2G19A

Cellular oxygen sensing: crystal structure of hypoxia-inducible factor prolyl hydroxylase (phd2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
b'LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Cellular oxygen sensing: Crystal structure of hypoxia-inducible factor prolyl hydroxylase (PHD2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 67
structure length 216
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2g19A00
3HQRA 3HQUA 4XAAA 4XCBA 5DAWA 2OPWA 3ITQA 4ZPIA 5DAQA 4XACA 2RDQA 4IW3A 4MHRA 2FCTA 3DKQA 4BQYA 5EP9A 4NHLA 2RG4A 5ERLA 2HBUA 5EQUA 4NHMA 5LBBA 3W21A 2G1MA 5IAXA 4J25A 4Q5OA 5DAXA 4NMIA 4NHXA 5L9BA 2FCVA 5LBEA 2JIGA 3PL0A 5M0TA 3GZEA 3W20A 5LBCA 4Y5SA 2RDSA 2RDRA 3NNLA 5A3UA 4BQXA 5LBFA 4KBZA 4ZONA 3NNFA 5L9VA 4BQWA 3OUHA 3OUIA 4Y5TA 3OUJA 2A1XA 2JIJA 4XC9A 2V4AA 3GJBA 3KT4A 5C5TA 3NNJA 2Y34A 4XCAA 4JZRA 3KT1A 4NAOA 3KT7A 5C5UA 5IATA 4MHUA 3GJAA 3MGUA 5IAVA 5LASA 5HV0A 3OBZA 4XABA 5HV4A 5LATA 2FCUA 5DAPA 5EPAA 3NNMA 4UWDA 4NHKA 2Y33A 5LB6A 4NHYA 5DAVA 5L9RA 3BVCA 2HBTA 3EMRA 5LA9A 2G19A 2RDNA
chains in the Genus database with same CATH superfamily
2VBPA 3DCQA 4C1XA 4BMEA 2BU9A 5G04L 3CZUA 3KCXA 3NWKA 5LA2A 4ONUA 1ENSA 1OF4A 4KWJA 2G9ZA 2D3PA 3FWEA 2RR12 4X6QB 1RUE1 1UO9A 1GUIA 3NL1A 1CZVA 2JG9C 4K20A 1W2OA 2D44A 3MO4A 4XZUG 1MQTC 2YGLA 1VBC3 4YVWC 4C91A 4LBKA 3ZXEA 1LULA 2YGMA 2PHWA 1ALYA 4BK5A 1ZYBA 5CFCC 1VIWB 4BXSV 4W6XA 4KWUA 2Q0AA 3VDAA 4AYUA 2RJLA 3APBA 2WNEA 2B9UA 3AMHA 1SLTA 2ZX3A 1MS1A 3P3PA 4HVOA 5DAXA 1N3OA 3T3YA 1RUG1 1U5XA 4MLOA 5FK7A 4B1LA 4JAAA 1PGL2 4LQRA 3RJ2X 3WY6A 3RVHA 2W1UA 3B93A 3OGRA 3D5OA 1VRH2 5D1IA 1WMEA 2XJQA 3BPSA 1H0BA 2LTNA 1LODA 3TEZA 2BTVC 2XGXA 3HBKA 4KGQA 4M3CE 4OCTA 1H6YA 1XSRA 1DHKB 2QUOA 3KVAA 4R9BA 3UGHA 3A23A 1AX2A 2RS32 5FO7B 2UWAA 4JV4A 2WWJA 1POQA 1CAUA 3POWA 1R091 1Y9GA 2ZBJA 4FFHA 1PMHX 4AOCA 1S0DA 2VGDA 2EICA 2JE7A 1QXJA 3ZYPA 5IK8A 5ACA3 2JD4A 3CHXA 1XBFA 2G4IA 4QQPA 4QX0A 3IDCB 1PO23 3LKJA 2JXAA 3FHQA 5KHGA 2OQ6A 1T6GC 3VD4A 2WN2A 1W0OA 3WUDA 1I3HA 3POEA 4WM8C 1W6MA 2GSYA 1LHWA 1UMIA 1DFQA 4P9JA 1COV1 1NQJA 1JYXA 3GZUC 2Z5WA 3BPZA 1ZZBA 2ZEXA 5T55A 3WSOA 1OQ1A 4E2SA 3JD73 1CAWB 2ZMLA 1G6NA 5B4XA 3FUQA 2HH9A 3NRUA 4Q4X3 2XJSA 1PX4A 2JICA 1TE1B 2VBDA 1SPPB 2VXJA 4XHXA 1FMD1 4N43C 2VCBA 4DFSA 1JN2P 2Z79A 5JMCA 4BU2A 3VHRA 2JE8A 3ECQA 4CEYC 1C8M2 4PI0A 3VGIA 1NYWA 1PO13 2ZMKA 4Z2AA 5K0UC 4WBBA 1AL23 2H6BA 3NAPC 1W6QA 4MXWA 4K3UA 4AEJA 2QCSB 5DUVA 4ZHNA 2WRAA 1C5HA 1RHI3 2RM23 4ZZ8A 4AVTA 1UN1A 1AR82 4UFKA 3ZYBA 1EAH1 3KV5A 2XBO1 5LASA 4QHOA 1OKQA 2W08A 5DQ0A 5T52A 5ANQA 3G6JB 1EP0A 3CL1A 2BOIA 2PN5A 3E6DA 3LIGA 2QQJA 5FYUA 1E5HA 3ELNA 2Q8DA 4CVUA 2IXJA 3GZAA 1DGLA 3LIHA 1NCRA 4YG6A 2DUOA 1F2NA 5FYTA 1TME1 5LRSA 3AC0A 1VMHA 2ZHMA 5LA0A 3O0VA 4LBQB 1RMU2 1W6OA 4UI9L 4NIAA 4QKNA 3OD4A 1AR93 2P4EA 1JW6A 5CA6A 4YW1A 5JVVA 4LMFA 1VBA1 2JG9B 3J7MA 4UAPA 5JIUA 1GR3A 3HQUA 4XZPA 4D94A 4LHSA 1MQTB 4XF0A 2PHUA 4YVWB 1OXCA 2A3XA 1FOD3 4QQOA 4H7LA 1FPN1 2G9FA 2P2KA 1U5YA 2O0OA 5IUQA 5CFCB 4EN0A 5E6HA 5JCTA 1ZA4A 3KF5A 4MHRA 1CESA 1RUC1 1JZ6A 4IUGA 1KRIA 2WT0A 5AC93 1ASJ3 1S0FA 5GJ6A 4I2OA 2ARBA 4ZU4A 1QH6A 4AR2A 1GANA 4Y1UA 1WBFA 2G1MA 3A0KA 5FUNA 3VKLA 4MVTA 3RGBA 1K3IA 1V6MA 1S0CA 1KS4A 3OBTA 1CIWA 2D7FA 4Y1ZA 4QGMA 3V65A 2B8MA 1IQDC 2VVFA 3VHOA 2VZ3A 1VAMA 2IUWA 2XUEA 1IKPA 5IVJA 1DQ1A 4QPWA 5F6LB 5LY1A 1I9RA 3IBMA 1BBT3 2FZ2A 4LBOA 3KQ4B 1K5MC 4D3WA 1JYCA 4LO4B 4M4RA 4G9SB 1CVNA 1JYTA 3IMMA 2QQKA 4J1XA 1LKNA 1DZRA 1OMIA 4IE4A 3MFAA 5GLUA 1W9YA 4M0HA 4WM8B 1RUJ1 1XRUA 2EIEA 2E9QA 3K51A 4IQPA 4D7SA 5FYIA 4CP0A 1ZA7A 4KGGA 2WLPA 1YFUA 2PHXA 3AYEA 4JTOA 1BEV3 1EV11 1NUKA 3WDXA 4B3NA 1UZYA 1V9U3 2LUWA 3HVDA 4H3WA 1VBC2 4COUA 5JSOA 2AC1A 1H4HA 3OJBA 5LK5A 3AYCA 4N43B 1J1LA 4UW5A 5EFUA 1YXWA 2VULA 3KMHA 5FY7A 1GQHA 2A5ZA 4PLMA 4CEYB 4CDXA 2W5FA 4HL0A 2VPVA 5K0UB 3J26N 3PTRB 3J7LA 3OSDA 4XC9A 5IW0A 5EZWA 4A3ZA 4DXZA 3PHMA 2VECA 3NNJA 1KDKA 4KH9A 5FZHA 2VOKA 2JDKA 4P9IA 4EWEA 4LR4A 2R1BA 5D8AA 4F7ZA 3PMEA 3OD0A 4QX2A 2C0ZA 4N9IA 4IDZA 1AL0G 3D4KA 2ZACA 3HD8B 3ZN6A 4X6RB 1CN1A 5GLTA 5TSWA 1AR63 4QB2A 2WNUA 3PUQA 3AP7A 4LOSA 2HWC2 4YG0A 2D3RA 1SZBA 3MLLA 3I2DA 4ARYA 4EZ4A 3ZLIA 5FZCA 5C8CA 3OCPA 4BQ5A 3F95A 3Q8CA 4XUQA 2A6XA 5FOBB 4GKYA 1W2UA 3VKOA 1PO22 2PYTA 2V5DA 4Y20A 2CYFA 3U37A 1OQDA 5LB6A 1LAJA 2E53A 4LLFA 3WNOA 5FWJA 3LCPA 5I8YA 1VALA 5T54A 1W3XA 1VBD1 4LULA 5FZIA 5KHHA 1POV3 3JD72 2Q1FA 1SFYA 3DYOA 4GJZA 1SLBA 3KGLA 4Q4X2 4CDQC 2DU0A 2PXJA 3VBUC 4CCJA 1W8WA 3N4MA 3H8OA 3CJXA 1SCSA 1W8NA 4GJYA 1OT5A 5A6QA 3N7JA 1S2EA 2W1WA 2ARXA 2OPWA 3CF6E 3PURA 3M2MA 3NKGA 2WNVA 1CZSA 4RQPC 3U07A 1UY3A 1AL22 5FZ8A 3KSCA 1CIYA 3POJA 4JKKA 4KG8A 2VZVA 2HKXA 4F8AA 2Q4SA 3CLPA 3OGJA 1XNKA 4NHMA 2AREA 4OI1A 3U4SA 4CEWC 4MYEA 3LAGA 2BW8A 2VMFA 4LKFA 4A44A 5AVPA 3THTA 4IEXA 1CJPA 3OEAA 4L8QA 3TAYA 1K5MB 3RMXA 3ZX7A 1I5PA 2OZJA 2Q1MA 1CJDA 1TNRA 4BH9A 5L9BA 3OYWA 1BLZA 3TRSB 2VMGA 2UY8A 1ONAA 2AR6A 1X33A 4YZ4A 4MG2A 2ZEYA 3OY8B 3AP9A 1MPXA 2R16A 2EXJA 3W9AA 3GDBA 3WNPA 3R4DB 4DXTA 1Y43B 2XWJB 1QMJA 1KITA 1XE0A 2XJRA 3I59B 1U5ZA 5HXVA 1CX4A 4R9CA 1JUIA 3DF0A 4RN5A 1D4VB 2K2SA 2VZUA 3N7LA 5A1LA 4AHZA 5GZCA 4IXLA 2QE3A 3OPZA 3FE5A 2CNAA 3LB9A 