4AF9A

Crystal structure of epithelial adhesin 1 a domain (epa1a) from candida glabrata in complex with galb1-3glc
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
228
structure length
228
Chain Sequence
ASKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNREYDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPA1P
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 60
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4af9A00
4GQ7A 4LHNA 2XJRA 4COUA 4CP2A 4AFBA 5A3MA 4AI0A 2XJQA 4AFCA 4AHWA 4CP0A 4D3WA 2XJUA 4COYA 4AI2A 5A3LA 4COZA 4LHKA 4COWA 4AHYA 4COVA 4ASLA 4AF9A 4AI3A 4CP1A 4AFAA 4AI1A 4LHLA 2XJVA 4AHZA 2XJSA 2XJPA 2XJTA 4A3XA 4AHXA
chains in the Genus database with same CATH superfamily
4D6SA 2DFCA 5ANNA 5JXGA 5JPMB 5HXMA 1Q43A 3M3EA 1OD5A 2AREA 2IXHA 3BODA 1Z7S3 1PO11 2B7YA 3IAPA 4CDQC 3MGUA 2WZR3 4C90A 2X29A 2ZGPA 2HWC1 4Y24A 1EUUA 1C8M3 3I59A 3ZFGC 4CRQA 3H7JA 1QKQA 1LR5A 1UYXA 5CAZA 3UGHA 4BISA 5A1AA 5TSWA 1HRV3 2EAAA 2HWB1 3P1IA 3ZPOA 3ZN6A 1WGPA 1DU3D 5F5CA 5C3SA 1VAKA 3JQXA 1PHMA 5G05L 1POV1 5L73A 1SG3A 3ZMOA 4ZU4A 5A3OA 5GALA 3VD9A 4BHPA 3AP4A 4RR3B 1QJU1 3ZXEA 5HV0A 5IVVA 4FPHA 2IVJA 3VZOA 4QXCA 1LHWA 5FAXA 5FUNA 5H9RA 1NCQA 2D6NA 2PA7A 4LA2A 2Y0IA 4S2FA 4XF9A 1F9KA 1W8HA 3B5LB 1R083 4EN9B 3J9SA 3C7FA 1JN2P 3IIIA 2BEOA 1UX6A 1SPPA 1QEXA 2W1SA 3SXWA 1RVF2 2K0GA 2XOMA 4Y20B 1R64A 5A3PA 4TZDA 2DVFA 4XDPA 2WBKA 1VBD3 3KZ4C 5IFPA 1NY72 3VZNA 5A1FA 1VBB2 2W87A 4JTNA 4Z8BA 2W52A 5A3NA 1LRHA 2D40A 4CUCA 1MEC1 4AEDB 3QCWA 3VV1A 1PMHX 1OLQA 1OVPA 5FKCA 5CU1A 3T2PA 1UOBA 4WVMA 5JXJA 1G86A 2IXLA 4AGVA 1LHOA 4QX5A 4NIIA 5CFDC 1RHI3 4JTOA 5F3CA 1IS3A 1W6MA 4YLZA 2OZ6A 3WEZA 4LNVA 1D2QA 2WLPA 1RUF1 1UAIA 2HJIA 2UWCA 4ASLA 2A75A 2FCUA 1NCRA 2VY0A 5KHGA 2YXSA 5AVPA 3IBMA 4ARYA 3ECQA 4CDXB 3K4DA 2J1TA 4META 5T5PA 2CGPA 2VULA 4JGYC 1GZWA 2Q5TA 3DYMA 4HL0A 3MW2A 5BUVA 1R1A1 2PHUA 2RS51 1H1MA 4IEUA 3BOPA 4QX7A 4MYEA 1UCXA 2VVEA 3P6BA 2VECA 4P5YA 5FYUA 3FC0A 4UFLA 1V9U1 5IVFA 4CXWA 1AX0A 1HXS2 4KBZA 4M00A 4TLFA 4WM8B 5FY4A 4CU7A 1WA6X 1TMF2 4DINB 2DUQA 3IMNA 5KBFA 1TME1 4FPEA 2F4PA 4RHV3 2D5HA 1UOJA 5IUQA 3WP4A 2GP3A 4RGAA 1VR3A 1N3PA 1PMIA 1ZZBA 4LITA 5HCFA 1ZYBA 5FYBA 5HPOA 4ZHNA 4Y33A 2J1SA 4JQRA 4WBBA 1T2XA 5C4WA 1W6NA 4YM1A 4YW5A 1UPIA 1VBA3 1WCUA 1XNTA 5F8PA 5FXWA 4BQ2A 1O7FA 1JH5A 1QJFA 3EXUA 2WA3A 1RMU2 1IHMA 1MS9A 1DHKB 4GWMA 2VQAA 1V6IA 4O65A 1C28A 1JUHA 2WDBA 1F35A 3QH7A 4Q26A 1SCRA 3BIEA 4NO4A 3AL5A 4XAEA 2A6WA 4INDA 4ITCA 2BNOA 2VQTA 5JI9A 3FX3A 3OGRA 3TEYA 1PZ9A 5C3PA 2VE1A 1RJ8A 1QOTA 3FUOA 5FP8A 4P5HA 1C4RA 4O7XA 4AL9A 3R05A 5LK5A 4LBMA 4DS0A 5HCAA 3BTXA 1YUDA 4NUBA 1VBC2 5J96B 1AR92 2VGDA 4Z92B 1LAJA 1KRIA 3O12A 2RE9A 3SITA 3O1TA 4BLJA 2P1BA 3M1HA 3O0XA 3SH3A 5DDJ3 2W1WA 1AR73 3JBG1 3POGA 2W95A 4FFIA 3ZXJA 4EJRA 5DABA 5FMCA 2WAAA 5FPBA 4YZ2A 5CEHA 4G4FA 5FTTC 5I0TA 2GN7A 4FOWA 4C1XA 4LE4A 1NCQC 3AMMA 5C5TA 2R043 1IGOA 3J26N 1H2NA 2CV6A 3MIFA 5J98B 1D7PM 1D2SA 3VD4A 2XHNA 5KXDA 2RR13 3K4AA 3LB9A 2WFF3 3OPWA 1Q8SA 4LKSA 1AYM1 4UT5A 1J83A 5FZ3A 2XDVA 4BA6A 1PK6A 4ES8A 4I2OA 4PLMA 4HETA 3JZVA 5BNPA 4OHXA 4DPNA 2UWAA 4CEWB 2GSYA 2XBO1 5JPNB 3GCXA 3HQXA 2QBXA 4BZ4A 1BK1A 5LA0A 1AXZA 5A3MA 1QDCA 2BVBA 2B46X 2VBPA 2ARAA 4GWIA 1PIV2 1DF0A 2A6VA 1GOFA 5BNNB 4AEMA 1ND2B 1TNRA 2ADDA 2JDHA 4COZA 1QJX2 4P9WA 4D6QA 5L36A 4GWNA 3LA7A 3VD7A 4QPGA 2PLV1 4IV1B 2ES3A 1UU4A 1NCRC 4QXHA 5DAWA 4HLTA 4KG8A 4L9BA 5FMDA 1GV9A 3WHTA 3BB6A 4Z1VA 1OKOA 2GNBA 1W03A 4JX0A 3LDBA 5FP9A 1H1AA 2J7MA 2W1QA 4NHYA 4BIFA 1BCXA 2GH2A 5LRRA 4BQ4A 3UESA 1QJY1 3ALQA 4HOOA 3K46A 3SCFA 3PJYA 2VQ0A 4WZCA 2EA7A 1W99A 1IPKA 2Y6GA 4DUWA 2RJLA 3TN91 2DUOA 2VTFA 3UYJA 3JD72 3ZPYA 2JWPA 4Y3OA 1ASJ3 1EPZA 1SFNA 5FBJA 2RJ2A 4XJWA 4K6BA 5AVAA 3TBDA 1STMA 1TG7A 1D4M3 5IVCA 3W20A 3AK0A 3EQEA 3J7LA 2JE8A 1VIWB 2JJ6A 2NYYA 5LATA 4AEKA 1W8TA 1CAWA 2ET1A 3DPRA 4IEYA 1FX5A 1FPN2 1UYZA 2D5FA 2Y6JA 1OD3A 4MGZE 2HWE1 2JDKA 3VBSB 1HB2A 1OURA 1XSRA 5DUWA 2VBBA 3M4FA 3TEXA 2R062 4XFIA 3I2OA 1H8TA 1DQ6A 1E5RA 2X10A 3AZYA 3IN9A 4XJAA 3THTA 3ZFFB 3VD5A 1ZRFA 1RC6A 1VB4A 1NLQA 1PO13 2ZPXA 1COV2 4KG0A 4CP0A 4LKEA 4RQPA 5F2WA 4DRVA 1K5MB 1S2KA 3NJYA 2HWC3 4XVHA 3POFA 5FZDA 1RUG1 2XHKA 1L7LA 2JDMA 2WYFA 4GH4B 3ILNA 5IAXA 4WVWA 2HEVF 4XUPA 4AI1A 1A34A 4LHLA 1DYKA 1UPSA 2JD4A 3DECA 2P3YA 4LXLA 2HWB3 3V56A 4PIXA 1UY3A 3I8TA 4B7KA 5BNOC 2PHTA 1CJDA 3GJBA 3HEIA 1XU2A 4HMZA 4CE8A 1Q8PA 2K9ZA 4CCJA 1YLLA 1POV3 1F15A 1LOAA 2D97A 3K2OA 3MIGA 4JRLA 1VB2A 1SMVA 4QDQA 1W9FA 3NW4A 4KI5M 1NQDA 1XRUA 1QJU3 5F9TA 4BQ1A 1UU5A 4HBNA 2V4VA 2RJKA 4GXLA 4CDQB 1KITA 2ZGMA 2A3YA 3OY8A 3T4VA 3ZFGB 4COVA 1DZQA 1W8WA 2AR6A 2VNVA 3NJXA 3CBNA 5FUIA 4LHSA 1JZ8A 4CDUB 4DUXA 2G19A 2K46A 2WAOA 4JGZB 1PK6C 1W6OB 2VU9A 5B2GB 1JW6A 2TBVA 4LO8A 4Z2AA 5BNPC 5HV4A 5J3UA 5F7UA 3KM5A 5DUXA 1YFXA 3BIWE 1XE0A 4A44A 1W9WA 4AGGA 3MW3A 2BDRA 4ZPIA 2FHRA 1EV12 3JXSA 1MEC3 5ACA2 4GJYA 1GU3A 5HI0A 1HIXA 1SLAA 4PQQA 4RS5C 1YFWA 5HCBA 4Q0QA 1J58A 1K45A 2AH2A 1PX3A 3ZOIA 4COWA 2RHPA 2ZGLA 3ACGA 1VBE2 3ACLA 3DN7A 3HIFA 3OD0A 