3NMBA

Crystal structure of a putative sugar hydrolase (bacova_03189) from bacteroides ovatus at 2.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
b'PSKVALSYSKSLKAPETDSLNLPVDENGYITIFDGETFNGWRGYGKDRVPTKWTIEDGCIKFNGSGGGEAQDGDGGDLIFAHKFKNFELELEWKVAKGSNSGILYLAQEVTSKDKDGNDVLEPIYISAPEYQILDNANHPDAKLGKDNNRQSASLYDMIPAVPQNSKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTDMLQASKFSEDKWPLAFELLNNCGGENHEGFIGLQDHGDDVWFRNIRVKVLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative sugar hydrolase
publication title Crystal structure of a putative sugar hydrolase (BACOVA_03189) from Bacteroides ovatus at 2.40 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Hydrolase
total genus 68
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3nmbA00
3LF7A 3LEMA 1W2TA 4HXCA 4CCDA 4UFKA 1Y9MA 2AC1A 3LIGA 4CCEA 3LDKA 4UFMA 4B1MA 2QQVA 4FFGA 5FMCA 5FK7A 5FMDA 3KF3A 3PIGA 4FFFA 4UFJA 3U14A 4AZZA 1Y4WA 1Y9GA 5ANNA 5FIXA 3LIHA 3IMMA 5FK8A 3PIJA 2ADDA 3HBKA 2XQRA 2ADEA 2QQWA 3ZR6A 2AEYA 5FKBA 3NMBA 3RWKX 4JQTA 3KF5A 3U1XA 3UGHA 4B1LA 3SC7X 3ZR5A 4UFHA 5FMBA 4UFLA 2AEZA 3H3LA 3OSDA 5FKCA 3UGFA 4CCCA 3UGGA 3LFIA 3LDRA 4FFIA 1ST8A 4FFHA 2OXBA 1UYPA 4EQVA 3U75A 4UFIA 4QHZA 2QQUA 3S5QA
chains in the Genus database with same CATH superfamily
2HLEA 2ZMNA 2WO2A 3QOPA 3FMGA 3GJBA 3H8UA 2HWB3 5FPUA 5F5QA 1W6PB 1QNYA 3O1MA 1C8M2 1RMU2 4O7XA 3VL8A 2BOIA 5FUPA 4CDUB 1CPMA 2Z4FA 1PO21 1TMF2 2RDQA 5FBJA 1DQ1A 2VTXJ 3TEWA 2XWJB 4XBNA 5SV5A 4RA0A 3UGFA 1IPJA 3LB9A 5CFDA 4XURA 3ZKUA 3FX3A 5FCCA 4EN9B 3KCXA 4J1WA 2Y8KA 3HNYM 3ZIXA 4AQ6A 1PVC2 4XTPA 1Q8PA 2MNGA 5CFCB 3OGJA 4GH4B 4OLLA 1UMIA 5F6LB 2WNUA 4IGPA 4Y4YA 1DYKA 1NE4A 3AKPA 4IE4A 4X8PA 5FY8A 4ITCA 2WLQA 1LKNA 5G05L 1OOPC 2D6MA 3FUOA 1MS1A 1UIKA 2WSUA 1QOTA 3K3OA 4K20A 4CUGA 3KQ4B 5FLIA 1W9FA 1K5MB 4PLOA 1LGBA 3BIWE 2VTFA 5FV3A 4CDWC 5BV6A 1MZ5A 1PZ9A 5I8YA 5FYBA 1CD3G 1HX6A 1V9U1 2H0VA 3ETPA 3OPZA 4RGKA 1GANA 1H8TC 4CZSA 1WCUA 3CJIB 4QQPA 1JYCA 2OT7A 5DXDA 1PNFA 4EE2A 1F9KA 2BBAA 5DDJ1 5F3EA 5EV7A 2N7GA 2D5HA 4LR4A 1BZWA 1D7PM 2WZPP 1UAIA 3SISA 2BQPA 3NAPB 4W6YA 1CVNA 4XF4A 3NO8A 4CP9B 3NW4A 4XAAA 5D2AA 2HWF2 2OIIA 4ASKA 2BPA2 2AACA 5FR3A 1BXHA 5HXMA 3JU9A 4CCKA 1XNBA 3QLQA 5ACA2 3HR9A 1LOGA 4OVEA 1S2EA 1QY4A 2D97A 2X05A 1C8M1 1RMU1 4GKXA 4DINB 2Z42A 2ZGKA 4HPKA 4QU1A 1AR81 4EWAA 2WA4A 1A34A 1ZRCA 3BOWA 3ZXDA 3OTFA 1LGNA 4CRQA 4AHWA 2RDNA 5C8WA 4QT6A 1TMF1 3OBZA 3V65A 1EPWA 2A73B 3VLBB 4ZZ8A 4YW3A 4ORFA 4P9WA 1Y7BA 2VPVA 2WRAA 4YG6A 3WG4A 1G7YA 1WA4A 1YJLA 5J96B 1ULOA 1FNZA 3KT1A 5DABA 5ISLA 1W6NB 2YBPA 1PVC1 1S4CA 2HBUA 4Q0PA 1CAUB 4EYUA 4DZGA 3PLQA 2R061 3J8F2 5JI7A 2R0HA 2XB6C 1RUD2 3E1F1 1DYOA 2Q8EA 1W9SA 2ET7A 5B2GB 3NJYA 1AL21 5HV0A 1UY0A 2Y0IA 3OJBA 4XZPA 3I8TA 4CDXA 4NIDA 1BMV2 5FY7A 4LE3A 1QQP2 2V4VA 3PJYA 5FZAA 3SEPA 5KR7A 2V09A 1IS4A 2OA2A 1A8MA 2RVAA 4Q4X2 3H3LA 2J1RA 1FMD3 1O4YA 2VMGA 3ZSKA 3RNSA 1VBE2 3PUQA 3C7HA 3FFZA 2E53A 4LXLA 1GQHA 3EJKA 3ZM8A 1DQ2A 1CZVA 4LOSA 2YGMA 1FT9A 4KMQA 4QPGA 4E2GA 2BDRA 4UFMA 1G9DA 4E27A 4KU8A 2HWF1 1WCDJ 3WDWA 2VU9A 2MEV3 2WABA 4TYSA 1VBC3 3T3YA 1PGL2 2B8MA 4BLIA 2GMEA 4MOAA 2RHPA 4CU8A 1GR3A 3RDIA 2HWD1 3T2PA 5FP8A 2JDZA 4JC1A 4CXWA 2R32A 2IVIB 5BNOA 3AKSA 1D0GA 3ACGA 2WQZC 3WNOA 3LFIA 4FP3A 4HT1T 5FZEA 1ZBA2 3J7MA 4C1WA 1F2NA 1SLAA 4PIXA 3POSA 1AR73 2R041 4WVZA 2VVDA 3INAA 3PURA 1R092 2UY8A 4N43C 5KHHA 4F3JA 2XMLA 2JB8A 1XOYA 4NPLA 3P6BA 1VBD3 4XAEA 1BQPA 1STMA 3J8F1 1RUD1 1ZZ6A 2VBDA 4NHLA 5J37A 2WS93 2R6QA 5K0UB 1V70A 1YO8A 1KDKA 1DLLA 1VJ2A 1VBA2 2BVVA 3J7LA 4INDA 4KQ7A 4E9KA 3WLUA 3NMBA 1BMV1 1AXZA 4Q1RA 2OX0A 1QQP1 2ZS6B 1YFWA 3WXPA 1QKQA 1JHJA 4I3GA 3V64A 4Q4X1 4AEMA 3DPRC 1IQDC 4C91A 4XQWA 5M0TA 1ZREA 2ZCWA 5FZFA 2FDIA 4PQQA 1AVBA 1D4M2 5IK5A 2Z79A 3VBFB 3ZYIB 4IEPA 5CNAA 1VBE1 2Q5TA 2RR12 1RUE3 2VGDA 4R8HA 1H6YA 1SLLA 1FX5A 2QCSB 4OYUA 4AI9A 1RXGA 2XOMA 3U07A 2ZGMA 3SH4A 4K3UA 2UYAA 3LIGA 1FPN3 5DMYA 3EBRA 3FN9A 2VZOA 2VNGA 3KF3A 1ND2B 3DGTA 3H7JA 1UMZA 4MXWA 2P37A 4HMZA 4M4PA 2NYYA 3B00A 4YW2A 4QM9A 1DQ0A 3NV1A 3RG0A 4LKEA 3BPSA 4RQPC 1ZZ7A 3E6BA 5FO8B 3M4FA 4CDWA 2O14A 4AEKA 2OPWA 3OB8A 1YUDA 3S7EA 5FMOL 3WDYA 2NLRA 4LO7A 4ZU5A 3S57A 5A7SA 4N53C 1NG0A 3FFQA 4AFMA 4C8DA 2OXBA 4RR3B 1H8TA 5FMOS 2IUWA 4IXLA 3IAPA 3SH5A 4DIQA 1TME3 1UZWA 2NN8A 1UYYA 2A5ZA 5JOXA 1YQ6A 3N9QA 1R091 4UT5A 3B01A 3ZFFC 3JZVA 2J1TA 1W3VA 5E16A 5FREA 5T5PA 1V0AA 3WNNA 3NKTA 5C70A 2ID4A 1SCSA 4OQ9A 3VD9A 2HWE3 4FCAA 2D6OX 4PLNA 1VBA1 4JQTA 1XSQA 4PCRA 1Q5OA 1ASJ2 1ZYBA 3M3CA 4AHZA 1SMVA 1QU0A 1SZBA 4JKMA 1U5IA 2XLAA 3SEEA 3AMHA 3AB0A 1ULDA 4RS5B 4FFIA 5FZBA 4OUEA 1X8MA 3IMNA 4QGMA 2A70A 3M7AA 4D0QA 5A3UA 1G6NA 1GBGA 4CCLA 1I5ZA 2RR11 1KRIA 4K40A 5FZ1A 3KVAA 5A80A 2J1UA 1MVQA 1W8NA 1RYYA 1WMDA 2DVDA 2YFZA 3C7OA 4BK4A 5A1FA 1H0BA 1GWKA 3JUUA 1W39A 1DBNA 5L36A 3HQRA 4QGLA 5LEKA 3RZMA 4UFJA 3ZMOA 4MUVA 2W39A 3WW3A 1S0GA 1UZYA 2GNDA 2RS52 4M0HA 1JUIA 3BALA 4YVWC 3VZMA 2CDPA 2XH6A 1GZTA 2CY6A 1X9PA 2EA7A 4BXSV 3Q8CA 1TNFA 3KSCA 3OOXA 2ZGQA 3TN93 3OY8A 4L0PA 4LBLA 2YU2A 3KHBA 4CDQC 1ZZ9A 4XVHA 4G3YC 4OMDA 1J3QA 5LA1A 4HKWA 4PDWB 1YHFA 3KV9A 4E4DX 1PO12 3LSEA 2XBO3 2WSVA 3R0RA 3C3VA 3PVOA 1US3A 3BGAA 1LGCA 3H3ZA 1JUHA 4PJYA 3P3PA 3UKNA 2HWC2 2IFRA 2P34A 4OZOA 4COUA 4QX2A 2JIGA 3DV8A 3GM8A 4AAXA 4BQ3A 5FUIA 3IDBB 1QJEA 5T50A 2VCCA 4A41A 5FO7B 5C33A 1JOJA 2ZA9A 3OUIA 4Q27A 2OQ7A 2GNBA 2G4IA 1L3JA 1BLZA 1ASJ1 1U5ZA 2XJVA 3H9AA 4IUGA 3BIEA 3RZKA 4IV1A 4NO4A 1HB3A 5LA2A 4AFBA 5BNNC 5FZGA 1QOOA 4XIOA 1PVXA 4FVVA 4ISRA 3K4DA 1P8JA 1DGWA 5HV4A 1IKPA 1C1FA 4I0BA 1YIFA 2JG9B 4QU2A 2WT2A 1GKBA 2GALA 4HVOA 3PHMA 3O1SA 3J4UH 1LU1A 4EWDA 5DUVA 1VPHA 1N1SA 1AR62 2G19A 4F83A 2HEWF 4IGQA 4Z2AA 4Q4V2 2IXLA 1UF2C 2WC2A 5DN2A 1NT0A 4CCJA 2VG9A 5EQUA 4YZ4A 1W6OB 4GQ7A 3I2OA 1B09A 3CNAA 3NV2A 4ASLA 4COWA 4PF1A 3POFA 5LY1A 2WYFA 3VBSB 4AVCA 1QMJA 1AX0A 1KEXA 1UXXX 1YFUA 1UYPA 3DPRA 3FHIB 3VHNA 4BMBA 4DUXA 2PLV3 3FBYA 5IK7A 5JR7B 4C1XA 1F31A 3CQOA 4YW7A 3S5AA 4O9EA 1PO11 2P4EA 2W46A 3AM2A 3HPNA 3SCFA 3V56A 2QZ2A 3GBFA 4QX5A 1SFPA 3D5OA 4QPIB 4GD4A 2EIEA 3WINE 5BPXA 1ALYA 2KXLA 1C57A 1DYPA 4KI5M 4NAOA 2CNAA 4WVMB 3M3EA 4XTMA 3SLIA 2DF7A 3KT7A 4HFSA 3ZSLA 5HCAA 3OYWB 4XFHA 5CU1A 1MZFA 4RQPA 4UBHA 4CU7A 1BBT3 2BWAA 2TEPA 3APBA 3A7QA 4N53A 5FYHA 2VD7A 4RGAA 4YM2A 3WF3A 4W6WA 3I2JA 4LITA 4ZXKA 2D6NA 4BQ2A 3HJRA 5I0TA 4V2WA 3WEZA 1Q43A 2YC2A 1WMFA 2Q8OA 3EHKA 3THDA 1UXZA 1AR61 1BK0A 4GMP1 1CESA 3JBG3 2R1DA 1QHDA 4KU7A 3ZFFA 3HVDA 5IVVA 4TZDA 2VJXA 2J42A 3VKNA 4Q4V1 4ATEA 5F2SA 1K3IA 4P9JA 3LCPA 3VBHA 1SLCA 5FLHA 3VKLA 1GOGA 3VKMA 2E33A 4LT5A 4FTBA 1QJU3 1GV9A 5JOYA 1GU3A 2VZTA 4G4FA 2FDHA 1NQJA 1GWMA 1VALA 4OHZA 2C9KA 4E4SA 1IKQA 4XOGA 4OI2A 1AF9A 3KM5A 2W94A 3OBTA 3WY6A 5FY5A 2ARBA 5ABJB 4QDSA 2RG4A 3B93A 1US2A 5DG2A 5IK4A 1VRH2 2WZ8A 4XEZA 4N7UA 4FPYA 2R30A 1ENSA 3I7DA 3UESA 4AE2A 4CP0A 4DEQA 1B35B 5C9AA 3RWNA 1S2KA 2NM1A 4BWOA 1GP4A 5APAA 1NX9A 4OUMA 3WOGA 1QJX3 1VAMA 2JE8A 2DU0A 3ZX7A 3CDZB 4NRQA 3E97A 1UY1A 2W2IA 5EZWA 3WQ1A 4YVWA 4ZU4A 2VCBA 3JQWA 4GWJA 1TE1B 2VMFA 4LBQA 1DZRA 1E57A 1ZNPA 3GDBA 4XW3A 2WFF3 2YGLA 4CCNA 1Q8SA 2AENA 4CDQA 2XUEA 4XACA 1PGSA 3V0AA 3WF0A 1W2TA 4IE5A 4JTOA 2YBSA 2ZGUA 5C8CA 3B3QE 2Q1FA 3IAQA 5A7WB 1UD1A 5K4LA 4DUWA 2MHFA 2I45A 1W6QA 3NNGA 2DUPA 4Q0SA 2P6HA 2VC9A 3IM0A 1Q8OA 4IEYA 2RM21 1QWRA 2PN5A 1D4VB 1VLNA 1MZEA 5FP9A 1RHI3 1OI6A 5ANQA 5FZLA 1SCRA 1BHGA 3HWJA 1NCQC 3JD72 3B5LB 4Q4Y3 4MXVA 4X8NA 4Y26A 2XL7A 5J7MA 3W5MA 2WLPA 3AYCA 3DEMA 5IVFA 4Y1ZA 1YEWA 2DV9A 2ZEZA 2VBBA 1VE0A 4YG3A 3VBUC 3UNPA 4FOWA 5KC6A 2AH2A 1VRH1 2CAUA 4W8JA 4D8MA 3ME2A 2QQPA 4IESA 1OXCA 2ZGLA 4GAZA 5FZ6A 4LA2A 4XFAA 1CAVB 2JKBA 3WHUA 3IMMA 5FZ0A 4C0HA 4IL7A 2P3IA 2VUAA 4RHV2 5FKBA 3ZR6A 3LAGA 4GB32 2RS13 3ZXLA 2OQ6A 5JSPA 3ZN6A 2D6PA 4HKOA 2VW1A 4Z07A 1Z7S2 2G9ZA 3AKQA 1POV3 3O5SA 3WP5A 3VD4A 4X6RB 1NCRB 3O1OA 1DDLA 1W8WA 3FUQA 3WV6A 1D2SA 3VD7A 2ZAAA 3MW4A 3FJSA 1OPMA 3LF7A 1RUOA 1O6UA 1YQ5A 3PMSA 3FHQA 3DXUA 4FBFA 3ZYFA 1SFNA 2G9FA 1IZ3A 1URXA 1FATA 1Y9GA 4YZ5A 3I3DA 4FPJA 4XCBA 5IVJA 4AQSA 2VUJA 2WNOA 3DYMA 1AUYA 2LM3A 1MQTC 1R082 1PO23 3CF6E 4QX3A 4B1LA 1RTVA 1JU4A 2WN3A 4MGKE 2Z69A 1E5HA 1KFUL 3J9SA 1N3QA 4TWTA 2A3XA 1RJ7A 5JDBA 1NA1C 3AZZA 2BW8A 4QQHA 4YGCA 4QQLA 3RZGA 1RUG2 3ZIWA 1AHSA 1V6KA 3BVCA 4SLIA 3PVNA 3K51A 4YG0A 4LUKA 3EXUA 5C4WB 1WMXA 4E8DA 4H2AA 2C24A 1W05A 5LBEA 3DCQA 4YLZA 1J1TA 2V5YA 2X5IA 1VBB3 3I2GA 5FPVA 3H8OA 5HCHA 3JXSA 4P9YA 1JYTA 3I59B 1R1ZA 4NIHA 2ZZJA 2JDMA 5DAQA 3ZXKA 1JZ4A 1PX3A 1S1AA 4LBQD 1PZ8A 2YPJA 3ZPOA 2ADDA 4HG6B 1DF0A 1WW6A 3AMQA 5JWPA 3D82A 