1Z78A

Crystal structure of the thrombospondin-1 n-terminal domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
NSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin 1
publication title The structures of the thrombospondin-1 N-terminal domain and its complex with a synthetic pentameric heparin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2005-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1z78A00
1MVEA 2JECA 1VALA 3C2UA 5CAZA 4M3CF 2WKKA 4XTMA 1DIWA 1W6PA 2NZ9A 3D5OA 3I8TA 2ZGRA 2A71A 4BMBA 5BYNA 4U2AA 4YGCA 3ZSMA 2BQPA 2EXJA 4R9DA 2EXIA 3NV1A 3WDVA 1ONAA 4YLZA 1WW7A 4LBLA 2YMZA 1WW5A 2ZGOA 3VUOA 2HYKA 1F5FA 1SCSA 2DV9A 2EAKA 2R0FA 1W6QA 2WT1A 3TAYA 1CPMA 3AX4A 2FHRA 3AYDA 4XJAA 4DRRA 3AP9A 2GMMA 2YY1A 3AP4A 5EYXA 3JUUA 3RS6A 3POSA 2A3XA 1CIWA 2JE7A 2PHWA 1N3QA 1ZA4A 1CVNA 3B69A 3ZXJA 1CJPA 5E8AA 1V00A 1A8DA 3UK9A 4YZ2A 1DQ0A 2VXRA 3POWA 2ZMLA 4XBQA 1LJ7A 5GLUA 1KDKA 4ASMB 4CTEA 4XHBA 3LCPA 1GLHA 1LHUA 1WD3A 3LSDA 3R4SA 4UW5A 2VU9A 4RA0A 1W6OB 5CNAA 5DG2A 1DHKB 3RRDA 1LGNA 4YM3A 2NYYA 2DURA 1IS3A 4ITCA 2R1DA 1YI7A 2PHRA 2SLIA 1DBNA 1MR5A 2VY0A 1DQ4A 4GWMA 4Y22B 2A6YA 1AX2A 2CL2A 4BLIA 3L2YA 4YW1A 5JLVA 1AJKA 3OYWB 1SCRA 1GSLA 3NV4A 4XXPA 2W39A 1WBLA 1DQ6A 1JXNA 3AFKA 1KITA 5IK8A 4YW4A 3SITA 3N3HA 5EWSA 3V0BA 3GALA 2WLQA 2AGSA 4HANA 1SFYA 4JCKA 3ENRA 1OQ1A 4WVWA 5DZFA 4XJZA 4LBQB 3FUOA 1QDOA 1KJLA 4FOYA 4Y20B 1HQWA 2ENRA 4GA9A 5T5OA 5HCFA 3M3OA 2CWMA 2W52A 5GZGA 4OZXA 4YM0A 3O12A 2GMEA 4FPOB 4IQPA 1LOGA 1N1TA 1GNZA 4FOQA 4M01A 4XIKA 5DUVA 3AYEA 1FNYA 1H9WA 1V6LA 1URXA 2RHPA 3IM0A 3N36A 3NWKA 4K1YA 4LBQD 4Y1YA 3FLRA 3WDWA 2NM1A 2A6ZA 1BYHA 1D0HA 2A7AA 2DWRA 3M3EA 4YGEA 2ZMNA 1PZ7A 1GZCA 2V73A 1QMJA 1APNA 3N7LA 3O5SA 5SV8A 1AZDA 4NO4A 1UMZA 2D6OX 4YW3A 4MYEA 5DZEA 2NN8A 1W6MA 4FP3A 1OFSA 1FX5A 1WCSA 1SBEA 3M3QA 3MW4A 1A3KA 1BJQA 2ZA9A 1YRZA 2ARXA 3I4IA 1LGBA 1JBCA 3MW2A 1S0BA 1V6MA 3AYCA 4FQZA 2ZABA 5FRAA 3FUQA 4FQ4A 3NV3A 4YG0A 5IK7A 5FREA 2DTYA 1KDMA 2GNDA 1C1FA 4LBMA 4UW6A 5DUUA 5CB7A 1MZ5A 2P34A 1QGLA 3VKFC 2ZGMA 3M1HA 2JKBA 3USUB 1IS5A 5T54A 4FPGA 4Y1VA 1GZWB 2ZGTA 4XDQA 4Q27A 2AH2A 3FLTA 4L8QA 1CONA 3POYA 5JOXA 1LGCA 3BOPA 3IKWA 1QNYA 4FOVA 2D6PA 2E6VA 1MVQA 4XILA 5GALA 3WZ1A 3V0AB 3WHUA 1N3PA 1MS3A 1W6NA 1AXZA 1V6NA 2DVGA 2VUAA 3OBRA 3PVNA 1Z78A 4FOWA 1MS4A 3MEPA 5AVAA 5T5PA 3AXDA 3AZZA 3T1MA 1W6PB 1LHVA 3O0XA 5IUQA 2A6WA 2XB6C 4XBLA 2E53A 3ZSJA 3INAA 1LU1A 2R1BA 1UKGA 4Q2FA 1RIRA 1PZ9A 1QDCA 2B7YA 1QOSA 1UZYA 1LOFC 1V6IA 1W6QB 4YG6A 1DYKA 1EPWA 2WSUA 2WNEA 1WUVA 3PVOA 2ZBJA 1ULEA 1C57A 2EXHA 2R49A 3AP7A 4ZKTB 1S1AA 2EALA 4ISQA 3ATGA 1IS4A 2I2SA 3WG1A 1RITA 4PBOA 2ZAAA 1SBDA 3OY8A 1LENA 4XXAA 4M3CA 2AUYA 3WUCA 3AZWA 4XJUA 1IOAA 1YIFA 4BQ1A 2R16A 5IK4A 2XG3A 1GKBA 5DUWA 3AYAA 4GKXA 3VKMA 2P2KA 4C1WA 5H9SA 1CR7A 5T5JA 1Q8OA 4AGRA 2NMNA 1BQPA 5T5LA 3T1LA 2AENA 3HN1A 4DS0A 1QOTA 4BOWA 5JDBA 3A0NA 2CTVA 4XZPA 3KM5A 3IMNA 3RG0A 5F5QA 4FPKA 4YW2A 4UW4A 2EXKA 2EIGA 2PHXA 2YROA 4Y1XA 1N1VA 1FATA 1LTEA 2A6VA 2DUOA 5KXDA 3MPPG 3QCWA 2ZKNA 3ILNA 1BZWA 2D3PA 3UJOA 3ZVXA 2DVBA 3SH5A 3WCRA 1HKDA 5GZEA 1WLCA 5DUXA 2DU1A 3WCSA 4XJ9A 3V0BB 2GMPA 1LESA 2NMOA 1JOJA 2JJ6A 2UWCA 2LTNA 5GZFA 4Y1UA 2Z42A 2OW4A 2W68A 3ZXLA 2GALA 2DVFA 5DG1A 4RL7A 4AYUA 1NXD1 2A3WA 2ZGKA 2CWSA 5GLZA 4AWDA 4K21A 1ULGA 3AP5A 5JOYA 2GNBA 1WBFA 3U4XA 1SLIA 4R9BA 1BKZA 3TB0A 1AVBA 4TZDA 3WUDA 1W6OA 3QLQA 4FPEA 1YXWA 1AXYA 1AJOA 4PBPA 4FPHA 3SISA 3VKNA 4TYSA 1FYUA 4I30A 4Y22A 1IKQA 2PHUA 5H9RA 4YG3A 3ZXKA 3N35A 1Q8QA 4YZ4A 1A78A 3OYWA 4XTPA 3WDTA 1UN1A 1MZ6A 3W58A 5KXBA 1R1ZA 1H30A 1GZ9A 2WT0A 5GJ6A 4Q26A 5JOZA 1KRIA 2A70A 2H0BA 3CNAA 3D6EA 5H9QA 2AYHA 4FPJA 4BMEA 1SBFA 1DLLA 1LOAA 2V5YA 3R4UA 1S0IA 3ZYRA 2A3YA 2E51A 4W65A 1QU0A 4LBQA 3WG4A 1GV9A 2A75A 1CPNA 4Q1RA 2YZ4A 4Y20A 4YFZA 1UAIA 1Q8PA 1O4ZA 3APBA 2ZMKA 3IPVB 1RINA 2AREA 4FPCA 2DU0A 1G86A 2ZGQA 1FAYA 1UL9A 3FBYA 1HQLA 4XMAA 1V6JA 5L73A 3ZSKA 2ERFA 1MS5A 1DQ2A 2ZHLA 4P9WA 1QKQA 2CYFA 2DUQA 1DGLA 2DVDA 1S0FA 1Q8VA 1JHNA 5GZCA 3SLIA 1OKQA 1QF3A 1W6NB 5DXDA 4YM2A 1MS9A 2P3KA 3WG2A 2PELA 3ZYPA 1Y7BA 1CESA 5T52A 1FNZA 5HCBA 2VH9A 4XIOA 3UL2A 4WZFA 2GN3A 1S0DA 1GBGA 1LHWA 2ZHMA 4FPFA 4JRAA 5GM0A 4BPZA 4D69A 1XQNA 2KM2A 4DPNA 2ZGLA 5CBLA 5IK5A 1V6OA 4XJWA 2WQZC 1YO8A 1UX6A 3N7JA 2DTWA 1MACA 2A5ZA 3SNMA 1I3HA 2P37A 2UWAA 2LALA 5T50A 1O4YA 3O0VA 3BODA 3RMXA 1HDKA 5JOWA 4K1ZA 4PQ9A 1WD4A 3WLUA 5LK5A 2ARBA 4M3CE 3LSEA 1SLLA 4BLJA 1GZWA 1SLTA 5EYYA 4LBNA 2VW2A 1CQ9A 3IN9A 1AXKA 3B9CA 1Z0HA 2ZGSA 4C1XA 1FV3A 2ZGNA 3HR9A 3WHTA 2R0HA 4H55A 5GLTA 4WV8A 1LEMA 4M3CB 3N7KA 3N7MA 4YZ3A 4CZSA 1Q56A 2DVAA 2ZGPA 2WJSA 4LBJA 1S0CA 3AZYA 1LECA 1QNWA 4FVVA 3WNXA 4YZ5A 1W0OA 1G9DA 1AX1A 1GYKA 3AZVA 1ULFA 3DUIA 1ULDA 5HCAA 2OVUA 3FLPA 2DYCA 4R9CA 3WVJA 2YXSA 1G9FA 4PCRA 4GXLA 2ZZJA 4UW3A 2WT2A 2D3SA 3R05A 1WW4A 1CN1A 2CY6A 4BM8A 2W08A 1JYIA 1AX0A 1G8WA 3T2TA 4P9YA 2SBAA 3OPZA 3VKLA 1WLDA 4XYXA 4DRVA 4ATFA 3PVEA 2D6MA 4P9XA 3SH4A 4ZXKA 1N1SA 1C4RA 5GZDA 3V65A 1H9PA 2ES3A 3RQ0A 1N1YA 3BTAA 2D44A 4NOTA 4DQAA 3W59A 2UURA 