2G19A

Cellular oxygen sensing: crystal structure of hypoxia-inducible factor prolyl hydroxylase (phd2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cellular oxygen sensing: Crystal structure of hypoxia-inducible factor prolyl hydroxylase (PHD2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 67
structure length 216
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2g19A00
4XAAA 4NHMA 3GZEA 5LB6A 4NHLA 2A1XA 3PL0A 5HV0A 4Y5TA 2Y34A 4Y5SA 2RDNA 4BQYA 5DAPA 2FCVA 4NMIA 2HBUA 3W21A 5DAVA 3NNMA 4XCBA 4NAOA 4NHKA 5LASA 4ZONA 2RDSA 2G1MA 3MGUA 4XCAA 5LA9A 5EPAA 5IAVA 2FCTA 3OUJA 3ITQA 4IW3A 5C5TA 5LBEA 5IAXA 5ERLA 4MHRA 4ZPIA 3GJAA 3EMRA 3NNFA 3OBZA 3HQRA 3HQUA 4NHYA 5EP9A 4JZRA 2JIGA 4J25A 5M0TA 5LBCA 2V4AA 4MHUA 4XABA 4BQXA 5IATA 3KT1A 3KT4A 5LBFA 5LATA 5L9RA 2OPWA 2Y33A 4XC9A 3NNLA 3OUIA 5DAWA 5DAQA 4Q5OA 2G19A 3OUHA 5HV4A 5EQUA 4XACA 5C5UA 2HBTA 5LBBA 2JIJA 5L9VA 3W20A 4KBZA 4BQWA 3GJBA 3DKQA 5DAXA 2RDRA 2FCUA 3KT7A 2RDQA 4UWDA 2RG4A 3BVCA 4NHXA 3NNJA 5L9BA 5A3UA
chains in the Genus database with same CATH superfamily
1LOEA 4XAAA 4MXVA 1X33A 1QJY2 2A6YA 3AMNA 2WNUB 4HVRA 1VBC3 1LRHA 4QDRA 3VBFB 1KFXL 2XJTA 2J1VA 2ZHKA 1D0GA 1YI7A 2RM22 4HKLA 1JYWA 5A70A 5K8SA 2GAUA 1F31A 1PO21 3ZIWA 1Q8OA 4NMIA 4YVSA 3CKHA 2GMEA 2HBUA 2RS32 4G9SB 4K21A 1ENRA 3ZKYA 5FZFA 4CPBD 2QQMA 3H3ZA 2DF7A 4XQ4A 5KHGA 4XJZA 4DUWA 1VMJA 1DZQA 1KS4A 2I07B 1EUTA 2E51A 1ULDA 3LPFA 5T54A 2XJSA 2RS31 4IDZA 1OC1A 3OPZA 2MHFA 2ZKLA 3KS7A 2J7MA 4IV1C 2VOVA 3T2TA 5K7PA 4NPLA 2D6LX 1O3SA 2FQPA 2JWPA 2KR2A 2DBIA 5IFTA 3HNBM 5FY4A 3EO6A 1AL21 1A3KA 4CU7A 1ODNA 2WO1A 1MVQA 3SH5A 2VW2A 5F3CA 3QLQA 1WZXA 3VDBA 3I2DA 3AB0A 1O8SA 1YCIA 3VGIA 3ITQA 5A3LA 1PGW2 4AEDC 1K5MC 1GFF2 4TZDA 1N3OA 5SV8A 1C8M3 3OD0A 3GHNA 3M4FA 5GZDA 2HWE1 4AQ6A 2DDUA 1RMU2 3KLSA 1S2KA 2WYSA 5EP9A 2GNDA 3GALA 4V2VA 3WCSA 3WX5A 4CCOA 3EJKA 3VHRA 5F37A 1BVP1 4QX2A 4MXWA 2YZ4A 5EJ1B 3GBGA 2XONA 4QGNA 4QX5A 1BHGA 4AZZA 3OY8B 2BGOA 4N90A 3EBRA 5I0RA 4XTMA 2H0BA 3U14A 4RA0A 2JDAA 1MR5A 2R0HA 2VVDA 2ZGOA 4Y20B 4PLNA 2R1DA 3NJXA 1WA4A 5J48A 2OIIA 5LW9A 3ACGA 1O3QA 1E5SA 1JOPA 4MX3A 5E1RA 4EN6B 3K46A 1D2QA 5FXXA 1XBFA 2E26A 1MS4A 2XLAA 5AC92 1RUG1 1MS8A 3KHCA 2WLPA 1AF9A 2EICA 3PTYA 1V70A 5F2WA 2X10A 3EQEA 5FFOC 1YJKA 3NMBA 4PDWB 5KXCA 2Y0IA 2WA4A 1UZWA 1AX0A 1IS3A 2RS12 2CYFA 1TVGA 3VL8A 2OQ7A 3MIEA 1YLLA 3Q8AA 5A3PA 1JYXA 3NNGA 4B1MA 5JXGA 4A6OA 3OGVA 2P3YA 3W58A 1ZBA3 4OHXA 4D8MA 1AYM1 4MGSA 4RFRB 5BNPB 1G9AA 5T50A 3LSDA 3FE5A 4B7KA 2Z79A 1W03A 1QXRA 1WBLA 3AM2A 4OMDA 3POEA 3WG1A 4HETA 2ET7A 3PDQA 1EV13 1FMD2 4K1YA 3VZKA 1UYXA 4R8HA 4JGYC 2WC2A 5LY2A 3WXPA 1W8HA 1UY4A 3NV2A 1W2OA 4YW3A 1DQ0A 3K3NA 3U07A 3WP4A 4Z07A 1C8M2 4CUBA 1JODA 2FD8A 1S2EA 4IQPA 4CDXC 1O4YA 4V2WA 1FT9A 2P37A 4FPLA 4R52A 4HG6B 1C8NA 4JHZA 4JAAA 3ROUA 5T5JA 3PU3A 2WRAA 4DXTA 2ZX3A 2C24A 3QBQA 4E4SA 1DHKB 5HCAA 5KC6A 2P3JA 5DAPA 2JD4A 1FXZA 2FCVA 1YHFA 2Y60A 3OCPA 3CJIC 4YNIA 4BQ3A 3J7HA 1IS4A 4LLOA 2YYOA 1ULPA 2E9QA 5CFDA 4UT5A 3TOJA 4Q4X2 4NHKA 3WQ1A 5FWEA 4L0PA 5GLUA 4UW5A 1VRH2 3FX3A 4QM8A 5FZ8A 5K0UC 1W9FA 2GDFA 2LALA 5C8CA 4DUXA 5JZGC 1RUNA 4XQWA 3BIWE 3VBSB 2VUAA 1B09A 4I0BA 4L8QA 2WWJA 3GGLA 3QH7A 5F5AA 4JGYA 4W4ZA 5FZ4A 3I3QA 4XFFA 4JTNA 5F3EA 5LA9A 1R093 2ZAAA 1GSLA 2CL2A 1LHNA 3DN7A 4XJ9A 1BKZA 2F6BA 5FOJB 2ZAHA 2K46A 2LW8A 2BZDA 3LOIA 1KS5A 4BLIA 2RMU3 5A3OA 3I2FA 3OB8A 3S5QA 5J09A 5A1FA 1OF3A 4YZ2A 4MHRA 3UGFA 4LO5B 1SLIA 5CFDB 1JOJA 2YC2A 1LOAA 3BOPA 5A33B 3KCXA 1MS0A 3VD5A 3CZUA 3VBRC 3OF1A 2CTVA 4HXCA 5EV7A 2CHHA 1XQNA 1WW5A 1WUVA 2WA3A 3OPTA 3OYWA 3M2MA 4MHUA 1C8M1 3PUSA 2HWC3 4MO3M 5F3GA 3UESA 3U4XA 1ZZ6A 1HDKA 5FZEA 5L19A 1W06A 3DYPA 1JBCA 4CCJA 4Q0SA 5B4XA 1JZ5A 5FZGA 3GBWA 3AKPA 4RGKA 3N7JA 4K40A 4CEYB 3POWA 3T2QA 1AL23 2ATFA 5D8AC 4FOWA 1UY2A 5IVEA 3WVJA 1JZ2A 1BLZA 1O8PA 4EQVA 2PAKA 2XUMA 3HNMA 4AVVA 3MBWA 2EIBA 4OHYA 2VBPA 1AR92 3ILFA 4FPEA 3AKTA 1JZ8A 3RZJA 1O5LA 3J7NA 5DAQA 3WR0A 5GLVA 1HRV3 4ZZ5A 2AYHA 2JE9A 2W95A 2OVUA 3F2ZA 1DDLA 1MEC3 4L92A 4DPNA 5EQUA 4ZU7A 1D2SA 1HN0A 2NYYA 3LAGA 4PIXA 3WLUA 2VVFA 4COWA 4R9AA 2WT0A 2IXLA 1BYHA 1XOYA 1GOFA 1PGL1 4NIIA 3GZAA 2Q8DA 3ZXDA 1WCQA 3A22A 3E97A 3DXUA 1OBNA 5KXDA 3M3OA 2VNVA 3UJQA 2IVJA 1GMMA 2VMFA 1SPPB 2ZPXA 3WHTA 1LENA 4Q29A 3U10A 4XVHA 3LGRA 1AL0G 1VRBA 2IFWA 2QQKA 2WNUC 2QZ2A 3DXTA 3O14A 4YVWC 4AI1A 4AHWA 5A1AA 1OLRA 1RYYA 4C1XA 3QOPA 2P6HA 4YWAA 4MXWB 4QGLA 1O3RA 2JDZA 2QZ3A 2WQZC 5B2GB 3T1LA 5FZMA 4LJHA 4E4ZA 4FVVA 2UYAA 2WQ4A 2JDPA 1G6NA 3ALQA 3RWNA 3B69A 2RMU1 2VC9A 2OZ6A 3IKWA 3V64A 1QQP3 4XMAA 1PK6C 1DQ5A 1UX6A 2VBDA 1NZCA 5JOYA 5I8YA 1N1SA 3Q8CA 1JYVA 1ND2B 4QPYA 5JPMB 1DBNA 1R091 2W47A 4ONUA 1VBB1 1JZ7A 2UWCA 3AZZA 1U12A 2BOJA 3ZFFB 4URAA 3O1UA 2H6CA 2WZPP 2R063 3IDCB 4L97A 2GC0A 3AMHA 3MIHA 2OPKA 3TRSB 2I2SA 2VZTA 2XL7A 3M1HA 5JXHA 2ERFA 1YRZA 2VOTA 5IK5A 3KMHA 4LXLA 2YGMA 1PHMA 2RVAA 1F4AA 4NRPA 1F4HA 4E2QA 4HPKA 1CQ9A 2DWRA 4S2GA 3T09A 3ZXFA 1CIWA 4B4PA 3VZOA 3H8UA 4AEDB 1V9U1 1MPXA 4XURA 3TEYA 4YZ1A 5JVVA 1C1FA 2VTXA 1W8WA 4PCRA 4XBNA 3T2OA 1AR93 1LU2A 3THDA 5A6XA 3A23A 2JX9A 3WDXA 2VQAA 3FHAA 4JDOA 3ZYJB 1OA4A 2W0XA 4UFIA 4MGYE 1LAJA 2DU0A 3OUJA 2JENA 1E5IA 1MS1A 1MS9A 3SEPA 4B29A 4XDQA 2Z5WA 5CVRA 4ZXKA 1QMJA 5FRAA 2ZMLA 4ZPIA 5AC91 5GJ6A 3BTZA 1NCRB 3B9IA 3B93A 3J7MA 5DZFA 4KGQA 1BXHA 4NRQA 3WDYA 3RNSA 3VHNA 2VQ0A 3WNKA 2VCBA 4FPCA 1BEV2 4MGIE 3UGGA 3KQRA 2A6WA 4BWOA 1AR61 1J3RA 2OS2A 4P9LA 4I0WB 4LUMA 3NQHA 1OXCA 1XE7A 1ASJ3 2VULA 5C8WA 5AC93 3VD4A 1F5JA 5GKAC 2GC1A 3WHUA 1POV3 3KWVA 5FZDA 3AK0A 3LKJA 1I1EA 1AYM3 1T2XA 2LRPA 1ZBA1 1HB4A 5C9AB 3BALA 5FP4A 5FBJA 4HK9A 1MZEA 4IEUA 4Y5Z0 1RXGA 1YFWA 3PTRB 2A3YA 1Z78A 3NNLA 2HWD2 1WLWA 4XUOA 4AFBA 4E4DX 1LOFA 3IPVA 4XW3A 5ANQA 5F6LB 3SKVA 5K9YA 2ZBJA 1OH3A 3GZTB 3ZYGA 3OUHA 3PUHA 4DINB 3FLRA 2JXAA 2CDOA 1VP6A 3ES4A 1MS5A 3UL2A 4JQTA 3ON7A 3ASIA 3IAPA 4P9GA 5ACA2 2FDGA 4I30A 2JG9B 4OZOA 3I59B 4NWVA 5E16A 2WABA 3VN4A 5JDBA 1Y43B 4ET7A 4LK7A 1QQP1 1LOBA 3ZVXA 3VBHB 2GNTA 1HV1A 4QB1A 2B8MA 2NMOA 3ZO0B 3TBDA 2D3RA 4UFHA 4XDPA 1EAH2 4PT6A 4CPBA 2FMYA 1BZWA 4FPGA 2YDEA 1UZ0A 1G9CA 1H30A 1REEA 1WLDA 2RG4A 4C8DA 3ZXAC 4AF9A 4IEZA 2QQLA 2GNBA 2HWE3 5L9BA 1SFPA 4I3PA 1G9FA 3TNQA 5KR7A 2V4VA 3LEKA 4FSJA 2YY1A 2ZOEB 4GWNA 5DG2A 4RFT0 4NHLA 3M3IA 4DS0A 2Z4FA 1H2KA 4XUQA 4DRRA 1GANA 5CFCC 4LT5A 1SQ4A 1YEWA 1LGNA 5C3QA 5K0UB 3O1PA 5FYMA 4AG4A 4GH4C 3RZMA 3VKOA 3ILNA 5AVAA 1MEC1 2RS33 3WNNA 3MW3A 4XFAA 2NQYA 2XPJA 2Q1MA 2BEOA 1OQ1A 2QE3A 2P5BA 2XVKA 3WINE 1YC61 2Q1FA 4MG2A 1TG7A 2EIEA 4KNCA 2R49A 1VBD2 1V6LA 3KHBA 1PO23 4Q8KA 4FPYA 1H0BA 4HKWA 3GCXA 4WZFA 4A3XA 1RVF3 1D4M2 1WMDA 4FBFA 3G7DA 1TMF3 2XHKA 1PVXA 2V5DA 4LIUA 2JG8A 5C3PA 2R071 4UFMA 4UFJA 2LUWA 4OVEA 3O0WA 3PUAA 1J3QA 2HWC1 1G9DA 2J1TA 3OGRA 4IV3A 2R1BA 4ZS3A 2E63A 2FZ2A 2JJ6A 1RTVA 2QUOA 2X5IB 3I97A 3MF9A 1YFXA 4GWMA 4RN5A 4XOGA 2GN7A 2GP5A 2RJKA 3HEIA 4C91A 5JMCA 3FZ3A 2VTFA 4I3GA 3ST7A 4NWWA 3RZKA 3WUDA 3VDCA 4IL7A 2ZZQA 5BNNB 5FUIA 1OVPA 2J1RA 3UNPA 4PDWA 2PELA 3KM5A 2R042 4FPJA 1RITA 5BUVA 5LEKA 1RUF3 4GZ9A 3WNPA 1I5ZA 5FPXA 1QOOA 5F1RA 3WNXA 4AL9A 1UCXA 1H1IA 4YZ3A 3S7EA 1AVBA 5D8AA 2WBKA 4KL1A 2CWSA 5A80A 3H0OA 3ZOIA 5L9RA 2OPWA 3RQ0A 2ORZA 2ZGTA 1JTZX 1PVC1 2W87A 1IKPA 2WQ8A 4P08A 1NA1A 3GNEA 5KXBA 1OMIA 4XJUA 4EWAA 1K12A 4E2SA 3EB7A 3U4SA 5IK7A 2VMCA 3TAYA 2ZX1A 2ZGSA 1ND3A 3E5UA 3IDAA 3H3UA 3ME2A 3WEZA 1ZBE2 5FPZA 1YIFA 2WS92 4TWTA 1GUIA 5FPVA 2JIJA 1NLQA 4NIGA 1WW4A 3ZXLA 1YO8A 4AYUA 4LBQD 2YU2A 5F5IA 5JSPA 4OUSA 4BQWA 2Z2SB 3TEZA 3PIGA 3JUUA 3JBG3 2ZGNA 3Q8FA 4CDQA 1OQDA 1VBD3 3P5BA 1WLTA 2OUJA 1TME2 3VZNA 3J4UH 4RHV3 5JR2A 2Y6HA 4X6QB 2ENRA 2VVEA 3AX4A 2C4XA 3OSDA 5IVJA 1H9PA 2RDQA 5LRRA 3NAPC 1PK6B 1QJX2 2JE7A 4GA9A 4QD2A 1QOSA 2QNKA 1A8MA 1SLCA 5BNOA 2FBEA 1SACA 1YUDA 1EV11 1UIJA 3POIA 3ZFFC 3V65A 1W6PB 1UMHA 5C4WC 3AKRA 1O4ZA 4P9XA 2AENA 1EY2A 3WY6A 4P9YA 1VRH1 1MVEA 4K7JA 2A1XA 4MZUA 1XB9A 4UXAA 3ELNA 3VDDC 3V0AA 2EAKA 1BK0A 3DPRB 2CGPA 1W8TA 1DGLA 4UFKA 5KC5A 4A6SA 2QQWA 4I02A 1FPN3 4YVSC 4TLGA 4LBQB 4NR1A 1L7LA 2ARXA 1TE1B 1FX5A 1XXNA 2FMDA 4OULA 4YZ4A 4KG8A 3VBFA 1ZBE1 5JOWA 2IXCA 4Y33A 4FPKA 2CAUA 1W0OA 5IVVA 1JN2P 2AEYA 5JXJA 1GKBA 2G1MA 4CUCA 5FZBA 3ZN4A 1RUG3 4GH4B 4RHV2 5A3NA 4FI9A 4QGMA 3P3NA 2BUKA 3M7AA 1O59A 2W2IA 2CY6A 5IHRA 4U2AA 3ZXKA 2HWB3 4QU1A 2XWBB 1UXZA 2PHFA 5IAVA 3UK9A 1UIKA 4AEDA 4SLIA 3O1RA 1G9BA 5BNOC 3FFZA 4CP9A 5FXVA 2QFEA 5GLWA 4NVPA 4NRMA 3UYJA 1S0EA 5T52A 2W52A 2R041 5FYBA 1W2AX 1HJGA 3MI8A 1PZ9A 1UPIA 1DLCA 1W05A 1XRUA 4RGGA 2WNEA 3AZWA 3BU7A 3LA2A 3HQUA 2PN5A 2TEPA 5M0TA 1DQ2A 5JMOA 1Q56A 1HIXA 4B1LA 2D3PA 1QDOA 4QX1A 1YNAA 4AI2A 