3NMBA

Crystal structure of a putative sugar hydrolase (bacova_03189) from bacteroides ovatus at 2.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
PSKVALSYSKSLKAPETDSLNLPVDENGYITIFDGETFNGWRGYGKDRVPTKWTIEDGCIKFNGSGGGEAQDGDGGDLIFAHKFKNFELELEWKVAKGSNSGILYLAQEVTSKDKDGNDVLEPIYISAPEYQILDNANHPDAKLGKDNNRQSASLYDMIPAVPQNSKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTDMLQASKFSEDKWPLAFELLNNCGGENHEGFIGLQDHGDDVWFRNIRVKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative sugar hydrolase
publication title Crystal structure of a putative sugar hydrolase (BACOVA_03189) from Bacteroides ovatus at 2.40 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Hydrolase
total genus 68
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3nmbA00
2QQUA 4CCEA 2ADDA 3PIJA 3IMMA 5FMCA 4FFIA 4UFHA 5FKCA 5FKBA 4UFJA 2AEYA 1Y9GA 1UYPA 4CCCA 3LIHA 3KF3A 3LIGA 3ZR5A 1Y9MA 3S5QA 5FMDA 3UGGA 2AC1A 4HXCA 1Y4WA 4B1LA 3PIGA 4CCDA 4UFMA 4FFGA 3U75A 3LDKA 2OXBA 3LEMA 3LFIA 4JQTA 4UFIA 3ZR6A 3KF5A 2QQVA 3OSDA 1ST8A 4FFHA 5FK7A 3SC7X 2ADEA 5FIXA 4UFKA 4EQVA 3NMBA 3UGFA 4FFFA 3U1XA 5FMBA 5ANNA 1W2TA 5FK8A 3UGHA 2XQRA 4UFLA 2AEZA 3H3LA 3U14A 2QQWA 3LDRA 3LF7A 4B1MA 3RWKX 3HBKA 4QHZA 4AZZA
chains in the Genus database with same CATH superfamily
1DGWX 2JG8C 5KHJA 2EALA 5F39A 2WNOA 3RMXA 2ZZQA 2OS2A 5FV3A 1YQ8A 1AYN3 1A34A 1YLLA 3IN9A 4CU7A 1CAVA 2X5IC 2IXIA 3T0BA 2GH2A 5BNPB 5HI0A 4ONUA 5HCFA 4NWVA 1MZ6A 3ZX7A 1S4CA 1QJZA 3MW4A 4HKWA 1S0GA 4RD7A 1L3JA 2PHXA 4OYUA 3D0JA 1CIWA 1WCQA 2UY8A 1BHGA 1LGCA 3HT2A 4CEWC 3VV1A 3WD5A 3PDQA 4XJUA 1OFNA 5FBZA 1GZWB 1K5MA 1OT5A 1LJ7A 1ZZ6A 3HN1A 3OBZA 4YVWA 3KQ4B 2WRAA 4QKNA 3BUCA 5D8AB 3U0ZA 2ERFA 3CIHA 1C57A 5IYYA 1SBDA 1OPOA 3B02A 1W6MB 3Q8EA 3ZR5A 1GNZA 1W06A 2WR9A 2ZGOA 4W4ZA 5FZGA 1C5IA 3J7MA 3HJRA 3MLLA 1VBE1 4DXTA 1SLCA 4LPLA 4AGVA 1NLRA 4QB6A 3O1PA 3URFA 1GWMA 1I3HA 1JYCA 3WNNA 1URXA 3LDKA 1SFPA 2VMDA 1MS3A 5T52A 5LCWL 3A4UA 3UV9A 4B3NA 3IDBB 5AC91 4WVMB 3BI3A 4AFBA 5AFBA 2GN7A 4N8MA 4NPMA 4D69A 1FXZA 1ND2B 5T5LA 1UIJA 4BPZA 3A22A 2AR6A 4XUTA 1XYPA 1AL22 2ADDA 3IPVB 2PHLA 4Y1XA 3S7IA 5LBCA 2QQOA 2AEYA 2NLRA 2UWBA 3EXUA 4JKMA 3DYPA 5FY9A 2BUKA 1CZVA 2LRPA 1A8DA 1O5LA 1UZZA 2P6HA 4PDWB 4X8NA 1VBE3 2JE9A 4UF0A 4CCJA 1CR7A 1ASJ2 2RS52 2XG3A 2HYXA 5DUWA 1W6PA 2VZ1A 4EROA 1HLCA 5AC93 2OZ6A 3MYXA 5JMOA 2ZS6B 5ISLA 4XZPA 4YM0A 2Y0OA 1AR72 4BQXA 1U5ZA 3VKOA 3ZYBA 1AR62 4JKLA 1GNYA 1HJGA 2J1RA 2YU2A 2JE8A 4PT6A 4CDXB 5LK7B 3ZDVA 4JRAA 3V0AA 2JD9A 4AEDA 2NMOA 1WLDA 5ABJA 3NAPC 4QKBA 1VRH1 5FO7B 2ORXA 2RM21 2GNDA 1WMEA 3LD8A 2VW0A 1OUSA 5JR7B 3ZSLA 4S2GA 2BOIA 1AR91 1PNGA 4K8RB 5DDJ2 1OA4A 2ZAAA 4A44A 1MS0A 1GOHA 1KJLA 2A75A 2R30A 3EHKA 4AHWA 4EWAA 4KBBA 2MNGA 4NPLA 1CAUA 4W65A 3USUA 1JMUB 2EXIA 3VHNA 1TEIA 1RUF1 2R042 4N53A 3NMBA 4FP2A 2EIDA 1YIFA 2WAAA 4FFFA 5F5QA 1CAWB 3WG1A 4E2SA 4LUMA 2J1AA 3I2KA 2QVSB 1BQPA 4FQZA 2RVAA 3O1RA 1DGWA 1ALYA 3BYWA 5FY5A 4QM8A 4QX3A 4RHV2 5DABA 5GM0A 2GMPA 4BA6A 2WAOA 1F5JA 1VRH3 1FMD2 1WCUA 4QDQA 2RM23 5E1RA 5FY1A 3VBUC 3A7QA 5FP9A 1MZ5A 5FPUA 3INAA 1TG7A 1S55A 4M4PA 1C1LA 1W39A 1W8TA 3FLPA 4OI1A 1AR93 1ULOA 4DUWA 4OI2A 1W3XA 3IKWA 4CDUA 4Y5SA 1W9YA 1K3IA 3AYAA 3BB6A 4KGQA 4MGZE 3VBRA 5C3SA 4AHZA 4B7EA 1UY3A 2DFBA 1RUF3 4ASLA 4QXHA 2VQTA 3H0OA 1AX0A 3MF9A 5ACA3 1DCSA 1RUJ2 2YBKA 3GGLA 3AMMA 5BNPC 1PGW1 3WUCA 1GP4A 2B45X 3M1HA 4HKOA 2HWF2 2OT7A 2WLPA 3ZFEA 5IAXA 1V6LA 1SDDB 3UNPA 1XSRA 4XFGA 2BRTA 3DECA 1PIV1 1X50A 1WMXA 4FXGB 2GC1A 2WO2A 2YHJA 3GYDA 2ZABA 3IT8A 4GAZA 1X9TA 2BJSA 2VZQA 2VMCA 4BXFA 2WLQA 4IE5A 1ST8A 1M4WA 5AFEA 1Q8VA 1F9KA 3J7NA 3K46A 4CXXA 3D4KA 5J48A 1GLHA 1HB1A 1UCXA 1S0CA 3FZ3A 4Z82A 4AEMA 1GWKA 3DYOA 4IEXA 4IERA 1IS6A 1GSLA 2K0GA 3WNKA 1VE0A 3H1MA 4E4HA 4CCMA 4GMP1 2R071 4GULA 1J3RA 2RDRA 4YW3A 1BEV2 5CFCB 1YFWA 3ITQA 3QH7A 4WM7B 4XF4A 3FBMA 2QBXA 2Y64A 3CDZB 5FZ1A 3QBQA 1TNRA 3R6SA 1LEMA 5SV5A 3DN7A 2B46X 4HFSA 4CDQC 4D7TA 1MQTB 1IS4A 1ZBE2 3GBGA 3MI8A 4QDRA 1F31A 4E9KA 4PDWC 2ATFA 3PTYA 3FHQA 3O12A 3N35A 4UYBA 1D0GA 2QCSB 2BZDA 1UL9A 4WVWA 1NE6A 2C9KA 3TRSB 5HCAA 4GMP3 1Z7S1 5FYUA 1KD7A 2Y6JA 3R0RA 3N7JA 3DXTA 4EZ4A 2Z4FA 4IV1A 1A6CA 1BBT2 1NXD1 1ND3A 1ULDA 2DURA 3E6DA 3Q8AA 4MVTA 5DQ0A 4CDXC 5C71A 3ZYFA 3A23A 1I9RA 3TOJA 3U78A 4H2AA 2D44A 1WZXA 2WINB 2WT2A 4RGGA 3RPQA 1AYM2 3ZXDA 3TAYA 2ZA9A 3H9AA 2DFCA 2I45A 3CEWA 1OOPA 4E8CA 3I8TA 4NIHA 4LOSA 2ZGTA 3AJYA 3PJQA 4YG6A 4R4XA 4BU2A 1LOCA 1WA4A 2YC2A 1DQ5A 1LODA 4UW5A 2XUEA 5T55A 5FOBB 3WP6A 1AL21 2PHWA 2VBDA 1NY72 4XF1A 1YCIA 2AACA 1J83A 5JXJA 1H2NA 2DBIA 2XOMA 3IM0A 4IGOA 3VBSA 4LEJA 5C5TA 3C7EA 1UX7A 3AB0A 4LK6A 2JG8A 3PIGA 4GIQA 4DEQA 4MHRA 4URTA 4GA9A 2RS51 4XUOA 2QDNA 3EJKA 5JOZA 1GU3A 1CZSA 5FMOS 4QWNA 2IC1A 3LA7A 5A3OA 2X5IA 2ADEA 4I0AA 4JX0A 4CEYC 1AR71 1W0NA 4ZS3A 1SLBA 4R9CA 1AR61 5LRRA 3DYMA 4Q26A 5H9PA 4B8EA 3O5SA 4FT8A 2PN5A 1LOBA 4LORA 1J3PA 2ZZJA 4AAXA 1AL23 1U5YA 4BQ4A 1ZZ9A 4K1YA 5A6QA 3BIWE 4CEWA 3OPZA 1EY2A 3BU7A 4LA2A 3ZVXA 4GALA 2G9ZA 3T4HB 3TEWA 4RR3C 4CCCA 1KJRA 5FAXA 5DDJ1 1NQJA 1W04A 3E1F1 5LASA 3WSOA 1ASJ3 2RS53 3E6CC 2W47A 2WIIB 3THTA 1VMFA 2ARBA 3ZFFB 4S2HA 1EUTA 2ZGUA 2R041 5A3MA 4IEOA 1AR73 2EXJA 2UURA 3VDDB 3RSJA 4AXOA 4EN8B 5JXIA 1AR63 1GR3A 1W9WA 1VAKA 2R49A 3ZSJA 1J84A 3LDRA 1UQXA 2BNOA 3PL0A 2GNMA 1BVP1 2DDUA 5APAA 1GOGA 1FMD1 5FLJA 4LBKA 2VMEA 5JMCA 5FUNA 1VBB2 2KD7A 2VQUA 4FOQA 2H0BA 2CY6A 1N3QA 1O91A 1WW6A 2UWCA 5DDJ3 1QNWA 5F3EA 1YUDA 4HMZA 5A32A 2VVDA 2PLV2 2ZMKA 3WHTA 1IKPA 2FHRA 3VKLA 5L7OC 1OMIA 1QOOA 5L19A 5FP4A 2R043 1ODMA 5LW9A 1DYOA 4WM7C 3NSTA 2DCTA 5T50A 1US3A 1D4M2 1MS8A 2CU5A 2IFWA 3IB3A 4AVBA 4ZPIA 5DZFA 5JI7A 1RUNA 1YFXA 2HWF1 4P9GA 4QXBA 4RA0A 3W59A 4RHV3 1MS4A 3P1IA 1JUIA 4LBMA 5LBFA 2AH2A 3WDUA 5IATA 3E5XA 4AQ6A 1LOAA 1JZ5A 1FMD3 1LULA 1EV12 1Z0HA 3OGJA 4CZSA 4Q4X2 1BJQA 4ZZ8A 2WQZC 1CVNA 1C3HA 1W6NA 1POQA 3DEMA 3NAPA 4MZUA 1HN0A 3JCIA 3OBAA 3VBHC 4K21A 5I8SA 4UI9L 1FPN2 1OUXA 3KCXA 1LHNA 2DUQA 2OW4A 4Y1ZA 4CDWB 4CCOA 1G86A 2GALA 1PK6C 5CZKA 2V5DA 4FFHA 4MHUA 1RUJ3 2W95A 3EB7A 3MPPG 4MX3A 1LR5A 4QPIB 5LY2A 2HWF3 1DLLA 3MBWA 3EO6A 2VQ0A 1NT0A 4QM9A 4WVVA 5A6ZA 3K3OA 4DEVA 3NKGA 4JDNA 4YFZA 1YI9A 1LOFC 3UT0A 4A45A 1BEV1 4BQYA 3AP6A 1VLNA 3OB8A 5FPZA 3ILNA 1NA1B 3PVBB 4FTEA 5L9VA 2E33A 1R1ZA 2W1UA 3VBUA 1YWKA 3POWA 5DG1A 3WF0A 4L9BA 5FQ0A 4FCAA 3H42B 1AJKA 2UY9A 3AZWA 2I07B 2ZGNA 1ZBE1 2B5HA 5FYTA 2GNTA 1PMHX 3IAPA 4FO9A 1RUOA 3HAGA 2D6KA 3NNLA 3AYDA 2HJIA 3WF2A 2A6XA 4TXWA 4HN0A 2A6YA 4DQAA 2WNUB 2BNNA 4P9YA 4L2NA 5TSWA 1W6QB 2XGXA 1UD1A 4FFIA 1BEV3 3M3IA 5FKCA 3HMYA 5T3NA 5GZCA 2ZGQA 4MGIE 4L8QA 3UGGA 1PO22 2BERA 2BBAA 1LHUA 4BM8A 4ET7A 4Q4V1 4BQ2A 1LKNA 1AYM1 3T4VA 1MZFA 1OQ1A 4DIQA 3ETPA 1QXPA 1XNBA 4I02A 1AR82 2PAMA 5FWEA 4ZHNA 3MLKA 3G7DA 4M3CF 1DQ4A 1ZBE3 2XLFA 4LBLA 4HK9A 4FPJA 3LGRA 4CP2A 1JU4A 2DCKA 4CRQA 4COVA 1OF4A 3SCHA 2ZEWA 4ARYA 2VM9A 1SLAA 4A2UA 4AR2A 4B4PA 3ZFFC 3RZMA 3KHCA 1REEA 3PU3A 4JHTA 1NY71 4JCKA 4XUNA 4BXSV 4DXSA 5FXWA 5DAXA 5A3TA 2EICA 5FLIA 5FZFA 5ERLA 5LEJA 4Z07A 4M3CB 2VOTA 1MVEA 3MIDA 4Q4V3 1X9PA 1UMIA 2G1MA 1AYM3 1O6UA 2VMHA 2B39A 3ZKYA 4CCDA 4ASMB 5A7WB 3TBDA 3KB5A 5BNOC 1C4RA 3I2OA 2ZMNA 2PHFA 5T54A 1S2EA 2BFUS 5CKNA 3HNMA 4PLOA 1KXGA 3OUIA 4BWOA 2GC3A 2QQLA 4HK8A 4F7ZA 5IW0A 2AEZA 3NNGA 4ITCA 4CDQA 1IGOA 2VBPA 3RWKX 4PDWA 1IPSA 2A3YA 2XDVA 2P1BA 2QQUA 1QU0A 5J1XA 2BP6A 1KQRA 4D8MA 2FDFA 2IUWA 4Z92B 1J1TA 2W1WA 5FMDA 1M06G 4PI2A 5BUVA 4BISA 1PVC2 1GP5A 1ZX5A 4INDA 2AYHA 3DKWA 5IVFA 4CDXA 2K2SA 4P5YA 4YARA 1CIYA 2FCVA 5GLWA 2Z69A 3ZXAC 1S0IA 5FYBA 3CQOA 5FZ3A 4GWIA 2JEMA 3W5MA 3O0VA 1RJ7A 3A21A 2JG9C 3M70A 4MH0E 1GV9A 2DVGA 4M0NA 5CG9A 4QB2A 4IV3C 4O7XA 1O3SA 2W87A 1RTVA 1DGRN 3H50A 1N1TA 5H9RA 2PHDA 2XXZA 1VBB1 3A0NA 1W8UA 3LA2A 4Q0QA 5DZGA 1XBFA 2P5BA 1ULEA 3J8F1 2JDPA 5F37A 1YEWA 3CJIB 2FDHA 2P3JA 2PLV1 2JICA 1K5JA 4N9HA 2D5FA 1OQEA 4OHZA 5JXGA 3N9QA 5KXCA 1W6OB 4CUGA 3DCQA 3H7JA 5DZEA 3LEKA 1NA1C 2YMZA 2XJVA 1D4M1 2RR12 3JU9A 2ZAHA 1MR5A 3WOGA 1VB2A 4C1WA 5IFPA 3GDBA 3GJAA 1VALA 3VHRA 1G9AA 1OH4A 4XMAA 4XYXA 4CEYA 4CU9A 2Y60A 4FBFA 4Z1VA 3RZJA 3N4MA 2A6ZA 4YW1A 1EV11 5C9AA 2R6QA 3B3QE 2Q1FA 4W50A 1VBB3 5FZ0A 3O1VA 2P3YA 4OULA 1KS4A 2OZJA 3GZUC 3LB9A 5DAVA 2RS12 2PLV3 2X05A 3LPFA 4J6GA 4RR3A 4XEZA 5LBBA 3OEBA 4LBOA 4LJHA 2Y33A 3ZSMA 3S6PA 2R1DA 5FY7A 4NIGA 1QXJA 3FFZA 5FIXA 3MPBA 1QGLA 2R7EB 4EWDA 1FI2A 3DXUA 4RL7A 1D4M3 3DGTA 2P37A 2R061 5IJRA 3AZVA 5A6XA 2GMMA 4QXCA 3VN4A 4N90A 2C1FA 2VNOA 1V9U1 4FPOB 4KU7A 3RZLA 1SLIA 3C3VA 2JJ6A 2XONA 2ZJCA 2JB8A 4CCKA 2X29A 1EV13 1D4VB 5A7OA 3I2DA 4B4QA 1MZEA 4Q4X3 