1RMU2

Three-dimensional structures of drug-resistant mutants of human rhinovirus 14
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Three-dimensional structures of drug-resistant mutants of human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rmu200
1NCQC 2HWB3 1FOD2 4RHV2 2X5IA 3JBG3 2BUKA 2FZ1A 1ZBE1 1RUE3 3VBFB 5CFCC 5C8CB 4RR3B 1QQP3 1COV1 2RMU3 4FSJA 4Q4V1 4Q4Y3 5DDJ2 4GB32 1NG0A 2RS13 1QJU3 3CJIC 1RHI3 4CEYA 2X5IB 2ZZQA 1RVF2 3JBG2 4QPGC 4CDWA 1PO12 1FMD3 2HWE3 1WCDJ 1X33A 3VBOC 4BCUA 5C9AC 3ZFEC 2R071 2HWB1 4GMP3 1MEC2 5ACA3 1ZBA3 1D4M1 1PIV1 1OHFA 1EV12 1RUE1 5K0UC 1NCRA 1TMF2 4CEYB 5C4WC 4FTBA 1QQP1 2RMU1 4CDWB 3VBRA 2TBVA 1AYM2 3J8F3 4Q4Y1 2HWE2 2RS11 4LLFA 1QJU1 1RHI1 2R062 1VBE3 4Z92B 1CD3G 1NOVA 3JD73 1V9U2 1RUI3 4RQPC 1W39A 1NCRB 2RS52 1FMD1 1QJZA 4JGYC 1AR62 3VBRB 4GMP1 1RMU3 5ACA1 5CFCA 1ZBA1 1PO22 2XBO2 3LOBA 1PGW1 5GKAC 4WM7C 3JD72 1RUD2 1RUI2 4Q4X2 1HXS3 1EAH3 3J8F1 3CJIA 4RFT0 4QPIC 1VBD3 1RUH2 4QPGA 1VBE1 5CFCB 1FPN2 1ASJ2 1OPOA 2HWD1 5C9AA 1RUF1 3VBUC 1K5MA 1RMU1 3CJIB 1RUJ2 1NY71 3HAGA 4Y4YA 4QPGB 4JGZC 2Y26A 1GFF2 5C9AB 1HXS1 1EAH1 4CDXC 1R092 4PDWC 1VBD1 3TN91 5DDJ3 2FZ2A 4GB33 1TME2 4RQPA 1RUG2 1K5MB 5BNPA 5D8AC 3DPRC 3NAPC 3ZFFA 1RVF3 1R1A2 4FTEA 4FTSA 4JGYA 4YVSC 1HQNA 1MQTC 3VBHC 1F8VA 1PO13 1AL22 5JZGC 1ND3A 1FOD1 2BPA2 2HWF2 4RHV1 1MEC3 2GSYA 2RM22 2DF7A 1QJY2 4RQPB 1CJDA 1EV13 2VQ0A 5BNPB 1TMF3 3M8LA 1VBC2 3ZFFB 1DDLA 1M06G 4JGYB 2BFUL 2RR12 1Z7S3 4N53A 1AYM3 5DDJ1 4GB31 1ND3B 4IV1C 1HRI2 2RS32 2R063 1RVF1 3JBG1 3VDDA 1V9U3 4CDQA 1POV3 3VBUA 2HWC2 2RS53 1PO11 5LK7B 4NWWA 4RS5A 1AR63 4IV3C 1MEC1 1Z7S2 4N53B 2WLPA 1PO23 1B35A 1VB2A 2XBO3 2ZTNA 3JB4C 1EV11 3S6PA 1TMF1 2WZR2 4CDXA 1VRH2 3VDDB 4CDQB 1BMV2 1RUD3 3VBUB 4Q4X3 1AYM1 1NCQA 2HWE1 4WM8C 3DPRA 3NAPA 4YVWC 1OOPC 4RS5B 1RUH3 1BBT2 2R061 3VBHA 1AR83 5FOJB 5L7OC 2R042 2MEV2 1FPN3 1V9U1 1C8M2 1POV1 1B35B 1PVC2 1ASJ3 5JZGA 2RS51 5AC92 4CDXB 1AR61 4CEWC 4Y5Z0 4GMP0 1X36A 1NCQB 1PO21 1VBA2 2XBO1 1BEV2 3DPRB 3NAPB 2PLV3 1RUJ3 3VBHB 1AR92 1AR82 1RUC2 4Q4W2 3JD71 1RUD1 1R082 1RUI1 4Q4X1 5JZGB 3VBOA 2QQPA 1AL0G 3ZFEA 1R093 1HRV2 1RUH1 1TME3 1RUG3 5ABJC 2XPJA 5CFDC 1AYN2 1FPN1 5K0UA 1ASJ1 5C4WA 4CEYC 1R1A3 2WFF2 2PLV2 1QJX2 4EJRA 1AL23 3VBOB 3ZFEB 2HWF3 5J96B 1PGL2 1RUJ1 2RM23 5FMOL 1SMVA 1QJY3 5K0UB 4NWVA 1VBB2 1H8TC 4WM8A 2WS92 1VBC3 5C4WB 4YVWA 1OOPA 1R091 3VBSC 2RR13 1AR72 5L7OA 2BFUS 3VBRC 1NA1C 1TME1 1RUG1 1HRI3 2RS33 1R1A1 4CEWA 4WM7A 1ZBE2 2HWC3 4AEDC 4WM8B 1AL21 2R073 4QPIA 4YVWB 1OOPB 1COV2 2HWF1 1HX6A 2RM21 5L7OB 4Q4V2 1D4M3 1PIV3 1QJY1 1VAKA 5A32A 2WZR3 1VRH3 4N43C 1VBC1 4CDUC 2RR11 4CEWB 4WM7B 5A33A 5ABJA 5BNNC 5CFDA 1ND2C 4QPIB 2R072 2HWB2 1HRI1 5BNOC 1BBT3 2RS31 3ZFGC 4JGZA 2R043 2MEV3 1C8M3 1D4M2 5A32B 1PIV2 1PVC3 1RUE2 2HWC1 5AC93 1QQP2 2BBVA 4PDWA 2RMU2 1Z7S1 4GH4C 5A33B 5CFDB 5ABJB 4Q4Y2 1K5MC 1VBA3 2RS12 1BEV3 1H8TA 1QJU2 5D8AA 1RHI2 2WZR1 3VBSA 1VRH1 4YVSA 1AR93 1MQTA 4JGZB 1RUC3 4Q4W3 1BMV1 1NA1A 1R083 3VBFC 1FMD2 5C8CC 4RR3C 1HRV3 4PDWB 2GH8A 1BBT1 2R041 5ACA2 2MEV1 1AYN3 1ZBA2 1C8M1 2HWD3 4AEDA 1PVC1 1A6CA 1H8TB 1POV0 1RUF3 2IZWA 5D8AB 5BNPC 5AC91 1PGW2 2WFF3 3VBSB 1QJX3 3ZFFC 2X5IC 4YVSB 1MQTB 3JB8A 1AUYA 1NA1B 2WWSA 3J8F2 1IHMA 4IV1A 1VBA1 1BEV1 1ND3C 4N43A 4CDUA 1AR91 1VBE2 1AR81 1RUC1 5FMOS 5BNNA 4Q4W1 1ND2A 4AEDB 1VBB3 2HWD2 1F2NA 1R081 2WS93 1RUF2 1HRV1 1AR73 5BNOA 3TN93 4IV3A 3ZFGA 4N53C 4CDWC 1RMU2 1AYN1 4IV1B 3IDEA 4SBVA 4N43B 4CDUB 1C8NA 2WFF1 2PLV1 1NY72 1QJX1 1ZBE3 3VDDC 4GH4A 5BNNB 4CDQC 1ND2B 1HXS2 1EAH2 1FOD3 1NCRC 5J98B 3ZXAC 1COV3 1VB4A 4RHV3 5BNOB 1RB8G 1PGL1 4IV3B 3ZFGB 4RS5C 1VBD2 3TN92 4Q4V3 3FBMA 3VBFA 1B35C 5C8CA 4RR3A 1VBB1 1E57A 2WS91 2ZAHA 1AR71 4GH4B
chains in the Genus database with same CATH superfamily
1AXZA 3D8CA 1W8WA 1U5YA 1V00A 2QBXA 3LEGA 3ETQA 3O5SA 1W6OB 2VMFA 4RHV2 4B3NA 2X5IA 2JDAA 2RDQA 5JLVA 1UZWA 3WINE 2IXKA 4XFGA 3LEKA 1ZBE1 2VH9A 4K9SA 1XBFA 3WF0A 4EN6B 3ZN6A 5I91A 5FZMA 3VDCA 1N3PA 1FATA 2VXRA 2WLQA 1DQ5A 1UX7A 3TWIA 3OGSA 5DUVA 1UXZA 2RMU3 2QZ2A 4FSJA 2K9ZA 1ENXA 3SCHA 1AHSA 3OTFA 4Q4V1 4UFLA 3ZYRA 1LU2A 2WR9A 2VD7A 1H2KA 5JOXA 1APNA 2YB7A 3FLRA 5K7PA 1YYNA 1IG3A 3WW1A 4CEYA 3AP4A 1RVF2 2B9VA 1VMFA 3WZ1A 3EQEA 1YIPA 4M3CA 1XNDA 4YW7A 4M3CE 1GQPA 1GQHA 2AEZA 1PO12 3U1XA 4AQ6A 1F4HA 1LTEA 2QQWA 2ZGNA 1DIWA 1HB1A 1HB2A 1VPHA 2VNRA 3NKGA 3OBTA 5FZAA 4UFJA 5A3OA 4EWEA 3VDBA 1N1YA 4Y20B 5C6CA 2AC1A 4GMP3 1OFNA 5FUIA 4MGQA 2A6XA 4LITA 3AMPA 4LXLA 3RWNA 5IWFA 1PIV1 5I93A 1OHFA 2JWPA 2O8OA 1W2AX 2XOMA 4OMDA 3B69A 1J1LA 4DUWA 3ZN5A 4MLOA 4YGCA 2E33A 2C26A 4NN0A 1EY2A 1DZRA 2RMU1 2JG9A 4CDWB 1D4VB 3NNFA 3VBRA 1Y4WA 3E97A 3J8F3 3KV9A 1IQDC 5IJRA 1HB4A 4TWTA 1JYWA 4NIDA 1CONA 2BP6A 4NMIA 4FPCA 2JDUA 4QX0A 4P5YA 5C3PA 2WNVC 1QU0A 4LUMA 2QQKA 1CD3G 1XJAA 4XYXA 2W95A 2ARAA 2H6BA 4B8EA 2UY9A 4RQPC 2ZGPA 4LO6B 1U12A 1NCRB 1W39A 2RS52 5T5OA 4XUQA 1YEWA 2LALA 2R16A 4BE3A 3BODA 3KB5A 4JRLA 1WW6A 4JGYC 1AR62 1PGSA 3ACHA 2Z79A 1OF3A 4GMP1 4IEXA 3BGAA 2ZGOA 4E8CA 5FYIA 