2JX9A

Solution structure of the gal_lectin domain of mouse latrophilin-1 gpcr
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
106
structure length
106
Chain Sequence
GLPFGLMRRELACEGYPIELRCPGSDVIMVENANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQRCNNRTQCVVVAGSDAFPDPCPGTYKYLEVQYDCVPYKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, signaling protein
molecule keywords Latrophilin 1
publication title Solution structure and sugar-binding mechanism of mouse Latrophilin-1 RBL: a novel 7TM receptor-attached lectin-like domain.
rcsb
source organism Mus musculus
total genus 16
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02140 Gal_Lectin Galactose binding lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.740 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jx9A00
2JXAA 5FTTC 2ZX1A 2JX9A 2ZX4A 2ZX2A 2ZX0A 2ZX3A 5AFBA
chains in the Genus database with same CATH superfamily
4IE0A 2QNKA 4B4PA 4LEJA 1SACA 1SLLA 3WINE 4QQLA 5DZEA 1ZRFA 1PMJX 1I5PA 3KGLA 3BALA 3KVAA 1NY71 1OMIA 1NX9A 1RIRA 1UMIA 4ZU5A 4M0NA 1XC6A 1OLQA 5LA0A 1MQTC 1Q3EA 4GH4B 2W9XA 2VW1A 5A32B 3VD3A 3ZN6A 2VUCA 1Z0HA 1SLCA 1R091 3WW3A 2DVAA 2WBKA 3OPZA 2VMGA 5D8AB 1W6MA 3WF4A 1W9FA 3VKOA 2PN5A 1ZBE2 1SLIA 1W0OA 2CAUA 4W6YA 3H42B 5IJRA 1QQP3 4YM0A 4DZGA 3K4ZA 3T0DA 4XW3A 1BMV2 5A7QA 2G4IA 1CJDA 1Z7S1 2VTXA 4IV3A 1QJEA 4K6BA 5ABJA 3SCGA 2ORXA 2R1DA 4XABA 2YMZA 4AQ6A 2JKXA 2V09A 4NIHA 1H9WA 4M01A 3IDAA 2GALA 3HPNA 1W03A 2J1EA 3WQ7A 1NQJA 2AZ5A 1R093 3C7HA 5DAQA 2V5DA 3ZVXA 3NV1A 4RD7A 3VBHB 4Y20A 1ND2A 1DHKB 4FPEA 1OFSA 4KBBA 3ZYFA 1X8EA 4Y5SA 3N9MA 1ULCA 2BZDA 2ZCWA 2VCBA 4IDZA 2DVBA 4BQ4A 1V9U1 5A1FA 2VZOA 1XE8A 4XQ4A 1D7PM 4TLGA 5ISLA 5B4XA 1FMD1 5JR2A 4Z82A 1QJX1 1S0GA 4CDWA 5JWPA 2ARAA 2RHPA 3U0ZA 1BLZA 2RM21 1Z7S3 1NCRC 2C5DA 4IL7A 4WVMA 3AKQA 2WFF2 2ZGMA 2E26A 3FWEA 1ZRDA 2WL1A 4CCKA 2IVJA 2LTNA 2EXIA 1ZRRA 2VW2A 1HRI2 3WHUA 4NMIA 3WF2A 2XWBB 1ULDA 2IXKA 4MGQA 1S2KA 4XPVA 4BZ4A 1OQ1A 3SQOA 3P3PA 3LSEA 3ZYGA 3UL2A 2BJSA 4QQ2A 2PA7A 4N53C 4YVWB 3BI3A 5K4LA 1EV12 2Y0OA 1A6CA 2EXKA 3A0NA 4JKLA 4BIOA 5FZMA 1V9U3 4QXHA 4XVHA 3WNNA 4BLJA 3VN4A 4CUAA 1PO11 1FMD3 1YCIA 3CNAA 2PAKA 1Y9MA 4QXKA 4QMAA 2OUJA 1HV0A 2RM23 4UYBA 4DEVA 3QOPA 1FXZA 1G6NA 4BQ1A 3OD0A 1NCQA 1CAXA 2BFUL 2R072 1S2EA 3RYPA 2XQXA 4NPLA 3N36A 1D4M1 2C1FA 2JE8A 4Z2WA 1YJLA 1T6GC 3WNLA 5A1AA 1OLRA 1UMZA 4AVCA 1T2XA 2PHUA 2AREA 2Y26A 3AP9A 4Q4X1 3BTYA 3OD4A 5DG2A 1W2OA 2CGNA 3MUZ1 4XBNA 5FXZA 3D5OA 4GZ9A 1PO13 2HWC3 5FYBA 3SITA 3ZFEB 2A6ZA 2P3KA 2ZGRA 3NMBA 2WUHA 1REDA 2VUAA 2XG3A 2PHRA 3I2OA 3VZKA 3GZEA 4D7YA 4FPLA 2OW4A 3K3NA 5K9YA 5FO9B 1TME1 2XJUA 1HXS2 1CAVA 1TQ5A 2BWAA 1VBD2 1UKRA 1VBA2 1ZNPA 2RS51 1RUC2 3DL3A 4MH0E 4Q4V1 1NXMA 4Q4X3 3DXTA 1LB2A 3S30A 1LGBA 2FCVA 5IVFA 4QX1A 1OSGA 1REFA 4DXRA 1Q5OA 5IVVA 2A70A 4XDPA 3GXUA 5E16A 4CSWA 1SBEA 3BOPA 5JDBA 1O7FA 4NROA 4Z2AA 2CDPA 5F9TA 4H55A 4LBQB 1MQTA 3OOXA 4Q0PA 3WY6A 1QJU1 2KM2A 3NNGA 5FPLA 2OS2A 3QH6A 1TME3 2VZUA 2PQSA 1WD3A 2JB8A 1NZCA 2YC4A 4CUGA 1RUD1 3FUQA 1LKNA 2P4EA 3Q8CA 1J3RA 4OI1A 3RI9A 2XR4A 1ZZ8A 3AVRA 3OB8A 4GB32 1W6PA 1AL21 2BBAA 2R061 4PHZA 1RXGA 1U5ZA 3I2HA 1B35B 2VUDA 2LRPA 3MIEA 3C7GA 3O7OA 4L97A 4N90A 4UI9L 2WNVC 4XUQA 1AR72 4RR3B 2D98A 4H7LA 5JI9A 1EUTA 1FAYA 3RZHA 1C1LA 4DPNA 1IS5A 1NLRA 3PUSA 3RMYA 4MGZE 2P2KA 3NV3A 4UW4A 2VVDA 1QJU3 2WINB 2P3YA 3H50A 3ITQA 5A33A 1YWKA 1IQDC 1WCQA 1RUD3 1C28A 1PGW1 2DFCA 4JGYC 5ACA1 5IFPA 3GBWA 2D5FA 4A6OA 1R1A1 2JG9C 4A42A 1CQ9A 5G04L 4KWUA 1AR61 1LOBA 1AL23 1PZ9A 1VMJA 2XJPA 2R063 3A21A 3PURA 1HQWA 1IS4A 3KB5A 4UOJA 3WV6A 4NHLA 1K5MA 4SLIA 5L73A 5JOWA 1ODMA 4NR1A 2YZ4A 3IAQA 2TUNA 1BYHA 1UAIA 3MO4A 3B3QE 2PHXA 1MVEA 4Y4YA 2BGPA 4R4ZA 3S7IA 1UIKA 2C26A 5FUNA 4YWAA 2DDUA 1QH7A 4BK5A 5T55A 4MX3A 3WG2A 4AEDC 4N53A 4LA3A 5ACA3 5JXJA 5FZ4A 4AVBA 2XJTA 1LHWA 4KWJA 4QB2A 2GMMA 4DOUA 3AYAA 1CIWA 4HMZA 4FCAA 1ZA4A 2E51A 3WG4A 1G9BA 2IC1A 3K4AA 3OBTA 2ZMLA 2Y0IA 1HKDA 1LCLA 4RS5B 2A3YA 5JPMB 2WWSA 4IEPA 1GOFA 3WP6A 2QJVA 3PUAA 4GWNA 3LB9A 5C3QA 1YXWA 1NT0A 4XF0A 1FI2A 1UMHA 3T1LA 4DFSA 4I09A 1XE7A 4K8RB 2XPJA 4I3GA 1SZBA 3ROUA 2L9LA 2GC3A 3DECA 4DRVA 2J1SA 5CEHA 4ZXEA 3ZR5A 2R041 4URAA 1W2AX 3BYWA 2WT2A 1H6YA 1ONAA 1J83A 3TEXA 3ZN5A 5E8AA 3DCQA 3IPVA 4BA6A 3UESA 3ES4A 4L9BA 3NAPC 5A3TA 3FBYA 4IEXA 4QKDA 2GNDA 1JOPA 3Q8AA 4Z07A 3VKMA 4M4RA 3PMSA 3SKJE 3N7LA 3ZN6B 2QTWB 3JB8A 4ET7A 4GWMA 3J7NA 2VO5A 3WDXA 3WF1A 1DLCA 1W06A 1W0PA 1LR5A 3LA7A 4FFIA 4ASMB 4JTNA 1MZ5A 3ZYJB 5FQ0B 1DLLA 4U36A 4MGIE 5A3UA 1MS1A 2R043 5I8SA 1NKGA 4LTAA 4NAMA 2BPA2 3J9SA 2FHRA 2VCCA 4C91A 1IPKA 3VZOA 4CCCA 2VZRA 3D6EA 3POGA 4CYDA 4OZXA 2A1XA 2PMWB 4YM3A 4J25A 3LQCA 2V72A 2G1MA 3JB4C 4RGAA 1NY72 1CONA 2PYTA 4JDNA 1QJY1 1HIXA 2P17A 3FMGA 1GZTA 1STMA 4HK9A 2B42B 3GZAA 3OBRA 4D7TA 1H4HA 5KHJA 2WO7A 1BVVA 3G6JB 1WMXA 5CG8A 4BQYA 1R092 2VG9A 1DZQA 3MDPA 1T6BX 3SCFA 4XJUA 1DBNA 1SDWA 3B00A 3ILNA 1WLWA 2QQIA 4IEZA 4MO3M 5F6LB 4JQRA 5FPAA 1RYYA 2GN3A 2VL4A 1JMUB 1YRZA 4G4FA 4CDWB 4E2GA 4OUEA 3BIWE 1FT9A 2WNVA 2QDNA 3JZVA 1GWLA 4WVMB 2UYAA 2PELA 2WYSA 3MI8A 