4AF9A

Crystal structure of epithelial adhesin 1 a domain (epa1a) from candida glabrata in complex with galb1-3glc
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
228
structure length
228
Chain Sequence
ASKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNREYDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
molecule keywords EPA1P
total genus 60
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4af9A00
4COYA 2XJTA 2XJUA 4AFAA 4AI3A 4AHXA 4LHLA 2XJQA 4CP2A 4AFCA 4AFBA 4COZA 4CP0A 4D3WA 4AI1A 4ASLA 4LHNA 2XJVA 4GQ7A 4LHKA 2XJPA 2XJSA 4AHYA 4AHZA 4COVA 2XJRA 5A3LA 4AHWA 4AF9A 4AI0A 4A3XA 4CP1A 4COUA 4AI2A 4COWA 5A3MA
chains in the Genus database with same CATH superfamily
4HOOA 1JZ5A 2EIEA 3KCYA 4Q29A 1T2XA 5H9RA 5FY5A 1R1A1 4FVVA 1V0AA 1Y9GA 4QXCA 1GNHA 1OPOA 2WWUA 5E88A 2ZGOA 3RZGA 2VR4A 3L9JT 4Q1RA 1JYIA 2HWC2 5EJ3A 2AEZA 3N9MA 3WDYA 3EHKA 2QQIA 1TEIA 4PIYA 1NA1A 4CEWB 5C8CC 4Q26A 1US3A 3BOWA 4N43A 4NIIA 3ILNA 3S5QA 5CIRA 4Q0SA 4DY5A 3GZUC 1WZXA 3NJVA 2K2SA 3RZZA 1POV3 3UK9A 1KGYA 2R062 4X8PA 1K12A 3ON7A 2ES3A 2W3JA 1QJX1 2DVBA 1LULA 2PHXA 2ZBJA 3SKVA 4GWJA 3D5OA 2D44A 3BTAA 1PNGA 4IE5A 1AVBA 5ACA1 1KQRA 5L9RA 3NNJA 4KL1A 2JDHA 2PAMA 5FZ8A 1CESA 3O1MA 4IEUA 1F31A 2KD7A 2QQOA 1QOTA 1C28A 1AL23 3A21A 2Q5TA 1GFF2 4LO7A 1R082 1OXCA 1LOCA 3ENRA 4MLOA 4YVSC 3ZN4A 4CCMA 4HANA 2QKDA 1YQ2A 2W1QA 3ZM8A 4CTEA 5F1RA 5KWRA 1X8MA 4AEDC 1T6GC 1DYPA 1PO11 2R7EB 2VBBA 3PHMA 5GLZA 1S2EA 4ISQA 5GLUA 4BLJA 2R042 4XILA 5LA9A 1F2NA 4AGVA 5C4WB 2ZMKA 4MVTA 4WM7A 3U37A 1K42A 1GBGA 4BXFA 4Q4V1 5JCTA 5H9PA 1FOD2 4Q0QA 2VM9A 1G9CA 1EYBA 3LZZA 2FDIA 3SMHA 1CQ9A 2D6PA 4XF3A 5GZFA 1LEMA 1BEV1 1J1TA 4WV8A 4KNCA 1O3SA 1BYHA 2WLQA 2JG8A 3SH5A 2VU9A 3H8XA 5HCHA 2I2SA 5EWSA 3VZNA 2WNUC 5CB7A 3TBDA 3LWCA 3AKSA 1GKBA 4IEZA 1NCQA 5T50A 1K5MB 4CDWA 4JKLA 5EFUA 4FPCA 3IDEA 3WCSA 1VBE2 4LBQA 2PAKA 5LK5A 3ZYGA 5DAVA 3C7OA 5FZ7A 4XCBA 1F4AA 5BNPA 1VBD2 4JHZA 4GQ7A 1OMIA 4JGZC 4A7KA 3I97A 3UKVA 2YGMA 3AP4A 1GANA 1SCRA 3D82A 5FO7B 3ZSKA 1WW6A 1AR82 2JDZA 4IUGA 3ZIXA 4AAXA 5KBFA 3OGSA 1QXRA 4PF1A 4KGQA 3IDAA 2QUOA 1AR61 3VKNA 4A3XA 1O3TA 4YLZA 3JQXA 4W6XA 4B3NA 3VUOA 3NQHA 3SNMA 3VBSB 4EJRA 4LBLA 4XQDA 2JDAA 3BU7A 2V73A 1YQ6A 2CU5A 4IE0A 4XHBA 2QQPA 4LK7A 3VV1A 3ATGA 2RE9A 4LE3A 1NCRC 3S7IA 4EZ4A 3GHNA 2QQKA 2BQPA 3TOJA 2HEYF 1KRIA 1GP4A 1HJGA 3N35A 3DPRA 4LHSA 1UYXA 2ZS6B 3LFIA 3N9PA 5I0UA 2J1UA 5B4NA 4CDQA 2BU9A 2A75A 5FY0A 3VDDB 1JYXA 2XBO2 1Q56A 1ZBA3 3AM2A 5TSWA 3POSA 1V6IA 3VBUC 3ZFGB 2BGCA 5BV6A 2CGPA 3KD4A 1R64A 2GAUA 5A32A 1K45A 2WC2A 3AXEA 2G9ZA 3KHBA 5CFCB 4QB1A 1J58A 5A3MA 3UGFA 4HKOA 4EN7B 2VCMA 1MQTC 2RR11 5EXOA 1S55A 4FPHA 4WZFA 1W8OA 4GWIA 1JYTA 4Q4X3 1SBEA 1NG0A 2P37A 4QDRA 3H1YA 2VNVA 3OGJA 3RGBA 1QGLA 2V5DA 1PO21 2VZUA 1VB4A 2JKXA 4GH4C 4LHNA 4EYUA 4YSFA 4YWAA 4COVA 1MACA 5F2SA 5FLHA 2QDNA 1PVC2 3NNGA 5FRAA 2Z4FA 3THPA 1W0NA 4B7KA 1HV0A 1YYNA 1W99A 2ADEA 4M3CB 1NUKA 3AMPA 1CAWA 1MEC2 4TZDA 4Q4V2 4UFJA 3I7DA 4TSVA 1S0FA 3POWA 5CVRA 1CR7A 4IV1C 4PF5A 1EAH2 2GZWA 2XG3A 4EV0A 5A1AA 2PN5A 2NYYA 5JI9A 4HPKB 2FQPA 1D2QA 1MS8A 1RUI1 3MEPA 4XF9A 5BNOC 2RS53 1DCSA 4BWOA 5HCAA 2DFBA 4GIQA 4HVQA 3GNEA 5DAPA 5C3OA 1HB3A 4DRVA 2CHHA 5EYYA 3O1TA 3IM0A 4QHZA 1MVQA 4IERA 5T55A 4CDUC 3EYPA 5FZ3A 1S1AA 5FZAA 3MLKA 4UF0B 4BA6A 4Z1VA 3AYEA 4Y5Z0 3ZSLA 4RFRB 3FHAA 4GMP0 4XJ9A 3VDCA 3JD71 1X7NA 4RQPC 3R4UA 1I6XA 2LALA 1RUE2 1B09A 2HWB2 3W5MA 2WRAA 4XEZA 3Q8AA 2RMU3 2R16A 5K9YA 1TE1B 2ZPXA 5DG2A 2VD7A 5JR2A 1SLAA 4N43B 4CP0A 2GU9A 3I2OA 3ZIWA 2ET7A 3AYCA 5ANQA 1HRI2 4XBQA 3QOPA 4AHYA 3HWJA 2OQ7A 4M0HA 4AYUA 2WZ8A 2WJSA 1YFXA 2VTXA 4FT8A 3ZFGA 1X50A 4COUA 2B8MA 1G6NA 2BWAA 3O1PA 1DGRN 3M3QA 3RYPA 4XJAA 1R081 2V5YA 1ZA4A 2GN7A 2O8QA 1POV1 5FQ0B 1HXS1 1EV13 1LESA 4HK9A 4LMFA 2A7AA 4Q0UA 4AHXA 1FPN1 2G1MA 1O7FA 4HVOA 1SFPA 3M7AA 3OTFA 5FY1A 3OPTA 3NJYA 2PYTA 2TUNA 3ZYIB 2W08A 3QH6A 2CGNA 4RQPB 4LBOA 1XJAA 2ZX3A 3GHMA 1ST8A 5FKBA 1RUJ1 3TN93 3ZMNA 3FLTA 4UW3A 4M3CF 5DN2A 1RIRA 3FFZA 3CL1A 3VHRA 3PVEA 4N9IA 3ZYJB 5HV4A 3I2KA 3ZDSA 5I0RA 1WCQA 5L19A 3IDCB 3VBRA 1RHI3 2D97A 1E5SA 2D3RA 2HLEA 1W6MA 1S0BA 4FPGA 2WNOA 3ZKYA 4E9KA 1PO22 4M3CA 3HT1A 4FI9A 1R091 1JYCA 2D93A 1GSLA 3WDUA 1S0CA 5FMOS 2Y60A 3WSOA 4H55A 1DGLA 4NWWA 1RUG1 3NSTA 1ZRIA 4XVHA 5L36A 3ACLA 3DYMA 4I0WB 2Y6KA 4YVWA 4RFT0 3BODA 3ACIA 2DVDA 1RUH1 2BW8A 1EPZA 1KDKA 1O4TA 4N90A 1OH3A 4YW5A 2QDRA 3VGIA 1NQDA 1UOBA 1XYPA 2YC4A 1J83A 3IT8A 4M0NA 5F5IA 4CCOA 3N7LA 4D6QA 1OHFA 5A6ZA 4RS5C 1VBB2 5ACA3 3TB0A 1L3JA 1ONAA 1WLWA 2QZ3A 2WS91 1QQP1 1LAJA 3O12A 5JOXA 1HW5A 2YBPA 3POEA 3LGRA 3VBOC 3D0SA 3TAYA 2VMGA 2UWBA 1PM7A 1YQ8A 1UQXA 2SLIA 3KMHA 3OGVA 3TEZA 1UY1A 1U5YA 1MPXA 2PMWB 5LRRA 5E89A 5IYYA 5JXHA 5FZMA 4OHXA 1AR63 2W87A 4L11A 3VKOA 1VBA2 3HD8B 4WM7C 3ZFEC 4EN9B 2GNBA 1XNBA 4XE9A 1O8PA 3GDBA 2HWB1 4WVMA 3WP6A 2VTXJ 5FZ4A 4YM3A 3C2UA 3RWKX 1FV2A 3VDDC 3CHXA 2BP6A 3D0JA 1HB1A 1YFWA 5J98B 1JOJA 1W8TA 4IE7A 3S5AA 5ACA2 5ABJA 2DVGA 2E63A 4P9LA 4RR3A 5A6YA 1LOFA 3OSDA 3SEPA 2W2IA 3K2OA 2AUYA 2PLV2 5CG9A 2BNMA 