1Z78A

Crystal structure of the thrombospondin-1 n-terminal domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
NSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin 1
publication title The structures of the thrombospondin-1 N-terminal domain and its complex with a synthetic pentameric heparin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2005-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1z78A00
5T5LA 5GLWA 1DGLA 3KQRA 1WLDA 2EXHA 2GNDA 2ZGPA 3N7KA 3WG1A 1NLSA 3ZYPA 2DTYA 1OKQA 2ZHLA 1SLTA 1V6IA 1KJLA 1S0BA 1YO8A 3N3HA 2VW2A 5GZEA 3WNXA 2ZHMA 2LALA 4Q1PA 2GALA 4XJAA 1G9BA 2PHRA 1KDMA 1W6PA 2A6XA 3RSJA 1JHNA 1X50A 4GKYA 2D6PA 3PMEA 1S0FA 2ENRA 4D69A 4AGGA 1UZZA 1S0CA 2R49A 2GN7A 1RIRA 3V0BB 5IK8A 5CBLA 3D6EA 3OPZA 1LOAA 4R9BA 1LHVA 2AR6A 4RA0A 3ZSJA 4FVVA 4ATFA 4PCRA 3V0AB 4Y22A 2PELA 2DYCA 4LBNA 1S0EA 3FBYA 1G9DA 1LHNA 2W39A 3ILFA 4SLIA 1S1AA 4YZ2A 1HKDA 1G9AA 4XMIA 4Y1VA 4AVSA 4BMBA 1LHUA 2DVBA 5DG1A 2ZGNA 5GLVA 4LBKA 1WD4A 1JUIA 3B3QE 3NV4A 5GLTA 2EAKA 1H30A 5FREA 1AX1A 1WLCA 3FLRA 2D6LX 2GNMA 4YZ5A 2GDFA 5H9RA 3M3OA 2P3IA 3BOPA 3LSDA 3AP4A 3R05A 1Q8VA 1VALA 1DQ4A 4YM3A 1CIWA 3AZVA 2EF6A 3H0OA 1QDCA 3QCWA 2AREA 4YFWA 1ULDA 2R16A 3AYCA 1W6NA 3FUQA 3PVNA 3MW4A 4LBQD 3VUOA 4XBLA 1SLAA 4CZSA 3WDWA 1AVBA 1MVQA 4FPOB 3MW2A 1FNZA 1H9WA 3T1MA 1JXNA 1GLHA 1G9CA 1DBNA 2A70A 4FPKA 3OBRA 3IPVA 3WVJA 2C9AA 5F9TA 2ZGQA 1BYHA 2ZZJA 1N3QA 1KRIA 1LGBA 3AJZA 1SCRA 1W6OB 5IUQA 2Z42A 1V6LA 5AVAA 3T2TA 1I3HA 1V6NA 4Y20B 2D6NA 2CTVA 1ZM1A 2NN8A 5T5OA 2XG3A 2ZMKA 4YZ1A 5T5PA 3A0NA 4Q2FA 1DLLA 1VAMA 2A5ZA 4ISQA 2JJ6A 2NZ9A 5IK5A 1LOCA 2D6MA 1HDKA 3U4XA 1GNZA 3POYA 3N7JA 1MS5A 3VKNA 3PVEA 1W6QB 1FYUA 3VKMA 1JYCA 1ULEA 3C2UA 4DFSA 5IK7A 4BQ1A 4W65A 2ZGTA 3CNAA 3BTAA 3POWA 4XIOA 2JDZA 1V6MA 4YGCA 3D4KA 2P3KA 1ULGA 4JCKA 1O4YA 5E8AA 4GXLA 2BQPA 1RINA 1F9KA 5F5QA 3SITA 1Q8OA 2DVGA 2VY0A 5L73A 3ZXFA 4M3CA 4UW5A 4WV8A 1DQ2A 2PHFA 2YV8A 4Q26A 1ULCA 4BOWA 1DQ1A 4XXPA 2B7YA 2GNTA 3B69A 1WCSA 2A6VA 1CONA 3ZXEA 3USUA 2FMDA 2AUYA 3AP7A 3OY8A 1LCLA 1N1TA 2DVDA 2WSUA 5GZGA 4M3CF 4FOYA 1YI7A 3GNEA 4XIKA 4DQAA 4PQ9A 4YLZA 1G7YA 4FPHA 4XXAA 1QNYA 1C1LA 4YW3A 1FX5A 1GKBA 1LGNA 1CESA 1UKGA 1WW6A 4OZXA 3RS6A 2CL2A 4AYUA 1WBFA 2DV9A 3IN9A 2UWBA 4I30A 3UJOA 1WW4A 1Q8QA 1JW6A 1SLCA 1GNHA 1LOFA 1ONAA 3SLIA 1AXZA 1OQ1A 4YW5A 3AZXA 2JD4A 1GZCA 2YROA 4FP3A 2YXSA 5KXEA 5DZFA 2CY6A 4DRRA 2TEPA 1MVEA 4P14A 1OFSA 4YGDA 4UW3A 4BMEA 2EXIA 2D44A 1A8DA 5KXCA 3HN1A 3M3EA 4ZXKA 2I2SA 2ZGOA 4HL0A 1SCSA 5DZGA 1CJPA 3JUUA 3DGTA 2CYFA 5DUXA 4ASMB 1PZ8A 4U2AA 2NM1A 2VH9A 1EPWA 3V65A 1SLIA 3M2MA 5FRAA 1HQLA 4C1WA 4XE9A 3T1LA 4LBQB 3W58A 1O4ZA 1AJKA 2D3PA 1GSLA 1H9PA 2DU1A 1PZ9A 3AP6A 1CPMA 4Y1UA 3N7LA 4YZ3A 2PHTA 2ZHNA 1UL9A 2OUHA 3FLTA 2JE7A 1W6MB 1G8WA 2LTNA 4IQPA 4R9DA 4YW4A 1R1ZA 5EYYA 4YG6A 2JKBA 4XBNA 1S0IA 3TAYA 4K1YA 2VW1A 5T52A 4PBOA 2AGSA 1VAVA 3I8TA 4RL7A 1SBDA 4ITCA 3POSA 1YYNA 2ZACA 5H9SA 4H55A 2A3YA 3WUDA 2A3WA 2FHRA 1YIFA 1V6KA 2WT1A 2C5DA 4BM8A 1AZDA 2DUOA 1Q8SA 1DZQA 4GA9A 1SFYA 3RRDA 4CRQA 4AVTA 3OYWA 3R4UA 3WG4A 1N1SA 3D5OA 1LU1A 1QMJA 4K20A 3NV2A 2GN3A 1VLNA 4Q8KA 1I1EA 1LU2A 2WT0A 3VV1A 1UX6A 2EALA 3ZSLA 3IMNA 4YGBA 5T50A 4GKXA 2AH2A 3WCRA 5T5JA 1IS6A 5EXOA 1AX0A 3LSEA 1GZWA 3AYEA 3V64A 4XJ9A 1SLLA 4FPFA 3AX4A 1MS1A 3O0XA 5DUVA 1QDOA 2W52A 2WNEA 3ZXKA 3ZVXA 1MS8A 1QNWA 4PF5A 3AP9A 4LBMA 4YM1A 4AGRA 4FOWA 1Q8PA 1MS0A 1ENSA 4XILA 2D3RA 1S0GA 4BLJA 2Q5TA 2DUQA 3WOGA 1DIWA 1LECA 2DUPA 3SH4A 2E51A 5HCFA 4DPNA 3VKLA 1S0JA 2ZAAA 5GZFA 2P37A 3WCSA 3HMYA 3OGGA 4P9XA 1DFQA 1LOEA 4L8QA 1U0AA 1ENRA 2GMMA 1UPSA 4F83A 1MZ6A 3WUCA 3ZSMA 1FATA 1AJOA 4FOVA 1CVNA 2DVAA 4XJZA 3AZZA 1DYKA 3NWKA 1URXA 4Y1YA 5H9QA 2RHPA 2E53A 3V0BA 1IS5A 2ZGLA 5LK5A 4GWMA 1W6PB 1QF3A 1SLBA 1GV9A 3V0AA 2SLIA 5DG2A 1AXYA 2ARXA 3MW3A 2UWCA 5EYXA 1IS4A 1C57A 2W08A 1ULFA 4AWDA 4C1XA 1LODA 2R1BA 4XTPA 3VKFC 3O0WA 1D2SA 3N36A 1BQPA 1QOOA 2EXJA 4FPJA 1LOFC 2ZGUA 3AYDA 4UW6A 2UU8A 1QOTA 3AXEA 4P9WA 4Y22B 1WW7A 5DXDA 3B9CA 3ENRA 1MR5A 2NMNA 1C4RA 4FOQA 4DS0A 5CAZA 4YM2A 3O0VA 1LESA 2UURA 5DZEA 5HCAA 5JOZA 3A4UA 3R4SA 5CNAA 2OVUA 4DRVA 4FPEA 1TEIA 2WQZC 2ZABA 4KBBA 5EWSA 5JOXA 1W0PA 1WD3A 5GJ6A 4FQ4A 2GMPA 3SNMA 2WJSA 3AK0A 1LHWA 2XB6C 1SACA 4XJWA 1YRZA 1G86A 3PJQA 4GWNA 1F31A 4XJ8A 4XOGA 3UL2A 4M01A 3M1HA 2G4IA 4NO4A 2YY1A 4FPGA 1W6NB 1LTEA 1FAYA 4ISRA 4U36A 4M3CE 4P9YA 1W6OA 4XHBA 3AJYA 4Q27A 1J1TA 1JOJA 2ZGRA 1IOAA 3M3CA 4FPCA 4YW2A 4XZPA 2A71A 2JECA 3AZWA 4Y20A 1SBEA 3WG3A 3WDUA 3WHUA 3IPVB 2CWMA 1DYPA 2ZGSA 3KM5A 1LULA 1LGCA 5IK4A 3INAA 1GBGA 3IKWA 3WLUA 3TB0A 2ZA9A 1DQ6A 1F5FA 4XYXA 5DUWA 2KM2A 3L2YA 4BPZA 2NP0A 1MS3A 1KQRA 2ARBA 2A7AA 1JBCA 2VXRA 3NV1A 1IKPA 3UJQA 4CTEA 1JYIA 2DTWA 3WZ1A 2P34A 3JU9A 4Q1RA 3AYAA 1CN1A 1IS3A 1SBFA 1DQ0A 1YXWA 1A78A 1A3KA 2ZHKA 4XJUA 1RITA 5H9PA 4YG0A 1LOGA 2WSVA 1PZ7A 1HLCA 3FFZA 3WDVA 1UMZA 2WLQA 4GALA 1Q56A 1C1FA 3ZYRA 1BJQA 2A3XA 2A6YA 4AGVA 3RQ0A 4LBLA 1GICA 1B09A 1WW5A 1JN2P 1Z0HA 2R0HA 4FQZA 4K1ZA 4M3CB 1BZWA 2NMOA 2P2KA 2D6KA 5CB7A 1QKQA 3I4IA 4XMAA 