2D44A 1AZDA 2JDAA 1SQ4A 4RHV1 2FMYA 1QJY3 1R64A 4FPFA 3U1XA 3BPZA 4QQPA 4K9SA 1N1TA 4XMIA 1BK0A 4M0HA 5LEKA 4LKDA 2AH2A 1O6UA 5A7WA 1YHFA 4IE6A 4JGYA 1N3QA 1WW7A 3AP7A 4IE5A 4M4PA 4MADA 4NHYA 4EWAA 5JLVA 4PQQA 4JQTA 1H6XA 1QXRA 5F2WA 2JG9A 2P6HA 2QQLA 4YNIA 3RFRA 3H1MA 4FBFA 4GXLA 4PT6A 3VDDC 1S4CA 1RUG1 2OKXA 2PAMA 3UK9A 4COVA 4LIUA 1QXJA 1N1YA 5KXBA 1QJX2 1CAXB 5FIXA 4ZS2A 3U78A 2EVXA 4NO4A 5A6YA 2RM22 4NHXA 1NUKA 2VQAA 3DF0A 5EYXA 1WA6X 2YGMA 1F5FA 2YPDA 5F5IA 3MZHA 2HJIA 2ZS6B 4RQPB 4R9BA 5HBAA 1ASJ1 1APNA 4GD4A 2OZ6A 4E8DA 3ETQA 3ZFGA 2WZPP 1X82A 2UWBA 5LBEA 2UU8A 4W50A 4AEDA 4I2OA 1AX2A 3VBUB 2C0ZA 5FYIA 4K7JA 2QQJA 3RDIA 1PX4A 2RR11 4F7ZA 1VMFA 4D94A 3J7LA 2VNOA 2HWE3 4A44A 1RUG3 1PO12 5CU1A 4P08A 1HB4A 4QU2A 2ZGLA 3KV5A 1FOD1 2F6BA 4EN9B 2BW8A 2VMHA 1OBNA 4XF1A 4CEYA 5BPXA 5FYVA 2NP0A 3GNEA 3P3NA 4UFMA 2ZX2A 1DQ1A 1CAVB 2B39A 5FBJA 3UV9A 3DPRC 4E4DX 1D4M2 4W6WA 1Q56A 3BCWA 1VE0A 5C4WC 5KXDA 3O5SA 1OUSA 3L2YA 1WUVA 4XBLA 3ILFA 4Q27A 2XVGA 3GF6A 1VBB1 4Q4X2 2XONA 4QGMA 3JUUA 4ATEA 1UL9A 2DCJA 3C7FA 3NAPA 1RUH1 3MICA 4LR4A 1LOGA 3KHBA 2V73A 4JHZA 4KGQA 4UW5A 4BQ5A 1GQGA 3UJOA 5JIUA 3VZJA 1MQTB 1FOD3 3D3AA 1QF3A 3RJ2X 5HCFA 4TXWA 3UJQA 4MVTA 1JZ8A 4AI3A 2UY8A 4KGGA 2GMPA 2JIGA 5FYZA 2YXSA 3GBFA 1IG3A 3GZUC 1WBLA 1O3RA 1S2BA 1TME2 1O4TA 1DGLA 4NHKA 5L7OA 3A23A 2HBUA 2CV6A 3ZYHA 3NJYA 1W6PB 1YEWA 2RS52 2P1BA 3C7EA 1VBB3 1ZZ9A 2VCMA 3J7MA 4Q4V2 4Y22A 4CXYA 1UKGA 4F8AA 2TBVA 2E7TA 1EPZA 1UU6A 4FSJA 4F83A 3LIHA 3WDUA 4QXBA 4NPMA 1RUH3 1WCDJ 4BCUA 1UYYA 3OGSA 5DXDA 5DDJ1 4HFSA 1MPXA 1OURA 4CU9A 5J7MA 1PZ7A 1W6QA 3NV4A 4W8JA 4COZA 5C9AC 1S0JA 3MFAA 1C3HA 4LUKA 2EAKA 1YI7A 5DAVA 2B7YA 1QJU2 1JZ2A 1CX1A 2H6BA 3L2HA 4G3YC 5LWBA 2ZEXA 4GQ7A 4CDXC 1JU3A 1LESA 4KWLA 1RUD2 2GN7A 4B7KA 2D3PA 4NRPA 1LGNA 3VHNA 3WW2A 4AEMA 2CYFA 4LO4B 1AL22 4HETA 2R062 4CCJA 1NCRB 3A22A 4IEVA 5DG1A 3PUQA 1ZREA 1UNBA 1FPN3 1ZA7A 3ZM8A 2HWD1 3WUCA 4A3XA 5DDJ3 4YZ3A 4PIXA 4BDVB 3W5NA 3N9QA 3V56A 1XNCA 1CZVA 1VALA 2Q5TA 4UFIA 5FAXA 3URFA 3ZXGA 4OVEA 1W8OA 4JDOA 4CVUA 5JUVA 4JTOA 5FZFA 4Y1XA 2K2SA 5IK5A 1OVSA 4IEQA 5FPZA 3INAA 2RDQA 4N53B 1ODNA 3D82A 3KHCA 1JHNA 3QACA 2XXZA 3GZTB 2FD8A 1PGW2 5ACA2 1VMHA 2DCZA 3FN9A 2ARXA 1F31A 3I59B 1R1A2 3X29B 3FL7A 3ILRA 4KWKA 2A6WA 2WSVA 3VDDA 2EIBA 1AR62 4FTEA 4K40A 2GMEA 3FHIB 2BVBA 1E5HA 3J26N 2HWD3 3T2QA 1LU1A 1UYZA 3VBRC 3POFA 1AUYA 4LHSA 1H8TA 1UCXA 5BXXA 1AYN3 1IS3A 4CCLA 4EWDA 2UURA 4MG2A 2ZGKA 1HB3A 2PAEA 1Q43A 3LPFA 3THTA 2I2SA 3MIFA 3U37A 1JYWA 4HN1A 1L7LA 2DVFA 3GCWA 3KQ4B 2ZHKA 3UETA 4MYEA 1UYPA 4S2GA 4UXAA 3UKTA 3LDKA 5GM0A 1ND3A 4J1XA 1M4WA 3TEYA 3VGIA 1H2KA 4EN7B 4FVVA 3DKQA 1KJRA 2WAOA 3GDBA 3J8F3 4JKMA 4AE2A 4QB6A 4YGEA 4DS0A 5HV0A 3AL6A 4PCRA 1XSQA 2VGDA 4GIQA 4YZ1A 5LEJA 4LKSA 1HJGA 2YC0A 5FDBA 2ZGSA 3FUOA 4E4SA 1OPMA 1SCSA 1JZ5A 3KS7A 4MUVA 4ZZ5A 2V4VA 1XB9A 3T08A 3PNAA 4LKFA 2FDJA 2WABA 3BTXA 4HK8A 3ZYPA 4KQ7A 4G9SB 4ATFA 3OBAA 5C4WA 3U10A 4BH9A 3ALQA 2PHDA 1ULPA 2ARBA 4Q4Y3 5DPNA 2LM3A 5T54A 2VBPA 1GZWA 2R042 2XJVA 5LBFA 5J36A 2XMLA 4FFGA 3AMQA 5F7UA 1ENRA 1XQNA 3KVBA 3CHXA 4FFFA 1MR5A 5T3NA 5HXVA 2JEMA 4HVOA 4KMQA 3ZDSA 4IE7A 4E9KA 1ZBA1 2ZEWA 4IV3C 5ABJC 2XHNA 3ATGA 2V5YA 1IKPA 5E89A 3FLRA 3OG2A 4A7ZA 1MS5A 4META 1JOJA 5KHKA 5A80A 3S6PA 3JD71 5K7PA 2C9AA 3VZNA 1SPPA 2QZ3A 2NM1A 3O1SA 1A78A 1ND2C 3ZXLA 2BERA 4S2FA 1URXA 2ZZJA 4BLIA 2E31A 3NV2A 3N9NA 4ZONA 2JDYA 5EYYA 1QH6A 2E9QA 4I02A 2VQ0A 5A7OA 4AR2A 1YQ8A 2GNTA 2R49A 1PNFA 1UQXA 5FP9A 4XETA 5GLVA 1LTEA 2QQVA 1O4ZA 4AI2A 2G9ZA 1COV1 2YC2A 4SBVA 2VMDA 2EXHA 2FZ1A 4XUOA 5A7WB 2WT1A 3C3VA 3OGVA 4JGYB 3ORJA 3JD73 4ZXKA 4JGZC 4QKBA 5FZ8A 2ZGPA 4CDXA 2JG9B 2OPKA 1E5SA 4R9AA 3B7MA 3G7DA 3N9PA 2RDSA 3BU7A 3FHQA 3V0AB 4CRQA 3IM0A 2HWB2 4BB3A 2ZABA 3CO2A 4DEQA 2BNNA 4HKLA 4OUSA 4X6QB 1PO23 2BU9A 3LEIA 3ZSJA 3VD4A 1CN1A 2NZ9A 4PLNA 4PI0A 1NCQC 1COV3 3GALA 1G7YA 4RHV2 2G19A 1W6OA 2X29A 1KXGA 5FP4A 3DEMA 1NOVA 4FOVA 5EQUA 2XKPA 1VAVA 3RYRA 2WDBA 4AEDB 4DXTA 3M3EA 1HN1A 1UWWA 2NN8A 4D6RA 3MGUA 1DZRA 3AJZA 4C90A 5FR3A 2FDGA 2C24A 1C5HA 5F3EA 4CUCA 4XFHA 4QX8A 3U4XA 1YQ5A 3KSCA 3W5MA 1Y7BA 4WVWA 2YBPA 3AMPA 1JYIA 1UIJA 3TB0A 1GLHA 3GBGA 3AP5A 1RXFA 3POJA 5C8CA 1RUG2 4NUBA 4OFGA 4XXPA 5T5JA 4CCMA 2CY6A 1HN0A 4TLFA 4IEUA 1BKZA 4C1XA 1WZXA 3WCRA 2RS31 3AYEA 3KGZA 3BKZA 1KDMA 3EB7A 1ASJ2 2ZHMA 4AFCA 4QX2A 4AI9A 5JSOA 5FMOS 3Q9OA 1SDDB 4XFCA 3PVNA 1MEC2 2QBXA 3DV8A 3OY8A 2WYFA 2Y6GA 3NAPB 2MEV3 4GULA 2ES3A 5KXEA 4ITCA 1QQP1 1DGRN 2ZJCA 4Q0UA 3RSJA 1KFUL 2RR12 4XFBA 4LO5B 2WLPA 2Q8OA 3OSDA 4LXLA 4FFHA 3I8TA 5I8TA 3H3LA 5APAA 5A7SA 1LULA 2VU9A 3AFGA 4HN0A 1FOD2 4QM8A 3ZSKA 4EN0A 3ZXEA 4BIFA 3D0SA 3VBFC 2QQUA 4AI0A 3ZX7A 2WN3A 2JG8C 2RS33 4XUPA 1POV3 3I97A 3LWCA 1W8ZA 2VECA 3IWZA 2IWGB 5T5LA 1HX6A 1C1FA 3ZOIA 5GLWA 3BN6A 1OT5A 1U5IA 2ZX3A 4Y24A 1GBGA 3NJZA 4ONUA 1ULOA 3WSOA 2VJXA 3ZXDA 3AMNA 1UU4A 3ZPOA 1MS8A 4A2UA 3EXUA 3IBMA 5CYYA 1RUH2 3I3QA 1RUE1 2OQ7A 4ARXA 5T50A 3T09A 1KITA 1YI9A 3ETPA 4EZHA 1OA4A 2WZR1 3P1IA 2V4AA 1S0IA 3A0KA 3M4FA 2ZX4A 5EHDA 4AI1A 1PVC1 4DIQA 5IT6A 1BEV3 2FMDA 5FLIA 4X8NA 4FAGA 2NMNA 2YBSA 