4EZ4A 4PQQA 1RXFA 1U5YA 5H9PA 3CZJA 3VD7A 5IVYA 5T55A 3T3YA 1BMV2 1ZA7A 3CF6E 3GZUC 5FPBA 3ABZA 5FZ6A 3UETA 5I93A 4NJ4A 4WV8A 2HEWF 1YQ6A 4YZ5A 4RQPC 4XFIA 1UN1A 1RUH3 2YG0A 1CONA 1LHUA 3AYCA 4MLOA 2DVBA 1YQ5A 2R0FA 2UWAA 3J7LA 1RUE2 4UW4A 5J98B 4ASMB 2JG9C 4IE0A 4GULA 2EF6A 3UT0A 3CEWA 4XF4A 3PJYA 3DCQA 3ZR6A 4BMEA 1CWPA 3R05A 2LS6A 4FFIA 5JCTA 1W99A 4D7TA 2PXJA 3I2IA 4DEQA 4QX7A 1IQAA 1UZYA 1V6KA 4RR3C 1PM7A 2X53S 4RL7A 1AZDA 3PMSA 3W20A 1IKQA 1RHI1 4F3JA 3WZ1A 4EJRA 2I74A 1ZRFA 1KDMA 4Q26A 2WZEA 1VBC1 3ZR5A 1UNBA 1ST8A 4IUGA 1RUD1 1VMHA 4BA6A 4YPJA 4XETA 5FOBB 4LKFA 2XBO3 4ZZ8A 2ZTNA 1XNAA 3H1YA 5C4WA 2DU1A 3VV1A 2RHPA 2ZGLA 1LEMA 4QHOA 1C4RA 2HEYF 2JDKA 5IUQA 3I2KA 4E9KA 3V0BB 3INAA 4IV1A 4CCCA 1KGYA 3SNMA 1JYTA 1W9TA 1OA2A 5FYVA 4N9IA 1ODMA 1OURA 1YQCA 4AFMA 1NQDA 4CRQA 2E32A 4PIZA 3R0RA 1UO9A 4YLZA 2NM1A 3MZHA 3ZPYA 1JI6A 1HN1A 1UY3A 2FHRA 4Q4V1 4QXBA 4Y5SA 4C0HA 2RDNA 4LBJA 4Q4Y2 3O0XA 1OLME 2JDUA 4LNVA 4RR3A 4Y22B 5E89A 4ASKA 1GZWB 1ZYBA 3L9JT 2BPA2 3JQXA 5A6QA 4Q0UA 2NPIA 1D7PM 4ZONA 1WBFA 3NO8A 4YYOA 4E2GA 4Z2AA 3RDIA 5I8TA 3ZYIB 2HWF1 4QB2A 3LEMA 5DDJ1 3UGHA 5GZCA 3VD9A 1AR73 4ARYA 2YBPA 5FKCA 5J37A 2HYXA 3VKMA 2ZGQA 1WW6A 4CA9A 1SBFA 4RS5A 4XCAA 1X7NA 2BW8A 3GM8A 4LEJA 3KD4A 1O5UA 3W5MA 3C3VA 4A4AA 2Q0AA 4XIOA 3AP7A 2H6BA 1H2LA 1UOGA 2N7GA 3PVOA 4FXKB 2BERA 3I4IA 5LA1A 2WFF1 1B35B 2W46A 2YROA 4HMZA 5FXWA 4YG0A 3POFA 1OD3A 3K2OA 1RUF2 4B7EA 5FPUA 2VUDA 2DV9A 1FMD3 2XLGA 1NLRA 1SDWA 4D6QA 4QDQA 1F15A 2RR13 1JXNA 2OXBA 3ETQA 5JLVA 2XQXA 3O1MA 1BEV1 2CDPA 4LE3A 2YBSA 5TSWA 2VMEA 3FN9A 2HJIA 4LMFA 5FR3A 1AUYA 1G7YA 2JKBA 3HOBA 2BBVA 2A73B 4AHXA 1SMVA 1O91A 4WM8C 3RVHA 5KHIA 3LEGA 4XBQA 2J1UA 4XFCA 3K48A 3ZXGA 1RUE1 5HPOA 1LB2A 2RJ2A 2XLFA 2WFF2 5HBAA 1WWYA 3SITA 2MEV1 4OI4A 5L36A 3SC7X 2Y33A 4UYBA 1QY4A 1LR5A 1SFYA 3PU8A 1VBE3 2ARBA 1NY72 2XJVA 1HRI1 3WP5A 3VZJA 4H7MA 3R4SA 5BNPC 3N35A 5FQ0B 2PHTA 2R32A 3D8CA 3FUQA 3VBHA 2G19A 1W9WA 1XYOA 2P3IA 1QKQA 3CL1A 2PAMA 2SBAA 4MOAA 4CCNA 5GLZA 4JQRA 3MLLA 1LHWA 3VBOA 4MGTA 1YWKA 2BRTA 2W94A 3E6BA 3OPWA 4LPLA 2YC0A 1H9WA 3ZX7A 4N7UA 4BZ4A 4Y20A 3S5AA 2VW1A 2BNOA 4XHXA 5FZLA 4KBBA 5FUNA 4M0NA 1U5XA 4UW6A 3GF6A 4TLFA 3JD73 5JIAA 1OHFA 1IS5A 2QQNA 1W3XA 2DVGA 2ZMNA 1Q8QA 2YHJA 3WNLA 1GZWA 1RMU3 4Q4V2 4LOTA 1UQXA 1OOPB 1K45A 4FCAA 4UOJA 1GWLA 3VHPA 2X29A 4A7KA 4C1WA 1H1AA 4FAGA 4A3ZA 5IT6A 2A6ZA 2GALA 4TSVA 1W8OA 4PLMA 4AI3A 3ZDSA 1HXS1 5F8PA 2ARAA 1LEDA 2Y34A 1W6QB 4XXPA 3HBKA 1QJY1 2VQUA 3NKTA 1O6UA 1UF2C 4FTBA 1C57A 2QQOA 1GWMA 4YGCA 5KWRA 3UV9A 2P6CA 3VBSC 2ZGMA 2CU5A 1XE0A 2ZABA 5CNAA 4Y1YA 4CUGA 3F95A 4AR2A 1W2TA 4JC1A 3H1MA 3LZZA 1CZTA 1KFUL 3QCWA 1L7QA 4Q4X1 1W8ZA 2ZMKA 1KD7A 3PLQA 1HRV2 1VBE2 2F17A 5FK7A 1FV3A 1EV12 3N9OA 4QMAA 2Y0OA 4BDVB 5C71A 2JB8A 4WVMB 1HQWA 5JIUA 1M06G 1NCQA 3BGAA 3MUZ1 3VLBB 4Q0QA 1GQHA 1QXPA 4XIKA 3RGBA 3ZYRA 1QF3A 2FCTA 1CD3G 4RD7A 2VZVA 5DUWA 5ACA1 2XOMA 3MW4A 2RS53 1K5MA 1QJZA 3E6CC 5FLIA 4Z8BA 2Y6JA 5F9TA 1RB8G 3GJAA 3O0VA 1UY0A 2A6XA 1AR83 2E7TA 1PGSA 1YXWA 2Q1ZB 2UURA 4N43A 4WM7B 2VOKA 3KV9A 4JZRA 3TEXA 1QJU3 1RUC2 4PF5A 5FYIA 2VPVA 2B9UA 4BIFA 1JMUB 4CCDA 2WKKA 2ZA9A 3J8F3 4E8CA 3KV4A 3VL9A 3TEWA 4UF0A 3I49A 3G6JB 3WDVA 4D69A 2EXJA 2BGCA 2VNGA 3ZDVA 1NG0A 5FUPA 3CO2A 5GZEA 3LIGA 1ZRRA 3VBOB 2HKXA 4GD4A 1COV1 3AL6A 5FY8A 1PIV3 3MFAA 4XJAA 3O1VA 5CG9A 1OQEA 3KQ4B 4XC9A 4QAWA 3GCWA 5T5OA 1AHSA 1NUKA 3ACHA 1XPWA 1GWKA 1RUH2 1CPNA 3I54A 4QXKA 4Z1VA 1PO12 4N53B 5HCFA 5C3SA 3QD6A 4LR4A 1X82A 1HV0A 2WO3A 1R082 4N8MA 3T0AA 3NL1A 4FQZA 2BGPA 5FY9A 3AP9A 1RUJ3 3OGSA 1CAWB 2AEZA 4JRLA 4YVWB 1WD4A 3Q9OA 3IPVB 3E1F1 4FAHA 5I0SA 1YYNA 4FQ4A 4EWEA 3IN9A 3DKQA 3N9QA 5L7OC 5KHKA 4AHZA 5F5CA 2IXKA 3WF2A 4Q4W1 5IWFA 2W1QA 1VMFA 3URFA 3PVBB 3AP6A 4YW6A 3HWJA 3KT7A 2VUJA 3DPRA 1ACCA 2D5HA 1LHVA 2CGOA 4YG6A 2HWF2 1LNSA 4PJYA 4CXYA 4IETA 4HOOA 4CVUA 3MHZA 4KWKA 1UOFA 3N7MA 4CTEA 2DUQA 3OY8A 2AREA 3LOBA 4O61A 2VZSA 1LHOA 3NJVA 4KWLA 1NXMA 1TME1 3EHKA 1CVNA 3BUCA 1QJFA 1ZNPA 4GWJA 2A75A 3CJXA 3ZSJA 3D0JA 5DUVA 5BYNA 2Z42A 2AH2A 2RM23 2EALA 3RYKA 3W59A 1OVSA 5ABJC 5JSRA 1C3HA 2PAEA 3JBG2 1AR72 5A3TA 4KGGA 1XSRA 5BNQA 2WDBA 2ORXA 3NW4A 3THTA 3W21A 1R1A3 3BCWA 4AFDA 1AYN1 1IS6A 1ULGA 2VOWA 4OZXA 4NAMA 4RGAA 5LY1A 4EZHA 3CBNA 5FY0A 3S7IA 4XUPA 3HAGA 3SXWA 2K0GA 1R081 1MEC2 2WNOA 2WS91 2PLV3 4QU2A 4BH9A 5LEJA 3MGUA 4H3WA 1UYPA 3RJ2X 2R16A 3MF6A 3TN93 3CNAA 1AJOA 1Y7BA 1UU6A 5EPAA 2WAAA 1Y9QA 2CSGA 3B01A 4GMP1 4XUTA 4LO8A 3KF5A 3AC0A 5GLTA 3K51A 4Q1RA 1LODA 1G86A 4CDXA 5FMBA 4MV2A 4LBOA 1YFYA 2EVXA 3MICA 2GH2A 4BLJA 1H8TC 4QKBA 2WYFA 2XWJB 3I3BA 3OYWB 4ES8A 1TZOA 1BQPA 2UY8A 3I8TA 3FLTA 1Y4WA 1Z7S3 3NV4A 3H42B 3RZGA 2B4KA 4PHZA 4LKDA 2JECA 3TB0A 1DYOA 1EP0A 4PI2A 4XABA 4IE7A 4XFGA 5C9AC 5CG8A 2DTWA 3HN1A 4OMCA 4S2FA 3M8LA 4WM7C 1JUHA 1OI6A 5EJZB 4JDNA 5FZAA 1W28A 4XFBA 1D4M1 2L9LA 2OUHA 2OZJA 4TN7A 1DU3D 1QJX1 1W6OB 4XE9A 2I45A 3CDZB 4AVAA 4IERA 4OQ8A 4CSWA 1LOGA 1ULFA 4ZS2A 2VR4A 1VBA3 3AZYA 3T30A 1UD1A 3N4MA 2HWD1 2D98A 1ZZCA 3R4UA 4BU2A 3IBMA 4HZFA 3VBOC 5HV4A 4FXGB 2XJUA 4A7YA 1UKGA 4DXZA 3VBSA 5LBBA 2DFBA 2Q4SA 2A3XA 1BBT3 2HYKA 5FTTC 1PZ8A 1OOPC 1UY1A 4LE4A 1UPSA 2R062 2R6QA 1ENXA 1A6CA 2QVSB 4M0HA 4OYUA 3I3MA 1LESA 3H8OA 2QJVA 2VZUA 4CP1A 2B42B 1X8MA 1D0HA 2D7FA 3DUIA 3N9PA 1N3PA 1FOD3 2CGNA 2EXIA 5D1IA 4M3CF 3POGA 3VKFC 4WBBA 4QPIA 1C28A 4HVOA 4JX0A 5H9QA 2NMNA 4MUVA 2K2SA 3W9AA 1FAYA 3ZYFA 1UW8A 2OX0A 5C3RA 1P8JA 5D21A 5FREA 3U11A 3ZYBA 5A32A 1Z0HA 5C6CA 1DQ6A 5JPNB 1ZZ8A 3C8XA 4KWJA 4XF0A 1ZREA 2IXHA 3ACLA 4KU8A 1IHMA 2D97A 1S0IA 4ORFA 1RJ8A 2IXIA 3WF4A 4GIQA 1WW7A 5DZEA 4R4XA 5FP8A 4QQPA 2HLEA 3N9MA 5A7QA 4WVVA 1VLNA 2EIDA 5IJRA 1OKQA 3VBFC 1IQDC 2VD7A 4LIVA 2HH9A 4QKFA 4Y26A 3RPQA 1E57A 1OKOA 3WG4A 4XUNA 3LD8A 4HPKB 4COVA 2ZX4A 2K9ZA 1F2NA 1HRI2 1XNDA 5J36A 3A4UA 2PA7A 3AYDA 5A32B 5IYYA 4J6GA 1U5IA 1NCQC 5CKNA 1LCLA 1NQJA 1QNYA 2Q30A 4QPGC 3IMMA 2BFUS 4QHBA 2PMWB 1N1YA 4Z2WA 5LA0A 1FATA 2WNVA 1W9YA 4IV1B 4BCUA 1LKNA 2RS11 1PNGA 3TNPB 2ZX2A 4X8PA 1DCSA 1POQA 4FOQA 5FZ0A 4QM9A 2UWBA 3IDBB 1J83A 3QH6A 2XB6C 4R4ZA 4WVMA 4EN0A 5A1LA 5J1XA 3H8XA 1W9SA 2JIGA 4JKKA 5FBZA 3DF0A 3PJQA 1K5MB 1PNFA 4J1XA 3OEAA 5DABA 4FFHA 3T2PA 3IIAA 2VXJA 1K42A 2TUNA 4GXLA 3B94A 5AFEA 4S2DA 4D94A 4JRAA 1VALA 1VIWB 4QT6A 3KGZA 1STMA 1S0JA 4RYDA 3ZSEA 4J1WA 4BM8A 3FL7A 1RINA 2VZQA 5FKBA 2D44A 3LWCA 3ETPA 3C7HA 3HQXA 1PO13 4UBHA 4QPWA 3CQOA 5CYYA 4OQ9A 5LATA 3O5SA 4COUA 2WN2A 4YRDA 2E6VA 3HVDA 3E5XA 5FZ3A 2C26A 3JB4C 1EAH1 1V9U2 2WIIB 3AYAA 4P00B 5LK7B 1VBA1 4Q1PA 4QHZA 4LULA 1RUC1 5KHJA 1GZ9A 4XF1A 3EXUA 5C7GA 1SCSA 4EWDA 1C5IA 2SLIA 4L2NA 1W39A 4XBLA 4OFGA 2VMHA 1MZ5A 1W6MB 1S0DA 2X8KA 4YG3A 5L9VA 3GYDA 3OGGA 4PDWC 2RE9A 2WNUA 3USUA 1D4M3 4CEYA 2R072 5FMOL 3MIBA 1W6QA 1HKDA 1BCXA 4IXLA 2O0OA 5JAXA 3WF0A 3HR9A 3MPBA 1W8FA 3AJYA 5FYUA 4CDXB 4DRVA 2XG3A 1F8VA 3H50A 1Q3EA 2RDRA 4YFZA 3THPA 3I2OA 1ZM1A 1JS9A 5DXDA 3BKZA 3B3QE 3IWZA 3LA3A 4YARA 2FZ1A 1Z7S1 4META 5CBLA 3NNJA 2DURA 5KBFA 3DL3A 4YM3A 4YGEA 3X29B 1REDA 2BP6A 4ES9A 3ZFGA 4NHMA 5EHDA 5CIRA 1WGPA 5F39A 3WW2A 3FMGA 3ZN5A 2YGLA 2B7YA 2ZCWA 2A6VA 1HLCA 4O9GA 4A7ZA 2W5FA 2BOIA 2C1FA 1BVVA 2WUHA 4CZSA 3H9AA 2W92A 2PQSA 1UWWA 2DBNA 3USSA 1H2MA 4PQ9A 3VBRA 1O7FA 3ZSMA 4FP2A 2MNGA 1RUOA 1X36A 1WMEA 4JGZA 3HT1A 3SKJE 3N9NA 4Q4W2 2B5HA 3C7EA 4AGRA 2WS93 1JYCA 2VZ1A 2QDRA 2DUPA 2VNOA 4IEPA 4QKNA 3P1IA 5LA2A 4BQ1A 3POBA 3SCFA 2G4IA 3RWKX 5T3NA 2VQTA 2YC4A 3T08A 4K8FA 4ISQA 1GP4A 3VZLA 3I3EA 1RUI2 4Q8LA 1PO11 1DGWX 2VXRA 2OQ6A 2OT7A 4QDSA 5C70A 5I0UA 1XU2A 3NJYA 5FYSA 3RJRA 2GZWA 1SCRA 3KCCA 5FWJA 4K20A 1LTEA 4GKYA 2VMDA 5FP3A 4EROA 3VBRB 3DKWA 1LJ7A 1KITA 4ATEA 5FMDA 1EPZA 1PGW1 3KB5A 4XEZA 5DQ0A 3R6SA 3NVCA 4JKLA 1NE4A 4P9WA 1UX7A 4OHZA 4COYA 4DY5A 2ILMA 2XKPA 1DP0A 1Y3TA 3MIGA 5FZIA 1UKRA 2ZXQA 4D6RA 4COZA 3MLJA 1APNA 1CAUB 4FO9A 5LBCA 3UKNA 4CDWA 1JW6A 1QDCA 2J1AA 3U78A 2ZEXA 1YJLA 1I6XA 3C7OA 2E7QA 3MIFA 4LKSA 1GZCA 1SG3A 4BQXA 1RUI1 1QJEA 3KT1A 2WZR3 2OKXA 2VJXA 2CWMA 4M4PA 1CAWA 3L2HA 3KT4A 2ZGUA 1RUJ1 3B7MA 1CX4A 1ND3B 2PQQA 3T1MA 5LRSA 4WM8A 5BV6A 4QXCA 3AVSA 1NKGA 1W8NA 1ULOA 2W08A 2IVIB 1RL3A 4AVTA 3THCA 4AQSA 4XJWA 4E27A 3CU7A 2G9GA 2D6MA 3CIHA 3WF1A 1IOAA 5FY1A 2WFPA 3K77A 4CEYC 1JHJA 4EN7B 2LM3A 2PHXA 2P34A 3A7QA 2QCSB 5CKQA 1PGL2 2JE8A 5J3UA 2VBBA 4BIOA 1SBEA 2C5DA 5F3IA 2WSVA 4NROA 4FPFA 4AAXA 4CDUC 4LBMA 5J7MA 1UU4A 2F4LA 3GHMA 1CJPA 3MPPG 1RHI2 4IGOA 1FPN2 2WZR1 4HLTA 4CCLA 4CU6A 1V6IA 4ZKTB 1XC6A 1RUI3 2BTVC 2VE1A 3FWEA 3BU0A 2NP0A 1E5RA 1POV0 2WLQA 3J8F1 3LE0A 2VZ3A 1QQP2 1G8WA 4BK5A 3FC0A 2QKDA 2D6OX 3ZXJA 1OUSA 1RGSA 3I59A 1W6PA 4QQOA 4Z82A 1OLMA 4ZU5A 3VKNA 1XNKA 