PLNA 3MDPA 1JYVA 1GQGA 1GV9A 1XNDA 1EUUA 4JDOA 4E8DA 1NCRA 4CU8A 4DXRA 1TME3 3K4DA 1GP6A 2PHFA 4GKYA 3SCHA 2EXJA 4E9KA 2ZCWA 1GQHA 3N9OA 5DDJ3 1N47A 3BB6A 2D5HA 1QJX3 4HOOA 3N9MA 2DCZA 3HVDA 1AL21 4AFMA 4Y5SA 4HPKB 3FN9A 4JKKA 1BMV2 4Y1VA 4TN7A 3GBWA 2PQSA 1LHNA 2W47A 2ZXQA 2WQ4A 2Y6KA 5CB7A 3K4AA 2AZ5A 2D6OX 4RR3A 1CAVB 1D0HA 5A3LA 3A22A 1OKOA 2QNKA 3RI8A 1M06G 2B9UA 2VM9A 1OVSA 1FOD1 3BALA 1V6MA 3AMMA 1WZXA 3PNAA 2GNBA 4UFIA 5F32A 5FPVA 5ABJB 3UGGA 2Y6HA 3RQ0A 1WA4A 3LKJA 2ORXA 1X36A 4AAXA 3GXUA 5BNQA 5E89A 1CX1A 3APBA 4CP2A 3B94A 1VBC2 2D3PA 4LKDA 4NPMA 5CZKA 5BY5A 4BQ2A 3HBZA 1HRI3 4QX7A 2WAAA 2WNUA 3WW3A 1IPSA 1ULGA 2HBTA 2JENA 2LS6A 4RS5A 5KBFA 4K6BA 4FSJA 2YBKA 2VOWA 3VBSC 5BPXA 1BHGA 1NLRA 5E8AA 4LT5A 2DDUA 1EV11 1F5FA 1VBE3 1VLNA 1RUF1 1UZVA 4QQHA 3VBHB 1KQRA 1RUI3 4E27A 1C8NA 4TSVA 3WXPA 3T30A 2FD8A 3D4KA 4RGAA 4U36A 1WUVA 2Y0OA 3AP6A 3OBZA 3NJZA 2AENA 4AEKA 4GJYA 3FHIB 3CZJA 1V9U1 4D7SA 3P1IA 3GM8A 4QMAA 5FOBB 3I3BA 2KA3A 4A4AA 4F7ZA 3QBQA 4BMBA 4TLFA 4CEWA 4CPBA 2PLV3 1GUIA 1VPHA 3WG1A 4X8PA 1L7QA 5I8SA 1G8WA 2WZPP 4CA9A 1OQDA 1KJLA 3PHMA 3IPVA 4JGZC 3I3QA 3MHZA 3H3UA 5G05L 5EJ3A 4AHYA 4BE3A 2BTVC 1D4M3 2VAUA 1W8UA 1JOJA 3MO4A 4XFHA 1Z7S1 2DU0A 2CYFA 4X6RB 1MS1A 4WVWA 5FXZA 4NPLA 4QDSA 2QQJA 3DEMA 3MIDA 1IKPA 3BCWA 4EWEA 1R081 1QH6A 3AL6A 3T4HB 4QGNA 2C0ZA 2XUMA 2W2IA 3AP7A 1X9PA 4YVSA 2HWB2 2BYVE 4QPGC 3V65A 1EAH1 4DFSA 1F5JA 2DBIA 3S7IA 1PVXA 1JI6A 5ACA1 2WINB 4COWA 3NJYA 1ZM1A 1LGCA 4CEYB 1NAEA 2OPKA 3IDAA 1RXGA 4FOVA 2O14A 5C8CC 1WMFA 1MR5A 1MS0A 1QJY1 1YQ5A 5KHGA 2R072 2Z69A 4MX3A 2ATFA 4CUGA 3TEZA 2TUNA 2Y6LA 1DGRA 1D4VB 4LO5B 5FMBA 2J7MA 2QCSB 5GLUA 5SV5A 4XFGA 5FR3A 1MZ5A 3N9NA 3OD4A 4XDPA 4K20A 5DABA 1KFXL 1VBC3 2ADEA 3JBG2 4CCKA 2UWCA 3U4SA 4YW2A 3CKHA 2BQPA 5FV3A 2E32A 4CDQA 5BUVA 5GZCA 4ZU5A 3I2KA 3Q8AA 4HK8A 3O12A 4AHWA 4M0NA 3I4IA 1L3JA 3ALQA 2FDIA 3KQ4B 1HB1A 1VAVA 1W8HA 4GMP1 3WCSA 2H0BA 3INAA 3ZFEC 