1Z78A

Crystal structure of the thrombospondin-1 n-terminal domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
NSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of the thrombospondin-1 N-terminal domain and its complex with a synthetic pentameric heparin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Thrombospondin 1
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2005-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1z78A00
2P2KA 1PZ9A 3AYCA 2A71A 2ZZJA 3SLIA 1N1YA 3ASIA 4Y1YA 2E51A 1AX1A 1WW6A 1UAIA 4YZ5A 5CAZA 1BJQA 1I1EA 3NV1A 2WJSA 4D69A 2VU9A 2ZAAA 5HCAA 3B9CA 4DFSA 1H30A 1AF9A 2UWCA 3OY8A 3RMYA 2A6YA 3D4KA 4YGEA 1DQ4A 1UKGA 2CNAA 3I8TA 3ILRA 1YIFA 2Z42A 4MYEA 3O12A 1LECA 4YW1A 3IMNA 4YW3A 3AP5A 1SBEA 2ZA9A 4UW6A 2CYFA 2DVBA 1CONA 3ZSLA 2E7QA 4FOQA 2CY6A 2YZ4A 5HCFA 1AJKA 1KQRA 1QF3A 4R9CA 4C1XA 4DS0A 5IK7A 3N7KA 3V0AB 3FBYA 4M3CE 2ZGQA 5E89A 3VKOA 2H0BA 4TYSA 1NXD1 3QCWA 4Y22A 3V0BA 1ULEA 2A70A 1FNZA 1AZDA 1WLCA 3AP6A 2PHTA 1W6PA 4W65A 1IKPA 2JD4A 4XJZA 2SBAA 4YM2A 5DG2A 1CIWA 1LHVA 1JXNA 1WW4A 5CB7A 1QU0A 5FRAA 5GM0A 1LOBA 4XZPA 4XTPA 3ZXLA 1SACA 4YLZA 4YW2A 1MACA 4JC1A 3H0OA 4WZFA 1LU1A 2D6KA 3RMXA 4FOYA 2GMPA 2DTWA 4YGBA 1BQPA 2ZMNA 2NMNA 1C4RA 2ZABA 3ILFA 1URXA 4CTEA 3N35A 3AJYA 3M2MA 4ITCA 1S1AA 3M1HA 1R1ZA 3FLTA 2CL2A 2OUJA 3N7MA 1YXWA 2CTVA 3B3QE 3UK9A 1FV2A 2D7FA 3BODA 4JCKA 1SLAA 1MVQA 3PJQA 1Q8OA 2UU8A 3AZVA 3RRDA 4ASMB 2V5YA 4XXPA 2JJ6A 4C1WA 1FATA 1W0OA 1X50A 2YV8A 4FPCA 4XIOA 4YGDA 5FREA 1Q56A 2ZMLA 2AYHA 5KXBA 4LBOA 1CN1A 1FYUA 1O4YA 3OYWB 1EPWA 3OJBA 2LTNA 4DRVA 1MR5A 2VW1A 1KRIA 2WT2A 2AREA 2ARXA 4FPGA 4TZDA 2ZGUA 2R1DA 2ZHMA 3AZXA 1MZ6A 4IQPA 4XYXA 4YZ1A 4XJWA 4M3CF 4UW3A 4K21A 4ATEA 4AVSA 1JYIA 1I3HA 1J1TA 4K1YA 1V6OA 2WKKA 2WT1A 3WDWA 1S0IA 4LBKA 4XDQA 2VW2A 2JKBA 1AXYA 5DZEA 3UJQA 4XBNA 1U0AA 3WVJA 2ZGPA 1KJLA 4Y1ZA 2VH9A 1H9PA 1YRZA 3TB0A 5JVVA 1UPSA 2EIGA 2DTYA 4BMBA 4RL7A 1N47A 2D3SA 2D6MA 2DURA 2YY1A 4P14A 3AXEA 1DYPA 1LOFA 1F5FA 2DVAA 2D6OX 2E6VA 5EWSA 5JOZA 3WG2A 2E7TA 5H9SA 5T54A 1WW5A 2JE7A 2XG3A 4XMAA 4XJ8A 3R05A 3FUQA 1BZWA 2VUAA 3RSJA 5AVAA 4Q2FA 1LODA 1F9KA 4ZXKA 1HQLA 3IM0A 4M01A 5GZEA 2B7YA 1O4ZA 3A4UA 1GZ9A 2WT0A 1JHNA 5DG1A 1AJOA 1DIWA 2PELA 2CWSA 1SLTA 2R0HA 4YFZA 4XJ9A 1LGCA 2UWAA 3MW2A 1UZZA 3WHTA 2ZBJA 4P9YA 1QNYA 1ULDA 2LALA 3AJZA 5JDBA 3WDTA 1BYHA 3WG1A 4Q1PA 4R9DA 5CA6A 3V0BB 3AP9A 4H55A 4PF5A 2EXKA 1AVBA 2DYCA 4BLIA 5F9TA 4LBLA 4XTMA 1G9BA 1GYKA 1G9FA 1CVNA 5T5PA 2ZHNA 3M3EA 4LBNA 3B01A 3OYWA 1D2SA 4Z8BA 3JUUA 3WDXA 3N36A 5H9PA 4BOWA 4FQZA 1WLWA 4Y20A 2PHWA 3SISA 5DUVA 3N3HA 1WBFA 3IPVB 1LHNA 5CBLA 4YW4A 4BPZA 2GNMA 1YO8A 4LBQD 3ZXJA 2E53A 1LOEA 2GNDA 1BXHA 2EXJA 2P3JA 1C1LA 2DU1A 1D0HA 1SLIA 2ES3A 5T5OA 3USUA 5GLUA 2AR6A 1DLLA 2ERFA 1KDKA 1N3OA 5KXEA 3LSDA 1QDOA 1GZWA 2ZKNA 1QOSA 2WQZC 4GALA 3MW4A 3OPZA 3NWKA 4LBMA 3VV1A 4GKXA 3PVNA 4PCRA 3SH5A 3ZVXA 2DUOA 1S0BA 1SLCA 2OVUA 1Q8SA 5GZDA 5GLTA 1LOGA 5E88A 5T5LA 4DPNA 1YI7A 5CNAA 3SH3A 1Q8VA 1V6LA 1VALA 3AP4A 1UL9A 2D6LX 4PBOA 2A75A 1WD3A 3I4IA 4AVVA 4BMEA 4GA9A 4Q26A 4XIKA 4YW5A 5IT6A 1AXKA 1ULFA 3JU9A 3WG4A 1SBFA 5SV8A 2DVFA 1DGLA 4XOGA 3DUIA 1HLCA 1RITA 1ZM1A 4NO4A 4XXAA 4WVWA 4FPHA 4AGRA 4BLJA 4RA0A 2A6WA 2YMZA 1MS9A 2ZACA 3O0VA 4U36A 3PVEA 3HMYA 3INAA 3Q9OA 3V65A 1ENSA 2A3YA 2DUPA 2FMDA 2DVDA 4UW4A 5JMCA 4YG3A 1ULCA 1LTEA 4YM0A 3IKWA 1A3KA 4FPKA 2ZGOA 2WSUA 3MPPG 2UWBA 1UZYA 4FOWA 4ISQA 5E8AA 4XE9A 3C2UA 1JN2P 2ZGTA 4ISRA 2GN3A 2R49A 1HQWA 2KM2A 2ZGNA 5IUQA 1LU2A 2OUHA 1MS3A 3N7JA 1H9WA 3U4XA 3V0AA 1LGNA 3AYAA 3B69A 3IPVA 4YFWA 1LHUA 4DQAA 5T55A 2EALA 4BQ1A 2ZHKA 1N1SA 4LBJA 4P9XA 3AYEA 1WCSA 5L73A 2ZGLA 1BKZA 1SCSA 4Q8LA 2UURA 4XBLA 2DV9A 1GICA 1CJPA 2A7AA 2AGSA 2Q5TA 3LCPA 5DUUA 2W08A 4HANA 4P9WA 3USUB 4Q1RA 1GZCA 1GBGA 1DYKA 1HDKA 1Z78A 4Y1VA 5BYNA 1CPMA 4ZKTB 1CR7A 1ENRA 5GLWA 1DQ5A 4FPJA 4R9BA 4YM1A 2AH2A 1HKDA 1SLLA 4K1ZA 5F5QA 3V64A 3WUCA 5GZCA 3AK0A 3FLPA 3A0NA 1IOAA 4M3CA 3O0WA 3AYDA 1B09A 1QDCA 4PQ9A 2GMEA 1DQ1A 4LBQB 1W6NA 2ZHLA 1UMZA 1G8WA 2GALA 1ONAA 4Q8KA 2D3PA 1JUIA 1RINA 1Y7BA 2PHUA 4XJUA 3SITA 2NYYA 4Q27A 1WUVA 5DUXA 2W39A 4SLIA 2V73A 5KXCA 1XQNA 1LHWA 1PZ8A 2EAKA 1LEMA 3BOPA 3N7LA 3A0KA 3POYA 2P37A 3OBTA 1ULGA 1MVEA 4YG0A 3UL2A 3UJOA 3W59A 1JOJA 4CRQA 5T50A 3IN9A 3SH4A 3WCRA 3ZSJA 3O5SA 2EF6A 3OBRA 2NMOA 5EYYA 1UX6A 2JDZA 3R4SA 4WV8A 1V6NA 3VKNA 5IK4A 4XJAA 5IK8A 4YGCA 4AWDA 1AX2A 1N1TA 1WW7A 2JECA 1IS6A 5GZFA 3ZSMA 2D44A 3NV2A 3FUOA 1LULA 3KM5A 3WLUA 1W6OA 2HYKA 3O0XA 1GSLA 1LEDA 2ZMKA 3RS6A 1QNWA 3WNXA 3ZXEA 4YM3A 2TEPA 3WZ1A 2AUYA 1UN1A 4U2AA 1G9DA 1FX5A 2DUQA 2ZGMA 3QLQA 3RG0A 4ATFA 1V6IA 1LENA 1Z0HA 4FP2A 3WUDA 1A8DA 4AVTA 1FV3A 2P3IA 3WCSA 4M00A 3OGGA 4YZ3A 1Q8PA 1QOTA 4FP3A 4KBBA 3ZYRA 2C5DA 1MZ5A 2W68A 2XB6C 4L8QA 5GZGA 1S0FA 1GKBA 1W6MA 2VW0A 2SLIA 3HN1A 1LOAA 2DU0A 3AZYA 3B00A 1C1FA 1W6QA 2ENRA 2OW4A 1CQ9A 4Y24A 3TAYA 3WV6A 1JW6A 3LSEA 5T52A 5EXOA 4Y1UA 2GN7A 4AYUA 2ZGSA 1N3PA 2D6PA 1S0JA 1G86A 1C57A 2EXIA 1W6MB 3MW3A 3AFKA 3R4UA 3T1MA 1DQ6A 5H9RA 3AXDA 4XHBA 1IKQA 1AXZA 