2WQZC

Crystal structure of synaptic protein neuroligin-4 in complex with neurexin-beta 1: alternative refinement
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
177
structure length
177
Chain Sequence
b'HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROLIGIN 4, X-LINKED
molecule tags Cell adhesion
source organism Homo sapiens
publication title Structural Analysis of the Synaptic Protein Neuroligin and its Beta-Neurexin Complex: Determinants for Folding and Cell Adhesion.
pubmed doi rcsb
total genus 34
structure length 177
sequence length 177
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wqzC00
5T5PA 2ZGRA 1JXNA 3ASIA 4LBOA 4AVSA 2DVDA 2D6NA 3AP4A 2SLIA 3SNMA 1G86A 1Q8PA 3D4KA 2ZACA 2CTVA 3AZYA 1ENSA 1URXA 1W6PA 1LGBA 2D3RA 2D6OX 5DXDA 4U2AA 4ZKTB 5EXOA 2LALA 4YW3A 1H9PA 1DYKA 4K20A 1IS6A 1QMJA 3AP6A 4YG0A 1BYHA 4Q27A 2V5YA 3M2MA 1A8DA 2W08A 1NXD1 2DVFA 1UL9A 1F31A 4M3CB 1DFQA 1AXKA 5JOZA 3WUCA 1DGLA 1I3HA 5F5QA 1LU1A 4MYEA 1LOCA 4XOGA 4XHXA 4BPZA 2P3IA 1UAIA 2ARXA 4Y22B 4Y26A 4XIOA 2DVGA 3B69A 3A0KA 3KQRA 4FPOB 4SLIA 4XJUA 2DUPA 5E8AA 3W58A 1G9BA 1S1AA 3V0AB 2ZGLA 2A6VA 1JYIA 1TEIA 3B01A 4FPHA 5H9PA 1W6MA 3NV2A 1A3KA 3WCSA 1V6KA 2WT1A 3LSEA 3M3OA 2JE9A 3M3QA 1W0PA 2VUAA 3IKWA 3SISA 5DUUA 3D6EA 4XJ9A 1FNYA 3VKOA 2ZBJA 3INAA 1F5FA 1SLCA 2GN3A 2I2SA 3BIWE 1W0OA 1G9FA 2D6MA 4AVTA 4NOTA 1N1TA 4YGDA 3AP7A 3O0WA 3VKNA 4Y1VA 4FPKA 4LBKA 1UKGA 3PVNA 1WD3A 1SLBA 1GZ9A 2CWSA 2A71A 4Y1UA 3TAYA 2G4IA 5H9QA 1G9CA 4XXPA 4YM1A 4FPGA 4AGGA 2NMOA 1V6OA 1OKQA 5T5LA 1V6LA 1GYKA 1SLTA 2ZGKA 5GJ6A 3GALA 1APNA 1LESA 2AREA 1S0FA 3ZSKA 1MS5A 4GKYA 3W59A 1O4YA 2Z42A 3AXDA 1IS4A 3FUOA 1BXHA 1JN2P 1Q56A 1DQ1A 1DQ6A 4K1ZA 4ASMB 2DTYA 3WHTA 3ZXJA 1IOAA 1ONAA 1W6OB 1MVQA 4XZPA 1W6QB 1GV9A 1LGCA 5T5JA 1LULA 4XBQA 1LOBA 2EXJA 4P9YA 4Y1ZA 2NM1A 4WVVA 5DZEA 3T2TA 1GICA 4Y24A 4XMAA 4XXAA 3IN9A 2ERFA 1H9WA 1LTEA 3WG1A 3FBYA 4M3CE 1UZYA 3OGGA 2ZHLA 1D0HA 4WV8A 2E7TA 1ULCA 2XB6C 1VAMA 2ZZJA 3FFZA 3ATGA 2A70A 3N36A 1LJ7A 5CNAA 5SV8A 3ZYRA 4XJAA 4M01A 4YW2A 2AH2A 1ULDA 1G9DA 5JOXA 3N7JA 3WG4A 1QOTA 1S0GA 2WSUA 1BQPA 3MPPG 3MW4A 3N7MA 4YM3A 5JOWA 2EALA 4BQ1A 1QKQA 2OUJA 2UURA 3VKLA 3AYDA 3ZXFA 1CPMA 4LBQD 2EAKA 3SH3A 4RL7A 3APBA 3MW3A 5CAZA 3AZVA 2ZGQA 1FYUA 4HL0A 5CA6A 3PMEA 1YI7A 2UU8A 1G7YA 4BMEA 1MS1A 1QDCA 4YZ1A 3M3EA 3RG0A 1Q8QA 3AK0A 1CPNA 5H9RA 4YGEA 5F9TA 1X50A 1KRIA 1JBCA 1S0IA 4P9XA 1OQ1A 1WLWA 4YG3A 2P3KA 3NWKA 1DQ0A 2KM2A 3M1HA 3ZXKA 1KDKA 2EXIA 2W39A 1JW6A 1Y7BA 1RITA 1ULEA 4XIKA 2E7QA 3HMYA 3V64A 4XJWA 4LBQA 5JVVA 1CQ9A 1YIFA 5KXDA 1FX5A 3WNXA 3AX4A 2R1BA 1DIWA 1B09A 2HYKA 2JDZA 1W6QA 1Z78A 4AGVA 2RHPA 2GMPA 2ZA9A 1JUIA 1UX6A 1DZQA 3FUQA 3NV1A 4FPJA 4PCRA 2E51A 1GLHA 2ZGUA 3O5SA 1AXYA 1WUVA 3O12A 3KM5A 2WLQA 1W6MB 1LU2A 2OVUA 4PBOA 5KXCA 3USUB 3ILFA 4ISQA 4R9AA 1C1LA 1CONA 1JYCA 2LTNA 4U36A 1NLSA 1GBGA 1W6PB 2PHWA 2VH9A 2ZAAA 1UN1A 1D2SA 2R16A 3I4IA 3M3CA 1WW7A 3WDWA 1MVEA 2AENA 1G8WA 5CBLA 3WUDA 1WBFA 1SBDA 1QOSA 3AYAA 4YM2A 5JOYA 1PZ7A 3R05A 2AUYA 3FLPA 4Z8BA 1LCLA 4ATFA 2PHFA 4DS0A 1MS3A 1LHWA 3ZXEA 4XHBA 1DQ2A 1ENRA 3AZXA 4AWDA 3O0VA 3T1MA 4K1YA 2R49A 1UPSA 5DUWA 1N1YA 1UZZA 1C57A 1FNZA 1FV3A 2A75A 4Y20A 1DQ4A 5GLZA 4BM8A 1WD4A 3I8TA 4FOVA 1DHKB 4LBJA 1VALA 1CJPA 3AJYA 1SFYA 4Q1RA 5FRAA 4BOWA 1W6NB 4K21A 4TZDA 1MZ6A 3V0AA 2UWCA 1GZWB 2JE7A 2WT0A 2A6WA 3VKFC 4LBQB 2SBAA 2WJSA 5GLWA 2PHXA 4FP2A 1HDKA 2DYCA 5IUQA 3RQ0A 1UMZA 1MR5A 1Q8OA 4M3CF 1GSLA 1ULFA 4I30A 2JJ6A 1N1SA 5IK7A 4YZ3A 5DZGA 3OBTA 5CB7A 1SCSA 2D6PA 3ZPYA 2A3YA 3ZYPA 3WVJA 3RMYA 3A0NA 1ZA4A 2ZGTA 4Q1PA 5FREA 5T5OA 5IK8A 1PZ9A 5LK5A 1FAYA 4YG6A 1I1EA 3OPZA 1LHUA 2AGSA 3GNEA 4FPYA 1V6IA 2ZHMA 1BZWA 3UK9A 4KBBA 4XJZA 4ATEA 3AYCA 5KXEA 1GKBA 2EF6A 1XQNA 2ARBA 1N1VA 1GANA 2WNEA 1YXWA 3VV1A 1IS3A 4FOWA 2DURA 1HQLA 2ZMNA 4ISRA 5DG2A 2R1DA 5HCBA 3SH4A 4IQPA 5JDBA 1ULGA 2YV8A 3NV3A 2B7YA 5DUXA 2E53A 3V0BB 3WCRA 1QU0A 2DTWA 5GLVA 1S0CA 2WQZC 3WDUA 2ZHNA 2ZHKA 4UW6A 4UW3A 3DGTA 1MS8A 1LHNA 2ZGOA 2ZGSA 5GLTA 5GLUA 4CZSA 3LCPA 3OYWB 3IMNA 2D44A 4Y1XA 4Y1YA 2W68A 2A6XA 4Y20B 4AVVA 2AR6A 3WLUA 4YW1A 1N3OA 2OW4A 3B3QE 4DPNA 4YW5A 2YZ4A 4C1WA 1U0AA 2ZGNA 3AYEA 4GALA 4L8QA 2FHRA 1AX0A 2ENRA 4JCKA 2GDFA 3OBRA 4DRRA 3O0XA 2D3PA 1SBEA 4FVVA 4M3CA 3H0OA 2A3XA 1KQRA 2AYHA 4FPFA 4CTEA 2GN7A 1QGLA 4R9BA 4PF5A 5IT6A 1QDOA 2EIGA 3WV6A 1QNWA 3R4SA 4GWMA 3L2YA 2XG3A 3AZWA 3FLRA 4LBNA 4YW4A 1Q8VA 2NMNA 5GZFA 1LHVA 2H0BA 2E6VA 1QNYA 3ILNA 1N3QA 3ZSJA 2ZMLA 2VY0A 1V6JA 1LENA 5DG1A 2A6ZA 5DZFA 1VAVA 4YM0A 4YFWA 4XYXA 5JMCA 3WHUA 1N3PA 3HR9A 2FMDA 3IPVB 1LOEA 3PVEA 1H30A 4WVWA 4XMIA 5KXBA 2A7AA 1JHNA 1MZ5A 2JD4A 4FQ4A 1Z0HA 5DUVA 3UJOA 2BQPA 2ZGMA 3OY8B 2CNAA 3BODA 3ZSLA 2D7FA 1AJKA 3SH5A 4XTPA 4PQ9A 1LOFA 3LSDA 1S0DA 4BLIA 1SLIA 5JLVA 2TEPA 3VUOA 1Q8SA 3AXEA 1EPWA 3JU9A 3HN1A 4FPCA 4JRAA 3D5OA 1RINA 2DUQA 5IK5A 2WKKA 3WDYA 3WOGA 3WG2A 2OUHA 2GNBA 1QOOA 3BOPA 4OZXA 3WDTA 1G9AA 3MW2A 1N47A 1SLAA 3RS6A 3TB0A 1IKQA 2JECA 4RA0A 4YFZA 3T1LA 1PZ8A 4YGBA 4GA9A 2NP0A 3OY8A 2D43A 1CR7A 1WCSA 3CNAA 3BTAA 2ZABA 1QF3A 3OYWA 1IS5A 