4W6YA

Co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf9
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
SSASSAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F18 fimbrial adhesin AC
publication title Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli dh5[alpha]
molecule tags Cell adhesion
total genus 33
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4w6yA00
4B4PA 4W6WA 4W6XA 4B4RA 4BWOA 4B4QA 4W6YA
chains in the Genus database with same CATH superfamily
1FAYA 4FTBA 2JENA 2WNOA 4P9XA 2YFZA 5DUVA 2GH8A 3VBUC 3BTAA 1JZ7A 4IESA 1VRH1 5L36A 1ZRDA 1W6MB 3MGUA 3NJVA 2X09A 5BUVA 1BVP1 4KNCA 1QU0A 3PJQA 2QFEA 5SV5A 4HKLA 1HKDA 2ZHKA 2VOWA 2GC2A 1HB1A 1O3TA 1Q43A 2WKKA 3NNFA 4ATEA 4LOSA 4EWAA 1WLCA 3S6PA 2X10A 1QQP1 1J83A 2JG9A 1U5IA 1GQGA 4XC9A 1G9CA 2FDFA 3JB8A 4C1WA 3IDAA 5EZWA 5FYZA 5M0TA 1NCQC 2VTXA 3FZ3A 1MZ5A 4CP9A 1TNFA 1QGLA 4JHTA 4L9BA 3H1YA 3U07A 3VKNA 2EXJA 1DQ6A 1IKQA 2W92A 2ZEZA 3E6BA 4FPYA 1XNKA 1MS5A 5FYYA 5FZCA 3RYRA 4BDVB 2Y34A 4Q0SA 1FT9A 2OPWA 4R9DA 5L7OC 1LHOA 3VDDA 3QLQA 5HCBA 1JHJA 1DF0A 2W52A 1OOPA 1R093 2FBEA 3T1MA 5ANNA 1AR91 2VTFA 2HBTA 1JI6A 2YUEA 2HEYF 5D21A 4B7EA 4IEVA 1J3QA 4NPRA 3EXUA 3VBUB 1N1VA 5IUQA 2E53A 1CWPA 4QX3A 4Q4V2 1O91A 1EV13 2J1AA 3AXEA 4AHXA 3ETQA 4JV4A 5CYYA 3GDBA 5A3MA 2NQYA 5ACA3 4EJRA 2WFPA 2ZHLA 5LK7B 5FZ9A 4UW5A 2YC4A 4S2HA 3T1LA 4DEVA 1N1SA 2WQ8A 1C28A 3VL9A 5IFTA 1NLSA 1WKYA 3NW4A 2HWE3 4K21A 3V0BB 1OBNA 4FPJA 3AJZA 4LPLA 4YGDA 1NCQB 4ITCA 2EALA 1CAWB 1UWWA 1BBT3 5JIUA 1AXKA 4D69A 3UKVA 3PUQA 2E33A 1AL0G 3QCWA 4XMAA 2IXHA 3FBYA 1HN0A 3RS6A 3J4UH 1SLCA 1WCKA 3T3YA 5L7OB 5DPNA 4BB3A 2GN7A 5CG9A 2CYFA 3GHNA 4JC1A 4QPWA 1LHNA 2GU9A 1LENA 3GCWA 2RG4A 2B42B 3B5LB 4RR3A 3UNPA 4XMIA 2WZPP 3VBOC 5FYCA 4LBMA 5F1RA 2RM21 2BZDA 5LCWL 4CXYA 3ILNA 5DAPA 3V65A 3AL6A 5DXDA 4JKMA 1ZBA2 3M3QA 1L3JA 4CP0A 1WCDJ 2W0XA 3ZMOA 3WDYA 4HETA 1POV1 3RZHA 1AVBA 5FZ7A 5I8YA 2ZABA 3AFGA 2BBVA 1XU2A 1D0GA 4HN0A 2RE9A 4I02A 1WUVA 1MS4A 3ABZA 3QH7A 4CU6A 4PIXA 1QIQA 2EXHA 1DGWX 4KI5M 4FT8A 4QHZA 3OYWB 1RUC2 1QJZA 5I8SA 1CPNA 2JX9A 4RFT0 4H7MA 3NRUA 5I0SA 3C2UA 1H8TC 3WEZA 1UOFA 4AQ6A 5LZ6A 3BIEA 4XF9A 4PLOA 5DABA 2GAUA 3LFMA 3BOPA 5CFDA 2PELA 2RS11 3FFQA 3NKTA 3GZTB 1W2OA 2CHHA 3VBOB 5FMDA 3AMHA 5FKCA 4ZKTB 4M4PA 5GM0A 1UYPA 4FSJA 3K3OA 3ZFGA 1DZTA 4NROA 1AR82 4LXLA 4GMP1 4XUPA 4AGRA 2WZEA 1UXZA 4HOOA 1JZ4A 2BU9A 1IPKA 3ETPA 1OI6A 2Q30A 5L19A 4Q1RA 4KWJA 4NE9A 4QX7A 2ZMNA 4GWJA 1XB9A 5E88A 5EV7A 1YFUA 5IW0A 2P3KA 1XNAA 1RGSA 1Z7S3 3B02A 4X6QB 2Q1MA 4CEWC 2ES3A 3WV6A 5AC92 3U75A 4E4ZA 1LKNA 2YGMA 2B39A 1VBC3 2GP5A 2VZVA 3KV9A 4D3WA 4FBFA 4RS5A 1GWMA 4N90A 1JS9A 1VRH2 1ZA7A 3FMGA 1OPMA 2NZ9A 2XL7A 2P1BA 2Y6FA 5E89A 2Y0OA 5C8WA 3AK0A 1H8TB 2VNOA 4QQ2A 2HEVF 1OF4A 2ZHMA 1QDOA 2OUHA 5C3PA 4GAZA 3OJBA 1AF9A 2E7AA 4H3WA 3A23A 2R041 2D3SA 1VBD1 3ILFA 2WNVC 4I01A 4XJWA 1QQP2 4OZOA 4C91A 4J6GA 5JPMB 4Q4Y1 1J1TA 3ACIA 4UFMA 1AYM3 1S0IA 3DXTA 3MYXA 1I5PA 1Y43B 1H2MA 4HMZA 5DQ0A 1RUJ1 4EYUA 5K8SA 5FZOB 2ZAAA 1UY2A 1W9YA 2JD9A 3DYPA 4FPHA 1J3RA 1CJPA 2C26A 2Q1ZB 4AL9A 2PMWB 3OBRA 5A7NA 2ADEA 4Z8BA 5C71A 1WLTA 3PVBB 1YHFA 1AR71 4NWVA 1AR92 1RUH3 4X6RB 1SFYA 5BNOA 2HWD1 3R6SA 3FHIB 4NPMA 3PLQA 3ZYRA 3JD72 3K4ZA 5T3NA 4XURA 4XAEA 1QJY3 3OOXA 4YVSC 2HKXA 3ZN4A 5IATA 1W8NA 1SPPA 5IK5A 3GXUA 3GZUC 5EFUA 4IV1A 4WVMA 4AXOA 4GD4A 1RUF3 4YW2A 5H9PA 4PF5A 3IAQA 1GUIA 4PF1A 1ZRCA 1CR7A 5FPZA 3IKWA 4CEYA 2WZR3 2VZ1A 4BA6A 5JWPA 1CQ9A 2DUOA 4KGGA 1GP6A 3W20A 1QXJA 1ZRIA 4YRDA 1HV0A 3WNLA 1WW5A 3CIHA 2J1VA 4N7IA 1TEIA 1PHMA 2WNVB 4GALA 2GC3A 3UJQA 5HCHA 5A3OA 4XUQA 2FZ1A 5C3SA 4CU9A 2WS91 4MH0E 1WMEA 1YI9A 2JXAA 2OT7A 2P5BA 4YW7A 2HYXA 5BNQA 3WZ1A 1LRHA 2YY1A 4BU2A 2VD7A 4CXWA 1MEC3 2P3JA 3KCXA 1GOHA 1WBLA 4H2AA 2BGCA 1UOGA 5KHJA 2BNMA 4A42A 1HDKA 4IEUA 5FQ0A 3HNYM 1NCRC 5IVVA 3WD5A 4FOWA 2BERA 1LOCA 1Q8VA 3AZYA 3Q8AA 4XJZA 4BQ4A 3BPZA 5JPNB 3LQCA 2CDPA 3DYOA 5D2AA 4OHYA 5LA9A 2VMIA 2ERFA 2PA7A 1JYIA 1K5JA 3L2HA 4UFIA 3WG4A 3ORJA 4N53C 3S5QA 1JHNA 4AEDA 1W0OA 1WD3A 4M4RA 5FOJB 2RHPA 4YVSB 3VBRC 3LB9A 1GBGA 3MIGA 4LO5B 1MQTA 4MXVA 4OUEA 4Q5OA 2LUWA 4Z07A 2E9QA 4DMIA 4D94A 3O1PA 3BIWE 4AGGA 2WSVA 3N9OA 4LUMA 5JZGA 2IFRA 4IQPA 1CZVA 3R4UA 5KWRA 3U1XA 1VBE1 3ZSKA 2VUCA 2XLAA 4LUKA 5F9TA 1HW5A 3SXWA 4AHYA 3VBSA 4AYUA 4K20A 4JZRA 1QJEA 4GWIA 3PUHA 4QMAA 1JXNA 4XUNA 4AFDA 5B4XA 3ZXFA 1YC61 3N9QA 1MS8A 4RN5A 4RYDA 4DRRA 1UZYA 2VVFA 1QOTA 2P34A 1NCRB 3C7FA 2D43A 1VIWB 2HWF3 1X8MA 3ACLA 4RSUA 1B09A 4QGMA 2R063 1V6JA 1H9WA 4XF4A 4N53B 3PL0A 1QNWA 3T08A 4NJ4A 1H4GA 2TEPA 4MGYE 3NJXA 2WRAA 2MEV3 4JDMA 1ULPA 3VBRB 1W8UA 3P5BA 2GN3A 4B1MA 1CJDA 3IBMA 4P08A 3KCYA 3SNMA 1BK1A 5C4WC 5E16A 1IZ3A 2NM1A 3IIIA 2YXSA 1OXCA 1PGSA 3K3NA 5LASA 5FZIA 3OGVA 1SLTA 2XHNA 3OBZA 4Y5Z0 2G19A 2CV6A 4AW7A 1W2UA 1O6UA 5DG1A 2KM2A 2VE1A 5JXJA 3BTXA 3TRSB 5GZEA 2BNNA 4TSVA 2VNVA 1OQEA 1W6PA 2PHRA 4PDWA 1G7YA 3O7OA 1UYXA 5FZ1A 1R1A2 4CCKA 1CAUA 4KWKA 3AYAA 4JQRA 3IZOA 3NMBA 5CIRA 1HQNA 1BJQA 4PBPA 2A6WA 1ZYBA 3ECQA 1GNHA 5FY8A 4DS0A 2VBBA 5LEKA 