3NMBA

Crystal structure of a putative sugar hydrolase (bacova_03189) from bacteroides ovatus at 2.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
PSKVALSYSKSLKAPETDSLNLPVDENGYITIFDGETFNGWRGYGKDRVPTKWTIEDGCIKFNGSGGGEAQDGDGGDLIFAHKFKNFELELEWKVAKGSNSGILYLAQEVTSKDKDGNDVLEPIYISAPEYQILDNANHPDAKLGKDNNRQSASLYDMIPAVPQNSKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTDMLQASKFSEDKWPLAFELLNNCGGENHEGFIGLQDHGDDVWFRNIRVKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative sugar hydrolase (BACOVA_03189) from Bacteroides ovatus at 2.40 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Hydrolase
molecule keywords putative sugar hydrolase
total genus 68
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3nmbA00
5FMDA 5FMBA 4B1LA 3LIHA 5FKBA 3UGFA 3KF5A 2AEZA 2QQVA 3U1XA 4UFHA 4FFFA 2AC1A 3U14A 3LDKA 4UFJA 1ST8A 2XQRA 3NMBA 1Y9GA 5ANNA 3H3LA 3LEMA 3S5QA 3ZR6A 4CCEA 1Y4WA 5FMCA 3ZR5A 4FFHA 3UGGA 2QQUA 4AZZA 4UFLA 3UGHA 1Y9MA 3HBKA 4JQTA 4UFKA 3KF3A 2AEYA 2ADDA 1UYPA 2QQWA 4FFIA 3OSDA 3LFIA 3LIGA 4HXCA 5FK8A 5FKCA 3SC7X 3PIGA 4UFIA 3PIJA 4EQVA 3RWKX 2ADEA 4CCCA 5FIXA 1W2TA 3LDRA 4FFGA 4CCDA 3IMMA 3LF7A 3U75A 4B1MA 4QHZA 5FK7A 4UFMA 2OXBA
chains in the Genus database with same CATH superfamily
1GMMA 2WRAA 1ULOA 1MR5A 4LK7A 5C71A 2VZSA 4XBQA 4LO5B 5FMCA 4OZOA 1HB1A 1C1FA 1AL23 2I2SA 4GH4B 5FO7B 1OA4A 3SMHA 1RUI1 2KD7A 4LPLA 2KR2A 4UFKA 4IE5A 1JZ8A 3T1MA 3GBGA 5A3TA 2AUYA 3VDDA 1EV11 5FLIA 1GZWA 4P9YA 1FPN1 1ZBA1 1GZWB 1UMZA 4I30A 2RR13 1D4M2 1VBC1 4XMIA 1A8MA 2BVVA 4FOWA 4QD2A 5HXVA 5AFEA 3OG2A 4ASMB 1QDOA 1TE1B 5A3LA 2J1AA 1RUD2 2UU8A 3GHNA 2ZGNA 4YW1A 2J1UA 5AVPA 2EICA 1LCLA 3KGZA 2LALA 1KEXA 5A7OA 4BQ5A 5LW9A 1E5RA 1GWKA 1RHI2 5DDJ2 5C3PA 2VQTA 3AZVA 3N3HA 1ZRCA 1Y9QA 1Z0HA 4QKFA 4NHMA 5F39A 5F1RA 3K75B 1EPWA 3OUJA 3OD4A 3ITQA 1GUIA 1YRZA 2R073 3VBFC 5F3IA 5JZGA 4TYSA 2XL7A 2ERFA 1YQCA 5LBFA 1VALA 2A3XA 4ARXA 1H1MA 3DL3A 1NKGA 1TZOA 4DXRA 1SDWA 4W65A 1UZZA 1OOPC 5L9BA 3OF1A 4XABA 3AVSA 1O59A 4EWAA 1LKNA 2UWCA 4XJUA 4I0AA 4AL9A 3T3YA 1WLDA 1NE6A 5CFCB 3AP4A 1W6MB 3S0MA 4XACA 1SLBA 1UIKA 1W6MA 4HSJA 3UNPA 1R64A 2ARBA 3EB7A 1W6NA 4FPGA 3TBDA 3TNQA 3UETA 1OVSA 3WG2A 1KQRA 4AVVA 5A6XA 3S57A 2QQKA 2J1VA 3M4FA 4W8JA 1HQWA 4ORFA 3CLPA 1LHUA 3JB4C 4WM8A 1VRH1 3FUOA 3ROUA 5L7OB 5FPAA 5FZKA 3E6BA 1AXKA 4UXAA 3IDBB 4LUKA 4AR2A 3BI3A 5FYBA 2A3WA 1AYM3 3O5SA 2OS2A 2WT2A 1JUIA 1XNTA 1S0JA 2HKXA 4K3UA 4BZ4A 2MEV2 3JD73 3RJRA 1W8FA 5C8CB 5LRRA 1W6OB 2XKPA 1AR72 4QU1A 1JHJA 1C5IA 2D43A 5D8AC 4LHSA 3O1PA 2IUWA 4NIAA 1XSQA 4JGYB 3B9CA 5CEHA 1COV3 1ZZBA 3S5QA 3D8CA 2PLV1 1V6NA 2DWRA 4XETA 3NO8A 4ZS3A 4AOCA 4Z8BA 4I2OA 3VBUA 4XURA 5F32A 4HBNA 3PTRB 3O14A 3WHUA 4A3XA 3CDZB 3I8TA 2NM1A 1IGOA 3BN6A 2HEVF 4Q8KA 4GB33 4QXBA 4FPLA 1AYM2 1ZZ7A 2VXJA 1LTEA 4XIOA 4LHNA 5A33A 2PA7A 1QJU1 4CDWA 5GZCA 1IKPA 5BV6A 2DVBA 1R1A1 1E5IA 2I07B 4W6WA 4COVA 3JU9A 5FZBA 1AR81 4RD7A 4UW5A 3LDKA 5AC93 4Y20B 5FP8A 4CCKA 1S0GA 4Y22A 3CEWA 2G9GA 5GLVA 3LEKA 3VZLA 3GCWA 5C4WB 3MV01 4HMZA 4UFLA 5I8SA 1R082 4KWUA 2YU1A 2JDHA 1XU1A 5IVEA 3LWCA 1FOD2 3N9OA 2BU9A 4RGKA 2CDOA 2P3YA 3FUQA 3UKVA 2R0HA 1Q5OA 1GLHA 3EMRA 2PAKA 3MW3A 4XF3A 3M7AA 2XBO1 4LOTA 4XPVA 2R30A 1GU3A 1PO22 1JBCA 5C33A 3RZJA 3KVBA 2W3JA 4YM3A 5IAXA 2R072 2VZRA 1ASJ2 1NQDA 5EXOA 1GOFA 2BWCA 2QDRA 4FPKA 2ZTNA 1JOJA 2JE7A 4O9EA 3DYMA 4GQ7A 3J8F2 2A73B 1GP6A 3POWA 3BIWE 3I59B 3PVBB 3QACA 4PBOA 4X8NA 1RUOA 4AFAA 2BOIA 3U4XA 3WNKA 1XYPA 2RJKA 3DCQA 4ONUA 5A7SA 3WW1A 4BYYA 3WG4A 1F8VA 1AYN3 2YC0A 5I8TA 2VCMA 4GH4C 1UL9A 2JG8A 3OBAA 2NMNA 4YLZA 3AX4A 3H7YA 3AMMA 4LLFA 2PHFA 2RM23 4NVPA 1LNSA 2RG4A 5KHKA 2WUHA 2FZ2A 3LOBA 2FDJA 4A45A 3V0BB 5JZGB 4XXAA 3ZFEC 4C0HA 3LA3A 4NIGA 2CGPA 3CZUA 3NL1A 3SCGA 3SH5A 1TNRA 1BCXA 5F5CA 5IK7A 3PU3A 1AYN1 2DYCA 4MGYE 4AAPA 3KS7A 2C6SA 1ND3B 3VZKA 2XL9A 5DUXA 3OBTA 1TVGA 4TTGA 5E88A 4OZXA 4AEMA 4KGGA 3ZN6B 1DQ2A 2W1SA 5CBLA 4AI2A 2A75A 1W05A 2VNOA 2ZGKA 2IFWA 2FDGA 4CP0A 2WZEA 3VDCA 2W91A 1ASJ1 4HONA 3HNBM 3CJIA 1PIV3 2NN8A 3KD4A 4DUWA 4Y3OA 3IMMA 4COYA 1RUG1 2WFF2 3IZOA 4Q4V3 3B69A 4UOJA 4KWLA 2NQYA 1YWKA 2OA2A 4KH9A 2JDZA 4HVRA 2BWAA 2PMWB 1L7QA 4PCRA 2YYOA 1UXZA 1ACCA 1ND2B 1O8PA 3NV1A 3PUIA 2GDFA 4Q0PA 4AI1A 3WP3A 4QGLA 3ZSEA 5KWRA 1H8TA 3I3DA 2DCKA 3WF2A 5FYZA 3UYJA 4AZZA 4CCJA 3U10A 5LCWL 3WP5A 4UW3A 1PZ9A 5CFCC 4ES9A 3I2IA 1LGNA 2IVJA 3FZ3A 2IC1A 3HQXA 1E57A 3T0DA 1JZ5A 2V09A 2YV8A 4GWJA 5J96B 5FZCA 1LHOA 5F2SA 2HWF3 3AFGA 4I09A 3TEZA 4XJ8A 2D98A 4E2SA 1V9U3 2RS33 2ATFA 4MX3A 3TB0A 2E6VA 4AGGA 5C4WC 2CU5A 1DF0A 1S2KA 4JGZC 3T1LA 2JD4A 1KXGA 3LQCA 4YPJA 4OMCA 4J6GA 3IPVA 3OPZA 4QHOA 5B4NA 4FXKB 3O1TA 1UZ0A 2WN2A 3MIFA 3LOIA 4GJYA 3N9QA 4JQRA 4RYDA 4DMIA 4YVWA 4Q4X3 2RE9A 5FYSA 1SLIA 2DVGA 5L73A 1RUD1 3ETPA 2PLV2 1J3QA 2ZOEB 1ZX5A 3KT1A 2FBEA 4NWVA 4CEYA 3J7NA 3AYEA 1CAVA 3PNAA 5K0UA 1GICA 5FLHA 1REDA 3JXSA 1OLQA 1RXFA 1EV12 4BQ1A 3PU8A 1KGYA 2UWAA 3HR9A 1FXZA 4K1ZA 1PM4A 1W6NB 3KCXA 4QPGB 5DUVA 2VJXA 3ZFFC 1TG7A 4Y20A 1NE4A 4E9KA 4Q26A 5AC91 5CADA 3O1RA 4JGYC 1SEFA 2ZX1A 3MIEA 4MHUA 2XLAA 2P6HA 1I5PA 1K12A 5CKQA 3UGGA 3KV9A 4D69A 2JJ6A 2D5FA 3T0AA 5JCTA 3VDBA 4IV3B 1QF3A 3ILRA 4FQ4A 2AENA 3RI8A 2D6MA 1N1VA 3JBG3 1YYNA 4N53C 4ZZ8A 3SC7X 5I91A 4K8FA 4KU8A 2WBKA 4U36A 4KGQA 1W9FA 3LPFA 2QUOA 1F2NA 4X6QB 3MPBA 1J58A 3SKJE 4ZU4A 4YZ4A 4PF1A 4OI0A 2B9UA 2PHXA 1BBT3 1V6LA 3ES4A 4UBHA 5IJRA 1YCIA 3C7HA 3W20A 1VRH3 1BK0A 4E4ZA 1AR91 1PX3A 3PMEA 1UMHA 1ULCA 4LBQB 5F5AA 1X8EA 2YMZA 2B39A 5FZAA 3N9NA 4XILA 1JZ3A 2ZHLA 4META 5A3PA 1ZA7A 1MZEA 4YZ1A 5A1LA 2XJQA 5ABJC 4I0BA 2EIDA 3MIBA 4XFCA 1LOEA 4CCEA 1F9KA 1ZRDA 2PXJA 3ZYFA 3AP7A 1US3A 1N1SA 1UAIA 3GZAA 2QZ3A 2PHRA 2OKXA 4P00B 5IVCA 2ZACA 4BDVB 2DDUA 4KQ7A 2X05A 3HT1A 3OY8A 4QDSA 1OQEA 2W1WA 3KT4A 2BJSA 1KFUL 1Q43A 1GFF2 4OLLA 1R091 1W8UA 5ABJA 1HW5A 4DFSA 5IFTA 1XXNA 4RGAA 2QQMA 3POFA 3PJQA 4OI4A 3WCSA 2NP0A 2OVUA 4J1XA 4LNVA 4AEDA 4QWNA 3ZIXA 2AR6A 4NPLA 1NCQB 4UFJA 5J37A 4S2FA 2RDSA 3VB9A 2HH9A 4XQWA 5HXMA 2I45A 3ZSLA 2H6BA 4BPZA 1CESA 2V4VA 4IE7A 3HIFA 4F83A 5FAXA 4BXFA 3T2PA 3M8LA 4FAGA 4L97A 4E2QA 2XGXA 2B4KA 5JAXA 1ENQA 4QQHA 4EZHA 4FPJA 5KHIA 4UBGA 1CIWA 3AP6A 3IKWA 2VZ1A 1UKGA 2Y8KA 1UY0A 4XEZA 5H9QA 2FD8A 1CN1A 5FMOL 2XUEA 4PF5A 4URAA 3MYXA 3J7MA 2HWD2 1CONA 1FATA 5FZHA 2ZBJA 5FY7A 1E5SA 3C7EA 3FHQA 4A2UA 1EAH3 1RUF1 3RMXA 4WVMB 1GBGA 4O65A 1MS4A 2BNOA 1GNZA 4XE9A 3CL1A 3ZLIA 1WCKA 1RMU3 4CDQC 1XNAA 2PELA 3D0SA 3T4HB 1VBB1 4J25A 4LUMA 4FPYA 4XC9A 3I7DA 1VBD2 4ATFA 3MV11 2WNUA 3A7QA 1N1TA 3J4UH 3O0WA 1AXYA 2DUQA 3CBNA 5FBZA 2ZMNA 4D7YA 1SZBA 2G9FA 4JGYA 5JOZA 5KXEA 1UOFA 2HWC3 5J3UA 3QOPA 4Q1PA 1JYXA 2PQQA 3H8RA 3SISA 3H42B 4RA0A 3WP6A 1ALYA 1UO9A 2G4IA 4HLTA 2ZGUA 5BNOB 5FZ6A 3M2MA 2HWB2 4I3PA 2OZ6A 3JBG2 2VU9A 3QH7A 3ZYHA 1LODA 3LPGA 4Q4W1 1QY4A 4K21A 5FR3A 2GMMA 4F3JA 3ST7A 3RZGA 4AW7A 1DGWA 1OSGA 3KCCA 4HN1A 4AHZA 4XF9A 4C91A 3I2GA 3OOXA 4XVHA 4CEYB 1W8HA 1WLWA 2G19A 2EXKA 4ASKA 1NA1B 4DXSA 3AYDA 3SNMA 1JUHA 5C8WA 4PLNA 1H0BA 3LIHA 2E7AA 2MEV3 4PI0A 4XUQA 2CYFA 2WNUC 4M3CE 2O8OA 5A7WA 4RQPA 2GN3A 3BCWA 4Q4W3 3GZUC 5CFDB 1UD1A 1W3XA 4NJ4A 2BOJA 3KQRA 4M3CA 1PGW2 4YFZA 3I3QA 4MHRA 1XC6A 2YDEA 2E51A 4MGSA 2R061 2E32A 2HWE3 3CJXA 2RS53 3FMGA 1REEA 2ZHMA 4MOAA 3VBSB 2O8QA 4PQ9A 4Q1RA 2E33A 2RDQA 4IDZA 1YIPA 1BKZA 2V72A 4UI9L 4WBBA 2BGOA 2X5IC 1MZ6A 4A4AA 1XBFA 1S2EA 2DU0A 2JDPA 3N36A 4GAZA 2HYXA 1X33A 2VMDA 1HXS3 5FMOS 5A3OA 4IEVA 5CNAA 4EN6B 3VGIA 3I4IA 4XUTA 1ENRA 1K5MB 4CEWB 2J1SA 1D4VB 4XF1A 1OVPA 2F6BA 5L9VA 1UU6A 3WHTA 1FOD3 1LEMA 1GNHA 1OKOA 5A1AA 5DAVA 1J83A 1W39A 1YI9A 3GYDA 3U0ZA 4LBKA 4GIQA 1QJU2 3Q8BA 5BUVA 1RUC3 1YJKA 2DUOA 3M3QA 1WGPA 2XUMA 1OBNA 3TEYA 3DF0A 1RHI3 2HWB1 3K2OA 4K8RB 3RJ2X 2YUEA 4Y5TA 1G7YA 5ABJB 1G9CA 1DDLA 2VUJA 2W95A 4GXLA 4YWAA 3AB0A 5LY2A 5EZWA 1C28A 4GWNA 3U11A 3ZPYA 1DIWA 2GNMA 3HWJA 3TRSB 1DQ1A 3VBHA 4BU2A 4NO4A 2O1QA 1K5JA 1OI6A 3AFKA 3B02A 5FXVA 5C70A 2JDMA 3WF1A 1UMIA 4AGRA 4TN7A 4R4ZA 3ZO0B 2DURA 2K46A 1ZYBA 4CDQB 2XPJA 3CKHA 5FZ9A 5AFBA 1A8DA 5EPAA 3C2UA 3LFMA 2TUNA 4KU7A 4EN7B 5F3EA 3PIJA 4HG6B 4CCCA 4MH0E 5FZDA 2D97A 2BV4A 3NAPC 2EXIA 3VKMA 4CZSA 4CPBA 3E97A 3WUCA 3VL9A 4KL1A 4ZU7A 1RUNA 2ORXA 1VJ2A 5TSWA 1W03A 3NWKA 4QKBA 3MFCA 4ASLA 1SPPB 2ZGMA 2EAKA 2YBSA 5E8AA 2JXAA 1JU4A 2ILMA 1O5UA 1P8JA 1QKQA 4B8EA 2KA3A 3O1UA 4RHV1 4P5HA 1J1LA 2XJSA 1W90A 4Q4Y2 3OYWB 2D3SA 1LOGA 5FYMA 1O3SA 3ZXJA 4LORA 1PX4A 1UQXA 1VBD3 4NRMA 3UT0A 1I5ZA 3W5NA 4JGZB 1CPNA 4NIDA 1O3TA 4BQ4A 2FMYA 2VL4A 4IEZA 3TN92 1RIRA 3THDA 5GZEA 1S4CA 2O0OA 1FMD3 1YLLA 3WD5A 1RITA 3MF6A 1W06A 1NA1C 