5I91A 4AVVA 1WD4A 1FOD1 4RHV1 4GB31 4MH0E 1V9U3 4OUSA 4QAWA 2WKKA 4EN6B 4DXSA 4XJ9A 1UYZA 1Z7S1 3ZFGB 1O91A 1VIWB 2ZX4A 5DDJ3 2BEOA 1I9RA 3FBMA 5FYUA 3BUCA 2DCTA 2AC1A 2IXJA 4LQRA 4YARA 4B1MA 2Y6JA 2E51A 3MHZA 4RSUA 4XF3A 4D69A 4A6SA 2JG8C 4L9BA 1TVGA 4CDUC 1UZZA 1C8M3 1RMU3 3VDDB 1HJGA 1AR83 1VR3A 5CKQA 4NE9A 1LTEA 1GP5A 1H4HA 1NKGA 1VAVA 3C7FA 4D7SA 4P08A 2EAKA 5FPAA 4LUMA 1TMF3 5A3TA 2VQUA 1WLDA 1J3RA 2ZPXA 3O0WA 4TLFA 4M3CB 2BJSA 1QH7A 4XABA 3GGLA 3MIGA 4JGYC 1KXGA 1YJKA 4Y3OA 4DY3A 5CG9A 4A42A 1OLQA 3RMYA 3N7JA 1PVC3 3J26N 4LK7A 3TOJA 4BJ0A 4HLTA 2YXSA 4S2HA 5A33B 4MLOA 2R063 4PF5A 1ENQA 2ZGTA 5I0UA 3LPFA 1DZQA 5DUUA 2FCTA 4AZZA 2XDVA 2WNVA 4LO5B 4OHYA 3T0AA 1AL23 5DZFA 2CL2A 5FZ3A 1PMJX 4Y24A 1DIWA 1YI7A 3MF6A 3SMHA 1REFA 1VMJA 2EIDA 3R4UA 4FOYA 4Q8LA 5FYCA 4AQ2A 5JMCA 3SC7X 1TEIA 2JDUA 4Q4W2 5H9PA 5FY1A 5FZ7A 2UWBA 3IIAA 1R1A2 3AK0A 1Y43B 1REDA 4LO8A 3IBMA 2YBKA 2LROA 2JDKA 4L8QA 1NCQA 4LOTA 1CAWA 4MGSA 3EB7A 2DYCA 4RYDA 3AJZA 1QDCA 1XRUA 3E5QA 3T30A 1G9AA 1NZIA 2HWF3 1GLHA 1PGW2 1VAKA 2ZZQA 3U10A 5BUVA 5K9YA 5L9RA 2ZX2A 4MGIE 2AZ5A 4AOCA 1OKQA 3N9LA 2Q8DA 1UU4A 1OD5A 2HWD3 3M3OA 2BP6A 4MHRA 3K2OA 3NL1A 3WZ1A 3MIDA 5CFDB 2A6YA 4UFLA 1EAH2 3ZYRA 2B42B 4ZPIA 1DG6A 1KJRA 2HKXA 1KD7A 2GDFA 4OHVA 2WNUB 4Z1VA 2R043 1RL3A 4Q0QA 2D7FA 1LNSA 3VDBA 5E8AA 3UETA 2W1WA 3OG2A 4XQ4A 1CX1A 3KB5A 3NJXA 3E5XA 1HQNA 4HONA 2CTVA 1CJPA 3J8F3 1RUD3 2Y0OA 3ZVXA 4FXKB 2QQOA 1XNTA 4XYXA 4FSJA 4FT8A 5GZDA 2PQSA 1AX2A 1S2BA 4H14A 1HQWA 1I5PA 3BB6A 1QQP3 3MPPG 5KHJA 1MQTA 3LA2A 5L9BA 1V6NA 2KM2A 2OUJA 2PHXA 2PQQA 1AXKA 1NA1A 5HCBA 3OGRA 3G6JB 3WW1A 1CGPA 1GZCA 2VE1A 3POGA 3DUIA 4XJWA 1VBE3 3S5QA 4U2AA 3MBWA 1QJZA 1DFQA 1UL9A 1XNKA 2Y26A 1SLTA 4CPBA 1SLBA 1UCXA 4JKLA 5GLZA 4HPKB 1LOFC 1PGW1 1XE7A 5JZGC 2GNTA 1CZTA 4P02B 2WWSA 3N9NA 3USUA 1LESA 5J48A 1AJOA 3EMRA 4FAHA 3AMNA 1WWYA 5KWRA 4NPRA 1H2MA 5FY0A 5A3OA 1LULA 1AL0G 1MS8A 1GSLA 4X6QB 4CSWA 1DGRN 2WT1A 2DCKA 1ZRIA 1EAH1 5LCWL 2PHRA 4YVSC 1OLRA 2GN3A 4WZCA 1QH6A 5L7OC 2ET1A 1IS6A 1GNZA 1WGPA 1WLWA 2NPIA 5DUWA 1EP0A 1R093 3OBAA 1VB2A 3AJYA 3THCA 3ASIA 5FPLA 2ZJCA 2VULA 3LDKA 1OFNA 4XJAA 5K0UC 4CDXB 1KS5A 2J1AA 1W2OA 4KGQA 3AVRA 2JG8A 2X53S 2P1BA 2ATFA 3AYAA 2PXJA 1RUC2 1VBA3 4Y1YA 1V00A 3AYEA 1OA3A 4AEDC 1JTZX 1XNCA 4BQXA 1TZOA 1DHKB 1T6BX 3D4KA 2HEVF 5IYYA 2WQ8A 3GNEA 4AEJA 3LPGA 4N9IA 4N9HA 3ZKYA 3UYJA 5HI0A 1JYNA 4CXYA 3KHCA 2VVFA 3TNQA 4PIYA 1SEFA 5FTTC 4QPGB 3MLJA 4H7MA 1D2QA 5EJ1B 2I74A 4JGYA 2PTMA 3ZSJA 1E5IA 1O3QA 4I30A 1HN0A 4FPOB 4JGZC 4MADA 3P5BA 4QQ2A 4A4AA 3ZO0B 2BNMA 4FFGA 4UYBA 2PAMA 5IHRA 2UURA 3BI3A 1MEC2 1QXJA 2E31A 3I3BA 4FFFA 3LE0A 2EXJA 1EV12 3DYPA 1Q8VA 4YM0A 1X9TA 5IVEA 1XYOA 3IDAA 4BMEA 5BNOB 4XDOA 5T5LA 3SHRA 4JVAA 2XUMA 2ZMKA 2JDNA 4P5HA 2RDSA 2RE9A 1ULFA 3LDBA 2AEZA 4AG4A 4UXAA 2TNFA 4FO9A 3UT0A 3PVEA 3LOBA 1DQ4A 1OH3A 2Y64A 2VVEA 3VDAA 3WP3A 1UQXA 4XJZA 3LGRA 2VMHA 3W59A 4NIAA 1RITA 3B9IA 4BQWA 3WCRA 1S0FA 4IDZA 2XG3A 4D94A 1N1TA 2HWB2 2YDEA 3NKGA 1C3HA 2VXRA 2R16A 2WO1A 3CBNA 1OA2A 2D3RA 2PMWB 2WA3A 2WT0A 4R52A 4YGDA 4LBKA 4N8MA 4FAGA 3K46A 2VQTA 3OUJA 5ACA1 3WCSA 5FK8A 1HV1A 2QNKA 1W9YA 3VBRC 4A3XA 2FMYA 3IKWA 4HETA 4Y5TA 4K21A 1ZZCA 1W03A 1COV3 2MPFA 4JAAA 3RRDA 3IT8A 4FPHA 1ASJ3 2VM9A 4P00B 1GUIA 3OGVA 3I54A 4DOUA 2A75A 4PLMA 3SCHA 5C7GA 3PUAA 1HRI2 5LATA 3WNXA 4Y22A 1KFXL 4YYOA 3VN4A 4HVRA 4DMIA 5FYVA 1YI9A 4QX8A 1X7NA 1CN1A 4Z92B 2JB4A 1Y9MA 4WBBA 3FC0A 2FDKA 2Q4SA 1DGRA 4MXWB 1J84A 2VOWA 5IK8A 4BQ4A 1O7FA 1YQ2A 4YM3A 5KXDA 4DPNA 1EV11 3CKHA 5A3MA 1TQ5A 1YYNA 4E8CA 3TEYA 1JI6A 2ZGPA 1SFYA 3T1LA 4CDWB 1UX7A 3T4VA 2QTWB 3AX4A 5C3QA 2BERA 3CL1A 3LEIA 3A4UA 4OZXA 3ZXAC 4TSVA 1H8TB 1QOSA 1XC6A 2XGXA 3HEIA 2DCYA 4MV2A 3VV1A 4BYYA 1O3SA 4D6QA 2VBPA 5C71A 4Q26A 3V0BA 1G9FA 2VNRA 4DY5A 1PMHX 3M1HA 4S2FA 1OC1A 1J58A 5F1RA 5KXBA 3CIHA 3W20A 1PO13 5DG1A 4R4XA 1GFF2 4XUPA 3EO6A 3DYOA 2A6WA 1NXD1 5JIAA 5LA9A 3WT3A 2AYHA 3S0MA 4ZZ5A 1OOPA 4COVA 4V1PA 1PGL1 1VP6A 3LOIA 1ZBE2 1E5SA 3AZYA 5JZGA 2A6ZA 3HMYA 3FL7A 2PHTA 4Q29A 3NQHA 1M06G 3WQ7A 4LLFA 2ZGOA 4E4ZA 2BUKA 3LA7A 1ZBA1 4GA9A 4PBOA 3MO4A 1JZ7A 1HRI1 3VHPA 4YVSA 1OLME 2ZKLA 5A7PA 1LHNA 3QH7A 3S30A 1JZ5A 4M01A 4MGTA 3ROUA 2BNNA 5L7OA 1O3RA 2PFWA 4YPJA 4I02A 2ENRA 1RINA 3A22A 3AKTA 4L11A 5CISA 1AR63 2W1UA 4GULA 4GMP3 1OKOA 5IT6A 1WW5A 5F3GA 3LA3A 3MI8A 3WG2A 2O8QA 4ISQA 5FRAA 4Q4V3 4I0AA 2XJTA 2Y6KA 1I3HA 2P3KA 2SBAA 2YV8A 3ORJA 3LSDA 1FMD2 1DCSA 3OY8B 4IQPA 3KMHA 4CEYC 3R4DB 1LCLA 2DWRA 2CWSA 3AFGA 4PQ9A 4AEDA 5FO9B 3RYRA 5EP9A 1HDKA 5DZEA 4OQ8A 2QUOA 1D4M1 3MLLA 3PUHA 1L7RA 1PK6C 4GZ9A 2PYTA 3LWCA 3RGBA 5FQ0A 3O7OA 5FPZA 2QJVA 1VBC2 1EUUA 2VXJA 2Y6LA 3GJAA 4WVWA 2C6SA 2XVGA 3L2HA 4JGZA 3WR0A 5JI9A 5F3IA 2OZ6A 4TN7A 4EN0A 1FV3A 3ABZA 3PIJA 1RVF2 3ZFEC 2PHFA 5L19A 4QDRA 3T1MA 1X82A 2LW8A 1ZBE1 4GKYA 4IV1B 3ZR5A 5I93A 1W8ZA 2QFEA 1YLLA 3OSDA 2QZ3A 2ZTNA 4M4RA 4XUNA 2P3JA 2NMOA 3MIEA 2ARAA 2ERFA 5FY4A 1GNYA 2YHJA 1UKGA 2VCMA 1UU5A 4W50A 3WX5A 5F3CA 1PX4A 3LFMA 3ZPYA 1QJY2 2WUHA 4LHKA 1RUH3 1POQA 4HZFA 2C5DA 5FZ4A 1K42A 4UFKA 4MHUA 4UW5A 1XJAA 3FLRA 3OBRA 4IV3C 1OMIA 4QX0A 5C5UA 3E5UA 2ZACA 4PBPA 2XQRA 2XR4A 4JDMA 5A1LA 2UYBA 2LTNA 2IC1A 4AVAA 2RM23 2WAAA 5JCTA 2BOJA 3PU8A 3VBRA 4NUBA 1FMD1 1LR5A 3WD5A 5FXWA 3OEAA 3ST7A 2XLFA 5LBCA 4DQAA 2VZPA 1DU3D 4ZS2A 3AL6A 3DPRB 2HJIA 5A3WA 3WF4A 1RUE2 2BVBA 4JKKA 4NHYA 3URFA 1JS9A 3N7KA 3U4SA 3ZDSA 4ZKTB 4XMIA 2XHKA 3T09A 4A7ZA 2VL4A 1OQ1A 1BK1A 4LBNA 2VZSA 2VZRA 1VRH3 2XONA 4N43A 1HB1A 4AFAA 1KDMA 3IPVA 2A1XA 1YWKA 3OD0A 2YZ4A 4CCOA 1BVVA 4ZY9A 5K8SA 1PMIA 1RVF1 1QEXA 2VNVA 1NAEA 2RS51 4RQPB 5F5AA 1C8NA 3VUOA 1YFXA 1CONA 1HRV2 1UOGA 3R4SA 5LB6A 2WQ4A 4B3NA 3U0ZA 4N53B 1HXS2 2KR2A 3THTA 4NAMA 1WUVA 2PA7A 1ODMA 4CUBA 4Q8KA 1QJY1 3POBA 2WZR3 2F6BA 3HQXA 3ZFFB 1AYM2 4IETA 2V73A 3H50A 3T2QA 2OUHA 4YRDA 3RZHA 4XBLA 5I0SA 1QIQA 1UZVA 2JENA 2HWC1 4IW3A 1AJKA 5FIXA 3VBHB 5HPOA 1SBDA 3GYDA 3ZN5A 4I01A 3FLTA 3I2DA 2VQAA 1RXFA 4LTAA 3WG1A 1GP6A 4AI2A 3VKFC 4CTEA 1T6GC 2B5HA 3K4AA 3IB3A 4CCCA 2Y34A 3TBDA 3PU3A 3NNLA 4QDQA 1RUF2 2PHDA 4QKDA 3TRSB 1R64A 3MDPA 3K4ZA 4YW5A 2RDRA 2OVUA 3D0JA 4COZA 3CZJA 2YYOA 4EWEA 5C9AB 1Y3TA 2DBNA 1O5LA 3H1WA 3ZXGA 5AC92 4BQYA 3AP6A 4GWMA 1IOAA 5LZ6A 1ND3C 4J6GA 1UX6A 1DGLA 1N1VA 1HQLA 2QQWA 1DQ5A 1LOCA 2WYSA 2PHLA 3AP7A 4YVWB 3ZYPA 1V6MA 1FOD3 4GWIA 4RHV3 4E2QA 2GP5A 4LBQB 4GB33 3UL2A 1I6XA 3POIA 4YNIA 5J09A 1HRV1 4QKNA 4CEYA 4UBGA 4CDQB 1A3KA 2Y38A 3H7YA 2D3SA 1Z7S3 2XL9A 3MFCA 1PIV2 1HXS1 5DAWA 4AHXA 3V0AB 1YQ8A 1H9WA 5FWJA 5C8CB 2CYFA 1VMFA 5D8AC 5JPMB 5H9RA 3VL9A 1PK6A 4KNCA 4IEUA 1CJDA 3ZMNA 1JYXA 1AYM1 3B02A 1LHVA 3POWA 4AGGA 2ZEYA 3WF1A 5LWBA 4M0NA 1W6QB 2OYZA 2DURA 3DL3A 4XHBA 4CUCA 2W52A 1XB9A 4H55A 4MGQA 2WN2A 4CE8A 1SQ4A 3ZFEA 3N4MA 3USSA 1OURA 5C3OA 3MPBA 4LE4A 4QB2A 4QB1A 1ULPA 5C6CA 1LOBA 4QPYA 3ACHA 3N36A 1L7QA 3ZXEA 4WZFA 5GLTA 3TWIA 1UNBA 4WM7C 1RUF1 5ERLA 4A45A 2F17A 4Y4RA 5CBLA 3TYJA 4L97A 2ES3A 5CB7A 3KV6A 5CVRA 1RUI2 4QMAA 1W2UA 1WD3A 2EXIA 5GZFA 2VNOA 4D7TA 3VZLA 1XPWA 4FPEA 3KV5A 2TBVA 1OVPA 5AC91 4BU2A 1J83A 4COYA 1QGLA 3BTXA 3ITQA 2IWGB 4IV3A 4PT6A 2DDUA 4M3CE 3AYDA 5AVAA 1JOBA 4P9GA 3ZN6B 1J3PA 4LKFA 5FYZA 2K2SA 5GJ6A 2B9VA 2AR6A 5CKMA 3PNAA 4FXGB 3KZ4C 4BCUA 3H0OA 4CEWC 1JZ3A 2PLV2 3NV4A 3BTZA 2VQ0A 4LK6A 1NLSA 2CHHA 4AW7A 2LS6A 4FQ4A 4C90A 1A8DA 1PZ7A 4CYDA 5C3PA 1W2NA 3I3QA 5BNNA 1PIV1 1XE0A 4KH9A 2Y6GA 4UF0A 2BGCA 3L9JT 2XXZA 5IFTA 3ACIA 5DAPA 4QWNA 1XSRA 3VD5A 2OS2A 4R9AA 1IPSA 4AVBA 5DUXA 3OCPA 1BVP1 3RJ2X 1S0BA 5A32A 1OA4A 1TG7A 4NN0A 5BNPC 3KCYA 2C0ZA 1Q56A 1SLIA 2BNOA 3UGHA 2QDRA 1G8WA 4EZ4A 2EXHA 3PJQA 1BKZA 1FI2A 4XF0A 3I49A 2WJSA 4UAPA 1AX1A 1XBFA 2JDAA 2JD9A 3GF6A 1EY2A 4L2NA 3MICA 4QB6A 1YRZA 4W4ZA 2V5DA 2ORZA 2FCVA 1XXNA 1C28A 3LQCA 4QHZA 2RS32 2VO5A 2X5IB 3OUHA 3NSTA 4NIGA 1JU3A 3MV11 4JHZA 3JBG2 4HOOA 4FI9A 4AK3A 3O1UA 3TAYA 1RUI1 3PTRB 2A6VA 3JQXA 1FYUA 4FTEA 3JCIA 5C3SA 2ZGNA 4XF9A 1AR92 2DVGA 2ZBJA 5LRRA 4AR2A 2ZHLA 2DVAA 2XWBB 3CHXA 2FHRA 3AP5A 4B4PA 5EFUA 5IVCA 4N90A 2Q8CA 4UI9L 1ZVFA 1ZA4A 3LEKA 2IFWA 3ILRA 4KG8A 3U78A 4BE3A 3VBOC 3A23A 4BIFA 3ZOIA 1Z78A 3T4HB 4ES9A 1MS4A 4JDOA 4BQ1A 4EQVA 4K1ZA 2DCJA 1ULCA 2VH9A 3WDUA 3M8LA 1S0EA 3JD71 5LW9A 1E5RA 1ZRDA 4JZRA 4XIKA 5FJKA 4YW4A 4LBOA 5FXZA 3O1RA 2W9XA 1UKRA 2RJ2A 3NJZA 4AVSA 3RZJA 2QQVA 2E9QA 4TTGA 4AQTA 2E6VA 2XKOA 3BKZA 4WM8C 3SITA 2SLIA 1V6JA 3DXTA 4O61A 4H3WA 5A7NA 4QHBA 1N47A 5EXOA 1ND3A 1XNDA 5FPBA 1EPZA 3POYA 2FD8A 4YW6A 4IE0A 3VZNA 1LODA 1GZWA 3GBWA 5EYXA 3O12A 4LULA 1W8HA 2P17A 5CA6A 5A3PA 3GHNA 1H1MA 1EAH3 2QQIA 2ZEXA 4JRAA 2OW4A 5FZOA 