4Z07A

Co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
260
structure length
260
Chain Sequence
SHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cGMP-dependent protein kinase 1
publication title Crystal Structure of PKG I:cGMP Complex Reveals a cGMP-Mediated Dimeric Interface that Facilitates cGMP-Induced Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 260
sequence length 260
chains with identical sequence C, E
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z07A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z07A01
1ZZ7A 4QXKA 4XF0A 2H0VA 2IXIA 4L2NA 4X6QB 4QX5A 1QWRA 5KHIA 3RYRA 1YFXA 2D93A 4MV2A 3DN7A 1YWKA 2BEOA 3NSTA 1RUOA 2F4PA 2PQQA 2XHKA 5I0UA 3MZHA 1LRHA 4E2SA 2XL9A 5J48A 3PLQA 3UKNA 4LUMA 2D40A 2GC2A 2FMYA 3FFQA 1YUDA 5C6CA 2CAUA 3D82A 4XF3A 4KU7A 4EROA 4KWLA 2WC2A 4I3PA 4MGZE 3IDCB 1GQGA 2XKOA 3DL3A 1FI2A 3UKVA 2OYZA 2O8QA 2GZWA 4AQ6A 5FPZA 3SXWA 4Q0QA 3FJSA 3PVBB 4WBBA 5J7MA 2GU9A 2GAUA 2Q1ZB 3NKTA 4LA3A 2IXKA 3BPZA 2BNNA 4MGIE 4HMZA 3U0ZA 4E2GA 4O9EA 2XLAA 4E2QA 4NVPA 4XFBA 2XLFA 4I0BA 1NXMA 1ZVFA 3H3UA 3BCWA 4FAHA 1UD1A 3I54A 3E6CC 4MGKE 1CAXA 1JUHA 4ZU5A 5LRSA 4AVBA 3H1MA 3KGLA 2WFPA 3SHRA 1XE7A 3NVCA 3U11A 4LLOA 1OFNA 3FX3A 4F8AA 3VHRA 1ZZ8A 3ES4A 4F7ZA 4AVCA 3S0MA 3KGZA 5FLHA 5CADA 5J3UA 4EWAA 3S7IA 1DZRA 3LA7A 5D1IA 1ZRCA 1X82A 4MX3A 1OD5A 3JZVA 2IXLA 3IBMA 4X6RB 4XF1A 2PAMA 2Q0AA 3M70A 3H1YA 5I93A 3HQXA 1O3QA 5CVRA 3CEWA 1LB2A 3LWCA 4K8FA 4IEOA 3EJKA 3RDIA 4KL1A 1O4TA 1SEFA 3TNPB 3CJXA 4MZUA 4IEWA 1UIJA 3S7EA 5BY5A 3H7JA 5LEJA 4N9IA 5HI0A 2GH2A 3KCCA 5JCTA 4I0AA 4HVOA 2OA2A 1ZRDA 1ZNPA 3EHKA 3H1WA 4HSJA 3PNAA 4I2OA 3SMHA 1YFYA 5JR7B 2PAKA 4HZFA 3MDPA 1SQ4A 5FCCA 3OF1A 3E6BA 1O7FA 1J59A 2I45A 1J1LA 1O5LA 5C8WA 2BGCA 3C3VA 4I09A 4IEYA 3LA3A 1EPZA 2E9QA 4LEJA 4AXOA 1NE4A 1U12A 3I59A 1J58A 5FPXA 1O3RA 3ETQA 1ZX5A 5LRRA 4Q0PA 4BHPA 3GBFA 3RYKA 4IEXA 4HN1A 2PHDA 4L11A 3L2HA 5JAXA 2GC1A 3OTFA 1RTVA 4BYYA 1Q5OA 5KHGA 5AVPA 3ACLA 1RGSA 3G7DA 1NZCA 3D0SA 1CAWB 2PFWA 4LULA 3D0JA 1QXRA 2EAAA 4AVAA 4BIFA 2IXCA 3BB6A 1GQHA 4META 4IERA 4JVAA 4Q0SA 3NL1A 3OD0A 4PIXA 4Q29A 1O3SA 4H7LA 4XFFA 3DKWA 3ROUA 3GYDA 4HBNA 3HT1A 2CAVA 3RPQA 1RUNA 3QACA 3ES1A 5KHHA 5FDBA 1X7NA 5I0RA 5BPXA 5FQ0A 1ZZBA 4YNIA 3TNQA 1PMIA 2ZKLA 3NJZA 3BALA 2XLGA 4QM9A 3H7YA 4EWDA 2HKXA 2IXHA 1CAVA 3SCGA 3E5XA 2B8MA 1CGPA 1Y3TA 1CX4A 2Y0OA 1FXZA 2PTMA 5JSRA 4XFAA 4Z82A 2PYTA 4YARA 1L3JA 4R52A 1NYWA 2K9ZA 3E5QA 4QGMA 4XFIA 4XF4A 1CAUA 1VJ2A 4IEQA 1J3RA 1OMIA 4PIYA 4QGLA 5I0SA 2B9UA 2XKPA 4HN0A 3RYPA 3O14A 1I5ZA 1Y9QA 1CAXB 1ZZ6A 3CF6E 4MGYE 1X8MA 4JV4A 3E6DA 2DCTA 1EY2A 1PM7A 2XL7A 4HVQA 4IETA 1IPKA 2FQPA 4XETA 1O3TA 2ATFA 5EFUA 4TLFA 4YYOA 3NW4A 1EYBA 5BV6A 1O5UA 1ZZ9A 3BU7A 3DV8A 4Q0VA 4UBGA 4JTOA 3ELNA 4WZCA 2EA7A 5K8SA 5JSPA 3MPBA 1XE8A 2OPKA 4OLLA 2K0GA 2UYAA 3WW2A 2C0ZA 4MUVA 4JTNA 2HJIA 4IEPA 2Z2SB 2CGPA 2ET1A 4D7TA 2P17A 1WGPA 1NE6A 2Q4SA 4AQ2A 3N4MA 2GC3A 2PAEA 1Q43A 1OI6A 3UKTA 1DZTA 4O9GA 3FZ3A 4KWKA 4HVRA 3FWEA 3E97A 3ST7A 3U10A 2D5HA 2QCSB 4I01A 2BNOA 1TQ5A 2IXJA 4B29A 1RC6A 1ZZCA 3H3ZA 1FT9A 2QJVA 4IEVA 5KHKA 1H1MA 1WA4A 2QDRA 4KWJA 4UXAA 1CAWA 1EP0A 4ONUA 3EQEA 4QMAA 1ZRRA 4LTAA 2BYVE 4RD7A 3IWZA 3CL1A 4PIZA 5I8YA 3IDBB 5I8TA 3KSCA 2VQAA 3IIAA 2QNKA 3CO2A 4ZU4A 2MNGA 3I59B 3LAGA 4WVZA 1V70A 2BNMA 3OCPA 1G6NA 4HLTA 4OFGA 3FE5A 2Q30A 1UPIA 3H50A 5FLJA 5I8SA 1UIKA 3KMHA 5I0TA 1YHFA 1DGRA 2V09A 4KU8A 2IC1A 4EWEA 2PA7A 1J3QA 5BXXA 4XFHA 5KBFA 2UY9A 3SCHA 1RL3A 5E16A 2VPVA 3EBRA 4LUKA 1UW8A 4UBHA 2OZJA 5CU1A 3QOPA 1IPJA 1YLLA 4LA2A 1LR5A 2O1QA 1X8EA 2PHLA 4A2UA 5LEKA 4D7SA 3ZDSA 2QVSB 5KHJA 1H1IA 1LKNA 1ZRFA 1WLTA 2Z69A 1UCXA 1HW5A 2OZ6A 4YRDA 4ZU7A 4DINB 2UYBA 2N7GA 3WW1A 3USSA 2MPFA 4QGNA 4HSLA 1QY4A 4XFCA 5FQ0B 2H6BA 4R8HA 3LA2A 3LOIA 2ETEA 4ORFA 2KXLA 5FLIA 1QXJA 3H8UA 3WW4A 4BH9A 4CYDA 1CAVB 5T3NA 5F1RA 5JSOA 3B02A 4Q0UA 3M3IA 4FT8A 4J1WA 3I7DA 3RZZA 1CAUB 4FAGA 2H6CA 2EVXA 1ZREA 5EZWA 2XGXA 3OGJA 5I91A 4EV0A 3SCFA 2ET7A 1VP6A 4I02A 3H9AA 4XFGA 1YFWA 4PJYA 2UY8A 4IESA 4Z07A 4FBFA 1J3PA 5E1RA 3CLPA 3R6SA 4MH0E 1I6XA 3RNSA 4XEZA 1DGWA 3EO6A 1XRUA 3E5UA 1Q3EA 1YFUA 2MHFA 4N9HA 3HT2A 4YSFA 2GC0A 2ZCWA 4J1XA 4IEUA 2D5FA 4IEZA 4QM8A 4GULA 5BUVA 4XF9A 3FHIB 1VR3A 2B5HA 3MYXA 2VECA 1SFNA 3WW3A 3HIFA 2CV6A 4P9GA 3LZZA
chains in the Genus database with same CATH superfamily