3DGTA 1DYPA 5CA6A 1WLWA 2PHTA 1DZQA 2GNMA 2C9AA 1B09A 4YFWA 1FV2A 2A6XA 3AZXA 1JYCA 2JDZA 4FPYA 4Y24A 3Q9OA 4LBKA 3FFZA 2D7FA 3H0OA 3PJQA 4YGDA 5GLVA 4YW5A 1Q8SA 1V6KA 1W0PA 2P3IA 4DFSA 1NLSA 1VIWB 5E88A 1UPSA 1S0GA 4XBNA 3PMEA 1GNHA 3ILFA 1DFQA 4JC1A 4P14A 3D4KA 4Q8LA 4XE9A 1N47A 4XMIA 3SH3A 3ZPYA 3B3QE 3WDXA 1LOBA 3WDYA 3ZSLA 3A0KA 2YV8A 1PZ8A 2ZHKA 1KQRA 3AJZA 3OJBA 5H9PA 2AR6A 2VW0A 1BXHA 3RSJA 2ZACA 3WV6A 3WDUA 5E89A 3VKOA 3ZXFA 1AF9A 1JUIA 4AVSA 1DQ1A 4AVTA 3RMYA 3JU9A 2GDFA 4XJ8A 2GNTA 5F9TA 4ATEA 1LU2A 1W6MB 2EF6A 1J1TA 1F9KA 1SLBA 1LODA 1ENQA 3OBTA 4KBBA 5EXOA 4YM1A 4GWNA 2JE9A 4AGGA 4XHXA 1ENRA 2OUHA 3AK0A 3WG3A 4K20A 4GKYA 4U36A 2TEPA 3O0WA 2E7QA 1LHNA 2VW1A 3WOGA 1MS8A 1SLCA 2OUJA 1HLCA 4FP2A 1G9BA 1G9AA 5T55A 3KQRA 1JN2P 3B00A 2JD4A 1SLAA 2PHFA 2D6LX 5KXEA 1X50A 1ENSA 1I1EA 1U0AA 5JMCA 1GANA 5IT6A 1QOOA 4Y26A 4AGVA 1N3OA 4ISRA 3A4UA 3AP6A 2D3RA 1MS0A 3ILRA 5DZGA 4R9AA 3BIWE 2CNAA 2UU8A 5JVVA 3B01A 1S0JA 1YYNA 2WSVA 3VV1A 4Y1ZA 1LOCA 1IKPA 1G7YA 1VLNA 4PF5A 2E7TA 1WW6A 1LULA 4LBOA 3ZXEA 4F83A 4Q8KA 1F31A 3HMYA 1UZZA 1JW6A 3IPVA 2NP0A 1S0EA 3AXEA 3GNEA 1ULCA 4SLIA 2FMDA 2P3JA 3NV2A 1LHOA 4XOGA 4CRQA 1LCLA 1DQ5A 1D2SA 1VAVA 1ZM1A 1SACA 2Q5TA 2GN7A 2D6KA 3USUA 4AVVA 1TEIA 1LEDA 1MS1A 3ASIA 4HL0A 5GLWA 2C5DA 1LOEA 4YGBA 2ZGUA 5KXCA 3MW3A 1IS6A 2DUPA 3AJYA 1GICA 2D43A 3OY8B 1C1LA 2ZHNA 4YZ1A 1VAMA 4M00A 3OGGA 3M2MA 3V64A 1G9CA 3V0AA 2UWBA 1LOFA 2D6NA 4GALA 2G4IA 4Z8BA 1KJRA 4Q1PA 3M3CA 3UJQA 4WVVA 4FPLA
chains in the Genus database with same CATH superfamily
1MVEA 4GH4C 2MEV3 5FPBA 5CAZA 2WKKA 4J1WA 4XTMA 1L7RA 3CZUA 1DIWA 1PK6C 1W6PA 2O8OA 4CCCA 2A71A 5DAPA 3ZFFC 2QUOA 4AHYA 2BQPA 3WQ0A 2B4KA 4TLFA 2EA7A 4BZ4A 3NV1A 5I0TA 3WNOA 2VVDA 4UI9L 4LBLA 1WW5A 3CEWA 4AFDA 5JXGA 5L7OA 1PGL2 5FYMA 2HYKA 1F5FA 5F6KA 3OEBA 4MZUA 3J7HA 4QXBA 3AX4A 2FHRA 2WUHA 4XJAA 5F6LB 3GHNA 2YY1A 1AR92 1NX9A 1PGW2 5FFOC 2R042 4B4QA 3POSA 2JE7A 1OURA 2PHWA 1N3QA 4CDUB 5FYSA 3EXUA 4GWJA 4GAZA 1UYXA 2B5HA 2C26A 1W8OA 2XHNA 3IDEA 3ZYJB 4N43B 1A8DA 2TBVA 3UK9A 4YZ2A 1H8VA 1SHWB 1F4AA 4YRDA 3ETQA 2ZMLA 3CJXA 3E6DA 4XBQA 5GLUA 1VMFA 3N9PA 3ZFEB 4B8EA 2FCTA 1KS4A 1OA3A 4CU6A 5HI0A 1LHUA 1WD3A 5I93A 2RS51 4UW5A 3V56A 4E2QA 3ZYIB 1GNYA 1OH4A 5F37A 2WNUA 1AR93 1JOPA 2HEYF 3RRDA 1VMJA 4YM3A 2DURA 4GD4A 1WMEA 1D4VB 2VY0A 1K5MC 4GWMA 2A6YA 2CL2A 4FO9A 1H6YA 2QQUA 3L2YA 4YW1A 4CSWA 4EYUA 5K8SA 1AJKA 1QJU1 3NV4A 3E97A 1CAWB 2WN3A 4OVEA 3GBGA 1ZZ7A 2HWB1 5IK8A 3DECA 4FTBA 3SITA 1HB4A 3ZYGA 2AGSA 2FBEA 3BU7A 4JCKA 3UKNA 2Q1ZB 1UY2A 3FHQA 5LRSA 4XJZA 4XAEA 3RYPA 2YC0A 3W20A 4O61A 3I2JA 4QKBA 2BBAA 5T5OA 5FPUA 5C8CB 1Q5OA 2GC3A 4OZXA 3HBKA 4FCAA 1E5HA 2EIBA 2I45A 3OD0A 1GR3A 4LNVA 4CDWC 1O7FA 2E9QA 2Y64A 5CFDB 1R081 1XNBA 1NZCA 3P3PA 2C4XA 5E16A 2K2SA 2W9XA 3KCYA 1RHI2 3OUJA 1UCXA 1FNYA 4RQPA 2RHPA 4PT6A 4RFRB 3NWKA 4K1YA 4I09A 4WVZA 4RGGA 3OSDA 3A7QA 4ONUA 4HT1T 4YGEA 2ZMNA 3JD72 4HMZA 4DY3A 4FAGA 1ASJ1 2VNOA 5CFDC 4H3WA 4XDPA 3PDQA 4N90A 2NN8A 1OFSA 4JRLA 3HJRA 4JDNA 1YEWA 3HEIA 1JYXA 5A33A 1UF2C 3BALA 2WO2A 2WYFA 5FOJB 2ARXA 3H7YA 3ROUA 1PMIA 3MW2A 3VD9A 1S0BA 4I02A 5FZ1A 4YG0A 3E5QA 5DUUA 1CAVA 1LR5A 4N9HA 3QH7A 3BI3A 3F2ZA 3N9QA 2YBPA 3AKSA 3JD73 3P1IA 4FSJA 2JKBA 4UBHA 2K46A 4D8MA 1HN0A 1W8HA 3S6PA 5T54A 2VTXA 2ZGTA 3LB9A 4R4XA 1REFA 1UOJA 2ZCWA 1LGCA 1RXGA 3IKWA 4FOVA 4JDOA 3WZ1A 3ZYHA 1MVQA 2PHLA 2WFF2 3VBUB 1XSQA 1NCRC 1YQ6A 3I3BA 4TXWA 4DOUA 4J25A 1RUD1 1UYPA 2IXIA 3ACIA 3MEPA 1OQEA 5AVAA 5ISLA 1XE7A 2XKPA 4XW3A 5CKMA 4XBLA 1OT5A 4IV3B 4HZFA 4BB3A 4DNYA 2GSYA 4IGQA 4AI2A 1OD5A 1RJ7A 4EN7B 3OUHA 2H6BA 3T2OA 5KBFA 1ZBA1 1FOD2 2YBSA 4FTEA 2E31A 3H8OA 2WFF3 1UU5A 4QQLA 1V70A 1EAH1 3NVCA 5K7PA 5SV5A 5TSWA 4D3WA 4PDWB 3BUCA 4PI2A 1X36A 3T30A 2W95A 2EXHA 2EIEA 2R49A 3AP7A 4WM7A 2EALA 3BPSA 4ISQA 1NKGA 5FZDA 1PO22 2OS2A 2W1QA 2I2SA 4WM8C 3WG1A 2ZX4A 1VBC3 4PBOA 2NLRA 1O8PA 3FZ3A 3I3MA 4M3CA 1W9YA 5DQ0A 3WUCA 3RZJA 2J1UA 5FZLA 3VDDA 3VZJA 1AR62 2R063 5IATA 3K51A 5FUNA 1FOD3 4NIAA 4GKXA 2VOTA 1REEA 3HQXA 4XCAA 1Q8OA 4PDWC 5T5JA 3ZDVA 4P9LA 2CAVA 4XFBA 1HJGA 3VL9A 2P1BA 2CTVA 1BVP1 2XLAA 3KMHA 3KM5A 4XZPA 2VQTA 3E1F1 3E6CC 1RUOA 4H14A 2LUWA 1PO23 4G4FA 3OCPA 5FY5A 3WEZA 3WQ1A 1LTEA 4IGOA 3ZPOA 3QCWA 3TNQA 1GP5A 4GB31 2DVBA 3K4AA 4OUMA 1XE0A 2VQ0A 3VBFB 3IIIA 5GZEA 4CU9A 3B5LB 2DU1A 3V0BB 2GMPA 1DZRA 1VMHA 3H7JA 2OZ6A 4SBVA 2OW4A 2IVIB 3MLKA 2GALA 3DPRC 4XFFA 4E4HA 5HPOA 3TEYA 3JBG1 4RL7A 4AYUA 5A3LA 2OA2A 1XOYA 1YFXA 2ZGKA 5A7WA 1C5HA 1OPOA 3IWZA 1TQ5A 1RC6A 2BGCA 4LPLA 5GLZA 1ULGA 2IUWA 4O7XA 4RN5A 3WW1A 1SLIA 1JOBA 3TB0A 2JG9B 1AVBA 4Z82A 3U37A 1X7NA 1OA4A 1QQP3 4NAMA 3I3DA 5LCWL 2FCUA 2YGLA 4FPHA 2EVXA 1YJKA 2Y60A 3LDBA 1ULOA 4YG3A 4HONA 5IJRA 3N35A 4EWEA 1M4WA 4HETA 2WO7A 3SKJE 4YSFA 1A6CA 4L99A 3WDTA 1MZ6A 3W58A 5KXBA 2X05A 5CYYA 1H30A 1CX1A 1GQHA 4Q26A 2A70A 2H0BA 2JG9C 1UMIA 2Z4FA 4Y4RA 4E2GA 4QD2A 2AYHA 1CD3G 2RS52 1BCXA 1OFNA 2RMU1 2RG4A 4F7ZA 2QJVA 3FMGA 1S0IA 5FZHA 1W28A 2DCZA 5APAA 4QAWA 5K4LA 4QGNA 4LBQA 4Q0UA 1W8NA 1OF4A 1GV9A 2A75A 1CPNA 4NHYA 2YZ4A 