3M70A 5FIXA 5FRAA 4P14A 1UU4A 4NIHA 1PGW1 4DQAA 1JODA 2WNUA 5GKAC 4I09A 3N7KA 4GALA 5FK7A 1SCSA 2ZGMA 4AGRA 1AX1A 4ZXKA 2RJKA 2J7MA 3PVEA 3K2OA 1HXS3 3J8F1 4XMAA 3P1IA 5EHDA 5IAXA 1I9RA 3SCFA 1VBD3 1SQ4A 2WN3A 5C70A 3DYMA 4I2OA 5L9VA 2OPWA 2XJTA 1ZZ8A 4QQHA 1YQCA 4JVAA 4BA6A 5CFCB 4CVUA 4KMQA 1OPOA 2QTWB 3F95A 5C9AA 1XXNA 4KG0A 5T5PA 3USUA 4META 2XDVA 5CB7A 3HMYA 4LBOA 5FZ8A 4B4PA 2BZDA 5FWJA 4YPJA 4DY5A 4NHYA 2PHWA 2JXAA 4N9IA 2AREA 4ES8A 3INAA 4NRQA 2VPVA 4QKBA 4X8PA 1UY2A 4Y22A 1TG7A 4RL7A 3PNAA 4O61A 2QE3A 4LBJA 4F3JA 3HAGA 3ACFA 4Y4YA 4JGZC 1E5SA 2AGSA 3AP5A 5IK8A 4BLIA 1GNYA 2Y26A 3DL3A 4HZFA 5E88A 3HT2A 4WVZA 4A3ZA 4QQ2A 1HXS1 3VHPA 4IDZA 1R092 2XG3A 3H7YA 4W6WA 3RPQA 1VBD1 2VUCA 2VECA 2VCBA 1QOOA 1QXJA 1TME2 3RWKX 2EXJA 2GNDA 3DXUA 2W1SA 3K3NA 3VHNA 1MPXA 2Y34A 3CKHA 4MGTA 4IQPA 2D97A 1RVF3 3GHNA 4QU1A 3HBKA 4GQ7A 4FTSA 1DZTA 3VBHC 4AAXA 1CZSA 1SLAA 1PO13 4IEOA 2D5FA 4LHLA 5LBEA 4D6QA 3CZUA 1S0IA 4QPYA 3H8RA 3AVSA 4A45A 3CEWA 2HWF2 3WR0A 4RHV1 3JUUA 1RIRA 3HNMA 2GSYA 1QDOA 2EIBA 3G6JB 4AE2A 4A7YA 1DGLA 3IPVA 4DIQA 3PIGA 3HD8B 4ARYA 1IGOA 1ZREA 4E4DX 4P02B 1F4AA 4IGPA 3SH3A 2J42A 5BXXA 3D3AA 1Z7S3 1NKGA 3I2JA 4UW5A 2VW1A 4CYDA 3I4IA 2D6NA 2VZ3A 4EN0A 2A3YA 2AYHA 1ND3B 2BNOA 3BALA 4IV1C 5JOZA 1HRI2 1PK6B 1LENA 2WQ8A 2RS32 3K4DA 2QZ3A 1RVF1 4XQ4A 4XBQA 2TEPA 1W6NB 2WNOA 2J1AA 2DVDA 3HWJA 3WQ7A 1BQPA 2HWC2 2RS53 1PO11 4XUPA 2W08A 3ZPYA 3B01A 3FLPA 4IEYA 1CAXB 2JENA 4PIYA 3UESA 4AVSA 1AR63 4E2GA 2WO7A 3LKJA 3SEPA 1W8UA 2WKKA 3UKNA 1WLWA 2OX0A 3LCPA 1JZ4A 1O5LA 1UYXA 1CESA 2DVBA 1LKNA 2ZTNA 2W39A 3VZJA 2C1FA 3MPPG 2RJ2A 1AF9A 1O59A 4IEQA 2VCAA 3VDDB 3DKQA 5I0SA 3LGRA 3VBUB 3KGLA 1Y3TA 4PHZA 1KS4A 1AJOA 2QQVA 2VU9A 5LY1A 1UX6A 2AEYA 1OOPC 4HKOA 2DUOA 4XTPA 4YGEA 5FZBA 1W90A 5FZ3A 5LB6A 4COYA 4ZKTB 3WUCA 4Y3OA 1KDKA 5EQUA 1AR83 5FOJB 4XFCA 2QQNA 3PJQA 3FUQA 1OI6A 1QJEA 2VVEA 5DAVA 1C8M2 5AFBA 2RS51 4YG0A 1IKQA 4N90A 2JKXA 4ASLA 3MFAA 1X9PA 3AC0A 1AR61 3I59A 4QGNA 4CEWC 4Y1YA 1KGYA 1ST8A 4XCAA 5F8PA 2ARXA 3PURA 4HSJA 4QKFA 4Q8LA 1A8MA 3NAPB 5FBZA 4OQ8A 5FO7B 3AZVA 3WXPA 3TEZA 4CU7A 4F7ZA 2O14A 1RUC2 1X8MA 2D5HA 3NSTA 2W91A 2B45X 3NVCA 3WEZA 1LNSA 3B9CA 4OQ9A 2OUJA 1SBEA 5FZGA 4D8MA 1GOGA 4KGQA 4LUKA 2K0GA 5JZGB 2PAMA 2GDFA 3FLTA 1GWMA 1R093 2JIJA 4AEMA 2HBUA 3VZNA 4MUVA 1I3HA 1WCQA 1TME3 2VBPA 1KITA 1AYN2 5FZDA 1LCLA 4Y1ZA 3QLQA 2JDPA 1IS3A 4CCDA 1JZ2A 3WG3A 4BZ4A 2C6SA 2JD9A 2FDHA 2WFF2 2E6VA 3IT8A 4COZA 2YBPA 4S2GA 1GNHA 3WQBA 2ZGQA 1W3VA 1T2XA 4Q0PA 1US3A 1H2MA 1Y9GA 4LKDA 2HWF3 1CGPA 2DU1A 4HXCA 2ETEA 1CVNA 2DBNA 2WNVA 2G9ZA 4AI0A 4C8DA 5DAQA 1G9CA 4NAMA 4KU8A 1ODMA 3OF1A 4LO8A 2AZ5A 3NW4A 2J1SA 3BTZA 1MS1A 3IKWA 4NWVA 4ET7A 3AFKA 2LS6A 1H8TC 2BGCA 1WUVA 2FQPA 1R091 1C3HA 1AR72 4OUEA 3WD5A 3GBFA 3VL9A 4ZZ5A 5L7OA 1N1TA 4PLNA 2MNGA 4HPKA 1TME1 1FV3A 4Y1XA 2W1QA 1HRI3 5KXDA 4MGKE 2RS33 4QX1A 1XYPA 2WBKA 3PUAA 1FNYA 4RGGA 4BQ2A 1UKGA 1DGRA 2JDHA 2HWC3 3NKTA 4Y33A 5D2AA 5C8WA 3L9JT 3A4UA 4WM8B 5H9PA 4YVWB 2Y0OA 2Y64A 2BNNA 5JMOA 5GZFA 2HWF1 4YW3A 1VJ2A 4Y26A 1UD1A 5FYZA 2WWUA 1HX6A 1PNGA 4L2NA 4UOJA 1WBLA 3WY6A 5A32A 5I0UA 3C7HA 2XLFA 1PX3A 4ZU4A 3Q8BA 5IVBA 2WFPA 3N9PA 1OXCA 5GZGA 1V6KA 2OQ6A 3JZVA 4FPEA 4WM7B 1W8TA 2Y38A 1LOAA 4Q0UA 4HVOA 3OGGA 5A33A 1ACCA 1OSGA 4XJZA 5CFDA 4YFZA 5ABJA 5J3UA 1MVEA 3MBWA 1G8WA 3HN3A 4GIQA 4XFIA 1OVSA 2VM9A 4I3GA 2HWB2 2FMYA 4X8NA 1HRI1 3ZKYA 3QH6A 3ZX7A 3LEIA 3DGTA 5FZ9A 2RS31 3MFCA 3MICA 2Q8CA 3ZFGC 5A3NA 3WV6A 1OBNA 4JGZA 1W28A 2BVBA 1C8M3 1D4M2 3KD4A 2HWC1 4A7ZA 3WQ1A 2BU9A 2QDRA 2WO2A 3JU9A 4AG4A 4AGGA 4D6RA 5JOWA 3K51A 5JVVA 4OHYA 5DG1A 5FPUA 3MLKA 1UOFA 3LF7A 2VZSA 5LCWL 1LHVA 1LHOA 1XC6A 4CUBA 1EUUA 3PTRB 5LASA 2ZXQA 4UFMA 1HJFA 4ORFA 4FCAA 2E7QA 2ZJCA 1RUC3 4AXOA 3NNMA 3OEBA 4LQRA 2PHDA 4CUAA 5FYSA 2QQIA 4D7SA 4G3YC 5EYYA 4NIIA 1JYXA 1FMD2 1GP6A 4K20A 5C8CC 1XE0A 3LDKA 3J7HA 1KXGA 4NPRA 4IEUA 4PDWB 2GH8A 4JRAA 4AGVA 3N7LA 1CR7A 3CBNA 3WCRA 2VOTA 3EB7A 5EJZB 2WNEA 3KVBA 4H7LA 5ACA2 1AYN3 4AFBA 1C8M1 1WLTA 1N1SA 2OPKA 2IZWA 5D8AB 2WC2A 2ZX3A 4L92A 4FFGA 5FYUA 2WFF3 4AWDA 3ZFFC 2EALA 4AK3A 4Q8KA 2X5IC 4YVSB 5A1LA 3MF6A 1FV2A 4XJUA 1H1IA 5A7QA 1UPIA 3J4UH 5CAZA 1ODNA 1V6NA 1NA1B 3FZ3A 2FCTA 3EXUA 2ZHNA 1W6MB 3CZJA 3PUQA 1MS8A 4QB1A 5JCTA 3BI3A 4IV1A 4KU7A 5FPXA 4MGYE 3RMXA 4BMBA 3WNNA 4XF4A 1ZA4A 5LBFA 1F9KA 2GNTA 5F2WA 3U4SA 3ZM8A 1BK0A 1H9PA 2IWGB 4LPLA 2K46A 2ZGUA 1RUC1 5FMOS 3SQOA 4Y1VA 2I2SA 4MXWA 2HWD2 2DYCA 3AKSA 3UETA 1RUF2 1V6IA 3N9LA 4FVVA 5GLTA 3SC7X 3ZYFA 1AR73 2ID4A 4NHKA 3TN93 4Y4RA 1WD4A 5DUWA 3DUIA 5JXIA 1WCSA 3AJZA 3UGHA 4G4FA 5L73A 2Y60A 3GGLA 4N53C 4BQ3A 4UBHA 3GBGA 1AYN1 5BY5A 2GNBA 3GDBA 4LKSA 1X8EA 4SBVA 3VD9A 3WUDA 3VD4A 2WFF1 4LBLA 4OI0A 3C7FA 4XHBA 1JBCA 3WW2A 4LBQB 4HONA 4CDQC 1ND2B 3MEPA 2Y8KA 1YUDA 4XBLA 1FOD3 1Q8OA 2DCZA 2ZKNA 3HQRA 2KA3A 4V1PA 3ZXAC 3HQUA 2XJVA 3E5XA 1QWRA 1LESA 4F83A 3UGFA 5BNOB 3OD4A 4RS5C 2VOKA 4O9EA 2SLIA 2EAAA 4NJ4A 3FBMA 4QB2A 5DXDA 3ATGA 1MS0A 3VBFA 2XJQA 2YGLA 3I3DA 1ZRIA 1NZCA 1W2TA 1W04A 1AR71 4HVQA 4S2FA 4ATFA 