1RMU2

Three-dimensional structures of drug-resistant mutants of human rhinovirus 14
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Three-dimensional structures of drug-resistant mutants of human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rmu200
2HWC1 1PO11 4RR3C 5BNNC 2RS52 3VDDB 4CEYC 1PIV1 1X36A 1DDLA 1AUYA 4Q4X2 1FMD1 1B35C 1V9U1 4CDUA 1RMU3 2HWC2 5ABJA 1PO12 1AR61 4GB31 4N53B 1BMV2 1HRV1 4Y4YA 1AL0G 1PIV2 1ND3C 2WFF2 5CFDA 1RUD1 1PGL1 1V9U2 1VBE2 5FMOL 1ZBE3 5C4WB 1EV12 3S6PA 4GB32 1RUE2 1NCQA 5ACA3 1PVC1 3VBOC 1NG0A 1TMF1 2GH8A 1RHI2 3VDDC 5DDJ3 1PGL2 2WZR3 5C9AC 3ZFFA 2MEV3 5LK7B 1QJY3 4Q4Y3 1PVC2 1TMF2 1EAH3 3TN92 1AYM3 2RR11 1CD3G 2RS33 4NWVA 2HWB1 2FZ1A 5C4WC 1COV1 4LLFA 4GMP1 1VBD1 4IV1A 4GH4C 4N43B 3NAPA 2RR12 2RM21 1SMVA 4RHV1 2WLPA 4Y5Z0 1RUJ3 2ZAHA 1NA1B 2HWB2 2XBO1 1COV2 5BNPB 2RS11 1C8M3 1VBD2 1ND2A 1OOPB 4FTEA 2RM22 4RHV2 4YVWA 1FPN3 2RMU3 1VBB3 5K0UC 1TME3 1W39A 2X5IC 2PLV1 3JB4C 4IV3A 3CJIB 3VBFB 2BFUL 3ZFEA 1ASJ3 2RS12 2BPA2 1RMU1 4N43C 1BEV2 1MEC3 5FMOS 5D8AB 5AC93 4CDXB 4NWWA 1RUG2 2PLV2 1K5MC 4QPGB 5BNPC 1QJU3 5C8CB 1ZBE1 1FOD3 4RR3B 5BNNB 4GMP0 4IV1C 1MQTB 5ACA1 1H8TB 1HX6A 1AR93 1AYN3 3VBSB 2HWF2 4FTBA 5J96B 5DDJ1 1B35B 3VBFC 4RS5A 1ZBE2 1VRH3 4YVSC 1AR83 2MEV1 2ZTNA 5JZGC 1PO23 1QJY1 2WS93 2WWSA 3JD73 1RUH3 5ACA2 1EAH1 4CDXC 1Z7S3 1RVF3 4QPGC 3VBUA 5DDJ2 2FZ2A 4AEDB 1RUI2 4CDQB 2MEV2 3VBOB 1MQTC 1H8TC 4QPIB 3VBSC 2ZZQA 5C9AB 4Q4V3 3VBHA 1RUF3 1NCRA 3J8F3 5J98B 1C8M1 1D4M1 4WM7A 4CEWA 4N53A 1FMD2 1AL21 2R073 2BFUS 1FPN1 3M8LA 1VBB1 1TME1 4AEDC 4CDQC 1AR62 1ASJ1 1HRV2 5ABJB 1D4M2 4QPIC 5GKAC 5CFCA 4GH4B 1RUD2 2R043 1R091 1VBC3 1AL22 1FPN2 1R081 1MEC1 1VBB2 1NY71 3VBUC 1TME2 4CDWA 4PDWA 1ASJ2 1POV3 1QJU1 1HXS3 4WM8A 1FOD1 1R092 5BNOA 5K0UB 1R082 3DPRA 1AR91 2X5IB 1AYN1 4CDUC 3ZFFB 3VBHC 2BBVA 5ABJC 1QJU2 3LOBA 1AR81 4CEWC 2WS91 1QQP3 5CFDC 2RS53 1RUH1 1HQNA 3ZFGA 1AYN2 1NOVA 1K5MB 1Z7S1 1RVF1 4JGYA 1CJDA 1R1A3 1NCQC 1PO13 3FBMA 4IV1B 3IDEA 2WS92 3NAPB 1RUH2 3VBRA 4RFT0 1AR73 2WFF3 2XBO2 3ZFFC 4SBVA 3HAGA 1VBE3 5L7OA 3JB8A 4Q4V1 4YVSB 1RUF1 5JZGB 1EV13 4JGZA 2HWE3 1RUE3 1ZBA3 1RHI3 4YVWB 5A33A 3DPRC 5D8AA 2R071 1VB4A 4IV3B 1M06G 1RMU2 3ZFEB 1A6CA 5A32A 4Q4V2 1OPOA 1RUF2 5C8CA 1VBA3 3NAPC 4RR3A 5BNNA 3TN93 2R063 2Y26A 4CEYA 2R041 1VBC1 2WZR1 1B35A 1ND2C 4Q4Y1 1QJX3 1F8VA 1POV1 1HXS1 4YVWC 1VB2A 1AYM1 3VBRC 1ND3A 1VBC2 2WZR2 4IV3C 4EJRA 2HWB3 2RS31 3ZFEC 1IHMA 1RUC3 5L7OC 4RQPA 1QJY2 4Q4Y2 4GMP3 1VBD3 1EAH2 1AYM2 2RM23 3VDDA 1HRI3 1F2NA 1C8NA 2XPJA 4Q4W3 1QQP1 1RUJ1 2RS51 3VBUB 2RS32 2RS13 1R1A1 1RB8G 1BEV3 2RMU1 1BMV1 1QQP2 1RUJ2 1PGW1 3JBG3 1AR71 2WFF1 4CDUB 4RS5C 1RUG3 1BBT3 2PLV3 3VBHB 1NCRB 1VBE1 1C8M2 5C4WA 1R1A2 1EV11 4WM7B 4CEWB 1POV0 2HWE1 5CFDB 1RUE1 2RMU2 4GH4A 1PGW2 1ZBA1 1RHI1 5AC91 1AR72 2HWF3 4FTSA 3ZXAC 4RQPC 1NCQB 2HWD3 2VQ0A 5CFCB 2HWE2 1MEC2 1VBA1 1NY72 2GSYA 1ZBA2 5AC92 3TN91 5K0UA 2R061 1WCDJ 2X5IA 1NCRC 4Z92B 4CDWB 1RUI3 1VRH1 4PDWB 1FOD2 1PO21 4WM7C 4WM8B 1QJX1 4N53C 3JD71 4N43A 1VBA2 1AR92 1QJZA 5BNOB 4Q4X3 2R062 3DPRB 1NA1A 1K5MA 5BNPA 2HWC3 1VRH2 1RUC1 1AR82 1OOPA 1PO22 5CFCC 1QJX2 3JD72 1PIV3 1Z7S2 1FMD3 1RVF2 1X33A 3ZFGB 1HRI1 1V9U3 4Q4W1 3CJIA 4JGYB 3VBFA 4CDWC 4PDWC 1RUC2 1AR63 1ND2B 4GB33 2QQPA 3J8F1 1HRV3 4WM8C 4YVSA 1D4M3 5JZGA 5BNOC 1RUD3 3VBRB 1AL23 1HRI2 4CDXA 1BEV1 4Q4W2 4QPGA 3JBG1 5L7OB 1VAKA 1GFF2 1BBT1 1RUG1 3J8F2 1PVC3 1TMF3 4JGZB 4FSJA 1MQTA 1H8TA 1R093 3VBSA 3ZFGC 5A33B 2R072 2IZWA 1R083 2BUKA 1E57A 4JGYC 1NA1C 3JBG2 1OHFA 2HWF1 5C8CC 1BBT2 5A32B 1OOPC 2HWD1 2RR13 2R042 5FOJB 2TBVA 4CEYB 4RS5B 1COV3 3CJIC 4AEDA 4CDQA 1HXS2 4JGZC 3VBOA 1RUI1 2HWD2 4QPIA 4RHV3 4BCUA 1ND3B 2DF7A 2XBO3 5D8AC 5C9AA 4Q4X1 4RQPB
chains in the Genus database with same CATH superfamily
1EPWA 4ITCA 4P9GA 5I0SA 1PO11 3WUDA 2VTXJ 2WDBA 2RS52 4COWA 4RN5A 3RMXA 4UFLA 1IPKA 1YNAA 3CJXA 4LTAA 3WP6A 5JI7A 4URAA 1DDLA 2VZUA 3ZSKA 2GC2A 5FR3A 4JDNA 1W99A 4U2AA 4Y33A 1V9U1 5CB7A 3WP5A 5IAXA 2DV9A 4HK8A 1S1AA 4XC9A 2HWC2 2FMDA 4XXPA 1WA6X 4XAEA 4XBNA 2WWUA 1E5SA 1HRV1 1IKPA 3UETA 1EY2A 3KMHA 2YC4A 1PIV2 1WD4A 2WN2A 4Z07A 3WP3A 3JQXA 1Y3TA 4NRQA 1W6MA 5FBJA 4AE2A 1RUD1 2C0ZA 3N7LA 3TOJA 3WUCA 4QDSA 2CHHA 3RGBA 5FMOL 5GLWA 4FPKA 3TBDA 1GP6A 1JUIA 1MVEA 3POSA 3M3IA 3PMSA 4M3CA 4XYXA 5FZDA 3GJBA 4EE2A 5C4WB 4OVEA 4P9WA 4Y4RA 1PVC1 4DUWA 4AFAA 2J1VA 1DQ6A 1GNHA 1KGYA 1MS4A 5LY1A 3PDQA 3PL0A 4F7ZA 3NV1A 3WVJA 3LFMA 5E16A 5T50A 3SKVA 3MIGA 3O1MA 2E63A 2WZR3 5B4XA 3GCWA 5FXXA 3J4UH 4IEPA 4W6XA 3GM8A 5GLVA 1QJY3 1W2OA 1H2LA 2Y6FA 4QXKA 5F5IA 3KCXA 3K4DA 5BUVA 1TMF2 1I3HA 5LASA 3J7HA 1LOAA 4W6WA 5A3NA 3ORJA 2Q4SA 2RR11 4CCCA 3AB0A 1UYPA 4QX3A 3TNQA 5L9BA 3JQWA 1YQ5A 4JQTA 4NWVA 3GCXA 2ZGPA 3OD4A 2JG9B 5C4WC 1EPZA 3AYEA 2RDQA 3FE5A 4ONUA 3ZM8A 1GQPA 2O8OA 2GH2A 3PVNA 4R8HA 1X7NA 2VVDA 3I2GA 1N47A 1PHMA 1SDDB 4BE3A 1J59A 1CWPA 3K46A 4GH4C 3UKVA 2RM21 1SMVA 2W52A 2PN5A 4CA9A 4KNCA 2NM1A 4Y1VA 4YM0A 1COV2 5FZ1A 5FZ8A 1YXWA 3WCRA 4UXAA 5EZWA 3ZDSA 4CTEA 1UY4A 2RS11 2NZ9A 