3NMBA

Crystal structure of a putative sugar hydrolase (bacova_03189) from bacteroides ovatus at 2.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
PSKVALSYSKSLKAPETDSLNLPVDENGYITIFDGETFNGWRGYGKDRVPTKWTIEDGCIKFNGSGGGEAQDGDGGDLIFAHKFKNFELELEWKVAKGSNSGILYLAQEVTSKDKDGNDVLEPIYISAPEYQILDNANHPDAKLGKDNNRQSASLYDMIPAVPQNSKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTDMLQASKFSEDKWPLAFELLNNCGGENHEGFIGLQDHGDDVWFRNIRVKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords putative sugar hydrolase
publication title Crystal structure of a putative sugar hydrolase (BACOVA_03189) from Bacteroides ovatus at 2.40 A resolution
rcsb
source organism Bacteroides ovatus
total genus 68
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3nmbA00
3PIGA 4QHZA 3H3LA 4JQTA 3UGHA 3ZR5A 3LFIA 3IMMA 3UGFA 3LDRA 2QQUA 1Y4WA 1W2TA 5ANNA 5FK8A 5FKCA 3UGGA 4UFHA 2ADEA 5FMCA 3RWKX 4UFMA 5FKBA 1Y9GA 4AZZA 3U1XA 4FFFA 2QQWA 4UFJA 2AEZA 3KF5A 2AC1A 3LDKA 4UFIA 3NMBA 1UYPA 4UFLA 3OSDA 3ZR6A 5FK7A 4FFIA 3LEMA 2AEYA 2QQVA 4FFHA 5FMDA 3U14A 4CCCA 3KF3A 3LIGA 4B1LA 4CCDA 4B1MA 3PIJA 3S5QA 3LF7A 3SC7X 2ADDA 4HXCA 4EQVA 5FMBA 3LIHA 4CCEA 3U75A 4FFGA 2OXBA 4UFKA 5FIXA 3HBKA 2XQRA 1ST8A 1Y9MA
chains in the Genus database with same CATH superfamily
1V0AA 3H3LA 4QX5A 4QQ2A 2CY6A 1XNBA 4Q4V3 4QKDA 1CAXA 4DQAA 3BCWA 5IUQA 3FLRA 4RFT0 3ZYJB 1I3HA 3T1LA 2O8QA 1A8DA 2DVBA 3CJIC 3W5NA 2VPVA 1GP5A 1SHWB 4XF4A 5JMOA 4GZ9A 1UW8A 4QPGB 2AEYA 2A6ZA 2DBIA 1NOVA 3ALQA 4JAAA 4CCDA 4E2SA 4IEYA 1WMFA 2XH6A 2JICA 2H0BA 1W8NA 2WZR3 3URFA 4QM8A 5CA6A 1GP4A 2RE9A 1KDKA 4WM8A 1S0EA 3PVBB 2RM23 1ENRA 4QPYA 5FZ9A 2PXJA 4ZKTB 3F2ZA 4YLZA 1UU4A 3WX5A 4AI8A 4BQWA 5T5OA 5EYYA 2XVLA 2R041 4WVMA 1UOBA 2ZEWA 3Q8EA 2B5HA 1DYPA 3ITQA 1Z7S3 1L3JA 2CWMA 5CKNA 5ERLA 1JOPA 4IEXA 5GZCA 2WNVB 1VE0A 4IEUA 5CKQA 3TNQA 4BYYA 2VZQA 2BGOA 5F37A 4KL1A 3O1RA 1YFWA 4Q4W3 4R4XA 2ADDA 5JIAA 1VBB2 4RS5C 3ZYRA 4UT5A 2WO7A 4YARA 4XDQA 4AQSA 1AXYA 4GKYA 3AKTA 4K3UA 2VNRA 4EV0A 4CEWC 2D6NA 3CJXA 3AP9A 1FPN2 1AXKA 5GJ6A 3VL8A 4JGZC 5CYYA 2W0XA 1RUG2 4MSVA 1PMHX 1OD3A 2HWF3 4H55A 3ZIXA 5FR3A 1DDLA 4PI0A 2ZEYA 2WZPP 1SACA 2Q0AA 2WLPA 4GAZA 4CA9A 5FCCA 2YV8A 4NRMA 4ZU4A 1BYHA 5K0UB 2QE3A 3WQ7A 3VD3A 5CFCB 4Z2WA 2CYFA 2OX0A 4CCOA 2PLV2 4P9IA 5CZKA 2XBO3 1HXS2 4YZ4A 1W6MB 1PIV2 4GMP3 4B4PA 3BPZA 1GR3A 2LROA 2VH9A 4XAAA 3ZKYA 2DBNA 4Y1ZA 4YYOA 1O91A 2GC3A 1Q8QA 3UNPA 4L97A 4FPGA 1WLWA 2VZTA 1IKPA 2R1BA 3QOPA 1D4M3 5FY1A 2EAKA 2CGPA 1SCRA 4YZ5A 2VY0A 2HWB2 3NNMA 4GJZA 5LATA 4GWMA 4EN7B 2CWSA 3IM0A 1VRH2 2WS92 1CX1A 2ZZQA 4COUA 2VCAA 2ZGTA 5HV4A 1W9WA 1RHI3 4K40A 1CZVA 4HONA 4XQWA 3NNJA 2PHDA 1GZWB 2HJIA 5FY7A 1PO22 2PAMA 3U07A 4B1LA 3GBGA 3L2HA 4Q4V2 2D3RA 4PBPA 5J3UA 3H3ZA 3JB4C 1TZOA 1DQ6A 1HQNA 1W06A 3LEGA 2XL7A 3K3OA 4LNVA 1XYOA 5FMBA 5FXWA 3NV3A 4YWAA 5ABJC 2MEV3 3DN7A 4BISA 2WNOA 3SQOA 1UZVA 2D7FA 1WW6A 4XFBA 2XMLA 2E9QA 1ACCA 1EY2A 1LB2A 4C0BA 4UWDA 4DOUA 5I91A 3SEEA 2XLAA 2NMNA 2QBXA 5DUVA 4JHZA 1GNYA 3ZSJA 4Q27A 3VZOA 2LTNA 1KQRA 1SLIA 4XUTA 2WZR2 2AEZA 3QACA 3TYJA 2WJSA 1OOPC 3C7OA 1CPMA 2RM22 5FP9A 5I8SA 1UF2C 1VBA1 3N9LA 3LOBA 1B35C 1U5ZA 3OPZA 4B1MA 2PHLA 4JC1A 4WV8A 2A70A 4A41A 5FLHA 2J1TA 3WD5A 3OBAA 1M06G 1HB2A 2IZWA 1V00A 1S2KA 1REDA 1S0IA 5FTTC 3FZ3A 1UX7A 3WDYA 4FTSA 2CV6A 5D8AA 2BWCA 3JUUA 5FP7A 3DPRB 4N9HA 5A33A 1Y9MA 1PNFA 1H2KA 2V4VA 5ACA1 1GWMA 4FOVA 1LOFA 3ZOIA 3KHCA 1A8MA 4FXKB 1V6OA 4EE2A 4E2GA 2D5FA 3T3YA 2JG8C 5CISA 4IV3C 1W3XA 1QXPA 2EIDA 1CIWA 4HSJA 4NJ4A 5EJ3A 3T08A 1IZ3A 1AX2A 4XIOA 4RL7A 4CEYC 1MQTC 3VUOA 3ECQA 4GH4C 2G19A 3B7MA 2J7MA 1TMF2 2WC2A 2YC2A 4QKNA 1JYIA 3POWA 4QXKA 2C5DA 4BMBA 1Q43A 3N9NA 4LKFA 5KHHA 1UOFA 5I0SA 4WVWA 4IE0A 3OGJA 1POQA 3E97A 4HK9A 4KMQA 4ARXA 1HDKA 2E33A 4IEZA 4R9BA 2KR2A 5FYCA 5FYUA 4A6OA 1X82A 4MOAA 4CP1A 3GZAA 3E6CC 2W08A 3VKFC 1S0DA 3A4UA 2DTYA 1K12A 4XC9A 5BUVA 3GXUA 1QH6A 4RS5B 2WSVA 2P6HA 4AHZA 3TWIA 3V0BA 1BBT1 2IVIB 2JDYA 5A3OA 1XE8A 3K51A 2A6WA 1CAVA 1D0HA 5F3GA 2EXKA 2J1VA 2GDFA 4N43B 1NG0A 1RXGA 5C3QA 4JGZB 2DVGA 1X9TA 4HZFA 3OY8A 2P6CA 3I2HA 2YXSA 3PU3A 1YC61 3WF2A 3KCCA 1ZNPA 2E53A 2UWAA 4Q1PA 2C4XA 3BIWE 4CUGA 3TEZA 3ZX7A 2A7AA 3NW4A 5KXCA 3SISA 3FE5A 2QNKA 4IEVA 4FBFA 5FBZA 3ACIA 3MI8A 4AVAA 2W9XA 1RUH2 5KXDA 4Z2AA 3V0AB 4XPVA 1J58A 3VBOA 3PVOA 1Y3TA 4Y22A 4HVRA 1WZXA 1O4TA 1SLLA 2RS51 3K2OA 4G3YC 2JE8A 3B3QE 1CESA 1UX6A 2WT0A 2XDVA 3AP5A 5KHKA 4YW1A 4XIKA 4IXLA 3TB0A 4C91A 2ZXQA 2QQUA 3ENRA 5F3IA 3DL3A 2BWAA 2OZ6A 3RWKX 4AK3A 2PHFA 1KXGA 1VBB1 3HN3A 3I3QA 4NOTA 4QPGA 3ROUA 4P5HA 3VKOA 2HLEA 4WM7C 2PELA 4OHVA 5CFDB 1FPN1 2YFUA 5B2GB 5C8CA 1XYPA 1S2BA 4JHTA 2HYXA 2DCJA 4O9GA 3TN93 4QGMA 2UYAA 4I02A 4PCRA 1RJ8A 3SC7X 5KHIA 3KSCA 3R4DB 1H2NA 5HV0A 3NAPB 5C70A 3AM2A 3I2DA 3HNYM 3IPVB 4HPKA 1EV12 1UZWA 1HN1A 1JYNA 4NN0A 3HIFA 1RUI2 3H8XA 1RUD3 4WZCA 2PLV1 3ZLIA 3WDXA 1PIV1 4NIDA 2VCBA 3ZSKA 3I59A 3G6JB 4A7KA 1LECA 1HB3A 2VOVA 4XJWA 2ZX2A 1O3SA 3HT2A 3MV11 2I2SA 1I6XA 4ES8A 2R073 1ZBE1 2A75A 3ETQA 3ZMNA 3O1TA 4ISQA 3OD4A 5EIYB 1C3HA 1NUKA 2K0GA 2VUJA 2BOIA 4ZZ5A 1RUE3 4QGNA 5BNNA 3DUIA 1SDWA 1VRH1 2WS91 3U75A 3G7DA 2E31A 1ASJ3 3OUHA 5C3SA 3MBWA 3ZYBA 3KM5A 2VZ3A 1PO21 3DYMA 4OI0A 3I8TA 1FAYA 1RC6A 3LOIA 2MHFA 4Q4V1 4JRAA 5FMCA 1MQTB 1LOGA 1MR5A 1UKRA 4FOQA 2XKPA 4PIXA 1RUJ3 1Y7BA 4XOGA 1ND2A 1O3QA 3MLKA 3NJXA 4P08A 2DVAA 2P34A 3K4AA 4XMAA 3P6BA 3SITA 3RZHA 3AYCA 2YGLA 4XFGA 1MVQA 5CFCA 5JI9A 1W3VA 4EZ4A 2VMEA 1ULOA 4IE6A 4P9YA 4S2DA 5FPLA 5FZ1A 4AQTA 1O4ZA 1W6MA 4ORFA 4Q2FA 1N3PA 2P3IA 2XJRA 3B69A 4WBBA 2B4KA 2QZ2A 4QB2A 2QTWB 1MEC2 2WZR1 4MGSA 4P9GA 3VBFC 4YFWA 1WBLA 4BMEA 4Q4X3 4CCEA 4QXHA 1K5JA 5H9RA 2XJUA 2RM21 2Y6GA 3CF6E 3VDDC 4CDUB 4E4HA 2OIIA 1RL3A 1JODA 2VUDA 3KS7A 3R0RA 1T6GC 3LSDA 2C24A 3OGRA 1CGPA 5KHGA 1Y4WA 2RHPA 2VQ0A 4LBQD 4MGZE 3TEWA 2R49A 2EVXA 4QX1A 4LULA 2CGOA 1LGBA 1JYTA 4IERA 1YRZA 5L7OC 4AEDC 2W68A 4XUPA 4HOOA 5EP9A 3WF0A 4V2VA 3KF3A 2N7GA 4RD7A 2VMDA 3VHOA 4BQYA 1T6BX 2QQPA 4AXOA 1JTZX 1ZZ9A 1MS9A 4LE4A 1H1AA 4ASLA 1QOTA 2OVUA 4GKXA 3VBSA 1LGNA 2D43A 5JUVA 1W6NA 4LT5A 5CNAA 2ZX3A 1MPXA 1X7NA 4A6SA 2MPFA 1JN2P 3OG2A 5M0TA 1AYN2 2GSYA 2D3PA 2XLFA 4FPCA 3NJZA 4EWEA 3RZLA 1RUOA 4JGYA 3OOXA 5LEKA 2VL4A 1LU2A 3ILRA 4GWJA 5FO7B 2ZEXA 1R64A 2FCUA 1TMF1 4GWIA 2EAAA 3MUY1 4PLOA 3SKJE 4Y20A 3TN92 1H2LA 5A80A 1SQ4A 3GZUC 5FAXA 2HWF1 5A7NA 1SZBA 2RDRA 1RYYA 3I54A 3I2GA 4NVPA 2Y6LA 1GOFA 1QIQA 2ZEZA 2ZGPA 4TZDA 3AKQA 3UJQA 3VDBA 3KT1A 4XFFA 1ZRDA 1C5HA 2D6LX 1COV3 5EYXA 4CVUA 2JDKA 1LEMA 1NCRC 1PX4A 3I2IA 1SDDB 3CJIA 5IK8A 4F3JA 1I5ZA 2Y6KA 1W6QA 5BNNC 5JR2A 5TSWA 4XUNA 2VNGA 1W8UA 2ZGKA 4N9IA 1MS1A 3VKMA 4C1XA 4CDWB 3WP4A 2EXJA 3T4VA 5KWRA 3SCGA 4I01A 1OA3A 5DUWA 5B4XA 1D4M1 1UOJA 3NV2A 5KC6A 1CAWA 2ZGRA 4GMP0 1I9RA 1CAXB 4YGDA 2WLQA 3VBRC 1DZTA 3NNGA 3S7IA 4BQ1A 2L9LA 2VW2A 5JZGA 1AR92 3HVDA 4PBOA 2Y33A 1WD3A 1RUF3 1ASJ2 1QJX2 1RHI1 3E6BA 3PVEA 4OCTA 1PZ7A 3LFMA 4AFMA 2AENA 4NE9A 4LE3A 3LPFA 4CCJA 1UZZA 4X6QB 1BMV2 5LY2A 5F5AA 1FT9A 1UL9A 3KZ4C 4CUAA 4F8AA 3DXTA 4XFIA 4F83A 4C8DA 3BTZA 2D44A 1AJOA 3O0WA 4Q0UA 2E7TA 4K1YA 5E6HA 4META 3KVAA 4FTEA 3LAGA 3MIEA 1W2TA 4AYUA 2OUJA 3N3HA 4P02B 2GMEA 1SLCA 3VD5A 3HD8B 1WW5A 3AC0A 3LDKA 4RS5A 4TXWA 2X29A 4WVMB 2GP5A 2WUHA 3CQOA 3WW4A 4IESA 4CEWA 1GBGA 2NN8A 2HKXA 3O1UA 3A22A 3M3OA 2UWCA 3H1WA 4JGZA 2ZCWA 4AFBA 1W2AX 5FYYA 4O61A 4Q8LA 1A3KA 2DCZA 3KGLA 4YM2A 5T5PA 3IAPA 5FZAA 1RUC2 4DPNA 1W8ZA 4HLTA 3AMNA 1D7PM 4AAPA 1OFSA 3BALA 3OGGA 3MYXA 1LGCA 3ZXEA 3KV5A 4LITA 4XUOA 5EXOA 1A6CA 3BKZA 1VAKA 3JD73 3CZJA 4MZUA 1PO13 3FFQA 1URXA 1XPWA 3HWJA 1F35A 3I2JA 4LORA 4COZA 4CZSA 3T0DA 2W91A 2WL1A 5A6ZA 4UYBA 4MGTA 5DPNA 5JCTA 4I0BA 3PTYA 5KBFA 2MNGA 4JTOA 1RUI1 1AYM2 4YZ3A 2K9ZA 5FO9B 5LZ6A 2LW8A 2WO1A 3KV4A 1NT0A 3RGBA 2X8KA 1BZWA 3WXPA 1DHKB 3HQUA 3LA7A 4I0WB 2XQRA 4XTPA 1SFPA 4MXWA 5FZHA 2J1RA 3VHRA 1ALYA 4HETA 5GLZA 4AEDB 3IB3A 4ZONA 5ACA3 3KHBA 5GLVA 3GHNA 2JDZA 2UYBA 4FVVA 4PIZA 1LULA 3FLPA 4I3PA 1COV2 3RFRA 3MF9A 5IYYA 3U4XA 4GWNA 3PL0A 3NMBA 5FYVA 5ABJA 2FCVA 2BNOA 4WVZA 1DCSA 5LASA 3BI3A 2W95A 1F5JA 3EMRA 4QDRA 5A6QA 2X5IC 3LSEA 3LIGA 1WD4A 5FY5A 4IEQA 1SLAA 4FAGA 1WKYA 2KA3A 5CG8A 2V5DA 2A71A 3ACLA 5DG2A 2AH2A 2BOJA 5C9AC 1OOPA 2VZSA 1XSRA 1FXZA 1GZTA 5GZFA 4URTA 3PIGA 2J1AA 4YNIA 1XOYA 1B35A 2XUMA 1KGYA 1W8WA 3BYWA 4OHWA 2ORXA 4R4ZA 1AR63 5FREA 5GALA 1GNZA 1MEC1 2BERA 4LUMA 1UZYA 1SLTA 1W2NA 3EYPA 1UYPA 4LKSA 2DUPA 4NRPA 4X6RB 1MS0A 1EP0A 3KGZA 1YHFA 3I3DA 5LBBA 1QH7A 3UL2A 3VZLA 5BNNB 4MX3A 4XHBA 3WNNA 3WR0A 3AK0A 1OQ1A 3INAA 5LA0A 1IPJA 1D2SA 3T2PA 2JG8A 4IV3A 4XAEA 