4W6YA

Co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf9
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
SSASSAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords F18 fimbrial adhesin AC
publication title Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli dh5[alpha]
total genus 33
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4w6yA00
4BWOA 4B4PA 4W6WA 4W6XA 4B4RA 4B4QA 4W6YA
chains in the Genus database with same CATH superfamily
2AACA 1PO13 2VOVA 1S0JA 2WDBA 3T4HB 2A3YA 4EZHA 4F8AA 2A75A 3AL5A 3WZ1A 5KXCA 3GJAA 4AZZA 1UY4A 2VZPA 3GGLA 2HWB3 4C1WA 2MNGA 4W8JA 3VBOB 4D6SA 3O1VA 3PTYA 1BYHA 4MVTA 3NV3A 3K75B 5K0UA 4S2GA 1RJ7A 2I2SA 5EQUA 4ISRA 2HYKA 3VBRC 2E31A 4BQ4A 3OBTA 5BNQA 3S7IA 4NHXA 5BNNA 5C9AB 5L7OA 1RITA 1YFXA 1GP4A 2VY0A 4ITCA 3TB0A 2D3PA 2VZQA 3FBYA 4BCUA 2XKPA 2WWSA 1DQ2A 1BHGA 1C4RA 2VZVA 3MGUA 4N7IA 3IMNA 5DUWA 2WZR1 5I0UA 2RS33 4J1XA 3RJRA 3EHKA 3K46A 2VM9A 2D5HA 1CX4A 4XBNA 1U5ZA 1WW5A 2YB7A 5F8PA 2IXJA 5JOZA 4IQPA 1TME1 3CBNA 4FTBA 3H8XA 3PURA 1FXZA 3FBMA 1DF0A 5FZBA 1GR3A 3T0BA 3V56A 5I93A 5DZEA 1W2AX 4RS5C 2K9ZA 2OPKA 2W1UA 3I2GA 5ERLA 4OMDA 5A3PA 2JDKA 5FKCA 3ZXKA 5IVBA 4YLZA 1XNBA 5FYSA 4N43A 4JCKA 2UURA 4LTAA 1OHFA 2XMLA 3CDZB 5BNOA 1WMXA 1OOPB 4IE7A 5DAQA 4QGMA 1LGBA 1M06G 5F3GA 3GBWA 4O61A 2FMDA 1ZA7A 3I3MA 4PQ9A 1O4ZA 1H8TA 1RUC1 3M3CA 3NJZA 1JH5A 1QJX2 2PLV3 4JRLA 1AYN3 1PO22 1X33A 3ZDVA 5LA1A 1ZZ8A 1J3RA 3N4MA 3F95A 1NE4A 1C57A 2JXAA 4UBHA 4ISQA 1OF4A 3HN3A 5LZ6A 2KM2A 2VD7A 4LLFA 2V73A 4NRMA 4Q4X3 5F5QA 4MH0E 4CCLA 4D7SA 1CGPA 1L3JA 4Y1ZA 2ZGKA 1DQ0A 1LECA 2VOKA 3ZXDA 2RS52 5CFDA 2ZA9A 1NT0A 4FQ4A 2OQ6A 3LQCA 1VB2A 4Y22A 3KVAA 3WUCA 4COWA 4RHV2 5C3QA 5AC93 2HEVF 2VZ3A 4OI2A 2HWE3 3GALA 1GOGA 1BEV1 5FUPA 4DO0A 4GMP1 4LLOA 5D8AA 4K3UA 3FL7A 1K5MB 1B35B 2GU9A 2Y64A 4GZ9A 3JZVA 4GKYA 2ARXA 1CESA 1VBA3 1WLWA 1OBNA 2D43A 1XRUA 1YQ6A 5F39A 4FPHA 1SZBA 4B4PA 4P14A 3A23A 2R071 2VGDA 1DU3D 2WO7A 4N8MA 4XAEA 3JB4C 3ETQA 2QDNA 1JZ7A 1IOAA 3VD9A 2JG9B 3WNNA 4B29A 4W6WA 2NP0A 4L2NA 5CYYA 4CCMA 5DQ0A 1PX4A 3LGRA 4KG8A 1H8VA 2HWC1 4AFMA 5C3RA 1F5JA 1SDDB 3MIEA 3S5AA 1CAVB 2RMU2 4I3GA 1DGWX 4ZU5A 3BKZA 2Q8CA 2EVXA 2W92A 1YLLA 3I59B 1SMVA 3C7FA 1V6MA 2JB4A 3GM8A 4Q4V1 5IATA 1S0BA 1AR72 4NPMA 4AEKA 1BKZA 1NUKA 3M8LA 2Q8EA 4AYUA 1V6NA 1QQP3 2YBSA 3NW4A 1HN0A 4OHWA 4GALA 3AP7A 2D6KA 3MLKA 4QPIA 1PMJX 1BMV1 2GNMA 4URAA 2D6LX 2YZ4A 2HWF1 2WR9A 5LRRA 3VHRA 2G4IA 3PJQA 4IEUA 4QU1A 1FATA 4ES8A 3A0NA 3WHTA 4DIQA 2GC3A 3VDDB 5A32B 2CHHA 2AGSA 2VUCA 3PVBB 3AYEA 4IE6A 4Y24A 3KGLA 4J1WA 3WY6A 2OW4A 1LTEA 1W6QB 2EIBA 2JIGA 5AFBA 5GKAC 5CB7A 3U14A 1W9WA 2ZKNA 3LD8A 3EYPA 1YNAA 2YU2A 5FLHA 1W8UA 5FXZA 5HCBA 2CYFA 5C3OA 3B3QE 2B4KA 3GZAA 1W6NA 4AEDA 1VB4A 3ILNA 4ASLA 1W8OA 2VBPA 3U78A 1W28A 3VD4A 2LROA 1ACCA 4RD7A 2OZ6A 2RDNA 2WZR2 1AF9A 3Q9OA 5T5JA 1STMA 1C3HA 1PVC1 1BVP1 3NJXA 3OOXA 4JHTA 1XB9A 3H9AA 1RUH3 2VE1A 4INDA 3BTZA 1W8ZA 2H0BA 3B69A 4N7UA 1TME2 2Y8KA 1LOBA 3FJSA 3AFGA 3K51A 3P1IA 4XFBA 3OGRA 2VO5A 4XPVA 3TN91 3AVSA 1OC1A 5CKMA 1XE0A 2PYTA 5I8TA 1XU1A 1WCKA 2TBVA 2Q5TA 4RA0A 3PUAA 1QOOA 5T50A 4UYBA 2X05A 2VJXA 3VGIA 1W6PB 3ST7A 1JHJA 4AVBA 5FLJA 3HPNA 4P9YA 1DGWA 1HLCA 1VP6A 1UNBA 1LOCA 2JIJA 3HBKA 4KG0A 1TNFA 4BM8A 1SLTA 4LOSA 4YW7A 2BNMA 4RS5B 2QQKA 2ZAHA 2PQSA 3BYWA 3GHMA 2VCAA 2QQVA 4LBNA 1H0BA 2HLEA 1IG3A 1J3PA 3TEWA 2HWD2 1SBEA 3OF1A 4M4RA 3U07A 2CTVA 2ZAAA 4MGYE 5EHDA 1NE6A 4HN1A 1CAUB 3BODA 3WF0A 2FDHA 4YSFA 1UZZA 1QNYA 1UL9A 2A3WA 3VBRA 5IVCA 1UZWA 5FOJB 2GN7A 2P6HA 4L11A 4MOAA 4YGCA 5E89A 3SH4A 1AX0A 5FMCA 3P3NA 4BQYA 4XETA 4KL1A 4TTGA 3BI3A 3PU3A 5JPMB 4YPJA 2ZX1A 2BRTA 1DLCA 2WFF3 3MICA 5A7OA 2CGNA 1UX6A 4YW1A 1NLRA 1J59A 3MZHA 1BEV2 2ZBJA 5FFOC 2Z42A 5GM0A 2XQXA 5FQ0A 3OBRA 2JEMA 4PLNA 4Q4Y3 3THPA 4BMEA 2R1DA 5C8WA 1SBDA 3ZIXA 4DPNA 1S4CA 1H2MA 5C8CC 2WBKA 2ERFA 1W04A 2HYXA 5C71A 1FYUA 5JIAA 3LEMA 2DVFA 2QQOA 3R4UA 4S2FA 4LKSA 4EN9B 3UKTA 3PIGA 1U12A 4QX8A 4AFBA 3DECA 3FFZA 3MUZ1 4CPBA 4DEVA 4XUPA 3QH7A 1R081 2XVGA 3MW3A 3GDBA 2GMPA 4WM8A 2EIDA 3IPVB 3SCGA 4UAPA 4AI8A 5JXHA 4K1ZA 2VMGA 4AI9A 4LIUA 2VW1A 4D8MA 1SLLA 2CDPA 1OFSA 5I8SA 3WP4A 2BNOA 1WCSA 2BYVE 3L2HA 3LPGA 2ZX4A 4LUMA 5GZCA 2KD7A 2VNOA 2CWSA 2Y26A 1NOVA 3IIAA 1V6LA 1WW4A 4GWNA 4PLMA 3WDUA 1WKYA 4HSLA 1K3IA 5C4WC 2R49A 1YXWA 5FJKA 5FP4A 3ZXEA 5A70A 4LHSA 2WSUA 1IQDC 1I5ZA 1VLNA 5FZGA 3WG3A 2SLIA 4S2DA 4OQ9A 1NA1A 1V9U3 1REDA 1RUD1 3A7QA 4NVPA 1KEXA 2JDMA 4BQ2A 1SFPA 2E33A 2VCCA 1CN1A 1C5IA 3N3HA 3ZMNA 1HXS1 1XSRA 2ID4A 2XBO3 2Y6GA 2ZZJA 5JXJA 1D4M1 2WO1A 2XR4A 1W3VA 2B45X 2HWF2 4GH4B 1D4VB 1A3KA 1WD3A 3ZN4A 4ATEA 4NO4A 3JBG3 1Y43B 2Y38A 3DYMA 4LA2A 3I3QA 4M01A 5FK8A 3SQOA 3VB9A 3PUQA 1AR91 1W9TA 1QDCA 5FIXA 1JOPA 3W58A 3T3YA 4YVSA 3LAGA 2RDRA 3LEKA 1E5IA 1H1AA 1OLMA 1UY3A 2PHFA 4XJ8A 3LDBA 1OSGA 1XC6A 4OI1A 4LMFA 2DCJA 3NWKA 1OA3A 1WGPA 2LM3A 2WC2A 1ZZ6A 2XLAA 1JXNA 1TMF3 4BQ5A 2DFBA 4GD4A 4CDQC 4CXXA 5LK5A 1EAH1 1XQNA 2WT1A 1CJPA 4KU7A 5FZCA 4AAXA 4Y1YA 4QQ2A 1PVC2 2WS91 1MACA 1PMIA 4AHWA 2Z4FA 3FHIB 5DAPA 2BV4A 