4Z07A

Co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
260
structure length
260
Chain Sequence
SHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cGMP-dependent protein kinase 1
publication title Crystal Structure of PKG I:cGMP Complex Reveals a cGMP-Mediated Dimeric Interface that Facilitates cGMP-Induced Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 260
sequence length 260
chains with identical sequence C, E
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z07A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z07A01
3SCFA 4XETA 5BPXA 3S7IA 3RYKA 4I0AA 2PFWA 5JR7B 4BH9A 5I8TA 3D0JA 1HW5A 4XFIA 2EA7A 1DZRA 3IIAA 1CAVA 1QXRA 3C3VA 1VJ2A 4IEUA 3NKTA 4QM9A 1NE6A 3EHKA 1QY4A 1CAWA 2XL7A 4P9GA 4JTOA 2UY9A 4A2UA 1RC6A 4QXKA 1CAUA 4Q0VA 4L2NA 3L2HA 4LA2A 3WW1A 2GC1A 2ATFA 2P17A 5C8WA 4FT8A 2D5FA 1H1MA 5J7MA 2DCTA 5LEJA 3O14A 1XE7A 5JSOA 3ZDSA 3RYRA 3U0ZA 2ZCWA 3TNPB 3LA3A 2K0GA 4IETA 4MV2A 3HT1A 1FXZA 2OYZA 2CAVA 4MUVA 5AVPA 2IXIA 1ZVFA 4NVPA 5C6CA 4HLTA 5KHGA 4QGMA 2VPVA 2EVXA 3RZZA 2PTMA 4YARA 1EPZA 3SHRA 4Q29A 1OMIA 2QVSB 4AVAA 5KBFA 4J1WA 1GQHA 3PLQA 4XFBA 3BB6A 2PAEA 2GC2A 3EBRA 4XF1A 3S7EA 3EQEA 4FAHA 2IXLA 3ETQA 2GC0A 3ES4A 3H3UA 5HI0A 3ELNA 4I3PA 2Z69A 5I0TA 1UPIA 4B29A 3OD0A 2HKXA 4H7LA 1OFNA 1J58A 2PAMA 3KMHA 3H7YA 4E2GA 4XFAA 3LOIA 3USSA 5BY5A 1O3SA 1SEFA 4Q0UA 3FE5A 3OCPA 4O9GA 4YNIA 2F4PA 3H1WA 3PVBB 1O3TA 1UIJA 4OFGA 4XF0A 5CADA 3DV8A 1CAXA 3R6SA 2XKOA 3H3ZA 4ORFA 1SQ4A 2CV6A 1GQGA 4WBBA 4WVZA 3KGZA 3MYXA 4KU7A 4IEYA 3NL1A 3MDPA 3CLPA 1ZRFA 3E5QA 4XF3A 4I2OA 4IESA 1RL3A 4Q0QA 3G7DA 3DL3A 3RPQA 3CJXA 4MX3A 3VHRA 2HJIA 5KHJA 4HVOA 4YYOA 1O3QA 2BYVE 3RNSA 4X6RB 4LUKA 2QNKA 3FJSA 1OD5A 1V70A 3S0MA 1ZRRA 4KWKA 2XL9A 4L11A 1FI2A 1ZZ8A 5KHKA 5D1IA 2IC1A 2Q0AA 5FPZA 3H50A 3H1MA 3B02A 1SFNA 4IEOA 2O8QA 2CGPA 3LA2A 3WW2A 3IWZA 1XE8A 1J3PA 3KCCA 3QOPA 5FQ0B 4LA3A 5FDBA 5BUVA 1QWRA 3FWEA 4LUMA 4EROA 1UIKA 1ZNPA 4MZUA 5I0RA 2ZKLA 4N9IA 5KHIA 5JSRA 1ZRDA 4HSLA 2CAUA 3IBMA 3H7JA 3TNQA 3KGLA 3LWCA 3U11A 3E6DA 2PHDA 5I8YA 3WW4A 2QDRA 3H9AA 2Q1ZB 1O5LA 4HVQA 3NSTA 1VP6A 3SMHA 4EWDA 2MPFA 3I54A 2E9QA 4HVRA 5EFUA 5FLHA 2VQAA 4AVCA 5J48A 1ZZ6A 1UCXA 5F1RA 3CL1A 4UXAA 3I59A 2D40A 1XRUA 1L3JA 4XEZA 2MHFA 1LRHA 4FBFA 2WFPA 4HSJA 1CX4A 3PNAA 4IEXA 2BNNA 4AXOA 1YHFA 4IEWA 2OA2A 4XFHA 5JCTA 1YFXA 4XF4A 2H6CA 4K8FA 1FT9A 4JV4A 2GC3A 1J1LA 1WLTA 4LULA 1J59A 2QJVA 3ACLA 2BNOA 3SCGA 4X6QB 3LAGA 4DINB 4QM8A 2XKPA 2EAAA 1IPKA 5CU1A 4J1XA 4N9HA 1LR5A 3CF6E 2UY8A 3RYPA 1UW8A 1RTVA 3ES1A 2GU9A 3HT2A 5T3NA 1CAVB 4KL1A 2O1QA 3D82A 4ONUA 2ETEA 1O7FA 1CAWB 1RUOA 3SXWA 4HN1A 1ZZ9A 3FHIB 1CAUB 3JZVA 4FAGA 1JUHA 2OZ6A 2D5HA 2WC2A 4PIZA 3DN7A 1H1IA 3HQXA 1LB2A 4XFGA 4AVBA 4AQ6A 2IXCA 2IXJA 4YSFA 3M3IA 2GZWA 3E6BA 4Q0SA 3U10A 4GULA 4I02A 1ZRCA 2B8MA 3ROUA 1YFUA 3MZHA 4QMAA 3CEWA 3OF1A 4HMZA 2GH2A 4EWAA 1DZTA 1YLLA 4CYDA 3IDBB 4F7ZA 3ST7A 4IEQA 3I7DA 3NJZA 2BNMA 3OTFA 3UKNA 2H6BA 4MGIE 3UKVA 5J3UA 2IXHA 1Y3TA 3NW4A 4BHPA 3E5UA 3EJKA 1CGPA 2PAKA 1Q3EA 1EYBA 4D7TA 1Q5OA 3M70A 4LLOA 5BXXA 3EO6A 1YFWA 4IERA 1PMIA 3SCHA 5EZWA 4E2QA 2H0VA 3E97A 5FLJA 1RUNA 4JTNA 1YWKA 4F8AA 5JAXA 1ZREA 1J3QA 2B5HA 2I45A 2XLGA 1CAXB 4XFCA 4O9EA 3BPZA 4HZFA 3OGJA 5LRSA 2ET7A 1X8EA 3H8UA 3BCWA 1X82A 3LA7A 5I91A 4KU8A 3RDIA 2BEOA 4Z07A 2PYTA 1G6NA 1ZZ7A 4R8HA 4RD7A 1DGRA 3FFQA 1WA4A 1WGPA 3GBFA 1IPJA 4D7SA 2XLFA 1Q43A 1LKNA 1UD1A 3FX3A 5BV6A 3D0SA 4META 4MGYE 5FLIA 3NVCA 1U12A 4PIXA 4TLFA 2XGXA 1ZZBA 3CO2A 1O3RA 2IXKA 3H1YA 4JVAA 4EWEA 2Z2SB 5FCCA 4BIFA 4YRDA 4XF9A 1Y9QA 4HN0A 5E1RA 4IEPA 4IEZA 2C0ZA 1NYWA 4QGNA 2FQPA 1YFYA 3GYDA 2UYBA 5I0UA 3WW3A 4LTAA 2VECA 1VR3A 2ET1A 4WZCA 2Q4SA 5FQ0A 4EV0A 2B9UA 3E6CC 2D93A 1OI6A 1EY2A 2GAUA 4I0BA 1YUDA 5KHHA 4QGLA 1O4TA 5CVRA 4QX5A 4Z82A 2XLAA 2MNGA 1TQ5A 2PA7A 4E2SA 3MPBA 4OLLA 4UBGA 1I6XA 3UKTA 4BYYA 3QACA 3N4MA 3BU7A 4Q0PA 5I93A 1ZX5A 5E16A 1RGSA 4ZU5A 1QXJA 1NXMA 2FMYA 4UBHA 1O5UA 5I0SA 1NE4A 4KWLA 2KXLA 1PM7A 2Q30A 3I59B 2N7GA 4KWJA 1DGWA 4MGZE 3IDCB 5JSPA 4MGKE 4XFFA 1NZCA 2V09A 1X8MA 1I5ZA 2OZJA 2BGCA 3KSCA 4ZU7A 1J3RA 2PHLA 3HIFA 4HBNA 5K8SA 5LEKA 4AQ2A 5I8SA 1EP0A 4ZU4A 4MH0E 3DKWA 2PQQA 3FZ3A 4I09A 4PIYA 3E5XA 2K9ZA 3BALA 4R52A 2QCSB 5FPXA 2UYAA 4LEJA 3LZZA 4I01A 2XHKA 2OPKA 4PJYA 1X7NA 4IEVA 5LRRA 2Y0OA 1ZZCA
chains in the Genus database with same CATH superfamily
