4W6YA

Co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf9
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
SSASSAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F18 fimbrial adhesin AC
publication title Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli dh5[alpha]
molecule tags Cell adhesion
total genus 33
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4w6yA00
4B4RA 4B4PA 4W6YA 4BWOA 4W6WA 4B4QA 4W6XA
chains in the Genus database with same CATH superfamily
2VGDA 2IXIA 2RJLA 1FV3A 2Y0OA 1JN2P 3AP5A 3T2TA 2DVGA 5BNPB 2KR2A 3BODA 5FP9A 4OUMA 5HV4A 1AR83 4PDWC 4QHOA 4A3XA 4KQ7A 3KHBA 2VMHA 1YNAA 3ALQA 3AZWA 3NV3A 2A6XA 1F35A 3HT2A 4Q4V1 3VBUA 5B4NA 1OMIA 1RJ7A 3KHCA 1QJU3 2CL2A 4PQQA 2WUHA 5IUQA 1QDOA 2E53A 3M3OA 1BHGA 4L2NA 4LMFA 4XHXA 4ARYA 4Y5SA 1RUD3 1ZBA3 2VBPA 4JGZB 5EZWA 1LEDA 1POQA 4LA3A 5FK7A 2ET7A 2WC2A 1DZTA 1Y9MA 5A6YA 3WDUA 1B35B 1ZNPA 4E27A 3BOPA 4NOTA 2X8KA 3ZXJA 1VB2A 2J1RA 3GZTB 1KFXL 3GCWA 3BTXA 3QBQA 4AYUA 1OA2A 1L7RA 2YBSA 2WLPA 1UYPA 4XF3A 3V56A 3ITQA 3J26N 1TEIA 4RS5A 3NV1A 3WUCA 5K0UB 5FYVA 3QH7A 1VBB2 2IVJA 1QXPA 4IV1C 1AR63 5A1LA 3LQCA 2ZCWA 2FHRA 5A3UA 2D6OX 3AKRA 4FBFA 3UESA 4IV3A 1LGCA 3CJXA 3USSA 4META 1RUJ3 1NCQA 1SLIA 3S57A 2G9FA 2BFUL 3I3BA 2KM2A 3AM2A 3VBHC 2XH6A 4Y1YA 2ES3A 3WW4A 4OVEA 3VDBA 3L9JT 4WM8C 1LNSA 2CHHA 2RS53 3S30A 5ABJC 2Z42A 4XFHA 1D4M2 2WNUB 4WVZA 1DF0A 3IKWA 4K8RB 1ZBE1 4NE9A 4NVPA 4YVSC 1RUE3 1W0OA 4HLTA 4Y4YA 3CNAA 2JDNA 3M3CA 3B7MA 3ACFA 3NQHA 1V6KA 2LUWA 4J25A 4MGZE 4UT5A 4TWTA 4PJYA 3E5XA 3CMGA 1AR72 3Q8FA 5KHHA 5A7QA 4V2WA 5C71A 4JGZA 5I8SA 3B5LB 5K8SA 1MZEA 5B2GB 5DQ0A 1UYXA 2BGCA 2HWC1 4ISQA 5EWSA 1GP4A 2XJRA 1JH5A 3W5MA 1RYYA 5EPAA 1OC1A 4I0WB 2R062 1Z0HA 4LBQA 2VD7A 4N43A 3WX5A 1V6MA 1WMDA 3TYJA 1XNTA 1BKZA 2D3RA 1NZCA 1G9BA 1JZ7A 3VV1A 1UY0A 1BBT2 4DNYA 2MNGA 4FPGA 1W0NA 1ZZBA 4XPVA 1IQDC 3WF3A 5C8CC 2XL7A 1J3QA 1J1LA 5DMYA 3TEZA 3KVBA 3MIBA 5F1RA 4A44A 3BOWA 3CEWA 1H4GA 2R7EB 2VJXA 3OD4A 3OG2A 4QAWA 4QX1A 3ECQA 4BQ3A 1YRZA 2C5DA 4ITCA 3ATGA 3O5SA 3H42B 3SITA 3A4UA 3MV11 2WINB 1LHOA 3C7FA 4YVWA 5LATA 2VOTA 3HQRA 2ZKNA 4S2DA 5FMBA 1S0FA 4C1XA 1NXD1 4K1ZA 4PBPA 3WG1A 3S0MA 4XBNA 1GUIA 3EXUA 1RUG1 5LK5A 1RHI2 4Y1ZA 5FP8A 5D8AC 1O5LA 2UY8A 4NPMA 5FZBA 3H1MA 2Z4FA 1VBA2 4AI9A 5KC6A 2Y33A 5EYYA 4KI5M 1QWRA 1SLTA 1AXZA 5K9YA 3EB7A 5HCFA 5LRRA 4YW1A 2XOMA 1VLNA 1NLSA 5FO9B 3ZXLA 1GOGA 4W6YA 1AYM2 4A45A 1AR81 1XYNA 2BZDA 3K4DA 2H0VA 3FFQA 1U12A 4FP2A 3VBRB 4D6SA 3NRUA 1PO13 3O1PA 1ODMA 4YG6A 1APNA 1LJ7A 3NNMA 1AZDA 1R1A3 2VCCA 1CR7A 1QJU1 3A21A 3LSDA 3WP6A 3MW4A 2WN2A 4LR4A 1I6XA 5FPLA 3ZPOA 4Q29A 4UF0B 5KHGA 1RMU3 1RUD1 1ZBA1 2Z2SB 4YZ1A 4NHXA 4GB33 1G86A 4XAEA 1PM4A 2VCBA 3I2OA 4UW6A 2WQ8A 4LITA 2J22A 2ZPXA 1JZ4A 4M0NA 4P00B 1UIKA 4R9BA 5IVEA 1WW6A 1ND3A 1KXGA 4AGRA 1HB1A 4QX2A 3GJBA 4MSVA 5BUVA 2YROA 4LO5B 4DB5A 2WZR2 1WW7A 2R043 3E6BA 5LEJA 4NROA 2QDRA 1C8NA 1HKDA 4KH9A 5JR2A 3B00A 3J7HA 1ALYA 3LCPA 2OIIA 2XBO2 4KMQA 3W20A 3N9PA 5J1XA 3K46A 3ZN4A 5CG9A 3UGGA 2AC1A 2BJSA 2RM21 1ENRA 3EHKA 1AX0A 1RUF2 2RS31 3N9LA 4Z82A 1EV11 3PIJA 2JDZA 1MEC3 1RUJ1 3KMHA 4UFLA 5ERLA 3EMRA 1UKRA 1Q8QA 1OA3A 3FHQA 5HCAA 1UAIA 3TEXA 3T0AA 4RD7A 5BNNC 4UBHA 1T2XA 4QWNA 4W4ZA 1X8EA 5LBEA 1HRV3 4WV8A 5L7OC 1H1AA 5APAA 2D43A 5A7OA 1BK1A 1Q3EA 3VBRA 3AP4A 4JKMA 4MH0E 2CDPA 3THPA 5C70A 3EQEA 5GJ6A 3RZGA 4BQ5A 1SG3A 3AYAA 5FPVA 2ZEZA 4GKYA 2OPWA 2Y64A 4HSLA 3AFGA 1HRI1 2EICA 3ZSKA 4QGMA 4Q4Y1 5J09A 4IEYA 2JDMA 2PHRA 1BYHA 1LHWA 1HIXA 1PNFA 3S6PA 1AXYA 2VXJA 1T6BX 3DEMA 5JXHA 5JOXA 2JB8A 1SPPB 2W39A 3POEA 5FLIA 4A6SA 1QOTA 2LALA 4OI1A 5FZKA 2P1BA 1OUSA 4PIXA 3UGHA 1BXHA 2VNOA 3IDAA 2DFBA 2WYFA 2QQNA 1IPSA 4MUVA 4QQPA 3DUIA 3RS6A 2BUKA 3NAPC 2JG8A 1DQ6A 2F6BA 2X5IA 3KV4A 4FFIA 5T5OA 3T08A 1RVF2 4HOOA 2Z5WA 4MGSA 4BXFA 5BPXA 3ZFFB 3BIWE 3RMXA 1HN0A 1QQP1 1ND2B 1QXJA 1RUH2 4ZXEA 1K5JA 2FDJA 3RWKX 4D8MA 5C3OA 4Q4W2 3JZVA 4MXWB 3R4DB 3LF7A 2PLV3 1S0BA 3POBA 1GZ9A 1JXNA 1PZ7A 1Y9QA 3AYEA 1GP5A 4IV3C 5JSPA 1W8NA 1SLCA 2FD8A 1Y3TA 4CP0A 2VXRA 1NCQC 1D0GA 3RYRA 4O65A 2P3KA 1W6QB 4HVQA 5AFEA 2GSYA 1CAWA 2XGXA 4R9CA 5FY4A 2RJKA 5E1RA 4Q4V2 2J1EA 4DXZA 3E5UA 2BPA2 2QJVA 1NCRB 5LB6A 3O1MA 3K2OA 3CHXA 4UOJA 1O8PA 2N7GA 3VBOB 1H8TB 3PU3A 2Q8OA 3T2PA 4COZA 2FDIA 1PO11 1VB4A 5T55A 5FY8A 4E4HA 4PHZA 2DFCA 1PVC2 1R1A1 2YY1A 3I3DA 1URXA 3OCPA 4MO3M 3WW1A 4E2QA 4XC9A 3MEPA 4IE6A 4DXSA 3AKTA 1NUKA 1CPNA 1RMU1 3GM8A 3OGSA 1W8ZA 4GB31 3C7OA 4M3CB 3T2OA 5IVFA 5AC92 1YQ5A 4XCAA 4ES8A 2IC1A 3NSTA 2XVLA 5A3PA 3DPRA 3WVJA 2WNVB 4HXCA 5DDJ3 4FOYA 1ENSA 3MIDA 1V6IA 3QLQA 2JDYA 2UYBA 3N7KA 4N43C 1K5MB 2R041 2VBDA 5H9SA 4HFSA 3GHNA 3ZFFA 4F8AA 2P37A 4CDWA 1ND2A 3OUIA 4QX0A 3VLBB 4BIFA 3CF6E 4RR3B 4MXWA 2Q5TA 4BM8A 1QH6A 2ZGTA 1OXCA 5BV6A 4IEZA 2JE8A 4LA2A 1FATA 1MEC1 1GOHA 2E32A 1G9CA 1CVNA 1W3VA 1S0EA 1NQDA 1SDWA 1SBFA 1F5FA 1W6QA 4E2SA 1ZBE2 4JRLA 4AFBA 4OCTA 3TWIA 4CP9B 2ZEXA 2HLEA 1NCRA 5DXDA 2VTFA 2PYTA 1MVEA 1HRV1 3VBOA 1H2KA 3J7NA 4QPGA 2AH2A 1K12A 2HWD3 4R4ZA 5H9PA 1WD3A 1ZRDA 3AKQA 2L9LA 1YEWA 