3I8TA 4CUBA 2XKPA 2Q0AA 5A6ZA 4QDQA 4DO0A 1HXS1 4CTEA 3HD8B 2D44A 3VBFC 3MW4A 5K0UC 1VBD2 1YNAA 4E2QA 4WM8C 3FJSA 5DG2A 4QPGA 3RSJA 3R4SA 1JH5A 1REEA 1QJU3 3EB7A 4Q4Y2 4DY3A 4XFHA 1ND2A 4RHV1 5CG8A 4HLTA 4Q26A 2ZZQA 3WNKA 2Y6GA 1A8DA 3LOIA 4A45A 5C4WB 1E57A 3RVHA 2WAOA 1S0FA 2ORXA 2EA7A 2VZTA 4K3UA 3TNPB 4Q2FA 3WHUA 2I2SA 5FY5A 4XXPA 2R7EB 2JICA 4D6RA 3O1OA 2CGPA 5FZEA 2C9AA 1AR72 4EV0A 1JW6A 4HKOA 2WNEA 5BNPC 3WLUA 5EYYA 4AVCA 2HWD2 2Y38A 3S57A 1W9SA 4N8MA 4FFHA 2CGOA 2AYHA 4A7ZA 1O5UA 3KV6A 4W4ZA 1RIRA 4UXAA 2B4KA 2XJPA 3N7KA 5CU1A 4A4AA 3APBA 3CO2A 1X8EA 3GGLA 1AJOA 3MV01 1YO8A 4KH9A 3GYDA 5I91A 3VBFB 1PGW2 4LORA 1SHWB 5GLVA 3ZYHA 5A3UA 5K0UB 3KGZA 4WM8B 3VB9A 2FDJA 1OSGA 1ND3A 1YJKA 2NN8A 3W5NA 1TME1 1AL23 2IWGB 1X50A 3K4DA 4XW3A 1MVQA 3NQHA 4FPGA 3K4AA 4FQZA 3VKFC 5EIYB 3WVJA 3TWIA 2V72A 5CKQA 4B8EA 3VHRA 2ZHNA 3VDCA 2GNTA 1NOVA 2AR6A 2JDYA 4XFAA 1TE1B 2AZ5A 4XYXA 1EYBA 2QNKA 4AGVA 2BTVC 3O1RA 3KHCA 2VVEA 1RMU3 4OMCA 2JDPA 3GZEA 4XDPA 4E2GA 4BK4A 4OFGA 5BNPB 1CIWA 1OLQA 2HWB3 1JYTA 4O9GA 5L9BA 3AC0A 4XABA 5E8AA 4B4QA 3CMGA 3UL2A 3LSEA 3N7LA 4Q4W1 2J42A 4MGTA 1TMF1 4ZS3A 2ZXQA 5EJ3A 1ACCA 3ZFFA 4D7YA 1U5YA 2BVVA 4JGZA 1AYN1 1XJAA 1VBE2 1WLWA 2VZOA 1RVF1 3H50A 4IXLA 1S0GA 3RRDA 4A6SA 3IM0A 1JU4A 4AQ2A 4WM7A 4XTMA 1UZWA 3NV1A 4R9BA 5FMBA 4HBNA 4Y5SA 4OHZA 3SH5A 4V2WA 3DUIA 4R4ZA 5H9SA 2IXJA 5A7WA 1QEXA 3UGHA 3N3HA 1STMA 2W94A 4XXAA 3RZKA 4DOUA 1XYPA 3ME2A 5CNAA 1RUG3 5F32A 5ABJC 5CBLA 5IVCA 3GZAA 5FK7A 4GWNA 1OKOA 4XQWA 1UO9A 2VZ3A 1SLLA 4BQ3A 4LBQA 3ES4A 1I5ZA 4LIVA 4M01A 5T5LA 2FZ2A 4NIHA 3LCPA 2WINB 4AHZA 4ZHNA 5GJ6A 3B93A 4QXCA 2AH2A 1FOD1 5T5PA 1DYOA 3KQRA 2GSYA 3ZYGA 3I4IA 1ZZCA 2C24A 4XUTA 1JYWA 1XPWA 1IS6A 1D2SA 4N9IA 4ET7A 3AP6A 4EN9B 3HWJA 1V9U3 4C0BA 3I59A 1FI2A 3KLSA 1MACA 3ZN6B 1QJX3 2A6XA 4AI3A 2AENA 3JZVA 2RR11 1QH7A 1JUIA 2ZX0A 4ZS2A 2WLQA 5J48A 4CCDA 1UNBA 4YPJA 3BKZA 1ZBE1 1COV1 1D2QA 5JOWA 1HJGA 3OUHA 3O1TA 1W04A 1RL3A 3O12A 5A3NA 5FO8B 2RJ2A 3WW2A 4KU8A 3KHBA 2W87A 4JRLA 2EF6A 3LEMA 3HQXA 4FP2A 1HXS2 3ACGA 5F8PA 2ZGMA 5C5UA 3MIFA 2ZX1A 5ABJB 2KR2A 1FPN3 2LS6A 4HXCA 5F5QA 5CB7A 1MPXA 5A7OA 3QACA 5KHIA 3HBZA 4QAWA 2OW4A 2AEZA 5IK8A 4YVWA 1I9RA 1XNCA 3URFA 1K5MA 5KC6A 2E31A 4LTAA 3GJAA 1YXWA 4LKDA 2RS53 1WA4A 2RMU1 4FOQA 4XFCA 5DN2A 4E4SA 5BNNC 5KXBA 1FMD3 5BPXA 2DCKA 1U5ZA 2XUMA 1IG3A 1VBB3 2XJUA 3A0KA 5FY0A 1WZXA 1SG3A 3N9MA 3MW2A 4JTNA 3S7EA 2RVAA 5C9AC 1PK6A 5IYYA 4CCOA 2WSUA 3POBA 2RV9A 1POQA 3N9LA 4YW4A 5BY5A 2SBAA 4IE6A 4YZ4A 3G7DA 5DUXA 4HG6B 3WP3A 3SH3A 1VR3A 2I07B 5HPOA 4AE2A 3LFIA 1OF3A 3AYEA 3VD5A 3HQRA 3H7YA 2WLPA 4LA3A 5IVFA 2XHKA 4AVVA 4BJ0A 4CPBA 1XSRA 4M3CB 3WUCA 3DCQA 3OCPA 5BNNB 4QKFA 2FCUA 4RFRB 1O59A 3AVSA 3UV9A 4EN8B 2YV8A 3HJRA 4UT5A 1W8OA 4UW6A 4IEXA 4OULA 4O7XA 5DUWA 3B9CA 1JBCA 2JJ6A 3PUIA 4LHLA 4CDWA 1KXGA 1UD1A 3IPVB 1C8M2 1OLRA 5C9AB 5J09A 3ATGA 2XPJA 4TTGA 4KWLA 2VJXA 3FBMA 2V73A 4Q4W2 3W9AA 2QUOA 3DPRC 3GBGA 1TMF2 3S0MA 2K46A 4IV3A 3OD0A 1AYN2 4N9HA 1R091 2VPVA 1OA3A 2EAAA 2R0FA 1RVF2 2QQNA 4P14A 1BKZA 3TNQA 1ZX5A 2XBO3 5FXXA 2W47A 3ZKUA 3UGGA 4Z82A 3W21A 4LIUA 2PAEA 1OFSA 1LODA 1UY0A 3MIEA 2OUJA 3O0VA 1J58A 1EV11 1LOGA 3MDPA 3SC7X 1UX6A 2B5HA 1OVPA 3H0OA 5ACA1 4NR1A 2RJKA 3V0AA 2ZGNA 1LB2A 3BPSA 1S0JA 1UW8A 4UBHA 1VALA 5LY2A 3WNNA 1KD7A 4PIYA 2GC0A 2YC0A 4RQPC 2HWC3 4WZCA 4XQ4A 1ST8A 1F5JA 1RXGA 4ZY9A 3TN92 1O3QA 1RC6A 1O4ZA 5FZGA 1RUOA 2HWE1 3FLPA 2VL4A 3PHMA 2ZEWA 1PVC3 2WFF3 4FQ4A 5HCFA 4P9LA 3MHZA 5T5JA 3T0AA 1Q3EA 3VLBB 2TUNA 2QQPA 1BBT1 4LLOA 3WQBA 1UAIA 1US2A 3TAYA 4MLOA 3DPRB 1PIV3 2J1EA 5FP7A 1DQ2A 1W8HA 1FOD2 3MI8A 4LBKA 1V70A 2UY8A 1NKGA 3ZDVA 1HB2A 4I30A 4OI1A 1WMFA 2GH2A 3KB5A 4QHOA 3BYWA 5LB6A 4AI0A 5FIXA 3USUB 4CU7A 1AR81 5L73A 3H8XA 4O9EA 1UPIA 1US3A 4OHVA 5FZ3A 5JOYA 1MS0A 4ARYA 3ZPOA 3N4MA 4S2DA 1RUI3 4BHPA 2QQLA 2RR12 2O8QA 2WO2A 1D4M3 3U11A 4O65A 1B35A 1Q56A 4DY5A 1XNBA 5L9VA 2XUEA 1PM4A 1COV2 1XSQA 2E32A 2ORZA 4IGOA 5A32B 5AC91 2YFUA 1O4TA 4GJYA 4RQPB 1TZOA 3TB0A 1G9DA 4ATFA 2BP6A 2WQZC 1ZNPA 4ES9A 2JDKA 1L7QA 5H9RA 4CCNA 4QHBA 2BFUS 4HPKA 2ZGQA 2W2IA 1NY71 4J1WA 4MZUA 2X5IB 4I2OA 1RUD3 3FLRA 2R32A 4QX1A 4MHRA 3OY8A 1RUE3 4YGCA 2J1TA 3J8F3 1V6KA 1BZWA 4RGKA 3S30A 2EICA 2G4IA 2VMEA 2RMU2 1PO23 2LW8A 5CFCC 1ENRA 1O8SA 2D98A 3RG0A 3ALQA 1GANA 1OPOA 1AJKA 1REFA 1S0BA 1WCQA 2BGPA 3C7GA 4M3CF 4QX8A 3WQ1A 4A7KA 1NT0A 1A34A 1FNZA 5FMCA 1S2BA 1E5RA 4JVAA 1VBA2 4XAAA 1J1LA 5GZFA 1RTVA 4FFFA 4XIOA 3NAPC 4LE3A 4BQ1A 3GM8A 3HIFA 4W65A 3WNPA 4C1XA 4FTEA 2CDOA 4R4XA 2YPDA 1Q8PA 4GH4A 1FXZA 5E6HA 1J59A 1V6LA 1W8TA 3FFZA 1VMHA 3JD71 1BLZA 1GZWA 1LHWA 4MGZE 4KGQA 5F6LB 3WQ0A 5A6XA 1V0AA 1W6QA 3CZJA 2VMHA 2VZPA 4PIZA 3THCA 3SCHA 1QXPA 3KF3A 4N43C 5FPAA 4QQLA 2WR9A 5GALA 2ZKLA 2GMMA 3QOPA 1RHI3 5GLWA 5FP8A 3VBHC 4MVTA 1APNA 4ASKA 4CUCA 1DG6A 3NV3A 5DDJ3 5EPAA 5FDBA 4UFKA 1X82A 3CJIC 2VZSA 1H4HA 3ACFA 3ZXJA 1POV0 5HCAA 1CIYA 2PHDA 3IN9A 4XJUA 2D93A 2VAUA 1SLIA 3PMSA 4D7TA 5FPUA 2IVJA 2QQKA 3D8CA 3LDRA 5CFCB 4MXWB 4KQ7A 3TEXA 1YUDA 5FYBA 1OURA 5IVEA 3SKJE 1CAVB 2RJLA 4KU7A 