2DCYA 3NAPB 1JYXA 4FCAA 4QKBA 2FD8A 1US2A 4OHWA 3ZDVA 2AACA 2MEV1 1NCQB 2H0VA 3M8LA 3S5QA 2YY1A 2AC1A 4LO6B 2J1SA 3O1TA 3WT3A 4CDUA 1H8TB 4AFAA 2JX9A 4QX5A 4RR3B 2Q1MA 2YC2A 3CDZB 4FXGB 3RYRA 3J8F3 2VOVA 2I74A 5FIXA 2WS93 5E89A 3K4ZA 1JZ5A 1YWKA 2BEOA 3NNLA 3NSTA 4LNVA 1QQP2 3BGAA 3P1IA 4ISRA 2RS51 1GKBA 2P4EA 4E2SA 4DUVA 4B1LA 3PLQA 1BBT3 2Y0IA 1CX1A 2D7FA 4AK3A 1JYNA 2D40A 2GC2A 4H14A 1RUC2 4PF1A 2QQUA 5C6CA 2CAUA 4XF3A 4HKOA 4KU7A 1H8TC 4EROA 4CDQA 4RR3C 4KWLA 2JDZA 4NPLA 2EAKA 2F6BA 1AXZA 4YM1A 3MO4A 4IV3A 5FMOL 1GICA 4GD4A 4XYXA 5T5JA 4XCAA 4CVUA 2LW8A 1JYIA 4YG3A 1ALYA 2W2IA 3PUHA 2JDKA 3AL6A 3NV4A 3CMGA 5JIUA 2GU9A 2HWC1 2Q1ZB 2VZOA 5BNPA 1HB3A 4LA3A 1PIV1 4MGIE 3CIHA 1W8FA 1RUH2 4HMZA 4EE2A 2DUQA 3AKPA 1ZBE2 5FXWA 2CNAA 1WD3A 4LLFA 3TOJA 4A6OA 3U0ZA 5IK7A 3I3EA 1HV0A 1BVVA 4XTMA 4E2GA 4EN6B 1GZWB 3AP9A 3VZOA 3ZFFA 4RQPC 1C8M1 3JD71 1Z7S2 2GMPA 5FZHA 3J7NA 2ARCA 1FOD3 5M0TA 1ZVFA 3BCWA 1LJ7A 1ZA7A 3RZGA 1UD1A 3POGA 1ST8A 4MGKE 3CBNA 3S57A 3ZYRA 2LTNA 2ILMA 3GCWA 2VZUA 4LORA 5LY2A 4AVBA 3H1MA 4CDWA 2AR6A 3FL7A 3VKLA 4XPVA 2E63A 3ZFGA 2VXJA 5A3OA 3ACHA 3H0OA 1MS3A 3KS7A 1L7LA 3ZPOA 1UWWA 1C8NA 1XE0A 4GXLA 1PZ7A 1V6NA 4E4ZA 4QDQA 2QUOA 1UMIA 1NY72 1LGNA 3N35A 1W6MA 3USUB 3VHRA 4AVCA 4F7ZA 3RMXA 5J3UA 1F15A 2A70A 2V72A 2HWE1 3G6JB 1PVC3 5LBCA 1I3HA 1B35B 3THDA 1S2EA 1RXGA 1RUG2 1ODNA 1N47A 2JKBA 3DPRB 4NROA 1H2MA 3S7IA 2L9LA 5D1IA 2VY0A 5J36A 2FDJA 5FAXA 1X82A 1ZRCA 4XOGA 4R4ZA 1SACA 3IBMA 4JKKA 4A42A 4CSWA 4XF1A 3ZXLA 2YMZA 2ORZA 4NIIA 3B01A 1C1FA 5C4WA 2HLEA 3H1YA 5JUVA 2X29A 2V5YA 1VBA2 1YI7A 1R1ZA 3FMGA 1Y7BA 1CIYA 3WOGA 2JD9A 5AFEA 1AVBA 3O0VA 4GA9A 3DPRC 3CEWA 3NV1A 1FV3A 1U5ZA 1UZWA 2A6ZA 3LWCA 2XVKA 3VBUA 4K8FA 4IEOA 1IKQA 3TYJA 4LHNA 2ERFA 5FUNA 4DZGA 1NQDA 4CUCA 2WA4A 5A80A 5L36A 4KL1A 1JZ8A 4OCTA 3ZN5A 3AZVA 1FATA 1F4HA 5FYCA 1SEFA 1AYN2 2BDRA 3F95A 3VZKA 3KQ4B 4MZUA 1R1A2 4IEWA 4P02B 4EN8B 5IFPA 5BY5A 4G3YC 4ZPIA 5JZGB 1D0GA 1VRH2 1SDDB 1TNRA 4QB6A 2HBTA 2BERA 3H1WA 1A34A 2VE1A 4LQRA 1QJU2 4Q4Y1 1YJLA 2E6VA 3AYCA 1YFYA 1H0BA 4AI0A 2PAKA 4BJ0A 3MEPA 1W06A 5JZGC 4QU1A 3WDTA 3E6BA 1O7FA 3URFA 1C8M3 2WZR1 3C7EA 2YXSA 2BGCA 2XBO1 4IEYA 3LA3A 1W8HA 3IM0A 3B7MA 5LBEA 1PX3A 2JE8A 4LEJA 1KRIA 4XTPA 4AFBA 1LAJA 3E1F1 4XUPA 2VZ3A 1TMF2 1XNKA 1J58A 1SFPA 5FZ0A 1OSGA 4BU2A 4M4RA 5DAPA 1TME3 5LRRA 4BHPA 4Q0PA 2NPIA 4ITCA 1LGBA 1ZRIA 3RYKA 3O1VA 2R061 4B1MA 2FDFA 4K6BA 3LOBA 4FTSA 3WG3A 4BZ4A 4Q4X2 4COVA 1S0CA 4WVWA 1VE0A 4L11A 3UYJA 1DGWX 1U5XA 1GWKA 1YI9A 1Z0HA 2E33A 3L2HA 2NM1A 1CESA 4V2VA 3MI8A 2DU0A 1N3QA 2G19A 2XB6C 1VBB1 3OTFA 2J1UA 2JG8C 5CYYA 5KHGA 4S2FA 2JXAA 2AZ5A 3GHNA 4IGPA 4RQPA 3OUIA 5DPNA 4XXPA 2GNMA 3TN91 2D3PA 2HWE3 4GWIA 2AH2A 2VZ1A 1RGSA 1W6QB 5F5CA 3RSJA 1NZCA 4D6QA 4Y5SA 2R042 4LULA 2EALA 2VJXA 4AVAA 2IXCA 4QKFA 3UL2A 1GQHA 1HQNA 1JTZX 1LENA 4JRLA 4AYUA 2VTFA 1YIPA 4AE2A 1WW7A 3NL1A 1PGW2 1KJLA 3A23A 1RUE2 1O3SA 1GZCA 3DKWA 5FZBA 1CJDA 1LOFA 3ROUA 1JUIA 1ZM1A 1W2TA 2C5DA 3HT1A 5LZ6A 2Y8KA 4HFSA 3UT0A 2DUPA 4DFSA 2CGOA 3AB0A 4W4ZA 3BODA 1V6MA 2OXBA 1KS5A 5KHHA 4CTEA 3LFIA 2R16A 3VD5A 3PUAA 1X7NA 3A0NA 3ILFA 4XCBA 4HETA 4NWVA 4QPGB 3WP5A 1ZZBA 2VW1A 2OQ7A 1HX6A 3SKJE 3F2ZA 2FBEA 5IJRA 2Y6HA 1O4YA 2W87A 1HB4A 1DCSA 2RS13 4M3CE 2QE3A 3WLUA 2VW2A 5DAXA 1OFSA 1RUF1 2XUEA 3QH7A 4KNCA 2GSYA 1CD3G 4B3NA 2E32A 2IXHA 2GP5A 4I30A 4DXZA 4P9LA 3THCA 2RVAA 3OPWA 4EZ4A 5LA2A 3V65A 1FYUA 1TZOA 2Y0OA 3A4UA 2ZHNA 1O6UA 2XQXA 5D8AB 5FY7A 3H8OA 2WS92 2ZHKA 4AZZA 2VCBA 4QX0A 4FPYA 1S55A 3HBKA 4CE8A 3E5QA 4QGMA 1QDCA 2EIBA 2VUCA 2WYFA 4AQTA 1UZ0A 1LECA 1CAUA 4XABA 2WZR3 1J3RA 4PIYA 2XBO3 4ZY9A 5I0SA 2YB7A 2LS6A 2B9UA 1DLCA 1NUKA 1U5YA 1XU2A 1MPXA 2DVGA 2YUEA 3J7LA 5DZFA 2GH8A 1S0EA 1Y9QA 3TEWA 1G9BA 3O1SA 2C1FA 1NLSA 4MG2A 1QOSA 5E88A 2PHUA 1OHFA 4CUGA 4JV4A 2YFUA 4URTA 5IK4A 2DCTA 3O7OA 4NRPA 4M00A 1SPPB 2WAAA 2Y64A 3ZFEC 4YGBA 4A44A 3SISA 1CQ9A 4YW4A 2R30A 1UZZA 4YVWB 1CIWA 4AWDA 1VBB3 3OGRA 1O3TA 2ATFA 2O0OA 1SCRA 1OLQA 1PMJX 1SLBA 3B9CA 1UU5A 1ZBA3 3OJBA 4WM8A 4UBGA 1OH3A 5A6XA 2KA3A 1FOD2 4CDXB 4CP0A 1O91A 1OA2A 2SBAA 2EA7A 1ULEA 3VDDC 5JOXA 3WQ1A 1UOFA 3I8TA 3RVHA 1WCKA 5JSPA 2DURA 2ZHMA 2BWCA 3CHXA 3MPBA 2E26A 4YVSB 5FO8B 1WLCA 3WW2A 2EIDA 4MUVA 1LHVA 2VMGA 5T52A 1AYM1 3Q8BA 2A75A 3Q9OA 4O65A 4ZONA 1JOJA 4DPNA 1RMU1 1NE6A 2JG8A 2P37A 4Z2AA 4MVTA 5F3GA 1Q43A 1CZSA 4YGCA 5DQ0A 1D2QA 3VBRA 1WLDA 5GLUA 4AVVA 1MEC1 1BKZA 2E53A 2NQYA 4QPWA 5FPUA 3R4DB 5A32B 5LY1A 3FWEA 1PVC2 2GNBA 2CHHA 2P3KA 3JCIA 2VMFA 4QX8A 3U10A 2D5HA 4I01A 4M3CB 1VAVA 4Y5TA 5FWEA 1NLRA 2IXJA 1TQ5A 2ES3A 3SH4A 2FDKA 4B29A 5H9SA 1RUF3 4AEDB 5FR3A 3H3ZA 2MEV2 3PL0A 2QJVA 4P9IA 4OI1A 4UW5A 3VBHB 1H1MA 3CU7A 1WA4A 5JMOA 1FPN1 4H7MA 1XU1A 1UKRA 2J1EA 3ZYPA 1W2AX 1GBGA 1YQ6A 4NIHA 4BE3A 5T54A 2O14A 2VCAA 4OZXA 4ZS2A 3UJQA 4CUAA 2VGDA 2JG9B 2RS52 5A3TA 1W28A 4FPJA 1HN1A 1RYYA 4AEDC 2HH9A 1NAEA 5FUIA 5H9PA 1VRBA 2VQAA 1EUUA 4JX0A 4Y1ZA 1A3KA 3ATGA 1XNBA 1VLNA 2MNGA 3I59B 3LAGA 1N1SA 5JDBA 2LROA 4ASLA 1NA1B 3OCPA 2DWRA 2ZHLA 3FE5A 3TEZA 5FK8A 3WDVA 3IDAA 5FLJA 3MLLA 2ZGKA 3O0WA 1UIKA 2QFEA 4B8EA 4PBOA 2HWC2 1DGRA 1RUJ1 1PIV2 3L2YA 3K46A 3V64A 4XW3A 4EN7B 4QQ2A 3NJXA 5HCAA 1LULA 2Q8OA 4XFHA 3K75B 1S2KA 1W6OB 2B45X 1FNYA 2BWAA 3ZYBA 2UY9A 2DFCA 3O0XA 2OPWA 1C8M2 3EBRA 1DFQA 4FTBA 1WCQA 4E8DA 4QX2A 1E5HA 4UBHA 3T3YA 4LO4B 3PVNA 2WRAA 4CXXA 1IPJA 4LBQB 3HD8B 2EXJA 5CA6A 1RHI1 2VNVA 4FQZA 2JE9A 1I1EA 2JECA 4FVVA 4PLOA 4AR2A 5LEKA 4A2UA 3N7LA 2DCKA 3W59A 4KGGA 3WF1A 2GDFA 3ZFEA 1K5MB 2ZS6B 3IMNA 1AYM3 1ASJ3 3OEAA 1W9FA 1UCXA 1UY0A 2OZ6A 5FZCA 3WZ1A 1RMU3 1JOPA 4DINB 4XHBA 2JWPA 2HBUA 4WVMA 2V73A 4NRMA 4BPZA 2MPFA 4NIGA 1BYHA 5JMCA 1NOVA 1OLRA 1IG3A 5FQ0B 4BDVB 4Q8KA 3DECA 2H6BA 4IDZA 1PX4A 3NJYA 5GJ6A 3LA2A 4Q27A 3OY8A 2HWE2 5FV3A 