3SCFA 1XYOA 1UZZA 4BXSV 3KV4A 2EICA 5GM0A 1F4AA 1LENA 4BQ4A 4YWAA 1RJ7A 5JR7B 3VZJA 4BH9A 5JIUA 2ZAHA 4C0BA 5I8TA 3D0JA 5DAXA 2UURA 1CPNA 1FX5A 1VBD3 5FYBA 1HRV3 5L19A 1BVP1 1AR82 1UYXA 3H42B 1C8NA 3QH7A 4Q5OA 4CA9A 4E4SA 3MIGA 4A7YA 1W28A 4RQPB 2BWCA 3S5QA 3NWKA 4BZ4A 2JE8A 1NX9A 3ZFEC 3O0XA 5CEHA 4AVVA 1T6BX 4HG6B 2J1AA 1ENRA 2WS92 4JTOA 1ZBA2 3DECA 4A2UA 5FZLA 1RC6A 2ZOEB 4GJZA 2A5ZA 4AFCA 3L2HA 4Y33A 5CA6A 2WQZC 2ZGTA 1YQ6A 2R062 1MS4A 3K4AA 4Y1YA 2ATFA 1EAH2 1VAMA 2P17A 1V6LA 4GIQA 5FP3A 5T5JA 1VBD1 2WQ8A 2D5FA 3OUJA 4A7ZA 1HRV1 3IPVB 1APNA 3AP9A 1PIV3 2VMGA 3AP7A 2ZGNA 5G05L 5L73A 5LEJA 3ZFEB 3O14A 4EN9B 3ZN6A 2R16A 5IK5A 2D6OX 2YPDA 2E31A 1LHOA 3WG1A 3ZDSA 4AL9A 1G9CA 4P9LA 1LNSA 5GLVA 3U0ZA 2R072 2J7MA 2WQ4A 3OEAA 1DP0A 4MV2A 2VC9A 2W1WA 4YFWA 3DUIA 2JDZA 1FXZA 2XVKA 5FYZA 2OYZA 2CAVA 3M3OA 3MV11 5KXDA 4LKDA 4YVWA 5AVPA 1W0PA 1ZVFA 1VRH2 2K46A 4QT6A 4HLTA 4COZA 1CZTA 1UO9A 3OG2A 1PIV1 3T2OA 3NV1A 3QH6A 4OI4A 5FZKA 1TMF2 5T5LA 4R4XA 4YM2A 3SHRA 3T2QA 1OMIA 1W9SA 4AVAA 1SDDB 2VOVA 4UWDA 1HJGA 3EBRA 4P9IA 5FZ9A 5GZDA 4CCOA 3WQ1A 3AMMA 3MLJA 2XMLA 2RR11 1VBA3 1AZDA 1CIWA 2XG3A 4FFFA 4BQWA 2LALA 1WD3A 3H3UA 1HKDA 2L9LA 1OOPC 1VMJA 1SLBA 4GALA 1LGCA 5J96B 4I3PA 1UY2A 4NN0A 1B35A 1RUF2 2WNVB 1DLCA 1UPIA 3DEMA 1ACCA 1DZQA 1KGYA 2ARAA 5FP7A 3TB0A 1KQRA 2P3IA 3OYWA 1JZ2A 1PM4A 1OT5A 1J58A 1V6JA 2VAUA 3HAGA 4E2GA 1REEA 4CRQA 2YUEA 4AOCA 1VB4A 1OVSA 3R4UA 3O1PA 4RN5A 5A3OA 4QX8A 5KWRA 4YW7A 2F4PA 4UFLA 2QQVA 5JUVA 1VBA1 5IVCA 1U0AA 1PVXA 1QQP3 1UIJA 1V0AA 4OFGA 3ZX7A 2VH9A 3WD5A 2RJ2A 3DV8A 1CAXA 5LBFA 4AHYA 2X10A 2XKOA 3HD8B 1SQ4A 5IATA 4IE5A 2G4IA 1QNYA 3KGZA 3CZUA 4WVMA 1UYYA 1S4CA 4IEYA 3VBHB 3VBRB 4HETA 4TTGA 2R0HA 1QOOA 5J1XA 4AGRA 3NQHA 1GP4A 5D2AA 5FYTA 1DGRN 3WEZA 4BDVB 1W9WA 3N35A 1OVPA 1GP5A 2RHPA 5FY1A 3WDXA 3WDVA 4Q0QA 3MUY1 1QQP1 1VBD2 4INDA 4NWVA 3LOBA 1HRV2 3VHRA 3ZXLA 4COUA 2HYXA 3K2OA 4NE9A 2CY6A 2WYSA 2FD8A 3N3HA 5LASA 4ATFA 4E4HA 4YYOA 4QX2A 4D3WA 1LGNA 5EYXA 4CSWA 1JZ5A 2FDKA 1HDKA 4X6RB 4LUKA 2VCMA 2XWJB 2UWBA 2GMPA 1QH6A 2XOMA 1ZRRA 4KWKA 5KXBA 5LWBA 2BBAA 4L11A 1OPOA 3WP6A 4MLOA 3NNGA 1B35C 2IWGB 4AQSA 1OSGA 4RYDA 2IC1A 3VD3A 3IDAA 3AFKA 3H50A 3H1MA 5C71A 1MACA 3B5LB 4IEOA 3ZPYA 1EUTA 4K21A 1PIV2 2CGPA 3BKZA 5FY0A 5A7WA 2YC4A 2E26A 4I0WB 2Q8EA 4A4AA 3BGAA 5JPMB 1YI9A 1O4YA 5BUVA 4CPBA 3APBA 4EROA 3V65A 5I0RA 1ZRDA 4N9IA 3W21A 2TBVA 3PJYA 2RR12 3TNQA 3KGLA 1AJOA 2OW4A 1WCKA 5FJKA 1HN1A 4COWA 3P3PA 3E6DA 4Z92B 1K12A 2X09A 3N7JA 5FTTC 2LM3A 5JMOA 2C9AA 3V0BA 5FIXA 4XC9A 1TVGA 1BK0A 4XURA 4BMBA 4DUXA 5FOJB 3ZN4A 1DDLA 2AR6A 1A3KA 1UOJA 4AI9A 1JZ4A 3AYDA 5C5UA 1D0HA 3HEIA 3BOWA 3I2KA 5J48A 2E7AA 4UYBA 1UCXA 1WMEA 5F1RA 4OHZA 3W5NA 2HLEA 4Q4W3 1VBA2 2YG0A 1LECA 1DYOA 3MFAA 4LIVA 4W65A 4XEZA 1KD7A 4CUCA 1BCXA 1CX4A 4IEXA 1OLME 2D97A 2XBO1 1A34A 3VD7A 2FBEA 2VUDA 1CJPA 3AP6A 4QHOA 4COYA 3AL6A 4IEWA 2RDQA 2OXBA 5CFCA 2Y6FA 4HFSA 2OVUA 4YFZA 3WY6A 5A33B 1FT9A 5FZAA 2ZZQA 1LULA 1ULEA 5FXWA 3M4FA 2BBVA 3S5AA 3TN91 1NT0A 4Q4W1 5IVFA 4NMIA 1WW5A 2RS53 2ZGLA 2Y33A 3NKGA 4LULA 1QQP2 3SCGA 2BNOA 4GMP0 4JGYC 3LAGA 4P9JA 5DUXA 1KDMA 1QHDA 2WAOA 4L8QA 5C3QA 5LA0A 5FP9A 1OUXA 3KD4A 1MS0A 2VBBA 3AYAA 3DGTA 4BLIA 3M7AA 5CKNA 4SLIA 1IPKA 1TEIA 3WCRA 1RITA 4GXLA 2XHNA 1POQA 5EIYB 1FMD1 1MS8A 3CF6E 4L97A 1RUG3 2UY8A 2QZ2A 1DQ4A 1IOAA 1VRBA 2WNUB 1UW8A 4FXGB 5SV8A 3ZO0B 4DRVA 2Z42A 1QIQA 2GU9A 2E53A 3B01A 4DXZA 4FPOB 1PNGA 1VIWB 2JE9A 3AMHA 2RS51 4ONUA 3R4SA 2IVJA 4XW3A 2ZABA 4ZXEA 3ZYGA 2JG9A 2QQLA 2ETEA 1O7FA 2YU1A 4OQ9A 1CAWB 3ACFA 3GZEA 3K75B 3HQUA 5C4WB 3RMXA 2QZ3A 1GKBA 1ZZ9A 4UF0A 4Y26A 1SZBA 2ZJCA 1EV13 1Z78A 2DVGA 1RUG1 3CU7A 2JDAA 3K3OA 1ASJ1 1GOGA 4B4RA 3HQXA 3LE0A 3AZXA 2XQRA 4NRQA 4XILA 1LB2A 1E5IA 3CDZB 1JUIA 4MXWA 1W6PA 4AQ6A 3T0DA 1S0CA 3WX5A 1A8DA 5FUNA 2YXSA 2VY0A 4NIHA 1RUI3 1QKQA 3D6EA 4XZPA 2GZWA 1W9FA 2DU0A 2JDKA 2VD7A 5FZEA 1AUYA 1UZYA 4LO8A 4IV3A 2AYHA 2VE1A 3NJVA 2C5DA 4Q4Y3 1EV11 1LOAA 4GA9A 2EIEA 2VOWA 3MIEA 4ZS3A 3OF1A 4QPGB 3RFRA 4HMZA 4DEVA 2QQMA 3HOBA 3PVEA 4OMCA 4XTPA 3BUCA 1LCLA 2PHTA 3OOXA 2DU1A 3ALQA 3IN9A 3VL9A 4XDOA 2OUJA 4CYDA 3IDBB 4OI1A 5A6QA 1RUI1 1JW6A 3VBOA 2XBO2 3I7DA 2BNMA 3ZYFA 1TNFA 3B7MA 4OMDA 2A6VA 2H6BA 3UKVA 4NOTA 2G9FA 4CPBD 4CU9A 3KVAA 1VBC3 4Q4Y1 1G9BA 3C7FA 1K45A 3E5UA 2JG9C 4N43B 1MEC3 2VUJA 2Y6HA 3TN92 4Q4W2 2DBNA 1CGPA 2PAKA 2W1QA 3VZLA 1DQ5A 3M1HA 3WXPA 5LK5A 2C26A 4DY3A 1VE0A 1FNZA 1I3HA 2VZQA 3GALA 1EYBA 3BTAA 5FZCA 1IS5A 3M70A 1XNDA 2DVBA 4CDUC 3ATGA 4A3XA 1PMIA 4CTEA 2BDRA 2SLIA 5EZWA 4A42A 3NNFA 3ECQA 4Q26A 2H0VA 3PHMA 1PO23 2PQSA 4RR3C 2VR4A 1FMD2 2TNFA 3THDA 4CCMA 1YYNA 4D6SA 1VBC1 2BERA 1R1ZA 1GSLA 3C7OA 4FPKA 5A7SA 1ZREA 4FTEA 1J3QA 3O7OA 2I45A 5KXEA 4CDWB 1PNFA 2VJXA 1W6NB 2RS52 5DAQA 4LMFA 3O0WA 1G7YA 1OKQA 4WM8C 1X82A 1DHKB 4CDUB 5I91A 1AR63 3T09A 3U75A 4XDPA 1V6IA 4KU8A 3I2IA 4M4PA 4LNVA 3RDIA 1UXXX 2BEOA 4LBKA 1DGRA 1RUG2 1WA4A 3FFQA 4JC1A 4JQTA 4CP0A 1ASJ2 4CVUA 3GBFA 4EE2A 2XLFA 4DY5A 2WWJA 1HB2A 5LZ6A 1W2AX 3VBOC 3OGVA 2VNVA 4KQ7A 5JZGA 2A1XA 4META 3URFA 4IL7A 1MS5A 5A3TA 1W0OA 3OUHA 4ZZ5A 5ACA3 3C2UA 3J26N 3I2OA 4DQAA 2CU5A 3W9AA 4LQRA 2ZBJA 2XGXA 1DGWX 4JDNA 1O3RA 1AR61 1M06G 3R05A 4EWEA 4K7JA 2IZWA 2WNEA 1W03A 1EV12 3N9NA 5FK8A 3GBWA 3JQWA 4NO4A 5A3WA 1H4GA 2UWAA 4P9XA 5JIAA 1A6CA 1F2NA 1X33A 5E88A 1NYWA 4N53A 1NA1A 3A7QA 4AK3A 4YZ2A 2FQPA 5ACA1 3THCA 1UL9A 3MW4A 4LTAA 1RUI2 2VECA 4ATEA 4ET7A 5FQ0A 5F3CA 4JX0A 1ST8A 2OQ7A 5JPNB 1OQDA 4LIUA 4NROA 1LJ7A 4MYEA 2HWF3 5FO9B 3U1XA 5CVRA 4QX5A 2DWRA 4Q4Y2 3USUA 2P5BA 3ZDVA 3SH5A 4M3CA 1GZTA 4Y22B 4E2SA 4LKFA 1V00A 3N9MA 3VBUC 4LBLA 5K7PA 1ZM1A 2VU9A 2ZEWA 2J1UA 2PMWB 3BU7A 1ENXA 1O6UA 4H2AA 4JKLA 5JDBA 3P3NA 5E16A 1RGSA 3O12A 1V6KA 2Y6LA 2VZVA 1NXMA 2XJUA 4OULA 3T0BA 2BP6A 