4ATEA 2ES3A 4FPLA 3USUB 5JLVA 4XHXA 1QU0A 3MEPA 3MPPG 2R0FA 3OY8B 4Q8LA 2EIGA 3LCPA 5JVVA 5E89A 5T54A 3WG2A 1HQWA 3NV3A 3PVOA 3ZSKA 1MZ5A 1V6JA 4BLIA 4TZDA 2GNBA 4M00A 1DQ5A 4LBJA 4YW1A 2ZMLA 1D0HA 1S0DA 2VU9A 2YZ4A 1WLWA 1KJRA 2R1DA 3M3QA 2ZKNA 3HR9A 1G9FA 3FLPA 3N7MA 3AP5A 3ZPYA 2DURA 1MS9A 1ENQA 3BODA 2AENA 5GALA 4ZKTB 5CA6A 2YMZA 3DUIA 1Y7BA 4YGEA 1UAIA 2PHUA 4AVVA 2H0BA 3WDTA 3RG0A 2OUJA 2ZGMA 3B01A 2HYKA 3AZYA 1KDKA 3WDXA 1V6OA 5KXBA 3B00A 2P3JA 5GLZA 2AYHA 3RMXA 3SISA 1BXHA 4JRAA 5HCBA 2PHXA 3O5SA 3Q9OA 4K21A 2D6OX 4LBQA 2W68A 4PBPA 1UZYA 1FV2A 1MS4A 5T55A 4JC1A 1UN1A 4MYEA 2VW0A 2CNAA 3SH5A 1CQ9A 1CR7A 2DU0A 3FUOA 4R9AA 3A0KA 1LENA 1W6MA 1N1VA 3W59A 5GM0A 3WHTA 3APBA 3WDYA 1BKZA 4Y1ZA 5BYNA 5GZDA 5JMCA 5JOWA 3IM0A 3ILRA 4XTMA 3VKOA 3QLQA 1CPNA 3SH3A 4Y1XA 1LJ7A 1N3OA 3RMYA 4HANA 1IKQA 4XDQA 5SV8A 4WZFA 1MACA 1N1YA 5E88A 2UWAA 4UW4A 1WUVA 2WT2A 4Y26A 5GLUA 3ILNA 2A6WA 1XQNA 5IT6A 1V00A 3ATGA 1DHKB 3UK9A 3ZXJA 1GZ9A 1LEMA 1VIWB 4Y24A 3AXDA 5JDBA 1QOSA 2CWSA 1NXD1 1GYKA 2ZGKA 2ZMNA 3OJBA 1N47A 2D7FA 2E7QA 2VUAA 1W0OA 4NOTA 1AX2A 4YM0A 3OYWB 2E6VA 2A75A 3OBTA 4Z8BA 2NYYA 2A6ZA 3ASIA 1KITA 1LHOA 2DWRA 3BIWE 3ZXLA 1LEDA 2EXKA 2WKKA 2PHWA 1APNA 3O12A 2D3SA 4WVVA 3GALA 4R9CA 4WVWA 2V5YA 2JE9A 3WV6A 4YG3A 3AFKA 1AF9A 1GZWB 2ZBJA 2E7TA 3N35A 2V73A 4LBOA 2SBAA 4XBQA 5JOYA 1AXKA 5GZCA 1WBLA 1Z78A 1FV3A 2OW4A 4TYSA 1FNYA 4YZ4A 5KXDA 2DVFA 4FPYA 5DUUA 1LOBA 1QGLA 2D43A 2ERFA 1ZA4A 2GMEA 4YFZA 4FP2A 1W6QA 1N3PA 1GANA
chains in the Genus database with same CATH superfamily
5JIAA 2X5IC 1AYN3 4EN6B 1O3QA 1AYM3 1UCXA 4O65A 2GNDA 2WINB 1H2NA 2BOIA 2Y38A 3WG1A 5CKNA 1VMJA 2ZHLA 1SLTA 1YO8A 4F3JA 2VW2A 3PIJA 4GJYA 1W8ZA 1UXZA 2ZHMA 4JHZA 2VM9A 1G9BA 1OXCA 4OHYA 5BNOB 2Q8OA 1UYXA 1X50A 2D6PA 2W95A 1CAVA 4IV3B 1O3SA 4PF1A 1S0FA 3D82A 4IEVA 4D7TA 2EIEA 4RN5A 4XUNA 4BIOA 4DXZA 2XKOA 3BVCA 3EBRA 3ZXDA 1SG3A 2XUMA 4XACA 5FWJA 4TSVA 4ES9A 3AMMA 5CBLA 5DAQA 1LHVA 4CEWC 4YPJA 3HD8B 1HB1A 2OQ6A 4QB6A 4CCEA 4ATFA 5C4WA 2CHHA 2Y6FA 4JDNA 5EHDA 4LBNA 1UIJA 4I0AA 4KG0A 2HWC1 4Z82A 3O1MA 5FYCA 3LGRA 4CP9A 1LHNA 1B35C 1G9DA 1AYN2 1FPN1 1AYM2 2QTWB 1BMV1 3BU0A 3FHQA 4Y1VA 2Q4SA 3U78A 4AVSA 4BMBA 2FZ2A 4IE6A 5DG1A 5DMYA 2Q8EA 5F3CA 1NCRC 1PX3A 1UY0A 3NV4A 1NZCA 2ZEXA 2PAEA 4A3ZA 1WLCA 5FO8B 4XQWA 1KS4A 2P3IA 3H3UA 3LSDA 3AP4A 1PVC3 3I2DA 5EJZB 5FLJA 1DQ4A 3UGGA 3H0OA 1CX1A 1QDCA 1XPWA 2AREA 4LO4B 4QHOA 4YFWA 1Y9GA 3AYCA 5HXMA 1W6NA 4IGPA 3RDIA 3BIEA 3TBDA 4CZSA 1AVBA 5FPAA 4O7XA 3MW2A 5F39A 2VR4A 3T1MA 1H6YA 2Y64A 3DPRC 3ZFEC 5A7WA 2A70A 4MZUA 4OQ9A 3PUHA 5FZKA 3IPVA 2C9AA 4ZU7A 5F9TA 5ABJC 2P5BA 2VOWA 2J1AA 1UY2A 4H14A 2XMLA 4KWUA 3RJRA 3ZYJB 4CPBD 3KV5A 1F2NA 1SCRA 4B1MA 2OS2A 3GBFA 1QJEA 1I3HA 3BPZA 2OPWA 1BEV3 1EAH1 2D6NA 4AQTA 5LWBA 4MXWA 1W3XA 2XONA 4YZ1A 2WWJA 3A0NA 1UWWA 4JRLA 1OLQA 5FXVA 2FQPA 2G1MA 2BUKA 2NZ9A 4YW6A 3U4XA 1NKGA 3N7JA 3OUIA 1MS5A 5FBZA 1FYUA 2EICA 2JDUA 4AI2A 1PVC2 3C2UA 4DFSA 4DOUA 2BNOA 4AEDB 1AR82 3RI8A 5LRRA 2QQKA 4OQ8A 1ZA7A 1I6XA 2VECA 4X8PA 4CDXA 1LB2A 2HWF1 5JXGA 4HK8A 2N7GA 2HJIA 3IDCB 3RFRA 3SITA 2D40A 1J84A 4UFLA 1QJU3 4IV1B 5DDJ3 4EYUA 5CFDA 1I5PA 2GH2A 5FPVA 4UW5A 4WV8A 3I3QA 1DQ2A 3ZXFA 1QQP1 4CDWA 5CFCC 3KZ4C 2VBDA 2GNTA 3OGVA 3HT1A 3T2QA 1RL3A 3ZXEA 1BEV2 4B29A 5FMCA 2QVSB 2NLRA 5IVVA 1OSGA 2HWE2 2RDQA 4HETA 1LCLA 5BUVA 4CU6A 3KT4A 1YI7A 3Q8AA 5I0RA 4YLZA 1G7YA 2C6SA 1C1LA 1ODNA 1IHMA 1CESA 4OZXA 3T2OA 3ZN6B 2OIIA 2VNGA 1RUOA 1IG0A 1WBFA 3RPQA 4HVQA 3IN9A 3BCWA 3RZLA 2VZRA 1W05A 1FOD1 1YQ8A 1JW6A 1KFXL 2TUNA 3E97A 5JWPA 1OQ1A 2JD4A 1GZCA 1GP5A 3LDRA 4Q4Y1 1RUG1 3ZFFB 3DYMA 2YXSA 4JDMA 5HCHA 3WNKA 4D6QA 4CCNA 1UZWA 5DZFA 2ZKLA 1QJU2 2DCJA 4NR1A 1K5MA 5DDJ2 2WLPA 4PIZA 3WY6A 3Q8EA 4YGDA 4BMEA 3WNPA 5HXVA 4QPIB 3TOJA 3S7IA 2ZGOA 1NG0A 5DZGA 1CJPA 3JUUA 4FBFA 4BWOA 4S2HA 2VC9A 4A7YA 1HN1A 4U2AA 2I07B 2GZWA 5JCTA 2QBXA 1ND3B 4EZHA 1RUC3 2Y0OA 1O4ZA 4HONA 4LKEA 1GSLA 1S2BA 1NAEA 1H9PA 1NT0A 4Y1UA 1RUNA 2V4AA 1BBT3 2PHTA 2BERA 2R32A 2OUHA 3KV4A 4RR3C 4AI9A 2CU5A 2JE7A 5FZDA 5AFEA 2WZR3 4V2VA 3WF1A 3VZMA 3AKPA 4LO6B 2JKBA 4OHXA 4R8HA 1VR3A 4XBNA 1F4HA 2V4VA 3MFCA 1VBB1 2BTVC 5T52A 4EQVA 1GU3A 2AGSA 2BBAA 3I8TA 2QQMA 1POV0 1AHSA 5L9RA 3AL6A 3VBFA 1D4M3 3KVBA 2YPDA 5FPBA 2WZEA 4H55A 2A3YA 3VB9A 2FHRA 2WT1A 4MUVA 1NLQA 3WW4A 4NIIA 3CJIB 1SFYA 4CXXA 4AW7A 3RRDA 1WWYA 2ADDA 4NPMA 2CAVA 4AVTA 1HN0A 3VHPA 3L9JT 5ANNA 4CUCA 4N53A 4XDPA 3VBOA 1CZTA 1UU5A 4AFDA 3NV2A 2GN3A 1I1EA 4QPWA 1YJLA 2R061 4MHUA 2W91A 2EALA 2F4LA 3PLQA 3IMNA 3U07A 1BVP1 4GAZA 2QCSB 2RS51 2XQRA 2Z4FA 4YNIA 5C8CC 1BK0A 3FHAA 3FJSA 1GZWA 3AYEA 3C8XA 5CZKA 2B45X 3WD5A 4FPFA 3GM8A 5LATA 1JYVA 4XFHA 1MS1A 5FP3A 2AEYA 2J7MA 5DUVA 1T2XA 3S7EA 2WNEA 2YC4A 5A6XA 3WNOA 4CCJA 3GCWA 3HBZA 3P3PA 4YYOA 2GC3A 4J6GA 1QNWA 5FLIA 3ZXKA 3NMBA 3I3EA 4LBMA 2P6CA 2VQUA 4UFMA 1O6UA 4YM1A 3BALA 4AGRA 4AI3A 3OEBA 2WC2A 5EQUA 2E7AA 5FPZA 3WW1A 1Y4WA 4P5HA 5JI9A 1W9YA 4CCLA 4QKNA 3WOGA 4CCKA 1DIWA 2DUPA 4KWJA 1DCSA 4N7IA 3SH4A 3VKLA 2ZAAA 4IUGA 1JZ2A 1NE4A 1W8NA 1PX4A 2NPIA 3OGGA 1K12A 