4UT5A 4Y20A 4YW7A 4FFGA 5IAVA 1QJU2 4XCBA 3ZOIA 1ZREA 1RINA 2AREA 4NRMA 4E4ZA 1RUJ1 1W3VA 2VCAA 2EIDA 5B4NA 2AC1A 2F4PA 2ZGQA 5A32A 2HWB2 4XMAA 3G7DA 1OC1A 5L73A 1ACCA 1AYM3 2JDNA 2RS53 4MADA 1H8TA 1WCUA 2CAUA 2UYAA 2JG8A 2RJKA 4P9WA 2CYFA 4P9GA 1Q8VA 5LA0A 2PN5A 3SLIA 1QF3A 3OTFA 4NIIA 1CAUA 4CDXB 2VUCA 2XR4A 2QZ3A 2PELA 5FO7B 4NE9A 4YNIA 1CESA 3O1SA 3GXUA 4MX3A 4Q0QA 3DXUA 4XIOA 1YLLA 2GN3A 1GBGA 1PX3A 2ZHMA 2YPDA 4FPFA 4BQ5A 4D69A 1R082 1XQNA 3RYKA 3W5NA 2QQIA 1FT9A 5CBLA 1V6OA 2HWB3 2V4AA 1YO8A 4IEPA 1UX6A 2O8QA 4QHZA 4W6YA 1MEC2 2QTWB 5A6QA 5FDBA 1SPPA 2A5ZA 1JHJA 3WNPA 3LOIA 5D8AC 3OB8A 2VZ1A 4IEXA 3O0VA 4CE8A 1XB9A 2HWD1 5JOWA 1W39A 4CDXC 2WR9A 4K6BA 4PQ9A 5F3IA 4DXRA 4AEJA 1WD4A 1ASJ2 1YWKA 3WLUA 4DINB 5EJ1B 3TN92 5AFBA 4BDVB 3PUIA 5AC91 1SLLA 3ZN6B 1SLTA 2WNVB 5EYYA 1W9SA 3DYMA 4PIYA 4PHZA 4BHPA 1R083 3KCXA 5CIRA 1FV3A 3BIEA 2BP6A 5F7UA 1F4HA 2GH8A 3MBWA 2J1TA 2W5FA 3N7MA 1OOPA 5I0UA 4RR3C 4CZSA 1ZBE1 4LEJA 4DEQA 4Y5SA 2WJSA 4CDQB 3WINE 3AB0A 1VBB1 2F6BA 1QNWA 2HH9A 1WLTA 3LFMA 2HWE1 1G9DA 3I2FA 1OA2A 1ASJ3 4LJHA 3ETPA 2BRTA 2WNVC 3VBSB 1ULFA 1ST8A 5FQ0B 1WCQA 2OVUA 5KC5A 4P00B 4XPVA 3WQ7A 4LKSA 3PU3A 2BNOA 2WYSA 3N9MA 4R9CA 3WVJA 4B7EA 1G9FA 3O7OA 2ZZJA 4V2WA 4A3ZA 2ZKLA 1SFNA 4CDQC 1WW4A 2CY6A 2XKOA 1RUD2 2W08A 1AX0A 5FZ8A 1W2NA 4P9YA 1NCQA 2RJ2A 3VKLA 1WLDA 3AMQA 4QB2A 4ATFA 4Q4W1 3VBSC 5LW9A 5FYUA 1ULPA 4P9XA 1ZA7A 1COV1 1LKNA 1NAEA 3ZKUA 1A34A 1QJY1 4ZXKA 1N1SA 5C9AA 1M06G 4CEWB 3AKRA 1H9PA 3RQ0A 4L9BA 3RZGA 3W59A 2X5IC 5ERLA 1W06A 5CA6A 2I07B 1DZQA 2W1WA 3HPNA 4X8PA 5FZKA 2C9AA 2VZPA 4AFCA 2N7GA 4OMDA 1RGSA 4QX0A 2JDZA 3RDIA 4PLNA 2CGOA 3GZUC 3Q9OA 1RUD3 2BNMA 5JZGA 1RUG2 3AMPA 2D7FA 5FPZA 4CUAA 4BQWA 3PJQA 4PIZA 4YGDA 2VZTA 1NOVA 4X6QB 1V6KA 2D97A 4RD7A 2VBBA 5G05L 1DF0A 1OH3A 1UPSA 5F2WA 5F32A 4JC1A 3SH3A 1LRHA 4RS5C 2ARCA 4XMIA 2EICA 4AFAA 5JPMB 3B3QE 4X6RB 3LQCA 3QOPA 1BK1A 3VB9A 1ZRFA 2YG0A 1ZBA3 1W8UA 2MHFA 3Q8EA 4NMIA 1SZBA 5LEKA 2W0XA 1XNDA 2AR6A 4IESA 1BXHA 4QPGA 3ZO0B 5C5UA 3WDUA 1EAH3 1ND3B 4LO6B 3VKOA 3EMRA 3DF0A 4RGKA 2JDKA 4HVOA 3DN7A 5BV6A 2JDAA 2GDFA 4AEDB 4L0PA 4ATEA 1J1TA 4Y4YA 4MGZE 5EXOA 5DDJ1 4XHXA 5FCCA 2BWCA 3AK0A 3LGRA 1XNAA 2VMCA 4K20A 2TEPA 2XGXA 3NRUA 1MS8A 5FXVA 2G9FA 1ND3C 2OUJA 3H3LA 1HLCA 4FI9A 2GP3A 3N9OA 4FP2A 1EY2A 2JDMA 4LKFA 4CEYC 2FCVA 3B00A 2JD4A 5I8SA 1H2LA 3CJIB 2D6LX 5KXEA 1L7LA 1W8TA 2R071 2WL1A 3BYWA 5G04L 1I1EA 2XL9A 3JBG2 1SG3A 1GANA 1PIV2 1S2EA 3KGLA 3BVCA 3S5AA 4AGVA 1K3IA 1N3OA 4DY5A 3CIHA 5FYBA 3LFIA 3DL3A 2IXLA 3AP6A 2D3RA 1MS0A 3ILRA 3ZN4A 3W9AA 3TEWA 4GB33 2BU9A 1PGL1 4Z1VA 2YC2A 2WO1A 1YIPA 1WCDJ 5C71A 1QXRA 3VD5A 3CU7A 3CJIC 1LOCA 1B35A 1G7YA 1YI9A 3GBFA 4UFJA 5BNNB 2E7TA 1D2QA 1WW6A 1ND2A 1F8VA 5LEJA 1BBT1 1EYBA 1LULA 2R041 3CF6E 4OCTA 4PI0A 2XJQA 1F31A 3ZXEA 1UY4A 3JBG3 1DGRA 1OLQA 2VTFA 4LXLA 3HMYA 4CUGA 5CFCC 3IPVA 1JW6A 5FY0A 2RJLA 4DUXA 5JSPA 1PO12 2DCJA 2P3JA 5FLHA 4ARXA 2ZS6B 1DQ5A 4LO7A 3OBAA 1D2SA 4YVSC 2RMU2 1NT0A 3NNGA 4QDQA 1H0BA 1VBA1 2D6KA 1TEIA 4YPJA 1MS1A 3LEIA 4HL0A 4LR4A 3KVBA 4YGBA 2YFZA 2QQJA 1UU6A 2ETEA 5BNOC 1GICA 4NHKA 1OHFA 1QWRA 4YZ1A 4DXZA 1S2BA 2ZTNA 2ZEWA 1POV1 1RUJ2 3H8UA 4MGKE 3GCWA 4GALA 2VECA 4Q1PA 4R52A 3UJQA 2HJIA 3MO4A 4FPLA 4KNCA 3ST7A 4AQ6A 1VALA 5JSOA 1F2NA 3GHMA 4M3CF 2Q4SA 4AAXA 2RMU3 2I74A 2NZ9A 2PA7A 3RJ2X 2ZGRA 3VZKA 4U2AA 1D4M2 3ZSMA 1Q3EA 4QX8A 3GZTB 4R9DA 1IG0A 3J8F1 3KV9A 4YLZA 1WW7A 2UYBA 2YMZA 3SEPA 2ZGOA 3AKQA 4ORFA 3VUOA 4PLMA 4CCMA 1AYN1 3ZFGA 3GZAA 2DV9A 2QDNA 2R0FA 2WT1A 1QIQA 1W6QA 4E8DA 4EE2A 2BEOA 1UY1A 3EBRA 3ZR5A 3MIHA 4IEWA 2GMMA 3AP4A 1JH5A 4DRRA 5EYXA 4J6GA 1JZ2A 4ZY9A 5LY2A 5A6YA 2FDIA 4JGYB 4W50A 1ZA4A 5FZ0A 3ZXJA 5JI9A 1GQPA 3AMNA 3DV8A 4OLLA 5E8AA 2HEVF 2OIIA 3HD8B 3LZZA 3MF6A 4LA3A 3RWKX 1POV0 2E33A 2VXRA 3POWA 1RUNA 1RHI1 2HWD2 2PAMA 2ZPXA 3FBMA 1QHDA 3LA7A 4N53B 1QJZA 3KF3A 1LJ7A 3Q8CA 4Z2WA 3O1PA 4MG2A 2IFWA 2OQ6A 3OGVA 1W0NA 5AC92 3LSDA 2HWF2 4BISA 1J59A 4HXCA 2TUNA 1W6OB 3VBRB 1DHKB 2VOXA 4YVWA 1IS3A 4ITCA 2R1DA 2SLIA 3WF0A 1POQA 1MR5A 1XYPA 1DQ4A 1MZFA 1ZBE2 2ZX3A 3RWNA 1KEXA 4KWUA 4N53C 1VBB2 2HWD3 5DPNA 2W39A 2VMFA 3TRSB 2HWE2 1WBLA 2OXBA 4Z07A 2GP5A 1JXNA 2BV4A 2DBIA 1YFWA 5FUIA 1JYWA 2KR2A 4IETA 3K48A 3GZEA 1UWWA 2O0OA 4HLTA 3KT7A 5AC93 2WNOA 3ACGA 3N3HA 3NAPA 2BUKA 3H3UA 5EWSA 3T0BA 4Q4Y1 1GUIA 4L97A 1WMFA 3NMBA 5J1XA 3T08A 3Q8FA 4MSVA 5C3RA 1O91A 4L2NA 2Z2SB 4HN1A 4JKMA 3WF2A 4QPIC 2ENRA 4HPKB 1ZBE3 1VBE3 3PVBB 4V2VA 3TBDA 3M3OA 2CWMA 3MGUA 4IV1B 4XF9A 5JPNB 2G19A 3O12A 5J96B 4FPOB 2VGDA 4Q4W2 1RUH2 4QXKA 5L9BA 2HWE3 4AI3A 5BPXA 3ACFA 5C4WC 1COV2 3OF1A 2XJVA 4LIVA 4XIKA 1QJY2 3GYDA 5F5AA 3VHOA 3FHIB 4ZZ5A 3WSOA 2QQLA 3N36A 3W5MA 1URXA 2FDFA 1J3PA 4K7JA 2VG9A 3FLRA 3JXSA 2MNGA 1D0HA 1C5IA 2DWRA 1PZ7A 3VBOC 2V73A 1QMJA 2W1UA 3MFAA 4GIQA 4H2AA 1AZDA 1Y9GA 3N9LA 4KGGA 4NO4A 1UMZA 4YW3A 1WCKA 1RUE2 4MYEA 4UFKA 1XU1A 4XFGA 5DZEA 5K0UA 4MGIE 1Y9QA 2J1RA 4FP3A 4Q4W3 3VDBA 3M3QA 2Y0OA 3MW4A 4MGYE 1COV3 2ZA9A 1YRZA 3I4IA 3ORJA 1NQJA 1QJY3 4MVTA 5FJHA 1ZZCA 2HBUA 4ARYA 2VJXA 1GP4A 1V6MA 4BK5A 