4RS5A 1W8NA 4AEDA 4EJRA 4E8DA 5IT6A 4DXSA 4DMIA 2Z4FA 3WNXA 2HWF1 2Q30A 4CEWB 5IVJA 3I59B 4C8DA 1VBC2 4W6XA 2N7GA 5JZGC 1DGWA 3IDCB 4AI8A 2WZ8A 1H9WA 2B4KA 5F8PA 5JXIA 1X8MA 1IKPA 2P1BA 3NNLA 5FZ3A 3VN4A 4HBNA 5FWEA 4IW3A 3RRDA 3IT8A 3T3YA 4A41A 1LAJA 2XXZA 4QQPA 3VZKA 5FZOB 3RMYA 3OSDA 2OKXA 1PVC3 4MH0E 2YFZA 5K0UA 5LW9A 3I2JA 3ZYRA 3U4SA 4I09A 3MEPA 4YVSB 5ABJA 1UY4A 2O14A 2GDFA 2QCSB 2UYAA 4N7IA 4LEJA 1K5MA 3UJOA 4N53C 1NA1C 1MVQA 5A3LA 3SQOA 2WNOA 1LOBA 2OPKA 3PTYA 1PGL1 4FTSA 2YY1A 1UOBA 2RG4A 3J7HA 3MF6A 2E7QA 4S2GA 2HYKA 4B4PA 3B9IA 2Q1FA 1K42A 1FPN3 5JI7A 2W1SA 4BQ1A 5DUUA 1H1AA 3VBSA 5BPXA 1PVC1 2D6MA 2J1EA 3MIBA 1GBGA 4XIOA 1Y4WA 1AR62 4YGEA 1Q8QA 1XSQA 5GZGA 4BU2A 2EA7A 1OLMA 1MZ5A 1O8PA 3C3VA 2WN2A 4GH4B 4ISRA 1VJ2A 1QMJA 2WABA 2QBXA 3NKTA 4QM9A 1GQPA 1NOVA 2RV9A 5HCBA 1CIYA 1JYTA 1OHFA 1QY4A 4AEDC 2YGLA 2VCCA 1KDKA 3O1OA 4BB3A 2RS33 1IQAA 3ZXJA 4KGQA 5DXDA 4M4RA 5ANNA 1FPN1 1S0GA 5ACA2 4QPIB 4UW6A 3OGRA 1AR93 4Q0VA 4RGAA 5FUIA 1E5RA 1PZ8A 3PURA 4PCRA 2GC1A 1UU6A 2EIGA 2Y34A 1WW4A 1RJ8A 2C24A 2DCKA 2RMU3 1C57A 5CFDC 3H8RA 2ZGOA 4U36A 2W95A 1XNCA 4D7YA 2DCTA 1AXKA 2AEYA 3GM8A 5T55A 2KA3A 5FPUA 2HBTA 1SBDA 5K0UC 2VQ0A 5BNOA 4BCUA 1LEDA 2ZGMA 1SPPA 3M3QA 1AXZA 2YV8A 4YW2A 5LB6A 4B7EA 5ABJC 3ZIXA 2RS31 2SBAA 3OPZA 3T08A 1RUD3 3RYRA 4N90A 3WG4A 3U07A 3C7GA 3LA3A 5FYYA 1SLIA 4Q2FA 1DF0A 3TEWA 1AR91 1ZBA3 5DG2A 5A6YA 4XACA 4X8NA 3H8OA 2P6CA 3HT1A 5FKCA 2QE3A 1G9AA 1YRZA 4XVHA 1EPWA 2VZRA 4FO9A 3VDDC 2HWF2 5F7UA 2IXIA 2RMU1 4PDWB 4XBLA 4NVPA 1GZWA 2YYOA 5C6CA 5L9RA 4DB5A 5KHGA 2J1TA 2A6ZA 1K3IA 2D3SA 3VBSC 3HN3A 1LOFA 1V9U3 3ZMOA 1POV0 2QVSB 4QHBA 1D4VB 3TOJA 3GDBA 4J1WA 5FZ4A 3ZSJA 3AXEA 3DPRA 2VZ3A 2ZGQA 3K77A 3PLQA 4MSVA 2F4LA 1RUD1 4LHNA 4O65A 2ADDA 2GC2A 2ZXQA 1QOSA 1CVNA 1W6OA 3OY8B 4HPKA 2IXLA 1MZEA 2B42B 2GALA 1ZBA1 2QQKA 2R073 3ETQA 5EQUA 5FZ6A 5FY5A 3PTRB 4HKOA 3LPFA 4C90A 3VDDB 1GWLA 1VB2A 2PHRA 3ELNA 4BQYA 5HI0A 3ZYPA 5KC5A 2EF6A 4CCKA 1GMMA 2JKXA 4K3UA 5A3NA 4JGZC 4FPJA 1GNHA 2XJSA 2YC0A 1VRH3 3WG2A 4CCLA 3OD0A 1PGL2 3KWVA 4H7LA 1QNWA 1V9U1 2PAMA 3VHOA 4ZZ8A 3H7YA 3D4KA 2CWSA 3GCWA 4QX1A 1TMF3 3HBZA 3LOIA 1DLLA 1UMHA 1AF9A 2P6HA 1SEFA 3P1IA 1OLRA 3MIHA 1PVC2 4QQHA 1C8M3 2P37A 3TYJA 2ERFA 1CPMA 1KFXL 4RQPA 3H1WA 1QJEA 5CNAA 4BOWA 1U5YA 1JOJA 4AI1A 1SLCA 4CCNA 2ARXA 2ZHNA 4XF0A 2YDEA 4GWIA 4JGZB 4B4QA 3WHTA 1IS4A 1GWMA 3I2GA 4YG6A 3ZKUA 2QTWB 2VM9A 4WBBA 4QD2A 3UL2A 2LW8A 4QQLA 4WVZA 4AHZA 2E63A 2GNDA 4QX7A 4DOUA 1C28A 4KU7A 1NY71 2X5IA 1TMF1 3NL1A 4CUAA 1FPN2 4IXLA 1AJKA 3IAPA 3CLPA 1ZRFA 2OS2A 3AK0A 4XF3A 5JOYA 3VD9A 1C8M1 1T2XA 2D7FA 3A22A 3JB4C 2JKBA 4UFHA 3ZFFB 4WM7A 5IYYA 1LOFC 1BBT3 3DL3A 3KLSA 5JVVA 5J36A 4LOSA 4YW1A 3THPA 3KT1A 1XNBA 3DPRC 4HVOA 4H7MA 3C7HA 3WF3A 5A32A 1LHVA 3NV3A 3RNSA 5A1LA 4JAAA 3FJSA 3WLUA 1OD5A 5CIRA 1AL21 1GICA 3S0MA 2RS32 4AG4A 1KEXA 1W3VA 3CKHA 1ENSA 2AH2A 3GHMA 4PI0A 3GZUC 4UW5A 4XAAA 3W59A 4CP9B 3LIHA 1AR92 1FI2A 2YPJA 2K2SA 5KHKA 5JXGA 4YZ4A 5T5OA 4ITCA 1IHMA 2VW2A 4CEYB 1BBT1 3AMPA 1VMHA 2RMU2 5BNPB 1S0JA 3B02A 5F6KA 5A6XA 5EPAA 1B09A 2DVAA 3IWZA 5EJ1B 1XE8A 3KCCA 5B4XA 1OFSA 1SMVA 1KFUL 1NCQB 2D3PA 5FYVA 3R0RA 4XXAA 4D6QA 1C1FA 4Y1UA 1UY3A 4XHBA 5FKBA 1E5HA 1QDOA 1RUD2 1ZNPA 3LGRA 2Q8OA 2ZKLA 1UQXA 5KHIA 2R1BA 5JSRA 4HSLA 1H6XA 2CAUA 2BUKA 3IBMA 3H7JA 3ZYHA 2V5DA 3LPGA 1DYKA 3NJYA 2PHDA 5FMCA 5I8YA 2QDRA 4R9DA 4S2FA 2AGSA 1JI6A 2X5IC 2FDFA 3VKNA 2BRTA 4WZFA 4CU8A 4FOQA 3CQOA 1SLAA 1VP6A 3AVRA 1V9U2 1LODA 4MG2A 4TN7A 2OPWA 4HVRA 4UT5A 4WM7C 3TWIA 2VQAA 1I9RA 2AC1A 3MHZA 1S0DA 3DXTA 5C3RA 2DDUA 4OZOA 1ZZ6A 3GXUA 2VW0A 4XTMA 4IE0A 5A7QA 5FXXA 2ZGSA 4Z2AA 5HXVA 2D40A 2G1MA 4LBJA 2JD4A 2VCAA 4LHLA 5A70A 2ORZA 2RR13 5FR3A 3HQRA 2VXJA 1WLWA 2MHFA 1HB4A 2EXJA 1WUVA 2CL2A 2RDSA 1WBFA 4Y1ZA 4FBFA 1JZ7A 3LCPA 1KXGA 4TXWA 4FP2A 5EJ3A 4DXRA 1AYN3 3Q8CA 2J1RA 3BODA 1NLQA 3OBTA 2IFRA 5G04L 4A6OA 4AHXA 4CCCA 1NY72 4XFHA 4DRRA 3OB8A 2FCUA 1S1AA 4NR1A 1YFXA 1CJDA 2C9KA 1ULGA 3I97A 1W05A 4KNCA 4CUBA 5IHRA 1C8M2 3PIJA 2VQTA 3WHUA 5DG1A 4DEQA 3ZYBA 3VZMA 1REDA 3KF3A 4X6QB 2FDGA 3KHBA 2JE7A 2YHJA 3ZXFA 4DINB 1YJKA 2ZEYA 4TZDA 3VDAA 1UYZA 4ASLA 4N7UA 1AYN1 3RG0A 2QQIA 5FYIA 2WLPA 1QJFA 1XNAA 1AL22 1Q8SA 4J1XA 5FK7A 3JBG3 3ZXDA 1HN0A 2AREA 4OHWA 4A7KA 1LR5A 5F5IA 3DYMA 3RYPA 1UF2C 1ULCA 1LOGA 4GJYA 4SBVA 5HCFA 4MHRA 3R4DB 1YEWA 4KL1A 3RWNA 3D82A 3GNEA 1PMHX 1BBT2 4K1YA 4PLOA 5H9QA 4F3JA 2ZX4A 3AVSA 1LESA 4EN6B 1OOPB 2AZ5A 2XWBB 4FXKB 3WP5A 5H9SA 4H14A 4AI3A 2RVAA 3H0OA 1RUOA 1IKQA 2D43A 3D8CA 3ZPOA 2Q8DA 1ZA7A 2P3YA 4HN1A 2VO5A 3JZVA 1UY1A 2HWC3 2CHHA 3JBG1 2OZ6A 2X05A 4FAGA 2IVIB 2WC2A 3LSDA 4PIZA 1MZFA 1CR7A 1Q56A 5DAVA 1H1IA 4LBQB 4XJWA 1BZWA 3HPNA 4YVWC 5C9AA 1EUUA 1DQ0A 2B39A 4QKNA 3O1MA 1FV2A 1H8TA 3UGGA 3ASIA 4B7KA 3FUQA 3GZAA 2I07B 2AUYA 1I5PA 3M3IA 3PU3A 5FP8A 3ZN6B 2WYFA 4JHZA 4CDXA 4M0HA 1RUC3 4AYUA 5L7OA 4GULA 3NO8A 4KMQA 3UETA 2VW1A 1N1SA 1ZRCA 3ROUA 1YFUA 2HWC1 4CU7A 2CDPA 2E33A 2ZX2A 2W47A 3AKTA 1BVVA 3CEWA 4FPHA 3VKMA 4CUGA 4H55A 4EQVA 2OIIA 4B8EA 1OLQA 2XDVA 4FSJA 1MS3A 5APAA 1MQTA 