4BIOA 3CEWA 3N35A 1UOJA 2YUEA 3ECQA 1C5HA 4MSVA 5J98B 1DLCA 2RS31 3LEMA 4N7IA 1ZX5A 3AP4A 5D8AA 2GC3A 2WNVB 3MW3A 5FMCA 5LBBA 3MIBA 1JODA 3VHRA 5F7UA 5FWEA 4R9CA 4XDPA 1AR91 2X09A 2FZ2A 5A6YA 2VUCA 3E6CC 4XUOA 2GH2A 3KF5A 2W1QA 4ARXA 3RYKA 4JX0A 4EROA 4IE6A 4GXLA 1R081 2FDJA 3DN7A 4FOQA 1NE6A 4Q4Y2 1LECA 1A78A 2DTWA 4K8RB 4LHSA 4XZUG 1JW6A 5FZ8A 3T0BA 4AFCA 4IEOA 4XXAA 1N3PA 3ZXJA 1NCQB 1POV0 2F4LA 1CAWB 3KS7A 5FAXA 2ZHNA 1RUG1 5TSWA 1O8PA 2VOVA 3N9MA 3VDCA 4AFDA 5BNQA 5CFCC 4MGYE 4GH4C 1REEA 1RUJ2 4WM7A 1MS3A 4HXCA 1RB8G 3M2MA 3K77A 4FPCA 4LHLA 2ZKNA 1JZ8A 2OZJA 1LHWA 4LPLA 5F37A 3W5NA 1K5MC 1JBCA 3OGSA 5LA0A 2XPJA 4C0BA 1HW5A 5JLVA 2R7EB 2RS12 2O1QA 5JXIA 1EUTA 2NMNA 1LB2A 1CAXA 5FOJB 3A0KA 5GZEA 1H2KA 4EN7B 4NHKA 3VZKA 3CJIC 1LJ7A 3TEZA 1HV0A 1F4AA 1LHUA 1UW8A 2R072 5IVYA 4DXRA 5JPNB 4UWDA 1GNHA 2UWCA 4CEWA 1UY4A 5F5IA 2Q30A 4MGZE 4BHPA 4I2OA 3AKRA 2GSYA 2BFUL 3H3UA 4Y20A 2RV9A 3NAPC 5JSOA 3R6SA 4QX1A 2VZ1A 3ELNA 2E7TA 1NQDA 2BFUS 4SBVA 1TNRA 2VUDA 2RMU2 4CCEA 5A1AA 3VBUA 5F39A 4CDXC 4P9LA 2X29A 4HVQA 3GCWA 2BTVC 2BRTA 2JKXA 4LO4B 4R9BA 2X8KA 4XCAA 4JDNA 5ACA3 2VOXA 4F8AA 2E7AA 4EV0A 3MUZ1 4ONUA 4Q0UA 3ILFA 1MQTB 4QGNA 5BNPA 4D3WA 2YU1A 3VHOA 2D44A 1O8SA 4BLJA 3ATGA 1NA1B 3UK9A 4FPKA 4XFBA 4YFWA 4OI1A 3ZN4A 4IGOA 5FP3A 3I97A 1CWPA 1QDOA 4L92A 1VBB2 1X36A 1LEMA 2B39A 3POEA 2CGPA 1FXZA 1RUJ1 5GZCA 1NUKA 3K3NA 4E2SA 5J3UA 3POJA 5K7PA 5E88A 1NZCA 3DECA 1IPKA 2VOKA 5LBFA 4ATFA 1LAJA 3U14A 2VY0A 4LIVA 3USUB 1S0DA 4LEJA 1I1EA 2RS11 5HXVA 2B9UA 4XILA 4YFZA 2J22A 3HNMA 1JXNA 1W6MA 1F15A 2WAOA 4AI8A 4XUQA 1W06A 1XYNA 2Q1ZB 1X50A 3O0VA 3X29B 5A3LA 3O1VA 1VB4A 3LKJA 4Q4X3 4NIIA 2EVXA 2R071 4Q4W1 5JVVA 3SNMA 3VBOA 3GZUC 1J59A 2QE3A 1RJ8A 1R1A1 4DXZA 4HKLA 2E32A 3R05A 1BEV2 4O65A 5LEJA 5LASA 4R4ZA 3W21A 2JEMA 1NY72 1OH4A 3PUSA 5FYSA 4Z8BA 4LA3A 4AI1A 5J1XA 1UOBA 2ZHMA 2ZEWA 3ACLA 4BH9A 2RMU1 1XU2A 1CIYA 2Q1MA 1W04A 1AR82 4BA6A 5JAXA 5I0RA 2JG8B 3ACFA 5IFPA 2ZHKA 2ADEA 3H1MA 4WM8A 3PL0A 1UO9A 1H2LA 5FYYA 4H7LA 4LKSA 3O14A 4META 2QQLA 3FZ3A 5CKNA 1ZRFA 3EQEA 4XJUA 4WV8A 1SPPA 3GZAA 3UGGA 2P2KA 1O3TA 1WBFA 3GHMA 4QXBA 1S0JA 4S2GA 4KWJA 2GP3A 3BOPA 1AYN2 1OUXA 4JGYB 1ZBA3 3BU7A 4AAPA 5EIYB 3WSOA 1HRI3 3CO2A 2ZMLA 1VBB1 2R062 4PHZA 3OPTA 4URAA 2WINB 3KD4A 3B9CA 4HSJA 4O9GA 4NHXA 1AL22 1LOEA 3ES4A 2GZWA 2LRPA 2W1SA 1Q8QA 1L7LA 1WMEA 4GIQA 3RZZA 3Q8FA 4BK5A 2VW2A 1Y4WA 4GWNA 5T52A 1W6PA 1XQNA 4JQRA 1MR5A 2CGNA 4KBBA 1U5YA 3MGUA 5D1IA 4ZS3A 4A7KA 4CDUA 1MPXA 2IZWA 3WNPA 1APNA 2EF6A 1MVEA 1ODNA 2BBVA 3CJXA 4HK8A 3HBZA 5FXXA 3VKOA 1ULGA 4AI0A 4DNYA 1T2XA 3M70A 3JB4C 2IXHA 3VBFC 4DB5A 3AZWA 2GH8A 2ZAHA 3NWKA 1D4M3 4RL7A 4TXWA 1XU1A 1BEV1 5CFCA 3GXUA 2RR13 4GH4A 1NY71 4B4QA 2EAAA 4QM8A 4FTSA 1ND2C 4K7JA 2UWAA 2XQXA 5A6ZA 2Q0AA 5IAVA 2HWD2 2VMIA 5IWFA 5CZKA 1K5MA 3T08A 2HH9A 1ULEA 2AEYA 2DUOA 2JIJA 4QXHA 4AYUA 4I3PA 1ZRRA 1ZBE3 2Z2SB 3OD4A 4NJ4A 2EXKA 3HN1A 1XYPA 4LBJA 1A6CA 2JICA 3VB9A 2BGPA 2BYVE 3AZVA 4AF9A 1ST8A 4RR3C 4BB3A 2R042 1W28A 3I3EA 3CJIA 4LLOA 4Y22B 2C1FA 1QNWA 4IERA 1V6OA 1AYN1 5LK7B 5F9TA 2AREA 3AC0A 4DUVA 4MYEA 2GC0A 3MW2A 3NAPA 4KWLA 5D21A 1JYWA 2WWUA 5FUNA 4CP9A 3Q9OA 4XF1A 2FQPA 1MS0A 5B4NA 1WKYA 2R0FA 3Q8BA 1QXPA 2QKDA 3H8RA 2GC2A 4GJZA 4B7KA 3FHAA 1OT5A 2O8OA 2EALA 2W92A 4XXPA 3TNPB 2CWMA 1Q3EA 3OGGA 1RUC1 3WQBA 4RS5C 4W65A 3D8CA 1OSGA 1YXWA 5KHKA 3V0BB 3IZOA 3AL5A 2D6KA 3N9OA 1RGSA 5E1RA 4CPBD 4XFGA 2JE9A 1W9TA 3MFAA 4K9SA 1W6NA 4QX7A 5DZGA 3UJQA 1CAUA 2G1MA 2Y6HA 3DF0A 4OFGA 3NNFA 5GKAC 2HEYF 3J7NA 3N7LA 3WP4A 1OOPB 2D3PA 1OF3A 2V72A 3ALQA 4XETA 5IW0A 5FY9A 4NPMA 1MEC1 3H42B 2W95A 5JZGB 3RVHA 4MG2A 3C7EA 5DQ0A 4IV1C 4XHXA 1RVF3 5JOZA 5FYTA 3WF2A 2D93A 2RS53 1OVSA 3WQ0A 5FZHA 2W5FA 2WR9A 5GZGA 3I3MA 3AFKA 2ZGRA 2DFBA 2GAUA 1W8FA 4YVSB 4PDWC 4FP2A 4ASMB 5I8SA 1KGYA 4J25A 4CU6A 5FOBB 1F35A 5F32A 2JJ6A 1DZTA 5L7OB 3RPQA 4JTNA 1ZM1A 1QJY3 2J1VA 4MZUA 4Q5OA 5CAZA 4OI4A 1LENA 2HWB1 4UW6A 5FP4A 3ZYBA 4WVVA 1YC61 1JH5A 2WFPA 4CP1A 3WNLA 3GZEA 3QD6A 2HWC3 2UU8A 5T3NA 1C4RA 2F4PA 1KQRA 1LOFA 4YGBA 1LRHA 1H6XA 2TUNA 4AEDB 2IXIA 5EJ3A 5FZKA 5G04L 1X33A 3K75B 2I07B 5GLVA 2ARXA 1WCSA 3PMEA 5KXEA 2JWPA 4NOTA 2QDNA 2JG9C 2YROA 2VZUA 3OF1A 5FQ0B 1N1YA 5CIRA 1LOAA 1ENXA 1DP0A 5F5CA 5IAXA 4BDVB 2OKXA 2IXCA 4JGZB 2DVBA 5JMOA 3GCXA 2YPDA 1CZSA 1GMMA 2I2SA 3ES1A 2A3YA 2D40A 5K0UA 3RI8A 4PI2A 5JR2A 5FZIA 4P9XA 4U36A 3ENRA 3RZLA 1V6IA 3D3AA 2XJSA 3BTAA 1JMUB 1V6LA 5JXGA 2OPKA 3VBSC 5H9QA 1HRV3 4NR1A 4Q1PA 1HXS3 1GQPA 4XFCA 3BODA 1F5FA 1U5XA 3VBFA 4OULA 3RFRA 1G9BA 5GLWA 1ZA7A 2WO7A 1GICA 4QXCA 1S0IA 2MEV2 3B94A 2ZXQA 4QQOA 1J1LA 3HQUA 1AYM3 4DO0A 5I0DA 4B4RA 3VBHC 3O1PA 4QPIC 1K12A 4HBNA 1IS5A 1ND2A 2ZABA 1COV2 2FMDA 2B45X 2VR4A 4IE7A 4QHOA 4RFT0 3VBRB 3D0SA 1FV2A 3AZXA 3LEGA 4LMFA 3TEXA 1W3XA 5LK5A 4I09A 5FZ9A 1UZ0A 3ZYHA 2R49A 3S7IA 1AR72 3RSJA 4LIUA 2PHUA 1LU2A 4GJYA 2LUWA 1GZ9A 2Y60A 3A21A 4RR3A 1RUF3 1H8VA 2KD7A 4FPGA 4NWWA 1CX4A 1VBD2 4ZONA 1SG3A 2IXKA 1GWLA 4L99A 4N43B 3CZUA 1SACA 2CDOA 4OHXA 3IPVB 3WUCA 2WS92 4QKFA 1JYVA 1WCQA 5KHIA 2GU9A 2VW0A 3U4XA 4AL9A 5AC93 3RMXA 1W0NA 3IDCB 4A7YA 3AVSA 1OFSA 2PHWA 3NRUA 2QQNA 4DRVA 4Y5Z0 1W8TA 4HN0A 2C26A 3WP6A 1XNAA 2NQYA 2P6CA 5FFOC 3NNMA 2GMMA 4IEZA 4B8EA 3IWZA 4Y5SA 3J7HA 3WDVA 1GOHA 2EIGA 4RS5A 3KVBA 3U75A 5C8CC 5ABJC 1KS4A 1YNAA 1PIV3 3FLPA 1WBLA 2WDBA 5F6KA 4ARYA 2HYKA 1FPN2 2UY9A 2B4KA 4Y1XA 1O4ZA 4AHYA 4P9IA 1B35C 5FMDA 4B7EA 3PDQA 2MEV1 1VBC1 3M3QA 2H6CA 2WBKA 3HIFA 4GMP0 2K46A 5JOWA 4AGVA 1UMHA 2W68A 4MX3A 3WW4A 1COV1 2GNMA 3KGZA 2BZDA 1H1IA 3LD8A 4URTA 4M3CF 1XE8A 2IVJA 3UKTA 2BWCA 3L2YA 4FQZA 1TME2 1AR71 1ONAA 4XPVA 3WDTA 5C9AC 5IATA 5FZDA 4MVTA 3NNJA 4PDWA 4CUAA 5EJZB 4PIZA 4ZU7A 4IEXA 4BPZA 1VBD1 4AVTA 4Z2WA 3TB0A 2JE7A 1RUI3 3MF9A 1CIWA 3ZYJB 3NJVA 3RI9A 2WS91 2HWE2 5HCFA 1HLCA 4QKBA 2XJPA 3F2ZA 5CG8A 1SBFA 4Z82A 1ACCA 4ES8A 1RIRA 1N3OA 2ARCA 2W47A 2DVFA 3EYPA 3HOBA 2HYXA 1QF3A 2VZ3A 4BOWA 4E4HA 2VMEA 1EYBA 4DRRA 2BGOA 4CEYB 3RQ0A 4YGEA 1ZZBA 1UN1A 1W8OA 3C7GA 4K1YA 4BXFA 1IQAA 1H9PA 4QXKA 1RUE1 3I2HA 1C5IA 1D0HA 2K9ZA 3PUIA 4HN1A 3JD73 5T55A 5E6HA 2E26A 1PK6B 2D5FA 3AMMA 5FJHA 2CU5A 2JG9A 5JSRA 4Q2FA 4V2VA 5AFEA 1FPN1 1SDDB 2D6LX 5A3NA 5E89A 5FP7A 2VAUA 4XQDA 1WLTA 5LY2A 2A71A 4YWAA 5L9VA 5F8PA 2JDPA 3FWEA 4G9SB 3OPWA 2LALA 1JZ6A 1IG3A 5ANNA 3RJRA 5A6QA 3U37A 3G7DA 3BPZA 4D7YA 3S6PA 3ZFEB 4XFIA 2HBTA 5EYYA 3TN92 4JCKA 2W0XA 1Z0HA 4AGRA 1W6OA 2CGOA 1Y9QA 2WL1A 3BN6A 4KG0A 1F4HA 3UV9A 1NCRC 3I2IA 2ZX1A 1NLQA 1RUH2 4D6SA 1LEDA 2QQMA 2X5IC 1TME1 1H2NA 2XBO2 4XBQA 3VBSA 1QJFA 2RS33 4CCDA 4BM8A 3OEBA 1G86A 4NVPA 3BTYA 4IV3B 3K48A 2RM22 4Y1UA 2HWE1 4YW1A 1FAYA 1OLMA 1WA6X 1AR93 5A70A 4QD2A 4QPIA 1VRBA 2FCUA 4P5YA 3SCGA 5I8TA 4CP2A 1JYIA 5GM0A 3ETQA 4LNVA 4WVMA 2A7AA 1R083 1KITA 1HIXA 4A2UA 4KBZA 3OYWA 1AXYA 3SKVA 5BNNB 5C4WC 1M4WA 1RUG3 4RN5A 4DS0A 3AXEA 2QQUA 2AGSA 3MYXA 4RGGA 2W91A 2K0GA 4MO3M 4UF0B 3SXWA 3E6DA 1MZ6A 4KL1A 3CMGA 1UPIA 3DKQA 1PHMA 3BU0A 4OMCA 1BCXA 5JUVA 1YQCA 2D43A 2YB7A 4XMAA 5A32B 4QPWA 1UWWA 2B46X 1PM4A 2ZOEB 5C3RA 4P14A 3TN91 2W3JA 5FMBA 1W9WA 1O5UA 1IGOA 4XC9A 3KT4A 4XJ8A 3WDXA 3D6EA 3CU7A 3C2UA 3KLSA 2ZGSA 3AP9A 3ZFGC 3THPA 2QVSB 2Y33A 3VGIA 2WZR2 1RUH1 4AI3A 4NRPA 3LZZA 2XBO1 3KV4A 5ABJA 1VMHA 4TLGA 2RJKA 1U12A 2WNVC 4KWUA 3PVBB 4LBMA 2C4XA 3FE5A 1OF4A 1IS3A 3PIGA 4KWKA 5FYMA 2ETEA 4HK9A 4LHNA 4OHWA 3WVJA 3WNMA 1B35A 1O59A 2C9AA 3VDDC 1S55A 3HAGA 2VOTA 5EPAA 1OQEA 4D6RA 4IEWA 3C8XA 1WW7A 3IIIA 1RC6A 4NROA 4RFRB 5T54A 3VZJA 2EICA 3P3NA 2DTYA 5FZCA 1BBT2 4XDQA 4FOVA 4IEVA 3WW2A 3BCWA 3NV3A 1HB4A 3VZOA 3U11A 4OCTA 4BQ5A 3H1YA 4M00A 4A6OA 2XJQA 5HBAA 5CYYA 4ZXEA 1KJLA 4PI0A 1RUJ3 3GZTB 3HNBM 2EIBA 1GQGA 2DUQA 2YMZA 1CPNA 3JB8A 2GN7A 1UY2A 3HT1A 2J1SA 1ENRA 5A7WA 1ND3B 2L9LA 4HANA 3LIHA 1W2AX 1FOD2 2JDYA 3O0XA 1X8EA 2H0BA 1SDWA 1WLCA 1GZWB 3MZHA 5IVBA 1OD3A 1QJU2 1K5JA 2E7QA 4ZHNA 4UFHA 1K45A 4XE9A 3AXDA 3I2KA 3ZLIA 5JIUA 1UU6A 4S2DA 5FZOB 2G9GA 3RS6A 2J7MA 3ZSMA 2VTXA 2R073 4Q4W3 2PLV1 2QQJA 2YFUA 2ILMA 1R1A3 4UFIA 1YCIA 2Z5WA 2WZR1 3MV01 3T2TA 4CA9A 1LHOA 4RD7A 5IJRA 5D8AB 5LRSA 4UOJA 3WUDA 2O0OA 2R1BA 3WG3A 1OPOA 4CXXA 3IDEA 2XVKA 4DFSA 5JXHA 1NYWA 2VMDA 5FK7A 5FYIA 5BYNA 2RMU3 1JOPA 2W08A 3W58A 4XUTA 1QJX2 2JXAA 3GALA 3IN9A 1JN2P 3HBKA 1ZZ8A 1CAVA 4LORA 2WO3A 1HJFA 5J36A 3SQOA 2FDFA 3I4IA 1PNGA 5CFDC 2GC1A 5EWSA 2W87A 2WFF2 2DU1A 1BBT1 1UY3A 4YZ1A 2WWJA 3P1IA 3ZDVA 2A6XA 2CSGA 3ILNA 4FPFA 3KWVA 4F7ZA 5FDBA 2WNUC 5JXJA 4WM7B 5F2WA 1NCRA 1UIJA 4R9DA 1U0AA 5T5OA 2DBIA 4AXOA 5KBFA 2KA3A 1SBEA 2GMPA 3VD3A 1NOVA 2AUYA 1S0CA 1H30A 1SHWB 2PELA 3JBG1 4NMIA 