2HBUA

Crystal structure of hif prolyl hydroxylase egln-1 in complex with a biologically active inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
225
structure length
219
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKGVRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
publication title Crystal structure of HIF prolyl hydroxylase in complex with a biologically active inhibitor
rcsb
source organism Homo sapiens
total genus 64
structure length 219
sequence length 225
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2hbuA00
5EPAA 2HBUA 5IAVA 5LBFA 5A3UA 3KT1A 3HQRA 5LASA 4NHMA 4UWDA 5LA9A 2RDSA 4XCBA 2V4AA 3W20A 4MHRA 3OBZA 4XC9A 4JZRA 4BQXA 2FCTA 5L9RA 3OUHA 2RDQA 5IAXA 5EP9A 5ERLA 4KBZA 4NHKA 3NNMA 2G1MA 3KT7A 2FCVA 5LBEA 2RDRA 4MHUA 4Q5OA 4Y5SA 3GJBA 3PL0A 4ZONA 3NNFA 5DAQA 4XCAA 5DAPA 5HV0A 2Y33A 3NNJA 3HQUA 3OUIA 5M0TA 4BQYA 2FCUA 4NHXA 4NHLA 2JIJA 5C5UA 3OUJA 4IW3A 3GJAA 5LBCA 5C5TA 5L9VA 4BQWA 2OPWA 5EQUA 3W21A 5DAWA 3ITQA 3EMRA 2Y34A 4XAAA 5LB6A 5DAXA 3GZEA 2HBTA 3KT4A 4NAOA 4NHYA 3NNLA 3DKQA 3MGUA 4XABA 2RDNA 3BVCA 5LATA 4Y5TA 4XACA 2RG4A 2A1XA 5L9BA 4NMIA 5DAVA 5LBBA 2G19A 4J25A 5HV4A 4ZPIA 5IATA 2JIGA
chains in the Genus database with same CATH superfamily
1GFF2 3LA7A 1RUF3 1HQLA 2DCTA 4YZ1A 3GDBA 5FPBA 5I0DA 1DGWX 5JSOA 3T2OA 1ZZ8A 5FP4A 4PDWC 2VC9A 3S7EA 5I8SA 1OFSA 4BMBA 2W1SA 2ZKLA 4RHV1 5GLUA 3WNPA 3RZGA 3C3VA 2ENRA 2CGOA 2CDOA 2EXHA 2ILMA 2TUNA 3M70A 1WW7A 4G3YC 5LEJA 2F4LA 1ULGA 1W2UA 3IIAA 4KH9A 4QU2A 3N9OA 5DG1A 1EAH1 3NVCA 4JQRA 1IS5A 1KS5A 4Y1VA 3RZHA 1POV3 2RVAA 3KV4A 4I0AA 2VZOA 4QDSA 4QX3A 5T54A 3ZN5A 2ZGUA 4P9IA 2RDQA 3OUHA 4M01A 5FY1A 1HJFA 5FJKA 1UF2C 2A7AA 1QJU1 2LM3A 2XDVA 3PJQA 2ZACA 4AEDA 5JZGB 2VTXA 4YFWA 4CCJA 3OG2A 4KG0A 4ZS3A 4DPNA 1QEXA 4QM9A 4BYYA 5JXIA 1LOFA 2RDRA 1LR5A 5EFUA 1PO21 1X9TA 1WMDA 4QAWA 3E1F1 4UF0B 5FY4A 2CGNA 3WR0A 1X82A 4IEWA 3ZYBA 1D0GA 1CX1A 3KGLA 4K3UA 3RZLA 2WR9A 3FE5A 3POYA 2D7FA 4FFFA 4Y24A 1HQWA 3LB9A 4QGNA 4EQVA 4CDUC 4CZSA 1EUTA 5D8AA 5E8AA 4H14A 3PIGA 2AEZA 4BPZA 5A3TA 5JSPA 3OEBA 5BNPC 4MUVA 1W8HA 5DDJ1 5BNNB 3SC7X 3FWEA 4NOTA 2RS52 3LIHA 2R071 4OULA 3UJOA 1L3JA 3FL7A 4FSJA 4LKEA 1C4RA 5CG8A 1YFWA 2W39A 4GD4A 4NVPA 4GA9A 2EICA 3AFKA 3BU0A 1BBT1 1KXGA 1RUI3 2VECA 3OUJA 4CEWC 2UYBA 4XFGA 3GJAA 1RUE3 3FC0A 1T6GC 4IE7A 5A7SA 3GCWA 3GZTB 1D2SA 3LFIA 1EYBA 2BGPA 1POQA 5A7WA 1Y9QA 1EPZA 3ZDVA 2W1QA 4NIDA 3R05A 1I1EA 3N9PA 4N53B 2OS2A 1BEV2 2DVFA 1PIV2 5CAZA 3VD5A 4CDXC 2VOTA 2GP3A 2NM1A 3T0DA 1PVC1 3B93A 2VGDA 3N9QA 4WVWA 4XUTA 2E31A 1MQTB 1UW8A 2IXLA 2QDNA 2O8QA 3N35A 4LBNA 4AW7A 2RJLA 2VQAA 3AYCA 3ILFA 1XE8A 2P17A 2VUDA 4EJRA 3OOXA 5FBZA 3OEAA 4XUQA 4OHWA 2YG0A 3CDZB 1UAIA 3UT0A 2HWC1 4WBBA 5EZWA 4H2AA 5L9BA 1NA1B 1GLHA 1W9WA 3VHOA 4CUCA 1O4TA 1JYCA 1HRV1 2AACA 4LBQD 1IPKA 4Y22B 4ZPIA 5F37A 2DCJA 3N3HA 1W6PB 2A6YA 4EROA 2GMEA 4DMIA 4FTBA 1QGLA 2VUJA 3JCIA 4E4DX 1VBC2 3I54A 4FPYA 1HDKA 4DOUA 2JD4A 5LBFA 1AYN2 5K4LA 3GBFA 5KHIA 5AC93 1OVSA 4FPLA 4Y3OA 4PI0A 3Q8BA 4R4XA 4YG3A 4J1XA 2LROA 1MS8A 3MZHA 1ZBA3 3GXUA 3S57A 4YW5A 4P9GA 1GICA 2PFWA 1JZ5A 4YVWC 1K5MA 1XYPA 3FHIB 4JAAA 4XUNA 4QXKA 3ZYIB 1ZA4A 4A4AA 1SBFA 1DQ4A 1JW6A 1X7NA 3HVDA 3VD3A 4XFIA 3VKNA 4ATEA 1FOD3 3LPGA 2UU8A 3LD8A 5FY5A 4BQXA 2VM9A 3MIEA 3ROUA 4A44A 2IFWA 1CAXB 4RHV2 3CIHA 3UKNA 5ERLA 2VOKA 3BALA 3M3EA 1OPOA 1HIXA 1WW4A 4CU6A 1RUF1 4Y20B 5FP9A 1RYYA 3ACGA 5A6ZA 2JJ6A 3KT7A 1ZBE2 1EAH2 4B1MA 3VBHA 2X5IC 5DZEA 1U12A 2JE9A 4K40A 4FFIA 2A6VA 2ZEZA 4L11A 4P9WA 3VBOA 5IJRA 1V6KA 1MS3A 4WM8B 4YM0A 2JG9A 4IEXA 2VR4A 2P3IA 5FZBA 1XNBA 1DGWA 1V70A 2ET1A 1NYWA 1VLNA 4D7YA 2IXIA 4HL0A 4C1XA 3MHZA 2BOIA 4DZGA 1LKNA 2AC1A 2J1UA 3KCCA 1V6OA 4XFAA 2JECA 4AI3A 3AFGA 1GOGA 3ZYJB 2VXJA 1PO22 2WQZC 3O7OA 4GMP3 2ORZA 4UOJA 3OUIA 5GZDA 3SH5A 3JQXA 1JZ3A 2XLAA 2YPJA 3K3OA 4I2OA 3FBMA 2DV9A 4BE3A 2WQ8A 3FUOA 3FLTA 2JIJA 4QKDA 2WN3A 3OY8B 4IESA 4F8AA 2AGSA 3GF6A 4UW4A 5A33A 2DYCA 2PHDA 1J84A 3NMBA 4A3XA 3K75B 2NQYA 4FOQA 3WUDA 1OURA 3W5NA 1W39A 3K4ZA 4JCKA 3KHBA 4CDWA 5JDBA 3HAGA 1QU0A 3N9NA 5FY0A 1M06G 3ITQA 1CAUA 2BERA 1W6OB 2WT0A 3LA2A 3VBSA 4HSLA 3ZSEA 4XUOA 2J1EA 3ZN6B 3UESA 5K9YA 2VMEA 5HXMA 4LT5A 3GZEA 1UKGA 3W58A 4P08A 1MS9A 2RJKA 3H1YA 1WUVA 4QQOA 2V73A 5C6CA 1WBLA 2QQJA 5JZGC 2PN5A 1G9FA 3ZFGA 4EN0A 2BFUL 3DKQA 1QJX2 3RSJA 3KF3A 1RUI1 1PNGA 4XABA 4I30A 1P8JA 1YFYA 3WVJA 4AHWA 4DNYA 4EWEA 1KEXA 2D3SA 1RUE1 3KM5A 4QMAA 2FHRA 4RR3A 2YGLA 4IEOA 3DEMA 4XACA 4IE4A 1DQ6A 4YSFA 5IFTA 4KGGA 4MLOA 4BLIA 2BOJA 1TZOA 2D3PA 5IWFA 1C5HA 1DGRA 4OCTA 1DLCA 3AZXA 3VLBB 4GWJA 2DTWA 1YNAA 3FX3A 2QZ3A 4P5YA 4YW7A 3RZZA 3A23A 5FZDA 1UNBA 2HWE3 1QJY2 2R0HA 3AC0A 5E88A 3VZJA 3WF1A 4BMEA 1QOSA 4E27A 4UW3A 2LALA 2D6KA 2QE3A 2EIDA 2VULA 5BNNC 2BNOA 4LHKA 1S2KA 1IG3A 2UWBA 1PVXA 1NXD1 1QJEA 1RUNA 2RDSA 4GKXA 2QCSB 3JXSA 1YQ2A 3O1RA 1UYXA 5FPXA 5DG2A 4I3PA 1UZ0A 1W3XA 2A3XA 2IXKA 3BPSA 1F4HA 4NRMA 4J6GA 3RVHA 1RUD3 2QQUA 4LNVA 3ZYHA 3USSA 2W95A 4AGRA 3UV9A 5FJHA 3CJXA 4KU8A 3MICA 3V0AB 1XB9A 2Q30A 3BYWA 2MEV3 1UL9A 3IN9A 5FZ0A 5IAXA 3VL8A 3CZJA 1N47A 4HPKB 3POGA 4RFRB 4B4PA 4N53C 5LK5A 1YIPA 3LDBA 4XF0A 1S55A 1QKQA 2G1MA 4TWTA 5GZEA 2GU9A 5C3PA 1MQTC 2WZR3 3KCYA 2QQIA 5FZFA 4LA3A 3OJBA 5AC91 5JCTA 2K2SA 1HB2A 4IEQA 5LEKA 1RXFA 2G9ZA 2DCZA 3P6BA 2YROA 1ZBA1 1PK6A 4Q0VA 1ULOA 4QPYA 1XJAA 4K6BA 3NNFA 5DAQA 1H9PA 4YZ2A 4MGTA 5EIYB 4LA2A 5F9TA 5DXDA 5DAPA 2DFBA 2Y6JA 1IS6A 2YYOA 2FDJA 2WFPA 3C7EA 4FI9A 2QQNA 4QGLA 3W5MA 1YQ6A 5IW0A 4QQPA 1UPIA 2HH9A 2AH2A 2XG3A 1NA1C 4N9IA 2YDEA 1YJKA 3NNJA 1FNZA 1URXA 2YBPA 1W8ZA 2WO7A 4OQ8A 2D44A 1ACCA 4YVSA 2ES3A 2VMFA 2XLFA 4ARYA 1APNA 4IETA 2XBO2 4RQPA 2VW2A 2BNMA 5FP3A 2PELA 1OD5A 1JHJA 4P02B 1NY72 4XE9A 2VQTA 4JDOA 2ZX1A 3ELNA 1L7QA 3RG0A 1WMEA 1LHVA 3I8TA 3AMMA 2H6BA 3OGSA 4X8PA 4AF9A 2W0XA 3ZFFB 5FKCA 4YM3A 3F95A 5BPXA 2JG8B 3ACLA 2R49A 1CAWB 1F4AA 2ZEYA 1KFXL 4UFHA 3M3QA 3ZXKA 3J26N 1DIWA 1B35A 1BK0A 3EBRA 4PLMA 1XNDA 2VW0A 2R041 4K8FA 4R52A 3DYPA 3U07A 3B9IA 3LDKA 3VZMA 1Z7S1 4JKKA 2WAAA 1UOJA 2O8OA 5CB7A 1HN0A 2WA3A 1FMD2 2NYYA 4HVOA 1FT9A 5A6YA 4V1PA 1GYKA 4BU2A 2XXZA 1G9BA 1DQ5A 4XDPA 4YGCA 5CFCB 1W0PA 3ZR6A 2VVEA 5CG9A 2EVXA 4WM8C 2RG4A 4WVMA 4RL7A 4NMIA 3J8F3 4PBPA 5FDBA 2QUOA 4IDZA 5HV4A 2ADEA 1W0OA 5J96B 1JOBA 1R64A 2JIGA 4LMFA 1FYUA 2UWAA 4XJ9A 3FFQA 4ES9A 1JOJA 4NUBA 2PQQA 2VVFA 1X8EA 2CU5A 4GWIA 5A7OA 2D6OX 3Q9OA 3PTYA 2PHUA 2JXAA 4G9SB 1BVVA 3CJIB 4GWNA 4Q4X3 4UW5A 3UYJA 4IEPA 4OHVA 4WM7B 1HW5A 5FZHA 2P6HA 2B5HA 2HYXA 1RUJ1 1O91A 4PBOA 4UWDA 1HXS3 2YC2A 1RVF3 1ZA7A 3O0XA 3I2HA 4AZZA 5KC6A 4QX0A 2DBNA 4LO7A 3SEPA 4ES8A 3WCRA 2HWB2 4MHRA 4IV1B 5CKMA 5IHRA 4YG0A 1CX4A 4HLTA 1GNYA 1ZZBA 2Q8EA 1GUIA 1AZDA 2P2KA 4JZRA 4LITA 1OLME 2YGMA 4META 1DZRA 4UFMA 2JX9A 1UYZA 1O6UA 4CU9A 3MF6A 1D7PM 2ZHMA 1RUOA 2UURA 4IE0A 3WDTA 3OPWA 1UZWA 4AQ2A 5K0UB 2ZBJA 2X05A 4M3CF 3PUSA 1IS4A 1YC61 4UFJA 5FPVA 3T2TA 4CPBD 4FTEA 3LIGA 1TVGA 1VE0A 2JKBA 3O5SA 4BISA 5DUVA 3VDDB 4LOTA 5JOWA 4CA9A 3ZSMA 1R092 1VBD3 4Q4W1 2RV9A 3E6BA 4KNCA 1XSRA 4Y5SA 3TAYA 2VZSA 4BIFA 3VV1A 1YFXA 5FZGA 5BNQA 1W6QA 5FY7A 4DFSA 2Y60A 4QX7A 4X6QB 3ORJA 1RUD1 2P1BA 5C8CA 4HOOA 4MXWB 3KD4A 2ZZJA 4IL7A 1U5ZA 4AEKA 3TOJA 4CEYA 2WNUA 1DBNA 3CL1A 4NPMA 3E6CC 4MGKE 1YHFA 1OHFA 2MEV1 2HWF2 2G4IA 2VMGA 1JMUB 4COVA 2GMPA 2Q5TA 3KLSA 3LF7A 3P3NA 4BOWA 5J37A 3AVSA 5JXHA 2WS91 5GM0A 2P4EA 4D3WA 4W50A 4NPRA 2P37A 3LEGA 4XIOA 1SLIA 2P3YA 2W46A 1IKPA 1CAVB 4N43B 2WZR1 4XF3A 4YZ3A 3WNXA 4CCOA 3LOIA 2YBSA 4JC1A 3H0OA 3IZOA 4QPIA 4CCEA 4R9CA 2V4VA 1EY2A 1GZWA 2UYAA 4XZUG 5T3NA 4Y1ZA 4B4QA 2NN8A 4FBFA 4URTA 1RXGA 4UXAA 2XL7A 3IDAA 1GV9A 3M3IA 4V2WA 4YARA 4EN8B 2RMU2 3VDAA 1GWMA 2VBPA 3O0WA 4XFFA 1O4ZA 2DU1A 2ET7A 1F15A 1W2OA 1NLRA 1GQPA 4HONA 1SDWA 2HEYF 3O12A 1QMJA 1WMFA 5IVCA 5I0RA 3H42B 5L7OA 4OZOA 1RTVA 3HQXA 3DV8A 4NAOA 1UYPA 5AFEA 2PHRA 4QQLA 4CDQA 2ARCA 1XXNA 1C5IA 1MS5A 4E4HA 4PQQA 2EIBA 3VBUB 4COUA 1MS4A 1Y43B 2C24A 1XU1A 1REDA 2MNGA 2PAMA 2QVSB 1R083 5FPAA 5LATA 5KBFA 1KDKA 1OA3A 2JB8A 3WQ1A 2I2SA 3RJ2X 2R042 3SKVA 3VHNA 3J9SA 2G19A 3VKLA 1Z7S2 3FN9A 1H2LA 2O1QA 1JHNA 4YGDA 1V9U3 4QKNA 1YCIA 2WLQA 2ZX2A 5F8PA 1CN1A 5F2SA 4XF1A 2VNVA 1OA4A 4IGQA 1WD3A 1VRH2 2EALA 2GNMA 1OA2A 2JDNA 1W8NA 4LKSA 5FO8B 1H4GA 3NJXA 3ZXLA 1OF4A 5HCAA 3QOPA 1AYM2 1ENRA 2ZAAA 1WKYA 2VZ3A 3UETA 4LR4A 5J09A 3ZR5A 5F1RA 4CP0A 1OBNA 4I0WB 2R062 2A6XA 2VL4A 1WCSA 4HXCA 4H7LA 5GZFA 3J8F1 4R9AA 1RUJ2 4O9EA 1C8M2 3ZFFC 2HYKA 1AX2A 1TMF2 2JG8C 2WNEA 3DYOA 3R4DB 5C33A 4HT1T 5JR7B 2FCVA 4O65A 4Q4X1 1HX6A 2A75A 4MXVA 1O5LA 3ZO0B 1J83A 2QQMA 4LJHA 4NPLA 4OUSA 1KGYA 4KWLA 5I91A 2E32A 1HXS1 1RVF1 4OQ9A 1IG0A 1REEA 5CFDC 4FT8A 3JZVA 