3SHRA 3NL1A 1NE4A 3AL5A 3GYDA 3W21A 1R083 1VP6A 5LA2A 2HYXA 1EYBA 1VIWB 5F3IA 5F1RA 3WQBA 1GSLA 1K5MC 1G8WA 2K9ZA 4HLTA 3ZXKA 1RUE3 2YV8A 4C0HA 2QDRA 4IV1A 4PQ9A 1AR91 5BYNA 3HT2A 2YGLA 2WZR3 2ZXQA 4HANA 2WNUC 4Q0VA 5DDJ2 3N35A 1D0HA 4AI8A 1PVC3 4QAWA 3CBNA 4RFT0 2CGPA 2D6NA 3SEEA 4K3UA 2I07B 4QQOA 3WNMA 3H9AA 4YARA 5A3LA 1WMDA 4JGZA 2Y60A 2FDHA 4GKXA 5LATA 3S5AA 4LLFA 1JYTA 4LBKA 5DMYA 4CDQA 2G9GA 1O8PA 3NJVA 2W52A 1O91A 4NVPA 3VDDB 3SH5A 4H2AA 4W65A 5CNAA 2Q30A 5M0TA 5FZEA 4YPJA 2HWC1 4HOOA 3VHOA 1PK6C 1F8VA 3H3UA 4M3CF 4QKFA 4B4QA 3T1MA 2ZEZA 5H9QA 3WZ1A 4N43A 4PLMA 4K20A 3T0AA 2HWD2 1AR93 2ET1A 3NWKA 5TSWA 1PHMA 1OHFA 3WDVA 3ZSLA 3DYPA 4Q2FA 2K46A 1XRUA 2DFBA 2W47A 2E7QA 3VDCA 3PVBB 2D40A 2AGSA 5H9PA 4CCOA 1N1VA 2W1WA 2JDZA 1AJOA 4O9EA 4OQ9A 3AKPA 2A6YA 3PU3A 3R4DB 1BHGA 3R6SA 5FZLA 5FZHA 1JI6A 1DIWA 4C0BA 1YNAA 2Z5WA 3CJIC 3HR9A 3MF9A 2DURA 3LA3A 4LORA 1OD3A 4HPKA 4QXCA 2VOTA 1X50A 1F5JA 1QIQA 2VOVA 4UW3A 3RNSA 4I01A 3DPRB 2WC2A 2DTYA 2GNMA 4FPKA 5C4WB 1E5RA 1W2UA 2X10A 4LT5A 2VM9A 4CXXA 1UXXX 1EAH1 1LENA 5FKCA 1DQ6A 3MLJA 5FZBA 5JVVA 1GICA 3PMEA 3THPA 1U5XA 2X5IC 1AJKA 1GZWB 2CWSA 3LPGA 3OYWA 1QOTA 2VMIA 2YHJA 2KR2A 3AZVA 4FQZA 3B94A 3VV1A 1UN1A 4WM8C 4CCEA 5FZKA 2TNFA 2WIIB 1ZZ6A 5DN2A 1V70A 1AHSA 3HNMA 3PIGA 5BY5A 1W6NB 1JUHA 1ENXA 2OUHA 4IETA 2IZWA 3AYCA 1US2A 1WWYA 2UWAA 3O0XA 4O61A 4OI2A 2ZGTA 3I2KA 5CKNA 1UPIA 3ZN4A 1MZEA 1SMVA 2JE7A 1JZ3A 5JR7B 3VBFA 2B9UA 3ZSEA 4B8EA 4P9GA 2KA3A 4JHTA 1PGL1 2JG8A 4AGGA 4CU8A 4UFJA 2FQPA 4MZUA 1EAH3 3SISA 2Q1ZB 1GWKA 1NLSA 1FNZA 4PF1A 4OULA 1S55A 4HT1T 4YSFA 4Z1VA 5JZGA 2RJ2A 1NLQA 4IGOA 4E8CA 2CNAA 2GC1A 4MXWA 1ZX5A 2X8KA 2R30A 3ES1A 2A71A 4HXCA 4MGYE 1HRV2 2ZZQA 5GALA 5GZGA 4FXKB 3RZGA 3WF3A 1S0EA 4Y1ZA 1F15A 5C9AB 1NA1A 1ZBA2 2R0HA 5FY8A 5G05L 1F2NA 2B4KA 3O1TA 1DZTA 2YPJA 4ASKA 1X33A 2ZGQA 3P5BA 1O3SA 1LOAA 5LK7B 5HXMA 1ST8A 4BOWA 4EQVA 1OVPA 3I7DA 4CDXB 4NJ4A 3O14A 1LHUA 2JECA 3JD72 1FV2A 1CAWA 2Y6KA 5IHRA 4A41A 5FY7A 4LLOA 3UYJA 5LW9A 2VPVA 2ZTNA 5CA6A 2XUMA 2IXJA 2VVFA 1WCUA 3EHKA 3TNPB 5EPAA 3CIHA 1X8MA 3M70A 1ZZCA 1LOCA 2IFRA 1J3QA 4LKEA 2XWJB 4UFHA 2WNUA 1IS6A 2F17A 4O65A 4MLOA 3UT0A 3AXEA 5FK8A 2RMU3 1COV2 3N9OA 2Z69A 2ZHNA 2ZEYA 4B7EA 2Y64A 2QQNA 2QE3A 5FZOB 3ZFGC 1O59A 3FX3A 4P02B 4Q4W1 3H8RA 4E4HA 1YFUA 1W8WA 2ILMA 4DB5A 1VB2A 4CEWC 5IK4A 1WD4A 1E5IA 1WGPA 4FTBA 2D6MA 5EP9A 2BBVA 4AK3A 1PK6A 2XGXA 1XBFA 3VBRB 3I49A 2ZA9A 1YFYA 2Y34A 5FWJA 1XYNA 5FLHA 2VMCA 2WRAA 2D6KA 4AL9A 1XU2A 4CEYC 4XAEA 1DYKA 1QOSA 1UY1A 4CZSA 5FYSA 2VZPA 2W39A 4DXZA 5IVJA 1YQCA 3SMHA 1RUOA 2QFEA 4COUA 3WQ0A 3I2JA 5FZ1A 4CCNA 2D7FA 3SXWA 3T2TA 1RB8G 4JV4A 1JN2P 4Q4W3 1P8JA 2IXIA 3E97A 5A1LA 3OGJA 5IFTA 3AFKA 4XURA 5AVPA 3TN91 2W94A 2OYZA 5CFCC 2J1AA 1VBE3 1CX4A 5IW0A 2JD9A 1Q8SA 1GNZA 2DF7A 3F95A 3ZFFC 2OIIA 3KF5A 3LIGA 3CJIA 4P9WA 3K4DA 1MACA 4M3CA 3E5QA 2VTFA 4XJ8A 4B3NA 4P9YA 5J3UA 3THCA 5LRSA 4WBBA 2DU1A 2TEPA 2F4LA 2BOJA 3SC7X 4D69A 1W6MB 1RJ8A 2OX0A 3H1YA 2YYOA 2ZAAA 2A73B 2X5IA 5L7OC 1W0NA 2NPIA 2PXJA 2YFUA 2IFWA 4GJYA 1JU4A 4GMP1 5FZCA 2VE1A 3LE0A 5IWFA 2JDHA 2YB7A 3TN93 4WM8A 4AXOA 4LO8A 5DQ0A 4JCKA 1V0AA 4K1YA 4BJ0A 4CDUC 1QQP2 4IV3B 3GJAA 1SCRA 1OKOA 1KFXL 2D6PA 3T2OA 3VKNA 5ABJB 3KLSA 1RUNA 2DVGA 4IQPA 3R05A 3O1UA 1LU2A 5C3PA 1AL0G 4XUNA 3RRDA 1PM4A 4BE3A 1WKYA 2C9KA 1WMFA 4FOYA 1OKQA 3K77A 1Y9GA 1ND2B 1LHNA 4Y20B 1BBT1 4MXVA 2JDPA 5JI7A 3PL0A 1QMJA 4E27A 4Q1RA 3U14A 3RZMA 5IVYA 4CP9A 4GMP3 1UZ0A 5E88A 3E1F1 2QQPA 4AF9A 3FHAA 3WLUA 1YUDA 1H8VA 5EZWA 4E2QA 4QHOA 3POYA 4N7IA 4JAAA 1DF0A 2LUWA 1RVF1 5A6QA 5AVAA 3ENRA 4LBNA 3JCIA 1RUE2 3C2UA 5T5OA 4AQTA 4ES9A 1Z7S2 4IESA 2Y33A 2DV9A 2P34A 2JICA 2Y6HA 2WZR2 4JX0A 1XNBA 2WZEA 3POWA 1MS3A 3HT1A 3CLPA 3KCXA 4JGZB 4L11A 5D21A 3VL9A 1WBFA 4QDSA 4BQXA 4PBPA 1KRIA 1VJ2A 2XDVA 2XKOA 2AEZA 3NKTA 3IT8A 4NWWA 1BBT3 4XJ9A 5BNOC 3PTRB 1RUJ1 4OUMA 4P9IA 4XC9A 3A4UA 1YJKA 3ASIA 2AUYA 4OYUA 3WXPA 3NQHA 4Q5OA 3RVHA 2B8MA 1GKBA 4XYXA 3JQWA 1V9U2 3V0BA 1GYKA 2HWE1 4PLOA 5IVCA 1FNYA 1FMD2 1RVF3 2XBO3 2ZGOA 4YM1A 1NCQB 3NRUA 4Q26A 5F3CA 1XJAA 2IVIB 2MHFA 2YG0A 2JX9A 3IKWA 1H8TC 3NNMA 4Y1VA 2W92A 2OVUA 5FJHA 5J1XA 2QZ2A 4I0AA 4QU1A 1Q8OA 4XEZA 4LJHA 3IMMA 4N8MA 1RUJ3 1HB1A 2GAUA 4AG4A 4AHYA 5JSRA 4CEWA 3KMHA 1QHDA 4I30A 3HOBA 1MVQA 2ENRA 2GSYA 4NIIA 4CTEA 1M06G 1UY3A 1ND3C 3M3IA 3KZ4C 4LULA 3OEBA 3ACHA 1QOOA 3U11A 2ADDA 2HWC2 1QEXA 3Q8EA 5FY1A 5LA1A 3THDA 4KBZA 1RINA 4JKKA 3KQRA 2XB6C 4DQAA 4DO0A 3AZWA 4LBOA 2QQWA 5DAXA 3CEWA 4DMIA 2VXJA 2WAAA 5FUIA 5LASA 2BV4A 2JD4A 3HN3A 3MBWA 5K8SA 3BTZA 1GNYA 1D4VB 4FOQA 2BGCA 5FP8A 5L9BA 3O1OA 4LNVA 5LY2A 2BUKA 1YFXA 5FV3A 1JZ6A 2PHTA 5CFCA 4FAHA 1NZIA 2IUWA 3ZFFA 2FDKA 3AKSA 1RMU1 3M3CA 1JS9A 1OC1A 3VBFB 1YFWA 1TNFA 2JG8B 2WA3A 3LEKA 1H0BA 1ULFA 5CFDC 1W9YA 5CB7A 4NIGA 4CP2A 5KHIA 1XYOA 3U75A 3WW1A 5AFBA 2CTVA 1EAH2 1HLCA 1L7QA 2VQUA 3VHRA 1ZBE1 3EBRA 2CL2A 4B1LA 4OHZA 5CIRA 4MXWB 2ZPXA 2DUQA 5LA9A 3LSDA 1CAUA 2YUEA 2W68A 3PDQA 1Y4WA 3NVCA 4CDUA 3TOJA 1OF4A 5FLJA 1RGSA 4XZUG 1RMU3 1WLDA 5CVRA 1FPN1 2OQ6A 5FYHA 4BYYA 4QDRA 1OQDA 1A8MA 1OH3A 2W5FA 2E63A 2GC2A 3HNYM 