4AF9A

Crystal structure of epithelial adhesin 1 a domain (epa1a) from candida glabrata in complex with galb1-3glc
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
228
structure length
228
Chain Sequence
ASKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNREYDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords EPA1P
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
total genus 60
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4af9A00
5A3MA 4AI3A 4AFCA 4AI0A 4ASLA 4AI1A 4LHKA 4LHNA 4GQ7A 4COVA 2XJPA 4COWA 4AFBA 4A3XA 2XJUA 4LHLA 4D3WA 4CP0A 4CP2A 4CP1A 4AHXA 4COYA 4AHZA 2XJQA 4AHYA 2XJRA 4AI2A 2XJVA 4AFAA 4COUA 4COZA 4AF9A 5A3LA 4AHWA 2XJTA 2XJSA
chains in the Genus database with same CATH superfamily
1LU2A 2FDGA 2VZ3A 1OURA 1E5SA 2P4EA 3AKSA 3QCWA 1VIWB 2BGCA 1MQTA 1JYIA 1TE1B 2RM23 3FFQA 1JZ4A 1CAXA 2ZGNA 3I4IA 1YQ6A 2VNGA 4FTEA 2WN2A 4D69A 2PA7A 4IEOA 1S1AA 2EVXA 3AFKA 4LIVA 2VBBA 1DLLA 2CU5A 2R072 1W2TA 5FY5A 2VBPA 4BA6A 2CDOA 4BIOA 1QOOA 3TNQA 4J1XA 2JJ6A 4C0BA 3UKTA 1GICA 1STMA 3OJBA 1NLRA 1JZ5A 2Y6GA 1FMD2 1Q8SA 2R16A 2RMU2 2ZOEB 1OH3A 3A22A 3POJA 5LA2A 3WHUA 2GMPA 1YC61 2HEVF 4M0HA 4UAPA 4BLJA 2W92A 1J83A 1W6OB 3GBFA 3IMMA 3OSDA 4LA3A 3USUB 3S5AA 1Q5OA 2EXIA 1JYXA 2WT0A 2D3SA 5LK7B 4HKLA 4XFBA 4AFMA 1OPMA 5JZGA 3J7MA 4P9LA 2QBXA 5EQUA 3VBUC 3WNKA 4WM7A 5A7PA 3HOBA 1JYWA 2VZRA 5CFDB 3ZVXA 1PVC1 1WA6X 1RB8G 3ZIWA 1QDOA 4AZZA 4S2GA 4CDXB 5KXCA 1NX9A 4DS0A 1NCRB 2VE1A 3J8F2 1QJU2 4CEYC 4JHZA 4KGQA 2WO2A 2NN8A 3LAGA 5FPAA 1H4GA 4XQWA 2XXZA 4XCBA 1RUI1 3K4AA 5J09A 3DEMA 2Y60A 4XQ4A 5FUPA 2G1MA 3LA2A 4Q0VA 3AP4A 4G9SB 2YB7A 2ZGOA 1AYM2 1VRBA 3D0SA 4QD2A 2WZEA 4FAHA 5JLVA 4A3XA 5JOXA 4XJAA 3KGLA 1XYOA 3APBA 4M3CF 2HWD3 2XH6A 4ZPIA 2FDIA 4FI9A 5C5UA 2UWCA 1W28A 1LECA 2Y8KA 4ZU5A 4P00B 5FY1A 2ZBJA 3UJQA 4NAMA 5BNNC 1EP0A 2OVUA 2XKOA 3LDKA 3MIGA 4K40A 3R6SA 1YUDA 3GBGA 1OQEA 3FL7A 1QIQA 4JZRA 1KD7A 4AHWA 5KC5A 2QQIA 3GGLA 4DINB 1EV13 1RXFA 1MEC3 2Q1MA 3OTFA 4BIFA 5CFCA 3IAQA 3TYJA 2O1QA 5A70A 2JB8A 3OOXA 2YFZA 4AVAA 2ZHNA 3K51A 4NPMA 2FDFA 4LKFA 4LPLA 5I0TA 1CZVA 1DQ4A 3S7EA 1WLCA 2IUWA 3IDEA 4XXPA 1FNZA 4GJYA 1UMHA 1WUVA 1G7YA 3VBSB 3KHCA 2YFUA 1PIV3 3E5XA 4YGDA 2RG4A 5LB6A 5LRRA 5BNNA 5FOBB 2J1UA 3B5LB 3RGBA 1WD3A 3OGVA 3ITQA 1H2KA 5D8AB 2ZS6B 4GALA 1D0HA 2HYXA 4E8DA 5KC6A 1Q8PA 1W04A 1OFNA 2AYHA 1W8NA 2XGXA 4LKEA 4QDQA 3WHTA 5IJRA 1CX1A 3ZKUA 1UMIA 4R9DA 4E4SA 1LU1A 1V6JA 4C1WA 2P2KA 5LBFA 2K9ZA 1W6NB 3H9AA 3CZUA 1R1A2 1GV9A 1RL3A 1G86A 1PZ9A 2VUAA 3SQOA 2Q5TA 4ES9A 1O59A 4RA0A 1OA2A 1AVBA 2RS51 4KGGA 3ZN4A 3ZYRA 1XNKA 5A1LA 4UFIA 2GALA 3U14A 4KBBA 1K5MB 2PHXA 3CJXA 2AC1A 5FO7B 4AWDA 4COUA 1RUI2 4Q5OA 4AF9A 4YW4A 4COZA 2JDNA 5F5QA 1WWYA 1CN1A 1SEFA 1VBD3 2YV8A 1MQTB 3OEBA 4QXCA 4BWOA 4SBVA 4LUMA 3U10A 2WNUC 1PO23 1RVF1 3AKTA 5EPAA 5FPVA 4V2WA 1DCSA 1KS4A 3VZMA 4XF3A 4NOTA 4PQ9A 3WG1A 5AVPA 1YFWA 2WR9A 2DCTA 3FHAA 4COVA 5JXHA 4ZZ8A 1DZRA 3POWA 4Q1RA 2XDVA 5L9VA 2JDAA 1QXRA 4CEWC 3WOGA 2PHTA 5J98B 1RUC3 4KWJA 3WP4A 4AAPA 4E4HA 3D4KA 2ZXQA 2C1FA 3CDZB 4OFGA 5FZMA 5JCTA 4NIHA 4LK7A 2QUOA 3QD6A 1MVEA 1OBNA 2IVIB 5T54A 3BVCA 5BV6A 5D2AA 4FPJA 3I97A 1U5IA 1XNCA 3ACIA 4OMDA 3RPQA 1GQGA 3HVDA 2VTXA 1C8M3 3ELNA 5FUNA 2XL9A 5JZGB 2Y6HA 1WMXA 4P14A 4WM7B 5FXXA 5GLUA 3WP6A 4KH9A 3MZHA 4XZUG 4AFCA 4BXSV 5CZKA 5CKMA 3H1MA 1GP5A 3MV11 1GWLA 1KFUL 5GJ6A 4BOWA 3NNJA 5IK7A 2RJLA 3V65A 4YG6A 2VMCA 2VQTA 3HN1A 3PHMA 3CEWA 5B4NA 1TME3 2F6BA 4IE6A 4CEWA 1D4VB 5A7WB 1Q43A 1WW7A 2X09A 3ECQA 5DAXA 1O3RA 3KVBA 3WF4A 4JGZA 4XURA 2DV9A 4UYBA 1RUF3 1UY0A 1VBB3 1PMIA 5HCFA 2WRAA 5CVRA 2A6VA 2LS6A 3NMBA 4MADA 1Z78A 2TNFA 2WKKA 1YJLA 2BOIA 2PQQA 3SKJE 3N9PA 5JAXA 3HBZA 2YC2A 2DCYA 2RS52 3RI9A 1HJFA 2JICA 1XU2A 1ULOA 1H8TB 1LHUA 1ZX5A 3IWZA 1FT9A 4LIUA 2JDUA 3KF3A 4J1WA 1H0BA 2NPIA 5FPZA 5CAZA 4QKNA 3I2FA 2W52A 2Q30A 2OUHA 4EN6B 2JG8A 4OI1A 4OULA 5ABJA 1WA4A 4FT8A 4E2QA 1JOJA 4GMP1 4QQLA 3WDXA 1RVF2 2PQSA 2V09A 3O0XA 1KFXL 4GWMA 5CFCB 3LDBA 2VCAA 4NO4A 3WDUA 5FQ0A 2ORZA 3AP6A 1YI7A 4M4PA 4HMZA 2F4PA 3DL3A 1APNA 2OT7A 1S2EA 3UKNA 4I30A 4XF0A 2XG3A 3N35A 5F32A 1AJOA 1DHKB 2G9FA 3O5SA 1ZRFA 4QX0A 2P17A 5IVVA 1FNYA 2YY1A 4BZ4A 5FYBA 3LB9A 3GZUC 4CCOA 2FCTA 3TEWA 3SISA 3RZKA 2VNOA 2A71A 3SKVA 1HRV3 1W9FA 3CU7A 3EO6A 5FV3A 3N36A 4CP9B 5DDJ3 1H2MA 1QJY1 1DBNA 2VBDA 1PGSA 2IFRA 3ZMOA 2RDRA 2GDFA 2ZGSA 2G9ZA 3Q8BA 2YGLA 3H8UA 2RDNA 3POBA 2V73A 4UI9L 2VW1A 3CMGA 4DY5A 4OHYA 4OZOA 1SACA 5FZ6A 3WR0A 3SH5A 3VD4A 1Y9MA 4DXSA 1OOPC 4IE0A 3VN4A 1PNFA 4J6GA 3ZXJA 5K8SA 3OBRA 2A75A 1LTEA 3OUHA 4BQ4A 3RFRA 1PVXA 1JU3A 1UL9A 2WZR3 2D6PA 2RM21 4L97A 3KLSA 2P5BA 3I3DA 3BTYA 2W3JA 3URFA 1C8NA 4RL7A 5F3EA 3WF2A 3LSEA 2E7QA 4YM0A 1JI6A 4QX2A 4HBNA 3KD4A 3HNMA 4PDWC 5FZKA 5IHRA 1Q56A 4NRQA 4FPLA 1NOVA 1BHGA 3GF6A 1KDMA 4LHSA 1KEXA 5I0RA 3ILRA 5I93A 4OQ9A 1AXKA 3WG3A 2O14A 2LTNA 2EIDA 1W3VA 2OX0A 3FUQA 2IXIA 3WP5A 1UXXX 2Q8DA 1OOPA 4M0NA 2FQPA 2AH2A 3F2ZA 4Q26A 5FK8A 5IVCA 1GUIA 4Y4RA 1DYPA 1W3XA 4KG8A 4YNIA 1BQPA 1U5ZA 3I2IA 4ARXA 1W6MA 4CCDA 3HJRA 4LHLA 4YW6A 