2G19A

Cellular oxygen sensing: crystal structure of hypoxia-inducible factor prolyl hydroxylase (phd2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
publication title Cellular oxygen sensing: Crystal structure of hypoxia-inducible factor prolyl hydroxylase (PHD2).
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 216
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2g19A00
3NNJA 5EP9A 3HQUA 3NNFA 2FCUA 4NAOA 3PL0A 4IW3A 4UWDA 2FCTA 4XABA 3MGUA 3KT7A 5LBCA 4NHXA 3EMRA 3KT1A 2RDSA 4XAAA 3NNLA 3HQRA 5EPAA 4J25A 4Q5OA 5DAPA 2HBTA 4MHRA 3OBZA 4NHMA 5L9BA 3ITQA 3BVCA 5L9RA 2A1XA 4KBZA 4XCAA 5M0TA 2RG4A 2RDNA 4XACA 5IAXA 2OPWA 3GJBA 3W20A 3OUIA 3OUHA 2Y34A 5LB6A 5LBBA 5LATA 5A3UA 5LBFA 5L9VA 3DKQA 5HV0A 2Y33A 5C5TA 4NMIA 5IAVA 4JZRA 4Y5TA 5C5UA 5EQUA 3W21A 5ERLA 4BQYA 4BQXA 4XCBA 4XC9A 5IATA 3OUJA 3NNMA 5DAWA 2V4AA 3KT4A 4ZPIA 2RDRA 4NHYA 5LA9A 4NHKA 4Y5SA 2G19A 2RDQA 5DAQA 2JIGA 4ZONA 5HV4A 2G1MA 4MHUA 5DAVA 5DAXA 4NHLA 2FCVA 4BQWA 5LASA 2HBUA 2JIJA 3GJAA 3GZEA 5LBEA
chains in the Genus database with same CATH superfamily
3MI8A 4ZS3A 4HBNA 1DQ0A 1E57A 3HMYA 1BMV1 4CCKA 3R4DB 1QJX3 1WCSA 4OZXA 4CDUB 5JSRA 1U5XA 4HONA 1TNRA 5JWPA 4FTSA 1O3SA 1DZQA 5F8PA 4CU8A 2ET1A 2ERFA 1QOOA 2AH2A 4MUVA 2HWF1 2DCJA 2HYXA 5L7OC 3ACLA 4YGCA 1RUC3 4GMP1 5FKCA 5FZOA 5A7WA 1D2SA 4DEVA 2ZGNA 4BMEA 1JYNA 1RUNA 4AHXA 2RDSA 4A7ZA 2RS13 4X6QB 3C3VA 3SC7X 2VZSA 4BLJA 2R0HA 3EB7A 1HX6A 1UNBA 1WA6X 2RM22 4PT6A 4S2GA 3SISA 3VL8A 2CV6A 1EPWA 3VDAA 3OD0A 4KH9A 4XIKA 2VXJA 4BQ2A 4IGQA 4MLOA 3ZM8A 2VZTA 4AI0A 1ZRCA 5DAPA 2V09A 2JWPA 3KHBA 2WL1A 4I0WB 3AJZA 1LHOA 2OVUA 5I0RA 3D3AA 2DFCA 2HYKA 4IE7A 5M0TA 3RZLA 1EPZA 2IFWA 1N1TA 2PAEA 2XLFA 3LEIA 4LA3A 4LITA 1CPMA 2FHRA 4L99A 1YEWA 1BBT3 1VAVA 3OUHA 4W50A 2Y0IA 3JBG3 3CO2A 3OGVA 4AYUA 2XB6C 3NAPA 1G8WA 1GV9A 1LEDA 1POV3 2GC2A 4EN6B 1JZ6A 1LOFA 4QPIA 3T0DA 4AQSA 4AVAA 1DGLA 3I2OA 4FPFA 2R49A 3I3MA 3ABZA 2X5IA 1XYOA 4S2HA 5FO9B 2KXLA 1JXNA 1FNYA 3S0MA 3NRUA 4QU1A 3ROUA 5A7OA 3WW1A 2XBO3 4XC9A 5FWEA 2XWBB 2RE9A 5I0UA 4W65A 4AQ6A 5GZCA 3ZFGB 4UI9L 4EZHA 1G9BA 3V65A 3ZOIA 4FTEA 4W8JA 1LKNA 2D3SA 4AVBA 5GLZA 2VXRA 2ZX4A 5CBLA 4NHYA 4GWMA 3R0RA 5APAA 4BK5A 2ZEWA 3T4VA 3B69A 4AOCA 2FDIA 2VCMA 1NY72 3VBOB 4A6SA 4P9XA 2GC3A 1WMEA 4M00A 2NN8A 3M7AA 4LE3A 2WQZC 1H2MA 4IE4A 2D6LX 4PIZA 4EN9B 3POGA 2CHHA 5T52A 2BWAA 2I45A 3OSDA 4X8PA 3KF5A 4WM8B 1UY2A 2JKXA 1I5ZA 2OIIA 2R073 5FXXA 5A7QA 4NR1A 2D7FA 1RHI2 2VULA 4EZ4A 3V0BB 2AEZA 1D0GA 4HLTA 1Y9MA 2HBUA 3HR9A 4UFLA 5FXVA 2V5DA 1DYKA 3LKJA 4NPLA 3T08A 3DPRC 3VD5A 2WA3A 3KCCA 1T6BX 4NRQA 2DU1A 1XE7A 2RJLA 4P9IA 4DOUA 5FO8B 3N9NA 1NKGA 5JCTA 1PNFA 1DF0A 3HQUA 3S7EA 4ZHNA 1SPPA 1U5YA 4RQPB 5JOWA 1RXFA 3B5LB 3KV6A 1W8TA 1W6MA 1HRI2 2QQKA 1HDKA 2WFPA 2JDZA 5FZCA 1ULCA 2X10A 4XHXA 4H7LA 3I54A 3RFRA 4CEWC 2W9XA 4BDVB 4DS0A 2QQOA 2VOXA 1C5IA 4JX0A 3NJZA 4IW3A 5A3PA 2MNGA 2GMEA 4AI2A 1YO8A 3IPVA 1QQP1 2ZHKA 4BQ3A 4ASKA 3BTXA 5T50A 3O0VA 5HCFA 4IE5A 4A3ZA 4WVWA 4ZXKA 2DVFA 4IETA 1Z78A 3KLSA 4WM7A 1VR3A 3KCXA 3PNAA 4O61A 4YM1A 5G05L 4AFCA 4CP0A 2WFF2 2WNOA 2VZVA 3RYPA 4BISA 2BRTA 4HANA 2P3KA 4XETA 3H50A 3TNQA 1VPHA 2ZGRA 3NQHA 5D8AA 5C8WA 2FDFA 4LBQA 2HLEA 4GKXA 4M3CA 3LF7A 1VBC1 1O4YA 3T2QA 4HVQA 3U4SA 2G9ZA 1JN2P 5IVBA 5JDBA 1RB8G 1YQ6A 2BP6A 5KXDA 4OHYA 2E51A 5FPAA 2QQJA 2BWCA 1GNZA 2C0ZA 2MHFA 3AFKA 3NV1A 4GIQA 2NPIA 4QX1A 2PFWA 2OPWA 5C3SA 1C4RA 3AMMA 3OCPA 3VHRA 4AEJA 4IEYA 3ZPYA 1TE1B 3EQEA 3VDCA 2OXBA 3P3PA 5FYUA 2NYYA 1BVP1 1QJY1 4JGYB 2WO3A 2IXLA 3CLPA 1QJU3 3JXSA 4AVCA 4AWDA 5BNNB 1UPSA 4QQOA 4COWA 1SBDA 2QQWA 4Q8LA 5FUPA 4Y1ZA 4QD2A 2BEOA 4IV1B 4I0BA 5HV0A 4ISRA 5C9AA 1SQ4A 3IIIA 1MS8A 3UETA 4RR3A 1WBLA 1RMU2 4CEYB 1CAWA 1RITA 5C8CC 3HNMA 4LQRA 1DQ1A 3H7YA 3LDKA 3MV01 4QB1A 2ZGLA 3OUJA 3CBNA 2B46X 2PAKA 1S0EA 2LM3A 5K0UA 2W91A 1CGPA 1RUI3 1YJKA 4X6RB 4COUA 3LOBA 1Q8OA 4ITCA 5DZEA 4EJRA 4PCRA 1DDLA 5CA6A 2XR4A 1JOBA 4AEDC 4LO4B 5FBZA 1XBFA 1F2NA 2W5FA 4GH4B 1Y9GA 5DZFA 4CDWB 4DUWA 2PHLA 3GCWA 1ND3A 2YU1A 3WD5A 5IHRA 4MHUA 4COYA 1P8JA 1PK6B 4YM3A 5LA0A 3F95A 5FQ0B 4XF3A 2OT7A 2YUEA 5LASA 4CDXC 2IXJA 2K2SA 3ZDSA 3KZ4C 3W59A 1W39A 1O4TA 5K4LA 1WMDA 4QDSA 5FYBA 5IT6A 4UFKA 1VBD1 3PVBB 1RC6A 4DO0A 3MBWA 1B09A 2GP5A 1NA1C 2JG9C 4PF1A 4DPNA 5A6QA 2HWD3 3S5QA 4PF5A 2KD7A 2PHWA 3ZYPA 5FY4A 3UGFA 4QX8A 5JPMB 1CONA 3TWIA 2E33A 2J1UA 1W2UA 4N9IA 4XFGA 5FY9A 3PUQA 4MO3M 1OF4A 2AGSA 3B93A 4RD7A 4CDQA 4CCOA 1W8UA 2ETEA 3MUY1 5FZMA 2FZ2A 4AAPA 1V6JA 3MO4A 3KHCA 4S2DA 1S55A 1BHGA 3NV4A 4W6WA 2FZ1A 1QJX2 5J96B 4JKMA 4XQDA 1OC1A 1WCKA 2BNNA 4GWNA 3M4FA 2GAUA 2YZ4A 2YPDA 4LIVA 1CX1A 2HWE2 4YVSB 3D0JA 4AVSA 1VRH3 3POBA 4LNVA 3ZFEC 1OSGA 3MLJA 3ZYFA 4ET7A 1O91A 3VZLA 3O1TA 1ZA7A 1VMFA 5J37A 3SXWA 1LECA 3BTZA 1HB1A 2CYFA 3KWVA 5FY8A 4PI0A 1S2BA 2CU5A 3SMHA 1Y4WA 4FCAA 1PZ9A 2RMU2 3FLPA 1SZBA 3VB9A 3TEZA 3J7NA 5FLHA 2ZX3A 5DMYA 1AR71 3K77A 3LDBA 1AL23 4AZZA 4PDWC 2ZAHA 1YFWA 1IS4A 2XVLA 5FY1A 1A8MA 4EYUA 1HB4A 1DCSA 3LQCA 4LBMA 5JIUA 1S0IA 5FFOC 3ENRA 4AI1A 5IAXA 2BVVA 5ACA3 4RYDA 2DCZA 4LULA 5IW0A 1JZ2A 2PLV1 1HKDA 2J1EA 3U07A 1UL9A 2EVXA 3T2TA 5EWSA 1W2TA 3POSA 4DRVA 2LRPA 3MLKA 3LFIA 2D98A 4M4PA 1YIPA 2J1VA 1PHMA 1ZBE1 5FDBA 3RZKA 2ARCA 3WNMA 1X9TA 2Y33A 1FT9A 4LHNA 4CDUC 3DEMA 4NIGA 2WS92 3RGBA 1U0AA 4I0AA 3OTFA 2OA2A 2P34A 2YC0A 3ES4A 1D4M2 3ILNA 5CVRA 3ELNA 2YBPA 5DUVA 1F35A 1QIQA 3LB9A 4GA9A 2XG3A 5ERLA 1QH6A 4BQ5A 1ZZ8A 4E2QA 1GLHA 2EIDA 3DYOA 4IGOA 5KWRA 3QOPA 1GBGA 3FMGA 2W1UA 2D3PA 3INAA 1AR91 4Q4Y2 2IVJA 3VLBB 3RZGA 4ZPIA 3N9LA 1XQNA 2NM1A 2VG9A 4JTNA 5F3EA 5JSPA 5JR2A 1NQDA 4XF9A 2E9QA 2W3JA 4INDA 4IEXA 3SNMA 3ZXAC 1TME2 1PO12 4WVVA 3CJIB 1KDMA 1HN0A 2JKBA 2QBXA 3RYRA 2YFZA 2ENRA 2RM21 2VUDA 2WKKA 3WNXA 5BNOB 1STMA 2C26A 2C1FA 1A8DA 5DAXA 5BNPA 3VBSB 3N7MA 2FCVA 1ULEA 5EFUA 3EO6A 2XL7A 4Q4V3 1ZZ7A 2IXHA 1VBA2 4EE2A 2VMDA 4HVOA 4OHVA 3IDBB 1OHFA 5FP3A 1COV2 2J1AA 4ZU7A 1J59A 5FZFA 5DPNA 1PX4A 1NYWA 3JQWA 1RUG3 1MQTB 1UN1A 1BEV3 3O1VA 2BV4A 3OGJA 2IC1A 2IFRA 3MPBA 2EIEA 4EQVA 4YSFA 4P5YA 3ATGA 2OZJA 5FLIA 5GLVA 3BALA 1UMZA 1YC61 2WZR3 2GP3A 4NWVA 5CG9A 3GZTB 5I8TA 1NE4A 5DDJ1 3AKSA 3QBQA 1DGRA 1ASJ3 1YLLA 4SLIA 3GGLA 5HXVA 3KB5A 1TZOA 3ZFGC 4KWLA 2VY0A 3NV2A 1R1A1 2H6BA 3CKHA 4NWWA 5A1AA 3RI8A 1GP5A 1KRIA 1W6NA 3AKTA 2Y6JA 2E7TA 2RJ2A 1Z7S3 4HPKA 4AI3A 4DMIA 4LIUA 2VM9A 4LK7A 3THDA 3SEPA 5FAXA 3VBOC 3RZHA 2VZ1A 1HXS2 3AP6A 3AMHA 1UKGA 3KVBA 4CEWA 3V0AA 1Y3TA 2F4LA 3OBZA 2MEV1 1AXKA 1MS3A 4WVMA 5JVVA 1GOFA 1H4GA 4FQ4A 3ZFFA 1CAUA 1GZWA 1W6QB 4NOTA 5DG2A 3NNGA 2W1WA 1FPN2 1NCRB 1RUE2 1V9U2 2D44A 3U1XA 3B9CA 2VGDA 4XFAA 1PO21 5KXBA 4TTGA 1OKQA 1A34A 4D69A 3MF6A 1JZ4A 1JZ8A 3H42B 4TXWA 3MEPA 1YI7A 1SBFA 1W3VA 3OPWA 4GQ7A 4XVHA 3SH4A 1LTEA 3WQBA 5ANNA 3FN9A 3ZVXA 5E8AA 5A3UA 4FQZA 3VZMA 1ZZBA 4RQPC 5BYNA 4XTPA 3B01A 2P3JA 1PNGA 5C5TA 2DYCA 1JYWA 3VKLA 5DQ0A 4MSVA 5IAVA 1LHNA 3APBA 1CAXB 4OMCA 1UPIA 3RJ2X 2DUOA 3O1MA 3OEBA 1US2A 1ZZ6A 3NJXA 1GZTA 3DYMA 5IK7A 1AYM3 1NT0A 2XUEA 2PHDA 3CHXA 3NNMA 3SITA 3VDDB 3O12A 3BIEA 1W03A 4MZUA 5A6ZA 4QKDA 5FP8A 2YGMA 1HJGA 4COZA 4XMIA 4NHKA 4EV0A 1S0FA 5AFBA 3CF6E 2DBIA 3TOJA 1UX6A 2G19A 3F2ZA 2W47A 4KU8A 3DF0A 1LAJA 3WF3A 1D4VB 2HKXA 4FP2A 3WF2A 2IZWA 2WFF1 1L7RA 1LULA 2C24A 1DZRA 3S30A 2HWB1 4YW3A 2WNVA 1HN1A 1UZYA 1SLIA 2OQ6A 4H3WA 2ARBA 5JLVA 2VVFA 3O1UA 2CGOA 2A3WA 5FYZA 5T5LA 1B35B 2CSGA 3ES1A 4R4ZA 1XU1A 3VKFC 5IVFA 2WWSA 1ZNPA 4D3WA 1KS5A 4FPOB 4FOVA 1UD1A 5JZGB 5C8CB 5F2WA 4CUCA 5G04L 2P2KA 5KXCA 2VOTA 3M2MA 1IS3A 1H9PA 1ZZ9A 1N3PA 5JXGA 3O1PA 5GJ6A 5EP9A 4JGYC 5F37A 5BNNC 5I91A 3THCA 3IMMA 2PTMA 3Q8AA 2IXKA 5J09A 1S2EA 3ZN6B 4B8EA 4UF0A 4CUBA 1JZ7A 4IV1C 1LGCA 2ATFA 3QH6A 1ZBA3 1RHI3 1SHWB 4QB2A 1W6PA 4M0NA 2NLRA 1TNFA 1PIV1 1FOD1 4LMFA 4Y1XA 5H9RA 4CEYC 1H6YA 4AFBA 2RS31 5BXXA 2DVBA 1WKYA 2GDFA 2JD4A 1CZTA 2WNEA 3HBKA 3BU7A 3GNEA 4O65A 4QHBA 4XIOA 1XNCA 1X9PA 1G9DA 3NKTA 2ILMA 5JR7B 4MH0E 1T2XA 4UT5A 3EMRA 2VAUA 3LSDA 1HRI3 3USSA 2YY1A 3ZN5A 5AVAA 4XOGA 4TZDA 1FNZA 1AL0G 1TG7A 2XQRA 2ZGMA 1Q5OA 3GALA 2A3XA 2XKOA 1YWKA 5FP9A 1ULFA 4AFDA 4CP9A 1DHKB 4GH4C 1SCRA 5A33A 5D1IA 4CDWC 1VJ2A 5J3UA 2P5BA 4MXVA 3WNPA 1DU3D 1QXJA 2DVDA 1GWLA 2B7YA 2JB8A 1DLLA 1UZWA 3DXTA 1VRBA 1A78A 1XE8A 5L9RA 5JXIA 1PK6C 1QKQA 2BQPA 2BTVC 4DQAA 5AVPA 2A6ZA 4CCEA 1JS9A 2VW1A 5LA1A 4AG4A 4YZ2A 3BTYA 4OFGA 2Q1MA 2ZX2A 3R4SA 2XOMA 3AZWA 1AL22 2WQ4A 4UFJA 4LXLA 4HKOA 3ST7A 1IS5A 3PIJA 4GZ9A 4Y1UA 4W6YA 4LT5A 1OVSA 1XJAA 4OI0A 4YW1A 3UJQA 2DUPA 1UY0A 1ZVFA 2P1BA 4PLOA 4JQTA 1DQ4A 4P02B 1K5MA 1R083 3FFQA 4NAMA 2CTVA 1X50A 3K4AA 5ACA2 2E31A 3POFA 4K7JA 1Y43B 3VD4A 2VMCA 2QDNA 4Q4W2 4IV3B 4V1PA 4F83A 2EIGA 1GKBA 