3GM8A 3IDCB 5FRAA 3NKGA 4IDZA 2QQNA 4FQ4A 3WNLA 4EN0A 5FREA 4YARA 2DTYA 1KDMA 4UW6A 1C1FA 3KGZA 3R6SA 3Q8AA 1C28A 1MZ5A 4LHSA 3SEEA 4R8HA 1QGLA 1VJ2A 3VKFC 1DGWX 2ZGMA 3UV9A 5ACA1 2VC9A 4QPWA 5FY7A 2Y0IA 4QU2A 1Y4WA 5DAXA 2VQAA 2VMDA 3I3QA 4DIQA 5A6ZA 4L8QA 2Y6JA 4IW3A 5A7SA 5DDJ2 1QNYA 3CLPA 2VMEA 1PK6B 2E6VA 4XILA 5GALA 3V0AB 4CUCA 1GOFA 3HT1A 4XF3A 1NLQA 3WHUA 3H1WA 4Y33A 1W6NA 3HOBA 4I2OA 4CCJA 1YCIA 2YUEA 1XPWA 1W3XA 5KHHA 5T5PA 1J83A 2UY8A 3AXDA 2XJTA 3ELNA 1US3A 1W6PB 1E5SA 1LHVA 3O0XA 5IUQA 1R091 2RM21 4XDOA 3ZSJA 2R072 5FWJA 3FJSA 5FYZA 1RIRA 5FMDA 5L7OB 3PU8A 5DDJ3 1QOSA 3NNLA 5J37A 1UZYA 4DB5A 4GWIA 3F95A 4LK6A 4OYUA 1EPWA 5DAVA 4AOCA 2XHKA 4CP2A 1HV0A 5IW0A 3U11A 1ULEA 3SCGA 2BOJA 3DYOA 1VBD1 5FKBA 3THTA 4ZKTB 5I91A 3NJYA 1D0GA 1Z7S1 3FE5A 5BNPA 1QEXA 5CEHA 5B4XA 1BBT2 2ZAAA 2R073 4A6OA 1V0AA 3OY8A 5IYYA 2K9ZA 2XLFA 1H2NA 3GJAA 5L7OC 5CG9A 3VZLA 2R16A 1K5MB 2CDOA 1GKBA 2BGOA 4KGQA 1W2TA 1W04A 1X8EA 1H6XA 4B3NA 1VBA2 1YUDA 5JDBA 5FZFA 1UXZA 1BMV1 3H3ZA 5LY1A 4HVQA 4C90A 2EIGA 5FZ9A 2V72A 4Y1XA 1BBT3 1N1VA 1FATA 2DUOA 2R043 2JB4A 3ILNA 3UJOA 1BZWA 2D3PA 4FTSA 3CQOA 2XJPA 1HKDA 2XXZA 3VDCA 3WCRA 4N7IA 4XQWA 1QXPA 2BDRA 2CU5A 2WNUC 4BIOA 5C8WA 4NPRA 1JOJA 2JJ6A 4CDUA 4NRPA 1EUUA 4QXHA 4XABA 1VBA3 4CDWB 4E27A 5J48A 4N43A 4XUTA 1IQDC 3J8F2 4EN8B 3N4MA 2VOKA 2LS6A 1IQAA 1XNTA 5JOYA 5IHRA 4XUNA 3ZFEA 1AYN2 1JU3A 3WX5A 5KR7A 3U4XA 3DKWA 1O3TA 1X8MA 1POV3 2J1VA 4YYOA 3VZOA 4TZDA 4QPYA 3QLQA 4FPEA 1TZOA 3AC0A 3T0AA 1AXYA 1AJOA 3C7HA 4PBPA 4YWAA 3SISA 4TYSA 1FYUA 1TE1B 3VKNA 5DMYA 1Q8QA 4NUBA 4GQ7A 4CCEA 3AKTA 1MEC1 4ZS2A 5EJ3A 3J8F3 1UN1A 1CAWA 3AL5A 2WZEA 5JOZA 2WT0A 1CZTA 2ZEXA 3KT4A 4MGQA 5IVFA 1UY3A 1KRIA 1AYN3 1XU2A 1W03A 4D0QA 3K46A 3VDAA 4RQPC 1RMU2 3R4UA 3TN91 3H1MA 3ZYRA 3RI8A 4MOAA 5A3NA 5L9RA 3IT8A 1O4TA 2HWC1 3D3AA 3AM2A 4P9IA 4IEZA 4AVAA 4LO5B 2Y6LA 2V09A 2Y33A 5C8CA 5FUPA 3APBA 1RHI3 4JTNA 5HV0A 3JZVA 1NCRB 1TNFA 2DU0A 4I0WB 1A8MA 1FXZA 1UL9A 3FBYA 2Z69A 3ZR6A 4D7YA 2R30A 3QH6A 2B9VA 5HXVA 3ZSKA 3KWVA 2WC2A 4BQ2A 2X8KA 4Q4Y2 2JEMA 2ERFA 4EZ4A 2W47A 1MS5A 1DQ2A 4Q4V1 4ASLA 2DUQA 5L19A 1DGLA 1FI2A 2BVVA 4CPBA 1LB2A 5HBAA 4BE3A 1OLME 1OKQA 5C3PA 4YM2A 5C7GA 1CX4A 1MS9A 2VD7A 2YU1A 5FZ7A 5KHGA 4FFIA 4XFCA 1I9RA 5T52A 4KBZA 1W99A 2VH9A 3UL2A 1S0DA 1LHWA 1EUTA 4OQ8A 1HIXA 4XJWA 4DMIA 4LOSA 5FLIA 1U5ZA 1MACA 3I49A 4I3PA 4Q4Y3 1I3HA 5F2SA 1QH7A 4AVBA 4WM8B 3BODA 3RMXA 1HDKA 4S2DA 3LKJA 1XYNA 1PGSA 1FMD2 2VULA 3D0JA 3VZNA 2QFEA 4CVUA 5LK5A 4N9IA 2P4EA 3LSEA 1CWPA 4FAHA 4CXYA 4LBNA 1CQ9A 1AXKA 2FZ2A 1TNRA 2VOVA 1RUG1 3UGHA 3WHTA 5IAXA 4A4AA 4H55A 1K42A 3WF4A 1LEMA 2CGNA 4M3CB 4M4PA 3N7KA 5LA1A 3VDDB 3RPQA 3VBUA 3KLSA 5DABA 4AZZA 3AMHA 1Q56A 2G9ZA 3T3YA 4J1XA 2HYXA 3BTYA 2VZVA 1U12A 3I2IA 3FHAA 3WNXA 5ACA2 1PX4A 5FPVA 4MHRA 2VTXJ 4QQHA 3WF3A 3DUIA 4IV3A 4P9JA 1ULDA 1VRBA 3WNNA 2ADEA 4KG0A 3ZM8A 3TEZA 3HIFA 2DYCA 3QD6A 1T6BX 2ET7A 3SHRA 5C6CA 4PLOA 3VDDC 3WW2A 3DPRB 2IFRA 5A3OA 4GXLA 5F1RA 2WT2A 2D3SA 4COUA 1YNAA 3DXTA 1G8WA 3T2TA 1VP6A 2JICA 3J4UH 4HSJA 2QKDA 4DRVA 1ZNPA 2GC0A 5ACA3 1AR63 4QGMA 1HX6A 1WA4A 1R092 2RM22 3SH4A 5FWEA 3E5XA 5IFPA 1C4RA 1UZVA 2ES3A 5FMOL 2QQVA 3BTAA 4NOTA 3MICA 1JS9A 1S2KA 3DGTA 5FP3A 5FAXA 1DYPA 2J42A 5FZ3A 2PHTA 5A7QA 3FL7A 3MUZ1 5F3EA 4WZCA 1MQTA 3I7DA 1PIV1 4QM8A 2VCMA 3ES4A 4FPYA 4QQOA 4LBKA 1AR71 3S57A 3JB8A 1QJEA 4LO8A 1ZVFA 3H0OA 3PUAA 4YW5A 5DAQA 2B45X 1VBD2 1ZZBA 2VBPA 3K3NA 4DFSA 2BBVA 2Y34A 4XBNA 1Z7S2 1R093 2RM23 4P14A 2AEYA 1RUI1 3D4KA 3JQXA 4XE9A 3J7MA 1OPMA 3H9AA 4ZONA 3U4SA 3POIA 3VZMA 3WDXA 3MIGA 3HQUA 3WDYA 2YBKA 5D2AA 4XEZA 4P02B 3A0KA 3IIAA 2PQSA 1GU3A 3VBFA 5H9PA 4N8MA 3RSJA 3WV6A 5E89A 3CKHA 1TVGA 5J09A 5BY5A 5FIXA 3AL6A 1I5ZA 4JHZA 3RMYA 3WD5A 1PO11 1W9TA 2PAKA 1W6MB 1YQ8A 2EF6A 5EIYB 1VBD3 1BMV2 5IVEA 1SLBA 5FY9A 4A3XA 2Z79A 1ENQA 2B9UA 3I59B 3O14A 4URAA 2VCCA 4AGGA 4HVRA 2IZWA 2E63A 4JGZB 2F17A 3NO8A 4WVMA 5C3QA 3O0WA 5DAWA 2VW1A 1LHNA 5A32B 3WOGA 2ZEZA 2VCBA 5FPXA 4NPMA 3LAGA 4D7TA 1XBFA 4G9SB 3J7NA 5T55A 1G9AA 1H2MA 4LE3A 2JG8B 3U10A 5FR3A 1ENSA 2O14A 1U0AA 5I0SA 2VL4A 5C5TA 2BOIA 4XF0A 1RUC2 3RGBA 4JGZC 5FBZA 1D4M1 4QM9A 4JVAA 5D8AB 1AL21 5DZGA 2JD9A 4JKKA 4R9AA 3IAPA 5JVVA 1C8NA 3B01A 3TNPB 3A22A 1YYNA 5CKQA 4BQ4A 2WSVA 1H8TC 1QJU3 1QJX1 2JG8C 2XMLA 3LPFA 1SPPB 5CKNA 1VLNA 4KWLA 5EPAA 1W2UA 1UPIA 5BXXA 4AI8A 4I0AA 4CXXA 4C0HA 3G6JB 4HK8A 2QE3A 3LIHA 4A6SA 4UF0B 4AE2A 4RR3B 4NR1A 2FMDA 4SLIA 3UGFA 2XBO1 3PIGA 4CRQA 1LCLA 2V5DA 1RL3A 4GJYA 3RZKA 3LWCA 2Q5TA 4TTGA 3USUA 1S55A 3LA2A 5EQUA 4PF1A 3ASIA 5CVRA 1BLZA 3ZMNA 4HKLA 2HWF1 1OOPB 4QB1A 1R1A1 2HWC2 1IS6A 2DUPA 2VM9A 3AFGA 3AJYA 2VNVA 4IE0A 2ZX1A 1C1LA 4FT8A 2ZHNA 2WRAA 3GJBA 2FDHA 1VAMA 4MGTA 3OGGA 1MEC3 1G9CA 2UWBA 5FP9A 2OPKA 3KZ4C 1OLMA 1LOFA 3IBMA 2QZ2A 1ODMA 2G4IA 3T2PA 3E5UA 1W2OA 2JECA 4CP1A 3PUHA 2C24A 4TN7A 4BQ3A 2C1FA 1REDA 2WABA 4XFIA 5JXIA 4BMBA 3RZMA 3ALQA 3CBNA 3J7LA 4Q4V2 1HRI1 1OOPC 3TN93 2EXJA 2EXIA 3WDVA 1ONAA 2QDRA 1PHMA 4URTA 2YGMA 3ES1A 4MUVA 3MF9A 2ADDA 3J26N 2X5IB 5E1RA 1QJFA 4XFAA 1VR3A 