1Q8PA 1SLBA 3E1F1 4GH4B 3ZXEA 2VY0A 3WVJA 3S5AA 3U10A 5FMCA 3HJRA 1HIXA 4MO3M 4W50A 5C71A 3ZOIA 3FHIB 3ME2A 3ROUA 2HWB3 3KMHA 3AYEA 3MUZ1 3BUCA 4XQWA 3JBG3 5E16A 5DZFA 2RJLA 5LK5A 5IK7A 5IUQA 4Y5TA 2OW4A 1QMJA 5B4XA 3OPZA 4HSLA 2LUWA 4RR3B 3TEYA 4EWAA 3O1TA 4RFRB 5C5TA 3ITQA 3RGBA 2VL4A 1VE0A 3CL1A 4OLLA 3M2MA 2BOJA 2VMIA 1Y43B 4I3PA 3HT1A 1PZ9A 1GYKA 4P9WA 3WNKA 1CAUB 2ENRA 5J09A 3MIHA 1YNAA 1SCRA 4ZPIA 4NE9A 1NT0A 4FPHA 3WDVA 3MPBA 4YM0A 4O7XA 2F6BA 2VUAA 5D1IA 3UGGA 2DDUA 3O1SA 1FMD3 1PM7A 2HWE3 1WCDJ 2VO5A 3M1HA 3NMBA 3OOXA 3S5QA 4P08A 4BCUA 5C9AC 5FZKA 3T08A 3BOWA 2HWB1 1X82A 4ZU7A 2IXCA 4QDSA 5FLIA 1MEC2 3RZMA 3KCCA 3DN7A 5E8AA 2X29A 3JQWA 4OUMA 4EZHA 5ACA3 1HLCA 2NN8A 1D4M1 2PELA 4P9XA 1GOHA 1EV12 3DYOA 3K77A 1TMF2 2GH2A 5F32A 4DUVA 5K0UC 4FTBA 4YM1A 2ZS6B 3VZLA 1W6QB 4FP2A 5FTTC 3BPZA 4R52A 3ZXLA 2TBVA 2H0BA 3UK9A 3H42B 3R0RA 5IFTA 3ZR5A 1REFA 5HXVA 4E2SA 4LLFA 4IESA 1JH5A 2C0ZA 4CUCA 2GNMA 4BMEA 3AL6A 3HQXA 3FC0A 4OMCA 1OLRA 5LY2A 5SV8A 3T3YA 3P6BA 3S57A 3JD73 3T1LA 2IUWA 5EWSA 1V9U2 4K6BA 2WYSA 4QHZA 1RUI3 4PBPA 5FP4A 1LHUA 3RZJA 1DHKB 1FMD1 5EIYB 1CX1A 1QJZA 1FX5A 5FQ0A 5A7PA 2BGOA 3OPWA 2Y6FA 1JZ3A 4Y1UA 5A1FA 5APAA 3RZLA 2BEOA 4OULA 4TXWA 3THPA 1TE1B 4UF0A 5ACA1 1LHNA 2XBO2 1JI6A 1XE8A 3N35A 4NR1A 1RJ7A 3OB8A 2ZGTA 4KGGA 5B4NA 2N7GA 3BB6A 3IMMA 3SNMA 1GICA 5JXJA 1PX4A 5L19A 2D6KA 5F5CA 4JCKA 1K5JA 1RUD2 1W9YA 3WP3A 3WG1A 3VUOA 1DQ4A 2NM1A 5F3EA 5IW0A 3CJIA 2QNKA 4MSVA 1KFUL 4ASMB 3V0BA 5FO8B 4XXAA 1S0EA 4XF9A 4BM8A 4CCOA 1SPPB 2EXIA 2WT2A 4CCNA 4HKLA 1RXGA 3TEWA 3K46A 4QPGA 3MIGA 1CIYA 2W52A 4H3WA 2Q1FA 3V65A 1UIKA 2HWD1 2W47A 4WVMB 4CCEA 1YO8A 1RUF1 4W8JA 3ZYIB 4BPZA 1LHWA 1UZ0A 4XACA 1A8DA 3HNBM 4QD2A 2R6QA 2VC9A 3D82A 3MIDA 2YXSA 1WCKA 2BBAA 4CP9B 2Y6HA 4MGIE 2MPFA 5JSRA 5AVPA 4WVWA 2BNMA 2C9KA 3APBA 3T09A 4EN8B 1RTVA 4EV0A 1W0PA 2Z4FA 3D0JA 1DGWX 4XIOA 2ZABA 1AVBA 2EXKA 2XVGA 5CADA 4TYSA 1H6XA 1Z78A 4KG8A 1UYPA 3KV5A 1D0HA 3DECA 3H9AA 1GFF2 2Q8OA 1WCUA 1K45A 2BDRA 4JZRA 2FCVA 4M00A 4DINB 3AKRA 2EAKA 3BPSA 3W58A 4AVBA 1JZ6A 1I1EA 2DURA 3OYWA 4XHXA 2FHRA 2OIIA 5FPZA 5GLZA 5A7WA 3I2DA 4TLGA 5GALA 5G04L 4FPKA 1UCXA 3RYKA 3POGA 4ONUA 1K5MB 4Q5OA 1NYWA 3LSEA 1GNZA 3POSA 3VHOA 5M0TA 5KHKA 2ZOEB 2OUHA 2GC1A 4G9SB 4JTOA 3M7AA 3ZFFA 1XNCA 3OBAA 3WF1A 4FTEA 2Q30A 4B4QA 4LE4A 1MQTC 4LOTA 2AUYA 1OA2A 2JICA 4AVAA 1F8VA 1GMMA 4XDPA 5J37A 2VUDA 3K4AA 4P9IA 1AL22 5KHIA 1LOFA 4AW7A 1NLRA 1S0DA 1OKQA 5EXOA 1L7LA 4LO4B 4QM9A 1MEC3 5JIAA 2KR2A 2VULA 2DF7A 3ZYGA 2B39A 5ERLA 3S7EA 2VR4A 1ULPA 4RQPB 3QBQA 3KLSA 1EV13 5FYBA 5BNPB 1TMF3 3M8LA 3K3OA 4BLJA 2WWJA 1WW4A 1VBC2 2AR6A 5D21A 3T2TA 3KV6A 2R0FA 4MADA 5ANQA 4JGYB 5FYMA 1M06G 3CQOA 3VB9A 1SHWB 4AI3A 4LKFA 4XVHA 4N53A 3NV2A 5HXMA 4RGKA 1J3PA 4YNIA 3TNQA 4NPLA 1CPNA 1BVVA 3UNPA 4MGSA 2VOXA 1CQ9A 1D2SA 3MIBA 1JZ5A 2X53S 4CCCA 1KFXL 2NQYA 4HANA 4HETA 3LD8A 2YV8A 1V9U3 2EICA 4I01A 4CDQA 1XSRA 5FPLA 4DS0A 1LGCA 4L97A 5IVFA 1A3KA 1OA3A 1ULCA 1XPWA 2FMDA 5CISA 1CX4A 3KCYA 3THDA 5LK7B 4NWWA 3H50A 1GBGA 3ZMOA 4RS5A 4IV3C 2P3YA 3ILNA 1RYYA 1QH7A 1UQXA 1VMJA 1MEC1 1Z7S2 2QCSB 3AYCA 3I2FA 3K48A 4WZFA 4YW6A 2WLPA 2CGNA 3MUY1 4YWAA 5F37A 2XBO3 3JB4C 4W6YA 1W8HA 3NJVA 1EV11 4XABA 5CKMA 1TMF1 3WNMA 3H3UA 4CDXA 5J36A 2GP3A 4GWJA 1JYVA 5C3RA 3BCWA 4OCTA 4Z1VA 4QU2A 1US2A 2BWAA 1YQ5A 1RUD3 3JQXA 1HB3A 4GXLA 1UOJA 3O1PA 3AFGA 1H4HA 2QQLA 3W59A 5CNAA 4NVPA 3IIIA 1I6XA 3DPRA 5CEHA 1IS5A 1S0GA 1PZ7A 2GAUA 5L7OC 1NXD1 2X8KA 1V9U1 1MZ5A 1U0AA 1B35B 5LA9A 3RZKA 5LBCA 3DCQA 1WZXA 4AVTA 1LRHA 1KRIA 1E5RA 4XC9A 5E1RA 5KHHA 3ACGA 1YJLA 1Q8QA 2PXJA 3FX3A 2VZRA 4N9HA 4Q2FA 3HOBA 2BV4A 2FD8A 3BU7A 1FYUA 1H30A 3WHTA 1H0BA 2VNGA 1X36A 3KQ4B 1JOJA 4A4AA 1NCQB 2XBO1 4GJYA 1LB2A 1BEV2 4HLTA 3RYPA 3VKMA 2YFZA 4KI5M 4AQ2A 4OHZA 2PLV3 1MR5A 2CV6A 3FFQA 3NWKA 4FOQA 1V70A 5F3CA 1DQ0A 3VBHB 5FYVA 5L36A 1RB8G 1VR3A 2W68A 1AR82 3CHXA 4K8FA 3U14A 1RUD1 1R082 2QQPA 1AL0G 1YLLA 3I3MA 3PLQA 2CY6A 2NMOA 3UL2A 3V0AA 3EO6A 1XE7A 3GALA 1W2UA 4FP3A 2JG8A 1S2KA 2Y0IA 3WW4A 2WO1A 3CDZB 2ZGRA 4AHYA 5I0DA 1H2NA 4RGAA 4CTEA 5ABJC 5CFDC 3Q9OA 4QQOA 4HKWA 5K0UA 3POFA 3O1VA 3A7QA 3RVHA 2Z42A 4YLZA 4PI0A 2D43A 4YZ3A 3ZR6A 2QVSB 1J84A 2IXLA 3PHMA 1W8OA 2P6HA 3IAPA 3RS6A 5FZ6A 4BHPA 2XH6A 1AL23 2DFBA 3GHMA 3BVCA 2OYZA 3EHKA 3VBOB 1O6UA 2PFWA 3ZFEB 1ENRA 1YC61 4AHWA 2JB8A 3LFMA 4WV8A 4YZ2A 4JDOA 5LRRA 1PGL2 1NX9A 1V0AA 3N9QA 5BYNA 5FMOL 1SMVA 2V72A 2YY1A 5EP9A 5F39A 4P9LA 1U5IA 2PQSA 2CSGA 1LJ7A 4NHLA 1DGWA 1S0BA 1LULA 2VZVA 1VBC3 2WS92 3LDBA 4E8DA 5A3UA 1GU3A 5C4WB 1XNTA 2X10A 4UBGA 5F3IA 5IVJA 1M4WA 4E4HA 3PMSA 1WA4A 3QH7A 3OY8B 4JX0A 4QHOA 4AZZA 3IB3A 1OC1A 2P1BA 4HG6B 4D3WA 4C0HA 3RDIA 1E5IA 2ILMA 3FJSA 3WP5A 3OUIA 3LIGA 3MW4A 2VZ1A 3I7DA 3WF2A 4AF9A 4CPBD 5CBLA 5IT6A 1N47A 1ONAA 3NRUA 1SBDA 4UYBA 1IKPA 1AL21 2R073 1OOPB 3ZN4A 3KHBA 1COV2 2P34A 5LRSA 5JXHA 3D5OA 4XPVA 4QMAA 3E6BA 3RZHA 1UO9A 4Q26A 2GC3A 4UT5A 4ZS3A 2D44A 3ENRA 4GD4A 1DQ6A 1VBC1 2HEYF 4CU8A 2PYTA 4I30A 4CEWB 4TN7A 2VCMA 5CVRA 1GLHA 1OLMA 2CHHA 3B94A 