4Z07A

Co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
260
structure length
260
Chain Sequence
SHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of PKG I:cGMP Complex Reveals a cGMP-Mediated Dimeric Interface that Facilitates cGMP-Induced Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords cGMP-dependent protein kinase 1
total genus 72
structure length 260
sequence length 260
chains with identical sequence C, E
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z07A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z07A01
1RL3A 2XLGA 4HSLA 1ZZ6A 5JCTA 4CYDA 3DL3A 4IERA 3IBMA 1O3SA 4AVAA 3H7YA 4MV2A 1OFNA 4XF3A 2GC3A 3ETQA 4KWLA 3GBFA 1UPIA 4UBHA 5JR7B 1UD1A 5EZWA 4FAHA 3CLPA 1X82A 3RDIA 3EO6A 3CO2A 2PHDA 4IEXA 3ST7A 3JZVA 3CL1A 3LA2A 4OLLA 3OGJA 1XE7A 4AQ6A 1GQGA 2GC1A 4XFIA 3BPZA 4ONUA 3I59A 5FQ0B 2N7GA 3FWEA 3LOIA 3WW3A 4JVAA 3KGLA 1ZRFA 1QXRA 3HIFA 2GU9A 5BXXA 1EYBA 1LKNA 4XFGA 4QM8A 4K8FA 1L3JA 3OF1A 3NSTA 4I01A 3D0SA 1LR5A 3M3IA 3ES4A 3MYXA 4ZU5A 4EV0A 2MHFA 2UY9A 2K9ZA 5BV6A 2Y0OA 3KGZA 1I6XA 1XRUA 3IWZA 3LWCA 3UKVA 3OD0A 2BNNA 5LRSA 1DZRA 3SCGA 1YUDA 4X6RB 2XHKA 1OI6A 3LA7A 2PHLA 4I09A 2Q30A 5J7MA 4D7TA 4O9EA 1RC6A 5BPXA 2GH2A 1RGSA 2BYVE 3KSCA 5AVPA 5T3NA 1CAXA 1H1MA 2FQPA 4QX5A 1Y9QA 3VHRA 2K0GA 4HMZA 5LRRA 4YRDA 2GC2A 3NW4A 2XL7A 3E6BA 4QM9A 1J58A 1CAXB 2HKXA 4IEZA 3FFQA 4FBFA 3SMHA 3KCCA 2XLAA 3H3UA 1VP6A 3FJSA 3E6DA 1O3QA 2HJIA 2KXLA 3EJKA 2ATFA 1VJ2A 4WBBA 3BALA 1CGPA 4MH0E 2UY8A 4I2OA 1ZRDA 2F4PA 5KHGA 2GZWA 1YHFA 2EA7A 5E1RA 3SCHA 1FI2A 4IEVA 3WW4A 4XF0A 4EWDA 4KU7A 2BEOA 1UIJA 4B29A 1UIKA 5FLJA 1Q43A 1Y3TA 4ZU7A 4IETA 1CAWA 1GQHA 4FT8A 4MUVA 1DZTA 4BYYA 2FMYA 4XFFA 2H6BA 1CAUB 1O7FA 4I0AA 5J3UA 2CAVA 3PLQA 1J59A 2MNGA 1O5UA 4YNIA 1EP0A 4L2NA 3ACLA 4N9HA 2Q1ZB 3EHKA 3G7DA 3RYRA 1WGPA 2D5FA 2O8QA 2PA7A 3ROUA 4HVOA 5HI0A 2PFWA 5FDBA 2XGXA 3O14A 3FE5A 4IEUA 1CAWB 4I0BA 3ZDSA 4LLOA 1YFXA 4XETA 4META 1EPZA 1I5ZA 1LB2A 5I91A 4J1WA 4H7LA 2XL9A 2H6CA 3HT2A 3E5XA 3KMHA 3M70A 4AVCA 4I02A 3WW1A 3RZZA 5F1RA 3L2HA 1X8EA 4O9GA 1J3QA 4HVRA 1ZVFA 4QMAA 1JUHA 4PJYA 4QGNA 1ZZ8A 4Q0QA 5JSRA 4IEYA 4DINB 2CV6A 5KHKA 2IXHA 4IESA 4TLFA 4YARA 4WVZA 4N9IA 4MGKE 5CADA 1NZCA 3PVBB 1OD5A 1O3RA 1ZZBA 1WLTA 3EQEA 2D5HA 1QXJA 5JSOA 1NYWA 1DGWA 2E9QA 2Q0AA 2PYTA 1ZX5A 1FXZA 4JTNA 2BNOA 3IDBB 3E5UA 4AXOA 5J48A 3H9AA 1OMIA 4L11A 2BNMA 4QGLA 3H1WA 5FCCA 4XFBA 3S0MA 2CGPA 4HZFA 5I0TA 4EWEA 3H50A 3DKWA 5KHIA 5BUVA 1YLLA 1ZRRA 1CAVB 4HLTA 2IXKA 5CVRA 3CJXA 3RNSA 4MGIE 4BHPA 3BB6A 1CAVA 3UKTA 3OCPA 4JV4A 4HN0A 1YFWA 2DCTA 2XLFA 4NVPA 1RUOA 3FX3A 4P9GA 5C6CA 5KHHA 2V09A 4RD7A 1J1LA 3H8UA 1NXMA 5I93A 5FQ0A 3IDCB 1ZRCA 4BH9A 1ZNPA 3BU7A 4LA3A 3R6SA 1RUNA 5I0UA 3H3ZA 4EWAA 1CAUA 3NKTA 1TQ5A 3TNPB 2IXCA 2IXJA 4GULA 3E5QA 5I8SA 1ZZ9A 5D1IA 5FLIA 4EROA 3D82A 5JSPA 2C0ZA 4UBGA 4Z07A 4XFAA 3BCWA 2IC1A 4MGZE 1SQ4A 4IEQA 1NE6A 4LEJA 3NVCA 2XKOA 3S7IA 5FLHA 3TNQA 3PNAA 4XFCA 1EY2A 2IXLA 4IEPA 3HQXA 3EBRA 2GAUA 2Q4SA 2GC0A 3LAGA 5LEKA 3FHIB 2QNKA 3SCFA 1XE8A 2UYAA 3SXWA 5KBFA 1O3TA 3ELNA 3SHRA 2OYZA 1UW8A 2ZKLA 4MX3A 4Q0UA 3U10A 4AQ2A 2QDRA 3E6CC 2ET1A 1YWKA 1X7NA 3B02A 2OPKA 1QY4A 3MDPA 1WA4A 4JTOA 3NJZA 2D93A 4ORFA 1PMIA 1O5LA 1VR3A 3HT1A 3LZZA 2EVXA 3NL1A 4OFGA 3RPQA 2WFPA 1J3RA 4E2SA 1X8MA 5I0SA 5C8WA 4HSJA 2PTMA 3CF6E 4YYOA 5E16A 4KU8A 5BY5A 2BGCA 3U0ZA 3MPBA 1SEFA 1QWRA 3USSA 4E2QA 2D40A 3IIAA 5FPZA 4Z82A 4D7SA 4PIYA 3OTFA 2ETEA 4KWJA 1H1IA 4J1XA 4XF9A 1Q5OA 4R52A 1G6NA 4Q0SA 4WZCA 5I8YA 3RYKA 5I0RA 4PIZA 5JAXA 3DN7A 2VQAA 4KL1A 4HBNA 1U12A 4XF1A 4XF4A 4LUMA 3FZ3A 2XKPA 3RYPA 4LUKA 3ES1A 2Z69A 1ZZCA 1J3PA 3I54A 4BIFA 4LTAA 1Q3EA 4QGMA 5K8SA 2P17A 3QOPA 2PAEA 2O1QA 2VPVA 4XFHA 2B9UA 4XEZA 4IEOA 3H1YA 1SFNA 1O4TA 3S7EA 4LULA 5FPXA 2WC2A 1FT9A 2UYBA 1HW5A 1YFUA 1PM7A 2B5HA 3N4MA 2Z2SB 3C3VA 4KWKA 2MPFA 1LRHA 2B8MA 4MZUA 4E2GA 4Q0VA 5CU1A 4MGYE 4X6QB 1V70A 2CAUA 2OA2A 2QVSB 3DV8A 4PIXA 4I3PA 2OZJA 2EAAA 3CEWA 4ZU4A 2QCSB 4F7ZA 4YSFA 4A2UA 1YFYA 1ZREA 1ZZ7A 3LA3A 4UXAA 2PQQA 2ET7A 3I59B 2PAKA 2I45A 3H1MA 2H0VA 2PAMA 4HN1A 1UCXA 4LA2A 5I8TA 5KHJA 2VECA 4QXKA 1RTVA 4Q0PA 4HVQA 1NE4A 1IPJA 4R8HA 5LEJA 3D0JA 4IEWA 2ZCWA 3H7JA 4Q29A 3I7DA 1DGRA 5EFUA 1CX4A 2OZ6A 1IPKA 3UKNA 3E97A 3MZHA 2QJVA 3WW2A 3GYDA 3U11A 2IXIA 4FAGA 4F8AA 4AVBA 3QACA
chains in the Genus database with same CATH superfamily