1JU3A 2Q4SA 3CZJA 1AZDA 5FMOS 1JH5A 2BGOA 1UF2C 2VNRA 4NE9A 3I2HA 2VMFA 2B39A 4ATFA 1GP6A 1GFF2 4OQ9A 2PHUA 4YVSC 1AYN3 1FV3A 1QJX1 4JQRA 2B9UA 2RV9A 2XJQA 3IKWA 2JDUA 3Q8FA 2R30A 1OQDA 3BPZA 2JG8A 2XJTA 3P1IA 5CNAA 5GKAC 2UY8A 3LGRA 2QUOA 1AVBA 2JEMA 5T54A 1RUC1 3MYXA 4J6GA 1E5IA 1ENSA 2LW8A 1LOAA 4DRRA 5EIYB 3H8OA 1H1MA 3JB8A 2RS11 4CCMA 4BK4A 2CWSA 3KQRA 1PVC2 4LO6B 2ZABA 1DFQA 1GZCA 2OKXA 4A6OA 4MG2A 2YC2A 1LGBA 1RIRA 2WRAA 5BPXA 5T55A 2WDBA 3VL9A 5IVCA 2R1BA 3SLIA 3J26N 3C7GA 4KNCA 3HD8B 4AGGA 4LBJA 1JOPA 5A6YA 4R9DA 1QY4A 1GNHA 2X8KA 3H1MA 5C4WB 2VH9A 3AMQA 3ZYRA 3RS6A 2VTXJ 2XQXA 1AX1A 5E1RA 5A3LA 5BY5A 4D6SA 2ZEZA 1WD4A 3Q8CA 4LO5B 4HKLA 5DABA 4BIFA 4FBFA 2ZKNA 4F7ZA 3OBTA 2NMNA 3ZR6A 1M06G 2N7GA 4IESA 4FPJA 3UGHA 5FOJB 1W0NA 1JYTA 2ZZQA 1BBT1 1LOCA 3IM0A 2NP0A 4J1WA 4QPGA 2LUWA 2V72A 4FAGA 3JBG1 3U11A 2H6CA 1J1LA 1TMF3 4F8AA 2P3YA 1POV1 4QQHA 3KT7A 5LK7B 4Y22B 4AGRA 1X8MA 2Q8OA 5KHKA 4JKKA 1AR62 4YVWA 1ASJ2 1UKRA 2PHRA 2VW0A 1CD3G 1GMMA 1GICA 1V6MA 3RPQA 3NNLA 4AHWA 4UAPA 2XBO1 3FHAA 5KHGA 4Q0SA 4IERA 2ZOEB 3ZYBA 2WUHA 3CJIC 3KCYA 3MLLA 5KXEA 2BZDA 3MIFA 2P4EA 1Z7S2 2ZTNA 1RXGA 4FOYA 2GALA 4NHMA 2HWE3 5L9BA 3WCSA 4CUGA 4E8CA 1OLMA 3TYJA 1ZRFA 3VBSC 4Q4X3 1H8TB 3I59B 2VQTA 1MS5A 4JGZB 1EP0A 4WVZA 4HG6B 4XACA 3ZSMA 4D6QA 1K42A 1J1TA 1PGW1 2WN3A 1CVNA 1F15A 3UV9A 3VBHA 2XJPA 2XWJB 3BKZA 1OOPB 1RGSA 1UYZA 2J7MA 5AFEA 2RMU3 5F5CA 3W20A 1SLTA 3IDEA 4A2UA 4PIYA 3OYWB 3PUAA 1MQTC 5LBBA 1IPSA 1JYVA 3M3IA 3BIWE 5LATA 4BLIA 2Z5WA 3DYPA 4DXRA 1XSRA 4FXGB 2WIIB 3C2UA 4QPWA 4N43B 2JE7A 1UCXA 2R071 5F5IA 4D7YA 5ABJA 1S0GA 5C6CA 1DGWX 1HRV2 2LALA 4ARXA 3VBFA 2R0FA 1WBFA 3ILFA 3HN1A 3NJYA 4RS5A 5F5AA 1NAEA 3J9SA 4IEOA 1WUVA 2MPFA 2ZEXA 3VKOA 2ADDA 1XXNA 3M3CA 1DYPA 4LKEA 3FE5A 1RUF3 5CFDA 4YRDA 5J7MA 2KR2A 1EUTA 2V73A 5FO7B 1DQ6A 3K3OA 1NLSA 3KT4A 4QQLA 2RDRA 1W04A 1QH7A 5FPBA 3AK0A 2VZ3A 5CKMA 2BBAA 1VMJA 1YXWA 2WS93 4ISQA 1AYM2 1D4M3 1QNYA 1H2LA 1L7LA 4O7XA 2IWGB 4Z2AA 5CFCA 3O1OA 1ZRDA 4Y20B 2FDKA 4Z92B 3BCWA 4PHZA 4Q4Y3 4AW7A 2VNGA 4NHLA 1UYXA 3WG4A 1GZ9A 1OLRA 5FP4A 1K45A 5F2SA 4BQWA 4NROA 3T0AA 1C8M3 5A7PA 1H1AA 1EV13 1NCRC 1I5PA 2VD7A 1YNAA 2VE1A 3A4UA 3AZYA 4CCDA 1QXPA 2I2SA 1GOGA 3UNPA 3ETPA 1TME3 1PO13 3I3DA 4N53A 3VKMA 1JI6A 3I2FA 2VJXA 2WNUA 5FIXA 3SCHA 1ZREA 5LEJA 2JDMA 3AZXA 2FD8A 5LRSA 4NRMA 1R093 1U5IA 2A71A 2FCUA 3POWA 3AM2A 1AJKA 2AC1A 4AE2A 1RVF2 1VBA3 2UWBA 1GWMA 3B7MA 3IWZA 3M70A 1COV3 2RR12 1CR7A 2XLGA 2R32A 3P6BA 4XXPA 4COVA 3PL0A 1QHDA 2QE3A 4UWDA 4H55A 4XHBA 3A0NA 5A7WB 1D0HA 1ZBA2 1QJU1 5FZOB 2ZZJA 1C57A 4GULA 3ETQA 4XABA 3FBMA 3VDDC 3LA7A 4MGKE 4XUNA 3WNKA 1PMIA 3WVJA 3VBRC 4FVVA 5FMCA 2I07B 3PU3A 5JMCA 3ZMOA 3NSTA 3PIGA 4XF4A 4NO4A 5T3NA 4J25A 3LOIA 3FWEA 1I6XA 2P6CA 3HAGA 4KWKA 5J1XA 2E26A 2Z69A 1RUI1 2XH6A 5KR7A 5LCWL 1UWWA 1V6NA 1XYNA 1N47A 2GN3A 2RG4A 3AL6A 3J8F2 5HBAA 2XHNA 5JIAA 4CSWA 1B35C 1NCQA 2WWJA 3E97A 1BLZA 1V6OA 3UGGA 2ARXA 3OEAA 5JZGC 1UY3A 1F31A 1HXS3 3H9AA 2YB7A 3J4UH 2KA3A 3OUIA 3NAPB 3VBUC 2O14A 3LEKA 1X8EA 1UOBA 1ENQA 1V0AA 2CAVA 1HB2A 4XF0A 4QPIB 3ALQA 4YW6A 3SCFA 3JZVA 5J98B 1WGPA 2ZKLA 4Y33A 1FPN3 1YFUA 3RG0A 4CVUA 2X5IB 5A7NA 4YLZA 4UFHA 3G6JB 4NMIA 1RUE3 2EXHA 1E5HA 1V9U3 3VV1A 1LR5A 2VZOA 4CZSA 5C5UA 1LJ7A 5EQUA 1I9RA 3H3ZA 4Q0PA 5HXMA 2P37A 3I2IA 1R082 3WHUA 5FY7A 2AENA 1KFUL 4Y1VA 4QX3A 2RJKA 4CXYA 4HOOA 2HWD1 2R042 2Q8CA 4FPKA 4K21A 1US3A 4CU9A 2J1SA 3LPFA 3DUIA 3I2KA 4QX5A 4R9BA 5CG8A 5FZ9A 4QPYA 4NIHA 1AR82 3ZKUA 4IEZA 4B7EA 2R6QA 2RDQA 1RUH2 1UZZA 3W58A 4E4DX 4A45A 2RHPA 2VQUA 4XZUG 2FMDA 1FMD2 3QLQA 4LJHA 1AYN2 2FBEA 3U10A 1NXD1 3PJQA 5FZ4A 5FMBA 4DUXA 1F5JA 1WWYA 3OY8A 5FP7A 1C5HA 2Y6KA 5F39A 5A32A 2YYOA 1KJLA 1WMFA 4CXXA 3WQ0A 5GLTA 1PGL1 1VRH1 4MXWA 4W4ZA 4Y1YA 1L7QA 3WF4A 2GN7A 1YIFA 4QGNA 1XE0A 1QOSA 5DG1A 2D6KA 2YFUA 3IT8A 4AHZA 5JPNB 1ULPA 2EAAA 3MW3A 1K12A 4QDQA 5LW9A 1RTVA 3VKNA 2PN5A 4R9CA 1NG0A 2H0VA 5JI7A 1SPPB 1OD3A 3NW4A 4U2AA 2FDJA 1AL21 4WBBA 2Z79A 1PGSA 1W6MB 1UMHA 4OULA 4LE4A 5GLWA 3QD6A 5EYXA 3Q8BA 4YZ3A 2YMZA 3UKNA 1OURA 2JDHA 2JDNA 4K6BA 1W9YA 2VTXA 4IV3C 2WZEA 4YW2A 1ND2A 3S57A 3IPVB 5FXZA 3K48A 1SBEA 2D6MA 3ME2A 1NLRA 4PQQA 1OA2A 3PMSA 4HN1A 4LHSA 3RMYA 1ENRA 2VMGA 3AYEA 4WM7B 5LBCA 2YU2A 4FXKB 2J22A 1SLAA 1IG0A 1MR5A 3BTAA 2G9FA 5I93A 4OHZA 5KC6A 2YGLA 2OX0A 4IDZA 5D8AB 1PM7A 1TMF2 4R4XA 3RDIA 3D8CA 4LBQB 2XVGA 3WP3A 2ZGUA 2RS52 2WJSA 1OA3A 4M3CB 4IEVA 3RVHA 1LU1A 1L3JA 3PVOA 1I1EA 1NQJA 2QQIA 5F6LB 3RQ0A 4TSVA 3BGAA 1XC6A 3PHMA 3I3QA 3MW4A 2A1XA 4Q29A 2GNDA 2ZS6B 1VAMA 3ZO0B 2VOKA 5A1LA 3WDUA 3VD3A 3UKVA 2W46A 2ES3A 5GALA 1DG6A 5FBJA 2BFUL 3N7KA 5EJ1B 4DEQA 2EIBA 4IL7A 3NKGA 2VR4A 3VZOA 5IVVA 1W06A 2ZGOA 3C7HA 4L92A 4QMAA 4HT1T 5FZ6A 3GDBA 4LHLA 5GM0A 4Q4X2 4N8MA 3U0ZA 1TQ5A 5C4WC 4OI1A 1MEC2 1CZVA 4QDRA 4ASMB 1WW5A 5EJZB 5L9VA 4QXKA 2VQAA 1V6KA 4RL7A 4XDQA 4E27A 4E4SA 1FXZA 2VW2A 2JE9A 3AYDA 2VUJA 4LLOA 3T1LA 1KGYA 4Q4V1 1H6XA 2A3YA 5A3WA 4RR3B 4AF9A 4AQTA 5CKNA 1CAWB 3O1RA 3I49A 2FDGA 4QXBA 3A7QA 3LA3A 3ZN4A 3M8LA 4GWIA 4CUAA 2WC2A 4ZXEA 4FI9A 1CAVA 1ULOA 1EAH3 4XCBA 3FX3A 1RUG1 1C3HA 1BEV1 2EXIA 1SLBA 5FR3A 3N7LA 3TN92 5K0UB 3GZUC 5L7OA 5D21A 2Y6HA 4ZU4A 1YQCA 4DXTA 5DAWA 1J3PA 1YI9A 4KG8A 5FZ0A 3OB8A 4AEMA 5LA9A 4LTAA 3U75A 4KL1A 4Q4W3 3NV3A 2DTWA 1MZEA 4GD4A 2WZR1 1RUF2 3ACHA 3C7EA 2G9GA 4OHXA 4ZONA 1RL3A 3PUSA 1KFXL 1RUJ3 1ND3B 2IVIB 2UWCA 4LOSA 5IUQA 3RI9A 1ASJ1 2GSYA 3BUCA 2R7EB 2VUAA 1WW6A 1LU2A 2K9ZA 3WDTA 3MIDA 3U4XA 4P9WA 3E6DA 1JMUB 2Z42A 3G7DA 1Q56A 4XUQA 5A7SA 1H8TC 4BYYA 1OXCA 4JGZC 4KWJA 4G9SB 1RUD2 3H7JA 3OOXA 1F8VA 1X33A 2ZMNA 2IXIA 1OOPC 3ZPOA 1UQXA 2QFEA 3A23A 4P08A 4E2SA 4XURA 4C8DA 2V4VA 1C8M2 1G7YA 4BQ1A 1EV12 1BCXA 3KV9A 2HH9A 1MVQA 5FYIA 4MVTA 4CDQB 4URAA 4N43C 1UY1A 1F4HA 1PVC3 2DUQA 2OS2A 2XVKA 4KI5M 5T5JA 4BXSV 3IIAA 1OLQA 4E4HA 3WNLA 4LLFA 4AQ2A 1EYBA 1GU3A 2A70A 3MIGA 1R092 4PI2A 4DFSA 3B9IA 4ZZ8A 1NZIA 2QZ3A 5F1RA 2C9AA 3JCIA 2VZUA 3HEIA 4NIAA 2VECA 3FHQA 5J48A 5EZWA 1W8NA 2W87A 4UW3A 1BMV2 1BZWA 4XJAA 5T5PA 1O3QA 2WN2A 4LBOA 3NL1A 2WO1A 1LOGA 2A6YA 3AKPA 4XAAA 3BOPA 3DGTA 1LB2A 1ZRRA 4EWEA 2IUWA 5DUXA 1C28A 1J84A 3OGRA 1O4ZA 4ORFA 1O3TA 5BUVA 1XNAA 2AR6A 5EPAA 2W95A 1DGRN 2X53S 2HWF2 3K46A 4LO8A 1UZ0A 5C7GA 1AYM1 1HW5A 3AYCA 2F6BA 4QKFA 1SFPA 2A5ZA 1GQGA 1S0BA 1AR63 1VIWB 2Q0AA 5C71A 4I01A 4TN7A 3BOWA 3NWKA 1IKQA 1DP0A 2BNOA 4IEQA 3I2DA 5KBFA 3WG1A 1AF9A 1ST8A 4OMDA 4XUOA 1SFYA 1WW7A 3DPRA 3BYWA 1U5ZA 2SLIA 5F9TA 2OZ6A 3VBRA 4FFIA 1PVXA 2A6WA 4JHTA 4BU2A 1HIXA 1F4AA 2HWC3 3MFCA 3MDPA 1OA4A 5LBFA 4YZ1A 2V5YA 5FY5A 2CNAA 1CWPA 4C0BA 5CIRA 5FYYA 4B29A 2XJRA 1NY71 5DN2A 2D6PA 2QNKA 4XJ8A 3MFAA 3KGZA 3W21A 2ET7A 5I0DA 4BQXA 2E63A 3DV8A 4RHV3 4FFHA 5A3TA 4MGYE 4WM8C 3ZXLA 1SMVA 4V2VA 3ZXEA 5IVEA 3VHNA 1PZ7A 3BPSA 3LA2A 1R64A 2HEYF 3N9QA 4A7YA 1CN1A 1YFYA 1XRUA 3VBUA 1DLCA 3WXPA 4URTA 3RZMA 1ONAA 1HRV3 1ZBA1 1RHI1 1S4CA 1WCQA 1VBB3 5HCHA 3O0XA 2E7QA 4MX3A 4P9LA 1RUOA 2VCAA 2JIGA 3I3EA 1WZXA 5HV4A 3O1SA 3DL3A 2Y64A 4D94A 4K8FA 3USUA 4OCTA 1REFA 2WAAA 1JZ3A 1QU0A 3GYDA 1XPWA 5BNPB 4QM9A 5FZ7A 3OJBA 4K1YA 4Z07A 4RGGA 4FOWA 4Y26A 2AUYA 2Y26A 3ZSKA 4YZ5A 1HRI1 3QH7A 4GB33 4MOAA 3WDYA 4UXAA 1UOFA 1JZ5A 4QWNA 5KHJA 1Q8PA 2ORZA 1W8WA 1UU6A 4YZ4A 1D2QA 1CIYA 5GZEA 3CL1A 1OD5A 4K3UA 4GKYA 3B3QE 1AHSA 1AJOA 3FHIB 3T3YA 3ZSJA 3QCWA 4B4PA 1EY2A 1XYPA 4BQ4A 1KXGA 2DCTA 3ZX7A 2VOWA 1PZ8A 2VNOA 3E5UA 1KEXA 2CDOA 4XJWA 3CQOA 1EUUA 1LOFC 4XYXA 3OGGA 4YW7A 3TEWA 4QPIC 5DUUA 4FTBA 1OLME 4K20A 5EV7A 5FYSA 2EXKA 3NJVA 3ZIWA 1GR3A 2X5IC 2AYHA 1JW6A 2Y8KA 4LR4A 3ACGA 4AEDA 3SEEA 1HQWA 4KGGA 2QQUA 3VHPA 2QZ2A 2ZMLA 3LIHA 2VZQA 3CJXA 1R081 4JDOA 3ZLIA 1W6NB 2UY9A 3L2YA 1W6OA 2EXJA 4OZOA 2CAUA 1HV0A 1E5RA 1RVF3 4HPKB 4CXWA 1VAKA 4HK9A 2ID4A 1O59A 3LSEA 3PLQA 3QACA 2WSVA 5FPZA 5I0TA 2P6HA 4A44A 2RR13 5JOZA 1QJZA 5LY2A 1UX7A 3E6CC 3S7IA 1QQP2 3H1YA 3MIBA 4Q5OA 5EJ3A 3UESA 4CEWB 4JV4A 3V0AB 3MICA 4JVAA 4WVMB 1CZSA 2VVDA 3N9PA 4UFIA 5BV6A 3ZFFB 3BI3A 1CAUB 1GZWB 4P9YA 1LENA 2BU9A 3Q9OA 4Y4RA 5FZLA 3VZKA 2ADEA 3AKQA 4TLGA 3ZYHA 3ZYJB 4CDXA 4LEJA 4M4RA 1VE0A 1XNTA 2Y60A 2BOIA 3LFMA 1RMU1 3V56A 1LGNA 3EYPA 2OQ7A 3GJBA 2WT0A 4MGTA 1CX4A 3UT0A 2Y34A 1IOAA 1NA1A 2B45X 2JG9A 1N1SA 4AXOA 3JU9A 4K40A 2DVGA 4QX7A 4LKSA 2DWRA 3DN7A 1OUSA 4ES9A 4CYDA 3J8F3 3R4UA 1GANA 3NMBA 1UXXX 2UYAA 3WP5A 4UBGA 2VC9A 2R063 1SFNA 3C7OA 4RSUA 4XFIA 5T5OA 2WQ8A 5AC93 3HWJA 1QOTA 2OUHA 4FPCA 2PHFA 3M3OA 5CYYA 3DCQA 4QKBA 3S5AA 1SG3A 4FP3A 2XONA 1QJY2 3GBWA 2QJVA 2HEWF 2QTWB 3TB0A 1UU4A 4WM7C 5F5QA 2D93A 4AR2A 3VDBA 2VCBA 1WLWA 2TNFA 5EHDA 3ZFEA 4KBBA 1EAH2 5FLJA 3TEXA 4UBHA 2A6VA 3AZZA 3D4KA 4ZS2A 2BOJA 3WNNA 2ZHMA 