1QDCA 2GNTA 2PLV1 4DINB 4G3YC 1R1A1 3LSEA 4K1YA 3ZIXA 5IJRA 5HCHA 4I0AA 4KI5M 3I3QA 1U12A 2P5BA 4FPCA 3SH4A 5AC92 4BMBA 3T0DA 2YUEA 4WV8A 2FBEA 4DY3A 1DYPA 4S2FA 1UZ0A 1PGSA 4PDWC 4XUOA 5A3PA 1CGPA 4G4FA 5KHIA 1BHGA 2VG9A 4A2UA 5C5TA 2WAAA 3N9NA 2VQUA 3K77A 3LEMA 4YM0A 5CU1A 5GKAC 1Y9QA 4PLNA 4KWKA 3FHIB 4TZDA 1BBT2 1P8JA 5IFPA 1LGBA 4KU7A 1XYPA 1PHMA 1C4RA 3IPVB 3PVNA 2XHKA 5KR7A 1POV0 4QB6A 4HBNA 3ZYRA 4BLIA 3J9SA 1JXNA 1X36A 3WUCA 4BJ0A 2ORZA 2ZGLA 3WG1A 5LA1A 4DXRA 5EXOA 3VBRA 3WP4A 1AR71 4LA2A 1V70A 1GKBA 3WZ1A 2R041 1QDOA 2WFF3 2WJSA 3GM8A 3O7OA 3MLJA 5EHDA 1QJX1 4CDQB 3PVBB 1V9U2 1ZBA3 2HWB1 3VBUB 5DDJ3 2EXIA 4N7UA 2E6VA 4R4XA 3WCRA 5FJHA 4I09A 3AYDA 3E1F1 3OPTA 4YM2A 3DYPA 3B69A 4RQPB 1ZBE2 3HPNA 3PTYA 2NQYA 2X10A 4XCBA 3PUHA 1LOEA 3B01A 4XOGA 2RS53 4MOAA 2HWF1 2VXRA 5FZ0A 4CEWB 3KGZA 2GMEA 3ITQA 1J3RA 4XQWA 4WVZA 3FFZA 4FPYA 2ILMA 5DAQA 4BYYA 2WABA 1WA4A 2BNNA 5IVYA 1HQWA 1PX3A 1E57A 4XFHA 1AR62 5JPNB 3SHRA 3J7NA 5FUIA 3WDYA 2NPIA 2PAMA 1RUD1 3LGRA 4FPEA 1JOBA 4NAMA 4E4SA 1CAWA 4AVBA 1HRV3 3SKVA 2JX9A 5FBJA 2CV6A 4GMP1 2LS6A 1OA2A 3X29B 1SPPA 5JPMB 4IGPA 1JOJA 2WS92 2WZR2 2VE1A 4RD7A 3H1YA 4RA0A 2GH8A 4SLIA 5LBEA 1GZTA 1FATA 3AX4A 1RUH1 4MGKE 1WCKA 3FLPA 1EUUA 3ZMNA 2YY1A 3JU9A 3U10A 2ZX2A 5FZGA 5FYYA 1ODNA 1W90A 4IEVA 2GC3A 4YARA 2ADEA 4XF9A 2WT1A 4LBMA 3ZYHA 1ZRCA 4FOYA 1CONA 3AZWA 2KXLA 5FZAA 1XSQA 4NE9A 5C3OA 1DQ5A 1HJFA 4Q4Y3 4Y1XA 3AZXA 1OPMA 2ZGOA 4FXGB 2I74A 4Q4W3 2JB4A 3WF0A 4YVSC 4CCKA 4PDWB 3I2IA 1RUI3 3WNKA 2VQ0A 4LBQA 1AF9A 3SITA 4BQWA 1VBE1 1OA4A 3L9JT 3VBSC 4QPGC 1H9WA 4QXCA 4DUVA 2QQUA 3INAA 4IE5A 3SEEA 1K5JA 1GBGA 2QQLA 1WMXA 2EIBA 2JG9A 2VM9A 2QDNA 4FSJA 1MQTA 3LEKA 2BUKA 4XQ4A 3ZFFC 4YVWA 5FQ0B 4WVVA 2D6MA 3PIJA 1PNFA 3I2GA 2Y6HA 1ENXA 3M3QA 5A3WA 2KM2A 1URXA 5CFCA 2R062 1PVXA 5BYNA 4JZRA 1BK1A 2QQNA 3B02A 4NAOA 1A34A 3KT7A 1G9FA 4QKBA 1H4GA 5JI7A 2EALA 2BJSA 1Y3TA 3UKVA 5HBAA 1W05A 3J8F2 3S7IA 1REEA 1D0HA 3G7DA 2MEV3 1PVC1 1YFYA 2Q1ZB 1DYOA 1MS9A 3K3NA 5LW9A 2YB7A 4PHZA 4AG4A 3GCWA 2IXCA 5KXDA 3AJYA 2DFBA 1H2MA 3IIAA 2Y60A 5ISLA 2FQPA 3AMNA 1X7NA 1AX1A 3CIHA 3JBG1 4COVA 5EYXA 4DB5A 5JIAA 4PBOA 3MBWA 4KU8A 2VBBA 2Z42A 2P6CA 4NJ4A 4NWWA 2OZ6A 4EROA 2R49A 4QAWA 5DN2A 3BN6A 5CIRA 5F3EA 2R6QA 3S7EA 3HWJA 4MH0E 4Q4V3 4WM8A 1OLQA 3AJZA 4Q0UA 2ADDA 4QDSA 4P14A 4A6SA 1OKOA 2WQ4A 4JGZB 1AZDA 4HT1T 3I54A 4LE3A 5K8SA 4XEZA 3QBQA 4P08A 3MUZ1 4HZFA 2EIGA 3WQBA 4N43A 1LESA 4Q26A 4Z07A 4D8MA 4I3GA 4QU2A 4XMAA 5EQUA 2CWMA 4CEYA 4F83A 1LOFC 2D6OX 2Q5TA 1LGCA 5K0UA 3ZPYA 3ZM8A 5JMOA 3NAPA 2VTXA 3ROUA 1Z7S2 4META 3DECA 5IK5A 3BOWA 1VBB1 4Q5OA 4HVRA 1RJ8A 1STMA 2BVBA 4M3CB 3A7QA 2WFF2 4FPKA 4UF0B 1O8SA 2FCVA 3NVCA 4OI0A 2VJXA 4K21A 5DZEA 5EV7A 3AZYA 1V6JA 4J1WA 1ZBA2 1JOPA 4YW5A 5DDJ2 4AAXA 4AK3A 2DURA 1UYPA 3VZLA 1OBNA 5C9AC 1SBEA 2JG8C 4JGYC 4GB31 3U11A 4XTPA 4H7MA 1NZCA 5H9RA 3P6BA 3ZSJA 3LDRA 3S5QA 5IVFA 3E6CC 3DL3A 5A33B 2HWD3 1NKGA 5JOZA 5FXZA 2RR11 1QJU1 1OQEA 1F9KA 4YVSB 4FPFA 4AL9A 4AGVA 1KQRA 1CPNA 4QM8A 2WZPP 2RS52 2DTWA 2VU9A 3WG2A 3VBSB 3WNLA 5HI0A 3AL6A 1UAIA 4E8CA 4ISQA 3ZXDA 2WQZC 4Z1VA 4IE7A 1K45A 4Y3OA 3ZFFB 2VR4A 4MZUA 4FBFA 4N7IA 2W39A 1E5IA 5FYMA 1E5SA 1EUTA 4V1PA 1W8FA 3MF9A 3W59A 1HRV2 2LW8A 5JOYA 4HOOA 5FZEA 2VZTA 4L11A 1VRH1 4JDOA 4W4ZA 4EN8B 5BNOC 1V6KA 2P1BA 5GZEA 3H1MA 2DWRA 3WCSA 1WCSA 4C0BA 3WP6A 4XVHA 1CPMA 1BVVA 4Q8LA 5A3LA 2F4PA 3ES4A 4GA9A 4DPNA 2RS31 3MW3A 2WO3A 1SG3A 3PUAA 4CCDA 4RHV3 1RUOA 2VW2A 4MHUA 3USUB 2QZ3A 3HOBA 5FPAA 1A3KA 1L3JA 1MS8A 1H30A 4HK9A 4LO5B 1K5MA 4CP2A 2VZPA 1YHFA 4Q4Y2 3U1XA 1ZZ9A 5KHKA 1QXRA 1PNGA 3SQOA 3BIEA 3S30A 1OFNA 2OUJA 2VNVA 1F35A 3VZJA 1MEC3 2D6LX 2H0VA 3NMBA 3TB0A 5FO8B 3RS6A 2TEPA 2HBTA 1CZTA 1UZWA 4DS0A 1EPZA 3EMRA 2IWGB 3I59A 2ZGNA 5CYYA 5SV5A 1NY71 2ERFA 5J96B 3O14A 4Z2WA 1C8M1 4UBHA 1R1ZA 1V6IA 3MHZA 4O65A 3LFMA 4AI1A 3FFQA 5GLVA 3RZLA 3WT3A 4LUMA 1Z78A 1AR81 3WD5A 2W0XA 4K8RB 2Y8KA 3VBOC 1RUE3 1ZX5A 1IOAA 2W68A 1HDKA 1GFF2 1GWKA 2D6KA 2D93A 4WVWA 2CGOA 4NR1A 2I07B 3VDCA 2AYHA 5LBBA 2W52A 4XQDA 4XIKA 4E9KA 1MZ6A 3PIGA 5C9AB 3VBHC 2SLIA 4LXLA 2JG8B 1HXS3 4BLJA 4JGYB 3RMYA 3SNMA 3LF7A 3NSTA 4JX0A 3FMGA 3SEPA 3TWIA 1RMU1 4GWNA 4FTBA 1IQAA 1OLMA 1RUG3 2XQXA 3OGVA 1HN1A 3IPVA 3OGSA 3K75B 1YFXA 3ZSLA 5JI9A 5M0TA 1MACA 2AZ5A 5FLHA 3WXPA 3SC7X 3BTAA 1RJ7A 1UW8A 4TSVA 4JKLA 3ETPA 4GWIA 4W6WA 5FREA 4BPZA 5FZ4A 3I97A 5LBCA 5JOXA 2DUPA 4DUXA 1JHJA 5CG8A 4K8FA 3LPGA 4H55A 5AFBA 1FAYA 1FNYA 5F2WA 3S6PA 1YQ8A 1GOHA 2LROA 1DZTA 2HWE3 3I2KA 4OVEA 4CDQA 1PM4A 4FT8A 1DGWA 5AVAA 3VBUA 2IFRA 2A6YA 2B39A 3HAGA 4W50A 4UT5A 2WYFA 4AGRA 4AEDC 5BNOB 3ZXLA 2WA4A 4BM8A 4KQ7A 2BGPA 4DXSA 4NN0A 4RQPA 3TBDA 4TN7A 2WSVA 2FDGA 1F8VA 2QQMA 4LJHA 1COV3 3ETQA 2EAKA 2JDHA 2V4AA 2O8OA 1DQ0A 1EPWA 3U78A 4CEWA 5DZGA 1YYNA 4XUNA 4N53C 1I1EA 1HIXA 1C5IA 4BIFA 1WW4A 1QJEA 3NV1A 3GZTB 4OMCA 5FKBA 5FP4A 1US3A 2OQ7A 5FPBA 2VD7A 4CXWA 3CU7A 1FMD3 3BCWA 1NA1C 2Z4FA 2A7AA 3ZPOA 1PIV3 2XLGA 5HCBA 4AQ2A 1S0IA 2WNOA 3J4UH 1NXMA 2RS11 2J1SA 3SMHA 2HWD2 3T2OA 1B35C 3BGAA 3GJAA 1WLCA 2C6SA 3EBRA 1YRZA 3POSA 4A7YA 2B46X 1OD3A 1XNAA 3HEIA 4WVMB 2VNOA 1ACCA 1GMMA 4BWOA 4UBGA 5CG9A 4INDA 3N9LA 3THDA 2XBO3 4ZXKA 3ENRA 1UKGA 4HMZA 5FK8A 3UL2A 4UWDA 2J1EA 1PGW2 