1Z78A

Crystal structure of the thrombospondin-1 n-terminal domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
b'NSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin 1
molecule tags Cell adhesion
source organism Homo sapiens
publication title The structures of the thrombospondin-1 N-terminal domain and its complex with a synthetic pentameric heparin.
pubmed doi rcsb
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2005-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1z78A00
3IKWA 3IM0A 1LOGA 2GNTA 2DTYA 2EXIA 2KM2A 4PF5A 5GLTA 2YROA 2FMDA 1C1LA 1ULDA 3AP5A 5GZEA 1HDKA 1QOSA 1MR5A 1FATA 1ULCA 3MPPG 4DPNA 4XYXA 1GBGA 1G9CA 2GMPA 1HLCA 1S0DA 3TB0A 1Q8SA 2PELA 5T55A 2P3JA 4YW3A 1S0EA 4L8QA 3CNAA 3WDVA 1BJQA 2XB6C 1MZ6A 1QOTA 3AZVA 1SLIA 1AZDA 3WCSA 1LOBA 1AJKA 4JCKA 5H9SA 2NN8A 3A0NA 3MEPA 1WLDA 1N1VA 3WG1A 5IK7A 2D3PA 4NOTA 1I1EA 2VW1A 1AX2A 1LTEA 1W0PA 4XJAA 3WHTA 5BYNA 2AREA 4AGVA 2E51A 5EYXA 1W6QB 1G9BA 5E89A 1VIWB 3D6EA 4BMBA 5GZGA 4FOQA 1JW6A 2GMEA 4C1WA 3Q9OA 1AVBA 2BQPA 1JOJA 2HYKA 1AXKA 1IS3A 1X50A 2UWAA 4K1ZA 3NV1A 4YGBA 1FYUA 5JVVA 1LGCA 5DG1A 1SLCA 3RQ0A 3WNXA 1BZWA 4Q1PA 2CWSA 2ZGQA 3GALA 3WOGA 1Q56A 2A5ZA 3SNMA 1SBEA 5GZDA 4Y20A 4R9CA 2H0BA 3ZXKA 4DQAA 4Y22B 2JJ6A 4XBLA 2C5DA 2D3RA 5FREA 2EAKA 4Y1VA 5T5JA 1GZCA 2UWCA 1CN1A 1QDOA 2WT0A 3AZZA 2VY0A 4YGDA 4BOWA 1R1ZA 1DZQA 1QNWA 1VAMA 2WQZC 5T5OA 4CZSA 2ZBJA 3UJOA 3AJYA 3M1HA 3B01A 1FV2A 1YIFA 1BXHA 1KDKA 2ZABA 1PZ7A 3RSJA 4LBOA 1SFYA 2A70A 4Z8BA 4HANA 2ZGRA 1Q8OA 1GYKA 5IK4A 5GLUA 1QDCA 2PHXA 1DHKB 3AXDA 3ZSLA 4F83A 1WD4A 3M3CA 1YXWA 3IMNA 5GM0A 3O0XA 1UN1A 1MACA 2ZHLA 3BOPA 3WV6A 4D69A 1YYNA 4AVVA 4GALA 3NV3A 1A8DA 3IPVA 1DQ2A 1S0CA 5JLVA 4M3CA 3MW4A 2DV9A 1LHVA 3R05A 2W52A 1S0JA 1GNZA 3N7LA 1GZWA 4LBNA 4YGCA 3U4XA 3L2YA 2A6XA 4XE9A 1N3QA 2OVUA 1ULGA 2NMNA 2DUOA 3FUQA 1N3OA 2GN7A 1C1FA 1VALA 1BQPA 1UKGA 2DTWA 3AXEA 1SLBA 1DQ5A 1DFQA 2TEPA 3N36A 4GA9A 2PHFA 4YW5A 4ISQA 5GLVA 1WW4A 2GALA 3POWA 1WBFA 3WVJA 3DGTA 2JE7A 1DYPA 1F9KA 5SV8A 1HQWA 4XJWA 2CWMA 3M2MA 3MW2A 2VXRA 4YM1A 3O0VA 4FPGA 2YMZA 1IS5A 2NYYA 4XHXA 1LCLA 1CPNA 2EALA 3B3QE 1JUIA 5CA6A 2EXJA 3HN1A 1W6QA 2GNDA 1A3KA 3RMYA 4AVSA 4YZ5A 3OPZA 1KJLA 4Q2FA 2AR6A 1G86A 2R1BA 5CNAA 2ARXA 5DG2A 1GV9A 1G9FA 2R49A 3AYEA 4TZDA 1AX1A 3FLPA 2PHRA 2SBAA 4XXAA 1WLWA 3VKNA 1VAVA 5IK8A 2P34A 5DUWA 2D6NA 2JD4A 3WG4A 4Q8KA 2YZ4A 5KXCA 1UPSA 3ZXLA 2ZKNA 3AP4A 3POYA 4K21A 3UJQA 1DBNA 1LGBA 2D6LX 1KQRA 1Q8VA 1TEIA 1DQ4A 2DU0A 2ZMNA 4WZFA 4LBQB 4R9BA 2VW0A 3PVEA 3QLQA 5FRAA 1D2SA 1LHWA 1SLTA 2E53A 2WNEA 1IKPA 3FFZA 4GKXA 4Y22A 5IK5A 1G7YA 4FVVA 4PBOA 3WCRA 1WW5A 1N1YA 3AJZA 3WDUA 2P37A 3RMXA 2AENA 2ZGOA 3ZSKA 2GDFA 2D6KA 4YGEA 3W58A 4M3CE 4XJZA 4ATFA 1QU0A 3AYAA 2GMMA 1ENQA 4M01A 3UL2A 2W08A 4M3CB 1CQ9A 1LESA 3M3QA 3IPVB 3ZSJA 4FOYA 4FPYA 1V6LA 4M3CF 4MYEA 4ZXKA 3HMYA 1N1SA 1LU1A 1QGLA 4AGRA 3V0AB 4Y1XA 1RINA 1URXA 1IS4A 1NLSA 4LBQA 4FP3A 2NP0A 1G8WA 2ZGTA 5DXDA 2I2SA 2ERFA 4YG6A 1SLLA 1D0HA 2OUHA 2A6VA 4GWMA 4IQPA 1DQ0A 2D6MA 4FPKA 1PZ9A 4XJ8A 1MS0A 2ARBA 1LOAA 1H30A 1LEMA 1Q8QA 1V6IA 1JXNA 3R4UA 3B9CA 3O5SA 3APBA 1YI7A 1APNA 2ZGKA 1WW6A 4ASMB 1MVQA 5EXOA 2D43A 2GNBA 3ZYRA 2A7AA 4AVTA 1F5FA 4XTPA 4YZ2A 3H0OA 3FUOA 3LCPA 5T5LA 2NM1A 3AFKA 4YZ1A 4CTEA 5JOYA 4JRAA 3WG2A 1LGNA 3POSA 1LU2A 3PVNA 1QNYA 4YG0A 1RIRA 2ENRA 1KJRA 1YO8A 3N3HA 4YW2A 5T52A 3ENRA 3T1MA 1MVEA 3T2TA 4Q26A 5JOXA 1WCSA 1DQ6A 2NMOA 4AYUA 1B09A 5EYYA 1QF3A 3JUUA 4FQ4A 1V6NA 3WDWA 2D3SA 3PJQA 2WJSA 4PBPA 2JKBA 4Y24A 4AWDA 3SISA 4YZ3A 4P9WA 3WUDA 4BMEA 5JOWA 4FPCA 1FV3A 5T54A 3DUIA 2ZACA 3SLIA 2A75A 1V6KA 1N1TA 2B7YA 1DYKA 4RL7A 1RITA 2C9AA 4I30A 3NV4A 1ULEA 2R1DA 2V73A 2OUJA 4DS0A 1MZ5A 4BM8A 4LBJA 4UW6A 5L73A 3ZYPA 1W6PA 1UX6A 3ZXJA 2V5YA 3OGGA 2A3WA 3ILNA 1LEDA 3ZXFA 2ZGMA 1IKQA 1ULFA 3OYWB 1BKZA 2RHPA 3M3EA 3OJBA 4XJ9A 4CRQA 2DWRA 2WSVA 1U0AA 2CNAA 3PVOA 2JECA 3SH5A 3WG3A 4WVWA 2A6WA 3KM5A 4XDQA 2DVAA 4HL0A 2UURA 2ZZJA 3RS6A 1LHOA 1QMJA 4PQ9A 2UU8A 2Z42A 3V0BB 4WV8A 3V0AA 2ZGUA 1LOEA 4K20A 1GSLA 2E6VA 4DRVA 1VLNA 2DUQA 1IOAA 2WKKA 4YM0A 5GLZA 3SITA 1ENSA 1WD3A 2JE9A 3ZXEA 2DVDA 2ZGLA 1CIWA 3ILFA 1GKBA 1MS1A 5DZEA 5HCAA 5IT6A 3AP6A 1KITA 2D44A 4LBLA 2EXKA 2VW2A 1W6MB 4RA0A 5T50A 1O4YA 5GJ6A 3MW3A 4U36A 3V64A 1ENRA 5KXEA 1LULA 2P3KA 4Q27A 2D6OX 2D7FA 4FOWA 3SH4A 2R0HA 1LOFC 1GNHA 1LOFA 1I3HA 1SCRA 1YRZA 3N7JA 1Y7BA 1GICA 1CESA 2A6YA 1G9AA 3WDXA 2CL2A 3FLTA 2GN3A 1FAYA 1FNZA 1MS4A 3VKOA 4BLJA 3WDTA 3WUCA 4H55A 1KDMA 1S0IA 4Q1RA 4TYSA 5AVAA 2EIGA 4DFSA 4Y26A 5EWSA 1W6NB 4FPJA 3B69A 4GXLA 3LSDA 1HQLA 2VH9A 3D4KA 2DURA 3OY8B 1WUVA 3VV1A 3SH3A 1JN2P 3OBRA 1EPWA 3N35A 2JDZA 3WDYA 3ZSMA 1DIWA 1W6OA 3USUB 3VKMA 4XOGA 2A71A 3BODA 1DGLA 5DUVA 2A6ZA 1ZA4A 3RRDA 4BQ1A 4YLZA 3AYCA 3C2UA 3A0KA 5JOZA 1UZZA 2WLQA 1JYCA 1J1TA 4BLIA 1UAIA 1QOOA 4K1YA 2D6PA 2DUPA 3AZXA 4XBQA 5GALA 1CONA 4XMAA 3KQRA 4FP2A 3LSEA 1OKQA 3QCWA 4FQZA 2DVFA 3HR9A 3ZPYA 4AGGA 1LHUA 4YW4A 2VUAA 2ZAAA 4M00A 1S0FA 3FBYA 2ZGNA 4LBKA 1GZWB 5H9RA 1AJOA 1LOCA 2DVBA 3ATGA 4PCRA 4YZ4A 5E8AA 1MS3A 1Z78A 2R0FA 