1TEIA 5F3CA 2FDHA 2BERA 2QQMA 1S2KA 2VMEA 4JCKA 5FPVA 2WNVB 1IQAA 3KD4A 2ZHLA 2R043 2VBDA 4IE6A 5JAXA 3CDZB 4A7KA 1TMF1 4PDWA 2D43A 5HCBA 4HVRA 3ZSEA 2KM2A 2PAMA 1IS6A 4OHWA 4XF1A 1RUJ2 4QAWA 1U12A 3AMPA 3H8RA 3WSOA 1AR83 1CQ9A 1FYUA 3UK9A 2ARAA 1W9WA 2GNTA 3ZYGA 1RUH3 4IXLA 3GBFA 1VB4A 3VZNA 5FZHA 2Z4FA 3TEYA 4XJZA 5FJHA 2EICA 3I97A 4LHKA 1FMD3 3VZJA 3W9AA 4C1WA 1KITA 1XU2A 3RWKX 2P17A 3D5OA 2HWE1 4UF0B 4WZCA 4GJYA 4PJYA 3WZ1A 4Q4X1 4B1LA 1W6PB 2VPVA 5C9AC 3IAPA 1W2AX 1X7NA 1O8PA 4JC1A 4RR3C 5H9SA 4CDUA 1VBD2 1XOYA 1XB9A 2XKPA 4NAOA 4YM2A 1F5FA 1W99A 1KQRA 2RMU1 1ULDA 3WG3A 4AI8A 4N9HA 3WUCA 1POQA 2EF6A 4BB3A 3I4IA 1PIV3 2BNMA 5K8SA 2D97A 2PQQA 4BOWA 4E4ZA 4LK6A 3D6EA 1YQ2A 5K0UC 3MGUA 1REEA 4Q0UA 3KF3A 1KDKA 2WT2A 4PLMA 5F3IA 1OT5A 1URXA 4M3CE 4EWDA 2X05A 2BBVA 4EN7B 4OI2A 4PBOA 3TNPB 4CP9B 5A33B 3PVEA 4ONUA 4Z82A 2ZXQA 4R8HA 3AKRA 5IVJA 1BYHA 2VBPA 1ND3C 4Q1RA 2HBTA 1RUF1 1GUIA 1VP6A 2VCCA 5IJRA 1UZVA 2JD9A 3BVCA 4RGAA 4CP2A 3AMNA 1Q8QA 5GZDA 2K0GA 1E5SA 1Y9QA 2RDNA 3MW2A 2WO2A 5IFPA 3ZSLA 2WS91 1YCIA 1FV2A 1D4M1 4C0HA 2RS53 2CGPA 4RA0A 3PUIA 4EN0A 1SCSA 3SH5A 3T09A 3VUOA 2JENA 1K5MB 4XFFA 2PELA 4Q4Y1 2DV9A 4BA6A 1APNA 1CIWA 2YHJA 1AX2A 5E16A 4CDQC 1C8M1 1IGOA 4SBVA 1C1FA 3VN4A 3WNOA 1FAYA 1EV11 2WBKA 2HWC2 1IG3A 1XSQA 3IAQA 2NZ9A 3JQXA 3EJKA 1TME1 1PO11 4QHZA 5A80A 1MEC3 4Y4YA 4QM8A 5SV8A 2PHXA 2ZGPA 3WT3A 4TLFA 3ZFGA 4AFAA 2NQYA 5C3RA 3I3BA 1R091 3FUOA 4C90A 3PTRB 1OKOA 4P9GA 3HNBM 4RHV2 4TYSA 4FFFA 1VBA1 1YUDA 2DCKA 2WR9A 4FO9A 4GWJA 2DURA 2E32A 1COV1 1HJFA 1Q3EA 3E6BA 4META 1W8FA 2JG8B 5F32A 5IFTA 3VBOA 2BW8A 1VBE3 4MGSA 4XAEA 4XILA 2WABA 3KS7A 1GYKA 2G1MA 3GHMA 4L9BA 3TN93 3ZMNA 5FPXA 4UOJA 3WW4A 1VBB2 2GNMA 1AR92 1SACA 4QX2A 3H0OA 4E8DA 4NRPA 1SDDB 5KC5A 3T0BA 1DZTA 1UYYA 4WM8A 2XUMA 2VU9A 4JTOA 1JUIA 3ZXDA 1CJPA 3PU8A 4H2AA 3V0BA 2E6VA 2JIJA 3WR0A 5LWBA 1ZX5A 4XJ9A 1AUYA 5LBEA 2ZJCA 4XE9A 4IEWA 4FSJA 1Q43A 1FATA 3HT1A 3AZVA 4CE8A 4Z8BA 3C7FA 4ASLA 2ZAAA 4GB32 3PUHA 3VD7A 2WLPA 4NUBA 4Y5Z0 4I2OA 2OPKA 4LBLA 4EN8B 4GAZA 5A3MA 4RQPA 5FY0A 2X09A 1SLCA 2XL9A 4RN5A 4C1XA 1RUD3 4MGIE 3GBGA 2CWMA 4I3PA 4B1MA 1WCDJ 1WCUA 4HN0A 2ZA9A 2HEVF 4QPGB 4B7KA 4AAXA 1HXS1 5KHHA 4NN0A 4D8MA 1DIWA 4Q1PA 4YWAA 3T30A 3ZR5A 2XGXA 4XZPA 3SKVA 3JD73 3WLUA 4XBQA 5GZGA 5IK8A 5FZGA 4ZY9A 2ZGTA 1MS0A 2W08A 4YVWB 4KU7A 1FPN1 4P14A 1QF3A 2ZPXA 4UW5A 1NUKA 1RUE1 2LROA 2YXSA 1V9U1 1RJ7A 1LHVA 3B02A 3TAYA 5DDJ2 2VOVA 3T4HB 3FLRA 3WCRA 3KQ4B 4QX0A 4D7TA 5JUVA 1HV1A 1UY4A 4YARA 2F17A 1CPNA 3BODA 2CL2A 2JDKA 1N1VA 4L2NA 1GNYA 5BNPC 1JOJA 1N3OA 1NXMA 1R1A2 3POIA 3OD4A 1O3RA 4QKNA 5HI0A 4XXAA 3LPGA 2BGPA 2LS6A 3VBHB 1XNBA 1LOEA 3WP4A 3PMEA 5JSOA 3HOBA 4AVTA 3OPTA 1ZRIA 2R1DA 4AEKA 2PA7A 4LUKA 5I8SA 5E89A 1IZ3A 4YGDA 1W2OA 4Q26A 2HWF3 4N7UA 3J7HA 3PDQA 1RYYA 2A6XA 4BZ4A 4JGYA 2MEV2 1S0JA 4GMP3 5BNNA 2WO7A 3HJRA 5CISA 4NJ4A 4FPGA 2ZX0A 4OYUA 5C3QA 4Y3OA 5ABJB 4PIXA 3UKTA 3OG2A 4IV1A 5LZ6A 5KHIA 3VBFB 1UXZA 4HETA 1G9AA 2DDUA 4RS5B 2CY6A 4CEYA 1PO22 2W0XA 4BIOA 1QJFA 4OLLA 1ODMA 1ALYA 1JODA 4YYOA 5CFDB 5IATA 3IN9A 2R062 1T6GC 3C8XA 5AC92 4Z2WA 1H4HA 1VALA 2V4AA 2H0BA 5FREA 1LNSA 4OVEA 2JJ6A 4N90A 1UOGA 3RWNA 1H0BA 5DAQA 3THTA 5SV5A 1JTZX 4MGZE 5F6KA 3WDWA 4D0QA 4FAHA 4GH4A 5CFCB 4XFCA 3SHRA 2GMMA 4CDWA 3IB3A 5IYYA 2E7AA 1DGWA 1JYCA 5FYVA 2ORXA 5JXJA 3TRSB 5HCAA 5DAVA 3AVSA 3CZUA 4LORA 1LEMA 1PK6A 3ZFFC 3ORJA 1GQHA 3TBDA 5FQ0A 3DECA 5B2GB 3AL5A 3RJRA 3K51A 2WLQA 3WX5A 4I30A 2VBBA 2W94A 1LHWA 3M1HA 4N53B 1OPOA 1YJLA 4W6XA 1UO9A 2WNUB 4YGEA 1ACCA 1HQNA 4M01A 2HWB2 3VGIA 1OUXA 2ZGKA 1W9TA 3KM5A 3KV5A 3E1F1 3AP4A 4C91A 3EBRA 4RGKA 2QQPA 2WAOA 4HK8A 1OFSA 2Q5TA 2VO5A 2JICA 4CA9A 4CU6A 4P5HA 1YRZA 4I02A 4BE3A 2D5HA 2D6OX 2XHKA 3I7DA 5I0SA 2QQNA 1JBCA 5FPUA 4NPRA 4QB6A 5FCCA 2Y6LA 1V70A 2BGCA 1QXRA 2HJIA 3GM8A 3HBZA 5FJKA 5IK4A 5FK8A 1JU4A 1ODNA 2QQVA 1UMIA 2FCTA 3MHZA 4G3YC 4B4RA 1LRHA 3WINE 1NOVA 5FK7A 3PJYA 4JRAA 4NHXA 2WYFA 3WW2A 4BWOA 3WDVA 1ULGA 4YVSA 2GC0A 3LEGA 2D6NA 2GNBA 2JXAA 4XBLA 2OYZA 3RZZA 3RMXA 1PIV2 1J3QA 1BK0A 1FOD2 1BJQA 2C6SA 3GHNA 1O5LA 2EALA 4KGQA 2X29A 5EYYA 2RS32 4LKDA 5A6XA 1AXYA 4O9GA 1EAH1 4QT6A 3T1MA 1A6CA 1WMXA 2WNVC 4MHRA 3CEWA 3GXUA 1GQPA 4KQ7A 5JMOA 3A22A 5ACA1 3URFA 2YV8A 5ISLA 5CB7A 1SDWA 1TVGA 3A0KA 1BKZA 1K5JA 1QEXA 1NCQB 1RJ8A 3K3NA 2B5HA 4DY3A 2QKDA 4Q4W1 5EXOA 1H1IA 1OBNA 1PX3A 4I3GA 5LY1A 2SBAA 2W1SA 3EHKA 3EXUA 4Y24A 3MUZ1 1N1YA 1QQP3 1RUJ1 1W8OA 2UU8A 4KMQA 5BNOC 1NZCA 3N9MA 3NVCA 1VLNA 3WEZA 1G9FA 3HNYM 4I09A 3WHTA 3N35A 3RZJA 3FLTA 4LKFA 4XPVA 5H9PA 4J1XA 3HN3A 2WYSA 4HKWA 3OPZA 1Q8VA 4QHOA 5C9AB 2DF7A 4FPEA 2C4XA 2JB4A 3WP6A 3I2GA 3V64A 4JHZA 5F3GA 2D5FA 2BUKA 3B94A 3IMNA 4D6RA 5FPLA 4WV8A 4BMBA 1VBC3 3L2HA 3L9JT 3WW3A 1AXZA 3GCXA 3M3QA 2GC1A 2GMPA 4HL0A 3ZXKA 3A21A 4LPLA 1OQ1A 4Z1VA 1PVC1 1W28A 5L73A 3AC0A 1N3QA 4V2WA 2BFUS 4BH9A 2GH8A 3H3UA 1ZA4A 3KVAA 4CCLA 4XEZA 3ZIXA 1QJY3 4NVPA 1UOJA 3CJIA 4L0PA 2Y6FA 1I3HA 3GZAA 1W0PA 3LEMA 4OUEA 2O0OA 1C1LA 2XMLA 3OY8B 5A32B 3T2PA 5BNOA 2R16A 3CNAA 2XPJA 1H2KA 4MXWB 1X36A 3AP7A 3VBSA 4OUMA 3JB4C 1VBE2 3NO8A 1CJDA 2CGNA 1JUHA 3K2OA 1NE6A 4HMZA 1IQDC 4XTMA 3FBYA 4IUGA 2J42A 1J83A 4MGQA 1CESA 5F7UA 1YFXA 4HSJA 2Y6GA 3WUDA 2AZ5A 1MQTA 2GZWA 2XXZA 3AX4A 2WA4A 4E2GA 1RUC2 4OI4A 3R05A 4GJZA 4CU7A 5C70A 1K5MC 3PTYA 3CMGA 1S1AA 2RS12 1QWRA 2Q1FA 1R1ZA 4H7MA 1AR61 4P00B 4JRLA 3ZXJA 1WLCA 2ZBJA 2G4IA 1ND2B 1DQ5A 1KD7A 3AXEA 5A70A 3H1WA 1IKPA 4XDPA 2YPJA 4QQPA 2J1TA 3K75B 4ZU5A 3OBRA 1Y7BA 4ZKTB 2HWC1 1Z7S1 5FV3A 2XLAA 2ZGSA 3T2OA 1DYOA 4CTEA 1O8SA 2Y0OA 2W39A 1ENXA 4PLNA 1VBD3 1J58A 5H9QA 3WG2A 3IZOA 2YC4A 3JD72 1MACA 4FOQA 4DUVA 1MS4A 1WA4A 1BBT2 1VMHA 2C5DA 2JG8C 3H3LA 4QQ2A 4RHV1 3E5XA 3JBG2 3J7MA 3ACFA 5LEKA 4X8NA 3ITQA 5FZIA 2JDAA 4KBZA 2BVBA 2EA7A 1W6QA 2P3IA 2JDYA 3OGSA 1HRV1 1VBB1 3IDAA 1NCRA 1QNWA 2GU9A 2WZ8A 5C33A 3O5SA 4XUPA 3H8UA 1GP4A 2VUCA 3WQ1A 4B4QA 1GOHA 2XBO2 3MIEA 3WY6A 4IEUA 4HXCA 1H8VA 2OW4A 4IE0A 1WLDA 4UYBA 5JXHA 4RFRB 3O0WA 4B3NA 5B4NA 3B00A 4WZFA 4YPJA 3X29B 3DKQA 1UYPA 2ZCWA 4GB31 3MZHA 2JE8A 2Q1ZB 3AYAA 2ZHNA 4LBQD 5FZKA 1PGW2 4UFMA 4AHYA 4LO7A 4CRQA 5E88A 4Y5TA 5CADA 3J7LA 1PM4A 1CAVB 4R52A 2YBSA 1CAXA 2QCSB 4QPGC 4UW6A 3FJSA 1POV0 4L8QA 4DXZA 5L7OB 1AR73 1QDOA 4YGBA 1UW8A 5FZ3A 4JKLA 1OF3A 3I8TA 3HQXA 3VDDA 4YW5A 5JI9A 5JOXA 2R072 5FWJA 2DFBA 3ECQA 3FL7A 4FT8A 1W2NA 1W9SA 4XQ4A 4YVWC 3THPA 1G86A 3MPPG 4L97A 1KS4A 5FMDA 1W9FA 4ZZ5A 2PLV3 2B9VA 2ZMKA 4YG3A 3KSCA 3ZKYA 2QQLA 4LBNA 2UWAA 4H14A 2TUNA 3D82A 1Z0HA 1ZBE3 1BVVA 3LDRA 4K1ZA 2EAKA 2WT1A 4NIIA 4EWAA 2TBVA 2A7AA 3U14A 1RVF1 1LOBA 4IGPA 4XQWA 4GMP0 2IXCA 3D0SA 5FZEA 1B35A 5D2AA 3VBHC 1VB2A 3WF1A 4BCUA 5K9YA 1MS1A 2RR11 3GZEA 3K4ZA 5FTTC 1WLTA 5JZGA 5C8CA 3FFZA 3ON7A 3LWCA 1UIJA 1IPKA 2AREA 2Q30A 3NNJA 4DZGA 4GXLA 2XJSA 4TWTA 1AR93 4AK3A 4PBPA 4OUSA 4XUTA 3NNFA 3LD8A 3N3HA 3Q8EA 3OF1A 3SQOA 3ZN6A 5ABJC 3S6PA 5IWFA 2E53A 2XDVA 3U37A 3VBFC 4N7IA 1W90A 3K4DA 5FOBB 1C8NA 2UURA 2VMHA 4RS5C 4EROA 4YG0A 5CEHA 4A3XA 5FYTA 4CPBA 1A3KA 2DTYA 4U36A 2RM23 1D7PM 3KMHA 5FZ1A 5CFDC 1OMIA 3O7OA 4BPZA 4AI9A 5L19A 2VZPA 4AGVA 2O8QA 2O8OA 4IEPA 3HT2A 3VHOA 3J8F1 1DBNA 3RRDA 2R061 5AC91 3NAPC 2VNVA 2ZACA 4YFZA 4DNYA 1BQPA 3AB0A 1QJEA 5CFCC 3AP5A 5ANQA 1QJU2 3ILRA 1OQEA 4Q2FA 4XFHA 3WV6A 2JX9A 1JHNA 2GH2A 4XCAA 5LRRA 4QU2A 4QGMA 1UAIA 2VQ0A 2JECA 4NIDA 4FPHA 3WF0A 3DXUA 5FYMA 2Q8DA 3DPRB 3FC0A 1MPXA 2AEYA 1YQ8A 3AP9A 1O7FA 3DKWA 5DDJ3 4F3JA 4LOTA 4N53C 5LB6A 2XJVA 3VBRB 3LZZA 2WNUC 4M3CF 2Y38A 1RINA 2R041 3W5MA 1W8HA 4BHPA 5E6HA 1BK1A 5FZBA 4CP1A 1RUI2 1R1A3 4ARYA 1H30A 4S2FA 2FMYA 4Q0VA 4AL9A 3R6SA 3N7JA 4BM8A 2CDPA 2L9LA 2VL4A 1AX0A 2ZX1A 3BN6A 3HVDA 3MF9A 2B42B 3FUQA 1AR81 4MADA 4L11A 3U78A 4IV3A 1K3IA 1RUH1 1LODA 1V00A 4UW4A 2XJUA 1KJRA 1S0DA 3MIHA 3WDXA 2D40A 5DXDA 4YG6A 1H2NA 2BPA2 1FMD1 5FYCA 4FPYA 4KWUA 1AYN1 4OQ8A 4A41A 5FZDA 2MEV3 2RVAA 3VBUB 4LUMA 5C3PA 4A42A 5FZAA 5FKBA 5HPOA 1LHUA 5J36A 1XNDA 3E5QA 4XW3A 5FZ8A 5BNQA 2ZEYA 2WSUA 5IK5A 2VMIA 3SH3A 3OBAA 1VBC2 4AVVA 1SLLA 2W92A 4QXCA 1PO23 1FI2A 1W0OA 3LCPA 3ACIA 3N36A 4XMAA 1QGLA 2W52A 3USUB 1MZ5A 2HWD2 5L36A 4CCJA 1G6NA 2ZGQA 1BXHA 4MV2A 2W1QA 2JDPA 3SCGA 5DUWA 3LE0A 3ZDVA 4K8RB 5JOYA 3AFGA 1REDA 4XDOA 1QDCA 1NCQC 3KGLA 2WWUA 4JDMA 4JDNA 4LA2A 2BDRA 2QVSB 4YW4A 1ZZCA 4RFT0 3FZ3A 1JHJA 2YG0A 1LESA 2C9KA 3I2JA 5C4WA 2WZPP 3M3EA 1O6UA 1IPJA 3POEA 4LBKA 5CU1A 1PGL2 1MVEA 3HIFA 5D8AC 1VRH2 3POJA 4HFSA 3RNSA 3BU0A 1HLCA 3O14A 4E9KA 1GSLA 2PXJA 4D7SA 1H9WA 2YBKA 4GALA 1YHFA 4JAAA 3RSJA 5FRAA 3H8XA 3W5NA 2RS51 2WFF3 2I74A 5FUNA 2HWB3 4QXHA 4ES8A 4PQ9A 5A1FA 1NLQA 3ZYIB 2BYVE 3LIGA 2Z2SB 1W6OB 4R9AA 2K46A 3KT1A 4Y22A 3UYJA 2DCYA 4NPMA 2BJSA 4AEDB 1X82A 5K7PA 2O1QA 1V6IA 2J1RA 1HB3A 5FMOL 1SEFA 4BXFA 4QGLA 3N9OA 3PURA 3HQRA 3CIHA 4Q8KA 5FYHA 4M0HA 4DIQA 3N4MA 2PQSA 1MZFA 1MEC1 3RYKA 3AVRA 2YDEA 1OPMA 3WOGA 4CDXB 1ZYBA 1JYXA 5GZFA 3ZXGA 1H8TA 2NMOA 5A3NA 3I59A 4JGZA 5B4XA 3BB6A 1PMHX 1FX5A 1FOD3 3IDCB 2A75A 4O9EA 5FXWA 2DU0A 3AJYA 2RS33 1OFNA 1NA1B 1OOPA 2B4KA 2JG9B 3SKJE 2W2IA 3PVNA 1VBE1 3UJOA 3WQ7A 1J3RA 4A4AA 4DY5A 1RMU3 1UIKA 4ATEA 3TN91 3GF6A 3OYWA 4FFGA 5DZGA 3AXDA 4BJ0A 2LTNA 1IHMA 1OI6A 1PMJX 4K9SA 1DQ2A 4N43A 1YQ5A 2OUJA 2B8MA 4Q0QA 1UU5A 4DXSA 4DB5A 3IBMA 4HZFA 1M4WA 3CU7A 4JZRA 1Q8SA 1JYIA 1ND2C 4CCNA 5C3OA 1WD3A 4BQYA 1O5UA 3UL2A 2AACA 5IVYA 1W3XA 1OVPA 2PHTA 2VTFA 3HPNA 4YNIA 1F9KA 1G9CA 5FUIA 3ZXFA 2DVAA 1MZ6A 1NX9A 5CKQA 4YM0A 4MYEA 4CPBD 4CCCA 4Q27A 3ZFEB 2F4PA 2TEPA 5LK5A 2Q8EA 4G4FA 4Q4V2 1W05A 4HSLA 2D3RA 4IQPA 2VVEA 4DINB 3JUUA 1RUD1 3POYA 4Y5SA 1AR72 3P3NA 3P5BA 4FPLA 1OH3A 5LA2A 4P9JA 2VZRA 1LCLA 4XBNA 1RUG2 1WW4A 5TSWA 1BEV2 2A73B 4AFMA 5CAZA 3ASIA 4PDWB 4Y20A 2DBNA 2WINB 2FQPA 1YYNA 3JD71 1ZM1A 2PLV2 1HQLA 2W68A 1S0CA 4XJUA 4YFWA 1XNKA 3LAGA 2YROA 1V6LA 5GLUA 5I8YA 1MS9A 2PYTA 2WZR2 5CZKA 1GWKA 1W8ZA 3KV4A 2PMWB 2UYBA 3MV11 4KG0A 3GJAA 5A3OA 1ZBE2 1QMJA 1OH4A 3VD9A 2QDRA 4XFBA