2XLGA 2CWSA 5JCTA 5F3IA 4NRMA 3OEAA 2WRAA 3WEZA 4HKOA 3WF2A 4AVAA 2A3XA 4MV2A 5JWPA 4I3GA 2WBKA 3PIJA 4GJYA 5JDBA 4XF3A 3AKRA 4QXCA 2GC3A 2R072 3ETQA 4KWLA 4QKBA 1UPIA 1DP0A 1SBFA 3SH5A 4EN7B 1UD1A 1HX6A 1Q8OA 5EZWA 3ILNA 1U5ZA 1ZRIA 4SBVA 2DU0A 3VKNA 1NCRB 3JZVA 4AGRA 2JDAA 1RUE1 4JC1A 1RUE2 1PMHX 1TEIA 2YFZA 4BZ4A 4DOUA 3AKQA 1GYKA 2YXSA 2GC1A 3EXUA 3B01A 3OYWA 4YZ3A 1KD7A 1DQ4A 1C28A 4HXCA 2OKXA 2N7GA 1RMU1 3LOIA 1SLIA 2W08A 1ZRFA 3HIFA 2GU9A 2YG0A 2OXBA 2RE9A 5A6ZA 3HWJA 3R05A 1RUF1 2VMFA 3APBA 1LKNA 1RUF2 1YJLA 5A7WA 3T2QA 1V9U1 3VDDB 1GP6A 2OQ7A 3ETPA 4K8FA 5EJZB 3SQOA 5KWRA 5DZEA 3OF1A 3ZPOA 2QDNA 1W6OB 3NV1A 3THTA 2BWCA 4RSUA 1KITA 2JG8B 3WNKA 4YG3A 1GZWA 1NA1B 1OVPA 3NRUA 3IKWA 1LODA 3ES4A 1O4ZA 3MYXA 3Q8BA 4QX1A 3PU8A 4LKSA 5DAWA 1JYTA 2K9ZA 5BV6A 4QPIB 2R062 2Y0OA 4Z2AA 5IAXA 2W1UA 1BQPA 2LW8A 2P37A 1I6XA 2E7AA 1XRUA 3KF5A 1WKYA 3KVBA 4LBQA 1GP4A 1H30A 2HYKA 4LO7A 2BNNA 1OKQA 1UXZA 1XNBA 4PF5A 4B8EA 1NLSA 3IT8A 3ZSKA 2WZR3 4E8DA 1HRI2 3QD6A 3N7KA 3O1MA 4I09A 5BNPA 5A32B 3MI8A 3WSOA 4NHXA 2QUOA 2ZEWA 5F8PA 3A22A 3ASIA 3T0BA 4URTA 1CAXA 1H1MA 4QX5A 2R042 1ULDA 1Y9QA 2JDMA 2YV8A 3OG2A 4D6RA 1A3KA 2VMHA 2WN2A 1ASJ1 4AFMA 3ZXEA 3LCPA 2HWE1 2EAKA 3B69A 4QX7A 4CEYC 4OMCA 4CCKA 4GQ7A 5FR3A 3AKSA 1HB1A 2O8OA 2QQWA 2SBAA 4IE7A 4BPZA 1MZEA 2CYFA 4N43A 1LJ7A 5CISA 4RR3A 4FSJA 2DVAA 3NNMA 4XACA 3ZN5A 2W47A 3EJKA 3I3MA 1QKQA 5B4XA 4GB31 3WDXA 1DQ6A 1H4HA 1CGPA 4OHYA 4PT6A 2HEWF 2XBO3 2R6QA 4LBKA 1PGL2 2F4PA 2ZEXA 5A7NA 1PO12 3C2UA 4K8RB 5E1RA 3SCHA 4M01A 2YBSA 4XF0A 5FPLA 4KU7A 2K2SA 2WSVA 1JOJA 1IQDC 3I4IA 3PUAA 5FY0A 4RL7A 2VXJA 3PL0A 4ES8A 2Z4FA 1C4RA 1JOPA 2QQLA 2Y33A 1Q43A 3NAPB 4IETA 3JD71 1UYXA 1V6KA 5FYBA 4CDQB 2EF6A 4M3CA 5C8CC 3Q8FA 1NOVA 5BNOC 4BYYA 3MV11 5DZFA 2UWCA 4FCAA 1S0FA 4XFFA 1LOEA 1W90A 3OGSA 4CDXC 5HCFA 4IE0A 2GMPA 2MEV2 1HV0A 1O7FA 1W6NA 5K7PA 2CAVA 2ZZJA 4LR4A 5BNNA 2JX9A 1NX9A 4PLMA 1J1TA 4M3CF 4OHWA 2P3IA 3ME2A 3ZOIA 2Z42A 3EHKA 2VMDA 2FCTA 2HH9A 4RQPC 4QQHA 3RYRA 4OUEA 4PLNA 4AI2A 1R083 1NLRA 3WQBA 1VBC3 3U78A 3THCA 1HRI1 5E6HA 4IGPA 1ULEA 3J7MA 3UGHA 1HXS1 2V73A 3MLJA 5FDBA 2YUEA 5JI9A 3RMYA 1CZTA 1CAWB 4I0BA 1DZQA 2VTXJ 5ANNA 1CZVA 2HWD1 3VHPA 3TB0A 1JHNA 1LAJA 4META 3OBTA 4NN0A 1I5ZA 4H3WA 3AL6A 2NMOA 2QQIA 4NIHA 2ZAHA 4FPGA 5F9TA 2VR4A 1O8PA 2VBDA 1JZ8A 4GMP3 4XAEA 1AX1A 1UU6A 2VOXA 4GH4A 1TNFA 3U37A 3BN6A 1VAMA 4HVRA 1ZVFA 2F4LA 3JUUA 5F6LB 2V72A 2BOJA 2JG9B 2WN3A 5GZGA 1W6QA 4KGGA 3RVHA 5A3LA 4HFSA 4PJYA 2GP3A 3ZYRA 1QQP1 1KXGA 3BGAA 4F83A 2VVEA 5JSRA 5IT6A 3LEMA 3J4UH 5IFTA 4IEYA 4A42A 5FWEA 3VBHA 4IESA 5BYNA 2JD4A 3MW4A 1ENQA 4JX0A 4TLFA 1W2AX 4YARA 1RVF2 3M4FA 3TOJA 3W20A 1LEMA 4NAOA 4AEDC 1NZCA 3PVBB 2KR2A 1O3RA 3EQEA 5EV7A 3M1HA 1AVBA 2D5HA 2UWBA 4MADA 1JYCA 4XUTA 4E9KA 1NYWA 5IVBA 5L19A 1QDOA 2BFUS 4A7YA 1QJY2 4UFKA 2PYTA 5DN2A 1YI7A 1ZA7A 2W39A 1H8TB 3WDWA 2HWB1 4LOSA 1RHI1 2ZTNA 1OKOA 4OI0A 4ZS2A 1A8DA 3FC0A 2RS13 3LIGA 5DDJ1 5IWFA 5A7QA 2ZMKA 1LU1A 2C24A 1BJQA 4AI0A 4EWEA 1QGLA 1IS5A 5LA2A 5A1FA 3H50A 3UYJA 1X33A 4YZ4A 4MHRA 2IWGB 4EN9B 1F9KA 1ODNA 5DUWA 4HLTA 5CVRA 1UZZA 1AF9A 1N1VA 2P3JA 3OBAA 1SPPB 1ZYBA 2X8KA 1PIV2 2C1FA 2PELA 1V6OA 2GALA 3POFA 4ARYA 2YY1A 4LIVA 1RUOA 4AF9A 5FUIA 3BTZA 2YBPA 4RD7A 4BQWA 1J1LA 3ON7A 4RGAA 5I93A 4Y5TA 1B35C 2DTWA 3IPVB 1W0OA 5FZDA 3BU7A 3JBG1 1HN1A 4FPCA 4MVTA 1RUNA 5JI7A 3AZVA 5E8AA 4M4RA 3VHOA 5ERLA 3V0BB 1LOAA 2A5ZA 5E88A 4Z8BA 5FYUA 4NE9A 2LTNA 3IMMA 2IXJA 1VBD1 1XSRA 3I2GA 3AVRA 4M4PA 3I97A 5I8SA 1W9FA 1YI9A 5D1IA 4BQ1A 3PUIA 2R063 2VZRA 4MO3M 3P6BA 2DCKA 4AYUA 2E7QA 4HETA 2AEZA 3DYPA 2G1MA 5T5JA 1MEC2 5F5IA 2VM9A 4UF0A 4COWA 1DBNA 3OUIA 1A6CA 3VL8A 1SQ4A 3MPPG 3ZFGB 3VDBA 4BISA 5A1AA 4UT5A 4NROA 5LW9A 4KMQA 2NQYA 4HPKA 1GOHA 4OZXA 4XFCA 1UOFA 3N9NA 4HK9A 3AZZA 2FD8A 5C9AC 2IXLA 4RQPA 3HQXA 2TEPA 2GAUA 1WBLA 2GC0A 3BODA 1RUH1 3LAGA 1O4YA 2E53A 2HWE2 3POJA 5LEKA 3FHIB 2QNKA 1O8SA 4LO4B 3SCFA 1B35B 2BOIA 1D4M3 3WVJA 4N53A 4DZGA 5HV0A 3I2OA 4N43B 1BCXA 2PQSA 2XVKA 3ELNA 3WHTA 3SHRA 2OYZA 1BVP1 3I2JA 3KM5A 5A33A 2ZX3A 4AAXA 2QZ2A 3FN9A 2ZA9A 4LJHA 2QDRA 3HQRA 2HBTA 4QPYA 4XAAA 3E6CC 2ET1A 3ZFEA 4E4SA 1YXWA 5FBZA 4DXRA 3BTAA 1RUG3 4CP0A 1X7NA 3URFA 1R64A 3B02A 1QY4A 5A3PA 1WA4A 2Y6HA 2W5FA 1W28A 1HJGA 4QHOA 3LSDA 1GZ9A 4IV1B 5JXIA 3PVOA 5F6KA 3L2YA 1PO13 5LBFA 1O6UA 3KWVA 4CUCA 3T0AA 3DUIA 2VU9A 3O12A 5EHDA 1CWPA 1UZYA 1H6YA 1OQEA 4HKWA 5ACA3 1N1SA 4AAPA 4FOVA 4R9BA 1REFA 1X8MA 4YM1A 4K1YA 2ZGMA 4BQXA 3K48A 2PTMA 3T4HB 3DF0A 1PK6A 2ARXA 3CF6E 4B1MA 1CPNA 4RR3C 5BY5A 3AFKA 3R4SA 2AACA 4JDOA 1AYN2 1HLCA 1JBCA 2J1AA 1K45A 2QKDA 2JDHA 4E2QA 4MXWA 4GZ9A 3POSA 4K1ZA 4OULA 5GJ6A 5AFEA 2D98A 1KS4A 1OF3A 3EB7A 4W6XA 1H1IA 4UW3A 3VBRC 1Y4WA 3VD3A 4FFIA 4R52A 1G6NA 4CTEA 2ERFA 5LY1A 1CN1A 3MUZ1 3NNGA 3WR0A 5I0RA 3HPNA 3HBZA 2P4EA 5FZ8A 1ALYA 4LO6B 1AL0G 3VKLA 5FUNA 2XH6A 4P9LA 4XF1A 3OBZA 3PTYA 3LB9A 4I30A 1H2KA 1AYM3 3ZMNA 3MW2A 2TUNA 1V6JA 2RM21 5KXCA 4Q4V1 4C0HA 3ES1A 3FHAA 4QU1A 2VZTA 1RUH2 2O0OA 3U14A 5A1LA 1UYYA 1BYHA 3TEWA 1PHMA 4QGMA 3SITA 1QJY3 2VUCA 3N35A 2DVFA 1X9TA 5D8AA 1ZM1A 2VUAA 2O1QA 4DXZA 1UYPA 1HRV1 3J8F1 1R093 4Y1ZA 1PO11 3VDDC 1H8TC 1QJZA 5F5CA 4YZ1A 2BERA 1ND2B 1D4VB 3THDA 2XUEA 4Q1RA 1YFUA 1W3VA 4JAAA 3WF0A 4CSWA 4QDSA 5A6QA 1GZTA 3N4MA 2OS2A 1LGCA 1W8FA 2DVDA 4KWKA 4CEYA 1AR91 2WKKA 4UFLA 1GZCA 4KI5M 2MPFA 4OI1A 5LA1A 2X05A 5CU1A 1F8VA 4MGQA 3WF1A 2JIGA 4X6QB 3VBFB 1ND2A 2CAUA 4NJ4A 2QVSB 2WSUA 3PVNA 4E27A 4A6SA 3V0BA 1ULFA 1V6IA 1LHUA 4ZU4A 4FOWA 3TN92 3TN91 2AGSA 3VD5A 1YFYA 4NIGA 4DEVA 4UXAA 3HAGA 1ENXA 3IAPA 1UY1A 4XDPA 2I45A 3H1MA 5FZFA 4PBOA 4HN1A 5CFDB 2JENA 1S0IA 5IK4A 4QXKA 1MZ5A 4HVQA 4R8HA 1Z0HA 4S2HA 1XQNA 4XUOA 5APAA 4BQ2A 1AR61 3OPWA 3LQCA 2RV9A 5FZIA 1ND2C 1DQ2A 2ZCWA 5FXXA 3SEPA 5IATA 