1OURA 1QJY3 4L2NA 4MGZE 4E8DA 2GMMA 4FXGB 5EIYB 2WYFA 5BNPC 1YC61 2PLV3 1YUDA 2DVAA 4XUOA 1UF2C 3V56A 3VDDC 1URXA 1XSQA 1EPZA 5A3PA 2PN5A 3IMMA 3WW3A 2ZGLA 3JXSA 2FDGA 4GWMA 3IDBB 2VMCA 3VBSA 1CAVB 3OUJA 1AL23 2HWB3 3V0AA 2K46A 1ACCA 4ZXEA 1AXYA 4LQRA 2UWCA 4I0BA 1YNAA 5EYXA 1ULFA 2DBIA 3AKTA 2OZJA 3Q8CA 2E63A 1VBD2 5K7PA 4BXFA 4CUGA 1LOFC 4HLTA 4D7YA 3AXEA 3AMNA 2BGCA 4P9WA 5C4WB 5DXDA 5BNNA 3RZKA 4B7EA 2R072 1HXS1 4FOQA 1C4RA 3CJXA 4CP9B 2RR11 4H2AA 5CAZA 1QJY2 3GF6A 3KQ4B 4GQ7A 4HN0A 3HQUA 2WFF1 5HCAA 3MZHA 1J58A 5FBJA 2PLV2 2Z5WA 1ZX5A 2ZABA 2J1TA 3C7FA 5CVRA 3EB7A 3NJZA 2WJSA 4LA3A 1LHWA 4BXSV 2XB6C 1SACA 4HVRA 2WAOA 4XJWA 2Y6KA 3A21A 4XJ8A 4XOGA 1F31A 4AEMA 2OA2A 2TBVA 1HJFA 2B9UA 3ZYIB 1W6NB 4GWJA 1NXMA 2HWC3 5EPAA 2VNOA 2RMU2 1FPN3 1J1TA 4HSLA 5A7WB 2A71A 4Y20A 3WG3A 3J7HA 3IPVB 1QXRA 4Y5TA 2ZGSA 3S6PA 4AI0A 5C5UA 1LGCA 3CF6E 3INAA 1GBGA 5HPOA 3LKJA 1AUYA 5A3NA 4YW7A 2YG0A 4XYXA 3L2YA 2QQLA 5LRSA 1MS3A 4ZZ5A 1X8MA 3Q8FA 4MXWB 5FYVA 3THDA 5JXIA 5L7OC 4C0HA 1AR61 3GHNA 4KU8A 3JD73 4E2QA 1JYNA 2P34A 3JBG1 3LIGA 3AYAA 4P08A 3WQBA 1CN1A 1IS3A 1VBA1 2DCZA 2RG4A 4KWLA 1YXWA 4PI0A 1MQTA 1A78A 3UV9A 2X5IA 5TSWA 1LOGA 1GP4A 2HWC2 2WSVA 4IEZA 4QX5A 4CA9A 4PLMA 5FR3A 1QY4A 1UMZA 2WDBA 2Y33A 1Q56A 4O9GA 1FPN2 1C1FA 5FYTA 3VBHA 4CDXB 1BMV2 4Q29A 3CIHA 2A6YA 5F37A 3H50A 4AGVA 4HT1T 4LBLA 4IXLA 1B09A 5CFDB 1JN2P 4AI8A 4AEJA 3BPSA 4CDWB 4XMAA 4YARA 4IE0A 1QWRA 2QDRA 5D21A 3EXUA 1XU2A 3GGLA 4MXVA 4QX7A 4HKWA 4E8CA 1ND2C 3NAPA 4N90A 1UKRA 1QU0A 2R0FA 3B02A 2RVAA 4NRMA 4CEWA 4D8MA 1IGOA 5A7NA 3WNLA 3PVOA 3ZSKA 1U5ZA 1MZ5A 1RMU1 1V6JA 1NA1A 5FMBA 3FC0A 4JHTA 2HWF3 5DAVA 4DEVA 2ZTNA 4YW1A 2VU9A 5LA1A 1B35A 1O5UA 2J1UA 1G6NA 1UNBA 3ZIXA 2OZ6A 3FLPA 1QXJA 3N7MA 3NO8A 1LR5A 1NLRA 1YFYA 4URAA 1S4CA 1ENQA 1BHGA 2O8OA 3W21A 1NCRA 5GALA 5M0TA 4ZKTB 3ACFA 4ET7A 4YGEA 1UAIA 1EAH2 2H0BA 3MIBA 5F2WA 4UF0A 4BJ0A 4B4RA 1K5MB 2HYKA 3I3DA 3FX3A 3WDXA 4B4QA 1CAXA 4XDOA 4CEYC 5I91A 2AYHA 1M4WA 3E5QA 3RMXA 1WMXA 2ZPXA 2ARCA 2W68A 2MNGA 1FV2A 4QD2A 4Q4X1 3MLLA 4AHXA 1H1IA 4XUQA 1UN1A 3LWCA 5F7UA 1REDA 5EZWA 4QKDA 1CQ9A 2IUWA 3H1WA 3SH5A 2O1QA 4AL9A 4D94A 1LENA 5F5CA 1Q5OA 4UBGA 5I93A 1Y43B 3W59A 5ABJA 4PDWC 4Q4Y3 2HWF2 1RUG3 3APBA 4Y1ZA 2QZ3A 1E5SA 3IM0A 3K48A 5FZAA 4W6YA 3ILRA 3VKOA 2ET1A 4RS5A 1CJDA 1CPNA 1QQP2 2CV6A 4MH0E 4OCTA 4XF3A 5SV8A 3RNSA 3VBUC 3I2OA 3LIHA 4UW4A 2Q8DA 4DNYA 1VBC1 1ZRIA 4OZOA 4QT6A 4H7MA 1V00A 3NKTA 3VBFB 1U5YA 3RZJA 3MV01 1STMA 3UK9A 5KHJA 2WRAA 1UZ0A 2PXJA 3AXDA 3RWKX 1NXD1 1GWMA 4BQWA 2UY9A 5FPUA 2ZMNA 2D7FA 5E6HA 1RUI1 1UMIA 2VMDA 1W0OA 1AX2A 4Q0PA 1FOD2 3DYOA 4TXWA 4P9JA 3O1TA 3PIGA 1W06A 3OBTA 3M4FA 2R6QA 4YVSA 4N53B 4KL1A 4BQ2A 3VBOB 1WCUA 4Q4Y2 3KWVA 5FMDA 2DWRA 1RUG2 3VZNA 5ACA1 4AF9A 1VBB3 3K51A 1GOFA 2B5HA 5C3OA 4DUWA 2PHWA 4HKLA 2XLGA 4WVVA 4B3NA 3BGAA 3ZDVA 1OMIA 2P3YA 4YG3A 5D8AC 3WP5A 1GZWB 3K3OA 1W8HA 2SBAA 2WWUA 1L7LA 4XBQA 3SC7X 4LHSA 1WBLA 2VZTA 1Z78A 1JODA 4FFIA 1FV3A 4BISA 4TYSA 5J37A 3MIFA 3RZZA 4DEQA 4FPYA 4NHYA 2VTFA 5DUUA 1QGLA 2QNKA 2BEOA 1UOFA 4LUMA 4YSFA 1XB9A 3GCXA 4NHLA 1XNDA 5IVYA 4UT5A 5T5LA 2C1FA 3E6DA 3ZM8A 4BB3A 4JX0A 2EXHA 1KFUL 1UYPA 1OT5A 4CDQC 5C3RA 3ZKUA 3ZYPA 5JPNB 3LD8A 1OKQA 2XQXA 5FZOA 2J42A 1S0BA 1XOYA 3NNMA 3ZDSA 1OQDA 5LBFA 1VBB2 4LO5B 4Q1PA 4AEKA 2UYAA 2PHRA 1KDMA 2HKXA 3ACGA 4N43A 1XBFA 2VXJA 3PMEA 5L9VA 5LASA 4A2UA 2W47A 4CE8A 3DXUA 4AGGA 5LEJA 3VDAA 2GN7A 4YVWC 2C26A 4QQHA 3CHXA 1NE6A 4RA0A 3ZSJA 4AE2A 3VBSB 4MGTA 1PO11 4PCRA 4XVHA 3V0AB 5CU1A 1JYXA 1PO21 1W04A 1XYOA 3DCQA 4A6OA 1WMFA 1GR3A 2RS13 4M4RA 2W39A 4I0WB 5KHIA 3BUCA 4XZUG 1EV13 2R062 2JG8C 2P1BA 3HWJA 3U1XA 1LHUA 3CO2A 4RD7A 4QQ2A 5CADA 2RS52 2IVJA 4WBBA 1WD4A 1UQXA 1J83A 1RUC1 4OI4A 5BNNB 4GH4C 1H30A 2D5HA 2JDHA 4OVEA 3FLRA 4Z1VA 1K42A 1IPJA 2D6LX 2GNMA 1YQ6A 4UWDA 1BBT1 3R05A 1Q8VA 5JOWA 5D2AA 3AZVA 1POQA 3J7NA 3PTYA 2XGXA 2WZR1 3CDZB 4ES8A 1ULDA 2R16A 4ARYA 3LEGA 2VZUA 3ZKYA 3CBNA 4E4ZA 4FPOB 1H8VA 2F4PA 1PGSA 5F3EA 4IGQA 3ST7A 5KR7A 1FNZA 1GLHA 4ZY9A 1D4M1 1ODMA 3POBA 4MGSA 5A7QA 3WVJA 2ZGQA 2IXCA 4Q4V1 1KRIA 1LGBA 3AJZA 5C8CA 2RR13 5IUQA 1UOBA 5AVAA 3DECA 3OPTA 3OB8A 1V6NA 2CGOA 4Y20B 2CTVA 2IWGB 3ZYGA 2NN8A 5C3SA 2I45A 2XG3A 2G19A 2ZMKA 3URFA 4Q2FA 4NRPA 1VAMA 1PK6C 5IK5A 3ZFGC 3VKNA 3ZR5A 3GZTB 3PVEA 1W9FA 4F8AA 1C3HA 3GBWA 4BQ1A 3MV11 4W65A 5IHRA 1RGSA 4A41A 1EYBA 1YI9A 3POWA 4EV0A 5JZGB 1V6MA 2G9FA 3D4KA 3MIEA 4JCKA 1O4YA 4LUKA 1MQTB 1F9KA 5F5QA 4X8NA 2X5IB 5FYYA 4RYDA 1WGPA 2BJSA 2VY0A 1JOBA 5J96B 4M3CA 4BDVB 3VBRA 4MG2A 1HXS2 2BRTA 4Q26A 5FOJB 3MIGA 3MDPA 2RR12 2E32A 4JKLA 3T2PA 3VBHB 4BOWA 4XXPA 2OPKA 3MF9A 2G9GA 3B69A 2WFF2 1WCSA 2GC1A 2A6VA 3THCA 3VDDA 1JU3A 3USUA 2VL4A 2FMDA 2GU9A 1HB2A 1N1TA 4YWAA 4COVA 5GZGA 4M3CF 3LFIA 3JBG3 5CISA 4XIKA 4FPHA 1PMJX 1WCQA 1VBA3 2ZCWA 4GB33 2W1QA 3VN4A 1WW6A 3BYWA 4AYUA 3NAPB 3RS6A 3H8UA 1UIKA 2WA3A 3DKQA 4LOSA 4Y5SA 4B1LA 2UWBA 1VB2A 3WP4A 4CDUC 5K8SA 5FK7A 5A3OA 4OHZA 4CEWB 5A7SA 1HQNA 1SLCA 1LOFA 2XPJA 4YW5A 5A3TA 2XJSA 3HEIA 2YROA 4H7LA 3KCXA 4B7KA 2VOVA 5A1AA 3QD6A 3GJAA 