5FZEA 2RR13 1LRHA 5ANQA 3VD3A 3NJVA 1ULDA 2DUPA 2PXJA 2WT2A 3AP4A 3TN92 1PIV3 2UWCA 4DFSA 1EV13 5IFPA 3W5MA 2VMEA 3WT3A 4DUWA 2AC1A 3CL1A 3PNAA 4IXLA 3AC0A 3NV4A 5FWEA 3R6SA 3ASIA 2WO2A 5GLUA 4QDSA 4S2HA 3WNMA 4JX0A 4CRQA 4P5HA 4I0AA 4XBLA 1HW5A 2VMFA 5JSRA 3KQ4B 5IK4A 1YI9A 4HKLA 4MO3M 1ND3B 2R6QA 5FPVA 3OGVA 3ZFGC 1ULCA 1WMDA 4RSUA 4WVMB 3T2QA 3ZR6A 1N1YA 5FO8B 1LHNA 3IB3A 3OGJA 2R063 4LE3A 4LT5A 5JUVA 4QXHA 1POV3 3IZOA 4XQ4A 3FLTA 5D1IA 1ENRA 4M3CB 4NR1A 4D94A 4UFKA 2FD8A 2G19A 1AR61 1O91A 2Y33A 3R05A 1VBC3 4I0BA 1MEC1 4JVAA 4M0NA 2KXLA 4UW5A 4LBQD 2D6MA 5FZ8A 2YV8A 5A7QA 4Z07A 2Q8DA 1W6OB 4ORFA 3WDVA 2RHPA 5GZFA 3AB0A 3JCIA 4ASMB 2WIIB 3J8F3 4QHBA 4DXSA 3MPPG 5LK7B 1Y4WA 3I2FA 5DN2A 1RUI1 3NNJA 2XKOA 2Y6KA 4BA6A 2QFEA 1WA6X 1AYM2 2BJSA 3O0XA 5FMBA 3VDAA 3JUUA 3U4XA 1ZRDA 1NZIA 4LEJA 3POGA 5DDJ3 2WAAA 4A44A 3USUB 1AXZA 1LAJA 1SPPB 3VBSC 3R4DB 4YW6A 4MSVA 1EPWA 1ZRCA 3WVJA 3J7NA 4TLGA 5LA0A 1COV3 5DMYA 3POEA 3I3BA 1W2UA 1HRI1 5BNPA 1CZVA 3RWNA 3K3NA 2GC0A 4AWDA 3ACGA 1UYZA 3RQ0A 1LJ7A 4AHXA 5KHIA 1R082 1G86A 5A3OA 1KITA 4LK7A 4CXYA 4HFSA 1PO11 4BDVB 3KV5A 5C8CB 5FZFA 3BVCA 2V72A 4BQ1A 3EO6A 3WG1A 4OHZA 2HWB1 4NHLA 3AJZA 4CCCA 4MGTA 2WA4A 4LO4B 2W1SA 4K1YA 5E88A 4EN6B 2W5FA 3KT4A 2GALA 3B94A 3ES1A 4AI1A 1ODNA 2VQTA 4KBBA 5KR7A 2ZGNA 4OHXA 3RZKA 3ZXGA 4QWNA 3UETA 3OY8A 1MR5A 2VOXA 5FWJA 2RS31 3T1MA 2AREA 3O1PA 1RUD2 1BXHA 5ANNA 4LBKA 4EWEA 3H8OA 5FPLA 4MUVA 4H3WA 3VDCA 5A6YA 2YFUA 2E7QA 1HXS2 4JGZC 1S1AA 4XFIA 3PVEA 4BOWA 2W9XA 4LITA 1F15A 2ES3A 2VBDA 5ACA3 3T1LA 2LW8A 2RS13 4CEYA 3POJA 4YM1A 3IIIA 4YG3A 1FI2A 2BQPA 3CJIC 5CEHA 4PJYA 5HI0A 1WLCA 5C70A 1MQTC 1SCSA 1AR92 2WKKA 2YUEA 5GLVA 3D0SA 2Z2SB 5FXWA 1KDMA 1RUE3 2GH8A 3VZMA 4NHKA 4IEWA 4D0QA 3I49A 3GXUA 3IT8A 2R0FA 4XDQA 4BQ3A 2WABA 1O4TA 3VBOC 1UMZA 3OGGA 1OKQA 1VALA 5IVVA 4ET7A 1Y3TA 2JDUA 2PELA 2X53S 2UY9A 1YIFA 1FT9A 3IDEA 4IE5A 1ZRFA 2ZMNA 4TSVA 4COVA 3ZIWA 2QZ2A 2QE3A 2VVDA 4E2GA 4AGGA 4Z1VA 3PMEA 1EAH2 2PLV1 3KGZA 4YVWA 4XZPA 5A6QA 1AYN1 4GULA 3VV1A 3OYWB 1UU4A 1ZBA2 2QQUA 2CV6A 1RVF2 2VZSA 2WNVC 4XF0A 5F32A 5A7SA 3T2PA 3U4SA 4U36A 3KLSA 3UGHA 4CU7A 1OVSA 2HH9A 2GP3A 3JQWA 4LBLA 3VKFC 3RGBA 2OZJA 1ULPA 5CKQA 1XE7A 1YO8A 4KH9A 4HVOA 4FP2A 5JI7A 3RI8A 2W94A 3H3UA 1T2XA 3QACA 2W0XA 3AKQA 2WAOA 3T09A 3WLUA 4AFAA 2QQJA 2X10A 3MHZA 1QJU1 3NMBA 3TNPB 4Y1XA 3WV6A 4CU6A 4XXAA 1H1MA 2JG8A 4R9BA 3MPBA 4QQHA 4CDWB 3CIHA 1FOD2 4MZUA 5IW0A 2DF7A 1WUVA 1JZ2A 2VCBA 3AK0A 2QZ3A 4KBZA 4ZPIA 2BEOA 1H2LA 4LBQA 2D40A 4Z2AA 4OHVA 3RFRA 5J48A 5ABJB 1VBA1 3KV4A 3N7MA 5FZ0A 3AMMA 1Q56A 1GMMA 4Y20A 3I54A 1OA2A 1GSLA 2JD9A 3OJBA 4XFHA 5J3UA 1UOBA 4CDXA 4U2AA 1DLLA 1QJY1 1UYPA 1S0EA 4QMAA 3K3OA 2PHTA 2TEPA 4Y5Z0 1NQJA 5T55A 3TEYA 4WV8A 3WNKA 3ENRA 3IM0A 1AR62 2EXKA 2V4AA 2W95A 2RVAA 1MEC2 3N7JA 4Y26A 3A4UA 3OGSA 4W65A 1Y9QA 5BV6A 2ZEWA 1D7PM 4CDQA 2EAKA 5DAXA 5J7MA 4LJHA 3WD5A 4AHYA 3QD6A 4RGAA 4CP2A 3LIHA 5FBZA 1V0AA 2Z5WA 3V0BB 4BE3A 1RUI2 1YIPA 1LCLA 2IXIA 5GALA 5JAXA 2ENRA 3FLPA 3ACHA 3HIFA 5J09A 3U1XA 3UESA 2ZJCA 4L9BA 4OUSA 1UOJA 3UJQA 2DV9A 1RMU3 1QQP1 1V6KA 4YZ1A 3KHCA 4QU2A 2VECA 1K5MC 3SCFA 1X7NA 3D0JA 3PL0A 4F3JA 4I02A 5A33B 3O1MA 4LNVA 4AI2A 1GBGA 3VN4A 1NXD1 3ATGA 2PHDA 1PO12 4Y4RA 3POFA 2D6PA 3RVHA 1RUG3 2VBBA 4YZ4A 4GWJA 4BJ0A 4YFZA 5L19A 2BWCA 3VBSB 1PGL2 1IQAA 3MLJA 4B1MA 2VUJA 2K0GA 2JG9C 1CAXB 1KGYA 1R1ZA 4M4PA 5JLVA 1OF3A 1U0AA 2D6OX 1JOBA 3DUIA 1DQ5A 2BFUS 4L99A 4UFMA 3U37A 1WWYA 5FY9A 4H14A 3ILRA 2G9GA 1RUF3 2AENA 4LOTA 5FAXA 1HX6A 3GZUC 5IAVA 2QVSB 4CUCA 1MS3A 2Y0OA 3EXUA 4NOTA 2JDNA 4RFRB 4CEWA 2IVJA 4MGIE 3VBUB 2LUWA 2YYOA 4A45A 4UBGA 4HK8A 1RJ8A 1M4WA 1RUH1 2DTWA 4GMP0 3H42B 4E8DA 3VKNA 4D6QA 1NLSA 2PMWB 3KCXA 3OBAA 4MXWA 1FNYA 2YC4A 4FTSA 2VW2A 2FQPA 3W21A 2YXSA 2QCSB 3AMQA 3W20A 1UOGA 3POSA 1TNRA 3ZVXA 2XHKA 4X6RB 4F7ZA 4QPGA 4OMCA 1J3QA 1EUTA 3CHXA 5LEKA 1QH6A 3KF3A 3VDDC 4K6BA 3ZFFC 2UY8A 2BGCA 3GBFA 3RZJA 1MS8A 3UV9A 2A1XA 4Q29A 3ZKUA 2Q30A 3AKPA 1LOFC 1O8PA 4ZONA 2F17A 2B39A 2R043 3M3IA 2OKXA 3CLPA 5K0UB 1FV3A 1QIQA 2VVEA 3CJIB 5H9RA 5BYNA 4LXLA 2RJ2A 1RC6A 1N1VA 3MIBA 4IUGA 4QKFA 1MQTB 5LATA 3HQRA 3W59A 4Q4W3 1XXNA 2J7MA 2FBEA 4NRQA 3HT2A 4XHXA 4KQ7A 2XH6A 1R093 2IFWA 2NPIA 5JMCA 2XLGA 4GJZA 4ES9A 3IWZA 3MF6A 2O0OA 1PK6C 2CAUA 2TNFA 4E4ZA 2Q1MA 3S5QA 5LWBA 4G3YC 1MVEA 1GNHA 4LE4A 4SLIA 4NAMA 2WNUC 4R8HA 2VR4A 2AYHA 1EUUA 3NKGA 3PJYA 2WNVB 3MW2A 4ARYA 4K8RB 1QJU2 1ZBE3 4FPYA 3AJYA 3ZMOA 4FPJA 3FZ3A 3DN7A 4CUBA 2E6VA 1VAMA 3RYRA 3KV9A 4Q4Y1 1ST8A 4AQ6A 4UF0B 2AEZA 5FY7A 1G9DA 1UW8A 1H2NA 3K4ZA 1QY4A 2JDAA 5KBFA 2JKXA 4FBFA 2P17A 4M0HA 4BQWA 1VBA2 2C4XA 4FPFA 4OI0A 2DBNA 2O1QA 1VBE3 2QBXA 1RYYA 1GV9A 3AZXA 1XYNA 1NCRC 4O9EA 4P9IA 4YW3A 1GQHA 4QKNA 4CDUA 4Y33A 1QJY2 4BK5A 4HZFA 3AFKA 3GZEA 4MXVA 1XNKA 4DS0A 4YM0A 3APBA 5GJ6A 4A7KA 2OPWA 4V2WA 2DUQA 1YWKA 1ASJ2 4P9WA 5FY1A 4LPLA 4GXLA 1AR83 4NPLA 1QU0A 1VBD3 2J1TA 4XXPA 3IDBB 1NLQA 1ZX5A 2ZABA 1W2NA 3FX3A 5JI9A 3TWIA 3MUY1 1SLBA 3AMHA 5FDBA 1DQ4A 5C9AA 4BXFA 2W3JA 1TEIA 2VMDA 4NWWA 3BU0A 1IKPA 3ZSKA 4O9GA 