4XMIA 1UY2A 5F3GA 3RJRA 5CKMA 1GZCA 4JDMA 4QPGC 1RUF3 2N7GA 3AP9A 4MADA 5JIUA 4Q0VA 1UF2C 4QXBA 5FK8A 1UY1A 1Q56A 4OUSA 3A23A 1UIJA 1SDDB 4Y22B 3J8F1 4IUGA 3VDCA 4D69A 4E2GA 3CLPA 3KCXA 5GZGA 4CUAA 3AVRA 1QIQA 4ISRA 4BCUA 1UD1A 1Y9GA 1REEA 3ASIA 4Q5OA 1NX9A 1R1A3 4PBOA 4Y1XA 2VZPA 2ZACA 4P9YA 3TB0A 1LB2A 2RS53 5FYHA 2WWUA 2YC2A 1UYPA 3H42B 2QQLA 1AR82 2P4EA 2C5DA 2VOKA 3PUHA 1MACA 1N1SA 3FZ3A 2VZOA 4J6GA 1R1ZA 1V9U3 4NIAA 3JU9A 5LY2A 1Z0HA 3CKHA 1VMJA 2RMU1 5CFDB 2GDFA 5E6HA 1OT5A 1TME3 3AKRA 5FZKA 3DXUA 2JDNA 3WP6A 3N7JA 5KHJA 3PMSA 4IV3A 3GZAA 2ZBJA 1OFNA 1NG0A 1G9AA 2JDZA 3AJZA 3LFIA 2Q8CA 1OOPA 1QQP2 3RWKX 1PM4A 3DPRC 3NL1A 4MGQA 1SBFA 5A32B 4JGYB 1CJPA 2GALA 1HDKA 4OI4A 2GAUA 3B94A 4KU8A 4QU1A 1H8TC 5E89A 4DXZA 5FY1A 1OBNA 3DF0A 4Q4Y3 2QQPA 1RUC2 2XQRA 3D4KA 3QLQA 5CBLA 2QVSB 2PHRA 2ZEWA 5I0SA 3ZFEB 4AFMA 4COYA 2BYVE 3F95A 3RZZA 2ZX2A 1WLDA 3WOGA 4LUMA 4Q4W2 5KHHA 1FOD1 2DUPA 1X50A 3MPPG 5A70A 1PGW1 1RUE2 2ZX3A 1GWLA 4GB32 4DRRA 1LOEA 2MEV2 1SBDA 1UKRA 1S0GA 4UFKA 1W8OA 3D82A 2DYCA 3AM2A 3E97A 1NKGA 1FNYA 1FMD2 4FBFA 1LEMA 1ZA7A 4IW3A 1XNCA 5DG2A 1QDOA 3GZEA 1H2LA 3I3MA 4K3UA 4YW4A 4XF1A 1GKBA 2CWSA 2BUKA 2XONA 4EZHA 4EN8B 4B3NA 5I0DA 1EPWA 1ZNPA 4XAAA 5EWSA 1IS5A 3U11A 3N7LA 4BIOA 2VJXA 1GOHA 3JBG3 5IATA 4FOQA 5FP7A 1XPWA 2QQIA 2QDRA 2J1UA 3UK9A 3PUAA 1F31A 1MVQA 4OI1A 3FLRA 5C8WA 3HQUA 2HWF3 5CFCA 1WW7A 3I59B 2QQWA 3INAA 4H14A 3HWJA 3JQWA 3EO6A 5IVBA 2VNGA 1ENSA 3NO8A 4JVAA 5FYIA 1AYM3 4FPFA 3H9AA 2VTXA 2TUNA 4H3WA 1S0EA 1JUIA 4KQ7A 3WUCA 3ZN6B 2O0OA 3MICA 3BCWA 2YFZA 2AENA 4YG6A 3FHAA 2H0BA 2VO5A 2YPJA 5LB6A 4COUA 4FPGA 4XPVA 1UY0A 1CWPA 1GWKA 2QQVA 3B93A 2XBO3 5IWFA 4XCAA 4MGTA 4C1WA 4QGLA 4WVVA 1JYCA 1MR5A 2FCTA 2HKXA 1GUIA 2Z4FA 5FYZA 4UAPA 1R081 1JZ6A 1U5ZA 4LHKA 2FCVA 4NR1A 3S5QA 1ZBE2 4EWDA 4EN0A 2C4XA 2A3XA 1ZBA1 2PLV3 4YVWA 1JOJA 1DLCA 1T6GC 2PQSA 3I3DA 2B9VA 4KH9A 1I5ZA 4MGIE 4FT8A 2DU0A 2IXKA 4GMP1 4PI2A 2XUEA 4ZONA 5FMOL 5GZEA 5K8SA 1BEV2 1DGLA 1QOOA 3C8XA 4ZS2A 4E4SA 3POWA 1NQJA 2D3PA 5FLHA 5FZBA 1SFPA 1F8VA 4NAOA 1OH3A 3K77A 4BM8A 1XYPA 4NRQA 1QJY3 2VZUA 2Z42A 5A7WB 4KWKA 3C2UA 2NLRA 3KGZA 4D7TA 3S6PA 1ODNA 2E31A 2VH9A 3DGTA 4XQ4A 4BQXA 1LKNA 3LFMA 4WVMB 1HV0A 3TN93 2A6YA 2R072 4UF0A 1YQ2A 2LTNA 3BOWA 5F1RA 1AYN2 1Q5OA 4MH0E 3RYRA 3WNKA 2OUHA 2QZ2A 1W6MB 2ZS6B 3VDDA 4IV3C 3NVCA 5C9AA 4NPRA 1NCRB 2GC2A 1OOPC 4ZY9A 3L9JT 3ZYIB 4UOJA 3BU0A 3EB7A 5FV3A 2ZABA 1YRZA 2JIGA 2D6PA 1GZWB 2XUMA 4LHNA 3AXDA 4QB1A 3MZHA 1X8EA 3HVDA 1UL9A 3KF3A 2WNOA 3KQRA 5A80A 1W0PA 4G3YC 2NP0A 2R1BA 1XBFA 1OQEA 3AYDA 5LZ6A 2OYZA 4XBNA 5LBBA 3RQ0A 3JB8A 3BVCA 3HT2A 4QKDA 1US3A 2WO2A 2E32A 1EAH2 4DY3A 4URAA 3CNAA 3A4UA 4PDWA 1P8JA 4QX0A 4BOWA 1WW6A 4XABA 2CU5A 2RS12 3RPQA 1IQAA 3M7AA 1XJAA 2NMOA 2XJVA 2XVLA 1HRI2 4DEQA 1HN1A 3KSCA 1AX2A 1BYHA 1CD3G 1QGLA 1SFYA 2XKOA 2GP5A 4CPBD 2NM1A 3Q8EA 2YU2A 1VBB1 5ERLA 3WW3A 5C4WB 1CX1A 3LWCA 1WCDJ 4LJHA 4XF4A 4YFZA 1K5JA 2RV9A 2NZ9A 5DXDA 1ENXA 1WA4A 2VMDA 5HXVA 3MUY1 3TEWA 1RIRA 2Z5WA 2HWD1 5JUVA 4S2GA 1GNZA 1N3QA 5FOJB 1LOCA 1A78A 1EUTA 1S0FA 3J4UH 1PO21 4CDWA 3PL0A 5CFCC 2VNOA 5C70A 4XJZA 4QGNA 1HLCA 3FFZA 1BMV2 1MPXA 2WN3A 4D6RA 2VMCA 4DY5A 4YZ5A 1FYUA 2MPFA 4O9GA 4TYSA 1G9CA 2D6MA 2BNMA 5IVJA 2UY9A 1DGRA 4M3CB 1UX7A 2G9FA 1YIPA 2XR4A 2VZTA 2ZGRA 3AKSA 4FP3A 1LHUA 2ZHNA 4I0WB 1VP6A 3UGGA 1BLZA 1AVBA 2Y0OA 4AFBA 4N9HA 2HBTA 4AVTA 2DWRA 1SHWB 2WO1A 5LASA 1YFUA 2Y64A 4LLOA 2R041 4EWAA 3IMMA 1ZZ8A 5GJ6A 1URXA 3MO4A 3WW4A 1CR7A 4MXWA 2RR11 2P6HA 5F39A 1V70A 3DV8A 1XNBA 5IVYA 2X8KA 3LOIA 3SH5A 4AI3A 4BQ3A 1O5LA 2ZAAA 5C33A 4KWLA 4PLNA 4XTMA 3UGFA 3LZZA 3MLLA 4X8NA 3SQOA 1FNZA 3ZXLA 4AFDA 4WV8A 4AQ6A 1C5HA 3J8F3 3QOPA 2EXIA 1XQNA 3LKJA 5GKAC 3OGGA 3GDBA 4OULA 1PK6B 2FMYA 3A0NA 1NZCA 1Y43B 4AEJA 3OGJA 4L11A 2UURA 5FQ0A 4RFT0 2PAEA 4HVQA 5KXBA 2XB6C 4RGGA 1PNGA 4XUQA 1QNYA 2WIIB 4N53A 4OVEA 3H1MA 3WF3A 4Q4V2 2WLQA 5FYMA 1DCSA 4BWOA 4WM7A 5CISA 4Q4X2 4YVSB 3EYPA 4R8HA 3V0AA 1Y3TA 3BALA 3VDDC 4QPGB 4DFSA 5FUPA 5C9AC 1AX1A 4R9CA 1Z7S2 2ILMA 2YG0A 1DG6A 3ZYPA 2RG4A 4PIYA 1WD3A 1AF9A 3HOBA 1OMIA 5BPXA 2WZR2 1REDA 3UKNA 1PGL2 5H9SA 1OSGA 1C8M2 5IW0A 4P9GA 4K8RB 3I3QA 5CNAA 3V64A 3O1VA 1CPNA 3THDA 5AC91 1RL3A 2ARCA 1UZZA 2VMHA 2DBNA 4OMCA 3WVJA 3N36A 2IVIB 2HYXA 2W9XA 5FY9A 2IZWA 2GZWA 2LROA 3OTFA 1S4CA 3GBFA 1FOD3 4PDWC 4R52A 4R4XA 4C0BA 1PX4A 2JEMA 3WNXA 3SLIA 3C3VA 1LGCA 1QF3A 4LO7A 2A3WA 3VDAA 1UMIA 3LGRA 2JICA 4FOYA 2WNVA 1CAWB 3DPRB 1RGSA 2JB4A 3OBZA 4QQLA 4LUKA 1G9DA 2VMIA 1VRBA 3GZTB 5JXIA 5CG9A 4L8QA 2YFUA 1H8TB 1O3QA 2WYSA 4B29A 4LORA 2XJUA 4FPOB 4YZ3A 2E9QA 1NA1A 3ACFA 3U75A 1JOBA 2BRTA 3WZ1A 4K1ZA 2VR4A 5LWBA 2E7QA 4RQPB 1QJX1 1UU6A 2I07B 5FPZA 4GJZA 3WD5A 4CDWC 4E2SA 2RS31 3VKNA 4CUBA 4IXLA 4KWUA 2QDNA 1O3SA 2KR2A 4LK6A 1JHJA 2P2KA 2ZA9A 4XE9A 5CKQA 4F7ZA 2VCAA 3PDQA 3U07A 2G9GA 3DKWA 4E4DX 2E26A 5C8CA 2DCZA 2AYHA 1RHI2 2CGOA 4LEJA 4BPZA 1ZX5A 4YGEA 3ST7A 2SLIA 1GWMA 3H8RA 1LULA 1GP4A 4FXGB 4QKBA 4IGOA 2BP6A 2Q1FA 1Y7BA 4QAWA 1IQDC 2WR9A 3KT1A 4I02A 2YMZA 5IHRA 3LE0A 3WNLA 2EXKA 4S2HA 4DEVA 