2CU5A

Crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
MEGVVRLEVPTPEEGFVNITRKVEAALSGHTGLVYLFVPHTTCGLTVQEGADPTVAQDLLGRLAELAPRHRPQDRHLEGNSHAHLKSLLTGVHLLLLAEKGRLRLGRWQQVFLAEFDGPRVREVWVRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved Hypothetical Protein TT1486
publication title Crystal Structure Of The Conserved Hypothetical Protein TT1486 From Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 29
structure length 129
sequence length 129
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01894 UPF0047 Uncharacterised protein family UPF0047
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.460 Mainly Beta Sandwich Jelly Rolls YjbQ-like 2cu5A00
2P6CA 1VE0A 1VMJA 1XBFA 2CU5A 2P6HA 1VMHA 1VMFA 1VPHA
chains in the Genus database with same CATH superfamily
2CAUA 4Q0SA 1RVF3 4Y1VA 3WOGA 3WNPA 1DF0A 3KF5A 3CQOA 2JDZA 5FXZA 3KMHA 2ZX0A 4DEQA 2R0HA 4JX0A 3GNEA 4MGZE 5JR2A 1DLCA 3OGGA 4LT5A 2XUMA 2VD7A 1YHFA 3KZ4C 3LWCA 2VZ3A 2VOXA 1LHWA 2NZ9A 4YLZA 1UCXA 1QNYA 3OD4A 3QBQA 1W9SA 4AGGA 2VVDA 4A6OA 3NWKA 1QEXA 1D4M1 2VUCA 2QQIA 4HT1T 1RUOA 4JKKA 2JD9A 1UKRA 1TMF1 5CAZA 1WGPA 2V09A 4IEWA 2DVBA 3PHMA 2WUHA 1S0IA 2A7AA 4LQRA 4M3CB 5T5LA 4BJ0A 5FK7A 4F3JA 3MV01 2IVIB 2BERA 4MVTA 4OI2A 4ZPIA 5FZ4A 4AGVA 1M4WA 2P3YA 2BGCA 5L9BA 3WW4A 4LIVA 1OA4A 2FZ2A 1VJ2A 3FE5A 5FY1A 5JOXA 3MIDA 3WCSA 2R6QA 3KVAA 4IXLA 3UJQA 5C33A 1LKNA 2DFCA 4E2QA 4HVQA 1FMD1 1XJAA 2PLV2 4K1ZA 5EXOA 1ND3A 3FUOA 3V0AB 1SDWA 2OXBA 4QXBA 1ULCA 2VVFA 2MNGA 5CU1A 1MZFA 3VBUC 2XJVA 5HPOA 4PLOA 1IKPA 4C8DA 2R063 1GQHA 3PURA 4NWWA 2YMZA 3OUIA 1AF9A 5IVEA 3PUIA 2WSUA 2D3RA 3VDDB 4CU9A 2Y6JA 4AAXA 1W2AX 1PVC2 1BK0A 2CNAA 1OQ1A 2C1FA 3IAPA 3ZFFC 3CU7A 4E8DA 4S2FA 5FPLA 5FP8A 4CDXA 2D6NA 1X82A 4H7LA 4BXSV 4LUMA 3VBUB 4FTEA 4XUTA 3IPVB 2MHFA 3ZX7A 1Y3TA 1QOSA 3IMMA 5GZGA 1BK1A 5KXCA 4BWOA 2QQKA 1WUVA 1WCQA 1LHOA 3B02A 3K77A 4YVWC 3PVNA 2R30A 2YBSA 3ZFFB 4P08A 5HI0A 3ETQA 4Q26A 2VCCA 3SH3A 3SQOA 3WF2A 2WZR2 1OPMA 2W08A 1FNYA 4EN9B 3NAPC 5IVBA 2A6ZA 2QJVA 5JOWA 1GZ9A 1SZBA 4UOJA 3SKVA 4W8JA 4AXOA 3NJZA 1U5IA 4LBNA 5BNNA 1DGWX 4Q4Y3 4G3YC 5B2GB 2ZGRA 1PO23 4Q0QA 2PA7A 1PVXA 4M3CA 4N53B 1Q5OA 4QKBA 4YVWB 4AEMA 1W8ZA 4RL7A 5FP7A 3NV1A 3WINE 2Q30A 5A7SA 3T08A 3VBFB 4AI3A 2XVLA 2WN2A 1G6NA 5F32A 4EWEA 2WA3A 2ZHNA 4IL7A 4XDPA 5EV7A 4D7TA 2A3WA 1JZ7A 4CP2A 3U4XA 2ZEZA 3NNFA 2XJSA 3NAPB 4Q29A 4DXRA 4PDWC 1BBT1 5FO9B 2V72A 3MIBA 4UW4A 2ZXQA 5ABJB 4PI0A 5JLVA 4LHKA 5DDJ1 5JVVA 1ZBA2 1A8MA 4QPIB 5CISA 4GAZA 1JZ6A 1X9TA 4M4RA 1XSQA 1SLTA 2XXZA 1ZA4A 1JOBA 1H6YA 1MEC2 2HWD2 2VXJA 3HN3A 4OZXA 4TYSA 4XZUG 5KHHA 2F4PA 2EF6A 1QJU1 5DPNA 1OLMA 1OUXA 4FXKB 2O14A 4TSVA 1UZZA 5LASA 4B4RA 4DUVA 5L19A 5G05L 4BISA 3VDDA 3ZXLA 3MW4A 2GC2A 3SH4A 1FPN2 3O1RA 1RUD1 4QPGC 2ZGQA 1UXXX 1RTVA 3I97A 3I3EA 4P9LA 5F5AA 4CTEA 3AZYA 3K4DA 3JQXA 2WL1A 4NJ4A 1G9FA 2CWSA 1GMMA 2JE9A 3QACA 3PL0A 1V6LA 3W5NA 4UFJA 1RHI1 3IPVA 3M3IA 5FZFA 1PX3A 2NN8A 3ON7A 4Q8KA 3GCWA 3ZO0B 3N35A 3WP6A 3OYWB 1AR93 4PT6A 1H8VA 4LULA 1W9FA 3POFA 5FQ0A 3PUHA 1RUC3 3WUCA 4FAHA 3ZYHA 5JZGC 4KI5M 1REFA 2IXJA 1XB9A 3T1LA 2R16A 2RS13 5IK4A 3CZUA 4MYEA 1PHMA 3DKWA 1DGLA 4E4HA 1BHGA 2WWUA 3AMNA 3ZDVA 5K0UB 3I2OA 1LENA 4NR1A 4A4AA 1E5SA 1R091 4K40A 1VBD1 4K20A 1Y43B 1W0NA 2JG9A 3R05A 3OTFA 4GJZA 1VB4A 1UL9A 4XFAA 5APAA 4Q0UA 4N53A 4YVWA 4AI1A 5JZGB 2CGPA 1JZ3A 3OBAA 4OHXA 3D5OA 4NPMA 1C57A 2NYYA 3JD73 2EIEA 2E63A 2PHDA 4DFSA 1FNZA 4INDA 3VBFA 4YW4A 3PVEA 3LFMA 4CEWC 2W47A 2HWE1 4XZPA 1AR83 1NCRB 2VW2A 3SITA 3AZXA 2YHJA 1ZM1A 4Q4V1 3T1MA 2E31A 4HONA 1RJ7A 3UETA 4C1XA 1FXZA 3WW1A 2UU8A 4URTA 2JDYA 5ABJA 3VBOB 4CU6A 2W94A 5DAXA 3R0RA 2NPIA 2GH2A 4YZ4A 1Q56A 5F3CA 1DYOA 4QPIA 2P3IA 1HB2A 2VUDA 2ZABA 4KU7A 3J9SA 4JC1A 1WBFA 1UOGA 5IVYA 5DAQA 3URFA 2X29A 4F7ZA 3SH5A 5JSPA 1OC1A 2MEV1 1TE1B 3LA3A 2UWCA 2D44A 5ISLA 2EICA 5FO7B 1ACCA 1A6CA 1V6IA 3B94A 5A7PA 3PIJA 1I1EA 2YGMA 5BNPC 2DVDA 2WZEA 3ASIA 2DCZA 4QMAA 2P1BA 1REDA 2YB7A 1WMXA 2ERFA 3BALA 1XE0A 5JUVA 4UFMA 5GZDA 2EALA 1AL22 4JV4A 2D5HA 2PTMA 1HJFA 3TN91 3ZYFA 4OYUA 4CEYC 1IQAA 4ZU4A 3N3HA 2FDJA 2VMEA 1AJKA 2YUEA 3HEIA 3OYWA 1H1AA 1W2NA 3I3DA 2E6VA 1W9TA 1MS9A 2YBKA 3ACHA 4N7IA 3MF9A 4P14A 1NY72 3QH7A 3H1WA 4KG0A 2WFF3 3ETPA 3Q8FA 3TNQA 4CUCA 1WCKA 5JSOA 5BNPB 1PZ9A 1WLWA 5IAXA 4COZA 1QJY1 1W8NA 4ZXKA 1POV0 5K0UA 4J25A 3EJKA 5FLHA 4U2AA 4ASMB 4C91A 1APNA 4NRMA 1UOBA 1NCQB 2VH9A 4QX0A 3UGFA 1W6QB 2QQUA 3D0JA 4NO4A 4UYBA 2VY0A 2HWB3 1CQ9A 4CEYB 4XCAA 2NMNA 3IKWA 5DUUA 3MIHA 4DY5A 1H8TB 3SCGA 2A3XA 2OQ6A 2W46A 4JRAA 4XUPA 1TEIA 2BWCA 1XC6A 5KC5A 4D8MA 2RVAA 2BPA2 1AR71 4WM7C 1CR7A 1NCRA 3HR9A 3O1MA 1HRI2 2BGOA 3DGTA 4KMQA 1ZZ7A 1Q8VA 1CX1A 3A22A 2AACA 4FFIA 3ME2A 5LCWL 1QF3A 1CN1A 4IW3A 3VBOA 4IDZA 3WDVA 2BJSA 1EAH3 2EVXA 2C26A 4XIKA 3E5QA 3CJXA 5IUQA 4DOUA 5KC6A 1AYN2 2VECA 4XHBA 3H8UA 1N47A 1F2NA 3JBG3 1ZA7A 3POYA 4NHXA 3JB8A 4FPEA 3I2FA 2J1RA 3J7LA 1KS4A 4XJUA 4LLFA 1GNHA 4A3XA 1C5HA 1SLLA 2Z69A 3C3VA 5B4NA 3SNMA 1COV1 1R1A1 1SG3A 4I3PA 4RQPA 5GALA 4J1XA 3LA7A 4DPNA 1JYVA 1OBNA 2QQOA 3IIAA 4LBJA 1E57A 1R64A 3K4AA 3M3OA 4DY3A 1BMV1 1KDMA 4V2VA 5BXXA 3RYRA 1IS3A 2XDVA 1LOAA 2B8MA 1MZ5A 1NA1B 2HEYF 3VB9A 2IVJA 3VHRA 2Q8OA 2DWRA 1HXS3 3T09A 1QXRA 4D6RA 5LA1A 1ZRIA 1RUJ2 2N7GA 2ZGKA 4HETA 5KHGA 4W6WA 2OYZA 3KV9A 2XQXA 1RL3A 2JWPA 5JCTA 2PAMA 4UFKA 1P8JA 4P9YA 2WS91 4LE4A 2VZUA 3W58A 3ZSLA 1J3RA 2B9UA 5FP9A 4YGBA 5F7UA 2DF7A 3O0XA 1NCQA 2DCJA 5C3QA 2NQYA 4WZFA 1QJEA 2EAAA 3HNMA 1B09A 5CKMA 5F5QA 4Y1ZA 2B46X 1RC6A 5F3GA 4WVMA 1JYXA 3I2GA 1H8TA 1R092 1W03A 3OGJA 4LUKA 3IDEA 4SLIA 2ZAAA 2A1XA 1VBA3 2XKPA 3RFRA 2PAEA 2CL2A 1LR5A 1G7YA 1OH4A 5F5CA 2WQZC 5GZEA 3G7DA 3LF7A 5DXDA 1IZ3A 3T2QA 3AJZA 2B7YA 2OZ6A 4AL9A 1MS5A 4FP2A 4AZZA 1UU4A 4BDVB 5C70A 4QXCA 3I8TA 4XXAA 3VZOA 2TUNA 1XYPA 4KWJA 2PHTA 3B93A 2OZJA 4IEXA 2W3JA 4C90A 2V5YA 4KWKA 3ZYRA 1K3IA 2BBAA 1RUF1 2OPWA 2ZGSA 3T3YA 1JZ8A 2VQTA 3LQCA 1JTZX 1GP4A 4Q4X1 4FPFA 4N7UA 2OUJA 5T5PA 1C8NA 2YPDA 3VBHA 2JDMA 5JI9A 3I2IA 4XJ9A 4GB31 3RZKA 1WMDA 3LGRA 1GU3A 1QQP2 2ZOEB 4ISRA 4FXGB 1H9WA 4RGKA 3VBSC 2Y60A 3LOIA 5C3RA 3AK0A 1GZWB 3SMHA 1JOJA 3PUAA 2R042 3BPSA 1HJGA 1NA1A 3C7EA 1ZRFA 3MW2A 1GOHA 1CPNA 3H3UA 1S0EA 2XPJA 1ENSA 2WYSA 3X29B 3O1SA 1DBNA 5CFCC 1GZTA 1UX7A 5A1LA 2D97A 3N9QA 2WNOA 4LHLA 3AMMA 4I3GA 1O3SA 1HQLA 1OA3A 3MIEA 4K9SA 2VU9A 2F6BA 2VOTA 4OUEA 1NG0A 3V56A 1D4M3 1GICA 5JAXA 1QU0A 2XJUA 2H6CA 2ZGOA 1TME2 4GH4C 1SBEA 3BOPA 1OSGA 3ITQA 1TMF3 2BGPA 2VC9A 1HW5A 3J8F3 4OULA 4LEJA 5DAVA 2NM1A 5FMOS 2K2SA 1QJZA 4CPBD 5ACA1 2R0FA 1ZRDA 3W59A 1IQDC 1J83A 3WD5A 1V00A 3K3NA 2ENRA 5CFCB 1CVNA 4UFLA 4GALA 3NNGA 1RVF2 3UKNA 2FHRA 4YSFA 2BV4A 1RUG3 5FMDA 4BK5A 2YG0A 1KJLA 5FUPA 2XR4A 3VBRA 4HKLA 2RDRA 4ZHNA 1UAIA 1AR61 3VZMA 5H9SA 1K5JA 1ULPA 2VTXA 2WLQA 4FPLA 1F31A 1NE6A 4JGZA 3WP4A 2DU1A 2IXIA 2RM21 1CZVA 1XE8A 3CEWA 2X10A 3AFGA 3MYXA 5ANNA 1LOBA 5LRRA 4YFWA 4BU2A 2HJIA 2YDEA 3O12A 3JCIA 2B9VA 3R4UA 3ZR5A 3B5LB 4NROA 4AVVA 2X8KA 2UWAA 3CJIC 4QHZA 2PN5A 2WT1A 1Q8QA 4BQ4A 1H2MA 4I0WB 2P3KA 4CCLA 1PGW2 1XU1A 5F39A 5FBZA 1RMU3 1ZBE3 3OEAA 3RZJA 4R52A 1H2LA 5C8CA 2JDUA 5KHJA 2GC1A 3VKFC 3LZZA 4MGYE 3FX3A 2BWAA 4V2WA 2RDQA 4F83A 1GNZA 1KXGA 3D3AA 3NV4A 4PBPA 4JQTA 4QDQA 5AVPA 2ZX1A 1ZZ6A 4GULA 3AKTA 5FYZA 4FPCA 1O3TA 5FPZA 5FAXA 1YNAA 4IEZA 2R1BA 5FMBA 4JGYC 2XHNA 1FOD3 3DECA 3ES1A 4ISQA 3AVSA 1GSLA 2R062 1EYBA 3HMYA 3Q8CA 4PJYA 1UIKA 5T5OA 1AX2A 4DXTA 1UXZA 1MACA 1RUH3 1Y4WA 1JMUB 2JDNA 5E6HA 1TNRA 3O1UA 2D6LX 3UT0A 3M2MA 2CSGA 3FZ3A 1OQDA 1ASJ2 4AHWA 3WF4A 4LO7A 4XABA 4YW6A 5FZ1A 1OURA 3THDA 3EO6A 2W92A 4KGGA 3MFCA 4KWLA 1OFSA 1UZ0A 3NJXA 3VL8A 5C3SA 4M3CE 4XIOA 2LRPA 1AXZA 1D2SA 1PO13 2JEMA 4JGYB 1QDCA 2X5IC 3AKSA 4KNCA 2CAVA 4M0HA 1UNBA 4RHV2 2PLV1 4XFGA 5CFCA 2WKKA 4AQ6A 1DZRA 2W52A 2BUKA 2EXIA 2PHRA 4JHZA 5FLIA 2BBVA 3ZN4A 1QOOA 3OCPA 1ZYBA 5FUNA 3ATGA 1XYOA 1HKDA 4I09A 4LR4A 4MH0E 4PQ9A 3WUDA 3EHKA 5DDJ3 1PVC1 1KDKA 4B8EA 2GNTA 4D69A 5FJKA 5LK5A 4GMP0 1W2TA 3OPWA 3WZ1A 3A0KA 1QNWA 2X5IB 1VBC2 3BB6A 1QJU3 4KH9A 4GZ9A 2CY6A 4MG2A 3VLBB 3VZLA 4COYA 1OLME 2ADDA 3GXUA 4CUGA 2ORXA 2UYBA 1W8OA 1YFXA 4XQDA 5AFBA 1MS0A 3OGSA 1GBGA 2BZDA 2WINB 3ALQA 5KXDA 3AZVA 3KCYA 3DEMA 4K7JA 5I0TA 3KD4A 1RHI3 1V9U1 4J1WA 1F15A 1U12A 1O5LA 4M00A 4Y24A 4CDUA 1ONAA 3LSDA 1UY4A 2B5HA 3GALA 1SBFA 4MXWB 3WDTA 2WZR1 