2YV8A 1UZYA 4XTMA 2A3XA 1N3PA 1V6OA 3IN9A 2ZGSA 3PMEA 1MS5A 5KXBA 4C1XA 2WT1A 1JHNA 4UW4A 3AX4A 3TAYA 2WSUA 2ZHKA 3AP9A 3BIWE 1V6MA 4OZXA 1XQNA 1W0OA 2P3IA 2ZA9A 5E88A 4SLIA 1QKQA 1N47A 2SLIA 4XZPA 4FPLA 2PHWA 4U2AA 3WZ1A 4R9AA 1HKDA 2DU1A 2W68A 5IUQA 4DRRA 2AUYA 1WLCA 4ATEA 3RG0A 3AZWA 5F9TA 1F31A 3AK0A 4JC1A 2G4IA 2AYHA 3INAA 2E7QA 4UW3A 3N7MA 5T5PA 3VKFC 1NXD1 1DLLA 1H9PA 1OFSA 1PZ8A 4P9YA 5GZFA 3V65A 1OQ1A 3B00A 1WBLA 3D5OA 1LENA 4XILA 3O12A 3OYWA 1V6JA 3I4IA 4YW1A 1W6PB 4XBNA 4XMIA 2YY1A 1CR7A 2ZHNA 4ZKTB 4ISRA 5JMCA 4Y1YA 1JYIA 1GLHA 1S0GA 5H9PA 4Y20B 1H9WA 1C57A 4FOVA 4P14A 5DUXA 1CJPA 4Q8LA 5DZGA 1SBDA 5HCFA 1Q8PA 3BTAA 3WLUA 1UL9A 2W39A 2AH2A 3AP7A 4XHBA 2DYCA 1GZ9A 2YXSA 5LK5A 4UW5A 1LJ7A 1V00A 3I8TA 5CAZA 4R9DA 4ITCA 4XXPA 1LECA 1MS8A 3W59A 2WT2A 4XIOA 3UK9A 5JDBA 4Y1ZA 4YFZA 4FPOB 4W65A 1ZM1A 4XIKA 3VUOA 4FPEA 2GNMA 4XJUA 4GKYA 2XG3A 3M3OA 4BPZA 1CPMA 5KXDA 4YFWA 4YM2A 3JU9A 3OBTA 1S1AA 2PHTA 2Q5TA 4YM3A 2CYFA 1SACA 1FNYA 1SBFA 1SLAA 1W6OB 4YG3A 5H9QA 3USUA 2EF6A 1UMZA 1AXYA 1FX5A 2CY6A 5CB7A 2NZ9A 2CTVA 4LBQD 5CBLA 1ONAA 2ZMLA 1AXZA 3OY8A 1A78A 2EXHA 4P9XA 1KRIA 1S0BA 3ASIA 3NV2A 2ZMKA 2AGSA 5GZCA 1LODA 1W6NA 5DUUA 1JBCA 4LBMA 2PHUA 4FPHA 1BYHA 2LALA 5F5QA 2E7TA 1LHNA 1CVNA 2R16A 4Y1UA 3N7KA 2DVGA 3GNEA 4KBBA 3O0WA 4WVVA 3WHUA 5GLWA 1MS9A 1AX0A 4GWNA 3ZVXA 1WW7A 2ZGPA 1O4ZA 1AF9A 3AZYA 2VU9A 3A4UA 2UWBA 1IS6A 3VKLA 5HCBA 1GANA 2FHRA 3V0BA 2LTNA 1Z0HA 5DZFA 2A3YA 3T1LA 2P2KA 3NWKA 1G9DA 3FLRA 4NO4A 1C4RA 1SCSA 4FPFA 2ES3A 1W6MA 3ILRA 2ZHMA 2OW4A 3AYDA 3R4SA 1DQ1A
chains in the Genus database with same CATH superfamily
3PTYA 1LOGA 4CEYC 2GNTA 1PO23 4PF5A 4IGQA 3C7GA 2YROA 4Y3OA 5GZEA 1U5XA 1BCXA 1MEC2 5LATA 3MPPG 1DF0A 4IEVA 1YFYA 2R043 1GBGA 4JV4A 4NE9A 5IVEA 1G9CA 1ACCA 4IEXA 4A7KA 1UW8A 3TB0A 2PELA 3PU3A 1S0EA 4JHTA 2HYXA 1UPIA 3CNAA 3DV8A 4GB32 2XB6C 4XQ4A 1GUIA 4B29A 1BEV3 1QOTA 3AZVA 5I0RA 3N4MA 3J8F3 4AK3A 1O4TA 1R092 2DF7A 1NA1C 3A0NA 4QD2A 2XBO2 1TNFA 2D3PA 2HLEA 5IK7A 2JB8A 4NOTA 3VBFB 2VW1A 1AX2A 1DCSA 1W0PA 3FE5A 3LZZA 4XJAA 2IWGB 2QQUA 3WHTA 3WF1A 1C8M1 1CAUB 3WXPA 5EFUA 3KQ4B 4AI1A 3BTXA 1STMA 4UXAA 5LA1A 5KHKA 2XVKA 2VOTA 3TN91 4CCNA 4EZHA 1G9BA 1VIWB 3DECA 1VP6A 4BQYA 1OF4A 3D6EA 4NN0A 4FOQA 1PX3A 4MO3M 3J7HA 3JCIA 4BHPA 4NHYA 3ZMNA 1JZ3A 4Z92B 4NROA 3Q9OA 1AVBA 5FXVA 4DNYA 1GQPA 4QAWA 1GQHA 4YARA 1AXKA 4YGBA 1ZZBA 3NV1A 1FYUA 3H8UA 1LGCA 2VOWA 5FLHA 3VN4A 3GALA 1OLQA 2A5ZA 4TN7A 5FCCA 1NE6A 1ASJ3 3KCCA 5GZDA 1ND3C 5F7UA 4DQAA 3HAGA 2Q1ZB 5F2WA 4OHWA 5KHJA 5FREA 4QQ2A 2EAKA 2V5DA 3NJYA 1GZTA 1RUC1 1QDOA 2WT0A 2VY0A 1ZREA 4LIUA 5FZAA 1IPJA 3THDA 4QHOA 1D7PM 1OD5A 4KGGA 2VC9A 2JDNA 3TEXA 5BNOC 1S2BA 1ZBE2 3AJYA 4A42A 3LEIA 1AR91 2O14A 3FHIB 4XFGA 4N53A 4UYBA 1SFYA 2FCUA 1MQTB 5AC92 1BEV1 5K9YA 1GYKA 2WFF2 5GLUA 1QDCA 3RFRA 3ZLIA 2WLPA 3WD5A 3AMQA 5C5UA 5A6ZA 4D69A 5C33A 5I0TA 1XSRA 2NLRA 4BJ0A 4I2OA 4BWOA 4WVZA 1LHVA 2DV9A 3GZAA 3KMHA 4KWKA 4RHV2 4RS5A 5A7OA 4JDMA 5FYMA 3TEYA 4YGCA 2G9FA 3GYDA 3LPFA 4KG0A 3U4XA 1M06G 2A6XA 4ZHNA 2BNOA 2YU2A 2XQRA 4JKLA 4Q4Y3 3ZYBA 2WNUC 4B1LA 2DCYA 1VALA 1UKGA 2DTWA 4MGSA 1DQ5A 4NR1A 4AR2A 4H3WA 1AL0G 3RNSA 4ZU5A 5JSRA 2VUJA 1WBFA 4OHYA 3GF6A 3DGTA 1GR3A 2EIDA 4AEDA 2OQ7A 1DYPA 4INDA 4OCTA 3PL0A 1HQWA 1WZXA 1QWRA 4XJWA 2CWMA 3LAGA 1EUUA 3MW2A 2HWD1 4AI2A 2VXRA 5FV3A 1IG3A 4QPGB 2GP3A 3U0ZA 1TVGA 3H42B 4W4ZA 3PDQA 2NYYA 1R1A3 1OF3A 2W95A 4IUGA 5BNNB 1LCLA 4XUPA 3PVBB 4HKOA 2RM21 2EXJA 2ZEXA 3HN1A 1O3RA 3SCGA 4Y33A 4AVCA 1WGPA 3IZOA 4IESA 3ROUA 4AEKA 3UYJA 4YZ5A 3OPZA 4Q2FA 3PU8A 3W21A 4JQTA 3KGLA 2YPDA 4CPBD 1RUJ2 4TXWA 3HN3A 2W94A 2Y6HA 3IDCB 2XJPA 3SCHA 5KXCA 1UPSA 3WNMA 2CGNA 2BOIA 5FPAA 2A1XA 1KQRA 1Q8VA 4WZFA 1DQ4A 3ZN6B 1XOYA 3J4UH 1Y4WA 2HWB3 2LM3A 3LIHA 4MGIE 2VW0A 3QLQA 4D8MA 1SLTA 5DPNA 3RZLA 4V1PA 1ZRFA 2C4XA 3WDUA 1N1YA 3AJZA 3T0AA 5FWJA 1XE0A 2VCBA 3ZSKA 5FJHA 2WN2A 2XJRA 2D6KA 2VMGA 2WAOA 3ZR6A 3MUY1 2UY8A 3MI8A 4LKSA 4XFBA 1POV0 1QU0A 2ZXQA 4K40A 4YVSC 4DZGA 1ENQA 2QCSB 1RUF2 3UL2A 2W08A 2MEV2 1CQ9A 1LESA 4QGMA 3ZSJA 4NAOA 1H2KA 3QD6A 1V6LA 4FPYA 4M3CF 4XZUG 3THPA 3HMYA 4EN9B 4AGRA 1LU1A 3VL8A 1MEC3 2CU5A 2X10A 1XNTA 5ABJB 1NLSA 5FMBA 4AFCA 5LK7B 1S2EA 2I2SA 5DXDA 1D0HA 4G4FA 2D6MA 1GWMA 4FPKA 1IHMA 4IV3C 3NAPA 2ARBA 2F6BA 4RQPC 5ACA1 1H30A 1LEMA 1RJ7A 2Y33A 4EROA 3UKVA 4HZFA 5FXWA 1YI7A 4Q4X2 3ELNA 1AR61 1APNA 2ZGKA 3T09A 4RHV3 5EXOA 2Q8CA 4CYDA 2GNBA 2VCMA 1W8ZA 4AVTA 4YZ2A 1YWKA 2WWJA 1Z7S3 1V9U1 3ZN5A 2E9QA 4YZ1A 3DEMA 3W20A 4JRAA 4NRMA 1BBT2 1LGNA 3CMGA 1LU2A 3H3UA 1QNYA 3PVNA 4UFJA 4YW2A 1KJRA 3ZYRA 4LHNA 3ENRA 2WFF3 5LA2A 4Q26A 2OS2A 5JOXA 4ES8A 5FZ4A 4B7EA 1VBE3 1CIYA 5EIYB 2XJTA 1OI6A 1AR82 1PM7A 4YVSB 1POV3 3OEBA 1ODMA 3WDWA 1UY0A 1AYN3 3PJQA 3P3NA 1QJEA 3VZNA 1W2UA 3ZSEA 2HKXA 1HJFA 5CFCB 4P9WA 1LNSA 3DXTA 1SFNA 5LY2A 2WO1A 2C24A 2PAMA 2YC0A 4JZRA 3MO4A 2B7YA 2YPJA 2VBPA 4DIQA 4Y5SA 3VZJA 4LO5B 2JG9C 2OPWA 1ULEA 2B4KA 4PDWB 3CJXA 2QQKA 3OBAA 4WM8B 1ULOA 1JI6A 4XFCA 2FBEA 4YM3A 1MZ5A 4XABA 2WYSA 5L73A 4AI3A 3ACLA 3H8XA 1YI9A 2A3WA 3ZXFA 1EAH1 3A22A 3T0DA 