1NUKA 2JB8A 3F95A 1TMF1 4HZFA 1NX9A 5HV0A 4QQPA 4Q29A 1AR62 3HJRA 5A33B 5A3MA 2GU9A 4LJHA 2A71A 1FX5A 1IG0A 2VOVA 4Q27A 2QFEA 5FUNA 3WF3A 1F5JA 2Y0IA 2VH9A 2ZX3A 1PGSA 4JQTA 3JQWA 2VNGA 3APBA 4N8MA 2WWUA 3OSDA 3A0NA 3MUY1 1WW5A 4LMFA 3C7OA 2WZR1 2Y33A 4XUOA 3IB3A 1NA1A 4L8QA 1C8NA 1RC6A 1H1IA 1AX2A 5FY1A 4LQRA 5F2WA 3A23A 5LBBA 2NYYA 3VZJA 2E7QA 4CPBD 4GWIA 1DCSA 1XYNA 5BNPC 2VZVA 2OW4A 1AL21 1U5ZA 2ZMLA 3B01A 3VBOB 5JUVA 3HMYA 3ZXDA 4JDOA 3ZXGA 4QKDA 1EYBA 5FZOA 2VCCA 2IXIA 1D2SA 5GZDA 3KB5A 1Y9GA 2P3IA 4F8AA 3GBFA 5JPMB 4ISRA 1UOJA 1W2OA 3P5BA 4IV1C 4R52A 1HXS1 4LKEA 3DUIA 3K48A 5LB6A 2WIIB 4IEOA 1AUYA 4H14A 4NROA 4XHBA 4YG0A 1EV13 3FLRA 3PUAA 3PDQA 1NCRA 3ZYRA 3POEA 4UFIA 1H8TC 2ZAAA 3A21A 4XIKA 1NAEA 1GOGA 1AL0G 3N7MA 1PMHX 3ZFFB 2W2IA 4CRQA 1ENXA 2W5FA 2F17A 4A6OA 2XOMA 4CDUC 2HBTA 1W28A 5F37A 3I2HA 1T6BX 4XFFA 1JZ2A 5KC6A 2WT1A 4RFT0 4P9GA 2AREA 5C9AC 4PHZA 3T2TA 4DB5A 1RUC1 3GF6A 1PNGA 2B42B 2Y60A 2VMHA 3FN9A 2JIGA 4QGNA 3DXUA 1IHMA 4AF9A 1M06G 4CCLA 2W08A 4UT5A 3AKPA 1ONAA 1A78A 2QJVA 2VOXA 4NR1A 4AFMA 5JMCA 1GKBA 3N4MA 1KJRA 2WFPA 1PIV1 5A7QA 3WSOA 4EZ4A 3UGFA 1MS8A 1G9BA 2J1EA 1VBA2 1KDMA 2GAUA 3CZJA 3PL0A 4XBLA 3TN91 4EN9B 5JIUA 2C26A 3VBFB 4M0NA 2X8KA 5T5OA 3RRDA 1B35B 3KSCA 3NAPB 3U4SA 2RDNA 2GC0A 3AMHA 2ZHKA 4HOOA 3VV1A 2VW1A 5SV8A 4BLIA 2ZHNA 2VZ3A 4LA3A 2KXLA 1CZVA 2B46X 1UY4A 2XQXA 3QH6A 4BIFA 5DN2A 5FZGA 4RHV2 2BP6A 2VQ0A 1BXHA 3HN3A 1MS5A 1XOYA 5A7PA 3SHRA 3I97A 3FBMA 3DYOA 5AVAA 3ELNA 2BERA 2DVDA 2H0VA 1NLQA 2PHUA 2WYFA 2JKBA 1HJFA 3EXUA 3ZFEB 2RS52 1I3HA 4YARA 5BNNA 3IMNA 1S0FA 1Q3EA 4WM7A 3RWNA 1VB2A 4FFFA 1ST8A 2WDBA 4NAMA 3MLJA 1KFXL 1NLRA 5DZFA 3CJIC 3WF0A 4XDQA 1DLLA 1RUG2 2WFF1 3MBWA 5GALA 4BOWA 3H0OA 4DPNA 4YVSA 2W47A 4YW3A 5FY9A 5FY0A 1F4AA 2A1XA 3EJKA 4COZA 2ARCA 5IVVA 2VBBA 1WCQA 4KBZA 2ZMKA 3IAQA 1POQA 1GV9A 3BU7A 5C7GA 5LEKA 4NHLA 4CP2A 3KCYA 2CGNA 4NHKA 4G4FA 3LDRA 1DBNA 1QJX3 2AZ5A 2J1TA 3AZWA 4B7EA 2BRTA 3RPQA 3VLBB 1XQNA 5F5IA 4BH9A 4MYEA 1JN2P 4YVSC 5CU1A 3P1IA 1G6NA 2WJSA 2GP5A 4YGBA 3CQOA 4CEWA 5FMDA 1IPSA 5CAZA 5L7OC 2AEZA 2SBAA 3EO6A 2JICA 2BPA2 1NCRC 3ZN4A 2YG0A 1N3QA 3WCRA 4B4RA 5FJHA 2WZ8A 1VRBA 2W46A 4IEYA 1OKQA 4XZPA 3W9AA 2ET7A 2HEWF 1A34A 3BGAA 2OUJA 3PLQA 5FRAA 1OFNA 2VNRA 5I0TA 2XBO3 1FPN3 1YFWA 1QQP1 1HB3A 2RR11 3PVNA 3PTYA 4BQ3A 4CTEA 3OTFA 2PAMA 1CAUA 2WS93 1GR3A 2OPWA 4I0WB 1DU3D 4Y1XA 3ECQA 3J8F1 3JZVA 4MZUA 2RMU3 2JKXA 3R4SA 2XVKA 1X7NA 2BGCA 5BPXA 4Z92B 3UESA 2W52A 2XWJB 2X5IA 1CAXB 1NT0A 2JDUA 4RR3C 3RI9A 3FL7A 1XNDA 2QQNA 3T0BA 4IERA 4CDQA 4CEYC 1BVVA 3SH4A 2GMEA 4P02B 3W5MA 1MQTC 1NG0A 3B5LB 2YGMA 3BIEA 2ENRA 2VMFA 3OBZA 2E7TA 1BEV3 1N3PA 1QXRA 1C5HA 1W6QB 1W2UA 2WSVA 2XLGA 4IEUA 3WEZA 4LIVA 2JENA 1JYNA 3BTAA 2VULA 1OLME 1H2MA 5IK5A 1DQ0A 1UXXX 1LR5A 3JUUA 1YNAA 4XJZA 2P2KA 3VBRA 2ZGRA 4HL0A 1YHFA 2IXKA 4HT1T 4TLGA 3X29B 4AXOA 2YPJA 1PK6C 1S55A 4K20A 1UU4A 3IIAA 4M00A 5ANNA 2X53S 2LTNA 1Z78A 2D40A 1KD7A 2VVFA 2WA4A 3VBSC 3WDWA 3WG1A 1DYOA 3ZXAC 1ZREA 2RS32 4D6SA 3NNFA 3W58A 4RHV3 1CPMA 3VBUB 3LDBA 3J9SA 1YUDA 3LEGA 5CKNA 1LGCA 3OGGA 4CU8A 1YQ5A 2RV9A 1Y43B 4AEDC 3O12A 5C3OA 2XWBB 3R05A 3MO4A 1ZBE3 2XVLA 4QPIB 4XFGA 4CCMA 4MSVA 3RFRA 3EYPA 4CCDA 4NIHA 4QX7A 1C8M2 1UY2A 1US2A 3POYA 4QX8A 5FK7A 3AZZA 3NNGA 3QCWA 4B1LA 3RDIA 3NAPA 4Q0UA 2ZA9A 2UYBA 1RUJ1 5KHGA 4MVTA 2YC2A 4FSJA 1OFSA 2CHHA 5FQ0B 1S0BA 4GMP1 4XDOA 3FHIB 1TNFA 2J7MA 3KGLA 3KVAA 4C8DA 1H4GA 2NPIA 3AC0A 2Q8DA 4GB31 3LCPA 1UNBA 2CWMA 2FQPA 1POV3 4DINB 5T5LA 2WFF3 4Q4V2 3U07A 4I3GA 1VRH2 5A6QA 3QBQA 4ZKTB 1H2LA 1LHVA 4XW3A 1LOCA 3WDXA 5C6CA 1RUH3 3NJXA 3ILFA 5EJ3A 1W9TA 3GCXA 1SDDB 5GLZA 1JMUB 4XYXA 4QX0A 2XXZA 4N43B 3AKQA 2H0BA 4Q2FA 4GALA 1SLTA 5SV5A 3KHCA 1RUE3 1H1AA 2W9XA 1OD3A 3N9MA 4FPOB 4E2GA 3CU7A 3NQHA 5J48A 3AL5A 1ZA4A 5DPNA 4JTOA 2CWSA 3ZYPA 3RZMA 3VD7A 1LECA 2Q5TA 1PMIA 4M3CF 4OUMA 4BISA 1WLTA 3S7EA 3AL6A 4KNCA 4O61A 3BODA 3I59A 4DIQA 3IM0A 1W0PA 1AL22 3F2ZA 4UWDA 4P14A 4Y1UA 3GXUA 4EQVA 2WR9A 4LHLA 1RVF1 2RS11 5FY4A 1G86A 1HJGA 1UY3A 4M01A 2WZR2 1SACA 4WM8C 3E1F1 4HPKA 5JVVA 3HNYM 4JX0A 2HWE1 1SBDA 3A22A 4UF0B 3I49A 2JIJA 4IGOA 1QJFA 2R1DA 3QD6A 4UF0A 1I6XA 3NRUA 2ZX2A 2A6YA 5IW0A 1U5YA 3LE0A 1SQ4A 1H6YA 1QJX1 5DAXA 3O0VA 3LGRA 2UY8A 1BMV1 4H7MA 3VZOA 4FXGB 2EXJA 5KXBA 5IK8A 3MIHA 1BJQA 1GQGA 5JOWA 1PO23 3CO2A 4PBPA 1FPN2 3VBRC 5C4WA 2RM21 5GZGA 5KXCA 3I54A 1BBT2 3VZMA 1WWYA 3R0RA 3DV8A 2LROA 1ULEA 2P5BA 1LHNA 1V6OA 4FP3A 2IXLA 4KMQA 3AJYA 3DXTA 4FP2A 5F6LB 4QPGC 5BNNB 4DXTA 3LA2A 2ZEYA 1CX4A 1FI2A 2HEYF 1PMJX 2PAEA 3VBFA 1JZ6A 3OB8A 2P17A 3AP5A 1XB9A 1R083 1YQ6A 2JDKA 1LB2A 2X5IB 5LK5A 3V0AB 4LE3A 4I02A 5ANQA 2PN5A 4Y4YA 1HN0A 5FUIA 4LBNA 4EN8B 4MGTA 1S0CA 1CD3G 2XKOA 4IE4A 3B9IA 4MGQA 2R49A 4M0HA 3WDTA 3VD9A 4QMAA 3ZFEA 2LM3A 5A3WA 1VAVA 3ABZA 1U12A 2ZX4A 1GANA 5FK8A 4HXCA 1IPJA 4QDRA 4INDA 5JOYA 1H30A 1R093 2DVAA 1FYUA 5FYVA 3J26N 2DFCA 2RDRA 2WO3A 2Y64A 2JDYA 4XHXA 4WVZA 3ZVXA 2PQSA 4GKYA 2ZX0A 4H55A 4PIZA 3IDEA 1O8SA 5GLUA 3MICA 3AZXA 1N1YA 1OQ1A 5H9RA 1QGLA 2ZEZA 1RUJ2 3AKTA 4QHBA 1HB2A 1YIFA 3K3NA 2JE8A 4PIYA 1PZ7A 5T54A 4Z1VA 2FDHA 3H8UA 1W3VA 5DUUA 3UKTA 2WL1A 3IPVB 4J1WA 4R9BA 5I0DA 1F4HA 3LAGA 5CKMA 5F7UA 2R32A 1PHMA 3OBRA 4QT6A 3RG0A 1JOPA 1UYPA 4R9AA 3WNLA 1DQ5A 2HWB3 3ZKYA 3I3BA 3I3EA 1GQHA 2WWSA 3WUDA 4AHXA 4AVAA 1CAWB 3N7LA 4ZONA 1WA6X 4AWDA 5FO8B 3AJZA 1M4WA 1J59A 2WAOA 2GMPA 5FPUA 3RMYA 1CVNA 1CZTA 5D1IA 3LEIA 1QXPA 1RJ7A 1X9PA 5FPVA 4HKLA 4Z82A 1TME3 4UFMA 5IT6A 4IE0A 1G9AA 1W04A 1FNYA 3GNEA 1NLSA 3OGVA 1TMF3 3NMBA 4W6XA 2Q30A 3TAYA 3H8OA 3GJBA 3H3LA 3NJYA 4ATEA 3U78A 2OQ7A 4JDNA 4D7SA 1S0IA 1I9RA 1SFPA 4FFHA 1LOFA 4GMP3 4XFIA 3WY6A 2ZKNA 2DTWA 4LO4B 1VAKA 2WNVC 4XQ4A 1UU5A 1WLCA 1LGBA 4Q0QA 1NXMA 1JXNA 3T08A 5A32A 1O3RA 4FOYA 1BYHA 4GD4A 4WM8B 3AKRA 4DRVA 5L7OA 3PMSA 4DO0A 5JSPA 3AMNA 2A6ZA 1VBE2 1W9WA 2WWJA 3DKWA 4ES8A 2J22A 3EHKA 3PUSA 5ISLA 5CZKA 3RYRA 3WDVA 1YC61 3VBSA 4AVCA 2A6WA 3SH3A 2OQ6A 2W0XA 5EHDA 4CDXB 4QDQA 3KLSA 4ZZ5A 1NYWA 2WZPP 2B9VA 1OHFA 3BOPA 3ENRA 3H1YA 5FUPA 4FAHA 4AFDA 4NRQA 1RUJ3 2C0ZA 4OQ9A 3DPRB 3WNXA 4CDUA 5JI9A 2UYAA 4CU9A 2JEMA 5FP7A 2Z69A 4CCOA 3I2OA 2HWF1 4WVVA 5JSOA 4MXWB 3UJOA 1QQP2 3BPSA 1UWWA 1U5IA 2D3PA 5EJZB 3USSA 3NKGA 3HQUA 2IVIB 3V0BA 3POBA 1CGPA 2RMU2 4OULA 1RGSA 1V6IA 4GMP0 3W59A 5FKBA 4IESA 4DY3A 2DUPA 2RMU1 1XE8A 4NIIA 3BU0A 2V5DA 1RVF3 2RS13 5BNQA 1TEIA 2G1MA 2QZ2A 3ZR6A 1OF3A 3ORJA 4JRAA 1URXA 4OI2A 4D7TA 1XPWA 1TQ5A 5ACA1 2HWF2 4KWKA 5FV3A 1CAUB 3RZHA 3U37A 2BBVA 4QPIA 4FBFA 1LEDA 1UZVA 1DZQA 3FE5A 4XXPA 5CG9A 1ZZ6A 5J1XA 1G8WA 2QE3A 4CUGA 1EPZA 2ZZQA 1VBB2 2VZPA 4RR3B 1DZRA 1OH4A 2P3JA 3ZMOA 1DLCA 1GNYA 2VTXJ 4L9BA 2WQZC 2JX9A 4L99A 4IQPA 2XBO2 2K9ZA 1J3PA 1GP5A 1AF9A 5GKAC 2VAUA 1H9WA 4V2VA 1F5FA 4ZY9A 1XSRA 4IW3A 4Q4X1 2UY9A 1O91A 4B7KA 4MGKE 4XFHA 2VY0A 4KG8A 1W8TA 3D5OA 3I2DA 4AI8A 1R081 3U75A 3I2FA 2PHWA 3TEXA 5LA1A 4RQPC 5FOJB 1HRV1 1Z7S1 2D93A 5DXDA 1WBFA 2CDPA 1C1LA 3PVOA 4LBLA 2BBAA 5FBJA 3SXWA 4LT5A 2OPKA 4DNYA 1RB8G 1OD5A 2A6XA 1H2NA 3HD8B 4K9SA 2Y6JA 3ZMNA 3ZX7A 2GNBA 3P6BA 4NPRA 4OUEA 1JI6A 2R042 3SEPA 1LAJA 2WNVA 4QX1A 4Z2AA 1SCRA 1ZRRA 2ZABA 4JKLA 4LITA 2D6OX 3VHOA 2GNTA 3HNMA 3ZR5A 4BJ0A 1HQNA 3NVCA 1HIXA 4YZ3A 4BM8A 4CSWA 1XE7A 1RL3A 1UPSA 2A70A 1G9DA 3M1HA 4K6BA 2GNDA 4N9HA 1NZIA 2XONA 1OUSA 1B35A 3VUOA 2WNOA 1R092 4HVOA 2WYSA 1GZCA 1LOFC 3WW2A 4KI5M 4S2GA 2VW2A 3MW2A 4L2NA 2F4PA 2HWC1 1NY72 2ZGTA 4P9WA 3CMGA 1AR71 1HN1A 1JTZX 3O0XA 3KV6A 2ARAA 3MZHA 3INAA 3WQ0A 5B2GB 4D3WA 3SKVA 3WW3A 1FNZA 3V0AA 2ZGQA 1H4HA 1RINA 5BNPA 3VDDC 1UCXA 3ES1A 4XMAA 2QVSB 3Q9OA 5FZEA 2B7YA 1JYIA 1OOPB 1QU0A 4ZXEA 2D6KA 3AXDA 4RL7A 3KF3A 4LULA 1QJU3 1WKYA 3K46A 4FPFA 2QQWA 5A32B 1R1A3 1ND3C 5BXXA 1VBB3 5IVBA 3TOJA 3FX3A 3VZNA 4ZPIA 3DGTA 3E5UA 1CJDA 1ZM1A 5APAA 1RXGA 2VMGA 4GWMA 5FP3A 1IQAA 5ERLA 3VN4A 1QJEA 1S0EA 4FPHA 1D0HA 1DG6A 4O9GA 4RGGA 5DDJ1 3URFA 5C9AA 1IZ3A 4OMDA 3IBMA 4YVSB 3DN7A 4PDWB 4IEWA 1KDKA 1ZRFA 4ZU5A 4UW4A 2GN7A 3GZTB 1HV1A 4CDXA 2GC3A 3Q8CA 4DS0A 2W92A 4AFCA 2WS91 1HRI2 2RVAA 3NJVA 2IXJA 4WZCA 5AC92 1J1TA 1OF4A 4Z2WA 4NRPA 4NOTA 3WLUA 5LY1A 1O4TA 1LULA 1W6PA 1Y7BA 3B00A 3ZFFA 1FV3A 5T5JA 4L11A 2PHTA 2DV9A 2RHPA 1IKQA 2ID4A 3PIGA 4GA9A 3WT3A 2JDAA 3WW4A 2P37A 3W21A 3BUCA 1QQP3 1DHKB 1S1AA 4FT8A 1YQ8A 2W87A 3VKOA 5D8AB 5C8CA 1JW6A 4SLIA 2OT7A 3M70A 4AEKA 3ZKUA 2MPFA 4F7ZA 3L2HA 2Z79A 2GZWA 4YGDA 4BK5A 4AI9A 2BTVC 4XFAA 1PNFA 2WAAA 3NW4A 1D4M1 3OEAA 4QPGA 3D3AA 3GALA 1VBC3 4Q0SA 4QXKA 4XJ9A 5FDBA 5FYUA 3ETQA 1JYWA 3ZXEA 4RQPB 2D6NA 2P4EA 1W0NA 5C8CC 4NMIA 4LR4A 1QH6A 3Q8AA 1OQDA 1RUI2 2ZPXA 