3RDIA 1Y9GA 3JZVA 5JXGA 1JZ2A 4I09A 1REFA 3A0KA 4OUSA 3AYEA 3OUIA 4AHZA 1NLSA 2B42B 5T5JA 3SEEA 4C8DA 4ES8A 2D5FA 1BJQA 1REDA 1AR91 1RUJ2 1JZ7A 2ZAHA 1LHVA 1UPIA 5FZBA 3GZAA 3THCA 3BN6A 2PHFA 3E5UA 1FOD3 4JKLA 1GLHA 2ZJCA 3ACLA 1O4YA 2OUJA 4QKDA 4A6SA 2YBKA 5F2SA 3VUOA 4K6BA 2ZEYA 2P34A 4HSJA 1QEXA 2QDNA 5A3MA 1LEMA 1GR3A 4QQPA 5F3IA 4W6YA 4EWDA 1C3HA 2WLQA 4JGZB 4X8PA 5C8CA 5F5AA 1QJEA 1QJY2 1POQA 2D6MA 1NCQB 2WS92 3ZOIA 4AEKA 4OHZA 4L99A 2HWD1 5FZHA 4EYUA 5GLTA 2VVEA 4QGMA 4FPHA 4BXFA 1TZOA 4TXWA 5BNPA 4OVEA 2XJVA 2ZGPA 2P3YA 1DYOA 2JENA 3C7OA 4QHBA 2YUEA 3I59B 3JBG1 4N53B 5HCHA 4CDUC 3MIDA 1RUG3 1ODMA 4XUQA 5CA6A 1A34A 2XVKA 2B7YA 4AK3A 4Q0SA 1YO8A 2RM22 1AR63 1UY3A 4OHXA 4R8HA 4KI5M 1OT5A 4I02A 2QZ2A 2JG8B 3ABZA 5ABJB 3AKRA 3VKFC 1ENXA 5HV4A 4XUNA 2IC1A 3WQ1A 3LDRA 1TNFA 1VP6A 5B4XA 3U07A 3N9QA 1TEIA 4Y4YA 5FQ0B 5JDBA 3K3NA 5C5TA 4YVSC 2XR4A 2XOMA 4OZXA 4Y1YA 1CAUB 3HR9A 3ZFFA 4Q1PA 4IV1A 3I2HA 1IOAA 4CDWA 1BKZA 3R05A 3IT8A 2J42A 3WCSA 4BDVB 1PIV1 2R1BA 4XUOA 4QPIC 5EYYA 4YVWB 4B7KA 2VNRA 3ALQA 3CBNA 1UIKA 1SZBA 1WW5A 3AM2A 3H50A 2A3WA 4GWNA 1RHI1 4AXOA 3B00A 3VD7A 4RGGA 2Q1FA 2VAUA 4LITA 1ZA4A 3K3OA 1ZZ8A 4PBPA 3GDBA 3MDPA 4JX0A 4W6WA 3TN92 1FX5A 2P3IA 4H2AA 1UCXA 3NNLA 4I0AA 2ZGRA 4R9CA 5K9YA 4G3YC 1R093 2OS2A 5BNQA 1WCKA 1UY2A 1LHOA 1JOPA 1AR92 1S0CA 2LALA 2WNEA 2ZA9A 5D1IA 2WWUA 2YPJA 1GSLA 4Q4Y1 1DZQA 1QH6A 3WW3A 3IZOA 2C24A 2RDSA 4NHYA 4IGPA 1XRUA 5FMOL 2VTXJ 3ZYIB 1CESA 1GQHA 4URAA 1JYNA 1OQDA 3MF9A 1WZXA 2VOKA 1UNBA 2UWBA 3KVAA 4P9JA 4XIKA 1YNAA 1JYCA 3LF7A 4UFLA 1WBFA 1DGWX 5E88A 1GFF2 2XHKA 1Y9QA 3B3QE 4JKKA 2BZDA 3RJRA 5KHJA 2E32A 3EHKA 3ZYPA 3IM0A 2DVFA 2EICA 3MFCA 3UT0A 1WGPA 3UNPA 3DGTA 4MO3M 1MS8A 1CD3G 4INDA 4MGIE 5FAXA 2A70A 1H1MA 1MS5A 1RUC1 1SLTA 3JBG2 4HETA 1WMEA 2Y0OA 4FPGA 2JD9A 4N43C 1FAYA 1HXS1 1QKQA 3AXDA 1RITA 4DXZA 1H30A 1RUD3 3M3QA 2JIJA 3M7AA 2VZUA 4TSVA 2WT1A 2JG9A 3GCXA 4YFWA 4ATEA 1C8M1 5E8AA 4JCKA 1W6MB 3T2PA 1JYVA 4YW5A 5L19A 5EFUA 4LNVA 5FZEA 4IEYA 5FDBA 3IPVA 1UY4A 2UURA 3CJIC 1WCUA 2A6ZA 4IEVA 1PIV2 1UWWA 1POV3 5EYXA 2YMZA 5FO8B 5KHGA 1CGPA 2ZX0A 1PM4A 1SPPA 5FWEA 5E1RA 4XCAA 3OYWA 3Q8EA 4LT5A 4CP1A 5LZ6A 1NCRC 1TME1 1X8EA 4CU8A 5A6YA 1B09A 2YZ4A 2YC4A 2XVGA 3FLTA 1RHI2 4R9BA 2GZWA 4XUPA 3PMSA 4QX7A 1QXPA 4D8MA 3NKGA 1VBB1 2YGMA 3WSOA 1Q8VA 4HT1T 4O61A 3QH7A 4IW3A 4K8RB 4DY3A 5EWSA 5C8CB 3K77A 2K0GA 4AFDA 2VR4A 2VVDA 1AR82 2Z79A 4UF0A 2QJVA 4YSFA 4JQRA 1OFSA 4QPGA 3T08A 4Q4Y2 2J1TA 3VHOA 5BNPB 5JXIA 1RYYA 2B9VA 2BBAA 2ZMNA 3J9SA 1UIJA 3RG0A 4WVMA 5FY7A 3CZJA 5C3OA 1A6CA 3W58A 3PUIA 3RWKX 4LBMA 3SITA 4IE7A 5I0UA 1A8DA 3WEZA 4BH9A 2DTWA 4NWVA 5GLWA 2JDZA 3I3MA 5DAWA 3N9NA 2ZZJA 4NHKA 1XNBA 4HK8A 2Z69A 4SLIA 4XUTA 3SCGA 4QT6A 2SBAA 1J1TA 3ZYJB 1OUXA 1PZ8A 3IAPA 1RMU3 1Y43B 3BYWA 2P3KA 1DQ2A 5HCAA 4XF9A 2QQOA 4QXHA 2MEV3 2DUOA 2WQ4A 4IV1B 4CDWB 5JPMB 3MIEA 4PIZA 4Q29A 4XFIA 2FCUA 3KT7A 5F6LB 1GNYA 4W4ZA 1H2NA 3MIHA 3MYXA 3O1RA 3IB3A 1URXA 5FBJA 1HXS2 4CCNA 2B8MA 2HLEA 1BYHA 2FCVA 2ZGMA 3O14A 4A3ZA 4XF4A 3BTXA 2QCSB 1WD4A 5C6CA 3RQ0A 3AB0A 3ZSLA 2VZQA 5KXBA 4LR4A 1W9YA 4MHUA 3ZFEB 4CYDA 5DDJ1 3O1PA 2OPKA 3A4UA 1T6GC 5DUWA 5CISA 1QQP1 3V64A 2PHRA 2PAKA 2BGOA 4OQ8A 1Y3TA 4OYUA 3USUA 1OVSA 1KQRA 4HPKA 4C90A 5DZFA 3DYMA 1FI2A 2RS13 4GJZA 3NKTA 2DBNA 1SBEA 1DP0A 3PUHA 2WFF1 4XYXA 5CFDA 2O8OA 4OUEA 4Q8LA 2D6NA 2VZPA 4D6QA 4Q8KA 3BI3A 1S0DA 1TME2 3ETQA 4Q0QA 2EXJA 4CDXA 1VRH3 4H55A 2HEYF 3ZYGA 2WAOA 4MZUA 4NAOA 1SQ4A 1VBB2 2JX9A 3CKHA 4HZFA 3CNAA 3I2GA 2LUWA 1SMVA 2ET7A 4JDNA 2TEPA 1IQAA 3AZZA 3HQRA 5JXJA 5FZIA 5FPUA 3W5MA 2HEWF 1XBFA 3MI8A 5FUIA 4N7IA 1VBA3 2A6YA 3EMRA 3AMHA 4FOVA 2CY6A 3ROUA 4TYSA 3VDAA 4IE4A 3VD5A 1BMV1 4XMAA 1I5ZA 1VBC3 3VBSC 2EIGA 3ZFGC 4I3PA 4HVOA 3WNOA 5FBZA 1LOAA 2HJIA 4BISA 2BEOA 4MGYE 1LHNA 2VECA 3LOBA 3FLRA 1VBE3 2H6CA 2H6BA 5D8AC 5FYMA 3T09A 3WT3A 2PLV3 3OGSA 1NZCA 5CADA 1DQ5A 2JG9B 4EN9B 4YGCA 1VAVA 2ZKNA 1J84A 2GC2A 4JDMA 4RR3A 5FYTA 4O7XA 5FYZA 4XC9A 5EJZB 1ZZCA 2AR6A 3LEKA 3T2TA 4CSWA 4HFSA 5JSPA 1E5IA 1IS6A 1SPPB 5CB7A 1B35B 1AJKA 4IQPA 4XABA 5A7QA 4AOCA 3RS6A 1X9PA 1K5MC 3VBSA 2BNMA 3D3AA 1AYN1 1OA4A 3MEPA 3U75A 4AVBA 1R082 2J1VA 3AZVA 2D3PA 5I0DA 1MQTC 4UOJA 3GBWA 4PLMA 1QQP2 4XILA 1SLLA 2XJUA 4RS5A 3T4VA 1O5LA 3JD73 3GYDA 3SNMA 2HWB1 4UF0B 2ARAA 3A0NA 1F8VA 2OPWA 3KHBA 4QPGB 1TMF3 4B1MA 2WFF2 2C9KA 5C9AA 4P9IA 3KB5A 1W8UA 5GLVA 4C1XA 1OXCA 2Y26A 5T52A 4WVMB 3N4MA 3NWKA 1KJRA 2GMMA 1PNGA 1O5UA 2ZX3A 3PTRB 2HBUA 2D5HA 2ES3A 3Q9OA 2X05A 3HD8B 4FXGB 5CG9A 2BUKA 5JR2A 1JZ6A 1O4TA 2ZCWA 1CIYA 2GH2A 4RN5A 4EROA 3DCQA 3TWIA 1MS9A 5ANNA 3UGHA 4X8NA 3NAPB 5JZGC 1RUE1 4FFGA 3QBQA 2RR13 1DGLA 4WM7C 4XACA 2W94A 4MYEA 3WQBA 4CRQA 3BODA 3RMXA 2WO7A 3LQCA 4OMCA 3HT2A 3MHZA 1BMV2 3OY8A 3IBMA 3VBOB 1GWMA 2BWCA 1FPN2 2XMLA 5LATA 3VGIA 4E2SA 3VDBA 4YW3A 3IKWA 4BQ1A 1AL21 2BDRA 2W9XA 1NE4A 4AVVA 2EIBA 2ZEXA 3OBAA 5FYVA 2KR2A 4XE9A 4MSVA 1RUH3 5B2GB 3BIWE 4FQZA 1LOCA 1AR71 3MF6A 1GYKA 4AQSA 1R091 3SLIA 3ZYBA 1C1FA 1C57A 3H3UA 3MLJA 4CDQB 4LBQB 4HPKB 5FLIA 2JDKA 4GB33 4QQOA 1BEV3 3ZMNA 