1SCSA 3TAYA 3RJRA 1CPMA 3ZN6A 3D0SA 3ME2A 3S7EA 5FZOB 3JUUA 4Y5Z0 3RS6A 4LLOA 4EJRA 2A3XA 1UZ0A 4JAAA 3MI8A 4QWNA 5DN2A 1CVNA 1JZ8A 3B69A 2FQPA 1RUH1 4EN9B 2DFBA 1CJPA 1XE8A 5FMOS 4Q4V3 4OMCA 1Y3TA 1ZZ9A 2E32A 1DQ0A 4XURA 4RS5B 4ZXEA 1NCQC 1ZZ6A 1KDKA 1NQDA 2ATFA 2Q1FA 4CTEA 1HB2A 3LCPA 4ET7A 5FQ0A 1E57A 5C9AC 3ZXGA 5DG2A 1LGNA 2NYYA 1YFYA 1RUE1 1HJFA 2PHRA 3I2DA 4GJZA 2PTMA 4Y22B 1AX2A 4OZOA 5LASA 3OYWB 4XQ4A 1GSLA 4QPGB 3VD7A 5AFEA 5JZGC 4QDSA 4MGSA 5FJKA 1EPZA 3ZX7A 1X9TA 3BPZA 1DQ6A 5A3WA 2BPA2 2FDJA 3POBA 5FPLA 4YW4A 3EQEA 4N7UA 4CEWA 2WLQA 2W1SA 1FPN1 2X09A 3R0RA 4HANA 4CP9A 4A42A 1OLRA 4CEYB 3ENRA 1RUG3 3FFQA 1OQ1A 4WVWA 5FPAA 3VGIA 5L9VA 3X29B 5D21A 1ALYA 2WQ8A 3USSA 3FUOA 1QDOA 2WA4A 1KJLA 3PLQA 4QPGC 1HQWA 1TMF2 4GA9A 5GZGA 5A1LA 4M0NA 4YM0A 3UGGA 1XC6A 2ORZA 4PJYA 1PMJX 3P5BA 4IQPA 4QGLA 3O1OA 1LOGA 5FYHA 1CAXB 2A1XA 4UXAA 4ZPIA 4FOQA 2HKXA 4OUSA 1ZRCA 2KD7A 2RS31 3AYEA 1OQDA 3FWEA 5GLVA 3POFA 1OKOA 4LBQD 1U5IA 1UIKA 3WDWA 2NM1A 2A6ZA 3IDAA 2A7AA 3LE0A 3WQBA 3WP4A 1HXS1 1APNA 2C9KA 1AR72 3O5SA 5CFCB 1HN1A 3MV01 4IUGA 2D6OX 4AEDA 2VR4A 4Y3OA 3VLBB 3FN9A 3CO2A 1VRH1 1UYYA 4OHYA 1WCSA 1SBEA 4QU1A 1C8M1 1A3KA 1BJQA 1RUI2 3EHKA 4YVSB 3SC7X 5I8YA 4OI2A 1JBCA 1EV11 2FMYA 3THPA 1ZRRA 4JTOA 4S2FA 1YQCA 5IK7A 2GNDA 3GF6A 5CB7A 5BNOB 1DP0A 2XOMA 2ZX0A 2P34A 3PL0A 4XQDA 4XACA 1PIV3 1KXGA 3M1HA 4B1MA 4FBFA 4UWDA 3LEGA 1AR73 1CJDA 2PLV1 1B35C 3PTRB 1DZTA 1GZWB 4V1PA 2VUJA 2VVFA 1ND2C 4XDQA 5FZBA 1XNKA 3FLTA 5ABJA 5JAXA 3I2KA 1RUI3 3T4VA 2D6PA 2VNGA 2JDYA 4QQ2A 1N3PA 2FDKA 4FOWA 2VUAA 1UD1A 3OBRA 3PVNA 4GZ9A 3DEMA 3Q8BA 3WP3A 1KFXL 4MXWA 5BUVA 1SFPA 1PM4A 3AZZA 4L92A 2VPVA 4QDRA 3T1MA 4EZHA 2VQUA 2A6WA 5FYIA 2XB6C 4C8DA 2XQRA 2E53A 5BNNA 1V9U1 1J84A 1PO13 2H6CA 3INAA 4DXTA 4ZHNA 1GWMA 1DGRN 1PZ9A 2BW8A 3BU0A 1JZ5A 2B7YA 1OSGA 3ZFGB 3ZYBA 1STMA 1J58A 1AL22 1V6IA 2WS91 1W6QB 4YG6A 2C0ZA 1DYKA 3PTYA 2Q8DA 1ZZ8A 1JUHA 1WUVA 3CHXA 2ZBJA 1QJX2 3PJYA 4RGAA 1S1AA 1U5YA 4LE4A 4EWDA 1RUJ3 1OMIA 1OI6A 3ATGA 1IS4A 5FYTA 1ZX5A 3WXPA 5J36A 2LM3A 1G6NA 4UFIA 3H42B 3IMMA 5FZGA 4XXAA 2RV9A 2BJSA 3AZWA 1IOAA 1OBNA 3ZFGC 5LK7B 2VMGA 1YIFA 3SCFA 2XG3A 3AVSA 5LA2A 2XUEA 1D4M3 5DUWA 4C1WA 1AL23 2XBO2 1CR7A 1VE0A 4AGRA 4QKFA 3ZYFA 4E4SA 3T1LA 1BQPA 4W4ZA 2AENA 5FY8A 2MPFA 1QOTA 3IDBB 4BOWA 3PUSA 1KFUL 2ARAA 4DUWA 5C3OA 3RG0A 1YC61 4FPKA 1RVF1 2ZJCA 4HBNA 4UW4A 3LA3A 1R1A2 5EFUA 3UKVA 5F5CA 4OI0A 2G1MA 2PHXA 2W92A 1RMU1 4UOJA 3MHZA 2ZKNA 3PMSA 3VHNA 3KHCA 5LZ6A 4S2GA 3SH5A 3H8RA 1GOHA 2FZ1A 4QPIB 5A1AA 1WLCA 2XBO3 3WCSA 4XJ9A 2Y6KA 1LESA 4JGYA 2D98A 2UWCA 2Y6HA 2LTNA 3MIBA 4Y1UA 4YVWC 5GZFA 1F35A 1UXXX 2W68A 4IEOA 2Q1MA 1HRI2 5DG1A 2DDUA 5C4WB 2HWF3 2A3WA 5JR2A 2CWSA 3LIGA 1R1A3 4QX7A 4S2HA 4B4RA 2B8MA 2UY9A 4AWDA 1TME2 1KGYA 3AP5A 2XWBB 2GNBA 5AVPA 3VBHA 4DEVA 4R9BA 1W90A 1O3SA 1WWYA 3NAPC 3VBOB 3WUDA 1W6OA 5B2GB 3VBRA 2W91A 1VBB3 1YXWA 4AL9A 4EROA 1CZSA 5A3PA 3VHPA 4PIXA 4I30A 1EP0A 2ET1A 1UOGA 2J1SA 2PHUA 1HRI3 4D6QA 1L3JA 3JB4C 1A78A 4YZ4A 4MLOA 4XTPA 1R1ZA 3SQOA 2HLEA 2W3JA 5GJ6A 1VB4A 1W8FA 2QQOA 3C3VA 4B1LA 3CNAA 3D6EA 3KS7A 1ODNA 4LA2A 3ABZA 1FMD1 1DLLA 1LOAA 5KWRA 2V5YA 4KMQA 3DKQA 1SEFA 1SMVA 2A3YA 1HRV1 2E51A 4TLGA 4NAOA 4W65A 1QU0A 4O9GA 4AEMA 1RUH3 3WG4A 3PURA 4YFZA 4TSVA 4Q1RA 5FXZA 2WINB 2WIIB 3NL1A 4HPKA 1Q8PA 3IZOA 4IV1A 4XFHA 2B46X 3K3OA 2L9LA 3LD8A 3EYPA 2NPIA 5K0UC 3D82A 4EV0A 1FAYA 1VBC1 2B39A 3R4DB 4IEYA 2FDGA 1V6JA 4IEUA 3SCHA 4OFGA 4AF9A 1NA1A 4P5HA 5F8PA 4Q0PA 2CV6A 1AUYA 1FPN2 3K4ZA 3HVDA 4CCLA 5KHJA 2OQ7A 4H7LA 4KWJA 3U1XA 1NXMA 1QKQA 2DVDA 1RUE3 1NE4A 3B9IA 1JHNA 5GZCA 1W6NB 4NRQA 5DXDA 2OYZA 3MIDA 4XF1A 1NY71 5F3CA 2P3KA 2WAAA 2PMWB 4LMFA 1Y7BA 2GH2A 2HEWF 4WZFA 5BNQA 4XETA 3BTZA 3TEXA 2KM2A 1OVSA 2BFUL 3BN6A 4KG8A 2ZAHA 4CYDA 2WQZC 5JR7B 4QQPA 5LATA 2RS32 3N7JA 4H7MA 2WO3A 5FZEA 1FPN3 3NJZA 4B4PA 1HB3A 3SNMA 5FXXA 5JSRA 3HQRA 3OGRA 2ZOEB 2LALA 3OUIA 4HN0A 5T50A 1O4YA 2QQWA 3FX3A 5CISA 2MEV2 1HXS2 1IZ3A 1J3RA 4K1ZA 5ANNA 4X8NA 2VMIA 2ARBA 2YYOA 4M3CE 4COZA 4I0BA 5FOBB 2VW2A 1VRH2 4GH4A 1Z0HA 2CDPA 2ZGSA 4C1XA 1C8M2 3HR9A 5GLTA 1PK6A 1GWLA 1EV12 2RS33 4CA9A 2Z5WA 3B7MA 3IB3A 3ZFFA 4MHUA 4YZ3A 4QMAA 1F15A 2ZZQA 4GMP1 2DVAA 2ZGPA 4IE6A 4KWKA 3B02A 3U14A 1BHGA 1S0CA 2FD8A 1QQP1 3AZYA 1HXS3 4FVVA 2YU2A 4YZ5A 1W0OA 1GMMA 3S0MA 1UKRA 2PLV2 2WWSA 1AX1A 3M70A 2G9GA 5BNPC 4NIGA 2RVAA 1IPJA 3FLPA 1VRH3 2WNUB 1JMUB 4XZUG 2ORXA 1MPXA 4IEQA 4W6WA 1C8M3 3FC0A 2QNKA 4OHVA 4XUPA 2YXSA 1EV13 5CU1A 4PCRA 3MZHA 3S7IA 2Y26A 3AKPA 1CN1A 2QQMA 5JIAA 4BM8A 5CADA 1JYIA 3U0ZA 2SBAA 2ZEYA 4XYXA 2XJSA 4OHXA 5IVYA 5A6XA 5ANQA 2PLV3 1V9U2 4TWTA 5F3GA 1GQGA 5GZDA 3V65A 4EN6B 4ES9A 1N1YA 4QX5A 2D44A 2B42B 2PFWA 3OPWA 4GMP0 3U75A 3NSTA 3VL8A 4NWVA 1K5MA 3P6BA 2WS92 4KH9A 2VOWA 4YFWA 1AYM1 4AVCA 2A6XA 1RUC1 3AZXA 1JYCA 4Y24A 2P6CA 2F4LA 3FFZA 1WMDA 4CDUC 3HNMA 1VAKA 1Q8SA 4HK9A 3WW3A 4N43C 4RSUA 5E88A 1S0GA 4I01A 3PMEA 3ILFA 4AQTA 5FO8B 4Q8LA 3WR0A 2JXAA 1V9U3 1N47A 3UNPA 4RQPB 1LOBA 5J98B 1HQNA 3WW4A 3ZFEC 2GC2A 3N9NA 3ZSLA 2YV8A 1XNCA 1PZ8A 4LITA 3E6BA 