2FHRA 2ZKLA 4M3CB 4N7IA 3RQ0A 3RSJA 4HANA 4A7ZA 1H9PA 1JYCA 1WCUA 2WS92 3FBYA 1UKRA 1QMJA 2VG9A 4OHXA 1MPXA 2B8MA 2VQAA 2ZGLA 1DGLA 3OJBA 2TBVA 4QXHA 4YW7A 5FREA 1UYXA 5FTTC 4B4QA 5E89A 3D82A 4ET7A 3I3MA 5CFCA 4G3YC 2C1FA 3OGJA 4OHZA 1HRV3 5G04L 4CP9B 2VCBA 4AQSA 1GWLA 3JQXA 5LATA 5BNPB 1AHSA 3WR0A 1GP4A 2ZEWA 3WQ7A 1Y4WA 1Q8OA 4YGCA 1EAH1 1RUF3 3CNAA 3ZXKA 2LRPA 4IL7A 1Q8PA 4M4PA 4CXXA 4FFIA 4XF4A 4XDPA 1C8M3 1Q56A 3L2YA 2W39A 4XF0A 3WNMA 2KM2A 2A5ZA 2ZZJA 5T50A 3H3ZA 5HCBA 5KR7A 2UWBA 3ZIWA 1OT5A 3PJYA 1CX1A 3UJQA 4P9JA 1LJ7A 5HV4A 1NY71 4OHWA 5JLVA 4HETA 5DG1A 3WOGA 2Y6GA 1C8M1 2K2SA 2VVEA 1IOAA 4IGPA 3VD5A 4K1YA 1ND3A 1O3QA 5A6ZA 1UX7A 3MPPG 4BMBA 4E27A 1X9TA 4MGZE 3POJA 4YW5A 1NCQC 3HPNA 4TZDA 4FTBA 5FP4A 1RUE1 4BQXA 4HSLA 3LIGA 1UW8A 1CAWA 1HX6A 1W2AX 2CSGA 3OY8B 4HN0A 4IUGA 4XAEA 2DF7A 4CUBA 4EWEA 4RR3A 1X36A 1E5HA 1REFA 1QJZA 3KMHA 5IYYA 1JS9A 5JMOA 3BTZA 4JAAA 1BVP1 5J7MA 4BXSV 1SHWB 2JG9C 2BEOA 2VCAA 4PIXA 3HQRA 5FPXA 3UV9A 5H9SA 4L0PA 4AK3A 3JD72 3OCPA 4IETA 5M0TA 5FO9B 4H7LA 3POSA 1Z7S2 5DDJ3 3IDCB 4OQ8A 2WLQA 3C8XA 4R9CA 2X10A 2ET1A 4XCBA 3VD4A 5JXIA 4P5YA 1WUVA 4FOVA 4XUPA 2O14A 3P3PA 1OPOA 1ZRIA 4XBNA 1I1EA 1VBE3 4YM0A 3G6JB 3H50A 2UURA 1RUH2 1V6KA 1APNA 3KT7A 1QDCA 3ZFGC 4YG3A 1L7RA 2BDRA 3P3NA 4JKMA 1BQPA 2V4AA 5A70A 3KM5A 3MEPA 3R6SA 3DECA 1CZSA 3M3CA 1K5MA 4DQAA 1SPPA 5FLJA 2C5DA 4Q4Y3 1OMIA 1W8ZA 2AH2A 2BQPA 2R6QA 2ORZA 5K8SA 2D3RA 2PTMA 1F15A 3BB6A 1V70A 5FWJA 3WP4A 1X50A 4MV2A 2BGPA 2DU1A 1U5XA 4BLJA 5HPOA 1WA4A 1XE0A 1Z7S3 1FV2A 2WZR3 4IXLA 4MO3M 4Q4W2 2GH8A 3TEWA 1OUXA 1WMDA 4P9IA 3RNSA 5EIYB 1WW6A 3K51A 4FO9A 3AZYA 2HWD3 1PVXA 1PVC3 4MADA 1RUD3 2VZQA 4LKFA 3RZKA 4HKWA 4UFHA 1UX6A 4Y22B 4QPWA 3VBHB 3VBOA 4FPEA 3VD3A 3KHBA 5I0SA 2BYVE 2PLV3 1JOBA 4GKXA 4MXVA 1JODA 5T5PA 4BQ2A 5BNOA 4DXZA 1UF2C 2QCSB 3KV4A 4CDWB 1MS9A 3I2KA 5IHRA 4Y24A 5D2AA 1VBD1 1GZ9A 2DTYA 3OD0A 5KHHA 1V6MA 5FZ3A 3V64A 4DUXA 4A42A 2XMLA 5CISA 1RTVA 2CNAA 2VZOA 4O7XA 4AVSA 1KS4A 5FZ4A 1MVQA 4JHZA 3VDAA 4B3NA 1S2BA 3T09A 5JPNB 3TYJA 1BEV2 1EY2A 2R063 2VOKA 4X6RB 3WVJA 3FJSA 2QQVA 5C3SA 1VBE1 4YVWC 2JDNA 2CY6A 2E9QA 3MHZA 3FLPA 5GZFA 4N90A 4HFSA 3NV4A 1WD4A 5T55A 1BLZA 4AQ6A 2JG8C 2XVGA 4JZRA 4AEJA 3UGHA 2Q8CA 4QAWA 1LU1A 3SITA 4A7KA 2JECA 2YXSA 5FXXA 3FFZA 4IGQA 4LBOA 4ZXKA 2YFUA 4OVEA 4CA9A 3RWKX 2D7FA 2ADEA 2XJRA 4AI3A 5HBAA 1QJY3 2VNVA 2EF6A 4IE6A 1QJY2 5KHJA 2J42A 4LK6A 3BOWA 3DKQA 3T2QA 1HKDA 4BA6A 1GYKA 4W50A 3UL2A 2EAAA 1Q8VA 1LESA 5I93A 4N53B 2WNVB 2YBKA 5F9TA 1PIV2 4V2WA 2VXRA 4N53A 2IFRA 4NE9A 3JCIA 5C5UA 2JG8B 2D6PA 3MUZ1 1VMHA 1XJAA 1RHI1 1MS1A 2C9AA 3S7IA 4COUA 4FPCA 2DCYA 3N7JA 3S30A 3J7HA 2JG9B 2OZJA 4CXWA 1MVEA 1POV1 1MZ5A 5FYHA 4ZHNA 5IATA 1GQPA 1VBC2 2W68A 4QU2A 5A6YA 4I01A 4CDXC 1PO13 3POIA 4H2AA 5FQ0A 1RVF2 2RS12 3I2JA 5FYYA 2X09A 4AEDB 4P9XA 5JR2A 3MLKA 4HK9A 3SCFA 3B7MA 2Y6FA 5L9RA 4CU7A 4MLOA 4COWA 4BHPA 3O1MA 2NZ9A 4ZS2A 1HRI1 1NXD1 1VMFA 4GULA 1OXCA 3MGUA 5FZOB 1ND2C 3T4VA 2ARXA 2B5HA 3MIDA 2EIEA 3ZN6A 1V6JA 3HT2A 5E16A 5FZFA 4AFBA 1WD3A 2LS6A 3WV6A 1LOBA 1W8OA 2PFWA 3RZZA 1QNYA 4YM1A 5EYYA 2VVDA 1NZCA 2W1UA 3T30A 5LA0A 4LA2A 4OFGA 3THTA 2CGOA 5FZIA 3L9JT 5A7NA 3ACFA 3H9AA 5D21A 4GH4A 4XAAA 2VECA 3ZYIB 4E4SA 5EJ1B 2GSYA 2WKKA 4WZFA 2YZ4A 3AP9A 4MUVA 2VM9A 4LO6B 5JWPA 1BBT1 2ZCWA 4LIUA 1JHNA 1ZBE1 2GC2A 2PYTA 5LASA 2VC9A 4JRLA 4K7JA 4AQTA 2Z4FA 3PVEA 2VUCA 5CA6A 4AE2A 1J84A 4XJWA 1OH3A 2HWC2 1BMV2 4EV0A 4N43C 4EROA 5K0UC 4MGIE 1KS5A 4JCKA 2JB4A 1QJX2 2WLPA 2FDFA 5BNOC 3SCHA 4R8HA 3ZN5A 4FI9A 3KV5A 2V5YA 1AR61 2FCVA 2HWE2 1WW4A 1H8VA 5FOBB 4QHZA 5G05L 1RMU2 4Y5Z0 3H1MA 3S6PA 1WMFA 2MNGA 2XJUA 3NNMA 3KF5A 4Y26A 3LKJA 2VQUA 4E8DA 2XDVA 4DRRA 4BWOA 3ZSKA 2EA7A 1YXWA 4CXYA 4YZ5A 4C90A 2R041 3ASIA 1HQLA 1AJOA 4JDMA 1RUI3 5K0UB 1IS6A 3HEIA 3D4KA 2BNMA 4FVVA 4A7YA 2AACA 4AVBA 2ZEXA 3RYKA 3USUA 4NHYA 5GJ6A 2HYKA 1VR3A 3AXEA 3VBHC 1YFUA 5IVJA 1PM7A 5JXJA 1ZZ9A 2N7GA 1K5MC 4L92A 2X29A 4TLFA 3RZLA 3RYPA 4A6SA 5BY5A 5E6HA 4S2DA 1PVC2 1JZ7A 1UN1A 2VOTA 4A44A 1SLLA 4Q4X2 1DQ6A 3AVRA 4PLOA 3ZSMA 4EE2A 3KZ4C 4N9IA 1BZWA 4YFWA 4EN0A 1AVBA 5CFDA 3H3UA 1BEV1 2EVXA 3U14A 2XQRA 1L3JA 1H8TB 4BCUA 1GWMA 5FP9A 3NKTA 5F6KA 3OGRA 1F31A 2FZ1A 3HBKA 4LKSA 4YM2A 1LHWA 4EWDA 1ULFA 4OHYA 1CR7A 4PDWA 2VUDA 2Y6KA 2VTFA 4YW2A 2HLEA 3PHMA 5JI7A 4Q0VA 5EV7A 5K7PA 4UAPA 1EUUA 1WCDJ 2QBXA 2VGDA 4QPYA 4XZUG 4YW6A 5C9AB 1W99A 5L36A 2G9ZA 2E31A 2Y38A 5F8PA 1HV0A 5FZMA 5EFUA 2OUHA 5ACA2 1UYYA 3C7GA 1XU2A 1G9FA 1OLRA 3ZXFA 3IIIA 1IG3A 4D94A 3WNNA 4B1MA 3GHMA 1YI7A 3AMPA 1ULGA 3C3VA 4HPKB 4W6YA 5F3GA 4TWTA 5E1RA 1W9SA 4AI0A 4PJYA 5KXDA 1KITA 5B4XA 2BUKA 1MS0A 5HCFA 5FYCA 1Y9MA 3IAPA 3C7FA 4WM7C 2WQ8A 2RS31 4D8MA 4MG2A 2NLRA 2BNNA 4Y1YA 1C3HA 3BTXA 2XJTA 2HBUA 5DUWA 3USUB 5ACA3 2BFUS 2K0GA 1W9YA 4YGEA 2VBPA 3WQBA 1PGL2 1ODNA 4Q8LA 3MW4A 1WBLA 2B45X 3PUHA 3AYAA 4KBBA 1A6CA 1AR83 3ZM8A 1OOPA 3SLIA 4AQ2A 2OXBA 3ACLA 4CUCA 3DPRC 3K4ZA 1CAXA 1O5LA 4XTPA 4D6RA 2R071 3CF6E 4AG4A 1C4RA 4QKNA 3Q8EA 1PO21 3SQOA 4U2AA 3WXPA 3ZDSA 1HLCA 5FWEA 1RUH1 5JR7B 5JXGA 3PUQA 4E8CA 1QH7A 1DP0A 4IEQA 4Y1VA 1OPMA 1SFNA 3ALQA 2WA3A 4G9SB 2RS51 4QB1A 5DZEA 4QX2A 2GALA 5FYTA 4LO8A 1UZYA 1PO12 3NJZA 2R1BA 1YEWA 1FOD1 1NCRB 3DPRA 4EJRA 2ZGPA 1ASJ3 1HDKA 1L7LA 1OURA 2ZS6B 1O4YA 2CL2A 2QQPA 1W0OA 1BHGA 1XYOA 5DG2A 5C3QA 5C5TA 4XUNA 5FMBA 3JD71 2XH6A 5J36A 4HVQA 1N3OA 1VPHA 3ZYBA 4OCTA 3V65A 3O7OA 1T6GC 3S5AA 1UZWA 2YPDA 2D44A 1POV0 1Q8SA 1HRI3 1R1ZA 2YC4A 1R1A2 4AAXA 1WZXA 5IVFA 3VBRB 4FCAA 5T3NA 4X8PA 2VMEA 3WG3A 1VBA1 2R0FA 2Q1MA 4XJAA 1IPKA 1Y3TA 3OEBA 1AYM1 2VE1A 5A80A 5FKCA 3VKNA 4LEJA 5FZLA 3ZFGB 2DCZA 1YJLA 1MACA 4OI1A 2LW8A 2Y6LA 3O1VA 2WINB 2LUWA 4LTAA 4RFRB 4XOGA 2XLFA 2ZGOA 4BB3A 2VO5A 5FZ1A 5C3RA 3ZYJB 4CE8A 4BK4A 1TME2 1CIYA 4NWWA 2WT0A 4KWJA 4DEVA 1SBFA 1RUC2 2W94A 5GLWA 1UOGA 1V9U1 1VB4A 1VLNA 3WDYA 2F4LA 4GZ9A 5K9YA 3ZDVA 1GOHA 1AJKA 2C24A 2VMIA 3H7JA 4Z07A 1CAVB 1O6UA 2JG9A 1H2KA 1A3KA 1QWRA 4RS5B 2H6CA 4YSFA 4B29A 1PK6A 2FCTA 3WDUA 4W4ZA 2Y34A 4QM9A 1ZZCA 3TWIA 4RS5C 5DQ0A 3MDPA 4CP9A 1W6QA 5IVYA 2YGLA 3EQEA 2DVFA 5DMYA 2QNKA 2FDIA 1AX0A 1QOOA 2YB7A 3B3QE 4FFGA 5CYYA 2Y26A 4C0BA 2J1RA 2L9LA 2XHKA 2DBIA 1T2XA 4B4PA 2XG3A 1RJ8A 1IS5A 2TEPA 5FY8A 2CV6A 2JE9A 4JTNA 1QIQA 2D6LX 2VZUA 1D4M3 1UYZA 4Q5OA 2YHJA 1SLCA 5LBCA 2VTXA 1W6OA 1K45A 1NQJA 2D5HA 3KQ4B 2A6VA 4R9DA 3K4AA 5DAPA 3VHPA 4CDUB 5HCAA 1XRUA 4CYDA 2R043 3WZ1A 3D0JA 1K42A 2VZTA 5LA2A 2AYHA 1QOSA 2P3KA 5DAWA 4MXWA 2Y6HA 3VKLA 5F5QA 2RM22 3BKZA 4Y33A 1ENSA 1GSLA 1VP6A 4R4XA 4YVWB 3LA7A 3WX5A 1J3RA 1LRHA 1VAMA 1VE0A 5EWSA 3GJAA 1FMD1 1RMU1 2Y0OA 3VBUC 2BVBA 3AMQA 2QQOA 4YNIA 1W2NA 1B35C 1O4ZA 2DFBA 1LENA 3OUHA 2VOWA 3LD8A 3ZXLA 4YYOA 2BZDA 4GJZA 3BVCA 5IFPA 4FQZA 5FPBA 1FMD2 3LSDA 1PK6B 5I0UA 3RGBA 3OGSA 5D8AA 2QQIA 3MLLA 2ZJCA 4ITCA 4UW6A 1AX1A 1ZZ8A 2QQLA 3ZSJA 4A3ZA 1ZBA2 4CU6A 4XQDA 3THPA 1JH5A 4D6QA 4DY5A 4CVUA 2E63A 2E26A 4OYUA 1WMXA 4WVWA 1QOTA 1D2QA 1W8WA 1KJLA 3B93A 1DFQA 1X8MA 1FT9A 2JWPA 4AHYA 4E4DX 2VR4A 3BPZA 3FHAA 3IN9A 5H9PA 4IEPA 1CQ9A 3GZEA 4QM8A 3WINE 5K4LA 3VHRA 4DZGA 1CWPA 4WM7B 2AGSA 3U1XA 1AR92 1LU2A 1UY1A 2CAVA 3WNPA 2XJPA 5DZGA 4EYUA 1DQ4A 3KWVA 2IZWA 2YY1A 4NHXA 1CJPA 1ULDA 3R4DB 2VD7A 1UIJA 2ZAHA 3JB8A 3GM8A 3N9PA 3FWEA 2ETEA 3R4UA 1QHDA 5EP9A 5A3UA 5J09A 5L19A 4S2HA 1MZFA 3IT8A 4JC1A 4TXWA 5FFOC 2JD9A 3GGLA 3MFAA 4QX5A 2WN3A 2A7AA 4P9LA 3QLQA 1ULPA 3MF9A 5FIXA 1RUG3 4Q4V1 2I74A 4JGZA 4XTMA 3GDBA 3VDDB 3ILNA 3THCA 5T52A 5IWFA 2EALA 4GB32 4C1WA 1K3IA 1SCSA 3M3IA 1O7FA 5FCCA 4AHWA 1V00A 5DAQA 2ZXQA 3HN1A 5FJKA 3K3OA 3O1OA 1MEC1 4QQOA 3OYWA 1XNBA 3E5XA 2Q8OA 4LKDA 3DYPA 1IQDC 1QEXA 4JVAA 4YW4A 1V9U2 1OA2A 4BE3A 4AVTA 1QNWA 1TME1 5KC5A 1C57A 3B94A 2FCUA 4PLMA 5CFDC 1D0GA 2MHFA 5FPZA 1NCQA 1TMF2 2C9KA 3NNJA 3VL8A 4YRDA 3A4UA 1MEC3 2P1BA 1W8NA 1EP0A 1VBA3 3UK9A 4RS5A 2E53A 1U0AA 3BYWA 2IXCA 4BQYA 1COV1 1OC1A 2YFZA 4ISQA 2RJLA 3E5QA 3ON7A 1QJY1 4CP1A 1SFYA 1OLMA 4WV8A 4Q4Y1 5LA9A 1OA3A 1SBEA 2OX0A 1LOAA 4E4HA 1MS3A 4JV4A 4LLOA 3NV2A 4LXLA 3AK0A 3D6EA 3G7DA 5CVRA 2EIGA 3ACGA 2Z5WA 1HRV2 4CDWC 4QXCA 3LFIA 1AXZA 3FC0A 1PZ8A 5I8YA 2Z42A 4QX3A 4BIOA 2OIIA 4D0QA 4V1PA 2OYZA 1PO11 2IXHA 1KRIA 3ATGA 3K77A 3UKNA 3E6CC 3OPTA 4WVMA 2QQJA 4OUSA 3BTYA 4YG6A 3FLTA 1V0AA 3LB9A 4IV3A 5FXWA 4N43A 4NPMA 5J98B 1JU3A 2XB6C 2NMOA 3ACIA 3IDAA 2DCTA 1FAYA 1PGW1 4LE4A 1F35A 4Y5SA 5FZ8A 5JOXA 1DGRA 3OPWA 2Q1ZB 1JYVA 2W1QA 4LBQD 5CB7A 3RS6A 3ZPOA 3VHNA 1YO8A 2WNUB 5IAVA 1HB4A 1ODMA 4CEWC 4SBVA 2GC1A 2GH2A 4KG0A 1YQ2A 4DEQA 2Q1FA 3OUIA 5LRSA 1ZNPA 2SLIA 5JDBA 2Z2SB 3CIHA 4FTSA 3M3OA 1PGL1 1H6XA 1W2TA 