4Z07A

Co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
260
structure length
260
Chain Sequence
b'SHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cGMP-dependent protein kinase 1
publication title Crystal Structure of PKG I:cGMP Complex Reveals a cGMP-Mediated Dimeric Interface that Facilitates cGMP-Induced Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 260
sequence length 260
chains with identical sequence C, E
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z07A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z07A01
4IEXA 3IDCB 4XFIA 1ZZCA 3HIFA 3ES1A 2XHKA 3UKNA 1O3RA 1XRUA 4MH0E 1UIJA 5BPXA 4ORFA 4GULA 2BEOA 3NKTA 4XF1A 5JSOA 5FPZA 1J3QA 2FQPA 1NE4A 2CAUA 2PHLA 1ZZ8A 1Q3EA 4XFBA 2GU9A 4LA3A 3RDIA 3PVBB 2IXLA 2CGPA 1EP0A 3EBRA 3DL3A 4ZU4A 4AXOA 1LB2A 1YFYA 3H1WA 3CL1A 1NYWA 4EWAA 1Y9QA 1ZRRA 1ZX5A 3SXWA 5I8YA 2B5HA 5E1RA 4HSJA 3B02A 1NXMA 2ETEA 2UYAA 1RUNA 1G6NA 3ES4A 2B8MA 2EA7A 1UD1A 1EPZA 3S7EA 4EWEA 4YSFA 2QCSB 3LA2A 1YHFA 4IEWA 4UBGA 1OFNA 3H1YA 1VJ2A 3LA3A 1DZTA 2PAMA 4WVZA 5T3NA 2O1QA 1EY2A 1EYBA 4HN0A 4MGKE 4HVRA 2GC0A 4LEJA 3UKTA 4P9GA 4I0BA 2E9QA 3FHIB 4R8HA 5E16A 4E2QA 1QXRA 2BGCA 4D7TA 4KL1A 5EFUA 5KHHA 1ZNPA 4HN1A 1QXJA 2XKPA 2ZCWA 3E6DA 3ETQA 5JR7B 4BHPA 5KHGA 1RGSA 2WFPA 1J3PA 1QY4A 4IETA 4XFCA 2MNGA 3E6CC 4PIZA 2GZWA 3KGZA 1X82A 4MX3A 2K0GA 1RC6A 4N9HA 3CEWA 3EHKA 4YNIA 2XLFA 2VPVA 3WW1A 4UBHA 1FT9A 1Y3TA 1CAXB 3FE5A 3H7YA 1YFUA 1OMIA 1NE6A 3HT2A 4IEOA 4XF3A 3IIAA 4KWLA 3DN7A 4HMZA 2D5FA 1PMIA 1WA4A 3SCGA 4LULA 1J3RA 2Q4SA 3NW4A 5CVRA 4J1XA 3FJSA 5I93A 3OCPA 5KBFA 3EO6A 1H1MA 4QM9A 4Q0QA 2V09A 4Q29A 5FDBA 3OGJA 4FT8A 5F1RA 4QGMA 3EQEA 4XF0A 4FBFA 1CAUB 3JZVA 1YFWA 1J1LA 2IXCA 3NVCA 3U11A 3H3UA 4XFGA 4MZUA 3MZHA 4META 2PTMA 2OA2A 2P17A 5JCTA 1CX4A 2C0ZA 2ET7A 3NL1A 4KWKA 1O3TA 3MPBA 2EVXA 4I0AA 4JTOA 4HBNA 5LRRA 5LEKA 1SFNA 1CGPA 3U10A 3HQXA 4BH9A 1JUHA 1CAWB 5FPXA 3LWCA 3KSCA 4LUKA 5JSPA 4D7SA 1VR3A 3E5UA 4HSLA 2Q30A 2ET1A 2XLAA 3BB6A 2CAVA 2D93A 2QNKA 4QX5A 4LUMA 2MPFA 3GYDA 3E5QA 2EAAA 4IEYA 1ZZ9A 2N7GA 3I59B 1FI2A 4PIXA 5BUVA 4L11A 3U0ZA 4RD7A 3OF1A 4I2OA 4JVAA 1GQGA 4XF4A 3ZDSA 4WBBA 5FLHA 1DGRA 1XE7A 4IERA 3WW3A 4ZU7A 5KHKA 3PNAA 1CAXA 5J48A 3D0SA 3LA7A 3S0MA 3VHRA 2UYBA 4BYYA 3SCHA 4HVOA 4KU7A 2H6BA 1ZREA 2DCTA 1UW8A 4I02A 1X8MA 1I6XA 5HI0A 4ONUA 2VQAA 1L3JA 3BU7A 4IEPA 3OTFA 3I54A 2QJVA 4AVCA 3E6BA 1OI6A 3ROUA 1X7NA 4TLFA 5I0UA 4BIFA 2GC2A 4EV0A 1NZCA 3CF6E 4X6RB 3H1MA 4XF9A 1CAUA 3BPZA 1IPJA 1LR5A 4LA2A 4F7ZA 5I0SA 5I91A 3GBFA 3R6SA 4R52A 3RZZA 5LEJA 1X8EA 4YARA 1H1IA 4N9IA 3G7DA 3H8UA 1RL3A 2UY8A 2XL9A 3HT1A 4FAHA 4LLOA 2OYZA 1WLTA 2UY9A 4HLTA 2XLGA 3MDPA 2D40A 3SCFA 3N4MA 1GQHA 2D5HA 2OZ6A 5KHIA 2XGXA 3E97A 3D82A 1CAWA 1XE8A 4AQ6A 2IXKA 2QDRA 5EZWA 4E2GA 4FAGA 4QMAA 3H50A 1SQ4A 2PHDA 1RUOA 4B29A 4ZU5A 2GAUA 1ZVFA 4QGLA 5KHJA 2PA7A 3C3VA 1I5ZA 2ATFA 3I59A 1Q43A 1LKNA 1CAVB 3WW4A 5I8SA 2Y0OA 1FXZA 4MGZE 4OFGA 1UCXA 2K9ZA 1Q5OA 2H0VA 3M70A 4L2NA 4QXKA 2VECA 2KXLA 2BNMA 4Q0SA 5AVPA 5BV6A 3KCCA 4F8AA 1PM7A 1O5UA 3L2HA 4XFAA 3FFQA 3LOIA 4IEUA 4IEZA 4E2SA 5FLJA 1DZRA 3H9AA 3OD0A 5BXXA 4KU8A 3RPQA 2GC1A 2Z2SB 2PAEA 3D0JA 3NSTA 1DGWA 2PAKA 2IXIA 2WC2A 3TNQA 2IXHA 1ZZBA 2ZKLA 4K8FA 2GC3A 4Q0VA 4QGNA 1UPIA 3BCWA 2PQQA 3MYXA 4J1WA 4MUVA 1O5LA 5J3UA 3ACLA 3FWEA 4Q0UA 5JAXA 4EWDA 4KWJA 3RYRA 3I7DA 5FQ0B 5J7MA 2Q1ZB 3IDBB 4Z82A 3FZ3A 5CADA 3QACA 2PFWA 4O9GA 5C8WA 4PJYA 1J58A 4IESA 5K8SA 4I3PA 2O8QA 3LZZA 4NVPA 2QVSB 2IXJA 4O9EA 5CU1A 1V70A 4DINB 2BYVE 3IWZA 4YYOA 1O4TA 4XFHA 4H7LA 4Z07A 5BY5A 3EJKA 4MV2A 3RYKA 1YUDA 5LRSA 4AVBA 2I45A 1O7FA 4OLLA 4LTAA 4A2UA 3SMHA 1WGPA 3RNSA 2Z69A 3CLPA 3DV8A 1CAVA 4PIYA 3ST7A 1HW5A 1LRHA 1ZRFA 1UIKA 1ZRDA 1ZZ7A 4MGYE 1J59A 1YFXA 1SEFA 2BNNA 3LAGA 1VP6A 2FMYA 2IC1A 2MHFA 1O3SA 3NJZA 1O3QA 5I0RA 5D1IA 3ELNA 3BALA 2PYTA 4I01A 2XKOA 4UXAA 3CO2A 3H3ZA 4HZFA 1IPKA 3H7JA 3UKVA 3WW2A 2H6CA 2B9UA 2Q0AA 3FX3A 3KGLA 4JV4A 1YLLA 4AVAA 4IEQA 1OD5A 3USSA 1TQ5A 5JSRA 1RTVA 1ZZ6A 3TNPB 3RYPA 4HVQA 5C6CA 3E5XA 5FQ0A 4Q0PA 3CJXA 3IBMA 4XETA 5FLIA 2GH2A 3KMHA 4XEZA 5I0TA 2OZJA 4I09A 2HKXA 4IEVA 3O14A 4WZCA 4XFFA 1U12A 4X6QB 4AQ2A 1QWRA 5I8TA 1ZRCA 2CV6A 2XL7A 2HJIA 4EROA 2BNOA 3S7IA 3SHRA 1YWKA 3M3IA 4JTNA 4QM8A 3QOPA 2OPKA 3PLQA 4YRDA 5FCCA 2F4PA 4MGIE 3DKWA 4CYDA
chains in the Genus database with same CATH superfamily