2VMGA 3AP5A 5LBEA 4L99A 4KMQA 3RYPA 1NAEA 2B42B 3OY8A 2FZ1A 4PBPA 2WYSA 4DMIA 1UXZA 4RQPB 4OQ9A 2CGPA 5JAXA 4XILA 4LA3A 4XAAA 1G9DA 2YBSA 1GMMA 3UJQA 1SLLA 4JKKA 1AHSA 2WUHA 4XQDA 1POV0 3WG4A 4Q0SA 3ZXFA 4OHVA 5F32A 1XOYA 3DV8A 4BOWA 4YW6A 3AZZA 1KDMA 1XNDA 3CF6E 3HNYM 2OKXA 3U1XA 5J96B 5L7OA 4QPGB 4J25A 1S0BA 1SPPB 1REDA 3WF4A 5KC6A 4QQ2A 4WM7A 2VMFA 2D6LX 4PI0A 3R4UA 5DMYA 2ZEXA 3TEZA 5GLUA 4DUXA 1YQ2A 2I74A 4L0PA 4XFCA 2BV4A 5JR2A 2RDQA 1K45A 3CL1A 5FOJB 5JZGC 1EPWA 3FJSA 4NE9A 5FYCA 1PO21 3KM5A 3SH3A 2DTWA 4URAA 3U07A 2P3IA 5CNAA 3PUAA 4D7SA 5CAZA 3B5LB 3JD71 1AR81 5C5UA 4JQTA 2VXJA 3ZR6A 4CA9A 2BWAA 3VBHA 3HBZA 4JHZA 5G04L 1HN1A 3KV6A 4QQOA 1ZYBA 4L97A 4BQ1A 3GALA 1XNKA 4RN5A 1W0PA 1PK6A 4LO8A 5CKMA 1DQ0A 1YQCA 5KXDA 5GALA 2VR4A 1W8FA 3U11A 4I0WB 4B4RA 2Q30A 4TN7A 4I09A 1OH3A 3RYKA 2C0ZA 4LKDA 3ZFGA 4NOTA 4EYUA 2WZR2 1PIV2 2P17A 3LSDA 4COWA 1PO23 3GZAA 1QJFA 1LOFA 1UOFA 3HD8B 3FMGA 1ZRRA 3JD73 2YB7A 1ULCA 1AR83 2QZ2A 4JVAA 3V64A 2EIGA 2C26A 3M3EA 4A3XA 4AF9A 1H8TB 5FZBA 4TLGA 2RV9A 4EN6B 3MIEA 4Y5Z0 2OQ7A 1A3KA 3LFMA 4XJAA 3ZDSA 3SNMA 1W2UA 4FPGA 2OA2A 1VAMA 1N1SA 4MGYE 2BEOA 1PZ9A 5C4WC 2WQ8A 3I59B 3OUJA 3PUIA 5JPMB 1RUC2 2WO3A 2WBKA 2R072 4AE2A 4KH9A 1BK1A 5FYYA 3ZYPA 2EVXA 1DU3D 3IWZA 1PVC1 3VL9A 1H4HA 2D6OX 1B35B 2WNVB 2JX9A 5C8WA 1W8WA 3OD0A 4Q8LA 1CAXB 1S0EA 3IIIA 5A7PA 4EJRA 2XJPA 4TSVA 1YXWA 4IW3A 5C3RA 2ETEA 3T2QA 1J58A 1V70A 1JYWA 5A1AA 2ZKNA 3KGZA 3ZYGA 5FO9B 5LZ6A 2KM2A 1E5IA 1C8M1 3W9AA 1WD4A 3C7GA 5JOWA 4Y22A 2GZWA 4GWNA 2Y6GA 1Z7S2 2WYFA 3O1MA 2V72A 3K75B 5C6CA 1RITA 2W52A 1DG6A 2PHTA 1PVC3 3ZFFA 3WHUA 2EXHA 3CZJA 3FLRA 5EPAA 2A70A 3T08A 3GHNA 1GOFA 2AREA 1QDCA 1NXMA 3PMEA 2FQPA 2RS31 4IUGA 1ZREA 5DAWA 1OA3A 4FPLA 5T5OA 4LITA 4DFSA 1CPNA 4OLLA 3V56A 2LM3A 4Y5TA 1QDOA 1R091 2RR11 1JBCA 5BNOA 1AUYA 4XHBA 2RDSA 1U5XA 5FLHA 3DPRC 3JQWA 3S0MA 4ISRA 4XQ4A 4Y1VA 1PNFA 4QQPA 4Q27A 2PTMA 4IDZA 1ULFA 4WV8A 3S5AA 1LGBA 3D0SA 3M7AA 5FZIA 3NNMA 2D43A 4B1LA 2RS11 1VMJA 3Q8CA 3J7HA 3WQ0A 5L73A 3K51A 2RS33 2VCAA 1IS3A 3GZEA 3KMHA 2AZ5A 5LK5A 4N9IA 3T3YA 4D7YA 1R093 2RR13 4JQRA 4CP9A 5IHRA 3ILRA 2JDNA 1LHWA 4N43C 2E7AA 2CAUA 4XUPA 1NG0A 1W2AX 1CJPA 5J09A 3N9OA 1UKGA 5GJ6A 3WF3A 1UW8A 1H6YA 1N1YA 2J1VA 2VO5A 2XWBB 3H1YA 4M01A 2VW1A 4O9EA 5FKBA 4D3WA 2JG9A 4V2WA 4WZCA 2ES3A 2JDKA 1W90A 1CX4A 1H8VA 4IV3A 2RS13 4HONA 4CPBA 4DINB 2YV8A 4LHLA 4AGRA 4HN1A 4XBQA 2DTYA 1G9FA 1MVQA 2ENRA 3MIBA 4K3UA 1NKGA 1IKQA 3LEMA 3RNSA 2KA3A 1F8VA 1QH6A 3WG2A 1LU2A 2FCUA 2YPDA 2B8MA 4HKLA 3PVEA 2ZOEB 1OI6A 1I5PA 2W08A 2GP5A 4NRMA 1JH5A 1WBLA 3RMYA 1PVXA 1JOJA 2TUNA 2VOXA 4OUSA 4A7KA 1NA1A 3T30A 4FPCA 1H8TC 2DCJA 1ULGA 3LDBA 1YQ6A 2ET1A 2O8OA 1MS5A 1TMF1 4NHKA 5K0UB 5LA0A 1XYOA 2Q1MA 2VG9A 4P00B 1IQDC 2DCYA 3UK9A 3WDTA 1MEC1 1FYUA 4YLZA 3T2TA 4BYYA 1L7LA 4YW4A 5CBLA 5FZKA 2DVFA 1BYHA 2KR2A 1UU6A 1DGLA 3KF5A 1RHI1 5JSRA 4FSJA 1HIXA 4NWWA 1H2MA 2GAUA 4XC9A 1H9WA 5IVJA 4BK5A 2JXAA 3KS7A 4LLOA 5GZEA 4YPJA 5A3UA 3AM2A 1W2TA 2W1SA 1ENSA 2B9VA 2WNVC 2ZX0A 2WN2A 5FYMA 1L7RA 4AYUA 3H7YA 3HPNA 1JZ8A 3O7OA 1UX6A 2Y6FA 2IXKA 3OG2A 2F4PA 1QJX2 2XJRA 5FZ7A 1W3VA 3V0BB 4NJ4A 2E53A 4S2FA 1S1AA 2IZWA 1RXGA 2WZR1 4Q8KA 5LATA 4IQPA 3P6BA 3W5NA 3RZZA 1VBC2 1WWYA 2YDEA 3BOPA 3N7MA 5D8AC 3AP7A 4ES8A 1FNZA 1Y7BA 2IXJA 2PQQA 3CMGA 1WCSA 4E8DA 2VH9A 1S2KA 4YVSB 5KWRA 4LHNA 5CVRA 4A3ZA 5F8PA 3ZN6B 2HBTA 1UYXA 2ZEYA 5J98B 5KHHA 3JQXA 1SACA 3SCFA 3SEEA 1RUC1 3IBMA 3K48A 3CO2A 4OUMA 4LBQD 3KZ4C 3SISA 2WZR3 1PIV3 1VPHA 3KHBA 1ND2C 4C8DA 1ZBA2 2VUAA 1UY2A 4UW6A 5JZGA 2HWB1 1JODA 4MV2A 1SCRA 4UFIA 1COV2 4MGTA 4CUBA 3M8LA 4O61A 4KWLA 2HEYF 5HCHA 1DYKA 5FK8A 3I54A 2XHNA 4AVTA 2D3RA 2TBVA 4BLJA 1AX2A 4EN0A 5DG2A 4A6SA 1RUC3 3H8OA 1JUHA 2R073 3IDCB 4I0BA 3OJBA 3AMNA 4NRQA 3H1WA 4WBBA 4DZGA 4YNIA 1WLWA 2H0VA 3D3AA 3BOWA 3OYWB 4P9XA 1JXNA 5FYHA 5CIRA 5LA9A 3RJ2X 5A33B 3MICA 2F6BA 1GUIA 4KG0A 4Q4V2 3S30A 1VBD2 4BJ0A 3CU7A 3PU8A 2FCTA 1V6OA 3FHIB 4CYDA 5EIYB 4LIUA 3GXUA 1NCRB 4KNCA 3VKNA 1XU1A 4HOOA 1QXRA 1NQDA 3JBG2 4QQHA 5E8AA 4RSUA 1PX3A 3NW4A 1MACA 2GMEA 3ACLA 3C7FA 3NV1A 3AVRA 3H8UA 1OLME 1JHNA 3KT4A 2PQSA 4AZZA 1JYVA 2BVVA 1Z7S3 3GJBA 3OGSA 4RGAA 3WDVA 4AW7A 1X36A 5JI9A 5EV7A 4FPYA 4OMDA 2E7TA 3PTRB 2BPA2 1GZCA 4PIYA 3ON7A 3OF1A 3AP9A 1F15A 5C4WA 1XYNA 4Y1UA 2GDFA 4MXWA 3C7OA 4HANA 3WEZA 1XSQA 3ABZA 2D93A 3U10A 3UESA 5CFDB 2NM1A 5C3QA 3N7KA 4MGKE 3VBOB 2QQNA 4PLMA 1QHDA 4XQWA 5FK7A 2P3KA 4EQVA 4QDSA 3AKTA 4O9GA 1R64A 4D6QA 3N9PA 1ZZCA 1XE8A 4F3JA 4AFCA 1ENRA 1C5HA 2DBNA 3M2MA 4D6RA 4EZHA 2D97A 4XAEA 4AHYA 5IK7A 3DL3A 4CCEA 1RXFA 1PX4A 4UBGA 5IK5A 1ENXA 3AL6A 4LBQA 4RS5B 1QY4A 4Q4Y1 3BN6A 5KHKA 2YBPA 2XLGA 1AXZA 1YC61 1J3QA 2W0XA 3O0XA 2QQKA 5JWPA 3HR9A 4UFMA 4F8AA 1R1A2 4LTAA 4DO0A 4NMIA 3FN9A 5JOXA 4CU6A 2YC0A 1CAVB 3EQEA 2P34A 1NCQB 4DY3A 4CXWA 5KXEA 2VGDA 1LNSA 2XJUA 4G9SB 4PJYA 5F2WA 3P3PA 4HT1T 2VUJA 3N9LA 4NAMA 5K7PA 3ZYIB 1QH7A 3ZKUA 1CGPA 5FWJA 1IOAA 2HWE1 2NQYA 3HBKA 5KHGA 1H2LA 2J7MA 1AF9A 3PIJA 3AVSA 1UZ0A 4Y4RA 2Q8DA 5CISA 4Q4Y3 2H6CA 3B7MA 3DUIA 2WO1A 1K5MB 1YFUA 4Q2FA 4QPYA 3TYJA 4BLIA 3R4DB 4NHLA 3DPRA 3QH6A 4HSJA 5A6YA 1RUD1 1HB3A 2RJ2A 3J8F2 4MGQA 1VP6A 4LNVA 3AZXA 1PO11 1UOJA 1UU4A 1IG3A 4XABA 2BW8A 5GLZA 3K77A 3VKFC 2WO7A 1CPMA 3OUHA 3GM8A 4YYOA 4WZFA 3VD5A 4XF3A 5CFCC 2JKXA 2W3JA 3WNLA 3T2PA 4BMEA 2O8QA 1VJ2A 1FT9A 1O4ZA 4LKEA 1H6XA 2J42A 2HEWF 2WQ4A 2BGPA 2DVAA 4QGMA 4UWDA 2HWE3 4DRRA 5A3LA 2D5HA 1QJX1 1LCLA 2MEV1 5M0TA 5F3CA 1BK0A 1MQTC 2ZHMA 1R082 4O65A 3RS6A 4N43A 2ZHLA 2OPKA 4FXKB 5L36A 3DF0A 5C70A 5E6HA 1PMJX 2WWSA 4C91A 5I0TA 3NJVA 1VBC1 5IWFA 3MGUA 1DFQA 1O7FA 2OPWA 3D82A 1GQGA 2J1UA 2WS92 3VZOA 4XCBA 4E4DX 4XFIA 4BIOA 4UF0B 3WXPA 5JPNB 1GYKA 2SBAA 2BQPA 3UL2A 2BOJA 3I7DA 5FZOA 1W6PB 1JZ7A 5K4LA 4DS0A 2XB6C 2R062 1HV0A 3H3LA 5FPVA 3K4DA 5F2SA 2ZKLA 3WW4A 1V9U2 1QJX3 2MEV3 4IETA 5JCTA 1Q56A 4JZRA 5FZOB 4HPKA 5CU1A 4XFFA 4GWJA 3V65A 4HVOA 5C3PA 1WBFA 1OSGA 1LOEA 1UMZA 4Y20A 3V0AB 1YQ5A 1QOSA 1DP0A 3AZYA 1VMHA 3WW3A 1HX6A 3ZYRA 4NIIA 3ZXLA 5ABJB 1ZBA1 3M3QA 3GCXA 3FL7A 1VBC3 4B29A 4UW3A 2LTNA 3FE5A 1XJAA 4OZOA 5T5PA 3JB4C 4AI3A 2RMU1 2JENA 2R1BA 3QACA 1COV1 1WKYA 3AMPA 3POGA 4P5HA 4QPWA 5LRSA 4YZ1A 1X8MA 4TZDA 2ZBJA 4AEKA 3K4ZA 3O0WA 3FFQA 2JDMA 2EIEA 3POBA 1D2QA 2ZX4A 5CFDC 3A0KA 3LF7A 4BK4A 3NNJA 3B01A 5BNQA 1RC6A 2RHPA 2XL7A 4QD2A 4XDOA 3AFKA 1JU3A 1CESA 4YGCA 4XDQA 5F3IA 5BNPA 3OEAA 5I8YA 1DDLA 1W0OA 4WM8B 3WW2A 5FREA 1OPMA 5B4NA 1W2NA 1ZBA3 2AENA 3MV11 4H14A 3VZKA 3SITA 1VBD1 4AVSA 2IWGB 3AC0A 2Q4SA 3I2FA 2X8KA 3JD72 2CTVA 1COV3 4CDUB 3HQRA 1RMU2 1GZWA 5DXDA 1V00A 1N3PA 5D8AA 3JBG1 2C24A 3VBRB 3VZJA 2WZPP 2MPFA 1CONA 5FJKA 2V73A 1Q8PA 2BNMA 4GMP0 1UIKA 4HETA 4AK3A 3W58A 5AVAA 1NLQA 1W6MA 2P2KA 4W6XA 3MIHA 4ATEA 3VB9A 5FY4A 1NCQC 3IMMA 1LRHA 5FYSA 4XF0A 1E5RA 2GSYA 2VE1A 5F5CA 2WA3A 5CEHA 3VDDC 3ZFEB 1WW4A 3KWVA 3PVNA 1F4HA 1W99A 1PGL1 1EUUA 4WVMA 3ILFA 4P08A 3VHPA 1VBD3 4K7JA 4N7UA 1OURA 3KVBA 1SMVA 1XXNA 3IDEA 3NNFA 5JXHA 1ND2A 1D7PM 4NAOA 1SQ4A 1H9PA 4XFHA 3BIEA 4P14A 3JBG3 3AFGA 1FX5A 3KV4A 3IPVA 2Y0IA 3LZZA 1UU5A 2YXSA 1RUE2 2OUJA 4LT5A 3QOPA 4DB5A 1ZA4A 2P4EA 2D40A 4AQTA 3MW3A 3ACGA 2ZGPA 1F2NA 1NYWA 4Y33A 2R16A 3SH5A 3ZXJA 2QTWB 2VCCA 2WWJA 4YM3A 5A3PA 4FPFA 4EE2A 4M0HA 4Z2WA 3AKSA 4QHOA 4FAGA 1CD3G 1R1A1 4FPEA 5FP7A 1T6BX 3NL1A 1W05A 4YGDA 4ZU5A 4BMBA 4HVRA 5FPBA 4MYEA 4CE8A 1DQ6A 1ZRDA 5C33A 1Z78A 3K3NA 4HZFA 5JSPA 4CUCA 2CV6A 1ZVFA 2C9AA 3NO8A 3ZXEA 2K46A 1G8WA 3AMHA 1C8M2 4ZXKA 4COYA 3KLSA 1YRZA 4AG4A 5FDBA 3WCSA 4JDMA 1AVBA 4XOGA 4AFAA 4I3GA 1ENQA 4CDWC 3AXEA 2VW2A 4F83A 4QKFA 1NUKA 4P9IA 1VBA2 2PA7A 2Q0AA 3WT3A 4CSWA 4OQ8A 4TTGA 1SEFA 3VBFB 1ONAA 4KG8A 4QPIC 2D98A 1ZNPA 4FOWA 3WDXA 1R1A3 1W8OA 4IV1B 1ND3B 2GH8A 5FRAA 1CAWA 1JZ4A 1A8MA 2L9LA 2W9XA 3PUHA 4YW5A 5E88A 5FZAA 5B4XA 1CX1A 2CYFA 5FPXA 2RS32 4FPHA 1EAH2 1KDKA 4IE7A 4MADA 2VZTA 1YJLA 2EIBA 2ZX3A 3TEYA 1KFXL 4R8HA 1KRIA 3UGHA 1OOPB 1JTZX 1R092 2UU8A 5D21A 2WJSA 1JHJA 2WZ8A 4GWMA 3ZSKA 5FPAA 3QD6A 2W2IA 3ZMOA 2FZ2A 2HWC2 1QJY1 2VAUA 4QGNA 1HQWA 2VECA 3SXWA 2GP3A 3D6EA 1R081 1U0AA 1GICA 2IXHA 2YFZA 3MHZA 3ZIXA 4AI0A 3ZXGA 4M00A 3ZN5A 4LULA 3J8F3 3MFCA 2V5YA 4KL1A 2WNUC 3VBSB 2VXRA 4ZONA 1UKRA 1RUH1 2VPVA 4CVUA 2JG8B 3LFIA 2PXJA 2WS91 1U12A 2WFF1 2CWMA 4WM8C 1IPKA 1HJFA 3Q8BA 2QKDA 3HN3A 5GLVA 2DVDA 3ZOIA 2X5IB 1SZBA 1O8SA 3T1MA 3BPSA 2IFRA 1KS5A 2A7AA 4B7KA 1YI7A 2VZRA 3BVCA 4D6SA 1R083 4K9SA 1GZTA 1HDKA 1W8HA 1WCDJ 1UOBA 4YSFA 1NX9A 2WN3A 2Y6LA 3J9SA 4Y24A 3SH4A 2JD4A 4YM2A 5IK8A 1LGNA 4EN9B 2Q1ZB 5C3OA 4EV0A 4CEWB 3GBWA 3Q8FA 1AXKA 1A78A 3VHOA 4DPNA 1RUH3 