4BQWA 2R7EB 5FYYA 1RB8G 1QKQA 2LALA 4MV2A 4HN1A 3BKZA 2YY1A 2WBKA 3MF6A 1WD4A 2Y34A 3FFZA 1CESA 3ZXJA 2QNKA 4FOVA 1ULFA 1O8SA 2ZTNA 5H9PA 1CZTA 2Q1FA 3GHNA 1VAKA 2XLFA 4FP3A 3PNAA 3RMXA 1CAVA 3WG4A 1XE7A 2RS32 1N3PA 4EV0A 2WO7A 4JKLA 4UFHA 4PBOA 1VBD3 5LA0A 3BI3A 1K12A 5BYNA 3KV4A 3S57A 2CWMA 2UYAA 2W2IA 2D40A 3AXEA 2RS53 1ND3C 3OEBA 4GKYA 1O5UA 3INAA 3CBNA 3HBZA 4GJYA 4QHOA 2HH9A 2LROA 1MZ6A 1ZX5A 2GH8A 4XDQA 2ZZQA 3AB0A 1W05A 4MSVA 1LAJA 1ZBA1 3DXTA 1WKYA 4AWDA 1OA2A 3C2UA 5B4XA 1JBCA 3O1OA 4CCJA 1LHUA 4Q4V3 2C24A 2WQ4A 1VBE3 2ID4A 5ACA2 1HN1A 1RUC2 1MEC1 1US3A 2HWD1 2UY8A 1UD1A 2YZ4A 3FLPA 4MX3A 4UW3A 1JYTA 4RR3B 4JDMA 1H1IA 1SFNA 4CDXC 3NW4A 4LE3A 5E1RA 3M3EA 1ND3B 3AP7A 2E53A 3RMYA 2FCVA 1FPN1 4NMIA 5EYXA 5I8YA 1GWLA 3IAQA 3UKTA 5A3OA 5CIRA 3LOBA 2FCTA 1ODNA 4OHZA 2WZ8A 1DGWA 1VBB3 2I07B 2ZMKA 3M3QA 1W2OA 4LLOA 3U07A 1PMHX 2X5IA 1W8HA 1MQTA 1OQEA 3U78A 4CYDA 3ZR6A 5EQUA 5D21A 2ZAHA 3V65A 1PZ8A 3DPRB 2FMYA 2A5ZA 3JD72 4EN7B 3OD0A 4K3UA 3FBYA 5FZHA 2Y38A 4UFIA 3WHTA 3UGGA 2VJXA 4GIQA 3AZWA 4TLGA 3HQRA 3VN4A 1O7FA 1WW5A 3JUUA 5KXBA 3OBZA 5BNNC 1YJLA 4MXWA 1VP6A 3AKRA 3TN93 4JHTA 4Z82A 5CNAA 3W9AA 2MPFA 1JYCA 2EA7A 2QQLA 1VAMA 3AC0A 5FZCA 4CE8A 5JI7A 4AQ2A 1Y9MA 3VDCA 3UK9A 2K9ZA 4K6BA 2VBBA 3AXDA 1VMJA 4FFGA 1QJY3 2OT7A 4JCKA 3U0ZA 1XU2A 3KHCA 1FX5A 2J7MA 4HK9A 4JDOA 4XFBA 4IEOA 5IT6A 1W9WA 1UO9A 3N9MA 5BNNB 3S0MA 3DKQA 1H4HA 4EE2A 2VZ1A 5FKBA 1S0CA 2DBNA 3FWEA 1FAYA 4YZ2A 3ELNA 1J3QA 2PAKA 4OQ8A 3RZMA 1CAWA 3E97A 3B00A 5C5UA 2QDRA 4N90A 1G9DA 5A3LA 4ZONA 2B45X 3THCA 3VDDC 3N9LA 1C8M1 2VCMA 3B7MA 1H30A 1OKOA 1QY4A 3EBRA 1KRIA 2W1SA 3AVRA 5FZGA 2VTFA 3N4MA 4XETA 1XNCA 4RR3A 3T2PA 3WG2A 3EXUA 1SLAA 5T3NA 5A3WA 2A73B 1YYNA 1VRH3 4FPHA 1X50A 3ZVXA 1V6NA 5FIXA 3T4VA 3BTYA 1ENRA 4HLTA 4LBKA 4ARYA 1S2BA 3HWJA 3VZNA 2VPVA 4CU8A 2G9FA 4JVAA 5I91A 4IERA 2ZHLA 2NMOA 4AFAA 2HWB2 5J48A 4CP1A 4ITCA 2HWC2 2A71A 5C5TA 1JS9A 3VGIA 1NXD1 4META 1LHVA 1AL21 2IFWA 2DDUA 3DPRA 3KT4A 1COV3 2CDOA 4RFT0 4AE2A 1UYZA 4AHZA 3SHRA 4C0BA 2D3SA 3M7AA 2P2KA 1YEWA 2VOWA 1DP0A 1GOGA 3BODA 4Q0VA 1XXNA 4LIUA 1NY71 2JG9C 2XONA 5JPNB 4NOTA 3HT2A 5C3PA 4RSUA 3BOWA 4N53C 5FQ0B 3O1VA 3MI8A 5CYYA 5J98B 1IHMA 3AYEA 4S2HA 1UY1A 3E5XA 1S0JA 1DCSA 1WCDJ 1V9U2 5LA9A 1QJFA 3VBFC 2BNMA 2OVUA 5JPMB 4S2DA 4QX8A 1DYPA 3MIGA 1OKQA 2W87A 3TB0A 1HQWA 3LIGA 4PCRA 3UJOA 2WO1A 4ES9A 4H55A 3HNYM 4EROA 5HXMA 2XL7A 3VD3A 2GAUA 2VMCA 3RDIA 2BVBA 2HYKA 2JG9B 3FJSA 4MO3M 5ABJC 3T4HB 2K0GA 2RMU3 2Y6GA 1YQ2A 5A3NA 3BTZA 2Y6FA 2C9AA 4YWAA 4BQ1A 1BEV2 2JENA 2X09A 1IS6A 1HRI1 1UZWA 4QPIC 2Q8EA 5JMOA 1OOPB 1PMIA 1DGRN 4LBOA 5DN2A 2YFUA 3G6JB 3WQBA 3ZXDA 1DYKA 3ACGA 1UY0A 2VXRA 3P5BA 2YC4A 4PQQA 2DCTA 4Y1YA 1QXJA 5FZEA 3N36A 4ZXEA 1D4VB 1I5ZA 1JW6A 1R1ZA 4YVSB 3UKVA 1AXKA 2WO3A 1HXS2 4LK7A 2SBAA 1AYN1 4M01A 4V1PA 4AFDA 3E6DA 3MFAA 4QX1A 3ZKYA 2PELA 2WQ8A 3N7MA 4UT5A 3ZMOA 3P3PA 5E88A 4AGRA 5FP4A 3S6PA 4FT8A 1EUTA 4N9IA 4BQ2A 2FDGA 1Y7BA 2QVSB 4AI9A 1W28A 4HXCA 3OG2A 3KGZA 3RWNA 1PIV3 4NRQA 5A80A 5HCHA 1RUF3 4UW5A 1STMA 2ZZJA 1ULGA 4E2GA 1YQCA 1S55A 3SCFA 3D6EA 2D7FA 4Y22B 3POEA 3SEPA 2WNEA 3RZLA 1SPPB 1TZOA 2DCKA 5K0UC 1JOPA 1SLIA 2EAKA 1VBA2 1CIWA 1L7LA 4IE4A 4X8PA 1RUJ1 2HBTA 2VMFA 2GU9A 3AX4A 3ZYGA 2O8OA 5BNQA 5GZCA 2VZRA 3T2TA 4L8QA 4R9CA 3KT1A 1OI6A 4D6SA 3APBA 2VQAA 1G8WA 3L2YA 1I6XA 3M4FA 3C7GA 4IEUA 4M3CF 4UI9L 1N1VA 5IK7A 5FY0A 4CUBA 3PMEA 1K45A 1URXA 1MR5A 4DRRA 1QJX3 1IS4A 3DN7A 4AFCA 2W91A 1NCRC 4H2AA 2GMEA 2XLAA 4L0PA 4DMIA 1O6UA 3UESA 5HCFA 2ZX3A 4BE3A 3EYPA 2GNDA 4QXHA 4QX3A 1TG7A 2VTXJ 3POJA 1RUE3 3FHQA 4X6QB 3VBOC 4EN8B 4E4DX 4Z8BA 5FY8A 5IFPA 4JQRA 5C6CA 1NZCA 4Y5TA 2XQRA 1NLQA 3E6BA 5FXWA 1HB3A 1ZZCA 2B4KA 1MS4A 2VMIA 3CZJA 3U1XA 4XJWA 2Y64A 1OOPA 1XNDA 4P9IA 4RN5A 3D82A 2BTVC 4LXLA 1D7PM 3NKGA 1ENQA 3W20A 4OI4A 3PJYA 3VZKA 2D5FA 1Z0HA 3IB3A 3J7NA 4HZFA 5FZ8A 1QIQA 4YVSA 4ES8A 5FWJA 2ORZA 1W8FA 1NYWA 4RQPC 4BLIA 4TZDA 1HRV2 1W0PA 1C4RA 3H7YA 1CD3G 2ZGNA 4DEVA 2IUWA 3I2KA 3K2OA 5JOZA 1AYM2 4FO9A 1W39A 4FOQA 1C8M2 1DHKB 2P6CA 4HFSA 2VAUA 4NWVA 1LNSA 4W4ZA 4AFBA 2I2SA 3RYPA 3WP3A 4FQ4A 4OUMA 3VZJA 2XUEA 1HV0A 1X9PA 1W0OA 3WDXA 4KU8A 3GZEA 3J8F2 4HSJA 4WM8B 1QQP1 1IPJA 3T0BA 5HCAA 4AEJA 2WNUC 1JU3A 1I5PA 4ONUA 2FQPA 1HDKA 4RQPB 3QCWA 1GZCA 1N1YA 2R041 4Y22A 3TEWA 3WF1A 4XJ8A 2LUWA 5FYIA 1SPPA 4CDQC 1KITA 3EB7A 2ZMLA 3U4SA 4Z2AA 4GMP1 2W39A 5IATA 2GDFA 2XBO3 3WQ1A 2H0VA 1NCQC 4Z1VA 2HWF2 1KFUL 4CCMA 4QGMA 4L97A 4BXFA 3K46A 2QQPA 3PIGA 3TRSB 3O5SA 5L7OB 5KBFA 1H8TC 2WNUB 4B29A 5FPAA 2J42A 1TME1 2DBIA 4AG4A 1W90A 4Y1XA 2XJRA 4CDQB 3O7OA 1OD3A 2ZGPA 3LAGA 2I74A 2YU1A 1AUYA 3GCXA 3IWZA 1CPMA 3KV5A 1A34A 1DQ0A 1RVF1 2VUJA 4GQ7A 1RMU2 1ZBE2 4R9BA 4W6YA 2CU5A 1OLQA 2FCUA 2VZTA 2DUPA 4WVMB 3ZFEA 4Q4W2 4GWJA 5IAVA 4IV3B 4B4PA 5LZ6A 1DGRA 1L3JA 1YLLA 3ZYJB 1XNKA 3LPFA 1Z7S3 3POSA 1ALYA 2DCYA 3ZXGA 2PQSA 2PLV3 2BEOA 4TWTA 2ZX2A 2JDPA 5I0DA 1X8MA 4D3WA 5FZOB 2VO5A 1C1FA 5CBLA 1F35A 1W8WA 5FPVA 3NQHA 1BQPA 3UYJA 3VBHC 1FOD2 1UMZA 4UW6A 4AVCA 1G9CA 5DG2A 1H0BA 4I01A 2DYCA 1XPWA 3ZKUA 3RJ2X 1RUH2 2DV9A 4HPKA 2GMPA 4KGQA 1PGW1 1PM4A 2RDSA 3IBMA 3IN9A 1NA1C 1DQ4A 1R083 4J6GA 5FREA 5LEKA 1VALA 2ZGTA 2ZPXA 4CCNA 1DZQA 1SEFA 4JTNA 4KBBA 1V0AA 4WM8A 1BZWA 3MBWA 3RS6A 2TEPA 4QU2A 4JAAA 3TWIA 4AAPA 1LULA 1A3KA 1UMHA 3HT1A 3J7HA 1PO12 5F3EA 1HV1A 3VBHB 5I0UA 1UPIA 2WC2A 1N3QA 5F6KA 2PHLA 4UF0B 2FDHA 1L7RA 2OS2A 2VZPA 3AMPA 1VIWB 2ZJCA 3H42B 3AL6A 1V6KA 3HQXA 4Y5SA 5DQ0A 2XHKA 2ZEXA 2A6XA 3B69A 3M3CA 4GWIA 2IFRA 4QKNA 2CGNA 3CO2A 1XNTA 5AC93 2R061 3OJBA 2ZMNA 4COWA 3THPA 5F2WA 1W6OB 2JB8A 5A7WB 2CYFA 3H7JA 3USUB 3D4KA 5L7OA 5J36A 3GBFA 1YCIA 3HVDA 2WNUA 4UWDA 5TSWA 3RI8A 1ASJ1 3C7FA 2RR13 4ZY9A 1ZZBA 3PVOA 4CDQA 1EV12 4IETA 2IZWA 1EUUA 1H2KA 2PQQA 2Y26A 4IE5A 4NUBA 3S5AA 3MUZ1 3B01A 1PK6C 1YXWA 5FTTC 4RHV1 1XYNA 1AX1A 3ILFA 4HVRA 3H3ZA 4YG0A 3VBRC 5FPBA 4XDOA 4LKFA 4LPLA 3KQ4B 3ZXFA 4CCEA 1RIRA 4NVPA 4D6QA 2IXCA 5GZFA 3NNJA 3ZSKA 5GJ6A 2PMWB 1MZEA 3NNLA 4JGZC 2BFUS 4L92A 5A7QA 4IV3A 2SLIA 5J37A 2K46A 4XF3A 3BU7A 1POV3 1ZBA3 2JG8B 3GJBA 2JX9A 3DUIA 5FZOA 3NSTA 4TLFA 4BQYA 4CXWA 4A45A 1EY2A 1GLHA 2A6WA 2HWD3 1PK6B 1AVBA 1SLCA 4P5YA 2YGLA 3VBRB 4IUGA 1VBC1 2Q1ZB 4QB2A 3WW3A 2FDKA 2ZA9A 1RINA 4Q4Y1 2H0BA 3AKPA 2C4XA 1XOYA 5C8CC 3M70A 2ETEA 3T30A 1FV2A 5KHIA 4CZSA 4LBQB 4JGZB 1D0HA 2E7AA 3K48A 4Y5Z0 4G4FA 4FTBA 5DAPA 5EIYB 2VOKA 4KBZA 3SLIA 4XAEA 2RS52 4K8FA 1OVPA 4GA9A 1IKQA 1DIWA 1AHSA 2WABA 5FO8B 3DXUA 3RZHA 1WMFA 4OMDA 1RUI3 3LDRA 2E51A 3OB8A 1A8DA 1UIJA 1EPWA 2ZGMA 1NAEA 2WFPA 3CHXA 2VMHA 2VW1A 2WR9A 5C8CB 2R072 4UF0A 2C6SA 4IEQA 4Y3OA 2YROA 5IJRA 4CDWA 4AVAA 4ZS2A 1VBE2 3O0WA 4HVOA 3O14A 4O9EA 3BTAA 4D7YA 1DLLA 2HEWF 1K5MB 5DAWA 4DXSA 5FP3A 3U75A 3WY6A 1W6OA 4LO4B 5A7WA 4Z2WA 3USUA 1YQ6A 2JDHA 2DFBA 4LKSA 3Q8EA 4Q1PA 2RS31 1ND2A 3ABZA 2A3YA 4IEPA 1FI2A 1E5HA 1YIFA 2JKXA 4EWAA 2W0XA 4YZ1A 3CMGA 1JU4A 1QGLA 1VBB2 2C0ZA 2E26A 2FBEA 5CFDC 1PZ7A 4QPWA 3I7DA 4JKMA 3FMGA 3NO8A 1NZIA 3MPBA 3P3NA 2Y8KA 2OQ7A 4YZ5A 3ZSEA 3IIIA 5A33B 5E16A 3PU8A 2G1MA 1W04A 1UZVA 1RUC1 1JI6A 2KA3A 5FY7A 5BV6A 4CCDA 2YYOA 4OVEA 1H6XA 1UQXA 2QCSB 4ZU5A 3T2OA 4B1LA 4LNVA 1H9PA 2GP5A 3E1F1 3MPPG 5K7PA 2JG8A 2QDNA 3RJRA 3VD5A 1S4CA 2XH6A 5CFDB 3RSJA 3WF3A 2VNGA 3LEIA 1JHNA 4RS5A 2IC1A 5EWSA 1NUKA 5A1FA 4H14A 1Q43A 2PHUA 1PK6A 3TBDA 2D3PA 4YGDA 3ZMNA 3KGLA 5FYCA 1BXHA 1FMD3 2BYVE 5AVAA 5T5JA 4CDUC 4LBQA 3PDQA 5EZWA 3JD71 2C5DA 2D6MA 1ULOA 5A7OA 2ZS6B 4XOGA 4BB3A 1XQNA 3RGBA 5SV8A 1GNYA 1PNGA 2D43A 2QZ2A 4H3WA 4RGGA 3WNOA 4AI0A 5FZ7A 3HJRA 1WA6X 5BNOA 2VE1A 2KR2A 2R1DA 3VKMA 4FPKA 3WSOA 4MZUA 1D0GA 5GLUA 4E2SA 1W6NA 2P6HA 5LBFA 1XSRA 5I8TA 4CDUB 4GWMA 4XTPA 2FZ1A 1YC61 5FZDA 1UY2A 2WNVB 3DCQA 2Z42A 1K5MA 4QX7A 1HN0A 1PGSA 2GMMA 1G9AA 1YFUA 2D98A 3WG3A 3OUJA 3SISA 2BQPA 1DG6A 5IFTA 3ILNA 3BGAA 3DL3A 3TEYA 4NN0A 4R4ZA 2JICA 2BVVA 2CV6A 2PHFA 5M0TA 5LEJA 1RGSA 1I3HA 3ZPYA 1H2NA 3GDBA 1O8PA 4ATEA 2IXKA 4ATFA 1CAVB 3AYAA 4NIAA 1SLBA 4WV8A 4RD7A 4HMZA 2W9XA 4W50A 4XJZA 3OGVA 5C8WA 2Z4FA 5E8AA 4D94A 1UMIA 4N8MA 5JXHA 2P37A 4N9HA 1F9KA 3FLRA 5F3IA 5A33A 1SDDB 4YW3A 4HANA 4E27A 4FOWA 4Q8LA 3M8LA 4UXAA 4A7YA 3RPQA 3ZSMA 4B7KA 3ZDSA 2VVEA 1KFXL 1MQTC 1JYIA 2YPJA 1GV9A 3S7IA 2DVAA 4Q5OA 5CFDA 5LRSA 2JDAA 1B35A 4SBVA 4HL0A 5FV3A 1UN1A 3D0SA 1BBT3 1MPXA 2GNMA 3AYCA 3K4ZA 4QKDA 1ZRRA 