4CTEA 2CGPA 5LK5A 3RSJA 2YPDA 4NUBA 2OW4A 1RGSA 1H8TC 2UY8A 2CHHA 3UKVA 3W5NA 1W8TA 1X7NA 1AYN2 1S0GA 3SEPA 2VC9A 1S55A 3FHQA 4PQQA 3L2YA 3BKZA 3WNLA 2BVVA 1KS5A 5A7WA 1O6UA 4XAAA 3M4FA 2GC0A 2Y34A 1WLWA 3THDA 2Y33A 3VBHA 5CFCC 1EY2A 2XLGA 2HWB2 1AHSA 2ZPXA 5A33A 2C4XA 4CZSA 1ACCA 4LO4B 1NYWA 2ENRA 4H7MA 1PZ7A 2TUNA 3T1LA 5KHIA 2YYOA 5DABA 2W1SA 4LOSA 4XFAA 3KCCA 4FFIA 4Y22A 1TG7A 5L73A 4P5HA 2B45X 1H8TA 3PU3A 4Q4W3 3MBWA 1M4WA 4N9IA 4QB6A 4AEDA 5A1AA 2W1QA 5J7MA 1LOFA 1Z7S1 3WX5A 3CIHA 2D6OX 3LEMA 1OD5A 1U0AA 1VR3A 4QKBA 2XL7A 1G9AA 4ATFA 3RJ2X 1BK0A 3F95A 1HB2A 1UU4A 1RUE2 4RR3B 4WZFA 4AI8A 1W0OA 3RZHA 3NJYA 4LK6A 1T6BX 1LKNA 5AC91 1KGYA 4IEWA 2DCJA 2H0VA 5FYYA 1K3IA 5KR7A 1D4M3 3DKWA 4HN0A 4GH4A 1AL22 3KQ4B 2GSYA 2ZABA 4KL1A 4LLOA 2Q8EA 3KF5A 1V9U1 3KV6A 1I9RA 2F17A 2B5HA 3I2KA 1CIWA 2WN3A 3OBTA 1WCQA 1DGWA 4IUGA 4LBQD 2R063 3DXUA 3JB8A 3FJSA 1AR72 3WDTA 1V6KA 1R1ZA 3C7HA 4RS5B 4XHBA 1VJ2A 4FOQA 3EB7A 4QGNA 3D0JA 4CP9A 1G9FA 3ACGA 3CQOA 2BTVC 4YLZA 1YIPA 4AI3A 5ACA3 1F31A 1HRI3 1UOBA 1LAJA 2Q0AA 3H1WA 5EHDA 1YFYA 2VMGA 3THPA 5C9AB 1PVC2 2PHUA 2XJPA 4ET7A 3KV9A 3I49A 5C3SA 1I3HA 3S0MA 2D40A 4PIYA 1ASJ1 4LXLA 1GNHA 3DPRA 2VCMA 2VCCA 3FX3A 5IWFA 1YI9A 2E63A 1VLNA 2VXJA 3ZPYA 3ZXLA 1C1LA 5F1RA 3BIEA 1OKQA 4Z82A 1RMU1 4S2FA 1VAMA 2W1WA 4Y5SA 2J1EA 2B39A 4LKSA 3RMYA 4WBBA 4P9GA 2JDHA 1UOFA 1H9WA 3OY8B 4U36A 1XXNA 3H7YA 4QXBA 3C3VA 1QJX1 2D3RA 3BB6A 1COV1 1SFNA 3POGA 4Y3OA 1OLRA 4HOOA 3VZNA 3NRUA 1GOGA 2D97A 5FMDA 1Z7S2 4ZKTB 2AACA 3E6DA 3JUUA 4XTPA 5ANQA 3O12A 5K0UA 2QQJA 2G4IA 2CGOA 1BBT1 4JGZC 4Q0UA 4QMAA 5GM0A 1XNTA 2DDUA 1NCQC 1ONAA 2XBO1 2RS33 4LBOA 3MLKA 4B8EA 3ZDSA 1H6XA 5AC92 5JSOA 3SMHA 5IVJA 5H9PA 3KM5A 2OZ6A 2KXLA 3AX4A 3VLBB 4DRRA 1ALYA 3M70A 4GD4A 2UWAA 2VTFA 2W47A 2B46X 4ORFA 1VRH1 5J48A 1W8OA 2BFUL 4N53C 4RFRB 1V9U2 2HWE1 2XUEA 2VQAA 2C9AA 3VB9A 1DF0A 3MUZ1 2WABA 1S2KA 4YGBA 4NPLA 4CUAA 2JG8C 5ABJC 4N7UA 5CEHA 4WM8A 3ZKYA 3SH4A 5JOZA 4BM8A 3C2UA 4FO9A 1ULEA 3VBHB 1VBA1 3FMGA 3ETPA 2O0OA 5A33B 1HB4A 1W9WA 1NCQA 1U5XA 1REEA 4CUBA 5J36A 1VBC1 2JE9A 5FREA 3O1OA 4FAGA 2WA4A 1EAH3 5HXMA 3H3LA 1MR5A 2NM1A 4YVWC 1YQ8A 3B94A 5D21A 3D8CA 3HNBM 1ASJ2 1VBE1 4XFHA 3VDCA 5LBEA 1J3QA 2PLV1 2ADEA 4Y22B 3TEXA 1S0EA 2WJSA 3IIAA 4AR2A 4CXWA 1AX1A 4LTAA 4N53A 3I59A 2R32A 4CCLA 4AEDB 1UOJA 5FOJB 2FDKA 2NZ9A 5H9SA 3UETA 3T3YA 5FR3A 5KXDA 3WF0A 1ULPA 2VO5A 4I3GA 2ET1A 4XEZA 1YWKA 3BTAA 3M2MA 3RZZA 1KJLA 4DOUA 1UD1A 1ND3B 1OLME 3S30A 4UW4A 5JI9A 1V6NA 3FBYA 2ZGTA 3RZGA 2Y64A 1CPNA 3WD5A 4RYDA 5FWJA 1CAUA 3ZXAC 2Z42A 4OCTA 1QJX2 3K75B 1IKQA 4GH4B 1COV2 1ULDA 3WXPA 3A21A 2NP0A 3N7MA 4LORA 4YVWA 4TTGA 2WZ8A 5A3NA 4A45A 4JHTA 3M3CA 1GNZA 4A41A 1F2NA 2GP3A 4E4DX 2V5DA 1BBT2 3BU0A 5CYYA 2IZWA 4KQ7A 5FZ7A 2ARBA 5E6HA 4MX3A 1IHMA 2XBO2 5DN2A 2JIGA 4O65A 4COYA 4R9AA 2J22A 3K4DA 4FPKA 4I0BA 4MH0E 3ZM8A 1FATA 3LSDA 5KXEA 2CWSA 4M00A 4ISQA 2WQ8A 4GXLA 2R043 1ZREA 1VRH2 1A3KA 1YJKA 3S57A 4NPRA 1F35A 2HWE2 4Q4V3 2QQNA 3LIGA 3HEIA 4OI0A 1XJAA 2A6WA 3AMPA 4OUMA 2ZX2A 1X82A 3DPRB 1UYYA 2QQVA 5HXVA 4K7JA 1F15A 5FY0A 4IV3A 2VMDA 3R4DB 5C4WA 3LZZA 2NQYA 4JRLA 2R0FA 1N1VA 1R64A 3DYPA 3OGGA 3VL8A 1K42A 2RR11 1VBA2 1IPSA 3GCWA 4GWJA 4CP2A 4E4ZA 4QQ2A 4L92A 2D93A 2D6LX 2GN3A 1W0PA 4K1ZA 3VBFB 1VBC2 5A3PA 2FDJA 2ZHKA 1GP6A 3FZ3A 2Y0IA 5BNOA 1GZCA 1YLLA 3RZMA 3H8OA 4BQWA 1XPWA 3KV5A 2ERFA 4ASKA 5DUVA 3GZTB 2N7GA 5IW0A 3ZSJA 3B93A 4Q4X3 2VXRA 3NV4A 2W08A 2XQXA 4EE2A 5K0UB 2RJ2A 1NE6A 5C8CC 1W0NA 2PHWA 2HWC3 4LO6B 1ZZBA 1UKRA 5FZ0A 4QKFA 1BEV1 4FP2A 1L7LA 2B9UA 3OD4A 1NA1A 1LOBA 2AZ5A 3P5BA 4ZXEA 5LA0A 5BNPC 4Y20A 4YW7A 1WCSA 1CZSA 5DMYA 4D6RA 5DAPA 1WW4A 2LW8A 3J4UH 2ZAAA 4V1PA 3BUCA 2E6VA 4IL7A 2GC3A 5T55A 3TEYA 2EAAA 2Q8CA 3O1TA 5IK8A 1EUTA 4LLFA 4AE2A 5CKQA 2R073 1UXZA 1LHWA 3DF0A 4WM8B 2E26A 2KD7A 2ZZQA 3P1IA 5LCWL 3BPZA 4FOWA 2PAEA 2F4LA 3O1UA 3VZOA 1XYNA 2GNTA 3PU8A 3ZFFC 1FMD3 5FZCA 4BK4A 2XKPA 3JQWA 4IV1C 4CDWC 3KCXA 3UL2A 5T5PA 4URTA 3OF1A 5LW9A 1VAKA 5FYIA 4D6SA 4IGQA 4Q4W1 4HXCA 2H0BA 2X10A 5IUQA 5IK5A 2WA3A 3H8RA 2Q1ZB 3KT1A 1IS5A 2R30A 1OA3A 3WNMA 2V4VA 2DU0A 3M3IA 4LE4A 1E5RA 4JQTA 3ZFEC 5IAVA 4XF1A 4AEJA 1EV11 3R0RA 5EV7A 3IDAA 1F4AA 3UGGA 1MEC1 2RJKA 4BB3A 2A5ZA 3POSA 3I7DA 4LJHA 4DRVA 2BGPA 3J8F3 1QJU3 1C28A 4LHNA 1D4M1 5ERLA 1N3OA 4IEUA 4EZ4A 3A23A 4PCRA 4O9EA 1IS4A 2QQKA 3LEIA 1WLDA 3S6PA 3ZR6A 2ZHMA 4J25A 2YC0A 1LOGA 4R52A 5E89A 4ITCA 1AYM3 1QWRA 1PX3A 1IQDC 3JB4C 3VBRB 2B4KA 2C0ZA 5JUVA 3I3QA 1UX6A 4K1YA 2JWPA 2PFWA 2VJXA 4NVPA 1RJ7A 4HN1A 5L9BA 5A6QA 4QWNA 4AYUA 3J7LA 1GP4A 5K4LA 3ZFEA 1ULCA 2XLAA 4DQAA 1XQNA 2R7EB 2V72A 1NXD1 4FCAA 1BEV2 2WFPA 3NJXA 3OEAA 4K21A 4X6RB 4AQ2A 4CPBA 4XVHA 3MW4A 3O0WA 5FJKA 3GXUA 4JGYB 4LOTA 4E8CA 4DEVA 4AFBA 3TNPB 4FXKB 2DUQA 5F5IA 3C7GA 4JTNA 2E7TA 2CDPA 2CL2A 4XOGA 4ZU4A 5FKCA 3WF3A 5FZFA 4Q0PA 1F5FA 5FP8A 4XETA 1GKBA 1YEWA 4XJUA 2XUMA 4YM1A 3VZKA 4IV3B 2Q8OA 5C4WB 4MUVA 1Y7BA 3ON7A 1VBD1 2JG9C 2DFCA 4QDRA 2XHNA 3DV8A 4NIGA 2QDRA 5A7OA 5F9TA 1PO21 2VVFA 3RWNA 1X33A 3BOPA 2WIIB 2DURA 2VQUA 2HWD2 1GMMA 4WVWA 