4QKBA 3WNLA 2XH6A 1HN1A 4QQOA 2JD4A 3C7EA 3A0NA 3VKNA 1PO13 1CIYA 3NQHA 2AC1A 4H55A 4YZ1A 1XU2A 4JDMA 4MXWA 1AL23 4OQ9A 2V73A 3V64A 1PVC3 1UIJA 3MBWA 3ZFEA 4JCKA 1S0CA 5A1LA 1QJX1 4ZS3A 2BEOA 2OW4A 3NKTA 2J42A 1C8M3 2PHLA 1RXFA 4Q4W1 2GU9A 4FOWA 1AZDA 3VZLA 1V6OA 4GH4A 3PVBB 4TTGA 1D2QA 3HNBM 3RJRA 4XDPA 4LIVA 4FOVA 4ZU4A 2X09A 4AXOA 1K42A 2B7YA 2CHHA 3W58A 3TEZA 2GMEA 5A80A 5AC91 4Y26A 2IVJA 5DQ0A 1TZOA 4BMEA 1XYPA 1SLLA 1IGOA 4XOGA 2LM3A 4HK8A 4YW5A 5L7OB 1MEC3 1RUJ3 3AZYA 1I9RA 3UNPA 3H1WA 5FYSA 1AVBA 3CL1A 4NHLA 3VBFC 3RGBA 4H2AA 4XTMA 5C8CC 2QDNA 1ZRRA 1G8WA 2OPWA 5E1RA 3VBOB 1UF2C 3JUUA 5ACA2 1PK6B 3ME2A 1BVVA 2BFUL 2F17A 4QPGA 1K45A 1K5JA 1RUC2 1S0GA 5FXVA 3S7EA 3CNAA 1LU2A 3JD71 2QUOA 2QCSB 5GZFA 3WG2A 5DZFA 2CNAA 4B7EA 3GCWA 4NN0A 2Z4FA 4FPHA 3MIEA 4LKDA 2PAMA 3KV6A 5LASA 2W1SA 1DCSA 1JOBA 1SFPA 3M1HA 1RUG2 3PIJA 1JODA 2XBO1 4CCKA 3V0BB 4HN0A 5LBEA 1WLWA 1C57A 4HVRA 1UXXX 2E53A 3BGAA 2G4IA 1AL0G 1FNYA 3IZOA 3QD6A 4HPKA 1RUE2 4LEJA 2VE1A 2Q8CA 3RI9A 5IK5A 1W9FA 2G9GA 4I0BA 1EV11 2BGPA 4KG8A 3FLTA 4CU8A 4XBLA 1PX4A 4KGGA 5FXZA 1LGCA 4WVWA 3VUOA 3THTA 2WT2A 4KL1A 4CP1A 5KHHA 5LATA 4R9DA 1REFA 1ZNPA 3M3CA 2ZMKA 4HN1A 4JQRA 3R4UA 4OUSA 1DLCA 3R05A 5KHGA 2JX9A 1RGSA 1AR72 3PMSA 4IETA 2ZEXA 4MSVA 4QU2A 2MNGA 2WS92 1KFXL 4W6WA 4XJ8A 1ZBE2 1CJDA 1X82A 2JDPA 1DQ1A 1OFSA 1FMD3 3EHKA 3WDUA 5DDJ1 2C1FA 1RJ8A 5D8AC 1WD4A 4UBHA 2VMHA 4AHWA 4WM7B 4NIGA 3IKWA 2OT7A 1WCSA 1SG3A 5FPVA 4GIQA 1UX7A 3ZLIA 2XQRA 3RSJA 1OMIA 3HT2A 3PVNA 2BP6A 5J36A 3RZJA 1L7RA 1YCIA 3TN92 1ULEA 2ZEWA 3K75B 4EN9B 3DN7A 1NA1C 1YXWA 4CP9B 2Y8KA 4Z92B 1Z7S2 4JX0A 4YGDA 3SCGA 5HCHA 5FY5A 4M3CF 1J3RA 4AGRA 3OBTA 3AM2A 2A5ZA 2XG3A 3NW4A 5FYTA 5L7OA 2YROA 4J1XA 4D94A 5I93A 4NE9A 3HWJA 1ULDA 4IV1B 1UZVA 2D6NA 2R6QA 4Q26A 5KBFA 4QM9A 1JYTA 3VDDC 3MW2A 4OHZA 3VHOA 4XZUG 4IE0A 1AX2A 4XQ4A 2E33A 3ZXLA 5IAXA 1Q8VA 1HRV1 3OGJA 3I3MA 5LBBA 3VBOA 1D0GA 5G04L 1PK6A 5FZDA 1BHGA 2JXAA 1SLCA 4XMIA 4COUA 4XBQA 2IXCA 3NVCA 1PO22 1N1VA 3ZR5A 2DUOA 1CD3G 4CCJA 3U11A 4AQSA 4W8JA 5ANQA 4DXRA 3C2UA 2ORXA 4UFKA 2Q1FA 5DAXA 5CFCC 3RZLA 1VBC3 1DQ0A 1GP6A 3D8CA 3EXUA 3S5QA 3WP6A 4ATEA 3N7MA 3VL8A 2W68A 4CUAA 4OVEA 1OLRA 1A8DA 3MPBA 4WM8C 5FMCA 3P1IA 4JTOA 1TVGA 4B4PA 3BUCA 2BBVA 3VDBA 2WT1A 5T5LA 2Y34A 4PT6A 5LBFA 2AUYA 4XDOA 4ASKA 4BH9A 1JUHA 5F5QA 1GUIA 3LWCA 3WHTA 4COYA 4AG4A 5GLUA 3U4SA 2Y26A 4A7KA 5JSPA 1D4M3 4D7SA 1VR3A 2X10A 3E5UA 3AKTA 3NV3A 4HSLA 3IDEA 4QQ2A 1WMFA 4D7YA 1JZ4A 2QNKA 2R32A 3RZKA 3O1SA 4CU7A 5CA6A 1DU3D 1LEDA 4QDRA 2WJSA 1VBE2 3N9QA 5FIXA 3OJBA 4QX7A 4L11A 5JI7A 5LA0A 4XTPA 4FPYA 4CP0A 2B46X 5FYHA 1V6NA 1SBDA 3NJXA 5T50A 1GNZA 3VBRB 3ZDSA 2ES3A 4WBBA 4BXFA 1UYZA 2ZGKA 1XE7A 4BMBA 4QXCA 3WX5A 1MACA 1REDA 3SH5A 2HWF3 1WBFA 2D3RA 4WM7A 3D0SA 1N3PA 2E32A 3LA7A 3B3QE 4QB1A 4WZFA 5GLWA 5IJRA 1W03A 4BYYA 3S0MA 1OURA 4QPIB 2Q8DA 4R4XA 4COVA 2JE8A 2ZJCA 3WOGA 3FN9A 5J96B 2DCTA 2WWSA 4CP9A 3VBSB 4EZ4A 3URFA 4LHKA 2J1RA 2E51A 1FPN1 1H30A 3D5OA 2R071 3BU7A 3JQXA 3DYPA 2ORZA 4GH4C 5FWEA 4NPMA 2YV8A 4AFCA 3O1UA 3MIDA 4IV1A 4AL9A 5A32A 5F6LB 1COV3 1LGBA 3S6PA 4HKLA 5K4LA 1X7NA 3T0AA 5JXGA 2XJPA 4M01A 3WQ1A 5I0UA 4BIFA 4D0QA 4HANA 4BQ3A 2QQOA 3T4HB 4X6RB 5CZKA 3HQRA 2A6XA 2RS32 3VB9A 4BQWA 1O8PA 2VUAA 3P5BA 4K3UA 3IB3A 5KXCA 5JZGB 1HRI1 5I91A 3W5NA 2ARCA 4R52A 1IS5A 4X8NA 1JI6A 4UWDA 1X8EA 4W65A 1R082 4N9IA 1FOD3 1QQP2 2ILMA 4Q4X1 4A42A 3AKPA 1W2TA 3POYA 2OYZA 4FCAA 4LBJA 4XABA 4RR3C 4OZOA 5A7SA 1ALYA 2HWB2 3I4IA 3MDPA 3ZN4A 1V6LA 4ASMB 1OKQA 2JJ6A 2D5HA 1AR62 5LA2A 1K12A 2Y60A 2P6HA 3BU0A 2QZ3A 3WNOA 2C9KA 3NNLA 3WHUA 1WCKA 4C8DA 5FZIA 5EJ3A 4LE4A 5EZWA 4E2GA 4H7MA 4NHKA 1FV2A 3GGLA 1SQ4A 3LIGA 2BBAA 4INDA 4UYBA 3K4ZA 3KCXA 1I1EA 1FNZA 2IVIB 2PA7A 2VZOA 3C3VA 5C71A 3ZYBA 4UFIA 4NRPA 1QGLA 2JDZA 2PHUA 3OPTA 4RFRB 5IATA 1VPHA 2BOJA 5IT6A 2ATFA 3KF5A 2RM23 3QH6A 4M0NA 1Q43A 4QX3A 3B5LB 3POGA 3LD8A 2I07B 5FZ8A 2Y0OA 3IAQA 4N90A 3ZXEA 3UESA 4CXXA 5L9VA 3N7LA 3N9NA 1RHI1 2BVBA 1CZSA 1Q5OA 4L2NA 5FFOC 2VECA 2HLEA 4TWTA 2KXLA 1IS3A 1RVF1 1W6OB 4Q0SA 4HKWA 1C28A 5AVPA 3U37A 4FPFA 4F8AA 5C70A 3L2HA 1SLIA 2A6ZA 2RR12 1NLSA 3AL5A 3GNEA 4IEZA 1RB8G 4AI2A 2WZR3 3P3PA 4KH9A 4BE3A 4QPIA 3PTRB 3Q8FA 1QJU3 4P9XA 3AYCA 4JZRA 1H2NA 2DFCA 1W39A 1OQ1A 3WF4A 1POV1 1GOHA 1GP4A 4WVVA 4E4ZA 2XJSA 5BXXA 1W0PA 1V00A 5FZLA 5GKAC 4AFMA 1C5HA 3VHNA 2HH9A 3OGRA 3TEYA 4KNCA 1FAYA 4BB3A 1DYKA 3NV1A 1E57A 1MS1A 5M0TA 1QJFA 1X9TA 4Q0VA 4Y1YA 1SLAA 1QNYA 5F2WA 2CU5A 4MGSA 1POQA 1VMHA 1W6QB 2ZGOA 5T5PA 4FXGB 4D6QA 4NPLA 1KS4A 4URTA 5J3UA 1GNHA 1OXCA 2QQVA 4Q0UA 1SBEA 5JAXA 5JZGA 5LY2A 3PMEA 2XUMA 1RUC1 3UJQA 4XBNA 1A3KA 3USUB 3ZSMA 1A6CA 2E31A 3TBDA 1ODMA 5GZEA 3LEIA 5DAQA 3VBOC 1E5IA 1AYN2 4HONA 3FZ3A 5CADA 5F7UA 3QACA 1A34A 4FOQA 2PFWA 3LPGA 1WCUA 3F2ZA 3KQ4B 3O0WA 3C7FA 4IESA 4I3PA 4BQ4A 1JMUB 1RUG1 2P34A 3VBFB 4DXSA 3VKOA 1V9U2 2QVSB 4GWJA 2D6KA 5F5AA 4AEDC 2ZS6B 4O9EA 4P5YA 1AR81 5CU1A 5F6KA 1UY2A 3WLUA 2XDVA 4YYOA 2ZTNA 2P4EA 4CDWC 2CTVA 4XFHA 4H7LA 1UMZA 2PHXA 4Z07A 5KXBA 1TMF2 2DU0A 4MV2A 1GLHA 3LSDA 5LRSA 1S1AA 2HWD3 3MFCA 1AYM3 1CJPA 1OOPC 1O7FA 1VRH2 2LUWA 4OLLA 4A2UA 4BU2A 3RNSA 5C3SA 1WKYA 1H9WA 2JDKA 1AR71 1Q56A 1HW5A 2ZMLA 4A7ZA 1VBB2 3BI3A 2WS91 3B94A 1LRHA 1XQNA 3EYPA 5F37A 1GOGA 4FFGA 1ZBE1 4L8QA 3POJA 2ZXQA 4BWOA 4YZ5A 1AR93 1HXS1 1YFXA 2FCUA 5A3UA 1HB4A 1W6OA 1JYXA 4L97A 3WV6A 2NQYA 2A3WA 1AX1A 3ZYRA 1SLBA 2YGLA 1RUD2 4GB32 3ITQA 1F5FA 2D44A 2EICA 2PLV2 3BKZA 3U07A 3JQWA 5D1IA 3TN91 2RE9A 4KQ7A 2ENRA 1YQ8A 5HPOA 3CO2A 4AEJA 3DCQA 4HZFA 3LKJA 3WR0A 1HIXA 2H6CA 3ACIA 1JZ7A 1R1A1 5FYYA 2FDKA 4FSJA 4LBLA 4D69A 1WW7A 4FFFA 1HX6A 4PF1A 4RGAA 4YW6A 4TZDA 5JOWA 4AVAA 2CSGA 5JVVA 1GBGA 3KD4A 1W6QA 3PUHA 1OD5A 4AEKA 2ADDA 2RDSA 4ZZ5A 5JSRA 1RTVA 1VBA3 4XPVA 4RHV2 