1DYPA 3BVCA 1FOD1 3NAPA 5A3UA 3IT8A 1SBDA 2EXKA 3GZEA 4R9CA 2GP3A 2HWB2 2ZGRA 4D7YA 3CJIA 5LB6A 3A0NA 2WAOA 1W2UA 2EA7A 1HJFA 1F35A 1SLTA 1CAVB 4MGZE 4P5YA 5EJ3A 5FYZA 4HANA 4IGQA 1J1LA 4Q4Y1 4DXRA 3NRUA 4BXSV 2CAVA 1MQTA 4OUEA 4M3CE 4XTPA 4BQ4A 3LSEA 4D7SA 3N9LA 1V00A 1VAVA 3C7GA 3D82A 4N53A 4AXOA 4DNYA 3VHOA 1VB2A 1W6NA 3AP5A 2YB7A 2VGDA 2YPDA 2B9VA 2DTYA 2PHRA 2DUOA 1NCQB 2QDNA 1GBGA 2VW0A 3HT2A 5JI9A 1QEXA 2V73A 1GNHA 4Q4X3 4XAEA 3WV6A 3ZFEB 1HQLA 3BYWA 3SCGA 1ND2C 1LOCA 3SISA 1TMF2 2QQVA 1PVC2 1RC6A 5CAZA 1SFNA 2YFUA 4IEVA 4JHTA 5EFUA 2XGXA 2NZ9A 3PVNA 2ARCA 3NV1A 4X8NA 1DQ4A 5CISA 1OFNA 1QJY3 3LQCA 2PTMA 4Y1XA 1VBC2 2QQPA 4Y4YA 3AVRA 1GNZA 5A7PA 3SLIA 5LBEA 4P14A 2E53A 3OGJA 5FMCA 3PUIA 5EZWA 4XXAA 1I5PA 3BPSA 4HKOA 1NXD1 4GB31 4ZY9A 4OUMA 3VDDA 3HQRA 3MFCA 4NHYA 1AXYA 3ATGA 3BODA 3MIDA 3SH4A 3U1XA 3C7FA 4HSLA 1OUXA 2VCMA 3ZIXA 1X9PA 4GB33 4Z92B 5A7SA 4GWIA 4BOWA 4C0BA 4ASLA 1QU0A 4YFWA 5FZKA 4AI9A 5IK8A 1IG3A 1NYWA 5FAXA 3R4DB 5FP7A 2FDJA 4LUKA 4IEYA 3WT3A 2WNVB 2RS52 4GMP3 3HPNA 2VO5A 1H4HA 1QWRA 1NT0A 3ZXEA 4V1PA 1Y9MA 3J9SA 2QQIA 5F7UA 4JCKA 2OYZA 4BJ0A 1PMJX 3OOXA 2R30A 1R092 2W9XA 4AK3A 3LDKA 4E4HA 1VPHA 2PLV1 1N47A 1ZZ9A 3FBYA 1QJU2 1RUC3 2PHWA 5I8SA 5IK4A 4B8EA 4INDA 1Z7S2 2WWUA 4Q5OA 2VMIA 2WZ8A 1X9TA 4Y3OA 2OW4A 1J84A 2MEV3 1R1A1 3FFQA 3Q8EA 1CJDA 5HXMA 4LBNA 2VM9A 2PHUA 4K8RB 3CHXA 2HBTA 4GH4A 4OCTA 4OHVA 4AFAA 3VUOA 3NKGA 3LPGA 4GAZA 1NA1C 4LTAA 1HQNA 5DDJ2 1X50A 4FFFA 4KBZA 4Q4Y3 1OPOA 2GU9A 2VZPA 2KXLA 3OBRA 2W39A 4DZGA 1TME3 4QPIB 4YM2A 3IMNA 2A71A 5CU1A 3H7JA 3AJZA 1W90A 4NPRA 1AR62 2BNNA 1GLHA 2A7AA 3LEIA 1GZTA 1RUG2 1I9RA 4Y1UA 2JD9A 1DLLA 4QQHA 1CAUA 3D5OA 4CDWB 4Y4RA 1PK6A 3HIFA 4SBVA 5BNPA 2D6PA 1WLCA 1MQTB 1MACA 1S0FA 2TNFA 3IM0A 3O7OA 3SEEA 3UKTA 3VBHC 5CZKA 4CDQB 4M00A 3M3EA 3FUOA 2GH8A 3K75B 4PIYA 2RS13 4Q4W3 4UAPA 3DECA 4NIHA 5FZ7A 2E33A 1JZ4A 3W5NA 2Y6KA 1ZZBA 3D0SA 1CN1A 4KMQA 1TNFA 5ABJA 3TWIA 3T4VA 2XXZA 5FZOA 5DZGA 5JUVA 5FYYA 2J42A 1KJRA 3QACA 1WD3A 2O8OA 2DCYA 4M4RA 2JDHA 4Y22A 1PM4A 2Y6LA 5H9SA 1RUD2 5C33A 2ZJCA 5AFBA 3RMXA 5DDJ3 2HWF3 2J1EA 2PHLA 4N43C 1JOBA 2XHNA 3IAQA 4NAOA 1GYKA 4XCBA 2BFUL 1GQPA 5APAA 2CNAA 5D2AA 3MEPA 2RDSA 1IZ3A 4M3CB 2ZEWA 5FPAA 3BOWA 3WUCA 1COV3 3JD72 1REFA 5K4LA 4EE2A 5DPNA 2WO7A 2WT1A 4JGZB 5DG1A 3WP6A 3N3HA 1LGCA 1NLSA 2W91A 5EWSA 3AFGA 4IEOA 1NOVA 1UZZA 4JVAA 4LHKA 5C8CB 4DUVA 1RUJ2 3RG0A 4AQTA 4XHBA 1QNWA 5ERLA 4XYXA 4UBGA 2WINB 1HB1A 3ZKUA 5BNNC 5DMYA 2WZR2 2Q8OA 5E6HA 1W2NA 4W6WA 1K5JA 4L99A 3B9CA 2WR9A 3AXEA 4Q0PA 2ZHMA 1AR81 1CZSA 2EIGA 5FZ1A 2WL1A 1FNZA 5A7WB 4BK4A 4UI9L 3M3QA 3ACIA 4YM0A 4FOVA 4W6YA 1EPWA 2EXHA 2UYBA 4WM7A 3S6PA 2RS51 3CLPA 2PYTA 1FYUA 2XUEA 3MV11 4AHYA 4EN8B 2BBAA 2GMPA 3I7DA 1US2A 2XL9A 1ZA4A 2IC1A 3MV01 3JQWA 5A7OA 4TXWA 1BBT1 4KI5M 4JDMA 2Z69A 1HW5A 2VCAA 3A0KA 1XNTA 1W6MA 1NE6A 4LO7A 4R9BA 2X09A 2YXSA 3B02A 4UW3A 5FZHA 1GP5A 3ZFFA 4AI0A 3BIEA 1N1VA 3AZVA 3KSCA 2HWD3 3A21A 4CDUB 2IXJA 5JZGB 4HONA 2ADEA 5FMOS 5KHHA 5FY7A 2B45X 1W6OA 1ONAA 4XF3A 4O65A 4MGQA 4IV3C 1RUH1 4CEWB 4CP2A 4XACA 4A41A 1JZ3A 3S30A 1NZIA 1US3A 3PHMA 2O8QA 1QJX3 1YQ8A 1GOGA 3IZOA 3AMQA 3PUQA 4BB3A 4LBKA 2AZ5A 4B3NA 1BK1A 4OI0A 5CB7A 3WF3A 1S4CA 2O14A 2QQUA 3I2GA 1IPJA 4GALA 3MDPA 4IE6A 2XJPA 5IW0A 3HNYM 4QKDA 1H6YA 4YVWA 3DYOA 4IEXA 4ZXEA 4EYUA 2P1BA 1QGLA 3PVEA 2C6SA 3WQ7A 4LQRA 5I0DA 5HCHA 4AVCA 3JU9A 3VDDB 1QHDA 1V6NA 2Y38A 3OD4A 4BHPA 4EV0A 2YPJA 1Q5OA 2DCZA 4QPIC 1YI9A 3MW2A 1CX1A 3GBFA 4LO6B 1V6JA 2X05A 4DEVA 3B00A 5FIXA 1ALYA 4M01A 1PMHX 5FLJA 1JHNA 3PNAA 5FZCA 5HV0A 2VH9A 4JKMA 4QB6A 1KXGA 4NN0A 4FT8A 1MQTC 3ZFEC 4BXFA 4D0QA 2HWB1 2FDFA 1O4TA 1ZZ7A 4CP9B 3AZXA 2G9FA 4A2UA 3RRDA 5DN2A 4CUAA 2MPFA 3K3OA 4I0AA 4XZUG 3KV5A 3AL5A 1LGBA 5DAVA 5C4WB 4I2OA 1R083 2VY0A 1YQ2A 1CIYA 5IVCA 4CCKA 3DPRC 3E5QA 3LDRA 1CAVA 5F5QA 3DEMA 3M70A 3J8F2 1AYN3 1W3VA 1EAH3 1ENSA 1QH6A 3POJA 4CU9A 2DCJA 3CJIB 5FYCA 3VB9A 5BNOB 1CGPA 4YVSB 4KWUA 1FPN1 5L73A 2DFCA 2XJQA 3OTFA 4N43B 4ITCA 4GMP0 2XMLA 2YV8A 4UF0B 1DGRN 4MH0E 2QQJA 4G3YC 4QPGA 4URTA 4A44A 4LLFA 4GJYA 4LA2A 5HCBA 3WDTA 1OSGA 1B35A 1WMFA 3POYA 4O9EA 4JGZC 4K6BA 4X6RB 5GZGA 5EXOA 5FLHA 1IPSA 1WCDJ 2BV4A 3C2UA 3WQBA 5KXEA 4D3WA 3MO4A 1SHWB 3ILRA 2RR11 2VCCA 5ANNA 2IFRA 1I3HA 1FMD1 4MADA 2IZWA 2BWCA 4W6XA 5DUXA 4K9SA 2CV6A 4RS5B 4MGKE 3VBUA 4JTOA 2VMGA 1WMXA 2WFF3 2AGSA 3AXDA 2WJSA 1VBB2 3AKQA 4YSFA 3P6BA 3ECQA 3JBG1 4XZPA 4FTSA 3LFMA 2KD7A 2JICA 3AYEA 1JU3A 4P5HA 2JDNA 2MEV2 3BTXA 1NCRA 2ETEA 3IIIA 3KV6A 4DB5A 3LF7A 3T4HB 5LZ6A 3WW3A 1RVF2 3OJBA 3TN92 4XFHA 3P3PA 4LO4B 1H2NA 1NA1B 1HB2A 4AW7A 4S2HA 5FY5A 4XILA 3WNOA 5CFCA 1Q8PA 4M3CA 3U75A 1UMIA 4XQDA 3ZN6B 2TBVA 1DG6A 4NUBA 2PLV2 4CE8A 3H3LA 1KEXA 3RS6A 1JH5A 1LECA 1VE0A 4LBLA 1KQRA 2VZOA 2RJLA 3OG2A 4AVSA 2JB4A 2D93A 4YW1A 4LORA 1GICA 2B39A 5A33A 4Q4V3 3VKLA 1OT5A 2GSYA 5JSOA 3DGTA 1Q8VA 3JZVA 2DVFA 4IV3B 5T5LA 4CEWC 4IGPA 1LU1A 2A70A 3FHIB 3TYJA 2BDRA 2W1SA 1GP6A 4B4RA 3EYPA 1H1MA 3OBTA 4LBQA 3ZPOA 1S55A 3DV8A 1ND2A 3ZMNA 1ZVFA 5F32A 4IE4A 1S0BA 3L2YA 4CXWA 3T0DA 5IVBA 4RQPA 1DFQA 2V72A 3ES1A 1F9KA 1RUD3 4ISRA 1TQ5A 1MS3A 3ZM8A 3RZLA 3BN6A 4DO0A 5F6KA 3BTYA 1TMF1 3D6EA 5G04L 1RVF1 2ZS6B 5C9AA 3N7LA 5FDBA 1FI2A 1PX3A 1RHI3 2ZX0A 4I09A 3VDAA 4YM1A 1E5HA 3Q8BA 4NIDA 2Y6GA 1YIPA 2VUCA 5A7NA 5JZGA 3NNMA 3BPZA 3H1WA 3N36A 2A3WA 5LASA 4QPGB 2Y26A 4PI0A 1TEIA 3RYRA 4AWDA 4DQAA 4FTEA 2B46X 2W3JA 5A6YA 5C8CC 3ZSKA 4L11A 4L9BA 1F5FA 4Q0VA 4NPMA 1V0AA 2IWGB 3HD8B 2RR12 2VU9A 1OD5A 5SV5A 2GN3A 4A42A 2GMMA 4NE9A 2E7AA 2JG8C 1HXS3 3K4ZA 4KH9A 1T6GC 3KGLA 3LCPA 2VTXJ 3ZYHA 1OF4A 1DQ1A 5IAXA 2DCTA 4QQLA 3VBUC 1KJLA 1OA3A 1RJ7A 4GJZA 3EMRA 4DXSA 1XSQA 1FOD2 3NNFA 4P9JA 2ZKNA 2X5IA 2WSUA 4F8AA 4HVQA 1XJAA 4HT1T 4NO4A 5FP9A 1CAXB 1WCSA 1RMU1 4WM8B 1J59A 1S2BA 1N1TA 1QOTA 3ACFA 3N7KA 4K3UA 4LHSA 1B35C 5GM0A 4B4QA 2LTNA 1T6BX 5CADA 1NCRC 1BBT2 1W8UA 3MUY1 4CCEA 2ZHNA 3JXSA 1ZRDA 1L3JA 1UMZA 3RZZA 4HL0A 1DF0A 1EUUA 1N3QA 3HN3A 5FJHA 4MSVA 3FHQA 4E8DA 4DOUA 1URXA 2A5ZA 5BPXA 3TN91 1WA6X 3K4AA 4ZU4A 4CXXA 4AGVA 1W04A 1V6OA 4PF1A 1V6MA 2BNMA 3ENRA 4PBPA 2D6KA 3B5LB 3SMHA 2OA2A 3JCIA 1VR3A 4F7ZA 5ISLA 3H8RA 1XE8A 5DAWA 3V0AB 2BQPA 3HJRA 2JEMA 1GV9A 1HRI3 1XYPA 2NN8A 4OHWA 3V0BA 1ZBA2 1UYZA 1JYNA 1JU4A 1KDKA 4F83A 5C5UA 3BI3A 4LITA 1RIRA 1GU3A 3LFIA 4LK6A 5A3WA 1A8DA 4AEJA 1IGOA 2RM21 3D3AA 3MLKA 2BWAA 2D40A 1POV1 1ZRIA 4AQ2A 4TTGA 3SCHA 4DIQA 4KQ7A 1VAMA 3HMYA 4UFLA 3SQOA 3PMEA 1AX2A 1NX9A 4AFCA 3WSOA 4FOYA 2XVGA 1ASJ1 3AP4A 3NSTA 4Q2FA 1BEV3 3APBA 5FZOB 4QX0A 4UWDA 4BQ2A 2G9ZA 5K0UA 1LOFC 1SLAA 5BY5A 3IB3A 3BTAA 2D6NA 3DYMA 3WW4A 3WNMA 5LCWL 2W1UA 2AR6A 2ZACA 3S0MA 4RHV1 1SLLA 4DFSA 3T0BA 3ZMOA 2QTWB 1S0CA 5FYHA 3PL0A 2P17A 4NIAA 4H55A 2W1WA 1Q43A 2VG9A 2H0VA 4AEMA 3RMYA 3MYXA 5G05L 4BQYA 2VECA 4QWNA 2C9AA 3WDWA 1AR91 4YGDA 3KVBA 3LA7A 1W0NA 2P3KA 3U0ZA 5FPLA 1XNCA 1UZVA 1WCKA 1AR71 4KU7A 2GNMA 1GR3A 5CEHA 2WO2A 4YW7A 4BQ5A 5IVFA 1HB3A 5CFCB 1CZVA 1CESA 1DZRA 1NAEA 2XJRA 1ULEA 1OH4A 4N7IA 2BVVA 3LDBA 3WG3A 3WQ0A 1TNRA 3LIHA 2XR4A 2F4PA 1HX6A 4FP3A 5EIYB 1R64A 1S0GA 1PIV1 2XBO2 5H9RA 4YW2A 2ES3A 2R061 3UJOA 1Y9GA 2KM2A 4WVZA 3AMMA 1XU1A 3PIJA 5I0TA 2FDHA 1COV2 1OPMA 2DCKA 2DVDA 1IG0A 2VAUA 4FFGA 4MVTA 1QXJA 4BYYA 1AYN2 4P9IA 3WOGA 4ATFA 2XH6A 4QX8A 4IW3A 3ZN6A 4AI8A 3NWKA 5GALA 1A78A 4KG0A 1UU5A 2BU9A 1AYM2 4RS5C 4FPOB 2WN3A 1M4WA 1D4VB 1C5HA 1DGWA 2ZZJA 5J96B 1LULA 2UY9A 2XVLA 5JR7B 1QJU1 3WD5A 1OLQA 4A45A 2ID4A 4J25A 4Y1VA 3RI9A 4IEQA 4IE5A 4CU8A 1ND3C 2V4AA 1PIV2 2XBO1 4XDOA 1H8TA 1J58A 1UXXX 3FLPA 3AKSA 3CMGA 4CEWA 3VBUB 5C3OA 4W65A 4BISA 2R073 4CDUA 5IATA 1GOHA 2X5IC 2YMZA 3I2HA 3WCRA 4AOCA 3HBZA 1FV2A 3ZSLA 4D6SA 5ACA3 1QH7A 2JDMA 2JKXA 5BXXA 2C0ZA 5LBFA 4HN1A 4U36A 2VZRA 1QIQA 1DYKA 4HN0A 4YW5A 3RZHA 5I91A 2D5FA 3ZLIA 2Q8CA 4HBNA 2J22A 4DY3A 5B4NA 2P4EA 5FZ9A 2ZEZA 1HRV1 2BVBA 4WVWA 4GB32 3KF3A 3KCYA 1UOBA 4XPVA 3WW1A 2IUWA 4TYSA 3USUB 3E6DA 3ZYPA 4NOTA 4IESA 2YU1A 4OI2A 5E88A 4ARXA 4BPZA 1DZTA 2NLRA 1R1ZA 4H2AA 1W6NB 2HWE2 3ZFGB 2UU8A 1L7RA 2DVAA 2FDIA 1SLBA 5JXIA 4XMIA 2GC2A 3VD3A 4OI1A 4ZHNA 4HFSA 3AFKA 5EYYA 5FO8B 3WG2A 4N53C 4XJ8A 2XDVA 3GXUA 4LA3A 5FXZA 2ZGPA 5JI7A 4OLLA 3NV3A 3SH3A 3VZMA 5JWPA 1O3TA 4K1ZA 1VAKA 5JOXA 1SEFA 4W8JA 2FCUA 2J1SA 1JUIA 2HEVF 2V09A 3IDEA 4YGBA 5AVPA 1OOPA 4FPHA 5L7OB 1A34A 3WP3A 4IEWA 2D3SA 1VJ2A 1W0PA 2WWSA 1R1A2 3GDBA 3O1TA 1CAXA 2WT2A 4HK8A 4CP0A 2R043 4QXHA 1AX1A 4QQ2A 2YFZA 1AJKA 3JD71 5GZFA 1XYNA 2Y6FA 4Y24A 2VOXA 2RV9A 3FJSA 1IPKA 2Q5TA 3NAPB 4Y5TA 5E8AA 1PO22 5IFPA 2XQRA 4R9DA 3PURA 1BMV1 4AAPA 2V5YA 1SDDB 3O1SA 4DMIA 1J3PA 2BJSA 3O1OA 4I01A 2ZHLA 3AMPA 2AC1A 1K3IA 2D43A 2W68A 4G4FA 4GQ7A 4HSJA 1J1TA 2C9KA 2E31A 2EAAA 2JDYA 4YW4A 1PMIA 3WDUA 1S1AA 1HXS2 5ABJB 1ZBE3 4BMBA 2DYCA 1VBE1 2JG8B 3M3CA 4LKEA 5LK5A 1EYBA 1JZ6A 3OBAA 1C1LA 1U0AA 5EYXA 2O1QA 3H7YA 1NY71 5FO7B 4AGGA 3LB9A 1H8TB 1RUE3 2VNRA 2ZGKA 1U5ZA 5FJKA 4MYEA 5FQ0A 3UKVA 1PZ7A 2PHDA 3ZFEA 1VRH3 3SHRA 5C5TA 3KVAA 4PLOA 4C90A 1FNYA 3FBMA 5DUUA 5BNNA 3I3DA 1H8VA 1UYYA 1DGRA 1H6XA 4LHNA 2AACA 5FV3A 1AR63 3OBZA 5CKMA 4H7LA 2WNVC 3OEBA 1ASJ2 2BYVE 5FCCA 2YBKA 2YUEA 5LWBA 5CFDC 2Y8KA 1ZRCA 2ZEYA 1VBD1 1UAIA 4RSUA 3U37A 1AR82 4O7XA 3D4KA 4PBOA 1JYIA 1KRIA 3JB8A 1XNBA 3ORJA 4AEKA 5T5PA 5A6ZA 5CA6A 4EN9B 2GC3A 2Y64A 5A7WA 2FDKA 2RMU2 1CR7A 4XF9A 5JOZA 4N9HA 1CPMA 4H14A 4BE3A 2HWC2 2XKOA 3S57A 1V9U3 1OFSA 2ADDA 2P2KA 5F2SA 3RYPA 5FO9B 4JV4A 4CCMA 3OUIA 2R7EB 5A3MA 5FK8A 5HI0A 2PFWA 4AE2A 1PVC3 1YFUA 3I2JA 1GQGA 5D8AB 4RQPB 1MZ6A 1AL22 3RSJA 2QBXA 1H4GA 1UOJA 5HXVA 3J26N 4WZCA 2AUYA 1GNYA 1DIWA 1AXZA 1Q8SA 2LROA 1VBB3 4LHLA 4JGYB 1WCUA 1X8EA 3POSA 4QX3A 3RI8A 3V56A 3O12A 4CDWC 1WKYA 3GJBA 4Y1ZA 3BB6A 4Q27A 1RUF1 4LOSA 1VBA2 1PX4A 1ULCA 1UL9A 4CDQC 3NJZA 5DAXA 4P02B 1SPPA 3ZFGC 2VL4A 4RR3B 2Q8EA 1AXKA 1ENQA 1SZBA 4AVBA 1BJQA 1ZX5A 2ET1A 3K4DA 3KZ4C 5FYTA 4GKXA 2KA3A 2JG9A 3RFRA 5L7OA 1VB4A 4W50A 4NHXA 4CYDA 1MZFA