1K5MC 3VV1A 5FLIA 3AZXA 4CPBA 3VDDA 2EXKA 3I2GA 2D6KA 2ARBA 2ZEXA 1O8SA 4GKYA 5KXDA 3H8UA 2B42B 5LK5A 4XXAA 4GALA 4OUEA 4BWOA 1A6CA 4CYDA 5T3NA 4TLGA 3VL9A 2FMDA 3RJ2X 4DY3A 3GZTB 3WX5A 3R05A 4XJAA 1FPN3 5FJKA 5KC6A 2ZX2A 4JGZB 4IE7A 4OMDA 1FAYA 4BLJA 2D6NA 4J1WA 3I7DA 5F39A 3NNGA 1GNHA 3RZZA 4FAGA 2WT2A 2X09A 5IVBA 4QQLA 4QKDA 2QDNA 3VN4A 4EQVA 1NZIA 1OBNA 1UY1A 2RS31 2WAOA 4KGQA 4LO7A 3OGJA 3UETA 5I91A 1VBD1 4E9KA 2WWUA 3DYOA 4FPFA 2XJTA 2IVJA 4JZRA 1YFWA 4PJYA 4IESA 4YZ3A 1S0BA 2JDHA 4Z07A 1JHNA 1OQDA 3CLPA 1H9PA 3INAA 4Y1XA 3ZO0B 3CKHA 1I6XA 3MIGA 4JDMA 3I3QA 4KI5M 4Y22B 3RNSA 5C9AB 3I2OA 2WL1A 1DGWA 1RUJ3 1GYKA 4QXBA 1IQAA 2R6QA 1ULCA 2XJQA 1L7RA 1X9PA 3HT2A 1JS9A 4Q4Y2 5CISA 3JQWA 3WCRA 2E31A 3KV5A 4E27A 3MLJA 5BNOB 3WSOA 4IEUA 5CIRA 2W1SA 2D5FA 1MQTB 4IEZA 2LALA 1APNA 2WZR2 3AMHA 2XBO2 2PMWB 2R073 2B5HA 4C0BA 1PVXA 1A8MA 3WW3A 5T50A 2SLIA 3HIFA 2CV6A 1RHI3 4ZZ8A 3LZZA 2DCZA 4JC1A 4YW1A 1DQ5A 5CFDA 4TTGA 2WA3A 3ON7A 4QXKA 2A3XA 2QZ2A 3QBQA 2IXIA 4AI3A 4L2NA 2R062 3IAQA 1H2LA 5C8CC 1UZYA 2VUAA 4RHV3 1MS1A 1YRZA 1V6IA 2V5DA 2YGMA 3QCWA 4YVWC 5IHRA 2C24A 2WN2A 5KHIA 2WNOA 2DBNA 2YZ4A 4MV2A 5CEHA 1VBB2 4YZ5A 2XHKA 3SKVA 2FCUA 3SLIA 5FYMA 2VBBA 4HXCA 3TN92 5A3WA 3UKNA 4MSVA 4AVSA 5A7WB 3ITQA 2FMYA 5GZCA 3FFQA 5FY4A 4COYA 1DBNA 2WC2A 1W8WA 4OMCA 4NHKA 2F4LA 2LM3A 4MGZE 1GQGA 1GOGA 2DBIA 3ZXKA 5A1FA 2R0HA 1FI2A 2RDNA 3TB0A 2RDRA 4AVTA 2BRTA 4IGOA 4DS0A 1GQPA 1FMD1 2QQJA 2D6OX 4RYDA 4U2AA 1AR91 3FJSA 3K3OA 4WBBA 3ZIXA 3BTAA 1UY4A 2GAUA 2NN8A 3NKTA 4MYEA 1FX5A 4QDRA 3KV9A 4M01A 4W8JA 4K21A 5FO9B 2W94A 2XUMA 2ZGNA 3VBOB 1GP5A 1YQ5A 1XSRA 1ND2C 1K5MA 4ATEA 1VBD3 4RS5C 3AZZA 3LPFA 3FLRA 4ZHNA 3T1MA 1Y4WA 1Y9MA 4XFBA 4URAA 4OI4A 4RFT0 1DQ1A 2UURA 2VMIA 1RUF2 4OZOA 3SQOA 3I54A 4MO3M 2XWBB 1ND3C 2EXHA 4ZU5A 2VD7A 4AGVA 3AKSA 3I2HA 3J8F1 1AZDA 2WUHA 4UT5A 3FHAA 2J22A 3SH5A 1XE7A 5FP8A 4CCOA 2A3WA 2BFUS 5HXMA 1Y43B 3A7QA 5B4XA 2ADDA 1BBT1 4LLOA 1OFNA 1QOOA 3POWA 5EP9A 5AC91 2VG9A 4JGYB 3C8XA 3CNAA 5FZ7A 4A7ZA 1ZZ8A 3C7GA 3ES4A 3P6BA 4BQ4A 5FY5A 2J1RA 2RJLA 1YO8A 5CADA 4ASKA 2W39A 2P3YA 1KJRA 3OYWA 3PTYA 5IWFA 4LHLA 4NUBA 4XUOA 3BN6A 1K42A 2QKDA 2D43A 2PHXA 2OVUA 3O5SA 4HK8A 2EIGA 3RGBA 3HWJA 4CCMA 5F2SA 2Q8EA 4D94A 5HV4A 1G9CA 4X6RB 2UWCA 4D3WA 4KBZA 1VMJA 4JGYC 4TWTA 3WDXA 5F3EA 4LPLA 3M70A 1OOPA 5I93A 4RSUA 3PU8A 4L92A 2X5IC 5FZEA 1CPMA 4DUWA 1VB2A 2DF7A 2HWB1 2YBPA 3WF2A 4S2GA 4BQYA 3ZYIB 2ZGSA 4UWDA 2YBKA 1BMV1 1RUD1 1REFA 2ZGLA 1SDWA 5A7QA 1UY2A 3NNFA 1O4ZA 3TNPB 4EJRA 1UU4A 2JDPA 2R1BA 3N9MA 4AG4A 1OLMA 2CWSA 4AGGA 3NJVA 3ZSKA 5KXEA 2TNFA 5FZGA 3CZUA 3KCCA 4FXKB 5JCTA 1FMD3 2P1BA 2BVBA 2Y33A 4HVOA 1AR93 3C7HA 5DABA 4C8DA 2WJSA 2WNEA 2CWMA 4JAAA 1AYM2 1V6JA 2R49A 1R64A 4Y3OA 4UF0B 5GZDA 1QJZA 1ZRDA 1RMU2 4BIOA 5K7PA 4L0PA 4C1WA 1CVNA 1HDKA 3ZXGA 1ACCA 3PNAA 5B2GB 4I2OA 2ZGTA 3SMHA 5LATA 4FOQA 1XJAA 4GWNA 3N9LA 1AR73 3DYPA 3LEIA 1MEC2 1W6NA 2VVDA 1JODA 5FP7A 2FDHA 1O5LA 1GV9A 5C8WA 4W6WA 3I2IA 1UF2C 2HYXA 3K51A 4R9AA 5CKNA 2W9XA 5EJZB 4HKLA 4AXOA 1OQ1A 5FZDA 1NE4A 1U12A 2WINB 4C90A 1QMJA 3K4DA 3ZMOA 2GP3A 5GZFA 3UESA 4GH4B 4BA6A 2HEYF 1FPN2 5EJ3A 4IEXA 3WF0A 2WZ8A 3NAPC 3I2FA 5CFCA 1W9SA 5JAXA 1AX2A 3ZOIA 2GC1A 1NCQC 1ENRA 1ND2A 1F4AA 3HN3A 5AC93 1RTVA 4FPLA 3K4AA 4NJ4A 1Q5OA 3NNMA 4RS5A 3WNOA 5F7UA 2ZTNA 4NN0A 4QQPA 4GAZA 4I0WB 2QQMA 3KLSA 4WM7B 3G7DA 3BTXA 3A22A 3D0SA 1CAWB 2PFWA 4AL9A 2XVLA 5JWPA 2ZX3A 2EAAA 1ND3A 1UZVA 2ZMLA 3KF5A 3LSEA 1D2SA 1FNZA 3S6PA 4QPIB 3T0BA 1SLTA 1XYPA 3N9NA 5T55A 3THPA 3WG4A 4META 5BNQA 3NRUA 4GMP3 5FYHA 4AEMA 3PDQA 5IW0A 1RUJ2 5C3OA 4PIXA 4Q29A 3GGLA 1EV11 4Y1VA 5ABJB 1M06G 2B39A 2VZQA 1KFXL 2HWB3 3GYDA 1C57A 5F8PA 3JB4C 2CAVA 1RUNA 3ZIWA 2QBXA 1WUVA 5GKAC 4D0QA 5A7PA 3D8CA 1YCIA 1HKDA 3T0AA 1RUD3 4Q1PA 1GP4A 4HPKB 3P5BA 1PO23 3B00A 5FZ3A 4K1ZA 1PMIA 5F6LB 5FMOS 2ZX0A 5F3IA 4C0HA 2XR4A 1RHI2 4YZ4A 3NJZA 3A0KA 1TME1 3JB8A 5CZKA 1RUI3 1TE1B 1DQ4A 3FN9A 5JR2A 3L9JT 3C7OA 2HKXA 4RA0A 2WWSA 2OIIA 5L7OB 1VMHA 3N36A 5FYBA 2X5IA 5JI9A 1QHDA 5JSRA 1F35A 1QOTA 2PTMA 1KDMA 1PNGA 3AKRA 4OI2A 3KZ4C 4YARA 1L3JA 4CEYB 4QX7A 2WNUA 5FY0A 1I9RA 3ZSJA 1YQ2A 3J26N 2A5ZA 3KT7A 1J84A 1H9WA 2JDAA 1OMIA 4IEQA 4QGLA 5FP4A 3V0AB 3O1MA 4HN0A 2WFF3 1AF9A 3J7HA 3O14A 2WNVB 5DDJ1 1CAXB 3CF6E 4PI2A 3T08A 3LEGA 4GMP0 2P34A 1PNFA 1X8MA 4JRAA 4LOTA 2BQPA 3E6DA 3BUCA 1KXGA 3U4XA 2CL2A 1B35C 5EHDA 3I3MA 3T2OA 1BZWA 1EAH1 5BNNC 3PMEA 2XJVA 1IGOA 1D4M3 3TBDA 1H4GA 4P5HA 1AR81 1IPKA 1GWMA 1A78A 1JHJA 1UL9A 2WT1A 4AAXA 1NXD1 4XBLA 2TBVA 2DVFA 2WO7A 5EFUA 2HWD1 3VD7A 2RS32 3J4UH 4TLFA 1VBD2 3NW4A 1EYBA 2YC4A 4XUNA 3WP4A 3ZSLA 4AOCA 3DV8A 4Q0VA 2RS11 3BU7A 4S2DA 4A45A 4CP9A 5IAXA 2VOWA 3WG2A 3HPNA 3IIIA 3ZKUA 1XQNA 1JOBA 1BCXA 1NKGA 1W8ZA 4V1PA 5LA9A 1WCUA 2ZPXA 1VBE1 4O61A 5JVVA 5FYZA 4BQWA 4OLLA 1AXKA 4IE6A 2K0GA 2RV9A 3FBYA 4XQ4A 3QD6A 1SBEA 2C0ZA 3NAPA 4JTNA 2VH9A 1EV13 2DVAA 1NCQA 4D7TA 5FRAA 5A1AA 5IVYA 2WYSA 1WGPA 2NMNA 3IB3A 1X33A 2Q4SA 5ANQA 2CU5A 5FPVA 3MICA 1H8TA 3ZVXA 4RR3A 4LE3A 4LHKA 5ANNA 5ERLA 1BEV1 4MXWB 4CRQA 5J1XA 1KQRA 2YROA 