1V70A 5LBFA 1VBD2 1BKZA 3NNGA 1MZFA 3ZSLA 3BPZA 4MGSA 2RMU3 3WD5A 5K0UC 3H8OA 2A6VA 3IAQA 4A42A 4YGDA 4Y26A 4YW5A 2JG9C 3NJVA 2PLV1 3FMGA 5CISA 5IFPA 1Y9MA 3AMMA 3WSOA 1BZWA 4BQWA 1CAUB 1PX3A 3C7GA 2QQIA 2R1BA 3M3OA 3RYKA 4CP9B 1LEDA 2QCSB 3N4MA 3ILNA 4XQWA 4LUKA 4OQ8A 2OX0A 3GHNA 2PHRA 1VRBA 2MHFA 3D3AA 4NWWA 4JHZA 5F39A 1MPXA 1IS4A 1H1MA 1NX9A 4RFRB 4Q5OA 3DL3A 4URTA 5H9PA 3VB9A 1CVNA 3I59B 3CKHA 4IEUA 4PBOA 1KRIA 4RR3B 2VMCA 4IV1C 2J1AA 4GZ9A 4QHOA 5CU1A 4CCKA 3KGZA 3U1XA 1AR93 1ZVFA 4JAAA 1EUUA 4LHLA 5FZ7A 1RJ7A 5JXGA 2HWF2 3KLSA 1I9RA 4QT6A 4QU2A 1B35B 3UV9A 1ZX5A 4RS5A 4XIKA 3S30A 4E4HA 2VW1A 1ZBE2 4HL0A 3HT1A 4QM9A 3GZUC 2MEV1 3RG0A 2WS93 2WWSA 3GF6A 2AYHA 1WLTA 3JD73 5KHHA 1EAH1 3R4DB 2Z2SB 3IKWA 4F83A 5KWRA 2WBKA 3WNPA 4GQ7A 2OS2A 4FCAA 3ZN6B 4MSVA 5LRSA 1J3PA 1Q8PA 3IPVA 3NKTA 1XPWA 4IXLA 3IWZA 1WW4A 3C7FA 3ZO0B 5A3LA 1S2BA 3VHPA 1O8SA 2Z42A 4NHMA 5FXWA 3VBOB 1QXPA 5J36A 2J1EA 3R4SA 1TEIA 2DCJA 3IN9A 1LAJA 3ZIWA 1YC61 1ZZBA 3MV11 5CZKA 3KVAA 5B2GB 1RGSA 2P1BA 2ZZQA 4K40A 3VD4A 1OD5A 3K77A 3CDZB 3ST7A 2CV6A 2BQPA 2QBXA 2BNMA 4K21A 4BU2A 2B4KA 1CAWA 2A75A 2OQ7A 4L0PA 1GOHA 1W6NB 1WD3A 1D4M1 1XNTA 3ABZA 1SFYA 4CEWA 3BUCA 1I1EA 2QKDA 3VZOA 3ZR6A 1FMD2 1GKBA 1W8UA 2LTNA 2BFUS 2ZGMA 4AG4A 1X82A 1L7RA 1MS1A 4AFDA 4E4DX 4NIGA 1F31A 2IXJA 2ZX0A 2D6LX 4X6RB 4DUVA 1WMEA 4QDQA 4GA9A 1LULA 1Q8OA 2EIBA 1IS6A 4DPNA 5ABJB 5ISLA 3I3EA 4BMEA 3NRUA 3AKPA 3DEMA 2R043 1VBC3 1IGOA 1FPN2 4D69A 1VBB2 1NY71 3K3OA 2RJKA 4K7JA 4MGTA 5FO7B 4Q0UA 3D6EA 3T0DA 2BOIA 2P5BA 3AP6A 1ASJ2 4XIOA 1QJU1 3TEXA 4A7ZA 4LULA 4XHXA 4QQLA 5FZCA 1RUNA 4OHVA 3BOPA 1SDWA 4I09A 3DPRA 4YM3A 2X5IB 2VQTA 4LO8A 5FZ3A 4AW7A 3ZFFB 2UWAA 5ABJC 1O4YA 1W3VA 2TUNA 2VNGA 2CYFA 3DKWA 4AEJA 4AHZA 1AR81 1DU3D 1PMJX 2XUEA 3ZSMA 3ZKUA 3AXEA 2BP6A 5JXJA 4QQPA 2A1XA 3B9CA 4OHWA 3NV4A 1AYN2 4IEXA 3ZFGA 1K5MB 4LE3A 4Y1ZA 1MS8A 5L9RA 2P3IA 4OI1A 5I8YA 2C9KA 4EN7B 1AXKA 3O1RA 2ARCA 1J1LA 2DUOA 4KG8A 4YGBA 1QNWA 3V0AB 1UL9A 1C28A 3PVBB 4AHYA 3VKFC 1NCQC 1PO13 5GLUA 4L8QA 2HEYF 4IESA 5HCFA 2O0OA 1OVPA 2V72A 3HOBA 3NAPB 3POIA 2BV4A 4X6QB 1WCSA 1ZYBA 1A78A 1DZTA 2Z79A 2XBO2 4LBOA 4AEKA 4C8DA 3OY8A 3ZDVA 3ZFFC 3AJZA 5FZHA 4YVSB 2W1UA 3B00A 4XFGA 1UZWA 3CQOA 3RZHA 3MUZ1 1CAUA 2P37A 2VUAA 3RNSA 4CP9A 4QM8A 1J58A 1RHI3 1ZBA3 4LEJA 1JODA 2EAAA 4KQ7A 4AQ2A 4ORFA 5DXDA 3SCGA 1L7LA 5FWJA 2DTYA 4Y22A 1LKNA 4Y20A 2XWBB 3ZFEB 4FP2A 2WUHA 3N35A 2ZHLA 5IK4A 3IAPA 5C3OA 3H3ZA 2H0BA 3NAPC 3I59A 4D0QA 4MGQA 1UWWA 4XBQA 1EUTA 1LOFC 2PA7A 4RR3A 4AI9A 3T4VA 4W50A 3TN93 5L36A 2Y26A 1NLSA 2JG8A 2VNRA 4CEYA 4RD7A 2WQZC 3ZYHA 1QMJA 4O9GA 5FPLA 2G1MA 1B35A 2X10A 5AVAA 2W94A 3C7OA 3CO2A 2XVLA 3D0JA 2YBPA 1QJX3 4Q4Y1 5DABA 4ZS3A 5FY4A 2W3JA 3INAA 1J3RA 1U12A 1U5IA 3NMBA 4XUTA 3ACHA 4TXWA 2DVBA 1AYM1 3VBRC 5FPZA 3WG2A 3PTYA 5IW0A 2WZR2 1FI2A 2VZRA 3ZFEC 2EALA 3ZN6A 2BGOA 1WGPA 1G9DA 1KEXA 4RQPA 1PM7A 1Q56A 2RE9A 4JDMA 1QJY2 3J7MA 5FY8A 3R05A 5LCWL 1WA4A 2BBAA 4UAPA 2HBTA 2RM23 4K8RB 3DYPA 4M3CF 1HRI3 1H4GA 3ASIA 1QQP1 1Z78A 3HN1A 5DUXA 5A7WB 2Q8DA 3VBUB 3WOGA 2E51A 5K4LA 3V0BB 1PX4A 2A3XA 2VUCA 2Q8CA 2RS13 2DVFA 2VH9A 4K1ZA 3ILRA 5EPAA 5FXZA 5BPXA 3NVCA 1O4ZA 2VE1A 3AKSA 1WLDA 5FP3A 1DHKB 5FQ0B 1RB8G 3C2UA 1CPNA 3D5OA 1MZEA 1PGW1 3BKZA 4MOAA 3WZ1A 2WFF1 1REDA 4CDUB 1BBT3 2PLV3 4OI2A 5BXXA 5JSOA 4CUCA 4K20A 2W92A 4AHXA 5KXDA 2QDRA 4XJ9A 1R1A2 4LKSA 4M0HA 4N9HA 4QHBA 5FP9A 5HV0A 5A3TA 1K3IA 4QB6A 5LA2A 1EV11 3I3BA 4WM7B 1DFQA 1UPIA 2HWE1 2EF6A 1RUE1 2VCCA 2RMU2 4M3CE 4CCDA 5CFDB 3THTA 1OURA 3NL1A 1ZZCA 1DCSA 3E97A 1AR72 3MHZA 3PUQA 4XDPA 4D94A 2PHWA 2ZKLA 1DGWA 2OVUA 5A3OA 1CZVA 3LSDA 2UYBA 4I30A 3JXSA 4AHWA 3M7AA 3LWCA 1ZREA 3POBA 3L2HA 4NROA 3AYCA 4OULA 2HWD3 4AFBA 2OXBA 4B7KA 5FKCA 3H3UA 3AKTA 4ZS2A 5CFCB 5LRRA 2XQRA 3T30A 3H3LA 1VBA1 3DECA 3LZZA 2GSYA 1GANA 3OEBA 2JWPA 4MXWB 1JYNA 4Z2WA 1CR7A 4JVAA 3SCHA 3KV4A 2PMWB 1QOTA 2X5IA 1RC6A 2PYTA 2D44A 4LITA 4CDWB 4PDWB 1VRH1 4BB3A 2RJ2A 5HCAA 4IE6A 4KL1A 4RGGA 4WM7C 3WNOA 2HLEA 4YW1A 2ZHMA 4AI3A 5IVEA 1KDMA 1YUDA 1AR92 1QJZA 3D8CA 4NR1A 5FYZA 5BNOB 1JHJA 5IK7A 1YQCA 1A8MA 1K5JA 2R062 4PBPA 2XDVA 4BH9A 3I2KA 2HBUA 3T4HB 4KWJA 1K5MA 4LBJA 4AR2A 2W1SA 2HWC3 2E9QA 2XJUA 3B02A 2WN3A 4A41A 1YIFA 4O7XA 4UI9L 1F35A 3AFGA 3FHQA 5CFCC 3UNPA 1O3QA 1UX7A 3JD72 4N7IA 3RQ0A 1PIV3 2X05A 4COZA 3N7MA 5H9QA 1FV2A 1M4WA 2WR9A 1NYWA 2Z69A 2EIEA 3U37A 1QOOA 2VG9A 2A3WA 4BOWA 1DYKA 1AXZA 2G9GA 3CJIA 4JGYB 4R52A 3VBFA 4CDWC 4PDWC 1PM4A 3PTRB 4HK9A 1GZCA 1GYKA 1ND2B 2LALA 2R30A 2ZPXA 1JYTA 2FDFA 4YVSA 1K42A 2WRAA 1GNZA 1D4M3 2B39A 2WAAA 4LA2A 4FPOB 3TYJA 2O8QA 5BNOC 1JYCA 4MLOA 1HV0A 4CDXA 4E4SA 3PNAA 3JBG1 1T2XA 5FMBA 4NO4A 3S7EA 3AK0A 1GFF2 2Z4FA 5GLZA 1AJOA 3HQUA 4XHBA 1KDKA 3WF4A 5CKNA 2YBSA 1TMF3 2ZGRA 4YM1A 4YZ4A 1DIWA 2VGDA 1MQTA 4BPZA 3K4ZA 1QXRA 1OKOA 4CU6A 1VAVA 4OQ9A 3VBSA 4E2QA 5A33B 3FFQA 4BQ2A 3EMRA 1UNBA 1SBDA 1MZ6A 1PMIA 2W08A 5J3UA 4JGYC 1NA1C 2E31A 4NIIA 3FX3A 4TSVA 3OBAA 4UOJA 4LT5A 3V65A 1ZZ7A 3LEMA 5L73A 4LO4B 4LXLA 3TEYA 2AEZA 5LA1A 3BB6A 1VJ2A 