2HWD1 3I59A 4M0HA 1DYPA 1F5FA 1XE7A 1VBA3 5CFCC 3C8XA 2XVGA 4R9DA 5J1XA 2VOXA 1K42A 2BWCA 4H7MA 1RHI3 4JDNA 3GHMA 3HT1A 4A7KA 3A0KA 3GBGA 2QZ2A 2AREA 2W87A 5BXXA 1JZ7A 3HQUA 1ULEA 1ULPA 4Q4W2 3ZMNA 2DDUA 1LECA 1UO9A 3R4UA 1JZ6A 5FYYA 5F3IA 5IT6A 5IVEA 3CJIC 1KFUL 4WM7C 1ZRRA 2JICA 2GSYA 2Y0IA 4LBQA 3W9AA 4AEJA 2WNVB 2BUKA 1MZFA 3ZXFA 4IW3A 4Y4RA 1K12A 4E8DA 2R1DA 4QT6A 2XJUA 3R4SA 1VBD1 3GGLA 2GDFA 1GBGA 1J59A 1O5UA 1W6NB 1NZIA 4LK7A 4IV1C 4Q27A 1RIRA 3BGAA 3DYMA 1LODA 3K77A 5DZGA 2W1WA 5LRRA 4D7SA 2TEPA 1PNFA 2WS92 4YWAA 3PDQA 1COV3 3PU3A 4X6RB 2RHPA 3AP6A 2DVAA 2VOVA 2B4KA 3QCWA 1W06A 5FAXA 2YZ4A 1V00A 5FZKA 3BTZA 4K20A 4PI2A 3WW1A 3WP3A 4AK3A 3OF1A 4BWOA 5C3OA 3P3PA 4IV3B 4YYOA 5K0UC 3NW4A 4YVWB 3DF0A 5C7GA 3SITA 2BVVA 1G9DA 1UOGA 5FBJA 4AGGA 1PM4A 1BZWA 5BUVA 1AL21 1LHNA 3VDDC 1NZCA 1VJ2A 4XBLA 4QHZA 2WUHA 5FZOA 3WG1A 2OX0A 1GQHA 4MGSA 3T0BA 2GAUA 2PHXA 5A7NA 2CHHA 1OFNA 1WW5A 1OXCA 5C4WB 5HCHA 1E5IA 5IAVA 1CZTA 1Y9GA 3KV5A 2JE8A 3KT1A 3ZFEA 1AR83 1CZVA 1ZRFA 1UX6A 1EV13 2Y6HA 3M3CA 1CVNA 1ULFA 3T3YA 2C26A 3SNMA 3N7KA 1F31A 3H7YA 5FUNA 5A80A 1AR63 1PHMA 3H50A 5FUPA 4CDUA 5JOXA 2IVIB 4YGEA 2JWPA 4N43C 3WINE 1ODMA 3LGRA 1FV3A 3TN93 5ACA2 5BNPA 2F6BA 2C9AA 5L9RA 3IAQA 3AYEA 2C1FA 2FDHA 2WT2A 1J58A 3OD4A 3WHTA 1Q8VA 1S0CA 2JDPA 2Q0AA 2QBXA 2YFUA 2Q8OA 2CTVA 4PF5A 1WW6A 1S1AA 3IIIA 4HG6B 4AQTA 4FAGA 4FPOB 3H8RA 1SFNA 3C2UA 1YJLA 5FO7B 4KI5M 4EYUA 5JR2A 1LOBA 1FNYA 4CEWA 5CBLA 1UPSA 2QQKA 1QNYA 4CXYA 4JVAA 1Q43A 1WCUA 1XE0A 1IHMA 4L8QA 3POEA 4XQ4A 4ZONA 2F4PA 3NV2A 4XCAA 3CBNA 2ZKNA 1WMXA 2EAKA 5FTTC 4M3CA 4CCKA 3VBUC 1PGL1 2ZGQA 1YFUA 3HN3A 1AUYA 2E7AA 4AAPA 4CDXA 1QHDA 3SH4A 2ZHNA 2BRTA 2RE9A 1IQAA 4BLJA 2VY0A 2GN3A 2Q1MA 3MFAA 5CU1A 4EZHA 2OUHA 4URAA 1ZRDA 1SLBA 3NV1A 5HPOA 2XWBB 5GZCA 1MS0A 1ASJ1 1VPHA 2R32A 1US2A 3HWJA 2HWD2 2NLRA 5A3WA 3D6EA 4XXPA 5F7UA 2FCUA 1Y7BA 4OZXA 1JS9A 1RITA 1NX9A 4P5HA 1U5XA 1JYWA 1RUG3 5LRSA 1CONA 2NMNA 2Q1FA 3BOWA 1KQRA 4QXHA 4QPWA 1OH4A 1SACA 1BXHA 2V5YA 3ATGA 1DYKA 4CP2A 2FDFA 2VCAA 1BQPA 3D5OA 2GC2A 3IPVA 3PMSA 4W8JA 1YUDA 1VBA1 5FZ7A 4CCDA 3LOBA 1S0FA 3VD9A 4XIKA 2HKXA 4JQTA 2JENA 5E16A 4MGYE 3CNAA 4TYSA 2D97A 3BTXA 1RUC3 1RHI1 4CCMA 3L2YA 1SCSA 4L9BA 5DAXA 2ZABA 4AQSA 4XQWA 3AMQA 2ARXA 2WT1A 4XHBA 2D3RA 2SLIA 3VHPA 4A7YA 5J3UA 2FQPA 1BHGA 4ZXKA 3WSOA 4AI8A 5CZKA 1PMJX 3AKRA 1CPMA 3C7GA 3WG2A 4UFLA 1UU6A 1JH5A 3ASIA 2AZ5A 4XURA 1Z78A 4AEMA 1C1FA 3JBG3 3JD71 3Q8AA 4CCCA 2F17A 3TYJA 4JGZB 1G6NA 4QQ2A 4XBNA 2LS6A 4A6OA 3ZXGA 4M0NA 1QIQA 1MVQA 3MW3A 4GJZA 4BK5A 1CR7A 2YXSA 4JTNA 3FJSA 2C6SA 3SCGA 1MEC3 2RR11 2LW8A 2Y26A 3HJRA 3V0BB 1N3QA 1AR72 4SBVA 1BMV2 3B7MA 4BA6A 1SZBA 2ATFA 4NRQA 1D4M1 2X5IA 5FZIA 4RGAA 3ME2A 1COV1 3CEWA 3J7HA 1AL22 3CLPA 4XTPA 3BUCA 4XJAA 1GOHA 3TEYA 4QB2A 2XR4A 3HMYA 3CZUA 2R16A 3MDPA 3U1XA 1GZTA 3RRDA 1VBE3 1W2AX 2A70A 5JMOA 1ZNPA 3OPZA 1W6MA 4PCRA 3ZXEA 4E4ZA 1LB2A 4HN0A 1ENSA 1FV2A 5T55A 2WNVC 2P5BA 1NQJA 2ZA9A 4FVVA 4JKLA 3IKWA 4L2NA 1J3QA 4CP9B 4KWJA 1SPPB 2PLV2 3MO4A 4XJWA 2WFF3 4XEZA 3WG3A 3BB6A 3ZYGA 1IOAA 1QJFA 3AM2A 4LBMA 4F83A 1S2EA 4EN6B 1I6XA 1NOVA 5B2GB 3TEZA 3CHXA 2Q8DA 2QJVA 3I3DA 1AR81 1ZYBA 3WZ1A 2WO1A 1EV11 2DBIA 2RJ2A 4ZS2A 5SV8A 1F9KA 4FAHA 2ZGKA 4Q8KA 4IV3C 3POJA 3EHKA 5DABA 5JLVA 2E51A 4JGYB 2BU9A 3PUAA 3QD6A 1UU5A 1KDMA 4B4RA 4C0BA 4UW6A 1DDLA 1GU3A 1UOFA 1IGOA 3OB8A 3Q8EA 3TN91 1D2QA 1LGCA 5CYYA 3KQRA 2RS13 2BDRA 1LHWA 3AZYA 4AVTA 3N7MA 3AP9A 5C4WC 1AXKA 5FPZA 3ZMOA 5JZGA 3ILNA 4XXAA 5LCWL 2PMWB 4AI0A 4XETA 2VQUA 4DS0A 3S7IA 1UMIA 3VKMA 1NLQA 1XQNA 4UF0A 4A45A 2D43A 3G7DA 1NCQB 4C90A 2RM23 2BPA2 1QJU2 2OUJA 3HOBA 2QQWA 4FCAA 2Z79A 1ASJ2 3EO6A 4LHSA 1HQNA 4XHXA 5DZFA 5BNOB 3WP4A 3URFA 5DAWA 1POV1 2ZX3A 3SHRA 2O0OA 2GALA 3KZ4C 1SDDB 4INDA 3L2HA 5BNNA 1O8PA 5CEHA 1H1MA 3WP6A 5IK4A 5H9SA 3NO8A 5I8YA 3AKPA 5LA0A 2E33A 5GLZA 4ITCA 3OD0A 2VMCA 1O4YA 3WNKA 1OUSA 1AX0A 1AHSA 3NNLA 2VCCA 4PJYA 2CAUA 1PO13 3RQ0A 3NKTA 2B42B 2OXBA 3V65A 4DINB 4QKBA 2KXLA 1G8WA 1RUG1 2Z69A 4FPFA 5DDJ2 2BGOA 1QJZA 2H0VA 4LUMA 1UYYA 4Q4V3 4K1YA 3WCSA 4CPBA 4XVHA 1BKZA 1X9PA 2R072 5F3GA 1DQ2A 5IATA 1GNHA 4N53A 1Q56A 1UWWA 3O0VA 2BGCA 2WZPP 5A1FA 1BBT2 5FXVA 3JD72 3WDVA 1MQTA 2QNKA 4JX0A 2YBKA 2RS33 2P34A 2D5HA 1VAMA 3WNMA 3N7JA 4LO8A 3AP4A 4FTSA 4OHXA 2C4XA 2JKXA 2RR12 2AYHA 4MG2A 3PU8A 3H1WA 1U5YA 1HRI3 3OBAA 2ARBA 3CMGA 1I5PA 3AJYA 4L97A 3RMXA 4D69A 1PVC2 1D4M2 2DVDA 3KV6A 5A70A 3DCQA 1NA1A 2WAOA 5D2AA 3SMHA 4N7UA 3QH6A 4RN5A 2XJQA 3VN4A 1X36A 1KITA 4Y22A 5A7QA 3RDIA 5EP9A 1W6PA 2HEVF 4XF9A 1YIFA 2X53S 3WDWA 3VHRA 3WNOA 5JWPA 5JXGA 1UKRA 3HNYM 2B46X 2YY1A 4FPJA 5T5JA 1UN1A 2FBEA 4Q4Y3 5A32B 1OD3A 3SEEA 5F5AA 2HWC2 1H2KA 1ST8A 1VMFA 3GJBA 2YU2A 3H3LA 1H2MA 1HRV2 2PQSA 4XFBA 3AKQA 1ENXA 1VBE1 5EV7A 3KCXA 2ZEWA 2DVBA 2VTFA 1TME3 3M2MA 4RGGA 5FZLA 2CNAA 2C0ZA 1N3PA 1MZ5A 4JGZC 2DF7A 4EE2A 1ZREA 5F6LB 4TZDA 4OI2A 3UGHA 4U36A 4W65A 3MPPG 1AR82 1CAXA 2A71A 3PLQA 2E63A 4Q0PA 4QWNA 5HCBA 3E97A 5HXVA 3MBWA 2J1RA 1OT5A 1V6IA 2GH8A 5L73A 4Y20A 5FY9A 3UNPA 4NHXA 1AF9A 4NIAA 5KXEA 3DKWA 1R1A3 4Z82A 5FMOL 1QQP3 2HLEA 2OW4A 1Y4WA 2ZCWA 5C5TA 3RZKA 2ARAA 2JE7A 1SQ4A 1OLQA 2VOWA 1IQDC 1H6XA 1H30A 3MIGA 4E8CA 1JYNA 4AHXA 1RUF2 4DO0A 4XAEA 1S0IA 4YM2A 2X8KA 3SLIA 2WYFA 3H7JA 4Z2AA 2FDKA 2WSVA 1FOD1 3P1IA 4QU1A 2QDRA 4AHZA 4LBOA 2Y34A 4XTMA 4XAAA 2VW1A 3D4KA 5J36A 4OI0A 1DQ0A 4ISQA 3OYWB 1S0DA 1POV0 1N1SA 1LGNA 1WCKA 2RS11 3NKGA 3QLQA 4GAZA 4GH4B 1JXNA 5FWJA 5FXZA 1S4CA 4P9XA 3WP5A 2ZGLA 3X29B 4DIQA 5IVJA 4Z92B 4LIUA 1WLDA 4BZ4A 3AKTA 3OY8A 2GC0A 4HK8A 3MUY1 1QDOA 4RYDA 5EYYA 4C0HA 4Y1UA 3VB9A 2V72A 2A1XA 4EWAA 3R0RA 4AVCA 1ULCA 3LEKA 5KXCA 4GWMA 2BWAA 3B3QE 4JGYC 1PGW1 4CEYB 2WNUB 5F39A 2A3WA 3K46A 1TNFA 1UIKA 1ND2B 2VZUA 2MHFA 5J98B 1UMHA 2PHFA 4UBGA 3WX5A 3VBRB 3ZDSA 3B5LB 1W6OA 4S2GA 2XVLA 3ZIWA 2D40A 3ZN6A 1VIWB 5H9QA 3SH3A 2WO3A 4CYDA 4BJ0A 2KD7A 1VBB3 1JODA 1O59A 1RUG2 3F2ZA 3IDEA 5FK8A 4GMP1 1AR93 1HKDA 1PZ7A 5C9AB 1WZXA 1XOYA 3LE0A 5CFDB 4OHYA 3QACA 4MYEA 2P3JA 2Y6KA 5I93A 2B7YA 2LUWA 2WJSA 1QDCA 3I97A 4B7KA 4QPGA 3AX4A 4KQ7A 3N7LA 5FQ0B 5KR7A 1SLCA 1ZM1A 5FCCA 1PO11 3QBQA 5CKQA 4C1WA 4SLIA 3IMNA 4PIXA 1YQ5A 5B4NA 1RMU3 4V2VA 2OZ6A 3AMHA 1T6BX 1NCQC 1JUHA 3T1MA 4LBKA 1Q8QA 3GCXA 4Q4V1 1JYIA 3B00A 3B01A 4AG4A 2OQ6A 3RYRA 2PHWA 4E2GA 5BNOC 2XHNA 3ZN4A 1ALYA 1H8TB 1S0EA 4RS5B 1K3IA 2WZEA 3NV3A 1RUI2 3TEWA 1RUE2 3EJKA 1U0AA 2RS31 3GYDA 1QNWA 5FV3A 2YC4A 5EXOA 4Q2FA 1JYTA 4EN9B 1HV0A 4DUXA 1A3KA 2WWSA 4XMIA 1MPXA 3NSTA 5C70A 4NIGA 4LLOA 1HRI1 4XDQA 1QXRA 3HR9A 5GALA 3V0AA 4IEYA 4K7JA 3T2QA 4QX1A 1N1VA 4HPKA 3AXEA 1MZ6A 3BPZA 4LE4A 4AE2A 4EWDA 1EPWA 4EV0A 2VBDA 3TNQA 3MEPA 2HWE1 3VDBA 3RPQA 4WVZA 2I45A 5FZAA 4YVSC 1JZ8A 3IAPA 4MSVA 1PGSA 3I2DA 1JTZX 4QX2A 3ZPYA 5ABJB 4DXRA 3PVBB 2EAAA 1ND3B 1ZZCA 2VPVA 3KSCA 1PX4A 3LCPA 3WDXA 5FXXA 2B9UA 4DEVA 1ZZ6A 4UAPA 3ZYFA 4B8EA 1D4VB 3IDBB 4YG6A 1L7LA 3E5QA 1LU1A 5EQUA 2Z4FA 1TME1 4OFGA 1OOPB 4L99A 1WLWA 4Y26A 4IUGA 3ZPOA 3VBFB 4LOSA 5JUVA 5AC92 5KC5A 3OGRA 3RS6A 5JI7A 3ZXDA 3MYXA 4O61A 4YNIA 1CWPA 3SCFA 1ZBA2 4I01A 2RS53 2JDKA 3WQ7A 1NKGA 4UFIA 4LULA 4NHYA 1VB4A 2W68A 2ZJCA 3EXUA 3TEXA 2D5FA 2JDHA 3MGUA 1R1A1 4JV4A 4F7ZA 1QQP1 5FIXA 1FOD2 3APBA 3PVEA 3GM8A 2XJPA 5LY1A 4AOCA 4WVVA 3WUCA 4AFDA 4ZU7A 2VCBA 4FPHA 4Q8LA 5A7PA 2BTVC 2JG8A 2EIEA 1O3RA 4LHLA 1CAWA 2VBBA 4YW4A 2ZHLA 1DZTA 2OQ7A 1BEV3 1UY2A 5E89A 4LE3A 3ZLIA 3V64A 1DQ1A 4MZUA 4QX5A 5A3UA 4XW3A 2VO5A 3NV4A 2YB7A 4KU7A 3N36A 1J1TA 1XU2A 2EXKA 2WWUA 4OYUA 5JIAA 5LASA 4ASMB 3O1MA 5LA9A 4CUAA 2ZZQA 3ZKYA 4YFZA 3HT2A 4ARXA 1G9AA 1CIYA 2J1VA 1HB1A 3EQEA 4LK6A 3USUB 5LW9A 1W28A 3RI8A 1PGW2 3KV9A 1XPWA 4GMP0 3JU9A 5FP8A 4OHZA 1MR5A 4PHZA 5CFCA 4ASKA 4BQ2A 1I5ZA 2OZJA 3ZXJA 5I0TA 1V6JA 4YRDA 4OUEA 1ODNA 1U5IA 4FP3A 2PA7A 1GZ9A 2W52A 3J7MA 3HNMA 4X8NA 1SMVA 3ETPA 4AFBA 1C3HA 3FMGA 2XJVA 4JHZA 4OVEA 3O14A 2E7QA 1NCRB 3CJIA 1VBC3 3LA3A 4S2HA 3T0AA 4WM7A 4CCLA 4LKDA 1AYN3 2VZPA 2VQ0A 4MHUA 1DCSA 3Q8CA 1VBB1 4GH4C 3TRSB 3VKFC 4ONUA 5JOYA 4NIHA 1GQGA 4ZU4A 5GZGA 4IV1A 1H4HA 1BCXA 2XLGA 4RD7A 4N7IA 1ONAA 2GMMA 1DLLA 5FYIA 5HV0A 1RJ8A 4DXTA 4CXWA 2YUEA 4AQ6A 4Y1XA 1WWYA 2PYTA 3H1MA 4LBJA 2CSGA 3S0MA 3AXDA 4ZHNA 2Y38A 4QB1A 4ZXEA 5BY5A 4RHV3 3CKHA 2ID4A 1OLRA 2WNUC 3DGTA 4CEYC 2BVBA 5K0UA 2BBAA 1ND2C 1VB2A 3WLUA 3VBRC 3OGVA 2WO2A 2B8MA 4BCUA 1ZBE3 5J48A 3HD8B 1WCQA 3J7NA 3VDDA 1KRIA 1HRI2 4Y5Z0 1JU3A 5LA2A 1UY1A 5C9AC 2W94A 5KHHA 1S0JA 4ORFA 5IK5A 4BQWA 1JU4A 4YZ4A 1DYOA 3DPRB 3ZYRA 2D6MA 2BP6A 2GP5A 2OPWA 3CQOA 2I74A 4ZY9A 4FPCA 3THTA 3WDYA 4B1LA 3RWKX 4COWA 3NAPA 1GSLA 2TNFA 3K48A 4P00B 1IPSA 2HWE2 1DFQA 4MXWA 3TWIA 1PX3A 1H6YA 4ISRA 2YMZA 1JZ4A 3T08A 1XNAA 2V09A 3A21A 