2MEV2 3D8CA 3HQXA 4GQ7A 3TAYA 4XHBA 5C6CA 5CADA 1KJRA 1WMEA 3O5SA 2PAMA 3I4IA 1MS4A 4XC9A 1FMD3 1N47A 1QQP2 1UX7A 1UY1A 3BU7A 1QXJA 4OUEA 4D7YA 2XHNA 1GNYA 1O8SA 2AZ5A 2ZMLA 2XBO1 5H9QA 5FZDA 1UIKA 3F2ZA 2DUOA 4Y5TA 4FPEA 3ZFEB 1A6CA 2NQYA 3JBG1 4AVAA 3CZJA 3WP5A 3GYDA 3WEZA 2WN2A 5FPAA 4A41A 1CVNA 3U10A 1OOPA 2ZGUA 5FP8A 5KHHA 3VLBB 4UFJA 4E4DX 2XJUA 3L9JT 1LR5A 3VBFB 2ZS6B 4A2UA 2R1BA 4L8QA 4COZA 5I8YA 1UY0A 3BPSA 1O4YA 4HETA 2O14A 3SMHA 1CZSA 1YQ2A 2J22A 1UZVA 5I0SA 3LE0A 3J7LA 1TMF1 4CU8A 4QM9A 1S0GA 2H6BA 1FPN3 4AI0A 2Q0AA 5FCCA 1VRH2 4FOQA 1ZZBA 3IDAA 3M3EA 4C0BA 1DQ6A 4I30A 4ZU4A 3AP9A 1W9YA 3T0AA 1WLTA 4R9AA 4BK4A 2C9KA 1AJKA 1UU6A 5FP9A 2RR11 5A6XA 1I3HA 4QPIB 1PIV1 2YHJA 4CPBD 4DY3A 3DV8A 2VNGA 4GH4C 1EV11 4JDNA 1O3SA 3B02A 4O65A 5A3LA 2X5IA 5G04L 4WBBA 4AAPA 4RQPB 2OYZA 3ZR5A 4K21A 2R16A 4Y1UA 1W0PA 2YGLA 4NWVA 3WW4A 1V6OA 5CISA 1ZREA 1JMUB 1RTVA 2XXZA 3HNMA 3KSCA 4EZ4A 3P3PA 1JS9A 1K5MA 1B35A 5DUVA 3WP6A 1DHKB 3H3ZA 4FCAA 1KD7A 1YJKA 3I3DA 4XFCA 4MV2A 3TOJA 5TSWA 3NAPA 1QH7A 5A3NA 1W99A 3HT1A 5M0TA 5LW9A 1A78A 1NCQC 2BFUL 5FY0A 4CYDA 2LS6A 2EAAA 1PNFA 3K48A 4KGGA 3N9LA 3ZFFB 1PO23 1ENQA 2P37A 5A80A 3HR9A 3VZKA 1POV1 2JG9A 3PUHA 1SLAA 2W47A 3WQ0A 2ORZA 4NROA 1LGNA 4P9JA 4QDRA 5JOXA 1F35A 1OPOA 3O7OA 4K40A 1X82A 1RXGA 1QJZA 2DVAA 4HOOA 1VBC1 2P6CA 5K4LA 3IBMA 3M4FA 2IFRA 1XE8A 1CAVA 1DP0A 2D97A 1VIWB 4TN7A 2R0HA 3SKJE 4RHV3 3J8F1 2YPDA 2ET1A 3BUCA 4PIYA 3WNOA 4HVQA 5LY1A 1UMIA 4MG2A 1ZZCA 4HPKB 3OD4A 1YQCA 4XCAA 5T52A 1H2KA 2ZOEB 3D6EA 5JMOA 1E57A 4QT6A 1PK6B 3ZKYA 5IAXA 5K9YA 5CG8A 1FX5A 5DDJ1 4PLOA 2WQ4A 1EP0A 1VAKA 1YRZA 2WNUB 3LPFA 1UOFA 1ND3C 1Y7BA 3B01A 4LORA 4TLFA 5BUVA 1UZ0A 3MV01 4NMIA 1OQ1A 4XURA 3VDDA 4CVUA 1QMJA 5A32A 4JQTA 3G6JB 1AVBA 1AL0G 1CIWA 1ND2C 1S2EA 3O1UA 1LOFA 5T54A 1TVGA 4HVRA 1N1TA 3KT7A 4GJYA 4BLIA 1CONA 2WL1A 2QNKA 5IVEA 3ZSLA 4BWOA 1NCRB 1W6MB 3I97A 1CZTA 4FOVA 3E6DA 3Q8CA 3ZYHA 2VC9A 2B46X 3HNBM 3VKOA 4YGEA 2VMIA 2W39A 1RUC2 2XJTA 2DU1A 1F2NA 4FPOB 4OULA 1QOTA 2AH2A 4P08A 4PHZA 4XFGA 3VBHC 5JCTA 4HL0A 4XUOA 3VKLA 4XTPA 1C28A 1O6UA 2AUYA 5D2AA 1AR73 2YBPA 5A3TA 2B9VA 3L2YA 3AM2A 1KFXL 1AL23 3TRSB 5GLZA 4EWAA 1JZ8A 1PZ9A 1GYKA 4A3XA 2WNOA 5FYHA 1JZ5A 5JXGA 1B09A 1XNDA 2VNRA 3N7LA 2YROA 1GOHA 1O59A 3PVNA 1W8FA 4F83A 3BTAA 2RS11 5FZLA 1W6PA 5FP3A 1VPHA 3OCPA 3C7EA 1DZRA 3FN9A 3HQUA 1RUE1 5CAZA 1H4HA 3SCHA 1JYIA 3ZXLA 2A73B 4EWDA 1JODA 1JUIA 3NNMA 4RS5A 5FPUA 5FOBB 5LEJA 3EQEA 2P3YA 3CF6E 1S0CA 1OT5A 2XB6C 1IZ3A 3ITQA 3RYPA 3THCA 2ZCWA 2JENA 1IGOA 1HDKA 2BGPA 4CCJA 2R072 2CL2A 2A7AA 3ZYBA 3S30A 5CA6A 2P2KA 2VW0A 4RR3C 1IPJA 4BISA 5CG9A 3TEZA 2IVIB 1RUNA 4NN0A 3FLRA 3SEPA 2FCUA 1TME3 2CNAA 2RR12 2HWC2 2WRAA 3DXUA 3OUHA 5FXVA 2BPA2 4XUQA 2J1RA 1L7LA 4IV3C 1ALYA 2YG0A 3UL2A 2XL7A 3EB7A 3ZPYA 4B4QA 5C3SA 5DZFA 3WSOA 4P5YA 2WWJA 2BU9A 4GB33 4Q4V2 3WW1A 1QXPA 3AKTA 5APAA 4C90A 5F6LB 4XMIA 2YPJA 4NIIA 1JW6A 1N3PA 2V4VA 2IWGB 2XOMA 1PM7A 4AFDA 4QX7A 4AEMA 1DGRN 3N9PA 5FRAA 2QQMA 1UQXA 4NIAA 3MIGA 4IV1C 4LKEA 3LEIA 3SKVA 4JKKA 1MS9A 1SCRA 5KC5A 3WW2A 1OLRA 3U11A 5FY5A 3O0VA 2JE9A 1TG7A 3IMMA 3KVBA 2I45A 4EROA 1PX3A 2HWD3 4CCEA 3TBDA 3X29B 1UPIA 3IPVA 1GKBA 4PF5A 4XBQA 5FBJA 4LIVA 2P4EA 3H1MA 4DZGA 1BMV2 1VMFA 4YM2A 4B7EA 5F5IA 5FMOS 5F1RA 4MYEA 2VMCA 1VBC2 1W8NA 5IK8A 1GQGA 2G9ZA 1AXKA 4LBJA 1K12A 1NCQB 4SBVA 4CP0A 1W8WA 3GCXA 4R9DA 2Q4SA 1J83A 2P3JA 2VU9A 4NRPA 4E4HA 1R1A3 3POYA 2VUAA 4XYXA 1ZRRA 3AVRA 5A7PA 5IVFA 4GKXA 1UWWA 1MZ6A 3GF6A 1YCIA 1BEV3 4UOJA 3AZWA 5LBCA 3DYOA 4XIKA 1L7QA 2ZEZA 3RPQA 4DOUA 4E8CA 1RINA 2JX9A 3BIEA 1O3TA 1UKGA 2LRPA 4XIOA 2OIIA 3IDCB 3UT0A 5DDJ2 1EPZA 5L73A 3ZO0B 4CDWC 3LDKA 1GOFA 4Z82A 4MGSA 5E16A 4JKMA 2XUMA 1UYXA 3I7DA 4XJWA 3Q8AA 4BU2A 5ABJC 1HQWA 1REFA 1D0HA 3BCWA 2PHXA 2ZGTA 2W2IA 3ALQA 4TWTA 2VXJA 1OQDA 1AUYA 3THDA 3E5UA 1IPKA 1NY71 2P1BA 4EJRA 1PGW1 2DCTA 5JSOA 2XJRA 4XTMA 1W05A 1QDOA 2RE9A 1GZWB 1RXFA 3LA3A 1UD1A 2GDFA 1GP5A 3LFMA 1BQPA 3NV1A 1A8MA 4LBMA 1CAWB 4EV0A 2C1FA 4XF4A 3EMRA 1A34A 3RRDA 3UKNA 1KFUL 1V6JA 1NQDA 1ND2B 3OPZA 3RZZA 4R4ZA 2W1QA 1OLME 4MGZE 1HQLA 2F4PA 1BLZA 5DXDA 1T6GC 4QQOA 2BERA 3TYJA 4AK3A 2ZHKA 3ZPOA 2PAEA 5A7WB 5CFCC 1QJEA 2I07B 3JD73 1H6XA 3O1RA 2FDGA 3OUIA 4OCTA 3VBHB 4DUXA 1X36A 3RJ2X 2HWF3 4Q2FA 5FY4A 4ZZ5A 1O3RA 1X8MA 4XFAA 4N9HA 4OLLA 4LULA 3QH6A 2BUKA 4N53C 1Z78A 3WX5A 2ZEXA 4IE0A 3WDTA 5LASA 5HV0A 1JYCA 3HN1A 1WCDJ 3PDQA 2D5FA 1RUE2 2PA7A 3ELNA 4NHMA 3WF1A 4TYSA 3LF7A 4YW5A 5IFTA 3PTRB 2W91A 3URFA 2VZRA 2XPJA 1LOAA 5LBFA 4AF9A 4AHZA 1NX9A 2R041 4WVMA 1Q5OA 5HCHA 1JZ3A 4WVWA 4R4XA 2JDYA 3K4AA 4Q0VA 1KS5A 4Q4W1 3NV2A 4M3CA 3H1YA 3B9CA 5AVAA 1Z7S3 4O7XA 3MEPA 3H50A 1R091 3LWCA 5BPXA 1UO9A 3VBUC 4QXCA 1C8M3 1HIXA 1LHVA 4QB1A 3MBWA 1W6OA 1MZ5A 4PI2A 3DL3A 4WM7C 1IKQA 5FTTC 5HBAA 4BMBA 4EE2A 4CUGA 2FDFA 4RR3B 3UKVA 3HMYA 2RM23 2YDEA 2ZKLA 1HRV3 3H8UA 4IERA 1ODMA 2BDRA 2FDIA 3RZHA 3WCSA 1YYNA 3ETPA 2VVFA 1ZBE1 3SC7X 3AKRA 5I91A 4HXCA 5FYMA 3B00A 2ORXA 4PF1A 4COUA 4BXSV 4LKDA 3SEEA 3USUA 5FPXA 1HKDA 1SPPA 3H3LA 4IV3B 3H7YA 2IXKA 