5GLZA 1SLBA 4HL0A 1VAMA 2PHXA 4BM8A 2DWRA 5DZFA 5KXDA 2ARBA 3BTAA 3D6EA 1MS5A 1N1VA 4Y26A 2ZGKA 1JBCA 1MS8A 2A6XA 1QMJA 1FNYA 2P34A 2R1BA 2VY0A 5H9QA 3WG3A 3AZZA 1Q8QA 5IK5A 1V6JA 4Y1XA 1S0CA 1W6NB 1LESA 4AGGA 2G4IA 2YROA 3NV4A 1DQ0A 1V6KA 2W52A 3PVOA 4FPEA 3ZSKA 4CZSA 1V6MA 3OY8B 1DBNA 2GMMA 1LOFC 3HR9A 1VLNA 1ENQA 1LJ7A 4FPLA 2GNTA 1PZ7A 1KITA 4R9AA 4WVVA 1OKQA 3WHUA 4YZ2A 4FVVA 4XBQA 3WDVA 1IS4A 1LHOA 1FAYA 2DVGA 2R0FA 1YYNA 1N3QA 1CPNA 1ZA4A 2WSVA 3ENRA 4LBQA 4DRRA 3T2TA 4GWMA 3AP7A 1SFYA 1VIWB 4FPYA 1W6PB 1G9CA 1NLSA 3W58A 2WNEA 1IS5A 3D5OA 1MS1A 3M3OA 2CWMA 4YZ4A 2NN8A 3APBA 1DQ2A 4F83A 1V00A 2NZ9A 5LK5A 4I30A 1CESA 1APNA 1MS0A 1W6QB 4AGVA 3PMEA 4FPOB 1IS3A 2R16A 2ZGRA 4M3CB 4YG6A 1LCLA 4XMIA 3RQ0A 2FHRA 2PHFA 4XILA 1VAVA 3VKMA 2EXHA 3T1LA 3ZPYA 1KJRA 2P3KA 1SBDA 5T5JA 3VKFC 3WOGA 5GALA 4Y22B 2JE9A 1DZQA 3ZXFA 5JOWA 2A5ZA 1AX0A 5JOYA 5DUWA 1QOOA 3VKLA 1LGBA 1QKQA 1W6OB 1JYCA 1GLHA 3AX4A 2NP0A 1W0PA 2A3XA 1OQ1A 3WDUA 3M3QA 1OFSA 4GWNA 3CNAA 4OZXA 5GLVA 2WLQA 1GNHA 1S0EA 1G7YA 3POSA 2RHPA 1RIRA 3FFZA 4FPFA 2NM1A 4FQ4A 3KQRA 3MEPA 3GNEA 2A6VA 1G9AA 1QGLA 1SCRA 2YXSA 4FOVA 2AENA 1GZWB 5EYXA 2A3WA 2VXRA 5DXDA 1F31A 3NV3A 4K20A 2GDFA 5JLVA 1A78A 2GNBA 3AZWA 4GXLA 4Y20B 1DHKB 1GANA 5GJ6A 1LOCA 3M3CA 4XHXA 1DFQA 2I2SA 5DZGA 1KDMA 2D3RA 1S0GA 3ATGA 4UW5A 1WD4A 1GV9A 3ZYPA 4GKYA 2D43A 1MS4A 1TEIA 4PBPA 5HCBA 3WDYA 2A6ZA 3BIWE 1GNZA 2D6NA 2BQPA 3FLRA 3DGTA 3ZXKA 1S0DA 5JOXA 3VUOA 1WBLA 3POWA 3ILNA 2PHRA 4NOTA 2C9AA 3GALA 3SNMA 1WLDA 4JRAA 3L2YA
chains in the Genus database with same CATH superfamily
3U11A 4AR2A 1W9FA 3AYCA 3I3DA 3M70A 2Y0IA 3P5BA 1N1YA 3ASIA 4YZ5A 4COZA 5FXZA 4EWEA 4D0QA 1GP4A 1NCQB 1UQXA 2ZAAA 1I6XA 2ILMA 5HCAA 2Y6HA 2K0GA 4UFLA 1AF9A 2UWCA 3OY8A 3X29B 3CKHA 3FWEA 2I74A 3LDRA 4MYEA 2VVDA 2XR4A 1MZEA 5ERLA 4YW1A 3O12A 1LECA 5DAVA 3IMNA 4BQ3A 3RVHA 2ZA9A 4UW6A 2WZPP 2CYFA 2RM23 2DVBA 1RUC1 4LIVA 3ZSLA 2E7QA 1BVP1 1F15A 2CY6A 5HCFA 4P9GA 3ZMOA 1AJKA 1COV2 2QKDA 4IEVA 1KGYA 4C1XA 1AR83 3N7KA 2X8KA 1AR73 2XJVA 4TYSA 3ZIXA 1NXD1 2GH2A 1OLRA 2BERA 3DECA 3H9AA 4SBVA 3V0BA 1CX1A 4Q0PA 4QX7A 2PHTA 4MGTA 2ZS6B 4L9BA 4LKFA 2R6QA 3GBWA 2YU2A 4XJZA 4LKEA 1F8VA 4YM2A 2R042 2XONA 3BTZA 1W9TA 1WW4A 2Z69A 4QX5A 1QU0A 4XEZA 5A1FA 1TME1 1E5SA 3WQ0A 2HJIA 1NA1A 5FYSA 1ST8A 2XKOA 4IL7A 4JC1A 3HQRA 1S55A 1LU1A 2C6SA 3C7HA 3VD7A 1UXXX 4FOYA 2GMPA 5FJKA 3OGSA 2ZMNA 2NMNA 2NPIA 4Q4W1 1X9TA 2BVVA 4B4PA 5KHIA 4AW7A 2LS6A 3SCGA 4D7YA 4AI0A 2CL2A 4AHYA 4QQOA 4KNCA 4IE7A 5A3TA 1WMDA 3LE0A 2I07B 5DN2A 4PIYA 5BNNB 3HT2A 4OMDA 4Q4X3 5FY1A 5FZCA 3EQEA 2YBSA 3BOWA 3PJQA 1Q8OA 3AZVA 4S2GA 3RRDA 2V5YA 1ZBA3 4ARXA 4YGDA 5C33A 4XIOA 3FC0A 1Q56A 1UU6A 2XLAA 1WGPA 3LF7A 3OYWB 1FYUA 4GZ9A 1EPWA 3OJBA 1UYYA 2BWCA 1FOD1 5IATA 2Y8KA 3LWCA 2ARXA 3O1VA 2VZPA 2A73B 2ZGUA 2R1DA 5EJ1B 2J1VA 4NN0A 3U0ZA 4IE4A 4AEJA 5CADA 2BUKA 4XYXA 5F8PA 2HEWF 2YC4A 4XFCA 4UW3A 5FKCA 1CAXA 2WO2A 4DUVA 4AVSA 3BI3A 5TSWA 2IXIA 1JYIA 2ZKLA 5F6LB 2WT1A 3WDWA 4FCAA 4UBHA 3ZYHA 4XDQA 2VW2A 4EN8B 1WWYA 1U0AA 4LO5B 4XBNA 3WVJA 1YRZA 3FBMA 2KA3A 1SDDB 2RS13 3TB0A 3UT0A 2E26A 1NYWA 4E4ZA 4EYUA 2CV6A 4IDZA 3VL8A 2D6MA 1I9RA 2DURA 4EROA 1MEC2 3AXEA 2BOJA 2R041 2JG8C 3H8OA 4DOUA 4AI9A 2E7TA 3PDQA 4MUVA 1GQHA 2JE7A 2XG3A 2Y6FA 4QD2A 1BBT1 1C28A 4LO7A 1J3QA 2RM22 4UI9L 4XJ8A 4AQTA 3J26N 5ACA1 3FUQA 1BZWA 4QMAA 3RSJA 5AVAA 2WA3A 1LODA 4LOTA 4ZXKA 2R062 4X6RB 1VBA2 2HWC1 1O4ZA 5FZMA 1GZ9A 1WLTA 3JQXA 3NNJA 4I2OA 1HRI1 2WT0A 1JHNA 3U1XA 4IESA 3T2QA 5C3QA 1UY4A 3PLQA 3GHNA 2PELA 2CWSA 3CIHA 4QB6A 2A1XA 3WF1A 2R0HA 2W1SA 2BEOA 4W4ZA 4CP0A 2R043 2UWAA 2XGXA 2B46X 4A7KA 2XVGA 3KV6A 5GKAC 1EV13 1QNYA 5F2WA 3LEKA 2ADDA 4LO8A 3AJZA 1RUF2 3AKTA 4N9IA 1ZZBA 5IW0A 4AEKA 4AVCA 5CFDC 3KV4A 4LUKA 3O14A 4IE6A 5CA6A 4H55A 4CCJA 3I49A 4PF5A 1AVBA 1VE0A 5A3WA 1ZRFA 2E33A 3EJKA 5T5PA 1IGOA 2QQWA 3S30A 3OYWA 4HFSA 1ZX5A 3ZN5A 4K9SA 1AR61 2XWJB 5LEJA 2WR9A 3F95A 4Y20A 3WX5A 3S5QA 3KV5A 5FPBA 3MUY1 2KR2A 3ZX7A 2QFEA 2IUWA 3RZZA 3ZMNA 1LHNA 1ZRCA 2YDEA 4JTNA 4AI3A 2QCSB 1CAXB 5FZ7A 1UOFA 2P3JA 3MZHA 5FPZA 1R1A1 3B94A 3VZNA 1RUI3 1SLIA 2ES3A 3ETPA 2AR6A 1DLLA 1W8ZA 1KDKA 2JDHA 2PLV3 1N3OA 5KXEA 4XUNA 3FHIB 3MV11 1GZWA 2FZ2A 2WFF3 2HWF3 4MSVA 4QGMA 3AMNA 3SH5A 4PCRA 5A3UA 2VUDA 1ND3B 5DAPA 3AKSA 1S0BA 1SLCA 5DABA 5GZDA 5E88A 5T5LA 4TN7A 3VHNA 1CZTA 1CZVA 3SH3A 3KF5A 1AL22 1Q8VA 5FZ0A 3LDBA 1OPMA 1CIYA 2RVAA 5BNNA 2P17A 1VALA 3MYXA 3AP4A 1UL9A 4PBOA 1PNGA 1WD3A 1D4M2 3GM8A 4IEYA 2RS12 4AVVA 2GC0A 4GA9A 4LXLA 3BALA 4Q26A 3RWKX 4QX8A 5A70A 4YW5A 1IHMA 2W3JA 2Z79A 1ULFA 3T1MA 1SBFA 4PIZA 1DGLA 3O1SA 2WO1A 2JG9B 3D82A 1ZM1A 2ZX3A 4XXAA 5EV7A 4AGRA 3P3PA 2A6WA 4QT6A 2C1FA 1MS9A 2CHHA 3O0VA 4U36A 3HPNA 3PVEA 3INAA 3Q9OA 4AEDA 2A3YA 3URFA 2DVDA 4YG3A 4CDUC 1QJY3 2OX0A 2X5IA 4YM0A 3VDDB 1EV11 3IKWA 1ND3C 1AR81 1MQTC 2VUCA 5C6CA 5LRRA 4I3PA 4AVAA 3MPPG 4ISQA 3SXWA 2LROA 4WM7B 3KCYA 3NRUA 4KI5M 4ISRA 1HQWA 1EAH2 2XUEA 2VD7A 2ZGNA 1NG0A 1OMIA 4AF9A 1LU2A 2OUHA 3POIA 1GWMA 1MS3A 2AEYA 1BLZA 1H9WA 5FMBA 3RDIA 4ASKA 1LGNA 3AYAA 1ZREA 2VZTA 