4CCNA 1PO23 2VZVA 3MV11 1W9TA 2HBTA 4YZ5A 3DUIA 4FPEA 1GKBA 1H8TC 1GANA 3B69A 4RS5C 4HETA 2SBAA 2DUOA 5L19A 2V5DA 3WW2A 1RUD2 1LNSA 1CAVA 4B29A 2XJRA 1R1ZA 2EA7A 5E1RA 4GB33 5G05L 5FPUA 4Y5TA 4ZZ8A 1O8SA 1LJ7A 3JB8A 3UJQA 1SFPA 1W8TA 1LOEA 1W9SA 2MEV2 4HKWA 5FYSA 5FP7A 5FY8A 2FZ2A 2NMOA 5T50A 1RINA 1QF3A 5EPAA 2ZGTA 4L0PA 3NQHA 5JPNB 1VALA 4N9HA 4ATFA 1I9RA 4AEDB 1WA4A 4PDWA 3DXTA 2R7EB 1AJKA 4HKOA 3S5AA 1RUH3 2X29A 2WZR2 1YO8A 2DU0A 4MO3M 2FMDA 3HN1A 1QOOA 1LOAA 1W2TA 1PZ8A 4NWWA 2KA3A 3EYPA 3KS7A 4FFHA 1RJ7A 4XCBA 2RS51 5DUUA 1OSGA 4J1WA 2Y64A 5FYCA 1DU3D 2D98A 4GIQA 3VBUA 1XBFA 1QJX3 2C5DA 3H3UA 3KF5A 4JRAA 5ABJC 4M3CE 5D8AB 2YFZA 1ND3C 4D0QA 2IUWA 5FMBA 4DUVA 3R6SA 1HN1A 4COYA 4BXSV 4UBHA 2XVKA 2OPKA 3JB4C 3K4AA 1OOPC 3L9JT 1DF0A 1KJLA 1BEV1 1GOFA 1QJY3 3J4UH 3VBFC 5FYBA 1SCRA 2AR6A 4KWUA 4R4ZA 5HBAA 4AR2A 4U2AA 1Q8SA 2BV4A 3ABZA 4Z8BA 4NE9A 3CU7A 2BQPA 1GP5A 5A7WB 2D93A 2XPJA 5FKBA 2BFUS 2Y6LA 5F3EA 3BTYA 1YXWA 4BHPA 1SLTA 1R081 2J1TA 1CJPA 3T30A 1LOGA 4K1ZA 5F3CA 2PAKA 3SISA 4COZA 3PUHA 4K9SA 3PNAA 3ZSKA 4MV2A 1Q8PA 2QQLA 3LEIA 1A34A 5FFOC 1X33A 4EZ4A 5FPLA 1AJOA 2CDPA 1V9U1 4FP2A 3GALA 3WV6A 3AYAA 4IEVA 1OQEA 1VBC1 3UKTA 2ZGRA 5CISA 4GKYA 1UQXA 1E5HA 4P14A 1WLCA 2QQOA 1AL0G 1WD4A 1FPN3 3MIFA 4Q1RA 3J8F2 5F5QA 5SV5A 5A1AA 3PUQA 1F5JA 1OKQA 4CU8A 1GWKA 2CV6A 3WNLA 1AVBA 2O14A 1GNZA 3HBKA 4OUMA 3OGGA 3S6PA 3AZZA 2J42A 1WLTA 2VMHA 2VZQA 3LSEA 1NUKA 4Q4X2 1OKOA 2K46A 2GNTA 3EMRA 4Q26A 2Z5WA 1EUUA 4I09A 1FATA 3BU7A 4NJ4A 1HXS2 2Y6FA 1RVF2 1O3QA 2ZHKA 1S0GA 1H1IA 4HN1A 5APAA 3THDA 3H8XA 2QTWB 1QWRA 4ZU5A 3WW3A 1NCRC 4PT6A 5FYZA 3PMEA 3KHCA 2XBO3 3MIHA 1K5MB 1ZBE1 2WNVA 4Q0UA 4AI2A 5FMOS 3VUOA 3E5XA 5H9RA 3LPFA 3W59A 3I2IA 4AFAA 2VUAA 1W6NA 2WN2A 1UY0A 4BDVB 1KJRA 4YM1A 3VGIA 3MUZ1 2XOMA 1UD1A 4TN7A 4YW2A 4CU7A 1L7RA 1V6MA 2YHJA 2Q8CA 5KXDA 3BIEA 1HLCA 2XB6C 4QHBA 2WINB 1UXZA 4D6RA 1CJDA 5JAXA 3U37A 2WC2A 2XUMA 3VBHB 5JXJA 2ZXQA 1LGBA 3ZFEC 2CGPA 4W6YA 1YRZA 1VBD2 3VBOB 1EP0A 3U78A 3MIDA 3JQWA 4IV3A 1GZCA 2JG9B 3DL3A 4YVWA 3VZKA 1FMD3 2UWCA 5F5IA 1XNCA 1SBDA 3HBZA 4LIVA 4MGIE 1UY4A 2Y8KA 4TXWA 1UY3A 3RYKA 3WXPA 5CIRA 3WF3A 4YW1A 1XSQA 3LFMA 4GB31 4LO6B 5KHGA 1GP4A 4JKMA 4TSVA 5GLWA 2W2IA 1TQ5A 3DPRC 2BW8A 4NROA 3VDCA 5FZEA 2Y0OA 1ENQA 5C4WA 1GP6A 3MIBA 3C7HA 2VD7A 2CWMA 1MZEA 4LO4B 1G7YA 4XBQA 4MX3A 1I3HA 3KQ4B 5C8WA 1BVP1 5DMYA 1UCXA 1RUH1 3PTRB 3H9AA 3AL5A 3I3EA 4Z1VA 1W0NA 2XJSA 4QKFA 2WQ4A 2VH9A 2XJTA 3SQOA 3BCWA 4XQDA 5A33B 5A3MA 1LTEA 2KR2A 2R1BA 3JUUA 1XC6A 3S5QA 2BYVE 2HWB3 4XMAA 4AVAA 3T09A 4R8HA 3I49A 4XUPA 4RSUA 5FLJA 1QJX1 5FZ6A 3NNGA 1ZVFA 1H8VA 1W03A 1CAUB 3UGGA 1DG6A 3VBSB 4N90A 4H55A 4LBLA 5FXWA 4UT5A 5C3QA 3HIFA 3G6JB 4IQPA 4TTGA 3WF2A 1DHKB 1LENA 1YEWA 4A41A 4AEDC 2IFRA 5TSWA 2BJSA 1QJY1 3ZFGB 1MS1A 4QD2A 4HVRA 4YW3A 4Z07A 1A8DA 3K4DA 3DXUA 1R082 4FPKA 1OVPA 1NE6A 1LOFC 4P9JA 3RFRA 1R093 3FHQA 3BIWE 4RR3B 4CDWB 4AFCA 4DRVA 1JOPA 3U75A 2E6VA 2XMLA 4A42A 1AR61 1V9U2 1W05A 4OI1A 3ZSLA 1GWLA 3AP7A 5G04L 5D8AC 3RJRA 2WDBA 4FO9A 2G9GA 3C7FA 2TBVA 3SCHA 4D6QA 2ZMKA 4LUKA 5EJ1B 1H1AA 1US3A 2HWF3 1QY4A 1W8UA 3WF0A 5H9PA 3AB0A 3O1OA 5E6HA 4NWVA 2EF6A 4W6WA 2IXJA 2H6CA 4KGQA 4XFHA 1Q8OA 3AZWA 1M4WA 3KB5A 3ON7A 4E2SA 1PGL2 4A2UA 2GNBA 3H8UA 3VD4A 2FD8A 2IXCA 4DEQA 2ZX0A 5A3NA 3NL1A 4FOYA 4BQ3A 5AFBA 4LORA 5EJ3A 1FPN1 3UKVA 4A7ZA 3NWKA 4CE8A 4N8MA 5A1LA 4K21A 4FQZA 3OBRA 4AVSA 4ASLA 2GN7A 4BQ1A 3IT8A 2RMU3 2VZRA 2WNOA 4UFKA 1KD7A 3UK9A 3UL2A 2J1SA 4ZZ5A 4W4ZA 1PMIA 4XJ8A 4A6SA 4E2QA 5IK7A 3M8LA 3ALQA 2WABA 2V4AA 1X8MA 1PK6B 5KWRA 2ZGOA 2ERFA 2GC1A 3OBZA 1VBA2 2GC3A 2XBO1 3LQCA 2AEYA 4JGZA 4W6XA 3V56A 1OH3A 4XDOA 2ZOEB 1NY71 1RHI2 3PVNA 4OI4A 2R043 4ZKTB 4CTEA 1Z7S3 1W8WA 3IM0A 3V0BA 3ENRA 4FOVA 4D94A 1K45A 3NNMA 2FZ1A 2W5FA 2DUQA 5A6XA 4QXCA 1CPNA 4S2DA 4YVSB 1VRH3 3TBDA 3LDRA 4RQPB 5BYNA 2AENA 1LOCA 1CIWA 1RUC1 4Q29A 5AVPA 5FZCA 2WWJA 5EYXA 5FYHA 5FYUA 1V6NA 1LU2A 3N9LA 4GB32 4KG8A 1LULA 2NP0A 5IUQA 2FDIA 4DQAA 3I2GA 1DP0A 4I0BA 1AYM3 5EJZB 2Z42A 1FMD1 4Y1YA 2CY6A 2DCYA 3JBG1 1K5MC 3HPNA 2NZ9A 4RFT0 3I3MA 4E9KA 4WZCA 4CUGA 1COV2 4HFSA 4CP9A 1B35B 3POFA 1SPPA 1UXXX 2R063 2Y33A 1RUH2 4B7EA 4MOAA 3WQ0A 2BEOA 1MEC1 1RUJ3 3SKJE 3THCA 2VAUA 1WA6X 4IEZA 1C8M3 1OUXA 1TMF3 5DPNA 3LSDA 4I02A 5IFPA 3WDUA 3FZ3A 1BYHA 4TLGA 2VNOA 4NHLA 2Z2SB 5LY2A 3ACIA 4UI9L 4QPGB 3VBHC 5C5UA 1OMIA 3PVOA 5FZ4A 1JZ2A 2DCKA 2E53A 3M3OA 4NIIA 3MPBA 1FAYA 3U4SA 1C28A 3VBOC 3WD5A 4CXXA 5D21A 3U4XA 4WVMB 2FMYA 2JG9C 2PAEA 3GZUC 2JEMA 4JGYA 4Q1PA 4QXBA 4XOGA 3A4UA 5IVVA 3U14A 2HWB1 2XKPA 3DN7A 2JDZA 5FMDA 5JIUA 2LRPA 1QXPA 3FLPA 1AXYA 2HEWF 5LB6A 2WFF1 2A5ZA 1EV12 3K2OA 1TE1B 3WF4A 4Q4W3 4PIYA 3HNBM 3OPTA 2W9XA 2K0GA 3MW4A 4GQ7A 4Y33A 5D1IA 5FLIA 4GULA 4BQ4A 4QB6A 1AR62 2CYFA 1G9CA 1O3TA 3BODA 3MW2A 5FO9B 2ZGSA 2ZMLA 3I2FA 4OLLA 5EHDA 1FX5A 3ECQA 4NRPA 4WM8A 5FYTA 3TN92 3D3AA 1FXZA 5F2WA 1LAJA 1R091 1NCQA 3IWZA 2VUCA 4IE6A 2LTNA 4YPJA 2D6LX 4AVVA 5JOZA 4J25A 4QHOA 3K51A 3AK0A 5BNOA 3P5BA 2YPDA 4BIOA 3HEIA 4MADA 3E6DA 5A6QA 2VJXA 2WS93 2ZPXA 4HKLA 4P9YA 4PF1A 3RWNA 3ZM8A 1JI6A 4C91A 5KHJA 2MPFA 3GZAA 5FZ9A 5GJ6A 3VBSC 4TLFA 2WYSA 4IXLA 4NHMA 2XKOA 1FPN2 2HWF1 3WW4A 3MV01 4QQHA 4HANA 3W20A 4KWKA 5C3RA 1CGPA 2ZGPA 1S0BA 1W6QB 2EXJA 3AKSA 3T1LA 3ZFGC 4P9LA 3ZIXA 5LZ6A 1XYOA 3CF6E 5C8CB 2XUEA 3LKJA 2WL1A 4RR3C 4CDWC 5FMCA 2R30A 2QFEA 2RM21 2XONA 3RNSA 1O7FA 3VZLA 3BTAA 4O9GA 2GNDA 4KBZA 4FOWA 2Q1ZB 2VZTA 3OGJA 1NAEA 3EB7A 4BK4A 4QDRA 2JB4A 2RMU1 4JTOA 2H0BA 4Z2WA 4KBBA 4B3NA 1DZQA 1UOBA 4PIZA 2OKXA 3O1PA 3O1TA 1MACA 4Q5OA 1ULDA 1IS3A 2J1AA 4QPIB 3PL0A 1GZWB 2E7TA 3D8CA 2E26A 3LZZA 4NO4A 3VL9A 3ZSJA 1UZZA 2JDMA 1BLZA 3RZJA 2HJIA 2A73B 2XL9A 5FR3A 3D0JA 5ACA3 5CA6A 1VP6A 4YLZA 4BH9A 1G86A 2W3JA 1RUC2 5T52A 4AXOA 1D0HA 1IZ3A 2ZS6B 2QQVA 5FZMA 1C8NA 5L7OB 2EXIA 4FQ4A 2ZGNA 5GKAC 1OC1A 3RZMA 3WEZA 4CDQB 1ZX5A 5A32A 3JBG2 1UZYA 1VRH1 1C57A 1REFA 4LO5B 3WOGA 3MLJA 4AI1A 5HI0A 1T2XA 3BKZA 1F35A 4D8MA 1NXMA 2WBKA 1S2BA 5L9VA 1W3VA 1VAVA 4FFGA 1JBCA 1XYNA 1MEC2 1PK6C 3PIJA 3THPA 2IC1A 1AYM1 1SFYA 5DN2A 4CUBA 5T5PA 3PJYA 3N4MA 1W99A 2QKDA 1N1TA 4LXLA 1N1YA 3Q8FA 4XFCA 1J3RA 2YC0A 3POSA 4XYXA 2UY8A 1OPMA 3AYDA 3NRUA 3NJZA 1HB4A 4DRRA 4BB3A 1VMHA 1W04A 2VU9A 1YLLA 3AP5A 5FREA 4RA0A 3H8OA 2R061 5T5OA 1Q5OA 5DQ0A 1JYVA 1C8M1 2ZGMA 4ET7A 1TMF1 1VBE2 1IPJA 1UX7A 1YWKA 2HWD3 5ANNA 4RQPC 2VTXJ 1SLLA 4Q4Y1 1W9FA 4NR1A 3RMYA 3O1SA 1TNRA 1TG7A 3I3BA 5CNAA 2RDNA 3WT3A 4S2FA 3S30A 4LTAA 2NPIA 3B9CA 1QH6A 2PTMA 4Y4YA 5DAVA 2VNGA 3RI9A 4FPGA 2WFF2 3IDCB 2Q4SA 2BZDA 2WKKA 2WZ8A 4LKFA 3I2OA 3H3ZA 4BQ5A 1A78A 3A22A 4CRQA 4Q0SA 2A6WA 5IK8A 3CO2A 1B35C 3RYPA 1LEDA 3HQRA 2WIIB 1SBEA 3OYWA 4QDQA 4A3ZA 4AYUA 4GH4A 2J7MA 1OI6A 3POBA 4YW6A 3NJVA 5CKNA 1NLSA 4FXKB 5JSRA 1LHOA 1YQ8A 1W9YA 3I59B 1OQ1A 4QGMA 4CP1A 2XHKA 4QPGC 2W47A 3I2JA 3PUIA 3NAPB 5FZ8A 5BV6A 3ZOIA 3ST7A 5A3OA 2FCTA 1C1LA 4Q0QA 3AZVA 3T4HB 2RS12 3KMHA 2VZ1A 4I3GA 1XNKA 4WV8A 2XQXA 3INAA 2ADDA 5AVAA 3ZFFA 1RC6A 1YYNA 1UZVA 5K7PA 5KHKA 1ND2A 1W8OA 1WCDJ 4WZFA 1PIV3 1AR73 4NHKA 3VBRA 5FOBB 4MGQA 2AUYA 2IWGB 3U10A 1K5JA 1X50A 4M4PA 3NJYA 3QH7A 4LQRA 1FI2A 1ZZ7A 1AL23 1YQCA 1B09A 1OF3A 4JRLA 4LBQB 5B4XA 3BI3A 5C9AA 2XQRA 4XJZA 4HVQA 5CFDA 4QX8A 1H2NA 2I07B 2X10A 2JDUA 5A3LA 1SG3A 2RM22 3WY6A 2B39A 4R9BA 5FQ0A 1JUIA 4M4RA 4IGPA 3GHNA 4PQ9A 5DUWA 1OLMA 3FLRA 3WQBA 5JI9A 5FZ1A 4DUWA 1Q3EA 2XH6A 2VMDA 2D6PA 1UU4A 2Y6GA 4YGBA 3ZYPA 3MLLA 4PDWB 1NQDA 4GALA 3IB3A 1UMZA 2PLV3 4XPVA 2VCMA 5CVRA 1BJQA 4LPLA 3FUQA 2DUPA 4KL1A 1CESA 3FFZA 2VG9A 1Y9MA 5C71A 1XNTA 5CADA 1E57A 1H8TA 1Y3TA 2P6CA 4RS5A 5M0TA 3GNEA 4L92A 2KM2A 1PO12 3A7QA 1H0BA 1WBFA 3LWCA 2VVDA 1KS4A 3AMNA 5FRAA 2DTYA 1AR91 4HSJA 2OIIA 3I3QA 2W91A 4LHNA 1N3OA 2W08A 5FZOB 4AL9A 4Q4V2 1NG0A 1QXJA 1STMA 1OQDA 1SEFA 3UGFA 1SLAA 1HV1A 1H9WA 5FLHA 2UY9A 5JMCA 1RB8G 3VKOA 2PHTA 2OVUA 4G4FA 4IERA 4GXLA 5C8CC 4PLOA 4AHYA 1RMU1 3POWA 5ACA1 1E5RA 1V6LA 3D82A 2GZWA 5FUIA 3ZFEB 2RS32 2B45X 3ILRA 3U11A 1VRBA 4E4SA 4UYBA 1JYXA 3OBTA 2YU1A 3KT4A 5I0UA 4DB5A 4DY3A 3ACFA 3B94A 3AL6A 1LRHA 1EAH3 1J3PA 1CD3G 1UIJA 5IYYA 3AMPA 3FBYA 3T2PA 4AGVA 4H3WA 1RGSA 4CDUB 2DVGA 5ABJA 2VNRA 2OYZA 5C3SA 2K9ZA 3BVCA 4BXFA 1ND3A 5L36A 4K8RB 4AFMA 5BNPB 1ZZ9A 4QPIC 3ES4A 1E5SA 4LLFA 3GBWA 5FWEA 1VMJA 3N9MA 4HZFA 1GMMA 3PHMA 3J7LA 4CVUA 1QJU3 1YI9A 1VAKA 1ASJ3 4AWDA 2PXJA 4IE5A 2HBUA 3WNNA 1OOPA 2N7GA 3KGZA 4HK9A 5FYMA 3VBFA 1V0AA 2CL2A 4Q4Y2 1J1LA 3MF9A 5I0SA 5FYVA 4CEWB 3RGBA 5ANQA 5T5LA 1A6CA 4GJYA 4OMDA 3VD7A 3VZOA 5L7OC 1F8VA 2IXHA 5HCFA 1DGRN 2XWJB 4MGZE 1TME2 4PLNA 4CDQC 1CQ9A 4GZ9A 2J22A 4N43A 2WRAA 2YV8A 4M3CB 4XC9A 4DXSA 5ISLA 4C8DA 1TEIA 4CDXB 3IBMA 5EWSA 3I7DA 