4I0WB 3WF3A 2R042 3MIBA 5KR7A 5LW9A 3SQOA 5AFEA 3PURA 2BDRA 1UYYA 5GM0A 1COV3 5FMDA 3T08A 5JOWA 2WNUC 3GALA 3I3DA 4YSFA 4XF0A 4A3ZA 5JOXA 3P3NA 3MV01 3J7LA 4EN8B 1ULOA 2P2KA 1ND3B 2WYSA 2BZDA 3B9IA 3KHBA 3MW2A 5D8AC 3CZJA 5DAPA 1AX0A 4FPCA 4Q4X1 5FZBA 3T09A 3AP4A 5A7WA 4BHPA 2VQUA 1QHDA 4YM2A 2FBEA 4WVMA 3FC0A 1LGBA 3V0BA 5LEJA 1UY0A 3PIGA 1A34A 1KJRA 2ZBJA 3RMYA 3NV3A 2ETEA 3VD3A 2OIIA 1OLQA 3O12A 4JQRA 5I91A 4A2UA 1S0FA 5A6YA 4LPLA 3VDDB 4YW6A 3AL6A 2P3YA 4KGQA 4CP1A 1OQ1A 4QKNA 4QX5A 1JYXA 2JKXA 4CDUA 2ZZJA 5LWBA 3A23A 5HPOA 5FY7A 3JU9A 3KHCA 1PO12 2P6CA 4UWDA 1AR61 1WLWA 3B93A 5FTTC 4N53B 4BDVB 1W6OB 2VQAA 4WBBA 5FREA 4C0HA 4Y4YA 1BMV2 4HN1A 1JZ7A 1WMXA 2XKOA 4IW3A 5IVCA 1ND3C 5CFDA 1MS3A 1PGL1 1N1YA 2D5FA 1V9U2 1XNCA 1ZBE3 3POGA 1QXJA 3AYAA 1HKDA 4Y24A 1DQ4A 4MV2A 5FZEA 1CN1A 2VXJA 1AZDA 4META 4QD2A 4DO0A 2XMLA 2GH8A 1RHI2 3VDDC 2IWGB 2JB8A 1WCQA 3EHKA 1DYOA 2XWJB 5IUQA 4JCKA 2JDZA 3ES1A 5C9AC 3I2DA 2W39A 3WF2A 2W2IA 5LK7B 1SLAA 4Q4Y3 4X8PA 1PK6A 4FQ4A 4H55A 1QY4A 1PVC2 4XUOA 3O7OA 3MFCA 4LBMA 3TN92 1AYM3 2WAOA 1JXNA 2WQ8A 3W58A 3LPGA 4A44A 1OPMA 1CQ9A 1GWMA 1UZZA 2HWB1 4H3WA 4XETA 4EZ4A 4I2OA 4OFGA 5A3UA 2ZGTA 4Y1XA 3W59A 4DZGA 4QX2A 4DIQA 5KHGA 1LEMA 5LBCA 4HPKA 1IS3A 1VIWB 3OPZA 4N43B 1MS9A 1CX4A 3USUB 2RR12 2YGLA 4AOCA 4LK6A 5FWEA 1LHWA 2JDHA 4A45A 1JH5A 2SBAA 1DGRN 2ZAHA 3MGUA 4IEWA 4XDOA 5CADA 1UOFA 2PAMA 4ES8A 5J7MA 2LM3A 5E6HA 4CCOA 1JHNA 4XF9A 1C8M3 3CNAA 3M3CA 1J1TA 1ND2A 1OOPB 4IEVA 4FQZA 4FTEA 4CSWA 4GWIA 2DBNA 2WYFA 2BERA 2W5FA 2RM22 3I7DA 5CNAA 2PHXA 4I0AA 4YVWA 1FPN3 4BXFA 1VBB3 3IM0A 4BYYA 2I74A 4AZZA 3X29B 5JMOA 1YFUA 5CG9A 3H1YA 1ULDA 2QQKA 3JB4C 3R0RA 1ULCA 2BFUL 5F3GA 1ASJ3 2DVGA 4LKEA 1HV1A 2RS12 3I8TA 2XHNA 2J42A 2VAUA 3TB0A 1OH3A 1RMU1 2UWCA 2X8KA 4X8NA 2ADEA 4N43C 3OTFA 3C8XA 1YIPA 5FP8A 4BIOA 2A7AA 2QQWA 1W8WA 1QGLA 3HD8B 5A7NA 4BM8A 2CWMA 2PLV2 3F95A 1ULPA 4D7SA 5FZOB 3MLKA 1XNKA 4Y5SA 3THDA 2W1WA 4MHRA 5JAXA 3GZTB 2BJSA 3DYOA 2EXHA 1FOD3 3GBWA 4IEOA 4V1PA 2WA3A 3LSEA 3BVCA 5ACA1 1H8TB 4C91A 1HX6A 3O0WA 1AYN3 1W90A 2ZEYA 3KQRA 5DDJ1 3W9AA 5CAZA 4M00A 3FJSA 1GSLA 5SV5A 1VRH3 2VOXA 4Q1RA 2ORXA 4FPLA 5JZGC 1S0JA 5JSRA 4OHYA 1R1ZA 3UGGA 2R0HA 1JZ3A 2C9AA 1VALA 1C3HA 2RDRA 2WINB 1Z7S3 1E5HA 1D0GA 1RVF3 1VMFA 4I01A 1OF4A 2OPKA 2YV8A 3ATGA 1A8DA 4XFBA 3KV5A 4O9EA 3ES4A 4OZOA 4AEDB 4LHNA 4Q1PA 5KXBA 2MEV2 1TZOA 4HN0A 1FYUA 4H14A 1H8TC 2Y6KA 1ZRCA 3POYA 3MIDA 2ATFA 2V4AA 1Q8VA 4JTOA 2D97A 1CAVA 1RIRA 1MVQA 2HYKA 1OXCA 3LOIA 1O59A 3HMYA 2C26A 3N9PA 2JDPA 4L11A 3VBHA 4NPLA 4ZONA 3HVDA 5CKQA 5DAVA 1HB2A 1LHUA 2PELA 4LBQD 2QQOA 3ZXJA 3QOPA 4N53A 2ZKNA 4JTNA 1C1LA 1EP0A 2FDHA 1DGWX 3CIHA 5EIYB 1W6QB 1AL21 4IE0A 3TAYA 2CU5A 1H6YA 3M8LA 3RDIA 1TME1 4AEDC 4XFFA 2JJ6A 1BLZA 1Y43B 1N1SA 2W0XA 4OHZA 3U14A 4AVTA 1D4M2 3LA3A 3H7YA 5C71A 4KBBA 4GH4B 4IDZA 4ZKTB 4QX1A 3RFRA 3O1SA 1TVGA 5FPVA 1WMFA 1R081 1MEC1 2QQPA 2WNVA 1XRUA 3B94A 4RSUA 3AZXA 5T5JA 1NZCA 1OQEA 4FPEA 2XUMA 1URXA 4Q27A 1POV3 2L9LA 1HXS3 1XYNA 3SC7X 1ST8A 3OBTA 4V2VA 2NPIA 2WO2A 3NNFA 1IQAA 3EJKA 4D6QA 5K0UB 2TNFA 3O1TA 4MHUA 4XACA 2W1QA 4LQRA 4B1MA 5FY5A 3OGVA 3LPFA 5FXVA 5AFBA 2PFWA 3FLRA 2E33A 2OZ6A 3R6SA 1QJU2 2Y64A 1H8VA 2GNTA 5IVVA 2ZCWA 3WNLA 4CXWA 3NJXA 1I6XA 2ZX4A 5HI0A 4CEWC 4HVRA 2QZ3A 1AX2A 3IIIA 4XUNA 3BTZA 1RUH1 3AP9A 1JU4A 4HKWA 4KWUA 4BK5A 2E32A 4DY3A 5KC5A 3S7IA 5JLVA 2DU1A 1BVVA 1IG3A 4ASLA 1GNYA 4TZDA 3OOXA 3FN9A 3DXTA 1R1A3 2VD7A 4DXRA 2GC3A 5FK8A 2HH9A 4IV1B 2X53S 5FPXA 1UF2C 4UFIA 4RFT0 4XFHA 3LF7A 1AR73 4ZU5A 4LKDA 5IATA 1DZQA 5FP4A 5IWFA 4FBFA 4HKLA 3ZLIA 4QU1A 2VULA 3CZUA 4SBVA 2V5DA 1VBE3 5L7OA 2BW8A 1CGPA 4XPVA 3JB8A 5D2AA 1D4VB 1WW7A 1WMDA 2GMEA 4Q4V1 3TWIA 3BYWA 4K3UA 1OA3A 1RUF1 1UOJA 4JHTA 4XZPA 3DXUA 3K51A 4ZHNA 1IZ3A 3H50A 1BQPA 5EQUA 4JV4A 4WZCA 3I2OA 5JR7B 3FHIB 3DPRC 3RZLA 2VZOA 2R071 1YQ6A 4LIUA 4NUBA 2J1SA 4IV3B 3KZ4C 5A32A 4HETA 2J1TA 5FZOA 1OPOA 2DBIA 3I3QA 4MZUA 4KWKA 1UD1A 4PQQA 4R9BA 5KC6A 2Y33A 1W2AX 2IXIA 2VW2A 3AZVA 3HWJA 1HQLA 4LBQA 5I0TA 5T5OA 5A1FA 3W5MA 2R063 1QEXA 3E1F1 4CXYA 1XU2A 4UFKA 4XXAA 3WDTA 3OGRA 2MPFA 3Q8AA 2D40A 3LAGA 3SCFA 3AMQA 1FXZA 5I8SA 4ZXEA 5IJRA 2F4PA 3HEIA 2A73B 1H2KA 3SKJE 3OPWA 4NMIA 3MIHA 1IG0A 1BJQA 2NN8A 4GULA 2VM9A 2IFRA 2BU9A 4D8MA 1XB9A 2R16A 2Z5WA 5A80A 3WQ1A 2BTVC 1KITA 1PNGA 4IV3C 2HWB3 1V6IA 2RS31 3C7HA 4OZXA 1IHMA 5FUIA 4EJRA 1LHNA 3ZSEA 1W2UA 1H9PA 1Y7BA 1NT0A 5CA6A 4Q4Y2 4DMIA 4RL7A 3NWKA 3JCIA 3WF0A 3ZX7A 3WCSA 2WNOA 2ARAA 2ZMNA 3J26N 3NJYA 1AYM2 2W87A 2F6BA 3HIFA 2YFZA 3OG2A 1FNZA 5FCCA 2BVBA 2RS51 2B7YA 3FUOA 2OKXA 4W4ZA 2D3PA 5I0DA 2Q0AA 2HJIA 1LOEA 2XJRA 1LECA 3RJRA 4LKFA 4LBKA 1PVXA 3VHOA 5A6QA 1SPPB 1BEV3 1W04A 1ZZ6A 4H2AA 4WVZA 1QQP2 4SLIA 1CZTA 3S5AA 5DUWA 3ZXLA 4AF9A 1XOYA 4PF5A 4YG6A 3MLJA 1RUG3 1SCRA 3K3NA 5C3RA 2CY6A 5IVJA 1NCRB 2VMGA 1C8M2 1XJAA 5C4WA 5JVVA 4I0BA 5FIXA 1C5IA 1F4HA 3LA2A 4WVVA 4NPMA 3UGHA 3QCWA 2IFWA 2D3RA 3LDBA 4GH4A 5LBEA 2QJVA 2NYYA 3HNMA 1W0OA 1PGW2 2PHFA 4ARXA 1SLCA 4BQXA 2WLQA 5AC91 3U78A 1R64A 2ZMKA 4XQDA 