1KQRA 2IXLA 1GANA 1PIV1 3AC0A 5A33B 1S0FA 2I45A 1CAWB 1PGL2 4QHZA 1PVXA 1W2TA 2BNMA 1JXNA 2H0VA 5FJKA 3IB3A 4Q0QA 1ZBE3 2MPFA 3LGRA 2W1SA 3ZR6A 4BK4A 4HZFA 4WVZA 4LMFA 3B01A 1RUI1 4NRMA 1K5MB 2A5ZA 4XZPA 2DWRA 5FZAA 2WT0A 1CESA 4KNCA 4FQ4A 4DUWA 5KHGA 2WA4A 1GNHA 2WNEA 4Q1PA 1IPSA 4XF9A 4YG6A 2WNUB 3LOBA 2W1QA 1XU1A 3RWKX 2WO1A 4UW6A 1MS9A 1AYN1 3HIFA 4XHBA 2OXBA 1PIV3 1H2NA 1Y3TA 5FZGA 5BNOA 3VD5A 5A3OA 3VBHA 5CKMA 1O5LA 1SBDA 1SBFA 2XLFA 3KWVA 4QT6A 4W4ZA 1LOFC 1F9KA 1OQEA 2VY0A 1PK6B 5K0UC 1V00A 1RUI3 5FYYA 4Z8BA 1DU3D 1WLCA 1DQ4A 2VNVA 2B46X 1GOGA 3J8F1 3O0WA 4NOTA 4XJZA 3VKLA 2Z4FA 5C8CC 3H8OA 2PHLA 4NRQA 2DBNA 5DAWA 2YU1A 5F5AA 3MIDA 2VAUA 4XAAA 1HRI3 3JXSA 1GOHA 3R4UA 1JOBA 5I0TA 4JC1A 3O1MA 4OMDA 1XPWA 4N9IA 1TG7A 1JZ7A 5A3NA 4HVQA 1AXZA 2B9VA 4CP0A 5J96B 4BWOA 4OMCA 2YBKA 2P3IA 2GH8A 2WS91 1RHI1 2VD7A 3E6DA 4Q4Y1 2H6CA 3IPVB 4Q4W2 1AF9A 4D0QA 2XLAA 1EUUA 2JXAA 4BHPA 2ID4A 3MUY1 1VRBA 5IVBA 4LE4A 4L2NA 3ZIXA 2KXLA 2XQRA 3CZJA 3QH7A 2Z79A 4ISQA 4PI2A 4R9DA 4E4ZA 1G86A 4R52A 3DXUA 5LY1A 5A70A 3ME2A 1HXS1 3RMXA 3R0RA 1VBD1 2J1RA 2X5IB 3RQ0A 3IDEA 1DGRA 1LOEA 1XNAA 1VRH1 1KDKA 3AB0A 5J48A 2E32A 3FLPA 2OA2A 4MHUA 2WS93 1RHI3 4WM8B 4BQ3A 1OA3A 2JDNA 2J22A 3RPQA 2JKBA 4Y5Z0 5AFEA 1W04A 1W39A 1O3TA 2EIDA 4PIZA 3TN92 3O1RA 2WO2A 2VZ1A 4BM8A 2Q0AA 3HJRA 1X7NA 4OHWA 1ZRCA 3N7MA 2JDKA 3VZLA 2E53A 4FPHA 3POIA 4FPGA 4XACA 5KXCA 2HYKA 2ZHLA 3CKHA 4DRRA 4EJRA 4WV8A 4QDQA 1X9PA 2EIEA 1U12A 1RUF1 1GMMA 1DGWX 1HXS3 5CFDA 1VBD3 1HB2A 1RUC3 3DUIA 1LHOA 5D2AA 1CD3G 4QD2A 2R6QA 5DUVA 5GLUA 1VRH3 5DABA 4ARYA 5F37A 2EXJA 4Z92B 2R16A 4ORFA 4QPGC 4QX0A 3VDAA 2FZ2A 2W0XA 1PMHX 4QPYA 2Q1FA 2WNVB 1SFNA 4UFLA 3ACGA 5F32A 3IAPA 4OHYA 4KU7A 5BV6A 1IG0A 1PO21 3AMMA 3T3YA 3I3MA 4LQRA 2WJSA 1UD1A 2D6LX 4IV1C 2DYCA 4L92A 2P37A 1NAEA 5C3RA 2XVKA 1QJY2 4LBQA 3TBDA 5KBFA 1RUF3 2Y8KA 1GV9A 1AR81 1DFQA 1FX5A 4Q29A 1BBT2 4N7UA 4UBHA 4OCTA 2DVDA 4IEWA 4FPCA 4UF0A 5FY0A 4BXSV 4CDQC 4Q8KA 1H2MA 1MZ6A 4YYOA 1UF2C 2QVSB 3PJQA 3N4MA 2JDMA 4LHLA 4MOAA 1AR73 2ZGNA 1A8DA 1KEXA 5FO8B 4PDWA 1UO9A 4A6SA 1SLBA 2XHKA 3I2DA 1RVF2 4N43C 4YVSC 5F8PA 5IYYA 2CHHA 3B93A 4D6SA 4P00B 4I3PA 5FZIA 3ABZA 3ZFGB 4XJAA 1JBCA 1AR83 1H30A 3KCCA 4ZU4A 3M1HA 1BCXA 4CEWB 2WO3A 2K0GA 1RUJ2 1V6JA 5K0UA 4NE9A 1LOFA 4GJZA 2WWUA 2CWMA 2MEV1 3AZZA 4MHRA 3HQUA 5FMOL 3ZXAC 1KS4A 3AP6A 3QCWA 5ANNA 2X05A 2HWE2 3LF7A 4PIYA 1Z78A 4CEYB 1JYCA 5JOXA 4CA9A 3EJKA 3SNMA 3ELNA 2VUJA 2C6SA 4LO7A 5F39A 4ASLA 2GU9A 1G9CA 3LZZA 1BZWA 4LA2A 3E5XA 2D5HA 4A3ZA 1POV1 5J09A 3ZDVA 1I5ZA 4PDWB 3OBZA 4ZU7A 2WKKA 4ZY9A 3UGHA 4AAXA 5CFCB 1UZYA 4CU7A 4EYUA 4AHZA 3RZKA 3KT4A 1F4HA 2BYVE 3AVSA 3ZFFB 3APBA 4Y5TA 2BP6A 3ACFA 2A7AA 2GP3A 1SLTA 1PX3A 1TZOA 1W8TA 1W8NA 4AVVA 3RZJA 5KR7A 1UOGA 4YFZA 4B4RA 3PUHA 4TSVA 1W9SA 2PHWA 4YZ5A 2NMOA 4XTMA 1V6IA 1H1IA 3WNXA 1UZWA 5F2SA 4C8DA 4EV0A 1BEV1 5L36A 5CAZA 5KC5A 3BIEA 5L7OB 1PMIA 3OJBA 4LBMA 3W9AA 3B69A 4Y22B 4RL7A 3W20A 4UFKA 2NYYA 3MV11 5HCAA 5HCHA 1EY2A 1LEMA 1R081 5FP7A 3UKNA 4D7SA 1CAUB 1RC6A 4IE4A 3N7JA 4Y26A 1VBB2 3TNQA 1QJFA 1J58A 4CDUB 5CBLA 3AK0A 3WQ1A 5JZGC 1YO8A 3U4SA 1TMF1 4DY3A 2ERFA 2O8OA 2ZX0A 3FZ3A 4AFDA 2BRTA 1VAMA 1RMU2 2GP5A 1W6QB 3IMNA 1OOPC 1QNYA 4IXLA 4CPBD 4CXWA 1NA1C 1O8SA 3MIGA 4XFIA 1L3JA 1LHVA 3V65A 4BXFA 2ZKNA 4XTPA 5FZ9A 5H9RA 4FI9A 3ZYRA 1DGWA 2HH9A 2CU5A 1UX6A 3GHMA 4H3WA 4JZRA 3SH4A 1HV1A 5BNNC 5LCWL 5FZ3A 5E1RA 3VB9A 2O8QA 4QPGA 5FQ0A 1KGYA 5FCCA 3HAGA 1QKQA 3PHMA 5KHHA 3FE5A 3JBG1 2W46A 1DYOA 4QGLA 5IK7A 4LHNA 1Q8PA 4XF4A 1CVNA 1TMF3 4YFWA 5FOBB 1OUXA 1POV0 2VZ3A 1QGLA 1OLMA 4AGRA 1FPN2 5JSPA 3OPTA 1LNSA 3ACIA 5DUXA 4EROA 3LOIA 4A45A 5FYMA 5FXWA 1US3A 2CGOA 3WT3A 5FO7B 1U5YA 1VR3A 3WHTA 4ZZ8A 5J37A 1GP6A 2UY9A 5BNOB 3PJYA 3H1WA 1W2NA 1C5IA 3K2OA 1PIV2 4HKWA 1OD5A 3R4SA 2RS11 3ON7A 4CU6A 3AKRA 1N47A 3MYXA 3VUOA 2WWJA 5IK8A 4QPIC 1JW6A 4NIAA 2BDRA 2VZTA 3JBG3 3I4IA 1RUI2 1WW6A 3KT1A 1LECA 1W05A 4YLZA 4EN6B 3ZKYA 5HPOA 4Y1UA 1Y43B 3RWNA 2P3JA 3LA2A 4K21A 3WG1A 3KCYA 3KD4A 1H8TB 4RGKA 3MLKA 4YVSA 5FMBA 1EP0A 4CE8A 3HEIA 1I6XA 4EE2A 4EN8B 4HG6B 2X09A 4KL1A 1AYN2 1OA2A 4I0WB 4QM9A 5FFOC 3DGTA 4CUBA 2WZ8A 3HNBM 1QJZA 2RS13 5EJ1B 1QNWA 2R32A 2VR4A 3MIHA 3CF6E 3VLBB 1ND3B 1QY4A 3ACLA 1D2QA 5CISA 1J84A 3O12A 3Q8BA 3D0JA 3PVEA 2N7GA 4QX3A 4BISA 4OQ8A 4UBGA 1QJX3 1IZ3A 3J4UH 2Z42A 2Y6LA 2MNGA 3J8F2 4A7YA 4V2WA 5L9RA 3MW4A 4H7MA 3POSA 4BU2A 2WN2A 2XJQA 3NNJA 4LK6A 2W3JA 2HLEA 4KI5M 5C8WA 3NSTA 3L9JT 4KH9A 5SV5A 1VBC1 4RQPA 4WVVA 3SEPA 3IDCB 5D1IA 2BOIA 3A7QA 1BVP1 4XCAA 4R4XA 4NHMA 1GFF2 2XL7A 3ZSMA 5C71A 3WNOA 2AACA 1ALYA 1RHI2 2WS92 4IW3A 1K12A 4Q4Y2 3VBUA 5BNPC 1K45A 2GNBA 2G9FA 1H1MA 4RFRB 5FY4A 2Q8EA 5EJ3A 4P5HA 5I8YA 2BFUS 2DBIA 5GJ6A 2BTVC 3C7OA 4GWIA 4JDMA 5EFUA 4N9HA 3ZIWA 4YW1A 4X6RB 1WW4A 3VKFC 3M2MA 4LE3A 5CFDB 2B45X 2EF6A 2EICA 2ETEA 2R1BA 4AHXA 1D4M3 3RZLA 3S57A 3I3DA 4QB1A 3MEPA 1VBC3 2FCTA 1SPPB 4DNYA 5B2GB 5T5PA 4GA9A 4ISRA 4MSVA 3BOWA 4LBQD 1VRH2 2JB4A 1C8NA 5CZKA 4TZDA 5JXHA 2EA7A 1V6LA 4UAPA 1QWRA 2FCUA 1G9FA 2LW8A 5FYUA 3PU8A 3TEZA 3BTAA 5FREA 4OZOA 2YFZA 1X9TA 3VBSC 2VCAA 3VHPA 2RJKA 