1VBE2 2DWRA 4YSFA 2YBPA 2ZCWA 1WWYA 4I0WB 2VZ1A 2VOXA 4TSVA 2DVAA 3P5BA 1L7QA 2UURA 2QBXA 4QKFA 3PHMA 4WVMB 1LHOA 2XHNA 2P3YA 3HIFA 1EV11 2QJVA 3JQWA 4AHZA 3IIIA 4WV8A 4XUQA 1LOEA 4K20A 5IFPA 1GSLA 1UYPA 3K48A 1IOAA 4W50A 4YM0A 2PLV3 3ZIWA 4EWDA 3JB4C 4LQRA 1PX4A 1FMD3 1VRH3 1GKBA 1RUH3 2FDHA 1I6XA 5HCAA 4D7YA 4WM7A 3VBOC 2XHKA 2D44A 2PQSA 2XGXA 2WS92 2YBKA 1W6MB 3AL6A 4RA0A 2AC1A 3CDZB 5T50A 1O4YA 2WC2A 3GCXA 4N9HA 4E8DA 4U36A 3V64A 2RE9A 3IB3A 2R061 4YW6A 4BQXA 4FOWA 2QDRA 1LOFC 5C9AA 3WF2A 3EB7A 1I3HA 1U5YA 1PK6B 2LRPA 4RR3B 4N7IA 3EQEA 3NO8A 2Z69A 4J1WA 3J8F2 3VBRB 3VBUB 2Y38A 3MICA 3WDXA 4F7ZA 2Q1MA 3C7EA 2XJUA 3ABZA 3NQHA 4NRPA 4LO4B 5A6XA 1UQXA 1HRV2 2J1RA 4H55A 5FZBA 2VQUA 2HWE3 2RJLA 1NQJA 4HK9A 3PUHA 2BYVE 4HSJA 1W2NA 4FPJA 4CCLA 3B69A 3OEAA 4FI9A 2BFUS 1EP0A 2VH9A 2DURA 5FMOS 2VE1A 4O9GA 3VV1A 4GIQA 5FZ3A 1UXZA 4FSJA 1AYM3 5FKBA 1XU1A 2JDZA 3WDYA 3ZSMA 1DIWA 1PVC3 2VNVA 2HEWF 2WABA 3PUAA 4FFIA 1RUG2 4NUBA 1QJX3 5FOBB 4JGYB 1DGLA 4HETA 4KU7A 4BQ1A 4LUKA 3AYCA 3A0KA 3VBHC 1UZZA 3CZUA 5DDJ2 1J1TA 5JCTA 4LOSA 4QPIA 4OULA 5IVYA 3WNPA 1ZZCA 3AZXA 4XBQA 3OD4A 5GALA 2K0GA 3CKHA 3WF4A 3HNMA 1SZBA 2QFEA 4Q4V2 4URTA 4XMAA 3UETA 4DOUA 2Y26A 4FQZA 1T2XA 4KI5M 5A3OA 5F1RA 3HR9A 1R082 4LULA 5LRRA 5A3LA 1H0BA 3AFGA 4YW4A 2ZAAA 2B5HA 2XL9A 2XWBB 1S0FA 3FBYA 4COZA 2FDIA 2Y6KA 4FAGA 1O5UA 4MGQA 1GZWB 2ZJCA 4CDWB 5F3EA 2DVBA 1MS3A 2R0FA 4KWLA 4AI8A 3WW2A 4J25A 4RGKA 5KHIA 4CDUB 1YUDA 1D4VB 3PMEA 1CZVA 1E5HA 3IT8A 4RQPB 2Q0AA 2GSYA 3JD72 3ZMOA 3ZFEA 4C1XA 1JHNA 5HV4A 3AX4A 3TAYA 3MIBA 1RJ8A 1V6MA 2RMU1 1XQNA 2P3IA 3C7OA 3K4AA 4SLIA 3DYPA 5IAXA 1TE1B 4QQOA 1N47A 1W05A 1AR72 2JG9B 5FY1A 4PDWC 1FOD1 5LZ6A 2PTMA 2P4EA 4XPVA 2RS12 3IDBB 2PHWA 1QJU1 2VMIA 3I59A 1XJAA 1HKDA 2DU1A 3I3EA 4R9AA 3AVSA 4R4XA 1OHFA 1RHI1 1WLCA 2BOJA 3NVCA 1F31A 3RG0A 4BQ3A 3LB9A 4JC1A 2G1MA 1AYN2 2AYHA 2ARAA 3INAA 3OUIA 3WW4A 1OFNA 4IXLA 4NJ4A 2JG8C 2GH8A 1PNGA 1PZ8A 1UWWA 1UYYA 1WBLA 4W6YA 2BTVC 3O12A 4AL9A 4YW1A 5FZ1A 3J9SA 1W6PB 4IDZA 4XBNA 4CDUA 1W28A 2YY1A 4CCKA 1JYWA 1CR7A 3GZTB 2XPJA 2CDPA 4S2GA 1BBT3 4BDVB 5FYCA 5J48A 2C9KA 5LEJA 1JYIA 1C5IA 3AB0A 1H9WA 2RS52 1PO13 4MH0E 1C57A 5JWPA 5JUVA 2BGOA 1AYM2 4Q0SA 1L7RA 2PAEA 4FOVA 4HKWA 1PIV2 4Q8LA 5DZGA 1SBDA 2QNKA 1Q8PA 3BTAA 4AAXA 4DEVA 4NIHA 1PMIA 2QE3A 1TMF2 3DPRC 4XHBA 3WNKA 4NVPA 4O65A 1ODNA 4FT8A 2ARCA 4C90A 3W59A 1FPN2 4AOCA 5A3UA 2ETEA 2WN3A 4CCMA 4W65A 1ZM1A 5CZKA 3O1MA 4FPEA 4B1MA 3EXUA 2DBNA 3M3IA 3AMNA 3AL5A 1CPMA 3HQXA 1WKYA 4YM2A 2VZVA 3OBTA 2PHTA 4GAZA 2FQPA 1RUE3 1YLLA 1SACA 1W6OB 2QZ2A 3LEGA 4AI9A 4YG3A 4P9JA 2EF6A 2V09A 1YC61 2H0VA 1OUXA 3VDBA 1AXYA 2CTVA 2ZMLA 3OY8A 4GWJA 2GU9A 5L7OB 2RR11 1Q43A 4XF0A 1X8EA 5DUUA 4URAA 5GZCA 1JBCA 2PHUA 3HOBA 2YGMA 5LA9A 4B4RA 3SKVA 5F5QA 4TLGA 2E7TA 1S55A 3I2GA 1Q3EA 2HWF3 4Y1UA 1W8FA 3N7KA 5DQ0A 1X8MA 2WO2A 4WVVA 1NT0A 3RJRA 1EAH3 1A34A 2RJKA 3WY6A 4GWNA 3N9OA 2ZGPA 2QDNA 1OT5A 3HEIA 1AF9A 1LRHA 1VMFA 3AZYA 4Q0UA 1ND3A 3T08A 4CXYA 4IEQA 4P00B 1I9RA 1UY1A 3KV4A 1R093 1K5MB 1IG0A 2VGDA 3T1LA 1YFXA 4QQLA 1HX6A 2OIIA 1RUC3 1VBC1 2IXCA 4LO6B 4XVHA 2VR4A 5ISLA 1SCSA 1ULPA 1W6MA 3I2FA 5FP8A 4ZU7A 3ILRA 3MZHA 1Y9MA 1K5MA 2OW4A 4QPGC 1U5IA 1YHFA 1DQ1A 1SHWB 2R042 3IKWA 4D0QA 1EYBA 2CGOA 2JXAA 4XC9A 5FO9B 3VZKA 2FMDA 1GFF2 5C3RA 4OQ8A 1HDKA 5FMCA 1QOSA 1ULCA 4CUBA 4DPNA 1VBB3 5ANQA 1GQGA 3CBNA 4XYXA 4A41A 2DCZA 1XE7A 4D7TA 5T3NA 1Q8SA 4E2GA 2ZX1A 3CF6E 4YW3A 4CCDA 4NHMA 4K3UA 3WQ7A 3KF5A 4JCKA 4OHVA 1WLDA 3WG1A 5FZHA 5JXJA 2VZSA 1LTEA 1W9YA 1YFUA 3KGZA 2E51A 2K9ZA 5EYXA 1JU4A 1YIPA 3PIGA 5FZ0A 1YQ6A 2BBVA 3CJIA 2JG8B 5K7PA 4YVWC 1NXMA 5JXGA 4BYYA 1PMJX 2BDRA 2VD7A 3MFAA 5FYVA 2BZDA 1RUI3 4QPGA 5FYYA 4DXRA 5BNPA 4FTEA 5I93A 3HWJA 4QQHA 1JOJA 1CAVB 2ADDA 4CP9A 3UKTA 1U12A 2MPFA 1RUD2 5JVVA 3VBRA 5IVVA 3AMPA 3WNXA 1BZWA 1ZA7A 2CWSA 2ZGQA 1G6NA 4IEUA 3WOGA 4RD7A 5C3QA 2VOVA 1SBEA 2J7MA 3RZMA 5K0UB 2GAUA 2C5DA 5FO8B 3NJXA 4Y1VA 2P6HA 5LBEA 4HLTA 1D2QA 1AUYA 4PI0A 4LLOA 4K8RB 1X33A 1DZRA 3LIGA 4XCAA 1JZ5A 1R1ZA 2OZ6A 4LUMA 1B35A 4CZSA 1KEXA 4S2HA 1RUF3 2B8MA 3B01A 1YQCA 1FV2A 3RSJA 1PZ7A 3WP3A 5EP9A 2RDRA 3B94A 2JICA 2A70A 3L2HA 3F95A 2VO5A 4UFKA 4GMP3 3RZHA 2LUWA 2ZGRA 4WVMA 4AXOA 4NIGA 1VBD2 5IK4A 4MZUA 4YNIA 3AXDA 3P1IA 2CGPA 1WD4A 2HWC2 1MACA 3WV6A 2J1TA 2R071 4AQSA 1YYNA 3AKQA 4N53B 3ETPA 4P08A 5FZLA 4AVVA 1POQA 4AW7A 2RS31 3HNBM 4GALA 1A8DA 4LXLA 4PLOA 5F5CA 4L0PA 4P02B 3NSTA 4M3CA 3R05A 3Q8AA 1E5RA 1VMHA 2W52A 3BN6A 4QXKA 1UIJA 2WAAA 4X6QB 2ZX0A 1TME1 3L2YA 2JIJA 3KB5A 5FP3A 4XE9A 3FFQA 1H1MA 5LBCA 4OLLA 5EPAA 1ND2C 1XU2A 5D8AB 5D21A 2DUOA 2X5IA 3FUQA 5A7QA 4F3JA 3LDRA 5K0UC 2GN7A 2MNGA 3FLRA 4Y22A 5KHGA 1H2MA 2PHFA 1RTVA 2BUKA 4ISQA 5I8SA 1QQP2 3U10A 4EN6B 3I2OA 2GALA 4RSUA 3IBMA 3PJYA 4KMQA 3WVJA 3O14A 5KWRA 3UGHA 1W3VA 4QM9A 4BXSV 3Q8FA 1CZSA 3I49A 4XFIA 2TUNA 4Q4Y1 4CU8A 4GB33 3M2MA 1OOPA 4CP9B 3O1RA 2JDPA 5CFDB 1X82A 2YMZA 2BERA 1W39A 4XHXA 1NZCA 4M4PA 2EALA 2EIBA 2JEMA 2VMCA 1NLRA 3QBQA 3RMYA 2QTWB 5A3MA 1CAUA 1NCQC 2WA4A 5IVFA 3RZGA 2R1BA 5F5IA 1XPWA 3EMRA 2ARXA 4O9EA 