3VD3A 4DQAA 1FPN3 1OT5A 5T55A 4LBJA 3R0RA 2QBXA 4PI0A 2ZGLA 3NAPA 5DUUA 2DV9A 3LCPA 4EQVA 3W9AA 1US3A 3JBG3 3S7EA 1DZRA 4Y1VA 5D8AC 1Z78A 2FZ1A 5ABJB 1CPMA 4TLFA 3ZLIA 1OOPC 5GLWA 1VRBA 5LZ6A 5K4LA 1H4HA 1PGW2 4K1ZA 1RUE2 5F37A 3AK0A 3FLPA 4CDUB 4C91A 5ACA2 1UIKA 2ZAHA 1QDCA 2GMEA 1YI9A 3H3ZA 1NLRA 2Y6LA 1UMZA 4WM7C 4BE3A 1VBB1 3LD8A 4XJUA 1JUIA 1Y7BA 1QH7A 2BGPA 3K4DA 4LHSA 1WCUA 2B9UA 4M4PA 4SLIA 5CYYA 4RGGA 3KCXA 4AI1A 2V5DA 1SEFA 5BNNC 3UJOA 1GP6A 1MVEA 1PVC3 5FZIA 3W59A 3ZYJB 3JB4C 3IN9A 4LPLA 3WCRA 3ACIA 4WVMB 3K77A 3I2DA 1E5HA 2JDZA 2ZEXA 1PMHX 1DLCA 2QNKA 2GC3A 2VCAA 1DZTA 4FFHA 5IVYA 3VKNA 5J3UA 1K12A 4DO0A 3MLJA 2Q8OA 3ES1A 4AWDA 4L99A 5F5AA 5FY9A 5F1RA 1A8MA 4XF1A 1VRH2 4CDXB 3FUOA 4GB33 3ABZA 2XLFA 5DPNA 2HYKA 3O0XA 2ZMKA 2EA7A 3BVCA 4QX0A 4S2DA 1L7QA 4MGSA 1F35A 5I0TA 2TEPA 3WZ1A 2AUYA 4BHPA 1UN1A 1NX9A 4U2AA 4PHZA 1NE4A 1UY2A 2DUQA 2XL9A 4ZS3A 3RG0A 3WUDA 5F5CA 2MPFA 1D4M3 3J7NA 2GH8A 2VQUA 4ZU5A 5FP3A 3VBOA 4NRMA 4BB3A 5A3MA 4YZ3A 3WQ7A 3AMMA 4HKWA 4MXWA 3LIGA 4OULA 3ZYRA 2JB4A 3SQOA 1ZVFA 4LHLA 2XB6C 2HWC3 5C5UA 4EN6B 1GKBA 1W6MA 4KWJA 2VW0A 2BVBA 2SLIA 2VQTA 5JXIA 1LOAA 4CEWB 2DU0A 2FDIA 3NJYA 1PMJX 1HW5A 4WM8B 2VPVA 5KHGA 2R072 3TAYA 4XQDA 4Q0VA 3LSEA 2PQSA 1QJY2 4MVTA 5F2SA 2D6PA 1PMIA 1S0JA 1C57A 2JICA 1RUJ2 1W6MB 2VBBA 3AFKA 4LK6A 4AFMA 3W5NA 3KCCA 1R091 4QPIC 4PDWB 1AXZA 4JHZA 4HL0A 1VAMA 4Q0QA 2Q30A 2KD7A 5KXDA 2ARBA 3VBRB 2RJLA 3LPFA 4H7LA 1O3SA 3AMQA 3SCHA 3D6EA 3T09A 5C5TA 2IVJA 1QMJA 2RR13 3CL1A 3KGZA 4AHWA 4B3NA 2BNMA 2G9GA 3A7QA 1ZBE3 1Q8QA 2YFUA 3HOBA 1W04A 3SEEA 3VBOC 1LESA 4AGGA 2QZ2A 1DQ0A 1OF3A 1EUTA 1V6KA 2W52A 2HWE3 3VBFA 4ET7A 5JR2A 3AL5A 4UOJA 2VMHA 4MZUA 5E6HA 3EYPA 4GWJA 4I01A 4OHVA 3L9JT 4BQ4A 1TME2 5K0UB 4FPLA 2GNTA 2C0ZA 1POV1 1PZ7A 1PX3A 4R9AA 1OKQA 1OVPA 1PO23 3AKRA 5AFBA 2VBPA 3VDDA 4PI2A 1IS4A 1VAKA 3B7MA 1AYM3 1XNDA 2DVGA 3EO6A 2R0FA 2WNVB 3CEWA 3OUHA 1VBC2 2HLEA 4N43B 2FCTA 4AFDA 5FXXA 5AVPA 3H42B 4YPJA 1VBA1 3ZDVA 4A3ZA 2VNGA 4AQ2A 4H14A 3D0SA 4GB31 3QH6A 5JZGB 1JI6A 3DKQA 5FZLA 3OUJA 5IVJA 5CKNA 1G9CA 2VNRA 1IS5A 4CU7A 1W3VA 3ZFGA 2E9QA 2RDNA 1OA4A 1UU5A 3M3OA 3AB0A 2NN8A 4O7XA 5IVVA 3CLPA 1EY2A 2BWAA 4UF0A 1V00A 2NZ9A 4EWAA 4URTA 5KHJA 4QAWA 2BPA2 4BJ0A 1APNA 1W6QB 4Z07A 3ALQA 1RUC3 5FBZA 4FPOB 5FK8A 4S2HA 3UKTA 3H8RA 1O3TA 4FAHA 4JTOA 5HXVA 4YG6A 4IEOA 1JU3A 4KG0A 2XH6A 2FHRA 1XBFA 4IE0A 4NAMA 4JDOA 5J48A 2RS53 3LA2A 1UKRA 2JDNA 2XBO2 4GD4A 2WO7A 1G6NA 1NOVA 2ZOEB 1CAUB 3S6PA 4FTBA 1OFNA 5T5JA 3VKFC 3QACA 1YNAA 3IIIA 4E8CA 3C3VA 3ZXFA 2A5ZA 5BNPB 2VZUA 4HXCA 1YC61 1W6OB 2V4AA 4GMP0 5A1AA 4XAAA 2QDRA 2QQMA 5FZEA 2VECA 4LUMA 3WDUA 2VOVA 3SHRA 4LT5A 1XYOA 2ZX1A 3M3QA 3CNAA 1LRHA 4IUGA 5GLVA 3TBDA 3ZYIB 4RGKA 3ZYGA 1LKNA 3IDEA 3SMHA 4QU1A 3LOIA 4NIGA 3NMBA 2NM1A 5LA1A 1LR5A 2YBPA 1QGLA 5LEKA 5BNOA 4FOVA 5C3OA 2PTMA 5HCHA 3VBSC 2ZX0A 4KGGA 4I02A 5JLVA 3WNKA 2GNBA 1IG0A 4CU9A 2WZR1 2XHKA 3AZWA 5EFUA 3THTA 2FDFA 2ARAA 3K4ZA 2C26A 4LHNA 1DFQA 1KDMA 4E2GA 3GCXA 1REDA 4HZFA 1GV9A 2L9LA 5FO7B 5FV3A 2D43A 2R061 1MS4A 3PTRB 5CKMA 1VJ2A 1GNZA 4UFIA 4AEMA 4EWDA 2BV4A 4YSFA 1NE6A 1UY3A 3M4FA 5JI7A 3T2PA 1S0DA 3LGRA 4W6YA 1HB2A 2VZSA 1X7NA 1WA4A 1XU1A 1H1MA 3OGVA 4MV2A 1CD3G 1QIQA 4JRAA 5IAVA 5D8AB 2A71A 3GJBA 3T08A 5FZ4A 4Y1YA 5I0RA 1WW6A 1YFWA 3L2HA 4V2VA 2WJSA 1RUD2 4LULA 4D69A 2RS51 1H30A 4RHV3 4UFJA 3TWIA 1HXS3 1VBD1 4I09A 4YGEA 1J84A 4IEXA 1QHDA 5M0TA 1YIFA 1AYN2 5APAA 2VAUA 4LKSA 4ZHNA 1DGRN 1XE7A 5T3NA 1AYN1 5FPLA 2HWF1 4IV3B 5FZKA 5IK7A 3ELNA 3KQ4B 5CG9A 4QHOA 3I3QA 1H1AA 2ZGQA 4PT6A 5ANNA 1C8NA 1XPWA 2H0BA 3QCWA 4FT8A 5E89A 3RWNA 1L7RA 2JB8A 1NLQA 4E2SA 3ACLA 3DXUA 3BU7A 5FOJB 4RFT0 2IZWA 3Q8EA 4JGZA 4P02B 5JPMB 2PAMA 5DG2A 2TUNA 3HT1A 1JXNA 2B9VA 2K46A 2X53S 5BXXA 5A7PA 2RS52 5FRAA 5LBEA 1UYZA 2JG8A 4XTPA 1UCXA 1FOD2 2YGMA 1NUKA 2QQOA 3ECQA 3ZXLA 4YLZA 2VZOA 1W8WA 4QPGA 1HV1A 1R64A 4JQRA 3H1YA 2C9KA 3B02A 2Q4SA 3NJVA 5FWEA 5DAWA 1R092 4YGBA 4COYA 2WBKA 4DXZA 4A41A 4ZU7A 4Q4W2 4XACA 3N35A 2WUHA 4ITCA 4BIOA 4BWOA 2O0OA 2Z5WA 4F7ZA 2OUJA 2E31A 1BEV3 3UK9A 1FV2A 2J1UA 1SLAA 3LQCA 1QXJA 3C7FA 3OSDA 5IVCA 4CVUA 4XXPA 3MHZA 3DCQA 1FATA 5FREA 3BIEA 5A6XA 1ZZ6A 5FIXA 5LCWL 5KXBA 2AACA 3EBRA 4QGLA 2Z4FA 1HRI3 1S2BA 2P6HA 4MH0E 2TNFA 5C8CB 5IVFA 4FFIA 2ET7A 1OD3A 2BGOA 5FUNA 1OHFA 4HN1A 1W05A 2VW1A 3IDBB 4QM8A 4DRVA 5JPNB 2QQVA 2W5FA 1YLLA 2ZHMA 3BUCA 3J8F3 5CFDA 4DXRA 4NMIA 1MZ6A 3A21A 3WP6A 5FLIA 4K21A 4CUGA 1J1TA 3K4AA 2CDPA 5K8SA 1S0IA 1QXPA 2OPKA 1W9WA 4IV1B 3AKQA 1AXYA 2ORXA 3WD5A 1F2NA 3GJAA 4DEVA 1H9PA 1RUH3 1TVGA 5FYMA 3VZMA 3CZJA 5F5IA 3TEWA 3ON7A 4JZRA 5JVVA 1N47A 3O1MA 2D3SA 4YYOA 4D6QA 3AFGA 4D6SA 2NQYA 2QJVA 4DUXA 1VBA3 1Y4WA 1IQDC 1F5FA 2DVAA 2WRAA 2J42A 4ONUA 1HRV3 2XMLA 2IXLA 1SFNA 3K46A 3LEGA 3PU3A 3AM2A 3PVBB 1AYN3 5C8CC 4E4HA 5FYVA 1VB4A 3RPQA 3TEZA 3UYJA 3ITQA 1HJGA 3O1UA 2B7YA 3A4UA 4MHRA 4NWWA 2R30A 1YJLA 2BRTA 3BYWA 5J36A 5JSOA 3MF9A 1O3RA 4UAPA 5E1RA 4NPRA 5C8WA 1OPOA 1RUF3 1BBT3 2IXJA 2PAKA 5DAQA 1OLMA 1AJOA 5DG1A 1RB8G 1O91A 4XCBA 1GNYA 1SLTA 5FUIA 1ZZ8A 5G05L 1ZRIA 