4PIYA 5F5IA 4S2FA 4CEYA 1JYXA 1MQTA 1RVF2 2C0ZA 3LFIA 4E4SA 4GH4A 5D8AB 3WQ0A 1CZSA 5A33B 1J3QA 1F2NA 2ZACA 2FDIA 2GU9A 3I2OA 2I07B 5LK5A 1UYYA 2QQKA 3GJAA 5H9QA 1A34A 2YG0A 3I4IA 4B29A 1IOAA 3K75B 4RQPC 4P00B 2R7EB 4HVQA 3EQEA 3C2UA 2LRPA 5F39A 3FX3A 4S2GA 1AXZA 2WSUA 4CU6A 2VTFA 2XL9A 2GP3A 2XOMA 4W6XA 2OKXA 2BNMA 3TN91 3RZGA 2XKOA 3I2KA 1J83A 3T30A 5GZDA 5JSOA 3VDCA 4DFSA 3CBNA 3WNKA 1OH4A 1F31A 2ZPXA 3NQHA 3ZDVA 1MZEA 3MFCA 2HWE2 2F6BA 5IW0A 3UGGA 1OHFA 5DAXA 3N4MA 1TQ5A 1VBB3 3WSOA 4AR2A 2GN7A 3KQRA 1RUD1 4EN6B 3LZZA 4IGOA 5A32A 2YU2A 1ZRCA 4QGLA 2R16A 4XYXA 4XBLA 3BGAA 4CXWA 4LOTA 4XZPA 2BYVE 4NHXA 3U14A 4LHSA 3WG2A 4K7JA 1KFUL 2X05A 2WIIB 3USUA 1RUG3 1SBDA 1W8OA 4P9JA 2XHKA 3MIFA 4BIOA 3V0BB 1HB1A 5FZFA 1XBFA 1VAVA 4HG6B 1US2A 4MHUA 5IK5A 3BTYA 3WUDA 1CAVB 1WLDA 2OXBA 2R32A 3C7GA 1RUE1 4UFKA 4XFAA 1KJLA 5JMCA 1AL0G 1ASJ1 1QJX1 2DURA 1GWKA 2W3JA 3OY8B 5ANQA 3B9IA 5C8WA 3RZKA 1N1YA 1G8WA 2VR4A 1HXS3 4UFMA 5T52A 1PIV3 1R083 4F7ZA 1AUYA 1Q5OA 5FJKA 1BMV1 2YYOA 4QKFA 1NAEA 2PYTA 1RUJ1 1S1AA 5A1LA 5LK7B 2D3SA 2XG3A 4HT1T 5FK7A 2FMDA 2Z2SB 4OLLA 1F5FA 1H6YA 4BQ2A 3E5QA 2VBBA 3EHKA 3R4SA 5J48A 4LK6A 5E1RA 3MIHA 2HWB3 3UKTA 3O12A 2E51A 4MGKE 3VBOB 1AR62 3J4UH 4Y22B 3RNSA 5IFTA 1VRH3 2WWJA 4EN8B 4Q4X1 4LOSA 1UMZA 4WM7A 2AUYA 5DAQA 4COYA 1JHNA 4JV4A 4R52A 5BYNA 4NROA 2B8MA 3TNPB 1YQ5A 4Y4RA 2VAUA 1DQ1A 1C57A 1H1MA 2YFZA 1QWRA 4QX2A 1QXJA 3ZXKA 1LU1A 2BRTA 2DDUA 3B94A 1K42A 4X8PA 4B7EA 3DCQA 2GC1A 1LTEA 4KWKA 5JXIA 5C8CB 1SFYA 1ZRIA 5A3TA 5A3NA 3SCHA 4YW2A 5A7OA 2DU0A 2CSGA 4YW6A 5JZGC 2EIGA 5F3CA 1DFQA 2GH8A 2PHXA 3GZTB 1NA1C 3AZXA 3R05A 3K46A 3ZPOA 1S0FA 2JEMA 1L7RA 4PDWC 4E8DA 1BLZA 4HPKB 4I0AA 4D8MA 1G9BA 1ULGA 4URAA 1AR72 4BXSV 2WQZC 1ND3C 5T5JA 5FPXA 5IK4A 1SFNA 4LBQA 5F9TA 3DV8A 3ZR6A 2X53S 4YVSC 3I59B 5H9PA 1KEXA 2ET7A 1O5LA 3TBDA 3H1MA 1ZA7A 2EXIA 4LK7A 4BH9A 2Q8OA 1COV1 4DO0A 1YFUA 2W39A 2Z69A 1FYUA 1GKBA 2JDAA 1QJY3 1AR82 2V72A 4LJHA 1KFXL 4QX3A 3UGHA 4BCUA 4BQ3A 5FMOL 2WT2A 3IIIA 1NY72 4MYEA 3E1F1 1TMF3 2H6BA 1E57A 1TNRA 2VZUA 2ZS6B 5JVVA 3OGVA 3CL1A 3ZFEA 4RSUA 2VGDA 5IVYA 2HWC2 4NRQA 3VBFA 3POBA 4XW3A 1S2EA 1RMU3 5F2WA 1ND2B 3LEMA 1IKQA 1H8VA 3VDDA 4D6RA 4Q4Y3 1UPIA 2XB6C 3I3BA 5EJZB 5K4LA 2OPWA 1RUF1 1DYOA 4NHMA 5FFOC 5IT6A 4H2AA 4HXCA 4INDA 1RUNA 5HCHA 1R082 1OLMA 4QPIC 5JOZA 5L7OA 2RS12 4AEDA 2VU9A 1H8TC 2OPKA 2XVKA 3POJA 3H1YA 3AZVA 5HCFA 5AFBA 4P5YA 2WABA 1HJFA 1PK6C 3H8UA 3Q8CA 4OMCA 1PZ8A 3N35A 1YEWA 5C4WC 1JZ4A 1OI6A 3AXDA 4XQ4A 1Q8PA 1RB8G 4FPJA 4MH0E 1F15A 2YHJA 1WW7A 1OFNA 1REFA 3NJVA 2VG9A 1KRIA 5LBCA 4OUEA 2PA7A 1H9WA 4RHV2 1GFF2 2PHWA 4UOJA 2VMIA 2CHHA 1IG0A 2WR9A 2Z42A 3PURA 1JMUB 4N53C 2GZWA 4AQ6A 2QDNA 3HJRA 1RUH3 3VBSB 1OVPA 5EPAA 2VZ1A 1W6NB 1X9PA 1XC6A 3CZUA 4D7TA 4YFZA 1UCXA 2PFWA 1RJ7A 3CU7A 4JGYB 3K48A 3IDCB 2UY8A 2B42B 3GBFA 1NCRA 2SLIA 1D2QA 2ARBA 2VQTA 3JD71 1FV2A 1S0GA 2WQ4A 4M0HA 1PO11 3MIGA 1DLCA 1TG7A 2VNVA 4NPRA 4Y20B 3T09A 3AJZA 4BLIA 2E7AA 4OQ9A 2HWE1 2G9FA 2AREA 4XEZA 3OYWB 2IXIA 5LB6A 5IK7A 2JDMA 4OVEA 2Y64A 3SXWA 5GLUA 4DZGA 2H0VA 5FZDA 5DZGA 4KNCA 4LTAA 1PNGA 1YI9A 4NHLA 3VBRA 2WAAA 4UW6A 4Z82A 3CJIB 4B8EA 1OLRA 1W6QB 2GMMA 5A3WA 3THTA 4FOWA 4GQ7A 5KXBA 3J26N 4L0PA 4TTGA 3B00A 2XHNA 4LR4A 3H7YA 1CAWB 2R30A 2ZGNA 4NAMA 1HRV2 1VMFA 4EWAA 1EV13 4MLOA 1UPSA 1LJ7A 3N9PA 3HR9A 2I45A 1QJY2 5J1XA 5A7QA 1RUI3 2R1DA 4L2NA 4CYDA 1N1VA 2SBAA 3S5QA 5BNOC 5JZGB 3VD4A 3H3UA 1EUTA 4DXTA 1JYVA 1UN1A 4JKMA 3FBMA 1QOOA 5FY8A 5FZ3A 3MHZA 4KU8A 3FC0A 4ZXEA 1YJLA 3BVCA 1OF3A 4NWWA 1UWWA 2DCYA 4Y5Z0 3B9CA 3VHPA 2HEYF 3WG3A 1RMU2 4BK5A 4RFRB 1WLCA 1LENA 1PVXA 1K5MA 2WO2A 3DYOA 4Q4Y2 4YVSB 1AX0A 1NCQC 1QJZA 5FV3A 5LRRA 1AR61 2ZHNA 3VBHC 1KD7A 4W6YA 1MVEA 3U37A 1YQ8A 1YYNA 5C5UA 3AMMA 5IATA 5KXEA 1XE0A 4SBVA 4FFHA 3PUQA 3HNBM 2JDNA 4XE9A 2OUHA 3FUOA 5EZWA 5A1AA 3NKGA 4LO8A 2WBKA 4CEWB 2JG9C 5DUUA 4CP0A 2VMHA 1MZ6A 2QDRA 4XACA 3WVJA 1W6PA 5IJRA 2ZHKA 3MDPA 4OUSA 3FHIB 2W1UA 2BP6A 3O1VA 1R1ZA 1J3RA 4ZXKA 1W0PA 3J7NA 1MEC3 1ZRFA 3AMQA 2IVJA 2Y8KA 4C90A 1CIYA 1NLSA 1O3RA 3RG0A 2JJ6A 5BNPC 2QQOA 4IGPA 1FMD2 4JCKA 3IBMA 4HBNA 3ZKUA 3WNOA 1C4RA 5AVAA 3RZZA 1YQ2A 5FUPA 1W8FA 3ME2A 1PK6B 3T2TA 1ODMA 2GH2A 2HYKA 1UZ0A 3PHMA 4CPBD 5FZEA 3GZEA 2PMWB 3J8F3 3OF1A 1VR3A 3K4DA 3CIHA 2Q5TA 4ZU5A 1W03A 4TWTA 5FZMA 4E27A 5C3PA 2XWJB 5F2SA 1ST8A 2GNBA 4CP9A 1Y43B 3ZFFA 1LOCA 1JXNA 3AFKA 4TYSA 3RMYA 2BV4A 1PGSA 2X5IA 3FWEA 1WMXA 2P1BA 4MXWB 4P9WA 2Y26A 2A6YA 3CLPA 5CB7A 2OW4A 4BM8A 1ULEA 5I0TA 4A44A 1ENXA 1AYN3 3UYJA 2FMYA 3O7OA 3N7LA 4O7XA 5C9AA 1W6OA 1MS4A 4J1XA 2BBVA 1YLLA 5ABJB 1MACA 1GMMA 1GOGA 2JIGA 5AC92 4OI1A 1YQCA 5FZGA 5C33A 4LHKA 1RUG1 2J1EA 2WFF2 3POIA 3UETA 4EQVA 2ZAAA 4BK4A 4M4RA 4CSWA 2HWC1 2ZGOA 4JDMA 2YUEA 3GALA 4FP2A 1NXMA 1OPOA 4Y24A 1LHOA 2D97A 3AYDA 4Q5OA 1LOEA 3USSA 2ZHMA 4O65A 1OOPB 3UV9A 3WF3A 1SPPA 1GSLA 2C1FA 2HBUA 3OEBA 4XETA 3LDBA 4IEOA 1B35B 2YGMA 4FFFA 1HXS1 1G9AA 1R081 3WLUA 1W9SA 3ZYPA 2RS11 1XNAA 2VCMA 4N7UA 1ENQA 3VDAA 3S5AA 2VOWA 3WDTA 3GJBA 3GNEA 1XQNA 4QB6A 1JZ7A 4AEJA 1VBD2 5C7GA 1AHSA 1AVBA 1ZREA 2ZGQA 5KC5A 1W28A 3DECA 2HWB1 1OQDA 3WDWA 1YXWA 2Z4FA 1S55A 4Y1VA 3VD9A 2FBEA 2QQIA 3VD7A 2FCTA 3NV1A 4RQPA 1AR93 4XDPA 1LHWA 1GANA 2R0FA 2XGXA 3Q8BA 1QJX3 2GNDA 2JG8B 1J3PA 2VOKA 4IV3B 2W1QA 4MGIE 2JB8A 2BTVC 2PHRA 1E5HA 4CEYB 3AKPA 2R062 5DUXA 3E5XA 4GH4B 4AE2A 3KF5A 3U78A 3UK9A 3ZSLA 2IXLA 4Q1RA 1O8SA 5CVRA 1FATA 3O0XA 3NNLA 5FYMA 4NPLA 3OCPA 5FRAA 2B9UA 1IG3A 4CRQA 2XR4A 4JTNA 1YO8A 5J37A 1OKQA 3U0ZA 1YJKA 3KB5A 3ZFEC 4TLGA 3DEMA 4YG6A 4H14A 5A7WA 4MO3M 4A7ZA 4DXSA 1JZ2A 3VBUC 3K77A 3BOWA 4FPHA 4EWDA 4IV1C 1ULPA 4HVOA 1MS8A 3FMGA 5FZCA 5G05L 2Y38A 2DV9A 4HKOA 5A7SA 2B9VA 4B4QA 2XXZA 1KS5A 4LPLA 4NHYA 4BZ4A 1CX4A 1IS6A 4QX7A 5DZEA 2Q8DA 5K7PA 1RUC3 1ZM1A 3GHMA 2O8OA 1LCLA 1JH5A 4GD4A 2JG9B 1YUDA 3J8F2 3O5SA 5DDJ2 5A32B 3RYPA 5A6YA 5CIRA 4LBMA 4RN5A 2VC9A 2RS33 5HI0A 5K9YA 5E8AA 1PM4A 4DMIA 3AP4A 3FL7A 1H4HA 5JPMB 3WP6A 3KV9A 1VBC2 3USUB 4MG2A 3ACGA 4FPOB 2NQYA 3MUZ1 4PI2A 4LO5B 4D7SA 3BPSA 4AG4A 2XVGA 5BV6A 1N1SA 3GGLA 1QJY1 4LKEA 3RQ0A 1GQHA 5FYTA 2RR12 1AYM3 4FPEA 5EFUA 3OPWA 3PVNA 4HFSA 3SH3A 3ZIWA 2DVFA 3ZSEA 2ZX4A 4M0NA 3RRDA 5I8YA 3MIDA 4AI1A 4XURA 1H0BA 3ZXJA 4W4ZA 3THCA 3A0NA 3MW2A 4J25A 3WNPA 2FDGA 3KMHA 4LBNA 2WNUC 5FZIA 1RMU1 2YPJA 1XSQA 1LESA 3D3AA 3OYWA 3N9QA 1KITA 4FTBA 1ZRRA 4PQQA 1OMIA 4Q4Y1 3WEZA 1H30A 4NMIA 1VMJA 4FQ4A 1CN1A 1WLTA 5CADA 1RXFA 5FLJA 4R8HA 4I2OA 2F4LA 3HN1A 5H9SA 1JZ6A 3MLJA 3H7JA 4Q0SA 5LA9A 3DF0A 1K45A 1RGSA 1STMA 1YFYA 4BQXA 4XJ9A 4YVWC 1QJEA 1GQGA 3IN9A 1DQ4A 1JYCA 2VBPA 3JBG2 4RGAA 3MW4A 4KI5M 4WM7B 4K1ZA 4YM1A 4ZZ8A 1ZX5A 2HH9A 3T0BA 3LD8A 3PU8A 1QEXA 4BQ5A 4PLMA 1POV1 1TME3 2CTVA 2UURA 2BPA2 2EIEA 1Y9QA 4XCAA 1NA1A 1PGW2 1XXNA 1S4CA 4EZHA 3QBQA 1LHNA 2FZ1A 4PDWA 1BVP1 4IQPA 4XJZA 4AVCA 1VAMA 1GLHA 1TVGA 5GM0A 1ND3A 1PZ9A 2GMPA 3AL5A 4LUKA 4AI2A 2WDBA 4Q0QA 1ZBA2 5F1RA 3OBRA 1RUH1 1XB9A 3JZVA 1OUXA 4YVSA 4D0QA 1FX5A 1PGL2 1X36A 3MV01 1TNFA 2DUQA 3BU0A 5C71A 1FV3A 4Y1UA 1EUUA 4HSLA 4AFCA 4E2QA 1VB2A 1MZ5A 4NPMA 4CDQA 2RJKA 4QHOA 1DZQA 1OLQA 1RIRA 1XNTA 1N3QA 4CU9A 4CCCA 1RVF3 2BEOA 4LBQB 5IVBA 1K5MC 5FZ0A 5SV5A 3WT3A 1PHMA 2JECA 2TNFA 3WW2A 3ACFA 2QUOA 3ES4A 3KCYA 4A42A 2JD9A 1F9KA 2XJQA 2J22A 5LA2A 1XU2A 3TEXA 2XPJA 4D3WA 1G9FA 3SKVA 5I93A 3WG4A 1X50A 4D6QA 2XJTA 4D7YA 3DKWA 5AC91 4DS0A 2RS32 4LXLA 2D6KA 5T55A 4UXAA 2VUCA 4BU2A 3UKNA 5JOYA 5LW9A 4ARYA 2Q30A 1UYZA 2ZABA 3RI8A 4EYUA 5FQ0A 4K9SA 3QLQA 5APAA 1UIKA 2LUWA 4QPIA 2GC0A 3PMEA 3ZXLA 3ZFEB 4DRRA 4YPJA 5C3OA 3GCXA 1H8TA 2HWE3 1BJQA 1EV11 1T2XA 1EPWA 3HNMA 3J9SA 3R6SA 3RPQA 1PK6A 2IXJA 2WA3A 4LA3A 1QNYA 4QD2A 4QU2A 4C1WA 1NE6A 4FP3A 2ZX1A 5C4WA 4BJ0A 2VVEA 3DYPA 3LF7A 3VDDB 5LWBA 2K2SA 3GBWA 4CCLA 2VOTA 1VB4A 2YZ4A 4AVSA 2O1QA 2D5HA 1UIJA 4D94A 1NZIA 5L7OB 1CONA 4QKBA 2E26A 4Y1YA 1C28A 1YI7A 2VD7A 4W8JA 4A7YA 2ERFA 4ASMB 1VBD1 2CL2A 1TE1B 1QGLA 3MLLA 3AYEA 2NM1A 3VZKA 4UF0A 4B4RA 4BQ4A 4DXZA 2UWBA 1G9DA 2IXCA 4N53A 4KH9A 5FYZA 2NPIA 2VO5A 1IPSA 5GLWA 3DGTA 3NV4A 4DUXA 3ZFFC 5I0RA 4YW5A 3QH6A 5J36A 2R042 4PF1A 5DAPA 3GF6A 5T3NA 1W99A 5FZ8A 3VZMA 2OS2A 1OSGA 3V56A 3RDIA 4B3NA 2PQSA 2WZEA 3Q9OA 1UXZA 2C26A 4GXLA 4Y4YA 3WQ1A 4Y1XA 1V6NA 5GZGA 1CQ9A 2YB7A 4Q26A 4QXCA 1TME2 3ZR5A 3O1SA 5IVFA 1W90A 4N90A 3M70A 4RR3C 5JXGA 4IEPA 1R092 2WNUB 1E5SA 1UMIA 4V1PA 2VW0A 5F6KA 1DYKA 2F4PA 1Z78A 2VE1A 1GUIA 3ETPA 3LEIA 4UI9L 4CP2A 4RA0A 2JDPA 2KM2A 4RGKA 1NCRB 3TAYA 1GOHA 2QKDA 5JIUA 2Z5WA 2UY9A 5DABA 3WINE 3H8OA 3FHAA 3PMSA 5JDBA 3KV6A 4W65A 1BHGA 3N9MA 3JB8A 2W87A 4IE4A 1FOD3 4P14A 4IE5A 4XUQA 