4DZGA 1G9FA 1SLCA 1OLME 2OZ6A 4YZ1A 2L9LA 4NIGA 1TNFA 3ILFA 4M0HA 3WQ0A 4QPIB 5KXEA 1PM4A 4KBBA 5C33A 1ENQA 1G9BA 1DGRN 1C57A 4MOAA 3POEA 1YFWA 4LJHA 4IE6A 5F9TA 2G9GA 5JMCA 4YYOA 1XNKA 4H7MA 4JQRA 4MVTA 1CAWA 5F2SA 1UU6A 1UZVA 1RUE2 3WW3A 2P3JA 1DBNA 2YUEA 4LK6A 3ZKUA 4ARXA 3O0WA 5H9SA 4CXXA 3KHCA 4Q27A 1X50A 1Z7S1 1DYPA 2A6YA 4OZOA 1W9FA 2ZKLA 2XKOA 3LB9A 5IVEA 2RS12 3PUHA 1BEV3 2WT1A 5A7NA 1DZQA 3ZMNA 4OZXA 4BWOA 1RHI2 1ZRRA 3RMYA 5T3NA 1D0GA 5FP7A 3VBSA 4AVVA 1MQTA 3J9SA 2ZX4A 3WLUA 3OCPA 5FZOA 4BXSV 1H9WA 3GF6A 5EJ1B 1J3QA 4AHZA 1R083 3SH4A 3ALQA 4Y24A 3AKTA 3VBFC 3WP4A 1W6PB 2JX9A 4B4RA 1ZZ9A 2OS2A 5FXXA 1W8ZA 3GJBA 3NQHA 1YXWA 2V4VA 1HN0A 3JCIA 1HQWA 5KC6A 2JDYA 3R6SA 2GN7A 3LE0A 3RYRA 1QOSA 2PHFA 1ZBA2 2UYAA 4EN7B 3HBZA 1MACA 4AEDA 4D94A 1H8TB 1POV0 3FMGA 1CAVA 1F15A 3MYXA 4LK7A 2HH9A 1JYIA 4HT1T 1UPSA 4JAAA 1AUYA 1RL3A 1UOGA 2BGPA 1V6OA 1SDDB 4OHVA 4LHKA 3LEMA 3U11A 3IM0A 3V64A 2IVJA 1BEV1 1ND3C 4N43A 3O12A 2H6CA 2A70A 1PK6C 5FMBA 4RSUA 4CDUA 1JYTA 1YI7A 4XJWA 1DQ2A 4Q1RA 1LECA 3FUOA 1AR81 2PHXA 4YFWA 5DAPA 2JDZA 4BK5A 2J1VA 5A70A 1GZWB 3ES1A 4C1WA 5BNNA 1UMIA 1ULOA 1R081 4DXSA 2WS93 4XZUG 4EQVA 2CGPA 4YM2A 4KWUA 4JKMA 2ZBJA 4IV3A 4JDMA 4MYEA 3H1YA 1RMU2 2OA2A 1A78A 5LBBA 3BU0A 4QDQA 4YW5A 2D6LX 2Q0AA 5G05L 2GU9A 5A7OA 1C8NA 2W94A 4FFFA 1JUIA 2ZMNA 3ST7A 2DCJA 2P6CA 1YIFA 3VDDC 1QDCA 3B7MA 5EV7A 1EPWA 1GKBA 2ARBA 1CIWA 3OSDA 4XJ8A 1COV3 1VB4A 1W3XA 1JHJA 5CZKA 5J98B 3O1UA 1W6OA 1PGL1 3PIJA 3ZFGB 3TN92 2PQQA 1H6YA 3URFA 1YJKA 3ZO0B 4DRRA 1K42A 4XEZA 3SEEA 3IBMA 4KQ7A 2XMLA 3E6CC 2DUPA 3QD6A 3K75B 2E31A 2WS91 4QX3A 4CP2A 5JIUA 1V6MA 4HFSA 2GALA 1LAJA 1GP4A 3HIFA 1SLIA 4EYUA 3LA3A 4AI1A 5A6YA 1W8FA 4GAZA 3I3EA 5DUXA 1MZEA 3A22A 5FV3A 1FOD2 4E27A 1KS5A 4QB6A 1K12A 1JU4A 4HK8A 3C7GA 3IN9A 3RNSA 2WSVA 1AX0A 2E63A 3OUJA 3WX5A 1IPKA 1XQNA 5KC5A 3WDUA 1RUE3 4EROA 2VTXA 4AR2A 3PTYA 4NIAA 5C8CB 3ZSKA 2ZZJA 1COV1 2Y6GA 4L11A 1GWKA 3CNAA 3CIHA 3WF3A 3KQRA 2JD4A 4Y20A 1LOGA 5GZCA 3LQCA 1BHGA 4CE8A 2Y33A 3USSA 2W92A 4GB32 1NG0A 2PAEA 2RS13 4AVCA 4QX8A 4XTMA 4XFFA 1S0JA 3CJIC 1RHI3 3I2IA 2G4IA 3ZSJA 1WA6X 2X5IB 1G9DA 2ZZQA 2W9XA 2CTVA 4EN9B 3JBG2 3TYJA 4LBQD 5FZ7A 1D7PM 5DUUA 4QPGC 4CDWA 1JTZX 4JC1A 5FZEA 1JZ7A 4HMZA 3C7OA 2Y6JA 3ZN6B 1SACA 5CYYA 3AP9A 1ENSA 4ITCA 1SBFA 1GP5A 4IERA 1ZRDA 2VJXA 2P3IA 2YFUA 2D6MA 5T5JA 5T55A 2B42B 1IOAA 3WT3A 4R8HA 5A6QA 1ZBA3 1IG0A 5DN2A 1OD5A 1RUE1 1S1AA 4IE5A 1NCRA 3GNEA 1PZ8A 4CEYB 4V2WA 4BOWA 1JYCA 4O9GA 2NLRA 4M3CB 2JDMA 3T4VA 4CCLA 4DMIA 4X6RB 1AYM2 4EWDA 2QQJA 3TAYA 3ZIWA 2HWE2 2RS11 5AVAA 3TRSB 3B3QE 1RHI1 2WL1A 4OHWA 4QKNA 1SG3A 2NMNA 4JKKA 4YM3A 3Q8AA 2GMEA 5FKBA 1NOVA 2RDRA 3NNLA 2HYXA 2WZPP 2DUQA 1WMFA 3D4KA 4A41A 4ZY9A 4U36A 5FP3A 2VQUA 3OGJA 2JE7A 4IEVA 1DYOA 3T30A 5LEKA 4FQ4A 4D69A 3IDAA 1O8PA 2JG9B 5LA2A 3IIAA 3VBRB 2RG4A 4CZSA 4P9YA 1RMU3 2XWJB 5FK8A 4DO0A 5CFCA 1ZBA1 2WZEA 5FO9B 5JDBA 1PO22 2QJVA 4ES9A 1LGNA 1LOFC 2RE9A 3GZUC 2ZX2A 3SLIA 2JDNA 1CPMA 1W9SA 5FCCA 4D0QA 3MO4A 4BH9A 2BYVE 3DF0A 3T0BA 3CMGA 4HOOA 4WM7C 5C5UA 3JD72 3EMRA 2A71A 4DEVA 4BIFA 1RUI2 2BJSA 3H3LA 5DAWA 4RFT0 3WSOA 4INDA 3L2YA 4WVVA 3AP7A 1NLQA 1RITA 2RDNA 4FOYA 4LO5B 2EIGA 4QXHA 1O3SA 2V73A 4XW3A 1RUH2 4XFAA 1O4YA 3LWCA 1BVP1 1QJFA 4RYDA 3DYPA 4BQ4A 4IEZA 1GOFA 2WIIB 4P5HA 3ZDSA 3I97A 3MIEA 5E89A 1FPN2 4YW2A 2W0XA 5CA6A 4Q0QA 4GA9A 3OJBA 5DG2A 4LE3A 1S2EA 4FT8A 2WNUB 4N8MA 3FHQA 4FPJA 3ZYJB 1UL9A 1XNBA 3M3CA 3ABZA 4ISRA 4J25A 1O5UA 2ZAAA 5FZ1A 4Z8BA 1IPJA 2WN2A 2KD7A 2XL7A 4JDNA 4BK4A 3PDQA 1EUTA 1RMU1 4UI9L 5C3QA 4L0PA 3W5MA 4K3UA 1KEXA 2SBAA 4GKXA 4UFHA 5EJ3A 3Q8CA 1RJ8A 4IEPA 4KNCA 3G7DA 5EYXA 1YI9A 4BDVB 3FN9A 2LM3A 5FY8A 4OVEA 5IVCA 4YW4A 3N7MA 2XUMA 4I0WB 3RJ2X 5C9AB 4OUSA 3USUB 4QWNA 4CDXC 4NROA 1EP0A 3AB0A 4PDWC 3TN91 2ES3A 4UFIA 4GB33 5HV0A 4BISA 4BIOA 2ZHMA 3M3IA 1UY4A 4Y22B 5D8AC 4FPOB 2OT7A 5FFOC 3DPRC 5FYCA 3RG0A 3M3QA 4IXLA 3W9AA 2XB6C 3O0XA 5GJ6A 2FDIA 5FY1A 4YVSC 3N3HA 1HQNA 4XF3A 1PMHX 3WNOA 3ZXDA 3I3QA 4LBNA 3LOIA 5F6LB 4K7JA 3THTA 4R4ZA 4NAOA 2P2KA 4LNVA 3WDXA 4R9DA 2VQAA 2VXJA 3KT4A 4ZS2A 1ND3A 1WKYA 1FOD1 2BPA2 1PK6A 4RA0A 3KWVA 5CU1A 2XQRA 2W2IA 3P3PA 3O1RA 2IFWA 1RGSA 1W6NA 2CAUA 3N9MA 1QJY2 4FXKB 4SLIA 4DY3A 1QKQA 2FDGA 4O65A 1DYKA 1ZZCA 5JXGA 1BCXA 2VMHA 2O0OA 1CAXA 2Q1MA 4MV2A 4PLOA 2VW0A 1OUSA 2NZ9A 3TNPB 3VD5A 1DDLA 2RR12 1BK1A 1AYM3 5E6HA 2ET1A 4BQXA 3OD0A 4GB31 1RINA 4R9BA 4PF5A 4BYYA 4M4PA 4BQYA 2PHRA 1ZVFA 4E4SA 4Q29A 1JHNA 2JE8A 1SEFA 1QIQA 1H2LA 3ZXKA 1QXRA 5A6XA 1CN1A 1OQDA 2JG8C 3JBG1 2OQ7A 3NJXA 2ZEZA 3VDDA 5A6ZA 1POV3 2GMPA 3IPVB 3BIWE 3KSCA 3MW3A 5CIRA 3VBUA 3IAQA 2C9AA 2D3PA 3ACIA 4ZHNA 2VOVA 2EXHA 2B46X 1X7NA 2R32A 1VP6A 2OZJA 4Q0VA 4UW3A 3WHUA 1WLDA 4JHZA 4QXKA 1JZ8A 1GZ9A 1FAYA 3M4FA 4LBMA 4MZUA 1CJPA 1PO23 1G86A 3S6PA 2XHKA 3ZSEA 1LGBA 2B9UA 2WZR2 1S2BA 1U5ZA 1XB9A 1MVQA 3MI8A 3TEXA 3ZYBA 4C90A 1LOBA 2IC1A 2GMMA 5B2GB 4FFIA 2HBTA 5FZFA 4FBFA 2IVIB 3RRDA 1AYM1 2ZACA 4QM8A 3WDTA 2HWE1 5IVYA 3NAPA 4QT6A 4D7YA 4D7TA 1EYBA 2YMZA 1RUH3 3KF3A 3ZSLA 