5FY9A 3WW1A 2BBVA 1JMUB 5C7GA 4MXVA 3PVOA 1HKDA 1LGBA 5BNOB 1JUIA 3NNGA 2MPFA 5LA9A 4YM3A 2JE7A 3C8XA 4YZ2A 2FDHA 3AP9A 3ILFA 2A7AA 5FMCA 4DUWA 1JHJA 3OCPA 5DG2A 4YYOA 1R1A3 2J1SA 4ZHNA 4B1LA 4DUXA 4YG3A 1GZTA 3CO2A 1EV12 2NYYA 1I5PA 1YFXA 5FFOC 5FPLA 2RS31 3LGRA 1MEC2 3VHNA 4P5YA 4QAWA 5FTTC 3V0BB 1JU4A 2R0HA 3KZ4C 4IETA 3ME2A 4PT6A 5FZDA 1D4M2 1X36A 1CWPA 1IZ3A 4QPGC 4GKYA 1NA1B 1P8JA 2WNVA 4DO0A 1QXJA 3ZIXA 1BCXA 4Y20B 5IFTA 4ZS2A 5EXOA 3H7JA 3HBKA 5APAA 4TLFA 1G6NA 4F83A 3H3ZA 2ATFA 4W50A 3AK0A 2VGDA 2E53A 4KG0A 3M8LA 1B35A 2NLRA 2WWSA 1UO9A 5I0SA 3LPGA 4EN8B 3MV01 4NROA 3M3EA 1O3SA 3D5OA 4XDPA 2XJQA 5LY1A 4NHXA 4MV2A 4A7ZA 1RUF1 3LA3A 1UZZA 2JDPA 4AVSA 3NAPC 3WLUA 1QNWA 4S2DA 2W91A 2FBEA 2GNDA 2CTVA 1POV0 1ZM1A 1A78A 1Y4WA 2EA7A 1US2A 4PBOA 1ZBE3 4IEQA 3VBOC 3FE5A 4ONUA 4Y1UA 5G04L 1SG3A 3ZXDA 5FYHA 3Q8CA 4A6OA 4FFFA 1RTVA 3ZX7A 3JQXA 3UV9A 2WT2A 4IEXA 4TN7A 5L7OB 4IDZA 4F7ZA 4CP0A 2GH8A 1VBD2 3PMEA 2BWAA 2W2IA 4Z2WA 5LEKA 4UWDA 4IERA 1PO22 3PUAA 3TOJA 2ZEZA 4QU1A 2QQPA 3T30A 5A32A 2NMOA 4A42A 4CDQC 5JOWA 3KCYA 4KBZA 2VOTA 1Q3EA 3NAPA 1MZEA 2ORXA 4Q2FA 5LBCA 5ISLA 2W1UA 5CFDC 4AAXA 4XBQA 1VB4A 3B9IA 3VBOA 5GKAC 1RUC2 4CDXC 4EN7B 1YQ5A 2ZKLA 2PN5A 4JTOA 4RQPB 5A6XA 5LY2A 3J7NA 3N9MA 3ZXEA 5FYCA 3PIGA 1HRV1 2O8QA 3OPTA 1QHDA 2DTYA 2HWF3 2RS53 2G19A 4MGTA 1GOHA 2C6SA 1N3QA 1C8M2 1G9CA 2XJRA 3BCWA 4LUKA 4AI9A 1N47A 1W6QB 3FBMA 4NN0A 3DUIA 1LGCA 2R041 1JHNA 4CDQA 1K12A 2AUYA 2JECA 4LBQA 4CU9A 3RZLA 1RVF3 5T50A 1GU3A 4K9SA 5JI7A 2DYCA 1VB2A 4Z1VA 5FP3A 4XBLA 1XE0A 1NY71 4AI0A 3OUJA 1PMHX 4TLGA 2WINB 1DQ6A 1OHFA 2WZR1 5FIXA 1DU3D 1C5IA 1CONA 1AF9A 4A7KA 4OLLA 5A1FA 1RUF2 2WO3A 5FPBA 4N90A 1BXHA 3C7EA 3O1MA 4RR3C 5HBAA 4AL9A 3U0ZA 3POFA 2A1XA 3RVHA 2PMWB 5JWPA 3KQRA 4A4AA 3VKLA 2YROA 5JMCA 1V70A 3TRSB 4I01A 1ST8A 4UBGA 2WDBA 2P1BA 1KITA 5FZOA 3DKQA 5FPXA 4U2AA 3PVNA 2ARCA 2W68A 1SLAA 4M3CE 3VDDA 2ZMLA 1OD3A 3OPWA 1LB2A 2IXCA 1UX7A 4QB2A 1JUHA 4DEQA 1GWKA 5IFPA 2HWC1 2ETEA 3KWVA 2DCZA 1NT0A 1DQ1A 2DBIA 2EALA 2VUDA 1ZYBA 2AEZA 3MIFA 4IEZA 4RS5C 5F39A 3U1XA 2WZPP 1Z0HA 3SC7X 1ZBA3 5EJ1B 5FXWA 3FHIB 4BU2A 2R6QA 1S0FA 2BRTA 5DXDA 1RINA 3BPSA 2OQ6A 2WNVB 1XE7A 2RE9A 4Y24A 3VZLA 1Q8OA 5FZ9A 5C9AC 4YZ3A 5FYUA 5GZGA 3IIIA 1OI6A 5EP9A 1FOD1 4YRDA 3PVBB 5FLHA 4WZCA 3ZN6B 1OLMA 1UYPA 2IXLA 3K48A 2DVBA 5JIUA 4CPBD 4P08A 3HPNA 1L7RA 3HN3A 3H0OA 1HRV2 3ZLIA 2WO1A 4QU2A 3T1MA 3MPPG 2Y6KA 3MIBA 3Q8FA 1W8WA 4P02B 3V0AA 4TZDA 4UFHA 5DDJ2 2X5IB 4D7YA 3GZEA 1MS1A 1W8FA 2R042 2X53S 3NV1A 1IS3A 3LKJA 4GMP3 3WCRA 1G8WA 1OUSA 3PIJA 4DIQA 1UZVA 5E16A 2QQUA 2DU1A 4X6QB 1V6LA 4QB1A 1RUG1 4OI4A 1SDDB 5DQ0A 1KXGA 1W05A 2W87A 2WZR2 1AR61 4DUVA 2VUCA 1N1SA 1RUJ3 1H4HA 3I3EA 4OHWA 4BE3A 5L36A 5G05L 3J8F1 5L9RA 2ZTNA 3H42B 2VM9A 4A2UA 4MGZE 5I91A 4DXRA 5T5LA 5A32B 5A7SA 5HPOA 3TAYA 1US3A 3N7LA 4BK5A 3D82A 1HV1A 3PDQA 5J3UA 4XW3A 1RUNA 1AYM1 4D94A 1D0GA 4HKOA 3TB0A 3NQHA 4PIXA 5FXZA 1QJY3 1X8MA 4O9GA 3SH3A 3HIFA 1SBFA 2VU9A 2WS93 3AKQA 4WV8A 3T0AA 1O91A 3HQXA 3OB8A 4IE5A 4RSUA 1W2NA 3Q8AA 1ENRA 2RHPA 2HWC2 4PI2A 1ZZ9A 2ARXA 4IESA 5F8PA 2VULA 4XTMA 2XVLA 5EIYB 3R4SA 1H1AA 1HIXA 5EJ3A 1DLCA 1PK6B 5KWRA 3VBHC 3WP3A 4FPFA 3AL5A 3U37A 5DUUA 1W9TA 4CUCA 1JBCA 1W6PA 1HJGA 3OPZA 1BVP1 3AYAA 1GZWA 1ND2A 2GP5A 4LO5B 2WSVA 1V6OA 4W8JA 1FOD2 1G9BA 3E6CC 4GWIA 5FZ8A 2KA3A 5GZDA 1SLCA 5C71A 1CAVA 1PGW1 3NVCA 4WVZA 4AQ6A 2WL1A 5CKNA 2HKXA 5H9RA 4AEDC 1LOFC 4CCMA 3I3BA 4UT5A 2WUHA 3E6BA 2D44A 3LE0A 3O1VA 1AZDA 1GZ9A 1PMJX 3CLPA 4PF1A 3ZXKA 1XU1A 2D98A 1ND3C 2XB6C 3AVRA 3W20A 3E97A 2C5DA 5FLJA 1V6IA 1MZFA 1JZ8A 2QVSB 1D7PM 1HQWA 4LO7A 3KT4A 3MGUA 4FP3A 2K2SA 4GH4C 4H3WA 1H1IA 4HONA 5I8TA 2DVAA 5FZOB 3N3HA 3NNMA 4Y33A 1R1A1 3PUQA 3TN93 1RUG2 4AGVA 5AFBA 1MACA 2IXKA 1O8SA 4H7LA 1F5JA 3AFGA 5LWBA 2GNBA 4G4FA 1AR62 1DYKA 1XE8A 4XHXA 4QX1A 3VDDB 1RUD1 4ARYA 1AR93 4XQDA 4YG0A 3WNPA 4YZ1A 3INAA 2VQ0A 4QHOA 3ZSEA 2ID4A 4CXXA 2UYBA 2E51A 5J37A 5IVYA 4B4PA 2AEYA 4GZ9A 4QX3A 4C91A 4XFGA 3ZPOA 4Z92B 3KV4A 3H8XA 2A3XA 1JOBA 2CYFA 4JC1A 1ND3A 5T3NA 2A6XA 4ZU7A 3VKOA 4RFT0 2EIEA 1POV1 2IXHA 4BQ5A 3N9LA 1WMDA 1YFUA 1YQ2A 1QJZA 4PI0A 4WVVA 4EQVA 4QDSA 1LJ7A 3NJVA 3ST7A 4AHXA 1RXGA 5IK4A 1IG0A 3VBUA 3E1F1 3DPRC 3VD3A 4BHPA 1UOGA 3MW3A 3NNFA 3CL1A 3N7JA 1MPXA 3HMYA 4XDOA 3WINE 4DPNA 2DFBA 3A7QA 3WDVA 4B4QA 3V0AB 4AQTA 1JTZX 3JBG3 3ZXFA 3I2DA 1VALA 2I74A 1UW8A 3IDCB 2PYTA 4CEYA 3VBFC 3AMMA 1R092 1ZBE1 3OGRA 4YARA 2GNMA 1DGRN 2ZX1A 3POEA 2ILMA 4YW2A 2JDYA 4LULA 1N1YA 5CU1A 4DXTA 1HV0A 3EJKA 4DFSA 4S2HA 4EWAA 1V0AA 1XOYA 2VZTA 3POIA 4LHKA 3BGAA 3VHRA 2OZJA 1PGW2 3HT1A 3AYDA 1VMJA 1HDKA 3D6EA 2WQZC 3RNSA 1HB3A 1H2LA 4D7SA 2XWJB 2R1DA 2VOWA 1CPMA 1MZ5A 2YXSA 3BU7A 3ZFGB 4KWLA 1N1TA 1ZRRA 2G9GA 3U11A 1TNRA 5C3RA 4KU7A 5K0UC 5DZGA 4EWEA 2HYKA 4UFMA 2BW8A 1DG6A 2JB4A 4Q27A 3W21A 5KHKA 2CWMA 5FCCA 3USSA 2VW2A 2R49A 3SHRA 1RHI3 3WUCA 3ZSKA 1CR7A 1QDCA 1MVQA 1D2SA 1W90A 2MEV1 3VBFA 1U12A 4KWKA 5FXVA 4YFZA 2Z2SB 3RZJA 5IVFA 3L9JT 3QACA 4ISRA 1W2OA 1AR83 2TBVA 2WYFA 5BYNA 1RUD2 4FPOB 2SLIA 1NQJA 4XJZA 4YZ5A 2HWF1 