1QJZA 3HOBA 3JB4C 3TNPB 1GV9A 2E6VA 2PHFA 1UN1A 2VH9A 3K4DA 3M2MA 1UWWA 2A6YA 1ENXA 4Q0PA 1UZ0A 3USUA 4A4AA 1AF9A 4LQRA 3ZN5A 4A44A 1UYYA 2NM1A 3IBMA 4CDUC 3ZIWA 2W47A 2OUJA 4YVSB 4XETA 5FLIA 1F15A 3ENRA 1PIV1 4SLIA 4AHXA 4CA9A 4Y1VA 4URAA 4Z1VA 3OPWA 4XEZA 5JR2A 5I0TA 1KDKA 4WZCA 4DUVA 4EJRA 3VBFA 1QWRA 1ZRCA 4BQ5A 2XL7A 1N1YA 3U75A 3WINE 3LSEA 2BNOA 4XUOA 1MVQA 1NCQB 1EAH3 2RDNA 3LCPA 3S7IA 3MI8A 5FY4A 3M3IA 3CMGA 3AFGA 3CJIB 1VLNA 1DGLA 2E63A 1KDMA 2VTXA 3AP5A 3K48A 3RQ0A 4K7JA 4DQAA 4L99A 2F4PA 1VBD2 1C1LA 3JXSA 2ARBA 4Y24A 1NCRB 4IEXA 1HDKA 1REEA 4QQLA 3IDCB 1KFUL 1ZZCA 1CZVA 1XYNA 4JRLA 4OYUA 5ERLA 1W6NB 3AMPA 3DPRB 4YPJA 3VGIA 4AVTA 1F4AA 4KBBA 3H0OA 5DG1A 5CFCB 1SFYA 2RDRA 4Y5SA 4NMIA 2RG4A 3JBG2 4WVMB 3TEXA 3GBGA 3O12A 4AFAA 1VBE1 3O5SA 2ZX1A 5FZMA 3ZSEA 5FPUA 4GULA 1DFQA 3GHNA 3IIIA 4V2VA 4K40A 5F3EA 4I3GA 3OYWA 1CN1A 2ZKNA 4WM8B 5FPZA 2ZACA 3PTYA 3SKJE 2ZHKA 1ZZ8A 2B9VA 2O0OA 1L7LA 4QPWA 3RDIA 3TB0A 2RDQA 1PO12 2YDEA 2X8KA 5T54A 2VUCA 4LT5A 4U36A 2ZHNA 1JYCA 1S4CA 3N7JA 4PQQA 1JYWA 1AL22 3FBYA 1PVC2 3WUCA 2BZDA 3GZTB 2WQZC 1PZ9A 3VBRC 1ONAA 2GDFA 3VDAA 2B39A 2XJVA 2D7FA 4J25A 4ZKTB 5L19A 1NX9A 1LB2A 3I3BA 1X36A 1YFYA 2CY6A 5DABA 4Z8BA 3UETA 4XAEA 4QPYA 3N9OA 3J7LA 5FP7A 2YPJA 4EWAA 1Y9QA 3WDXA 4OHXA 5FZ3A 1ZX5A 3SXWA 3UT0A 3A4UA 5A33B 3TWIA 5IVJA 4ES9A 2BV4A 1BEV3 1IG0A 3VBSC 4DOUA 1LOBA 5C33A 2Y0IA 2ETEA 1G6NA 2B45X 4NHYA 2EA7A 1EPZA 1MEC2 1ST8A 1X33A 2RS31 4AF9A 5JPNB 1YHFA 4IEWA 1J84A 1OFNA 5EV7A 3ZFFB 4XJUA 1HJGA 4AZZA 1DLLA 3LFIA 3LA3A 3FLPA 3P6BA 1R081 1DZTA 2XJTA 2OKXA 4AFBA 1DYOA 2RMU3 4YVSA 5T3NA 3Q8AA 1RUH3 1UL9A 4DPNA 3AXEA 1OQEA 2SBAA 1US3A 4NRMA 5JZGC 1MS3A 2RVAA 4JGZB 1JHNA 4LE3A 2HWB1 4UW4A 1H8VA 2VMGA 3GCXA 2AZ5A 3AC0A 1AR61 4GAZA 1OA2A 4R8HA 1NCQA 4RGGA 4E2QA 2VZUA 4BK5A 1ZBA1 1LHOA 3AJYA 2VM9A 1E5HA 2V4VA 3CJIA 3GDBA 2XBO3 2W08A 5DN2A 5FREA 4Q27A 4XCAA 3MIHA 5FUIA 3DF0A 1NCRA 1DYPA 2XKPA 1QH7A 3O0XA 2SLIA 2DCZA 4BHPA 2AACA 4WV8A 3MV01 1YQ2A 2WFPA 1W6NA 1J3PA 3DPRA 4OZXA 1J1TA 1MQTB 1DQ5A 2JKXA 3K3NA 4UF0B 4XFCA 1CZTA 5CFCA 3RMYA 2GZWA 3SNMA 4KI5M 4WVMA 4QHZA 2W9XA 4FFIA 3POBA 2K0GA 2WBKA 2GH8A 2CWSA 4N9HA 4S2HA 4RR3B 1GWLA 2ZZQA 4WM8A 4QX1A 2V72A 3ZM8A 1SPPB 1FT9A 3RS6A 3U78A 4CTEA 3FE5A 4NOTA 1D4VB 2JE7A 1R64A 4A3ZA 1LU1A 4CDXC 4NWVA 2WNOA 4IEOA 3POIA 1OUSA 3I97A 5FXXA 2VZSA 1NUKA 5A70A 4HMZA 2D5FA 3SITA 5DAVA 1ZREA 1RUI2 4BLJA 4PF5A 1FMD2 5FMBA 2IUWA 4ET7A 2OXBA 3NRUA 1F2NA 2W87A 4COWA 2BTVC 2JDHA 3KVBA 4AVVA 1CX1A 3OCPA 4YGEA 4KGQA 3EO6A 5FOBB 4XUNA 4XVHA 2V5YA 1KD7A 1OHFA 2LTNA 4YW1A 5K7PA 1LODA 3Q9OA 4Q29A 5FDBA 5A33A 4FT8A 2OVUA 2QQJA 3QLQA 4N43B 1WZXA 3FL7A 4QGMA 5BNQA 3IT8A 2NP0A 4CEWB 2NPIA 1Y4WA 5IAVA 4XCBA 4CRQA 1W8TA 4Y33A 3KHBA 2PELA 1RITA 4Q2FA 2Y6HA 4FPLA 2GP3A 4JQTA 1NZIA 2J1AA 4PI2A 1HRV3 2ZMNA 1BBT3 3ZFFA 3ZXJA 4M3CB 5JCTA 4MGTA 4NPRA 4MHUA 1IOAA 2C0ZA 4X8PA 2QQMA 1AYN1 3ACGA 4KWKA 5A7WB 3SISA 4CEYB 2A6WA 1O3TA 4HBNA 5KXDA 1JZ8A 1DGRN 2AENA 5LEKA 1H2LA 1YC61 5FZFA 3C7OA 3AFKA 3U10A 2D43A 1NQJA 1BZWA 3HAGA 1HKDA 4JGZA 1JN2P 3HJRA 4Q4Y3 2WUHA 4MADA 1CAWB 4QHBA 3WG1A 5CAZA 5TSWA 1AXZA 1T6GC 3HBKA 5GZDA 1QDOA 1VBC2 2EXHA 4LUKA 3WXPA 4ARXA 5HXMA 3AL6A 1V9U1 4P02B 2D3PA 1UOFA 2XLAA 4TLGA 2CAVA 1IQAA 3ASIA 4Q4V3 3S30A 2MPFA 2G9ZA 3WSOA 4HETA 4NRQA 2EAAA 2LRPA 2F6BA 2YU2A 2X29A 2ZEYA 2YXSA 3ON7A 1ZZ9A 4FPKA 3I59B 4UF0A 1W9TA 4PIXA 1MQTA 5F3IA 1ULFA 1TME3 5FZ1A 1VRH1 1E5SA 2WQ4A 3AYAA 3BTYA 1D4M2 4IV3B 4XHXA 3NJYA 4XXPA 5D2AA 5E88A 4NJ4A 4XF4A 2VNGA 4RR3A 5FLHA 1I5PA 2GALA 4BK4A 3Q8BA 2P37A 1SPPA 3CHXA 2VOKA 3T2PA 4Y4YA 4XAAA 4YW3A 1FATA 5H9PA 1XPWA 4AEDB 4OHVA 3O1RA 3SCHA 1DDLA 3OD4A 2DVDA 2R041 5FRAA 4PHZA 2WO7A 1BJQA 1W6MB 3HVDA 2BRTA 2H6BA 4KU7A 1RUD1 4GB31 4P00B 3TEWA 3WDTA 4LBQD 1UOJA 3JB8A 1X8MA 4CDWB 1NXD1 1KEXA 1YJLA 2PLV1 2ZABA 4ONUA 1XYOA 3CBNA 1L3JA 2C5DA 3PDQA 4IEPA 4PDWB 3I54A 1OOPB 2QQUA 2VC9A 3ZYFA 2QJVA 4AVCA 2CGOA 1OI6A 4XIOA 2A73B 3KLSA 5FBZA 1WBLA 3ETPA 2IZWA 4Y1UA 3MIBA 4TLFA 3T2OA 4ITCA 2EIEA 4JHTA 1C5IA 4NHXA 4N43A 1NZCA 3CF6E 4NAMA 2R073 3H1MA 4XF9A 5BNOC 4CEWA 4LMFA 2YMZA 4PBOA 1ND3B 3WNNA 3KHCA 3AP4A 4BXSV 3R6SA 2CWMA 2YBPA 1UMHA 1YNAA 3RZZA 2NMNA 3G7DA 1COV2 4LO4B 1RL3A 2YYOA 1F5JA 1RUF3 2WSVA 3EB7A 4OI2A 5F3CA 2XL9A 3GJBA 4RHV1 4XYXA 2Q1MA 5JIUA 1HQLA 4M3CA 4LLOA 3ZDVA 3ZYPA 2BGOA 4CCEA 1HLCA 1OC1A 1WLTA 2VW2A 2W52A 3LDRA 4JKLA 5A7WA 4CEYA 1HRI3 2WDBA 3BN6A 2XLGA 4DY3A 3D3AA 4ZONA 2D40A 4M00A 3SCFA 1Y9GA 2XOMA 3N4MA 4FVVA 2OZ6A 4XQDA 3VKMA 3QH7A 2XGXA 3E97A 2YUEA 3D4KA 3NNJA 1CAWA 1FOD2 1APNA 3WQ0A 4YZ2A 5EXOA 4AQ6A 1W06A 2UWAA 3RMXA 3MF9A 4LJHA 5A3WA 3V56A 2HEVF 4QMAA 4YVSC 3H50A 4FAGA 5CFDB 4JDNA 1N1TA 4B29A 4UFJA 3MIFA 4ZU5A 4B1MA 1QJY2 1GZ9A 1QH6A 3GJAA 4AYUA 4FOYA 4YG0A 3KVAA 1VBD1 2CDPA 2PQSA 3NV4A 4AHZA 4B3NA 1JTZX 1GFF2 4XUPA 3RWKX 4CCOA 3I59A 4CSWA 2OUHA 1NCQC 2VGDA 5GM0A 1GQPA 1F9KA 3PUIA 3CJIC 4CDUB 1GZTA 1PGL2 2JDAA 2C26A 1UCXA 1XNBA 3MHZA 3THPA 4CUGA 2HBUA 1NCRC 4C0HA 2H0VA 4S2FA 1KS5A 5F3GA 2Z5WA 2VO5A 3DPRC 5BV6A 3KCCA 1ND2C 2RM22 3GF6A 3MUZ1 4XFAA 3LOIA 