2Y33A 2QZ2A 4ZZ5A 5FZOB 2GNDA 4NRPA 2X5IC 2DUQA 4Y4YA 3MW4A 1AYM1 2PHDA 1UMZA 3LOBA 5CKMA 4E2QA 2JDUA 2TUNA 5IK7A 1QJY2 1TME3 5E89A 4PLOA 5F6KA 5F5QA 1XOYA 4Y4RA 1DF0A 2DBNA 4B7KA 1UPSA 3VBOB 4XAAA 5JAXA 4XMIA 4Z82A 1WLWA 1UYXA 2ID4A 2IXKA 4CE8A 1JMUB 3BYWA 2FD8A 3THPA 2DCYA 1ULDA 4AFBA 2HWC1 5A7WB 5BNQA 4PJYA 4BE3A 4PDWA 2HYXA 3OBAA 4KL1A 4UW4A 1SBFA 3VBHB 2NZ9A 1SLCA 2WL1A 4CCMA 4C1WA 4FAGA 1FPN3 5FLJA 3BODA 3I2JA 2IC1A 3AL5A 4HSJA 4JKMA 1JZ4A 1RUC3 2Y6KA 1MVQA 2VUAA 3KWVA 5J1XA 2G9GA 1PO21 2VZRA 2YYOA 1UOFA 2YFUA 1G9DA 3WG3A 5FQ0A 4EN7B 4QT6A 4UOJA 5C4WC 1G9BA 1HRI1 1C1LA 2EA7A 2OPKA 3KB5A 4S2HA 2RMU1 2W92A 5I8TA 1LECA 2QJVA 4FOWA 3U4XA 4CCLA 3JD71 4IESA 2RVAA 2FDFA 4ZU7A 4NUBA 1MEC2 2GP5A 2WBKA 3IMNA 4O61A 4JDMA 1H1IA 3Q8AA 3KCCA 5I0TA 2XVKA 4MADA 4SBVA 3OG2A 5CNAA 4XFBA 2Y6LA 1BMV1 1W8UA 1CAXA 2Y0OA 4CZSA 4XF4A 1HKDA 1QY4A 4AAPA 1NCQC 2RJKA 3AXEA 2ATFA 4AVSA 1QQP3 1OD5A 4AEDB 3I7DA 4D6RA 1XU1A 4URTA 1GICA 1RVF3 1XJAA 5A1FA 3M70A 2DU1A 1W3VA 2VCCA 1RUJ3 2YU1A 4FP2A 4LO7A 1I6XA 4LNVA 2K9ZA 3AVSA 4XE9A 3O1UA 4OUSA 1WLTA 4D7TA 1GZCA 3CNAA 1ZRFA 1TVGA 1V6LA 4LBQD 5L9VA 3OUHA 2J1VA 4P9WA 4N53B 5LY2A 3RRDA 4CCEA 4DEQA 1S0GA 4J6GA 5BXXA 1H8VA 2UYAA 4XAEA 1HXS2 3S5AA 1GV9A 1NA1B 2B42B 4QDQA 3R6SA 4CCCA 4COYA 2YG0A 2R7EB 3KT4A 1ZVFA 4CTEA 4JQTA 1B35B 4E4ZA 1C8NA 3RJRA 4E2GA 4Q0QA 1IHMA 4EN9B 1RUG2 3WDUA 4FO9A 1JHNA 2BYVE 2WFPA 3WINE 2QQWA 3D3AA 1KJRA 3SISA 2DVAA 3T1LA 3WF4A 3VD9A 3ZKUA 5IATA 1SFNA 4RGKA 1LHVA 5GM0A 2R073 2J1RA 3AP6A 3HR9A 2DCTA 1PZ9A 2YPDA 1Y7BA 5FY4A 1DZQA 4LKEA 5FZ1A 5FMOL 1OHFA 1GQPA 3KHBA 4AF9A 2X5IB 3RFRA 4XABA 1MZ5A 3KV6A 3O1PA 4R8HA 1LNSA 4M3CA 5B2GB 4M4PA 4D0QA 2HWE2 2Z2SB 4YM1A 5AFEA 1FNZA 3AFKA 3B5LB 4TWTA 3HJRA 1GLHA 2ZX4A 5JXHA 1PM7A 4XBNA 4YLZA 3AP5A 3T08A 2DVFA 3N9MA 1W9FA 2FHRA 4HK8A 4N90A 4FOQA 5K4LA 3B9IA 5A33A 5T5PA 3VBFC 4FOVA 1R081 4QM9A 5EJ1B 3VHNA 2VH9A 1VPHA 4YVSA 4Q0PA 1COV2 2CWSA 1VBD3 2RDNA 4DY5A 4DZGA 5A6YA 1AYN1 4A42A 4L0PA 2C5DA 1O91A 5F5IA 4R4ZA 4QPGA 3VBSA 4NIGA 4KWLA 1A6CA 2XVLA 3I2FA 4FPOB 1ENRA 5E1RA 4EE2A 2FDJA 4M00A 3AYAA 4CA9A 3TEYA 4TTGA 2Q8OA 4OHWA 3NQHA 3ZFFA 4YSFA 3EB7A 3PU8A 4B29A 5C4WB 1PIV2 1G9AA 2RHPA 5ACA2 4B1MA 3DKQA 4HANA 1QGLA 2VNGA 3Q8BA 2BDRA 1ULCA 4ZS3A 1E5RA 3MIHA 1W03A 4Y24A 1IZ3A 3LFIA 3K2OA 1YQ5A 4XJ9A 5KXCA 3POFA 4RGAA 5ABJC 3WF2A 1UKRA 4OZOA 4R9AA 4QQLA 4CPBA 1RUF3 3A4UA 1SHWB 4ASMB 3WHUA 3FUOA 1NCQB 1ZBE1 3JB8A 4LBJA 1WCUA 3RZJA 4AQ6A 3USUA 2TBVA 4X8PA 3VDDC 4GZ9A 1PO12 1LU1A 1TME2 3POGA 4L9BA 1OH3A 4D6QA 1TQ5A 4EJRA 1OC1A 1RHI2 2RM22 4NPLA 2P6HA 4BB3A 3VL8A 5JLVA 5I0RA 1X9TA 1BJQA 5FZMA 3KS7A 3NNLA 5CZKA 2CHHA 4LA3A 1HLCA 2Y26A 4XJAA 3UNPA 2A6WA 4BQXA 1D7PM 2WINB 3FLRA 3AK0A 5LBFA 5A32B 2CAUA 4IL7A 4L2NA 1GNZA 5DG2A 5FFOC 3UGGA 1V6NA 1H8TC 4IV1C 3KLSA 3IM0A 2WQ8A 2AUYA 2CDPA 4B4RA 3B9CA 2JB8A 2P34A 5A80A 2WS91 2WZR1 5EWSA 1QKQA 2VMCA 4FFGA 4LHKA 1WLDA 4JRLA 3CZJA 1VMJA 4Z92B 1AR92 1LOCA 2FMDA 2GN3A 2AEZA 4OI4A 5FZ9A 1LOFA 1J83A 3BU7A 4EWAA 1NLRA 2OKXA 2XQRA 1FOD2 2VZOA 1UZVA 4HSLA 2WKKA 3IDBB 2GDFA 4LO8A 4NROA 1F5JA 4FPHA 5C9AA 2Y6FA 2JG8A 3CKHA 3EXUA 4JGYA 1ASJ2 1JYIA 1JS9A 1QQP2 2IZWA 2XB6C 4NOTA 5FJKA 1KFXL 2OW4A 2PQSA 3VBFB 3HT2A 4KBBA 1RVF2 4ORFA 3PU3A 1RUJ2 2D3SA 1X8EA 2FCUA 3WQ0A 4MV2A 3ZSMA 3BU0A 4YGCA 4XUTA 1PK6C 2VCMA 4ZU5A 4LBNA 3VKNA 4AHYA 3K4AA 1X8MA 3AZVA 3WVJA 2CAVA 1QJX3 1W2NA 1UXZA 2HWB3 1FT9A 3T2QA 3QACA 3NV3A 3C7HA 3NNGA 2R061 3LA3A 1YJLA 1REDA 1HV0A 2GALA 4LK6A 1WCDJ 2ZTNA 3H9AA 2LALA 2X8KA 1HN0A 4AFAA 1S2KA 4P9GA 4YW4A 3E97A 1OOPC 5FZBA 3FN9A 3J8F1 2ZJCA 2D97A 4PIZA 4MGZE 5BNOA 5ABJB 1OVSA 2R072 4R9DA 3OOXA 1YFWA 1BEV2 1C28A 1N47A 3M7AA 4FCAA 5BNPC 1ZRDA 3LA2A 1ZZ8A 1NCRC 2V72A 3VDBA 4CUGA 2VUDA 2Y64A 1RUD3 4W8JA 1W6NB 4K6BA 3UT0A 1UX7A 5F3CA 3PJYA 2YXSA 4V2WA 4OMDA 3VDDB 4NMIA 4NHXA 2YBPA 1ST8A 2P3IA 1MVEA 1J58A 2J42A 4C90A 4QWNA 4YWAA 3V0BB 1H1AA 2KR2A 1WW6A 1XNBA 3TNPB 5FIXA 2ZX1A 5I91A 5F5AA 2QQVA 4HKWA 2A3WA 4WVMA 2RDSA 4P5HA 1H8TB 3I3MA 2DBIA 4LOTA 4GXLA 4IV1B 5FWEA 4HETA 2W95A 1WD4A 3ES1A 5FXVA 4HG6B 1RTVA 1W28A 4JGZC 4OYUA 4Y1YA 2XDVA 3Q8EA 2VC9A 1XYNA 2ZZQA 3JXSA 4UFLA 3ZR5A 1YC61 1UF2C 5FZOA 3NJYA 4Q29A 3VD3A 1WW7A 1MZFA 4JQRA 4ZONA 1Z7S1 2W94A 1JODA 3MV01 3JCIA 4NPMA 4YPJA 2DYCA 2OA2A 3ORJA 3DYMA 3WDVA 4WM7C 3BALA 2XPJA 2WFF1 3B3QE 5A3MA 2L9LA 2C9KA 3VBOA 5BV6A 1MS5A 1ZBA1 3HN1A 1XE7A 2E31A 2E26A 5DDJ1 1QHDA 2V4VA 4BQ4A 2J1TA 5C6CA 2OT7A 1D4M3 2DCKA 2EIDA 3GBFA 4P9XA 2ENRA 2YV8A 4Y5Z0 1RUF2 5G05L 3NV2A 2XUMA 5A7WA 2WZ8A 5KXEA 3BOPA 5DUWA 3VBHA 1UOGA 4N9HA 5LRRA 4AI0A 1NLSA 2J1UA 1JH5A 3WP3A 4EV0A 2OYZA 2PHTA 1J3QA 3MIEA 3T4VA 4IEWA 2RS51 4UW6A 1KGYA 5T3NA 3BTXA 2C24A 2LM3A 3R4SA 3ME2A 1A78A 2JEMA 5H9QA 4MGYE 1UL9A 3OGGA 1PK6B 1LRHA 1SQ4A 2P3YA 4D7YA 4BQ3A 1YIFA 4Q1PA 3HBZA 5A3NA 5HV4A 3O1SA 1UY0A 3BB6A 3O1TA 1PZ8A 1QOOA 1QOSA 3T0AA 3T2PA 1TEIA 1FXZA 1HRV1 3PVOA 4HKOA 4DNYA 2WAOA 4E27A 4P02B 3U14A 2VOTA 1GNYA 2SBAA 4IE0A 3HQXA 2D43A 4NHYA 3A21A 4XFCA 5GZFA 3ZYFA 5IVVA 3ACIA 1Q56A 1IS3A 3O0XA 4XUPA 5K9YA 2O8QA 5FPZA 3JBG3 1OOPB 2D6PA 3R05A 1ND3C 2JD9A 1XNCA 3MIFA 3WLUA 5CKNA 1X9PA 4BK4A 4AEDA 2CL2A 3T30A 2DV9A 1L7QA 3LA7A 5IVCA 4Y22B 4PT6A 2B7YA 1S0BA 2DCZA 5DZFA 4FAHA 4XDQA 5BNPB 