2XLGA 1QXRA 4NRMA 5FXVA 5A7QA 1CAXB 3QCWA 3ZXFA 1W99A 1WZXA 2A3WA 4XFFA 2B7YA 2V4AA 1RHI2 3B7MA 1OBNA 4BZ4A 2PAEA 3DKWA 4IEQA 1QJU1 4YM1A 1PM7A 3SKJE 3QACA 4CCMA 5AFBA 2NP0A 1HN1A 2D98A 4K8FA 4CVUA 2E63A 3ON7A 4CEWB 5C5TA 2YC4A 3Q8AA 3KQRA 4Y20B 1H1AA 2YG0A 1JZ2A 3BYWA 3B69A 1H4GA 5C4WA 4GALA 4A44A 3QH6A 5FBZA 2XVLA 3PTYA 1BYHA 1BEV3 4Q0VA 4JHTA 5FLJA 2XJRA 1GOFA 3VBUB 3WHTA 5CADA 3QBQA 2H6BA 1NXMA 5CEHA 3ZSEA 2BU9A 5FPXA 3I59A 2CAVA 3I2FA 2DCZA 3AMPA 5FKCA 2ORXA 5KXCA 1QJX1 4A3ZA 1W0OA 4YSFA 2RJLA 5BNPB 3N3HA 3ZYGA 5B4XA 5KHGA 1JHNA 2VECA 3MIFA 2YC0A 2VZQA 1UPSA 3KGLA 2VCAA 3NVCA 4UW4A 4DEVA 2Y6FA 4YZ2A 3KCCA 3LDRA 2WFF1 5SV8A 4ET7A 2JECA 3MLKA 4Y33A 3GBGA 3N9PA 4JRLA 1DQ6A 2VMCA 4LO6B 2QBXA 3ZFGA 1AYN3 2BV4A 2P5BA 5BXXA 5BY5A 5A7OA 3H8XA 2FBEA 5DAVA 4CU9A 3W9AA 3Q8EA 4DXTA 5GLUA 4Y1VA 2VZVA 1DGWX 3M3IA 5T5JA 4HL0A 1BJQA 1MS5A 4K6BA 2NZ9A 2QQKA 1HB2A 2WIIB 1C1LA 1PO22 1YIPA 5DPNA 5IUQA 1MACA 1W6MB 3RWKX 1HKDA 1W8UA 3VDDA 3HD8B 3U1XA 4UW3A 1RHI1 2ZX0A 2YY1A 3UKVA 1UOFA 3RYPA 2FZ1A 1RUC3 2JDHA 4KGGA 5GALA 2WNEA 5DAXA 3O1TA 3VBOB 3WNKA 1W0PA 4B29A 1IHMA 4Q4Y1 2DFCA 3SH3A 3N7MA 4YZ3A 2WZEA 2X10A 4M3CA 1CR7A 1UYXA 4JV4A 1F5JA 5EHDA 1GYKA 1G9CA 4QPGC 2P3YA 2ZX3A 3MEPA 4BISA 5KC5A 2JD4A 1RUNA 3CLPA 3MIHA 2JX9A 5L73A 1OQDA 4HSLA 3F95A 5A33A 4EJRA 3T0DA 2PAKA 4WM8B 1NLRA 5FZMA 4EZHA 5AVPA 2FDGA 1WCKA 1FNYA 4FPLA 1MEC3 3MUY1 1CQ9A 4LJHA 2J1EA 5BNOC 1EV13 3HN3A 4I0WB 1OUSA 1V9U2 3HT2A 2CV6A 4J1XA 1SPPB 4OI0A 4AWDA 1F8VA 1MS9A 3A0NA 5A6XA 3T2OA 1AZDA 4LKDA 1POV1 1W90A 2XKPA 4W6XA 1OHFA 4FFHA 5DDJ2 3UJOA 4EN8B 1YFYA 1O4TA 1WW4A 2XJUA 2XHNA 4NHMA 4NWVA 1IG0A 5H9SA
chains in the Genus database with same CATH topology
3LF7A 3LEMA 1W2TA 4HXCA 4CCDA 4UFKA 1Y9MA 2AC1A 3LIGA 4CCEA 3LDKA 4UFMA 4B1MA 2QQVA 4FFGA 5FMCA 5FK7A 5FMDA 3KF3A 3PIGA 4FFFA 4UFJA 3U14A 4AZZA 1Y4WA 1Y9GA 5ANNA 5FIXA 3LIHA 3IMMA 5FK8A 3PIJA 2ADDA 3HBKA 2XQRA 2ADEA 2QQWA 3ZR6A 2AEYA 5FKBA 3NMBA 3RWKX 4JQTA 3KF5A 3U1XA 3UGHA 4B1LA 3SC7X 3ZR5A 4UFHA 5FMBA 4UFLA 2AEZA 3H3LA 3OSDA 5FKCA 3UGFA 4CCCA 3UGGA 3LFIA 3LDRA 4FFIA 1ST8A 4FFHA 2OXBA 1UYPA 4EQVA 3U75A 4UFIA 4QHZA 2QQUA 3S5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LF7 A;  3LEM A;  1W2T A;  4HXC A;  4CCD A;  4UFK A;  1Y9M A;  2AC1 A;  3LIG A;  4CCE A;  3LDK A;  4UFM A;  4B1M A;  2QQV A;  4FFG A;  5FMC A;  5FK7 A;  5FMD A;  3KF3 A;  3PIG A;  4FFF A;  4UFJ A;  3U14 A;  4AZZ A;  1Y4W A;  1Y9G A;  5ANN A;  5FIX A;  3LIH A;  3IMM A;  5FK8 A;  3PIJ A;  2ADD A;  3HBK A;  2XQR A;  2ADE A;  2QQW A;  3ZR6 A;  2AEY A;  5FKB A;  3NMB A;  3RWK X;  4JQT A;  3KF5 A;  3U1X A;  3UGH A;  4B1L A;  3SC7 X;  3ZR5 A;  4UFH A;  5FMB A;  4UFL A;  2AEZ A;  3H3L A;  3OSD A;  5FKC A;  3UGF A;  4CCC A;  3UGG A;  3LFI A;  3LDR A;  4FFI A;  1ST8 A;  4FFH A;  2OXB A;  1UYP A;  4EQV A;  3U75 A;  4UFI A;  4QHZ A;  2QQU A;  3S5Q A; 
#chains in the Genus database with same CATH topology
 2HLE A;  2ZMN A;  2WO2 A;  3QOP A;  3FMG A;  3GJB A;  3H8U A;  2HWB 3;  5FPU A;  5F5Q A;  1W6P B;  1QNY A;  3O1M A;  1C8M 2;  1RMU 2;  4O7X A;  3VL8 A;  2BOI A;  5FUP A;  4CDU B;  1CPM A;  2Z4F A;  1PO2 1;  1TMF 2;  2RDQ A;  5FBJ A;  1DQ1 A;  2VTX J;  3TEW A;  2XWJ B;  4XBN A;  5SV5 A;  4RA0 A;  3UGF A;  1IPJ A;  3LB9 A;  5CFD A;  4XUR A;  3ZKU A;  3FX3 A;  5FCC A;  4EN9 B;  3KCX A;  4J1W A;  2Y8K A;  3HNY M;  3ZIX A;  4AQ6 A;  1PVC 2;  4XTP A;  1Q8P A;  2MNG A;  5CFC B;  3OGJ A;  4GH4 B;  4OLL A;  1UMI A;  5F6L B;  2WNU A;  4IGP A;  4Y4Y A;  1DYK A;  1NE4 A;  3AKP A;  4IE4 A;  4X8P A;  5FY8 A;  4ITC A;  2WLQ A;  1LKN A;  5G05 L;  1OOP C;  2D6M A;  3FUO A;  1MS1 A;  1UIK A;  2WSU A;  1QOT A;  3K3O A;  4K20 A;  4CUG A;  3KQ4 B;  5FLI A;  1W9F A;  1K5M B;  4PLO A;  1LGB A;  3BIW E;  2VTF A;  5FV3 A;  4CDW C;  5BV6 A;  1MZ5 A;  1PZ9 A;  5I8Y A;  5FYB A;  1CD3 G;  1HX6 A;  1V9U 1;  2H0V A;  3ETP A;  3OPZ A;  4RGK A;  1GAN A;  1H8T C;  4CZS A;  1WCU A;  3CJI B;  4QQP A;  1JYC A;  2OT7 A;  5DXD A;  1PNF A;  4EE2 A;  1F9K A;  2BBA A;  5DDJ 1;  5F3E A;  5EV7 A;  2N7G A;  2D5H A;  4LR4 A;  1BZW A;  1D7P M;  2WZP P;  1UAI A;  3SIS A;  2BQP A;  3NAP B;  4W6Y A;  1CVN A;  4XF4 A;  3NO8 A;  4CP9 B;  3NW4 A;  4XAA A;  5D2A A;  2HWF 2;  2OII A;  4ASK A;  2BPA 2;  2AAC A;  5FR3 A;  1BXH A;  5HXM A;  3JU9 A;  4CCK A;  1XNB A;  3QLQ A;  5ACA 2;  3HR9 A;  1LOG A;  4OVE A;  1S2E A;  1QY4 A;  2D97 A;  2X05 A;  1C8M 1;  1RMU 1;  4GKX A;  4DIN B;  2Z42 A;  2ZGK A;  4HPK A;  4QU1 A;  1AR8 1;  4EWA A;  2WA4 A;  1A34 A;  1ZRC A;  3BOW A;  3ZXD A;  3OTF A;  1LGN A;  4CRQ A;  4AHW A;  2RDN A;  5C8W A;  4QT6 A;  1TMF 1;  3OBZ A;  3V65 A;  1EPW A;  2A73 B;  3VLB B;  4ZZ8 A;  4YW3 A;  4ORF A;  4P9W A;  1Y7B A;  2VPV A;  2WRA A;  4YG6 A;  3WG4 A;  1G7Y A;  1WA4 A;  1YJL A;  5J96 B;  1ULO A;  1FNZ A;  3KT1 A;  5DAB A;  5ISL A;  1W6N B;  2YBP A;  1PVC 1;  1S4C A;  2HBU A;  4Q0P A;  1CAU B;  4EYU A;  4DZG A;  3PLQ A;  2R06 1;  3J8F 2;  5JI7 A;  2R0H A;  2XB6 C;  1RUD 2;  3E1F 1;  1DYO A;  2Q8E A;  1W9S A;  2ET7 A;  5B2G B;  3NJY A;  1AL2 1;  5HV0 A;  1UY0 A;  2Y0I A;  3OJB A;  4XZP A;  3I8T A;  4CDX A;  4NID A;  1BMV 2;  5FY7 A;  4LE3 A;  1QQP 2;  2V4V A;  3PJY A;  5FZA A;  3SEP A;  5KR7 A;  2V09 A;  1IS4 A;  2OA2 A;  1A8M A;  2RVA A;  4Q4X 2;  3H3L A;  2J1R A;  1FMD 3;  1O4Y A;  2VMG A;  3ZSK A;  3RNS A;  1VBE 2;  3PUQ A;  3C7H A;  3FFZ A;  2E53 A;  4LXL A;  1GQH A;  3EJK A;  3ZM8 A;  1DQ2 A;  1CZV A;  4LOS A;  2YGM A;  1FT9 A;  4KMQ A;  4QPG A;  4E2G A;  2BDR A;  4UFM A;  1G9D A;  4E27 A;  4KU8 A;  2HWF 1;  1WCD J;  3WDW A;  2VU9 A;  2MEV 3;  2WAB A;  4TYS A;  1VBC 3;  3T3Y A;  1PGL 2;  2B8M A;  4BLI A;  2GME A;  4MOA A;  2RHP A;  4CU8 A;  1GR3 A;  3RDI A;  2HWD 1;  3T2P A;  5FP8 A;  2JDZ A;  4JC1 A;  4CXW A;  2R32 A;  2IVI B;  5BNO A;  3AKS A;  1D0G A;  3ACG A;  2WQZ C;  3WNO A;  3LFI A;  4FP3 A;  4HT1 T;  5FZE A;  1ZBA 2;  3J7M A;  4C1W A;  1F2N A;  1SLA A;  4PIX A;  3POS A;  1AR7 3;  2R04 1;  4WVZ A;  2VVD A;  3INA A;  3PUR A;  1R09 2;  2UY8 A;  4N43 C;  5KHH A;  4F3J A;  2XML A;  2JB8 A;  1XOY A;  4NPL A;  3P6B A;  1VBD 3;  4XAE A;  1BQP A;  1STM A;  3J8F 1;  1RUD 1;  1ZZ6 A;  2VBD A;  4NHL A;  5J37 A;  2WS9 3;  2R6Q A;  5K0U B;  1V70 A;  1YO8 A;  1KDK A;  1DLL A;  1VJ2 A;  1VBA 2;  2BVV A;  3J7L A;  4IND A;  4KQ7 A;  4E9K A;  3WLU A;  3NMB A;  1BMV 1;  1AXZ A;  4Q1R A;  2OX0 A;  1QQP 1;  2ZS6 B;  1YFW A;  3WXP A;  1QKQ A;  1JHJ A;  4I3G A;  3V64 A;  4Q4X 1;  4AEM A;  3DPR C;  1IQD C;  4C91 A;  4XQW A;  5M0T A;  1ZRE A;  2ZCW A;  5FZF A;  2FDI A;  4PQQ A;  1AVB A;  1D4M 2;  5IK5 A;  2Z79 A;  3VBF B;  3ZYI B;  4IEP A;  5CNA A;  1VBE 1;  2Q5T A;  2RR1 2;  1RUE 3;  2VGD A;  4R8H A;  1H6Y A;  1SLL A;  1FX5 A;  2QCS B;  4OYU A;  4AI9 A;  1RXG A;  2XOM A;  3U07 A;  2ZGM A;  3SH4 A;  4K3U A;  2UYA A;  3LIG A;  1FPN 3;  5DMY A;  3EBR A;  3FN9 A;  2VZO A;  2VNG A;  3KF3 A;  1ND2 B;  3DGT A;  3H7J A;  1UMZ A;  4MXW A;  2P37 A;  4HMZ A;  4M4P A;  2NYY A;  3B00 A;  4YW2 A;  4QM9 A;  1DQ0 A;  3NV1 A;  3RG0 A;  4LKE A;  3BPS A;  4RQP C;  1ZZ7 A;  3E6B A;  5FO8 B;  3M4F A;  4CDW A;  2O14 A;  4AEK A;  2OPW A;  3OB8 A;  1YUD A;  3S7E A;  5FMO L;  3WDY A;  2NLR A;  4LO7 A;  4ZU5 A;  3S57 A;  5A7S A;  4N53 C;  1NG0 A;  3FFQ A;  4AFM A;  4C8D A;  2OXB A;  4RR3 B;  1H8T A;  5FMO S;  2IUW A;  4IXL A;  3IAP A;  3SH5 A;  4DIQ A;  1TME 3;  1UZW A;  2NN8 A;  1UYY A;  2A5Z A;  5JOX A;  1YQ6 A;  3N9Q A;  1R09 1;  4UT5 A;  3B01 A;  3ZFF C;  3JZV A;  2J1T A;  1W3V A;  5E16 A;  5FRE A;  5T5P A;  1V0A A;  3WNN A;  3NKT A;  5C70 A;  2ID4 A;  1SCS A;  4OQ9 A;  3VD9 A;  2HWE 3;  4FCA A;  2D6O X;  4PLN A;  1VBA 1;  4JQT A;  1XSQ A;  4PCR A;  1Q5O A;  1ASJ 2;  1ZYB A;  3M3C A;  4AHZ A;  1SMV A;  1QU0 A;  1SZB A;  4JKM A;  1U5I A;  2XLA A;  3SEE A;  3AMH A;  3AB0 A;  1ULD A;  4RS5 B;  4FFI A;  5FZB A;  4OUE A;  1X8M A;  3IMN A;  4QGM A;  2A70 A;  3M7A A;  4D0Q A;  5A3U A;  1G6N A;  1GBG A;  4CCL A;  1I5Z A;  2RR1 1;  1KRI A;  4K40 A;  5FZ1 A;  3KVA A;  5A80 A;  2J1U A;  1MVQ A;  1W8N A;  1RYY A;  1WMD A;  2DVD A;  2YFZ A;  3C7O A;  4BK4 A;  5A1F A;  1H0B A;  1GWK A;  3JUU A;  1W39 A;  1DBN A;  5L36 A;  3HQR A;  4QGL A;  5LEK A;  3RZM A;  4UFJ A;  3ZMO A;  4MUV A;  2W39 A;  3WW3 A;  1S0G A;  1UZY A;  2GND A;  2RS5 2;  4M0H A;  1JUI A;  3BAL A;  4YVW C;  3VZM A;  2CDP A;  2XH6 A;  1GZT A;  2CY6 A;  1X9P A;  2EA7 A;  4BXS V;  3Q8C A;  1TNF A;  3KSC A;  3OOX A;  2ZGQ A;  3TN9 3;  3OY8 A;  4L0P A;  4LBL A;  