4OULA 5L73A 3V0AA 1XNTA 4FAHA 4AOCA 1C1FA 2X53S 4HMZA 3T0AA 1DG6A 2WIIB 1J3RA 2IXHA 1MS8A 3ZSMA 4UFKA 1S1AA 4YVWB 1YI7A 1XOYA 2VZRA 4JDMA 5B4XA 5FZ9A 2QE3A 3S5QA 1LEDA 5JI9A 3T0BA 1AF9A 4P9GA 5E88A 2ZGKA 2EIDA 3WDUA 4C1XA 3GZAA 3JD72 1NCRB 4M3CA 4CDXA 4FBFA 5F3CA 3R05A 4AQTA 3B3QE 2UYAA 4LBQD 4NRQA 4XVHA 1RITA 2F4LA 1QEXA 2X5IB 1NT0A 4ARXA 4XBNA 4CE8A 4EYUA 1ENSA 2AEZA 2QQVA 1IPKA 2VG9A 2VY0A 3WDVA 4BQ4A 3B93A 3I3MA 1FX5A 2JDHA 2XH6A 4E8CA 1NA1C 3JQXA 5HXVA 3K77A 2AEYA 1SFYA 1OLME 3ENRA 3NV4A 5AFEA 3MIEA 1AR72 1ENXA 2WN3A 1ALYA 2YGMA 2JDUA 1BZWA 3CMGA 1UMZA 1PMIA 3PJQA 1W9TA 4J6GA 1EPZA 3CL1A 4Q4W2 4QX8A 1D2SA 3VZJA 4CYDA 4ORFA 3POSA 2XVKA 2EAKA 3LOIA 2HWB3 3NL1A 3ZX7A 5A3UA 3NO8A 1Y4WA 4XIOA 5BNOB 5FFOC 4ZHNA 1LEMA 4Y1UA 2D97A 1R1A3 1S4CA 1XE0A 1C5IA 1XNKA 3N7JA 4QPIC 3B01A 4HXCA 5C9AB 5HV4A 4H55A 3F2ZA 5LZ6A 2WNUB 1PGL1 2ZHKA 3J7LA 1VBB1 4BWOA 1JYTA 3RVHA 2I07B 3A21A 3CDZB 4KWLA 4RS5B 4MXVA 3IIAA 4Z1VA 1NZCA 1PGW1 2GSYA 2HWF1 5F7UA 4BJ0A 2EVXA 2PELA 3K4ZA 5FYUA 3ACIA 5IVEA 4FQZA 1S2KA 1MEC3 3DKQA 3R4UA 4FPCA 3VD5A 3OGJA 3AM2A 3PURA 3VHPA 3EO6A 1RUH2 4V2WA 5A7OA 2XLFA 3JBG3 2ZX3A 2ZEZA 5LY2A 5A3MA 1XU2A 2FQPA 4CUBA 1IG3A 2VE1A 2JKXA 2R062 3FLRA 1FPN2 4LUKA 4N53A 1GNYA 4ZKTB 1LOCA 4YWAA 4AK3A 4LO6B 2XWJB 1CPMA 2P17A 4FOYA 1L7LA 5FYZA 1AXYA 2VBDA 4L9BA 3LOBA 3VBOA 4Q5OA 2PMWB 4JX0A 1LTEA 5C5UA 1MQTA 1YFXA 4XMAA 3OBRA 5LBFA 1DHKB 1WCDJ 1AUYA 1NOVA 1W2UA 4LIUA 3O1TA 4OQ9A 3SEEA 3MZHA 1JZ6A 1J58A 4L8QA 3VHOA 2DCKA 4L0PA 4FPLA 4YZ3A 1RHI2 1QQP2 4COYA 3T0DA 2VMIA 4N43C 5C3OA 3PUSA 1POV1 5ANQA 4META 2QQOA 5K0UA 1TEIA 2YC2A 1DQ1A 1RUC2 3KF5A 3RG0A 4AVAA 3RYPA 3LQCA 5EJ1B 5FY0A 2IXKA 3SH5A 4QHZA 2RR12 3N3HA 2BOJA 5F3GA 4ISRA 3ZFFB 1XXNA 1AR73 4NIDA 3VBUA 1V00A 1JODA 2LTNA 4OFGA 4ISQA 5FZ0A 3SNMA 4FAGA 4MLOA 1HJFA 1HXS1 5FLHA 5F5CA 1UOFA 3D0SA 3WG4A 1OFNA 4IEYA 4BHPA 2BFUS 1RUG1 3U10A 4ASLA 1LOFC 2DFCA 3AXEA 5BNNA 3V0BA 2P6HA 1RB8G 4BXSV 2CL2A 