1SCSA 3J7MA 3TEZA 3VD4A 1DZRA 3A0NA 2DWRA 4XPVA 1GOGA 2Q8OA 3NAPB 1AYM1 3E5XA 3IDCB 3HR9A 2IUWA 1SQ4A 3C7OA 3AZZA 3O14A 1OD3A 3B7MA 3WP6A 3AP7A 1T6GC 4MYEA 4UF0A 1QOSA 2VO5A 4Q29A 3AMMA 1UOJA 4LBNA 2O0OA 2D6PA 4YG3A 2YBKA 1LOAA 5LBBA 3VZNA 4XE9A 3WF2A 5FTTC 1W0PA 4NRMA 4MX3A 5DZEA 3VL8A 2WT0A 1EUUA 1R092 2QVSB 3FHQA 5BV6A 5JI7A 1RUH1 1VAMA 3VZLA 1TVGA 4G9SB 5A33A 4GJZA 5A3TA 5A7SA 4BXSV 1PM7A 1QJY1 5FY4A 3VBHB 4DRVA 5FOBB 3AKRA 4GMP0 3HNBM 3CJIB 5F5AA 2JE7A 1RUF1 1EV12 1A3KA 3Q8CA 1M4WA 4AFCA 1MZEA 3LPGA 5ACA2 3PTRB 4MGSA 1UZZA 5DZFA 2W9XA 1OUSA 3NV4A 5T50A 4TZDA 5FREA 1GSLA 2ZCWA 1UL9A 3MFAA 5B2GB 1ASJ3 4PLNA 1NLQA 2HWE2 1D4VB 3AKPA 4HSLA 2XJRA 3ON7A 2BUKA 4LK7A 1OFNA 2WN2A 3MEPA 2BWAA 3WT3A 1BBT2 1K45A 4QPIA 1DP0A 2GMEA 2E63A 2HLEA 5G05L 1HRI1 3I54A 3RZGA 1RUNA 3PJYA 1W39A 1NCRA 3HPNA 5D1IA 4BCUA 4RGGA 2BQPA 3RNSA 2B7YA 2JG9C 2D6OX 3JXSA 2DU0A 2WO7A 1KFXL 2FMYA 4LOTA 2QQWA 4JGYC 2WA4A 2KD7A 4XBNA 4FOVA 4YZ1A 2NPIA 3PTYA 4V1PA 4XFBA 1JUHA 4BQ5A 1LHUA 1XRUA 5FZ4A 1W2NA 1DQ4A 1PZ9A 1R1A1 2UURA 2VULA 4LJHA 4XF3A 3VDDC 1UMHA 3K77A 5EXOA 1PZ7A 2ENRA 1MZ6A 1W6OB 2DCYA 1LECA 1OOPC 4QB6A 3MF6A 2K0GA 2ZJCA 1GR3A 5AVAA 5JXIA 3PURA 4LO6B 2OQ7A 1OA4A 2XB6C 3OGSA 2Q8EA 1AXZA 3N7JA 1V6OA 4QDSA 1WCUA 3M4FA 1NY72 4XBQA 4A3XA 2HYKA 3WNXA 2WAAA 1JZ8A 1KQRA 3DF0A 4YW5A 4JAAA 3PVEA 2ZGRA 4AI8A 4TWTA 5DAWA 1QXRA 1H0BA 1HIXA 2AGSA 5F3GA 3IMMA 5EP9A 2OS2A 3INAA 1GKBA 4XFIA 2HWF1 1JZ5A 1GP5A 1QF3A 4W6XA 2HJIA 4CP2A 2XXZA 3LZZA 3PVOA 4Q0UA 4YM0A 4Z1VA 3ZSMA 3KGLA 1NQJA 2Y8KA 1YI7A 3UKTA 2D6LX 3RFRA 1DZQA 2JG9B 2Z2SB 1M06G 4CDXA 2XWBB 3SCFA 5J1XA 4JGYB 2OIIA 1C8NA 2NMNA 4QX5A 5JAXA 4GQ7A 4CP9B 4HZFA 4QX0A 1OLME 5FBJA 1HB4A 4XVHA 3K46A 4GULA 3RZMA 4CEWB 3J7HA 3O0XA 3P3NA 4BQYA 1ZZ7A 2BPA2 3HN1A 1J3PA 5GKAC 1MZFA 3AL5A 3ZX7A 4AAXA 5LA1A 1OOPB 4JCKA 1Z7S2 4LEJA 2Z69A 2XVKA 4RR3C 4OUMA 3PMEA 5E1RA 3RWKX 3KMHA 2XG3A 4Y24A 1PGW1 3LEKA 2CWSA 3LDKA 2ARBA 3HT2A 3E5UA 2ZPXA 1GMMA 5L9RA 2RM23 4LLFA 4URTA 5A3WA 2YBPA 5FYSA 3E6DA 2GMPA 3POJA 2TBVA 4QQPA 3VDAA 2BW8A 4BLJA 2O1QA 3D0SA 2ZKNA 1VMJA 2VBDA 3M8LA 1LCLA 3PUAA 3FL7A 4Y20A 3VBFA 3PIJA 4B4PA 1UMIA 2ARAA 4CE8A 1J84A 3NWKA 1GZ9A 2WIIB 5IJRA 4F3JA 1WBFA 2WO3A 1UY1A 4XZUG 5FY7A 3RPQA 1AYM2 1W6NA 2GC1A 4COZA 2OZ6A 2RDNA 2OPKA 3LF7A 4B1LA 1XNDA 4NN0A 4ARXA 4FPKA 2ID4A 4FPCA 4CRQA 2ZEYA 1ZM1A 3VHOA 2C4XA 1GWKA 1YEWA 3OGRA 1DLLA 4DFSA 4TLFA 2FDGA 1S0EA 4DNYA 2VW2A 1OD5A 1RUH2 3RJRA 3DKWA 5CFDC 2ZX2A 4RR3B 2WNUA 5BNPA 4K9SA 2RS13 1QJY2 1QJFA 2JG8A 1W28A 2H6CA 2FDIA 2PLV3 1GP4A 3SKVA 3WF0A 4D6QA 1XNTA 2CAVA 4IEYA 1OQ1A 1RUF2 3ZFGC 2ZGSA 3LPFA 2E26A 5GZDA 2D6KA 4NAMA 3SCGA 2WZR2 4YW6A 4IEQA 4Y1UA 3WG2A 5J96B 1NXMA 3T09A 1NYWA 1DDLA 5LRRA 3UK9A 1BEV3 2DFCA 3LD8A 4CUAA 5FWJA 4K8FA 3H1MA 3NNMA 1F5FA 5FZKA 3ZIXA 4TN7A 4MOAA 1WW7A 1A6CA 3PVNA 3IIAA 1H1AA 1AL21 3USSA 5LK5A 3HEIA 2VMFA 1NE4A 3WDUA 1MEC2 2UY9A 3WDWA 4RS5C 3VUOA 3MPPG 4BE3A 3I3DA 3POIA 2D97A 2E51A 3LOBA 4JDOA 1HRI2 5FWEA 5FYVA 5FAXA 1QKQA 5FZHA 3C7EA 4K6BA 1Q8OA 1DBNA 2Y6KA 2H0VA 2R043 2HEWF 1ZZ9A 4IL7A 2Y33A 2HWB1 3M7AA 3AFKA 5CFDB 4Y26A 1V6MA 1HX6A 3X29B 4CCLA 3PIGA 5JSPA 4NUBA 2QQMA 3ENRA 4ZXEA 2GNMA 3MFCA 3ZFGB 1FNYA 1FV2A 1UX7A 4HVOA 1YQ5A 3LIHA 5I0RA 1RUJ3 3FE5A 4HVQA 5LY1A 4OHXA 3OUJA 3VN4A 3W5MA 3WCRA 1L7RA 2WL1A 4P5HA 1JOPA 4OZXA 2TNFA 5JUVA 4QDRA 4U2AA 2ETEA 4JDNA 5BNOC 2A70A 1PO13 4NIGA 4OI0A 3BALA 3P3PA 1T6BX 3GBWA 3LEIA 4FFIA 1L7LA 3ROUA 3MIBA 5KXDA 2AUYA 3WHTA 4IV1C 1VLNA 3NO8A 2ZAHA 3SEEA 3T0BA 1LTEA 2QQJA 1EP0A 2A6ZA 5FFOC 3V64A 4JTOA 1G9FA 2WA3A 4XJ8A 4CEYC 4LK6A 4SBVA 4F8AA 1CZTA 3I2HA 2P17A 1HRV3 2HWF2 2JECA 2PHWA 4CUGA 1QH6A 3WDXA 3N35A 4PLMA 3O1VA 4MHUA 4BQWA 2R062 4LKFA 3CEWA 1VJ2A 4A6OA 2VQAA 3AYDA 2SLIA 1AXYA 3KF5A 4YSFA 2MEV2 2WS93 2LTNA 1YFWA 4JQTA 5LATA 4L2NA 2XJVA 4AF9A 2JWPA 5HXVA 2OZJA 2YG0A 3B3QE 4Q0VA 4W50A 1ZA4A 1IS3A 2Q1FA 4QKNA 2PHTA 3PDQA 3MV11 4YLZA 1V9U1 3ZYBA 4XCAA 1R083 3I2JA 5BNOB 4GXLA 3POFA 4AEDC 3H1WA 1NA1A 4NO4A 1Y9QA 5CEHA 3UETA 2Z5WA 1AUYA 1SPPB 1S2KA 3OB8A 4QU2A 1SACA 1MQTC 4IV1B 1H2NA 3AX4A 4WVMB 3OPWA 1RJ7A 4AFBA 4LBQD 3MO4A 3CHXA 5JZGC 3KCCA 2DBIA 4CEYB 4QXBA 3ELNA 3B69A 2XJQA 4QD2A 4UAPA 5JCTA 1GFF2 4K1ZA 2VW1A 1FATA 3KWVA 1AR63 1UY4A 4LO8A 3WP4A 1H6YA 4FO9A 4GKYA 1QJU2 3K2OA 1EUTA 4Y4YA 3WF4A 5LRSA 5EWSA 1ODNA 2VCBA 2ARXA 1DU3D 4FFGA 5FJHA 4GB33 4XHBA 1HV1A 1ALYA 2RS51 3MZHA 2A6VA 5DAVA 1C8M1 5DUUA 1FMD1 5FQ0B 2GDFA 3TYJA 2MPFA 3GNEA 3BCWA 3VZJA 3CU7A 1F31A 5JVVA 3TBDA 1OMIA 4G4FA 4I3GA 4YZ2A 5AFBA 5APAA 3I3MA 5FZDA 4Q4X3 1ENQA 4URAA 3D4KA 4XFFA 2CY6A 2OQ6A 1SEFA 1NUKA 4M3CE 3RJ2X 3VHNA 3VV1A 4AEDB 4B7KA 4OQ9A 4XQDA 4UYBA 5FYIA 1MQTB 4CCCA 3CF6E 3KV5A 3AZWA 4DB5A 3JQWA 5JZGB 3PUSA 2FCVA 2GNBA 2Y26A 5A1LA 5FYUA 1SCRA 4M0NA 4FPOB 1G86A 3I97A 3JBG3 5JIAA 2ZX3A 2FD8A 5K9YA 1C1LA 1UYZA 2DURA 2LM3A 5FMOL 5FYMA 3ASIA 3VKLA 4NHYA 3RI9A 1AL22 4PDWC 5F3IA 3U37A 1G8WA 3WQ7A 5CISA 3S5AA 3TN91 2FMDA 4OI4A 1PMIA 1A8MA 1C57A 3UGFA 4WVWA 5I0DA 4DEQA 5A6YA 4AG4A 3U14A 4YM3A 1W05A 4AEKA 1FYUA 1RMU2 5FZFA 4A7YA 3THPA 2P6HA 