1FV3A 1V6MA 4QPWA 4Q4Y3 3VHPA 2Y6LA 2JDMA 3RYRA 4GKXA 4WM8C 5C70A 2Z4FA 1ENSA 1SLBA 1RJ8A 4Z07A 1DZTA 2JD4A 1IPJA 3AXEA 1YCIA 2PTMA 1W6PB 1CJPA 2VG9A 2VW0A 2VMFA 2AREA 3PJQA 3G7DA 1CAXB 1MS4A 1ULGA 2RS11 1FXZA 2HH9A 3LOIA 1GZWB 3LWCA 3M1HA 4LMFA 5A7NA 4Z8BA 1ND2B 3AMQA 3WQ0A 2JKXA 1OSGA 1XSRA 5LBBA 4CU7A 2BPA2 4FOYA 4MVTA 5IT6A 1CAVB 4L8QA 4YM2A 2QZ3A 4ASLA 4CCJA 5JVVA 3UYJA 2BNNA 1LOEA 3GNEA 1G9DA 2UY9A 2P6HA 1AXYA 2W5FA 5JIAA 5DPNA 3ZXGA 3ZYHA 5DG1A 4XAEA 3AZYA 4NE9A 3N7KA 4RD7A 2BOJA 4W65A 1HXS3 3UK9A 4MLOA 1ZBE2 1CZTA 3MLLA 4V2VA 1XNDA 3U4XA 4ZXKA 5GALA 3VZJA 1DDLA 3O0VA 3DECA 2J1AA 3ATGA 1W39A 3GHNA 4RHV3 1AX0A 2P3JA 1CX4A 2WNUA 2AENA 1AXZA 1YIFA 3LPFA 2PHLA 3RI8A 2PHDA 2ZX4A 2XPJA 3VBRC 1PGL1 1JS9A 1MS0A 2DCKA 2LROA 2WC2A 1LNSA 3DXTA 3PLQA 3C7FA 1BVVA 3J26N 5FZAA 1ZBA1 2IFWA 2EF6A 4N8MA 1VE0A 4JKMA 3B02A 1RMU2 2VZVA 2ZGKA 4K3UA 5CNAA 5C8WA 4AGGA 3MO4A 5IVBA 3HQUA 3JXSA 2MEV2 4JGYC 1M06G 2QQWA 3AJYA 2GN7A 1YHFA 3R4UA 4P9XA 4META 4QGLA 3VKNA 1QOSA 3PURA 1UZWA 3FWEA 4GIQA 3VBUB 4LQRA 3NV2A 2HWF2 3GM8A 5TSWA 2K46A 3T4HB 4IV3C 5C4WC 3VBRA 4AVTA 5GZEA 1VPHA 3LIHA 5KHHA 5CBLA 2VZSA 5HCBA 2ZGLA 2CSGA 2FZ1A 1J59A 1V00A 1UU6A 2JKBA 4CUGA 4CEYB 4I2OA 3JD71 2OQ7A 2RS12 5BPXA 4UW3A 5F2WA 1H6YA 2XLFA 3NL1A 3SCHA 1UMZA 1TMF1 2EXKA 3GJAA 2AGSA 2BV4A 2E33A 3WDWA 1GOFA 5BNOC 4NIDA 2LRPA 4JGYA 3WG4A 2ZGUA 4CCKA 1UZYA 1W99A 2BNOA 2BU9A 1UU5A 1AX2A 4HKWA 1OKOA 1O3QA 4MOAA 1RUJ1 3AJZA 3GALA 4KWUA 4KU8A 4L2NA 3KMHA 2CAVA 4QXKA 2QQMA 5BNNB 3I54A 5IAXA 1W2AX 4QHZA 4GQ7A 4PF5A 2BVBA 4E2GA 2BYVE 4B7EA 4N9HA 2BQPA 3AKPA 4CA9A 2JE8A 2V4AA 3M3OA 1OQ1A 1QF3A 4FPEA 1NA1C 4HSLA 1GBGA 2OIIA 1R083 4ZONA 4FBFA 3HWJA 3KGZA 2WS91 1QQP3 1AUYA 1GQPA 5CIRA 1ZZ6A 1PGL2 3VL9A 2CNAA 2LM3A 2VMIA 1VBE2 1TVGA 3O7OA 3P3NA 1EYBA 3WF1A 2PLV2 2XJTA 2DF7A 1QJFA 2YBPA 5KBFA 4YPJA 1RUH1 3FLPA 4LE3A 2WFF3 1ZRCA 1ZBA2 3B69A 2W0XA 1W9SA 2QKDA 3ES1A 5C33A 5F37A 1NG0A 3I2OA 4XIOA 3POYA 5GLZA 3V0BA 1NAEA 2EAKA 2NMNA 1L7QA 4H14A 4M3CA 4QPYA 1PO13 4Y5TA 1D2QA 2JEMA 5JPNB 3NSTA 4IEPA 4P9YA 4GB31 3EYPA 3MW2A 4PLOA 3CF6E 3FUOA 3P3PA 4AEMA 5I8SA 1ODNA 1QY4A 3WNXA 4AHYA 4AI2A 4AFAA 3I8TA 1ENQA 4PLNA 4XFCA 4BMEA 4XJWA 2CGNA 2QQLA 5JMOA 4QM9A 5L7OC 3AVSA 2D7FA 1OF4A 1WLTA 1U5YA 1SLIA 2DUPA 2BFUS 2I07B 1FPN3 2GU9A 1JXNA 2XJSA 1WCDJ 2PAMA 5FP7A 4AG4A 5FZGA 3JCIA 1LODA 3K46A 4BLIA 1JODA 4XXAA 5J96B 3JD72 1J3PA 4QX8A 4BJ0A 3SCFA 4EN0A 3GHMA 1OF3A 4BPZA 1HLCA 1TMF2 1YYNA 1RIRA 3I2JA 3TN91 1YXWA 2PXJA 1NUKA 1SCSA 2RMU3 3AL6A 4DZGA 4UW5A 4CU6A 2WNUB 4NRMA 5DAVA 1CJDA 1JN2P 1IGOA 4PDWA 1LENA 2WSUA 4RQPC 2EXHA 4CVUA 2ZEWA 4LA2A 3OBZA 1H9PA 4HLTA 4XBNA 3OD0A 2RDQA 1TQ5A 2QE3A 1MZ6A 5L7OA 4Z2AA 3ILNA 1UYXA 4I0WB 3MPBA 3S7IA 1UYZA 5FZ1A 4CEWB 1F4HA 5CG8A 2RR12 1QOTA 2IWGB 4LBLA 2VOXA 1AYN3 1FYUA 4UW6A 4Y1VA 3NJZA 3WDYA 5JR7B 2X29A 4L9BA 3W9AA 3O1SA 1J58A 3PUSA 3LEGA 3VV1A 1S4CA 1UY1A 1O4ZA 1NLQA 2W95A 1J1LA 3VD9A 5DAQA 1LCLA 2HWB3 4PJYA 1CVNA 4MHRA 1W8HA 3FFZA 2E9QA 1RUH2 5JSRA 3T0DA 1SFPA 3JU9A 1PM7A 2R061 3OGJA 1S2BA 3NO8A 4RQPA 4XJ9A 5F3GA 5A3LA 1HX6A 2GMEA 2OA2A 5IVEA 3NV3A 1XNAA 3OG2A 4NJ4A 1OC1A 4NRPA 2VY0A 3J7HA 4XFFA 2Y6JA 3IMNA 1PHMA 3MUY1 4JV4A 2WBKA 3ORJA 4W6XA 4GB32 5ACA1 1HRI1 1W6QA 3ES4A 3LD8A 5FK7A 4MG2A 1JW6A 3P6BA 4HG6B 3TBDA 2VH9A 1NKGA 4D3WA 1RUE3 2VOVA 4BQ3A 3QH6A 3ZDVA 1XSQA 3PL0A 3WY6A 4MGKE 4MGQA 3WW2A 3ZYFA 3AP5A 1WBLA 4ASMB 1BZWA 2YBSA 4LO8A 2WNOA 4XPVA 1CAWA 5FZ4A 1AL23 2VZ1A 1L3JA 4CDUA 4EV0A 4Y1ZA 2OKXA 4FPCA 3UESA 2J1RA 2WNVC 2D6KA 1C4RA 1OLQA 2IXJA 1AR73 5LRSA 2BP6A 3E5QA 4XJ8A 2CV6A 1AR81 1S0IA 4LEJA 5FZLA 5A80A 3BTZA 1JH5A 3KSCA 1VMHA 3FN9A 3X29B 3K2OA 1W06A 1B35C 1DFQA 4OHVA 2VCBA 3PJYA 4MGSA 4NR1A 4Q4W2 4YVSA 3ASIA 3WG2A 1K45A 4GULA 4BQXA 1KRIA 1IKPA 1BLZA 1HN1A 1OMIA 1PVC3 4QPIA 4XMIA 1KDKA 1S0JA 2X5IC 4BYYA 5FZ3A 3QLQA 1HQNA 5FRAA 2IVJA 4M3CB 3ZO0B 5FP4A 1IPKA 3EQEA 2HBTA 5SV8A 5GZCA 2Y6FA 3NW4A 4F8AA 1RUI3 1I1EA 5BXXA 2RV9A 4CXYA 4Y5Z0 3U78A 5F3CA 2FHRA 3WVJA 3EXUA 4UXAA 4HVRA 5A3OA 1HN0A 4COWA 2XWBB 5A6ZA 3ZN6A 1W2UA 2MHFA 2R062 2A3YA 3IDBB 2Q4SA 3SXWA 5HV0A 2JXAA 1OOPB 5AFEA 3PVEA 1OVPA 1DGRA 2Z5WA 3VKMA 3T2QA 4CCEA 2X5IA 4RHV1 1Z7S3 5ACA2 1HRI2 4FSJA 4RGAA 3HNYM 4E9KA 1EAH1 5A3WA 3ZN5A 1UN1A 3DYOA 3AMNA 2GAUA 4BQYA 2DVDA 4UBHA 1YRZA 4HL0A 4KMQA 2FMDA 4GAZA 4PDWB 5AC93 3UJOA 2D43A 2E31A 5J1XA 4HVQA 1UKGA 2BERA 3ENRA 2ZMKA 2YG0A 2CAUA 4ZS3A 4NIAA 1PK6C 4F3JA 5GZFA 1RUOA 5IYYA 1V9U3 1OH4A 2KM2A 4N43A 1LEDA 1QH7A 3U4SA 2ZACA 1JZ3A 2UU8A 1QGLA 3T2OA 1IG3A 4MXWA 4C0HA 4K8FA 1LRHA 1MS3A 2UYAA 4A7YA 3ZR5A 1WW6A 2V5YA 1SCRA 4QX5A 1JYTA 2YHJA 4HK9A 2ZGQA 4B29A 2YU2A 4D0QA 1PX4A 3CJIA 4FTBA 3T0BA 5LA1A 4L0PA 4YGEA 1WMFA 3K4ZA 4NMIA 3RYPA 4LBNA 1ZVFA 1SBDA 3LFMA 4FFHA 3WZ1A 2C26A 3L2HA 1O7FA 2RS32 1ASJ3 2XONA 1NCRA 4QM8A 4ZZ5A 4FVVA 5AVAA 1UPSA 1PK6A 4R4ZA 3WW4A 1LR5A 2VNVA 4YZ4A 1QU0A 2VPVA 3GJBA 2WYSA 1WKYA 4YWAA 4FPYA 1DIWA 4EZHA 1XC6A 3ZFFB 2P37A 5SV5A 4M01A 4Q4V1 4UFJA 2BJSA 5FY8A 2FD8A 4A44A 2DWRA 1ZZ7A 3VDDC 4PHZA 1W8ZA 5T5OA 1EUUA 3B7MA 5FY4A 3DN7A 5FJHA 3W59A 4FTSA 