chains in the Genus database with same CATH topology
4XAAA 4NHMA 3GZEA 5LB6A 4NHLA 2A1XA 3PL0A 5HV0A 4Y5TA 2Y34A 4Y5SA 2RDNA 4BQYA 5DAPA 2FCVA 4NMIA 2HBUA 3W21A 5DAVA 3NNMA 4XCBA 4NAOA 4NHKA 5LASA 4ZONA 2RDSA 2G1MA 3MGUA 4XCAA 5LA9A 5EPAA 5IAVA 2FCTA 3OUJA 3ITQA 4IW3A 5C5TA 5LBEA 5IAXA 5ERLA 4MHRA 4ZPIA 3GJAA 3EMRA 3NNFA 3OBZA 3HQRA 3HQUA 4NHYA 5EP9A 4JZRA 2JIGA 4J25A 5M0TA 5LBCA 2V4AA 4MHUA 4XABA 4BQXA 5IATA 3KT1A 3KT4A 5LBFA 5LATA 5L9RA 2OPWA 2Y33A 4XC9A 3NNLA 3OUIA 5DAWA 5DAQA 4Q5OA 2G19A 3OUHA 5HV4A 5EQUA 4XACA 5C5UA 2HBTA 5LBBA 2JIJA 5L9VA 3W20A 4KBZA 4BQWA 3GJBA 3DKQA 5DAXA 2RDRA 2FCUA 3KT7A 2RDQA 4UWDA 2RG4A 3BVCA 4NHXA 3NNJA 5L9BA 5A3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XAA A;  4NHM A;  3GZE A;  5LB6 A;  4NHL A;  2A1X A;  3PL0 A;  5HV0 A;  4Y5T A;  2Y34 A;  4Y5S A;  2RDN A;  4BQY A;  5DAP A;  2FCV A;  4NMI A;  2HBU A;  3W21 A;  5DAV A;  3NNM A;  4XCB A;  4NAO A;  4NHK A;  5LAS A;  4ZON A;  2RDS A;  2G1M A;  3MGU A;  4XCA A;  5LA9 A;  5EPA A;  5IAV A;  2FCT A;  3OUJ A;  3ITQ A;  4IW3 A;  5C5T A;  5LBE A;  5IAX A;  5ERL A;  4MHR A;  4ZPI A;  3GJA A;  3EMR A;  3NNF A;  3OBZ A;  3HQR A;  3HQU A;  4NHY A;  5EP9 A;  4JZR A;  2JIG A;  4J25 A;  5M0T A;  5LBC A;  2V4A A;  4MHU A;  4XAB A;  4BQX A;  5IAT A;  3KT1 A;  3KT4 A;  5LBF A;  5LAT A;  5L9R A;  2OPW A;  2Y33 A;  4XC9 A;  3NNL A;  3OUI A;  5DAW A;  5DAQ A;  4Q5O A;  2G19 A;  3OUH A;  5HV4 A;  5EQU A;  4XAC A;  5C5U A;  2HBT A;  5LBB A;  2JIJ A;  5L9V A;  3W20 A;  4KBZ A;  4BQW A;  3GJB A;  3DKQ A;  5DAX A;  2RDR A;  2FCU A;  3KT7 A;  2RDQ A;  4UWD A;  2RG4 A;  3BVC A;  4NHX A;  3NNJ A;  5L9B A;  5A3U A; 
#chains in the Genus database with same CATH topology
 1LOE A;  4XAA A;  4MXV A;  1X33 A;  1QJY 2;  2A6Y A;  3AMN A;  2WNU B;  4HVR A;  1VBC 3;  1LRH A;  4QDR A;  3VBF B;  1KFX L;  2XJT A;  2J1V A;  2ZHK A;  1D0G A;  1YI7 A;  2RM2 2;  4HKL A;  1JYW A;  5A70 A;  5K8S A;  2GAU A;  1F31 A;  1PO2 1;  3ZIW A;  1Q8O A;  4NMI A;  4YVS A;  3CKH A;  2GME A;  2HBU A;  2RS3 2;  4G9S B;  4K21 A;  1ENR A;  3ZKY A;  5FZF A;  4CPB D;  2QQM A;  3H3Z A;  2DF7 A;  4XQ4 A;  5KHG A;  4XJZ A;  4DUW A;  1VMJ A;  1DZQ A;  1KS4 A;  2I07 B;  1EUT A;  2E51 A;  1ULD A;  3LPF A;  5T54 A;  2XJS A;  2RS3 1;  4IDZ A;  1OC1 A;  3OPZ A;  2MHF A;  2ZKL A;  3KS7 A;  2J7M A;  4IV1 C;  2VOV A;  3T2T A;  5K7P A;  4NPL A;  2D6L X;  1O3S A;  2FQP A;  2JWP A;  2KR2 A;  2DBI A;  5IFT A;  3HNB M;  5FY4 A;  3EO6 A;  1AL2 1;  1A3K A;  4CU7 A;  1ODN A;  2WO1 A;  1MVQ A;  3SH5 A;  2VW2 A;  5F3C A;  3QLQ A;  1WZX A;  3VDB A;  3I2D A;  3AB0 A;  1O8S A;  1YCI A;  3VGI A;  3ITQ A;  5A3L A;  1PGW 2;  4AED C;  1K5M C;  1GFF 2;  4TZD A;  1N3O A;  5SV8 A;  1C8M 3;  3OD0 A;  3GHN A;  3M4F A;  5GZD A;  2HWE 1;  4AQ6 A;  2DDU A;  1RMU 2;  3KLS A;  1S2K A;  2WYS A;  5EP9 A;  2GND A;  3GAL A;  4V2V A;  3WCS A;  3WX5 A;  4CCO A;  3EJK A;  3VHR A;  5F37 A;  1BVP 1;  4QX2 A;  4MXW A;  2YZ4 A;  5EJ1 B;  3GBG A;  2XON A;  4QGN A;  4QX5 A;  1BHG A;  4AZZ A;  3OY8 B;  2BGO A;  4N90 A;  3EBR A;  5I0R A;  4XTM A;  2H0B A;  3U14 A;  4RA0 A;  2JDA A;  1MR5 A;  2R0H A;  2VVD A;  2ZGO A;  4Y20 B;  4PLN A;  2R1D A;  3NJX A;  1WA4 A;  5J48 A;  2OII A;  5LW9 A;  3ACG A;  1O3Q A;  1E5S A;  1JOP A;  4MX3 A;  5E1R A;  4EN6 B;  3K46 A;  1D2Q A;  5FXX A;  1XBF A;  2E26 A;  1MS4 A;  2XLA A;  5AC9 2;  1RUG 1;  1MS8 A;  3KHC A;  2WLP A;  1AF9 A;  2EIC A;  3PTY A;  1V70 A;  5F2W A;  2X10 A;  3EQE A;  5FFO C;  1YJK A;  3NMB A;  4PDW B;  5KXC A;  2Y0I A;  2WA4 A;  1UZW A;  1AX0 A;  1IS3 A;  2RS1 2;  2CYF A;  1TVG A;  3VL8 A;  2OQ7 A;  3MIE A;  1YLL A;  3Q8A A;  5A3P A;  1JYX A;  3NNG A;  4B1M A;  5JXG A;  4A6O A;  3OGV A;  2P3Y A;  3W58 A;  1ZBA 3;  4OHX A;  4D8M A;  1AYM 1;  4MGS A;  4RFR B;  5BNP B;  1G9A A;  5T50 A;  3LSD A;  3FE5 A;  4B7K A;  2Z79 A;  1W03 A;  1QXR A;  1WBL A;  3AM2 A;  4OMD A;  3POE A;  3WG1 A;  4HET A;  2ET7 A;  3PDQ A;  1EV1 3;  1FMD 2;  4K1Y A;  3VZK A;  1UYX A;  4R8H A;  4JGY C;  2WC2 A;  5LY2 A;  3WXP A;  1W8H A;  1UY4 A;  3NV2 A;  1W2O A;  4YW3 A;  1DQ0 A;  3K3N A;  3U07 A;  3WP4 A;  4Z07 A;  1C8M 2;  4CUB A;  1JOD A;  2FD8 A;  1S2E A;  4IQP A;  4CDX C;  1O4Y A;  4V2W A;  1FT9 A;  2P37 A;  4FPL A;  4R52 A;  4HG6 B;  1C8N A;  4JHZ A;  4JAA A;  3ROU A;  5T5J A;  3PU3 A;  2WRA A;  4DXT A;  2ZX3 A;  2C24 A;  3QBQ A;  4E4S A;  1DHK B;  5HCA A;  5KC6 A;  2P3J A;  5DAP A;  2JD4 A;  1FXZ A;  2FCV A;  1YHF A;  2Y60 A;  3OCP A;  3CJI C;  4YNI A;  4BQ3 A;  3J7H A;  1IS4 A;  4LLO A;  2YYO A;  1ULP A;  2E9Q A;  5CFD A;  4UT5 A;  3TOJ A;  4Q4X 2;  4NHK A;  3WQ1 A;  5FWE A;  4L0P A;  5GLU A;  4UW5 A;  1VRH 2;  3FX3 A;  4QM8 A;  5FZ8 A;  5K0U C;  1W9F A;  2GDF A;  2LAL A;  5C8C A;  4DUX A;  5JZG C;  1RUN A;  4XQW A;  3BIW E;  3VBS B;  2VUA A;  1B09 A;  4I0B A;  4L8Q A;  2WWJ A;  3GGL A;  3QH7 A;  5F5A A;  4JGY A;  4W4Z A;  5FZ4 A;  3I3Q A;  4XFF A;  4JTN A;  5F3E A;  5LA9 A;  1R09 3;  2ZAA A;  1GSL A;  2CL2 A;  1LHN A;  3DN7 A;  4XJ9 A;  1BKZ A;  2F6B A;  5FOJ B;  2ZAH A;  2K46 A;  2LW8 A;  2BZD A;  3LOI A;  1KS5 A;  4BLI A;  2RMU 3;  5A3O A;  3I2F A;  3OB8 A;  3S5Q A;  5J09 A;  5A1F A;  1OF3 A;  4YZ2 A;  4MHR A;  3UGF A;  4LO5 B;  1SLI A;  5CFD B;  1JOJ A;  2YC2 A;  1LOA A;  3BOP A;  5A33 B;  3KCX A;  1MS0 A;  3VD5 A;  3CZU A;  3VBR C;  3OF1 A;  2CTV A;  4HXC A;  5EV7 A;  2CHH A;  1XQN A;  1WW5 A;  1WUV A;  2WA3 A;  3OPT A;  3OYW A;  3M2M A;  4MHU A;  1C8M 1;  3PUS A;  2HWC 3;  4MO3 M;  5F3G A;  3UES A;  3U4X A;  1ZZ6 A;  1HDK A;  5FZE A;  5L19 A;  1W06 A;  3DYP A;  1JBC A;  4CCJ A;  4Q0S A;  5B4X A;  1JZ5 A;  5FZG A;  3GBW A;  3AKP A;  4RGK A;  3N7J A;  4K40 A;  4CEY B;  3POW A;  3T2Q A;  1AL2 3;  2ATF A;  5D8A C;  4FOW A;  1UY2 A;  5IVE A;  3WVJ A;  1JZ2 A;  1BLZ A;  1O8P A;  4EQV A;  2PAK A;  2XUM A;  3HNM A;  4AVV A;  3MBW A;  2EIB A;  4OHY A;  2VBP A;  1AR9 2;  3ILF A;  4FPE A;  3AKT A;  1JZ8 A;  3RZJ A;  1O5L A;  3J7N A;  5DAQ A;  3WR0 A;  5GLV A;  1HRV 3;  4ZZ5 A;  2AYH A;  2JE9 A;  2W95 A;  2OVU A;  3F2Z A;  1DDL A;  1MEC 3;  4L92 A;  4DPN A;  5EQU A;  4ZU7 A;  1D2S A;  1HN0 A;  2NYY A;  3LAG A;  4PIX A;  3WLU A;  2VVF A;  4COW A;  4R9A A;  2WT0 A;  2IXL A;  1BYH A;  1XOY A;  1GOF A;  1PGL 1;  4NII A;  3GZA A;  2Q8D A;  3ZXD A;  1WCQ A;  3A22 A;  3E97 A;  3DXU A;  1OBN A;  5KXD A;  3M3O A;  2VNV A;  3UJQ A;  2IVJ A;  1GMM A;  2VMF A;  1SPP B;  2ZPX A;  3WHT A;  1LEN A;  4Q29 A;  3U10 A;  4XVH A;  3LGR A;  1AL0 G;  1VRB A;  2IFW A;  2QQK A;  2WNU C;  2QZ2 A;  3DXT A;  3O14 A;  4YVW C;  4AI1 A;  4AHW A;  5A1A A;  1OLR A;  1RYY A;  4C1X A;  3QOP A;  2P6H A;  4YWA A;  4MXW B;  4QGL A;  1O3R A;  2JDZ A;  2QZ3 A;  2WQZ C;  5B2G B;  3T1L A;  5FZM A;  4LJH A;  4E4Z A;  4FVV A;  2UYA A;  2WQ4 A;  2JDP A;  1G6N A;  3ALQ A;  3RWN A;  3B69 A;  2RMU 1;  2VC9 A;  2OZ6 A;  3IKW A;  3V64 A;  1QQP 3;  4XMA A;  1PK6 C;  1DQ5 A;  1UX6 A;  2VBD A;  1NZC A;  5JOY A;  5I8Y A;  1N1S A;  3Q8C A;  1JYV A;  1ND2 B;  4QPY A;  5JPM B;  1DBN A;  1R09 1;  2W47 A;  4ONU A;  1VBB 1;  1JZ7 A;  2UWC A;  3AZZ A;  1U12 A;  2BOJ A;  3ZFF B;  4URA A;  3O1U A;  2H6C A;  2WZP P;  2R06 3;  3IDC B;  4L97 A;  2GC0 A;  3AMH A;  3MIH A;  2OPK A;  3TRS B;  2I2S A;  2VZT A;  2XL7 A;  3M1H A;  5JXH A;  2ERF A;  1YRZ A;  