2BJSA 1F2NA 2W3JA 2YBSA 5FO9B 1CX4A 2YMZA 3AZXA 4KBZA 4LO7A 3VZMA 2WWJA 1H9PA 2HWB2 2QCSB 4QPGC 1UCXA 5JSOA 3T2PA 1ND2C 3U10A 2AC1A 2AACA 4RHV3 3M1HA 4LHNA 1O3SA 1LOFA 1ZZBA 4L0PA 5CVRA 3OEBA 4UFJA 5EHDA 3NKGA 4DXSA 2QKDA 3WG1A 2EIEA 2MNGA 1JYVA 4CPBD 1BXHA 5F3EA 1W9WA 4JHZA 2IXKA 2XBO1 4Q0QA 4F83A 1VMFA 3USUA 1PZ8A 1UF2C 3BVCA 4AOCA 1YQ2A 4NPLA 3ZFEA 4D8MA 3ZXEA 2CTVA 3P1IA 4OCTA 1IKPA 1EAH1 1H2LA 4QQHA 1Y7BA 5ANQA 3WX5A 3THDA 1W6PB 4PDWB 4CDQA 3ACHA 5A1FA 1VAVA 2UYAA 3MLKA 4MUVA 4AI1A 1CAUB 1YQ8A 4LQRA 4UOJA 2YU2A 1Y4WA 4LHKA 1OQDA 4QB1A 3ZXGA 1YJLA 4Y22B 2DFBA 1YQ6A 1ONAA 4H55A 3WSOA 5J7MA 2J1SA 4RGAA 3T4VA 4RQPA 5FY9A 5FP3A 5A70A 3N9PA 4COVA 3DV8A 1RUG2 1W6MA 4BLIA 2VZRA 4LITA 3SH4A 4HN1A 5HXMA 4QPGB 4AQTA 1ND3C 2X5IA 3VZKA 3T2OA 3AB0A 5JMOA 1ND2B 2VG9A 1TME3 4NHMA 5FRAA 2VQ0A 1VBA1 1PIV1 2DDUA 3L2YA 1JZ3A 1MVEA 3UESA 4BQ2A 3BU0A 3D0JA 3E5QA 3GJBA 2RS33 3HAGA 3MICA 3NV2A 3QBQA 4AFAA 4CXXA 3JCIA 2VMGA 4P9WA 2D3PA 2W95A 2YU1A 1F4HA 5J37A 2BNOA 1AX0A 1V9U2 2DBNA 1HJFA 2X8KA 2XVLA 4XILA 2QJVA 5CKMA 1QJX2 4BM8A 3OGGA 1RUI1 1ZZ6A 1C5HA 2PHUA 2ZTNA 1D4M1 4YGEA 4RD7A 1WWYA 2G1MA 5A7PA 1XE8A 5KC5A 1SMVA 3C7HA 2UWBA 2C5DA 4ONUA 3OUIA 4D7SA 1HQLA 2FCTA 1DCSA 5A1AA 3W59A 2D6NA 3ZFFC 1TMF3 4AR2A 4JGZC 1SFNA 3OEAA 3VBUA 4I3PA 4AK3A 2A75A 3HOBA 4J1XA 2A73B 3POWA 5JLVA 2P3YA 2VM9A 4UW3A 4UFHA 1Y9MA 2PTMA 1FPN2 4WM7C 5EJ1B 4Y4RA 5J3UA 5JOXA 1RJ8A 1XE0A 3H3UA 4EZ4A 3EJKA 2E7QA 2VOKA 1RUD1 1ND3B 2CWMA 2ILMA 3AP4A 3HQUA 1I6XA 3M3CA 4PI2A 2N7GA 1F9KA 2CGNA 1RUE1 3ST7A 5GLZA 3AXDA 4NAOA 3DL3A 2IC1A 4AEJA 2BGOA 2RS52 4YFZA 1PO21 3AVRA 1FMD2 2OKXA 3B01A 3V0BA 4MSVA 2IXIA 1NCQA 1VBB2 1OH3A 5FUNA 1CAWA 4QB2A 5C8CC 2Y60A 2QZ2A 2UWCA 2R073 1K42A 2X05A 4HFSA 5L7OA 2BOJA 2WYSA 1CGPA 2UYBA 4FPLA 2B46X 2W68A 4QGNA 4YGBA 4TLGA 4A2UA 2JDMA 4LT5A 4S2GA 1KRIA 3GCXA 4PBOA 1UN1A 4IW3A 4YWAA 1AX1A 3OD4A 2JIGA 3ZFFB 3EQEA 3KM5A 3ITQA 4JGZB 4E4DX 5LEJA 2BBAA 1WA6X 3LAGA 1A78A 1W06A 4MG2A 4PHZA 4IGQA 1F4AA 2DVAA 4WM7B 2VW0A 2J22A 3RQ0A 2CAUA 2VNRA 3I2IA 2DF7A 2D6MA 3I2GA 2OA2A 1GNZA 1V6NA 4FPFA 4CVUA 1XC6A 1LULA 2JEMA 2UWAA 5IAVA 3ZDSA 5A7WB 4IETA 3KS7A 4LO4B 4W6YA 2XR4A 3M3IA 5K4LA 2YROA 4B29A 4MV2A 4CZSA 2JE8A 1ZBE3 1NX9A 1CZSA 2VVDA 4FPEA 3RYPA 5C8CB 5FZBA 2VMDA 3OYWA 4QT6A 5IK4A 2FHRA 4Y5TA 2AREA 4YZ5A 1S0DA 2KXLA 5A6QA 1YIFA 2B9UA 3E6CC 1ZREA 1S1AA 4LBQB 3WUDA 4FAGA 1RINA 4YVWC 5F2WA 1DLCA 1CAXB 1SBEA 4CCJA 2XDVA 1K5MC 2WZ8A 4IEPA 2VOVA 4OMDA 2F6BA 3VBOA 5B4NA 1XYNA 3NSTA 4I0WB 4Q27A 1SFPA 2J7MA 3A4UA 1PMJX 2YB7A 5C3OA 5T52A 3U0ZA 4GIQA 5HBAA 1DGWA 5FPLA 1MS9A 2XBO2 2VBPA 1QHDA 3BUCA 4AWDA 2RDRA 1EAH2 1C3HA 3I7DA 3FUQA 3RGBA 4JKLA 5KHKA 5GLUA 1NLRA 4RA0A 1PK6C 2F17A 1YRZA 2A6YA 1N3QA 5I0UA 5HV0A 4AVSA 3KZ4C 3DXUA 1S55A 3UKNA 2V09A 5DZGA 4CCEA 4AQSA 1DGRA 3H3ZA 3CZUA 2HWC2 2PQSA 2B9VA 4QGLA 4A41A 5JDBA 5C3RA 1I3HA 1O5LA 4Q4V3 2I45A 5F7UA 3JB4C 3OPTA 4ZZ8A 2ZGKA 4EZHA 1H8TA 1C5IA 4QM8A 2J1RA 1PVC2 2WFF2 3MLJA 4QKDA 4XF1A 5F6KA 4IUGA 4NHXA 3RI8A 1V00A 1LEDA 4H7LA 1JN2P 3P6BA 4YVWB 1IPSA 4HK9A 1K5MB 1VP6A 3ZO0B 1PIV2 2YC2A 3R4DB 1DYKA 1E5HA 4HL0A 4AHWA 4D0QA 3KT4A 5FZLA 3IT8A 4CSWA 3FUOA 4P5YA 4QXKA 3N36A 4Y1VA 3WDTA 5EJZB 2VECA 4HT1T 1W8WA 1ZZ8A 1N47A 2P37A 5FZOA 3MIHA 2XOMA 4CDWC 1XXNA 4CU8A 1BK0A 1RUI2 4LBOA 2WWSA 4S2FA 5D8AC 5A7QA 1D4M2 4JGYA 1D0HA 3QH6A 4NWWA 1NZIA 1PK6B 1Q5OA 2WT1A 1H1IA 1Z7S1 3MPBA 3W58A 3AKQA 4BK5A 4JKKA 5CA6A 2DUQA 2BVBA 4DXZA 4Q8KA 1XOYA 4CEWA 1UU5A 1VBC1 2XKOA 4P9IA 2KA3A 1KJLA 2W1UA 2X29A 1KGYA 2ZS6B 3IWZA 1PNFA 2DCTA 3D3AA 2R0HA 4IV3C 5JXGA 4IEZA 1LU1A 4U36A 1O7FA 2DYCA 3AP9A 1ZBA3 4DZGA 1UKRA 1HQWA 1RUD2 3I2FA 3AKTA 5IVYA 3DECA 1MS3A 1XU1A 1RUE2 2NYYA 3ZSJA 3ZXAC 3J8F2 2WNVA 1Q8SA 2ZGLA 5IHRA 2Z4FA 1PO22 3ZSLA 1JYNA 3THTA 1H8VA 4W6WA 5C7GA 3LWCA 5J36A 1KDMA 2EAKA 4YG0A 1DQ1A 5IT6A 1X9TA 2OYZA 4CYDA 1LGNA 1RUC3 5KBFA 3WF1A 4CDWB 1VB2A 1Z0HA 2B45X 4OVEA 2Z42A 1W8FA 4P9JA 5D8AB 4ZXKA 5C70A 3LA3A 4L97A 4N43B 4HK8A 3LEGA 5FLHA 4R52A 5FBZA 3CNAA 4BPZA 1BMV2 2BV4A 3POSA 2XJTA 4XZPA 2JD4A 3BOWA 4IV3B 4YVSA 2G9GA 3R05A 3RZZA 3POGA 4L99A 5FUIA 3M2MA 5LW9A 1RHI2 2IXLA 3VKOA 3D82A 1UIKA 2WZR1 1CPMA 2EIBA 2W08A 3J26N 1AR83 5DDJ2 5FV3A 1ULGA 3DGTA 3NL1A 1KDKA 3WF3A 2CU5A 4CDUC 1B35C 1JOJA 2VNGA 3FC0A 4LHSA 4YZ3A 2G9ZA 2W5FA 4I09A 4DXRA 2DVDA 3BODA 3WNMA 3V0AB 1UZ0A 5KXCA 5AC93 2V5YA 3ZYPA 1UIJA 2ZGTA 4M0HA 1MEC1 1ENSA 2C0ZA 4NIIA 1LAJA 3LIGA 5CKNA 4AZZA 2UU8A 5F3CA 1DIWA 1E5SA 2ZGUA 4Z92B 1VRH3 1ENXA 1UXXX 1XBFA 4OHWA 1TQ5A 1K3IA 5A80A 5KHGA 2LRPA 2NLRA 4ISQA 1CVNA 1DHKB 4BYYA 5LA2A 2DU1A 4INDA 4BWOA 4N53A 2BRTA 4Y3OA 1QQP3 2EXIA 5IWFA 2O14A 5CZKA 2ATFA 5FPVA 1PMHX 3VBRA 3ZXKA 2VR4A 1P8JA 4XETA 2VU9A 2Q4SA 4XHXA 4B4RA 5BYNA 4YM1A 3K51A 4LBLA 1PX4A 2GZWA 4NRPA 4OYUA 3G6JB 4WVZA 1OC1A 4W8JA 1AX2A 4ZU7A 3VDBA 2CL2A 2PLV1 3NNJA 4Y1XA 3IAPA 1UKGA 4QXHA 1PNGA 3C3VA 4PJYA 4Z2AA 1GV9A 3VHPA 4K8RB 2C1FA 4CDUB 1B35B 4GH4C 2PHFA 4CA9A 3JQXA 1AR93 1YLLA 2VMCA 2CSGA 1GNYA 3U78A 3LA7A 4L11A 3JD73 4JX0A 1BEV1 2PHXA 2VUJA 2QQVA 5FR3A 4YW1A 4AEMA 3FWEA 1ASJ2 