4UI9L 4LBMA 1H9PA 5F2WA 1DZTA 1JZ6A 1JXNA 1QF3A 2X53S 1YQ5A 1AYM3 1H0BA 4QQ2A 4LHSA 3OPTA 5JXJA 2Y6KA 4F7ZA 3ST7A 2PN5A 4XBQA 4FVVA 3RI8A 1G8WA 1TZOA 5IVBA 3O5SA 1RUC1 1UZWA 3WQBA 3I8TA 1JU3A 3UKNA 3JUUA 1SDWA 2EXKA 4MGIE 3J7NA 5J3UA 3LDBA 3FFZA 1Y3TA 4NPRA 3NW4A 5H9PA 3DCQA 3FUOA 2YU2A 3AZZA 3MIDA 4BPZA 1WCDJ 3MGUA 1XC6A 2ZHKA 5FXZA 5IFTA 1B35B 1WKYA 2OT7A 2P34A 5BNNA 2Y38A 4FOYA 4XJ9A 3L2YA 2W52A 1AYM1 3OYWB 1NCRA 3KCXA 3PUSA 2Y6GA 3LB9A 2BFUS 4LLOA 4P00B 5IWFA 3AZWA 1Q8OA 1AYN2 4GWNA 1W8HA 3GJBA 4UW3A 2XBO3 1O4ZA 3N9PA 2XVLA 3SLIA 4YW4A 2WO1A 3SEEA 5C9AC 4IUGA 1W8WA 5GZEA 5DZGA 5FLJA 4IV1A 2XQXA 3BVCA 3NAPA 5FV3A 1QGLA 4NAMA 3AZVA 5JAXA 3AKQA 4CDXC 4OI0A 2B5HA 2XLGA 2YC2A 4JKKA 3Q8AA 1CAXB 5C4WA 4O9EA 5L7OC 4HZFA 1PK6A 2D6PA 2W39A 3TN93 4FPLA 2WZR3 4CU6A 1KJRA 2OQ6A 2PHXA 3N7KA 1RUJ3 4WVMB 3BU0A 1BLZA 1JS9A 3UT0A 1GOFA 2VMHA 2BWAA 2KD7A 2VBPA 1D7PM 3IZOA 4L9BA 1DQ1A 1ND2A 3KV5A 1MQTC 3VZNA 1G6NA 3JBG2 4BA6A 1HB1A 4NPLA 4D8MA 4DO0A 4I30A 1FMD3 5IJRA 5A7PA 2VNGA 1LKNA 1UD1A 3F2ZA 2G9GA 4ASKA 1T6GC 5D8AA 5E8AA 3SISA 1H2NA 4QHZA 1GU3A 2WZR1 2JDMA 2JICA 3NVCA 1U12A 1RUJ1 2JIJA 4PIXA 3CJIA 3FN9A 1ZZBA 1Z0HA 2IXKA 4JVAA 2V4AA 2W68A 1GFF2 2R0FA 2Z2SB 2ZEXA 5FCCA 4BIFA 5DABA 4GD4A 5JI9A 3AC0A 2HWC2 4KBZA 5BNNC 2KR2A 4MVTA 4XE9A 3MBWA 1NCRC 4UFJA 3MFCA 3VHNA 1ULFA 5E1RA 2A70A 5KR7A 4IEPA 1ASJ3 4IEZA 3L9JT 1HQWA 2W1UA 5IVVA 2CSGA 4YZ5A 3F95A 5A7WB 2Y0IA 1UKRA 4QGNA 5FPVA 3ZN5A 3ZSEA 4Y20A 4ASMB 5A1AA 1LTEA 4FOVA 3ILNA 5I0UA 4QKBA 4JGYB 3WW3A 1VR3A 1CQ9A 1F31A 2ET1A 2W9XA 4IV1C 1S2BA 3NAPC 4WZCA 2B9UA 4OUMA 4NIIA 1RUC2 1IQDC 1SG3A 3X29B 1OI6A 1EY2A 4PQQA 5FZDA 2ZEZA 5KHHA 3M3EA 4HOOA 3AKRA 4Z82A 1PK6C 3VBFA 1D2SA 5DUVA 4OLLA 4GB33 1OQ1A 1I6XA 3V0BB 1ODMA 3QACA 1HV1A 3I2FA 3NNJA 1AYM2 1ND2C 5IK7A 5FPLA 5FYCA 3N9LA 4RL7A 5I93A 1AL0G 4QKDA 4MADA 2VOTA 1QXJA 2VUCA 5CFCC 3RS6A 3KS7A 4UBHA 3S57A 2RM23 2BOIA 3VDBA 2NLRA 3FMGA 3WCSA 3I3DA 4KWLA 1PM7A 3MUZ1 4JRLA 4NHYA 1DGLA 2EIDA 2P3KA 4P5YA 5D8AC 3WNPA 4XFFA 2V73A 4M01A 1ZBE3 2X8KA 3CJIC 4GB31 1I5ZA 2PLV1 2BGCA 3T1MA 4D94A 4IDZA 2ZKNA 4KWUA 4C0HA 4ES9A 1XYPA 1US2A 3K3NA 2DFBA 4X8PA 5BYNA 3W5MA 4OHVA 3Q8FA 3A0KA 4AHWA 5CFCB 5CG8A 4BK4A 4QXHA 3ORJA 1UN1A 2QQOA 2VZ1A 4A44A 3E5XA 2RM21 4V2WA 3FHQA 1C5IA 3LZZA 1Y9GA 2CGNA 5B4NA 2WSUA 1PZ7A 1G9DA 4NWWA 1COV3 1S0BA 1X7NA 2EXIA 2FCVA 4PJYA 5EV7A 1ZBE1 1ONAA 3M3CA 4YW6A 2Y0OA 1WW7A 1ZZCA 1BJQA 2WZR2 4UFKA 4XETA 2EAKA 3A23A 1RUJ2 1ALYA 1UWWA 3S7IA 3RYKA 5FZBA 2GN3A 3VBFC 1BEV3 4I0AA 4DNYA 4XABA 2PFWA 1GYKA 2YZ4A 2UWCA 5CYYA 4NRMA 3I49A 3DKQA 4O7XA 2HWB2 2V4VA 2VMCA 4XCBA 4DUWA 1DZRA 3IIAA 1CAVA 2BTVC 5C3PA 1J1TA 3AMQA 1ULOA 1WA6X 1COV1 1J84A 2JG9B 3PUHA 1ZYBA 1XU1A 2XJPA 4OVEA 1Z7S3 3EHKA 3DXUA 2XL7A 2VNRA 4P9GA 1F8VA 1QU0A 2VTFA 2B7YA 4IV3C 4UF0B 1AX2A 4J25A 1CN1A 1HX6A 1CAUA 3GBGA 1SLTA 4YW3A 1JYIA 1BEV1 4NIAA 1DFQA 2JENA 1W0NA 1AX0A 2CGOA 4RR3B 5IAXA 4M00A 1DQ2A 3GJAA 4NIDA 2P2KA 1BMV1 4XMAA 1OQEA 3H8XA 1Z7S1 4XYXA 2D3RA 5EHDA 4UW4A 3ZMNA 2ZCWA 1LOCA 3TNPB 4AR2A 5IFPA 3POYA 4XQ4A 1H6YA 4WM8B 4IETA 2VMFA 5F37A 1DYPA 3WZ1A 4CXWA 3PL0A 4MUVA 2W87A 4LKEA 3V0AA 4PF1A 3FHAA 2BOJA 3JCIA 4AGGA 4ZS2A 2WZEA 4TSVA 3LQCA 3JD73 1VBE3 2PLV2 4GB32 4YARA 4Q29A 5ISLA 5C3SA 2NYYA 3VBOB 1R083 2Q5TA 3VD4A 1US3A 1WCUA 4XFBA 5DN2A 1UMZA 4XF1A 2Y8KA 3EQEA 4LE3A 1WW6A 3RQ0A 4FAHA 2GC0A 3DF0A 1YQ2A 5CKMA 5C8CA 1YQ8A 2EALA 1VAVA 3LEIA 4HXCA 2RM22 1DCSA 4YG3A 2WT2A 2BU9A 2LS6A 3Q8EA 1PMJX 2DTWA 2Z69A 4Q4X3 4BXFA 4FOWA 5I0TA 1W99A 2WKKA 1ZBE2 2HKXA 3JD71 1VBE1 5FYMA 2UU8A 2D98A 3KMHA 5HV4A 2BVBA 4Q27A 4Z1VA 1R081 4OUSA 4Z2WA 3OGSA 2D44A 1W8ZA 3FE5A 3KCYA 3OCPA 4O9GA 2E7TA 2W91A 4YNIA 5DZFA 5L9BA 4KG0A 4Q8KA 4AF9A 1O3TA 3POFA 3WQ0A 3ZXKA 1RMU3 1X50A 3V64A 2DYCA 4Q4X1 4MGTA 2ORXA 4UFMA 4QPIA 1COV2 4EZ4A 4ORFA 4CP1A 4BIOA 5FZ0A 2DUPA 3VBUB 5AFEA 2LRPA 1BQPA 3CHXA 2C6SA 4R4ZA 2ZX0A 2FDJA 3WDYA 5KXCA 4P14A 2JDNA 3MDPA 4XDQA 1RINA 3IMNA 5F5QA 2YB7A 3WNLA 1KS5A 4XJZA 2JEMA 2WFF3 2YFUA 1TG7A 3B93A 3BN6A 4BE3A 1CWPA 2HWD1 1OC1A 1BEV2 3WDTA 4I2OA 5GZCA 1MPXA 2E32A 2A7AA 3VZOA 1RMU1 1W6QA 2J1SA 1CESA 3CJXA 3QBQA 4PT6A 4MX3A 2HJIA 4R9CA 4HANA 1C4RA 1W2TA 2VL4A 4E9KA 5HXMA 4BQ2A 2JG8A 4FFHA 4QPYA 5JZGB 3O1TA 3RZHA 2BYVE 1BMV2 1Z7S2 2QNKA 1PO11 4OUEA 2R6QA 3LSEA 3POBA 2QQUA 2GSYA 3MW2A 4S2DA 2WWSA 3WF4A 1W2NA 2XL9A 2WFF1 2V72A 1ZZ8A 3J9SA 4WV8A 5D1IA 2DCJA 2V5YA 3LD8A 4Y5TA 2BV4A 2Q0AA 2D6KA 4CXYA 5LY2A 3K4DA 2R32A 4URAA 2VOKA 3AX4A 5EJZB 2GNMA 1RVF3 2A75A 3WF2A 5CISA 4HONA 1SFNA 5IVYA 4AFAA 2VVEA 4CDQA 4OQ8A 3EMRA 4N53B 1NA1B 2WBKA 4FPFA 5DZEA 4AFMA 3MIFA 4BISA 4NHLA 1I1EA 1J3PA 3OY8A 1Y9MA 2DVDA 2H0BA 3HNBM 4HL0A 1W6MA 4XUPA 5FQ0B 1KITA 3WINE 1QWRA 4LUMA 2ARCA 1XNKA 4RS5C 2JIGA 1UIKA 4N8MA 5F3IA 4ZXKA 3ME2A 4Y5SA 3O1VA 3U14A 1NUKA 5T52A 2QQJA 3USUB 4XUTA 4M3CB 3LWCA 2VZUA 4XPVA 3WW4A 1P8JA 2C4XA 1RVF1 2Q1ZB 5FYUA 5IW0A 1JU4A 1LHWA 1ND3A 1L7RA 5DDJ3 4AI2A 5T54A 3CIHA 3JD72 1VBE2 3VKOA 2D6NA 3SMHA 4EWDA 2NQYA 1RB8G 4LO6B 2MPFA 2WO7A 2E9QA 3I54A 5FLHA 1FYUA 4AEDB 1R082 3POJA 1L7QA 4RS5B 2FZ1A 