3OF1A 4AW7A 2A6VA 4NPLA 2Q4SA 4NE9A 2ZBJA 4XW3A 1BVVA 2HWB1 2HYXA 1KGYA 2HWC1 1LOCA 2VQ0A 3I3MA 4D0QA 2AR6A 4BZ4A 1DU3D 5J7MA 3AMQA 4P02B 3DYPA 3AL5A 5T52A 3S5QA 4P9GA 4ASKA 4BQ5A 1MQTB 3GM8A 4Y20B 3KLSA 3P1IA 2RMU2 4QDRA 1WLCA 4Q4Y2 3RZGA 2VBDA 1PO22 3VDBA 1JZ5A 4K21A 2HLEA 4Y1UA 2XKOA 1W06A 1RUD3 2Q1MA 2QFEA 2W68A 5C4WB 3ACFA 1X8EA 4IGPA 1CWPA 2E32A 2R32A 3HIFA 2ZEWA 3OBRA 4FTSA 3RZZA 1VE0A 1F5JA 2IXHA 1QOTA 1D2QA 1RUJ3 5FZ3A 5L73A 4I0BA 1ZREA 4BA6A 4NHLA 4XILA 5I0RA 5JWPA 4PF1A 2YC0A 2WNVA 4YPJA 3KQRA 2Y6KA 5EJ3A 3HBKA 5A32B 5FYBA 3ORJA 2P3JA 1LHNA 2VZQA 1SQ4A 1PIV2 1GKBA 4QT6A 5FRAA 1OUSA 3ZN6B 5E89A 1BEV1 5LW9A 2GSYA 2JXAA 1T6GC 1U0AA 1XNAA 1DQ1A 1J3PA 2WZPP 3U11A 2GNBA 1ZRCA 1R093 2D6OX 5JMCA 1VMHA 1UOFA 4RR3C 2VMGA 4RA0A 3GBGA 1PGL2 2QKDA 3B9CA 3J26N 4NHMA 1NXMA 2ZCWA 3LFIA 1QXPA 4N43A 4Q0PA 4XBLA 1CAWB 4XAAA 5DZGA 1HXS1 2VCBA 1NLSA 4XF9A 3ZIXA 2OIIA 4NPRA 4IESA 1VR3A 4CSWA 4CU7A 2KM2A 4B4QA 4WBBA 1KQRA 1CAXA 2UWBA 3S7EA 1WBLA 1LOGA 1VLNA 1VPHA 1LU2A 2HWE3 3LSEA 1S0GA 3PLQA 3RG0A 5JIAA 1AR92 4AF9A 4QD2A 1BKZA 5JXIA 3VHPA 5DG1A 3DPRC 1C28A 1GUIA 1S0BA 4A41A 3PTYA 4XFIA 1ZZ8A 3LA2A 2Y0IA 2RS12 1QJX2 2YU2A 4YGCA 1BJQA 1RYYA 2WA4A 5KWRA 2BW8A 3OY8A 2XVKA 3RRDA 1CJPA 1VAVA 4LJHA 4K1YA 1RUE2 3ST7A 2YXSA 4Y20A 5K9YA 4CXXA 3KSCA 1TQ5A 1VBA1 2MEV3 4YM1A 2P34A 4XQ4A 4NIGA 5CA6A 4LA3A 2AH2A 1AX0A 4LBMA 2OW4A 5C4WA 1GYKA 2KXLA 4QGLA 4AEDC 3NRUA 4I30A 2ARBA 3JQWA 5LK7B 1AR82 4I0AA 2OUHA 5FYSA 1N3OA 4R9DA 4LO8A 3FL7A 2OA2A 1MS8A 4QXKA 4ZU7A 2Z79A 1UPSA 3DV8A 1LGBA 3AJYA 3HD8B 4QQHA 5GM0A 4OCTA 5A70A 2Y33A 4QB6A 2G9GA 1UOJA 1ODMA 2VUAA 5A32A 1TME3 4XC9A 1JUIA 1UZYA 3GZAA 2UY9A 4GWNA 5IW0A 3WDWA 1FV3A 3ZN6A 4AEDB 2DVGA 2WN3A 3PUSA 2Y0OA 4MLOA 4EN6B 1V6OA 3JXSA 1GWKA 2Q8CA 4DUWA 2O8QA 5LY1A 3WNKA 1HRV1 1VB2A 2AZ5A 1LGCA 4QQPA 4NIDA 1CIYA 2XBO2 3H9AA 3LIHA 4PF5A 2BU9A 1FYUA 1S0DA 5FZIA 4XVHA 1AYM1 1SMVA 1YWKA 4EWDA 3O1TA 1AR73 3GF6A 3GZTB 1OHFA 3ECQA 5JIUA 4IE6A 1OD5A 1IG0A 4LKEA 4DQAA 1QH6A 2AC1A 2AUYA 2WFF2 1X36A 3J8F1 3GJAA 4DINB 2EXHA 4BYYA 2QQJA 4EJRA 3FHIB 3FFQA 2PHXA 5EJ1B 1OF3A 4XUNA 3LE0A 1VMFA 4OHVA 3ZXEA 4CP0A 5FMOL 3RYKA 4CVUA 2RG4A 1UY3A 4FAGA 3H50A 4RYDA 2LW8A 3ZYPA 1KJRA 4FQZA 3TAYA 2RJLA 1PNFA 3O1PA 1RUG1 2HWF1 2QZ3A 2VZVA 1R1A3 2VR4A 4LMFA 4O7XA 2PFWA 4XF4A 4KWUA 4AYUA 5LBEA 4FCAA 2CTVA 5FBJA 1O59A 1Z7S2 1ST8A 2PXJA 1YQ8A 2ILMA 2OX0A 3NJYA 3WLUA 4EZ4A 1Z78A 1LB2A 4XTMA 1G9BA 1U5YA 1Q8OA 1Y9QA 2FMDA 1NT0A 2VOVA 3ACLA 2AGSA 4MGIE 5FY5A 1J58A 2GP3A 5F1RA 1QMJA 4H7MA 5FOBB 2JIGA 4Q27A 1EAH2 1OOPC 4AK3A 1W2UA 2JECA 4YW2A 2B39A 3IM0A 1FATA 1WW6A 1ASJ3 1NKGA 4HOOA 5DUXA 1N1SA 3FLTA 4P9XA 5FFOC 4BLJA 3UNPA 1NOVA 1YFWA 1RMU1 1R082 1ZBE1 2JIJA 3IT8A 3JBG2 2X53S 4AEDA 2AENA 2WS93 1JYNA 1UF2C 4FI9A 4YVSC 2PYTA 2ZKLA 4LBLA 4Q4W1 5LBBA 5FZBA 4BOWA 2ZEYA 4RHV3 5HXVA 2QQVA 4NHKA 4YM0A 5FMCA 2OKXA 5FPXA 2AEYA 4XPVA 3UV9A 5A3MA 4ZS3A 2QQNA 5FYVA 2WWSA 3B3QE 5CG8A 2J1TA 4IQPA 1LOFA 5A3PA 2WSVA 3GGLA 1FOD1 4BH9A 4BMEA 4YG6A 5AC92 2W1UA 5FZ6A 4BCUA 1KS5A 2B42B 2W1WA 4LHNA 2JE7A 3LCPA 1RUH1 2F17A 4OUSA 5FZLA 2P5BA 4FFHA 2ET1A 3B9IA 3WEZA 1VBC3 2TNFA 1HX6A 2RR12 2YBPA 3SKJE 3OBTA 3GHMA 2LM3A 3HAGA 5JR7B 3U10A 5JOYA 2LTNA 1JODA 3QD6A 5IYYA 1DQ2A 2IXLA 1I9RA 1PO11 4AVSA 1F8VA 1JHJA 4QU1A 3POGA 1OH3A 5JSRA 3FN9A 3VD9A 2E33A 3RWKX 4TTGA 4Q4X3 2W95A 4OI1A 4FPJA 2VW0A 3FC0A 4Z07A 4ZZ5A 1QH7A 4AHXA 2QBXA 2Y6LA 4GB33 4E4SA 1ENXA 3V0AA 4XFFA 4OQ9A 3OPZA 1O3QA 4YG3A 1EV11 2W5FA 2VZSA 4OZOA 1S2KA 4PLNA 4BMBA 4MGKE 5FJHA 4WVWA 3ZFEC 3C7HA 4XEZA 2RS33 5EHDA 1HQNA 3WNXA 4PDWB 4GD4A 1GOFA 4CP9B 4YARA 1SHWB 5LB6A 2BOJA 5C9AA 4CXYA 2E9QA 2R49A 1W3XA 3ZSJA 1HIXA 2CGOA 4COVA 4R9AA 5HV0A 4L11A 1LESA 2VG9A 3VBUA 1LEMA 3D8CA 1XBFA 3GBWA 5A7NA 4XURA 4AQSA 3M1HA 3I2JA 2BRTA 1DQ6A 1RUI2 4LITA 2YV8A 3OGRA 4PHZA 4MOAA 4U36A 3K75B 1E5RA 1SCRA 2D93A 3ZFEB 1Y9GA 3ZXAC 4D7SA 5ACA3 3C7OA 4HSLA 2ZGUA 3TOJA 1O3RA 1AL0G 3V64A 4QPGB 3HN1A 3ZFFA 3JB4C 4A7ZA 4WM8C 4LORA 1C5IA 1H4GA 5GLZA 5FCCA 4CDWC 1IG3A 3NJVA 3VD4A 2VL4A 2F4LA 2ARAA 3KS7A 1OVSA 4YW5A 5G04L 2KD7A 1GP5A 1LTEA 2RS51 4L9BA 5EJZB 3N9PA 1AR63 1W99A 4CUAA 3W5MA 3WNNA 2CHHA 3AMHA 2WYFA 4HPKB 4E9KA 4YW1A 1D4M2 5IHRA 3MZHA 4CCCA 4DZGA 4MADA 1T6BX 1X33A 5F9TA 1MVQA 1GR3A 2RM23 3VKLA 3WHUA 5IVFA 2DUQA 2J1VA 2R071 3OPTA 4O9GA 4XUOA 1TMF2 1YI9A 4IEYA 5CVRA 5FYMA 5L7OC 4CDWB 4BQXA 5A6YA 3DYMA 5BPXA 1VBE1 2VZOA 5FYUA 3NAPA 1HB4A 1V6MA 3A4UA 3AP5A 1L7QA 2RHPA 3DF0A 3O0VA 2QQMA 2JE8A 2XJPA 2CDPA 3SCHA 4LO6B 3QOPA 3MEPA 4XJAA 3CNAA 4MHRA 4PLMA 2VQUA 4ARXA 1RUG2 4PI2A 4XFCA 1VBB1 1JUHA 5HBAA 2D6KA 4CEWB 4XFHA 1FMD2 1MS3A 2WAOA 4ASLA 1A78A 4KQ7A 3BIEA 3HPNA 4IV3C 4DB5A 4AVBA 1YIPA 4YW7A 4PDWA 1IGOA 3E5UA 2EXKA 3R4DB 3RVHA 3VKNA 4CP9A 5A1AA 2GZWA 3BYWA 5FR3A 4X8NA 2UURA 3ES4A 3CLPA 5JXGA 2IWGB 4XMAA 4P00B 4HG6B 5CB7A 1ZNPA 5A3UA 1DFQA 2JDKA 2VGDA 1WWYA 1W6MB 3KHBA 2C9KA 4QHBA 1HLCA 2ADEA 3ZPOA 4IEVA 1FT9A 4L99A 1LGNA 3ZYIB 4YRDA 1EPZA 2A70A 3WX5A 5LWBA 3ILRA 2EIDA 4X6RB 4P5HA 5L9RA 2J1SA 3A0NA 4QDSA 4QPGA 3WVJA 3TYJA 5F5IA 5K8SA 3BU0A 1IPKA 1K42A 4HKWA 1F4AA 2XJTA 1LEDA 3NNMA 3LDBA 4FPGA 3LDKA 4QWNA 4QQ2A 4A7KA 1WCSA 2BP6A 2VNOA 2E7TA 3C8XA 4MUVA 4UAPA 5LA2A 1PVC3 4WVVA 2HWC3 4MHUA 3RQ0A 4RGAA 1T2XA 2WRAA 5JZGA 3AYDA 5C9AC 3THTA 4HK8A 4GKXA 4DRVA 5BY5A 4AOCA 4COUA 5FDBA 2OPKA 4QX5A 3WDYA 1RUNA 2EIBA 1DDLA 4XACA 3S30A 3BN6A 1ND2C 2VULA 1Q8SA 1GQGA 1OT5A 1SFPA 1G86A 1SCSA 3K3OA 3AP4A 1HB1A 3IMNA 5GKAC 3VHOA 4C0HA 4DXZA 1GWMA 3MIFA 1W6PB 4XF0A 1WW4A 5FZMA 2ZACA 2XG3A 4ZKTB 5GLTA 1RITA 3LKJA 4AEKA 4B1MA 1VRH1 5C71A 1V9U3 4CRQA 4AQTA 5C9AB 1DQ5A 3L2HA 4Y4YA 1RXFA 1V70A 1BBT2 5CKQA 3ZIWA 1W9YA 5FUIA 3RI9A 4B7EA 5A6QA 1YI7A 4BPZA 3NVCA 2WZR3 4G9SB 5J09A 4BM8A 4CEWA 4W65A 3PJQA 5DDJ2 4WM7B 1ND2B 1RXGA 2YC2A 4EZHA 2ZGLA 4Y26A 2ARCA 4LO5B 1GFF2 2JG8C 4NHYA 1BEV3 1QJU2 4RS5C 2AEZA 2G9ZA 1RUD2 3TEXA 3U37A 5FYHA 3FHAA 1GP6A 1W6MA 2EXJA 3NL1A 3ZM8A 4XBQA 5K4LA 1J1LA 2O1QA 3V0BB 3LD8A 4MXVA 1RHI2 4FVVA 2YFZA 3OOXA 2FD8A 1OF4A 1CGPA 3FUQA 2J1UA 1UX6A 1SFYA 2V5DA 3EQEA 2XL9A 3VKOA 4FSJA 3WF0A 5KR7A 2WT0A 5BNPA 4RS5B 5L9VA 5FY9A 1MEC3 5BNOC 2DTWA 2P17A 1AJOA 1OFNA 1REEA 1CX4A 2RMU1 3MGUA 4M4PA 1W6QA 4O65A 3F95A 4Y4RA 5F37A 4NIHA 2G4IA 1O4ZA 1PO21 3MLLA 4NAMA 4CEYA 5FZKA 1FPN3 1NLRA 2ES3A 3WT3A 2WO2A 4DIQA 3WXPA 5GLVA 1JH5A 5FZ0A 2PHWA 1K5MC 1VBD2 2W1QA 1MS1A 4FPOB 4IV1C 4Q2FA 2BNNA 5IVCA 5CEHA 2FDIA 1WD3A 1LU1A 4HN0A 5T50A 5F2SA 4C1WA 5LATA 5BNOB 3MUY1 3QLQA 1JYWA 4EQVA 1IPSA 1W6PA 1ULDA 3OUHA 3WCRA 1POQA 3WW2A 4BIOA 3H1YA 1YJKA 1W8UA 3BIWE 1W6NB 5A6XA 2HWE2 3H1MA 2AYHA 3BVCA 4Q4V2 5KXEA 2QTWB 5CZKA 1YRZA 5FKCA 3U14A 4PIYA 1PIV1 4XYXA 3MHZA 3UL2A 5L36A 1WLDA 4IV1B 1E5IA 5SV5A 2WLPA 4LBQD 5I0SA 4WM7A 3WNLA 3KV6A 3ACIA 3T0DA 4CCKA 3I59B 3I54A 5HV4A 4AVTA 4EYUA 1PGL1 5FWEA 5IWFA 3Q9OA 2Q0AA 4QM8A 3LEMA 3CF6E 1OPOA 4PIZA 1B35C 5C3OA 3H8OA 2MEV2 2NLRA 3OSDA 3WQ0A 3POIA 3BUCA 1ZVFA 2ZKNA 3ZLIA 4I02A 4XMIA 1LECA 2E7QA 4QB1A 5FXVA 2H6BA 1IOAA 2V4AA 3H0OA 3KWVA 3BCWA 4OFGA 1AR91 3TNPB 4CA9A 2ET7A 2DUOA 1DZTA 2HEVF 4IGQA 5FK8A 3N9NA 2TBVA 4E4ZA 1HRV3 3V0BA 4LTAA 1JXNA 4PIXA 2RS11 1NQDA 1QJX1 2LS6A 2D6PA 1AYM3 3TN92 5JXJA 1QHDA 1C8M3 5GLWA 1JZ4A 1B35B 3ROUA 3Q8AA 3ZFGC 4KL1A 1J1TA 1RUE1 2XGXA 2XVGA 2XOMA 3VBSB 4P9WA 2VCAA 2DTYA 5CG9A 2GALA 1AZDA 3R4SA 1QJY2 4LOTA 5FY4A 1PX4A 3AFKA 2DVFA 2VNRA 4F8AA 3CDZB 3JU9A 1YFYA 2WNVC 1LODA 4BHPA 2VMDA 5A3TA 3AZZA 4JRLA 3CL1A 4MGSA 2DU0A 4QQOA 2DURA 1QWRA 1OXCA 4YGEA 1AR81 1UU5A 4BIFA 1S0FA 4WVZA 3KVBA 2Q8DA 5H9RA 3ZFGB 1UW8A 3A21A 1AL23 2HWF3 4IE7A 4XUQA 2GN7A 4DO0A 1F5FA 2J22A 4GH4B 2BOIA 2ZHMA 2Z5WA 3N9OA 3VHNA 2ARXA 4HBNA 1J59A 5T54A 2P4EA 1AR72 1UYXA 4QX2A 1ZZ9A 3QH6A 4OLLA 4YM3A 3USSA 3NKTA 5DZFA 4NAOA 2XWJB 4IV1A 3HNBM 4N43C 3KT7A 4DUXA 2Z2SB 3I2DA 1U5XA 1KEXA 5HCBA 1VRH2 5D1IA 2X05A 5FPUA 3I59A 3AP9A 4P9JA 4XHXA 3PTRB 3KCCA 4JZRA 1JN2P 4QAWA 4R8HA 1S1AA 1WZXA 3N7JA 2VNVA 3PVBB 3I49A 1LCLA 2J1EA 5IVVA 4CPBA 4Q4W3 4AR2A 1MVEA 4ET7A 1YO8A 3H8XA 2XBO1 4FOYA 4AI8A 5EPAA 2HKXA 4A3ZA 4WZCA 1COV2 1R1A2 1GZWA 3IZOA 4DS0A 4MGTA 4N43B 3LEKA 2GN3A 1HRI3 3MV11 1CAUB 3LPGA 4JDNA 3SXWA 1OLRA 3SEEA 1BMV2 1UWWA 5FLJA 5J96B 4LHSA 2NP0A 3CJIB 2WFF1 1BLZA 4QM9A 4A42A 1CAXB 4L2NA 4XE9A 2QQWA 1X7NA 3KM5A 5FXXA 1LJ7A 3UGHA 1KD7A 4QQLA 3ZYBA 1YQ5A 3NV3A 4NIIA 1UKGA 1J84A 4XF1A 