1B35B 1AL21 5ANQA 1DYOA 1RJ8A 2HWB1 2Y8KA 3HNBM 3VHOA 2ADEA 4P14A 2RJ2A 1O4TA 5JR7B 4CXWA 1RUJ3 1RUD1 2EXIA 1F4AA 3ZLIA 1OPMA 1PM7A 3VHRA 5C70A 1NCRB 5FP9A 1H2MA 4IEOA 5KXCA 3I49A 3M3EA 1E5RA 1JS9A 3MHZA 5FY8A 1O8PA 1SCSA 2KD7A 4UF0B 4XF1A 4C8DA 1VP6A 3OD0A 3WNMA 3AMHA 1AR62 2NM1A 1CAXB 2VH9A 3V65A 1SLIA 3JBG2 3M2MA 5FRAA 5IVBA 1H4HA 4XQDA 1RMU3 4BU2A 1VBA2 1LRHA 1AJKA 2D3PA 2R041 1J59A 1NQDA 1PZ9A 2DU1A 3AP6A 4J1XA 1CPMA 2IC1A 2W1WA 4YZ3A 2ZHNA 4UI9L 2YU1A 3ETQA 4V2WA 2JDNA 2CAUA 2VVFA 4R9DA 5ABJB 1R1ZA 3H3ZA 4I3PA 5EYYA 1XYNA 5I8SA 1AL0G 3I97A 4N7UA 4K1YA 3I7DA 3A7QA 3O1VA 1SBDA 2W3JA 4RS5B 4WM8C 2VVEA 4CP0A 2ZACA 4OFGA 4QX1A 3LQCA 5L7OA 1GWLA 2C5DA 1AZDA 2DUOA 2ARAA 4Q4X3 4XEZA 4FAGA 3J7LA 4K40A 5J36A 1M06G 4GA9A 1WKYA 2Z2SB 4XCBA 1KXGA 4CRQA 1H2KA 5IVCA 5FMOS 5LA0A 1RMU2 4BQ3A 3ITQA 1COV3 1JMUB 1LU1A 1QMJA 4Q8KA 4DIQA 2HYXA 1GMMA 3VV1A 5I8TA 3ZSLA 1FI2A 1UOGA 2IXHA 3HOBA 3JD71 5C3PA 4GKXA 1NY71 4TWTA 5JMOA 5LEKA 4LJHA 4YVSB 5EXOA 1UX7A 3LA2A 2J22A 4XJ9A 2LM3A 5KHGA 4I09A 2XHKA 3OTFA 1VBC3 1LAJA 3AX4A 5CFCB 3O0XA 4OHWA 4W50A 2W52A 1OLRA 3KSCA 3WF4A 1W3VA 4JDOA 5B4XA 1ND2A 4L11A 3U37A 1MS8A 1WA6X 3AP9A 1H8TA 1CGPA 1PGL1 1Q8PA 4XILA 5A70A 1W9SA 1TZOA 4Q4X2 1S0GA 4BLJA 5IAXA 4WM7C 2DUQA 1RUI3 4IEXA 1SHWB 5BNOC 5IFTA 2E51A 2FDHA 4UAPA 3GBGA 1W9TA 1MEC1 2P37A 1YHFA 3WCSA 4DB5A 4IEQA 2QQUA 4LNVA 5ACA3 5C9AC 1LOEA 1REFA 4L8QA 1U0AA 1ENRA 3MLKA 4JKMA 3K2OA 4QWNA 4RFT0 4HKOA 3N9MA 5FZ6A 3U75A 4COZA 1ZRFA 4Y4RA 1MZ6A 1UY1A 3AKQA 2PQQA 1PNFA 4P5YA 2WBKA 3ZYBA 4E2SA 2VBPA 4XJZA 1KD7A 5FZOB 3MFAA 1DYKA 3JZVA 4A6SA 4QAWA 4Y1YA 2H6CA 4BE3A 1US3A 2RHPA 4CEYA 1VBC2 2E53A 2X8KA 2XHNA 4QU2A 4WVMA 4N43B 5IYYA 1SLBA 3OGJA 3PUSA 1GV9A 2V72A 2WNVC 1K5JA 2SLIA 2XWBB 3EO6A 5FYUA 1XNBA 2ARXA 2O8QA 2RS31 3WQ1A 4AWDA 1IS4A 1C57A 2W08A 4CP2A 3KGLA 2X10A 5FOBB 2Y34A 4I01A 4XTPA 3VKFC 3O0WA 4AXOA 4MGYE 1YQ5A 1RUI2 2FZ1A 3QOPA 4XPVA 5FY1A 4DZGA 1JU4A 2ZGUA 3AMQA 3AYDA 5AVPA 2UU8A 1QOTA 4HFSA 3HPNA 4J1WA 1ZRRA 3AC0A 1XE8A 1MR5A 3E5UA 4FXKB 1O3RA 4YM2A 3HNMA 2RDRA 5DZEA 4ZS2A 5CNAA 3NRUA 3VBUA 2YYOA 1GQHA 2OVUA 4XURA 3M70A 3UT0A 1Q43A 2RMU1 4I02A 1TEIA 5EWSA 1S2EA 5L19A 4OI0A 1W0PA 1WD3A 2W9XA 4FQ4A 5GJ6A 2GMPA 3GZUC 3MF6A 1YCIA 4FTBA 2HWD1 1G86A 4ONUA 4GWNA 4OUSA 1GOGA 1PO13 4I2OA 1TG7A 4FPGA 3SEPA 1LTEA 2IFRA 4ISRA 1PO23 1MZEA 1DZRA 1W6OA 3H7JA 4XHBA 2EAAA 4J25A 4IE5A 1XNTA 4RHV3 5ERLA 2VO5A 1SBEA 4AVCA 2CWMA 3SXWA 1OFNA 2QQIA 1LULA 1TNRA 5C8CB 3WLUA 5CKQA 5LY2A 2ZA9A 2Q30A 5D8AA 5FXXA 5C7GA 4LPLA 3G7DA 2KM2A 4XAAA 5FZMA 4BPZA 1W8WA 1JBCA 2V5DA 1WA4A 4TTGA 2DDUA 4IV1C 3ZXGA 3WZ1A 4FI9A 4NE9A 1PM4A 3RVHA 2XKPA 1OHFA 2XJRA 4MLOA 4HN1A 3T30A 5FPXA 1SBFA 4JZRA 2K2SA 4MHRA 3K4ZA 2ZHKA 4PT6A 1PO12 4XF9A 1RITA 4Q0SA 4K7JA 4MV2A 3C7HA 4Q4V3 2XL9A 1PO22 2FBEA 1J3QA 2GSYA 1HLCA 4W6WA 3FFZA 2HEWF 5FJKA 2WLQA 3IB3A 4GALA 2VUDA 3UETA 3KHBA 3P3NA 5F6KA 3IAPA 4AFCA 4JV4A 3ZYRA 2WNOA 2A3XA 3BTZA 3RQ0A 1Z0HA 1O91A 4FQZA 4WZCA 1RUC2 2FD8A 4M3CB 5J7MA 3VBRB 1BZWA 1AR71 1JZ8A 1GUIA 1QKQA 4ATEA 2ZZQA 2DFCA 2QZ2A 3N9OA 1Q3EA 3VDDB 1BBT2 4QQLA 2BGOA 3H42B 3USUB 3MEPA 2WZR2 4YVWA 1W2TA 3TRSB 3LAGA 1Y9QA 2EIGA 1QJX1 2E31A 5E89A 5JAXA 4UYBA 1Z7S1 3NV3A 3N9LA 1DQ5A 2FMYA 5F8PA 2JB8A 1D4M2 1OOPC 2YZ4A 1W8UA 1WLWA 2OT7A 4FTEA 1ZRCA 2R1DA 3M3QA 5EJ1B 2JE8A 3OSDA 2JG8A 1VRH3 2VZQA 2QQVA 4Q4V2 5FXZA 2D97A 4GULA 4QGLA 4COWA 1OF3A 3BODA 4QB2A 4AFBA 2YMZA 3LPFA 3OPWA 4K3UA 2ORZA 2PHUA 2RDSA 3Q8BA 1UY4A 4A7KA 2VZ1A 5A7PA 4DXSA 4QX8A 1V70A 3TNPB 4ZU4A 1FMD3 4LOTA 5I0SA 2RS11 1BXHA 4AQSA 1EV11 1DZTA 2PHXA 3Q9OA 4IW3A 4K21A 4LBQA 4V1PA 5FZGA 1XU1A 1X9PA 5T55A 4NIHA 4JGYA 3E1F1 4MYEA 1I9RA 1H1MA 3A0KA 4BQ5A 4NHMA 4HPKA 2F6BA 1A8MA 2QQJA 5GM0A 3WHTA 5DQ0A 5FFOC 2YC0A 3WDYA 3WSOA 1BKZA 5BYNA 3LB9A 5FCCA 5GZDA 3CJIC 3J8F1 1RUD3 4NPRA 1LJ7A 3RMYA 2J1SA 5F32A 4XDQA 4WZFA 1MACA 2VOXA 5E88A 2GAUA 4Y26A 2BWCA 3ZFGA 4TLGA 3RZGA 2VVDA 5IT6A 1YJKA 4JQRA 2WZ8A 4QKFA 3LDKA 1GZ9A 4QQPA 1VIWB 3T08A 5L7OB 4INDA 3PUAA 3ZSEA 2R043 5EV7A 2XJUA 1OC1A 3T0AA 3MICA 2DCKA 4QGNA 4AHYA 2E7QA 1PGW1 2VUAA 1RTVA 2GP3A 4XAEA 5DAPA 2E6VA 3HNYM 1YFXA 3LOIA 4Z8BA 2JWPA 4QDQA 5FP7A 1KITA 1GP6A 1LHOA 3ZXLA 2AZ5A 5JSOA 3MPBA 4XFCA 1AL22 2HWB2 2EXKA 2WKKA 2ZX3A 2GC2A 3CZJA 3N9PA 4IEYA 3A23A 1OH3A 1XJAA 3GALA 4AFMA 4WVWA 3W5MA 1QIQA 1RUD2 3CKHA 3UNPA 3AFKA 4FAHA 5C6CA 2BFUL 5IFPA 2XH6A 3ORJA 3NNFA 3OGSA 3WINE 4HVOA 4XC9A 4AVAA 2WL1A 1GOHA 3POEA 1ND2B 2D43A 2ERFA 1JI6A 5DABA 5FZ3A 2GMEA 3H9AA 4YFZA 1H8TB 3CLPA 4CDUA 4CCOA 2VG9A 1GANA 5FLHA 2R042 3U10A 4KGGA 1DGLA 2DF7A 4RFRB 1ALYA 4CUAA 2JIJA 4QDRA 3VHNA 3N7KA 3DEMA 1YLLA 3KCYA 2DTYA 2BWAA 4B4PA 5JZGA 3DXTA 5BV6A 4A3XA 5K0UC 1HW5A 4GB31 1HB3A 5GZEA 3ZPOA 1ZZ9A 3OBZA 3UKVA 4NMIA 2WQ4A 2FDFA 4XJAA 2GALA 2XVLA 1W6PA 1H6XA 3RSJA 1JHNA 4GKYA 1OA4A 3P5BA 4BIFA 5C4WC 5FZ4A 2VNRA 1ZYBA 2ENRA 4ARXA 5A3MA 1HRI1 3K77A 4CEYB 2FCVA 1RIRA 4LHNA 4WVMB 4BCUA 3OPZA 1LOAA 1UZVA 2JG9C 2AR6A 1RUJ1 3OGRA 4ASLA 1SMVA 3IIAA 2WA4A 1K45A 2DYCA 4P9LA 1S0EA 1MEC3 2WN2A 3FBYA 3BU7A 2B8MA 2BNMA 3PNAA 1EUUA 