1MS9A 3QCWA 4R9CA 2ZGPA 1LOAA 1HKDA 1WW6A 2PHUA 4AYUA 1SCRA 4YGCA 1CN1A 5AVAA 1HQWA 1S0JA 3FLTA 1LECA 2Q5TA 4Y22A 2UWBA 5T50A 5HCAA 2CL2A 1BJQA 1SBFA 1WW5A 4YZ4A 2C5DA 4FPEA 4FP3A 4XTMA 3SLIA 2VW0A 2DUOA 4BMBA 4Q8KA 1OFSA 4F83A 1LEMA 1RIRA 2WSVA 2DU1A 2A3WA 1F9KA 3ZVXA 3AZZA 4GWNA 3POWA 2DU0A 2R0FA 1KJLA 4UW4A 2GNTA 3WG3A 1AX2A 4GXLA 4P14A 1YRZA 5E89A 1LODA 4XJ8A 3POYA 1AF9A 2CYFA 3WZ1A 5EYYA 4Q8LA 2A6YA 1C1FA 2P2KA 3RSJA 1V6NA 2VXRA 4GKXA 2NZ9A 5T55A 4XE9A 3RMXA 2UWAA 3QLQA 2NYYA 1AXZA 4YLZA 1AVBA 2VW2A 4XDQA 4FQZA 2ZKNA 1GNHA 2YMZA 1WLCA 5EWSA 2P3JA 5HCFA 4DRVA 4XILA 1DLLA 3U4XA 5GZCA 2YY1A 3AFKA 2C9AA 1DBNA 1BKZA 2CY6A 1FATA 1LHOA 1W6OA 3RRDA 3OJBA 5IK4A 1WLDA 3PJQA 3JUUA 2A5ZA 4LBLA 2R0HA 2EXKA 4FOQA 3C2UA 3ENRA 3NV4A 5H9SA 4FPLA 1IKPA 1LGNA 1S0EA 2DV9A 2VU9A 3USUA 1MS0A 4Q26A 1V6MA 2JKBA 1KJRA 2DWRA 4P9WA 1R1ZA 1J1TA 4DQAA 1WW4A 2EXHA 2GMMA 4CRQA 2GNDA 4LBMA 2P37A 3B00A 5GALA 4BLJA 1A78A 1LEDA 4HANA 3N7LA 3R4UA 4PBPA 4YZ2A 1CVNA 3AP9A 2DVAA 2NN8A 4DFSA 1DQ5A 2GNMA 2V73A 3AP5A 5GZEA 1C4RA 4C1XA 4H55A 3PVOA 2PELA 4JC1A 1DYPA 3ILRA 1FV2A 3N7KA 4UW5A 1W6NA 4M00A 1S0BA 1LOGA 3WDXA 1LOFC 1GZWA 5BYNA 3UL2A 5GZGA 5EYXA 4XBLA 4FOYA 1VIWB 4Q2FA 1KDMA 4R9DA 2YROA 1KITA 1JOJA 2GMEA 5L73A 3VKMA 2D6LX 3POSA 2GALA 2PHTA 2CWMA 2ZMKA 5E88A 5GM0A 2P34A 3V65A 3DUIA 2VW1A 1AJOA 1MACA 2D6KA 3N3HA 4XBNA 1CESA 1ENQA 5GZDA 3A4UA 5T52A 3IM0A 3V0BA 4ZXKA 1SACA 2YXSA 3WDVA 1AZDA 3ZXLA 1VLNA 3Q9OA 1GNZA 1SLLA 4NO4A 4D69A 3IPVA 1GZCA 4AGRA 2W52A 1WBLA 2ES3A 3AJZA 1HLCA 2WT2A 3ZSMA 1V00A 2D3SA 4ITCA 1YO8A 3N35A 3SITA 2DVBA 4YZ5A 1CIWA 3B9CA 1AX1A 1MS4A 4TYSA 4WZFA 3UJQA 3MEPA 4W65A 5T54A 1YYNA 1ZM1A 1O4ZA 2PHRA
chains in the Genus database with same CATH superfamily
4D6RA 3TBDA 3H7JA 3SC7X 3LEMA 3H8RA 2VMGA 4AL9A 2D6NA 4FXKB 2BOIA 2HEWF 2R32A 3D4KA 2P3YA 1UY1A 1HV0A 1ENSA 5L19A 1DCSA 1EY2A 1XXNA 2D3RA 2LS6A 2MPFA 3GM8A 1Y9QA 5CFCA 3CJIC 4M0HA 1UU6A 1ND3A 1UU4A 3BYWA 4K20A 2PXJA 1QMJA 1JHJA 4YG0A 4Q27A 2JDUA 1A8DA 2EVXA 3J9SA 1S4CA 5HI0A 3E5UA 5A70A 1AXKA 1SPPB 2B9VA 1DGLA 2G9FA 3KVAA 1ENXA 4QB2A 3KV5A 5F5QA 2GP5A 1LU1A 4MYEA 1LOCA 4XOGA 4XHXA 3GZTB 2X8KA 2V09A 2YC0A 4E4HA 3WP6A 1GR3A 4Y22B 4Y26A 4XIOA 3W58A 3KQRA 4XJUA 3ZMNA 3CEWA 1PO23 4D8MA 3ITQA 1JYIA 3KVBA 1E57A 2HWE1 2CGOA 3ZYIB 5H9PA 1AYM2 2IXLA 4HETA 3VLBB 4YARA 1C5IA 2HWD3 1QJX2 1PMHX 1V6KA 3M3OA 3E6BA 3W9AA 2VR4A 1W0PA 1C28A 1IG0A 3AMMA 4QHBA 2B4KA 4UOJA 2WZR3 3VZMA 3IB3A 3AMNA 3GF6A 4XJ9A 1Y9GA 4Q4X1 1FNYA 2Q1ZB 1US3A 2E63A 1JZ7A 1F5FA 2GN3A 1W9SA 4XPVA 1G9FA 4NVPA 2XVKA 1LAJA 4AVTA 3H3UA 2G19A 4OFGA 5B4XA 5A1FA 5FZCA 2WWUA 3ZXGA 3PHMA 3KF3A 2HWD1 4QD2A 3MHZA 3OD4A 4XXPA 2YDEA 1US2A 3U75A 4LKEA 2NMOA 3MFCA 1OKQA 5T5LA 2H6CA 2YBPA 2ZEWA 2BGOA 5FPVA 4DXZA 1W05A 2R063 1O4YA 2Z42A 2Z5WA 2WR9A 3AXDA 1NCQC 2WAOA 2EIDA 1BXHA 1XE8A 3ST7A 3TNPB 3QH7A 3M4FA 2DTYA 4HVRA 5ANQA 2RS11 4BQ3A 4DNYA 5J09A 4QX7A 2JG8A 1IOAA 3RVHA 1W8WA 1W6QB 1PNFA 3J4UH 5IVCA 1BEV3 1GV9A 1LGCA 5L9RA 5A7SA 5T5JA 1LOBA 5FPLA 4AR2A 1ZRRA 2LUWA 2BGPA 2VBDA 2FZ1A 4NRMA 4XMAA 3O1UA 4ZONA 4HK9A 2ERFA 2DCZA 3WNOA 1LTEA 4M3CE 1HRI1 1RVF1 4LMFA 5ABJA 4PI0A 4GJZA 1F35A 3KSCA 3HQRA 1AR72 3ATGA 2A70A 2RJ2A 5CNAA 3WQBA 3ZYRA 3S57A 5DABA 1R1A3 1X9TA 2HBTA 4ASLA 1ULDA 2R042 3ZR6A 2BU9A 1S0GA 2WSUA 3JD72 5JOWA 2GZWA 2EALA 4E8CA 5J7MA 1QKQA 2UURA 4IV1C 4XUPA 3AYDA 5FXZA 2BBAA 2QTWB 2Q1FA 1UWWA 4LBQD 4WM8B 4DUWA 3ZN6B 3NW4A 3USSA 2Z79A 2XVGA 4IESA 3ORJA 3OUHA 3LDRA 4DIQA 2ADDA 3AZVA 5DDJ2 4HL0A 5CA6A 3VD9A 4OHZA 4EN9B 1REEA 3POGA 1TQ5A 3U07A 3B94A 4YGEA 4EV0A 1MZFA 1KRIA 1NCRA 4META 4P9XA 4LHSA 4Q29A 1VBA3 5C8WA 2UY9A 3T3YA 1HX6A 1UOJA 3O1VA 4YW6A 5F6KA 3M1HA 5CU1A 3KT1A 5APAA 1WLTA 2V4VA 1PO13 1DF0A 1RITA 4NIGA 3O7OA 2F6BA 2JX9A 1JZ8A 1YIFA 2VQ0A 1FX5A 2J42A 1SHWB 2VZUA 4E4ZA 1DDLA 4AGVA 2D98A 4BQYA 2GMPA 1SFPA 3FUQA 5FDBA 1DZQA 1MZEA 3NV1A 1VBE3 1MQTB 1UO9A 4E27A 3WXPA 4NIDA 2YUEA 3ZFFC 3BTXA 4EN7B 1W6MB 1UIKA 2D93A 2OVUA 3GCXA 5DAPA 3USUB 3DN7A 1QJU3 5TSWA 3T08A 4K8FA 5A3PA 3C3VA 1VBC1 2EICA 4U36A 4EE2A 1GBGA 5FZDA 1ZVFA 5C3OA 3K2OA 2ZAAA 3LKJA 1UN1A 2VQAA 3NVCA 4P9GA 4CU6A 5A32B 1MVEA 1QJZA 1NY71 1D7PM 3WW4A 3WUDA 1PX3A 3AYAA 5JOYA 4XZUG 1PZ7A 4QXCA 4BWOA 5AC93 2AUYA 3FLPA 1V0AA 4Z07A 3ZFGB 1LCLA 4Z1VA 2PHFA 4Z8BA 1VBE2 3LPGA 1HN1A 4XHBA 4CCCA 1B35A 4AWDA 3LEGA 1W28A 1GOHA 3O0VA 4A6OA 3TEXA 4KH9A 2XJTA 4N43B 5DUWA 4CDXA 4NJ4A 2ZTNA 1L3JA 4QPIC 2QBXA 3KHBA 1FNZA 1V9U1 1PIV1 3JZVA 1AYN1 1GQGA 3BOWA 4Y20A 4IERA 1DQ4A 5GLZA 1WD4A 2FDGA 3I8TA 1TME1 2FCTA 1VB4A 3W5NA 5FZFA 5K0UB 4LOTA 3K48A 4PJYA 4KQ7A 5M0TA 3MYXA 1KGYA 1XU1A 4ZY9A 4NPRA 1OQEA 4QQ2A 2A6WA 1DGWA 3MF6A 1HQNA 3POBA 4YVSB 1K45A 3A21A 2FDIA 4PI2A 1JOBA 1RHI3 5IUQA 4QDSA 1MR5A 3GDBA 4CE8A 4UI9L 4CEWC 2EAAA 5IFPA 1W99A 3B5LB 5FY5A 1CAWB 5IWFA 4MXWA 3EYPA 5A80A 4BDVB 1RUF1 4P08A 4JQTA 5FPZA 4OI4A 4F7ZA 1SCSA 1W8NA 1EAH1 4YSFA 1LNSA 1NCRC 3FHQA 3RMYA 3H50A 5IK8A 2ZCWA 4GH4C 2W5FA 4HN1A 1FOD1 2WO1A 4S2DA 1LHUA 2D40A 4FPYA 3RI9A 3VBUB 4ES9A 5K7PA 5FY1A 4BQ4A 3RZKA 1O3QA 1D4M2 1H1MA 2C1FA 4AEDA 3CJIB 5BNOA 