1OMIA 4BOWA 1V6JA 2IXJA 2V09A 2Q8EA 4F83A 2QQLA 1ENQA 2CGPA 1F31A 1DDLA 3ZLIA 4CXXA 4R8HA 4OQ8A 4CDQB 3K51A 5A3PA 5JOZA 2P5BA 3EMRA 3L2HA 1DBNA 1PX3A 4GH4A 2AUYA 2P1BA 1AR93 4PDWA 3OOXA 1N1YA 1NYWA 1OD3A 3JCIA 3V0AB 4LIVA 1BBT2 1O3SA 1H0BA 3KV6A 5FQ0A 5J3UA 4RL7A 1YLLA 1UZ0A 4UW6A 3VBRB 1BMV1 2XG3A 2WUHA 3CJIC 4W6XA 1XRUA 3CU7A 3PDQA 1UXZA 2R063 4Q29A 5DAWA 1GU3A 1ZA7A 2IVIB 2RS32 2V4VA 2DVGA 1MZFA 2X29A 4HKOA 4RA0A 2GNTA 5B2GB 3FWEA 5L7OC 3QACA 3VDDA 4OZXA 5H9QA 2VUCA 3AMHA 3PTRB 4YW7A 3X29B 4K1YA 3WW1A 2A3WA 3TB0A 3CJXA 3NAPB 1VMJA 5T54A 3RGBA 5EQUA 2VBPA 1QXPA 3WUDA 5CISA 4I01A 3OPWA 4INDA 3K48A 4QB2A 2C9KA 1RHI3 1QQP3 4KNCA 4BH9A 3AC0A 3DPRB 2K46A 3DYOA 2SLIA 1VRH1 4GB31 2J22A 4K3UA 1OOPB 1PO23 1YJLA 2JXAA 3RWNA 3WQBA 3B02A 1RUC3 5KXCA 2JDAA 2E7AA 2J42A 4FCAA 4GKXA 5FZGA 1GP4A 5JIAA 3U75A 3LIHA 2G9ZA 1S0EA 1YI9A 2R043 4XAEA 5JIUA 1BJQA 4MO3M 4KWUA 1ULOA 2OPWA 1LODA 2WS93 3I3EA 2YBSA 3PIGA 5FY5A 1QDOA 1SHWB 1SLIA 4F3JA 5C70A 2W94A 1HIXA 4UW3A 3FUOA 4JKMA 1AYN1 2BWCA 4Q0UA 1LOAA 2JJ6A 4XFFA 1W6NA 5J96B 1ZBA1 3I2GA 5FZCA 2JG8A 4C90A 4I2OA 3POGA 1BXHA 1WW4A 1UY0A 4CU7A 4AFBA 4Q4V1 2WWUA 1PMJX 5L9BA 1LOEA 2E26A 2PHXA 3NV2A 5FXWA 3U78A 1W8OA 3LPFA 3RDIA 3ZYRA 3MFCA 1JZ7A 4Y1YA 2W52A 2BVBA 5CKMA 3J8F2 1VE0A 4IERA 1LRHA 3W59A 2GAUA 2YV8A 1IQAA 4NRMA 4QB6A 4I0AA 4N53B 5FZKA 1T6GC 1W8ZA 1S0GA 2P3YA 2WZR2 4FOWA 3VZMA 2WQZC 1UCXA 3ZFGC 4NO4A 1BBT3 1TZOA 4UT5A 1H1IA 2HWB1 5F1RA 3A23A 4MGZE 5IVCA 4AI9A 2JG9A 2J1SA 3PUAA 5JMOA 3I2HA 1LR5A 1KD7A 1ODNA 2D6MA 3OY8A 3CLPA 2RS33 4L2NA 4IEXA 3LWCA 1H2KA 1C1LA 1DGWA 1GWMA 2Z2SB 3OEAA 2R071 4UXAA 4MZUA 4Y33A 3V56A 3M1HA 4AWDA 2VVFA 3RJRA 4M3CF 4Q0PA 5HI0A 2XHNA 2OUJA 4XDQA 1H30A 1K42A 1Y3TA 1LGBA 3TNQA 4H7LA 3ZR5A 1F4HA 1UMHA 5LBEA 1BEV1 1LNSA 1H6XA 3OJBA 4O65A 1ZYBA 2DURA 3TN92 4B3NA 1CZVA 1HLCA 1NCQC 3HEIA 2XVGA 4IE0A 2WL1A 5F6KA 2RV9A 3VV1A 2PA7A 3ZSLA 2AH2A 3BYWA 4AG4A 1AJKA 1Q5OA 1X7NA 4OCTA 