2VULA 1POV0 1PO11 5FYCA 2XWBB 4QAWA 4AEDA 4E2SA 4GZ9A 3VV1A 2VU9A 2WO3A 1PVXA 5BNNB 3BVCA 1RHI3 2GNTA 4E27A 5KXEA 1W6MA 4XZPA 4DMIA 5FLJA 1DZRA 1AL21 2PN5A 3OUJA 1PVC1 1HN0A 3OD0A 4CDWA 3V0BA 2XPJA 4IW3A 1RVF3 1LAJA 2HYKA 3PUQA 2V4AA 4CXWA 3SQOA 3NO8A 4LBQB 2WN3A 2PAEA 3NSTA 4PDWA 2VVFA 2MEV1 4UT5A 1OOPA 2VXJA 3R4DB 2JG8C 3DXTA 3LEMA 2FDGA 1SLTA 1IPSA 3PUAA 1N3OA 1WW4A 2WC2A 3PVOA 2C9AA 5GLZA 1POV3 1QJU2 2IXHA 3OG2A 4JAAA 1ASJ1 1MS0A 4K8FA 2GC3A 3OGVA 4DNYA 1D7PM 3UK9A 1S2EA 4IL7A 3BCWA 1U5ZA 2JENA 4J1WA 1A78A 4MUVA 5APAA 4B1LA 1PMHX 1ND3A 5FXWA 1MS9A 2FZ1A 4AAXA 1JS9A 1O4ZA 4TN7A 3RYRA 3I7DA 3J7NA 3SEPA 4DRRA 3VD4A 1MR5A 4DO0A 5E8AA 4FXKB 1IS4A 1OT5A 1XSRA 3T1MA 3IDBB 4Z82A 4AI9A 1EUUA 3RWNA 5LBCA 1Y43B 1WW5A 2W94A 1J58A 1W99A 1R091 4XIKA 4EYUA 5L36A 5JXJA 5FYIA 1UPSA 1BKZA 4HKOA 3LZZA 2ZOEB 4YGCA 3O7OA 4XXAA 2DCYA 5GZCA 4UFHA 5H9RA 3ZFFC 1AX0A 1Z78A 3HD8B 3LEGA 3I8TA 3LIHA 5FYUA 1ENRA 2QQPA 1V70A 1BCXA 3IWZA 4NO4A 5T55A 2VOWA 5CFDA 3VBUB 3T3YA 1OH4A 3BOWA 5F39A 1KRIA 2RS13 2CL2A 2Q5TA 1RUG3 3EJKA 4R9CA 3RYKA 4JGZC 1UAIA 2Y33A 2W91A 2WNVC 4U2AA 1AR83 2A3YA 3SMHA 3WDWA 5JDBA 1OA4A 4Y1ZA 3WNXA 3DV8A 4YFZA 3CKHA 4CDUA 4AEMA 1GWMA 1HQWA 2ZGQA 1HB2A 4FTEA 3VZJA 1H4HA 5ANNA 1ZRFA 4DY5A 1IG3A 2YY1A 1KITA 4QKFA 3C7HA 4N7IA 1ZRDA 2WNUB 2WT0A 1CONA 4MGYE 5FP3A 5A7NA 2P3KA 1ZRIA 4GA9A 1LNSA 1SEFA 3G6JB 5F5CA 2HWD2 1AYM2 2BNNA 1BK0A 1MQTC 1G7YA 3ILFA 3LAGA 4Y5TA 5H9QA 3FLRA 1C8NA 3ZSKA 2IC1A 4LLFA 2MHFA 2W0XA 1IHMA 2HWE1 4NR1A 1TG7A 3POSA 5BNNA 1ODNA 1X50A 5I0RA 1XU1A 2XONA 3NAPB 4FP2A 2D6OX 3I2KA 5H9SA 3WQ7A 2PYTA 1HXS3 4YZ4A 1QNWA 1URXA 1RUI1 2XUEA 5EYYA 5LK5A 1FMD1 1IPKA 1M4WA 3UKVA 3LEKA 4LBQA 2A1XA 4ES8A 2XJUA 1C3HA 1UY0A 2B9UA 5A6ZA 3IAPA 3KF3A 5KC5A 5LK7B 4A41A 3GBWA 1H1AA 2FCVA 2E7QA 1VAVA 3MO4A 3HPNA 1V6IA 1YLLA 3ZN6B 3DXUA 4C1WA 1CESA 1LHWA 1U0AA 5LY1A 1C1FA 2Y38A 3INAA 1W2UA 2VVEA 3ILRA 4P08A 4P5HA 2C24A 1PGW2 3TRSB 3UV9A 4AI3A 5C4WB 1R1A3 1LESA 2PMWB 3GALA 3RYPA 4CDXB 5C6CA 4GWNA 1OLMA 1STMA 3CJXA 4N43C 5KWRA 3KT7A 4GJZA 2ZAHA 2FDIA 1GICA 4CEWC 3VBRA 3KMHA 3KV9A 4Y5Z0 1C4RA 4I09A 4ISQA 1G9FA 2K2SA 4XFFA 1VBA2 3I49A 4AQ2A 2A7AA 2ZX0A 5I8TA 3ZSLA 2CV6A 5FZ7A 1GNYA 1FV3A 1LOGA 2HJIA 5L73A 4MVTA 3PJYA 2WKKA 3U1XA 2FZ2A 1FX5A 4QM8A 1PIV3 2XQXA 4M4PA 4H14A 4PLOA 4YRDA 3VBUA 3VBSA 5FCCA 4CEYC 4D7TA 3DKWA 4CYDA 2W1UA 4UW3A 2J1UA 2D6LX 1S0JA 4XFIA 5FY8A 2BJSA 1RMU3 1U5YA 1XOYA 3O0VA 2P3JA 3PL0A 2EXKA 5AFBA 2XHKA 1GWKA 1O3RA 2VOTA 4PCRA 5FMOL 3QBQA 1EAH2 4BQXA 4DEQA 4CUCA 2LALA 4ORFA 4E4HA 1LHUA 1WLCA 5LZ6A 2WYSA 2D97A 3M7AA 4XF1A 5ACA1 5A3TA 5JSOA 1SCRA 1J3QA 4OMCA 5FYBA 2ZA9A 2H0BA 2WNUA 5JI9A 4XFBA 4OHYA 4LA3A 2CYFA 2J1TA 3J8F3 4NROA 5C3RA 1VMFA 2BFUS 1HV0A 3HN3A 2CGPA 4W4ZA 1MS8A 1VBE3 1O91A 3AZXA 3N9MA 4CE8A 1QHDA 4IV3C 2Q8EA 3GHMA 2DBNA 1UKGA 5FZKA 3ECQA 3OB8A 1HB1A 1UU5A 4LK6A 4LOTA 1QJEA 3RVHA 2I74A 3H3LA 3ZXKA 4ZXKA 3AMQA 1QEXA 1SHWB 2ZGRA 4MO3M 2X5IB 2DV9A 1RUE1 2UWBA 5IW0A 4A45A 3W21A 2HWC3 4N53C 4HSJA 3RRDA 3VKFC 3WY6A 4XJAA 1MPXA 1SZBA 2JDUA 1YYNA 2JEMA 3LFMA 3ZPOA 3B02A 5JLVA 3ZN6A 3PIGA 1SDDB 4UFLA 1SCSA 2WFF2 2AGSA 1NAEA 1YO8A 3OUIA 4PDWC 4DXTA 5HCAA 2R49A 1QIQA 3LA2A 1S0DA 2R16A 4G4FA 4YGBA 5DUUA 3APBA 2HEYF 1W3XA 3OEBA 5C4WA 4CDXA 1S0IA 3H1YA 2ZGMA 5CYYA 1VJ2A 4CDQB 3A7QA 1BEV2 1UYPA 2VUJA 3V0AB 1COV1 4GMP1 2IWGB 1JHJA 4FPOB 4EQVA 2VL4A 4DXZA 1IKQA 1EY2A 3HNYM 3BODA 2RS33 3BTAA 1ND3C 4TYSA 2WABA 1XNDA 3BIWE 4AWDA 1PX3A 1GR3A 3UKTA 1K5MB 4P9GA 1OH3A 5FP4A 1XXNA 3KWVA 4M4RA 3AB0A 3AX4A 4AAPA 2NN8A 3AMHA 2DVGA 2DF7A 2E9QA 3FHIB 4AGVA 1KQRA 1GOFA 2RS53 1HQNA 2BGCA 2RMU2 3EMRA 4FQ4A 4M3CE 1RUH2 5BNOB 2X05A 5FJKA 1Z7S1 2VNOA 3JU9A 1QXJA 2ZCWA 5JOYA 5FY9A 2J7MA 3AJZA 2JG9B 3ZYIB 1QJY1 4R9AA 3TOJA 3WF0A 4OI4A 3BOPA 5HBAA 5A1FA 3A22A 2VY0A 1QY4A 3OOXA 1OF3A 3E6CC 1ZBA3 2J1VA 5CFDC 4YW7A 4MX3A 3ZYHA 1RC6A 4LITA 2YFUA 1XNCA 4P9YA 1AXYA 4N7UA 4YNIA 1W8NA 2VPVA 5IUQA 4Y4RA 1PGL1 3WW1A 1S0FA 3ALQA 1Y3TA 4QHOA 3KS7A 2NLRA 2W39A 1F8VA 1PO21 1DG6A 3FFZA 3H7YA 1YFUA 2ZAAA 1NE6A 2BQPA 3LE0A 4GD4A 4XF3A 5JXHA 4FPEA 1G9CA 4I0WB 4F3JA 5E89A 2RM21 4KWLA 3I2DA 2XJQA 4E4SA 5B4XA 1F35A 2KR2A 1PMIA 2YG0A 1L7QA 1JZ6A 3X29B 2GNDA 1W8UA 2EXIA 2R062 3MLJA 3T2TA 3B01A 5CVRA 1K3IA 1Q8SA 1WMEA 2VJXA 3N35A 1H1MA 2DVFA 2UURA 3VBHB 4Q0QA 3ZXAC 4K9SA 2V09A 3WF3A 5BNNC 3QCWA 1JU4A 4C91A 1X9PA 4J6GA 4GQ7A 4BA6A 4EZHA 2TEPA 4XF0A 3KT1A 3THDA 1CAUB 1QJU1 4YVWB 2R0HA 5FK7A 4LO8A 3JZVA 5DAWA 3ZMNA 1J1LA 2DVBA 4BJ0A 1H9PA 3I2GA 4QX0A 5ISLA 3H3UA 1ND2B 2BPA2 4MZUA 2VQUA 3W9AA 2PHTA 3L2YA 2Y64A 3MZHA 4META 2VCCA 2PTMA 4XW3A 1PZ8A 1G9DA 2OA2A 1CPNA 2P17A 4BOWA 2FHRA 4CDQA 1CX4A 1XNTA 2DBIA 4OHWA 4YZ3A 3T0BA 3WCSA 2QBXA 3NL1A 1GP5A 4XDQA 3V0AA 4H3WA 3PVEA 2WZPP 2EVXA 4AHYA 4I0AA 2VMCA 5CKNA 4QT6A 4MLOA 4OI1A 4GWIA 4GWMA 1CGPA 1EPWA 4Q1RA 4XQWA 3A21A 3ZSJA 1K5MA 1PMJX 2JG8B 5L9RA 2F4LA 1QOSA 1QJX3 1HRV2 2YU1A 4LHSA 4B7KA 5K9YA 1BBT2 1DGWX 1W05A 2VW0A 3KSCA 4K6BA 3T0DA 3HNMA 1ENQA 2Q30A 2ET1A 4QX8A 2D6PA 1RJ7A 4Q4W3 4E4DX 2D93A 5ABJB 1JUIA 4QX5A 4LUMA 5BNOA 1C8M2 3GYDA 