3WQ7A 2CSGA 1RUG2 3ZSEA 5KXDA 2AEYA 2A6YA 3BOWA 3OY8B 2OVUA 4KGQA 2VMCA 4XUQA 3ROUA 5AC92 2R041 5LATA 1DGRA 1IPKA 1UPSA 4U36A 2YZ4A 2JE7A 2BU9A 1BK1A 2D6PA 2VQUA 2YU1A 3U4SA 1IG0A 3AMMA 3JQXA 3WD5A 4QD2A 3LIHA 4CCNA 2QJVA 3ZSMA 4ATFA 3WT3A 4LBNA 3HR9A 3MIEA 1POQA 3MLKA 4BJ0A 3AX4A 4AI9A 3IDAA 1PZ9A 5A80A 1P8JA 4N43C 2I07B 1STMA 4WVMA 3IIIA 4CYDA 4H14A 4ATEA 4GB32 1OBNA 5ANQA 3FUQA 4H7MA 4CCOA 1LNSA 1FX5A 2WO3A 1J84A 1WLDA 1OFNA 4LBQD 5FZBA 3O1RA 2E31A 2E7TA 3P3PA 1TMF2 3J7NA 4UBHA 5FJHA 5FXWA 4C91A 1KEXA 1LENA 4UWDA 4L0PA 3RDIA 3ST7A 3O1VA 1LULA 2WQ4A 5F39A 3LA2A 5JIUA 1QU0A 1FOD1 3OGJA 1TME1 4ZY9A 3J9SA 4TLGA 1HB3A 1GQGA 1PZ7A 2RR13 4UFMA 2A70A 3BPZA 3DGTA 2VQ0A 4ONUA 2ZGQA 3MW3A 5FQ0B 3CZJA 1MVEA 1VAKA 3O0VA 1S0DA 4MYEA 4ZXKA 3VBRA 1NQDA 1OF4A 4XQDA 5IW0A 1EYBA 3T2TA 3WG1A 1QJY1 1Q8QA 1QXPA 1WW6A 2E26A 5FZHA 3ZXJA 2BFUL 3DPRB 3F2ZA 1W99A 3K75B 4JKKA 1OQDA 2D7FA 2XVLA 5LK7B 2HEYF 3MIBA 3VZMA 4FFFA 3KVAA 4YGBA 1LR5A 4HL0A 1YQCA 4ZU5A 1VIWB 2EXHA 2FDJA 2VJXA 2RM23 3V0AB 3USUA 2Y38A 4W4ZA 4WM7C 2XJVA 3O1TA 1CVNA 4CEYB 1I5PA 2E32A 3KGZA 2P3YA 2YHJA 4YM0A 1AXYA 3IWZA 4XHXA 3LWCA 3RZMA 1W6PB 4DEQA 1I9RA 3MEPA 3B7MA 1VBC2 3VD9A 1YUDA 4X6RB 1QQP3 1D2SA 1V0AA 2XHKA 3LA7A 5GZFA 2PHLA 1ACCA 4BWOA 1AYN3 1H2LA 2HYXA 4D7TA 5HBAA 4O9EA 2RVAA 3GZEA 3O1UA 2J22A 3UV9A 4ZKTB 1URXA 1NG0A 4FI9A 2LUWA 5T3NA 3BKZA 3B00A 4DQAA 2XHNA 4LOTA 3NAPC 4HMZA 4WVVA 3RI8A 4FPOB 4YRDA 1PX4A 2PXJA 5FY1A 1ND3C 4Q4Y2 4CZSA 4QDQA 1F4AA 3AZYA 4FTBA 1SFPA 1GNZA 2EXKA 5FZ7A 3T2OA 3VBFC 3GALA 3VHNA 4AHWA 5IFPA 2GNMA 2PHFA 3DEMA 4D0QA 1QH6A 4IEZA 3H0OA 4FBFA 3SMHA 1HXS3 5FKBA 4N53C 4NPMA 3H3UA 1FMD3 1VP6A 2YBKA 3ZN6A 1LOGA 1O3QA 2R30A 2AENA 3S6PA 3B3QE 5G05L 2ATFA 2WYFA 4NHYA 1R081 3HN1A 5TSWA 4BXFA 3BALA 3Q9OA 2UY8A 3P3NA 3K3OA 1PNFA 5DUVA 1OSGA 5A3WA 3QLQA 5JUVA 2XJSA 1S0CA 1WW5A 2QQJA 2XJRA 4KG8A 1FI2A 3WW4A 3M3OA 3VLBB 1SPPA 3SC7X 2GN7A 5FZOB 2UWAA 3AXDA 2WS91 3V0AA 4XBQA 1R1A3 4UW5A 1L7QA 4B29A 5J36A 1UIKA 3VD4A 2W9XA 2J1TA 5FLJA 3CKHA 4XCBA 1MS5A 4DY3A 2XXZA 3I2DA 5L9BA 3BI3A 2X5IA 2HWF1 4QB1A 2NM1A 1CESA 4M0HA 5LY2A 4W8JA 5D8AC 1UXXX 4V2WA 2H6BA 2P2KA 5FZEA 2R1DA 4COZA 2WA3A 3DXUA 3RS6A 5BNQA 1J59A 4XHBA 1LTEA 1QJU3 4A7ZA 1DF0A 1O5UA 1S55A 2L9LA 2DVBA 4L2NA 2Q1ZB 3DPRC 3LEGA 3G7DA 3AMPA 1WGPA 3VBOA 1COV2 2A7AA 2D5FA 2P5BA 4XDQA 4QX2A 1OOPA 4Y33A 1MZFA 2HBUA 5GZDA 3VN4A 4A4AA 1UMIA 4Y1XA 3JD72 2NZ9A 1GR3A 3IN9A 2Q8EA 2PFWA 3HJRA 5A3MA 1LHVA 2BW8A 2A1XA 2ZJCA 3FE5A 2X5IB 4IGQA 2YROA 3JBG2 4IV3C 4NIAA 1QMJA 3P1IA 4Y20B 4JQRA 4LLOA 5EWSA 5JLVA 3WY6A 1U5XA 3VBUA 1YFXA 3K4AA 1VBA2 1EPZA 3R4UA 2A6ZA 2JG9A 2QTWB 3NO8A 5GZEA 3WUCA 4AI8A 1SCRA 4J1WA 5I91A 2XL9A 1ZBE3 1QJEA 4A3ZA 5J1XA 4JGZA 4NRQA 5FP3A 3I2FA 5C3PA 4H55A 4ISRA 5FXVA 3E5XA 1SBDA 3KMHA 3M70A 4XJAA 3G6JB 1XNCA 1VMFA 2IUWA 4I02A 1TZOA 1SCSA 2P6CA 1J3QA 2WNVC 1QDCA 3OPTA 4NO4A 4XMIA 4K20A 3ZXLA 4Z92B 2JDNA 5FY4A 5T50A 2W3JA 1ND3B 1X9PA 1ZZ8A 4WZFA 2D6OX 1UY3A 2JB8A 4I0WB 4Q0QA 2ZACA 2D3RA 2IXHA 1CJPA 2PN5A 3I3QA 1XYNA 2TNFA 4TXWA 1WUVA 3ZSLA 4AE2A 4WVZA 4N9IA 3CZUA 5GM0A 1YC61 1LU2A 1ZA4A 4DIQA 2BBVA 1LOFC 1OD5A 4MG2A 1ZZBA 3ZIXA 2WS92 1UOJA 4IV3B 3OBRA 5JSOA 5CYYA 5CZKA 3RG0A 1YCIA 3ZFEC 1DLLA 5F5AA 1H2NA 1HDKA 2DUQA 5HXMA 2V4AA 2BNOA 1ULGA 1YQ6A 5FMOL 3IPVA 1RUF3 3E5UA 2ORXA 5J48A 1VBE3 4PLOA 3KHBA 1NKGA 4M0NA 2VCAA 4O65A 2OIIA 1L7LA 4IL7A 1NCQB 3C7GA 4L11A 4QGLA 4D8MA 2FCUA 3S0MA 4CDQA 3QBQA 1PVXA 5EPAA 3J8F2 1XNKA 5KHIA 1B09A 1W2TA 5BUVA 4FOYA 4OI2A 1AYM1 3KLSA 4DB5A 4WV8A 4YZ5A 1DQ1A 3INAA 2IXKA 2Y64A 3RNSA 1PGW1 2OUHA 4MGIE 4TYSA 3BB6A 3WNLA 1F5FA 5FP4A 1YYNA 4AI3A 1YFWA 2XJUA 5FMDA 4BMEA 2ZBJA 3A23A 2DCTA 4AR2A 1E5HA 4JHTA 3WG4A 3WQ1A 3FX3A 4BQYA 4QT6A 1IQAA 4NUBA 5ACA2 1SZBA 5KHHA 1QHDA 1C1FA 1TE1B 3WNMA 2WZ8A 3CBNA 1XYOA 3IDCB 5SV5A 4DMIA 1ZRCA 4BH9A 1ZNPA 4FTSA 3ZN6B 4LA3A 3EMRA 2D6MA 4JQTA 3A4UA 4K9SA 1JXNA 3R6SA 4CVUA 2YPDA 3RQ0A 2W1SA 4BLIA 4N90A 4RS5B 4S2DA 1W6NB 5BNPC 4N7UA 3O1SA 1CR7A 1TQ5A 3VKOA 3B93A 5CKQA 4FPLA 3W58A 4YW6A 4GULA 5F3EA 3OB8A 4OUSA 3JXSA 1PVC2 1SLLA 4PDWB 4KWUA 4XJ8A 2NN8A 5J98B 3MF6A 5DZGA 5F3CA 1VBC1 2C0ZA 1F5JA 3BIWE 4O7XA 2WWUA 4Z07A 1JUIA 4XFAA 1FATA 4Q4V2 1EV12 1NE6A 1TME3 4URAA 5IHRA 3N9LA 4XBNA 5JOYA 1PGSA 1QOSA 1LGNA 1OA4A 2B42B 3PNAA 1ZBA2 5K0UC 3ZYBA 5FV3A 3D3AA 1GQPA 1K5JA 1RMU2 1U5IA 1AR92 2DYCA 4FP3A 1MZ6A 1YRZA 1WD4A 5FYYA 5FZ0A 2AZ5A 4LHKA 2F6BA 4TWTA 5LCWL 5DAPA 5F2SA 1V9U2 3M3EA 4HG6B 4FVVA 2VY0A 3UGFA 2BDRA 1MS0A 2ZGNA 3M8LA 5KBFA 4Q5OA 5C3OA 3N9PA 4AHXA 3HNMA 3ZO0B 4AQ2A 4DXSA 1JZ4A 1RUH3 3ACFA 1SFYA 4IGOA 4P00B 3U07A 1HQLA 3OGVA 4E4HA 3AYCA 1KRIA 3DECA 2R7EB 1YWKA 1TME2 3PVEA 3C7EA 4LBMA 4XXPA 4CCMA 1OFSA 2ORZA 4DFSA 2OPKA 3SLIA 3W21A 3H8RA 4OCTA 2WT0A 3ABZA 4BXSV 2JXAA 3OUHA 1Y9MA 4D6QA 2FDKA 1AJKA 3I3DA 4ORFA 3IDEA 2D6NA 5IVFA 2XBO1 1MEC3 1O5LA 3HT1A 2BJSA 4HOOA 1PMJX 2FDFA 2ARAA 3DKQA 5IVVA 5CNAA 1XNAA 3C7OA 3FLPA 4XVHA 4P9XA 3WNXA 4HKLA 1MQTC 1PO21 4YWAA 4D6SA 1BMV1 5DDJ2 3POBA 4C1XA 4QKDA 4MLOA 5F5QA 2R043 2VOKA 3N7JA 2EIBA 1S0BA 5JVVA 2NLRA 5E16A 2EXJA 