1IS3A 4K20A 1D4M2 4HT1T 2DCZA 4XOGA 3ZDSA 2W08A 2HBUA 4R9CA 5K0UC 1MPXA 3NKTA 3SXWA 3CQOA 1LOEA 2B9UA 1JYXA 5FZKA 3ECQA 4P9GA 4IE4A 3C8XA 1ENXA 2ADDA 5C8CA 3WF4A 3WDWA 3GBGA 1TZOA 4IV1B 2EXIA 2B8MA 4NE9A 4AW7A 1UXZA 2VH9A 4TZDA 4AI3A 1H9WA 4MHUA 1GWMA 2GSYA 2E51A 5T5LA 4RFT0 2JE7A 3BIWE 3DPRB 1HJGA 3BTXA 2V5YA 3KMHA 4QAWA 4Q0PA 4I3PA 4QX2A 3HEIA 1WMFA 4E2SA 4DUVA 4X8NA 3D3AA 4EN8B 3ZSMA 5KHKA 4AR2A 4UI9L 2BBAA 2E32A 3B93A 4AQ2A 2DCKA 3VZJA 2WS92 5FZAA 2UYAA 2GH2A 2XDVA 5GLWA 1GFF2 1AYM3 1MS0A 3H1WA 4N43C 3KQRA 4H7LA 2JG8B 3KF5A 1PHMA 2GMEA 2RJKA 1FMD1 3KCCA 2B42B 1PMHX 3LA7A 1WD4A 1GQPA 4IEYA 4Q4X1 2EXHA 3AX4A 5JSPA 3NNLA 2FCVA 4IEOA 5C4WA 3WG2A 4LUKA 4PBPA 4PIZA 1CIYA 4AEJA 4JGYB 5AC91 2ARBA 2DVDA 5JR7B 1DYKA 2LALA 2HWE1 1UKRA 4MGKE 4ZY9A 4YARA 3LEGA 1NY72 2WT0A 2ZACA 4Q8LA 1PGW2 3M70A 2X29A 2Y6FA 1IG0A 1ZRIA 2VOWA 5FZHA 3IKWA 1CR7A 3SNMA 1DG6A 3KWVA 1OVPA 4IDZA 1RIRA 1S0DA 4LO7A 4UWDA 2WYSA 5FMOL 3AL6A 3N9QA 4DQAA 1KQRA 1O7FA 3IAPA 2V09A 3B7MA 3NRUA 5AFEA 4AQTA 5GZDA 1HJFA 4QGNA 5J37A 3RZMA 3FWEA 1VMHA 2BP6A 3QLQA 4AG4A 2FDJA 1ZYBA 3HAGA 3ZYJB 4CP9A 2GC1A 3OYWA 4YYOA 1FPN1 2N7GA 1BBT3 1XYPA 4ATFA 3WR0A 4MLOA 1ULOA 1W39A 2R7EB 2L9LA 1PZ7A 2OUHA 2VCMA 2ZZQA 3LFIA 3MI8A 4FAGA 5EP9A 2YFZA 3M7AA 1NAEA 4K7JA 1RUD3 3CNAA 3ABZA 4MADA 3CEWA 1HXS3 1U5IA 2ZGLA 5D8AC 2X8KA 2W1WA 3HBZA 1YHFA 3WCRA 1Y9MA 3LCPA 1OQEA 2V5DA 5J36A 4PDWB 5EPAA 4IW3A 2C26A 2WYFA 3VUOA 3LB9A 1S2BA 5EZWA 4CCOA 3WW3A 1S2KA 1AR93 1UYYA 2YGMA 3ZFEC 1Q43A 2EF6A 1PGSA 5FK7A 4FXKB 2BTVC 2TUNA 2XVKA 5CFCB 1HB4A 5JZGB 4OYUA 4OVEA 2X09A 4NJ4A 1UPSA 3J7MA 1GNZA 1SLCA 1US2A 5EYYA 2NZ9A 5FYTA 3WDYA 5CZKA 2CWMA 4LQRA 3KD4A 3ZYIB 3VBFC 4GA9A 1ULFA 1HRI2 1VE0A 2ZXQA 4FPGA 3GZTB 4N53B 4IEQA 1L7RA 2QTWB 2UU8A 4RGKA 5FZOA 3WOGA 2C6SA 3THTA 5IHRA 3J4UH 2P3IA 3FFQA 3AYCA 3POWA 4CUAA 4E9KA 3LIGA 3V0AB 1EAH3 1UMHA 2XUEA 5FZ1A 3NVCA 1AXYA 5FYZA 2FZ1A 2ARAA 4YG0A 4C1XA 4YZ2A 2Y6LA 1ZBA3 2K46A 4QKBA 1RVF3 3SLIA 4AVSA 2YBKA 5L9VA 4DXTA 1R092 2HWB2 2YU1A 2JE8A 3ZFGA 4Z92B 3VZNA 3J26N 5EFUA 5F2SA 5A3UA 1XOYA 2PQQA 3WQ1A 1DDLA 1I1EA 1UCXA 2RDSA 2NN8A 3QBQA 4IL7A 1ULGA 3VD7A 1HV0A 2BGOA 2GNBA 3LSDA 3OSDA 4QPIC 1UIJA 5FYUA 3V0BA 4RHV1 2IXHA 2OT7A 4Y3OA 5FZ6A 1G8WA 2J1SA 3I2KA 3IN9A 4UFLA 3NNFA 2RS32 1DQ1A 4XACA 5I0RA 4RQPC 3Q8EA 3I8TA 4QXBA 5LBEA 4R52A 4Z8BA 5KWRA 5K7PA 2BVVA 1FOD3 5JVVA 5EJ3A 5CIRA 4Q0SA 4WM7B 5KHGA 2F4LA 2OX0A 3FHAA 4OZOA 1LHOA 5CKNA 3W5NA 5LRSA 4HK9A 4N9IA 5FO7B 5A33A 4ZHNA 2DWRA 5EXOA 1TE1B 1W3XA 5JDBA 4IGPA 2WQ8A 1GICA 1W90A 4CE8A 3RNSA 4AEDC 1NXMA 3CKHA 2E9QA 1V70A 2IXCA 4D7TA 3VDBA 3ES4A 3ZXJA 3VBSA 3WNXA 4XMAA 1OH4A 1RUJ3 1WBLA 2EIGA 3Q8BA 4QB6A 4XZUG 4JAAA 1AR63 2BZDA 2ZGMA 3FMGA 1MEC3 2SBAA 4LHNA 1F8VA 3OG2A 4MX3A 1C1FA 2A6VA 2MHFA 3M2MA 2NMOA 4NHYA 2XONA 4V2VA 3T08A 5KXBA 1JZ4A 2WJSA 5BNNB 5L7OB 4FPKA 2PLV2 1LU1A 2J1UA 1AYN2 4B3NA 4YNIA 1RUI3 4H2AA 2EA7A 4Y4YA 1AR71 4NUBA 4LBOA 4XF9A 1I9RA 3ZYRA 2ILMA 3C2UA 3AP6A 4OFGA 5IWFA 1AL21 3ZN6A 1FMD2 4Q4X2 4QX0A 1MZEA 2J42A 5JR2A 4Q5OA 2FMYA 5FUIA 1REEA 4HG6B 3UGGA 5EJ1B 1KRIA 4AL9A 4NAOA 5AC92 2WFF1 2YC2A 3ME2A 4FFFA 2HWE2 1VMJA 4FI9A 2RDQA 4N43B 1WBFA 5LCWL 1DGLA 4JGZA 1D0GA 1POV0 3PHMA 4YGBA 4Y5SA 1H30A 2B5HA 4Q26A 1OURA 5BNOB 3FC0A 2A6XA 3BALA 3VKMA 1RHI3 2ZGSA 1N3QA 3CJIA 4YZ3A 3T4VA 3G7DA 2VTXA 4FO9A 4P02B 5HCFA 4W6YA 2WFPA 1MQTA 3HOBA 3GJBA 5KXEA 5JWPA 1SEFA 4JZRA 1H8TB 4Q0UA 4DINB 1FPN2 4NIHA 2BBVA 2WWUA 2XG3A 5A1FA 3VBOA 5GZEA 3S0MA 3GCWA 1JBCA 4KWUA 1ZM1A 4LKFA 5IK5A 4A6OA 5E1RA 4A6SA 3PU8A 1XNCA 3D82A 4LO5B 1S55A 3SH5A 4LR4A 5IVJA 2YMZA 5CFDB 4FXGB 4QM8A 1W0OA 2WNVA 1SQ4A 4Y22B 1RUOA 2VNVA 4RL7A 2A5ZA 1GANA 2XGXA 2XJVA 4LHKA 4GB31 4RYDA 4XF3A 1S0IA 3JXSA 3C7OA 3MV11 1SFYA 4UF0A 2QQWA 1OKOA 1HN1A 2O8OA 3N9NA 5D8AB 3HJRA 2JWPA 1V9U1 1E5HA 2DU0A 4WM8C 2H0VA 5JXIA 5FZIA 5B4NA 2BOIA 4X6QB 1JYVA 3DCQA 1GWKA 4COYA 2FDKA 3VL9A 3RMXA 1VBB3 1DBNA 3DGTA 4XUTA 3ACFA 2HWD1 5JOYA 5F2WA 4Q8KA 2ZPXA 3ZYPA 2F6BA 5DG1A 3N7KA 4V1PA 4EQVA 2BWAA 4YFWA 3RG0A 2W87A 1N3OA 2C0ZA 3OEBA 2PHLA 3OUJA 5H9PA 1SG3A 1LNSA 1N1SA 3KM5A 4KWLA 3WXPA 1NA1C 4UW3A 3FHQA 3SH3A 3LA2A 2JB8A 1R1A1 2CSGA 1I5PA 1IS5A 1BZWA 1KJLA 2R32A 2ETEA 5FPZA 3OEAA 4Z2WA 2FCTA 2X5IB 1JOJA 1QJU3 1DFQA 3ILFA 4N90A 4MHRA 3WP3A 1G6NA 1CJDA 1YI7A 4M00A 2OS2A 1RUH2 3OPTA 3EJKA 4KWJA 2PHRA 2NLRA 2ZX2A 5HV4A 4XQWA 1JU4A 1HQNA 3HNYM 1F9KA 4YVSC 1G9CA 4IEZA 2ZTNA 4DRRA 2VQ0A 2XL9A 3NAPB 3MIDA 2WINB 3ZFEA 4B4RA 1QJY3 5HXMA 2OA2A 1E5SA 2E7TA 5C5TA 5HCAA 4FTEA 4FSJA 1POQA 3I2JA 2HJIA 4GIQA 3I2OA 3UGFA 1YEWA 2Y0IA 3T30A 3VBFA 2Z79A 3BGAA 1ASJ3 2VZTA 1O5LA 5DUUA 1AZDA 5EYXA 2VMHA 5CBLA 1BK0A 1G9BA 3RMYA 1W6NB 4X8PA 4AEDB 1CWPA 1G9FA 3E6CC 3GNEA 3KT1A 4QGLA 2RV9A 1W8TA 2LTNA 3FUQA 1QJX3 2MPFA 2R061 5FYBA 1MVQA 2MEV3 2CAVA 1H1IA 4IESA 1W03A 2G9FA 3D5OA 1US3A 3UNPA 2HBTA 2I74A 2QQLA 1LENA 1HB1A 4QHZA 2WQZC 3MW4A 5H9SA 5DAVA 1C8NA 1AL22 1DCSA 1XNAA 3ACLA 1X9PA 3CZUA 4W6XA 5IVYA 4B1LA 2A71A 3U0ZA 1IHMA 1A8DA 2WN3A 3JD71 2RS53 4URTA 2C9AA 4XEZA 1LEMA 1YFUA 2EALA 4D6RA 3AZYA 4E2QA 2WSVA 