1VRH2 1MS4A 5C6CA 4BLIA 4QD2A 3OY8B 4EV0A 1I5PA 4BB3A 1ZBA3 2PHDA 4IL7A 5LCWL 2WS92 1IKQA 4V2VA 4XQDA 4GMP3 4GIQA 1YQ6A 1W0OA 3NAPA 2R1DA 5EZWA 4RL7A 4YSFA 3MV01 4IEPA 1N3OA 3MIBA 4R9BA 3ON7A 2R061 3PUSA 5FXZA 3RZGA 1QOSA 2WN2A 5C3QA 4RHV2 1XSQA 5C71A 2XVGA 3VBOB 2VM9A 2VVFA 2R0HA 4QT6A 4N53C 5BNOA 2XH6A 4IEWA 4WM7C 3M70A 1F2NA 1VBA2 1BBT2 1BHGA 2QQUA 1DFQA 1N1TA 2IC1A 1OC1A 3GCWA 3AC0A 4LMFA 4MHRA 4QB6A 1N47A 4B7EA 3HJRA 1YHFA 5LK7B 3GHMA 4M0HA 4H7MA 3ZSJA 3WCRA 1SQ4A 2EIDA 4GAZA 4AAXA 1NT0A 4A7ZA 1NZIA 5BXXA 3HAGA 5FPUA 1TE1B 1C57A 2ZOEB 4AI9A 1FV3A 2VNRA 5FZCA 5GZFA 3ES1A 2V5DA 3IWZA 4C91A 1PZ7A 4FAHA 2JE9A 4QPYA 1WLWA 3HBKA 2JG8A 3WW2A 2BGCA 3GZUC 1CAUA 2XJPA 3KT7A 3PTRB 1RVF3 5DDJ2 3H3UA 4P00B 5CB7A 1AR72 1OOPB 2WNVC 3OBTA 4AQSA 4FPLA 5FO8B 1R092 1RUI1 3C7GA 3HR9A 3A21A 3KV4A 3NRUA 4FAGA 1GQPA 1VBB3 2I74A 4ZU5A 1JU3A 1J59A 3D5OA 4ATFA 4Q4Y1 5ISLA 2LALA 2ETEA 1L3JA 3P3NA 5ACA1 2D43A 5FPVA 2WFF2 2EVXA 3GJAA 2Y38A 1NA1C 1JMUB 2HWD3 2VCBA 2XWBB 3X29B 1KQRA 4XJUA 1POV0 2W2IA 1VBE1 5A33A 1PO23 2Q8OA 2Y6FA 1ACCA 2Q8EA 3OUJA 2DBIA 2R30A 4LA3A 3VD3A 5FREA 4N43A 3R4SA 5KC5A 1B09A 3PVEA 4LE3A 3ZXGA 4U36A 2IXIA 3E6BA 2WZEA 4UI9L 3U0ZA 3PUQA 2XJRA 3T2TA 4URTA 2ET7A 1TVGA 5C8CC 4JDOA 4DIQA 3DKQA 1AR81 3VHRA 1ND3A 4H2AA 4QQPA 1CAXA 3R4UA 4AI2A 1WKYA 4XBLA 2OKXA 3I2HA 2HWF1 3WG3A 1HQLA 5FDBA 5LEKA 3ZYGA 4CCOA 4QU2A 1O3TA 5FY5A 2VMGA 2VMFA 2QJVA 3WT3A 4NJ4A 4N9IA 3QH6A 3SEPA 1OPMA 3AP6A 2YDEA 3MI8A 4OHYA 4HPKA 2ARBA 4J25A 5FWEA 2PMWB 4AVAA 1MVEA 2BV4A 4PIZA 3NAPC 2QCSB 5I8SA 1HB3A 2FQPA 1J1LA 1WMEA 2YB7A 3IPVA 5JZGA 2VXJA 4ORFA 5EV7A 3MUZ1 4CTEA 4HN1A 4Y4YA 5DG1A 2GN3A 4GWJA 4LT5A 1ASJ2 4RS5A 1RMU3 2Q30A 2RM22 3AX4A 4LKDA 3WDTA 3WF1A 1BVP1 3AMQA 3FE5A 1YIFA 2KXLA 2GC1A 2YC0A 1D4M2 1MS0A 3GM8A 4FFHA 4PBPA 3VBHA 1E57A 2Y8KA 2AACA 3LEMA 3SKVA 1FT9A 4IE7A 3T1LA 2ZMKA 3OBRA 3OF1A 1C3HA 3OPZA 3ZXFA 5E1RA 2OQ7A 1WMFA 2UU8A 1J3QA 4CCLA 3KLSA 3AL6A 3R0RA 2XMLA 3A0KA 5ABJA 4YVWB 2C9AA 2ZJCA 3ZSMA 2WNEA 4PF5A 4Y1ZA 2E7AA 5A3TA 1VBC3 2PHXA 4CA9A 1HX6A 4YM3A 2EAKA 2RVAA 1JYWA 3SHRA 4A42A 4I30A 3GBGA 1UN1A 5EYXA 5L19A 5LY1A 1U5YA 4HG6B 4LR4A 5AC93 1FATA 3CJXA 2FDKA 3A22A 2GU9A 2X5IA 2HWB2 3U4XA 3MF6A 3QD6A 3H8UA 5FY0A 4HKWA 4UF0B 5D8AA 1JYVA 3LDRA 5LA9A 5LBEA 4NWVA 2D6OX 5LA2A 2GC3A 2JG8C 1EYBA 1AR61 1KS4A 2ZZJA 5I0UA 3DUIA 3VDDB 2ZHLA 5K0UA 2Y34A 3VN4A 2GMEA 2E7TA 1WCKA 2HBUA 3K75B 5FXVA 1S1AA 2WUHA 3IAQA 3ZN4A 3KVBA 4KNCA 2XQXA 2BBAA 3WQBA 1GP6A 3ENRA 4EE2A 5GLVA 1W8ZA 1H4GA 3OSDA 3POSA 5JOYA 1Y9MA 2D7FA 2CWMA 4AHYA 1CGPA 3PJQA 2ZMLA 4MV2A 3E5UA 3LSEA 5L7OA 1DZTA 3CMGA 4DNYA 5A3WA 3WHUA 1QJX3 1UZVA 1BJQA 3I2DA 5F6LB 4PDWB 4QDRA 3WDXA 2HEWF 4AXOA 2RS33 1OLRA 4CXXA 2FDGA 3ITQA 5A1LA 4A4AA 5EFUA 1KFUL 1MEC2 1XNAA 1TNFA 4H7LA 1J3RA 4LK7A 4N43C 1UXZA 3FJSA 4CCCA 1SACA 3TEZA 3E5XA 2CTVA 5LRSA 4AVSA 1Y4WA 2UYBA 3FL7A 3D6EA 5A7PA 4R9DA 4L0PA 2V73A 2PQQA 5DQ0A 4EN7B 1RUF2 1ND3C 1CIYA 3JCIA 1CX4A 1WW4A 1ENQA 4CVUA 1TZOA 2WQZC 3AP7A 3KV5A 3RS6A 1VJ2A 4LOSA 1YC61 2WO7A 2W46A 2YUEA 4YW6A 2JB8A 3Q8AA 3AZXA 1R1A2 1YQCA 2D93A 4AQ2A 4CP9A 1NLSA 2RS52 3I7DA 1WW5A 4OCTA 4A6OA 3UT0A 4AOCA 4C8DA 1S0IA 3PUIA 3OUHA 2A6ZA 3LIGA 1V9U2 5JLVA 2GNMA 1I3HA 1W2OA 3B9IA 1JBCA 1IZ3A 3DEMA 3I3EA 4W6XA 1AL21 1QHDA 2BWAA 3IDBB 3O1SA 1IKPA 2R063 1TME2 3OGSA 1PZ8A 5KXCA 1AXKA 2PTMA 2Y60A 5BV6A 4AHWA 2I2SA 5FRAA 2DDUA 4GZ9A 5GZDA 4XCBA 3VBHC 1MQTC 2WA4A 1US2A 3D3AA 1KS5A 2VAUA 3V65A 2C1FA 1COV3 1NXMA 5FZ1A 3NMBA 4QPIA 1L7RA 1XYOA 2WO3A 3CL1A 1KGYA 4LO6B 4WVZA 4A41A 3UKTA 1WMXA 2DVAA 4MXWB 3GF6A 3T1MA 3WF0A 5A6QA 1OA2A 5ABJC 4AEDA 4DQAA 4ES9A 4IETA 4XXPA 5FIXA 1JYXA 3RJ2X 2P3JA 1IS6A 2Q8DA 2BFUL 3FHQA 1ULEA 5T3NA 1DQ5A 3HNYM 3U78A 1JTZX 1YQ5A 4XJ9A 2ZEYA 1QU0A 2ZMNA 3NNGA 1XNKA 2ID4A 4KU7A 1LOGA 1JZ7A 2H6BA 5FZ7A 2P37A 3S0MA 5JOWA 4NPLA 4IEQA 5FQ0B 3SKJE 2YY1A 2J1EA 4PF1A 1O8PA 4FPKA 4XZUG 3AYEA 3ES4A 1ODMA 1OKQA 3E6DA 3WNNA 5I0RA 1RUJ1 2X5IC 3LEKA 4EYUA 4N53B 1HW5A 4NRPA 5FBZA 1IG0A 4OHVA 1HJGA 3B01A 5D8AC 1DLLA 4D7SA 3PIJA 3O1RA 1C8NA 3ZIWA 1CN1A 2J42A 3V0AB 3I54A 5KHKA 3TNPB 1LNSA 2A73B 1VALA 5K0UC 1NE6A 2B4KA 5BNQA 3HN1A 4WM8A 5DAXA 3B02A 1RUI3 1UIKA 2PELA 5DZGA 3N9OA 3R4DB 1WCQA 2NQYA 3I2JA 3E5QA 4CEYC 5CVRA 5ACA3 1K12A 3GBWA 4MOAA 5A7QA 3ZYBA 4NWWA 1AYM2 1V00A 4BH9A 5L7OC 1YJLA 2HEYF 5FJKA 1DBNA 1W8NA 5DUUA 1I6XA 1VBE3 4LULA 2H6CA 3PVOA 1RUH2 2VUCA 4Q27A 3NNLA 4HVRA 3EJKA 2WZPP 2CDOA 1H8VA 2DVDA 1F5JA 3AYAA 2AZ5A 5FMBA 2R6QA 5CG8A 2ZGUA 1Z78A 2VOXA 5IAVA 4CP2A 1V6MA 3N7MA 4HSJA 1PVC2 3Q8BA 5GM0A 3MIEA 1AZDA 4F83A 3K3NA 1AR83 3KS7A 2G4IA 3F2ZA 2PLV2 3LD8A 4FFFA 3U4SA 2VPVA 3ABZA 1OVSA 4B1LA 5FO9B 4B1MA 2B42B 2Y6LA 5AFBA 3CU7A 1NA1B 1SDWA 4LQRA 4XHBA 5B4NA 3BTZA 4FTEA 4I0BA 4Q4X1 4QXKA 2QUOA 2BFUS 3WUDA 2PHFA 2XKPA 2Q1MA 4AHZA 1X7NA 4CYDA 3WQ1A 1U12A 1QJY2 4QX3A 5F5AA 4F8AA 4MZUA 4A45A 2JXAA 4GQ7A 4XOGA 2PN5A 2NN8A 3O1OA 2PYTA 4YW3A 5C3OA 3B69A 2ZGNA 4D7YA 2QFEA 5D1IA 1X9TA 1SLBA 2BNNA 3TN92 1OXCA 4E27A 1X9PA 2CAVA 4JKLA 4UBHA 2VL4A 5C8CB 4V2WA 2G1MA 2YGLA 5LW9A 1AL0G 3THCA 3AVSA 