3I4IA 4IGOA 5DDJ3 5F6KA 1MVEA 1PMHX 5IVYA 3E5UA 4XJUA 2R073 2W1UA 2EIGA 2ZMNA 1F2NA 3OSDA 2ETEA 3WHUA 1A8MA 2DFCA 1ZRCA 5JVVA 4HBNA 2L9LA 1BBT3 1R1A2 2VE1A 2ZEXA 3VZNA 1QQP2 3JD73 5LBEA 2WLPA 3ZX7A 3AJZA 5JPMB 4XZPA 1XRUA 1BK1A 3IMMA 2ZAHA 2OT7A 5LWBA 2CAVA 3BN6A 5LK7B 3USUA 1O3SA 3ACHA 3ES1A 4JDMA 2G9FA 4DY5A 2FDGA 3OCPA 5F32A 2RR13 4EN7B 4XF4A 4FXGB 1ZRIA 3LAGA 3IPVB 5FZ3A 5F5CA 3K3NA 1W2NA 4O7XA 3DECA 2ORXA 3I2KA 1PVC3 1D4M3 2VXRA 4AVBA 3MFCA 3MI8A 1LEMA 1IKQA 4RGKA 1Z0HA 2JDYA 3KVBA 4AI9A 2P3KA 4BM8A 3OTFA 5IVFA 2WSUA 4KMQA 3M4FA 4CSWA 1NCRA 4D6SA 1PIV1 1AR71 4BQYA 5I8TA 1BMV1 1JN2P 4NAMA 3ETQA 4IEUA 1QH7A 4OMCA 1LCLA 1VR3A 3POIA 4XILA 2HWC3 2BNNA 5LBCA 3AVRA 3SXWA 3TB0A 2BBVA 3FHAA 2X09A 2XGXA 4AAXA 4QM8A 1DGLA 1SHWB 1HRV3 2GH2A 4M00A 1CZSA 1WGPA 2A3YA 4D7TA 2W92A 3C7OA 1AXZA 2DWRA 3ZVXA 3BOPA 3W21A 3U0ZA 1GR3A 3NAPC 2PHLA 5GLTA 3MLKA 4F3JA 2JDAA 1AX1A 2X5IB 3LEMA 4DXZA 3M1HA 5FOJB 5GLVA 4LEJA 1VBB2 2A6ZA 2PLV1 2C9KA 3B02A 1AR92 2DURA 5J7MA 3O1VA 3T4VA 2OA2A 3M7AA 4NN0A 4MH0E 5A3PA 4MVTA 2IZWA 3TNPB 4JHTA 3WG4A 1W8FA 1YI7A 2B9VA 2JD9A 2R6QA 1W6MB 2VMIA 3KVAA 3ZXAC 5KXBA 1HJGA 1AYN1 1W90A 2QQPA 2IVJA 3O1UA 3KWVA 2ZTNA 1PM7A 2CWSA 5K8SA 1RMU2 3D0SA 1HB3A 2E9QA 2WA4A 1PZ9A 5IVBA 5LBBA 3DPRA 2D6NA 2R0FA 1LHUA 5DUXA 2ZX4A 1NT0A 5LA1A 1QOTA 1RL3A 4HMZA 5FK7A 3ZKUA 1NE4A 1LESA 3PURA 3A0NA
chains in the Genus database with same CATH topology
5EPAA 2HBUA 5IAVA 5LBFA 5A3UA 3KT1A 3HQRA 5LASA 4NHMA 4UWDA 5LA9A 2RDSA 4XCBA 2V4AA 3W20A 4MHRA 3OBZA 4XC9A 4JZRA 4BQXA 2FCTA 5L9RA 3OUHA 2RDQA 5IAXA 5EP9A 5ERLA 4KBZA 4NHKA 3NNMA 2G1MA 3KT7A 2FCVA 5LBEA 2RDRA 4MHUA 4Q5OA 4Y5SA 3GJBA 3PL0A 4ZONA 3NNFA 5DAQA 4XCAA 5DAPA 5HV0A 2Y33A 3NNJA 3HQUA 3OUIA 5M0TA 4BQYA 2FCUA 4NHXA 4NHLA 2JIJA 5C5UA 3OUJA 4IW3A 3GJAA 5LBCA 5C5TA 5L9VA 4BQWA 2OPWA 5EQUA 3W21A 5DAWA 3ITQA 3EMRA 2Y34A 4XAAA 5LB6A 5DAXA 3GZEA 2HBTA 3KT4A 4NAOA 4NHYA 3NNLA 3DKQA 3MGUA 4XABA 2RDNA 3BVCA 5LATA 4Y5TA 4XACA 2RG4A 2A1XA 5L9BA 4NMIA 5DAVA 5LBBA 2G19A 4J25A 5HV4A 4ZPIA 5IATA 2JIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPA A;  2HBU A;  5IAV A;  5LBF A;  5A3U A;  3KT1 A;  3HQR A;  5LAS A;  4NHM A;  4UWD A;  5LA9 A;  2RDS A;  4XCB A;  2V4A A;  3W20 A;  4MHR A;  3OBZ A;  4XC9 A;  4JZR A;  4BQX A;  2FCT A;  5L9R A;  3OUH A;  2RDQ A;  5IAX A;  5EP9 A;  5ERL A;  4KBZ A;  4NHK A;  3NNM A;  2G1M A;  3KT7 A;  2FCV A;  5LBE A;  2RDR A;  4MHU A;  4Q5O A;  4Y5S A;  3GJB A;  3PL0 A;  4ZON A;  3NNF A;  5DAQ A;  4XCA A;  5DAP A;  5HV0 A;  2Y33 A;  3NNJ A;  3HQU A;  3OUI A;  5M0T A;  4BQY A;  2FCU A;  4NHX A;  4NHL A;  2JIJ A;  5C5U A;  3OUJ A;  4IW3 A;  3GJA A;  5LBC A;  5C5T A;  5L9V A;  4BQW A;  2OPW A;  5EQU A;  3W21 A;  5DAW A;  3ITQ A;  3EMR A;  2Y34 A;  4XAA A;  5LB6 A;  5DAX A;  3GZE A;  2HBT A;  3KT4 A;  4NAO A;  4NHY A;  3NNL A;  3DKQ A;  3MGU A;  4XAB A;  2RDN A;  3BVC A;  5LAT A;  4Y5T A;  4XAC A;  2RG4 A;  2A1X A;  5L9B A;  4NMI A;  5DAV A;  5LBB A;  2G19 A;  4J25 A;  5HV4 A;  4ZPI A;  5IAT A;  2JIG A; 
#chains in the Genus database with same CATH topology
 1GFF 2;  3LA7 A;  1RUF 3;  1HQL A;  2DCT A;  4YZ1 A;  3GDB A;  5FPB A;  5I0D A;  1DGW X;  5JSO A;  3T2O A;  1ZZ8 A;  5FP4 A;  4PDW C;  2VC9 A;  3S7E A;  5I8S A;  1OFS A;  4BMB A;  2W1S A;  2ZKL A;  4RHV 1;  5GLU A;  3WNP A;  3RZG A;  3C3V A;  2ENR A;  2CGO A;  2CDO A;  2EXH A;  2ILM A;  2TUN A;  3M70 A;  1WW7 A;  4G3Y C;  5LEJ A;  2F4L A;  1ULG A;  1W2U A;  3IIA A;  4KH9 A;  4QU2 A;  3N9O A;  5DG1 A;  1EAH 1;  3NVC A;  4JQR A;  1IS5 A;  1KS5 A;  4Y1V A;  3RZH A;  1POV 3;  2RVA A;  3KV4 A;  4I0A A;  2VZO A;  4QDS A;  4QX3 A;  5T54 A;  3ZN5 A;  2ZGU A;  4P9I A;  2RDQ A;  3OUH A;  4M01 A;  5FY1 A;  1HJF A;  5FJK A;  1UF2 C;  2A7A A;  1QJU 1;  2LM3 A;  2XDV A;  3PJQ A;  2ZAC A;  4AED A;  5JZG B;  2VTX A;  4YFW A;  4CCJ A;  3OG2 A;  4KG0 A;  4ZS3 A;  4DPN A;  1QEX A;  4QM9 A;  4BYY A;  5JXI A;  1LOF A;  2RDR A;  1LR5 A;  5EFU A;  1PO2 1;  1X9T A;  1WMD A;  4QAW A;  3E1F 1;  4UF0 B;  5FY4 A;  2CGN A;  3WR0 A;  1X82 A;  4IEW A;  3ZYB A;  1D0G A;  1CX1 A;  3KGL A;  4K3U A;  3RZL A;  2WR9 A;  3FE5 A;  3POY A;  2D7F A;  4FFF A;  4Y24 A;  1HQW A;  3LB9 A;  4QGN A;  4EQV A;  4CDU C;  4CZS A;  1EUT A;  5D8A A;  5E8A A;  4H14 A;  3PIG A;  2AEZ A;  4BPZ A;  5A3T A;  5JSP A;  3OEB A;  5BNP C;  4MUV A;  1W8H A;  5DDJ 1;  5BNN B;  3SC7 X;  3FWE A;  4NOT A;  2RS5 2;  3LIH A;  2R07 1;  4OUL A;  3UJO A;  1L3J A;  3FL7 A;  4FSJ A;  4LKE A;  1C4R A;  5CG8 A;  1YFW A;  2W39 A;  4GD4 A;  4NVP A;  4GA9 A;  2EIC A;  3AFK A;  3BU0 A;  1BBT 1;  1KXG A;  1RUI 3;  2VEC A;  3OUJ A;  4CEW C;  2UYB A;  4XFG A;  3GJA A;  1RUE 3;  3FC0 A;  1T6G C;  4IE7 A;  5A7S A;  3GCW A;  3GZT B;  1D2S A;  3LFI A;  1EYB A;  2BGP A;  1POQ A;  5A7W A;  1Y9Q A;  1EPZ A;  3ZDV A;  2W1Q A;  4NID A;  3R05 A;  1I1E A;  3N9P A;  4N53 B;  2OS2 A;  1BEV 2;  2DVF A;  1PIV 2;  5CAZ A;  3VD5 A;  4CDX C;  2VOT A;  2GP3 A;  2NM1 A;  3T0D A;  1PVC 1;  3B93 A;  2VGD A;  3N9Q A;  4WVW A;  4XUT A;  2E31 A;  1MQT B;  1UW8 A;  2IXL A;  2QDN A;  2O8Q A;  3N35 A;  4LBN A;  4AW7 A;  2RJL A;  2VQA A;  3AYC A;  3ILF A;  1XE8 A;  2P17 A;  2VUD A;  4EJR A;  3OOX A;  5FBZ A;  3OEA A;  4XUQ A;  4OHW A;  2YG0 A;  3CDZ B;  1UAI A;  3UT0 A;  2HWC 1;  4WBB A;  5EZW A;  4H2A A;  5L9B A;  1NA1 B;  1GLH A;  1W9W A;  3VHO A;  4CUC A;  1O4T A;  1JYC A;  1HRV 1;  2AAC A;  4LBQ D;  1IPK A;  4Y22 B;  4ZPI A;  5F37 A;  2DCJ A;  3N3H A;  1W6P B;  2A6Y A;  4ERO A;  2GME A;  4DMI A;  4FTB A;  1QGL A;  2VUJ A;  3JCI A;  4E4D X;  1VBC 2;  3I54 A;  4FPY A;  1HDK A;  4DOU A;  2JD4 A;  5LBF A;  1AYN 2;  5K4L A;  3GBF A;  5KHI A;  5AC9 3;  1OVS A;  4FPL A;  4Y3O A;  4PI0 A;  3Q8B A;  4R4X A;  4YG3 A;  4J1X A;  2LRO A;  1MS8 A;  3MZH A;  1ZBA 3;  3GXU A;  3S57 A;  4YW5 A;  4P9G A;  1GIC A;  2PFW A;  1JZ5 A;  4YVW C;  1K5M A;  1XYP A;  3FHI B;  4JAA A;  4XUN A;  4QXK A;  3ZYI B;  1ZA4 A;  4A4A A;  1SBF A;  1DQ4 A;  1JW6 A;  1X7N A;  3HVD A;  3VD3 A;  4XFI A;  3VKN A;  4ATE A;  1FOD 3;  3LPG A;  2UU8 A;  3LD8 A;  5FY5 A;  4BQX A;  2VM9 A;  3MIE A;  3ROU A;  4A44 A;  2IFW A;  1CAX B;  4RHV 2;  3CIH A;  3UKN A;  5ERL A;  2VOK A;  3BAL A;  3M3E A;  1OPO A;  1HIX A;  1WW4 A;  4CU6 A;  1RUF 1;  4Y20 B;  5FP9 A;  1RYY A;  3ACG A;  5A6Z A;  2JJ6 A;  3KT7 A;  1ZBE 2;  1EAH 2;  4B1M A;  3VBH A;  2X5I C;  5DZE A;  1U12 A;  2JE9 A;  4K40 A;  4FFI A;  2A6V A;  2ZEZ A;  4L11 A;  4P9W A;  3VBO A;  5IJR A;  1V6K A;  1MS3 A;  4WM8 B;  4YM0 A;  2JG9 A;  4IEX A;  2VR4 A;  2P3I A;  5FZB A;  1XNB A;  1DGW A;  1V70 A;  2ET1 A;  1NYW A;  1VLN A;  4D7Y A;  2IXI A;  4HL0 A;  4C1X A;  3MHZ A;  2BOI A;  4DZG A;  1LKN A;  2AC1 A;  2J1U A;  3KCC A;  1V6O A;  4XFA A;  2JEC A;  4AI3 A;  3AFG A;  1GOG A;  3ZYJ B;  2VXJ A;  1PO2 2;  2WQZ C;  3O7O A;  4GMP 3;  2ORZ A;  4UOJ A;  3OUI A;  5GZD A;  3SH5 A;  3JQX A;  1JZ3 A;  2XLA A;  2YPJ A;  3K3O A;  4I2O A;  3FBM A;  2DV9 A;  4BE3 A;  2WQ8 A;  3FUO A;  3FLT A;  2JIJ A;  4QKD A;  2WN3 A;  3OY8 B;  4IES A;  4F8A A;  2AGS A;  3GF6 A;  4UW4 A;  5A33 A;  2DYC A;  2PHD A;  1J84 A;  3NMB A;  4A3X A;  3K75 B;  2NQY A;  4FOQ A;  3WUD A;  1OUR A;  3W5N A;  1W39 A;  3K4Z A;  4JCK A;  3KHB A;  4CDW A;  5JDB A;  3HAG A;  1QU0 A;  3N9N A;  5FY0 A;  1M06 G;  3ITQ A;  1CAU A;  2BER A;  1W6O B;  2WT0 A;  3LA2 A;  3VBS A;  4HSL A;  3ZSE A;  4XUO A;  2J1E A;  3ZN6 B;  3UES A;  5K9Y A;  2VME A;  5HXM A;  4LT5 A;  3GZE A;  1UKG A;  3W58 A;  4P08 A;  1MS9 A;  2RJK A;  3H1Y A;  1WUV A;  4QQO A;  2V73 A;  5C6C A;  1WBL A;  2QQJ A;  5JZG C;  2PN5 A;  1G9F A;  3ZFG A;  4EN0 A;  2BFU L;  3DKQ A;  1QJX 2;  3RSJ A;  3KF3 A;  1RUI 1;  1PNG A;  4XAB A;  4I30 A;  1P8J A;  1YFY A;  3WVJ A;  4AHW A;  4DNY A;  4EWE A;  1KEX A;  2D3S A;  1RUE 1;  3KM5 A;  4QMA A;  2FHR A;  4RR3 A;  2YGL A;  4IEO A;  3DEM A;  4XAC A;  4IE4 A;  1DQ6 A;  4YSF A;  5IFT A;  4KGG A;  4MLO A;  4BLI A;  2BOJ A;  1TZO A;  2D3P A;  5IWF A;  1C5H A;  1DGR A;  4OCT A;  1DLC A;  3AZX A;  3VLB B;  4GWJ A;  2DTW A;  1YNA A;  3FX3 A;  2QZ3 A;  4P5Y A;  4YW7 A;  3RZZ A;  3A23 A;  5FZD A;  1UNB A;  2HWE 3;  1QJY 2;  2R0H A;  3AC0 A;  5E88 A;  3VZJ A;  3WF1 A;  4BME A;  1QOS A;  4E27 A;  4UW3 A;  2LAL A;  2D6K A;  2QE3 A;  2EID A;  2VUL A;  5BNN C;  2BNO A;  4LHK A;  1S2K A;  1IG3 A;  2UWB A;  1PVX A;  1NXD 1;  1QJE A;  1RUN A;  2RDS A;  4GKX A;  2QCS B;  3JXS A;  1YQ2 A;  3O1R A;  1UYX A;  5FPX A;  5DG2 A;  4I3P A;  1UZ0 A;  1W3X A;  2A3X A;  2IXK A;  3BPS A;  1F4H A;  4NRM A;  4J6G A;  3RVH A;  1RUD 3;  2QQU A;  4LNV A;  3ZYH A;  