5HPOA 2JDUA 2BGCA 1GZWB 1NA1A 3BIEA 3MPBA 1AR63 4Q4Y3 4UFJA 5T5OA 1S2EA 2Z5WA 3JBG3 3KS7A 3LPFA 1LESA 4HT1T 4YVSA 1YQ5A 2D40A 1C3HA 2WABA 3B94A 2YDEA 3IIAA 3LGRA 3TN93 5FPZA 4Z82A 5A7WB 3ZVXA 4A7KA 1QQP2 4PIYA 2WA4A 3AP9A 1OLME 4FPHA 4OHZA 4GAZA 4DPNA 1HIXA 2DF7A 1RXGA 2BVBA 1QJU1 2BVVA 2WWJA 4LO5B 3K4ZA 3GZAA 4IXLA 4XUPA 3ZR5A 1S0JA 1GMMA 2GP5A 1AJOA 4PQQA 3RYKA 1N47A 2VQAA 2DFCA 4PF1A 1W8NA 3PJYA 4C1WA 3OY8A 4X8PA 4EE2A 4RR3B 1RIRA 4S2FA 3TYJA 4XF4A 5GLTA 5AVAA 4KBZA 4LUMA 3GM8A 5FJKA 1NY71 2VZUA 4ASLA 3ZPYA 2GMMA 5A3OA 3RRDA 3TBDA 4EYUA 1OH4A 2D43A 2WWSA 2ZGUA 5EP9A 5FBJA 5C70A 1Q8SA 4RYDA 2WNUB 1JYXA 1AR93 3EYPA 1R1A1 1ZZCA 3P5BA 5FPVA 1J3PA 1Q8VA 4BIFA 4EJRA 2ZMLA 4LTAA 4QAWA 1DDLA 3J8F3 3T08A 1V9U3 3CU7A 3WZ1A 4RHV1 5FMBA 3VD7A 1UY2A 1AR82 1RHI3 2PAEA 3AMQA 2VPVA 3W59A 5BNOA 4IEOA 2RJLA 4CCJA 2RJKA 1WD3A 3S7EA 3W5NA 5CB7A 4LE4A 1R091 2XVGA 1DCSA 4Y5Z0 1FT9A 2BGOA 4LK7A 3AP6A 4AEMA 2C26A 1FMD2 1MS4A 2DWRA 1NCQC 3PUQA 3JU9A 1N3PA 2JD9A 1F31A 3WDYA 1OPOA 2WNEA 3WHUA 4AHZA 2Y60A 2ZS6B 1C57A 5EYXA 1JYVA 2FMDA 2RDSA 4QPIA 3CJIB 1LRHA 2B8MA 4NWVA 5JMCA 1JZ5A 1F4HA 1WA6X 3VBUB 1HN0A 2QQPA 5ACA1 1V70A 2C4XA 2DBNA 4LHLA 4QQPA 5F32A 2YC0A 3CEWA 4JZRA 4FP2A 4YSFA 4QPGA 5FY5A 5FP9A 1IS4A 3KV5A 1ENSA 2ET7A 3PURA 1VBB3 5FIXA 1GLHA 3OYWB 2RMU1 4N7IA 3WCSA 4CUAA 4CDWA 2RHPA 5ISLA 4LA2A 4NR1A 4YM3A 3Q8AA 4PDWA 4XZPA 5L9RA 4LIUA 5LEJA 1JI6A 1UOGA 5DAXA 1C5IA 4K3UA 3RZGA 2B4KA 3RZJA 4NMIA 3GZUC 1JYNA 3AMNA 5A33B 4LBJA 2VMEA 3IAQA 5HCBA 3FL7A 2FZ1A 1WMFA 1MQTB 3VDCA 1VBA1 4AG4A 1Z7S2 2CHHA 3WV6A 3UKNA 3E97A 1JU4A 2W52A 4AI1A 3AMHA 1GV9A 1Y9GA 2A6XA 3FLTA 2R32A 3DCQA 4INDA 4JRLA 4NPLA 3WW2A 4E4DX 3H8XA 2R0HA 4RHV3 4WM8C 5H9SA 3U11A 4L99A 1G9BA 1DIWA 1W3XA 1US2A 1UAIA 3N9MA 2ZX1A 2CTVA 2ZGTA 3PMSA 4EQVA 1L7RA 1NAEA 4F8AA 2RR11 4AVBA 3O1PA 1QH7A 2RR12 4HSLA 4UF0B 4KNCA 1FOD3 4IERA 1D0GA 1A34A 1AR81 1A8MA 2ZX2A 3CJIA 1XXNA 5FZKA 2A6VA 4NOTA 3M2MA 3VL9A 4AEDB 2A71A 2F17A 1J83A 4PI0A 1C8M2 1AUYA 1H0BA 2BV4A 4BM8A 1HRV2 2J1VA 3NV3A 1W0NA 2B39A 2PHDA 4IEXA 4YGCA 4GALA 2KD7A 3POYA 4Y24A 3N9OA 4OLLA 1IHMA 4EN6B 3NNFA 2FDHA 1K5MA 1KGYA 4AQ6A 3GBGA 1IPSA 1DGWX 2CWMA 5FYIA 4C0BA 3MO4A 3I59A 1ODMA 4KG0A 3UGGA 4CP2A 4LK6A 4MHUA 1ZBE1 3R4DB 1SG3A 3KGLA 4GWMA 3WW3A 4CEWA 4ZZ8A 5IAVA 5BXXA 4S2GA 5J96B 1JZ3A 1NT0A 4YGDA 3MIFA 4QM8A 1S2KA 4BMBA 2XG3A 4M3CE 1L3JA 2RDNA 4A45A 1UZVA 4I01A 1VBD3 1DYOA 3D0SA 4LE3A 5FMOS 5M0TA 1PO23 4MGSA 1ULOA 1LCLA 4B1LA 4EV0A 2MHFA 4LPLA 2UY9A 2R061 1XU2A 4JRAA 1APNA 5L7OB 3LPGA 1EPWA 1JOBA 1Y7BA 2Y6KA 4QQOA 4RGKA 1I1EA 2YC2A 5T5PA 4HANA 2ZX0A 2DFBA 1JZ6A 3UKVA 4CDUA 3OD0A 4PCRA 4Q4W1 5LRSA 3VV1A 1DZRA 1PGW2 1UX6A 2WFF2 2WLQA 2XWJB 3SCGA 1BKZA 1OA3A 3UJOA 2W1WA 1OI6A 4XJWA 1DYPA 3GNEA 5JXHA 2QQUA 4CA9A 1AR62 5J7MA 1RC6A 4FFGA 2GH2A 4D94A 1H6XA 4MOAA 2BYVE 1E5RA 3KSCA 5AVPA 4P9JA 4XTMA 1PO22 4LITA 2VOTA 2IFWA 2VZVA 2ID4A 3AYDA 4UW6A 1OVSA 4Y20A 1K12A 4IV3A 3T4VA 2HWF3 3VHRA 5LRRA 1UOBA 2VZ1A 3ZM8A 4HK8A 4P9IA 1XBFA 3POWA 5DUUA 5EXOA 5JIAA 4EN0A 3NW4A 1MPXA 2D6LX 5FKCA 2XL7A 2VCMA 1V6MA 3D4KA 3MHZA 3E6BA 1LHOA 3J7LA 3NMBA 3T1LA 1RB8G 1H1AA 5IYYA 2VZSA 3HNBM 2RDRA 4RFT0 3JB4C 3KCCA 4G3YC 2XLAA 4P5HA 5FYZA 5CIRA 1OA2A 3E6DA 1ULPA 2HJIA 1W8TA 1AL22 1N1TA 2XQXA 3GF6A 4IV1A 4UOJA 4WBBA 5IK5A 1UZWA 4XDOA 4MH0E 3KT4A 1F2NA 3D6EA 3LE0A 3TAYA 3NJXA 1Q8PA 1HRV3 3I2IA 1NUKA 5KHGA 4FPEA 3VDAA 1W0PA 3OJBA 4U2AA 3ZFEB 1UN1A 1EUTA 2JDYA 3PUSA 1UY4A 1CD3G 4QPGC 3HVDA 5FZMA 1EV11 2BEOA 1T6GC 4RA0A 4BU2A 1G86A 4LNVA 2LM3A 3N9QA 3VGIA 3S5AA 4XE9A 5ABJB 1Y3TA 4ZU7A 2BBAA 3ZN4A 1VLNA 4XXAA 5C3RA 1LOCA 4YLZA 2EICA 1FNYA 2DURA 4A44A 5KC5A 4LQRA 3ZKUA 1JMUB 5EYYA 2JEMA 5IK7A 1SLAA 4B4QA 1E5SA 3CIHA 1TMF1 2VZQA 4JGZC 1OOPB 1CAUB 2WNVB 2MEV1 1PM4A 4L9BA 5K4LA 3PLQA 1AYN1 3Q8CA 1RUD2 5FPAA 2MNGA 1MVQA 3M3CA 5HCHA 4YW1A 5KXEA 1EP0A 3T30A 1YIFA 2W1QA 4N9HA 1DGRN 1SHWB 3ACLA 3VBUC 5KR7A 3UNPA 5FZ3A 4YVWB 5FZAA 3FBMA 4Z2WA 2HWD3 5HCAA 1UWWA 1X36A 4XTPA 4CDXA 5IVEA 4LKEA 2Y6LA 5LBCA 5T54A 2ZHMA 3WCRA 5C3SA 3FHQA 4FQ4A 5HI0A 1XYPA 1HXS2 3J26N 2XGXA 3C7HA 3O14A 5LA0A 2RDQA 1G8WA 2X53S 4IEUA 2D6KA 1GNYA 2D3SA 1VRH1 4A41A 4XETA 4ZXEA 1OLMA 2VCBA 4W6YA 1LB2A 1CPMA 1VBE1 2G9GA 3OEBA 4XOGA 4IW3A 1WMDA 4H7LA 3LFIA 5GALA 4CDWC 1UYZA 1X50A 2H6CA 2OT7A 3KQRA 4R4XA 3B5LB 3RZLA 3HT2A 1JYWA 2VOVA 2QBXA 4AVSA 2DVGA 5JOWA 1UMHA 2ILMA 3WW1A 4AVCA 3RZZA 1OC1A 1GKBA 1HQWA 3JCIA 3L2HA 4MSVA 4O9GA 4UW4A 4QMAA 2JICA 2R0FA 3ZFGA 4QB2A 4B7EA 4FXKB 3N36A 2YC4A 4QGNA 4YW5A 5C5UA 1XSQA 2YB7A 2VH9A 1CJDA 2ZABA 1HJFA 4DINB 1COV3 2JWPA 3R0RA 5DQ0A 1T6BX 1F35A 3LD8A 1FOD2 1QF3A 2ZGKA 1REDA 2GH8A 4A6OA 1RITA 5E89A 4MGKE 1NLQA 1D4M1 4P9WA 2CU5A 4WM8A 1S2BA 3O0XA 3NV2A 3LDRA 1NCQA 1WLTA 3MGUA 4FPJA 2XBO2 4CEWB 3W9AA 3ZYPA 1C8M3 3ILFA 5HV4A 1DGWA 2E9QA 2Q0AA 4DRVA 1HB4A 1ZX5A 1JODA 4JTNA 5BNNB 5A32A 3IZOA 2A3YA 4GWJA 4DY5A 1OMIA 5FO7B 1IS6A 1QNWA 4ZHNA 3VBFA 2BNMA 2XDVA 3H1WA 1BLZA 5FCCA 3I3BA 4HZFA 1W6PA 4AFDA 5I0TA 1N3QA 1W6MB 2VUJA 4PDWC 1ONAA 1WLCA 1G9CA 3V65A 2VBBA 2JECA 1PZ8A 3GHNA 3NAPA 4OYUA 