2YPJA 5K0UA 3JBG3 1UZZA 2R073 1QXPA 2D98A 3WINE 1ZRCA 2E26A 4PLOA 2G19A 4XFFA 1ALYA 3RZJA 2UU8A 4BDVB 1UN1A 4Q8LA 5FR3A 1AR81 4CCJA 5D2AA 1G9FA 1XYNA 3KWVA 5JLVA 3QH7A 2PHLA 4Q4W1 5FV3A 1MZ6A 4FOQA 2XJSA 4JGZA 4MGQA 4B1MA 4CCDA 3RQ0A 4URAA 3WNKA 2VNOA 2DBNA 1IG3A 5ANNA 3S30A 2IXCA 2HWC1 3OY8A 1REEA 4GKYA 1MR5A 4Q4Y1 5A7OA 1YXWA 1ZNPA 4Q27A 2ADDA 3J7HA 1JZ8A 3A23A 1WMEA 4LOSA 1AYM1 5FZOA 4BQ5A 3WDVA 1R1A2 4BB3A 2WA4A 4IV3A 2OVUA 1HJFA 1FXZA 1LU1A 3CJIC 3R4DB 2ZKLA 2DVAA 2UYAA 3TN92 5HXMA 1YJLA 2DU0A 2BPA2 4ITCA 1W6NA 1GV9A 4FBFA 4WM8C 3MGUA 3KM5A 3Q8FA 4TWTA 3USSA 4OHYA 2WT1A 2XQXA 2Y8KA 3C7FA 3LPFA 3T2OA 1TVGA 3O1UA 4DXZA 1UOJA 3POYA 1N3QA 3WP3A 4R8HA 5LY2A 3PU8A 3MW4A 5FYHA 5E6HA 5T5PA 4FAGA 1IKPA 2RS11 2IFRA 4E8DA 3M3IA 3A4UA 3R6SA 2OPWA 5C9AC 1QF3A 1TZOA 3LB9A 1AYN2 1AHSA 1H4HA 4O7XA 2O8OA 2OW4A 1HRI3 5DDJ2 5FZIA 4Y5SA 3U11A 1RUF3 2Y6JA 4Z92B 1O91A 1SEFA 2Y0IA 4XMAA 2PHDA 3EJKA 2PXJA 1PX4A 3FBYA 4P14A 4FO9A 2W39A 2CAVA 4RA0A 5FLJA 3ZR5A 2HWB3 3WNLA 1RUE3 1C8M3 3A0KA 1Y3TA 3MLJA 4LOTA 1DGWA 3MW3A 1VIWB 2JWPA 4O9EA 2XPJA 5FKCA 4GJZA 1WCDJ 1LB2A 2ZXQA 3VKMA 3LOIA 3JCIA 1VBA1 4H3WA 1GQPA 4DRRA 2Q8CA 5J3UA 4UFMA 3IN9A 1BBT2 4JRLA 3WG4A 2ZCWA 4RR3B 4MSVA 5F3CA 4CCEA 1NCRB 2C4XA 1CVNA 5C7GA 4YW4A 4YW3A 3I4IA 3OEBA 4K1ZA 4N7UA 2NMNA 1VBB1 4J25A 4NAOA 5CEHA 2DUQA 5JXIA 4KQ7A 1O4YA 4Q2FA 3I2JA 1EAH3 2HEVF 4NIHA 3THTA 4KG8A 2XL9A 1RYYA 3C7GA 3PMSA 5JIAA 3OYWB 1DHKB 4HK8A 1VLNA 4NPMA 4XDPA 4BK4A 5AC91 1MEC3 1YLLA 2LROA 2NPIA 4P9JA 3WW1A 1JS9A 5FQ0A 2C26A 4RR3C 4CCCA 1HXS3 2XJTA 3E5QA 3J8F2 1EAH1 2DV9A 4CDQC 2CTVA 5C4WA 3PIJA 3U4XA 3POBA 3DL3A 4W65A 5I91A 1H4GA 1W9YA 3FWEA 3H9AA 1CAWB 3K4AA 5EV7A 4OHZA 2CV6A 2JG9C 3KQRA 2JJ6A 3KVBA 2JDNA 5IVEA 1U5XA 2FCVA 3MFCA 1CONA 1OKQA 3E97A 4NHKA 3GCXA 5FBZA 4AQ2A 1QJY1 1XU2A 5FK7A 5IK4A 1RMU2 2XVKA 2NP0A 3INAA 1UNBA 1AXZA 3FLRA 3LKJA 2JIJA 3IIAA 4RHV2 1ULFA 4PIXA 2ILMA 4TLFA 3WVJA 2VO5A 4TXWA 3KCCA 1CWPA 1EPWA 4QHOA 2ZGTA 3RZKA 5J37A 1JODA 4QGLA 1MEC1 1WD3A 5FOJB 5F5CA 1GNYA 4CUBA 3ITQA 1E5HA 4YGDA 3FZ3A 4N8MA 1SQ4A 3S57A 1GU3A 5FXZA 2XKPA 1R093 2L9LA 1MQTA 1FV3A 3OD0A 1MVEA 1WMXA 1D4M1 2NLRA 2VXJA 4FFIA 5CG8A 1COV1 1HRV1 4QU2A 4BQ4A 4K1YA 3P6BA 1GOFA 1Y7BA 4K40A 2MHFA 3U1XA 4CPBA 4BK5A 3JQWA 5IJRA 4CVUA 5FO8B 3VBUB 3ZFGC 3RDIA 3H8OA 2D6LX 4BIFA 4CSWA 2XJRA 4AZZA 4ZKTB 1VPHA 3NNFA 4FPKA 1DLCA 2ZACA 1JOBA 1ZM1A 5GZEA 1F8VA 1VE0A 5IVCA 5KC6A 2ZEXA 4PDWB 4AQSA 4JAAA 2VW0A 4YFWA 3BGAA 1L7LA 1W8ZA 3VDAA 2PHWA 4AGGA 1SLCA 1OLMA 1MS9A 3BVCA 3DKQA 2WUHA 4CCLA 5IVVA 4GZ9A 3VZKA 4WVMB 2WN2A 3QCWA 1N1YA 5DABA 1CX1A 3VBFC 1DIWA 3GYDA 2EA7A 1H2NA 5FPXA 2DWRA 3LQCA 4YW7A 3O1SA 1E5RA 1VR3A 5FCCA 1IZ3A 3POFA 4D94A 5F2WA 5AVAA 3LEGA 4H2AA 3O5SA 1D0HA 4L2NA 2X53S 4R9AA 5LA0A 5DZEA 4PLNA 3AYAA 3UESA 4Q8KA 2E51A 3N7MA 3O7OA 2JE7A 3QBQA 4JTNA 3I59B 3W20A 1GWKA 3FMGA 2AYHA 5A7WB 1ENRA 1NX9A 4W50A 1UO9A 4CP9B 3U4SA 5EIYB 3MIDA 1S2KA 4LORA 3RS6A 2WKKA 2OX0A 4HN0A 2UWCA 4COZA 2WNUB 4XZPA 2ZABA 1ZBA1 4MGZE 2IWGB 1I1EA 2YC0A 3EMRA 4C91A 1FPN3 2ARCA 2I45A 2WAAA 4IV3C 1GWLA 5I0TA 5LBFA 4LUMA 1QY4A 2Q1ZB 1XE7A 4O61A 4A6SA 5BNNC 2VMFA 3B9IA 2LUWA 1BBT3 4OFGA 4LXLA 5J1XA 3AZXA 4WM8A 2YV8A 4IGPA 3OPWA 5G04L 2IVIB 4XDQA 1IG0A 3RZHA 2EXIA 2RJKA 4JQRA 2XL7A 5FZ6A 3WQ1A 4D8MA 4MGKE 1C8M2 4QX3A 4OQ8A 3AMNA 4QXKA 1PMIA 3NV1A 2XXZA 1G86A 4C1XA 2ZEYA 5C5UA 4FPJA 4CDXB 3N9NA 2VW1A 2WA3A 4FP2A 4UFHA 2J1VA 4INDA 3SC7X 3RZLA 5T3NA 1MQTB 4XETA 4C8DA 1V6JA 5BNNA 4Y4RA 4CUGA 4ZPIA 1J1LA 2PA7A 4JGYC 1HRI1 5FMBA 5KHKA 2JIGA 5FUNA 4CCKA 1UF2C 1UKRA 1LOFC 1N1VA 2A5ZA 4YVSB 2WQ4A 4D0QA 1W6PA 1Q8PA 4R9BA 1GQHA 1WW7A 5H9SA 2A73B 2Y34A 3U75A 3W5NA 2ORZA 3AKTA 4UW5A 2ZX2A 2XKOA 2ZGQA 2R1DA 3UYJA 1YRZA 5CADA 2FBEA 2GNDA 4DZGA 5I8YA 1C8M1 4YZ4A 1F35A 4QX8A 3AZZA 4NN0A 3FN9A 1W3VA 3TYJA 2HWC3 1PZ7A 4V2WA 4F83A 3RI8A 1BZWA 1RUD2 4OZOA 3OGRA 4QQHA 4DQAA 3AL5A 3VBSC 5FY7A 4GA9A 1JH5A 1M06G 1OOPA 3W9AA 1UY2A 1JI6A 1RGSA 4XCAA 5DDJ1 5A33B 4OUMA 1P8JA 3UGHA 2D43A 1KDMA 1NYWA 4CEWC 3SH3A 4JGZB 3WNPA 1BCXA 3AB0A 2J22A 2YUEA 3UV9A 2ZHNA 3V56A 1W0OA 5DUXA 5JR7B 1UIKA 2DCTA 4KWUA 5GZGA 1NE4A 4QKDA 1ODNA 1QEXA 3ZKUA 4CP9A 1DDLA 3I3QA 2WZPP 1RUI2 4P9GA 2FZ1A 4LA3A 3U10A 4AI9A 4D3WA 3AJZA 1TQ5A 4ES8A 2WNUA 1FMD2 1CPMA 2YDEA 5FOBB 3NKTA 3ZFFA 1XSQA 2R041 2VZQA 2PLV3 4XFGA 3WQ0A 2DF7A 3ZFEB 3CEWA 4FXGB 5HI0A 4XW3A 1PMJX 3H1WA 3PU3A 1YQ5A 5GJ6A 4A44A 2CNAA 1AR93 1RL3A 3GJAA 3I2IA 1QNYA 2WS92 4XFCA 4RSUA 4UBGA 4B7EA 2RHPA 2XVLA 1W6QB 4AEMA 4DNYA 1EUTA 5LK7B 4YARA 1H2KA 5IK5A 1RJ7A 3FLPA 5C9AB 1UOGA 2WNVA 4K9SA 4UFIA 4XPVA 2BBVA 4YYOA 2QVSB 4DXTA 4HFSA 2CL2A 4NPLA 2BVVA 3NKGA 5A6QA 3BPSA 1VBA3 3AZWA 4CDXA 5FYTA 3WOGA 4MXWB 1WCSA 2EICA 2F4PA 4Z82A 5IVBA 3P3PA 5JWPA 2QFEA 2DCYA 4W6WA 3MFAA 4SBVA 5FYUA 4A2UA 1ZRDA 2OPKA 1KJRA 4S2GA 3HAGA 4JVAA 2GN3A 4BU2A 2BWCA 3JD73 4EN8B 2D6MA 4YZ3A 5K4LA 1DP0A 1AUYA 2Q0AA 4UW6A 4Y20B 3EXUA 3TRSB 1VBB3 5D21A 4COWA 2RDSA 1POV0 4QQ2A 4EZHA 1CZVA 1NQJA 3AKRA 3MW2A 3SLIA 4LKDA 2OZJA 4DO0A 2AGSA 1LOAA 4LK6A 3O1VA 1NKGA 4IEOA 4XJZA 1FX5A 1CZTA 