1ENQA 1N1VA 1Q8PA 4JC1A 1NCRB 2XKOA 3RZMA 3WDTA 3O1MA 1WA6X 3F2ZA 5KHJA 3UJOA 4GALA 4QMAA 4AQTA 2HJIA 2VQTA 3S57A 4L92A 1O4TA 1WKYA 1ULPA 2R0FA 5BNNC 2FCTA 1XXNA 4N53A 4Q4Y1 5FXXA 4YYOA 4AEKA 1W8TA 3AKTA 2NP0A 3W5MA 2VW1A 3IAPA 3ST7A 2BPA2 5CISA 4ZS2A 1JI6A 1IG0A 3KM5A 1NA1A 3A0NA 4OHZA 3IDEA 1UMHA 5IK4A 2J7MA 1CAVB 5CVRA 1GSLA 4Q27A 1B35A 2B4KA 3POIA 2E63A 1UU6A 2F4LA 4XYXA 5J37A 4Q2FA 3I4IA 2XHNA 3LOIA 4LLOA 3H7YA 5SV8A 1JU4A 1TG7A 2LRPA 1ULEA 5H9SA 3VKMA 1JYNA 5C70A 1Q8OA 3IB3A 5GALA 2WYSA 3U0ZA 1HX6A 3P1IA 3PL0A 1QJX2 5F3IA 1SFPA 3VL9A 2PFWA 4YZ5A 4GB33 2ES3A 3HMYA 2WO7A 1AHSA 1K12A 2X5IA 3JQWA 2DVBA 5FCCA 2AH2A 2TNFA 3LWCA 3RNSA 2E51A 2KD7A 4AXOA 1OFSA 2RR13 1QJU3 5FY8A 2R30A 1NLQA 1TMF3 4DMIA 1UU4A 4WM7B 1LHNA 3H3UA 2ET7A 3KV4A 3O12A 3H8XA 5FP3A 2A6ZA 3ZXFA 4M3CF 2XG3A 4BDVB 5J7MA 3AFGA 3ACFA 4FFFA 3K4ZA 4AI8A 4R52A 1WMFA 3AXDA 5FP7A 3QD6A 3WOGA 2W87A 4XPVA 5FYVA 1IGOA 2EAAA 1NX9A 4QXHA 4XF3A 5JSRA 2VCAA 1O5LA 1VJ2A 5LK7B 3T09A 3C3VA 2Q8CA 4XXAA 5EYYA 3WW1A 4GWMA 3H3LA 4P5YA 4XDOA 3HIFA 1GP6A 2C26A 5C8WA 5L7OC 5GZGA 3MLKA 5A3TA 1VRH3 1LENA 1W8HA 2BGOA 1DIWA 2WLQA 5C4WA 3ILFA 2H0BA 4XILA 1QEXA 3URFA 4GQ7A 1WZXA 5J48A 1DQ4A 4JVAA 3GHMA 3M1HA 2RS33 2VOWA 4D6SA 4LPLA 4Y1VA 3TN93 1SCRA 2DF7A 2D98A 2AGSA 4NRQA 5CKQA 1OA3A 2QQOA 4I3PA 4A7ZA 3CEWA 3WQ1A 2XLFA 2MHFA 4JTNA 5T50A 1PGL1 4OI2A 1W39A 2QKDA 1SEFA 1ND3B 2ZPXA 5FYBA 5FY1A 3KZ4C 3P5BA 1NCQA 2XKPA 3DUIA 3TYJA 4EN6B 1LR5A 1M06G 1W04A 2I2SA 1DDLA 4XURA 2WA3A 1CR7A 4LE4A 4V2VA 2W47A 1XB9A 2FMYA 3E5QA 3DGTA 4AVVA 1UY4A 3LEIA 4EQVA 1S55A 5BNNB 3DXTA 5FZ6A 2FDKA 4AI2A 4CU8A 1D4M2 4LITA 2BNMA 4XJUA 5D21A 4Y20B 5FY9A 4HVQA 5BY5A 5JZGC 1OF3A 3ZOIA 1BYHA 1BK0A 2HWD1 3M3EA 4IE6A 1LJ7A 4ZPIA 5A32A 2Q30A 3VBRC 2NMOA 1LHOA 2RDQA 1JZ5A 1NQDA 2Y6JA 4A3XA 3AMPA 1N1TA 3I3DA 3OPWA 4Q4W2 5FZLA 4CUAA 3V64A 4BQYA 3D8CA 1QOTA 4QHZA 5BPXA 4CXYA 2RG4A 2WO1A 5ERLA 4CDWC 1RUI2 3OY8A 5EJ3A 4NVPA 2VTFA 4UFIA 4BIOA 4CP9B 1RYYA 1ODMA 5A3OA 5IAXA 1PGW1 1SMVA 2E33A 4ARXA 1VP6A 1L7LA 3D6EA 4J25A 3RDIA 4A4AA 1NG0A 3GGLA 3P3NA 3RZZA 5FPXA 2NN8A 5H9PA 4GIQA 1QJY1 4CPBD 2W91A 1GZ9A 2BFUL 1ZZCA 4GWJA 5IVBA 1RGSA 1YWKA 4LIVA 1RMU3 4AW7A 2D40A 3ON7A 4B7EA 4LT5A 1U0AA 3NW4A 4FI9A 4LK7A 5FMOS 3JBG2 1W06A 2ZMNA 1AXZA 3GCXA 4AFDA 2JE9A 3WW3A 1FV2A 4MGIE 5F7UA 1TZOA 2ZEWA 2F6BA 1W9TA 3KD4A 5KXBA 4Y5SA 3VBFA 4QPIC 3H8RA 1JTZX 4XTMA 3RWNA 2MEV2 4CCOA 4URAA 1ND2C 3BTZA 1D2SA 2XJVA 3PNAA 3N7MA 3O1OA 2JKBA 4CUBA 2ORXA 2XH6A 1SLIA 3T1MA 1GQGA 1W0PA 1FYUA 2QFEA 1Q43A 2VMEA 3KF3A 4U2AA 5JR2A 2YHJA 1O4ZA 1YNAA 5L7OB 4JRAA 3SCGA 1DGRA 4RR3C 1O8PA 2XXZA 5FYZA 3WF3A 4D69A 4YW7A 3PLQA 2EXHA 2CSGA 2N7GA 2WN3A 2ZXQA 2A1XA 2HEYF 1WBLA 3LD8A 5T5OA 3JUUA 4FQZA 1YI9A 2KA3A 1O3SA 3C7EA 4A41A 4YGEA 1DQ6A 4Q4V2 5LZ6A 2VMIA 2RJ2A 5J98B 1X82A 2OUHA 5ABJA 3KCYA 1S2BA 5A6XA 1HB2A 2JDMA 1W9SA 3PVEA 3ZXGA 4A7KA 3SXWA 2ZOEB 1R093 1OI6A 1SLAA 3VN4A 3WX5A 4GB32 1N1SA 1YQCA 2BNOA 2XMLA 2X29A 1KS5A 1S0EA 2ZCWA 2WSUA 2RS13 3PDQA 2CU5A 1HB4A 1J1TA 1W6NA 2BOJA 2V09A 3NJXA 3TNQA 1UNBA 1QJU2 2PQQA 3FL7A 4XFIA 1TMF2 4QGNA 3VDDA 3PMSA 1Q8VA 4IERA 1JZ8A 5FP8A 4XFAA 1UYYA 2CTVA 3UJQA 4HN1A 3OTFA 1HXS1 1IG3A 3V0BA 2WIIB 2ZGKA 1BKZA 4MXVA 4ASLA 1UOBA 5JZGB 3RI8A 1W8OA 2PAEA 1AYM3 3EQEA 4LBLA 3VBRB 4CP1A 1H8TA 4B8EA 4IV1A 4QX8A 3GYDA 4IETA 3UK9A 4TLFA 2VNRA 3EHKA 2V5YA 2XWBB 4BOWA 4CDWB 3ALQA 5I8SA 3WDWA 2JKXA 4AZZA 3T4HB 3TEXA 3WR0A 3S0MA 2DTYA 4XACA 1EAH3 1VBC1 1VRBA 2PHRA 4YZ3A 2HWC3 2ET1A 2V73A 3IWZA 5HCAA 3UYJA 1WD3A 1DLLA 4AQSA 2HWE1 3TN92 5FRAA 1O59A 2QQPA 1IKQA 1FX5A 3LSDA 5E8AA 2ZHNA 5F1RA 1SBDA 3FLTA 1ZZ6A 2XJUA 1NT0A 2XL7A 2P37A 5FPVA 1HRI3 1XNTA 2RMU3 1VBA3 3M8LA 4QPIB 2BWAA 2XR4A 1AUYA 1S4CA 5B4NA 4QB1A 1W99A 3DV8A 1ND2B 5DPNA 1NAEA 5IT6A 1PK6A 2JDZA 1YI7A 4XXPA 5C3RA 4RHV2 4AFCA 4BQ1A 2ZX0A 1IS4A 1W0NA 1RXGA 5A7PA 3MICA 3POYA 1PIV1 1NY72 3MEPA 3QCWA 5ACA1 2Y0IA 1GZWB 3M3IA 1W9WA 5T5LA 3ZFGC 5K7PA 4RR3B 2PTMA 4PQQA 1H2NA 4ISRA 4QX7A 2DCJA 3GBWA 2B5HA 2VZQA 4YZ2A 1WCQA 2GP3A 4QKFA 2A75A 2O14A 2O1QA 2K46A 4TYSA 1Q8SA 1OUSA 1IS5A 3MF6A 5A7NA 5CFDC 3I49A 2AACA 3RWKX 1LOGA 1OOPA 2ZZJA 1NZIA 2WZEA 3WNNA 4Q4X1 2WUHA 3LDKA 3OUIA 3ACHA 4GH4C 4YRDA 4AWDA 3OUJA 5FZ7A 2VW0A 5KWRA 1MS0A 2BQPA 4Y22A 1US2A 2A6VA 2GMPA 3PUSA 1F31A 4LEJA 2PHLA 1PMIA 5BNPA 2W1QA 1DYKA 1KFUL 1ZRIA 3IT8A 5A70A 1PO11 4DUWA 1SDDB 1AL21 1C3HA 1RXFA 4UFHA 4OHYA 2XOMA 2JDPA 4OLLA 1RHI1 2RM21 4NPRA 2BRTA 1F4HA 1C1FA 4MGQA 3ZDVA 2BBVA 1MZEA 4YGDA 3ZR6A 5DXDA 4YGBA 4HPKB 4AI3A 1RB8G 1NE6A 1YO8A 2XJPA 1W6PB 1RUE2 2GNMA 4IEOA 2E7QA 1BQPA 1CAVA 5DUXA 3H7JA 1EV13 2R1DA 5A1AA 5F8PA 4WZFA 1J3PA 3H0OA 4XJWA 2E7AA 2ETEA 3DPRC 4QGLA 3VD7A 3H3ZA 3FBMA 2Z69A 1DG6A 1XYOA 2ZA9A 3LE0A 4NIHA 1LU2A 4DRRA 1O3RA 2VZSA 4JGZA 1JYWA 1W2TA 4IV3C 2C9AA 1AR91 3ZSKA 5ANNA 1IPJA 2YDEA 1KD7A 2BWCA 2VAUA 5FZFA 3HNMA 1O3TA 2HEVF 1H9PA 5LA9A 4RFRB 5L73A 5FTTC 1R083 3DEMA 3IKWA 4EYUA 3AKQA 1FOD1 1WMDA 4GKXA 4WM7A 1AYN3 1LEDA 4KMQA 3AVRA 3ZFEC 4CXXA 3N7KA 3NJVA 3QH7A 4JHZA 1V0AA 3RYPA 3LPFA 4FXKB 2WC2A 2FZ1A 2R0HA 1DP0A 1ZNPA 4MGSA 1J84A 3GBGA 4Z8BA 4IW3A 5AC91 1ASJ1 4UF0A 2BP6A 5LEJA 3SCFA 1QQP1 4IGQA 4OQ8A 5JWPA 1R092 4A6OA 3DXUA 1XQNA 1OPOA 3MIDA 4EZHA 2P3KA 4OFGA 5EP9A 1XNDA 