2VOT A;  5IK5 A;  3KMH A;  4LXL A;  2YGM A;  1PHM A;  2RVA A;  1F4A A;  4NRP A;  1F4H A;  4E2Q A;  4HPK A;  1CQ9 A;  2DWR A;  4S2G A;  3T09 A;  3ZXF A;  1CIW A;  4B4P A;  3VZO A;  3H8U A;  4AED B;  1V9U 1;  1MPX A;  4XUR A;  3TEY A;  4YZ1 A;  5JVV A;  1C1F A;  2VTX A;  1W8W A;  4PCR A;  4XBN A;  3T2O A;  1AR9 3;  1LU2 A;  3THD A;  5A6X A;  3A23 A;  2JX9 A;  3WDX A;  2VQA A;  3FHA A;  4JDO A;  3ZYJ B;  1OA4 A;  2W0X A;  4UFI A;  4MGY E;  1LAJ A;  2DU0 A;  3OUJ A;  2JEN A;  1E5I A;  1MS1 A;  1MS9 A;  3SEP A;  4B29 A;  4XDQ A;  2Z5W A;  5CVR A;  4ZXK A;  1QMJ A;  5FRA A;  2ZML A;  4ZPI A;  5AC9 1;  5GJ6 A;  3BTZ A;  1NCR B;  3B9I A;  3B93 A;  3J7M A;  5DZF A;  4KGQ A;  1BXH A;  4NRQ A;  3WDY A;  3RNS A;  3VHN A;  2VQ0 A;  3WNK A;  2VCB A;  4FPC A;  1BEV 2;  4MGI E;  3UGG A;  3KQR A;  2A6W A;  4BWO A;  1AR6 1;  1J3R A;  2OS2 A;  4P9L A;  4I0W B;  4LUM A;  3NQH A;  1OXC A;  1XE7 A;  1ASJ 3;  2VUL A;  5C8W A;  5AC9 3;  3VD4 A;  1F5J A;  5GKA C;  2GC1 A;  3WHU A;  1POV 3;  3KWV A;  5FZD A;  3AK0 A;  3LKJ A;  1I1E A;  1AYM 3;  1T2X A;  2LRP A;  1ZBA 1;  1HB4 A;  5C9A B;  3BAL A;  5FP4 A;  5FBJ A;  4HK9 A;  1MZE A;  4IEU A;  4Y5Z 0;  1RXG A;  1YFW A;  3PTR B;  2A3Y A;  1Z78 A;  3NNL A;  2HWD 2;  1WLW A;  4XUO A;  4AFB A;  4E4D X;  1LOF A;  3IPV A;  4XW3 A;  5ANQ A;  5F6L B;  3SKV A;  5K9Y A;  2ZBJ A;  1OH3 A;  3GZT B;  3ZYG A;  3OUH A;  3PUH A;  4DIN B;  3FLR A;  2JXA A;  2CDO A;  1VP6 A;  3ES4 A;  1MS5 A;  3UL2 A;  4JQT A;  3ON7 A;  3ASI A;  3IAP A;  4P9G A;  5ACA 2;  2FDG A;  4I30 A;  2JG9 B;  4OZO A;  3I59 B;  4NWV A;  5E16 A;  2WAB A;  3VN4 A;  5JDB A;  1Y43 B;  4ET7 A;  4LK7 A;  1QQP 1;  1LOB A;  3ZVX A;  3VBH B;  2GNT A;  1HV1 A;  4QB1 A;  2B8M A;  2NMO A;  3ZO0 B;  3TBD A;  2D3R A;  4UFH A;  4XDP A;  1EAH 2;  4PT6 A;  4CPB A;  2FMY A;  1BZW A;  4FPG A;  2YDE A;  1UZ0 A;  1G9C A;  1H30 A;  1REE A;  1WLD A;  2RG4 A;  4C8D A;  3ZXA C;  4AF9 A;  4IEZ A;  2QQL A;  2GNB A;  2HWE 3;  5L9B A;  1SFP A;  4I3P A;  1G9F A;  3TNQ A;  5KR7 A;  2V4V A;  3LEK A;  4FSJ A;  2YY1 A;  2ZOE B;  4GWN A;  5DG2 A;  4RFT 0;  4NHL A;  3M3I A;  4DS0 A;  2Z4F A;  1H2K A;  4XUQ A;  4DRR A;  1GAN A;  5CFC C;  4LT5 A;  1SQ4 A;  1YEW A;  1LGN A;  5C3Q A;  5K0U B;  3O1P A;  5FYM A;  4AG4 A;  4GH4 C;  3RZM A;  3VKO A;  3ILN A;  5AVA A;  1MEC 1;  2RS3 3;  3WNN A;  3MW3 A;  4XFA A;  2NQY A;  2XPJ A;  2Q1M A;  2BEO A;  1OQ1 A;  2QE3 A;  2P5B A;  2XVK A;  3WIN E;  1YC6 1;  2Q1F A;  4MG2 A;  1TG7 A;  2EIE A;  4KNC A;  2R49 A;  1VBD 2;  1V6L A;  3KHB A;  1PO2 3;  4Q8K A;  4FPY A;  1H0B A;  4HKW A;  3GCX A;  4WZF A;  4A3X A;  1RVF 3;  1D4M 2;  1WMD A;  4FBF A;  3G7D A;  1TMF 3;  2XHK A;  1PVX A;  2V5D A;  4LIU A;  2JG8 A;  5C3P A;  2R07 1;  4UFM A;  4UFJ A;  2LUW A;  4OVE A;  3O0W A;  3PUA A;  1J3Q A;  2HWC 1;  1G9D A;  2J1T A;  3OGR A;  4IV3 A;  2R1B A;  4ZS3 A;  2E63 A;  2FZ2 A;  2JJ6 A;  1RTV A;  2QUO A;  2X5I B;  3I97 A;  3MF9 A;  1YFX A;  4GWM A;  4RN5 A;  4XOG A;  2GN7 A;  2GP5 A;  2RJK A;  3HEI A;  4C91 A;  5JMC A;  3FZ3 A;  2VTF A;  4I3G A;  3ST7 A;  4NWW A;  3RZK A;  3WUD A;  3VDC A;  4IL7 A;  2ZZQ A;  5BNN B;  5FUI A;  1OVP A;  2J1R A;  3UNP A;  4PDW A;  2PEL A;  3KM5 A;  2R04 2;  4FPJ A;  1RIT A;  5BUV A;  5LEK A;  1RUF 3;  4GZ9 A;  3WNP A;  1I5Z A;  5FPX A;  1QOO A;  5F1R A;  3WNX A;  4AL9 A;  1UCX A;  1H1I A;  4YZ3 A;  3S7E A;  1AVB A;  5D8A A;  2WBK A;  4KL1 A;  2CWS A;  5A80 A;  3H0O A;  3ZOI A;  5L9R A;  2OPW A;  3RQ0 A;  2ORZ A;  2ZGT A;  1JTZ X;  1PVC 1;  2W87 A;  1IKP A;  2WQ8 A;  4P08 A;  1NA1 A;  3GNE A;  5KXB A;  1OMI A;  4XJU A;  4EWA A;  1K12 A;  4E2S A;  3EB7 A;  3U4S A;  5IK7 A;  2VMC A;  3TAY A;  2ZX1 A;  2ZGS A;  1ND3 A;  3E5U A;  3IDA A;  3H3U A;  3ME2 A;  3WEZ A;  1ZBE 2;  5FPZ A;  1YIF A;  2WS9 2;  4TWT A;  1GUI A;  5FPV A;  2JIJ A;  1NLQ A;  4NIG A;  1WW4 A;  3ZXL A;  1YO8 A;  4AYU A;  4LBQ D;  2YU2 A;  5F5I A;  5JSP A;  4OUS A;  4BQW A;  2Z2S B;  3TEZ A;  3PIG A;  3JUU A;  3JBG 3;  2ZGN A;  3Q8F A;  4CDQ A;  1OQD A;  1VBD 3;  3P5B A;  1WLT A;  2OUJ A;  1TME 2;  3VZN A;  3J4U H;  4RHV 3;  5JR2 A;  2Y6H A;  4X6Q B;  2ENR A;  2VVE A;  3AX4 A;  2C4X A;  3OSD A;  5IVJ A;  1H9P A;  2RDQ A;  5LRR A;  3NAP C;  1PK6 B;  1QJX 2;  2JE7 A;  4GA9 A;  4QD2 A;  1QOS A;  2QNK A;  1A8M A;  1SLC A;  5BNO A;  2FBE A;  1SAC A;  1YUD A;  1EV1 1;  1UIJ A;  3POI A;  3ZFF C;  3V65 A;  1W6P B;  1UMH A;  5C4W C;  3AKR A;  1O4Z A;  4P9X A;  2AEN A;  1EY2 A;  3WY6 A;  4P9Y A;  1VRH 1;  1MVE A;  4K7J A;  2A1X A;  4MZU A;  1XB9 A;  4UXA A;  3ELN A;  3VDD C;  3V0A A;  2EAK A;  1BK0 A;  3DPR B;  2CGP A;  1W8T A;  1DGL A;  4UFK A;  5KC5 A;  4A6S A;  2QQW A;  4I02 A;  1FPN 3;  4YVS C;  4TLG A;  4LBQ B;  4NR1 A;  1L7L A;  2ARX A;  1TE1 B;  1FX5 A;  1XXN A;  2FMD A;  4OUL A;  4YZ4 A;  4KG8 A;  3VBF A;  1ZBE 1;  5JOW A;  2IXC A;  4Y33 A;  4FPK A;  2CAU A;  1W0O A;  5IVV A;  1JN2 P;  2AEY A;  5JXJ A;  1GKB A;  2G1M A;  4CUC A;  5FZB A;  3ZN4 A;  1RUG 3;  4GH4 B;  4RHV 2;  5A3N A;  4FI9 A;  4QGM A;  3P3N A;  2BUK A;  3M7A A;  1O59 A;  2W2I A;  2CY6 A;  5IHR A;  4U2A A;  3ZXK A;  2HWB 3;  4QU1 A;  2XWB B;  1UXZ A;  2PHF A;  5IAV A;  3UK9 A;  1UIK A;  4AED A;  4SLI A;  3O1R A;  1G9B A;  5BNO C;  3FFZ A;  4CP9 A;  5FXV A;  2QFE A;  5GLW A;  4NVP A;  4NRM A;  3UYJ A;  1S0E A;  5T52 A;  2W52 A;  2R04 1;  5FYB A;  1W2A X;  1HJG A;  3MI8 A;  1PZ9 A;  1UPI A;  1DLC A;  1W05 A;  1XRU A;  4RGG A;  2WNE A;  3AZW A;  3BU7 A;  3LA2 A;  3HQU A;  2PN5 A;  2TEP A;  5M0T A;  1DQ2 A;  5JMO A;  1Q56 A;  1HIX A;  4B1L A;  2D3P A;  1QDO A;  4QX1 A;  1YNA A;  4AI2 A;  4EZ4 A;  4PQQ A;  1RXF A;  1U5Y A;  5H9P A;  3CZJ A;  3VD7 A;  5IVY A;  5T55 A;  3T3Y A;  1BMV 2;  1ZA7 A;  3CF6 E;  3GZU C;  5FPB A;  3ABZ A;  5FZ6 A;  3UET A;  5I93 A;  4NJ4 A;  4WV8 A;  2HEW F;  1YQ6 A;  4YZ5 A;  4RQP C;  4XFI A;  1UN1 A;  1RUH 3;  2YG0 A;  1CON A;  1LHU A;  3AYC A;  4MLO A;  2DVB A;  1YQ5 A;  2R0F A;  2UWA A;  3J7L A;  1RUE 2;  4UW4 A;  5J98 B;  4ASM B;  2JG9 C;  4IE0 A;  4GUL A;  2EF6 A;  3UT0 A;  3CEW A;  4XF4 A;  3PJY A;  3DCQ A;  3ZR6 A;  4BME A;  1CWP A;  3R05 A;  2LS6 A;  4FFI A;  5JCT A;  1W99 A;  4D7T A;  2PXJ A;  3I2I A;  4DEQ A;  4QX7 A;  1IQA A;  1UZY A;  1V6K A;  4RR3 C;  1PM7 A;  2X53 S;  4RL7 A;  1AZD A;  3PMS A;  3W20 A;  1IKQ A;  1RHI 1;  4F3J A;  3WZ1 A;  4EJR A;  2I74 A;  1ZRF A;  1KDM A;  4Q26 A;  2WZE A;  1VBC 1;  3ZR5 A;  1UNB A;  1ST8 A;  4IUG A;  1RUD 1;  1VMH A;  4BA6 A;  4YPJ A;  4XET A;  5FOB B;  4LKF A;  2XBO 3;  4ZZ8 A;  2ZTN A;  1XNA A;  3H1Y A;  5C4W A;  2DU1 A;  3VV1 A;  2RHP A;  2ZGL A;  1LEM A;  4QHO A;  1C4R A;  2HEY F;  2JDK A;  5IUQ A;  3I2K A;  4E9K A;  3V0B B;  3INA A;  4IV1 A;  4CCC A;  1KGY A;  3SNM A;  1JYT A;  1W9T A;  1OA2 A;  5FYV A;  4N9I A;  1ODM A;  1OUR A;  1YQC A;  4AFM A;  1NQD A;  4CRQ A;  2E32 A;  4PIZ A;  3R0R A;  1UO9 A;  4YLZ A;  2NM1 A;  3MZH A;  3ZPY A;  1JI6 A;  1HN1 A;  1UY3 A;  2FHR A;  4Q4V 1;  4QXB A;  4Y5S A;  4C0H A;  2RDN A;  4LBJ A;  4Q4Y 2;  3O0X A;  1OLM E;  2JDU A;  4LNV A;  4RR3 A;  4Y22 B;  5E89 A;  4ASK A;  1GZW B;  1ZYB A;  3L9J T;  2BPA 2;  3JQX A;  5A6Q A;  4Q0U A;  2NPI A;  1D7P M;  4ZON A;  1WBF A;  3NO8 A;  4YYO A;  4E2G A;  4Z2A A;  3RDI A;  5I8T A;  3ZYI B;  2HWF 1;  4QB2 A;  3LEM A;  5DDJ 1;  3UGH A;  5GZC A;  3VD9 A;  1AR7 3;  4ARY A;  2YBP A;  5FKC A;  5J37 A;  2HYX A;  3VKM A;  2ZGQ A;  1WW6 A;  4CA9 A;  1SBF A;  4RS5 A;  4XCA A;  1X7N A;  2BW8 A;  3GM8 A;  4LEJ A;  3KD4 A;  1O5U A;  3W5M A;  3C3V A;  4A4A A;  2Q0A A;  4XIO A;  3AP7 A;  2H6B A;  1H2L A;  1UOG A;  2N7G A;  3PVO A;  4FXK B;  2BER A;  3I4I A;  5LA1 A;  2WFF 1;  1B35 B;  2W46 A;  2YRO A;  4HMZ A;  5FXW A;  4YG0 A;  3POF A;  1OD3 A;  3K2O A;  1RUF 2;  4B7E A;  5FPU A;  2VUD A;  2DV9 A;  1FMD 3;  2XLG A;  1NLR A;  1SDW A;  4D6Q A;  4QDQ A;  1F15 A;  2RR1 3;  1JXN A;  2OXB A;  3ETQ A;  5JLV A;  2XQX A;  3O1M A;  1BEV 1;  2CDP A;  4LE3 A;  2YBS A;  5TSW A;  2VME A;  3FN9 A;  2HJI A;  4LMF A;  5FR3 A;  1AUY A;  1G7Y A;  2JKB A;  3HOB A;  2BBV A;  2A73 B;  4AHX A;  1SMV A;  1O91 A;  4WM8 C;  3RVH A;  5KHI A;  3LEG A;  4XBQ A;  2J1U A;  4XFC A;  3K48 A;  3ZXG A;  1RUE 1;  5HPO A;  1LB2 A;  2RJ2 A;  2XLF A;  2WFF 2;  5HBA A;  1WWY A;  3SIT A;  2MEV 1;  4OI4 A;  5L36 A;  3SC7 X;  2Y33 A;  4UYB A;  1QY4 A;  1LR5 A;  1SFY A;  3PU8 A;  1VBE 3;  2ARB A;  1NY7 2;  2XJV A;  1HRI 1;  3WP5 A;  3VZJ A;  4H7M A;  3R4S A;  5BNP C;  3N35 A;  5FQ0 B;  2PHT A;  2R32 A;  3D8C A;  3FUQ A;  3VBH A;  2G19 A;  1W9W A;  1XYO A;  