4JC1A 1ENXA 4XBNA 1CD3G 4DUVA 2TEPA 2ZHMA 2PQSA 4LNVA 1H1MA 2JX9A 3WHTA 3WW4A 1RUNA 1ULGA 1H2LA 4IQPA 4X8NA 3T1MA 2VZOA 3E6BA 1FI2A 2JB4A 2JECA 1FATA 4GD4A 1QJEA 1RHI2 1L7RA 1NA1C 4RGAA 2VUJA 3VHNA 1J84A 5A32B 4CEYC 1D7PM 5FK8A 3PJYA 3ZXFA 2IXKA 4I3GA 1SLIA 2DU1A 4Q4W2 3NWKA 5FMCA 2RS12 2VUCA 4L92A 2EAKA 1RUJ3 1COV3 1UYPA 3KZ4C 4BHPA 2EF6A 1WLDA 2A70A 2NZ9A 1AF9A 4GB32 2VZPA 3P5BA 4XFAA 2G9FA 1DQ6A 1OVPA 2HWD3 2Q1MA 1EV12 2B5HA 2WFPA 3HNMA 1WWYA 1SACA 2JE8A 4N43C 4KBZA 3MICA 3IMMA 4MADA 3G7DA 1CX4A 4FPYA 1A78A 2BUKA 3O0XA 2VJXA 1NXMA 1OKOA 1V9U1 3NV4A 4TTGA 3V0BA 3MUZ1 2FDHA 4P00B 2VBPA 1NAEA 1OQDA 2VTFA 4CU9A 3M1HA 5EP9A 5L7OA 2WNVB 5DQ0A 5A3NA 1H2MA 1W0PA 1W6NB 4JKKA 4OMCA 4HPKA 5FYVA 5A7SA 3MPBA 4QB2A 4QXHA 4RL7A 2AH2A 4V1PA 3WNNA 4CDUB 4EN6B 1X8EA 4XAEA 1WKYA 3JB8A 4AWDA 1CAUA 3BYWA 3NJZA 1C5IA 4KG0A 1ZRRA 2NN8A 3OUHA 4WM8B 1H30A 2W68A 1SG3A 5D8AA 1ZZCA 4AVBA 3H8RA 4J1XA 2VUAA 3U14A 4GWMA 3NO8A 1U0AA 3CJIB 4LO8A 1RXFA 1AR73 4MH0E 5JSPA 4DIQA 1XE0A 3OPZA 4CXXA 1G9AA 5EJZB 1K5MA 4K8FA 5FYSA 3DKWA 1LODA 5IAXA 3ROUA 1QJX2 3V0AB 2B39A 2DTYA 2XHKA 1JYVA 1QJZA 3WW2A 4E4ZA 4QT6A 2W5FA 2WDBA 4XIOA 4NAMA 1HQWA 3DEMA 2O1QA 1S4CA 5FZDA 3RFRA 1CIWA 4PDWA 1LHWA 2D5HA 1UZYA 4MXVA 4CEYB 3FBMA 4XYXA 5CZKA 2FDKA 4GH4B 4XXAA 1GZCA 2OT7A 3ZMOA 4XF0A 4AVAA 1I5ZA 4YPJA 4QQOA 2YFZA 3KLSA 2C5DA 3FHIB 2RS33 1UU5A 2MEV3 1OQ1A 2ZEWA 4GJYA 5KHGA 1OFNA 5FP3A 2JDMA 5DZFA 3ZXDA 2H0BA 3T3YA 4B4RA 3ACGA 3CBNA 2YY1A 1AR72 3FX3A 4PJYA 5DUWA 3T30A 4ES9A 1CZSA 3ME2A 5J36A 4XJWA 2WQZC 4QDQA 1ODMA 5FPAA 1TMF2 1S2BA 5K7PA 4A4AA 1YI9A 1ASJ2 4LBJA 4CE8A 5C33A 2F6BA 2FDGA 1V6LA 4P5YA 2ZJCA 3LEMA 1KXGA 1SPPA 2WZR1 4LBKA 5GLVA 2RDQA 2XUEA 3VDDA 3K46A 1QJY2 3JB4C 4DXRA 4OI0A 1JHJA 4MZUA 1I9RA 2IXJA 4O65A 2B7YA 3M4FA 4WM7B 2N7GA 2Y0OA 3M8LA 3I49A 2IC1A 1W39A 4NO4A 3K48A 1SHWB 2VZTA 4PBPA 2VVFA 4BQ2A 4XABA 1W8HA 4ZY9A 4I01A 1EY2A 1W8WA 1E57A 2XMLA 5IT6A 2RR12 1GZTA 3WNMA 4QPGB 5GZDA 4FFHA 1PIV1 2GNTA 4D6SA 1IPSA 4LHLA 5H9QA 3T4HB 3PUSA 3PDQA 4Y5TA 4QKFA 4BM8A 2D3PA 4OCTA 4GB33 2E31A 3SISA 1GOGA 3PTYA 1RUJ2 3JU9A 2RS13 2XWBB 4HKWA 4Q4W3 3DN7A 3WW3A 5FZBA 1UL9A 5BNOB 4PLMA 4OI2A 2BOJA 3ZXGA 4P9XA 3BUCA 1QKQA 3PUQA 4XF4A 1SBDA 3AVRA 3U78A 1W05A 2ZMLA 2YZ4A 3LF7A 4I0BA 1J3PA 4KGGA 4ZXEA 1X36A 1PZ8A 3PJQA 4HBNA 1UZWA 1W6OB 2KXLA 1KS4A 2GP5A 2Q8OA 3LIHA 3VBSA 4CP2A 4WZCA 2EXHA 1O5UA 1US2A 1HN1A 2CY6A 3OBAA 4MGIE 3C3VA 3CMGA 4KU7A 2F4LA 2P3IA 2WO2A 3QD6A 5T54A 1VBE3 3WX5A 5LBBA 5A1LA 3JBG1 1HB4A 5FUIA 2YC2A 3VKFC 4ZONA 3S7EA 1RUC1 1DYKA 5F5AA 5LATA 4IESA 1W9WA 2ZZQA 4A42A 5F3EA 4OVEA 1OOPB 2RS51 4HG6B 4UFLA 4UT5A 5IWFA 4JDMA 1O3QA 3D6EA 3NAPB 5JI7A 4AR2A 3BTYA 4AW7A 1JW6A 2PTMA 4AEDB 3JD72 1WUVA 2XJUA 3WG3A 4A7ZA 4AVTA 1LHUA 2ERFA 5F3IA 2RMU1 1OLME 4META 1PHMA 5CFCA 3P1IA 3HQUA 4QMAA 1KJLA 5J96B 2OXBA 2VOXA 2VNGA 3POIA 4L0PA 4NUBA 3WT3A 1KD7A 5DAQA 5AC93 2BZDA 4TLGA 2Q8EA 3KVAA 3O0VA 5BUVA 1AX0A 2R043 5T5JA 2W92A 3IAQA 4EWDA 1VBE1 4KWLA 4LBNA 4LBQD 4AL9A 1HN0A 5FZEA 3VN4A 5SV5A 1E5IA 3D4KA 3HEIA 2VCBA 3T0AA 3LDRA 4NHYA 3ZFFB 3K4DA 1YEWA 2WS93 3ES1A 2MNGA 4HKLA 2B4KA 1TME3 1ULPA 2DFCA 4D7TA 1JZ7A 2Y6FA 2E6VA 2QQUA 4BMBA 1HQNA 2VNRA 5C3SA 1AL22 1ASJ1 1IS6A 1PM4A 2VPVA 4KH9A 4KWJA 1LKNA 4OYUA 3WD5A 4CDXC 3MZHA 3C7HA 1CIYA 3F95A 4FPEA 1RC6A 2GMPA 2H6BA 2WFF2 4OI4A 4LPLA 5GALA 4A6OA 4YFZA 3VHOA 1ZBE3 2WL1A 4QAWA 1JUIA 4URTA 2BV4A 2ZMNA 4XJ8A 2FDJA 4MXWA 2PHFA 2R063 1S0JA 4UWDA 3PMEA 3DYPA 1XC6A 2Z79A 3VD9A 2EXKA 1ND2B 1SMVA 5IVJA 1NCQC 3MIBA 4CDWC 5KHIA 1OA4A 4R4XA 2QQJA 1OD3A 4E4DX 2P17A 2VBDA 1LTEA 5CKNA 1VBC2 1NCQB 4BISA 2IZWA 4CDWB 1RUG3 5LWBA 4PI2A 4JDNA 1XXNA 4MHRA 5JAXA 4HSJA 5JMCA 5BNPC 5CA6A 4QB6A 1D2SA 3DGTA 3NNMA 1RUD3 1SLLA 1RINA 4BLIA 2B9UA 3K3NA 5FPVA 3RSJA 1OVSA 4CRQA 5JDBA 1KEXA 3ACFA 3MIHA 2BFUS 4DFSA 5JPNB 4Y26A 1VBC3 1B35C 2QQLA 1GP6A 1LHNA 2WO3A 3IB3A 2UY8A 3OGGA 4RYDA 1RB8G 4DINB 2JDPA 2HWF2 4PHZA 4RHV1 3OG2A 3AP5A 3MBWA 3GBFA 3I3DA 2WLPA 2ZTNA 5BXXA 1DQ4A 3CJXA 3KV4A 1G7YA 4LO4B 4K8RB 4KU8A 4S2FA 4M01A 4BXSV 3USUB 1Q3EA 1HKDA 1VAMA 1XRUA 1ZZ9A 3WY6A 5JZGA 4FQ4A 1BVP1 1UPIA 1F5FA 3AFGA 1RUH3 2B9VA 2KM2A 3VBHA 4AEDA 1DZTA 4NJ4A 4AI3A 4FTEA 4EWEA 3H42B 1FYUA 3AXDA 4LT5A 1QJU3 1U5IA 2ARAA 1ZBE2 3FHQA 1RUOA 1V9U2 3P3NA 2GC2A 3B00A 3IDBB 1EV11 3KB5A 3NV2A 4QD2A 2P34A 1RVF1 2E53A 5FP8A 1LU2A 4LA2A 2JDKA 4XC9A 4AK3A 4QHBA 2TBVA 1H8TA 2RM23 2HH9A 4AHZA 1TNFA 2OKXA 2HWF1 4AVSA 1PNFA 1PVC1 1SLBA 1TME2 3NW4A 2V72A 3URFA 5E1RA 1QJFA 3T0DA 1NE6A 5FFOC 1LENA 2KA3A 2XQRA 5K0UB 2W91A 3BCWA 4LKFA 1PK6B 3ORJA 3K3OA 5F39A 4OZXA 2JD9A 5EJ1B 1OOPC 3FFQA 1QQP3 3A7QA 2UWAA 4CA9A 5AC92 4B4QA 1URXA 1QMJA 3MV01 1A34A 4QPIC 4BYYA 2HKXA 2IXIA 2GC0A 2P5BA 3UJQA 3EBRA 1RTVA 1QJU1 2Y38A 2VMHA 4NHMA 2BTVC 2NM1A 4HL0A 4LLFA 5JPMB 3HN1A 3ABZA 4CDUA 1LJ7A 2LS6A 3N7KA 5A7PA 3IPVA 1ZZ6A 4DMIA 1K5MC 3M70A 4M00A 4MGYE 4A45A 5L9VA 4IV3B 4CPBD 5D8AB 2WSVA 3POGA 5ERLA 4K21A 2A3WA 1PO12 1VALA 3IWZA 2XUMA 4WBBA 3LPGA 1QHDA 1NZCA 4P08A 2Q8DA 2BJSA 4DS0A 4E27A 1Q8OA 1PIV2 4PBOA 3AYDA 1WBFA 4S2HA 