4UFJA 4XIOA 3TWIA 1W9WA 3SEPA 4BQ2A 3RWKX 1PZ8A 3FBMA 3V0BB 2UWAA 1R081 4CU6A 3QLQA 4GZ9A 4NHLA 1RC6A 3HNBM 2ZX1A 1ULFA 1FT9A 5FXVA 1OUXA 5LCWL 3VKNA 1V9U1 5KHKA 2YYOA 2QDRA 4KMQA 4CXYA 1KITA 3J9SA 1CAWA 4MGQA 1GWLA 3EQEA 3RZKA 2VCMA 1LOEA 3MIEA 4QMAA 4BMEA 1JZ3A 4P08A 5SV5A 4LTAA 1F5JA 1GZTA 2BYVE 2Z42A 1ZBA1 4Q2FA 1HXS1 4WVVA 5DUWA 3T4VA 2D3SA 2PHWA 2E51A 2DFBA 3AM2A 3GF6A 1COV3 1VBC3 3J7MA 3VHOA 1NG0A 2PXJA 2ZABA 3IIAA 1GANA 2GNTA 2QNKA 3CO2A 4Y20B 5FZ9A 4P00B 4CCJA 3ZXFA 5ACA1 3WD5A 3KT4A 1OD3A 2JKXA 3GBWA 3GXUA 5DDJ3 4EZHA 1HB1A 1GZWA 5K0UB 1V70A 2C26A 5A6ZA 1DQ6A 2WO3A 1ENXA 3GDBA 2IWGB 3MW4A 4HLTA 3UV9A 4XJ9A 4XJ8A 4OFGA 1FMD2 1V6KA 1UPIA 1AR92 3IDEA 3UGGA 1EAH3 4N43B 2YFZA 3VGIA 5FZAA 3KMHA 5F5IA 5DN2A 5I0TA 2BZDA 2D98A 3LIGA 1AR83 2A1XA 2IC1A 2RDQA 1AHSA 1Q8SA 2PA7A 4RGKA 4X8PA 1J3QA 1UQXA 2XJPA 3VBSB 1VIWB 2W52A 5BXXA 1E57A 2HWD3 3I3DA 3MUY1 1PMHX 3OBRA 5E16A 3MPPG 1HB2A 2DDUA 4IUGA 4N43C 5FO7B 1FV2A 3WQBA 5FFOC 1WCDJ 2HEVF 4CU8A 3USUA 5CNAA 3PHMA 3O12A 1UN1A 4N53B 2W95A 1VBE3 2CSGA 1B35A 1XYNA 4QPGC 5BNNA 3DPRA 3J8F2 5FZFA 3ZDSA 2QVSB 2VZRA 4G9SB 4COWA 1WLTA 2A6VA 1UPSA 4QQOA 4YRDA 2R32A 5JXHA 4DEQA 2D6LX 3U4SA 1BBT2 1H2KA 1XBFA 3M3CA 2K46A 5AC92 5L19A 3WV6A 4Q4V3 1SG3A 4N53C 4QGNA 3R0RA 1QXPA 5C5UA 4BK4A 1BEV3 1UYYA 1OQEA 5J09A 1BHGA 5D8AC 4OHZA 3T30A 2Z4FA 2W91A 3MF9A 4ORFA 3M2MA 1UYXA 2W46A 1R083 3FUOA 1JI6A 1LOGA 3NO8A 4JQTA 4OQ9A 3WW4A 1GP6A 4BH9A 1W9TA 1CAVB 4IE5A 5DUXA 3NQHA 3WINE 4DOUA 3B02A 4KH9A 1XNDA 1V9U3 4P9JA 4FO9A 4BLIA 1V6LA 5FMBA 3VHPA 3W5MA 3WUCA 4FT8A 5FZOB 3VKOA 5JZGA 1RJ7A 2QQIA 4P9YA 3PVOA 2QQLA 3OBTA 3MBWA 4L9BA 5GALA 1KS4A 2HWB2 1HXS3 3RG0A 3GBGA 1UMZA 4HG6B 4Y1YA 3AP6A 5FY1A 3VUOA 2XG3A 3KM5A 1S0DA 2WLQA 3ECQA 2EVXA 1ZREA 4J25A 5EZWA 2XGXA 1RUD2 3AKQA 1BMV2 2IFRA 2YPDA 4EV0A 5ACA3 2ET7A 1GFF2 1LTEA 2R7EB 4I02A 3H9AA 1SBDA 4UFKA 5DG2A 2RE9A 1LOCA 4N7IA 3WQ0A 2W0XA 2VCCA 3DF0A 2NZ9A 1A8DA 1LHOA 1OUSA 2XMLA 4A3XA 1J3PA 1C5IA 1ASJ1 3VZNA 4MH0E 3N7KA 3W9AA 3AXEA 4CDXC 4Q1RA 4XEZA 2OUHA 1XRUA 3E5UA 3D4KA 4UW6A 5DUUA 2PHRA 3AMNA 4FTEA 4AGRA 3HAGA 4YSFA 3VDBA 2W5FA 4CPBD 1ENSA 1GNYA 3GZAA 3QH6A 2GC0A 2ZCWA 4L8QA 4YVSC 5C3SA 5CKMA 1GU3A 2FZ2A 4YW2A 5FZ6A 4KWUA 2QQVA 4QD2A 1C1LA 4FOWA 2J42A 4QM8A 4XF9A 3AMQA 3FHIB 1DZQA 4DB5A 2ZZJA 3OUHA 1DP0A 1YNAA 3D3AA 2WFF2 2QQWA 1HQWA 5FK7A 1POV3 2XJUA 3I2DA 3LQCA 4YFWA 4AHYA 1W6QA 1DHKB 4YGDA 1VALA 2YBSA 3JXSA 1REDA 5EYYA 1US3A 3WNXA 1CPNA 4X6QB 2JB8A 4PT6A 4Y20A 5FP9A 5LA0A 1VAKA 3WNLA 1D4M2 2R0FA 1QWRA 5SV8A 5GZGA 1W39A 2DCJA 2D93A 2KM2A 3VBHC 1S2BA 4PLMA 3FLPA 1MZ5A 2CDOA 2PQQA 2VW0A 4LBMA 2AENA 1LRHA 5I0UA 1WBFA 3BIEA 1YEWA 4HANA 4BXFA 2ZGUA 3H8XA 2WQ4A 1S4CA 1YUDA 3RFRA 3AYEA 2JG9C 5FYSA 1DDLA 1QH6A 4I3PA 4YG6A 4QPGA 5FTTC 3IDCB 1POQA 2W47A 4CCDA 1DYPA 1ONAA 2YDEA 3UKVA 2O8QA 4JDOA 2ZAHA 1MZEA 2ZZQA 3SXWA 4SBVA 1OF4A 3O1RA 2I07B 1EV12 2VNRA 1J1TA 1NA1C 5J7MA 2GN3A 4FPCA 4LKEA 5FMCA 2IXKA 3BPZA 1W90A 2BNNA 2Q1FA 3DUIA 4N53A 5F37A 5CAZA 2VAUA 4HL0A 4PDWB 5EIYB 2WSVA 3PJYA 5D8AA 4K40A 2R071 5IVCA 1E5IA 5A7NA 3DXTA 3IMMA 4O9EA 2XLAA 1OVPA 1B09A 3MV01 4E2QA 4YW6A 1G86A 1RVF3 3DKQA 1POV0 5JXGA 2XLFA 3BOPA 1TME2 3ACIA 3H3UA 1Z78A 2C6SA 4RGGA 3E6CC 4RHV1 1LHWA 2ZKNA 2ZGPA 4IV1B 4K3UA 1JUHA 4PDWC 5LRSA 4A6SA 5FYVA 4P9XA 2WFPA 2ZGRA 3K77A 1QJX3 4M3CF 1YIFA 3MIBA 3APBA 3SHRA 3AP4A 5IUQA 2VBDA 3UJOA 4W65A 1OA4A 4BMBA 5IVJA 1SPPA 2AGSA 2LRPA 4V2WA 4BQXA 5DZGA 3T1LA 4AHXA 3FX3A 1AL21 4DIQA 2ZEWA 1UYZA 2LUWA 1IS4A 3LEMA 3OBZA 2D97A 4QU2A 4YVWA 4LT5A 3KGZA 4UYBA 2PELA 5FLHA 3VZJA 1QGLA 5A33B 4L99A 4Q4W3 1IS3A 1BVP1 5K4LA 4M0NA 5DDJ2 3BTYA 2Y6LA 3LA7A 2GMEA 1JZ6A 4LBQD 4Y33A 1LOAA 5F5QA 5FPBA 2QZ3A 2IXLA 4CDXA 5ISLA 4YG0A 3KQRA 1NCRB 5AFBA 1EAH2 1F5FA 4BQ3A 4IGQA 5F32A 3BU0A 2Q0AA 1R093 2BOJA 1AR82 2Y38A 3LDKA 4YVSA 1JW6A 3U1XA 2JDMA 3VZMA 1PGL1 4ATFA 4DRRA 1O3QA 1K12A 2NLRA 2PHTA 3LD8A 2EICA 4COZA 2HWD2 4K9SA 1H4HA 2VTXJ 2WO2A 4JGZC 1W6PB 3B94A 5FWJA 3HMYA 2RS12 2XDVA 4FFFA 1NCRC 4UOJA 5FXXA 3RDIA 1MS0A 3RJRA 2OUJA 3WCSA 3S5AA 1DF0A 2Y6FA 4IE0A 5KXBA 2C4XA 3JQXA 5A32A 1UIJA 3S7EA 1VBE2 1KD7A 3H7JA 4H3WA 3U78A 2JE7A 4QWNA 4N9IA 4NRQA 1RUC3 2A6WA 5EPAA 5HI0A 3OGSA 4M3CA 4I0AA 4IE4A 1WMFA 4S2HA 4AEDA 2OA2A 1W3XA 4CZSA 4MGSA 1ZNPA 3VBHA 2BBVA 4CXWA 4AFCA 2W92A 4YGEA 4HSJA 4AEJA 1PZ9A 3LB9A 4H55A 4YPJA 5T5OA 1N3OA 2VUDA 4QXCA 5C9AC 4LMFA 3MDPA 1SQ4A 1BEV2 3OF1A 3KF3A 1W0NA 2WQ8A 2JG9A 2I45A 1OURA 3ZN6B 1F8VA 1RUH3 3AKTA 1MACA 4NPRA 1R082 1EPZA 2E9QA 5BNOC 3UGHA 1G8WA 2ZMKA 4TSVA 2C9AA 1G9AA 3CQOA 1MQTC 3Q8FA 3X29B 1UXXX 2PN5A 4F83A 1Z7S3 1DLLA 1V9U2 3I59A 3MUZ1 5BNNB 1F2NA 1O3RA 1NA1A 1SLLA 2ZA9A 3ETQA 1ZX5A 4JDNA 3GBFA 1SLAA 3RQ0A 4IQPA 3GNEA 3T0DA 1OPMA 4PCRA 3TEYA 1ZBA2 1HXS2 2ZGOA 1AL23 3HQUA 3R4UA 3EYPA 3CJIB 1STMA 4BYYA 1IQDC 4A7YA 4BK5A 1TEIA 3KV4A 1C28A 1SMVA 5AVPA 5HCHA 4AAPA 1XPWA 5ACA2 3AMMA 1W6OA 2X8KA 2BUKA 1KDKA 3AYDA 2AREA 2P2KA 5F9TA 5IFTA 1OA3A 5JPNB 2WZEA 1RXFA 2XVGA 4YWAA 1QXRA 1UO9A 3BB6A 4Q8LA 2ADEA 3Q8CA 4A4AA 4ES9A 1AX0A 1MS9A 4CDUB 2H0BA 1IS5A 3GM8A 3KD4A 