2JDAA 3CDZB 5HI0A 2XL9A 2Z79A 2VOTA 2VQUA 4HPKB 3WNOA 1CESA 3KD4A 1OLMA 2Q8DA 1VB4A 3K75B 3KT7A 3MF9A 2R061 4KMQA 4XFGA 1CONA 1SBDA 2ZGPA 3T2QA 2JDNA 2D5HA 2ZEXA 3OY8B 4BXFA 4YARA 4EN0A 2R6QA 2MEV1 1BHGA 4DUWA 3ZLIA 2FDKA 3ZOIA 3Q8EA 5A3PA 1DQ5A 2LALA 5C4WA 2QE3A 2ZMKA 3BB6A 4Y33A 3E1F1 4PQ9A 4GZ9A 1O3RA 4IE7A 1O8PA 1NE6A 1SZBA 4QQOA 3VDDB 2D7FA 5FZ8A 5J98B 3FLTA 1OKQA 4XDQA 2VZUA 4GH4B 1UMZA 3OF1A 4XJ9A 1WMDA 3WCSA 4GKXA 4E4HA 1GZWB 1VBC2 1CN1A 1V6IA 2P2KA 1DGRN 1G6NA 1GZTA 1W6QB 3CQOA 4KBBA 1GWLA 4P9YA 1W9TA 1VE0A 3LA2A 4LULA 3RZJA 3T0DA 2Q5TA 1RXFA 2GP3A 1PO11 2A1XA 2DVBA 3SLIA 1DFQA 3EHKA 5CAZA 3GBFA 1IG0A 2F4LA 2W39A 3AMQA 3BN6A 3PU3A 5LA0A 3WW1A 1POV3 5K0UA 1JU3A 4WM8A 2A3XA 1QJU1 2G9FA 2R16A 3DN7A 4LKEA 1HRV1 4UI9L 1CD3G 2BYVE 4IE5A 1OA2A 2PAMA 2ET1A 4LR4A 5KXEA 3O1MA 4K40A 1D7PM 1WW4A 3CJXA 4PQQA 5FK8A 5HV4A 3EYPA 3ILRA 4ZONA 2D3RA 1YYNA 1EY2A 4BOWA 5FPBA 2Y64A 1T2XA 1PVXA 3NVCA 4H14A 2W46A 4IERA 1F35A 2XVGA 4QPIC 5FZAA 2P4EA 4M00A 4UF0B 1WMXA 1GU3A 4XIKA 5FKBA 4A44A 1S4CA 4QM9A 5JOZA 1HRI3 4IEWA 1OH4A 3E97A 3CBNA 1WCSA 3J9SA 5G04L 3U4SA 4E2SA 3WW4A 3IMNA 4Z2WA 1G9AA 3I3BA 1R081 3L9JT 4MO3M 5A33B 1BQPA 3Q8BA 3I2KA 5ERLA 3DKQA 3N9NA 4HKWA 1MR5A 4BMBA 4ZU5A 5JR7B 3IDEA 5LBEA 4GMP3 3ZXDA 1LR5A 3WR0A 4DQAA 1OT5A 2VTXJ 2XLGA 2GALA 5GZCA 5IVJA 2RM22 1IHMA 3IB3A 4R9AA 3ZMNA 3SHRA 2A71A 2WO1A 3FN9A 4MGKE 1QOOA 1SDWA 3M70A 1R1A3 1LJ7A 4IDZA 3ZIWA 2RDSA 1AR61 5IK7A 4ES8A 2EVXA 2W1SA 4XF0A 1OUXA 1RMU1 2WJSA 1SLBA 1W2AX 5FXVA 2GNDA 2PN5A 2ADDA 2IFWA 2VCMA 4FOYA 5KHHA 3VD9A 3ZR6A 4GB31 4UWDA 4YYOA 2VXRA 4QPIB 1QDCA 3VD7A 1URXA 2E6VA 4KG8A 3SMHA 1VBD3 3RMYA 5IVBA 2H0BA 1JZ2A 1W90A 4PCRA 5SV8A 4GWMA 2ARCA 3B94A 4XOGA 4Q4Y3 1VAKA 4Q4X1 4ZU4A 4LA2A 3ZKYA 2DCZA 1W2TA 4J25A 3I3EA 4DUVA 3NNLA 3ZYFA 1F15A 2RS12 2NP0A 2WBKA 1EPZA 3R0RA 2JE9A 2DCJA 2PLV2 4CDXC 4MADA 2IZWA 3GF6A 1KITA 2D40A 4X8NA 4BIOA 3N7MA 5FXZA 3ZN6A 1AR73 4HVRA 2QDNA 5JMCA 3PU8A 2HWD3 3DEMA 2ZX4A 2PQQA 1PGL1 2Y6HA 1BEV2 2OXBA 3JBG1 4RS5B 2R49A 2EIGA 2K9ZA 2YZ4A 2VCAA 3AP5A 4UW4A 1LGCA 1DGLA 4FVVA 4NMIA 1RUG1 2VOXA 1JYCA 1F8VA 5ABJA 1YFYA 1W03A 2IVIB 4YNIA 1U0AA 4IE4A 5I8TA 4Y22A 1C1FA 1LNSA 4P02B 1JODA 3WOGA 1NZCA 2R1BA 2R042 3GHMA 1WD4A 2V5DA 3A21A 4LE4A 5JXHA 3ZN5A 4AAPA 3H8OA 4CDXB 1KFUL 1WW6A 5AVPA 4YW3A 4COUA 4EN6B 5FXWA 4MGQA 4V2VA 4P00B 1QJX1 4I0BA 5F5CA 5LBCA 4OQ8A 1BVVA 5IFPA 2QBXA 4PT6A 1RUJ2 5H9QA 2JKBA 2DV9A 4GA9A 4O61A 1IQAA 3I3QA 2YDEA 1G9BA 3V56A 2QZ3A 2NMOA 2ZMLA 4MGIE 4E8CA 2QDRA 1PO12 2WNUC 4TXWA 3CLPA 5F2SA 2JG8C 1VBE3 2IXCA 3O1SA 2WYFA 1FPN1 1X36A 1W0NA 4R8HA 3VBSC 2L9LA 4IGPA 1ULEA 3AKSA 2PAKA 3MUY1 4OLLA 5FUPA 3RDIA 1HRV2 3WY6A 3KVAA 1QMJA 1X9PA 4EWEA 2ZOEB 2QTWB 2J1UA 4Y20B 1DYPA 2JB4A 4M3CA 4B3NA 4QPYA 4CCMA 3O1UA 5AFEA 5BNNA 1SDDB 3B9IA 2V4VA 1X7NA 3A22A 1VBB1 3A7QA 1S2EA 2BOIA 4FAHA 2WS92 1NAEA 3HT1A 4Y1YA 2JDZA 1Z78A 1W6NB 1KS4A 2PXJA 2EIDA 2WDBA 3S7IA 5FLJA 3VZOA 5DMYA 2RS31 5I0TA 3IPVA 4HANA 4Q8LA 1W3VA 3H9AA 4TYSA 5C9AA 2A3WA 3TEYA 1S0CA 3BU7A 1QWRA 1Y9GA 4XDOA 2YYOA 5K7PA 4XBLA 1UU6A 4A3ZA 4ASMB 5F39A 1R082 5FZ6A 2WNUB 2XH6A 4BISA 4JRAA 1REDA 4XJAA 3RZLA 2JG8B 2ZACA 4Q0PA 1GICA 1JMUB 3MLLA 3VBSB 3F2ZA 2W1QA 2QQOA 3GALA 4OUSA 2JB8A 5FJKA 1R64A 4L8QA 4ZPIA 2MHFA 3OSDA 5IAXA 1FX5A 3LE0A 3POYA 2O8OA 1N3OA 2BEOA 4HSJA 4C8DA 4DINB 2VCCA 1AR62 3H42B 3WXPA 2C9KA 4XTPA 4NIAA 3SISA 1W3XA 3UT0A 3ZSEA 5FLIA 3ZR5A 2WQ4A 1UU4A 3AJYA 1HXS3 3POEA 2AEYA 2JIJA 2VGDA 4GB32 4LNVA 4AI2A 2A5ZA 4BH9A 5CADA 2YPJA 3BGAA 1JYXA 2PHLA 3AMNA 4K1YA 4QX2A 1XQNA 1WLDA 5FZ0A 5LBFA 4NRQA 4AFMA 2WUHA 2E7TA 5GZGA 2VUAA 5JR2A 5C3QA 4N7UA 2R071 1IPJA 5C8CA 1LHVA 2C6SA 3Q9OA 2D5FA 3O0WA 4Q4X2 4ASLA 3U4XA 3DPRA 3UYJA 1LGBA 1ZRFA 3ZPYA 3M3EA 2XLFA 3NJZA 3KT1A 1BYHA 3AMPA 5FYHA 1CAXA 3CKHA 2QQIA 2ZBJA 3HNMA 2PFWA 3WP5A 3C8XA 4EN7B 1MS1A 1UPSA 3BTZA 2OX0A 3K48A 3T4HB 1PGL2 5EYXA 1VRBA 2Y0IA 3AM2A 4LBJA 3JBG2 4Y1ZA 2XGXA 4E9KA 5A32A 2HBUA 3OBTA 5I93A 4C90A 1TG7A 2HWC1 1LEMA 1W9FA 1UYYA 1N3PA 1NA1C 3OGJA 5FP4A 3WW3A 2VC9A 4ORFA 4COWA 4EROA 1YCIA 3KQ4B 1ULDA 4WZFA 5T54A 4ISRA 4FXKB 3VD3A 1O4YA 1PVC1 1UY3A 2WFF1 5DAQA 1OVSA 4E27A 1KJRA 2XWJB 4NVPA 3M3OA 5KR7A 3VGIA 1SLAA 2YGLA 1H2KA 4FCAA 3ZM8A 1ZVFA 2DUPA 4XACA 1BCXA 2A7AA 1N1TA 1QY4A 4XEZA 3JUUA 3MBWA 3D5OA 4NOTA 5C6CA 2ZGOA 2WABA 3I49A 1I1EA 1NQDA 3Q8FA 1SBFA 2Q8CA 3HMYA 4KL1A 4RL7A 4RHV2 1RB8G 1ZRRA 5JI9A 2LROA 3RMXA 2WC2A 1C8M3 3RWNA 2HH9A 3J7NA 2DVGA 4AVTA 3QD6A 4EWDA 4NIDA 5F37A 3I2OA 5JSRA 3WINE 5A3LA 1JTZX 1R1ZA 2OVUA 4Q4W3 5C33A 4NHKA 1GQPA 1RITA 3MUZ1 3ES1A 1HLCA 3MW3A 3H8UA 4DXTA 4BIFA 2ET7A 1YQCA 2Y6LA 5FYTA 1NA1B 4F7ZA 1AYN3 2DVFA 1XYOA 2BFUL 1RVF3 2B8MA 4BMEA 1HN1A 4EE2A 3H3LA 2VH9A 3J7LA 1GOFA 3AYCA 5FZMA 4WVVA 4C0HA 3BI3A 1KEXA 4BZ4A 4CP1A 1IGOA 4Q4V1 4R9CA 3J8F1 3LGRA 3T2TA 4YG6A 1Q8QA 3ZVXA 4XCBA 2XONA 1LOBA 2VUDA 5TSWA 1WGPA 5CFCA 3FX3A 3LKJA 4MXWA 2V4AA 3O5SA 1UOBA 4UBGA 2R1DA 4META 2K2SA 3KV4A 4UFLA 1TME2 5FMOS 1CAVA 1H30A 1W8ZA 3H7JA 4I0AA 1YFXA 5FY1A 3B00A 3ZXLA 1OHFA 2JDUA 4HONA 4Q1PA 3TN93 2RS32 2H6BA 