1G9DA 3A22A 1UPSA 3UJOA 3I2FA 2ZEZA 4NIAA 5JXJA 2VE1A 1NY71 1BMV1 2ATFA 3B9CA 3SCFA 5AFBA 4GXLA 5C4WC 2GC3A 3SHRA 2P2KA 1BXHA 2Q1FA 3H7JA 2K9ZA 4MOAA 3OBTA 2ZGRA 2ORXA 3WCRA 3JUUA 5F9TA 5IATA 1W2AX 2FDFA 5D1IA 3KHCA 1ZREA 4QKNA 2AREA 4Z2WA 4R9CA 3WG2A 1LHVA 4FPLA 3OUJA 1VAKA 1R092 1AJKA 2Y6GA 5C5TA 3WHUA 2XJVA 3MO4A 1YIPA 2BEOA 3AKQA 4Y1YA 1DFQA 2RR13 5FYMA 3DUIA 1W2TA 1IHMA 2CSGA 2CWSA 4YNIA 3VB9A 1UZ0A 3M3OA 2C24A 1H8TB 3IKWA 4HVRA 3W59A 5EPAA 4AVCA 5FWJA 1UYYA 5A3UA 5C3QA 3K4ZA 1TNRA 3PUAA 1CGPA 2WZR2 3OBZA 1XNTA 2IFWA 2CWMA 2YBSA 3BN6A 5JIUA 5A3PA 3T2TA 3JXSA 1W90A 2GP3A 4E2SA 1RMU3 2C9AA 5DPNA 3VBHC 1S0IA 1QNWA 1QJY3 4ZU4A 5HV0A 4BQYA 4DEVA 3AP6A 4B8EA 3GBWA 3VDBA 5FZOB 4P9YA 1FAYA 3PTRB 5HCBA 4F8AA 3SCHA 5C8CB 2X09A 2HJIA 4Q5OA 1BQPA 4LJHA 5LASA 1RVF2 1VP6A 1X33A 2WSUA 3NJXA 4SLIA 3NV3A 3ELNA 1ASJ3 3DCQA 1Z7S1 4IEYA 3THCA 4YZ5A 3O1OA 4GALA 2DDUA 1TMF3 5A70A 4JKMA 4BQXA 5KR7A 2XBO1 4QGNA 4K6BA 1JU4A 5FIXA 1OF3A 5CU1A 1O4ZA 3RG0A 3IPVB 1REDA 3C7EA 3CDZB 1UY0A 2NQYA 1OUXA 4Q4Y2 2TNFA 2YROA 3QACA 1OBNA 5FY4A 4R52A 1QH6A 5JUVA 5LCWL 3D3AA 1K5JA 4Y1VA 4UXAA 4FQZA 3MPPG 4EROA 1KFUL 2JG8C 3WF2A 2YXSA 4JV4A 2B46X 2EIBA 1CAUB 2HWE3 4QWNA 4QXBA 5A7QA 1YCIA 3ES4A 3PUHA 3HNYM 1PGL1 1AYN1 3N3HA 5HPOA 3UKTA 2GMMA 2J7MA 3NNLA 1A3KA 3TWIA 1V00A 5C6CA 1OH4A 3CQOA 4XFBA 4B29A 4NHLA 2WNVC 2PAEA 2C9KA 5ABJC 1XNCA 2GC1A 5IVYA 1PZ9A 3M3EA 1ZZ8A 1O5LA 2A6XA 3GXUA 1WD4A 4K20A 4RN5A 5FMOL 5A7NA 4EE2A 5E8AA 4ONUA 4RGGA 1LGBA 2VVEA 3N9LA 2YGLA 2FD8A 1D0GA 4AVVA 5J7MA 5JOZA 4AGRA 3I3MA 3T0BA 1K3IA 2DCZA 2VULA 2ZGMA 5L73A 5IVFA 4CEWA 3HJRA 4CEYA 2R6QA 5LZ6A 1D4M3 1JBCA 3J8F1 4XURA 1L7QA 1NCRA 2OS2A 1OF4A 1RUF2 1AZDA 1RJ8A 3DYOA 4FFGA 4QX2A 1ZX5A 4LULA 4YW6A 5FP4A 4ARYA 4BQWA 1AYN3 4FPFA 2VH9A 4BPZA 2WN3A 4FOVA 2QQWA 3E1F1 5FPUA 1OQEA 5A33A 4GWNA 4C0HA 3KCXA 4E2QA 5F8PA 1G8WA 4MUVA 4TN7A 4XTPA 4O9GA 5AFEA 1JUHA 4W8JA 3HN3A 4OHVA 5DUVA 4OQ9A 1IOAA 1CAXB 1A6CA 1SBFA 2ID4A 4QM8A 5G05L 4P5HA 4DXSA 3CZJA 3R05A 2HWD2 4QX7A 3SKJE 1UOFA 4AFCA 1LOEA 4UYBA 4XAAA 4XBLA 2BBAA 4IGOA 2RDNA 5GKAC 3VBOB 4AI1A 4W6YA 3KQ4B 5L7OC 2A1XA 1R1A3 4QQLA 3C8XA 2KR2A 1Z7S3 3WNOA 3VZMA 5LA1A 2P6CA 3KS7A 5A7WA 3WF1A 1XPWA 1GZWA 4XQWA 4ZU5A 5KXDA 1H9WA 3KT7A 3UGGA 1QU0A 4FFFA 5JSOA 1DGWX 1S0DA 2RV9A 4XUOA 4ET7A 2QQVA 4JGYA 4ZS2A 2VQ0A 3J4UH 2Y26A 1DF0A 2VVDA 1VAVA 4Q0PA 4LKSA 1HRV2 5LEKA 2XB6C 4OUEA 3JBG2 5A3OA 3DV8A 1WW5A 1UMHA 3V64A 2DCKA 1VBC1 5B2GB 1UMZA 2D6NA 3IBMA 3I3EA 2Z5WA 3CU7A 1N1SA 4MGSA 1W8UA 2CDOA 4I30A 5DUUA 2OIIA 3FUQA 4NRMA 3G6JB 3BPZA 2YPDA 1XNKA 4AFDA 3K51A 1VMHA 1W9TA 1UCXA 2CGOA 2SBAA 3HIFA 4YM2A 5FWEA 3USUA 4NWVA 4NE9A 3RVHA 2A71A 3ZYHA 2UYBA 1AR62 2J1RA 1ZZBA 3ECQA 3AZVA 4YVSA 4XTMA 3RJRA 1EP0A 3W58A 4CU8A 5FZ1A 4ZXKA 5IUQA 1OC1A 4V2VA 1WGPA 5AVPA 3LEIA 1AXKA 1UXZA 2P3YA 3E6DA 3ILFA 3S6PA 3ZSEA 3ZXAC 1QDCA 3O14A 3OOXA 4N9HA 1JOPA 1H6XA 1Q8VA 3HQXA 4S2DA 2YHJA 4E8CA 4ZHNA 2BGPA 3BB6A 1GNZA 2X5IA 2E9QA 3H1MA 4G4FA 1HB2A 1IS3A 1XYOA 3U0ZA 3GM8A 1JZ3A 5J09A 3O0WA 1UY3A 1MS5A 3HBKA 4N53B 5CNAA 3GGLA 1FMD3 1GUIA 3DPRB 2A6ZA 3MIFA 5M0TA 1UKGA 2E33A 1H6YA 1RUC3 2GH8A 3KT1A 3RPQA 1AX2A 1YNAA 2X10A 5F32A 5LB6A 4BE3A 2W1WA 5A3TA 5F37A 2W9XA 4AE2A 3ZOIA 2IXHA 2HBTA 2C1FA 3LA3A 3OD4A 1GICA 4J1WA 3EQEA 4HSLA 2YFUA 5CFDB 1XBFA 3MIGA 1Y9QA 1PGW1 1RHI1 4ASMB 1Q43A 2QJVA 4BH9A 4FAHA 1O59A 2Q30A 4COYA 3V0BB 2PHRA 1Z7S2 3KV6A 1ZRFA 3BOPA 4NOTA 1JU3A 3LE0A 3GJBA 4IXLA 3E5UA 5A80A 1HLCA 1Q8QA 3VLBB 3U07A 5APAA 1PGSA 5I8SA 3AKPA 2VCCA 2XH6A 2VG9A 2Z42A 3CZUA 3VL8A 1KS5A 1W2NA 2Q4SA 3N9QA 4I0AA 4NR1A 4YVWB 1F9KA 3CNAA 2J1AA 2BNOA 3J7MA 3AMQA 5FYYA 1C57A 2RM21 2WO1A 2B45X 3WDXA 4KWKA 1N3OA 3PLQA 4JZRA 1ND2A 2LW8A 2QBXA 2VW2A 3AMHA 2R1BA 3BIWE 4MX3A 3T4VA 4AI0A 2GMEA 4GMP3 1CJDA 4Y22B 1QIQA 4YG6A 1W6PB 3OJBA 4IE6A 4MO3M 4UFKA 2RDRA 2A3XA 4YRDA 2QQMA 4XQ4A 5A3WA 4UW4A 2W46A 3MHZA 4GKXA 1ACCA 2FCTA 2JE9A 2RVAA 3DPRC 1ZZ7A 3LCPA 1W9FA 2DCJA 3HR9A 2AZ5A 4UF0A 4DEQA 3BTZA 1C5HA 3AL6A 4JX0A 2W1SA 2VZSA 3RMXA 1LR5A 1S0GA 2ZKNA 2ZA9A 1C1LA 3MDPA 4P02B 3T08A 4CXWA 4GH4A 4FP3A 2V09A 3R4SA 3VBUA 1XOYA 4JTOA 2WIIB 1W2OA 3WR0A 3RMYA 5CYYA 2JG9B 1F15A 4QPIA 3RI9A 5DZGA 2EIDA 3HMYA 4LE4A 1VRBA 2BGOA 2ZAHA 1NLRA 4XDOA 1FOD1 1WLCA 2D7FA 4CDQB 1UD1A 1SFYA 4PCRA 2XONA 1RUF1 4B4PA 5IFTA 2RJLA 3S0MA 4EWAA 2ZGKA 1MS4A 4OI1A 4CYDA 5C3RA 1YIFA 5CAZA 5DMYA 1FPN2 4LO5B 3CF6E 3MI8A 4YGEA 4QX5A 2E7QA 1HX6A 1IQDC 1X82A 4AG4A 3B69A 1GYKA 3KF3A 3LSDA 3ZN6B 4ARXA 2JICA 3OUIA 3GZEA 3RYKA 1BK1A 1Y43B 2DTWA 2P6HA 4U36A 2ZX1A 1MS0A 4IEWA 5E16A 3VBFB 3ZN5A 1BVVA 2Z69A 4YG0A 2Y33A 1RITA 2K0GA 4W4ZA 1GR3A 5C71A 4Z8BA 4IEPA 2B42B 2ZAAA 1CAXA 4UAPA 2BYVE 5CFDA 1JN2P 2AENA 3VL9A 1A8MA 3SXWA 4C0BA 4R9DA 2Y6HA 1CJPA 5FBJA 5IW0A 2WT2A 4DY3A 5IK8A 4RQPA 2PLV1 5CISA 2ZGPA 3AVSA 1S0EA 1RVF3 1ND3C 1NOVA 3N36A 1N1TA 3PNAA 4BCUA 3HPNA 5FP7A 5FYBA 3ZYRA 2VMDA 2DURA 1OI6A 2J1TA 1MS1A 4YW1A 3B01A 2PELA 1D4VB 1TG7A 2R49A 5EQUA 5I0DA 3LDKA 1NT0A 5F6KA 2VOKA 1JZ6A 2GNMA 1GLHA 5ISLA 1MZEA 2H0VA 4ISRA 4XUTA 2VQUA 1SLTA 5FDBA 4HXCA 5L7OB 