2HWF2 2XQRA 3LA3A 3ZYPA 2HWC2 3B69A 5FZEA 2EXIA 3D4KA 4OUEA 5T54A 3RRDA 5FIXA 3LKJA 3GHMA 4FXKB 4QQLA 2FMDA 4AFCA 2JECA 4MLOA 5IWFA 3TN93 3J8F3 1YFYA 4GH4B 4CCOA 1DGWA 2WNVA 5CU1A 1AJKA 3G7DA 4AI0A 3DXTA 1YFUA 2Z79A 1OVPA 5FPUA 1ZRFA 4F83A 1S2KA 3IM0A 3WDWA 3H3UA 3NW4A 4B4PA 2WKKA 3O1RA 2ZACA 3ZFGB 2Q30A 3FN9A 4W6WA 1NLQA 1FV2A 3ZN6B 2E33A 3KQRA 4BQ4A 4AGGA 1PX3A 4FPCA 1COV3 2BERA 4Y3OA 4CDQA 1ND3C 1VAKA 3TNPB 1TVGA 4QGLA 1S0IA 3D82A 3DYMA 5LA1A 5F5QA 1TNFA 4QB1A 3PLQA 1T6GC 1RUG2 1GMMA 2FMYA 4FOQA 5A6XA 2DF7A 2RR13 2EVXA 4FQ4A 4YWAA 3QCWA 1CESA 4LEJA 5LRSA 1KFUL 1DQ4A 1HV1A 1XU1A 4FPFA 2B9VA 2LS6A 2Y26A 2B7YA 1VALA 4AVAA 2Q1ZB 5JSOA 5F32A 4Q0PA 5FYHA 4YZ4A 4XW3A 2YPJA 4CVUA 2D6MA 1AR82 3HEIA 4CEYB 3KD4A 2RE9A 5CKQA 4QQHA 2W1SA 1V9U3 1W6OB 2HBUA 4EN6B 5A1AA 2J42A 2RS13 3KCYA 3ZXEA 1QJU2 1HDKA 1PIV3 2I74A 1RTVA 2A73B 3I3EA 4KWKA 4PF5A 4IEXA 1W0PA 4Y5TA 3E6CC 3POGA 2VR4A 2K9ZA 1H6XA 1RUD2 1ZBA2 5DAXA 5T5PA 1H0BA 4I30A 4LUMA 3WCSA 2MEV3 4YM2A 5A1FA 3JU9A 2ETEA 1XXNA 2QQOA 4HKWA 4GWMA 2WAAA 4H3WA 5T5JA 4N7UA 2EXHA 4EYUA 5GZCA 3HMYA 4BLIA 4EV0A 4GAZA 1BEV3 3ZFGA 3ZXGA 3PVBB 4Z2WA 1CD3G 3ZN6A 4G4FA 2VCMA 3D5OA 3H50A 1X9TA 1OQDA 4P9WA 3VBSB 1HB3A 4AW7A 3PMSA 4XF0A 3WLUA 4EJRA 1AR62 3AZYA 3K75B 3WP5A 5LK7B 1QXRA 1AL0G 4Y20B 4BISA 1UOBA 4EZ4A 3HIFA 3KV5A 5I0RA 2RS32 1UZZA 1V6LA 5L9RA 1A8MA 3Q9OA 1EV12 4XTMA 5FR3A 1RUJ2 3OGGA 3J9SA 3LOIA 4INDA 4L0PA 5A7PA 5GALA 4QM8A 2JG9C 2FDFA 4YFZA 5A6ZA 2JG8C 4H7MA 2JDPA 2X5IC 4YSFA 3D8CA 3KWVA 5FYUA 4TYSA 1LOAA 3VD4A 1W8HA 4AEDA 2RHPA 1EPWA 4TN7A 4Z07A 4LLOA 4AEJA 4CEYA 1NG0A 2CWMA 4EN8B 4A7KA 3LPFA 5I0TA 1O59A 2QTWB 1PMHX 3V0BB 2W95A 1U0AA 1VBE3 3AJYA 3C7HA 3I2FA 2DDUA 2WSUA 4K40A 4IGPA 4Q4Y2 4RQPC 2HWD1 1JS9A 3CJIC 2VMDA 4O61A 3PHMA 5J7MA 2GAUA 4HSJA 4CDUC 1ZX5A 2EALA 4IESA 3OTFA 4GXLA 5F3CA 4RSUA 3O0WA 3ZOIA 4XUPA 1GNHA 4XMAA 3MIGA 4YW7A 3NJYA 1TG7A 3RPQA 1UNBA 3UNPA 3TN91 1F5JA 1UY3A 2EIDA 3ZSJA 2ZS6B 5L36A 4AVVA 2ZGSA 2GC3A 2ZGRA 4IETA 4YYOA 3T30A 4FPLA 5E88A 5FOJB 3VBSA 4ZKTB 2D7FA 4NHMA 2VNGA 5G05L 5CFDC 3ABZA 1LHVA 2J1UA 4HANA 2XWBB 4OQ8A 2R0FA 5GLZA 3M3QA 3POFA 3THTA 4H7LA 4EWDA 4AE2A 1W3XA 1UX6A 1WKYA 3GBFA 2CGOA 1JHJA 4TTGA 4RHV3 1UIJA 2PHWA 2K0GA 5GKAC 5CAZA 2K46A 3EYPA 3O1UA 4BMEA 4SBVA 1LECA 5KXDA 2W2IA 2YFZA 3TEWA 1LENA 2GMEA 4CDWC 4U2AA 4CCEA 2NZ9A 4UFIA 2YMZA 3WY6A 2RR11 4DFSA 3NJVA 5FYTA 1IZ3A 2ZGMA 1W6NA 1JTZX 3V0BA 5CISA 3P6BA 1DQ5A 3BVCA 1JU4A 4R9AA 4AEMA 1VMFA 2WSVA 2VZTA 3AMQA 1LB2A 3FE5A 2ZABA 1V6OA 2XJSA 3WG2A 1A34A 3H8UA 3BPZA 1FNYA 1VP6A 1PO12 2GP5A 4QQOA 1U5IA 3IIAA 3QD6A 2R1BA 4JGYA 1R1A2 2RS11 4YG3A 2PHFA 1HN1A 5HI0A 4FFHA 1RMU2 5IVCA 2OS2A 4GB32 2G19A 1K3IA 2MEV1 2R30A 2V5YA 4Q4X3 5EYXA 1ULCA 1WD4A 4LTAA 4Y33A 5F2SA 1JOPA 1MR5A 1PX4A 3CL1A 4D94A 1B09A 1RINA 3M3IA 2ILMA 5DZEA 1BEV1 4Q8KA 1VAMA 3ZLIA 5BNOC 4RGKA 1PGW2 4NIDA 2ZBJA 2R042 1ULPA 3K4AA 1DHKB 2WT1A 4RGGA 3NNFA 4CCCA 1JZ3A 4JTOA 4LKSA 1UZWA 2SLIA 4I02A 1F9KA 3RZLA 3HWJA 1UOFA 2YGLA 4QB6A 4LBJA 3U75A 3M2MA 2CWSA 5DABA 3SH5A 4NO4A 4RA0A 1CX1A 5JI7A 5I0UA 2HH9A 3NV2A 3MLLA 4CPBA 2JENA 2OX0A 2B46X 1MEC2 1HQLA 1GZWA 4I3PA 4LNVA 4E4SA 4CDQC 1W6MB 1VIWB 4O9EA 4HETA 2FZ1A 1UPSA 2XKPA 4CDXB 3M8LA 2ADEA 2D93A 5FZ1A 5HPOA 1CPMA 1LHNA 2WT2A 1ULEA 1UMHA 3ZYIB 2WZ8A 5L7OB 1HRV2 3ZO0B 5FZ7A 3SH4A 4DZGA 4S2HA 3WT3A 1JYVA 1DQ0A 1BCXA 2D6PA 3NVCA 4LBOA 5BXXA 3PDQA 1RXGA 2Z69A 1VBE1 5A3LA 5IFTA 4K3UA 3J7MA 1L7QA 3AMHA 3OEBA 3M7AA 1IS3A 1MQTC 4ZU5A 3I2KA 1F31A 4K9SA 3WP4A 2VW0A 1VBD3 4JQTA 5I93A 4C90A 2BU9A 3AXEA 3KVAA 2R16A 3SH3A 4MHRA 4I09A 1ONAA 1W28A 1H9WA 1I5PA 3AP9A 2BNNA 1BQPA 4GMP0 2E51A 1YJKA 2XJPA 5KXEA 1FT9A 3PU8A 5FZCA 3BTZA 3BIEA 4UW5A 1HX6A 1XB9A 4BYYA 3HR9A 5A7SA 3CU7A 2VUAA 5T5LA 3ZR6A 1YUDA 2E6VA 3B9CA 4HG6B 3B9IA 5CYYA 4AQ6A 4D6RA 4N8MA 3JB8A 1R093 3NAPB 4AI1A 1MPXA 3HQUA 4AR2A 3OJBA 3OEAA 5IK4A 1OSGA 3KF3A 3OGVA 4QPIB 3LZZA 1R64A 4A7YA 4CEWC 1TME3 1XNAA 3GNEA 4HVOA 4IEUA 2BTVC 1WCQA 2WABA 1NZIA 1PNGA 4JTNA 3VGIA 3WNXA 2O14A 3ILFA 4HKOA 1W9FA 1GQGA 2VMCA 4LXLA 4XJ8A 1IOAA 3U14A 5L9VA 1M06G 3MV01 3D3AA 5CG8A 2W1UA 4CDXA 2SBAA 3LFIA 3JBG3 2AENA 2BGPA 2DU1A 2PLV2 4KWUA 1PK6B 4LBNA 4V1PA 3HOBA 2YC0A 3USUB 5FZMA 1X50A 4ZZ5A 1EY2A 3ZKYA 5C4WB 1PVC1 4C1WA 1CJDA 2FBEA 4AVSA 2WQ4A 4P14A 2W1QA 1AX2A 3ZSMA 3WQ0A 1Z7S3 2A6ZA 1SZBA 4A41A 4YZ3A 1D0HA 1W04A 3PNAA 1DGRN 3EJKA 4NIAA 5AC91 3O0VA 4AGVA 3FL7A 3VDDC 1QF3A 1QJX3 4PI0A 2QCSB 1NYWA 1AF9A 3WG3A 1GWMA 1RUI3 4IUGA 4J1XA 1CAVB 3I97A 3JB4C 4FPJA 1W2TA 2W91A 4NUBA 4BMBA 1YIPA 2OXBA 3OBAA 3BU7A 1SCRA 4OZXA 1KRIA 3NNLA 5F8PA 2P6CA 4Q4X1 4XYXA 4FPHA 5FYMA 3RZKA 2FQPA 2K2SA 4HONA 4B29A 4E8CA 1DQ1A 5DDJ2 4FI9A 2QNKA 2Y38A 3JD73 4QPIA 5A3OA 1DYKA 1RIRA 2VQAA 3LEMA 3UGFA 1L3JA 1RITA 2PHLA 4Z1VA 3VL8A 5C7GA 3P3NA 1PMIA 3DN7A 5BNPA 2VQUA 1LODA 3CBNA 3KF5A 5FO7B 5JXGA 5FYIA 2W1WA 2HWB3 2A7AA 5SV5A 3VBFB 4HN0A 2HJIA 5DUXA 2NN8A 2VZUA 2XLFA 3SHRA 4GWIA 3N9OA 3WR0A 4YM3A 5ACA3 1PK6A 2QQWA 4MADA 4GKXA 2YU1A 3USUA 3U4XA 1OFNA 3AX4A 4XBLA 5FY9A 5C4WA 5FZ6A 2HWF1 4W6XA 5JPNB 1FYUA 4XHBA 