2YU1A 2Z5WA 4XVHA 2VOWA 4Y1YA 2WS93 2PHUA 5J36A 3MZHA 1TE1B 3O1TA 4A7YA 5FMBA 1H1MA 3WW1A 1YHFA 4G3YC 1AL0G 1DF0A 4L92A 2R063 4XJWA 3RYRA 3WVJA 5F6LB 1OLMA 2VVEA 2DV9A 5CFCA 5A80A 4LOTA 5HV4A 1V9U3 3U37A 2C6SA 2W91A 2E6VA 3I3BA 1FNYA 2NZ9A 4MUVA 4YW2A 3WR0A 4GKYA 1UN1A 4MG2A 2XJSA 1V6NA 1FV2A 3NJYA 2XL9A 2J22A 1TMF2 2O0OA 2YYOA 5A1LA 1UZVA 1KITA 2YUEA 2WDBA 4R9DA 4GQ7A 5IVBA 2QDRA 1ZRCA 3POYA 2FMDA 1MQTA 2Y34A 4H55A 3LSEA 4H7LA 4FFGA 3ALQA 1MEC2 4LBJA 4V1PA 3ZO0B 4ATFA 3I3MA 3PHMA 4K1ZA 3OSDA 2QQVA 5KXBA 4HBNA 5A32B 4QU1A 1APNA 1RHI2 1RMU1 2VL4A 5L9RA 2OYZA 3VD4A 1XB9A 2A71A 4WVZA 3S57A 2BDRA 3MIFA 5ANNA 4NO4A 4QKDA 3NWKA 2VZ3A 4BH9A 1BMV1 5J7MA 3KCCA 3ACHA 4BQ5A 3VZNA 2ARAA 3OOXA 4QU2A 4E2GA 3ES4A 4OZXA 2BYVE 2HWD1 2TNFA 3FC0A 4XMIA 3RDIA 2G9FA 4IEYA 2QQJA 1WW5A 4Q0PA 3IZOA 4XJZA 3KV9A 1PMIA 1XNCA 5A3WA 4CTEA 3O1OA 2A6WA 2ZGMA 2ZGSA 4A6OA 1JN2P 5AVPA 2CHHA 2EAAA 3WP5A 4E4SA 2JDHA 1C8NA 4R4ZA 2VUCA 1W6NB 1H4GA 1QWRA 1UAIA 3I2GA 3NAPB 3C7HA 2ZGLA 1RMU3 5LEKA 2UYBA 4NHMA 4AVVA 5FZEA 3VBFC 1PM4A 1OLRA 2XJQA 3ACFA 3CJIC 3U14A 5JSOA 1RUE1 1UO9A 3X29B 5A1FA 3B93A 4P9LA 4XIOA 5FZLA 2CWSA 1O3TA 3I49A 1E57A 1O3QA 4GH4B 2IVIB 5CFDA 3RQ0A 1RIRA 4LUKA 2OX0A 3VDAA 1OHFA 5CB7A 1BCXA 1JS9A 1XU2A 4GD4A 2QFEA 2ORZA 4YZ4A 2DF7A 4COUA 4CPBD 5JIAA 4AAPA 2A6VA 3PLQA 4ZS2A 3L2HA 1AXYA 4X6QB 3VD9A 2VQAA 3ZYJB 5IAVA 4IESA 2HWB2 4Q4W1 4PF5A 4W6YA 5FTTC 3AYEA 5FQ0B 2VY0A 4N7IA 1MPXA 5FYVA 3WUDA 3ZLIA 2VZSA 4YW7A 3S7EA 4CUAA 1RUE3 1V6MA 5FY0A 4R9BA 1RUG2 3VD3A 1VRBA 2JIJA 3M3OA 3OD4A 1PHMA 5GZDA 1PGSA 3LA3A 2DCZA 1X33A 1Q8OA 4U2AA 2GC0A 5FZMA 3O14A 4IEVA 5F5AA 3K2OA 4CU8A 3APBA 4XE9A 1VBA1 1US2A 3RJRA 2HYKA 4XFAA 3AYCA 2ARXA 5IFTA 1NCQA 2JDUA 4PCRA 4C90A 4TYSA 1UZWA 1JOPA 3VDDA 1W8NA 4QQLA 2E31A 2Y38A 3RI8A 1W9FA 4LHKA 4XTMA 2ZX2A 3RWNA 1GKBA 2YGMA 1KEXA 4Q4W3 3THPA 4BCUA 1CWPA 1EAH1 1UZYA 3NV2A 3UGFA 2Z42A 4LO5B 4ZY9A 5JLVA 1PZ7A 2W94A 3MDPA 4RQPC 2DYCA 3E5UA 1C8M3 1JYIA 3DKQA 5K9YA 3W21A 1N47A 4PQQA 4GJZA 3WZ1A 2HWC1 1DBNA 4LE3A 2Q8CA 2JECA 4LQRA 1VBA3 5SV8A 1NOVA 4FOYA 3ZYHA 1Y9GA 4HVQA 3LIHA 2F4LA 3WG3A 4QPGC 3HEIA 4PIZA 1XQNA 1MS1A 5E89A 2H6BA 5A70A 5FBJA 2CGNA 3B94A 4CP1A 5C8CB 1EAH3 3WV6A 1OC1A 3KT7A 5FZ8A 2FBEA 3ECQA 1FV3A 1SG3A 3LKJA 2NN8A 3H8XA 1RUI2 4DNYA 3FLTA 2UWAA 5FP3A 2YG0A 4GB32 1SHWB 5EYXA 5I0DA 2HWC3 1MS9A 3ZN4A 1X8EA 2A73B 2R0FA 2PMWB 3VZLA 2JB4A 2J1EA 3WP4A 4CDQB 4BQ3A 1D2SA 4I3PA 3LE0A 4Q4Y2 3ZM8A 3ME2A 4UBHA 1UPIA 3VL8A 1LU1A 4KBZA 4CDWA 3WDWA 5FZ4A 4IXLA 1SFYA 5DAPA 4UOJA 5LA2A 2I2SA 3WNPA 4AHXA 2C5DA 4QHBA 2V4VA 1XC6A 4AEJA 1JOBA 4QPIA 5FZHA 4NR1A 4H3WA 1GQHA 4ES9A 2OVUA 1UF2C 1DQ2A 1C1FA 1V6JA 4MXVA 1IG0A 4NUBA 4CCNA 5JOYA 3LPGA 2FDKA 2K9ZA 4Y3OA 2X09A 3AK0A 4S2DA 1UYYA 3WQ7A 2QQWA 2VUDA 2ZHNA 3SKVA 4PBOA 2HWE2 1WD3A 2XMLA 5FZDA 4ORFA 4ZU7A 1WMDA 5FUIA 1OF3A 2DUOA 2Q8EA 3SQOA 4COZA 2W39A 4ZKTB 3G6JB 2Y6HA 4GXLA 4JAAA 5EHDA 1NZIA 1Y4WA 2JDZA 3KGLA 5JDBA 1RUD2 1YO8A 4QAWA 2CAVA 2C4XA 1PO12 4XJ9A 2WA4A 2EXKA 4GH4C 1Q5OA 1ZM1A 3J26N 4FVVA 2OXBA 3C8XA 4XF9A 2A1XA 3VKMA 1AZDA 2X10A 1FOD2 3NV4A 3AKPA 4HSLA 3PURA 4KWJA 2Y6KA 2XPJA 2PFWA 4YWAA 5ACA1 2WNUA 1DIWA 1S0JA 1W9TA 4BIFA 1ACCA 2XLAA 2W92A 1W6QA 1B35C 3R4SA 3KSCA 1OD3A 4QHZA 4WM8A 2NMNA 3USSA 2MEV2 1TZOA 1BXHA 3SKJE 1TMF3 1UYPA 5FMOL 3B9IA 3GZTB 1IQAA 4CEYB 5FZCA 1QOTA 2WT0A 3N36A 1Q3EA 2NPIA 1T2XA 1VB4A 4KGGA 4RFRB 5C9AB 1MEC3 1HXS2 3TB0A 4AWDA 5DN2A 2HBUA 2CGOA 1QMJA 3BALA 1AJOA 1G7YA 1LENA 1EYBA 1V6IA 2HLEA 3EYPA 3MLJA 1CZTA 3J4UH 5BNNB 1RHI3 1L7QA 2ZXQA 5H9SA 3SEPA 4KWUA 4P9WA 3BGAA 4RR3B 1O4YA 3MUZ1 1QIQA 2JDYA 1OVPA 2WWUA 3HQXA 3NJXA 4IL7A 4LR4A 4QMAA 4JDOA 4FOVA 4XFBA 4FTBA 1GZ9A 3VGIA 3POFA 1OVSA 4MGSA 1WCKA 5IVCA 4M3CA 3LEGA 1OD5A 2VNRA 4QX2A 2HH9A 3SLIA 1HKDA 2QZ3A 2XQXA 2XVGA 4MLOA 5A7WA 4LO6B 5LA1A 3BTZA 2VCBA 3BTYA 2VNVA 3IMNA 1RVF2 3OY8B 1JI6A 2VTXJ 4GKXA 4K40A 4K6BA 4JGZB 1HQNA 1KGYA 2YGLA 3HQUA 3PUQA 4KI5M 5I0UA 1OKQA 4QB1A 3T09A 4BB3A 2O14A 2RMU2 1S0DA 1B09A 3VUOA 4SLIA 3HNBM 4DRVA 4LLFA 2EF6A 2XVKA 4NIAA 3ST7A 4LO4B 4W6WA 1RUG1 1SBFA 1IHMA 4HLTA 5C8CC 5L7OB 4A42A 5KHIA 4XIKA 3POSA 4XZUG 3MV01 3ZPYA 1LAJA 5GZGA 4NHYA 4R52A 1K42A 4XBLA 4OUEA 1VAVA 2XH6A 5I0RA 3H3UA 4YG3A 3RGBA 3FX3A 1H30A 2VZOA 5D2AA 1HV1A 2BBVA 4ISQA 2HWB3 4LHSA 5I8TA 5BYNA 1DZTA 2VD7A 3ATGA 3CKHA 4J1WA 2GC2A 5L9BA 4Z2AA 1ZRFA 3HVDA 2YZ4A 4JGYB 2XKPA 5D1IA 2XJTA 3HOBA 4X8PA 5HXVA 1RUG3 2D3PA 3OTFA 3VBHB 5A3NA 4C0HA 2A3WA 3VBFA 3AP4A 2IVJA 5FMCA 3CJIA 1PK6B 1UY1A 3R05A 4IE4A 4AL9A 1O5UA 1G6NA 2VJXA 1LECA 1N1VA 1DHKB 5HXMA 3POEA 3KQRA 4JTNA 4MO3M 5EYYA 1W6OA 4Z8BA 1D0HA 3RI9A 1PGL2 1OLQA 3NJZA 3ZFGB 3OPTA 3NKTA 4XXAA 5KR7A 5IVYA 1ZZBA 2CDPA 1H1AA 1UOGA 1ODNA 2UYAA 3FHAA 1ZZ8A 1UY0A 5K0UC 2WABA 4OFGA 1HW5A 1LESA 3ZIWA 1F4AA 4C0BA 2G19A 1F5FA 1RUI1 2O1QA 4UFLA 1NE4A 3NRUA 3LWCA 4LBNA 4GB31 4GZ9A 1GNHA 3VBOC 1FAYA 3SHRA 4BDVB 1O4TA 5EXOA 3UETA 3HIFA 1YIPA 3THDA 1FATA 3POIA 3OBRA 4P9JA 5EZWA 2E7QA 2E51A 1ASJ1 3POJA 4LXLA 4OCTA 1W28A 5I93A 2VU9A 4AI8A 4LO7A 2D3SA 4FAHA 3GBFA 1GBGA 4XXPA 5T5JA 1TVGA 3O1SA 1ZRIA 2DUPA 4UXAA 3KT1A 4Q29A 1JZ3A 1DYPA 5JIUA 5C9AC 1XRUA 2SLIA 1RUI3 1RB8G 1Q8QA 1V6KA 4AVCA 1XE0A 2A5ZA 3BTAA 4CCLA 5IT6A 1OQDA 3RRDA 4GB33 2VBBA 4E4ZA 1I6XA 3ES1A 3MEPA 2DU0A 4L11A 5BNNC 4RQPA 3AKRA 4TWTA 4YVSC 1Q8SA 2R32A 1E5SA 3GCWA 2N7GA 2VOVA 1EP0A 4Y22B 2RJLA 3AX4A 4YVWB 2DU1A 3BU0A 3TN92 4RYDA 5A7SA 4IE6A 1QJEA 3WQ1A 2ZEZA 4UAPA 2WNEA 2FMYA 5FJHA 4PQ9A 1GP6A 3B69A 2XHKA 4QPGA 2QQPA 5J3UA 1FOD1 1CN1A 3OCPA 1OXCA 1SPPA 3ASIA 4QX5A 4FI9A 4Y26A 4KQ7A 4R9AA 1REFA 3MW2A 4A7ZA 4RHV1 1TQ5A 2VC9A 4JGZC 3EBRA 3H8RA 4K20A 2TEPA 4E27A 1HRI2 5BNOB 1W2OA 2MHFA 4YGEA 2VTFA 1AX1A 1QJY2 1QJU2 2R0HA 1X82A 2CSGA 4YFWA 1LTEA 5KC5A 4BQWA 2LROA 4E2QA 1SBEA 5ANQA 2BFUL 4ARXA 4EN7B 1RUD3 3OPWA 3WNXA 5FYIA 1HXS1 1PO13 4XPVA 4DUVA 3K4AA 2XUMA 1Y3TA 1RUH2 5CA6A 1FOD3 3SC7X 3U4XA 2WFF2 5IVVA 3CHXA 1RUJ1 4MOAA 5K8SA 1POV1 3I2JA 1GWLA 5FXVA 3PJYA 2VTXA 4QXKA 2FDGA 4B1MA 2CDOA 5F7UA 5BXXA 2D6MA 4JTOA 2WSVA 4FQ4A 4IEUA 4LIVA 1GFF2 1QQP2 3I4IA 3M3CA 4CP9B 1NCRC 3L2YA 3RZGA 2JDAA 4K8FA 1EPZA 3PVOA 3OBTA 3WY6A 4JGYC 4AI2A 2Q5TA 2NYYA 4AEDB 2J1TA 1T6GC 3LOIA 1H8TA 1HXS3 1RVF1 1UYZA 2AUYA 4XW3A 3WCRA 2JG9B 5HBAA 3E97A 1NZCA 3QCWA 4IV3B 2PAEA 2B4KA 4UW4A 3VDCA 5GZFA 2WKKA 3B00A 4D0QA 1POV3 4OHXA 3I59A 4XBNA 1H1IA 4GH4A 4GJYA 4AVAA 4DXRA 2LUWA 3AL5A 1CAUB 4I2OA 3ZFGC 2FD8A 3UKTA 3USUB 1RINA 4OVEA 4NROA 4N53B 5F3GA 3BTXA 1WLTA 4J1XA 1ULPA 5FPLA 3MF6A 4IE0A 1ZZ7A 2JE7A 5FFOC 2FDJA 1JW6A 1B35A 4UFHA 1XNTA 2WNVA 4AGGA 4ZZ5A 2KXLA 1CAXA 1TME2 3VDBA 1SCSA 4AI1A 5I91A 5FUPA 4XACA 3I3DA 1G9BA 2PHRA 1RVF3 1W9SA 5DUUA 3C2UA 3LOBA 1I1EA 2J1SA 5HCBA 3JUUA 3FUOA 4RS5C 1ZA7A 4Q0UA 2RMU3 2NP0A 3WQBA 2WZEA 4XTPA 5A7QA 1LHVA 1HRV2 2Y8KA 2WC2A 4NPRA 4RFT0 2FDIA 2W5FA 2B7YA 3CZUA 1BMV2 4Q1RA 5EWSA 5FZ6A 2YY1A 4NVPA 1XE7A 1JZ2A 2HWD2 2QJVA 1BBT1 2VZUA 2X53S 5I0SA 4G4FA 3O1UA 2OIIA 2XBO2 1Y9MA 2VULA 2EA7A 3UKNA 3AXDA 2RJKA 5HV0A 3ROUA 4XURA 3OGVA 5GKAC 3CNAA 4NHXA 1C28A 5IUQA 2Z79A 2BU9A 2LS6A 5FY8A 4PHZA 4U36A 1UMHA 1QKQA 2RDNA 1K5MC 5F5IA 4OHWA 4YVWC 2JWPA 5HPOA 1JYNA 2WSUA 1RGSA 4QT6A 2QNKA 1RJ8A 5EP9A 5EFUA 2DWRA 3ENRA 1XNAA 4IGQA 3VD7A 3BCWA 1S2BA 4DY5A 4D94A 3J7LA 3N9MA 1SFNA 4YGBA 3I2IA 2ZCWA 1BBT3 5J37A 3Q9OA 1LOGA 3RZKA 5DUXA 4JV4A 3JZVA 1AYN2 2ZACA 3M4FA 5JVVA 1GQPA 3CLPA 5C8CA 4QX1A 4ZU4A 3I3EA 5FR3A 1X7NA 4LKFA 2D6NA 1K12A 3VZMA 3U75A 1OBNA 4QX8A 4P02B 1U5IA 4Q5OA 4Q4W2 1HB2A 1BKZA 2CL2A 2QUOA 2W1QA 5JZGB 3WDYA 1IS5A 2CNAA 1DLCA 1VR3A 2QE3A 2RG4A 2ZGRA 4I30A 5KBFA 4Y4YA 1KFUL 4NRPA 2QQIA 4AQ2A 4FPKA 5F1RA 4XJ8A 3NV3A 2WT1A 4NN0A 4UT5A 5EJ1B 1XPWA 2XVLA 3GNEA 4IEWA 4M3CE 1HQLA 4QGLA 2Y26A 4DOUA 1JZ6A 3WLUA 2ZX1A 1Q43A 2WFPA 5F6KA 5CG8A 2AC1A 4YZ3A 5A7NA 3TN91 3TNQA 2W68A 4AOCA 4FTSA 2YFUA 4CP0A 5FYZA 3I2HA 4I01A 2ZPXA 1WA6X 3D8CA 2Q8OA 2IXLA 2RE9A 1LB2A 3L9JT 1V0AA 1YNAA 3HT1A 4AEDC 4EWEA 1YFYA 5ABJC 5IK4A 3AKQA 3I3QA 3TWIA 4A4AA 1G9CA 4ZXEA 2XWJB 5K0UA 2VOKA 2ARCA 3D5OA 3TNPB 2HEVF 4OI4A 3JB8A 1HRI1 3NQHA 5CADA 2HKXA 2A3XA 3CJXA 3MO4A 1QJU1 1PZ8A 4UFJA 5EJ3A 3FWEA 3PMSA 4XDPA 2VZPA 2ID4A 3LEIA 3TN93 3WNMA 4BZ4A 2E32A 1VBE2 1W8ZA 2BWCA 4N53C 4RGKA 3KCYA 4NIDA 1DZRA 3RG0A 5C4WB 5B2GB 4MXWB 2GNBA 1O3RA 2ZTNA 1TNFA 5LWBA 4IEPA 4OMCA 5GLTA 1DZQA 4ASKA 2D6PA 4M4RA 5AC92 1LHOA 2V4AA 1SDWA 3TEXA 5BY5A 2BGCA 2OUHA 1IPJA 2YROA 3V0BA 3FBYA 4LE4A 3E6BA 4AFDA 1J59A 4YZ5A 3FUQA 5IVEA 1HB4A 1UNBA 2AGSA 1HRI3 2LALA 4OI0A 3BODA 3LCPA 2V09A 4IGPA 1QQP1 3U4SA 1PM7A 1QJY3 4CDUC 4Q4X1 5JUVA 1QJU3 3N9NA 3BKZA 3W20A 3PUSA 3LIGA 2ZGKA 3S5QA 