3USS A;  2W95 A;  4AGR A;  3UV9 A;  5FJH A;  3CJX A;  4KU8 A;  3MIC A;  3V0A B;  1XB9 A;  2Q30 A;  3BYW A;  2MEV 3;  1UL9 A;  3IN9 A;  5FZ0 A;  5IAX A;  3VL8 A;  3CZJ A;  1N47 A;  4HPK B;  3POG A;  4RFR B;  4B4P A;  4N53 C;  5LK5 A;  1YIP A;  3LDB A;  4XF0 A;  1S55 A;  1QKQ A;  2G1M A;  4TWT A;  5GZE A;  2GU9 A;  5C3P A;  1MQT C;  2WZR 3;  3KCY A;  2QQI A;  5FZF A;  4LA3 A;  3OJB A;  5AC9 1;  5JCT A;  2K2S A;  1HB2 A;  4IEQ A;  5LEK A;  1RXF A;  2G9Z A;  2DCZ A;  3P6B A;  2YRO A;  1ZBA 1;  1PK6 A;  4Q0V A;  1ULO A;  4QPY A;  1XJA A;  4K6B A;  3NNF A;  5DAQ A;  1H9P A;  4YZ2 A;  4MGT A;  5EIY B;  4LA2 A;  5F9T A;  5DXD A;  5DAP A;  2DFB A;  2Y6J A;  1IS6 A;  2YYO A;  2FDJ A;  2WFP A;  3C7E A;  4FI9 A;  2QQN A;  4QGL A;  3W5M A;  1YQ6 A;  5IW0 A;  4QQP A;  1UPI A;  2HH9 A;  2AH2 A;  2XG3 A;  1NA1 C;  4N9I A;  2YDE A;  1YJK A;  3NNJ A;  1FNZ A;  1URX A;  2YBP A;  1W8Z A;  2WO7 A;  4OQ8 A;  2D44 A;  1ACC A;  4YVS A;  2ES3 A;  2VMF A;  2XLF A;  4ARY A;  1APN A;  4IET A;  2XBO 2;  4RQP A;  2VW2 A;  2BNM A;  5FP3 A;  2PEL A;  1OD5 A;  1JHJ A;  4P02 B;  1NY7 2;  4XE9 A;  2VQT A;  4JDO A;  2ZX1 A;  3ELN A;  1L7Q A;  3RG0 A;  1WME A;  1LHV A;  3I8T A;  3AMM A;  2H6B A;  3OGS A;  4X8P A;  4AF9 A;  2W0X A;  3ZFF B;  5FKC A;  4YM3 A;  3F95 A;  5BPX A;  2JG8 B;  3ACL A;  2R49 A;  1CAW B;  1F4A A;  2ZEY A;  1KFX L;  4UFH A;  3M3Q A;  3ZXK A;  3J26 N;  1DIW A;  1B35 A;  1BK0 A;  3EBR A;  4PLM A;  1XND A;  2VW0 A;  2R04 1;  4K8F A;  4R52 A;  3DYP A;  3U07 A;  3B9I A;  3LDK A;  3VZM A;  1Z7S 1;  4JKK A;  2WAA A;  1UOJ A;  2O8O A;  5CB7 A;  1HN0 A;  2WA3 A;  1FMD 2;  2NYY A;  4HVO A;  1FT9 A;  5A6Y A;  4V1P A;  1GYK A;  4BU2 A;  2XXZ A;  1G9B A;  1DQ5 A;  4XDP A;  4YGC A;  5CFC B;  1W0P A;  3ZR6 A;  2VVE A;  5CG9 A;  2EVX A;  4WM8 C;  2RG4 A;  4WVM A;  4RL7 A;  4NMI A;  3J8F 3;  4PBP A;  5FDB A;  2QUO A;  4IDZ A;  5HV4 A;  2ADE A;  1W0O A;  5J96 B;  1JOB A;  1R64 A;  2JIG A;  4LMF A;  1FYU A;  2UWA A;  4XJ9 A;  3FFQ A;  4ES9 A;  1JOJ A;  4NUB A;  2PQQ A;  2VVF A;  1X8E A;  2CU5 A;  4GWI A;  5A7O A;  2D6O X;  3Q9O A;  3PTY A;  2PHU A;  2JXA A;  4G9S B;  1BVV A;  3CJI B;  4GWN A;  4Q4X 3;  4UW5 A;  3UYJ A;  4IEP A;  4OHV A;  4WM7 B;  1HW5 A;  5FZH A;  2P6H A;  2B5H A;  2HYX A;  1RUJ 1;  1O91 A;  4PBO A;  4UWD A;  1HXS 3;  2YC2 A;  1RVF 3;  1ZA7 A;  3O0X A;  3I2H A;  4AZZ A;  5KC6 A;  4QX0 A;  2DBN A;  4LO7 A;  3SEP A;  4ES8 A;  3WCR A;  2HWB 2;  4MHR A;  4IV1 B;  5CKM A;  5IHR A;  4YG0 A;  1CX4 A;  4HLT A;  1GNY A;  1ZZB A;  2Q8E A;  1GUI A;  1AZD A;  2P2K A;  4JZR A;  4LIT A;  1OLM E;  2YGM A;  4MET A;  1DZR A;  4UFM A;  2JX9 A;  1UYZ A;  1O6U A;  4CU9 A;  3MF6 A;  1D7P M;  2ZHM A;  1RUO A;  2UUR A;  4IE0 A;  3WDT A;  3OPW A;  1UZW A;  4AQ2 A;  5K0U B;  2ZBJ A;  2X05 A;  4M3C F;  3PUS A;  1IS4 A;  1YC6 1;  4UFJ A;  5FPV A;  3T2T A;  4CPB D;  4FTE A;  3LIG A;  1TVG A;  1VE0 A;  2JKB A;  3O5S A;  4BIS A;  5DUV A;  3VDD B;  4LOT A;  5JOW A;  4CA9 A;  3ZSM A;  1R09 2;  1VBD 3;  4Q4W 1;  2RV9 A;  3E6B A;  4KNC A;  1XSR A;  4Y5S A;  3TAY A;  2VZS A;  4BIF A;  3VV1 A;  1YFX A;  5FZG A;  5BNQ A;  1W6Q A;  5FY7 A;  4DFS A;  2Y60 A;  4QX7 A;  4X6Q B;  3ORJ A;  1RUD 1;  2P1B A;  5C8C A;  4HOO A;  4MXW B;  3KD4 A;  2ZZJ A;  4IL7 A;  1U5Z A;  4AEK A;  3TOJ A;  4CEY A;  2WNU A;  1DBN A;  3CL1 A;  4NPM A;  3E6C C;  4MGK E;  1YHF A;  1OHF A;  2MEV 1;  2HWF 2;  2G4I A;  2VMG A;  1JMU B;  4COV A;  2GMP A;  2Q5T A;  3KLS A;  3LF7 A;  3P3N A;  4BOW A;  5J37 A;  3AVS A;  5JXH A;  2WS9 1;  5GM0 A;  2P4E A;  4D3W A;  4W50 A;  4NPR A;  2P37 A;  3LEG A;  4XIO A;  1SLI A;  2P3Y A;  2W46 A;  1IKP A;  1CAV B;  4N43 B;  2WZR 1;  4XF3 A;  4YZ3 A;  3WNX A;  4CCO A;  3LOI A;  2YBS A;  4JC1 A;  3H0O A;  3IZO A;  4QPI A;  4CCE A;  4R9C A;  2V4V A;  1EY2 A;  1GZW A;  2UYA A;  4XZU G;  5T3N A;  4Y1Z A;  4B4Q A;  2NN8 A;  4FBF A;  4URT A;  1RXG A;  4UXA A;  2XL7 A;  3IDA A;  1GV9 A;  3M3I A;  4V2W A;  4YAR A;  4EN8 B;  2RMU 2;  3VDA A;  1GWM A;  2VBP A;  3O0W A;  4XFF A;  1O4Z A;  2DU1 A;  2ET7 A;  1F15 A;  1W2O A;  1NLR A;  1GQP A;  4HON A;  1SDW A;  2HEY F;  3O12 A;  1QMJ A;  1WMF A;  5IVC A;  5I0R A;  3H42 B;  5L7O A;  4OZO A;  1RTV A;  3HQX A;  3DV8 A;  4NAO A;  1UYP A;  5AFE A;  2PHR A;  4QQL A;  4CDQ A;  2ARC A;  1XXN A;  1C5I A;  1MS5 A;  4E4H A;  4PQQ A;  2EIB A;  3VBU B;  4COU A;  1MS4 A;  1Y43 B;  2C24 A;  1XU1 A;  1RED A;  2MNG A;  2PAM A;  2QVS B;  1R08 3;  5FPA A;  5LAT A;  5KBF A;  1KDK A;  1OA3 A;  2JB8 A;  3WQ1 A;  2I2S A;  3RJ2 X;  2R04 2;  3SKV A;  3VHN A;  3J9S A;  2G19 A;  3VKL A;  1Z7S 2;  3FN9 A;  1H2L A;  2O1Q A;  1JHN A;  4YGD A;  1V9U 3;  4QKN A;  1YCI A;  2WLQ A;  2ZX2 A;  5F8P A;  1CN1 A;  5F2S A;  4XF1 A;  2VNV A;  1OA4 A;  4IGQ A;  1WD3 A;  1VRH 2;  2EAL A;  2GNM A;  1OA2 A;  2JDN A;  1W8N A;  4LKS A;  5FO8 B;  1H4G A;  3NJX A;  3ZXL A;  1OF4 A;  5HCA A;  3QOP A;  1AYM 2;  1ENR A;  2ZAA A;  1WKY A;  2VZ3 A;  3UET A;  4LR4 A;  5J09 A;  3ZR5 A;  5F1R A;  4CP0 A;  1OBN A;  4I0W B;  2R06 2;  2A6X A;  2VL4 A;  1WCS A;  4HXC A;  4H7L A;  5GZF A;  3J8F 1;  4R9A A;  1RUJ 2;  4O9E A;  1C8M 2;  3ZFF C;  2HYK A;  1AX2 A;  1TMF 2;  2JG8 C;  2WNE A;  3DYO A;  3R4D B;  5C33 A;  4HT1 T;  5JR7 B;  2FCV A;  4O65 A;  4Q4X 1;  1HX6 A;  2A75 A;  4MXV A;  1O5L A;  3ZO0 B;  1J83 A;  2QQM A;  4LJH A;  4NPL A;  4OUS A;  1KGY A;  4KWL A;  5I91 A;  2E32 A;  1HXS 1;  1RVF 1;  4OQ9 A;  1IG0 A;  1REE A;  5CFD C;  4FT8 A;  3JZV A;  2HWD 1;  3I59 A;  4M0H A;  1DYP A;  1F5F A;  1XE7 A;  1VBA 3;  5CFC C;  3C8X A;  2XVG A;  4R9D A;  5J1X A;  2VOX A;  1K42 A;  2BWC A;  4H7M A;  1RHI 3;  4JDN A;  3GHM A;  3HT1 A;  4A7K A;  3A0K A;  3GBG A;  2QZ2 A;  2ARE A;  2W87 A;  5BXX A;  1JZ7 A;  3HQU A;  1ULE A;  1ULP A;  4Q4W 2;  3ZMN A;  2DDU A;  1LEC A;  1UO9 A;  3R4U A;  1JZ6 A;  5FYY A;  5F3I A;  5IT6 A;  5IVE A;  3CJI C;  1KFU L;  4WM7 C;  1ZRR A;  2JIC A;  2GSY A;  2Y0I A;  4LBQ A;  3W9A A;  4AEJ A;  2WNV B;  2BUK A;  1MZF A;  3ZXF A;  4IW3 A;  4Y4R A;  1K12 A;  4E8D A;  2R1D A;  4QT6 A;  2XJU A;  3R4S A;  1VBD 1;  3GGL A;  2GDF A;  1GBG A;  1J59 A;  1O5U A;  1W6N B;  1NZI A;  4LK7 A;  4IV1 C;  4Q27 A;  1RIR A;  3BGA A;  3DYM A;  1LOD A;  3K77 A;  5DZG A;  2W1W A;  5LRR A;  4D7S A;  2TEP A;  1PNF A;  2WS9 2;  4YWA A;  3PDQ A;  1COV 3;  3PU3 A;  4X6R B;  2RHP A;  3AP6 A;  2DVA A;  2VOV A;  2B4K A;  3QCW A;  1W06 A;  5FAX A;  2YZ4 A;  1V00 A;  5FZK A;  3BTZ A;  4K20 A;  4PI2 A;  3WW1 A;  3WP3 A;  4AK3 A;  3OF1 A;  4BWO A;  5C3O A;  3P3P A;  4IV3 B;  4YYO A;  5K0U C;  3NW4 A;  4YVW B;  3DF0 A;  5C7G A;  3SIT A;  2BVV A;  1G9D A;  1UOG A;  5FBJ A;  4AGG A;  1PM4 A;  1BZW A;  5BUV A;  1AL2 1;  1LHN A;  3VDD C;  1NZC A;  1VJ2 A;  4XBL A;  4QHZ A;  2WUH A;  5FZO A;  3WG1 A;  2OX0 A;  1GQH A;  4MGS A;  3T0B A;  2GAU A;  2PHX A;  5A7N A;  2CHH A;  1OFN A;  1WW5 A;  1OXC A;  5C4W B;  5HCH A;  1E5I A;  5IAV A;  1CZT A;  1Y9G A;  3KV5 A;  2JE8 A;  3KT1 A;  3ZFE A;  1AR8 3;  1CZV A;  1ZRF A;  1UX6 A;  1EV1 3;  2Y6H A;  3M3C A;  1CVN A;  1ULF A;  3T3Y A;  2C26 A;  3SNM A;  3N7K A;  1F31 A;  3H7Y A;  5FUN A;  5A80 A;  1AR6 3;  1PHM A;  3H50 A;  5FUP A;  4CDU A;  5JOX A;  2IVI B;  4YGE A;  2JWP A;  4N43 C;  3WIN E;  1ODM A;  3LGR A;  1FV3 A;  3TN9 3;  5ACA 2;  5BNP A;  2F6B A;  2C9A A;  5L9R A;  3IAQ A;  3AYE A;  2C1F A;  2FDH A;  2WT2 A;  1J58 A;  3OD4 A;  3WHT A;  1Q8V A;  1S0C A;  2JDP A;  2Q0A A;  2QBX A;  2YFU A;  2Q8O A;  2CTV A;  4PF5 A;  1WW6 A;  1S1A A;  3III A;  4HG6 B;  4AQT A;  4FAG A;  4FPO B;  3H8R A;  1SFN A;  3C2U A;  1YJL A;  5FO7 B;  4KI5 M;  4EYU A;  5JR2 A;  1LOB A;  1FNY A;  4CEW A;  5CBL A;  1UPS A;  2QQK A;  1QNY A;  4CXY A;  4JVA A;  1Q43 A;  1WCU A;  1XE0 A;  1IHM A;  4L8Q A;  3POE A;  4XQ4 A;  4ZON A;  2F4P A;  3NV2 A;  4XCA A;  3CBN A;  2ZKN A;  1WMX A;  2EAK A;  5FTT C;  4M3C A;  4CCK A;  3VBU C;  1PGL 1;  2ZGQ A;  1YFU A;  3HN3 A;  1AUY A;  2E7A A;  4AAP A;  4CDX A;  1QHD A;  3SH4 A;  2ZHN A;  2BRT A;  2RE9 A;  1IQA A;  4BLJ A;  2VY0 A;  2GN3 A;  2Q1M A;  3MFA A;  5CU1 A;  4EZH A;  2OUH A;  4URA A;  1ZRD A;  1SLB A;  3NV1 A;  5HPO A;  2XWB B;  5GZC A;  1MS0 A;  1ASJ 1;  1VPH A;  2R32 A;  1US2 A;  3HWJ A;  2HWD 2;  2NLR A;  5A3W A;  3D6E A;  4XXP A;  5F7U A;  2FCU A;  1Y7B A;  4OZX A;  1JS9 A;  1RIT A;  1NX9 A;  4P5H A;  1U5X A;  1JYW A;  1RUG 3;  5LRS A;  1CON A;  2NMN A;  2Q1F A;  3BOW A;  1KQR A;  4QXH A;  4QPW A;  1OH4 A;  1SAC A;  1BXH A;  2V5Y A;  3ATG A;  1DYK A;  4CP2 A;  2FDF A;  2VCA A;  1BQP A;  3D5O A;  2GC2 A;  3IPV A;  