3NMBA

Crystal structure of a putative sugar hydrolase (bacova_03189) from bacteroides ovatus at 2.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
PSKVALSYSKSLKAPETDSLNLPVDENGYITIFDGETFNGWRGYGKDRVPTKWTIEDGCIKFNGSGGGEAQDGDGGDLIFAHKFKNFELELEWKVAKGSNSGILYLAQEVTSKDKDGNDVLEPIYISAPEYQILDNANHPDAKLGKDNNRQSASLYDMIPAVPQNSKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTDMLQASKFSEDKWPLAFELLNNCGGENHEGFIGLQDHGDDVWFRNIRVKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative sugar hydrolase (BACOVA_03189) from Bacteroides ovatus at 2.40 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Hydrolase
molecule keywords putative sugar hydrolase
total genus 68
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3nmbA00
3KF5A 5FIXA 3OSDA 5FK7A 3PIJA 3PIGA 4CCEA 4JQTA 2XQRA 1Y4WA 3LIHA 4FFGA 5FMCA 3U75A 4EQVA 3ZR6A 2QQVA 2QQUA 4HXCA 4FFHA 3SC7X 4UFHA 4UFKA 1ST8A 4CCDA 4UFJA 4UFIA 4FFFA 3S5QA 4FFIA 1Y9MA 3KF3A 2QQWA 3RWKX 3HBKA 4B1LA 2AEYA 3UGHA 5FKBA 4CCCA 5ANNA 3NMBA 1W2TA 3LDKA 3LIGA 4UFMA 1Y9GA 5FMBA 3UGFA 4QHZA 5FKCA 5FMDA 3UGGA 2AEZA 1UYPA 3IMMA 3ZR5A 3U14A 4B1MA 3LF7A 2AC1A 2ADEA 2OXBA 5FK8A 4AZZA 3H3LA 3LEMA 3LFIA 2ADDA 3LDRA 4UFLA 3U1XA
chains in the Genus database with same CATH superfamily
3JQWA 1Q8VA 1XBFA 4Z92B 3PIGA 1RMU3 4I0WB 2A6XA 4GD4A 2VOXA 5FP8A 4X6RB 4HN0A 1HRV3 1GWMA 3WG1A 4B8EA 1H2LA 3OGVA 4QM8A 2BW8A 3EXUA 3POSA 1R093 3GDBA 1GNZA 1ASJ3 1UIKA 2W1QA 4Y22B 5FZBA 3T0AA 3OPZA 4Q4V3 4U2AA 2CGOA 2RMU3 1J1TA 4BMEA 4MO3M 2XLGA 3K2OA 2F4LA 2B4KA 2E33A 5DDJ3 3WHTA 3DPRA 1TVGA 5F3GA 5BNNC 4IUGA 2YZ4A 4D6RA 5A3LA 3H0OA 1NZIA 5A3PA 2QVSB 4FPFA 3ECQA 1LB2A 4YW5A 1HB4A 1LECA 3O1SA 3FLPA 5LK5A 1XE7A 4HKOA 3ORJA 3LSEA 5K0UA 1SLLA 2YBSA 4BQ1A 4XPVA 3ZPOA 1UXXX 4XBNA 1UAIA 4ZU4A 1YCIA 4Y5TA 3WG3A 5F7UA 4L0PA 2ZMKA 1SLBA 3GALA 4ARXA 1YRZA 5FZ6A 5A33A 3SH3A 3C8XA 3WVJA 1W6NA 4KWLA 3Q8BA 4UW4A 1XPWA 5GJ6A 5A7OA 2VMFA 4FTSA 4AEMA 2D6KA 2WSVA 4WM8B 1UU6A 4JKKA 3LWCA 5KHIA 3MIBA 5BUVA 4UFMA 3MIHA 4UW6A 1DLLA 5JZGB 1K45A 4QM9A 1PZ8A 2O8OA 1X9PA 2XBO1 5FZOA 5LBEA 3T2QA 2R6QA 1H1AA 3NNLA 1J58A 1CR7A 4RS5C 5HBAA 5LY2A 1W28A 4XJ9A 2ERFA 2OZ6A 2TUNA 3A0KA 1FOD1 2LALA 3N9LA 1A8DA 2DU0A 4LE3A 4P14A 3U75A 2XL9A 3VD7A 3ZYHA 4YSFA 5FY5A 3LEGA 1SZBA 1RINA 4CU6A 2MEV3 4FTEA 3H1YA 3U11A 3HQXA 1XRUA 3ZYJB 4Q29A 4DS0A 4GA9A 5I91A 5E8AA 1TMF1 4HG6B 1OF4A 3IMNA 1LHNA 4QQHA 2NP0A 1CD3G 3NAPA 2ADEA 1VBD2 3TEZA 2VMEA 2B45X 3CJIA 5FYVA 5GKAC 2JEMA 1HJGA 1LU1A 4LR4A 4A45A 1G86A 4XXAA 1ASJ2 1CAWB 3PVBB 4DXRA 3L9JT 3OB8A 1RUE3 2PHRA 4KG8A 4MGSA 5T5PA 2O8QA 4AEJA 1H2MA 2TNFA 4COWA 1YFWA 4DO0A 1KJLA 3I49A 2FD8A 3KM5A 3LEIA 4BXSV 1RITA 2MHFA 3DGTA 1PIV1 4HK9A 5BNPA 1ZZ6A 4QQOA 2B7YA 4LQRA 1RB8G 4B1MA 4IEPA 4NRQA 1TEIA 2R1DA 3MHZA 2EF6A 4B7EA 3N9OA 1CIYA 4XAEA 3UNPA 2VW2A 1LOEA 1ND3B 2OQ6A 3HPNA 2UWBA 5J96B 4XUTA 5I0UA 4CCMA 2VU9A 2OQ7A 3WOGA 1SLIA 4ES9A 2XL7A 2XOMA 5CVRA 3LAGA 1QJZA 4XUOA 5C4WA 5C3RA 1NOVA 3ABZA 1F8VA 3MFAA 4DY5A 3BODA 4YW7A 3MF9A 1H8TB 1SBFA 5FLHA 5FREA 3OD4A 5GALA 1UU5A 3K75B 5E1RA 2HH9A 1V9U3 3ME2A 3THPA 2C0ZA 2FQPA 1NCQC 2PHTA 4EN7B 4Q4Y1 1CAUB 4ZXKA 4IEWA 3P6BA 2HWB1 2XJVA 3LDBA 3POYA 3I3DA 4CDUB 2R7EB 2V5DA 2DUOA 3UT0A 2P34A 2QQLA 1XSRA 1FAYA 1RUNA 3LIHA 5EXOA 1RUC2 3B7MA 3MLKA 1X82A 3TYJA 4ATEA 4UFKA 2RM23 3QOPA 4X6QB 2G9FA 4E27A 5B4NA 1PO12 1NKGA 1YQ5A 3BGAA 4AK3A 3B9IA 5A32B 1RUG3 2GMMA 1W6PB 5BNNA 3BIWE 2C24A 3H50A 2ZJCA 1UYXA 1SCSA 2YDEA 4EN9B 3VBRC 3DYPA 1NA1B 2FMYA 1U5ZA 3R6SA 5FYTA 3LB9A 2Q8CA 4ZU7A 1FT9A 1SHWB 3HN1A 1CZSA 1XQNA 5J37A 1HXS3 1UY2A 3ZXDA 1OA3A 4N90A 5T55A 4IERA 1J3RA 1OVSA 5T5OA 1OD3A 4AYUA 5F9TA 3NJZA 3T08A 4AAXA 2BU9A 2JDYA 3LQCA 2GDFA 3RJ2X 3QH6A 2UYAA 2VTXA 4D6QA 1POQA 1G6NA 1ZA7A 3GXUA 4V2WA 3SISA 4YW3A 4AI3A 4E4DX 4XJZA 2IVIB 2RS31 1OOPB 1KXGA 1WKYA 1WA4A 2Z5WA 4G9SB 4LKDA 4IE5A 5DZEA 4JZRA 4P02B 4CCCA 2EIDA 1AR63 4W6YA 5LASA 3VBSC 1COV1 1OC1A 1LGCA 1EY2A 1XE8A 1F31A 3LDKA 2G9ZA 4OUSA 4P5YA 4RN5A 3SNMA 5FR3A 1YFUA 3T30A 1ZBA1 3PUAA 5FUNA 1FATA 1LR5A 2Y6KA 3GHMA 5LRRA 2PLV1 3HIFA 4CP2A 3VZLA 3LEMA 1JYXA 2WN2A 2Y6FA 5IVFA 3AXDA 1LOBA 5CA6A 4XJ8A 2RHPA 3AKRA 3LFMA 2AREA 4WM7B 4COVA 4E4SA 2PHWA 5K4LA 5A3UA 2BGCA 2ES3A 3KV9A 4CCNA 4CCKA 3VBSA 3O12A 3I2HA 3WW1A 1VBA3 2NLRA 4AHWA 2WA4A 4QDRA 2Q0AA 1SPPB 2G19A 4JGYB 4QGNA 3O7OA 4BLIA 4E2SA 4R4ZA 1DLCA 3JU9A 5CFCB 1T6GC 1TMF3 3H7YA 3AVSA 4L11A 4OHWA 5ANNA 3VL9A 3BUCA 1KRIA 1CESA 4PT6A 2GALA 2LRPA 4LPLA 5EYXA 1RVF1 2HLEA 2BNOA 3MV11 5T5LA 1R1A2 4LO6B 4XQ4A 1AF9A 2VQ0A 3IMMA 3FJSA 4Y1VA 4C8DA 2OVUA 1AR72 2QBXA 1SG3A 2PHLA 5CBLA 4LLOA 5IT6A 1RUH3 2VUJA 4PDWC 5B4XA 2WO2A 3AP9A 3RMXA 2YC0A 4FO9A 3ZFGA 1QMJA 1RYYA 1VALA 2UY9A 4UW5A 3FHAA 1SFPA 5IK7A 4R9CA 3ALQA 1RJ8A 2D6PA 1WZXA 3J8F2 5FKBA 1O3RA 2VBBA 1WWYA 2N7GA 3CDZB 3HQUA 5JLVA 1JZ2A 2CY6A 3O0VA 4RS5A 1WD3A 3V0BB 1ND2B 1HRV1 3ON7A 5FKCA 3I97A 5A7WA 2ZAAA 2VCBA 4OULA 2OXBA 4OMCA 1QIQA 2YBPA 5IJRA 4QXCA 2JDMA 5FIXA 4LBNA 2UY8A 5A1FA 1RUF1 1NYWA 3CKHA 3JBG3 4LBKA 3EJKA 4WM8A 2P6CA 1G9FA 1YO8A 2OYZA 5JOWA 1RUG2 2R062 4JGZC 1FXZA 2ET7A 4HANA 4LJHA 3MUZ1 1W03A 3X29B 1MQTB 1QWRA 4IV1C 2VD7A 5D1IA 2YHJA 3OY8B 4LO5B 4MHRA 2BP6A 1Q8QA 3C7EA 1MS1A 3B00A 4YZ4A 2JX9A 2PAMA 1T6BX 1S0DA 1IKQA 2FZ2A 1U5XA 2JDNA 2VW0A 2ZHLA 5B2GB 4MXWA 2DVGA 4WVMA 1VBD1 5IAXA 4I3GA 4KG0A 1JODA 2RV9A 1HRV2 3VGIA 3AP4A 5JPMB 4KNCA 5FWEA 1WLCA 2C4XA 4XMIA 3ZXAC 1Q8PA 3N3HA 3TNPB 1DQ2A 2A70A 1I5PA 1CPNA 1OVPA 2BOJA 3ILNA 2L9LA 4OLLA 3VBFA 1Z78A 1Y4WA 1O5LA 2VH9A 4Q0SA 3SKJE 1UZ0A 4CDXC 4FVVA 5C33A 3IB3A 1B09A 5C9AB 1XYOA 3CBNA 2X53S 2O1QA 3VBUB 3WF0A 5AC92 4Z07A 4ARYA 1BKZA 2BRTA 3M4FA 3NKTA 3BIEA 1QXJA 3AMPA 3WUCA 1GWLA 1C1LA 4MUVA 3IKWA 5LEKA 1UY0A 2ZMLA 1E5IA 1CVNA 5T54A 2WC2A 2VTXJ 3K4ZA 3R4UA 3ZMOA 1NXMA 3RZKA 3PTYA 1S55A 4KMQA 4PI0A 2WQ4A 1HN0A 4QPIC 4GWIA 2V5YA 2HWD3 4JGZB 5F6KA 2WO7A 4K7JA 1JS9A 4XE9A 4AFAA 4YFWA 4AI2A 4QPGC 4A44A 4GQ7A 2V4AA 2DCJA 4XUPA 4I30A 3BTYA 2D7FA 1RJ7A 4RR3C 3DPRB 4AHXA 2BERA 3IN9A 2CAUA 2OPKA 4URAA 4QB6A 2H6BA 4JDOA 2ZAHA 3WDYA 3A23A 4QX8A 1NUKA 1N1TA 2UWCA 3HBKA 1WW4A 5DUVA 1ULEA 1LEDA 1QQP3 1Q43A 4OFGA 2VZ3A 2RR13 2FBEA 3IAPA 4OVEA 3N9NA 4RL7A 2O14A 4QQ2A 1VBD3 3PVOA 2FHRA 3I3QA 3JUUA 5EJ1B 4PLMA 4TWTA 1LAJA 1A34A 3C7HA 2RVAA 4J1WA 1UKGA 1ZX5A 2V09A 2RS51 2MEV2 2VAUA 3FBMA 4NIIA 2CNAA 3USSA 1E5SA 1PVC3 2IWGB 2CU5A 5JIAA 1QJX3 5FZ9A 4L9BA 5JZGA 5CG8A 4UF0B 4J25A 4Q4W1 4E4HA 2XMLA 3S6PA 3FFZA 5K7PA 2JG9B 4N43A 4Q4Y3 4QB2A 4QQLA 5FYYA 3H8OA 3D0JA 4YVWB 4FTBA 1EYBA 1NCRA 3IPVA 2OT7A 2ORZA 1UL9A 4Q0PA 2ENRA 4OQ9A 5CFCC 1U5IA 2PHDA 1W8FA 4CYDA 1OLQA 3AC0A 3P3NA 4RHV3 4XFCA 4LA3A 3HJRA 4BIOA 5FP7A 4QDSA 4MGQA 2HWE2 4A7ZA 1TNRA 3H3LA 2TEPA 1OMIA 2QNKA 2WKKA 5A32A 4JDMA 4CDWC 1VBB2 4FOWA 4YM0A 5A6ZA 3KSCA 5FY7A 4CDWB 1UOJA 1FMD2 3POJA 2RJLA 4NIHA 1RUI1 2A5ZA 4CDQC 1VAKA 2DFBA 5HCBA 3VDDA 1ODNA 3L2YA 2WSUA 3D5OA 1OA2A 1A6CA 4GH4A 1WW7A 4IV3B 2VOWA 1DFQA 5A1AA 5LB6A 3UJQA 3I8TA 2JE7A 3TWIA 5LA2A 4BQ2A 3WF2A 4Q4X1 1PIV2 4BIFA 1YQ6A 1S0CA 4QDQA 1S2EA 2ZBJA 3USUB 1CAWA 1W39A 4A7YA 4XF4A 5GZDA 3ZSLA 2VZSA 1DQ0A 4Z2WA 1V6JA 4ONUA 1UCXA 2WABA 3VL8A 5D8AC 5J36A 1M06G 1RGSA 3C7FA 4HETA 3VLBB 2RS52 3WUDA 2WO3A 2XJQA 4LMFA 2O0OA 3ZFFC 1WLWA 4AE2A 5AC93 3OSDA 3WW4A 1VB4A 3H8RA 3ZM8A 3O1RA 4LULA 5EWSA 1PO13 4AAPA 3VZOA 1VMFA 2WS93 4AG4A 1Y43B 1W2AX 2VUDA 3TNQA 1W8ZA 3IM0A 2RE9A 2I45A 2E31A 4KI5M 4NN0A 4ISRA 5DZFA 3GZAA 5C8CA 3SQOA 2RMU1 3ZFFB 4H7MA 3OG2A 2VNVA 3GCXA 1H0BA 3MIGA 4IEQA 3T4VA 1WLDA 2W2IA 3HAGA 4H3WA 4ZU5A 4RR3B 1LTEA 5IVVA 4D7TA 2JG8C 1BLZA 2K0GA 2FDKA 2BNMA 2OZJA 3ACIA 1H8TA 4M0NA 1KDKA 4N9HA 5FZ1A 2X8KA 5CB7A 1YLLA 3WNOA 5C3SA 2P3IA 3SHRA 4EQVA 2C6SA 2W91A 3UKNA 1KDMA 1XC6A 1FMD1 4IV3C 4XDQA 1L7LA 1KGYA 2W52A 3RI8A 2LS6A 3S57A 2WJSA 3A22A 3DEMA 5DAXA 4Q4W3 1CAUA 5ERLA 2HKXA 3POBA 4SLIA 1VP6A 3SMHA 3FLTA 4UW3A 3W58A 2VY0A 1I9RA 1H8TC 4I3PA 1B35A 1VLNA 2RS11 2ZHMA 3WY6A 1QJEA 1W9TA 2XJSA 2Y0OA 1W0NA 2NZ9A 2X10A 4P9XA 1F5JA 1CN1A 1UYPA 3NNJA 4AEDC 2W9XA 3VDCA 3HNBM 4DOUA 1UIJA 2ZX3A 3WDWA 1UXZA 3CEWA 2WWSA 1DHKB 1OPMA 1F2NA 3GBGA 3M2MA 3MUY1 4HSLA 4MZUA 4YVWC 2ID4A 2ZOEB 4F83A 1NA1A 1PMJX 4BQXA 2P3JA 4LT5A 1H9PA 1D0HA 1HB1A 2WZEA 4I09A 4JX0A 3LE0A 2DCZA 5EP9A 3WNMA 2QQMA 2WT0A 2QDRA 2WZ8A 2XKPA 1PO21 2A75A 3RYKA 4HBNA 1R1A3 3FUOA 4HPKA 4M3CA 4J6GA 2VNRA 4YGCA 4IL7A 4Q1RA 1OUXA 1Q3EA 2XBO2 2XB6C 4Q0VA 4XJUA 5T52A 4XUQA 2CL2A 2WLPA 4FPGA 4GMP1 4HOOA 2VZ1A 4Y22A 4CEYB 1IS5A 2NN8A 4XXPA 5GLVA 3RS6A 3MZHA 1DGRN 3VB9A 4CPBD 4XTMA 2YMZA 1MVEA 1CAXA 5GM0A 2JIJA 2ZPXA 5FCCA 1DCSA 4UWDA 3MICA 5ANQA 1C57A 2BFUL 