1YLLA 3JB8A 1CAVB 1H9WA 2EIEA 3JQWA 4BHPA 2Q5TA 3UETA 1CX1A 4R9CA 1PNGA 3UKTA 2QZ3A 1M4WA 1UO9A 5EIYB 1D0HA 1W6QB 2BZDA 3D8CA 4JV4A 4HN0A 3AL5A 1SBEA 4NIIA 3VKFC 5L9VA 5FO9B 1ASJ3 2X29A 4NVPA 3WQ0A 2J1RA 3K2OA 4P9GA 5C6CA 2WL1A 4YM2A 5FZ4A 4AL9A 2XPJA 5LBBA 3AVSA 4XPVA 5D8AB 2V09A 2CNAA 2WZEA 5LBEA 1GBGA 1NXMA 1VRH2 5FQ0A 2WAAA 1VAVA 3LEIA 2X10A 5KXBA 4BB3A 2GNTA 3O5SA 1H8TA 4JGYB 4YW7A 5H9PA 1D7PM 1OLRA 3H3ZA 2XWBB 5C4WC 4EWAA 3D5OA 3NKTA 5HXVA 2PLV2 1FNZA 2EXIA 2HWC1 3TNPB 1JZ7A 4XJUA 1VBD2 1R1A2 1TG7A 4WM7B 3WNPA 2WS93 1W8UA 3NQHA 3V64A 3AM2A 1ZZ9A 4UFHA 3WG3A 4OHVA 1JN2P 2BP6A 1E57A 1GSLA 3ACGA 4NWWA 5FLIA 5JMOA 5JZGC 2A75A 4EROA 1O91A 3D82A 5FTTC 5FPBA 1RUJ1 3DYOA 5FY8A 3W5MA 4AGGA 3FFZA 2BWAA 3ZYJB 3GXUA 4GJZA 3GCXA 5DUXA 5LASA 3KV6A 1RJ7A 1T2XA 2ZMNA 3BCWA 4K7JA 4BK4A 1C8NA 1SDWA 4MXWB 3ZX7A 5LB6A 1W9WA 1PX3A 1FMD1 1AR71 5DPNA 2FBEA 1DGLA 2PHWA 2VL4A 3NVCA 5FLHA 5FZLA 2HWB3 3S7IA 2QQVA 4F3JA 4AQSA 4MGTA 2LALA 1W8HA 4DS0A 3EBRA 4DO0A 4K21A 1RUC1 5JZGA 1RUC2 3AZXA 2ZX4A 1WLWA 4CP9A 2WT2A 4ZPIA 3AK0A 1DFQA 3SXWA 1GWMA 5T52A 2HLEA 1G7YA 1HQNA 2JDPA 3VZJA 1O3TA 4Q26A 3LFMA 1OH3A 5FYSA 1BHGA 1UMZA 1D2QA 1UKRA 2YYOA 1CIWA 2ZKLA 4MX3A 2ENRA 4Q0UA 5FZOA 3IB3A 4BCUA 4XQWA 3TWIA 2JDZA 1FAYA 3ZR6A 5JOZA 4P9YA 3ALQA 3NJVA 4YVSC 3ZFGC 1UZ0A 1EAH1 2YPJA 3MDPA 1AXKA 2XONA 3AP4A 5BNOB 4JTOA 4Q8LA 4YW4A 1WBFA 1YQ8A 5D21A 1U0AA 3I3EA 4E8CA 1XJAA 1PMIA 4AFCA 1W9SA 4AVVA 5FO8B 1YEWA 1S0GA 2D44A 5J09A 2C6SA 4CU6A 3NL1A 4IE6A 4LKDA 1IZ3A 2VE1A 2WNUA 3AYAA 1QJU2 4ITCA 4OFGA 3WUDA 2W46A 1KS5A 2J7MA 2WFPA 2ZGSA 1BEV2 2VNOA 3CMGA 2P1BA 1VMJA 3UESA 4M3CB 2BGPA 2VTXA 3MF9A 4HSJA 1IOAA 5I0SA 3S57A 4N8MA 5JPMB 3HN3A 1WCSA 5FZ9A 4YYOA 4ASMB 5JPNB 2UU8A 3PHMA 4KU8A 5FK8A 1SLTA 1VBB2 3MIGA 1HRI3 2Q1FA 2TBVA 1WCQA 3HQUA 3K4DA 3QH7A 1SEFA 3U0ZA 4OQ9A 1WW7A 2PLV3 2WINB 3A0NA 2WFF1 4BDVB 3KD4A 2BPA2 3USSA 3WLUA 1NCRC 4FFHA 3WDUA 3A21A 3HD8B 2DUPA 4D7SA 2QQKA 3OTFA 4JGYC 3MV01 1ENRA 4YVSB 4Q1PA 1H4GA 1RUJ2 4EN8B 4XF9A 1TNRA 1Q5OA 1RUG1 5FOJB 2JB4A 3E1F1 4Q0SA 2RS31 1RXFA 1PVC1 4WZCA 4B7KA 5JAXA 2ZGPA 2FZ2A 3DN7A 1K5MB 2VMGA 3T09A 4QDRA 1PK6B 3T3YA 5GLUA 1JYIA 5CA6A 2WFF3 1U12A 3ITQA 2DTYA 2J1UA 3FZ3A 1VRBA 4DUXA 2XKPA 1E5IA 2JG8C 4OHXA 3RYPA 2WAOA 3SH4A 3TRSB 4LUKA 4LT5A 2WLPA 2Z69A 1YNAA 1AX0A 3VDDA 3MIHA 5AFBA 1FPN2 4BQ5A 3FMGA 4D3WA 3PMEA 3O0WA 3VUOA 1Q3EA 1WMEA 5L36A 5CFCA 5CKMA 3K46A 4B3NA 4BQ4A 2WT1A 1POV0 5K8SA 3PJQA 5DAQA 1BK0A 1LGBA 3QOPA 4Y4YA 1W8OA 5DXDA 2GMEA 4XFHA 4XEZA 2B45X 4L92A 2LS6A 3BPSA 4G9SB 1O4TA 3BUCA 1POV1 2NP0A 4W6WA 3ZXGA 4RS5C 5BNPB 1OHFA 4AFAA 1GWLA 4Y1UA 2AYHA 3WOGA 1WZXA 3LKJA 1EAH2 2UYBA 1QJFA 1HW5A 3MICA 2VMIA 1PM7A 2CGOA 1AZDA 5IUQA 3FBYA 4FQZA 4N53B 4XCAA 3ENRA 1O59A 3POGA 3LEKA 4MZUA 2QQMA 2FDGA 1LHNA 4IE4A 2VNGA 3ECQA 4KBBA 5FY7A 4E2GA 2VD7A 4BOWA 5FZ1A 2VULA 2ZAAA 4CXYA 4WVMB 2OA2A 4FXGB 3NNLA 2JG8A 2E51A 2E6VA 1W6OA 3WF3A 4Q2FA 3AP7A 4F7ZA 3VBSB 2BTVC 3KT7A 4Q4X2 1DHKB 2G4IA 4A2UA 1FPN3 4J25A 1ZZ7A 1KJRA 3ATGA 3LA3A 3LDBA 4XMAA 5DMYA 3WDVA 1IKQA 1ASJ2 4EZHA 2P3KA 2PAKA 1XNDA 1AR73 2WZR2 4GWNA 5FWJA 1RUD1 2PAMA 1UCXA 5KHJA 1DQ5A 1H9PA 2ARBA 1GNHA 1RTVA 2JG9C 4QPWA 3U75A 1XOYA 1RUI2 3D0JA 1NCRA 4JHZA 2A6WA 2Y26A 3VBHB 1M06G 5A6YA 4DUWA 4CRQA 4BLJA 1GWKA 3ZFFC 3ZLIA 5B4NA 2ARCA 3AKTA 5FXZA 5CFDA 4NAMA 5EFUA 4XW3A 5IVCA 2OZ6A 5C8CA 1B35A 4OQ8A 4AVTA 1US3A 2RS11 2W2IA 3QH6A 2HWC3 3HBKA 1W39A 3VBOC 4RQPB 3GYDA 2R16A 1LOFA 2ZEYA 1RJ8A 1RMU3 2VNVA 4Y3OA 3GHMA 3I2KA 3TEZA 4XC9A 4FAGA 1FPN1 1FV3A 3K51A 3QACA 1RL3A 5JXJA 1ZZ6A 3RZKA 4Q4V3 4AWDA 3DL3A 2DDUA 1BZWA 3IBMA 5DAVA 1RUE3 1W05A 1O3SA 1OT5A 3ORJA 2V4VA 3H7YA 2JE8A 5C8CB 4AQTA 4HONA 2E63A 3RJRA 4CUGA 1G9DA 5L7OC 3GBFA 1R082 3ACIA 4QX0A 2FHRA 2Y8KA 5JR7B 4Y1VA 4FAHA 3CLPA 2OPWA 1X82A 1ULCA 2GNDA 2ZPXA 3EO6A 4P14A 3CO2A 2VOWA 4CE8A 5A70A 3CL1A 2AREA 1R092 5G04L 4ES9A 4GMP0 3VZOA 4NHKA 4QPIC 1XE7A 1AL23 2CL2A 2RJ2A 4D69A 2VUDA 2WQZC 2P34A 4KH9A 4R9DA 1N1YA 5A7PA 4AZZA 4XFIA 1MS1A 4QHBA 4LLFA 4ET7A 4GMP1 4OVEA 5A6XA 3FWEA 1CZSA 1S4CA 3GJBA 4JVAA 2Y6FA 4NIDA 1ZBA3 1FV2A 1QXRA 3WXPA 4RHV2 3NKGA 2W94A 2BQPA 4RGGA 4XFGA 2W91A 3S5QA 5FPUA 1JU3A 4Q4X3 3NSTA 2WYSA 5CAZA 3ZFFB 5IJRA 1F15A 1QJX3 4QWNA 3M3IA 1K42A 2VXRA 1UL9A 1MS9A 3AP5A 4FTEA 1S0EA 1ND3A 4COUA 2QQOA 2Q8OA 5SV8A 4XYXA 1BXHA 4SLIA 4RN5A 5T5LA 4UYBA 3MUY1 4OUMA 2WUHA 2PHRA 2RS52 1XC6A 2Y34A 1QOOA 2QE3A 3WNOA 1U5YA 3GBWA 4Y5SA 2WNUC 1K5MC 4L97A 4JGZB 3ZKYA 5CFDC 3T0DA 5C4WA 3RFRA 2Q30A 3VBSC 4YGEA 3VKMA 4AW7A 5BPXA 1DG6A 3C8XA 1RGSA 1XU1A 3VB9A 1SDDB 4W65A 1DQ0A 4LHSA 2FQPA 5GLZA 2VZPA 2PLV1 5J37A 3THPA 2K0GA 4NHLA 4YG0A 5FZCA 3JD73 1D4M2 2W68A 2GC2A 1GU3A 3AFGA 3I2HA 4WM7A 3ILRA 2ZZQA 2VVFA 4GA9A 1QJX1 2ZOEB 1H2MA 3OD4A 2XQRA 2PHXA 4QM9A 2EALA 1J58A 4XILA 4YZ2A 1K3IA 4XBLA 3MFCA 5DABA 2XMLA 1DYKA 1CAXB 1V6NA 1NA1C 3CNAA 2HKXA 4QQ2A 3VBOB 3FFQA 4Y26A 3ZXKA 4CU8A 4JGYA 1I3HA 3FJSA 1XE0A 2CGNA 4QKFA 5CBLA 4Q8KA 4JDMA 4CPBD 2KXLA 1KDMA 5FREA 1VJ2A 2W95A 1Z7S1 3WINE 3KZ4C 3BVCA 3J7HA 1HKDA 4I2OA 4KQ7A 2XOMA 3H42B 4CPBA 1ZRDA 4GB33 2GZWA 