5FK7A 1KQRA 3OJBA 2WS93 2VW0A 2W46A 1P8JA 2ZACA 5I8TA 1AF9A 1JUIA 2VZRA 4E9KA 2P3YA 4Q0SA 2D5FA 1J1LA 5KHKA 5C3SA 4AFMA 1T6GC 4CDWA 4XF4A 1LU2A 1Y9MA 4O9EA 5FY4A 1RVF2 5LBBA 3LDRA 5A33B 4A7YA 1U5XA 3VD4A 4YW6A 2QQPA 4PQQA 3PIJA 2DF7A 1ENRA 2OUHA 1J3QA 2VVEA 4LKDA 1W9WA 1CAVB 2YFUA 1H1AA 4AW7A 4CCKA 3NQHA 3RVHA 3M8LA 4A7ZA 1JN2P 5CFDA 4XVHA 2JENA 4D7SA 4UYBA 5JMCA 5IT6A 1RVF3 3QBQA 4XUQA 5C8CC 1QOOA 4Y26A 1RMU3 5LWBA 3MLJA 4XC9A 2K0GA 3BIWE 4LHNA 4LUMA 2UU8A 1W9FA 1AHSA 1S0JA 2D5HA 3O1RA 3W21A 3VV1A 4Y1ZA 2JIJA 3KV5A 2WA3A 2BFUS 2VZOA 3OD4A 1JZ6A 1IKPA 1UZWA 3UT0A 1WMXA 2R6QA 3U78A 4LBOA 4NJ4A 3RNSA 4Q8KA 2CSGA 4LTAA 5LBEA 4AHWA 5IWFA 1GOGA 1S0EA 1WZXA 1OF3A 1NCRA 3IAQA 5A7NA 3NV2A 2W87A 4ES8A 3SKVA 3KHBA 1ZM1A 1SACA 4R4ZA 2GN7A 5JXJA 4AVVA 4BCUA 3HWJA 5EHDA 4WM7B 5GLWA 4LQRA 1LOEA 1H4GA 1HRV2 1K45A 5LBFA 1NZIA 4E2SA 5CZKA 4P5YA 1OUSA 2XJRA 3BGAA 4IE4A 5HXMA 3V64A 2OT7A 2X53S 5EV7A 4E4DX 2IVJA 4BQXA 2R7EB 3M3CA 1VBC2 4W8JA 3C2UA 4QKNA 1W8ZA 3I54A 1CIYA 1X82A 1FMD3 3D5OA 2J7MA 2R062 3GGLA 3I8TA 4WM7C 5FZIA 3VBUC 4YGCA 1DU3D 2XPJA 1H1IA 4IL7A 2E7AA 1HRV3 4WM8A 2WZPP 4CU7A 2KXLA 4QX1A 4A44A 5EZWA 1NY72 1H2KA 1WKYA 2O1QA 5K9YA 2RDRA 3KV4A 4LIUA 1UO9A 1PVC1 2VZUA 5HV4A 2EAKA 4IV3C 3AYDA 3AP9A 2XH6A 1TMF1 3ON7A 4BH9A 4PDWA 4DZGA 3K77A 2BYVE 2IXCA 2JIGA 1CIWA 2VNRA 1TG7A 4AAPA 4BQYA 3LEMA 4UFHA 1V00A 2XVLA 2Q8EA 3K4DA 1MQTB 5A7WB 2WZR1 4NVPA 1UMHA 4CU8A 1O5UA 1X33A 3ZIWA 4ASMB 4JKLA 4XHBA 1R64A 1I5PA 5FYYA 1UYZA 1GLHA 5FKCA 3R4SA 4QXCA 4BJ0A 1GWKA 1RYYA 2VU9A 4RA0A 5FYVA 5CNAA 4OQ9A 1IHMA 2RS11 2W94A 2GU9A 1GP6A 1YI7A 2RR11 4LULA 1DBNA 3T09A 3DPRA 1XSRA 2OX0A 5A7PA 1UW8A 3ZLIA 4Q4X1 1MQTC 2PAEA 4BLIA 4COVA 2AACA 1LAJA 3JQWA 4JQRA 5JLVA 5FLJA 1SCRA 2A73B 1QQP2 4XXPA 4CCNA 4OHWA 1NUKA 3KF5A 1UY0A 5JI7A 2ID4A 4HG6B 3AFKA 5JCTA 3MIFA 1KITA 4Y5TA 1O59A 5FTTC 5IFTA 3T0DA 1JZ3A 2J22A 3GALA 2Y38A 3V0BA 1SFYA 2CHHA 1S4CA 5DZFA 3KQ4B 1DG6A 1O5LA 4WVMB 4LBQB 4JDMA 2D93A 2LW8A 4LK7A 4FOYA 4Y20B 3VBFC 1Z7S3 5HCFA 4GMP3 2W52A 3ZXDA 2CGPA 2GMEA 3OPTA 3LDKA 4G3YC 3MLLA 5M0TA 3EB7A 2JG9A 2PQQA 2WN2A 5GKAC 1N1TA 1XJAA 1GNZA 4M01A 5FMCA 4OHZA 3S30A 4RHV1 1KS5A 3A21A 5DUVA 3SMHA 1DGWA 1H8TB 3O1TA 1H9WA 1V6LA 3IM0A 1XYOA 4Y1YA 4QB6A 3TYJA 1UOBA 1O8SA 1BYHA 3M3EA 2VZ3A 1AYM2 1SQ4A 1GZCA 3GBWA 4FXGB 1CAUB 4A41A 3RZHA 3N7LA 5J3UA 5SV8A 1PNFA 4OI4A 1RB8G 4NROA 1W6MA 2Q8CA 1FX5A 5FP4A 4LUKA 4AI0A 3I59A 2VZSA 3MIEA 1LGBA 2JDHA 3BKZA 5FV3A 4JGZA 4CPBD 2BWAA 3WF1A 3AYCA 4FQZA 2Q30A 2ZABA 1MZEA 3FUQA 5IVCA 3NV3A 5D1IA 3BTXA 5IVBA 1GFF2 4LBMA 4CCDA 4ZZ8A 1RJ8A 1QXJA 5JUVA 1E5IA 1K5JA 5A1FA 5HCHA 1RUC3 3USUB 1IS5A 4IE5A 1K12A 5LA9A 5LRRA 4ZS3A 4ZU5A 4FPGA 4NHXA 3K2OA 4Y1VA 3OBZA 4Q27A 2AH2A 4O65A 1F5JA 5C33A 1CONA 3POYA 5JOXA 5JIUA 1I6XA 3BOPA 3HBZA 3M3IA 1Q43A 4KL1A 5JWPA 2RDNA 4HFSA 4MXVA 4BIFA 3WNMA 5L36A 5D8AA 1UQXA 3J9SA 1MS3A 1AXZA 1V6NA 2DVGA 1SDDB 3I97A 3ZKYA 1Z78A 1MS4A 4CDXA 1O6UA 1UX7A 4EWAA 1BEV1 3ITQA 4P08A 3O1VA 2BNNA 2AZ5A 3NJXA 3P3NA 2IWGB 3WP5A 1LU1A 2R1BA 2Y8KA 3KCCA 1UKGA 4Q2FA 4M4RA 4Q5OA 1QDCA 4BXFA 2XJUA 2YDEA 4CP0A 3NJVA 1LOFC 4UF0A 1DDLA 4RR3A 4AXOA 4AI1A 1GZTA 2RDSA 2HWC3 4AQ2A 1TME1 2WNEA 1NCQB 2WSUA 3PVOA 5FZMA 2XLGA 3H50A 3OG2A 1C57A 2EAAA 3KD4A 2WNVA 4I3GA 4AK3A 1RITA 1VBE1 3ACLA 2JDPA 2XL7A 4JQTA 3CDZB 5C9AB 2XVKA 1SBDA 1ZRDA 1LENA 3MDPA 2AUYA 2JDUA 4XJUA 1NLRA 4K8FA 4BQ1A 5IK4A 4NHLA 3AYAA 3VKMA 2P2KA 3H8XA 5H9SA 4CDQA 3ZSEA 1XXNA 3HT2A 3MFCA 4GULA 1PMHX 5J7MA 2NMNA 5T5LA 2RDQA 1D7PM 1RUF1 3HN1A 3CZJA 4C91A 4DS0A 5JZGB 4QX3A 3A0NA 3VBSA 3JCIA 2KA3A 3IMNA 1AR81 3WP6A 5F5QA 3VN4A 2AEZA 4YW2A 2EXKA 2LRPA 2PXJA 3KB5A 2V4VA 3MYXA 5I0RA 2YROA 5KXDA 2A6VA 2WAOA 2X5IA 3MPPG 2WDBA 1SDWA 1ENXA 3ZVXA 4A45A 1WA6X 3THCA 3UESA 1C3HA 1CGPA 1NG0A 3ZIXA 1DCSA 2DCYA 2C6SA 3GCXA 1BK0A 2J1AA 1O3RA 1CZVA 5DUXA 5FZOA 4CXWA 4C0BA 2WWJA 2NMOA 4CP9B 4ZU4A 3NW4A 5LBCA 4OI1A 4DO0A 2Z42A 1JYTA 3SXWA 3ZXLA 1ZBA2 2DVFA 2XUMA 4BK4A 5FZCA 1YFUA 2X29A 3HN3A 4KU7A 5FMBA 1NXD1 4RS5A 1EAH2 4QX2A 4AHXA 2JWPA 2XQXA 3M4FA 1HB1A 4NIDA 3LEKA 4K21A 2PYTA 5KHIA 1WBFA 4BWOA 1PVC2 2OPWA 3T4HB 4B7KA 2QBXA 3H1YA 1HW5A 1BKZA 2XVGA 4COYA 4Z92B 5C70A 4CEWC 3MV11 3MPBA 3RFRA 3C7EA 4META 4AEKA 2VAUA 4Y22A 1IKQA 4MO3M 5H9RA 5IVJA 3ZXKA 3ZN5A 3OYWA 1KD7A 4NN0A 2WZR2 1JTZX 4K40A 3BB6A 1GZ9A 3L2HA 1ZYBA 2Q0AA 3M7AA 1IPKA 1PVC3 2MEV1 5H9QA 4BA6A 4Z2AA 4FPJA 4BMEA 4K9SA 1ND3A 1SBFA 1TMF3 5FZAA 4CEYA 4FFHA 4A7KA 2RS12 5FZ6A 4FXKB 1B35B 2RR12 2YC4A 1JZ4A 4GB32 2WQ4A 4UAPA 1ND2B 3O1UA 4Q4X2 2VBDA 3TOJA 3LOBA 4WBBA 5FO9B 2DCTA 1UAIA 5EP9A 1O4ZA 2OZJA 2ZMKA 3IPVB 4ZU7A 2WZR3 4FPCA 2LROA 2IXJA 1NYWA 4AEDC 1G86A 5LB6A 4D6SA 2HBTA 1CAXA 1HQLA 1IPSA 3I3EA 5FYCA 3B94A 5ABJB 5JXHA 5A3UA 3VHRA 2ZHLA 5FBJA 3CJIA 2P6HA 4OULA 2RS13 1S0FA 2RR13 4DUVA 1PVXA 1QY4A 4Q4X3 4QHOA 3RZZA 4CCOA 4HSLA 4MXWB 2BTVC 3WG2A 3ZYPA 5CFCA 3DCQA 1XRUA 1FNZA 4BXSV 4AFBA 5HCBA 2ILMA 5BYNA 4JRAA 5GM0A 4E8CA 1YQ5A 4BPZA 1UOFA 4DPNA 2XONA 4AR2A 1AR91 2DFCA 1PGW1 2ZGLA 5FP8A 4IEVA 4HKOA 5ABJC 5IK5A 2ZX2A 4K3UA 4RHV2 5E6HA 4YVSA 4FFFA 