3USSA 5A80A 2P1BA 1QXRA 4O65A 1LGCA 1V70A 3MW2A 1PGSA 2ARCA 5DDJ2 3RZJA 1ULDA 2ZEWA 3I59A 5FK7A 4CDWA 2H6BA 3E5QA 2W91A 1L3JA 5FP8A 1GQGA 3WDTA 3RZMA 5FZ3A 2OXBA 1QJU1 4Q1PA 3HNMA 3IAPA 1YUDA 3V0BB 5FAXA 3S7IA 5FDBA 3TRSB 1UNBA 1OA2A 3KLSA 3VBHC 1RMU3 2WNUC 4IV3A 4XTMA 1G9BA 1CVNA 1UZ0A 2JDPA 4L11A 1OLQA 2JDYA 4JAAA 4LBNA 1B35B 4MGQA 4QWNA 5FY7A 1D2SA 4ARYA 2XQRA 1ODMA 4BQXA 4NJ4A 4YW7A 1XRUA 4CDUA 3JBG1 5H9PA 4META 4AZZA 1WLWA 3OEBA 2XPJA 2PHWA 4XPVA 3SISA 3N3HA 2G9FA 3JQWA 2J1RA 3IPVB 5LB6A 5CFCB 2YG0A 4BPZA 1YO8A 4LBQD 1BK0A 2E53A 1QQP1 2GNDA 1BXHA 1HB1A 2EXJA 1RUG1 4Q4Y1 1C1LA 1D0HA 1DG6A 1QY4A 3N9NA 4UFMA 1RJ7A 2BOIA 3RGBA 3USUA 4CSWA 4A44A 4EZ4A 4CU8A 2GP5A 1AL23 5IAXA 1RUJ1 4K7JA 4QXKA 2HKXA 1QOSA 2WQZC 2ZKNA 4AG4A 4AFAA 2C24A 4Q4X1 3NWKA 4OI4A 3J8F2 1O7FA 4IEUA 4L2NA 1Q8SA 1QJX2 3NJZA 4FSJA 4Q5OA 1AR62 3KS7A 1OQDA 4NRPA 1DGRA 2DCJA 1NZIA 2DBIA 2VR4A 4WM7A 1KS4A 3W20A 4LLOA 4B7KA 2D6LX 1MQTA 3I4IA 5A6YA 1CAWA 1MPXA 1O5UA 2RDSA 3T3YA 4RD7A 1SG3A 1CZSA 4QDQA 2I45A 2XKPA 5SV8A 3Q8BA 2Q1MA 4RQPA 4XOGA 3E6BA 3G7DA 4WVWA 4FPHA 4RA0A 1D4VB 1ND2C 5LA9A 3V65A 2W87A 2FMDA 3RJ2X 4CEWC 3AVRA 4I0BA 4MGKE 4XF0A 1ULCA 2BBAA 1LTEA 2RG4A 2R063 4RQPB 1ZZ7A 4J1XA 5FZ9A 3HIFA 3HJRA 3R6SA 1RHI1 4HBNA 5E8AA 4XE9A 3C2UA 3JCIA 4Z2WA 3KZ4C 2Q8CA 5DMYA 1NXMA 2R49A 3KV9A 5FQ0A 4LR4A 4Q4V2 1EAH1 1H8TC 3EXUA 3ZFGC 3WNLA 3JBG2 2W0XA 4COVA 3WY6A 2X09A 4JHTA 3FZ3A 4JKMA 4YFWA 3ME2A 3NSTA 3IDAA 4P9XA 3AYEA 3NL1A 1WCSA 1RTVA 4GH4C 4BK4A 4Q8LA 5B4XA 1GICA 1CJPA 2A7AA 2AGSA 1YQ2A 2Q5TA 3NNMA 2W08A 4P9WA 1TNRA 3VBFB 1BMV1 2WIIB 5F3EA 2Q8EA 4ZKTB 1CR7A 4MHUA 3LFMA 4FPJA 4YVSB 5C70A 5F7UA 1ASJ2 2AH2A 5F5QA 3V64A 5J09A 3POGA 2BBVA 3UESA 2HWB1 4HSLA 4LQRA 3AYDA 4M3CA 4RQPC 4PQ9A 5KHKA 1DQ1A 1YQ8A 1RHI2 4XETA 1G8WA 5JZGA 4I0WB 2W1UA 4FBFA 2D3PA 1RINA 1W8OA 1OI6A 3I54A 1XB9A 3SITA 2NYYA 3I2GA 2KXLA 4Q27A 3ZFGB 5KXCA 4QKFA 3UKVA 4MO3M 3TN91 1XQNA 1LHWA 1PZ8A 1W2AX 1LEMA 1NY72 3DPRA 1KFUL 3A0KA 3D3AA 3PHMA 3VL9A 4CRQA 3CHXA 5C9AB 2IVIB 1JOJA 2JIGA 5T50A 1JS9A 4J6GA 2F4LA 1WZXA 2CSGA 3CJIC 3SH4A 1HV0A 3O5SA 3OBRA 4GH4B 5HPOA 3R4SA 1PM7A 2BW8A 5IK4A 3B5LB 5FZAA 2B42B 5IK8A 2JXAA 1NA1C 1N1TA 3V56A 3ZSMA 1IS6A 2BJSA 1QJX3 2VMEA 3P3NA 1I5ZA 1VRH1 4CDQB 4JDNA 2OS2A 4OQ9A 1LEDA 3ZXEA 3VBUC 4YM3A 3LA7A 3BTYA 1HN1A 1K5JA 4URAA 2OA2A 1G9DA 1OC1A 1FX5A 5I8SA 2P5BA 1RVF2 3CF6E 1OF4A 2GZWA 2P3IA 3MBWA 5LY2A 1CAUA 1RUI1 2VMIA 3S57A 1T6BX 1W8TA 4M00A 4IV1C 1Z7S3 1RUG3 4NPMA 4FP3A 4Q4V1 4KBBA 4YRDA 4NIIA 2C5DA 1KFXL 4QDRA 3GXUA 5ISLA 5BNPA 1XXNA 1ZZ9A 4L8QA 5GZGA 1S0FA 5C9AC 4UXAA 3HN1A 3PUSA 1JU4A 1LAJA 1QJEA 2J7MA 3AL6A 4XF9A 5FXWA 4RN5A 3UGGA 3CJIB 3MFAA 3ZDSA 4QX1A 2VCBA 3N9MA 4BK5A 3RYRA 2ENRA 2OW4A 2WDBA 4Z2AA 1UYPA 2C4XA 3WV6A 1RL3A 1JW6A 2QTWB 2RDRA 2J1TA 4Y1UA 2JWPA 5LK7B 2ZGSA 1D7PM 2Y33A 1ULPA 2V4VA 4C0HA 3AXDA 2ET1A 1IKQA 3CJIA 1ULOA 1Z7S1 1MQTB 1RYYA 2CGOA 2PHXA 2PYTA 2DWRA 4Q4V3 4S2FA 5DZFA 3R4DB 2VGDA 2WO3A 2WFPA 4YVSA 3K3OA 4CEWA 2F17A 2ZTNA 2ZGKA 5L9BA 1MS8A 5JUVA 4OI0A 2R1BA 1XE0A 2VY0A 3WG3A 4KQ7A 4NIHA 3I2OA 1PO13 2IFWA 1DYOA 5IK5A 2R7EB 2H6CA 3I2IA 1S0CA 1O6UA 2G4IA 2YROA 4P9LA 1GFF2 3FJSA 3PVOA 4N9HA 5AC92 2XJPA 2VC9A 1IPKA 1C8M1 4E8DA 1LOFC 1ENQA 2YB7A 3IIAA 1SPPA 3GZUC 4WVVA 1ASJ3 3JB8A 4AFBA 3WW4A 1U12A 4FVVA 4YW6A 1AUYA 1YIPA 4G4FA 3PTYA 5D8AA 4HVOA 1FAYA 4QXBA 1YYNA 1N3QA 2WNUB 2Q8DA 3OGRA 4P5YA 4NWVA 1B35C 1MZFA 1X8EA 4CCCA 2WSVA 4A6OA 4JKKA 1WMEA 4QKDA 4R52A 3U14A 1SFYA 2QDNA 4RS5B 4FPYA 1GOGA 1YFXA 1W6PB 3NQHA 4M0HA 2VCMA 5L36A 2WNEA 3D5OA 4O61A 1MS1A 2X5IC 3UETA 5LATA 2FMYA 5LWBA 4AVTA 1DQ2A 2QUOA 5KHHA 4F83A 4A7ZA 3C7EA 4NROA 1J3RA 5F6KA 4LMFA 5D1IA 1O3QA 3LOBA 1MS0A 1HX6A 2HH9A 3POFA 1BK1A 1UPIA 3PMEA 4GAZA 1UOJA 4Q29A 2JG8B 2ZGRA 4M4RA 4M3CB 3J8F1 5F3CA 1PGW1 3A22A 1VAVA 4QHBA 1RJ8A 3VKMA 3ZPYA 1OOPA 3RYPA 4X8PA 3OGJA 3FHQA 4IXLA 4P5HA 2WS92 4ORFA 1VMFA 2WNOA 4FTSA 5DUWA 3OCPA 5FP7A 2HWC2 1LGBA 3ZO0B 1JYCA 1XNTA 1GLHA 2YPDA 3AX4A 2GU9A 4P08A 1W0PA 5L7OC 3DYPA 2PLV1 1TMF2 2RDQA 5FP9A 4IW3A 1BCXA 2OQ7A 2OPWA 3NNGA 2BNOA 1JZ4A 4CEYA 1GNHA 2BP6A 4FXGB 1TMF1 3I2KA 2RHPA 3IAQA 4FQ4A 1G9AA 3MEPA 3GNEA 2A6VA 4RHV1 5FYZA 1FPN1 4BQYA 2YXSA 1SCRA 4BXSV 1XE8A 2G1MA 5JSPA 3D0JA 2A3WA 1IPSA 3JD73 1L7LA 2B39A 4N53A 2FQPA 4A2UA 3H8UA 2GDFA 4JGYC 1A78A 5A33B 4NRQA 4CUBA 2W95A 1RUE1 1DHKB 5GJ6A 1JZ5A 4XFIA 4XHXA 4UW5A 1W39A 1WD4A 2QQLA 4ZZ8A 2FDGA 1TEIA 4NE9A 2X05A 2A6ZA 5JIAA 3P6BA 1NKGA 3O1PA 2D6NA 4OHYA 3VHOA 2HWB3 3ZYBA 1H8VA 2N7GA 2E63A 1WCDJ 2B45X 5CVRA 3VUOA 4KU8A 1AR91 1IG3A 1WBLA 3POWA 2PHRA 1PGL1 5JIUA 2E32A 3MICA 4YVWB 3CU7A 1U5ZA 3GALA 3PUQA 4FOQA 3SNMA 4GWIA 1PZ9A 4LORA 5KWRA 1QJU2 2D40A 4LK7A 2ZZJA 3SLIA 2WN3A 4B7EA 1OA3A 1I1EA 5I0SA 4CEYC 5CAZA 1BJQA 1Y9QA 2J1SA 5C7GA 1QQP3 1NCRA 1COV3 2HEVF 1XC6A 2VU9A 3MI8A 4BISA 4DFSA 2ZZQA 1AR82 2BNNA 2RV9A 3OPWA 3MIHA 3D4KA 1DQ4A 1UKGA 3I8TA 3LAGA 3SKVA 2Z42A 3AKPA 4YW3A 4JDMA 3AP5A 1SBEA 2OQ6A 1CONA 5LBCA 4ZPIA 1PO11 4ZZ5A 1NCRB 1RUOA 1KQRA 4R9CA 4QB2A 4DS0A 3CDZB 5FPXA 4KG8A 3VBSA 1ULEA 2JG9C 4B1MA 4E2QA 1AZDA 