1OLMA 3BN6A 4XUPA 4Q0QA 3EO6A 3GDBA 1S0IA 4RQPC 2VBPA 1ZRDA 1NCQB 3LKJA 4GAZA 4DNYA 2GP3A 2QFEA 4PF1A 2HWE2 4Q8KA 4XQ4A 1ULFA 5CG8A 2K9ZA 2P4EA 2DFBA 4LE4A 4MXVA 1E5RA 5K0UA 1N3OA 3THPA 2YMZA 3MI8A 2JG9A 4AI2A 1NCRC 1UAIA 2DUPA 4CPBD 4KI5M 4YARA 1W28A 4Z92B 1RUI3 1V6NA 2YC2A 3LEGA 1FOD2 2FCTA 2B9VA 1W6PB 4AL9A 3RWNA 4WM8B 2VC9A 5FPUA 1SLLA 1WW6A 3VKOA 4AVVA 1VBA2 1X8EA 1JOJA 1PZ9A 5FJKA 2PXJA 3T3YA 1W3XA 5FO8B 5FZ0A 4EZHA 2ZABA 4CE8A 4JKMA 2IUWA 2J7MA 5KXCA 4DRRA 1LTEA 5C5TA 2VNVA 2D6MA 4AAXA 4ZZ8A 4HKOA 1BVP1 3ZSJA 2BNOA 1VRH2 4XAAA 1RUC1 3V64A 2G4IA 3SEEA 1YI9A 5G04L 2FDGA 3KSCA 3ZYRA 3ZXKA 2A6YA 1UKRA 1NLRA 1TE1B 3PUIA 2R32A 3RI8A 1ZA4A 1FX5A 1Z7S2 3PLQA 1US2A 1RVF2 1X33A 3O0XA 1REFA 3A21A 1V9U3 4NAOA 3WX5A 3HQRA 3L2YA 3AJYA 4Q4W1 2BGCA 2PHDA 3DYMA 1C1FA 4QQHA 2UU8A 4MX3A 2QE3A 3J8F1 5EJ1B 1HRV3 4WM8C 5FYSA 3I4IA 1SFPA 1FV3A 4LUMA 4M0NA 4AEMA 4EN6B 3Q8CA 2RV9A 1OFSA 3VD5A 3VLBB 1ONAA 1RUD3 3VBRB 1RXFA 1AL23 2D98A 2ES3A 2AACA 2DCZA 2AC1A 3WNNA 3DN7A 4OUEA 1YFXA 2D6KA 4E8DA 3BI3A 3IZOA 4ZY9A 1PVC3 4HSJA 3P3PA 1QKQA 4MH0E 4J25A 4QQOA 4QXBA 1O3TA 4S2HA 4JGZB 4XW3A 5HCHA 1JZ5A 5IVFA 3CEWA 4FOYA 3WNMA 1Q3EA 4IEQA 2A70A 1V6LA 1R083 2BUKA 2DCTA 3PUHA 1QWRA 3JBG2 1LJ7A 2HWF1 4P9JA 2JEMA 4FPFA 3CMGA 1SEFA 4HXCA 4Y1YA 4PT6A 3BCWA 2DWRA 1RJ8A 2UY9A 4OCTA 2RR13 1GU3A 1O5LA 1J83A 1NAEA 4QB1A 4TYSA 2VMIA 3LCPA 2H6CA 2JIGA 3LB9A 2XJSA 2V4VA 4DXTA 2OPWA 3N9MA 4KG0A 2NMOA 3CJIC 4V2WA 5I93A 1HXS2 1YEWA 4JGZC 2R6QA 5FYIA 3VV1A 1NXMA 1XBFA 4I3GA 2ENRA 4M4RA 2QUOA 4XJZA 5FZFA 2KA3A 3VBOA 3ZIXA 3ZYJB 1GV9A 5FDBA 5APAA 1OD3A 4AI0A 2K46A 1G6NA 5H9SA 2YU1A 4BCUA 1U5YA 1O7FA 1W8FA 4FPJA 5IK5A 2QDNA 5C8CC 3SH3A 4CPBA 4UYBA 4P9IA 1NE6A 1W6NA 1OC1A 4XJAA 2JD9A 2VCAA 2WL1A 4LHKA 4ZU4A 5FAXA 5BNNC 2CGOA 2O14A 5T3NA 4AGVA 2VZVA 1YFWA 5G05L 3ZOIA 2CNAA 3OD0A 3ZPOA 4Q4X2 3RZZA 1FMD1 3GHMA 3KM5A 2JE8A 1W8HA 5FFOC 4EV0A 4R9AA 1G9AA 1QJFA 2VZQA 3MF6A 2IVJA 4M01A 5FY0A 5ABJA 1JZ8A 5C3SA 3A22A 2UWBA 4GB31 2JDMA 4OUMA 5A7PA 1POQA 1GOGA 4E27A 4NIDA 4NHXA 1AL0G 4A7YA 1H2MA 5C5UA 2WFPA 3L9JT 4NVPA 3KGLA 4AQ6A 1FNYA 3IIAA 1F9KA 1W8TA 4W65A 2WQ4A 3BPSA 1VBE2 2AGSA 2I07B 2X09A 4BWOA 4QXHA 3E5XA 5A1AA 4QHZA 1UXXX 4XVHA 1NCQA 3AP7A 5DAWA 1ALYA 1NG0A 5LY2A 3CL1A 3SH5A 4ASKA 4YFZA 4F8AA 4P02B 4IETA 5F32A 2XLAA 1UYZA 1W06A 4DXSA 4HBNA 2GDFA 1PGL2 1VMJA 2GN3A 1CAXB 3WG1A 3ZFFA 2FDJA 1PZ8A 1RITA 5I0UA 2MEV3 4UW6A 2DTWA 3ACLA 1RTVA 4PQ9A 2E7TA 2PQQA 3MIEA 5F2WA 2JDNA 4HZFA 4FFGA 1EAH3 3MICA 1V6KA 1Q8QA 1HN0A 2BNNA 4FFIA 3VZMA 4C0BA 1CD3G 3FLTA 4YFWA 5EV7A 1SCSA 3I97A 1X9TA 2RS33 3Q9OA 2WKKA 2FZ1A 4AGGA 3KV6A 4XFIA 3V0AA 4P14A 4LOSA 5FYCA 1ZRIA 1WZXA 3OYWB 5JI9A 1ODNA 4CYDA 1HLCA 2EIGA 1YFYA 2PQSA 4YZ5A 5SV8A 3NAPA 1LESA 2R49A 4RHV1 3A0NA 1LOFA 2ERFA 2WLPA 3KS7A 3WP4A 4AXOA 4Y5Z0 4ATFA 5A3MA 3URFA 4DRVA 1NA1B 2HWB2 5E1RA 2XBO1 4JDOA 4YG0A 3ZPYA 5BNPB 4S2FA 3I2JA 1W2NA 2WWJA 4NHLA 3LEIA 1O6UA 3VZKA 4GWJA 1LB2A 1AX1A 3LE0A 2PHLA 2JENA 3BU7A 5GZEA 4CZSA 3OBRA 3POEA 2A6WA 4PLOA 2QQLA 5DPNA 1UCXA 4AFCA 3FL7A 4XUQA 2VUJA 3EXUA 2A71A 3U4XA 4DUXA 3ZFEA 1BK1A 4Z8BA 4PCRA 4FOVA 2WNUB 2C4XA 1V6MA 3LD8A 4XURA 1GMMA 3U0ZA 4IL7A 2ILMA 2HYXA 2JDUA 5JUVA 1BEV2 2Y6GA 4XJUA 1XXNA 3DCQA 3MDPA 5LATA 4HSLA 5FYYA 5A3PA 2AR6A 5D8AB 2XOMA 5CIRA 3UESA 5AC93 3BTYA 1RUG2 1WBFA 3A7QA 2FCVA 2QZ2A 3NKGA 4QPGB 3UGFA 3M3EA 3VD7A 5BNPC 1QJU3 1ENSA 1LOCA 4IE4A 3AL5A 4BQYA 4IEZA 4LA3A 2ZX3A 4HONA 5FY9A 3AVSA 4GALA 1T6BX 4LORA 2Q1ZB 2AUYA 4JZRA 1OUXA 2YHJA 2EXJA 3A0KA 3I2HA 5K9YA 3O1VA 1K12A 5A7SA 3WW1A 5J96B 4PI2A 3ZMOA 1XSQA 2J1RA 4LJHA 3HJRA 4EYUA 1OT5A 4KBZA 1AR83 2B5HA 2ZTNA 2BEOA 2CL2A 1MACA 4YYOA 1QJY1 3AZYA 5ACA2 4B1LA 2Q5TA 5EXOA 5H9RA 2Q1FA 3CLPA 4GWMA 2ZGNA 4RA0A 1TNRA 3G6JB 3W21A 2W95A 4ZU7A 4QPGC 3VBUA 2P6HA 5DDJ2 2FZ2A 3BOWA 1RUI2 1UU5A 4CDQB 3WEZA 1DBNA 3D82A 4FXGB 4E2SA 3RZJA 3K4AA 5DQ0A 2H6BA 4QPIB 3GYDA 3LIGA 3E6DA 3H8UA 5FQ0A 5F6KA 5FP7A 2G19A 4PJYA 1HJFA 4QPYA 4YWAA 1UU6A 5A1LA 5C9AB 2VOKA 2C1FA 4AFMA 1I5ZA 1NLQA 4AYUA 1JTZX 4GD4A 4Q0SA 2GNBA 5K7PA 3J8F3 2A5ZA 5J98B 4A6OA 1F15A 1XQNA 3ILFA 1OKQA 4BLIA 3PMEA 2ZGUA 4WM7A 3NSTA 2XHKA 3SXWA 2GNDA 1W9SA 5FPAA 4TTGA 2G9ZA 2ZACA 2CDOA 4CDQC 4QKBA 5IVBA 5JCTA 2BYVE 1HRV2 2WZ8A 2XLFA 4Z2AA 4QPIC 1OLME 4QQ2A 5FZMA 5GKAC 2YYOA 1X8MA 4MO3M 5CFCA 3W5NA 3E6BA 3RJ2X 1RUD2 4YG3A 1Y4WA 2HKXA 1R091 2VPVA 1AL22 2WA4A 3POJA 4MXWA 1XYOA 1W6MB 2LUWA 2VXRA 4FFFA 4XE9A 4AAPA 4Q26A 3MO4A 1TME2 5L9VA 3EBRA 2OQ6A 4R4ZA 3FWEA 3H8RA 3AFKA 1CAXA 4CDWA 3OUJA 4PDWA 4LHSA 4FAHA 3PJYA 4LO6B 3MPPG 5J48A 1CONA 4PIZA 5BV6A 3AXDA 4WVWA 2O1QA 5FJHA 5BNOA 4JRLA 1DLLA 1DGRA 1R082 2E7AA 2B46X 1WBLA 3LIHA 4GJZA 4K6BA 4YZ1A 2YDEA 1AR91 2KD7A 1XE7A 2GALA 2Q8EA 2ET7A 3VBHC 2BBVA 3NNMA 4FO9A 3OF1A 4BZ4A 1U5ZA 4ES9A 2VMHA 1HB4A 3LOBA 1YWKA 3POWA 4AI1A 4IQPA 2ZGOA 2WS91 1QQP3 2XONA 4XFCA 1HQNA 2PHTA 5C6CA 1NUKA 1NOVA 2EA7A 5HV4A 3FHAA 3DGTA 3IDBB 1DGLA 4UF0B 5GZCA 1GP4A 3Q8BA 4JGYA 1ZNPA 1IPSA 5FYVA 3LEKA 2OUHA 2B8MA 1UZVA 2W68A 1DLCA 3EB7A 5GALA 3WLUA 1OVSA 1G8WA 