3I8TA 1RVF1 3WHTA 4M0NA 1UPIA 2RS12 2WWUA 3ZIWA 4MUVA 4UFJA 3D0JA 3EYPA 3O1RA 3CJIC 5DUUA 1VR3A 2UY9A 2VVEA 4NWVA 4XIOA 4BXFA 5FZ3A 4RS5C 4CU9A 1KEXA 1DBNA 1BBT1 2QNKA 2X09A 4RGGA 1AVBA 2UWCA 4GULA 2IVJA 2K0GA 4Q0VA 3UETA 1JZ7A 3NJZA 1BCXA 4K1ZA 2VQAA 3MDPA 2OVUA 3VHPA 3ZFGB 1MR5A 3NAPB 1ZBE3 2ZS6B 1AYM2 1FMD2 2UYBA 1LCLA 1K42A 4LORA 3H50A 5JR7B 1XPWA 1SLLA 3W20A 3MZHA 4PF5A 1KDMA 4AGGA 4IGOA 4M01A 1H2KA 5CFDB 4ITCA 3EO6A 3NV4A 3D0SA 3M3CA 5FO9B 2HYKA 2R071 5T5JA 3I2HA 1ND3A 1BEV1 5FLIA 2NLRA 4GH4B 1V9U1 4CDUC 3A22A 1ZM1A 1EAH2 2P3JA 2BBAA 2F17A 2XBO2 4KBZA 2D6NA 5JXGA 4FPJA 5FYSA 4YFWA 5F32A 4YM3A 2J1AA 2YBSA 3MIBA 3SKJE 2W2IA 3I2OA 4C8DA 5J3UA 2ARCA 2YZ4A 3LQCA 5BNNA 4Y5TA 3RYKA 5C3PA 4FP3A 3FC0A 1CWPA 2RV9A 2WS93 2WZR3 1UIJA 2YU2A 3N3HA 1YQ6A 4E4DX 1WGPA 1CX1A 1CQ9A 1LGNA 3AB0A 5BUVA 5LCWL 1HRI2 2Y34A 1UY1A 4O7XA 5JDBA 2RMU2 1VBA2 5I0SA 1AR61 1UYZA 4Y26A 2GNBA 5FPLA 1YQ2A 5GLZA 3RZKA 3DPRB 4H14A 1JU3A 2VMDA 4XW3A 4QXBA 4CP9A 1AJOA 4ES8A 1FPN2 3KV9A 1OURA 2IVIB 2PLV3 2W1SA 2ZGPA 1R1A3 1UY2A 2VOVA 4PQ9A 5HV0A 4AHXA 1RUC2 2DVDA 2ZEZA 1BMV2 4IV3B 3BI3A 4YFZA 4GAZA 2PHFA 1LEMA 1QNWA 5DAPA 2Q8EA 2JENA 3T0BA 1LOAA 3ZVXA 5C33A 1R64A 1EY2A 1JBCA 1DCSA 1D2QA 2UWBA 3VV1A 2E7TA 4YZ1A 1XC6A 3MI8A 1A8DA 1POV1 3VKFC 1VMFA 3BVCA 3ZFEB 1O3QA 3LEGA 3V56A 2XL9A 1KJLA 1RUF1 1UU5A 3ILNA 5FMBA 4CU7A 4LKDA 2WWSA 5IFTA 4ZY9A 4DO0A 4S2GA 3N9QA 3ACGA 2ZGSA 3AM2A 4C0HA 1YUDA 5FZKA 1ZZ7A 4P9LA 5JXJA 4XFGA 2R063 1G86A 2QQIA 2XLAA 4CU6A 3CQOA 2R32A 5JOWA 1UX6A 4NIDA 5DMYA 1GU3A 3MYXA 4AI9A 2GN7A 2E32A 1O6UA 3CJIB 5FKCA 3V0AB 3O0WA 5C3SA 5L7OA 4W65A 3J8F3 4RSUA 3OEBA 1AR73 4RS5B 4QQ2A 2HBUA 2VZ1A 2R043 1W8ZA 1KXGA 5I93A 1I5ZA 1EV12 5F5CA 2UU8A 3K46A 2Y38A 2GC1A 2NYYA 3H8UA 3N35A 3AKPA 3POBA 3ZXJA 3KQRA 5FMDA 3VD5A 2D5HA 5IHRA 4PF1A 4OUMA 1S1AA 2JDAA 3FBYA 3IZOA 4YW6A 1IPKA 4KG0A 1AXYA 3ZDSA 2AEYA 4MSVA 3UGFA 4BISA 4TXWA 3MFCA 1G8WA 5IVEA 5FY0A 4L97A 2A70A 3M3OA 3GZEA 3MPPG 3AKSA 1Y9MA 2HEWF 2HWF3 3AMQA 1DGRN 4OULA 3RYRA 4CDUB 1MS4A 4ES9A 4QKDA 4UXAA 2Y6GA 3FJSA 1R082 3OF1A 1QF3A 3KVBA 4AVAA 4WZCA 2YBKA 4ZKTB 2GAUA 1AYN2 3ASIA 4Y33A 4XHBA 2ZHKA 2IXLA 3C7GA 2EVXA 3CMGA 1NXD1 1APNA 2VMHA 1QJZA 4HLTA 3AMMA 5JZGA 1CD3G 3HNBM 4GMP3 4OHVA 4QD2A 3IDAA 3ZYIB 3I3BA 4HKLA 3UESA 3L2YA 4I02A 1FV3A 3H42B 1UIKA 1Z7S3 1Y4WA 2YROA 2I45A 4PIXA 2MNGA 1ZREA 3VZOA 3D82A 3Q9OA 1F5FA 3C2UA 1LHUA 3MV11 3CBNA 2ZGMA 4XJZA 4H2AA 2X05A 4CDWA 1QXPA 4FVVA 3UV9A 4I0WB 1RUH3 1VBD2 3IIIA 1ULOA 4FTEA 2CDOA 4CYDA 4AFMA 3E5XA 3SCHA 4BCUA 1OH4A 4E8DA 3SH5A 1FI2A 5CAZA 3N9PA 1UQXA 1RINA 4IEYA 4TLGA 5HXMA 3MUY1 3QOPA 4O9GA 1VB2A 3HNYM 4Q1RA 1T6BX 3VUOA 3RQ0A 4MGTA 2MPFA 4Q0SA 3ZO0B 1UOJA 3OB8A 4L99A 3JQXA 5F3GA 3AP4A 2PAKA 3RPQA 4QX5A 1AXKA 3R0RA 3MW2A 4LHLA 5LWBA 2BFUS 2QVSB 4OZXA 1CAUB 1VBE3 1HV1A 1YJKA 3AZZA 4MX3A 5D2AA 1WWYA 1DLCA 3O5SA 5HPOA 4YG3A 4IEQA 5EPAA 3VLBB 1DU3D 3NNMA 1YLLA 3BUCA 4QPIA 4CUCA 4F3JA 1PMJX 5J09A 4XDPA 1ND2A 4K40A 3H1WA 4XF1A 4I01A 4CCNA 4LHNA 4QX3A 5FXWA 2YC0A 1W6MB 3HN3A 5GZDA 3K48A 4AVCA 2G19A 4FFIA 3R4UA 1H1MA 3ACLA 1GZWA 3UKNA 2FDHA 2EXKA 5DAWA 1D0GA 2CGPA 3FX3A 3ZXKA 5FUPA 2XVGA 3BIWE 4RR3A 1ZRRA 2DDUA 2C1FA 1NE4A 1VAKA 3GNEA 2ZABA 3GALA 1AX0A 2VTXJ 2D5FA 2YMZA 1REFA 1OSGA 1A8MA 1O7FA 1PVC3 4CDXC 1GYKA 3ZN4A 3HT1A 4UW3A 4HONA 1W6QB 4MXWB 4EWDA 1M4WA 4OUEA 3PUIA 2PLV2 5DG1A 2JECA 4E4HA 1R1A2 4I30A 4AEMA 2GU9A 5APAA 4XETA 4YNIA 5D8AC 1H2LA 3AKRA 3C7OA 1OUXA 2P17A 1SACA 1O5UA 1ULGA 1WUVA 2WNUC 2BEOA 2GZWA 4GMP0 5FV3A 1W2AX 5KC5A 1L7RA 3GF6A 2JIGA 3WQ7A 2DFCA 4LIUA 5F9TA 2VOXA 1D4M1 1LOBA 1YEWA 2JDYA 4HPKA 4K7JA 3NKTA 1DGWX 4HXCA 1AJKA 4PBPA 1W6PA 5C8CC 2ZGTA 3BKZA 2ZGUA 1W6OB 2PMWB 2ZAHA 3M4FA 4P00B 1VE0A 2GMMA 3VZKA 3MPBA 4ZXEA 3J7HA 5JSPA 1MS3A 1XE8A 4LUKA 2A73B 4JHTA 4QXKA 4UYBA 2ZGRA 2ZKLA 4Q4W1 2ZAAA 3WF1A 2PELA 5A3UA 2A3YA 2J22A 1U5IA 2GC0A 5IWFA 1RUI1 4AHWA 5FY5A 4N8MA 4NRMA 3CDZB 3ZN5A 1AR72 5GLWA 3WG4A 1VBB3 1HQNA 4PCRA 1CAXB 2R042 2W46A 2BZDA 1YIPA 3Q8FA 1HB1A 4AE2A 5KC6A 2A71A 1WW5A 1HB3A 1SDWA 2HWB2 1UCXA 5A7OA 1OVPA 2JIJA 2WNVC 5IYYA 4ATEA 4W6YA 5FBZA 5FMCA 2ZHLA 3VB9A 3W58A 4QX1A 4QPYA 3TOJA 3TEWA 1N3QA 5KBFA 1UD1A 2VUCA 4COZA 4LKSA 3KHCA 4S2DA 3N36A 2B45X 1IPSA 1JUHA 2HLEA 5F2SA 5C5UA 4GD4A 3VZNA 4OHXA 1EYBA 2HWF2 1DQ2A 2MEV1 2NMNA 3IN9A 3E6BA 1O4YA 1GP5A 1BXHA 2WDBA 3L2HA 4LTAA 5IAVA 4B4QA 2B9VA 4QHBA 1V00A 5JXIA 3OBZA 1OLME 3WV6A 3W5NA 2DVGA 1N3PA 3K3OA 3QLQA 1QH7A 5E88A 1LTEA 1GWMA 3ATGA 4MO3M 1RUD2 4YW3A 4CRQA 5FDBA 1XU2A 5FYCA 3B7MA 2X53S 3CO2A 3ZYJB 5J36A 4NHKA 2OXBA 3USSA 3ZFGA 5DAVA 4OQ9A 4X8NA 4BHPA 3RSJA 3OBRA 4XFFA 4DEVA 4DOUA 1H6XA 4Q4V1 1QU0A 3U75A 2IXIA 5A7QA 4XJ8A 1GWLA 3K4DA 4NO4A 5CFDA 4BZ4A 4CDXB 2CGNA 3HQRA 1RUH2 5CEHA 1F15A 4IEUA 2YFZA 2RE9A 4IEPA 3MIGA 2WO2A 3ZYGA 4GH4A 3RG0A 4A45A 1UXXX 5FR3A 1BVP1 1V6OA 2QBXA 3ABZA 4FTSA 2VUJA 2VY0A 3RI9A 5D8AB 5FZDA 5L19A 4UFMA 2NM1A 5C3QA 2CY6A 4RYDA 1QNYA 1TMF1 5L36A 1VB4A 3JZVA 1GNHA 3LZZA 4XBLA 1HJGA 4NHLA 3ZN6B 3C8XA 3ZXAC 3I3EA 3SLIA 1JYVA 1QWRA 2WNUB 5FOJB 3BTYA 3B00A 4QPGB 3W21A 3DN7A 5CADA 1OLRA 5FP9A 3THCA 2W9XA 2YPJA 1RC6A 1VBE2 4KNCA 5C8CB 5I0UA 1LB2A 1GOFA 2GC2A 4B4PA 4FPGA 2C4XA 1VAVA 4RFT0 2ZGQA 2BGCA 2OX0A 1IS6A 5F39A 1RL3A 3DKWA 