2JDKA 3GGLA 3Q8AA 3AP6A 4QQ2A 5FZDA 2HWD1 4G3YC 2VM9A 4W65A 4ZY9A 2SBAA 2MEV3 2JKXA 1LHVA 1NA1B 1ZA7A 3RZHA 2ZJCA 5GM0A 4XZPA 2WNUA 4Q0UA 2VQ0A 4CEYB 5CEHA 1PVXA 3E6CC 3IDCB 1MACA 2B5HA 4WZFA 2WS93 4NHMA 3RMXA 3LFIA 4HVRA 3M8LA 4XQ4A 5C3SA 1BQPA 5JXHA 1OH4A 2QQUA 2ZABA 5J96B 1ZBA2 3M2MA 4F8AA 1S1AA 3M1HA 1R1ZA 1TMF3 3FLTA 3A23A 2VOKA 2ZX2A 3HVDA 5FLJA 3N7MA 1ND3A 1YXWA 2CTVA 2P3YA 3B3QE 3IBMA 1JZ8A 3S5AA 3UNPA 1E5RA 4JGZC 3HQUA 1JH5A 2CAVA 3BODA 3RNSA 3DEMA 1HRV1 2UU8A 4ASMB 4C1WA 2WWUA 4KMQA 2JJ6A 5FMOL 2YC2A 4FPCA 3P1IA 4MOAA 3O1RA 2ZMLA 2JDUA 2FCVA 1OOPB 4B1LA 1QWRA 1CN1A 4PLNA 5JMOA 4XUPA 2LTNA 4O9EA 2OIIA 4Q4X2 2WT2A 2R32A 4XDOA 2AREA 1F5JA 2DCKA 2UYBA 5FBJA 1XOYA 3AZXA 1RUH2 4IQPA 4YZ1A 4R4ZA 2WS91 3N9QA 2HWB2 1D0GA 1I3HA 3ZM8A 1V6OA 2JDAA 2WKKA 3NO8A 3T0BA 5EPAA 4QQLA 5DZEA 2JE8A 1KJLA 1W99A 1VBB3 1CX4A 2VH9A 3OTFA 4Y1ZA 3TNQA 2VE1A 1DDLA 1NQJA 3J7HA 5F39A 3QOPA 1UPSA 2DTYA 4RL7A 1VP6A 3WW3A 1E57A 1SPPB 2YY1A 3VZKA 1DYPA 1LOFA 2WABA 3KVAA 4NHKA 4BQWA 4UWDA 2D6OX 2B4KA 1HXS2 5EWSA 5JOZA 3WG2A 5F3IA 1CWPA 5H9SA 5T54A 3ZYFA 3T2OA 1LNSA 5E16A 1BBT2 3U75A 5ANQA 4EE2A 2ETEA 4COWA 2VUAA 4NPLA 1F9KA 5EJ3A 3IM0A 2Z2SB 1JODA 4M01A 4XC9A 4ZONA 2XWBB 2WINB 2QQKA 3JZVA 1CAVA 5FCCA 5BY5A 4IV3C 3I3MA 5FQ0B 5HV4A 1U5XA 1K45A 2EIDA 1D4M1 1ZBE1 1ACCA 3C7GA 1YFUA 2MEV2 1PM4A 4AXOA 3LIHA 3OF1A 3ACFA 5HBAA 5I93A 1C8M2 2LALA 5A3LA 5IJRA 5JDBA 2FBEA 1RC6A 5FY8A 3H50A 4Y33A 5A7QA 4IEQA 1R093 4RGAA 3ZKYA 2J1EA 3ZOIA 3AP9A 4QPIB 5IFTA 2EXKA 1V9U1 5F9TA 1UX7A 4Q4W3 4LBLA 5FMCA 3DKWA 1GYKA 1G9FA 5B2GB 2WQ4A 1J83A 4JKLA 1EV12 4EN7B 1X8MA 3ACGA 2Y26A 2ZPXA 4NHXA 4AVBA 4Z8BA 4BOWA 1W2NA 2WQ8A 3I7DA 1UWWA 1RUI2 3ZR6A 2AEZA 3GCWA 4W6WA 3FFQA 4QPGB 5L7OB 2PLV2 5LBBA 2WFF2 3ZXJA 5HI0A 1YEWA 4EV0A 4QQPA 1C3HA 2YHJA 3M7AA 2DU1A 2Y0OA 4CP9A 2V09A 5T5OA 4D8MA 3ZFEB 1WMXA 2DCZA 3LSDA 3ZIWA 4LKDA 4AI2A 5ABJA 4GH4A 3WF0A 1KS5A 3MW4A 4YWAA 1RUD1 4LO6B 1AR93 4F3JA 3I97A 1YCIA 2GSYA 2VTXJ 5A32B 4MG2A 2OVUA 5KBFA 1QJX1 5GLTA 1FXZA 1OH3A 2XXZA 2Y34A 1C5HA 4BQ2A 1W2UA 3ST7A 5JZGC 2BFUL 1V6LA 3TNPB 1VBB2 2X10A 3I3EA 2DBNA 2W46A 3T4HB 1T2XA 2P4EA 2VZ3A 1EYBA 4XIKA 2VUJA 4Q4Y2 2XOMA 1AXKA 1DGWX 3GZEA 4OHZA 5A3OA 2DVFA 2OT7A 3H7JA 5FYUA 3DUIA 1HLCA 1RITA 3VB9A 4MX3A 2WC2A 4IGQA 3POBA 4QDSA 5FFOC 1TG7A 1BHGA 3HMYA 1W8UA 2WLPA 4UW4A 1VBE1 1IPJA 3AMHA 2XBO1 1A3KA 5JCTA 1UZYA 2HYXA 4FOWA 4GJZA 4CPBD 2BYVE 4E4DX 2GN3A 5FYTA 5FOBB 5JAXA 1W8FA 1NCRC 3MUZ1 4NHYA 2RJ2A 2YFZA 2YU1A 5A6QA 3B69A 4ZU4A 5JSRA 1LHUA 3RI9A 4BQ1A 4W6XA 1N1SA 1XSQA 5DDJ3 4H7MA 2FCUA 1C8M3 4JV4A 1BKZA 3KT7A 4XVHA 5L73A 2UURA 3DXTA 2BDRA 5DQ0A 5ACA3 1EAH3 5FYBA 4BIFA 1OURA 2HBTA 2VZRA 3TEYA 3Q8FA 4Q1RA 1RHI3 1QJZA 1FPN2 1RMU2 1ENRA 3KWVA 3LKJA 2FDKA 2ZCWA 4PLOA 3ZSEA 1HKDA 1SLLA 2VVEA 4UF0B 5BPXA 4DZGA 3MLKA 1H6XA 4GMP3 3WR0A 5GZCA 3WNMA 1VBE3 1VBC1 3A0NA 1UOBA 1IOAA 3BPSA 3KHBA 3O0WA 1QJFA 3PUHA 5EZWA 3ZN4A 5A1LA 3VDAA 1B09A 3CQOA 4CDWB 4NUBA 1W6NA 2ZHLA 3MLLA 3KF3A 2RS32 3GBFA 1PHMA 1US2A 4RS5A 3TEXA 4WVZA 1SDWA 3GHMA 4MXVA 2ADEA 3EMRA 2VZ1A 2W39A 3ZPOA 4PLMA 4CXWA 3N7LA 4J25A 4JGZB 3POYA 5EHDA 3OBTA 4H2AA 1ULGA 2XDVA 4YG0A 1W9SA 3UL2A 2Y64A 4X8NA 3J9SA 4IETA 3VZLA 4AAXA 4AHXA 1XNAA 3ZSJA 1RUNA 2EF6A 5C3PA 4XABA 5EYYA 1UX6A 2WL1A 2G19A 1MEC1 1YQ6A 3ZFFA 1WW7A 2JECA 2WZR2 2D44A 3NV2A 1PVC2 4GQ7A 3DYOA 1LULA 3WLUA 2W9XA 4XUOA 1QNWA 3K75B 5IYYA 3RZLA 5I0DA 4LNVA 3QLQA 4ATFA 3H7YA 1HB4A 1LENA 1V6IA 1Z0HA 3WF3A 1FV3A 3BN6A 1C5IA 1AYM1 3OGGA 1VRH3 1Q8PA 1H4GA 1QOTA 4OYUA 4Q4Y3 5FMDA 3U07A 3VGIA 4CP1A 1RVF1 2HBUA 4XQWA 1MZ5A 3W21A 2WN2A 1YQCA 2GC2A 1POV3 3CJXA 3VBHA 3WXPA 4EN9B 2QQPA 2W68A 3ZFEA 4HPKA 3PMSA 1EPZA 4RR3B 4P9IA 5JXGA 3HD8B 4LTAA 5K9YA 3AZYA 2UYAA 1H2LA 5AFEA 1C1FA 1W6QA 4FFGA 3K3NA 3KD4A 1A6CA 3BTXA 3WW2A 4Y24A 5CG8A 1UO9A 2QQNA 1GOFA 1IZ3A 1PIV3 2RMU2 5EXOA 1UIJA 5EJZB 5T52A 3EB7A 2GN7A 2RR11 4AE2A 2GP3A 4XURA 4BXFA 4QX2A 1N3PA 5CFDB 1Y9MA 1JOBA 1UZVA 1G86A 2EXIA 2VCCA 3E5UA 1FMD1 3OBAA 2VOWA 5FPVA 5H9RA 4AAPA 2FD8A 2VJXA 2H0VA 4IGPA 4XUQA 4L0PA 2R073 3WNPA 4BM8A 1Y43B 1DP0A 2HWE2 2IXKA 2YYOA 1RUH1 2VOXA 5FZ1A 3BKZA 1MS5A 1N1VA 2O8OA 1SQ4A 3E6DA 4D3WA 2P34A 1FNYA 3MGUA 4CUAA 3QD6A 1Y9GA 1O59A 1V6JA 4Y1XA 3E1F1 3UGHA 1W6NB 4C8DA 3KGLA 3NV4A 4FPEA 4DMIA 4Z92B 2BTVC 4RR3C 4CZSA 3OY8B 4MGYE 4JVAA 1VLNA 1LJ7A 3O7OA 5A7WB 2IWGB 2WWJA 3WT3A 5K0UA 4WZCA 3WHUA 4HVQA 4YZ2A 1VBE2 2PAEA 2HEYF 1LHOA 4K3UA 5A7NA 4UYBA 4YVSC 5FO8B 3MIDA 1UY0A 1VBD2 1CPNA 1ZBA1 3PUIA 5JR7B 5K7PA 5CIRA 3GBGA 3H1MA 4HK8A 3B93A 4XAEA 4DY5A 2WAAA 4MGZE 1W2TA 4LBQA 3I3BA 3VD4A 4GWMA 3AP7A 1HIXA 1VIWB 1GWLA 4QPGC 2XLGA 1YJKA 5L7OA 3W58A 4LE3A 2Y6JA 2W2IA 2DDUA 3RZGA 4OUSA 2BGCA 3FE5A 4N8MA 4J1WA 1OSGA 1JHJA 4FFFA 1XNBA 4I30A 5FLHA 5LK5A 4DXSA 5L9VA 4UT5A 2CGNA 2JIJA 1UZWA 2WZR3 3ZFEC 2DCTA 4AGVA 4AL9A 1RGSA 2W1WA 1Q3EA 3TN93 1ZRDA 1UF2C 2D98A 3LZZA 5I0UA 4HPKB 4RR3A 1LCLA 2OYZA 4RFRB 3RQ0A 2GAUA 4PIXA 5FTTC 5J7MA 3J7LA 2XL7A 5SV5A 4XILA 4RYDA 1QH6A 1UD1A 4CDQC 4EN0A 1JYTA 1H2NA 1ZRRA 1RVF3 3T1LA 2P3KA 1SBDA 4FXKB 5LA2A 3U4SA 5LASA 1GU3A 