2EVXA 1ZX5A 3ETPA 4PT6A 4CP1A 2VZOA 3D6EA 1Q8SA 2R042 2G9FA 4C0BA 2MEV2 5FXVA 1FPN3 5KWRA 1POV1 2CU5A 4CPBA 1PVC2 1OH4A 3AZYA 4DXRA 5JZGA 4PF1A 1UY1A 5JUVA 4EE2A 5AC92 3BKZA 4A3XA 2F4LA 4QX2A 3AX4A 3HEIA 1RC6A 2R1BA 2BRTA 4QGLA 4Y5Z0 3KCXA 2BWCA 3NJZA 4GZ9A 1LU1A 3KGZA 2ZGKA 5I0TA 4LIVA 2GZWA 1GANA 1PO21 2P37A 3AMQA 5LATA 3HVDA 2RVAA 1HV1A 1UZZA 1O3TA 2ZMKA 1XU2A 1QF3A 3T1MA 3Q8EA 3ORJA 3NNGA 3JD71 1JOBA 2RDSA 1LOCA 3RZZA 1RUI1 1QOTA 3O1OA 1UU5A 3VKFC 2ZMLA 1RUH1 3I59B 4N7UA 3WCSA 2A6WA 3LA7A 2XKPA 3LFIA 2Q8EA 1KJLA 1FPN1 1Y9QA 3H7JA 5CKQA 5GZDA 4JKLA 4DXZA 1OMIA 4W65A 2PLV2 4LA2A 2WT0A 1ALYA 1KDMA 4EJRA 1DLCA 1VAMA 3AXDA 1NLSA 2XWBB 4QAWA 2YG0A 2EF6A 4IE4A 2P17A 1KD7A 5FR3A 1C5IA 2Q4SA 2OKXA 3U78A 3CF6E 1XYNA 1QJY3 2VGDA 4X6QB 4P9JA 1VRBA 2E7TA 5FXZA 4BQ1A 3TBDA 2ZX1A 2ZHLA 1VBB2 4AI8A 4WM8A 2YPJA 5JPMB 1UAIA 4YVWA 4E9KA 4DB5A 4URAA 4COWA 3ZXJA 3VBSC 2RR13 4H14A 1ULEA 2VNOA 5KR7A 4CRQA 3PVOA 2AACA 3SXWA 3ZIXA 2BFUS 2R49A 4UXAA 2KXLA 2LTNA 4XETA 5FYYA 3LDRA 2WINB 2J1RA 5GLWA 2X05A 1QHDA 1O91A 2CL2A 5JR7B 1GSLA 2WNVB 4K1ZA 1WMXA 4IGOA 3MGUA 1BXHA 1ZRFA 3WDWA 1ZZBA 4WM7A 2QUOA 1UWWA 3FE5A 2A6ZA 1Q8VA 2VW2A 3PMEA 5T52A 4XDQA 4AEDC 5JSPA 2X09A 3X29B 4CXYA 3POBA 4YW1A 1XU1A 1YFUA 3AYAA 3BTAA 2CNAA 2ADEA 2W1WA 2YBKA 1P8JA 1G9AA 5L7OB 1F5JA 3ZXGA 4B7EA 2TUNA 5DABA 1PIV3 1QJY1 1VAKA 3B00A 1O4TA 3H3ZA 4HPKB 3JXSA 4PI2A 1DLLA 1K3IA 4YARA 1ZNPA 5J1XA 2WZR3 3I2OA 3IDBB 1H1MA 4N43C 4Q0SA 4CDUC 1PMJX 2VCCA 3SKJE 2RR11 1AX2A 2J1UA 2RHPA 2YROA 2XJRA 4E4ZA 4NO4A 5BNNC 5H9QA 3U07A 3P3NA 3VKLA 4KWLA 2VVDA 3MW2A 1Y9MA 2R072 4R4XA 5LEJA 4C1XA 1WMEA 4D6SA 2UY8A 2QQMA 1HW5A 2W5FA 2F4PA 2R043 2MEV3 1H1AA 3U75A 4PIZA 5A32B 1PVC3 2AH2A 1N3OA 2HEWF 5AC93 2CWSA 3POWA 3VHRA 1QQP2 3PUIA 4PDWA 1LOEA 3OGVA 1IS6A 3OGRA 3I2HA 3W21A 5A33B 5ABJB 5CFDB 5FPBA 1NUKA 4FFHA 2G19A 4Q4Y2 1K5MC 1OURA 1YRZA 3SMHA 4QDRA 1Q5OA 1QJU2 2VMCA 4URTA 5D8AA 5CG8A 3O14A 2J1TA 4Z07A 2WZR1 3ZDVA 3P5BA 2YC2A 3RSJA 3SKVA 4YVSA 1CWPA 2YC0A 2XJSA 3AZWA 3RQ0A 4JGZB 3VD3A 1OQ1A 1MS4A 1DP0A 2ZCWA 1Y7BA 3DEMA 3VLBB 1NA1A 1UY0A 4XQDA 4KBZA 1X9TA 1W6MA 4YG6A 1HKDA 3R4UA 2CGOA 4K8RB 1FI2A 1QNWA 2ZHKA 3RI8A 4GJZA 2BERA 5F5AA 4IL7A 4I0AA 5JI9A 4PLMA 5T50A 1SLLA 2R041 1GUIA 1QNYA 2MEV1 4KWKA 3BYWA 3N36A 5A3TA 1PVC1 3R05A 5BNPC 5C3SA 1L3JA 1O4ZA 2DV9A 5C7GA 2B4KA 2ORZA 5AC91 3I2KA 5EFUA 4DFSA 5K4LA 1NQJA 4XOGA 5IFPA 3JB8A 4AFCA 4DUXA 1IZ3A 2NYYA 1STMA 3W20A 2WWSA 5DPNA 3T0AA 2ATFA 3LPFA 3QACA 5IHRA 4XCBA 4ATEA 1JW6A 4UFKA 4P00B 1J3RA 1F31A 4XJ9A 3S7IA 2ET7A 5F3GA 5DAXA 1VBE2 5LWBA 1IS4A 3KV4A 4LBQA 3ZVXA 1ND2A 3VGIA 3AK0A 1VBB3 1F2NA 4CCJA 3KF5A 3MZHA 1JXNA 2DU0A 2GP5A 5LA0A 5BNOA 1VIWB 4XFBA 5F6KA 4YZ5A 1A34A 2QDNA 3UV9A 3GZAA 4K1YA 4S2HA 2YHJA 1UZYA 4NRPA 4CDWC 3B5LB 4XAAA 1E5HA 4NHMA 1C28A 3UYJA 1AZDA 2C5DA 4IV1B 3FBYA 4MH0E 3IDEA 3I54A 1FXZA 2RV9A 3N4MA 4I0BA 4OI2A 2MHFA 1JOPA 3NV4A 4OI4A 2ARCA 2PLV1 1NY72 1VLNA 1V6LA 2WABA 1W0OA 2CDOA 2PHUA 4FPLA 4R9AA 4M4RA 1S0FA 4GH4A 5T54A 4PIXA 4DEQA 4MXWB 4H55A 5LA1A 2XXZA 1H4GA 1NCRC 1EAH2 2D93A 4PQ9A 4NUBA 4CCMA 4RHV3 3KVAA 4WBBA 2VVFA 1WWYA 3VZOA 4ASKA 2VQTA 1WW5A 1W03A 5I8TA 4JV4A 4XUTA 1B35C 4AFAA 3O7OA 5A3WA 4RR3A 1VBB1 1E57A 1UYYA 2DVFA 2PA7A 2ZAHA 2ZEYA 4B7KA 3CU7A 1NE6A 4PJYA 2DCKA 3F2ZA 4JQTA 5IK4A 3TOJA 1HN1A 1JUHA 3T2PA 1OH3A 2VNVA 5L9BA 1DFQA 2QQOA 4L99A 2WQ4A 1CAUA 1NCQC 3C2UA 2OVUA 4YRDA 4MHUA 5FUPA 4AOCA 4BB3A 5JOYA 1UOBA 2DVGA 4Z2AA 5JI7A 1JS9A 2BUKA 2FZ1A 3GBWA 2BTVC 3UKVA 1SFPA 2HYKA 2VG9A 3VBFB 1OQEA 5CFCC 5FP8A 1UN1A 3AJYA 1NQDA 1QQP3 4LA3A 1YCIA 3T2OA 1ULDA 3SCGA 1C1LA 4QGMA 1W2OA 4AEKA 4S2DA 1OUXA 2CDPA 2I45A 4LORA 3AZZA 4Q4Y3 5DDJ2 5J48A 4H2AA 2Z5WA 1QJU3 3KM5A 4L9BA 3MDPA 3N7JA 4K40A 5K8SA 1OVPA 3OEAA 3OBZA 2DCYA 2XVKA 1W6QA 3E5UA 1W9WA 1RUOA 4GWMA 5FP9A 2V4AA 2PAKA 4AAPA 1MZFA 4COUA 5A3LA 2YYOA 1XSQA 1X33A 3VBOC 1C4RA 3ZFEC 2R071 4BQ5A 2EIEA 2GC2A 3R4SA 3WP6A 1MS5A 2JEMA 1C1FA 4XBNA 4A44A 1F35A 2XLGA 3ZPOA 3ZYHA 5C4WC 1J58A 3WNPA 4WZCA 1QQP1 4P9GA 3HNYM 3MV11 2A7AA 2XONA 3ZLIA 2D3RA 2FBEA 1UMHA 3KT7A 4DRVA 4B29A 1WW7A 1FNZA 3LPGA 5IYYA 4Q4Y1 3DXTA 3VDAA 2VTFA 1QJU1 5GZEA 3VL8A 1ZA7A 2QFEA 2VZTA 3U37A 2R062 3A0KA 5FZLA 4Z2WA 1VBE3 1Z0HA 4Z92B 4J1WA 4XUNA 5JR2A 1W2NA 1T6GC 5FY5A 2WZ8A 4AQSA 4IE0A 1W99A 1XYOA 3HPNA 2ZEXA 2NP0A 1N1VA 1OD3A 5FLJA 1ULFA 3POYA 3CO2A 5L9RA 1SPPA 3VN4A 5A3PA 4LT5A 4CUGA 1XNAA 3H8OA 3B93A 1S55A 3GZTB 5FZ0A 3GZEA 1TVGA 4FAGA 2WUHA 4ZZ8A 3LOBA 2JJ6A 4WVMA 1UYZA 5FZCA 2JDKA 1PMIA 3GJAA 2UWCA 4QHBA 4CU9A 1TNRA 2B7YA 3THCA 2LROA 4YGBA 3I2GA 4Q4X2 2ZPXA 2E32A 1EAH3 5FREA 4LMFA 4CP9A 1REEA 4QPIC 3QOPA 5FQ0B 2UWBA 5FY7A 1ZRCA 3D0SA 1Q56A 4N7IA 2JE9A 1VBE1 4GWIA 3GCXA 4A42A 2A3WA 4A7KA 4UF0B 4DPNA 1ASJ2 3UJOA 2WA3A 2W87A 2WAAA 1W0NA 3O0VA 2D40A 4YSFA 1AXYA 3PVBB 4CU6A 2VBBA 3ACLA 5FWEA 2XJUA 2Y6LA 5FUNA 4TSVA 2UYBA 3BOPA 3VBUC 5BV6A 3IMNA 2OXBA 2VOWA 1K5MA 3PVNA 1MS3A 3CJIB 4OYUA 4QQPA 3WDYA 1Q3EA 3V0BB 1N3QA 4FPFA 4AFMA 3RZGA 3K4ZA 3BTXA 1HJGA 3AKPA 1RUJ2 2Q8DA 3GM8A 5GLVA 1NY71 5FJHA 1UNBA 3T0DA 4QPGB 3MHZA 5EPAA 5DZEA 5DMYA 4KL1A 2WSUA 4OHXA 5JWPA 1ZZ7A 5FMDA 3AP6A 3L2HA 1EAH1 4JHTA 3QCWA 3SISA 2H0VA 2W3JA 1WD3A 4XMIA 4AYUA 1J83A 4EZ4A 3R4DB 3AMNA 1V6JA 5DDJ3 3LIHA 4XUOA 2FZ2A 3POIA 4RQPA 1RUG2 3H0OA 4Z82A 5BNPA 1O3QA 5ANNA 3NAPC 4NHXA 3PU3A 2A73B 1R1A2 4COVA 5IATA 5FY4A 4JGYA 2HEVF 4RN5A 4BU2A 1OKOA 1RXFA 5FYHA 4I02A 1NE4A 5JZGC 1SDWA 4LLOA 4AI2A 3B9IA 1MZ6A 3C3VA 3ZSMA 2V5DA 3DKWA 2Q1ZB 2E53A 2LW8A 3OYWB 2VAUA 3J26N 2VMEA 4YG3A 1OF4A 1ULGA 3GXUA 3PJYA 2D98A 2RM22 4XXPA 5A7WB 1G6NA 4IW3A 1JMUB 4LEJA 1IPSA 1CJDA 2R7EB 2VQ0A 3V56A 2YGMA 1U5XA 1DCSA 2A6VA 3AKQA 5A80A 2FDFA 5FZHA 3ZFFB 3ECQA 3GYDA 4FQZA 4LHSA 5FY0A 2WA4A 2YU2A 2BFUL 4UAPA 2I74A 1UMZA 5BUVA 4JTNA 3RJRA 3NV3A 5CKNA 3NL1A 5DDJ1 1I5ZA 1Q43A 2JB4A 3OG2A 2I07B 1HDKA 1XOYA 2UWAA 4QXBA 1W8NA 4XURA 2R063 3WNXA 2WYFA 3FFZA 4MX3A 4NOTA 5A1AA 4AFDA 1IQAA 3RFRA 1SLTA 1UXXX 1DF0A 4XIKA 3C8XA 2FDKA 3Q8FA 1EPZA 3AVRA 1YWKA 3WOGA 2BQPA 5JAXA 1WMDA 2XHNA 2ZEWA 1WGPA 4N53B 4CP0A 4QKDA 1VB2A 1B35A 2DVAA 5JSOA 3E6DA 1O3RA 4CA9A 4LBKA 2PN5A 5A3MA 1VRH2 1BZWA 3RI9A 3HN1A 5F5QA 2B8MA 5I8SA 2ORXA 5FAXA 4LR4A 1JYNA 1G7YA 3H1MA 1J59A 1D2QA 1LR5A 4CDQB 1BMV2 3J7MA 4Q4X3 2PMWB 4GWNA 1DQ1A 2DBIA 2BVVA 1PNFA 1NCQA 2JIGA 4WM8C 1T6BX 3N9OA 3AZXA 4YVWC 4B1MA 2CWMA 1UIJA 3ILRA 4FPYA 3WNLA 4RS5B 1QXPA 2DTYA 4XZPA 3I8TA 1BBT2 1ZYBA 2E9QA 2J22A 2R061 2Y6KA 1W9TA 3VBHA 1LEMA 1S4CA 5I8YA 1ASJ3 1WBFA 5IVVA 2XVLA 3VKNA 4AEJA 4CDXB 1JU3A 3AXEA 2V09A 3SHRA 2VE1A 2V5YA 2VZUA 3I3BA 3VZKA 2IXIA 4QXCA 2G1MA 4GMP0 5A7SA 5HI0A 4TZDA 5IAVA 4AL9A 1VBA2 2O8QA 4KWJA 5FDBA 1YQ8A 3DPRB 2YBSA 4MGZE 5I0RA 1RUJ3 1GV9A 1HV0A 5IK5A 1AR92 1QH6A 2WRAA 1POQA 4PCRA 2XGXA 3MV01 4GULA 2XQXA 4Q4W2 2C24A 4Q4X1 4M01A 3TB0A 1TEIA 3VBOA 2A3XA 3H8UA 1YHFA 2JKBA 3EJKA 4ZXEA 1HRV2 2W46A 3ZFEA 4AQTA 4FOVA 4K21A 4ISQA 2XJPA 1L7RA 3M3EA 1R1ZA 5HCBA 3H8XA 3AL5A 4BQWA 1VAVA 1VALA 2VUJA 1RUG3 3WF4A 3ZXFA 5FKCA 2XPJA 2ZA9A 4XDOA 5FLHA 3A23A 1OA4A 4QX5A 1ASJ1 2XUEA 2A5ZA 4LOSA 5C4WA 4B1LA 3SITA 1I5PA 1R1A3 2VBDA 4CEYC 1BJQA 4UWDA 2IFRA 1QJX2 4PBOA 1KJRA 4HN0A 1GWLA 4A2UA 5K9YA 4IGQA 2EIDA 5JPNB 3OPTA 3OY8A 4TTGA 1H8VA 2HJIA 4V2VA 4LTAA 2VMDA 3V0AB 1YFYA 5J96B 3ES4A 1RUJ1 2RM23 2JG8B 2WDBA 4XILA 3S30A 2WAOA 3FHAA 3KS7A 4FO9A 1YQ2A 4AI9A 1CZVA 5K0UB 3LSDA 2D3SA 2P3KA 2C4XA 1BYHA 5F5IA 2TNFA 1OOPA 1SZBA 4YGDA 2F17A 4A6OA 4BXFA 3T2QA 5F1RA 3AMMA 2LRPA 1WLCA 2JG9C 1JN2P 3EYPA 3J7NA 3VBRC 1NA1C 2W1UA 4GKYA 1RUG1 3SH5A 2YC4A 5HBAA 5LZ6A 3S0MA 4FOWA 5SV5A 3CLPA 1C5HA 5FY9A 3J7LA 1TZOA 2XLAA 3N9NA 5GM0A 2VZPA 4M0NA 4CSWA 4MG2A 1OFSA 1R1A1 3PL0A 5EZWA 5T5LA 2VZQA 4MXVA 4CEWA 2KM2A 5HCAA 2HLEA 2D6PA 1ZBE2 2ZGLA 4QPIA 1UY3A 1YFXA 5FYTA 3PU8A 4IEWA 2YZ4A 2YU1A 1XRUA 4ZONA 5AFEA 3A21A 2RM21 4ZU5A 4Q4V2 1D4M3 1KQRA 1TQ5A 3ASIA 4LO7A 1DG6A 2B5HA 2P5BA 5KBFA 4DXTA 2FCUA 1VRH3 3NJYA 3AMHA 2HKXA 2WNUC 4IE7A 4J6GA 4AHXA 1QY4A 4KH9A 4HL0A 3U0ZA 2K2SA 1J1TA 3OBRA 1ND2C 1URXA 1S0CA 3MLLA 4XF1A 1OPMA 3C7EA 3UJQA 3BIEA 2Q5TA 1NAEA 4FPGA 4Y5SA 4HVRA 5FXWA 4XE9A 2UU8A 4TLFA 3UKTA 4Q1PA 5BNOC 5FOBB 1BBT3 3MF9A 1OT5A 3NNJA 4OFGA 3IDCB 2BW8A 3BTYA 5KXCA 2YDEA 4IETA 1PIV2 2DTWA 1DU3D 1NZIA 4J1XA 4LKEA 3VZMA 3IWZA 5KHJA 4RD7A 1SFNA 1W6PA 3IZOA 1UF2C 2BBVA 5DZGA 1R64A 2ADDA 4MHRA 3T4HB 2O1QA 5KHGA 3BN6A 2RMU2 5CG9A 4HN1A 2VMGA 2DFCA 3ELNA 4A6SA 4GH4C 1AXKA 2GC0A 5BPXA 5FZIA 2P4EA 3A0NA 1VBA3 4C91A 1W05A 4QX7A 1H8TA 3NV1A 2EA7A 4NRMA 4XAEA 2XL9A 3HR9A 1BLZA 4XFHA 1VMHA 2XR4A 1VRH1 1B09A 1AR93 3FWEA 1PHMA 3LZZA 1MS9A 1SFYA 4LIUA 1CAWB 4Q4W3 1BMV1 4NPMA 1GZCA 5ISLA 2D6OX 4RR3C 1HRV3 4R9CA 1OLQA 2Z69A 5HV4A 3MIFA 4UW4A 2A75A 1BBT1 3W5NA 1UKRA 1QEXA 3OUHA 2HWD3 1GZWA 4UW6A 2CAVA 5FJKA 1A6CA 1RUF3 1PGW2 4FXGB 1BKZA 2Z2SB 4QPWA 3VBSB 1QJX3 2E26A 4F8AA 4QQLA 5H9RA 4DOUA 1MQTB 4IUGA 4U2AA 1UW8A 4BJ0A 5FZOB 5HCFA 2VTXJ 2GN3A 3FL7A 2R0HA 4W6XA 3J8F2 1IHMA 3MLJA 3ON7A 3VKOA 2ZGSA 3WG2A 3NO8A 4L8QA 4PQQA 1VBA1 3LAGA 5FZ4A 3VD7A 1PVXA 4HBNA 2WJSA 5FBJA 2IXHA 2ZX0A 1AJKA 3EBRA 3H1WA 1AR91 1QGLA 5F7UA 2WQZC 4Q4W1 4AEDB 4FAHA 2PHLA 4HK9A 1CAVB 3CJXA 3DV8A 3M3OA 1HRV1 5TSWA 2QKDA 3ZFGA 5DQ0A 2UURA 2R1DA 1L7QA 4FI9A 1ZZ6A 2FDJA 1ZM1A 2D7FA 4N43B 3LA2A 4DNYA 1W06A 2IXJA 1GQGA 3POJA 4CDUB 2PTMA 5KXBA 1NXMA 3I49A 2NPIA 1QJX1 1GR3A 5GLUA 1O7FA 2E7AA 1ZBE3 3KZ4C 5BNNB 2DWRA 3VV1A 3B02A 1F5FA 3WG4A 3KT1A 2E51A 3PUSA 1GZTA 4XF0A 4E2QA 1LODA 1HXS2 3U4XA 2QQUA 3AM2A 3O1MA 1HQLA 1O8SA 2ERFA 3UT0A 4XJAA 5BNQA 5C3OA 5J7MA 5LW9A 4IV3B 5FPVA 1CZTA 1VBD2 3GCWA 3E5QA 2R30A 4LHNA 4Q4V3 5FPAA 3ZYPA 2AENA 1FT9A 2PHTA 5HCHA 5HPOA 1REDA 1LEDA 2BOIA 2WO3A 5C8CA 2JECA 4YZ4A 2J1EA 4CCKA 1YQ6A 4M3CF 1RUNA 2DCTA 4W4ZA 4LULA 2YPDA 4OI1A 4CXWA 2CYFA 3AYDA 2A1XA
chains in the Genus database with same CATH topology
1AXZA 3D8CA 3O5SA 1U5YA 1V00A 3ETQA 1W6OB 4RHV2 4B3NA 2X5IA 5JLVA 3WINE 2IXKA 4XFGA 1ZBE1 2VH9A 4K9SA 4EN6B 3ZN6A 5I91A 1N3PA 1FATA 2VXRA 2WLQA 1DQ5A 3TWIA 5DUVA 2RMU3 2QZ2A 4FSJA 2K9ZA 1ENXA 3SCHA 1AHSA 3OTFA 4Q4V1 3ZYRA 1LU2A 1H2KA 5JOXA 1APNA 3FLRA 5K7PA 1YYNA 3WW1A 4CEYA 3AP4A 1RVF2 3WZ1A 3EQEA 1YIPA 4M3CA 1XNDA 4M3CE 1GQHA 1PO12 4AQ6A 1LTEA 2ZGNA 1DIWA 2VNRA 3NKGA 3OBTA 4EWEA 1N1YA 4Y20B 5C6CA 4GMP3 1OFNA 2A6XA 3AMPA 3RWNA 1PIV1 5I93A 1OHFA 2O8OA 3B69A 1J1LA 3ZN5A 4MLOA 4YGCA 4NN0A 1EY2A 1DZRA 2RMU1 2JG9A 4CDWB 1D4VB 3VBRA 3E97A 3J8F3 4TWTA 1CONA 4FPCA 2WNVC 1QU0A 4LUMA 1CD3G 4XYXA 4B8EA 2H6BA 2UY9A 4RQPC 2ZGPA 4LO6B 1U12A 1NCRB 1W39A 2RS52 5T5OA 2LALA 2R16A 4BE3A 3BODA 3KB5A 4JRLA 1WW6A 4JGYC 1AR62 1PGSA 2Z79A 4IEXA 4GMP1 2ZGOA 3M70A 5FRAA 4P14A 1UU4A 1PGW1 4DQAA 2WNUA 5GKAC 4I09A 3N7KA 4GALA 1SCSA 2ZGMA 4AGRA 1AX1A 4ZXKA 2RJKA 3PVEA 1HXS3 3J8F1 4XMAA 1I9RA 3SCFA 1VBD3 1SQ4A 4I2OA 2XJTA 1ZZ8A 4QQHA 4JVAA 4BA6A 5CFCB 1OPOA 5C9AA 1XXNA 4KG0A 5T5PA 3USUA 4META 5CB7A 3HMYA 4LBOA 4B4PA 4DY5A 2PHWA 2JXAA 4N9IA 2AREA 4ES8A 3INAA 2VPVA 4Y22A 4X8PA 4RL7A 3PNAA 2QE3A 4LBJA 4F3JA 3HAGA 4Y4YA 4JGZC 2AGSA 3AP5A 5IK8A 4BLIA 2Y26A 3DL3A 4HZFA 5E88A 3HT2A 4WVZA 4QQ2A 1HXS1 3VHPA 1R092 2XG3A 3H7YA 4W6WA 3RPQA 1VBD1 2VECA 1QOOA 1QXJA 1TME2 2EXJA 2GNDA 3VHNA 4IQPA 2D97A 1RVF3 3GHNA 4FTSA 4GQ7A 1DZTA 3VBHC 1SLAA 1PO13 4IEOA 2D5FA 4LHLA 1S0IA 4QPYA 3CEWA 2HWF2 3WR0A 4RHV1 3JUUA 1RIRA 2GSYA 1QDOA 3G6JB 4AE2A 4A7YA 1DGLA 3IPVA 3HD8B 1IGOA 1ZREA 4E4DX 3SH3A 5BXXA 1Z7S3 4UW5A 4CYDA 2VW1A 3I4IA 2D6NA 4EN0A 2A3YA 2AYHA 1ND3B 2BNOA 3BALA 4IV1C 5JOZA 1HRI2 1PK6B 1LENA 2RS32 2QZ3A 1RVF1 4XQ4A 4XBQA 2TEPA 1W6NB 2DVDA 3HWJA 3WQ7A 1BQPA 2HWC2 2RS53 1PO11 2W08A 3ZPYA 3B01A 3FLPA 4IEYA 1CAXB 2JENA 4PIYA 4AVSA 1AR63 4E2GA 3LKJA 2WKKA 3UKNA 1WLWA 3LCPA 1O5LA 1CESA 2DVBA 1LKNA 2ZTNA 2W39A 3VZJA 2C1FA 3MPPG 1AF9A 4IEQA 3VDDB 5I0SA 3LGRA 3VBUB 3KGLA 1Y3TA 1KS4A 1AJOA 2VU9A 1UX6A 4XTPA 1OOPC 4HKOA 2DUOA 4YGEA 4COYA 4ZKTB 3WUCA 1KDKA 1AR83 5FOJB 4XFCA 3PJQA 3FUQA 1OI6A 2VVEA 1C8M2 5AFBA 2RS51 4YG0A 1IKQA 4N90A 4ASLA 3MFAA 4QGNA 1AR61 3I59A 4CEWC 4Y1YA 2ARXA 4HSJA 4Q8LA 1A8MA 3NAPB 5FBZA 5FO7B 3AZVA 3WXPA 4F7ZA 1RUC2 1X8MA 2D5HA 3NSTA 2B45X 3NVCA 3B9CA 2OUJA 1SBEA 5JZGB 4KGQA 4LUKA 2K0GA 2PAMA 2GDFA 3FLTA 4AEMA 1R093 3VZNA 4MUVA 1I3HA 1TME3 1KITA 1AYN2 1LCLA 4Y1ZA 3QLQA 1IS3A 3WG3A 4BZ4A 2WFF2 2E6VA 3IT8A 4COZA 4S2GA 1GNHA 2ZGQA 4Q0PA 1H2MA 2HWF3 2DU1A 2ETEA 1CVNA 2WNVA 4AI0A 1G9CA 4KU8A 3OF1A 4LO8A 2AZ5A 3NW4A 1MS1A 3IKWA 4NWVA 3AFKA 1H8TC 2BGCA 1WUVA 2FQPA 1R091 1C3HA 1AR72 3WD5A 3GBFA 3VL9A 5L7OA 1N1TA 4PLNA 2MNGA 4HPKA 1TME1 1FV3A 4Y1XA 1HRI3 5KXDA 4MGKE 2RS33 1XYPA 1FNYA 4RGGA 1UKGA 1DGRA 3NKTA 2HWC3 5C8WA 3L9JT 3A4UA 4WM8B 5H9PA 4YVWB 2Y0OA 2BNNA 5GZFA 2HWF1 4YW3A 1VJ2A 4Y26A 1UD1A 1HX6A 1PNGA 4L2NA 1WBLA 3WY6A 5A32A 5I0UA 2XLFA 4ZU4A 2WFPA 5GZGA 1V6KA 3JZVA 4FPEA 4WM7B 2Y38A 1LOAA 4Q0UA 4HVOA 3OGGA 5A33A 4XJZA 1OSGA 5CFDA 4YFZA 5ABJA 5J3UA 1MVEA 1G8WA 4GIQA 4XFIA 4I3GA 2HWB2 2FMYA 4X8NA 1HRI1 3ZX7A 3QH6A 3DGTA 2RS31 3MFCA 3MICA 3ZFGC 3WV6A 4JGZA 2BVBA 1C8M3 1D4M2 3KD4A 2HWC1 4A7ZA 3WQ1A 2QDRA 3JU9A 4AG4A 4AGGA 5JOWA 3K51A 5JVVA 4OHYA 5DG1A 3MLKA 1LHVA 1LHOA 4ORFA 4FCAA 2E7QA 2ZJCA 1RUC3 4AXOA 2PHDA 4D7SA 4G3YC 5EYYA 1FMD2 4K20A 5C8CC 1KXGA 4NPRA 4IEUA 4PDWB 2GH8A 4JRAA 4AGVA 3N7LA 1CR7A 3WCRA 2WNEA 4H7LA 5ACA2 1AYN3 4AFBA 1C8M1 1WLTA 1N1SA 2OPKA 2IZWA 5D8AB 2WC2A 2ZX3A 4L92A 2WFF3 4AWDA 3ZFFC 2EALA 4AK3A 4Q8KA 2X5IC 4YVSB 3MF6A 1FV2A 4XJUA 1H1IA 1UPIA 3J4UH 5CAZA 1V6NA 1NA1B 3FZ3A 3EXUA 2ZHNA 1W6MB 1MS8A 5JCTA 4IV1A 4KU7A 5FPXA 4MGYE 3RMXA 4BMBA 4XF4A 1ZA4A 1F9KA 2GNTA 1H9PA 2IWGB 2ZGUA 1RUC1 5FMOS 4Y1VA 2I2SA 4MXWA 2HWD2 2DYCA 3AKSA 1RUF2 1V6IA 4FVVA 5GLTA 1AR73 4NHKA 3TN93 1WD4A 5DUWA 3DUIA 1WCSA 3AJZA 4G4FA 5L73A 4N53C 4UBHA 3GBGA 1AYN1 5BY5A 2GNBA 4SBVA 1X8EA 3WUDA 2WFF1 4LBLA 4OI0A 4XHBA 1JBCA 3WW2A 4LBQB 4CDQC 1ND2B 3MEPA 1YUDA 4XBLA 1FOD3 1Q8OA 2DCZA 2ZKNA 3ZXAC 2KA3A 4V1PA 5BNOB 1RB8G 2XJVA 3E5XA 1QWRA 1LESA 4F83A 3OD4A 4RS5C 2VOKA 4O9EA 2SLIA 2EAAA 3FBMA 5DXDA 3ATGA 1MS0A 3VBFA 2XJQA 2YGLA 1NZCA 4HVQA 1AR71 4S2FA 4ATFA 1Q8PA 1SLBA 4GH4B 3ZXEA 2VY0A 3WVJA 3U10A 1HIXA 3FHIB 3ME2A 3ROUA 2HWB3 3KMHA 3AYEA 4XQWA 3JBG3 5E16A 5DZFA 2RJLA 5LK5A 5IK7A 5IUQA 2OW4A 1QMJA 3OPZA 4HSLA 2LUWA 4RR3B 4EWAA 3CL1A 4OLLA 3M2MA 2VMIA 1Y43B 4I3PA 3HT1A 1PZ9A 1GYKA 4P9WA 1CAUB 2ENRA 5J09A 3MIHA 1YNAA 1SCRA 4FPHA 3WDVA 3MPBA 4YM0A 2F6BA 2VUAA 5D1IA 1FMD3 1PM7A 2HWE3 1WCDJ 3M1HA 4BCUA 5C9AC 3BOWA 2HWB1 1X82A 4ZU7A 2IXCA 5FLIA 1MEC2 3KCCA 3DN7A 5E8AA 2X29A 3JQWA 4OUMA 5ACA3 1HLCA 2NN8A 1D4M1 2PELA 4P9XA 1EV12 5K0UC 1TMF2 2GH2A 4FTBA 4YM1A 2ZS6B 3VZLA 1W6QB 4FP2A 5FTTC 3BPZA 4R52A 3ZXLA 2TBVA 2H0BA 3UK9A 3R0RA 1REFA 5HXVA 4E2SA 4LLFA 4IESA 1JH5A 2C0ZA 2GNMA 4BMEA 3HQXA 3FC0A 5SV8A 1OLRA 3JD73 3T1LA 5EWSA 1V9U2 4K6BA 1RUI3 4PBPA 1LHUA 1DHKB 1FMD1 1QJZA 1FX5A 5FQ0A 4Y1UA 2BEOA 4OULA 3THPA 1TE1B 5ACA1 1LHNA 2XBO2 1XE8A 3N35A 4NR1A 1RJ7A 4KGGA 2ZGTA 2N7GA 3BB6A 3SNMA 1GICA 5L19A 2D6KA 4JCKA 1RUD2 3WP3A 3WG1A 3VUOA 1DQ4A 2NM1A 3CJIA 2QNKA 4MSVA 1KFUL 4ASMB 3V0BA 5FO8B 4XXAA 1S0EA 4XF9A 4BM8A 2EXIA 2WT2A 4HKLA 4QPGA 3MIGA 2W52A 4H3WA 3V65A 1UIKA 2HWD1 4WVMB 1YO8A 1RUF1 3ZYIB 4BPZA 1LHWA 1A8DA 4QD2A 2R6QA 3D82A 3MIDA 