1V6JA 2RV9A 4S2GA 5EYYA 3GYDA 3TEZA 1AYN3 2WIIB 3VV1A 5C4WC 1EP0A 3CKHA 4IGOA 5D8AC 4R4XA 4YYOA 1GANA 3VBSA 3A7QA 1LRHA 4NRPA 3SC7X 3H3LA 2XJQA 5DUWA 1LOEA 1PM7A 3I4IA 2RJ2A 4LA2A 5I93A 1NQJA 4LOSA 3OY8B 4XXPA 4BQ3A 2WS92 3F2ZA 3E6CC 2A6YA 2BNOA 2GC0A 2HBUA 5DUVA 3ZN5A 4M0NA 3KF3A 4AFMA 4ORFA 1WCUA 1Z7S1 2AREA 4UBGA 1AXYA 5FZAA 3Q8BA 4YFZA 3BTXA 1XRUA 3IDCB 1WW7A 4OHYA 1UU6A 3CIHA 2JKBA 1JZ2A 3AKQA 1PMJX 2WT2A 3ZFGA 2WJSA 3WDUA 2ZHKA 4A44A 4JTOA 1WMEA 5D8AB 3VUOA 4GH4A 2Q5TA 5CADA 1EAH1 3WNMA 2GC3A 4HKOA 1UYYA 3I3BA 3W21A 4Y33A 1CJDA 5DZEA 1C1LA 4OHWA 1YUDA 3N7LA 1Q8PA 3LB9A 5FYTA 5IK5A 4QGNA 1OMIA 1R081 3JBG1 3ZOIA 1N1TA 3WR0A 1EV13 3WP5A 2Y6HA 4GXLA 1VRBA 4XBNA 2VM9A 3MO4A 5F8PA 5J3UA 4FFFA 3LEGA 1XNBA 4ZZ8A 5CKNA 2JD4A 4I2OA 2O0OA 1RJ8A 4LKDA 3H8RA 1W3VA 1RUF2 3PUQA 2RDNA 1M06G 1SACA 5D2AA 1C3HA 4Z92B 4A6SA 4KG8A 1IS5A 5IK8A 4OI0A 3NMBA 4Q4X2 2JJ6A 4FPYA 5AC91 1ULEA 3K51A 3PMSA 1CONA 1U5ZA 1CAUA 1US2A 3A23A 3T0AA 3HOBA 5LY2A 4GB32 1BCXA 1SBDA 5IVJA 4QKFA 3IDAA 4OMCA 2WAAA 3CJIA 1TNFA 3MICA 4QPYA 2RR11 5C7GA 3WG1A 3PU3A 5BUVA 2RJKA 2XMLA 2QUOA 3VD7A 3IDBB 4BK4A 1O4YA 1S2EA 4MGQA 4RFRB 3JZVA 5EFUA 1NE4A 4DNYA 1UYPA 2ATFA 2XWBB 4YZ3A 5JDBA 3R6SA 2A75A 3ZXKA 5I8SA 4YNIA 4LK6A 3FBMA 1H1MA 3MLJA 3WQ7A 2J1AA 3J4UH 2JB4A 4XQWA 3VDAA 2EIGA 2V4VA 3L9JT 5A6ZA 5ERLA 1O91A 3KB5A 4TN7A 3HQUA 1BVP1 4JGYA 3MW3A 3WV6A 4O61A 1F4HA 2R073 1POV1 4Q1RA 2WDBA 4E8CA 1QQP3 2BFUL 5FZ9A 2BDRA 1QDOA 2XB6C 5H9QA 4A2UA 4W6XA 1NX9A 2R043 1BYHA 5D8AA 2L9LA 4K8RB 3N7KA 1WA4A 3DYOA 4AHYA 2V73A 3AM2A 3NV2A 4GMP3 2FDFA 2XLGA 4TXWA 5FOJB 5F6LB 3P6BA 4XCBA 4UBHA 1O4TA 5T55A 5DMYA 2RE9A 3KCXA 3J7MA 3POBA 1WLTA 5LBCA 3I2HA 2VBPA 3GZUC 3MLKA 4CCOA 4AI2A 4YM2A 1AR62 4EN0A 1LOFC 3MDPA 1RUI1 3AP6A 2QE3A 3I3QA 1CZSA 5DABA 4FBFA 3EMRA 2G19A 2RM22 3POWA 4CDXB 4URAA 3ENRA 1TVGA 1W8TA 5KHKA 2I45A 5EP9A 5AFEA 3BPZA 5J1XA 4B3NA 1Q3EA 3VL9A 5ANQA 3RNSA 4IE0A 2ZX4A 1GQPA 2WWJA
chains in the Genus database with same CATH topology
2P6CA 1VE0A 1VMJA 1XBFA 2CU5A 2P6HA 1VMHA 1VMFA 1VPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6C A;  1VE0 A;  1VMJ A;  1XBF A;  2CU5 A;  2P6H A;  1VMH A;  1VMF A;  1VPH A; 
#chains in the Genus database with same CATH topology
 2CAU A;  4Q0S A;  1RVF 3;  4Y1V A;  3WOG A;  3WNP A;  1DF0 A;  3KF5 A;  3CQO A;  2JDZ A;  5FXZ A;  3KMH A;  2ZX0 A;  4DEQ A;  2R0H A;  4JX0 A;  3GNE A;  4MGZ E;  5JR2 A;  1DLC A;  3OGG A;  4LT5 A;  2XUM A;  2VD7 A;  1YHF A;  3KZ4 C;  3LWC A;  2VZ3 A;  2VOX A;  1LHW A;  2NZ9 A;  4YLZ A;  1UCX A;  1QNY A;  3OD4 A;  3QBQ A;  1W9S A;  4AGG A;  2VVD A;  4A6O A;  3NWK A;  1QEX A;  1D4M 1;  2VUC A;  2QQI A;  4HT1 T;  1RUO A;  4JKK A;  2JD9 A;  1UKR A;  1TMF 1;  5CAZ A;  1WGP A;  2V09 A;  4IEW A;  2DVB A;  3PHM A;  2WUH A;  1S0I A;  2A7A A;  4LQR A;  4M3C B;  5T5L A;  4BJ0 A;  5FK7 A;  4F3J A;  3MV0 1;  2IVI B;  2BER A;  4MVT A;  4OI2 A;  4ZPI A;  5FZ4 A;  4AGV A;  1M4W A;  2P3Y A;  2BGC A;  5L9B A;  3WW4 A;  4LIV A;  1OA4 A;  2FZ2 A;  1VJ2 A;  3FE5 A;  5FY1 A;  5JOX A;  3MID A;  3WCS A;  2R6Q A;  3KVA A;  4IXL A;  3UJQ A;  5C33 A;  1LKN A;  2DFC A;  4E2Q A;  4HVQ A;  1FMD 1;  1XJA A;  2PLV 2;  4K1Z A;  5EXO A;  1ND3 A;  3FUO A;  3V0A B;  1SDW A;  2OXB A;  4QXB A;  1ULC A;  2VVF A;  2MNG A;  5CU1 A;  1MZF A;  3VBU C;  2XJV A;  5HPO A;  4PLO A;  1IKP A;  4C8D A;  2R06 3;  1GQH A;  3PUR A;  4NWW A;  2YMZ A;  3OUI A;  1AF9 A;  5IVE A;  3PUI A;  2WSU A;  2D3R A;  3VDD B;  4CU9 A;  2Y6J A;  4AAX A;  1W2A X;  1PVC 2;  1BK0 A;  2CNA A;  1OQ1 A;  2C1F A;  3IAP A;  3ZFF C;  3CU7 A;  4E8D A;  4S2F A;  5FPL A;  5FP8 A;  4CDX A;  2D6N A;  1X82 A;  4H7L A;  4BXS V;  4LUM A;  3VBU B;  4FTE A;  4XUT A;  3IPV B;  2MHF A;  3ZX7 A;  1Y3T A;  1QOS A;  3IMM A;  5GZG A;  1BK1 A;  5KXC A;  4BWO A;  2QQK A;  1WUV A;  1WCQ A;  1LHO A;  3B02 A;  3K77 A;  4YVW C;  3PVN A;  2R30 A;  2YBS A;  3ZFF B;  4P08 A;  5HI0 A;  3ETQ A;  4Q26 A;  2VCC A;  3SH3 A;  3SQO A;  3WF2 A;  2WZR 2;  1OPM A;  2W08 A;  1FNY A;  4EN9 B;  3NAP C;  5IVB A;  2A6Z A;  2QJV A;  5JOW A;  1GZ9 A;  1SZB A;  4UOJ A;  3SKV A;  4W8J A;  4AXO A;  3NJZ A;  1U5I A;  4LBN A;  5BNN A;  1DGW X;  4Q4Y 3;  4G3Y C;  5B2G B;  2ZGR A;  1PO2 3;  4Q0Q A;  2PA7 A;  1PVX A;  4M3C A;  4N53 B;  1Q5O A;  4QKB A;  4YVW B;  4AEM A;  1W8Z A;  4RL7 A;  5FP7 A;  3NV1 A;  3WIN E;  2Q30 A;  5A7S A;  3T08 A;  3VBF B;  4AI3 A;  2XVL A;  2WN2 A;  1G6N A;  5F32 A;  4EWE A;  2WA3 A;  2ZHN A;  4IL7 A;  4XDP A;  5EV7 A;  4D7T A;  2A3W A;  1JZ7 A;  4CP2 A;  3U4X A;  2ZEZ A;  3NNF A;  2XJS A;  3NAP B;  4Q29 A;  4DXR A;  4PDW C;  1BBT 1;  5FO9 B;  2V72 A;  3MIB A;  4UW4 A;  2ZXQ A;  5ABJ B;  4PI0 A;  5JLV A;  4LHK A;  5DDJ 1;  5JVV A;  1ZBA 2;  1A8M A;  4QPI B;  5CIS A;  4GAZ A;  1JZ6 A;  1X9T A;  4M4R A;  1XSQ A;  1SLT A;  2XXZ A;  1ZA4 A;  1JOB A;  1H6Y A;  1MEC 2;  2HWD 2;  2VXJ A;  3HN3 A;  4OZX A;  4TYS A;  4XZU G;  5KHH A;  2F4P A;  2EF6 A;  1QJU 1;  5DPN A;  1OLM A;  1OUX A;  4FXK B;  2O14 A;  4TSV A;  1UZZ A;  5LAS A;  4B4R A;  4DUV A;  5L19 A;  5G05 L;  4BIS A;  3VDD A;  3ZXL A;  3MW4 A;  2GC2 A;  3SH4 A;  1FPN 2;  3O1R A;  1RUD 1;  4QPG C;  2ZGQ A;  1UXX X;  1RTV A;  3I97 A;  3I3E A;  4P9L A;  5F5A A;  4CTE A;  3AZY A;  3K4D A;  3JQX A;  2WL1 A;  4NJ4 A;  1G9F A;  2CWS A;  1GMM A;  2JE9 A;  3QAC A;  3PL0 A;  1V6L A;  3W5N A;  4UFJ A;  1RHI 1;  3IPV A;  3M3I A;  5FZF A;  1PX3 A;  2NN8 A;  3ON7 A;  4Q8K A;  3GCW A;  3ZO0 B;  3N35 A;  3WP6 A;  3OYW B;  1AR9 3;  4PT6 A;  1H8V A;  4LUL A;  1W9F A;  3POF A;  5FQ0 A;  3PUH A;  1RUC 3;  3WUC A;  4FAH A;  3ZYH A;  5JZG C;  4KI5 M;  1REF A;  2IXJ A;  1XB9 A;  3T1L A;  2R16 A;  2RS1 3;  5IK4 A;  3CZU A;  4MYE A;  1PHM A;  3DKW A;  1DGL A;  4E4H A;  1BHG A;  2WWU A;  3AMN A;  3ZDV A;  5K0U B;  3I2O A;  1LEN A;  4NR1 A;  4A4A A;  1E5S A;  1R09 1;  4K40 A;  1VBD 1;  4K20 A;  1Y43 B;  1W0N A;  2JG9 A;  3R05 A;  3OTF A;  4GJZ A;  1VB4 A;  1UL9 A;  4XFA A;  5APA A;  4Q0U A;  4N53 A;  4YVW A;  4AI1 A;  5JZG B;  2CGP A;  1JZ3 A;  3OBA A;  4OHX A;  3D5O A;  4NPM A;  1C57 A;  2NYY A;  3JD7 3;  2EIE A;  2E63 A;  2PHD A;  4DFS A;  1FNZ A;  4IND A;  3VBF A;  4YW4 A;  3PVE A;  3LFM A;  4CEW C;  2W47 A;  2HWE 1;  4XZP A;  1AR8 3;  1NCR B;  2VW2 A;  3SIT A;  3AZX A;  2YHJ A;  1ZM1 A;  4Q4V 1;  3T1M A;  2E31 A;  4HON A;  1RJ7 A;  3UET A;  4C1X A;  1FXZ A;  3WW1 A;  2UU8 A;  4URT A;  2JDY A;  5ABJ A;  3VBO B;  4CU6 A;  2W94 A;  5DAX A;  3R0R A;  2NPI A;  2GH2 A;  4YZ4 A;  1Q56 A;  5F3C A;  1DYO A;  4QPI A;  2P3I A;  1HB2 A;  2VUD A;  2ZAB A;  4KU7 A;  3J9S A;  4JC1 A;  1WBF A;  1UOG A;  5IVY A;  5DAQ A;  3URF A;  2X29 A;  4F7Z A;  3SH5 A;  5JSP A;  1OC1 A;  2MEV 1;  1TE1 B;  3LA3 A;  2UWC A;  2D44 A;  5ISL A;  2EIC A;  5FO7 B;  1ACC A;  1A6C A;  1V6I A;  3B94 A;  5A7P A;  3PIJ A;  1I1E A;  2YGM A;  5BNP C;  2DVD A;  2WZE A;  3ASI A;  2DCZ A;  4QMA A;  2P1B A;  1RED A;  2YB7 A;  1WMX A;  2ERF A;  3BAL A;  1XE0 A;  5JUV A;  4UFM A;  5GZD A;  2EAL A;  1AL2 2;  4JV4 A;  2D5H A;  2PTM A;  1HJF A;  3TN9 1;  3ZYF A;  4OYU A;  4CEY C;  1IQA A;  4ZU4 A;  3N3H A;  2FDJ A;  2VME A;  1AJK A;  2YUE A;  3HEI A;  3OYW A;  1H1A A;  1W2N A;  3I3D A;  2E6V A;  1W9T A;  1MS9 A;  2YBK A;  3ACH A;  4N7I A;  3MF9 A;  4P14 A;  1NY7 2;  3QH7 A;  3H1W A;  4KG0 A;  2WFF 3;  3ETP A;  3Q8F A;  3TNQ A;  4CUC A;  1WCK A;  5JSO A;  5BNP B;  1PZ9 A;  1WLW A;  5IAX A;  4COZ A;  1QJY 1;  1W8N A;  4ZXK A;  1POV 0;  5K0U A;  4J25 A;  3EJK A;  5FLH A;  4U2A A;  4ASM B;  4C91 A;  1APN A;  4NRM A;  1UOB A;  1NCQ B;  2VH9 A;  4QX0 A;  3UGF A;  1W6Q B;  2QQU A;  3D0J A;  4NO4 A;  4UYB A;  2VY0 A;  2HWB 3;  1CQ9 A;  4CEY B;  4XCA A;  2NMN A;  3IKW A;  5DUU A;  3MIH A;  4DY5 A;  1H8T B;  3SCG A;  2A3X A;  2OQ6 A;  2W46 A;  4JRA A;  4XUP A;  1TEI A;  2BWC A;  1XC6 A;  5KC5 A;  4D8M A;  2RVA A;  2BPA 2;  1AR7 1;  4WM7 C;  1CR7 A;  1NCR A;  3HR9 A;  3O1M A;  1HRI 2;  2BGO A;  3DGT A;  4KMQ A;  1ZZ7 A;  1Q8V A;  1CX1 A;  3A22 A;  2AAC A;  4FFI A;  3ME2 A;  5LCW L;  1QF3 A;  1CN1 A;  4IW3 A;  3VBO A;  4IDZ A;  3WDV A;  2BJS A;  1EAH 3;  2EVX A;  2C26 A;  4XIK A;  3E5Q A;  3CJX A;  5IUQ A;  4DOU A;  5KC6 A;  1AYN 2;  2VEC A;  4XHB A;  3H8U A;  1N47 A;  1F2N A;  3JBG 3;  