3Q8AA 4RFT0 1QOTA 4BQWA 5CU1A 5JXGA 2VECA 4LHLA 3LCPA 1PIV3 2A73B 3SEPA 5CFDC 2XUEA 4QKNA 4A41A 3T4HB 3RZLA 3LOBA 1ODMA 1X36A 2C1FA 1V6IA 4D7YA 1O4TA 1X50A 2PA7A 4QPIB 1FPN3 2XR4A 3N7LA 3NV4A 1TNFA 4DNYA 1QJX1 3PUQA 4HONA 4XQWA 2EIEA 3W20A 3WNNA 2A3WA 4XF0A 1JZ5A 2EXHA 4S2FA 4ZONA 1N1YA 4OUMA 1RUH2 2WFF1 2BDRA 1KITA 5CFDA 3WD5A 3ZFEA 4C1XA 3SCFA 1W3XA 3J7NA 2YY1A 2D97A 2E6VA 3VBUC 1GICA 1NY71 3W5NA 4IW3A 4XQDA 5FZOB 2Y26A 4F3JA 1CAVA 4JGZA 3DKWA 1MS4A 1VJ2A 3ETPA 2ATFA 2R041 3GYDA 1IPJA 3MIDA 5F2WA 4Z8BA 1AL0G 1W04A 2ZZQA 3O14A 1FYUA 4FPJA 5A3OA 1A3KA 1IPSA 2WIIB 4X8PA 1W8WA 5H9SA 2MPFA 2OUJA 2I2SA 1HLCA 2D6NA 4ES8A 2YGLA 2NYYA 4QPGA 4CU7A 1HN1A 2X29A 4XFFA 3EB7A 1MR5A 1VR3A 2ZXQA 3WF3A 4RYDA 1E5RA 4YZ3A 1QH6A 3EYPA 4CXYA 4XDPA 3D8CA 2WQZC 4TLGA 3AL5A 3ZSKA 1TQ5A 4QX1A 1RUJ1 4UOJA 4BDVB 3P3PA 3LOIA 1YQ2A 1YC61 2WYFA 5EQUA 1CWPA 5K0UB 5LWBA 4EN0A 2XQXA 3WSOA 1JW6A 1WBFA 1UY3A 1O4YA 4IEYA 1HRI3 2QQJA 1LHOA 2IC1A 2NM1A 3AFGA 3NKGA 3TN91 3M7AA 5JSPA 1NLRA 3C3VA 2JE9A 2HWC2 5FPZA 1NE6A 4EWEA 4K1ZA 3PTRB 1JTZX 1GP5A 1J59A 2DCYA 2IVJA 1MZ6A 1BEV1 2ARAA 5HXVA 3RGBA 4IEXA 3WW3A 4YFZA 3RZJA 2R30A 4KH9A 4ZZ5A 3I3MA 3AB0A 4UXAA 5FY9A 3MW3A 3UKTA 1J84A 3LSDA 4FT8A 1VMHA 3SKVA 5IATA 4XF9A 1POV0 4JDNA 5DN2A 3ZYFA 4ZHNA 2D40A 5FBJA 5J98B 3DECA 3AZWA 5IK4A 2ZKLA 2VOKA 5GLTA 3O5SA 3AZYA 4MH0E 4DXZA 2VM9A 3GM8A 1QEXA 5A80A 2Q8OA 3F95A 3WNLA 1WMFA 2VMGA 4XBQA 5FXZA 5LA1A 2Q8DA 1EP0A 1MS0A 2FCUA 2BJSA 1ZVFA 1GQPA 4Y24A 1UZZA 1K5JA 2HEVF 4K8FA 3LGRA 1F4HA 3WDXA 1SDDB 4P9YA 4FOYA 5F37A 4NMIA 5H9PA 2ZX2A 2F6BA 3DUIA 2QQVA 3GNEA 2VZPA 2GSYA 5FUIA 1RUE1 4W8JA 5C3OA 1UZWA 5BNOB 2XJRA 3CJIB 3GZEA 4Y1UA 1UMIA 5LATA 5JXHA 1NAEA 3RVHA 2VCAA 1Z7S1 4YZ1A 2PQQA 1DGRA 2BVVA 1C8M1 3VHNA 4XAAA 5EPAA 4MGKE 3TB0A 1HIXA 1UYYA 1UX7A 2DUQA 2X5IB 1N1SA 2BVBA 5GLWA 1E5HA 1OOPA 5C8CB 2ZCWA 3E6BA 4BISA 1RUG1 3SXWA 1JYCA 4CA9A 4ITCA 2JDPA 3CMGA 3IDAA 3DYMA 4DFSA 4GWNA 4QPWA 4N9IA 1PHMA 5ACA2 4NROA 4IETA 4KWKA 2QKDA 3W5MA 1R083 4YGBA 2YFZA 4EN6B 5FLIA 5I93A 4YVSB 3R0RA 2RMU2 3J4UH 4B1LA 1XYPA 1WGPA 1ULDA 3DYOA 3ZYRA 2HWE3 2Y6HA 3C7OA 3AP7A 5JMOA 4OQ8A 1AR73 3KT4A 1TME2 2XJUA 3ILFA 5LRSA 4IV1B 1IKPA 1C8M2 1UOFA 4KBZA 1CJDA 3VHPA 2LUWA 3WZ1A 4YPJA 3AX4A 3WNPA 3EBRA 4JTNA 2DVDA 3NVCA 3U07A 3QH7A 1NCRC 5CFCA 5FPLA 2BGOA 3VZJA 5LEJA 2GC2A 4MXWB 2OIIA 1OLME 1NG0A 4A3ZA 1GZ9A 4NAMA 1SBEA 1ND2C 3D0SA 5FPXA 2ARBA 3HNMA 3E5XA 5K9YA 2R043 2ZTNA 2HWC3 3P1IA 3V56A 2JDUA 3NV2A 2G9GA 3GZUC 2JKXA 4I02A 4CEYC 3H1WA 2KXLA 1TZOA 3OBZA 4IE0A 5FZMA 1ZZ7A 4HK8A 1SPPA 4DXSA 2EICA 2HYXA 1JZ3A 1H2KA 2ADDA 1WCKA 2VL4A 4UFLA 5IW0A 4Q4V2 2RJ2A 1Z7S3 4EWAA 2FDFA 3DCQA 3S7EA 1OFNA 1G8WA 4RS5B 4LNVA 1O3TA 1PM7A 4M0HA 3USUA 3VBHA 1ONAA 4IESA 4UFHA 5KXCA 3FFQA 4OHZA 4FFFA 2G1MA 2DDUA 4CP9B 1H9WA 1KEXA 3WF1A 1V70A 4NRMA 3VZNA 2Y6LA 1IGOA 1YFYA 1HV0A 5FV3A 2BOIA 1W2TA 4WV8A 1YEWA 2D5HA 5GLZA 5J3UA 1B35C 1OXCA 3ZFEC 1MQTA 4CU8A 2X5IC 4CDXA 5JR7B 1JZ8A 3U0ZA 2RS33 1JZ7A 2ET1A 4FSJA 2XVLA 3BB6A 1G9BA 1A8MA 5DUWA 5A3MA 5DAWA 4IE6A 4OYUA 3PIJA 4Q2FA 3W21A 3W59A 4BQ3A 4JCKA 2H0VA 3VHOA 3KB5A 5BNQA 1NCQA 1MQTC 5BNNB 4GMP3 2DBNA 1V0AA 4WZFA 4NWWA 1G7YA 3VDBA 1BZWA 2PAEA 4V1PA 5JR2A 1YFXA 5DAQA 5A1LA 2P37A 4XVHA 5DMYA 2ZHKA 5E89A 3N9MA 3VN4A 3VUOA 2XPJA 3S0MA 1ZA4A 2ZX4A 4FOVA 1LNSA 1O6UA 1VE0A 2H0BA 1QJFA 4D94A 1VBA1 1SCRA 4ZPIA 2QQOA 3OY8A 4LK7A 5ACA3 1VRH1 4QGMA 1OD5A 2MNGA 3CIHA 3U1XA 4XCAA 3U78A 5FDBA 3D3AA 4DMIA 1D4M2 1BBT3 2VQUA 3IDCB 3AYCA 3KZ4C 3WEZA 1D2QA 2KD7A 2J1SA 1O91A 4HXCA 1FOD2 3T1MA 1RUJ2 2VZQA 4JRAA 5DPNA 4ZS2A 4AW7A 4CVUA 3O1UA 4NOTA 3U4SA 1KQRA 1K5MA 1UYZA 3K4AA 2XWBB 4MYEA 2K9ZA 5FBZA 1I3HA 3RSJA 4O9GA 4PDWB 5FPBA 2K2SA 3H9AA 1MVQA 4MLOA 1W6MB 2B8MA 2QZ2A 3R05A 4EYUA 1BVVA 3MYXA 4RFRB 4LA2A 1O4ZA 5D8AB 1GV9A 2JWPA 1AUYA 1SQ4A 3WQ1A 3WNKA 3CZJA 4AFBA 5J09A 5LBCA 4Q0UA 1UY4A 2VXRA 2VNOA 1BVP1 4FPEA 2J1UA 3BN6A 2NMOA 1F9KA 4MHUA 3LA3A 1UMZA 1E57A 4AFCA 2CDPA 5GZFA 1QKQA 1H6XA 1RUC3 4NE9A 5HPOA 4SBVA 4XIKA 5AVPA 4FOQA 1JXNA 2WT2A 2WWJA 5F1RA 3O1TA 2D98A 2W0XA 3JD73 3PHMA 2PMWB 4CTEA 2ORXA 5F5AA 4JHTA 2VZUA 3S5QA 4BQ5A 2IXIA 1C5HA 3KF3A 4YNIA 2EVXA 3WCSA 5EV7A 2D3PA 1J3QA 4QU1A 1UOBA 4ZS3A 2VMCA 2C9KA 2RDNA 3UKVA 1VBC2 3POIA 3QLQA 2BWAA 5DXDA 2WZR2 2WNEA 4BK4A 1ULOA 1V00A 4N7UA 4NPRA 2FZ1A 4XACA 4P5HA 3MO4A 2AC1A 1QJX2 2JG8A 3E5QA 1M4WA 4HKLA 1X7NA 4UAPA 4P9LA 4AI8A 1HV1A 3FUQA 4ZKTB 3SH4A 5F32A 1ND3C 5KBFA 5CYYA 3B02A 1BYHA 1W6OA 1FPN1 3KGZA 3CHXA 4DRVA 3H7JA 5BYNA 2JG9C 3BVCA 2P5BA 4WVMB 4WZCA 4UFJA 3F2ZA 1D4M3 4WVWA 2BGPA 2VG9A 1OH4A 3HVDA 1F4AA 1N47A 5CIRA 4YLZA 2DU1A 4Q8KA 1LOFC 3JB4C 1RUD1 1FOD3 4CCJA 4WM7A 3LA7A 2VMIA 3VBFB 1MS3A 3BTAA 3FE5A 4AEKA 1XNKA 1W0OA 3CU7A 3LA2A 3EQEA 4A6OA 4N53A 1APNA 3B69A 4HN1A 4MGZE 3MGUA 3BPSA 3U14A 3A7QA 3U37A 4EE2A 4Y4YA 5L7OB 1N3OA 1MPXA 2QJVA 4JGYA 1AR62 1Q56A 2YB7A 4LBLA 2ZEXA 5ABJC 1S1AA 4XCBA 4JKLA 1G9AA 1AXKA 4FFGA 2CSGA 1IS4A 1EV11 1ULFA 1HKDA 1HQWA 4QXHA 1CPMA 3ZYBA 5CISA 1WCUA 1LGBA 3I2GA 5EYYA 5C5TA 5BNOC 3I2OA 4OCTA 4QKDA 1WMDA 3UYJA 1HXS2 2E7AA 2UYBA 4QPGB 5FPAA 3NW4A 3OJBA 3FHQA 4CDWA 5FWJA 3KLSA 4JHZA 4GJZA 4CPBA 5DUXA 3PLQA 3HOBA 3ZIXA 1NE4A 5H9QA 4CDQA 2BPA2 3ASIA 1YJLA 4JV4A 1ZRIA 1GFF2 2R072 5KXBA 2PQSA 4AZZA 4FQ4A 3V0AA 4HVRA 1DQ5A 3D6EA 4JRLA 4LE4A 4FP2A 5IHRA 1P8JA 2Y6GA 4FCAA 1LOGA 2PAKA 4H55A 4P9JA 4EJRA 4TZDA 1REEA 4M3CB 4XW3A 2XXZA 3OOXA 4QX0A 3WR0A 5FZIA 2R0FA 5FXVA 4L2NA 5BV6A 1CONA 3GGLA 5FYMA 4CEYA 3FZ3A 1BQPA 2VZOA 4LOSA 1VBC1 2EA7A 3JBG1 1QQP1 2VGDA 1H30A 4TSVA 4WBBA 1H4HA 4AVVA 3I2DA 1GZWA 3N35A 3PMSA 4WVVA 2Y34A 4FPHA 5CG9A 3RWNA 1UW8A 1AR91 1S0FA 3E6DA 2E9QA 3WG4A 1US2A 2VBPA 4OMDA 5F3EA 3HT1A 2IFRA 1UKRA 1V9U1 2CGPA 2GNBA 4GJYA 4PCRA 5K0UC 1HJFA 3C2UA 1DYKA 2JB4A 2A71A 1O3QA 4EZHA 3LPGA 3KGLA 2XGXA 2JD4A 1D0GA 2RDRA 3HBZA 4PLOA 1TME1 3NMBA 2D6OX 1RXGA 4LEJA 3AJYA 4QT6A 4Q26A 5FMBA 3ZN6A 3VDDB 4AQ2A 4WM7C 4GH4B 1WMEA 2AEZA 4LLFA 4NHLA 1H4GA 5F6LB 2GNTA 5FO7B 2P17A 3ACHA 3U10A 3CJIC 1VIWB 5AVAA 2DCTA 3AJZA 1H6YA 4MSVA 3WX5A 1DYOA 2GMPA 2H6CA 3JCIA 2HWB2 4R9DA 3T1LA 3M70A 1B35B 1W06A 4GB31 2R49A 2WINB 3MPPG 1GOGA 4M00A 3PUSA 5IVBA 2A6ZA 2GN7A 1GWKA 1R082 1KJRA 1J83A 3N7MA 3KHBA 1XNTA 1ZZ8A 4LUKA 3S30A 4BMBA 2E53A 3N36A 3ST7A 5ISLA 2Y0IA 4CCOA 2HWD1 5I0TA 2BBAA 2W94A 4CUAA 2A6WA 5JWPA 2ZGLA 3NV3A 2V73A 1C8NA 1LCLA 5FMDA 3O1VA 2YV8A 4R52A 4O7XA 5C5UA 1OURA 2IFWA 3G7DA 4LORA 1MZEA 1OQ1A 2VC9A 4Y33A 2Q1MA 5JXIA 1PVC2 4Z2AA 1VAVA 1X8EA 4N7IA 3J7MA 4WM8C 1COV3 3J9SA 2I74A 3QCWA 4DIQA 2DBIA 4QB1A 1HB2A 1GSLA 2XQRA 4LBQB 2OUHA 2YPDA 3AK0A 5FZHA 2E51A 3HT2A 3WDVA 1AJKA 2Y8KA 3E1F1 2XJTA 3HEIA 1BMV2 2Y38A 1C3HA 1SMVA 2AENA 2QQKA 1AR93 1WW6A 3JD71 5F5CA 3RWKX 4Z82A 3K51A 1JH5A 1QQP2 5KC5A 4FAGA 5FZCA 1IZ3A 2W39A 4P9GA 3VDDC 2DWRA 3WQ0A 1I1EA 3BCWA 5I8SA 4F7ZA 2JIGA 3J7HA 3ZR5A 5KHJA 4N43B 4RGAA 3RZHA 2V4VA 4DRRA 4COYA 1CAVB 2DTWA 2GNMA 3NV1A 2GC0A 5FO9B 2EXKA 2ETEA 4QWNA 5DG1A 1BEV3 4K6BA 5EZWA 1MS9A 3JXSA 4JAAA 4LO4B 3RDIA 1OBNA 5KR7A 4LO8A 3OGGA 4P00B 1WA6X 2HYKA 3NNGA 3L2HA 4IGPA 1GNYA 5K8SA 1AX0A 3KT1A 1G9CA 1CZTA 1QU0A 2GAUA 2J42A 3VZKA 3NNFA 3WNXA 1XYNA 1DGLA 3M3QA 2RS32 1UN1A 4PQQA 4Q4X3 3ZFEB 2JB8A 4GB33 4D3WA 5I8YA 1BBT1 3VBRA 4DINB 3ATGA 3PVNA 4LIVA 1NQDA 5J7MA 3VBHB 5A70A 2YFUA 4FPCA 3BTXA 1BK1A 3IDEA 2X05A 1ULCA 3M3OA 3VBUA 5BNOA 3C7GA 1L3JA 5L9BA 3QD6A 1V6MA 3AKSA 3POGA 4AEDB 5AFBA 1O8SA 4P9IA 1HDKA 3I59A 3IDBB 2XG3A 4V2VA 3ROUA 3AMMA 5C3PA 3INAA 3P5BA 3KWVA 3SLIA 1K12A 5C70A 4LKFA 5E88A 2YXSA 4FXKB 5F3CA 3ETQA 1PX4A 1ST8A 5A3WA 3E6CC 1VBE3 3LPFA 1VBB3 2AYHA 5LY1A 2QQPA 2ZGPA 4J1XA 1C5IA 4E9KA 1W6OB 3I3EA 2W68A 4C90A 3OYWA 1IG3A 1ZNPA 4K3UA 4TLFA 5JSOA 1GYKA 3UGGA 2OA2A 1X9TA 3OPWA 3D4KA 5FPUA 2W1WA 3FN9A 2ZZJA 3LDRA 1GP4A 3DV8A 3OGSA 4BHPA 2AGSA 1PGL1 1ZRRA 2WN3A 4P08A 3B93A 4RQPA 2EALA 3W9AA 1GOHA 2AR6A 2XLFA 2ZKNA 3KS7A 1PM4A 4FI9A 2PN5A 1GZTA 3A0NA 4Q4W2 3RNSA 4DZGA 1DDLA 4A7KA 5KWRA 1W6QA 1KFXL 2J1EA 4KL1A 2WNUB 3WLUA 1W2UA 2VUCA 1YWKA 4KQ7A 4XHBA 4AVCA 1QNWA 4AVTA 1QJY3 4OHYA 4CXWA 4R8HA 2W1SA 4I0BA 2YBKA 1AXYA 1YQ8A 5FP9A 4FPOB 4E8CA 5CEHA 3BOPA 2BTVC 5EJ3A 3VBFC 4C0HA 2ZX1A 4UF0A 4XFGA 2WQ8A 4A4AA 2E7QA 1OLMA 1D4VB 4IE7A 2GC1A 2VMDA 4YZ5A 4QU2A 2VQAA 4QKBA 4PDWA 2DF7A 2P4EA 3WW2A 4GULA 1AR92 2DVFA 3MF6A 2GMEA 4XFAA 2DVAA 5FY4A 2VXJA 1W2OA 2WAOA 2NQYA 5JI9A 2AUYA 4XZUG 1HXS1 3OGRA 4XFBA 1AZDA 3KV5A 1AX2A 2AEYA 1S2KA 1ZM1A 3AZVA 2XJPA 3HR9A 3JBG2 4N43C 5CKNA 2IXJA 1YI9A 1S0GA 2QFEA 3H8UA 3DL3A 5CAZA 3K77A 4A3XA 3I2KA 2A3YA 3KHCA 2DUPA 2D3RA 4XBLA 4DQAA 4LO7A 3VDAA 1YUDA 4CE8A 2FDGA 4AI9A 3VKFC 