2DTWA 3C7GA 3LF7A 3MUY1 2P37A 2UWAA 3LPGA 4RYDA 5FXWA 5BNOA 1RXFA 4XAAA 2R32A 3WNKA 5JMOA 1W05A 1NE6A 4HKWA 3THDA 2VZQA 2JE8A 2W2IA 3ECQA 1JI6A 2DCKA 3NNJA 1PNGA 4BLJA 1GZWA 5BNNC 4NHMA 1H1MA 3IN9A 3B9CA 3CMGA 3HNBM 2ZGNA 2R0HA 2NQYA 4RHV3 4WV8A 2BGPA 2XWJB 3GDBA 4IXLA 5A70A 4LHKA 2D40A 2WWUA 3NKTA 2P5BA 1US2A 4LHLA 4BYYA 3B93A 1OVPA 4LBJA 3WT3A 1LECA 1RTVA 4NIHA 1UIJA 2X10A 4QKDA 1AL0G 1GYKA 1DYOA 3AZVA 4AG4A 5HCAA 3RI9A 3RZLA 3UYJA 2ZXQA 2VO5A 5A7OA 4QT6A 4YVWB 3OOXA 3PNAA 4JZRA 2GZWA 1QJX3 5FZ4A 4AQSA 4UW3A 4AI9A 3QACA 1X9PA 3POJA 4B29A 4DXSA 3R05A 3ZMOA 1PM7A 1YJLA 3I2HA 4MH0E 3OPZA 2TNFA 3BCWA 1BEV2 4F8AA 1JYNA 1W8WA 3U07A 3PVEA 2D6MA 4NPLA 4INDA 5A3TA 2QVSB 3RYRA 3NAPB 2VXJA 2Y6GA 2GAUA 4DQAA 1JYVA 3UETA 2UURA 3WY6A 3ACHA 1WLWA 3OGSA 2GNMA 3A23A 4KU8A 1B09A 3VBHB 4LLFA 1FV2A 4LO4B 2P17A 2WZ8A 2VUDA 3JD71 3K75B 3URFA 2JB8A 4N53A 4JX0A 1UU4A 4JGYC 3C7OA 4JHTA 1UNBA 1QH6A 1BEV3 1W2AX 2WBKA 1W0PA 2P3IA 1NLSA 1VIWB 1JODA 5FK8A 1OD3A 2WLPA 1GNHA 1DFQA 3ZPYA 3POEA 1VBE2 4UBGA 5F5IA 3S5QA 3NNMA 2VMHA 4QHBA 4D94A 4LOTA 4EQVA 1YHFA 4IE7A 1JZ7A 3ZXAC 3VBHC 2ZHKA 5A3MA 1DLCA 3AJZA 4Q0VA 4Q29A 4QPIA 1VPHA 2BVBA 3PUQA 3VBRC 4CUBA 3ZXFA 1RUF2 4AVSA 1DQ1A 1TME3 4AVTA 4KI5M 2BZDA 3JU9A 5IVVA 4XJ8A 3I2OA 2GNTA 2Y6FA 3TWIA 5F9TA 5K0UB 1AR82 3NNFA 5C4WA 1F9KA 1LODA 3OBTA 4KBBA 4YM1A 3UKTA 4GWNA 2JE9A 1WGPA 2PHDA 5T3NA 2WFF1 3C8XA 3CL1A 5CG8A 2IXKA 3WG3A 3EO6A 5EJZB 1O3QA 4GKYA 1OUXA 4U36A 4LORA 2E7QA 5F39A 1E5RA 2E26A 3HAGA 3VBOA 1Y43B 1SLCA 1NA1B 4JV4A 4K8RB 2JKXA 1G9BA 4OUEA 3C7FA 3KQRA 3ZDSA 1H4HA 1HV1A 1RUF3 2RE9A 1SLAA 2PHFA 3OEAA 3EJKA 1BVVA 1X50A 3AVRA 2DBNA 4L11A 2YB7A 3POGA 2IC1A 1AR83 4COWA 3T2QA 2WFPA 4IV1C 2R061 3KVAA 4A2UA 3VD3A 4ISRA 1FOD1 2H0VA 3KSCA 3A4UA 4D6RA 1YQ2A 4IERA 3DYPA 2OKXA 2CNAA 2BERA 1IGOA 1T2XA 2GC1A 2QCSB 1NA1C 1ZRIA 2YHJA 4M0HA 2Q8OA 1L7QA 4AHZA 3O1MA 5FY1A 4HOOA 3D8CA 4PF5A 1PO21 2XDVA 1IG3A 1OXCA 4BU2A 3BOWA 3L9JT 4UFLA 4F83A 4NWWA 4F3JA 2IXHA 4UFMA 4LT5A 2JX9A 1UZZA 2NP0A 2VE1A 1AR61 3KV6A 4XUOA 5A80A 3AXEA 3GNEA 1ULCA 4XOGA 1LHOA 4W6XA 1VAVA 4GH4B 2YPJA 1LEDA 4RFT0 1VB2A 5KC6A 2J1EA 2C5DA 3ZFFB 2ZGUA 5KXCA 3MW3A 5BNPB 1JU4A 4LKEA 2D43A 3AMMA 4MV2A 3OY8B 2QQKA 3KT1A 4ASKA 4M00A 3M2MA 3V0AA 3PHMA 5I0DA 1LNSA 2D6NA 3HNYM 4IGPA 4Z8BA 3I2GA 1KJRA 3OGJA 4KQ7A 4WVVA 5FP7A
chains in the Genus database with same CATH topology
1MVEA 4GH4C 2MEV3 5CAZA 2WKKA 4J1WA 4XTMA 1DIWA 1PK6C 1W6PA 2O8OA 2A71A 3ZFFC 4AHYA 2QUOA 2BQPA 3WQ0A 4TLFA 2EA7A 4BZ4A 3NV1A 5I0TA 2VVDA 4LBLA 1WW5A 3CEWA 4AFDA 5L7OA 1PGL2 2HYKA 1F5FA 5F6KA 4MZUA 5F6LB 3AX4A 2FHRA 4XJAA 3GHNA 2YY1A 1AR92 1PGW2 5FFOC 2R042 4B4QA 3POSA 2JE7A 2PHWA 1N3QA 4CDUB 3EXUA 3ZYJB 2B5HA 3IDEA 4N43B 1A8DA 2TBVA 3UK9A 4YZ2A 1H8VA 4YRDA 3ETQA 2ZMLA 3CJXA 3E6DA 4XBQA 5GLUA 3ZFEB 4B8EA 1KS4A 1OA3A 5HI0A 1LHUA 1WD3A 5I93A 2RS51 4UW5A 3V56A 4E2QA 3ZYIB 2WNUA 1AR93 2HEYF 3RRDA 4YM3A 2DURA 1WMEA 1D4VB 2VY0A 1K5MC 4GWMA 2A6YA 2CL2A 4FO9A 3L2YA 4YW1A 5K8SA 1AJKA 1QJU1 3NV4A 3E97A 1CAWB 4OVEA 3GBGA 1ZZ7A 2HWB1 5IK8A 4FTBA 3SITA 3ZYGA 2AGSA 2FBEA 3BU7A 4JCKA 3UKNA 2Q1ZB 5LRSA 4XJZA 3RYPA 2YC0A 5T5OA 5C8CB 1Q5OA 2GC3A 4OZXA 4FCAA 3OD0A 2I45A 4LNVA 1GR3A 5CFDB 4CDWC 1O7FA 2E9QA 1R081 1XNBA 1NZCA 3P3PA 5E16A 2K2SA 3KCYA 1RHI2 1UCXA 1FNYA 4RQPA 2RHPA 3NWKA 4K1YA 4I09A 4WVZA 4RGGA 4ONUA 4HT1T 4YGEA 2ZMNA 3JD72 4HMZA 4DY3A 4FAGA 1ASJ1 2VNOA 5CFDC 4H3WA 4N90A 2NN8A 1OFSA 4JRLA 4JDNA 5A33A 1UF2C 3BALA 5FOJB 2ARXA 3H7YA 3ROUA 1PMIA 3MW2A 1S0BA 4I02A 4YG0A 3E5QA 5DUUA 1CAVA 1LR5A 4N9HA 3QH7A 3JD73 3AKSA 4FSJA 2JKBA 4UBHA 3S6PA 5T54A 2ZGTA 3LB9A 4R4XA 1REFA 2ZCWA 1LGCA 3IKWA 4FOVA 4JDOA 3WZ1A 1MVQA 2PHLA 2WFF2 3VBUB 1NCRC 4DOUA 1RUD1 2IXIA 3MEPA 1OQEA 5AVAA 1XE7A 2XKPA 4XW3A 4XBLA 4IV3B 4HZFA 4DNYA 2GSYA 4AI2A 1OD5A 1RJ7A 4EN7B 2H6BA 5KBFA 1ZBA1 1FOD2 4FTEA 2WFF3 1UU5A 4QQLA 1V70A 1EAH1 3NVCA 5K7PA 5SV5A 5TSWA 4D3WA 4PDWB 1X36A 2EXHA 2R49A 3AP7A 4WM7A 2EALA 4ISQA 1PO22 2I2SA 4WM8C 3WG1A 2ZX4A 1VBC3 4PBOA 2NLRA 3FZ3A 4M3CA 3WUCA 3VDDA 3VZJA 1AR62 2R063 3K51A 1FOD3 4GKXA 1REEA 3HQXA 5T5JA 1Q8OA 4PDWC 4P9LA 2CAVA 4XFBA 3VL9A 3KMHA 2CTVA 1BVP1 2XLAA 3KM5A 4XZPA 3E6CC 1RUOA 4H14A 2LUWA 1PO23 4G4FA 3OCPA 3WQ1A 1LTEA 3QCWA 3TNQA 4GB31 2DVBA 4OUMA 2VQ0A 3VBFB 5GZEA 3B5LB 2DU1A 3V0BB 2GMPA 1DZRA 3H7JA 2OZ6A 4SBVA 2OW4A 3MLKA 2GALA 3DPRC 4XFFA 3JBG1 4RL7A 4AYUA 5A3LA 2OA2A 1YFXA 2ZGKA 1C5HA 1OPOA 3IWZA 1TQ5A 1RC6A 2BGCA 5GLZA 1ULGA 3WW1A 1SLIA 3TB0A 2JG9B 1AVBA 4Z82A 1X7NA 1OA4A 1QQP3 2YGLA 4FPHA 2EVXA 1YJKA 4EWEA 4YG3A 3N35A 1M4WA 4HETA 4YSFA 1A6CA 4L99A 3WDTA 1MZ6A 3W58A 5KXBA 1H30A 1GQHA 4Q26A 2A70A 2H0BA 2JG9C 4E2GA 4QD2A 2AYHA 1CD3G 2RS52 1BCXA 1OFNA 2RMU1 4F7ZA 2QJVA 3FMGA 1S0IA 2DCZA 4QGNA 4LBQA 4Q0UA 1GV9A 2A75A 1CPNA 4Y20A 2YZ4A 1QJU2 1ZREA 1RINA 2AREA 4E4ZA 1RUJ1 2ZGQA 2F4PA 5A32A 2HWB2 4XMAA 3G7DA 5L73A 1AYM3 2RS53 1H8TA 2CAUA 2UYAA 2JG8A 2RJKA 4P9WA 2CYFA 4P9GA 1Q8VA 2PN5A 3SLIA 1QF3A 3OTFA 1CAUA 4CDXB 5FO7B 2QZ3A 2PELA 4YNIA 1CESA 4MX3A 4Q0QA 4XIOA 1YLLA 2GN3A 1GBGA 2ZHMA 4FPFA 4D69A 