5DG2A 5FUIA 2HEVF 4TZDA 1AX1A 4LE3A 3FLPA 5FYBA 2H6BA 1WLWA 2L9LA 1RUH2 3N9LA 2P34A 1QH7A 4FCAA 1UOGA 1VR3A 2D6NA 2JD4A 3G6JB 3LOIA 3MPBA 5A3PA 3ZXLA 3DKQA 1OOPB 3ORJA 4IW3A 2Q8EA 2XUMA 4K21A 4QX7A 4DY5A 3ES4A 5C7GA 2D6LX 4RGGA 2VUDA 2BEOA 4MXWB 1J84A 3CHXA 4XF9A 2Y6FA 4AEDB 5C71A 1VBA2 4HONA 1JZ7A 1VBD3 4QHZA 4ORFA 4Q0PA 1D2SA 5IW0A 2WNEA 3FFZA 2ADEA 5A1AA 2X5IB 5JAXA 3WCRA 3E5XA 2P37A 5IVCA 4J6GA 5L9RA 1XSQA 4V2WA 4HVQA 2OXBA 3OG2A 1ASJ1 1XYOA 3W58A 4AFBA 4M3CE 3IDAA 3AYAA 4UF0A 1CAXA 5JR2A 5A70A 1ZRDA 3R0RA 2KXLA 4FOYA 4MYEA 1OLMA 3C7FA 1N1SA 3M7AA 3V0AB 1DG6A 3LWCA 4Y1XA 3NRUA 1URXA 5I8TA 1IS4A 1HB2A 4LIVA 4LBQA 4QKBA 1HRI2 1G8WA 1GP6A 1NCQB 2X09A 5FZEA 2ZGTA 4DINB 5HBAA 2ERFA 3K3OA 1SLLA 2OUHA 4YG6A 5L19A 4BIFA 1R083 1K12A 3OBZA 4Q0QA 4UT5A 2WYFA 1OLME 1WCQA 5LB6A 1V6IA 3S5QA 4LITA 3VBHB 3I97A 3DXUA 4LHKA 3MGUA 3O5SA 3APBA 3IIAA 3GXUA 1GWKA 2YFZA 5FPZA 3Q8EA 2YU1A 4DUVA 5L7OA 4GMP1 5C3PA 1F5FA 4MVTA 1S2KA 4QGLA 4XTPA 4AEDC 3B5LB 4AHWA 2NM1A 4NMIA 3LEMA 1XNAA 2WINB 1HXS2 2Y0OA 2Z4FA 3POFA 5KHHA 3H9AA 3I2JA 5E16A 5BNNA 4YG0A 1W9TA 1PVC2 1RIRA 3N3HA 1YO8A 2G19A 3T1MA 2XQXA 5APAA 1IZ3A 5JPMB 1MVEA 1O59A 4N43C 3WSOA 4PIXA 3LPGA 3LD8A 1AL23 3M8LA 2NMOA 5FQ0B 1B09A 5CKNA 1DGWX 3HVDA 4CDUC 3O1TA 2FCTA 4AE2A 4MG2A 3WR0A 4R4ZA 4FQ4A 3BIEA 4I3PA 2D3SA 4PBPA 5IATA 2BNMA 2HWE2 4YZ3A 3UNPA 2XKOA 4FPCA 1FV3A 2VVDA 3PUIA 2ZACA 3QH7A 4I0AA 4IE6A 3TNPB 3WQBA 1CX1A 2PHLA 3DF0A 4RL7A 1RITA 3ZOIA 1RVF1 2W92A 3D8CA 5KC5A 2R1DA 3T0BA 3EBRA 1W0NA 2V73A 4PLNA 1W06A 2AEYA 2D5HA 5FUNA 3WINE 3MV01 1UX6A 4F8AA 3ZXJA 4BA6A 2V5YA 3OGGA 3ILNA 5FZIA 5JMOA 3RPQA 3RVHA 2WSVA 1B35C 3POBA 1REEA 3PVOA 3SH5A 1Y3TA 4QXBA 1HN1A 2A6WA 4HL0A 2PLV2 3I3QA 5LW9A 4E2SA 5F6LB 2Y60A 4PQ9A 3VHNA 3V0AA 3KSCA 4DB5A 2ORZA 2WIIB 5L9VA 1WMDA 2XXZA 5FKCA 5BPXA 2DUQA 1UNBA 5K4LA 4DRVA 1TZOA 2ZX4A 3LEKA 2AEZA 3LDBA 3SITA 3NNGA 5CYYA 1OC1A 2ZGLA 4HKLA 2WO7A 3WP5A 2BGPA 1MS1A 4JQRA 1W90A 5DZEA 5IT6A 3ZFEB 2YHJA 1KITA 3I3BA 3CL1A 2VW2A 2E32A 4O7XA 5F8PA 2VVEA 1ZBA2 4Q27A 1COV2 2R0HA 1TQ5A 1RUE2 1PHMA 1RUI1 3LA2A 5FJKA 1OA2A 3BU0A 3N7JA 2BU9A 1O91A 2FDJA 3ZN6A 1ZNPA 1BVVA 4GJYA 3OUJA 4AEMA 1VBC3 2RVAA 3FLTA 4PI2A 4XFHA 3BB6A 4AF9A 2G9GA 4EWEA 1QJY2 3MLLA 3SEEA 3WW1A 1QJX1 4CDXB 5KC6A 2WZR2 4Q1RA 1KDMA 3WUCA 1HV0A 4TYSA 4CCJA 4N90A 2FZ1A 3CLPA 4Y26A 1J58A 5HXMA 2C26A 4NPRA 4JGYA 4OI2A 5JZGB 5A3TA 2I07B 2VG9A 1F4AA 4E2QA 1OBNA 2HWF1 1PO12 1JN2P 5D1IA 5A6QA 1MZEA 5JZGA 2A71A 1VBB1 2A6ZA 1QIQA 1ZA4A 2J1SA 4JGZA 4YLZA 5F5AA 3RRDA 1UOBA 3I2HA 5A1LA 4G9SB 4BK5A 4DXZA 2IXJA 3CU7A 1UAIA 2WL1A 2YBSA 1DGRA 3USSA 4WBBA 1OURA 1ZZ8A 4EN0A 4Q4X3 1DZTA 5DAVA 4ES9A 5JPNB 4FP2A 2GC1A 4LR4A 3LSEA 3OTFA 2R063 3QCWA 4GB31 2DVFA 3VBUA 4B8EA 2CHHA 3J7LA 4CEYB 4MGTA 2VQAA 1PK6A 3OPWA 4RR3A 1FT9A 1ZRCA 4CE8A 1R091 2GZWA 5H9RA 4S2FA 3NNLA 1LOCA 1XRUA 4PCRA 3GJAA 3GJBA 1UZYA 2P1BA 2R6QA 1V6OA 3IN9A 4E27A 2PN5A 2ZGSA 2VXJA 2MEV3 1MS5A 3GCWA 3LA3A 5J96B 2WSUA 1JYTA 3H1WA 5FMDA 4JHZA 4N43A 1XNCA 1O6UA 4NAMA 1QKQA 2SLIA 4PJYA 1NA1B 4FPLA 1XBFA 3MIDA 5AFBA 4QU2A 2RR13 1GMMA 2JDUA 1RB8G 1REDA 2WNVA 4U2AA 1OQEA 4L9BA 5FP4A 5FZKA 3VHOA 5IUQA 1QJZA 3WZ1A 4MXVA 2VTXA 4IGPA 2PA7A 4AI0A 3PUSA 2O1QA 4Q4V3 3AZWA 3T2OA 5F9TA 1F15A 1ZBA3 2E26A 4JTOA 3N7MA 1RHI3 1DLLA 1OFSA 4R8HA 1OQ1A 2CSGA 1B35B 1LENA 4IE5A 1QY4A 4Q4W1 1PMHX 3O1PA 1LAJA 3KD4A 4WZCA 3AMHA 5F6KA 5J36A 3TEZA 4LT5A 3VL9A 4ISRA 4Y1YA 3ZN4A 3C3VA 1I5PA 4MLOA 4DUXA 1RMU2 5FP9A 1ZBE1 2JDKA 3C8XA 4JDNA 4P14A 4NPMA 1CJPA 3GHMA 5DAQA 1W03A 2VQ0A 2W39A 2AH2A 3AP7A 2DYCA 4QDRA 5B4XA 5LK5A 2CV6A 4UW5A 1SG3A 5CAZA 5LCWL 3FX3A 4ITCA 1T6GC 2VECA 2Y6LA 1BEV2 2WT2A 4IV1B 2WFF1 4XIOA 3UK9A 3WNNA 2B45X 2RDSA 4QX2A 3OCPA 2C6SA 4IEYA 4RYDA 1YQ2A 5FQ0A 1V9U3 4BPZA 3NJVA 2Q4SA 4LA2A 1OXCA 1NYWA 1SBFA 4RHV1 4YWAA 2XUEA 3VBRC 4CDXC 2NZ9A 4GULA 1AXZA 5CEHA 1A78A 5ACA3 2WS93 1KRIA 1S0BA 2EIEA 3ASIA 4CDQB 2AGSA 1LODA 3T2PA 4V2VA 4N8MA 3WP6A 1DU3D 1BYHA 4KNCA 1X9TA 2ZAHA 4COWA 2EVXA 5JZGC 2YGLA 2R16A 5F39A 2RMU3 4A44A 4COYA 1AL22 3WHUA 4GQ7A 5GLWA 3VZOA 3MF6A 5I0UA 3ZVXA 4A2UA 5C4WB 3W5NA 5I91A 4QX0A 4XDOA 3QH6A 5LBFA 1H8TA 1YJKA 2BJSA 3OSDA 1CZTA 4GH4B 2VU9A 4Z82A 3A4UA 2UWBA 3IWZA 1IS6A 4HK8A 2Q8OA 5A33B 1VAKA 1UYZA 1X9PA 2LTNA 5GKAC 3THTA 2O8QA 1GOHA 2P2KA 3NWKA 4UBHA 1G9DA 2RM22 4NO4A 4MV2A 5CADA 2J1VA 1K5JA 3D82A 2VOKA 4PQQA 2ES3A 3TBDA 1ZBE3 3A7QA 3MIFA 3AYDA 5FZCA 2F17A 1W2AX 5EJZB 4IL7A 5FP7A 3VZMA 1RUJ1 4DY3A 2EXIA 1VPHA 2FCVA 2KM2A 3AKRA 3ZKUA 2X53S 1ULDA 3AP5A 3CIHA 2WZEA 5FLJA 1ND2A 3PTRB 1MR5A 1FATA 2R30A 1OMIA 3ALQA 2VPVA 4TTGA 3WT3A 1YJLA 4UFLA 1JU3A 5FZ6A 1HLCA 2BGCA 3WDVA 4CDQC 5T55A 2P3JA 1GP4A 3GBFA 2J42A 4L8QA 4LK6A 1BMV2 3PNAA 3JZVA 4W6XA 1SLIA 1AZDA 1H2LA 3EHKA 3OD0A 1H8VA 4RFRB 1OOPC 1SQ4A 1LOBA 1AJKA 3WCSA 2N7GA 4K9SA 5FY9A 2LROA 5H9SA 4EWAA 2NN8A 2RM23 3MEPA 5ABJC 1N1VA 1WCDJ 4ZONA 4YW7A 1BK0A 2WRAA 1UMIA 2XJQA 5BYNA 2AREA 3KV6A 4GH4C 4HVRA 1H1IA 2QQOA 4UBGA 1Z7S2 2MEV1 2X5IC 1VBA3 4HT1T 5J7MA 4EZ4A 1K45A 4DXTA 1KFUL 2KR2A 4NWVA 4AFDA 2QQWA 4EV0A 2RDNA 2GMEA 2C1FA 5FY4A 