4Q4V3 4AVCA 3O1UA 5BNQA 4K40A 2A6YA 3DYPA 5FUPA 3CL1A 4AEJA 1K5MC 1QEXA 2ID4A 2QDNA 4B1MA 2Q8CA 4QXCA 3VUOA 5FZIA 4LXLA 3VB9A 3AP4A 3ZLIA 2WFPA 4HSJA 4Q4X2 5CFDB 3LEMA 5JXHA 3CZJA 3KV6A 4K8RB 5DDJ1 3SKVA 3BOPA 4LO5B 3WSOA 4AXOA 3VD5A 4C1WA 1YO8A 3ZFGA 5K0UB 3I4IA 5EXOA 1VALA 2OA2A 1W8FA 1XJAA 2JXAA 4IGOA 4Q4V1 5JCTA 2ZHMA 4XF4A 2JECA 4YM3A 5ABJB 2DVFA 2VZPA 2HWD2 4W50A 3KQRA 2GC3A 2TUNA 1GP6A 1E5SA 1J1LA 4W4ZA 3RGBA 3IM0A 2RDNA 5K4LA 1RMU2 1YXWA 2QJVA 4Y1VA 4XJUA 2W94A 5CAZA 3BTXA 2FDHA 5LK7B 3I3QA 5AVAA 2EAAA 3VBSB 2ZX1A 1R64A 1PO12 1JHJA 5CU1A 4B1LA 3I2DA 1H2KA 2Y26A 3VKFC 5FY8A 4N9HA 4MGQA 1ENQA 3UNPA 5FZ8A 2JDHA 1RTVA 1W9TA 2WFF2 5BNPA 2WO2A 5DMYA 4IE7A 3HT2A 1GNYA 1ND3C 2O8OA 3A4UA 1JZ8A 1NAEA 2VTXA 3A0NA 3WP3A 4RHV1 4AFBA 1NLSA 3PVNA 5FWJA 4KGGA 5BNOC 3ZOIA 1JZ3A 3FC0A 3NV2A 5FP4A 3RSJA 5GLZA 4D6RA 1JTZX 2VCBA 3SXWA 3PMSA 2EIBA 1ZA4A 2A71A 1CZSA 2IUWA 3FHIB 1BHGA 4AFDA 4ISQA 4OCTA 1JUHA 2BZDA 4QB6A 4P9WA 5TSWA 1AL23 2D5HA 2GNTA 4OYUA 1GWKA 2QQNA 4NJ4A 3DN7A 4ZY9A 1JYWA 3T2TA 4AEMA 4DZGA 3THTA 4XFGA 2VZSA 3IPVA 1GV9A 1D4M3 2VZOA 3ON7A 3BPSA 5A7NA 3ZFGC 2IXCA 1RVF2 2HBUA 3ZFEA 2IXJA 4YSFA 5BNOB 1VAKA 1SPPB 5J37A 4Y3OA 3T4HB 3MICA 3AFGA 4Q0SA 1HXS3 1FOD3 3I3BA 4JRAA 4I02A 3SITA 3B9CA 4QDRA 2F17A 2B8MA 4HKLA 4YLZA 4LT5A 1WMXA 4LO4B 4QMAA 5F5CA 2OUHA 5K9YA 3HBKA 1S0EA 4PLNA 1UY0A 2GH2A 4EWAA 2YGMA 3ZSLA 1CX1A 1GZWB 3ZR5A 3BI3A 1YLLA 1D4M1 3Q9OA 4QQOA 5F9TA 2A3XA 3E1F1 3Q8BA 2DURA 2W3JA 4LHKA 3RJRA 4IEQA 5FZHA 2FDIA 2J1VA 5DDJ2 3DPRB 3POEA 4EYUA 3NJZA 4LBOA 1HXS1 1FOD1 5FMOS 4HPKB 1QH7A 1W6OB 4K20A 3KVBA 3AJZA 4L92A 4QU2A 1PZ9A 4YZ1A 4GAZA 4Q4V2 4P02B 4BHPA 2FZ2A 4RQPC 3T1LA 3B69A 3TEYA 4HKWA 4K9SA 4DS0A 4CDQB 4GMP3 5CG9A 2FHRA 4QX3A 1OD3A 5JOZA 2WNVA 2JD9A 5F39A 3RWKX 1DG6A 5GLWA 1SACA 1JYNA 3WG3A 3PDQA 1Q5OA 4FCAA 2ZX3A 4LPLA 3ZSMA 3EO6A 1YFWA 1UKGA 3O1RA 4LBNA 4IERA 3SCHA 2RS11 1WMDA 2ZMNA 5C5TA 2BFUL 2DBIA 1FATA 3PU8A 4AE2A 4D69A 3WF1A 4HK8A 3O0VA 1RUNA 3AL5A 4JTNA 4CCDA 1VPHA 1D2QA 1YWKA 4F8AA 4RA0A 3LKJA 1OOPA 3KT4A 1YIPA 2ZMLA 3PMEA 4GMP1 5A7OA 2WT0A 4XFCA 3P5BA 1WLCA 5LRSA 2PHUA 4RHV2 5J09A 1X36A 1X8EA 2VNOA 1F9KA 5FJHA 3H8UA 5C7GA 4XQWA 2X5IB 5JR2A 1E57A 4YGDA 3ZR6A 2ZACA 3VBHA 3VBRA 3VKLA 4LBQA 5EWSA 5IK4A 2C1FA 2PYTA 1ZZ7A 1L7LA 4R8HA 3AKSA 4RD7A 5FMDA 2QUOA 3TEXA 4WM7B 5H9RA 1UX6A 1XPWA 5A1FA 3U4XA 4W8JA 3UESA 1XB9A 1WGPA 5LCWL 2E6VA 3HN1A 4D7SA 3P6BA 2XJTA 3WV6A 1CD3G 4CCJA 1OA4A 2WIIB 2AACA 3LEKA 5A32B 4FFIA 3WNNA 2ZHLA 4MGYE 5FLIA 3JXSA 1R1A3 1CONA 1PHMA 2YBKA 5FY4A 4NPMA 3S6PA 1TE1B 4TLFA 1XBFA 4PLMA 4XZUG 4DPNA 3CO2A 3H1YA 1IG3A 2BJSA 4AW7A 4CE8A 3ACGA 4CZSA 2WNVC 4XF9A 1NQDA 2DUQA 3AZYA 2WLQA 1SBFA 1HB3A 2ARBA 1ULPA 2NMOA 1PX3A 5E6HA 5HCHA 1D4M2 1WZXA 1Q8PA 1LU1A 2B46X 4QDSA 2UYBA 1R1A1 2J42A 1Y43B 5F2SA 4ARYA 2HEYF 3MPPG 5DPNA 2LUWA 5FZ1A 3E6CC 5AC93 1YCIA 1HXS2 1FOD2 1N1YA 3MF9A 4K6BA 1MVEA 1O4TA 2B9VA 4YM0A 1IS3A 1WCSA 3IKWA 2MNGA 1WWYA 2WUHA 2PA7A 1IS6A 1BXHA 3MPBA 1U5ZA 4WVVA 5GLTA 3UKTA 3W20A 4BYYA 4E4DX 2DCYA 4Y24A 1X9PA 3VBHC 3VBRC 1UX7A 4Q0PA 4JDMA 2VBDA 4P9YA 2AENA 2W2IA 3IMMA 4ZU5A 1XNTA 4XJ8A 5DUWA 4BQXA 2JDUA 2GN7A 5AC91 2RS12 3AJYA 1NLRA 1OXCA 5I0SA 2WDBA 4GQ7A 3EYPA 2KXLA 2VZTA 1OF3A 4MGZE 1GANA 1DU3D 2GMEA 3POWA 3UV9A 3MLLA 1NZCA 3IB3A 1JMUB 2CDOA 4ZU7A 4YVWB 2PHLA 2XR4A 3HIFA 2PHWA 2A73B 3B94A 5K8SA 2AEZA 2HEVF 3RVHA 5FZ7A 1IG0A 2NPIA 3KF5A 5LATA 4QU1A 5I8SA 4AQ2A 4Y1XA 3PUAA 4E4ZA 3NRUA 1H4HA 1YIFA 3DKWA 2PQQA 4ES8A 2JWPA 4PI2A 4PIYA 4E27A 2Q1MA 3ZXAC 1XYNA 5EYYA 1RXFA 4P5HA 5F6LB 1NQJA 1AXYA 3LFMA 2Y60A 4IQPA 2VVFA 4M3CE 4AVSA 1U5XA 4S2HA 2LROA 1PGW1 3AXDA 4U2AA 5LRRA 4JDOA 3VLBB 2JDPA 1LOEA 4Y4YA 1LGBA 1S2EA 4F83A 2VXRA 4Q8LA 5SV5A 4EN8B 2RJLA 2VUAA 3M8LA 1GOHA 5A3MA 5A6ZA 1STMA 1RUE3 3V56A 1UYPA 3WOGA 4PBOA 2R30A 2WNUA 5FOBB 1HW5A 3PUIA 4XFIA 3SC7X 1XXNA 3WNKA 4V1PA 3WUCA 2I2SA 3RI9A 5FBJA 1QXRA 1YC61 4IEUA 2WWUA 1VLNA 3NNMA 4JGYA 3UGHA 1H8TC 2GH8A 2W0XA 1NE6A 1SFYA 4MO3M 5IUQA 2QQPA 1CAWA 1YNAA 2DUOA 3LDRA 3SNMA 1SLLA 1UOFA 2UY9A 1MZ6A 4JQRA 1R1A2 2ZGKA 2VTXJ 5ERLA 4QXKA 4YZ3A 1OA3A 1QDCA 4LBQD 3AYEA 3PUQA 1W90A 4L2NA 3SEPA 1RUE1 3KHCA 4LA2A 3SKJE 1XOYA 1FV3A 3J8F3 3KB5A 3WW1A 5C8WA 1LHNA 4FT8A 3ITQA 4PF5A 5C9AB 1H1MA 1XQNA 4G4FA 5J7MA 3HWJA 1IGOA 4XQDA 2HWB3 4NUBA 4ZHNA 3SH4A 4AI0A 5I0DA 4BQ3A 3ZYJB 3LF7A 1H8TB 5FYHA 1XE7A 3N9QA 3BTZA 5JSOA 1GR3A 2HWE3 4CDXB 1KS4A 5L7OB 1JOBA 1A8MA 3IIIA 3KM5A 2XUEA 5CZKA 2BPA2 3VHPA 3WP4A 2VULA 2K0GA 2XJQA 3C8XA 4RGGA 5AC92 2G19A 5JMCA 2XB6C 3J8F1 4KG8A 3RZLA 2VMDA 4QPGA 3ZKYA 2EXHA 1G9FA 1MQTB 1YQCA 2A3WA 1VBB3 2HWB1 4QGMA 2VPVA 2A3YA 2EVXA 2PTMA 3NV4A 3RZZA 1EPZA 1S0FA 4R9BA 4Q1PA 3ILRA 2NMNA 4RSUA 5FZGA 5LBEA 5HCAA 5KBFA 2HWE1 4IGPA 2GNBA 1GQHA 2WNUC 3ABZA 2PELA 2WINB 2ZMKA 3BB6A 3N7LA 5FZFA 2W08A 1QXPA 2PAEA 3LFIA 1F5JA 5JWPA 3INAA 2WSVA 5M0TA 1S0IA 3ES4A 1J83A 2HH9A 1QJX3 1CZVA 4N43A 1JODA 3J4UH 2F6BA 4NIGA 4FPYA 3HVDA 4QB2A 5BNNB 3RZJA 2ZAAA 1LEMA 3ETPA 5C4WC 1PGW2 1NXD1 1HIXA 1VBB1 4XUQA 4B29A 1KRIA 1NCRB 5FZMA 3LIGA 1RHI3 4TYSA 1OFNA 5GLUA 3MV01 1YI7A 