1R082 1XQNA 3RYKA 1FT9A 5CBLA 1V6OA 2HWB3 1YO8A 4IEPA 1UX6A 2O8QA 4W6YA 5FDBA 1MEC2 2A5ZA 3LOIA 5D8AC 4IEXA 3O0VA 2HWD1 5JOWA 1W39A 4CDXC 4K6BA 4PQ9A 4AEJA 1WD4A 1ASJ2 1YWKA 3WLUA 4DINB 5AFBA 3TN92 5AC91 1SLLA 3ZN6B 1SLTA 2WNVB 5EYYA 4PIYA 4BHPA 1R083 3KCXA 5CIRA 1FV3A 2GH8A 3N7MA 1OOPA 5I0UA 4RR3C 4CZSA 1ZBE1 4LEJA 2WJSA 4CDQB 3WINE 3AB0A 1VBB1 2F6BA 1QNWA 1WLTA 2HWE1 1G9DA 1OA2A 1ASJ3 3VBSB 2WNVC 1ULFA 5FQ0B 2OVUA 5KC5A 4XPVA 3WQ7A 2BNOA 4R9CA 3WVJA 4B7EA 1G9FA 3O7OA 2ZZJA 2ZKLA 1SFNA 4CDQC 1WW4A 2CY6A 2XKOA 1RUD2 2W08A 1AX0A 4P9YA 1NCQA 3VKLA 1WLDA 3AMQA 4ATFA 4Q4W1 3VBSC 4P9XA 1COV1 1LKNA 1QJY1 4ZXKA 1N1SA 5C9AA 1M06G 4CEWB 3AKRA 1H9PA 3RQ0A 4L9BA 3W59A 2X5IC 5CA6A 2I07B 1DZQA 4X8PA 2C9AA 4AFCA 2N7GA 1RGSA 2JDZA 3RDIA 4PLNA 2CGOA 3GZUC 3Q9OA 1RUD3 2BNMA 5JZGA 1RUG2 3AMPA 2D7FA 5FPZA 3PJQA 4PIZA 4YGDA 1NOVA 4X6QB 1V6KA 2D97A 4RD7A 1DF0A 1UPSA 3SH3A 4JC1A 1LRHA 4RS5C 4XMIA 4AFAA 5JPMB 3B3QE 4X6RB 3QOPA 1BK1A 1ZRFA 1ZBA3 2MHFA 5LEKA 2W0XA 1XNDA 2AR6A 4IESA 1BXHA 4QPGA 3ZO0B 3WDUA 1EAH3 1ND3B 4LO6B 3VKOA 3DF0A 4HVOA 3DN7A 5BV6A 2GDFA 4AEDB 4ATEA 1J1TA 4Y4YA 4MGZE 5EXOA 5DDJ1 4XHXA 5FCCA 2BWCA 3AK0A 3LGRA 4K20A 2TEPA 2XGXA 1MS8A 2G9FA 1ND3C 2OUJA 1HLCA 4FP2A 1EY2A 4CEYC 3B00A 2JD4A 5I8SA 1H2LA 3CJIB 2D6LX 5KXEA 2R071 2WL1A 1I1EA 2XL9A 3JBG2 1GANA 1PIV2 3KGLA 4AGVA 1N3OA 4DY5A 3DL3A 2IXLA 3AP6A 2D3RA 1MS0A 3ILRA 3ZN4A 3W9AA 4GB33 1PGL1 4Z1VA 1YIPA 1WCDJ 1QXRA 3CU7A 3CJIC 1LOCA 1B35A 1G7YA 1YI9A 3GBFA 5BNNB 2E7TA 1D2QA 1WW6A 1ND2A 1F8VA 5LEJA 1BBT1 1EYBA 1LULA 2R041 3CF6E 3ZXEA 1RUNA 2XJQA 1F31A 3JBG3 1DGRA 1OLQA 3HMYA 5CFCC 3IPVA 1JW6A 2RJLA 5JSPA 1PO12 2DCJA 2P3JA 5FLHA 2ZS6B 1DQ5A 4LO7A 1D2SA 4YVSC 2RMU2 1H0BA 1VBA1 2D6KA 1TEIA 1MS1A 4HL0A 4LR4A 4YGBA 1UU6A 2ETEA 5BNOC 1GICA 4NHKA 1OHFA 1QWRA 4YZ1A 4DXZA 1S2BA 2ZTNA 3H8UA 1POV1 1RUJ2 4MGKE 4GALA 2VECA 4Q1PA 4R52A 3UJQA 2HJIA 4FPLA 3ST7A 4KNCA 4AQ6A 1VALA 5JSOA 1F2NA 3GHMA 4M3CF 2Q4SA 2RMU3 2I74A 2NZ9A 2PA7A 3RJ2X 2ZGRA 3VZKA 4U2AA 1D4M2 3ZSMA 1Q3EA 3GZTB 4R9DA 3J8F1 4YLZA 1WW7A 2UYBA 2YMZA 2ZGOA 3AKQA 4ORFA 3VUOA 4PLMA 1AYN1 3ZFGA 3GZAA 2DV9A 2QDNA 2R0FA 2WT1A 1W6QA 2BEOA 3EBRA 4DRRA 3MIHA 4IEWA 2GMMA 3AP4A 1JH5A 5EYXA 4J6GA 4JGYB 1ZA4A 3ZXJA 5JI9A 3AMNA 3DV8A 4OLLA 5E8AA 2HEVF 2OIIA 3HD8B 3LZZA 3MF6A 4LA3A 1POV0 2VXRA 3POWA 1RHI1 2HWD2 2PAMA 2ZPXA 3FBMA 1QHDA 3LA7A 4N53B 1QJZA 4Z2WA 1LJ7A 2IFWA 5AC92 3LSDA 2HWF2 1J59A 2TUNA 1W6OB 3VBRB 1DHKB 2VOXA 4YVWA 1IS3A 4ITCA 2R1DA 2SLIA 1MR5A 1XYPA 1DQ4A 1MZFA 1ZBE2 2ZX3A 4N53C 1VBB2 2HWD3 2W39A 3TRSB 2HWE2 1WBLA 4Z07A 1JXNA 1YFWA 4IETA 3K48A 2O0OA 4HLTA 5AC93 3KT7A 3NAPA 3N3HA 5EWSA 2BUKA 3H3UA 4Q4Y1 4L97A 1WMFA 4MSVA 1O91A 4L2NA 2Z2SB 4HN1A 4QPIC 2ENRA 4HPKB 1ZBE3 1VBE3 3PVBB 3TBDA 3M3OA 2CWMA 3MGUA 4IV1B 4XF9A 5JPNB 3O12A 5J96B 4FPOB 2VGDA 4Q4W2 1RUH2 4QXKA 2HWE3 4AI3A 5BPXA 5C4WC 1COV2 3OF1A 2XJVA 4XIKA 1QJY2 3GYDA 3VHOA 3FHIB 3N36A 1URXA 1J3PA 4K7JA 2VG9A 3FLRA 2MNGA 1D0HA 1C5IA 2DWRA 1PZ7A 3VBOC 2V73A 1QMJA 3MFAA 4GIQA 1AZDA 4KGGA 4NO4A 1UMZA 4YW3A 1WCKA 1RUE2 4MYEA 4XFGA 1XU1A 5DZEA 5K0UA 4MGIE 1Y9QA 4FP3A 4Q4W3 3M3QA 2Y0OA 3MW4A 4MGYE 1COV3 2ZA9A 1YRZA 3I4IA 4MVTA 1NQJA 1QJY3 1ZZCA 1V6MA 3IDCB 4EN0A 5FRAA 3NKGA 4FQ4A 5FREA 4YARA 2DTYA 1KDMA 4UW6A 1C1FA 3KGZA 3R6SA 1C28A 1MZ5A 4R8HA 1QGLA 1VJ2A 3VKFC 1DGWX 2ZGMA 3UV9A 5ACA1 2Y0IA 4QU2A 2VQAA 4L8QA 5DDJ2 1QNYA 3CLPA 1PK6B 2E6VA 4XILA 5GALA 3V0AB 3HT1A 3WHUA 4XF3A 3H1WA 1W6NA 4I2OA 1YCIA 2YUEA 5KHHA 5T5PA 2UY8A 3AXDA 2XJTA 3ELNA 1W6PB 1LHVA 3O0XA 5IUQA 1R091 2RM21 3ZSJA 2R072 3FJSA 1RIRA 5L7OB 5DDJ3 1QOSA 5J37A 1UZYA 4DB5A 1EPWA 4CP2A 2XHKA 1HV0A 3U11A 1ULEA 3SCGA 5I91A 1VBD1 4ZKTB 3THTA 1D0GA 1Z7S1 3FE5A 5BNPA 1BBT2 2ZAAA 2R073 3OY8A 2K9ZA 2XLFA 1H2NA 5L7OC 5CG9A 3VZLA 2R16A 1K5MB 1GKBA 4KGQA 1X8EA 4B3NA 1VBA2 1YUDA 5JDBA 1BMV1 3H3ZA 4HVQA 4C90A 2EIGA 4Y1XA 1BBT3 1N1VA 1FATA 2DUOA 2R043 3ILNA 3UJOA 1BZWA 2D3PA 4FTSA 3WCRA 2XJPA 1HKDA 4N7IA 4XQWA 1QXPA 2WNUC 4BIOA 5C8WA 4NPRA 1JOJA 2JJ6A 4CDUA 4E27A 5J48A 1VBA3 4CDWB 4N43A 3J8F2 4EN8B 3N4MA 2VOKA 1IQAA 5JOYA 3ZFEA 1AYN2 3WX5A 3U4XA 3DKWA 1O3TA 1X8MA 1POV3 4YYOA 3VZOA 4TZDA 4QPYA 3QLQA 4FPEA 1AXYA 1AJOA 4PBPA 3VKNA 3SISA 4TYSA 1FYUA 1TE1B 1Q8QA 4GQ7A 3AKTA 1MEC1 5EJ3A 3J8F3 1UN1A 1CAWA 5JOZA 2WT0A 3KT4A 1KRIA 1AYN3 1XU2A 4RQPC 1RMU2 3R4UA 3TN91 3H1MA 3ZYRA 3RI8A 3IT8A 1O4TA 2HWC1 3AM2A 4P9IA 4IEZA 4AVAA 4LO5B 2V09A 5C8CA 3APBA 1RHI3 4JTNA 3JZVA 1NCRB 1TNFA 2DU0A 4I0WB 1A8MA 1FXZA 1UL9A 3FBYA 2Z69A 4D7YA 2R30A 3QH6A 5HXVA 3ZSKA 2WC2A 2X8KA 4Q4Y2 2JEMA 2ERFA 1MS5A 1DQ2A 4Q4V1 4ASLA 2DUQA 5L19A 1DGLA 1FI2A 2BVVA 1LB2A 5HBAA 4BE3A 1OKQA 4YM2A 1CX4A 1MS9A 5KHGA 4XFCA 1I9RA 5T52A 2VH9A 3UL2A 1S0DA 1LHWA 1HIXA 4XJWA 4DMIA 5FLIA 1U5ZA 1MACA 4I3PA 4Q4Y3 1I3HA 1QH7A 4AVBA 4WM8B 3BODA 3RMXA 1HDKA 4S2DA 3LKJA 1XYNA 1PGSA 1FMD2 2VULA 3D0JA 3VZNA 2QFEA 5LK5A 4N9IA 3LSEA 4FAHA 4LBNA 1CQ9A 1AXKA 2FZ2A 1TNRA 2VOVA 1RUG1 3WHTA 4H55A 1LEMA 2CGNA 4M3CB 3N7KA 3VDDB 3RPQA 3VBUA 3KLSA 3AMHA 1Q56A 4J1XA 1U12A 3WNXA 5ACA2 4QQHA 3DUIA 4IV3A 4P9JA 1ULDA 4KG0A