3C3VA 4K6BA 1U5YA 3CMGA 4YZ1A 1YIFA 1VJ2A 1FNYA 3J8F1 3P5BA 4YM0A 3KQ4B 5GLTA 1DG6A 3ILNA 4M01A 1DQ5A 4YG0A 5FP4A 3VBRB 2J1UA 1O59A 2ETEA 4OFGA 1LR5A 5BNOA 1PVC3 3PUHA 5F5QA 5AVPA 2QFEA 1BK1A 1ZYBA 4CCNA 1N1TA 4K21A 4JQRA 4E4ZA 1DBNA 1AYN1 5DAWA 1H1IA 3T2OA 2WINB 1V6JA 4RGGA 5FPBA 2RR11 1QOSA 3WP3A 4LQRA 1AR73 2WNVC 5JR7B 3I49A 3IDEA 4OHZA 3WF4A 3HPNA 1NCQA 4KQ7A 1GWLA 4QQHA 1NZCA 3VBHA 3O1PA 2VZVA 1J84A 4CPBA 1ONAA 1O7FA 1REEA 1WA4A 2W5FA 3D5OA 3HAGA 1V9U3 4AVTA 1C8NA 3W21A 4D69A 4DNYA 3S30A 4EJRA 2Q1MA 5DQ0A 5FMOS 4BPZA 4CU8A 1JZ5A 2DFCA 2FHRA 2XONA 3PLQA 4FPYA 2JG9A 2VMFA 1K5MB 4JX0A 2ARCA 1AR83 3THDA 2V4AA 3H0OA 4FFIA 3M8LA 4JKLA 1UY4A 2BVBA 4KU7A 4CU7A 1OKOA 4AVBA 2BUKA 2WNEA 2CU5A 2R0HA 3JBG1 3ACHA 5FUNA 2LALA 3CEWA 2E6VA 4DRVA 1QY4A 1XU1A 2VQUA 2WWSA 2HWC3 3C7EA 2JDHA 4XJAA 5K0UC 5FYBA 3OUJA 4FQZA 5JSPA 3EBRA 1VBA2 3GCWA 3K4ZA 1V6KA 3O14A 3SHRA 1LOBA 3D8CA 3W5MA 1AR91 5BNPA 5KR7A 1W6PB 1WMEA 1PGW1 3LKJA 5FK8A 3VZJA 1LHVA 4DEVA 4G9SB 4YW3A 5IAXA 4G4FA 5JXJA 5FXVA 2RS13 4FXGB 4AW7A 2HWD3 2Q4SA 5KHJA 4Q0VA 1GQPA 4Y3OA 4FSJA 3IKWA 2FQPA 5JI7A 2P3JA 3EJKA 1PGL1 3ZVXA 4OMDA 1IPKA 2JXAA 2ZOEB 1W0NA 2B39A 1YCIA 2H6CA 1N47A 5FZBA 2RV9A 3ZYIB 2FZ2A 5FYSA 4QQLA 1UY0A 2EICA 2AR6A 1EYBA 1WGPA 3QCWA 4MHRA 1MS5A 2ATFA 5DZFA 1MS3A 1Z0HA 2P37A 3WQBA 4RHV3 2XLGA 1Q8OA 2JIJA 1WWYA 1QMJA 3AJYA 3AVSA 3E6DA 2ZGLA 5FKCA 3WP5A 3KD4A 2W92A 2VCCA 4CP9B 4LKDA 5D2AA 5BNQA 2W1WA 3ZFFB 1C8M3 5C6CA 1DGLA 2X5IB 2P17A 4CXXA 4BIFA 1FOD2 2D6PA 3VZNA 1RUC1 2P3KA 3LGRA 4IETA 4AEKA 1ZA4A 1Q8SA 3O1OA 3H42B 2BDRA 3UT0A 5LA1A 2RS31 2C9KA 5CAZA 4DY3A 5C9AB 2VXJA 1W6OB 3ATGA 4AGVA 4OZOA 2A6XA 1PVC2 2JWPA 3AB0A 2C6SA 4CXYA 2DYCA 3WDVA 1OURA 1M4WA 3WW3A 4LHLA 1BBT2 1LODA 3KVBA 2BU9A 1L7LA 3HOBA 2IFWA 1S0JA 4QM9A 5HXVA 1EAH3 2VNOA 2HEVF 3IIAA 4AFDA 2AYHA 4A2UA 1AYM1 4YRDA 3D82A 2QCSB 3DPRC 3LEKA 3POGA 2HEWF 2J42A 1SPPB 1W05A 1QHDA 2OT7A 4A3XA 1UAIA 4NHKA 5F5CA 5JAXA 1D0GA 1VMHA 4ATFA 2QVSB 1OLME 1V9U2 5D1IA 4B7KA 5IAVA 4OULA 5L9RA 1TEIA 2YY1A 1XNDA 4BXFA 4CDQC 1QDCA 1HRV3 2A73B 3HQXA 3WNMA 3ZXGA 2JX9A 4ES9A 3OGSA 3WOGA 3AMPA 5HBAA 4KGGA 2YMZA 5HXMA 3KT4A 1W2UA 3K3NA 4RQPB 2RS52 3NNFA 4CCKA 4IW3A 4UBHA 4LLFA 1QDOA 1VP6A 2P5BA 3PDQA 5FPVA 4QU1A 2D6OX 3ZN6B 4M3CF 1CAUA 1HQLA 4AL9A 3FUQA 3VBUA 3RS6A 3LWCA 1TME1 4IV1A 1HRI2 2ZGUA 2B45X 5CKMA 1R091 3UKVA 1JZ8A 3WDUA 4LHNA 4U36A 4GJYA 4AFAA 2PAKA 1XJAA 2ZJCA 1SG3A 1EPZA 2QQLA 4YZ2A 2JB4A 4N43C 2HWD2 5A7WB 3PJYA 3QD6A 3W9AA 3NWKA 4PQ9A 1UU5A 1ZZBA 3M7AA 4QWNA 4GIQA 1QKQA 1FNZA 1AL23 2ILMA 4QHBA 1SMVA 1WCUA 4HL0A 2Q1ZB 1POV3 3N36A 5CU1A 4TN7A 1HJGA 1DQ2A 5B4NA 5IVEA 2Y6FA 4P9LA 1NQDA 2TUNA 1RVF1 4MADA 4Q0PA 3T4HB 4AHYA 5J09A 2KXLA 2WO3A 4MUVA 4DUWA 2FDFA 2IUWA 3TRSB 3NSTA 1J1LA 3POYA 1C8M2 3IT8A 5A3UA 5A3PA 1LKNA 3L9JT 3AP7A 2TEPA 1FMD3 3C8XA 3SH5A 4UW4A 1U5XA 2WNUA 2BQPA 5ANNA 1WCSA 1ZBE2 2WQ8A 2D40A 2OYZA 4BOWA 1NLRA 1W9YA 3ABZA 5FUIA 2GN3A 1L7QA 2VUAA 3MO4A 2A5ZA 3U1XA 2YBSA 3WNXA 4UFIA 4BHPA 5FP3A 2DTWA 1D4VB 4IEWA 4J6GA 4IE7A 1X8MA 1RITA 5F32A 4E9KA 3T1MA 1QQP3 3NJYA 4TLFA 4Z1VA 4BWOA 1LAJA 4AGRA 1HV1A 1EAH2 1U12A 1SBEA 2VZRA 4YVWA 4NIIA 5CFDC 1VBE3 3OB8A 3DKQA 2JKBA 1W8TA 3HT1A 4OHXA 4A45A 1S0CA 2WA4A 4FFGA 4XABA 5FY0A 5FIXA 1PMIA 3T2QA 2NMOA 4Y5SA 1CD3G 3ZFGA 5FDBA 2RDNA 4OI2A 1PM7A 3D0JA 4BLJA 5AC93 2ZMKA 2JKXA 2WT1A 2ADEA 2WFF3 3NAPC 2DWRA 3ZXDA 1QJU3 2FD8A 1APNA 1ZZCA 4OYUA 1QNWA 1OH3A 4XTMA 4L8QA 5E89A 1S0BA 2RVAA 4PF5A 1ULFA 2AC1A 5L9BA 3VN4A 1BVVA 4KG8A 2PTMA 2JE7A 3P3PA 4X8NA 1F4AA 3ST7A 4XZUG 4QDSA 5JOXA 1X33A 3HMYA 1GU3A 2ORZA 4H7MA 3NVCA 2EIBA 4QT6A 2VBDA 4L92A 2E63A 3W58A 1HB4A 4FAHA 1OD5A 1NA1B 1U0AA 2G9ZA 5GKAC 1Z7S2 4EN0A 3RZMA 4PDWB 1OVSA 2WYFA 4UW3A 1QF3A 1ND3B 4QX0A 2V5YA 4R9CA 3KWVA 1VBD3 3EB7A 4Q4W2 4XBNA 2HBTA 3O0VA 5FKBA 3M3IA 5FY9A 2CGNA 4AWDA 4JZRA 5DAVA 3N7KA 4UFLA 4AF9A 3HQRA 1VALA 2YU1A 4FI9A 4HN0A 5FXZA 3AFGA 4IL7A 3TOJA 4CDQB 3NRUA 2W94A 2PHTA 5LRSA 5CG9A 2JENA 1XRUA 1DGWA 1WW4A 3ZN4A 4XVHA 3WCSA 4E4DX 2R063 4QQOA 4NR1A 3AZYA 3ZXFA 2Q8EA 3LQCA 3MEPA 2HWF2 3SH4A 1LOAA 3LIHA 4V2WA 5CBLA 1FOD1 2VQAA 1AL22 3I3EA 3W20A 4LBLA 3M4FA 4XQDA 3ZDSA 4DY5A 2BW8A 3V64A 3M2MA 1JUHA 1IQDC 4AI0A 5HCBA 4E8CA 5FO8B 4CDXA 3JCIA 4L9BA 4CDUC 2P3YA 2WN3A 1UU6A 2XBO2 1GP6A 2W52A 2OZJA 1PVC1 4EN9B 5LCWL 1WA6X 4CTEA 2VM9A 5AFEA 1ULCA 5FQ0B 3Q8AA 1NQJA 3ZN5A 3CNAA 4XBQA 4QMAA 1D4M2 1W2OA 3MIBA 4QDQA 4QPIB 4YGBA 5I8TA 3MF6A 2QQMA 2Y0IA 1H8TB 3AP6A 1UQXA 1AR71 3FBYA 4FPLA 2ET1A 5FPZA 4FPKA 1GYKA 1QU0A 1UOGA 5C4WB 1GZ9A 1JUIA 2ZKLA 4P9XA 5DDJ3 2B7YA 5G04L 4YGCA 4DUVA 3MGUA 4MV2A 4JRLA 3IDBB 4GB33 1RHI2 2IC1A 2BFUS 1V9U1 2BZDA 2VMCA 2ARAA 3FJSA 4XJUA 3IWZA 4KBBA 4PJYA 2W1SA 1QQP2 4KBZA 1AJKA 4J1WA 4XF3A 2UU8A 4Z07A 5EWSA 2XJSA 3HEIA 2Q8CA 3U4SA 1VBC3 5A3LA 2D93A 4AI9A 2GC2A 4XCBA 1VBE2 2MEV2 4LO6B 1G86A 1I5PA 1W9TA 1UO9A 1RTVA 2X09A 1IS4A 2ZTNA 2VZOA 1AR81 3AVRA 4UF0B 4W50A 2RR13 4MXVA 2BNNA 4N53B 3S0MA 4FT8A 1ZVFA 1NY71 4XDOA 2A3XA 1BQPA 4RR3A 3F95A 3ZYFA 1XNKA 2GNMA 1DZRA 4ONUA 1QJU2 1UY3A 1IHMA 1CWPA 5IHRA 4XF1A 3B02A 3FN9A 2CNAA 3FFZA 4NWVA 2DFBA 3BU7A 5LY1A 3HBKA 4YM3A 4KWUA 1DLLA 4R9AA 2RDSA 1BEV3 1C1LA 1HRI1 1W0OA 3BTAA 4Y33A 3WHTA 1ZZ6A 4COVA 1RINA 5FOBB 3V65A 2ZMLA 4KG0A 3U10A 4CDWC 1UD1A 2Y6JA 2W2IA 5DMYA 3ZM8A 4UAPA 1ZZ7A 2DU1A 1V6MA 2RJ2A 3MZHA 4YW7A 2HWD1 2A3WA 3I2FA 3KCXA 4K20A 2I74A 3JBG3 3MW3A 2EA7A 1VIWB 5FZ4A 3IDAA 3NKTA 1DIWA 1AX1A 5IVVA 2G9GA 1HW5A 3EXUA 2VOXA 4D6SA 3IAQA 1OBNA 5EHDA 3LE0A 3WNLA 3BIEA 2GALA 4OZXA 2JE9A 3IMMA 2GNTA 4AGGA 5JLVA 4RHV1 1OA2A 2B46X 2YBKA 3ASIA 1NE4A 3ZN6A 3B5LB 2WNVA 2QQJA 4WM8C 1WUVA 2ENRA 2V73A 1C8M1 2AGSA 2XQXA 5J98B 1ZBA3 5BNOB 3LA3A 3A21A 2LM3A 3RI9A 5FPAA 4FO9A 4Q29A 4K8FA 3GDBA 1R1A3 5D21A 4M3CB 5E88A 1MZFA 1NCQB 3OSDA 1HN0A 3IMNA 3SMHA 2F17A 4DINB 4OQ8A 4XXAA 1UY1A 3PNAA 3VBHB 5L36A 2Y60A 2RMU3 4M4PA 1UMHA 4N8MA 1EAH1 4BB3A 1Y9GA 1UKGA 4M00A 1WCKA 1JOJA 1NYWA 1NKGA 2VTXJ 5K0UA 1GV9A 1UY2A 3SNMA 5F6LB 1DU3D 4IGQA 2X10A 4PLNA 3D0SA 4CCMA 3B93A 4GB32 3JQWA 4LIVA 2YPDA 1N3OA 2GAUA 3AMHA 3OPTA 4COWA 2ZA9A 3UESA 4RYDA 4OI4A 5FYHA 1ULDA 1HRV1 4OUMA 4W6WA 2QZ3A 3N7JA 4ET7A 2PHUA 3OUIA 2BFUL 4CUCA 5IWFA 1ODNA 1GNHA 2VMGA 4O9EA 2OA2A 3RYKA 4LIUA 4Z92B 2JD4A 2Y34A 1G6NA 1Q3EA 5EJ1B 3C7FA 4C0HA 5BNPB 5HCAA 4UFJA 5L73A 1VLNA 1BXHA 4A3ZA 1Z7S1 4Z8BA 1GZWA 4ZS2A 1YFXA 5EV7A 1DGRN 4LO4B 4NIAA 3T0AA 3VKLA 2XWBB 3RMXA 1O4YA 4DEQA 2FDKA 3TEYA 3VKNA 1SEFA 3LB9A 3WW1A 3PIJA 5HPOA 2G1MA 1BEV2 2VULA 4Q4W1 5FLIA 5FZOB 1FI2A 4XF9A 3ILFA 3THPA 1KDMA 3ZO0B 4SLIA 3H9AA 4PT6A 2Z79A 2PAEA 2ZKNA 3FLTA 1YIPA 3VGIA 1O3TA 5F3EA 4HN1A 4QB1A 3RJ2X 1A78A 2ARXA 3PUAA 2R043 1IS5A 1UYXA 4LMFA 3J7LA 5J7MA 1P8JA 3NL1A 1CR7A 4XHXA 2QQWA 5EQUA 4AVVA 4HANA 2JDUA 4ITCA 4UBGA 2NLRA 1AL21 3LPGA 3OJBA 3WG1A 4LBKA 1CZTA 2QQVA 3ZFGC 4WVVA 1XNCA 2VVFA 5A70A 5IVJA 1JU4A 1R093 3S57A 2P2KA 1RUD2 4H7LA 2R6QA 5J96B 2XBO1 3DPRA 4GALA 4JDOA 4GMP1 5ISLA 3CKHA 2PN5A 1SCSA 4IDZA 1Q56A 4QPWA 3VB9A 1G7YA 1POV0 1KJRA 1V6IA 3PUSA 1LNSA 4AAXA 4LBOA 3DXUA 1FMD1 3E5UA 3LDRA 4I09A 4AZZA 1OF4A 1U5IA 1JHJA 1Q8VA 2WKKA 2YROA 3APBA 2R072 1OT5A 3MICA 3RWNA 4TSVA 5FXXA 1ENSA 2E32A 4K8RB 5FZ6A 5D8AC 1O8PA 1RUE2 5BPXA 3PTRB 1R1A2 3AZWA 3OBZA 1DP0A 4DIQA 2D6MA 3Q8FA 1YNAA 2ID4A 4BE3A 1LOFC 2RG4A 1DQ0A 2IXHA 2CAUA 1E5IA 3H50A 1IS3A 1LHUA 4ASKA 1QQP1 3UJOA 2WAOA 2RMU2 3WHUA 2CAVA 4XFHA 2CDPA 4QX8A 2NZ9A 1RUJ2 2BGCA 1VBE1 2MEV1 4MVTA 2ZHLA 2ZX0A 3M3QA 4JKKA 2EALA 4WM8B 3U11A 1UXXX 2DCTA 1NLQA 2WWUA 2Y0OA 3POFA 5FYIA 3ZSMA 2XUEA 4PHZA 2ZZJA 1JW6A 2XJPA 1BCXA 5FZ7A 1OC1A 2IWGB 5GZEA 2WFF1 2NP0A 5LBFA 1QJU1 1B09A 3CHXA 2A3YA 1H4GA 2VXRA 3BB6A 4Q4X2 2AZ5A 3PJQA 5FZLA 3WZ1A 3GYDA 4AHWA 3MFAA 1AF9A 3AKRA 5DXDA 4A4AA 3WCRA 3S6PA 3KT7A 4N43A 2ZAHA 1CAUB 1WCQA 1OPMA 2W46A 4XJ8A 3VV1A 1HKDA 4CDXC 1F8VA 4L99A 5E16A 3VBUB 4IV1B 1H6XA 5IVCA 3PUIA 1W8HA 3N9OA 4KWJA 1BKZA 1PMJX 3N7MA 1OA4A 3EO6A 1OUSA 2VTXA 3I97A 3UGFA 5K8SA 5I0DA 2DCKA 2QJVA 4AOCA 2OQ7A 4XMIA 1W04A 4R9DA 5LBEA 5T54A 2ZGMA 3RVHA 2DVDA 3A0KA 4XILA 2ZGSA 3V0AA 3POEA 1WMDA 1VBA3 3OBTA 1V6LA 5L9VA 3R4UA 4H3WA 4NIGA 2WZ8A 2E7QA 4S2HA 3VHNA 1CVNA 2ZMNA 1GZCA 2BVVA 3ZXAC 4XF0A 1HIXA 4JVAA 4QAWA 4Y26A 2FDJA 1ZZ8A 2K46A 3CDZB 1GICA 3VLBB 4DXRA 2C9AA 4HKWA 2R061 3SLIA 5FJHA 1JU3A 1JBCA 5JPNB 5A3MA 2A6VA 2PQQA 4ZU7A 5I0UA 4LO7A 3B01A 4NAOA 3RJRA 4MGYE 3VBOC 1HQWA 2RDQA 1E5RA 3IZOA 1H9PA 1IQAA 1WCDJ 3D4KA 3OTFA 2VJXA 4LA2A 2VVDA 3S7EA 3AX4A 2BGPA 5CFDA 3SEPA 2YDEA 1SBFA 1JI6A 1V70A 1XYNA 3HBZA 4M3CE 1W39A 1VRBA 4WZFA 4XXPA 3RZJA 5IFPA 4QXBA 3ZYGA 3OD0A 4HKLA 5JOWA 3AYAA 1US3A 