2OQ6A 3VBRC 2G4IA 2E26A 5BNNA 4LBQB 2P6CA 5FCCA 1FPN1 1GANA 3JXSA 4YVSA 2G9GA 2Z2SB 2PAKA 5FZ9A 1BLZA 3T0AA 5F9TA 3E5QA 3OGGA 2JKBA 3ZN6A 2WFF3 3KD4A 5CYYA 1Y9QA 2LW8A 4HL0A 3QLQA 3ZFEC 3CBNA 1YJKA 3ELNA 5FO8B 5DUVA 4AQSA 1O59A 3SCGA 3AJZA 4JRLA 1NLSA 4V2VA 3WINE 3WP3A 3ETQA 5LY1A 2QQMA 4C1XA 2ZMLA 1J1LA 1OKOA 1Y43B 4XCAA 4H7MA 3ZPOA 2VMIA 2W46A 4YG0A 4Q1PA 1QQP3 5BPXA 4A41A 1RL3A 1OFSA 1SLTA 3AMQA 4MSVA 1VRH2 3ZMNA 2GU9A 2RM22 1TME1 4JGZA 1RYYA 3MIGA 1CQ9A 4IEQA 2E63A 3T1LA 1AR92 3GF6A 1FPN3 3ZSEA 1VIWB 4JC1A 5FP8A 4BE3A 5C7GA 3PNAA 1UPSA 3LAGA 3N3HA 4META 3B9CA 3DPRB 3ZXKA 1CJDA 5EJZB 3KV5A 5H9QA 1RUF2 5LB6A 1W03A 2B9UA 4FP3A 5EQUA 3N7LA 4LKSA 3ACIA 5ACA2 3ORJA 2ZHKA 3T2OA 1H2KA 1HRV1 5G05L 4DXZA 3F95A 4LK7A 1JYTA 2ET7A 4YZ2A 2JIGA 3OYWA 5DAQA 3RZHA 5BV6A 2BGOA 5A33A 1WUVA 2PELA 3GHMA 3MUY1 1TME3 3P3NA 4XETA 3THCA 4BHPA 2GN3A 2XBO1 1BVVA 4QX7A 4CXYA 2F17A 3F2ZA 3UKVA 3T0DA 4PIXA 1WW7A 1NCRA 3H3ZA 4N43B 4TLFA 2DVBA 3WF1A 1H0BA 3WNOA 1UWWA 2BVBA 4OHYA 4JGYA 3UJOA 4IEZA 3KVAA 5DPNA 3MFAA 1WGPA 3VLBB 2YC4A 4YM1A 2VVFA 4PF1A 2E9QA 4UFKA 4KU8A 1HRV3 1PGW2 2ILMA 1O8PA 1IZ3A 1DGRA 1I5ZA 1P8JA 4LMFA 1UXXX 4XUQA 4XHXA 4IV1C 3OGRA 3UYJA 1UY4A 1ND3C 1BZWA 2VCMA 1N3OA 2PYTA 2XR4A 3WX5A 4HG6B 3IDAA 2WL1A 1YYNA 3HWJA 3P5BA 3I97A 4YRDA 5E16A 2HWD3 4Q0VA 3RVHA 1JYXA 2IXCA 3IIAA 1QEXA 4AI9A 3RFRA 4KWKA 3EMRA 2EAKA 1AYN1 1S0FA 2D7FA 2XBO3 3KF3A 4QX0A 1OOPC 1F35A 4HXCA 3VBOA 4HPKB 1E5HA 4X6RB 2XKOA 1WMFA 1STMA 4Y20B 4W8JA 1DQ1A 5FXZA 1QF3A 1WLCA 3BPZA 1QNYA 2VNGA 3VBUB 2YPJA 4SBVA 3SMHA 4RS5A 2BTVC 2VZVA 2XQRA 3NVCA 5FXXA 1LEDA 3IAQA 1OA2A 4PLNA 3VBSC 5CKQA 4AFMA 3LQCA
chains in the Genus database with same CATH topology
2QQUA 4CCEA 2ADDA 3PIJA 3IMMA 5FMCA 4FFIA 4UFHA 5FKCA 5FKBA 4UFJA 2AEYA 1Y9GA 1UYPA 4CCCA 3LIHA 3KF3A 3LIGA 3ZR5A 1Y9MA 3S5QA 5FMDA 3UGGA 2AC1A 4HXCA 1Y4WA 4B1LA 3PIGA 4CCDA 4UFMA 4FFGA 3U75A 3LDKA 2OXBA 3LEMA 3LFIA 4JQTA 4UFIA 3ZR6A 3KF5A 2QQVA 3OSDA 1ST8A 4FFHA 5FK7A 3SC7X 2ADEA 5FIXA 4UFKA 4EQVA 3NMBA 3UGFA 4FFFA 3U1XA 5FMBA 5ANNA 1W2TA 5FK8A 3UGHA 2XQRA 4UFLA 2AEZA 3H3LA 3U14A 2QQWA 3LDRA 3LF7A 4B1MA 3RWKX 3HBKA 4QHZA 4AZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQU A;  4CCE A;  2ADD A;  3PIJ A;  3IMM A;  5FMC A;  4FFI A;  4UFH A;  5FKC A;  5FKB A;  4UFJ A;  2AEY A;  1Y9G A;  1UYP A;  4CCC A;  3LIH A;  3KF3 A;  3LIG A;  3ZR5 A;  1Y9M A;  3S5Q A;  5FMD A;  3UGG A;  2AC1 A;  4HXC A;  1Y4W A;  4B1L A;  3PIG A;  4CCD A;  4UFM A;  4FFG A;  3U75 A;  3LDK A;  2OXB A;  3LEM A;  3LFI A;  4JQT A;  4UFI A;  3ZR6 A;  3KF5 A;  2QQV A;  3OSD A;  1ST8 A;  4FFH A;  5FK7 A;  3SC7 X;  2ADE A;  5FIX A;  4UFK A;  4EQV A;  3NMB A;  3UGF A;  4FFF A;  3U1X A;  5FMB A;  5ANN A;  1W2T A;  5FK8 A;  3UGH A;  2XQR A;  4UFL A;  2AEZ A;  3H3L A;  3U14 A;  2QQW A;  3LDR A;  3LF7 A;  4B1M A;  3RWK X;  3HBK A;  4QHZ A;  4AZZ A; 
#chains in the Genus database with same CATH topology
 1DGW X;  2JG8 C;  5KHJ A;  2EAL A;  5F39 A;  2WNO A;  3RMX A;  2ZZQ A;  2OS2 A;  5FV3 A;  1YQ8 A;  1AYN 3;  1A34 A;  1YLL A;  3IN9 A;  4CU7 A;  1CAV A;  2X5I C;  2IXI A;  3T0B A;  2GH2 A;  5BNP B;  5HI0 A;  4ONU A;  5HCF A;  4NWV A;  1MZ6 A;  3ZX7 A;  1S4C A;  1QJZ A;  3MW4 A;  4HKW A;  1S0G A;  4RD7 A;  1L3J A;  2PHX A;  4OYU A;  3D0J A;  1CIW A;  1WCQ A;  2UY8 A;  1BHG A;  1LGC A;  3HT2 A;  4CEW C;  3VV1 A;  3WD5 A;  3PDQ A;  4XJU A;  1OFN A;  5FBZ A;  1GZW B;  1K5M A;  1OT5 A;  1LJ7 A;  1ZZ6 A;  3HN1 A;  3OBZ A;  4YVW A;  3KQ4 B;  2WRA A;  4QKN A;  3BUC A;  5D8A B;  3U0Z A;  2ERF A;  3CIH A;  1C57 A;  5IYY A;  1SBD A;  1OPO A;  3B02 A;  1W6M B;  3Q8E A;  3ZR5 A;  1GNZ A;  1W06 A;  2WR9 A;  2ZGO A;  4W4Z A;  5FZG A;  1C5I A;  3J7M A;  3HJR A;  3MLL A;  1VBE 1;  4DXT A;  1SLC A;  4LPL A;  4AGV A;  1NLR A;  4QB6 A;  3O1P A;  3URF A;  1GWM A;  1I3H A;  1JYC A;  3WNN A;  1URX A;  3LDK A;  1SFP A;  2VMD A;  1MS3 A;  5T52 A;  5LCW L;  3A4U A;  3UV9 A;  4B3N A;  3IDB B;  5AC9 1;  4WVM B;  3BI3 A;  4AFB A;  5AFB A;  2GN7 A;  4N8M A;  4NPM A;  4D69 A;  1FXZ A;  1ND2 B;  5T5L A;  1UIJ A;  4BPZ A;  3A22 A;  2AR6 A;  4XUT A;  1XYP A;  1AL2 2;  2ADD A;  3IPV B;  2PHL A;  4Y1X A;  3S7I A;  5LBC A;  2QQO A;  2AEY A;  2NLR A;  2UWB A;  3EXU A;  4JKM A;  3DYP A;  5FY9 A;  2BUK A;  1CZV A;  2LRP A;  1A8D A;  1O5L A;  1UZZ A;  2P6H A;  4PDW B;  4X8N A;  1VBE 3;  2JE9 A;  4UF0 A;  4CCJ A;  1CR7 A;  1ASJ 2;  2RS5 2;  2XG3 A;  2HYX A;  5DUW A;  1W6P A;  2VZ1 A;  4ERO A;  1HLC A;  5AC9 3;  2OZ6 A;  3MYX A;  5JMO A;  2ZS6 B;  5ISL A;  4XZP A;  4YM0 A;  2Y0O A;  1AR7 2;  4BQX A;  1U5Z A;  3VKO A;  3ZYB A;  1AR6 2;  4JKL A;  1GNY A;  1HJG A;  2J1R A;  2YU2 A;  2JE8 A;  4PT6 A;  4CDX B;  5LK7 B;  3ZDV A;  4JRA A;  3V0A A;  2JD9 A;  4AED A;  2NMO A;  1WLD A;  5ABJ A;  3NAP C;  4QKB A;  1VRH 1;  5FO7 B;  2ORX A;  2RM2 1;  2GND A;  1WME A;  3LD8 A;  2VW0 A;  1OUS A;  5JR7 B;  3ZSL A;  4S2G A;  2BOI A;  1AR9 1;  1PNG A;  4K8R B;  5DDJ 2;  1OA4 A;  2ZAA A;  4A44 A;  1MS0 A;  1GOH A;  1KJL A;  2A75 A;  2R30 A;  3EHK A;  4AHW A;  4EWA A;  4KBB A;  2MNG A;  4NPL A;  1CAU A;  4W65 A;  3USU A;  1JMU B;  2EXI A;  3VHN A;  1TEI A;  1RUF 1;  2R04 2;  4N53 A;  3NMB A;  4FP2 A;  2EID A;  1YIF A;  2WAA A;  4FFF A;  5F5Q A;  1CAW B;  3WG1 A;  4E2S A;  4LUM A;  2J1A A;  3I2K A;  2QVS B;  1BQP A;  4FQZ A;  2RVA A;  3O1R A;  1DGW A;  1ALY A;  3BYW A;  5FY5 A;  4QM8 A;  4QX3 A;  4RHV 2;  5DAB A;  5GM0 A;  2GMP A;  4BA6 A;  2WAO A;  1F5J A;  1VRH 3;  1FMD 2;  1WCU A;  4QDQ A;  2RM2 3;  5E1R A;  5FY1 A;  3VBU C;  3A7Q A;  5FP9 A;  1MZ5 A;  5FPU A;  3INA A;  1TG7 A;  1S55 A;  4M4P A;  1C1L A;  1W39 A;  1W8T A;  3FLP A;  4OI1 A;  1AR9 3;  1ULO A;  4DUW A;  4OI2 A;  1W3X A;  3IKW A;  4CDU A;  4Y5S A;  1W9Y A;  1K3I A;  3AYA A;  3BB6 A;  4KGQ A;  4MGZ E;  3VBR A;  5C3S A;  4AHZ A;  4B7E A;  1UY3 A;  2DFB A;  1RUF 3;  4ASL A;  4QXH A;  2VQT A;  3H0O A;  1AX0 A;  3MF9 A;  5ACA 3;  1DCS A;  1RUJ 2;  2YBK A;  3GGL A;  3AMM A;  5BNP C;  1PGW 1;  3WUC A;  1GP4 A;  2B45 X;  3M1H A;  4HKO A;  2HWF 2;  2OT7 A;  2WLP A;  3ZFE A;  5IAX A;  1V6L A;  1SDD B;  3UNP A;  1XSR A;  4XFG A;  2BRT A;  3DEC A;  1PIV 1;  1X50 A;  1WMX A;  4FXG B;  2GC1 A;  2WO2 A;  2YHJ A;  3GYD A;  2ZAB A;  3IT8 A;  4GAZ A;  1X9T A;  2BJS A;  2VZQ A;  2VMC A;  4BXF A;  2WLQ A;  4IE5 A;  1ST8 A;  1M4W A;  5AFE A;  1Q8V A;  1F9K A;  3J7N A;  3K46 A;  4CXX A;  3D4K A;  5J48 A;  1GLH A;  1HB1 A;  1UCX A;  1S0C A;  3FZ3 A;  4Z82 A;  4AEM A;  1GWK A;  3DYO A;  4IEX A;  4IER A;  1IS6 A;  1GSL A;  2K0G A;  3WNK A;  1VE0 A;  3H1M A;  4E4H A;  4CCM A;  4GMP 1;  2R07 1;  4GUL A;  1J3R A;  2RDR A;  4YW3 A;  1BEV 2;  5CFC B;  1YFW A;  3ITQ A;  3QH7 A;  4WM7 B;  4XF4 A;  3FBM A;  2QBX A;  2Y64 A;  3CDZ B;  5FZ1 A;  3QBQ A;  1TNR A;  3R6S A;  1LEM A;  5SV5 A;  3DN7 A;  2B46 X;  4HFS A;  4CDQ C;  4D7T A;  1MQT B;  1IS4 A;  1ZBE 2;  3GBG A;  3MI8 A;  4QDR A;  1F31 A;  4E9K A;  4PDW C;  2ATF A;  3PTY A;  3FHQ A;  3O12 A;  3N35 A;  4UYB A;  1D0G A;  2QCS B;  2BZD A;  1UL9 A;  4WVW A;  1NE6 A;  2C9K A;  3TRS B;  5HCA A;  4GMP 3;  1Z7S 1;  5FYU A;  1KD7 A;  2Y6J A;  3R0R A;  3N7J A;  3DXT A;  4EZ4 A;  2Z4F A;  4IV1 A;  1A6C A;  1BBT 2;  1NXD 1;  1ND3 A;  1ULD A;  2DUR A;  3E6D A;  3Q8A A;  4MVT A;  5DQ0 A;  4CDX C;  5C71 A;  3ZYF A;  3A23 A;  1I9R A;  3TOJ A;  3U78 A;  4H2A A;  2D44 A;  1WZX A;  2WIN B;  2WT2 A;  4RGG A;  3RPQ A;  1AYM 2;  3ZXD A;  3TAY A;  2ZA9 A;  3H9A A;  2DFC A;  2I45 A;  3CEW A;  1OOP A;  4E8C A;  3I8T A;  4NIH A;  4LOS A;  2ZGT A;  3AJY A;  3PJQ A;  4YG6 A;  4R4X A;  4BU2 A;  1LOC A;  1WA4 A;  2YC2 A;  1DQ5 A;  1LOD A;  4UW5 A;  2XUE A;  5T55 A;  5FOB B;  3WP6 A;  1AL2 1;  2PHW A;  2VBD A;  1NY7 2;  4XF1 A;  1YCI A;  2AAC A;  1J83 A;  5JXJ A;  1H2N A;  2DBI A;  2XOM A;  3IM0 A;  4IGO A;  3VBS A;  4LEJ A;  5C5T A;  3C7E A;  1UX7 A;  3AB0 A;  4LK6 A;  2JG8 A;  3PIG A;  4GIQ A;  4DEQ A;  4MHR A;  4URT A;  4GA9 A;  2RS5 1;  4XUO A;  2QDN A;  3EJK A;  5JOZ A;  1GU3 A;  1CZS A;  5FMO S;  4QWN A;  2IC1 A;  3LA7 A;  5A3O A;  2X5I A;  2ADE A;  4I0A A;  4JX0 A;  4CEY C;  1AR7 1;  1W0N A;  4ZS3 A;  1SLB A;  4R9C A;  1AR6 1;  5LRR A;  3DYM A;  4Q26 A;  5H9P A;  4B8E A;  3O5S A;  4FT8 A;  2PN5 A;  1LOB A;  4LOR A;  1J3P A;  2ZZJ A;  4AAX A;  1AL2 3;  1U5Y A;  4BQ4 A;  1ZZ9 A;  4K1Y A;  5A6Q A;  3BIW E;  4CEW A;  3OPZ A;  1EY2 A;  3BU7 A;  4LA2 A;  3ZVX A;  4GAL A;  2G9Z A;  3T4H B;  3TEW A;  4RR3 C;  4CCC A;  1KJR A;  5FAX A;  5DDJ 1;  1NQJ A;  1W04 A;  3E1F 1;  5LAS A;  3WSO A;  1ASJ 3;  2RS5 3;  3E6C C;  2W47 A;  2WII B;  3THT A;  1VMF A;  2ARB A;  3ZFF B;  4S2H A;  1EUT A;  2ZGU A;  2R04 1;  5A3M A;  4IEO A;  1AR7 3;  2EXJ A;  2UUR A;  3VDD B;  3RSJ A;  4AXO A;  4EN8 B;  5JXI A;  1AR6 3;  1GR3 A;  1W9W A;  1VAK A;  2R49 A;  3ZSJ A;  1J84 A;  3LDR A;  1UQX A;  2BNO A;  3PL0 A;  2GNM A;  1BVP 1;  2DDU A;  5APA A;  1GOG A;  1FMD 1;  5FLJ A;  4LBK A;  2VME A;  5JMC A;  5FUN A;  1VBB 2;  2KD7 A;  2VQU A;  4FOQ A;  2H0B A;  2CY6 A;  1N3Q A;  1O91 A;  1WW6 A;  2UWC A;  5DDJ 3;  1QNW A;  5F3E A;  1YUD A;  4HMZ A;  5A32 A;  2VVD A;  2PLV 2;  2ZMK A;  3WHT A;  1IKP A;  2FHR A;  3VKL A;  5L7O C;  1OMI A;  1QOO A;  5L19 A;  5FP4 A;  2R04 3;  1ODM A;  5LW9 A;  1DYO A;  4WM7 C;  3NST A;  2DCT A;  5T50 A;  1US3 A;  1D4M 2;  1MS8 A;  2CU5 A;  2IFW A;  3IB3 A;  4AVB A;  4ZPI A;  5DZF A;  5JI7 A;  1RUN A;  1YFX A;  2HWF 1;  4P9G A;  4QXB A;  4RA0 A;  3W59 A;  4RHV 3;  1MS4 A;  3P1I A;  1JUI A;  4LBM A;  5LBF A;  2AH2 A;  3WDU A;  5IAT A;  3E5X A;  4AQ6 A;  1LOA A;  1JZ5 A;  1FMD 3;  1LUL A;  1EV1 2;  1Z0H A;  3OGJ A;  4CZS A;  4Q4X 2;  1BJQ A;  4ZZ8 A;  2WQZ C;  1CVN A;  1C3H A;  1W6N A;  1POQ A;  3DEM A;  3NAP A;  4MZU A;  1HN0 A;  3JCI A;  3OBA A;  3VBH C;  4K21 A;  5I8S A;  4UI9 L;  1FPN 2;  1OUX A;  3KCX A;  1LHN A;  2DUQ A;  2OW4 A;  4Y1Z A;  4CDW B;  4CCO A;  1G86 A;  2GAL A;  1PK6 C;  5CZK A;  2V5D A;  4FFH A;  4MHU A;  1RUJ 3;  2W95 A;  3EB7 A;  3MPP G;  4MX3 A;  1LR5 A;  4QPI B;  5LY2 A;  2HWF 3;  1DLL A;  3MBW A;  3EO6 A;  2VQ0 A;  1NT0 A;  4QM9 A;  4WVV A;  5A6Z A;  3K3O A;  4DEV A;  3NKG A;  4JDN A;  4YFZ A;  1YI9 A;  1LOF C;  3UT0 A;  4A45 A;  1BEV 1;  4BQY A;  3AP6 A;  1VLN A;  3OB8 A;  5FPZ A;  3ILN A;  1NA1 B;  3PVB B;  4FTE A;  5L9V A;  2E33 A;  1R1Z A;  2W1U A;  3VBU A;  1YWK A;  3POW A;  5DG1 A;  3WF0 A;  4L9B A;  5FQ0 A;  4FCA A;  3H42 B;  1AJK A;  2UY9 A;  3AZW A;  2I07 B;  2ZGN A;  1ZBE 1;  2B5H A;  5FYT A;  2GNT A;  1PMH X;  3IAP A;  4FO9 A;  1RUO A;  3HAG A;  2D6K A;  3NNL A;  3AYD A;  2HJI A;  3WF2 A;  2A6X A;  4TXW A;  4HN0 A;  2A6Y A;  4DQA A;  2WNU B;  2BNN A;  4P9Y A;  4L2N A;  5TSW A;  1W6Q B;  2XGX A;  1UD1 A;  4FFI A;  1BEV 3;  3M3I A;  5FKC A;  3HMY A;  5T3N A;  5GZC A;  2ZGQ A;  4MGI E;  4L8Q A;  3UGG A;  1PO2 2;  2BER A;  2BBA A;  1LHU A;  4BM8 A;  4ET7 A;  4Q4V 1;  4BQ2 A;  1LKN A;  1AYM 1;  3T4V A;  1MZF A;  1OQ1 A;  4DIQ A;  3ETP A;  1QXP A;  1XNB A;  4I02 A;  1AR8 2;  2PAM A;  5FWE A;  4ZHN A;  3MLK A;  3G7D A;  4M3C F;  1DQ4 A;  1ZBE 3;  2XLF A;  4LBL A;  4HK9 A;  4FPJ A;  3LGR A;  4CP2 A;  1JU4 A;  2DCK A;  4CRQ A;  4COV A;  1OF4 A;  3SCH A;  2ZEW A;  4ARY A;  2VM9 A;  1SLA A;  4A2U A;  4AR2 A;  4B4P A;  3ZFF C;  3RZM A;  3KHC A;  1REE A;  3PU3 A;  4JHT A;  1NY7 1;  4JCK A;  4XUN A;  4BXS V;  4DXS A;  5FXW A;  5DAX A;  5A3T A;  2EIC A;  5FLI A;  5FZF A;  5ERL A;  5LEJ A;  4Z07 A;  4M3C B;  2VOT A;  1MVE A;  3MID A;  4Q4V 3;  1X9P A;  1UMI A;  2G1M A;  1AYM 3;  1O6U A;  2VMH A;  2B39 A;  3ZKY A;  4CCD A;  4ASM B;  5A7W B;  3TBD A;  3KB5 A;  5BNO C;  1C4R A;  3I2O A;  2ZMN A;  2PHF A;  5T54 A;  1S2E A;  2BFU S;  5CKN A;  3HNM A;  4PLO A;  1KXG A;  3OUI A;  4BWO A;  2GC3 A;  2QQL A;  4HK8 A;  4F7Z A;  5IW0 A;  2AEZ A;  3NNG A;  4ITC A;  4CDQ A;  1IGO A;  2VBP A;  3RWK X;  4PDW A;  1IPS A;  2A3Y A;  2XDV A;  2P1B A;  2QQU A;  1QU0 A;  5J1X A;  2BP6 A;  1KQR A;  4D8M A;  2FDF A;  2IUW A;  4Z92 B;  1J1T A;  2W1W A;  5FMD A;  1M06 G;  4PI2 A;  5BUV A;  4BIS A;  1PVC 2;  1GP5 A;  1ZX5 A;  4IND A;  2AYH A;  3DKW A;  5IVF A;  4CDX A;  2K2S A;  4P5Y A;  4YAR A;  1CIY A;  2FCV A;  5GLW A;  2Z69 A;  3ZXA C;  1S0I A;  5FYB A;  3CQO A;  5FZ3 A;  4GWI A;  2JEM A;  3W5M A;  3O0V A;  1RJ7 A;  3A21 A;  2JG9 C;  3M70 A;  4MH0 E;  1GV9 A;  2DVG A;  4M0N A;  5CG9 A;  4QB2 A;  4IV3 C;  4O7X A;  1O3S A;  2W87 A;  1RTV A;  1DGR N;  3H50 A;  1N1T A;  5H9R A;  2PHD A;  2XXZ A;  1VBB 1;  3A0N A;  1W8U A;  3LA2 A;  4Q0Q A;  5DZG A;  1XBF A;  2P5B A;  1ULE A;  3J8F 1;  2JDP A;  5F37 A;  1YEW A;  3CJI B;  2FDH A;  2P3J A;  2PLV 1;  2JIC A;  1K5J A;  4N9H A;  2D5F A;  1OQE A;  4OHZ A;  5JXG A;  3N9Q A;  5KXC A;  1W6O B;  4CUG A;  3DCQ A;  3H7J A;  5DZE A;  3LEK A;  1NA1 C;  2YMZ A;  2XJV A;  1D4M 1;  2RR1 2;  3JU9 A;  2ZAH A;  1MR5 A;  3WOG A;  1VB2 A;  4C1W A;  5IFP A;  3GDB A;  3GJA A;  1VAL A;  3VHR A;  1G9A A;  1OH4 A;  4XMA A;  4XYX A;  4CEY A;  4CU9 A;  2Y60 A;  4FBF A;  4Z1V A;  3RZJ A;  3N4M A;  2A6Z A;  4YW1 A;  1EV1 1;  5C9A A;  2R6Q A;  3B3Q E;  2Q1F A;  4W50 A;  1VBB 3;  5FZ0 A;  3O1V A;  2P3Y A;  4OUL A;  1KS4 A;  2OZJ A;  3GZU C;  3LB9 A;  5DAV A;  2RS1 2;  2PLV 3;  2X05 A;  3LPF A;  4J6G A;  4RR3 A;  4XEZ A;  5LBB A;  3OEB A;  4LBO A;  4LJH A;  2Y33 A;  3ZSM A;  3S6P A;  2R1D A;  5FY7 A;  4NIG A;  1QXJ A;  3FFZ A;  5FIX A;  3MPB A;  1QGL A;  2R7E B;  4EWD A;  1FI2 A;  3DXU A;  4RL7 A;  1D4M 3;  3DGT A;  2P37 A;  2R06 1;  5IJR A;  3AZV A;  5A6X A;  2GMM A;  4QXC A;  3VN4 A;  4N90 A;  2C1F A;  2VNO A;  1V9U 1;  4FPO B;  4KU7 A;  3RZL A;  1SLI A;  3C3V A;  2JJ6 A;  2XON A;  2ZJC A;  2JB8 A;  4CCK A;  2X29 A;  1EV1 3;  1D4V B;  5A7O A;  3I2D A;  4B4Q A;  1MZE A;  4Q4X 3;  2VMG A;  3AP5 A;  5LBE A;  4L99 A;  4KMQ A;  3RYP A;  1NAE A;  2B42 B;  3OY8 A;  2FZ1 A;  4PBP A;  2WYS A;  4DMI A;  1UXZ A;  4RQP B;  4OQ9 A;  2CGP A;  5JAX A;  4XIL A;  4LA3 A;  4XAA A;  1G9D A;  2YBS A;  1GMM A;  3UJQ A;  1SLL A;  4JKK A;  1AHS A;  2WUH A;  4XQD A;  1POV 0;  3WG4 A;  4Q0S A;  3ZXF A;  4OHV A;  5F32 A;  1XOY A;  3DV8 A;  4BOW A;  4YW6 A;  3AZZ A;  1KDM A;  1XND A;  3CF6 E;  3HNY M;  2OKX A;  3U1X A;  5J96 B;  5L7O A;  4QPG B;  4J25 A;  1S0B A;  1SPP B;  1RED A;  3WF4 A;  5KC6 A;  4QQ2 A;  4WM7 A;  2VMF A;  2D6L X;  4PI0 A;  3R4U A;  5DMY A;  2ZEX A;  3TEZ A;  5GLU A;  4DUX A;  1YQ2 A;  2I74 A;  4L0P A;  4XFC A;  2BV4 A;  5JR2 A;  2RDQ A;  1K45 A;  3CL1 A;  5FOJ B;  5JZG C;  1EPW A;  3FJS A;  4NE9 A;  5FYC A;  1PO2 1;  3KM5 A;  3SH3 A;  2DTW A;  4URA A;  3U07 A;  2P3I A;  5CNA A;  3PUA A;  4D7S A;  5CAZ A;  3B5L B;  3JD7 1;  1AR8 1;  5C5U A;  4JQT A;  2VXJ A;  3ZR6 A;  4CA9 A;  2BWA A;  3VBH A;  3HBZ A;  4JHZ A;  5G04 L;  1HN1 A;  3KV6 A;  4QQO A;  1ZYB A;  4L97 A;  4BQ1 A;  3GAL A;  1XNK A;  4RN5 A;  1W0P A;  1PK6 A;  4LO8 A;  5CKM A;  1DQ0 A;  1YQC A;  5KXD A;  5GAL A;  2VR4 A;  1W8F A;  3U11 A;  4I0W B;  4B4R A;  2Q30 A;  4TN7 A;  4I09 A;  1OH3 A;  3RYK A;  2C0Z A;  4LKD A;  3ZFG A;  4NOT A;  4EYU A;  2WZR 2;  1PIV 2;  2P17 A;  3LSD A;  4COW A;  1PO2 3;  3GZA A;  1QJF A;  1LOF A;  1UOF A;  3HD8 B;  3FMG A;  1ZRR A;  3JD7 3;  2YB7 A;  1ULC A;  1AR8 3;  2QZ2 A;  4JVA A;  3V64 A;  2EIG A;  2C26 A;  3M3E A;  4A3X A;  4AF9 A;  1H8T B;  5FZB A;  4TLG A;  2RV9 A;  4EN6 B;  3MIE A;  4Y5Z 0;  2OQ7 A;  1A3K A;  3LFM A;  4XJA A;  3ZDS A;  3SNM A;  1W2U A;  4FPG A;  2OA2 A;  1VAM A;  1N1S A;  4MGY E;  2BEO A;  1PZ9 A;  5C4W C;  2WQ8 A;  3I59 B;  3OUJ A;  3PUI A;  5JPM B;  1RUC 2;  2WO3 A;  2WBK A;  2R07 2;  4AE2 A;  4KH9 A;  1BK1 A;  5FYY A;  3ZYP A;  2EVX A;  1DU3 D;  3IWZ A;  1PVC 1;  3VL9 A;  1H4H A;  2D6O X;  1B35 B;  2WNV B;  2JX9 A;  5C8W A;  1W8W A;  3OD0 A;  4Q8L A;  1CAX B;  1S0E A;  3III A;  5A7P A;  4EJR A;  2XJP A;  4TSV A;  1YXW A;  4IW3 A;  5C3R A;  2ETE A;  3T2Q A;  1J58 A;  1V70 A;  1JYW A;  5A1A A;  2ZKN A;  3KGZ A;  3ZYG A;  5FO9 B;  5LZ6 A;  2KM2 A;  1E5I A;  1C8M 1;  3W9A A;  1WD4 A;  3C7G A;  5JOW A;  4Y22 A;  2GZW A;  4GWN A;  2Y6G A;  1Z7S 2;  2WYF A;  3O1M A;  2V72 A;  3K75 B;  5C6C A;  1RIT A;  2W52 A;  1DG6 A;  2PHT A;  1PVC 3;  3ZFF A;  3WHU A;  2EXH A;  3CZJ A;  3FLR A;  5EPA A;  2A70 A;  3T08 A;  3GHN A;  1GOF A;  2ARE A;  1QDC A;  1NXM A;  3PME A;  2FQP A;  2RS3 1;  4IUG A;  1ZRE A;  5DAW A;  1OA3 A;  4FPL A;  5T5O A;  4LIT A;  4DFS A;  1CPN A;  4OLL A;  3V56 A;  2LM3 A;  4Y5T A;  1QDO A;  1R09 1;  2RR1 1;  1JBC A;  5BNO A;  1AUY A;  4XHB A;  2RDS A;  1U5X A;  5FLH A;  3DPR C;  3JQW A;  3S0M A;  4ISR A;  4XQ4 A;  4Y1V A;  1PNF A;  4QQP A;  4Q27 A;  2PTM A;  4IDZ A;  1ULF A;  4WV8 A;  3S5A A;  1LGB A;  3D0S A;  3M7A A;  5FZI A;  3NNM A;  2D43 A;  4B1L A;  2RS1 1;  1VMJ A;  3Q8C A;  3J7H A;  3WQ0 A;  5L73 A;  3K51 A;  2RS3 3;  2VCA A;  1IS3 A;  3GZE A;  3KMH A;  2AZ5 A;  5LK5 A;  4N9I A;  3T3Y A;  4D7Y A;  1R09 3;  2RR1 3;  4JQR A;  4CP9 A;  5IHR A;  3ILR A;  2JDN A;  1LHW A;  4N43 C;  2E7A A;  2CAU A;  4XUP A;  1NG0 A;  1W2A X;  