3PMS A;  4W8J A;  1YUD A;  1VBA 1;  5FZ7 A;  4CCD A;  3LOB A;  1S0F A;  3VD9 A;  4XIK A;  2HKX A;  4JQT A;  2JEN A;  5E16 A;  4MGY E;  3CNA A;  4TYS A;  2D97 A;  3BTX A;  1RUC 3;  1RHI 1;  4CCM A;  3L2Y A;  1SCS A;  4L9B A;  5DAX A;  2ZAB A;  4AQS A;  4XQW A;  3AMQ A;  2ARX A;  2WT1 A;  4XHB A;  2D3R A;  2SLI A;  3VHP A;  4A7Y A;  5J3U A;  2FQP A;  1BHG A;  4ZXK A;  3WSO A;  4AI8 A;  5CZK A;  1PMJ X;  3AKR A;  1CPM A;  3C7G A;  3WG2 A;  4UFL A;  1UU6 A;  1JH5 A;  3ASI A;  2AZ5 A;  4XUR A;  1Z78 A;  4AEM A;  1C1F A;  3JBG 3;  3JD7 1;  3Q8A A;  4CCC A;  2F17 A;  3TYJ A;  4JGZ B;  1G6N A;  4QQ2 A;  4XBN A;  2LS6 A;  4A6O A;  3ZXG A;  4M0N A;  1QIQ A;  1MVQ A;  3MW3 A;  4GJZ A;  4BK5 A;  1CR7 A;  2YXS A;  4JTN A;  3FJS A;  2C6S A;  3SCG A;  1MEC 3;  2RR1 1;  2LW8 A;  2Y26 A;  3HJR A;  3V0B B;  1N3Q A;  1AR7 2;  4SBV A;  1BMV 2;  3B7M A;  4BA6 A;  1SZB A;  2ATF A;  4NRQ A;  1D4M 1;  2X5I A;  5FZI A;  4RGA A;  3ME2 A;  1COV 1;  3CEW A;  3J7H A;  1AL2 2;  3CLP A;  4XTP A;  3BUC A;  4XJA A;  1GOH A;  3TEY A;  4QB2 A;  2XR4 A;  3HMY A;  3CZU A;  2R16 A;  3MDP A;  3U1X A;  1GZT A;  3RRD A;  1VBE 3;  1W2A X;  2A70 A;  5JMO A;  1ZNP A;  3OPZ A;  1W6M A;  4PCR A;  3ZXE A;  4E4Z A;  1LB2 A;  4HN0 A;  1ENS A;  1FV2 A;  5T55 A;  2WNV C;  2P5B A;  1NQJ A;  2ZA9 A;  4FVV A;  4JKL A;  3IKW A;  4L2N A;  1J3Q A;  4CP9 B;  4KWJ A;  1SPP B;  2PLV 2;  3MO4 A;  4XJW A;  2WFF 3;  4XEZ A;  3WG3 A;  3BB6 A;  3ZYG A;  1IOA A;  1QJF A;  3AM2 A;  4LBM A;  4F83 A;  1S2E A;  4EN6 B;  1I6X A;  1NOV A;  5B2G B;  3TEZ A;  3CHX A;  2Q8D A;  2QJV A;  3I3D A;  1AR8 1;  1ZYB A;  3WZ1 A;  2WO1 A;  1EV1 1;  2DBI A;  2RJ2 A;  4ZS2 A;  5SV8 A;  1F9K A;  4FAH A;  2ZGK A;  4Q8K A;  4IV3 C;  3POJ A;  3EHK A;  5DAB A;  5JLV A;  2E51 A;  4JGY B;  2BU9 A;  3PUA A;  3QD6 A;  1UU5 A;  1KDM A;  4B4R A;  4C0B A;  4UW6 A;  1DDL A;  1GU3 A;  1UOF A;  1IGO A;  3OB8 A;  3Q8E A;  3TN9 1;  1D2Q A;  1LGC A;  5CYY A;  3KQR A;  2RS1 3;  2BDR A;  1LHW A;  3AZY A;  4AVT A;  3N7M A;  3AP9 A;  5C4W C;  1AXK A;  5FPZ A;  3ZMO A;  5JZG A;  3ILN A;  4XXA A;  5LCW L;  2PMW B;  4AI0 A;  4XET A;  2VQU A;  4DS0 A;  3S7I A;  1UMI A;  3VKM A;  1NLQ A;  1XQN A;  4UF0 A;  4A45 A;  2D43 A;  3G7D A;  1NCQ B;  4C90 A;  2RM2 3;  2BPA 2;  1QJU 2;  2OUJ A;  3HOB A;  2QQW A;  4FCA A;  2Z79 A;  1ASJ 2;  3EO6 A;  4LHS A;  1HQN A;  4XHX A;  5DZF A;  5BNO B;  3WP4 A;  3URF A;  5DAW A;  1POV 1;  2ZX3 A;  3SHR A;  2O0O A;  2GAL A;  3KZ4 C;  1SDD B;  4IND A;  3L2H A;  5BNN A;  1O8P A;  5CEH A;  1H1M A;  3WP6 A;  5IK4 A;  5H9S A;  3NO8 A;  5I8Y A;  3AKP A;  5LA0 A;  2E33 A;  5GLZ A;  4ITC A;  3OD0 A;  2VMC A;  1O4Y A;  3WNK A;  1OUS A;  1AX0 A;  1AHS A;  3NNL A;  2VCC A;  4PJY A;  2CAU A;  1PO1 3;  3RQ0 A;  3NKT A;  2B42 B;  2OXB A;  3V65 A;  4DIN B;  4QKB A;  2KXL A;  1G8W A;  1RUG 1;  2Z69 A;  4FPF A;  5DDJ 2;  2BGO A;  1QJZ A;  2H0V A;  4LUM A;  1UYY A;  4Q4V 3;  4K1Y A;  3WCS A;  4CPB A;  4XVH A;  1BKZ A;  1X9P A;  2R07 2;  5F3G A;  1DQ2 A;  5IAT A;  1GNH A;  4N53 A;  1Q56 A;  1UWW A;  3O0V A;  2BGC A;  2WZP P;  5A1F A;  1BBT 2;  5FXV A;  3JD7 2;  3WDV A;  1MQT A;  2QNK A;  4JX0 A;  2YBK A;  2RS3 3;  2P34 A;  2D5H A;  1VAM A;  3WNM A;  3N7J A;  4LO8 A;  3AP4 A;  4FTS A;  4OHX A;  2C4X A;  2JKX A;  2RR1 2;  2AYH A;  4MG2 A;  3PU8 A;  3H1W A;  1U5Y A;  1HRI 3;  3OBA A;  2ARB A;  3CMG A;  1I5P A;  3AJY A;  4L97 A;  3RMX A;  4D69 A;  1PVC 2;  1D4M 2;  2DVD A;  3KV6 A;  5A70 A;  3DCQ A;  1NA1 A;  2WAO A;  5D2A A;  3SMH A;  4N7U A;  3QH6 A;  4RN5 A;  2XJQ A;  3VN4 A;  1X36 A;  1KIT A;  4Y22 A;  5A7Q A;  3RDI A;  5EP9 A;  1W6P A;  2HEV F;  4XF9 A;  1YIF A;  2X53 S;  3WDW A;  3VHR A;  3WNO A;  5JWP A;  5JXG A;  1UKR A;  3HNY M;  2B46 X;  2YY1 A;  4FPJ A;  5T5J A;  1UN1 A;  2FBE A;  4Q4Y 3;  5A32 B;  1OD3 A;  3SEE A;  5F5A A;  2HWC 2;  1H2K A;  1ST8 A;  1VMF A;  3GJB A;  2YU2 A;  3H3L A;  1H2M A;  1HRV 2;  2PQS A;  4XFB A;  3AKQ A;  1ENX A;  1VBE 1;  5EV7 A;  3KCX A;  2ZEW A;  2DVB A;  2VTF A;  1TME 3;  3M2M A;  4RGG A;  5FZL A;  2CNA A;  2C0Z A;  1N3P A;  1MZ5 A;  4JGZ C;  2DF7 A;  4EE2 A;  1ZRE A;  5F6L B;  4TZD A;  4OI2 A;  3UGH A;  4U36 A;  4W65 A;  3MPP G;  1AR8 2;  1CAX A;  2A71 A;  3PLQ A;  2E63 A;  4Q0P A;  4QWN A;  5HCB A;  3E97 A;  5HXV A;  3MBW A;  2J1R A;  1OT5 A;  1V6I A;  2GH8 A;  5L73 A;  4Y20 A;  5FY9 A;  3UNP A;  4NHX A;  1AF9 A;  4NIA A;  5KXE A;  3DKW A;  1R1A 3;  4Z82 A;  5FMO L;  1QQP 3;  2HLE A;  2OW4 A;  1Y4W A;  2ZCW A;  5C5T A;  3RZK A;  2ARA A;  2JE7 A;  1SQ4 A;  1OLQ A;  2VOW A;  1IQD C;  1H6X A;  1H30 A;  3MIG A;  4E8C A;  1JYN A;  4AHX A;  1RUF 2;  4DO0 A;  4XAE A;  1S0I A;  4YM2 A;  2X8K A;  3SLI A;  2WYF A;  3H7J A;  4Z2A A;  2FDK A;  2WSV A;  1FOD 1;  3P1I A;  4QU1 A;  2QDR A;  4AHZ A;  4LBO A;  2Y34 A;  4XTM A;  4XAA A;  2VW1 A;  3D4K A;  5J36 A;  4OI0 A;  1DQ0 A;  4ISQ A;  3OYW B;  1S0D A;  1POV 0;  1N1S A;  1LGN A;  1WCK A;  2RS1 1;  3NKG A;  3QLQ A;  4GAZ A;  4GH4 B;  1JXN A;  5FWJ A;  5FXZ A;  1S4C A;  4P9X A;  3WP5 A;  2ZGL A;  3X29 B;  4DIQ A;  5IVJ A;  4Z92 B;  4LIU A;  1WLD A;  4BZ4 A;  3AKT A;  3OY8 A;  2GC0 A;  4HK8 A;  3MUY 1;  1QDO A;  4RYD A;  5EYY A;  4C0H A;  4Y1U A;  3VB9 A;  2V72 A;  2A1X A;  4EWA A;  3R0R A;  4AVC A;  1ULC A;  3LEK A;  5KXC A;  4GWM A;  2BWA A;  3B3Q E;  4JGY C;  1PGW 1;  4CEY B;  2WNU B;  5F39 A;  2A3W A;  3K46 A;  1TNF A;  1UIK A;  1ND2 B;  2VZU A;  2MHF A;  5J98 B;  1UMH A;  2PHF A;  4UBG A;  3WX5 A;  3VBR B;  3ZDS A;  3B5L B;  1W6O A;  4S2G A;  2XVL A;  3ZIW A;  2D40 A;  3ZN6 A;  1VIW B;  5H9Q A;  3SH3 A;  2WO3 A;  4CYD A;  4BJ0 A;  2KD7 A;  1VBB 3;  1JOD A;  1O59 A;  1RUG 2;  3F2Z A;  3IDE A;  5FK8 A;  4GMP 1;  1AR9 3;  1HKD A;  1PZ7 A;  5C9A B;  1WZX A;  1XOY A;  3LE0 A;  5CFD B;  4OHY A;  3QAC A;  4MYE A;  2P3J A;  2Y6K A;  5I93 A;  2B7Y A;  2LUW A;  2WJS A;  1QDC A;  3I97 A;  4B7K A;  4QPG A;  3AX4 A;  4KQ7 A;  3N7L A;  5FQ0 B;  5KR7 A;  1SLC A;  1ZM1 A;  5FCC A;  1PO1 1;  3QBQ A;  5CKQ A;  4C1W A;  4SLI A;  3IMN A;  4PIX A;  1YQ5 A;  5B4N A;  1RMU 3;  4V2V A;  2OZ6 A;  3AMH A;  1T6B X;  1NCQ C;  1JUH A;  3T1M A;  4LBK A;  1Q8Q A;  3GCX A;  4Q4V 1;  1JYI A;  3B00 A;  3B01 A;  4AG4 A;  2OQ6 A;  3RYR A;  2PHW A;  4E2G A;  5BNO C;  2XHN A;  3ZN4 A;  1ALY A;  1H8T B;  1S0E A;  4RS5 B;  1K3I A;  2WZE A;  3NV3 A;  1RUI 2;  3TEW A;  1RUE 2;  3EJK A;  1U0A A;  2RS3 1;  3GYD A;  1QNW A;  5FV3 A;  2YC4 A;  5EXO A;  4Q2F A;  1JYT A;  4EN9 B;  1HV0 A;  4DUX A;  1A3K A;  2WWS A;  4XMI A;  1MPX A;  3NST A;  5C70 A;  4NIG A;  4LLO A;  1HRI 1;  4XDQ A;  1QXR A;  3HR9 A;  5GAL A;  3V0A A;  4IEY A;  4K7J A;  3T2Q A;  4QX1 A;  1N1V A;  4HPK A;  3AXE A;  1MZ6 A;  3BPZ A;  4LE4 A;  4AE2 A;  4EWD A;  1EPW A;  4EV0 A;  2VBD A;  3TNQ A;  3MEP A;  2HWE 1;  3VDB A;  3RPQ A;  4WVZ A;  2I45 A;  5FZA A;  4YVS C;  1JZ8 A;  3IAP A;  4MSV A;  1PGS A;  3I2D A;  1JTZ X;  4QX2 A;  3ZPY A;  5ABJ B;  4DXR A;  3PVB B;  2EAA A;  1ND3 B;  1ZZC A;  2VPV A;  3KSC A;  1PX4 A;  3LCP A;  3WDX A;  5FXX A;  2B9U A;  4DEV A;  1ZZ6 A;  4UAP A;  3ZYF A;  4B8E A;  1D4V B;  3IDB B;  4YG6 A;  1L7L A;  3E5Q A;  1LU1 A;  5EQU A;  2Z4F A;  1TME 1;  4OFG A;  1OOP B;  4L99 A;  1WLW A;  4Y26 A;  4IUG A;  3ZPO A;  3VBF B;  4LOS A;  5JUV A;  5AC9 2;  5KC5 A;  3OGR A;  3RS6 A;  5JI7 A;  3ZXD A;  3MYX A;  4O61 A;  4YNI A;  1CWP A;  3SCF A;  1ZBA 2;  4I01 A;  2RS5 3;  2JDK A;  3WQ7 A;  1NKG A;  4UFI A;  4LUL A;  4NHY A;  1VB4 A;  2W68 A;  2ZJC A;  3EXU A;  3TEX A;  2D5F A;  2JDH A;  3MGU A;  1R1A 1;  4JV4 A;  4F7Z A;  1QQP 1;  5FIX A;  1FOD 2;  3APB A;  3PVE A;  3GM8 A;  2XJP A;  5LY1 A;  4AOC A;  4WVV A;  3WUC A;  4AFD A;  4ZU7 A;  2VCB A;  4FPH A;  4Q8L A;  5A7P A;  2BTV C;  2JG8 A;  2EIE A;  1O3R A;  4LHL A;  1CAW A;  2VBB A;  4YW4 A;  2ZHL A;  1DZT A;  2OQ7 A;  1BEV 3;  1UY2 A;  5E89 A;  4LE3 A;  3ZLI A;  3V64 A;  1DQ1 A;  4MZU A;  4QX5 A;  5A3U A;  4XW3 A;  2VO5 A;  3NV4 A;  2YB7 A;  4KU7 A;  3N36 A;  1J1T A;  1XU2 A;  2EXK A;  2WWU A;  4OYU A;  5JIA A;  5LAS A;  4ASM B;  3O1M A;  5LA9 A;  4CUA A;  2ZZQ A;  3ZKY A;  4YFZ A;  3HT2 A;  4ARX A;  1G9A A;  1CIY A;  2J1V A;  1HB1 A;  3EQE A;  4LK6 A;  3USU B;  5LW9 A;  1W28 A;  3RI8 A;  1PGW 2;  3KV9 A;  1XPW A;  4GMP 0;  3JU9 A;  5FP8 A;  4OHZ A;  1MR5 A;  4PHZ A;  5CFC A;  4ASK A;  4BQ2 A;  1I5Z A;  2OZJ A;  3ZXJ A;  5I0T A;  1V6J A;  4YRD A;  4OUE A;  1ODN A;  1U5I A;  4FP3 A;  2PA7 A;  1GZ9 A;  2W52 A;  3J7M A;  3HNM A;  4X8N A;  1SMV A;  3ETP A;  4AFB A;  1C3H A;  3FMG A;  2XJV A;  4JHZ A;  4OVE A;  3O14 A;  2E7Q