4Y5TA 1CJDA 1O6UA 3AKSA 5SV8A 5JXHA 2EXHA 3I7DA 3NAPA 1HX6A 4DB5A 2FDHA 5A7PA 3IPVA 4QPGC 4YVWB 2ES3A 4YG3A 3JQXA 2ZBJA 5C8CC 1HV0A 4ZPIA 5DDJ1 1CPNA 4HK8A 1QJFA 3A23A 1RUF2 4GB31 3A7QA 2WYSA 5FWEA 5C3RA 2YBPA 4KGQA 4XFCA 3ZFGB 1IGOA 2VW1A 3J7HA 5FPUA 3BOPA 1VBC1 2Q1FA 4ATEA 5T50A 1BBT3 2VZPA 4N7IA 4NUBA 3RSJA 1DGRA 3GM8A 3MPBA 3ORJA 4I3GA 3M1HA 3ZYHA 4OHYA 1DF0A 3D6EA 2G4IA 4M3CA 1YQ6A 3J7MA 1J1TA 2DUOA 4FPFA 1VPHA 4QQPA 3WV6A 4BA6A 4ZHNA 3JU9A 3H8RA 2BBAA 3WY6A 2P4EA 2Y6HA 4LEJA 1I1EA 1JZ3A 3I3MA 2CDOA 3RYRA 3BN6A 4GA9A 4FCAA 3LA2A 1BEV1 2OQ6A 3X29B 3CO2A 1UNBA 1O5UA 1C5IA 1CJPA 4CE8A 3P3NA 4MGQA 4YSFA 1JYWA 5L19A 3OEAA 4AI3A 4U2AA 5CEHA 4IUGA 1J59A 3ES1A 4LBJA 1JS9A 5FZKA 2KD7A 2RS53 1OQEA 1W9FA 4GULA 1ND2C 4FOYA 2D98A 1JOBA 2W47A 4CDUA 3LCPA 3JD72 4NIHA 3M3EA 3P1IA 3KLSA 1PO12 3AZZA 3C7HA 5CFCC 4AHXA 4NO4A 2V09A 4JQTA 2WFPA 1HRI3 1OXCA 1K3IA 1DGWX 2J1SA 5FWJA 4UFHA 5T5LA 3BUCA 5A6XA 4YW4A 5BY5A 3AL6A 1C1FA 1BK0A 4HMZA 4CDXB 1X8EA 1FPN3 2O0OA 4Q8KA 1LRHA 1ZBA1 2XJVA 3BODA 3VL9A 5C5TA 5FZOA 5ACA2 2IXKA 2BJSA 2DF7A 4ISRA 2R071 5DG1A 4AEMA 1QXRA 2RJLA 5BXXA 3M3CA 1F4HA 1XE7A 3QH7A 4BDVB 3FHQA 1R1A1 4JDNA 5A1FA 2WRAA 3NO8A 1HLCA 2O14A 4QHZA 4ZS3A 2IFRA 2NYYA 2YC4A 3ZPYA 2PLV3 4AQ2A 1KS4A 1NXD1 3AXEA 5FP8A 1YWKA 2RMU1 3VBSC 4L11A 3O1MA 1LEDA 5DN2A 2YC0A 5FBJA 1AZDA 5F8PA 5F7UA 3POSA 4JGYC 1H2MA 5FOJB 5FMDA 3JXSA 2EF6A 1PX3A 1ZBE3 2A1XA 4ZY9A 5JWPA 1WBFA 2WN2A 1G9CA 3BTXA 3SCFA 2VECA 5JSRA 3W59A 2TBVA 4EROA 2QQNA 3WF1A 4UW5A 5LEJA 1SLBA 2AACA 2WS93 4I30A 3MPPG 4YGEA 3ON7A 3WUCA 4CDWA 4CUBA 4LLOA 4RR3B 3L2YA 3VBFB 3ELNA 3ZMOA 4KWLA 5FY4A 1NX9A 2LS6A 1PO23
chains in the Genus database with same CATH topology
3PIGA 4QHZA 3H3LA 4JQTA 3UGHA 3ZR5A 3LFIA 3IMMA 3UGFA 3LDRA 2QQUA 1Y4WA 1W2TA 5ANNA 5FK8A 5FKCA 3UGGA 4UFHA 2ADEA 5FMCA 3RWKX 4UFMA 5FKBA 1Y9GA 4AZZA 3U1XA 4FFFA 2QQWA 4UFJA 2AEZA 3KF5A 2AC1A 3LDKA 4UFIA 3NMBA 1UYPA 4UFLA 3OSDA 3ZR6A 5FK7A 4FFIA 3LEMA 2AEYA 2QQVA 4FFHA 5FMDA 3U14A 4CCCA 3KF3A 3LIGA 4B1LA 4CCDA 4B1MA 3PIJA 3S5QA 3LF7A 3SC7X 2ADDA 4HXCA 4EQVA 5FMBA 3LIHA 4CCEA 3U75A 4FFGA 2OXBA 4UFKA 5FIXA 3HBKA 2XQRA 1ST8A 1Y9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIG A;  4QHZ A;  3H3L A;  4JQT A;  3UGH A;  3ZR5 A;  3LFI A;  3IMM A;  3UGF A;  3LDR A;  2QQU A;  1Y4W A;  1W2T A;  5ANN A;  5FK8 A;  5FKC A;  3UGG A;  4UFH A;  2ADE A;  5FMC A;  3RWK X;  4UFM A;  5FKB A;  1Y9G A;  4AZZ A;  3U1X A;  4FFF A;  2QQW A;  4UFJ A;  2AEZ A;  3KF5 A;  2AC1 A;  3LDK A;  4UFI A;  3NMB A;  1UYP A;  4UFL A;  3OSD A;  3ZR6 A;  5FK7 A;  4FFI A;  3LEM A;  2AEY A;  2QQV A;  4FFH A;  5FMD A;  3U14 A;  4CCC A;  3KF3 A;  3LIG A;  4B1L A;  4CCD A;  4B1M A;  3PIJ A;  3S5Q A;  3LF7 A;  3SC7 X;  2ADD A;  4HXC A;  4EQV A;  5FMB A;  3LIH A;  4CCE A;  3U75 A;  4FFG A;  2OXB A;  4UFK A;  5FIX A;  3HBK A;  2XQR A;  1ST8 A;  1Y9M A; 
#chains in the Genus database with same CATH topology
 1V0A A;  3H3L A;  4QX5 A;  4QQ2 A;  2CY6 A;  1XNB A;  4Q4V 3;  4QKD A;  1CAX A;  4DQA A;  3BCW A;  5IUQ A;  3FLR A;  4RFT 0;  3ZYJ B;  1I3H A;  3T1L A;  2O8Q A;  1A8D A;  2DVB A;  3CJI C;  3W5N A;  2VPV A;  1GP5 A;  1SHW B;  4XF4 A;  5JMO A;  4GZ9 A;  1UW8 A;  4QPG B;  2AEY A;  2A6Z A;  2DBI A;  1NOV A;  3ALQ A;  4JAA A;  4CCD A;  4E2S A;  4IEY A;  1WMF A;  2XH6 A;  2JIC A;  2H0B A;  1W8N A;  2WZR 3;  3URF A;  4QM8 A;  5CA6 A;  1GP4 A;  2RE9 A;  1KDK A;  4WM8 A;  1S0E A;  3PVB B;  2RM2 3;  1ENR A;  4QPY A;  5FZ9 A;  2PXJ A;  4ZKT B;  3F2Z A;  4YLZ A;  1UU4 A;  3WX5 A;  4AI8 A;  4BQW A;  5T5O A;  5EYY A;  2XVL A;  2R04 1;  4WVM A;  1UOB A;  2ZEW A;  3Q8E A;  2B5H A;  1DYP A;  3ITQ A;  1Z7S 3;  1L3J A;  2CWM A;  5CKN A;  5ERL A;  1JOP A;  4IEX A;  5GZC A;  2WNV B;  1VE0 A;  4IEU A;  5CKQ A;  3TNQ A;  4BYY A;  2VZQ A;  2BGO A;  5F37 A;  4KL1 A;  3O1R A;  1YFW A;  4Q4W 3;  4R4X A;  2ADD A;  5JIA A;  1VBB 2;  4RS5 C;  3ZYR A;  4UT5 A;  2WO7 A;  4YAR A;  4XDQ A;  4AQS A;  1AXY A;  4GKY A;  3AKT A;  4K3U A;  2VNR A;  4EV0 A;  4CEW C;  2D6N A;  3CJX A;  3AP9 A;  1FPN 2;  1AXK A;  5GJ6 A;  3VL8 A;  4JGZ C;  5CYY A;  2W0X A;  1RUG 2;  4MSV A;  1PMH X;  1OD3 A;  2HWF 3;  4H55 A;  3ZIX A;  5FR3 A;  1DDL A;  4PI0 A;  2ZEY A;  2WZP P;  1SAC A;  2Q0A A;  2WLP A;  4GAZ A;  4CA9 A;  5FCC A;  2YV8 A;  4NRM A;  4ZU4 A;  1BYH A;  5K0U B;  2QE3 A;  3WQ7 A;  3VD3 A;  5CFC B;  4Z2W A;  2CYF A;  2OX0 A;  4CCO A;  2PLV 2;  4P9I A;  5CZK A;  2XBO 3;  1HXS 2;  4YZ4 A;  1W6M B;  1PIV 2;  4GMP 3;  4B4P A;  3BPZ A;  1GR3 A;  2LRO A;  2VH9 A;  4XAA A;  3ZKY A;  2DBN A;  4Y1Z A;  4YYO A;  1O91 A;  2GC3 A;  1Q8Q A;  3UNP A;  4L97 A;  4FPG A;  1WLW A;  2VZT A;  1IKP A;  2R1B A;  3QOP A;  1D4M 3;  5FY1 A;  2EAK A;  2CGP A;  1SCR A;  4YZ5 A;  2VY0 A;  2HWB 2;  3NNM A;  4GJZ A;  5LAT A;  4GWM A;  4EN7 B;  2CWS A;  3IM0 A;  1VRH 2;  2WS9 2;  1CX1 A;  2ZZQ A;  4COU A;  2VCA A;  2ZGT A;  5HV4 A;  1W9W A;  1RHI 3;  4K40 A;  1CZV A;  4HON A;  4XQW A;  3NNJ A;  2PHD A;  1GZW B;  2HJI A;  5FY7 A;  1PO2 2;  2PAM A;  3U07 A;  4B1L A;  3GBG A;  3L2H A;  4Q4V 2;  2D3R A;  4PBP A;  5J3U A;  3H3Z A;  3JB4 C;  1TZO A;  1DQ6 A;  1HQN A;  1W06 A;  3LEG A;  2XL7 A;  3K3O A;  4LNV A;  1XYO A;  5FMB A;  5FXW A;  3NV3 A;  4YWA A;  5ABJ C;  2MEV 3;  3DN7 A;  4BIS A;  2WNO A;  3SQO A;  1UZV A;  2D7F A;  1WW6 A;  4XFB A;  2XML A;  2E9Q A;  1ACC A;  1EY2 A;  1LB2 A;  4C0B A;  4UWD A;  4DOU A;  5I91 A;  3SEE A;  2XLA A;  2NMN A;  2QBX A;  5DUV A;  4JHZ A;  1GNY A;  3ZSJ A;  4Q27 A;  3VZO A;  2LTN A;  1KQR A;  1SLI A;  4XUT A;  2WZR 2;  2AEZ A;  3QAC A;  3TYJ A;  2WJS A;  1OOP C;  3C7O A;  1CPM A;  2RM2 2;  5FP9 A;  5I8S A;  1UF2 C;  1VBA 1;  3N9L A;  3LOB A;  1B35 C;  1U5Z A;  3OPZ A;  4B1M A;  2PHL A;  4JC1 A;  4WV8 A;  2A70 A;  4A41 A;  5FLH A;  2J1T A;  3WD5 A;  3OBA A;  1M06 G;  1HB2 A;  2IZW A;  1V00 A;  1S2K A;  1RED A;  1S0I A;  5FTT C;  3FZ3 A;  1UX7 A;  3WDY A;  4FTS A;  2CV6 A;  5D8A A;  2BWC A;  3JUU A;  5FP7 A;  3DPR B;  4N9H A;  5A33 A;  1Y9M A;  1PNF A;  1H2K A;  2V4V A;  5ACA 1;  1GWM A;  4FOV A;  1LOF A;  3ZOI A;  3KHC A;  1A8M A;  4FXK B;  1V6O A;  4EE2 A;  4E2G A;  2D5F A;  3T3Y A;  2JG8 C;  5CIS A;  4IV3 C;  1W3X A;  1QXP A;  2EID A;  1CIW A;  4HSJ A;  4NJ4 A;  5EJ3 A;  3T08 A;  1IZ3 A;  1AX2 A;  4XIO A;  4RL7 A;  4CEY C;  1MQT C;  3VUO A;  3ECQ A;  4GH4 C;  2G19 A;  3B7M A;  2J7M A;  1TMF 2;  2WC2 A;  2YC2 A;  4QKN A;  1JYI A;  3POW A;  4QXK A;  2C5D A;  4BMB A;  1Q43 A;  3N9N A;  4LKF A;  5KHH A;  1UOF A;  5I0S A;  4WVW A;  4IE0 A;  3OGJ A;  1POQ A;  3E97 A;  4HK9 A;  4KMQ A;  4ARX A;  1HDK A;  2E33 A;  4IEZ A;  4R9B A;  2KR2 A;  5FYC A;  5FYU A;  4A6O A;  1X82 A;  4MOA A;  4CP1 A;  3GZA A;  3E6C C;  2W08 A;  3VKF C;  1S0D A;  3A4U A;  2DTY A;  1K12 A;  4XC9 A;  5BUV A;  3GXU A;  1QH6 A;  4RS5 B;  2WSV A;  2P6H A;  4AHZ A;  3TWI A;  3V0B A;  1BBT 1;  2IVI B;  2JDY A;  5A3O A;  1XE8 A;  3K51 A;  2A6W A;  1CAV A;  1D0H A;  5F3G A;  2EXK A;  2J1V A;  2GDF A;  4N43 B;  1NG0 A;  1RXG A;  5C3Q A;  4JGZ B;  2DVG A;  1X9T A;  4HZF A;  3OY8 A;  2P6C A;  3I2H A;  2YXS A;  3PU3 A;  1YC6 1;  3WF2 A;  3KCC A;  1ZNP A;  2E53 A;  2UWA A;  4Q1P A;  2C4X A;  3BIW E;  4CUG A;  3TEZ A;  3ZX7 A;  2A7A A;  3NW4 A;  5KXC A;  3SIS A;  3FE5 A;  2QNK A;  4IEV A;  4FBF A;  5FBZ A;  3ACI A;  3MI8 A;  4AVA A;  2W9X A;  1RUH 2;  5KXD A;  4Z2A A;  3V0A B;  4XPV A;  1J58 A;  3VBO A;  3PVO A;  1Y3T A;  4Y22 A;  4HVR A;  1WZX A;  1O4T A;  1SLL A;  2RS5 1;  3K2O A;  4G3Y C;  2JE8 A;  3B3Q E;  1CES A;  1UX6 A;  2WT0 A;  2XDV A;  3AP5 A;  5KHK A;  4YW1 A;  4XIK A;  4IXL A;  3TB0 A;  4C91 A;  2ZXQ A;  2QQU A;  3ENR A;  5F3I A;  3DL3 A;  2BWA A;  2OZ6 A;  3RWK X;  4AK3 A;  2PHF A;  1KXG A;  1VBB 1;  3HN3 A;  3I3Q A;  4NOT A;  4QPG A;  3ROU A;  4P5H A;  3VKO A;  2HLE A;  4WM7 C;  2PEL A;  4OHV A;  5CFD B;  1FPN 1;  2YFU A;  5B2G B;  5C8C A;  1XYP A;  1S2B A;  4JHT A;  2HYX A;  2DCJ A;  4O9G A;  3TN9 3;  4QGM A;  2UYA A;  4I02 A;  4PCR A;  1RJ8 A;  3SC7 X;  5KHI A;  3KSC A;  3R4D B;  1H2N A;  5HV0 A;  3NAP B;  5C70 A;  3AM2 A;  3I2D A;  3HNY M;  3IPV B;  4HPK A;  1EV1 2;  1UZW A;  1HN1 A;  1JYN A;  4NN0 A;  3HIF A;  1RUI 2;  3H8X A;  1RUD 3;  4WZC A;  2PLV 1;  3ZLI A;  3WDX A;  1PIV 1;  4NID A;  2VCB A;  3ZSK A;  3I59 A;  3G6J B;  4A7K A;  1LEC A;  1HB3 A;  2VOV A;  4XJW A;  2ZX2 A;  1O3S A;  3HT2 A;  3MV1 1;  2I2S A;  1I6X A;  4ES8 A;  2R07 3;  1ZBE 1;  2A75 A;  3ETQ A;  3ZMN A;  3O1T A;  4ISQ A;  3OD4 A;  5EIY B;  1C3H