3LDRA 4GJYA 1CONA 3NV2A 4LBQA 3CJIC 5DG1A 2W08A 1RUG3 4Q0SA 5G04L 3T09A 1RINA 4HKWA 4K20A 2TEPA 1LEDA 1DYKA 4N8MA 1AR71 1Q8QA 4XFFA 3HNMA 3WY6A 1JZ7A 2XQRA 5AVAA 2NP0A 2OW4A 3LKJA 4MLOA 1N1VA 3T2QA 3QACA 2D3RA 5A3UA 4G4FA 1WCSA 1AL0G 4L97A 4LKFA 4CDUC 1WBLA 4I3GA 4CDQB 5I0RA 3GHMA 4AI8A 1U0AA 2QQNA 3AFGA 3ZR5A 5FQ0A 5HV0A 4YNIA 1WMEA 1SCSA 1K45A 1XYOA 3TNQA 3VBOC 4Z1VA 1ULGA 4IV3B 5KR7A 5FZKA 3RWNA 1W05A 2XLGA 1OT5A 4QM9A 5HCFA 3H7YA 4EWDA 2Z5WA 5BNPB 1AYN3 4NPMA 1F9KA 5A33A 1W8UA 1ULPA 2HWF1 3E5XA 3LF7A 2A7AA 3SCGA 3B9IA 4HT1T 4BM8A 3AZWA 4XFAA 2PLV1 1S1AA 1DYOA 1KGYA 4Z82A 3KCYA 3ZM8A 3ACGA 1OXCA 4K7JA 4JGZA 4R52A 3ZFFB 2RR11 1J83A 2FZ1A 1WD4A 3SC7X 2VMCA 3ASIA 4DXTA 5FZLA 5BNPC 1QJU3 1WZXA 2P6CA 4UW4A 1AR61 4DQAA 2W3JA 1OKQA 2GN7A 1XB9A 2JEMA 3N9OA 3RYPA 3B93A 4GMP1 1ZZ6A 4CDWB 1PK6B 4IXLA 3VDAA 3PIJA 1C3HA 4MGYE 3GJBA 4M4PA 4CCKA 5EV7A 1LODA 3ZFGB 2D6MA 2JDNA 3H8RA 2ZX4A 3LDBA 2P3JA 4GJZA 4UFMA 4HVQA 1N1TA 5CKQA 4WV8A 4Y22A 5FZ1A 4IETA 1CZTA 1IZ3A 1TMF3 5C9AA 4CU9A 1AUYA 3OGGA 2FQPA 1UKGA 1W6MB 1Q8PA 1XNCA 4XIKA 2G9FA 4XETA 1PO21 1PK6C 4QHOA 4OUSA 1H6YA 4ET7A 5LB6A 2ZMNA 1JU3A 2ENRA 3B3QE 5GLWA 4YYOA 4NOTA 4Y4YA 1SBFA 5BV6A 1O5UA 1ZZ9A 5BNOA 1PGSA 4GIQA 1JZ2A 1RUI1 1CZVA 4FOYA 4JTOA 4O7XA 3ELNA 1IKPA 1MQTA 3ZN4A 3MGUA 4WZCA 1OPOA 1ASJ2 2XJRA 3ZPYA 4A41A 3SH3A 1XNTA 3ZMNA 1XE8A 2OPKA 5C4WB 2W1UA 2RJKA 1TNFA 1QNWA 2R043 2UYAA 2YHJA 3ZXEA 4MGTA 4CEWB 1QU0A 2ET1A 3VBUB 1AXYA 2P17A 2QQKA 3NWKA 3ZYHA 5TSWA 5LASA 1V6OA 2GC3A 1G9DA 1C4RA 1ZYBA 1RUE3 1DZTA 2VTXA 4JKLA 4O9GA 4D6SA 2WFF1 3N7MA 4XJUA 3FZ3A 4Y4RA 3RRDA 4Y24A 4KWKA 4CEWC 4HVRA 5CB7A 2WWJA 3E97A 5FXZA 3ST7A 2YG0A 5IYYA 3LPGA 2QCSB 5A7WA 4XUQA 5EJ1B 1NX9A 3POFA 4JHZA 2G9GA 1OC1A 4M0HA 4LK6A 4NE9A 5HXVA 4ZXKA 1GLHA 3P3NA 1D4M1 5DZEA 1D7PM 1WW6A 2UWBA 2HWF3 2WO1A 3AP7A 5A3LA 2BGPA 4CCEA 1R092 3NMBA 1GOFA 2OX0A 5C7GA 3BI3A 2PLV3 3WEZA 1EP0A 4ONUA 2IVIB 1HRI1 1ZRRA 4XZUG 2NYYA 4C91A 5JOZA 4GH4C 4RD7A 3IWZA 2EF6A 2RR13 3BVCA 3CL1A 4PIZA 3IDBB 3LGRA 5I8TA 2Q8CA 5L9RA 2X10A 5JXIA 4GWMA 3VBOA 1UY3A 1AR63 1W8TA 3PVEA 3GZEA 4ZU4A 1X9TA 2ID4A 1E5RA 2WLPA 4ZS3A 4WVZA 2BNMA 5JPMB 1G6NA 4XMIA 5LA1A 4QB1A 3ORJA 3LFMA 4WM7C 1AJKA 5CG8A 1TVGA 3AP5A 2VVEA 2ZEYA 3ABZA 4N7UA 2VBPA 2ARAA 2G4IA 5FZIA 5DXDA 3DYMA 4XAAA 5CBLA 4FP2A 2V09A 3LSDA 1V0AA 4KU8A 3OG2A 4QPIC 1GR3A 4R9DA 3WF3A 2IFWA 3MIDA 5JOYA 4RQPB 2WR9A 4W50A 3HEIA 4OUMA 1IOAA 2R072 2E7QA 2XPJA 5KBFA 5KWRA 2DVDA 1RL3A 4GQ7A 5ABJC 1F31A 1PHMA 4TXWA 4JGYA 3KB5A 3TEXA 2BW8A 5DAWA 3QOPA 3VBFB 2E7TA 5A7SA 3RZHA 2ZJCA 3AL5A 3MFCA 2EIEA 5LBFA 4J6GA 4LBOA 4LA2A 3WVJA 2DU1A 4RHV2 1E5SA 1QEXA 3W58A 1MVQA 3NNJA 3EMRA 1LKNA 3T2TA 4F3JA 2VMHA 1ULOA 3KWVA 4OHVA 4CCCA 2JIJA 3DGTA 3Q8AA 4QKNA 3VHNA 1COV1 1PK6A 1X36A 1VBC1 1AL22 1WMXA 2EXIA 2N7GA 4LHSA 3VBFC 3AXDA 3FHQA 4OHYA 1HIXA 1DGLA 3MLKA 3POBA 3BIWE 3MW2A 4B4PA 5L7OC 4A7KA 3GZUC 3GCXA 4PF5A 5EQUA 2ETEA 1LOFC 2R1DA 2KXLA 4QAWA 4CEYC 4JCKA 2F17A 3JBG1 5J96B 1SLIA 2FDGA 4D8MA 5A1LA 4C1XA 3WXPA 5F1RA 1JBCA 2VR4A 3WP3A 3HNYM 4XURA 2J1TA 3M3IA 1CN1A 1IS6A 1UMHA 3PUIA 4FFIA 4AI9A 4CP2A 5C33A 2A3YA 2NMOA 2WN3A 3POJA 2WNVC 1WW5A 2VM9A 1MS5A 5A3MA 1PGL2 4JKMA 2MEV3 1VPHA 1HRI3 3HBZA 1MR5A 3FC0A 3R4SA 4UF0A 2IUWA 1CAUB 5C3PA 2B7YA 2WZPP 1JH5A 1AJOA 2DTYA 2H6CA 4CEWA 2D6PA 4EN9B 2TUNA 2ZEZA 3PMSA 1UNBA 3OPTA 1VP6A 2RS53 5B4NA 4B7EA 3RZLA 1YC61 5EWSA 4COUA 4XAEA 3VD3A 5IK5A 3BYWA 2D44A 3R6SA 1WA6X 3MF6A 1ULDA 4AI2A 1EUTA 1IHMA 5C71A 3WDYA 4ASMB 1Q3EA 2XHNA 1YFUA 4Q4V1 4QT6A 4YW5A 2MHFA 3LIHA 1XNAA 4GH4A 4D7YA 5LW9A 3RMYA 4ARXA 1YQ8A 5FP3A 4DUXA 2A6YA 4E4DX 2HWC3 4WM8B 2VUJA 4ZZ5A 3PJQA 4XDPA 3WUDA 4DRVA 2YC0A 4OVEA 1PIV3 2QTWB 2FCTA 4FPKA 1KEXA 5IVFA 2VZVA 1RITA 2CY6A 4AFMA 2XH6A 3IZOA 4QHZA 3IKWA 4DEVA 2ZAAA 2Y6JA 3K48A 1Q8VA 1P8JA 1T6BX 3ILNA 4NHXA 5HCBA 2VECA 2X05A 1C5HA 1MZ6A 4P9GA 4WM7A 1QF3A 2VOXA 3JD73 4HK9A 1BJQA 2P3IA 5F5AA 5T5PA 4AEKA 1ZZ7A 3I4IA 4XF0A 3OD4A 4WM8C 1LOBA 1OKOA 5F2WA 4B4RA 2V4VA 4PQQA 4QPIA 2JG8B 5FKBA 1G9FA 4UI9L 5IATA 1XSQA 1UXZA 3KT1A 1YFXA 3VBRB 1GNZA 1W2OA 3RI8A 1AX1A 2A73B 3AK0A 3DN7A 1YXWA 1RUOA 2F4PA 1QJY1 4Y5Z0 1W99A 5ABJA 3MZHA 2XL9A 2X53S 5J48A 5K9YA 2HEWF 5L9BA 4PHZA 1OH4A 1BQPA 1QJFA 2P6HA 2WT0A 1L7QA 4FI9A 4LO5B 2WKKA 4LUMA 3VD9A 3AJZA 3MW3A 5A6QA 3D82A 3JBG3 4DO0A 1NT0A 4K8RB 4HPKA 1RJ8A 3VBRC 2XKOA 3DL3A 1LCLA 3CZJA 2DUOA 2J1VA 3H42B 2OYZA 2CGNA 3WHUA 1GOHA 1HV1A 2GZWA 4KQ7A 5FPZA 3FFZA 3UGFA 4AQ6A 3K2OA 4Q0QA 1S0GA 1OVSA 5IK8A 4XQWA 5K0UC 3PVBB 1AR72 3WP6A 3VBFA 4QX1A 4FFGA 4Y1UA 3Q8EA 5L7OA 5FOJB 3AJYA 2QQPA 3RZMA 2JENA 2XWJB 4GB31 3MV11 5GLTA 4H2AA 4QB2A 4CA9A 4NR1A 4XQDA 4CEYA 4Z2WA 1POV1 3UNPA 3AMPA 3VBSC 1XC6A 2ZACA 4NVPA 4QDSA 1WLWA 1YQCA 4I0BA 2PHFA 4YM2A 2A6XA 2QQOA 3KCXA 3V0AA 1NXMA 5L73A 4QX3A 5FUPA 3RS6A 4FAHA 2W1WA 5I0DA 5IVVA 5DAQA 3VB9A 2WNVA 1VAMA 1CAXA 4DMIA 2HWF2 3HR9A 1M4WA 4KBBA 3KGLA 1UOBA 1BLZA 1XOYA 2Q8DA 2PLV2 3NVCA 1SFYA 3U11A 5IVEA 5FKCA 4NIDA 1UU6A 1ZA4A 5E6HA 3AC0A 3VKFC 3OB8A 5IAVA 3POEA 1VMFA 5J37A 4Z8BA 2RR12 4XJZA 4F8AA 2VO5A 4Q4Y3 1WWYA 3UK9A 