4BA6A 3DPRA 1C8M3 4FPLA 1BZWA 1QJY3 3N9OA 4DRVA 5JUVA 1F4AA 5CB7A 1Q5OA 4JCKA 4DIQA 2ARAA 4I0BA 1AR83 1S0JA 4O9EA 4IV3A 3ILRA 2WR9A 5DABA 1VLNA 3E5UA 2RDRA 4RL7A 5I0DA 2AENA 1T2XA 3ZKYA 2JDNA 3TN91 2EF6A 2JJ6A 4ET7A 1Z0HA 1PVC2 3WNMA 1PZ7A 2ZKNA 2BERA 1UZZA 4JDNA 5E16A 2WNVB 4U36A 2VO5A 4DQAA 1JZ2A 4YW2A 3ZFEA 3NNFA 3VZMA 3GHNA 2QTWB 5FYHA 3JB4C 4COWA 4IEZA 2JWPA 4PI2A 3WW4A 4QU1A 4P9YA 1RUNA 1QIQA 4LO6B 3ZMOA 3LDBA 5C7GA 2GH2A 1NOVA 2YC2A 4K9SA 5F37A 4HN0A 3GJBA 1JZ3A 3WP5A 4ASKA 5A6ZA 2H6CA 1Q3EA 3EJKA 3O1VA 2VVDA 4BQ2A 4XCAA 1HQLA 3SH3A 3CJIA 3UKTA 3OYWB 3RZGA 3KT1A 3B94A 4RHV1 3V0AA 1B09A 4QDRA 1X50A 4NIIA 5FAXA 4RS5A 2XJTA 2XONA 3WEZA 2OS2A 2BV4A 1ULFA 5EIYB 3FHAA 5LEKA 3GXUA 3QH6A 3MGUA 4CSWA 4HFSA 3C7FA 2PA7A 1J59A 2IXHA 3T2TA 1RITA 1C57A 1G7YA 2W3JA 5EJZB 4ATFA 2FDIA 1RIRA 2QDRA 3NO8A 2IFWA 2YC4A 3FZ3A 5LATA 3PJQA 4FQ4A 3WNXA 5FPUA 4PIYA 2VL4A 1YCIA 5C71A 1UWWA 1N1YA 1MEC1 4XBQA 2OIIA 2UURA 1GP4A 1G9CA 4Q8KA 3ZSEA 5CBLA 5HCFA 1VBB2 3RZHA 5L9RA 1HW5A 2BVVA 1Q8QA 4QQHA 4CDUA 1TNFA 1GOGA 2WT2A 1QJFA 5A7SA 3IAQA 3WW2A
chains in the Genus database with same CATH topology
3HQRA 3HQUA 4XAAA 4XCBA 5DAWA 2OPWA 3ITQA 4ZPIA 5DAQA 4XACA 2RDQA 4IW3A 4MHRA 2FCTA 3DKQA 4BQYA 5EP9A 4NHLA 2RG4A 5ERLA 2HBUA 5EQUA 4NHMA 5LBBA 3W21A 2G1MA 5IAXA 4J25A 4Q5OA 5DAXA 4NMIA 4NHXA 5L9BA 2FCVA 5LBEA 2JIGA 3PL0A 5M0TA 3GZEA 3W20A 5LBCA 4Y5SA 2RDSA 2RDRA 3NNLA 5A3UA 4BQXA 5LBFA 4KBZA 4ZONA 3NNFA 5L9VA 4BQWA 3OUHA 3OUIA 4Y5TA 3OUJA 2A1XA 2JIJA 4XC9A 2V4AA 3GJBA 3KT4A 5C5TA 3NNJA 2Y34A 4XCAA 4JZRA 3KT1A 4NAOA 3KT7A 5C5UA 5IATA 4MHUA 3GJAA 3MGUA 5IAVA 5LASA 5HV0A 3OBZA 4XABA 5HV4A 5LATA 2FCUA 5DAPA 5EPAA 3NNMA 4UWDA 4NHKA 2Y33A 5LB6A 4NHYA 5DAVA 5L9RA 3BVCA 2HBTA 3EMRA 5LA9A 2G19A 2RDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQR A;  3HQU A;  4XAA A;  4XCB A;  5DAW A;  2OPW A;  3ITQ A;  4ZPI A;  5DAQ A;  4XAC A;  2RDQ A;  4IW3 A;  4MHR A;  2FCT A;  3DKQ A;  4BQY A;  5EP9 A;  4NHL A;  2RG4 A;  5ERL A;  2HBU A;  5EQU A;  4NHM A;  5LBB A;  3W21 A;  2G1M A;  5IAX A;  4J25 A;  4Q5O A;  5DAX A;  4NMI A;  4NHX A;  5L9B A;  2FCV A;  5LBE A;  2JIG A;  3PL0 A;  5M0T A;  3GZE A;  3W20 A;  5LBC A;  4Y5S A;  2RDS A;  2RDR A;  3NNL A;  5A3U A;  4BQX A;  5LBF A;  4KBZ A;  4ZON A;  3NNF A;  5L9V A;  4BQW A;  3OUH A;  3OUI A;  4Y5T A;  3OUJ A;  2A1X A;  2JIJ A;  4XC9 A;  2V4A A;  3GJB A;  3KT4 A;  5C5T A;  3NNJ A;  2Y34 A;  4XCA A;  4JZR A;  3KT1 A;  4NAO A;  3KT7 A;  5C5U A;  5IAT A;  4MHU A;  3GJA A;  3MGU A;  5IAV A;  5LAS A;  5HV0 A;  3OBZ A;  4XAB A;  5HV4 A;  5LAT A;  2FCU A;  5DAP A;  5EPA A;  3NNM A;  4UWD A;  4NHK A;  2Y33 A;  5LB6 A;  4NHY A;  5DAV A;  5L9R A;  3BVC A;  2HBT A;  3EMR A;  5LA9 A;  2G19 A;  2RDN A; 
#chains in the Genus database with same CATH topology
 2VBP A;  3DCQ A;  4C1X A;  4BME A;  2BU9 A;  5G04 L;  3CZU A;  3KCX A;  3NWK A;  5LA2 A;  4ONU A;  1ENS A;  1OF4 A;  4KWJ A;  2G9Z A;  2D3P A;  3FWE A;  2RR1 2;  4X6Q B;  1RUE 1;  1UO9 A;  1GUI A;  3NL1 A;  1CZV A;  2JG9 C;  4K20 A;  1W2O A;  2D44 A;  3MO4 A;  4XZU G;  1MQT C;  2YGL A;  1VBC 3;  4YVW C;  4C91 A;  4LBK A;  3ZXE A;  1LUL A;  2YGM A;  2PHW A;  1ALY A;  4BK5 A;  1ZYB A;  5CFC C;  1VIW B;  4BXS V;  4W6X A;  4KWU A;  2Q0A A;  3VDA A;  4AYU A;  2RJL A;  3APB A;  2WNE A;  2B9U A;  3AMH A;  1SLT A;  2ZX3 A;  1MS1 A;  3P3P A;  4HVO A;  5DAX A;  1N3O A;  3T3Y A;  1RUG 1;  1U5X A;  4MLO A;  5FK7 A;  4B1L A;  4JAA A;  1PGL 2;  4LQR A;  3RJ2 X;  3WY6 A;  3RVH A;  2W1U A;  3B93 A;  3OGR A;  3D5O A;  1VRH 2;  5D1I A;  1WME A;  2XJQ A;  3BPS A;  1H0B A;  2LTN A;  1LOD A;  3TEZ A;  2BTV C;  2XGX A;  3HBK A;  4KGQ A;  4M3C E;  4OCT A;  1H6Y A;  1XSR A;  1DHK B;  2QUO A;  3KVA A;  4R9B A;  3UGH A;  3A23 A;  1AX2 A;  2RS3 2;  5FO7 B;  2UWA A;  4JV4 A;  2WWJ A;  1POQ A;  1CAU A;  3POW A;  1R09 1;  1Y9G A;  2ZBJ A;  4FFH A;  1PMH X;  4AOC A;  1S0D A;  2VGD A;  2EIC A;  2JE7 A;  1QXJ A;  3ZYP A;  5IK8 A;  5ACA 3;  2JD4 A;  3CHX A;  1XBF A;  2G4I A;  4QQP A;  4QX0 A;  3IDC B;  1PO2 3;  3LKJ A;  2JXA A;  3FHQ A;  5KHG A;  2OQ6 A;  1T6G C;  3VD4 A;  2WN2 A;  1W0O A;  3WUD A;  1I3H A;  3POE A;  4WM8 C;  1W6M A;  2GSY A;  1LHW A;  1UMI A;  1DFQ A;  4P9J A;  1COV 1;  1NQJ A;  1JYX A;  3GZU C;  2Z5W A;  3BPZ A;  1ZZB A;  2ZEX A;  5T55 A;  3WSO A;  1OQ1 A;  4E2S A;  3JD7 3;  1CAW B;  2ZML A;  1G6N A;  5B4X A;  3FUQ A;  2HH9 A;  3NRU A;  4Q4X 3;  2XJS A;  1PX4 A;  2JIC A;  1TE1 B;  2VBD A;  1SPP B;  2VXJ A;  4XHX A;  1FMD 1;  4N43 C;  2VCB A;  4DFS A;  1JN2 P;  2Z79 A;  5JMC A;  4BU2 A;  3VHR A;  2JE8 A;  3ECQ A;  4CEY C;  1C8M 2;  4PI0 A;  3VGI A;  1NYW A;  1PO1 3;  2ZMK A;  4Z2A A;  5K0U C;  4WBB A;  1AL2 3;  2H6B A;  3NAP C;  1W6Q A;  4MXW A;  4K3U A;  4AEJ A;  2QCS B;  5DUV A;  4ZHN A;  2WRA A;  1C5H A;  1RHI 3;  2RM2 3;  4ZZ8 A;  4AVT A;  1UN1 A;  1AR8 2;  4UFK A;  3ZYB A;  1EAH 1;  3KV5 A;  2XBO 1;  5LAS A;  4QHO A;  1OKQ A;  2W08 A;  5DQ0 A;  5T52 A;  5ANQ A;  3G6J B;  1EP0 A;  3CL1 A;  2BOI A;  2PN5 A;  3E6D A;  3LIG A;  2QQJ A;  5FYU A;  1E5H A;  3ELN A;  2Q8D A;  4CVU A;  2IXJ A;  3GZA A;  1DGL A;  3LIH A;  1NCR A;  4YG6 A;  2DUO A;  1F2N A;  5FYT