4EZ4A 5FKCA 2BZDA 4BLIA 4HKLA 1W0OA 4CCLA 2FDHA 2A5ZA 5A1AA 2C1FA 3V0BB 1W2TA 5C4WA 4PHZA 1PO12 4LO4B 3LDKA 1COV1 5JZGC 2UY9A 2CWMA 3BIEA 3H1MA 1IS4A 1AHSA 3JD71 4JC1A 3C7HA 2BGPA 2XJSA 1F9KA 3SLIA 4JZRA 1VAKA 1NXD1 5EWSA 4AI1A 1B35A 3O0VA 1H2MA 2JIGA 4FFFA 3ZDVA 3KHCA 5D1IA 1E5HA 1ZZBA 2A6XA 2XGXA 3NQHA 1TE1B 4CU9A 4NIHA 1GZWB 4FTEA 2HEYF 4SBVA 5A3OA 1JZ2A 1QHDA 3AX4A 5KR7A 5C6CA 4BA6A 4AGRA 5KC6A 3LFIA 5FJHA 3KCYA 4HZFA 5HV0A 1CAXA 2IFRA 2YB7A 2Z42A 4KH9A 5FUNA 4Q4W1 2X10A 3DV8A 2WZR3 4WZCA 1POQA 4FPGA 4WM8A 3PVBB 2Q8OA 1XQNA 2J1VA 2Z79A 5L9RA 2B39A 3MI8A 2HWD2 2CSGA 2RDNA 4Y4RA 1UOJA 1PM7A 5FYMA 1PMHX 1RUJ1 3I59B 4NHMA 1ASJ3 3KGZA 4TLGA 5GLZA 4CCOA 3AL5A 3C7GA 2ZGUA 3U1XA 4I0BA 3U11A 1XSRA 3MW4A 4PI0A 2VZOA 3DKWA 2DVDA 4HL0A 4AVSA 4LORA 5KXEA 1GFF2 3NNGA 1YHFA 3IMNA 3N9PA 4IESA 4KMQA 1QNYA 1RUH1 2RS52 3OGRA 4LHNA 3VL8A 4A44A 1OC1A 3OUHA 3B5LB 2BFUL 5FYCA 3UGFA 1W6NB 1ND2B 3M3CA 1ZVFA 3NWKA 2JG8B 4BQXA 4P9WA 4QGMA 5AVPA 3KLSA 4WV8A 1QNWA 1FPN1 3Q8BA 2SBAA 4NIAA 4COUA 3IBMA 4AQ6A 4CDWA 2LM3A 3ZSKA 5JXHA 5F2WA 2F17A 2BRTA 1K5MA 1RUOA 1W8TA 2JB8A 2IFWA 2ZPXA 3AK0A 1VBD2 2PAMA 1JHNA 1CX4A 1PO13 4QQLA 4CPBD 2D5FA 1S0FA 4QGLA 4P5HA 1GR3A 3K3NA 4HFSA 3NMBA 4WVZA 2ZMLA 3ZYBA 4QX0A 4WVMA 1RHI1 3ZMNA 3EJKA 4YGEA 1RVF2 2ZBJA 3MIHA 1V6IA 3SQOA 3TEWA 5JSPA 1RUC1 2YFZA 4DPNA 3H8OA 1CONA 4TZDA 2WO2A 2Y6JA 3LAGA 1FV2A 2ZHNA 2FZ1A 4AI2A 4JV4A 1RYYA 5I0RA 1RUE3 3UK9A 5FYYA 2VZ1A 2RR11 4QKBA 2VMGA 3FZ3A 2JG9B 2ZAHA 4P08A 1AR83 2V5DA 2VTXA 4IEWA 4XAAA 5FZMA 3MIBA 2L9LA 3WF0A 4ZU4A 4E2QA 2GC1A 3IMMA 2YZ4A 3OY8B 4FP2A 2LRPA 2R49A 4E4SA 1ULEA 2OQ7A 4FTBA 1W0PA 4QKNA 1TME2 3W5MA 4LPLA 1DZTA 1Q3EA 2VPVA 2Y34A 1W6PB 2XJQA 3CEWA 3ZYGA 3WR0A 4DY5A 4WM7C 3RZZA 1LHUA 2GP3A 4IEVA 4ZPIA 5KHKA 1QJX2 4TTGA 5AFBA 2HWD3 2WZEA 2WNVA 3VBFA 3IDEA 4KG8A 5FIXA 1ZZ8A 1DQ6A 1QJU3 5F2SA 4NJ4A 2VW2A 1YQCA 2W95A 1H2NA 3NNMA 4Y20B 1D7PM 4IEZA 5T5LA 5J09A 4NAMA 1ZBE2 2EA7A 4XJUA 5DUUA 5KXDA 3LEKA 4KU7A 4AW7A 2D3RA 4AEDC 3SCFA 3EXUA 5JDBA 3POIA 1MACA 4Z92B 1JBCA 3PVEA