4PI0A 4MV2A 4AXOA 2WBKA 2R061 2XBO3 3VZOA 1VBD1 1ND3A 3UNPA 3SQOA 1XE8A 3I54A 4Q4X1 2WYSA 3TN91 3VD7A 4OLLA 1IS5A 2QE3A 1WW4A 2OUJA 4JDOA 4XHXA 5KXEA 1NLQA 2RS31 4YM1A 2ZGSA 4I09A 4Q1PA 3AP9A 3WZ1A 3DXTA 2R0HA 3NVCA 3VZLA 2OUHA 3LOBA 4YG3A 4FOWA 4PT6A 2A6VA 3I2DA 4CCNA 3J9SA 3ASIA 4ASKA 3V0AA 4AOCA 2FCUA 1HIXA 2P4EA 1UU4A 3AZYA 2VOWA 1V6OA 3M3CA 4WVWA 4RHV3 2CYFA 5FZFA 3V65A 3NL1A 4R4ZA 4NIDA 2ARBA 4NRQA 1VBD3 4HLTA 5FZ0A 3J7LA 4XIKA 3BIEA 2X8KA 1UMIA 2W0XA 1LNSA 1AR71 2ETEA 3WQ7A 3BI3A 2X5IC 1OFSA 2XHNA 5FZLA 2XR4A 2ARXA 4D6RA 2WINB 2H6CA 1DQ1A 5CBLA 4KMQA 1MZFA 2CDPA 3H3LA 3OF1A 3GZTB 5ABJB 1YC61 1UWWA 2D5FA 3J8F3 4MG2A 1PO13 3CLPA 3LD8A 1HXS2 4PIZA 4XACA 1LCLA 5F6LB 4AHWA 4IL7A 1B35B 2R32A 3LFMA 2FMDA 4XJUA 5FZ9A 3SH4A 1UY4A 4XOGA 5C70A 5LEJA 4AI2A 3R0RA 4JRAA 1Y4WA 1BBT1 1UYZA 2R071 4NMIA 4QU1A 1GZWB 2YU2A 2QQNA 4QX1A 1FT9A 1W06A 2VAUA 2VCAA 2G4IA 4AFAA 4C90A 4HT1T 4JHTA 5KC5A 1XSRA 4IGQA 2UURA 2ZGUA 1PX3A 3B02A 3B94A 1C1FA 4K3UA 2XOMA 3WEZA 1ULCA 1STMA 4HN1A 4OULA 4EQVA 5BY5A 5C3PA 4BZ4A 1V6MA 3MIEA 5FTTC 4JGYB 2VMEA 1JZ2A 3L2HA 4RS5A 1GZ9A 5HXVA 3ZFEA 1PGL2 5KXBA 2W95A 2BFUL 3WNXA 2CAUA 2D3SA 2LTNA 3J26N 2ZX4A 4HZFA 2D6KA 3DXUA 1WCUA 4IEXA 3WF4A 4BQ3A 3BALA 1BHGA 3T2PA 5I8TA 3ALQA 3B5LB 2BVBA 1W6QA 4QPWA 4KI5M 3MUY1 4NRPA 3H3UA 4BMEA 3MF6A 5GZCA 4LIVA 4HMZA 1BLZA 4FTSA 1XQNA 1AJOA 2VC9A 2RM22 1AL21 4NPRA 3ZR6A 4LUKA 3EB7A 1H9PA 4PQ9A 3WDTA 2VZ3A 1F4HA 4DB5A 2ZX0A 3I8TA 3ZSJA 3JZVA 3VD3A 4Y24A 1TMF1 2WYFA 4D7SA 1DG6A 2V4AA 1QJU2 1PK6C 4LBMA 4ASLA 1WMFA 5F7UA 2MEV1 3RZMA 1O3RA 5DDJ3 3PL0A 5LRSA 2AR6A 2GDFA 3D8CA 1RUH2 2VECA 4JQTA 3UETA 3WG1A 4FXKB 3H50A 4Y1ZA 1OUSA 1O6UA 1W6OA 5FJHA 1J59A 4ZU7A 4FOYA 4LIUA 2HWF3 3IZOA 4L97A 3CKHA 3KF5A 2ZGNA 4DUWA 2JDUA 5J48A 4GAZA 2O0OA 2YYOA 4ZS3A 2RG4A 2WQ8A 1DQ2A 1OLRA 3MF9A 3ZDVA 1C8NA 4QPYA 4A41A 3WP5A 1LOGA 1IGOA 1KITA 2WT0A 5DXDA 4YGBA 1QXJA 1UW8A 3GF6A 3RJ2X 5EYXA 1X9TA 2GH2A 1U5ZA 1Z78A 5EZWA 4XFHA 5F5QA 3ACHA 1RUG2 2VOVA 4BIOA 5FPLA 3AMMA 5LY1A 4WVZA 3GZAA 1SDDB 3CIHA 4G9SB 4N53C 4F7ZA 5JMOA 4QM9A 4C1WA 5FYCA 4CP1A 4AQTA 2W52A 5BYNA 4D69A 1VB2A 2EXJA 4NIGA 2I07B 2JEMA 2ZGLA 1PK6A 5KHHA 3GALA 3OY8B 4JCKA 3PVBB 1JYWA 4Y1XA 2R30A 2K46A 4FPOB 4UBHA 2VOTA 1KFXL 3VD4A 1BJQA 1JTZX 1RUC2 2WZEA 4H14A 3HVDA 3RRDA 1AR91 3VBOA 3VBFA 3X29B 1UZVA 1Q8SA 2WFF3 3OYWA 4J6GA 4QPGA 1LHOA 1C4RA 2R072 3FJSA 3LSEA 1W9SA 1DQ0A 1WLTA 3HBZA 3OEAA 4KBBA 5D8AC 5FAXA 3AP7A 1ND2C 3ETPA 3OCPA 2O14A 1IS4A 2QNKA 4D7YA 5FPZA 5FXWA 3DECA 4QGMA 4BJ0A 5CKQA 5FPBA 4CUAA 4A3ZA 2VZRA 3GCWA 4E4SA 2ENRA 2VXRA 2WWJA 1IPKA 1JXNA 5GLTA 3WDWA 4E2GA 1RUE1 2YBKA 1H1IA 2QTWB 4ATFA 5F3GA 2VUDA 1FNYA 1ULDA 2JD4A 4Y22A 2ZHLA 4QPGC 3VZJA 2BOIA 3TEYA 4CZSA 4CUCA 5GM0A 4FCAA 1OLQA 3HOBA 3KSCA 1U12A 2OQ6A 3BKZA 2EALA 4XZUG 2A6YA 3UL2A 3KGLA 1YQCA 5K0UC 2WO7A 5JSRA 4ATEA 1UIJA 3CJIA 1JYNA 2HBUA 5I0SA 1XNAA 1ND3B 3GBGA 4IV1A 2QZ2A 4LLOA 1V6KA 2GSYA 4NROA 3TEXA 4DUXA 4ORFA 5BPXA 1VRH2 1GWMA 1XU1A 3I2GA 4AAPA 4Y33A 2Z2SB 2DBIA 3NMBA 3UT0A 1H8VA 1ULEA 3VD5A 2XDVA 2YB7A 2ZHKA 1HRV3 1W04A 3WF3A 5I93A 3M2MA 1OURA 3ZO0B 4XFIA 2C6SA 3Q8BA 1DZRA 1XB9A 2VGDA 3NAPC 2C0ZA 1MS3A 4CXYA 1BK0A 3ZXJA 1SFNA 3RWNA 5JZGB 3LEKA 1F5JA 3ZN6A 1ZBE1 4IW3A 4RD7A 4EN0A 1PO23 5JVVA 3LAGA 3ZYFA 3VBHB 5EHDA 1QOOA 4AQ6A 4AF9A 4MYEA 5FYIA 2BNNA 2WR9A 4OMDA 3IIIA 1VJ2A 5FLIA 1DLLA 1UU6A 3J7NA 2JKBA 3TNPB 1J3RA 2VY0A 4CU7A 4IEQA 4N53A 3EO6A 1Q5OA 1LGNA 2XWJB 3PVOA 4XMIA 3ST7A 5FZKA 3AK0A 1WA6X 2P3KA 3PURA 4H7LA 1XNDA 3HQRA 3VHPA 5DAWA 3WUDA 1QH7A 1V70A 3PUIA 1POQA 4M3CE 1C3HA 3HNBM 1GQGA 2A6WA 5C8CA 1W28A 1B35A 1W2UA 3Q8EA 4MGTA 1G9BA 1BKZA 2VZVA 3I59A 4YZ2A 2EVXA 4E4HA 1YFYA 3N4MA 4AEJA 2ET1A 1ENQA 2G9GA 4X6QB 2ZOEB 3VBRC 2J42A 4F3JA 1FMD1 5FO9B 1REFA 1UX7A 1I5PA 2GALA 2P3JA 3APBA 2ZZJA 1VMJA 4M4PA 2V4VA 4WVVA 3HT2A 2W1UA 4Y4YA 3ZVXA 1CAVA 2YMZA 2YG0A 4A7YA 1DYOA 2DUPA 5FY8A 2EIGA 4RS5B 5FUPA 3AX4A 3ZPOA 3WUCA 2AEYA 2HWD1 3SEEA 2DYCA 5LBCA 1IQAA 1D4M2 4GB31 4YZ1A 2XLAA 2FHRA 2IXLA 2J1SA 1PMHX 2WABA 4YVWC 2RMU2 4XUPA 2OZ6A 4Z2AA 4IE4A 1JMUB 1BEV3 1YO8A 3CO2A 2IVJA 1EUUA 1AYM3 4OHWA 1R1ZA 2OYZA 1I3HA 1W8NA 2HEWF 2WWSA 4P9WA 1QWRA 2HYKA 4IV1B 3SITA 4BOWA 2P1BA 4XXPA 1LOBA 5FXVA 2MEV2 2RS32 4Y20A 3WLUA 1HV1A 2WAOA 1NY72 1APNA 3MLLA 1BMV2 2R0FA 4YW2A 3A0NA 3F2ZA 2VQAA 5CFDC 3ZLIA 5B4XA 4YGCA 2HWE2 5JOYA 2OA2A 3T09A 1NXD1 2RS52 1DU3D 1W3XA 5FJKA 4K7JA 1N47A 3Q8CA 3DF0A 4YM0A 3ZXKA 1GOHA 4IETA 1SZBA 2D6OX 2JG9A 4QPIB 4XUQA 3H8UA 1QJX3 3PIGA 3I3BA 4GULA 2JXAA 1A8DA 4I3PA 2BERA 4NVPA 4Q4V3 4Q4Y3 5FP9A 3ZSMA 1OD5A 3NAPA 3FC0A 2UY9A 3LIGA 5SV8A 5T52A 1PVC3 4B1LA 1AYM2 5LBEA 3AFKA 1BEV2 5CKMA 5CFCC 1YFUA 3TEWA 3AC0A 4L8QA 1LECA 3NRUA 1W8FA 1LEDA 2JB8A 1DQ5A 4HETA 3ZYPA 4AI8A 4Q0VA 1Z0HA 5LA2A 3I2HA 3ZX7A 2LRPA 2J1EA 2YU1A 2HWE1 1H1AA 1DGRA 4L9BA 4NHXA 3VKLA 1WBLA 1WMDA 5IFPA 2Y6LA 2PFWA 2LM3A 4G3YC 1ENSA 2VZ1A 1LRHA 3N7JA 4LO6B 1JHNA 2X29A 4Q4X2 4X6RB 5FYZA 3WV6A 3H0OA 1M4WA 2HYXA 3LA2A 4Z07A 4XF1A 1HDKA 3FL7A 5A3LA 3K77A 2WZR3 3QLQA 4GMP1 5GLWA 2WFF1 4IDZA 1TME1 5FZGA 1AL0G 