1CVNA 3PJQA 1CWPA 1UNBA 1AHSA 2EIDA 4Q4Y2 2N7GA 1FI2A 3JCIA 4DIQA 3HR9A 5AC93 1V9U3 1S0BA 2VMIA 4QB6A 4D6SA 1ULGA 3MLLA 3U0ZA 4LO6B 3VBUC 3OF1A 1H8TB 4I2OA 4TXWA 2GMPA 4JVAA 3NNFA 3N7KA 2D3SA 4Q4V2 2XB6C 1D0HA 1RUJ2 3WW3A 3PNAA 3ZMOA 2FCTA 3T08A 2HBTA 4CCCA 1TNFA 3R0RA 2G19A 2VG9A 4MXVA 3V65A 1OKOA 3Q8CA 1WMDA 4R9BA 3VHRA 3K4AA 3PHMA 1FYUA 3I2FA 4HVOA 3NNMA 1AYM1 1TME2 1DQ4A 1QQP1 2QQKA 3C7GA 5JWPA 3WNMA 1UW8A 3RFRA 4LO5B 3U14A 3JD73 3MV11 4JGYB 2JDMA 4FTBA 5JUVA 4UW5A 5HI0A 4LKSA 2WNUC 1NLRA 3OBZA 4YG6A 4R4ZA 1GKBA 3OTFA 2Y6JA 2JDNA 1DQ6A 1H0BA 1KJLA 2WNVB 3VKLA 4QQPA 3ROUA 2R043 4OUEA 5EJ1B 2YFZA 2KD7A 4XUQA 1RUD3 4GB33 4MXWB 4A6SA 5A3OA 3NKGA 5KC6A 2OQ6A 4GALA 3J7MA 2B4KA 4RSUA 1W8WA 3NAPC 4GKXA 4ATFA 2K46A 2KM2A 1BYHA 3ZKYA 1CAUA 2VCAA 4YVWA 1JYVA 3BYWA 4YLZA 1LR5A 5I0SA 5K0UB 2ARAA 2WWJA 4ZHNA 1EV13 4B4QA 4MYEA 4IGQA 1ND2A 5HCFA 5FUPA 1H1IA 1AUYA 3H8UA 1PGW1 2W46A 2FBEA 3HT1A 1T2XA 4FAHA 1LHNA 1UYXA 1V6KA 5FMDA 5CISA 2UY9A 4Y20B 1WA6X 4HLTA 2DUQA 2GN3A 4IE5A 5LA1A 3M3OA 5IHRA 2BDRA 2VW1A 2DVAA 3NJVA 5KHIA 1V6MA 5C4WC 4QQHA 4LBKA 3AZZA 4OULA 3D82A 4RHV3 1Q8OA 2JG8A 1DQ2A 1CIWA 1KXGA 2YC2A 1XE8A 1RUF2 3LDKA 4D8MA 1VBA1 2RR11 5FO7B 2PHRA 3W5MA 5DDJ3 4EN6B 5HV4A 1OLME 1QKQA 2XHNA 2GAUA 2XJRA 1NT0A 2W1QA 3AKRA 2VCMA 3HN1A 5ABJA 3FHQA 4QGLA 4RQPC 5KHJA 5DG2A 2A3XA 4XHBA 2QQNA 3POWA 4W6YA 3N9PA 5JIAA 2VQTA 3W20A 1CAVB 1LKNA 3WP3A 2WQ8A 2WZEA 1UOBA 5FPAA 3WW4A 5T5JA 5EQUA 1FXZA 1H8TA 5FY1A 5HV0A 4OFGA 1EAH1 2EIGA 1GU3A 2K9ZA 1QOOA 1LJ7A 2BWCA 3B7MA 3KV4A 4QXKA 4G9SB 3M3QA 2BNMA 5GALA 5FMOS 1MZEA 3M4FA 1PM7A 1O5UA 1S55A 3GZUC 3FFQA 5DZGA 2VTFA 4XJ9A 4IEUA 4HOOA 5A7OA 1BMV2 2WO1A 2R1DA 1CR7A 1LOEA 1M06G 5IK7A 2WAOA 3SH3A 3IPVB 3ZYJB 2BWAA 3ZVXA 3HQUA 4BLIA 4KU8A 3RPQA 3VLBB 2Z2SB 3D0JA 4HT1T 1DGWA 2PAKA 1VAKA 3B93A 3O1OA 2WNVA 3KT4A 4YWAA 1JYIA 3C8XA 4RA0A 4PQ9A 1RHI2 1ZZBA 1GYKA 1YEWA 2TBVA 2ZKLA 4QGNA 4QKDA 1XBFA 1QXPA 1B35C 4K1YA 1UPIA 1VALA 4AW7A 4E9KA 4FPGA 1IQDC 3AMNA 2FD8A 1RVF2 1O5LA 3LGRA 2MEV3 3MICA 1QF3A 5K0UA 4S2DA 1DZQA 3LB9A 4N8MA 3GZAA 4GXLA 1TMF1 1S2BA 2WFF1 1LOAA 3VL9A 4ZZ8A 2RHPA 2X5IC 2ARXA 1NOVA 4IDZA 5J7MA 1ASJ3 1T6BX 1ACCA 2Q1ZB 2QE3A 4LXLA 4RS5B 4PI0A 3W59A 3WD5A 4QXBA 4W50A 4P9JA 4UI9L 2WRAA 4AGGA 1VRBA 1VBB1 4PJYA 1BEV1 4Y20A 1NQDA 3TAYA 1D2SA 1JZ3A 1TNRA 4AFDA 2ERFA 2PXJA 5FY0A 5FYVA 4Q8KA 2O8QA 1LULA 5DAPA 1LGNA 5CBLA 2TUNA 3M8LA 5FZAA 4I30A 3FUOA 5A3PA 1OLQA 1V6JA 4N53B 4CDQC 5C5UA 4EN8B 3MIGA 3WF2A 3I2OA 1B09A 1R093 1ZM1A 3F95A 1LOFA 1O4TA 2WZ8A 4JKKA 1BK1A 2RMU1 2HWF2 1RUH1 4LNVA 1K5MC 1W90A 5FAXA 2I45A 4AVBA 1G86A 1UY1A 2CGNA 5IVCA 1QOTA 5LWBA 1XSQA 1QMJA 3SEEA 5DMYA 3CZUA 5C7GA 4Q8LA 2W1WA 1CAVA 5A3MA 4PIYA 3ST7A 5A1AA 3K51A 4IE4A 5EP9A 1FPN3 4P14A 3UGFA 3H8RA 1CQ9A 4LOSA 4HG6B 3OBAA 4XJZA 3I2IA 4ZXEA 1ZZ7A 2RS12 2VBDA 1E5RA 2ZBJA 3MFAA 2JG9C 4D3WA 3WG4A 4XE9A 3BTZA 2C6SA 2VQ0A 4DRVA 1VE0A 3S57A 1YQ6A 2DU1A 1AR82 4LHLA 3NMBA 4XURA 2Z79A 3T30A 2FMYA 5A6QA 5JOZA 2ZX2A 1DBNA 1O3SA 3NJZA 2EAKA 3R4SA 4S2GA 3BALA 3FMGA 1W3VA 3IPVA 5LB6A 2XKOA 5IFPA 4JRAA 5BNPB 4Q4X3 4YM1A 2R061 3IN9A 2W92A 4CCLA 2JB8A 4RN5A 5HCBA 2HWE3 4ZPIA 5A6XA 1DIWA 1TE1B 3KM5A 5FTTC 1OF4A 2YHJA 4QB2A 3KGLA 2XR4A 2AREA 3VD5A 5FZOB 5J1XA 4DB5A 1RUI3 5J98B 1OUXA 1HXS2 3WEZA 1XB9A 4DEVA 3USSA 1TEIA 3A0KA 1TQ5A 2AR6A 3WVJA 5CG9A 1H6XA 1US2A 2R7EB 3VBHC 1ZZ6A 4AOCA 3A23A 3OPZA 4LK7A 1W8OA 3CU7A 4JHZA 1OVPA 3K2OA 1WUVA 2DUPA 4YM0A 4RS5A 4IV3A 5IVEA 3JBG1 2AEYA 1UOGA 1W9SA 3ZPYA 5E6HA 1KGYA 3HMYA 4YVWC 2BW8A 1W9YA 3T4VA 4E8CA 2JB4A 1O6UA 1IZ3A 2OZJA 1HJFA 2CDOA 2HKXA 3O14A 4L9BA 1QU0A 4NIIA 1R1A2 1U12A 5A32B 2AYHA 4QX2A 4CU6A 4EROA 2R0FA 5EIYB 4N53A 3L9JT 3DUIA 1XNAA 4JTNA 3QOPA 2Y6GA 1BBT1 3WCRA 2OS2A 4L0PA 3POEA 2ZGUA 1JU3A 5IFTA 3H8OA 5FY7A 4AK3A 2JDYA 1C8M1 3HIFA 3T1LA 2ZHMA 3OSDA 3ES1A 5GLTA 4KWUA 3VN4A 2WZR2 3UKNA 5SV8A 3I2JA 1XRUA 4MH0E 4Q4Y1 3WNKA 5BPXA 3J4UH 1UY4A 2Y6KA 4A7YA 2JWPA 1PIV2 5ABJC 5DPNA 5EYXA 3RG0A 2A70A 2VBBA 1Q8PA 1WW6A 4FTSA 2FQPA 1MS4A 1NE4A 1ULOA 2CAUA 2QTWB 3LF7A 3NV2A 4NUBA 2E7AA 1Q3EA 4OMDA 5F2SA 2YBKA 4Q4V1 3WG3A 4DUXA 2UU8A 1MEC1 1RMU2 1RUJ1 2IXLA 2C4XA 1W0NA 1GMMA 1EP0A 3EBRA 4CCDA 1AXKA 3DL3A 3OUHA 2FDFA 3AK0A 2EF6A 5CIRA 1AJOA 1H8TC 5FV3A 5KR7A 5ACA3 5A7PA 2WR9A 2Y6LA 4F83A 2XXZA 1TME1 5CEHA 4CUBA 3I3DA 2VZ1A 1RUC3 3VZOA 2KA3A 3CQOA 3I3EA 5F5IA 5LA9A 4Z2AA 3WP4A 5BNPA 5I0DA 3J8F2 4O65A 2WNEA 1NYWA 2BVVA 2IFWA 4QU1A 1BQPA 2FDHA 1YQCA 2LS6A 2A71A 5I8YA 2B5HA 1H6YA 2ZGTA 2YZ4A 3FBMA 3HBZA 4NWWA 1MS5A 4NIAA 5FPBA 1VIWB 4JGYC 1BXHA 2O14A 4Y22B 1NXMA 1UKRA 5DUXA 5FZOA 4YW2A 5IVFA 2UYAA 1XJAA 1RUNA 3ES4A 2B8MA 1UD1A 4EWEA 1SMVA 5CB7A 4YSFA 4K1ZA 1BLZA 4UBGA 1ULPA 1RUE3 1Y7BA 4GMP0 1MZFA 3LOBA 3ZFEC 3IMMA 1W6PB 2HWC2 2I2SA 3IMNA 3ABZA 1YI9A 4RGKA 4RYDA 5G05L 4WVZA 4PBPA 2O1QA 1P8JA 3VHPA 1EYBA 2VUDA 4AVSA 5K0UC 5FZ9A 1J83A 4MGKE 1GZWB 1N3QA 5EWSA 4XUTA 2P5BA 2GC0A 5JPMB 4CXYA 1AR73 1OQDA 4M0HA 5A3NA 4PLMA 2XMLA 2WS93 2VMDA 1G9AA 1W8ZA 4GMP3 1ZBE3 2L9LA 4LO7A 5E16A 5FZBA 1QXRA 1RUF1 2DURA 5EFUA 2GNBA 4BQYA 3O1VA 2XWJB 2VZ3A 