1CJP A;  5J09 A;  3N9O A;  1UKG A;  5GJ6 A;  3WF3 A;  1UW8 A;  1H6Y A;  1N1Y A;  2J1V A;  2VO5 A;  2XWB B;  3H1Y A;  4M01 A;  2VW1 A;  4O9E A;  5FKB A;  4D3W A;  2JG9 A;  4V2W A;  4WZC A;  2ES3 A;  2JDK A;  1W90 A;  1CX4 A;  1H8V A;  4IV3 A;  2RS1 3;  4HON A;  4CPB A;  4DIN B;  2YV8 A;  4LHL A;  4AGR A;  4HN1 A;  4XBQ A;  2DTY A;  1G9F A;  1MVQ A;  2ENR A;  3MIB A;  4K3U A;  1NKG A;  1IKQ A;  3LEM A;  3RNS A;  2KA3 A;  1F8V A;  1QH6 A;  3WG2 A;  1LU2 A;  2FCU A;  2YPD A;  2B8M A;  4HKL A;  3PVE A;  2ZOE B;  1OI6 A;  1I5P A;  2W08 A;  2GP5 A;  4NRM A;  1JH5 A;  1WBL A;  3RMY A;  1PVX A;  1JOJ A;  2TUN A;  2VOX A;  4OUS A;  4A7K A;  1NA1 A;  3T30 A;  4FPC A;  1H8T C;  2DCJ A;  1ULG A;  3LDB A;  1YQ6 A;  2ET1 A;  2O8O A;  1MS5 A;  1TMF 1;  4NHK A;  5K0U B;  5LA0 A;  1XYO A;  2Q1M A;  2VG9 A;  4P00 B;  1IQD C;  2DCY A;  3UK9 A;  3WDT A;  1MEC 1;  1FYU A;  4YLZ A;  3T2T A;  4BYY A;  1L7L A;  4YW4 A;  5CBL A;  5FZK A;  2DVF A;  1BYH A;  2KR2 A;  1UU6 A;  1DGL A;  3KF5 A;  1RHI 1;  5JSR A;  4FSJ A;  1HIX A;  4NWW A;  1H2M A;  2GAU A;  4XC9 A;  1H9W A;  5IVJ A;  4BK5 A;  2JXA A;  3KS7 A;  4LLO A;  5GZE A;  4YPJ A;  5A3U A;  3AM2 A;  1W2T A;  2W1S A;  1ENS A;  2B9V A;  2WNV C;  2ZX0 A;  2WN2 A;  5FYM A;  1L7R A;  4AYU A;  3H7Y A;  3HPN A;  1JZ8 A;  3O7O A;  1UX6 A;  2Y6F A;  2IXK A;  3OG2 A;  2F4P A;  1QJX 2;  2XJR A;  5FZ7 A;  1W3V A;  3V0B B;  4NJ4 A;  2E53 A;  4S2F A;  1S1A A;  2IZW A;  1RXG A;  2WZR 1;  4Q8K A;  5LAT A;  4IQP A;  3P6B A;  3W5N A;  3RZZ A;  1VBC 2;  1WWY A;  2YDE A;  3BOP A;  3N7M A;  5D8A C;  3AP7 A;  4ES8 A;  1FNZ A;  1Y7B A;  2IXJ A;  2PQQ A;  3CMG A;  1WCS A;  4E8D A;  2VH9 A;  1S2K A;  4YVS B;  5KWR A;  4LHN A;  5CVR A;  4A3Z A;  5F8P A;  3ZN6 B;  2HBT A;  1UYX A;  2ZEY A;  5J98 B;  5KHH A;  3JQX A;  1SAC A;  3SCF A;  3SEE A;  1RUC 1;  3IBM A;  3K48 A;  3CO2 A;  4OUM A;  4LBQ D;  3KZ4 C;  3SIS A;  2WZR 3;  1PIV 3;  1VPH A;  3KHB A;  1ND2 C;  4C8D A;  1ZBA 2;  2VUA A;  1UY2 A;  4UW6 A;  5JZG A;  2HWB 1;  1JOD A;  4MV2 A;  1SCR A;  4UFI A;  1COV 2;  4MGT A;  4CUB A;  3M8L A;  4O61 A;  4KWL A;  2HEY F;  5HCH A;  1DYK A;  5FK8 A;  3I54 A;  2XHN A;  4AVT A;  2D3R A;  2TBV A;  4BLJ A;  1AX2 A;  4EN0 A;  5DG2 A;  4A6S A;  1RUC 3;  3H8O A;  1JUH A;  2R07 3;  3IDC B;  4I0B A;  3OJB A;  3AMN A;  4NRQ A;  3H1W A;  4WBB A;  4DZG A;  4YNI A;  1WLW A;  2H0V A;  3D3A A;  3BOW A;  3OYW B;  4P9X A;  1JXN A;  5FYH A;  5CIR A;  5LA9 A;  3RJ2 X;  5A33 B;  3MIC A;  2F6B A;  1GUI A;  4KG0 A;  4Q4V 2;  3S30 A;  1VBD 2;  4BJ0 A;  3CU7 A;  3PU8 A;  2FCT A;  1V6O A;  3FHI B;  4CYD A;  5EIY B;  4LIU A;  3GXU A;  1NCR B;  4KNC A;  3VKN A;  1XU1 A;  4HOO A;  1QXR A;  1NQD A;  3JBG 2;  4QQH A;  5E8A A;  4RSU A;  1PX3 A;  3NW4 A;  1MAC A;  2GME A;  3ACL A;  3C7F A;  3NV1 A;  3AVR A;  3H8U A;  1OLM E;  1JHN A;  3KT4 A;  2PQS A;  4AZZ A;  1JYV A;  2BVV A;  1Z7S 3;  3GJB A;  3OGS A;  4RGA A;  3WDV A;  4AW7 A;  1X36 A;  5JI9 A;  5EV7 A;  4FPY A;  4OMD A;  2E7T A;  3PTR B;  2BPA 2;  1GZC A;  4PIY A;  3ON7 A;  3OF1 A;  3AP9 A;  1F15 A;  5C4W A;  1XYN A;  4Y1U A;  2GDF A;  4MXW A;  3C7O A;  4HAN A;  3WEZ A;  1XSQ A;  3ABZ A;  2D93 A;  3U10 A;  3UES A;  5CFD B;  2NM1 A;  5C3Q A;  3N7K A;  4MGK E;  3VBO B;  2QQN A;  4PLM A;  1QHD A;  4XQW A;  5FK7 A;  2P3K A;  4EQV A;  4QDS A;  3AKT A;  4O9G A;  1R64 A;  4D6Q A;  3N9P A;  1ZZC A;  1XE8 A;  4F3J A;  4AFC A;  1ENR A;  1C5H A;  2DBN A;  3M2M A;  4D6R A;  4EZH A;  2D97 A;  4XAE A;  4AHY A;  5IK7 A;  3DL3 A;  4CCE A;  1RXF A;  1PX4 A;  4UBG A;  5IK5 A;  1ENX A;  3AL6 A;  4LBQ A;  4RS5 B;  1QY4 A;  4Q4Y 1;  3BN6 A;  5KHK A;  2YBP A;  2XLG A;  1AXZ A;  1YC6 1;  1J3Q A;  2W0X A;  3O0X A;  2QQK A;  5JWP A;  3HR9 A;  4UFM A;  4F8A A;  1R1A 2;  4LTA A;  4DO0 A;  4NMI A;  3FN9 A;  5JOX A;  4CU6 A;  2YC0 A;  1CAV B;  3EQE A;  2P34 A;  1NCQ B;  4DY3 A;  4CXW A;  5KXE A;  2VGD A;  1LNS A;  2XJU A;  4G9S B;  4PJY A;  5F2W A;  3P3P A;  4HT1 T;  2VUJ A;  3N9L A;  4NAM A;  5K7P A;  3ZYI B;  1QH7 A;  3ZKU A;  1CGP A;  5FWJ A;  1IOA A;  2HWE 1;  2NQY A;  3HBK A;  5KHG A;  1H2L A;  2J7M A;  1AF9 A;  3PIJ A;  3AVS A;  1UZ0 A;  4Y4R A;  2Q8D A;  5CIS A;  4Q4Y 3;  2H6C A;  3B7M A;  3DUI A;  2WO1 A;  1K5M B;  1YFU A;  4Q2F A;  4QPY A;  3TYJ A;  4BLI A;  3R4D B;  4NHL A;  3DPR A;  3QH6 A;  4HSJ A;  5A6Y A;  1RUD 1;  1HB3 A;  2RJ2 A;  3J8F 2;  4MGQ A;  1VP6 A;  4LNV A;  3AZX A;  1PO1 1;  1UOJ A;  1UU4 A;  1IG3 A;  4XAB A;  2BW8 A;  5GLZ A;  3K77 A;  3VKF C;  2WO7 A;  1CPM A;  3OUH A;  3GM8 A;  4YYO A;  4WZF A;  3VD5 A;  4XF3 A;  5CFC C;  2JKX A;  2W3J A;  3WNL A;  3T2P A;  4BME A;  2O8Q A;  1VJ2 A;  1FT9 A;  1O4Z A;  4LKE A;  1H6X A;  2J42 A;  2HEW F;  2WQ4 A;  2BGP A;  2DVA A;  4QGM A;  4UWD A;  2HWE 3;  4DRR A;  5A3L A;  2D5H A;  1QJX 1;  1LCL A;  2MEV 1;  5M0T A;  5F3C A;  1BK0 A;  1MQT C;  2ZHM A;  1R08 2;  4O65 A;  3RS6 A;  4N43 A;  2ZHL A;  2OPK A;  4FXK B;  5L36 A;  3DF0 A;  5C70 A;  5E6H A;  1PMJ X;  2WWS A;  4C91 A;  5I0T A;  3NJV A;  1VBC 1;  5IWF A;  3MGU A;  1DFQ A;  1O7F A;  2OPW A;  3D82 A;  1GQG A;  2J1U A;  2WS9 2;  3VZO A;  4XCB A;  4E4D X;  4XFI A;  4BIO A;  4UF0 B;  3WXP A;  5JPN B;  1GYK A;  2SBA A;  2BQP A;  3UL2 A;  2BOJ A;  3I7D A;  5FZO A;  1W6P B;  1JZ7 A;  5K4L A;  4DS0 A;  2XB6 C;  2R06 2;  1HV0 A;  3H3L A;  5FPV A;  3K4D A;  5F2S A;  2ZKL A;  3WW4 A;  1V9U 2;  1QJX 3;  2MEV 3;  4IET A;  5JCT A;  1Q56 A;  4JZR A;  5FZO B;  4HPK A;  5CU1 A;  4XFF A;  4GWJ A;  3V65 A;  4HVO A;  5C3P A;  1WBF A;  1OSG A;  1LOE A;  1UMZ A;  4Y20 A;  3V0A B;  1YQ5 A;  1QOS A;  1DP0 A;  3AZY A;  1VMH A;  3WW3 A;  1HX6 A;  3ZYR A;  4NII A;  3ZXL A;  5ABJ B;  1ZBA 1;  3M3Q A;  3GCX A;  3FL7 A;  1VBC 3;  4B29 A;  4UW3 A;  2LTN A;  3FE5 A;  1XJA A;  4OZO A;  5T5P A;  3JB4 C;  4AI3 A;  2RMU 1;  2JEN A;  2R1B A;  3QAC A;  1COV 1;  1WKY A;  3AMP A;  3POG A;  4P5H A;  4QPW A;  5LRS A;  4YZ1 A;  1X8M A;  4TZD A;  2ZBJ A;  4AEK A;  3K4Z A;  3O0W A;  3FFQ A;  2JDM A;  2EIE A;  3POB A;  1D2Q A;  2ZX4 A;  5CFD C;  3A0K A;  3LF7 A;  4BK4 A;  3NNJ A;  3B01 A;  5BNQ A;  1RC6 A;  2RHP A;  2XL7 A;  4QD2 A;  4XDO A;  3AFK A;  1JU3 A;  1CES A;  4YGC A;  4XDQ A;  5F3I A;  5BNP A;  3OEA A;  5I8Y A;  1DDL A;  1W0O A;  4WM8 B;  3WW2 A;  5FRE A;  1OPM A;  5B4N A;  1W2N A;  1ZBA 3;  2AEN A;  3MV1 1;  4H14 A;  3VZK A;  3SIT A;  1VBD 1;  4AVS A;  2IWG B;  3AC0 A;  2Q4S A;  3I2F A;  2X8K A;  3JD7 2;  2CTV A;  1COV 3;  4CDU B;  3HQR A;  1RMU 2;  1GZW A;  5DXD A;  1V00 A;  1N3P A;  5D8A A;  3JBG 1;  2C24 A;  3VBR B;  3VZJ A;  2WZP P;  2MPF A;  1CON A;  5FJK A;  2V73 A;  1Q8P A;  2BNM A;  4GMP 0;  1UIK A;  4HET A;  4AK3 A;  3W58 A;  5AVA A;  1NLQ A;  1W6M A;  2P2K A;  4W6X A;  3MIH A;  4ATE A;  3VB9 A;  5FY4 A;  1NCQ C;  3IMM A;  1LRH A;  5FYS A;  4XF0 A;  1E5R A;  2GSY A;  2VE1 A;  5F5C A;  2WA3 A;  5CEH A;  3VDD C;  3ZFE B;  1WW4 A;  3KWV A;  3PVN A;  1F4H A;  1W99 A;  1PGL 1;  1EUU A;  4WVM A;  3ILF A;  4P08 A;  3VHP A;  1VBD 3;  4K7J A;  4N7U A;  1OUR A;  3KVB A;  1SMV A;  1XXN A;  3IDE A;  3NNF A;  5JXH A;  1ND2 A;  1D7P M;  4NAO A;  1SQ4 A;  1H9P A;  4XFH A;  3BIE A;  4P14 A;  3JBG 3;  3AFG A;  1FX5 A;  3KV4 A;  3IPV A;  2Y0I A;  3LZZ A;  1UU5 A;  2YXS A;  1RUE 2;  2OUJ A;  4LT5 A;  3QOP A;  4DB5 A;  1ZA4 A;  2P4E A;  2D40 A;  4AQT A;  3MW3 A;  3ACG A;  2ZGP A;  1F2N A;  1NYW A;  4Y33 A;  2R16 A;  3SH5 A;  3ZXJ A;  2QTW B;  2VCC A;  2WWJ A;  4YM3 A;  5A3P A;  4FPF A;  4EE2 A;  4M0H A;  4Z2W A;  3AKS A;  4QHO A;  4FAG A;  1CD3 G;  1R1A 1;  4FPE A;  5FP7 A;  1T6B X;  3NL1 A;  1W05 A;  4YGD A;  4ZU5 A;  4BMB A;  4HVR A;  5FPB A;  4MYE A;  4CE8 A;  1DQ6 A;  1ZRD A;  5C33 A;  1Z78 A;  3K3N A;  4HZF A;  5JSP A;  4CUC A;  2CV6 A;  1ZVF A;  2C9A A;  3NO8 A;  3ZXE A;  2K46 A;  1G8W A;  3AMH A;  1C8M 2;  4ZXK A;  4COY A;  3KLS A;  1YRZ A;  4AG4 A;  5FDB A;  3WCS A;  4JDM A;  1AVB A;  4XOG A;  4AFA A;  4I3G A;  1ENQ A;  4CDW C;  3AXE A;  2VW2 A;  4F83 A;  4QKF A;  1NUK A;  4P9I A;  1VBA 2;  2PA7 A;  2Q0A A;  3WT3 A;  4CSW A;  4OQ8 A;  4TTG A;  1SEF A;  3VBF B;  1ONA A;  4KG8 A;  4QPI C;  2D98 A;  1ZNP A;  4FOW A;  3WDX A;  1R1A 3;  1W8O A;  4IV1 B;  1ND3 B;  2GH8 A;  5FRA A;  1CAW A;  1JZ4 A;  1A8M A;  2L9L A;  2W9X A;  3PUH A;  4YW5 A;  5E88 A;  5FZA A;  5B4X A;  1CX1 A;  2CYF A;  5FPX A;  2RS3 2;  4FPH A;  1EAH 2;  1KDK A;  4IE7 A;  4MAD A;  2VZT A;  1YJL A;  2EIB A;  2ZX3 A;  3TEY A;  1KFX L;  4R8H A;  1KRI A;  3UGH A;  1OOP B;  