1N47A 1O8SA 2DFCA 2PLV3 4XFAA 3WDUA 3ZIWA 3USSA 3G6JB 5BY5A 1O3SA 3WT3A 4Q0UA 1KJLA 3TRSB 3HMYA 2WJSA 4MXVA 5JLVA 5A33A 3BYWA 2WL1A 4IV1B 5IK8A 3NAPB 3PVBB 3JU9A 1QJX1 4NRPA 4URTA 3ILFA 5FO8B 3DYOA 2QFEA 3D3AA 3ZXEA 5CADA 2NN8A 4CDWA 1PK6B 2VG9A 1W6NA 2YMZA 5GALA 3H3ZA 5GZFA 3R6SA 1W8UA 2CV6A 1GQGA 1RHI1 1K5JA 4NHMA 2ADEA 2ZA9A 3MYXA 4LJHA 4Z8BA 4OI2A 3T0AA 4CDUA 1SBEA 2WAAA 4QPGC 4XCAA 2P3JA 1ND2B 1DBNA 1GLHA 3FL7A 3TEZA 5F32A 1A78A 3E5QA 2WR9A 4A3ZA 4AGVA 3POIA 4RR3A 3AM2A 1RUE2 2W92A 3HNMA 2QKDA 2JB8A 4CP2A 4E8CA 4IESA 2W46A 1RL3A 5LBCA 3G7DA 5FFOC 4YPJA 3RPQA 2VMIA 4XUOA 1N3QA 2JDYA 3OBAA 2RE9A 1UNBA 1SHWB 5D8AB 5KHJA 3BIEA 1N3PA 1V6OA 1O3QA 3MW3A 4KI5M 4H3WA 1H30A 1R093 4WM8A 1Q8VA 4M0NA 3CJIB 2PXJA 1V70A 4XUNA 5HPOA 1BYHA 3N9OA 4NAOA 4FTBA 2CWMA 3T4VA 4N43C 4DFSA 1JYCA 3CNAA 4B3NA 1AX1A 4QDQA 1UMIA 3UJQA 1YJLA 1U5IA 1WLDA 3J8F2 5F3GA 5LA9A 1G86A 5FPZA 4QKFA 2ENRA 4LK7A 4PHZA 5DQ0A 3ZSKA 1FAYA 1POV3 3PVOA 2O8QA 4JHTA 4PBPA 3LA2A 3WW2A 4L99A 1RUH3 1WMFA 4WVWA 4LKSA 2CTVA 4Y20B 3VL8A 2YBPA 3K4ZA 3QOPA 1WCQA 1R091 1M4WA 5A80A 1BK1A 2HWE2 3ENRA 3I3EA 1QJU3 4LA3A 2FMDA 5FDBA 1W9YA 3FWEA 1H2LA 1GNZA 3ZXGA 4MZUA 4QPWA 5FYSA 3T2PA 1UOGA 1BKZA 3EXUA 2WRAA 4CDWC 1UPSA 3VBFB 3U11A 3QCWA 1DIWA 4QAWA 4Y22A 1LHUA 4C1XA 1W04A 4RFRB 1C1LA 3H9AA 2Z79A 3CMGA 3J7MA 5DAWA 4V2VA 1POV1 1VBB2 2WZPP 1O5LA 4KH9A 4HVQA 1W39A 1QJZA 1RUH1 2I74A 3NSTA 2BVVA 1TME3 3POGA 4MXWB 3UYJA 1W6PB 4GKXA 5EFUA 3TAYA 1QJU1 4GWJA 1MEC1 1OH4A 2CYFA 3UGFA 3I3MA 1JN2P 4IV3B 4UXAA 4CEWA 3HNYM 3I59A 1XRUA 1QJX2 1JYXA 1L3JA 4GKYA 4OHXA 1LRHA 4RFT0 3VBUA 3FLPA 4ZONA 4OHYA 5FXVA 4QWNA 4LOTA 3IAQA 2JB4A 3PNAA 1OURA 1OH3A 5HV0A 4L0PA 4YG0A 1GZ9A 3ACIA 4ARXA 1JYVA 2GP3A 2VVDA 1RHI2 2BNNA 1PO21 1TME1 1YHFA 2GMMA 4XJAA 2BGPA 1S55A 5FZOA 4EN0A 4W6WA 2ZTNA 5FREA 4M3CF 2RDRA 2H6CA 1UZVA 4K8FA 4YVSA 2XJVA 3NJXA 4JV4A 2VGDA 5DAPA 4G9SB 5AFBA 3GF6A 3KV9A 1WLTA 2X29A 1J59A 1PX4A 1RIRA 3ACLA 4BMEA 2W5FA 2XUMA 5EP9A 2R043 2XVGA 4QM8A 3WVJA 2CNAA 2XKPA 3K51A 4DXTA 4FFGA 4W6YA 4UAPA 3W58A 1H2MA 4QB1A 4FI9A 5FAXA 1UU5A 1F5FA 2PHFA 4BJ0A 3HR9A 2VOXA 5CB7A 4TWTA 3ES1A 4RGKA 1ZRIA 1N1TA 3ACHA 5T3NA 1CAVB 2HWD3 2O1QA 3J7LA 4GH4A 4UOJA 1SFPA 2R041 1OA2A 2B45X 5T50A 3OD4A 1GUIA 3OGGA 4MOAA 4AWDA 3CBNA 2E51A 1MR5A 1R092 2FCTA 4CEWC 1AR73 1CAUB 3LEGA 5E89A 2ZGRA 3B3QE 1PO13 4AEKA 3B00A 4Q1RA 1AVBA 4NHXA 4C91A 2D6LX 1F15A 2R1DA 5J98B 3AP5A 4EN7B 3OBZA 4IGQA 4AVBA 4UFIA 2JX9A 5LA2A 3FLRA 1JHNA 3VGIA 1F4HA 5FPBA 5JOWA 5L36A 4CCEA 2A6XA 2O0OA 3E6BA 3NMBA 1RUH2 4XIKA 4YVSC 1HQNA 3U10A 3H3LA 1JBCA 3WQ7A 1URXA 1UAIA 3N7MA 2BW8A 2ILMA 2BGOA 1AR71 1C3HA 2A6WA 1QJU2 5LBBA 3T30A 2RJKA 3MZHA 1MEC2 3KT7A 4XBNA 5C8CC 3KZ4C 2ZGUA 2VQUA 4FPGA 5ANQA 2TEPA 4G3YC 5CFDA 1HRI3 3OBRA 3V0AB 4PDWA 5FBZA 5FMBA 5FPAA 4LITA 4AAPA 2KM2A 3OUIA 3BIWE 2MEV3 5FY9A 3LDKA 5F3EA 1LU2A 3HJRA 1PO22 1TME2 3OTFA 1ULDA 3D5OA 4CXXA 2IXHA 5C8CB 4GH4C 4JCKA 5FMOL 2Z5WA 1OPMA 3EJKA 2J22A 3GGLA 3VDDA 1OKOA 5LA1A 3TBDA 1HRI1 1ODNA 4D0QA 5B2GB 1QJY3 1H8VA 1W2UA 2BQPA 1N1VA 2Y6JA 1Q3EA 1S2KA 4GZ9A 4AZZA 3AB0A 4FQ4A 4P08A 4QPIC 3S30A 4Y4RA 3VV1A 4D7TA 1UXZA 5BXXA 4QX0A 3FLTA 2JJ6A 1RYYA 2MEV1 4XOGA 2DF7A 4EZHA 4E2QA 1AHSA 3EB7A 2R49A 1W8TA 3E97A 3RZKA 3S7EA 2XH6A 4YGCA 2NM1A 4DIQA 1JH5A 4QXBA 5FY7A 3PJQA 1UU4A 4FQZA 1QJY1 3N36A 4JGZA 4ZPIA 3BPZA 5HBAA 1F35A 3OGJA 1JOPA 2ET7A 2JG8C 2WA3A 3BTYA 2P4EA 4HT1T 2XONA 2R042 3BCWA 3AKPA 3LA7A 2IFWA 1MS9A 2WT1A 3U37A 3M2MA 1W8OA 2R7EB 4PDWC 4AVTA 4Z07A 2ZGPA 3K46A 1AR83 3FBYA 4BK5A 2LTNA 5D21A 3ZFFA 1RXGA 1W2OA 1W6QB 3WUDA 1IPJA 1C5HA 4BWOA 1Q43A 1W3XA 2ZPXA 3FX3A 4YGBA 4AQTA 3QD6A 1K5MB 3D0SA 1WBLA 2JG8B 2ZS6B 4CDQC 5BV6A 1X9TA 4MHUA 1TNRA 2WS93 3ZM8A 5T5PA 1PGSA 4RHV3 4YW5A 3RJ2X 5JOXA 3QLQA 5F5AA 4I3GA 2WO3A 4FP3A 2R063 1Y7BA 1EAH3 1AR72 2GP5A 3MO4A 5GKAC 3VDCA 1XU2A 4CP9A 1NZIA 1XE0A 1D0GA 4YRDA 2YBSA 1XSRA 1AR81 5L9VA 3GCXA 3RZMA 4IE6A 5GJ6A 1Y9QA 2DCZA 5FRAA 4CEYA 4HN0A 5LY1A 4FPEA 2DTYA 2C0ZA 3GZTB 4JKMA 2ZZJA 3UK9A 1YFYA 2WS91 4LE4A 3FBMA 3GYDA 5C70A 1NCQA 1O59A 2YROA 3MI8A 1W6MB 2XJRA 2DV9A 2Q4SA 5IVEA 4EV0A 4XXPA 2QQWA 4XAEA 5CBLA 2D93A 4LLFA 4NHKA 2R061 2GAUA 4I0BA 4ZKTB 1EAH1 1YUDA 3K48A 4QGLA 3MLKA 4KBBA 1NKGA 2XPJA 4LR4A 5FO7B 2XLAA 1FNYA 5C3OA 1TQ5A 4GWMA 1MS1A 4R9AA 3WDWA 1HV0A 4UBGA 1HRI2 1W06A 3PIGA 3ZYIB 2NP0A 3N4MA 1REFA 1V6MA 1ND3B 3WNMA 1OUSA 3IDEA 4O61A 1GZCA 4BM8A 1ZX5A 4BLJA 2R071 2NZ9A 4J6GA 4MGSA 4TLGA 1SCSA 2MEV2 4OZXA 3KQ4B 4XHXA 4YM1A 2G9ZA 3ZFFC 2FMYA 4HK9A 1SCRA 5IAVA 1IPSA 4FPCA 1O5UA 3POSA 1NE4A 3O1SA 2WA4A 4LK6A 2WN3A 1VRH1 4KWJA 4LO7A 1DQ6A 1RUF3 3A21A 4LORA 5CKQA 4MGKE 3WNOA 2OX0A 5JSPA 1O91A 2V09A 3OJBA 2OZJA 1QJY2 3KSCA 3AYCA 3OPWA 1J3RA 1HLCA 4IE4A 4Y5Z0 3SH3A 4A45A 1N3OA 1WD4A 4PQ9A 2ES3A 3C7EA 3WF0A 1QOTA 3WR0A 5LEKA 4A6SA 3OEBA 5A3UA 1EP0A 3ZFGB 4ZU4A 4BQ5A 3U78A 3ZVXA 5KC6A 3FZ3A 3AMNA 4CEYC 3RZGA 4COVA 2K9ZA 3BALA 3I2HA 4R52A 1UZ0A 2RS13 4K1ZA 5BNPC 5FPXA 4AAXA 1V6NA 5A3PA 1NG0A 4I01A 2VMEA 1OF4A 2XHKA 1RUF1 2Y64A 1NCQC 1OBNA 3JB8A 4IEVA 4DUVA 3GHNA 4JZRA 5C33A 1VMFA 1HQLA 1IZ3A 3JQXA 1HJFA 4XMIA 2HEWF