2YU2 A;  3KHB A;  4CDQ C;  1ZZ9 A;  4XVH A;  4G3Y C;  4OMD A;  1J3Q A;  5LA1 A;  4HKW A;  4PDW B;  1YHF A;  3KV9 A;  4E4D X;  1PO1 2;  3LSE A;  2XBO 3;  2WSV A;  3R0R A;  3C3V A;  3PVO A;  1US3 A;  3BGA A;  1LGC A;  3H3Z A;  1JUH A;  4PJY A;  3P3P A;  3UKN A;  2HWC 2;  2IFR A;  2P34 A;  4OZO A;  4COU A;  4QX2 A;  2JIG A;  3DV8 A;  3GM8 A;  4AAX A;  4BQ3 A;  5FUI A;  3IDB B;  1QJE A;  5T50 A;  2VCC A;  4A41 A;  5FO7 B;  5C33 A;  1JOJ A;  2ZA9 A;  3OUI A;  4Q27 A;  2OQ7 A;  2GNB A;  2G4I A;  1L3J A;  1BLZ A;  1ASJ 1;  1U5Z A;  2XJV A;  3H9A A;  4IUG A;  3BIE A;  3RZK A;  4IV1 A;  4NO4 A;  1HB3 A;  5LA2 A;  4AFB A;  5BNN C;  5FZG A;  1QOO A;  4XIO A;  1PVX A;  4FVV A;  4ISR A;  3K4D A;  1P8J A;  1DGW A;  5HV4 A;  1IKP A;  1C1F A;  4I0B A;  1YIF A;  2JG9 B;  4QU2 A;  2WT2 A;  1GKB A;  2GAL A;  4HVO A;  3PHM A;  3O1S A;  3J4U H;  1LU1 A;  4EWD A;  5DUV A;  1VPH A;  1N1S A;  1AR6 2;  2G19 A;  4F83 A;  2HEW F;  4IGQ A;  4Z2A A;  4Q4V 2;  2IXL A;  1UF2 C;  2WC2 A;  5DN2 A;  1NT0 A;  4CCJ A;  2VG9 A;  5EQU A;  4YZ4 A;  1W6O B;  4GQ7 A;  3I2O A;  1B09 A;  3CNA A;  3NV2 A;  4ASL A;  4COW A;  4PF1 A;  3POF A;  5LY1 A;  2WYF A;  3VBS B;  4AVC A;  1QMJ A;  1AX0 A;  1KEX A;  1UXX X;  1YFU A;  1UYP A;  3DPR A;  3FHI B;  3VHN A;  4BMB A;  4DUX A;  2PLV 3;  3FBY A;  5IK7 A;  5JR7 B;  4C1X A;  1F31 A;  3CQO A;  4YW7 A;  3S5A A;  4O9E A;  1PO1 1;  2P4E A;  2W46 A;  3AM2 A;  3HPN A;  3SCF A;  3V56 A;  2QZ2 A;  3GBF A;  4QX5 A;  1SFP A;  3D5O A;  4QPI B;  4GD4 A;  2EIE A;  3WIN E;  5BPX A;  1ALY A;  2KXL A;  1C57 A;  1DYP A;  4KI5 M;  4NAO A;  2CNA A;  4WVM B;  3M3E A;  4XTM A;  3SLI A;  2DF7 A;  3KT7 A;  4HFS A;  3ZSL A;  5HCA A;  3OYW B;  4XFH A;  5CU1 A;  1MZF A;  4RQP A;  4UBH A;  4CU7 A;  1BBT 3;  2BWA A;  2TEP A;  3APB A;  3A7Q A;  4N53 A;  5FYH A;  2VD7 A;  4RGA A;  4YM2 A;  3WF3 A;  4W6W A;  3I2J A;  4LIT A;  4ZXK A;  2D6N A;  4BQ2 A;  3HJR A;  5I0T A;  4V2W A;  3WEZ A;  1Q43 A;  2YC2 A;  1WMF A;  2Q8O A;  3EHK A;  3THD A;  1UXZ A;  1AR6 1;  1BK0 A;  4GMP 1;  1CES A;  3JBG 3;  2R1D A;  1QHD A;  4KU7 A;  3ZFF A;  3HVD A;  5IVV A;  4TZD A;  2VJX A;  2J42 A;  3VKN A;  4Q4V 1;  4ATE A;  5F2S A;  1K3I A;  4P9J A;  3LCP A;  3VBH A;  1SLC A;  5FLH A;  3VKL A;  1GOG A;  3VKM A;  2E33 A;  4LT5 A;  4FTB A;  1QJU 3;  1GV9 A;  5JOY A;  1GU3 A;  2VZT A;  4G4F A;  2FDH A;  1NQJ A;  1GWM A;  1VAL A;  4OHZ A;  2C9K A;  4E4S A;  1IKQ A;  4XOG A;  4OI2 A;  1AF9 A;  3KM5 A;  2W94 A;  3OBT A;  3WY6 A;  5FY5 A;  2ARB A;  5ABJ B;  4QDS A;  2RG4 A;  3B93 A;  1US2 A;  5DG2 A;  5IK4 A;  1VRH 2;  2WZ8 A;  4XEZ A;  4N7U A;  4FPY A;  2R30 A;  1ENS A;  3I7D A;  3UES A;  4AE2 A;  4CP0 A;  4DEQ A;  1B35 B;  5C9A A;  3RWN A;  1S2K A;  2NM1 A;  4BWO A;  1GP4 A;  5APA A;  1NX9 A;  4OUM A;  3WOG A;  1QJX 3;  1VAM A;  2JE8 A;  2DU0 A;  3ZX7 A;  3CDZ B;  4NRQ A;  3E97 A;  1UY1 A;  2W2I A;  5EZW A;  3WQ1 A;  4YVW A;  4ZU4 A;  2VCB A;  3JQW A;  4GWJ A;  1TE1 B;  2VMF A;  4LBQ A;  1DZR A;  1E57 A;  1ZNP A;  3GDB A;  4XW3 A;  2WFF 3;  2YGL A;  4CCN A;  1Q8S A;  2AEN A;  4CDQ A;  2XUE A;  4XAC A;  1PGS A;  3V0A A;  3WF0 A;  1W2T A;  4IE5 A;  4JTO A;  2YBS A;  2ZGU A;  5C8C A;  3B3Q E;  2Q1F A;  3IAQ A;  5A7W B;  1UD1 A;  5K4L A;  4DUW A;  2MHF A;  2I45 A;  1W6Q A;  3NNG A;  2DUP A;  4Q0S A;  2P6H A;  2VC9 A;  3IM0 A;  1Q8O A;  4IEY A;  2RM2 1;  1QWR A;  2PN5 A;  1D4V B;  1VLN A;  1MZE A;  5FP9 A;  1RHI 3;  1OI6 A;  5ANQ A;  5FZL A;  1SCR A;  1BHG A;  3HWJ A;  1NCQ C;  3JD7 2;  3B5L B;  4Q4Y 3;  4MXV A;  4X8N A;  4Y26 A;  2XL7 A;  5J7M A;  3W5M A;  2WLP A;  3AYC A;  3DEM A;  5IVF A;  4Y1Z A;  1YEW A;  2DV9 A;  2ZEZ A;  2VBB A;  1VE0 A;  4YG3 A;  3VBU C;  3UNP A;  4FOW A;  5KC6 A;  2AH2 A;  1VRH 1;  2CAU A;  4W8J A;  4D8M A;  3ME2 A;  2QQP A;  4IES A;  1OXC A;  2ZGL A;  4GAZ A;  5FZ6 A;  4LA2 A;  4XFA A;  1CAV B;  2JKB A;  3WHU A;  3IMM A;  5FZ0 A;  4C0H A;  4IL7 A;  2P3I A;  2VUA A;  4RHV 2;  5FKB A;  3ZR6 A;  3LAG A;  4GB3 2;  2RS1 3;  3ZXL A;  2OQ6 A;  5JSP A;  3ZN6 A;  2D6P A;  4HKO A;  2VW1 A;  4Z07 A;  1Z7S 2;  2G9Z A;  3AKQ A;  1POV 3;  3O5S A;  3WP5 A;  3VD4 A;  4X6R B;  1NCR B;  3O1O A;  1DDL A;  1W8W A;  3FUQ A;  3WV6 A;  1D2S A;  3VD7 A;  2ZAA A;  3MW4 A;  3FJS A;  1OPM A;  3LF7 A;  1RUO A;  1O6U A;  1YQ5 A;  3PMS A;  3FHQ A;  3DXU A;  4FBF A;  3ZYF A;  1SFN A;  2G9F A;  1IZ3 A;  1URX A;  1FAT A;  1Y9G A;  4YZ5 A;  3I3D A;  4FPJ A;  4XCB A;  5IVJ A;  4AQS A;  2VUJ A;  2WNO A;  3DYM A;  1AUY A;  2LM3 A;  1MQT C;  1R08 2;  1PO2 3;  3CF6 E;  4QX3 A;  4B1L A;  1RTV A;  1JU4 A;  2WN3 A;  4MGK E;  2Z69 A;  1E5H A;  1KFU L;  3J9S A;  1N3Q A;  4TWT A;  2A3X A;  1RJ7 A;  5JDB A;  1NA1 C;  3AZZ A;  2BW8 A;  4QQH A;  4YGC A;  4QQL A;  3RZG A;  1RUG 2;  3ZIW A;  1AHS A;  1V6K A;  3BVC A;  4SLI A;  3PVN A;  3K51 A;  4YG0 A;  4LUK A;  3EXU A;  5C4W B;  1WMX A;  4E8D A;  4H2A A;  2C24 A;  1W05 A;  5LBE A;  3DCQ A;  4YLZ A;  1J1T A;  2V5Y A;  2X5I A;  1VBB 3;  3I2G A;  5FPV A;  3H8O A;  5HCH A;  3JXS A;  4P9Y A;  1JYT A;  3I59 B;  1R1Z A;  4NIH A;  2ZZJ A;  2JDM A;  5DAQ A;  3ZXK A;  1JZ4 A;  1PX3 A;  1S1A A;  4LBQ D;  1PZ8 A;  2YPJ A;  3ZPO A;  2ADD A;  4HG6 B;  1DF0 A;  1WW6 A;  3AMQ A;  5JWP A;  3D82 A;  5I91 A;  4AVV A;  1WD4 A;  1FOD 1;  4RHV 1;  4GB3 1;  4MH0 E;  1V9U 3;  4OUS A;  4QAW A;  2WKK A;  4EN6 B;  4DXS A;  4XJ9 A;  1UYZ A;  1Z7S 1;  3ZFG B;  1O91 A;  1VIW B;  2ZX4 A;  5DDJ 3;  2BEO A;  1I9R A;  3FBM A;  5FYU A;  3BUC A;  2DCT A;  2AC1 A;  2IXJ A;  4LQR A;  4YAR A;  4B1M A;  2Y6J A;  2E51 A;  3MHZ A;  4RSU A;  4XF3 A;  4D69 A;  4A6S A;  2JG8 C;  4L9B A;  1TVG A;  4CDU C;  1UZZ A;  1C8M 3;  1RMU 3;  3VDD B;  1HJG A;  1AR8 3;  1VR3 A;  5CKQ A;  4NE9 A;  1LTE A;  1GP5 A;  1H4H A;  1NKG A;  1VAV A;  3C7F A;  4D7S A;  4P08 A;  2EAK A;  5FPA A;  4LUM A;  1TMF 3;  5A3T A;  2VQU A;  1WLD A;  1J3R A;  2ZPX A;  3O0W A;  4TLF A;  4M3C B;  2BJS A;  1QH7 A;  4XAB A;  3GGL A;  3MIG A;  4JGY C;  1KXG A;  1YJK A;  4Y3O A;  4DY3 A;  5CG9 A;  4A42 A;  1OLQ A;  3RMY A;  3N7J A;  1PVC 3;  3J26 N;  4LK7 A;  3TOJ A;  4BJ0 A;  4HLT A;  2YXS A;  4S2H A;  5A33 B;  4MLO A;  2R06 3;  4PF5 A;  1ENQ A;  2ZGT A;  5I0U A;  3LPF A;  1DZQ A;  5DUU A;  2FCT A;  4AZZ A;  2XDV A;  2WNV A;  4LO5 B;  4OHY A;  3T0A A;  1AL2 3;  5DZF A;  2CL2 A;  5FZ3 A;  1PMJ X;  4Y24 A;  1DIW A;  1YI7 A;  3MF6 A;  3SMH A;  1REF A;  1VMJ A;  2EID A;  3R4U A;  4FOY A;  4Q8L A;  5FYC A;  4AQ2 A;  5JMC A;  3SC7 X;  1TEI A;  2JDU A;  4Q4W 2;  5H9P A;  5FY1 A;  5FZ7 A;  2UWB A;  3IIA A;  1R1A 2;  3AK0 A;  1Y43 B;  1RED A;  4LO8 A;  3IBM A;  2YBK A;  2LRO A;  2JDK A;  4L8Q A;  1NCQ A;  4LOT A;  1CAW A;  4MGS A;  3EB7 A;  2DYC A;  4RYD A;  3AJZ A;  1QDC A;  1XRU A;  3E5Q A;  3T30 A;  1G9A A;  1NZI A;  2HWF 3;  1GLH A;  1PGW 2;  1VAK A;  2ZZQ A;  3U10 A;  5BUV A;  5K9Y A;  5L9R A;  2ZX2 A;  4MGI E;  2AZ5 A;  4AOC A;  1OKQ A;  3N9L A;  2Q8D A;  1UU4 A;  1OD5 A;  2HWD 3;  3M3O A;  2BP6 A;  4MHR A;  3K2O A;  3NL1 A;  3WZ1 A;  3MID A;  5CFD B;  2A6Y A;  4UFL A;  1EAH 2;  3ZYR A;  2B42 B;  4ZPI A;  1DG6 A;  1KJR A;  2HKX A;  1KD7 A;  2GDF A;  4OHV A;  2WNU B;  4Z1V A;  2R04 3;  1RL3 A;  4Q0Q A;  2D7F A;  1LNS A;  3VDB A;  5E8A A;  3UET A;  2W1W A;  3OG2 A;  4XQ4 A;  1CX1 A;  3KB5 A;  3NJX A;  3E5X A;  1HQN A;  4HON A;  2CTV A;  1CJP A;  3J8F 3;  1RUD 3;  2Y0O A;  3ZVX A;  4FXK B;  2QQO A;  1XNT A;  4XYX A;  4FSJ A;  4FT8 A;  5GZD A;  2PQS A;  1AX2 A;  1S2B A;  4H14 A;  1HQW A;  1I5P A;  3BB6 A;  1QQP 3;  3MPP G;  5KHJ A;  1MQT A;  3LA2 A;  5L9B A;  1V6N A;  2KM2 A;  2OUJ A;  2PHX A;  2PQQ A;  1AXK A;  1NA1 A;  5HCB A;  3OGR A;  3G6J B;  3WW1 A;  1CGP A;  1GZC A;  2VE1 A;  3POG A;  3DUI A;  4XJW A;  1VBE 3;  3S5Q A;  4U2A A;  3MBW A;  1QJZ A;  1DFQ A;  1UL9 A;  1XNK A;  2Y26 A;  1SLT A;  4CPB A;  1SLB A;  1UCX A;  4JKL A;  5GLZ A;  4HPK B;  1LOF C;  1PGW 1;  1XE7 A;  5JZG C;  2GNT A;  1CZT A;  4P02 B;  2WWS A;  3N9N A;  3USU A;  1LES A;  5J48 A;  1AJO A;  3EMR A;  4FAH A;  3AMN A;  1WWY A;  5KWR A;  4NPR A;  1H2M A;  5FY0 A;  5A3O A;  1LUL A;  1AL0 G;  1MS8 A;  1GSL A;  4X6Q B;  4CSW A;  1DGR N;  2WT1 A;  2DCK A;  1ZRI A;  1EAH 1;  5LCW L;  2PHR A;  4YVS C;  1OLR A;  2GN3 A;  4WZC A;  1QH6 A;  5L7O C;  2ET1 A;  1IS6 A;  1GNZ A;  1WGP A;  1WLW A;  2NPI A;  5DUW A;  1EP0 A;  1R09 3;  3OBA A;  1VB2 A;  3AJY A;  3THC A;  3ASI A;  5FPL A;  2ZJC A;  2VUL A;  3LDK A;  1OFN A;  4XJA A;  5K0U C;  4CDX B;  1KS5 A;  2J1A A;  1W2O