2WO7A 2E7AA 3TOJA 2XQXA 1CIYA 4FOWA 1PVC1 1HQLA 2DURA 5HCBA 5DG2A 4QPWA 3SH4A 4MH0E 4LK6A 1HB4A 4AVCA 5DUXA 2E53A 3M7AA 3WCRA 2DTWA 4XFIA 4I0BA 1Q43A 2YYOA 2ZHKA 4UW3A 2GH2A 5FZ8A 1MS8A 3PIJA 1LHNA 2JB4A 2GC0A 4PIYA 5GLTA 5GLUA 1HXS3 5JWPA 2V72A 2VQUA 2D44A 3IMNA 4Y1YA 2Y6LA 5ABJB 3H9AA 4GULA 4JHZA 4N9HA 3LF7A 4YW1A 3WX5A 5FP9A 2Y34A 4RR3A 3ACIA 5KC5A 1W9WA 1PK6C 1PHMA 4D7TA 4GALA 3VZLA 1AX0A 2XKOA 4DRRA 1PGW2 1SBEA 4LO4B 4UF0A 2A3XA 5DAXA 2AYHA 3LFIA 1UYPA 3L2HA 4DINB 1XE0A 2WZR1 1JYVA 3JCIA 5A7WB 4CCOA 2WFF2 5AFEA 3ZYGA 4QPGC 4IGOA 2BZDA 1P8JA 4I02A 2BVBA 5J3UA 2ZKLA 3GHNA 4GWMA 4QXHA 4RQPB 3VN4A 5LA2A 3WSOA 3GCWA 3O1SA 4QM8A 2NMNA 5GZFA 4HKLA 4HG6B 4DEVA 1LB2A 3KV4A 4RHV2 3H3LA 2DF7A 4NWWA 1GOGA 4MZUA 1QNYA 1N3QA 1OUXA 4Y33A 1Q3EA 5FMOL 4GIQA 2VY0A 5F3EA 1AR83 2RV9A 2W2IA 5DZFA 1PK6A 5DPNA 1UQXA 1XYNA 4XYXA 4AHWA 4ET7A 1U5YA 2QVSB 1NCQB 3LGRA 1Z7S3 4XC9A 3PVEA 4XMIA 2FCVA 4O65A 4B7KA 5J98B 3AL5A 3BCWA 3LEIA 2UY8A 2PFWA 3IZOA 1V9U3 2JD4A 4LHNA 1OF4A 1Z0HA 5FR3A 2BQPA 4LKSA 1EV11 3BODA 2R30A 2XJQA 2OPKA 5FY4A 4XTPA 3T09A 1YQ2A 4JX0A 4FTEA 3OUJA 4NMIA 5L36A 4CVUA 1RUH3 3VD5A 1EPWA 4V1PA 5F6LB 2B8MA 3D5OA 1RXFA 1RUOA 3DPRB 1BMV2 4I2OA 3CQOA 4OZXA 4P02B 1G9AA 3RZHA 2QQPA 2RR13 3LZZA 3NJXA 3T2PA 2Q30A 2HWC3 3K75B 3RS6A 3NAPB 4JZRA 1YFXA 4V2VA 5EJ1B 4BB3A 3CIHA 5EJZB 2D43A 1GWKA 3V56A 1WCSA 4QAWA 2ZABA 1IS5A 4NPMA 4NPLA 4R9CA 1R64A 4AYUA 5FO9B 2PHUA 1SCRA 4IEOA 1AYM3 2VVFA 5AVAA 1RUH1 3VBOB 1NA1C 1CZSA 3N9QA 1W8TA 1S0JA 5ABJC 3N9LA 5IHRA 1PGL1 5HCAA 5T3NA 3ETQA 4PDWC 5T50A 5A6XA 2XBO2 1W2TA 1CAVA 1WGPA 5FBJA 1B35B 4Q0UA 5HCHA 4FPEA 2XLGA 4FP3A 4B4PA 2VW0A 4CCLA 3I2KA 1JH5A 1OFSA 1LEMA 2WSVA 4IV1A 1X9PA 2DU1A 1F9KA 1NLQA 3AZZA 1J3PA 4FAGA 4CCDA 4TTGA 4AQ6A 5FUIA 1E5HA 1TMF3 3VB9A 3ZSEA 4LUMA 1OOPC 5FY7A 1ACCA 4P14A 4GXLA 2YGLA 5A3MA 2QKDA 1LODA 4HPKA 3JQWA 3WZ1A 4HVOA 3OOXA 3TRSB 2WYSA 2HYXA 3RSJA 1I5PA 4CCNA 1NCRB 1BHGA 4A42A 4CDUC 4C90A 1TE1B 2ID4A 4XE9A 2DCKA 4O61A 5CG8A 3URFA 2WZEA 4EN0A 2NYYA 1FI2A 1OA4A 2W1WA 1RUE3 2HWB3 5A33B 3DPRA 3ZYFA 2VW2A 4PHZA 4I0AA 5KHIA 4AI8A 2ZKNA 1GWLA 5EWSA 2P3JA 4UFHA 2XMLA 4A7YA 3FC0A 3UYJA 4IEVA 2JXAA 1XNCA 5F5AA 4Z82A 3AFKA 3PVBB 4ORFA 1QJU2 3J7MA 4A41A 2JIJA 5FMBA 4YVWB 3UESA 5BNPB 2RVAA 1F5JA 2QQWA 1W6OA 1RUG2 2PTMA 4IEZA 1ULPA 1UZVA 1LKNA 3PJQA 3JUUA 2C6SA 3ZIXA 4B8EA 3I54A 4CP9B 3EMRA 3CF6E 3MF9A 1ZZ8A 3C2UA 3NV4A 4KWKA 1IKPA 2DV9A 2BDRA 2VU9A 4K7JA 1MS0A 4Q26A 1V6MA 2JKBA 1AUYA 3UKNA 1W2UA 2DWRA 3BALA 5FXVA 5BV6A 4P9WA 1H1IA 1WW4A 2WS92 4LBMA 3J7NA 1OLME 1W3XA 4QB1A 5IJRA 3WQ1A 1R092 4NWVA 3JBG1 1GWMA 3J8F1 1IPKA 1Y4WA 3ACFA 1DQ5A 2GNMA 2V73A 3OF1A 1W8FA 4MSVA 4FT8A 4DFSA 4I3PA 4EJRA 2CAUA 1H8VA 3PVOA 5FO8B 2WINB 3ILRA 1IQDC 1ZBA3 2E32A 3H1WA 4UFLA 2Q0AA 2RS51 4AF9A 5BNPC 2BTVC 2DCYA 2OZJA 2ZX1A 4UWDA 1FT9A 5GZGA 3DEMA 3N9MA 3HNYM 4IGPA 5I0UA 1ND2C 2XBO1 4UF0B 4RQPA 4CPBA 2J22A 1ASJ3 1BK0A 2WNUB 4XF3A 1GQPA 2CWMA 3ZFFB 3OBZA 4LA2A 3VBSC 3LA3A 1AJOA 3N3HA 4XBNA 3KQ4B 3U14A 1CESA 1YJLA 1JS9A 3HOBA 1UPIA 5JIAA 4CDQB 4R8HA 4AFAA 1J58A 1AZDA 2ZPXA 3WP3A 1WWYA 2Y6JA 4HN0A 4JDMA 4AFCA 4IEXA 1GZCA 3LOBA 1WBLA 1UY3A 3F95A 2ES3A 1YO8A 1ZNPA 2ET7A 4D0QA 4YZ5A 3AVSA 3B9CA 5A1AA 5F32A 4QPIA 3MIBA 5T54A 2K2SA 3MI8A 1ZM1A 1O4ZA 2ZACA 1XPWA 1COV2 1JXNA 4L11A 4LBOA 1TG7A 1J3RA 1UYZA 2DVDA 4AFBA 3I2JA 3CHXA 4XQDA 4JRLA 1MEC3 3SNMA 2BBVA 1G86A 2VVDA 3ZDSA 2R061 3AZYA 3VBFA 3I2GA 3WT3A 1LGBA 3PJYA 4N53B 1HXS2 4N8MA 4ZKTB 4YW3A 5FYMA 4BH9A 4GMP1 1X8EA 1F4AA 3ZYHA 3SHRA 2PQQA 4IV3C 1NG0A 3LWCA 5D2AA 3NL1A 1O3TA 2RM23 3AP6A 1JYWA 3THCA 2Y6KA 1QJY3 3M2MA 3C7HA 3VBUA 1PMIA 4RGGA 4X6QB 2XPJA 3VZOA 1UL9A 1F31A 4M3CB 3PIGA 5C5TA 5JOZA 2RMU2 3WUCA 3VD4A 5I0SA 2QJVA 2YG0A 5K0UA 1UAIA 4D94A 2OQ7A 2WYFA 5E8AA 4ONUA 3H7YA 1OBNA 1S1AA 2ZGLA 2FDFA 2J1EA 4NIAA 3VHRA 5BNOC 3MUY1 5E16A 5FZ0A 5C9AC 2CDPA 2YB7A 4JKLA 2RMU1 1A3KA 3WCSA 5A7OA 2RDSA 3DYMA 3M3QA 3ZX7A 3NKTA 5DUUA 5JSPA 5KHGA 4LR4A 1AR81 4XEZA 4Y5Z0 2ZXQA 5LBEA 4MGKE 3VKOA 1RHI2 2ZBJA 3INAA 4MXVA 3VBHB 2MEV1 1SLCA 3BIWE 3GXUA 5FXWA 3VBRC 1NQJA 2IWGB 3UT0A 4NOTA 4URAA 1OVPA 3FWEA 4YGDA 1X8MA 3ZLIA 4LBKA 4UXAA 4HT1T 1Z7S2 2OYZA 5LK7B 1C8M3 5FMCA 3MLJA 1G9CA 3LA2A 3DXTA 2WN2A 5JIUA 5IAVA 1PO11 3I2HA 5A1LA 1APNA 1LESA 1PVC2 1S0FA 2AREA 3IAQA 4CDWC 1MS5A 1I6XA 5FLIA 3VZNA 3FUOA 1NY72 2P5BA 3P6BA 1Q56A 1DQ6A 5LA9A 5C4WA 4AHZA 4IE6A 1YFUA 2VD7A 4JTOA 5FZEA 3ZXJA 3IIAA 1NT0A 3W20A 1CAVB 4C0HA 5FYYA 3C8XA 3DV8A 4XBQA 5J1XA 1YWKA 3OSDA 1C8M2 1ODNA 5DZEA 3MLKA 1OH3A 1CAXB 3HPNA 3KWVA 3KLSA 4C0BA 2B46X 1H9WA 4NAMA 5FOBB 4HSLA 5HV0A 1DU3D 1D0HA 3RZMA 4LITA 4LQRA 4EYUA 4QQHA 1VAMA 2ZZJA 1X7NA 3FFZA 4QDQA 4A3ZA 3N36A 4XDPA 4YW2A 3BU0A 3MO4A 5JOXA 3N7JA 1IHMA 3HNMA 3MW4A 3RZZA 2DFCA 4AEMA 3HVDA 1M06G 3VKLA 1IPJA 4W6WA 3J26N 1VBB3 1TME2 3SH3A 3UGHA 3UKTA 4XAEA 4ZHNA 3GJAA 3APBA 3MW3A 1FMD2 4Z2AA 1PIV2 3R4DB 2JDKA 4COVA 1YI7A 5FY0A 5EZWA 1QDCA 2O0OA 4MUVA 4YZ1A 2DDUA 4JKMA 2WS93 5CFDC 3RG0A 5DDJ1 4PLMA 3O1PA 5A3WA 1WCKA 3ZMOA 3IMMA 2XHKA 2DFBA 5BNPA 1G6NA 1OQ1A 3I59A 3R6SA 2OIIA 1BVP1 2BOJA 2KM2A 1DP0A 