2QVSB 5FZAA 4LKFA 1B35A 1F4AA 4XQWA 5DG2A 3AMPA 3ST7A 4LBMA 3LEIA 2CAUA 1SFYA 5JDBA 2V73A 5DAWA 1VMJA 4MXVA 1XJAA 1MVQA 2DVDA 5F6KA 2HWD2 3PUQA 1U5ZA 3LB9A 2BW8A 3ZDVA 3AZVA 3IAQA 5F5CA 5K0UA 4BIOA 1H4HA 2XUEA 4JKKA 1CAVA 2WIIB 4NIHA 4LPLA 3BTAA 2D6KA 3CZJA 3HBZA 2WZEA 3I59B 2VBBA 2W9XA 3URFA 3WDTA 5JMCA 1H2NA 4DEVA 3WF4A 3NJXA 1JOBA 3TN92 4DRRA 4LE4A 5FY0A 3OUHA 1X8MA 4JGYC 5A6QA 3OPWA 1NY71 4OZOA 5SV8A 3I2GA 3WF1A 1NAEA 1ZM1A 4MG2A 2CGPA 2VZVA 2WNUA 2XQXA 3BPSA 4JQRA 3MW3A 4B1MA 2WZPP 5JXJA 4FTSA 3I2HA 1W8TA 1OH4A 3VBFA 1GZTA 2G9GA 4LO8A 1HQWA 3HN3A 3BKZA 2W68A 2ZHLA 4WM7C 4IEQA 4QDQA 2HYXA 1NE6A 4BK4A 5JUVA 1JU3A 1C5IA 4OQ9A 3ZYGA 2AYHA 3T4HB 5L73A 4DMIA 1H6YA 2BNMA 3GJAA 3I2IA 3I54A 1QIQA 1YXWA 3FX3A 4Z2AA 5C33A 3POJA 4FSJA 4F3JA 2VPVA 3V64A 1W8WA 1QJEA 2RR12 1SQ4A 1S0DA 4CTEA 3JBG1 1NE4A 4B7EA 4QXHA 5FBJA 4Y24A 4KL1A 2VAUA 4Q1RA 4W65A 1FPN3 3ZKUA 5E6HA 4BWOA 3IWZA 4I01A 1WZXA 2YU2A 3MF6A 4HN1A 3VZOA 2LTNA 1SFPA 3TOJA 2WA4A 2A6VA 3ZFEC 3BU0A 1VMHA 3OPTA 1A8DA 2RS12 2ARAA 2W94A 4XJAA 3WCRA 2ERFA 4OHXA 1NA1C 2WFF3 1RUOA 1QJX1 5L19A 4P9GA 3C2UA 2MEV2 3MGUA 4CRQA 1RUI1 3B93A 1KDKA 4N53B 1MZ5A 2JX9A 1AR61 1LOFC 2E7AA 4OMDA 4Q8LA 2TNFA 3K51A 2GALA 3N36A 4FPOB 3ZSLA 2I45A 4BPZA 1ZREA 3I4IA 4P08A 2OZJA 3DXUA 3KZ4C 2VM9A 3AVRA 1BEV2 1KGYA 2C26A 3OY8B 1XC6A 3K48A 3ZIWA 4X6QB 1XSQA 1O3TA 4Z92B 4P9IA 3JD71 5FZ0A 3CQOA 5C9AB 5FZOB 2RS51 1H8VA 1H9PA 5JOZA 4HVRA 5HCHA 5FYCA 4FPKA 4FOWA 1TQ5A 1W8OA 3UK9A 1RUE1 1Y4WA 1LOEA 3B94A 2DCYA 4RFT0 4G9SB 4YNIA 5ACA1 4IXLA 3AMMA 3ENRA 3HVDA 1GNYA 4A2UA 3APBA 4UF0A 2YC4A 2WO2A 1W9YA 2VE1A 3WP3A 2DBIA 1PO23 2VCAA 1MZ6A 3ORJA 3B01A 3VBUC 3ES4A 2B8MA 3E1F1 3FWEA 2BOIA 5BY5A 1C8M3 5EP9A 1VBE2 2YPDA 1N1SA 2W3JA 4FPYA 3E97A 1WUVA 1RL3A 5FZ3A 2QQJA 3LA7A 2E7TA 3ZX7A 1VRBA 3IPVB 3OB8A 3AK0A 2P34A 2DURA 1W99A 5IAVA 4CXWA 1W2OA 2AZ5A 3PUSA 3W59A 2QFEA 4FAGA 5CEHA 1W6PB 1WW5A 2B9UA 5JZGB 5KXBA 1GWLA 1FXZA 5DPNA 1C4RA 1Y9GA 2AEZA 1LHUA 4RS5C 4JDNA 1QNYA 5IATA 4EWEA 4P5HA 3GCXA 3MW2A 3Q8BA 4YZ2A 2OVUA 3DYOA 5C9AA 4P9LA 3VKOA 5FZOA 3KV6A 4R8HA 2GC1A 3DCQA 3W21A 3MLKA 3SKJE 4WBBA 1ZRRA 1GFF2 4PLOA 5DUWA 5CFCB 3RDIA 1E5IA 5FQ0B 4YGCA 1ZZ6A 4RHV2 2G1MA 1PZ9A 4QKDA 5K7PA 1SHWB 4OHYA 1TMF3 1UW8A 2XG3A 3FHAA 1DDLA 1LOBA 2YC2A 2V4AA 1X7NA 5FP7A 2IUWA 3U11A 1MS8A 1SFNA 2JE7A 5D2AA 2YG0A 4XUTA 4CCDA 4FXGB 1SPPA 4QX8A 4OMCA 3PTYA 2ARBA 1BVP1 4K20A 3IN9A 3WNNA 3O1VA 2DYCA 1ASJ3 1XSRA 3NMBA 4B4QA 4CCKA 5F3IA 1UYZA 2ZGLA 4KGQA 4FTEA 3ACHA 4FAHA 2ZGUA 2WNEA 5DAVA 4K7JA 4JGZC 4M4PA 4X8NA 3LE0A 4DO0A 1F4HA 1CIYA 1B35C 1LOGA 1UMZA 3NV4A 2VVEA 4J1WA 4LQRA 1WCUA 4TSVA 1YIFA 2A1XA 3DV8A 1OOPB 1XRUA 2AACA 3SCHA 4YW3A 5JZGA 3RZHA 1LU2A 1UY4A 1W6PA 4PIYA 3ROUA 1PGW1 3O7OA 2NP0A 4KWLA 4XQ4A 2XUMA 3OGJA 4LHSA 4Q4X2 3WDXA 5FZDA 1N1TA 4AEKA 2WYSA 1R083 2XB6C 3KQ4B 2V72A 2EXKA 2VW2A 4QDRA 4G3YC 5BNOB 5KHJA 5A32B 4OI2A 4AZZA 3A23A 2WS93 3VKMA 5CFCA 5FQ0A 5FZLA 2A3YA 4YVWC 2LW8A 2B45X 4XIOA 2PQSA 1W03A 4IE4A 1ZZ8A 1DGWX 1YHFA 2OUHA 1C5HA 3RWNA 2ZMKA 1AVBA 3UT0A 1ZYBA 3MUY1 3SCGA 1HXS3 5JPMB 3RNSA 5C8WA 4IDZA 3KT1A 4D3WA 2W47A 1AYN3 2OW4A 2GH2A 1HLCA 5FZHA 3NO8A 1H8TA 5DZGA 4XUNA 1GICA 4RGAA 5EJ3A 1YO8A 1JYWA 2VTXJ 2WO7A 3NWKA 2OUJA 4BOWA 1H1MA 1Q8PA 1UYYA 2WQZC 4JCKA 3NKTA 5JSRA 3PJYA 4LBQD 4WVMB 3ZM8A 1AR93 4M3CA 4IQPA 4H14A 4NHYA 1S2EA 1O8SA 3LIGA 5H9QA 1I3HA 1JOJA 1ENXA 3LWCA 1W39A 2O0OA 4JV4A 5FY5A 3N9QA 2RG4A 4LKEA 3KT4A 4RN5A 1US3A 1W8UA 3ZIXA 1JZ6A 2AGSA 4FPEA 5DAQA 3EO6A 2A6YA 3WNLA 1OOPA 1Q8VA 1VRH3 2R063 4L92A 3LD8A 3QH6A 2XVGA 1UY1A 3D6EA 2Q4SA 2CGNA 5FYZA 4NRQA 4Z8BA 1K5MA 1MQTB 4QU1A 5C3RA 3GZAA 4URTA 1BMV1 3P5BA 3MHZA 2JD9A 1OLQA 1REDA 2WWJA 1XNKA 3ON7A 4LKDA 2RMU3 2YFUA 1VBD2 4LBLA 4O7XA 4WVVA 1UZYA 3KB5A 2G4IA 4JRAA 4JVAA 3U78A 2XJUA 2WBKA 3AL6A 4RR3A 4MGKE 2W52A 4XJUA 4LORA 3VZMA 2WR9A 1NY72 2KD7A 3HNBM 1GV9A 3N9MA 4XETA 4YRDA 3N7MA 5A32A 1WCDJ 2CDOA 3AYCA 2GN7A 5FYBA 2JIJA 2F4PA 2F17A 2HBTA 4OI4A 5LA9A 2DUOA 1XE7A 3K77A 5GZFA 4CP9A 3S5QA 1A6CA 5KHKA 2PLV1 1PZ8A 4LHNA 4N9IA 4NMIA 1STMA 2ZEYA 3FUQA 5FP4A 1PGL1 1DCSA 1EUTA 2VU9A 5J48A 3LIHA 3MICA 1SLLA 5A3WA 1NQJA 5A7NA 5LA0A 4LO6B 4PDWB 5EFUA 3L2YA 1DBNA 2PN5A 3JQWA 1JMUB 3R0RA 1FAYA 1NKGA 2ARCA 3I8TA 1TMF1 3AXDA 2OZ6A 2IXHA 3AFKA 3FJSA 1RXFA 3JBG2 2X29A 1WBFA 3WOGA 2X10A 3PVEA 3WDYA 2P3YA 1QGLA 4JDMA 2QZ2A 4XMIA 4AI3A 2J7MA 2FDGA 1YI7A 2P3IA 2RVAA 2WL1A 4R52A 3VBRC 4GH4A 4DY3A 1E5HA 3AL5A 2H6CA 4TLGA 3LDKA 1ASJ1 2BBAA 3A0NA 4FO9A 4D7SA 1JYXA 1ULGA 3MUZ1 2DV9A 4ZS2A 3IB3A 4BQXA 5FXXA 1Z7S2 1LOCA 2P4EA 1Q56A 3OSDA 3GGLA 4Q2FA 3V0AB 3CLPA 3O0XA 2JD4A 2O8QA 4DXRA 4I0AA 1GSLA 3T3YA 3C7EA 4DQAA 5CVRA 3TBDA 3F2ZA 3D0JA 4KBBA 4XFGA 3JXSA 1QJX2 2ZZQA 2HEWF 5DDJ1 3K3NA 4A3ZA 3NNJA 1DP0A 4GJYA 4AI8A 4AI2A 4IV1B 3RZMA 1RUI2 2EIGA 1YQ6A 2VZQA 2RDSA 4L97A 4YW2A 5T52A 5EIYB 2A3XA 3VHRA 1AL23 5EXOA 1EP0A 4KU7A 2D6NA 1G9FA 5LCWL 5FWJA 1WLWA 4QB2A 2YYOA 2UWAA 1R081 1CAXB 3SMHA 3VBHB 2ZHNA 4AVCA 4TZDA 3VKLA 1J3RA 1OFSA 2Y6LA 4LLFA 4WM8B 5FDBA 3JD72 2BQPA 2GP3A 3CDZB 3Q8CA 4BA6A 4PT6A 2RS52 