1YHFA 4G4FA 2EA7A 4CCDA 5A3UA 2JKXA 2XB6C 4IEVA 3NJYA 5FAXA 2AUYA 3C7FA 4EWDA 1OURA 3H8OA 1CQ9A 1UIJA 1KQRA 3HMYA 4LMFA 2ZHNA 3ZYIB 5F2WA 4X8NA 2HWE3 5EJ3A 1CAWA 1GQHA 1V6LA 2HWF2 2VZ3A 4TZDA 3M3QA 4FT8A 4MUVA 2XJPA 3RSJA 1DZTA 2ZHLA 3NV4A 3WP5A 4BIOA 2FMYA 3UT0A 2R071 2W0XA 5F7UA 1RUC3 4I0AA 5J3UA 4JKLA 3GCWA 3Q8EA 3FLRA 1EV13 2BRTA 1UY0A 2AR6A 1PIV3 3N7LA 2XJTA 3FUOA 1LOBA 4YNIA 5GLWA 1AXZA 5IVYA 5JOXA 2VQTA 4ASKA 1MS3A 1BVVA 5C3QA 2WDBA 3WG2A 2D3PA 3OGGA 1G9FA 1BBT1 1A78A 2VGDA 5LK5A 1BBT2 2VO5A 2DV9A 4DNYA 2JIJA 3KT1A 4WM8B 2O8QA 2RS53 1BEV1 2PA7A 5FK7A 4XJZA 5FZGA 5A7OA 2VCCA 1ZBE2 1ST8A 2B46X 4GXLA 4HVOA 4YPJA 2B9VA 3V56A 3KV4A 3AJZA 5C33A 1YO8A 1VE0A 5DG2A 3ZDSA 1W9TA 3SEEA 1JW6A 2G19A 2IVIB 1VPHA 2WNOA 4NRPA 5DDJ3 3CDZB 3PU3A 4Y22B 4B4RA 2WO2A 1WMXA 2GNBA 3MLLA 3LDKA 3M7AA 3F95A 2UURA 3HEIA 3QCWA 1BEV3 1JTZX 5FYTA 1XNTA 1Z78A 3IM0A 2J1SA 2Z79A 1BBT3 3IMNA 1W2UA 4PHZA 5F1RA 4UAPA 1X8EA 3WDTA 3SNMA 4LBQB 3WP3A 1JUHA 5EQUA 4Y22A 3LOBA 5CEHA 1OLQA 3B9IA 4P5YA 4TSVA 4LKFA 2YGLA 4IQPA 4QXHA 5I0DA 5KHKA 2CV6A 3WNNA 2R073 1G9AA 1GOFA 3BTYA 1WCKA 4LBLA 4LHNA 1XPWA 2NPIA 5AC91 2ADDA 5FYHA 4FPKA 2E33A 1PK6C 2NMNA 3AXEA 4CDXB 2G9ZA 3HNYM 3NNJA 2RS12 5CADA 4BK5A 1GFF2 1UKGA 2YFUA 5H9RA 5GZCA 3VBRB 1QXJA 5K0UA 4AHYA 2R49A 2VW1A 4MXVA 4BA6A 1Q56A 5K9YA 2EIDA 4Z1VA 3PDQA 1JHJA 1FXZA 1KDKA 2I2SA 3IDBB 5FYVA 1OUXA 3VBSA 3WF4A 4AXOA 4A3XA 1N3OA 1CONA 1H8VA 3K3NA 4CDQC 3HOBA 3H9AA 5F37A 2XR4A 1QEXA 5LZ6A 3BU0A 1HV1A 5CG9A 1EUUA 4XUNA 4C8DA 4XFBA 2C5DA 2CGPA 1QIQA 4ZS3A 3DKWA 4QB6A 5JR2A 4PI2A 3ZXDA 3PUHA 4J6GA 1AYM2 1RVF1 4QQLA 4QX8A 4DUVA 1ZRRA 1MQTA 2GSYA 2LROA 2YGMA 3CJXA 2DCJA 4Q4W2 4D7YA 1WWYA 2LRPA 4BQ3A 1OUSA 1CAVA 1COV1 2FCVA 3UJQA 4V1PA 3OCPA 3KQ4B 4IE5A 3O7OA 2P6HA 2IZWA 2RS33 4GKYA 2VW2A 2ZXQA 2QQNA 5C5TA 2QFEA 2XLFA 4XZUG 1AR83 1RHI2 2Q8DA 2VBPA 1IKPA 4NHMA 3VZKA 3KB5A 1UQXA 3I8TA 1AHSA 2GDFA 3N3HA 4GH4B 4QKNA 4YVWA 4AEJA 3VZLA 3H8UA 4JKMA 5C9AA 1BMV2 1AX2A 1WCDJ 3ZMOA 1VALA 3OPZA 4QU2A 4AFBA 1LHWA 3RGBA 4CXWA 1AR72 5I0UA 2RM22 3U1XA 1CAUA 1HB2A 2DU1A 2WNVA 2Y0IA 4CU7A 5LA9A 2A73B 5K0UB 4CXXA 4QX3A 4GKXA 2VAUA 1RUI3 2IXCA 4YFWA 1GOGA 3ZXAC 1W2OA 3E5QA 5DG1A 1LEDA 2GN3A 1QNYA 2RS32 2ZHKA 3LSEA 1RVF3 4TTGA 2YU2A 5A3TA 4XIKA 5ABJA 2FDIA 3RMXA 5JSPA 4V2VA 2ZGOA 4LO8A 1S1AA 1W04A 3OOXA 1MACA 4UBGA 4P02B 2O14A 4OI4A 4L8QA 2IC1A 2VC9A 2HWD2 4MGZE 5H9QA 1AL21 1KJLA 2YMZA 4IEQA 1VB4A 3TEYA 1W03A 3A0KA 1W8ZA 2RMU3 4GD4A 4LEJA 1VBE2 4R9AA 2XKOA 3TNQA 1ZBA1 3T2PA 3BYWA 2WIIB 4XABA 5L73A 4CDUB 3UK9A 4UI9L 4EZ4A 1EY2A 1SACA 4IEPA 1SLBA 2DCZA 2Q4SA 2EIGA 1TMF3 4AK3A 4CUBA 1UNBA 3AC0A 5IVJA 4YG6A 1XE8A 2VNRA 4RFRB 2UYAA 4ARXA 1OQ1A 2WJSA 4PBPA 1W9YA 2R1BA 2CY6A 4YW2A 3WP6A 4FO9A 3SH3A 1UW8A 3T1MA 3ZFFA 4YFZA 5AC93 1W2NA 1LECA 1GICA 2HEVF 2HWB2 3U10A 1UU4A 3ZXFA 5B2GB 2ADEA 2W92A 1W8WA 4YW3A 3K77A 3PIGA 4COYA 3AYEA 5ABJC 4XJ9A 1YJKA 1JH5A 2WO7A 3BTXA 4E4ZA 2WZR1 4XQ4A 2C9KA 1GANA 3MIDA 3NJZA 2D93A 2X09A 4C90A 1C1LA 1JS9A 2V5YA 4K40A 1NZIA 1XB9A 1VR3A 3LZZA 1CIYA 4H2AA 4XIOA 2EVXA 2SLIA 4M00A 3DXTA 4Y1YA 1UU5A 1W06A 3KV9A 4BE3A 4CP1A 1DLCA 4COVA 2KM2A 1RUJ3 2D97A 3RPQA 5A3NA 2IFRA 3LF7A 1J3RA 2JE9A 2RG4A 2Q1MA 4YVWC 4CDUC 2PMWB 4AGVA 4E2SA 3POIA 3GGLA 1VMHA 3A7QA 4AEDA 1KFUL 4P08A 2DUOA 5C8WA 5GLVA 5L7OA 3USUB 4OMDA 1MS8A 2B7YA 3SKJE 2W87A 4LORA 3ZYHA 4W50A 4ZZ5A 5IK8A 3OUJA 5FZ6A 1OOPC 4TN7A 2Q8CA 3GJAA 3BOPA 2RMU2 4UFIA 4Y4RA 1QWRA 2RS51 2XJQA 2VG9A 3CHXA 5D2AA 4AOCA 3I49A 3DPRA 3ZDVA 3ZYFA 5FYMA 2I74A 1RUD3 2PHTA 2C9AA 5CKNA 2ETEA 1GP5A 2WZPP 1PIV1 4KWJA 4OZOA 4AEKA 2AC1A 2VZOA 1RYYA 4CEWC 4J1XA 5FP8A 3ZYGA 2Y6GA 5I8YA 2OX0A 4PIZA 1PGL1 4GH4C 3ZIWA 5CFCC 1REEA 4Q4W3 4KL1A 2XUMA 2JJ6A 4ISQA 4B4PA 2CDOA 2VTFA 3VZNA 4HBNA 4LBOA 3KF3A 4Q4Y1 1OD3A 4O61A 5T55A 3RWKX 1KFXL 2KA3A 1NY72 4XURA 3MBWA 3ZSJA 4CCCA 3CQOA 4ZONA 2OQ6A 2H0BA 1FYUA 4CCEA 2ES3A 4CCLA 4CDWB 1VB2A 5A7SA 3I54A 3AZWA 5CG8A 3GZTB 4WVWA 3CJIC 5JZGB 3PTRB 2P17A 3RWNA 2ZEZA 4NPRA 2JKBA 3N7MA 5C9AB 2CDPA 1RINA 2V5DA 1MR5A 2B9UA 3H1YA 1SFNA 2ZGRA 4QPGB 2BUKA 3OSDA 1V00A 2PHUA 4LULA 5C7GA 5FPXA 1POV3 1MEC1 1Z7S3 1C8M1 2OUJA 2VW0A 3AJYA 5C4WB 2ZGLA 3O1OA 2WC2A 4GIQA 3AKPA 4FPYA 3U4XA 2B5HA 3RZHA 3RJ2X 5FUPA 2J1EA 4CU9A 5C71A 5KC6A 5FFOC 4LXLA 2Z2SB 3C3VA 3H3LA 4JDNA 3B9CA 1RUI1 3RI9A 1C5HA 2VVDA 4FPFA 3L9JT 4Q0VA 3SKVA 1W6MA 3VBHC 1PVC3 1YIPA 5FY9A 1WCUA 4MGYE 3TEXA 3DV8A 4Q27A 4IV1C 3WX5A 1NXD1 4PIXA 4I3PA 2OZJA 1WW4A 3KCXA 2EAAA 4HPKB 4RS5A 2QCSB 4JCKA 5GKAC 1IS3A 2OW4A 1IGOA 5FOBB 4FOQA 1ZREA 2IVJA 2PQQA 2HWC2 1R1ZA 3I59B 3S30A 2A3WA 5CFCB 5EJ1B 2ZKNA 3KHCA 1JZ2A 4QXBA 3GDBA 4IUGA 3KCYA 2H0VA 4IDZA 5I8TA 1SMVA 2X5IC 2Y6JA 4K6BA 2G9FA 2VECA 1YQ2A 1QOTA 1SLCA 1VRH3 3POEA 4Q0PA 5JXGA 1IPJA 1NE4A 2JDKA 3DYMA 5FMCA 1UF2C 3UL2A 4IEWA 1VBA3 2WR9A 3SISA 5FP7A 2WO1A 1DU3D 3H7JA 4Q29A 4DXTA 2J42A 4GWIA 3NWKA 1Y43B 3I7DA 3MFAA 1CX4A 3AB0A 4Q4X1 5F3GA 2K46A 3X29B 1IG3A 4CP9B 3MZHA 2DBIA 2AH2A 1NQJA 1GUIA 4PQ9A 4QHZA 5LWBA 4DRRA 1TVGA 2DCYA 5FRAA 1QJX2 1VBB1 3WP4A 2NYYA 1EAH3 3ACHA 1UX7A 3OGRA 5FYCA 1OXCA 2IXIA 2MEV3 4R4ZA 2WQ8A 5BNNC 1OPMA