A;  1NCR B;  3CJI A;  1VBC 3;  3LA3 A;  4S2H A;  3T0A A;  4WM7 A;  4CCL A;  4LKD A;  1AYN 3;  2VZP A;  2VQ0 A;  4MHU A;  1DCS A;  3Q8C A;  1VBB 1;  4GH4 C;  3TRS B;  3VKF C;  4ONU A;  5JOY A;  4NIH A;  1GQG A;  4ZU4 A;  5GZG A;  4IV1 A;  1H4H A;  1BCX A;  2XLG A;  4RD7 A;  4N7I A;  1ONA A;  2GMM A;  1DLL A;  5FYI A;  5HV0 A;  1RJ8 A;  4DXT A;  4CXW A;  2YUE A;  4AQ6 A;  4Y1X A;  1WWY A;  2PYT A;  3H1M A;  4LBJ A;  2CSG A;  3S0M A;  3AXD A;  4ZHN A;  2Y38 A;  4QB1 A;  4ZXE A;  5BY5 A;  4RHV 3;  3CKH A;  2ID4 A;  1OLR A;  2WNU C;  3DGT A;  4CEY C;  2BVB A;  5K0U A;  2BBA A;  1ND2 C;  1VB2 A;  3WLU A;  3VBR C;  3OGV A;  2WO2 A;  2B8M A;  4BCU A;  1ZBE 3;  5J48 A;  3HD8 B;  1WCQ A;  3J7N A;  3VDD A;  1KRI A;  1HRI 2;  4Y5Z 0;  1JU3 A;  5LA2 A;  1UY1 A;  5C9A C;  2W94 A;  5KHH A;  1S0J A;  4ORF A;  5IK5 A;  4BQW A;  1JU4 A;  4YZ4 A;  1DYO A;  3DPR B;  3ZYR A;  2D6M A;  2BP6 A;  2GP5 A;  2OPW A;  3CQO A;  2I74 A;  4ZY9 A;  4FPC A;  3THT A;  3WDY A;  4B1L A;  3RWK X;  4COW A;  3NAP A;  1GSL A;  2TNF A;  3K48 A;  4P00 B;  1IPS A;  2HWE 2;  1DFQ A;  4MXW A;  3TWI A;  1PX3 A;  1H6Y A;  4ISR A;  2YMZ A;  1JZ4 A;  3T08 A;  1XNA A;  2V09 A;  3A21 A;  4CCN A;  1PO2 3;  2VZV A;  3MV1 1;  1W9T A;  2HBT A;  4YZ5 A;  3DUI A;  4FPE A;  1GKB A;  1H8T C;  1GAN A;  3B69 A;  4RS5 C;  4HET A;  2SBA A;  2DUO A;  5L19 A;  2V5D A;  3WW2 A;  1RUD 2;  1LNS A;  1CAV A;  4B29 A;  2XJR A;  1R1Z A;  2EA7 A;  5E1R A;  4GB3 3;  5G05 L;  5FPU A;  4Y5T A;  4ZZ8 A;  1O8S A;  1LJ7 A;  3JB8 A;  3UJQ A;  1SFP A;  1W8T A;  1LOE A;  1W9S A;  2MEV 2;  4HKW A;  5FYS A;  5FP7 A;  5FY8 A;  2FZ2 A;  2NMO A;  5T50 A;  1RIN A;  1QF3 A;  5EPA A;  2ZGT A;  4L0P A;  3NQH A;  5JPN B;  1VAL A;  4N9H A;  4ATF A;  1I9R A;  4AED B;  1WA4 A;  4PDW A;  3DXT A;  2R7E B;  1AJK A;  4HKO A;  3S5A A;  1RUH 3;  2X29 A;  2WZR 2;  1YO8 A;  2DU0 A;  4MO3 M;  2FMD A;  3HN1 A;  1QOO A;  1LOA A;  1W2T A;  1PZ8 A;  4NWW A;  2KA3 A;  3EYP A;  3KS7 A;  4FFH A;  1RJ7 A;  4XCB A;  2RS5 1;  5DUU A;  1OSG A;  4J1W A;  2Y64 A;  5FYC A;  1DU3 D;  2D98 A;  4GIQ A;  3VBU A;  1XBF A;  1QJX 3;  2C5D A;  3H3U A;  3KF5 A;  4JRA A;  5ABJ C;  4M3C E;  5D8A B;  2YFZ A;  1ND3 C;  4D0Q A;  2IUW A;  5FMB A;  4DUV A;  3R6S A;  1HN1 A;  4COY A;  4BXS V;  4UBH A;  2XVK A;  2OPK A;  3JB4 C;  3K4A A;  1OOP C;  3L9J T;  1DF0 A;  1KJL A;  1BEV 1;  1GOF A;  1QJY 3;  3J4U H;  3VBF C;  5FYB A;  1SCR A;  2AR6 A;  4KWU A;  4R4Z A;  5HBA A;  4AR2 A;  4U2A A;  1Q8S A;  2BV4 A;  3ABZ A;  4Z8B A;  4NE9 A;  3CU7 A;  2BQP A;  1GP5 A;  5A7W B;  2D93 A;  2XPJ A;  5FKB A;  2BFU S;  2Y6L A;  5F3E A;  3BTY A;  1YXW A;  4BHP A;  1SLT A;  1R08 1;  2J1T A;  1CJP A;  3T30 A;  1LOG A;  4K1Z A;  5F3C A;  2PAK A;  3SIS A;  4COZ A;  3PUH A;  4K9S A;  3PNA A;  3ZSK A;  4MV2 A;  1Q8P A;  2QQL A;  3LEI A;  1A34 A;  5FFO C;  1X33 A;  4EZ4 A;  5FPL A;  1AJO A;  2CDP A;  1V9U 1;  4FP2 A;  3GAL A;  3WV6 A;  3AYA A;  4IEV A;  1OQE A;  1VBC 1;  3UKT A;  2ZGR A;  5CIS A;  4GKY A;  1UQX A;  1E5H A;  4P14 A;  1WLC A;  2QQO A;  1AL0 G;  1WD4 A;  1FPN 3;  3MIF A;  4Q1R A;  3J8F 2;  5F5Q A;  5SV5 A;  5A1A A;  3PUQ A;  1F5J A;  1OKQ A;  4CU8 A;  1GWK A;  2CV6 A;  3WNL A;  1AVB A;  2O14 A;  1GNZ A;  3HBK A;  4OUM A;  3OGG A;  3S6P A;  3AZZ A;  2J42 A;  1WLT A;  2VMH A;  2VZQ A;  3LSE A;  1NUK A;  4Q4X 2;  1OKO A;  2K46 A;  2GNT A;  3EMR A;  4Q26 A;  2Z5W A;  1EUU A;  4I09 A;  1FAT A;  3BU7 A;  4NJ4 A;  1HXS 2;  2Y6F A;  1RVF 2;  1O3Q A;  2ZHK A;  1S0G A;  1H1I A;  4HN1 A;  5APA A;  3THD A;  3H8X A;  2QTW B;  1QWR A;  4ZU5 A;  3WW3 A;  1NCR C;  4PT6 A;  5FYZ A;  3PME A;  3KHC A;  2XBO 3;  3MIH A;  1K5M B;  1ZBE 1;  2WNV A;  4Q0U A;  4AI2 A;  5FMO S;  3VUO A;  3E5X A;  5H9R A;  3LPF A;  3W59 A;  3I2I A;  4AFA A;  2VUA A;  1W6N A;  2WN2 A;  1UY0 A;  4BDV B;  1KJR A;  4YM1 A;  3VGI A;  3MUZ 1;  2XOM A;  1UD1 A;  4TN7 A;  4YW2 A;  4CU7 A;  1L7R A;  1V6M A;  2YHJ A;  2Q8C A;  5KXD A;  3BIE A;  1HLC A;  2XB6 C;  4QHB A;  2WIN B;  1UXZ A;  4D6R A;  1CJD A;  5JAX A;  3U37 A;  2WC2 A;  2XUM A;  3VBH B;  5JXJ A;  2ZXQ A;  1LGB A;  3ZFE C;  2CGP A;  4W6Y A;  1YRZ A;  1VBD 2;  3VBO B;  1EP0 A;  3U78 A;  3MID A;  3JQW A;  4IV3 A;  1GZC A;  2JG9 B;  3DL3 A;  4YVW A;  3VZK A;  1FMD 3;  2UWC A;  5F5I A;  1XNC A;  1SBD A;  3HBZ A;  4LIV A;  4MGI E;  1UY4 A;  2Y8K A;  4TXW A;  1UY3 A;  3RYK A;  3WXP A;  5CIR A;  3WF3 A;  4YW1 A;  1XSQ A;  3LFM A;  4GB3 1;  4LO6 B;  5KHG A;  1GP4 A;  4JKM A;  4TSV A;  5GLW A;  2W2I A;  1TQ5 A;  3DPR C;  2BW8 A;  4NRO A;  3VDC A;  5FZE A;  2Y0O A;  1ENQ A;  5C4W A;  1GP6 A;  3MIB A;  3C7H A;  2VD7 A;  2CWM A;  1MZE A;  4LO4 B;  1G7Y A;  4XBQ A;  4MX3 A;  1I3H A;  3KQ4 B;  5C8W A;  1BVP 1;  5DMY A;  1UCX A;  1RUH 1;  3PTR B;  3H9A A;  3AL5 A;  3I3E A;  4Z1V A;  1W0N A;  2XJS A;  4QKF A;  2WQ4 A;  2VH9 A;  2XJT A;  3SQO A;  3BCW A;  4XQD A;  5A33 B;  5A3M A;  1LTE A;  2KR2 A;  2R1B A;  3JUU A;  1XC6 A;  3S5Q A;  2BYV E;  2HWB 3;  4XMA A;  4AVA A;  3T09 A;  4R8H A;  3I49 A;  4XUP A;  4RSU A;  5FLJ A;  1QJX 1;  5FZ6 A;  3NNG A;  1ZVF A;  1H8V A;  1W03 A;  1CAU B;  3UGG A;  1DG6 A;  3VBS B;  4N90 A;  4H55 A;  4LBL A;  5FXW A;  4UT5 A;  5C3Q A;  3HIF A;  3G6J B;  4IQP A;  4TTG A;  3WF2 A;  1DHK B;  1LEN A;  1YEW A;  4A41 A;  4AED C;  2IFR A;  5TSW A;  2BJS A;  1QJY 1;  3ZFG B;  1MS1 A;  4QD2 A;  4HVR A;  4YW3 A;  4Z07 A;  1A8D A;  3K4D A;  3DXU A;  1R08 2;  4FPK A;  1OVP A;  1NE6 A;  1LOF C;  4P9J A;  3RFR A;  1R09 3;  3FHQ A;  3BIW E;  4RR3 B;  4CDW B;  4AFC A;  4DRV A;  1JOP A;  3U75 A;  2E6V A;  2XML A;  4A42 A;  1AR6 1;  1V9U 2;  1W05 A;  4OI1 A;  3ZSL A;  1GWL A;  3AP7 A;  5G04 L;  5D8A C;  3RJR A;  2WDB A;  4FO9 A;  2G9G A;  3C7F A;  2TBV A;  3SCH A;  4D6Q A;  2ZMK A;  4LUK A;  5EJ1 B;  1H1A A;  1US3 A;  2HWF 3;  1QY4 A;  1W8U A;  3WF0 A;  5H9P A;  3AB0 A;  3O1O A;  5E6H A;  4NWV A;  2EF6 A;  4W6W A;  2IXJ A;  2H6C A;  4KGQ A;  4XFH A;  1Q8O A;  3AZW A;  1M4W A;  3KB5 A;  3ON7 A;  4E2S A;  1PGL 2;  4A2U A;  2GNB A;  3H8U A;  3VD4 A;  2FD8 A;  2IXC A;  4DEQ A;  2ZX0 A;  5A3N A;  3NL1 A;  4FOY A;  4BQ3 A;  5AFB A;  4LOR A;  5EJ3 A;  1FPN 1;  3UKV A;  4A7Z A;  3NWK A;  4CE8 A;  4N8M A;  5A1L A;  4K21 A;  4FQZ A;  3OBR A;  4AVS A;  4ASL A;  2GN7 A;  4BQ1 A;  3IT8 A;  2RMU 3;  2VZR A;  2WNO A;  4UFK A;  1KD7 A;  3UK9 A;  3UL2 A;  2J1S A;  4ZZ5 A;  4W4Z A;  1PMI A;  4XJ8 A;  4A6S A;  4E2Q A;  5IK7 A;  3M8L A;  3ALQ A;  2WAB A;  2V4A A;  1X8M A;  1PK6 B;  5KWR A;  2ZGO A;  2ERF A;  2GC1 A;  3OBZ A;  1VBA 2;  2GC3 A;  2XBO 1;  3LQC A;  2AEY A;  4JGZ A;  4W6X A;  3V56 A;  1OH3 A;  4XDO A;  2ZOE B;  1NY7 1;  1RHI 2;  3PVN A;  4OI4 A;  2R04 3;  4ZKT B;  4CTE A;  1Z7S 3;  1W8W A;  3IM0 A;  3V0B A;  3ENR A;  4FOV A;  4D94 A;  1K45 A;  3NNM A;  2FZ1 A;  2W5F A;  2DUQ A;  5A6X A;  4QXC A;  1CPN A;  4S2D A;  4YVS B;  1VRH 3;  3TBD A;  3LDR A;  4RQP B;  5BYN A;  2AEN A;  1LOC A;  1CIW A;  1RUC 1;  4Q29 A;  5AVP A;  5FZC A;  2WWJ A;  5EYX A;  5FYH A;  5FYU A;  1V6N A;  1LU2 A;  3N9L A;  4GB3 2;  4KG8 A;  1LUL A;  2NP0 A;  5IUQ A;  2FDI A;  4DQA A;  3I2G A;  1DP0 A;  4I0B A;  1AYM 3;  5EJZ B;  2Z42 A;  1FMD 1;  4Y1Y A;  2CY6 A;  2DCY A;  3JBG 1;  1K5M C;  3HPN A;  2NZ9 A;  4RFT 0;  3I3M A;  4E9K A;  4WZC A;  4CUG A;  1COV 2;  4HFS A;  4CP9 A;  1B35 B;  3POF A;  1SPP A;  1UXX X;  2R06 3;  2Y33 A;  1RUH 2;  4B7E A;  4MOA A;  3WQ0 A;  2BEO A;  1MEC 1;  1RUJ 3;  3SKJ E;  3THC A;  2VAU A;  1WA6 X;  4IEZ A;  1C8M 3;  1OUX A;  1TMF 3;  5DPN A;  3LSD A;  4I02 A;  5IFP A;  3WDU A;  3FZ3 A;  1BYH A;  4TLG A;  2VNO A;  4NHL A;  2Z2S B;  5LY2 A;  3ACI A;  4UI9 L;  4QPG B;  3VBH C;  5C5U A;  1OMI A;  3PVO A;  5FZ4 A;  1JZ2 A;  2DCK A;  2E53 A;  3M3O A;  4NII A;  3MPB A;  1FAY A;  3U4S A;  1C28 A;  3VBO C;  3WD5 A;  4CXX A;  5D21 A;  3U4X A;  4WVM B;  2FMY A;  2JG9 C;  2PAE A;  3GZU C;  2JEM A;  4JGY A;  4Q1P A;  4QXB A;  4XOG A;  3A4U A;  5IVV A;  3U14 A;  2HWB 1;  2XKP A;  3DN7 A;  2JDZ A;  5FMD A;  5JIU A;  2LRP A;  1QXP A;  3FLP A;  1AXY A;  2HEW F;  5LB6 A;  2WFF 1;  2A5Z A;  1EV1 2;  3K2O A;  1TE1 B;  3WF4 A;  4Q4W 3;  4PIY A;  3HNB M;  3OPT A;  2W9X A;  2K0G A;  3MW4 A;  4GQ7 A;  4Y33 A;  5D1I A;  5FLI A;  4GUL A;  4BQ4 A;  4QB6 A;  1AR6 2;  2CYF A;  1G9C A;  1O3T A;  3BOD A;  3MW2 A;  5FO9 B;  2ZGS A;  2ZML A;  3I2F A;  4OLL A;  5EHD A;  1FX5 A;  3ECQ A;  4NRP A;  4WM8 A;  5FYT A;  3TN9 2;  3D3A A;  1FXZ A;  5F2W A;  1LAJ A;  1R09 1;  1NCQ A;  3IWZ A;  2VUC A;  4IE6 A;  2LTN A;  4YPJ A;  2D6L X;  4AVV A;  5JOZ A;  4J25 A;  4QHO