1Z7S2 3WOGA 3LDKA 4Y22B 5GALA 1DZQA 4JGYA 4LITA 5JOWA 1AX0A 4AK3A 5CISA 3PU8A 4BQ5A 5FZ6A 2Y60A 4X6QB 1YQ5A 2A3XA 2XBO3 1OQ1A 3IB3A 4CDXA 4XFAA 1RXGA 1OFSA 4OZXA 2BU9A 3MFCA 1H2MA 1S0EA 1W06A 3POSA 1R083 2ZEZA 1U5YA 4Y5Z0 1KD7A 3FFZA 5EP9A 3ZFFB 3KQRA 4OLLA 1OVSA 3Q8CA 2W92A 2AENA 2JG9A 2VXRA 5DXDA 2DCYA 2VULA 5ABJC 4K20A 1PVC1 1E5IA 2IC1A 2VG9A 4MLOA 4DIQA 3ZR5A 4Y20B 4GXLA 5FY5A 2VMCA 1U5IA 1CAWB 2I2SA 4QM9A 4CCMA 3ATGA 1VR3A 3ZYPA 4GKYA 3RFRA 1RXFA 4COUA 2MHFA 5HCBA 1OD5A 4FTEA 1WCKA 3EHKA 1PO12 4WM8A 1GMMA 3BIWE 4NAOA 5KC6A 2VMFA 2JX9A 3I2HA 4UFHA 3K48A 4CCEA 4GMP1 3FLRA 2XVLA 2EIBA 3ILNA 4NOTA 2WFF1 2C9AA 2EVXA 3DN7A 4RHV2 2FDJA 2VOTA 2HWD2 1WLDA 3L2YA 3WINE 2AZ5A 2P2KA 3PNAA 1K5MA 5FKBA 1X36A 1AX1A 1RUF1 1UAIA 2E51A 2WA4A 4M0NA 1ENXA 3NV1A 1HXS1 1VBD3 1XYNA 3BPZA 5FZ8A 3CMGA 5FUPA 2DFBA 3B9CA 3T30A 4CDXC 3WW1A 5J98B 3RMYA 1F4AA 2A6YA 5FYCA 5JXJA 2CNAA 2LUWA 3ILRA 2OZJA 5HV0A 3ES4A 1NZCA 2HWE1 4TWTA 1S4CA 4O9GA 5FJHA 4CP2A 4CDQA 3OBZA 3W5MA 2YZ4A 1RUD3 3VHPA 4PQQA 2PN5A 1QF3A 3MF6A 3N9PA 5FZBA 3V0AB 2D5HA 3E5XA 1OKOA 3FBYA 3TOJA 4M3CE 5A7SA 2Q1ZB 5C4WA 3VKOA 4FAGA 2RJKA 1S2EA 2LM3A 3ETQA 3QBQA 4KWLA 4NVPA 4Y22A 5FZFA 2R071 5AC91 2A70A 5EIYB 1FNZA 4AEDB 2GC1A 1WLCA 1M06G 1ODNA 1W6PA 3HEIA 1IKPA 2JD4A 1XNCA 3PURA 4HKLA 1ND2B 4LEJA 1OUXA 1CIWA 3ZN6B 2D97A 4NR1A 5CB7A 3IWZA 5FZGA 1LOBA 3RYKA 5JI9A 3BU0A 2XJSA 4DXTA 1SACA 4YW2A 4IEWA 3H0OA 4TXWA 1BEV2 4XW3A 4QQHA 2JD9A 2D6KA 4AQ6A 4C90A 2DTWA 1OUSA 1C4RA 4PDWC 4QPYA 3ILFA 1URXA 1H8TA 1UU4A 4GULA 4QPIA 1M4WA 1GOHA 4CTEA 3T0DA 4GIQA 3VBRC 3AJYA 2TBVA 4WBBA 1JZ2A 2F6BA 3ORJA 4OI1A 4D6RA 1JZ6A 3NAPB 3IT8A 4OVEA 1HRI2 1UOGA 4OHXA 2CU5A 5F3GA 2D7FA 4Z1VA 3LB9A 4JCKA 3GF6A 4B8EA 3VBOB 1MVQA 2RE9A 4XF4A 4MADA 4KWKA 1V0AA 1W0OA 1X50A 2YV8A 5LBFA 3U10A 1JMUB 3VBFC 4CE8A 5LRSA 1S2KA 2AYHA 5C4WC 5A7OA 1O8SA 5C8CA 4LBOA 3UV9A 1UMHA 4B29A 2VNOA 1HJFA 3MIGA 4CP9B 1O4YA 2QVSB 1AL0G 2PFWA 4CUCA 4P00B 1W8HA 1PO21 4HN0A 1ASJ1 4TSVA 4N7IA 1MR5A 1H2KA 1KRIA 3BB6A 4JGYB 4FPGA 4TZDA 2VZVA 3UKNA 2JEMA 3M3IA 3HAGA 4HLTA 2OZ6A 2VVFA 4XJWA 4M3CF 4QGNA 1W3XA 3ZXGA 3F2ZA 1DF0A 4ATEA 2YPJA 4K1YA 1KXGA 4KH9A 4LBKA 1XU2A 3KB5A 2JKBA 1JZ7A 5DAXA 4HMZA 3UJQA 1HRV2 2QZ3A 1OBNA 2ZGPA 3VBRA 5C3RA 1W90A 4CCNA 3H3LA 4HOOA 4ASLA 3VHRA 3OUIA 2EIGA 4OHWA 4D94A 2YBKA 4BMBA 3MIEA 3H8XA 2CGPA 5IVEA 2QQIA 5J37A 5A7WA 3PIJA 3OB8A 4P14A 5FO9B 2JDMA 4HK9A 5C4WB 2K9ZA 2E6VA 4XFFA 4JQTA 4IGOA 1WW5A 1STMA 3VBUB 1NCQA 2Q0AA 1X82A 2RM21 4OUMA 4XMAA 2VO5A 3R05A 2EAAA 3MIBA 4K8RB 3N4MA 3S0MA 4Q2FA 1MEC3 1WCQA 2MNGA 1HQLA 5GZEA 1GQPA 5BV6A 3UGFA 2WNVA 1COV1 4N43A 4XFBA 1JYNA 3VBUA 1VB2A 1DIWA 4Y4YA 2WYFA 4I3GA 5BUVA 4OQ8A 5FY4A 4YFZA 2P6CA 4XJ9A 3FL7A 4BU2A 1D2QA 1KEXA 1W0NA 1UZZA 2PQQA 2VBDA 2YUEA 3WHTA 2ZBJA 4P9YA 2QE3A 3HWJA 1K5MC 1JOPA 5IFPA 5LY1A 1BMV2 4PDWA 4IEZA 2E7AA 2VTFA 2WZ8A 1HQNA 1BYHA 3WG1A 1A34A 4A3XA 2WAOA 4R9DA 5C9AA 3OD4A 4GJYA 4W50A 3VBSB 3H3UA 3WF2A 3O1TA 2LW8A 2DYCA 1JUHA 3AMPA 4BLIA 2BZDA 4QU2A 1OLME 2VMDA 3VLBB 2ZHNA 3M3EA 3B01A 2ZXQA 3JUUA 2XJRA 3WDXA 1TE1B 3N36A 4FQZA 5FY0A 3LEMA 5DUVA 2VTXA 1HN0A 3T4VA 5I8TA 5LW9A 4IV1A 2PHLA 4OZOA 3VD9A 1WBFA 3THCA 5CBLA 3CZUA 4YW4A 2ZEYA 2GNMA 3MDPA 3ZN6A 1AR92 4N53C 1LOEA 3MO4A 4QKBA 4CA9A 4IEPA 1GWKA 5FPAA 1I5PA 1ALYA 3ZFFC 4LOSA 5FYIA 5GLUA 3VDBA 1AR71 2ERFA 3JXSA 3PJYA 1W8NA 3NVCA 4HT1T 4Y5SA 1QDOA 2IXHA 4GALA 4V2WA 4YVWA 3OPZA 4LBMA 3VV1A 4GKXA 3PVNA 1TZOA 3ZVXA 2DUOA 1BEV1 3GDBA 4HG6B 3VZJA 1LOGA 3DYMA 4DPNA 1O5LA 1YI7A 1EP0A 1SZBA 1UY1A 2CDOA 1WKYA 5CNAA 3TYJA 4QXHA 1SHWB 4LIUA 1XSRA 1T6GC 4QPWA 4RS5C 3AC0A 3KSCA 5F32A 5A3PA 1LB2A 3FHAA 4EZHA 2HWF2 1XYPA 5J1XA 2A75A 3WP3A 3HNBM 2X5IB 1DCSA 3DPRB 1W9YA 3POJA 4BMEA 5FZHA 4BA6A 1GR3A 2EIEA 3WQBA 1AR63 5IT6A 4D7SA 1REFA 3JU9A 3WG4A 3JD71 2J22A 4N53B 1XNKA 3G6JB 4WM8C 2MEV1 3OOXA 3C7OA 1ZYBA 4NO4A 1QJY1 3OEAA 4BLJA 4G9SB 1AHSA 1VMJA 2YMZA 1ZZCA 2QQJA 2ZACA 4FI9A 3WSOA 3ZXAC 1OXCA 1ENSA 2DUPA 4IE5A 5JMCA 2PHDA 5L19A 4B4QA 1JYWA 4OFGA 1UYXA 4FPKA 4HSJA 2ZGOA 2WSUA 1V9U2 4OUEA 4XF3A 2UWBA 4L92A 1RUJ3 1SFPA 3FX3A 2RS31 1AL21 1JN2P 1PNFA 4LHKA 4Y3OA 2ZGTA 2KM2A 1CJDA 4A7YA 5IUQA 3WP4A 1HB3A 3N7JA 1TQ5A 1FI2A 1GUIA 4LA2A 5A6ZA 3U4XA 3V0AA 3K2OA 3GZAA 3IPVA 4XCAA 2EALA 3DPRC 2ZHKA 4Y4RA 5BNOB 4P9JA 3NKTA 4AEDC 5I91A 1ZBE2 1SCSA 4XBLA 3ACHA 5K0UC 4QKNA 2BFUS 4HANA 4Z82A 3USUB 1GZCA 1GBGA 3U78A 1DYKA 1HDKA 2O8QA 3HQXA 4H3WA 5BYNA 5I8YA 4QXCA 4Y5TA 2IXCA 5BNQA 3RJRA 1RMU1 2J1AA 2WNVC 1DQ5A 3E97A 4N43C 4QHZA 4R9BA 4YM1A 1PO22 5D2AA 1NCQC 3WUCA 4WVMA 5CKQA 1DU3D 1F4HA 4HONA 2EICA 4Q0SA 1NAEA 4LBQB 4INDA 4LO4B 1W03A 2Q1FA 4BH9A 3C8XA 3LPGA 2GALA 1ONAA 2IFRA 3NNLA 4Q8KA 3I59B 3NAPC 3SEPA 4CXXA 2PHUA 4DEQA 4JX0A 5DUXA 1WUVA 2V73A 4AHZA 1RUE3 3N9OA 4A45A 1WMFA 5L9RA 2EAKA 3BOPA 1O4TA 4JRLA 2P37A 3I2JA 1O8PA 5FYHA 4TLGA 3FMGA 1GZTA 1SMVA 1UXZA 2VQAA 4HKOA 4XFGA 1PK6A 3KT1A 4LLFA 4YVWC 4R4XA 3OD0A 4AQSA 4BCUA 4XFHA 1UMIA 4YNIA 2VXJA 4BYYA 2NMOA 1XJAA 3QH7A 4DUWA 4WV8A 1V6NA 3MPBA 2RMU1 3J4UH 4XJAA 4YGCA 4YARA 1REEA 3DL3A 1AX2A 4MGIE 5GZFA 