4IEXA 2Q0AA 2RR12 4BQWA 3O1SA 4LHKA 1WW7A 2R7EB 1AR93 4YZ2A 4XFBA 3AKSA 3N7KA 5GLTA 4PQQA 1AYN2 2Q8EA 3AM2A 3MIGA 4QGMA 4AGVA 1NOVA 2XR4A 3PURA 3Q8FA 5A3NA 5LWBA 4LO7A 2FMDA 4JKKA 2PHDA 3JBG1 4Y4RA 5A1FA 3J8F3 2QKDA 4CCNA 4FOQA 1ZBA3 5JIAA 4NN0A 2VUAA 3ACHA 4URTA 1EUTA 1STMA 5GM0A 3NSTA 4QQ2A 3SEEA 5CG8A 4M4RA 4AYUA 1MQTA 2WNEA 3N35A 5FXZA 3E6DA 4UYBA 5A7WB 2QTWB 1VMJA 3GBWA 5FPLA 4HKOA 5FYIA 3J7LA 4PT6A 1GZTA 2GP3A 3V56A 5JZGC 5KBFA 3TN93 2YBPA 2RJ2A 1AZDA 2AC1A 4QB6A 1XNCA 2ES3A 5DABA 3ZYGA 1D7PM 1RUF2 2DCJA 3LEMA 4QPIC 5FZ0A 4ARYA 1IS4A 2HJIA 4LBQA 3CJIB 3NNLA 3ME2A 2V73A 4JHTA 3RVHA 4N7UA 2R062 4LBMA 2EXHA 2QDNA 2WQ4A 4BMEA 4HK8A 5LK7B 2HWD1 2XHNA 4RSUA 3NV3A 5LZ6A 4RN5A 2AEYA 1DGRN 1PVC1 2ADDA 2PHLA 2WSUA 3K4DA 4K40A 2FDKA 4OHVA 2Q4SA 3H8XA 1DZTA 1ND2A 1UPIA 1WMEA 4TSVA 3N9LA 4C1XA 1ZVFA 3HBZA 3ZOIA 4PI2A 3LZZA 2VPVA 3FFQA 3MI8A 1W6PB 4QB2A 5IK4A 1WCSA 1QXJA 3EBRA 2CTVA 4PDWC 1AR82 3M3EA 5LEJA 4A41A 4P08A 2YU2A 5EQUA 1BK1A 1DYKA 2EIBA 1RYYA 1COV2 2A3YA 5F3CA 3ZFGA 4DUVA 5CIRA 1JYTA 2VMCA 2WC2A 1YFXA 2VW0A 2C4XA 4H3WA 1B09A 4NUBA 2WO2A 1RUE2 2BFUL 1AR73 2CAUA 1DYPA 3WNOA 5BNNC 5FY5A 1SMVA 3IWZA 1N47A 1UOBA 2P6CA 1DGWX 1MQTB 3WF4A 1AR63 1SLAA 4XCAA 5I0RA 1XNKA 3WQ1A 5JXHA 4Y1ZA 2P34A 4CUAA 3VKFC 3BALA 2ZGSA 3LSEA 4IV1A 1YFYA 1MEC2 5HI0A 4IV1B 4LBJA 2TNFA 1ZBE2 1IS3A 2XJVA 2MEV1 2WABA 2WO1A 5JSRA 2QQUA 3CHXA 5IUQA 5LBEA 2VBDA 3H1WA 2DBNA 5FZ7A 3POGA 3VBOC 2YROA 4IV3C 3T2OA 3HOBA 2IWGB 5EYXA 3TNPB 1JZ4A 3AYCA 2BW8A 1X82A 2R16A 3HVDA 1EAH2 3DEMA 1Q8QA 4DOUA 3A0KA 4LOSA 3LF7A 4NAOA 1S0DA 2WO7A 3HAGA 4QQLA 5BYNA 4FTEA 5HCHA 1SG3A 1HXS2 1VIWB
chains in the Genus database with same CATH topology
5FMDA 5FMBA 4B1LA 3LIHA 5FKBA 3UGFA 3KF5A 2AEZA 2QQVA 3U1XA 4UFHA 4FFFA 2AC1A 3U14A 3LDKA 4UFJA 1ST8A 2XQRA 3NMBA 1Y9GA 5ANNA 3H3LA 3LEMA 3S5QA 3ZR6A 4CCEA 1Y4WA 5FMCA 3ZR5A 4FFHA 3UGGA 2QQUA 4AZZA 4UFLA 3UGHA 1Y9MA 3HBKA 4JQTA 4UFKA 3KF3A 2AEYA 2ADDA 1UYPA 2QQWA 4FFIA 3OSDA 3LFIA 3LIGA 4HXCA 5FK8A 5FKCA 3SC7X 3PIGA 4UFIA 3PIJA 4EQVA 3RWKX 2ADEA 4CCCA 5FIXA 1W2TA 3LDRA 4FFGA 4CCDA 3IMMA 3LF7A 3U75A 4B1MA 4QHZA 5FK7A 4UFMA 2OXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FMD A;  5FMB A;  4B1L A;  3LIH A;  5FKB A;  3UGF A;  3KF5 A;  2AEZ A;  2QQV A;  3U1X A;  4UFH A;  4FFF A;  2AC1 A;  3U14 A;  3LDK A;  4UFJ A;  1ST8 A;  2XQR A;  3NMB A;  1Y9G A;  5ANN A;  3H3L A;  3LEM A;  3S5Q A;  3ZR6 A;  4CCE A;  1Y4W A;  5FMC A;  3ZR5 A;  4FFH A;  3UGG A;  2QQU A;  4AZZ A;  4UFL A;  3UGH A;  1Y9M A;  3HBK A;  4JQT A;  4UFK A;  3KF3 A;  2AEY A;  2ADD A;  1UYP A;  2QQW A;  4FFI A;  3OSD A;  3LFI A;  3LIG A;  4HXC A;  5FK8 A;  5FKC A;  3SC7 X;  3PIG A;  4UFI A;  3PIJ A;  4EQV A;  3RWK X;  2ADE A;  4CCC A;  5FIX A;  1W2T A;  3LDR A;  4FFG A;  4CCD A;  3IMM A;  3LF7 A;  3U75 A;  4B1M A;  4QHZ A;  5FK7 A;  4UFM A;  2OXB A; 
#chains in the Genus database with same CATH topology
 1GMM A;  2WRA A;  1ULO A;  1MR5 A;  4LK7 A;  5C71 A;  2VZS A;  4XBQ A;  4LO5 B;  5FMC A;  4OZO A;  1HB1 A;  1C1F A;  1AL2 3;  2I2S A;  4GH4 B;  5FO7 B;  1OA4 A;  3SMH A;  1RUI 1;  2KD7 A;  4LPL A;  2KR2 A;  4UFK A;  4IE5 A;  1JZ8 A;  3T1M A;  3GBG A;  5A3T A;  2AUY A;  3VDD A;  1EV1 1;  5FLI A;  1GZW A;  4P9Y A;  1FPN 1;  1ZBA 1;  1GZW B;  1UMZ A;  4I30 A;  2RR1 3;  1D4M 2;  1VBC 1;  4XMI A;  1A8M A;  2BVV A;  4FOW A;  4QD2 A;  5HXV A;  5AFE A;  3OG2 A;  4ASM B;  1QDO A;  1TE1 B;  5A3L A;  2J1A A;  1RUD 2;  2UU8 A;  3GHN A;  2ZGN A;  4YW1 A;  2J1U A;  5AVP A;  2EIC A;  1LCL A;  3KGZ A;  2LAL A;  1KEX A;  5A7O A;  4BQ5 A;  5LW9 A;  1E5R A;  1GWK A;  1RHI 2;  5DDJ 2;  5C3P A;  2VQT A;  3AZV A;  3N3H A;  1ZRC A;  1Y9Q A;  1Z0H A;  4QKF A;  4NHM A;  5F39 A;  5F1R A;  3K75 B;  1EPW A;  3OUJ A;  3OD4 A;  3ITQ A;  1GUI A;  1YRZ A;  2R07 3;  3VBF C;  5F3I A;  5JZG A;  4TYS A;  2XL7 A;  2ERF A;  1YQC A;  5LBF A;  1VAL A;  2A3X A;  4ARX A;  1H1M A;  3DL3 A;  1NKG A;  1TZO A;  4DXR A;  1SDW A;  4W65 A;  1UZZ A;  1OOP C;  5L9B A;  3OF1 A;  4XAB A;  3AVS A;  1O59 A;  4EWA A;  1LKN A;  2UWC A;  4XJU A;  4I0A A;  4AL9 A;  3T3Y A;  1WLD A;  1NE6 A;  5CFC B;  3AP4 A;  1W6M B;  3S0M A;  4XAC A;  1SLB A;  1UIK A;  1W6M A;  4HSJ A;  3UNP A;  1R64 A;  2ARB A;  3EB7 A;  1W6N A;  4FPG A;  3TBD A;  3TNQ A;  3UET A;  1OVS A;  3WG2 A;  1KQR A;  4AVV A;  5A6X A;  3S57 A;  2QQK A;  2J1V A;  3M4F A;  4W8J A;  1HQW A;  4ORF A;  3CLP A;  1LHU A;  3JB4 C;  4WM8 A;  1VRH 1;  3FUO A;  3ROU A;  5L7O B;  5FPA A;  5FZK A;  3E6B A;  1AXK A;  4UXA A;  3IDB B;  4LUK A;  4AR2 A;  3BI3 A;  5FYB A;  2A3W A;  1AYM 3;  3O5S A;  2OS2 A;  2WT2 A;  1JUI A;  1XNT A;  1S0J A;  2HKX A;  4K3U A;  4BZ4 A;  2MEV 2;  3JD7 3;  3RJR A;  1W8F A;  5C8C B;  5LRR A;  1W6O B;  2XKP A;  1AR7 2;  4QU1 A;  1JHJ A;  1C5I A;  2D43 A;  5D8A C;  4LHS A;  3O1P A;  2IUW A;  4NIA A;  1XSQ A;  4JGY B;  3B9C A;  5CEH A;  1COV 3;  1ZZB A;  3S5Q A;  3D8C A;  2PLV 1;  1V6N A;  2DWR A;  4XET A;  3NO8 A;  4ZS3 A;  4AOC A;  4Z8B A;  4I2O A;  3VBU A;  4XUR A;  5F32 A;  4HBN A;  3PTR B;  3O14 A;  3WHU A;  4A3X A;  3CDZ B;  3I8T A;  2NM1 A;  1IGO A;  3BN6 A;  2HEV F;  4Q8K A;  4GB3 3;  4QXB A;  4FPL A;  1AYM 2;  1ZZ7 A;  2VXJ A;  1LTE A;  4XIO A;  4LHN A;  5A33 A;  2PA7 A;  1QJU 1;  4CDW A;  5GZC A;  1IKP A;  5BV6 A;  2DVB A;  1R1A 1;  1E5I A;  2I07 B;  4W6W A;  4COV A;  3JU9 A;  5FZB A;  1AR8 1;  4RD7 A;  4UW5 A;  3LDK A;  5AC9 3;  4Y20 B;  5FP8 A;  4CCK A;  1S0G A;  4Y22 A;  3CEW A;  2G9G A;  5GLV A;  3LEK A;  3VZL A;  3GCW A;  5C4W B;  3MV0 1;  4HMZ A;  4UFL A;  5I8S A;  1R08 2;  4KWU A;  2YU1 A;  2JDH A;  1XU1 A;  5IVE A;  3LWC A;  1FOD 2;  3N9O A;  2BU9 A;  4RGK A;  2CDO A;  2P3Y A;  3FUQ A;  3UKV A;  2R0H A;  1Q5O A;  1GLH A;  3EMR A;  2PAK A;  3MW3 A;  4XF3 A;  3M7A A;  2XBO 1;  4LOT A;  4XPV A;  2R30 A;  1GU3 A;  1PO2 2;  1JBC A;  5C33 A;  3RZJ A;  3KVB A;  2W3J A;  4YM3 A;  5IAX A;  2R07 2;  2VZR A;  1ASJ 2;  1NQD A;  5EXO A;  1GOF A;  2BWC A;  2QDR A;  4FPK A;  2ZTN A;  1JOJ A;  2JE7 A;  4O9E A;  3DYM A;  4GQ7 A;  3J8F 2;  2A73 B;  1GP6 A;  3POW A;  3BIW E;  3I59 B;  3PVB B;  3QAC A;  4PBO A;  4X8N A;  1RUO A;  4AFA A;  2BOI A;  3U4X A;  3WNK A;  1XYP A;  2RJK A;  3DCQ A;  4ONU A;  5A7S A;  3WW1 A;  4BYY A;  3WG4 A;  1F8V A;  1AYN 3;  2YC0 A;  5I8T A;  2VCM A;  4GH4 C;  1UL9 A;  2JG8 A;  3OBA A;  2NMN A;  4YLZ A;  3AX4 A;  3H7Y A;  3AMM A;  4LLF A;  2PHF A;  2RM2 3;  4NVP A;  1LNS A;  2RG4 A;  5KHK A;  2WUH A;  2FZ2 A;  3LOB A;  2FDJ A;  4A45 A;  3V0B B;  5JZG B;  4XXA A;  3ZFE C;  4C0H A;  3LA3 A;  4NIG A;  2CGP A;  3CZU A;  3NL1 A;  3SCG A;  3SH5 A;  1TNR A;  1BCX A;  5F5C A;  5IK7 A;  3PU3 A;  1AYN 1;  2DYC A;  4MGY E;  4AAP A;  3KS7 A;  2C6S A;  1ND3 B;  3VZK A;  2XL9 A;  5DUX A;  3OBT A;  1TVG A;  4TTG A;  5E88 A;  4OZX A;  4AEM A;  4KGG A;  3ZN6 B;  1DQ2 A;  2W1S A;  5CBL A;  4AI2 A;  2A75 A;  1W05 A;  2VNO A;  2ZGK A;  2IFW A;  2FDG A;  4CP0 A;  2WZE A;  3VDC A;  2W91 A;  1ASJ 1;  4HON A;  3HNB M;  3CJI A;  1PIV 3;  2NN8 A;  3KD4 A;  4DUW A;  4Y3O A;  3IMM A;  4COY A;  1RUG 1;  2WFF 2;  3IZO A;  4Q4V 3;  3B69 A;  4UOJ A;  4KWL A;  2NQY A;  1YWK A;  2OA2 A;  4KH9 A;  2JDZ A;  4HVR A;  2BWA A;  2PMW B;  1L7Q A;  4PCR A;  2YYO A;  1UXZ A;  1ACC A;  1ND2 B;  1O8P A;  3NV1 A;  3PUI A;  2GDF A;  4Q0P A;  4AI1 A;  3WP3 A;  4QGL A;  3ZSE A;  5KWR A;  1H8T A;  3I3D A;  2DCK A;  3WF2 A;  5FYZ A;  3UYJ A;  4AZZ A;  4CCJ A;  3U10 A;  5LCW L;  3WP5 A;  4UW3 A;  1PZ9 A;  5CFC C;  4ES9 A;  3I2I A;  1LGN A;  2IVJ A;  3FZ3 A;  2IC1 A;  3HQX A;  1E57 A;  3T0D A;  1JZ5 A;  2V09 A;  2YV8 A;  4GWJ A;  5J96 B;  5FZC A;  1LHO A;  5F2S A;  2HWF 3;  3AFG A;  4I09 A;  3TEZ A;  4XJ8 A;  2D98 A;  4E2S A;  1V9U 3;  2RS3 3;  2ATF A;  4MX3 A;  3TB0 A;  2E6V A;  4AGG A;  5C4W C;  2CU5 A;  1DF0 A;  1S2K A;  4JGZ C;  3T1L A;  2JD4 A;  1KXG A;  3LQC A;  4YPJ A;  4OMC A;  4J6G A;  3IPV A;  3OPZ A;  4QHO A;  5B4N A;  4FXK B;  3O1T A;  1UZ0 A;  2WN2 A;  3MIF A;  3LOI A;  4GJY A;  3N9Q A;  4JQR A;  4RYD A;  4DMI A;  4YVW A;  4Q4X 3;  2RE9 A;  5FYS A;  1SLI A;  2DVG A;  5L73 A;  1RUD 1;  3ETP A;  2PLV 2;  1J3Q A;  2ZOE B;  1ZX5 A;  3KT1 A;  2FBE A;  4NWV A;  4CEY A;  3J7N A;  3AYE A;  1CAV A;  3PNA A;  5K0U A;  1GIC A;  5FLH A;  1RED A;  3JXS A;  1OLQ A;  1RXF A;  1EV1 2;  4BQ1 A;  3PU8 A;  1KGY A;  2UWA A;  3HR9 A;  1FXZ A;  4K1Z A;  1PM4 A;  1W6N B;  3KCX A;  4QPG B;  5DUV A;  2VJX A;  3ZFF C;  1TG7 A;  4Y20 A;  1NE4 A;  4E9K A;  4Q26 A;  5AC9 1;  5CAD