chains in the Genus database with same CATH topology
4YFZA 3BODA 4P9LA 5C4WB 1VBA1 4COZA 4XW3A 2GMPA 1EYBA 2ENRA 5JPNB 1OD5A 3U07A 1WCSA 3WHUA 3ZVXA 1HRI2 4LBLA 2ZGNA 1MVEA 1OLQA 4NN0A 4R4XA 5AC92 1WMEA 5F6LB 3ST7A 2OVUA 5J7MA 2XJRA 1RUI2 1LHVA 1DF0A 2V5YA 5JWPA 2XLAA 4QPYA 3ZXJA 1CAXB 1UZZA 1RVF3 4JGZA 1GZ9A 1HRV3 4MSVA 4AQSA 3KM5A 4G3YC 2P3IA 4Z82A 2ZGPA 4XMIA 2DCTA 3WW2A 2ZMNA 2VW1A 1ZA4A 2HWC2 3KMHA 3AZZA 2PLV2 2ZAAA 1RMU1 1SBDA 4J1XA 4B4RA 4L99A 3NW4A 1I3HA 1APNA 1TNRA 4QPGA 3AB0A 1D4M2 1GYKA 1H8TB 3KCXA 5IUQA 3ZN6B 1DGLA 4XIKA 4QM8A 4LA3A 4NWVA 5ABJC 2A3XA 3WQ0A 5C8CA 3GALA 2RJKA 4OVEA 5F9TA 3J8F1 2XLGA 2EXHA 2Q5TA 4Q4X1 1SQ4A 2E7TA 4AGVA 1GZCA 4C0HA 1ZBE3 2A6WA 2ZGLA 4RFT0 1SCRA 2MEV3 4AHZA 3ATGA 4JTOA 3WZ1A 3GBGA 3KS7A 4N7UA 2WJSA 2WSVA 3VBHC 1AYM2 2HEWF 2WNEA 3WLUA 3QOPA 1UIJA 4RSUA 3FX3A 4XEZA 4GWNA 2ZX0A 2E53A 4WVMB 2ETEA 1CJDA 3EHKA 2YUEA 4O9GA 4PF5A 5JR7B 5AC93 1PNGA 4LTAA 1RL3A 3MLJA 2BPA2 3MICA 1AXZA 4Y24A 4AEMA 2O1QA 4Q0QA 1FMD2 1RGSA 2FBEA 1AX1A 2XVLA 2PTMA 4KG0A 5L19A 1DQ5A 3M3IA 1UPSA 2JE7A 4IV1B 3TN91 4OHVA 1HV0A 1NA1A 2BW8A 2VNRA 4FPKA 1OA4A 2P3JA 2HWC3 1TMF2 1G9CA 1IPJA 2XB6C 1CQ9A 3VBFB 1UF2C 2WNVB 4HSLA 1RJ8A 3GHMA 4DMIA 2GC3A 2PHTA 4PLMA 4CEYC 4A7YA 4W6YA 3B9CA 3LA3A 4ONUA 4R52A 3U4XA 3D8CA 4Z07A 4QPIA 1FV3A 1ZRRA 3ASIA 4OHZA 2XL9A 2R1BA 5JCTA 1UU6A 3JQWA 3P3NA 4Q26A 4XQWA 2VOXA 2ZGSA 1R1A2 4L97A 3CF6E 3WQ1A 1KJRA 1DU3D 4CDUC 2QUOA 4FPJA 1SBFA 2DV9A 3E6DA 4K9SA 1AYM3 4XFBA 4Z2WA 1RJ7A 1MEC2 2MPFA 1YO8A 3VL9A 4YVWC 1JUIA 5JOYA 4PJYA 2JKBA 1QJZA 3AKSA 3J4UH 1BCXA 2RM22 1MS9A 1DFQA 1NCRC 2LALA 1O4ZA 4HT1T 5JAXA 2X5IC 2GH2A 2XBO3 4MUVA 4N43A 4MXWA 1NY72 3VZKA 4AVTA 2VVDA 5CFDA 2LUWA 3MF6A 1FMD3 1CGPA 1SLTA 2QZ2A 2RS51 1WBFA 1IS6A 4BPZA 4XFCA 4QQOA 2ARXA 2TNFA 3FFZA 1V6LA 5T5PA 1O7FA 1S55A 4IETA 4ITCA 3AXDA 5GZEA 1LKNA 