1JTZ X;  1R09 2;  2UU8 A;  5D21 A;  2WJS A;  1JHJ A;  2WZ8 A;  4GWM A;  3ZSK A;  5FPA A;  3QD6 A;  2W2I A;  3ZMO A;  2FZ2 A;  2HWC 2;  1QJY 1;  2VAU A;  4QGN A;  1HQW A;  2VEC A;  3SXW A;  2GP3 A;  3D6E A;  1R08 1;  1U0A A;  1GIC A;  2IXH A;  2YFZ A;  3MHZ A;  3ZIX A;  4AI0 A;  3ZXG A;  4M00 A;  3ZN5 A;  4LUL A;  3J8F 3;  3MFC A;  2V5Y A;  4KL1 A;  2WNU C;  3VBS B;  2VXR A;  4ZON A;  1UKR A;  1RUH 1;  2VPV A;  4CVU A;  2JG8 B;  3LFI A;  2PXJ A;  2WS9 1;  1U12 A;  2WFF 1;  2CWM A;  4WM8 C;  1IPK A;  1HJF A;  3Q8B A;  2QKD A;  3HN3 A;  5GLV A;  2DVD A;  3ZOI A;  2X5I B;  1SZB A;  1O8S A;  3T1M A;  3BPS A;  2IFR A;  1KS5 A;  2A7A A;  4B7K A;  1YI7 A;  2VZR A;  3BVC A;  4D6S A;  1R08 3;  4K9S A;  1GZT A;  1HDK A;  1W8H A;  1WCD J;  1UOB A;  4YSF A;  1NX9 A;  2WN3 A;  2Y6L A;  3J9S A;  4Y24 A;  3SH4 A;  2JD4 A;  4YM2 A;  5IK8 A;  1LGN A;  4EN9 B;  2Q1Z B;  5C3O A;  4EV0 A;  4CEW B;  3GBW A;  3Q8F A;  1AXK A;  1A78 A;  3VHO A;  4DPN A;  1RUH 3;  2YU1 A;  2Z5W A;  4XVH A;  2VOW A;  4Y1Y A;  2WS9 3;  2PHU A;  5J36 A;  3MZH A;  1TE1 B;  3O1T A;  4A7Y A;  5FMB A;  1H1M A;  3WW1 A;  1YHF A;  4G3Y C;  1AL0 G;  1DF0 A;  4L92 A;  2R06 3;  4XJW A;  3RYR A;  3WVJ A;  5F6L B;  1OLM A;  2VVE A;  2DV9 A;  5CFC A;  5A80 A;  4LOT A;  5HV4 A;  1V9U 3;  3U37 A;  2C6S A;  2W91 A;  2E6V A;  3I3B A;  1FNY A;  2NZ9 A;  4MUV A;  4YW2 A;  3WR0 A;  4GKY A;  1UN1 A;  4MG2 A;  2XJS A;  1V6N A;  1FV2 A;  3NJY A;  2XL9 A;  2J22 A;  1TMF 2;  2O0O A;  2YYO A;  5A1L A;  1UZV A;  1KIT A;  2YUE A;  2WDB A;  4R9D A;  4GQ7 A;  5IVB A;  2QDR A;  1ZRC A;  3POY A;  2FMD A;  1MQT A;  2Y34 A;  4H55 A;  3LSE A;  4H7L A;  4FFG A;  3ALQ A;  1MEC 2;  4LBJ A;  4V1P A;  3ZO0 B;  4ATF A;  3I3M A;  3PHM A;  4K1Z A;  3OSD A;  2QQV A;  5KXB A;  4HBN A;  5A32 B;  4QU1 A;  1APN A;  1RHI 2;  1RMU 1;  2VL4 A;  5L9R A;  2OYZ A;  3VD4 A;  1XB9 A;  2A71 A;  4WVZ A;  3S57 A;  2BDR A;  3MIF A;  5ANN A;  4NO4 A;  4QKD A;  3NWK A;  2VZ3 A;  4BH9 A;  1BMV 1;  5J7M A;  3KCC A;  3ACH A;  4BQ5 A;  3VZN A;  2ARA A;  3OOX A;  4QU2 A;  4E2G A;  3ES4 A;  4OZX A;  2BYV E;  2HWD 1;  2TNF A;  3FC0 A;  4XMI A;  3RDI A;  2G9F A;  4IEY A;  2QQJ A;  1WW5 A;  4Q0P A;  3IZO A;  4XJZ A;  3KV9 A;  1PMI A;  1XNC A;  5A3W A;  4CTE A;  3O1O A;  2A6W A;  2ZGM A;  2ZGS A;  4A6O A;  1JN2 P;  5AVP A;  2CHH A;  2EAA A;  3WP5 A;  4E4S A;  2JDH A;  1C8N A;  4R4Z A;  2VUC A;  1W6N B;  1H4G A;  1QWR A;  1UAI A;  3I2G A;  3NAP B;  3C7H A;  2ZGL A;  1RMU 3;  5LEK A;  2UYB A;  4NHM A;  4AVV A;  5FZE A;  3VBF C;  1PM4 A;  1OLR A;  2XJQ A;  3ACF A;  3CJI C;  3U14 A;  5JSO A;  1RUE 1;  1UO9 A;  3X29 B;  5A1F A;  3B93 A;  4P9L A;  4XIO A;  5FZL A;  2CWS A;  1O3T A;  3I49 A;  1E57 A;  1O3Q A;  4GH4 B;  2IVI B;  5CFD A;  3RQ0 A;  1RIR A;  4LUK A;  2OX0 A;  3VDA A;  1OHF A;  5CB7 A;  1BCX A;  1JS9 A;  1XU2 A;  4GD4 A;  2QFE A;  2ORZ A;  4YZ4 A;  2DF7 A;  4COU A;  4CPB D;  5JIA A;  4AAP A;  2A6V A;  3PLQ A;  4ZS2 A;  3L2H A;  1AXY A;  4X6Q B;  3VD9 A;  2VQA A;  3ZYJ B;  5IAV A;  4IES A;  2HWB 2;  4Q4W 1;  4PF5 A;  4W6Y A;  5FTT C;  3AYE A;  5FQ0 B;  2VY0 A;  4N7I A;  1MPX A;  5FYV A;  3WUD A;  3ZLI A;  2VZS A;  4YW7 A;  3S7E A;  4CUA A;  1RUE 3;  1V6M A;  5FY0 A;  4R9B A;  1RUG 2;  3VD3 A;  1VRB A;  2JIJ A;  3M3O A;  3OD4 A;  1PHM A;  5GZD A;  1PGS A;  3LA3 A;  2DCZ A;  1X33 A;  1Q8O A;  4U2A A;  2GC0 A;  5FZM A;  3O14 A;  4IEV A;  5F5A A;  3K2O A;  4CU8 A;  3APB A;  4XE9 A;  1VBA 1;  1US2 A;  3RJR A;  2HYK A;  4XFA A;  3AYC A;  2ARX A;  5IFT A;  1NCQ A;  2JDU A;  4PCR A;  4C90 A;  4TYS A;  1UZW A;  1JOP A;  3VDD A;  1W8N A;  4QQL A;  2E31 A;  2Y38 A;  3RI8 A;  1W9F A;  4LHK A;  4XTM A;  2ZX2 A;  3RWN A;  1GKB A;  2YGM A;  1KEX A;  4Q4W 3;  3THP A;  4BCU A;  1CWP A;  1EAH 1;  1UZY A;  3NV2 A;  3UGF A;  2Z42 A;  4LO5 B;  4ZY9 A;  5JLV A;  1PZ7 A;  2W94 A;  3MDP A;  4RQP C;  2DYC A;  3E5U A;  1C8M 3;  1JYI A;  3DKQ A;  5K9Y A;  3W21 A;  1N47 A;  4PQQ A;  4GJZ A;  3WZ1 A;  2HWC 1;  1DBN A;  4LE3 A;  2Q8C A;  2JEC A;  4LQR A;  1VBA 3;  5SV8 A;  1NOV A;  4FOY A;  3ZYH A;  1Y9G A;  4HVQ A;  3LIH A;  2F4L A;  3WG3 A;  4QPG C;  3HEI A;  4PIZ A;  1XQN A;  1MS1 A;  5E89 A;  2H6B A;  5A70 A;  5FBJ A;  2CGN A;  3B94 A;  4CP1 A;  5C8C B;  1EAH 3;  3WV6 A;  1OC1 A;  3KT7 A;  5FZ8 A;  2FBE A;  3ECQ A;  1FV3 A;  1SG3 A;  3LKJ A;  2NN8 A;  3H8X A;  1RUI 2;  4DNY A;  3FLT A;  2UWA A;  5FP3 A;  2YG0 A;  4GB3 2;  1SHW B;  5EYX A;  5I0D A;  2HWC 3;  1MS9 A;  3ZN4 A;  1X8E A;  2A73 B;  2R0F A;  2PMW B;  3VZL A;  2JB4 A;  2J1E A;  3WP4 A;  4CDQ B;  4BQ3 A;  1D2S A;  4I3P A;  3LE0 A;  4Q4Y 2;  3ZM8 A;  3ME2 A;  4UBH A;  1UPI A;  3VL8 A;  1LU1 A;  4KBZ A;  4CDW A;  3WDW A;  5FZ4 A;  4IXL A;  1SFY A;  5DAP A;  4UOJ A;  5LA2 A;  2I2S A;  3WNP A;  4AHX A;  2C5D A;  4QHB A;  2V4V A;  1XC6 A;  4AEJ A;  1JOB A;  4QPI A;  5FZH A;  4NR1 A;  4H3W A;  1GQH A;  4ES9 A;  2OVU A;  1UF2 C;  1DQ2 A;  1C1F A;  1V6J A;  4MXV A;  1IG0 A;  4NUB A;  4CCN A;  5JOY A;  3LPG A;  2FDK A;  2K9Z A;  4Y3O A;  2X09 A;  3AK0 A;  4S2D A;  1UYY A;  3WQ7 A;  2QQW A;  2VUD A;  2ZHN A;  3SKV A;  4PBO A;  2HWE 2;  1WD3 A;  2XML A;  5FZD A;  4ORF A;  4ZU7 A;  1WMD A;  5FUI A;  1OF3 A;  2DUO A;  2Q8E A;  3SQO A;  4COZ A;  2W39 A;  4ZKT B;  3G6J B;  2Y6H A;  4GXL A;  4JAA A;  5EHD A;  1NZI A;  1Y4W A;  2JDZ A;  3KGL A;  5JDB A;  1RUD 2;  1YO8 A;  4QAW A;  2CAV A;  2C4X A;  1PO1 2;  4XJ9 A;  2WA4 A;  2EXK A;  4GH4 C;  1Q5O A;  1ZM1 A;  3J26 N;  4FVV A;  2OXB A;  3C8X A;  4XF9 A;  2A1X A;  3VKM A;  1AZD A;  2X10 A;  1FOD 2;  3NV4 A;  3AKP A;  4HSL A;  3PUR A;  4KWJ A;  2Y6K A;  2XPJ A;  2PFW A;  4YWA A;  5ACA 1;  2WNU A;  1DIW A;  1S0J A;  1W9T A;  4BIF A;  1ACC A;  2XLA A;  2W92 A;  1W6Q A;  1B35 C;  3R4S A;  3KSC A;  1OD3 A;  4QHZ A;  4WM8 A;  2NMN A;  3USS A;  2MEV 2;  1TZO A;  1BXH A;  3SKJ E;  1TMF 3;  1UYP A;  5FMO L;  3B9I A;  3GZT B;  1IQA A;  4CEY B;  5FZC A;  1QOT A;  2WT0 A;  3N36 A;  1Q3E A;  2NPI A;  1T2X A;  1VB4 A;  4KGG A;  4RFR B;  5C9A B;  1MEC 3;  1HXS 2;  3TB0 A;  4AWD A;  5DN2 A;  2HBU A;  2CGO A;  1QMJ A;  3BAL A;  1AJO A;  1G7Y A;  1LEN A;  1EYB A;  1V6I A;  2HLE A;  3EYP A;  3MLJ A;  1CZT A;  3J4U H;  5BNN B;  1RHI 3;  1L7Q A;  2ZXQ A;  5H9S A;  3SEP A;  4KWU A;  4P9W A;  3BGA A;  4RR3 B;  1O4Y A;  3MUZ 1;  1QIQ A;  2JDY A;  1OVP A;  2WWU A;  3HQX A;  3NJX A;  4IL7 A;  4LR4 A;  4QMA A;  4JDO A;  4FOV A;  4XFB A;  4FTB A;  1GZ9 A;  3VGI A;  3POF A;  1OVS A;  4MGS A;  1WCK A;  5IVC A;  4M3C A;  3LEG A;  1OD5 A;  2VNR A;  4QX2 A;  2HH9 A;  3SLI A;  1HKD A;  2QZ3 A;  2XQX A;  2XVG A;  4MLO A;  5A7W A;  4LO6 B;  5LA1 A;  3BTZ A;  2VCB A;  3BTY A;  2VNV A;  3IMN A;  1RVF 2;  3OY8 B;  1JI6 A;  2VTX J;  4GKX A;  4K40 A;  4K6B A;  4JGZ B;  1HQN A;  1KGY A;  2YGL A;  3HQU A;  3PUQ A;  4KI5 M;  5I0U A;  1OKQ A;  4QB1 A;  3T09 A;  4BB3 A;  2O14 A;  2RMU 2;  1S0D A;  1B09 A;  3VUO A;  4SLI A;  3HNB M;  4DRV A;  4LLF A;  2EF6 A;  2XVK A;  4NIA A;  3ST7 A;  4LO4 B;  4W6W A;  1RUG 1;  1SBF A;  1IHM A;  4HLT A;  5C8C C;  5L7O B;  4A42 A;  5KHI A;  4XIK A;  3POS A;  4XZU G;  3MV0 1;  3ZPY A;  1LAJ A;  5GZG A;  4NHY A;  4R52 A;  1K42 A;  4XBL A;  4OUE A;  1VAV A;  2XH6 A;  5I0R A;  3H3U A;  4YG3 A;  3RGB A;  3FX3 A;  1H30 A;  2VZO A;  5D2A A;  1HV1 A;  2BBV A;  4ISQ A;  2HWB 3;  4LHS A;  5I8T A;  5BYN A;  1DZT A;  2VD7 A;  3ATG A;  3CKH A;  4J1W A;  2GC2 A;  5L9B A;  4Z2A A;  1ZRF A;  3HVD A;  2YZ4 A;  4JGY B;  2XKP A;  5D1I A;  2XJT A;  3HOB A;  4X8P A;  5HXV A;  1RUG 3;  2D3P A;  3OTF A;  3VBH B;  5A3N A;  4C0H A;  2A3W A;  3VBF A;  3AP4 A;  2IVJ A;  5FMC A;  3CJI A;  1PK6 B;  1UY1 A;  3R05 A;  4IE4 A;  4AL9 A;  1O5U A;  1G6N A;  2VJX A;  1LEC A;  1N1V A;  1DHK B;  5HXM A;  3POE A;  3KQR A;  4JTN A;  4MO3 M;  5EYY A;  1W6O A;  4Z8B A;  1D0H A;  3RI9 A;  1PGL 2;  1OLQ A;  3NJZ A;  3ZFG B;  3OPT A;  3NKT A;  4XXA A;  5KR7 A;  5IVY A;  1ZZB A;  2CDP A;  1H1A A;  1UOG A;  1ODN A;  2UYA A;  3FHA A;  1ZZ8 A;  1UY0 A;  5K0U C;  2WAB A;  4OFG A;  1HW5 A;  1LES A;  3ZIW A;  1F4A A;  4C0B A;  2G19 A;  1F5F A;  1RUI 1;  2O1Q A;  4UFL A;  1NE4 A;  3NRU A;  3LWC A;  4LBN A;  4GB3 1;  4GZ9 A;  1GNH A;  3VBO C;  1FAY A;  3SHR A;  4BDV B;  1O4T A;  5EXO A;  3UET A;  3HIF A;  1YIP A;  3THD A;  1FAT A;  3POI A;  3OBR A;  4P9J A;  5EZW A;  2E7Q A;  2E51 A;  1ASJ 1;  3POJ A;  4LXL A;  4OCT A;  1W28 A;  5I93 A;  2VU9 A;  4AI8 A;  4LO7 A;  2D3S A;  4FAH A;  3GBF A;  1GBG A;  4XXP A;  5T5J