A;  3O1R A;  4JGY C;  1SEF A;  2ZX1 A;  3MIE A;  4MHU A;  2XLA A;  2P6H A;  1I5P A;  1K12 A;  5CKQ A;  3UGG A;  3KV9 A;  4D69 A;  2JJ6 A;  2D5F A;  3T0A A;  5JCT A;  3VDB A;  4IV3 B;  1QF3 A;  3ILR A;  4FQ4 A;  2AEN A;  3RI8 A;  2D6M A;  1N1V A;  3JBG 3;  1YYN A;  4N53 C;  4ZZ8 A;  3SC7 X;  5I91 A;  4K8F A;  4KU8 A;  2WBK A;  4U36 A;  4KGQ A;  1W9F A;  3LPF A;  2QUO A;  1F2N A;  4X6Q B;  3MPB A;  1J58 A;  3SKJ E;  4ZU4 A;  4YZ4 A;  4PF1 A;  4OI0 A;  2B9U A;  2PHX A;  1BBT 3;  1V6L A;  3ES4 A;  4UBH A;  5IJR A;  1YCI A;  3C7H A;  3W20 A;  1VRH 3;  1BK0 A;  4E4Z A;  1AR9 1;  1PX3 A;  3PME A;  1UMH A;  1ULC A;  4LBQ B;  5F5A A;  1X8E A;  2YMZ A;  2B39 A;  5FZA A;  3N9N A;  4XIL A;  1JZ3 A;  2ZHL A;  4MET A;  5A3P A;  1ZA7 A;  1MZE A;  4YZ1 A;  5A1L A;  2XJQ A;  5ABJ C;  4I0B A;  2EID A;  3MIB A;  4XFC A;  1LOE A;  4CCE A;  1F9K A;  1ZRD A;  2PXJ A;  3ZYF A;  3AP7 A;  1US3 A;  1N1S A;  1UAI A;  3GZA A;  2QZ3 A;  2PHR A;  2OKX A;  4P00 B;  5IVC A;  2ZAC A;  4BDV B;  2DDU A;  4KQ7 A;  2X05 A;  3HT1 A;  3OY8 A;  4QDS A;  1OQE A;  2W1W A;  3KT4 A;  2BJS A;  1KFU L;  1Q43 A;  1GFF 2;  4OLL A;  1R09 1;  1W8U A;  5ABJ A;  1HW5 A;  4DFS A;  5IFT A;  1XXN A;  4RGA A;  2QQM A;  3POF A;  3PJQ A;  4OI4 A;  3WCS A;  2NP0 A;  2OVU A;  4J1X A;  4LNV A;  4AED A;  4QWN A;  3ZIX A;  2AR6 A;  4NPL A;  1NCQ B;  4UFJ A;  5J37 A;  4S2F A;  2RDS A;  3VB9 A;  2HH9 A;  4XQW A;  5HXM A;  2I45 A;  3ZSL A;  2H6B A;  4BPZ A;  1CES A;  2V4V A;  4IE7 A;  3HIF A;  4F83 A;  5FAX A;  4BXF A;  3T2P A;  3M8L A;  4FAG A;  4L97 A;  4E2Q A;  2XGX A;  2B4K A;  5JAX A;  1ENQ A;  4QQH A;  4EZH A;  4FPJ A;  5KHI A;  4UBG A;  1CIW A;  3AP6 A;  3IKW A;  2VZ1 A;  1UKG A;  2Y8K A;  1UY0 A;  4XEZ A;  5H9Q A;  2FD8 A;  1CN1 A;  5FMO L;  2XUE A;  4PF5 A;  4URA A;  3MYX A;  3J7M A;  2HWD 2;  1CON A;  1FAT A;  5FZH A;  2ZBJ A;  5FY7 A;  1E5S A;  3C7E A;  3FHQ A;  4A2U A;  1EAH 3;  1RUF 1;  3RMX A;  4WVM B;  1GBG A;  4O65 A;  1MS4 A;  2BNO A;  1GNZ A;  4XE9 A;  3CL1 A;  3ZLI A;  1WCK A;  1RMU 3;  4CDQ C;  1XNA A;  2PEL A;  3D0S A;  3T4H B;  1VBB 1;  4J25 A;  4LUM A;  4FPY A;  4XC9 A;  3I7D A;  1VBD 2;  4ATF A;  3MV1 1;  2WNU A;  3A7Q A;  1N1T A;  3J4U H;  3O0W A;  1AXY A;  2DUQ A;  3CBN A;  5FBZ A;  2ZMN A;  4D7Y A;  1SZB A;  2G9F A;  4JGY A;  5JOZ A;  5KXE A;  1UOF A;  2HWC 3;  5J3U A;  3QOP A;  4Q1P A;  1JYX A;  2PQQ A;  3H8R A;  3SIS A;  3H42 B;  4RA0 A;  3WP6 A;  1ALY A;  1UO9 A;  2G4I A;  4HLT A;  2ZGU A;  5BNO B;  5FZ6 A;  3M2M A;  2HWB 2;  4I3P A;  2OZ6 A;  3JBG 2;  2VU9 A;  3QH7 A;  3ZYH A;  1LOD A;  3LPG A;  4Q4W 1;  1QY4 A;  4K21 A;  5FR3 A;  2GMM A;  4F3J A;  3ST7 A;  3RZG A;  4AW7 A;  1DGW A;  1OSG A;  3KCC A;  4HN1 A;  4AHZ A;  4XF9 A;  4C91 A;  3I2G A;  3OOX A;  4XVH A;  4CEY B;  1W8H A;  1WLW A;  2G19 A;  2EXK A;  4ASK A;  1NA1 B;  4DXS A;  3AYD A;  3SNM A;  1JUH A;  5C8W A;  4PLN A;  1H0B A;  3LIH A;  2E7A A;  2MEV 3;  4PI0 A;  4XUQ A;  2CYF A;  2WNU C;  4M3C E;  2O8O A;  5A7W A;  4RQP A;  2GN3 A;  3BCW A;  4Q4W 3;  3GZU C;  5CFD B;  1UD1 A;  1W3X A;  4NJ4 A;  2BOJ A;  3KQR A;  4M3C A;  1PGW 2;  4YFZ A;  3I3Q A;  4MHR A;  1XC6 A;  2YDE A;  2E51 A;  4MGS A;  2R06 1;  2E32 A;  2HWE 3;  3CJX A;  2RS5 3;  3FMG A;  1REE A;  2ZHM A;  4MOA A;  3VBS B;  2O8Q A;  4PQ9 A;  4Q1R A;  2E33 A;  2RDQ A;  4IDZ A;  1YIP A;  1BKZ A;  2V72 A;  4UI9 L;  4WBB A;  2BGO A;  2X5I C;  1MZ6 A;  4A4A A;  1XBF A;  1S2E A;  2DU0 A;  2JDP A;  3N36 A;  4GAZ A;  2HYX A;  1X33 A;  2VMD A;  1HXS 3;  5FMO S;  5A3O A;  4IEV A;  5CNA A;  4EN6 B;  3VGI A;  3I4I A;  4XUT A;  1ENR A;  1K5M B;  4CEW B;  2J1S A;  1D4V B;  4XF1 A;  1OVP A;  2F6B A;  5L9V A;  1UU6 A;  3WHT A;  1FOD 3;  1LEM A;  1GNH A;  1OKO A;  5A1A A;  5DAV A;  1J83 A;  1W39 A;  1YI9 A;  3GYD A;  3U0Z A;  4LBK A;  4GIQ A;  1QJU 2;  3Q8B A;  5BUV A;  1RUC 3;  1YJK A;  2DUO A;  3M3Q A;  1WGP A;  2XUM A;  1OBN A;  3TEY A;  3DF0 A;  1RHI 3;  2HWB 1;  3K2O A;  4K8R B;  3RJ2 X;  2YUE A;  4Y5T A;  1G7Y A;  5ABJ B;  1G9C A;  1DDL A;  2VUJ A;  2W95 A;  4GXL A;  4YWA A;  3AB0 A;  5LY2 A;  5EZW A;  1C28 A;  4GWN A;  3U11 A;  3ZPY A;  1DIW A;  2GNM A;  3HWJ A;  3TRS B;  1DQ1 A;  3VBH A;  4BU2 A;  4NO4 A;  2O1Q A;  1K5J A;  1OI6 A;  3AFK A;  3B02 A;  5FXV A;  5C70 A;  2JDM A;  3WF1 A;  1UMI A;  4AGR A;  4TN7 A;  4R4Z A;  3ZO0 B;  2DUR A;  2K46 A;  1ZYB A;  4CDQ B;  2XPJ A;  3CKH A;  5FZ9 A;  5AFB A;  1A8D A;  5EPA A;  3C2U A;  3LFM A;  2TUN A;  4KU7 A;  4EN7 B;  5F3E A;  3PIJ A;  4HG6 B;  4CCC A;  4MH0 E;  5FZD A;  2D97 A;  2BV4 A;  3NAP C;  2EXI A;  3VKM A;  4CZS A;  4CPB A;  3E97 A;  3WUC A;  3VL9 A;  4KL1 A;  4ZU7 A;  1RUN A;  2ORX A;  1VJ2 A;  5TSW A;  1W03 A;  3NWK A;  4QKB A;  3MFC A;  4ASL A;  1SPP B;  2ZGM A;  2EAK A;  2YBS A;  5E8A A;  2JXA A;  1JU4 A;  2ILM A;  1O5U A;  1P8J A;  1QKQ A;  4B8E A;  2KA3 A;  3O1U A;  4RHV 1;  4P5H A;  1J1L A;  2XJS A;  1W90 A;  4Q4Y 2;  3OYW B;  2D3S A;  1LOG A;  5FYM A;  1O3S A;  3ZXJ A;  4LOR A;  1PX4 A;  1UQX A;  1VBD 3;  4NRM A;  3UT0 A;  1I5Z A;  3W5N A;  4JGZ B;  1CPN A;  4NID A;  1O3T A;  4BQ4 A;  2FMY A;  2VL4 A;  4IEZ A;  3TN9 2;  1RIR A;  3THD A;  5GZE A;  1S4C A;  2O0O A;  1FMD 3;  1YLL A;  3WD5 A;  1RIT A;  3MF6 A;  1W06 A;  1NA1 C;  1NUK A;  2JB8 A;  3F95 A;  1TMF 1;  4HZF A;  1NX9 A;  5HV0 A;  4QQP A;  4Q29 A;  1AR6 2;  3HJR A;  5A33 B;  5A3M A;  2GU9 A;  4LJH A;  2A71 A;  1FX5 A;  1IG0 A;  2VOV A;  4Q27 A;  2QFE A;  5FUN A;  3WF3 A;  1F5J A;  2Y0I A;  2VH9 A;  2ZX3 A;  1PGS A;  4JQT A;  3JQW A;  2VNG A;  3APB A;  4N8M A;  2WWU A;  3OSD A;  3A0N A;  3MUY 1;  1WW5 A;  4LMF A;  3C7O A;  2WZR 1;  2Y33 A;  4XUO A;  3IB3 A;  1NA1 A;  4L8Q A;  1C8N A;  1RC6 A;  1H1I A;  1AX2 A;  5FY1 A;  4LQR A;  5F2W A;  3A23 A;  5LBB A;  2NYY A;  3VZJ A;  2E7Q A;  4CPB D;  4GWI A;  1DCS A;  1XYN A;  5BNP C;  2VZV A;  2OW4 A;  1AL2 1;  1U5Z A;  2ZML A;  3B01 A;  3VBO B;  5JUV A;  3HMY A;  3ZXD A;  4JDO A;  3ZXG A;  4QKD A;  1EYB A;  5FZO A;  2VCC A;  2IXI A;  1D2S A;  5GZD A;  3KB5 A;  1Y9G A;  2P3I A;  4F8A A;  3GBF A;  5JPM B;  4ISR A;  1UOJ A;  1W2O A;  3P5B A;  4IV1 C;  4R52 A;  1HXS 1;  4LKE A;  3DUI A;  3K48 A;  5LB6 A;  2WII B;  4IEO A;  1AUY A;  4H14 A;  4NRO A;  4XHB A;  4YG0 A;  1EV1 3;  3FLR A;  3PUA A;  3PDQ A;  1NCR A;  3ZYR A;  3POE A;  4UFI A;  1H8T C;  2ZAA A;  3A21 A;  4XIK A;  1NAE A;  1GOG A;  1AL0 G;  3N7M A;  1PMH X;  3ZFF B;  2W2I A;  4CRQ A;  1ENX A;  2W5F A;  2F17 A;  4A6O A;  2XOM A;  4CDU C;  2HBT A;  1W28 A;  5F37 A;  3I2H A;  1T6B X;  4XFF A;  1JZ2 A;  5KC6 A;  2WT1 A;  4RFT 0;  4P9G A;  2ARE A;  5C9A C;  4PHZ A;  3T2T A;  4DB5 A;  1RUC 1;  3GF6 A;  1PNG A;  2B42 B;  2Y60 A;  2VMH A;  3FN9 A;  2JIG A;  4QGN A;  3DXU A;  1IHM A;  4AF9 A;  1M06 G;  4CCL A;  2W08 A;  4UT5 A;  3AKP A;  1ONA A;  1A78 A;  2QJV A;  2VOX A;  4NR1 A;  4AFM A;  5JMC A;  1GKB A;  3N4M A;  1KJR A;  2WFP A;  1PIV 1;  5A7Q A;  3WSO A;  4EZ4 A;  3UGF A;  1MS8 A;  1G9B A;  2J1E A;  1VBA 2;  1KDM A;  2GAU A;  3CZJ A;  3PL0 A;  4XBL A;  3TN9 1;  4EN9 B;  5JIU A;  2C26 A;  3VBF B;  4M0N A;  2X8K A;  5T5O A;  3RRD A;  1B35 B;  3KSC A;  3NAP B;  3U4S A;  2RDN A;  2GC0 A;  3AMH A;  2ZHK A;  4HOO A;  3VV1 A;  2VW1 A;  5SV8 A;  4BLI A;  2ZHN A;  2VZ3 A;  4LA3 A;  2KXL A;  1CZV A;  2B46 X;  1UY4 A;  2XQX A;  3QH6 A;  4BIF A;  5DN2 A;  5FZG A;  4RHV 2;  2BP6 A;  2VQ0 A;  1BXH A;  3HN3 A;  1MS5 A;  1XOY A;  5A7P A;  3SHR A;  3I97 A;  3FBM A;  3DYO A;  5AVA A;  3ELN A;  2BER A;  2DVD A;  2H0V A;  1NLQ A;  2PHU A;  2WYF A;  2JKB A;  1HJF A;  3EXU A;  3ZFE B;  2RS5 2;  1I3H A;  4YAR A;  5BNN A;  3IMN A;  1S0F A;  1Q3E A;  4WM7 A;  3RWN A;  1VB2 A;  4FFF A;  1ST8 A;  2WDB A;  4NAM A;  3MLJ A;  1KFX L;  1NLR A;  5DZF A;  3CJI C;  3WF0 A;  4XDQ A;  1DLL A;  1RUG 2;  2WFF 1;  3MBW A;  5GAL A;  4BOW A;  3H0O A;  4DPN A;  4YVS A;  2W47 A;  4YW3 A;  5FY9 A;  5FY0 A;  1F4A A;  2A1X A;  3EJK A;  4COZ A;  2ARC A;  5IVV A;  2VBB A;  1WCQ A;  4KBZ A;  2ZMK A;  3IAQ A;  1POQ A;  1GV9 A;  3BU7 A;  5C7G A;  5LEK A;  4NHL A;  4CP2 A;  3KCY A;  2CGN A;  4NHK A;  4G4F A;  3LDR A;  1DBN A;  1QJX 3;  2AZ5 A;  2J1T A;  3AZW A;  4B7E A;  2BRT A;  3RPQ A;  3VLB B;  1XQN A;  5F5I A;  4BH9 A;  4MYE A;  1JN2 P;  4YVS C;  5CU1 A;  3P1I A;  1G6N A;  2WJS A;  2GP5 A;  4YGB A;  3CQO A;  4CEW A;  5FMD A;  1IPS A;  5CAZ A;  5L7O C;  2AEZ A;  2SBA A;  3EO6 A;  2JIC A;  2BPA 2;  1NCR C;  3ZN4 A;  2YG0 A;  1N3Q A;  3WCR A;  4B4R A;  5FJH A;  2WZ8 