A;  1NUK A;  2K0G A;  2VUJ A;  2BOI A;  4ZZ5 A;  1RUE 3;  4QGN A;  5BNN A;  3DUI A;  1SDW A;  1VRH 1;  2WS9 1;  3U75 A;  3G7D A;  2E31 A;  1ASJ 3;  3OUH A;  5C3S A;  3MBW A;  3ZYB A;  3KM5 A;  2VZ3 A;  1PO2 1;  3DYM A;  4OI0 A;  3I8T A;  1FAY A;  1RC6 A;  3LOI A;  2MHF A;  4Q4V 1;  4JRA A;  5FMC A;  1MQT B;  1LOG A;  1MR5 A;  1UKR A;  4FOQ A;  2XKP A;  4PIX A;  1RUJ 3;  1Y7B A;  4XOG A;  1ND2 A;  1O3Q A;  3MLK A;  3NJX A;  4P08 A;  2DVA A;  2P34 A;  3K4A A;  4XMA A;  3P6B A;  3SIT A;  3RZH A;  3AYC A;  2YGL A;  4XFG A;  1MVQ A;  5CFC A;  5JI9 A;  1W3V A;  4EZ4 A;  2VME A;  1ULO A;  4IE6 A;  4P9Y A;  4S2D A;  5FPL A;  5FZ1 A;  4AQT A;  1O4Z A;  1W6M A;  4ORF A;  4Q2F A;  1N3P A;  2P3I A;  2XJR A;  3B69 A;  4WBB A;  2B4K A;  2QZ2 A;  4QB2 A;  2QTW B;  1MEC 2;  2WZR 1;  4MGS A;  4P9G A;  3VBF C;  4YFW A;  1WBL A;  4BME A;  4Q4X 3;  4CCE A;  4QXH A;  1K5J A;  5H9R A;  2XJU A;  2RM2 1;  2Y6G A;  3CF6 E;  3VDD C;  4CDU B;  4E4H A;  2OII A;  1RL3 A;  1JOD A;  2VUD A;  3KS7 A;  3R0R A;  1T6G C;  3LSD A;  2C24 A;  3OGR A;  1CGP A;  5KHG A;  1Y4W A;  2RHP A;  2VQ0 A;  4LBQ D;  4MGZ E;  3TEW A;  2R49 A;  2EVX A;  4QX1 A;  4LUL A;  2CGO A;  1LGB A;  1JYT A;  4IER A;  1YRZ A;  5L7O C;  4AED C;  2W68 A;  4XUP A;  4HOO A;  5EP9 A;  3WF0 A;  4V2V A;  3KF3 A;  2N7G A;  4RD7 A;  2VMD A;  3VHO A;  4BQY A;  1T6B X;  2QQP A;  4AXO A;  1JTZ X;  1ZZ9 A;  1MS9 A;  4LE4 A;  1H1A A;  4ASL A;  1QOT A;  2OVU A;  4GKX A;  3VBS A;  1LGN A;  2D43 A;  5JUV A;  1W6N A;  4LT5 A;  5CNA A;  2ZX3 A;  1MPX A;  1X7N A;  4A6S A;  2MPF A;  1JN2 P;  3OG2 A;  5M0T A;  1AYN 2;  2GSY A;  2D3P A;  2XLF A;  4FPC A;  3NJZ A;  4EWE A;  3RZL A;  1RUO A;  4JGY A;  3OOX A;  5LEK A;  2VL4 A;  1LU2 A;  3ILR A;  4GWJ A;  5FO7 B;  2ZEX A;  1R64 A;  2FCU A;  1TMF 1;  4GWI A;  2EAA A;  3MUY 1;  4PLO A;  3SKJ E;  4Y20 A;  3TN9 2;  1H2L A;  5A80 A;  1SQ4 A;  3GZU C;  5FAX A;  2HWF 1;  5A7N A;  1SZB A;  2RDR A;  1RYY A;  3I54 A;  3I2G A;  4NVP A;  2Y6L A;  1GOF A;  1QIQ A;  2ZEZ A;  2ZGP A;  4TZD A;  3AKQ A;  3UJQ A;  3VDB A;  3KT1 A;  4XFF A;  1ZRD A;  1C5H A;  2D6L X;  1COV 3;  5EYX A;  4CVU A;  2JDK A;  1LEM A;  1NCR C;  1PX4 A;  3I2I A;  1SDD B;  3CJI A;  5IK8 A;  4F3J A;  1I5Z A;  2Y6K A;  1W6Q A;  5BNN C;  5JR2 A;  5TSW A;  4XUN A;  2VNG A;  1W8U A;  2ZGK A;  4N9I A;  1MS1 A;  3VKM A;  4C1X A;  4CDW B;  3WP4 A;  2EXJ A;  3T4V A;  5KWR A;  3SCG A;  4I01 A;  1OA3 A;  5DUW A;  5B4X A;  1D4M 1;  1UOJ A;  3NV2 A;  5KC6 A;  1CAW A;  2ZGR A;  4GMP 0;  1I9R A;  1CAX B;  4YGD A;  2WLQ A;  3VBR C;  1DZT A;  3NNG A;  3S7I A;  4BQ1 A;  2L9L A;  2VW2 A;  5JZG A;  1AR9 2;  3HVD A;  4PBO A;  2Y33 A;  1WD3 A;  1RUF 3;  1ASJ 2;  1QJX 2;  1RHI 1;  3E6B A;  3PVE A;  4OCT A;  1PZ7 A;  3LFM A;  4AFM A;  2AEN A;  4NE9 A;  4LE3 A;  3LPF A;  4CCJ A;  1UZZ A;  4X6Q B;  1BMV 2;  5LY2 A;  5F5A A;  1FT9 A;  1UL9 A;  3KZ4 C;  4CUA A;  4F8A A;  3DXT A;  4XFI A;  4F83 A;  4C8D A;  3BTZ A;  2D44 A;  1AJO A;  3O0W A;  4Q0U A;  2E7T A;  4K1Y A;  5E6H A;  4MET A;  3KVA A;  4FTE A;  3LAG A;  3MIE A;  1W2T A;  4AYU A;  2OUJ A;  3N3H A;  4P02 B;  2GME A;  1SLC A;  3VD5 A;  3HD8 B;  1WW5 A;  3AC0 A;  3LDK A;  4RS5 A;  4TXW A;  2X29 A;  4WVM B;  2GP5 A;  2WUH A;  3CQO A;  3WW4 A;  4IES A;  4CEW A;  1GBG A;  2NN8 A;  2HKX A;  3O1U A;  3A22 A;  3M3O A;  2UWC A;  3H1W A;  4JGZ A;  2ZCW A;  4AFB A;  1W2A X;  5FYY A;  4O61 A;  4Q8L A;  1A3K A;  2DCZ A;  3KGL A;  4YM2 A;  5T5P A;  3IAP A;  5FZA A;  1RUC 2;  4DPN A;  1W8Z A;  4HLT A;  3AMN A;  1D7P M;  4AAP A;  1OFS A;  3BAL A;  3OGG A;  3MYX A;  1LGC A;  3ZXE A;  3KV5 A;  4LIT A;  4XUO A;  5EXO A;  1A6C A;  3BKZ A;  1VAK A;  3JD7 3;  3CZJ A;  4MZU A;  1PO1 3;  3FFQ A;  1URX A;  1XPW A;  3HWJ A;  1F35 A;  3I2J A;  4LOR A;  4COZ A;  4CZS A;  3T0D A;  2W91 A;  2WL1 A;  5A6Z A;  4UYB A;  4MGT A;  5DPN A;  5JCT A;  4I0B A;  3PTY A;  5KBF A;  2MNG A;  4JTO A;  1RUI 1;  1AYM 2;  4YZ3 A;  2K9Z A;  5FO9 B;  5LZ6 A;  2LW8 A;  2WO1 A;  3KV4 A;  1NT0 A;  3RGB A;  2X8K A;  1BZW A;  3WXP A;  1DHK B;  3HQU A;  3LA7 A;  4I0W B;  2XQR A;  4XTP A;  1SFP A;  4MXW A;  5FZH A;  2J1R A;  3VHR A;  1ALY A;  4HET A;  5GLZ A;  4AED B;  3IB3 A;  4ZON A;  5ACA 3;  3KHB A;  5GLV A;  3GHN A;  2JDZ A;  2UYB A;  4FVV A;  4PIZ A;  1LUL A;  3FLP A;  4I3P A;  1COV 2;  3RFR A;  3MF9 A;  5IYY A;  3U4X A;  4GWN A;  3PL0 A;  3NMB A;  5FYV A;  5ABJ A;  2FCV A;  2BNO A;  4WVZ A;  1DCS A;  5LAS A;  3BI3 A;  2W95 A;  1F5J A;  3EMR A;  4QDR A;  5A6Q A;  2X5I C;  3LSE A;  3LIG A;  1WD4 A;  5FY5 A;  4IEQ A;  1SLA A;  4FAG A;  1WKY A;  2KA3 A;  5CG8 A;  2V5D A;  2A71 A;  3ACL A;  5DG2 A;  2AH2 A;  2BOJ A;  5C9A C;  1OOP A;  2VZS A;  1XSR A;  1FXZ A;  1GZT A;  5GZF A;  4URT A;  3PIG A;  2J1A A;  4YNI A;  1XOY A;  1B35 A;  2XUM A;  1KGY A;  1W8W A;  3BYW A;  4OHW A;  2ORX A;  4R4Z A;  1AR6 3;  5FRE A;  5GAL A;  1GNZ A;  1MEC 1;  2BER A;  4LUM A;  1UZY A;  1SLT A;  1W2N A;  3EYP A;  1UYP A;  4LKS A;  2DUP A;  4NRP A;  4X6R B;  1MS0 A;  1EP0 A;  3KGZ A;  1YHF A;  3I3D A;  5LBB A;  1QH7 A;  3UL2 A;  3VZL A;  5BNN B;  4MX3 A;  4XHB A;  3WNN A;  3WR0 A;  3AK0 A;  1OQ1 A;  3INA A;  5LA0 A;  1IPJ A;  1D2S A;  3T2P A;  2JG8 A;  4IV3 A;  4XAE A;  4PIY A;  5F5I A;  4S2F A;  4CEY A;  1JYX A;  1MQT A;  1RVF 2;  2C0Z A;  3LFI A;  4E4S A;  4GH4 A;  5D8A B;  3WQ0 A;  1CZS A;  5A33 B;  1J3Q A;  1F2N A;  2ZAC A;  2FDI A;  2GU9 A;  3I2O A;  2I07 B;  5LK5 A;  1UYY A;  2QQK A;  3GJA A;  5H9Q A;  1A34 A;  2YG0 A;  3I4I A;  4B29 A;  1IOA A;  3K75 B;  4RQP C;  4P00 B;  2R7E B;  4HVQ A;  3EQE A;  3C2U A;  2LRP A;  5F39 A;  3FX3 A;  4S2G A;  1AXZ A;  2WSU A;  4CU6 A;  2VTF A;  2XL9 A;  2GP3 A;  2XOM A;  4W6X A;  2OKX A;  2BNM A;  3TN9 1;  3RZG A;  2XKO A;  3I2K A;  1J83 A;  3T30 A;  5GZD A;  5JSO A;  3VDC A;  4DFS A;  3CBN A;  3WNK A;  1OH4 A;  1F31 A;  2ZPX A;  3NQH A;  3ZDV A;  1MZE A;  3MFC A;  2HWE 2;  2F6B A;  5IW0 A;  3UGG A;  1OHF A;  5DAX A;  3N4M A;  1TQ5 A;  1VBB 3;  3WSO A;  4AR2 A;  2GN7 A;  3KQR A;  1RUD 1;  4EN6 B;  3LZZ A;  4IGO A;  5A32 A;  2YU2 A;  1ZRC A;  4QGL A;  2R16 A;  4XYX A;  4XBL A;  3BGA A;  4CXW A;  4LOT A;  4XZP A;  2BYV E;  4NHX A;  3U14 A;  4LHS A;  3WG2 A;  4K7J A;  1KFU L;  2X05 A;  2WII B;  3USU A;  1RUG 3;  1SBD A;  1W8O A;  4P9J A;  2XHK A;  3MIF A;  4BIO A;  3V0B B;  1HB1 A;  5FZF A;  1XBF A;  1VAV A;  4HG6 B;  1US2 A;  4MHU A;  5IK5 A;  3BTY A;  3WUD A;  1CAV B;  1WLD A;  2OXB A;  2R32 A;  3C7G A;  1RUE 1;  4UFK A;  4XFA A;  1KJL A;  5JMC A;  1AL0 G;  1ASJ 1;  1QJX 1;  2DUR A;  1GWK A;  2W3J A;  3OY8 B;  5ANQ A;  3B9I A;  5C8W A;  3RZK A;  1N1Y A;  1G8W A;  2VR4 A;  1HXS 3;  4UFM A;  5T52 A;  1PIV 3;  1R08 3;  4F7Z A;  1AUY A;  1Q5O A;  5FJK A;  1BMV 1;  2YYO A;  4QKF A;  1NAE A;  2PYT A;  1RUJ 1;  1S1A A;  5A1L A;  5LK7 B;  2D3S A;  2XG3 A;  4HT1 T;  5FK7 A;  2FMD A;  2Z2S B;  4OLL A;  1F5F A;  1H6Y A;  4BQ2 A;  3E5Q A;  2VBB A;  3EHK A;  3R4S A;  5J48 A;  4LK6 A;  5E1R A;  3MIH A;  2HWB 3;  3UKT A;  3O12 A;  2E51 A;  4MGK E;  3VBO B;  1AR6 2;  3J4U H;  4Y22 B;  3RNS A;  5IFT A;  1VRH 3;  2WWJ A;  4EN8 B;  4Q4X 1;  4LOS A;  1UMZ A;  4WM7 A;  2AUY A;  5DAQ A;  4COY A;  1JHN A;  4JV4 A;  4R52 A;  5BYN A;  4NRO A;  2B8M A;  3TNP B;  1YQ5 A;  4Y4R A;  2VAU A;  1DQ1 A;  1C57 A;  1H1M A;  2YFZ A;  1QWR A;  4QX2 A;  1QXJ A;  3ZXK A;  1LU1 A;  2BRT A;  2DDU A;  3B94 A;  1K42 A;  4X8P A;  4B7E A;  3DCQ A;  2GC1 A;  1LTE A;  4KWK A;  5JXI A;  5C8C B;  1SFY A;  1ZRI A;  5A3T A;  5A3N A;  3SCH A;  4YW2 A;  5A7O A;  2DU0 A;  2CSG A;  4YW6 A;  5JZG C;  2EIG A;  5F3C A;  1DFQ A;  2GH8 A;  2PHX A;  3GZT B;  1NA1 C;  3AZX A;  3R05 A;  3K46 A;  3ZPO A;  1S0F A;  2JEM A;  1L7R A;  4PDW C;  4E8D A;  1BLZ A;  4HPK B;  4I0A A;  4D8M A;  1G9B A;  1ULG A;  4URA A;  1AR7 2;  4BXS V;  2WQZ C;  1ND3 C;  5T5J A;  5FPX A;  5IK4 A;  1SFN A;  4LBQ A;  5F9T A;  3DV8 A;  3ZR6 A;  2X53 S;  4YVS C;  3I59 B;  5H9P A;  1KEX A;  2ET7 A;  1O5L A;  3TBD A;  3H1M A;  1ZA7 A;  2EXI A;  4LK7 A;  4BH9 A;  2Q8O A;  1COV 1;  4DO0 A;  1YFU A;  2W39 A;  2Z69 A;  1FYU A;  1GKB A;  2JDA A;  1QJY 3;  1AR8 2;  2V72 A;  4LJH A;  1KFX L;  4QX3 A;  3UGH A;  4BCU A;  4BQ3 A;  5FMO L;  2WT2 A;  3III A;  1NY7 2;  4MYE A;  3E1F 1;  1TMF 3;  2H6B A;  1E57 A;  1TNR A;  2VZU A;  2ZS6 B;  5JVV A;  3OGV A;  3CL1 A;  3ZFE A;  4RSU A;  2VGD A;  5IVY A;  2HWC 2;  4NRQ A;  3VBF A;  3POB A;  4XW3 A;  1S2E A;  1RMU 3;  5F2W A;  1ND2 B;  3LEM A;  1IKQ A;  