4EWAA 4YZ1A 1AR62 4FPGA 5J98B 4LIVA 4MHRA 1QKQA 1GSLA 3C2UA 1DZRA 1W03A 3AX4A 3SITA 2HYKA 3ZFEB 4MX3A 1OD5A 3JZVA 3ILRA 1JN2P 4Z92B 3OSDA 3THTA 4B4QA 2PAMA 4YM3A 1DGRN 2XXZA 3EXUA 3IAPA 4LR4A 3M3QA 4MADA 4WVMB 3NKGA 2JDUA 3OOXA 3HQXA 2VZSA 2RM21 5CVRA 3WDUA 1PO22 4ISQA 3OY8B 2R063 1QJY3 4UFIA 1LB2A 4XVHA 5IT6A 3ZYJB 3ME2A 3NV3A 1UOGA 2RMU1 3EJKA 1RVF1 4QXHA 2BVVA 3VDDB 4BQ1A 4PBPA 1TG7A 1UX7A 2JD4A 1RUI2 3ZSMA 1O4TA 3POIA 1N3PA 1O59A 4MXWA 5FZ8A 3CJXA 3WHTA 3TN93 4LE4A 4NIAA 1W3VA 3LEKA 2PQSA 5LEJA 1QJX1 2VQTA 4NWWA 3I97A 4FFHA 4RFRB 4FOVA 2GH2A 4OULA 4U36A 3V0BA 4W6YA 1JYVA 4B7KA 2J1AA 4UW3A 4DY5A 1PO11 5FBZA 3EHKA 1LESA 3VZLA 5A3PA 1LNSA 5G05L 5GLVA 5KC5A 1CWPA 1HRV1 1W04A 5JR7B 2ZXQA 4GB33 4HZFA 4Q4W1 4LOSA 1D4VB 4A3ZA 3GJAA 4DXSA 5FCCA 3IT8A 2BGOA 4BISA 1J59A 1J1LA 3DEMA 1XXNA 5C5TA 1LHUA 3ZR6A 3AFKA 3C3VA 2WIIB 2VZPA 3AVSA 3ETPA 3C7FA 4I09A 4NAMA 4RL7A 4QHBA 3SNMA 3U14A 2DVBA 1RB8G 2FCVA 2IZWA 1UX6A 3BPSA 1X50A 2VMEA 1R091 1QIQA 3EB7A 1MS4A 4QPYA 2JJ6A 4IL7A 5K0UA 5T5LA 5FPXA 1IG0A 5FYYA 2BV4A 4LKDA 4P5YA 3TAYA 3U37A 4HN1A 2VL4A 1HRI2 3D6EA 1MVEA 5FPAA 4N43A 3PU3A 4HOOA 2PHDA 5BYNA 5FREA 4Y26A 1LHNA 1I5PA 1BXHA 2YU1A 4AHWA 1QQP1 2XOMA 4Q26A 4PI0A 3IPVB 3VBSA 3ALQA 2VQUA 1BK0A 3ACLA 4XE9A 5CFDB 1RUC1 3D0JA 3POSA 3VKMA 2KD7A 1YJKA 3PIGA 4AF9A 4BIFA 3KHBA 1GMMA 2W68A 4YW3A 1QH7A 4IERA 4JVAA 4LJHA 4ARYA 1DIWA 1H1AA 3VL8A 3OD0A 4AFDA 4CCLA 2Y6GA 3T4HB 3PUSA 4H7LA 2BPA2 1WMDA 2RM23 5CFDC 2CDPA 2O8OA 2OQ6A 2WDBA 4HBNA 3RPQA 3W21A 2RMU3 1RUH1 3B69A 3U07A 2A71A 4SLIA 1ZBE1 2VULA 3ES1A 5FDBA 2G1MA 4AQSA 5BPXA 2Y60A 2VC9A 1HLCA 4XJWA 4FQ4A 2WBKA 1OLME 1DG6A 2ZKLA 1Z7S1 4LKSA 5GM0A 2AEZA 3IN9A 4DXRA 5L9VA 1GZ9A 3KHCA 2OS2A 3BALA 4XBQA 5EYXA 3JD72 3OBAA 1UOJA 2VNOA 5A6YA 3JUUA 3ZYFA 4XZPA 4YM0A 2JIGA 4IW3A 2P5BA 1HN0A 1CAVA 3ZX7A 4E4HA 2B8MA 5H9RA 1PO13 1Y3TA 1CX4A 1CGPA 4EN0A 1FXZA 1EPWA 2BP6A 5F3CA 1COV2 4AHZA 1IPSA 1VBC2 2KR2A 2PYTA 5FZOA 3N3HA 4IV1C 2VU9A 3BOWA 1HRV3 4XC9A 5FY8A 2AUYA 3KVBA 3POYA 1NYWA 2CTVA 3HN1A 4LBNA 2K9ZA 4BXSV 4FSJA 1LU1A 3PURA 5H9QA 4XFIA 1W9YA 3RZJA 2BBAA 4JHTA 5A3NA 2FDIA 4XF4A 1ENQA 4YZ2A 1VJ2A 3I3BA 5FY9A 1NY71 4XACA 3MHZA 2I2SA 2XKPA 3JBG2 4KG0A 5EXOA 1CJPA 1MEC3 3TRSB 1I5ZA 3BKZA 1RUG1 4CU7A 4W6XA 4YFZA 3ZYGA 4P14A 2AEYA 4DNYA 4LITA 2ORXA 3RI9A 5FZMA 3SEEA 5C3QA 2XJSA 4LO8A 1VB4A 3HVDA 3WG1A 1EY2A 1JMUB 1PM7A 2XL7A 3VD4A 5FMDA 2RDSA 4LBJA 3ZKYA 2BTVC 4XUTA 3HJRA 3P3PA 5JXJA 1MZFA 1VBA1 1W8OA 3WNKA 4FPOB 1QQP3 2B9VA 3OYWB 5DAVA 4RN5A 5GLZA 3O1OA 5FPLA 1W0OA 3OUJA 5CG9A 2W1QA 4LBKA 3WNPA 4AW7A 4BB3A 2JICA 3W20A 2WSUA 1AYN1 5K8SA 1R1A1 4QQHA 5DUVA 1OOPB 4ES8A 4GWJA 3K3NA 1G7YA 1VRH1 2C9KA 4Q4V2 1JYTA 1S0JA 2HJIA 4IEPA 3S30A 4NHMA 2YPJA 2Z2SB 4PLNA 4FP3A 3WF4A 4D6RA 3BTZA 2V4AA 2CGPA 4R4XA 3VLBB 2YU2A 2RG4A 4XDOA 4AQ2A 3N4MA 1U5IA 1QJU1 2PAEA 2BJSA 1OI6A 3UKTA 1ZBE3 3ZSEA 1DQ2A 3OPZA 3KVAA 4XILA 4OQ8A 1OOPC 4KG8A 3WNNA 1SHWB 3GALA 2VMDA 2VZTA 4Q5OA 3M7AA 1UAIA 1W2UA 5APAA 5LK7B 1URXA 2ZGQA 2BNOA 5FJHA 5C8CB 1ZZCA 2VXRA 3T2PA 2G9ZA 2K2SA 4IEVA 1BK1A 2WQZC 3IPVA 1H6XA 2FHRA 1TMF1 4UAPA 2RHPA 5C8CA 4NAOA 5LWBA 4BOWA 4KWJA 4UXAA 1LGCA 2Y6KA 1W0PA 1T2XA 1Y9GA 2J7MA 3M1HA 4INDA 5FZ4A 4Q4X1 1W6NB 3M3OA 1QJY2 4P9WA 2WABA 4LIUA 3V56A 5I8YA 1V00A 1H2NA 1HJGA 1QJEA 4CCNA 3KSCA 1OF3A 3B5LB 3MFAA 4LXLA 3AVRA 4PDWA 5JIAA 1S0IA 2DTWA 4YLZA 4LBLA 3AYAA 1DU3D 1W8NA 2R041 1Q8OA 2OKXA 3ZLIA 1QDOA 1S0FA 4E8CA 2Q30A 3H50A 3I2KA 2JB4A 1LEMA 5I8SA 1QNYA 5C70A 5CFCB 1T6GC 1YHFA 1ND2B 1PGW1 4IV1A 4RGAA 3DCQA 3PUQA 1RUE1 1VBA3 3HQRA 4EWEA 1REEA 4RS5B 5A70A 1RIRA 1YYNA 2BFUL 1HQLA 2VNGA 4GB32 3I2JA 5A7OA 2ARXA 2JDYA 3SCHA 1K3IA 2VPVA 5FYIA 1ND3B 1UW8A 4LUKA 5CFCC 3H3LA 1SLCA 3N9QA 2B4KA 1MS8A 2OZJA 4E4SA 5DMYA 3WDWA 4MXVA 4OI0A 5CU1A 2RS33 4YW7A 3OGVA 5C3RA 1R1A3 3PTRB 1UYPA 1YLLA 3N7JA 1LR5A 3LCPA 5LBBA 4CDQC 2Y34A 4TZDA 2BOIA 2O1QA 1X8EA 2PHLA 2OT7A 4D7SA 4XDQA 5KHJA 1H1IA 1LU2A 1VRH3 2UU8A 4IV3C 4N90A 5KXCA 4FPEA 1ZRFA 2ZBJA 3WQ7A 4NO4A 2Z69A 1HW5A 1NCRA 4ZU7A 5JLVA 1DQ0A 2UYBA 3FUQA 3WW1A 3USSA 2Q5TA 2WS91 2GNDA 5JOWA 3ZXDA 4HSLA 1QY4A 4XFCA 2Y26A 1D0HA 1JU4A 4R8HA 4XBNA 3I49A 4CUBA 1WKYA 3LOIA 1JYCA 1QXJA 2Z79A 1W6PA 3VDCA 3ZFFC 2YV8A 3O1PA 2VOKA 4LK7A 4R9CA 1ODMA 2DV9A 4XHXA 3M3EA 4D69A 2CYFA 3LE0A 5GZEA 5E8AA 5JSOA 2AYHA 1WW4A 5D21A 4R9BA 4Q0UA 2X5IB 3ENRA 2XONA 1JZ4A 4HONA 4UFLA 2ZOEB 4BCUA 4CP1A 5FBJA 4EYUA 4FPHA 3WR0A 4MHUA 3ZXAC 4CDWC 4JQRA 2WNUB 4X8NA 3S0MA 2GALA 3MIHA 2RM22 4Q4X3 2GMMA 3ACFA 3KV6A 3ZFGC 1N1YA 2RMU2 1RVF2 4NMIA 3O1UA 4NHYA 3MIFA 3U75A 4TN7A 1JXNA 2E7AA 3SCFA 4ZXEA 5FOBB 3FLTA 1H30A 1NQJA 4XFGA 1O8PA 1SZBA 2WNUC 4WZFA 4AI1A 2VQ0A 3ZN6A 1FOD1 5F6KA 1QJX2 3D5OA 2UY8A 4OHXA 5D2AA 4FBFA 3N9PA 5E1RA 5FYTA 3ZXJA 1GUIA 1PM4A 2VOTA 4MOAA 3HOBA 2RJ2A 3A21A 1PO12 3EO6A 1NLQA 3OEBA 4GKXA 4ZKTB 1CR7A 4N9HA 3DXUA 5C4WC 1HRV2 5HPOA 4J1XA 3AZYA 4Q4W2 4UFHA 2BU9A 1W2NA 4OYUA 3JU9A 4CP9B 1HJFA 2YGLA 4TYSA 4BQ5A 2DYCA 4XMAA 3M4FA 4GULA 3VBUC 4K1YA 5BUVA 4PQ9A 3CJIA 5HBAA 1Q56A 1VR3A 1K5JA 1PVC1 3MYXA 1JYWA 1H8VA 1SFNA 5FYUA 5JI7A 3WNMA 2VVFA 1KFUL 2ZGMA 2B46X 3W5NA