A;  1VRB A;  2W46 A;  4IEY A;  1OKQ A;  4XZP A;  3W9A A;  2ET7 A;  2HEW F;  1A34 A;  3BGA A;  2OUJ A;  3PLQ A;  5FRA A;  1OFN A;  2VNR A;  5I0T A;  2XBO 3;  1FPN 3;  1YFW A;  1QQP 1;  1HB3 A;  2RR1 1;  3PVN A;  3PTY A;  4BQ3 A;  4CTE A;  3OTF A;  2PAM A;  1CAU A;  2WS9 3;  1GR3 A;  2OPW A;  4I0W B;  1DU3 D;  4Y1X A;  3ECQ A;  3J8F 1;  3JZV A;  4MZU A;  2RMU 3;  2JKX A;  3R4S A;  2XVK A;  1X7N A;  2BGC A;  5BPX A;  4Z92 B;  3UES A;  2W52 A;  2XWJ B;  2X5I A;  1CAX B;  1NT0 A;  2JDU A;  4RR3 C;  3RI9 A;  3FL7 A;  1XND A;  2QQN A;  3T0B A;  4IER A;  4CDQ A;  4CEY C;  1BVV A;  3SH4 A;  2GME A;  4P02 B;  3W5M A;  1MQT C;  1NG0 A;  3B5L B;  2YGM A;  3BIE A;  2ENR A;  2VMF A;  3OBZ A;  2E7T A;  1BEV 3;  1N3P A;  1QXR A;  1C5H A;  1W6Q B;  1W2U A;  2WSV A;  2XLG A;  4IEU A;  3WEZ A;  4LIV A;  2JEN A;  1JYN A;  3BTA A;  2VUL A;  1OLM E;  1H2M A;  5IK5 A;  1DQ0 A;  1UXX X;  1LR5 A;  3JUU A;  1YNA A;  4XJZ A;  2P2K A;  3VBR A;  2ZGR A;  4HL0 A;  1YHF A;  2IXK A;  4HT1 T;  4TLG A;  3X29 B;  4AXO A;  2YPJ A;  1PK6 C;  1S55 A;  4K20 A;  1UU4 A;  3IIA A;  4M00 A;  5ANN A;  2X53 S;  2LTN A;  1Z78 A;  2D40 A;  1KD7 A;  2VVF A;  2WA4 A;  3VBS C;  3WDW A;  3WG1 A;  1DYO A;  3ZXA C;  1ZRE A;  2RS3 2;  4D6S A;  3NNF A;  3W58 A;  4RHV 3;  1CPM A;  3VBU B;  3LDB A;  3J9S A;  1YUD A;  3LEG A;  5CKN A;  1LGC A;  3OGG A;  4CU8 A;  1YQ5 A;  2RV9 A;  1Y43 B;  4AED C;  3O12 A;  5C3O A;  2XWB B;  3R05 A;  3MO4 A;  1ZBE 3;  2XVL A;  4QPI B;  4XFG A;  4CCM A;  4MSV A;  3RFR A;  3EYP A;  4CCD A;  4NIH A;  4QX7 A;  1C8M 2;  1UY2 A;  1US2 A;  3POY A;  4QX8 A;  5FK7 A;  3AZZ A;  3NNG A;  3QCW A;  4B1L A;  3RDI A;  3NAP A;  4Q0U A;  2ZA9 A;  2UYB A;  1RUJ 1;  5KHG A;  4MVT A;  2YC2 A;  4FSJ A;  1OFS A;  2CHH A;  5FQ0 B;  1S0B A;  4GMP 1;  4XDO A;  3FHI B;  1TNF A;  2J7M A;  3KGL A;  3KVA A;  4C8D A;  1H4G A;  2NPI A;  3AC0 A;  2Q8D A;  4GB3 1;  3LCP A;  1UNB A;  2CWM A;  2FQP A;  1POV 3;  4DIN B;  5T5L A;  2WFF 3;  4Q4V 2;  3U07 A;  4I3G A;  1VRH 2;  5A6Q A;  3QBQ A;  4ZKT B;  1H2L A;  1LHV A;  4XW3 A;  1LOC A;  3WDX A;  5C6C A;  1RUH 3;  3NJX A;  3ILF A;  5EJ3 A;  1W9T A;  3GCX A;  1SDD B;  5GLZ A;  1JMU B;  4XYX A;  4QX0 A;  2XXZ A;  4N43 B;  3AKQ A;  2H0B A;  4Q2F A;  4GAL A;  1SLT A;  5SV5 A;  3KHC A;  1RUE 3;  1H1A A;  2W9X A;  1OD3 A;  3N9M A;  4FPO B;  4E2G A;  3CU7 A;  3NQH A;  5J48 A;  3AL5 A;  1ZA4 A;  5DPN A;  4JTO A;  2CWS A;  3ZYP A;  3RZM A;  3VD7 A;  1LEC A;  2Q5T A;  1PMI A;  4M3C F;  4OUM A;  4BIS A;  1WLT A;  3S7E A;  3AL6 A;  4KNC A;  4O61 A;  3BOD A;  3I59 A;  4DIQ A;  3IM0 A;  1W0P A;  1AL2 2;  3F2Z A;  4UWD A;  4P14 A;  4Y1U A;  3GXU A;  4EQV A;  2WR9 A;  4LHL A;  1RVF 1;  2RS1 1;  5FY4 A;  1G86 A;  1HJG A;  1UY3 A;  4M01 A;  2WZR 2;  1SAC A;  4WM8 C;  3E1F 1;  4HPK A;  5JVV A;  3HNY M;  4JX0 A;  2HWE 1;  1SBD A;  3A22 A;  4UF0 B;  3I49 A;  2JIJ A;  4IGO A;  1QJF A;  2R1D A;  3QD6 A;  4UF0 A;  1I6X A;  3NRU A;  2ZX2 A;  2A6Y A;  5IW0 A;  1U5Y A;  3LE0 A;  1SQ4 A;  1H6Y A;  1QJX 1;  5DAX A;  3O0V A;  3LGR A;  2UY8 A;  1BMV 1;  4H7M A;  3VZO A;  4FXG B;  2EXJ A;  5KXB A;  5IK8 A;  3MIH A;  1BJQ A;  1GQG A;  5JOW A;  1PO2 3;  3CO2 A;  4PBP A;  1FPN 2;  3VBR C;  5C4W A;  2RM2 1;  5GZG A;  5KXC A;  3I54 A;  1BBT 2;  3VZM A;  1WWY A;  3R0R A;  3DV8 A;  2LRO A;  1ULE A;  2P5B A;  1LHN A;  1V6O A;  4FP3 A;  2IXL A;  4KMQ A;  3AJY A;  3DXT A;  4FP2 A;  5F6L B;  4QPG C;  5BNN B;  4DXT A;  3LA2 A;  2ZEY A;  1CX4 A;  1FI2 A;  2HEY F;  1PMJ X;  2PAE A;  3VBF A;  1JZ6 A;  3OB8 A;  2P17 A;  3AP5 A;  1XB9 A;  1R08 3;  1YQ6 A;  2JDK A;  1LB2 A;  2X5I B;  5LK5 A;  3V0A B;  4LE3 A;  4I02 A;  5ANQ A;  2PN5 A;  4Y4Y A;  1HN0 A;  5FUI A;  4LBN A;  4EN8 B;  4MGT A;  1S0C A;  1CD3 G;  2XKO A;  4IE4 A;  3B9I A;  4MGQ A;  2R49 A;  4M0H A;  3WDT A;  3VD9 A;  4QMA A;  3ZFE A;  2LM3 A;  5A3W A;  1VAV A;  3ABZ A;  1U12 A;  2ZX4 A;  1GAN A;  5FK8 A;  4HXC A;  1IPJ A;  4QDR A;  4IND A;  5JOY A;  1H30 A;  1R09 3;  2DVA A;  1FYU A;  5FYV A;  3J26 N;  2DFC A;  2RDR A;  2WO3 A;  2Y64 A;  2JDY A;  4XHX A;  4WVZ A;  3ZVX A;  2PQS A;  4GKY A;  2ZX0 A;  4H55 A;  4PIZ A;  3IDE A;  1O8S A;  5GLU A;  3MIC A;  3AZX A;  1N1Y A;  1OQ1 A;  5H9R A;  1QGL A;  2ZEZ A;  1RUJ 2;  3AKT A;  4QHB A;  1HB2 A;  1YIF A;  3K3N A;  2JE8 A;  4PIY A;  1PZ7 A;  5T54 A;  4Z1V A;  2FDH A;  3H8U A;  1W3V A;  5DUU A;  3UKT A;  2WL1 A;  3IPV B;  4J1W A;  4R9B A;  5I0D A;  1F4H A;  3LAG A;  5CKM A;  5F7U A;  2R32 A;  1PHM A;  3OBR A;  4QT6 A;  3RG0 A;  1JOP A;  1UYP A;  4R9A A;  3WNL A;  1DQ5 A;  2HWB 3;  3ZKY A;  3I3B A;  3I3E A;  1GQH A;  2WWS A;  3WUD A;  4AHX A;  4AVA A;  1CAW B;  3N7L A;  4ZON A;  1WA6 X;  4AWD A;  5FO8 B;  3AJZ A;  1M4W A;  1J59 A;  2WAO A;  2GMP A;  5FPU A;  3RMY A;  1CVN A;  1CZT A;  5D1I A;  3LEI A;  1QXP A;  1RJ7 A;  1X9P A;  5FPV A;  4HKL A;  4Z82 A;  1TME 3;  4UFM A;  5IT6 A;  4IE0 A;  1G9A A;  1W04 A;  1FNY A;  3GNE A;  1NLS A;  3OGV A;  1TMF 3;  3NMB A;  4W6X A;  2Q30 A;  3TAY A;  3H8O A;  3GJB A;  3H3L A;  3NJY A;  4ATE A;  3U78 A;  2OQ7 A;  4JDN A;  4D7S A;  1S0I A;  1I9R A;  1SFP A;  4FFH A;  1LOF A;  4GMP 3;  4XFI A;  3WY6 A;  2ZKN A;  2DTW A;  4LO4 B;  1VAK A;  2WNV C;  4XQ4 A;  1UU5 A;  1WLC A;  1LGB A;  4Q0Q A;  1NXM A;  1JXN A;  3T08 A;  5A32 A;  1O3R A;  4FOY A;  1BYH A;  4GD4 A;  4WM8 B;  3AKR A;  4DRV A;  5L7O A;  3PMS A;  4DO0 A;  5JSP A;  3AMN A;  2A6Z A;  1VBE 2;  1W9W A;  2WWJ A;  3DKW A;  4ES8 A;  2J22 A;  3EHK A;  3PUS A;  5ISL A;  5CZK A;  3RYR A;  3WDV A;  1YC6 1;  3VBS A;  4AVC A;  2A6W A;  3SH3 A;  2OQ6 A;  2W0X A;  5EHD A;  4CDX B;  4QDQ A;  3KLS A;  4ZZ5 A;  1NYW A;  2WZP P;  2B9V A;  1OHF A;  3BOP A;  3ENR A;  3H1Y A;  5FUP A;  4FAH A;  4AFD A;  4NRQ A;  1RUJ 3;  2C0Z A;  4OQ9 A;  3DPR B;  3WNX A;  4CDU A;  5JI9 A;  2UYA A;  4CU9 A;  2JEM A;  5FP7 A;  2Z69 A;  4CCO A;  3I2O A;  2HWF 1;  4WVV A;  5JSO A;  4MXW B;  3UJO A;  1QQP 2;  3BPS A;  1UWW A;  1U5I A;  2D3P A;  5EJZ B;  3USS A;  3NKG A;  3HQU A;  2IVI B;  3V0B A;  3POB A;  1CGP A;  2RMU 2;  4OUL A;  1RGS A;  1V6I A;  4GMP 0;  3W59 A;  5FKB A;  4IES A;  4DY3 A;  2DUP A;  2RMU 1;  1XE8 A;  4NII A;  3BU0 A;  2V5D A;  1RVF 3;  2RS1 3;  5BNQ A;  1TEI A;  2G1M A;  2QZ2 A;  3ZR6 A;  1OF3 A;  3ORJ A;  4JRA A;  1URX A;  4OI2 A;  4D7T A;  1XPW A;  1TQ5 A;  5ACA 1;  2HWF 2;  4KWK A;  5FV3 A;  1CAU B;  3RZH A;  3U37 A;  2BBV A;  4QPI A;  4FBF A;  1LED A;  1UZV A;  1DZQ A;  3FE5 A;  4XXP A;  5CG9 A;  1ZZ6 A;  5J1X A;  1G8W A;  2QE3 A;  4CUG A;  1EPZ A;  2ZZQ A;  1VBB 2;  2VZP A;  4RR3 B;  1DZR A;  1OH4 A;  2P3J A;  3ZMO A;  1DLC A;  1GNY A;  2VTX J;  4L9B A;  2WQZ C;  2JX9 A;  4L99 A;  4IQP A;  2XBO 2;  2K9Z A;  1J3P A;  1GP5 A;  1AF9 A;  5GKA C;  2VAU A;  1H9W A;  4V2V A;  1F5F A;  4ZY9 A;  1XSR A;  4IW3 A;  4Q4X 1;  2UY9 A;  1O91 A;  4B7K A;  4MGK E;  4XFH A;  2VY0 A;  4KG8 A;  1W8T A;  3D5O A;  3I2D A;  4AI8 A;  1R08 1;  3U75 A;  3I2F A;  2PHW A;  3TEX A;  5LA1 A;  4RQP C;  5FOJ B;  1HRV 1;  1Z7S 1;  2D93 A;  5DXD A;  1WBF A;  2CDP A;  1C1L A;  3PVO A;  4LBL A;  2BBA A;  5FBJ A;  3SXW A;  4LT5 A;  2OPK A;  4DNY A;  1RB8 G;  1OD5 A;  2A6X A;  1H2N A;  3HD8 B;  4K9S A;  2Y6J A;  3ZMN A;  3ZX7 A;  2GNB A;  3P6B A;  4NPR A;  4OUE A;  1JI6 A;  2R04 2;  3SEP A;  1LAJ A;  2WNV A;  4QX1 A;  4Z2A A;  1SCR A;  1ZRR A;  2ZAB A;  4JKL A;  4LIT A;  2D6O X;  3VHO A;  2GNT A;  3HNM A;  3ZR5 A;  4BJ0 A;  1HQN A;  3NVC A;  1HIX A;  4YZ3 A;  4BM8 A;  4CSW A;  1XE7 A;  1RL3 A;  1UPS A;  2A70 A;  1G9D A;  3M1H A;  4K6B A;  2GND A;  4N9H A;  1NZI A;  2XON A;  1OUS A;  1B35 A;  3VUO A;  2WNO A;  1R09 2;  4HVO A;  2WYS A;  1GZC A;  1LOF C;  3WW2 A;  4KI5 M;  4S2G A;  2VW2 A;  3MW2 A;  4L2N A;  2F4P A;  2HWC 1;  1NY7 2;  2ZGT A;  4P9W A;  3CMG A;  1AR7 1;  1HN1 A;  1JTZ X;  3O0X A;  3KV6 A;  2ARA A;  3MZH A;  3INA A;  3WQ0 A;  5B2G B;  4D3W A;  3SKV A;  3WW3 A;  1FNZ A;  3V0A A;  2ZGQ A;  1H4H A;  1RIN A;  5BNP A;  3VDD C;  1UCX A;  3ES1 A;  4XMA A;  2QVS B;  3Q9O A;  5FZE A;  2B7Y A;  1JYI A;  1OOP B;  1QU0 A;  4ZXE A;  2D6K A;  3AXD A;  4RL7 A;  3KF3 A;  4LUL A;  1QJU 3;  1WKY A;  3K46 A;  4FPF A;  2QQW A;  5A32 B;  1R1A 3;  1ND3 C;  5BXX A;  1VBB 3;  5IVB A;  3TOJ A;  3FX3 A;  3VZN A;  4ZPI A;  3DGT A;  3E5U A;  1CJD A;  1ZM1 A;  5APA A;  1RXG A;  2VMG A;  4GWM A;  5FP3 A;  1IQA A;  5ERL A;  3VN4 A;  1QJE A;  1S0E A;  4FPH A;  1D0H A;  1DG6 A;  4O9G A;  4RGG A;  5DDJ 1;  3URF A;  5C9A A;  1IZ3 A;  4OMD