1H8V A;  3VDD A;  4D6R A;  4Q4Y 3;  1UPI A;  2XB6 C;  3I3B A;  5EJZ B;  5K4L A;  2OPW A;  1RUF 1;  1DYO A;  4NHM A;  5FFO C;  5IT6 A;  4H2A A;  4HXC A;  4IND A;  1RUN A;  5HCH A;  1R08 2;  1OLM A;  4QPI C;  5JOZ A;  5L7O A;  2RS1 2;  4AED A;  2VU9 A;  1H8T C;  2OPK A;  2XVK A;  3POJ A;  3H1Y A;  3AZV A;  5HCF A;  5AFB A;  4P5Y A;  2WAB A;  1HJF A;  1PK6 C;  3H8U A;  3Q8C A;  4OMC A;  1PZ8 A;  3N35 A;  1YEW A;  5C4W C;  1JZ4 A;  1OI6 A;  3AXD A;  4XQ4 A;  1Q8P A;  1RB8 G;  4FPJ A;  4MH0 E;  1F15 A;  2YHJ A;  1WW7 A;  1OFN A;  1REF A;  3NJV A;  2VG9 A;  1KRI A;  5LBC A;  4OUE A;  2PA7 A;  1H9W A;  4RHV 2;  1GFF 2;  2PHW A;  4UOJ A;  2VMI A;  2CHH A;  1IG0 A;  2WR9 A;  2Z42 A;  3PUR A;  1JMU B;  4N53 C;  2GZW A;  4AQ6 A;  2QDN A;  3HJR A;  1RUH 3;  3VBS B;  1OVP A;  5EPA A;  2VZ1 A;  1W6N B;  1X9P A;  1XC6 A;  3CZU A;  4D7T A;  4YFZ A;  1UCX A;  2PFW A;  1RJ7 A;  3CU7 A;  4JGY B;  3K48 A;  3IDC B;  2UY8 A;  2B42 B;  3GBF A;  1NCR A;  2SLI A;  1D2Q A;  2ARB A;  2VQT A;  3JD7 1;  1FV2 A;  1S0G A;  2WQ4 A;  4M0H A;  1PO1 1;  3MIG A;  1DLC A;  1TG7 A;  2VNV A;  4NPR A;  4Y20 B;  3T09 A;  3AJZ A;  4BLI A;  2E7A A;  4OQ9 A;  2HWE 1;  2G9F A;  2ARE A;  4XEZ A;  3OYW B;  2IXI A;  5LB6 A;  5IK7 A;  2JDM A;  4OVE A;  2Y64 A;  3SXW A;  5GLU A;  4DZG A;  2H0V A;  5FZD A;  5DZG A;  4KNC A;  4LTA A;  1PNG A;  1YI9 A;  4NHL A;  3VBR A;  2WAA A;  4UW6 A;  4Z82 A;  3CJI B;  4B8E A;  1OLR A;  1W6Q B;  2GMM A;  5A3W A;  3THT A;  4FOW A;  4GQ7 A;  5KXB A;  3J26 N;  4L0P A;  4TTG A;  3B00 A;  2XHN A;  4LR4 A;  3H7Y A;  1CAW B;  2R30 A;  2ZGN A;  4NAM A;  1HRV 2;  1VMF A;  4EWA A;  1EV1 3;  4MLO A;  1UPS A;  1LJ7 A;  3N9P A;  3HR9 A;  2I45 A;  1QJY 2;  5J1X A;  5A7Q A;  1RUI 3;  2R1D A;  4L2N A;  4CYD A;  1N1V A;  2SBA A;  3S5Q A;  5BNO C;  5JZG B;  3VD4 A;  3H3U A;  1EUT A;  4DXT A;  1JYV A;  1UN1 A;  4JKM A;  3FBM A;  1QOO A;  5FY8 A;  5FZ3 A;  3MHZ A;  4KU8 A;  3FC0 A;  4ZXE A;  1YJL A;  3BVC A;  1OF3 A;  4NWW A;  1UWW A;  2DCY A;  4Y5Z 0;  3B9C A;  3VHP A;  2HEY F;  3WG3 A;  1RMU 2;  4BK5 A;  4RFR B;  1WLC A;  1LEN A;  1PVX A;  1K5M A;  2WO2 A;  3DYO A;  4Q4Y 2;  4YVS B;  1AX0 A;  1NCQ C;  1QJZ A;  5FV3 A;  5LRR A;  1AR6 1;  2ZHN A;  3VBH C;  1KD7 A;  4W6Y A;  1MVE A;  3U37 A;  1YQ8 A;  1YYN A;  5C5U A;  3AMM A;  5IAT A;  5KXE A;  1XE0 A;  4SBV A;  4FFH A;  3PUQ A;  3HNB M;  2JDN A;  4XE9 A;  2OUH A;  3FUO A;  5EZW A;  5A1A A;  3NKG A;  4LO8 A;  2WBK A;  4CEW B;  2JG9 C;  5DUU A;  4CP0 A;  2VMH A;  1MZ6 A;  2QDR A;  4XAC A;  3WVJ A;  1W6P A;  5IJR A;  2ZHK A;  3MDP A;  4OUS A;  3FHI B;  2W1U A;  2BP6 A;  3O1V A;  1R1Z A;  1J3R A;  4ZXK A;  1W0P A;  3J7N A;  1MEC 3;  1ZRF A;  3AMQ A;  2IVJ A;  2Y8K A;  4C90 A;  1CIY A;  1NLS A;  1O3R A;  3RG0 A;  2JJ6 A;  5BNP C;  2QQO A;  4IGP A;  1FMD 2;  4JCK A;  3IBM A;  4HBN A;  3ZKU A;  3WNO A;  1C4R A;  5AVA A;  3RZZ A;  1YQ2 A;  5FUP A;  1W8F A;  3ME2 A;  1PK6 B;  3T2T A;  1ODM A;  2GH2 A;  2HYK A;  1UZ0 A;  3PHM A;  4CPB D;  5FZE A;  3GZE A;  2PMW B;  3J8F 3;  3OF1 A;  1VR3 A;  3K4D A;  3CIH A;  2Q5T A;  4ZU5 A;  1W03 A;  4TWT A;  5FZM A;  4E27 A;  5C3P A;  2XWJ B;  5F2S A;  1ST8 A;  2GNB A;  4CP9 A;  1Y43 B;  3ZFF A;  1LOC A;  1JXN A;  3AFK A;  4TYS A;  3RMY A;  2BV4 A;  1PGS A;  2X5I A;  3FWE A;  1WMX A;  2P1B A;  4MXW B;  4P9W A;  2Y26 A;  2A6Y A;  3CLP A;  5CB7 A;  2OW4 A;  4BM8 A;  1ULE A;  5I0T A;  4A44 A;  1ENX A;  1AYN 3;  3UYJ A;  2FMY A;  3O7O A;  3N7L A;  4O7X A;  5C9A A;  1W6O A;  1MS4 A;  4J1X A;  2BBV A;  1YLL A;  5ABJ B;  1MAC A;  1GMM A;  1GOG A;  2JIG A;  5AC9 2;  4OI1 A;  1YQC A;  5FZG A;  5C33 A;  4LHK A;  1RUG 1;  2J1E A;  2WFF 2;  3POI A;  3UET A;  4EQV A;  2ZAA A;  4BK4 A;  4M4R A;  4CSW A;  2HWC 1;  2ZGO A;  4JDM A;  2YUE A;  3GAL A;  4FP2 A;  1NXM A;  1OPO A;  4Y24 A;  1LHO A;  2D97 A;  3AYD A;  4Q5O A;  1LOE A;  3USS A;  2ZHM A;  4O65 A;  1OOP B;  3UV9 A;  3WF3 A;  1SPP A;  1GSL A;  2C1F A;  2HBU A;  3OEB A;  4XET A;  3LDB A;  4IEO A;  1B35 B;  2YGM A;  4FFF A;  1HXS 1;  1G9A A;  1R08 1;  3WLU A;  1W9S A;  3ZYP A;  2RS1 1;  1XNA A;  2VCM A;  4N7U A;  1ENQ A;  3VDA A;  3S5A A;  2VOW A;  3WDT A;  3GJB A;  3GNE A;  1XQN A;  4QB6 A;  1JZ7 A;  4AEJ A;  1VBD 2;  5C7G A;  1AHS A;  1AVB A;  1ZRE A;  2ZGQ A;  5KC5 A;  1W28 A;  3DEC A;  2HWB 1;  1OQD A;  3WDW A;  1YXW A;  2Z4F A;  1S55 A;  4Y1V A;  3VD9 A;  2FBE A;  2QQI A;  3VD7 A;  2FCT A;  3NV1 A;  4RQP A;  1AR9 3;  4XDP A;  1LHW A;  1GAN A;  2R0F A;  2XGX A;  3Q8B A;  1QJX 3;  2GND A;  2JG8 B;  1J3P A;  2VOK A;  4IV3 B;  2W1Q A;  4MGI E;  2JB8 A;  2BTV C;  2PHR A;  1E5H A;  4CEY B;  3AKP A;  2R06 2;  5DUX A;  3E5X A;  4GH4 B;  4AE2 A;  3KF5 A;  3U78 A;  3UK9 A;  3ZSL A;  2IXL A;  4Q1R A;  1O8S A;  5CVR A;  1FAT A;  3O0X A;  3NNL A;  5FYM A;  4NPL A;  3OCP A;  5FRA A;  2B9U A;  1IG3 A;  4CRQ A;  2XR4 A;  4JTN A;  1YO8 A;  5J37 A;  1OKQ A;  3U0Z A;  1YJK A;  3KB5 A;  3ZFE C;  4TLG A;  3DEM A;  4YG6 A;  4H14 A;  5A7W A;  4MO3 M;  4A7Z A;  4DXS A;  1JZ2 A;  3VBU C;  3K77 A;  3BOW A;  4FPH A;  4EWD A;  4IV1 C;  1ULP A;  4HVO A;  1MS8 A;  3FMG A;  5FZC A;  5G05 L;  2Y38 A;  2DV9 A;  4HKO A;  5A7S A;  2B9V A;  4B4Q A;  2XXZ A;  1KS5 A;  4LPL A;  4NHY A;  4BZ4 A;  1CX4 A;  1IS6 A;  4QX7 A;  5DZE A;  2Q8D A;  5K7P A;  1RUC 3;  1ZM1 A;  3GHM A;  2O8O A;  1LCL A;  1JH5 A;  4GD4 A;  2JG9 B;  1YUD A;  3J8F 2;  3O5S A;  5DDJ 2;  5A32 B;  3RYP A;  5A6Y A;  5CIR A;  4LBM A;  4RN5 A;  2VC9 A;  2RS3 3;  5HI0 A;  5K9Y A;  5E8A A;  1PM4 A;  4DMI A;  3AP4 A;  3FL7 A;  1H4H A;  5JPM B;  3WP6 A;  3KV9 A;  1VBC 2;  3USU B;  4MG2 A;  3ACG A;  4FPO B;  2NQY A;  3MUZ 1;  4PI2 A;  4LO5 B;  4D7S A;  3BPS A;  4AG4 A;  2XVG A;  5BV6 A;  1N1S A;  3GGL A;  1QJY 1;  4LKE A;  3RQ0 A;  1GQH A;  5FYT A;  2RR1 2;  1AYM 3;  4FPE A;  5EFU A;  3OPW A;  3PVN A;  4HFS A;  3SH3 A;  3ZIW A;  2DVF A;  3ZSE A;  2ZX4 A;  4M0N A;  3RRD A;  5I8Y A;  3MID A;  4AI1 A;  4XUR A;  1H0B A;  3ZXJ A;  4W4Z A;  3THC A;  3A0N A;  3MW2 A;  4J25 A;  3WNP A;  2FDG A;  3KMH A;  4LBN A;  2WNU C;  5FZI A;  1RMU 1;  2YPJ A;  1XSQ A;  1LES A;  3D3A A;  3OYW A;  3N9Q A;  1KIT A;  4FTB A;  1ZRR A;  4PQQ A;  1OMI A;  4Q4Y 1;  3WEZ A;  1H30 A;  4NMI A;  1VMJ A;  4FQ4 A;  1CN1 A;  1WLT A;  5CAD A;  1RXF A;  5FLJ A;  4R8H A;  4I2O A;  2F4L A;  3HN1 A;  5H9S A;  1JZ6 A;  3MLJ A;  3H7J A;  4Q0S A;  5LA9 A;  3DF0 A;  1K45 A;  1RGS A;  1STM A;  1YFY A;  4BQX A;  4XJ9 A;  4YVW C;  1QJE A;  1GQG A;  3IN9 A;  1DQ4 A;  1JYC A;  2VBP A;  3JBG 2;  4RGA A;  3MW4 A;  4KI5 M;  4WM7 B;  4K1Z A;  4YM1 A;  4ZZ8 A;  1ZX5 A;  2HH9 A;  3T0B A;  3LD8 A;  3PU8 A;  1QEX A;  4BQ5 A;  4PLM A;  1POV 1;  1TME 3;  2CTV A;  2UUR A;  2BPA 2;  2EIE A;  1Y9Q A;  4XCA A;  1NA1 A;  1PGW 2;  1XXN A;  1S4C A;  4EZH A;  3QBQ A;  1LHN A;  2FZ1 A;  4PDW A;  1BVP 1;  4IQP A;  4XJZ A;  4AVC A;  1VAM A;  1GLH A;  1TVG A;  5GM0 A;  1ND3 A;  1PZ9 A;  2GMP A;  3AL5 A;  4LUK A;  4AI2 A;  2WDB A;  4Q0Q A;  1ZBA 2;  5F1R A;  3OBR A;  1RUH 1;  1XB9 A;  3JZV A;  1OUX A;  4YVS A;  4D0Q A;  1FX5 A;  1PGL 2;  1X36 A;  3MV0 1;  1TNF A;  2DUQ A;  3BU0 A;  5C71 A;  1FV3 A;  4Y1U A;  1EUU A;  4HSL A;  4AFC A;  4E2Q A;  1VB2 A;  1MZ5 A;  4NPM A;  4CDQ A;  2RJK A;  4QHO A;  1DZQ A;  1OLQ A;  1RIR A;  1XNT A;  1N3Q A;  4CU9 A;  4CCC A;  1RVF 3;  2BEO A;  4LBQ B;  5IVB A;  1K5M C;  5FZ0 A;  5SV5 A;  3WT3 A;  1PHM A;  2JEC A;  2TNF A;  3WW2 A;  3ACF A;  2QUO A;  3ES4 A;  3KCY A;  4A42 A;  2JD9 A;  1F9K A;  2XJQ A;  2J22 A;  5LA2 A;  1XU2 A;  3TEX A;  2XPJ A;  4D3W A;  1G9F A;  3SKV A;  5I93 A;  3WG4 A;  1X50 A;  4D6Q A;  2XJT A;  4D7Y A;  3DKW A;  5AC9 1;  4DS0 A;  2RS3 2;  4LXL A;  2D6K A;  5T55 A;  4UXA A;  2VUC A;  4BU2 A;  3UKN A;  5JOY A;  5LW9 A;  4ARY A;  2Q30 A;  1UYZ A;  2ZAB A;  3RI8 A;  4EYU A;  5FQ0 A;  4K9S A;  3QLQ A;  5APA A;  1UIK A;  2LUW A;  4QPI A;  2GC0 A;  3PME A;  3ZXL A;  3ZFE B;  4DRR A;  4YPJ A;  5C3O A;  3GCX A;  1H8T A;  2HWE 3;  1BJQ A;  1EV1 1;  1T2X A;  1EPW A;  3HNM A;  3J9S A;  3R6S A;  3RPQ A;  1PK6 A;  2IXJ A;  2WA3 A;  4LA3 A;  1QNY A;  4QD2 A;  4QU2 A;  4C1W A;  1NE6 A;  4FP3 A;  2ZX1 A;  5C4W A;  4BJ0 A;  2VVE A;  3DYP A;  3LF7 A;  3VDD B;  5LWB A;  2K2S A;  3GBW A;  4CCL A;  2VOT A;  1VB4 A;  2YZ4 A;  4AVS A;  2O1Q A;  2D5H A;  1UIJ A;  4D94 A;  1NZI A;  5L7O B;  1CON A;  4QKB A;  2E26 A;  4Y1Y A;  1C28 A;  1YI7 A;  2VD7 A;  4W8J A;  4A7Y A;  2ERF A;  4ASM B;  1VBD 1;  2CL2 A;  1TE1 B;  1QGL A;  3MLL A;  