1UKGA 5CVRA 3TEWA 1UOBA 1LOGA 3IDEA 5ERLA 1L3JA 2XJTA 3J9SA 1RUH2 5DZEA 2WFF3 2EIDA 2WT0A 1KXGA 2GC1A 4P9YA 2LROA 2YC0A 3ETQA 1W9YA 4HANA 3HAGA 1QJEA 2RVAA 3SMHA 4R9DA 2D6OX 1WW5A 5GLTA 5FZIA 2OUJA 2WNUA 2ZGKA 1EV13 3O14A 4DS0A 5JZGB 2HWE3 1RUE3 4EWEA 4PHZA 2GZWA 2VMEA 3RYPA 1MS5A 1UMIA 5A33A 4YPJA 5GZFA 4B7EA 1LGCA 1B09A 2JDKA 2VCMA 1VB4A 2DVDA 3ECQA 5D8AA 3T2PA 3M2MA 1M06G 3U75A 1A6CA 3BODA 4Q4V2 3PUSA 1RUF2 2JDYA 1DQ5A 3G7DA 5EYYA 4EN9B 2VVFA 3KB5A 4GIQA 1VBA3 1WUVA 5A6XA 3VKNA 4AVCA 3NQHA 2YZ4A 4D3WA 5HCBA 3N9NA 3VUOA 2R041 1MR5A 1VBC1 5IFTA 4LK7A 1YJLA 5FKBA 4RGKA 1W0PA 2ZJCA 4YZ3A 1QIQA 4UBGA 4XCBA 2VZPA 4OI4A 3WDYA 4LNVA 2GP5A 3OUHA 4BQ4A 3KCCA 4P00B 5JIAA 4XABA 3MLLA 4RYDA 2LS6A 2WIIB 1ND3A 1SZBA 5T55A 4A3XA 2XL9A 3PIJA 4L99A 3RZGA 5ANNA 5L7OC 4P9XA 5F2SA 2VOTA 1HW5A 4DXZA 1GWKA 4L97A 2XB6C 1EAH2 2XJVA 3OEAA 1OFNA 2XKPA 4CCNA 4BMBA 4N8MA 4JC1A 3DV8A 4K1YA 3VDDA 4NIHA 3JUUA 1C8NA 3VN4A 1VLNA 3KCYA 4KGGA 1RUJ1 4Q0VA 3D4KA 2XPJA 4B29A 2RS32 2TEPA 3IPVB 2YU2A 3WG3A 2AH2A 1OF3A 5BYNA 5B4NA 2FMYA 1UY1A 3QACA 2P17A 4ARYA 3I49A 1JOPA 3MW4A 1OA2A 3ZYGA 4DEVA 3ETPA 4C90A 5AVPA 2D6NA 1W6OA 4MGYE 4DB5A 4ZPIA 4JKLA 4QMAA 2VZ3A 5FZGA 1BMV1 1MS0A 2BGPA 3LA7A 4CUGA 3JBG3 1OBNA 1X50A 2GMPA 4RS5C 4XJWA 4FT8A 1GICA 5FRAA 1LENA 2EXKA 1CAWB 2WT2A 5FZAA 2BRTA 1O5UA 1WKYA 1JU3A 4A7KA 2JECA 3PU3A 5JIUA 3PU8A 4R9CA 4CEWB 5BY5A 3GGLA 1PNFA 5FUNA 1ZBA1 1RHI1 1VPHA 3SEPA 2ZX1A 3ZXAC 1OUSA 2A6ZA 1GQGA 3WXPA 3AMNA 4DINB 4XJ8A 2D5HA 1ZRFA 1ACCA 1H2NA 1XE8A 3GZAA 1RINA 4P9LA 4BA6A 2VQ0A 2K0GA 1DQ2A 3M1HA 4UT5A 4E9KA 4XCAA 4QXCA 3RYRA 1NY72 3ZYPA 1UIJA 3MFAA 4EWDA 3CHXA 3M3QA 2WJSA 5AC92 3TN91 2XL7A 4MGZE 4BLJA 1S2KA 1WCUA 3ELNA 1W05A 3ACIA 3ME2A 4MYEA 4CU9A 2KM2A 4KH9A 1PO21 1WCKA 3UYJA 1QJX1 2XGXA 4FVVA 5C3PA 4GXLA 4N43A 3USUA 1AHSA 2Y8KA 3KT7A 1US3A 5F7UA 1S0CA 2LRPA 1O91A 3MUY1 4FFHA 1D0HA 4Q4X3 4YW3A 3DPRB 4QGMA 3WW2A 3RZKA 2BOJA 1GZWB 3LQCA 4IGPA 2FDKA 3UL2A 5BNQA 3WDVA 2JIJA 4MVTA 4UF0A 3GXUA 3T2TA 1AR82 4HFSA 4IE7A 2WSVA 1OOPA 1OH4A 3MW3A 2E6VA 2HEVF 4IGOA 2RDNA 1V0AA 4IE5A 3AZZA 1DF0A 4R4XA 3ZN5A 5A6ZA 5C33A 4E8CA 1XNDA 1JYVA 5GZDA 2VZSA 3ZFGB 1HRI1 1UU4A 3P1IA 3WQBA 4FPYA 4W6YA 4UW4A 1UO9A 4MADA 5FYTA 1ZZ9A 4Q8LA 4PIXA 1OQDA 1RUC2 4L9BA 2ID4A 4UW5A 2XVGA 1AR63 1SG3A 5FV3A 4AK3A 3VZJA 4HVQA 3KQ4B 3JZVA 5JZGA 1UY3A 3KT4A 1NE4A 2P3KA 3H0OA 5KXEA 4G4FA 3U07A 4LOTA 1C4RA 4QKFA 1TQ5A 4Q4W2 1G9FA 3CU7A 1YLLA 4XILA 3OY8B 1GBGA 1Q8SA 4D6RA 5JDBA 1VAKA 1BBT1 3T0AA 2QQMA 1XNAA 3ENRA 3J8F2 4QX8A 5EJ3A 1QDCA 1XE0A 3LDKA 2Y0IA 1H8TA 2D93A 2CAUA 5E88A 3K2OA 4BISA 1R093 1XNBA 3ZFGC 5DUVA 2R1DA 4CCLA 3BTAA 1E57A 5FLJA 1C57A 1OHFA 4Y22B 4QDRA 4Y20B 4S2GA 3VHNA 4CU7A 1DYPA 5JXHA 2ZS6B 3POFA 2HWD1 2P34A 1W8OA 3WQ7A 4BJ0A 1BK0A 3HR9A 5FZ6A 1SBFA 4DQAA 3VDBA 2YROA 3I3MA 1GUIA 2YY1A 2JG8B 3UJQA 4CEYB 3KF3A 2J22A 3AZWA 4OYUA 3WNKA 4QGNA 4AEDA 1G86A 4RGAA 1JOBA 1N3QA 3UKTA 2ORZA 1FAYA 4O61A 3QH6A 4LO7A 5J1XA 4FPHA 1DG6A 5F5QA 2XG3A 3VDAA 1YCIA 4AVSA 4E2GA 2OW4A 1JN2P 2DF7A 4FP3A 2IC1A 4AI8A 2WZEA 3N9QA 1UPSA 2CAVA 2D6PA 4J1XA 4RQPB 5GJ6A 4ASMB 3WF1A 2HWC1 2DU0A 5E8AA 2XLGA 5T52A 2ARBA 1UIKA 4RR3C 5EWSA 2ZEZA 2JG8C 1APNA 3F2ZA 3H7JA 3HT2A 1PIV1 1W6QA 1X36A 4MUVA 3WDXA 4CEYC 1JZ2A 3ITQA 1CJPA 1AUYA 1H0BA 4BQ3A 4OLLA 3QH7A 1B35C 5FYHA 4NOTA 5K8SA 1OI6A 1RMU3 5DG1A 5T5LA 1DP0A 3OPTA 4GJYA 4INDA 5M0TA 3RRDA 1CPMA 2IXLA 2JDAA 3APBA 2JE9A 3T2OA 4COVA 4WZFA 5DN2A 2ZMLA 3ACGA 4U36A 3P5BA 2VUDA 2WFF2 4GKYA 2CTVA 5FK7A 1BXHA 3UKNA 4B4RA 5IAVA 3CBNA 4JRAA 1L7QA 4MG2A 3MEPA 3GJAA 1OLRA 1QNYA 1ZM1A 1HQWA 2DDUA 4HVOA 5FMCA 3Q8FA 1EV12 3S6PA 4GB32 1RUE2 5ACA3 3IMMA 2I2SA 3VBOC 1XSRA 2EVXA 2VECA 3ON7A 1TMF1 1XC6A 1ULGA 4B4PA 1Z0HA 1H30A 3NNLA 4CXXA 5DDJ3 5I0RA 1NKGA 4K9SA 4COUA 2MNGA 2Y6HA 3IDAA 4UFHA 2ZXQA 3NW4A 2NP0A 3D0SA 3PJQA 4AGRA 3C7EA 3SISA 4H7MA 2WT1A 1DZRA 4J6GA 3N7KA 3VHRA 2JE7A 3ZN4A 2IXKA 1N3PA 1G9BA 4KU8A 2CGNA 3N9OA 4DEQA 1UXZA 1RYYA 5LZ6A 4S2DA 1G7YA 2JKBA 2OYZA 2D3SA 2DVAA 2EXIA 2Y34A 3EQEA 1KQRA 4HOOA 1CX1A 4UBHA 1GZWA 1J3QA 4CP2A 1HB1A 1COV1 1K45A 2ZHKA 3HNYM 4AQTA 3S57A 4LLFA 1W9FA 4KMQA 4GMP1 5DUUA 1VBD1 5KHJA 2PAEA 4IV1A 4P5HA 3A4UA 2ZGLA 3W20A 2VR4A 2C24A 3KD4A 1H6XA 2G9FA 3V56A 4NE9A 2WO7A 2D7FA 5FYBA 1RUJ3 5FLHA 5DZGA 4QKDA 3VKMA 2VU9A 1GZ9A 2FDIA 1ZRRA 3B3QE 3WHUA 4BXSV 4E4ZA 3BIWE 5LBBA 1IKQA 1LHVA 1QOSA 2UURA 1S55A 5F3EA 4RHV2 1SLTA 1LR5A 1LNSA 2QQNA 3RPQA 5GZGA 5CBLA 5FO9B 1TME3 4Q2FA 4YW7A 1KFXL 3ZXEA 1W39A 2X5IC 3SLIA 1V6JA 3CJIB 4IV3A 3VBFB 1HJGA 3ZMNA 2AREA 4BQ1A 2JICA 1WLCA 3HBZA 2JX9A 4DOUA 2BPA2 3MPBA 2XR4A 2ZX2A 3VDCA 2WC2A 2Q30A 3B69A 2ZEWA 3AMHA 4H7LA 3ZVXA 5DAXA 1MEC3 3BU0A 2J1UA 3FFZA 4HG6B 5FMOS 3VL8A 5HXMA 1LRHA 3GZEA 5FYUA 4CDXB 5JMCA 2E53A 4G9SB 4FXKB 1K5MC 1ENXA 2YG0A 4OMDA 2V09A 5C8CB 2Y6JA 4D7TA 1VMHA 5TSWA 2UYAA 1YQ2A 5F3CA 1ZBE1 4QGLA 4WV8A 3T1MA 5FZ9A 5FZKA 1Q43A 5BNNB 4GMP0 3T0BA 1MQTB 1HDKA 3ZKYA 1SFNA 3VBSB 3CF6E 3B7MA 1UZ0A 3QBQA 3OJBA 3WV6A 1S0EA 3T1LA 5IYYA 4FTBA 3VBFC 3H9AA 4P08A 4J1WA 2WNEA 1W0NA 