A;  3IBM A;  4YVS B;  3DN7 A;  4PDW B;  4IEW A;  1KDK A;  1ZRF A;  4ZU5 A;  4UW4 A;  2GN7 A;  3GZT B;  1HV1 A;  4CDX A;  2GC3 A;  3Q8C A;  4DS0 A;  2W92 A;  4AFC A;  2WS9 1;  1HRI 2;  2RVA A;  3NJV A;  2IXJ A;  4WZC A;  5AC9 2;  1J1T A;  1OF4 A;  4Z2W A;  4NRP A;  4NOT A;  3WLU A;  5LY1 A;  1O4T A;  1LUL A;  1W6P A;  1Y7B A;  3B00 A;  3ZFF A;  1FV3 A;  5T5J A;  4L11 A;  2PHT A;  2DV9 A;  2RHP A;  1IKQ A;  2ID4 A;  3PIG A;  4GA9 A;  3WT3 A;  2JDA A;  3WW4 A;  2P37 A;  3W21 A;  3BUC A;  1QQP 3;  1DHK B;  1S1A A;  4FT8 A;  1YQ8 A;  2W87 A;  3VKO A;  5D8A B;  5C8C A;  1JW6 A;  4SLI A;  2OT7 A;  3M70 A;  4AEK A;  3ZKU A;  2MPF A;  4F7Z A;  3L2H A;  2Z79 A;  2GZW A;  4YGD A;  4BK5 A;  4AI9 A;  2BTV C;  4XFA A;  1PNF A;  2WAA A;  3NW4 A;  1D4M 1;  3OEA A;  4QPG A;  3D3A A;  3GAL A;  1VBC 3;  4Q0S A;  4QXK A;  4XJ9 A;  5FDB A;  5FYU A;  3ETQ A;  1JYW A;  3ZXE A;  4RQP B;  2D6N A;  2P4E A;  1W0N A;  5C8C C;  4NMI A;  4LR4 A;  1QH6 A;  3Q8A A;  1OQD A;  1RUI 2;  2ZPX A;  2FHR A;  2ZKL A;  4M3C B;  4N7I A;  3RQ0 A;  3RSJ A;  4HAN A;  4A7Z A;  1H9P A;  1JYC A;  1WCU A;  2WS9 2;  3FBY A;  1UKR A;  1QMJ A;  2VG9 A;  4OHX A;  1MPX A;  2B8M A;  2VQA A;  2ZGL A;  1DGL A;  3OJB A;  2TBV A;  4QXH A;  4YW7 A;  5FRE A;  1UYX A;  5FTT C;  4B4Q A;  5E89 A;  3D82 A;  4ET7 A;  3I3M A;  5CFC A;  4G3Y C;  2C1F A;  3OGJ A;  4OHZ A;  1HRV 3;  5G04 L;  4CP9 B;  2VCB A;  4AQS A;  1GWL A;  3JQX A;  5LAT A;  5BNP B;  1AHS A;  3WR0 A;  1GP4 A;  2ZEW A;  3WQ7 A;  1Y4W A;  1Q8O A;  4YGC A;  1EAH 1;  1RUF 3;  3CNA A;  3ZXK A;  2LRP A;  4IL7 A;  1Q8P A;  4M4P A;  4CXX A;  4FFI A;  4XF4 A;  4XDP A;  1C8M 3;  1Q56 A;  3L2Y A;  2W39 A;  4XF0 A;  3WNM A;  2KM2 A;  2A5Z A;  2ZZJ A;  5T50 A;  3H3Z A;  5HCB A;  5KR7 A;  2UWB A;  3ZIW A;  1OT5 A;  3PJY A;  1CX1 A;  3UJQ A;  4P9J A;  1LJ7 A;  5HV4 A;  1NY7 1;  4OHW A;  5JLV A;  4HET A;  5DG1 A;  3WOG A;  2Y6G A;  1C8M 1;  2K2S A;  2VVE A;  1IOA A;  4IGP A;  3VD5 A;  4K1Y A;  1ND3 A;  1O3Q A;  5A6Z A;  1UX7 A;  3MPP G;  4BMB A;  4E27 A;  1X9T A;  4MGZ E;  3POJ A;  4YW5 A;  1NCQ C;  3HPN A;  4TZD A;  4FTB A;  5FP4 A;  1RUE 1;  4BQX A;  4HSL A;  3LIG A;  1UW8 A;  1CAW A;  1HX6 A;  1W2A X;  2CSG A;  3OY8 B;  4HN0 A;  4IUG A;  4XAE A;  2DF7 A;  4CUB A;  4EWE A;  4RR3 A;  1X36 A;  1E5H A;  1REF A;  1QJZ A;  3KMH A;  5IYY A;  1JS9 A;  5JMO A;  3BTZ A;  4JAA A;  1BVP 1;  5J7M A;  4BXS V;  1SHW B;  2JG9 C;  2BEO A;  2VCA A;  4PIX A;  3HQR A;  5FPX A;  3UV9 A;  5H9S A;  4L0P A;  4AK3 A;  3JD7 2;  3OCP A;  4IET A;  5M0T A;  5FO9 B;  4H7L A;  3POS A;  1Z7S 2;  5DDJ 3;  3IDC B;  4OQ8 A;  2WLQ A;  3C8X A;  4R9C A;  2X10 A;  2ET1 A;  4XCB A;  3VD4 A;  5JXI A;  4P5Y A;  1WUV A;  4FOV A;  4XUP A;  2O14 A;  3P3P A;  1OPO A;  1ZRI A;  4XBN A;  1I1E A;  1VBE 3;  4YM0 A;  3G6J B;  3H50 A;  2UUR A;  1RUH 2;  1V6K A;  1APN A;  3KT7 A;  1QDC A;  3ZFG C;  4YG3 A;  1L7R A;  2BDR A;  3P3N A;  4JKM A;  1BQP A;  2V4A A;  5A70 A;  3KM5 A;  3MEP A;  3R6S A;  3DEC A;  1CZS A;  3M3C A;  1K5M A;  4DQA A;  1SPP A;  5FLJ A;  2C5D A;  4Q4Y 3;  1OMI A;  1W8Z A;  2AH2 A;  2BQP A;  2R6Q A;  2ORZ A;  5K8S A;  2D3R A;  2PTM A;  1F15 A;  3BB6 A;  1V70 A;  5FWJ A;  3WP4 A;  1X50 A;  4MV2 A;  2BGP A;  2DU1 A;  1U5X A;  4BLJ A;  5HPO A;  1WA4 A;  1XE0 A;  1Z7S 3;  1FV2 A;  2WZR 3;  4IXL A;  4MO3 M;  4Q4W 2;  2GH8 A;  3TEW A;  1OUX A;  1WMD A;  4P9I A;  3RNS A;  5EIY B;  1WW6 A;  3K51 A;  4FO9 A;  3AZY A;  2HWD 3;  1PVX A;  1PVC 3;  4MAD A;  1RUD 3;  2VZQ A;  4LKF A;  3RZK A;  4HKW A;  4UFH A;  1UX6 A;  4Y22 B;  4QPW A;  3VBH B;  3VBO A;  4FPE A;  3VD3 A;  3KHB A;  5I0S A;  2BYV E;  2PLV 3;  1JOB A;  4GKX A;  4MXV A;  1JOD A;  5T5P A;  4BQ2 A;  5BNO A;  4DXZ A;  1UF2 C;  2QCS B;  3KV4 A;  4CDW B;  1MS9 A;  3I2K A;  5IHR A;  4Y24 A;  5D2A A;  1VBD 1;  1GZ9 A;  2DTY A;  3OD0 A;  5KHH A;  1V6M A;  5FZ3 A;  3V64 A;  4DUX A;  4A42 A;  2XML A;  5CIS A;  1RTV A;  2CNA A;  2VZO A;  4O7X A;  4AVS A;  1KS4 A;  5FZ4 A;  1MVQ A;  4JHZ A;  3VDA A;  4B3N A;  1S2B A;  3T09 A;  5JPN B;  3TYJ A;  1BEV 2;  1EY2 A;  2R06 3;  2VOK A;  4X6R B;  3WVJ A;  3FJS A;  2QQV A;  5C3S A;  1VBE 1;  4YVW C;  2JDN A;  2CY6 A;  2E9Q A;  3MHZ A;  3FLP A;  5GZF A;  4N90 A;  4HFS A;  3NV4 A;  1WD4 A;  5T55 A;  1BLZ A;  4AQ6 A;  2JG8 C;  2XVG A;  4JZR A;  4AEJ A;  3UGH A;  2Q8C A;  4QAW A;  1LU1 A;  3SIT A;  4A7K A;  2JEC A;  2YXS A;  5FXX A;  3FFZ A;  4IGQ A;  4LBO A;  4ZXK A;  2YFU A;  4OVE A;  4CA9 A;  3RWK X;  2D7F A;  2ADE A;  2XJR A;  4AI3 A;  5HBA A;  1QJY 3;  2VNV A;  2EF6 A;  4IE6 A;  1QJY 2;  5KHJ A;  2J42 A;  4LK6 A;  3BOW A;  3DKQ A;  3T2Q A;  1HKD A;  4BA6 A;  1GYK A;  4W50 A;  3UL2 A;  2EAA A;  1Q8V A;  1LES A;  5I93 A;  4N53 B;  2WNV B;  2YBK A;  5F9T A;  1PIV 2;  4V2W A;  2VXR A;  4N53 A;  2IFR A;  4NE9 A;  3JCI A;  5C5U A;  2JG8 B;  2D6P A;  3MUZ 1;  1VMH A;  1XJA A;  1RHI 1;  1MS1 A;  2C9A A;  3S7I A;  4COU A;  4FPC A;  2DCY A;  3N7J A;  3S30 A;  3J7H A;  2JG9 B;  2OZJ A;  4CXW A;  1MVE A;  1POV 1;  1MZ5 A;  5FYH A;  4ZHN A;  5IAT A;  1GQP A;  1VBC 2;  2W68 A;  4QU2 A;  5A6Y A;  4I01 A;  4CDX C;  1PO1 3;  3POI A;  4H2A A;  5FQ0 A;  1RVF 2;  2RS1 2;  3I2J A;  5FYY A;  2X09 A;  4AED B;  4P9X A;  5JR2 A;  3MLK A;  4HK9 A;  3SCF A;  3B7M A;  2Y6F A;  5L9R A;  4CU7 A;  4MLO A;  4COW A;  4BHP A;  3O1M A;  2NZ9 A;  4ZS2 A;  1HRI 1;  1NXD 1;  1VMF A;  4GUL A;  1OXC A;  3MGU A;  5FZO B;  1ND2 C;  3T4V A;  2ARX A;  2B5H A;  3MID A;  2EIE A;  3ZN6 A;  1V6J A;  3HT2 A;  5E16 A;  5FZF A;  4AFB A;  1WD3 A;  2LS6 A;  3WV6 A;  1LOB A;  1W8O A;  2PFW A;  3RZZ A;  1QNY A;  4YM1 A;  5EYY A;  2VVD A;  1NZC A;  2W1U A;  3T30 A;  5LA0 A;  4LA2 A;  4OFG A;  3THT A;  2CGO A;  5FZI A;  3L9J T;  5A7N A;  3ACF A;  3H9A A;  5D21 A;  4GH4 A;  4XAA A;  2VEC A;  3ZYI B;  4E4S A;  5EJ1 B;  2GSY A;  2WKK A;  4WZF A;  2YZ4 A;  3AP9 A;  4MUV A;  2VM9 A;  4LO6 B;  5JWP A;  1BBT 1;  2ZCW A;  4LIU A;  1JHN A;  1ZBE 1;  2GC2 A;  2PYT A;  5LAS A;  2VC9 A;  4JRL A;  4K7J A;  4AQT A;  2Z4F A;  3PVE A;  2VUC A;  5CA6 A;  4AE2 A;  1J84 A;  4XJW A;  1OH3 A;  2HWC 2;  1BMV 2;  4EV0 A;  4N43 C;  4ERO A;  5K0U C;  4MGI E;  1KS5 A;  4JCK A;  2JB4 A;  1QJX 2;  2WLP A;  2FDF A;  5BNO C;  3SCH A;  4R8H A;  3ZN5 A;  4FI9 A;  3KV5 A;  2V5Y A;  1AR6 1;  2FCV A;  2HWE 2;  1WW4 A;  1H8V A;  5FOB B;  4QHZ A;  5G05 L;  1RMU 2;  4Y5Z 0;  3H1M A;  3S6P A;  1WMF A;  2MNG A;  2XJU A;  3NNM A;  3KF5 A;  4Y26 A;  3LKJ A;  2VQU A;  4E8D A;  2XDV A;  4DRR A;  4BWO A;  3ZSK A;  2EA7 A;  1YXW A;  4CXY A;  4YZ5 A;  4C90 A;  2R04 1;  3ASI A;  1HQL A;  1AJO A;  4JDM A;  1RUI 3;  5K0U B;  1IS6 A;  3HEI A;  3D4K A;  2BNM A;  4FVV A;  4A7Y A;  2AAC A;  4AVB A;  2ZEX A;  3RYK A;  3USU A;  4NHY A;  5GJ6 A;  2HYK A;  1VR3 A;  3AXE A;  3VBH C;  1YFU A;  5IVJ A;  1PM7 A;  5JXJ A;  1ZZ9 A;  2N7G A;  1K5M C;  4L92 A;  2X29 A;  4TLF A;  3RZL A;  3RYP A;  4A6S A;  5BY5 A;  5E6H A;  4S2D A;  1PVC 2;  1JZ7 A;  1UN1 A;  2VOT A;  4A44 A;  1SLL A;  4Q4X 2;  1DQ6 A;  3AVR A;  4PLO A;  3ZSM A;  4EE2 A;  3KZ4 C;  4N9I A;  1BZW A;  4YFW A;  4EN0 A;  1AVB A;  5CFD A;  3H3U A;  1BEV 1;  2EVX A;  3U14 A;  2XQR A;  1L3J A;  1H8T B;  4BCU A;  1GWM A;  5FP9 A;  3NKT A;  5F6K A;  3OGR A;  1F31 A;  2FZ1 A;  3HBK A;  4LKS A;  4YM2 A;  1LHW A;  4EWD A;  1ULF A;  4OHY A;  1CR7 A;  4PDW A;  2VUD A;  2Y6K A;  2VTF A;  4YW2 A;  2HLE A;  3PHM A;  5JI7 A;  4Q0V A;  5EV7 A;  5K7P A;  4UAP A;  1EUU A;  1WCD J;  2QBX A;  2VGD A;  4QPY A;  4XZU G;  4YW6 A;  5C9A B;  1W99 A;  5L36 A;  2G9Z A;  2E31 A;  2Y38 A;  5F8P A;  1HV0 A;  5FZM A;  5EFU A;  2OUH A;  5ACA 2;  1UYY A;  3C7G A;  1XU2 A;  1G9F A;  1OLR A;  3ZXF A;  3III A;  1IG3 A;  4D94 A;  3WNN A;  4B1M A;  3GHM A;  1YI7 A;  3AMP A;  1ULG A;  3C3V A;  4HPK B;  4W6Y A;  5F3G A;  4TWT A;  5E1R A;  1W9S A;  4AI0 A;  4PJY A;  5KXD A;  1KIT A;  5B4X A;  2BUK A;  1MS0 A;  5HCF A;  5FYC A;  1Y9M A;  3IAP A;  3C7F A;  4WM7 C;  2WQ8 A;  2RS3 1;  4D8M A;  4MG2 A;  2NLR A;  2BNN A;  4Y1Y A;  1C3H A;  3BTX A;  2XJT A;  2HBU A;  5DUW A;  3USU B;  5ACA 3;  2BFU S;  2K0G A;  1W9Y A;  4YGE A;  2VBP A;  3WQB A;  1PGL 2;  1ODN A;  4Q8L A;  3MW4 A;  1WBL A;  2B45 X;  3PUH A;  3AYA A;  4KBB A;  1A6C A;  1AR8 3;  3ZM8 A;  1OOP A;  3SLI A;  4AQ2 A;  2OXB A;  3ACL A;  4CUC A;  3DPR C;  3K4Z A;  1CAX A;  1O5L A;  4XTP A;  4D6R A;  2R07 1;  3CF6 E;  4AG4 A;  1C4R A;  4QKN A;  3Q8E A;  1PO2 1;  3SQO A;  4U2A A;  3WXP A;  3ZDS A;  1HLC A;  5FWE