3NAPA 5FCCA 4KWUA 1XE7A 4FTSA 1BMV1 5C5TA 4WBBA 5FPXA 1Y3TA 2ZZJA 1NG0A 1KS5A 2P6CA 2BWCA 1IS4A 1FOD3 1EPWA 1IQDC 2VQTA 3HBKA 3LDBA 5D8AA 2RDQA 4N43A 3NNGA 4AVAA 5LWBA 5F5IA 1RHI1 3OG2A 4LMFA 4BQXA 2VZQA 5T55A 1LOFC 1QNYA 3BTYA 3RYKA 2XQXA 5DDJ1 3VBHA 5T5OA 2PYTA 1TNRA 3HVDA 3T30A 4COYA 4FI9A 1FV3A 2BDRA 1CX1A 2RR13 3CJIA 5BXXA 2R30A 4G3YC 3ZYJB 1E5IA 4IEOA 1UQXA 1H6XA 2Y6JA 1C4RA 4QKBA 1ZBA1 1GYKA 1YIPA 1PX3A 1COV3 3ZFEC 2DTWA 2A3YA 4AI9A 3UJOA 3NJYA 3ZYIB 2WWUA 3KSCA 1EAH3 2F4PA 4CDQC 4P9GA 4WV8A 4K7JA 3VKMA 2XQRA 2WN3A 4XUOA 5GLTA 4EQVA 3EO6A 5ISLA 1AZDA 2W1WA 2YHJA 1X33A 2W91A 3KVBA 3HN3A 2CNAA 5FO7B 2QQUA 1GZCA 3PNAA 3F95A 2R072 1UZVA 4IE0A 5FP9A 1RUC1 3I2DA 1JZ6A 1GQHA 3JU9A 3LSDA 2EXKA 3DYMA 1JOBA 1ODMA 2VXJA 3CL1A 4SLIA 2JKXA 3EBRA 3OTFA 1GLHA 2RMU3 3OPZA 4YFWA 4PI0A 2X5IC 3SITA 4QWNA 3OBAA 3FHAA 4LKSA 4E8DA 2FDHA 4ZZ5A 3TOJA 2X53S 2JDHA 1NXD1 1AHSA 1HB3A 4DUXA 3I59B 1VBA3 1U5XA 3WG3A 3MIDA 1ULFA 1LOEA 4L92A 5DAXA 4DIQA 3D6EA 1ULOA 3TEWA 1K12A 4OI2A 4D6SA 1ULCA 3EMRA 1U12A 4YM2A 1RYYA 1VPHA 1LESA 1YWKA 3H8RA 1N1YA 4KG0A 4X8PA 3ZFEB 2ZA9A 3AZVA 1LU2A 2XMLA 1H1MA 4FP3A 4NHLA 2FQPA 4QU1A 4AVBA 2I74A 4FXGB 4CDQB 1W6OA 2VY0A 1IOAA 4DPNA 1ASJ1 3IDBB 5EQUA 3SEPA 1W99A 4CDUA 2XJSA 1IS5A 2P3IA 2WT2A 2DTYA 3SQOA 1ZBE2 3WDVA 1DQ0A
chains in the Genus database with same CATH topology
1FAYA 4FTBA 2JENA 4P9XA 5DUVA 2GH8A 3VBUC 3BTAA 4IESA 1VRH1 5L36A 1ZRDA 1W6MB 3MGUA 5BUVA 1BVP1 4KNCA 1QU0A 3PJQA 2QFEA 5SV5A 4HKLA 1HKDA 2ZHKA 2VOWA 2GC2A 1Q43A 2WKKA 4ATEA 4EWAA 1WLCA 3S6PA 1QQP1 2JG9A 1U5IA 1GQGA 1G9CA 3JB8A 4C1WA 5EZWA 1NCQC 3FZ3A 1MZ5A 1TNFA 1QGLA 4L9BA 3H1YA 3U07A 3VKNA 2EXJA 1DQ6A 1IKQA 3E6BA 4FPYA 1XNKA 1MS5A 3RYRA 4Q0SA 1FT9A 4R9DA 5L7OC 1LHOA 3VDDA 3QLQA 5HCBA 2W52A 1DF0A 1OOPA 1R093 2FBEA 3T1MA 1AR91 2YUEA 2HEYF 4B7EA 4IEVA 1J3QA 4NPRA 3EXUA 3VBUB 1N1VA 5IUQA 2E53A 4Q4V2 1O91A 1EV13 3AXEA 4AHXA 3ETQA 4JV4A 5A3MA 2NQYA 5ACA3 4EJRA 2WFPA 2ZHLA 5LK7B 3T1LA 4UW5A 4S2HA 1N1SA 1C28A 3VL9A 1NLSA 3NW4A 2HWE3 4K21A 3V0BB 4FPJA 3AJZA 4YGDA 1NCQB 4ITCA 2EALA 1CAWB 1BBT3 5JIUA 1AXKA 4D69A 3UKVA 1AL0G 3QCWA 4XMAA 2IXHA 3FBYA 3RS6A 3J4UH 1SLCA 1WCKA 5L7OB 5CG9A 2GN7A 2CYFA 3GHNA 4JC1A 1LHNA 2GU9A 1LENA 2B42B 3B5LB 4RR3A 4XMIA 2WZPP 3VBOC 5F1RA 4LBMA 2RM21 3ILNA 3V65A 5DXDA 1ZBA2 3M3QA 1L3JA 4CP0A 1WCDJ 2W0XA 3ZMOA 3WDYA 4HETA 1POV1 1AVBA 5I8YA 2ZABA 3AFGA 2BBVA 1XU2A 1D0GA 4HN0A 2RE9A 4I02A 1WUVA 1MS4A 3QH7A 4PIXA 2EXHA 1DGWX 4FT8A 3OYWB 1RUC2 1QJZA 5I8SA 1CPNA 2JX9A 4RFT0 4H7MA 5I0SA 3C2UA 1H8TC 4AQ6A 4XF9A 4PLOA 2GAUA 3BOPA 5CFDA 2PELA 2RS11 3FFQA 3NKTA 3GZTB 3VBOB 3AMHA 4ZKTB 5GM0A 4FSJA 3ZFGA 1DZTA 1AR82 4GMP1 1IPKA 1OI6A 2Q30A 5L19A 4Q1RA 4KWJA 5E88A 2ZMNA 5EV7A 1YFUA 2P3KA 1Z7S3 1RGSA 4X6QB 3B02A 2Q1MA 4CEWC 2ES3A 3WV6A 5AC92 4E4ZA 1LKNA 2YGMA 2B39A 1VBC3 4D3WA 4FBFA 4RS5A 4N90A 1VRH2 3FMGA 5K9YA 5C8WA 1OPMA 2NZ9A 2XL7A 5E89A 2Y0OA 3AK0A 1H8TB 2VNOA 4QQ2A 2HEVF 2ZHMA 1QDOA 2OUHA 3OJBA 1AF9A 2E7AA 4H3WA 2R041 2D3SA 1VBD1 3ILFA 2WNVC 4I01A 4XJWA 1QQP2 4C91A 4J6GA 5JPMB 4Q4Y1 1J1TA 1AYM3 1S0IA 3MYXA 1Y43B 1H2MA 4HMZA 1RUJ1 5K8SA 2ZAAA 4FPHA 1J3RA 1CJPA 2Q1ZB 3OBRA 4Z8BA 1WLTA 3PVBB 1YHFA 1AR71 4NWVA 1AR92 1RUH3 4X6RB 1SFYA 5BNOA 2HWD1 3R6SA 3FHIB 3ZYRA 3PLQA 3JD72 5T3NA 1QJY3 4YVSC 2HKXA 3ZN4A 5IK5A 3GZUC 5EFUA 4AXOA 4IV1A 4WVMA 1RUF3 4YW2A 5H9PA 4PF5A 1ZRCA 1CR7A 5FPZA 3IKWA 4CEYA 2WZR3 4BA6A 5JWPA 1CQ9A 2DUOA 4KGGA 1QXJA 4YRDA 1HV0A 1WW5A 4N7IA 1TEIA 1PHMA 2WNVB 4GALA 2GC3A 3UJQA 2FZ1A 2WS91 4MH0E 1WMEA 1YI9A 2JXAA 5BNQA 3WZ1A 1LRHA 2YY1A 1MEC3 2P3JA 3KCXA 1WBLA 2BGCA 5KHJA 2BNMA 1HDKA 4IEUA 5FQ0A 1NCRC 3WD5A 4FOWA 3AZYA 1LOCA 1Q8VA 4XJZA 5JPNB 3BPZA 4OHYA 2VMIA 2ERFA 2PA7A 1JYIA 3L2HA 3WG4A 4N53C 4AEDA 1JHNA 1W0OA 1WD3A 5FOJB 2RHPA 4YVSB 3VBRC 3LB9A 1GBGA 3MIGA 4LO5B 1MQTA 4MXVA 4Z07A 4DMIA 2LUWA 2E9QA 4D94A 3BIWE 4AGGA 2WSVA 4LUMA 5JZGA 5KWRA 2IFRA 4IQPA 3R4UA 1VBE1 3ZSKA 2XLAA 4LUKA 5F9TA 1HW5A 3SXWA 4AHYA 3VBSA 4AYUA 4K20A 4QMAA 1JXNA 4AFDA 3ZXFA 1MS8A 4DRRA 1UZYA 2VVFA 1QOTA 2P34A 1NCRB 2D43A 1VIWB 2HWF3 1X8MA 3ACLA 4RSUA 1B09A 4QGMA 2R063 1V6JA 1H9WA 4XF4A 4N53B 1QNWA 1H4GA 2TEPA 4MGYE 4JDMA 2MEV3 3VBRB 2GN3A 1CJDA 3IBMA 3KCYA 3SNMA 1BK1A 5C4WC 5E16A 1IZ3A 2NM1A 2YXSA 1PGSA 1SLTA 4Y5Z0 2CV6A 4AW7A 1W2UA 5DG1A 2KM2A 3TRSB 5GZEA 2BNNA 4TSVA 1OQEA 1W6PA 2PHRA 4PDWA 1G7YA 3O7OA 1R1A2 1CAUA 4KWKA 3AYAA 4JQRA 5CIRA 1HQNA 1BJQA 4PBPA 2A6WA 1ZYBA 3ECQA 1GNHA 4DS0A 5LEKA 3I8TA 2XKPA 2Q0AA 1HXS1 4CTEA 3HD8B 2D44A 3VBFC 3MW4A 5K0UC 1VBD2 1YNAA 4E2QA 4WM8C 3FJSA 5DG2A 4QPGA 3RSJA 3R4SA 1JH5A 1REEA 1QJU3 4Q4Y2 4DY3A 4XFHA 1ND2A 4RHV1 5CG8A 4HLTA 4Q26A 2ZZQA 1A8DA 3LOIA 5C4WB 1E57A 1S0FA 2EA7A 4K3UA 3TNPB 4Q2FA 3WHUA 2I2SA 4XXPA 2JICA 2CGPA 2C9AA 1AR72 4EV0A 1JW6A 4HKOA 2WNEA 5BNPC 3WLUA 5EYYA 4AVCA 2HWD2 2Y38A 2CGOA 2AYHA 4A7ZA 1O5UA 1RIRA 4UXAA 3N7KA 2XJPA 5CU1A 3APBA 3CO2A 1X8EA 1AJOA 4KH9A 1YO8A 3GYDA 5I91A 3VBFB 1PGW2 5GLVA 5K0UB 3KGZA 4WM8B 1OSGA 1ND3A 1YJKA 2NN8A 1TME1 1AL23 2IWGB 1X50A 4XW3A 1MVQA 4FPGA 4FQZA 3VKFC 3WVJA 3TWIA 