1QDOA 1W6MB 1ZBA2 1AX1A 1FNZA 3O1RA 4QQPA 1RMU1 1WCKA 3FE5A 1CPNA 1ZYBA 4L99A 3WXPA 1CAVB 3N9OA 5FMDA 4DPNA 3PVNA 2XJQA 2E7AA 1YUDA 3K75B 4LEJA 4TYSA 3T1LA 1VMFA 5JOWA 3THDA 5A1FA 5IHRA 5FZCA 2FZ2A 4QX0A 5JXGA 1GMMA 2AACA 1SCSA 4LQRA 4MHUA 1COV2 5T5LA 2XVGA 4LBQB 3ZYBA 5KHJA 5IAVA 3POJA 1RXGA 4I2OA 5BNPB 1CN1A 5BNNB 3UKNA 1HQLA 1YHFA 3BU0A 3B3QE 1SDWA 1OT5A 2PHUA 1VRH1 4DOUA 1AR83 1UAIA 2WNEA 4M4RA 1W03A 2RJ2A 5KXCA 3OBRA 1WA4A 3W21A 1QOSA 1LGCA 1RUD1 3ILRA 3KV5A 1MZ5A 4AEKA 1UX6A 5IK7A 4N7IA 1PIV3 2EAAA 1OPMA 1NA1B 3MV11 1X9PA 2MPFA 4LTAA 4CU6A 3H3ZA 3ETQA 2JENA 4P9IA 4ZZ8A 3AJYA 2DUOA 1VRH3 2F17A 3WF0A 2QCSB 1DBNA 1V6NA 1YI7A 5JZGC 4UOJA 3ZXLA 2X05A 1J3QA 2W47A 2XLFA 2NMOA 3RNSA 1OA3A 4FTBA 5FY9A 2A3YA 2X5IB 1PVXA 1H0BA 4XUNA 2AC1A 5FXXA 5L9BA 1ULOA 4UI9L 4Y1UA 1FOD3 4HONA 3ZFFC 3LA7A 2E7TA 1H8TC 3OB8A 5HBAA 4PDWC 1IPJA 3KT4A 1SPPB 2BDRA 4PQQA 3ZPYA 2XGXA 2VMCA 3H7YA 1QQP2 1NZIA 1OA2A 3KV9A 2Y64A 2BRTA 4I02A 4LITA 2XLGA 1JZ4A 5DG1A 3KGZA 2E32A 5HCFA 2W94A 3T2QA 5LW9A 3B93A 3IMNA 3FUOA 4OUSA 5FZHA 2VL4A 5BNQA 1GP5A 5DAXA 1AR92 2PHTA 3LDBA 1OSGA 3IAPA 3TNQA 3ZXEA 4ZZ5A 4RGKA 1O8SA 2IUWA 1R083 1T6BX 4QKBA 3L2YA 5FREA 4H7MA 1DZQA 1Y9MA 2VQTA 5K8SA 3B7MA 2JDYA 2PQQA 1ZVFA 4AFBA 5C8WA 5C9AA 4LR4A 1AXYA 1UXXX 1V9U3 2D40A 1IKQA 3Q9OA 1RUI3 2VMIA 2I74A 3E6CC 3SCGA 3BTXA 3VBRB 4Y3OA 1YJKA 4BQ1A 5A6XA 4LHKA 2XJPA 4QDSA 5T5OA 1ZA7A 3MYXA 1YWKA 3WQBA 1NLSA 3RYRA 2JG8B 3E5XA 5BNOA 1N3PA 4FSJA 1PGW2 2FMYA 4U2AA 4IEVA 4AFMA 3WP4A 2DVFA 4LKEA
chains in the Genus database with same CATH topology
3KCYA 4Q29A 5H9RA 1R1A1 4FVVA 1GNHA 1OPOA 5E88A 2ZGOA 3L9JT 4Q1RA 1JYIA 2HWC2 5EJ3A 3WDYA 3EHKA 4CEWB 1TEIA 4PIYA 1NA1A 5C8CC 4Q26A 3BOWA 4N43A 3ILNA 5CIRA 4Q0SA 4DY5A 3GZUC 2K2SA 3RZZA 1POV3 3UK9A 2R062 4X8PA 2ES3A 1QJX1 2DVBA 1LULA 2PHXA 2ZBJA 3D5OA 2D44A 3BTAA 1PNGA 1AVBA 5ACA1 1KQRA 4KL1A 2PAMA 1CESA 4IEUA 1F31A 1QOTA 1C28A 1AL23 2Q5TA 1GFF2 4LO7A 1R082 1LOCA 3ENRA 4MLOA 4YVSC 3ZN4A 4HANA 2QKDA 4CTEA 5F1RA 5KWRA 1X8MA 4AEDC 1T6GC 1DYPA 1PO11 3PHMA 5GLZA 4ISQA 5GLUA 4BLJA 2R042 4XILA 1F2NA 5C4WB 2ZMKA 4MVTA 4WM7A 1GBGA 4Q4V1 5JCTA 5H9PA 1FOD2 4Q0QA 1G9CA 1EYBA 3LZZA 3SMHA 1CQ9A 2D6PA 4XF3A 5GZFA 1LEMA 1BEV1 1J1TA 4WV8A 4KNCA 1O3SA 1BYHA 2WLQA 2JG8A 3SH5A 2VU9A 2I2SA 5EWSA 3VZNA 2WNUC 5CB7A 3TBDA 3LWCA 3AKSA 1GKBA 4IEZA 1NCQA 5T50A 1K5MB 4CDWA 5EFUA 4FPCA 3IDEA 3WCSA 1VBE2 4LBQA 2PAKA 5LK5A 3ZYGA 5BNPA 1VBD2 4GQ7A 1OMIA 4JGZC 4A7KA 3UKVA 2YGMA 3AP4A 1GANA 1SCRA 3D82A 5FO7B 3ZSKA 1WW6A 1AR82 2JDZA 5KBFA 3ZIXA 1QXRA 4KGQA 4A3XA 2QUOA 1AR61 3VKNA 1O3TA 4YLZA 3JQXA 4W6XA 4B3NA 3VUOA 3SNMA 3VBSB 4EJRA 4LBLA 4XQDA 3BU7A 2V73A 4XHBA 2QQPA 3VV1A 3ATGA 2RE9A 4LE3A 1NCRC 3S7IA 3GHNA 2BQPA 3TOJA 2HEYF 1KRIA 3N35A 3DPRA 2ZS6B 5I0UA 4CDQA 2A75A 3VDDB 2XBO2 1Q56A 1ZBA3 3AM2A 5TSWA 3POSA 1V6IA 3VBUC 3ZFGB 2BGCA 5BV6A 2CGPA 3KD4A 2GAUA 5A32A 3AXEA 2WC2A 5CFCB 1J58A 5A3MA 4EN7B 4HKOA 1MQTC 2RR11 5EXOA 1S55A 4FPHA 4WZFA 4Q4X3 1SBEA 1NG0A 2P37A 3H1YA 3OGJA 1QGLA 1PO21 1VB4A 4GH4C 4LHNA 4YSFA 4COVA 1MACA 5FLHA 2QDNA 1PVC2 5FRAA 3THPA 4B7KA 1HV0A 1YYNA 4M3CB 3AMPA 1CAWA 1MEC2 4TZDA 4Q4V2 3I7DA 4TSVA 1S0FA 3POWA 5CVRA 1CR7A 4IV1C 4PF5A 1EAH2 2GZWA 2XG3A 4EV0A 2PN5A 2NYYA 5JI9A 4HPKB 2FQPA 1D2QA 1MS8A 1RUI1 3MEPA 4XF9A 5BNOC 2RS53 4BWOA 5HCAA 2DFBA 4GIQA 4HVQA 3GNEA 4DRVA 5EYYA 3IM0A 1MVQA 4IERA 5T55A 4CDUC 4BA6A 1S1AA 4Z1VA 3MLKA 3AYEA 4Y5Z0 3ZSLA 4GMP0 4XJ9A 3JD71 1X7NA 4RQPC 3R4UA 1I6XA 2LALA 1RUE2 1B09A 2HWB2 4XEZA 2RMU3 2R16A 5K9YA 1TE1B 2ZPXA 5DG2A 1SLAA 4N43B 4CP0A 2GU9A 3ZIWA 2ET7A 3AYCA 1HRI2 4XBQA 3QOPA 4AHYA 3HWJA 4M0HA 4AYUA 2WJSA 1YFXA 4FT8A 3ZFGA 1X50A 4COUA 2B8MA 1G6NA 2BWAA 1DGRN 3M3QA 3RYPA 4XJAA 1R081 2V5YA 1ZA4A 2GN7A 2O8QA 1POV1 5FQ0B 1HXS1 1EV13 1LESA 4HK9A 2A7AA 4Q0UA 4AHXA 1FPN1 1O7FA 4HVOA 3M7AA 3OTFA 2PYTA 2TUNA 3ZYIB 2W08A 3QH6A 2CGNA 4RQPB 4LBOA 2ZX3A 3GHMA 1RUJ1 3TN93 3ZMNA 3FLTA 4UW3A 4M3CF 1RIRA 3FFZA 3CL1A 3VHRA 3PVEA 4N9IA 3ZYJB 3ZDSA 5I0RA 5L19A 3IDCB 3VBRA 1RHI3 2D97A 2D3RA 1W6MA 1S0BA 4E9KA 4FPGA 1PO22 4M3CA 3HT1A 1R091 1JYCA 2D93A 1GSLA 3WDUA 1S0CA 5FMOS 4H55A 1DGLA 4NWWA 1RUG1 3NSTA 5L36A 3ACLA 4I0WB 4YVWA 4RFT0 3BODA 2DVDA 1RUH1 2BW8A 1EPZA 1KDKA 1O4TA 4N90A 4YW5A 4AGVA 2QDRA 3VGIA 1NQDA 4M0NA 1XYPA 3IT8A 3N7LA 1OHFA 4RS5C 1VBB2 5ACA3 3TB0A 1L3JA 1ONAA 1WLWA 2QZ3A 2WS91 1QQP1 3O12A 5JOXA 1HW5A 3LGRA 3VBOC 3D0SA 3TAYA 2VMGA 2UWBA 1PM7A 2SLIA 3KMHA 1U5YA 5LRRA 5E89A 4OHXA 1AR63 4L11A 3VKOA 1VBA2 3HD8B 4WM7C 3ZFEC 4EN9B 2GNBA 1XNBA 4XE9A 2HWB1 4WVMA 3WP6A 4YM3A 3C2UA 1FV2A 3VDDC 3D0JA 1YFWA 5J98B 1JOJA 5ACA2 5ABJA 2DVGA 2E63A 4P9LA 4RR3A 1LOFA 2AUYA 2PLV2 5CG9A 2BNMA 2YPJA 5K0UA 3JBG3 1UZZA 2R073 1QXPA 2D98A 3WINE 1ZRCA 4PLOA 4XFFA 1ALYA 2UU8A 1UN1A 4Q8LA 1AR81 1G9FA 1XYNA 5JLVA 3QH7A 2PHLA 4Q4W1 1MZ6A 4FOQA 2XJSA 4JGZA 3RQ0A 2VNOA 3S30A 2IXCA 2HWC1 3OY8A 1REEA 4GKYA 1MR5A 4Q4Y1 1YXWA 1ZNPA 4Q27A 1WMEA 1AYM1 3WDVA 1R1A2 2WA4A 4IV3A 2OVUA 3R4DB 1FXZA 3CJIC 1LU1A 3TN92 2ZKLA 2DVAA 2UYAA 1YJLA 2DU0A 2BPA2 4ITCA 1W6NA 1GV9A 4FBFA 4WM8C 