2EXIA 2JEMA 1UOFA 4H14A 1RUG3 3O1RA 4KNCA 1ULEA 1VBB1 3VBUC 5CFCC 1QJU1 4XIKA 2E7QA 3HMYA 1JOPA 4XJWA 4A7KA 5A7PA 4YYOA 1W2AX 5KXDA 1MPXA 4YVSC 2R1BA 3VL8A 2KA3A 2RE9A 1W6QA 2RHPA 1EPZA 1JUIA 1XRUA 1K12A 1F2NA 3GBWA 1NKGA 4PCRA 4GMP0 4BK4A 3S7EA 5K0UC 3O5SA 2GU9A 1UYYA 1AR82 5FFOC 1UMIA 1QHDA 3I2IA 2X05A 1W8ZA 2VZ3A 5DQ0A 1LU2A 1D4VB 1U5IA 1RB8G 3BB6A 1RUI2 1JYCA 1XC6A 1WZXA 3T0DA 1GOFA 2PHWA 3I3EA 1D2SA 2R16A 2X10A 3HQUA 4N43C 1S55A 2AENA 5CBLA 5JR7B 5LA1A 3I97A 4Y5SA 1LR5A 1DGRN 4OMCA 2VPVA 3ZYJB 1AYN3 3PTRB 4KU7A 1QQP3 5JUVA 1UMHA 3R05A 3T2OA 3ZN4A 4OQ8A 1UNBA 5FYVA 1EP0A 1LHWA 3ZXEA 4Z2WA 5FK7A 5IYYA 2FDJA 1JZ6A 3AKQA 4O7XA 2XL7A 1UZWA 5J37A 2R49A 3PU8A 3J8F2 5JSRA 2VO5A 1NZIA 1R091 4B4RA 5ACA1 2WS91 1FV3A 5L9VA 2NQYA 4ASKA 5IVVA 1DGRA 1ST8A 2HLEA 3VHNA 4LBJA 4Q1RA 3I59B 1VALA 1R081 1SFYA 5FRAA 4Q4X2 2XLFA 3LIHA 3WW2A 4E2GA 1MZ6A 5F7UA 3DYPA 2VC9A 2VZQA 1XNDA 3H42B 2BRTA 1GP5A 2H6BA 3BVCA 4NR1A 4P5HA 4AEDC 4YPJA 1AR71 3NNGA 1QH6A 1HDKA 4FP2A 1FPN3 2Y0OA 4I30A 4LNVA 2JD9A 2VOKA 3NKGA 1N1SA 5IK7A 3I2OA 3OBTA 4XFGA 1YC61 5GKAC 5FZGA 2QNKA 4BQ5A 2VZ1A 2OT7A 2P1BA 4L2NA 4CSWA 5EP9A 1Y3TA 3ZYPA 5G05L 5IVBA 3A0NA 1WA4A 1ZA4A 3AKSA 2NPIA 4TSVA 4YG6A 3K4DA 3S30A 1I1EA 3GNEA 4BYYA 2ZHMA 3NNJA 1BZWA 5C3SA 4XETA 3TEZA 4KBBA 4BQXA 4ATEA 3Q8BA 2JIGA 1H2LA 2VCAA 1UCXA 3AYCA 1VBC3 2VMIA 3HT2A 3ZOIA 3ZN6A 2WNEA 1GANA 1J1LA 1TNFA 1YXWA 3OBAA 4G3YC 1W2NA 1OFNA 4ISRA 4MHRA 2R1DA 1YNAA 2VOVA 2WDBA 3DKWA 3THTA 2BEOA 4QX2A 1ND3B 2B7YA 2F4LA 3KMHA 4EZ4A 1H2MA 5GLVA 2WQZC 4NROA 2CU5A 4FTBA 4IEUA 1YQCA 2WIIB 2ZGOA 4OYUA 4XF0A 5CKMA 3LCPA 2W47A 4Y1XA 4CDQC 3EJKA 1YUDA 1UY0A 4NN0A 4URTA 1H6YA 2A6XA 3QOPA 4UYBA 1HIXA 1D2QA 2VZOA 1N3OA 1FMD3 3JBG2 3N9PA 4Q4V1 3VBOA 3MBWA 4DPNA 2YZ4A 2WWSA 5JR2A 4AZZA 2ZGNA 3QH6A 2GC3A 2ENRA 4JCKA 1CJDA 2XOMA 2RMU3 2D3PA 4XUNA 3H0OA 1PGW1 2RDNA 1QJX1 2HEVF 4HLTA 2IVJA 3AMPA 2WBKA 4OCTA 4P9IA 3PTYA 4IGQA 4TLFA 4PF5A 1VBD3 1W2OA 5C6CA 2CSGA 3LPFA 2EIGA 3NNFA 3WV6A 1QNWA 2XBO3 4OUMA 2BV4A 3FLRA 4LBNA 3LE0A 1LRHA 3LQCA 4QB6A 4XF9A 3BTYA 1TVGA 1LHVA 2E33A 2PAEA 5LEJA 5FZ1A 1U12A 3KS7A 2Y6FA 2E6VA 3SQOA 2DCJA 1VRH3 1ZZ6A 3THDA 5CISA 5I8SA 2FMYA 1VAVA 1W0NA 3DL3A 5BXXA 4LOSA 3MIDA 3IPVB 1KXGA 4W6YA 3VHPA 1H30A 1RUC3 5FZBA 4LT5A 2D97A 1SG3A 2X53S 4XQ4A 4W8JA 5DUVA 3UJOA 2O14A 2CHHA 4EROA 2Y38A 2VZVA 3Q8CA 5BNNC 1AR62 1QJEA 5AFBA 5ISLA 3AKPA 1VMJA 5CG9A 1LOFA 4KGGA 1RUNA 5FPUA 4KMQA 2VJXA 3VUOA 5CZKA 2QZ2A 1OA3A 2N7GA 3WD5A 2HWD2 2WKKA 5A33A 3WDYA 1U5XA 1K5MB 2GNBA 3BOPA 1A8MA 1UZ0A 2B39A 5IFTA 1JTZX 2WFF1 1BBT1 2E31A 2F4PA 3NMBA 2B45X 3TB0A 3JD73 1OH4A 4RA0A 4CUBA 4YFZA 3LA7A 3BI3A 1PGL2 1GP6A 4GA9A 2X5IB 3OY8A 2TUNA 3BTAA 3PURA 1O5LA 3OYWA 2QQLA 2ADEA 3SKVA 3WNLA 3VBHC 4RHV3 5FZOA 1BCXA 2LW8A 3FLTA 3C7GA 4ZU5A 4TWTA 1RXGA 4AFMA 2YBSA 4BQWA 2WNOA 3OTFA 1SBFA 3VZKA 3CL1A 4B7EA 4UAPA 3Q8AA 4MLOA 5LY2A 3SLIA 1OA2A 2DUOA 4BMBA 1B35C 1PVXA 5KWRA 4RGKA 3VZJA 3ZFEC 4A7ZA 1C5HA 1TNRA 3O1TA 2VXJA 4PDWB 3SMHA 4BIOA 2PA7A 2DU0A 3VBOC 1ASJ2 1VJ2A 3U10A 2WZ8A 4UW4A 1OXCA 2GNTA 2YGMA 1AX2A 3FFQA 3POEA 1OVSA 1YRZA 5IVYA 2IFWA 3W21A 3POYA 2CYFA 2ZJCA 3JB4C 1ZA7A 4MXWB 4Q8LA 1E5SA 5CEHA 1C1FA 2P2KA 4IV3B 1V6NA 2VXRA 2QDRA 1SFNA 2GC2A 4L99A 1AHSA 5HV4A 3AKRA 4HK8A 5CADA 4M4PA 1YCIA 1W90A 3QLQA 3S5QA 2BWCA 1AXZA 3ZFEA 3E5XA 4XDQA 4FQZA 1GNHA 4MGIE 4DB5A 5HCFA 4XILA 4D3WA 3VDDC 1VE0A 2YU1A 2ATFA 3I2FA 2C26A 3MUZ1 2VZSA 1RJ7A 1DBNA 3JBG3 4XFBA 2L9LA 2IXCA 2VMCA 4ES8A 4JDNA 3B02A 3OJBA 5I8YA 1WLDA 1AR61 1ZZ9A 4J6GA 4LBLA 3ZKYA 4G9SB 4FPLA 1LGNA 1S0EA 3FHAA 5C9AA 5FMOS 2VL4A 3KT7A 1KJRA 3OB8A 4QX1A 1X36A 1ZRCA 1HXS1 1R1ZA 1J1TA 4AFDA 1O8PA 2GH8A 2GMMA 3ZKUA 4E2SA 1RTVA 3I3DA 1LEDA 1YEWA 3N7LA 4M4RA 4YZ2A 2WA3A 3AP9A 3SEEA 4M0NA 2XUMA 5FZ6A 4C1XA 1OQDA 5DMYA 1DYPA 2XHNA 1OLMA 1CAUA 5F3CA 3D3AA 3MLLA 5F5IA 1FV2A 5FYUA 4CP0A 1W6NA 1ND2B 3AMQA 4IXLA 2EIBA 2NLRA 3BUCA 1LOFC 1GZWA 4QPGB 5BYNA 4COUA 1S2EA 2VTXJ 4IEPA 1XJAA 4XBLA 2JWPA 5A32A 1VAKA 4LULA 1KDMA 1L7LA 1NLRA 3OGJA 4MGZE 5CYYA 1KITA 3S5AA 2ILMA 3IIIA 3N9OA 4N9IA 2WNVC 1IZ3A 4R52A 3VKMA 4AOCA 4COZA 1H2KA 2DBNA 2WFF3 5JXIA 5K9YA 3V65A 1RUC2 3DUIA 2VW1A 4X8NA 4LHLA 4OHVA 1ENQA 5GZDA 2AC1A 3A4UA 4K3UA 5T52A 4B29A 5HBAA 5J36A 4ZXKA 4C8DA 4WM7B 2JE8A 1SACA 1BVVA 4LE3A 4RHV1 1VRH2 5LA0A 2YXSA 3WINE 2ZX2A 3ALQA 3HAGA 1VLNA 2P6CA 1GNZA 1SLLA 4NO4A 1O3SA 1FXZA 4B1MA 4E4SA 1RMU2 3IPVA 4L97A 4CEYA 5A6YA 5F37A 4QM9A 3ZN5A 5JI9A 2WT2A 3MGUA 4DXTA 1V00A 5B4NA 2D3SA 1O6UA 1RUF3 1T6GC 5F2SA 1X82A 3HT1A 1AL21 1CIWA 3IDBB 4JV4A 1AX1A 1EAH3 3SITA 1YQ5A 4MGTA 1C8M1 2JB8A 2FDHA 4OI0A 3OPTA 3TEYA 1VR3A 2ZGRA 5T5PA 4GD4A 5LRRA 2QQOA 3LEKA 4EN6B 1NE6A 2Q8CA 4HKOA 4GJYA 3CBNA 3AP4A 5FZ3A 4X6RB 3WF2A 2W1QA 1Q8PA 1DZTA 1WMFA 2IUWA 1C3HA 1XYPA 1RL3A 2CTVA 2CDOA 4XURA 4XVHA 3WNNA 3TYJA 2D6OX 5DXDA 5FJKA 4ZS3A 2LALA 1AYN2 2RR11 5I91A 3BGAA 2ZEYA 4PT6A 4HBNA 1DYKA 3FZ3A 3AMHA 4OVEA 2RDRA 3I3BA 1QQP1 3SCGA 3U0ZA 2W08A 2VUCA 5LASA 2DVFA 4MGYE 1RUI3 1JODA 1DFQA 2HKXA 1QJX3 3Q8EA 4BPZA 5A3LA 4CU8A 2FCUA 2VAUA 2HBUA 2QDNA 5ACA3 3A0KA 4FPOB 2DUPA 