1ZA7 A;  3POY A;  4NHX A;  3JB8 A;  4FPE A;  3I2F A;  2J1R A;  3J7L A;  1KS4 A;  4XJU A;  4LLF A;  1GNH A;  4A3X A;  1C5H A;  1SLL A;  2Z69 A;  3C3V A;  5B4N A;  3SNM A;  1COV 1;  1R1A 1;  1SG3 A;  4I3P A;  4RQP A;  5GAL A;  4J1X A;  3LA7 A;  4DPN A;  1JYV A;  1OBN A;  2QQO A;  3IIA A;  4LBJ A;  1E57 A;  1R64 A;  3K4A A;  3M3O A;  4DY3 A;  1BMV 1;  1KDM A;  4V2V A;  5BXX A;  3RYR A;  1IS3 A;  2XDV A;  1LOA A;  2B8M A;  1MZ5 A;  1NA1 B;  2HEY F;  3VB9 A;  2IVJ A;  3VHR A;  2Q8O A;  2DWR A;  1HXS 3;  3T09 A;  1QXR A;  4D6R A;  5LA1 A;  1ZRI A;  1RUJ 2;  2N7G A;  2ZGK A;  4HET A;  5KHG A;  4W6W A;  2OYZ A;  3KV9 A;  2XQX A;  1RL3 A;  2JWP A;  5JCT A;  2PAM A;  4UFK A;  1P8J A;  4P9Y A;  2WS9 1;  4LE4 A;  2VZU A;  3W58 A;  3ZSL A;  1J3R A;  2B9U A;  5FP9 A;  4YGB A;  5F7U A;  2DF7 A;  3O0X A;  1NCQ A;  2DCJ A;  5C3Q A;  2NQY A;  4WZF A;  1QJE A;  2EAA A;  3HNM A;  1B09 A;  5CKM A;  5F5Q A;  4Y1Z A;  2B46 X;  1RC6 A;  5F3G A;  4WVM A;  1JYX A;  3I2G A;  1H8T A;  1R09 2;  1W03 A;  3OGJ A;  4LUK A;  3IDE A;  4SLI A;  2ZAA A;  2A1X A;  1VBA 3;  2XKP A;  3RFR A;  2PAE A;  2CL2 A;  1LR5 A;  1G7Y A;  1OH4 A;  5F5C A;  2WQZ C;  5GZE A;  3G7D A;  3LF7 A;  5DXD A;  1IZ3 A;  3T2Q A;  3AJZ A;  2B7Y A;  2OZ6 A;  4AL9 A;  1MS5 A;  4FP2 A;  4AZZ A;  1UU4 A;  4BDV B;  5C70 A;  4QXC A;  3I8T A;  4XXA A;  3VZO A;  2TUN A;  1XYP A;  4KWJ A;  2PHT A;  3B93 A;  2OZJ A;  4IEX A;  2W3J A;  4C90 A;  2V5Y A;  4KWK A;  3ZYR A;  1K3I A;  2BBA A;  1RUF 1;  2OPW A;  2ZGS A;  3T3Y A;  1JZ8 A;  2VQT A;  3LQC A;  1JTZ X;  1GP4 A;  4Q4X 1;  4FPF A;  4N7U A;  2OUJ A;  5T5P A;  1C8N A;  2YPD A;  3VBH A;  2JDM A;  5JI9 A;  3I2I A;  4XJ9 A;  4GB3 1;  3RZK A;  1WMD A;  3LGR A;  1GU3 A;  1QQP 2;  2ZOE B;  4ISR A;  4FXG B;  1H9W A;  4RGK A;  3VBS C;  2Y60 A;  3LOI A;  5C3R A;  3AK0 A;  1GZW B;  3SMH A;  1JOJ A;  3PUA A;  2R04 2;  3BPS A;  1HJG A;  1NA1 A;  3C7E A;  1ZRF A;  3MW2 A;  1GOH A;  1CPN A;  3H3U A;  1S0E A;  2XPJ A;  1ENS A;  2WYS A;  3X29 B;  3O1S A;  1DBN A;  5CFC C;  1GZT A;  1UX7 A;  5A1L A;  2D97 A;  3N9Q A;  2WNO A;  4LHL A;  3AMM A;  4I3G A;  1O3S A;  1HQL A;  1OA3 A;  3MIE A;  4K9S A;  2VU9 A;  2F6B A;  2VOT A;  4OUE A;  1NG0 A;  3V56 A;  1D4M 3;  1GIC A;  5JAX A;  1QU0 A;  2XJU A;  2H6C A;  2ZGO A;  1TME 2;  4GH4 C;  1SBE A;  3BOP A;  1OSG A;  3ITQ A;  1TMF 3;  2BGP A;  2VC9 A;  1HW5 A;  3J8F 3;  4OUL A;  4LEJ A;  5DAV A;  2NM1 A;  5FMO S;  2K2S A;  1QJZ A;  4CPB D;  5ACA 1;  2R0F A;  1ZRD A;  3W59 A;  1IQD C;  1J83 A;  3WD5 A;  1V00 A;  3K3N A;  2ENR A;  5CFC B;  1CVN A;  4UFL A;  4GAL A;  3NNG A;  1RVF 2;  3UKN A;  2FHR A;  4YSF A;  2BV4 A;  1RUG 3;  5FMD A;  4BK5 A;  2YG0 A;  1KJL A;  5FUP A;  2XR4 A;  3VBR A;  4HKL A;  2RDR A;  4ZHN A;  1UAI A;  1AR6 1;  3VZM A;  5H9S A;  1K5J A;  1ULP A;  2VTX A;  2WLQ A;  4FPL A;  1F31 A;  1NE6 A;  4JGZ A;  3WP4 A;  2DU1 A;  2IXI A;  2RM2 1;  1CZV A;  1XE8 A;  3CEW A;  2X10 A;  3AFG A;  3MYX A;  5ANN A;  1LOB A;  5LRR A;  4YFW A;  4BU2 A;  2HJI A;  2YDE A;  3O12 A;  3JCI A;  2B9V A;  3R4U A;  3ZR5 A;  3B5L B;  4NRO A;  4AVV A;  2X8K A;  2UWA A;  3CJI C;  4QHZ A;  2PN5 A;  2WT1 A;  1Q8Q A;  4BQ4 A;  1H2M A;  4I0W B;  2P3K A;  4CCL A;  1PGW 2;  1XU1 A;  5F39 A;  5FBZ A;  1RMU 3;  1ZBE 3;  3OEA A;  3RZJ A;  4R52 A;  1H2L A;  5C8C A;  2JDU A;  5KHJ A;  2GC1 A;  3VKF C;  3LZZ A;  4MGY E;  3FX3 A;  2BWA A;  4V2W A;  2RDQ A;  4F83 A;  1GNZ A;  1KXG A;  3D3A A;  3NV4 A;  4PBP A;  4JQT A;  4QDQ A;  5AVP A;  2ZX1 A;  1ZZ6 A;  4GUL A;  3AKT A;  5FYZ A;  4FPC A;  1O3T A;  5FPZ A;  5FAX A;  1YNA A;  4IEZ A;  2R1B A;  5FMB A;  4JGY C;  2XHN A;  1FOD 3;  3DEC A;  3ES1 A;  4ISQ A;  3AVS A;  1GSL A;  2R06 2;  1EYB A;  3HMY A;  3Q8C A;  4PJY A;  1UIK A;  5T5O A;  1AX2 A;  4DXT A;  1UXZ A;  1MAC A;  1RUH 3;  1Y4W A;  1JMU B;  2JDN A;  5E6H A;  1TNR A;  3O1U A;  2D6L X;  3UT0 A;  3M2M A;  2CSG A;  3FZ3 A;  1OQD A;  1ASJ 2;  4AHW A;  3WF4 A;  4LO7 A;  4XAB A;  4YW6 A;  5FZ1 A;  1OUR A;  3THD A;  3EO6 A;  2W92 A;  4KGG A;  3MFC A;  4KWL A;  1OFS A;  1UZ0 A;  3NJX A;  3VL8 A;  5C3S A;  4M3C E;  4XIO A;  2LRP A;  1AXZ A;  1D2S A;  1PO1 3;  2JEM A;  4JGY B;  1QDC A;  2X5I C;  3AKS A;  4KNC A;  2CAV A;  4M0H A;  1UNB A;  4RHV 2;  2PLV 1;  4XFG A;  5CFC A;  2WKK A;  4AQ6 A;  1DZR A;  2W52 A;  2BUK A;  2EXI A;  2PHR A;  4JHZ A;  5FLI A;  2BBV A;  3ZN4 A;  1QOO A;  3OCP A;  1ZYB A;  5FUN A;  3ATG A;  1XYO A;  1HKD A;  4I09 A;  4LR4 A;  4MH0 E;  4PQ9 A;  3WUD A;  3EHK A;  5DDJ 3;  1PVC 1;  1KDK A;  4B8E A;  2GNT A;  4D69 A;  5FJK A;  5LK5 A;  4GMP 0;  1W2T A;  3OPW A;  3WZ1 A;  3A0K A;  1QNW A;  2X5I B;  1VBC 2;  3BB6 A;  1QJU 3;  4KH9 A;  4GZ9 A;  2CY6 A;  4MG2 A;  3VLB B;  3VZL A;  4COY A;  1OLM E;  2ADD A;  3GXU A;  4CUG A;  2ORX A;  2UYB A;  1W8O A;  1YFX A;  4XQD A;  5AFB A;  1MS0 A;  3OGS A;  1GBG A;  2BZD A;  2WIN B;  3ALQ A;  5KXD A;  3AZV A;  3KCY A;  3DEM A;  4K7J A;  5I0T A;  3KD4 A;  1RHI 3;  1V9U 1;  4J1W A;  1F15 A;  1U12 A;  1O5L A;  4M00 A;  4Y24 A;  4CDU A;  1ONA A;  3LSD A;  1UY4 A;  2B5H A;  3GAL A;  1SBF A;  4MXW B;  3WDT A;  2WZR 1;  4BQW A;  2R7E B;  5FYY A;  1RB8 G;  1QKQ A;  2LAL A;  4MV2 A;  4HN1 A;  3BKZ A;  2YY1 A;  2WBK A;  3MF6 A;  1WD4 A;  2Y34 A;  3FFZ A;  1CES A;  3ZXJ A;  2QNK A;  4FOV A;  1ULF A;  1O8S A;  2ZTN A;  5H9P A;  1CZT A;  2Q1F A;  3GHN A;  1VAK A;  2XLF A;  4FP3 A;  3PNA A;  3RMX A;  1CAV A;  3WG4 A;  1XE7 A;  2RS3 2;  1N3P A;  4EV0 A;  2WO7 A;  4JKL A;  4UFH A;  4PBO A;  1VBD 3;  5LA0 A;  3BI3 A;  1K12 A;  5BYN A;  3KV4 A;  3S57 A;  2CWM A;  2UYA A;  2W2I A;  2D40 A;  3AXE A;  2RS5 3;  1ND3 C;  3OEB A;  4GKY A;  1O5U A;  3INA A;  3CBN A;  3HBZ A;  4GJY A;  4QHO A;  2HH9 A;  2LRO A;  1MZ6 A;  1ZX5 A;  2GH8 A;  4XDQ A;  2ZZQ A;  3AB0 A;  1W05 A;  4MSV A;  1LAJ A;  1ZBA 1;  3DXT A;  1WKY A;  4AWD A;  1OA2 A;  3C2U A;  5B4X A;  1JBC A;  3O1O A;  4CCJ A;  1LHU A;  4Q4V 3;  2C24 A;  2WQ4 A;  1VBE 3;  2ID4 A;  5ACA 2;  1HN1 A;  1RUC 2;  1MEC 1;  1US3 A;  2HWD 1;  2UY8 A;  1UD1 A;  2YZ4 A;  3FLP A;  4MX3 A;  4UW3 A;  1JYT A;  4RR3 B;  4JDM A;  1H1I A;  1SFN A;  4CDX C;  3NW4 A;  4LE3 A;  5E1R A;  3M3E A;  1ND3 B;  3AP7 A;  2E53 A;  3RMY A;  2FCV A;  1FPN 1;  4NMI A;  5EYX A;  5I8Y A;  1GWL A;  3IAQ A;  3UKT A;  5A3O A;  5CIR A;  3LOB A;  2FCT A;  1ODN A;  4OHZ A;  2WZ8 A;  1DGW A;  1VBB 3;  2I07 B;  2ZMK A;  3M3Q A;  1W2O A;  4LLO A;  3U07 A;  1PMH X;  2X5I A;  1W8H A;  1MQT A;  1OQE A;  3U78 A;  4CYD A;  3ZR6 A;  5EQU A;  5D21 A;  2ZAH A;  3V65 A;  1PZ8 A;  3DPR B;  2FMY A;  2A5Z A;  3JD7 2;  4EN7 B;  3OD0 A;  4K3U A;  3FBY A;  5FZH A;  2Y38 A;  4UFI A;  3WHT A;  3UGG A;  2VJX A;  4GIQ A;  3AZW A;  4TLG A;  3HQR A;  3VN4 A;  1O7F A;  1WW5 A;  3JUU A;  5KXB A;  3OBZ A;  5BNN C;  1YJL A;  4MXW A;  1VP6 A;  3AKR A;  3TN9 3;  4JHT A;  4Z82 A;  5CNA A;  3W9A A;  2MPF A;  1JYC A;  2EA7 A;  2QQL A;  1VAM A;  3AC0 A;  5FZC A;  4CE8 A;  5JI7 A;  4AQ2 A;  1Y9M A;  3VDC A;  3UK9 A;  2K9Z A;  4K6B A;  2VBB A;  3AXD A;  1VMJ A;  4FFG A;  1QJY 3;  2OT7 A;  4JCK A;  3U0Z A;  1XU2 A;  3KHC A;  1FX5 A;  2J7M A;  4HK9 A;  4JDO A;  4XFB A;  4IEO A;  5IT6 A;  1W9W A;  1UO9 A;  3N9M A;  5BNN B;  3S0M A;  3DKQ A;  1H4H A;  4EE2 A;  2VZ1 A;  5FKB A;  1S0C A;  2DBN A;  3FWE A;  1FAY A;  4YZ2 A;  3ELN A;  1J3Q A;  2PAK A;  4OQ8 A;  3RZM A;  1CAW A;  3E97 A;  3B00 A;  5C5U A;  2QDR A;  4N90 A;  1G9D A;  5A3L A;  4ZON A;  2B45 X;  3THC A;  3VDD C;  3N9L A;  1C8M 1;  2VCM A;  3B7M A;  1H30 A;  1OKO A;  1QY4 A;  3EBR A;  1KRI A;  2W1S A;  3AVR A;  5FZG A;  2VTF A;  3N4M A;  4XET A;  1XNC A;  4RR3 A;  3T2P A;  3WG2 A;  3EXU A;  1SLA A;  5T3N A;  5A3W A;  2A73 B;  1YYN A;  1VRH 3;  4FPH A;  1X50 A;  3ZVX A;  1V6N A;  5FIX A;  3T4V A;  3BTY A;  1ENR A;  4HLT A;  4LBK A;  4ARY A;  1S2B A;  3HWJ A;  3VZN A;  2VPV A;  4CU8 A;  2G9F A;  4JVA A;  5I91 A;  4IER A;  2ZHL A;  2NMO A;  4AFA A;  2HWB 2;  5J48 A;  4CP1 A;  4ITC A;  2HWC 2;  2A71 A;  5C5T A;  1JS9 A;  3VGI A;  1NXD 1;  4MET A;  1LHV A;  1AL2 1;  2IFW A;  2DDU A;  3DPR A;  3KT4 A;  1COV 3;  2CDO A;  4RFT 0;  4AE2 A;  1UYZ A;  4AHZ A;  3SHR A;  4C0B A;  2D3S A;  3M7A A;  2P2K A;  1YEW A;  2VOW A;  1DP0 A;  1GOG A;  