chains in the Genus database with same CATH topology
2DCYA 3NAPB 4FCAA 4OHWA 2MEV1 3M8LA 1NCQB 2H0VA 2YY1A 4LO6B 3WT3A 4CDUA 1H8TB 4AFAA 2JX9A 4QX5A 4RR3B 2Q1MA 4FXGB 3RYRA 3J8F3 2VOVA 2I74A 2WS93 5E89A 1YWKA 2BEOA 3NSTA 4LNVA 1QQP2 4ISRA 2RS51 1GKBA 4E2SA 3PLQA 1BBT3 2Y0IA 2D7FA 4AK3A 2D40A 2GC2A 4H14A 1RUC2 5C6CA 2CAUA 4XF3A 4HKOA 4KU7A 1H8TC 4EROA 4CDQA 4RR3C 4KWLA 2JDZA 2EAKA 2F6BA 1AXZA 4YM1A 4IV3A 5FMOL 1GICA 4XYXA 5T5JA 1JYIA 4YG3A 1ALYA 3NV4A 5JIUA 2GU9A 2HWC1 2Q1ZB 5BNPA 4LA3A 1PIV1 4MGIE 1RUH2 4HMZA 2DUQA 3AKPA 1ZBE2 2CNAA 1WD3A 4LLFA 3TOJA 3U0ZA 5IK7A 1HV0A 1BVVA 4XTMA 4E2GA 4EN6B 1GZWB 3AP9A 3VZOA 3ZFFA 4RQPC 1C8M1 3JD71 1Z7S2 2GMPA 1FOD3 1ZVFA 3BCWA 1LJ7A 1UD1A 4MGKE 3ZYRA 2LTNA 2ILMA 4CDWA 4AVBA 3H1MA 2AR6A 3VKLA 4XPVA 2E63A 3ZFGA 3H0OA 1MS3A 3KS7A 1C8NA 4GXLA 1PZ7A 1V6NA 4E4ZA 2QUOA 3N35A 1NY72 1LGNA 3USUB 1W6MA 3VHRA 4AVCA 4F7ZA 5JOYA 3RMXA 5J3UA 2A70A 2HWE1 3G6JB 1PVC3 1I3HA 1B35B 5JOWA 1RUG2 5BNNB 1N47A 2JKBA 3DPRB 3S7IA 1H2MA 5D1IA 2VY0A 5J36A 1ZRCA 5FAXA 1X82A 4XOGA 4R4ZA 1SACA 3IBMA 4XF1A 3ZXLA 2YMZA 3B01A 1C1FA 5C4WA 3H1YA 2X29A 2V5YA 1VBA2 1YI7A 1R1ZA 3FMGA 1Y7BA 3WOGA 5AFEA 1AVBA 3O0VA 4GA9A 3DPRC 3CEWA 3NV1A 1FV3A 1U5ZA 2A6ZA 3LWCA 2XVKA 3VBUA 4K8FA 4IEOA 1IKQA 3TYJA 4LHNA 2ERFA 4DZGA 1NQDA 2WA4A 5L36A 4KL1A 3ZN5A 3AZVA 1FATA 1SEFA 1AYN2 3VZKA 4EN8B 4MZUA 1R1A2 4IEWA 5BY5A 4G3YC 5JZGB 1D0GA 1VRH2 1TNRA 3H1WA 1QJU2 4Q4Y1 1YJLA 2E6VA 3AYCA 1YFYA 1H0BA 4AI0A 2PAKA 3MEPA 5JZGC 3WDTA 3E6BA 1O7FA 3URFA 1C8M3 2WZR1 2YXSA 2BGCA 2XBO1 4IEYA 3LA3A 3IM0A 3B7MA 1KRIA 4LEJA 4XTPA 4AFBA 1TMF2 1XNKA 1J58A 1OSGA 1TME3 5LRRA 4BHPA 4Q0PA 2NPIA 4ITCA 1LGBA 3RYKA 2R061 3LOBA 4K6BA 4FTSA 3WG3A 4BZ4A 4Q4X2 4COVA 1S0CA 4WVWA 4L11A 1DGWX 1U5XA 1YI9A 3L2HA 1Z0HA 2NM1A 1CESA 3MI8A 2DU0A 1N3QA 3OTFA 2XB6C 1VBB1 2JG8C 5KHGA 4S2FA 2JXAA 2AZ5A 3GHNA 4RQPA 4XXPA 2GNMA 3TN91 2D3PA 2HWE3 2AH2A 1RGSA 1W6QB 3RSJA 1NZCA 2R042 4LULA 2EALA 4AVAA 2IXCA 3UL2A 1GQHA 1HQNA 1JTZX 1LENA 4JRLA 4AYUA 1YIPA 4AE2A 1WW7A 3NL1A 1PGW2 1KJLA 1RUE2 1O3SA 1GZCA 3DKWA 1CJDA 1LOFA 3ROUA 1JUIA 1ZM1A 2C5DA 3HT1A 4HFSA 2DUPA 4DFSA 2CGOA 3AB0A 3BODA 1V6MA 1KS5A 5KHHA 4CTEA 2R16A 1X7NA 3A0NA 3ILFA 4HETA 4NWVA 4QPGB 3WP5A 1ZZBA 2VW1A 1HX6A 2FBEA 1O4YA 2RS13 4M3CE 2QE3A 3WLUA 2VW2A 1OFSA 1RUF1 3QH7A 4KNCA 2GSYA 1CD3G 4B3NA 2IXHA 4I30A 4DXZA 4P9LA 3V65A 1FYUA 2Y0OA 3A4UA 2ZHNA 5D8AB 2WS92 2ZHKA 4FPYA 1S55A 3E5QA 4QGMA 1QDCA 4AQTA 1LECA 1CAUA 2WZR3 1J3RA 4PIYA 2XBO3 5I0SA 2B9UA 1U5YA 2DVGA 2YUEA 1XU2A 5DZFA 2GH8A 1S0EA 1Y9QA 1G9BA 2C1FA 1NLSA 1QOSA 5E88A 2PHUA 1OHFA 5IK4A 4JV4A 4URTA 2DCTA 3O7OA 4M00A 3ZFEC 4YGBA 3SISA 1CQ9A 4YW4A 2R30A 1UZZA 4YVWB 1CIWA 4AWDA 1VBB3 1O3TA 2ATFA 2O0OA 1SCRA 1OLQA 1SLBA 3B9CA 1UU5A 1ZBA3 3OJBA 4WM8A 4UBGA 2KA3A 1FOD2 4CDXB 4CP0A 1O91A 1OA2A 2SBAA 1ULEA 2EA7A 3VDDC 5JOXA 3WQ1A 3I8TA 1WCKA 5JSPA 2DURA 2ZHMA 2BWCA 3MPBA 4YVSB 5FO8B 1WLCA 3WW2A 4MUVA 1LHVA 2VMGA 5T52A 1AYM1 2A75A 3Q9OA 1JOJA 4DPNA 1RMU1 1NE6A 2JG8A 2P37A 4MVTA 1Q43A 4YGCA 3VBRA 1D2QA 1WLDA 5GLUA 4AVVA 1MEC1 1BKZA 2E53A 2NQYA 3R4DB 5A32B 3FWEA 1PVC2 2GNBA 2P3KA 3JCIA 3U10A 2D5HA 4I01A 4M3CB 1VAVA 1NLRA 2IXJA 1TQ5A 2ES3A 3SH4A 4B29A 5H9SA 1RUF3 4AEDB 3H3ZA 2MEV2 4P9IA 2QJVA 4OI1A 4UW5A 3VBHB 1H1MA 3CU7A 1WA4A 1FPN1 4H7MA 1XU1A 1UKRA 3ZYPA 1GBGA 4BE3A 5T54A 4OZXA 3UJQA 2VGDA 2JG9B 2RS52 4FPJA 4AEDC 5H9PA 2VQAA 4Y1ZA 1A3KA 3ATGA 1XNBA 1VLNA 2MNGA 3I59B 3LAGA 1N1SA 5JDBA 4ASLA 1NA1B 3OCPA 2DWRA 2ZHLA 3FE5A 3WDVA 5FLJA 3MLLA 2ZGKA 3O0WA 1UIKA 2QFEA 4B8EA 4PBOA 2HWC2 1DGRA 1RUJ1 1PIV2 3L2YA 3V64A 4XW3A 4EN7B 4QQ2A 5HCAA 1LULA 2Q8OA 4XFHA 1S2KA 1W6OB 2B45X 1FNYA 2BWAA 2UY9A 2DFCA 3O0XA 1C8M2 3EBRA 1DFQA 4FTBA 4UBHA 4LO4B 3PVNA 1IPJA 4LBQB 3HD8B 2EXJA 5CA6A 1RHI1 4FQZA 2JE9A 1I1EA 2JECA 4FVVA 4PLOA 5LEKA 4A2UA 3N7LA 2DCKA 3W59A 4KGGA 2GDFA 3ZFEA 1K5MB 2ZS6B 3IMNA 1AYM3 1ASJ3 1UCXA 2OZ6A 3WZ1A 1RMU3 4DINB 4XHBA 4WVMA 2V73A 4BPZA 2MPFA 1BYHA 5JMCA 1NOVA 1OLRA 5FQ0B 4Q8KA 2H6BA 5GJ6A 3LA2A 4Q27A 3OY8A 2HWE2 3VV1A 1K5MC 5FLIA 3AZXA 3VDDA 2EXKA 2D6KA 2ARBA 4GKYA 5KXDA 3H8UA 2B42B 5LK5A 4XXAA 4GALA 4BWOA 4CYDA 1A6CA 5T3NA 3VL9A 2FMDA 3RJ2X 4DY3A 3GZTB 3WX5A 3R05A 4XJAA 1FPN3 5KC6A 2ZX2A 4JGZB 1FAYA 4BLJA 2D6NA 4J1WA 3I7DA 3RZZA 1GNHA 4FAGA 2WT2A 4QQLA 2QDNA 3VN4A 2RS31 4KGQA 4LO7A 3OGJA 5I91A 1VBD1 4E9KA 4FPFA 2XJTA 1YFWA 4PJYA 4IESA 4YZ3A 1S0BA 4Z07A 1JHNA 1OQDA 3CLPA 1H9PA 3INAA 4Y1XA 3ZO0B 4Y22B 1I6XA 3MIGA 4JDMA 3RNSA 5C9AB 2WL1A 1DGWA 1RUJ3 1GYKA 1IQAA 2R6QA 1ULCA 2XJQA 4Q4Y2 3HT2A 3JQWA 3WCRA 4E27A 3MLJA 5BNOB 4IEUA 5CIRA 2D5FA 1MQTB 4IEZA 2LALA 1APNA 2WZR2 3AMHA 2XBO2 2R073 2B5HA 4C0BA 1PVXA 1A8MA 3WW3A 5T50A 2SLIA 3HIFA 2CV6A 1RHI3 3LZZA 2DCZA 4JC1A 4YW1A 1DQ5A 5CFDA 2WA3A 4QXKA 2A3XA 2QZ2A 3QBQA 2IXIA 4AI3A 4L2NA 2R062 1H2LA 5C8CC 1UZYA 2VUAA 4RHV3 1MS1A 1YRZA 1V6IA 2YGMA 3QCWA 5KHIA 2YZ4A 4MV2A 1VBB2 4YZ5A 2XHKA 3SLIA 3TN92 3UKNA 4MSVA 4AVSA 2FMYA 5GZCA 3FFQA 4COYA 1DBNA 2WC2A 4NHKA 2LM3A 4MGZE 1GQGA 3ZXKA 2R0HA 1FI2A 3TB0A 4AVTA 4DS0A 