3I59A 1T6BX 2WFF2 4RQPA 1H4GA 5DABA 3VL8A 2DDUA 1W2TA 2NM1A 3AXDA 1SACA 5FLIA 4A7YA 5IJRA 2QDRA 3PLQA 2UWAA 3KB5A 4JC1A 4Q4Y2 4PT6A 2E63A 2KR2A 2VG9A 3BB6A 5FZMA 3O1TA 4I2OA 4CCDA 1V6IA 4UW6A 1COV1 3MFCA 3UK9A 2VTXJ 2DURA 3OPWA 5JOWA 1MS5A 3W9AA 1ZZ9A 4XJUA 3ZFFA 1QOSA 1D2QA 1OI6A 3OBZA 5K8SA 2B7YA 1VRH3 5F5AA 1MZFA 1W6QA 1NG0A 2G1MA 1Z7S1 3AYAA 2OVUA 2K2SA 2NMNA 2Q1ZB 4FFGA 4HKWA 3INAA 4YWAA 3AMNA 4HN0A 3KZ4C 3VBRB 4DB5A 3POIA 1C8M1 4QPYA 2XJQA 2D44A 3WQ7A 3JB8A 2VUDA 1F5FA 4YG6A 1GP6A 5J96B 1K45A 2HKXA 2RMU3 3I2DA 4FVVA 2ZEYA 4YW2A 1IS4A 3ON7A 4IETA 4XJ9A 1IPSA 1F4HA 5F3EA 2WNEA 1JYNA 4LO8A 2RM21 3PUIA 4GB32 1HRV1 1JU3A 1W8HA 4HPKA 5BNPC 5FYVA 5FR3A 1PK6A 5FQ0B 5FJHA 5CU1A 4HBNA 1Q3EA 3N9OA 1V9U2 2JD4A 2XWJB 5FV3A 4JDMA 3VHOA 2WNUA 4P9LA 2VULA 5IUQA 4JQRA 2ET7A 4UFHA 2XBO2 4XE9A 1HB2A 3WG4A 1LU2A 3FUOA 4LHLA 4AQSA 3BTYA 1XU2A 5ACA1 1FV2A 1QGLA 3VHPA 2GMMA 2WZEA 2PN5A 3JBG2 3ZM8A 2H6CA 1AHSA 1GLHA 1PVXA 2WLPA 1YFYA 5LY2A 1UY2A 4WM8B 5KHJA 5J1XA 4KI5M 3C3VA 3O0WA 2IUWA 3RZGA 4CA9A 2PHWA 1NCRA 1W6MA 4LA3A 4XDPA 3UYJA 5DAWA 1UAIA 3K77A 3DXTA 4ASKA 4ONUA 4GAZA 2GP5A 1DGRA 5JIUA 5FZ3A 2IC1A 2D3SA 1R1A2 1TMF2 4ZS2A 4PI0A 2W68A 5GZGA 3VD5A 1Y9GA 1VAVA 2WZR3 4AFCA 1CAUA 1MS1A 4L92A 1XYOA 4ZKTB 4AVVA 4CEYC 1CX1A 3ROUA 2VQUA 1AYM1 2VZUA 4WVVA 5FO9B 5IT6A 5FPBA 4C8DA 1NA1B 1Q8PA 4YGDA 4FPLA 1K5JA 1PIV2 5EWSA 5ISLA 1W06A 3WNPA 1C5HA 3PVOA 1EV12 4META 2DYCA 5KC6A 4BPZA 3ZYGA 1JN2P 2CGOA 2D93A 4A7ZA 2RG4A 1W0NA 4W4ZA 1GU3A 4WVZA 4KNCA 4YVWC 2VOTA 5FZ9A 3BPZA 4HSJA 4YVSB 1X50A 1NZCA 3S6PA 1X8EA 3DKWA 2GAUA 3DPRC 3K4DA 4OZXA 1LOGA 5FP7A 1RUC3 1YJLA 2D98A 2VZOA 2R062 2E7AA 3I2HA 2ZGPA 3WQBA 3ZSEA 5T3NA 1PNGA 1JHNA 1BBT1 3TNQA 5HPOA 1EYBA 1WLDA 3BOPA 1UN1A 3AKSA 2P3KA 3LOBA 3BOWA 1E5RA 1OD5A 4BIOA 2E53A 2A6YA 5CVRA 4AOCA 2P34A 3DYPA 4B7KA 4DXZA 3JD72 2JG8C 1DYPA 2RJLA 4CCKA 1HB3A 5CNAA 2BVBA 2ZHNA 3J8F2 2HEYF 2QQIA 5I0TA 2FZ2A 1I6XA 3FE5A 2GC2A 1G9AA 2XLFA 3I2IA 3M3OA 5E8AA 4JGYC 1Q8OA 2PTMA 1CPMA 1Q8QA 3J9SA 4GMP3 4WZCA 5L9RA 4EYUA 5F9TA 3ZYFA 3E1F1 1LEDA 3R0RA 5DZGA 1ONAA 3MIFA 4CDXC 4IEVA 4UT5A 2YC0A 5FXXA 4JTOA 1RMU1 1BVVA 1EY2A 2PHUA 4BZ4A 4GH4A 3POBA 5BXXA 3E6BA 3AMPA 4KGQA 3VHNA 4D69A 5C3PA 3SHRA 1COV2 5F7UA 3JQXA 4A42A 4DRVA 2IXLA 4DNYA 5FYCA 3ZOIA 2R073 3NSTA 3HD8B 3CU7A 4HANA 4I0WB 1CD3G 3USSA 3N36A 4JV4A 1RUG1 1Z7S2 1ZBA1 1RVF1 5FY8A 3QOPA 3AZZA 2QKDA 5FKBA 4CXWA 4UW4A 5AVPA 3JU9A 1NCQA 1C8M2 3ACIA 2HWC3 4XDOA 5HXVA 4E27A 1AJOA 1LESA 4BQXA 5F3IA 2NYYA 2VL4A 4CP1A 2WUHA 4DXRA 4D3WA 3MYXA 4Q27A 3RS6A 4FP3A 3MLLA 5DUXA 5F37A 1RUF1 1OMIA 2RM22 4Q4V3 3VZLA 1HRV2 4PDWC 2ZGOA 4FT8A 4J25A 1LODA 1OPMA 1GZTA 3ZSJA 2XJSA 5E6HA 2DFCA 1ZNPA 5C7GA 1FOD1 1H6YA 4BLJA 5JZGC 2ATFA 1Q8VA 1LHUA 5FYIA 2ZHMA 2EXJA 2CDOA 2GNDA 3M3QA 1SLIA 5ACA2 4BH9A 2RS12 5BNPB 1RB8G 3SITA 3IAQA 2J1AA 1PZ8A 4J6GA 4UXAA 1UZYA 2Z69A 4Q1RA 4XVHA 3HWJA 4C91A 5EIYB 4M3CF 4OUMA 1GZWA 1RUJ1 3C7HA 4I09A 1NYWA 1QWRA 1QEXA 1ND3A 1Z0HA 4H55A 5EV7A 1CAWA 4ZXKA 4CEWC 2A6ZA 5B2GB 1LGCA 4W50A 2VZ1A 1ND2A 3HVDA 2WLQA 4FAHA 3N9MA 3RYKA 4OI4A 1OD3A 1QJFA 2JJ6A 3I3EA 5G05L 2D3RA 2Y6HA 4XF1A 1DZQA 1PVC3 3OY8B 4TXWA 2ADEA 4YW4A 1ZZ7A 2JDZA 3WUDA 4QPGC 5A7WA 1QHDA 1QF3A 2HEWF 4H7MA 3AZVA 3VBHA 3A22A 3TN93 1R64A 4EN0A 3QCWA 1BCXA 1JYWA 1QNWA 4FPCA 2ZHLA 2QQPA 2EICA 4XCBA 4DEQA 1KXGA 5A3WA 4CEYB 2J1VA 2ZGQA 3OTFA 5A3MA 1FNZA 5LA2A 3R4SA 2UYBA 1SDWA 4QX1A 2AR6A 1X9TA 4DY5A 2ZMKA 3BN6A 1Q8SA 3E5QA 4NPRA 4XFFA 1PGL1 1UF2C 4QDQA 3WHUA 3VZOA 3O1OA 1RHI1 5F3CA 4XJAA 2JDPA 1XJAA 1PM4A 1VBE1 4AGVA 1YFWA 1XPWA 1GWLA 2UWBA 1H9PA 4XUNA 2Y6JA 3NQHA 4FOWA 2WO3A 1IS6A 5IYYA 4BIFA 5BNNC 5JZGA 5L7OC 1BBT2 4YVWB 3SISA 1LULA 1JUHA 5C33A 3LOIA 4CSWA 4LO6B 2W52A 1WA4A 3MF9A 1AR81 1FAYA 1KDKA 1VBD1 2QJVA 3AYDA 4KMQA 4ZS3A 1JI6A 5FZ4A 2Q8OA 3N35A 4UFIA 4IGQA 4M3CE 1QKQA 3MIHA 4RR3A 5C4WB 1O5UA 5L36A 4XQDA 3TEXA 3A21A 3P6BA 1ZVFA 2DBIA 2JKBA 2OQ7A 3ZLIA 4CDUC 1GUIA 3KHBA 1O3QA 4OHYA 4BHPA 1OFNA 3OB8A 4K8FA 4C0HA 5A6ZA 4IV3A 4EN7B 4CU9A 1RMU2 1YQ8A 3T0DA 4GWMA 4NIGA 4K9SA 4P9XA 5A1AA 4LBQB 5BNOC 4BB3A 1SFNA 4A4AA 5A7NA 3UJOA 4E4SA 4ZU7A 2DVBA 1VBB1 3O1SA 1R083 2EIEA 2VAUA 4Y20B 1VJ2A 4YM3A 5T5PA 1DIWA 1AX2A 1F31A 4AXOA 1UU5A 5C9AC 5F6KA 4IV1A 4CDXB 1V00A 1H8TC 4CP9B 1RUG2 3T2OA 4JTNA 4FFIA 2ZX0A 4P00B 3RI9A 3LDRA 3PIJA 5D21A 3WF3A 5IK7A 2Y60A 3DPRA 3LZZA 4AGRA 2P5BA 3V65A 3H0OA 4ZXEA 2Y34A 5GLTA 1LKNA 3ZXAC 1APNA 3KS7A 2GNTA 4NIDA 5B4XA 4CDQB 5LB6A 3RDIA 3S7EA 3OD0A 4QKDA 1XNTA 3ZX7A 1RUF2 1ENSA 1HV1A 2XQRA 3V64A 1BK1A 4FQZA 5CFDC 1JZ6A 2XVLA 1CQ9A 1J58A 2VTFA 4XAAA 1ZA4A 3B5LB 4DMIA 2OUJA 3B9IA 1UXXX 3RWKX 3WF2A 3KCYA 3CMGA 3NO8A 4YRDA 5T5OA 1DZTA 5C5UA 2VPVA 1JYTA 1D4M3 3KV6A 2PFWA 1OOPC 3A0KA 4PBOA 1G7YA 4JGYA 3M1HA 4HLTA 1VR3A 2FHRA 4XILA 3NL1A 4PIXA 5FZOB 2PAKA 2JDHA 1KS4A 4JRAA 1SBFA 2BNNA 3T2TA 4AVTA 4HMZA 1CPNA 1LB2A 2A70A 3U75A 1DYOA 3MDPA 2JICA 4JDOA 5L9BA 5LA9A 4CDWA 1S0FA 4QQLA 1RUJ2 4L0PA 2D6NA 4G9SB 2D7FA 4CZSA 1OH3A 2W46A 4OQ8A 2AEYA 4XABA 1ASJ1 2A6WA 3ORJA 1RGSA 4Q0QA 3ZFGB 1OLQA 5ABJA 2JECA 