5IVVA 3ATGA 1AR92 3E6DA 3ETQA 3MF6A 4UFMA 1S0EA 5JR7B 5IYYA 3VD3A 1G9BA 4AR2A 2DDUA 3BIEA 1NG0A 2J1EA 4XMAA 2QQIA 4PIZA 5FBJA 5B4NA 3TN93 3BPSA 2JIGA 2ZZJA 3UL2A 2ZEZA 3KGZA 4LBMA 2RS52 5FZ4A 1VB2A 1Z7S3 1JH5A 4QPGC 3WDYA 1LOFC 2A6VA 4QXHA 3CEWA 3IM0A 2NYYA 3TYJA 4CVUA 2XLFA 1A8MA 5LCWL 2E7TA 3VD7A 1QJY3 3DKQA 1HV1A 3MEPA 1CAXB 3KB5A 4TSVA 3AVSA 1WCQA 3B9CA 5D21A 4ZY9A 5FP8A 4MHRA 3J26N 3ZYGA 5JMOA 1OPOA 3PUSA 4COZA 1XNKA 2R30A 1OSGA 1JZ2A 1ZBA2 2YBSA 2WWUA 3IIAA 4HXCA 2ADEA 2DTYA 2G9FA 3J7HA 3P3NA 1UX6A 2PHWA 3OBRA 3RZMA 1BMV1 1WA4A 4LULA 1H2KA 1DHKB 3ZFGB 4SBVA 2Q4SA 5CNAA 1WWYA 4RQPB 3UGGA 5IVBA 1PO23 1PNFA 2P1BA 3AYDA 3DECA 3FJSA 3KV5A 4G3YC 3ZXDA 1JYNA 4JDOA 5FZHA 1MZ5A 5C9AB 3CIHA 2QQLA 4D6RA 4A6OA 2UWCA 1JOPA 2P3IA 4ARYA 4AI1A 2E26A 1VBC1 4Z2WA 5F1RA 3O1MA 1NY72 2X53S 3EQEA 3WT3A 5J37A 5L9BA 4CCNA 4FBFA 4OI0A 4Y22A 1LHVA 3OGGA 1YFWA 1YIFA 2WLQA 3B69A 4FFHA 4XACA 4XFGA 3MW3A 3N9LA 3SC7X 1MZ6A 3T2QA 2QFEA 1UO9A 3O1TA 2JKBA 2GMMA 2VVDA 1JW6A 1W6PA 2WN2A 2ET7A 2ZPXA 1NLQA 1PM4A 1D4M1 3DEMA 4XJWA 2VR4A 5LRRA 3RI8A 1N47A 1SFNA 2W2IA 1GZWA 5FO8B 4BQ2A 4BIOA 2EIBA 3HQXA 5IVYA 5FPXA 3H8XA 4KMQA 4RS5C 5EPAA 3H42B 3K77A 4XC9A 4FQZA 3ZO0B 3NAPA 1B35B 3BB6A 4C90A 2ZGNA 3WF1A 1ZYBA 4K21A 4PLNA 1W2OA 3E5QA 5L7OC 1ZA4A 3IDAA 1O4YA 5A6YA 4NHMA 4IEYA 1UXZA 2HWF1 5IK4A 1QJX2 1OBNA 2WA3A 5BUVA 2ZX4A 4CPBD 2AEZA 2HEWF 4K8RB 5FO9B 1W8HA 2WO2A 3CDZB 4JC1A 4RD7A 5FZCA 1VMJA 1PK6C 4Q4W2 4OUMA 1GQGA 3VDCA 2DTWA 4P9LA 3OEAA 1DGRA 4IERA 4ZU7A 5KHKA 1YI7A 3PURA 1CAXA 2D6MA 4AE2A 5J48A 3POFA 2RS11 1WLDA 3I3QA 4QD2A 3NNGA 2UYBA 4Q5OA 5FZEA 4V1PA 5AC92 2QQWA 5DZEA 5C8CB 2VXRA 5JOXA 4DS0A 1Y9MA 4LKEA 4I02A 5A3LA 1U5IA 2YC4A 2VNVA 2W5FA 5C3PA 1I6XA 1BVP1 3GM8A 3ZFGA 4BPZA 3VD9A 4GKYA 2VQAA 1RXGA 4RQPA 3RZHA 4LORA 4YG3A 4L92A 2VBPA 3E6BA 1R083 1UU4A 3UYJA 5C9AA 1QQP3 3ACHA 3N36A 1FOD1 2DWRA 4EV0A 2WIIB 2GC2A 2P2KA 1R1ZA 1LTEA 4E8DA 1AJKA 1WMXA 1PHMA 3JD72 2EXJA 1SACA 4FPJA 2Z42A 4IGOA 3OYWB 3WNPA 2HWB3 3BPZA 3DGTA 1IPJA 3DYOA 4LA2A 4F7ZA 4FPCA 5BNPC 3GBFA 4YM2A 1AR63 5LEJA 4V2WA 5T5OA 4QDQA 4QWNA 2R042 4YARA 4KBZA 2UY8A 5GJ6A 4BCUA 4RL7A 5FR3A 2LW8A 3UGHA 2XBO2 4MOAA 2YB7A 1W9WA 4O61A 3FC0A 2BUKA 5DUVA 2RV9A 4FO9A 2VCBA 1OA3A 1EV12 1GQHA 1W0OA 2JE9A 4WM7C 4CP2A 4IUGA 1ZA7A 5SV5A 1LEMA 3WP5A 5F9TA 1KJRA 2IXKA 2QDRA 3N3HA 2NMOA 1F4HA 2VTXJ 3K46A 4HL0A 2PHDA 3AXDA 1B35A 2VZRA 1RUOA 2B42B 2ZGPA 1ZVFA 4Q1PA 2QZ2A 5CKMA 1VAMA 1W2NA 2RJLA 2VOXA 5D8AB 3WZ1A 5FWJA 5AFEA 1I5ZA 4IV1C 1LOCA 4IGPA 4LR4A 2RR13 3AYEA 1RIRA 2X5IA 1CPMA 4C0BA 2VNRA 1PGSA 2A75A 2VMFA 3B00A 4CCMA 2XVKA 3SKVA 2BU9A 2WZR1 5DDJ2 5I8SA 1NA1B 3ZKUA 5C3QA 4Y3OA 3NWKA 4MGZE 4Y1XA 5FZGA 1W8FA 1HB3A 3M70A 3VZKA 4ZS2A 3DYMA 1WD3A 4JKMA 2J1SA 5F32A 5T52A 3ORJA 3MUY1 4OCTA 2AH2A 3VDDB 3GXUA 2WINB 4O7XA 5F8PA 5C8CA 1RMU1 4YW4A 1PNGA 3AKSA 2RJKA 2P6CA 2FMDA 3U4XA 3GZEA 1OVSA 1LENA 1UZYA 1OPMA 3ZR6A 2QKDA 4ASLA 1UQXA 3H9AA 2GSYA 2BERA 2WYFA 5EJZB 3BTXA 1MVEA 2GC1A 4IQPA 3PU3A 2DCJA 2IXIA 3WQBA 3E1F1 3J8F1 3SLIA 1AYN3 1Q8QA 3TNQA 1W04A 3OY8B 1XE0A 2Q8OA 2VAUA 2PQQA 3MYXA 2D98A 3B9IA 4YFWA 5FYZA 2JG9A 3ACLA 3FWEA 4C1XA 4CU9A 4EWDA 5C3OA 4OQ8A 5FOJB 4KWJA 4DUWA 3FUQA 5FZ0A 2ZHLA 5FQ0B 5FUNA 1V0AA 4B8EA 5HXVA 1RYYA 1DP0A 3LDBA 4YM3A 2P3YA 1DF0A 3MGUA 4O9GA 1JBCA 4A3XA 2OX0A 4HFSA 2HYXA 2HWC1 3AKQA 3MW4A 4EN0A 5C8WA 2J22A 2O8OA 1YRZA 1O59A 5FPLA 1EUTA 2XVLA 4IE6A 3ZXGA 4BISA 5K8SA 1TMF3 2MEV2 2TNFA 2WFF3 1W2AX 1WCDJ 4NVPA 3FHAA 1VRH3 2WL1A 4BDVB 5A7QA 2VZTA 2HWD1 2BOIA 2IXJA 2V5DA 1YQ5A 2WSUA 4QPIC 1ASJ2 5IWFA 2ZGSA 4AI0A 4DINB 1GANA 2YPDA 1YIPA 2BYVE 3VZNA 4DZGA 1IS6A 1VBB3 3WUDA 4CZSA 3S5AA 1S2KA 2WLPA 5GZGA 3WDVA 2WA4A 1H4GA 1UU6A 3KCYA 2VOVA 5BY5A 2RJ2A 2VZQA 3HEIA 5D8AA 4K20A 1W28A 3LPFA 1YUDA 4NIDA 2ID4A 1H2MA 3AP9A 2VMEA 3MPPG 4LHNA 1AR91 3VBHA 4KG0A 1ENSA 4LTAA 4RFT0 5GLVA 1WGPA 3ZFEB 2EALA 2Z69A 4LKFA 3CLPA 3AMMA 2OIIA 1LCLA 3ILNA 4LIUA 1SBFA 2DYCA 2PLV3 4UOJA 2GP5A 4EE2A 5FP9A 5FK8A 1JXNA 3AP6A 1R092 1NA1A 5BYNA 1SDWA 2RS51 1UIKA 3SH4A 4CPBA 3D6EA 4DFSA 2G1MA 1J59A 1UZZA 5FKCA 4MG2A 4GH4B 3ZXFA 3AZVA 3KQRA 5FJHA 2YC0A 3UJOA 4LBNA 1VP6A 3VDDA 1U5XA 5JXIA 1I3HA 1JZ5A 3Q8EA 4FI9A 1F31A 1FPN2 1O3QA 5FKBA 1YJKA 5B2GB 2R072 3PU8A 1RINA 1XC6A 3ELNA 4AI8A 3AP7A 1OD3A 4P9IA 4I01A 3M3EA 3K3OA 4IXLA 2JIJA 4UXAA 5LW9A 3H3ZA 2JICA 3H7JA 4XILA 3T09A 3WW2A 2DCKA 1ULCA 5FYMA 2W95A 4W6XA 4LBOA 4MGQA 3ZX7A 5EHDA 1UMIA 2Q0AA 4GJYA 1PZ7A 2JECA 3ZIXA 2LROA 2YGMA 3OY8A 4QPGB 3FX3A 4B4RA 4JV4A 3LQCA 5DUWA 5AVAA 1HRI2 3I2HA 3ZFGC 4LPLA 4IEQA 4NAOA 2GN7A 3THCA 1NY71 2VZPA 2R063 4AQTA 4BM8A 1QDCA 4BQ1A 2XVGA 2ZX3A 4Q4X2 1N1SA 2WAAA 5C9AC 1VB4A 4UW6A 3VZMA 3OGSA 2HWE2 2Y6FA 1IKPA 1O8SA 3E5XA 4IE7A 4BZ4A 4HVQA 5FQ0A 1GZCA 5J09A 1Z0HA 3AVRA 4EN7B 4P9WA 1VBD3 2GH2A 4ISRA 3RJ2X 4NIHA 5C5TA 1NKGA 3ACFA 2IFRA 1UY3A 2R1BA 4QKNA 2FDJA 4FP3A 3RZGA 5CG8A 3CZJA 1JOJA 1GSLA 2W3JA 3KZ4C 5DXDA 3O1PA 4IEVA 2DFBA 4HPKB 5CKQA 5FZ6A 4HK9A 2NZ9A 4X6QB 5JMCA 3MLKA 4UAPA 3J9SA 5IK8A 2ZGLA 2VZVA 3AZWA 3JBG3 3ZOIA 2VD7A 3SHRA 1YWKA 2OQ7A 4QDSA 2GNMA 2JD9A 1UZWA 2OPKA 3PLQA 1LECA 4JGYA 4MGIE