3AYE A;  2NM1 A;  3VZK A;  4UF0 A;  4B4R A;  4BQ4 A;  4DXZ A;  2UWB A;  1G9D A;  2IXC A;  4N53 A;  4KH9 A;  5FYZ A;  2NPI A;  2VO5 A;  1IPS A;  5GLW A;  3DGT A;  3NV4 A;  4DUX A;  3ZFF C;  5I0R A;  4YW5 A;  3QH6 A;  5J36 A;  2R04 2;  4PF1 A;  5DAP A;  3GF6 A;  5T3N A;  1W99 A;  5FZ8 A;  3VZM A;  2OS2 A;  1OSG A;  3V56 A;  3RDI A;  4B3N A;  2PQS A;  2WZE A;  3Q9O A;  1UXZ A;  2C26 A;  4GXL A;  4Y4Y A;  3WQ1 A;  4Y1X A;  1V6N A;  5GZG A;  1CQ9 A;  2YB7 A;  4Q26 A;  4QXC A;  1TME 2;  3ZR5 A;  3O1S A;  5IVF A;  1W90 A;  4N90 A;  3M70 A;  4RR3 C;  5JXG A;  4IEP A;  1R09 2;  2WNU B;  1E5S A;  1UMI A;  4V1P A;  2VW0 A;  5F6K A;  1DYK A;  2F4P A;  1Z78 A;  2VE1 A;  1GUI A;  3ETP A;  3LEI A;  4UI9 L;  4CP2 A;  4RA0 A;  2JDP A;  2KM2 A;  4RGK A;  1NCR B;  3TAY A;  1GOH A;  2QKD A;  5JIU A;  2Z5W A;  2UY9 A;  5DAB A;  3WIN E;  3H8O A;  3FHA A;  3PMS A;  5JDB A;  3KV6 A;  4W65 A;  1BHG A;  3N9M A;  3JB8 A;  2W87 A;  4IE4 A;  1FOD 3;  4P14 A;  4IE5 A;  4XUQ A;  3C3V A;  4K6B A;  1U5Y A;  3CMG A;  4YZ1 A;  1YIF A;  1VJ2 A;  1FNY A;  3J8F 1;  3P5B A;  4YM0 A;  3KQ4 B;  5GLT A;  1DG6 A;  3ILN A;  4M01 A;  1DQ5 A;  4YG0 A;  5FP4 A;  3VBR B;  2J1U A;  1O59 A;  2ETE A;  4OFG A;  1LR5 A;  5BNO A;  1PVC 3;  3PUH A;  5F5Q A;  5AVP A;  2QFE A;  1BK1 A;  1ZYB A;  4CCN A;  1N1T A;  4K21 A;  4JQR A;  4E4Z A;  1DBN A;  1AYN 1;  5DAW A;  1H1I A;  3T2O A;  2WIN B;  1V6J A;  4RGG A;  5FPB A;  2RR1 1;  1QOS A;  3WP3 A;  4LQR A;  1AR7 3;  2WNV C;  5JR7 B;  3I49 A;  3IDE A;  4OHZ A;  3WF4 A;  3HPN A;  1NCQ A;  4KQ7 A;  1GWL A;  4QQH A;  1NZC A;  3VBH A;  3O1P A;  2VZV A;  1J84 A;  4CPB A;  1ONA A;  1O7F A;  1REE A;  1WA4 A;  2W5F A;  3D5O A;  3HAG A;  1V9U 3;  4AVT A;  1C8N A;  3W21 A;  4D69 A;  4DNY A;  3S30 A;  4EJR A;  2Q1M A;  5DQ0 A;  5FMO S;  4BPZ A;  4CU8 A;  1JZ5 A;  2DFC A;  2FHR A;  2XON A;  3PLQ A;  4FPY A;  2JG9 A;  2VMF A;  1K5M B;  4JX0 A;  2ARC A;  1AR8 3;  3THD A;  2V4A A;  3H0O A;  4FFI A;  3M8L A;  4JKL A;  1UY4 A;  2BVB A;  4KU7 A;  4CU7 A;  1OKO A;  4AVB A;  2BUK A;  2WNE A;  2CU5 A;  2R0H A;  3JBG 1;  3ACH A;  5FUN A;  2LAL A;  3CEW A;  2E6V A;  4DRV A;  1QY4 A;  1XU1 A;  2VQU A;  2WWS A;  2HWC 3;  3C7E A;  2JDH A;  4XJA A;  5K0U C;  5FYB A;  3OUJ A;  4FQZ A;  5JSP A;  3EBR A;  1VBA 2;  3GCW A;  3K4Z A;  1V6K A;  3O14 A;  3SHR A;  1LOB A;  3D8C A;  3W5M A;  1AR9 1;  5BNP A;  5KR7 A;  1W6P B;  1WME A;  1PGW 1;  3LKJ A;  5FK8 A;  3VZJ A;  1LHV A;  4DEV A;  4G9S B;  4YW3 A;  5IAX A;  4G4F A;  5JXJ A;  5FXV A;  2RS1 3;  4FXG B;  4AW7 A;  2HWD 3;  2Q4S A;  5KHJ A;  4Q0V A;  1GQP A;  4Y3O A;  4FSJ A;  3IKW A;  2FQP A;  5JI7 A;  2P3J A;  3EJK A;  1PGL 1;  3ZVX A;  4OMD A;  1IPK A;  2JXA A;  2ZOE B;  1W0N A;  2B39 A;  1YCI A;  2H6C A;  1N47 A;  5FZB A;  2RV9 A;  3ZYI B;  2FZ2 A;  5FYS A;  4QQL A;  1UY0 A;  2EIC A;  2AR6 A;  1EYB A;  1WGP A;  3QCW A;  4MHR A;  1MS5 A;  2ATF A;  5DZF A;  1MS3 A;  1Z0H A;  2P37 A;  3WQB A;  4RHV 3;  2XLG A;  1Q8O A;  2JIJ A;  1WWY A;  1QMJ A;  3AJY A;  3AVS A;  3E6D A;  2ZGL A;  5FKC A;  3WP5 A;  3KD4 A;  2W92 A;  2VCC A;  4CP9 B;  4LKD A;  5D2A A;  5BNQ A;  2W1W A;  3ZFF B;  1C8M 3;  5C6C A;  1DGL A;  2X5I B;  2P17 A;  4CXX A;  4BIF A;  1FOD 2;  2D6P A;  3VZN A;  1RUC 1;  2P3K A;  3LGR A;  4IET A;  4AEK A;  1ZA4 A;  1Q8S A;  3O1O A;  3H42 B;  2BDR A;  3UT0 A;  5LA1 A;  2RS3 1;  2C9K A;  5CAZ A;  4DY3 A;  5C9A B;  2VXJ A;  1W6O B;  3ATG A;  4AGV A;  4OZO A;  2A6X A;  1PVC 2;  2JWP A;  3AB0 A;  2C6S A;  4CXY A;  2DYC A;  3WDV A;  1OUR A;  1M4W A;  3WW3 A;  4LHL A;  1BBT 2;  1LOD A;  3KVB A;  2BU9 A;  1L7L A;  3HOB A;  2IFW A;  1S0J A;  4QM9 A;  5HXV A;  1EAH 3;  2VNO A;  2HEV F;  3IIA A;  4AFD A;  2AYH A;  4A2U A;  1AYM 1;  4YRD A;  3D82 A;  2QCS B;  3DPR C;  3LEK A;  3POG A;  2HEW F;  2J42 A;  1SPP B;  1W05 A;  1QHD A;  2OT7 A;  4A3X A;  1UAI A;  4NHK A;  5F5C A;  5JAX A;  1D0G A;  1VMH A;  4ATF A;  2QVS B;  1OLM E;  1V9U 2;  5D1I A;  4B7K A;  5IAV A;  4OUL A;  5L9R A;  1TEI A;  2YY1 A;  1XND A;  4BXF A;  4CDQ C;  1QDC A;  1HRV 3;  2A73 B;  3HQX A;  3WNM A;  3ZXG A;  2JX9 A;  4ES9 A;  3OGS A;  3WOG A;  3AMP A;  5HBA A;  4KGG A;  2YMZ A;  5HXM A;  3KT4 A;  1W2U A;  3K3N A;  4RQP B;  2RS5 2;  3NNF A;  4CCK A;  4IW3 A;  4UBH A;  4LLF A;  1QDO A;  1VP6 A;  2P5B A;  3PDQ A;  5FPV A;  4QU1 A;  2D6O X;  3ZN6 B;  4M3C F;  1CAU A;  1HQL A;  4AL9 A;  3FUQ A;  3VBU A;  3RS6 A;  3LWC A;  1TME 1;  4IV1 A;  1HRI 2;  2ZGU A;  2B45 X;  5CKM A;  1R09 1;  3UKV A;  1JZ8 A;  3WDU A;  4LHN A;  4U36 A;  4GJY A;  4AFA A;  2PAK A;  1XJA A;  2ZJC A;  1SG3 A;  1EPZ A;  2QQL A;  4YZ2 A;  2JB4 A;  4N43 C;  2HWD 2;  5A7W B;  3PJY A;  3QD6 A;  3W9A A;  3NWK A;  4PQ9 A;  1UU5 A;  1ZZB A;  3M7A A;  4QWN A;  4GIQ A;  1QKQ A;  1FNZ A;  1AL2 3;  2ILM A;  4QHB A;  1SMV A;  1WCU A;  4HL0 A;  2Q1Z B;  1POV 3;  3N36 A;  5CU1 A;  4TN7 A;  1HJG A;  1DQ2 A;  5B4N A;  5IVE A;  2Y6F A;  4P9L A;  1NQD A;  2TUN A;  1RVF 1;  4MAD A;  4Q0P A;  3T4H B;  4AHY A;  5J09 A;  2KXL A;  2WO3 A;  4MUV A;  4DUW A;  2FDF A;  2IUW A;  3TRS B;  3NST A;  1J1L A;  3POY A;  1C8M 2;  3IT8 A;  5A3U A;  5A3P A;  1LKN A;  3L9J T;  3AP7 A;  2TEP A;  1FMD 3;  3C8X A;  3SH5 A;  4UW4 A;  1U5X A;  2WNU A;  2BQP A;  5ANN A;  1WCS A;  1ZBE 2;  2WQ8 A;  2D40 A;  2OYZ A;  4BOW A;  1NLR A;  1W9Y A;  3ABZ A;  5FUI A;  2GN3 A;  1L7Q A;  2VUA A;  3MO4 A;  2A5Z A;  3U1X A;  2YBS A;  3WNX A;  4UFI A;  4BHP A;  5FP3 A;  2DTW A;  1D4V B;  4IEW A;  4J6G A;  4IE7 A;  1X8M A;  1RIT A;  5F32 A;  4E9K A;  3T1M A;  1QQP 3;  3NJY A;  4TLF A;  4Z1V A;  4BWO A;  1LAJ A;  4AGR A;  1HV1 A;  1EAH 2;  1U12 A;  1SBE A;  2VZR A;  4YVW A;  4NII A;  5CFD C;  1VBE 3;  3OB8 A;  3DKQ A;  2JKB A;  1W8T A;  3HT1 A;  4OHX A;  4A45 A;  1S0C A;  2WA4 A;  4FFG A;  4XAB A;  5FY0 A;  5FIX A;  1PMI A;  3T2Q A;  2NMO A;  4Y5S A;  1CD3 G;  3ZFG A;  5FDB A;  2RDN A;  4OI2 A;  1PM7 A;  3D0J A;  4BLJ A;  5AC9 3;  2ZMK A;  2JKX A;  2WT1 A;  2ADE A;  2WFF 3;  3NAP C;  2DWR A;  3ZXD A;  1QJU 3;  2FD8 A;  1APN A;  1ZZC A;  4OYU A;  1QNW A;  1OH3 A;  4XTM A;  4L8Q A;  5E89 A;  1S0B A;  2RVA A;  4PF5 A;  1ULF A;  2AC1 A;  5L9B A;  3VN4 A;  1BVV A;  4KG8 A;  2PTM A;  2JE7 A;  3P3P A;  4X8N A;  1F4A A;  3ST7 A;  4XZU G;  4QDS A;  5JOX A;  1X33 A;  3HMY A;  1GU3 A;  2ORZ A;  4H7M A;  3NVC A;  2EIB A;  4QT6 A;  2VBD A;  4L92 A;  2E63 A;  3W58 A;  1HB4 A;  4FAH A;  1OD5 A;  1NA1 B;  1U0A A;  2G9Z A;  5GKA C;  1Z7S 2;  4EN0 A;  3RZM A;  4PDW B;  1OVS A;  2WYF A;  4UW3 A;  1QF3 A;  1ND3 B;  4QX0 A;  2V5Y A;  4R9C A;  3KWV A;  1VBD 3;  3EB7 A;  4Q4W 2;  4XBN A;  2HBT A;  3O0V A;  5FKB A;  3M3I A;  5FY9 A;  2CGN A;  4AWD A;  4JZR A;  5DAV A;  3N7K A;  4UFL A;  4AF9 A;  3HQR A;  1VAL A;  2YU1 A;  4FI9 A;  4HN0 A;  5FXZ A;  3AFG A;  4IL7 A;  3TOJ A;  4CDQ B;  3NRU A;  2W94 A;  2PHT A;  5LRS A;  5CG9 A;  2JEN A;  1XRU A;  1DGW A;  1WW4 A;  3ZN4 A;  4XVH A;  3WCS A;  4E4D X;  2R06 3;  4QQO A;  4NR1 A;  3AZY A;  3ZXF A;  2Q8E A;  3LQC A;  3MEP A;  2HWF 2;  3SH4 A;  1LOA A;  3LIH A;  4V2W A;  5CBL A;  1FOD 1;  2VQA A;  1AL2 2;  3I3E A;  3W20 A;  4LBL A;  3M4F A;  4XQD A;  3ZDS A;  4DY5 A;  2BW8 A;  3V64 A;  3M2M A;  1JUH A;  1IQD C;  4AI0 A;  5HCB A;  4E8C A;  5FO8 B;  4CDX A;  3JCI A;  4L9B A;  4CDU C;  2P3Y A;  2WN3 A;  1UU6 A;  2XBO 2;  1GP6 A;  2W52 A;  2OZJ A;  1PVC 1;  4EN9 B;  5LCW L;  1WA6 X;  4CTE A;  2VM9 A;  5AFE A;  1ULC A;  5FQ0 B;  3Q8A A;  1NQJ A;  3ZN5 A;  3CNA A;  4XBQ A;  4QMA A;  1D4M 2;  1W2O A;  3MIB A;  4QDQ A;  4QPI B;  4YGB A;  5I8T A;  3MF6 A;  2QQM A;  2Y0I A;  1H8T B;  3AP6 A;  1UQX A;  1AR7 1;  3FBY A;  4FPL A;  2ET1 A;  5FPZ A;  4FPK A;  1GYK A;  1QU0 A;  1UOG A;  5C4W B;  1GZ9 A;  1JUI A;  2ZKL A;  4P9X A;  5DDJ 3;  2B7Y A;  5G04 L;  4YGC A;  4DUV A;  3MGU A;  4MV2 A;  4JRL A;  3IDB B;  4GB3 3;  1RHI 2;  2IC1 A;  2BFU S;  1V9U 1;  2BZD A;  2VMC A;  2ARA A;  3FJS A;  4XJU A;  3IWZ A;  4KBB A;  4PJY A;  2W1S A;  1QQP 2;  4KBZ A;  1AJK A;  4J1W A;  4XF3 A;  2UU8 A;  4Z07 A;  5EWS A;  2XJS A;  3HEI A;  2Q8C A;  3U4S A;  1VBC 3;  5A3L A;  2D93 A;  4AI9 A;  2GC2 A;  4XCB A;  1VBE 2;  2MEV 2;  4LO6 B;  1G86 A;  1I5P A;  1W9T A;  1UO9 A;  1RTV A;  2X09 A;  1IS4 A;  2ZTN A;  2VZO A;  1AR8 1;  3AVR A;  4UF0 B;  4W50 A;  2RR1 3;  4MXV A;  2BNN A;  4N53 B;  3S0M A;  4FT8 A;  1ZVF A;  1NY7 1;  4XDO A;  2A3X A;  1BQP A;  4RR3 A;  3F95 A;  3ZYF A;  1XNK A;  2GNM A;  1DZR A;  4ONU A;  1QJU 2;  1UY3 A;  1IHM A;  1CWP