1QJX3 1ZNPA 2OXBA 1COV3 1CAWB 1UQXA 1UZ0A 4CDUB 4UFKA 3FC0A 5FMOS 3UGFA 1O3TA 1GANA 1RC6A 1R081 4RHV2 5F5CA 5A3TA 3AZWA 1YQCA 3G6JB 1EAH2 2XQRA 5C3PA 1BBT3 1W6OA 1EPWA 3RYKA 4JVAA 2XBO3 4D7TA 5K7PA 4E27A 4K20A 1QMJA 3WQ7A 3BOWA 4YVSB 2OYZA 4B3NA 1OPOA 1H8VA 5BY5A 4TWTA 1NXMA 5DUXA 5F7UA 4RGKA 4Q4X1 1HW5A 2A73B 2QTWB 2VL4A 2VMHA 4QPIB 4AI1A 3MICA 1SHWB 4DNYA 5IATA 2HWE3 1XYPA 1E5HA 2FMYA 1HQLA 1PO11 4BMBA 5A3UA 2YU1A 4GA9A 1F9KA 2I45A 5DZEA 4YW1A 1J3RA 3KS7A 5I8YA 4FQ4A 5M0TA 3EBRA 2P6CA 1W03A 1SDWA 3THTA 4NIIA 1ULFA 1I6XA 4JRAA 5HI0A 1EPZA 4NHLA 1N3PA 3LA7A 2ADDA 1LESA 4HANA 2MNGA 1FPN1 2QFEA 3WNNA 3N9OA 4DMIA 1AL0G 5EZWA 2R071 5LEJA 3PNAA 1BK1A 3MFAA 5FMBA 1A8MA 5F6KA 4CCCA 2WAAA 1S0BA 1QNYA 4NHMA 3RRDA 2QNKA 2J7MA 2W46A 1FMD1 2RMU1 1VMFA 2WWJA 1K5JA 3PTYA 4BCUA 3HAGA 5H9QA 4LBJA 1UAIA 1LGNA 1E57A 4IXLA 3BALA 4XZPA 2PELA 3B9CA 5JOYA 5FKBA 3S5QA 3IPVB 2YDEA 4Q4V2 2Y38A 2DVGA 5FP9A 1ZA7A 1Q8QA 4ZY9A 4XDQA 4M4RA 5LASA 2X8KA 2VUJA 1NY72 4IGOA 4CE8A 4Y1XA 4DB5A 1X50A 3OYWB 3CHXA 3TEZA 5FO9B 2RVAA 5C3QA 4Y26A 3ZFGA 3WV6A 1NZIA 2I2SA 3AC0A 4L11A 2VMEA 4N43B 2W39A 4QQHA 1QJU1 1O8PA 3IN9A 3ACHA 3WUDA 1SFYA 5D8AA 4GMP0 3AYCA 4AVCA 4BQ2A 3QOPA 2WLPA 4LBKA 2E7AA 4MXWB 3V56A 1FV2A 1ND2C 2ZHLA 2VZOA 1NQDA 1DQ0A 3B01A 4AGRA 1C5HA 1CQ9A 4B4RA 4EJRA 1X9TA 3AP7A 3AZXA 4KNCA 4OI2A 4JAAA 4LKDA 1LULA 1W6NA 1HB1A 2VD7A 4R4XA 4P9WA 3CJIB 2L9LA 4Q4X2 3LCPA 4NWWA 4JDOA 3H1YA 5BUVA 1T2XA 3LFIA 2FZ2A 1ZRDA 1ZRIA 3ZSMA 1XB9A 1PO12 1UF2C 5FYSA 1K5MA 2GC1A 3ACFA 4AW7A
chains in the Genus database with same CATH topology
1LU2A 3AKSA 3QCWA 1VIWB 2BGCA 1MQTA 1TE1B 2RM23 3FFQA 1CAXA 2ZGNA 3I4IA 2VNGA 4FTEA 4D69A 2PA7A 4IEOA 1S1AA 2EVXA 3AFKA 1DLLA 2R072 4BA6A 4BIOA 1QOOA 3TNQA 4J1XA 2JJ6A 4C0BA 3UKTA 1GICA 3OJBA 1NLRA 1FMD2 1Q8SA 2R16A 2RMU2 2ZOEB 3WHUA 2GMPA 4M0HA 2HEVF 4BLJA 3GBFA 1W6OB 4LA3A 3USUB 1Q5OA 2EXIA 2WT0A 2D3SA 5LK7B 4HKLA 4XFBA 4AFMA 1OPMA 5JZGA 4P9LA 3VBUC 4WM7A 5CFDB 3ZVXA 1PVC1 1RB8G 3ZIWA 1QDOA 4S2GA 4CDXB 5KXCA 4DS0A 1NCRB 3J8F2 1QJU2 4CEYC 4KGQA 2NN8A 3LAGA 1H4GA 4XQWA 1RUI1 5J09A 4XQ4A 3LA2A 4Q0VA 3AP4A 4G9SB 2ZGOA 1AYM2 3D0SA 4QD2A 4FAHA 5JLVA 4A3XA 5JOXA 4XJAA 3KGLA 1XYOA 3APBA 4M3CF 2HWD3 2XH6A 2UWCA 1LECA 5BNNC 4ZU5A 2ZBJA 3UJQA 1EP0A 2OVUA 2XKOA 3MIGA 4K40A 3R6SA 1YUDA 3GBGA 1OQEA 4AHWA 5KC5A 1KD7A 4DINB 1EV13 1MEC3 2Q1MA 3OTFA 4BIFA 5CFCA 3TYJA 2O1QA 4AVAA 2ZHNA 3K51A 5I0TA 1DQ4A 3S7EA 1WLCA 3IDEA 4XXPA 1FNZA 1WUVA 1G7YA 3VBSB 1PIV3 3E5XA 4YGDA 5LRRA 5FOBB 5BNNA 3B5LB 1WD3A 1H2KA 5D8AB 2ZS6B 4GALA 1D0HA 5KC6A 1Q8PA 1OFNA 2AYHA 2XGXA 3WHTA 4E4SA 4R9DA 1LU1A 1V6JA 4C1WA 2P2KA 2K9ZA 1W6NB 3H9AA 1R1A2 1GV9A 1RL3A 1G86A 1PZ9A 2VUAA 2Q5TA 4ES9A 4RA0A 1OA2A 1AVBA 2RS51 4KGGA 3ZN4A 3ZYRA 1XNKA 2GALA 4KBBA 1K5MB 2PHXA 3CJXA 5FO7B 4AWDA 4COUA 4COZA 1RUI2 4AF9A 4YW4A 5F5QA 1CN1A 1SEFA 1VBD3 2YV8A 1MQTB 4BWOA 4SBVA 4LUMA 3U10A 2WNUC 1PO23 1RVF1 3AKTA 1KS4A 3VZMA 4XF3A 4NOTA 4PQ9A 3WG1A 5AVPA 1YFWA 2DCTA 4COVA 1DZRA 3POWA 4Q1RA 1QXRA 4CEWC 3WOGA 2PHTA 5J98B 1RUC3 4KWJA 3WP4A 3D4KA 4OFGA 2C1FA 5JCTA 2QUOA 3QD6A 1MVEA 5T54A 5BV6A 4FPJA 1U5IA 1XNCA 3RPQA 1GQGA 1C8M3 3ELNA 2XL9A 5JZGB 4P14A 4WM7B 5GLUA 3WP6A 4KH9A 3MZHA 4AFCA 3H1MA 1KFUL 5GJ6A 4BOWA 5IK7A 2RJLA 3V65A 4YG6A 3HN1A 3PHMA 3CEWA 1TME3 2F6BA 4CEWA 1D4VB 1Q43A 1WW7A 3ECQA 1O3RA 4JGZA 2DV9A 1RUF3 1VBB3 1PMIA 5HCFA 5CVRA 2A6VA 1Z78A 2TNFA 2WKKA 1YJLA 2PQQA 5JAXA 3HBZA 2DCYA 2RS52 3RI9A 2JICA 1XU2A 1H8TB 1LHUA 1ZX5A 3IWZA 1FT9A 4J1WA 1H0BA 2NPIA 5FPZA 5CAZA 2W52A 2Q30A 2OUHA 4EN6B 2JG8A 4OI1A 4OULA 5ABJA 1WA4A 4FT8A 4E2QA 1JOJA 4GMP1 4QQLA 3WDXA 1RVF2 2V09A 3O0XA 1KFXL 4GWMA 5CFCB 3WDUA 4NO4A 5FQ0A 3AP6A 1YI7A 4HMZA 2F4PA 3DL3A 1APNA 3UKNA 4I30A 4XF0A 2XG3A 3N35A 1AJOA 1DHKB 2G9FA 3O5SA 1ZRFA 2P17A 1FNYA 2YY1A 4BZ4A 3LB9A 3GZUC 3SISA 2VNOA 2A71A 1HRV3 3CU7A 3EO6A 3N36A 5DDJ3 1H2MA 1QJY1 1DBNA 1PGSA 2IFRA 3ZMOA 2GDFA 2ZGSA 2YGLA 3H8UA 2V73A 2VW1A 4DY5A 4OHYA 1SACA 3WR0A 3SH5A 1OOPC 3VN4A 1PNFA 4J6GA 3ZXJA 5K8SA 3OBRA 2A75A 1LTEA 1PVXA 1UL9A 2WZR3 2D6PA 2RM21 4L97A 3KLSA 3URFA 1C8NA 4RL7A 3LSEA 2E7QA 4YM0A 4HBNA 3KD4A 4PDWC 1Q56A 4FPLA 1NOVA 3GF6A 1KDMA 5I0RA 3ILRA 5I93A 1AXKA 3WG3A 2LTNA 3FUQA 2IXIA 3WP5A 1OOPA 4M0NA 2FQPA 2AH2A 4Q26A 1DYPA 4KG8A 4YNIA 1BQPA 1U5ZA 1W6MA 4LHLA 3RDIA 3JZVA 4I09A 1REFA 3A0KA 4OUSA 3AYEA 4AHZA 1NLSA 2B42B 5T5JA 4ES8A 2D5FA 1BJQA 1REDA 1AR91 1RUJ2 2ZAHA 1LHVA 1UPIA 3GZAA 2PHFA 3E5UA 1FOD3 1GLHA 2ZJCA 3ACLA 1O4YA 2OUJA 3VUOA 4K6BA 2P34A 4HSJA 2QDNA 5A3MA 1LEMA 1GR3A 4QQPA 4W6YA 4EWDA 1C3HA 2WLQA 4JGZB 4X8PA 5C8CA 1QJY2 2D6MA 1NCQB 2WS92 4AEKA 4OHZA 4L99A 2HWD1 5GLTA 2VVEA 4QGMA 4FPHA 5BNPA 4OVEA 2XJVA 2ZGPA 2JENA 4QHBA 2YUEA 3I59B 3JBG1 4N53B 4CDUC 3MIDA 1RUG3 5CA6A 2XVKA 2B7YA 4AK3A 4Q0SA 1YO8A 2RM22 1AR63 4OHXA 4R8HA 4I02A 2QZ2A 2JG8B 5ABJB 3AKRA 3VKFC 1ENXA 2IC1A 3WQ1A 1TNFA 1VP6A 3U07A 1TEIA 4Y4YA 5FQ0B 5JDBA 4YVSC 4Y1YA 3ZFFA 4OZXA 1CAUB 3HR9A 4Q1PA 4IV1A 4CDWA 1IOAA 1BKZA 3R05A 3IT8A 3WCSA 1PIV1 2R1BA 5EYYA 4QPIC 4YVWB 4B7KA 2VNRA 3ALQA 1UIKA 1WW5A 3AM2A 