chains in the Genus database with same CATH topology
3SCFA 1XYOA 1UZZA 5GM0A 1LENA 1RJ7A 5JR7B 3VZJA 4BH9A 5JIUA 2ZAHA 4C0BA 5I8TA 3D0JA 2UURA 1CPNA 1FX5A 1VBD3 1HRV3 5L19A 1BVP1 1AR82 3QH7A 4E4SA 1C8NA 3MIGA 4A7YA 4RQPB 2BWCA 3NWKA 4BZ4A 3ZFEC 3O0XA 4AVVA 1ENRA 2WS92 4JTOA 1ZBA2 4A2UA 1RC6A 2ZOEB 2A5ZA 4AFCA 3L2HA 5CA6A 2WQZC 2ZGTA 4Y1YA 2R062 1MS4A 2ATFA 1EAH2 1VAMA 2P17A 1V6LA 4GIQA 5T5JA 4A7ZA 1VBD1 2D5FA 1HRV1 3IPVB 1APNA 3AP9A 1PIV3 2VMGA 3AP7A 2ZGNA 5L73A 5LEJA 3ZFEB 3O14A 4EN9B 3ZN6A 2R16A 5IK5A 2D6OX 1LHOA 3WG1A 3ZDSA 4P9LA 5GLVA 3U0ZA 2R072 2WQ4A 4MV2A 4YFWA 3DUIA 2JDZA 1FXZA 2XVKA 2OYZA 2CAVA 3M3OA 5KXDA 4YVWA 5AVPA 1W0PA 1ZVFA 1VRH2 4QT6A 4HLTA 4COZA 1PIV1 3NV1A 3QH6A 4OI4A 5T5LA 1TMF2 4R4XA 4YM2A 3SHRA 1OMIA 4AVAA 2VOVA 3EBRA 4P9IA 5GZDA 3WQ1A 3AMMA 3MLJA 2RR11 1VBA3 1AZDA 1CIWA 2XG3A 2LALA 1WD3A 3H3UA 1HKDA 1OOPC 1SLBA 4GALA 1LGCA 5J96B 4I3PA 4NN0A 1B35A 1RUF2 2WNVB 1UPIA 1DZQA 3TB0A 1KQRA 2P3IA 3OYWA 1J58A 1V6JA 3HAGA 4E2GA 1REEA 4CRQA 2YUEA 1VB4A 3R4UA 5KWRA 2F4PA 1VBA1 1U0AA 1PVXA 1QQP3 1UIJA 4OFGA 3ZX7A 2VH9A 3WD5A 3DV8A 1CAXA 4AHYA 2XKOA 3HD8B 1SQ4A 2G4IA 1QNYA 3KGZA 4WVMA 4IEYA 3VBHB 3VBRB 4HETA 2R0HA 1QOOA 4AGRA 1DGRN 3N35A 2RHPA 3WDXA 3WDVA 4Q0QA 1QQP1 1VBD2 4INDA 4NWVA 3LOBA 1HRV2 3VHRA 3ZXLA 4COUA 2CY6A 3N3HA 4ATFA 4YYOA 4D3WA 1LGNA 5EYXA 1HDKA 4X6RB 4LUKA 2XWJB 2UWBA 2GMPA 1QH6A 1ZRRA 4KWKA 5KXBA 4L11A 1OPOA 3WP6A 4MLOA 1B35C 2IWGB 4AQSA 1OSGA 2IC1A 3AFKA 3H50A 3H1MA 1MACA 3B5LB 4IEOA 3ZPYA 4K21A 1PIV2 2CGPA 5JPMB 1YI9A 1O4YA 5BUVA 3APBA 4EROA 3V65A 5I0RA 1ZRDA 4N9IA 2TBVA 3PJYA 2RR12 3TNQA 3KGLA 1AJOA 2OW4A 1WCKA 4COWA 3P3PA 3E6DA 4Z92B 3N7JA 5FTTC 2LM3A 2C9AA 3V0BA 4BMBA 5FOJB 3ZN4A 1DDLA 2AR6A 1A3KA 3AYDA 1D0HA 3BOWA 5J48A 2E7AA 1UCXA 1WMEA 5F1RA 4OHZA 4Q4W3 1VBA2 1LECA 3MFAA 4W65A 4XEZA 1KD7A 1BCXA 1CX4A 4IEXA 2D97A 2XBO1 4COYA 2FBEA 3AP6A 1CJPA 4IEWA 5CFCA 4HFSA 2OVUA 4YFZA 3WY6A 1FT9A 2ZZQA 1LULA 1ULEA 3M4FA 2BBVA 3TN91 4Q4W1 1WW5A 2RS53 2ZGLA 3NKGA 4LULA 1QQP2 3SCGA 2BNOA 4GMP0 4JGYC 3LAGA 4P9JA 5DUXA 1KDMA 1QHDA 4L8QA 3KD4A 1MS0A 3AYAA 3DGTA 4BLIA 3M7AA 4SLIA 1IPKA 1TEIA 3WCRA 1RITA 4GXLA 1FMD1 1MS8A 3CF6E 4L97A 1RUG3 2UY8A 2QZ2A 1DQ4A 1IOAA 2WNUB 4FXGB 1UW8A 5SV8A 3ZO0B 4DRVA 2Z42A 2GU9A 2E53A 3B01A 4DXZA 4FPOB 1PNGA 1VIWB 2JE9A 3AMHA 2RS51 4ONUA 3R4SA 4XW3A 2ZABA 3ZYGA 2JG9A 2ETEA 1O7FA 1CAWB 5C4WB 3RMXA 2QZ3A 1GKBA 1ZZ9A 4Y26A 2ZJCA 1EV13 1Z78A 2DVGA 1RUG1 3CU7A 1ASJ1 4B4RA 3HQXA 3AZXA 1LB2A 4XILA 1JUIA 4MXWA 1W6PA 4AQ6A 1S0CA 3WX5A 1A8DA 2YXSA 2VY0A 1RUI3 1QKQA 3D6EA 4XZPA 2GZWA 2DU0A 1AUYA 1UZYA 4LO8A 4IV3A 2AYHA 2C5DA 4Q4Y3 1EV11 1LOAA 4GA9A 3MIEA 2VOWA 3OF1A 4QPGB 4HMZA 4XTPA 3PVEA 1LCLA 2PHTA 2DU1A 3ALQA 3IN9A 3VL9A 2OUJA 4CYDA 3IDBB 4OI1A 1RUI1 1JW6A 3VBOA 2XBO2 3I7DA 2BNMA 1TNFA 3B7MA 2A6VA 2H6BA 3UKVA 4NOTA 2G9FA 1VBC3 4Q4Y1 1G9BA 3E5UA 2JG9C 4N43B 1MEC3 2VUJA 3TN92 4Q4W2 1CGPA 2PAKA 3VZLA 1DQ5A 3M1HA 3WXPA 5LK5A 4DY3A 1FNZA 1I3HA 3GALA 1EYBA 3BTAA 1IS5A 3M70A 1XNDA 2DVBA 4CDUC 3ATGA 4A3XA 1PMIA 4CTEA 2SLIA 5EZWA 3ECQA 4Q26A 2H0VA 3PHMA 1PO23 5A33B 4RR3C 1G9CA 1FMD2 2TNFA 1YYNA 1VBC1 1R1ZA 1GSLA 4FPKA 1ZREA 4FTEA 1J3QA 3O7OA 2I45A 5KXEA 4CDWB 1PNFA 1W6NB 2RS52 3O0WA 1G7YA 1OKQA 4WM8C 1X82A 1DHKB 4CDUB 5I91A 1AR63 1V6IA 4KU8A 3RDIA 4LNVA 4LBKA 2BEOA 1DGRA 1RUG2 1WA4A 3FFQA 4JC1A 4CP0A 1ASJ2 3GBFA 2XLFA 4DY5A 3VBOC 4KQ7A 5JZGA 4META 3URFA 4IL7A 1MS5A 5ACA3 1W0OA 3C2UA 3J26N 4DQAA 3W9AA 2ZBJA 2XGXA 1DGWX 4JDNA 1O3RA 1AR61 1M06G 3R05A 4EWEA 4K7JA 2IZWA 2WNEA 1EV12 3GBWA 3JQWA 4NO4A 1H4GA 2UWAA 4P9XA 5JIAA 1A6CA 1F2NA 1X33A 5E88A 1NYWA 4N53A 1NA1A 4AK3A 4YZ2A 2FQPA 5ACA1 1UL9A 3MW4A 4LTAA 2VECA 1RUI2 4ATEA 5FQ0A 5JPNB 1OQDA 1LJ7A 4MYEA 2HWF3 5FO9B 5CVRA 4QX5A 2DWRA 4Q4Y2 3USUA 3SH5A 4M3CA 4Y22B 4E2SA 1V00A 3VBUC 4LBLA 5K7PA 1ZM1A 2VU9A 3BU7A 1ENXA 5JDBA 3P3NA 5E16A 1RGSA 3O12A 1V6KA 4OULA 1NXMA 2XJUA 4AEDA 4RS5A 4EJRA 5IT6A 4DMIA 3WNXA 2HWF1 2Q30A 4CEWB 3I59B 1VBC2 4W6XA 2N7GA 5JZGC 1DGWA 3IDCB 4AI8A 1H9WA 1X8MA 1IKPA 3VN4A 4HBNA 3RRDA 3IT8A 4QQPA 3VZKA 3RMYA 1PVC3 4MH0E 5K0UA 3ZYRA 4I09A 3MEPA 4YVSB 5ABJA 2GDFA 2QCSB 2UYAA 4N7IA 4LEJA 1K5MA 3UJOA 4N53C 1NA1C 1MVQA 5A3LA 1LOBA 2OPKA 3PTYA 1PGL1 4FTSA 2YY1A 3MF6A 2E7QA 4S2GA 2HYKA 4B4PA 3B9IA 1FPN3 5JI7A 4BQ1A 5DUUA 1H1AA 3VBSA 5BPXA 1PVC1 2D6MA 3MIBA 4XIOA 1GBGA 1AR62 4YGEA 1Q8QA 5GZGA 2EA7A 1MZ5A 3C3VA 4ISRA 4GH4B 1VJ2A 1QMJA 3NKTA 4QM9A 1NOVA 5HCBA 1OHFA 1QY4A 4AEDC 2YGLA 1KDKA 2RS33 1IQAA 3ZXJA 4KGQA 5DXDA 5ACA2 1FPN1 1S0GA 4QPIB 4UW6A 1AR93 4Q0VA 4RGAA 1PZ8A 4PCRA 2GC1A 1UU6A 2EIGA 1WW4A 1RJ8A 2DCKA 2RMU3 5CFDC 1C57A 2ZGOA 4U36A 1XNCA 4D7YA 2DCTA 1AXKA 5T55A 2KA3A 1SBDA 5K0UC 2VQ0A 5BNOA 4BCUA 1LEDA 2ZGMA 3M3QA 1AXZA 2YV8A 4YW2A 4B7EA 5ABJC 3ZIXA 2RS31 2SBAA 3OPZA 1RUD3 3RYRA 4N90A 3WG4A 3U07A 3LA3A 1SLIA 4Q2FA 1DF0A 1AR91 1ZBA3 5DG2A 4X8NA 3HT1A 1G9AA 2QE3A 1YRZA 1EPWA 4FO9A 3VDDC 2HWF2 2IXIA 2RMU1 4PDWB 4XBLA 4NVPA 1GZWA 2YYOA 5C6CA 4DB5A 5KHGA 2A6ZA 2D3SA 3VBSC 1LOFA 1V9U3 3ZMOA 1POV0 2QVSB 