1YWKA 5ABJB 1W9WA 2WS91 4CCLA 3FMGA 4PDWA 4Q0QA 5F37A 2WFPA 4QMAA 1OD3A 4YVSB 2Y6GA 1RUE2 4HMZA 3THCA 2JE9A 1W6OA 4IGOA 1HXS1 5FPZA 1A78A 4FQZA 5ACA2 1HQNA 2XKOA 1AYN1 3FBYA 1IGOA 3W58A 2ZZJA 3J4UH 4QHBA 1QDCA 2UU8A 5ISLA 3I3MA 1OA4A 5FCCA 2D3SA 5DUUA 3OBRA 4QKBA 3WF0A 3RZJA 1PGSA 3PMEA 3ILRA 4MHUA 2DTYA 5DN2A 4YARA 5HV0A 2GNMA 3V0AA 2QQIA 4QXKA 3WD5A 5L9BA 2VNRA 2D97A 1N3OA 5FMOL 5HXMA 1C3HA 3TEYA 4FP3A 2X05A 2VOWA 3J8F1 5LWBA 3O12A 4LHKA 1UOJA 1N3PA 5CIRA 4IEPA 1D2SA 1VRH1 4IV1A 3NNGA 5I0SA 4C0HA 1CONA 1X33A 2WRAA 1UD1A 3HNMA 4ISRA 4WVWA 3S7IA 4EN0A 1OD5A 4MVTA 2XLAA 4Y20A 3VD5A 2VZRA 1WCSA 3TAYA 4KNCA 2RMU1 4BB3A 4HZFA 4JX0A 1KITA 1CAXA 2EF6A 3DPRC 4LE3A 1AXKA 1COV1 3MPBA 2ENRA 3VBHA 2WWSA 1AHSA 4XZUG 4ZY9A 4M0HA 1YJLA 4GZ9A 4QX5A 1SLBA 1UF2C 2QDNA 2JIGA 5CADA 4YW4A 1UL9A 4TLFA 1DYOA 4KG8A 4JHTA 3ZFFC 1ND2C 1XYOA 2JDUA 5D8AB 2TBVA 2VMEA 4UXAA 1DZRA 1ZA4A 4XACA 4AF9A 3UYJA 1ZZ7A 1S55A 1J84A 4CYDA 4GMP3 3P3PA 3O1TA 2B4KA 4CSWA 5IVBA 1Y43B 4AQTA 2RJ2A 3B02A 1W2AX 2PAMA 1J83A 2VOXA 3OYWB 2VUJA 4ZS3A 4Y4RA 2ORXA 4GA9A 4ZU4A 3HT1A 1V9U1 1QU0A 1NCRC 3FUOA 1PIV1 3WHUA 5JOWA 1G8WA 4R9DA 3VBOC 5FY7A 1CZSA 1ODNA 3AC0A 4OUSA 1OHFA 1POV0 1NT0A 2B5HA 2JKXA 3LFMA 4QPGC 3SKVA 3VKFC 3AJZA 4E9KA 4MGTA 2LRPA 4KU8A 4MV2A 3UJOA 4PI2A 2ZGQA 3IDEA 4PF1A 1SLAA 1W2NA 3AP7A 5FBZA 4B1LA 3N35A 4LJHA 5A3NA 2GC2A 2BVBA 5E89A 3VZKA 4CXXA 4BK5A 5AVAA 2ARXA 3IAPA 2VG9A 1NA1B 4D69A 2ID4A 2JDAA 4ASLA 2ZHKA 2WNVC 5FFOC 3S5AA 2VC9A 4XJWA 3RFRA 3T4VA 4QDSA 4NAMA 3OBTA 2AR6A 1SEFA 5JVVA 5F6LB 2YZ4A 3ME2A 1QJY3 3ZSEA 4CXYA 1DIWA 4D6QA 1JZ8A 1AL21 1K5MC 3FLPA 1JUIA 2JEMA 2VY0A 2ZHMA 4LO4B 3WNOA 2D40A 4ORFA 3IDCB 2PA7A 4XFBA 4NIGA 3ASIA 4UW3A 5D8AA 5CKNA 4DINB 1DQ2A 4RR3C 5C3PA 3GXUA 3OOXA 1GP6A 3SNMA 3CIHA 5BNNB 5IK8A 3POIA 2J1VA 2ET1A 1G9AA 2IWGB 4EQVA 3SISA 4AVBA 1KJLA 1QOSA 3WNPA 3DKQA 4LIVA 1LAJA 2PTMA 2RDQA 4QPWA 2EIEA 2O1QA 1RJ8A 3BALA 4Y1UA 1CQ9A 1VBC3 3MLJA 5FTTC 3U07A 1V70A 4BJ0A 5A7WB 1PM7A 1XNDA 4IL7A 1QY4A 3VN4A 3MDPA 5LBFA 2A70A 1FOD3 2ORZA 4QKNA 2E63A 3VBUB 1RB8G 4UAPA 3H3LA 1CGPA 4DRVA 2PFWA 2BWCA 3AB0A 4UW4A 2ZX2A 2A75A 4YPJA 3S7EA 1R1ZA 4XFFA 2D5HA 5CZKA 2BGOA 3AZZA 3RMYA 5GLVA 3IBMA 1UMIA 4IEVA 4BE3A 2V5DA 1BMV2 2NPIA 4GD4A 3M1HA 2BOJA 5DZFA 5FZFA 4PLNA 2WT0A 1UPIA 4NRPA 3RVHA 5JMOA 1IS4A 5FKBA 2NM1A 1OPMA 2NMNA 3MIHA 1EAH3 2ZGKA 3ZMNA 1YYNA 4HL0A 1HW5A 3W5NA 3ZFGC 3NJZA 1ZZCA 2OA2A 1OBNA 1EYBA 4YZ5A 4QXBA 1KEXA 4W8JA 5FXWA 1W6MA 3UETA 4DUXA 4RHV1 2VOKA 5KXCA 3DL3A 3U37A 2VNVA 1MS3A 3U10A 3UKVA 2H0BA 1OLRA 4Y1XA 3WSOA 1FMD3 4UWDA 4SLIA 5L7OA 4IV3B 1Q8OA 3ZYHA 1PGL2 1O5UA 4NIIA 4COVA 1NCQB 1O3SA 1NLRA 2GU9A 1OLME 1TZOA 2QQKA 3N4MA 4CCJA 4BQ1A 2FZ2A 1JW6A 4D7YA 1TMF2 2VZ3A 2ZMNA 1X82A 4MGQA 4YGDA 4AEDC 4C0BA 2BFUS 2C0ZA 1WA6X 3MF9A 4Q0SA 4CEYC 4OHVA 4W50A 1F8VA 4IEOA 4AFAA 4ZZ8A 1L7LA 1ASJ2 2WJSA 4L8QA 2B42B 1BZWA 2JKBA 2V4VA 4IE0A 3C7GA 4XVHA 1OF3A 1PHMA 4XILA 1OQEA 3SEEA 4M4RA 2BWAA 3SXWA 2BEOA 4OHWA 2CTVA 3VL9A 3NAPA 2HYKA 3TNQA 3F95A 4NJ4A 5GLUA 1IQAA 2IXKA 4LBQB 4N43B 4COUA 2DTWA 4CP1A 2R6QA 2GNDA 2P3JA 1NX9A 3VUOA 4GWNA 2FCVA 4U36A 2W46A 3PUAA 2Q8CA 3FHIB 3VBSC 1OURA 1X9PA 1R082 2QQUA 1QJY1 4P02B 5T3NA 2ZX4A 3WQBA 2WN3A 3WZ1A 2RM23 3ETPA 1WGPA 2PAKA 4LULA 2BVVA 2RS33 4IGQA 1HB2A 1EV13 2A71A 3UV9A 2WS92 1YLLA 3L2HA 2X53S 2RDNA 2E7QA 2EAAA 4I0BA 4YVWB 3ZXAC 1U5XA 2XONA 4CU7A 4X6RB 2XJQA 2H6BA 2UY9A 3EBRA 2VMGA 4OHZA 4ASKA 1HXS2 1N1VA 2VECA 4CCNA 5I8TA 1AYN2 2PXJA 1KS4A 3IDBB 5JOYA 1MACA 3FZ3A 5FLHA 4XUQA 2R073 1VBC1 4BZ4A 2VTXA 3PUHA 1G6NA 2E9QA 2BV4A 5FZ8A 1P8JA 2VVDA 3IZOA 5FOBB 3ACLA 3WHTA 3MIFA 1DG6A 5D21A 4B3NA 4QX7A 5C5UA 1HRI3 4MZUA 4HPKB 1IS6A 1V6JA 2GNTA 4Q4Y3 5D1IA 1LULA 3POWA 5F5IA 1PVXA 1FOD1 1AR92 1IHMA 3UKNA 2IFWA 3ZDSA 4WZFA 2CSGA 2BYVE 4XDPA 1VBD1 3D0SA 2VMIA 5F3GA 2JB4A 2QZ3A 1LU1A 3J8F2 2ZX3A 1ZRCA 3KGLA 2Y6JA 4UI9L 1GOFA 1VRH2 2GDFA 3T1MA 2FDHA 1D2QA 1E5RA 2HWE3 1DGLA 2VQ0A 2VZPA 3MO4A 4NWWA 1GR3A 2DWRA 2Y6KA 3NL1A 1UXZA 3KSCA 3OD0A 2RMU2 4NAOA 4NPRA 1D4VB 1REFA 2CV6A 4L99A 4ZU7A 1ND3B 1R091 1Q5OA 1COV2 2XMLA 1OF4A 1EAH1 2GN3A 3H1YA 4QD2A 5FLJA 5C8CB 1KQRA 2DVAA 5JAXA 1TME1 4QQ2A 2VOVA 2BDRA 3AKPA 3MYXA 4UYBA 4BCUA 4DUWA 1QQP3 3H0OA 2QQPA 1N3QA 3GZEA 4ZHNA 4QM9A 2ZAAA 1CJPA 1MS9A 4AG4A 2Q8EA 3C8XA 3WF2A 1LRHA 4UFKA 2ZGOA 4XIKA 4N90A 2XPJA 1REEA 3GDBA 2OKXA 1FMD1 2DCJA 2UYAA 3BTYA 3J7LA 4M00A 1I5ZA 3BYWA 4RYDA 2OPKA 5JR7B 4AHYA 4GJZA 2XWJB 3T09A 1D7PM 5EHDA 4JDOA 1Z7S1 2W0XA 3MBWA 1E57A 1AX1A 1V9U2 3DF0A 1JODA 4HPKA 5J98B 4A7ZA 3T0DA 2DUPA 5IK7A 1ZRIA 2OQ7A 1PIV2 3I59A 4IEWA 2R49A 3WXPA 5FY1A 4DIQA 1EPZA 1NXMA 1OH3A 2PAEA 2XR4A 4AOCA 1O4ZA 3N9NA 2XJVA 2Y6HA 3P1IA 4XFIA 1ULOA 1WCKA 2ZEWA 3HD8B 2NMOA 2W92A 1VAVA 1G7YA 3R05A 4I2OA 1JHNA 2PHTA 2V09A 1WMXA 2JXAA 4YGEA 3MIEA 2P5BA 2E26A 4Q0UA 2PHXA 3AMNA 1UXXX 1Z78A 2DBNA 5GLWA 3SLIA 1AUYA 4NHKA 5C5TA 1LGBA 1DZQA 4P9JA 3HAGA 3DGTA 3H3ZA 3ZXKA 4CPBD 1AL22 4LK7A 5M0TA 1DU3D 3N7JA 4YM1A 4XAAA 2HWB1 2J1AA 3PIGA 1XU2A 2DCTA 5LEKA 2JG9B 4KWJA 4YG0A 1WA4A 2JG8B 2VZ1A 5F2WA 4AHZA 1LEMA 