A;  4KGQ A;  3AVR A;  2JG8 A;  2X53 S;  2P1B A;  2ATF A;  3AYA A;  2PXJ A;  1RUC 2;  1VBA 3;  4Y1Y A;  1V00 A;  3AYE A;  1OA3 A;  4AED C;  1JTZ X;  1XNC A;  4BQX A;  1TZO A;  1DHK B;  1T6B X;  3D4K A;  2HEV F;  5IYY A;  2WQ8 A;  3GNE A;  4AEJ A;  3LPG A;  4N9I A;  4N9H A;  3ZKY A;  3UYJ A;  5HI0 A;  1JYN A;  4CXY A;  3KHC A;  2VVF A;  3TNQ A;  4PIY A;  1SEF A;  5FTT C;  4QPG B;  3MLJ A;  4H7M A;  1D2Q A;  5EJ1 B;  2I74 A;  4JGY A;  2PTM A;  3ZSJ A;  1E5I A;  1O3Q A;  4I30 A;  1HN0 A;  4FPO B;  4JGZ C;  4MAD A;  3P5B A;  4QQ2 A;  4A4A A;  3ZO0 B;  2BNM A;  4FFG A;  4UYB A;  2PAM A;  5IHR A;  2UUR A;  3BI3 A;  1MEC 2;  1QXJ A;  2E31 A;  3I3B A;  4FFF A;  3LE0 A;  2EXJ A;  1EV1 2;  3DYP A;  1Q8V A;  4YM0 A;  1X9T A;  5IVE A;  1XYO A;  3IDA A;  4BME A;  5BNO B;  4XDO A;  5T5L A;  3SHR A;  4JVA A;  2XUM A;  2ZMK A;  2JDN A;  4P5H A;  2RDS A;  2RE9 A;  1ULF A;  3LDB A;  2AEZ A;  4AG4 A;  4UXA A;  2TNF A;  4FO9 A;  3UT0 A;  3PVE A;  3LOB A;  1DQ4 A;  1OH3 A;  2Y64 A;  2VVE A;  3VDA A;  3WP3 A;  1UQX A;  4XJZ A;  3LGR A;  2VMH A;  3W59 A;  4NIA A;  1RIT A;  3B9I A;  4BQW A;  3WCR A;  1S0F A;  4IDZ A;  2XG3 A;  4D94 A;  1N1T A;  2HWB 2;  2YDE A;  3NKG A;  1C3H A;  2VXR A;  2R16 A;  2WO1 A;  3CBN A;  1OA2 A;  2D3R A;  2PMW B;  2WA3 A;  2WT0 A;  4R52 A;  4YGD A;  4LBK A;  4N8M A;  4FAG A;  3K46 A;  2VQT A;  3OUJ A;  5ACA 1;  3WCS A;  5FK8 A;  1HV1 A;  2QNK A;  1W9Y A;  3VBR C;  4A3X A;  2FMY A;  3IKW A;  4HET A;  4Y5T A;  4K21 A;  1ZZC A;  1W03 A;  1COV 3;  2MPF A;  4JAA A;  3RRD A;  3IT8 A;  4FPH A;  1ASJ 3;  2VM9 A;  4P00 B;  1GUI A;  3OGV A;  3I54 A;  4DOU A;  2A75 A;  4PLM A;  3SCH A;  5C7G A;  3PUA A;  1HRI 2;  5LAT A;  3WNX A;  4Y22 A;  1KFX L;  4YYO A;  3VN4 A;  4HVR A;  4DMI A;  5FYV A;  1YI9 A;  4QX8 A;  1X7N A;  1CN1 A;  4Z92 B;  2JB4 A;  1Y9M A;  4WBB A;  3FC0 A;  2FDK A;  2Q4S A;  1DGR A;  4MXW B;  1J84 A;  2VOW A;  5IK8 A;  4BQ4 A;  1O7F A;  1YQ2 A;  4YM3 A;  5KXD A;  4DPN A;  1EV1 1;  3CKH A;  5A3M A;  1TQ5 A;  1YYN A;  4E8C A;  3TEY A;  1JI6 A;  2ZGP A;  1SFY A;  3T1L A;  4CDW B;  1UX7 A;  3T4V A;  2QTW B;  3AX4 A;  5C3Q A;  2BER A;  3CL1 A;  3LEI A;  3A4U A;  4OZX A;  3ZXA C;  4TSV A;  1H8T B;  1QOS A;  1XC6 A;  2XGX A;  3HEI A;  2DCY A;  4MV2 A;  3VV1 A;  4BYY A;  1O3S A;  4D6Q A;  2VBP A;  5C71 A;  4Q26 A;  3V0B A;  1G9F A;  2VNR A;  4DY5 A;  1PMH X;  3M1H A;  4S2F A;  1OC1 A;  1J58 A;  5F1R A;  5KXB A;  3CIH A;  3W20 A;  1PO1 3;  5DG1 A;  4R4X A;  1GFF 2;  4XUP A;  3EO6 A;  3DYO A;  2A6W A;  1NXD 1;  5JIA A;  5LA9 A;  3WT3 A;  2AYH A;  3S0M A;  4ZZ5 A;  1OOP A;  4COV A;  4V1P A;  1PGL 1;  1VP6 A;  3LOI A;  1ZBE 2;  1E5S A;  3AZY A;  5JZG A;  2A6Z A;  3HMY A;  3FL7 A;  2PHT A;  4Q29 A;  3NQH A;  1M06 G;  3WQ7 A;  4LLF A;  2ZGO A;  4E4Z A;  2BUK A;  3LA7 A;  1ZBA 1;  4GA9 A;  4PBO A;  3MO4 A;  1JZ7 A;  1HRI 1;  3VHP A;  4YVS A;  1OLM E;  2ZKL A;  5A7P A;  1LHN A;  3QH7 A;  3S30 A;  1JZ5 A;  4M01 A;  4MGT A;  3ROU A;  2BNN A;  5L7O A;  1O3R A;  2PFW A;  4YPJ A;  4I02 A;  2ENR A;  1RIN A;  3A22 A;  3AKT A;  4L11 A;  5CIS A;  1AR6 3;  2W1U A;  4GUL A;  4GMP 3;  1OKO A;  5IT6 A;  1WW5 A;  5F3G A;  3LA3 A;  3MI8 A;  3WG2 A;  2O8Q A;  4ISQ A;  5FRA A;  4Q4V 3;  4I0A A;  2XJT A;  2Y6K A;  1I3H A;  2P3K A;  2SBA A;  2YV8 A;  3ORJ A;  3LSD A;  1FMD 2;  1DCS A;  3OY8 B;  4IQP A;  3KMH A;  4CEY C;  3R4D B;  1LCL A;  2DWR A;  2CWS A;  3AFG A;  4PQ9 A;  4AED A;  5FO9 B;  3RYR A;  5EP9 A;  1HDK A;  5DZE A;  4OQ8 A;  2QUO A;  1D4M 1;  3MLL A;  3PUH A;  1L7R A;  1PK6 C;  4GZ9 A;  2PYT A;  3LWC A;  3RGB A;  5FQ0 A;  3O7O A;  5FPZ A;  2QJV A;  1VBC 2;  1EUU A;  2VXJ A;  2Y6L A;  3GJA A;  4WVW A;  2C6S A;  2XVG A;  3L2H A;  4JGZ A;  3WR0 A;  5JI9 A;  5F3I A;  2OZ6 A;  4TN7 A;  4EN0 A;  1FV3 A;  3ABZ A;  3PIJ A;  1RVF 2;  3ZFE C;  2PHF A;  5L19 A;  4QDR A;  3T1M A;  1X82 A;  2LW8 A;  1ZBE 1;  4GKY A;  4IV1 B;  3ZR5 A;  5I93 A;  1W8Z A;  2QFE A;  1YLL A;  3OSD A;  2QZ3 A;  2ZTN A;  4M4R A;  4XUN A;  2P3J A;  2NMO A;  3MIE A;  2ARA A;  2ERF A;  5FY4 A;  1GNY A;  2YHJ A;  1UKG A;  2VCM A;  1UU5 A;  4W50 A;  3WX5 A;  5F3C A;  1PX4 A;  3LFM A;  3ZPY A;  1QJY 2;  2WUH A;  4LHK A;  1RUH 3;  1POQ A;  4HZF A;  2C5D A;  5FZ4 A;  1K42 A;  4UFK A;  4MHU A;  4UW5 A;  1XJA A;  3FLR A;  3OBR A;  4IV3 C;  1OMI A;  4QX0 A;  5C5U A;  3E5U A;  2ZAC A;  4PBP A;  2XQR A;  2XR4 A;  4JDM A;  5A1L A;  2UYB A;  2LTN A;  2IC1 A;  4AVA A;  2RM2 3;  2WAA A;  5JCT A;  2BOJ A;  3PU8 A;  3VBR A;  4NUB A;  1FMD 1;  1LR5 A;  3WD5 A;  5FXW A;  3OEA A;  3ST7 A;  2XLF A;  5LBC A;  4DQA A;  2VZP A;  1DU3 D;  4ZS2 A;  3AL6 A;  3DPR B;  2HJI A;  5A3W A;  3WF4 A;  1RUE 2;  2BVB A;  4JKK A;  4NHY A;  3URF A;  1JS9 A;  3N7K A;  3U4S A;  3ZDS A;  4ZKT B;  4XMI A;  2XHK A;  3T09 A;  4A7Z A;  2VL4 A;  1OQ1 A;  1BK1 A;  4LBN A;  2VZS A;  2VZR A;  1VRH 3;  2XON A;  4N43 A;  1HB1 A;  4AFA A;  1KDM A;  3IPV A;  2A1X A;  1YWK A;  3OD0 A;  2YZ4 A;  4CCO A;  1BVV A;  4ZY9 A;  5K8S A;  1PMI A;  1RVF 1;  1QEX A;  2VNV A;  1NAE A;  2RS5 1;  4RQP B;  5F5A A;  1C8N A;  3VUO A;  1YFX A;  1CON A;  1HRV 2;  1UOG A;  3R4S A;  5LB6 A;  2WQ4 A;  4B3N A;  3U0Z A;  4N53 B;  1HXS 2;  2KR2 A;  3THT A;  4NAM A;  1WUV A;  2PA7 A;  1ODM A;  4CUB A;  4Q8K A;  1QJY 1;  3POB A;  2WZR 3;  2F6B A;  3HQX A;  3ZFF B;  1AYM 2;  4IET A;  2V73 A;  3H50 A;  3T2Q A;  2OUH A;  4YRD A;  3RZH A;  4XBL A;  5I0S A;  1QIQ A;  1UZV A;  2JEN A;  2HWC 1;  4IW3 A;  1AJK A;  5FIX A;  3VBH B;  5HPO A;  1SBD A;  3GYD A;  3ZN5 A;  4I01 A;  3FLT A;  3I2D A;  2VQA A;  1RXF A;  4LTA A;  3WG1 A;  1GP6 A;  4AI2 A;  3VKF C;  4CTE A;  1T6G C;  2B5H A;  3K4A A;  3IB3 A;  4CCC A;  2Y34 A;  3TBD A;  3PU3 A;  3NNL A;  4QDQ A;  1RUF 2;  2PHD A;  4QKD A;  3TRS B;  1R64 A;  3MDP A;  3K4Z A;  4YW5 A;  2RDR A;  2OVU A;  3D0J A;  4COZ A;  3CZJ A;  2YYO A;  4EWE A;  5C9A B;  1Y3T A;  2DBN A;  1O5L A;  3H1W A;  3ZXG A;  5AC9 2;  4BQY A;  3AP6 A;  4GWM A;  1IOA A;  5LZ6 A;  1ND3 C;  4J6G A;  1UX6 A;  1DGL A;  1N1V A;  1HQL A;  2QQW A;  1DQ5 A;  1LOC A;  2WYS A;  2PHL A;  3AP7 A;  4YVW B;  3ZYP A;  1V6M A;  1FOD 3;  4GWI A;  4RHV 3;  4E2Q A;  2GP5 A;  4LBQ B;  4GB3 3;  3UL2 A;  1I6X A;  3POI A;  4YNI A;  5J09 A;  1HRV 1;  4QKN A;  4CEY A;  4UBG A;  4CDQ B;  1A3K A;  2Y38 A;  3H7Y A;  2D3S A;  1Z7S 3;  2XL9 A;  3MFC A;  1PIV 2;  1HXS 1;  5DAW A;  4AHX A;  3V0A B;  1YQ8 A;  1H9W A;  5FWJ A;  5C8C B;  2CYF A;  1VMF A;  5D8A C;  5JPM B;  5H9R A;  3VL9 A;  1PK6 A;  4KNC A;  4IEU A;  1CJD A;  3ZMN A;  1JYX A;  1AYM 1;  3B02 A;  1LHV A;  3POW A;  4AGG A;  2ZEY A;  3WF1 A;  5LWB A;  4M0N A;  1W6Q B;  2OYZ A;  2DUR A;  3DL3 A;  4XHB A;  4CUC A;  2W52 A;  1XB9 A;  4H55 A;  4MGQ A;  2WN2 A;  4CE8 A;  1SQ4 A;  3ZFE A;  3N4M A;  3USS A;  1OUR A;  5C3O A;  3MPB A;  4LE4 A;  4QB2 A;  4QB1 A;  1ULP A;  5C6C A;  1LOB A;  4QPY A;  3ACH A;  3N36 A;  1L7Q A;  3ZXE A;  4WZF A;  5GLT A;  3TWI A;  1UNB A;  4WM7 C;  1RUF 1;  5ERL A;  4A45 A;  2F17 A;  4Y4R A;  5CBL A;  3TYJ A;  4L97 A;  2ES3 A;  5CB7 A;  3KV6 A;  5CVR A;  1RUI 2;  4QMA A;  1W2U A;  1WD3 A;  2EXI A;  5GZF A;  2VNO A;  4D7T A;  3VZL A;  1XPW A;  4FPE A;  3KV5 A;  2TBV A;  1OVP A;  5AC9 1;  4BU2 A;  1J83 A;  4COY A;  1QGL A;  3BTX A;  3ITQ A;  2IWG B;  4IV3 A;  4PT6 A;  2DDU A;  4M3C E;  3AYD A;  5AVA A;  1JOB A;  4P9G A;  3ZN6 B;  1J3P A;  4LKF A;  5FYZ A;  2K2S A;  5GJ6 A;  2B9V A;  2AR6 A;  5CKM A;  3PNA A;  4FXG B;  3KZ4 C;  4BCU A;  3H0O A;  4CEW C;  1JZ3 A;  2PLV 2;  3NV4 A;  3BTZ A;  2VQ0 A;  4LK6 A;  1NLS A;  2CHH A;  4AW7 A;  2LS6 A;  4FQ4 A;  4C90 A;  1A8D A;  1PZ7 A;  4CYD A;  5C3P A;  1W2N A;  3I3Q A;  5BNN A;  1PIV 1;  1XE0 A;  4KH9 A;  2Y6G A;  4UF0 A;  2BGC A;  3L9J T;  2XXZ A;  5IFT A;  3ACI A;  5DAP A;  4QWN A;  1XSR A;  3VD5 A;  2OS2 A;  4R9A A;  1IPS A;  4AVB A;  5DUX A;  3OCP A;  1BVP 1;  3RJ2 X;  1S0B A;  5A32 A;  1OA4 A;  1TG7 A;  4NN0 A;  5BNP C;  3KCY A;  2C0Z A;  1Q56 A;  1SLI A;  2BNO A;  3UGH A;  2QDR A;  1G8W A;  4EZ4 A;  2EXH A;  3PJQ A;  1BKZ A;  1FI2 A;  4XF0 A;  3I49 A;  2WJS A;  4UAP A;  1AX1 A;  1XBF A;  2JDA A;  2JD9 A;  3GF6 A;  1EY2 A;  4L2N A;  3MIC A;  4QB6 A;  1YRZ A;  4W4Z A;  2V5D A;  2ORZ A;  2FCV A;  1XXN A;  1C28 A;  3LQC A;  4QHZ A;  2RS3 2;  2VO5 A;  2X5I B;  3OUH A;  3NST A;  4NIG A;  1JU3 A;  3MV1 1;  4JHZ A;  3JBG 2;  4HOO A;  4FI9 A;  4AK3 A;  3O1U A;  3TAY A;  1RUI 1;  3PTR B;  2A6V A;  3JQX A;  1FYU A;  4FTE A;  3JCI A;  5C3S A;  2ZGN A;  