chains in the Genus database with same CATH topology
2XLGA 2CWSA 5JCTA 4HKOA 4AVAA 2A3XA 4MV2A 5JWPA 4I3GA 5JDBA 4XF3A 3AKRA 2GC3A 2R072 3ETQA 4KWLA 3SH5A 1UPIA 1SBFA 4EN7B 1UD1A 1HX6A 1Q8OA 5EZWA 3ILNA 1U5ZA 4SBVA 2DU0A 3VKNA 1NCRB 3JZVA 4AGRA 1RUE1 4JC1A 1RUE2 1TEIA 4BZ4A 4DOUA 3AKQA 1GYKA 2YXSA 2GC1A 3EXUA 3B01A 3OYWA 4YZ3A 1KD7A 1DQ4A 1C28A 2N7GA 1RMU1 3LOIA 1SLIA 2W08A 1ZRFA 3HIFA 2GU9A 2RE9A 3HWJA 3R05A 1RUF1 3APBA 1LKNA 1RUF2 1YJLA 3VDDB 1V9U1 4K8FA 5KWRA 5DZEA 3OF1A 2QDNA 1W6OB 3NV1A 3THTA 2BWCA 4RSUA 1KITA 2JG8B 4YG3A 1GZWA 1NA1B 3IKWA 1LODA 3ES4A 1O4ZA 3MYXA 2K9ZA 5BV6A 4QPIB 2R062 2Y0OA 1BQPA 2P37A 1I6XA 2E7AA 1XRUA 4LBQA 1H30A 2HYKA 4LO7A 2BNNA 1OKQA 1XNBA 4PF5A 4B8EA 1NLSA 3IT8A 3ZSKA 2WZR3 1HRI2 3QD6A 3N7KA 4I09A 5BNPA 5A32B 3MI8A 2QUOA 3ASIA 4URTA 1CAXA 1H1MA 4QX5A 2R042 1ULDA 1Y9QA 2YV8A 1A3KA 2VMHA 1ASJ1 4AFMA 3ZXEA 3LCPA 2HWE1 2EAKA 3B69A 4CEYC 4GQ7A 3AKSA 2O8OA 2SBAA 4BPZA 1MZEA 2CYFA 4N43A 1LJ7A 4RR3A 4FSJA 2DVAA 3ZN5A 3EJKA 1QKQA 4GB31 3WDXA 1DQ6A 1H4HA 1CGPA 4OHYA 2HEWF 2XBO3 2R6QA 4LBKA 1PGL2 2F4PA 1PO12 3C2UA 5E1RA 3SCHA 4M01A 4XF0A 4KU7A 2K2SA 2WSVA 1JOJA 3I4IA 4RL7A 4ES8A 1C4RA 1Q43A 3NAPB 4IETA 3JD71 1V6KA 4CDQB 2EF6A 4M3CA 5C8CC 1NOVA 5BNOC 4BYYA 5DZFA 2UWCA 4FCAA 1S0FA 4XFFA 1LOEA 4CDXC 5HCFA 2GMPA 2MEV2 1HV0A 1O7FA 1W6NA 5K7PA 2CAVA 2ZZJA 4LR4A 5BNNA 2JX9A 4PLMA 1J1TA 4M3CF 4OHWA 2P3IA 3ME2A 2Z42A 3EHKA 4RQPC 4QQHA 3RYRA 4PLNA 4AI2A 1R083 1NLRA 1VBC3 1HRI1 1ULEA 1HXS1 2V73A 3MLJA 5FDBA 2YUEA 5JI9A 3RMYA 1CAWB 4I0BA 1DZQA 2HWD1 3VHPA 3TB0A 1JHNA 4META 3OBTA 4NN0A 1I5ZA 4H3WA 2NMOA 2ZAHA 4FPGA 5F9TA 4GMP3 1AX1A 1UU6A 2VOXA 4GH4A 1TNFA 1VAMA 4HVRA 1ZVFA 3JUUA 5F6LB 5GZGA 2JG9B 1W6QA 4KGGA 5A3LA 4HFSA 4PJYA 3ZYRA 1QQP1 1KXGA 4F83A 2VVEA 5JSRA 5IT6A 3J4UH 4IEYA 3VBHA 5BYNA 4IESA 2JD4A 3MW4A 1ENQA 4TLFA 4YARA 1RVF2 3M4FA 3TOJA 1LEMA 4AEDC 1NZCA 3PVBB 1O3RA 3EQEA 5EV7A 3M1HA 1AVBA 2D5HA 2UWBA 4E9KA 1JYCA 5L19A 1NYWA 1QDOA 2BFUS 4A7YA 1QJY2 2PYTA 1YI7A 2W39A 1H8TB 3WDWA 2HWB1 1RHI1 2ZTNA 4OI0A 1A8DA 3FC0A 2RS13 5DDJ1 2ZMKA 1LU1A 1BJQA 4AI0A 4EWEA 1QGLA 1IS5A 3H50A 1X33A 4YZ4A 2IWGB 4EN9B 1F9KA 5DUWA 4HLTA 5CVRA 1UZZA 1AF9A 1N1VA 2P3JA 1ZYBA 2X8KA 1PIV2 2C1FA 2PELA 1V6OA 2GALA 2YY1A 1RUOA 4AF9A 4RD7A 1J1LA 4RGAA 5I93A 1B35C 2DTWA 3IPVB 1W0OA 3BU7A 3JBG1 4FPCA 4MVTA 1RUNA 5JI7A 3AZVA 5E8AA 3VHOA 3V0BB 1LOAA 2A5ZA 5E88A 4Z8BA 2LTNA 2IXJA 1VBD1 5I8SA 5D1IA 1YI9A 4BQ1A 2R063 2DCKA 4AYUA 2E7QA 4HETA 5T5JA 1MEC2 4COWA 1DBNA 1A6CA 3VL8A 1SQ4A 3MPPG 3ZFGB 2NQYA 4HPKA 4OZXA 4XFCA 4HK9A 3AZZA 5C9AC 2IXLA 4RQPA 3HQXA 2TEPA 2GAUA 3BODA 1WBLA 2GC0A 1RUH1 3LAGA 1O4YA 2E53A 2HWE2 5LEKA 3FHIB 2QNKA 3SCFA 4LO4B 1B35B 1D4M3 3WVJA 4N53A 4DZGA 4N43B 1BCXA 2XVKA 3ELNA 3WHTA 3SHRA 2OYZA 1BVP1 3KM5A 5A33A 2ZX3A 2QZ2A 2ZA9A 2QDRA 4QPYA 3E6CC 2ET1A 3ZFEA 4E4SA 1YXWA 5FBZA 3BTAA 1RUG3 4CP0A 1X7NA 3URFA 3B02A 1QY4A 1WA4A 3LSDA 1GZ9A 4IV1B 3PVOA 5F6KA 3L2YA 1PO13 3DUIA 2VU9A 3O12A 1UZYA 1OQEA 4HKWA 5ACA3 1N1SA 4FOVA 4R9BA 1REFA 1X8MA 4YM1A 4K1YA 2ZGMA 3K48A 2PTMA 3DF0A 1PK6A 2ARXA 3CF6E 1CPNA 4RR3C 5BY5A 3AFKA 3R4SA 4JDOA 1AYN2 1HLCA 1JBCA 4E2QA 2QKDA 4MXWA 3POSA 4K1ZA 4OULA 5GJ6A 5AFEA 2D98A 1KS4A 4W6XA 1H1IA 4UW3A 3VBRC 4R52A 1G6NA 4CTEA 2ERFA 1CN1A 5I0RA 3WR0A 3HBZA 1ALYA 4LO6B 1AL0G 3VKLA 2XH6A 4P9LA 4XF1A 3PTYA 4I30A 3LB9A 1H2KA 1AYM3 3ZMNA 3MW2A 2TUNA 1V6JA 2RM21 5KXCA 4Q4V1 4C0HA 3ES1A 1RUH2 2O0OA 1BYHA 1PHMA 4QGMA 3SITA 1QJY3 3N35A 2DVFA 5D8AA 1ZM1A 2VUAA 2O1QA 4DXZA 1HRV1 3J8F1 1R093 4Y1ZA 1PO11 3VDDC 1H8TC 1QJZA 4YZ1A 1ND2B 1D4VB 4Q1RA 1YFUA 4JAAA 3N4MA 1LGCA 2DVDA 4KWKA 4CEYA 1AR91 2WKKA 1GZCA 2MPFA 4OI1A 5CU1A 1F8VA 4X6QB 3VBFB 1ND2A 2CAUA 2QVSB 2WSUA 3PVNA 4E27A 3V0BA 1ULFA 1V6IA 1LHUA 4ZU4A 4FOWA 3TN92 3TN91 2AGSA 1YFYA 4UXAA 3HAGA 1ENXA 2I45A 3H1MA 4PBOA 4HN1A 5CFDB 2JENA 1S0IA 5IK4A 4QXKA 1MZ5A 4HVQA 4R8HA 1Z0HA 4S2HA 1XQNA 1AR61 1ND2C 1DQ2A 2ZCWA 3WQ7A 5KXDA 1RUG2 3ZSEA 2A6YA 3BOWA 3OY8B 2OVUA 4KGQA 5AC92 2R041 1DGRA 1IPKA 1UPSA 4U36A 2YZ4A 2JE7A 1BK1A 2D6PA 3AMMA 3JQXA 3WD5A 4QD2A 2QJVA 3ZSMA 4ATFA 3WT3A 4LBNA 3HR9A 3MIEA 3MLKA 3AX4A 1PZ9A 4N43C 2I07B 4WVMA 4CYDA 4H14A 4ATEA 4GB32 3FUQA 4H7MA 1FX5A 1WLDA 1OFNA 4LBQD 2E7TA 3P3PA 1TMF2 4UBHA 4C91A 1LENA 3RDIA 3ST7A 1LULA 2WQ4A 3LA2A 5JIUA 1QU0A 1FOD1 3OGJA 1TME1 3J9SA 1GQGA 1PZ7A 2RR13 2A70A 3BPZA 3DGTA 2VQ0A 4ONUA 2ZGQA 3MW3A 5FQ0B 1MVEA 1VAKA 3O0VA 1S0DA 4MYEA 4ZXKA 3VBRA 1NQDA 4XQDA 3T2TA 1EYBA 3WG1A 1QJY1 1Q8QA 1QXPA 1WW6A 3ZXJA 2BFUL 3DPRB 1OQDA 2D7FA 2XVLA 5LK7B 2HEYF 3MIBA 3VZMA 4YGBA 1LR5A 4HL0A 4ZU5A 1VIWB 2EXHA 3V0AB 2RM23 3USUA 2Y38A 4WM7C 2XJVA 1CVNA 4CEYB 3KGZA 2YHJA 4YM0A 1AXYA 3IWZA 4XHXA 3LWCA 1W6PB 1I9RA 3MEPA 3B7MA 1VBC2 1YUDA 4X6RB 1QQP3 1D2SA 2XHKA 5GZFA 3LA7A 2PHLA 4BWOA 1AYN3 1H2LA 4D7TA 5HBAA 4O9EA 4ZKTB 3UV9A 1URXA 1NG0A 2LUWA 5T3NA 3B00A 4DQAA 3NAPC 4HMZA 4WVVA 3RI8A 4FPOB 4YRDA 1ND3C 4Q4Y2 4CZSA 3AZYA 4FTBA 2EXKA 1GNZA 3VBFC 4AHWA 3GALA 3VHNA 2GNMA 2PHFA 1QH6A 4IEZA 3H0OA 4FBFA 3SMHA 1HXS3 4N53C 3ZN6A 