3BOD A;  4Q0V A;  1XXN A;  4LIU A;  1NY7 1;  2JG9 C;  2XON A;  5JPN B;  4NOT A;  3HT2 A;  5C3P A;  4RSU A;  3BOW A;  4N53 C;  5FQ0 B;  3O1V A;  3MI8 A;  5CYY A;  5J98 B;  1IHM A;  3AYE A;  4S2H A;  1UY1 A;  3E5X A;  1S0J A;  1DCS A;  1WCD J;  1V9U 2;  5LA9 A;  1QJF A;  3VBF C;  2BNM A;  2OVU A;  5JPM B;  4S2D A;  4QX8 A;  1DYP A;  3MIG A;  1OKQ A;  2W87 A;  3TB0 A;  1HQW A;  3LIG A;  4PCR A;  3UJO A;  2WO1 A;  4ES9 A;  4H55 A;  3HNY M;  4ERO A;  5HXM A;  2XL7 A;  3VD3 A;  2GAU A;  2VMC A;  3RDI A;  2BVB A;  2HYK A;  2JG9 B;  3FJS A;  4MO3 M;  5ABJ C;  3T4H B;  2K0G A;  2RMU 3;  2Y6G A;  1YQ2 A;  5A3N A;  3BTZ A;  2Y6F A;  2C9A A;  4YWA A;  4BQ1 A;  1BEV 2;  2JEN A;  2X09 A;  1IS6 A;  1HRI 1;  1UZW A;  4QPI C;  2Q8E A;  5JMO A;  1OOP B;  1PMI A;  1DGR N;  4LBO A;  5DN2 A;  2YFU A;  3G6J B;  3WQB A;  3ZXD A;  1DYK A;  3ACG A;  1UY0 A;  2VXR A;  3P5B A;  2YC4 A;  4PQQ A;  2DCT A;  4Y1Y A;  1QXJ A;  5FZE A;  3N36 A;  4ZXE A;  1D4V B;  1I5Z A;  1JW6 A;  1R1Z A;  4YVS B;  3UKV A;  1AXK A;  2WO3 A;  1HXS 2;  4LK7 A;  2SBA A;  1AYN 1;  4M01 A;  4V1P A;  4AFD A;  3E6D A;  3MFA A;  4QX1 A;  3ZKY A;  2PEL A;  2WQ8 A;  3N7M A;  4UT5 A;  3ZMO A;  3P3P A;  5E88 A;  4AGR A;  5FP4 A;  3S6P A;  4FT8 A;  1EUT A;  4N9I A;  4BQ2 A;  2FDG A;  1Y7B A;  2QVS B;  4AI9 A;  1W28 A;  4HXC A;  3OG2 A;  3KGZ A;  3RWN A;  1PIV 3;  4NRQ A;  5A80 A;  5HCH A;  1RUF 3;  4UW5 A;  1STM A;  2ZZJ A;  1ULG A;  4E2G A;  1YQC A;  1S55 A;  3SCF A;  3D6E A;  2D7F A;  4Y22 B;  3POE A;  3SEP A;  2WNE A;  3RZL A;  1SPP B;  1TZO A;  2DCK A;  5K0U C;  1JOP A;  1SLI A;  2EAK A;  1VBA 2;  1CIW A;  1L7L A;  4IE4 A;  4X8P A;  1RUJ 1;  2HBT A;  2VMF A;  2GU9 A;  3AX4 A;  3ZYG A;  2O8O A;  5BNQ A;  5GZC A;  2VZR A;  3T2T A;  4L8Q A;  4R9C A;  3KT1 A;  1OI6 A;  4D6S A;  3APB A;  2VQA A;  1G8W A;  3L2Y A;  1I6X A;  3M4F A;  3C7G A;  4IEU A;  4M3C F;  4UI9 L;  1N1V A;  5IK7 A;  5FY0 A;  4CUB A;  3PME A;  1K45 A;  1URX A;  1MR5 A;  4DRR A;  1QJX 3;  1IS4 A;  3DN7 A;  4AFC A;  2W91 A;  1NCR C;  4H2A A;  2GME A;  2XLA A;  4L0P A;  4DMI A;  1O6U A;  3UES A;  5HCF A;  2ZX3 A;  4BE3 A;  3EYP A;  2GND A;  4QXH A;  4QX3 A;  1TG7 A;  2VTX J;  3POJ A;  1RUE 3;  3FHQ A;  4X6Q B;  3VBO C;  4EN8 B;  4E4D X;  4Z8B A;  5FY8 A;  5IFP A;  4JQR A;  5C6C A;  1NZC A;  4Y5T A;  2XQR A;  1NLQ A;  3E6B A;  5FXW A;  1HB3 A;  1ZZC A;  2B4K A;  1MS4 A;  2VMI A;  3CZJ A;  3U1X A;  4XJW A;  2Y64 A;  1OOP A;  1XND A;  4P9I A;  4RN5 A;  3D82 A;  2BTV C;  4LXL A;  1D7P M;  3NKG A;  1ENQ A;  3W20 A;  4OI4 A;  3PJY A;  3VZK A;  2D5F A;  1Z0H A;  3IB3 A;  3J7N A;  4HZF A;  5FZ8 A;  1QIQ A;  4YVS A;  4ES8 A;  5FWJ A;  2ORZ A;  1W8F A;  1NYW A;  4RQP C;  4BLI A;  4TZD A;  1HRV 2;  1W0P A;  1C4R A;  3H7Y A;  1CD3 G;  2ZGN A;  4DEV A;  2IUW A;  3I2K A;  3K2O A;  5JOZ A;  1AYM 2;  4FO9 A;  1W39 A;  4FOQ A;  1C8M 2;  1DHK B;  2P6C A;  4HFS A;  2VAU A;  4NWV A;  1LNS A;  4W4Z A;  4AFB A;  2I2S A;  3RYP A;  3WP3 A;  4FQ4 A;  4OUM A;  3VZJ A;  2XUE A;  1HV0 A;  1X9P A;  1W0O A;  3WDX A;  4KU8 A;  3GZE A;  3J8F 2;  4HSJ A;  4WM8 B;  1QQP 1;  1IPJ A;  3T0B A;  5HCA A;  4AEJ A;  2WNU C;  1JU3 A;  1I5P A;  4ONU A;  2FQP A;  1HDK A;  4RQP B;  3QCW A;  1GZC A;  1N1Y A;  2R04 1;  4Y22 A;  3TEW A;  3WF1 A;  4XJ8 A;  2LUW A;  5FYI A;  1SPP A;  4CDQ C;  1KIT A;  3EB7 A;  2ZML A;  3U4S A;  4Z2A A;  4GMP 1;  2W39 A;  5IAT A;  2GDF A;  2XBO 3;  3WQ1 A;  2H0V A;  1NCQ C;  4Z1V A;  2HWF 2;  1KFU L;  4CCM A;  4QGM A;  4L97 A;  4BXF A;  3K46 A;  2QQP A;  3PIG A;  3TRS B;  3O5S A;  5L7O B;  5KBF A;  1H8T C;  2WNU B;  4B29 A;  5FPA A;  2J42 A;  1TME 1;  2DBI A;  4AG4 A;  1W90 A;  4Y1X A;  2XJR A;  4CDQ B;  3O7O A;  1OD3 A;  2ZGP A;  3LAG A;  2I74 A;  2YU1 A;  1AUY A;  3GCX A;  3IWZ A;  1CPM A;  3KV5 A;  1A34 A;  1DQ0 A;  1RVF 1;  2VUJ A;  4GQ7 A;  1RMU 2;  1ZBE 2;  4R9B A;  4W6Y A;  2CU5 A;  1OLQ A;  2FCU A;  2VZT A;  2DUP A;  4WVM B;  3ZFE A;  4Q4W 2;  4GWJ A;  5IAV A;  4IV3 B;  4B4P A;  5LZ6 A;  1DGR A;  1L3J A;  1YLL A;  3ZYJ B;  1XNK A;  3LPF A;  1Z7S 3;  3POS A;  1ALY A;  2DCY A;  3ZXG A;  2PQS A;  2PLV 3;  2BEO A;  4TWT A;  2ZX2 A;  2JDP A;  5I0D A;  1X8M A;  4D3W A;  5FZO B;  2VO5 A;  1C1F A;  5CBL A;  1F35 A;  1W8W A;  5FPV A;  3NQH A;  1BQP A;  3UYJ A;  3VBH C;  1FOD 2;  1UMZ A;  4UW6 A;  4AVC A;  1G9C A;  5DG2 A;  1H0B A;  4I01 A;  2DYC A;  1XPW A;  3ZKU A;  3RJ2 X;  1RUH 2;  2DV9 A;  4HPK A;  2GMP A;  4KGQ A;  1PGW 1;  1PM4 A;  2RDS A;  3IBM A;  3IN9 A;  1NA1 C;  1DQ4 A;  1R08 3;  4J6G A;  5FRE A;  5LEK A;  1VAL A;  2ZGT A;  2ZPX A;  4CCN A;  1DZQ A;  1SEF A;  4JTN A;  4KBB A;  1V0A A;  4WM8 A;  1BZW A;  3MBW A;  3RS6 A;  2TEP A;  4QU2 A;  4JAA A;  3TWI A;  4AAP A;  1LUL A;  1A3K A;  1UMH A;  3HT1 A;  3J7H A;  1PO1 2;  5F3E A;  1HV1 A;  3VBH B;  5I0U A;  1UPI A;  2WC2 A;  1N3Q A;  5F6K A;  2PHL A;  4UF0 B;  2FDH A;  1L7R A;  2OS2 A;  2VZP A;  3AMP A;  1VIW B;  2ZJC A;  3H42 B;  3AL6 A;  1V6K A;  3HQX A;  4Y5S A;  5DQ0 A;  2XHK A;  2ZEX A;  2A6X A;  3B69 A;  3M3C A;  4GWI A;  2IFR A;  4QKN A;  2CGN A;  3CO2 A;  1XNT A;  5AC9 3;  2R06 1;  3OJB A;  2ZMN A;  4COW A;  3THP A;  5F2W A;  1W6O B;  2JB8 A;  5A7W B;  2CYF A;  3H7J A;  3USU B;  3D4K A;  5L7O A;  5J36 A;  3GBF A;  1YCI A;  3HVD A;  2WNU A;  4UWD A;  5TSW A;  3RI8 A;  1ASJ 1;  3C7F A;  2RR1 3;  4ZY9 A;  1ZZB A;  3PVO A;  4CDQ A;  1EV1 2;  4IET A;  2IZW A;  1EUU A;  1H2K A;  2PQQ A;  2Y26 A;  4IE5 A;  4NUB A;  3S5A A;  3MUZ 1;  3B01 A;  1PK6 C;  1YXW A;  5FTT C;  4RHV 1;  1XYN A;  1AX1 A;  3ILF A;  4HVR A;  3H3Z A;  4YG0 A;  3VBR C;  5FPB A;  4XDO A;  4LKF A;  4LPL A;  3KQ4 B;  3ZXF A;  4CCE A;  1RIR A;  4NVP A;  4D6Q A;  2IXC A;  5GZF A;  3NNJ A;  3ZSK A;  5GJ6 A;  2PMW B;  1MZE A;  3NNL A;  4JGZ C;  2BFU S;  4L92 A;  5A7Q A;  4IV3 A;  2SLI A;  5J37 A;  2K46 A;  4XF3 A;  3BU7 A;  1POV 3;  1ZBA 3;  2JG8 B;  3GJB A;  2JX9 A;  3DUI A;  5FZO A;  3NST A;  4TLF A;  4BQY A;  4CXW A;  4A45 A;  1EY2 A;  1GLH A;  2A6W A;  2HWD 3;  1PK6 B;  1AVB A;  1SLC A;  4P5Y A;  2YGL A;  3VBR B;  4IUG A;  1VBC 1;  2Q1Z B;  4QB2 A;  3WW3 A;  2FDK A;  2ZA9 A;  1RIN A;  4Q4Y 1;  2H0B A;  3AKP A;  2C4X A;  1XOY A;  5C8C C;  3M70 A;  2ETE A;  3T30 A;  1FV2 A;  5KHI A;  4CZS A;  4LBQ B;  4JGZ B;  1D0H A;  2E7A A;  3K48 A;  4Y5Z 0;  4G4F A;  4FTB A;  5DAP A;  5EIY B;  2VOK A;  4KBZ A;  3SLI A;  4XAE A;  2RS5 2;  4K8F A;  1OVP A;  4GA9 A;  1IKQ A;  1DIW A;  1AHS A;  2WAB A;  5FO8 B;  3DXU A;  3RZH A;  1WMF A;  4OMD A;  1RUI 3;  3LDR A;  2E51 A;  3OB8 A;  1A8D A;  1UIJ A;  1EPW A;  2ZGM A;  1NAE A;  2WFP A;  3CHX A;  2VMH A;  2VW1 A;  2WR9 A;  5C8C B;  2R07 2;  4UF0 A;  2C6S A;  4IEQ A;  4Y3O A;  2YRO A;  5IJR A;  4CDW A;  4AVA A;  4ZS2 A;  1VBE 2;  3O0W A;  4HVO A;  3O14 A;  4O9E A;  3BTA A;  4D7Y A;  1DLL A;  2HEW F;  1K5M B;  5DAW A;  4DXS A;  5FP3 A;  3U75 A;  3WY6 A;  1W6O A;  4LO4 B;  5A7W A;  4Z2W A;  3USU A;  1YQ6 A;  2JDH A;  2DFB A;  4LKS A;  3Q8E A;  4Q1P A;  2RS3 1;  1ND2 A;  3ABZ A;  2A3Y A;  4IEP A;  1FI2 A;  1E5H A;  1YIF A;  2JKX A;  4EWA A;  2W0X A;  4YZ1 A;  3CMG A;  1JU4 A;  1QGL A;  1VBB 2;  2C0Z A;  2E26 A;  2FBE A;  5CFD C;  1PZ7 A;  4QPW A;  3I7D A;  4JKM A;  3FMG A;  3NO8 A;  1NZI A;  3MPB A;  3P3N A;  2Y8K A;  2OQ7 A;  4YZ5 A;  3ZSE A;  3III A;  5A33 B;  5E16 A;  3PU8 A;  2G1M A;  1W04 A;  1UZV A;  1RUC 1;  1JI6 A;  2KA3 A;  5FY7 A;  5BV6 A;  4CCD A;  2YYO A;  4OVE A;  1H6X A;  1UQX A;  2QCS B;  4ZU5 A;  3T2O A;  4B1L A;  4LNV A;  1H9P A;  2GP5 A;  3E1F 1;  3MPP G;  5K7P A;  2JG8 A;  2QDN A;  3RJR A;  3VD5 A;  1S4C A;  2XH6 A;  5CFD B;  3RSJ A;  3WF3 A;  2VNG A;  3LEI A;  1JHN A;  4RS5 A;  2IC1 A;  5EWS A;  1NUK A;  5A1F A;  4H14 A;  1Q43 A;  2PHU A;  1PK6 A;  3TBD A;  2D3P A;  4YGD A;  3ZMN A;  3KGL A;  5FYC A;  1BXH A;  1FMD 3;  2BYV E;  5AVA A;  5T5J A;  4CDU C;  4LBQ A;  3PDQ A;  5EZW A;  3JD7 1;  2C5D A;  2D6M A;  1ULO A;  5A7O A;  2ZS6 B;  4XOG A;  4BB3 A;  1XQN A;  3RGB A;  5SV8 A;  1GNY A;  1PNG A;  2D43 A;  2QZ2 A;  4H3W A;  4RGG A;  3WNO A;  4AI0 A;  5FZ7 A;  3HJR A;  1WA6 X;  5BNO A;  2VE1 A;  2KR2 A;  2R1D A;  3VKM A;  4FPK A;  3WSO A;  4MZU A;  1D0G A;  5GLU A;  4E2S A;  1W6N A;  2P6H A;  5LBF A;  1XSR