2X5IB 3FBMA 1S1AA 1QHDA 1JBCA 5LA2A 1FX5A 1OVSA 5JIAA 5JLVA 4BQ2A 4BDVB 2Y34A 4M01A 3KCXA 5FREA 4EE2A 2QBXA 2D5FA 5A3TA 4NWVA 4XDOA 4CDXC 4ZPIA 3LEKA 1MS1A 4OYUA 4EWAA 5FZ9A 3N3HA 1RUC3 4LO7A 1WLTA 3TRSB 4ZONA 3GF6A 4B8EA 2PMWB 3HN1A 3SQOA 4ASMB 4RQPB 1XOYA 2C24A 3M3EA 4LUKA 1JYTA 1CAUB 1OUXA 1ENQA 2R071 3CJIB 4X8PA 1IKPA 3DECA 3A22A 5GM0A 4AAPA 2LM3A 3VHPA 3MFCA 1CAWB 3M70A 4CDUB 5C3SA 1W05A 4CE8A 4N53A 1GU3A 4Y26A 1H1IA 4QHZA 3ZN5A 3O14A 4XXAA 3MFAA 2VUDA 2WDBA 3GALA 3GZUC 5AFBA 3HNYM 5IYYA 3OY8A 1HB4A 1NOVA 1CWPA 1RUNA 4H2AA 1V0AA 4UFMA 5E8AA 5G04L 1JZ5A 3ETQA 1GQPA 1WW4A 2P6HA 5J3UA 3KM5A 2Q1MA 2D44A 1VPHA 3WUDA 5CA6A 5CFDB 2HWE1 1LCLA 5CKMA 3PL0A 5HCBA 1W06A 1SMVA 2C6SA 4N7IA 5IW0A 2WAOA 2EAKA 2EA7A 3K4ZA 3U1XA 3WNMA 1GBGA 4CUBA 1CX4A 4K6BA 2ZTNA 4Q0VA 2A5ZA 3DPRB 4OLLA 2YB7A 5A70A 5IJRA 5LBCA 2JG9A 5KR7A 2RV9A 2XLGA 5B4XA 2DCKA 4AFMA 4QPIC 4AL9A 1IS5A 3VDAA 1JYIA 3H8RA 3O1OA 4HK8A 1JYCA 4QGNA 5BNPC 4AAXA 4CDWB 5EV7A 1O3RA 1ULDA 3IMMA 5EJZB 4LT5A 2MHFA 1O3QA 5FYSA 2VO5A 5FO8B 4CA9A 2JWPA 3IT8A 1SACA 4URAA 1SDDB 4JZRA 1PK6C 4LHLA 4OI0A 1FPN1 4RQPA 4AFDA 1CAUA 3CJIA 3ZXDA 1J1TA 1QOOA 3FC0A 2YHJA 4C91A 5J96B 5C4WC 2R32A 5FJKA 1V00A 3ZXFA 4EROA 4P9XA 2VZOA 4KGGA 5A80A 4CDUA 1K45A 3WQ7A 3IPVA 2ZX0A 2HEYF 2ZGNA 3HQXA 4DY5A 5JWPA 3BUCA 2VQTA 3ACIA 4YLZA 4AHXA 1O4YA 2PELA 2WFF1 2UWBA 4QPGB 3A0KA 4RFRB 4IERA 4E4DX 3GBGA 2B39A 2WO1A 1JZ2A 3I3QA 5K0UC 3MI8A 4Y5Z0 1VBB3 3Q8EA 3VZJA 5JXIA 4PIZA 3CZUA 4XJ9A 1IPKA 4BQYA 2WWUA 2YBKA 3H7JA 2XDVA 3G6JB 1O91A 1HJFA 5CFDA 1BK0A 2OT7A 3E5QA 4COYA 4EZHA 5IHRA 4XE9A 1GYKA 4XCBA 1WLDA 1TNRA 1XNBA 2C9KA 4FCAA 3VZLA 1W9TA 1OKOA 4OFGA 4UBGA 5I0DA 3C3VA 5A3MA 5FKCA 4COWA 1QNWA 4FT8A 4XXPA 5IAXA 4TXWA 1O7FA 3OBZA 5FP3A 1QJY2 4GULA 4K8FA 4R4XA 2O8OA 1VJ2A 4QKFA 5JI9A 1D4M3 3WW3A 2JICA 2WNUC 2IXCA 3ELNA 1UOGA 3WG4A 3VBFC 4NN0A 1KJRA 4CDQB 1UU4A 4XJZA 1O6UA 3PUIA 3RG0A 4E8DA 3UL2A 2JDHA 3ZPYA 3VZNA 1AR73 4GALA 5LY2A 2D6LX 3WDVA 4DPNA 5BNQA 1O4TA 3W9AA 1S2BA 1UO9A 5GZDA 1A3KA 1PO21 4O9GA 5JIUA 2C9AA 3VDCA 1UCXA 2YV8A 1VBC2 3T0BA 1SBEA 5FRAA 3H8OA 4FTBA 1GZCA 1RUC1 4JHZA 1C8M1 1LR5A 1DLLA 3BCWA 3B3QE 3LAGA 4PQ9A 4BU2A 1F2NA 4BXSV 2VMFA 2OQ6A 1ZVFA 4YW5A 1FOD2 3RI8A 5KC5A 3T2QA 1BBT3 2UURA 1E5SA 1JI6A 2VZSA 3DYPA 3PVOA 3U4SA 4CU6A 1S0GA 1H30A 4NRMA 3LOBA 1YI9A 5IK5A 3TB0A 2BBVA 4IE5A 4S2FA 2I2SA 2J1SA 3HPNA 5FK8A 4XABA 3RYPA 4CCMA 2ZA9A 1I1EA 1OKQA 3RJ2X 5BNOA 3QOPA 2DVBA 3JUUA 4XZPA 5LASA 4LBKA 2FCUA 3HBKA 4A42A 2ZJCA 1LGNA 3ZYJB 3OUJA 2DCZA 2GH8A 4MX3A 5KHIA 1LTEA 1ZA7A 4MGIE 1UKGA 3WEZA 1N47A 3LPGA 5FMDA 3ACGA 4YGBA 1R092 5FPAA 3RQ0A 1EAH2 2QQLA 4MYEA 2GMMA 4M3CE 2TEPA 4YFWA 4CEWB 5FUNA 1IPJA 1RHI3 2PHDA 5FV3A 4C8DA 1TME2 2G9ZA 3GBWA 4QXCA 1HJGA 4XURA 4BHPA 3A7QA 1DGRA 2C1FA 1GNZA 4AVTA 1VBA3 4ZXKA 4YM0A 3LA2A 4QT6A 1ST8A 3FLRA 1WBLA 1LKNA 3KCCA 4CUAA 2CNAA 2Q0AA 2VUCA 2NQYA 4B4RA 4WVMA 1WMFA 2VH9A 2IXLA 1AYM3 1FMD2 3NKGA 4A6OA 3R6SA 3AP6A 4IE7A 1YQCA 4AXOA 1WWYA 1AJOA 1DYPA 1V6NA 4Q27A 4Q5OA 4XBQA 5AVPA 1N1YA 5IVYA 2D3PA 3PURA 3V65A 5CB7A 4D0QA 3INAA 4K1YA 5IVJA 2PHUA 4AEDB 1MQTA 4BH9A 4CUGA 2P17A 4XFCA 1GQHA 1MS5A 3PVNA 4HKLA 3VDDB 4LOTA 4M3CF 4FVVA 4E4ZA 2DU0A 4FFFA 3CKHA 1QKQA 2WNOA 5I8YA 4E2GA 2KA3A 4PBOA 3AKSA 5DUVA 2FDKA 2WZR3 3CO2A 5A33B 1DFQA 2A6WA 4DEQA 1QJFA 4ARXA 1Q8SA 1VBB1 5FUIA 4LK6A 1UQXA 2GC0A 2XHNA 4D7TA 1K42A 1IKQA 2AREA 2YBPA 2HEVF 4N53C 5I91A 3KT7A 1W8FA 2XBO3 2BNOA 2QQMA 3I2JA 4XF4A 1QMJA 1OI6A 2QE3A 3ES1A 4Q1PA 4CEWA 2VULA 1POV3 2Q1FA 1H2MA 3AYDA 1RUF3 3FLTA 3HJRA 3KV9A 3RJRA 3RZZA 1YFXA 3T1LA 4DUVA 4JKLA 5F3EA 4EN7B 4F7ZA 2JJ6A 2UWCA 5IFPA 2C4XA 4MOAA 2CY6A 1RGSA 1Y7BA 2QQVA 1S0JA 2HWB2 1C57A 4Y22B 3UJQA 5C9AC 1C28A 5FMOS 3SC7X 1D4M1 4CU9A 3ILNA 2RM22 5C3QA 2PQQA 5FXVA 2DVFA 1M4WA 2YUEA 3VB9A 4XOGA 3Q8AA 2WO3A 5F5AA 4EN9B 4JAAA 4CUCA 3ZYRA 5BYNA 4J6GA 4A4AA 2ZMLA 3ZYFA 5CBLA 4GQ7A 2W5FA 4K21A 3X29B 5F9TA 1AR71 1QEXA 5HBAA 4DXTA 1QH7A 2VW1A 3E6DA 1AR91 2YDEA 2EXJA 4XUOA 2Q8DA 4ATFA 4PCRA 4QX3A 2Y8KA 2ZXQA 3VDDA 1KS5A 2R072 4OULA 1W6NB 3QACA 5EJ1B 2E31A 1I9RA 4LOSA 2R061 2R0HA 1UU6A 2EIBA 1HRI2 3POSA 3H1WA 5ANQA 3BB6A 5FUPA 3VD3A 2MPFA 5A33A 4CP2A 4ET7A 4XDQA 1XE0A 1BBT1 1XBFA 2NLRA 3LDBA 1WMEA 2ZKLA 5FAXA 1XYPA 5FPXA 3LSEA 1KDMA 1BLZA 4JGYB 1UZ0A 3JQXA 3K3OA 2VVFA 1G9DA 3VD9A 4WM8A 5JZGC 3AZXA 3I49A 3OPZA 1RVF3 2HKXA 2HWE2 4AWDA 1UN1A 2QUOA 5ABJA 4N9HA 2FCTA 2CAVA 4CZSA 5J37A 1BVVA 1W2UA 3WINE 1RUH3 1ZZ9A 2AEYA 4YVSA 2ZAHA 5FZ4A 3KGZA 1TE1B 2XHKA 5FZIA 4Y22A 3ZMOA 4ONUA 4Q4W3 1BJQA 4WM7B 1S4CA 4UFJA 1MS4A 2ZOEB 1YQ2A 1RHI1 3WW2A 1Q43A 1XE8A 4HK9A 2A3WA 1YFWA 2W87A 2XJTA 1KD7A 5J36A 1ULFA 5H9RA 5CFCC 1VBA1 4GIQA 1QQP2 4P9YA 1RC6A 2GZWA 1LESA 2IVIB 4P5YA 4S2GA 4V2VA 3N7LA 4HBNA 4Q4V3 1WLCA 3SCFA 3IIIA 4FOVA 4Y1VA 2AUYA 1AYM1 5FYYA 3ZYBA 1XNCA 2VL4A 5FPBA 4XTPA 1DLCA 1MZFA 2GMPA 5FJHA 1ACCA 1H8TC 1FPN2 4XEZA 3OF1A 4B7KA 1GZWB 1CZVA 1J3PA 2OYZA 1PVC3 2W08A 2YGMA 3LDRA 3POYA 4KG0A 1GWKA 1HV0A 3PTRB 3H7YA 3MPPG 2TUNA 1JUHA 2XXZA 3ZFEB 3LEGA 2P2KA 1SBDA 1UY2A 5C8CA 3BGAA 1OT5A 