A;  5IHR A;  4XF1 A;  3B02 A;  3FN9 A;  2CNA A;  3FFZ A;  4NWV A;  2DFB A;  3BU7 A;  5LY1 A;  3HBK A;  4YM3 A;  4KWU A;  1DLL A;  4R9A A;  2RDS A;  1BEV 3;  1C1L A;  1HRI 1;  1W0O A;  3BTA A;  4Y33 A;  3WHT A;  1ZZ6 A;  4COV A;  1RIN A;  5FOB B;  3V65 A;  2ZML A;  4KG0 A;  3U10 A;  4CDW C;  1UD1 A;  2Y6J A;  2W2I A;  5DMY A;  3ZM8 A;  4UAP A;  1ZZ7 A;  2DU1 A;  1V6M A;  2RJ2 A;  3MZH A;  4YW7 A;  2HWD 1;  2A3W A;  3I2F A;  3KCX A;  4K20 A;  2I74 A;  3JBG 3;  3MW3 A;  2EA7 A;  1VIW B;  5FZ4 A;  3IDA A;  3NKT A;  1DIW A;  1AX1 A;  5IVV A;  2G9G A;  1HW5 A;  3EXU A;  2VOX A;  4D6S A;  3IAQ A;  1OBN A;  5EHD A;  3LE0 A;  3WNL A;  3BIE A;  2GAL A;  4OZX A;  2JE9 A;  3IMM A;  2GNT A;  4AGG A;  5JLV A;  4RHV 1;  1OA2 A;  2B46 X;  2YBK A;  3ASI A;  1NE4 A;  3ZN6 A;  3B5L B;  2WNV A;  2QQJ A;  4WM8 C;  1WUV A;  2ENR A;  2V73 A;  1C8M 1;  2AGS A;  2XQX A;  5J98 B;  1ZBA 3;  5BNO B;  3LA3 A;  3A21 A;  2LM3 A;  3RI9 A;  5FPA A;  4FO9 A;  4Q29 A;  4K8F A;  3GDB A;  1R1A 3;  5D21 A;  4M3C B;  5E88 A;  1MZF A;  1NCQ B;  3OSD A;  1HN0 A;  3IMN A;  3SMH A;  2F17 A;  4DIN B;  4OQ8 A;  4XXA A;  1UY1 A;  3PNA A;  3VBH B;  5L36 A;  2Y60 A;  2RMU 3;  4M4P A;  1UMH A;  4N8M A;  1EAH 1;  4BB3 A;  1Y9G A;  1UKG A;  4M00 A;  1WCK A;  1JOJ A;  1NYW A;  1NKG A;  2VTX J;  5K0U A;  1GV9 A;  1UY2 A;  3SNM A;  5F6L B;  1DU3 D;  4IGQ A;  2X10 A;  4PLN A;  3D0S A;  4CCM A;  3B93 A;  4GB3 2;  3JQW A;  4LIV A;  2YPD A;  1N3O A;  2GAU A;  3AMH A;  3OPT A;  4COW A;  2ZA9 A;  3UES A;  4RYD A;  4OI4 A;  5FYH A;  1ULD A;  1HRV 1;  4OUM A;  4W6W A;  2QZ3 A;  3N7J A;  4ET7 A;  2PHU A;  3OUI A;  2BFU L;  4CUC A;  5IWF A;  1ODN A;  1GNH A;  2VMG A;  4O9E A;  2OA2 A;  3RYK A;  4LIU A;  4Z92 B;  2JD4 A;  2Y34 A;  1G6N A;  1Q3E A;  5EJ1 B;  3C7F A;  4C0H A;  5BNP B;  5HCA A;  4UFJ A;  5L73 A;  1VLN A;  1BXH A;  4A3Z A;  1Z7S 1;  4Z8B A;  1GZW A;  4ZS2 A;  1YFX A;  5EV7 A;  1DGR N;  4LO4 B;  4NIA A;  3T0A A;  3VKL A;  2XWB B;  3RMX A;  1O4Y A;  4DEQ A;  2FDK A;  3TEY A;  3VKN A;  1SEF A;  3LB9 A;  3WW1 A;  3PIJ A;  5HPO A;  2G1M A;  1BEV 2;  2VUL A;  4Q4W 1;  5FLI A;  5FZO B;  1FI2 A;  4XF9 A;  3ILF A;  3THP A;  1KDM A;  3ZO0 B;  4SLI A;  3H9A A;  4PT6 A;  2Z79 A;  2PAE A;  2ZKN A;  3FLT A;  1YIP A;  3VGI A;  1O3T A;  5F3E A;  4HN1 A;  4QB1 A;  3RJ2 X;  1A78 A;  2ARX A;  3PUA A;  2R04 3;  1IS5 A;  1UYX A;  4LMF A;  3J7L A;  5J7M A;  1P8J A;  3NL1 A;  1CR7 A;  4XHX A;  2QQW A;  5EQU A;  4AVV A;  4HAN A;  2JDU A;  4ITC A;  4UBG A;  2NLR A;  1AL2 1;  3LPG A;  3OJB A;  3WG1 A;  4LBK A;  1CZT A;  2QQV A;  3ZFG C;  4WVV A;  1XNC A;  2VVF A;  5A70 A;  5IVJ A;  1JU4 A;  1R09 3;  3S57 A;  2P2K A;  1RUD 2;  4H7L A;  2R6Q A;  5J96 B;  2XBO 1;  3DPR A;  4GAL A;  4JDO A;  4GMP 1;  5ISL A;  3CKH A;  2PN5 A;  1SCS A;  4IDZ A;  1Q56 A;  4QPW A;  3VB9 A;  1G7Y A;  1POV 0;  1KJR A;  1V6I A;  3PUS A;  1LNS A;  4AAX A;  4LBO A;  3DXU A;  1FMD 1;  3E5U A;  3LDR A;  4I09 A;  4AZZ A;  1OF4 A;  1U5I A;  1JHJ A;  1Q8V A;  2WKK A;  2YRO A;  3APB A;  2R07 2;  1OT5 A;  3MIC A;  3RWN A;  4TSV A;  5FXX A;  1ENS A;  2E32 A;  4K8R B;  5FZ6 A;  5D8A C;  1O8P A;  1RUE 2;  5BPX A;  3PTR B;  1R1A 2;  3AZW A;  3OBZ A;  1DP0 A;  4DIQ A;  2D6M A;  3Q8F A;  1YNA A;  2ID4 A;  4BE3 A;  1LOF C;  2RG4 A;  1DQ0 A;  2IXH A;  2CAU A;  1E5I A;  3H50 A;  1IS3 A;  1LHU A;  4ASK A;  1QQP 1;  3UJO A;  2WAO A;  2RMU 2;  3WHU A;  2CAV A;  4XFH A;  2CDP A;  4QX8 A;  2NZ9 A;  1RUJ 2;  2BGC A;  1VBE 1;  2MEV 1;  4MVT A;  2ZHL A;  2ZX0 A;  3M3Q A;  4JKK A;  2EAL A;  4WM8 B;  3U11 A;  1UXX X;  2DCT A;  1NLQ A;  2WWU A;  2Y0O A;  3POF A;  5FYI A;  3ZSM A;  2XUE A;  4PHZ A;  2ZZJ A;  1JW6 A;  2XJP A;  1BCX A;  5FZ7 A;  1OC1 A;  2IWG B;  5GZE A;  2WFF 1;  2NP0 A;  5LBF A;  1QJU 1;  1B09 A;  3CHX A;  2A3Y A;  1H4G A;  2VXR A;  3BB6 A;  4Q4X 2;  2AZ5 A;  3PJQ A;  5FZL A;  3WZ1 A;  3GYD A;  4AHW A;  3MFA A;  1AF9 A;  3AKR A;  5DXD A;  4A4A A;  3WCR A;  3S6P A;  3KT7 A;  4N43 A;  2ZAH A;  1CAU B;  1WCQ A;  1OPM A;  2W46 A;  4XJ8 A;  3VV1 A;  1HKD A;  4CDX C;  1F8V A;  4L99 A;  5E16 A;  3VBU B;  4IV1 B;  1H6X A;  5IVC A;  3PUI A;  1W8H A;  3N9O A;  4KWJ A;  1BKZ A;  1PMJ X;  3N7M A;  1OA4 A;  3EO6 A;  1OUS A;  2VTX A;  3I97 A;  3UGF A;  5K8S A;  5I0D A;  2DCK A;  2QJV A;  4AOC A;  2OQ7 A;  4XMI A;  1W04 A;  4R9D A;  5LBE A;  5T54 A;  2ZGM A;  3RVH A;  2DVD A;  3A0K A;  4XIL A;  2ZGS A;  3V0A A;  3POE A;  1WMD A;  1VBA 3;  3OBT A;  1V6L A;  5L9V A;  3R4U A;  4H3W A;  4NIG A;  2WZ8 A;  2E7Q A;  4S2H A;  3VHN A;  1CVN A;  2ZMN A;  1GZC A;  2BVV A;  3ZXA C;  4XF0 A;  1HIX A;  4JVA A;  4QAW A;  4Y26 A;  2FDJ A;  1ZZ8 A;  2K46 A;  3CDZ B;  1GIC A;  3VLB B;  4DXR A;  2C9A A;  4HKW A;  2R06 1;  3SLI A;  5FJH A;  1JU3 A;  1JBC A;  5JPN B;  5A3M A;  2A6V A;  2PQQ A;  4ZU7 A;  5I0U A;  4LO7 A;  3B01 A;  4NAO A;  3RJR A;  4MGY E;  3VBO C;  1HQW A;  2RDQ A;  1E5R A;  3IZO A;  1H9P A;  1IQA A;  1WCD J;  3D4K A;  3OTF A;  2VJX A;  4LA2 A;  2VVD A;  3S7E A;  3AX4 A;  2BGP A;  5CFD A;  3SEP A;  2YDE A;  1SBF A;  1JI6 A;  1V70 A;  1XYN A;  3HBZ A;  4M3C E;  1W39 A;  1VRB A;  4WZF A;  4XXP A;  3RZJ A;  5IFP A;  4QXB A;  3ZYG A;  3OD0 A;  4HKL A;  5JOW A;  3AYA A;  1US3 A;  4Y5T A;  1CJD A;  1O6U A;  3AKS A;  5SV8 A;  5JXH A;  2EXH A;  3I7D A;  3NAP A;  1HX6 A;  4DB5 A;  2FDH A;  5A7P A;  3IPV A;  4QPG C;  4YVW B;  2ES3 A;  4YG3 A;  3JQX A;  2ZBJ A;  5C8C C;  1HV0 A;  4ZPI A;  5DDJ 1;  1CPN A;  4HK8 A;  1QJF A;  3A23 A;  1RUF 2;  4GB3 1;  3A7Q A;  2WYS A;  5FWE A;  5C3R A;  2YBP A;  4KGQ A;  4XFC A;  3ZFG B;  1IGO A;  2VW1 A;  3J7H A;  5FPU A;  3BOP A;  1VBC 1;  2Q1F A;  4ATE A;  5T50 A;  1BBT 3;  2VZP A;  4N7I A;  4NUB A;  3RSJ A;  1DGR A;  3GM8 A;  3MPB A;  3ORJ A;  4I3G A;  3M1H A;  3ZYH A;  4OHY A;  1DF0 A;  3D6E A;  2G4I A;  4M3C A;  1YQ6 A;  3J7M A;  1J1T A;  2DUO A;  4FPF A;  1VPH A;  4QQP A;  3WV6 A;  4BA6 A;  4ZHN A;  3JU9 A;  3H8R A;  2BBA A;  3WY6 A;  2P4E A;  2Y6H A;  4LEJ A;  1I1E A;  1JZ3 A;  3I3M A;  2CDO A;  3RYR A;  3BN6 A;  4GA9 A;  4FCA A;  3LA2 A;  1BEV 1;  2OQ6 A;  3X29 B;  3CO2 A;  1UNB A;  1O5U A;  1C5I A;  1CJP A;  4CE8 A;  3P3N A;  4MGQ A;  4YSF A;  1JYW A;  5L19 A;  3OEA A;  4AI3 A;  4U2A A;  5CEH A;  4IUG A;  1J59 A;  3ES1 A;  4LBJ A;  1JS9 A;  5FZK A;  2KD7 A;  2RS5 3;  1OQE A;  1W9F A;  4GUL A;  1ND2 C;  4FOY A;  2D98 A;  1JOB A;  2W47 A;  4CDU A;  3LCP A;  3JD7 2;  4NIH A;  3M3E A;  3P1I A;  3KLS A;  1PO1 2;  3AZZ A;  3C7H A;  5CFC C;  4AHX A;  4NO4 A;  2V09 A;  4JQT A;  2WFP A;  1HRI 3;  1OXC A;  1K3I A;  1DGW X;  2J1S A;  5FWJ A;  4UFH A;  5T5L A;  3BUC A;  5A6X A;  4YW4 A;  5BY5 A;  3AL6 A;  1C1F A;  1BK0 A;  4HMZ A;  4CDX B;  1X8E A;  1FPN 3;  2O0O A;  4Q8K A;  1LRH A;  1ZBA 1;  2XJV A;  3BOD A;  3VL9 A;  5C5T A;  5FZO A;  5ACA 2;  2IXK A;  2BJS A;  2DF7 A;  4ISR A;  2R07 1;  5DG1 A;  4AEM A;  1QXR A;  2RJL A;  5BXX A;  3M3C A;  1F4H A;  1XE7 A;  3QH7 A;  4BDV B;  3FHQ A;  1R1A 1;  4JDN A;  5A1F A;  2WRA A;  3NO8 A;  1HLC A;  2O14 A;  4QHZ A;  4ZS3 A;  2IFR A;  2NYY A;  2YC4 A;  3ZPY A;  2PLV 3;  4AQ2 A;  1KS4 A;  1NXD 1;  3AXE A;  5FP8 A;  1YWK A;  2RMU 1;  3VBS C;  4L11 A;  3O1M A;  1LED A;  5DN2 A;  2YC0 A;  5FBJ A;  1AZD A;  5F8P A;  5F7U A;  3POS A;  4JGY C;  1H2M A;  5FOJ B;  5FMD A;  3JXS A;  2EF6 A;  1PX3 A;  1ZBE 3;  2A1X A;  4ZY9 A;  5JWP A;  1WBF A;  2WN2 A;  1G9C A;  3BTX A;  3SCF A;  2VEC A;  5JSR A;  3W59 A;  2TBV A;  4ERO A;  2QQN A;  3WF1 A;  4UW5 A;  5LEJ A;  1SLB A;  2AAC A;  2WS9 3;  4I30 A;  3MPP G;  4YGE A;  3ON7 A;  3WUC A;  4CDW A;  4CUB A;  4LLO A;  4RR3 B;  3L2Y A;  3VBF B;  3ELN A;  3ZMO A;  4KWL A;  5FY4 A;  1NX9 A;  2LS6 A;  1PO2 3; 
#chains in the Genus database with same CATH homology
 3PIG A;  4QHZ A;  3H3L A;  4JQT A;  3UGH A;  3ZR5 A;  3LFI A;  3IMM A;  3UGF A;  3LDR A;  2QQU A;  1Y4W A;  1W2T A;  5ANN A;  5FK8 A;  5FKC A;  3UGG A;  4UFH A;  2ADE A;  5FMC A;  3RWK X;  4UFM A;  5FKB A;  1Y9G A;  4AZZ A;  3U1X A;  4FFF A;  2QQW A;  4UFJ A;  2AEZ A;  3KF5 A;  2AC1 A;  3LDK A;  4UFI A;  3NMB A;  1UYP A;  4UFL A;  3OSD A;  3ZR6 A;  5FK7 A;  4FFI A;  3LEM A;  2AEY A;  2QQV A;  4FFH A;  5FMD A;  3U14 A;  4CCC A;  3KF3 A;  3LIG A;  4B1L A;  4CCD A;  4B1M A;  3PIJ A;  3S5Q A;  3LF7 A;  3SC7 X;  2ADD A;  4HXC A;  4EQV A;  5FMB A;  3LIH A;  4CCE A;  3U75 A;  4FFG A;  2OXB A;  4UFK A;  5FIX A;  3HBK A;  2XQR A;  1ST8 A;  1Y9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...