3H50A 2A3WA 4GWNA 1RHI1 4AXOA 3B00A 4RGGA 1ZA4A 1ZZ8A 4PBPA 3MDPA 4W6WA 3TN92 1FX5A 2P3IA 1UCXA 4I0AA 2ZGRA 4R9CA 5K9YA 4G3YC 1R093 5BNQA 1WCKA 2LALA 1LHOA 1S0CA 1AR92 2WNEA 5D1IA 2ZA9A 4AVSA 2YPJA 1GSLA 4Q4Y1 1DZQA 1QH6A 3WW3A 1XRUA 5FMOL 3ZYIB 1CESA 1GQHA 1OQDA 3MF9A 2VOKA 2UWBA 4P9JA 4XIKA 1YNAA 1JYCA 1WBFA 1DGWX 5E88A 1GFF2 2XHKA 1Y9QA 3B3QE 3RJRA 5KHJA 3EHKA 3ZYPA 3IM0A 2DVFA 3MFCA 1WGPA 3DGTA 1MS8A 1CD3G 4INDA 4MGIE 5FAXA 2A70A 1H1MA 1MS5A 1RUC1 1SLTA 3JBG2 4HETA 1WMEA 2Y0OA 4FPGA 4N43C 1FAYA 1HXS1 1QKQA 3AXDA 1RITA 4DXZA 1H30A 1RUD3 3M3QA 3M7AA 4TSVA 2WT1A 2JG9A 4YFWA 4ATEA 1C8M1 5E8AA 4JCKA 1W6MB 4YW5A 5L19A 5EFUA 4LNVA 4IEYA 5FDBA 3IPVA 2UURA 3CJIC 2A6ZA 4IEVA 1PIV2 5FO8B 1POV3 5EYXA 2YMZA 5KHGA 1CGPA 2ZX0A 5E1RA 3OYWA 4LT5A 4CP1A 1NCRC 1TME1 1X8EA 1B09A 2YZ4A 2XVGA 3FLTA 1RHI2 4R9BA 2GZWA 3PMSA 1QXPA 3NKGA 1VBB1 2YGMA 1Q8VA 4HT1T 3QH7A 4DY3A 5C8CB 5EWSA 2K0GA 4AFDA 2VVDA 1AR82 2Z79A 4YSFA 2QJVA 4JQRA 1OFSA 4QPGA 4Q4Y2 3VHOA 5BNPB 3J9SA 2ZMNA 1UIJA 3RG0A 4WVMA 1A6CA 3W58A 3SITA 4LBMA 5I0UA 4BH9A 1A8DA 2DTWA 4NWVA 5GLWA 2JDZA 2ZZJA 4NHKA 1XNBA 4HK8A 2Z69A 4SLIA 3SCGA 4QT6A 2SBAA 1J1TA 3ZYJB 1PZ8A 1RMU3 1Y43B 2P3KA 1DQ2A 5HCAA 4XF9A 5JPMB 2MEV3 2DUOA 2WQ4A 4IV1B 4CDWB 3MIEA 4PIZA 4Q29A 4XFIA 3KT7A 5F6LB 1H2NA 3MIHA 3MYXA 1URXA 1HXS2 2B8MA 1BYHA 2ZGMA 3O14A 4XF4A 2QCSB 1WD4A 5C6CA 3RQ0A 3AB0A 3ZSLA 5KXBA 4LR4A 3ZFEB 4CYDA 5DDJ1 2OPKA 3A4UA 1T6GC 5DUWA 1QQP1 3V64A 2PHRA 2PAKA 1Y3TA 3USUA 1KQRA 4HPKA 4C90A 5DZFA 1FI2A 2RS13 3NKTA 1SBEA 2WFF1 4XYXA 5CFDA 2O8OA 4Q8LA 4Q8KA 2D6NA 1S0DA 1TME2 3ETQA 4Q0QA 2EXJA 4CDXA 1VRH3 4H55A 2HEYF 3ZYGA 4MZUA 1SQ4A 1VBB2 2JX9A 4HZFA 3CNAA 2LUWA 1SMVA 2ET7A 4JDNA 2TEPA 1IQAA 3AZZA 2HEWF 3MI8A 4N7IA 1VBA3 2A6YA 3AMHA 4FOVA 2CY6A 3ROUA 4TYSA 1BMV1 4XMAA 1I5ZA 1VBC3 3VBSC 2EIGA 3ZFGC 4I3PA 4HVOA 5FBZA 1LOAA 2HJIA 2BEOA 4MGYE 1LHNA 2VECA 3LOBA 3FLRA 1VBE3 2H6CA 2H6BA 5D8AC 3WT3A 2PLV3 1NZCA 5CADA 1DQ5A 2JG9B 4EN9B 4YGCA 1VAVA 2ZKNA 2GC2A 4JDMA 4RR3A 1ZZCA 2AR6A 3T2TA 4HFSA 5JSPA 1IS6A 5CB7A 1B35B 1AJKA 4IQPA 3RS6A 1K5MC 3VBSA 2BNMA 1AYN1 1OA4A 3MEPA 4AVBA 1R082 3AZVA 2D3PA 1MQTC 3GBWA 4PLMA 1QQP2 4XILA 1SLLA 2XJUA 4RS5A 1O5LA 3JD73 3GYDA 3SNMA 2HWB1 1F8VA 3A0NA 4QPGB 1TMF3 2WFF2 5C9AA 4P9IA 3KB5A 5GLVA 4C1XA 2Y26A 5T52A 4WVMB 3N4MA 3NWKA 1KJRA 2GMMA 1PNGA 1O5UA 2ZX3A 2D5HA 2ES3A 3Q9OA 5CG9A 3HD8B 4FXGB 2BUKA 1O4TA 2ZCWA 2GH2A 4EROA 3TWIA 1MS9A 4X8NA 3NAPB 5JZGC 1RUE1 3QBQA 2RR13 1DGLA 4WM7C 4CRQA 4MYEA 3BODA 3RMXA 1BMV2 3HT2A 3OY8A 3IBMA 3VBOB 2BWCA 3VGIA 1FPN2 4E2SA 4YW3A 3IKWA 4BQ1A 1AL21 1NE4A 4AVVA 4XE9A 4MSVA 1RUH3 5B2GB 3BIWE 4FQZA 1LOCA 1AR71 3MF6A 1GYKA 4AQSA 1R091 3SLIA 1C1FA 1C57A 3H3UA 3MLJA 4CDQB 4LBQB 4HPKB 5FLIA 4GB33 4QQOA 1BEV3 3ZMNA 4CTEA 2CGPA 5LK5A 3RSJA 2OW4A 1RGSA 1H8TC 2UY8A 3UKVA 1X7NA 1AYN2 1S0GA 1S55A 3L2YA 2BVVA 1KS5A 3M4FA 2GC0A 1WLWA 5CFCC 3VBHA 1EY2A 2XLGA 2HWB2 1AHSA 2ZPXA 5A33A 4CZSA 4LO4B 1NYWA 2ENRA 4H7MA 1PZ7A 2TUNA 3T1LA 5KHIA 2YYOA 4XFAA 3KCCA 4Y22A 5L73A 4P5HA 2B45X 1H8TA 4Q4W3 5J7MA 1M4WA 4N9IA 4AEDA 1LOFA 1Z7S1 3WX5A 2D6OX 1OD5A 1U0AA 1VR3A 2XL7A 1G9AA 4ATFA 3RJ2X 4WZFA 1UU4A 1RUE2 4RR3B 4AI8A 1W0OA 1LKNA 5AC91 4IEWA 2DCJA 2H0VA 1D4M3 3DKWA 4HN0A 4GH4A 1AL22 2GSYA 2ZABA 4KL1A 4LLOA 1V9U1 1I9RA 2B5HA 1CIWA 3OBTA 1DGWA 4LBQD 2R063 3JB8A 3FJSA 1AR72 3WDTA 1V6KA 1R1ZA 4RS5B 4XHBA 1VJ2A 4FOQA 4QGNA 3D0JA 1G9FA 2BTVC 4YLZA 1YIPA 4AI3A 5ACA3 1F31A 1HRI3 2Q0AA 3H1WA 1YFYA 2VMGA 3THPA 5C9AB 1PVC2 2PHUA 2XJPA 1I3HA 3S0MA 2D40A 4PIYA 1ASJ1 1GNHA 3DPRA 3FX3A 1YI9A 2E63A 1VLNA 3ZPYA 3ZXLA 1C1LA 5F1RA 1OKQA 4Z82A 1RMU1 4S2FA 1VAMA 2B39A 3RMYA 4WBBA 4P9GA 1H9WA 3OY8B 4U36A 1XXNA 3H7YA 3C3VA 1QJX1 2D3RA 3BB6A 1COV1 1SFNA 1OLRA 3VZNA 2D97A 1Z7S2 4ZKTB 3E6DA 3JUUA 4XTPA 3O12A 5K0UA 2G4IA 2CGOA 1BBT1 4JGZC 4Q0UA 4QMAA 5GM0A 1NCQC 1ONAA 2XBO1 2RS33 4LBOA 3MLKA 4B8EA 3ZDSA 5AC92 5JSOA 3SMHA 5H9PA 3KM5A 2OZ6A 2KXLA 3AX4A 3VLBB 4DRRA 1ALYA 3M70A 2UWAA 2B46X 4ORFA 1VRH1 5J48A 2BFUL 4N53C 1V9U2 2HWE1 2VQAA 2C9AA 1DF0A 1S2KA 4YGBA 2JG8C 5ABJC 4N7UA 4WM8A 3SH4A 5JOZA 4BM8A 3C2UA 4FO9A 1ULEA 3VBHB 1VBA1 3FMGA 2O0OA 5A33B 1NCQA 1U5XA 1REEA 5J36A 1VBC1 2JE9A 5FREA 4FAGA 2WA4A 1EAH3 1MR5A 2NM1A 4YVWC 3B94A 3D8CA 4XFHA 1ASJ2 1VBE1 1J3QA 2PLV1 4Y22B 1S0EA 2WJSA 3IIAA 1AX1A 4LTAA 4N53A 3I59A 2R32A 4AEDB 5FOJB 2NZ9A 5H9SA 5KXDA 4I3GA 4XEZA 2ET1A 1YWKA 3BTAA 3M2MA 3RZZA 1KJLA 4DOUA 1UD1A 1ND3B 3S30A 4UW4A 5JI9A 1V6NA 3FBYA 2ZGTA 1CPNA 3WD5A 1CAUA 3ZXAC 2Z42A 1QJX2 1IKQA 4GH4B 1COV2 1ULDA 3WXPA 2NP0A 3N7MA 4YVWA 3M3CA 1GNZA 1F2NA 4E4DX 1BBT2 2IZWA 4KQ7A 2ARBA 4MX3A 1IHMA 2XBO2 4COYA 4R9AA 4FPKA 4I0BA 4MH0E 1FATA 3LSDA 5KXEA 2CWSA 4M00A 4ISQA 4GXLA 2R043 1ZREA 1VRH2 1A3KA 1YJKA 4NPRA 2HWE2 4Q4V3 4OI0A 2A6WA 3AMPA 4OUMA 2ZX2A 1X82A 3DPRB 5HXVA 4K7JA 4IV3A 3R4DB 5C4WA 3LZZA 2NQYA 4JRLA 2R0FA 1N1VA 3OGGA 3VL8A 2RR11 1VBA2 4E4ZA 4CP2A 4QQ2A 4L92A 2D93A 2D6LX 2GN3A 1W0PA 4K1ZA 3VBFB 1VBC2 2ZHKA 3FZ3A 2Y0IA 5BNOA 1GZCA 1YLLA 2ERFA 5DUVA 3GZTB 2N7GA 3ZSJA 3B93A 4Q4X3 2VXRA 3NV4A 2W08A 5K0UB 1NE6A 5C8CC 