chains in the Genus database with same CATH topology
3NNJA 5EP9A 3HQUA 3NNFA 2FCUA 4NAOA 3PL0A 4IW3A 4UWDA 2FCTA 4XABA 3MGUA 3KT7A 5LBCA 4NHXA 3EMRA 3KT1A 2RDSA 4XAAA 3NNLA 3HQRA 5EPAA 4J25A 4Q5OA 5DAPA 2HBTA 4MHRA 3OBZA 4NHMA 5L9BA 3ITQA 3BVCA 5L9RA 2A1XA 4KBZA 4XCAA 5M0TA 2RG4A 2RDNA 4XACA 5IAXA 2OPWA 3GJBA 3W20A 3OUIA 3OUHA 2Y34A 5LB6A 5LBBA 5LATA 5A3UA 5LBFA 5L9VA 3DKQA 5HV0A 2Y33A 5C5TA 4NMIA 5IAVA 4JZRA 4Y5TA 5C5UA 5EQUA 3W21A 5ERLA 4BQYA 4BQXA 4XCBA 4XC9A 5IATA 3OUJA 3NNMA 5DAWA 2V4AA 3KT4A 4ZPIA 2RDRA 4NHYA 5LA9A 4NHKA 4Y5SA 2G19A 2RDQA 5DAQA 2JIGA 4ZONA 5HV4A 2G1MA 4MHUA 5DAVA 5DAXA 4NHLA 2FCVA 4BQWA 5LASA 2HBUA 2JIJA 3GJAA 3GZEA 5LBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NNJ A;  5EP9 A;  3HQU A;  3NNF A;  2FCU A;  4NAO A;  3PL0 A;  4IW3 A;  4UWD A;  2FCT A;  4XAB A;  3MGU A;  3KT7 A;  5LBC A;  4NHX A;  3EMR A;  3KT1 A;  2RDS A;  4XAA A;  3NNL A;  3HQR A;  5EPA A;  4J25 A;  4Q5O A;  5DAP A;  2HBT A;  4MHR A;  3OBZ A;  4NHM A;  5L9B A;  3ITQ A;  3BVC A;  5L9R A;  2A1X A;  4KBZ A;  4XCA A;  5M0T A;  2RG4 A;  2RDN A;  4XAC A;  5IAX A;  2OPW A;  3GJB A;  3W20 A;  3OUI A;  3OUH A;  2Y34 A;  5LB6 A;  5LBB A;  5LAT A;  5A3U A;  5LBF A;  5L9V A;  3DKQ A;  5HV0 A;  2Y33 A;  5C5T A;  4NMI A;  5IAV A;  4JZR A;  4Y5T A;  5C5U A;  5EQU A;  3W21 A;  5ERL A;  4BQY A;  4BQX A;  4XCB A;  4XC9 A;  5IAT A;  3OUJ A;  3NNM A;  5DAW A;  2V4A A;  3KT4 A;  4ZPI A;  2RDR A;  4NHY A;  5LA9 A;  4NHK A;  4Y5S A;  2G19 A;  2RDQ A;  5DAQ A;  2JIG A;  4ZON A;  5HV4 A;  2G1M A;  4MHU A;  5DAV A;  5DAX A;  4NHL A;  2FCV A;  4BQW A;  5LAS A;  2HBU A;  2JIJ A;  3GJA A;  3GZE A;  5LBE A; 
#chains in the Genus database with same CATH topology
 3MI8 A;  4ZS3 A;  4HBN A;  1DQ0 A;  1E57 A;  3HMY A;  1BMV 1;  4CCK A;  3R4D B;  1QJX 3;  1WCS A;  4OZX A;  4CDU B;  5JSR A;  1U5X A;  4HON A;  1TNR A;  5JWP A;  4FTS A;  1O3S A;  1DZQ A;  5F8P A;  4CU8 A;  2ET1 A;  2ERF A;  1QOO A;  2AH2 A;  4MUV A;  2HWF 1;  2DCJ A;  2HYX A;  5L7O C;  3ACL A;  4YGC A;  1RUC 3;  4GMP 1;  5FKC A;  5FZO A;  5A7W A;  1D2S A;  4DEV A;  2ZGN A;  4BME A;  1JYN A;  1RUN A;  4AHX A;  2RDS A;  4A7Z A;  2RS1 3;  4X6Q B;  3C3V A;  3SC7 X;  2VZS A;  4BLJ A;  2R0H A;  3EB7 A;  1HX6 A;  1UNB A;  1WA6 X;  2RM2 2;  4PT6 A;  4S2G A;  3SIS A;  3VL8 A;  2CV6 A;  1EPW A;  3VDA A;  3OD0 A;  4KH9 A;  4XIK A;  2VXJ A;  4BQ2 A;  4IGQ A;  4MLO A;  3ZM8 A;  2VZT A;  4AI0 A;  1ZRC A;  5DAP A;  2V09 A;  2JWP A;  3KHB A;  2WL1 A;  4I0W B;  3AJZ A;  1LHO A;  2OVU A;  5I0R A;  3D3A A;  2DFC A;  2HYK A;  4IE7 A;  5M0T A;  3RZL A;  1EPZ A;  2IFW A;  1N1T A;  2PAE A;  2XLF A;  3LEI A;  4LA3 A;  4LIT A;  1CPM A;  2FHR A;  4L99 A;  1YEW A;  1BBT 3;  1VAV A;  3OUH A;  4W50 A;  2Y0I A;  3JBG 3;  3CO2 A;  3OGV A;  4AYU A;  2XB6 C;  3NAP A;  1G8W A;  1GV9 A;  1LED A;  1POV 3;  2GC2 A;  4EN6 B;  1JZ6 A;  1LOF A;  4QPI A;  3T0D A;  4AQS A;  4AVA A;  1DGL A;  3I2O A;  4FPF A;  2R49 A;  3I3M A;  3ABZ A;  2X5I A;  1XYO A;  4S2H A;  5FO9 B;  2KXL A;  1JXN A;  1FNY A;  3S0M A;  3NRU A;  4QU1 A;  3ROU A;  5A7O A;  3WW1 A;  2XBO 3;  4XC9 A;  5FWE A;  2XWB B;  2RE9 A;  5I0U A;  4W65 A;  4AQ6 A;  5GZC A;  3ZFG B;  4UI9 L;  4EZH A;  1G9B A;  3V65 A;  3ZOI A;  4FTE A;  4W8J A;  1LKN A;  2D3S A;  4AVB A;  5GLZ A;  2VXR A;  2ZX4 A;  5CBL A;  4NHY A;  4GWM A;  3R0R A;  5APA A;  4BK5 A;  2ZEW A;  3T4V A;  3B69 A;  4AOC A;  2FDI A;  2VCM A;  1NY7 2;  3VBO B;  4A6S A;  4P9X A;  2GC3 A;  1WME A;  4M00 A;  2NN8 A;  3M7A A;  4LE3 A;  2WQZ C;  1H2M A;  4IE4 A;  2D6L X;  4PIZ A;  4EN9 B;  3POG A;  2CHH A;  5T52 A;  2BWA A;  2I45 A;  3OSD A;  4X8P A;  3KF5 A;  4WM8 B;  1UY2 A;  2JKX A;  1I5Z A;  2OII A;  2R07 3;  5FXX A;  5A7Q A;  4NR1 A;  2D7F A;  1RHI 2;  2VUL A;  4EZ4 A;  3V0B B;  2AEZ A;  1D0G A;  4HLT A;  1Y9M A;  2HBU A;  3HR9 A;  4UFL A;  5FXV A;  2V5D A;  1DYK A;  3LKJ A;  4NPL A;  3T08 A;  3DPR C;  3VD5 A;  2WA3 A;  3KCC A;  1T6B X;  4NRQ A;  2DU1 A;  1XE7 A;  2RJL A;  4P9I A;  4DOU A;  5FO8 B;  3N9N A;  1NKG A;  5JCT A;  1PNF A;  1DF0 A;  3HQU A;  3S7E A;  4ZHN A;  1SPP A;  1U5Y A;  4RQP B;  5JOW A;  1RXF A;  3B5L B;  3KV6 A;  1W8T A;  1W6M A;  1HRI 2;  2QQK A;  1HDK A;  2WFP A;  2JDZ A;  5FZC A;  1ULC A;  2X10 A;  4XHX A;  4H7L A;  3I54 A;  3RFR A;  4CEW C;  2W9X A;  4BDV B;  4DS0 A;  2QQO A;  2VOX A;  1C5I A;  4JX0 A;  3NJZ A;  4IW3 A;  5A3P A;  2MNG A;  2GME A;  4AI2 A;  1YO8 A;  3IPV A;  1QQP 1;  2ZHK A;  4BQ3 A;  4ASK A;  3BTX A;  5T50 A;  3O0V A;  5HCF A;  4IE5 A;  4A3Z A;  4WVW A;  4ZXK A;  2DVF A;  4IET A;  1Z78 A;  3KLS A;  4WM7 A;  1VR3 A;  3KCX A;  3PNA A;  4O61 A;  4YM1 A;  5G05 L;  4AFC A;  4CP0 A;  2WFF 2;  2WNO A;  2VZV A;  3RYP A;  4BIS A;  2BRT A;  4HAN A;  2P3K A;  4XET A;  3H50 A;  3TNQ A;  1VPH A;  2ZGR A;  3NQH A;  5D8A A;  5C8W A;  2FDF A;  4LBQ A;  2HLE A;  4GKX A;  4M3C A;  3LF7 A;  1VBC 1;  1O4Y A;  3T2Q A;  4HVQ A;  3U4S A;  2G9Z A;  1JN2 P;  5IVB A;  5JDB A;  1RB8 G;  1YQ6 A;  2BP6 A;  5KXD A;  4OHY A;  2E51 A;  5FPA A;  2QQJ A;  2BWC A;  1GNZ A;  2C0Z A;  2MHF A;  3AFK A;  3NV1 A;  4GIQ A;  2NPI A;  4QX1 A;  2PFW A;  2OPW A;  5C3S A;  1C4R A;  3AMM A;  3OCP A;  3VHR A;  4AEJ A;  4IEY A;  3ZPY A;  1TE1 B;  3EQE A;  3VDC A;  2OXB A;  3P3P A;  5FYU A;  2NYY A;  1BVP 1;  1QJY 1;  4JGY B;  2WO3 A;  2IXL A;  3CLP A;  1QJU 3;  3JXS A;  4AVC A;  4AWD A;  5BNN B;  1UPS A;  4QQO A;  4COW A;  1SBD A;  2QQW A;  4Q8L A;  5FUP A;  4Y1Z A;  4QD2 A;  2BEO A;  4IV1 B;  4I0B A;  5HV0 A;  4ISR A;  5C9A A;  1SQ4 A;  3III A;  1MS8 A;  3UET A;  4RR3 A;  1WBL A;  1RMU 2;  4CEY B;  1CAW A;  1RIT A;  5C8C C;  3HNM A;  4LQR A;  1DQ1 A;  3H7Y A;  3LDK A;  3MV0 1;  4QB1 A;  2ZGL A;  3OUJ A;  3CBN A;  2B46 X;  2PAK A;  1S0E A;  2LM3 A;  5K0U A;  2W91 A;  1CGP A;  1RUI 3;  1YJK A;  4X6R B;  4COU A;  3LOB A;  1Q8O A;  4ITC A;  5DZE A;  4EJR A;  4PCR A;  1DDL A;  5CA6 A;  2XR4 A;  1JOB A;  4AED C;  4LO4 B;  5FBZ A;  1XBF A;  1F2N A;  2W5F A;  4GH4 B;  1Y9G A;  5DZF A;  4CDW B;  4DUW A;  2PHL A;  3GCW A;  1ND3 A;  2YU1 A;  3WD5 A;  5IHR A;  4MHU A;  4COY A;  1P8J A;  1PK6 B;  4YM3 A;  5LA0 A;  3F95 A;  5FQ0 B;  4XF3 A;  2OT7 A;  2YUE A;  5LAS A;  4CDX C;  2IXJ A;  2K2S A;  3ZDS A;  3KZ4 C;  3W59 A;  1W39 A;  1O4T A;  5K4L A;  1WMD A;  4QDS A;  5FYB A;  5IT6 A;  4UFK A;  1VBD 1;  3PVB B;  1RC6 A;  4DO0 A;  3MBW A;  1B09 A;  2GP5 A;  1NA1 C;  2JG9 C;  4PF1 A;  4DPN A;  5A6Q A;  2HWD 3;  3S5Q A;  4PF5 A;  2KD7 A;  2PHW A;  3ZYP A;  5FY4 A;  3UGF A;  4QX8 A;  5JPM B;  1CON A;  3TWI A;  2E33 A;  2J1U A;  1W2U A;  4N9I A;  4XFG A;  5FY9 A;  3PUQ A;  4MO3 M;  1OF4 A;  2AGS A;  3B93 A;  4RD7 A;  4CDQ A;  4CCO A;  1W8U A;  2ETE A;  3MUY 1;  5FZM A;  2FZ2 A;  4AAP A;  1V6J A;  3MO4 A;  3KHC A;  4S2D A;  1S55 A;  1BHG A;  3NV4 A;  4W6W A;  2FZ1 A;  1QJX 2;  5J96 B;  4JKM A;  4XQD A;  1OC1 A;  1WCK A;  2BNN A;  4GWN A;  3M4F A;  2GAU A;  2YZ4 A;  2YPD A;  4LIV A;  1CX1 A;  2HWE 2;  4YVS B;  3D0J A;  4AVS A;  1VRH 3;  3POB A;  4LNV A;  3ZFE C;  1OSG A;  3MLJ A;  3ZYF A;  4ET7 A;  1O91 A;  3VZL A;  3O1T A;  1ZA7 A;  1VMF A;  5J37 A;  3SXW A;  1LEC A;  3BTZ A;  1HB1 A;  2CYF A;  3KWV A;  5FY8 A;  4PI0 A;  1S2B A;  2CU5 A;  3SMH A;  1Y4W A;  4FCA A;  1PZ9 A;  2RMU 2;  3FLP A;  1SZB A;  3VB9 