2VC9A 2OT7A 1OOPA 5FZ7A 2J1VA 4DY5A 1PNGA 2WNOA 3POBA 5EXOA 3UGFA 2RMU1 3LDRA 1S0BA 3NNFA 3P6BA 1GU3A 1XNTA 4XQWA 1RUF2 5AC91 5BNNA 1ULEA 4WM7C 1AXKA 1JYXA 3IDBB 4K8FA 2RS53 4MGTA 4UF0B 4Q4V3 3M8LA 4XXAA 1KS5A 1QXPA 2A75A 5EWSA 3TEWA 1IQAA 1KJLA 2VQTA 4YGBA 3TYJA 5JXGA 2C4XA 2IXHA 5F6KA 4XDOA 2ATFA 1ULGA 4YW6A 2W2IA 2AENA 1BXHA 4WZCA 5JOYA 3EQEA 5GKAC 4MV2A 4XIOA 1C4RA 1UZZA 1PO22 2A6XA 2LS6A 5FMCA 3KV6A 3VBOC 1JODA 4BMEA 1W6OB 3H0OA 2PLV1 4BQ2A 5FPXA 1AYM1 1H2LA 4UT5A 1G9DA 4J1WA 2Q8DA 2DCTA 1XOYA 3HD8B 1IPJA 5AC93 2QQMA 1ACCA 3I2IA 1AR82 2VOWA 5K0UB 2SLIA 3VD7A 1JHJA 1XSRA 2HWF1 2VH9A 1N1SA 3FFZA 4GAZA 4NPRA 4QPIA 1VBE1 1QDCA 1W8HA 3BUCA 1POQA 2D43A 4FXGB 5C8CB 3AYDA 4XFAA 4WZFA 1NCRA 2VZQA 5FZ6A 3WEZA 4W6XA 5BNPA 1D2SA 1BK1A 2RVAA 4D8MA 4AAPA 3T4HB 2VNGA 4YW3A 1LEDA 2PLV3 3AXDA 1W3VA 2H0BA 1YIPA 1AYM3 3LAGA 4L0PA 4GWJA 2ET7A 3OTFA 4FPYA 2D93A 1CZTA 5FPBA 4PBOA 2P5BA 5HV4A 1LAJA 3OY8B 4TYSA 2RDRA 2GDFA 5KC6A 1R1A3 1OLME 2HWF3 5CADA 3K48A 1AR63 5A7NA 2CDOA 3MIBA 1IOAA 4RN5A 1O3QA 3I59A 2QUOA 2MEV2 4AZZA 3HQXA 1I3HA 3RG0A 3HWJA 3WVJA 3MW2A 5LZ6A 1J3PA 5KWRA 3M7AA 4FP3A 4OHVA 1MS0A 2D6OX 4AQ2A 3IIAA 1JH5A 1FATA 2CSGA 1UX7A 1LODA 4IEYA 2DTWA 4P9LA 2AEYA 1GQPA 4XCBA 3K3OA 3LCPA 4BQWA 3BU0A 4OHXA 2XLGA 1W9WA 3PLQA 5FYCA 4ZHNA 1UYXA 2EAAA 4YM2A 3WP3A 1OFNA 3AKTA 2RS32 1YQ2A 3E6BA 1UOJA 2W95A 3FFQA 3V64A 3I3BA 4Y33A 4COYA 1QU0A 3KT7A 1W8UA 3NJXA 1ZZ7A 3U07A 2PQQA 1B09A 2E33A 5C33A 5DZGA 1YQ6A 4FPJA 3RS6A 2BQPA 1S0DA 2HEWF 1K3IA 4AFMA 5FXVA 3AZXA 3GJBA 1S0CA 1CJPA 3UGGA 1G9AA 3IN9A 1DQ0A 4XBQA 4YW2A 5GZCA 1Y9QA 1YYNA 3M3QA 4J6GA 4YZ4A 3VDBA 4HKOA 1ZRIA 1BEV2 4GH4C 5EIYB 5FYTA 1EPWA 2ZX1A 5A3WA 2A6VA 4AEJA 3QLQA 4OI0A 5FP3A 3LDBA 4KU8A 4QPGB 3WCSA 4D3WA 4ZKTB 2CAVA 2VOKA 2XOMA 1CPNA 3CZUA 4XHXA 4YGDA 2ARCA 2J7MA 3AMHA 5D8AC 4GALA 1R082 3WG3A 4EWEA 2XUEA 3WF0A 2FDFA 3EO6A 1O5UA 1Q8VA 3LD8A 4ZPIA 3OGRA 5C6CA 4YG0A 1Q8QA 1GZ9A 3VBSA 5E6HA 1TMF2 2BEOA 2XBO1 4IV1B 2PFWA 4HBNA 4NAOA 3WUDA 3H8XA 2WQZC 5FPVA 5FKBA 4HONA 4C1WA 1WCKA 2JENA 1RL3A 1K42A 3OGGA 1PVC2 1XE0A 4WM7A 1WMEA 3W59A 3D8CA 1NYWA 2R7EB 3KV9A 3MF6A 5C3OA 3B02A 4LBLA 4CDQB 2VMFA 3MV01 3POEA 5FPUA 2HWB1 1WLTA 1UOBA 2D3RA 4FP2A 3VBHC 5IVEA 5FWEA 3S7EA 5LK5A 3PIJA 3ZXJA 3TRSB 3MFCA 3JBG2 4XE9A 1OF3A 4N43B 4YVSB 2VW0A 4JVAA 1F4AA 5FRAA 4NN0A 2VZSA 5FZDA 4AHWA 1C8M1 3VBOA 5JXIA 4AFBA 2ZOEB 1AR92 1IKQA 1JTZX 4GMP0 2O14A 3M3OA 1U0AA 4AYUA 1SFPA 4FOWA 3O1VA 1GWMA 2HBTA 1TEIA 4ES8A 3H7YA 1NG0A 2QKDA 1N3OA 4XILA 2RS12 1L7RA 2HWB3 3OPWA 2XJSA 4YVWC 5LBCA 3ZMNA 4P14A 1UY4A 5LB6A 3V0AA 1K5JA 1CR7A 1UW8A 4A7KA 2JDUA 4HPKB 1DG6A 5DAPA 5J98B 3B5LB 1UOFA 1UY0A 5JMCA 1HJFA 1RTVA 1C8M3 3RJRA 2Y38A 3PVOA 4RHV3 1PGSA 1X36A 1XNDA 1NQDA 2DCYA 2UYBA 1UU5A 2ZBJA 3TAYA 4BMBA 1ENQA 1BJQA 1CZSA 5FY9A 3CDZB 4I0BA 3WX5A 3I3EA 1DYPA 1UZVA 2GZWA 5F3GA 5FBZA 3OYWB 3AM2A 1MEC1 2JE9A 4JRAA 5FZ0A 5I0DA 3CMGA 3HN1A 2J42A 4QPWA 4XUTA 5BNQA 5L19A 2BNOA 2XJRA 3ZMOA 2Q1MA 2BVVA 5CKQA 4LPLA 1UXZA 3AJYA 2YU2A 1W3XA 3ZFEC 1AXYA 2UWCA 3W58A 4NIDA 5I0RA 1MZFA 3FLTA 3WOGA 1LRHA 2QQKA 2VOXA 3USUA 1ASJ3 1ZYBA 2JJ6A 1A3KA 4BPZA 3O0VA 2VBDA 1VBC2 1V6MA 3HBZA 1WCSA 1MEC3 5I91A 2Z2SB 5JZGB 4XIKA 1IHMA 4O7XA 3OEAA 2RR13 2Y6JA 3H8UA 1BMV1 3WP4A 3DYOA 4P9XA 4AVAA 2ZMNA 3H7JA 1OOPB 3SLIA 4OI4A 1NA1B 5T52A 4M00A 4Q0SA 1OH4A 3N9LA 1WW5A 2W87A 4HSJA 3UKVA 3LFMA 2WQ4A 4DINB 2AR6A 3LEMA 4IUGA 4AW7A 1KD7A 1UY2A 2VXRA 3K51A 5HCBA 5BNNB 1W28A 3NO8A 4GH4A 1XXNA 5SV8A 5A32A 1CGPA 2J1UA 3CU7A 3RZZA 4JRLA 4R9CA 1SLAA 3AP4A 3ZKUA 2O1QA 5D8AA 3E5UA 5I0UA 5A3PA 2ZGUA 3JQXA 1JYNA 1J59A 4M3CE 1SEFA 4Y3OA 4CPBA 2VNRA 3HQRA 3T4VA 2WLQA 3K75B 3SKVA 3ZYBA 1D0GA 3MW3A 4PDWC 1F35A 1B35C 3C8XA 1FYUA 3I54A 2WFF1 1SG3A 3OUJA 4LOSA 4H14A 3MLLA 4RR3C 3WDTA 3FC0A 3MPBA 1PZ8A 3CJXA 1HRI1 2RE9A 1JYVA 4FTSA 1HW5A 1ENSA 2A3XA 1W9TA 2RMU2 4CP1A 2ORZA 4AWDA 2D97A 5AC92 5C5UA 3S0MA 4URTA 1EV11 4Y1YA 2WFPA 4QPIB 2EIGA 1MS4A 4TWTA 2ADEA 4IERA 1CWPA 3RI8A 1H9PA 2XL9A 4HL0A 3CQOA 1ZVFA 3NW4A 4FPOB 1TNRA 4NWVA 1O4YA 4U2AA 4X8PA 5BNPB 1HQNA 1TVGA 4IEOA 4KG8A 1A34A 2F4PA 3WDWA 2R071 2WFF3 4LIVA 1H1AA 5GLTA 3E6CC 2Y6FA 4QWNA 5GZDA 5IAXA 1AX0A 1TE1B 1XYPA 2ZAHA 1I9RA 2E7AA 3I2GA 3KF3A 4XFGA 3RYKA 2PLV2 5FOJB 1AYM2 1ZZBA 1YLLA 5C7GA 1JZ4A 2NLRA 3Q8FA 3BB6A 4F3JA 1EV13 3NNLA 3HMYA 4YVWA 3B9IA 5A7PA 4LOTA 3IIIA 2BGOA 2HWF2 2SBAA 3DKWA 4IGQA 4AEKA 3FBMA 5JPNB 3WNPA 1VBE2 2PTMA 3CJIB 1W99A 4LK7A 2R0FA 3LKJA 2FDIA 4M3CB 4XF3A 3ST7A 3CL1A 1PM7A 2ZMKA 3OUHA 2R073 4L99A 4Q8LA 4Y4RA 4A4AA 1RITA 5A6XA 4RS5C 5BUVA 1I1EA 1OI6A 2IXCA 2JIJA 2ZKLA 4MGKE 1AVBA 3SCHA 4E2SA 1V6NA 2DUOA 1VAKA 3DN7A 3GHNA 1VBA1 2WR9A 3T2PA 1CIYA 1RUC1 5LBBA 5HI0A 2QCSB 3PUIA 1H4GA 4D6QA 4P9JA 3BGAA 4LBJA 4XQDA 5JCTA 5JAXA 5C70A 3AX4A 2OPWA 5FY5A 4YRDA 2BWCA 2RG4A 2XH6A 5IUQA 1SHWB 4XMAA 5GZFA 3ZFEA 5I93A 1GR3A 5GLZA 3SH3A 1GQHA 3T0BA 4COWA 4B29A 2DU0A 3WW4A 2W08A 4V1PA 3EMRA 5FK7A 1W90A 1QDOA 2FBEA 3D4KA 3EYPA 3BODA 3ZLIA 4DUVA 3DPRA 3LEGA 1S1AA 3T30A 2AC1A 5DUUA 3BVCA 5FUPA 4AVSA 1VBA3 2E6VA 3HVDA 5F5QA 4CP9B 4YGCA 1DQ5A 5C5TA 2RV9A 4GB31 2KD7A 3WNKA 3VZMA 