3H3UA 1FMD3 1VP6A 1LOGA 1O3QA 2R30A 2AENA 3S6PA 3B3QE 2ATFA 1R081 3HN1A 5TSWA 3BALA 3Q9OA 2UY8A 3P3NA 1PNFA 5DUVA 1OSGA 3QLQA 2XJSA 1S0CA 1WW5A 2XJRA 4KG8A 1FI2A 3WW4A 3M3OA 3VLBB 2GN7A 2UWAA 3AXDA 2WS91 3V0AA 4XBQA 1R1A3 4UW5A 4B29A 5J36A 1UIKA 5FLJA 1MS5A 4DY3A 3I2DA 2X5IA 2HWF1 2NM1A 1CESA 4M0HA 5D8AC 2H6BA 2P2KA 2R1DA 4COZA 2WA3A 3RS6A 5BNQA 1J59A 4XHBA 1LTEA 1QJU3 4A7ZA 1DF0A 1O5UA 1S55A 2DVBA 4L2NA 2Q1ZB 3DPRC 3G7DA 3AMPA 1WGPA 3VBOA 1COV2 2A7AA 2D5FA 4XDQA 3VN4A 1OOPA 5GZDA 1MZFA 4Y1XA 3JD72 2NZ9A 1GR3A 3IN9A 2PFWA 5A3MA 1LHVA 2BW8A 2ZJCA 3FE5A 2X5IB 4IV3C 2YROA 3JBG2 1QMJA 4Y20B 4JQRA 4LLOA 5EWSA 5JLVA 3WY6A 1U5XA 3VBUA 1YFXA 1VBA2 1EPZA 3R4UA 2A6ZA 2JG9A 3NO8A 5GZEA 3WUCA 4AI8A 1SCRA 4J1WA 5I91A 2XL9A 1ZBE3 4JGZA 4H55A 4ISRA 3VZKA 3E5XA 1SBDA 3KMHA 3M70A 4XJAA 3G6JB 1XNCA 4I02A 1SCSA 1J3QA 2WNVC 1QDCA 4NO4A 4XMIA 4K20A 3ZXLA 4Z92B 5T50A 3VBUB 1ND3B 1ZZ8A 4WZFA 2D6OX 4I0WB 4Q0QA 2ZACA 2D3RA 2IXHA 1CJPA 2PN5A 1XYNA 2TNFA 1WUVA 3ZSLA 4AE2A 4WVZA 4N9IA 5GM0A 1LU2A 1ZA4A 2BBVA 1LOFC 1OD5A 1ZZBA 3ZIXA 2WS92 4IV3B 3OBRA 5JSOA 3RG0A 1YCIA 3ZFEC 1DLLA 1H2NA 1HDKA 2DUQA 2BNOA 1ULGA 5FMOL 3IPVA 1RUF3 3E5UA 5J48A 1VBE3 4PLOA 4M0NA 2OIIA 4IL7A 1NCQB 4L11A 4QGLA 3S0MA 4CDQA 3QBQA 1PVXA 3J8F2 1XNKA 5KHIA 1B09A 5BUVA 4FOYA 4OI2A 1AYM1 3KLSA 4DB5A 4WV8A 4YZ5A 1DQ1A 3INAA 2IXKA 3RNSA 1PGW1 2OUHA 4MGIE 4TYSA 3BB6A 1F5FA 1YYNA 4AI3A 1YFWA 2XJUA 4BMEA 2ZBJA 2DCTA 3WG4A 3WQ1A 3FX3A 4QT6A 1IQAA 5ACA2 5KHHA 1QHDA 1C1FA 1TE1B 1XYOA 3IDCB 5SV5A 4DMIA 1ZRCA 4BH9A 1ZNPA 4FTSA 3ZN6B 4LA3A 2D6MA 3A4UA 4K9SA 1JXNA 3R6SA 3RQ0A 4BLIA 4N90A 4RS5B 4S2DA 1W6NB 5BNPC 4N7UA 1CR7A 1TQ5A 3VKOA 3B93A 4FPLA 3W58A 4GULA 4OUSA 1PVC2 1SLLA 4PDWB 4XJ8A 2NN8A 5J98B 3MF6A 5DZGA 1VBC1 2C0ZA 1F5JA 3BIWE 4Z07A 1JUIA 4XFAA 1FATA 4Q4V2 1EV12 1NE6A 1TME3 5JOYA 4XBNA 1PGSA 1QOSA 1LGNA 1OA4A 2B42B 3PNAA 1ZBA2 5K0UC 1RMU2 1U5IA 1AR92 2DYCA 4FP3A 1MZ6A 1YRZA 1WD4A 2AZ5A 4LHKA 2F6BA 4TWTA 1V9U2 3M3EA 4FVVA 2VY0A 1MS0A 2ZGNA 3M8LA 5KBFA 4AHXA 3ZO0B 4AQ2A 1RUH3 1SFYA 3U07A 1HQLA 3AYCA 1KRIA 1YWKA 1TME2 3PVEA 4LBMA 4XXPA 1OFSA 4DFSA 2OPKA 3SLIA 2WT0A 2JXAA 1AJKA 4ORFA 3IDEA 2D6NA 2XBO1 1MEC3 1O5LA 3HT1A 5CNAA 3FLPA 3WNXA 4P9XA 4HKLA 1MQTC 1PO21 1BMV1 5DDJ2 4C1XA 4MLOA 5F5QA 2R043 2VOKA 3N7JA 1S0BA 5JVVA 2NLRA 5E16A 2EXJA 2BGCA 1GZWB 1NA1A 3MPBA 1AR63 4Q4Y3 5T5OA 2Z5WA 3JBG3 3KS7A 1LESA 4HT1T 4YVSA 3LGRA 2D40A 1C3HA 3B94A 3TN93 2YDEA 3IIAA 5FPZA 4Z82A 3ZVXA 4A7KA 1QQP2 4PIYA 2WA4A 3AP9A 4OHZA 4FPHA 4DPNA 1HIXA 2DF7A 2BVBA 1QJU1 2BVVA 4LO5B 3GZAA 4IXLA 1S0JA 3RYKA 1AJOA 1N47A 2VQAA 2DFCA 3PJYA 4C1WA 3OY8A 4X8PA 4RR3B 1RIRA 4S2FA 3TYJA 4XF4A 5GLTA 5AVAA 4LUMA 1NY71 4ASLA 3ZPYA 2GMMA 3RRDA 3TBDA 2D43A 2WWSA 2ZGUA 1Q8SA 2WNUB 1AR93 1R1A1 1ZZCA 1J3PA 1Q8VA 4BIFA 4EJRA 2ZMLA 4LTAA 1DDLA 3J8F3 1V9U3 3CU7A 3WZ1A 4RHV1 1AR82 3AMQA 1RHI3 2PAEA 2VPVA 3W59A 5BNOA 4IEOA 2RJLA 2RJKA 1WD3A 3S7EA 5CB7A 4LE4A 1R091 2XVGA 4Y5Z0 1FT9A 3AP6A 4AEMA 1FMD2 1MS4A 2DWRA 1NCQC 3JU9A 1N3PA 3WDYA 1F31A 1OPOA 2WNEA 3WHUA 4AHZA 2ZS6B 1C57A 5EYXA 2FMDA 4QPIA 3CJIB 1LRHA 2B8MA 4NWVA 5JMCA 2QQPA 1V70A 4LHLA 4QQPA 2YC0A 3CEWA 4FP2A 4YSFA 4QPGA 1IS4A 1ENSA 2ET7A 1VBB3 1GLHA 3OYWB 2RMU1 4N7IA 3WCSA 4CDWA 2RHPA 4LA2A 4NR1A 4YM3A 4PDWA 4XZPA 5LEJA 1C5IA 4K3UA 3GZUC 3AMNA 5A33B 4LBJA 5HCBA 2FZ1A 1WMFA 1MQTB 1VBA1 4AG4A 1Z7S2 3WV6A 3UKNA 3E97A 2W52A 4AI1A 3AMHA 1GV9A 2A6XA 3FLTA 4JRLA 2R32A 4INDA 4E4DX 5ACA1 3WW2A 2R0HA 4RHV3 4WM8C 5H9SA 3U11A 4L99A 1G9BA 1DIWA 1UAIA 2ZX1A 2CTVA 2ZGTA 3PMSA 4F8AA 2RR11 4AVBA 2RR12 1QH7A 4HSLA 4KNCA 1FOD3 4IERA 1D0GA 1AR81 1A8MA 2ZX2A 3CJIA 1XXNA 2A6VA 4NOTA 3M2MA 3VL9A 4AEDB 2A71A 1C8M2 1AUYA 1H0BA 4BM8A 1HRV2 3NV3A 2B39A 2PHDA 4IEXA 4YGCA 4GALA 3POYA 4Y24A 4OLLA 1IHMA 4EN6B 1K5MA 4AQ6A 3GBGA 1DGWX 2CWMA 4C0BA 3I59A 4KG0A 4CP2A 3WW3A 1ZBE1 3R4DB 3KGLA 4GWMA 4CEWA 5BXXA 4S2GA 5J96B 4YGDA 3MIFA 4QM8A 1S2KA 4BMBA 2XG3A 4M3CE 1L3JA 4I01A 1VBD3 3D0SA 4LE3A 5FMOS 1PO23 1LCLA 4EV0A 2MHFA 2UY9A 2R061 1XU2A 4JRAA 1APNA 5L7OB 1I1EA 1EPWA 1Y7BA 4QQOA 5T5PA 4HANA 2ZX0A 2DFBA 3UKVA 4CDUA 3OD0A 4PCRA 4Q4W1 5LRSA 3VV1A 1DZRA 1PGW2 1UX6A 2WFF2 2WLQA 2XWJB 3SCGA 1BKZA 1OA3A 3UJOA 1OI6A 4XJWA 1DYPA 3GNEA 1AR62 5J7MA 1RC6A 2GH2A 4D94A 2BYVE 3KSCA 5AVPA 4P9JA 4XTMA 1PO22 2IFWA 3AYDA 4UW6A 3VHRA 4Y20A 4IV3A 2HWF3 5LRRA 4HK8A 4P9IA 3POWA 5DUUA 5JIAA 5EXOA 4EN0A 3NW4A 4CDQC 2D6LX 2XL7A 3D4KA 1V6MA 3E6BA 1LHOA 1RB8G 3T1LA 1H1AA 4RFT0 3JB4C 3KCCA 4G3YC 2XLAA 4P5HA 5CIRA 1OA2A 3E6DA 2HJIA 1AL22 1N1TA 3GF6A 4IV1A 5IK5A 4WBBA 4MH0E 3KT4A 1F2NA 3D6EA 3TAYA 1Q8PA 1HRV3 5KHGA 4FPEA 1W0PA 3OJBA 4U2AA 3ZFEB 1UN1A 1CD3G 4QPGC 1EV11 2BEOA 1T6GC 4RA0A 1G86A 4LNVA 2LM3A 3VGIA 4XE9A 5ABJB 1Y3TA 4ZU7A 3ZN4A 1VLNA 4XXAA 1LOCA 4YLZA 1FNYA 2DURA 5KC5A 5EYYA 2JEMA 5IK7A 1SLAA 4B4QA 1TMF1 4JGZC 1OOPB 1CAUB 2WNVB 2MEV1 4L9BA 3PLQA 1AYN1 1RUD2 2MNGA 1MVQA 3M3CA 4YW1A 5KXEA 1EP0A 1YIFA 4N9HA 1DGRN 3ACLA 3VBUC 4YVWB 3FBMA 4Z2WA 2HWD3 5HCAA 1X36A 4XTPA 4CDXA 5T54A 2ZHMA 3WCRA 4FQ4A 5HI0A 1XYPA 1HXS2 3J26N 2XGXA 3O14A 2X53S 1G8WA 4IEUA 2D6KA