2WWSA 1GP5A 3CO2A 5KC5A 2DFCA 4PF1A 3BGAA 3ZKUA 1JTZX 3KM5A 1W6OA 2Y38A 1GSLA 3RS6A 3WNXA 4A4AA 2WZEA 4K6BA 3MV01 5A3NA 3K51A 1POV0 1POQA 2ZGMA 4FP2A 1A8DA 3B9IA 3WCSA 3POEA 5BNPC 3RZKA 1X33A 4XUTA 2O1QA 4CCDA 2VNVA 2K2SA 2VL4A 4GB32 2RS11 3GZTB 4OCTA 1P8JA 3AVSA 2LRPA 2VZQA 3D8CA 4L97A 1J58A 3NNFA 5FZOB 3B00A 3VZOA 1Q5OA 3WP5A 4LE4A 3VDCA 1RUG2 1CQ9A 1R1A2 4CXYA 4QB1A 5CZKA 1X9PA 4KL1A 1PK6C 4N7UA 4A42A 1W2OA 4N90A 2XUMA 4AYUA 4CCOA 4D7TA 1V9U3 4CYDA 3PL0A 3R4UA 3WQ1A 2ID4A 3MW3A 5KR7A 4DNYA 1DQ6A 4KGQA 1YHFA 2VMGA 4XHBA 3PUAA 4OI2A 3VBHB 4C0BA 5GLZA 1SLBA 4AI8A 5AC93 3IZOA 2Y6KA 3BTAA 1FMD3 4Y26A 5FXVA 3I2FA 1JBCA 5C71A 2A6XA 3H1WA 4UFKA 3HNYM 2XVKA 5H9QA 3AZZA 4LJHA 2XJQA 5FYYA 4B4RA 5CFCC 4V1PA 3ZSKA 3J7MA 3NJXA 1V6MA 4K8FA 1DBNA 2GMMA 1K5MB 3HBZA 3HR9A 3VN4A 2B8MA 2PA7A 5JWPA 4AOCA 2RR12 4W8JA 1KITA 1J3PA 5IHRA 4E4SA 4XBQA 3HN3A 3WDVA 1OQEA 5FR3A 2DF7A 1PK6B 3OG2A 2D93A 5FWJA 3KHCA 1CAVB 2G9ZA 1FT9A 1YFYA 1K3IA 1WA6X 3NW4A 2RS33 2PXJA 4XDPA 2ORZA 4NIAA 1ZA4A 1TME3 4DY3A 4E9KA 1W28A 4CDWC 1EUUA 3ENRA 5FPUA 2UY8A 3IMMA 3T2TA 4DRRA 2AC1A 5EQUA 5IWFA 1YWKA 2Y6GA 4CPBA 4DB5A 3SC7X 4ES9A 1B35A 5FMOS 1AYM2 2OKXA 1NLSA 3N9LA 5B4NA 2XJTA 3TN92 1J59A 2JENA 1IQAA 1VBC3 4NIDA 4IERA 5G04L 4A6SA 2CWMA 2V72A 4YZ4A 3APBA 2O14A 3MIFA 4KU7A 1H0BA 1PIV1 1AR72 1TNFA 1CESA 1JZ3A 4KWUA 2X29A 4CU6A 4OMCA 1IS3A 4ZXEA 1DGWA 4LA3A 2R16A 3VD5A 3OPTA 4XMIA 2D5FA 1ND2A 2PHFA 3HBKA 3WEZA 4R8HA 1FOD3 2EXHA 3CBNA 2YC0A 1KJRA 3WNOA 1R081 5D21A 4HETA 4BZ4A 1RUC2 4XZUG 2FDHA 4PJYA 3FN9A 1R082 2JE9A 1J1LA 5JOYA 3GYDA 2ZX4A 3VDDC 1H8TB 1QOOA 3KMHA 3SKJE 1QKQA 3VKLA 5CU1A 2NP0A 1H6YA 4MXWB 1NQDA 2WYSA 3JD72 4DINB 1PX4A 1VMHA 2XJUA 1Q43A 4CCKA 4GWNA 2UY9A 1JYVA 2WLQA 3WNNA 1ZNPA 1NY71 1R1A3 1G7YA 3KVBA 3LA3A 1PIV2 2RMU3 2XHNA 1RIRA 4FPFA 5DDJ1 2NLRA 4AFCA 5A32A 2W94A 3WF4A 1UW8A 1JYXA 4RSUA 4EJRA 1QEXA 1GZWB 5EYXA 1VPHA 5A33A 1F31A 3T0AA 2CAUA 4ZS2A 3NV3A 5FP4A 1K42A 3DF0A 4QX3A 3LEIA 5LA0A 3BCWA 1GANA 4I0AA 1LOCA 3M3CA 5IVBA 1FMD2 3ZXDA 4CCLA 1BVVA 2D3RA 5DZGA 1S0GA 4BDVB 2XQXA 4UBGA 4E27A 3U37A 5CFCA 4PBPA 3WDYA 5HXMA 2HWD3 4K40A 4NHLA 3THPA 3THDA 4TTGA 2F4PA 1QJU3 1NT0A 3NKGA 3RI8A 3O1OA 2W1QA 4ES8A 1Y3TA 2BQPA 5BNOC 3DGTA 3ZXKA 5JOXA 1QQP2 2PMWB 5FZOA 3ROUA 2W47A 4FO9A 3SCFA 1PGL2 4KBZA 3DV8A 3PIGA 2ATFA 1H1IA 2YGLA 3KT4A 1CGPA
chains in the Genus database with same CATH topology
3U11A 3AYCA 3M70A 2Y0IA 1N1YA 3ASIA 4YZ5A 4COZA 4EWEA 1NCQB 2ZAAA 5HCAA 1I6XA 2ILMA 2K0GA 1AF9A 2UWCA 3OY8A 3X29B 3FWEA 2I74A 4MYEA 3VDDC 2VVDA 4YW1A 1MZEA 3O12A 1LECA 3IMNA 2ZA9A 4UW6A 2WZPP 2CYFA 2RM23 2DVBA 1RUC1 3ZSLA 2E7QA 1BVP1 2CY6A 5HCFA 4P9GA 3ZMOA 1AJKA 1COV2 2QKDA 4IEVA 4C1XA 1AR83 3N7KA 2X8KA 1AR73 2XJVA 4TYSA 3ZIXA 1NXD1 2GH2A 1OLRA 3H9AA 4SBVA 3V0BA 4Q0PA 2PHTA 2ZS6B 4L9BA 2R6QA 3GBWA 4XJZA 1F8VA 4YM2A 2R042 1WW4A 2Z69A 4QX5A 1QU0A 4XEZA 1TME1 3WQ0A 2HJIA 1NA1A 2XKOA 4IL7A 4JC1A 1S55A 1LU1A 4FOYA 2GMPA 2ZMNA 2NMNA 2NPIA 4Q4W1 2BVVA 4B4PA 5KHIA 4AW7A 3SCGA 4D7YA 4AI0A 2CL2A 4AHYA 4QQOA 4KNCA 1WMDA 2I07B 4PIYA 5BNNB 3HT2A 4Q4X3 3EQEA 3PJQA 3BOWA 1Q8OA 3AZVA 4S2GA 3RRDA 2V5YA 1ZBA3 4YGDA 5C33A 4XIOA 3FC0A 1Q56A 1UU6A 2XLAA 1WGPA 3OYWB 1FYUA 1EPWA 3OJBA 2BWCA 1FOD1 3LWCA 2ARXA 2A73B 2ZGUA 2R1DA 4NN0A 3U0ZA 4AEJA 5CADA 2BUKA 4XYXA 2HEWF 4XFCA 4UW3A 1CAXA 1JYIA 4AVSA 5TSWA 2IXIA 2ZKLA 5F6LB 2WT1A 3WDWA 4FCAA 4UBHA 4XDQA 2VW2A 4EN8B 4XBNA 1U0AA 4LO5B 3WVJA 1YRZA 3FBMA 2KA3A 3TB0A 2RS13 1NYWA 4E4ZA 2CV6A 3VL8A 2D6MA 1I9RA 2DURA 4EROA 1MEC2 3AXEA 2R041 2JG8C 4DOUA 2E7TA 4MUVA 1GQHA 2JE7A 2XG3A 4QD2A 1BBT1 1C28A 4LO7A 1J3QA 2RM22 4XJ8A 4AQTA 3J26N 5ACA1 3FUQA 1BZWA 4QMAA 3RSJA 5AVAA 2WA3A 1LODA 4ZXKA 2R062 4X6RB 1VBA2 2HWC1 1O4ZA 1GZ9A 1WLTA 3JQXA 4I2OA 1HRI1 2WT0A 1JHNA 4IESA 3PLQA 3GHNA 2PELA 2CWSA 2R0HA 2BEOA 4CP0A 2R043 2UWAA 2XGXA 2B46X 4A7KA 2XVGA 5GKAC 1EV13 1QNYA 4LO8A 3AJZA 1RUF2 3AKTA 4N9IA 1ZZBA 4AEKA 4AVCA 5CFDC 4LUKA 3O14A 5CA6A 4H55A 4PF5A 1AVBA 1ZRFA 3EJKA 5T5PA 1IGOA 3S30A 3OYWA 4HFSA 1ZX5A 3ZN5A 4K9SA 1AR61 2XWJB 5LEJA 3WX5A 4Y20A 3ZX7A 2QFEA 3RZZA 3ZMNA 1LHNA 1ZRCA 2YDEA 4JTNA 4AI3A 2QCSB 1CAXB 2P3JA 3MZHA 5FPZA 1R1A1 3B94A 3VZNA 1RUI3 1SLIA 2ES3A 2AR6A 1DLLA 1KDKA 2PLV3 1N3OA 5KXEA 3FHIB 1GZWA 2FZ2A 2WFF3 2HWF3 4MSVA 4QGMA 3AMNA 3SH5A 4PCRA 1ND3B 3AKSA 1S0BA 1SLCA 5GZDA 5E88A 5T5LA 3VHNA 3SH3A 1AL22 1Q8VA 1OPMA 5BNNA 2P17A 1VALA 3MYXA 3AP4A 1UL9A 4PBOA 1PNGA 1WD3A 1D4M2 4IEYA 4AVVA 2RS12 2GC0A 4GA9A 4Q26A 3BALA 4YW5A 1IHMA 2Z79A 1ULFA 1SBFA 4PIZA 1DGLA 2JG9B 3D82A 1ZM1A 2ZX3A 4XXAA 5EV7A 4AGRA 3P3PA 2A6WA 4QT6A 2C1FA 1MS9A 3O0VA 4U36A 3PVEA 3INAA 3Q9OA 4AEDA 2A3YA 3URFA 2DVDA 4YG3A 4CDUC 1QJY3 2X5IA 4YM0A 3VDDB 1EV11 3IKWA 1ND3C 1AR81 1MQTC 5C6CA 5LRRA 4I3PA 4AVAA 3MPPG 4ISQA 3SXWA 4WM7B 3KCYA 4ISRA 1HQWA 1EAH2 2ZGNA 1NG0A 1OMIA 4AF9A 1LU2A 2OUHA 1MS3A 1H9WA 1ZREA 3RDIA 1LGNA 3AYAA 4DQAA 1FPN3 5T55A 4LBJA 3R0RA 2ZGLA 3NAPA 5DUUA 2DV9A 3LCPA 3W9AA 3JBG3 3S7EA 1DZRA 4Y1VA 5D8AC 1Z78A 2FZ1A 5ABJB 1CPMA 4TLFA 1OOPC 5GLWA 1H4HA 1PGW2 4K1ZA 1RUE2 3AK0A 3FLPA 4CDUB 4C91A 