2R042 1GZCA 4MGQA 5J98B 4WZFA 4AE2A 2ZGRA 1K42A 2C5DA 4PCRA 4QD2A 4Q4W2 1QJX1 3DKQA 4RN5A 3E97A 2MEV1 1PO21 3EBRA 2WS93 4Q1PA 4CCNA 1P8JA 2A3XA 3AP5A 4JHZA 1YUDA 2X5IC 4CEWB 1YC61 3Q8FA 4QX5A 5I0DA 5KXDA 1VRBA 2OXBA 1W9SA 4KWKA 4IGOA 4PQQA 1YQ5A 5DG2A 3WNLA 2BOJA 4LK6A 1D2SA 5FREA 5EJZB 3P5BA 1WW6A 3PMSA 4CTEA 5A1LA 4MXWB 2GN3A 4QHOA 1W9FA 1B35C 1XBFA 2RS51 5FMDA 3WINE 1OUXA 3O14A 4PDWA 3ZN5A 1J84A 2XJPA 4IEXA 2VQAA 2WA3A 1XSQA 4XJZA 3NAPC 5SV5A 3RZLA 2GZWA 1JTZX 2ZX3A 1ZBE2 4BYYA 4QPGB 1URXA 5CFCA 1J1LA 5FUNA 5LBBA 1QXRA 2IZWA 3RSJA 1SHWB 4QQPA 1WW7A 3MFAA 1OA4A 1RHI2 4ARXA 1W2OA 4N53A 2J1EA 1VBE2 5FYYA 1ULEA 3O12A 1U5XA 2DCYA 2QUOA 3LKJA 5BY5A 3CJXA 3V0AA 4FOYA 1WZXA 3D4KA 4KU8A 4G4FA 4A3ZA 4QB2A 4Y1VA 4ZZ8A 1VRH1 2ARCA 2CY6A 1WCQA 1WCUA 3MO4A 1U5YA 1CAXA 3AXEA 4RGGA 1BJQA 3K2OA 1AR82 1VBD2 3NJYA 4QX3A 2DVGA 3GHNA 4XW3A 1C1LA 3ZN6B 1F4AA 1NKGA 3J7HA 3NNGA 2XWBB 2KA3A 1OUSA 3DEMA 2RMU1 4I01A 5JPNB 4HONA 4FFHA 5DPNA 2YY1A 5F5CA 3VBUA 2CGPA 3C7GA 4QXKA 1GZ9A 3ZXFA 3H8RA 2WZ8A 4L97A 2DTYA 1J1TA 1OXCA 2O8QA 2VXRA 4WM7A 4JGZB 2E26A 1LHWA 4IEPA 2R30A 3WDXA 1AX1A 1RL3A 2CU5A 4GWIA 1HRI3 3LSEA 3PUSA 5FZ7A 5SV8A 2QQNA 4HKOA 3S57A 1VBB2 4AVCA 4CDUB 2Q1FA 3CO2A 3DF0A 1TQ5A 2BW8A 4QPWA 2C24A 3E5XA 2WZPP 3H7JA 4JKLA 4B8EA 4YZ5A
chains in the Genus database with same CATH topology
4F8AA 1PO13 2VOVA 1S0JA 5KXCA 2A3YA 2A75A 3WZ1A 4C1WA 2HWB3 2MNGA 3VBOB 3PTYA 1BYHA 4MVTA 3NV3A 5K0UA 4S2GA 1RJ7A 2I2SA 4ISRA 2HYKA 3VBRC 3OBTA 5BNQA 3S7IA 5BNNA 5C9AB 5L7OA 1RITA 1YFXA 2VY0A 4ITCA 3TB0A 2D3PA 3FBYA 4BCUA 2XKPA 2WWSA 1DQ2A 1C4RA 3MGUA 4N7IA 5I0UA 3IMNA 5DUWA 2WZR1 3RJRA 2RS33 4J1XA 3EHKA 2D5HA 1CX4A 4XBNA 1U5ZA 1WW5A 2IXJA 5JOZA 4IQPA 1TME1 4FTBA 1FXZA 3FBMA 1DF0A 1GR3A 3V56A 5I93A 5DZEA 4RS5C 2K9ZA 2OPKA 3ZXKA 4YLZA 1XNBA 4N43A 4JCKA 2UURA 4LTAA 1OHFA 5BNOA 1OOPB 4QGMA 1LGBA 1M06G 3GBWA 2FMDA 4PQ9A 1O4ZA 1H8TA 1RUC1 3M3CA 3NJZA 1JH5A 1QJX2 2PLV3 4JRLA 1AYN3 1PO22 1X33A 1ZZ8A 1J3RA 3N4MA 4UBHA 1NE4A 1C57A 2JXAA 4ISQA 2KM2A 5F5QA 4LLFA 2V73A 4D7SA 4Q4X3 1CGPA 4MH0E 1L3JA 4Y1ZA 2ZGKA 1DQ0A 1LECA 2VOKA 3ZXDA 2RS52 5CFDA 2ZA9A 4FQ4A 4COWA 1VB2A 4Y22A 3WUCA 4RHV2 5AC93 2HEVF 4OI2A 2HWE3 3GALA 1BEV1 4GMP1 4LLOA 5D8AA 4K3UA 1K5MB 1B35B 2GU9A 3JZVA 4GKYA 2ARXA 1CESA 1VBA3 1WLWA 2D43A 1XRUA 4B4PA 4FPHA 4P14A 2R071 2VGDA 1DU3D 3JB4C 3ETQA 2QDNA 1IOAA 2JG9B 4B29A 4W6WA 2NP0A 4L2NA 3LGRA 4KG8A 1H8VA 2HWC1 4AFMA 1F5JA 3MIEA 1CAVB 2RMU2 4I3GA 1DGWX 4ZU5A 2EVXA 1YLLA 3I59B 1SMVA 4Q4V1 1V6MA 1S0BA 1AR72 4AEKA 1BKZA 3M8LA 4AYUA 1V6NA 1QQP3 3NW4A 4OHWA 4GALA 3AP7A 2D6KA 3MLKA 4QPIA 1BMV1 2GNMA 2D6LX 2YZ4A 2HWF1 5LRRA 3VHRA 2G4IA 3PJQA 4IEUA 4ES8A 1FATA 3A0NA 3WHTA 2GC3A 3VDDB 5A32B 2AGSA 3PVBB 3AYEA 4Y24A 3KGLA 4J1WA 3WY6A 2OW4A 1LTEA 1W6QB 5AFBA 5GKAC 5CB7A 2ZKNA 5FLHA 1YNAA 5HCBA 2CYFA 3B3QE 3GZAA 1W6NA 4AEDA 1VB4A 3ILNA 4ASLA 4RD7A 2OZ6A 2WZR2 1AF9A 3Q9OA 5T5JA 1C3HA 1PVC1 1BVP1 3H9AA 1RUH3 4INDA 2H0BA 3B69A 4N7UA 1TME2 1LOBA 3FJSA 3AFGA 3K51A 4XFBA 4XPVA 3TN91 2PYTA 1XU1A 1WCKA 2TBVA 2Q5TA 4RA0A 1QOOA 5T50A 3VGIA 1W6PB 3ST7A 4AVBA 5FLJA 4P9YA 1DGWA 1HLCA 1VP6A 4KG0A 1LOCA 1TNFA 4BM8A 1SLTA 2BNMA 4RS5B 2ZAHA 3GHMA 4LBNA 1H0BA 1J3PA 2HWD2 1SBEA 3OF1A 3U07A 2CTVA 2ZAAA 4MGYE 1NE6A 4HN1A 1CAUB 3BODA 4YSFA 1UZZA 1QNYA 1UL9A 2A3WA 3VBRA 5FOJB 2GN7A 4L11A 4YGCA 5E89A 3SH4A 1AX0A 3P3NA 4XETA 4KL1A 5JPMB 2ZX1A 2WFF3 3MICA 2CGNA 1UX6A 4YW1A 1NLRA 1J59A 3MZHA 1BEV2 2ZBJA 5FFOC 2Z42A 5GM0A 5FQ0A 3OBRA 2JEMA 4PLNA 4Q4Y3 3THPA 4BMEA 2R1DA 5C8WA 1SBDA 3ZIXA 4DPNA 1H2MA 5C8CC 2ERFA 1FYUA 5JIAA 2DVFA 3R4UA 4S2FA 4EN9B 3UKTA 4AFBA 1U12A 3FFZA 3QH7A 1R081 2XVGA 3MW3A 2GMPA 4WM8A 3IPVB 3SCGA 4AI8A 4K1ZA 2VMGA 2VW1A 1SLLA 1OFSA 5I8SA 3WP4A 2BNOA 1WCSA 2BYVE 3L2HA 2ZX4A 4LUMA 5GZCA 2VNOA 2CWSA 2Y26A 1NOVA 3IIAA 1V6LA 1WW4A 4GWNA 4PLMA 3WDUA 4HSLA 5C4WC 2R49A 1YXWA 3ZXEA 2WSUA 1I5ZA 1VLNA 3WG3A 2SLIA 4S2DA 1NA1A 1V9U3 1REDA 1RUD1 4NVPA 1CN1A 1C5IA 3N3HA 3ZMNA 1HXS1 2ZZJA 1BMV2 2XBO3 1D4M1 4GH4B 2B45X 2HWF2 1D4VB 1A3KA 1WD3A 3ZN4A 4ATEA 4NO4A 3JBG3 1Y43B 2Y38A 4M01A 4LA2A 1AR91 1QDCA 3W58A 4YVSA 3LAGA 2PHFA 1H1AA 4XJ8A 1OSGA 4OI1A 2DCJA 3NWKA 1OA3A 1WGPA 2LM3A 2WC2A 1ZZ6A 2XLAA 1JXNA 1TMF3 2DFBA 4CDQC 5LK5A 1EAH1 1XQNA 2WT1A 1CJPA 4KU7A 4Y1YA 4QQ2A 1PVC2 2WS91 1MACA 1PMIA 4AHWA 3FHIB 2RR13 1LRHA 1ULDA 2DUPA 3AP4A 2WT2A 3TN92 1PIV3 2UWCA 4DFSA 1EV13 3WT3A 3R6SA 3CL1A 3PNAA 4IXLA 3NV4A 3ASIA 5GLUA 4S2HA 4CRQA 4P5HA 4I0AA 4XBLA 1HW5A 5JSRA 5IK4A 1YI9A 4HKLA 1ND3B 2R6QA 3ZFGC 1ULCA 1WMDA 4RSUA 4WVMB 5FO8B 1N1YA 1LHNA 3OGJA 2R063 4LE3A 4LT5A 1POV3 4XQ4A 3FLTA 5D1IA 1ENRA 4M3CB 4NR1A 4D94A 1AR61 1O91A 3R05A 4UW5A 1VBC3 4I0BA 1MEC1 4JVAA 4M0NA 2KXLA 4LBQD 2D6MA 2YV8A 4Z07A 1W6OB 4ORFA 3WDVA 2RHPA 5GZFA 3AB0A 3JCIA 4ASMB 2WIIB 3J8F3 4QHBA 3MPPG 5LK7B 1RUI1 2XKOA 4BA6A 2QFEA 1AYM2 1ZRDA 3O0XA 3U4XA 3JUUA 4LEJA 5DDJ3 3USUB 1AXZA 3VBSC 3R4DB 4MSVA 1EPWA 1ZRCA 3WVJA 1COV3 1W2UA 1HRI1 5BNPA 3RWNA 2GC0A 4AWDA 3RQ0A 4AHXA 1LJ7A 5KHIA 1R082 1G86A 1KITA 4HFSA 1PO11 5C8CB 4BQ1A 3EO6A 3WG1A 