4B8EA 3VHRA 2ZHNA 2GNTA 1NOVA 2AR6A 4XFAA 1TE1B 2AZ5A 4XYXA 1EYBA 2QNKA 4AGVA 2BTVC 2VVEA 1RMU3 4E2GA 4OFGA 5BNPB 1CIWA 1OLQA 2HWB3 4O9GA 5E8AA 4B4QA 3UL2A 3LSEA 3N7LA 4Q4W1 1TMF1 5EJ3A 3ZFFA 4D7YA 1U5YA 2BVVA 4JGZA 1AYN1 1VBE2 1WLWA 1RVF1 3H50A 4IXLA 1S0GA 3RRDA 3IM0A 4AQ2A 4WM7A 4XTMA 3NV1A 4R9BA 4HBNA 4OHZA 3SH5A 3DUIA 4R4ZA 5H9SA 2IXJA 3N3HA 4XXAA 4DOUA 1XYPA 3ME2A 5CNAA 1RUG3 5ABJC 5CBLA 3GZAA 4GWNA 4XQWA 1SLLA 4LBQA 3ES4A 1I5ZA 4M01A 5T5LA 2FZ2A 3LCPA 2WINB 4AHZA 5GJ6A 3B93A 2AH2A 1FOD1 5T5PA 3KQRA 2GSYA 3ZYGA 3I4IA 1ZZCA 1IS6A 1D2SA 4N9IA 3AP6A 4EN9B 3HWJA 1V9U3 4C0BA 3I59A 1FI2A 3KLSA 1MACA 3ZN6B 1QJX3 2A6XA 4AI3A 2AENA 3JZVA 2RR11 1QH7A 1JUIA 2ZX0A 2WLQA 5J48A 1COV1 1D2QA 1ZBE1 5JOWA 3O12A 1RL3A 5FO8B 3WW2A 4KU8A 4JRLA 2EF6A 3HQXA 4FP2A 1HXS2 2ZGMA 3MIFA 2ZX1A 5ABJB 1FPN3 5F5QA 5CB7A 3QACA 5KHIA 3HBZA 2OW4A 5IK8A 4YVWA 1I9RA 1XNCA 3URFA 1K5MA 5KC6A 4LTAA 1YXWA 2RS53 1WA4A 2RMU1 4FOQA 4XFCA 4E4SA 5BNNC 5KXBA 1FMD3 5BPXA 2DCKA 1U5ZA 2XUMA 1VBB3 2XJUA 3A0KA 3MW2A 4JTNA 3S7EA 5C9AC 1PK6A 2WSUA 4YW4A 5BY5A 2SBAA 4YZ4A 3G7DA 5DUXA 3WP3A 3SH3A 1VR3A 2I07B 4AE2A 3AYEA 3H7YA 2WLPA 4LA3A 2XHKA 4AVVA 4M3CB 3WUCA 3OCPA 5BNNB 3UV9A 4EN8B 2YV8A 4UW6A 4IEXA 4OULA 5DUWA 3B9CA 1JBCA 2JJ6A 4LHLA 4CDWA 1KXGA 1UD1A 3IPVB 1C8M2 1OLRA 5C9AB 5J09A 3ATGA 2XPJA 4KWLA 3FBMA 2V73A 4Q4W2 3W9AA 2QUOA 3DPRC 3GBGA 1TMF2 3S0MA 4IV3A 3OD0A 1AYN2 4N9HA 1R091 2VPVA 1OA3A 2EAAA 2R0FA 1RVF2 4P14A 1BKZA 3TNQA 1ZX5A 2XBO3 4Z82A 2PAEA 1OFSA 1LODA 3MIEA 2OUJA 3O0VA 1J58A 1EV11 1LOGA 3MDPA 1UX6A 2B5HA 3H0OA 5ACA1 4NR1A 2RJKA 3V0AA 2ZGNA 1LB2A 4UBHA 1S0JA 1UW8A 1VALA 1KD7A 4PIYA 2GC0A 2YC0A 4RQPC 2HWC3 4WZCA 4XQ4A 1F5JA 3TN92 1O3QA 1RC6A 1O4ZA 1RUOA 2HWE1 3FLPA 3PHMA 1PVC3 2WFF3 4FQ4A 5HCFA 4P9LA 3VLBB 5T5JA 4AGRA 1Q3EA 2QQPA 2TUNA 1BBT1 4LLOA 1UAIA 3TAYA 4MLOA 3DPRB 1PIV3 1DQ2A 1FOD2 3MI8A 4LBKA 1V70A 2UY8A 4I30A 4OI1A 1WMFA 2GH2A 3KB5A 4AI0A 3USUB 1AR81 5L73A 4O9EA 1UPIA 4OHVA 5JOYA 1MS0A 3N4MA 4S2DA 1RUI3 4BHPA 2RR12 2O8QA 3U11A 1D4M3 1B35A 1Q56A 4DY5A 1XNBA 1COV2 5AC91 5A32B 1O4TA 4RQPB 3TB0A 1G9DA 4ATFA 2WQZC 1ZNPA 4ES9A 5H9RA 4QHBA 2BFUS 4HPKA 2ZGQA 1NY71 4J1WA 4MZUA 2X5IB 4I2OA 1RUD3 3FLRA 2R32A 3OY8A 1RUE3 4YGCA 3J8F3 1V6KA 1BZWA 3S30A 2G4IA 2RMU2 1PO23 5CFCC 1ENRA 2D98A 3RG0A 3ALQA 1GANA 1OPOA 1AJKA 1REFA 1S0BA 4M3CF 3WQ1A 4A7KA 1FNZA 1S2BA 4JVAA 1VBA2 1J1LA 5GZFA 1RTVA 4XIOA 3NAPC 4LE3A 4BQ1A 4C1XA 3HIFA 4W65A 4FTEA 4R4XA 4GH4A 1Q8PA 1FXZA 1V6LA 3JD71 3FFZA 1GZWA 1LHWA 4MGZE 4KGQA 5F6LB 3WQ0A 1W6QA 2VMHA 4PIZA 3SCHA 1QXPA 4N43C 4QQLA 5GALA 2ZKLA 2GMMA 3QOPA 1RHI3 5GLWA 3VBHC 4MVTA 1APNA 1DG6A 3NV3A 5DDJ3 5FDBA 1X82A 3CJIC 1H4HA 3ZXJA 1POV0 5HCAA 2PHDA 3IN9A 4XJUA 2D93A 1SLIA 3PMSA 4D7TA 3D8CA 5CFCB 4MXWB 4KQ7A 1YUDA 1CAVB 2RJLA 4KU7A 1SCSA 1DZRA 3A0NA 2DWRA 4XPVA 2Q8OA 3NAPB 1AYM1 3E5XA 3IDCB 3HR9A 1SQ4A 3AZZA 3O14A 3B7MA 3WP6A 3AP7A 1T6GC 4MYEA 1QOSA 4Q29A 3AMMA 4LBNA 2O0OA 2D6PA 4YG3A 5BYNA 1LOAA 3VZNA 4XE9A 5FTTC 1W0PA 3VL8A 4MX3A 5DZEA 2WT0A 1R092 2QVSB 5BV6A 5JI7A 1RUH1 1VAMA 3VZLA 5A33A 4G9SB 1PM7A 1QJY1 3VBHB 4DRVA 5FOBB 3AKRA 4GMP0 3CJIB 2JE7A 1RUF1 1EV12 1A3KA 4AFCA 1M4WA 1MZEA 5ACA2 1UZZA 5DZFA 3NV4A 5T50A 4TZDA 5FREA 1GSLA 2ZCWA 1UL9A 3MFAA 5B2GB 1ASJ3 4PLNA 2HWE2 3AKPA 1D4VB 4HSLA 2XJRA 2BUKA 1OFNA 3MEPA 2BWAA 3WT3A 1BBT2 4QPIA 2GMEA 2E63A 1HRI1 3I54A 1RUNA 3PJYA 1W39A 1NCRA 5D1IA 4BCUA 4RGGA 2BQPA 3RNSA 2B7YA 2JG9C 2D6OX 2DU0A 1KFXL 2FMYA 4JGYC 2WA4A 4XBNA 4FOVA 4YZ1A 2NPIA 3PTYA 4V1PA 4XFBA 1JUHA 1LHUA 1XRUA 1DQ4A 1PZ9A 1R1A1 2UURA 2VULA 4XF3A 3VDDC 1J59A 1PZ7A 1MZ6A 1W6OB 2ENRA 1LECA 1OOPC 2DCYA 3MF6A 2K0GA 2ZJCA 1GR3A 5AVAA 4LO6B 1OA4A 2XB6C 1AXZA 3N7JA 1V6OA 3M4FA 1NY72 4XBQA 4A3XA 2HYKA 3WNXA 1KQRA 3DF0A 4YW5A 4JAAA 3PVEA 2ZGRA 4AI8A 4TWTA 1QXRA 1H0BA 1HIXA 2AGSA 3INAA 1GKBA 4XFIA 2HWF1 1QF3A 4W6XA 2HJIA 4CP2A 3LZZA 3PVOA 4Q0UA 4YM0A 4Z1VA 3ZSMA 3KGLA 1NQJA 1YI7A 3UKTA 2D6LX 1DZQA 2JG9B 2Z2SB 1M06G 4CDXA 2XWBB 3SCFA 4JGYB 2OIIA 1C8NA 2NMNA 4QX5A 5JAXA 4GQ7A 4HZFA 4GULA 4CEWB 3O0XA 3P3NA 1ZZ7A 2BPA2 3HN1A 1J3PA 5GKAC 1MZFA 3ZX7A 1OOPB 4JCKA 1Z7S2 4LEJA 2Z69A 2XVKA 4RR3C 4OUMA 3PMEA 5E1RA 3KMHA 2XG3A 4Y24A 1PGW1 2CWSA 2ARBA 3HT2A 3E5UA 2ZPXA 2RM23 4LLFA 4URTA 3E6DA 2GMPA 2TBVA 4QQPA 4BLJA 2BW8A 2O1QA 3D0SA 2ZKNA 3M8LA 1LCLA 3VBFA 4Y20A 4B4PA 3NWKA 1GZ9A 2WIIB 4F3JA 1WBFA 3RPQA 1AYM2 1W6NA 2GC1A 4COZA 2OZ6A 2OPKA 1XNDA 4NN0A 4FPKA 4FPCA 4CRQA 1ZM1A 3VHOA 1DLLA 4DFSA 4TLFA 1S0EA 4DNYA 2VW2A 1OD5A 1RUH2 3RJRA 3DKWA 5CFDC 2ZX2A 4RR3B 2WNUA 5BNPA 4K9SA 2RS13 1QJY2 2JG8A 2H6CA 2PLV3 2CAVA 4IEYA 1OQ1A 1RUF2 3ZFGC 2ZGSA 5GZDA 2D6KA 3SCGA 2WZR2 3WG2A 4IEQA 4Y1UA 5J96B 1NXMA 1NYWA 1DDLA 5LRRA 3UK9A 1BEV3 2DFCA 4K8FA 3H1MA 1F5FA 3ZIXA 1WW7A 1A6CA 3PVNA 3IIAA 1H1AA 1AL21 3USSA 5LK5A 1NE4A 3WDUA 1MEC2 2UY9A 3WDWA 4RS5C 3VUOA 3MPPG 4BE3A 2D97A 2E51A 3LOBA 4JDOA 1HRI2 5FAXA 1QKQA 4K6BA 1Q8OA 1DBNA 2H0VA 2R043 2HEWF 1ZZ9A 4IL7A 5CFDB 2HWB1 3M7AA 3AFKA 4Y26A 1V6MA 1HX6A 3X29B 5JSPA 3ENRA 2GNMA 3MFCA 3ZFGB 1FNYA 1FV2A 4HVOA 5I0RA 1RUJ3 3FE5A 4HVQA 