1PMHX 4CP9A 3I2JA 2A1XA 1Y7BA 3AL6A 3MW4A 5FZLA 5FYZA 4YW1A 4BLJA 3CZUA 3T3YA 5A6QA 2A3XA 2CV6A 2GH8A 1ZBE3 5M0TA 4OI0A 1T2XA 4HVOA 5LA9A 4LBMA 5C4WC 2J22A 1BMV1 1H2NA 2QQIA 4RSUA 2PELA 4IV1A 5BPXA 4ET7A 1AYN2 2J1VA 4QPYA 2LW8A 2XDVA 1OOPC 1YI7A 3PL0A 1H1IA 4AGGA 2J7MA 4PIXA 4NRPA 3OUJA 1PGW1 2AACA 3ACLA 1OF3A 1RTVA 5JCTA 1NQJA 1LHVA 1X8MA 1Y9GA 3ZSJA 2ZABA 2Y33A 5DABA 3THTA 2A7AA 1ENQA 2PLV2 1O8PA 1QY4A 4GMP0 4QGLA 5FZFA 3KMHA 1XU1A 2XUMA 4GIQA 4XUNA 3KQ4B 1ZBA2 4EV0A 5LCWL 1SACA 2Z42A 3KCCA 1XB9A 4OI2A 3MLLA 4Q1PA 1QHDA 1AR61 3B9CA 1RUF3 2DFCA 2E26A 3M3EA 3V64A 2KA3A 3ZFFA 2BWCA 3N9PA 3OTFA 2DYCA 3NJVA 3DN7A 1U0AA 1OSGA 4CEWA 1S0EA 3AP6A 4CSWA 4Y1ZA 4QX2A 5CFDB 5FZ8A 2WO1A 3LD8A 3DPRC 3N9QA 3K48A 1SBDA 2JJ6A 2RM22 4JVAA 1X33A 4L8QA 1WCSA 4B7KA 1D2SA 5FY8A 3URFA 3RYRA 3OEBA 1WMXA 1K5MB 4BE3A 1O5UA 1W0PA 5I0DA 3HWJA 2GZWA 1ZRDA 1AVBA 1DIWA 2PTMA 3GCWA 4Q5OA 1OH3A 5FFOC 4CDQB 5D8AA 1RVF3 2VCCA 4PF1A 5G04L 1AYM3 1UY1A 5KXEA 1V9U2 1AHSA 3RI9A 1Y9MA 3SITA 5F5QA 1UQXA 3ZN5A 3B94A 1OQEA 4XETA 5L36A 4X8NA 1TG7A 1S0IA 1HQLA 4Q4Y2 3JB8A 2P3KA 2W47A 1OKOA 1ZBE2 2ZHNA 1UPIA 5LK7B 5IFTA 3FC0A 2SLIA 4UI9L 4DEQA 4AVAA 3D82A 3CNAA 1OHFA 3ILRA 4QHOA 3Q8CA 4HPKB 4YM1A 3LEKA 5FYUA 4KGGA 3I54A 1NY72 3WT3A 1S4CA 2WRAA 2XWJB 1SDWA 2WBKA 3WP4A 1ZBA3 2D5FA 2QQUA 4JC1A 3ZPYA 3N4MA 1NX9A 2ZACA 4BPZA 2GU9A 3T0DA 2WUHA 4BU2A 4WVZA 1OQDA 3H3ZA 2WR9A 3MFCA 3M1HA 3DKQA 5FZDA 5KHHA 4M4PA 1REDA 3SEEA 4H2AA 3TEWA 1VAMA 4DUWA 2ZGSA 1AR71 2WL1A 1NCQB 1RUOA 2R0HA 1XXNA 1LULA 2ZGOA 3RYPA 3BU0A 3K46A 3OGJA 3ITQA 1D4M1 4YGDA 4XDOA 1GOFA 1PK6B 1AL21 1PK6C 3KF5A 2UU8A 1QDOA 4YW2A 1W6MA 1DGWA 1UF2C 1AYM1 2HBTA 2W46A 3IWZA 1FI2A 4JTOA 1RUI2 1V6LA 1ENXA 3KT7A 1PX3A 3WF4A 4UYBA 2ZGMA 5L7OC 1SEFA 1U12A 1CX1A 2WNOA 4DEVA 3OBTA 1QJY1 4TYSA 4AVBA 1AX1A 3Q9OA 3SH5A 4AL9A 4C91A 2YROA 4P9WA 3PNAA 5FYIA 1PGW2 4YG3A 2RM21 3BTZA 4Q4V1 4QD2A 1BEV2 3RZZA 3J8F3 5JOXA 5C8WA 2EIBA 1IPKA 3RFRA 1Q8SA 3WHUA 2IZWA 5HCAA 1REFA 2FCTA 4MXVA 4Y26A 3KV6A 1AYM2 5FOJB 3OEAA 2F17A 1RMU1 1SLTA 1IHMA 2OPWA 2BUKA 3E5UA 3JD72 4DB5A 2K46A 1RMU2 4CDXB 3JZVA 2FDHA 3VBHC 3A4UA 5C8CC 1RHI1 4B4QA 2VVDA 2FDIA 3VKMA 4RQPB 5EJZB 5JXJA 2IXLA 3BI3A 1PO23 5IVJA 1EAH3 4AF9A 1ZZCA 1N1VA 1POV3 4AGRA 4YRDA 2E63A 4DXTA 5BY5A 1U5YA 2JECA 3ZMNA 1STMA 5BNPC 2YU2A 2E32A 3NRUA 2VPVA 3QACA 4XF1A 4YZ2A 4S2DA 3ZR6A 2LTNA 4ASKA 2EIGA 5KC6A 5DAPA 3TOJA 3PJQA 2D6MA 1K5MC 1Z0HA 3RZMA 1PO11 3WINE 5C6CA 2JG8B 5L7OA 1R081 1AJOA 3TBDA 1MEC1 2RS13 2ZEZA 1PVXA 3OUHA 3EHKA 4Y4RA 4BXFA 1RUI3 5FTTC 1C4RA 4IEZA 3ACFA 4QHBA 3ZVXA 4U36A 5JZGC 4NHYA 1OI6A 2HEYF 5E16A 1BXHA 2JDHA 4BOWA 1Y9QA 5IVYA 1TME3 1KFUL 3SCHA 2CWMA 2R1BA 1ASJ1 3ZOIA 4D8MA 1FV3A 1ZRCA 1BK0A 4N53C 2HWD2 2W92A 5A7QA 3CQOA 1DZTA 5FQ0A 3K3OA 1QJU3 4NHXA 2R042 4K8RB 4XFIA 4E2QA 2NPIA 5ABJA 4XMAA 4HL0A 1UWWA 4E2GA 1POV1 1GKBA 4RA0A 4XURA 1HB3A 2D44A 2BNNA 3AKQA 5SV5A 1F5FA 4M01A 3AYDA 2RDQA 4FP3A 1RHI3 1CJPA 4GZ9A 4XJWA 5T3NA 2AZ5A 4G3YC 5DUUA 4DUXA 1QJU1 1ENSA 1YYNA 2RR12 3OBAA 5FK7A 2DVBA 1RUH1 2WFF2 2G4IA 3T2PA 4INDA 5J48A 4OI4A 2UURA 3AYAA 2IXHA 4R4XA 4F8AA 1S0BA 5BNPB 2JDKA 3O1MA 2YUEA 3KV4A 5IK8A 1PO22 3UK9A 5FO8B 1Z7S2 1GP6A 2BYVE 4A42A 3APBA 4CCLA 2ZGNA 1HX6A 4MOAA 4RQPC 5T5JA 2J1AA 4AHZA 2EAAA 3I3BA 4COUA 1UZVA 1W05A 1GQGA 3ZN4A 1GBGA 4LBQD 1OT5A 1LGNA 4NUBA 2W3JA 1VRH3 4D6SA 1EUUA 1QXRA 2HWB3 4MGIE 5IWFA 3T0BA 2WNUA 3UETA 3VD5A 3TN93 2B9UA 4YM2A 3ZDSA 2JENA 1MEC3 2PHXA 3IZOA 4L99A 1JMUB 2HWC1 4LITA 4LK6A 3VBOC 5HI0A 3N7JA 1N3PA 4I2OA 3ZFGC 5JMCA 5F3IA 5A3NA 2HJIA 1UU4A 3O1PA 1LJ7A 1GZWB 2WWUA 5FYHA 4AFMA 3KVAA 5I8TA 2RJKA 2KM2A 3HN3A 2UWAA 1PNFA 2HBUA 2R32A 2XONA 3GF6A 1OPOA 1W9WA 1BCXA 4PIYA 5FPVA 2VVFA 3HNYM 3UGHA 3ZYGA 2YG0A 3AKPA 4CUGA 4FXGB 3AYEA 2W95A 5A7PA 5JSRA 3ZO0B 2BQPA 2VMHA 4UBHA 3NAPC 5FYCA 4GALA 2YC2A 3MLJA 5KXDA 1R091 5GZEA 2QTWB 2B39A 3ZDVA 3KCXA 3O1OA 3SC7X 1ALYA 4KU7A 2VQTA 1I6XA 3WCRA 3WDUA 1WW5A 5DZGA 4BZ4A 3PUHA 2V72A 4CP1A 4ZXEA 1AYN1 2WNVB 2ZGQA 1GZCA 3HMYA 3MV01 3VD4A 2BBVA 2YPJA 4C0BA 3S5AA 5JDBA 2JDAA 3NAPB 4FFIA 1W90A 1W8OA 4AEDA 2RS12 4LXLA 1L7RA 2KR2A 3LIGA 4LBJA 4KWUA 4Y1XA 4O9EA 4YWAA 5LZ6A 4OI1A 3CLPA 3CF6E 2JD9A 3B5LB 1DZRA 4QAWA 3MDPA 3IIIA 1WBLA 4YVSC 1VB2A 2VZTA 1JYVA 3MPBA 4K21A 4Y3OA 4DPNA 4IEOA 3WP6A 4NO4A 4NIGA 1QJU2 2RR11 1NXD1 5HV0A 4MX3A 5FXWA 1FNZA 4CRQA 1AXZA 1DQ4A 1HRI2 1WLTA 4LKEA 5ACA1 2IXKA 5IK5A 4KU8A 3RQ0A 1NLSA 5FRAA 2Z79A 1PNGA 3FL7A 3UESA 3WQ7A 2ZS6B 1WCQA 4IEUA 1VBC3 4RD7A 3POEA 3UGFA 2YYOA 1KS4A 3PDQA 4A2UA 1DQ6A 1QH7A 4UBGA 4IDZA 4CEWC 4MGTA 5HCHA 3KCYA 4M3CE 4BJ0A 1MZFA 2EXIA 3LFIA 1W6NB 4RGKA 1NZCA 3FBYA 4HKWA 1YJKA 2RG4A 5DG2A 1AR82 3ZX7A 5IVEA 3OD0A 3VBOA 2E7TA 4TTGA 4E4ZA 2J1TA 3MIFA 4LHKA 5FMCA 4E8DA 4NVPA 2R061 3BU7A 4PI2A 4RGGA 1WD4A 1EPWA 4D0QA 3N7KA 2FCVA 3RZGA 1XU2A 1W9YA 1LHWA 1YIPA 2YC4A 4R9BA 3WQBA 4XEZA 3ZSMA 4Q4X2 3AMQA 5EIYB 1GU3A 4XJAA 2R073 1DZQA 2I07B 5A7NA 1MEC2 1V6NA 2VNGA 2OKXA 5LW9A 1VRH2 1C28A 1GANA 2ILMA 3AP5A 4LUMA 4Y20A 1F35A 3U4XA 1AR81 3VV1A 2CYFA 1IOAA 1QXPA 5JI7A 2BV4A 2GC3A 5FZKA 2CDOA 3M8LA 4CCEA 5FZ0A 3VBRB 4QXKA 1ND2A 2YU1A 3LKJA 1C8M3 3ES1A 3AVRA 3THCA 4AI1A 1MZ5A 4KBBA 2XLAA 4QQPA 1BJQA 4EZ4A 4NR1A 3T2TA 1CGPA 2JE8A 3IIAA 1RUE2 2WZPP 4ZZ8A 4K20A 4Q0QA 2GNDA 3PVEA 4GKYA 2CHHA 4I01A 2Q1FA 4W6WA 3BYWA 3VKNA 2JXAA 2D93A 1R1A1 1CIWA 2JICA 3R4DB 1LODA 4LBQA 2Y60A 4QHZA 3B01A 4CDUC 2ZMNA 3WXPA 1HW5A 1VBE1 3IT8A 2CGNA 1IS3A 2ZEWA 1AL22 5LBFA 3WV6A 4NIDA 1UOGA 4FPLA 4QX3A 2D3SA 4YG6A 3PURA 1XNDA 3PU8A 5FY0A 4NHKA 1PZ9A 2WDBA 5FXXA 3VKLA 2VJXA 2XBO3 1JUIA 3KD4A 2Z2SB 4YW6A 2D43A 3POWA 4NWVA 3HQRA 4CDUA 2PXJA 3OF1A 1PK6A 4UT5A 4W65A 1W8TA 1LESA 3QBQA 4MG2A 1JYIA 2JDZA 3AMHA 3PJYA 5E6HA 1CQ9A 3V65A 3OUIA 2ZA9A 3VBSB 1YHFA 1XNAA 4PIZA 5CADA 3J26N 3T09A 1W9FA 1AR83 5J1XA 1ZRFA 5AFEA 4FAHA 2CTVA 3NJXA 3I2FA 2B42B 4B4PA 3FMGA 1W8HA 1JOJA 3AM2A 4ZY9A 1RUC1 1IS6A 3ZKYA 1AYN3 4D7SA 4K40A 4H7LA 3POFA 1SLAA 5TSWA 1XNCA 3ZN6B 4N53B 1FPN2 1JYTA 2HWF1 5CKQA 2XVKA 2ZEYA 1EV12 3CL1A 4YW4A 4PBPA 4YG0A 3WDTA 1NT0A 1LHUA 5FMOL 3OBRA 5BXXA 1JZ6A 1URXA 1LRHA 2ZGRA 2QUOA 4AQTA 1C1FA 4QX5A 1NA1C 2WZR1 2ZGUA 4LHNA 4LTAA 4NHMA 3H42B 5IVCA 3FWEA 5GZGA 2GN3A 2QZ3A 1DG6A 1PMIA 1O7FA 2C5DA 1VBB1 4YGEA 1RUF2 3NO8A 4XOGA 3LZZA 5LA0A 3ZXEA 2HWE1 3ZXGA 2YGMA 4COZA 3WP3A 4YYOA 5I0SA 3BALA 3MBWA 1J1LA 1UO9A 3NNMA 2PFWA 3O0XA 4AFDA 3I7DA 2J1RA 3O0WA 4PJYA 2OS2A 4AGVA 2IXCA 1ULPA 3THDA 4MVTA 3BKZA 3NL1A 1RL3A 3V0AB 1PGSA 1TE1B 2QQWA 3RJRA 2B46X 4LIUA 1UNBA 2QQNA 3FLRA 2DCKA 1OKQA 3NWKA 1ND3A 5FYSA 1ULGA 5FYBA 4AVSA 1DYPA 4NJ4A 1FMD3 1LENA 5FP4A 3MI8A 1GNHA 2R16A 2VE1A 4RHV2 4CEWB 5JUVA 5FMOS 2JKBA 1OUSA 1DGWX 5F5IA 5A33B 3VD9A 2WFF3 5A3TA 1JHJA 2P6HA 4FPKA 4IEVA 4S2HA 5FJKA 1DP0A 5D2AA 1ZREA 1O3SA 1NCRB 3IPVB 4ATFA 4BK5A 4AQ6A 1NLQA 1FX5A 1QOOA 1GR3A 4O65A 2A6VA 1IQDC 3AMNA 1RIRA 3NJYA 4BQYA 1ZYBA 4AOCA 2VR4A 1VMJA 1JU4A 4GWJA 5FAXA 1WCDJ 2XVGA 3AKTA 2EXJA 1UD1A 1AL23 3TEXA 4AXOA 1VBA2 4TN7A 4ORFA 1EV13 4PBOA 5CZKA 3FHIB 2WNVA 3TN92 3ZKUA 4AHYA 5SV8A 3GZTB 3ZFGB 4EN8B 4CUCA 2QDNA 1RXFA 2QE3A 4Y5SA 5GZCA 2BEOA 3TRSB 1SFYA 1QOSA 3ES4A 3PMEA 2MEV1 4KGQA 4PQ9A 4L92A 1QNYA 1UMHA 2VOTA 1YIFA 1QDCA 4JQTA 2WS91 3WP5A 4AR2A 3Q8FA 4YARA 2X09A 2WS92 4FFHA 4H14A 5DAVA 2TBVA 2HWF3 3I2IA 5FZEA 3RPQA 2ZGTA 1DF0A 3AZXA 3FX3A 4NAOA 4XFHA 1L7QA 5GLUA 5AC91 2QCSB 3GJBA 4HLTA 1I5ZA 1W2NA 4META 4LKSA 4IXLA 4XIOA 4YM3A 4GXLA 2R071 3TAYA 4DUVA 1W8NA 1TMF2 2Q4SA 5JIUA 3ZIWA 5LBBA 4ASLA 2VZRA 4HVQA 1YNAA 2Q30A 3ZSEA 1JU3A 4XF3A 4BQ4A 3CO2A 4BWOA 4JKMA 5FY1A 1PVC1 4Q27A 2B9VA 4N8MA 3GHNA 4K1YA 5DDJ1 4CXXA 3OYWB 1UX6A 5A7WB 4AWDA 5KHKA 2SBAA 3HD8B 4IGOA 4HSJA 5F8PA 2GP5A 4PLNA 1J3PA 4BCUA 3GJAA 5FP3A 1JYWA 1QF3A 1ACCA 3MIEA 2WT1A 4IE4A 3Q8EA 2A6YA 3IBMA 3AZZA 4RHV1 1EUTA 4AI0A 2FMDA 3K4DA 4PHZA 1A78A 2VCMA 1VBE2 2ARCA 1V6KA 1W6QB 1PZ7A 2Y6JA 4JGYC 1RC6A 3MEPA 4BA6A 5C4WB 4FBFA 5JPNB 4JQRA 5C7GA 4QKFA 3M3CA 1XE0A 1Q8OA 2XKOA 4B3NA 4CU9A 4CP0A 4M3CF 1R1ZA 4OHVA 1YQCA 1OFSA 1H1MA 1ENRA 2W5FA 3VHRA 5A6YA 4GH4C 2Q8EA 4Y20B 2DTYA 3J8F1 2DV9A 3GBWA 1QJY2 5DQ0A 2VBDA 5EFUA 4IGQA 5FUPA 3TEYA 1WUVA 1JN2P 1XOYA 4MV2A 4FPYA 1V6OA 1RUD3 4W4ZA 1JI6A 3KVBA 2Q5TA 5CKMA 4D69A 5FZ4A 1XJAA 1LOFA 2ARXA 3H3UA 3J7LA 4A6SA 4IV3A 4HFSA 4EWDA 4HZFA 1DQ1A 3ZLIA 5L19A 2VW1A 3KQRA 5FQ0B 1LOCA 2W08A 4K9SA 1ZBE1 3WG2A 3DXUA 1ZZBA 4Y5Z0 5FZ7A 1EPZA 1H8VA 3ZYPA 4XZPA 3EO6A 2HWF2 1ZZ9A 1HRI1 1CX4A 4LBOA 5IFPA 1GMMA 1W3VA 3JQXA 2OW4A 1EAH2 1VPHA 4B4RA 1UZYA 4CCDA 1D7PM 5I0RA 5D21A 1O59A 2GH2A 2BZDA 3I59B 4G4FA 3M3IA 3BPZA 4URTA 1JUHA 1FV2A 1K3IA 3AFKA 