3ILFA 1S1AA 4SLIA 1HKDA 4UBHA 5FYBA 4YZ2A 3PU3A 4NAOA 4XMIA 1XXNA 3JD72 4OYUA 2DVBA 2VCAA 2ZGNA 1MZFA 1FT9A 1HRV1 1NY72 4LBKA 5GLVA 5LY1A 3B3QE 3AFGA 3IAQA 3QH6A 4Z07A 5GLTA 3S5AA 1XE0A 1S2KA 2H6BA 3FMGA 4WM8A 1VB4A 5FKBA 5H9RA 2P17A 3M3OA 3BOPA 3I2HA 3VBUB 3J7MA 2VCBA 1VALA 3NNGA 3EMRA 4EWEA 1CIWA 2O14A 3RI9A 5EP9A 3PVNA 2AACA 3BKZA 3FUQA 2RS33 3MW4A 4LBQD 3VUOA 2Y60A 5IATA 4QHBA 1PGL2 2IXIA 4P9IA 1H9WA 2VOKA 1JXNA 2X09A 2JD9A 3I2JA 1W8OA 4IDZA 1BYHA 3U4SA 1NUKA 2ZZJA 1MEC2 2IXJA 1QXPA 2YDEA 3DN7A 1W6OB 3T0DA 2VJXA 3CQOA 2UYBA 3LEKA 1WCKA 3T2TA 3ZFEA 3IIIA 5B4NA 3DPRA 2HBUA 1OQEA 4RGAA 2VUCA 4ASKA 2Q8CA 4Z2AA 1ZM1A 5A1LA 1TNFA 5T5OA 3SKJE 4QU1A 3S5QA 4AK3A 1DLLA 3HQRA 2A5ZA 4UFHA 4DUVA 1COV1 3CU7A 2JJ6A 1LOCA 2D6MA 1HDKA 4CSWA 1GNZA 1US2A 5KC6A 5D8AB 4AG4A 3J4UH 2WYSA 3ZX7A 5JSRA 2HWD3 1W6QB 1U12A 3ELNA 5FZ8A 1JYCA 2WQ8A 3VKMA 4K9SA 5IK7A 2Y6HA 3GZAA 2WZPP 2ZGTA 1NZIA 3CNAA 4WM7A 2CGNA 4D7SA 4FO9A 2XLFA 2Y6GA 5FZ1A 3EHKA 2JENA 3ZYHA 3D0JA 4GXLA 2BQPA 4BK5A 4FFGA 3SQOA 1IPSA 2E9QA 5C9AA 2DVGA 3O14A 4LHKA 5FZCA 3WR0A 5L73A 2ORXA 3FL7A 5LB6A 2VOTA 2YV8A 4CDQB 3CL1A 1W2AX 1ULCA 4RQPC 1IZ3A 5BPXA 4QDSA 1DQ1A 2YU2A 4A45A 4KI5M 2B7YA 2D5FA 1IQAA 2O0OA 4AR2A 2W1UA 3AP7A 4CU7A 4E4HA 5F1RA 1PIV3 2VGDA 4FT8A 2BPA2 2BP6A 2DVDA 2WSUA 4FOYA 3I2IA 3GNEA 3CMGA 4PQ9A 2WNVA 4XXAA 5CFCA 1QNYA 1R083 1ZVFA 2HWD2 3S57A 1FX5A 1GKBA 1LGNA 5J09A 3PHMA 5EFUA 3KS7A 4JTOA 4DY5A 4YVWB 1K5MC 3TEWA 4ZZ8A 3KVAA 2V09A 4I30A 3NNLA 3I3MA 3UJOA 1WW4A 2QKDA 1Q8QA 4XABA 1GNHA 1OUSA 1ONAA 4XUPA 1AXZA 2XJQA 4LE4A 3SLIA 4QM9A 3UYJA 2WNUC 3ACHA 4FP3A 2JDPA 5FJHA 4K8RB 3POFA 5BXXA 1OF4A 2VMGA 4DRRA 2TEPA 1MVEA 2VMEA 2JG8B 1CAUA 3DKWA 3NVCA 1AR73 4AQ6A 1I5ZA 4S2DA 1A8DA 1RYYA 3ZN5A 4AHZA 3E6CC 1WMEA 2I2SA 4ZXKA 3B93A 5F5AA 1GWKA 4DUXA 5DUXA 1PZ8A 3KGZA 3N9QA 4LK6A 1QJX3 4NN0A 2PHLA 2RV9A 1Z7S3 2RDNA 3HJRA 5AC93 4XE9A 1ZZCA 3IDEA 2BNNA 2OYZA 4G3YC 2ZEYA 1F15A 4LBQB 3W58A 1DF0A 4M0NA 4JGYB 2KA3A 3VBFC 1OLME 3ZR6A 4COYA 3NL1A 4LULA 1G8WA 4NIGA 4HPKB 4Q4W1 1V0AA 4HOOA 1DG6A 5CYYA 5FZFA 1PVXA 1S0IA 1UO9A 3VZOA 1W2OA 1VAVA 3OBAA 3RJ2X 4RL7A 4CUBA 2H0VA 4RR3A 3POSA 1AR72 4LIUA 2BW8A 2Q1MA 1ULPA 4N53C 1NOVA 3WUDA 4AQ2A 4RHV1 1V6KA 5FK8A 4BM8A 1Q8SA 2EA7A 1DZQA 3ZFGB 3LDBA 1Y9MA 1LKNA 1QJX2 4Q5OA 3OYWA 4XFGA 4EN8B 5KBFA 1Z7S2 4NPLA 4TN7A 1HIXA 2A73B 4CXYA 5LK7B 3JCIA 1NCQC 5IVFA 3FE5A 3KLSA 5FZLA 4PQQA 1OKOA 2B9VA 5C3QA 3J8F3 1JZ6A 3FFQA 2YPJA 3KV9A 4YGBA 5DN2A 5T50A 2W1SA 3VDCA 2KR2A 2VQTA 2VCMA 1UY3A 2JDKA 1AX0A 3LSEA 1DGRN 2HEYF 5I0TA 1QH6A 2VQ0A 1HV0A 4D6SA 4QXHA 1KEXA 2XVKA 1UYZA 3BN6A 1X7NA 4IE7A 4YRDA 1QDOA 2PAKA 1UXXX 2A1XA 1XNAA 2IZWA 2RS12 1GQGA 2YGLA 1EV12 5FO7B 3WEZA 1R1A3 5CEHA 1MS0A 1ENSA 3H7YA 2WIIB 3WQ0A 4PIXA 4BQXA 3TEXA 3AKSA 2OX0A 2Q5TA 4EWDA 4IESA 5DAWA 4LLFA 3H8RA 2BZDA 1O8SA 4NIDA 3QBQA 1OOPA 5HCFA 2AEZA 3T3YA 4CDUB 1RB8G 4META 1F8VA 4E4SA 4P9XA 1YFUA 1F5JA 3ETPA 3J8F2 4QMAA 3G6JB 3F2ZA 1ULOA 4HZFA 3VBSC 3WUCA 1OA3A 1AJOA 1C8M1 1CVNA 3AZZA 1RJ7A 4JQTA 2B46X 2YHJA 4QQOA 3NWKA 1ZZBA 5H9QA 2ZEWA 3PVBB 4E27A 1JHJA 3V0BA 4QPGC 5LK5A 1W6PB 3ME2A 1VRH1 5BNPA 4D3WA 3EQEA 5DG2A 3MW3A 4PI2A 3DYPA 2Q1FA 1ENXA 5C8WA 2JDMA 2I74A 1GFF2 1LODA 2R1BA 5LZ6A 1K3IA 5FPLA 3B5LB 4A4AA 3N36A 1BQPA 3MGUA 4FFHA 2EXJA 1FMD1 1PGW2 4FPJA 1X33A 4UW6A 3MUZ1 1C8NA 1WW7A 2LRPA 3ENRA 5BNQA 5FDBA 3WT3A 1AR91 4OULA 4F83A 4OMCA 2UURA 5A32A 2DCYA 2J1EA 3A4UA 5FTTC 2PQSA 5A33A 2PA7A 5BNOA 3TWIA 2B39A 3J9SA 4MVTA 2DCTA 5JOXA 1DGWA 3E5XA 1HRI3 2FDIA 4WM8B 3SNMA 1E5IA 5JXHA 1P8JA 2JXAA 4XFFA 5K9YA 3UL2A 4M01A 3M1HA 5FQ0A 1DDLA 2G4IA 3OUHA 3MO4A 4HK9A 1FAYA 2VULA 4LE3A 5GKAC 2EIBA 4P9YA 3D3AA 3AJYA 4Q27A 4Q0QA 2ZGRA 5J1XA 4CCMA 4AAXA 5L36A 1J3PA 2E33A 2JECA 3AM2A 3AZWA 4JGZC 4LITA 5A1FA 1HRV3 2WO7A 1JOPA 1TME1 1HX6A 3ZIWA 4DXRA 5JSPA 3TN91 5IK4A 4GB32 4CYDA 1TE1B 1ASJ1 4TLFA 5F6LB 1DQ6A 4HXCA 2NP0A 3ZFEB 3KCCA 3DPRB 2R30A 4PLOA 2ARBA 3AL5A 3KF5A 3UJQA 3VLBB 1IKPA 4CTEA 1DGWX 2DTWA 2GH8A 3KV6A 4NHKA 3O1SA 3O1UA 1YIPA 2MEV1 1HRI2 3VBHC 4DXTA 3POJA 4Y4YA 3OG2A 1RUJ2 1A3KA 4LKFA 3C7OA 1W28A 1VMHA 1CZSA 1VE0A 5FKCA 3EJKA 4WM7B 4YG0A 2UY8A 3I59A 3H8XA 4CCCA 3KHCA 1SFNA 3HT2A 5K0UA 4PIYA 2JB4A 3IT8A 4LKDA 1BJQA 3NAPC 1R091 1W2NA 5C9AB 1HRV2 1GICA 3FWEA 4K1ZA 1VPHA 3ACLA 4XFAA 2NMOA 2P2KA 4EN9B 3H8OA 1QHDA 2D6KA 2P6HA 2PYTA 3I4IA 5CB7A 3T09A 3WP6A 3MIDA 1NA1C 2ES3A 1DP0A 3TYJA 5JLVA 3RZMA 1RUE1 3MPPG 4A42A 5A3UA 4Q8LA 5FY0A 1XC6A 2JG9A 3LCPA 5JVVA 5T54A 3SMHA 3VGIA 3WG2A 3LA3A 5FZIA 5J3UA 2NQYA 2WNVB 2LUWA 2ATFA 4TZDA 3JB8A 2XL7A 2ZMLA 1S0DA 3RYPA 4UFKA 2ZKNA 5JIUA 1RXGA 3HR9A 1G9FA 3AP5A 3ZPYA 2HEVF 2DURA 2AENA 1AR83 5BY5A 4LMFA 3DUIA 5CA6A 1W8TA 1Y7BA 1ZBA1 1WZXA 4IV3C 2CDPA 3RG0A 4PHZA 3T4VA 2OUJA 2ZGMA 3E6BA 1T6BX 5F3IA 2W0XA 4GD4A 5FY4A 1CAUB 5JXJA 4GJZA 4OUEA 1COV2 5KXBA 3ALQA 2FDJA 2P3JA 2JDYA 3SISA 2OKXA 3M3IA 3T0BA 1OUXA 3O5SA 4PBPA 5FZ7A 2QJVA 4BK4A 1UZYA 4KH9A 4MGKE 1VMFA 1O59A 2VCCA 4JC1A 3M7AA 3RYRA 1CX4A 2VW0A 1CR7A 5KC5A 4RS5C 4QXCA 1W6MA 2W94A 2HWE3 3OCPA 4ZONA 3R6SA 5FUIA 2ZXQA 1X8EA 