5ACA2 1UIKA 2ZAHA 1QDCA 2GMEA 1YI9A 3H3ZA 1NLRA 1UMZA 4WM7C 4BE3A 1VBB1 4XJUA 1JUIA 1Y7BA 1QH7A 2B9UA 4SLIA 4RGGA 3KCXA 4AI1A 5BNNC 1SEFA 3UJOA 1MVEA 1PVC3 3W59A 3ZYJB 3JB4C 3IN9A 3WCRA 4WVMB 3I2DA 2JDZA 2QNKA 3VKNA 2GC3A 1DZTA 5J3UA 3MLJA 2Q8OA 3ES1A 4AWDA 4L99A 5F1RA 1A8MA 4XF1A 1VRH2 4CDXB 3FUOA 4GB33 2XLFA 2HYKA 3O0XA 2ZMKA 2EA7A 5I0TA 4S2DA 2TEPA 3WZ1A 2AUYA 4BHPA 1UN1A 4U2AA 1NE4A 2DUQA 2XL9A 3RG0A 3WUDA 2MPFA 1D4M3 3VBOA 2GH8A 4ZU5A 5A3MA 4YZ3A 3WQ7A 3AMMA 4HKWA 4MXWA 4OULA 3ZYRA 1ZVFA 4LHLA 2XB6C 2HWC3 4EN6B 1GKBA 1W6MA 4KWJA 2VW0A 2BVBA 2SLIA 1LOAA 4CEWB 2DU0A 1HW5A 4WM8B 2VPVA 5KHGA 2R072 3TAYA 4XQDA 4Q0VA 3LSEA 1QJY2 4MVTA 1S0JA 1PMIA 2D6PA 1C57A 2JICA 1RUJ2 1W6MB 3AFKA 3T1MA 4AFMA 3KCCA 1R091 4QPIC 4PDWB 1AXZA 4HL0A 1VAMA 4Q0QA 2Q30A 5KXDA 2ARBA 3VBRB 2RJLA 4H7LA 1O3SA 3AMQA 3SCHA 3D6EA 1QMJA 2RR13 3CL1A 3KGZA 4AHWA 4B3NA 2BNMA 2G9GA 1ZBE3 1Q8QA 3VBOC 1LESA 4AGGA 2QZ2A 1DQ0A 1V6KA 2W52A 3VBFA 2HWE3 2VMHA 4MZUA 4I01A 4OHVA 3L9JT 1TME2 5K0UB 4FPLA 2C0ZA 1POV1 1PZ7A 2GNTA 4R9AA 1OKQA 1PO23 3AKRA 5AFBA 3VDDA 1IS4A 3B7MA 1VAKA 1AYM3 1XNDA 2DVGA 3EO6A 3CEWA 2R0FA 2WNVB 4N43B 1VBC2 4AFDA 5AVPA 1VBA1 2VNGA 4AQ2A 4H14A 3D0SA 4GB31 3QH6A 5JZGB 1G9CA 2VNRA 1IS5A 3ZFGA 2E9QA 1OA4A 1UU5A 3M3OA 3AB0A 2NN8A 3CLPA 1EY2A 2BWAA 1V00A 2NZ9A 4EWAA 4URTA 5KHJA 2BPA2 1APNA 1W6QB 4Z07A 3ALQA 1RUC3 5FBZA 4FPOB 4S2HA 3UKTA 1O3TA 4FAHA 4JTOA 5HXVA 4YG6A 4IEOA 4KG0A 2XH6A 2FHRA 4JDOA 2RS53 3LA2A 1UKRA 2XBO2 1G6NA 1NOVA 2ZOEB 1CAUB 3S6PA 4FTBA 1OFNA 5T5JA 3VKFC 3QACA 1YNAA 3C3VA 3ZXFA 2A5ZA 5BNPB 1W6OB 4GMP0 2QDRA 2VECA 4LUMA 3WDUA 2VOVA 3SHRA 4LT5A 1XYOA 2ZX1A 3M3QA 3CNAA 1LRHA 5GLVA 3ZYIB 3TBDA 3ZYGA 1LKNA 3IDEA 3SMHA 3LOIA 2NM1A 1LR5A 1QGLA 5LEKA 5BNOA 4FOVA 2PTMA 3VBSC 2ZX0A 4KGGA 4I02A 5JLVA 2GNBA 2WZR1 2XHKA 3AZWA 5EFUA 3THTA 4LHNA 1DFQA 1KDMA 4E2GA 1REDA 4HZFA 1GV9A 5FO7B 2D43A 2R061 1MS4A 1VJ2A 1GNZA 4AEMA 4EWDA 4YSFA 1NE6A 3M4FA 5JI7A 1S0DA 3LGRA 4W6YA 1X7NA 1WA4A 1XU1A 1H1MA 4MV2A 1CD3G 4JRAA 5D8AB 2A71A 4Y1YA 5I0RA 1WW6A 1YFWA 3L2HA 2WJSA 1RUD2 4LULA 4D69A 2RS51 1H30A 4RHV3 3TWIA 1HXS3 1VBD1 4I09A 4YGEA 4IEXA 1QHDA 1YIFA 1AYN2 1DGRN 1XE7A 5T3NA 1AYN1 2HWF1 4IV3B 5IK7A 3ELNA 5CG9A 1H1AA 2ZGQA 5E89A 3RWNA 1C8NA 2H0BA 4FT8A 3QCWA 4E2SA 3ACLA 3BU7A 5FOJB 4RFT0 2IZWA 4JGZA 5JPMB 2PAMA 5DG2A 2TUNA 3HT1A 1JXNA 5BXXA 2X53S 2RS52 5FRAA 2JG8A 4XTPA 1UCXA 1FOD2 2YGMA 3ECQA 3ZXLA 4YLZA 4QPGA 1HV1A 4JQRA 3H1YA 3B02A 2Q4SA 1R092 4YGBA 4COYA 4DXZA 4ZU7A 4Q4W2 3N35A 4ITCA 4BIOA 4BWOA 2O0OA 2Z5WA 4F7ZA 2OUJA 1BEV3 3UK9A 1FV2A 1SLAA 1QXJA 4XXPA 1FATA 5FREA 1ZZ6A 5KXBA 3EBRA 4QGLA 1HRI3 1S2BA 4MH0E 2TNFA 5C8CB 2ET7A 4DRVA 1OHFA 4HN1A 4QM8A 2VW1A 3IDBB 5JPNB 1YLLA 2ZHMA 3J8F3 5CFDA 1MZ6A 3WP6A 5FLIA 4K21A 1J1TA 5K8SA 1S0IA 1QXPA 2OPKA 4IV1B 3AKQA 1AXYA 3WD5A 1F2NA 1H9PA 1RUH3 3VZMA 5JVVA 1N47A 2D3SA 4YYOA 3AFGA 2NQYA 2QJVA 1VBA3 1F5FA 2DVAA 4ONUA 1HRV3 2IXLA 1SFNA 3AM2A 3PVBB 1AYN3 5C8CC 1VB4A 3RPQA 2B7YA 3A4UA 4NWWA 2R30A 1YJLA 5J36A 5JSOA 3MF9A 1O3RA 5E1RA 4NPRA 5C8WA 1OPOA 1RUF3 1BBT3 2IXJA 2PAKA 5DG1A 1RB8G 1AJOA 1O91A 1SLTA 1ZZ8A 3USSA 1QXRA 1LGCA 1V70A 3MW2A 1PGSA 5DDJ2 1ULDA 3I59A 4CDWA 2H6BA 3E5QA 1L3JA 1GQGA 3WDTA 1QJU1 4Q1PA 3V0BB 1YUDA 5FAXA 3S7IA 5FDBA 3TRSB 1OA2A 3KLSA 3VBHC 1RMU3 2WNUC 4IV3A 4XTMA 1G9BA 1CVNA 4L11A 4LBNA 5J48A 1OLQA 4JAAA 1B35B 1D2SA 1XRUA 4CDUA 3JBG1 5H9PA 4META 1WLWA 2XPJA 2PHWA 4XPVA 3SISA 3N3HA 2G9FA 3JQWA 3IPVB 5CFCB 4BPZA 1YO8A 4LBQD 2E53A 1QQP1 2GNDA 1BXHA 2EXJA 1RUG1 4Q4Y1 1C1LA 1D0HA 1DG6A 1QY4A 1RJ7A 3USUA 1AL23 1RUJ1 4K7JA 4QXKA 2HKXA 1QOSA 2WQZC 2ZKNA 4AG4A 4AFAA 4Q4X1 3NWKA 4OI4A 3J8F2 1O7FA 4IEUA 4L2NA 1Q8SA 1QJX2 3NJZA 4FSJA 1AR62 3KS7A 1OQDA 1DGRA 2DCJA 4WM7A 1KS4A 4LLOA 4B7KA 2D6LX 1MQTA 3I4IA 1CAWA 1O5UA 4RD7A 2I45A 2XKPA 5SV8A 2Q1MA 4RQPA 4XOGA 3E6BA 3G7DA 4WVWA 4FPHA 4RA0A 1D4VB 1ND2C 3V65A 2FMDA 3RJ2X 4I0BA 4MGKE 4XF0A 1ULCA 1LTEA 2R063 4RQPB 1ZZ7A 4J1XA 3HIFA 3R6SA 1RHI1 4HBNA 5E8AA 4XE9A 3C2UA 3JCIA 4Z2WA 3KZ4C 1NXMA 2R49A 5FQ0A 4LR4A 4Q4V2 1EAH1 1H8TC 3EXUA 3ZFGC 3JBG2 2W0XA 4COVA 3WY6A 3FZ3A 4YFWA 3ME2A 3NSTA 4P9XA 3AYEA 1WCSA 1RTVA 4GH4C 4Q8LA 1GICA 1CJPA 2A7AA 2AGSA 2Q5TA 2W08A 4P9WA 1TNRA 3VBFB 1BMV1 2WIIB 4ZKTB 1CR7A 4YVSB 4FPJA 1ASJ2 2AH2A 5F5QA 3V64A 5J09A 2BBVA 2HWB1 4HSLA 4M3CA 3AYDA 4RQPC 4PQ9A 5KHKA 1DQ1A 1RHI2 4XETA 1G8WA 5JZGA 4I0WB 4FBFA 2D3PA 1RINA 1OI6A 3I54A 3SITA 2NYYA 4Q27A 2KXLA 3ZFGB 5KXCA 3UKVA 3TN91 1XQNA 1LHWA 1PZ8A 3DPRA 1LEMA 1NY72 3NL1A 1KFUL 3A0KA 3PHMA 3VL9A 4CRQA 5C9AB 1JOJA 5T50A 4J6GA 3CJIC 3SH4A 1HV0A 3O5SA 3OBRA 4GH4B 3R4SA 1PM7A 2BW8A 5IK4A 3B5LB 2B42B 5IK8A 2JXAA 1NA1C 1N1TA 3V56A 3ZSMA 1IS6A 1QJX3 3P3NA 1I5ZA 1VRH1 4CDQB 4JDNA 1LEDA 3ZXEA 3VBUC 4YM3A 3LA7A 1G9DA 2OA2A 1FX5A 5I8SA 1RVF2 4AVTA 3CF6E 2GZWA 2P3IA 1CAUA 1RUI1 2VMIA 4M00A 4IV1C 1Z7S3 1RUG3 4Q4V1 4FP3A 4YRDA 4KBBA 2C5DA 1KFXL 5BNPA 1XXNA 1ZZ9A 4L8QA 5GZGA 1S0FA 5C9AC 4UXAA 3HN1A 4XF9A 3CJIB 3MFAA 3ZDSA 3RYRA 2ENRA 2OW4A 3WV6A 1RL3A 1JW6A 4Y1UA 5LK7B 2ZGSA 4C0HA 3AXDA 2ET1A 1IKQA 3CJIA 1Z7S1 1MQTB 2CGOA