4R8HA 5B4NA 1FV3A 1CPMA 4INDA 3ZPYA 1HRV1 3MPPG 3WD5A 4QHBA 1R1ZA 3BPSA 3MHZA 4IGPA 1AR71 4XJWA 4QQHA 5EJZB 3VBSB 3RGBA 1J1TA 1W6NA 4FT8A 4LO6B 4CCDA 3PTYA 5I0SA 5CG9A 1GP5A 5C3SA 1DP0A 1VPHA 4RGGA 3USSA 1W8FA 1GUIA 5H9SA 2VVEA 3O1PA 4WM7B 3UNPA 2HEVF 4RA0A 1IGOA 3FJSA 2AYHA 2HKXA 4YW4A 1V6OA 3I2FA 1DQ2A 2DUPA 2I74A 4XOGA 1UPSA 4GB33 1YC61 4FO9A 2ZACA 4S2DA 4PJYA 1XNKA 2RJLA 1OXCA 2WSUA 2WQ8A 3B9CA 4YG3A 3KV4A 4YW5A 2LROA 1HRV3 3V0BB 3WDYA 2GC0A 4LITA 4V2VA 4RYDA 1B35A 4CDWC 5JOZA 5ERLA 3VBOB 2W91A 1ZBA3 1DDLA 5FXXA 2J1TA 3QD6A 4RR3A 2XBO2 2YROA 5C9AA 4AOCA 4DXSA 1WA4A 2EALA 4OLLA 4B1MA 4QKNA 2A3WA 5LRRA 4XDQA 3OUIA 3ZO0B 2JWPA 1YIFA 4LHKA 3ECQA 2PHFA 3LFIA 5DUWA 5FTTC 2X53S 4LUMA 3H3ZA 3N7KA 1RJ7A 3WR0A 3OF1A 2B5HA 4YZ2A 2DCKA 3GM8A 2Q4SA 5F5CA 1HDKA 3N3HA 5A3MA 5IATA 5IAVA 4TN7A 2HEYF 3QBQA 4MGSA 4UWDA 3KM5A 4QX7A 1J1LA 2GH2A 2QQOA 3F2ZA 1C8M2 2VZVA 4TTGA 2VBBA 4RSUA 1VLNA 4AVTA 5DZFA 4L8QA 4RQPC 3JU9A 1LGCA 2W1UA 4HVRA 1DCSA 4K1ZA 4P5YA 4S2HA 5FZOA 1BQPA 5EV7A 4AGVA 3VD9A 2Q8CA 4PF5A 4YW7A 2NQYA 1VB4A 3IZOA 4HSLA 1JUIA 2P6CA 3OCPA 3VBUC 2RDNA 4EZ4A 4AFAA 1SFYA 4XFFA 2YY1A 2YDEA 3TWIA 4DUXA 2XVLA 4GKYA 3WP5A 2OZJA 5ANQA 1ZM1A 3AZYA 1GZCA 3J7HA 4QX5A 3S5QA 2LALA 1C57A 4RS5A 3VBRA 3K46A 2VTXJ 1HQLA 3USUB 4ZS3A 5JMOA 3ZXFA 1GP4A 1LJ7A 2VULA 1V6KA 1E57A 2D3SA 3HBKA 4KG0A 5L9VA 3NKGA 4O9GA 5FMDA 5GZEA 5JIAA 1REEA 2VMEA 2O0OA 1OPOA 1NXD1 3DYMA 3GGLA 3VL8A 3ZYIB 4AQSA 1N3PA 5A6ZA 1AX1A 3GCXA 4QGNA 1NE6A
chains in the Genus database with same CATH topology
2QNKA 4B4PA 4LEJA 1SACA 1SLLA 3WINE 4QQLA 5DZEA 1ZRFA 3KGLA 3BALA 1NY71 1OMIA 1RIRA 4ZU5A 4M0NA 1OLQA 1MQTC 1Q3EA 4GH4B 5A32B 2VW1A 3ZN6A 1Z0HA 1SLCA 1R091 3WW3A 2DVAA 3OPZA 2VMGA 5D8AB 1W6MA 3VKOA 2PN5A 1ZBE2 1SLIA 1W0OA 2CAUA 4W6YA 1QQP3 4YM0A 4DZGA 4XW3A 1BMV2 2G4IA 1CJDA 1Z7S1 4IV3A 5ABJA 4K6BA 3SCGA 2R1DA 4AQ6A 2YMZA 2V09A 1H9WA 4M01A 2GALA 3WQ7A 1NQJA 2AZ5A 1R093 3ZVXA 3NV1A 4RD7A 3VBHB 4Y20A 1ND2A 1DHKB 4FPEA 1OFSA 4KBBA 1X8EA 1ULCA 2ZCWA 2DVBA 1V9U1 1XE8A 4XQ4A 1FMD1 4Z82A 1QJX1 1S0GA 4CDWA 5JWPA 2RHPA 3U0ZA 2RM21 1Z7S3 1NCRC 2C5DA 4IL7A 4WVMA 3AKQA 2WFF2 2ZGMA 3FWEA 1ZRDA 2WL1A 2LTNA 2EXIA 1ZRRA 2VW2A 1HRI2 3WHUA 2XWBB 1ULDA 2IXKA 4BZ4A 1S2KA 4XPVA 1OQ1A 3P3PA 3LSEA 3ZYGA 3UL2A 4QQ2A 2PA7A 4N53C 4YVWB 1EV12 2Y0OA 1A6CA 2EXKA 3A0NA 4BIOA 1V9U3 4BLJA 3VN4A 1PO11 1FMD3 1YCIA 3CNAA 2PAKA 4QXKA 4QMAA 2OUJA 1HV0A 2RM23 3QOPA 1FXZA 1G6NA 4BQ1A 3OD0A 1NCQA 1CAXA 2BFUL 2R072 3RYPA 3N36A 1D4M1 2C1FA 4Z2WA 1YJLA 1T6GC 1OLRA 1UMZA 4AVCA 2PHUA 3AP9A 2AREA 2Y26A 4Q4X1 3OD4A 5DG2A 2CGNA 4XBNA 3D5OA 1PO13 2HWC3 3ZFEB 3SITA 2A6ZA 2P3KA 2ZGRA 1REDA 2VUAA 2XG3A 2PHRA 3VZKA 4D7YA 4FPLA 2OW4A 5K9YA 5FO9B 1TME1 2XJUA 1HXS2 1CAVA 1TQ5A 2BWAA 1VBD2 1UKRA 1VBA2 1ZNPA 2RS51 1RUC2 3DL3A 4MH0E 4Q4V1 1NXMA 4Q4X3 1LB2A 3S30A 1LGBA 1OSGA 1REFA 1Q5OA 2A70A 5E16A 1SBEA 3BOPA 5JDBA 1O7FA 5F9TA 4H55A 4LBQB 1MQTA 4Q0PA 3WY6A 1QJU1 2KM2A 3QH6A 1TME3 1WD3A 1NZCA 1RUD1 3FUQA 1LKNA 1J3RA 4OI1A 3RI9A 4GB32 1ZZ8A 1W6PA 1AL21 2R061 4PDWB 1U5ZA 4DFSA 1B35B 3O7OA 3MIEA 4L97A 4N90A 2WNVC 1AR72 4RR3B 2D98A 4H7LA 5JI9A 1FAYA 1C1LA 4DPNA 1IS5A 1NLRA 3RMYA 4MGZE 2P2KA 3NV3A 4UW4A 2VVDA 1QJU3 2WINB 3H50A 5A33A 1YWKA 4JGYC 1RUD3 1C28A 1PGW1 2DFCA 5ACA1 3GBWA 2D5FA 1R1A1 2JG9C 1CQ9A 1AR61 1LOBA 1AL23 1PZ9A 2XJPA 2R063 3WV6A 1HQWA 1IS4A 3KB5A 4NHLA 1K5MA 4SLIA 5L73A 5JOWA 4NR1A 2YZ4A 2TUNA 1BYHA 1UAIA 3B3QE 2PHXA 1MVEA 4Y4YA 4R4ZA 3S7IA 1UIKA 1QH7A 5T55A 4MX3A 3WG2A 4AEDC 4N53A 4LA3A 5ACA3 4AVBA 2XJTA 1LHWA 4KWJA 4DOUA 2GMMA 3AYAA 1CIWA 4HMZA 4FCAA 1ZA4A 2E51A 3WG4A 1G9BA 2IC1A 3OBTA 2ZMLA 2Y0IA 1HKDA 1LCLA 4RS5B 2A3YA 5JPMB 2WWSA 4IEPA 3WP6A 2QJVA 4GWNA 3LB9A 1YXWA 4XF0A 1FI2A 3T1LA 4I09A 1XE7A 2XPJA 4I3GA 3ROUA 2GC3A 4DRVA 2R041 2WT2A 1ONAA 3ZN5A 5E8AA 3IPVA 4BA6A 3ES4A 4L9BA 3NAPC 3FBYA 4IEXA 2GNDA 4Z07A 3VKMA 3PMSA 3N7LA 3ZN6B 3JB8A 4GWMA 3WDXA 1W0PA 1LR5A 3LA7A 4ASMB 4JTNA 1MZ5A 3ZYJB 5FQ0B 1DLLA 4U36A 4MGIE 1MS1A 2R043 5I8SA 4LTAA 2BPA2 3J9SA 2FHRA 4C91A 1IPKA 3VZOA 3D6EA 4CYDA 4OZXA 4YM3A 3JB4C 4RGAA 1NY72 1CONA 2PYTA 4JDNA 1QJY1 1HIXA 2P17A 3FMGA 4HK9A 2B42B 3GZAA 3OBRA 4D7TA 1H4HA 5KHJA 1BVVA 3G6JB 5CG8A 1R092 2VG9A 1DZQA 3MDPA 3SCFA 4XJUA 1DBNA 1SDWA 3B00A 3ILNA 1WLWA 4IEZA 5F6LB 4JQRA 2GN3A 4G4FA 1YRZA 4CDWB 4E2GA 3BIWE 1FT9A 2WNVA 2QDNA 3JZVA 4WVMB 2UYAA 2PELA 3MI8A 2D44A 1AZDA 1SQ4A 4RHV1 2FMYA 1QJY3 4FPFA 3BPZA 4QQPA 4K9SA 1N1TA 4XMIA 4M0HA 5LEKA 2AH2A 1YHFA 4JGYA 1N3QA 1WW7A 3AP7A 5JLVA 4EWAA 1QXRA 2JG9A 4YNIA 3H1MA 4FBFA 4GXLA 3VDDC 1RUG1 2PAMA 3UK9A 4COVA 5KXBA 1QXJA 1N1YA 1QJX2 1CAXB 2EVXA 4NO4A 2RM22 2VQAA 3DF0A 5EYXA 2YGMA 1F5FA 3MZHA 2HJIA 2ZS6B 4RQPB 4R9BA 5HBAA 1ASJ1 1APNA 2OZ6A 3ETQA 3ZFGA 2WZPP 1X82A 2UWBA 2UU8A 4AEDA 4I2OA 1AX2A 3VBUB 2C0ZA 4K7JA 3RDIA 2RR11 4F7ZA 4D94A 2VNOA 2HWE3 1RUG3 1PO12 5CU1A 4QU2A 2ZGLA 1FOD1 2F6BA 4EN9B 2BW8A 2VMHA 4CEYA 4XF1A 5BPXA 2NP0A 3GNEA 3P3NA 2ZX2A 1DQ1A 1CAVB 2B39A 3UV9A 3DPRC 4E4DX 1D4M2 4W6WA 1Q56A 3BCWA 5KXDA 5C4WC 3O5SA 3L2YA 1WUVA 4XBLA 3ILFA 4Q27A 2XVGA 3GF6A 1VBB1 4Q4X2 4QGMA 3JUUA 4ATEA 1UL9A 2DCJA 3NAPA 