3MGUA 3KM5A 4TWTA 3USSA 4OHYA 2WT1A 4DXZA 3POYA 1N3QA 3WP3A 4R8HA 3MW4A 4FAGA 5T5PA 1IKPA 2RS11 2IFRA 3M3IA 3A4UA 3R6SA 5C9AC 1QF3A 3LB9A 1AYN2 1AHSA 1H4HA 2O8OA 2OW4A 1HRI3 5DDJ2 3U11A 1RUF3 4Z92B 1O91A 1SEFA 2Y0IA 4XMAA 2PHDA 3EJKA 3FBYA 4P14A 4FO9A 2W39A 2CAVA 4RA0A 5FLJA 2HWB3 1RUE3 1C8M3 3A0KA 1Y3TA 3MLJA 2XPJA 1DGWA 3MW3A 1VIWB 4O9EA 1WCDJ 1LB2A 3VKMA 3LOIA 3JCIA 1VBA1 4H3WA 4DRRA 5J3UA 3IN9A 1BBT2 4JRLA 3WG4A 2ZCWA 4RR3B 4MSVA 1NCRB 1CVNA 4YW4A 4YW3A 3I4IA 4K1ZA 4N7UA 2NMNA 1VBB1 2DUQA 4KQ7A 1O4YA 4Q2FA 1EAH3 2HEVF 3THTA 4KG8A 2XL9A 5JIAA 3PMSA 3OYWB 1DHKB 4HK8A 1VLNA 5AC91 1MEC3 1YLLA 2NPIA 4P9JA 3WW1A 5FQ0A 4RR3C 1HXS3 2XJTA 3E5QA 3J8F2 1EAH1 2DV9A 4CDQC 2CTVA 5C4WA 3U4XA 3DL3A 4W65A 5I91A 1H4GA 3FWEA 3H9AA 5EV7A 1CAWB 4OHZA 2CV6A 2JG9C 3KQRA 2JJ6A 1U5XA 3MFCA 1CONA 1OKQA 3E97A 4NHKA 5FBZA 4AQ2A 1QJY1 1XU2A 5IK4A 1RMU2 2XVKA 2NP0A 3INAA 3LKJA 1AXZA 3FLRA 3IIAA 4RHV2 1ULFA 4PIXA 2ILMA 4TLFA 3WVJA 3KCCA 1EPWA 2ZGTA 5J37A 4QGLA 1MEC1 1WD3A 5FOJB 4YGDA 3FZ3A 1SQ4A 2XKPA 1R093 1MQTA 1FV3A 3OD0A 1MVEA 1D4M1 2NLRA 5CG8A 1COV1 1HRV1 4QU2A 4K1YA 4K40A 1Y7BA 2MHFA 5FO8B 3JQWA 3VBUB 3ZFGC 3RDIA 2D6LX 4BIFA 2XJRA 4ZKTB 4FPKA 2ZACA 1ZM1A 5GZEA 1F8VA 5KC6A 4PDWB 4AQSA 4JAAA 2VW0A 4YFWA 4AGGA 2PHWA 1SLCA 1MS9A 3VZKA 4WVMB 3QCWA 1N1YA 3VBFC 1DIWA 3GYDA 2EA7A 1H2NA 5FPXA 2DWRA 1VR3A 5FCCA 1IZ3A 4D94A 5AVAA 3O5SA 1D0HA 4L2NA 2X53S 4R9AA 5DZEA 4PLNA 3AYAA 4Q8KA 2E51A 3N7MA 3O7OA 2JE7A 3QBQA 4JTNA 3I59B 3FMGA 2AYHA 1ENRA 3MIDA 1S2KA 3RS6A 2WKKA 4HN0A 2UWCA 4COZA 2WNUB 4XZPA 2ZABA 1ZBA1 4MGZE 2IWGB 1I1EA 2YC0A 4C91A 1FPN3 2I45A 5I0TA 4IV3C 4LUMA 1QY4A 2Q1ZB 1XE7A 5BNNC 3B9IA 2LUWA 1BBT3 4OFGA 3AZXA 4WM8A 2YV8A 4XDQA 2EXIA 2RJKA 4JQRA 2XL7A 3WQ1A 4MGKE 1C8M2 3AMNA 4QXKA 1PMIA 3NV1A 4C1XA 1G86A 4FPJA 4CDXB 2VW1A 2WA3A 4FP2A 4INDA 5T3NA 1MQTB 4XETA 1V6JA 5BNNA 1J1LA 2PA7A 4JGYC 1HRI1 5KHKA 1UF2C 1UKRA 1LOFC 1N1VA 2A5ZA 4YVSB 2WQ4A 1W6PA 1Q8PA 4R9BA 1GQHA 1WW7A 5H9SA 2A73B 3AKTA 4UW5A 2ZX2A 2XKOA 2ZGQA 2R1DA 5CADA 1YRZA 2FBEA 2GNDA 4DZGA 5I8YA 1C8M1 4YZ4A 3AZZA 4NN0A 3TYJA 2HWC3 1PZ7A 4F83A 3RI8A 1BZWA 1RUD2 4QQHA 4DQAA 3VBSC 4GA9A 1JH5A 1M06G 1OOPA 3W9AA 1RGSA 5DDJ1 5A33B 4OUMA 2D43A 1KDMA 1NYWA 4CEWC 3SH3A 4JGZB 1BCXA 3AB0A 3UV9A 2YUEA 2ZHNA 3V56A 1W0OA 5DUXA 5JR7B 1UIKA 2DCTA 5GZGA 1DDLA 1NE4A 2WZPP 1RUI2 4P9GA 2FZ1A 4LA3A 3U10A 4D3WA 3AJZA 1TQ5A 4ES8A 2WNUA 1FMD2 1CPMA 2YDEA 5FOBB 3NKTA 3ZFFA 2R041 4XFGA 3ZFEB 2PLV3 3WQ0A 2DF7A 3CEWA 4FXGB 5HI0A 4XW3A 3H1WA 5GJ6A 2CNAA 1AR93 1RL3A 1QNYA 2WS92 4XFCA 4RSUA 4UBGA 4B7EA 2RHPA 2XVLA 1W6QB 4AEMA 4DNYA 5LK7B 4YARA 1H2KA 5IK5A 1RJ7A 3FLPA 5C9AB 2WNVA 4K9SA 2BBVA 4XPVA 4YYOA 2QVSB 4HFSA 2CL2A 2BVVA 3NKGA 1VBA3 3AZWA 4CDXA 3WOGA 4MXWB 1WCSA 2F4PA 4Z82A 5JWPA 3P3PA 2QFEA 2DCYA 4W6WA 3MFAA 4SBVA 4A2UA 1ZRDA 2OPKA 1KJRA 4S2GA 3HAGA 4JVAA 2GN3A 4EN8B 2BWCA 3JD73 2D6MA 4YZ3A 1AUYA 2Q0AA 4UW6A 4Y20B 3EXUA 3TRSB 1VBB3 4COWA 1POV0 4QQ2A 1NQJA 3AKRA 3MW2A 3SLIA 2OZJA 2AGSA 1LOAA 4IEOA 4XJZA 1FX5A 4JC1A 1ENXA 4XBNA 1CD3G 2TEPA 2ZHMA 4LNVA 1H1MA 2JX9A 3WHTA 3WW4A 1ULGA 1H2LA 4IQPA 4X8NA 3T1MA 3E6BA 1FI2A 2JECA 1FATA 1RHI2 1NA1C 4RGAA 2VUJA 3VHNA 5A32B 4CEYC 3PJYA 3ZXFA 2IXKA 4I3GA 1SLIA 2DU1A 4Q4W2 3NWKA 2RS12 4L92A 2EAKA 1RUJ3 1COV3 3KZ4C 4BHPA 2EF6A 1WLDA 2A70A 2NZ9A 1AF9A 4GB32 4XFAA 2G9FA 1DQ6A 2HWD3 2Q1MA 1EV12 2B5HA 2WFPA 1SACA 4N43C 3MICA 3G7DA 1CX4A 4FPYA 1A78A 2BUKA 3O0XA 1NXMA 1V9U1 3NV4A 3V0BA 1OQDA 3M1HA 5L7OA 2WNVB 1H2MA 1W0PA 1W6NB 4HPKA 3MPBA 4V1PA 4RL7A 2AH2A 4EN6B 4CDUB 1X8EA 3JB8A 4AWDA 1CAUA 3NJZA 1C5IA 4KG0A 1ZRRA 2NN8A 4WM8B 1H30A 2W68A 5D8AA 1ZZCA 4AVBA 4J1XA 2VUAA 4GWMA 3NO8A 1U0AA 3CJIB 4LO8A 1AR73 4MH0E 5JSPA 3OPZA 1G9AA 1K5MA 4K8FA 3DKWA 1LODA 3ROUA 1QJX2 3V0AB 2B39A 2DTYA 2XHKA 1QJZA 3WW2A 4E4ZA 4QT6A 4XIOA 4EWAA 1HQWA 2O1QA 1CIWA 4PDWA 1LHWA 2D5HA 1UZYA 4MXVA 4CEYB 3FBMA 4XYXA 4GH4B 4XXAA 1GZCA 3ZMOA 4XF0A 4AVAA 1I5ZA 4QQOA 3KLSA 2C5DA 3FHIB 2RS33 1UU5A 2MEV3 1OQ1A 5KHJA 5KHGA 1OFNA 4B4RA 5DZFA 3ZXDA 2H0BA 2YY1A 1AR72 3FX3A 4PJYA 5DUWA 4ES9A 3ME2A 5J36A 4XJWA 2WQZC 1TMF2 1S2BA 5K7PA 1YI9A 1ASJ2 4LBJA 5C33A 2F6BA 1V6LA 2ZJCA 1KXGA 2WZR1 4LBKA 5GLVA 3VDDA 1QJY2 3JB4C 4OI0A 4MZUA 1I9RA 2IXJA 4WM7B 2B7YA 3M4FA 2N7GA 2Y0OA 3M8LA 2IC1A 1W39A 4NO4A 3K48A 4PBPA 2VVFA 4I01A 1EY2A 1E57A 5IT6A 2RR12 4QPGB 5GZDA 1PIV1 2GNTA 4LHLA 5H9QA 4BM8A 2D3PA 4GB33 3SISA 3PTYA 1RUJ2 3JU9A 2RS13 2XWBB 4HKWA 4Q4W3 3DN7A 3WW3A 1UL9A 5BNOB 4PLMA 4OI2A 3ZXGA 4P9XA 1QKQA 4XF4A 1SBDA 2ZMLA 2YZ4A 4I0BA 4KGGA 1J3PA 1X36A 1PZ8A 3PJQA 4HBNA 1W6OB 2KXLA 1KS4A 2Q8OA 3VBSA 4CP2A 4WZCA 2EXHA 1O5UA 4MGIE 2CY6A 3ZYRA 3C3VA 4KU7A 2P3IA 5T54A 3QD6A 1VBE3 3WX5A 3JBG1 3VKFC 3S7EA 1RUC1 1DYKA 4IESA 2ZZQA 4OVEA 1OOPB 2RS51 4JDMA 1O3QA 3D6EA 3NAPB 5JI7A 4AW7A 1JW6A 2PTMA 4AEDB 3JD72 1WUVA 2XJUA 3WG3A 4A7ZA 4AVTA 1LHUA 2ERFA 2RMU1 4META 1PHMA 5CFCA 4QMAA 1KJLA 5J96B 2VOXA 2VNGA 3WT3A 1KD7A 5AC93 3O0VA 5BUVA 1AX0A 2R043 5T5JA 4EWDA 1VBE1 4KWLA 4LBNA 4LBQD 3VN4A 5SV5A 3D4KA 3ZFFB 2WS93 3ES1A 2MNGA 4HKLA 4D7TA 1TME3 2DFCA 2E6VA 