A;  3TEZ A;  3J7N A;  5FLH A;  2ZX3 A;  5DMY A;  1AR7 1;  3K77 A;  3LDB A;  1AL2 3;  4AZZ A;  4PDW C;  2ZAH A;  1YFW A;  1IS4 A;  2XVL A;  5FY1 A;  1A8M A;  4EYU A;  1HB4 A;  1DCS A;  3LQC A;  4LBM A;  5JIU A;  1S0I A;  5FFO C;  3ENR A;  4AI1 A;  5IAX A;  2BVV A;  5ACA 3;  4RYD A;  2DCZ A;  4LUL A;  5IW0 A;  1JZ2 A;  2PLV 1;  1HKD A;  2J1E A;  3U07 A;  1UL9 A;  2EVX A;  3T2T A;  5EWS A;  1W2T A;  3POS A;  4DRV A;  2LRP A;  3MLK A;  3LFI A;  2D98 A;  4M4P A;  1YIP A;  2J1V A;  1PHM A;  1ZBE 1;  5FDB A;  3RZK A;  2ARC A;  3WNM A;  1X9T A;  2Y33 A;  1FT9 A;  4LHN A;  4CDU C;  3DEM A;  4NIG A;  2WS9 2;  3RGB A;  1U0A A;  4I0A A;  3OTF A;  2OA2 A;  2P34 A;  2YC0 A;  3ES4 A;  1D4M 2;  3ILN A;  5CVR A;  3ELN A;  2YBP A;  5DUV A;  1F35 A;  1QIQ A;  3LB9 A;  4GA9 A;  2XG3 A;  5ERL A;  1QH6 A;  4BQ5 A;  1ZZ8 A;  4E2Q A;  1GLH A;  2EID A;  3DYO A;  4IGO A;  5KWR A;  3QOP A;  1GBG A;  3FMG A;  2W1U A;  2D3P A;  3INA A;  1AR9 1;  4Q4Y 2;  2IVJ A;  3VLB B;  3RZG A;  4ZPI A;  3N9L A;  1XQN A;  2NM1 A;  2VG9 A;  4JTN A;  5F3E A;  5JSP A;  5JR2 A;  1NQD A;  4XF9 A;  2E9Q A;  2W3J A;  4IND A;  4IEX A;  3SNM A;  3ZXA C;  1TME 2;  1PO1 2;  4WVV A;  3CJI B;  1KDM A;  1HN0 A;  2JKB A;  2QBX A;  3RYR A;  2YFZ A;  2ENR A;  2RM2 1;  2VUD A;  2WKK A;  3WNX A;  5BNO B;  1STM A;  2C26 A;  2C1F A;  1A8D A;  5DAX A;  5BNP A;  3VBS B;  3N7M A;  2FCV A;  1ULE A;  5EFU A;  3EO6 A;  2XL7 A;  4Q4V 3;  1ZZ7 A;  2IXH A;  1VBA 2;  4EE2 A;  2VMD A;  4HVO A;  4OHV A;  3IDB B;  1OHF A;  5FP3 A;  1COV 2;  2J1A A;  4ZU7 A;  1J59 A;  5FZF A;  5DPN A;  1PX4 A;  1NYW A;  3JQW A;  1RUG 3;  1MQT B;  1UN1 A;  1BEV 3;  3O1V A;  2BV4 A;  3OGJ A;  2IC1 A;  2IFR A;  3MPB A;  2EIE A;  4EQV A;  4YSF A;  4P5Y A;  3ATG A;  2OZJ A;  5FLI A;  5GLV A;  3BAL A;  1UMZ A;  1YC6 1;  2WZR 3;  2GP3 A;  4NWV A;  5CG9 A;  3GZT B;  5I8T A;  1NE4 A;  5DDJ 1;  3AKS A;  3QBQ A;  1DGR A;  1ASJ 3;  1YLL A;  4SLI A;  3GGL A;  5HXV A;  3KB5 A;  1TZO A;  3ZFG C;  4KWL A;  2VY0 A;  3NV2 A;  1R1A 1;  2H6B A;  3CKH A;  4NWW A;  5A1A A;  3RI8 A;  1GP5 A;  1KRI A;  1W6N A;  3AKT A;  2Y6J A;  2E7T A;  2RJ2 A;  1Z7S 3;  4HPK A;  4AI3 A;  4DMI A;  4LIU A;  2VM9 A;  4LK7 A;  3THD A;  3SEP A;  5FAX A;  3VBO C;  3RZH A;  2VZ1 A;  1HXS 2;  3AP6 A;  3AMH A;  1UKG A;  3KVB A;  4CEW A;  3V0A A;  1Y3T A;  2F4L A;  3OBZ A;  2MEV 1;  1AXK A;  1MS3 A;  4WVM A;  5JVV A;  1GOF A;  1H4G A;  4FQ4 A;  3ZFF A;  1CAU A;  1GZW A;  1W6Q B;  4NOT A;  5DG2 A;  3NNG A;  2W1W A;  1FPN 2;  1NCR B;  1RUE 2;  1V9U 2;  2D44 A;  3U1X A;  3B9C A;  2VGD A;  4XFA A;  1PO2 1;  5KXB A;  4TTG A;  1OKQ A;  1A34 A;  4D69 A;  3MF6 A;  1JZ4 A;  1JZ8 A;  3H42 B;  4TXW A;  3MEP A;  1YI7 A;  1SBF A;  1W3V A;  3OPW A;  4GQ7 A;  4XVH A;  3SH4 A;  1LTE A;  3WQB A;  5ANN A;  3FN9 A;  3ZVX A;  5E8A A;  5A3U A;  4FQZ A;  3VZM A;  1ZZB A;  4RQP C;  5BYN A;  4XTP A;  3B01 A;  2P3J A;  1PNG A;  5C5T A;  2DYC A;  1JYW A;  3VKL A;  5DQ0 A;  4MSV A;  5IAV A;  1LHN A;  3APB A;  1CAX B;  4OMC A;  1UPI A;  3RJ2 X;  2DUO A;  3O1M A;  3OEB A;  1US2 A;  1ZZ6 A;  3NJX A;  1GZT A;  3DYM A;  5IK7 A;  1AYM 3;  1NT0 A;  2XUE A;  2PHD A;  3CHX A;  3NNM A;  3SIT A;  3VDD B;  3O12 A;  3BIE A;  1W03 A;  4MZU A;  5A6Z A;  4QKD A;  5FP8 A;  2YGM A;  1HJG A;  4COZ A;  4XMI A;  4NHK A;  4EV0 A;  1S0F A;  5AFB A;  3CF6 E;  2DBI A;  3TOJ A;  1UX6 A;  2G19 A;  3F2Z A;  2W47 A;  4KU8 A;  3DF0 A;  1LAJ A;  3WF3 A;  1D4V B;  2HKX A;  4FP2 A;  3WF2 A;  2IZW A;  2WFF 1;  1L7R A;  1LUL A;  2C24 A;  1DZR A;  3S30 A;  2HWB 1;  4YW3 A;  2WNV A;  1HN1 A;  1UZY A;  1SLI A;  2OQ6 A;  4H3W A;  2ARB A;  5JLV A;  2VVF A;  3O1U A;  2CGO A;  2A3W A;  5FYZ A;  5T5L A;  1B35 B;  2CSG A;  3ES1 A;  4R4Z A;  1XU1 A;  3VKF C;  5IVF A;  2WWS A;  1ZNP A;  4D3W A;  1KS5 A;  4FPO B;  4FOV A;  1UD1 A;  5JZG B;  5C8C B;  5F2W A;  4CUC A;  5G04 L;  2P2K A;  5KXC A;  2VOT A;  3M2M A;  1IS3 A;  1H9P A;  1ZZ9 A;  1N3P A;  5JXG A;  3O1P A;  5GJ6 A;  5EP9 A;  4JGY C;  5F37 A;  5BNN C;  5I91 A;  3THC A;  3IMM A;  2PTM A;  3Q8A A;  2IXK A;  5J09 A;  1S2E A;  3ZN6 B;  4B8E A;  4UF0 A;  4CUB A;  1JZ7 A;  4IV1 C;  1LGC A;  2ATF A;  3QH6 A;  1ZBA 3;  1RHI 3;  1SHW B;  4QB2 A;  1W6P A;  4M0N A;  2NLR A;  1TNF A;  1PIV 1;  1FOD 1;  4LMF A;  4Y1X A;  5H9R A;  4CEY C;  1H6Y A;  4AFB A;  2RS3 1;  5BXX A;  2DVB A;  1WKY A;  2GDF A;  2JD4 A;  1CZT A;  2WNE A;  3HBK A;  3BU7 A;  3GNE A;  4O65 A;  4QHB A;  4XIO A;  1XNC A;  1X9P A;  1G9D A;  3NKT A;  2ILM A;  5JR7 B;  4MH0 E;  1T2X A;  4UT5 A;  3EMR A;  2VAU A;  3LSD A;  1HRI 3;  3USS A;  2YY1 A;  3ZN5 A;  5AVA A;  4XOG A;  4TZD A;  1FNZ A;  1AL0 G;  1TG7 A;  2XQR A;  2ZGM A;  1Q5O A;  3GAL A;  2A3X A;  2XKO A;  1YWK A;  5FP9 A;  1ULF A;  4AFD A;  4CP9 A;  1DHK B;  4GH4 C;  1SCR A;  5A33 A;  5D1I A;  4CDW C;  1VJ2 A;  5J3U A;  2P5B A;  4MXV A;  3WNP A;  1DU3 D;  1QXJ A;  2DVD A;  1GWL A;  2B7Y A;  2JB8 A;  1DLL A;  1UZW A;  3DXT A;  1VRB A;  1A78 A;  1XE8 A;  5L9R A;  5JXI A;  1PK6 C;  1QKQ A;  2BQP A;  2BTV C;  4DQA A;  5AVP A;  2A6Z A;  4CCE A;  1JS9 A;  2VW1 A;  5LA1 A;  4AG4 A;  4YZ2 A;  3BTY A;  4OFG A;  2Q1M A;  2ZX2 A;  3R4S A;  2XOM A;  3AZW A;  1AL2 2;  2WQ4 A;  4UFJ A;  4LXL A;  4HKO A;  3ST7 A;  1IS5 A;  3PIJ A;  4GZ9 A;  4Y1U A;  4W6Y A;  4LT5 A;  1OVS A;  1XJA A;  4OI0 A;  4YW1 A;  3UJQ A;  2DUP A;  1UY0 A;  1ZVF A;  2P1B A;  4PLO A;  4JQT A;  1DQ4 A;  4P02 B;  1K5M A;  1R08 3;  3FFQ A;  4NAM A;  2CTV A;  1X50 A;  3K4A A;  5ACA 2;  2E31 A;  3POF A;  4K7J A;  1Y43 B;  3VD4 A;  2VMC A;  2QDN A;  4Q4W 2;  4IV3 B;  4V1P A;  4F83 A;  2EIG A;  1GKB A;  1JU3 A;  2Q4S A;  3CZJ A;  1AZD A;  5FMO S;  1JH5 A;  2BGO A;  1UF2 C;  2VNR A;  4NE9 A;  3I2H A;  2VMF A;  2B39 A;  4ATF A;  1GP6 A;  1GFF 2;  4OQ9 A;  2PHU A;  4YVS C;  1AYN 3;  1FV3 A;  1QJX 1;  4JQR A;  2B9U A;  2RV9 A;  2XJQ A;  3IKW A;  2JDU A;  3Q8F A;  2R30 A;  1OQD A;  3BPZ A;  2JG8 A;  2XJT A;  3P1I A;  5CNA A;  5GKA C;  2UY8 A;  3LGR A;  2QUO A;  1AVB A;  2JEM A;  5T54 A;  1RUC 1;  3MYX A;  4J6G A;  1E5I A;  1ENS A;  2LW8 A;  1LOA A;  4DRR A;  5EIY B;  3H8O A;  1H1M A;  3JB8 A;  2RS1 1;  4CCM A;  4BK4 A;  2CWS A;  3KQR A;  1PVC 2;  4LO6 B;  2ZAB A;  1DFQ A;  1GZC A;  2OKX A;  4A6O A;  4MG2 A;  2YC2 A;  1LGB A;  1RIR A;  2WRA A;  5BPX A;  5T55 A;  2WDB A;  3VL9 A;  5IVC A;  2R1B A;  3SLI A;  3J26 N;  3C7G A;  4KNC A;  3HD8 B;  4AGG A;  4LBJ A;  1JOP A;  5A6Y A;  4R9D A;  1QY4 A;  1GNH A;  2X8K A;  3H1M A;  5C4W B;  2VH9 A;  3AMQ A;  3ZYR A;  3RS6 A;  2VTX J;  2XQX A;  1AX1 A;  5E1R A;  5A3L A;  5BY5 A;  4D6S A;  2ZEZ A;  1WD4 A;  3Q8C A;  4LO5 B;  4HKL A;  5DAB A;  4BIF A;  4FBF A;  2ZKN A;  4F7Z A;  3OBT A;  2NMN A;  3ZR6 A;  1M06 G;  2N7G A;  4IES A;  4FPJ A;  3UGH A;  5FOJ B;  1W0N A;  1JYT A;  2ZZQ A;  1BBT 1;  1LOC A;  3IM0 A;  2NP0 A;  4J1W A;  4QPG A;  2LUW A;  2V72 A;  4FAG A;  3JBG 1;  3U11 A;  2H6C A;  1J1L A;  1TMF 3;  4F8A A;  2P3Y A;  1POV 1;  4QQH A;  3KT7 A;  5LK7 B;  4Y22 B;  4AGR A;  1X8M A;  2Q8O A;  5KHK A;  4JKK A;  1AR6 2;  4YVW A;  1ASJ 2;  1UKR A;  2PHR A;  2VW0 A;  1CD3 G;  1GMM A;  1GIC A;  1V6M A;  3RPQ A;  3NNL A;  4AHW A;  4UAP A;  2XBO 1;  3FHA A;  5KHG A;  4Q0S A;  4IER A;  2ZOE B;  3ZYB A;  2WUH A;  3CJI C;  3KCY A;  3MLL A;  5KXE A;  2BZD A;  3MIF A;  2P4E A;  1Z7S 2;  2ZTN A;  1RXG A;  4FOY A;  2GAL A;  4NHM A;  2HWE 3;  5L9B A;  3WCS A;  4CUG A;  4E8C A;  1OLM A;  3TYJ A;  1ZRF A;  3VBS C;  4Q4X 3;  1H8T B;  3I59 B;  2VQT A;  1MS5 A;  4JGZ B;  1EP0 A;  4WVZ A;  4HG6 B;  4XAC A;  3ZSM A;  4D6Q A;  1K42 A;  1J1T A;  1PGW 1;  2WN3 A;  1CVN A;  1F15 A;  3UV9 A;  3VBH A;  2XJP A;  2XWJ B;  3BKZ A;  1OOP B;  1RGS A;  1UYZ A;  2J7M A;  5AFE A;  2RMU 3;  5F5C A;  3W20 A;  1SLT A;  3IDE A;  4A2U A;  4PIY A;  3OYW B;  3PUA A;  1MQT C;  5LBB A;  1IPS A;  1JYV A;  3M3I A;  3BIW E;  5LAT A;  4BLI A;  2Z5W A;  3DYP A;  4DXR A;  1XSR A;  4FXG B;  2WII B;  3C2U A;  4QPW A;  4N43 B;  2JE7 A;  1UCX A;  2R07 1;  5F5I A;  4D7Y A;  5ABJ A;  1S0G A;  5C6C A;  1DGW X;  1HRV 2;  2LAL A;  4ARX A;  3VBF A;  2R0F A;  1WBF A;  3ILF A;  3HN1 A;  3NJY A;  4RS5 A;  5F5A A;  1NAE A;  3J9S A;  4IEO A;  1WUV A;  2MPF A;  2ZEX A;  3VKO A;  2ADD A;  1XXN A;  3M3C A;  1DYP A;  4LKE A;  3FE5 A;  1RUF 3;  5CFD A;  4YRD A;  5J7M A;  2KR2 A;  1EUT A;  2V73 A;  5FO7 B;  1DQ6 A;  3K3O A;  1NLS A;  3KT4 A;  4QQL A;  2RDR A;  1W04 A;  1QH7 A;  5FPB A;  3AK0 A;  2VZ3 A;  5CKM A;  2BBA A;  1VMJ A;  1YXW A;  2WS9 3;  4ISQ A;  1AYM 2;  1D4M 3;  1QNY A;  1H2L A;  1L7L