4Y5TA 5CFDA 2Y34A 3E5QA 4BZ4A 4BISA 2BQPA 1D4M3 3K4ZA 3EYPA 3J7NA 3MDPA 3RQ0A 1SLCA 2XWJB 5ACA2 3NNJA 4CU7A 4CEWB 1XNBA 1D4M1 4XF1A 2W46A 4Z07A 2W5FA 1ZZ7A 4H2AA 3SNMA 1FMD1 1H4HA 1VRH1 4Q4X1 2H0BA 4Y20A 5FUPA 3SKJE 3VZLA 1AR62 2JJ6A 4XBLA 4QGNA 3BGAA 4E4ZA 2I74A 1YQ8A 3ON7A 1PGL1 4YGDA 1PO22 1ZYBA 2HBTA 3HQRA 3GZEA 4XFAA 5IVBA 1DZQA 4MOAA 1ZZ9A 3LFIA 4I09A 1QNWA 1EV13 5C8WA 5T5OA 1BBT1 1GOGA 3UJOA 3H8OA 5BNOA 1YIFA 1BXHA 2V4AA 4LKEA 1NY71 3FC0A 4LBOA 1W8UA 4ZZ5A 4HANA 2WFPA 5BNNC 4ZU4A 2W9XA 3KZ4C 5A1FA 1Q8OA 3GBGA 3GDBA 3S0MA 4AEJA 2P6CA 2PHXA 1DHKB 4WM8C 3ZSLA 4F83A 5FDBA 2YB7A 4X8NA 3M3CA 1YXWA 3IMNA 3D0SA 1MQTA 1JYXA 3BCWA 4Q5OA 2BNNA 2BWAA 4FXGB 4AQ6A 1JZ2A 1PGW2 1DQ2A 5JLVA 3MW4A 4OVEA 3TWIA 1KS5A 1S0JA 1UU4A 4NHLA 4QXHA 3SHRA 4DO0A 1GNZA 4A3XA 1GZWA 2JDMA 1UU5A 4IE0A 4LBNA 4A45A 5BNPC 2ZOEB 3FHAA 3LDKA 4XW3A 1VB4A 5CFCC 5FZDA 3BOWA 3IAPA 1ULGA 2XJVA 3GHNA 4QX3A 1POV1 3CJIC 1RGSA 1EAH2 4IEWA 3JBG1 3RZJA 3AXEA 1SLBA 2YG0A 1DFQA 1VBE1 1R1A2 4XF4A 5A7SA 3I3MA 1NLQA 4LO7A 5GLVA 1WW4A 3MIEA 5FYTA 1M4WA 5CFCA 1W3XA 4LOTA 2JE7A 3LA7A 4YVSA 1F9KA 1UYXA 3VHPA 4XFFA 5BV6A 1EV12 1X7NA 5CVRA 5L9BA 1KGYA 1OH3A 1VRBA 3ETQA 3RWNA 3TN93 5FPUA 1YFWA 4YM1A 2WZ8A 4BQ2A 3O0VA 4FPGA 2HWB1 2UYAA 5FYHA 4D6RA 1MQTC 1UY4A 3ZDVA 3B3QE 4IV3A 3J26N 1QH6A 2B39A 1JOPA 5I0SA 1W8TA 4IEZA 2GNDA 1UOFA 3A23A 5CKMA 2FDGA 2WS91 2IXIA 1KFXL 3U1XA 4HOOA 1GP5A 1KJLA 4CP1A 1DP0A 2AR6A 4BB3A 1GV9A 4IV3B 4NHKA 1G9FA 2R49A 4ONUA 5FAXA 4OHZA 3U11A 5C8CA 2Y8KA 2PHRA 2SBAA 2XLGA 4OHXA 4XXAA 1VAVA 3VHRA 5IK8A 4CCOA 2J1AA 3ZFGA 2YC2A 4Q8KA 1MEC1 2YZ4A 1TMF3 1RVF3 2ZKNA 2MHFA 5A32A 2A73B 2PHDA 2XOMA 3UJQA 3X29B 4DMIA 1NCQA 5I0DA 5E1RA 4LBQB 3B93A 3NL1A 4R9BA 1JYNA 4PLMA 2HWD3 4SBVA 2QKDA 1LHWA 2E53A 3V56A 4GKXA 3ZYIB 4C91A 1H6YA 3I7DA 5FZ8A 1WW5A 2XBO1 5CKQA 3RMXA 1QXRA 2W2IA 2WBKA 2ZGOA 4LE4A 4QWNA 3H7YA 5IJRA 2GDFA 4RFT0 5HI0A 4QB6A 1C8M2 4XJZA 1PGSA 4ATFA 4XACA 2HJIA 3H3ZA 2OZJA 3K3NA 4QU1A 1F35A 3TN92 3G7DA 3M3QA 4Z2AA 1OPMA 3DPRA 3IPVB 4PHZA 3VD7A 1QGLA 5FBZA 5J09A 3S57A 2VTXJ 4ASKA 1IQAA 4Q4W3 1RINA 5DDJ1 1FI2A 5FZOA 2NQYA 4FP3A 5IHRA 1WLTA 1SPPA 4A7YA 2VNRA 4Q0VA 2IVIB 3ZYFA 3ZXAC 3DCQA 3M70A 4XJ8A 4IQPA 1DQ0A 3IAQA 4Q4V1 1PZ9A 5C4WA 3O1SA 1MS0A 1YEWA 1LOAA 1Q8QA 1W9FA 1O7FA 1JXNA 1XXNA 4XUNA 4ZPIA 3ZO0B 4M0NA 3WQ1A 3W5MA 3S5AA 3JQXA 1R081 5JR7B 4CUCA 5FZMA 1VB2A 1OA3A 2QQNA 2AACA 3UT0A 2D43A 4CDQA 3HQUA 1RUC2 4UFIA 1UO9A 3HBKA 5T5LA 2VMFA 5FY5A 1AR93 2WNVC 2ZEWA 5C70A 3AFKA 1NX9A 3WG2A 4D6QA 3POSA 5T52A 1W2OA 3UGGA 1RL3A 1NCRB 2RMU2 3ST7A 1AR92 3T2TA 1WCSA 1DQ6A 4AYUA 1AR71 4FO9A 4OI4A 1J1LA 5AC91 5ANNA 1GOFA 1V6NA 2W1SA 2W1UA 2F4PA 2WJSA 4Y24A 4MUVA 4IV1A 4X8PA 5J98B 4AWDA 1WMXA 1RHI2 5JI9A 5JOWA 2QQJA 1AYN1 3HPNA 1V6KA 3KV9A 4G3YC 1P8JA 1DYKA 4CP0A 5D8AC 3PIJA 1DYOA 1W04A 2VBDA 1H8TC 3NW4A 4I30A 2OKXA 2HEYF 3MYXA 4HVOA 4QXCA 3POJA 4OMDA 1I5ZA 2XVGA 3BPZA 1UX7A 5B4NA 4M4RA 1H1AA 1PVXA 3OUHA 1OKOA 2ZPXA 4BM8A 4LBJA 3ZYPA 5CG8A 2RS51 1LEDA 1IKQA 1BKZA 1PIV1 2RHPA 3M3EA 1C8M3 5EHDA 2VNGA 1FPN3 4E9KA 2D5FA 2F4LA 5FZFA 3U37A 1AR63 4LKFA 4P9LA 3OB8A 2XJSA 3WG3A 2J1EA 3KM5A 4OYUA 2PXJA 3RS6A 3ZXGA 4D94A 1FPN1 4LK7A 1PIV3 1QMJA 2IFWA 1BK1A 2Z42A 3NNFA 1RXFA 2HWD2 2OPKA 2RS53 3KT7A 2E6VA 1VLNA 4LPLA 2VULA 1HXS3 2WKKA 4KL1A 5F37A 5LEKA 2RDQA 1ENSA 3IMMA 4UF0B 2DVDA 4A3ZA 1CIWA 1PNFA 3IDEA 4JX0A 3RGBA 3MV11 1O3TA 1YQ5A 1OLRA 3AP6A 2AZ5A 4E4DX 5BUVA 4LBLA 2EXKA 3NAPC 1F4HA 2VUCA 3VD3A 1KS4A 5GJ6A 2D97A 4CSWA 2XH6A 5DN2A 1LULA 2GH2A 4HFSA 2BFUL 1OUSA 2P3KA 4H14A 2HBUA 2WWUA 5G05L 1XB9A 1K42A 3RZZA 1GNHA 1LOFA 3TYJA 5C9AC 5JXIA 2FDFA 2ZX2A 3H8RA 1HRI3 1O5LA 1E5IA 1Y7BA 3VD5A 2A6YA 1CESA 1G9AA 3HJRA 3HD8B 1JYVA 2P5BA 5FYIA 2E33A 3FBMA 1FNZA 1MS4A 1VJ2A 1SDWA 2J22A 4QX5A 3WDTA 2FZ2A 5FR3A 1KXGA 3VDDA 1QEXA 4DFSA 4OUSA 5EWSA 4JGZB 2XLAA 4GXLA 5A3NA 1HQLA 3AKPA 3D4KA 3OY8B 1VBC2 3MHZA 3SH3A 3HNYM 3KVAA 1U5ZA 1WMFA 3ECQA 3OBRA 5AVPA 3VBFA 1PM4A 3N35A 3T4VA 3AMMA 1RUF1 3H1MA 3USUB 3VKMA 2VVFA 3B02A 5C5TA 4XOGA 2R041 3BODA 4TLFA 4JKKA 3MBWA 3S30A 1ALYA 3ACIA 3C2UA 3RI9A 4ZZ8A 5JOZA 3B7MA 1JYCA 3POEA 2D93A 4BLIA 5BY5A 5JXHA 1QOOA 1IQDC 1SFPA 2D6PA 2DUPA 5DDJ3 2TBVA 3POGA 4CCCA 2ZX3A 5IFTA 2YFUA 2ZKLA 3HBZA 3LF7A 4Q29A 3KQRA 1WA4A 5E6HA 4CU9A 5C3OA 5F2SA 1OKQA 4JDOA 4HN0A 4CCEA 1O3QA 3FMGA 5FWEA 1PK6C 4RR3C 3ZPYA 4AGGA 1WCUA 1LHUA 2VUAA 4E4HA 4M00A 4B3NA 1ZX5A 4IEOA 5FK7A 1UD1A 2VM9A 1W8WA 2BWCA 3SMHA 4KQ7A 4FTBA 1AJOA 1JHJA 4YZ4A 3ATGA 5EJ3A 4BXFA 3U75A 1Z78A 2YV8A 1V9U2 2A3XA 3OGRA 1N3PA 3VBSB 3ZR5A 2RG4A 1NUKA 2QQMA 2XL7A 4AG4A 2WT1A 4UW4A 1XYPA 1JZ4A 3AP9A 2B9UA 5FPVA 4XUTA 4YVWA 2KD7A 1W0OA 4XCBA 5E88A 2UYBA 3Q8CA 1H8TB 2J1UA 1TNRA 3D3AA 4RGAA 1AR81 1W8NA 5KBFA 5FZ7A 5A7PA 5L36A 1J3RA 3U07A 2W68A 5I8YA 4DRRA 2AUYA 4ATEA 1DGWA 2G4IA 3KCXA 1ZRRA 4PIZA 4QHBA 5F3IA 2IC1A 1NXD1 5T5PA 3MIHA 1H9PA 1NCRC 3K46A 5GZFA 3VDDC 5FXXA 5J3UA 2BPA2 3B00A 1EPZA 3D5OA 4XILA 3JXSA 1V6JA 3ZKYA 1WCKA 2PQQA 4OQ9A 2WQ4A 2OA2A 4XMIA 2XR4A 1W99A 4JKMA 4KWUA 4ZKTB 4CEWC 4AVAA 5JMCA 1S0GA 4CDWA 5H9PA 1IGOA 4Y20B 