4OHZA 2HWB1 4NHLA 3AJZA 2WA4A 4LO4B 4K1YA 5E88A 4EN6B 3KT4A 2GALA 3B94A 3ES1A 4AI1A 4KBBA 2ZGNA 4OHXA 3ZXGA 3OY8A 1MR5A 2VOXA 2RS31 3T1MA 2AREA 1RUD2 1BXHA 4LBKA 4EWEA 4MUVA 4H3WA 2E7QA 1HXS2 4JGZC 1S1AA 4XFIA 3PVEA 4BOWA 2ES3A 5ACA3 3T1LA 2RS13 4CEYA 4YM1A 4YG3A 5HI0A 1FI2A 2BQPA 3CJIC 4PJYA 1WLCA 1MQTC 1SCSA 1AR92 2WKKA 2YUEA 5GLVA 3D0SA 2Z2SB 1KDMA 1RUE3 2GH8A 3VZMA 4NHKA 4IEWA 3IT8A 4XDQA 2R0FA 1O4TA 3VBOC 1UMZA 3OGGA 1OKQA 1VALA 1Y3TA 2PELA 2X53S 2UY9A 1YIFA 1FT9A 3IDEA 1ZRFA 2ZMNA 4TSVA 4COVA 3ZIWA 2QZ2A 2QE3A 2VVDA 4E2GA 4AGGA 4Z1VA 3PMEA 1EAH2 2PLV1 3KGZA 4YVWA 4XZPA 1AYN1 4GULA 3VV1A 3OYWB 1UU4A 1ZBA2 4XF0A 2CV6A 1RVF2 2WNVC 4U36A 3KLSA 3JQWA 4LBLA 3VKFC 2OZJA 1XE7A 1YO8A 4KH9A 4HVOA 4FP2A 5JI7A 3RI8A 3H3UA 3QACA 2W0XA 3AKQA 3WLUA 4AFAA 1QJU1 3TNPB 4Y1XA 3WV6A 4XXAA 1H1MA 2JG8A 4R9BA 3MPBA 4QQHA 4CDWB 1FOD2 4MZUA 2DF7A 1WUVA 3AK0A 2QZ3A 2BEOA 1H2LA 4LBQA 2D40A 5J48A 4OHVA 5ABJB 1VBA1 3N7MA 3AMMA 1Q56A 4Y20A 3I54A 1OA2A 1GSLA 3OJBA 4XFHA 5J3UA 4CDXA 4U2AA 1DLLA 1QJY1 1S0EA 4QMAA 2PHTA 2TEPA 4Y5Z0 1NQJA 5T55A 4WV8A 3ENRA 3IM0A 1AR62 2EXKA 1MEC2 3N7JA 4Y26A 3A4UA 4W65A 1Y9QA 5BV6A 4CDQA 2EAKA 5J7MA 3WD5A 4AHYA 3QD6A 4RGAA 4CP2A 5FBZA 3V0BB 2Z5WA 4BE3A 1RUI2 1YIPA 1LCLA 2IXIA 5GALA 5JAXA 2ENRA 3FLPA 3HIFA 5J09A 2ZJCA 4L9BA 4OUSA 3UJQA 2DV9A 1RMU3 1QQP1 1V6KA 4YZ1A 4QU2A 2VECA 1K5MC 3SCFA 1X7NA 3D0JA 4F3JA 4I02A 5A33B 4LNVA 4AI2A 1GBGA 3VN4A 1NXD1 3ATGA 2PHDA 1PO12 5JZGA 2D6PA 1RUG3 4YFZA 4YZ4A 5L19A 2BWCA 3VBSB 1PGL2 1IQAA 3MLJA 2VUJA 2K0GA 2JG9C 1CAXB 1R1ZA 5JLVA 1U0AA 2D6OX 3DUIA 1DQ5A 2BFUS 4L99A 4H14A 3ILRA 2G9GA 1RUF3 2AENA 5FAXA 1HX6A 3GZUC 2QVSB 1MS3A 2Y0OA 3EXUA 4NOTA 4CEWA 3VBUB 4MGIE 2LUWA 2YYOA 4UBGA 4HK8A 1RJ8A 1M4WA 1RUH1 2DTWA 4GMP0 3VKNA 1NLSA 3KCXA 4MXWA 1FNYA 4FTSA 2VW2A 2FQPA 2YXSA 2QCSB 3AMQA 3POSA 1TNRA 3ZVXA 2XHKA 4X6RB 4F7ZA 4QPGA 1J3QA 5LEKA 1QH6A 3VDDC 4K6BA 3ZFFC 2UY8A 2BGCA 3GBFA 1MS8A 3UV9A 4Q29A 2Q30A 3AKPA 1LOFC 2B39A 2R043 3M3IA 5K0UB 3CLPA 1FV3A 2VVEA 3CJIB 5H9RA 5BYNA 1RC6A 1N1VA 3MIBA 1MQTB 3W59A 4Q4W3 1XXNA 2FBEA 3HT2A 4XHXA 4KQ7A 2XH6A 1R093 2IFWA 2NPIA 5JMCA 2XLGA 4ES9A 3IWZA 3MF6A 2O0OA 1PK6C 2CAUA 2TNFA 4E4ZA 2Q1MA 4G3YC 1MVEA 1GNHA 4LE4A 4SLIA 2WNUC 4R8HA 2AYHA 3NKGA 3PJYA 2WNVB 3MW2A 1QJU2 1ZBE3 4FPYA 3AJYA 3ZMOA 4FPJA 3FZ3A 3DN7A 2E6VA 1VAMA 3RYRA 4Q4Y1 4AQ6A 1G9DA 1UW8A 1H2NA 1QY4A 5KBFA 4FBFA 2P17A 4M0HA 1VBA2 4FPFA 2O1QA 1VBE3 5I8TA 1GV9A 3AZXA 1XYNA 1NCRC 4O9EA 4P9IA 4YW3A 1GQHA 4CDUA 1QJY2 4HZFA 3AFKA 4MXVA 1XNKA 4DS0A 4YM0A 3APBA 5GJ6A 4A7KA 1YWKA 2DUQA 1ASJ2 4P9WA 4GXLA 1AR83 1QU0A 1VBD3 4XXPA 3IDBB 1ZX5A 2ZABA 3FX3A 5JI9A 3TWIA 5FDBA 1SLBA 3AMHA 1DQ4A 5C9AA 1TEIA 4NWWA 1IKPA 3ZSKA 4O9GA 2MEV2 3D8CA 3HQXA 4GQ7A 3TAYA 4XHBA 5C6CA 5CADA 1KJRA 1WMEA 3O5SA 2PAMA 3I4IA 1MS4A 1FMD3 1N47A 1QQP2 3BU7A 1QXJA 4D7YA 2AZ5A 2ZMLA 2XBO1 5H9QA 1UIKA 2DUOA 4FPEA 3ZFEB 1A6CA 2NQYA 3JBG1 4AVAA 3WP5A 3GYDA 1CVNA 3U10A 1OOPA 2ZGUA 5KHHA 3VLBB 4E4DX 2XJUA 3L9JT 1LR5A 3VBFB 2ZS6B 4A2UA 2R1BA 4L8QA 4COZA 5I8YA 1O4YA 4HETA 3SMHA 5I0SA 1TMF1 4QM9A 1S0GA 2H6BA 1FPN3 4AI0A 2Q0AA 5FCCA 1VRH2 4FOQA 1ZZBA 3M3EA 4C0BA 1DQ6A 4I30A 4ZU4A 3AP9A 1WLTA 4R9AA 1AJKA 1UU6A 2RR11 1I3HA 4QPIB 1PIV1 2YHJA 4DY3A 3DV8A 2VNGA 4GH4C 1EV11 4JDNA 1O3SA 3B02A 5A3LA 2X5IA 4WBBA 4RQPB 2OYZA 4K21A 2R16A 4Y1UA 1W0PA 2YGLA 4NWVA 3WW4A 1V6OA 1ZREA 1RTVA 3KSCA 3P3PA 3WP6A 1K5MA 1B35A 5DUVA 1DHKB 3H3ZA 4FCAA 1KD7A 1YJKA 4XFCA 4MV2A 3TOJA 5TSWA 3NAPA 1QH7A 3HT1A 1A78A 1NCQC 2BFUL 4CYDA 2EAAA 1PNFA 3K48A 4KGGA 3ZFFB 1PO23 1ENQA 2P37A 3HR9A 3VZKA 1POV1 2JG9A 3WQ0A 1SLAA 4P9JA 1LGNA 5JOXA 1OPOA 3O7OA 4K40A 1X82A 1QJZA 2DVAA 1VBC1 3IBMA 3M4FA 2IFRA 1XE8A 1CAVA 2D97A 1VIWB 2R0HA 4RHV3 3J8F1 2ET1A 4PIYA 4HVQA 1ZZCA 4HPKB 3OD4A 5T52A 1H2KA 2ZOEB 3D6EA 4OI0A 1E57A 4QT6A 1PK6B 5K9YA 5CG8A 1FX5A 5DDJ1 4PLOA 2WQ4A 1EP0A 2WNUB 1VAKA 1YRZA 1ND3C 1Y7BA 3B01A 4TLFA 5BUVA 3VDDA 1OQ1A 5A32A 1QMJA 3G6JB 1AVBA 1AL0G 1CIWA 1ND2C 1LOFA 5T54A 4HVRA 1N1TA 3KT7A 4BLIA 1CONA 2WL1A 2QNKA 3ZSLA 4BWOA 1NCRB 1W6MB 4FOVA 3E6DA 2B46X 3VKOA 4YGEA 2VMIA 2W39A 1RUC2 2XJTA 2DU1A 1F2NA 4FPOB 4OULA 1QOTA 2AH2A 4XFGA 3VBHC 5JCTA 4HL0A 3VKLA 4XTPA 1C28A 2AUYA 1AR73 3L2YA 3AM2A 1KFXL 1AL23 3TRSB 5GLZA 4EWAA 1PZ9A 1GYKA 4A3XA 1B09A 1XNDA 2VNRA 3N7LA 2YROA 3PVNA 4F83A 3BTAA 2RS11 1W6PA 3OCPA 1DZRA 5CAZA 1RUE1 1JYIA 1H4HA 3SCHA 3ZXLA 2A73B 4EWDA 1JUIA 4RS5A 5LEJA 5FOBB 3EQEA 3CF6E 1S0CA 2XB6C 1IZ3A 3RYPA 2ZCWA 2JENA 1IGOA 1HDKA 2R072 2CL2A 2A7AA 5CA6A 3S30A 2P2KA 2VW0A 4RR3C 1IPJA 5CG9A 1RUNA 4NN0A 3FLRA 2RR12 1TME3 2CNAA 2HWC2 2BPA2 4IV3C 1ALYA 3UL2A 2XL7A 3ZPYA 4B4QA 5DZFA 4GB33 4Q4V2 3WW1A 1QXPA 3AKTA 4C90A 5F6LB 4XMIA 2YPJA 1JW6A 1N3PA 2IWGB 4AFDA 1PM7A 4AEMA 1DGRN 5FRAA 3MIGA 4IV1C 1MS9A 1SCRA 5KC5A 3WW2A 1OLRA 3U11A 3O0VA 2JE9A 4EROA 2I45A 2HWD3 3TBDA 3X29B 1UPIA 3IPVA 1GKBA 4PF5A 4XBQA 4DZGA 3H1MA 4YM2A 4B7EA 5FMOS 5F1RA 4MYEA 1VBC2 5IK8A 1GQGA 4LBJA 1AXKA 4SBVA 1NCQB 4CP0A 4R9DA 2Q4SA 2P3JA 2VU9A 1R1A3 3POYA 2VUAA 4XYXA 1ZRRA 4GKXA 1MZ6A 3GF6A 1YCIA 1BEV3 3AZWA 