1MACA 4XTPA 1W9SA 4KWJA 3ACGA 3ZYIB 3LF7A 2C9AA 5FK8A 1DU3D 1JHNA 1GUIA 1W99A 2XHKA 3ELNA 1JYNA 3ZXLA 4GWMA 1HQNA 5A6XA 3PU3A 2Y64A 3OPTA 3A21A 1DBNA 2VZVA 1EAH1 1OLRA 4BYYA 3MW2A 4AQSA 1XSQA 3RG0A 1Q5OA 4ISQA 1W8UA 4I0AA 4OUEA 2NMNA 2WFPA 1IQAA 4C1WA 1BBT2 5A7SA 1XNBA 4DY3A 2CAVA 5C71A 2OX0A 1G9DA 3ENRA 1R092 4OZOA 3VZMA 5C9AA 3ZXJA 1MS8A 5G05L 2DURA 2VULA 2Z69A 1VRBA 1Y3TA 1JBCA 1MS5A 2JG9A 4XYXA 2PYTA 4EROA 4LOTA 2VTFA 1GLHA 4XILA 4YVWA 5T50A 2PHFA 3K3NA 3B3QE 5IAVA 2F4PA 1LU2A 3UL2A 4NPLA 5ABJB 1OA4A 1S0JA 3PUIA 3CJXA 1JZ4A 5FOBB 2VUAA 5L9VA 4MGYE 5C9AC 2IUWA 1SFNA 5EHDA 4XABA 5IUQA 2X5IA 4O61A 2P2KA 4QMAA 4S2GA 5F39A 5L9RA 2AH2A 4LHSA 5F2SA 4NIAA 3VKOA 2Z4FA 4R9AA 3UJOA 1RUD2 1COV2 4Y1YA 4PF5A 2W87A 1RHI2 2C26A 3BOWA 4HT1T 2P3YA 5IYYA 3DF0A 2RDSA 2ZX0A 3R4SA 2XH6A 2ZGKA 4NPMA 3H8XA 3I4IA 2VVEA 4W6XA 5APAA 4FQZA 1RUJ3 4B29A 3T2OA 4YVSA 2WA3A 1KS5A 3S7IA 3E97A 1W6PA 1S2BA 4BM8A 2D6LX 2W1UA 3H1MA 3RRDA 2HEWF 4TXWA 1FNYA 5H9RA 1BHGA 1JOPA 2PHUA 2WZR3 2WYSA 3V0BA 2WNUC 3IAQA 2LM3A 1LKNA 5DDJ2 2EAKA 2PLV3 5JOYA 1LEMA 4HMZA 4ASMB 2WNVC 4Z1VA 1GQHA 1YXWA 4GKXA 4CZSA 4QXBA 5L73A 2BFUS 1LOAA 3NSTA 1CAXB 4QX7A 4L97A 1US3A 5C3QA 5HXMA 2WLQA 4M4RA 5FLJA 1SLCA 3AXEA 3ZXFA 3DXTA 4MADA 2FDJA 2WAAA 5HCFA 5FZ3A 4Q8LA 5JAXA 2VO5A 2P1BA 1R64A 3EMRA 1QGLA 5KHGA 5FJHA 5CNAA 1K42A 4GB32 3VD3A 4BH9A 2RS53 4QPIA 5JVVA 2R063 4BB3A 5JOZA 3G6JB 3RMYA 4GAZA 4W50A 4XHXA 1JOBA 3UV9A 4UFIA 3SCGA 3GBFA 3OCPA 5FZGA 4RR3A 2VOVA 1N3QA 1IG0A 1UPSA 3ZXKA 3NQHA 4IQPA 3VBOB 1KD7A 4CUBA 2LROA 5FZAA 4OHXA 2GP3A 4XC9A 5HV4A 1RVF2 4OZXA 1CZVA 1F15A 1PGL2 2XHNA 2CWSA 2B5HA 2Q1ZB
chains in the Genus database with same CATH topology
3KF5A 5FIXA 3OSDA 5FK7A 3PIJA 3PIGA 4CCEA 4JQTA 2XQRA 1Y4WA 3LIHA 4FFGA 5FMCA 3U75A 4EQVA 3ZR6A 2QQVA 2QQUA 4HXCA 4FFHA 3SC7X 4UFHA 4UFKA 1ST8A 4CCDA 4UFJA 4UFIA 4FFFA 3S5QA 4FFIA 1Y9MA 3KF3A 2QQWA 3RWKX 3HBKA 4B1LA 2AEYA 3UGHA 5FKBA 4CCCA 5ANNA 3NMBA 1W2TA 3LDKA 3LIGA 4UFMA 1Y9GA 5FMBA 3UGFA 4QHZA 5FKCA 5FMDA 3UGGA 2AEZA 1UYPA 3IMMA 3ZR5A 3U14A 4B1MA 3LF7A 2AC1A 2ADEA 2OXBA 5FK8A 4AZZA 3H3LA 3LEMA 3LFIA 2ADDA 3LDRA 4UFLA 3U1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF5 A;  5FIX A;  3OSD A;  5FK7 A;  3PIJ A;  3PIG A;  4CCE A;  4JQT A;  2XQR A;  1Y4W A;  3LIH A;  4FFG A;  5FMC A;  3U75 A;  4EQV A;  3ZR6 A;  2QQV A;  2QQU A;  4HXC A;  4FFH A;  3SC7 X;  4UFH A;  4UFK A;  1ST8 A;  4CCD A;  4UFJ A;  4UFI A;  4FFF A;  3S5Q A;  4FFI A;  1Y9M A;  3KF3 A;  2QQW A;  3RWK X;  3HBK A;  4B1L A;  2AEY A;  3UGH A;  5FKB A;  4CCC A;  5ANN A;  3NMB A;  1W2T A;  3LDK A;  3LIG A;  4UFM A;  1Y9G A;  5FMB A;  3UGF A;  4QHZ A;  5FKC A;  5FMD A;  3UGG A;  2AEZ A;  1UYP A;  3IMM A;  3ZR5 A;  3U14 A;  4B1M A;  3LF7 A;  2AC1 A;  2ADE A;  2OXB A;  5FK8 A;  4AZZ A;  3H3L A;  3LEM A;  3LFI A;  2ADD A;  3LDR A;  4UFL A;  3U1X A; 
#chains in the Genus database with same CATH topology
 3JQW A;  1Q8V A;  1XBF A;  4Z92 B;  3PIG A;  1RMU 3;  4I0W B;  2A6X A;  4GD4 A;  2VOX A;  5FP8 A;  4X6R B;  4HN0 A;  1HRV 3;  1GWM A;  3WG1 A;  4B8E A;  1H2L A;  3OGV A;  4QM8 A;  2BW8 A;  3EXU A;  3POS A;  1R09 3;  3GDB A;  1GNZ A;  1ASJ 3;  1UIK A;  2W1Q A;  4Y22 B;  5FZB A;  3T0A A;  3OPZ A;  4Q4V 3;  4U2A A;  2CGO A;  2RMU 3;  1J1T A;  4BME A;  4MO3 M;  2XLG A;  3K2O A;  2F4L A;  2B4K A;  2E33 A;  5DDJ 3;  3WHT A;  3DPR A;  1TVG A;  5F3G A;  5BNN C;  4IUG A;  2YZ4 A;  4D6R A;  5A3L A;  3H0O A;  1NZI A;  5A3P A;  2QVS B;  4FPF A;  3ECQ A;  1LB2 A;  4YW5 A;  1HB4 A;  1LEC A;  3O1S A;  3FLP A;  5LK5 A;  1XE7 A;  4HKO A;  3ORJ A;  3LSE A;  5K0U A;  1SLL A;  2YBS A;  4BQ1 A;  4XPV A;  3ZPO A;  1UXX X;  4XBN A;  1UAI A;  4ZU4 A;  1YCI A;  4Y5T A;  3WG3 A;  5F7U A;  4L0P A;  2ZMK A;  1SLB A;  3GAL A;  4ARX A;  1YRZ A;  5FZ6 A;  5A33 A;  3SH3 A;  3C8X A;  3WVJ A;  1W6N A;  4KWL A;  3Q8B A;  4UW4 A;  1XPW A;  5GJ6 A;  5A7O A;  2VMF A;  4FTS A;  4AEM A;  2D6K A;  2WSV A;  4WM8 B;  1UU6 A;  4JKK A;  3LWC A;  5KHI A;  3MIB A;  5BUV A;  4UFM A;  3MIH A;  4UW6 A;  1DLL A;  5JZG B;  1K45 A;  4QM9 A;  1PZ8 A;  2O8O A;  1X9P A;  2XBO 1;  5FZO A;  5LBE A;  3T2Q A;  2R6Q A;  1H1A A;  3NNL A;  1J58 A;  1CR7 A;  4RS5 C;  5HBA A;  5LY2 A;  1W28 A;  4XJ9 A;  2ERF A;  2OZ6 A;  2TUN A;  3A0K A;  1FOD 1;  2LAL A;  3N9L A;  1A8D A;  2DU0 A;  4LE3 A;  4P14 A;  3U75 A;  2XL9 A;  3VD7 A;  3ZYH A;  4YSF A;  5FY5 A;  3LEG A;  1SZB A;  1RIN A;  4CU6 A;  2MEV 3;  4FTE A;  3H1Y A;  3U11 A;  3HQX A;  1XRU A;  3ZYJ B;  4Q29 A;  4DS0 A;  4GA9 A;  5I91 A;  5E8A A;  1TMF 1;  4HG6 B;  1OF4 A;  3IMN A;  1LHN A;  4QQH A;  2NP0 A;  1CD3 G;  3NAP A;  2ADE A;  1VBD 2;  3TEZ A;  2VME A;  2B45 X;  3CJI A;  5FYV A;  5GKA C;  2JEM A;  1HJG A;  1LU1 A;  4LR4 A;  4A45 A;  1G86 A;  4XXA A;  1ASJ 2;  1CAW B;  3PVB B;  4DXR A;  3L9J T;  3OB8 A;  1RUE 3;  2PHR A;  4KG8 A;  4MGS A;  5T5P A;  2O8Q A;  4AEJ A;  1H2M A;  2TNF A;  4COW A;  1YFW A;  4DO0 A;  1KJL A;  3I49 A;  2FD8 A;  3KM5 A;  3LEI A;  4BXS V;  1RIT A;  2MHF A;  3DGT A;  1PIV 1;  4HK9 A;  5BNP A;  1ZZ6 A;  4QQO A;  2B7Y A;  4LQR A;  1RB8 G;  4B1M A;  4IEP A;  4NRQ A;  1TEI A;  2R1D A;  3MHZ A;  2EF6 A;  4B7E A;  3N9O A;  1CIY A;  4XAE A;  3UNP A;  2VW2 A;  1LOE A;  1ND3 B;  2OQ6 A;  3HPN A;  2UWB A;  5J96 B;  4XUT A;  5I0U A;  4CCM A;  2VU9 A;  2OQ7 A;  3WOG A;  1SLI A;  4ES9 A;  2XL7 A;  2XOM A;  5CVR A;  3LAG A;  1QJZ A;  4XUO A;  5C4W A;  5C3R A;  1NOV A;  3ABZ A;  1F8V A;  3MFA A;  4DY5 A;  3BOD A;  4YW7 A;  3MF9 A;  1H8T B;  1SBF A;  5FLH A;  5FRE A;  3OD4 A;  5GAL A;  1UU5 A;  3K75 B;  5E1R A;  2HH9 A;  1V9U 3;  3ME2 A;  3THP A;  2C0Z A;  2FQP A;  1NCQ C;  2PHT A;  4EN7 B;  4Q4Y 1;  1CAU B;  4ZXK A;  4IEW A;  3P6B A;  2HWB 1;  2XJV A;  3LDB A;  3POY A;  3I3D A;  4CDU B;  2R7E B;  2V5D A;  2DUO A;  3UT0 A;  2P34 A;  2QQL A;  1XSR A;  1FAY A;  1RUN A;  3LIH A;  5EXO A;  1RUC 2;  3B7M A;  3MLK A;  1X82 A;  3TYJ A;  4ATE A;  4UFK A;  2RM2 3;  3QOP A;  4X6Q B;  2G9F A;  4E27 A;  5B4N A;  1PO1 2;  1NKG A;  1YQ5 A;  3BGA A;  4AK3 A;  3B9I A;  5A32 B;  1RUG 3;  2GMM A;  1W6P B;  5BNN A;  3BIW E;  2C24 A;  3H50 A;  2ZJC A;  1UYX A;  1SCS A;  2YDE A;  4EN9 B;  3VBR C;  3DYP A;  1NA1 B;  2FMY A;  1U5Z A;  3R6S A;  5FYT A;  3LB9 A;  2Q8C A;  4ZU7 A;  1FT9 A;  1SHW B;  3HN1 A;  1CZS A;  1XQN A;  5J37 A;  1HXS 3;  1UY2 A;  3ZXD A;  1OA3 A;  4N90 A;  5T55 A;  4IER A;  1J3R A;  1OVS A;  5T5O A;  1OD3 A;  4AYU A;  5F9T A;  3NJZ A;  3T08 A;  4AAX A;  2BU9 A;  2JDY A;  3LQC A;  2GDF A;  3RJ2 X;  3QH6 A;  2UYA A;  2VTX A;  4D6Q A;  1POQ A;  1G6N A;  1ZA7 A;  3GXU A;  4V2W A;  3SIS A;  4YW3 A;  4AI3 A;  4E4D X;  4XJZ A;  2IVI B;  2RS3 1;  1OOP B;  1KXG A;  1WKY A;  1WA4 A;  2Z5W A;  4G9S B;  4LKD A;  4IE5 A;  5DZE A;  4JZR A;  4P02 B;  4CCC A;  2EID A;  1AR6 3;  4W6Y A;  5LAS A;  3VBS C;  1COV 1;  1OC1 A;  1LGC A;  1EY2 A;  1XE8 A;  1F31 A;  3LDK A;  2G9Z A;  4OUS A;  4P5Y A;  4RN5 A;  3SNM A;  5FR3 A;  1YFU A;  3T30 A;  1ZBA 1;  3PUA A;  5FUN A;  1FAT A;  1LR5 A;  2Y6K A;  3GHM A;  5LRR A;  2PLV 1;  3HIF A;  4CP2 A;  3VZL A;  3LEM A;  1JYX A;  2WN2 A;  2Y6F A;  5IVF A;  3AXD A;  1LOB A;  5CA6 A;  4XJ8 A;  2RHP A;  3AKR A;  3LFM A;  2ARE A;  4WM7 B;  4COV A;  4E4S A;  2PHW A;  5K4L A;  5A3U A;  2BGC A;  2ES3 A;  3KV9 A;  4CCN A;  4CCK A;  3VBS A;  3O12 A;  3I2H A;  3WW1 A;  1VBA 3;  2NLR A;  4AHW A;  2WA4 A;  4QDR A;  2Q0A A;  1SPP B;  2G19 A;  4JGY B;  4QGN A;  3O7O A;  4BLI A;  4E2S A;  4R4Z A;  1DLC A;  3JU9 A;  5CFC B;  1T6G C;  1TMF 3;  3H7Y A;  3AVS A;  4L11 A;  4OHW A;  5ANN A;  3VL9 A;  3BUC A;  1KRI A;  1CES A;  4PT6 A;  2GAL A;  2LRP A;  4LPL A;  5EYX A;  1RVF 1;  2HLE A;  2BNO A;  3MV1 1;  5T5L A;  1R1A 2;  4LO6 B;  4XQ4 A;  1AF9 A;  2VQ0 A;  3IMM A;  3FJS A;  4Y1V A;  4C8D A;  2OVU A;  1AR7 2;  2QBX A;  1SG3 A;  2PHL A;  5CBL A;  4LLO A;  5IT6 A;  1RUH 3;  2VUJ A;  4PDW C;  5B4X A;  2WO2 A;  3AP9 A;  3RMX A;  2YC0 A;  4FO9 A;  3ZFG A;  1QMJ A;  1RYY A;  1VAL A;  2UY9 A;  4UW5 A;  3FHA A;  1SFP A;  5IK7 A;  4R9C A;  3ALQ A;  1RJ8 A;  2D6P A;  1WZX A;  3J8F 2;  5FKB A;  1O3R A;  2VBB A;  1WWY A;  2N7G A;  3CDZ B;  3HQU A;  5JLV A;  1JZ2 A;  2CY6 A;  3O0V A;  4RS5 A;  1WD3 A;  3V0B B;  1ND2 B;  1HRV 1;  3ON7 A;  5FKC A;  3I97 A;  5A7W A;  2ZAA A;  2VCB A;  4OUL A;  2OXB A;  4OMC A;  1QIQ A;  2YBP A;  5IJR A;  4QXC A;  2JDM A;  5FIX A;  4LBN A;  2UY8 A;  5A1F A;  1RUF 1;  1NYW A;  3CKH A;  3JBG 3;  4LBK A;  3EJK A;  4WM8 A;  2P6C A;  1G9F A;  1YO8 A;  