2GP5A 3DN7A 2YYOA 4PDWA 2W87A 4GJZA 2W1WA 3ZXDA 3NMBA 4N53C 3MF9A 4D6SA 3I2DA 3WLUA 5KXBA 1UL9A 1UF2C 1YNAA 2VMEA 4GWIA 2O0OA 2XLFA 3I8TA 1V70A 3E6BA 2WO3A 3J7MA 1K5MC 1US2A 4QB2A 5JI7A 3VBOB 2GC3A 3VBSC 1LECA 5C3SA 1VBD1 4B7KA 4MX3A 4Y1ZA 4YFZA 5AFEA 4FPOB 1UZVA 3S7EA 1QJFA 4XIKA 4RN5A 2DBIA 4QPIB 1JZ6A 2GNMA 4LA3A 1SEFA 1GNYA 1HB4A 1ENXA 4GKYA 3M3OA 3NKGA 2RS32 4BU2A 4QQPA 4YFWA 1CD3G 3JU9A 2OX0A 1S1AA 5DAXA 2Q5TA 3E6DA 3RI8A 2CYFA 5A7WA 1FNYA 2HH9A 4IETA 1Q5OA 4NWWA 5SV5A 3WNLA 4HPKA 5J37A 4BQ4A 4ET7A 1TME2 1UMZA 2CY6A 5CB7A 3UGFA 1MZFA 2Z2SB 5CBLA 1ONAA 2R062 3U14A 4W8JA 5B2GB 3NV2A 1W6NA 2EAAA 4CA9A 4XEZA 5FZGA 4N9IA 4QPYA 4C0BA 1L7LA 1CVNA 4AFAA 3J8F1 4QKNA 4CDXA 4AQTA 4LO8A 3VDCA 3ACFA 3NAPB 4FFGA 3N9PA 1MS9A 5KR7A 2NP0A 1WW7A 4Q4Y2 2WNUB 5JIAA 1Y43B 3HT1A 2G9ZA 1O4ZA 1HRV1 2Y0IA 3K75B 1C3HA 5FZOB 4AAPA 2ATFA 1ST8A 4I02A 4XF3A 3VKLA 5HCBA 3V0BA 4Y4YA 5DAWA 1US3A 2JENA 4L99A 1E5SA 1DDLA 2ET1A 1C4RA 4FTSA 2JB4A 4FPFA 1HIXA 4HBNA 2ID4A 5FXZA 4ASLA 2ZHMA 5EZWA 3V0BB 2VMDA 2VCAA 1RUG1 5CU1A 3VD4A 1A6CA 3IM0A 4KG8A 1GU3A 2DTYA 5FOJB 5AC93 5GLTA 4XETA 1AR73 1C1LA 2WNUA 4HN1A 4QB1A 4EE2A 5LA0A 4L11A 1UOJA 1K3IA 3RDIA 5F3CA 5DABA 3QACA 3E5UA 4LLFA 3ACGA 3P6BA 2R073 2GMPA 2ZZQA 1XNDA 5IYYA 1Y9GA 1S0DA 2ILMA 1HN0A 2IZWA 2WZR3 3I54A 4H7MA 5L7OC 1VBA1 3KS7A 1BJQA 3P3PA 1MZ6A 2VZUA 4HXCA 1E57A 3AM2A 2X8KA 4P9IA 4CU6A 3ZDSA 1O8SA 2IVJA 2XMLA 4I01A 2R32A 4XQDA 1FOD3 1I1EA 4IE7A 5A80A 1J83A 4MGZE 1OPOA 1UXXX 4NIIA 2JIGA 3OPTA 3GM8A 2W1QA 3T30A 4AGVA 3VD9A 1RMU3 3JD71 1W6QB 4XURA 5FYUA 5E89A 2Q8DA 4BMBA 3LKJA 3VDDB 5GZGA 1JW6A 1NKGA 4META 1OH4A 4LTAA 4PT6A 4C1WA 1FOD2 2JDAA 2RS11 1JH5A 2PAKA 1UY3A 3H7JA 3MLKA 3N9NA 1QJU2 2HYKA 4IE4A 4CXWA 1IS3A 1W8HA 1X50A 2E7AA 2UWAA 4K1ZA 3RYRA 4DUWA 2BRTA 4X6RB 3GZUC 3MIGA 4UI9L 2I45A 2OQ6A 5DG1A 5BNQA 4Q1PA 1W2TA 2VZQA 1IPSA 1Q56A 4UWDA 1C28A 4R9CA 3ZXKA 1LKNA 2XBO3 4Y22B 3KVBA 4OI1A 4YRDA 3WF3A 2D3RA 3NJZA 4QT6A 1GZCA 2UWCA 2CAUA 3POIA 1CN1A 3AZZA 3AVRA 3BVCA 1RC6A 3KT4A 4BOWA 4D3WA 4IGOA 2EICA 3H1YA 2W47A 1VAMA 2WQZC 3W9AA 4XQWA 4QPIC 2ZBJA 1PVC1 2VZOA 1AYM1 2VAUA 3M1HA 3SEPA 2ZABA 2JDYA 4Y4RA 1KDKA 4OI0A 1QQP3 1TMF1 4XDPA 2V72A 3I59B 3LE0A 2WNVB 4FFHA 2QZ3A 4QPWA 3R6SA 2Y64A 1BHGA 4Z8BA 2JE8A 1BLZA 4A6OA 2ZEYA 3AKSA 2X05A 2HWE1 4QKDA 2RV9A 5GM0A 1CAWA 1UN1A 3BOPA 2ZHLA 3O0XA 4YVWB 5FLIA 3NKTA 3ZYGA 1ZZ6A 2H6CA 4AQ2A 3NV3A 1OVSA 4HMZA 3DPRB 3IPVA 1S0CA 3I3DA 2Z79A 1JZ8A 1RVF2 1OVPA 1S4CA 2JWPA 2VZRA 3N7LA 5BXXA 2HWC3 1N3QA 3KHCA 2D40A 2OVUA 2VL4A 4L2NA 4B4PA 4CRQA 2FDKA 2RR12 2NMNA 4C8DA 4P9GA 1N3OA 3C7HA 1C1FA 1CJDA 1BQPA 1UZWA 2WA3A 3N36A 4GA9A 5K0UA 2TEPA 4YW5A 3SCFA 3TNQA 3LOBA 1XNKA 1RUOA 4Y5Z0 3POWA 3UV9A 2EA7A 3MUZ1 4CEWA 2XKPA 3JBG3 4QDQA 5JSPA 1NQDA 2PLV1 2ZTNA 4IERA 5SV8A 4CP2A 2GC2A 3R4DB 5A32B 3ACHA 3WEZA 4MSVA 2O8OA 1HB1A 4XAAA 5HXVA 5EQUA 2QQIA 1IS5A 1JOBA 3UESA 4BQWA 3U78A 1CPNA 3HT2A 1JUIA 4BH9A 5CA6A 3DL3A 1W6QA 1A3KA 4CPBA 1EUTA 4A6SA 3ZM8A 4A4AA 3F2ZA 3K4DA 4GMP0 3SXWA 1WMEA 4AVSA 5JOYA 1COV3 1G86A 2BP6A 5CNAA 1F5JA 1ZBA1 3AYEA 4OZOA 1OA4A 4PF1A 3O1OA 1RXGA 2RJ2A 1COV1 3AC0A 4QX1A 2IXKA 2Q30A 1RUE1 2Q1FA 3K51A 1RUI2 4JVAA 3FN9A 3VKNA 4FFFA 5DUWA 3WG4A 1HB3A 2QVSB 4AZZA 1QXPA 2PMWB 3AP4A 3POYA 4QX8A 4AVBA 4EJRA 1UIKA 1LR5A 1F8VA 1DBNA 1LGBA 1SPPB 2DU0A 2ZMNA 1TEIA 4LKDA 3VBFC 1QJY1 3AKTA 3T2QA 2W3JA 4BCUA 5EJ1B 1HQNA 5HPOA 3E97A 5C9AB 3PVEA 4JAAA 4MADA 5FRAA 1JS9A 4KBZA 5IK5A 1IKPA 4LMFA 3WNOA 4MHRA 3VB9A 1G7YA 5D2AA 3VBUC 2ORXA 4FVVA 4PBOA 1CAXB 2D98A 1HJGA 2AENA 3O1VA 5FMOL 3EJKA 2HWF2 1PO11 4YGEA 1VMJA 3BUCA 2LS6A 1QJY3 2GMMA 2DCTA 4M01A 4W6WA 2YUEA 4RS5B 1REFA 1HRV3 4M3CB 3ZFGC 4JGZC 2Y6JA 4FXKB 4ZXKA 2DFCA 3BPSA 4MHUA 5JSOA 1VBB2 5A33A 4DEQA 3CO2A 4LHLA 4AHXA 5LRSA 1NOVA 4KGQA 4MXWA 4C0HA 3N9MA 3WX5A 1UCXA 4GWMA 4BIOA 2A6VA 1RUD1 4P5HA 5HCHA 4JGYC 4OUMA 4L97A 5J1XA 1QJU3 3E1F1 3R4UA 1UY2A 4Z1VA 4K6BA 2XONA 3B9CA 4NHXA 5C8CB 2W0XA 5F32A 1WW6A 4ASMB 5BNOB 1MVQA 3O7OA 2A7AA 3TOJA 3H0OA 1NAEA 3FUOA 3LCPA 2E63A 3MFCA 4UOJA 2VZTA 1UU6A 3OGSA 3I2KA 4NIAA 4CTEA 5LY1A 2QQLA 1W9SA 3BTYA 5H9QA 2ENRA 4YYOA 1J3PA 5IWFA 5A7WB 3RWKX 2OT7A 2JDHA 2JX9A 3LQCA 3MLJA 4N7UA 3KLSA 3PURA 4CDWC 5C6CA 4EYUA 5EYYA 5K8SA 4JRLA 1LB2A 1QF3A 1RUJ3 3JUUA 4FBFA 1UMHA 4BQ5A 2JKBA 2CDOA 5JIUA 3SISA 2HWC1 1ZVFA 3WUDA 4BMEA 1NCRA 3UKNA 5T54A 2R072 3DUIA 3SLIA 2A75A 4GD4A 3O1UA 1OSGA 1N1TA 5D8AA 2QUOA 3CJIB 4Q4W2 3TRSB 1C5HA 2C9AA 2WZPP 3NV4A 2RS13 4ZY9A 4S2DA 1KD7A 2PFWA 3BU7A 4NIDA 1DLCA 4IV1C 2OUJA 1A8MA 4DS0A 4HG6B 4UW6A 4CVUA 3LFMA 1W6PA 2DFBA 1RMU1 1ULFA 2ZGMA 3JD73 3OYWB 4QM8A 3VBHA 1H4GA 4XJ9A 1ZRIA 3OJBA 2XDVA 2WDBA 3DYOA 1U0AA 1CAWB 2CNAA 4IEPA 1QQP1 1AR83 2BW8A 2JECA 2UY9A 3CEWA 4R52A 4CUGA 2VBBA 4COVA 5FZ9A 4LNVA 3GGLA 4WVWA 1F2NA 4XDQA 2ZZJA 2E31A 4I3GA 4EN7B 1O8PA 2UU8A 1JODA 2ZEZA 2ZGUA 5DMYA 1UKRA 5FY0A 2DCKA 3DYMA 1RUD3 5FK8A 4GZ9A 5ERLA 5GLZA 2Y6GA 4ZXEA 2BVBA 2JE9A 1WD3A 3KV5A 5FY8A 3ZXEA 3ZFFC 3ILFA 1CX4A 4XAEA 1SMVA 1CWPA 4LJHA 1IPKA 5G04L 5FBJA 1R64A 3BKZA 3OOXA 1OD3A 4XUOA 4OMCA 5FPXA 5C4WC 3RZKA 