5FXZA 5FWEA 2I07B 3VD7A 1QJZA 4HT1T 4DS0A 5EQUA 5AC93 2WFF2 2ZX1A 3BI3A 1FNZA 4FFGA 1YQ8A 5ANNA 3VHNA 4DOUA 5C6CA 1OOPC 4AQSA 3IMNA 3FFZA 4AK3A 5E16A 2WZR1 2D98A 2LROA 4L11A 1UZVA 4XQDA 3RGBA 1GANA 5DAPA 5GZGA 3WNKA 4KBZA 1CZTA 1J59A 3GYDA 2BP6A 2XBO1 4BLJA 2ATFA 1GLHA 3ZVXA 5GZEA 4WM7A 4H55A 5HXVA 2CU5A 5K4LA 3I2DA 1POV1 1RUF1 2X09A 1J58A 2J1TA 2ZGPA 4NPLA 2WA3A 4WZCA 3OYWA 1YCIA 1X36A 1ZBE3 3RSJA 1F15A 2R1DA 1UX7A 2KXLA 5JCTA 2Y0IA 3R4SA 1YC61 3KLSA 4BQWA 5F7UA 1XQNA 1VE0A 4AHWA 3R4UA 4IW3A 4RL7A 4ATEA 2QKDA 5GLTA 3THDA 3VKNA 1IG0A 1W90A 2IXJA 3RI9A 3MZHA 2JDKA 1PO22 2HWF3 3UKTA 2Y60A 4YW6A 4I3GA 2HWC3 3JCIA 4UFHA 3ZFEA 5FMCA 3ZR5A 3AVSA 4CU8A 3WV6A 1RUC2 2YXSA 3PJQA 1C8M2 4XF9A 4GWJA 1NA1A 1H2LA 3BN6A 3U0ZA 4XF1A 2IZWA 4NHLA 3DKWA 2BRTA 1JYNA 4GH4C 1MS0A 2DUQA 1IG3A 2CYFA 3H8XA 3RYKA 2IFRA 1LOFA 2F4LA 3VHOA 4LIUA 1XPWA 4AQ2A 1VR3A 1FI2A 2Y6FA 4NR1A 4PLMA 4JC1A 3LGRA 4MGYE 2XL9A 1S0CA 3SEPA 1W9SA 1EUUA 5CNAA 4RS5B 5LZ6A 1OLMA 2WLQA 3I7DA 1GKBA 5F39A 5LBBA 2ADDA 1CN1A 4QU2A 5T50A 3O1SA 5BNNA 1PMJX 1RVF1 2GNBA 5LW9A 5LY1A 4Q26A 4XFAA 1C1FA 5KBFA 5IT6A 5KWRA 1OPOA 1RUG3 1RUH1 5FZGA 2XVKA 2NYYA 5IVVA 3M4FA 1CIWA 1C1LA 4ES9A 5TSWA 1SCSA 4Q4W1 1UU5A 1OQ1A 1U5YA 1US2A 2RDRA 3OGRA 3H9AA 4QPYA 5DG1A 4GMP1 4L9BA 5A7WA 1UWWA 3WQ1A 3KS7A
chains in the Genus database with same CATH topology
2VGDA 2IXIA 2RJLA 1FV3A 2Y0OA 1JN2P 3AP5A 3T2TA 2DVGA 5BNPB 3BODA 4OUMA 1AR83 4PDWC 4A3XA 4KQ7A 2VMHA 1YNAA 3ALQA 3AZWA 3NV3A 2A6XA 3HT2A 3VBUA 4Q4V1 1OMIA 1RJ7A 1QJU3 2CL2A 5IUQA 1QDOA 2E53A 3M3OA 4L2NA 4XHXA 1RUD3 1ZBA3 4JGZB 5EZWA 1LEDA 4LA3A 2ET7A 2WC2A 1DZTA 3WDUA 1B35B 1ZNPA 4E27A 3BOPA 4NOTA 2X8KA 3ZXJA 1VB2A 3GZTB 1KFXL 3QBQA 4AYUA 1OA2A 2WLPA 4XF3A 3V56A 3J26N 1TEIA 4RS5A 3NV1A 3WUCA 5K0UB 3QH7A 1VBB2 1QXPA 4IV1C 1AR63 2ZCWA 2FHRA 2D6OX 3AKRA 4FBFA 4IV3A 1LGCA 3CJXA 3USSA 4META 1RUJ3 1NCQA 1SLIA 2G9FA 2BFUL 2KM2A 3AM2A 3VBHC 2XH6A 4Y1YA 2ES3A 3WW4A 4OVEA 3L9JT 4WM8C 2RS53 3S30A 5ABJC 2Z42A 4XFHA 1D4M2 2WNUB 4WVZA 1DF0A 3IKWA 1ZBE1 4NVPA 4YVSC 1RUE3 1W0OA 4HLTA 4Y4YA 3CNAA 3M3CA 3B7MA 1V6KA 2LUWA 4MGZE 4TWTA 4PJYA 3E5XA 1AR72 5KHHA 4JGZA 5I8SA 3B5LB 5K8SA 1MZEA 5B2GB 2BGCA 2HWC1 4ISQA 5EWSA 2XJRA 1JH5A 4I0WB 2R062 1Z0HA 4LBQA 4N43A 3WX5A 1V6MA 1WMDA 3TYJA 1BKZA 2D3RA 1NZCA 1G9BA 3VV1A 1BBT2 4DNYA 2MNGA 4FPGA 1ZZBA 4XPVA 5C8CC 2XL7A 1J3QA 1J1LA 3MIBA 5F1RA 3BOWA 3CEWA 1H4GA 3OD4A 3ECQA 1YRZA 2C5DA 4ITCA 3ATGA 3O5SA 3SITA 3A4UA 2WINB 1LHOA 4YVWA 2ZKNA 4S2DA 4C1XA 1S0FA 1NXD1 4K1ZA 4PBPA 3WG1A 3S0MA 4XBNA 3EXUA 1RUG1 5LK5A 1RHI2 4Y1ZA 5D8AC 1O5LA 2UY8A 3H1MA 1VBA2 5KC6A 5EYYA 1QWRA 1SLTA 1AXZA 5K9YA 5HCFA 5LRRA 4YW1A 1VLNA 1NLSA 5FO9B 3ZXLA 4W6YA 1AYM2 1AR81 1XYNA 2H0VA 3FFQA 1U12A 4FP2A 3VBRB 1PO13 4YG6A 1APNA 1LJ7A 1AZDA 1R1A3 1CR7A 1QJU1 3LSDA 3WP6A 3MW4A 4LR4A 1I6XA 4Q29A 5KHGA 1RMU3 1RUD1 1ZBA1 2Z2SB 4YZ1A 4GB33 1G86A 4UW6A 2ZPXA 4M0NA 1UIKA 4R9BA 1WW6A 1ND3A 1KXGA 4AGRA 4MSVA 5BUVA 2YROA 4LO5B 4DB5A 2WZR2 1WW7A 2R043 3E6BA 5LEJA 2QDRA 1C8NA 1HKDA 4KH9A 3B00A 1ALYA 3LCPA 2OIIA 2XBO2 5CG9A 3ZN4A 2RM21 1ENRA 3EHKA 1AX0A 1RUF2 2RS31 4Z82A 1EV11 2JDZA 1MEC3 1RUJ1 3KMHA 1UKRA 1Q8QA 1OA3A 5HCAA 1UAIA 4RD7A 5BNNC 4UBHA 1X8EA 1HRV3 4WV8A 5L7OC 1H1AA 2D43A 1BK1A 1Q3EA 3VBRA 3AP4A 4MH0E 3THPA 3EQEA 5GJ6A 3AYAA 4GKYA 4HSLA 3AFGA 1HRI1 3ZSKA 4QGMA 4Q4Y1 5J09A 4IEYA 2PHRA 1BYHA 1LHWA 1HIXA 1PNFA 3S6PA 1AXYA 5JOXA 2W39A 5FLIA 1QOTA 2LALA 4OI1A 4PIXA 1BXHA 2VNOA 2DFBA 4MUVA 4QQPA 3DUIA 3RS6A 2BUKA 3NAPC 2JG8A 1DQ6A 2F6BA 2X5IA 5T5OA 1RVF2 2Z5WA 5BPXA 3ZFFB 3BIWE 3RMXA 1QXJA 1QQP1 1ND2B 1RUH2 4Q4W2 3JZVA 4MXWB 3R4DB 2PLV3 1S0BA 1GZ9A 1JXNA 1PZ7A 1Y9QA 3AYEA 4IV3C 5JSPA 1SLCA 1Y3TA 4CP0A 2VXRA 1NCQC 1D0GA 3RYRA 2P3KA 1W6QB 4HVQA 5AFEA 2GSYA 1CAWA 2XGXA 4R9CA 2RJKA 5E1RA 4Q4V2 4DXZA 3E5UA 2BPA2 2QJVA 1NCRB 2N7GA 3VBOB 1H8TB 2Q8OA 4COZA 1PO11 1VB4A 5T55A 2DFCA 1PVC2 1R1A1 2YY1A 3OCPA 1URXA 3WW1A 4E2QA 3MEPA 3AKTA 1RMU1 1CPNA 4M3CB 4GB31 5AC92 4ES8A 2IC1A 3NSTA 2XVLA 3DPRA 3WVJA 2WNVB 5DDJ3 4FOYA 1ENSA 3MIDA 1V6IA 3QLQA 2UYBA 3N7KA 4N43C 1K5MB 2R041 5H9SA 4HFSA 3GHNA 3ZFFA 4F8AA 2P37A 4CDWA 1ND2A 3VLBB 4BIFA 3CF6E 4RR3B 4MXWA 2Q5TA 4BM8A 1QH6A 2ZGTA 5BV6A 4IEZA 4LA2A 1FATA 1MEC1 1G9CA 1CVNA 1S0EA 1NQDA 1SDWA 1SBFA 1F5FA 1W6QA 4E2SA 1ZBE2 4JRLA 4AFBA 3TWIA 1NCRA 5DXDA 2PYTA 1MVEA 1HRV1 3VBOA 1H2KA 4QPGA 2AH2A 2HWD3 4R4ZA 5H9PA 1WD3A 1ZRDA 3AKQA 2HWF2 3LA3A 3ZYPA 2HWC2 3B69A 2EXIA 3D4KA 5T54A 3RRDA 3LKJA 3GHMA 4FXKB 4QQLA 2FMDA 4AFCA 2JECA 4MLOA 3TN93 3J8F3 1YFYA 4GH4B 1DGWA 2WNVA 5CU1A 1AJKA 3G7DA 4AI0A 1YFUA 2Z79A 1ZRFA 4F83A 1S2KA 3IM0A 3WDWA 3H3UA 3NW4A 4B4PA 2WKKA 2ZACA 3ZFGB 2Q30A 4W6WA 1FV2A 3ZN6B 3KQRA 4AGGA 4FPCA 1COV3 4CDQA 1ND3C 1VAKA 3TNPB 4QGLA 1S0IA 3D82A 5F5QA 1TNFA 3PLQA 1T6GC 1RUG2 2FMYA 4FOQA 2DF7A 2RR13 2EVXA 4FQ4A 3QCWA 1CESA 4LEJA 5LRSA 1KFUL 1DQ4A 1HV1A 1XU1A 4FPFA 2Y26A 2B7YA 1VALA 4AVAA 2Q1ZB 5JSOA 4Q0PA 4YZ4A 4XW3A 2YPJA 2D6MA 1AR82 4CEYB 3KD4A 2RE9A 4QQHA 1V9U3 1W6OB 4EN6B 2RS13 3KCYA 3ZXEA 1QJU2 1HDKA 1PIV3 2I74A 1RTVA 2A73B 4KWKA 