A;  1RUH 1;  5JR7 B;  5JXG A;  3PUQ A;  4E8C A;  1QH7 A;  1DP0 A;  4IEQ A;  4Y1V A;  1OPM A;  1SFN A;  3ALQ A;  2WA3 A;  4G9S B;  2RS5 1;  4QB1 A;  5DZE A;  4QX2 A;  2GAL A;  5FYT A;  4LO8 A;  1UZY A;  1PO1 2;  3NJZ A;  2R1B A;  1YEW A;  1FOD 1;  1NCR B;  3DPR A;  4EJR A;  2ZGP A;  1ASJ 3;  1HDK A;  1L7L A;  1OUR A;  2ZS6 B;  1O4Y A;  2CL2 A;  2QQP A;  1W0O A;  1BHG A;  1XYO A;  5DG2 A;  5C3Q A;  5C5T A;  4XUN A;  5FMB A;  3JD7 1;  2XH6 A;  5J36 A;  4HVQ A;  1N3O A;  1VPH A;  3ZYB A;  4OCT A;  3V65 A;  3O7O A;  1T6G C;  3S5A A;  1UZW A;  2YPD A;  2D44 A;  1POV 0;  1Q8S A;  1HRI 3;  1R1Z A;  2YC4 A;  1R1A 2;  4AAX A;  1WZX A;  5IVF A;  3VBR B;  4FCA A;  5T3N A;  4X8P A;  2VME A;  3WG3 A;  1VBA 1;  2R0F A;  2Q1M A;  4XJA A;  1IPK A;  1Y3T A;  3OEB A;  1AYM 1;  2VE1 A;  5A80 A;  5FKC A;  3VKN A;  4LEJ A;  5FZL A;  3ZFG B;  2DCZ A;  1YJL A;  1MAC A;  4OI1 A;  2LW8 A;  2Y6L A;  3O1V A;  2WIN B;  2LUW A;  4LTA A;  4RFR B;  4XOG A;  2XLF A;  2ZGO A;  4BB3 A;  2VO5 A;  5FZ1 A;  5C3R A;  3ZYJ B;  4CE8 A;  4BK4 A;  1TME 2;  1CIY A;  4NWW A;  2WT0 A;  4KWJ A;  4DEV A;  1SBF A;  1RUC 2;  2W94 A;  5GLW A;  1UOG A;  1V9U 1;  1VB4 A;  1VLN A;  3WDY A;  2F4L A;  4GZ9 A;  5K9Y A;  3ZDV A;  1GOH A;  1AJK A;  2C24 A;  2VMI A;  3H7J A;  4Z07 A;  1CAV B;  1O6U A;  2JG9 A;  1H2K A;  1A3K A;  1QWR A;  4RS5 B;  2H6C A;  4YSF A;  4B29 A;  1PK6 A;  2FCT A;  3WDU A;  4W4Z A;  2Y34 A;  4QM9 A;  1ZZC A;  3TWI A;  4RS5 C;  5DQ0 A;  3MDP A;  4CP9 A;  1W6Q A;  5IVY A;  2YGL A;  3EQE A;  2DVF A;  5DMY A;  2QNK A;  2FDI A;  1AX0 A;  1QOO A;  2YB7 A;  3B3Q E;  4FFG A;  5CYY A;  2Y26 A;  4C0B A;  2J1R A;  2L9L A;  2XHK A;  2DBI A;  1T2X A;  4B4P A;  2XG3 A;  1RJ8 A;  1IS5 A;  2TEP A;  5FY8 A;  2CV6 A;  2JE9 A;  4JTN A;  1QIQ A;  2D6L X;  2VZU A;  1D4M 3;  1UYZ A;  4Q5O A;  2YHJ A;  1SLC A;  5LBC A;  2VTX A;  1W6O A;  1K45 A;  1NQJ A;  2D5H A;  3KQ4 B;  2A6V A;  4R9D A;  3K4A A;  5DAP A;  3VHP A;  4CDU B;  5HCA A;  1XRU A;  4CYD A;  2R04 3;  3WZ1 A;  3D0J A;  1K42 A;  2VZT A;  5LA2 A;  2AYH A;  1QOS A;  2P3K A;  5DAW A;  4MXW A;  2Y6H A;  3VKL A;  5F5Q A;  2RM2 2;  3BKZ A;  4Y33 A;  1ENS A;  1GSL A;  1VP6 A;  4R4X A;  4YVW B;  3LA7 A;  3WX5 A;  1J3R A;  1LRH A;  1VAM A;  1VE0 A;  5EWS A;  3GJA A;  1FMD 1;  1RMU 1;  2Y0O A;  3VBU C;  2BVB A;  3AMQ A;  2QQO A;  4YNI A;  1W2N A;  1B35 C;  1O4Z A;  2DFB A;  1LEN A;  3OUH A;  2VOW A;  3LD8 A;  3ZXL A;  4YYO A;  2BZD A;  4GJZ A;  3BVC A;  5IFP A;  4FQZ A;  5FPB A;  1FMD 2;  3LSD A;  1PK6 B;  5I0U A;  3RGB A;  3OGS A;  5D8A A;  2QQI A;  3MLL A;  2ZJC A;  4ITC A;  4UW6 A;  1AX1 A;  1ZZ8 A;  2QQL A;  3ZSJ A;  4A3Z A;  1ZBA 2;  4CU6 A;  4XQD A;  3THP A;  1JH5 A;  4D6Q A;  4DY5 A;  4CVU A;  2E63 A;  2E26 A;  4OYU A;  1WMX A;  4WVW A;  1QOT A;  1D2Q A;  1W8W A;  1KJL A;  3B93 A;  1DFQ A;  1X8M A;  1FT9 A;  2JWP A;  4AHY A;  4E4D X;  2VR4 A;  3BPZ A;  3FHA A;  3IN9 A;  5H9P A;  4IEP A;  1CQ9 A;  3GZE A;  4QM8 A;  3WIN E;  5K4L A;  3VHR A;  4DZG A;  1CWP A;  4WM7 B;  2AGS A;  3U1X A;  1AR9 2;  1LU2 A;  1UY1 A;  2CAV A;  3WNP A;  2XJP A;  5DZG A;  4EYU A;  1DQ4 A;  3KWV A;  2IZW A;  2YY1 A;  4NHX A;  1CJP A;  1ULD A;  3R4D B;  2VD7 A;  1UIJ A;  2ZAH A;  3JB8 A;  3GM8 A;  3N9P A;  3FWE A;  2ETE A;  3R4U A;  1QHD A;  5EP9 A;  5A3U A;  5J09 A;  5L19 A;  4S2H A;  1MZF A;  3IT8 A;  4JC1 A;  4TXW A;  5FFO C;  2JD9 A;  3GGL A;  3MFA A;  4QX5 A;  2WN3 A;  2A7A A;  4P9L A;  3QLQ A;  1ULP A;  3MF9 A;  5FIX A;  1RUG 3;  4Q4V 1;  2I74 A;  4JGZ A;  4XTM A;  3GDB A;  3VDD B;  3ILN A;  3THC A;  5T52 A;  5IWF A;  2EAL A;  4GB3 2;  4C1W A;  1K3I A;  1SCS A;  3M3I A;  1O7F A;  5FCC A;  4AHW A;  1V00 A;  5DAQ A;  2ZXQ A;  3HN1 A;  5FJK A;  3K3O A;  3O1O A;  1MEC 1;  4QQO A;  3OYW A;  1XNB A;  3E5X A;  2Q8O A;  4LKD A;  3DYP A;  1IQD C;  1QEX A;  4JVA A;  4YW4 A;  1V9U 2;  1OA2 A;  4BE3 A;  4AVT A;  1QNW A;  1TME 1;  5KC5 A;  1C57 A;  3B94 A;  2FCU A;  4PLM A;  5CFD C;  1D0G A;  2MHF A;  5FPZ A;  1NCQ A;  1TMF 2;  2C9K A;  3NNJ A;  3VL8 A;  4YRD A;  3A4U A;  1MEC 3;  2P1B A;  1W8N A;  1EP0 A;  1VBA 3;  3UK9 A;  4RS5 A;  2E53 A;  1U0A A;  3BYW A;  2IXC A;  4BQY A;  1COV 1;  1OC1 A;  2YFZ A;  4ISQ A;  2RJL A;  3E5Q A;  3ON7 A;  1QJY 1;  4CP1 A;  1SFY A;  1OLM A;  4WV8 A;  4Q4Y 1;  5LA9 A;  1OA3 A;  1SBE A;  2OX0 A;  1LOA A;  4E4H A;  1MS3 A;  4JV4 A;  4LLO A;  3NV2 A;  4LXL A;  3AK0 A;  3D6E A;  3G7D A;  5CVR A;  2EIG A;  3ACG A;  2Z5W A;  1HRV 2;  4CDW C;  4QXC A;  3LFI A;  1AXZ A;  3FC0 A;  1PZ8 A;  5I8Y A;  2Z42 A;  4QX3 A;  4BIO A;  2OII A;  4D0Q A;  4V1P A;  2OYZ A;  1PO1 1;  2IXH A;  1KRI A;  3ATG A;  3K77 A;  3UKN A;  3E6C C;  3OPT A;  4WVM A;  2QQJ A;  4OUS A;  3BTY A;  4YG6 A;  3FLT A;  1V0A A;  3LB9 A;  4IV3 A;  5FXW A;  4N43 A;  4NPM A;  5J98 B;  1JU3 A;  2XB6 C;  2NMO A;  3ACI A;  3IDA A;  2DCT A;  1FAY A;  1PGW 1;  4LE4 A;  1F35 A;  4Y5S A;  5FZ8 A;  5JOX A;  1DGR A;  3OPW A;  2Q1Z B;  1JYV A;  2W1Q A;  4LBQ D;  5CB7 A;  3RS6 A;  3ZPO A;  3VHN A;  1YO8 A;  2WNU B;  5IAV A;  1HB4 A;  1ODM A;  4CEW C;  4SBV A;  2GC1 A;  2GH2 A;  4KG0 A;  1YQ2 A;  4DEQ A;  2Q1F A;  3OUI A;  5LRS A;  1ZNP A;  2SLI A;  5JDB A;  2Z2S B;  3CIH A;  4FTS A;  3M3O A;  1PGL 1;  1H6X A;  1W2T A;  4IEX A;  2Q0A A;  2RR1 2;  4BQW A;  3O1S A;  4LHK A;  1WW7 A;  2R7E B;  1AR9 3;  4YZ2 A;  4XFB A;  3AKS A;  3N7K A;  5GLT A;  4PQQ A;  1AYN 2;  2Q8E A;  3AM2 A;  3MIG A;  4QGM A;  4AGV A;  1NOV A;  2XR4 A;  3PUR A;  3Q8F A;  5A3N A;  5LWB A;  4LO7 A;  2FMD A;  4JKK A;  2PHD A;  3JBG 1;  4Y4R A;  5A1F A;  3J8F 3;  2QKD A;  4CCN A;  4FOQ A;  1ZBA 3;  5JIA A;  4NN0 A;  2VUA A;  3ACH A;  4URT A;  1EUT A;  1STM A;  5GM0 A;  3NST A;  4QQ2 A;  3SEE A;  5CG8 A;  4M4R A;  4AYU A;  1MQT A;  2WNE A;  3N35 A;  5FXZ A;  3E6D A;  4UYB A;  5A7W B;  2QTW B;  1VMJ A;  3GBW A;  5FPL A;  4HKO A;  5FYI A;  3J7L A;  4PT6 A;  1GZT A;  2GP3 A;  3V56 A;  5JZG C;  5KBF A;  3TN9 3;  2YBP A;  2RJ2 A;  1AZD A;  2AC1 A;  4QB6 A;  1XNC A;  2ES3 A;  5DAB A;  3ZYG A;  1D7P M;  1RUF 2;  2DCJ A;  3LEM A;  4QPI C;  5FZ0 A;  4ARY A;  1IS4 A;  2HJI A;  4LBQ A;  3CJI B;  3NNL A;  3ME2 A;  2V73 A;  4JHT A;  3RVH A;  4N7U A;  2R06 2;  4LBM A;  2EXH A;  2QDN A;  2WQ4 A;  4BME A;  4HK8 A;  5LK7 B;  2HWD 1;  2XHN A;  4RSU A;  3NV3 A;  5LZ6 A;  4RN5 A;  2AEY A;  1DGR N;  1PVC 1;  2ADD A;  2PHL A;  2WSU A;  3K4D A;  4K40 A;  2FDK A;  4OHV A;  2Q4S A;  3H8X A;  1DZT A;  1ND2 A;  1UPI A;  1WME A;  4TSV A;  3N9L A;  4C1X A;  1ZVF A;  3HBZ A;  3ZOI A;  4PI2 A;  3LZZ A;  2VPV A;  3FFQ A;  3MI8 A;  1W6P B;  4QB2 A;  5IK4 A;  1WCS A;  1QXJ A;  3EBR A;  2CTV A;  4PDW C;  1AR8 2;  3M3E A;  5LEJ A;  4A41 A;  4P08 A;  2YU2 A;  5EQU A;  1BK1 A;  1DYK A;  2EIB A;  1RYY A;  1COV 2;  2A3Y A;  5F3C A;  3ZFG A;  4DUV A;  5CIR A;  1JYT A;  2VMC A;  2WC2 A;  1YFX A;  2VW0 A;  2C4X A;  4H3W A;  1B09 A;  4NUB A;  2WO2 A;  1RUE 2;  2BFU L;  1AR7 3;  2CAU A;  1DYP A;  3WNO A;  5BNN C;  5FY5 A;  1SMV A;  3IWZ A;  1N47 A;  1UOB A;  2P6C A;  1DGW X;  1MQT B;  3WF4 A;  1AR6 3;  1SLA A;  4XCA A;  5I0R A;  1XNK A;  3WQ1 A;  5JXH A;  4Y1Z A;  2P34 A;  4CUA A;  3VKF C;  3BAL A;  2ZGS A;  3LSE A;  4IV1 A;  1YFY A;  1MEC 2;  5HI0 A;  4IV1 B;  4LBJ A;  2TNF A;  1ZBE 2;  1IS3 A;  2XJV A;  2MEV 1;  2WAB A;  2WO1 A;  5JSR A;  2QQU A;  3CHX A;  5IUQ A;  5LBE A;  2VBD A;  3H1W A;  2DBN A;  5FZ7 A;  3POG A;  3VBO C;  2YRO A;  4IV3 C;  3T2O A;  3HOB A;  2IWG B;  5EYX A;  3TNP B;  1JZ4 A;  3AYC A;  2BW8 A;  1X82 A;  2R16 A;  3HVD A;  1EAH 2;  3DEM A;  1Q8Q A;  4DOU A;  3A0K A;  4LOS A;  3LF7 A;  4NAO A;  1S0D A;  2WO7 A;  3HAG A;  4QQL A;  5BYN A;  4FTE A;  5HCH A;  1SG3 A;  1HXS 2;  1VIW B; 
#chains in the Genus database with same CATH homology
 5FMD A;  5FMB A;  4B1L A;  3LIH A;  5FKB A;  3UGF A;  3KF5 A;  2AEZ A;  2QQV A;  3U1X A;  4UFH A;  4FFF A;  2AC1 A;  3U14 A;  3LDK A;  4UFJ A;  1ST8 A;  2XQR A;  3NMB A;  1Y9G A;  5ANN A;  3H3L A;  3LEM A;  3S5Q A;  3ZR6 A;  4CCE A;  1Y4W A;  5FMC A;  3ZR5 A;  4FFH A;  3UGG A;  2QQU A;  4AZZ A;  4UFL A;  3UGH A;  1Y9M A;  3HBK A;  4JQT A;  4UFK A;  3KF3 A;  2AEY A;  2ADD A;  1UYP A;  2QQW A;  4FFI A;  3OSD A;  3LFI A;  3LIG A;  4HXC A;  5FK8 A;  5FKC A;  3SC7 X;  3PIG A;  4UFI A;  3PIJ A;  4EQV A;  3RWK X;  2ADE A;  4CCC A;  5FIX A;  1W2T A;  3LDR A;  4FFG A;  4CCD A;  3IMM A;  3LF7 A;  3U75 A;  4B1M A;  4QHZ A;  5FK7 A;  4UFM A;  2OXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...