3RYPA 3MW3A 1TG7A 2ET7A 1ENRA 5KXEA 4JTNA 3QOPA 1RUG3 1V0AA 1SDDB 2PYTA 2D6OX 2D7FA 2VTFA 3SH4A 1RUH1 4A7ZA 1SCRA 5LBBA 4CEYA 1YRZA 3KWVA 3BALA 3PUQA 4GH4A 1GICA 2CL2A 4Z2WA 2GN3A 1AL21 2IXHA 4E4SA 1FAYA 4QDSA 3VKOA 4COUA 1JTZX 4RS5C 3ZFGB 4BLJA 1D0GA 4KH9A 4ARXA 3M4FA 1S0IA 5FY7A 3I2IA 4MGKE 3ZFFA 2JG8A 5AVAA 2EIGA 3ZIXA 1J59A 2WNOA 1W6NB 3E6CC 3LSDA 2K46A 1WUVA 3OGJA 1UZ0A 1ASJ2 2VMHA 2ZS6B 4UFHA 1EPWA 3KHBA 4D7SA 4EQVA 1EY2A 1W6OA 5FYSA 2IUWA 3WF0A 1VE0A 3BYWA 2WWSA 2Z5WA 1HV1A 5DUVA 3WP4A 4QMAA 2FD8A 4KU8A 4LHSA 5LWBA 3ZX7A 3ZFEC 2WLQA 1H6XA 4AHYA 2NPIA 1HRI1 1JMUB 1QHDA 2R7EB 4K1YA 4UFMA 2GC0A 3H3LA 1CONA 4AFMA 1J3QA 1OQDA 4O61A 1BMV1 4I0BA 5A3WA 5FO7B 3BI3A 5DAPA 3WQ0A 3FHQA 4M0HA 5FPLA 3GBWA 1T6BX 3KCYA 2ZGNA 3ZYHA 5HV0A 1DGRN 2K2SA 4LBKA 1C8NA 2DCJA 5T5JA 5E8AA 2W91A 4CXXA 5LASA 5A7NA 4XTMA 4BK4A 1HXS1 1NG0A 4YPJA 2JD9A 4UAPA 4WM7B 1Z7S1 3ZYJB 5FYZA 2ZHKA 3OGVA 3BIWE 4LORA 3ITQA 3TEWA 4OZXA 5C8CC 1ND3B 2ZA9A 3H50A 3S7IA 4XZPA 1GWLA 1BVP1 4KWJA 2YDEA 5IVJA 3PLQA 1AHSA 3T4HB 2QQPA 5F3GA 5A6YA 5CISA 3ME2A 2QQVA 3SC7X 2C0ZA 1NA1A 3AK0A 3VDAA 2TNFA 2E7QA 4UW3A 4ZS2A 1D4M2 3SQOA 3URFA 5TSWA 3VKFC 3CQOA 4N43B 4P9YA 1FMD2 1VRH2 4HSLA 4K8FA 3FL7A 3V65A 2YC4A 3OYWA 3I4IA 3A21A 4RQPA 1PGL2 2BBAA 3ZPOA 1PO21 3VBSA 2CAVA 2VJXA 1JUHA 4HPKB 2ZHNA 3JB8A 4WM8A 1HW5A 1GLHA 4H7LA 3D0JA 3KT1A 1FXZA 2WR9A 4NRQA 4K7JA 5DUXA 4ZS3A 4B4QA 1YCIA 5HCFA 2V4VA 1NY72 2YXSA 1GZ9A 3B9IA 1LJ7A 1V00A 3KF3A 3NNMA 4R9DA 3RJ2X 4XXPA 1CAVA 4OFGA 1MS8A 2VNOA 3Q8BA 5BNPB 5JDBA 4MGYE 3K2OA 4WM7C 3VBOA 3PMSA 3THCA 3EO6A 2FMYA 1Y9QA 4L92A 3VUOA 3U4SA 2LW8A 2B42B 4XJUA 1QXJA 1WA6X 2XG3A 3N9QA 3RYKA 5KXDA 1TME3 1PGW1 3FZ3A 2VZPA 5M0TA 1RUNA 2WUHA 5IAVA 1XC6A 3USUA 1SLAA 3WW3A 4OUEA 4DXSA 3L9JT 4NPLA 5FIXA 1H2NA 1W8OA 2RS33 3LGRA 4LEJA 1FX5A 3CZJA 3DKWA 5FTTC 1XE8A 4LBQD 1X36A 3FJSA 4P9XA 2EXHA 1W9WA 2B46X 2IFRA 2ZMKA 4BE3A 4TWTA 4LBMA 1L3JA 2DDUA 3JBG2 2LALA 4FPHA 3S6PA 1O3SA 3ZFFB 1R1A1 1XYNA 1LHNA 3OF1A 2XVLA 4FAHA 2X29A 2WQ8A 2DVGA 3GNEA 4KBBA 3K77A 3O0WA 2VZ3A 4J1XA 1AX0A 1ND2B 2KA3A 1QJX2 2JG9A 5FFOC 2WZR1 4E8CA 3T3YA 4EN8B 3FWEA 5ABJA 5FPBA 1NZIA 3VLBB 2JKXA 2HWB2 3BTZA 1GANA 2FHRA 4PIYA 1Z0HA 5DZFA 2A3YA 2IXLA 2OYZA 1MPXA 1RYYA 2VQTA 5CIRA 2BV4A 2VCCA 3ES1A 2B9VA 4P5YA 1CGPA 2P17A 1NE4A 5EV7A 2BVVA 5CG9A 4CUAA 5CFDC 4ARYA 3R4SA 3VGIA
chains in the Genus database with same CATH topology
3PTYA 1LOGA 4CEYC 2GNTA 1PO23 4PF5A 2YROA 5GZEA 1U5XA 1BCXA 1MEC2 3MPPG 1DF0A 4IEVA 1YFYA 2R043 1GBGA 4JV4A 1G9CA 4IEXA 4A7KA 1UW8A 3TB0A 2PELA 1S0EA 3CNAA 1UPIA 3DV8A 4GB32 4XQ4A 2XB6C 4B29A 1BEV3 1QOTA 3AZVA 5I0RA 3N4MA 3J8F3 4AK3A 1O4TA 1R092 2DF7A 1NA1C 3A0NA 4QD2A 2XBO2 1TNFA 2D3PA 5IK7A 4NOTA 3VBFB 2VW1A 1AX2A 4XJAA 1W0PA 3FE5A 3LZZA 2IWGB 3WHTA 1C8M1 1CAUB 3WXPA 5EFUA 4AI1A 4UXAA 5KHKA 2XVKA 3TN91 1G9BA 1VIWB 1VP6A 3D6EA 4NN0A 4FOQA 3JCIA 4BHPA 3ZMNA 4Z92B 3Q9OA 1AVBA 4DNYA 4YARA 1GQHA 1AXKA 4YGBA 1ZZBA 3NV1A 1FYUA 3H8UA 1LGCA 2VOWA 5FLHA 3VN4A 3GALA 1OLQA 2A5ZA 5FCCA 1NE6A 1ASJ3 3KCCA 5GZDA 1ND3C 4DQAA 3HAGA 2Q1ZB 4OHWA 5KHJA 5FREA 4QQ2A 2EAKA 1RUC1 1QDOA 2WT0A 2VY0A 1ZREA 1IPJA 4KGGA 1OD5A 5BNOC 1S2BA 1ZBE2 3AJYA 1AR91 4XFGA 3FHIB 4N53A 1SFYA 1MQTB 5AC92 1BEV1 5K9YA 1GYKA 2WFF2 5GLUA 1QDCA 2WLPA 3WD5A 3AMQA 4D69A 5C33A 5I0TA 2NLRA 4I2OA 4BWOA 4WVZA 1LHVA 2DV9A 3GZAA 3KMHA 4KWKA 4RHV2 4RS5A 4JDMA 4YGCA 2G9FA 3GYDA 3U4XA 4KG0A 1M06G 2A6XA 2BNOA 4Q4Y3 2WNUC 2DCYA 1VALA 1UKGA 2DTWA 1DQ5A 4NR1A 4H3WA 1AL0G 3RNSA 4ZU5A 5JSRA 2VUJA 1WBFA 4OHYA 3GF6A 3DGTA 1GR3A 4AEDA 1DYPA 4INDA 1HQWA 1QWRA 4XJWA 2CWMA 3LAGA 3MW2A 2HWD1 4AI2A 2VXRA 4QPGB 3U0ZA 2NYYA 1R1A3 5BNNB 1LCLA 3PVBB 4HKOA 2RM21 2EXJA 3HN1A 1O3RA 3SCGA 4AVCA 1WGPA 4IESA 3ROUA 4AEKA 4YZ5A 3OPZA 4Q2FA 3KGLA 1RUJ2 3IDCB 2XJPA 3SCHA 5KXCA 1UPSA 2CGNA 1KQRA 1Q8VA 4WZFA 1DQ4A 3ZN6B 3J4UH 2HWB3 2LM3A 4MGIE 2VW0A 3QLQA 1SLTA 4V1PA 1ZRFA 3WDUA 1N1YA 3AJZA 3ZSKA 2XJRA 2D6KA 2VMGA 2UY8A 3MI8A 4XFBA 4DZGA 1POV0 1QU0A 4K40A 4YVSC 1ENQA 2QCSB 1RUF2 3UL2A 2W08A 2MEV2 1CQ9A 1LESA 4QGMA 3ZSJA 4AQ6A 1H2KA 3QD6A 1V6LA 4FPYA 4M3CF 3THPA 4EN9B 3HMYA 4AGRA 1LU1A 3VL8A 1MEC3 5ABJB 1NLSA 4AFCA 5DXDA 2I2SA 1D0HA 4G4FA 2D6MA 4FPKA 1IHMA 4IV3C 3NAPA 2ARBA 2F6BA 4RQPC 5ACA1 1H30A 1LEMA 1RJ7A 4EROA 3UKVA 4HZFA 1YI7A 4Q4X2 3ELNA 1AR61 1APNA 2ZGKA 4RHV3 5EXOA 4CYDA 2GNBA 4AVTA 4YZ2A 1YWKA 1Z7S3 1V9U1 3ZN5A 2E9QA 4YZ1A 5JOYA 4JRAA 1BBT2 1LGNA 3H3UA 1LU2A 3PVNA 1QNYA 4YW2A 3ZYRA 1KJRA 4LHNA 3ENRA 2WFF3 4Q26A 5JOXA 4ES8A 4B7EA 1VBE3 2XJTA 1OI6A 1AR82 1PM7A 4YVSB 1POV3 3WDWA 1AYN3 3PJQA 3P3NA 3VZNA 3ZSEA 1W2UA 5CFCB 2HKXA 4P9WA 1SFNA 2YC0A 2PAMA 2B7YA 2YPJA 3VZJA 4LO5B 2JG9C 4PDWB 1ULEA 3CJXA 4WM8B 4XFCA 2FBEA 1MZ5A 4AI3A 5L73A 3ACLA 1YI9A 2A3WA 3ZXFA 1EAH1 1VBE2 2DWRA 4YSFA 2ZCWA 4I0WB 2VOXA 4TSVA 2DVAA 5J48A 2UURA 4WVMB 3PHMA 4AHZA 1LHOA 3HIFA 1EV11 2QJVA 3JQWA 4WV8A 1LOEA 4K20A 1GSLA 3K48A 1IOAA 4YM0A 2PLV3 3ZIWA 4EWDA 3JB4C 1FMD3 1VRH3 1GKBA 1RUH3 1I6XA 5HCAA 4D7YA 4WM7A 3VBOC 2XHKA 2D44A 2XGXA 2WS92 4RA0A 1W6MB 5T50A 1O4YA 2WC2A 4N9HA 4U36A 3V64A 2RE9A 