5ERLA 2Y8KA 2A6VA 4WBBA 5EHDA 1ND2A 1TEIA 3B01A 3K4AA 3RYRA 5A3OA 4FPHA 5HXVA 3X29B 3PU3A 3NV2A 1HRV3 1GMMA 5D8AA 3LSEA 2BJSA 1AR63 2JE9A 4AHXA 2VBPA 4ARXA 4FBFA 4BCUA 1F15A 4KG8A 2VUAA 3E5QA 1NA1B 5FV3A 4XCAA 5FP8A 2BGCA 4C91A 1FPN2 1XNBA 4F8AA 4XACA 4GB31 3ZFGA 3O0WA 5FYBA 4E8DA 4QX0A 4FPKA 4SBVA 4Y1VA 1UKGA 1D4M3 3NAPC 2BFUL 4LO6B 4AEDB 3KV9A 1GZ9A 4I09A 3H3ZA 2CWSA 3JB8A 3I3MA 1HRV1 2G4IA 4Y3OA 4HKWA 1ODMA 4YM1A 4DOUA 3AFGA 4EQVA 1V6OA 4Q4W2 4WVZA 2GC1A 1GYKA 3GGLA 3T30A 1OD5A 3GALA 3ZSKA 3ON7A 4H7LA 4N90A 1RUD3 2E9QA 4GKYA 4LPLA 1O91A 3OG2A 1IS4A 4L9BA 2R062 1D0GA 1JN2P 2C0ZA 1RGSA 2BUKA 2PMWB 4IEQA 4ASMB 2JDYA 1BBT3 1E5IA 5AVPA 3T0BA 3WHTA 1ONAA 3M8LA 1W6OB 4KU8A 1W8OA 3PMSA 3TN91 1QEXA 1NYWA 1T2XA 2EXJA 4P9YA 4WVVA 3S7IA 1JYXA 3MZHA 1ULOA 3T2TA 1GICA 3IBMA 4CXXA 4XXAA 5FYIA 3WG1A 3FBYA 2WNVA 1UZYA 3OGGA 1WCUA 2QFEA 5LWBA 1ULCA 1XNAA 4KWJA 4CUAA 4QKFA 5FJHA 4V2WA 2JDPA 4CEYC 1IGOA 1TMF2 5SV8A 1OOPA 4LIUA 1HB3A 3DKQA 1L7QA 4I01A 1G9DA 2RS13 4FFFA 5C4WB 5JPNB 3UGFA 2VOWA 4JVAA 3N7MA 4EN8B 5D8AC 4YM3A 2JG9B 4BQ1A 1H8TB 2B5HA 2Y6GA 4ZU4A 3TN93 2RS53 3UV9A 1XE7A 4HZFA 3KT4A 4P00B 1ZZ7A 4Q4V2 1W9YA 5EFUA 5A7WA 2EAKA 4RL7A 2OA2A 1VPHA 1RC6A 4RS5C 1I5ZA 1PO22 1FYUA 5F5CA 2UU8A 1G7YA 4BMEA 4YVSA 2GP3A 2Z2SB 1ZZCA 2WNUA 3M70A 3POFA 4BK5A 2UYBA 3ZM8A 1H0BA 4GH4A 4AXOA 1NA1A 3ZDVA 5CFCB 4H7MA 1JZ4A 1X50A 1JBCA 4IEYA 1JU4A 1S0IA 4A45A 2JG9C 2W87A 1CX1A 2VECA 2P3KA 4KGQA 1DQ0A 3LAGA 3ZXKA 4D7YA 3K4ZA 5FZ7A 1PGSA 1CZVA 1JW6A 2J7MA 3THPA 3ZYBA 5JXJA 1FPN1 4XFAA 2XJUA 4FCAA 3UNPA 2Q4SA 5JVVA 4NIHA 2XONA 1DIWA 2WLPA 2JDZA 1Z78A 5SV5A 1EUUA 2ZA9A 2WRAA 1UX6A 2QQMA 3ELNA 1UF2C 5DAWA 5FTTC 4NHYA 4XFCA 3JXSA 1O4TA 5FUPA 1GLHA 1AXYA 1BLZA 2WO3A 2ZS6B 4FSJA 5F8PA 3HQXA 1RUG1 2GSYA 2EIEA 5C8CA 3QACA 4CA9A 1H6XA 1QY4A 1SZBA 3ILFA 2R073 4ISQA 1H2NA 2QCSB 3LIGA 3FBMA 1C1LA 4R9AA 1CONA 2LTNA 5LBCA 1RYYA 3WQ7A 3CLPA 3S0MA 1W6PB 4W4ZA 2BNMA 2VNOA 3KGZA 4GB33 3I4IA 4OZOA 4XABA 4LUKA 5C7GA 1G8WA 1F4HA 4YVWA 1BMV1 4K40A 1HRI2 1RVF2 3GZEA 4YM2A 4S2GA 1K5MC 2BP6A 4QQOA 4MADA 5BPXA 1W9FA 1QQP2 1WCQA 4CEWB 5CIRA 2VE1A 1MS3A 4LE4A 1DQ2A 4N53A 3AZXA 4UT5A 5FYZA 3FN9A 4N7UA 1DG6A 4K1YA 1W03A 1UPSA 1OMIA 5FKBA 2PLV1 2YFUA 4GWIA 5A6ZA 1UZZA 1SDDB 3CKHA 5BNNB 2G1MA 1C57A 3ME2A 1FMD1 2A75A 3GBFA 2Y0IA 2IFRA 4WVMB 4BM8A 3M3IA 1A34A 1DHKB 3AJYA 1A6CA 4QXKA 1VBA2 3GHMA 4BOWA 1W6NB 3NO8A 1W3VA 4OUSA 1GFF2 3LFMA 4K21A 2VGDA 3C7OA 4JGYA 3HEIA 4ZPIA 4ARYA 4YRDA 2FQPA 4QPIB 5EIYB 3V0AA 1O8SA 2JE7A 3T4VA 2CAVA 2WT0A 5DAQA 5FWJA 1ZREA 3VKFC 4FFHA 4LBQB 1XSRA 2VULA 4NHMA 5GLWA 2DYCA 1RUJ3 3BPZA 5KBFA 1UMZA 5LW9A 4L0PA 4OHYA 4M3CF 1ULFA 4CP2A 2JJ6A 4Q0QA 2K9ZA 4S2FA 1CZTA 5DZGA 2TBVA 2Z69A 3VBRB 4DMIA 5JSOA 5CB7A 1HJFA 3PUQA 4IE0A 2D6PA 1T6BX 3WVJA 5FREA 4Q1PA 5T5OA 1PZ9A 5LK5A 1W9TA 2AGSA 4UFIA 3MDPA 5I93A 1V6IA 2UYAA 3UK9A 1QJFA 1W39A 3KHCA 4XJZA 2P17A 4KWUA 1VBB2 2XH6A 5C9AB 2EF6A 1MQTC 1MQTA 4K6BA 3VV1A 1UXZA 2ZOEB 4MHUA 1ZRFA 1JU3A 3ZPOA 1PO12 2ZMNA 4PIXA 1COV1 5JDBA 4OHXA 2JDAA 3ZIWA 4ZS2A 4CXYA 1QU0A 1QXJA 2V5DA 1S0CA 3WDUA 4TLGA 3RJ2X 4UW6A 2R041 2H0VA 2ZGSA 1VB2A 2VCBA 3OYWB 1IPSA 1OLRA 1ND3C 2W68A 2AR6A 4OULA 2CV6A 3WLUA 2WQ8A 5FKCA 4RS5B 2QUOA 1ZBE2 1UY2A 4FFGA 2OW4A 3B3QE 2X09A 4N53C 3B9IA 2GAUA 2YPJA 1OKOA 2QQUA 5DN2A 1OC1A 3HJRA 1SEFA 4L8QA 4WM7C 2YHJA 5A3UA 2GDFA 1H8TC 1OF3A 1XNKA 3HWJA 3O0XA 2Q8EA 2J1UA 3IAPA 1SPPA 3G7DA 2OX0A 4FPFA 2R6QA 5C4WC 2XVLA 3WW1A 2GN7A 3A22A 2R043 3SXWA 2KD7A 4WM8C 4WVMA 3MIFA 1QDOA 2BWAA 4PDWA 1NX9A 3AVRA 4QGMA 2RS31 3R4SA 4Q4Y3 5KHHA 4CU7A 3L2YA 1K42A 2VMEA 4YW4A 3CU7A 5C8CC 1Q8VA 2Y60A 2W92A 5JI7A 2WZR2 4JDOA 1PX4A 3RNSA 1DZRA 2VZPA 5FP7A 2VNRA 2H0BA 2XKPA 3CZUA 2FBEA 3ZSJA 3ILNA 1CD3G 5L7OA 2ZMLA 4D7SA 1STMA 1LENA 5LZ6A 2BW8A 4AI2A 3LOIA 5JMCA 3WHUA 3WF1A 1LOEA 3O1MA 2A7AA 4XUQA 3MIGA 2V4AA 2RJLA 2ORZA 4FQ4A 1RUD2 3HIFA 4IETA 4NIIA 2D5FA 5HXMA 2X5IA 2CNAA 3OY8B 1O59A 4DUVA 1AJKA 3JD71 4P5YA 3SH5A 4A2UA 2VQTA 4QT6A 1JZ3A 1S0DA 5JAXA 5JLVA 1OI6A 2ETEA 1OURA 1Q8SA 3AXEA 4FPCA 3OGSA 5IK5A 4J1XA 3H1MA 2AZ5A 3WOGA 4NRQA 4AHYA 5C3QA 2BNNA 4MO3M 2K46A 2MEV2 2OUHA 2C24A 1PNGA 2ARAA 1J84A 1HB1A 1QOOA 2HJIA 1UIJA 3KV6A 3U11A 5LCWL 2AACA 1SLAA 3I2DA 2VTXA 4BXFA 1NOVA 1WMXA 3IDCB 4BISA 4DXRA 1IKQA 2JECA 4PLOA 4B1LA 2FDKA 1R1A1 4YGBA 1EV13 3RYKA 1YJKA 4GZ9A 5KR7A 1QF3A 4FO9A 1MS9A 4LIVA 1WW6A 4LEJA 4YGCA 1CN1A 3WQ0A 1GZTA 1XBFA 4RFT0 3C7FA 2LROA 1LECA 2Q5TA 2C4XA 3EO6A 3VD3A 2XL9A 4IEWA 4LK7A 4D6SA 4YZ4A 1AL0G 1H4HA 2F17A 1OPOA 3P3NA 2RS52 3I7DA 4F83A 1CAXA 3RGBA 5BY5A 1H8TA 1RIRA 4UFJA 2VUJA 5FZHA 3ZFEB 3VBFB 2A3WA 4Q4W1 3ZVXA 4AE2A 3BKZA 3POWA 1ZBA1 1NAEA 5D21A 3LB9A 2PAKA 1KJLA 1AR91 1VRBA 1YQ8A 2WABA 3J7LA 3WG3A 5L9BA 5E89A 4UFKA 4F3JA 5ANNA 5EYYA 3QD6A 1JZ5A 2J1VA 3VD7A 2A6YA 4AVBA 1NXMA 5C3RA 4Q4Y2 4XF4A 4GKXA 3NJZA 5A6QA 5T55A 4WM8A 4QU2A 5FZ9A 1VBE1 4AI1A 4AVAA 3RMXA 1HV1A 4LJHA 3VBSA 4ZZ5A 5FZAA 1ZYBA 4IW3A 1VMHA 4LLFA 1UYXA 1AVBA 2QQIA 5E1RA 2PLV3 2KR2A 2YMZA 4DRVA 1WLCA 1JYTA 3U4XA 1QH7A 3KCYA 1AL23 5F39A 2VTFA 2C9AA 2RJKA 1ZBE3 1RJ8A 1BKZA 2IC1A 2G9ZA 