A;  5I8T A;  4CDU B;  4GWM A;  4XTP A;  2FZ1 A;  1YC6 1;  5FZD A;  1UY2 A;  2WNV B;  3DCQ A;  2Z42 A;  1K5M A;  4QX7 A;  1HN0 A;  1PGS A;  2GMM A;  1G9A A;  1YFU A;  2D98 A;  3WG3 A;  3OUJ A;  3SIS A;  2BQP A;  1DG6 A;  5IFT A;  3ILN A;  3BGA A;  3DL3 A;  3TEY A;  4NN0 A;  4R4Z A;  2JIC A;  2BVV A;  2CV6 A;  2PHF A;  5M0T A;  5LEJ A;  1RGS A;  1I3H A;  3ZPY A;  1H2N A;  3GDB A;  1O8P A;  4ATE A;  2IXK A;  4ATF A;  1CAV B;  3AYA A;  4NIA A;  1SLB A;  4WV8 A;  4RD7 A;  4HMZ A;  2W9X A;  4W50 A;  4XJZ A;  3OGV A;  5C8W A;  2Z4F A;  5E8A A;  4D94 A;  1UMI A;  4N8M A;  5JXH A;  2P37 A;  4N9H A;  1F9K A;  3FLR A;  5F3I A;  5A33 A;  1SDD B;  4YW3 A;  4HAN A;  4E27 A;  4FOW A;  4Q8L A;  3M8L A;  4UXA A;  4A7Y A;  3RPQ A;  3ZSM A;  4B7K A;  3ZDS A;  2VVE A;  1KFX L;  1MQT C;  1JYI A;  2YPJ A;  1GV9 A;  3S7I A;  2DVA A;  4Q5O A;  5CFD A;  5LRS A;  2JDA A;  1B35 A;  4SBV A;  4HL0 A;  5FV3 A;  1UN1 A;  3D0S A;  1BBT 3;  1MPX A;  2GNM A;  3AYC A;  3K4Z A;  4QKD A;  1ZRR A;  3OF1 A;  4AW7 A;  2A6V A;  4NPL A;  2Q4S A;  4NE9 A;  2ZBJ A;  4XW3 A;  1BVV A;  2HWB 1;  2HYX A;  1KGY A;  2HWC 1;  1LOC A;  2VQ0 A;  3I3M A;  4D0Q A;  2AR6 A;  4BZ4 A;  1DU3 D;  5J7M A;  3AMQ A;  4P02 B;  3DYP A;  3AL5 A;  5T52 A;  3S5Q A;  4P9G A;  4ASK A;  4BQ5 A;  1MQT B;  3GM8 A;  4Y20 B;  3KLS A;  3P1I A;  2RMU 2;  4QDR A;  1WLC A;  4Q4Y 2;  3RZG A;  2VBD A;  1PO2 2;  3VDB A;  1JZ5 A;  4K21 A;  2HLE A;  4Y1U A;  2XKO A;  1W06 A;  1RUD 3;  2Q1M A;  2QFE A;  2W68 A;  5C4W B;  3ACF A;  1X8E A;  4IGP A;  1CWP A;  2E32 A;  2R32 A;  3HIF A;  2ZEW A;  3OBR A;  4FTS A;  3RZZ A;  1VE0 A;  1F5J A;  2IXH A;  1QOT A;  1D2Q A;  1RUJ 3;  5FZ3 A;  5L73 A;  4I0B A;  1ZRE A;  4BA6 A;  4NHL A;  4XIL A;  5I0R A;  5JWP A;  4PF1 A;  2YC0 A;  2WNV A;  4YPJ A;  3KQR A;  2Y6K A;  5EJ3 A;  3HBK A;  5A32 B;  5FYB A;  3ORJ A;  2P3J A;  1LHN A;  2VZQ A;  1SQ4 A;  1PIV 2;  1GKB A;  4QT6 A;  5FRA A;  1OUS A;  3ZN6 B;  5E89 A;  1BEV 1;  5LW9 A;  2GSY A;  2JXA A;  1T6G C;  1U0A A;  1XNA A;  1DQ1 A;  1J3P A;  2WZP P;  3U11 A;  2GNB A;  1ZRC A;  1R09 3;  2D6O X;  5JMC A;  1VMH A;  1UOF A;  4RR3 C;  2VMG A;  4RA0 A;  3GBG A;  1PGL 2;  2QKD A;  3B9C A;  3J26 N;  4NHM A;  1NXM A;  2ZCW A;  3LFI A;  1QXP A;  4N43 A;  4Q0P A;  4XBL A;  1CAW B;  4XAA A;  5DZG A;  1HXS 1;  2VCB A;  1NLS A;  4XF9 A;  3ZIX A;  2OII A;  4NPR A;  4IES A;  1VR3 A;  4CSW A;  4CU7 A;  2KM2 A;  4B4Q A;  4WBB A;  1KQR A;  1CAX A;  2UWB A;  3S7E A;  1WBL A;  1LOG A;  1VLN A;  1VPH A;  1LU2 A;  2HWE 3;  3LSE A;  1S0G A;  3PLQ A;  3RG0 A;  5JIA A;  1AR9 2;  4AF9 A;  4QD2 A;  1BKZ A;  5JXI A;  3VHP A;  5DG1 A;  3DPR C;  1C28 A;  1GUI A;  1S0B A;  4A41 A;  3PTY A;  4XFI A;  1ZZ8 A;  3LA2 A;  2Y0I A;  2RS1 2;  1QJX 2;  2YU2 A;  4YGC A;  1BJQ A;  1RYY A;  2WA4 A;  5KWR A;  2BW8 A;  3OY8 A;  2XVK A;  3RRD A;  1CJP A;  1VAV A;  4LJH A;  4K1Y A;  1RUE 2;  3ST7 A;  2YXS A;  4Y20 A;  5K9Y A;  4CXX A;  3KSC A;  1TQ5 A;  1VBA 1;  2MEV 3;  4YM1 A;  2P34 A;  4XQ4 A;  4NIG A;  5CA6 A;  4LA3 A;  2AH2 A;  1AX0 A;  4LBM A;  2OW4 A;  5C4W A;  1GYK A;  2KXL A;  4QGL A;  4AED C;  3NRU A;  4I30 A;  2ARB A;  3JQW A;  5LK7 B;  1AR8 2;  4I0A A;  2OUH A;  5FYS A;  1N3O A;  4R9D A;  4LO8 A;  3FL7 A;  2OA2 A;  1MS8 A;  4QXK A;  4ZU7 A;  2Z79 A;  1UPS A;  3DV8 A;  1LGB A;  3AJY A;  3HD8 B;  4QQH A;  5GM0 A;  4OCT A;  5A70 A;  2Y33 A;  4QB6 A;  2G9G A;  1UOJ A;  1ODM A;  2VUA A;  5A32 A;  1TME 3;  4XC9 A;  1JUI A;  1UZY A;  3GZA A;  2UY9 A;  4GWN A;  5IW0 A;  3WDW A;  1FV3 A;  3ZN6 A;  4AED B;  2DVG A;  2WN3 A;  3PUS A;  2Y0O A;  4MLO A;  4EN6 B;  1V6O A;  3JXS A;  1GWK A;  2Q8C A;  4DUW A;  2O8Q A;  5LY1 A;  3WNK A;  1HRV 1;  1VB2 A;  2AZ5 A;  1LGC A;  4QQP A;  4NID A;  1CIY A;  2XBO 2;  3H9A A;  3LIH A;  4PF5 A;  2BU9 A;  1FYU A;  1S0D A;  5FZI A;  4XVH A;  1AYM 1;  1SMV A;  1YWK A;  4EWD A;  3O1T A;  1AR7 3;  3GF6 A;  3GZT B;  1OHF A;  3ECQ A;  5JIU A;  4IE6 A;  1OD5 A;  1IG0 A;  4LKE A;  4DQA A;  1QH6 A;  2AC1 A;  2AUY A;  2WFF 2;  1X36 A;  3J8F 1;  3GJA A;  4DIN B;  2EXH A;  4BYY A;  2QQJ A;  4EJR A;  3FHI B;  3FFQ A;  2PHX A;  5EJ1 B;  1OF3 A;  4XUN A;  3LE0 A;  1VMF A;  4OHV A;  3ZXE A;  4CP0 A;  5FMO L;  3RYK A;  4CVU A;  2RG4 A;  1UY3 A;  4FAG A;  3H50 A;  4RYD A;  2LW8 A;  3ZYP A;  1KJR A;  4FQZ A;  3TAY A;  2RJL A;  1PNF A;  3O1P A;  1RUG 1;  2HWF 1;  2QZ3 A;  2VZV A;  1R1A 3;  2VR4 A;  4LMF A;  4O7X A;  2PFW A;  4XF4 A;  4KWU A;  4AYU A;  5LBE A;  4FCA A;  2CTV A;  5FBJ A;  1O59 A;  1Z7S 2;  1ST8 A;  2PXJ A;  1YQ8 A;  2ILM A;  2OX0 A;  3NJY A;  3WLU A;  4EZ4 A;  1Z78 A;  1LB2 A;  4XTM A;  1G9B A;  1U5Y A;  1Q8O A;  1Y9Q A;  2FMD A;  1NT0 A;  2VOV A;  3ACL A;  2AGS A;  4MGI E;  5FY5 A;  1J58 A;  2GP3 A;  5F1R A;  1QMJ A;  4H7M A;  5FOB B;  2JIG A;  4Q27 A;  1EAH 2;  1OOP C;  4AK3 A;  1W2U A;  2JEC A;  4YW2 A;  2B39 A;  3IM0 A;  1FAT A;  1WW6 A;  1ASJ 3;  1NKG A;  4HOO A;  5DUX A;  1N1S A;  3FLT A;  4P9X A;  5FFO C;  4BLJ A;  3UNP A;  1NOV A;  1YFW A;  1RMU 1;  1R08 2;  1ZBE 1;  2JIJ A;  3IT8 A;  3JBG 2;  2X53 S;  4AED A;  2AEN A;  2WS9 3;  1JYN A;  1UF2 C;  4FI9 A;  4YVS C;  2PYT A;  2ZKL A;  4LBL A;  4Q4W 1;  5LBB A;  5FZB A;  4BOW A;  2ZEY A;  4RHV 3;  5HXV A;  2QQV A;  4NHK A;  4YM0 A;  5FMC A;  2OKX A;  5FPX A;  2AEY A;  4XPV A;  3UV9 A;  5A3M A;  4ZS3 A;  2QQN A;  5FYV A;  2WWS A;  3B3Q E;  5CG8 A;  2J1T A;  4IQP A;  1LOF A;  5A3P A;  2WSV A;  3GGL A;  1FOD 1;  4BH9 A;  4BME A;  4YG6 A;  5AC9 2;  2W1U A;  5FZ6 A;  4BCU A;  1KS5 A;  2B42 B;  2W1W A;  4LHN A;  2JE7 A;  3LCP A;  1RUH 1;  2F17 A;  4OUS A;  5FZL A;  2P5B A;  4FFH A;  2ET1 A;  3B9I A;  3WEZ A;  1VBC 3;  2TNF A;  1HX6 A;  2RR1 2;  2YBP A;  3SKJ E;  3OBT A;  3GHM A;  2LM3 A;  3HAG A;  5JR7 B;  3U10 A;  5JOY A;  2LTN A;  1JOD A;  3QD6 A;  5IYY A;  1DQ2 A;  2IXL A;  1I9R A;  1PO1 1;  4AVS A;  1F8V A;  1JHJ A;  4QU1 A;  3POG A;  1OH3 A;  5JSR A;  3FN9 A;  3VD9 A;  2E33 A;  3RWK X;  4TTG A;  4Q4X 3;  2W95 A;  4OI1 A;  4FPJ A;  2VW0 A;  3FC0 A;  4Z07 A;  4ZZ5 A;  1QH7 A;  4AHX A;  2QBX A;  2Y6L A;  4GB3 3;  4E4S A;  1ENX A;  3V0A A;  4XFF A;  4OQ9 A;  3OPZ A;  1O3Q A;  4YG3 A;  1EV1 1;  2W5F A;  2VZS A;  4OZO A;  1S2K A;  4PLN A;  4BMB A;  4MGK E;  5FJH A;  4WVW A;  3ZFE C;  3C7H A;  4XEZ A;  2RS3 3;  5EHD A;  1HQN A;  3WNX A;  4PDW B;  4GD4 A;  1GOF A;  4CP9 B;  4YAR A;  1SHW B;  5LB6 A;  2BOJ A;  5C9A A;  4CXY A;  2E9Q A;  2R49 A;  1W3X A;  3ZSJ A;  1HIX A;  2CGO A;  4COV A;  4R9A A;  5HV0 A;  4L11 A;  1LES A;  2VG9 A;  3VBU A;  1LEM A;  3D8C A;  1XBF A;  3GBW A;  5A7N A;  4XUR A;  4AQS A;  3M1H A;  3I2J A;  2BRT A;  1DQ6 A;  1RUI 2;  4LIT A;  2YV8 A;  3OGR A;  4PHZ A;  4MOA A;  4U36 A;  3K75 B;  1E5R A;  1SCR A;  2D93 A;  3ZFE B;  1Y9G A;  3ZXA C;  4D7S A;  5ACA 3;  3C7O A;  4HSL A;  2ZGU A;  3TOJ A;  1O3R A;  1AL0 G;  3V64 A;  4QPG B;  3HN1 A;  3ZFF A;  3JB4 C;  4A7Z A;  4WM8 C;  4LOR A;  1C5I A;  1H4G A;  5GLZ A;  5FCC A;  4CDW C;  1IG3 A;  3NJV A;  3VD4 A;  2VL4 A;  2F4L A;  2ARA A;  3KS7 A;  1OVS A;  4YW5 A;  5G04 L;  2KD7 A;  1GP5 A;  1LTE A;  2RS5 1;  4L9B A;  5EJZ B;  3N9P A;  1AR6 3;  1W99 A;  4CUA A;  3W5M A;  3WNN A;  2CHH A;  3AMH A;  2WYF A;  4HPK B;  4E9K A;  4YW1 A;  1D4M 2;  5IHR A;  3MZH A;  4CCC A;  4DZG A;  4MAD A;  1T6B X;  1X33 A;  5F9T A;  1MVQ A;  1GR3 A;  2RM2 3;  3VKL A;  3WHU A;  5IVF A;  2DUQ A;  2J1V A;  2R07 1;  3OPT A;  4O9G A;  4XUO A;  1TMF 2;  1YI9 A;  4IEY A;  5CVR A;  5FYM A;  5L7O C;  4CDW B;  4BQX A;  5A6Y A;  3DYM A;  5BPX A;  1VBE 1;  2VZO A;  5FYU A;  3NAP A;  1HB4 A;  1V6M A;  3A4U A;  3AP5 A;  1L7Q A;  2RHP A;  3DF0 A;  3O0V A;  2QQM A;  2JE8 A;  2XJP A;  2CDP A;  3SCH A;  4LO6 B;  3QOP A;  3MEP A;  4XJA A;  3CNA A;  4MHR A;  4PLM A;  2VQU A;  4ARX A;  1RUG 2;  4PI2 A;  4XFC A;  1VBB 1;  1JUH A;  5HBA A;  2D6K A;  4CEW B;  4XFH A;  1FMD 2;  1MS3 A;  2WAO A;  4ASL A;  1A78 A;  4KQ7 A;  3BIE A;  3HPN A;  4IV3 C;  4DB5 A;  4AVB A;  1YIP A;  4YW7 A;  4PDW A;  1IGO A;  3E5U A;  2EXK A;  3R4D B;  3RVH A;  3VKN A;  4CP9 A;  5A1A A;  2GZW A;  3BYW A;  5FR3 A;  4X8N A;  2UUR A;  3ES4 A;  3CLP A;  5JXG A;  2IWG B;  4XMA A;  4P00 B;  4HG6 B;  5CB7 A;  1ZNP A;  5A3U A;  1DFQ A;  2JDK A;  2VGD