A;  3K51 A;  3AK0 A;  5BNO A;  3P5B A;  2YPD A;  4BIO A;  3HEI A;  4MAD A;  3E6D A;  5A6Q A;  2VJX A;  2WS9 3;  2ZPX A;  4HKL A;  4P9Y A;  4PF1 A;  3RWN A;  3ZM8 A;  1JI6 A;  4C91 A;  5KHJ A;  2MPF A;  3GZA A;  5FZ9 A;  5GJ6 A;  3VBS C;  4TLF A;  2WYS A;  4IXL A;  4NHM A;  2XKO A;  1FPN 2;  2HWF 1;  3WW4 A;  3MV0 1;  4QQH A;  4HAN A;  3W20 A;  4KWK A;  5C3R A;  1CGP A;  2ZGP A;  1S0B A;  1W6Q B;  2EXJ A;  3AKS A;  3T1L A;  3ZFG C;  4P9L A;  3ZIX A;  5LZ6 A;  1XYO A;  3CF6 E;  5C8C B;  2XUE A;  3LKJ A;  2WL1 A;  4RR3 C;  4CDW C;  5FMC A;  2R30 A;  2QFE A;  2RM2 1;  2XON A;  3RNS A;  1O7F A;  3VZL A;  3BTA A;  4O9G A;  2GND A;  4KBZ A;  4FOW A;  2Q1Z B;  2VZT A;  3OGJ A;  1NAE A;  3EB7 A;  4BK4 A;  4QDR A;  2JB4 A;  2RMU 1;  4JTO A;  2H0B A;  4Z2W A;  4KBB A;  4B3N A;  1DZQ A;  1UOB A;  4PIZ A;  2OKX A;  3O1P A;  3O1T A;  1MAC A;  4Q5O A;  1ULD A;  1IS3 A;  2J1A A;  4QPI B;  3PL0 A;  1GZW B;  2E7T A;  3D8C A;  2E26 A;  3LZZ A;  4NO4 A;  3VL9 A;  3ZSJ A;  1UZZ A;  2JDM A;  1BLZ A;  3RZJ A;  2HJI A;  2A73 B;  2XL9 A;  5FR3 A;  3D0J A;  5ACA 3;  5CA6 A;  1VP6 A;  4YLZ A;  4BH9 A;  1G86 A;  2W3J A;  1RUC 2;  5T52 A;  4AXO A;  1D0H A;  1IZ3 A;  2ZS6 B;  2QQV A;  5FZM A;  1C8N A;  5L7O B;  2EXI A;  4FQ4 A;  2ZGN A;  5GKA C;  1OC1 A;  3RZM A;  3WEZ A;  4CDQ B;  1ZX5 A;  5A32 A;  3JBG 2;  1UZY A;  1VRH 1;  1C57 A;  1REF A;  4LO5 B;  3WOG A;  3MLJ A;  4AI1 A;  5HI0 A;  1T2X A;  3BKZ A;  1F35 A;  4D8M A;  1NXM A;  2WBK A;  1S2B A;  5L9V A;  1W3V A;  1VAV A;  4FFG A;  1JBC A;  1XYN A;  1MEC 2;  1PK6 C;  3PIJ A;  3THP A;  2IC1 A;  1AYM 1;  1SFY A;  5DN2 A;  4CUB A;  5T5P A;  3PJY A;  3N4M A;  1W99 A;  2QKD A;  1N1T A;  4LXL A;  1N1Y A;  3Q8F A;  4XFC A;  1J3R A;  2YC0 A;  3POS A;  4XYX A;  2UY8 A;  1OPM A;  3AYD A;  3NRU A;  3NJZ A;  1HB4 A;  4DRR A;  4BB3 A;  1VMH A;  1W04 A;  2VU9 A;  1YLL A;  3AP5 A;  5FRE A;  4RA0 A;  3H8O A;  2R06 1;  5T5O A;  1Q5O A;  5DQ0 A;  1JYV A;  1C8M 1;  2ZGM A;  4ET7 A;  1TMF 1;  1VBE 2;  1IPJ A;  1UX7 A;  1YWK A;  2HWD 3;  5ANN A;  4RQP C;  2VTX J;  1SLL A;  4Q4Y 1;  1W9F A;  4NR1 A;  3RMY A;  3O1S A;  1TNR A;  1TG7 A;  3I3B A;  5CNA A;  2RDN A;  3WT3 A;  4S2F A;  3S30 A;  4LTA A;  2NPI A;  3B9C A;  1QH6 A;  2PTM A;  4Y4Y A;  5DAV A;  2VNG A;  3RI9 A;  4FPG A;  2WFF 2;  3IDC B;  2Q4S A;  2BZD A;  2WKK A;  2WZ8 A;  4LKF A;  3I2O A;  3H3Z A;  4BQ5 A;  1A78 A;  3A22 A;  4CRQ A;  4Q0S A;  2A6W A;  5IK8 A;  3CO2 A;  1B35 C;  3RYP A;  1LED A;  3HQR A;  2WII B;  1SBE A;  3OYW A;  4QDQ A;  4A3Z A;  4AYU A;  4GH4 A;  2J7M A;  1OI6 A;  3POB A;  4YW6 A;  3NJV A;  5CKN A;  1NLS A;  4FXK B;  5JSR A;  1LHO A;  1YQ8 A;  1W9Y A;  3I59 B;  1OQ1 A;  4QGM A;  4CP1 A;  2XHK A;  4QPG C;  2W47 A;  3I2J A;  3PUI A;  3NAP B;  5FZ8 A;  5BV6 A;  3ZOI A;  3ST7 A;  5A3O A;  2FCT A;  1C1L A;  4Q0Q A;  3AZV A;  3T4H B;  2RS1 2;  3KMH A;  2VZ1 A;  4I3G A;  1XNK A;  4WV8 A;  2XQX A;  3INA A;  2ADD A;  5AVA A;  3ZFF A;  1RC6 A;  1YYN A;  1UZV A;  5K7P A;  5KHK A;  1ND2 A;  1W8O A;  1WCD J;  4WZF A;  1PIV 3;  1AR7 3;  4NHK A;  3VBR A;  5FOB B;  4MGQ A;  2AUY A;  2IWG B;  3U10 A;  1K5J A;  1X50 A;  4M4P A;  3NJY A;  3QH7 A;  4LQR A;  1FI2 A;  1ZZ7 A;  1AL2 3;  1YQC A;  1B09 A;  1OF3 A;  4JRL A;  4LBQ B;  5B4X A;  3BI3 A;  5C9A A;  2XQR A;  4XJZ A;  4HVQ A;  5CFD A;  4QX8 A;  1H2N A;  2I07 B;  2X10 A;  2JDU A;  5A3L A;  1SG3 A;  2RM2 2;  3WY6 A;  2B39 A;  4R9B A;  5FQ0 A;  1JUI A;  4M4R A;  4IGP A;  3GHN A;  4PQ9 A;  5DUW A;  1OLM A;  3FLR A;  3WQB A;  5JI9 A;  5FZ1 A;  4DUW A;  1Q3E A;  2XH6 A;  2VMD A;  2D6P A;  1UU4 A;  2Y6G A;  4YGB A;  3ZYP A;  3MLL A;  4PDW B;  1NQD A;  4GAL A;  3IB3 A;  1UMZ A;  2PLV 3;  4XPV A;  2VCM A;  5CVR A;  1BJQ A;  4LPL A;  3FUQ A;  2DUP A;  4KL1 A;  1CES A;  3FFZ A;  2VG9 A;  1Y9M A;  5C71 A;  1XNT A;  5CAD A;  1E57 A;  1H8T A;  1Y3T A;  2P6C A;  4RS5 A;  5M0T A;  3GNE A;  4L92 A;  2KM2 A;  1PO1 2;  3A7Q A;  1H0B A;  1WBF A;  3LWC A;  2VVD A;  1KS4 A;  3AMN A;  5FRA A;  2DTY A;  1AR9 1;  4HSJ A;  2OII A;  3I3Q A;  2W91 A;  4LHN A;  1N3O A;  2W08 A;  5FZO B;  4AL9 A;  4Q4V 2;  1NG0 A;  1QXJ A;  1STM A;  1OQD A;  1SEF A;  3UGF A;  1SLA A;  1HV1 A;  1H9W A;  5FLH A;  2UY9 A;  5JMC A;  1RB8 G;  3VKO A;  2PHT A;  2OVU A;  4G4F A;  4IER A;  4GXL A;  5C8C C;  4PLO A;  4AHY A;  1RMU 1;  3POW A;  5ACA 1;  1E5R A;  1V6L A;  3D82 A;  2GZW A;  5FUI A;  3ZFE B;  2RS3 2;  2B45 X;  3ILR A;  3U11 A;  1VRB A;  4E4S A;  4UYB A;  1JYX A;  3OBT A;  2YU1 A;  3KT4 A;  5I0U A;  4DB5 A;  4DY3 A;  3ACF A;  3B94 A;  3AL6 A;  1LRH A;  1EAH 3;  1J3P A;  1CD3 G;  1UIJ A;  5IYY A;  3AMP A;  3FBY A;  3T2P A;  4AGV A;  4H3W A;  1RGS A;  4CDU B;  2DVG A;  5ABJ A;  2VNR A;  2OYZ A;  5C3S A;  2K9Z A;  3BVC A;  4BXF A;  1ND3 A;  5L36 A;  4K8R B;  4AFM A;  5BNP B;  1ZZ9 A;  4QPI C;  3ES4 A;  1E5S A;  4LLF A;  3GBW A;  5FWE A;  1VMJ A;  3N9M A;  4HZF A;  1GMM A;  3PHM A;  3J7L A;  4CVU A;  1QJU 3;  1YI9 A;  1VAK A;  1ASJ 3;  4AWD A;  2PXJ A;  4IE5 A;  2HBU A;  3WNN A;  1OOP A;  2N7G A;  3KGZ A;  4HK9 A;  5FYM A;  3VBF A;  1V0A A;  2CL2 A;  4Q4Y 2;  1J1L A;  3MF9 A;  5I0S A;  5FYV A;  4CEW B;  3RGB A;  5ANQ A;  5T5L A;  1A6C A;  4GJY A;  4OMD A;  3VD7 A;  3VZO A;  5L7O C;  1F8V A;  2IXH A;  5HCF A;  1DGR N;  2XWJ B;  4MGZ E;  1TME 2;  4PLN A;  4CDQ C;  1CQ9 A;  4GZ9 A;  2J22 A;  4N43 A;  2WRA A;  2YV8 A;  4M3C B;  4XC9 A;  4DXS A;  5ISL A;  4C8D A;  1TEI A;  4CDX B;  3IBM A;  5EWS A;  3I7D A;  3I4I A;  4IGO A;  5DDJ 3;  5F6K A;  1MVE A;  1PMH X;  5IVY A;  3E5U A;  4XJU A;  2R07 3;  2W1U A;  2EIG A;  2ZMN A;  1F2N A;  3OSD A;  2ETE A;  3WHU A;  1A8M A;  2DFC A;  1ZRC A;  5JVV A;  4HBN A;  2L9L A;  1BBT 3;  1R1A 2;  2VE1 A;  2ZEX A;  3VZN A;  1QQP 2;  3JD7 3;  5LBE A;  2WLP A;  3ZX7 A;  3AJZ A;  5JPM B;  4XZP A;  1XRU A;  1BK1 A;  3IMM A;  2ZAH A;  2OT7 A;  5LWB A;  2CAV A;  3BN6 A;  5LK7 B;  3USU A;  1O3S A;  3ACH A;  3ES1 A;  4JDM A;  2G9F A;  4DY5 A;  2FDG A;  3OCP A;  5F32 A;  2RR1 3;  4EN7 B;  4XF4 A;  4FXG B;  1ZRI A;  3LAG A;  3IPV B;  5FZ3 A;  5F5C A;  3K3N A;  1W2N A;  4O7X A;  3DEC A;  2ORX A;  3I2K A;  1PVC 3;  1D4M 3;  2VXR A;  4AVB A;  3MFC A;  3MI8 A;  1LEM A;  1IKQ A;  4RGK A;  1Z0H A;  2JDY A;  3KVB A;  4AI9 A;  2P3K A;  4BM8 A;  3OTF A;  5IVF A;  2WSU A;  4KMQ A;  3M4F A;  4CSW A;  1NCR A;  4D6S A;  1PIV 1;  1AR7 1;  4BQY A;  5I8T A;  1BMV 1;  1JN2 P;  4NAM A;  3ETQ A;  4IEU A;  1QH7 A;  4OMC A;  1LCL A;  1VR3 A;  3POI A;  4XIL A;  2HWC 3;  2BNN A;  5LBC A;  3AVR A;  3SXW A;  3TB0 A;  2BBV A;  3FHA A;  2X09 A;  2XGX A;  4AAX A;  4QM8 A;  1DGL A;  1SHW B;  1HRV 3;  2GH2 A;  4M00 A;  1CZS A;  1WGP A;  2A3Y A;  4D7T A;  2W92 A;  3C7O A;  1AXZ A;  2DWR A;  3ZVX A;  3BOP A;  3W21 A;  3U0Z A;  1GR3 A;  3NAP C;  2PHL A;  5GLT A;  3MLK A;  4F3J A;  2JDA A;  1AX1 A;  2X5I B;  3LEM A;  4DXZ A;  3M1H A;  5FOJ B;  5GLV A;  4LEJ A;  1VBB 2;  2A6Z A;  2PLV 1;  2C9K A;  3B02 A;  1AR9 2;  2DUR A;  5J7M A;  3O1V A;  3T4V A;  2OA2 A;  3M7A A;  4NN0 A;  4MH0 E;  5A3P A;  4MVT A;  2IZW A;  3TNP B;  4JHT A;  3WG4 A;  1W8F A;  1YI7 A;  2B9V A;  2JD9 A;  2R6Q A;  1W6M B;  2VMI A;  3KVA A;  3ZXA C;  5KXB A;  1HJG A;  1AYN 1;  1W90 A;  2QQP A;  2IVJ A;  3O1U A;  3KWV A;  2ZTN A;  1PM7 A;  2CWS A;  5K8S A;  1RMU 2;  3D0S A;  1HB3 A;  2E9Q A;  2WA4 A;  1PZ9 A;  5IVB A;  5LBB A;  3DPR A;  2D6N A;  2R0F A;  1LHU A;  5DUX A;  2ZX4 A;  1NT0 A;  5LA1 A;  1QOT A;  1RL3 A;  4HMZ A;  5FK7 A;  3ZKU A;  1NE4 A;  1LES A;  3PUR A;  3A0N A; 
#chains in the Genus database with same CATH homology
 5EPA A;  2HBU A;  5IAV A;  5LBF A;  5A3U A;  3KT1 A;  3HQR A;  5LAS A;  4NHM A;  4UWD A;  5LA9 A;  2RDS A;  4XCB A;  2V4A A;  3W20 A;  4MHR A;  3OBZ A;  4XC9 A;  4JZR A;  4BQX A;  2FCT A;  5L9R A;  3OUH A;  2RDQ A;  5IAX A;  5EP9 A;  5ERL A;  4KBZ A;  4NHK A;  3NNM A;  2G1M A;  3KT7 A;  2FCV A;  5LBE A;  2RDR A;  4MHU A;  4Q5O A;  4Y5S A;  3GJB A;  3PL0 A;  4ZON A;  3NNF A;  5DAQ A;  4XCA A;  5DAP A;  5HV0 A;  2Y33 A;  3NNJ A;  3HQU A;  3OUI A;  5M0T A;  4BQY A;  2FCU A;  4NHX A;  4NHL A;  2JIJ A;  5C5U A;  3OUJ A;  4IW3 A;  3GJA A;  5LBC A;  5C5T A;  5L9V A;  4BQW A;  2OPW A;  5EQU A;  3W21 A;  5DAW A;  3ITQ A;  3EMR A;  2Y34 A;  4XAA A;  5LB6 A;  5DAX A;  3GZE A;  2HBT A;  3KT4 A;  4NAO A;  4NHY A;  3NNL A;  3DKQ A;  3MGU A;  4XAB A;  2RDN A;  3BVC A;  5LAT A;  4Y5T A;  4XAC A;  2RG4 A;  2A1X A;  5L9B A;  4NMI A;  5DAV A;  5LBB A;  2G19 A;  4J25 A;  5HV4 A;  4ZPI A;  5IAT A;  2JIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...