5TSWA 5FPXA 1G6NA 1PIV3 1TMF3 1VBD1 4P9JA 5BNOC 2NPIA 3DF0A 3ZYJB 5HCBA 5JOWA 4QQ2A 1QY4A 5C9AC 1W6MA 1V70A 4GALA 4RR3B 1RVF1 4RS5C 1SLLA 2ZS6B 1DQ0A 3MGUA 2QJVA 2HWE2 2QKDA 3OPZA 3JU9A 4YW4A 4WZFA 5KXBA 3E97A 1UAIA 2FMYA 2QVSB 5LEKA 4IEPA 5LRRA 5FLJA 3IM0A 4PIXA 1JXNA 3CJIA 2V73A 1TME1 4NVPA 5E16A 1PVC3 2WT0A 3ZYPA 4Y22A 2B5HA 5JSOA 2GN7A 2DVBA 5DDJ1 1AR92 3L9JT 2WFPA 3OTFA 1QJX1 4HVRA 3ZMOA 2D93A 2B46X 2ZGMA 4G4FA 3ZXFA 4ES9A 2RM23 4DXZA 2NLRA 1R092 3FLTA 1DQ2A 5EXOA 1NA1B 4FTSA 4AQ2A 4FQ4A 4Q4Y2 1S0IA 1NE6A 1SEFA 1PHMA 1A3KA 4CEWB 5C8WA 2C9AA 2EXIA 2RMU2 1U5YA 3USUA 5J48A 3ZFFC 5LK7B 4IXLA 4FPFA 1JTZX 3IPVB 5T52A 1X82A 1OA3A 1HRI1 4Y4YA 3ZIWA 3OF1A 4SLIA 3WHTA 3WV6A 1X8MA 1H1MA 2OA2A 3PVNA 1PO22 2R30A 1DYKA 2Y38A 4Y5Z0 3S0MA 2R042 3O14A 1VBE1 4UBGA 4YVSB 5FTTC 4K7JA 1RUI1 4YLZA 3WW4A 2WS92 5FO8B 3WP3A 2EIGA 2ZACA 3LA7A 4CDQC 5T3NA 3RMYA 5T5OA 4RHV3 4ZXKA 3WVJA 1N3QA 2YDEA 4KBBA 3GF6A 1ZRCA 3ZSJA 2HWE3 3C3VA 2ILMA 1BKZA 2PLV1 1V6OA 3VBRC 1WW6A 3ZFGA 4N90A 2AGSA 2H6CA 4EV0A 4RQPC 4A7ZA 2ZKLA 1WCKA 4XF0A 3ZXAC 1C8M3 1D4M1 5DG1A 1OLRA 3ZN5A 4DNYA 1AR62 3PLQA 1NQJA 3CNAA 1Y9QA 2Q30A 4NHKA 2FHRA 1QKQA 3E5XA 1A78A 3N7LA 4MXWB 2B42B 3ZXEA 2R0HA 5CFDB 3NAPC 4YGCA 5GKAC 4A3XA 1R093 3DN7A 3DPRC 3TRSB 2DVAA 1OOPC 2RS13 4M3CB 4AI3A 4CDXB 2D98A 4DY3A 1DGRN 4Q4Y3 4B7EA 1NCQA 2C5DA 2G4IA 2WFF3 4XZPA 5D8AC 1O5LA 2RMU3 1X8EA 3AKQA 1GBGA 2D3SA 1C5HA 1S2BA 1VBC1 3H50A 1CAWA 3OD0A 2ET1A 4HLTA 1KS4A 3BPZA 1ND3A 1JYCA 3N36A 1QOTA 4AEJA 2DFBA 2W08A 3G6JB 3WDYA 1W6QA 1J3QA 4BCUA 3VZLA 3TOJA 4XJ9A 1HW5A 1H9PA 1FMD1 1YFUA 1DZRA 2PHDA 4CZSA 2X8KA 3N35A 1I6XA 4QQPA 1RUD3 4U2AA 3VZNA 3G7DA 3T1LA 1LOBA 3T2TA 4ZU7A 4H7MA 2NP0A 5JLVA 5CVRA 4I02A 1XE8A 1KFUL 3E5QA 3WINE 1O91A 4EN0A 5J36A 3QD6A 1ZRDA 5CG8A 4QD2A 4AFCA 2WWSA 5A32A 4V1PA 1AR63 5I8YA 2ZKNA 1Z0HA 1UKRA 3VHRA 1MZ6A 1YXWA 1TNFA 1Q8QA 2IC1A 2N7GA 4C0BA 3VBOB 3HT1A 4YM1A 1IZ3A 1ZX5A 1MQTB 1U5XA 4I09A 