5IK4A 1EV12 2A5ZA 2JICA 2R0HA 1EUTA 4FOQA 2IXJA 2O1QA 1HJGA 4D6QA 2YU2A 3BPSA 5FP4A 3AKTA 2EXHA 2WNVB 1SDWA 2VVEA 4LO5B 4AW7A 1RUJ1 2P37A 4BLJA 1A78A 1YFYA 1XB9A 2WFPA 3BIEA 3LDKA 3P3PA 3MV01 3R4UA 4NUBA 1CVNA 4ZZ8A 4DUXA 3EHKA 1F8VA 4COYA 1ZX5A 2VNGA 1UX7A 5GZEA 4CDWB 4B4QA 2PELA 2I07B 2J1AA 2VOTA 3ACHA 4JC1A 3AM2A 3N7KA 4UW5A 1REDA 1U5ZA 2ET1A 2YC2A 2EA7A 3B93A 5K4LA 5A7NA 3CMGA 4UBGA 4XUTA 4FOYA 1VIWB 2VM9A 4R9DA 5B2GB 1JOJA 4QX8A 4BQ2A 3RWKX 2RS32 2GMEA 5L73A 2ZX3A 3WR0A 5KHKA 3POSA 2GALA 1VBD2 1COV3 2HWC1 5FWEA 5FPBA 3J8F3 2PYTA 1R083 4FI9A 4IDZA 5GM0A 4BXSV 2W95A 4ZU7A 3DF0A 2JDNA 1MACA 2D6KA 3WW3A 4XFHA 3GZAA 1Q5OA 3ES4A 3RZLA 1ALYA 3PL0A 1VRH1 1YQ6A 5FMDA 3KCCA 3WDVA 3ZXLA 4JQRA 2BNOA 3PNAA 1WA6X 4AGRA 1IQAA 1C8NA 5IW0A 3VDDB 3NNMA 3CJIA 4GMP3 5BNOB 3DCQA 4UBHA 1HLCA 2C9KA 3E97A 4YW7A 3SKJE 3PUSA 3N35A 2RM21 5G04L 4A3XA 3UJQA 3P5BA 1R082 1H4GA 5JZGC 3EXUA 2AEYA 4KL1A 1CWPA 3ASIA 3LDBA 2IVIB 3PDQA 4AVSA 2QE3A 2SLIA 1HW5A 4WM7A 4RN5A 2J1RA 2VMDA 4AK3A 3SCFA 1URXA 1W6PA 3K3OA 2RS33 1UU5A 4Q4Y1 4U2AA 5EXOA 4CP1A 1H9PA 4N43A 1NE4A 4CDXB 3L9JT 2PN5A 1IS6A 2W3JA 5D8AB 3UGGA 1O7FA 3QBQA 4B3NA 1BYHA 2V5YA 4EWEA 1NXD1 4AI9A 3POIA 3U78A 4MV2A 1VP6A 4JTNA 4LXLA 2R072 4RD7A 4DZGA 1I3HA 1RUE1 2HWB1 4JHTA 4MGQA 4XDOA 2P3IA 2ARXA 1KS4A 5BNQA 4FAHA 3HD8B 2DVGA 2WC2A 3B69A 1G9BA 5C33A 4SLIA 5IAXA 3V0AB 1PIV3 1RUH2 4IL7A 3HN3A 3VDAA 4PLNA 4NHKA 3CO2A 1W8UA 4GAZA 4IUGA 1W6MA 4IE5A 2HH9A 2WT1A 4TN7A 3AB0A 3SISA 3IKWA 1V9U2 2X5IC 4GH4B 1QJY2 1POV1 3D6EA 5A3NA 2HWE2 2IXKA 4RGAA 4P9JA 2I2SA 3H8XA 1W0OA 4QKDA 3IWZA 2D6MA 1KD7A 3OD0A 4QU1A 1N1TA 3VHOA 3AP7A 3VKNA 4CEWA 3PUHA 3GZUC 2XJPA 1WCDJ 2YFZA 1WD3A 1SLBA 3PVNA 2XWJB 4XW3A 4XQWA 2Y26A 2A71A 4Y1UA 3TAYA 5H9QA 2FD8A 1QIQA 1MEC1 1YLLA 4FPGA 4HOOA 4AGGA 3VL9A 4QMAA 1V6LA 3K51A 1SLTA 2OZ6A 2ZGKA 3TNQA 5GJ6A 2R7EB 1NUKA 1XNTA 5IATA 3W59A 1ZZBA 4QPGA 1OD3A 4H2AA 4CCKA 5FY8A 3F2ZA 1D4M1 1DQ1A 1PVC3 4K1ZA 1KS5A 2W46A 5JXHA 1YI9A 4FTSA 1QJY1 2DBIA 4CUCA 3ES1A 1FOD2 3NQHA 1MVQA 2WN3A 3D0SA 4XZPA 4I0WB 5D1IA 4AG4A 4H3WA 4A4AA 1LULA 4DEQA 2G9GA 5JMOA 1SQ4A 2W1UA 3RZJA 4MX3A 4Y1ZA 2NM1A 3U37A 5IVFA 1EAH2 1TZOA 4QX3A 2VCCA 2BYVE 3RDIA 2YPDA 4Y24A 3IN9A 4Q0VA 1UY4A 4CDUA 3N4MA 4Q0SA 1AR93 3ZFGC 1I9RA 4LKFA 2ZHLA 5FLHA 2I45A 1W8HA 4WV8A 2E7TA 1UKRA 3OGRA 4LTAA 4CDQA 1JYNA 2XB6C 4CXWA 2BPA2 1Y9MA 1XSQA 2Y6HA 2VMFA 1LJ7A 2RG4A 4LA3A 4M01A 4XJAA 2AH2A 2MHFA 5FYTA 4CDWA 3WG4A 5JXGA 1QOTA 1BQPA 3KCXA 3MPPG 4YNIA 2O8OA 2P4EA 3VGIA 4HVQA 2OUJA 1VBA1 3POJA 3NJYA 1CPMA 4HONA 3ZXFA 2MEV3 3DXUA 2QQKA 3PLQA 4CDUB 3UKVA 3NAPA 5CAZA 5L7OB 2ZGQA 3TEWA 3PMEA 4OI1A 1MS1A 3WP5A 3M3EA 1WMEA 2VZTA 1Q8QA 3AK0A 1CPNA 5H9RA 1OOPB 5F9TA 5FZOB 3BN6A 5K8SA 1WLWA 4J1WA 4FXGB 4EWDA 3ACLA 4YG3A 3ZXAC 2PHLA 3NWKA 5LBBA 2IZWA 2JG9A 2IXIA 1KDKA 2RM22 2D5HA 2W39A 2W94A 5BUVA 2LM3A 1Y43B 2WL1A 1Y7BA 1CX4A 4CYDA 1RHI1 5A3TA 2HWF3 3V64A 3VDDA 4LBQA 4PF1A 4BE3A 1CQ9A 1VBC2 3WNXA 3AX4A 3OUIA 3E6CC 4W6XA 1B09A 5FZLA 2HYKA 2XJRA 4AAPA 4HMZA 4MVTA 4QPYA 4FPJA 4CCMA 4UFMA 1J83A 3U1XA 1OUSA 2E51A 4GWJA 2RS12 2ZGUA 4QGNA 1WUVA 3O12A 5AC91 1XYOA 4OMDA 4LLOA 3KM5A 4JGZB 3ROUA 1M4WA 2YC4A 2WLQA 1GNYA 4OHWA 4PBOA 5CKQA 5KXCA 3TN92 3K46A 5EJ3A 2X29A 1GU3A 5FYHA 5BNNA 2B9UA 4HXCA 4RSUA 1NLSA 5FBZA 5FOJB 1JI6A 2VH9A 4RFRB 3WDWA 4IV3A 2WO2A 3M3CA 5FP3A 1WW7A 2XR4A 3IT8A 4QX5A 5IVJA 1WBFA 2I74A 1SBDA 1QOSA 3GBGA 3ZR5A 5I0RA 1KFXL 3DPRC 1BEV2 1VMFA 5F3IA 5LB6A 5FCCA 1UOGA 4ATFA 4GQ7A 4DS0A 3K77A 1ENRA 4Y5TA 1PM4A 4OQ9A 2R071 3T1MA 1OHFA 4A6SA 1O3RA 4RYDA 4DO0A 5I0DA 1N1YA 1WMDA 1E5RA 5FO7B 4A44A 5FZKA 1PO21 4QXBA 3NNLA 3WF0A 4KWLA 2WA4A 1HN0A 4GB32 4FOVA 5FPXA 1CJPA 4QHOA 3ZFFA 3K3NA 1RMU3 2WQ4A 1DGWX 3FJSA 3RYPA 5KC6A 4TZDA 4XUOA 4AI3A 5I0TA 4L92A 2UWCA 1GZWB 1JUHA 2A1XA 2HEYF 5FPAA 5I8TA 3FX3A 3S6PA 1J3QA 3AC0A 1UW8A 1H1AA 2ZEXA 1YIPA 4XCBA 3RPQA 4DY5A 2SBAA 2WJSA 1QXPA 3GJBA 2PHXA 5FZIA 3RQ0A 3H1YA 3KF5A 3O14A 1Q8OA 2J1TA 1GSLA 4I3GA 2VMHA 3SCHA 2PAMA 1TME3 2ARCA 4RQPC 4MGSA 4YZ3A 1BK1A 3KB5A 4G4FA 2VCMA 5F1RA 5JCTA 3ZPYA 3O1OA 2A3YA 2XJVA 3GYDA 1OPMA 3PUAA 4J25A 4K8RB 2ZGTA 4PQQA 4O9EA 1FAYA 5FQ0B 3OPZA 3MV11 2Q1MA 3EBRA 4DXSA 4JGZC 1RUD1 5KXEA 4NHXA 1GKBA 5C71A 4Q4V3 1XQNA 2XQRA 2ARBA 1N1VA 1AR92 2HWF2 4IE7A 1CGPA 1IS3A 5JZGB 3OGVA 2QQNA 4WZCA 1HB2A 3J7HA 4IQPA 1ULGA 2YV8A 3NV3A 5ACA2 2OS2A 2Y64A 1RUE2 2HWB2 2ORXA 3A7QA 4QHZA 5F3GA 4CCJA 3V0BB 1BEV1 1NQDA 3H8OA 4CP9A 5A7QA 2ZHNA 1UXXX 3PUIA 4W50A 3DGTA 3RZGA 4CEYB 3VDCA 4QQPA 4BA6A 3OEAA 2OPWA 2P6HA 3B7MA 4CZSA 4AQSA 5CFDB 2W9XA 4TXWA 2BERA 2HWF1 2JKXA 4NRPA 4Y20B 4AVVA 3NJVA 1PM7A 2LRPA 3RWNA 4YW5A 3WY6A 4C1WA 3TWIA 1V70A 1U0AA 5AC92 3AYEA 2FHRA 4KI5M 2VZRA 3OBRA 5FAXA 1YHFA 1W04A 1DLCA 2OKXA 3VDBA 5L7OC 1RUI1 4FVVA 4M3CA 3WNMA 1KQRA 4CTEA 5FYCA 1AYM1 1QGLA 4NAOA 4R9BA 2K0GA 4NE9A 3UETA 1NCQA 5IT6A 1K5JA 3CDZB 4R4XA 1RUC1 3I3QA 2HWE3 2XG3A 3AZWA 2AEZA 4NHLA 3ECQA 5FZMA 4XFFA 3OCPA 3MICA 1MEC2 4INDA 2PHDA 1XOYA 3SEPA 4XAAA 4Q4W3 2JG8B 3RJRA 1V6JA 4QWNA 1FOD3 2A6ZA 5DG1A 4YFWA 4YM0A 2B42B 2BVVA 2ZX0A 3KGLA 1N3PA 1VBD1 2FMDA 