4PF5A 4IEXA 1W0PA 3E6CC 2K9ZA 1RUD2 1ZBA2 5T5PA 1H0BA 4I30A 4LUMA 3WCSA 2MEV3 4YM2A 3JU9A 2ETEA 1XXNA 4HKWA 4GWMA 4H3WA 5T5JA 4N7UA 2EXHA 5GZCA 3HMYA 4BLIA 4EV0A 3ZXGA 1BEV3 3ZFGA 3PVBB 4Z2WA 1CD3G 3ZN6A 4G4FA 3D5OA 3H50A 1OQDA 4P9WA 3VBSB 4AW7A 3PMSA 4XF0A 3WLUA 4EJRA 1AR62 3AZYA 5LK7B 1QXRA 1AL0G 4Y20B 3HIFA 5I0RA 2RS32 1UZZA 1V6LA 1A8MA 3Q9OA 1EV12 4XTMA 1RUJ2 3OGGA 3J9SA 3LOIA 4INDA 5GALA 4QM8A 2JG9C 4YFZA 2JG8C 4H7MA 2X5IC 4YSFA 3D8CA 4TYSA 1LOAA 4AEDA 2RHPA 1EPWA 4Z07A 4LLOA 4AEJA 4CEYA 1NG0A 2CWMA 4EN8B 4A7KA 5I0TA 3V0BB 1U0AA 1VBE3 3AJYA 2WSUA 4K40A 4Q4Y2 4RQPC 2HWD1 3CJIC 3PHMA 5J7MA 2GAUA 4HSJA 4CDUC 1ZX5A 2EALA 4IESA 3OTFA 4GXLA 4RSUA 3O0WA 1GNHA 4XMAA 3MIGA 3RPQA 3TN91 1F5JA 3ZSJA 5L36A 2ZS6B 4AVVA 2ZGSA 2GC3A 2ZGRA 4IETA 4YYOA 4FPLA 5E88A 5FOJB 3VBSA 4ZKTB 2D7FA 4NHMA 2VNGA 5CFDC 1LHVA 4HANA 2XWBB 2R0FA 5GLZA 3M3QA 3THTA 4H7LA 4EWDA 4AE2A 1UX6A 3GBFA 2CGOA 4RHV3 1UIJA 2PHWA 2K0GA 5GKAC 5CAZA 4BMEA 4SBVA 1LECA 5KXDA 1LENA 2GMEA 4CDWC 4U2AA 2NZ9A 2YMZA 3WY6A 2RR11 4DFSA 1IZ3A 2ZGMA 1W6NA 1JTZX 3V0BA 1DQ5A 4R9AA 4AEMA 2WSVA 3AMQA 1LB2A 3FE5A 2ZABA 1V6OA 2XJSA 3WG2A 3H8UA 3BPZA 1FNYA 1VP6A 1PO12 4QQOA 1U5IA 3IIAA 3QD6A 2R1BA 4JGYA 1R1A2 2RS11 4YG3A 2PHFA 5HI0A 1RMU2 4GB32 2MEV1 2R30A 2V5YA 4Q4X3 5EYXA 1ULCA 1WD4A 4LTAA 1MR5A 3CL1A 4D94A 1B09A 1RINA 3M3IA 2ILMA 5DZEA 1BEV1 4Q8KA 1VAMA 5BNOC 1PGW2 2ZBJA 2R042 1DHKB 2WT1A 4RGGA 4JTOA 2SLIA 4I02A 1F9KA 3HWJA 2YGLA 4LBJA 3M2MA 2CWSA 3SH5A 4NO4A 4RA0A 5JI7A 5I0UA 3NV2A 3MLLA 2JENA 2B46X 1MEC2 1HQLA 1GZWA 4I3PA 4LNVA 4E4SA 4CDQC 1W6MB 1VIWB 4O9EA 4HETA 2FZ1A 1UPSA 2XKPA 4CDXB 3M8LA 2D93A 1CPMA 1LHNA 2WT2A 1ULEA 3ZYIB 5L7OB 1HRV2 3ZO0B 3SH4A 4DZGA 4S2HA 3WT3A 1DQ0A 1BCXA 2D6PA 3NVCA 4LBOA 5BXXA 2Z69A 1VBE1 5A3LA 4K3UA 3AMHA 3M7AA 1IS3A 1MQTC 4ZU5A 1F31A 4K9SA 3WP4A 2VW0A 1VBD3 5I93A 4C90A 3AXEA 2R16A 3SH3A 4I09A 1ONAA 1H9WA 3AP9A 2BNNA 1BQPA 4GMP0 2E51A 1YJKA 2XJPA 5KXEA 1FT9A 4UW5A 1HX6A 4BYYA 3HR9A 3CU7A 2VUAA 5T5LA 1YUDA 2E6VA 3B9CA 3B9IA 4AQ6A 3JB8A 1R093 3NAPB 4AI1A 3OJBA 5IK4A 1OSGA 4QPIB 3LZZA 4A7YA 4CEWC 1TME3 3GNEA 4HVOA 4IEUA 2BTVC 3VGIA 3WNXA 1PNGA 4JTNA 3ILFA 4HKOA 1GQGA 4XJ8A 1M06G 1IOAA 5CG8A 4CDXA 2SBAA 3JBG3 2AENA 2DU1A 2PLV2 1PK6B 4LBNA 4V1PA 2YC0A 3USUB 1X50A 1EY2A 5C4WB 1PVC1 4C1WA 1CJDA 2FBEA 4AVSA 2WQ4A 4P14A 1AX2A 3ZSMA 3WQ0A 1Z7S3 2A6ZA 4YZ3A 1D0HA 5AC91 3PNAA 1DGRN 3EJKA 3O0VA 4AGVA 3VDDC 1QF3A 1QJX3 2QCSB 1NYWA 1AF9A 3WG3A 1RUI3 4J1XA 1CAVB 3JB4C 4FPJA 4BMBA 1YIPA 3BU7A 1SCRA 4OZXA 1KRIA 4Q4X1 4XYXA 4FPHA 2FQPA 2K2SA 4B29A 1DQ1A 5DDJ2 2QNKA 2Y38A 3JD73 4QPIA 1DYKA 1RIRA 2VQAA 2PHLA 1L3JA 1RITA 4Z1VA 3VL8A 3P3NA 1PMIA 3DN7A 5BNPA 1LODA 5FO7B 2HWB3 2A7AA 5SV5A 3VBFB 4HN0A 2HJIA 5DUXA 2NN8A 2XLFA 3SHRA 3WR0A 4YM3A 5ACA3 1PK6A 4GKXA 3USUA 3U4XA 1OFNA 3AX4A 4XBLA 5C4WA 2HWF1 5JPNB 1FYUA 4XHBA 2QVSB 1B35A 4XQWA 5DG2A 3AMPA 3ST7A 4LBMA 2CAUA 1SFYA 5JDBA 2V73A 4MXVA 1MVQA 2DVDA 5F6KA 2HWD2 1U5ZA 3LB9A 2BW8A 3AZVA 5K0UA 4BIOA 1H4HA 1CAVA 2WIIB 3BTAA 2D6KA 3HBZA 3URFA 3I59B 3WDTA 5JMCA 1H2NA 3TN92 4DRRA 4LE4A 1X8MA 4JGYC 5SV8A 1NY71 1ZM1A 2CGPA 2WNUA 4JQRA 3MW3A 4FTSA 2WZPP 3VBFA 2G9GA 4LO8A 1HQWA 2W68A 2ZHLA 4WM7C 4IEQA 1NE6A 1C5IA 3ZYGA 2AYHA 5L73A 4DMIA 2BNMA 3I54A 1YXWA 3FX3A 5C33A 4FSJA 4F3JA 2VPVA 3V64A 2RR12 1SQ4A 1S0DA 4CTEA 3JBG1 1NE4A 4B7EA 4Y24A 4KL1A 4Q1RA 4W65A 1FPN3 4BWOA 3IWZA 4I01A 3MF6A 4HN1A 3VZOA 2LTNA 3TOJA 2WA4A 2A6VA 3ZFEC 1A8DA 2RS12 4XJAA 3WCRA 2ERFA 4OHXA 1NA1C 2WFF3 1RUOA 1QJX1 5L19A 4P9GA 3C2UA 2MEV2 3MGUA 4CRQA 1RUI1 3B93A 1KDKA 4N53B 1MZ5A 2JX9A 1AR61 1LOFC 2E7AA 4Q8LA 2TNFA 3K51A 2GALA 3N36A 4FPOB 3ZSLA 2I45A 4BPZA 3I4IA 2OZJA 3KZ4C 1BEV2 3OY8B 3K48A 3ZIWA 4X6QB 1O3TA 4Z92B 4P9IA 3JD71 5C9AB 2RS51 1H8VA 1H9PA 5JOZA 4HVRA 4FPKA 4FOWA 1TQ5A 3UK9A 1RUE1 3B94A 1LOEA 2DCYA 4RFT0 4G9SB 4YNIA 5ACA1 4IXLA 3AMMA 3ENRA 4A2UA 3APBA 3WP3A 1PO23 1MZ6A 3B01A 3VBUC 3ES4A 2B8MA 3FWEA 5BY5A 1C8M3 1VBE2 1N1SA 4FPYA 3E97A 1WUVA 1RL3A 3LA7A 2E7TA 3ZX7A 3IPVB 3AK0A 2P34A 2DURA 2AZ5A 3W59A 5JZGB 2QFEA 4FAGA 5KXBA 1W6PB 1WW5A 2B9UA 1FXZA 1C4RA 1LHUA 4RS5C 4JDNA 1QNYA 4EWEA 4P5HA 3MW2A 4YZ2A 2OVUA 5C9AA 4P9LA 3VKOA 4R8HA 2GC1A 3MLKA 4WBBA 1ZRRA 1GFF2 4PLOA 5DUWA 5CFCB 3RDIA 5FQ0B 4YGCA 1ZZ6A 4RHV2 1PZ9A 5K7PA 4OHYA 1TMF3 1UW8A 2XG3A 1DDLA 1LOBA 1X7NA 3U11A 1MS8A 1SFNA 2JE7A 4FXGB 3PTYA 2ARBA 1BVP1 4K20A 3IN9A 2DYCA 1ASJ3 4B4QA 2ZGLA 4KGQA 4FTEA 4FAHA 2ZGUA 2WNEA 4K7JA 4JGZC 4X8NA 1B35C 1LOGA 1UMZA 3NV4A 2VVEA 4J1WA 4TSVA 1YIFA 3DV8A 1OOPB 1XRUA 3SCHA 4YW3A 5JZGA 1LU2A 1W6PA 4PIYA 3ROUA 1PGW1 3O7OA 2NP0A 4KWLA 4XQ4A 2XUMA 3OGJA 4Q4X2 3WDXA 4AEKA 1N1TA 1R083 2XB6C 2EXKA 2VW2A 5BNOB 4G3YC 5KHJA 5A32B 4OI2A 2WS93 3VKMA 5CFCA 5FQ0A 2A3YA 4YVWC 2B45X 4XIOA 1ZZ8A 1DGWX 1YHFA 2OUHA 1C5HA 3RWNA 2ZMKA 1AVBA 1ZYBA 3SCGA 1HXS3 5JPMB 3RNSA 5C8WA 3KT1A 4D3WA 1AYN3 2OW4A 2GH2A 1HLCA 3NO8A 1H8TA 5DZGA 1GICA 4RGAA 5EJ3A 1YO8A 3NWKA 2OUJA 4BOWA 1H1MA 1Q8PA 2WQZC 4JCKA 3NKTA 5JSRA 3PJYA 4LBQD 4WVMB 1AR93 4M3CA 4IQPA 4H14A 5H9QA 1I3HA 1JOJA 1ENXA 3LWCA 1W39A 2O0OA 4JV4A 