A;  4O7X A;  2IWG B;  4Z2A A;  5CFC A;  3O1O A;  1ZRD A;  4Y20 B;  2FDK A;  4Z92 B;  3BCW A;  4PHZ A;  4Q4Y 3;  4AW7 A;  2VNG A;  4NHL A;  1UYX A;  3WG4 A;  1GZ9 A;  1OLR A;  5FP4 A;  1K45 A;  5F2S A;  4BQW A;  4NRO A;  3T0A A;  1C8M 3;  5A7P A;  1H1A A;  1EV1 3;  1NCR C;  1I5P A;  2VD7 A;  1YNA A;  2VE1 A;  3A4U A;  3AZY A;  4CCD A;  1QXP A;  2I2S A;  1GOG A;  3UNP A;  3ETP A;  1TME 3;  1PO1 3;  3I3D A;  4N53 A;  3VKM A;  1JI6 A;  3I2F A;  2VJX A;  2WNU A;  5FIX A;  3SCH A;  1ZRE A;  5LEJ A;  2JDM A;  3AZX A;  2FD8 A;  5LRS A;  4NRM A;  1R09 3;  1U5I A;  2A71 A;  2FCU A;  3POW A;  3AM2 A;  1AJK A;  2AC1 A;  4AE2 A;  1RVF 2;  1VBA 3;  2UWB A;  1GWM A;  3B7M A;  3IWZ A;  3M70 A;  1COV 3;  2RR1 2;  1CR7 A;  2XLG A;  2R32 A;  3P6B A;  4XXP A;  4COV A;  3PL0 A;  1QHD A;  2QE3 A;  4UWD A;  4H55 A;  4XHB A;  3A0N A;  5A7W B;  1D0H A;  1ZBA 2;  1QJU 1;  5FZO B;  2ZZJ A;  1C57 A;  4GUL A;  3ETQ A;  4XAB A;  3FBM A;  3VDD C;  3LA7 A;  4MGK E;  4XUN A;  3WNK A;  1PMI A;  3WVJ A;  3VBR C;  4FVV A;  5FMC A;  2I07 B;  3PU3 A;  5JMC A;  3ZMO A;  3NST A;  3PIG A;  4XF4 A;  4NO4 A;  5T3N A;  4J25 A;  3LOI A;  3FWE A;  1I6X A;  2P6C A;  3HAG A;  4KWK A;  5J1X A;  2E26 A;  2Z69 A;  1RUI 1;  2XH6 A;  5KR7 A;  5LCW L;  1UWW A;  1V6N A;  1XYN A;  1N47 A;  2GN3 A;  2RG4 A;  3AL6 A;  3J8F 2;  5HBA A;  2XHN A;  5JIA A;  4CSW A;  1B35 C;  1NCQ A;  2WWJ A;  3E97 A;  1BLZ A;  1V6O A;  3UGG A;  2ARX A;  3OEA A;  5JZG C;  1UY3 A;  1F31 A;  1HXS 3;  3H9A A;  2YB7 A;  3J4U H;  2KA3 A;  3OUI A;  3NAP B;  3VBU C;  2O14 A;  3LEK A;  1X8E A;  1UOB A;  1ENQ A;  1V0A A;  2CAV A;  1HB2 A;  4XF0 A;  4QPI B;  3ALQ A;  4YW6 A;  3SCF A;  3JZV A;  5J98 B;  1WGP A;  2ZKL A;  4Y33 A;  1FPN 3;  1YFU A;  3RG0 A;  4CVU A;  2X5I B;  5A7N A;  4YLZ A;  4UFH A;  3G6J B;  4NMI A;  1RUE 3;  2EXH A;  1E5H A;  1V9U 3;  3VV1 A;  1LR5 A;  2VZO A;  4CZS A;  5C5U A;  1LJ7 A;  5EQU A;  1I9R A;  3H3Z A;  4Q0P A;  5HXM A;  2P37 A;  3I2I A;  1R08 2;  3WHU A;  5FY7 A;  2AEN A;  1KFU L;  4Y1V A;  4QX3 A;  2RJK A;  4CXY A;  4HOO A;  2HWD 1;  2R04 2;  2Q8C A;  4FPK A;  4K21 A;  1US3 A;  4CU9 A;  2J1S A;  3LPF A;  3DUI A;  3I2K A;  4QX5 A;  4R9B A;  5CG8 A;  5FZ9 A;  4QPY A;  4NIH A;  1AR8 2;  3ZKU A;  4IEZ A;  4B7E A;  2R6Q A;  2RDQ A;  1RUH 2;  1UZZ A;  3W58 A;  4E4D X;  4A45 A;  2RHP A;  2VQU A;  4XZU G;  2FMD A;  1FMD 2;  3QLQ A;  4LJH A;  1AYN 2;  2FBE A;  3U10 A;  1NXD 1;  3PJQ A;  5FZ4 A;  5FMB A;  4DUX A;  1F5J A;  1WWY A;  3OY8 A;  5FP7 A;  1C5H A;  2Y6K A;  5F39 A;  5A32 A;  2YYO A;  1KJL A;  1WMF A;  4CXX A;  3WQ0 A;  5GLT A;  1PGL 1;  1VRH 1;  4MXW A;  4W4Z A;  4Y1Y A;  1L7Q A;  3WF4 A;  2GN7 A;  1YIF A;  4QGN A;  1XE0 A;  1QOS A;  5DG1 A;  2D6K A;  2YFU A;  3IT8 A;  4AHZ A;  5JPN B;  1ULP A;  2EAA A;  3MW3 A;  1K12 A;  4QDQ A;  5LW9 A;  1RTV A;  3VKN A;  2PN5 A;  4R9C A;  1NG0 A;  2H0V A;  5JI7 A;  1SPP B;  1OD3 A;  3NW4 A;  4U2A A;  2FDJ A;  1AL2 1;  4WBB A;  2Z79 A;  1PGS A;  1W6M B;  1UMH A;  4OUL A;  4LE4 A;  5GLW A;  3QD6 A;  5EYX A;  3Q8B A;  4YZ3 A;  2YMZ A;  3UKN A;  1OUR A;  2JDH A;  2JDN A;  4K6B A;  1W9Y A;  2VTX A;  4IV3 C;  2WZE A;  4YW2 A;  1ND2 A;  3S57 A;  3IPV B;  5FXZ A;  3K48 A;  1SBE A;  2D6M A;  3ME2 A;  1NLR A;  4PQQ A;  1OA2 A;  3PMS A;  4HN1 A;  4LHS A;  3RMY A;  1ENR A;  2VMG A;  3AYE A;  4WM7 B;  5LBC A;  2YU2 A;  4FXK B;  2J22 A;  1SLA A;  1IG0 A;  1MR5 A;  3BTA A;  2G9F A;  5I93 A;  4OHZ A;  5KC6 A;  2YGL A;  2OX0 A;  4IDZ A;  5D8A B;  1PM7 A;  1TMF 2;  4R4X A;  3RDI A;  3D8C A;  4LBQ B;  2XVG A;  3WP3 A;  2ZGU A;  2RS5 2;  2WJS A;  1OA3 A;  4M3C B;  4IEV A;  3RVH A;  1LU1 A;  1L3J A;  3PVO A;  1I1E A;  1NQJ A;  2QQI A;  5F6L B;  3RQ0 A;  4TSV A;  3BGA A;  1XC6 A;  3PHM A;  3I3Q A;  3MW4 A;  2A1X A;  4Q29 A;  2GND A;  2ZS6 B;  1VAM A;  3ZO0 B;  2VOK A;  5A1L A;  3WDU A;  3VD3 A;  3UKV A;  2W46 A;  2ES3 A;  5GAL A;  1DG6 A;  5FBJ A;  2BFU L;  3N7K A;  5EJ1 B;  4DEQ A;  2EIB A;  4IL7 A;  3NKG A;  2VR4 A;  3VZO A;  5IVV A;  1W06 A;  2ZGO A;  3C7H A;  4L92 A;  4QMA A;  4HT1 T;  5FZ6 A;  3GDB A;  4LHL A;  5GM0 A;  4Q4X 2;  4N8M A;  3U0Z A;  1TQ5 A;  5C4W C;  4OI1 A;  1MEC 2;  1CZV A;  4QDR A;  4ASM B;  1WW5 A;  5EJZ B;  5L9V A;  4QXK A;  2VQA A;  1V6K A;  4RL7 A;  4XDQ A;  4E27 A;  4E4S A;  1FXZ A;  2VW2 A;  2JE9 A;  3AYD A;  2VUJ A;  4LLO A;  3T1L A;  1KGY A;  4Q4V 1;  1H6X A;  2A3Y A;  5A3W A;  4RR3 B;  4AF9 A;  4AQT A;  5CKN A;  1CAW B;  3O1R A;  3I49 A;  2FDG A;  4QXB A;  3A7Q A;  3LA3 A;  3ZN4 A;  3M8L A;  4GWI A;  4CUA A;  2WC2 A;  4ZXE A;  4FI9 A;  1CAV A;  1ULO A;  1EAH 3;  4XCB A;  3FX3 A;  1RUG 1;  1C3H A;  1BEV 1;  2EXI A;  1SLB A;  5FR3 A;  3N7L A;  3TN9 2;  5K0U B;  3GZU C;  5L7O A;  5D21 A;  2Y6H A;  4ZU4 A;  1YQC A;  4DXT A;  5DAW A;  1J3P A;  1YI9 A;  4KG8 A;  5FZ0 A;  3OB8 A;  4AEM A;  5LA9 A;  4LTA A;  3U75 A;  4KL1 A;  4Q4W 3;  3NV3 A;  2DTW A;  1MZE A;  4GD4 A;  2WZR 1;  1RUF 2;  3ACH A;  3C7E A;  2G9G A;  4OHX A;  4ZON A;  1RL3 A;  3PUS A;  1KFX L;  1RUJ 3;  1ND3 B;  2IVI B;  2UWC A;  4LOS A;  5IUQ A;  3RI9 A;  1ASJ 1;  2GSY A;  3BUC A;  2R7E B;  2VUA A;  1WW6 A;  1LU2 A;  2K9Z A;  3WDT A;  3MID A;  3U4X A;  4P9W A;  3E6D A;  1JMU B;  2Z42 A;  3G7D A;  1Q56 A;  4XUQ A;  5A7S A;  1H8T C;  4BYY A;  1OXC A;  4JGZ C;  4KWJ A;  4G9S B;  1RUD 2;  3H7J A;  3OOX A;  1F8V A;  1X33 A;  2ZMN A;  2IXI A;  1OOP C;  3ZPO A;  1UQX A;  2QFE A;  3A23 A;  4P08 A;  4E2S A;  4XUR A;  4C8D A;  2V4V A;  1C8M 2;  1G7Y A;  4BQ1 A;  1EV1 2;  1BCX A;  3KV9 A;  2HH9 A;  1MVQ A;  5FYI A;  4MVT A;  4CDQ B;  4URA A;  4N43 C;  1UY1 A;  1F4H A;  1PVC 3;  2DUQ A;  2OS2 A;  2XVK A;  4KI5 M;  5T5J A;  4BXS V;  3IIA A;  1OLQ A;  4E4H A;  3WNL A;  4LLF A;  4AQ2 A;  1EYB A;  1GU3 A;  2A70 A;  3MIG A;  1R09 2;  4PI2 A;  4DFS A;  3B9I A;  4ZZ8 A;  1NZI A;  2QZ3 A;  5F1R A;  2C9A A;  3JCI A;  2VZU A;  3HEI A;  4NIA A;  2VEC A;  3FHQ A;  5J48 A;  5EZW A;  1W8N A;  2W87 A;  4UW3 A;  1BMV 2;  1BZW A;  4XJA A;  5T5P A;  1O3Q A;  2WN2 A;  4LBO A;  3NL1 A;  2WO1 A;  1LOG A;  2A6Y A;  3AKP A;  4XAA A;  3BOP A;  3DGT A;  1LB2 A;  1ZRR A;  4EWE A;  2IUW A;  5DUX A;  1C28 A;  1J84 A;  3OGR A;  1O4Z A;  4ORF A;  1O3T A;  5BUV A;  1XNA A;  2AR6 A;  5EPA A;  2W95 A;  1DGR N;  2X53 S;  2HWF 2;  3K46 A;  4LO8 A;  1UZ0 A;  5C7G A;  1AYM 1;  1HW5 A;  3AYC A;  2F6B A;  4QKF A;  1SFP A;  2A5Z A;  1GQG A;  1S0B A;  1AR6 3;  1VIW B;  2Q0A A;  5C71 A;  4I01 A;  4TN7 A;  3BOW A;  3NWK A;  1IKQ A;  1DP0 A;  2BNO A;  4IEQ A;  3I2D A;  5KBF A;  3WG1 A;  1AF9 A;  1ST8 A;  4OMD A;  4XUO A;  1SFY A;  1WW7 A;  3DPR A;  3BYW A;  1U5Z A;  2SLI A;  5F9T A;  2OZ6 A;  3VBR A;  4FFI A;  1PVX A;  2A6W A;  4JHT A;  4BU2 A;  1HIX A;  1F4A A;  2HWC 3;  3MFC A;  3MDP A;  1OA4 A;  5LBF A;  4YZ1 A;  2V5Y A;  5FY5 A;  2CNA A;  1CWP A;  4C0B A;  5CIR A;  5FYY A;  4B29 A;  2XJR A;  1NY7 1;  5DN2 A;  2D6P A;  2QNK A;  4XJ8 A;  3MFA A;  3KGZ A;  3W21 A;  2ET7 A;  5I0D A;  4BQX A;  2E63 A;  3DV8 A;  4RHV 3;  4FFH A;  5A3T A;  4MGY E;  4WM8 C;  3ZXL A;  1SMV A;  4V2V A;  3ZXE A;  5IVE A;  3VHN A;  1PZ7 A;  3BPS A;  3LA2 A;  1R64 A;  2HEY F;  3N9Q A;  4A7Y A;  1CN1 A;  1YFY A;  1XRU A;  3VBU A;  1DLC A;  3WXP A;  4URT A;  3RZM A;  1ONA A;  1HRV 3;  1ZBA 1;  1RHI 1;  1S4C A;  1WCQ A;  1VBB 3;  5HCH A;  3O0X A;  2E7Q A;  4MX3 A;  4P9L A;  1RUO A;  2VCA A;  2JIG A;  3I3E A;  1WZX A;  5HV4 A;  3O1S A;  3DL3 A;  2Y64 A;  4D94 A;  4K8F A;  3USU A;  4OCT A;  1REF A;  2WAA A;  1JZ3 A;  1QU0 A;  3GYD A;  1XPW A;  5BNP B;  4QM9 A;  5FZ7 A;  3OJB A;  4K1Y A;  4Z07 A;  4RGG A;  4FOW A;  4Y26 A;  2AUY A;  2Y26 A;  3ZSK A;  4YZ5 A;  1HRI 1;  3QH7 A;  4GB3 3;  4MOA A;  3WDY A;  4UXA A;  1UOF A;  1JZ5 A;  4QWN A;  5KHJ A;  1Q8P A;  2ORZ A;  1W8W A;  1UU6 A;  4YZ4 A;  1D2Q A;  1CIY A;  5GZE A;  3CL1 A;  1OD5 A;  4K3U A;  4GKY A;  3B3Q E;  1AHS A;  1AJO A;  3FHI B;  3T3Y A;  3ZSJ A;  3QCW A;  4B4P A;  1EY2 A;  1XYP A;  4BQ4 A;  1KXG A;  2DCT A;  3ZX7 A;  2VOW A;  1PZ8 A;  2VNO A;  3E5U A;  1KEX A;  2CDO A;  4XJW A;  3CQO A;  1EUU A;  1LOF C;  4XYX A;  3OGG A;  4YW7 A;  3TEW A;  4QPI C;  5DUU A;  4FTB A;  1OLM E;  4K20 A;  5EV7 A;  5FYS A;  2EXK A;  3NJV A;  3ZIW A;  1GR3 A;  2X5I C;  2AYH A;  1JW6 A;  2Y8K A;  4LR4 A;  3ACG A;  4AED A;  3SEE A;  1HQW A;  4KGG A;  2QQU A;  3VHP A;  2QZ2 A;  2ZML A;  3LIH A;  2VZQ A;  3CJX A;  1R08 1;  4JDO A;  3ZLI A;  1W6N B;  2UY9 A;  3L2Y A;  1W6O A;  2EXJ A;  4OZO A;  2CAU A;  1HV0 A;  1E5R A;  1RVF 3;  4HPK B;  4CXW A;  1VAK A;  4HK9 A;  2ID4 