1RUH1 3MICA 4LR4A 1LOGA 2V73A 4KGQA 4UW5A 1GQGA 3UJOA 5JIUA 3VZJA 1MQTB 1FOD3 1QF3A 3RJ2X 5HCFA 3UJQA 4MVTA 4AI3A 2UY8A 4KGGA 2GMPA 2YXSA 3GBFA 3GZUC 1WBLA 1O3RA 1S2BA 1TME2 1O4TA 1DGLA 4NHKA 5L7OA 2CV6A 1W6PB 2RS52 4Y22A 1VBB3 1ZZ9A 4Q4V2 1UKGA 4F8AA 2TBVA 2E7TA 1EPZA 1UU6A 4FSJA 4F83A 3WDUA 1RUH3 1WCDJ 4BCUA 5DXDA 5DDJ1 4HFSA 5J7MA 1PZ7A 1W6QA 3NV4A 4COZA 5C9AC 1S0JA 3MFAA 1C3HA 4LUKA 2EAKA 1YI7A 2B7YA 1QJU2 2H6BA 3L2HA 4G3YC 4GQ7A 4CDXC 4B7KA 1LESA 4KWLA 1RUD2 2GN7A 2D3PA 1LGNA 3VHNA 3WW2A 4AEMA 2CYFA 4LO4B 1AL22 4HETA 2R062 1NCRB 4IEVA 5DG1A 1ZREA 1FPN3 4A3XA 2HWD1 3WUCA 5DDJ3 4YZ3A 4PIXA 3V56A 1XNCA 1VALA 5FAXA 2Q5TA 3URFA 3ZXGA 4OVEA 4JDOA 4JTOA 5IK5A 4Y1XA 2K2SA 4IEQA 5FPZA 3INAA 4N53B 3D82A 1JHNA 3QACA 3GZTB 1PGW2 5ACA2 2DCZA 2ARXA 1F31A 3I59B 1R1A2 3X29B 3ILRA 4FTEA 4KWKA 2A6WA 2WSVA 3VDDA 1AR62 4K40A 2GMEA 3FHIB 2BVBA 3J26N 2HWD3 1LU1A 3VBRC 1AUYA 1H8TA 1UCXA 5BXXA 1AYN3 1IS3A 4EWDA 2UURA 2ZGKA 2PAEA 1Q43A 3THTA 2I2SA 3MIFA 4HN1A 2DVFA 2ZHKA 4MYEA 4UXAA 4S2GA 3UKTA 5GM0A 1ND3A 4J1XA 1M4WA 3VGIA 1H2KA 4EN7B 4FVVA 1KJRA 3J8F3 4AE2A 4DS0A 4YGEA 4PCRA 2VGDA 4GIQA 4YZ1A 5LEJA 2YC0A 5FDBA 2ZGSA 3FUOA 4E4SA 1OPMA 1SCSA 3KS7A 4MUVA 3PNAA 4HK8A 3ZYPA 4KQ7A 4G9SB 4ATFA 3U10A 5C4WA 4BH9A 3ALQA 2PHDA 2ARBA 4Q4Y3 2LM3A 5T54A 1GZWA 2R042 2XJVA 5J36A 3AMQA 1ENRA 1XQNA 5T3NA 1MR5A 5HXVA 2JEMA 4HVOA 3ZDSA 4E9KA 1ZBA1 4IV3C 5ABJC 3ATGA 2V5YA 1IKPA 5E89A 3FLRA 4A7ZA 1MS5A 4META 1JOJA 5KHKA 3S6PA 3JD71 5K7PA 2C9AA 3VZNA 2QZ3A 2NM1A 1A78A 1ND2C 3ZXLA 4S2FA 4BLIA 1URXA 2ZZJA 4DY3A 3NV2A 5EYYA 1QH6A 2E9QA 4I02A 2VQ0A 2R49A 2GNTA 1PNFA 5GLVA 4XETA 1LTEA 1O4ZA 4AI2A 1COV1 4SBVA 2EXHA 2FZ1A 2WT1A 3C3VA 4JGYB 4ZXKA 3JD73 4JGZC 2ZGPA 4CDXA 2JG9B 2OPKA 4R9AA 3B7MA 3G7DA 3BU7A 3V0AB 4CRQA 3IM0A 2HWB2 2ZABA 3CO2A 2BNNA 4HKLA 4OUSA 4X6QB 1PO23 3ZSJA 1CN1A 2NZ9A 4PLNA 1NCQC 1COV3 3GALA 1G7YA 4RHV2 1W6OA 2X29A 1KXGA 1NOVA 4FOVA 2XKPA 1VAVA 3RYRA 4AEDB 3M3EA 2NN8A 3MGUA 1DZRA 3AJZA 4C90A 1C5HA 4XFHA 3U4XA 3KSCA 1Y7BA 4WVWA 3AMPA 1JYIA 1UIJA 3TB0A 1GLHA 3GBGA 3AP5A 5C8CA 1RUG2 4OFGA 4XXPA 5T5JA 2CY6A 4TLFA 4IEUA 1BKZA 4C1XA 3WCRA 2RS31 3AYEA 3KGZA 1KDMA 1ASJ2 2ZHMA 4AFCA 5JSOA 5FMOS 3Q9OA 4XFCA 3PVNA 1MEC2 3DV8A 3OY8A 3NAPB 2MEV3 4GULA 2ES3A 5KXEA 4ITCA 1QQP1 1DGRN 2ZJCA 4Q0UA 3RSJA 1KFUL 2RR12 4XFBA 4LO5B 2WLPA 2Q8OA 3I8TA 1LULA 2VU9A 3AFGA 4HN0A 1FOD2 4QM8A 3ZSKA 4EN0A 3ZXEA 4BIFA 3D0SA 3VBFC 4AI0A 3ZX7A 2JG8C 2RS33 1POV3 3LWCA 2VECA 3IWZA 2IWGB 5T5LA 1HX6A 1C1FA 5GLWA 1U5IA 2ZX3A 4Y24A 1GBGA 3NJZA 4ONUA 3ZXDA 3AMNA 1UU4A 1MS8A 4A2UA 3EXUA 3IBMA 1RUH2 1RUE1 5T50A 1KITA 1YI9A 1OA4A 2WZR1 3M4FA 1S0IA 3A0KA 4AI1A 2ZX4A 1PVC1 5IT6A 1BEV3 2FMDA 5FLIA 4X8NA 4FAGA 2NMNA 3SHRA 3NL1A 1NE4A 3GYDA 1R083 1VP6A 1EYBA 1VIWB 5F1RA 1GSLA 1K5MC 1G8WA 2K9ZA 4HLTA 3ZXKA 1RUE3 2YV8A 4C0HA 2QDRA 4IV1A 4PQ9A 1AR91 5BYNA 3HT2A 2YGLA 2WZR3 4HANA 4Q0VA 2WNUC 5DDJ2 3N35A 1D0HA 4AI8A 1PVC3 4RFT0 2CGPA 2D6NA 4K3UA 2I07B 4QQOA 3H9AA 4YARA 5A3LA 1WMDA 4JGZA 4GKXA 4LLFA 4LBKA 4CDQA 2G9GA 3VDDB 2W52A 1O91A 4NVPA 3SH5A 5CNAA 4W65A 2Q30A 1F8VA 2HWC1 1PK6C 3H3UA 4M3CF 4B4QA 3T1MA 5H9QA 3WZ1A 4N43A 4PLMA 4K20A 2HWD2 1AR93 2ET1A 3NWKA 5TSWA 1PHMA 1OHFA 3WDVA 3ZSLA 4Q2FA 1XRUA 2DFBA 2E7QA 3PVBB 2D40A 2AGSA 5H9PA 1N1VA 2JDZA 1AJOA 4O9EA 3AKPA 2A6YA 3R4DB 3R6SA 1DIWA 4C0BA 1YNAA 2Z5WA 3CJIC 3HR9A 3MF9A 2DURA 3LA3A 4HPKA 1X50A 1F5JA 2VOVA 4UW3A 3RNSA 4I01A 3DPRB 2WC2A 2DTYA 2GNMA 4FPKA 5C4WB 4LT5A 1W2UA 1EAH1 1LENA 3THPA 1DQ6A 3MLJA 5JVVA 1GICA 3PMEA 1U5XA 2X5IC 1AJKA 1GZWB 2CWSA 3OYWA 1QOTA 2VMIA 2YHJA 3VV1A 3AZVA 4FQZA 3B94A 1UN1A 4WM8C 2TNFA 2WIIB 1ZZ6A 1V70A 1AHSA 5BY5A 1JUHA 1W6NB 1ENXA 2OUHA 4IETA 2IZWA 3AYCA 2UWAA 3ZO0B 3O0XA 4OI2A 2ZGTA 1UPIA 3ZN4A 1MZEA 1SMVA 2JE7A 5JR7B 3VBFA 2B9UA 3ZSEA 4B8EA 4P9GA 2KA3A 1PGL1 2JG8A 4AGGA 2FQPA 4MZUA 1EAH3 3SISA 2Q1ZB 1NLSA 1FNZA 4OULA 1S55A 4HT1T 4YSFA 4Z1VA 5JZGA 2CNAA 2GC1A 4MXWA 1ZX5A 2X8KA 2R30A 3ES1A 2A71A 4MGYE 5GALA 1HRV2 2ZZQA 5GZGA 4FXKB 1S0EA 4Y1ZA 5C9AB 1NA1A 1ZBA2 2R0HA 1F2NA 1DZTA 2YPJA 1X33A 2ZGQA 1O3SA 1LOAA 5LK7B 4BOWA 3I7DA 4CDXB 3O14A 1LHUA 2JECA 3JD72 1FV2A 1CAWA 4LLOA 2VPVA 2ZTNA 5CA6A 2XUMA 2IXJA 2VVFA 3EHKA 3TNPB 1X8MA 3M70A 1ZZCA 1LOCA 2IFRA 1J3QA 2XWJB 2WNUA 1IS6A 4MLOA 3AXEA 2RMU3 1COV2 2Z69A 2ZHNA 4B7EA 2QE3A 3ZFGC 3FX3A 4Q4W1 1YFUA 2ILMA 4FTBA 4DB5A 1VB2A 4CEWC 5IK4A 1WD4A 1WGPA 2D6MA 2BBVA 4AK3A 1PK6A 2XGXA 3VBRB 2ZA9A 1YFYA 1XYNA 5FLHA 2D6KA 1XU2A 4CEYC 1DYKA 1QOSA 4CZSA 4DXZA 2W39A 1RUOA 3SMHA 2QFEA 4COUA 3WQ0A 2D7FA 3SXWA 3T2TA 1RB8G 4JV4A 1JN2P 4Q4W3 2IXIA 3E97A 3OGJA 3AFKA 5AVPA 3TN91 2OYZA 5CFCC 1VBE3 1CX4A 1Q8SA 1GNZA 2DF7A 3ZFFC 2OIIA 4P9WA 3CJIA 1MACA 4M3CA 3E5QA 4XJ8A 4B3NA 4P9YA 5J3UA 5LRSA 4WBBA 2DU1A 2TEPA 4D69A 1W6MB 1RJ8A 3H1YA 2YYOA 2ZAAA 2A73B 2X5IA 5L7OC 2NPIA 2IFWA 4GMP1 3TN93 4WM8A 4AXOA 4LO8A 4JCKA 4K1YA 4CDUC 1QQP2 4IV3B 5ABJB 1SCRA 3VKNA 1KFXL 2D6PA 1RUNA 3KLSA 2DVGA 4IQPA 3R05A 1LU2A 1AL0G 3RRDA 4BE3A 1WMFA 4FOYA 1OKQA 4Y20B 1ND2B 1LHNA 1BBT1 4MXVA 5JI7A 1QMJA 4E27A 4Q1RA 4GMP3 5E88A 2QQPA 4AF9A 3WLUA 1YUDA 1H8VA 5EZWA 4E2QA 3POYA 4N7IA 