A;  1WWY A;  1W6M B;  3KHB A;  2C9K A;  4QHB A;  1HLC A;  2ADE A;  3ZPO A;  4IEV A;  1FT9 A;  4L99 A;  1LGN A;  3ZYI B;  4YRD A;  1EPZ A;  2A70 A;  3WX5 A;  5LWB A;  3ILR A;  2EID A;  4X6R B;  4P5H A;  5L9R A;  2J1S A;  3A0N A;  4QDS A;  4QPG A;  3WVJ A;  3TYJ A;  5F5I A;  5K8S A;  3BU0 A;  1IPK A;  1K42 A;  4HKW A;  1F4A A;  2XJT A;  1LED A;  3NNM A;  3LDB A;  4FPG A;  3LDK A;  4QWN A;  4QQ2 A;  4A7K A;  1WCS A;  2BP6 A;  2VNO A;  2E7T A;  3C8X A;  4MUV A;  4UAP A;  5LA2 A;  1PVC 3;  4WVV A;  2HWC 3;  4MHU A;  3RQ0 A;  4RGA A;  1T2X A;  2WRA A;  5JZG A;  3AYD A;  5C9A C;  3THT A;  4HK8 A;  4GKX A;  4DRV A;  5BY5 A;  4AOC A;  4COU A;  5FDB A;  2OPK A;  4QX5 A;  3WDY A;  1RUN A;  2EIB A;  1DDL A;  4XAC A;  3S30 A;  3BN6 A;  1ND2 C;  2VUL A;  1Q8S A;  1GQG A;  1OT5 A;  1SFP A;  1G86 A;  1SCS A;  3K3O A;  3AP4 A;  1HB1 A;  3IMN A;  5GKA C;  3VHO A;  4C0H A;  4DXZ A;  1GWM A;  3MIF A;  1W6P B;  4XF0 A;  1WW4 A;  5FZM A;  2ZAC A;  2XG3 A;  4ZKT B;  5GLT A;  1RIT A;  3LKJ A;  4AEK A;  4B1M A;  1VRH 1;  5C71 A;  1V9U 3;  4CRQ A;  4AQT A;  5C9A B;  1DQ5 A;  3L2H A;  4Y4Y A;  1RXF A;  1V70 A;  1BBT 2;  5CKQ A;  3ZIW A;  1W9Y A;  5FUI A;  3RI9 A;  4B7E A;  5A6Q A;  1YI7 A;  4BPZ A;  3NVC A;  2WZR 3;  4G9S B;  5J09 A;  4BM8 A;  4CEW A;  4W65 A;  3PJQ A;  5DDJ 2;  4WM7 B;  1ND2 B;  1RXG A;  2YC2 A;  4EZH A;  2ZGL A;  4Y26 A;  2ARC A;  4LO5 B;  1GFF 2;  2JG8 C;  4NHY A;  1BEV 3;  1QJU 2;  4RS5 C;  2AEZ A;  2G9Z A;  1RUD 2;  3TEX A;  3U37 A;  5FYH A;  3FHA A;  1GP6 A;  1W6M A;  2EXJ A;  3NL1 A;  3ZM8 A;  4XBQ A;  5K4L A;  1J1L A;  2O1Q A;  3V0B B;  3LD8 A;  4MXV A;  1RHI 2;  4FVV A;  2YFZ A;  3OOX A;  2FD8 A;  1OF4 A;  1CGP A;  3FUQ A;  2J1U A;  1UX6 A;  1SFY A;  2V5D A;  3EQE A;  2XL9 A;  3VKO A;  4FSJ A;  3WF0 A;  5KR7 A;  2WT0 A;  5BNP A;  4RS5 B;  5L9V A;  5FY9 A;  1MEC 3;  5BNO C;  2DTW A;  2P17 A;  1AJO A;  1OFN A;  1REE A;  1CX4 A;  2RMU 1;  3MGU A;  4M4P A;  1W6Q A;  4O65 A;  3F95 A;  4Y4R A;  5F37 A;  4NIH A;  2G4I A;  1O4Z A;  1PO2 1;  3MLL A;  4NAM A;  4CEY A;  5FZK A;  1FPN 3;  1NLR A;  2ES3 A;  3WT3 A;  2WO2 A;  4DIQ A;  3WXP A;  5GLV A;  1JH5 A;  5FZ0 A;  2PHW A;  1K5M C;  1VBD 2;  2W1Q A;  1MS1 A;  4FPO B;  4IV1 C;  4Q2F A;  2BNN A;  5IVC A;  5CEH A;  2FDI A;  1WD3 A;  1LU1 A;  4HN0 A;  5T50 A;  5F2S A;  4C1W A;  5LAT A;  5BNO B;  3MUY 1;  3QLQ A;  1JYW A;  4EQV A;  1IPS A;  1W6P A;  1ULD A;  3OUH A;  3WCR A;  1POQ A;  3WW2 A;  4BIO A;  3H1Y A;  1YJK A;  1W8U A;  3BIW E;  1W6N B;  5A6X A;  2HWE 2;  3H1M A;  2AYH A;  3BVC A;  4Q4V 2;  5KXE A;  2QTW B;  5CZK A;  1YRZ A;  5FKC A;  3U14 A;  4PIY A;  1PIV 1;  4XYX A;  3MHZ A;  3UL2 A;  5L36 A;  1WLD A;  4IV1 B;  1E5I A;  5SV5 A;  2WLP A;  4LBQ D;  5I0S A;  4WM7 A;  3WNL A;  3KV6 A;  3ACI A;  3T0D A;  4CCK A;  3I59 B;  3I54 A;  5HV4 A;  4AVT A;  4EYU A;  1PGL 1;  5FWE A;  5IWF A;  3Q9O A;  2Q0A A;  4QM8 A;  3LEM A;  3CF6 E;  1OPO A;  4PIZ A;  1B35 C;  5C3O A;  3H8O A;  2MEV 2;  2NLR A;  3OSD A;  3WQ0 A;  3POI A;  3BUC A;  1ZVF A;  2ZKN A;  3ZLI A;  4I02 A;  4XMI A;  1LEC A;  2E7Q A;  4QB1 A;  5FXV A;  2H6B A;  1IOA A;  2V4A A;  3H0O A;  3KWV A;  3BCW A;  4OFG A;  1AR9 1;  3TNP B;  4CA9 A;  2ET7 A;  2DUO A;  1DZT A;  2HEV F;  4IGQ A;  5FK8 A;  3N9N A;  2TBV A;  4E4Z A;  1HRV 3;  3V0B A;  4LTA A;  1JXN A;  4PIX A;  2RS1 1;  1NQD A;  1QJX 1;  2LS6 A;  2D6P A;  1AYM 3;  3TN9 2;  5JXJ A;  1QHD A;  1C8M 3;  5GLW A;  1JZ4 A;  1B35 B;  3ROU A;  3Q8A A;  3ZFG C;  4KL1 A;  1J1T A;  1RUE 1;  2XGX A;  2XVG A;  2XOM A;  3VBS B;  4P9W A;  2VCA A;  2DTY A;  5CG9 A;  2GAL A;  1AZD A;  3R4S A;  1QJY 2;  4LOT A;  5FY4 A;  1PX4 A;  3AFK A;  2DVF A;  2VNR A;  4F8A A;  3CDZ B;  3JU9 A;  1YFY A;  2WNV C;  1LOD A;  4BHP A;  2VMD A;  5A3T A;  3AZZ A;  4JRL A;  3CL1 A;  4MGS A;  2DU0 A;  4QQO A;  2DUR A;  1QWR A;  1OXC A;  4YGE A;  1AR8 1;  1UU5 A;  4BIF A;  1S0F A;  4WVZ A;  3KVB A;  2Q8D A;  5H9R A;  3ZFG B;  1UW8 A;  3A21 A;  1AL2 3;  2HWF 3;  4IE7 A;  4XUQ A;  2GN7 A;  4DO0 A;  1F5F A;  2J22 A;  4GH4 B;  2BOI A;  2ZHM A;  2Z5W A;  3N9O A;  3VHN A;  2ARX A;  4HBN A;  1J59 A;  5T54 A;  2P4E A;  1AR7 2;  1UYX A;  4QX2 A;  1ZZ9 A;  3QH6 A;  4OLL A;  4YM3 A;  3USS A;  3NKT A;  5DZF A;  4NAO A;  2XWJ B;  4IV1 A;  3HNB M;  4N43 C;  3KT7 A;  4DUX A;  2Z2S B;  3I2D A;  1U5X A;  1KEX A;  5HCB A;  1VRH 2;  5D1I A;  2X05 A;  5FPU A;  3I59 A;  3AP9 A;  4P9J A;  4XHX A;  3PTR B;  3KCC A;  4JZR A;  1JN2 P;  4QAW A;  4R8H A;  1S1A A;  1WZX A;  3N7J A;  2VNV A;  3PVB B;  3I49 A;  1LCL A;  2J1E A;  5IVV A;  4CPB A;  4Q4W 3;  4AR2 A;  1MVE A;  4ET7 A;  1YO8 A;  3H8X A;  2XBO 1;  4FOY A;  4AI8 A;  5EPA A;  2HKX A;  4A3Z A;  4WZC A;  1COV 2;  1R1A 2;  1GZW A;  3IZO A;  4DS0 A;  4MGT A;  4N43 B;  3LEK A;  2GN3 A;  1HRI 3;  3MV1 1;  1CAU B;  3LPG A;  4JDN A;  3SXW A;  1OLR A;  3SEE A;  1BMV 2;  1UWW A;  5FLJ A;  5J96 B;  4LHS A;  2NP0 A;  3CJI B;  2WFF 1;  1BLZ A;  4QM9 A;  4A42 A;  1CAX B;  4L2N A;  4XE9 A;  2QQW A;  1X7N A;  3KM5 A;  5FXX A;  1LJ7 A;  3UGH A;  1KD7 A;  4QQL A;  3ZYB A;  1YQ5 A;  3NV3 A;  4NII A;  1UKG A;  1J84 A;  4XF1 A;  1V6J A;  2RV9 A;  4S2G A;  5EYY A;  3GYD A;  3TEZ A;  1AYN 3;  2WII B;  3VV1 A;  5C4W C;  1EP0 A;  3CKH A;  4IGO A;  5D8A C;  4R4X A;  4YYO A;  1GAN A;  3VBS A;  3A7Q A;  1LRH A;  4NRP A;  3SC7 X;  3H3L A;  2XJQ A;  5DUW A;  1LOE A;  1PM7 A;  3I4I A;  2RJ2 A;  4LA2 A;  5I93 A;  1NQJ A;  4LOS A;  3OY8 B;  4XXP A;  4BQ3 A;  2WS9 2;  3F2Z A;  3E6C C;  2A6Y A;  2BNO A;  2GC0 A;  2HBU A;  5DUV A;  3ZN5 A;  4M0N A;  3KF3 A;  4AFM A;  4ORF A;  1WCU A;  1Z7S 1;  2ARE A;  4UBG A;  1AXY A;  5FZA A;  3Q8B A;  4YFZ A;  3BTX A;  1XRU A;  3IDC B;  1WW7 A;  4OHY A;  1UU6 A;  3CIH A;  2JKB A;  1JZ2 A;  3AKQ A;  1PMJ X;  2WT2 A;  3ZFG A;  2WJS A;  3WDU A;  2ZHK A;  4A44 A;  4JTO A;  1WME A;  5D8A B;  3VUO A;  4GH4 A;  2Q5T A;  5CAD A;  1EAH 1;  3WNM A;  2GC3 A;  4HKO A;  1UYY A;  3I3B A;  3W21 A;  4Y33 A;  1CJD A;  5DZE A;  1C1L A;  4OHW A;  1YUD A;  3N7L A;  1Q8P A;  3LB9 A;  5FYT A;  5IK5 A;  4QGN A;  1OMI A;  1R08 1;  3JBG 1;  3ZOI A;  1N1T A;  3WR0 A;  1EV1 3;  3WP5 A;  2Y6H A;  4GXL A;  1VRB A;  4XBN A;  2VM9 A;  3MO4 A;  5F8P A;  5J3U A;  4FFF A;  3LEG A;  1XNB A;  4ZZ8 A;  5CKN A;  2JD4 A;  4I2O A;  2O0O A;  1RJ8 A;  4LKD A;  3H8R A;  1W3V A;  1RUF 2;  3PUQ A;  2RDN A;  1M06 G;  1SAC A;  5D2A A;  1C3H A;  4Z92 B;  4A6S A;  4KG8 A;  1IS5 A;  5IK8 A;  4OI0 A;  3NMB A;  4Q4X 2;  2JJ6 A;  4FPY A;  5AC9 1;  1ULE A;  3K51 A;  3PMS A;  1CON A;  1U5Z A;  1CAU A;  1US2 A;  3A23 A;  3T0A A;  3HOB A;  5LY2 A;  4GB3 2;  1BCX A;  1SBD A;  5IVJ A;  4QKF A;  3IDA A;  4OMC A;  2WAA A;  3CJI A;  1TNF A;  3MIC A;  4QPY A;  2RR1 1;  5C7G A;  3WG1 A;  3PU3 A;  5BUV A;  2RJK A;  2XML A;  2QUO A;  3VD7 A;  3IDB B;  4BK4 A;  1O4Y A;  1S2E A;  4MGQ A;  4RFR B;  3JZV A;  5EFU A;  1NE4 A;  4DNY A;  1UYP A;  2ATF A;  2XWB B;  4YZ3 A;  5JDB A;  3R6S A;  2A75 A;  3ZXK A;  5I8S A;  4YNI A;  4LK6 A;  3FBM A;  1H1M A;  3MLJ A;  3WQ7 A;  2J1A A;  3J4U H;  2JB4 A;  4XQW A;  3VDA A;  2EIG A;  2V4V A;  3L9J T;  5A6Z A;  5ERL A;  1O91 A;  3KB5 A;  4TN7 A;  3HQU A;  1BVP 1;  4JGY A;  3MW3 A;  3WV6 A;  4O61 A;  1F4H A;  2R07 3;  1POV 1;  4Q1R A;  2WDB A;  4E8C A;  1QQP 3;  2BFU L;  5FZ9 A;  2BDR A;  1QDO A;  2XB6 C;  5H9Q A;  4A2U A;  4W6X A;  1NX9 A;  2R04 3;  1BYH A;  5D8A A;  2L9L A;  4K8R B;  3N7K A;  1WA4 A;  3DYO A;  4AHY A;  2V73 A;  3AM2 A;  3NV2 A;  4GMP 3;  2FDF A;  2XLG A;  4TXW A;  5FOJ B;  5F6L B;  3P6B A;  4XCB A;  4UBH A;  1O4T A;  5T55 A;  5DMY A;  2RE9 A;  3KCX A;  3J7M A;  3POB A;  1WLT A;  5LBC A;  3I2H A;  2VBP A;  3GZU C;  3MLK A;  4CCO A;  4AI2 A;  4YM2 A;  1AR6 2;  4EN0 A;  1LOF C;  3MDP A;  1RUI 1;  3AP6 A;  2QE3 A;  3I3Q A;  1CZS A;  5DAB A;  4FBF A;  3EMR A;  2G19 A;  2RM2 2;  3POW A;  4CDX B;  4URA A;  3ENR A;  1TVG A;  1W8T A;  5KHK A;  2I45 A;  5EP9 A;  5AFE A;  3BPZ A;  5J1X A;  4B3N A;  1Q3E A;  3VL9 A;  5ANQ A;  3RNS A;  4IE0 A;  2ZX4 A;  1GQP A;  2WWJ A; 
#chains in the Genus database with same CATH homology
 2P6C A;  1VE0 A;  1VMJ A;  1XBF A;  2CU5 A;  2P6H A;  1VMH A;  1VMF A;  1VPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...