2HWC2 3HR9A 4S2HA 4EZHA 2RR12 1KEXA 3BU7A 4WVWA 5C5UA 5KXBA 5CKNA 1JHNA 1MZ5A 4OLLA 2VNVA 1CAUB 4HFSA 5HPOA 1GUIA 2ZGMA 3WF4A 1ZRIA 2XJSA 3ZSLA 2D7FA 1OLQA 3MPBA 1S2BA 4AQTA 4PQ9A 5C3PA 3T2QA 4JAAA 2E26A 2Y33A 3LSDA 4BLIA 1SLIA 2TEPA 3JU9A 4JRAA 2XDVA 3HN1A 1RINA 2DUQA 2XLAA 5LY1A 1AL22 1HRV2 3H8UA 4RS5A 1X33A 1JMUB 4QQLA 3WG2A 1JZ2A 3WDTA 3MW2A 3FE5A 1N47A 4E2QA 3NSTA 4JGZA 1RUJ2 1REFA 4ZXEA 3U4SA 3MIHA 5DDJ3 4DY3A 4P9LA 3MIEA 1O5UA 5CVRA 1PZ8A 3T1LA 4COWA 2WAAA 5FIXA 2NP0A 5EPAA 1CR7A 3CNAA 5FLJA 2Q8OA 2W0XA 3ETPA 4JGYC 4BZ4A 1ZRDA 3QCWA 4Z92B 2KXLA 2XUEA 2ZGPA 1LOAA 1HKDA 1S2KA 1OT5A 4X8PA 3N9NA 1HQWA 4PIZA 4MG2A 2VBBA 1R1A2 4Y22A 4QKNA 2UWBA 2ZEZA 4HSJA 3VBFC 2OXBA 5J48A 2XGXA 2CL2A 3WEZA 2W91A 1BJQA 1WW5A 2C5DA 3JQXA 2ZX4A 3MFAA 5FZ4A 3T4HB 4XTMA 3FHIB 4EWAA 4LORA 3D8CA 4Q8KA 1QWRA 1KFUL 4N7IA 3RI8A 2A73B 4JKKA 4E4DX 3NRUA 2RDQA 4GWNA 1POV3 4CUGA 2QQVA 3CZJA 2R0FA 3WNPA 4RR3C 4IE4A 1POQA 4AAXA 3DYOA 3OPWA 1UOBA 1Z7S1 3ACGA 1NZCA 4Y4YA 3KZ4C 4XJ8A 1AF9A 1CAWA 4Y4RA 5JPMB 5LATA 4CDXC 4LHKA 3HBZA 2NZ9A 1ZBA2 3DECA 4RR3B 2ZZQA 5J96B 2UWAA 5IVEA 5DAVA 4QGLA 3FL7A 4IV1B 1K5MA 3E6DA 4YLZA 3IDAA 3VBRA 1OSGA 5LRSA 4KBZA 3IDEA 1R093 2BFUS 3D82A 1W06A 1DLLA 3C7EA 3KD4A 3I49A 5GZCA 2YY1A 4AI0A 1WKYA 2VUDA 2CY6A 1GQHA 1YFWA 1FATA 5LBFA 1LHOA 3RRDA 3EB7A 2WZPP 1RMU1 3FMGA 3ABZA 4K9SA 4QDRA 3ENRA 5H9SA 3VBHA 3WP4A 1UD1A 3USUA 4LO7A 3VBSB 2TNFA 4LKDA 2QQJA 1L7RA 2JENA 4JGYB 2WNUC 5CFDA 1POV0 4DQAA 2O8QA 3R0RA 4CRQA 2GNDA 3B00A 5GALA 3D0JA 2XXZA 4CU9A 2XWBB 3ZXDA 2PLV2 4HANA 1ZBE1 1DYOA 5FYSA 4PBPA 1PMJX 2PQSA 2VG9A 2DVAA 2NN8A 1ASJ1 2W1SA 3AP5A 5EV7A 5FUNA 1C4RA 5C8CB 3AL6A 4H55A 1J59A 4CCEA 5FY9A 2CGPA 3CJXA 3OEBA 4MOAA 4M00A 2JDHA 2FZ2A 1S0BA 3WF3A 4AEKA 1LOGA 3W5MA 3WDXA 4YWAA 3WNKA 1QXRA 3G6JB 4FFIA 3RFRA 3UL2A 2IXHA 2VOXA 5EYXA 1IG3A 3HNBM 5F2WA 1TMF1 2CGNA 4R4ZA 5FQ0A 4LO8A 4Q2FA 3T0AA 1AR73 2DCTA 4AQ2A 2YROA 2QZ3A 4KG0A 4XF1A 3EQEA 5EQUA 5E6HA 5FXXA 3P1IA 2D6LX 2ZAHA 3BTZA 2PHTA 2ZMKA 5E88A 3ZO0B 2P34A 5FK8A 3Q8FA 5JZGA 4O9GA 4AEJA 1RUF2 2MNGA 2YBKA 3IM0A 1EYBA 4BU2A 5C70A 3V0BA 2J1SA 2WWJA 4BIFA 1SMVA 2JG8C 4HPKB 4YVWC 1PK6B 1K3IA 1HRI3 1RVF3 3Q9OA 1BBT2 2Z4FA 4D69A 4Q4X3 3LD8A 5KHJA 5LEKA 4Q0PA 2W52A 3AJZA 4Q5OA 4E9KA 1GP4A 3ZSMA 3A23A 2Q8DA 4OI2A 2OQ6A 4ITCA 4BJ0A 1XU2A 4QKBA 2DVBA 3E1F1 4OUEA 4BHPA 1MS4A 4TYSA 4WZFA 3MEPA 4W65A 2WUHA 1YYNA 4CPBD 2EXKA 3HBKA 2JDMA 2PHRA
chains in the Genus database with same CATH topology
3TBDA 3H7JA 2VMGA 2D6NA 4FXKB 2HEWF 2R32A 3D4KA 1HV0A 1ENSA 5L19A 1EY2A 1XXNA 2D3RA 5CFCA 2MPFA 1Y9QA 3CJIC 4M0HA 1UU6A 1ND3A 1UU4A 4K20A 1QMJA 4YG0A 4Q27A 3J9SA 1A8DA 2EVXA 5HI0A 3E5UA 1AXKA 4CP1A 1DGLA 2G9FA 4EWDA 1ENXA 5F5QA 1LU1A 4MYEA 1LOCA 4XOGA 4XHXA 3GZTB 2X8KA 2V09A 2YC0A 3WP6A 1GR3A 4Y22B 4Y26A 4XIOA 3W58A 3KQRA 4XJUA 3ZMNA 3CEWA 1PO23 1JYIA 1E57A 2HWE1 2CGOA 3ZYIB 5H9PA 1AYM2 2IXLA 4HETA 3VLBB 4YARA 1C5IA 2HWD3 1QJX2 1V6KA 3M3OA 3E6BA 3W9AA 1W0PA 1C28A 3AMMA 4QHBA 3VZMA 2WZR3 3AMNA 3GF6A 4XJ9A 4Q4X1 1FNYA 2Q1ZB 2E63A 1F5FA 2GN3A 4XPVA 1G9FA 4NVPA 2XVKA 4AVTA 3H3UA 4OFGA 3ZXGA 3PHMA 2HWD1 4QD2A 3OD4A 4XXPA 2YDEA 2NMOA 3MFCA 1OKQA 5T5LA 2H6CA 4DXZA 2R063 1O4YA 2Z42A 2Z5WA 3AXDA 1NCQC 1BXHA 1XE8A 3ST7A 3TNPB 3QH7A 3M4FA 2DTYA 4HVRA 2RS11 5J09A 4DNYA 2JG8A 1IOAA 1W6QB 1PNFA 3J4UH 1BEV3 1GV9A 1LGCA 5T5JA 1LOBA 1ZRRA 2LUWA 2FZ1A 4XMAA 4HK9A 2ERFA 2DCZA 1LTEA 4M3CE 1HRI1 1RVF1 5ABJA 3KSCA 1AR72 3ATGA 2A70A 5CNAA 3ZYRA 1R1A3 4ASLA 1ULDA 2R042 1S0GA 2WSUA 3JD72 5JOWA 2GZWA 2EALA 5J7MA 1QKQA 2UURA 4IV1C 3AYDA 4WM8B 4LBQD 3ZN6B 3NW4A 3USSA 2Z79A 2XVGA 4IESA 5DDJ2 3AZVA 4HL0A 5CA6A 4OHZA 4EN9B 1REEA 1TQ5A 3U07A 3B94A 4YGEA 4EV0A 1MZFA 1KRIA 1NCRA 4META 4P9XA 4Q29A 5C8WA 1VBA3 2UY9A 1HX6A 5F6KA 3M1HA 5CU1A 3KT1A 1WLTA 1PO13 1DF0A 1RITA 3O7OA 2F6BA 2JX9A 1YIFA 2VQ0A 1FX5A 4E4ZA 1DDLA 4AGVA 2D98A 2GMPA 3FUQA 5FDBA 1DZQA 1MZEA 3NV1A 1VBE3 1MQTB 4E27A 3WXPA 2YUEA 3ZFFC 4EN7B 1W6MB 1UIKA 2D93A 2OVUA 3USUB 3DN7A 1QJU3 5TSWA 4K8FA 3C3VA 1VBC1 4U36A 1GBGA 5CG9A 1ZVFA 2ZAAA 3LKJA 1UN1A 2VQAA 3NVCA 4P9GA 5A32B 1MVEA 1QJZA 1NY71 3WW4A 3WUDA 3AYAA 5JOYA 1PZ7A 4BWOA 5AC93 2AUYA 3FLPA 4Z07A 3ZFGB 4Z1VA 1LCLA 4Z8BA 2PHFA 1VBE2 4XHBA 1B35A 4AWDA 3O0VA 4KH9A 2XJTA 4N43B 5DUWA 4CDXA 2ZTNA 1L3JA 4QPIC 1FNZA 1V9U1 1PIV1 3JZVA 1AYN1 1GQGA 3BOWA 4Y20A 4IERA 1DQ4A 5GLZA 1WD4A 3I8TA 1TME1 1VB4A 5K0UB 3K48A 4PJYA 4KQ7A 3MYXA 1XU1A 4NPRA 1OQEA 4QQ2A 2A6WA 1DGWA 3MF6A 1HQNA 4YVSB 1RHI3 5IUQA 1MR5A 4CEWC 2EAAA 3B5LB 1CAWB 4MXWA 1RUF1 5FPZA 4OI4A 4F7ZA 1SCSA 1EAH1 4YSFA 3RMYA 1NCRC 3H50A 5IK8A 2ZCWA 4GH4C 4HN1A 1FOD1 4S2DA 1LHUA 2D40A 4FPYA 3RI9A 3VBUB 4ES9A 5K7PA 1D4M2 1H1MA 2C1FA 4AEDA 3CJIB 5BNOA 2E7AA 3TOJA 4FOWA 1PVC1 1HQLA 2DURA 5HCBA 5DG2A 3SH4A 4MH0E 4AVCA 5DUXA 2E53A 3M7AA 3WCRA 2DTWA 4XFIA 4I0BA 1Q43A 2YYOA 2ZHKA 4UW3A 2GH2A 1MS8A 1LHNA 4PIYA 2GC0A 5GLTA 5GLUA 5JWPA 1HXS3 3IMNA 2D44A 4Y1YA 5ABJB 3H9AA 4GULA 4N9HA 4YW1A 3WX5A 4RR3A 1PK6C 1PHMA 4D7TA 4GALA 3VZLA 1AX0A 2XKOA 4DRRA 1PGW2 1SBEA 4LO4B 2A3XA 2AYHA 3L2HA 4DINB 2WZR1 3JCIA 2WFF2 5AFEA 