4JAAA 1DF0A 2LUWA 1RVF1 5AVAA 3ENRA 4LBNA 3JCIA 1RUE2 3C2UA 5T5OA 4AQTA 4ES9A 1Z7S2 4IESA 2DV9A 2P34A 2JICA 2WZR2 1XNBA 3POWA 5FPXA 1MS3A 3HT1A 3CLPA 3KCXA 4JGZB 4L11A 3VL9A 1WBFA 4PBPA 1KRIA 1VJ2A 2XKOA 3NKTA 4NWWA 3IT8A 4XJ9A 1BBT3 5BNOC 1RUJ1 4OUMA 4P9IA 3A4UA 1YJKA 3ASIA 2AUYA 3WXPA 2B8MA 1GKBA 4XYXA 3JQWA 1V9U2 3V0BA 1GYKA 2HWE1 4PLOA 1FNYA 1FMD2 1RVF3 2XBO3 2ZGOA 4YM1A 1NCQB 4Q26A 2MHFA 2JX9A 3IKWA 1H8TC 4Y1VA 2OVUA 2QZ2A 4I0AA 1Q8OA 4XEZA 1RUJ3 2GAUA 4AG4A 4AHYA 5JSRA 4CEWA 3KMHA 1QHDA 4I30A 1MVQA 2ENRA 2GSYA 4CTEA 1M06G 1ND3C 3M3IA 3KZ4C 4LULA 1QOOA 3U11A 2HWC2 1RINA 3KQRA 2XB6C 4DQAA 3AZWA 4LBOA 3CEWA 4DMIA 2JD4A 5K8SA 1D4VB 4FOQA 2BGCA 4LNVA 2BUKA 1YFXA 2PHTA 5CFCA 4FAHA 3ZFFA 3AKSA 1RMU1 3M3CA 3VBFB 1YFWA 1TNFA 2JG8B 2WA3A 1H0BA 1ULFA 5CFDC 5CB7A 4CP2A 5KHIA 1XYOA 3WW1A 5AFBA 2CTVA 1EAH2 1HLCA 3VHRA 1ZBE1 3EBRA 2CL2A 4OHZA 5CIRA 4MXWB 2ZPXA 2DUQA 3LSDA 1CAUA 2YUEA 2W68A 3NVCA 4CDUA 3TOJA 5FLJA 1RGSA 5CVRA 1RMU3 1WLDA 4BYYA 1FPN1 1OQDA 1A8MA 2E63A 2GC2A 1KQRA 2IXLA 1GANA 1PIV1 5A33B 1S0FA 2I45A 1CAWB 1PGL2 1PVXA 2BNMA 1JXNA 2H0VA 4Q0QA 1ZBE3 2MPFA 3LGRA 4HZFA 4WVZA 3B01A 1RUI1 1K5MB 2A5ZA 4XZPA 2DWRA 2WT0A 1CESA 4KNCA 4FQ4A 5KHGA 2WA4A 1GNHA 2WNEA 4Q1PA 4XF9A 4YG6A 2WNUB 3LOBA 1XU1A 4UW6A 1MS9A 1AYN1 3HIFA 4XHBA 1PIV3 1H2NA 1Y3TA 5BNOA 3VBHA 1O5LA 1SBDA 1SBFA 2XLFA 5K0UC 4QT6A 1LOFC 1F9KA 1OQEA 2VY0A 1PK6B 1V00A 1RUI3 4Z8BA 1DU3D 1WLCA 1DQ4A 2B46X 3J8F1 3O0WA 4NOTA 4XJZA 3VKLA 5C8CC 2PHLA 3MIDA 1HRI3 3R4UA 5I0TA 4JC1A 4N9IA 4HVQA 1AXZA 4CP0A 5J96B 4BWOA 2P3IA 2GH8A 2WS91 1RHI1 3E6DA 4Q4Y1 2H6CA 3IPVB 4Q4W2 1AF9A 2XLAA 2JXAA 4BHPA 4LE4A 4L2NA 3ZIXA 2KXLA 3QH7A 2Z79A 4ISQA 4R9DA 4E4ZA 1G86A 4R52A 3ME2A 1HXS1 3RMXA 3R0RA 1VBD1 2X5IB 3RQ0A 3IDEA 1DGRA 1LOEA 1VRH1 1KDKA 3AB0A 5J48A 3FLPA 2OA2A 2WS93 1RHI3 4WM8B 1OA3A 3RPQA 2JKBA 4Y5Z0 5AFEA 1O3TA 1W39A 4PIZA 3TN92 4BM8A 2Q0AA 4OHWA 1X7NA 1ZRCA 3N7MA 3VZLA 2E53A 4FPHA 4FPGA 5KXCA 2HYKA 2ZHLA 4DRRA 4EJRA 4WV8A 1U12A 1RUF1 1DGWX 1HXS3 5CFDA 1VBD3 1RUC3 3DUIA 1LHOA 1CD3G 4QD2A 2R6QA 5DUVA 5GLUA 1VRH3 2EXJA 4Z92B 2R16A 4ORFA 4QPGC 2FZ2A 2W0XA 4QPYA 2WNVB 1SFNA 4OHYA 4KU7A 5BV6A 1PO21 3AMMA 2WJSA 1UD1A 2D6LX 4IV1C 2DYCA 4L92A 2P37A 2XVKA 1QJY2 4LBQA 3TBDA 5KBFA 1RUF3 1GV9A 1AR81 1DFQA 1FX5A 4Q29A 1BBT2 4N7UA 4UBHA 2DVDA 4IEWA 4FPCA 4Q8KA 4CDQC 1H2MA 1MZ6A 4YYOA 1UF2C 2QVSB 3PJQA 3N4MA 4LHLA 1AR73 2ZGNA 1A8DA 5FO8B 4PDWA 1SLBA 2XHKA 3I2DA 1RVF2 4N43C 4YVSC 3B93A 4I3PA 3ZFGB 4XJAA 1JBCA 1AR83 1H30A 3KCCA 4ZU4A 3M1HA 1BCXA 4CEWB 2K0GA 1RUJ2 1V6JA 5K0UA 1LOFA 2CWMA 2MEV1 3AZZA 5FMOL 3ZXAC 1KS4A 3AP6A 3QCWA 2HWE2 4PIYA 1Z78A 4CEYB 1JYCA 5JOXA 3EJKA 3SNMA 3ELNA 2VUJA 4LO7A 4ASLA 2GU9A 1G9CA 3LZZA 1BZWA 4LA2A 3E5XA 2D5HA 1POV1 5J09A 1I5ZA 4ZU7A 2WKKA 5CFCB 1UZYA 4AHZA 3KT4A 2BYVE 3ZFFB 3APBA 2A7AA 1SLTA 4AVVA 4YFZA 4B4RA 4TSVA 2PHWA 4YZ5A 2NMOA 4XTMA 1V6IA 1H1IA 3WNXA 4EV0A 1BEV1 5L36A 5CAZA 5KC5A 5L7OB 1PMIA 3OJBA 4LBMA 3W9AA 3B69A 4Y22B 4RL7A 2NYYA 5HCAA 1EY2A 1LEMA 1R081 4D7SA 3UKNA 1CAUB 1RC6A 3N7JA 4Y26A 1VBB2 3TNQA 4CDUB 1J58A 5CBLA 5JZGC 3AK0A 3WQ1A 1YO8A 1TMF1 2ERFA 2O8OA 2ZX0A 3FZ3A 4AFDA 1VAMA 1RMU2 3IMNA 1W6QB 4IXLA 1OOPC 1QNYA 1NA1C 3MIGA 4XFIA 1L3JA 1LHVA 3V65A 2ZKNA 4XTPA 5H9RA 3ZYRA 1DGWA 4H3WA 3SH4A 1UX6A 3GHMA 1HV1A 5BNNC 5E1RA 2O8QA 4QPGA 5FQ0A 5FCCA 3HAGA 1QKQA 3PHMA 5KHHA 3FE5A 3JBG1 4QGLA 5IK7A 4LHNA 1Q8PA 4XF4A 1CVNA 1TMF3 4YFWA 5FOBB 1POV0 1QGLA 4AGRA 5JSPA 1FPN2 5DUXA 4EROA 3LOIA 2CGOA 3WT3A 5FO7B 1U5YA 1VR3A 3WHTA 5J37A 2UY9A 5BNOB 3PJYA 3H1WA 1C5IA 1PIV2 4HKWA 1OD5A 3R4SA 2RS11 3VUOA 3AKRA 1N47A 3MYXA 5IK8A 4QPIC 1JW6A 3JBG3 3I4IA 1RUI2 1WW6A 3KT1A 1LECA 4YLZA 4EN6B 4Y1UA 1Y43B 3RWNA 2P3JA 3LA2A 4K21A 3WG1A 3KCYA 3KD4A 1H8TB 4YVSA 3MLKA 5BNPC 1EP0A 1I6XA 4EN8B 4KL1A 1AYN2 1OA2A 4I0WB 4QM9A 5FFOC 3DGTA 1QJZA 2RS13 1QNWA 2R32A 3MIHA 3CF6E 3VLBB 1ND3B 1QY4A 3ACLA 1D2QA 3O12A 3D0JA 3PVEA 2N7GA 4UBGA 1QJX3 1IZ3A 3J4UH 2Z42A 2MNGA 3J8F2 4A7YA 3MW4A 4H7MA 3POSA 2XJQA 5C8WA 3NSTA 3L9JT 4KH9A 5SV5A 1VBC1 4RQPA 4WVVA 3IDCB 5D1IA 1BVP1 4R4XA 4NHMA 1GFF2 2XL7A 3ZSMA 2WS92 1ALYA 1RHI2 4Q4Y2 3VBUA 2GNBA 2G9FA 1H1MA 5I8YA 5EJ3A 4P5HA 2BFUS 5GJ6A 2BTVC 4JDMA 5EFUA 4N9HA 3ZIWA 4YW1A 4X6RB 1WW4A 3VKFC 3M2MA 4LE3A 5CFDB 2B45X 2EF6A 2ETEA 2R1BA 4AHXA 1D4M3 3MEPA 1VBC3 4DNYA 5B2GB 5T5PA 4GA9A 4ISRA 4MSVA 3BOWA 4LBQD 1VRH2 4TZDA 1C8NA 2EA7A 1V6LA 1QWRA 1G9FA 3BTAA 5FREA 3VBSC 3VHPA 2RJKA 1OOPA 4DY5A 1PNGA 5EXOA 2RMU1 1S0BA 4XQWA 1RUF2 5AC91 5BNNA 1ULEA 4WM7C 1AXKA 3IDBB 4K8FA 2RS53 4Q4V3 3M8LA 4XXAA 1KS5A 1QXPA 2A75A 5EWSA 1IQAA 1KJLA 3TYJA 4YGBA 2IXHA 5F6KA 2ATFA 1ULGA 2AENA 1BXHA 4WZCA 5JOYA 3EQEA 5GKAC 4MV2A 4XIOA 1C4RA 1UZZA 1PO22 2A6XA 3VBOC 4BMEA 1W6OB 3H0OA 2PLV1 1AYM1 1H2LA 1G9DA 4J1WA 2DCTA 3HD8B 1IPJA 5AC93 1AR82 2VOWA 5K0UB 2SLIA 2HWF1 2VH9A 1N1SA 3FFZA 4NPRA 4QPIA 1VBE1 1QDCA 2D43A 5C8CB 4FXGB 3AYDA 4XFAA 4WZFA 1NCRA 4W6XA 5BNPA 1D2SA 1BK1A 2VNGA 4YW3A 1LEDA 2PLV3 3AXDA 2H0BA 1YIPA 1AYM3 3LAGA 2ET7A 3OTFA 4FPYA 2D93A 4PBOA 3OY8B 4TYSA 2GDFA 5KC6A 1R1A3 2HWF3 5CADA 3K48A 1AR63 3MIBA 1IOAA 1O3QA 3I59A 2QUOA 2MEV2