chains in the Genus database with same CATH topology
2XH6A 4QQOA 2JD4A 3VKNA 3A0NA 1PO13 4H55A 4YZ1A 1XU2A 4JDMA 4MXWA 1AL23 3V64A 2V73A 3ZFEA 1PVC3 1UIJA 4JCKA 1S0CA 1QJX1 2BEOA 2OW4A 3NKTA 1C8M3 2PHLA 4Q4W1 2GU9A 4FOWA 1AZDA 3VZLA 1V6OA 4GH4A 3PVBB 1D2QA 3RJRA 4FOVA 4ZU4A 4AXOA 2B7YA 3W58A 2GMEA 5AC91 4Y26A 4BMEA 1XYPA 1SLLA 1IGOA 4XOGA 2LM3A 4HK8A 4YW5A 5L7OB 1MEC3 1RUJ3 3AZYA 1I9RA 3H1WA 1AVBA 3CL1A 4NHLA 3VBFC 4XTMA 5C8CC 2QDNA 1ZRRA 1G8WA 5E1RA 3VBOB 1UF2C 3JUUA 5ACA2 1PK6B 3ME2A 1BVVA 2BFUL 4QPGA 1RUC2 1S0GA 3S7EA 3CNAA 1LU2A 3JD71 2QUOA 2QCSB 5GZFA 3WG2A 5DZFA 2CNAA 4B7EA 4NN0A 4FPHA 3MIEA 2PAMA 3M1HA 1RUG2 2XBO1 3V0BB 4HN0A 1WLWA 1C57A 4HVRA 2E53A 4LEJA 2G4IA 1AL0G 1FNYA 3QD6A 4HPKA 1RUE2 3RI9A 5IK5A 2G9GA 4I0BA 1EV11 4KG8A 3FLTA 4XBLA 4KGGA 3VUOA 1LGCA 4WVWA 3THTA 2WT2A 4KL1A 4CP1A 5KHHA 4R9DA 1REFA 1ZNPA 3M3CA 2ZMKA 4HN1A 4JQRA 3R4UA 4OUSA 3R05A 5KHGA 2JX9A 1RGSA 1AR72 3PMSA 4IETA 4MSVA 4QU2A 2MNGA 2WS92 1KFXL 4W6WA 4XJ8A 1ZBE2 1CJDA 1X82A 1DQ1A 1OFSA 1FMD3 3EHKA 3WDUA 5DDJ1 2C1FA 1RJ8A 5D8AC 1WD4A 4UBHA 2VMHA 4AHWA 4WM7B 3IKWA 1WCSA 4GIQA 3RSJA 1OMIA 3HT2A 3PVNA 5J36A 1YCIA 3TN92 1ULEA 4EN9B 3DN7A 1NA1C 1YXWA 4Z92B 1Z7S2 4YGDA 3SCGA 4M3CF 1J3RA 4AGRA 3OBTA 3AM2A 2A5ZA 2XG3A 3NW4A 5L7OA 2YROA 4J1XA 4D94A 5I93A 3HWJA 1ULDA 4IV1B 2R6QA 2D6NA 4Q26A 5KBFA 4QM9A 3VDDC 3MW2A 4OHZA 3VHOA 1AX2A 4XQ4A 3ZXLA 1Q8VA 1HRV1 3OGJA 3VBOA 1D0GA 1PK6A 2JXAA 1SLCA 4XMIA 4COUA 4XBQA 2IXCA 3NVCA 1PO22 1N1VA 2DUOA 1CD3G 3U11A 4AQSA 3C2UA 5CFCC 1VBC3 1DQ0A 3D8CA 3EXUA 4ATEA 3WP6A 3N7MA 3VL8A 2W68A 4OVEA 1OLRA 1A8DA 3MPBA 4WM8C 4JTOA 4B4PA 2BBVA 2WT1A 5T5LA 2AUYA 4BH9A 1JUHA 5F5QA 3LWCA 3WHTA 4COYA 4AG4A 5GLUA 4A7KA 2Y26A 5JSPA 1D4M3 4D7SA 1VR3A 3E5UA 3NV3A 3AKTA 4HSLA 4QQ2A 3IDEA 4D7YA 1WMFA 2QNKA 2R32A 5CA6A 1DU3D 1LEDA 2WJSA 1VBE2 3OJBA 4L11A 5JI7A 4XTPA 4FPYA 4CP0A 2B46X 1V6NA 1SBDA 5T50A 1GNZA 3VBRB 3ZDSA 2ES3A 4WBBA 2ZGKA 1XE7A 4BMBA 3WX5A 1MACA 1REDA 3SH5A 2HWF3 1WBFA 2D3RA 4WM7A 3D0SA 1N3PA 3LA7A 5GLWA 3B3QE 3S0MA 4WZFA 4BYYA 4QPIB 4COVA 4R4XA 2ZJCA 3WOGA 5J96B 2DCTA 2WWSA 3VBSB 3URFA 4LHKA 2E51A 1FPN1 1H30A 3D5OA 2R071 3BU7A 3JQXA 4GH4C 4AFCA 2YV8A 3MIDA 4IV1A 5A32A 5F6LB 1LGBA 1COV3 3S6PA 4HKLA 1X7NA 2XJPA 4M01A 3WQ1A 5I0UA 4BIFA 4HANA 4X6RB 2A6XA 2RS32 2VUAA 4K3UA 5KXCA 5JZGB 1HRI1 5I91A 4R52A 1IS5A 4X8NA 1X8EA 4W65A 1R082 4N9IA 1FOD3 1QQP2 2ILMA 4Q4X1 3AKPA 3POYA 2OYZA 4FCAA 4LBJA 4RR3C 1ALYA 2HWB2 3I4IA 3MDPA 3ZN4A 1V6LA 4ASMB 1OKQA 2JJ6A 2D5HA 1AR62 2QZ3A 3WHUA 1WCKA 5EJ3A 4LE4A 5EZWA 4E2GA 4H7MA 4NHKA 1FV2A 1SQ4A 4INDA 3KCXA 1I1EA 1FNZA 2PA7A 3C3VA 1QGLA 2JDZA 2PHUA 5IT6A 2ATFA 2RM23 3QH6A 4M0NA 1Q43A 3B5LB 2I07B 2Y0OA 3ZXEA 4N90A 3N7LA 1RHI1 2BVBA 1Q5OA 4L2NA 5FFOC 2VECA 4TWTA 2KXLA 1IS3A 1RVF1 1W6OB 4Q0SA 4HKWA 1C28A 5AVPA 4FPFA 4F8AA 3L2HA 1SLIA 2A6ZA 2RR12 1NLSA 3GNEA 4IEZA 1RB8G 4AI2A 2WZR3 3P3PA 4KH9A 4BE3A 4QPIA 1QJU3 4P9XA 3AYCA 1H2NA 2DFCA 1W39A 1OQ1A 1POV1 4WVVA 4E4ZA 2XJSA 5BXXA 1W0PA 1V00A 5GKAC 4AFMA 1C5HA 3VHNA 4KNCA 1FAYA 1DYKA 3NV1A 1E57A 1MS1A 4Q0VA 4Y1YA 1SLAA 1QNYA 5T5PA 1W6QB 2ZGOA 4FXGB 1KS4A 4URTA 5J3UA 1GNHA 4Q0UA 5JZGA 1SBEA 5JAXA 3PMEA 2XUMA 1RUC1 3UJQA 4XBNA 1A3KA 3USUB 3ZSMA 1A6CA 3TBDA 5GZEA 3VBOC 1AYN2 3FZ3A 5CADA 3QACA 4FOQA 2PFWA 3O0WA 4IESA 4I3PA 1RUG1 2P34A 3VBFB 3VKOA 1V9U2 2QVSB 2D6KA 4AEDC 2ZS6B 4O9EA 5CU1A 1AR81 5F6KA 3WLUA 4YYOA 2ZTNA 4CDWC 2CTVA 4XFHA 4H7LA 1UMZA 2PHXA 4Z07A 5KXBA 1TMF2 2DU0A 4MV2A 1GLHA 3LSDA 5LRSA 1S1AA 2HWD3 3MFCA 2LUWA 1AYM3 1CJPA 1O7FA 1OOPC 1VRH2 4OLLA 4A2UA 3RNSA 1H9WA 1AR71 1Q56A 1HW5A 2ZMLA 4A7ZA 1VBB2 2WS91 3B94A 1LRHA 1XQNA 1ZBE1 4L8QA 4BWOA 4YZ5A 1AR93 1HXS1 1YFXA 1W6OA 4L97A 3WV6A 2NQYA 2A3WA 1AX1A 3ZYRA 1SLBA 2YGLA 1RUD2 4GB32 1F5FA 2D44A 2PLV2 3U07A 3JQWA 5D1IA 3TN91 2RE9A 4KQ7A 2ENRA 3CO2A 4AEJA 4HZFA 3LKJA 3WR0A 1HIXA 2H6CA 1R1A1 4FSJA 4LBLA 4D69A 1WW7A 4TZDA 1HX6A 4RGAA 5JOWA 4AVAA 5JVVA 1GBGA 3KD4A 1W6QA 1OD5A 4AEKA 5JSRA 1RTVA 1VBA3 4XPVA 4RHV2 1QJZA 3JB4C 3TNPB 1GV9A 2E6VA 2PHFA 1UN1A 2VH9A 3M2MA 1ENXA 2A6YA 4Q0PA 3USUA 1AF9A 3ZN5A 2NM1A 3IBMA 4CDUC 3ZIWA 2OUJA 4YVSB 4XETA 5FLIA 3ENRA 1PIV1 4SLIA 4AHXA 4Z1VA 4Y1VA 4XEZA 5I0TA 1KDKA 4WZCA 4EJRA 3VBFA 1QWRA 1ZRCA 2XL7A 1N1YA 3WINE 3LSEA 2BNOA 1MVQA 1NCQB 1EAH3 3S7IA 3LCPA 3MI8A 3M3IA 3AFGA 3CJIB 1VLNA 1DGLA 2E63A 1KDMA 3AP5A 3RQ0A 3K48A 4K7JA 4DQAA 4L99A 2F4PA 1VBD2 1C1LA 4Y24A 2ARBA 1NCRB 4IEXA 1HDKA 1REEA 4QQLA 3IDCB 1KFUL 1ZZCA 1XYNA 4JRLA 1W6NB 3AMPA 3DPRB 4AVTA 3VGIA 4KBBA 3H0OA 5DG1A 5CFCB 1SFYA 4WVMB 3JBG2 3GBGA 3O12A 4AFAA 1VBE1 3O5SA 2ZX1A 3ZSEA 4GULA 1DFQA 3GHNA 4K40A 4I3GA 3OYWA 1CN1A 2ZKNA 4WM8B 5FPZA 2ZACA 3PTYA 2ZHKA 1ZZ8A 3TB0A 2O0OA 3RDIA 1PO12 2YDEA 2X8KA 5T54A 4LT5A 4U36A 2ZHNA 1JYCA 3N7JA 1AL22 3FBYA 1PVC2 3WUCA 3GZTB 2WQZC 1PZ9A 3VBRC 1ONAA 2GDFA 2B39A 2XJVA 2D7FA 4ZKTB 5L19A 1LB2A 1X36A 1YFYA 2CY6A 4Z8BA 4QPYA 4EWAA 2YPJA 1Y9QA 3WDXA 1ZX5A 3SXWA 5A33B 3A4UA 3TWIA 4ES9A 1BEV3 3VBSC 4DOUA 1LOBA 5C33A 2Y0IA 2ETEA 1G6NA 2B45X 2EA7A 1EPZA 1MEC2 