2OYZ A;  5JOW A;  1RUG 2;  2R06 2;  4JGZ C;  1FXZ A;  2ET7 A;  4HAN A;  4LJH A;  3MUZ 1;  1W03 A;  3X29 B;  1MQT B;  1QWR A;  4IV1 C;  2VD7 A;  5D1I A;  2YHJ A;  3OY8 B;  4LO5 B;  4MHR A;  2BP6 A;  1Q8Q A;  3C7E A;  1MS1 A;  3B00 A;  4YZ4 A;  2JX9 A;  2PAM A;  1T6B X;  1S0D A;  1IKQ A;  2FZ2 A;  1U5X A;  2JDN A;  2VW0 A;  2ZHL A;  5B2G B;  4MXW A;  2DVG A;  4WVM A;  1VBD 1;  5IAX A;  4I3G A;  4KG0 A;  1JOD A;  2RV9 A;  1HRV 2;  3VGI A;  3AP4 A;  5JPM B;  4KNC A;  5FWE A;  1WLC A;  2C4X A;  4XMI A;  3ZXA C;  1Q8P A;  3N3H A;  3TNP B;  1DQ2 A;  2A70 A;  1I5P A;  1CPN A;  1OVP A;  2BOJ A;  3ILN A;  2L9L A;  4OLL A;  3VBF A;  1Z78 A;  1Y4W A;  1O5L A;  2VH9 A;  4Q0S A;  3SKJ E;  1UZ0 A;  4CDX C;  4FVV A;  5C33 A;  3IB3 A;  1B09 A;  5C9A B;  1XYO A;  3CBN A;  2X53 S;  2O1Q A;  3VBU B;  3WF0 A;  5AC9 2;  4Z07 A;  4ARY A;  1BKZ A;  2BRT A;  3M4F A;  3NKT A;  3BIE A;  1QXJ A;  3AMP A;  3WUC A;  1GWL A;  1C1L A;  4MUV A;  3IKW A;  5LEK A;  1UY0 A;  2ZML A;  1E5I A;  1CVN A;  5T54 A;  2WC2 A;  2VTX J;  3K4Z A;  3R4U A;  3ZMO A;  1NXM A;  3RZK A;  3PTY A;  1S55 A;  4KMQ A;  4PI0 A;  2WQ4 A;  1HN0 A;  4QPI C;  4GWI A;  2V5Y A;  2HWD 3;  4JGZ B;  5F6K A;  2WO7 A;  4K7J A;  1JS9 A;  4XE9 A;  4AFA A;  4YFW A;  4AI2 A;  4QPG C;  4A44 A;  4GQ7 A;  2V4A A;  2DCJ A;  4XUP A;  4I30 A;  3BTY A;  2D7F A;  1RJ7 A;  4RR3 C;  3DPR B;  4AHX A;  2BER A;  3IN9 A;  2CAU A;  2OPK A;  4URA A;  4QB6 A;  2H6B A;  4JDO A;  2ZAH A;  3WDY A;  3A23 A;  4QX8 A;  1NUK A;  1N1T A;  2UWC A;  3HBK A;  1WW4 A;  5DUV A;  1ULE A;  1LED A;  1QQP 3;  1Q43 A;  4OFG A;  2VZ3 A;  2RR1 3;  2FBE A;  3IAP A;  4OVE A;  3N9N A;  4RL7 A;  2O14 A;  4QQ2 A;  1VBD 3;  3PVO A;  2FHR A;  3I3Q A;  3JUU A;  5EJ1 B;  4PLM A;  4TWT A;  1LAJ A;  1A34 A;  3C7H A;  2RVA A;  4J1W A;  1UKG A;  1ZX5 A;  2V09 A;  2RS5 1;  2MEV 2;  2VAU A;  3FBM A;  4NII A;  2CNA A;  3USS A;  1E5S A;  1PVC 3;  2IWG B;  2CU5 A;  5JIA A;  1QJX 3;  5FZ9 A;  4L9B A;  5JZG A;  5CG8 A;  4UF0 B;  4J25 A;  4Q4W 1;  4E4H A;  2XML A;  3S6P A;  3FFZ A;  5K7P A;  2JG9 B;  4N43 A;  4Q4Y 3;  4QB2 A;  4QQL A;  5FYY A;  3H8O A;  3D0J A;  4YVW B;  4FTB A;  1EYB A;  1NCR A;  3IPV A;  2OT7 A;  2ORZ A;  1UL9 A;  4Q0P A;  2ENR A;  4OQ9 A;  5CFC C;  1U5I A;  2PHD A;  1W8F A;  4CYD A;  1OLQ A;  3AC0 A;  3P3N A;  4RHV 3;  4XFC A;  4LA3 A;  3HJR A;  4BIO A;  5FP7 A;  4QDS A;  4MGQ A;  2HWE 2;  4A7Z A;  1TNR A;  3H3L A;  2TEP A;  1OMI A;  2QNK A;  2WKK A;  5A32 A;  4JDM A;  4CDW C;  1VBB 2;  4FOW A;  4YM0 A;  5A6Z A;  3KSC A;  5FY7 A;  4CDW B;  1UOJ A;  1FMD 2;  3POJ A;  2RJL A;  4NIH A;  1RUI 1;  2A5Z A;  4CDQ C;  1VAK A;  2DFB A;  5HCB A;  3VDD A;  1ODN A;  3L2Y A;  2WSU A;  3D5O A;  1OA2 A;  1A6C A;  4GH4 A;  1WW7 A;  4IV3 B;  2VOW A;  1DFQ A;  5A1A A;  5LB6 A;  3UJQ A;  3I8T A;  2JE7 A;  3TWI A;  5LA2 A;  4BQ2 A;  3WF2 A;  4Q4X 1;  1PIV 2;  4BIF A;  1YQ6 A;  1S0C A;  4QDQ A;  1S2E A;  2ZBJ A;  3USU B;  1CAW A;  1W39 A;  4A7Y A;  4XF4 A;  5GZD A;  3ZSL A;  2VZS A;  1DQ0 A;  4Z2W A;  1V6J A;  4ONU A;  1UCX A;  2WAB A;  3VL8 A;  5D8A C;  5J36 A;  1M06 G;  1RGS A;  3C7F A;  4HET A;  3VLB B;  2RS5 2;  3WUD A;  2WO3 A;  2XJQ A;  4LMF A;  2O0O A;  3ZFF C;  1WLW A;  4AE2 A;  5AC9 3;  3OSD A;  3WW4 A;  1VB4 A;  3H8R A;  3ZM8 A;  3O1R A;  4LUL A;  5EWS A;  1PO1 3;  4AAP A;  3VZO A;  1VMF A;  2WS9 3;  4AG4 A;  1Y43 B;  1W2A X;  2VUD A;  3TNQ A;  1W8Z A;  3IM0 A;  2RE9 A;  2I45 A;  2E31 A;  4KI5 M;  4NN0 A;  4ISR A;  5DZF A;  3GZA A;  5C8C A;  3SQO A;  2RMU 1;  3ZFF B;  4H7M A;  3OG2 A;  2VNV A;  3GCX A;  1H0B A;  3MIG A;  4IEQ A;  3T4V A;  1WLD A;  2W2I A;  3HAG A;  4H3W A;  4ZU5 A;  4RR3 B;  1LTE A;  5IVV A;  4D7T A;  2JG8 C;  1BLZ A;  2K0G A;  2FDK A;  2BNM A;  2OZJ A;  3ACI A;  1H8T A;  4M0N A;  1KDK A;  4N9H A;  5FZ1 A;  2X8K A;  5CB7 A;  1YLL A;  3WNO A;  5C3S A;  2P3I A;  3SHR A;  4EQV A;  2C6S A;  2W91 A;  3UKN A;  1KDM A;  1XC6 A;  1FMD 1;  4IV3 C;  4XDQ A;  1L7L A;  1KGY A;  2W52 A;  3RI8 A;  2LS6 A;  3S57 A;  2WJS A;  3A22 A;  3DEM A;  5DAX A;  4Q4W 3;  1CAU A;  5ERL A;  2HKX A;  3POB A;  4SLI A;  1VP6 A;  3SMH A;  3FLT A;  4UW3 A;  3W58 A;  2VY0 A;  1I9R A;  1H8T C;  4I3P A;  1B35 A;  1VLN A;  2RS1 1;  2ZHM A;  3WY6 A;  1QJE A;  1W9T A;  2XJS A;  2Y0O A;  1W0N A;  2NZ9 A;  2X10 A;  4P9X A;  1F5J A;  1CN1 A;  1UYP A;  3NNJ A;  4AED C;  2W9X A;  3VDC A;  3HNB M;  4DOU A;  1UIJ A;  2ZX3 A;  3WDW A;  1UXZ A;  3CEW A;  2WWS A;  1DHK B;  1OPM A;  1F2N A;  3GBG A;  3M2M A;  3MUY 1;  4HSL A;  4MZU A;  4YVW C;  2ID4 A;  2ZOE B;  4F83 A;  1NA1 A;  1PMJ X;  4BQX A;  2P3J A;  4LT5 A;  1H9P A;  1D0H A;  1HB1 A;  2WZE A;  4I09 A;  4JX0 A;  3LE0 A;  2DCZ A;  5EP9 A;  3WNM A;  2QQM A;  2WT0 A;  2QDR A;  2WZ8 A;  2XKP A;  1PO2 1;  2A75 A;  3RYK A;  4HBN A;  1R1A 3;  3FUO A;  4HPK A;  4M3C A;  4J6G A;  2VNR A;  4YGC A;  4IL7 A;  4Q1R A;  1OUX A;  1Q3E A;  2XBO 2;  2XB6 C;  4Q0V A;  4XJU A;  5T52 A;  4XUQ A;  2CL2 A;  2WLP A;  4FPG A;  4GMP 1;  4HOO A;  2VZ1 A;  4Y22 A;  4CEY B;  1IS5 A;  2NN8 A;  4XXP A;  5GLV A;  3RS6 A;  3MZH A;  1DGR N;  3VB9 A;  4CPB D;  4XTM A;  2YMZ A;  1MVE A;  1CAX A;  5GM0 A;  2JIJ A;  2ZPX A;  5FCC A;  1DCS A;  4UWD A;  3MIC A;  5ANQ A;  1C57 A;  2BFU L;  3Q8A A;  4RFT 0;  1QOT A;  4BQW A;  5CU1 A;  5JXG A;  2VEC A;  4LHL A;  3LCP A;  1PIV 3;  2A73 B;  3SEP A;  5CFD C;  2XUE A;  4QKN A;  4A41 A;  3T4H B;  3RZL A;  3LOB A;  1ODM A;  1X36 A;  2C1F A;  1V6I A;  4D7Y A;  1O4T A;  1X50 A;  2PA7 A;  4QPI B;  1FPN 3;  2XR4 A;  3N7L A;  3NV4 A;  1TNF A;  4DNY A;  1QJX 1;  3PUQ A;  4HON A;  4XQW A;  2EIE A;  3W20 A;  3WNN A;  2A3W A;  4XF0 A;  1JZ5 A;  2EXH A;  4S2F A;  4ZON A;  1N1Y A;  4OUM A;  1RUH 2;  2WFF 1;  2BDR A;  1KIT A;  5CFD A;  3WD5 A;  3ZFE A;  4C1X A;  3SCF A;  1W3X A;  3J7N A;  2YY1 A;  2D97 A;  2E6V A;  3VBU C;  1GIC A;  1NY7 1;  3W5N A;  4IW3 A;  4XQD A;  5FZO B;  2Y26 A;  4F3J A;  1CAV A;  4JGZ A;  3DKW A;  1MS4 A;  1VJ2 A;  3ETP A;  2ATF A;  2R04 1;  3GYD A;  1IPJ A;  3MID A;  5F2W A;  4Z8B A;  1AL0 G;  1W04 A;  2ZZQ A;  3O14 A;  1FYU A;  4FPJ A;  5A3O A;  1A3K A;  1IPS A;  2WII B;  4X8P A;  1W8W A;  5H9S A;  2MPF A;  2OUJ A;  2I2S A;  1HLC A;  2D6N A;  4ES8 A;  2YGL A;  2NYY A;  4QPG A;  4CU7 A;  1HN1 A;  2X29 A;  4XFF A;  3EB7 A;  1MR5 A;  1VR3 A;  2ZXQ A;  3WF3 A;  4RYD A;  1E5R A;  4YZ3 A;  1QH6 A;  3EYP A;  4CXY A;  4XDP A;  3D8C A;  2WQZ C;  4TLG A;  3AL5 A;  3ZSK A;  1TQ5 A;  4QX1 A;  1RUJ 1;  4UOJ A;  4BDV B;  3P3P A;  3LOI A;  1YQ2 A;  1YC6 1;  2WYF A;  5EQU A;  1CWP A;  5K0U B;  5LWB A;  4EN0 A;  2XQX A;  3WSO A;  1JW6 A;  1WBF A;  1UY3 A;  1O4Y A;  4IEY A;  1HRI 3;  2QQJ A;  1LHO A;  2IC1 A;  2NM1 A;  3AFG A;  3NKG A;  3TN9 1;  3M7A A;  5JSP A;  1NLR A;  3C3V A;  2JE9 A;  2HWC 2;  5FPZ A;  1NE6 A;  4EWE A;  4K1Z A;  3PTR B;  1JTZ X;  1GP5 A;  1J59 A;  2DCY A;  2IVJ A;  1MZ6 A;  1BEV 1;  2ARA A;  5HXV A;  3RGB A;  4IEX A;  3WW3 A;  4YFZ A;  3RZJ A;  2R30 A;  4KH9 A;  4ZZ5 A;  3I3M A;  3AB0 A;  4UXA A;  5FY9 A;  3MW3 A;  3UKT A;  1J84 A;  3LSD A;  4FT8 A;  1VMH A;  3SKV A;  5IAT A;  4XF9 A;  1POV 0;  4JDN A;  5DN2 A;  3ZYF A;  4ZHN A;  2D40 A;  5FBJ A;  5J98 B;  3DEC A;  3AZW A;  5IK4 A;  2ZKL A;  2VOK A;  5GLT A;  3O5S A;  3AZY A;  4MH0 E;  4DXZ A;  2VM9 A;  3GM8 A;  1QEX A;  5A80 A;  2Q8O A;  3F95 A;  3WNL A;  1WMF A;  2VMG A;  4XBQ A;  5FXZ A;  5LA1 A;  2Q8D A;  1EP0 A;  1MS0 A;  2FCU A;  2BJS A;  1ZVF A;  1GQP A;  4Y24 A;  1UZZ A;  1K5J A;  2HEV F;  4K8F A;  3LGR A;  1F4H A;  3WDX A;  1SDD B;  4P9Y A;  4FOY A;  5F37 A;  4NMI A;  5H9P A;  2ZX2 A;  2F6B A;  3DUI A;  2QQV A;  3GNE A;  2VZP A;  2GSY A;  5FUI A;  1RUE 1;  4W8J A;  5C3O A;  1UZW A;  5BNO B;  2XJR A;  3CJI B;  3GZE A;  4Y1U A;  1UMI A;  5LAT A;  5JXH A;  1NAE A;  3RVH A;  2VCA A;  1Z7S 1;  4YZ1 A;  2PQQ A;  1DGR A;  2BVV A;  1C8M 1;  3VHN A;  4XAA A;  5EPA A;  4MGK E;  3TB0 A;  1HIX A;  1UYY A;  1UX7 A;  2DUQ A;  2X5I B;  1N1S A;  2BVB A;  5GLW A;  1E5H A;  1OOP A;  5C8C B;  2ZCW A;  3E6B A;  4BIS A;  1RUG 1;  3SXW A;  1JYC A;  4CA9 A;  4ITC A;  2JDP A;  3CMG A;  3IDA A;  3DYM A;  4DFS A;  4GWN A;  4QPW A;  4N9I A;  1PHM A;  5ACA 2;  4NRO A;  4IET A;  4KWK A;  2QKD A;  3W5M A;  1R08 3;  4YGB A;  2YFZ A;  4EN6 B;  5FLI A;  5I93 A;  4YVS B;  3R0R A;  2RMU 2;  3J4U H;  4B1L A;  1XYP A;  1WGP A;  1ULD A;  3DYO A;  3ZYR A;  2HWE 3;  2Y6H A;  3C7O A;  3AP7 A;  5JMO A;  4OQ8 A;  1AR7 3;  3KT4 A;  1TME 2;  2XJU A;  3ILF A;  