4KGQA 1R1A1 3BTAA 4OI1A 1WGPA 3AMPA 5JPMB 4LE4A 4KGGA 1ASJ2 3VUOA 3AFKA 5K0UB 3IDCB 4XJ8A 1S0BA 1C28A 3HWJA 2VQ0A 4N9IA 1PK6A 3D0JA 1MEC1 2D43A 3JB4C 3AZYA 1UIKA 5KHIA 1W6OA 5CFCA 1FOD2 4AHXA 3UKVA 4UW4A 3TAYA 3JBG1 4MGYE 2FMDA 2YY1A 4XXAA 1CR7A 2A75A 2CV6A 3VBUB 4DZGA 3NV1A 3URFA 4JQRA 1ZZ7A 4K40A 4XPVA 1Q43A 5FAXA 4E2SA 1BK1A 1ZRFA 1NY71 2DYCA 1WLCA 5BNNB 3SXWA 3ZFGB 2VUJA 4LLOA 5I93A 1RUF2 3W58A 2AYHA 4HSJA 3FMGA 4X8NA 2E7QA 1H1AA 2E63A 4R9CA 4YGDA 3SISA 5KC5A 5A33A 3AJZA 4GH4B 4E2GA 4AVCA 3NV3A 2TEPA 4EWDA 4PDWB 2BVVA 3FJSA 3OGGA 5K9YA 1LGNA 1VR3A 1RUE2 2DUQA 2XKPA 3RS6A 1SFNA 3ILNA 5FQ0B 1O3TA 2DCYA 3I8TA 3KT7A 1FATA 3HIFA 1AR82 1Y43B 1AR71 4BMEA 5C33A 3SITA 4LHKA 1IHMA 3AMQA 4N9HA 1Z7S2 3VKOA 1HV1A 1CN1A 4KU8A 3VDDB 4DRRA 4B7KA 3IWZA 3RNSA 1R082 1NQDA 2Y26A 1LU1A 4A7KA 3DUIA 1VIWB 2BGCA 1BVP1 1AL23 1QF3A 1ND2C 1JUHA 2DF7A 2JG8C 1H4HA 1KDMA 1QJU2 2ZGTA 5ACA2 1ND3B 4AE2A 4FPYA 4JCKA 4XTMA 3IN9A 5H9PA 1IOAA 1AZDA 3AP5A 4Q27A 5DZFA 3VKLA 1AR91 4I3GA 5DZEA 1QJY2 4XYXA 4Q1RA 2YROA 4FPHA 3MIGA 4IV3A 1FOD3 2Y0IA 3MYXA 4O9EA 2A6ZA 1LULA 4Q8LA 1EP0A 1QU0A 1M4WA 2R061 2ZGQA 3POYA 2ZJCA 4MYEA 4HKWA 1KXGA 3HMYA 3FFQA 1PZ8A 4BIFA 2AR6A 4LNVA 1ONAA 1O3QA 3R6SA 5CA6A 1Q56A 2ZGOA 1EV13 1N1VA 1VALA 1RUF3 5DXDA 4HPKA 2CGNA 1QQP1 4XFIA 1PNFA 5LEJA 1PO21 1HRV2 4YARA 1V9U3 4YG6A 5GM0A 2R041 3WY6A 2VOVA 2WS91 4JGYC 4FVVA 4YZ2A 1WLWA 3AZXA 2ET7A 2P2KA 1OQEA 2XKOA 3S7EA 1ZNPA 2RJLA 3EQEA 2OZJA 3ECQA 3DL3A 3M4FA 4HN1A 2YC0A 2VGDA 1Z7S3 4Q8KA 3UKTA 1J59A 3ES4A 1SCSA 4YRDA 1FT9A 4X6QB 1PK6B 5EFUA 1REDA 2CAVA 3WP4A 1R083 5C4WC 5GALA 1W6OB 5CFCB 4BYYA 1D2QA 2XWBB 3VBHA 5BNPC 4GA9A 5GZFA 1LHWA 3GNEA 5I0UA 2ZX2A 1IS5A 3C2UA 3DGTA 2R16A 1AR61 5ACA3 3A0NA 3BIWE 3LGRA 5J37A 3ZXDA 1WD3A 1O4TA 1UKGA 1PGL2 4D69A 2NN8A 1VBB2 3GBFA 4XF3A 2MEV2 5KHJA 1QJY3 4PLOA 3LA2A 1O3RA 1BBT1 3ZSEA 3M3OA 3OYWA 3VN4A 2HWF2 5GZDA 1UX6A 3HQXA 3VBSA 4LBKA 4AFDA 5EYXA 1Q8OA 4HVOA 4XE9A 