5JMCA 2AC1A 2WR9A 4SBVA 2ZX2A 4XTMA 3IZOA 3AVSA 1X36A 2WO3A 3PMSA 1RUH1 3JQXA 3POGA 4Y1XA 3X29B 5JPMB 2QQPA 2WABA 3T4HB 5A6ZA 4PDWA 2BV4A 2WT2A 4GMP3 2QE3A 4HSJA 5GLUA 3BOWA 2A6WA 4MADA 4RR3B 2CSGA 1ZZ8A 5ACA2 4L99A 4YVSC 3ZXJA 4IETA 1LEMA 4RSUA 4Y24A 1XNKA 4KGQA 5JDBA 3AB0A 2CWSA 2JEMA 3FBMA 5FWEA 2VMFA 4LKSA 4QXKA 5D1IA 4XFBA 1UYYA 2QDNA 1JZ5A 3NW4A 3OYWB 4AFAA 4NWVA 5FY5A 2VZVA 4Q4W3 3ROUA 3ASIA 2VZOA 5B2GB 2WO2A 1W03A 3BIWE 5FP8A 2F17A 1LEDA 2Y26A 4RQPA 3K4AA 5JI7A 2W46A 3M8LA 2BOJA 4LA2A 3O12A 5FP4A 1APNA 2XVGA 3GHMA 1TMF1 3UKNA 4R9CA 3WV6A 2JE9A 4COUA 4LIVA 1AF9A 3N35A 3HVDA 3NJVA 2VMIA 1VBE1 4LBOA 1L7QA 4QB1A 4EE2A 5JOYA 1AXKA 2LW8A 1RUF1 4IEWA 5GZCA 1D7PM 3VL9A 3OEAA 5IAVA 4AEDC 3U11A 1FNYA 1KS5A 2ILMA 1JYWA 2DVFA 1JYTA 1JTZX 4XCAA 1KGYA 1DU3D 4BH9A 1UOJA 4X6QB 5FY9A 3JB4C 2ZAHA 4FP2A 5EJ3A 1W6QA 1N3PA 2RJLA 2YGMA 4GWIA 4XIOA 4ZU5A 3RGBA 1VRBA 1QJZA 5GLWA 3L2HA 1ZREA 3UGHA 1PIV1 3A22A 2VPVA 3KQRA 1WLDA 2ZGPA 2WNUA 2VTXJ 1NYWA 4N43C 2J1RA 1NLSA 2WO1A 1OOPB 4XFIA 4BYYA 1S55A 2XBO1 1R081 4Q4W2 1V6IA 1KJLA 3N3HA 4FSJA 3WNXA 3NJXA 2B4KA 5FYSA 2VE1A 2LALA 4MSVA 4D0QA 3BTXA 2RE9A 2C24A 5G05L 2C0ZA 2A6XA 4CDQA 4MGIE 1JZ3A 1RVF1 2K9ZA 1L7RA 4RHV2 4D69A 1UZZA 1S0CA 2R49A 2D98A 3KMHA 1H2LA 3V0BB 3QH7A 5IK8A 4PJYA 3D6EA 2ET7A 4R9BA 3S30A 5BNPB 4FVVA 2RM21 4Y22A 2PELA 5JR2A 3O1PA 3ZFFC 4CCDA 5FYMA 5JUVA 2G9ZA 3FN9A 3SCFA 4WVZA 1YQCA 4FTSA 2VZ3A 3PUQA 1G9AA 3CZUA 2VBBA 3EYPA 4URTA 1RXFA 1O7FA 2PAMA 3NQHA 2OQ7A 5AC91 2WUHA 1C8M3 1JUIA 4QPIC 2BU9A 3BI3A 2EAKA 1OA2A 1OD5A 3I2FA 3NSTA 2ZX1A 1AX1A 1XSRA 5FREA 5LBBA 2VAUA 1HV1A 4XETA 5A32B 4YZ5A 2GDFA 4UOJA 4C0BA 4OLLA 5A33B 4YM3A 3N9NA 4OHVA 2EF6A 1ND3C 3QCWA 3LFMA 1C5HA 4LHLA 2YFZA 4FCAA 5A3WA 1VJ2A 4RGGA 1ZBE1 4GH4A 2ZS6B 1SLAA 3LPGA 4XBLA 3WDWA 5FYIA 3WF3A 1BVVA 1MVQA 3ON7A 4BZ4A 5LW9A 1A34A 4MGQA 3LF7A 4AI1A 1G9CA 1ZZ7A 1DBNA 1C5IA 1NCQA 1RHI1 3D0SA 4FPKA 3OBRA 2KXLA 5FQ0B 3U14A 1DLCA 5LA9A 4P02B 1N3QA 2LS6A 2FDKA 3HAGA 2JX9A 3LEIA 3RYKA 3ES1A 2XWJB 4HG6B 2MPFA 2WS91 1V6LA 1AR93 2Z42A 3K3NA 5C71A 2E26A 1NX9A 3PURA 2XR4A 3NNJA 4Y33A 1JZ4A 4BHPA 3C7GA 4HBNA 5L9BA 3SEEA 1C8M2 5T5PA 2CDOA 1VBD3 4ISQA 1XE7A 5HV0A 2J1VA 3VZKA 3POYA 2Y6LA 2ZJCA 1O3TA 2R073 4KU7A 1FXZA 2IFWA 4QGMA 1VRH2 4Z92B 1ULEA 1JZ7A 1SPPA 4P00B 3WQ7A 1SFPA 4M4PA 3BTAA 1C28A 3VBRC 4H3WA 1PK6A 1UPIA 4DY3A 1D0GA 1PHMA 4JKKA 2JDZA 4YGCA 4R4ZA 4XUTA 2P3KA 2VNVA 1ULGA 5E8AA 1FMD2 3PU8A 1RINA 3USSA 1Q8OA 1YFWA 1HJGA 4LORA 4XF0A 1TME3 2B42B 2P4EA 3SCGA 4CU9A 3TN93 1R1A1 2Q1ZB 2PHFA 3I59B 3LZZA 1ASJ3 4LK7A 4OI2A 1AR92 3MLJA 5K0UB 2LROA 4W6XA 1D4VB 2RMU3 1CONA 1EP0A 2XJPA 2AUYA 3OY8A 4L97A 4QPGA 4EN7B 1CD3G 3AVRA 4KBZA 3B7MA 2MEV3 2MHFA 1J1LA 2W5FA 4DQAA 2BDRA 4E4DX 4YW3A 1UKGA 2XLAA 3OOXA 2CL2A 2DV9A 3DL3A 3B9IA 1OVSA 2JG9B 3MI8A 4BQYA 5KHHA 2PHDA 4LLOA 4IEUA 3AZXA 2XJVA 1IQDC 3VD3A 1R093 3GJBA 5KXEA 3VZLA 5IVJA 1JH5A 4N9IA 2CY6A 3ZXAC 1TME2 4LR4A 1OFSA 4QPYA 2VD7A 3TN92 3C3VA 4UW3A 5HBAA 4AHWA 1ASJ2 1O5LA 2D44A 5CKMA 2WN3A 3VD7A 2YFUA 1NQJA 4KWKA 1CAWA 3HN1A 1V9U1 4S2FA 3O1OA 2IXKA 2TNFA 4HL0A 1YQ2A 1RUE3 1R64A 3DGTA 2PFWA 2CYFA 3LOBA 4ASMB 2MEV2 4CP1A 1EPWA 2JIGA 1REEA 2XOMA 4C1WA 1HQLA 5CIRA 5SV5A 3T1LA 5A6YA 1SZBA 3DV8A 1POV1 3WF2A 5FO9B 1BLZA 3CEWA 4R4XA 1JUHA 4C91A 3DF0A 4QM8A 4Y5Z0 5HI0A 3N7LA 1UL9A 2JDAA 3FLTA 2LTNA 1W6MB 4IQPA 4JGZA 5C33A 3MIHA 4UFJA 4YW4A 4GMP0 4YG6A 4EROA 1IPKA 1ZBA3 2VQAA 2YC2A 3HN3A 1R092 3TAYA 2VW1A 4PBOA 3KT1A 5A7OA 3HIFA 1H0BA 1SDDB 1X82A 4ITCA 3SCHA 1LNSA 1YYNA 1OI6A 4K6BA 5H9SA 1EUTA 2A3WA 2W92A 4PDWB 2Y6JA 1OBNA 1YIFA 2X53S 1RUE2 3BB6A 3W9AA 1PMHX 1EAH3 3R4UA 3WG4A 3PJYA 5IW0A 4DINB 2CGPA 3AMPA 1N1SA 5FUNA 4QX3A 3D5OA 5I8YA 3IWZA 1AYN1 4K20A 1VLNA 1AYM1 4OUMA 1LU2A 2WT0A 5FIXA 1UX6A 2YBSA 2BVBA 1ZZ6A 5CG8A 3F95A 5T3NA 2YB7A 4DO0A 4CVUA 2AH2A 3WCRA 1RUH3 5T5JA 4IEPA 1IS6A 5DPNA 1H8TC 2PMWB 3V64A 2DFBA 1ZBA2 1SLLA 4RQPB 3I3BA 3TEYA 3H1MA 3TEZA 2GC0A 1E57A 1Y3TA 1PMIA 2FCUA 3NJYA 3AKRA 3ZVXA 4PF5A 4NIAA 3MUY1 4MO3M 4NAMA 2YUEA 4QKBA 4FOWA 3FZ3A 1W0NA 2VMHA 1QQP3 2D3RA 3NKGA 1UW8A 3BTYA 4IE4A 5DAXA 3K75B 1A6CA 5FMOL 1LECA 3ACIA 2QFEA 2D93A 1OPOA 3WF0A 4CDXC 4DPNA 1S0JA 5GZFA 3LEMA 2HLEA 3B94A 3HMYA 1DFQA 2X29A 5CFDC 1QJFA 1TMF3 1UPSA 3WX5A 2RS32 2WNUB 4C90A 2OXBA 5LBEA 1GZTA 4CDWC 4IV3A 3ZSMA 2XJTA 1FATA 4FOVA 1RUH2 2XUEA 2QQOA 3VZJA 5APAA 3OD4A 1VBE3 4NROA 2HBTA 2Z79A 4NHXA 1FOD3 4O9EA 1X9TA 5A6QA 1RUF3 5FZ9A 3VD5A 1SEFA 3TNQA 5LCWL 1IS5A 4I3GA 2ZOEB 4IL7A 1QF3A 1PVC1 4KMQA 5FZHA 5ISLA 4LO8A 3QACA 1HB4A 3MYXA 1AR81 4L9BA 4D6RA 4S2GA 4C1XA 2EVXA 3HBKA 3PDQA 4NUBA 3J26N 1D2SA 4HMZA 1QOOA 2X05A 5LA2A 2YBPA 1OD3A 3SKVA 1W9WA 2HH9A 4ORFA 2YBKA 3GYDA 2XBO3 4Y22B 1OH4A 2Z69A 4MX3A 3I54A 3B9CA 2PTMA 5A3LA 2NMNA 4DS0A 3K4DA 4NVPA 3SHRA 3O0VA 1LESA 4EZ4A 2IVIB 4OI1A 4A7ZA 3FHIB 2ETEA 5JOZA 1TMF2 4G4FA 3R4SA 1BEV1 4EJRA 4GIQA 4JTNA 4DRVA 2HWE1 4AOCA 4FPEA 1RVF3 2WQZC 4KBBA 5C5TA 1VBE2 3ECQA 4XQ4A 3WNNA 1ST8A 4PLNA 3D8CA 1XYPA 1RUF2 3AK0A 5LBCA 3WXPA 4LEJA 1WLTA 1YRZA 3PJQA 5HV4A 3R0RA 2RM23 2YY1A 2BGPA 4NO4A 