A;  1TME 1;  5LRS A;  3AC0 A;  1VMH A;  2ZHM A;  5LA0 A;  3O0V A;  4LBQ B;  1RMU 2;  1W6O A;  4UI9 L;  4NIA A;  4QKN A;  3OD4 A;  1AR9 3;  2P4E A;  1JW6 A;  5CA6 A;  4YW1 A;  5JVV A;  4LMF A;  1VBA 1;  2JG9 B;  3J7M A;  4UAP A;  5JIU A;  1GR3 A;  3HQU A;  4XZP A;  4D94 A;  4LHS A;  1MQT B;  4XF0 A;  2PHU A;  4YVW B;  1OXC A;  2A3X A;  1FOD 3;  4QQO A;  4H7L A;  1FPN 1;  2G9F A;  2P2K A;  1U5Y A;  2O0O A;  5IUQ A;  5CFC B;  4EN0 A;  5E6H A;  5JCT A;  1ZA4 A;  3KF5 A;  4MHR A;  1CES A;  1RUC 1;  1JZ6 A;  4IUG A;  1KRI A;  2WT0 A;  5AC9 3;  1ASJ 3;  1S0F A;  5GJ6 A;  4I2O A;  2ARB A;  4ZU4 A;  1QH6 A;  4AR2 A;  1GAN A;  4Y1U A;  1WBF A;  2G1M A;  3A0K A;  5FUN A;  3VKL A;  4MVT A;  3RGB A;  1K3I A;  1V6M A;  1S0C A;  1KS4 A;  3OBT A;  1CIW A;  2D7F A;  4Y1Z A;  4QGM A;  3V65 A;  2B8M A;  1IQD C;  2VVF A;  3VHO A;  2VZ3 A;  1VAM A;  2IUW A;  2XUE A;  1IKP A;  5IVJ A;  1DQ1 A;  4QPW A;  5F6L B;  5LY1 A;  1I9R A;  3IBM A;  1BBT 3;  2FZ2 A;  4LBO A;  3KQ4 B;  1K5M C;  4D3W A;  1JYC A;  4LO4 B;  4M4R A;  4G9S B;  1CVN A;  1JYT A;  3IMM A;  2QQK A;  4J1X A;  1LKN A;  1DZR A;  1OMI A;  4IE4 A;  3MFA A;  5GLU A;  1W9Y A;  4M0H A;  4WM8 B;  1RUJ 1;  1XRU A;  2EIE A;  2E9Q A;  3K51 A;  4IQP A;  4D7S A;  5FYI A;  4CP0 A;  1ZA7 A;  4KGG A;  2WLP A;  1YFU A;  2PHX A;  3AYE A;  4JTO A;  1BEV 3;  1EV1 1;  1NUK A;  3WDX A;  4B3N A;  1UZY A;  1V9U 3;  2LUW A;  3HVD A;  4H3W A;  1VBC 2;  4COU A;  5JSO A;  2AC1 A;  1H4H A;  3OJB A;  5LK5 A;  3AYC A;  4N43 B;  1J1L A;  4UW5 A;  5EFU A;  1YXW A;  2VUL A;  3KMH A;  5FY7 A;  1GQH A;  2A5Z A;  4PLM A;  4CEY B;  4CDX A;  2W5F A;  4HL0 A;  2VPV A;  5K0U B;  3J26 N;  3PTR B;  3J7L A;  3OSD A;  4XC9 A;  5IW0 A;  5EZW A;  4A3Z A;  4DXZ A;  3PHM A;  2VEC A;  3NNJ A;  1KDK A;  4KH9 A;  5FZH A;  2VOK A;  2JDK A;  4P9I A;  4EWE A;  4LR4 A;  2R1B A;  5D8A A;  4F7Z A;  3PME A;  3OD0 A;  4QX2 A;  2C0Z A;  4N9I A;  4IDZ A;  1AL0 G;  3D4K A;  2ZAC A;  3HD8 B;  3ZN6 A;  4X6R B;  1CN1 A;  5GLT A;  5TSW A;  1AR6 3;  4QB2 A;  2WNU A;  3PUQ A;  3AP7 A;  4LOS A;  2HWC 2;  4YG0 A;  2D3R A;  1SZB A;  3MLL A;  3I2D A;  4ARY A;  4EZ4 A;  3ZLI A;  5FZC A;  5C8C A;  3OCP A;  4BQ5 A;  3F95 A;  3Q8C A;  4XUQ A;  2A6X A;  5FOB B;  4GKY A;  1W2U A;  3VKO A;  1PO2 2;  2PYT A;  2V5D A;  4Y20 A;  2CYF A;  3U37 A;  1OQD A;  5LB6 A;  1LAJ A;  2E53 A;  4LLF A;  3WNO A;  5FWJ A;  3LCP A;  5I8Y A;  1VAL A;  5T54 A;  1W3X A;  1VBD 1;  4LUL A;  5FZI A;  5KHH A;  1POV 3;  3JD7 2;  2Q1F A;  1SFY A;  3DYO A;  4GJZ A;  1SLB A;  3KGL A;  4Q4X 2;  4CDQ C;  2DU0 A;  2PXJ A;  3VBU C;  4CCJ A;  1W8W A;  3N4M A;  3H8O A;  3CJX A;  1SCS A;  1W8N A;  4GJY A;  1OT5 A;  5A6Q A;  3N7J A;  1S2E A;  2W1W A;  2ARX A;  2OPW A;  3CF6 E;  3PUR A;  3M2M A;  3NKG A;  2WNV A;  1CZS A;  4RQP C;  3U07 A;  1UY3 A;  1AL2 2;  5FZ8 A;  3KSC A;  1CIY A;  3POJ A;  4JKK A;  4KG8 A;  2VZV A;  2HKX A;  4F8A A;  2Q4S A;  3CLP A;  3OGJ A;  1XNK A;  4NHM A;  2ARE A;  4OI1 A;  3U4S A;  4CEW C;  4MYE A;  3LAG A;  2BW8 A;  2VMF A;  4LKF A;  4A44 A;  5AVP A;  3THT A;  4IEX A;  1CJP A;  3OEA A;  4L8Q A;  3TAY A;  1K5M B;  3RMX A;  3ZX7 A;  1I5P A;  2OZJ A;  2Q1M A;  1CJD A;  1TNR A;  4BH9 A;  5L9B A;  3OYW A;  1BLZ A;  3TRS B;  2VMG A;  2UY8 A;  1ONA A;  2AR6 A;  1X33 A;  4YZ4 A;  4MG2 A;  2ZEY A;  3OY8 B;  3AP9 A;  1MPX A;  2R16 A;  2EXJ A;  3W9A A;  3GDB A;  3WNP A;  3R4D B;  4DXT A;  1Y43 B;  2XWJ B;  1QMJ A;  1KIT A;  1XE0 A;  2XJR A;  3I59 B;  1U5Z A;  5HXV A;  1CX4 A;  4R9C A;  1JUI A;  3DF0 A;  4RN5 A;  1D4V B;  2K2S A;  2VZU A;  3N7L A;  5A1L A;  4AHZ A;  5GZC A;  4IXL A;  2QE3 A;  3OPZ A;  3FE5 A;  2CNA A;  3LB9 A;  1QDC A;  2GNT A;  2PLV 1;  4DIN B;  4G3Y C;  1R1A 1;  3LSE A;  4K1Y A;  3ZIX A;  5IJR A;  5HCH A;  4I0A A;  4KI5 M;  3I3Q A;  1U12 A;  2P5B A;  4FPC A;  3SH4 A;  5AC9 2;  4BMB A;  3T0D A;  2YUE A;  4WV8 A;  2FBE A;  4DY3 A;  1DYP A;  4S2F A;  1UZ0 A;  1PGS A;  4PDW C;  4XUO A;  5A3P A;  1CGP A;  4G4F A;  5KHI A;  1BHG A;  2VG9 A;  4A2U A;  5C5T A;  2WAA A;  3N9N A;  2VQU A;  3K77 A;  3LEM A;  4YM0 A;  5CU1 A;  5GKA C;  1Y9Q A;  4PLN A;  4KWK A;  3FHI B;  4TZD A;  1BBT 2;  1P8J A;  5IFP A;  1LGB A;  4KU7 A;  1XYP A;  1PHM A;  1C4R A;  3IPV B;  3PVN A;  2XHK A;  5KR7 A;  1POV 0;  4QB6 A;  4HBN A;  3ZYR A;  4BLI A;  3J9S A;  1JXN A;  1X36 A;  3WUC A;  4BJ0 A;  2ORZ A;  2ZGL A;  3WG1 A;  5LA1 A;  4DXR A;  5EXO A;  3VBR A;  3WP4 A;  1AR7 1;  4LA2 A;  1V70 A;  1GKB A;  3WZ1 A;  2R04 1;  1QDO A;  2WFF 3;  2WJS A;  3GM8 A;  3O7O A;  3MLJ A;  5EHD A;  1QJX 1;  4CDQ B;  3PVB B;  1V9U 2;  1ZBA 3;  2HWB 1;  3VBU B;  5DDJ 3;  2EXI A;  4N7U A;  2E6V A;  4R4X A;  3WCR A;  5FJH A;  4I09 A;  3AYD A;  3E1F 1;  3OPT A;  4YM2 A;  3DYP A;  3B69 A;  4RQP B;  1ZBE 2;  3HPN A;  3PTY A;  2NQY A;  2X10 A;  4XCB A;  3PUH A;  1LOE A;  3B01 A;  4XOG A;  2RS5 3;  4MOA A;  2HWF 1;  2VXR A;  5FZ0 A;  4CEW B;  3KGZ A;  2GME A;  3ITQ A;  1J3R A;  4XQW A;  4WVZ A;  3FFZ A;  4FPY A;  2ILM A;  5DAQ A;  4BYY A;  2WAB A;  1WA4 A;  2BNN A;  5IVY A;  1HQW A;  1PX3 A;  1E57 A;  4XFH A;  1AR6 2;  5JPN B;  3SHR A;  3J7N A;  5FUI A;  3WDY A;  2NPI A;  2PAM A;  1RUD 