2ARXA 1SQ4A 3O5SA 4D7YA 1O3SA 4XDQA 1AJKA 3MIFA 4LMFA 4QWNA 4YVSC 5LK5A 5F3IA 4DY5A 1PO23 5EHDA 1RXGA 1C5HA 1F4AA 2Q1MA 1RUH3 4L2NA 2F17A 1UY2A 3OGSA 1N1VA 4XTPA 4FOQA 1CZSA 4CDXC 1NZIA 1LHOA 2WZPP 5DAQA 1D2SA 2VZ1A 2Y38A 3VKLA 3GBFA 3N3HA 4LLOA 2B42B 2ZOEB 1IQDC 1UN1A 3H1MA 1ZZ8A 1I5PA 2VJXA 4PLMA 2RG4A 3ZYBA 3KWVA 5EFUA 3C3VA 3HNBM 5LA0A 2X29A 1G9CA 1Y9QA 2JXAA 1MQTC 4XTMA 4QX0A 3WQ0A 3VBSC 1SPPA 1D2QA 1OA4A 2ZGQA 4NRPA 1HB3A 4EWAA 3N7JA 3PVEA 2W9XA 3EYPA 5F37A 4Q4V3 3PUAA 1RUF3 4GKXA 1NCRA 4WVMB 5JSPA 4QB2A 1RUOA 2DCYA 4CU8A 2RJLA 4ISRA 1C8M1 3AC0A 3RSJA 1NQDA 3WW4A 1TNFA 3HQXA 5J37A 1O3RA 2AENA 2R073 5DG2A 1FPN1 2VBBA 1VBB1 4YLZA 3ZR5A 2N7GA 3RWKX 1EYBA 2E7QA 3J7NA 1AR62 4FAGA 4XF1A 1ASJ1 2OZJA 1SACA 3AYDA 4YW2A 2VCBA 3OGJA 1JMUB 2YGMA 4EROA 2XJQA 2GMMA 4OHXA 4N9IA 3BALA 4B8EA 3E6CC 2V73A 1UOGA 4MGKE 1GWLA 2F4LA 3SHRA 3VBUC 3O1UA 2DURA 4JKKA 4BQ5A 2ZAAA 4CCJA 2UY8A 2BWCA 3BTXA 3H1WA 4G3YC 1JS9A 4B4QA 4BK4A 2A6XA 4N90A 1W6PA 1LOBA 4YW4A 1IPJA 3USSA 4WM8A 1FOD1 4NAMA 3B01A 3RVHA 3TEZA 2VMDA 1R092 4M4PA 1AYN1 1GQHA 4PIYA 1UMHA 4CDUC 5JPMB 5E89A 4D6SA 3SITA 3NJZA 1JW6A 2D43A 1PK6B 3T2QA 2RDSA 2WABA 2Q8OA 1YI7A 5CFDC 3ZYIB 5JR2A 1ODMA 2RS53 2XXZA 1KS4A 3Q8EA 5JXIA 1XYPA 3OUIA 2B45X 1OSGA 2JB4A 2Y6LA 3VZNA 1GR3A 1Z7S1 2FQPA 2QVSB 3PHMA 1YJKA 5J09A 1RVF1 1GLHA 2GU9A 3AMPA 3O1PA 1SLIA 1CJDA 2QTWB 4FOWA 2ZA9A 4YGEA 1JZ6A 2CGPA 3WY6A 3B5LB 2VL4A 3UJOA 2PHUA 4IERA 2VOVA 3FBMA 3TNPB 2ZEXA 4HPKB 2VOWA 2VZTA 1IOAA 2WS92 4O65A 5F8PA 5ANQA 2FD8A 3VBRA 3MF9A 1STMA 3LGRA 2FHRA 5IT6A 4W8JA 1LU2A 4IUGA 4FI9A 3DKQA 1Y9GA 4EN0A 2H0VA 2QQJA 1SHWB 5C3QA 1W9WA 3I2IA 3UT0A 3DF0A 1PK6C 3OGGA 4Z1VA 1W8NA 1QH7A 1LGNA 5JOZA 3IDCB 5JOYA 5CKMA 2QNKA 4JGZA 2EAKA 2XH6A 2CWSA 1RL3A 1S0GA 2CDPA 3UK9A 1DQ0A 4ATEA 1N1TA 4YVWB 5IK8A 2VTXA 1T6GC 2YB7A 2GAUA 1UW8A 1H1AA 2QQVA 3E5QA 4UFMA 5FBZA 4CCMA 2PTMA 4Y3OA 1RMU2 3THCA 5C8CA 5A7QA 4A6SA 2IXCA 5I8TA 5A7OA 3E5UA 3MBWA 1BCXA 5L19A 5BNNA 2NMNA 2NQYA 5F1RA 1S0BA 1ZA7A 3P6BA 1E5IA 1REEA 1WWYA 2WZR1 3AM2A 4CCEA 1CIYA 1PGSA 3M70A 1A3KA 1ULEA 4AVAA 4Y5TA 1BYHA 1ND2C 3WDWA 3GBGA 4UW3A 1F8VA 1POV1 3GNEA 1HXS1 2OT7A 1AXYA 4YVWC 3OCPA 3U10A 3FZ3A 3IBMA 5LA9A 1VB2A 3MZHA 1V6OA 1QH6A 1VBC2 3ZYFA 1QU0A 1W8ZA 1HIXA 3NV2A 1RUC3 4IEYA 3K75B 3VD9A 4YGCA 3S5QA 2AZ5A 3TRSB 2YUEA 4LO5B 1PMHX 4GMP3 1VBD3 4XEZA 5KBFA 4QX7A 2B9UA 4TLGA 5FLIA 3WG4A 3ZXGA 4CUBA 2VBDA 4COYA 4Z82A 1F5JA 4PI0A 1F2NA 4Q4W3 4XOGA 3U11A 3KVBA 1FATA 1H4HA 2YBKA 3N9LA 4QPWA 1W03A 2LW8A 3NO8A 1JZ4A 5JWPA 1PZ7A 1YO8A 4OMCA 3O1OA 1JYIA 3I2FA 1U5XA 2EICA 4BIFA 1R1A1 4YZ2A 2AEYA 2DCKA 4F3JA 3FBYA 2ET1A 5EP9A 4ZXKA 2R0FA 5F5AA 1AF9A 2RMU1 2Y0OA 4P5YA 5KHIA 1RUJ2 2WO1A 4XMAA 1Q5OA 4YNIA 3IB3A 5IHRA 3WR0A 2W91A 1AR71 3OBZA 3AP5A 4PLNA 3RI9A 3KF5A 4TWTA 3VL9A 2YFUA 1CAVB 3IT8A 3VBHB 1VBE1 1SBEA 2GN7A 1BHGA 2XJPA 3HPNA 5LEKA 2VW0A 4QAWA 4JX0A 3S0MA 1LU1A 4KWLA 4DFSA 1POV0 2I45A 3WINE 1QF3A 3FLPA 4I02A 2HWF3 4HMZA 4Y1UA 5HXVA 1JBCA 2HEWF 2YPJA 3ZXFA 4FTSA 4XMIA 3QLQA 5JPNB 4NHKA 4M3CB 5FYMA 3WT3A 2RHPA 2VVEA 3WNXA 2P3JA 2YXSA 4NJ4A 1MZ5A 2IVIB 2ZGSA 4NIAA 2V5YA 1KS5A 3BGAA 4CUAA 2VMFA 3HN3A 3IMNA 1MEC2 3LFIA 4LBLA 4XBLA 4CVUA 1ZBA2 3AVRA 3NNJA 3I54A 2R061 5A70A 1WCDJ 2WNVB 1JYWA 1O8PA 2NLRA 2YPDA 4AVBA 5C7GA 5EJZB 1IS5A 3AKRA 4K8FA 4KU7A 3OYWA 4ZZ5A 4XZUG 1ENQA 1VP6A 3FUQA 4N53C 3WDUA 3JD71 4AWDA 2XVKA 1UZYA 1YRZA 4XF4A 4YRDA 2FCUA 1S2EA 1V00A 1JUHA 1W2TA 3VGIA 3R4UA 1NA1A 2ZHNA 3BIEA 4LIVA 2C5DA 5BNPA 1P8JA 3SH4A 3WW3A 2WO3A 4MGIE 1YYNA 5D21A 1UYXA 5DZFA 1PO22 1QJX2 4EQVA 1UQXA 1VE0A 2DYCA 4OUSA 5FZ4A 2BVVA 5FY1A 2C6SA 2Y60A 1X9PA 1FMD3 1J84A 2R7EB 2WNVC 2A3YA 2K2SA 2ADDA 3ZXDA 4N7UA 1GOFA 4I3PA 4HT1T 5F5CA 3KV9A 5CEHA 4GB33 3OB8A 1KD7A 2WSUA 3MYXA 4GWNA 4HLTA 1AVBA 5LB6A 1S0DA 3AX4A 4ET7A 2DUQA 2VTFA 5EYXA 4OI0A 3LDRA 3ROUA 4ISQA 1HRI2 2BWAA 2E26A 1BEV1 2CSGA 2IXHA 4UFJA 1ENRA 4QPGA 5FUPA 3VZLA 1NQJA 4TN7A 5L7OB 3KT1A 1RUG1 1U0AA 2VO5A 4FPGA 1OMIA 1YQ8A 3OSDA 1F5FA 3RZMA 1UMZA 4CP0A 4TLFA 2DFCA 4FSJA 2GC0A 3M4FA 2XQXA 2R072 2IZWA 4XF3A 3WHTA 5CYYA 3QD6A 1HN1A 4B3NA 1FT9A 1XU1A 3ACFA 1QDOA 1CESA 4LR4A 2W47A 3N36A 1BBT2 2KXLA 5A32B 5A3WA 4NRMA 4C1WA 1LODA 5FZLA 1DQ1A 1KFUL 3K48A 4XFAA 5T5PA 1NXD1 5KHKA 1OOPC 2SLIA 3ALQA 5FOBB 1H9WA 4NHYA 1D7PM 1GP5A 1YHFA 4LBQB 2KR2A 5FOJB 1UX6A 1GZTA 1W9TA 3AKQA 4L92A 2TBVA 5FPBA 5IVYA 3U4SA 2GNMA 1O4TA 2QQUA 5DMYA 1TG7A 4RS5B 4IGQA 5C8WA 4Q0PA 3DUIA 5C70A 3HBKA 3H8XA 1CIWA 3SNMA 1KJLA 4LBNA 5T54A 4A4AA 1SLBA 2OA2A 1H1IA 4CDQA 5HBAA 3H42B 1RUI1 2VY0A 2HWD2 4Q29A 4QPIA 4RHV3 1S4CA 2VNOA 2PAKA 5F9TA 1JI6A 5F6LB 2JD4A 1LCLA 4NN0A 3PVOA 4NPRA 2XBO3 3RS6A 5C9AA 4C1XA 3O0VA 4AQSA 4CRQA 1VAMA 2W46A 1VR3A 5D1IA
chains in the Genus database with same CATH topology