5LRS A;  4IV1 B;  1IKP A;  1C8M 2;  1UOF A;  4KBZ A;  1CJD A;  3VHP A;  2LUW A;  3WZ1 A;  4YPJ A;  3AX4 A;  3WNP A;  3EBR A;  4JTN A;  2DVD A;  3NVC A;  3U07 A;  3QH7 A;  1NCR C;  5CFC A;  5FPL A;  2BGO A;  3VZJ A;  5LEJ A;  2GC2 A;  4MXW B;  2OII A;  1OLM E;  1NG0 A;  4A3Z A;  1GZ9 A;  4NAM A;  1SBE A;  1ND2 C;  3D0S A;  5FPX A;  2ARB A;  3HNM A;  3E5X A;  5K9Y A;  2R04 3;  2ZTN A;  2HWC 3;  3P1I A;  3V56 A;  2JDU A;  3NV2 A;  2G9G A;  3GZU C;  2JKX A;  4I02 A;  4CEY C;  3H1W A;  2KXL A;  1TZO A;  3OBZ A;  4IE0 A;  5FZM A;  1ZZ7 A;  4HK8 A;  1SPP A;  4DXS A;  2EIC A;  2HYX A;  1JZ3 A;  1H2K A;  2ADD A;  1WCK A;  2VL4 A;  4UFL A;  5IW0 A;  4Q4V 2;  2RJ2 A;  1Z7S 3;  4EWA A;  2FDF A;  3DCQ A;  3S7E A;  1OFN A;  1G8W A;  4RS5 B;  4LNV A;  1O3T A;  1PM7 A;  4M0H A;  3USU A;  3VBH A;  1ONA A;  4IES A;  4UFH A;  5KXC A;  3FFQ A;  4OHZ A;  4FFF A;  2G1M A;  2DDU A;  4CP9 B;  1H9W A;  1KEX A;  3WF1 A;  1V70 A;  4NRM A;  3VZN A;  2Y6L A;  1IGO A;  1YFY A;  1HV0 A;  5FV3 A;  2BOI A;  1W2T A;  4WV8 A;  1YEW A;  2D5H A;  5GLZ A;  5J3U A;  1B35 C;  1OXC A;  3ZFE C;  1MQT A;  4CU8 A;  2X5I C;  4CDX A;  5JR7 B;  1JZ8 A;  3U0Z A;  2RS3 3;  1JZ7 A;  2ET1 A;  4FSJ A;  2XVL A;  3BB6 A;  1G9B A;  1A8M A;  5DUW A;  5A3M A;  5DAW A;  4IE6 A;  4OYU A;  3PIJ A;  4Q2F A;  3W21 A;  3W59 A;  4BQ3 A;  4JCK A;  2H0V A;  3VHO A;  3KB5 A;  5BNQ A;  1NCQ A;  1MQT C;  5BNN B;  4GMP 3;  2DBN A;  1V0A A;  4WZF A;  4NWW A;  1G7Y A;  3VDB A;  1BZW A;  2PAE A;  4V1P A;  5JR2 A;  1YFX A;  5DAQ A;  5A1L A;  2P37 A;  4XVH A;  5DMY A;  2ZHK A;  5E89 A;  3N9M A;  3VN4 A;  3VUO A;  2XPJ A;  3S0M A;  1ZA4 A;  2ZX4 A;  4FOV A;  1LNS A;  1O6U A;  1VE0 A;  2H0B A;  1QJF A;  4D94 A;  1VBA 1;  1SCR A;  4ZPI A;  2QQO A;  3OY8 A;  4LK7 A;  5ACA 3;  1VRH 1;  4QGM A;  1OD5 A;  2MNG A;  3CIH A;  3U1X A;  4XCA A;  3U78 A;  5FDB A;  3D3A A;  4DMI A;  1D4M 2;  1BBT 3;  2VQU A;  3IDC B;  3AYC A;  3KZ4 C;  3WEZ A;  1D2Q A;  2KD7 A;  2J1S A;  1O91 A;  4HXC A;  1FOD 2;  3T1M A;  1RUJ 2;  2VZQ A;  4JRA A;  5DPN A;  4ZS2 A;  4AW7 A;  4CVU A;  3O1U A;  4NOT A;  3U4S A;  1KQR A;  1K5M A;  1UYZ A;  3K4A A;  2XWB B;  4MYE A;  2K9Z A;  5FBZ A;  1I3H A;  3RSJ A;  4O9G A;  4PDW B;  5FPB A;  2K2S A;  3H9A A;  1MVQ A;  4MLO A;  1W6M B;  2B8M A;  2QZ2 A;  3R05 A;  4EYU A;  1BVV A;  3MYX A;  4RFR B;  4LA2 A;  1O4Z A;  5D8A B;  1GV9 A;  2JWP A;  1AUY A;  1SQ4 A;  3WQ1 A;  3WNK A;  3CZJ A;  4AFB A;  5J09 A;  5LBC A;  4Q0U A;  1UY4 A;  2VXR A;  2VNO A;  1BVP 1;  4FPE A;  2J1U A;  3BN6 A;  2NMO A;  1F9K A;  4MHU A;  3LA3 A;  1UMZ A;  1E57 A;  4AFC A;  2CDP A;  5GZF A;  1QKQ A;  1H6X A;  1RUC 3;  4NE9 A;  5HPO A;  4SBV A;  4XIK A;  5AVP A;  4FOQ A;  1JXN A;  2WT2 A;  2WWJ A;  5F1R A;  3O1T A;  2D98 A;  2W0X A;  3JD7 3;  3PHM A;  2PMW B;  4CTE A;  2ORX A;  5F5A A;  4JHT A;  2VZU A;  3S5Q A;  4BQ5 A;  2IXI A;  1C5H A;  3KF3 A;  4YNI A;  2EVX A;  3WCS A;  5EV7 A;  2D3P A;  1J3Q A;  4QU1 A;  1UOB A;  4ZS3 A;  2VMC A;  2C9K A;  2RDN A;  3UKV A;  1VBC 2;  3POI A;  3QLQ A;  2BWA A;  5DXD A;  2WZR 2;  2WNE A;  4BK4 A;  1ULO A;  1V00 A;  4N7U A;  4NPR A;  2FZ1 A;  4XAC A;  4P5H A;  3MO4 A;  2AC1 A;  1QJX 2;  2JG8 A;  3E5Q A;  1M4W A;  4HKL A;  1X7N A;  4UAP A;  4P9L A;  4AI8 A;  1HV1 A;  3FUQ A;  4ZKT B;  3SH4 A;  5F32 A;  1ND3 C;  5KBF A;  5CYY A;  3B02 A;  1BYH A;  1W6O A;  1FPN 1;  3KGZ A;  3CHX A;  4DRV A;  3H7J A;  5BYN A;  2JG9 C;  3BVC A;  2P5B A;  4WVM B;  4WZC A;  4UFJ A;  3F2Z A;  1D4M 3;  4WVW A;  2BGP A;  2VG9 A;  1OH4 A;  3HVD A;  1F4A A;  1N47 A;  5CIR A;  4YLZ A;  2DU1 A;  4Q8K A;  1LOF C;  3JB4 C;  1RUD 1;  1FOD 3;  4CCJ A;  4WM7 A;  3LA7 A;  2VMI A;  3VBF B;  1MS3 A;  3BTA A;  3FE5 A;  4AEK A;  1XNK A;  1W0O A;  3CU7 A;  3LA2 A;  3EQE A;  4A6O A;  4N53 A;  1APN A;  3B69 A;  4HN1 A;  4MGZ E;  3MGU A;  3BPS A;  3U14 A;  3A7Q A;  3U37 A;  4EE2 A;  4Y4Y A;  5L7O B;  1N3O A;  1MPX A;  2QJV A;  4JGY A;  1AR6 2;  1Q56 A;  2YB7 A;  4LBL A;  2ZEX A;  5ABJ C;  1S1A A;  4XCB A;  4JKL A;  1G9A A;  1AXK A;  4FFG A;  2CSG A;  1IS4 A;  1EV1 1;  1ULF A;  1HKD A;  1HQW A;  4QXH A;  1CPM A;  3ZYB A;  5CIS A;  1WCU A;  1LGB A;  3I2G A;  5EYY A;  5C5T A;  5BNO C;  3I2O A;  4OCT A;  4QKD A;  1WMD A;  3UYJ A;  1HXS 2;  2E7A A;  2UYB A;  4QPG B;  5FPA A;  3NW4 A;  3OJB A;  3FHQ A;  4CDW A;  5FWJ A;  3KLS A;  4JHZ A;  4GJZ A;  4CPB A;  5DUX A;  3PLQ A;  3HOB A;  3ZIX A;  1NE4 A;  5H9Q A;  4CDQ A;  2BPA 2;  3ASI A;  1YJL A;  4JV4 A;  1ZRI A;  1GFF 2;  2R07 2;  5KXB A;  2PQS A;  4AZZ A;  4FQ4 A;  3V0A A;  4HVR A;  1DQ5 A;  3D6E A;  4JRL A;  4LE4 A;  4FP2 A;  5IHR A;  1P8J A;  2Y6G A;  4FCA A;  1LOG A;  2PAK A;  4H55 A;  4P9J A;  4EJR A;  4TZD A;  1REE A;  4M3C B;  4XW3 A;  2XXZ A;  3OOX A;  4QX0 A;  3WR0 A;  5FZI A;  2R0F A;  5FXV A;  4L2N A;  5BV6 A;  1CON A;  3GGL A;  5FYM A;  4CEY A;  3FZ3 A;  1BQP A;  2VZO A;  4LOS A;  1VBC 1;  2EA7 A;  3JBG 1;  1QQP 1;  2VGD A;  1H30 A;  4TSV A;  4WBB A;  1H4H A;  4AVV A;  3I2D A;  1GZW A;  3N35 A;  3PMS A;  4WVV A;  2Y34 A;  4FPH A;  5CG9 A;  3RWN A;  1UW8 A;  1AR9 1;  1S0F A;  3E6D A;  2E9Q A;  3WG4 A;  1US2 A;  2VBP A;  4OMD A;  5F3E A;  3HT1 A;  2IFR A;  1UKR A;  1V9U 1;  2CGP A;  2GNB A;  4GJY A;  4PCR A;  5K0U C;  1HJF A;  3C2U A;  1DYK A;  2JB4 A;  2A71 A;  1O3Q A;  4EZH A;  3LPG A;  3KGL A;  2XGX A;  2JD4 A;  1D0G A;  2RDR A;  3HBZ A;  4PLO A;  1TME 1;  3NMB A;  2D6O X;  1RXG A;  4LEJ A;  3AJY A;  4QT6 A;  4Q26 A;  5FMB A;  3ZN6 A;  3VDD B;  4AQ2 A;  4WM7 C;  4GH4 B;  1WME A;  2AEZ A;  4LLF A;  4NHL A;  1H4G A;  5F6L B;  2GNT A;  5FO7 B;  2P17 A;  3ACH A;  3U10 A;  3CJI C;  1VIW B;  5AVA A;  2DCT A;  3AJZ A;  1H6Y A;  4MSV A;  3WX5 A;  1DYO A;  2GMP A;  2H6C A;  3JCI A;  2HWB 2;  4R9D A;  3T1L A;  3M70 A;  1B35 B;  1W06 A;  4GB3 1;  2R49 A;  2WIN B;  3MPP G;  1GOG A;  4M00 A;  3PUS A;  5IVB A;  2A6Z A;  2GN7 A;  1GWK A;  1R08 2;  1KJR A;  1J83 A;  3N7M A;  3KHB A;  1XNT A;  1ZZ8 A;  4LUK A;  3S30 A;  4BMB A;  2E53 A;  3N36 A;  3ST7 A;  5ISL A;  2Y0I A;  4CCO A;  2HWD 1;  5I0T A;  2BBA A;  2W94 A;  4CUA A;  2A6W A;  5JWP A;  2ZGL A;  3NV3 A;  2V73 A;  1C8N A;  1LCL A;  5FMD A;  3O1V A;  2YV8 A;  4R52 A;  4O7X A;  5C5U A;  1OUR A;  2IFW A;  3G7D A;  4LOR A;  1MZE A;  1OQ1 A;  2VC9 A;  4Y33 A;  2Q1M A;  5JXI A;  1PVC 2;  4Z2A A;  1VAV A;  1X8E A;  4N7I A;  3J7M A;  4WM8 C;  1COV 3;  3J9S A;  2I74 A;  3QCW A;  4DIQ A;  2DBI A;  4QB1 A;  1HB2 A;  1GSL A;  2XQR A;  4LBQ B;  2OUH A;  2YPD A;  3AK0 A;  5FZH A;  2E51 A;  3HT2 A;  3WDV A;  1AJK A;  2Y8K A;  3E1F 1;  2XJT A;  3HEI A;  1BMV 2;  2Y38 A;  1C3H A;  1SMV A;  2AEN A;  2QQK A;  1AR9 3;  1WW6 A;  3JD7 1;  5F5C A;  3RWK X;  4Z82 A;  3K51 A;  1JH5 A;  1QQP 2;  5KC5 A;  4FAG A;  5FZC A;  1IZ3 A;  2W39 A;  4P9G A;  3VDD C;  2DWR A;  3WQ0 A;  1I1E A;  3BCW A;  5I8S A;  4F7Z A;  2JIG A;  3J7H A;  3ZR5 A;  5KHJ A;  4N43 B;  4RGA A;  3RZH A;  2V4V A;  4DRR A;  4COY A;  1CAV B;  2DTW A;  2GNM A;  3NV1 A;  2GC0 A;  5FO9 B;  2EXK A;  2ETE A;  4QWN A;  5DG1 A;  1BEV 3;  4K6B A;  5EZW A;  1MS9 A;  3JXS A;  4JAA A;  4LO4 B;  3RDI A;  1OBN A;  5KR7 A;  4LO8 A;  3OGG A;  4P00 B;  1WA6 X;  2HYK A;  3NNG A;  3L2H A;  4IGP A;  1GNY A;  5K8S A;  1AX0 A;  3KT1 A;  1G9C A;  1CZT A;  1QU0 A;  2GAU A;  2J42 A;  3VZK A;  3NNF A;  3WNX A;  1XYN A;  1DGL A;  3M3Q A;  2RS3 2;  1UN1 A;  4PQQ A;  4Q4X 3;  3ZFE B;  2JB8 A;  4GB3 3;  4D3W A;  5I8Y A;  1BBT 1;  3VBR A;  4DIN B;  3ATG A;  3PVN A;  4LIV A;  1NQD A;  5J7M A;  3VBH B;  5A70 A;  2YFU A;  4FPC A;  3BTX A;  1BK1 A;  3IDE A;  2X05 A;  1ULC A;  3M3O A;  3VBU A;  5BNO A;  3C7G A;  1L3J A;  5L9B A;  3QD6 A;  1V6M A;  3AKS A;  3POG A;  4AED B;  5AFB A;  1O8S A;  4P9I A;  1HDK A;  3I59 A;  3IDB B;  2XG3 A;  4V2V A;  3ROU A;  3AMM A;  5C3P A;  3INA A;  3P5B A;  3KWV A;  3SLI A;  1K12 A;  5C70 A;  4LKF A;  5E88 A;  2YXS A;  4FXK B;  5F3C A;  3ETQ A;  1PX4 A;  1ST8 A;  5A3W A;  3E6C C;  1VBE 3;  3LPF A;  1VBB 3;  2AYH A;  5LY1 A;  2QQP A;  2ZGP A;  4J1X A;  1C5I A;  4E9K A;  1W6O B;  3I3E A;  2W68 A;  4C90 A;  3OYW A;  1IG3 A;  1ZNP A;  4K3U A;  4TLF A;  5JSO A;  1GYK A;  3UGG A;  2OA2 A;  1X9T A;  3OPW A;  3D4K A;  5FPU A;  2W1W A;  3FN9 A;  2ZZJ A;  3LDR A;  1GP4 A;  3DV8 A;  3OGS A;  4BHP A;  2AGS A;  1PGL 1;  1ZRR A;  2WN3 A;  4P08 A;  3B93 A;  4RQP A;  2EAL A;  3W9A A;  1GOH A;  2AR6 A;  2XLF A;  2ZKN A;  3KS7 A;  1PM4 A;  4FI9 A;  2PN5 A;  1GZT A;  3A0N A;  4Q4W 2;  3RNS