1X33A 2RS31 4AF9A 5JPNB 1YHFA 4IEWA 1OFNA 5EV7A 3ZFFB 4XJUA 1DLLA 3LA3A 3FLPA 1R081 1DZTA 2XJTA 4AFBA 2RMU3 4YVSA 5T3NA 1RUH3 1UL9A 4DPNA 3AXEA 1OQEA 2SBAA 5JZGC 1MS3A 4JGZB 1JHNA 4LE3A 2HWB1 4UW4A 1H8VA 2VMGA 2AZ5A 1AR61 1OA2A 4R8HA 1NCQA 4RGGA 4E2QA 1ZBA1 1LHOA 3AJYA 3CJIA 5FREA 4D7TA 2XBO3 2W08A 4Q27A 3MIHA 3DF0A 1NCRA 1DYPA 2XKPA 1QH7A 3O0XA 2SLIA 2DCZA 4BHPA 4WV8A 2WFPA 4OZXA 1W6NA 1J3PA 3DPRA 4XFCA 1J1TA 1MQTB 1DQ5A 5CFCA 3RMYA 2GZWA 3SNMA 4WVMA 2K0GA 2GH8A 2CWSA 4N9HA 4S2HA 4RR3B 2ZZQA 4WM8A 3RS6A 1FT9A 4CTEA 3FE5A 4NOTA 1D4VB 2JE7A 1LU1A 4CDXC 4NWVA 4IEOA 4HMZA 2D5FA 3SITA 1RUI2 4BLJA 4PF5A 1FMD2 1F2NA 4COWA 2BTVC 4AVVA 3OCPA 4YGEA 4KGQA 3EO6A 5FOBB 2V5YA 1KD7A 1OHFA 2LTNA 4YW1A 5K7PA 1LODA 3Q9OA 4Q29A 5FDBA 5A33A 4FT8A 2OVUA 3QLQA 4N43B 4QGMA 5BNQA 3IT8A 2NP0A 4CEWB 2NPIA 4CRQA 2PELA 1RITA 4Q2FA 4FPLA 1HRV3 2ZMNA 1BBT3 3ZFFA 3ZXJA 4M3CB 5JCTA 4NPRA 1IOAA 2C0ZA 4X8PA 4CEYB 1AYN1 4KWKA 3SISA 1O3TA 2A6WA 4HBNA 5KXDA 1DGRN 2AENA 5LEKA 1H2LA 3AFKA 3U10A 2D43A 1NQJA 1BZWA 3HAGA 1HKDA 4JGZA 1JN2P 4Q4Y3 4QHBA 3WG1A 1CAWB 5CAZA 5TSWA 1AXZA 1T6GC 5GZDA 1QDOA 1VBC2 2EXHA 4LUKA 3WXPA 1V9U1 2D3PA 2XLAA 2CAVA 1IQAA 3ASIA 4Q4V3 3S30A 2MPFA 4HETA 2EAAA 2F6BA 2X29A 2YXSA 1ZZ9A 4FPKA 3I59B 4PIXA 1MQTA 1ULFA 1TME3 1VRH1 2WQ4A 3AYAA 1D4M2 4IV3B 4XHXA 4XXPA 5E88A 4XF4A 2VNGA 4RR3A 5FLHA 2GALA 2P37A 2VOKA 4Y4YA 4YW3A 1FATA 5H9PA 4AEDB 4OHVA 3SCHA 1DDLA 3OD4A 2DVDA 2R041 5FRAA 1BJQA 1W6MB 4KU7A 2H6BA 1ZREA 1RUD1 4GB31 3WDTA 4LBQD 3JB8A 1X8MA 4CDWB 1NXD1 1YJLA 2PLV1 2ZABA 4ONUA 1XYOA 1L3JA 2C5DA 4IEPA 4PDWB 3I54A 1OOPB 2QJVA 4AVCA 2CGOA 1OI6A 4XIOA 2A73B 3KLSA 5FBZA 1WBLA 2IZWA 4Y1UA 3MIBA 4TLFA 4ITCA 1C5IA 4N43A 1NZCA 3CF6E 2R073 3H1MA 4XF9A 5BNOC 4CEWA 2YMZA 4PBOA 1ND3B 3AP4A 3R6SA 2CWMA 1YNAA 3RZZA 2NMNA 3G7DA 1COV2 4LO4B 1RL3A 2YYOA 1F5JA 1RUF3 2WSVA 4OI2A 2XL9A 4RHV1 4XYXA 2Q1MA 5JIUA 1HQLA 4M3CA 4LLOA 3ZYPA 1HLCA 1WLTA 2VW2A 2W52A 4CEYA 1HRI3 2XLGA 4DY3A 2D40A 4M00A 3SCFA 3N4MA 4FVVA 2OZ6A 4XQDA 3VKMA 3QH7A 2XGXA 3E97A 2YUEA 3D4KA 1CAWA 1FOD2 1APNA 3WQ0A 4YZ2A 5EXOA 4AQ6A 2UWAA 3RMXA 3MF9A 3V56A 4FAGA 5CFDB 2HEVF 4QMAA 4YVSC 3H50A 4JDNA 1N1TA 4B29A 4ZU5A 3MIFA 1QJY2 1GZ9A 1QH6A 4AYUA 4FOYA 4YG0A 1VBD1 3NV4A 4AHZA 4B3NA 1JTZX 1GFF2 3I59A 2OUHA 1NCQC 2VGDA 5GM0A 1F9KA 3CJIC 4CDUB 1PGL2 1UCXA 1XNBA 3THPA 1NCRC 4C0HA 2H0VA 4S2FA 1KS5A 2Z5WA 3DPRC 5BV6A 3KCCA 1ND2C 2RM22 3GF6A 4XFAA 3LOIA 2VULA 1POV0 1PO11 4AEDA 2XWBB 4E2SA 3VV1A 2VU9A 1PVXA 5BNNB 5KXEA 1RHI3 2GNTA 4E27A 1W6MA 4XZPA 4DMIA 5FLJA 1DZRA 1AL21 2PN5A 1PVC1 3OD0A 4CDWA 3V0BA 2XPJA 1RVF3 2HYKA 3NO8A 4LBQB 2PAEA 3NSTA 4PDWA 2VVFA 2MEV1 1OOPA 3R4DB 2JG8C 1SLTA 1N3OA 1WW4A 2WC2A 3PVOA 2C9AA 5GLZA 1POV3 1QJU2 2IXHA 4JAAA 1ASJ1 1MS0A 4K8FA 2GC3A 4DNYA 3UK9A 4IL7A 3BCWA 1U5ZA 2JENA 4J1WA 1A78A 4MUVA 1ND3A 1MS9A 2FZ1A 1O4ZA 3RYRA 3I7DA 4DRRA 1MR5A 5E8AA 4FXKB 1IS4A 3T1MA 3IDBB 4Z82A 3RWNA 1Y43B 1WW5A 1J58A 1R091 4XIKA 5L36A 1UPSA 1BKZA 4HKOA 3LZZA 2ZOEB 4YGCA 3O7OA 4XXAA 2DCYA 5GZCA 5H9RA 3ZFFC 1AX0A 1Z78A 3HD8B 3I8TA 1ENRA 2QQPA 1V70A 1BCXA 3IWZA 4NO4A 5T55A 2VOWA 5CFDA 3VBUB 3BOWA 1KRIA 2RS13 2CL2A 2Q5TA 1RUG3 3EJKA 4R9CA 3RYKA 4JGZC 1UAIA 2WNVC 4U2AA 1AR83 2A3YA 3SMHA 3WDWA 5JDBA 1OA4A 4Y1ZA 3WNXA 3DV8A 4YFZA 4CDUA 4AEMA 1HQWA 2ZGQA 4FTEA 3VZJA 1H4HA 1ZRFA 4DY5A 2YY1A 1KITA 1ZRDA 4N7IA 2WNUB 2WT0A 1CONA 4MGYE 2P3KA 4GA9A 1SEFA 3G6JB 2HWD2 1AYM2 2BNNA 1MQTC 1G7YA 3ILFA 3LAGA 5H9QA 3FLRA 1C8NA 3ZSKA 2IC1A 4LLFA 2MHFA 2W0XA 1IHMA 2HWE1 4NR1A 3POSA 5BNNA 1X50A 5I0RA 1XU1A 3NAPB 4FP2A 2D6OX 5H9SA 3WQ7A 2PYTA 1HXS3 4YZ4A 1QNWA 1URXA 1RUI1 5EYYA 5LK5A 1FMD1 1IPKA 1M4WA 3UKVA 4LBQA 4ES8A 2XJUA 1C3HA 2B9UA 5KC5A 5LK7B 3GBWA 1H1AA 2E7QA 1VAVA 1V6IA 1YLLA 3ZN6B 4C1WA 1CESA 1LHWA 1U0AA 1C1FA 2Y38A 3INAA 1W2UA 2VVEA 3ILRA 4P5HA 1PGW2 3TRSB 3UV9A 4AI3A 5C4WB 1R1A3 1LESA 3GALA 4CDXB 3RYPA 5C6CA 4GWNA 3CJXA 4N43C 5KWRA 3KT7A 2ZAHA 1GICA 4CEWC 3VBRA 3KMHA 4Y5Z0 1C4RA 4I09A 4ISQA 1G9FA 2K2SA 4XFFA 1VBA2 4AQ2A 2A7AA 2ZX0A 5I8TA 3ZSLA 2CV6A 1FV3A 1LOGA 2HJIA 5L73A 4MVTA 3PJYA 2WKKA 2FZ2A 1FX5A 4QM8A 1PIV3 3VBSA 4H14A 4PLOA 4YRDA 3VBUA 4CEYC 5FCCA 3DKWA 4CYDA 4UW3A 2D6LX 1S0JA 4XFIA 1RMU3 1U5YA 3O0VA 2P3JA 2EXKA 5AFBA 2XHKA 1O3RA 4PCRA 5FMOL 3QBQA 1EAH2 2LALA 4ORFA 1LHUA 1WLCA 2D97A 3M7AA 4XF1A 5ACA1 5JSOA 1SCRA 1J3QA 2ZA9A 2H0BA 2WNUA 5JI9A 4XFBA 4OHYA 4LA3A 2CYFA 3J8F3 2BFUS 1HV0A 2CGPA 1MS8A 1VBE3 1O91A 3AZXA 1QHDA 4IV3C 3GHMA 1UKGA 3ECQA 1UU5A 2I74A 3ZXKA 4ZXKA 3AMQA 2ZGRA 2X5IB 2DV9A 1RUE1 2UWBA 2HWC3 4N53C 4HSJA 3RRDA 3VKFC 3WY6A 4XJAA 1YYNA 2JEMA 5JLVA 3B02A 3ZN6A 1SCSA 2WFF2 2AGSA 1YO8A 4PDWC 5HCAA 2R49A 5DUUA 3LA2A 1S0DA 2R16A 4G4FA 4YGBA 3APBA 2HEYF 5C4WA 4CDXA 1S0IA 3H1YA 2ZGMA 1VJ2A 4CDQB 1BEV2 2VUJA 3V0AB 1COV1 4GMP1 2IWGB 4FPOB 4DXZA 1IKQA 1EY2A 3BODA 2RS33 3BTAA 1ND3C 4TYSA 1XNDA 3BIWE 4AWDA 1GR3A 3UKTA 1K5MB 4P9GA 1XXNA 3AB0A 3AX4A 2NN8A 3AMHA 2DVGA 2DF7A 2E9QA 3FHIB 4AGVA 1KQRA 2RS53 1HQNA 2BGCA 2RMU2 4FQ4A 4M3CE 1RUH2 5BNOB 1Z7S1 2VNOA 3JU9A 1QXJA 2ZCWA 5JOYA 3AJZA 2JG9B 3ZYIB 1QJY1 4R9AA 3TOJA