A;  1O59 A;  3LSE A;  3PLQ A;  3QAC A;  2WSV A;  5FPZ A;  5I0T A;  2P6H A;  4A44 A;  2RR1 3;  5JOZ A;  1QJZ A;  5LY2 A;  1UX7 A;  3E6C C;  3S7I A;  1QQP 2;  3H1Y A;  3MIB A;  4Q5O A;  5EJ3 A;  3UES A;  4CEW B;  4JV4 A;  3V0A B;  3MIC A;  4JVA A;  4WVM B;  1CZS A;  2VVD A;  3N9P A;  4UFI A;  5BV6 A;  3ZFF B;  3BI3 A;  1CAU B;  1GZW B;  4P9Y A;  1LEN A;  2BU9 A;  3Q9O A;  4Y4R A;  5FZL A;  3VZK A;  2ADE A;  3AKQ A;  4TLG A;  3ZYH A;  3ZYJ B;  4CDX A;  4LEJ A;  4M4R A;  1VE0 A;  1XNT A;  2Y60 A;  2BOI A;  3LFM A;  1RMU 1;  3V56 A;  1LGN A;  3EYP A;  2OQ7 A;  3GJB A;  2WT0 A;  4MGT A;  1CX4 A;  3UT0 A;  2Y34 A;  1IOA A;  1NA1 A;  2B45 X;  2JG9 A;  1N1S A;  4AXO A;  3JU9 A;  4K40 A;  2DVG A;  4QX7 A;  4LKS A;  2DWR A;  3DN7 A;  1OUS A;  4ES9 A;  4CYD A;  3J8F 3;  3R4U A;  1GAN A;  3NMB A;  1UXX X;  2UYA A;  3WP5 A;  4UBG A;  2VC9 A;  2R06 3;  1SFN A;  3C7O A;  4RSU A;  4XFI A;  5T5O A;  2WQ8 A;  5AC9 3;  3HWJ A;  1QOT A;  2OUH A;  4FPC A;  2PHF A;  3M3O A;  5CYY A;  3DCQ A;  4QKB A;  3S5A A;  1SG3 A;  4FP3 A;  2XON A;  1QJY 2;  3GBW A;  2QJV A;  2HEW F;  2QTW B;  3TB0 A;  1UU4 A;  4WM7 C;  5F5Q A;  2D93 A;  4AR2 A;  3VDB A;  2VCB A;  1WLW A;  2TNF A;  5EHD A;  3ZFE A;  4KBB A;  1EAH 2;  5FLJ A;  3TEX A;  4UBH A;  2A6V A;  3AZZ A;  3D4K A;  4ZS2 A;  2BOJ A;  3WNN A;  2ZHM A;  1TEI A;  5F3C A;  2FDH A;  2BER A;  2QQM A;  1S2K A;  2VME A;  4JCK A;  5FPV A;  2WNV B;  1IQA A;  3KD4 A;  2ZHL A;  2R04 3;  2VBD A;  4IE6 A;  5JAX A;  3CDZ B;  4A7K A;  1TMF 1;  4PDW A;  2D43 A;  5HCB A;  4HVR A;  3ZSE A;  2KM2 A;  2PAM A;  1IS6 A;  4OHW A;  4XF1 A;  1RUJ 2;  4QAW A;  1U12 A;  3AMP A;  3H8R A;  3WSO A;  1AR8 3;  1CQ9 A;  1FYU A;  3UK9 A;  2ARA A;  1W9W A;  2GNT A;  3ZYG A;  1RUH 3;  4IXL A;  3GBF A;  1VB4 A;  3VZN A;  5FZH A;  2Z4F A;  3TEY A;  4XJZ A;  5FJH A;  2EIC A;  3I97 A;  4LHK A;  1FMD 3;  3VZJ A;  3W9A A;  4C1W A;  1KIT A;  1XU2 A;  3RWK X;  2P17 A;  3D5O A;  2HWE 1;  4UF0 B;  4WZC A;  4GJY A;  4PJY A;  3WZ1 A;  4Q4X 1;  4B1L A;  1W6P B;  2VPV A;  5C9A C;  3IAP A;  1W2A X;  1X7N A;  1O8P A;  4JC1 A;  4RR3 C;  5H9S A;  4CDU A;  1VBD 2;  1XOY A;  1XB9 A;  2XKP A;  4NAO A;  4YM2 A;  1F5F A;  1W99 A;  1KQR A;  2RMU 1;  1ULD A;  3WG3 A;  4AI8 A;  4N9H A;  3WUC A;  1POQ A;  2EF6 A;  4BB3 A;  3I4I A;  1PIV 3;  2BNM A;  5K8S A;  2D97 A;  2PQQ A;  4BOW A;  4E4Z A;  4LK6 A;  3D6E A;  1YQ2 A;  5K0U C;  3MGU A;  1REE A;  4Q0U A;  3KF3 A;  1KDK A;  2WT2 A;  4PLM A;  5F3I A;  1OT5 A;  1URX A;  4M3C E;  4EWD A;  2X05 A;  2BBV A;  4EN7 B;  4OI2 A;  4PBO A;  3TNP B;  4CP9 B;  5A33 B;  3PVE A;  4ONU A;  4Z82 A;  2ZXQ A;  4R8H A;  3AKR A;  5IVJ A;  1BYH A;  2VBP A;  1ND3 C;  4Q1R A;  2HBT A;  1RUF 1;  1GUI A;  1VP6 A;  2VCC A;  5IJR A;  1UZV A;  2JD9 A;  3BVC A;  4RGA A;  4CP2 A;  3AMN A;  1Q8Q A;  5GZD A;  2K0G A;  1E5S A;  1Y9Q A;  2RDN A;  3MW2 A;  2WO2 A;  5IFP A;  3ZSL A;  2WS9 1;  1YCI A;  1FV2 A;  1D4M 1;  4C0H A;  2RS5 3;  2CGP A;  4RA0 A;  3PUI A;  4EN0 A;  1SCS A;  3SH5 A;  3T09 A;  3VUO A;  2JEN A;  1K5M B;  4XFF A;  2PEL A;  4Q4Y 1;  2DV9 A;  4BA6 A;  1APN A;  1CIW A;  2YHJ A;  1AX2 A;  5E16 A;  4CDQ C;  1C8M 1;  1IGO A;  4SBV A;  1C1F A;  3VN4 A;  3WNO A;  1FAY A;  1EV1 1;  2WBK A;  2HWC 2;  1IG3 A;  1XSQ A;  3IAQ A;  2NZ9 A;  3JQX A;  3EJK A;  1TME 1;  1PO1 1;  4QHZ A;  5A80 A;  1MEC 3;  4Y4Y A;  4QM8 A;  5SV8 A;  2PHX A;  2ZGP A;  3WT3 A;  4TLF A;  3ZFG A;  4AFA A;  2NQY A;  5C3R A;  3I3B A;  1R09 1;  3FUO A;  4C90 A;  3PTR B;  1OKO A;  4P9G A;  3HNB M;  4RHV 2;  4TYS A;  4FFF A;  1VBA 1;  1YUD A;  2DCK A;  2WR9 A;  4FO9 A;  4GWJ A;  2DUR A;  2E32 A;  1COV 1;  1HJF A;  1Q3E A;  3E6B A;  4MET A;  1W8F A;  2JG8 B;  5F32 A;  5IFT A;  3VBO A;  2BW8 A;  1VBE 3;  4MGS A;  4XAE A;  4XIL A;  2WAB A;  3KS7 A;  1GYK A;  2G1M A;  3GHM A;  4L9B A;  3TN9 3;  3ZMN A;  5FPX A;  4UOJ A;  3WW4 A;  1VBB 2;  2GNM A;  1AR9 2;  1SAC A;  4QX2 A;  3H0O A;  4E8D A;  4NRP A;  1SDD B;  5KC5 A;  3T0B A;  1DZT A;  1UYY A;  4WM8 A;  2XUM A;  2VU9 A;  4JTO A;  1JUI A;  3ZXD A;  1CJP A;  3PU8 A;  4H2A A;  3V0B A;  2E6V A;  2JIJ A;  3WR0 A;  5LWB A;  1ZX5 A;  4XJ9 A;  1AUY A;  5LBE A;  2ZJC A;  4XE9 A;  4IEW A;  4FSJ A;  1Q43 A;  1FAT A;  3HT1 A;  3AZV A;  4CE8 A;  4Z8B A;  3C7F A;  4ASL A;  2ZAA A;  4GB3 2;  3PUH A;  3VD7 A;  2WLP A;  4NUB A;  4Y5Z 0;  4I2O A;  2OPK A;  4LBL A;  4EN8 B;  4GAZ A;  5A3M A;  4RQP A;  5FY0 A;  2X09 A;  1SLC A;  2XL9 A;  4RN5 A;  4C1X A;  1RUD 3;  4MGI E;  3GBG A;  2CWM A;  4I3P A;  4B1M A;  1WCD J;  1WCU A;  4HN0 A;  2ZA9 A;  2HEV F;  4QPG B;  4B7K A;  4AAX A;  1HXS 1;  5KHH A;  4NN0 A;  4D8M A;  1DIW A;  4Q1P A;  4YWA A;  3T30 A;  3ZR5 A;  2XGX A;  4XZP A;  3SKV A;  3JD7 3;  3WLU A;  4XBQ A;  5GZG A;  5IK8 A;  5FZG A;  4ZY9 A;  2ZGT A;  1MS0 A;  2W08 A;  4YVW B;  4KU7 A;  1FPN 1;  4P14 A;  1QF3 A;  2ZPX A;  4UW5 A;  1NUK A;  1RUE 1;  2LRO A;  2YXS A;  1V9U 1;  1RJ7 A;  1LHV A;  3B02 A;  3TAY A;  5DDJ 2;  2VOV A;  3T4H B;  3FLR A;  3WCR A;  3KQ4 B;  4QX0 A;  4D7T A;  5JUV A;  1HV1 A;  1UY4 A;  4YAR A;  2F17 A;  1CPN A;  3BOD A;  2CL2 A;  2JDK A;  1N1V A;  4L2N A;  1GNY A;  5BNP C;  1JOJ A;  1N3O A;  1NXM A;  1R1A 2;  3POI A;  3OD4 A;  1O3R A;  4QKN A;  5HI0 A;  4XXA A;  3LPG A;  2BGP A;  2LS6 A;  3VBH B;  1XNB A;  1LOE A;  3WP4 A;  3PME A;  5JSO A;  3HOB A;  4AVT A;  3OPT A;  1ZRI A;  2R1D A;  4AEK A;  2PA7 A;  4LUK A;  5I8S A;  5E89 A;  1IZ3 A;  4YGD A;  1W2O A;  4Q26 A;  2HWF 3;  4N7U A;  3J7H A;  3PDQ A;  1RYY A;  2A6X A;  4BZ4 A;  4JGY A;  2MEV 2;  1S0J A;  4GMP 3;  5BNN A;  2WO7 A;  3HJR A;  5CIS A;  4NJ4 A;  4FPG A;  2ZX0 A;  4OYU A;  5C3Q A;  4Y3O A;  5ABJ B;  4PIX A;  3UKT A;  3OG2 A;  4IV1 A;  5LZ6 A;  5KHI A;  3VBF B;  1UXZ A;  4HET A;  1G9A A;  2DDU A;  4RS5 B;  2CY6 A;  4CEY A;  1PO2 2;  2W0X A;  4BIO A;  1QJF A;  4OLL A;  1ODM A;  1ALY A;  1JOD A;  4YYO A;  5CFD B;  5IAT A;  3IN9 A;  2R06 2;  1T6G C;  3C8X A;  5AC9 2;  4Z2W A;  1H4H A;  1VAL A;  2V4A A;  2H0B A;  5FRE A;  1LNS A;  4OVE A;  2JJ6 A;  4N90 A;  1UOG A;  3RWN A;  1H0B A;  5DAQ A;  3THT A;  5SV5 A;  1JTZ X;  4MGZ E;  5F6K A;  3WDW A;  4D0Q A;  4FAH A;  4GH4 A;  5CFC B;  4XFC A;  3SHR A;  2GMM A;  4CDW A;  3IB3 A;  5IYY A;  2E7A A;  1DGW A;  1JYC A;  5FYV A;  2ORX A;  5JXJ A;  3TRS B;  5HCA A;  5DAV A;  3AVS A;  3CZU A;  4LOR A;  1LEM A;  1PK6 A;  3ZFF C;  3ORJ A;  1GQH A;  3TBD A;  5FQ0 A;  3DEC A;  5B2G B;  3AL5 A;  3RJR A;  3K51 A;  2WLQ A;  3WX5 A;  4I30 A;  2VBB A;  2W94 A;  1LHW A;  3M1H A;  4N53 B;  1OPO A;  1YJL A;  4W6X A;  1UO9 A;  2WNU B;  4YGE A;  1ACC A;  1HQN A;  4M01 A;  2HWB 2;  3VGI A;  1OUX A;  2ZGK A;  1W9T A;  3KM5 A;  3KV5 A;  3E1F 1;  3AP4 A;  4C91 A;  3EBR A;  4RGK A;  2QQP A;  2WAO A;  4HK8 A;  1OFS A;  2Q5T A;  2VO5 A;  2JIC A;  4CA9 A;  4CU6 A;  4P5H A;  1YRZ A;  4I02 A;  4BE3 A;  2D5H A;  2D6O X;  2XHK A;  3I7D A;  5I0S A;  2QQN A;  1JBC A;  5FPU A;  4NPR A;  4QB6 A;  5FCC A;  2Y6L A;  1V70 A;  2BGC A;  1QXR A;  2HJI A;  3GM8 A;  3HBZ A;  5FJK A;  5IK4 A;  5FK8 A;  1JU4 A;  1ODN A;  2QQV A;  1UMI A;  2FCT A;  3MHZ A;  4G3Y C;  4B4R A;  1LRH A;  3WIN E;  1NOV A;  5FK7 A;  3PJY A;  4JRA A;  4NHX A;  2WYF A;  3WW2 A;  4BWO A;  3WDV A;  1ULG A;  4YVS A;  2GC0 A;  3LEG A;  2D6N A;  2GNB A;  2JXA A;  4XBL A;  2OYZ A;  3RZZ A;  3RMX A;  1PIV 2;  1J3Q A;  1BK0 A;  1FOD 2;  1BJQ A;  2C6S A;  3GHN A;  1O5L A;  2EAL A;  4KGQ A;  2X29 A;  5EYY A;  2RS3 2;  4LKD A;  5A6X A;  1AXY A;  4O9G A;  1EAH 1;  4QT6 A;  3T1M A;  1A6C A;  1WMX A;  2WNV C;  4MHR A;  3CEW A;  3GXU A;  1GQP A;  4KQ7 A;  5JMO A;  3A22 A;  5ACA 1;  3URF A;  2YV8 A;  5ISL A;  5CB7 A;  1SDW A;  1TVG A;  3A0K A;  1BKZ A;  1K5J A;  1QEX A;  1NCQ B;  1RJ8 A;  3K3N A;  2B5H A;  4DY3 A;  2QKD A;  4Q4W 1;  5EXO A;  1H1I A;  1OBN A;  1PX3 A;  4I3G A;  5LY1 A;  2SBA A;  2W1S A;  3EHK A;  3EXU A;  4Y24 A;  3MUZ 1;  1N1Y A;  1QQP 3;  1RUJ 1;  1W8O A;  2UU8 A;  4KMQ A;  5BNO C;  1NZC A;  3N9M A;  3NVC A;  1VLN A;  3WEZ A;  1G9F A;  3HNY M;  4I09 A;  3WHT A;  3N35 A;  3RZJ A;  3FLT A;  4LKF A;  4XPV A;  5H9P A;  4J1X A;  3HN3 A;  2WYS A;  4HKW A;  3OPZ A;  1Q8V A;  4QHO A;  5C9A B;  2DF7 A;  4FPE A;  2C4X A;  2JB4 A;  3WP6 A;  3I2G A;  3V64 A;  4JHZ A;  5F3G A;  2D5F A;  2BUK A;  3B94 A;  3IMN A;  4D6R A;  5FPL A;  4WV8 A;  4BMB A;  1VBC 3;  3L2H A;  3L9J T;  3WW3 A;  1AXZ A;  3GCX A;  3M3Q A;  2GC1 A;  2GMP A;  4HL0 A;  3ZXK A;  3A21 A;  4LPL A;  1OQ1 A;  4Z1V A;  1PVC 1;  1W28 A;  5L73 A;  3AC0 A;  1N3Q A;  4V2W A;  2BFU S;  4BH9 