2CDPA 1RUC3 3KCYA 4AVBA 4GULA 1MS5A 2EICA 2CNAA 2YPDA 3I2IA 3WG4A 1CESA 1NCQB 1HN0A 2ZKLA 2VW0A 4S2DA 5LBFA 1RUOA 4FQZA 2R49A 5KHIA 4QPIC 3I2FA 3RYKA 1ZREA 1IG3A 1RUD1 2HWE2 1JU4A 5FO7B 1V6LA 5H9PA 2ATFA 3ZDVA 4DZGA 1F4AA 4GB33 1SPPB 4YW2A 4M01A 2OQ6A 4Q1PA 1YJKA 1PVXA 4AEDC 4OZOA 5JOZA 3NAPB 1LEDA 2YGMA 4K1YA 4XILA 1PMJX 3PU8A 3WSOA 3WDUA 4XW3A 5JI7A 1W2AX 4WZFA 5T50A 3SISA 2VCMA 3SH4A 3MF9A 3ACHA 1RUG2 4Y5TA 4KGGA 5EJZB 3OCPA 1XOYA 2W3JA 4XURA 5A3LA 1OLME 1N1YA 1UW8A 5FZGA 5T52A 4BJ0A 4E9KA 1CZTA 1ZZ7A 3MEPA 3M8LA 1CVNA 2E51A 3KV9A 4XACA 5EIYB 3C7HA 1LOFA 3LQCA 4DXTA 4XQWA 3W5MA 4I09A 1AR63 3NNJA 5JMCA 3SCHA 4Q1RA 2GNTA 3ATGA 4UW6A 4D94A 2L9LA 1H30A 2MNGA 4WM8C 1JZ3A 3AMPA 4B8EA 3B9CA 5APAA 3VZKA 4Y1UA 2VTXJ 3RZMA 2W47A 4MX3A 2VVDA 4A7KA 1CQ9A 4LBQD 3VKLA 1A6CA 2XLAA 5FZEA 2F6BA 4XYXA 4ET7A 1XYNA 5A3UA 4FVVA 2YV8A 1D4VB 1ULFA 4E4ZA 2BWCA 1CIWA 1RVF1 1UY4A 2D3SA 2G9ZA 4NHLA 4ISQA 4PJYA 1DQ1A 3ZFFA 2JG8B 2WS91 3HNMA 1Q8QA 2C26A 4QGMA 1JXNA 1NY71 1CAUB 2OIIA 2VUDA 1OF3A 2BU9A 4IE4A 4QDSA 4XBQA 1BEV3 4RYDA 5H9QA 3VHNA 3WG2A 2ZGTA 4SBVA 1W6NB 1XB9A 2E53A 2JDYA 3WLUA 3V0BA 2YZ4A 3N9PA 3U37A 2DTYA 2AGSA 2IXCA 3H3LA 3OB8A 2VOWA 1ZA4A 1QXJA 2DTWA 4JZRA 1M4WA 1NAEA 1OF4A 3TOJA 2VC9A 3W9AA 3LA2A 5FZAA 1VAMA 3J8F2 3ZO0B 1DGWA 5JZGC 5FLIA 4HSLA 1WWYA 3FHIB 1H2KA 1O4YA 1VLNA 2DV9A 3BI3A 2A71A 1BBT1 5A33B 1AJKA 1W9SA 2JG9A 3TNQA 4A2UA 4HN0A 3Q8CA 4LBQA 2O8OA 4MGSA 3RGBA 3ZKYA 2UY8A 2V72A 1GFF2 4GKYA 2H0VA 1VMFA 4KMQA 4FFGA 3VUOA 2WZ8A 1FI2A 3PIGA 5F3IA 3THPA 4HONA 4K9SA 1KFXL 4DXRA 1O6UA 2JKBA 1AL23 1UMHA 2RMU2 5JMOA 3RZKA 4M3CF 1QNWA 2ARXA 4D8MA 4Q0SA 1HXS1 1RXFA 2AUYA 2ZX4A 4W8JA 3ZXAC 5DPNA 5J09A 4GMP0 4CDUA 1ND3B 1RB8G 1TMF1 5JR7B 1GMMA 1CAXB 1SLCA 2W1UA 3JB4C 3Q8FA 4NROA 4JGZA 3PTYA 1EAH3 2YROA 1J1TA 4HFSA 2TEPA 2GNDA 3K3OA 4N7UA 4OQ8A 1OQ1A 3CEWA 3AXEA 4XFGA 2F17A 4YRDA 2DCKA 4A3XA 5IJRA 1NXD1 4HPKB 4V1PA 5IK4A 4QQOA 2V09A 2XL7A 4OUMA 2C0ZA 2FDJA 1R091 2WQ4A 4AQTA 5BNPB 1JYIA 3RWNA 3IPVB 1RMU1 5JZGB 1I1EA 3S5AA 1FOD2 1W9YA 4JDNA 2XL9A 3MLKA 3VBFA 3UETA 4XIKA 1PGW2 4RS5B 4XDOA 3ZYRA 1T6BX 1Q8VA 3MFCA 3QACA 4UYBA 4E8DA 1GOGA 3BGAA 1DYOA 2TNFA 4NHXA 4DMIA 5AFEA 4XUOA 1RUJ3 2YYOA 1GR3A 4EROA 2C24A 4AVCA 2J1AA 5CZKA 4RGKA 2BQPA 3AMNA 3ZXKA 3ZLIA 1W6QA 4JC1A 4XUNA 4IGPA 4I3GA 1W05A 1LOFC 3BYWA 3USUA 3EMRA 4L99A 1VBC1 5ABJB 1AR91 5FY8A 1QJZA 3N7KA 4PT6A 4UFIA 5FPLA 1KXGA 3DYOA 3PLQA 4UW4A 3RZHA 4M4RA 3RMXA 1JOPA 4E2QA 2WRAA 3NQHA 5FK7A 4IE0A 4ZZ5A 2WSUA 4MXVA 4AFCA 4YZ4A 3APBA 1F5FA 3PMEA 3ZVXA 3POEA 1V6KA 2ZTNA 2X05A 2KD7A 3NV2A 1HRV2 2BOJA 5FZ4A 5FZOA 4AF9A 5KC6A 5GLTA 2B45X 1LGBA 4CU8A 2VZSA 4XFBA 3VBSC 3RMYA 1D0GA 5I91A 4OLLA 1CAVA 5D8AB 3UJOA 1ULGA 3IDAA 2WL1A 4AZZA 4LO4B 3ZFFC 4FTSA 4NIDA 3ROUA 3ZFEA 1E5HA 2VZ3A 3AJYA 1UMZA 5FWJA 1WBLA 2C6SA 3IZOA 1A3KA 3IKWA 4UFMA 2ZGSA 2MHFA 1R082 4A7YA 1C1FA 2LS6A 3MHZA 4YNIA 5IK5A 2FDFA 4AGRA 1IS4A 5DMYA 2ZAHA 3OEAA 4Y5Z0 5LBCA 1PIV1 1ZBA2 3WP3A 1VBD2 2VW2A 1GBGA 3OGVA 4XFHA 1LJ7A 4IQPA 4QX8A 2WINB 4YW1A 5JSRA 2RDRA 4LOTA 2VQUA 5L7OB 3RZJA 1GQHA 4Q4X3 2IFRA 2C9KA 1RJ7A 4M4PA 2JG9C 4JHTA 4XXAA 1NYWA 1UZ0A 3UJQA 4JRAA 4P9LA 2WJSA 3KD4A 1ONAA 4LO5B 3N9NA 1S0DA 2A7AA 2P34A 2ENRA 4Q2FA 1MS1A 3VL8A 3P3PA 1MZEA 4DO0A 1LU1A 3D0JA 2V5YA 2QKDA 4CCDA 4HK9A 5FPAA 1UXXX 1KJLA 3VHPA 1O3RA 1RITA 1XC6A 5FZ9A 4CDUC 2QQMA 1MZ6A 2VUAA 3JD71 4DUVA 4LBOA 5L9VA 5DAPA 2FZ2A 3LSDA 4JGZC 3RSJA 4UFHA 3N9QA 4N90A 5FPXA 3MYXA 3M3IA 4Y1YA 3I49A 3VB9A 3LF7A 1RUD3 2ZHKA 4YW7A 2W0XA 5A7NA 3DYPA 3HPNA 3GNEA 4KWJA 3U14A 4CP9B 1JS9A 1MS3A 4J1WA 5GLWA 1FPN1 5EQUA 1W0NA 3ETQA 1O59A 2DCJA 2NMNA 3IT8A 1KJRA 4FI9A 5K4LA 4P9XA 5BY5A 4Y5SA 3NKGA 2O8QA 2VOVA 3IDEA 3WR0A 1H1IA 4AI0A 1ST8A 2DCTA 3GALA 3MIDA 5FZIA 1F4HA 3T09A 3VBRC 4RN5A 2WNUA 4RSUA 4W65A 4K7JA 3JUUA 3VBFC 5I8YA 3BPZA 4Z2WA 1COV1 3G7DA 4LBKA 4NRMA 3WNMA 3QBQA 3OUIA 5FYVA 4CCMA 2ZX1A 2JDUA 4YARA 1TEIA 3ZKUA 4XEZA 2OS2A 1LESA 2GMPA 1H4HA 2QQOA 2R16A 5F6KA 4QPIB 2WSVA 3ZSEA 4GD4A 3WINE 3J7MA 3UL2A 5A7WA 1JODA 5FZHA 4W6YA 3VBRB 5BYNA 2BERA 4CCEA 3P5BA 3PHMA 2FMDA 1XE7A 4W4ZA 1DZRA 4FPYA 3NKTA 4XMAA 2A5ZA 4QPWA 3SCGA 1WLTA 2HWD2 4ZXKA 2XXZA 3O1PA 4QHOA 3VDBA 5IK8A 5SV8A 3HBZA 4MHUA 1PO22 1SLLA 1ZRDA 1G9BA 1FV2A 3RI8A 3S30A 5JVVA 4A6SA 1SBEA 3IB3A 2PHLA 1DDLA 4MSVA 2EIEA 4BXFA 4FTBA 1APNA 1W8UA 4K21A 2ZGOA 2WWJA 5FCCA 1VRH3 4CU6A 4QM9A 4IV3B 4P08A 2WWSA 2YHJA 3EBRA 1YFYA 2D3RA 4Q8KA 2WS93 4YM0A 5DN2A 3T0AA 3K51A 1ZRRA 4OI0A 5F5QA 3ZFEC 1LU2A 3N3HA 3PURA 4XF0A 3RFRA 3T3YA 3BUCA 3H1YA 2R042 3PNAA 5FFOC 3AKPA 5HCHA 1EV11 3I2KA 1E5SA 2V4AA 3FWEA 4EWEA 1RUNA 2RR12 5L9BA 1O4ZA 2VZQA 3C7OA 4NIGA 1W39A 1YO8A 1JHNA 2B8MA 5JCTA 4JV4A 4RFRB 1H6YA 3POJA 3OJBA 5F37A 1QH6A 4UW5A 4LTAA 5GLUA 1HQNA 4SLIA 1W3XA 5FXXA 4FCAA 1KD7A 5K7PA 3O0VA 1W90A 1WD4A 1DGWX 2W5FA 1BBT3 4JCKA 1GLHA 2OPWA 2WKKA 4QM8A 1CPMA 3VKOA 2SBAA 2OXBA 1PGSA 1ULOA 1SCSA 3USSA 1W06A 2DCYA 3NV1A 1W2NA 1GYKA 3OPTA 1EY2A 2Z69A 3DXTA 1X36A 1B35A 3OEBA 5FOBB 1K42A 3T08A 1XE8A 2I45A 4L92A 1QH7A 2Z79A 1HXS3 4BE3A 2VG9A 1TMF3 1JYTA 