4QHBA 1D4VB 3TOJA 4J1WA 3ZSJA 3AXEA 3DPRA 2ZGQA 3PLQA 4MSVA 4CDQB 1RUD1 4LHNA 2GC2A 4HPKA 1QOSA 1CVNA 1W6OA 3OY8B 4I0WB 2IXLA 1MZEA 2B42B 2GALA 1ZBA1 2R073 3ETQA 4HKOA 4C90A 3VDDB 2PHRA 1VB2A 5HI0A 3ELNA 3ZYPA 5KC5A 2EF6A 4K3UA 4JGZC 4FPJA 1GNHA 2YC0A 2XJSA 1VRH3 3WG2A 1PGL2 3OD0A 4H7LA 3VHOA 1QNWA 1V9U1 2PAMA 3H7YA 3D4KA 2CWSA 1TMF3 3HBZA 3LOIA 1DLLA 1AF9A 1SEFA 1OLRA 3MIHA 1PVC2 4QQHA 1C8M3 2P37A 3TYJA 2ERFA 1CPMA 1KFXL 4RQPA 3H1WA 5CNAA 4BOWA 1U5YA 1JOJA 4AI1A 1SLCA 2ARXA 2ZHNA 4XF0A 2YDEA 4JGZB 4B4QA 3WHTA 1IS4A 4YG6A 4WBBA 3UL2A 4QD2A 4AHZA 4QQLA 4WVZA 4DOUA 2E63A 2GNDA 1C28A 4KU7A 1NY71 2X5IA 1TMF1 3NL1A 1FPN2 4IXLA 1AJKA 3CLPA 1ZRFA 3AK0A 4XF3A 5JOYA 1C8M1 2D7FA 3JB4C 2JKBA 3ZFFB 4WM7A 1LOFC 1BBT3 3DL3A 3KLSA 5JVVA 5J36A 4YW1A 3THPA 3KT1A 1XNBA 3DPRC 4HVOA 4H7MA 5A32A 1LHVA 3NV3A 3RNSA 4JAAA 3FJSA 3WLUA 1OD5A 5CIRA 1AL21 1GICA 3S0MA 2RS32 4AG4A 1ENSA 2AH2A 3GHMA 4UW5A 3GZUC 3W59A 1AR92 1FI2A 2YPJA 2K2SA 5KHKA 4YZ4A 5T5OA 4ITCA 1IHMA 2VW2A 4CEYB 1BBT1 3AMPA 2RMU2 5BNPB 1S0JA 3B02A 5F6KA 1B09A 2DVAA 3IWZA 1XE8A 3KCCA 1OFSA 1SMVA 1KFUL 1NCQB 2D3PA 3R0RA 4XXAA 1C1FA 4Y1UA 4XHBA 1QDOA 1RUD2 1ZNPA 3LGRA 2Q8OA 2ZKLA 5KHIA 2R1BA 5JSRA 4HSLA 2CAUA 2BUKA 3IBMA 3H7JA 1DYKA 2PHDA 5I8YA 2QDRA 4R9DA 4S2FA 2AGSA 2X5IC 3VKNA 4WZFA 4FOQA 1SLAA 1VP6A 1V9U2 1LODA 4HVRA 4WM7C 3TWIA 2VQAA 1I9RA 1S0DA 1ZZ6A 2VW0A 4XTMA 2ZGSA 5HXVA 2D40A 4LHLA 4LBJA 2JD4A 2RR13 1WLWA 2MHFA 2EXJA 4Y1ZA 1WUVA 2CL2A 4FBFA 1WBFA 3LCPA 1KXGA 4FP2A 5EJ3A 1AYN3 3BODA 3OBTA 2IFRA 4AHXA 1NY72 4XFHA 4DRRA 4NR1A 1S1AA 1YFXA 1CJDA 1ULGA 4KNCA 1C8M2 3WHUA 5DG1A 3VZMA 1REDA 4X6QB 4DINB 2JE7A 2YHJA 3ZXFA 1YJKA 4TZDA 4ASLA 4N7UA 1AYN1 3RG0A 2WLPA 1AL22 1Q8SA 4J1XA 3ZXDA 3JBG3 2AREA 4OHWA 4A7KA 1LR5A 3RYPA 1UF2C 1ULCA 1LOGA 4SBVA 5HCFA 3R4DB 4KL1A 3RWNA 3D82A 3GNEA 4K1YA 1BBT2 4PLOA 4F3JA 5H9QA 2ZX4A 1LESA 4EN6B 1OOPB 2AZ5A 2XWBB 4FXKB 3WP5A 5H9SA 4H14A 4AI3A 3H0OA 1RUOA 1IKQA 2D43A 3D8CA 4HN1A 3JZVA 2HWC3 3JBG1 4FAGA 2OZ6A 2WC2A 3LSDA 4PIZA 1MZFA 1CR7A 1Q56A 1H1IA 4LBQB 4XJWA 1BZWA 4YVWC 5C9AA 1DQ0A 2B39A 1FV2A 1H8TA 3ASIA 4B7KA 3FUQA 3GZAA 2I07B 2AUYA 3M3IA 3ZN6B 4CDXA 4M0HA 1RUC3 4AYUA 5L7OA 4GULA 3NO8A 2VW1A 1N1SA 1ZRCA 3ROUA 1YFUA 2HWC1 2ZX2A 3AKTA 4FPHA 3CEWA 1BVVA 3VKMA 4H55A 2OIIA 4B8EA 1OLQA 4FSJA 1MS3A 1MQTA 4LBMA 1H9PA 1DZTA 1JXNA 1QF3A 2X53S 4QQ2A 1AYM3 1H0BA 4F7ZA 3ST7A 2PN5A 4XBQA 4FVVA 3RI8A 1G8WA 3O5SA 1RUC1 3I8TA 3UKNA 3JUUA 1SDWA 2EXKA 4MGIE 5J3UA 3FFZA 1Y3TA 4NPRA 3NW4A 5H9PA 3FUOA 3AZZA 3MIDA 4BPZA 1WCDJ 3MGUA 2ZHKA 1B35B 2P34A 5BNNA 2Y38A 4FOYA 4XJ9A 3L2YA 2W52A 1AYM1 3OYWB 1NCRA 3KCXA 3LB9A 2BFUS 4LLOA 3AZWA 1Q8OA 1AYN2 4GWNA 4UW3A 2XBO3 1O4ZA 3SLIA 2XVLA 4YW4A 5C9AC 5GZEA 5DZGA 5FLJA 4IV1A 3NAPA 1QGLA 3AZVA 5JAXA 3AKQA 4CDXC 4OI0A 2B5HA 2XLGA 5C4WA 1CAXB 4O9EA 5L7OC 4HZFA 1PK6A 2D6PA 2W39A 3TN93 4FPLA 2WZR3 1KJRA 2PHXA 3N7KA 4WVMB 1RUJ3 2VMHA 2BWAA 4L9BA 1DQ1A 1ND2A 1MQTC 3VZNA 1G6NA 3JBG2 4BA6A 4I30A 1FMD3 2VNGA 1LKNA 1UD1A 2G9GA 1T6GC 5D8AA 5E8AA 3SISA 1H2NA 2WZR1 2JICA 3NVCA 1U12A 1RUJ1 4PIXA 3CJIA 1ZZBA 1Z0HA 2IXKA 4JVAA 2W68A 1GFF2 2R0FA 2Z2SB 5FCCA 4BIFA 5JI9A 5BNNC 2HWC2 4MVTA 4XE9A 1NCRC 3MFCA 3VHNA 1ULFA 5E1RA 2A70A 4IEPA 1ASJ3 4IEZA 3L9JT 1HQWA 4YZ5A 2Y0IA 1UKRA 4QGNA 3ZSEA 3ZN5A 4ASMB 4Y20A 1LTEA 4FOVA 3ILNA 5I0UA 3WW3A 4JGYB 1VR3A 1CQ9A 1F31A 2ET1A 4IV1C 4WZCA 1S2BA 3NAPC 2B9UA 4OUMA 1RUC2 3X29B 1OI6A 1EY2A 5KHHA 3M3EA 3AKRA 4Z82A 1PK6C 3VBFA 1D2SA 5DUVA 4OLLA 4GB33 1OQ1A 1I6XA 3V0BB 3QACA 1HV1A 1AYM2 1ND2C 5IK7A 5I93A 4RL7A 1AL0G 1QXJA 5CFCC 3RS6A 3KS7A 4UBHA 2RM23 2NLRA 3FMGA 3WCSA 4KWLA 1PM7A 4JRLA 5D8AC 1DGLA 2P3KA 4XFFA 2V73A 4M01A 1ZBE3 2X8KA 3CJIC 4GB31 1I5ZA 2PLV1 2BGCA 3T1MA 4D94A 2ZKNA 4C0HA 4ES9A 1XYPA 4X8PA 5BYNA 2DFBA 4OHVA 3A0KA 4AHWA 5CFCB 5CG8A 1UN1A 3E5XA 2RM21 1C5IA 3LZZA 2CGNA 1G9DA 2WSUA 1PZ7A 4NWWA 1COV3 1S0BA 1X7NA 2EXIA 4PJYA 5EV7A 1ZBE1 1ONAA 3M3CA 2Y0OA 1WW7A 1ZZCA 2WZR2 1BJQA 4XETA 2EAKA 1RUJ2 1ALYA 3S7IA 3RYKA 3VBFC 2GN3A 1BEV3 4I0AA 4DNYA 2PFWA 1GYKA 2YZ4A 2UWCA 2HWB2 1DZRA 3IIAA 1CAVA 2BTVC 1J1TA 3AMQA 1COV1 2JG9B 4OVEA 1ZYBA 1XU1A 2XJPA 1Z7S3 3EHKA 2XL7A 2VNRA 4P9GA 1F8VA 1QU0A 2B7YA 4IV3C 1AX2A 1CN1A 1HX6A 1CAUA 3GBGA 1SLTA 4YW3A 1JYIA 1BEV1 1DFQA 2JENA 1AX0A 2CGOA 4RR3B 4M00A 1DQ2A 2P2KA 1BMV1 4XMAA 1OQEA 1Z7S1 4XYXA 2D3RA 4UW4A 3ZMNA 2ZCWA 1LOCA 3TNPB 3POYA 4XQ4A 4WM8B 4IETA 1DYPA 3WZ1A 4MUVA 3V0AA 3JCIA 4AGGA 4TSVA 4GB32 3JD73 1VBE3 2PLV2 4YARA 4Q29A 2NYYA 3VBOB 1R083 2Q5TA 4XFBA 1UMZA 4XF1A 3EQEA 4LE3A 1WW6A 3RQ0A 4FAHA 2GC0A 3DF0A 5C8CA 2EALA 1VAVA 2RM22 4YG3A 2WT2A 2Z69A 2DTWA 4Q4X3 4FOWA 5I0TA 2WKKA 1ZBE2 2HKXA 3JD71 1VBE1 2UU8A 2D98A 3KMHA 2BVBA 4Q27A 4Z1VA 1R081 4OUSA 4Z2WA 2D44A 3FE5A 3KCYA 3OCPA 4O9GA 2E7TA 4YNIA 5DZFA 4KG0A 4Q8KA 4AF9A 1O3TA 3WQ0A 3ZXKA 1RMU3 1X50A 3V64A 2DYCA 4Q4X1 4QPIA 1COV2 4ORFA 4CP1A 4BIOA 2DUPA 3VBUB 5AFEA 1BQPA 4R4ZA 2ZX0A 3WDYA 5KXCA 4P14A 4XDQA 3MDPA 5F5QA 1RINA 3IMNA 1KS5A 4XJZA 2JEMA 2WFF3 3B93A 4BE3A 2HWD1 1BEV2 3WDTA 4I2OA 5GZCA 2A7AA 3VZOA 1RMU1 1W6QA 3CJXA 1CESA 3QBQA 4MX3A