3U10A 3WP5A 3WZ1A 3ZIXA 3KT4A 2AGSA 4FPEA 3EO6A 2A6YA 1OOPA 1Q8VA 1VRH3 2R063 4L92A 3QH6A 2XVGA 3D6EA 2Q4SA 2CGNA 4Z8BA 1BMV1 1K5MA 1MQTB 3GZAA 4URTA 1OLQA 1REDA 4WVVA 1XNKA 4DY3A 2RMU3 4LBLA 1VBD2 1UZYA 3KB5A 2G4IA 4JRAA 4JVAA 2XJUA 4RR3A 4MGKE 2W52A 4XJUA 3VZMA 1NY72 1GV9A 4XETA 4YRDA 3N7MA 5A32A 1WCDJ 3AYCA 2GN7A 2F4PA 4OI4A 2DUOA 1XE7A 5GZFA 1A6CA 5KHKA 2PLV1 1PZ8A 4LHNA 4N9IA 3FUQA 1PGL1 2VU9A 5J48A 3MICA 1SLLA 1NQJA 4LO6B 4PDWB 5EFUA 3L2YA 1DBNA 2PN5A 3JQWA 3R0RA 1FAYA 3I8TA 1TMF1 3AXDA 2OZ6A 2IXHA 3AFKA 3FJSA 3JBG2 2X29A 1WBFA 3WOGA 3PVEA 3WDYA 1QGLA 4JDMA 2QZ2A 4XMIA 4AI3A 1YI7A 2P3IA 2WL1A 3VBRC 4R52A 4GH4A 4D7SA 2H6CA 1ASJ1 3A0NA 4FO9A 1ULGA 2DV9A 1Z7S2 1LOCA 3V0AB 1Q56A 4FTBA 4Q2FA 3CLPA 3O0XA 2JD4A 2O8QA 4I0AA 1GSLA 4DQAA 5CVRA 3TBDA 4XFGA 3D0JA 4KBBA 1QJX2 2ZZQA 2HEWF 5DDJ1 4AI2A 4AI8A 4IV1B 1RUI2 2EIGA 4L97A 5T52A 4YW2A 2A3XA 3VHRA 1AL23 5EXOA 1EP0A 4KU7A 2D6NA 1G9FA 1WLWA 2YYOA 2UWAA 1R081 1CAXB 3SMHA 3VBHB 2ZHNA 4AVCA 4TZDA 3VKLA 1J3RA 1OFSA 5FDBA 4LLFA 4WM8B 3JD72 2BQPA 4BA6A 5ABJB 2RS52 1YWKA 2WS91 3FMGA 4PDWA 4Q0QA 2WFPA 4QMAA 4YVSB 1RUE2 4HMZA 2JE9A 1W6OA 1HXS1 5FPZA 1A78A 4FQZA 5ACA2 1HQNA 2XKOA 1AYN1 3FBYA 1IGOA 3W58A 2ZZJA 3J4UH 4QHBA 1QDCA 2UU8A 1OA4A 5FCCA 2D3SA 5DUUA 3OBRA 1PGSA 3PMEA 3ILRA 2DTYA 4YARA 2GNMA 3V0AA 4QXKA 3WD5A 2VNRA 2D97A 1N3OA 5FMOL 1C3HA 4FP3A 2VOWA 3J8F1 3O12A 4LHKA 5CIRA 1N3PA 4IEPA 1D2SA 1VRH1 4IV1A 5I0SA 4C0HA 1CONA 1X33A 5C8CB 1UD1A 4WVWA 4ISRA 4EN0A 3S7IA 1OD5A 4MVTA 2XLAA 4Y20A 1WCSA 3TAYA 4KNCA 2RMU1 4HZFA 1KITA 1CAXA 2EF6A 3DPRC 4LE3A 1AXKA 1COV1 3MPBA 2ENRA 3VBHA 2WWSA 1AHSA 4M0HA 1YJLA 4QX5A 1SLBA 1UF2C 2QDNA 5CADA 4YW4A 1UL9A 4TLFA 4KG8A 3ZFFC 1ND2C 1XYOA 5D8AB 2TBVA 4UXAA 1DZRA 1ZA4A 4AF9A 1ZZ7A 1S55A 4CYDA 4GMP3 3P3PA 1Y43B 4AQTA 3B02A 2PAMA 2VOXA 3OYWB 2VUJA 4GA9A 4ZU4A 3HT1A 1V9U1 1QU0A 1NCRC 3FUOA 1PIV1 3WHUA 5JOWA 1G8WA 4R9DA 3VBOC 4QPGC 4OUSA 1OHFA 1POV0 2B5HA 4E9KA 3VKFC 3AJZA 4KU8A 4MV2A 3UJOA 2ZGQA 3IDEA 5FBZA 1SLAA 3AP7A 3N35A 2GC2A 2BVBA 5E89A 3VZKA 5AVAA 2ARXA 2VG9A 1NA1B 4D69A 4ASLA 2ZHKA 2WNVC 5FFOC 4XJWA 3OBTA 2AR6A 1SEFA 5JVVA 5F6LB 2YZ4A 3ME2A 1QJY3 3ZSEA 1DIWA 1AL21 1K5MC 3FLPA 1JUIA 2JEMA 2VY0A 2ZHMA 4LO4B 2D40A 4ORFA 3IDCB 2PA7A 4XFBA 3ASIA 4UW3A 5D8AA 4DINB 1DQ2A 4RR3C 3SNMA 5BNNB 5IK8A 2ET1A 1G9AA 2IWGB 3SISA 4AVBA 1KJLA 1QOSA 2PTMA 4Y1UA 2O1QA 1RJ8A 3BALA 3U07A 1CQ9A 1VBC3 3MLJA 5FTTC 1V70A 1PM7A 1XNDA 4IL7A 1QY4A 3VN4A 3MDPA 2A70A 1FOD3 2E63A 3VBUB 1RB8G 1CGPA 4DRVA 2PFWA 2BWCA 3AB0A 4UW4A 2ZX2A 2A75A 3S7EA 1R1ZA 4XFFA 2D5HA 3AZZA 3RMYA 5GLVA 3IBMA 4IEVA 4BE3A 1BMV2 2NPIA 3M1HA 5DZFA 4PLNA 2WT0A 1UPIA 1IS4A 2NM1A 1OPMA 2NMNA 3MIHA 1EAH3 2ZGKA 3ZMNA 1YYNA 4HL0A 1HW5A 3ZFGC 3NJZA 1ZZCA 2OA2A 1EYBA 4YZ5A 1W6MA 4RHV1 2VOKA 5KXCA 3DL3A 1MS3A 3UKVA 2H0BA 1OLRA 4Y1XA 1FMD3 4SLIA 5L7OA 4IV3B 1Q8OA 1PGL2 1O5UA 4COVA 1NCQB 1O3SA 1NLRA 2GU9A 3N4MA 4BQ1A 2FZ2A 1JW6A 4D7YA 1TMF2 2ZMNA 1X82A 4YGDA 4AEDC 4C0BA 2BFUS 2C0ZA 3MF9A 4Q0SA 4CEYC 4OHVA 1F8VA 4IEOA 4AFAA 1ASJ2 2WJSA 4L8QA 2B42B 1BZWA 2JKBA 1PHMA 4XILA 1OQEA 2BWAA 3SXWA 2BEOA 4OHWA 2CTVA 3VL9A 3NAPA 2HYKA 3TNQA 5GLUA 1IQAA 2IXKA 4LBQB 4N43B 4COUA 2DTWA 4CP1A 2R6QA 2GNDA 2P3JA 3VUOA 4GWNA 4U36A 3FHIB 3VBSC 1R082 1QJY1 5T3NA 2ZX4A 2RM23 1WGPA 2PAKA 4LULA 2BVVA 2RS33 1EV13 2A71A 3UV9A 2WS92 1YLLA 3L2HA 2X53S 2E7QA 2EAAA 4I0BA 4YVWB 3ZXAC 1U5XA 4X6RB 2XJQA 2H6BA 2UY9A 3EBRA 2VMGA 4OHZA 1HXS2 1N1VA 2VECA 5I8TA 1AYN2 1KS4A 3IDBB 5JOYA 1MACA 3FZ3A 5FLHA 2R073 1VBC1 4BZ4A 1G6NA 2E9QA 5FOBB 2VVDA 3ACLA 3WHTA 3MIFA 1DG6A 4B3NA 1HRI3 4MZUA 4HPKB 1IS6A 1V6JA 2GNTA 4Q4Y3 5D1IA 1LULA 3POWA 1PVXA 1FOD1 1AR92 1IHMA 3UKNA 2IFWA 3ZDSA 4WZFA 2BYVE 1VBD1 3D0SA 2VMIA 2QZ3A 1LU1A 3J8F2 2ZX3A 1ZRCA 3KGLA 1VRH2 2GDFA 3T1MA 1D2QA 2HWE3 1DGLA 2VQ0A 4NWWA 1GR3A 2DWRA 3NL1A 3OD0A 3KSCA 4NPRA 2RMU2 1D4VB 1REFA 2CV6A 4L99A 4ZU7A 1ND3B 1R091 1Q5OA 1COV2 3H1YA 4QD2A 1EAH1 2GN3A 5FLJA 1KQRA 2DVAA 5JAXA 1TME1 4QQ2A 2VOVA 3AKPA 3MYXA 4BCUA 1QQP3 3H0OA 2QQPA 1N3QA 4QM9A 2ZAAA 1CJPA 1MS9A 4AG4A 1LRHA 2ZGOA 4XIKA 4N90A 2XPJA 1REEA 1FMD1 2DCJA 2UYAA 4M00A 1I5ZA 2OPKA 5JR7B 4AHYA 2XWJB 4JDOA 1Z7S1 2W0XA 1E57A 1AX1A 1V9U2 3DF0A 4HPKA 5J98B 4A7ZA 2DUPA 5IK7A 1PIV2 3I59A 4IEWA 2R49A 3WXPA 1EPZA 1NXMA 2PAEA 1O4ZA 2XJVA 4XFIA 1WCKA 3HD8B 2NMOA 1VAVA 1G7YA 3R05A 4I2OA 1JHNA 2PHTA 2V09A 2JXAA 4YGEA 3MIEA 4Q0UA 2PHXA 3AMNA 1Z78A 5GLWA 3SLIA 1AUYA 4NHKA 1LGBA 1DZQA 4P9JA 3HAGA 3DGTA 3H3ZA 3ZXKA 1AL22 1DU3D 3N7JA 4YM1A 2HWB1 1XU2A 2DCTA 5LEKA 2JG9B 4KWJA 4YG0A 1WA4A 2JG8B 4AHZA 1LEMA 2X5IB 3FBMA 1S1AA 1QHDA 1JBCA 1FX5A 5JLVA 5JIAA 4M01A 3KCXA 5FREA 2D5FA 4NWVA 4CDXC 1MS1A 4EWAA 3N3HA 1RUC3 4LO7A 1WLTA 3TRSB 3GF6A 4B8EA 3HN1A 4ASMB 4RQPB 3M3EA 4LUKA 1CAUB 3CJIB 1ENQA 2R071 4X8PA 1IKPA 5GM0A 2LM3A 3VHPA 3MFCA 1CAWB 3M70A 4CDUB 4N53A 4Y26A 1H1IA 3ZN5A 3O14A 4XXAA 3MFAA 3GZUC 3GALA 5AFBA 3OY8A 1NOVA 1RUNA 5E8AA 3ETQA 1WW4A 5J3UA 3KM5A 2Q1MA 2D44A 3WUDA 5CA6A 5CFDB 2HWE1 1LCLA 5HCBA 1SMVA 4N7IA 2EAKA 2EA7A 1GBGA 1CX4A 4K6BA 2ZTNA 4Q0VA 2A5ZA 3DPRB 4OLLA