1EPWA 4ITCA 4P9GA 5I0SA 1PO11 3WUDA 2RS52 3RMXA 1IPKA 1YNAA 3CJXA 4LTAA 3WP6A 5JI7A 1DDLA 3ZSKA 2GC2A 4JDNA 4U2AA 1V9U1 5CB7A 3WP5A 2DV9A 4HK8A 1S1AA 2HWC2 2FMDA 4XXPA 4XBNA 1HRV1 1IKPA 1EY2A 3KMHA 1PIV2 1WD4A 4Z07A 3WP3A 3JQXA 1Y3TA 1W6MA 4AE2A 1RUD1 2C0ZA 3N7LA 3TOJA 3WUCA 5FMOL 5GLWA 4FPKA 3TBDA 1JUIA 1MVEA 3POSA 3M3IA 3PMSA 4M3CA 4XYXA 5C4WB 4OVEA 4P9WA 1PVC1 4AFAA 1DQ6A 1GNHA 1MS4A 4F7ZA 3NV1A 3WVJA 5E16A 5T50A 3MIGA 2E63A 2WZR3 3J4UH 4IEPA 4W6XA 5GLVA 1QJY3 1H2LA 4QXKA 3KCXA 5BUVA 1TMF2 1I3HA 1LOAA 4W6WA 2Q4SA 2RR11 3AB0A 3TNQA 3JQWA 4NWVA 3OD4A 2ZGPA 2JG9B 5C4WC 1EPZA 3AYEA 4ONUA 3FE5A 2O8OA 2GH2A 3PVNA 4R8HA 1X7NA 2VVDA 4BE3A 1N47A 1PHMA 4GH4C 3UKVA 2RM21 1SMVA 2W52A 2PN5A 4KNCA 2NM1A 4Y1VA 4YM0A 1COV2 4CTEA 1YXWA 3WCRA 4UXAA 5EZWA 3ZDSA 2RS11 2NZ9A 1V70A 1VBD2 1BKZA 1MZFA 3ZSLA 3BPZA 2RMU3 3WD5A 5K0UC 2A6VA 4YGDA 4Y26A 4YW5A 2JG9C 2PLV1 3FMGA 3AMMA 1BZWA 1CAUB 2R1BA 3M3OA 3RYKA 1LEDA 2QCSB 3N4MA 3ILNA 4XQWA 4LUKA 3GHNA 2PHRA 2MHFA 4NWWA 4URTA 1IS4A 1H1MA 5H9PA 3DL3A 1CVNA 3I59B 4IEUA 4PBOA 1KRIA 4RR3B 4IV1C 5CU1A 3KGZA 1AR93 1ZVFA 4JAAA 4LHLA 1RJ7A 2HWF2 3KLSA 1I9RA 4QT6A 4QU2A 1B35B 3UV9A 1ZX5A 4RS5A 4XIKA 3S30A 2VW1A 1ZBE2 4HL0A 3HT1A 4QM9A 3GZUC 2MEV1 3RG0A 2WS93 2WWSA 3GF6A 2AYHA 1WLTA 3JD73 5KHHA 1EAH1 3R4DB 2Z2SB 3IKWA 4F83A 5KWRA 4GQ7A 5LRSA 4FCAA 3ZN6B 4MSVA 1J3PA 1Q8PA 3IPVA 3NKTA 4IXLA 3IWZA 1WW4A 3ZO0B 5A3LA 1S2BA 3VHPA 4NHMA 2Z42A 3VBOB 1QXPA 5J36A 3R4SA 1TEIA 2DCJA 3IN9A 3ZIWA 1ZZBA 5B2GB 1RGSA 2ZZQA 4K40A 1OD5A 3ST7A 2CV6A 2BQPA 2BNMA 4K21A 1CAWA 2A75A 1W6NB 1WD3A 1D4M1 1SFYA 4CEWA 1I1EA 2QKDA 3VZOA 4AG4A 1FMD2 1GKBA 2LTNA 2ZGMA 2BFUS 1X82A 1MS1A 4AFDA 4E4DX 1F31A 2IXJA 2ZX0A 2D6LX 4X6RB 1WMEA 4GA9A 1LULA 1Q8OA 1IS6A 4DPNA 5ABJB 4BMEA 3AKPA 2R043 1VBC3 1IGOA 1FPN2 4D69A 1VBB2 1NY71 2RJKA 4K7JA 5FO7B 4Q0UA 3D6EA 3AP6A 1ASJ2 4XIOA 1QJU1 4A7ZA 4LULA 4XHXA 4QQLA 1RUNA 4OHVA 3BOPA 1SDWA 4I09A 3DPRA 4YM3A 2X5IB 4LO8A 4AW7A 3ZFFB 2UWAA 5ABJC 1O4YA 2TUNA 2VNGA 2CYFA 3DKWA 4AEJA 4AHZA 1AR81 1DU3D 3ZSMA 3AXEA 4QQPA 3B9CA 4OHWA 3NV4A 1AYN2 4IEXA 3ZFGA 1K5MB 4LE3A 4Y1ZA 1MS8A 2P3IA 4OI1A 5I8YA 4EN7B 1AXKA 1J1LA 3V0AB 2DUOA 4KG8A 4YGBA 1QNWA 1UL9A 1C28A 3PVBB 4AHYA 3VKFC 1NCQC 1PO13 5GLUA 4L8QA 2HEYF 4IESA 5HCFA 2O0OA 3NAPB 4X6QB 1WCSA 1ZYBA 1A78A 1DZTA 2Z79A 2XBO2 4LBOA 4AEKA 3OY8A 3ZFFC 3AJZA 4YVSB 3B00A 4XFGA 1CAUA 2P37A 2VUAA 3RNSA 4QM8A 1J58A 1RHI3 1ZBA3 4LEJA 2EAAA 4KQ7A 4AQ2A 4ORFA 5DXDA 3SCGA 2DTYA 4Y22A 1LKNA 4Y20A 2XWBB 3ZFEB 4FP2A 3N35A 2ZHLA 5IK4A 3H3ZA 2H0BA 3NAPC 3I59A 4XBQA 2PA7A 1LOFC 4RR3A 5L36A 3TN93 2Y26A 1NLSA 2JG8A 2VNRA 4CEYA 4RD7A 2WQZC 1QMJA 4O9GA 1B35A 5AVAA 3CO2A 2XVLA 3D0JA 4Q4Y1 1QJX3 3INAA 1J3RA 1U12A 1U5IA 2DVBA 1AYM1 3VBRC 5FPZA 3WG2A 3PTYA 2WZR2 1FI2A 3ZFEC 2EALA 3ZN6A 1WGPA 1G9DA 4RQPA 1PM7A 1Q56A 2RE9A 4JDMA 1QJY2 3R05A 1WA4A 2RM23 4M3CF 1HRI3 1H4GA 3ASIA 1QQP1 1Z78A 3HN1A 5DUXA 3VBUB 3WOGA 2E51A 3V0BB 2A3XA 2RS13 2DVFA 2VH9A 4K1ZA 3ILRA 5BPXA 3NVCA 1O4ZA 3AKSA 1WLDA 1DHKB 5FQ0B 1RB8G 3C2UA 1CPNA 3D5OA 1MZEA 1PGW1 3WZ1A 2WFF1 1REDA 4CDUB 1BBT3 2PLV3 4OI2A 5BXXA 5JSOA 4K20A 4AHXA 5KXDA 2QDRA 4XJ9A 1R1A2 4N9HA 4M0HA 4QHBA 1EV11 4WM7B 1DFQA 1UPIA 2HWE1 2EF6A 1RUE1 4M3CE 2RMU2 5CFDB 3THTA 3NL1A 1ZZCA 3E97A 1AR72 4D94A 2PHWA 2ZKLA 1DGWA 2OVUA 3LSDA 4AHWA 2UYBA 4I30A 1ZREA 3M7AA 3LWCA 3L2HA 4OULA 3AYCA 2HWD3 4AFBA 4B7KA 3H3UA 3AKTA 5CFCB 5LRRA 1VBA1 3LZZA 2GSYA 1GANA 4MXWB 4Z2WA 1CR7A 4JVAA 3SCHA 1QOTA 2X5IA 1RC6A 2PYTA 2D44A 4CDWB 4PDWB 1VRH1 5HCAA 4KL1A 4RGGA 4WM7C 4YW1A 2ZHMA 4AI3A 1KDMA 1AR92 1YUDA 1QJZA 3D8CA 5BNOB 5IK7A 1A8MA 2R062 4PBPA 4BH9A 4KWJA 1K5MA 4LBJA 2HWC3 2E9QA 2XJUA 3B02A 1YIFA 3AFGA 1O3QA 5CFCC 3JD72 4N7IA 3RQ0A 1PIV3 4COZA 3N7MA 5H9QA 1FV2A 1M4WA 2Z69A 1NYWA 1QOOA 2VG9A 2A3WA 4BOWA 1DYKA 1AXZA 2G9GA 3CJIA 4JGYB 4R52A 3VBFA 4CDWC 4PDWC 4HK9A 1GZCA 1GYKA 1ND2B 2LALA 2R30A 2ZPXA 4YVSA 1GNZA 1D4M3 2B39A 4LA2A 4FPOB 3TYJA 2O8QA 5BNOC 1JYCA 4MLOA 1HV0A 4CDXA 4E4SA 3PNAA 3JBG1 4NO4A 3S7EA 3AK0A 1GFF2 5GLZA 1AJOA 4XHBA 1KDKA 1TMF3 2ZGRA 4YM1A 4YZ4A 1DIWA 2VGDA 1MQTA 4BPZA 1QXRA 1VAVA 3VBSA 4E2QA 5A33B 3FFQA 1SBDA 1MZ6A 1PMIA 2W08A 5J3UA 4JGYC 1NA1C 3FX3A 4TSVA 4LT5A 3V65A 1ZZ7A 5L73A 4LO4B 3BB6A 1VJ2A 4I0WB 2R042 3MIBA 5AFEA 5GM0A 1COV3 5JOWA 2WNUC 3GALA 4YSFA 4XF0A 5JOXA 3P3NA 4EN8B 2P2KA 1ND3B 3B9IA 3MW2A 5D8AC 1AX0A 4FPCA 4Q4X1 3AP4A 4BHPA 4YM2A 1QHDA 2FBEA 4WVMA 3FC0A 1LGBA 3V0BA 5LEJA 1KJRA 2ZBJA 3RMYA 3NV3A 2ETEA 2OIIA 1OLQA 3O12A 4JQRA 5I91A 4A2UA 1S0FA 3VDDB 4KGQA 4CP1A 1OQ1A 4QX5A 4CDUA 2ZZJA 3JU9A 1PO12 1AR61 1WLWA 3B93A 5FTTC 4N53B 1W6OB 2VQAA 4WBBA 5FREA 4C0HA 4Y4YA 1BMV2 4HN1A 2XKOA 1ND3C 5CFDA 1MS3A 1PGL1 1N1YA 2D5FA 1V9U2 1XNCA 1ZBE3 1QXJA 3AYAA 1HKDA 4Y24A 1DQ4A 4MV2A 1CN1A 4META 1AZDA 4QD2A 2GH8A 1RHI2 3VDDC 2IWGB 3EHKA 2XWJB 5IUQA 4JCKA 2JDZA 3ES1A 5C9AC 3I2DA 2W39A 5LK7B 1SLAA 4Q4Y3 4X8PA 1PK6A 4FQ4A 4H55A 1QY4A 1PVC2 3O7OA 3MFCA 4LBMA 3TN92 1AYM3 1JXNA 3W58A 1OPMA 1CQ9A 1UZZA 2HWB1 4H3WA 4XETA 4I2OA 4OFGA 2ZGTA 4Y1XA 3W59A 4DZGA 5KHGA 1LEMA 4HPKA 1IS3A 1VIWB 3OPZA 4N43B 1MS9A 1CX4A 3USUB 2RR12 2YGLA 1LHWA 1JH5A 2SBAA 1DGRN 2ZAHA 3MGUA 4IEWA 5CADA 5J7MA 2PAMA 4ES8A 2LM3A 1JHNA 4XF9A 1C8M3 3CNAA 3M3CA 1J1TA 1ND2A 1OOPB 4IEVA 4FQZA 4FTEA 2RM22 3I7DA 5CNAA 2PHXA 4I0AA 4YVWA 1FPN3 1VBB3 3IM0A 