4OMDA 4QX0A 5E16A 5FZ0A 2WFPA 4U36A 4GH4B 5FZEA 4LXLA 3ZYFA 4M3CE 3OF1A 5KHKA 1VAKA 1XRUA 4GMP1 1JOJA 1PIV2 1IOAA 3M3CA 3KT7A 1UU4A 2QUOA 4FPCA 4YW2A 4XZPA 3ZMOA 1NCQB 2QQWA 3WDUA 4AVBA 3WHUA 3LE0A 2IXLA 1DYPA 1QJU1 2XBO2 5DDJ1 3KM5A 1R082 1SDWA 5KWRA 3IKWA 4NRQA 5FV3A 3TB0A 4JAAA 3GDBA 1CIYA 3LA7A 4E9KA 3RWNA 4CU8A 1F5FA 2ZX0A 4G9SB 5DUWA 3WP3A 1UU6A 1TQ5A 3ZO0B 3W5NA 1KQRA 4XW3A 2A7AA 2VXRA 5FXWA 3NV1A 5IJRA 4EN0A 1JYIA 3GXUA 2R063 1UMHA 1RVF2 4AEDA 3O7OA 5I0UA 3GZEA 1ZBE3 1E5HA 2RS53 3JU9A 4LO7A 3IBMA 4Q1RA 1T6GC 2WWSA 4UFIA 1QEXA 1DQ0A 5FZBA 1CZVA 1RHI3 4Q0VA 1SPPB 4UXAA 4XJUA 2RM22 4IV1A 4L92A 4W4ZA 5E1RA 3VBOC 5H9PA 2VTXA 4N9HA 4X6RB 1PK6B 1PZ7A 3I2GA 3PUIA 4KQ7A 3WDVA 5IVEA 2WS93 4L0PA 4AAPA 5F5IA 1ZRDA 3K46A 1RC6A 3O1RA 4O61A 5AC92 2ZX4A 4KNCA 1WW5A 4JVAA 2R0HA 1YWKA 1TVGA 2R7EB 1DGRA 3UKTA 1XNCA 2RJKA 5FYZA 4N8MA 4FPLA 3ZN6A 3ABZA 1W39A 3VD9A 1D2QA 1QH7A 2C9KA 4XHXA 5F2SA 3OY8B 2K0GA 4QPGB 4LTAA 5F3GA 2WAAA 1ZBE2 3S0MA 1OVPA 3VDBA 1HQWA 4IGOA 4KG8A 2W2IA 4BLIA 2GNBA 4FFFA 4M00A 4W8JA 4LBJA 3ZFFA 1H1AA 1D0HA 4DMIA 1RHI2 1BK1A 3ZN4A 1KJRA 2Y0IA 1L3JA 4GZ9A 4ZHNA 5A80A 2BBVA 3H1YA 4EWAA 1GQPA 1MS9A 2WS92 4Y3OA 4QPIA 3P6BA 4AVVA 3I2KA 3WDTA 3PL0A 5FUPA 3B01A 4JGYC 4NJ4A 5FYHA 3AZYA 1KDKA 1V6OA 3B00A 1UD1A 3KB5A 5GLZA 1ND3A 4JRAA 5HCBA 4F7ZA 1CAWB 3THTA 2D6OX 2QQNA 1HXS3 1MS4A 3C7EA 3ZMNA 5J98B 2EIDA 1ZNPA 2WFF3 3VD4A 2CNAA 4M0HA 1W2UA 2DU0A 3FUOA 4R9AA 1N1VA 2GP5A 2VZSA 4QXBA 3R4DB 3ZOIA 4CPBA 4R52A 1IG3A 3KF3A 4Q0UA 1U5XA 2ZEZA 2Q0AA 3MBWA 3P1IA 4B8EA 3W20A 2ID4A 2XXZA 3WW2A 2XDVA 5BNNC 2FCTA 1WMDA 2JKXA 4IERA 3N4MA 1R1A2 3QLQA 4MOAA 3SH3A 4JGZB 4E2GA 1N3OA 4HANA 1IKQA 4ZS3A 4P9GA 5AFBA 1V9U3 1N1YA 4RGKA 2BFUS 2UWAA 3UESA 1WUVA 3KD4A 3CJIA 5FAXA 3ILNA 1PNGA 1EY2A 1XQNA 4QHZA 3IDAA 1BCXA 3ATGA 3VL8A 4NWWA 1DHKB 1POV3 3PTRB 1CWPA 1QOSA 2BYVE 3RZHA 3POIA 4QX2A 2VZPA 1GYKA 2ZGKA 3H3LA 3OJBA 4ZPIA 1N47A 5IWFA 4Z2WA 1YEWA 1GNYA 1VBD1 4YM0A 4NOTA 5CG9A 1WCDJ 4LT5A 2A75A 4BA6A 3JQWA 2NYYA 2A6ZA 5K4LA 1F35A 1AR63 2BVVA 2R071 5I0DA 4K8FA 5G04L 1U5IA 1QJY1 1H4GA 1J3RA 5FY7A 4BQ4A 1W8FA 1OLMA 2D3SA 2DBNA 3HQXA 4AZZA 2V5YA 2JICA 2PLV1 3UGFA 3U0ZA 2ZBJA 2E7TA 2L9LA 2V73A 4XF4A 1V9U2 3ES4A 5J48A 1MPXA 2C4XA 1NA1B 2OW4A 4YZ4A 5KXDA 1W90A 1LOBA 1SQ4A 2W87A 4A44A 5JZGC 1ZA4A 2VUJA 3THPA 1W99A 1MQTC
chains in the Genus database with same CATH topology
5JIAA 2X5IC 1AYN3 4EN6B 1O3QA 1AYM3 1UCXA 2GNDA 2WINB 1H2NA 2Y38A 3WG1A 2ZHLA 1SLTA 1YO8A 4F3JA 2VW2A 2ZHMA 1G9BA 4OHYA 5BNOB 2Q8OA 1X50A 2D6PA 4IV3B 1CAVA 1O3SA 1S0FA 3D82A 4IEVA 4D7TA 4BIOA 4DXZA 2XKOA 3EBRA 3ZXDA 2XUMA 4TSVA 4ES9A 3AMMA 5CBLA 4CEWC 1LHVA 3HD8B 4ATFA 5C4WA 4JDNA 4LBNA 1UIJA 4I0AA 4KG0A 2HWC1 4Z82A 1G9DA 3LGRA 1LHNA 1B35C 1AYN2 1FPN1 1AYM2 1BMV1 4Y1VA 4AVSA 2Q4SA 4BMBA 2FZ2A 5DG1A 1NCRC 3NV4A 1NZCA 2PAEA 1WLCA 5FO8B 4XQWA 1KS4A 2P3IA 3H3UA 3LSDA 3AP4A 1PVC3 3I2DA 5FLJA 1DQ4A 3H0OA 1QDCA 4LO4B 2AREA 4YFWA 3AYCA 1W6NA 3RDIA 3TBDA 4CZSA 1AVBA 3MW2A 3T1MA 3ZFEC 3DPRC 2A70A 4MZUA 3IPVA 2C9AA 4ZU7A 5F9TA 5ABJC 2VOWA 4H14A 3RJRA 3ZYJB 1F2NA 1SCRA 3GBFA 1I3HA 3BPZA 1BEV3 1EAH1 2D6NA 4AQTA 4MXWA 4YZ1A 3A0NA 4JRLA 1OLQA 2FQPA 2BUKA 2NZ9A 3U4XA 3N7JA 1MS5A 5FBZA 1FYUA 4AI2A 1PVC2 3C2UA 4DFSA 4DOUA 2BNOA 4AEDB 1AR82 3RI8A 5LRRA 1I6XA 2VECA 4X8PA 4CDXA 1LB2A 2HWF1 4HK8A 2N7GA 2HJIA 3IDCB 3SITA 2D40A 1QJU3 4IV1B 5DDJ3 5CFDA 2GH2A 3ZXFA 4UW5A 4WV8A 1DQ2A 1QQP1 4CDWA 5CFCC 3KZ4C 2GNTA 3HT1A 1RL3A 3ZXEA 1BEV2 4B29A 2QVSB 2NLRA 1OSGA 2HWE2 4HETA 5BUVA 1LCLA 3KT4A 1YI7A 5I0RA 4YLZA 1G7YA 1C1LA 1IHMA 1CESA 4OZXA 3ZN6B 1RUOA 2OIIA 2VNGA 1WBFA 4HVQA 3RPQA 3IN9A 3BCWA 1FOD1 1JW6A 1KFXL 2TUNA 3E97A 5JWPA 1OQ1A 2JD4A 1GZCA 4Q4Y1 1RUG1 3ZFFB 2YXSA 4JDMA 5DZFA 2ZKLA 1QJU2 2DCJA 4NR1A 1K5MA 5DDJ2 2WLPA 4PIZA 3WY6A 4YGDA 4BMEA 5HXVA 4QPIB 3TOJA 3S7IA 2ZGOA 1NG0A 5DZGA 1CJPA 3JUUA 4FBFA 4BWOA 4S2HA 4A7YA 4U2AA 2I07B 2GZWA 5JCTA 1ND3B 1RUC3 2Y0OA 1O4ZA 1GSLA 1S2BA 1H9PA 4Y1UA 1RUNA 1BBT3 2PHTA 4RR3C 2R32A 2OUHA 2JE7A 5AFEA 2WZR3 3VZMA 3AKPA 4LO6B 2JKBA 4OHXA 4R8HA 1VR3A 4XBNA 3MFCA 1VBB1 2BTVC 5T52A 2AGSA 3I8TA 1POV0 1AHSA 3VBFA 1D4M3 4H55A 2A3YA 2FHRA 2WT1A 4MUVA 3WW4A 3CJIB 1SFYA 4AW7A 3RRDA 4AVTA 2CAVA 3VHPA 3L9JT 4N53A 3VBOA 1UU5A 4AFDA 3NV2A 2GN3A 1I1EA 1YJLA 2R061 2EALA 3PLQA 3IMNA 3U07A 1BVP1 5C8CC 2QCSB 2RS51 4YNIA 3FJSA 1GZWA 3AYEA 2B45X 3WD5A 4FPFA 4XFHA 1MS1A 5DUVA 3S7EA 2WNEA 3P3PA 3HBZA 4YYOA 2GC3A 4J6GA 1QNWA 5FLIA 3ZXKA 4LBMA 4YM1A 4AGRA 3BALA 4AI3A 2WC2A 2E7AA 5FPZA 3WW1A 4P5HA 5JI9A 3WOGA 1DIWA 2DUPA 4KWJA 4N7IA 3SH4A 3VKLA 2ZAAA 1NE4A 2NPIA 3OGGA 1QJY3 4L2NA 4MGZE 2GMMA 4FXGB 5BNPC 2PLV3 1YUDA 2DVAA 1UF2C 3V56A 3VDDC 1URXA 1EPZA 2PN5A 3WW3A 2ZGLA 4GWMA 3IDBB 3VBSA 1CAVB 1AL23 2HWB3 3V0AA 1AXYA 2UWCA 4I0BA 1YNAA 5EYXA 1ULFA 3AKTA 2OZJA 2E63A 1VBD2 5K7PA 1LOFC 4HLTA 4D7YA 3AXEA 3AMNA 2BGCA 4P9WA 5C4WB 5DXDA 5BNNA 4B7EA 2R072 1HXS1 4FOQA 1C4RA 3CJXA 5CAZA 2RR11 1QJY2 3GF6A 4GQ7A 4HN0A 2WFF1 5HCAA 3MZHA 1J58A 2PLV2 2Z5WA 1ZX5A 1MQTC 2ZABA 5CVRA 3NJZA 2WJSA 4LA3A 1LHWA 2XB6C 1SACA 4HVRA 