A;  4DZG A;  1DDL A;  4A7K A;  5KWR A;  1W6Q A;  1KFX L;  2J1E A;  4KL1 A;  2WNU B;  3WLU A;  1W2U A;  2VUC A;  1YWK A;  4KQ7 A;  4XHB A;  4AVC A;  1QNW A;  4AVT A;  1QJY 3;  4OHY A;  4CXW A;  4R8H A;  2W1S A;  4I0B A;  2YBK A;  1AXY A;  1YQ8 A;  5FP9 A;  4FPO B;  4E8C A;  5CEH A;  3BOP A;  2BTV C;  5EJ3 A;  3VBF C;  4C0H A;  2ZX1 A;  4UF0 A;  4XFG A;  2WQ8 A;  4A4A A;  2E7Q A;  1OLM A;  1D4V B;  4IE7 A;  2GC1 A;  2VMD A;  4YZ5 A;  4QU2 A;  2VQA A;  4QKB A;  4PDW A;  2DF7 A;  2P4E A;  3WW2 A;  4GUL A;  1AR9 2;  2DVF A;  3MF6 A;  2GME A;  4XFA A;  2DVA A;  5FY4 A;  2VXJ A;  1W2O A;  2WAO A;  2NQY A;  5JI9 A;  2AUY A;  4XZU G;  1HXS 1;  3OGR A;  4XFB A;  1AZD A;  3KV5 A;  1AX2 A;  2AEY A;  1S2K A;  1ZM1 A;  3AZV A;  2XJP A;  3HR9 A;  3JBG 2;  4N43 C;  5CKN A;  2IXJ A;  1YI9 A;  1S0G A;  2QFE A;  3H8U A;  3DL3 A;  5CAZ A;  3K77 A;  4A3X A;  3I2K A;  2A3Y A;  3KHC A;  2DUP A;  2D3R A;  4XBL A;  4DQA A;  4LO7 A;  3VDA A;  1YUD A;  4CE8 A;  2FDG A;  4AI9 A;  3VKF C;  1PMH X;  4CP9 A;  3I2J A;  2A1X A;  1Y7B A;  3AL6 A;  3MW4 A;  5FZL A;  5FYZ A;  4YW1 A;  4BLJ A;  3CZU A;  3T3Y A;  5A6Q A;  2A3X A;  2CV6 A;  2GH8 A;  1ZBE 3;  5M0T A;  4OI0 A;  1T2X A;  4HVO A;  5LA9 A;  4LBM A;  5C4W C;  2J22 A;  1BMV 1;  1H2N A;  2QQI A;  4RSU A;  2PEL A;  4IV1 A;  5BPX A;  4ET7 A;  1AYN 2;  2J1V A;  4QPY A;  2LW8 A;  2XDV A;  1OOP C;  1YI7 A;  3PL0 A;  1H1I A;  4AGG A;  2J7M A;  4PIX A;  4NRP A;  3OUJ A;  1PGW 1;  2AAC A;  3ACL A;  1OF3 A;  1RTV A;  5JCT A;  1NQJ A;  1LHV A;  1X8M A;  1Y9G A;  3ZSJ A;  2ZAB A;  2Y33 A;  5DAB A;  3THT A;  2A7A A;  1ENQ A;  2PLV 2;  1O8P A;  1QY4 A;  4GMP 0;  4QGL A;  5FZF A;  3KMH A;  1XU1 A;  2XUM A;  4GIQ A;  4XUN A;  3KQ4 B;  1ZBA 2;  4EV0 A;  5LCW L;  1SAC A;  2Z42 A;  3KCC A;  1XB9 A;  4OI2 A;  3MLL A;  4Q1P A;  1QHD A;  1AR6 1;  3B9C A;  1RUF 3;  2DFC A;  2E26 A;  3M3E A;  3V64 A;  2KA3 A;  3ZFF A;  2BWC A;  3N9P A;  3OTF A;  2DYC A;  3NJV A;  3DN7 A;  1U0A A;  1OSG A;  4CEW A;  1S0E A;  3AP6 A;  4CSW A;  4Y1Z A;  4QX2 A;  5CFD B;  5FZ8 A;  2WO1 A;  3LD8 A;  3DPR C;  3N9Q A;  3K48 A;  1SBD A;  2JJ6 A;  2RM2 2;  4JVA A;  1X33 A;  4L8Q A;  1WCS A;  4B7K A;  1D2S A;  5FY8 A;  3URF A;  3RYR A;  3OEB A;  1WMX A;  1K5M B;  4BE3 A;  1O5U A;  1W0P A;  5I0D A;  3HWJ A;  2GZW A;  1ZRD A;  1AVB A;  1DIW A;  2PTM A;  3GCW A;  4Q5O A;  1OH3 A;  5FFO C;  4CDQ B;  5D8A A;  1RVF 3;  2VCC A;  4PF1 A;  5G04 L;  1AYM 3;  1UY1 A;  5KXE A;  1V9U 2;  1AHS A;  3RI9 A;  1Y9M A;  3SIT A;  5F5Q A;  1UQX A;  3ZN5 A;  3B94 A;  1OQE A;  4XET A;  5L36 A;  4X8N A;  1TG7 A;  1S0I A;  1HQL A;  4Q4Y 2;  3JB8 A;  2P3K A;  2W47 A;  1OKO A;  1ZBE 2;  2ZHN A;  1UPI A;  5LK7 B;  5IFT A;  3FC0 A;  2SLI A;  4UI9 L;  4DEQ A;  4AVA A;  3D82 A;  3CNA A;  1OHF A;  3ILR A;  4QHO A;  3Q8C A;  4HPK B;  4YM1 A;  3LEK A;  5FYU A;  4KGG A;  3I54 A;  1NY7 2;  3WT3 A;  1S4C A;  2WRA A;  2XWJ B;  1SDW A;  2WBK A;  3WP4 A;  1ZBA 3;  2D5F A;  2QQU A;  4JC1 A;  3ZPY A;  3N4M A;  1NX9 A;  2ZAC A;  4BPZ A;  2GU9 A;  3T0D A;  2WUH A;  4BU2 A;  4WVZ A;  1OQD A;  3H3Z A;  2WR9 A;  3MFC A;  3M1H A;  3DKQ A;  5FZD A;  5KHH A;  4M4P A;  1RED A;  3SEE A;  4H2A A;  3TEW A;  1VAM A;  4DUW A;  2ZGS A;  1AR7 1;  2WL1 A;  1NCQ B;  1RUO A;  2R0H A;  1XXN A;  1LUL A;  2ZGO A;  3RYP A;  3BU0 A;  3K46 A;  3OGJ A;  3ITQ A;  1D4M 1;  4YGD A;  4XDO A;  1GOF A;  1PK6 B;  1AL2 1;  1PK6 C;  3KF5 A;  2UU8 A;  1QDO A;  4YW2 A;  1W6M A;  1DGW A;  1UF2 C;  1AYM 1;  2HBT A;  2W46 A;  3IWZ A;  1FI2 A;  4JTO A;  1RUI 2;  1V6L A;  1ENX A;  3KT7 A;  1PX3 A;  3WF4 A;  4UYB A;  2ZGM A;  5L7O C;  1SEF A;  1U12 A;  1CX1 A;  2WNO A;  4DEV A;  3OBT A;  1QJY 1;  4TYS A;  4AVB A;  1AX1 A;  3Q9O A;  3SH5 A;  4AL9 A;  4C91 A;  2YRO A;  4P9W A;  3PNA A;  5FYI A;  1PGW 2;  4YG3 A;  2RM2 1;  3BTZ A;  4Q4V 1;  4QD2 A;  1BEV 2;  3RZZ A;  3J8F 3;  5JOX A;  5C8W A;  2EIB A;  1IPK A;  3RFR A;  1Q8S A;  3WHU A;  2IZW A;  5HCA A;  1REF A;  2FCT A;  4MXV A;  4Y26 A;  3KV6 A;  1AYM 2;  5FOJ B;  3OEA A;  2F17 A;  1RMU 1;  1SLT A;  1IHM A;  2OPW A;  2BUK A;  3E5U A;  3JD7 2;  4DB5 A;  2K46 A;  1RMU 2;  4CDX B;  3JZV A;  2FDH A;  3VBH C;  3A4U A;  5C8C C;  1RHI 1;  4B4Q A;  2VVD A;  2FDI A;  3VKM A;  4RQP B;  5EJZ B;  5JXJ A;  2IXL A;  3BI3 A;  1PO2 3;  5IVJ A;  1EAH 3;  4AF9 A;  1ZZC A;  1N1V A;  1POV 3;  4AGR A;  4YRD A;  2E63 A;  4DXT A;  5BY5 A;  1U5Y A;  2JEC A;  3ZMN A;  1STM A;  5BNP C;  2YU2 A;  2E32 A;  3NRU A;  2VPV A;  3QAC A;  4XF1 A;  4YZ2 A;  4S2D A;  3ZR6 A;  2LTN A;  4ASK A;  2EIG A;  5KC6 A;  5DAP A;  3TOJ A;  3PJQ A;  2D6M A;  1K5M C;  1Z0H A;  3RZM A;  1PO1 1;  3WIN E;  5C6C A;  2JG8 B;  5L7O A;  1R08 1;  1AJO A;  3TBD A;  1MEC 1;  2RS1 3;  2ZEZ A;  1PVX A;  3OUH A;  3EHK A;  4Y4R A;  4BXF A;  1RUI 3;  5FTT C;  1C4R A;  4IEZ A;  3ACF A;  4QHB A;  3ZVX A;  4U36 A;  5JZG C;  4NHY A;  1OI6 A;  2HEY F;  5E16 A;  1BXH A;  2JDH A;  4BOW A;  1Y9Q A;  5IVY A;  1TME 3;  1KFU L;  3SCH A;  2CWM A;  2R1B A;  1ASJ 1;  3ZOI A;  4D8M A;  1FV3 A;  1ZRC A;  1BK0 A;  4N53 C;  2HWD 2;  2W92 A;  5A7Q A;  3CQO A;  1DZT A;  5FQ0 A;  3K3O A;  1QJU 3;  4NHX A;  2R04 2;  4K8R B;  4XFI A;  4E2Q A;  2NPI A;  5ABJ A;  4XMA A;  4HL0 A;  1UWW A;  4E2G A;  1POV 1;  1GKB A;  4RA0 A;  4XUR A;  1HB3 A;  2D44 A;  2BNN A;  3AKQ A;  5SV5 A;  1F5F A;  4M01 A;  3AYD A;  2RDQ A;  4FP3 A;  1RHI 3;  1CJP A;  4GZ9 A;  4XJW A;  5T3N A;  2AZ5 A;  4G3Y C;  5DUU A;  4DUX A;  1QJU 1;  1ENS A;  1YYN A;  2RR1 2;  3OBA A;  5FK7 A;  2DVB A;  1RUH 1;  2WFF 2;  2G4I A;  3T2P A;  4IND A;  5J48 A;  4OI4 A;  2UUR A;  3AYA A;  2IXH A;  4R4X A;  4F8A A;  1S0B A;  5BNP B;  2JDK A;  3O1M A;  2YUE A;  3KV4 A;  5IK8 A;  1PO2 2;  3UK9 A;  5FO8 B;  1Z7S 2;  1GP6 A;  2BYV E;  4A42 A;  3APB A;  4CCL A;  2ZGN A;  1HX6 A;  4MOA A;  4RQP C;  5T5J A;  2J1A A;  4AHZ A;  2EAA A;  3I3B A;  4COU A;  1UZV A;  1W05 A;  1GQG A;  3ZN4 A;  1GBG A;  4LBQ D;  1OT5 A;  1LGN A;  4NUB A;  2W3J A;  1VRH 3;  4D6S A;  1EUU A;  1QXR A;  2HWB 3;  4MGI E;  5IWF A;  3T0B A;  2WNU A;  3UET A;  3VD5 A;  3TN9 3;  2B9U A;  4YM2 A;  3ZDS A;  2JEN A;  1MEC 3;  2PHX A;  3IZO A;  4L99 A;  1JMU B;  2HWC 1;  4LIT A;  4LK6 A;  3VBO C;  5HI0 A;  3N7J A;  1N3P A;  4I2O A;  3ZFG C;  5JMC A;  5F3I A;  5A3N A;  2HJI A;  1UU4 A;  3O1P A;  1LJ7 A;  1GZW B;  2WWU A;  5FYH A;  4AFM A;  3KVA A;  5I8T A;  2RJK A;  2KM2 A;  3HN3 A;  2UWA A;  1PNF A;  2HBU A;  2R32 A;  2XON A;  3GF6 A;  1OPO A;  1W9W A;  1BCX A;  4PIY A;  5FPV A;  2VVF A;  3HNY M;  3UGH A;  3ZYG A;  2YG0 A;  3AKP A;  4CUG A;  4FXG B;  3AYE A;  2W95 A;  5A7P A;  5JSR A;  3ZO0 B;  2BQP A;  2VMH A;  4UBH A;  3NAP C;  5FYC A;  4GAL A;  2YC2 A;  3MLJ A;  5KXD A;  1R09 1;  5GZE A;  2QTW B;  2B39 A;  3ZDV A;  3KCX A;  3O1O A;  3SC7 X;  1ALY A;  4KU7 A;  2VQT A;  1I6X A;  3WCR A;  3WDU A;  1WW5 A;  5DZG A;  4BZ4 A;  3PUH A;  2V72 A;  4CP1 A;  4ZXE A;  1AYN 1;  2WNV B;  2ZGQ A;  1GZC A;  3HMY A;  3MV0 1;  3VD4 A;  2BBV A;  2YPJ A;  4C0B A;  3S5A A;  5JDB A;  2JDA A;  3NAP B;  4FFI A;  1W90 A;  1W8O A;  4AED A;  2RS1 2;  4LXL A;  1L7R A;  2KR2 A;  3LIG A;  4LBJ A;  4KWU A;  4Y1X A;  4O9E A;  4YWA A;  5LZ6 A;  4OI1 A;  3CLP A;  3CF6 E;  2JD9 A;  3B5L B;  1DZR A;  4QAW A;  3MDP A;  3III A;  1WBL A;  4YVS C;  1VB2 A;  2VZT A;  1JYV A;  3MPB A;  4K21 A;  4Y3O A;  4DPN A;  4IEO A;  3WP6 A;  4NO4 A;  4NIG A;  1QJU 2;  2RR1 1;  1NXD 1;  5HV0 A;  4MX3 A;  5FXW A;  1FNZ A;  4CRQ A;  1AXZ A;  1DQ4 A;  1HRI 2;  1WLT A;  4LKE A;  5ACA 1;  2IXK A;  5IK5 A;  4KU8 A;  3RQ0 A;  1NLS A;  5FRA A;  2Z79 A;  1PNG A;  3FL7 A;  3UES A;  3WQ7 A;  2ZS6 B;  1WCQ A;  4IEU A;  1VBC 3;  4RD7 A;  3POE A;  3UGF A;  2YYO A;  1KS4 A;  3PDQ A;  4A2U A;  1DQ6 A;  1QH7 A;  4UBG A;  4IDZ A;  4CEW C;  4MGT A;  5HCH A;  3KCY A;  4M3C E;  4BJ0 A;  1MZF A;  2EXI A;  3LFI A;  1W6N B;  4RGK A;  1NZC A;  3FBY A;  4HKW A;  1YJK A;  2RG4 A;  5DG2 A;  1AR8 2;  3ZX7 A;  5IVE A;  3OD0 A;  3VBO A;  2E7T A;  4TTG A;  4E4Z A;  2J1T A;  3MIF A;  4LHK A;  5FMC A;  4E8D A;  4NVP A;  2R06 1;  3BU7 A;  4PI2 A;  4RGG A;  1WD4 A;  1EPW A;  4D0Q A;  3N7K A;  2FCV A;  3RZG A;  1XU2 A;  1W9Y A;  1LHW A;  1YIP A;  2YC4 A;  4R9B A;  3WQB A;  4XEZ A;  3ZSM A;  4Q4X 2;  3AMQ A;  5EIY B;  1GU3 A;  4XJA A;  2R07 3;  1DZQ A;  2I07 B;  5A7N A;  1MEC 2;  1V6N A;  2VNG A;  2OKX A;  5LW9 A;  1VRH 2;  1C28 A;  1GAN A;  2ILM A;  3AP5 A;  4LUM A;  4Y20 A;  1F35 A;  3U4X A;  1AR8 1;  3VV1 A;  2CYF A;  1IOA