4XIKA 3RPQA 4DOUA 1RINA 2JX9A 1O3TA 1UKGA 4XIOA 2OIIA 3IDCB 5DDJ2 1EPZA 5L73A 3ZO0B 4CDWC 4Z82A 5E16A 2XUMA 3I7DA 4XJWA 5ABJC 1HQWA 1REFA 1D0HA 3BCWA 2PHXA 2ZGTA 3ALQA 4TWTA 1OQDA 1AUYA 3E5UA 1IPKA 1NY71 4EJRA 1PGW1 2DCTA 5JSOA 2XJRA 4XTMA 1QDOA 2RE9A 1GZWB 3LA3A 1UD1A 2GDFA 1BQPA 3NV1A 1A8MA 4LBMA 1CAWB 4EV0A 2C1FA 4XF4A 3RRDA 3UKNA 1KFUL 1V6JA 1NQDA 1ND2B 3OPZA 3RZZA 4R4ZA 4MGZE 1HQLA 2F4PA 5DXDA 1T6GC 4QQOA 3TYJA 4AK3A 2ZHKA 2PAEA 5CFCC 2I07B 3JD73 3VBHB 1X36A 3RJ2X 2HWF3 4Q2FA 1O3RA 1X8MA 4XFAA 4N9HA 4OLLA 4LULA 3QH6A 2BUKA 4N53C 1Z78A 3WX5A 3WDTA 1JYCA 3HN1A 1WCDJ 2D5FA 1RUE2 2PA7A 3ELNA 4NHMA 4TYSA 4YW5A 3URFA 2XPJA 1LOAA 4AF9A 4AHZA 2R041 4WVMA 1Q5OA 4WVWA 4R4XA 4Q0VA 1KS5A 4Q4W1 3NV2A 4M3CA 3H1YA 3B9CA 5AVAA 1Z7S3 3MEPA 3H50A 1R091 3LWCA 5BPXA 3VBUC 1C8M3 1HIXA 1LHVA 1W6OA 1MZ5A 3DL3A 4WM7C 1IKQA 5FTTC 5HBAA 4BMBA 4RR3B 3UKVA 3HMYA 2YDEA 2RM23 2ZKLA 1HRV3 3H8UA 4IERA 3WCSA 1YYNA 2VVFA 1ZBE1 5I91A 3AKRA 3B00A 4COUA 5FPXA 3USUA 1HKDA 4IV3B 3H7YA 2IXKA 1IS3A 4K20A 1D4M2 4HT1T 2DCZA 4XOGA 3ZDSA 2W08A 4R9CA 5K0UC 3NKTA 3SXWA 1LOEA 2B9UA 3ECQA 4P9GA 1ENXA 5C8CA 3WDWA 3GBGA 4AW7A 4IV1B 2EXIA 2B8MA 4TZDA 2VH9A 4AI3A 1H9WA 2GSYA 2E51A 5T5LA 4RFT0 2JE7A 3BIWE 3DPRB 2V5YA 3KMHA 4Q0PA 4I3PA 1WMFA 4E2SA 4X8NA 4EN8B 3ZSMA 5KHKA 3B93A 4AQ2A 2DCKA 3VZJA 2WS92 2UYAA 2GH2A 5GLWA 1GFF2 1AYM3 1MS0A 3H1WA 4N43C 3KQRA 4H7LA 2JG8B 1PHMA 2GMEA 2RJKA 1FMD1 3KCCA 2B42B 3LA7A 4IEYA 1WD4A 4Q4X1 5JSPA 2EXHA 3AX4A 3WG2A 5C4WA 4IEOA 4LUKA 4PBPA 4PIZA 4AEJA 4JGYB 5AC91 2ARBA 2DVDA 5JR7B 1DYKA 2LALA 2HWE1 1UKRA 4MGKE 4YARA 1NY72 2WT0A 2ZACA 4Q8LA 1PGW2 3M70A 2X29A 2VOWA 3IKWA 1CR7A 3SNMA 1DG6A 4LO7A 1RIRA 1S0DA 5FMOL 4DQAA 1KQRA 1O7FA 2V09A 3B7MA 5AFEA 4AQTA 5GZDA 4QGNA 5J37A 3FWEA 3QLQA 4AG4A 3HAGA 1ZYBA 3ZYJB 2GC1A 3OYWA 4YYOA 1FPN1 2N7GA 1BBT3 1XYPA 4ATFA 3WR0A 4MLOA 3MI8A 1W39A 2OUHA 1PZ7A 2ZZQA 4FAGA 3M7AA 4K7JA 1RUD3 3CNAA 3CEWA 1HXS3 1U5IA 2ZGLA 5D8AC 2X8KA 3HBZA 1YHFA 3WCRA 3LCPA 1OQEA 5J36A 4PDWB 3VUOA 3LB9A 1S2BA 5EZWA 3WW3A 1S2KA 1AR93 2YGMA 3ZFEC 1Q43A 2EF6A 1PGSA 4FXKB 2BTVC 2TUNA 2XVKA 5CFCB 5JZGB 4OVEA 1UPSA 1GNZA 1SLCA 3WDYA 5EYYA 2NZ9A 2CWMA 3KD4A 3ZYIB 3VBFC 4GA9A 1ULFA 1HRI2 4FPGA 3GZTB 4N53B 4IEQA 2UU8A 3WOGA 3THTA 3J4UH 2P3IA 3FFQA 3AYCA 3POWA 4E9KA 3V0AB 1EAH3 3NVCA 1AXYA 4C1XA 2FZ1A 4YZ2A 4YG0A 1ZBA3 3SLIA 1RVF3 4AVSA 1R092 2HWB2 3ZFGA 4Z92B 3VZNA 3J26N 5EFUA 1DDLA 2PQQA 3WQ1A 1I1EA 1UCXA 2NN8A 3QBQA 4IL7A 1ULGA 1HV0A 2GNBA 3LSDA 4QPIC 1UIJA 3V0BA 4RHV1 2IXHA 1G8WA 3IN9A 2RS32 1DQ1A 5I0RA 4RQPC 3I8TA 4R52A 4Z8BA 5KWRA 5K7PA 2BVVA 1FOD3 5JVVA 5EJ3A 5CIRA 4Q0SA 4WM7B 5KHGA 1LHOA 5LRSA 4HK9A 4N9IA 5FO7B 5A33A 2DWRA 5EXOA 1TE1B 5JDBA 1GICA 3RNSA 4AEDC 1NXMA 2E9QA 1V70A 2IXCA 4D7TA 3ES4A 3ZXJA 3VBSA 3WNXA 4XMAA 1RUJ3 1WBLA 2EIGA 4JAAA 1AR63 2ZGMA 3FMGA 1MEC3 2SBAA 4LHNA 1F8VA 4MX3A 1C1FA 2A6VA 2MHFA 3M2MA 2NMOA 5KXBA 2WJSA 5BNNB 5L7OB 4FPKA 2PLV2 1LU1A 1AYN2 4B3NA 4YNIA 1RUI3 2EA7A 4Y4YA 1AR71 4XF9A 4LBOA 3ZYRA 1I9RA 2ILMA 3C2UA 3AP6A 4OFGA 1AL21 3ZN6A 1FMD2 4Q4X2 1MZEA 2FMYA 1REEA 1KRIA 5AC92 2WFF1 3ME2A 2HWE2 4N43B 1WBFA 1DGLA 4JGZA 1D0GA 1POV0 3PHMA 4YGBA 1H30A 2B5HA 4Q26A 5BNOB 3FC0A 2A6XA 3BALA 3VKMA 1RHI3 2ZGSA 1N3QA 3CJIA 4YZ3A 3G7DA 4FO9A 5HCFA 4W6YA 2WFPA 1MQTA 5KXEA 5JWPA 1SEFA 1H8TB 4Q0UA 4DINB 1FPN2 2BBVA 2XG3A 3VBOA 5GZEA 3S0MA 1JBCA 5IK5A 1ZM1A 5E1RA 1XNCA 3D82A 4LO5B 1S55A 3SH5A 4LR4A 2YMZA 5CFDB 4FXGB 4QM8A 1W0OA 2WNVA 1SQ4A 4Y22B 1RUOA 4RL7A 2A5ZA 1GANA 2XGXA 2XJVA 4LHKA 4GB31 4XF3A 1S0IA 1SFYA 2O8OA 5D8AB 1V9U1 2DU0A 4WM8C 2H0VA 4X6QB 4COYA 3VL9A 3RMXA 1VBB3 1DBNA 3DGTA 2HWD1 5JOYA 4Q8KA 2ZPXA 3ZYPA 2F6BA 5DG1A 3N7KA 4V1PA 2BWAA 4YFWA 3RG0A 1N3OA 2C0ZA 2PHLA 5H9PA 1N1SA 3KM5A 4KWLA 3WXPA 1NA1C 4UW3A 3SH3A 3LA2A 1R1A1 1KJLA 1IS5A 1BZWA 2R32A 5FPZA 2ETEA 4Z2WA 2X5IB 3ILFA 1JOJA 1QJU3 1DFQA 4N90A 3WP3A 1G6NA 1CJDA 1YI7A 4M00A 4KWJA 1RUH2 3EJKA 2PHRA 2NLRA 2ZX2A 4XQWA 1HQNA 1F9KA 4YVSC 1G9CA 4IEZA 2ZTNA 4DRRA 2VQ0A 2XL9A 3NAPB 3MIDA 2WINB 3ZFEA 4B4RA 1QJY3 2OA2A 4FTEA 2E7TA 5HCAA 4FSJA 2HJIA 4GIQA 2Y0IA 3VBFA 2Z79A 1ASJ3 1O5LA 5DUUA 1AZDA 5EYXA 2VMHA 5CBLA 1G9BA 3RMYA 1W6NB 4X8PA 4AEDB 1G9FA 3E6CC 3GNEA 3KT1A 4QGLA 2LTNA 3FUQA 1QJX3 2MPFA 2R061 1MVQA 2MEV3 2CAVA 1H1IA 4IESA 2G9FA 3D5OA 2I74A 1LENA 2WQZC 3MW4A 5H9SA 1C8NA 1AL22 3ACLA 4W6XA 3U0ZA 2A71A 1IHMA 1A8DA 3JD71 2RS53 4URTA 2C9AA 4XEZA 1LEMA 1YFUA 2EALA 4E2QA 3AZYA 2WSVA 3I59A 2WFF2 4RQPA 1H4GA 3VL8A 2NM1A 3AXDA 1SACA 5FLIA 4A7YA 2QDRA 3PLQA 2UWAA 3KB5A 4JC1A 4Q4Y2 2E63A 2VG9A 3BB6A 4I2OA 1V6IA 4UW6A 1COV1 3MFCA 3UK9A 2DURA 5JOWA 1MS5A 3W9AA 1ZZ9A 4XJUA 3ZFFA 1QOSA 1D2QA 1OI6A 5K8SA 2B7YA 1VRH3 1MZFA 1W6QA 1NG0A 1Z7S1 3AYAA 2OVUA 2K2SA 2Q1ZB 2NMNA 4HKWA 3INAA 3AMNA 4HN0A 3KZ4C 3VBRB 4DB5A 1C8M1 4QPYA 2XJQA 2D44A 3WQ7A 3JB8A 1F5FA 4YG6A 5J96B 2HKXA 2RMU3 3I2DA 4YW2A 4FVVA 1IS4A 4IETA 4XJ9A 2WNEA 4LO8A 2RM21 4GB32 1HRV1 4HPKA 5BNPC 1PK6A 5FQ0B 5CU1A 4HBNA 1Q3EA 1V9U2 2JD4A 2XWJB 4JDMA 3VHOA 2WNUA 4P9LA 2VULA 5IUQA 4JQRA 2ET7A 2XBO2 4XE9A 3WG4A 4AQSA 1LU2A