2R061 4FOWA 2QDRA 1LOFC 5C9AA 1I3HA 1U5YA 1PK6B 4RR3B 4N7IA 3EQEA 3NO8A 2Z69A 4J1WA 3J8F2 3VBRB 3VBUB 2Y38A 3MICA 3WDXA 4F7ZA 2Q1MA 2XJUA 4LO4B 1HRV2 4H55A 2HWE3 2RJLA 1NQJA 4HK9A 2BYVE 4HSJA 4FPJA 3B69A 2BFUS 1EP0A 2VH9A 2DURA 5FMOS 4O9GA 3VV1A 4GIQA 4FSJA 1AYM3 1XU1A 2JDZA 3WDYA 3ZSMA 1DIWA 1PVC3 2HEWF 1RUG2 1QJX3 5FOBB 4JGYB 1DGLA 4HETA 4KU7A 4BQ1A 4LUKA 3AYCA 3A0KA 3VBHC 1UZZA 5DDJ2 1J1TA 5JCTA 4QPIA 4OULA 1ZZCA 3AZXA 4XBQA 3OD4A 5GALA 2K0GA 4Q4V2 4XMAA 2QFEA 4URTA 4DOUA 2Y26A 4FQZA 5F1RA 3HR9A 1R082 4LULA 5LRRA 5A3LA 1H0BA 3AFGA 4YW4A 2ZAAA 2B5HA 2XL9A 2XWBB 1S0FA 3FBYA 4COZA 4FAGA 1O5UA 1GZWB 2ZJCA 4CDWB 2DVBA 1MS3A 2R0FA 4KWLA 4AI8A 3WW2A 5KHIA 4CDUB 1YUDA 1D4VB 3PMEA 5C6CA 3IT8A 4RQPB 5KXBA 2Q0AA 2GSYA 3JD72 3ZMOA 3ZFEA 4C1XA 1JHNA 3AX4A 3TAYA 3MIBA 1RJ8A 1V6MA 2RMU1 1XQNA 2P3IA 4SLIA 1TE1B 4QQOA 1N47A 1AR72 2JG9B 4PDWC 1FOD1 2PTMA 4XPVA 2RS12 3IDBB 2PHWA 1QJU1 2VMIA 3I59A 4R9AA 1HKDA 2DU1A 4R4XA 1OHFA 1RHI1 1WLCA 3NVCA 3RG0A 1F31A 3LB9A 4JC1A 1AYN2 2AYHA 3INAA 3WW4A 1OFNA 4IXLA 2JG8C 2GH8A 1PNGA 1PZ8A 1WBLA 4W6YA 2BTVC 3O12A 4YW1A 3J9SA 1W6PB 4XBNA 4CDUA 2YY1A 2XPJA 1CR7A 3GZTB 1JYIA 4S2GA 1BBT3 5LEJA 1C5IA 3AB0A 1H9WA 2RS52 1PO13 4MH0E 1C57A 5JWPA 1AYM2 4Q0SA 2PAEA 4FOVA 4HKWA 1PIV2 4Q8LA 5DZGA 1SBDA 2QNKA 1Q8PA 3BTAA 2QE3A 1PMIA 1TMF2 3DPRC 4XHBA 4NVPA 4FT8A 4C90A 3W59A 1FPN2 2ETEA 4W65A 1ZM1A 4FPEA 3EXUA 3M3IA 3AMNA 1CPMA 3HQXA 4YM2A 3OBTA 2PHTA 4YM3A 2FQPA 1RUE3 1YLLA 1SACA 1W6OB 2QZ2A 4YG3A 4P9JA 2EF6A 2V09A 2H0VA 1AXYA 2CTVA 2ZMLA 3OY8A 2GU9A 5L7OB 2RR11 1Q43A 4XF0A 1X8EA 5DUUA 5GZCA 1JBCA 2PHUA 4B4RA 2YGMA 5F5QA 2E7TA 1S55A 1Q3EA 2HWF3 4Y1UA 3N7KA 1X8MA 4WVVA 3RJRA 1EAH3 2RJKA 3WY6A 4GWNA 2ZGPA 2QDNA 1AF9A 1LRHA 3AZYA 4Q0UA 1ND3A 4IEQA 1I9RA 1R093 1K5MB 2VGDA 3T1LA 1YFXA 4QQLA 1HX6A 1RUC3 2IXCA 1VBC1 2OIIA 4LO6B 1SCSA 1W6MA 4ZU7A 3ILRA 3MZHA 2OW4A 1K5MA 4QPGC 1U5IA 1YHFA 1DQ1A 2R042 3IKWA 1EYBA 2CGOA 2JXAA 5FO9B 3VZKA 2FMDA 1GFF2 1HDKA 1QOSA 1ULCA 4DPNA 1VBB3 1GQGA 4XYXA 2DCZA 1XE7A 4D7TA 5T3NA 1Q8SA 4E2GA 2ZX1A 3CF6E 4YW3A 4NHMA 4K3UA 3WQ7A 4JCKA 4OHVA 1WLDA 3WG1A 1LTEA 1YFUA 3KGZA 2E51A 2K9ZA 5EYXA 1YIPA 2BBVA 3CJIA 2JG8B 5K7PA 4YVWC 1NXMA 4BYYA 3MFAA 4QPGA 1RUI3 5BNPA 4FTEA 5I93A 3HWJA 4QQHA 1JOJA 1CAVB 3UKTA 1U12A 2MPFA 1RUD2 5JVVA 3VBRA 3AMPA 3WNXA 1BZWA 4IEUA 2CWSA 2ZGQA 1G6NA 3WOGA 4RD7A 2VOVA 1SBEA 5K0UB 2GAUA 2C5DA 5FO8B 4Y1VA 4HLTA 1D2QA 1AUYA 4LLOA 1X33A 1DZRA 1R1ZA 2OZ6A 4LUMA 1B35A 4CZSA 4S2HA 1RUF3 2B8MA 3B01A 1FV2A 3RSJA 1PZ7A 3WP3A 3B94A 2JICA 2A70A 3L2HA 4GMP3 2LUWA 2ZGRA 4WVMA 4AXOA 1VBD2 5IK4A 4MZUA 4YNIA 3AXDA 2CGPA 1WD4A 2HWC2 1MACA 3WV6A 2R071 4AQSA 1YYNA 3AKQA 4N53B 4AVVA 4AW7A 2RS31 4GALA 1A8DA 4PLOA 3NSTA 4M3CA 3R05A 2W52A 4QXKA 1UIJA 4X6QB 2ZX0A 1TME1 3L2YA 3KB5A 4XE9A 3FFQA 1H1MA 4OLLA 1ND2C 1XU2A 5D8AB 2DUOA 2X5IA 3FUQA 4F3JA 5K0UC 2GN7A 2MNGA 3FLRA 4Y22A 5KHGA 1H2MA 2PHFA 1RTVA 2BUKA 4ISQA 5I8SA 1QQP2 3U10A 4EN6B 2GALA 4RSUA 3IBMA 3PJYA 3WVJA 3O14A 5KWRA 4QM9A 4XFIA 2TUNA 4Q4Y1 4GB33 3M2MA 1OOPA 5CFDB 1X82A 2YMZA 1W39A 4XHXA 1NZCA 2EALA 2JEMA 1NLRA 3QBQA 3RMYA 5A3MA 1CAUA 1NCQC 2WA4A 2R1BA 2ARXA 4O9EA 5DG2A 2HEVF 4TZDA 1AX1A 4LE3A 3FLPA 2H6BA 1WLWA 1RUH2 2P34A 1QH7A 4FCAA 1VR3A 2D6NA 2JD4A 3G6JB 3LOIA 3MPBA 3ZXLA 1OOPB 2XUMA 4K21A 4DY5A 3ES4A 2D6LX 4RGGA 2BEOA 4MXWB 4XF9A 4AEDB 1VBA2 1VBD3 4ORFA 4Q0PA 1D2SA 2WNEA 3FFZA 2X5IB 5JAXA 3WCRA 3E5XA 2P37A 4J6GA 4HVQA 1ASJ1 1XYOA 3W58A 4AFBA 4M3CE 3AYAA 1CAXA 1ZRDA 3R0RA 2KXLA 4FOYA 4MYEA 1N1SA 3M7AA 3V0AB 1DG6A 3LWCA 4Y1XA 1URXA 5I8TA 1IS4A 4LBQA 1HRI2 1G8WA 1NCQB 2NP0A 2ZGTA 4DINB 5HBAA 2ERFA 4YG6A 1SLLA 2OUHA 5L19A 4BIFA 1R083 4Q0QA 1V6IA 3VBHB 4LHKA 3MGUA 3O5SA 3APBA 3IIAA 5FPZA 5L7OA 4GMP1 1F5FA 4MVTA 1S2KA 4QGLA 4XTPA 4AEDC 3B5LB 4AHWA 2NM1A 2WINB 1HXS2 2Y0OA 5KHHA 3H9AA 5E16A 5BNNA 4YG0A 1PVC2 1RIRA 3N3HA 1YO8A 3T1MA 1IZ3A 5JPMB 1MVEA 4N43C 4PIXA 1AL23 3M8LA 2NMOA 5FQ0B 1B09A 1DGWX 4CDUC 4AE2A 3WR0A 4R4ZA 4FQ4A 4I3PA 2D3SA 4PBPA 2BNMA 2HWE2 4YZ3A 2XKOA 4FPCA 1FV3A 2VVDA 2ZACA 3QH7A 4I0AA 3TNPB 2PHLA 3DF0A 4RL7A 1RITA 1RVF1 3D8CA 5KC5A 2R1DA 3EBRA 2V73A 4PLNA 2D5HA 3WINE 1UX6A 4F8AA 3ZXJA 4BA6A 2V5YA 3OGGA 3ILNA 3RPQA 2WSVA 1B35C 1REEA 3PVOA 3SH5A 1Y3TA 2A6WA 4HL0A 2PLV2 4E2SA 5F6LB 4PQ9A 3VHNA 3V0AA 3KSCA 4DB5A 2WIIB 1WMDA 4DRVA 5BPXA 2DUQA 2ZX4A 3SITA 2ZGLA 4HKLA 3WP5A 4JQRA 1MS1A 5DZEA 5IT6A 3ZFEB 2YHJA 1KITA 3CL1A 2VW2A 2VVEA 1ZBA2 4Q27A 1COV2 2R0HA 1TQ5A 1RUE2 1PHMA 1RUI1 3LA2A 1OA2A 3N7JA 1O91A 3ZN6A 1ZNPA 1BVVA 4AEMA 1VBC3 3FLTA 4XFHA 3BB6A 4AF9A 2G9GA 4EWEA 1QJY2 3MLLA 3WW1A 1QJX1 4CDXB 5KC6A 2WZR2 4Q1RA 1KDMA 3WUCA 1HV0A 4TYSA 4N90A 2FZ1A 3CLPA 4Y26A 1J58A 4OI2A 4NPRA 4JGYA 5JZGB 2I07B 2VG9A 4E2QA 2HWF1 1PO12 1JN2P 5D1IA 1MZEA 5JZGA 2A71A 1VBB1 2A6ZA 1ZA4A 3RRDA 4JGZA 4YLZA 4G9SB 4DXZA 2IXJA 3CU7A 1UAIA 2WL1A 1DGRA 3USSA 4WBBA 4EN0A 1ZZ8A 4Q4X3 1DZTA 5JPNB 4ES9A 4FP2A 2GC1A 4LR4A 3LSEA 3OTFA 2R063 3QCWA 4GB31 2DVFA 3VBUA 4B8EA 4CEYB 2VQAA 1PK6A 4RR3A 1FT9A 1ZRCA 1R091 2GZWA 5H9RA 4S2FA 1LOCA 1XRUA 4PCRA 1UZYA 2R6QA 1V6OA 3IN9A 4E27A