4BMBA 1HQNA 2VNRA 1AL22 1ASJ1 1IS6A 2VPVA 4KH9A 4KWJA 3WD5A 1LKNA 4CDXC 4DFSA 3MZHA 4FPEA 1RC6A 2GMPA 2H6BA 2WFF2 4OI4A 5GALA 4YFZA 3VHOA 1ZBE3 2WL1A 1JUIA 4URTA 2ZMNA 4XJ8A 4MXWA 2PHFA 2R063 1S0JA 3PMEA 2Z79A 2EXKA 1ND2B 1SMVA 1NCQC 3MIBA 4CDWC 5KHIA 1OA4A 4R4XA 4E4DX 2P17A 1LTEA 1VBC2 1NCQB 4CDWB 2IZWA 1RUG3 4JDNA 1XXNA 5JAXA 4HSJA 5JMCA 5BNPC 5CA6A 1D2SA 3DGTA 1RUD3 1SLLA 1RINA 4BLIA 2B9UA 3RSJA 4CRQA 5JDBA 3MIHA 2BFUS 5JPNB 4Y26A 1VBC3 1B35C 1LHNA 2UY8A 3OGGA 1RB8G 4DINB 2HWF2 4RHV1 3AP5A 3GBFA 2WLPA 2ZTNA 5BXXA 1DQ4A 3CJXA 4LO4B 1G7YA 4KU8A 4S2FA 4M01A 3USUB 1Q3EA 1HKDA 1VAMA 1XRUA 1ZZ9A 3WY6A 5JZGA 4FQ4A 1BVP1 1UPIA 1F5FA 3AFGA 1RUH3 2KM2A 3VBHA 4AEDA 1DZTA 4AI3A 4FTEA 4EWEA 1FYUA 3AXDA 4LT5A 1QJU3 1U5IA 1ZBE2 1RUOA 1V9U2 3P3NA 2GC2A 3B00A 3IDBB 1EV11 3KB5A 3NV2A 4QD2A 2P34A 1RVF1 2E53A 1LU2A 4LA2A 4AK3A 4QHBA 2TBVA 1H8TA 2RM23 4AHZA 1TNFA 2HWF1 4AVSA 1PNFA 1PVC1 1SLBA 1TME2 3NW4A 3URFA 5E1RA 1NE6A 5FFOC 1LENA 2KA3A 5K0UB 3BCWA 1PK6B 4OZXA 1OOPC 3FFQA 1QQP3 2UWAA 5AC92 4B4QA 1URXA 1QMJA 4QPIC 4BYYA 2HKXA 2IXIA 2GC0A 3UJQA 3EBRA 1RTVA 1QJU1 2Y38A 2VMHA 4NHMA 2BTVC 2NM1A 4HL0A 4LLFA 5JPMB 3HN1A 4CDUA 1LJ7A 3N7KA 4DMIA 3IPVA 1ZZ6A 1K5MC 3M70A 4M00A 4MGYE 4IV3B 5D8AB 2WSVA 4K21A 2A3WA 1PO12 1VALA 3IWZA 2XUMA 4WBBA 1QHDA 1NZCA 4DS0A 4E27A 1Q8OA 1PIV2 4PBOA 3AYDA 1WBFA 4S2HA 1G9DA 1UPSA 3UJOA 1NY71 1BMV1 2ATFA 3B9CA 3SCFA 5AFBA 4GXLA 5C4WC 2GC3A 3SHRA 2P2KA 1BXHA 3H7JA 2K9ZA 3OBTA 2ZGRA 3WCRA 3JUUA 5F9TA 5D1IA 1ZREA 2AREA 4Z2WA 4R9CA 3WG2A 1LHVA 4FPLA 1VAKA 1R092 1AJKA 3WHUA 2XJVA 4Y1YA 1YIPA 2BEOA 3AKQA 1DFQA 2RR13 4AXOA 3DUIA 1IHMA 4YNIA 2CWSA 3M3OA 1H8TB 3IKWA 4HVRA 3W59A 4AVCA 1TNRA 1CGPA 2WZR2 2IFWA 2CWMA 5JIUA 3T2TA 4E2SA 1RMU3 2C9AA 3VBHC 1S0IA 1QNWA 1QJY3 4ZU4A 3AP6A 4B8EA 3GBWA 4P9YA 1FAYA 5HCBA 4F8AA 3SCHA 5C8CB 2HJIA 1BQPA 1RVF2 1VP6A 1X33A 2WSUA 4SLIA 3NV3A 3ELNA 1ASJ3 1Z7S1 4IEYA 4YZ5A 4GALA 1TMF3 1RUNA 2XBO1 4QGNA 4K6BA 5CU1A 1O4ZA 3RG0A 3IPVB 1REDA 2NQYA 4Q4Y2 2TNFA 2YROA 3QACA 4R52A 1QH6A 4Y1VA 4UXAA 4FQZA 3MPPG 4EROA 1KFUL 2JG8C 2YXSA 4JV4A 2B46X 2HWE3 1CAUB 1YCIA 3ES4A 1PGL1 1AYN1 3N3HA 3UKTA 2GMMA 1A3KA 3TWIA 1V00A 5C6CA 4XFBA 4B29A 4NHLA 2WNVC 2PAEA 5ABJC 1XNCA 2GC1A 1PZ9A 3M3EA 1ZZ8A 1O5LA 2A6XA 4K20A 1WD4A 5FMOL 5E8AA 4ONUA 4RGGA 1LGBA 2VVEA 2YGLA 1D0GA 4AVVA 5J7MA 5JOZA 4AGRA 2DCZA 2VULA 2ZGMA 5L73A 4CEWA 4CEYA 2R6QA 1D4M3 1JBCA 3J8F1 1NCRA 1RUF2 1AZDA 1RJ8A 1ZX5A 4LULA 1AYN3 4FPFA 2VH9A 4BPZA 4FOVA 1OQEA 5A33A 4GWNA 4C0HA 3KCXA 4E2QA 1G8WA 4MUVA 4XTPA 4O9GA 5AFEA 1JUHA 4OHVA 5DUVA 1IOAA 1CAXB 1A6CA 1SBFA 4QM8A 4P5HA 3R05A 2HWD2 4AFCA 1LOEA 4XBLA 5GKAC 3VBOB 4AI1A 4W6YA 5L7OC 1R1A3 4QQLA 1Z7S3 3VZMA 3KS7A 1GZWA 4XQWA 4ZU5A 5KXDA 1H9WA 3KT7A 1QU0A 5JSOA 1DGWX 1S0DA 4JGYA 2VQ0A 3J4UH 2Y26A 1DF0A 2VVDA 1VAVA 4Q0PA 1HRV2 5LEKA 2XB6C 3JBG2 3DV8A 1WW5A 3V64A 1VBC1 2DCKA 5B2GB 1UMZA 2D6NA 3IBMA 2Z5WA 3CU7A 1N1SA 4I30A 5DUUA 2OIIA 3FUQA 3G6JB 3BPZA 1XNKA 4AFDA 3K51A 1UCXA 2CGOA 2SBAA 3HIFA 4YM2A 3USUA 4NWVA 2A71A 2UYBA 1AR62 1ZZBA 3ECQA 3AZVA 4YVSA 4XTMA 3RJRA 1EP0A 3W58A 4ZXKA 5IUQA 1WGPA 5AVPA 1AXKA 3ILFA 3S6PA 3E6DA 3ZSEA 3ZXAC 1QDCA 3O14A 4N9HA 1Q8VA 3HQXA 4S2DA 2YHJA 3BB6A 1GNZA 2X5IA 2E9QA 3H1MA 4G4FA 1IS3A 1XYOA 3U0ZA 5J09A 3O0WA 1MS5A 4N53B 5CNAA 1FMD3 3DPRB 2A6ZA 3MIFA 1UKGA 1RUC3 2GH8A 3KT1A 3RPQA 1AX2A 1YNAA 4BE3A 4AE2A 2IXHA 2C1FA 3LA3A 3OD4A 1GICA 4J1WA 3EQEA 4HSLA 5CFDB 3MIGA 1Y9QA 1PGW1 1RHI1 4ASMB 1Q43A 2QJVA 4BH9A 4FAHA 2Q30A 4COYA 3V0BB 2PHRA 1Z7S2 1ZRFA 3BOPA 4NOTA 4IXLA 3E5UA 1HLCA 1Q8QA 3VLBB 3U07A 1PGSA 5I8SA 3AKPA 2XH6A 2VG9A 2Z42A 3VL8A 1KS5A 2Q4SA 4I0AA 4NR1A 4YVWB 1F9KA 3CNAA 2BNOA 3AMQA 1C57A 2RM21 3WDXA 2B45X 4KWKA 1N3OA 3PLQA 1ND2A 4MX3A 3BIWE 2VW2A 2R1BA 3AMHA 4AI0A 2GMEA 4GMP3 1CJDA 4Y22B 4YG6A 1W6PB 3OJBA 2A3XA 4YRDA 4XQ4A 4UW4A 4GKXA 2JE9A 3DPRC 1ZZ7A 3LCPA 2DCJA 3HR9A 2AZ5A 1C5HA 3RMXA 1LR5A 1S0GA 2ZKNA 2ZA9A 1C1LA 3MDPA 4GH4A 4FP3A 2V09A 3R4SA 3VBUA 4JTOA 2WIIB 3WR0A 3RMYA 2JG9B 4QPIA 3RI9A 5DZGA 3HMYA 4LE4A 2ZAHA 1NLRA 1FOD1 1WLCA 2D7FA 4CDQB 1UD1A 1SFYA 4PCRA 1RUF1 4B4PA 2RJLA 3S0MA 2ZGKA 1MS4A 4OI1A 4CYDA 1YIFA 5CAZA 1FPN2 4LO5B 3CF6E 3MI8A 4YGEA 4QX5A 2E7QA 1HX6A 1X82A 4AG4A 3B69A 1GYKA 3LSDA 3ZN6B 2JICA 3RYKA 1BK1A 1Y43B 2DTWA 4U36A 2ZX1A 1MS0A 4IEWA 5E16A 3VBFB 3ZN5A 1BVVA 2Z69A 4YG0A 1RITA 2K0GA 1GR3A 4Z8BA 4IEPA 2B42B 2ZAAA 1CAXA 5CFDA 2BYVE 1JN2P 2AENA 3VL9A 1A8MA 3SXWA 4C0BA 4R9DA 1CJPA 2WT2A 4DY3A 5IK8A 4RQPA 2PLV1 2ZGPA 1S0EA 1RVF3 1ND3C 1NOVA 3N36A 1N1TA 3PNAA 4BCUA 2DURA 1OI6A 4YW1A 1MS1A 3B01A 2PELA 1D4VB 2R49A 5F6KA 2VOKA 2GNMA 1GLHA 1MZEA 2H0VA 4ISRA 1SLTA 5FDBA 5L7OB 4MV2A 2R061 2XBO3 3VZOA 1VBD1 1ND3A 1XE8A 3I54A 4Q4X1 3TN91 4OLLA 1IS5A 2QE3A 1WW4A 2OUJA 4JDOA 4XHXA 5KXEA 2RS31 4YM1A 2ZGSA 4I09A 4Q1PA 3AP9A 3WZ1A 2R0HA 3NVCA 3VZLA 2OUHA 3LOBA 4YG3A 4FOWA 2A6VA 3I2DA 3V0AA 3J9SA 3ASIA 1HIXA 1UU4A 3AZYA 2VOWA 1V6OA 3M3CA 4WVWA 4RHV3 2CYFA 3V65A 3NL1A 4R4ZA 2ARBA 1VBD3 4HLTA 4XIKA 2X8KA 2W0XA 3WQ7A 1AR71 2ETEA 2X5IC 1OFSA 2ARXA 2WINB 2H6CA 1DQ1A 5CBLA 1MZFA