4JAAA 2GMMA 4M3CA 1E5IA 5CFCB 4AVVA 4G9SB 4BQ5A 4YGDA 1JYNA 1AHSA 1JI6A 1S2BA 1QQP1 3WW1A 3T0DA 3N9LA 1OQDA 4QQHA 2RDQA 3RRDA 5AC92 1L7QA 2KA3A 2X09A 2GH8A 3ZYHA 3VZLA 1R093 2ZZQA 3POBA 3CF6E 1OPOA 3HT1A 2DFBA 2JE7A 4CUGA 1OHFA 1POQA 2NPIA 3WV6A 5DAVA 1RUC1 2IXJA 3WG1A 4ZS3A 3OYWA 3VBUA 2WNUC 1MQTA 5ANQA 3T2OA 4QB2A 5L9RA 3LPFA 4Q4W1 3LEIA 3VKMA 2ORZA 2R0FA 4ZKTB 1RUE1 1ULPA 4Z82A 4P14A 4GB31 3WY6A 4NOTA 1DQ2A 1Q8OA 2MEV1 1HKDA 4CSWA 5JSOA 1GP5A 4XFAA 1X8MA 4P9IA 4NMIA 3AB0A 3PVBB 1DQ4A 1RUH1 5FLJA 3T30A 1FMD1 3CHXA 4PCRA 4XFCA 3WDYA 2AEYA 1AR93 3W5NA 1A8DA 1PO12 3O0WA 4AE2A 1W28A 1V6NA 2CSGA 1W6PA 1YI9A 1Q3EA 2HWC2 2BOIA 1JZ2A 4QWNA 1PVC1 2EALA 3OG2A 4YVSA 2D6KA 1H6XA 4K40A 3SMHA 4XETA 1KDKA 1LOBA 4JQTA 2QE3A 2RS32 2K2SA 3NV4A 4OI2A 1OFSA 1PNFA 1BKZA 3CO2A 4AR2A 2XG3A 5IVEA 2QNKA 3O5SA 5LA1A 4M0NA 2OT7A 4CCNA 2W08A 4LBJA 2DURA 4IDZA 4NHMA 5A7OA 5K9YA 3OD4A 3M2MA 1REFA 5C9AB 4CU9A 3ILRA 1QXPA 1QJU2 2ERFA 2WT2A 3AKTA 1XU1A 2JX9A 1DQ0A 1YCIA 2BVVA 3FLPA 4M3CE 4LLFA 5KR7A 4EQVA 1ENRA 3FN9A 5FYSA 3KHBA 3CJIA 3LAGA 1NOVA 3MDPA 4TN7A 4D0QA 2BJSA 3H0OA 3NJVA 5J36A 2XLFA 4NAMA 2QQKA 3I2GA 4CEYA 1N1VA 3CZJA 4AG4A 1KDMA 2RM23 3KV6A 5FZFA 2QQJA 1S55A 2DU1A 1PIV3 4KGQA 4UFJA 2HYKA 5DUVA 2OVUA 1SLTA 3TYJA 1ZBE1 1WZXA 4AFAA 2VZRA 3W58A 5JDBA 3RNSA 2QTWB 3TWIA 2O1QA 2W91A 3KMHA 3MW4A 3VGIA 5C4WC 4FSJA 1PGL1 3W21A 3ZIXA 4YFWA 1RINA 4AYUA 2AC1A 1LHVA 3OBAA 3RZLA 1BEV1 3ME2A 4LBNA 4AK3A 3LOBA 3ZM8A 1GANA 1NLRA 2A6XA 4E4HA 2BPA2 1GQGA 4FPJA 1GZTA 3LA3A 4UBGA 1WLCA 3M3OA 1NE4A 4D3WA 3V0BB 1B35C 2FDIA 4EZ4A 2O14A 2ZGKA 3BTAA 4BQYA 1QY4A 1SEFA 2ZHMA 3OOXA 2R071 3I3BA 3JD73 3B00A 3WF2A 5CKNA 2EF6A 5B4XA 1AYN1 4ASMB 4FPCA 4CDWB 4TXWA 4BDVB 4RR3A 1W3VA 3O1MA 3SC7X 4ARXA 3ELNA 2JG9B 1AJOA 1S0CA 4ZZ8A 4E8CA 1FPN3 3POYA 4IESA 4LBQB 1U5XA 5T55A 3WNPA 5IT6A 4N8MA 1IOAA 4IE5A 2XJQA 3K4ZA 2JECA 4PHZA 1UO9A 4XUTA 5JR2A 2VXRA 4Y20A 3VBUC 3WCSA 5FZMA 4Z07A 4JKKA 3HN3A 1UZYA 4IEOA 1YNAA 4O9EA 4RD7A 2CYFA 2F4LA 1WUVA 2OA2A 2JIJA 2PHWA 2VCCA 1EAH1 4IEXA 3IM0A 3VLBB 1AXYA 4Y26A 2CL2A 3MBWA 4YG3A 4R4ZA 4YM2A 5C7GA 2RS11 3T2QA 2J1RA 3UV9A 1RUI2 1U5IA 2VD7A 4UWDA 5FKBA 2XJTA 1D0HA 3POIA 5CYYA 1HRI1 4OHWA 2LW8A 4Q4Y2 5JIAA 3U1XA 1Y9QA 4C0HA 3VBOA 5IFTA 4JHZA 4QQ2A 4BXSV 2A1XA 3B7MA 5GLZA 2ORXA 2CGNA 1AUYA 1FXZA 4YVSC 3ZYJB 1O8SA 1VMHA 4W50A 5M0TA 4HXCA 5F5IA 1UNBA 4ATEA 4CDXA 4BU2A 3VBFB 5DZFA 3WQ0A 2ZXQA 4N7IA 1QMJA 1IPJA 2FDHA 2P17A 3KWVA 4MG2A 1WBFA 4WM7B 3WX5A 3UNPA 3AP5A 4BMBA 1DP0A 4FQ4A 2B39A 2HLEA 4F3JA 3UKVA 4LIVA 3D0SA 1C1LA 3LDKA 4UXAA 1FAYA 1BMV1 4Y1VA 5EYYA 3PU3A 1W6QB 4CCKA 1LODA 1V0AA 1V6JA 2OZJA 3O1UA 3JBG2 4XJ8A 3USUB 2OUJA 3WF4A 2Q4SA 3T4HB 4XF3A 1K3IA 4YGCA 4QX2A 2HWF2 3CJIC 4NVPA 4W6WA 2A70A 4FOVA 4YPJA 2VZVA 1EV13 3S57A 4CXYA 3S7EA 1HB1A 5FP3A 5FY7A 3WNOA 2FZ1A 5A6ZA 1LGNA 4HVOA 2X53S 3BTYA 2QZ3A 2RDNA 3FMGA 5F2SA 2Z2SB 1JZ4A 2LM3A 1H2MA 3O7OA 4IE6A 4TSVA 5FZOB 1OH4A 3WXPA 2WQ8A 4JKMA 5JXHA 2ZCWA 3IDCB 3URFA 5GZCA 3L2HA 5C5UA 1CAVB 1ALYA 3R6SA 2XBO2 4HZFA 2P5BA 2E33A 3NSTA 2Q1ZB 3H50A 2DVGA 4QHBA 4HK8A 5FJHA 2WNVB 1OLMA 4B4QA 2XPJA 3AYCA 5EJ3A 3N9MA 2PFWA 5J1XA 5A7SA 4FXKB 4NPMA 4RQPC 1ZRCA 1XXNA 4Q29A 2W92A 2AEZA 4K8FA 4P02B 1DGRN 1H9WA 1RXGA 1SLIA 1XNDA 4OFGA 2ZEZA 3ORJA 4CP1A 4Q4V1 3EHKA 2ADEA 3HD8B 4HANA 1J84A 1TQ5A 2BGPA 2DF7A 5CADA 5I93A 2J22A 2XJSA 3O14A 3H3ZA 4I0AA 1W2TA 1HV1A 4LPLA 3VZJA 1LCLA 3ZX7A 3RVHA 2D44A 5C3RA 4RR3C 1Z7S1 1QQP3 3LEGA 3BN6A 2DVBA 2XLGA 1GNYA 2BW8A 2EXHA 1BZWA 2JKXA 3S7IA 3SNMA 3ZR5A 1HB4A 2WZR1 3GGLA 3SEEA 4LIUA 4IERA 5D21A 1C8M1 3ETPA 5KWRA 3NWKA 4PQ9A 3FBYA 3NV3A 1QWRA 4QMAA 1MZ5A 1HRV1 2P3IA 4MUVA 1G7YA 1AR62 5FZ0A 2XGXA 1CZVA 1OA4A 1YEWA 2YBSA 4Q4W3 3TRSB 4XIOA 3VL9A 1RUE3 1LTEA 3ZDSA 2JDAA 3ZYFA 2J1VA 2MEV3 4AW7A 5FYCA 4CEWA 1H9PA 1BQPA 4OHZA 3RDIA 3D8CA 2ZGQA 4B4RA 1CONA 3H7YA 4BMEA 4TTGA 1O5UA 1RUH3 3RG0A 1FMD3 4XFFA 1GNHA 1YYNA 2R7EB 2GC0A 3BPSA 3NNMA 4YG0A 4QHZA 3VBOC 5BNNA 3HMYA 2BZDA 1ND2A 3KT4A 1U0AA 3M3CA 3MLJA 4CZSA 5FYYA 2B5HA 2BBVA 1LENA 4IGQA 1PVC3 4KBBA 3VZMA 4IV1A 3N4MA 1OI6A 3L2YA 2YC4A 5SV5A 1RTVA 2WNUB 2Y6KA 4X6QB 4CDXC 5A6YA 1VBD1 5E88A 4BK5A 1GICA 2JENA 4H55A 5BNOB 3NJZA 2BTVC 4ONUA 4R9AA 3ZSKA 5JSPA 4J1XA 3TAYA 3BKZA 1OUSA 2FBEA 2ZEXA 3KCCA 4XZPA 2WABA 4OZXA 2OPKA 2XVKA 2UWBA 1J3PA 1UKGA 2BGOA 2P6CA 3I4IA 3J7NA 3MV11 2UYAA 4ASKA 4BYYA 1O4TA 4X8PA 4KL1A 1GSLA 3AZVA 3CZUA 4HKLA 4XDQA 4TLGA 4AAPA 3RI9A 3FLTA 1RHI1 4L97A 5JOXA 3KF5A 4AI8A 1CZSA 4IEZA 2VUJA 3FFQA 4NE9A 2OX0A 5DZEA 1QXRA 3AMHA 2VMEA 4YYOA 1PM7A 1MZFA 3BU7A 3G6JB 4OUEA 5CIRA 2D98A 1YXWA 3FBMA 3VBSA 1W04A 1ZBE3 1VRH1 2WT1A 2RDSA 2IWGB 1VPHA 1ZZ9A 1MS8A 5EP9A 3VKFC 3Q9OA 2HWE3 3A7QA 5EPAA 5FP4A 1AL22 3KB5A 5IK7A 1LHNA 1RYYA 4U2AA 5A6XA 2CAUA 2HH9A 2LUWA 3C7EA 4O61A 4BQWA 4Q8LA 4Q0PA 1OUXA 1K5MA 2Q0AA 3KHCA 3LCPA 1ULDA 4GH4A 4RHV1 4MVTA 3WQ7A 1G8WA 1W2UA 5G04L 3H8OA 2JD9A 4QKNA 4XC9A 1RUG3 4I01A 1BXHA 3KVAA 3M3QA 4PI0A 5EJ1B 3ZSLA 4MLOA 5T5OA 3ZXDA 2P3KA 2WC2A 1H0BA 1UZWA 2R073 4GALA 1UYYA 1AYN3 1YI7A 1VBA1 5FR3A 4XTPA 4NN0A 4MGKE 4DB5A 