A;  2GH8 A;  3H3U A;  1ZA4 A;  3KVA A;  4CCL A;  4XEZ A;  3ZIX A;  1QJY 3;  4NVP A;  1UOJ A;  3CJI A;  4L0P A;  2Y6F A;  1I3H A;  3GZA A;  1W0P A;  3LEM A;  4OUE A;  2O0O A;  1C1L A;  2XML A;  3OY8 B;  5A32 B;  3T2P A;  5BNO A;  2R16 A;  3CNA A;  2XPJ A;  1H2K A;  4MXW B;  1X36 A;  3AP7 A;  3VBS A;  4OUM A;  3JB4 C;  1VBE 2;  3NO8 A;  1CJD A;  2CGN A;  1JUH A;  3K2O A;  1NE6 A;  4HMZ A;  1IQD C;  4XTM A;  3FBY A;  4IUG A;  2J42 A;  1J83 A;  4MGQ A;  1CES A;  5F7U A;  1YFX A;  4HSJ A;  2Y6G A;  3WUD A;  2AZ5 A;  1MQT A;  2GZW A;  2XXZ A;  3AX4 A;  2WA4 A;  4E2G A;  1RUC 2;  4OI4 A;  3R05 A;  4GJZ A;  4CU7 A;  5C70 A;  1K5M C;  3PTY A;  3CMG A;  1S1A A;  2RS1 2;  1QWR A;  2Q1F A;  1R1Z A;  4H7M A;  1AR6 1;  4P00 B;  4JRL A;  3ZXJ A;  1WLC A;  2ZBJ A;  2G4I A;  1ND2 B;  1DQ5 A;  1KD7 A;  3AXE A;  5A70 A;  3H1W A;  1IKP A;  4XDP A;  2YPJ A;  4QQP A;  2J1T A;  3K75 B;  4ZU5 A;  3OBR A;  1Y7B A;  4ZKT B;  2HWC 1;  1Z7S 1;  5FV3 A;  2XLA A;  2ZGS A;  3T2O A;  1DYO A;  4CTE A;  1O8S A;  2Y0O A;  2W39 A;  1ENX A;  4PLN A;  1VBD 3;  1J58 A;  5H9Q A;  3WG2 A;  3IZO A;  2YC4 A;  3JD7 2;  1MAC A;  4FOQ A;  4DUV A;  1MS4 A;  1WA4 A;  1BBT 2;  1VMH A;  2C5D A;  2JG8 C;  3H3L A;  4QQ2 A;  4RHV 1;  3E5X A;  3JBG 2;  3J7M A;  3ACF A;  5LEK A;  4X8N A;  3ITQ A;  5FZI A;  2JDA A;  4KBZ A;  2BVB A;  2EA7 A;  1W6Q A;  2P3I A;  2JDY A;  3OGS A;  1HRV 1;  1VBB 1;  3IDA A;  1NCR A;  1QNW A;  2GU9 A;  2WZ8 A;  5C33 A;  3O5S A;  4XUP A;  3H8U A;  1GP4 A;  2VUC A;  3WQ1 A;  4B4Q A;  1GOH A;  2XBO 2;  3MIE A;  3WY6 A;  4IEU A;  4HXC A;  1H8V A;  2OW4 A;  4IE0 A;  1WLD A;  4UYB A;  5JXH A;  4RFR B;  3O0W A;  4B3N A;  5B4N A;  3B00 A;  4WZF A;  4YPJ A;  3X29 B;  3DKQ A;  1UYP A;  2ZCW A;  4GB3 1;  3MZH A;  2JE8 A;  2Q1Z B;  3AYA A;  2ZHN A;  4LBQ D;  5FZK A;  1PGW 2;  4UFM A;  4AHY A;  4LO7 A;  4CRQ A;  5E88 A;  4Y5T A;  5CAD A;  3J7L A;  1PM4 A;  1CAV B;  4R52 A;  2YBS A;  1CAX A;  2QCS B;  4QPG C;  4UW6 A;  3FJS A;  1POV 0;  4L8Q A;  4DXZ A;  5L7O B;  1AR7 3;  1QDO A;  4YGB A;  1UW8 A;  5FZ3 A;  4JKL A;  1OF3 A;  3I8T A;  3HQX A;  3VDD A;  4YW5 A;  5JI9 A;  5JOX A;  2R07 2;  5FWJ A;  2DFB A;  3ECQ A;  3FL7 A;  4FT8 A;  1W2N A;  1W9S A;  4XQ4 A;  4YVW C;  3THP A;  1G86 A;  3MPP G;  4L97 A;  1KS4 A;  5FMD A;  1W9F A;  4ZZ5 A;  2PLV 3;  2B9V A;  2ZMK A;  4YG3 A;  3KSC A;  3ZKY A;  2QQL A;  4LBN A;  2UWA A;  4H14 A;  2TUN A;  3D82 A;  1Z0H A;  1ZBE 3;  1BVV A;  3LDR A;  4K1Z A;  2EAK A;  2WT1 A;  4NII A;  4EWA A;  2TBV A;  2A7A A;  3U14 A;  1RVF 1;  1LOB A;  4IGP A;  4XQW A;  4GMP 0;  2IXC A;  3D0S A;  5FZE A;  1B35 A;  5D2A A;  3VBH C;  1VB2 A;  3WF1 A;  4BCU A;  5K9Y A;  1MS1 A;  2RR1 1;  3GZE A;  3K4Z A;  5FTT C;  1WLT A;  5JZG A;  5C8C A;  3FFZ A;  3ON7 A;  3LWC A;  1UIJ A;  1IPK A;  2ARE A;  2Q30 A;  3NNJ A;  4DZG A;  4GXL A;  2XJS A;  4TWT A;  1AR9 3;  4AK3 A;  4PBP A;  4OUS A;  4XUT A;  3NNF A;  3LD8 A;  3N3H A;  3Q8E A;  3OF1 A;  3SQO A;  3ZN6 A;  5ABJ C;  3S6P A;  5IWF A;  2E53 A;  2XDV A;  3U37 A;  3VBF C;  4N7I A;  1W90 A;  3K4D A;  5FOB B;  1C8N A;  2UUR A;  2VMH A;  4RS5 C;  4ERO A;  4YG0 A;  5CEH A;  4A3X A;  5FYT A;  4CPB A;  1A3K A;  2DTY A;  4U36 A;  2RM2 3;  1D7P M;  3KMH A;  5FZ1 A;  5CFD C;  1OMI A;  3O7O A;  4BPZ A;  4AI9 A;  5L19 A;  2VZP A;  4AGV A;  2O8Q A;  2O8O A;  4IEP A;  3HT2 A;  3VHO A;  3J8F 1;  1DBN A;  3RRD A;  2R06 1;  5AC9 1;  3NAP C;  2VNV A;  2ZAC A;  4YFZ A;  4DNY A;  1BQP A;  3AB0 A;  1QJE A;  5CFC C;  3AP5 A;  5ANQ A;  1QJU 2;  3ILR A;  1OQE A;  4Q2F A;  4XFH A;  3WV6 A;  2JX9 A;  1JHN A;  2GH2 A;  4XCA A;  5LRR A;  4QU2 A;  4QGM A;  1UAI A;  2VQ0 A;  2JEC A;  4NID A;  4FPH A;  3WF0 A;  3DXU A;  5FYM A;  2Q8D A;  3DPR B;  3FC0 A;  1MPX A;  2AEY A;  1YQ8 A;  3AP9 A;  1O7F A;  3DKW A;  5DDJ 3;  4F3J A;  4LOT A;  4N53 C;  5LB6 A;  2XJV A;  3VBR B;  3LZZ A;  2WNU C;  4M3C F;  2Y38 A;  1RIN A;  2R04 1;  3W5M A;  1W8H A;  4BHP A;  5E6H A;  1BK1 A;  5FZB A;  4CP1 A;  1RUI 2;  1R1A 3;  4ARY A;  1H30 A;  4S2F A;  2FMY A;  4Q0V A;  4AL9 A;  3R6S A;  3N7J A;  4BM8 A;  2CDP A;  2L9L A;  2VL4 A;  1AX0 A;  2ZX1 A;  3BN6 A;  3HVD A;  3MF9 A;  2B42 B;  3FUQ A;  1AR8 1;  4MAD A;  4L11 A;  3U78 A;  4IV3 A;  1K3I A;  1RUH 1;  1LOD A;  1V00 A;  4UW4 A;  2XJU A;  1KJR A;  1S0D A;  3MIH A;  3WDX A;  2D40 A;  5DXD A;  4YG6 A;  1H2N A;  2BPA 2;  1FMD 1;  5FYC A;  4FPY A;  4KWU A;  1AYN 1;  4OQ8 A;  4A41 A;  5FZD A;  2MEV 3;  2RVA A;  3VBU B;  4LUM A;  5C3P A;  4A42 A;  5FZA A;  5FKB A;  5HPO A;  1LHU A;  5J36 A;  1XND A;  3E5Q A;  4XW3 A;  5FZ8 A;  5BNQ A;  2ZEY A;  2WSU A;  5IK5 A;  2VMI A;  3SH3 A;  3OBA A;  1VBC 2;  4AVV A;  1SLL A;  2W92 A;  4QXC A;  1PO2 3;  1FI2 A;  1W0O A;  3LCP A;  3ACI A;  3N36 A;  4XMA A;  1QGL A;  2W52 A;  3USU B;  1MZ5 A;  2HWD 2;  5L36 A;  4CCJ A;  1G6N A;  2ZGQ A;  1BXH A;  4MV2 A;  2W1Q A;  2JDP A;  3SCG A;  5DUW A;  3LE0 A;  3ZDV A;  4K8R B;  5JOY A;  3AFG A;  1RED A;  4XDO A;  1QDC A;  1NCQ C;  3KGL A;  2WWU A;  4JDM A;  4JDN A;  4LA2 A;  2BDR A;  2QVS B;  4YW4 A;  1ZZC A;  4RFT 0;  3FZ3 A;  1JHJ A;  2YG0 A;  1LES A;  2C9K A;  3I2J A;  5C4W A;  2WZP P;  3M3E A;  1O6U A;  1IPJ A;  3POE A;  4LBK A;  5CU1 A;  1PGL 2;  1MVE A;  3HIF A;  5D8A C;  1VRH 2;  3POJ A;  4HFS A;  3RNS A;  3BU0 A;  1HLC A;  3O14 A;  4E9K A;  1GSL A;  2PXJ A;  4D7S A;  1H9W A;  2YBK A;  4GAL A;  1YHF A;  4JAA A;  3RSJ A;  5FRA A;  3H8X A;  3W5N A;  2RS5 1;  2WFF 3;  2I74 A;  5FUN A;  2HWB 3;  4QXH A;  4ES8 A;  4PQ9 A;  5A1F A;  1NLQ A;  3ZYI B;  2BYV E;  3LIG A;  2Z2S B;  1W6O B;  4R9A A;  2K46 A;  3KT1 A;  4Y22 A;  3UYJ A;  2DCY A;  4NPM A;  2BJS A;  4AED B;  1X82 A;  5K7P A;  2O1Q A;  1V6I A;  2J1R A;  1HB3 A;  5FMO L;  1SEF A;  4BXF A;  4QGL A;  3N9O A;  3PUR A;  3HQR A;  3CIH A;  4Q8K A;  5FYH A;  4M0H A;  4DIQ A;  3N4M A;  2PQS A;  1MZF A;  1MEC 1;  3RYK A;  3AVR A;  2YDE A;  1OPM A;  3WOG A;  4CDX B;  1ZYB A;  1JYX A;  5GZF A;  3ZXG A;  1H8T A;  2NMO A;  5A3N A;  3I59 A;  4JGZ A;  5B4X A;  3BB6 A;  1PMH X;  1FX5 A;  1FOD 3;  3IDC B;  2A75 A;  4O9E A;  5FXW A;  2DU0 A;  3AJY A;  2RS3 3;  1OFN A;  1NA1 B;  1OOP A;  2B4K A;  2JG9 B;  3SKJ E;  2W2I A;  3PVN A;  1VBE 1;  3UJO A;  3WQ7 A;  1J3R A;  4A4A A;  4DY5 A;  1RMU 3;  1UIK A;  4ATE A;  3TN9 1;  3GF6 A;  3OYW A;  4FFG A;  5DZG A;  3AXD A;  4BJ0 A;  2LTN A;  1IHM A;  1OI6 A;  1PMJ X;  4K9S A;  1DQ2 A;  4N43 A;  1YQ5 A;  2OUJ A;  2B8M A;  4Q0Q A;  1UU5 A;  4DXS A;  4DB5 A;  3IBM A;  4HZF A;  1M4W A;  3CU7 A;  4JZR A;  1Q8S A;  1JYI A;  1ND2 C;  4CCN A;  5C3O A;  1WD3 A;  4BQY A;  1O5U A;  3UL2 A;  2AAC A;  5IVY A;  1W3X A;  1OVP A;  2PHT A;  2VTF A;  3HPN A;  4YNI A;  1F9K A;  1G9C A;  5FUI A;  3ZXF A;  2DVA A;  1MZ6 A;  1NX9 A;  5CKQ A;  4YM0 A;  4MYE A;  4CPB D;  4CCC A;  4Q27 A;  3ZFE B;  2F4P A;  2TEP A;  5LK5 A;  2Q8E A;  4G4F A;  4Q4V 2;  1W05 A;  4HSL A;  2D3R A;  4IQP A;  2VVE A;  4DIN B;  3JUU A;  1RUD 1;  3POY A;  4Y5S A;  1AR7 2;  3P3N A;  3P5B A;  4FPL A;  1OH3 A;  5LA2 A;  4P9J A;  2VZR A;  1LCL A;  4XBN A;  1RUG 2;  1WW4 A;  5TSW A;  1BEV 2;  2A73 B;  4AFM A;  5CAZ A;  3ASI A;  4PDW B;  4Y20 A;  2DBN A;  2WIN B;  2FQP A;  1YYN A;  3JD7 1;  1ZM1 A;  2PLV 2;  1HQL A;  2W68 A;  1S0C A;  4XJU A;  4YFW A;  1XNK A;  3LAG A;  2YRO A;  1V6L A;  5GLU A;  5I8Y A;  1MS9 A;  2PYT A;  2WZR 2;  5CZK A;  1GWK A;  1W8Z A;  3KV4 A;  2PMW B;  2UYB A;  3MV1 1;  4KG0 A;  3GJA A;  5A3O A;  1ZBE 2;  1QMJ A;  1OH4 A;  3VD9 A;  2QDR A;  4XFB A; 
#chains in the Genus database with same CATH homology
 3NNJ A;  5EP9 A;  3HQU A;  3NNF A;  2FCU A;  4NAO A;  3PL0 A;  4IW3 A;  4UWD A;  2FCT A;  4XAB A;  3MGU A;  3KT7 A;  5LBC A;  4NHX A;  3EMR A;  3KT1 A;  2RDS A;  4XAA A;  3NNL A;  3HQR A;  5EPA A;  4J25 A;  4Q5O A;  5DAP A;  2HBT A;  4MHR A;  3OBZ A;  4NHM A;  5L9B A;  3ITQ A;  3BVC A;  5L9R A;  2A1X A;  4KBZ A;  4XCA A;  5M0T A;  2RG4 A;  2RDN A;  4XAC A;  5IAX A;  2OPW A;  3GJB A;  3W20 A;  3OUI A;  3OUH A;  2Y34 A;  5LB6 A;  5LBB A;  5LAT A;  5A3U A;  5LBF A;  5L9V A;  3DKQ A;  5HV0 A;  2Y33 A;  5C5T A;  4NMI A;  5IAV A;  4JZR A;  4Y5T A;  5C5U A;  5EQU A;  3W21 A;  5ERL A;  4BQY A;  4BQX A;  4XCB A;  4XC9 A;  5IAT A;  3OUJ A;  3NNM A;  5DAW A;  2V4A A;  3KT4 A;  4ZPI A;  2RDR A;  4NHY A;  5LA9 A;  4NHK A;  4Y5S A;  2G19 A;  2RDQ A;  5DAQ A;  2JIG A;  4ZON A;  5HV4 A;  2G1M A;  4MHU A;  5DAV A;  5DAX A;  4NHL A;  2FCV A;  4BQW A;  5LAS A;  2HBU A;  2JIJ A;  3GJA A;  3GZE A;  5LBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...