4OHXA 3VN4A 3WCRA 2WL1A 4P5HA 4OZXA 2TNFA 4U2AA 2ETEA 4JDNA 5BNOC 2A70A 1PO13 4OI0A 3BALA 3P3PA 3GBWA 3ROUA 3MIBA 5KXDA 2AUYA 3WHTA 4IV1C 1VLNA 3NO8A 2ZAHA 1LTEA 1EP0A 2A6ZA 5FFOC 3V64A 4JTOA 1G9FA 2WA3A 4XJ8A 4CEYC 4SBVA 4F8AA 2P17A 1HRV3 2HWF2 2JECA 2PHWA 1QH6A 3WDXA 3N35A 4PLMA 2R062 3CEWA 1VJ2A 2VQAA 3AYDA 2SLIA 1AXYA 4YSFA 2MEV2 2WS93 2LTNA 1YFWA 4L2NA 2XJVA 4AF9A 5HXVA 2OZJA 3B3QE 4Q0VA 1ZA4A 1IS3A 4YLZA 2PHTA 1V9U1 1R083 5BNOB 4GXLA 4AEDC 3H1WA 1NA1A 4NO4A 1Y9QA 2Z5WA 1AUYA 5EXOA 1S2KA 4QU2A 1SACA 1MQTC 4IV1B 1H2NA 3AX4A 4WVMB 1RJ7A 4AFBA 4LBQD 5JZGC 3KCCA 4CEYB 3ELNA 3B69A 2XJQA 4QD2A 5JCTA 1GFF2 4K1ZA 2VW1A 1FATA 1AR63 4LO8A 3WP4A 4FO9A 4GKYA 1QJU2 4Y4YA 5LRSA 5EWSA 2ARXA 1DU3D 4GB33 4XHBA 1HV1A 1ALYA 2RS51 3MZHA 2A6VA 1C8M1 5DUUA 1FMD1 5FQ0B 2GDFA 3TYJA 2MPFA 3GNEA 3BCWA 3VZJA 3CU7A 1F31A 5JVVA 3TBDA 1OMIA 4G4FA 4I3GA 4YZ2A 5AFBA 4Q4X3 1ENQA 3D4KA 4XFFA 2CY6A 3RJ2X 1SEFA 4M3CE 4AEDB 3VV1A 3VHNA 4B7KA 4XQDA 1MQTB 3CF6E 3AZWA 4DB5A 3JQWA 5JZGB 2GNBA 2Y26A 1SCRA 4M0NA 4FPOB 1G86A 3JBG3 5JIAA 2ZX3A 1C1LA 2DURA 2LM3A 5FMOL 3ASIA 3VKLA 3RI9A 1AL22 4PDWC 1G8WA 3WQ7A 3TN91 2FMDA 4OI4A 1PMIA 1A8MA 1C57A 4WVWA 4AG4A 4YM3A 4AEKA 1FYUA 1RMU2 4A7YA 3THPA 1F2NA 5FO9B 1CX4A 2YMZA 3AZXA 4LO7A 3VZMA 1H9PA 2HWB2 2QCSB 4QPGC 1UCXA 5JSOA 1ND2C 3U10A 4RHV3 3M1HA 4LHNA 1O3SA 1LOFA 1ZZBA 5CVRA 3NKGA 2QKDA 3WG1A 2MNGA 1BXHA 4F83A 2IXKA 2XBO1 4Q0QA 3USUA 1PZ8A 1UF2C 3ZFEA 3ZXEA 2CTVA 4QQHA 1IKPA 1EAH1 1H2LA 3WX5A 1Y7BA 1W6PB 4PDWB 4CDQA 1VAVA 2UYAA 3MLKA 4MUVA 4AI1A 1CAUB 4LHKA 1OQDA 3ZXGA 1YJLA 4Y22B 2DFBA 1ONAA 4H55A 5J7MA 4RGAA 4RQPA 4COVA 3DV8A 1RUG2 1W6MA 4BLIA 3SH4A 4HN1A 4QPGB 4AQTA 1ND3C 2X5IA 3VZKA 3AB0A 1ND2B 2VG9A 1TME3 4NHMA 5FRAA 2VQ0A 1VBA1 1PIV1 3L2YA 1MVEA 3D0JA 3E5QA 2RS33 3HAGA 3MICA 3NV2A 3QBQA 4AFAA 3JCIA 2VMGA 4P9WA 2D3PA 5J37A 2BNOA 1AX0A 1V9U2 2X8KA 2XVLA 4XILA 2QJVA 1QJX2 4BM8A 3OGGA 1RUI1 1ZZ6A 1C5HA 2PHUA 2ZTNA 1D4M1 4YGEA 4RD7A 1XE8A 5KC5A 1SMVA 2UWBA 2C5DA 4ONUA 4D7SA 1HQLA 3W59A 2D6NA 3ZFFC 1TMF3 4JGZC 1SFNA 3VBUA 4I3PA 4AK3A 2A75A 4J1XA 2A73B 3POWA 5JLVA 4UW3A 4WM7C 2PTMA 1FPN2 5J3UA 5JOXA 1RJ8A 3H3UA 3EJKA 2E7QA 2VOKA 1RUD1 1ND3B 2CWMA 2ILMA 3AP4A 1ZREA 1I6XA 3M3CA 2N7GA 1F9KA 2CGNA 1RUE1 3ST7A 5GLZA 3AXDA 3DL3A 2IC1A 4AEJA 2RS52 4YFZA 1PO21 1FMD2 3V0BA 3B01A 4MSVA 2IXIA 1NCQA 1VBB2 1CAWA 5C8CC 2QZ2A 2UWCA 2R073 4HFSA 5L7OA 1CGPA 2UYBA 4FPLA 2B46X 2W68A 4QGNA 4YGBA 4A2UA 4S2GA 1KRIA 4PBOA 1UN1A 1AX1A 3OD4A 3ZFFB 3EQEA 3KM5A 4JGZB 4E4DX 5LEJA 3LAGA 1A78A 2DVAA 4WM7B 2VW0A 3RQ0A 2CAUA 2VNRA 2DF7A 2D6MA 4FPFA 2OA2A 1GNZA 1V6NA 1LULA 2JEMA 2UWAA 3ZDSA 4IETA 3KS7A 4LO4B 4W6YA 3M3IA 4B29A 4CZSA 2YROA 4MV2A 1ZBE3 2VVDA 4FPEA 3RYPA 5C8CB 3OYWA 4QT6A 5IK4A 2FHRA 2AREA 1S0DA 2KXLA 3E6CC 1YIFA 2B9UA 1S1AA 4LBQB 3WUDA 4FAGA 1RINA 4YVWC 1CAXB 1SBEA 1K5MC 4IEPA 2VOVA 2F6BA 3VBOA 1XYNA 3NSTA 4I0WB 4Q27A 1O3TA 3A4UA 5T52A 3U0ZA 4GIQA 5HBAA 1DGWA 1MS9A 2XBO2 1QHDA 4AWDA 1EAH2 1C3HA 3I7DA 3FUQA 5KHKA 5GLUA 1NLRA 4RA0A 1PK6C 1YRZA 2A6YA 1N3QA 5I0UA 4AVSA 3KZ4C 1S55A 3UKNA 2V09A 5DZGA 4AQSA 1DGRA 3H3ZA 2HWC2 4QGLA 5JDBA 1I3HA 1O5LA 4Q4V3 2I45A 3JB4C 2ZGKA 1H8TA 1C5IA 4QM8A 3MLJA 1PVC2 2WFF2 5F6KA 4XF1A 3RI8A 1V00A 1LEDA 4H7LA 1JN2P 4YVWB 4HK9A 1K5MB 1VP6A 3ZO0B 1PIV2 3R4DB 1DYKA 4HL0A 4AHWA 3KT4A 3IT8A 3FUOA 4QXKA 3N36A 4Y1VA 3WDTA 2VECA 4HT1T 1ZZ8A 1N47A 2P37A 3MIHA 4CDWC 1XXNA 1RUI2 4S2FA 4LBOA 2WWSA 5D8AC 1D4M2 4JGYA 1D0HA 3QH6A 4NWWA 1PK6B 1Q5OA 2WT1A 1H1IA 1Z7S1 3MPBA 3W58A 3AKQA 5CA6A 2DUQA 2BVBA 4DXZA 4Q8KA 4CEWA 1UU5A 1VBC1 2XKOA 4P9IA 2KA3A 1KJLA 2X29A 2ZS6B 3IWZA 1PNFA 2DCTA 4IV3C 2R0HA 4IEZA 1LU1A 4U36A 1O7FA 2DYCA 3AP9A 1ZBA3 4DZGA 1UKRA 1HQWA 1RUD2 3AKTA 1MS3A 1XU1A 1RUE2 2NYYA 3ZSJA 3ZXAC 3J8F2 2WNVA 1Q8SA 2ZGLA 1PO22 3ZSLA 3THTA 1H8VA 4W6WA 3LWCA 5J36A 1KDMA 2EAKA 4YG0A 1DQ1A 5IT6A 4CYDA 2OYZA 1LGNA 1RUC3 5KBFA 4CDWB 1VB2A 1Z0HA 2B45X 4OVEA 2Z42A 4P9JA 5D8AB 4ZXKA 3LA3A 4L97A 4N43B 4HK8A 5FLHA 4R52A 5FBZA 3CNAA 4BPZA 1BMV2 3POSA 2XJTA 4XZPA 2JD4A 3BOWA 4IV3B 4YVSA 2G9GA 3R05A 3RZZA 4L99A 3M2MA 1RHI2 2IXLA 3VKOA 3D82A 1UIKA 2WZR1 1CPMA 2W08A 3J26N 1AR83 5DDJ2 1ULGA 3DGTA 3NL1A 1KDKA 4CDUC 1B35C 1JOJA 2VNGA 3FC0A 4YZ3A 4I09A 2DVDA 3BODA 3V0AB 5KXCA 5AC93 2V5YA 3ZYPA 1UIJA 2ZGTA 4M0HA 1MEC1 1ENSA 2C0ZA 2UU8A 4Z92B 1DIWA 2ZGUA 1VRH3 1ENXA 4OHWA 1TQ5A 5KHGA 2NLRA 4ISQA 1CVNA 1DHKB 4BYYA 2DU1A 4INDA 4BWOA 4N53A 1QQP3 2EXIA 2ATFA 3VBRA 3ZXKA 4XHXA 4XETA 2VU9A 2Q4SA 4B4RA 4YM1A 3K51A 4LBLA 2GZWA 3G6JB 4WVZA 1AX2A 4ZU7A 2CL2A 2PLV1 4Y1XA 1UKGA 1PNGA 3C3VA 4PJYA 1GV9A 3VHPA 2C1FA 4CDUB 1B35B 4GH4C 2PHFA 3JQXA 1AR93 1YLLA 3LA7A 4L11A 3JD73 1BEV1 2PHXA 2VUJA 4YW1A 4AEMA 3FWEA 1ASJ2 5HI0A 2XL9A 2Z79A 4HPKB 1CESA 3KD4A 1VB4A 3KT7A 3MF9A 2R061 4XFGA 1CONA 1SBDA 2ZGPA 2D5HA 3OY8B 4YARA 4EN0A 2R6QA 2MEV1 1DQ5A 2LALA 5C4WA 2QE3A 2ZMKA 3BB6A 4PQ9A 1O3RA 4QQOA 3VDDB 1NE6A 2D7FA 5J98B 3FLTA 1OKQA 4XDQA 4GH4B 1UMZA 3OF1A 4XJ9A 1WMDA 3WCSA 4GKXA 1GZWB 1VBC2 1CN1A 1V6IA 2P2KA 1DGRN 1G6NA 4KBBA 1W6QB 4P9YA 3LA2A 4LULA 2Q5TA 1PO11 2DVBA