4AHXA 2B9UA 5F3EA 1S0BA 1BVVA 3CIHA 3LPGA 4P9JA 1ZZ6A 4N43B 1G9FA 3HNBM 4CDQA 1V6OA 3ZR6A 1W9TA 3CQOA 5IYYA 3ZFGA 1ZZCA 3WDWA 2IFWA 1RUJ2 4Q0UA 5FMOS 2KM2A 5JAXA 1WCSA 1UOFA 3FUQA 3KGLA 1B35B 5LEJA 4AWDA 2PXJA 1W6OA 3LIHA 3PVNA 5EXOA 3GHNA 3DL3A 1SZBA 1ULCA 4A3ZA 1C5IA 5FZLA 3AFGA 1UQXA 1YWKA 2RS13 3DCQA 3MFAA 5F32A 2EIGA 2W68A 4DOUA 1UWWA 3WP5A 4CEWC 5J48A 1WMDA 3MIHA 4NHKA 1HRI3 1X33A 5DDJ1 1AR71 5T5JA 2QQNA 4YWAA 3B3QE 2WFPA 3WDVA 5HBAA 4LBLA 5T54A 5BNNC 2ZKNA 1ND2C 1ZVFA 2EXJA 3CDZB 3MPBA 3VBRA 4ZU7A 2WT0A 3N35A 4CPBA 1M06G 4NIHA 1I9RA 1HQWA 1KEXA 5D2AA 2XWJB 2ZX0A 3H8XA 4IV1C 3AZZA 5JWPA 3KQ4B 2WFF1 1G6NA 1VE0A 4I3PA 4Y22A 4B4PA 3OYWB 3VBUB 4FP2A 2R32A 1MQTB 1NUKA 3VBHB 3GYDA 4YVWC 2W39A 2VBDA 4L2NA 3ACIA 2PAKA 2W94A 1DIWA 5E8AA 4OQ9A 1ZM1A 4FO9A 2YU1A 3K48A 4LKFA 2VOTA 5FZ8A 4BK4A 1S2EA 2Y33A 4GKXA 4IEVA 5E16A 4DXSA 3J7HA 1VAVA 2VZ1A 3IIAA 4MGYE 4QKFA 1QJEA 4UW3A 1X82A 3AZWA 2E6VA 3W59A 3E1F1 3NNFA 2LRPA 5CFDA 2E63A 3ILFA 4MO3M 5EHDA 4Y4RA 1W6PB 1OA3A 4YGBA 5I8TA 2RMU3 5J7MA 1O91A 1HJFA 1UOGA 1A8MA 1ZRIA 3H1WA 5DAQA 3U10A 2EIBA 4XHXA 4K20A 5A32A 4JGYA 4ZXEA 2X5IB 4OYUA 2YBPA 1JZ5A 3AKQA 2IUWA 4HT1T 2D6LX 2Y26A 1IPSA 4OMDA 2YBKA 3ZMNA 1BK0A 5K0UB 2JDPA 2VW1A 4RA0A 5J37A 3HQRA 5FZ6A 3I97A 4QX1A 5T5LA 1S0JA 2PAMA 1K5MC 4EN6B 2CHHA 1LECA 2OW4A 1DYPA 4GA9A 1ASJ1 1W8FA 4GH4C 3CJIB 1YQ8A 2RM21 3GXUA 1EP0A 4TWTA 2Y6HA 1D4M1 1RUD2 4HKOA 3T0BA 4CEYB 2FD8A 3ZN5A 3RYPA 4PLOA 4X6RB 4Q4V3 5CA6A 3AFKA 4YZ1A 5KXEA 3E6CC 3VHOA 2CY6A 1GZ9A 5FYTA
chains in the Genus database with same CATH topology
2DFCA 5JPMB 1Q43A 3M3EA 1OD5A 2AREA 2IXHA 3BODA 1Z7S3 1PO11 2B7YA 4CDQC 3MGUA 2WZR3 4C90A 2X29A 2ZGPA 2HWC1 4Y24A 1C8M3 3I59A 3ZFGC 4CRQA 3H7JA 1QKQA 1LR5A 5CAZA 5TSWA 1HRV3 2EAAA 2HWB1 3ZN6A 1WGPA 1DU3D 1VAKA 3JQXA 1PHMA 5L73A 1POV1 3ZMOA 4ZU4A 5GALA 4BHPA 3AP4A 4RR3B 1QJU1 3ZXEA 4FPHA 3VZOA 1LHWA 5FAXA 5H9RA 1NCQA 2D6NA 2PA7A 4LA2A 2Y0IA 4S2FA 4XF9A 1F9KA 3B5LB 1R083 4EN9B 3J9SA 1JN2P 2BEOA 1UX6A 3SXWA 1RVF2 2K0GA 4Y20B 4TZDA 2DVFA 1VBD3 3KZ4C 1NY72 3VZNA 1VBB2 4JTNA 4Z8BA 2W52A 1LRHA 2D40A 1MEC1 4AEDB 3QCWA 3VV1A 1OLQA 5CU1A 4WVMA 1G86A 2IXLA 4AGVA 1LHOA 4QX5A 5CFDC 1RHI3 4JTOA 1IS3A 1W6MA 4YLZA 2OZ6A 4LNVA 1D2QA 2WLPA 1RUF1 1UAIA 2HJIA 2UWCA 4ASLA 2A75A 1NCRA 2VY0A 5KHGA 2YXSA 5AVPA 3IBMA 3ECQA 4CDXB 4META 5T5PA 2CGPA 2VULA 4JGYC 1GZWA 2Q5TA 4HL0A 3MW2A 5BUVA 1R1A1 2PHUA 2RS51 1H1MA 4IEUA 3BOPA 4MYEA 1UCXA 2VVEA 2VECA 3FC0A 1V9U1 1AX0A 1HXS2 4M00A 4TLFA 4WM8B 1TMF2 4DINB 2DUQA 3IMNA 5KBFA 1TME1 4FPEA 2F4PA 4RHV3 2D5HA 3WP4A 5IUQA 4RGAA 1VR3A 1N3PA 1PMIA 1ZZBA 5HCFA 1ZYBA 4JQRA 4WBBA 5C4WA 1W6NA 4YM1A 4YW5A 1UPIA 1VBA3 1O7FA 1JH5A 3EXUA 2WA3A 1RMU2 1IHMA 1MS9A 1DHKB 4GWMA 2VQAA 1V6IA 1C28A 1JUHA 3QH7A 4Q26A 1SCRA 4NO4A 2A6WA 4INDA 4ITCA 2BNOA 5JI9A 3FX3A 1PZ9A 1RJ8A 1QOTA 3FUOA 4P5HA 1C4RA 3R05A 5LK5A 4LBMA 4DS0A 5HCAA 1YUDA 1VBC2 5J96B 1AR92 2VGDA 1KRIA 3O12A 2RE9A 3SITA 4BLJA 3M1HA 3O0XA 3SH3A 5DDJ3 1AR73 3JBG1 4YZ2A 4EJRA 3ZXJA 4G4FA 5FTTC 5I0TA 2GN7A 4FOWA 4C1XA 4LE4A 1NCQC 3AMMA 2R043 1IGOA 3J26N 1H2NA 2CV6A 3MIFA 5J98B 1D2SA 5KXDA 2RR13 3LB9A 2WFF3 1Q8SA 4ES8A 1AYM1 4I2OA 4BA6A 1PK6A 4PLMA 4HETA 3JZVA 5BNPA 4OHXA 4DPNA 2UWAA 4CEWB 2GSYA 2XBO1 5JPNB 3HQXA 4BZ4A 1BK1A 1AXZA 5A3MA 1QDCA 2BVBA 2B46X 1PIV2 1DF0A 2A6VA 5BNNB 4AEMA 1ND2B 1TNRA 4COZA 1QJX2 4P9WA 5L36A 4GWNA 3LA7A 4QPGA 2PLV1 4IV1B 2ES3A 1UU4A 1NCRC 4HLTA 4KG8A 4L9BA 1GV9A 3WHTA 3BB6A 4Z1VA 2GNBA 1H1AA 4BIFA 1BCXA 2GH2A 5LRRA 1QJY1 3ALQA 3SCFA 3PJYA 2VQ0A 4WZCA 2EA7A 1IPKA 2RJLA 3TN91 2DUOA 3JD72 3ZPYA 1ASJ3 1EPZA 1SFNA 5AVAA 4XJWA 4K6BA 3TBDA 1D4M3 3AK0A 3EQEA 1VIWB 2JJ6A 2NYYA 4AEKA 4IEYA 1CAWA 2ET1A 3DPRA 1FX5A 1FPN2 4MGZE 2D5FA 2HWE1 3VBSB 5DUWA 3M4FA 2R062 4XFIA 1H8TA 1DQ6A 3AZYA 3THTA 3IN9A 4XJAA 3ZFFB 1ZRFA 1RC6A 1VB4A 1PO13 2ZPXA 1COV2 4KG0A 4CP0A 4RQPA 4DRVA 1K5MB 1S2KA 2HWC3 1RUG1 2XHKA 4GH4B 3ILNA 4WVWA 2HEVF 4AI1A 4LHLA 1DYKA 1UPSA 2JD4A 3V56A 4B7KA 2HWB3 4PIXA 3I8TA 2PHTA 1CJDA 1XU2A 4HMZA 1Q8PA 2K9ZA 1YLLA 1POV3 1LOAA 2D97A 3MIGA 4JRLA 1VB2A 1SMVA 3NW4A 1NQDA 1XRUA 1QJU3 5F9TA 4BQ1A 1UU5A 4HBNA 2RJKA 4GXLA 4CDQB 1KITA 2ZGMA 2A3YA 3OY8A 3ZFGB 4COVA 1DZQA 2AR6A 4CDUB 4JGZB 1PK6C 1W6OB 2VU9A 5B2GB 1JW6A 2TBVA 4LO8A 5BNPC 5J3UA 3KM5A 5DUXA 1YFXA 3BIWE 4AGGA 3MW3A 2FHRA 1EV12 1MEC3 5ACA2 5HI0A 1HIXA 1SLAA 4RS5C 1YFWA 5HCBA 4Q0QA 1J58A 2AH2A 4COWA 2RHPA 2ZGLA 3HIFA 1VBE2 3ACLA 3DN7A 3OD0A 3RJRA 4XMIA 3VBRB 1GZCA 4JDMA 4QPGC 1RUF3 2N7GA 3AP9A 5JIUA 4Q0VA 1UF2C 4OUSA 1Q56A 1UIJA 4Y22B 3J8F1 5GZGA 4D69A 4E2GA 3CLPA 3KCXA 4ISRA 4BCUA 1UD1A 1REEA 3ASIA 1R1A3 4PBOA 4Y1XA 3TB0A 2ZACA 4P9YA 1LB2A 2RS53 1AR82 2C5DA 2VOKA 1MACA 1N1SA 3FZ3A 4J6GA 1R1ZA 1V9U3 3JU9A 1Z0HA 2RMU1 5CFDB 2GDFA 1TME3 3AKRA 3WP6A 3N7JA 5KHJA 3PMSA 4IV3A 3GZAA 2ZBJA 1OFNA 1NG0A 1G9AA 2JDZA 3AJZA 1OOPA 1QQP2 3DPRC 3NL1A 1SBFA 5A32B 4JGYB 1CJPA 2GALA 1HDKA 4OI4A 2GAUA 3B94A 4KU8A 5E89A 1H8TC 4DXZA 3DF0A 4Q4Y3 2QQPA 1RUC2 3D4KA 3QLQA 5CBLA 5I0SA 2QVSB 2PHRA 3ZFEB 4AFMA 4COYA 2BYVE 3RZZA 2ZX2A 1WLDA 3WOGA 