A;  1QXP A;  5JI7 A;  2BV4 A;  2GC3 A;  5FZK A;  2CDO A;  3M8L A;  4CCE A;  5FZ0 A;  3VBR B;  4QXK A;  1ND2 A;  2YU1 A;  3LKJ A;  1C8M 3;  3ES1 A;  3AVR A;  3THC A;  4AI1 A;  1MZ5 A;  4KBB A;  2XLA A;  4QQP A;  1BJQ A;  4EZ4 A;  4NR1 A;  3T2T A;  1CGP A;  2JE8 A;  3IIA A;  1RUE 2;  2WZP P;  4ZZ8 A;  4K20 A;  4Q0Q A;  2GND A;  3PVE A;  4GKY A;  2CHH A;  4I01 A;  2Q1F A;  4W6W A;  3BYW A;  3VKN A;  2JXA A;  2D93 A;  1R1A 1;  1CIW A;  2JIC A;  3R4D B;  1LOD A;  4LBQ A;  2Y60 A;  4QHZ A;  3B01 A;  4CDU C;  2ZMN A;  3WXP A;  1HW5 A;  1VBE 1;  3IT8 A;  2CGN A;  1IS3 A;  2ZEW A;  1AL2 2;  5LBF A;  3WV6 A;  4NID A;  1UOG A;  4FPL A;  4QX3 A;  2D3S A;  4YG6 A;  3PUR A;  1XND A;  3PU8 A;  5FY0 A;  4NHK A;  1PZ9 A;  2WDB A;  5FXX A;  3VKL A;  2VJX A;  2XBO 3;  1JUI A;  3KD4 A;  2Z2S B;  4YW6 A;  2D43 A;  3POW A;  4NWV A;  3HQR A;  4CDU A;  2PXJ A;  3OF1 A;  1PK6 A;  4UT5 A;  4W65 A;  1W8T A;  1LES A;  3QBQ A;  4MG2 A;  1JYI A;  2JDZ A;  3AMH A;  3PJY A;  5E6H A;  1CQ9 A;  3V65 A;  3OUI A;  2ZA9 A;  3VBS B;  1YHF A;  1XNA A;  4PIZ A;  5CAD A;  3J26 N;  3T09 A;  1W9F A;  1AR8 3;  5J1X A;  1ZRF A;  5AFE A;  4FAH A;  2CTV A;  3NJX A;  3I2F A;  2B42 B;  4B4P A;  3FMG A;  1W8H A;  1JOJ A;  3AM2 A;  4ZY9 A;  1RUC 1;  1IS6 A;  3ZKY A;  1AYN 3;  4D7S A;  4K40 A;  4H7L A;  3POF A;  1SLA A;  5TSW A;  1XNC A;  3ZN6 B;  4N53 B;  1FPN 2;  1JYT A;  2HWF 1;  5CKQ A;  2XVK A;  2ZEY A;  1EV1 2;  3CL1 A;  4YW4 A;  4PBP A;  4YG0 A;  3WDT A;  1NT0 A;  1LHU A;  5FMO L;  3OBR A;  5BXX A;  1JZ6 A;  1URX A;  1LRH A;  2ZGR A;  2QUO A;  4AQT A;  1C1F A;  4QX5 A;  1NA1 C;  2WZR 1;  2ZGU A;  4LHN A;  4LTA A;  4NHM A;  3H42 B;  5IVC A;  3FWE A;  5GZG A;  2GN3 A;  2QZ3 A;  1DG6 A;  1PMI A;  1O7F A;  2C5D A;  1VBB 1;  4YGE A;  1RUF 2;  3NO8 A;  4XOG A;  3LZZ A;  5LA0 A;  3ZXE A;  2HWE 1;  3ZXG A;  2YGM A;  4COZ A;  3WP3 A;  4YYO A;  5I0S A;  3BAL A;  3MBW A;  1J1L A;  1UO9 A;  3NNM A;  2PFW A;  3O0X A;  4AFD A;  3I7D A;  2J1R A;  3O0W A;  4PJY A;  2OS2 A;  4AGV A;  2IXC A;  1ULP A;  3THD A;  4MVT A;  3BKZ A;  3NL1 A;  1RL3 A;  3V0A B;  1PGS A;  1TE1 B;  2QQW A;  3RJR A;  2B46 X;  4LIU A;  1UNB A;  2QQN A;  3FLR A;  2DCK A;  1OKQ A;  3NWK A;  1ND3 A;  5FYS A;  1ULG A;  5FYB A;  4AVS A;  1DYP A;  4NJ4 A;  1FMD 3;  1LEN A;  5FP4 A;  3MI8 A;  1GNH A;  2R16 A;  2VE1 A;  4RHV 2;  4CEW B;  5JUV A;  5FMO S;  2JKB A;  1OUS A;  1DGW X;  5F5I A;  5A33 B;  3VD9 A;  2WFF 3;  5A3T A;  1JHJ A;  2P6H A;  4FPK A;  4IEV A;  4S2H A;  5FJK A;  1DP0 A;  5D2A A;  1ZRE A;  1O3S A;  1NCR B;  3IPV B;  4ATF A;  4BK5 A;  4AQ6 A;  1NLQ A;  1FX5 A;  1QOO A;  1GR3 A;  4O65 A;  2A6V A;  1IQD C;  3AMN A;  1RIR A;  3NJY A;  4BQY A;  1ZYB A;  4AOC A;  2VR4 A;  1VMJ A;  1JU4 A;  4GWJ A;  5FAX A;  1WCD J;  2XVG A;  3AKT A;  2EXJ A;  1UD1 A;  1AL2 3;  3TEX A;  4AXO A;  1VBA 2;  4TN7 A;  4ORF A;  1EV1 3;  4PBO A;  5CZK A;  3FHI B;  2WNV A;  3TN9 2;  3ZKU A;  4AHY A;  5SV8 A;  3GZT B;  3ZFG B;  4EN8 B;  4CUC A;  2QDN A;  1RXF A;  2QE3 A;  4Y5S A;  5GZC A;  2BEO A;  3TRS B;  1SFY A;  1QOS A;  3ES4 A;  3PME A;  2MEV 1;  4KGQ A;  4PQ9 A;  4L92 A;  1QNY A;  1UMH A;  2VOT A;  1YIF A;  1QDC A;  4JQT A;  2WS9 1;  3WP5 A;  4AR2 A;  3Q8F A;  4YAR A;  2X09 A;  2WS9 2;  4FFH A;  4H14 A;  5DAV A;  2TBV A;  2HWF 3;  3I2I A;  5FZE A;  3RPQ A;  2ZGT A;  1DF0 A;  3AZX A;  3FX3 A;  4NAO A;  4XFH A;  1L7Q A;  5GLU A;  5AC9 1;  2QCS B;  3GJB A;  4HLT A;  1I5Z A;  1W2N A;  4MET A;  4LKS A;  4IXL A;  4XIO A;  4YM3 A;  4GXL A;  2R07 1;  3TAY A;  4DUV A;  1W8N A;  1TMF 2;  2Q4S A;  5JIU A;  3ZIW A;  5LBB A;  4ASL A;  2VZR A;  4HVQ A;  1YNA A;  2Q30 A;  3ZSE A;  1JU3 A;  4XF3 A;  4BQ4 A;  3CO2 A;  4BWO A;  4JKM A;  5FY1 A;  1PVC 1;  4Q27 A;  2B9V A;  4N8M A;  3GHN A;  4K1Y A;  5DDJ 1;  4CXX A;  3OYW B;  1UX6 A;  5A7W B;  4AWD A;  5KHK A;  2SBA A;  3HD8 B;  4IGO A;  4HSJ A;  5F8P A;  2GP5 A;  4PLN A;  1J3P A;  4BCU A;  3GJA A;  5FP3 A;  1JYW A;  1QF3 A;  1ACC A;  3MIE A;  2WT1 A;  4IE4 A;  3Q8E A;  2A6Y A;  3IBM A;  3AZZ A;  4RHV 1;  1EUT A;  4AI0 A;  2FMD A;  3K4D A;  4PHZ A;  1A78 A;  2VCM A;  1VBE 2;  2ARC A;  1V6K A;  1W6Q B;  1PZ7 A;  2Y6J A;  4JGY C;  1RC6 A;  3MEP A;  4BA6 A;  5C4W B;  4FBF A;  5JPN B;  4JQR A;  5C7G A;  4QKF A;  3M3C A;  1XE0 A;  1Q8O A;  2XKO A;  4B3N A;  4CU9 A;  4CP0 A;  4M3C F;  1R1Z A;  4OHV A;  1YQC A;  1OFS A;  1H1M A;  1ENR A;  2W5F A;  3VHR A;  5A6Y A;  4GH4 C;  2Q8E A;  4Y20 B;  2DTY A;  3J8F 1;  2DV9 A;  3GBW A;  1QJY 2;  5DQ0 A;  2VBD A;  5EFU A;  4IGQ A;  5FUP A;  3TEY A;  1WUV A;  1JN2 P;  1XOY A;  4MV2 A;  4FPY A;  1V6O A;  1RUD 3;  4W4Z A;  1JI6 A;  3KVB A;  2Q5T A;  5CKM A;  4D69 A;  5FZ4 A;  1XJA A;  1LOF A;  2ARX A;  3H3U A;  3J7L A;  4A6S A;  4IV3 A;  4HFS A;  4EWD A;  4HZF A;  1DQ1 A;  3ZLI A;  5L19 A;  2VW1 A;  3KQR A;  5FQ0 B;  1LOC A;  2W08 A;  4K9S A;  1ZBE 1;  3WG2 A;  3DXU A;  1ZZB A;  4Y5Z 0;  5FZ7 A;  1EPZ A;  1H8V A;  3ZYP A;  4XZP A;  3EO6 A;  2HWF 2;  1ZZ9 A;  1HRI 1;  1CX4 A;  4LBO A;  5IFP A;  1GMM A;  1W3V A;  3JQX A;  2OW4 A;  1EAH 2;  1VPH A;  4B4R A;  1UZY A;  4CCD A;  1D7P M;  5I0R A;  5D21 A;  1O59 A;  2GH2 A;  2BZD A;  3I59 B;  4G4F A;  3M3I A;  3BPZ A;  4URT A;  1JUH A;  1FV2 A;  1K3I A;  3AFK A;  1MAC A;  4XTP A;  1W9S A;  4KWJ A;  3ACG A;  3ZYI B;  3LF7 A;  2C9A A;  5FK8 A;  1DU3 D;  1JHN A;  1GUI A;  1W99 A;  2XHK A;  3ELN A;  1JYN A;  3ZXL A;  4GWM A;  1HQN A;  5A6X A;  3PU3 A;  2Y64 A;  3OPT A;  3A21 A;  1DBN A;  2VZV A;  1EAH 1;  1OLR A;  4BYY A;  3MW2 A;  4AQS A;  1XSQ A;  3RG0 A;  1Q5O A;  4ISQ A;  1W8U A;  4I0A A;  4OUE A;  2NMN A;  2WFP A;  1IQA A;  4C1W A;  1BBT 2;  5A7S A;  1XNB A;  4DY3 A;  2CAV A;  5C71 A;  2OX0 A;  1G9D A;  3ENR A;  1R09 2;  4OZO A;  3VZM A;  5C9A A;  3ZXJ A;  1MS8 A;  5G05 L;  2DUR A;  2VUL A;  2Z69 A;  1VRB A;  1Y3T A;  1JBC A;  1MS5 A;  2JG9 A;  4XYX A;  2PYT A;  4ERO A;  4LOT A;  2VTF A;  1GLH A;  4XIL A;  4YVW A;  5T50 A;  2PHF A;  3K3N A;  3B3Q E;  5IAV A;  2F4P A;  1LU2 A;  3UL2 A;  4NPL A;  5ABJ B;  1OA4 A;  1S0J A;  3PUI A;  3CJX A;  1JZ4 A;  5FOB B;  2VUA A;  5L9V A;  4MGY E;  5C9A C;  2IUW A;  1SFN A;  5EHD A;  4XAB A;  5IUQ A;  2X5I A;  4O61 A;  2P2K A;  4QMA A;  4S2G A;  5F39 A;  5L9R A;  2AH2 A;  4LHS A;  5F2S A;  4NIA A;  3VKO A;  2Z4F A;  4R9A A;  3UJO A;  1RUD 2;  1COV 2;  4Y1Y A;  4PF5 A;  2W87 A;  1RHI 2;  2C26 A;  3BOW A;  4HT1 T;  2P3Y A;  5IYY A;  3DF0 A;  2RDS A;  2ZX0 A;  3R4S A;  2XH6 A;  2ZGK A;  4NPM A;  3H8X A;  3I4I A;  2VVE A;  4W6X A;  5APA A;  4FQZ A;  1RUJ 3;  4B29 A;  3T2O A;  4YVS A;  2WA3 A;  1KS5 A;  3S7I A;  3E97 A;  1W6P A;  1S2B A;  4BM8 A;  2D6L X;  2W1U A;  3H1M A;  3RRD A;  2HEW F;  4TXW A;  1FNY A;  5H9R A;  1BHG A;  1JOP A;  2PHU A;  2WZR 3;  2WYS A;  3V0B A;  2WNU C;  3IAQ A;  2LM3 A;  1LKN A;  5DDJ 2;  2EAK A;  2PLV 3;  5JOY A;  1LEM A;  4HMZ A;  4ASM B;  2WNV C;  4Z1V A;  1GQH A;  1YXW A;  4GKX A;  4CZS A;  4QXB A;  5L73 A;  2BFU S;  1LOA A;  3NST A;  1CAX B;  4QX7 A;  4L97 A;  1US3 A;  5C3Q A;  5HXM A;  2WLQ A;  4M4R A;  5FLJ A;  1SLC A;  3AXE A;  3ZXF A;  3DXT A;  4MAD A;  2FDJ A;  2WAA A;  5HCF A;  5FZ3 A;  4Q8L A;  5JAX A;  2VO5 A;  2P1B A;  1R64 A;  3EMR A;  1QGL A;  5KHG A;  5FJH A;  5CNA A;  1K42 A;  4GB3 2;  3VD3 A;  4BH9 A;  2RS5 3;  4QPI A;  5JVV A;  2R06 3;  4BB3 A;  5JOZ A;  3G6J B;  3RMY A;  4GAZ A;  4W50 A;  4XHX A;  1JOB A;  3UV9 A;  4UFI A;  3SCG A;  3GBF A;  3OCP A;  5FZG A;  4RR3 A;  2VOV A;  1N3Q A;  1IG0 A;  1UPS A;  3ZXK A;  3NQH A;  4IQP A;  3VBO B;  1KD7 A;  4CUB A;  2LRO A;  5FZA A;  4OHX A;  2GP3 A;  4XC9 A;  5HV4 A;  1RVF 2;  4OZX A;  1CZV A;  1F15 A;  1PGL 2;  2XHN A;  2CWS A;  2B5H A;  2Q1Z B; 
#chains in the Genus database with same CATH homology
 3KF5 A;  5FIX A;  3OSD A;  5FK7 A;  3PIJ A;  3PIG A;  4CCE A;  4JQT A;  2XQR A;  1Y4W A;  3LIH A;  4FFG A;  5FMC A;  3U75 A;  4EQV A;  3ZR6 A;  2QQV A;  2QQU A;  4HXC A;  4FFH A;  3SC7 X;  4UFH A;  4UFK A;  1ST8 A;  4CCD A;  4UFJ A;  4UFI A;  4FFF A;  3S5Q A;  4FFI A;  1Y9M A;  3KF3 A;  2QQW A;  3RWK X;  3HBK A;  4B1L A;  2AEY A;  3UGH A;  5FKB A;  4CCC A;  5ANN A;  3NMB A;  1W2T A;  3LDK A;  3LIG A;  4UFM A;  1Y9G A;  5FMB A;  3UGF A;  4QHZ A;  5FKC A;  5FMD A;  3UGG A;  2AEZ A;  1UYP A;  3IMM A;  3ZR5 A;  3U14 A;  4B1M A;  3LF7 A;  2AC1 A;  2ADE A;  2OXB A;  5FK8 A;  4AZZ A;  3H3L A;  3LEM A;  3LFI A;  2ADD A;  3LDR A;  4UFL A;  3U1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...