4BYYA 2I74A 3X29B 1YFUA 5CG9A 3H1YA 1ULDA 3JB4C 3R0RA 1ULCA 2BFUL 1ASJ3 2DVGA 1HV1A 2RS12 3I8TA 3TB0A 1RMU1 2UWCA 2X8KA 4X8NA 4N43C 3OTFA 1YIPA 4BIOA 2A7AA 1QGLA 3HD8B 4BM8A 2CWMA 2PLV2 4D7SA 3MLKA 1XNKA 5JAXA 3GZTB 2EXHA 1FOD3 3GBWA 4IEOA 4V1PA 2WA3A 3LSEA 5ACA1 1H8TB 4C91A 1HX6A 3O0WA 1AYN3 3KQRA 5DDJ1 3W9AA 5CAZA 4M00A 3FJSA 1GSLA 5SV5A 1VRH3 2VOXA 4Q1RA 4FPLA 5JZGC 1S0JA 5JSRA 4OHYA 1R1ZA 2R0HA 2C9AA 1VALA 1C3HA 2WINB 1Z7S3 1D0GA 1RVF3 4I01A 2OPKA 2YV8A 3ATGA 1A8DA 4XFBA 4O9EA 3ES4A 4AEDB 4LHNA 4Q1PA 5KXBA 2MEV2 4HN0A 1FYUA 4H14A 1H8TC 1ZRCA 3POYA 3MIDA 2ATFA 1Q8VA 4JTOA 2D97A 1CAVA 1RIRA 1MVQA 2HYKA 3LOIA 4L11A 3RWNA 3HMYA 3VBHA 5IK8A 1LHUA 2PELA 4LBQD 3ZXJA 3QOPA 4N53A 2ZKNA 4JTNA 1C1LA 1EP0A 1DGWX 1W6QB 1AL21 3TAYA 3M8LA 3RDIA 1TME1 4AEDC 4XFFA 2JJ6A 1Y43B 1N1SA 2W0XA 4OHZA 4AVTA 1D4M2 3LA3A 3H7YA 4KBBA 4GH4B 4ZKTB 1WMFA 1R081 1MEC1 2WNVA 1XRUA 3B94A 4RSUA 3AZXA 5T5JA 1NZCA 1OQEA 4FPEA 2XUMA 1URXA 4Q27A 1POV3 1HXS3 1XYNA 3OBTA 2NPIA 1IQAA 3EJKA 5K0UB 2TNFA 5AFBA 2PFWA 3FLRA 2OZ6A 3R6SA 1QJU2 1H8VA 2GNTA 2ZCWA 1I6XA 2ZX4A 5HI0A 4CEWC 4HVRA 2QZ3A 1AX2A 1RUH1 3AP9A 4HKWA 4DY3A 5KC5A 3S7IA 5JLVA 2DU1A 1BVVA 4ASLA 4TZDA 1R1A3 2GC3A 4IV1B 2X53S 5FPXA 1UF2C 4XFHA 4RFT0 4ZU5A 1AR73 1DZQA 4FBFA 4HKLA 2VULA 4SBVA 5L7OA 1VBE3 1CGPA 2BW8A 4XPVA 3JB8A 1D4VB 1WW7A 1WMDA 2GMEA 4Q4V1 3TWIA 4K3UA 1OA3A 1RUF1 4XZPA 3K51A 1IZ3A 3H50A 1BQPA 4JV4A 4WZCA 5JR7B 3FHIB 3DPRC 2R071 4IV3B 3KZ4C 5A32A 4HETA 1OPOA 4MZUA 4KWKA 1UD1A 4R9BA 5KC6A 3AZVA 2IXIA 2VW2A 3HWJA 4LBQA 1HQLA 5I0TA 5T5OA 2R063 1XU2A 4XXAA 3WDTA 2MPFA 2D40A 3LAGA 3SCFA 3AMQA 1FXZA 5I8SA 2F4PA 2A73B 1H2KA 3MIHA 1BJQA 2NN8A 4GULA 2IFRA 2R16A 2Z5WA 3WQ1A 2BTVC 1KITA 1PNGA 4IV3C 2HWB3 1V6IA 2RS31 4OZXA 4EJRA 1IHMA 1LHNA 3ZSEA 1W2UA 1H9PA 1Y7BA 5CA6A 4Q4Y2 4DMIA 4RL7A 3NWKA 3JCIA 3ZX7A 3WCSA 2ZMNA 3J26N 1AYM2 2F6BA 3HIFA 5FCCA 1FNZA 2BVBA 2RS51 2B7YA 3FUOA 2D3PA 2Q0AA 2HJIA 1LOEA 2XJRA 1LECA 3RJRA 4LBKA 1PVXA 3VHOA 1BEV3 4WVZA 1ZZ6A 1QQP2 4SLIA 5DUWA 3ZXLA 4AF9A 4PF5A 4YG6A 3MLJA 1RUG3 1SCRA 2CY6A 1NCRB 2VMGA 1C8M2 5C4WA 5JVVA 4I0BA 1C5IA 3LA2A 4WVVA 3QCWA 2IFWA 2D3RA 4GH4A 2QJVA 2NYYA 1W0OA 1PGW2 2PHFA 1SLCA 2WLQA 5AC91 2ZMKA 4XQDA 4Q0QA 3EO6A 1S0IA 4RQPC 1ZRDA 1NCQB 3LKJA 4DNYA 2QFEA 2HWE2 4Q8KA 4XQ4A 1ULFA 5CG8A 2K9ZA 2DFBA 4LE4A 4MXVA 5K0UA 3THPA 1N3OA 2YMZA 3MI8A 2JG9A 4AI2A 1NCRC 1UAIA 2DUPA 4YARA 4Z92B 1RUI3 1V6NA 1FOD2 1W6PB 4WM8B 1SLLA 1WW6A 3VKOA 4AVVA 1X8EA 1VBA2 1JOJA 1PZ9A 5FO8B 2ZABA 5KXCA 4DRRA 1LTEA 2D6MA 4HKOA 1BVP1 3ZSJA 2BNOA 1VRH2 1RUC1 3V64A 2G4IA 1YI9A 3KSCA 3ZYRA 3ZXKA 2A6YA 1UKRA 1NLRA 1TE1B 2R32A 3RI8A 1FX5A 1ZA4A 1Z7S2 3PLQA 1RVF2 1X33A 3O0XA 1REFA 3WX5A 1V9U3 3L2YA 3AJYA 4Q4W1 2BGCA 2PHDA 1C1FA 4QQHA 2UU8A 4MX3A 2QE3A 3J8F1 1HRV3 4WM8C 4EN6B 3I4IA 4M0NA 1FV3A 4LUMA 4AEMA 1OFSA 3VLBB 1ONAA 1RUD3 3VBRB 1AL23 2D98A 2ES3A 2DCZA 3DN7A 1YFXA 2D6KA 1PVC3 4HSJA 3P3PA 1QKQA 4MH0E 4QQOA 1O3TA 4S2HA 4JGZB 4XW3A 3CEWA 4FOYA 1Q3EA 4IEQA 2A70A 1V6LA 1R083 2BUKA 2DCTA 1QWRA 3JBG2 1LJ7A 2HWF1 4P9JA 2JEMA 4FPFA 1SEFA 4Y1YA 3BCWA 2DWRA 1RJ8A 2UY9A 2RR13 1O5LA 4TYSA 2VMIA 3LCPA 2H6CA 3LB9A 2XJSA 4KG0A 2NMOA 3CJIC 5I93A 1HXS2 4JGZC 2R6QA 1J59A 3VV1A 1NXMA 4I3GA 3VBOA 2ENRA 2QUOA 4XJZA 2KA3A 5FDBA 3ZIXA 3ZYJB 1GV9A 4AI0A 1G6NA 5H9SA 4BCUA 1U5YA 1O7FA 4FPJA 5IK5A 2QDNA 5C8CC 3SH3A 4P9IA 1NE6A 1W6NA 4XJAA 2WL1A 4LHKA 4ZU4A 5FAXA 5BNNC 2CGOA 5T3NA 4AGVA 1YFWA 2CNAA 3OD0A 4Q4X2 3RZZA 1FMD1 3GHMA 3KM5A 5FFOC 4EV0A 4R9AA 1G9AA 3MF6A 4M01A 5ABJA 2UWBA 4GB31 4OUMA 4E27A 1AL0G 4A7YA 1H2MA 2WFPA 3L9JT 4NVPA 3KGLA 4AQ6A 1FNYA 3IIAA 1F9KA 4W65A 2WQ4A 1VBE2 2AGSA 2I07B 4BWOA 3E5XA 1NCQA 3AP7A 1ALYA 1NG0A 3CL1A 3SH5A 4YFZA 4F8AA 4IETA 2XLAA 4HBNA 2GDFA 1PGL2 2GN3A 1CAXB 3WG1A 3ZFFA 1PZ8A 1RITA 5I0UA 2MEV3 4UW6A 2DTWA 3ACLA 1RTVA 4PQ9A 2E7TA 2PQQA 3MIEA 4HZFA 1EAH3 3MICA 1V6KA 1Q8QA 2BNNA 4C0BA 3VZMA 1CD3G 3FLTA 4YFWA 5EV7A 1SCSA 3Q9OA 2RS33 2WKKA 2FZ1A 4AGGA 4XFIA 3V0AA 4P14A 3OYWB 5JI9A 4CYDA 1HLCA 2EIGA 1YFYA 4YZ5A 5SV8A 3NAPA 1LESA 2R49A 4RHV1 3A0NA 1LOFA 2ERFA 2WLPA 3KS7A 3WP4A 4AXOA 4Y5Z0 4ATFA 5A3MA 3URFA 4DRVA 1NA1B 2HWB2 5E1RA 2XBO1 4JDOA 4YG0A 3ZPYA 5BNPB 4S2FA 4NHLA 3VZKA 1LB2A 1AX1A 2PHLA 2JENA 3BU7A 5GZEA 4CZSA 3OBRA 4PLOA 2A6WA 1UCXA 4AFCA 2VUJA 3EXUA 2A71A 3U4XA 3ZFEA 1BK1A 4Z8BA 4PCRA 4FOVA 2WNUB 1V6MA 3U0ZA 4IL7A 2ILMA 1BEV2 4XJUA 1XXNA 3MDPA 4HSLA 2AR6A 5D8AB 5AC93 5CIRA 1RUG2 1WBFA 3NKGA 4COWA 2QZ2A 4QPGB 5BNPC 3M3EA 1QJU3 1ENSA 1LOCA 4IEZA 4LA3A 2ZX3A 4GALA 2Q1ZB 2AUYA 3A0KA 2YHJA 2EXJA 5K9YA 3WW1A 5J96B 3ZMOA 1AR83 2B5HA 2ZTNA 2BEOA 2CL2A 1MACA 4YYOA 1QJY1 3AZYA 5ACA2 2Q5TA 5EXOA 5H9RA 3CLPA 4GWMA 2ZGNA 4RA0A 1TNRA 3G6JB 4ZU7A 4QPGC 3VBUA 5DDJ2 2FZ2A 3BOWA 1RUI2 1UU5A 4CDQB 4E2SA 1DBNA 3D82A 4FXGB 2H6BA 4QPIB 3GYDA 3E6DA 3H8UA 5FQ0A 5F6KA 4PJYA 4QPYA 1UU6A 5C9AB 2VOKA 2C1FA 4AFMA 1I5ZA 4AYUA 1JTZX 4Q0SA 2GNBA 5K7PA 3J8F3 2A5ZA 5J98B 1XQNA 4BLIA 3ILFA 1OKQA 3PMEA 2ZGUA 4WM7A 3NSTA 2XHKA 3SXWA 2GNDA 2ZACA 4CDQC 5JCTA 2BYVE 1HRV2 2XLFA 4QPIC 5GKAC