4LUMA 4Q4W2 5KHHA 1FOD1 2DUPA 1X50A 3MPPG 1PGW1 1RUE2 2ZX3A 4GB32 4DRRA 1LOEA 2MEV2 1SBDA 1UKRA 1S0GA 3D82A 2DYCA 3AM2A 3E97A 1FNYA 1FMD2 4FBFA 1LEMA 5DG2A 1XNCA 1QDOA 1H2LA 4K3UA 4YW4A 4XF1A 1GKBA 2CWSA 2BUKA 4EN8B 4B3NA 1EPWA 1ZNPA 5EWSA 1IS5A 3U11A 3N7LA 4BIOA 3JBG3 4FOQA 2QDRA 3UK9A 1F31A 1MVQA 4OI1A 3FLRA 5C8WA 2HWF3 5CFCA 1WW7A 3I59B 3INAA 4H14A 3HWJA 3JQWA 3EO6A 2VNGA 1ENSA 3NO8A 4JVAA 1AYM3 4FPFA 3H9AA 4H3WA 2TUNA 3ZN6B 1S0EA 1JUIA 4KQ7A 3WUCA 2O0OA 3MICA 3BCWA 2AENA 4YG6A 2H0BA 2YPJA 4COUA 4FPGA 4XPVA 3B93A 2XBO3 4C1WA 4QGLA 4WVVA 1JYCA 1MR5A 2HKXA 1R081 1U5ZA 4LHKA 4NR1A 1ZBE2 4EWDA 4EN0A 2A3XA 1ZBA1 2PLV3 4YVWA 1JOJA 1T6GC 4KH9A 1PGL2 1I5ZA 4MGIE 4FT8A 2DU0A 2IXKA 4GMP1 5FMOL 5GZEA 5K8SA 1BEV2 1DGLA 1QOOA 4E4SA 3POWA 1NQJA 2D3PA 5FLHA 1F8VA 4BM8A 1XYPA 1QJY3 2Z42A 4KWKA 3C2UA 2NLRA 3KGZA 4D7TA 3S6PA 2VH9A 3DGTA 4XQ4A 1LKNA 4WVMB 1HV0A 3TN93 2A6YA 2R072 2LTNA 3BOWA 5F1RA 1AYN2 1Q5OA 4MH0E 3RYRA 2OUHA 2QZ2A 1W6MB 2ZS6B 3VDDA 4IV3C 3NVCA 5C9AA 4NPRA 1NCRB 2GC2A 1OOPC 3ZYIB 3L9JT 2ZABA 1YRZA 2D6PA 1GZWB 2XUMA 4LHNA 3AXDA 3MZHA 1X8EA 1UL9A 3KQRA 1W0PA 4G3YC 2NP0A 2R1BA 1OQEA 3AYDA 2OYZA 4XBNA 3RQ0A 3JB8A 3HT2A 1EAH2 4DY3A 3CNAA 3A4UA 4PDWA 4BOWA 1WW6A 2RS12 3RPQA 1IQAA 3M7AA 2NMOA 2XJVA 2XVLA 1HRI2 3KSCA 1AX2A 1BYHA 1CD3G 1QGLA 1SFYA 2XKOA 2NM1A 1VBB1 3WW3A 5C4WB 3LWCA 1WCDJ 4XF4A 4YFZA 2NZ9A 5HXVA 5DXDA 1ENXA 1WA4A 1RIRA 2Z5WA 2HWD1 4S2GA 1GNZA 1N3QA 5FOJB 1LOCA 1A78A 1S0FA 3J4UH 1PO21 4CDWA 5CFCC 2VNOA 4XJZA 4QGNA 1HLCA 3FFZA 1BMV2 4DY5A 4YZ5A 1FYUA 2MPFA 4O9GA 4TYSA 1G9CA 2D6MA 2BNMA 2UY9A 1DGRA 4M3CB 2G9FA 1YIPA 2ZGRA 3AKSA 4FP3A 1LHUA 2ZHNA 4I0WB 1VP6A 1AVBA 2Y0OA 4AFBA 4N9HA 4AVTA 2DWRA 1YFUA 4LLOA 2R041 4EWAA 1ZZ8A 5GJ6A 1URXA 3WW4A 1CR7A 4MXWA 2RR11 3SH5A 1V70A 3DV8A 1XNBA 4AI3A 2X8KA 3LOIA 1O5LA 2ZAAA 5C33A 4KWLA 4PLNA 4XTMA 4AFDA 3LZZA 3MLLA 4X8NA 1FNZA 3ZXLA 4AQ6A 4WV8A 1C5HA 3J8F3 3QOPA 2EXIA 1XQNA 3LKJA 5GKAC 3OGGA 4OULA 1PK6B 2FMYA 3A0NA 1NZCA 1Y43B 4AEJA 3OGJA 4L11A 2UURA 5FQ0A 4RFT0 2PAEA 4HVQA 5KXBA 2XB6C 4RGGA 1PNGA 1QNYA 2WIIB 4N53A 4OVEA 3H1MA 4Q4V2 2WLQA 4BWOA 4WM7A 4Q4X2 4YVSB 4R8HA 3V0AA 1Y3TA 3BALA 3VDDC 4QPGB 4DFSA 5C9AC 1AX1A 4R9CA 1Z7S2 2ILMA 3ZYPA 1DG6A 4PIYA 1WD3A 1AF9A 1OMIA 5BPXA 2WZR2 1REDA 3UKNA 5H9SA 1OSGA 1C8M2 4P9GA 5CNAA 3V64A 1CPNA 5AC91 1RL3A 1UZZA 2VMHA 3WVJA 3N36A 1ZRDA 2IZWA 2GZWA 3OTFA 3GBFA 4PDWC 1FOD3 4R52A 4R4XA 4C0BA 2JEMA 3WNXA 3SLIA 3C3VA 1LGCA 1QF3A 4LO7A 2A3WA 3LGRA 2JICA 4FOYA 2WNVA 1CAWB 3DPRB 1RGSA 4QQLA 4LUKA 1G9DA 2VMIA 3GZTB 5CG9A 4L8QA 1H8TB 1O3QA 4B29A 2XJUA 4FPOB 4YZ3A 2E9QA 1NA1A 3WZ1A 4K1ZA 2E7QA 4RQPB 1QJX1 1UU6A 2I07B 5FPZA 3WD5A 4CDWC 4E2SA 2RS31 3VKNA 4IXLA 2QDNA 1O3SA 2P2KA 2ZA9A 4XE9A 4F7ZA 3U07A 2G9GA 3DKWA 4E4DX 5C8CA 2DCZA 2AYHA 1RHI2 2CGOA 4LEJA 4BPZA 1ZX5A 4YGEA 3ST7A 2SLIA 1LULA 4FXGB 1Y7BA 4I02A 3KT1A 2YMZA 2EXKA 4S2HA 1VRH2 1MS4A 5C6CA 4BLIA 4QD2A 3OY8B 4EV0A 1ZBA3 2PHDA 4IL7A 2WS92 1IKQA 4XQDA 4GMP3 4GIQA 5EZWA 1W0OA 3NAPA 2R1DA 4RL7A 4YSFA 4IEPA 1N3OA 3MIBA 4R9BA 2R061 1QOSA 4RHV2 2XVGA 3VBOB 2VVFA 2R0HA 4QT6A 4N53C 5BNOA 2XH6A 4IEWA 4WM7C 3M70A 1F2NA 1VBA2 1BBT2 1DFQA 1N1TA 2IC1A 1N47A 4B7EA 1YHFA 5LK7B 3GHMA 4M0HA 4H7MA 3ZSJA 3WCRA 1SQ4A 4A7ZA 5BXXA 3HAGA 1TE1B 1C57A 2ZOEB 1FV3A 2VNRA 5GZFA 3ES1A 3IWZA 1PZ7A 4FAHA 2JE9A 4QPYA 1WLWA 2JG8A 3WW2A 2BGCA 3GZUC 1CAUA 2XJPA 3KT7A 1RVF3 5DDJ2 3H3UA 5CB7A 1AR72 1OOPB 2WNVC 3OBTA 4AQSA 4FPLA 5FO8B 1R092 1RUI1 3HR9A 4FAGA 1VBB3 2I74A 4ZU5A 1J59A 3D5OA 4ATFA 4Q4Y1 2LALA 2ETEA 1L3JA 3P3NA 5ACA1 2D43A 2WFF2 2EVXA 2Y38A 1NA1C 2HWD3 2XWBB 3X29B 1KQRA 4XJUA 1POV0 1VBE1 5A33A 1PO23 2Q8OA 2R30A 4LA3A 5FREA 4N43A 3R4SA 5KC5A 1B09A 3PVEA 4LE3A 3ZXGA 4U36A 2IXIA 3E6BA 3U0ZA 2XJRA 3T2TA 4URTA 2ET7A 5C8CC 4JDOA 1AR81 3VHRA 1ND3A 4QQPA 1CAXA 3R4UA 4AI2A 4XBLA 5FDBA 2HWF1 3WG3A 1HQLA 5LEKA 3ZYGA 4QU2A 1O3TA 2VMGA 3WT3A 2QJVA 4N9IA 3QH6A 1OPMA 3AP6A 2YDEA 3MI8A 4OHYA 4HPKA 2ARBA 4AVAA 1MVEA 4PIZA 3NAPC 2QCSB 5I8SA 2FQPA 1J1LA 1WMEA 3IPVA 5JZGA 4ORFA 5EV7A 4CTEA 4HN1A 4Y4YA 5DG1A 2GN3A 4LT5A 1ASJ2 4RS5A 1RMU3 2Q30A 2RM22 3AX4A 3WDTA 1BVP1 3AMQA 3FE5A 1YIFA 2YC0A 2KXLA 2GC1A 1D4M2 1MS0A 4PBPA 3VBHA 1E57A 1FT9A 3T1LA 2ZMKA 3OBRA 3OF1A 1C3HA 3OPZA 3ZXFA 5E1RA 5BNOC 1WMFA 2UU8A 1J3QA 3KLSA 3R0RA 3A0KA 5ABJA 4YVWB 2C9AA 2ZJCA 3ZSMA 2WNEA 4PF5A 4Y1ZA 2E7AA 1VBC3 2PHXA 1HX6A 4YM3A 2EAKA 3SHRA 4I30A 3GBGA 1UN1A 5EYXA 5L19A 1U5YA 4LR4A 5AC93 1FATA 3CJXA 2GU9A 2X5IA 2HWB2 3U4XA 3MF6A 3QD6A 3H8UA 4HKWA 5D8AA 4NWVA 2D6OX 2GC3A 2JG8C 1EYBA 1AR61 1KS4A 2ZZJA 5I0UA 3DUIA 3VDDB 2ZHLA 5K0UA 3VN4A 2GMEA 2E7TA 1WCKA 3ZN4A 1S1AA 4KNCA 3ENRA 5GLVA 1H4GA 3POSA 5JOYA 2D7FA 2CWMA 4AHYA 1CGPA 3PJQA 2ZMLA 4MV2A 3E5UA 3LSEA 5L7OA 1DZTA 4DNYA 3WHUA 1QJX3 3I2DA 1BJQA 5F6LB 4PDWB 3WDXA 2HEWF 4AXOA 2RS33 1OLRA 5EFUA 1KFUL 1MEC2 1TNFA 4H7LA 1J3RA 4N43C 3FJSA 1SACA 3E5XA 2CTVA 5LRSA 4AVSA 2UYBA 3D6EA 4R9DA 2V73A 2PQQA 4EN7B 1RUF2 1ND3C 3JCIA 1CX4A 1WW4A 1ENQA 2WQZC 3AP7A 3RS6A 1VJ2A 2YUEA 3AZXA 1R1A2 2D93A 4AQ2A 1NLSA 2RS52 3I7DA 1WW5A 1S0IA 2A6ZA 1V9U2 