2PHWA 2HWC3 4LO6B 1ZZBA 1UKRA 1BEV1 4FP2A 2B9UA 3OD4A 1NA1A 1LOBA 2AZ5A 5BNPC 4Y20A 1WCSA 1WW4A 3J4UH 4V1PA 2ZAAA 2E6VA 4IL7A 2GC3A 5T55A 2EAAA 5IK8A 4LLFA 4AE2A 2R073 1LHWA 3DF0A 4WM8B 2ZZQA 3BPZA 4FOWA 2PAEA 3VZOA 1XYNA 2GNTA 3ZFFC 1FMD3 2XKPA 3JQWA 4IV1C 4CDWC 3KCXA 3UL2A 5T5PA 4URTA 3OF1A 1VAKA 4Q4W1 2H0BA 5IUQA 5IK5A 2WA3A 2Q1ZB 3KT1A 1IS5A 2R30A 1OA3A 2DU0A 3M3IA 4LE4A 3ZFEC 4XF1A 4AEJA 1EV11 3R0RA 5EV7A 1MEC1 2RJKA 2A5ZA 3POSA 3I7DA 4DRVA 3J8F3 1QJU3 1C28A 4LHNA 1D4M1 1N3OA 4IEUA 4PCRA 4O9EA 1IS4A 1WLDA 3S6PA 2ZHMA 2YC0A 1LOGA 4R52A 5E89A 4ITCA 1AYM3 1QWRA 3JB4C 3VBRB 2C0ZA 1UX6A 4K1YA 2PFWA 4NVPA 1RJ7A 4HN1A 4AYUA 3ZFEA 1ULCA 2XLAA 4DQAA 1XQNA 4K21A 1NXD1 4FCAA 1BEV2 2WFPA 4X6RB 4AQ2A 3MW4A 3O0WA 4JGYB 4AFBA 3TNPB 4FXKB 2DUQA 4JTNA 2E7TA 2CL2A 4XOGA 4ZU4A 4Q0PA 1F5FA 3VZKA 4XETA 1GKBA 4XJUA 4YM1A 2XUMA 4IV3B 2Q8OA 5C4WB 4MUVA 1Y7BA 1VBD1 2JG9C 2DFCA 3DV8A 2QDRA 5F9TA 1PO21 2VVFA 3RWNA 1X33A 3BOPA 2WIIB 2DURA 4WVWA 2HWD2 2BBVA 3WW1A 4MXVA 3PVOA 1HKDA 1LGBA 5BNOB 1JUIA 2MPFA 4YM3A 2JE7A 4YZ2A 3AP9A 3ILFA 2A7AA 3OCPA 5DG2A 4YYOA 1R1A3 4YG3A 3CO2A 1EV12 2NYYA 5FFOC 1YFXA 2RS31 3LGRA 1MEC2 3VHNA 3V0BB 5FTTC 2R0HA 3KZ4C 4IETA 3ME2A 1D4M2 1X36A 1IZ3A 4QPGC 4GKYA 1NA1B 2WNVA 1QXJA 3ZIXA 1BCXA 4Y20B 5EXOA 3H7JA 4TLFA 1G6NA 4F83A 3H3ZA 2ATFA 3AK0A 2VGDA 2E53A 4KG0A 3M8LA 1B35A 2NLRA 2WWSA 5I0SA 4EN8B 3M3EA 1O3SA 3D5OA 2XJQA 4MV2A 4A7ZA 1RUF1 3LA3A 1UZZA 3NAPC 3WLUA 1QNWA 4S2DA 2FBEA 2GNDA 2CTVA 1POV0 1ZM1A 1A78A 2EA7A 4PBOA 1ZBE3 4IEQA 3VBOC 3FE5A 4ONUA 4Y1UA 3ZXDA 1RTVA 3ZX7A 3JQXA 3UV9A 2WT2A 4IEXA 5L7OB 4F7ZA 4CP0A 2GH8A 1VBD2 3PMEA 2BWAA 4Z2WA 5LEKA 4IERA 1PO22 3TOJA 2QQPA 5A32A 2NMOA 4CDQC 5JOWA 3KCYA 1Q3EA 3NAPA 1MZEA 4Q2FA 5CFDC 4XBQA 1VB4A 3B9IA 3VBOA 5GKAC 1RUC2 4CDXC 4EN7B 2ZKLA 2PN5A 4JTOA 4RQPB 3ZXEA 1HRV1 2O8QA 1QHDA 2DTYA 2HWF3 2RS53 1N3QA 1C8M2 1G9CA 2XJRA 3BCWA 4LUKA 1N47A 1W6QB 3FBMA 4NN0A 3DUIA 1LGCA 2R041 1JHNA 4CDQA 4LBQA 2AUYA 2JECA 1RVF3 5T50A 4K9SA 5JI7A 2DYCA 1VB2A 4Z1VA 4XBLA 1NY71 4AI0A 2WINB 1DQ6A 1OHFA 2WZR1 1DU3D 1C5IA 1CONA 1AF9A 4A7KA 4OLLA 1RUF2 4N90A 1BXHA 4RR3C 5HBAA 3U0ZA 5JWPA 3KQRA 3VKLA 2YROA 5JMCA 1V70A 3TRSB 4I01A 4UBGA 1KITA 5FPXA 4U2AA 3PVNA 2W68A 1SLAA 4M3CE 3VDDA 2ZMLA 1LB2A 2IXCA 1JUHA 2ETEA 2HWC1 2DCZA 1JYIA 1DQ1A 2EALA 3MIFA 1ZYBA 4IEZA 4RS5C 2WZPP 1Z0HA 1ZBA3 3FHIB 2R6QA 1S0FA 5DXDA 1RINA 2WNVB 1XE7A 2RE9A 4Y24A 3VZLA 1Q8OA 5C9AC 4YZ3A 5GZGA 1OI6A 1FOD1 4YRDA 3PVBB 5FLHA 4WZCA 3ZN6B 2IXLA 3K48A 5JIUA 2DVBA 3H0OA 1HRV2 4QU2A 3T1MA 3MPPG 3MIBA 3V0AA 4TZDA 5DDJ2 2X5IB 4D7YA 1MS1A 2R042 2X53S 3NV1A 1IS3A 3LKJA 4GMP3 3WCRA 1G8WA 5E16A 2DU1A 4X6QB 1V6LA 1RUG1 4OI4A 1KXGA 2WZR2 1AR61 1N1SA 1RUJ3 1H4HA 4OHWA 4BE3A 5L36A 3J8F1 2ZTNA 4A2UA 4MGZE 5I91A 5T5LA 5A32B 3TAYA 3N7LA 3D82A 1HV1A 5J3UA 4XW3A 1RUNA 1AYM1 4D94A 1D0GA 4HKOA 3TB0A 4PIXA 1QJY3 1X8MA 4O9GA 3SH3A 3HIFA 1SBFA 2VU9A 2WS93 3AKQA 4WV8A 1O91A 3HQXA 4RSUA 1ENRA 2RHPA 2HWC2 1ZZ9A 2ARXA 4IESA 2VULA 4XTMA 2XVLA 3R4SA 1H1AA 1HIXA 5EJ3A 5KWRA 1PK6B 3VBHC 3WP3A 4FPFA 5DUUA 1JBCA 1W6PA 3OPZA 1BVP1 3AYAA 1GZWA 1ND2A 4LO5B 2WSVA 1V6OA 1FOD2 1G9BA 3E6CC 2KA3A 5GZDA 1SLCA 1CAVA 1PGW1 3NVCA 4WVZA 4AQ6A 2WL1A 2HKXA 5H9RA 4AEDC 1LOFC 3E6BA 2D44A 1AZDA 1GZ9A 3CLPA 3ZXKA 1XU1A 2D98A 1ND3C 2XB6C 3E97A 2C5DA 5FLJA 1V6IA 1MZFA 2QVSB 1HQWA 4LO7A 3KT4A 3MGUA 4FP3A 2K2SA 4GH4C 4H3WA 1H1IA 5I8TA 2DVAA 3TN93 3N3HA 1R1A1 4AGVA 1RUG2 5AFBA 1MACA 2IXKA 4H7LA 1F5JA 3AFGA 2GNBA 4G4FA 1AR62 1DYKA 1XE8A 4XHXA 3VDDB 1RUD1 1AR93 4XQDA 4YG0A 4YZ1A 3INAA 2VQ0A 3ZSEA 2UYBA 2E51A 5J37A 4B4PA 4C91A 4XFGA 4Z92B 2A3XA 2CYFA 4JC1A 1ND3A 5T3NA 2A6XA 4ZU7A 3VKOA 4RFT0 2IXHA 1POV1 1WMDA 1YFUA 1QJZA 4WVVA 1LJ7A 3ST7A 4AHXA 5IK4A 3VBUA 4BHPA 3DPRC 3MW3A 3CL1A 3N7JA 3HMYA 4DPNA 3WINE 2DFBA 3WDVA 4B4QA 3V0AB 4AQTA 1JTZX 3JBG3 3ZXFA 3I2DA 1VALA 2I74A 1UW8A 3IDCB 2PYTA 4CEYA 3VBFC 3AMMA 1R092 1ZBE1 4YARA 2GNMA 1DGRN 2ZX1A 2ILMA 4YW2A 4LULA 1N1YA 5CU1A 1HV0A 3EJKA 4DFSA 4S2HA 4EWAA 4LHKA 3VHRA 2OZJA 1PGW2 3HT1A 3AYDA 1HDKA 3D6EA 2WQZC 3RNSA 1H2LA 4D7SA 2XWJB 2R1DA 2VOWA 1CPMA 1MZ5A 2YXSA 3BU7A 3ZFGB 4KWLA 1N1TA 1ZRRA 2G9GA 3U11A 1TNRA 5K0UC 4KU7A 5DZGA 4EWEA 2HYKA 2BW8A 1DG6A 4Q27A 5KHKA 2CWMA 5FCCA 3USSA 2VW2A 2R49A 3SHRA 1RHI3 3WUCA 3ZSKA 1CR7A 1QDCA 1MVQA 1D2SA 2MEV1 3VBFA 1U12A 4KWKA 4YFZA 2Z2SB 3L9JT 3QACA 4ISRA 2TBVA 1AR83 5BYNA 1RUD2 4FPOB 2SLIA 1NQJA 4XJZA 4YZ5A 2HWF1 1FV3A 1V6MA 3VHPA 4Q4Y3 3RYRA 4GKXA 4WM8C 1ENSA 1SLBA 1RJ8A 4Z07A 1DZTA 2JD4A 1IPJA 3AXEA 1YCIA 2PTMA 1W6PB 1CJPA 2VG9A 2VW0A 2AREA 3PJQA 3G7DA 1CAXB 1MS4A 1ULGA 2RS11 1FXZA 3LOIA 3LWCA 1GZWB 3M1HA 4Z8BA 1ND2B 3AMQA 3WQ0A 2BPA2 1OSGA 4FOYA 4MVTA 5IT6A 1CAVB 4L8QA 4YM2A 2QZ3A 4ASLA 5JVVA 2BNNA 1LOEA 3GNEA 1G9DA 2UY9A 1AXYA 5JIAA 3ZXGA 5DG1A 3AZYA 4RD7A 3N7KA 4W65A 1HXS3 3UK9A 4MLOA 1ZBE2 3MLLA 1XNDA 3U4XA 4ZXKA 5GALA 3VZJA 1DDLA 3O0VA 3ATGA 3GHNA 1W39A 4RHV3 1AX0A 2P3JA 1CX4A 2WNUA 2AENA 1AXZA 1YIFA 2PHLA 3RI8A 2PHDA 2ZX4A 2XPJA 3VBRC 1PGL1 2WC2A 1MS0A 2DCKA 3PLQA 1BVVA 3J26N 1ZBA1 2IFWA 2EF6A 3B02A 1RMU2 4K3UA