2YXSA 1WCKA 4MGIE 2MPFA 5JSRA 5AVPA 4WVWA 2BNMA 3APBA 4EN8B 4EV0A 1RTVA 1W0PA 3D0JA 1DGWX 4XIOA 2ZABA 1AVBA 2EXKA 2XVGA 5CADA 4TYSA 1Z78A 4KG8A 1D0HA 3H9AA 1GFF2 2Q8OA 4M00A 4DINB 3AKRA 2EAKA 3W58A 1I1EA 4AVBA 2DURA 3OYWA 4XHXA 2FHRA 2OIIA 5FPZA 5GLZA 3I2DA 5GALA 4FPKA 1UCXA 3RYKA 4ONUA 1K5MB 1NYWA 3LSEA 1GNZA 3POSA 3VHOA 5KHKA 2ZOEB 2OUHA 2GC1A 4G9SB 4JTOA 3M7AA 3ZFFA 1XNCA 4FTEA 2Q30A 4B4QA 4LE4A 1MQTC 2AUYA 1OA2A 2JICA 4AVAA 1F8VA 5J37A 4P9IA 1AL22 5KHIA 1LOFA 4AW7A 1NLRA 1S0DA 1OKQA 5EXOA 4LO4B 4QM9A 1MEC3 5JIAA 2VULA 2DF7A 3ZYGA 2B39A 3S7EA 4RQPB 3QBQA 3KLSA 1EV13 5BNPB 1TMF3 3M8LA 4BLJA 1WW4A 1VBC2 2AR6A 3T2TA 1M06G 2R0FA 4JGYB 4AI3A 4N53A 3NV2A 4YNIA 1J3PA 3TNQA 1CPNA 1BVVA 2VOXA 1CQ9A 1D2SA 3MIBA 2X53S 1KFXL 2NQYA 4HANA 4HETA 2YV8A 1V9U3 4I01A 4CDQA 4DS0A 1LGCA 4L97A 1A3KA 1OA3A 1ULCA 2FMDA 1CX4A 3KCYA 5LK7B 4NWWA 3H50A 1GBGA 3ZMOA 4RS5A 4IV3C 3ILNA 2QCSB 1QH7A 3AYCA 4FOYA 1MEC1 1Z7S2 4WZFA 3K48A 4D94A 2WLPA 2CGNA 2XBO3 3JB4C 4W6YA 1EV11 1TMF1 3H3UA 4CDXA 5J36A 3BCWA 4Z1VA 4QU2A 2BWAA 1RUD3 3JQXA 4GXLA 3AFGA 1H4HA 3W59A 5CNAA 4NVPA 1I6XA 3DPRA 1IS5A 1S0GA 1PZ7A 2GAUA 5L7OC 1NXD1 2X8KA 1V9U1 1MZ5A 1U0AA 1B35B 4AVTA 1LRHA 1KRIA 5E1RA 5KHHA 4N9HA 1YJLA 1Q8QA 3FX3A 4Q2FA 3BU7A 1FYUA 1H30A 3WHTA 1H0BA 2VNGA 1X36A 1JOJA 1NCQB 2XBO1 1LB2A 1BEV2 4HLTA 3RYPA 3VKMA 4AQ2A 4OHZA 2PLV3 1MR5A 2CV6A 3FFQA 3NWKA 4FOQA 1V70A 5L36A 1DQ0A 3VBHB 1VR3A 2W68A 1AR82 4K8FA 1RUD1 1R082 2QQPA 1AL0G 1YLLA 3PLQA 2CY6A 2NMOA 3UL2A 3V0AA 3EO6A 1XE7A 3GALA 1W2UA 4FP3A 2JG8A 1S2KA 2Y0IA 3WW4A 4AHYA 2ZGRA 1H2NA 4RGAA 5ABJC 5CFDC 3Q9OA 4QQOA 4HKWA 5K0UA 2Z42A 4YLZA 2D43A 4YZ3A 2QVSB 2IXLA 3PHMA 3RS6A 4BHPA 2XH6A 1AL23 2DFBA 3GHMA 2OYZA 3VBOB 3EHKA 2PFWA 3ZFEB 1ENRA 4AHWA 4WV8A 1PGL2 4YZ2A 4JDOA 5LRRA 5BYNA 5FMOL 1SMVA 2YY1A 4P9LA 1U5IA 1LJ7A 4NHLA 1DGWA 1S0BA 1LULA 2WS92 1VBC3 5C4WB 1ZRCA 4UBGA 1M4WA 3PMSA 1WA4A 3QH7A 3OY8B 4D3WA 4C0HA 3RDIA 2ILMA 3FJSA 3WP5A 3MW4A 4AF9A 3I7DA 5CBLA 5IT6A 1N47A 1ONAA 1SBDA 1IKPA 1AL21 2R073 1OOPB 3ZN4A 1COV2 2P34A 5LRSA 3D5OA 4XPVA 4QMAA 3E6BA 4Q26A 2GC3A 2D44A 3ENRA 1DQ6A 1VBC1 2HEYF 2PYTA 4I30A 4CEWB 5CVRA 1GLHA 3B94A 4DZGA 4YZ1A 1G9FA 1SLCA 2OZ6A 1TNFA 3ILFA 4M0HA 3WQ0A 4QPIB 5KXEA 4KBBA 5C33A 1ENQA 1G9BA 1DGRN 1C57A 1YFWA 5F9TA 2G9GA 5JMCA 4YYOA 1XNKA 4H7MA 4JQRA 4MVTA 1CAWA 1UU6A 1RUE2 3WW3A 2P3JA 1DBNA 2YUEA 3O0WA 5H9SA 4Q27A 1X50A 1Z7S1 1DYPA 2A6YA 2ZKLA 2XKOA 3LB9A 2RS12 1BEV3 2WT1A 1DZQA 3ZMNA 4OZXA 4BWOA 1RHI2 1ZRRA 3RMYA 5T3NA 1D0GA 3VBSA 4AVVA 1MQTA 3J9SA 2ZX4A 3WLUA 3OCPA 1H9WA 3GF6A 1J3QA 4AHZA 1R083 3SH4A 3ALQA 4Y24A 3AKTA 3VBFC 3WP4A 1W6PB 2JX9A 4B4RA 1ZZ9A 1YXWA 5KC6A 3JCIA 1HQWA 3R6SA 2GN7A 3RYRA 1QOSA 2PHFA 1ZBA2 2UYAA 4EN7B 3HBZA 1MACA 4AEDA 1H8TB 1POV0 3FMGA 1CAVA 3MYXA 1JYIA 4HT1T 1UPSA 4JAAA 1AUYA 1RL3A 1V6OA 4OHVA 4LHKA 3U11A 3IM0A 3V64A 1BEV1 1ND3C 4N43A 3O12A 2H6CA 2A70A 1PK6C 4CDUA 4RSUA 1YI7A 4XJWA 1DQ2A 4Q1RA 1LECA 3FUOA 1AR81 2PHXA 4YFWA 5BNNA 2JDZA 1GZWB 3ES1A 4C1WA 1R081 2WS93 2CGPA 4YM2A 2ZBJA 4IV3A 4JDMA 4MYEA 3H1YA 1RMU2 2OA2A 1A78A 4YW5A 2D6LX 2Q0AA 2GU9A 1C8NA 1JUIA 2ZMNA 3ST7A 2DCJA 1YIFA 3VDDC 1QDCA 3B7MA 5EV7A 1EPWA 1GKBA 2ARBA 1CIWA 4XJ8A 5J98B 1COV3 1VB4A 1W6OA 1PGL1 3ZFGB 3TN92 2PQQA 3URFA 1YJKA 3ZO0B 4DRRA 4XEZA 3IBMA 4KQ7A 3E6CC 2DUPA 3QD6A 2WS91 4CP2A 5JIUA 1V6MA 4HFSA 2GALA 3HIFA 1SLIA 3LA3A 4AI1A 5DUXA 1MZEA 1FOD2 4E27A 1KS5A 4HK8A 3IN9A 3RNSA 2WSVA 1AX0A 2E63A 3WX5A 1IPKA 1XQNA 5KC5A 3WDUA 1RUE3 4EROA 3PTYA 5C8CB 3ZSKA 2ZZJA 1COV1 4L11A 3CNAA 3KQRA 2JD4A 4Y20A 1LOGA 5GZCA 3USSA 4GB32 1NG0A 2PAEA 2RS13 4AVCA 4XTMA 4XFFA 1S0JA 3CJIC 1RHI3 2G4IA 3ZSJA 2X5IB 1G9DA 2ZZQA 2CTVA 4EN9B 3JBG2 3TYJA 4LBQD 5DUUA 4QPGC 4CDWA 1JTZX 4JC1A 4HMZA 3ZN6B 1SACA 3AP9A 1ENSA 4ITCA 1SBFA 4IERA 1ZRDA 2P3IA 5T5JA 2D6MA 5T55A 2B42B 1IOAA 3WT3A 4R8HA 1ZBA3 1OD5A 1RUE1 1S1AA 1NCRA 3GNEA 1PZ8A 4CEYB 4BOWA 1JYCA 4O9GA 2NLRA 4M3CB 4DMIA 4X6RB 1AYM2 4EWDA 3TAYA 3ZIWA 2HWE2 2RS11 5AVAA 3TRSB 3B3QE 1RHI1 2WL1A 4OHWA 2NMNA 4YM3A 2GMEA 1NOVA 2WZPP 2DUQA 1WMFA 3D4KA 4U36A 3OGJA 2JE7A 4IEVA 5LEKA 4FQ4A 4D69A 2JG9B 3IIAA 3VBRB 4CZSA 4P9YA 1RMU3 2XWJB 5CFCA 1ZBA1 5FO9B 5JDBA 1PO22 2QJVA 4ES9A 1LGNA 1LOFC 2RE9A 3GZUC 2ZX2A 3SLIA 1CPMA 5FCCA 4BH9A 2BYVE 3DF0A 4WM7C 3JD72 2A71A 4BIFA 1RUI2 4RFT0 4INDA 3L2YA 4WVVA 3AP7A 1RITA 4LO5B 2EIGA 1O3SA 2V73A 4XW3A 1RUH2 4XFAA 1O4YA 3LWCA 1BVP1 4IEZA 2WIIB 4P5HA 3ZDSA 3MIEA 5E89A 1FPN2 4YW2A 2W0XA 5CA6A 4Q0QA 4GA9A 3OJBA 5DG2A 4LE3A 4FT8A 2WNUB 4FPJA 3ZYJB 1UL9A 1XNBA 3M3CA 4ISRA 1O5UA 2ZAAA 4Z8BA 1IPJA 2XL7A 4JDNA 1RMU1 4K3UA 2SBAA 4GKXA 5EJ3A 4IEPA 1RJ8A 4KNCA 5EYXA 3G7DA 1YI9A 2LM3A 4OVEA 4YW4A 3N7MA 2XUMA 4I0WB 3RJ2X 5C9AB 4OUSA 3USUB 4CDXC 1EP0A 3AB0A 4PDWC 3TN91 2ES3A 4GB33 4BIOA 2ZHMA 3M3IA 4Y22B 5D8AC 4FPOB 5FFOC 3RG0A 3DPRC 3M3QA 4IXLA 3W9AA 2XB6C 3O0XA 5GJ6A 3ZXDA 4YVSC 3N3HA 1HQNA 4XF3A 4LBNA 3LOIA 5F6LB 4K7JA 3THTA 4R4ZA 2P2KA 4LNVA 3WDXA 4R9DA 2VQAA 3KT4A 1ND3A 1FOD1 2BPA2 1PK6A 4RA0A 5CU1A 3P3PA 2IFWA 1RGSA 1W6NA 2CAUA 4FXKB 1QJY2