2UYBA 1SMVA 2PAEA 1ULFA 2XHKA 1EPWA 2RS31 2OW4A 3FLPA 2B7YA 4MVTA 1F2NA 1NXMA 4YZ4A 5A33B 3RRDA 1B35B 2QDRA 3RYKA 4GMP3 4COVA 3WT3A 4HANA 4HN0A 3H7YA 3PVOA 2GU9A 1FXZA 2AREA 2ERFA 1W39A 3LB9A 3WDXA 2I2SA 4H3WA 1H8TC 1WLTA 3IKWA 3MW3A 4CEYA 3FBYA 4QM9A 3H0OA 4BQ1A 4FPEA 2XJVA 1CAUA 1WMDA 4JTNA 3RYRA 4WM8B 3KD4A 4HK9A 1HQWA 1TQ5A 2WLPA 5KHHA 1JW6A 2JEMA 4OUSA 1GANA 3M70A 4K1ZA 2BNMA 5CNAA 5FBZA 4B8EA 2WT2A 4K21A 2CNAA 4LO7A 4YG3A 1A8MA 4PIYA 5FMOS 4JRLA 3B69A 4QXKA 1QWRA 3L2YA 2R6QA 3M3QA 2WT1A 4AF9A 4CDUA 4XBQA 4P9XA 1WW5A 1RUG2 4L11A 4IV3B 2D40A 3V64A 4D3WA 3ZO0B 3RPQA 4AVBA 1WBLA 4WVVA 2R32A 4W65A 2PHUA 4YVWA 2O8QA 4M00A 3HD8B 5J98B 3WX5A 1MS5A 4XTPA 4CDWB 4BM8A 1VBB3 2WZR1 3AZVA 1K5MB 4Q0SA 3M2MA 2B45X 3R4SA 4I30A 1VJ2A 3TYJA 1GLHA 2X5IA 2HWF3 3WG2A 2PHWA 2GZWA 4LLFA 1YUDA 3NKGA 4LO8A 1E57A 3ZFEA 2B8MA 3B00A 4IV1C 2EXKA 3JZVA 1ASJ1 4XJAA 3Q9OA 2GN3A 4YM3A 1YYNA 4DQAA 4FT8A 3UV9A 5I0TA 4P14A 1OQ1A 2XBO2 1SDWA 3O0XA 4DB5A 2QQPA 3QH6A 4QT6A 3SH4A 2WNVC 3VBFC 2VH9A 5IK5A 4YM2A 1VB2A 5BNOA 3IDBB 3BU7A 1RUNA 2H6BA 2UWBA 1Q8PA 1UL9A 5C9AA 1H4GA 3RSJA 2P34A 2GMMA 3ZXGA 2G9FA 1V6KA 2GNDA 1VRH2 4GB32 1POV3 4C91A 1PIV2 2Q1MA 3H7JA 3M7AA 2PFWA 3ES1A 1QOSA 2NYYA 4FPOB 1PO11 2BUKA 2D44A 2A6VA 1XYNA 4GIQA 5H9SA 1GNHA 3MFAA 2O0OA 1PZ7A 3M8LA 4D94A 1MVQA 2WA4A 1AYN2 3BOPA 3VHNA 1ZZ6A 1YIPA 1ZBA2 1GKBA 1HXS3 2D7FA 2YHJA 2YPJA 1RC6A 4Q4V2 3B7MA 2ZMKA 1RUE1 1WW7A 3HN1A 3UJQA 1RUG3 3OYWB 2H0VA 3VBSB 4C1WA 5FREA 1AR81 1I1EA 4XF1A 3VZOA 1AL0G 3RJ2X 3S30A 2VNGA 3PJYA 3QCWA 1U5ZA 1SLCA 2A6YA 3ZPYA 2YYOA 1PVC2 5GJ6A 2DWRA 3VLBB 5EYYA 5GZGA 1DYPA 2HWD1 3QH7A 4M01A 2UU8A 4OI4A 2W0XA 2K9ZA 3JUUA 4MH0E 1QJU1 4R9AA 1NLSA 1OFSA 3ZFFA 2IXCA 4JGZB 2UWAA 4M3CE 2OUHA 1CAUB 3TNPB 3FUQA 3QLQA 2Z5WA 1G9FA 4CP1A 1MS4A 2IXLA 1LECA 2HYKA 4I3PA 2MHFA 1CESA 2DU1A 1IGOA 4OHWA 4QPGB 4RR3C 5GLWA 3HR9A 2K0GA 1BEV2 1V6NA 4LBJA 2GC2A 1VRH3 3POWA 4GB33 1OA2A 1YFWA 3T1MA 4YZ5A