A;  1TVG A;  3O1S A;  1ZRI A;  2DUP A;  4UXA A;  3KT1 A;  4Q29 A;  1JZ3 A;  1DYP A;  5JIU A;  5C9A C;  1XRU A;  2SLI A;  1RUI 3;  1RB8 G;  1Q8Q A;  1V6K A;  4AVC A;  1XE0 A;  2A5Z A;  3BTA A;  4CCL A;  5IT6 A;  1OQD A;  3RRD A;  4GB3 3;  2VBB A;  4E4Z A;  1I6X A;  3ES1 A;  3MEP A;  2DU0 A;  4L11 A;  5BNN C;  4RQP A;  3AKR A;  4TWT A;  4YVS C;  1Q8S A;  2R32 A;  1E5S A;  3GCW A;  2N7G A;  2VOV A;  1EP0 A;  4Y22 B;  2RJL A;  3AX4 A;  4YVW B;  2DU1 A;  3BU0 A;  3TN9 2;  4RYD A;  5A7S A;  4IE6 A;  1QJE A;  3WQ1 A;  2ZEZ A;  4UAP A;  2WNE A;  2FMY A;  5FJH A;  4PQ9 A;  1GP6 A;  3B69 A;  2XHK A;  4QPG A;  2QQP A;  5J3U A;  1FOD 1;  1CN1 A;  3OCP A;  1OXC A;  1SPP A;  3ASI A;  4QX5 A;  4FI9 A;  4Y26 A;  4KQ7 A;  4R9A A;  1REF A;  3MW2 A;  4A7Z A;  4RHV 1;  1TQ5 A;  2VC9 A;  4JGZ C;  3EBR A;  3H8R A;  4K20 A;  2TEP A;  4E27 A;  1HRI 2;  5BNO B;  1W2O A;  2MHF A;  4YGE A;  2VTF A;  1AX1 A;  1QJY 2;  1QJU 2;  2R0H A;  1X82 A;  2CSG A;  4YFW A;  1LTE A;  5KC5 A;  4BQW A;  2LRO A;  4E2Q A;  1SBE A;  5ANQ A;  2BFU L;  4ARX A;  4EN7 B;  1RUD 3;  3OPW A;  3WNX A;  5FYI A;  1HXS 1;  1PO1 3;  4XPV A;  4DUV A;  3K4A A;  2XUM A;  1Y3T A;  1RUH 2;  5CA6 A;  1FOD 3;  3SC7 X;  3U4X A;  2WFF 2;  5IVV A;  3CHX A;  1RUJ 1;  4MOA A;  5K8S A;  1POV 1;  3I2J A;  1GWL A;  5FXV A;  3PJY A;  2VTX A;  4QXK A;  2FDG A;  4B1M A;  2CDO A;  5F7U A;  5BXX A;  2D6M A;  4JTO A;  2WSV A;  4FQ4 A;  4IEU A;  4LIV A;  1GFF 2;  1QQP 2;  3I4I A;  3M3C A;  4CP9 B;  1NCR C;  3L2Y A;  3RZG A;  2JDA A;  4K8F A;  1EPZ A;  3PVO A;  3OBT A;  3WY6 A;  4JGY C;  4AI2 A;  2Q5T A;  2NYY A;  4AED B;  2J1T A;  1T6G C;  3LOI A;  1H8T A;  1HXS 3;  1RVF 1;  1UYZ A;  2AUY A;  4XW3 A;  3WCR A;  2JG9 B;  5HBA A;  3E97 A;  1NZC A;  3QCW A;  4IV3 B;  2PAE A;  2B4K A;  4UW4 A;  3VDC A;  5GZF A;  2WKK A;  3B00 A;  4D0Q A;  1POV 3;  4OHX A;  3I59 A;  4XBN A;  1H1I A;  4GH4 A;  4GJY A;  4AVA A;  4DXR A;  2LUW A;  3AL5 A;  1CAU B;  4I2O A;  3ZFG C;  2FD8 A;  3UKT A;  3USU B;  1RIN A;  4OVE A;  4NRO A;  4N53 B;  5F3G A;  3BTX A;  1WLT A;  4J1X A;  1ULP A;  5FPL A;  3MF6 A;  4IE0 A;  1ZZ7 A;  2JE7 A;  5FFO C;  2FDJ A;  1JW6 A;  1B35 A;  4UFH A;  1XNT A;  2WNV A;  4AGG A;  4ZZ5 A;  2KXL A;  1CAX A;  1TME 2;  3VDB A;  1SCS A;  4AI1 A;  5I91 A;  5FUP A;  4XAC A;  3I3D A;  1G9B A;  2PHR A;  1RVF 3;  1W9S A;  5DUU A;  3C2U A;  3LOB A;  1I1E A;  2J1S A;  5HCB A;  3JUU A;  3FUO A;  4RS5 C;  1ZA7 A;  4Q0U A;  2RMU 3;  2NP0 A;  3WQB A;  2WZE A;  4XTP A;  5A7Q A;  1LHV A;  1HRV 2;  2Y8K A;  2WC2 A;  4NPR A;  4RFT 0;  2FDI A;  2W5F A;  2B7Y A;  3CZU A;  1BMV 2;  4Q1R A;  5EWS A;  5FZ6 A;  2YY1 A;  4NVP A;  1XE7 A;  1JZ2 A;  2HWD 2;  2QJV A;  1BBT 1;  2VZU A;  2X53 S;  5I0S A;  4G4F A;  3O1U A;  2OII A;  2XBO 2;  1Y9M A;  2VUL A;  2EA7 A;  3UKN A;  3AXD A;  2RJK A;  5HV0 A;  3ROU A;  4XUR A;  3OGV A;  5GKA C;  3CNA A;  4NHX A;  1C28 A;  5IUQ A;  2Z79 A;  2BU9 A;  2LS6 A;  5FY8 A;  4PHZ A;  4U36 A;  1UMH A;  1QKQ A;  2RDN A;  1K5M C;  5F5I A;  4OHW A;  4YVW C;  2JWP A;  5HPO A;  1JYN A;  2WSU A;  1RGS A;  4QT6 A;  2QNK A;  1RJ8 A;  5EP9 A;  5EFU A;  2DWR A;  3ENR A;  1XNA A;  4IGQ A;  3VD7 A;  3BCW A;  1S2B A;  4DY5 A;  4D94 A;  3J7L A;  3N9M A;  1SFN A;  4YGB A;  3I2I A;  2ZCW A;  1BBT 3;  5J37 A;  3Q9O A;  1LOG A;  3RZK A;  5DUX A;  4JV4 A;  3JZV A;  1AYN 2;  2ZAC A;  3M4F A;  5JVV A;  1GQP A;  3CLP A;  5C8C A;  4QX1 A;  4ZU4 A;  3I3E A;  5FR3 A;  1X7N A;  4LKF A;  2D6N A;  1K12 A;  3VZM A;  3U75 A;  1OBN A;  4QX8 A;  4P02 B;  1U5I A;  4Q5O A;  4Q4W 2;  1HB2 A;  1BKZ A;  2CL2 A;  2QUO A;  2W1Q A;  5JZG B;  3WDY A;  1IS5 A;  2CNA A;  1DLC A;  1VR3 A;  2QE3 A;  2RG4 A;  2ZGR A;  4I30 A;  5KBF A;  4Y4Y A;  1KFU L;  4NRP A;  2QQI A;  4AQ2 A;  4FPK A;  5F1R A;  4XJ8 A;  3NV3 A;  2WT1 A;  4NN0 A;  4UT5 A;  5EJ1 B;  1XPW A;  2XVL A;  3GNE A;  4IEW A;  4M3C E;  1HQL A;  4QGL A;  2Y26 A;  4DOU A;  1JZ6 A;  3WLU A;  2ZX1 A;  1Q43 A;  2WFP A;  5F6K A;  5CG8 A;  2AC1 A;  4YZ3 A;  5A7N A;  3TN9 1;  3TNQ A;  2W68 A;  4AOC A;  4FTS A;  2YFU A;  4CP0 A;  5FYZ A;  3I2H A;  4I01 A;  2ZPX A;  1WA6 X;  3D8C A;  2Q8O A;  2IXL A;  2RE9 A;  1LB2 A;  3L9J T;  1V0A A;  1YNA A;  3HT1 A;  4AED C;  4EWE A;  1YFY A;  5ABJ C;  5IK4 A;  3AKQ A;  3I3Q A;  3TWI A;  4A4A A;  1G9C A;  4ZXE A;  2XWJ B;  5K0U A;  2VOK A;  2ARC A;  3D5O A;  3TNP B;  2HEV F;  4OI4 A;  3JB8 A;  1HRI 1;  3NQH A;  5CAD A;  2HKX A;  2A3X A;  3CJX A;  3MO4 A;  1QJU 1;  1PZ8 A;  4UFJ A;  5EJ3 A;  3FWE A;  3PMS A;  4XDP A;  2VZP A;  2ID4 A;  3LEI A;  3TN9 3;  3WNM A;  4BZ4 A;  2E32 A;  1VBE 2;  1W8Z A;  2BWC A;  4N53 C;  4RGK A;  3KCY A;  4NID A;  1DZR A;  3RG0 A;  5C4W B;  5B2G B;  4MXW B;  2GNB A;  1O3R A;  2ZTN A;  1TNF A;  5LWB A;  4IEP A;  4OMC A;  5GLT A;  1DZQ A;  4ASK A;  2D6P A;  4M4R A;  5AC9 2;  1LHO A;  2V4A A;  1SDW A;  3TEX A;  5BY5 A;  2BGC A;  2OUH A;  1IPJ A;  2YRO A;  3V0B A;  3FBY A;  4LE4 A;  3E6B A;  4AFD A;  1J59 A;  4YZ5 A;  3FUQ A;  5IVE A;  1HB4 A;  1UNB A;  2AGS A;  1HRI 3;  2LAL A;  4OI0 A;  3BOD A;  3LCP A;  2V09 A;  4IGP A;  1QQP 1;  3U4S A;  1PM7 A;  1QJY 3;  4CDU C;  4Q4X 1;  5JUV A;  1QJU 3;  3N9N A;  3BKZ A;  3W20 A;  3PUS A;  3LIG A;  2ZGK A;  3S5Q A;  2OQ6 A;  3VBR C;  2G4I A;  2E26 A;  5BNN A;  4LBQ B;  2P6C A;  5FCC A;  1FPN 1;  1GAN A;  3JXS A;  4YVS A;  2G9G A;  2Z2S B;  2PAK A;  5FZ9 A;  1BLZ A;  3T0A A;  5F9T A;  3E5Q A;  3OGG A;  2JKB A;  3ZN6 A;  2WFF 3;  3KD4 A;  5CYY A;  1Y9Q A;  2LW8 A;  4HL0 A;  3QLQ A;  3ZFE C;  3CBN A;  1YJK A;  3ELN A;  5FO8 B;  5DUV A;  4AQS A;  1O59 A;  3SCG A;  3AJZ A;  4JRL A;  1NLS A;  4V2V A;  3WIN E;  3WP3 A;  3ETQ A;  5LY1 A;  2QQM A;  4C1X A;  2ZML A;  1J1L A;  1OKO A;  1Y43 B;  4XCA A;  4H7M A;  3ZPO A;  2VMI A;  2W46 A;  4YG0 A;  4Q1P A;  1QQP 3;  5BPX A;  4A41 A;  1RL3 A;  1OFS A;  1SLT A;  3AMQ A;  4MSV A;  1VRH 2;  3ZMN A;  2GU9 A;  2RM2 2;  1TME 1;  4JGZ A;  1RYY A;  3MIG A;  1CQ9 A;  4IEQ A;  2E63 A;  3T1L A;  1AR9 2;  3GF6 A;  1FPN 3;  3ZSE A;  1VIW B;  4JC1 A;  5FP8 A;  4BE3 A;  5C7G A;  3PNA A;  1UPS A;  3LAG A;  3N3H A;  4MET A;  3B9C A;  3DPR B;  3ZXK A;  1CJD A;  5EJZ B;  3KV5 A;  5H9Q A;  1RUF 2;  5LB6 A;  1W03 A;  2B9U A;  4FP3 A;  5EQU A;  3N7L A;  4LKS A;  3ACI A;  5ACA 2;  3ORJ A;  2ZHK A;  3T2O A;  1H2K A;  1HRV 1;  5G05 L;  4DXZ A;  3F95 A;  4LK7 A;  1JYT A;  2ET7 A;  4YZ2 A;  2JIG A;  3OYW A;  5DAQ A;  3RZH A;  5BV6 A;  2BGO A;  5A33 A;  1WUV A;  2PEL A;  3GHM A;  3MUY 1;  1TME 3;  3P3N A;  4XET A;  3THC A;  4BHP A;  2GN3 A;  2XBO 1;  1BVV A;  4QX7 A;  4CXY A;  2F17 A;  3F2Z A;  3UKV A;  3T0D A;  4PIX A;  1WW7 A;  1NCR A;  3H3Z A;  4N43 B;  4TLF A;  2DVB A;  3WF1 A;  1H0B A;  3WNO A;  1UWW A;  2BVB A;  4OHY A;  4JGY A;  3UJO A;  4IEZ A;  3KVA A;  5DPN A;  3MFA A;  1WGP A;  3VLB B;  2YC4 A;  4YM1 A;  2VVF A;  4PF1 A;  2E9Q A;  4UFK A;  4KU8 A;  1HRV 3;  1PGW 2;  2ILM A;  1O8P A;  1IZ3 A;  1DGR A;  1I5Z A;  1P8J A;  4LMF A;  1UXX X;  4XUQ A;  4XHX A;  4IV1 C;  3OGR A;  3UYJ A;  1UY4 A;  1ND3 C;  1BZW A;  2VCM A;  1N3O A;  2PYT A;  2XR4 A;  3WX5 A;  4HG6 B;  3IDA A;  2WL1 A;  1YYN A;  3HWJ A;  3P5B A;  3I97 A;  4YRD A;  5E16 A;  2HWD 3;  4Q0V A;  3RVH A;  1JYX A;  2IXC A;  3IIA A;  1QEX A;  4AI9 A;  3RFR A;  4KWK A;  3EMR A;  2EAK A;  1AYN 1;  1S0F A;  2D7F A;  2XBO 3;  3KF3 A;  4QX0 A;  1OOP C;  1F35 A;  4HXC A;  3VBO A;  4HPK B;  1E5H A;  4X6R B;  2XKO A;  1WMF A;  1STM A;  4Y20 B;  4W8J A;  1DQ1 A;  5FXZ A;  1QF3 A;  1WLC A;  3BPZ A;  1QNY A;  2VNG A;  3VBU B;  2YPJ A;  4SBV A;  3SMH A;  4RS5 A;  2BTV C;  2VZV A;  2XQR A;  3NVC A;  5FXX A;  1LED A;  3IAQ A;  1OA2 A;  4PLN A;  3VBS C;  5CKQ A;  4AFM A;  3LQC A; 
#chains in the Genus database with same CATH homology
 2QQU A;  4CCE A;  2ADD A;  3PIJ A;  3IMM A;  5FMC A;  4FFI A;  4UFH A;  5FKC A;  5FKB A;  4UFJ A;  2AEY A;  1Y9G A;  1UYP A;  4CCC A;  3LIH A;  3KF3 A;  3LIG A;  3ZR5 A;  1Y9M A;  3S5Q A;  5FMD A;  3UGG A;  2AC1 A;  4HXC A;  1Y4W A;  4B1L A;  3PIG A;  4CCD A;  4UFM A;  4FFG A;  3U75 A;  3LDK A;  2OXB A;  3LEM A;  3LFI A;  4JQT A;  4UFI A;  3ZR6 A;  3KF5 A;  2QQV A;  3OSD A;  1ST8 A;  4FFH A;  5FK7 A;  3SC7 X;  2ADE A;  5FIX A;  4UFK A;  4EQV A;  3NMB A;  3UGF A;  4FFF A;  3U1X A;  5FMB A;  5ANN A;  1W2T A;  5FK8 A;  3UGH A;  2XQR A;  4UFL A;  2AEZ A;  3H3L A;  3U14 A;  2QQW A;  3LDR A;  3LF7 A;  4B1M A;  3RWK X;  3HBK A;  4QHZ A;  4AZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...