3ZYGA 4QPGC 4I02A 2BVBA 5J3UA 2ZKLA 3GHNA 4GWMA 4RQPB 3VN4A 4QM8A 2NMNA 5GZFA 4HKLA 1LB2A 4RHV2 2DF7A 4NWWA 4MZUA 1QNYA 1N3QA 1Q3EA 5FMOL 4GIQA 2VY0A 1AR83 5DZFA 1PK6A 1XYNA 4XYXA 4AHWA 1U5YA 2QVSB 1NCQB 3LGRA 1Z7S3 3PVEA 4XMIA 4B7KA 5J98B 3BCWA 2UY8A 2PFWA 1V9U3 2JD4A 4LHNA 1Z0HA 2BQPA 1EV11 3BODA 2R30A 2XJQA 2OPKA 4XTPA 4FTEA 5L36A 1RUH3 1EPWA 4V1PA 5F6LB 2B8MA 3D5OA 1RUOA 3DPRB 1BMV2 4I2OA 4OZXA 1G9AA 2QQPA 2RR13 3LZZA 2Q30A 2HWC3 3RS6A 3NAPB 1YFXA 2D43A 3V56A 1WCSA 2ZABA 1IS5A 4R9CA 5FO9B 4AYUA 2PHUA 1SCRA 4IEOA 1AYM3 2VVFA 5AVAA 1RUH1 3VBOB 1NA1C 1S0JA 5ABJC 1PGL1 5HCAA 5T3NA 3ETQA 4PDWC 5T50A 2XBO2 1CAVA 1WGPA 1B35B 4Q0UA 4FPEA 2XLGA 4FP3A 4B4PA 2VW0A 1JH5A 1OFSA 1LEMA 2WSVA 4IV1A 2DU1A 1F9KA 3AZZA 1J3PA 4FAGA 4AQ6A 1TMF3 3ZSEA 4LUMA 1OOPC 4P14A 4GXLA 2YGLA 5A3MA 2QKDA 1LODA 4HPKA 3JQWA 3WZ1A 4HVOA 3TRSB 3RSJA 1NCRB 4CDUC 4C90A 1TE1B 4XE9A 2DCKA 5CG8A 3URFA 4EN0A 2NYYA 1FI2A 1OA4A 1RUE3 2HWB3 5A33B 3DPRA 2VW2A 5KHIA 4I0AA 4AI8A 2ZKNA 5EWSA 2P3JA 4A7YA 3FC0A 4IEVA 2JXAA 1XNCA 4Z82A 3AFKA 3PVBB 4ORFA 1QJU2 5BNPB 4YVWB 1F5JA 1W6OA 1RUG2 2PTMA 4IEZA 1LKNA 3PJQA 3JUUA 3ZIXA 4B8EA 3I54A 3MF9A 3CF6E 1ZZ8A 3C2UA 3NV4A 4KWKA 1IKPA 2DV9A 2VU9A 4K7JA 1MS0A 4Q26A 1V6MA 2JKBA 1AUYA 3UKNA 1W2UA 2DWRA 3BALA 5BV6A 4P9WA 1H1IA 1WW4A 2WS92 4LBMA 3WQ1A 1R092 4NWVA 3JBG1 3J8F1 1IPKA 4DFSA 1DQ5A 2GNMA 2V73A 3OF1A 4MSVA 5FO8B 4FT8A 4I3PA 4EJRA 2CAUA 1H8VA 3PVOA 2WINB 3ILRA 1ZBA3 3H1WA 4AF9A 2Q0AA 2RS51 5BNPC 2BTVC 2DCYA 2OZJA 2ZX1A 1FT9A 5GZGA 5I0UA 1ND2C 2XBO1 4RQPA 1ASJ3 2WNUB 4XF3A 2CWMA 3ZFFB 4LA2A 3VBSC 3LA3A 1AJOA 3N3HA 4XBNA 1CESA 1YJLA 1UPIA 5JIAA 4CDQB 4R8HA 4AFAA 1J58A 1AZDA 2ZPXA 3WP3A 4HN0A 4JDMA 4AFCA 4IEXA 1GZCA 3LOBA 1WBLA 2ES3A 1YO8A 1ZNPA 2ET7A 4YZ5A 3B9CA 4QPIA 3MIBA 5T54A 2K2SA 3MI8A 1ZM1A 2ZACA 1O4ZA 1COV2 1JXNA 4L11A 4LBOA 1J3RA 2DVDA 4AFBA 4XQDA 4JRLA 1MEC3 3SNMA 2BBVA 1G86A 2VVDA 3ZDSA 2R061 3AZYA 3VBFA 3WT3A 1LGBA 3PJYA 4N53B 1HXS2 4ZKTB 4YW3A 4BH9A 4GMP1 1X8EA 3SHRA 2PQQA 4IV3C 1NG0A 3LWCA 3NL1A 1O3TA 2RM23 3AP6A 1QJY3 3M2MA 3VBUA 1PMIA 4RGGA 4X6QB 2XPJA 3VZOA 1UL9A 1F31A 4M3CB 5JOZA 2RMU2 3WUCA 5I0SA 2QJVA 5K0UA 1UAIA 4D94A 5E8AA 4ONUA 3H7YA 1S1AA 2ZGLA 3VHRA 5BNOC 5E16A 5C9AC 2RMU1 1A3KA 3WCSA 3ZX7A 3M3QA 3NKTA 5DUUA 5JSPA 5KHGA 4LR4A 1AR81 4XEZA 4Y5Z0 4MGKE 3VKOA 1RHI2 2ZBJA 3INAA 4MXVA 3VBHB 2MEV1 1SLCA 3BIWE 3VBRC 1NQJA 2IWGB 4NOTA 3FWEA 4YGDA 1X8MA 4LBKA 4UXAA 4HT1T 1Z7S2 2OYZA 5LK7B 1C8M3 3MLJA 1G9CA 3LA2A 5JIUA 1PO11 1APNA 1LESA 1PVC2 1S0FA 2AREA 4CDWC 1MS5A 1I6XA 5FLIA 3VZNA 3FUOA 1NY72 1Q56A 1DQ6A 5C4WA 4AHZA 1YFUA 4JTOA 3ZXJA 3IIAA 4C0HA 1CAVB 3DV8A 4XBQA 1YWKA 1C8M2 5DZEA 3MLKA 1CAXB 3KLSA 4C0BA 2B46X 1H9WA 5FOBB 4HSLA 1DU3D 1D0HA 4QQHA 1VAMA 2ZZJA 1X7NA 3FFZA 3N36A 4YW2A 5JOXA 3N7JA 1IHMA 3MW4A 3RZZA 2DFCA 4AEMA 1M06G 3VKLA 1IPJA 4W6WA 3J26N 1VBB3 1TME2 3SH3A 3UKTA 3APBA 3MW3A 1FMD2 1PIV2 3R4DB 4COVA 1YI7A 5EZWA 1QDCA 2O0OA 4MUVA 4YZ1A 2WS93 5CFDC 3RG0A 5DDJ1 4PLMA 1WCKA 3ZMOA 2XHKA 2DFBA 5BNPA 1G6NA 1OQ1A 3I59A 3R6SA 2OIIA 1BVP1 2KM2A 2EXIA 2JEMA 4H14A 1RUG3 4KNCA 1ULEA 1VBB1 5CFCC 1QJU1 4XIKA 2E7QA 3HMYA 4A7KA 4XJWA 4YYOA 5KXDA 4YVSC 2R1BA 3VL8A 2KA3A 2RE9A 1W6QA 2RHPA 1EPZA 1JUIA 1XRUA 3GBWA 1F2NA 4PCRA 4GMP0 3S7EA 5K0UC 3O5SA 2GU9A 5FFOC 1AR82 1QHDA 1LU2A 1D4VB 1U5IA 1RB8G 3BB6A 1RUI2 1JYCA 2PHWA 1D2SA 2R16A 4N43C 1S55A 2AENA 5CBLA 5JR7B 1LR5A 1DGRN 2VPVA 3ZYJB 1AYN3 4KU7A 1QQP3 3R05A 3ZN4A 1EP0A 1LHWA 3ZXEA 4Z2WA 3AKQA 2XL7A 5J37A 2R49A 3J8F2 5JSRA 1R091 4B4RA 5ACA1 2WS91 1FV3A 2NQYA 1DGRA 3VHNA 4LBJA 4Q1RA 3I59B 1VALA 1R081 1SFYA 5FRAA 4Q4X2 2XLFA 3WW2A 4E2GA 1MZ6A 1XNDA 2H6BA 4NR1A 4P5HA 4AEDC 1AR71 1QH6A 1HDKA 4FP2A 1FPN3 2Y0OA 4I30A 4LNVA 2VOKA 3NKGA 1N1SA 5IK7A 3OBTA 4XFGA 5GKAC 2QNKA 4L2NA 1Y3TA 3ZYPA 3A0NA 1WA4A 1ZA4A 3AKSA 2NPIA 4TSVA 4YG6A 3S30A 1I1EA 3GNEA 4BYYA 2ZHMA 1BZWA 4XETA 4KBBA 4ATEA 1H2LA 3AYCA 1UCXA 1VBC3 2VMIA 3HT2A 3ZN6A 2WNEA 1GANA 1J1LA 1TNFA 1YXWA 4G3YC 1OFNA 4ISRA 2R1DA 1YNAA 2VOVA 3DKWA 3THTA 2BEOA 1ND3B 2B7YA 3KMHA 1H2MA 5GLVA 2WQZC 4FTBA 4IEUA 4XF0A 2WIIB 2ZGOA 3LCPA 4Y1XA 4CDQC 3EJKA 1YUDA 4NN0A 4URTA 2A6XA 3QOPA 1HIXA 1D2QA 1N3OA 1FMD3 3JBG2 4Q4V1 3VBOA 4DPNA 2YZ4A 2WWSA 2ZGNA 3QH6A 2GC3A 2ENRA 4JCKA 1CJDA 2RMU3 2D3PA 3H0OA 1PGW1 1QJX1 2HEVF 4HLTA 3AMPA 4P9IA 4TLFA 3PTYA 5C6CA 4PF5A 1VBD3 2EIGA 3WV6A 1QNWA 2XBO3 4OUMA 3FLRA 4LBNA 1LRHA 4XF9A 1LHVA 2PAEA 5LEJA 1U12A 3KS7A 2E6VA 2DCJA 1VRH3 1ZZ6A 5I8SA 2FMYA 1VAVA 3DL3A 5BXXA 3MIDA 3IPVB 1KXGA 4W6YA 3VHPA 1H30A 1RUC3 4LT5A 2D97A 2X53S 4XQ4A 5DUVA 3UJOA 4EROA 1AR62 2Y38A 5BNNC 5AFBA 3AKPA 1LOFA 4KGGA 1RUNA 3VUOA 2QZ2A 1OA3A 2N7GA 3WD5A 2HWD2 2WKKA 5A33A 3WDYA 1U5XA 1K5MB 2GNBA 3BOPA 1A8MA 2B39A 1JTZX 2WFF1 1BBT1 3TB0A 2F4PA 2B45X 3JD73 4RA0A 4YFZA 3LA7A 1PGL2 4GA9A 2X5IB 3OY8A 2TUNA 3BTAA 1O5LA 3OYWA 3VBHC 4RHV3 1BCXA 3FLTA 4ZU5A 4TWTA 4AFMA 3OTFA 1SBFA 3VZKA 3CL1A 4B7EA 4MLOA 3SLIA 1OA2A 2DUOA 4BMBA 1B35C 1PVXA 5KWRA 3VZJA 3ZFEC 4A7ZA 1C5HA 1TNRA 4PDWB 3SMHA 4BIOA 2PA7A 2DU0A 3VBOC 1ASJ2 1VJ2A 3U10A 4UW4A 2GNTA 2YGMA 1AX2A 3FFQA 1YRZA 2IFWA