2P3I A;  1QKQ A;  3CL1 A;  2PAM A;  2SBA A;  4MOA A;  4CCN A;  5GLZ A;  4JQR A;  3MLL A;  1LHW A;  3VBO A;  4MGT A;  1YWK A;  2BRT A;  2W94 A;  3E6B A;  3OPW A;  4LPL A;  2YC0 A;  1H9W A;  3ZX7 A;  4N7U A;  4BZ4 A;  4Y20 A;  3S5A A;  2VW1 A;  2BNO A;  4XHX A;  5FZL A;  4KBB A;  5FUN A;  4M0N A;  1U5X A;  4UW6 A;  3GF6 A;  4TLF A;  3JD7 3;  5JIA A;  1OHF A;  1IS5 A;  2QQN A;  1W3X A;  2DVG A;  2ZMN A;  1Q8Q A;  2YHJ A;  3WNL A;  1GZW A;  1RMU 3;  4Q4V 2;  4LOT A;  1UQX A;  1OOP B;  1K45 A;  4FCA A;  4UOJ A;  1GWL A;  3VHP A;  2X29 A;  4A7K A;  4C1W A;  1H1A A;  4FAG A;  4A3Z A;  5IT6 A;  2A6Z A;  2GAL A;  4TSV A;  1W8O A;  4PLM A;  4AI3 A;  3ZDS A;  1HXS 1;  5F8P A;  2ARA A;  1LED A;  2Y34 A;  1W6Q B;  4XXP A;  3HBK A;  1QJY 1;  2VQU A;  3NKT A;  1O6U A;  1UF2 C;  4FTB A;  1C57 A;  2QQO A;  1GWM A;  4YGC A;  5KWR A;  3UV9 A;  2P6C A;  3VBS C;  2ZGM A;  2CU5 A;  1XE0 A;  2ZAB A;  5CNA A;  4Y1Y A;  4CUG A;  3F95 A;  4AR2 A;  1W2T A;  4JC1 A;  3H1M A;  3LZZ A;  1CZT A;  1KFU L;  3QCW A;  1L7Q A;  4Q4X 1;  1W8Z A;  2ZMK A;  1KD7 A;  3PLQ A;  1HRV 2;  1VBE 2;  2F17 A;  5FK7 A;  1FV3 A;  1EV1 2;  3N9O A;  4QMA A;  2Y0O A;  4BDV B;  5C71 A;  2JB8 A;  4WVM B;  1HQW A;  5JIU A;  1M06 G;  1NCQ A;  3BGA A;  3MUZ 1;  3VLB B;  4Q0Q A;  1GQH A;  1QXP A;  4XIK A;  3RGB A;  3ZYR A;  1QF3 A;  2FCT A;  1CD3 G;  4RD7 A;  2VZV A;  5DUW A;  5ACA 1;  2XOM A;  3MW4 A;  2RS5 3;  1K5M A;  1QJZ A;  3E6C C;  5FLI A;  4Z8B A;  2Y6J A;  5F9T A;  1RB8 G;  3GJA A;  3O0V A;  1UY0 A;  2A6X A;  1AR8 3;  2E7T A;  1PGS A;  1YXW A;  2Q1Z B;  2UUR A;  4N43 A;  4WM7 B;  2VOK A;  3KV9 A;  4JZR A;  3TEX A;  1QJU 3;  1RUC 2;  4PF5 A;  5FYI A;  2VPV A;  2B9U A;  4BIF A;  1JMU B;  4CCD A;  2WKK A;  2ZA9 A;  3J8F 3;  4E8C A;  3KV4 A;  3VL9 A;  3TEW A;  4UF0 A;  3I49 A;  3G6J B;  3WDV A;  4D69 A;  2EXJ A;  2BGC A;  2VNG A;  3ZDV A;  1NG0 A;  5FUP A;  3CO2 A;  5GZE A;  3LIG A;  1ZRR A;  3VBO B;  2HKX A;  4GD4 A;  1COV 1;  3AL6 A;  5FY8 A;  1PIV 3;  3MFA A;  4XJA A;  3O1V A;  5CG9 A;  1OQE A;  3KQ4 B;  4XC9 A;  4QAW A;  3GCW A;  5T5O A;  1AHS A;  1NUK A;  3ACH A;  1XPW A;  1GWK A;  1RUH 2;  1CPN A;  3I54 A;  4QXK A;  4Z1V A;  1PO1 2;  4N53 B;  5HCF A;  5C3S A;  3QD6 A;  4LR4 A;  1X82 A;  1HV0 A;  2WO3 A;  1R08 2;  4N8M A;  3T0A A;  3NL1 A;  4FQZ A;  2BGP A;  5FY9 A;  3AP9 A;  1RUJ 3;  3OGS A;  1CAW B;  2AEZ A;  4JRL A;  4YVW B;  1WD4 A;  3Q9O A;  3IPV B;  3E1F 1;  4FAH A;  5I0S A;  1YYN A;  4FQ4 A;  4EWE A;  3IN9 A;  3DKQ A;  3N9Q A;  5L7O C;  5KHK A;  4AHZ A;  5F5C A;  2IXK A;  3WF2 A;  4Q4W 1;  5IWF A;  2W1Q A;  1VMF A;  3URF A;  3PVB B;  3AP6 A;  4YW6 A;  3HWJ A;  3KT7 A;  2VUJ A;  3DPR A;  1ACC A;  2D5H A;  1LHV A;  2CGO A;  4YG6 A;  2HWF 2;  1LNS A;  4PJY A;  4CXY A;  4IET A;  4HOO A;  4CVU A;  3MHZ A;  4KWK A;  1UOF A;  3N7M A;  4CTE A;  2DUQ A;  3OY8 A;  2ARE A;  3LOB A;  4O61 A;  2VZS A;  1LHO A;  3NJV A;  4KWL A;  1NXM A;  1TME 1;  3EHK A;  1CVN A;  3BUC A;  1QJF A;  1ZNP A;  4GWJ A;  2A75 A;  3CJX A;  3ZSJ A;  3D0J A;  5DUV A;  5BYN A;  2Z42 A;  2AH2 A;  2RM2 3;  2EAL A;  3RYK A;  3W59 A;  1OVS A;  5ABJ C;  5JSR A;  1C3H A;  2PAE A;  3JBG 2;  1AR7 2;  5A3T A;  4KGG A;  1XSR A;  5BNQ A;  2WDB A;  2ORX A;  3NW4 A;  3THT A;  3W21 A;  1R1A 3;  3BCW A;  4AFD A;  1AYN 1;  1IS6 A;  1ULG A;  2VOW A;  4OZX A;  4NAM A;  4RGA A;  5LY1 A;  4EZH A;  3CBN A;  5FY0 A;  3S7I A;  4XUP A;  3HAG A;  3SXW A;  2K0G A;  1R08 1;  1MEC 2;  2WNO A;  2WS9 1;  2PLV 3;  4QU2 A;  4BH9 A;  5LEJ A;  3MGU A;  4H3W A;  1UYP A;  3RJ2 X;  2R16 A;  3MF6 A;  3TN9 3;  3CNA A;  1AJO A;  1Y7B A;  1UU6 A;  5EPA A;  2WAA A;  1Y9Q A;  2CSG A;  3B01 A;  4GMP 1;  4XUT A;  4LO8 A;  3KF5 A;  3AC0 A;  5GLT A;  3K51 A;  4Q1R A;  1LOD A;  1G86 A;  4CDX A;  5FMB A;  4MV2 A;  4LBO A;  1YFY A;  2EVX A;  3MIC A;  2GH2 A;  4BLJ A;  1H8T C;  4QKB A;  2WYF A;  2XWJ B;  3I3B A;  3OYW B;  4ES8 A;  1TZO A;  1BQP A;  2UY8 A;  3I8T A;  3FLT A;  1Y4W A;  1Z7S 3;  3NV4 A;  3H42 B;  3RZG A;  2B4K A;  4PHZ A;  4LKD A;  2JEC A;  3TB0 A;  1DYO A;  1EP0 A;  4PI2 A;  4XAB A;  4IE7 A;  4XFG A;  5C9A C;  5CG8 A;  2DTW A;  3HN1 A;  4OMC A;  4S2F A;  3M8L A;  4WM7 C;  1JUH A;  1OI6 A;  5EJZ B;  4JDN A;  5FZA A;  1W28 A;  4XFB A;  1D4M 1;  2L9L A;  2OUH A;  2OZJ A;  4TN7 A;  1DU3 D;  1QJX 1;  1W6O B;  4XE9 A;  2I45 A;  3CDZ B;  4AVA A;  4IER A;  4OQ8 A;  4CSW A;  1LOG A;  1ULF A;  4ZS2 A;  2VR4 A;  1VBA 3;  3AZY A;  3T30 A;  1UD1 A;  3N4M A;  2HWD 1;  2D98 A;  1ZZC A;  3R4U A;  4BU2 A;  3IBM A;  4HZF A;  3VBO C;  5HV4 A;  4FXG B;  2XJU A;  4A7Y A;  1UKG A;  4DXZ A;  3VBS A;  5LBB A;  2DFB A;  2Q4S A;  2A3X A;  1BBT 3;  2HYK A;  5FTT C;  1PZ8 A;  1OOP C;  1UY1 A;  4LE4 A;  1UPS A;  2R06 2;  2R6Q A;  1ENX A;  1A6C A;  2QVS B;  4M0H A;  4OYU A;  3I3M A;  1LES A;  3H8O A;  2QJV A;  2VZU A;  4CP1 A;  2B42 B;  1X8M A;  1D0H A;  2D7F A;  3DUI A;  3N9P A;  1N3P A;  1FOD 3;  2CGN A;  2EXI A;  5D1I A;  4M3C F;  3POG A;  3VKF C;  4WBB A;  4QPI A;  1C28 A;  4HVO A;  4JX0 A;  5H9Q A;  2NMN A;  4MUV A;  2K2S A;  3W9A A;  1FAY A;  3ZYF A;  1UW8 A;  2OX0 A;  5C3R A;  1P8J A;  5D21 A;  5FRE A;  3U11 A;  3ZYB A;  5A32 A;  1Z0H A;  5C6C A;  1DQ6 A;  5JPN B;  1ZZ8 A;  3C8X A;  4KWJ A;  4XF0 A;  1ZRE A;  2IXH A;  3ACL A;  4KU8 A;  1IHM A;  2D97 A;  1S0I A;  4ORF A;  1RJ8 A;  2IXI A;  3WF4 A;  4GIQ A;  1WW7 A;  5DZE A;  4R4X A;  5FP8 A;  4QQP A;  2HLE A;  3N9M A;  5A7Q A;  4WVV A;  1VLN A;  2EID A;  5IJR A;  1OKQ A;  3VBF C;  1IQD C;  2VD7 A;  4LIV A;  2HH9 A;  4QKF A;  4Y26 A;  3RPQ A;  1E57 A;  1OKO A;  3WG4 A;  4XUN A;  3LD8 A;  4HPK B;  4COV A;  2ZX4 A;  2K9Z A;  1F2N A;  1HRI 2;  1XND A;  5J36 A;  3A4U A;  2PA7 A;  3AYD A;  5A32 B;  5IYY A;  4J6G A;  1U5I A;  1NCQ C;  5CKN A;  1LCL A;  1NQJ A;  1QNY A;  2Q30 A;  4QPG C;  3IMM A;  2BFU S;  4QHB A;  2PMW B;  1N1Y A;  4Z2W A;  5LA0 A;  1FAT A;  2WNV A;  1W9Y A;  4IV1 B;  4BCU A;  1LKN A;  2RS1 1;  1PNG A;  3TNP B;  2ZX2 A;  4X8P A;  1DCS A;  1POQ A;  4FOQ A;  5FZ0 A;  4QM9 A;  2UWB A;  3IDB B;  1J83 A;  3QH6 A;  2XB6 C;  4R4Z A;  4WVM A;  4EN0 A;  5A1L A;  5J1X A;  3H8X A;  1W9S A;  2JIG A;  4JKK A;  5FBZ A;  3DF0 A;  3PJQ A;  1K5M B;  1PNF A;  4J1X A;  3OEA A;  5DAB A;  4FFH A;  3T2P A;  3IIA A;  2VXJ A;  1K42 A;  2TUN A;  4GXL A;  3B94 A;  5AFE A;  4S2D A;  4D94 A;  4JRA A;  1VAL A;  1VIW B;  4QT6 A;  3KGZ A;  1STM A;  1S0J A;  4RYD A;  3ZSE A;  4J1W A;  4BM8 A;  3FL7 A;  1RIN A;  2VZQ A;  5FKB A;  2D44 A;  3LWC A;  3ETP A;  3C7H A;  3HQX A;  1PO1 3;  4UBH A;  4QPW A;  3CQO A;  5CYY A;  4OQ9 A;  5LAT A;  3O5S A;  4COU A;  2WN2 A;  4YRD A;  2E6V A;  3HVD A;  3E5X A;  5FZ3 A;  2C26 A;  3JB4 C;  1EAH 1;  1V9U 2;  2WII B;  3AYA A;  4P00 B;  5LK7 B;  1VBA 1;  4Q1P A;  4QHZ A;  4LUL A;  1RUC 1;  5KHJ A;  1GZ9 A;  4XF1 A;  3EXU A;  5C7G A;  1SCS A;  4EWD A;  1C5I A;  2SLI A;  4L2N A;  1W39 A;  4XBL A;  4OFG A;  2VMH A;  1MZ5 A;  1W6M B;  1S0D A;  2X8K A;  4YG3 A;  5L9V A;  3GYD A;  3OGG A;  4PDW C;  2RE9 A;  2WNU A;  3USU A;  1D4M 3;  4CEY A;  2R07 2;  5FMO L;  3MIB A;  1W6Q A;  1HKD A;  1BCX A;  4IXL A;  2O0O A;  5JAX A;  3WF0 A;  3HR9 A;  3MPB A;  1W8F A;  3AJY A;  5FYU A;  4CDX B;  4DRV A;  2XG3 A;  1F8V A;  3H50 A;  1Q3E A;  2RDR A;  4YFZ A;  3THP A;  3I2O A;  1ZM1 A;  1JS9 A;  5DXD A;  3BKZ A;  3B3Q E;  3IWZ A;  3LA3 A;  4YAR A;  2FZ1 A;  1Z7S 1;  4MET A;  5CBL A;  3NNJ A;  2DUR A;  5KBF A;  3DL3 A;  4YM3 A;  4YGE A;  3X29 B;  1RED A;  2BP6 A;  4ES9 A;  3ZFG A;  4NHM A;  5EHD A;  5CIR A;  1WGP A;  5F39 A;  3WW2 A;  3FMG A;  3ZN5 A;  2YGL A;  2B7Y A;  2ZCW A;  2A6V A;  1HLC A;  4O9G A;  4A7Z A;  2W5F A;  2BOI A;  2C1F A;  1BVV A;  2WUH A;  4CZS A;  3H9A A;  2W92 A;  2PQS A;  1UWW A;  2DBN A;  3USS A;  1H2M A;  4PQ9 A;  3VBR A;  1O7F A;  3ZSM A;  4FP2 A;  2MNG A;  1RUO A;  1X36 A;  1WME A;  4JGZ A;  3HT1 A;  3SKJ E;  3N9N A;  4Q4W 2;  2B5H A;  3C7E A;  4AGR A;  2WS9 3;  1JYC A;  2VZ1 A;  2QDR A;  2DUP A;  2VNO A;  4IEP A;  4QKN A;  3P1I A;  5LA2 A;  4BQ1 A;  3POB A;  3SCF A;  2G4I A;  3RWK X;  5T3N A;  2VQT A;  2YC4 A;  3T08 A;  4K8F A;  4ISQ A;  1GP4 A;  3VZL A;  3I3E A;  1RUI 2;  4Q8L A;  1PO1 1;  1DGW X;  2VXR A;  2OQ6 A;  2OT7 A;  4QDS A;  5C70 A;  5I0U A;  1XU2 A;  3NJY A;  5FYS A;  3RJR A;  2GZW A;  1SCR A;  3KCC A;  5FWJ A;  4K20 A;  1LTE A;  4GKY A;  2VMD A;  5FP3 A;  4ERO A;  3VBR B;  3DKW A;  1LJ7 A;  1KIT A;  4ATE A;  5FMD A;  1EPZ A;  1PGW 1;  3KB5 A;  4XEZ A;  5DQ0 A;  3R6S A;  3NVC A;  4JKL A;  1NE4 A;  4P9W A;  1UX7 A;  4OHZ A;  4COY A;  4DY5 A;  2ILM A;  2XKP A;  1DP0 A;  1Y3T A;  3MIG A;  5FZI A;  1UKR A;  2ZXQ A;  4D6R A;  4COZ A;  3MLJ A;  1APN A;  1CAU B;  4FO9 A;  5LBC A;  3UKN A;  4CDW A;  1JW6 A;  1QDC A;  2J1A A;  3U78 A;  2ZEX A;  1YJL A;  1I6X A;  3C7O A;  2E7Q A;  3MIF A;  4LKS A;  1GZC A;  1SG3 A;  4BQX A;  1RUI 1;  1QJE A;  3KT1 A;  2WZR 3;  2OKX A;  2VJX A;  2CWM A;  4M4P A;  1CAW A;  3L2H A;  3KT4 A;  2ZGU A;  1RUJ 1;  3B7M A;  1CX4 A;  1ND3 B;  2PQQ A;  3T1M A;  5LRS A;  4WM8 A;  5BV6 A;  4QXC A;  3AVS A;  1NKG A;  1W8N A;  1ULO A;  2W08 A;  2IVI B;  1RL3 A;  4AVT A;  3THC A;  4AQS A;  4XJW A;  4E27 A;  3CU7 A;  2G9G A;  2D6M A;  3CIH A;  3WF1 A;  1IOA A;  5FY1 A;  2WFP A;  3K77 A;  4CEY C;  1JHJ A;  4EN7 B;  2LM3 A;  2PHX A;  2P34 A;  3A7Q A;  2QCS B;  5CKQ A;  1PGL 2;  2JE8 A;  5J3U A;  2VBB A;  4BIO A;  1SBE A;  2C5D A;  5F3I A;  2WSV A;  4NRO A;  4FPF A;  4AAX A;  4CDU C;  4LBM A;  5J7M A;  1UU4 A;  2F4L A;  3GHM A;  1CJP A;  3MPP G;  1RHI 2;  4IGO A;  1FPN 2;  2WZR 1;  4HLT A;  4CCL A;  4CU6 A;  1V6I A;  4ZKT B;  1XC6 A;  1RUI 3;  2BTV C;  2VE1 A;  3FWE A;  3BU0 A;  2NP0 A;  1E5R A;  1POV 0;  2WLQ A;  3J8F 1;  3LE0 A;  2VZ3 A;  1QQP 2;  1G8W A;  4BK5 A;  3FC0 A;  2QKD A;  2D6O X;  3ZXJ A;  1OUS A;  1RGS A;  3I59 A;  1W6P A;  4QQO A;  4Z82 A;  1OLM A;  4ZU5 A;  3VKN A;  1XNK A;  1DYP A;  3BVC A;  1FOD 1;  3NAP A;  5A3U A;  3IT8 A;  1SBD A;  2EXK A;  3GZE A;  4R9C A;  2GP3 A;  2HWB 2;  2ZGR A;  4D7Y A;  3CJI A;  5LB6 A;  3A0N A;  2WAO A;  1W2U A;  2EA7 A;  1HJF A;  1F35 A;  1SLT A;  1CAV B;  4MGZ E;  4P5Y A;  5EJ3 A;  5FYZ A;  4HAN A;  4IGQ A;  1J1L A;  4Q4Y 1;  4DXR A;  3NRU A;  4BXS V;  2CAV A;  1MQT A;  4OUE A;  4M3C E;  4XTP A;  4BQ4 A;  3LSE A;  4D7S A;  3N9L A;  1V00 A;  1VAV A;  3C7G A;  3D82 A;  4N53 A;  4AXO A;  4DNY A;  3VHO A;  1VB2 A;  1W6N A;  3AP5 A;  2YB7 A;  2VGD A;  2YPD A;  2B9V A;  2DTY A;  2PHR A;  2DUO A;  1NCQ B;  2QDN A;  1GBG A;  2VW0 A;  3HT2 A;  5JI9 A;  1QEX A;  2V73 A;  1GNH A;  4Q4X 3;  4XAE A;  3WV6 A;  3ZFE B;  1HQL A;  3BYW A;  3SCG A;  1ND2 C;  1LOC A;  3SIS A;  1TMF 2;  2QQV A;  1PVC 2;  1RC6 A;  5CAZ A;  1SFN A;  2YFU A;  4IEV A;  4JHT A;  5EFU A;  2XGX A;  2NZ9 A;  3PVN A;  2ARC A;  3NV1 A;  4X8N A;  1DQ4 A;  5CIS A;  1OFN A;  1QJY 3;  3LQC A;  2PTM A;  4Y1X A;  1VBC 2;  2QQP A;  4Y4Y A;  3AVR A;  1GNZ A;  5A7P A;  3SLI A;  5LBE A;  4P14 A;  2E53 A;  3OGJ A;  5FMC A;  3PUI A;  5EZW A;  4XXA A;  1I5P A;  3BPS A;  4HKO A;  1NXD 1;  4GB3 1;  4ZY9 A;  4OUM A;  3VDD A;  3HQR A;  3MFC A;  4NHY A;  1AXY A;  3ATG A;  3BOD A;  3MID A;  3SH4 A;  3U1X A;  3C7F A;  4HSL A;  1OUX A;  2VCM A;  3ZIX A;  1X9P A;  4GB3 3;  4Z92 B;  5A7S A;  4GWI A;  4BOW A;  4C0B A;  4ASL A;  1QU0 A;  4YFW A;  5FZK A;  4AI9 A;  5IK8 A;  1IG3 A;  1NYW A;  5FAX A;  3R4D B;  5FP7 A;  2FDJ A;  4LUK A;  4IEY A;  3WT3 A;  2WNV B;  2RS5 2;  4GMP 3;  3HPN A;  2VO5 A;  1H4H A;  1QWR A;  1NT0 A;  3ZXE A;  4V1P A;  1Y9M A;  3J9S A;  2QQI A;  5F7U A;  4JCK A;  2OYZ A;  4BJ0 A;  1PMJ X;  3OOX A;  2R30 A;  1R09 2;  2W9X A;  4AK3 A;  3LDK A;  4E4H A;  1VPH A;  2PLV 1;  1N47 A;  1ZZ9 A;  3FBY A;  1QJU 2;  1RUC 3;  2PHW A;  5I8S A;  5IK4 A;  4B8E A;  4IND A;  1Z7S 2;  2WWU A;  4Q5O A;  2VMI A;  2WZ8 A;  1X9T A;  4Y3O A;  2OW4 A;  1J84 A;  2MEV 3;  1R1A 1;  3FFQ A;  3Q8E A;  1CJD A;  5HXM A;  4LBN A;  2VM9 A;  2PHU A;  4K8R B;  3CHX A;  2HBT A;  4GH4 A;  4OCT A;  4OHV A;  4AFA A;  3VUO A;  3NKG A;  3LPG A;  4GAZ A;  1NA1 C;  4LTA A;  1HQN A;  5DDJ 2;  1X50 A;  4FFF A;  4KBZ A;  4Q4Y 3;  1OPO A;  2GU9 A;  2VZP A;  2KXL A;  3OBR A;  2W39 A;  4DZG A;  1TME 3;  4QPI B;  4YM2 A;  3IMN A;  2A71 A;  5CU1 A;  3H7J A;  3AJZ A;  1W90 A;  4NPR A;  1AR6 2;  2BNN A;  1GLH A;  2A7A A;  3LEI A;  1GZT A;  1RUG 2;  1I9R A;  4Y1U A;  2JD9 A;  1DLL A;  4QQH A;  1CAU A;  3D5O A;  4CDW B;  4Y4R A;  1PK6 A;  3HIF A;  4SBV A;  5BNP A;  2D6P A;  1WLC A;  1MQT B;  1MAC A;  1S0F A;  2TNF A;  3IM0 A;  3O7O A;  3SEE A;  3UKT A;  3VBH C;  5CZK A;  4CDQ B;  4M00 A;  3M3E A;  3FUO A;  2GH8 A;  3K75 B;  4PIY A;  2RS1 3;  4Q4W 3;  4UAP A;  3DEC A;  4NIH A;  5FZ7 A;  2E33 A;  1JZ4 A;  3W5N A;  2Y6K A;  1ZZB A;  3D0S A;  1CN1 A;  4KMQ A;  1TNF A;  5ABJ A;  3TWI A;  3T4V A;  2XXZ A;  5FZO A;  5DZG A;  5JUV A;  5FYY A;  2J42 A;  1KJR A;  3QAC A;  1WD3 A;  2O8O A;  2DCY A;  4M4R A;  2JDH A;  4Y22 A;  1PM4 A;  2Y6L A;  5H9S A;  1RUD 2;  5C33 A;  2ZJC A;  5AFB A;  3RMX A;  5DDJ 3;  2HWF 3;  2J1E A;  2PHL A;  4N43 C;  1JOB A;  2XHN A;  3IAQ A;  4NAO A;  1GYK A;  4XCB A;  2BFU L;  1GQP A;  5APA A;  2CNA A;  5D2A A;  3MEP A;  2RDS A;  1IZ3 A;  4M3C B;  2ZEW A;  5FPA A;  3BOW A;  3WUC A;  1COV 3;  3JD7 2;  1REF A;  5K4L A;  4EE2 A;  5DPN A;  2WO7 A;  2WT1 A;  4JGZ B;  5DG1 A;  3WP6 A;  3N3H A;  1LGC A;  1NLS A;  2W91 A;  5EWS A;  3AFG A;  4IEO A;  1NOV A;  1UZZ A;  4JVA A;  4LHK A;  5C8C B;  4DUV A;  1RUJ 2;  3RG0 A;  4AQT A;  4XHB A;  1QNW A;  5ERL A;  4XYX A;  4UBG A;  2WIN B;  1HB1 A;  3ZKU A;  5BNN C;  5DMY A;  2WZR 2;  2Q8O A;  5E6H A;  1W2N A;  4W6W A;  1K5J A;  4L99 A;  3B9C A;  2WR9 A;  3AXE A;  4Q0P A;  2ZHM A;  1AR8 1;  1CZS A;  2EIG A;  5FZ1 A;  2WL1 A;  1FNZ A;  5A7W B;  4BK4 A;  4UI9 L;  3M3Q A;  3ACI A;  4YM0 A;  4FOV A;  4W6Y A;  1EPW A;  2EXH A;  2UYB A;  4WM7 A;  3S6P A;  2RS5 1;  3CLP A;  2PYT A;  1FYU A;  2XUE A;  3MV1 1;  4AHY A;  4EN8 B;  2BBA A;  2GMP A;  3I7D A;  1US2 A;  2XL9 A;  1ZA4 A;  2IC1 A;  3MV0 1;  3JQW A;  5A7O A;  4TXW A;  1BBT 1;  4KI5 M;  4JDM A;  2Z69 A;  1HW5 A;  2VCA A;  3A0K A;  1XNT A;  1W6M A;  1NE6 A;  4LO7 A;  4R9B A;  2X09 A;  2YXS A;  3B02 A;  4UW3 A;  5FZH A;  1GP5 A;  3ZFF A;  4AI0 A;  3BIE A;  1N1V A;  3AZV A;  3KSC A;  2HWD 3;  3A21 A;  4CDU B;  2IXJ A;  5JZG B;  4HON A;  2ADE A;  5FMO S;  5KHH A;  5FY7 A;  2B45 X;  1W6O A;  1ONA A;  4XF3 A;  4O65 A;  4MGQ A;  4IV3 C;  1RUH 1;  4CEW B;  4CP2 A;  4XAC A;  4A41 A;  1JZ3 A;  3S30 A;  1NZI A;  1US3 A;  3PHM A;  2O8Q A;  1QJX 3;  1YQ8 A;  1GOG A;  3IZO A;  3AMQ A;  3PUQ A;  4BB3 A;  4LBK A;  2AZ5 A;  4B3N A;  1BK1 A;  4OI0 A;  5CB7 A;  3WF3 A;  1S4C A;  2O14 A;  2QQU A;  3I2G A;  1IPJ A;  4GAL A;  3MDP A;  4IE6 A;  2XJP A;  5IW0 A;  3HNY M;  4QKD A;  1H6Y A;  4YVW A;  3DYO A;  4IEX A;  4ZXE A;  4EYU A;  2P1B A;  1QGL A;  3PVE A;  2C6S A;  3WQ7 A;  4LQR A;  5I0D A;  5HCH A;  4AVC A;  3JU9 A;  3VDD B;  1QHD A;  1V6N A;  2Y38 A;  3OD4 A;  4BHP A;  4EV0 A;  2YPJ A;  1Q5O A;  2DCZ A;  4QPI C;  1YI9 A;  3MW2 A;  1CX1 A;  3GBF A;  4LO6 B;  1V6J A;  2X05 A;  4DEV A;  3B00 A;  5FIX A;  1ALY A;  4M01 A;  1PMH X;  5FLJ A;  1JHN A;  3PNA A;  5FZC A;  5HV0 A;  2VH9 A;  4JKM A;  4QB6 A;  1KXG A;  4NN0 A;  4FT8 A;  1MQT C;  3ZFE C;  4BXF A;  4D0Q A;  2HWB 1;  2FDF A;  1O4T A;  1ZZ7 A;  4CP9 B;  3AZX A;  2G9F A;  4A2U A;  3RRD A;  5DN2 A;  4CUA A;  2MPF A;  3K3O A;  4I0A A;  4XZU G;  3KV5 A;  3AL5 A;  1LGB A;  5DAV A;  5C4W B;  4I2O A;  1R08 3;  2VY0 A;  1YQ2 A;  1CIY A;  5IVC A;  4CCK A;  3DPR C;  3E5Q A;  3LDR A;  1CAV A;  5F5Q A;  3DEM A;  3M70 A;  3J8F 2;  1AYN 3;  1W3V A;  1EAH 3;  1ENS A;  1QH6 A;  3POJ A;  4CU9 A;  2DCJ A;  3CJI B;  5FYC A;  3VB9 A;  5BNO B;  1CGP A;  4YVS B;  4KWU A;  1FPN 1;  5L73 A;  2DFC A;  2XJQ A;  3OTF A;  4N43 B;  4ITC A;  4GMP 0;  2XML A;  2YV8 A;  4UF0 B;  1DGR N;  4MH0 E;  2QQJ A;  4G3Y C;  4QPG A;  4URT A;  4A44 A;  4LLF A;  4GJY A;  4LA2 A;  5HCB A;  3WDT A;  1OSG A;  1B35 A;  1WMF A;  3POY A;  4O9E A;  4JGZ C;  4K6B A;  4X6R B;  5GZG A;  5EXO A;  5FLH A;  1IPS A;  1WCD J;  2BV4 A;  3C2U A;  3WQB A;  5KXE A;  4D3W A;  3MO4 A;  1SHW B;  3ILR A;  2RR1 1;  2VCC A;  5ANN A;  2IFR A;  1I3H A;  1FMD 1;  4MAD A;  2IZW A;  2BWC A;  4W6X A;  5DUX A;  4K9S A;  2CV6 A;  4RS5 B;  4MGK E;  3VBU A;  4JTO A;  2VMG A;  1WMX A;  2WFF 3;  2AGS A;  3AXD A;  2WJS A;  1VBB 2;  3AKQ A;  4YSF A;  3P6B A;  3ECQ A;  3JBG 1;  4XZP A;  4FTS A;  3LFM A;  2KD7 A;  2JIC A;  3AYE A;  1JU3 A;  4P5H A;  2JDN A;  2MEV 2;  3BTX A;  1NCR A;  2ETE A;  3III A;  3KV6 A;  4DB5 A;  3LF7 A;  3T4H B;  5LZ6 A;  3WW3 A;  1RVF 2;  3OJB A;  3TN9 2;  4XFH A;  3P3P A;  4LO4 B;  1H2N A;  1NA1 B;  1HB2 A;  4AW7 A;  4S2H A;  5FY5 A;  4XIL A;  3WNO A;  5CFC A;  1Q8P A;  4M3C A;  3U75 A;  1UMI A;  4XQD A;  3ZN6 B;  2TBV A;  1DG6 A;  4NUB A;  2PLV 2;  4CE8 A;  3H3L A;  1KEX A;  3RS6 A;  1JH5 A;  1LEC A;  1VE0 A;  4LBL A;  1KQR A;  2VZO A;  2RJL A;  3OG2 A;  4AVS A;  2JB4 A;  2D93 A;  4YW1 A;  4LOR A;  1GIC A;  2B39 A;  5A33 A;  4Q4V 3;  3VKL A;  1OT5 A;  2GSY