4XF9 A;  1AR9 2;  2DVG A;  2ZBJ A;  5LRR A;  4AR2 A;  2ZHL A;  2DVA A;  2XWB B;  3CHX A;  2FHR A;  3AP5 A;  4B4P A;  5EFU A;  5IVC A;  4N90 A;  2Q8C A;  4UI9 L;  1ZVF A;  1ZA4 A;  3LEK A;  2IFW A;  3ILR A;  4KG8 A;  3U78 A;  4BE3 A;  3VBO C;  3A23 A;  4BIF A;  3ZOI A;  1Z78 A;  3T4H B;  4ES9 A;  1MS4 A;  4JDO A;  4BQ1 A;  4EQV A;  4K1Z A;  2DCJ A;  1ULC A;  2VH9 A;  3WDU A;  3M8L A;  1S0E A;  3JD7 1;  5LW9 A;  1E5R A;  1ZRD A;  4JZR A;  4XIK A;  5FJK A;  4YW4 A;  4LBO A;  5FXZ A;  3O1R A;  2W9X A;  1UKR A;  2RJ2 A;  3NJZ A;  4AVS A;  3RZJ A;  2QQV A;  2E9Q A;  4TTG A;  4AQT A;  2E6V A;  2XKO A;  3BKZ A;  4WM8 C;  3SIT A;  2SLI A;  1V6J A;  3DXT A;  4O61 A;  4H3W A;  5A7N A;  4QHB A;  1N47 A;  5EXO A;  1ND3 A;  1XND A;  5FPB A;  1EPZ A;  3POY A;  2FD8 A;  4YW6 A;  4IE0 A;  3VZN A;  1LOD A;  1GZW A;  3GBW A;  5EYX A;  3O12 A;  4LUL A;  1W8H A;  2P17 A;  5CA6 A;  5A3P A;  3GHN A;  1H1M A;  1EAH 3;  2QQI A;  2ZEX A;  4JRA A;  2OW4 A;  5FZO A;  4BIO A;  3CEW A;  3N35 A;  1UOJ A;  2YUE A;  3ECQ A;  1C5H A;  4MSV A;  5J98 B;  1DLC A;  2RS3 1;  3LEM A;  4N7I A;  1ZX5 A;  3AP4 A;  5D8A A;  2GC3 A;  2WNV B;  3MW3 A;  5FMC A;  5LBB A;  3MIB A;  1JOD A;  3VHR A;  5F7U A;  5FWE A;  4R9C A;  4XDP A;  1AR9 1;  2X09 A;  2FZ2 A;  5A6Y A;  2VUC A;  3E6C C;  4XUO A;  2GH2 A;  3KF5 A;  2W1Q A;  4ARX A;  3RYK A;  4JX0 A;  4ERO A;  4IE6 A;  4GXL A;  1R08 1;  2FDJ A;  3DN7 A;  4FOQ A;  1NE6 A;  4Q4Y 2;  1LEC A;  1A78 A;  2DTW A;  4K8R B;  4LHS A;  4XZU G;  1JW6 A;  5FZ8 A;  3T0B A;  4AFC A;  4IEO A;  4XXA A;  1N3P A;  3ZXJ A;  1NCQ B;  1POV 0;  2F4L A;  1CAW B;  3KS7 A;  5FAX A;  2ZHN A;  1RUG 1;  5TSW A;  1O8P A;  2VOV A;  3N9M A;  3VDC A;  4AFD A;  5BNQ A;  5CFC C;  4MGY E;  4GH4 C;  1REE A;  1RUJ 2;  4WM7 A;  1MS3 A;  4HXC A;  1RB8 G;  3M2M A;  3K77 A;  4FPC A;  4LHL A;  2ZKN A;  1JZ8 A;  2OZJ A;  1LHW A;  4LPL A;  5F37 A;  3W5N A;  1K5M C;  1JBC A;  3OGS A;  5LA0 A;  2XPJ A;  4C0B A;  1HW5 A;  5JLV A;  2R7E B;  2RS1 2;  2O1Q A;  5JXI A;  1EUT A;  2NMN A;  1LB2 A;  1CAX A;  5FOJ B;  3A0K A;  5GZE A;  1H2K A;  4EN7 B;  4NHK A;  3VZK A;  3CJI C;  1LJ7 A;  3TEZ A;  1HV0 A;  1F4A A;  1LHU A;  1UW8 A;  2R07 2;  5IVY A;  4DXR A;  5JPN B;  4UWD A;  1GNH A;  2UWC A;  4CEW A;  1UY4 A;  5F5I A;  2Q30 A;  4MGZ E;  4BHP A;  4I2O A;  3AKR A;  2GSY A;  2BFU L;  3H3U A;  4Y20 A;  2RV9 A;  3NAP C;  5JSO A;  3R6S A;  4QX1 A;  2VZ1 A;  3ELN A;  2E7T A;  1NQD A;  2BFU S;  4SBV A;  1TNR A;  2VUD A;  2RMU 2;  4CCE A;  5A1A A;  3VBU A;  5F39 A;  4CDX C;  4P9L A;  2X29 A;  4HVQ A;  3GCW A;  2BTV C;  2BRT A;  2JKX A;  4LO4 B;  4R9B A;  2X8K A;  4XCA A;  4JDN A;  5ACA 3;  2VOX A;  4F8A A;  2E7A A;  4EV0 A;  3MUZ 1;  4ONU A;  4Q0U A;  3ILF A;  1MQT B;  4QGN A;  5BNP A;  4D3W A;  2YU1 A;  3VHO A;  2D44 A;  1O8S A;  4BLJ A;  3ATG A;  1NA1 B;  3UK9 A;  4FPK A;  4XFB A;  4YFW A;  4OI1 A;  3ZN4 A;  4IGO A;  5FP3 A;  3I97 A;  1CWP A;  1QDO A;  4L92 A;  1VBB 2;  1X36 A;  1LEM A;  2B39 A;  3POE A;  2CGP A;  1FXZ A;  1RUJ 1;  5GZC A;  1NUK A;  3K3N A;  4E2S A;  5J3U A;  3POJ A;  5K7P A;  5E88 A;  1NZC A;  3DEC A;  1IPK A;  2VOK A;  5LBF A;  4ATF A;  1LAJ A;  3U14 A;  2VY0 A;  4LIV A;  3USU B;  1S0D A;  4LEJ A;  1I1E A;  2RS1 1;  5HXV A;  2B9U A;  4XIL A;  4YFZ A;  2J22 A;  3HNM A;  1JXN A;  1W6M A;  1F15 A;  2WAO A;  4AI8 A;  4XUQ A;  1W06 A;  1XYN A;  2Q1Z B;  1X50 A;  3O0V A;  3X29 B;  5A3L A;  3O1V A;  1VB4 A;  3LKJ A;  4Q4X 3;  4NII A;  2EVX A;  2R07 1;  4Q4W 1;  5JVV A;  3SNM A;  3VBO A;  3GZU C;  1J59 A;  2QE3 A;  1RJ8 A;  1R1A 1;  4DXZ A;  4HKL A;  2E32 A;  3R05 A;  1BEV 2;  4O65 A;  5LEJ A;  5LAS A;  4R4Z A;  3W21 A;  2JEM A;  1NY7 2;  1OH4 A;  3PUS A;  5FYS A;  4Z8B A;  4LA3 A;  4AI1 A;  5J1X A;  1UOB A;  2ZHM A;  2ZEW A;  3ACL A;  4BH9 A;  2RMU 1;  1XU2 A;  1CIY A;  2Q1M A;  1W04 A;  1AR8 2;  4BA6 A;  5JAX A;  5I0R A;  2JG8 B;  3ACF A;  5IFP A;  2ZHK A;  2ADE A;  3H1M A;  4WM8 A;  3PL0 A;  1UO9 A;  1H2L A;  5FYY A;  4H7L A;  4LKS A;  3O14 A;  4MET A;  2QQL A;  3FZ3 A;  5CKN A;  1ZRF A;  3EQE A;  4XJU A;  4WV8 A;  1SPP A;  3GZA A;  3UGG A;  2P2K A;  1O3T A;  1WBF A;  3GHM A;  4QXB A;  1S0J A;  4S2G A;  4KWJ A;  2GP3 A;  3BOP A;  1AYN 2;  1OUX A;  4JGY B;  1ZBA 3;  3BU7 A;  4AAP A;  5EIY B;  3WSO A;  1HRI 3;  3CO2 A;  2ZML A;  1VBB 1;  2R06 2;  4PHZ A;  3OPT A;  4URA A;  2WIN B;  3KD4 A;  3B9C A;  4HSJ A;  4O9G A;  4NHX A;  1AL2 2;  1LOE A;  3ES4 A;  2GZW A;  2LRP A;  2W1S A;  1Q8Q A;  1L7L A;  1WME A;  4GIQ A;  3RZZ A;  3Q8F A;  4BK5 A;  2VW2 A;  1Y4W A;  4GWN A;  5T52 A;  1W6P A;  1XQN A;  4JQR A;  1MR5 A;  2CGN A;  4KBB A;  1U5Y A;  3MGU A;  5D1I A;  4ZS3 A;  4A7K A;  4CDU A;  1MPX A;  2IZW A;  3WNP A;  1APN A;  2EF6 A;  1MVE A;  1ODN A;  2BBV A;  3CJX A;  4HK8 A;  3HBZ A;  5FXX A;  3VKO A;  1ULG A;  4AI0 A;  4DNY A;  1T2X A;  3M70 A;  3JB4 C;  2IXH A;  3VBF C;  4DB5 A;  3AZW A;  2GH8 A;  2ZAH A;  3NWK A;  1D4M 3;  4RL7 A;  4TXW A;  1XU1 A;  1BEV 1;  5CFC A;  3GXU A;  2RR1 3;  4GH4 A;  1NY7 1;  4B4Q A;  2EAA A;  4QM8 A;  4FTS A;  1ND2 C;  4K7J A;  2UWA A;  2XQX A;  5A6Z A;  2Q0A A;  5IAV A;  2HWD 2;  2VMI A;  5IWF A;  5CZK A;  1K5M A;  3T08 A;  2HH9 A;  1ULE A;  2AEY A;  2DUO A;  2JIJ A;  4QXH A;  4AYU A;  4I3P A;  1ZRR A;  1ZBE 3;  2Z2S B;  3OD4 A;  4NJ4 A;  2EXK A;  3HN1 A;  1XYP A;  4LBJ A;  1A6C A;  2JIC A;  3VB9 A;  2BGP A;  2BYV E;  3AZV A;  4AF9 A;  1ST8 A;  4RR3 C;  4BB3 A;  2R04 2;  1W28 A;  3I3E A;  3CJI A;  4LLO A;  4Y22 B;  2C1F A;  1QNW A;  4IER A;  1V6O A;  1AYN 1;  5LK7 B;  5F9T A;  2ARE A;  3AC0 A;  4DUV A;  4MYE A;  2GC0 A;  3MW2 A;  3NAP A;  4KWL A;  5D21 A;  1JYW A;  2WWU A;  5FUN A;  4CP9 A;  3Q9O A;  4XF1 A;  2FQP A;  1MS0 A;  5B4N A;  1WKY A;  2R0F A;  3Q8B A;  1QXP A;  2QKD A;  3H8R A;  2GC2 A;  4GJZ A;  4B7K A;  3FHA A;  1OT5 A;  2O8O A;  2EAL A;  2W92 A;  4XXP A;  3TNP B;  2CWM A;  1Q3E A;  3OGG A;  1RUC 1;  3WQB A;  4RS5 C;  4W65 A;  3D8C A;  1OSG A;  1YXW A;  5KHK A;  3V0B B;  3IZO A;  3AL5 A;  2D6K A;  3N9O A;  1RGS A;  5E1R A;  4CPB D;  4XFG A;  2JE9 A;  1W9T A;  3MFA A;  4K9S A;  1W6N A;  4QX7 A;  5DZG A;  3UJQ A;  1CAU A;  2G1M A;  2Y6H A;  3DF0 A;  4OFG A;  3NNF A;  5GKA C;  2HEY F;  3J7N A;  3N7L A;  3WP4 A;  1OOP B;  2D3P A;  1OF3 A;  2V72 A;  3ALQ A;  4XET A;  5IW0 A;  5FY9 A;  4NPM A;  1MEC 1;  3H42 B;  2W95 A;  5JZG B;  3RVH A;  4MG2 A;  3C7E A;  5DQ0 A;  4IV1 C;  4XHX A;  1RVF 3;  5JOZ A;  5FYT A;  3WF2 A;  2D93 A;  2RS5 3;  1OVS A;  3WQ0 A;  5FZH A;  2W5F A;  2WR9 A;  5GZG A;  3I3M A;  3AFK A;  2ZGR A;  2DFB A;  2GAU A;  1W8F A;  4YVS B;  4PDW C;  4FP2 A;  4ASM B;  5I8S A;  1KGY A;  4J25 A;  4CU6 A;  5FOB B;  1F35 A;  5F32 A;  2JJ6 A;  1DZT A;  5L7O B;  3RPQ A;  4JTN A;  1ZM1 A;  1QJY 3;  2J1V A;  4MZU A;  4Q5O A;  5CAZ A;  4OI4 A;  1LEN A;  2HWB 1;  4UW6 A;  5FP4 A;  3ZYB A;  4WVV A;  1YC6 1;  1JH5 A;  2WFP A;  4CP1 A;  3WNL A;  3GZE A;  3QD6 A;  2HWC 3;  2UU8 A;  5T3N A;  1C4R A;  2F4P A;  1KQR A;  1LOF A;  4YGB A;  1LRH A;  1H6X A;  2TUN A;  4AED B;  2IXI A;  5EJ3 A;  5FZK A;  5G04 L;  1X33 A;  3K75 B;  2I07 B;  5GLV A;  2ARX A;  1WCS A;  3PME A;  5KXE A;  2JWP A;  4NOT A;  2QDN A;  2JG9 C;  2YRO A;  2VZU A;  3OF1 A;  5FQ0 B;  1N1Y A;  5CIR A;  1LOA A;  1ENX A;  1DP0 A;  5F5C A;  5IAX A;  4BDV B;  2OKX A;  2IXC A;  4JGZ B;  2DVB A;  5JMO A;  3GCX A;  2YPD A;  1CZS A;  1GMM A;  2I2S A;  3ES1 A;  2A3Y A;  2D40 A;  5K0U A;  3RI8 A;  4PI2 A;  5JR2 A;  5FZI A;  4P9X A;  4U36 A;  3ENR A;  3RZL A;  1V6I A;  3D3A A;  2XJS A;  3BTA A;  1JMU B;  1V6L A;  5JXG A;  2OPK A;  3VBS C;  5H9Q A;  1HRV 3;  4NR1 A;  4Q1P A;  1HXS 3;  1GQP A;  4XFC A;  3BOD A;  1F5F A;  1U5X A;  3VBF A;  4OUL A;  3RFR A;  1G9B A;  5GLW A;  1ZA7 A;  2WO7 A;  1GIC A;  4QXC A;  1S0I A;  2MEV 2;  3B94 A;  2ZXQ A;  4QQO A;  1J1L A;  3HQU A;  1AYM 3;  4DO0 A;  5I0D A;  4B4R A;  3VBH C;  3O1P A;  4QPI C;  1K12 A;  4HBN A;  1IS5 A;  1ND2 A;  2ZAB A;  1COV 2;  2FMD A;  2B45 X;  2VR4 A;  4IE7 A;  4QHO A;  4RFT 0;  3VBR B;  3D0S A;  1FV2 A;  3AZX A;  3LEG A;  4LMF A;  3TEX A;  1W3X A;  5LK5 A;  4I09 A;  5FZ9 A;  1UZ0 A;  3ZYH A;  2R49 A;  3S7I A;  1AR7 2;  3RSJ A;  4LIU A;  2PHU A;  1LU2 A;  4GJY A;  2LUW A;  1GZ9 A;  2Y60 A;  3A21 A;  4RR3 A;  1RUF 3;  1H8V A;  2KD7 A;  4FPG A;  4NWW A;  1CX4 A;  1VBD 2;  4ZON A;  1SG3 A;  2IXK A;  1GWL A;  4L99 A;  4N43 B;  3CZU A;  1SAC A;  2CDO A;  4OHX A;  3IPV B;  3WUC A;  2WS9 2;  4QKF A;  1JYV A;  1WCQ A;  5KHI