1FMD1 2D6OX 4U2AA 1AR91 3FJSA 4WBBA 3ZIXA 3BTAA 2GAUA 2NN8A 3NKTA 4MYEA 1FX5A 4M01A 5FO9B 4K21A 2XUMA 2ZGNA 3VBOB 1ND2C 1K5MA 4ATEA 1VBD3 4RS5C 3AZZA 3FLRA 3T1MA 4XFBA 4OI4A 4RFT0 1DQ1A 2UURA 2VMIA 1RUF2 3I54A 2XWBB 1ND3C 2EXHA 4ZU5A 4AGVA 3AKSA 3J8F1 1AZDA 3SH5A 1XE7A 2A3WA 2BFUS 1Y43B 1BBT1 4LLOA 1OFNA 1QOOA 3POWA 5AC91 2VG9A 4JGYB 3CNAA 4A7ZA 1ZZ8A 3ES4A 2RJLA 1YO8A 5CADA 2W39A 1KJRA 3OYWA 3PTYA 4LHLA 2QKDA 2D43A 2PHXA 2OVUA 3O5SA 4HK8A 2EIGA 3HWJA 4D94A 1G9CA 4X6RB 2UWCA 4D3WA 4TWTA 4JGYC 3WDXA 3M70A 1OOPA 5I93A 4RSUA 4L92A 2X5IC 1CPMA 1VB2A 2DF7A 2HWB1 4S2GA 3ZYIB 2ZGSA 1BMV1 1RUD1 1REFA 2ZGLA 1SDWA 1O4ZA 3TNPB 4EJRA 1UU4A 2R1BA 4AG4A 2CWSA 4AGGA 3ZSKA 5KXEA 2TNFA 3KCCA 4FXKB 5JCTA 1FMD3 2BVBA 4HVOA 1AR93 5C8CA 2WJSA 2WNEA 2CWMA 4JAAA 1AYM2 1V6JA 2R49A 5GZDA 1ZRDA 1QJZA 1RMU2 4BIOA 5K7PA 4C1WA 1CVNA 1HDKA 3ZXGA 3PNAA 5B2GB 4I2OA 2ZGTA 3SMHA 4FOQA 4GWNA 1AR73 1MEC2 1W6NA 2VVDA 1O5LA 1GV9A 5C8WA 4W6WA 1UF2C 3K51A 4R9AA 4HKLA 4AXOA 1OQ1A 1NE4A 1U12A 2WINB 4C90A 1QMJA 3ZMOA 5GZFA 4GH4B 4BA6A 2HEYF 1FPN2 5EJ3A 4IEXA 3NAPC 5CFCA 5JAXA 1AX2A 2GC1A 1NCQC 1ENRA 1ND2A 5AC93 1RTVA 4FPLA 1Q5OA 4RS5A 2ZTNA 4NN0A 4QQPA 4I0WB 3KLSA 4WM7B 3G7DA 3D0SA 1CAWB 2PFWA 5JWPA 2XVLA 2ZX3A 2EAAA 1ND3A 2ZMLA 3LSEA 3S6PA 1D2SA 1FNZA 4QPIB 1SLTA 1XYPA 5T55A 3THPA 3WG4A 5BNQA 4META 4GMP3 4AEMA 1RUJ2 4PIXA 4Q29A 1EV11 4Y1VA 5ABJB 1M06G 2B39A 1KFXL 2HWB3 3GYDA 1C57A 3JB4C 2CAVA 1RUNA 3ZIWA 1WUVA 5GKAC 3D8CA 1YCIA 1HKDA 1RUD3 4Q1PA 4HPKB 1PO23 3B00A 4K1ZA 1PMIA 5F6LB 5FMOS 2ZX0A 4C0HA 1RHI2 4YZ4A 3NJZA 3A0KA 1TME1 3JB8A 1RUI3 1TE1B 1DQ4A 3L9JT 4RA0A 2HKXA 2WWSA 2OIIA 5L7OB 3N36A 2X5IA 5JI9A 1QHDA 5JSRA 2PTMA 1QOTA 1KDMA 1PNGA 3AKRA 4OI2A 3KZ4C 4YARA 1L3JA 4CEYB 2WNUA 1I9RA 3ZSJA 3J26N 2A5ZA 3KT7A 1H9WA 4IEQA 3V0AB 1OMIA 4QGLA 4HN0A 2WFF3 1AF9A 3O14A 2WNVB 5DDJ1 1CAXB 3CF6E 4JRAA 4GMP0 2P34A 1PNFA 1X8MA 2BQPA 3E6DA 1KXGA 3U4XA 2CL2A 1B35C 1BZWA 1EAH1 5BNNC 3PMEA 2XJVA 1IGOA 1D4M3 3TBDA 1H4GA 4P5HA 1AR81 1IPKA 1UL9A 1A78A 2WT1A 1NXD1 4XBLA 2TBVA 2DVFA 5EFUA 2HWD1 2RS32 3J4UH 4TLFA 1VBD2 3NW4A 1EYBA 3WP4A 3ZSLA 3DV8A 4Q0VA 2RS11 3BU7A 4S2DA 2VOWA 3WG2A 1XQNA 1BCXA 4V1PA 2ZPXA 1VBE1 5JVVA 4OLLA 1AXKA 2K0GA 3FBYA 4XQ4A 3QD6A 1SBEA 2C0ZA 3NAPA 4JTNA 2VH9A 1EV13 2DVAA 1NCQA 4D7TA 5FRAA 1WGPA 2NMNA 1X33A 2Q4SA 3MICA 1H8TA 3ZVXA 4RR3A 4LE3A 4LHKA 1BEV1 4MXWB 4CRQA 1KQRA 2YROA 4XIOA 3TWIA 1PZ8A 3FBMA 3V0BB 2UWAA 1R081 3QLQA 4NHLA 1RC6A 2ZX1A 1ULFA 1FT9A 3VKNA 1V9U1 5KHKA 2YYOA 2QDRA 1KITA 3J9SA 1CAWA 3EQEA 3MIEA 1LOEA 4QMAA 4BMEA 5SV5A 4LTAA 1F5JA 2BYVE 2Z42A 5DUWA 1ZBA1 4Q2FA 1HXS1 4WVVA 2D3SA 2PHWA 2E51A 2DFBA 3AM2A 3GF6A 1COV3 1VBC3 3VHOA 1NG0A 2ZABA 3IIAA 1GANA 2GNTA 2QNKA 3CO2A 4Y20B 5ACA1 3ZXFA 3WD5A 3KT4A 3GBWA 5DDJ3 1GZWA 5K0UB 1V70A 1DQ6A 1ENXA 3MW4A 2IWGB 4HLTA 3UV9A 4XJ9A 4XJ8A 4OFGA 1FMD2 1V6KA 1UPIA 1AR92 3IDEA 3VGIA 1EAH3 4N43B 3KMHA 5I0TA 2D98A 1AR83 2IC1A 4X8PA 1AHSA 1Q8SA 2PA7A 1J3QA 2XJPA 3VBSB 2W52A 1VIWB 5BXXA 1E57A 2HWD3 3OBRA 5E16A 3MPPG 4N43C 5FO7B 1FV2A 5FFOC 1WCDJ 2HEVF 3USUA 5CNAA 3PHMA 3O12A 1UN1A 4N53B 1VBE3 1B35A 1XYNA 4QPGC 5BNNA 3DPRA 3J8F2 3ZDSA 2QVSB 4G9SB 4COWA 1WLTA 2A6VA 1UPSA 4QQOA 4YRDA 2R32A 2D6LX 1BBT2 1H2KA 3M3CA 5AC92 5L19A 3WV6A 4Q4V3 4N53C 4QGNA 3R0RA 1QXPA 1BEV3 1OQEA 5J09A 5D8AC 4OHZA 3MF9A 4ORFA 3M2MA 3FUOA 1R083 1LOGA 3NO8A 3WW4A 4BH9A 1CAVB 5DUXA 3WINE 4DOUA 3B02A 4KH9A 1XNDA 1V9U3 4P9JA 4FO9A 4BLIA 1V6LA 3VHPA 3WUCA 4FT8A 3VKOA 5JZGA 1RJ7A 4P9YA 3PVOA 3OBTA 4L9BA 5GALA 1KS4A 2HWB2 1HXS3 3RG0A 3GBGA 1UMZA 4Y1YA 3AP6A 3VUOA 2XG3A 3KM5A 1S0DA 2WLQA 3ECQA 2EVXA 1ZREA 5EZWA 1BMV2 2XGXA 1RUD2 3AKQA 2IFRA 4EV0A 5ACA3 2ET7A 1GFF2 1LTEA 4I02A 5DG2A 3H9AA 1SBDA 4YVWC 2RE9A 1LOCA 4N7IA 3WQ0A 2W0XA 3DF0A 2NZ9A 1A8DA 1LHOA 4A3XA 1J3PA 1C5IA 1ASJ1 3VZNA 4MH0E 3N7KA 3W9AA 3AXEA 4CDXC 4Q1RA 4XEZA 2OUHA 1XRUA 3E5UA 3D4KA 4UW6A 5DUUA 2PHRA 3AMNA 4FTEA 4AGRA 3HAGA 4YSFA 1ENSA 3GZAA 3QH6A 2GC0A 2ZCWA 4L8QA 4YVSC 2FZ2A 4YW2A 4QD2A 1C1LA 4FOWA 4QM8A 4XF9A 3AMQA 3FHIB 1DZQA 4DB5A 2ZZJA 1YNAA 2WFF2 1HQWA 1POV3 2XJUA 3I2DA 4YFWA 4AHYA 1W6QA 1DHKB 4YGDA 1VALA 1REDA 5EYYA 3WNXA 1CPNA 4X6QB 4Y20A 1VAKA 1D4M2 2R0FA 1QWRA 5SV8A 5GZGA 1W39A 2DCJA 2D93A 2KM2A 3VBHC 1S2BA 4PLMA 3FLPA 1MZ5A 4LBMA 2PQQA 2VW0A 5I0UA 2AENA 1LRHA 1WBFA 4HANA 2ZGUA 2WQ4A 1YUDA 3AYEA 2JG9C 1DDLA 1QH6A 4I3PA 4YG6A 4QPGA 5FTTC 3IDCB 1DYPA 1ONAA 2YDEA 3UKVA 2O8QA 4JDOA 2ZAHA 1MZEA 2ZZQA 3SXWA 4SBVA 2I07B 1EV12 2VNRA 1J1TA 1NA1C 5J7MA 2GN3A 4FPCA 2IXKA 3BPZA 2BNNA 3DUIA 4N53A 5CAZA 4HL0A 4PDWB 2WSVA 3PJYA 5D8AA 4K40A 2R071 4O9EA 2XLAA 4E2QA 1B09A 1G86A 1RVF3 1POV0 2XLFA 3BOPA 1TME2 3H3UA 1Z78A 4RGGA 3E6CC 4RHV1 1LHWA 2ZKNA 2ZGPA 4IV1B 4K3UA 1JUHA 4PDWC 5LRSA 4P9XA 2WFPA 2ZGRA 4M3CF 1QJX3 1YIFA 3MIBA 3APBA 3SHRA 3AP4A 5IUQA 3UJOA 4W65A 1OA4A 4BMBA 2AGSA 5DZGA 3T1LA 4AHXA 3FX3A 1AL21 2LUWA 1IS4A 4LT5A 2D97A 4QU2A 4YVWA 3KGZA 2PELA 5FLHA 3VZJA 1QGLA 5A33B 4L99A 4Q4W3 1IS3A 1BVP1 4M0NA 5DDJ2 3LA7A 2GMEA 4LBQD 1LOAA 5F5QA 2QZ3A 2IXLA 4CDXA 4YG0A 3KQRA 1NCRB 5AFBA 1EAH2 1F5FA 2Q0AA 1R093