A;  5JSO A;  3DGT A;  1Q8V A;  3JZV A;  2DVF A;  4IV3 B;  5T5L A;  4CEW C;  4IGP A;  1LU1 A;  2A70 A;  3FHI B;  3TYJ A;  2BDR A;  2W1S A;  1GP6 A;  4B4R A;  3EYP A;  1H1M A;  3OBT A;  4LBQ A;  3ZPO A;  1S55 A;  3DV8 A;  1ND2 A;  3ZMN A;  1ZVF A;  5F32 A;  4IE4 A;  1S0B A;  3L2Y A;  4CXW A;  3T0D A;  5IVB A;  4RQP A;  1DFQ A;  2V72 A;  3ES1 A;  1F9K A;  1RUD 3;  4ISR A;  1TQ5 A;  1MS3 A;  3ZM8 A;  3RZL A;  3BN6 A;  4DO0 A;  5F6K A;  3BTY A;  1TMF 1;  3D6E A;  5G04 L;  1RVF 1;  2ZS6 B;  5C9A A;  3N7L A;  5FDB A;  1FI2 A;  1PX3 A;  1RHI 3;  2ZX0 A;  4I09 A;  3VDA A;  4YM1 A;  1E5H A;  3Q8B A;  4NID A;  2Y6G A;  1YIP A;  2VUC A;  5A7N A;  5JZG A;  3NNM A;  3BPZ A;  3H1W A;  3N36 A;  2A3W A;  5LAS A;  4QPG B;  2Y26 A;  4PI0 A;  1TEI A;  3RYR A;  4AWD A;  4DQA A;  4FTE A;  2B46 X;  2W3J A;  5A6Y A;  5C8C C;  3ZSK A;  4L11 A;  4L9B A;  1F5F A;  4Q0V A;  4NPM A;  1V0A A;  2IWG B;  3HD8 B;  2RR1 2;  2VU9 A;  1OD5 A;  5SV5 A;  2GN3 A;  4A42 A;  2GMM A;  4NE9 A;  2E7A A;  2JG8 C;  1HXS 3;  3K4Z A;  4KH9 A;  1T6G C;  3KGL A;  3LCP A;  2VTX J;  3ZYH A;  1OF4 A;  1DQ1 A;  5IAX A;  2DCT A;  4QQL A;  3VBU C;  1KJL A;  1OA3 A;  1RJ7 A;  4GJZ A;  3EMR A;  4DXS A;  1XSQ A;  1FOD 2;  3NNF A;  4P9J A;  2ZKN A;  2X5I A;  2WSU A;  4F8A A;  4HVQ A;  1XJA A;  4HT1 T;  4NO4 A;  5FP9 A;  1CAX B;  1WCS A;  1RMU 1;  4WM8 B;  1J59 A;  1S2B A;  1N1T A;  1QOT A;  3ACF A;  3N7K A;  4K3U A;  4LHS A;  1B35 C;  5GM0 A;  4B4Q A;  2LTN A;  1T6B X;  5CAD A;  1NCR C;  1BBT 2;  1W8U A;  3MUY 1;  4CCE A;  2ZHN A;  3JXS A;  1ZRD A;  1L3J A;  1UMZ A;  3RZZ A;  4HL0 A;  1DF0 A;  1EUU A;  1N3Q A;  3HN3 A;  5FJH A;  4MSV A;  3FHQ A;  4E8D A;  4DOU A;  1URX A;  2A5Z A;  5BPX A;  3TN9 1;  1WA6 X;  3K4A A;  4ZU4 A;  4CXX A;  4AGV A;  1W04 A;  1V6O A;  4PF1 A;  1V6M A;  2BNM A;  3ENR A;  4PBP A;  2D6K A;  3B5L B;  3SMH A;  2OA2 A;  3JCI A;  1VR3 A;  4F7Z A;  5ISL A;  3H8R A;  1XE8 A;  5DAW A;  3V0A B;  2BQP A;  3HJR A;  2JEM A;  1GV9 A;  1HRI 3;  1XYP A;  2NN8 A;  4OHW A;  3V0B A;  1ZBA 2;  1UYZ A;  1JYN A;  1JU4 A;  1KDK A;  4F83 A;  5C5U A;  3BI3 A;  4LIT A;  1RIR A;  1GU3 A;  3LFI A;  4LK6 A;  5A3W A;  1A8D A;  4AEJ A;  1IGO A;  2RM2 1;  3D3A A;  3MLK A;  2BWA A;  2D40 A;  1POV 1;  1ZRI A;  4AQ2 A;  4TTG A;  3SCH A;  4DIQ A;  4KQ7 A;  1VAM A;  3HMY A;  4UFL A;  3SQO A;  3PME A;  1AX2 A;  1NX9 A;  4AFC A;  3WSO A;  4FOY A;  2XVG A;  1ASJ 1;  3AP4 A;  3NST A;  4Q2F A;  1BEV 3;  3APB A;  5FZO B;  4QX0 A;  4UWD A;  4BQ2 A;  2G9Z A;  5K0U A;  1LOF C;  1SLA A;  5BY5 A;  3IB3 A;  3BTA A;  2D6N A;  3DYM A;  3WW4 A;  3WNM A;  5LCW L;  2W1U A;  2AR6 A;  2ZAC A;  3S0M A;  4RHV 1;  1SLL A;  4DFS A;  3T0B A;  3ZMO A;  2QTW B;  1S0C A;  5FYH A;  3PL0 A;  2P17 A;  4NIA A;  4H55 A;  2W1W A;  1Q43 A;  2VG9 A;  2H0V A;  4AEM A;  3RMY A;  3MYX A;  5G05 L;  4BQY A;  2VEC A;  4QWN A;  2C9A A;  3WDW A;  1AR9 1;  4YGD A;  3KVB A;  3LA7 A;  1W0N A;  2P3K A;  3U0Z A;  5FPL A;  1XNC A;  1UZV A;  1WCK A;  1AR7 1;  4KU7 A;  2GNM A;  1GR3 A;  5CEH A;  2WO2 A;  4YW7 A;  4BQ5 A;  5IVF A;  1HB3 A;  5CFC B;  1CZV A;  1CES A;  1DZR A;  1NAE A;  2XJR A;  1ULE A;  1OH4 A;  4N7I A;  2BVV A;  3LDB A;  3WG3 A;  3WQ0 A;  1TNR A;  3LIH A;  2XR4 A;  2F4P A;  1HX6 A;  4FP3 A;  5EIY B;  1R64 A;  1S0G A;  1PIV 1;  2XBO 2;  5H9R A;  4YW2 A;  2ES3 A;  2R06 1;  3UJO A;  1Y9G A;  2KM2 A;  4WVZ A;  3AMM A;  1XU1 A;  3PIJ A;  5I0T A;  2FDH A;  1COV 2;  1OPM A;  2DCK A;  2DVD A;  1IG0 A;  2VAU A;  4FFG A;  4MVT A;  1QXJ A;  4BYY A;  1AYN 2;  4P9I A;  3WOG A;  4ATF A;  2XH6 A;  4QX8 A;  4IW3 A;  3ZN6 A;  4AI8 A;  3NWK A;  5GAL A;  1A78 A;  4KG0 A;  1UU5 A;  2BU9 A;  1AYM 2;  4RS5 C;  4FPO B;  2WN3 A;  1M4W A;  1D4V B;  1C5H A;  1DGW A;  2ZZJ A;  5J96 B;  1LUL A;  2UY9 A;  2XVL A;  5JR7 B;  1QJU 1;  3WD5 A;  1OLQ A;  4A45 A;  2ID4 A;  4J25 A;  4Y1V A;  3RI9 A;  4IEQ A;  4IE5 A;  4CU8 A;  1ND3 C;  2V4A A;  1PIV 2;  2XBO 1;  4XDO A;  1H8T A;  1J58 A;  1UXX X;  3FLP A;  3AKS A;  3CMG A;  4CEW A;  3VBU B;  5C3O A;  4W65 A;  4BIS A;  2R07 3;  4CDU A;  5IAT A;  1GOH A;  2X5I C;  2YMZ A;  3I2H A;  3WCR A;  4AOC A;  3HBZ A;  1FV2 A;  3ZSL A;  4D6S A;  5ACA 3;  1QH7 A;  2JDM A;  2JKX A;  5BXX A;  2C0Z A;  5LBF A;  4HN1 A;  4U36 A;  2VZR A;  1QIQ A;  1DYK A;  4HN0 A;  4YW5 A;  3RZH A;  5I91 A;  2D5F A;  3ZLI A;  2Q8C A;  4HBN A;  2J22 A;  4DY3 A;  5B4N A;  2P4E A;  5FZ9 A;  2ZEZ A;  1HRV 1;  2BVB A;  4WVW A;  4GB3 2;  3KF3 A;  3KCY A;  1UOB A;  4XPV A;  3WW1 A;  2IUW A;  4TYS A;  3USU B;  3E6D A;  3ZYP A;  4NOT A;  4IES A;  2YU1 A;  4OI2 A;  5E88 A;  4ARX A;  4BPZ A;  1DZT A;  2NLR A;  1R1Z A;  4H2A A;  1W6N B;  2HWE 2;  3ZFG B;  2UU8 A;  1L7R A;  2DVA A;  2FDI A;  1SLB A;  5JXI A;  4XMI A;  2GC2 A;  3VD3 A;  4OI1 A;  4ZHN A;  4HFS A;  3AFK A;  5EYY A;  5FO8 B;  3WG2 A;  4N53 C;  4XJ8 A;  2XDV A;  3GXU A;  4LA3 A;  5FXZ A;  2ZGP A;  5JI7 A;  4OLL A;  3NV3 A;  3SH3 A;  3VZM A;  5JWP A;  1O3T A;  4K1Z A;  1VAK A;  5JOX A;  1SEF A;  4W8J A;  2FCU A;  2J1S A;  1JUI A;  2HEV F;  2V09 A;  3IDE A;  4YGB A;  5AVP A;  1OOP A;  4FPH A;  5L7O B;  1A34 A;  3WP3 A;  4IEW A;  2D3S A;  1VJ2 A;  1W0P A;  2WWS A;  1R1A 2;  3GDB A;  3O1T A;  1CAX A;  2WT2 A;  4HK8 A;  4CP0 A;  2R04 3;  4QXH A;  1AX1 A;  4QQ2 A;  2YFZ A;  1AJK A;  3JD7 1;  5GZF A;  1XYN A;  2Y6F A;  4Y24 A;  2VOX A;  2RV9 A;  3FJS A;  1IPK A;  2Q5T A;  3NAP B;  4Y5T A;  5E8A A;  1PO2 2;  5IFP A;  2XQR A;  4R9D A;  3PUR A;  1BMV 1;  4AAP A;  2V5Y A;  1SDD B;  3O1S A;  4DMI A;  1J3P A;  2BJS A;  3O1O A;  4I01 A;  2ZHL A;  3AMP A;  2AC1 A;  1K3I A;  2D43 A;  2W68 A;  4G4F A;  4GQ7 A;  4HSJ A;  1J1T A;  2C9K A;  2E31 A;  2EAA A;  2JDY A;  4YW4 A;  1PMI A;  3WDU A;  1S1A A;  1HXS 2;  5ABJ B;  1ZBE 3;  4BMB A;  2DYC A;  1VBE 1;  2JG8 B;  3M3C A;  4LKE A;  5LK5 A;  1EYB A;  1JZ6 A;  3OBA A;  1C1L A;  1U0A A;  5EYX A;  2O1Q A;  3H7Y A;  1NY7 1;  5FO7 B;  4AGG A;  3LB9 A;  1H8T B;  1RUE 3;  2VNR A;  2ZGK A;  1U5Z A;  5FJK A;  4MYE A;  5FQ0 A;  3UKV A;  1PZ7 A;  2PHD A;  3ZFE A;  1VRH 3;  3SHR A;  5C5T A;  3KVA A;  4PLO A;  4C90 A;  1FNY A;  3FBM A;  5DUU A;  5BNN A;  3I3D A;  1H8V A;  1UYY A;  1DGR A;  1H6X A;  4LHN A;  2AAC A;  5FV3 A;  1AR6 3;  3OBZ A;  5CKM A;  4H7L A;  2WNV C;  3OEB A;  1ASJ 2;  2BYV E;  5FCC A;  2YBK A;  2YUE A;  5LWB A;  5CFD C;  2Y8K A;  1ZRC A;  2ZEY A;  1VBD 1;  1UAI A;  4RSU A;  3U37 A;  1AR8 2;  4O7X A;  3D4K A;  4PBO A;  1JYI A;  1KRI A;  3JB8 A;  1XNB A;  3ORJ A;  4AEK A;  5T5P A;  5A6Z A;  5CA6 A;  4EN9 B;  2GC3 A;  2Y64 A;  5A7W A;  2FDK A;  2RMU 2;  1CR7 A;  4XF9 A;  5JOZ A;  4N9H A;  1CPM A;  4H14 A;  4BE3 A;  2HWC 2;  2XKO A;  3S57 A;  1V9U 3;  1OFS A;  2ADD A;  2P2K A;  5F2S A;  3RYP A;  5FO9 B;  4JV4 A;  4CCM A;  3OUI A;  2R7E B;  5A3M A;  5FK8 A;  5HI0 A;  2PFW A;  4AE2 A;  1PVC 3;  1YFU A;  3I2J A;  1GQG A;  5D8A B;  4RQP B;  1MZ6 A;  1AL2 2;  3RSJ A;  2QBX A;  1H4G A;  1UOJ A;  5HXV A;  3J26 N;  4WZC A;  2AUY A;  1GNY A;  1DIW A;  1AXZ A;  1Q8S A;  2LRO A;  1VBB 3;  4LHL A;  4JGY B;  1WCU A;  1X8E A;  3POS A;  4QX3 A;  3RI8 A;  3V56 A;  3O12 A;  4CDW C;  1WKY A;  3GJB A;  4Y1Z A;  3BB6 A;  4Q27 A;  1RUF 1;  4LOS A;  1VBA 2;  1PX4 A;  1ULC A;  1UL9 A;  4CDQ C;  3NJZ A;  5DAX A;  4P02 B;  1SPP A;  3ZFG C;  2VL4 A;  4RR3 B;  2Q8E A;  1AXK A;  1ENQ A;  1SZB A;  4AVB A;  1BJQ A;  1ZX5 A;  2ET1 A;  3K4D A;  3KZ4 C;  5FYT A;  4GKX A;  2KA3 A;  2JG9 A;  3RFR A;  5L7O A;  1VB4 A;  4W50 A;  4NHX A;  4CYD A;  1MZF A; 
#chains in the Genus database with same CATH homology
 4XAA A;  4NHM A;  3GZE A;  5LB6 A;  4NHL A;  2A1X A;  3PL0 A;  5HV0 A;  4Y5T A;  2Y34 A;  4Y5S A;  2RDN A;  4BQY A;  5DAP A;  2FCV A;  4NMI A;  2HBU A;  3W21 A;  5DAV A;  3NNM A;  4XCB A;  4NAO A;  4NHK A;  5LAS A;  4ZON A;  2RDS A;  2G1M A;  3MGU A;  4XCA A;  5LA9 A;  5EPA A;  5IAV A;  2FCT A;  3OUJ A;  3ITQ A;  4IW3 A;  5C5T A;  5LBE A;  5IAX A;  5ERL A;  4MHR A;  4ZPI A;  3GJA A;  3EMR A;  3NNF A;  3OBZ A;  3HQR A;  3HQU A;  4NHY A;  5EP9 A;  4JZR A;  2JIG A;  4J25 A;  5M0T A;  5LBC A;  2V4A A;  4MHU A;  4XAB A;  4BQX A;  5IAT A;  3KT1 A;  3KT4 A;  5LBF A;  5LAT A;  5L9R A;  2OPW A;  2Y33 A;  4XC9 A;  3NNL A;  3OUI A;  5DAW A;  5DAQ A;  4Q5O A;  2G19 A;  3OUH A;  5HV4 A;  5EQU A;  4XAC A;  5C5U A;  2HBT A;  5LBB A;  2JIJ A;  5L9V A;  3W20 A;  4KBZ A;  4BQW A;  3GJB A;  3DKQ A;  5DAX A;  2RDR A;  2FCU A;  3KT7 A;  2RDQ A;  4UWD A;  2RG4 A;  3BVC A;  4NHX A;  3NNJ A;  5L9B A;  5A3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...