5JLVA 1I3HA 2GNMA 3B9IA 4W6XA 1JBCA 1IZ3A 4C91A 5JZGC 1AL21 1QHDA 2BWAA 3IDBB 1IKPA 2R063 1TME2 1PZ8A 5KXCA 1AXKA 2PTMA 5BV6A 4AHWA 2I2SA 5FRAA 5GZDA 3VBHC 1MQTC 2WA4A 1KS5A 3V65A 2C1FA 1COV3 1NXMA 4QPIA 1XYOA 3CL1A 4LO6B 4WVZA 3UKTA 4MXWB 2DVAA 3GF6A 3T1MA 1OA2A 5ABJC 4AEDA 4DQAA 4ES9A 4IETA 4XXPA 3RJ2X 2P3JA 1IS6A 2BFUL 1ULEA 5T3NA 1DQ5A 1JTZX 4XJ9A 1QU0A 2ZMNA 1XNKA 4KU7A 1LOGA 2H6BA 2P37A 3S0MA 5JOWA 5FQ0B 4IEQA 2YY1A 4FPKA 3AYEA 3ES4A 1OKQA 3E6DA 5I0RA 1RUJ1 2X5IC 4N53B 1HW5A 5FBZA 4OHVA 3B01A 5D8AC 1DLLA 4D7SA 1C8NA 3ZIWA 1CN1A 3V0AB 3I54A 5KHKA 3TNPB 2A73B 1VALA 5K0UC 1NE6A 5BNQA 3HN1A 4WM8A 3B02A 1RUI3 1UIKA 2PELA 5DZGA 3R4DB 2NQYA 3E5QA 4CEYC 5CVRA 5ACA3 3GBWA 4NWWA 1AYM2 1V00A 4BH9A 5L7OC 1YJLA 2HEYF 1DBNA 5DUUA 1I6XA 1VBE3 4LULA 2H6CA 3PVOA 1RUH2 4Q27A 4HVRA 3EJKA 2WZPP 1H8VA 2DVDA 1F5JA 3AYAA 2AZ5A 5CG8A 2R6QA 2ZGUA 1Z78A 2VOXA 4CP2A 1V6MA 3N7MA 4HSJA 1PVC2 5GM0A 3MIEA 1AZDA 4F83A 1AR83 3KS7A 2G4IA 2PLV2 2VPVA 5FO9B 2B42B 5AFBA 3CU7A 1NA1B 1SDWA 4XHBA 4FTEA 4I0BA 4Q4X1 4QXKA 2QUOA 2BFUS 3WUDA 2PHFA 2XKPA 2Q1MA 4AHZA 1X7NA 4CYDA 3WQ1A 1U12A 1QJY2 4F8AA 4MZUA 2JXAA 4GQ7A 4XOGA 2PN5A 2NN8A 2PYTA 4YW3A 3B69A 2ZGNA 4D7YA 2QFEA 5D1IA 1SLBA 2BNNA 3TN92 4E27A 2CAVA 5C8CB 4UBHA 2YGLA 1AL0G 4AVBA 1RUC3 3KCYA 4GULA 1MS5A 2CNAA 3WG4A 1CESA 1NCQB 2ZKLA 4S2DA 2VW0A 1RUOA 4FQZA 2R49A 5KHIA 4QPIC 3RYKA 1ZREA 5FO7B 1RUD1 2HWE2 5H9PA 1V6LA 4DZGA 2ATFA 4GB33 4YW2A 4M01A 4Q1PA 1YJKA 1PVXA 4AEDC 5JOZA 3NAPB 1LEDA 2YGMA 4K1YA 4XILA 3WDUA 4XW3A 5JI7A 4WZFA 5T50A 3SISA 3SH4A 3MF9A 1RUG2 4KGGA 3OCPA 5A3LA 1N1YA 1UW8A 5T52A 4E9KA 1ZZ7A 3MEPA 3M8LA 1CVNA 2E51A 1LOFA 4XQWA 4I09A 1AR63 5JMCA 3SCHA 4Q1RA 2GNTA 3ATGA 4UW6A 4D94A 1H30A 2MNGA 4WM8C 3AMPA 4B8EA 3B9CA 3VZKA 4Y1UA 4MX3A 2VVDA 4A7KA 1CQ9A 4LBQD 3VKLA 1A6CA 2XLAA 2F6BA 4XYXA 1XYNA 4FVVA 2YV8A 1D4VB 1ULFA 4E4ZA 2BWCA 1CIWA 1RVF1 2D3SA 4NHLA 4PJYA 4ISQA 1DQ1A 3ZFFA 2JG8B 2WS91 1Q8QA 4QGMA 1JXNA 1NY71 1CAUB 2OIIA 4XBQA 5H9QA 3VHNA 1BEV3 3WG2A 2ZGTA 4SBVA 1W6NB 2E53A 3WLUA 3V0BA 2YZ4A 2DTYA 2AGSA 2IXCA 2VOWA 1ZA4A 1QXJA 2DTWA 1M4WA 3TOJA 3W9AA 3LA2A 1VAMA 3J8F2 3ZO0B 1DGWA 5FLIA 4HSLA 3FHIB 1H2KA 1O4YA 1VLNA 2DV9A 2A71A 1BBT1 5A33B 1AJKA 2JG9A 3TNQA 4A2UA 4HN0A 4LBQA 2O8OA 2UY8A 4GKYA 1GFF2 2H0VA 3VUOA 3THPA 1FI2A 4K9SA 1KFXL 2JKBA 1AL23 2RMU2 4M3CF 1QNWA 2ARXA 4Q0SA 1HXS1 2AUYA 5J09A 2ZX4A 3ZXAC 4GMP0 4CDUA 1ND3B 1RB8G 1TMF1 5JR7B 1SLCA 1CAXB 3JB4C 4JGZA 3PTYA 1EAH3 2YROA 1J1TA 4HFSA 2TEPA 2GNDA 4N7UA 1OQ1A 3CEWA 3AXEA 4XFGA 4YRDA 4A3XA 2DCKA 1NXD1 4HPKB 4V1PA 5IK4A 4QQOA 2V09A 2XL7A 4OUMA 2C0ZA 1R091 2WQ4A 4AQTA 5BNPB 1JYIA 3RWNA 3IPVB 1RMU1 5JZGB 1I1EA 1FOD2 4JDNA 2XL9A 3MLKA 3VBFA 4XIKA 1PGW2 4RS5B 3ZYRA 1Q8VA 3MFCA 3QACA 2TNFA 4DMIA 5AFEA 1RUJ3 2YYOA 1GR3A 4EROA 4AVCA 2BQPA 3AMNA 3ZXKA 1W6QA 4JC1A 4I3GA 1LOFC 3USUA 4L99A 1VBC1 5ABJB 1AR91 1QJZA 3N7KA 1KXGA 3PLQA 4UW4A 3RMXA 4E2QA 2WSUA 4MXVA 4AFCA 4YZ4A 3APBA 1F5FA 3PMEA 3ZVXA 1V6KA 2ZTNA 3NV2A 1HRV2 4AF9A 5KC6A 5GLTA 2B45X 1LGBA 4XFBA 3VBSC 3RMYA 1D0GA 5I91A 4OLLA 1CAVA 5D8AB 3UJOA 1ULGA 2WL1A 4LO4B 3ZFFC 4FTSA 3ROUA 3ZFEA 3AJYA 1UMZA 1WBLA 1A3KA 3IKWA 2ZGSA 2MHFA 1R082 4A7YA 1C1FA 4YNIA 5IK5A 4AGRA 1IS4A 2ZAHA 4Y5Z0 1PIV1 1ZBA2 3WP3A 1VBD2 2VW2A 1GBGA 4XFHA 1LJ7A 4IQPA 2WINB 4YW1A 5JSRA 5L7OB 1GQHA 4Q4X3 2IFRA 1RJ7A 2JG9C 4XXAA 1NYWA 3UJQA 4JRAA 4P9LA 2WJSA 3KD4A 1ONAA 4LO5B 1S0DA 2A7AA 2P34A 2ENRA 4Q2FA 1MS1A 3VL8A 3P3PA 1MZEA 1LU1A 3D0JA 2V5YA 2QKDA 4HK9A 1KJLA 3VHPA 1O3RA 1RITA 4CDUC 1MZ6A 2VUAA 3JD71 4LBOA 2FZ2A 3LSDA 4JGZC 3RSJA 4N90A 5FPXA 3MYXA 3M3IA 4Y1YA 1RUD3 2ZHKA 2W0XA 3GNEA 4KWJA 1MS3A 4J1WA 5GLWA 1FPN1 3ETQA 2DCJA 2NMNA 3IT8A 1KJRA 4P9XA 5BY5A 3NKGA 2O8QA 2VOVA 3IDEA 3WR0A 1H1IA 4AI0A 3GALA 2DCTA 3MIDA 3VBRC 2WNUA 4RSUA 4W65A 4K7JA 3JUUA 3VBFC 5I8YA 3BPZA 4Z2WA 1COV1 3G7DA 4LBKA 3QBQA 2ZX1A 4YARA 1TEIA 4XEZA 1LESA 2GMPA 1H4HA 2R16A 5F6KA 4QPIB 2WSVA 3ZSEA 3WINE 3UL2A 4W6YA 5BYNA 3PHMA 2FMDA 1XE7A 1DZRA 4FPYA 3NKTA 4XMAA 2A5ZA 3SCGA 1WLTA 2HWD2 4ZXKA 5IK8A 5SV8A 3HBZA 1PO22 1SLLA 1G9BA 1FV2A 3RI8A 3S30A 5JVVA 1SBEA 2PHLA 1DDLA 4MSVA 4FTBA 1APNA 4K21A 2ZGOA 5FCCA 1VRH3 4QM9A 4IV3B 2WWSA 2YHJA 3EBRA 1YFYA 2D3RA 4Q8KA 2WS93 4YM0A 3K51A 1ZRRA 4OI0A 5F5QA 3ZFEC 1LU2A 3N3HA 4XF0A 3H1YA 2R042 3PNAA 5FFOC 3AKPA 1EV11 1RUNA 3FWEA 4EWEA 2RR12 1O4ZA 1W39A 1YO8A 1JHNA 2B8MA 5JCTA 4JV4A 3OJBA 1QH6A 4UW5A 4LTAA 5GLUA 1HQNA 4SLIA 5K7PA 4FCAA 1KD7A 3O0VA 1WD4A 1DGWX 1BBT3 4JCKA 1GLHA 2WKKA 4QM8A 1CPMA 3VKOA 2SBAA 1PGSA 1SCSA 3USSA 2DCYA 3NV1A 1GYKA 1EY2A 2Z69A 5FOBB 1X36A 1B35A 1XE8A 2I45A 4L92A 1QH7A 2Z79A 1HXS3 4BE3A 2VG9A 1TMF3 4JAAA 2GMMA 4M3CA 5CFCB 4AVVA 4G9SB 4YGDA 1AHSA 1S2BA 1QQP1 3WW1A 1OQDA 4QQHA 5AC92 3RRDA 2KA3A 2GH8A 3VZLA 1R093 2ZZQA 3CF6E 1OPOA 3HT1A 2DFBA 2JE7A 1OHFA 3WV6A 2NPIA 1RUC1 2IXJA 3WG1A 3OYWA 3VBUA 2WNUC 1MQTA 4Q4W1 3VKMA 2R0FA 4ZKTB 1RUE1 4Z82A 4P14A 4GB31 3WY6A 4NOTA 1DQ2A 1Q8OA 2MEV1 1HKDA 5JSOA 4XFAA 1X8MA 4P9IA 3AB0A 3PVBB 1DQ4A 1RUH1 5FLJA 1FMD1 4XFCA 4PCRA 3WDYA 1AR93 1A8DA 1PO12 3O0WA 4AE2A 1V6NA