4XJWA 4XJ8A 4XOGA 1F31A 4AEMA 2OA2A 2TBVA 2B9UA 3ZYIB 1W6NB 1NXMA 2HWC3 2VNOA 2RMU2 1FPN3 1J1TA 4HSLA 2A71A 4Y20A 3WG3A 3IPVB 1QXRA 2ZGSA 3S6PA 4AI0A 1LGCA 3CF6E 3INAA 1GBGA 3LKJA 1AUYA 4XYXA 3L2YA 5LRSA 1MS3A 1X8MA 4MXWB 5L7OC 4C0HA 1AR61 3GHNA 4KU8A 3JD73 4E2QA 2P34A 3JBG1 3AYAA 1CN1A 1IS3A 1VBA1 2DCZA 4KWLA 1YXWA 1MQTA 1A78A 3UV9A 2X5IA 5TSWA 1LOGA 2WSVA 2HWC2 4IEZA 4QX5A 4PLMA 1QY4A 1UMZA 3VBHA 4CDXB 1Q56A 4O9GA 1FPN2 1C1FA 1BMV2 4Q29A 2A6YA 3H50A 4AGVA 4HT1T 4LBLA 4IXLA 1B09A 5CFDB 1JN2P 4AI8A 4AEJA 4CDWB 4XMAA 4YARA 1QWRA 2QDRA 3EXUA 1XU2A 4MXVA 4HKWA 1ND2C 3NAPA 4N90A 1UKRA 1QU0A 2R0FA 3B02A 4CEWA 1IGOA 3PVOA 3ZSKA 1U5ZA 1MZ5A 1RMU1 1V6JA 1NA1A 3FC0A 2HWF3 2ZTNA 4YW1A 2VU9A 1B35A 1O5UA 1G6NA 3ZIXA 2OZ6A 3FLPA 1QXJA 3N7MA 3NO8A 1LR5A 1NLRA 1YFYA 1ENQA 2O8OA 1NCRA 5GALA 4ZKTB 4YGEA 1UAIA 1EAH2 2H0BA 3MIBA 4B4RA 1K5MB 2HYKA 3FX3A 3WDXA 4B4QA 1CAXA 4CEYC 5I91A 2AYHA 1M4WA 3E5QA 3RMXA 2ZPXA 2W68A 2MNGA 1FV2A 4QD2A 4Q4X1 3MLLA 4AHXA 1H1IA 1UN1A 3LWCA 1REDA 5EZWA 3SH5A 1CQ9A 3H1WA 2O1QA 4D94A 1LENA 1Q5OA 4UBGA 5I93A 1Y43B 3W59A 5ABJA 4PDWC 4Q4Y3 2HWF2 1RUG3 3APBA 4Y1ZA 2QZ3A 3K48A 3IM0A 4W6YA 3ILRA 3VKOA 2ET1A 4RS5A 1CJDA 1CPNA 1QQP2 2CV6A 4MH0E 5SV8A 4XF3A 3RNSA 3VBUC 4UW4A 4DNYA 1VBC1 4QT6A 4H7MA 1V00A 3NKTA 3VBFB 1U5YA 3UK9A 5KHJA 3AXDA 1NXD1 2UY9A 2ZMNA 2D7FA 1RUI1 1W0OA 1AX2A 4Q0PA 1FOD2 4P9JA 3OBTA 3M4FA 2R6QA 4YVSA 4N53B 4KL1A 3VBOB 4Q4Y2 1RUG2 2DWRA 3VZNA 5ACA1 4AF9A 1VBB3 3K51A 2B5HA 2PHWA 4HKLA 2XLGA 4WVVA 4B3NA 1OMIA 5D8AC 4YG3A 3WP5A 1GZWB 2SBAA 4XBQA 1WBLA 1Z78A 1FV3A 4TYSA 5J37A 3MIFA 3RZZA 4FPYA 5DUUA 1QGLA 2QNKA 2BEOA 4LUMA 4YSFA 4NHLA 1XNDA 5T5LA 2C1FA 3E6DA 4CDQC 2EXHA 1KFUL 3ZYPA 5JPNB 1OKQA 1S0BA 3ZDSA 1OQDA 1VBB2 4LO5B 4Q1PA 4AEKA 2UYAA 2PHRA 1KDMA 2HKXA 4N43A 3PMEA 4A2UA 4AGGA 5LEJA 2GN7A 4YVWC 4QQHA 4AE2A 1NE6A 4RA0A 3ZSJA 3VBSB 1PO11 4PCRA 3V0AB 5CU1A 1PO21 1XYOA 1WMFA 1GR3A 2RS13 5KHIA 2W39A 4I0WB 1EV13 2R062 2JG8C 3HWJA 1LHUA 3CO2A 4RD7A 4QQ2A 5CADA 2RS52 4WBBA 1WD4A 1RUC1 5BNNB 4OI4A 4GH4C 1H30A 2D5HA 4OVEA 3FLRA 4Z1VA 1IPJA 2D6LX 2GNMA 1BBT1 3R05A 1Q8VA 5JOWA 3AZVA 3PTYA 2XGXA 2WZR1 4ES8A 1ULDA 2R16A 4E4ZA 4FPOB 1H8VA 2F4PA 1PGSA 3ST7A 1FNZA 1GLHA 1D4M1 3WVJA 2ZGQA 2IXCA 4Q4V1 1KRIA 1LGBA 3AJZA 5C8CA 2RR13 5IUQA 5AVAA 1V6NA 2CGOA 4Y20B 2CTVA 2IWGB 3ZYGA 2NN8A 2I45A 2XG3A 2ZMKA 3URFA 4Q2FA 1VAMA 1PK6C 5IK5A 3ZFGC 3VKNA 3GZTB 3PVEA 4F8AA 1C3HA 3GBWA 4BQ1A 4W65A 1RGSA 1EYBA 1YI9A 3POWA 4EV0A 5JZGB 1V6MA 2G9FA 3D4KA 3MIEA 4JCKA 1O4YA 4LUKA 1MQTB 1F9KA 5F5QA 4X8NA 2X5IB 1WGPA 2VY0A 5J96B 4M3CA 3VBRA 1HXS2 4Q26A 5FOJB 3MIGA 3MDPA 2RR12 4BOWA 3VBHB 4XXPA 2OPKA 3MF9A 2G9GA 3B69A 2WFF2 1WCSA 2GC1A 2A6VA 3VDDA 3USUA 2FMDA 2GU9A 1N1TA 4COVA 5GZGA 4M3CF 3JBG3 4XIKA 4FPHA 1VBA3 2ZCWA 4GB33 3VN4A 1WW6A 4AYUA 3NAPB 3RS6A 3H8UA 1UIKA 2WA3A 4LT5A 2UWBA 1VB2A 3WP4A 4CDUC 5K8SA 4OHZA 4CEWB 1HQNA 1SLCA 1LOFA 2XPJA 4YW5A 2XJSA 2YROA 4H7LA 3KCXA 4B7KA 2VOVA 3QD6A 1B35B 1AL21 2HWB1 1RJ8A 3VHOA 4P14A 5JR7B 1O4TA 1RUJ3 1RUD1 2EXIA 1OPMA 1PM7A 3VHRA 1NCRB 5KXCA 1H2MA 4IEOA 3M3EA 1SCSA 4XF1A 1VP6A 3OD0A 3AMHA 1AR62 2NM1A 1CAXB 2VH9A 3V65A 1SLIA 3JBG2 3M2MA 5FRAA 1H4HA 4XQDA 1RMU3 1VBA2 1LRHA 1AJKA 2D3PA 2R041 1J59A 1NQDA 1PZ9A 2DU1A 3AP6A 4J1XA 1CPMA 2IC1A 4YZ3A 2ZHNA 3ETQA 2CAUA 2VVFA 4R9DA 5ABJB 1R1ZA 3H3ZA 4I3PA 5EYYA 1XYNA 5I8SA 1AL0G 4N7UA 4K1YA 3I7DA 1SBDA 4RS5B 4WM8C 2VVEA 4CP0A 2ZACA 4OFGA 5L7OA 2C5DA 1AZDA 2DUOA 4Q4X3 4XEZA 4FAGA 5J36A 4K40A 1M06G 4GA9A 2Z2SB 4CRQA 1KXGA 1H2KA 5FMOS 1RMU2 1COV3 1LU1A 1QMJA 4Q8KA 5I8TA 3VV1A 3ZSLA 1FI2A 2IXHA 3JD71 4GKXA 1NY71 4TWTA 5LEKA 4YVSB 5EXOA 3LA2A 4XJ9A 2LM3A 5KHGA 4I09A 2XHKA 3OTFA 1VBC3 3AX4A 5CFCB 3O0XA 4OHWA 2W52A 1OLRA 3KSCA 4JDOA 1ND2A 4L11A 1MS8A 3AP9A 1H8TA 1CGPA 1PGL1 1Q8PA 4XILA 4Q4X2 1S0GA 4BLJA 4WM7C 2DUQA 1RUI3 4IEXA 5BNOC 2E51A 3GBGA 1MEC1 2P37A 1YHFA 3WCSA 4DB5A 4IEQA 4LNVA 5ACA3 5C9AC 1LOEA 1REFA 4L8QA 1U0AA 1ENRA 3MLKA 4RFT0 4COZA 4HKOA 1ZRFA 1MZ6A 3AKQA 2PQQA 1PNFA 4E2SA 4XJZA 1KD7A 3MFAA 1DYKA 3JZVA 4Y1YA 2H6CA 4BE3A 4CEYA 2RHPA 1VBC2 2E53A 2X8KA 4QU2A 4WVMA 4N43B 1SLBA 3OGJA 1GV9A 2WNVC 2XWBB 2SLIA 3EO6A 1XNBA 2ARXA 2O8QA 2RS31 3WQ1A 4AWDA 1IS4A 1C57A 2W08A 4CP2A 3KGLA 5FOBB 4I01A 4XTPA 3VKFC 3O0WA 4AXOA 4MGYE 3QOPA 1RUI2 2FZ1A 4XPVA 4DZGA 2ZGUA 3AMQA 3AYDA 5AVPA 2UU8A 1QOTA 4HFSA 4J1WA 1ZRRA 1XE8A 1MR5A 3E5UA 4FXKB 1O3RA 4YM2A 5DZEA 5CNAA 3VBUA 2YYOA 1GQHA 2OVUA 3M70A 1Q43A 4I02A 1TEIA 5EWSA 5L19A 4OI0A 1W0PA 1WD3A 5GJ6A 4FQ4A 2GMPA 3GZUC 3MF6A 1YCIA 4FTBA 2HWD1 1G86A 4ONUA 4GWNA 4OUSA 1PO13 4I2OA 4FPGA 1LTEA 2IFRA 4ISRA 1PO23 1MZEA 1DZRA 1W6OA 3H7JA 4XHBA 2EAAA 4RHV3 1SBEA 4AVCA 2CWMA 3SXWA 1OFNA 1LULA 1TNRA 5C8CB 3WLUA 2ZA9A 2Q30A 5D8AA 3G7DA 2KM2A 4BPZA 1JBCA 1WA4A 4IV1C 3ZXGA 3WZ1A 2XKPA 1OHFA 2XJRA 4MLOA 4HN1A 5FPXA 1SBFA 2K2SA 2ZHKA 1PO12 4XF9A 1RITA 4Q0SA 4K7JA 4MV2A 4Q4V3 2XL9A 1PO22 2FBEA 1J3QA 2GSYA 1HLCA 4W6WA 3FFZA 2HEWF 2WLQA 4GALA 3P3NA 5F6KA 4AFCA 4JV4A 3ZYRA 2A3XA 3RQ0A 1Z0HA 1O91A 4FQZA 4WZCA 1RUC2 4M3CB 5J7MA 3VBRB 1BZWA 1AR71 1QKQA 4ATEA