A;  2GU9 A;  2VW0 A;  3U4X A;  4AL9 A;  5AC9 3;  3RMX A;  1W0N A;  3IDC B;  4A7Y A;  3AVS A;  1OFS A;  2PHW A;  3NRU A;  2QQN A;  4DRV A;  4Y5Z 0;  1W8T A;  4HN0 A;  2C26 A;  3WP6 A;  1XNA A;  2NQY A;  2P6C A;  5FFO C;  3NNM A;  2GMM A;  4IEZ A;  4B8E A;  3IWZ A;  4Y5S A;  3J7H A;  3WDV A;  1GOH A;  2EIG A;  4RS5 A;  3KVB A;  3U75 A;  5C8C C;  5ABJ C;  1KS4 A;  1YNA A;  1PIV 3;  3FLP A;  1WBL A;  2WDB A;  5F6K A;  4ARY A;  2HYK A;  1FPN 2;  2UY9 A;  2B4K A;  4Y1X A;  1O4Z A;  4AHY A;  4P9I A;  1B35 C;  5FMD A;  4B7E A;  3PDQ A;  2MEV 1;  1VBC 1;  3M3Q A;  2H6C A;  2WBK A;  3HIF A;  4GMP 0;  2K46 A;  5JOW A;  4AGV A;  1UMH A;  2W68 A;  4MX3 A;  3WW4 A;  1COV 1;  2GNM A;  3KGZ A;  2BZD A;  1H1I A;  3LD8 A;  4URT A;  4M3C F;  1XE8 A;  2IVJ A;  3UKT A;  2BWC A;  3L2Y A;  4FQZ A;  1TME 2;  1AR7 1;  1ONA A;  4XPV A;  3WDT A;  5C9A C;  5IAT A;  5FZD A;  4MVT A;  3NNJ A;  4PDW A;  4CUA A;  5EJZ B;  4PIZ A;  4ZU7 A;  4IEX A;  4BPZ A;  1VBD 1;  4AVT A;  4Z2W A;  3TB0 A;  2JE7 A;  1RUI 3;  3MF9 A;  1CIW A;  3ZYJ B;  3NJV A;  3RI9 A;  2WS9 1;  2HWE 2;  5HCF A;  1HLC A;  4QKB A;  2XJP A;  3F2Z A;  5CG8 A;  1SBF A;  4Z82 A;  1ACC A;  4ES8 A;  1RIR A;  1N3O A;  2ARC A;  2W47 A;  2DVF A;  3EYP A;  3HOB A;  2HYX A;  1QF3 A;  2VZ3 A;  4BOW A;  4E4H A;  2VME A;  1EYB A;  4DRR A;  2BGO A;  4CEY B;  3RQ0 A;  4YGE A;  1ZZB A;  1UN1 A;  1W8O A;  3C7G A;  4K1Y A;  4BXF A;  1IQA A;  1H9P A;  4QXK A;  1RUE 1;  3I2H A;  1C5I A;  1D0H A;  2K9Z A;  3PUI A;  4HN1 A;  3JD7 3;  5T55 A;  5E6H A;  2E26 A;  1PK6 B;  2D5F A;  3AMM A;  5FJH A;  2CU5 A;  2JG9 A;  5JSR A;  4Q2F A;  4V2V A;  5AFE A;  1FPN 1;  1SDD B;  2D6L X;  5A3N A;  5E89 A;  5FP7 A;  2VAU A;  4XQD A;  1WLT A;  5LY2 A;  2A71 A;  4YWA A;  5L9V A;  5F8P A;  2JDP A;  3FWE A;  4G9S B;  3OPW A;  2LAL A;  1JZ6 A;  1IG3 A;  5ANN A;  3RJR A;  5A6Q A;  3U37 A;  3G7D A;  3BPZ A;  4D7Y A;  3S6P A;  3ZFE B;  4XFI A;  2HBT A;  5EYY A;  3TN9 2;  4JCK A;  2W0X A;  1Z0H A;  4AGR A;  1W6O A;  2CGO A;  1Y9Q A;  2WL1 A;  3BN6 A;  4KG0 A;  1F4H A;  3UV9 A;  1NCR C;  3I2I A;  2ZX1 A;  1NLQ A;  1RUH 2;  4D6S A;  1LED A;  2QQM A;  2X5I C;  1TME 1;  1H2N A;  2XBO 2;  4XBQ A;  3VBS A;  1QJF A;  2RS3 3;  4CCD A;  4BM8 A;  3OEB A;  1G86 A;  4NVP A;  3BTY A;  4IV3 B;  3K48 A;  2RM2 2;  4Y1U A;  2HWE 1;  4YW1 A;  1FAY A;  1OLM A;  1WA6 X;  1AR9 3;  5A70 A;  4QD2 A;  4QPI A;  1VRB A;  2FCU A;  4P5Y A;  3SCG A;  5I8T A;  4CP2 A;  1JYI A;  5GM0 A;  3ETQ A;  4LNV A;  4WVM A;  2A7A A;  1R08 3;  1KIT A;  1HIX A;  4A2U A;  4KBZ A;  3OYW A;  1AXY A;  3SKV A;  5BNN B;  5C4W C;  1M4W A;  1RUG 3;  4RN5 A;  4DS0 A;  3AXE A;  2QQU A;  2AGS A;  3MYX A;  4RGG A;  2W91 A;  2K0G A;  4MO3 M;  4UF0 B;  3SXW A;  3E6D A;  1MZ6 A;  4KL1 A;  3CMG A;  1UPI A;  3DKQ A;  1PHM A;  3BU0 A;  4OMC A;  1BCX A;  5JUV A;  1YQC A;  2D43 A;  2YB7 A;  4XMA A;  5A32 B;  4QPW A;  1UWW A;  2B46 X;  1PM4 A;  2ZOE B;  5C3R A;  4P14 A;  3TN9 1;  2W3J A;  5FMB A;  1W9W A;  1O5U A;  1IGO A;  4XC9 A;  3KT4 A;  4XJ8 A;  3WDX A;  3D6E A;  3CU7 A;  3C2U A;  3KLS A;  2ZGS A;  3AP9 A;  3ZFG C;  3THP A;  2QVS B;  2Y33 A;  3VGI A;  2WZR 2;  1RUH 1;  4AI3 A;  4NRP A;  3LZZ A;  2XBO 1;  3KV4 A;  5ABJ A;  1VMH A;  4TLG A;  2RJK A;  1U12 A;  2WNV C;  4KWU A;  3PVB B;  4LBM A;  2C4X A;  3FE5 A;  1OF4 A;  1IS3 A;  3PIG A;  4KWK A;  5FYM A;  2ETE A;  4HK9 A;  4LHN A;  4OHW A;  3WVJ A;  3WNM A;  1B35 A;  1O59 A;  2C9A A;  3VDD C;  1S55 A;  3HAG A;  2VOT A;  5EPA A;  1OQE A;  4D6R A;  4IEW A;  3C8X A;  1WW7 A;  3III A;  1RC6 A;  4NRO A;  4RFR B;  5T54 A;  3VZJ A;  2EIC A;  3P3N A;  2DTY A;  5FZC A;  1BBT 2;  4XDQ A;  4FOV A;  4IEV A;  3WW2 A;  3BCW A;  3NV3 A;  1HB4 A;  3VZO A;  3U11 A;  4OCT A;  4BQ5 A;  3H1Y A;  4M00 A;  4A6O A;  2XJQ A;  5HBA A;  5CYY A;  4ZXE A;  1KJL A;  4PI0 A;  1RUJ 3;  3GZT B;  3HNB M;  2EIB A;  1GQG A;  2DUQ A;  2YMZ A;  1CPN A;  3JB8 A;  2GN7 A;  1UY2 A;  3HT1 A;  2J1S A;  1ENR A;  5A7W A;  1ND3 B;  2L9L A;  4HAN A;  3LIH A;  1W2A X;  1FOD 2;  2JDY A;  3O0X A;  1X8E A;  2H0B A;  1SDW A;  1WLC A;  1GZW B;  3MZH A;  5IVB A;  1OD3 A;  1QJU 2;  1K5J A;  2E7Q A;  4ZHN A;  4UFH A;  1K45 A;  4XE9 A;  3AXD A;  3I2K A;  3ZLI A;  5JIU A;  1UU6 A;  4S2D A;  5FZO B;  2G9G A;  3RS6 A;  2J7M A;  3ZSM A;  2VTX A;  2R07 3;  4Q4W 3;  2PLV 1;  2QQJ A;  2YFU A;  2ILM A;  1R1A 3;  4UFI A;  1YCI A;  2Z5W A;  2WZR 1;  3MV0 1;  3T2T A;  4CA9 A;  1LHO A;  4RD7 A;  5IJR A;  5D8A B;  5LRS A;  4UOJ A;  3WUD A;  2O0O A;  2R1B A;  3WG3 A;  1OPO A;  4CXX A;  3IDE A;  2XVK A;  4DFS A;  5JXH A;  1NYW A;  2VMD A;  5FK7 A;  5FYI A;  5BYN A;  2RMU 3;  1JOP A;  2W08 A;  3W58 A;  4XUT A;  1QJX 2;  2JXA A;  3GAL A;  3IN9 A;  1JN2 P;  3HBK A;  1ZZ8 A;  1CAV A;  4LOR A;  2WO3 A;  1HJF A;  5J36 A;  3SQO A;  2FDF A;  3I4I A;  1PNG A;  5CFD C;  2GC1 A;  5EWS A;  2W87 A;  2WFF 2;  2DU1 A;  1BBT 1;  1UY3 A;  4YZ1 A;  2WWJ A;  3P1I A;  3ZDV A;  2A6X A;  2CSG A;  3ILN A;  4FPF A;  3KWV A;  4F7Z A;  5FDB A;  2WNU C;  5JXJ A;  4WM7 B;  5F2W A;  1NCR A;  1UIJ A;  4R9D A;  1U0A A;  5T5O A;  2DBI A;  4AXO A;  5KBF A;  2KA3 A;  1SBE A;  2GMP A;  3VD3 A;  1NOV A;  2AUY A;  1S0C A;  1H30 A;  1SHW B;  2PEL A;  3JBG 1;  4NMI A;  2XLG A;  1QXR A;  4NRM A;  5FXV A;  5A7Q A;  1CAX B;  3QCW A;  3ZXF A;  1W99 A;  1WZX A;  2A3W A;  4XFF A;  2B7Y A;  2V4A A;  1RHI 2;  3B7M A;  1OBN A;  4BZ4 A;  2PAE A;  3DKW A;  4IEQ A;  1QJU 1;  4YM1 A;  1PM7 A;  3SKJ E;  3QAC A;  4CCM A;  5AFB A;  2NP0 A;  1HN1 A;  2D98 A;  4K8F A;  4CVU A;  2E63 A;  3ON7 A;  4CEW B;  5C5T A;  2YC4 A;  3Q8A A;  3KQR A;  4Y20 B;  1H1A A;  2YG0 A;  1JZ2 A;  3BYW A;  3B69 A;  1H4G A;  5C4W A;  4GAL A;  4A44 A;  3QH6 A;  5FBZ A;  2XVL A;  3PTY A;  1BYH A;  1BEV 3;  4Q0V A;  4JHT A;  5FLJ A;  2XJR A;  1GOF A;  3VBU B;  3WHT A;  5CAD A;  3QBQ A;  2H6B A;  1NXM A;  5CEH A;  3ZSE A;  2BU9 A;  5FPX A;  3I59 A;  2CAV A;  3I2F A;  2DCZ A;  3AMP A;  5FKC A;  2ORX A;  5KXC A;  1QJX 1;  4A3Z A;  1W0O A;  4YSF A;  2RJL A;  5BNP B;  3N3H A;  3ZYG A;  5B4X A;  5KHG A;  1JHN A;  2VEC A;  3MIF A;  2YC0 A;  2VZQ A;  1UPS A;  3KGL A;  2VCA A;  3NVC A;  4UW4 A;  4DEV A;  2Y6F A;  4YZ2 A;  3KCC A;  3LDR A;  2WFF 1;  5SV8 A;  4ET7 A;  2JEC A;  3MLK A;  4Y33 A;  3GBG A;  3N9P A;  4JRL A;  1DQ6 A;  2VMC A;  4LO6 B;  2QBX A;  3ZFG A;  1AYN 3;  2BV4 A;  2P5B A;  5BXX A;  5BY5 A;  5A7O A;  3H8X A;  2FBE A;  5DAV A;  4CU9 A;  3W9A A;  3Q8E A;  4DXT A;  5GLU A;  4Y1V A;  2VZV A;  1DGW X;  3M3I A;  5T5J A;  4HL0 A;  1BJQ A;  1MS5 A;  4K6B A;  2NZ9 A;  2QQK A;  1HB2 A;  2WII B;  1C1L A;  1PO2 2;  1YIP A;  5DPN A;  5IUQ A;  1MAC A;  1W6M B;  3RWK X;  1HKD A;  1W8U A;  3VDD A;  3HD8 B;  3U1X A;  4UW3 A;  1RHI 1;  2ZX0 A;  2YY1 A;  3UKV A;  1UOF A;  3RYP A;  2FZ1 A;  1RUC 3;  2JDH A;  4KGG A;  5GAL A;  2WNE A;  5DAX A;  3O1T A;  3VBO B;  3WNK A;  1W0P A;  4B29 A;  1IHM A;  4Q4Y 1;  2DFC A;  3SH3 A;  3N7M A;  4YZ3 A;  2WZE A;  2X10 A;  4M3C A;  1CR7 A;  1UYX A;  4JV4 A;  1F5J A;  5EHD A;  1GYK A;  1G9C A;  4QPG C;  2P3Y A;  2ZX3 A;  3MEP A;  4BIS A;  5KC5 A;  2JD4 A;  1RUN A;  3CLP A;  3MIH A;  2JX9 A;  5L73 A;  1OQD A;  4HSL A;  3F95 A;  5A33 A;  4EJR A;  3T0D A;  2PAK A;  4WM8 B;  1NLR A;  5FZM A;  4EZH A;  5AVP A;  2FDG A;  1WCK A;  1FNY A;  4FPL A;  1MEC 3;  3MUY 1;  1CQ9 A;  4LJH A;  2J1E A;  5BNO C;  1EV1 3;  3HN3 A;  4I0W B;  1OUS A;  1V9U 2;  3HT2 A;  2CV6 A;  4J1X A;  1SPP B;  4OI0 A;  4AWD A;  1F8V A;  1MS9 A;  3A0N A;  5A6X A;  3T2O A;  1AZD A;  4LKD A;  1POV 1;  1W90 A;  2XKP A;  4W6X A;  1OHF A;  4FFH A;  5DDJ 2;  3UJO A;  4EN8 B;  1YFY A;  1O4T A;  1WW4 A;  2XJU A;  2XHN A;  4NHM A;  4NWV A;  1IG0 A;  5H9S A; 
#chains in the Genus database with same CATH homology
 3LF7 A;  3LEM A;  1W2T A;  4HXC A;  4CCD A;  4UFK A;  1Y9M A;  2AC1 A;  3LIG A;  4CCE A;  3LDK A;  4UFM A;  4B1M A;  2QQV A;  4FFG A;  5FMC A;  5FK7 A;  5FMD A;  3KF3 A;  3PIG A;  4FFF A;  4UFJ A;  3U14 A;  4AZZ A;  1Y4W A;  1Y9G A;  5ANN A;  5FIX A;  3LIH A;  3IMM A;  5FK8 A;  3PIJ A;  2ADD A;  3HBK A;  2XQR A;  2ADE A;  2QQW A;  3ZR6 A;  2AEY A;  5FKB A;  3NMB A;  3RWK X;  4JQT A;  3KF5 A;  3U1X A;  3UGH A;  4B1L A;  3SC7 X;  3ZR5 A;  4UFH A;  5FMB A;  4UFL A;  2AEZ A;  3H3L A;  3OSD A;  5FKC A;  3UGF A;  4CCC A;  3UGG A;  3LFI A;  3LDR A;  4FFI A;  1ST8 A;  4FFH A;  2OXB A;  1UYP A;  4EQV A;  3U75 A;  4UFI A;  4QHZ A;  2QQU A;  3S5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...