1;  3LGR A;  4FPE A;  1JOB A;  4NAM A;  4E4S A;  1CAW A;  4AVB A;  1HRV 3;  3SKV A;  2JX9 A;  5FBJ A;  2CV6 A;  4GMP 1;  2LS6 A;  1OA2 A;  3X29 B;  1SPP A;  5JPM B;  4IGP A;  1JOJ A;  2WS9 2;  2WZR 2;  2VE1 A;  4RD7 A;  3H1Y A;  4RA0 A;  2GH8 A;  4SLI A;  5LBE A;  1GZT A;  1FAT A;  3AX4 A;  1RUH 1;  4MGK E;  1WCK A;  3FLP A;  1EUU A;  3ZMN A;  2YY1 A;  3JU9 A;  3U10 A;  2ZX2 A;  5FZG A;  5FYY A;  1ODN A;  1W90 A;  4IEV A;  2GC3 A;  4YAR A;  2ADE A;  4XF9 A;  2WT1 A;  4LBM A;  3ZYH A;  1ZRC A;  4FOY A;  1CON A;  3AZW A;  2KXL A;  5FZA A;  1XSQ A;  4NE9 A;  5C3O A;  1DQ5 A;  1HJF A;  4Q4Y 3;  4Y1X A;  3AZX A;  1OPM A;  2ZGO A;  4FXG B;  2I74 A;  4Q4W 3;  2JB4 A;  3WF0 A;  4YVS C;  4CCK A;  4PDW B;  3I2I A;  1RUI 3;  3WNK A;  2VQ0 A;  4LBQ A;  1AF9 A;  3SIT A;  4BQW A;  1VBE 1;  1OA4 A;  3L9J T;  3VBS C;  4QPG C;  1H9W A;  4QXC A;  4DUV A;  2QQU A;  3INA A;  4IE5 A;  3SEE A;  1K5J A;  1GBG A;  2QQL A;  1WMX A;  2EIB A;  2JG9 A;  2VM9 A;  2QDN A;  4FSJ A;  1MQT A;  3LEK A;  2BUK A;  4XQ4 A;  3ZFF C;  4YVW A;  5FQ0 B;  4WVV A;  2D6M A;  3PIJ A;  1PNF A;  3I2G A;  2Y6H A;  1ENX A;  3M3Q A;  5A3W A;  2KM2 A;  1URX A;  5CFC A;  2R06 2;  1PVX A;  5BYN A;  4JZR A;  1BK1 A;  2QQN A;  3B02 A;  4NAO A;  1A34 A;  3KT7 A;  1G9F A;  4QKB A;  1H4G A;  5JI7 A;  2EAL A;  2BJS A;  1Y3T A;  3UKV A;  5HBA A;  1W05 A;  3J8F 2;  3S7I A;  1REE A;  1D0H A;  3G7D A;  2MEV 3;  1PVC 1;  1YFY A;  2Q1Z B;  1DYO A;  1MS9 A;  3K3N A;  5LW9 A;  2YB7 A;  4PHZ A;  4AG4 A;  3GCW A;  2IXC A;  5KXD A;  3AJY A;  2DFB A;  1H2M A;  3IIA A;  2Y60 A;  5ISL A;  2FQP A;  3AMN A;  1X7N A;  1AX1 A;  3CIH A;  3JBG 1;  4COV A;  5EYX A;  4DB5 A;  5JIA A;  4PBO A;  3MBW A;  4KU8 A;  2VBB A;  2Z42 A;  2P6C A;  4NJ4 A;  4NWW A;  2OZ6 A;  4ERO A;  2R49 A;  4QAW A;  5DN2 A;  3BN6 A;  5CIR A;  5F3E A;  2R6Q A;  3S7E A;  3HWJ A;  4MH0 E;  4Q4V 3;  4WM8 A;  1OLQ A;  3AJZ A;  4Q0U A;  2ADD A;  4QDS A;  4P14 A;  4A6S A;  1OKO A;  2WQ4 A;  4JGZ B;  1AZD A;  4HT1 T;  3I54 A;  4LE3 A;  5K8S A;  4XEZ A;  3QBQ A;  4P08 A;  3MUZ 1;  4HZF A;  2EIG A;  3WQB A;  4N43 A;  1LES A;  4Q26 A;  4Z07 A;  4D8M A;  4I3G A;  4QU2 A;  4XMA A;  5EQU A;  2CWM A;  4CEY A;  4F83 A;  1LOF C;  2D6O X;  2Q5T A;  1LGC A;  5K0U A;  3ZPY A;  3ZM8 A;  5JMO A;  3NAP A;  2VTX A;  3ROU A;  1Z7S 2;  4MET A;  3DEC A;  5IK5 A;  3BOW A;  1VBB 1;  4Q5O A;  4HVR A;  1RJ8 A;  1STM A;  2BVB A;  4M3C B;  3A7Q A;  2WFF 2;  4FPK A;  4UF0 B;  1O8S A;  2FCV A;  3NVC A;  4OI0 A;  2VJX A;  4K21 A;  5DZE A;  5EV7 A;  3AZY A;  1V6J A;  4J1W A;  1ZBA 2;  1JOP A;  4YW5 A;  5DDJ 2;  4AAX A;  4AK3 A;  2DUR A;  1UYP A;  3VZL A;  1OBN A;  5C9A C;  1SBE A;  2JG8 C;  4JGY C;  4GB3 1;  3U11 A;  4XTP A;  4H7M A;  1NZC A;  5H9R A;  3P6B A;  3ZSJ A;  3LDR A;  3S5Q A;  5IVF A;  3E6C C;  3DL3 A;  5A33 B;  2HWD 3;  1NKG A;  5JOZ A;  5FXZ A;  2RR1 1;  1QJU 1;  1OQE A;  1F9K A;  4YVS B;  4FPF A;  4AL9 A;  4AGV A;  1KQR A;  1CPN A;  4QM8 A;  2WZP P;  2RS5 2;  2DTW A;  2VU9 A;  3WG2 A;  3VBS B;  3WNL A;  5HI0 A;  3AL6 A;  1UAI A;  4E8C A;  4ISQ A;  3ZXD A;  2WQZ C;  4Z1V A;  4IE7 A;  1K45 A;  4Y3O A;  3ZFF B;  2VR4 A;  4MZU A;  4FBF A;  4N7I A;  2W39 A;  1E5I A;  5FYM A;  1E5S A;  1EUT A;  4V1P A;  1W8F A;  3MF9 A;  3W59 A;  1HRV 2;  2LW8 A;  5JOY A;  4HOO A;  5FZE A;  2VZT A;  4L11 A;  1VRH 1;  4JDO A;  4W4Z A;  4EN8 B;  5BNO C;  1V6K A;  2P1B A;  5GZE A;  3H1M A;  2DWR A;  3WCS A;  1WCS A;  4C0B A;  3WP6 A;  4XVH A;  1CPM A;  1BVV A;  4Q8L A;  5A3L A;  2F4P A;  3ES4 A;  4GA9 A;  4DPN A;  2RS3 1;  3MW3 A;  2WO3 A;  1SG3 A;  3PUA A;  4CCD A;  4RHV 3;  1RUO A;  2VW2 A;  4MHU A;  3USU B;  2QZ3 A;  3HOB A;  5FPA A;  1A3K A;  1L3J A;  1MS8 A;  1H30 A;  4HK9 A;  4LO5 B;  1K5M A;  4CP2 A;  2VZP A;  1YHF A;  4Q4Y 2;  3U1X A;  1ZZ9 A;  5KHK A;  1QXR A;  1PNG A;  3SQO A;  3BIE A;  3S30 A;  1OFN A;  2OUJ A;  2VNV A;  1F35 A;  3VZJ A;  1MEC 3;  2D6L X;  2H0V A;  3NMB A;  3TB0 A;  5FO8 B;  3RS6 A;  2TEP A;  2HBT A;  1CZT A;  1UZW A;  4DS0 A;  1EPZ A;  3EMR A;  2IWG B;  3I59 A;  2ZGN A;  5CYY A;  5SV5 A;  1NY7 1;  2ERF A;  5J96 B;  3O14 A;  4Z2W A;  1C8M 1;  4UBH A;  1R1Z A;  1V6I A;  3MHZ A;  4O65 A;  3LFM A;  4AI1 A;  3FFQ A;  5GLV A;  3RZL A;  3WT3 A;  4LUM A;  1Z78 A;  1AR8 1;  3WD5 A;  2W0X A;  4K8R B;  2Y8K A;  3VBO C;  1RUE 3;  1ZX5 A;  1IOA A;  2W68 A;  1HDK A;  1GFF 2;  1GWK A;  2D6K A;  2D93 A;  4WVW A;  2CGO A;  4NR1 A;  2I07 B;  3VDC A;  2AYH A;  5LBB A;  2W52 A;  4XQD A;  4XIK A;  4E9K A;  1MZ6 A;  3PIG A;  5C9A B;  3VBH C;  2SLI A;  4LXL A;  2JG8 B;  1HXS 3;  4BLJ A;  4JGY B;  3RMY A;  3SNM A;  3LF7 A;  3NST A;  4JX0 A;  3FMG A;  3SEP A;  3TWI A;  1RMU 1;  4GWN A;  4FTB A;  1IQA A;  1OLM A;  1RUG 3;  2XQX A;  3OGV A;  1HN1 A;  3IPV A;  3OGS A;  3K75 B;  1YFX A;  3ZSL A;  5JI9 A;  5M0T A;  1MAC A;  2AZ5 A;  5FLH A;  3WXP A;  3SC7 X;  3BTA A;  1RJ7 A;  1UW8 A;  4TSV A;  4JKL A;  3ETP A;  4GWI A;  4W6W A;  5FRE A;  4BPZ A;  5FZ4 A;  3I97 A;  5LBC A;  5JOX A;  2DUP A;  4DUX A;  1JHJ A;  5CG8 A;  4K8F A;  3LPG A;  4H55 A;  5AFB A;  1FAY A;  1FNY A;  5F2W A;  3S6P A;  1YQ8 A;  1GOH A;  2LRO A;  1DZT A;  2HWE 3;  3I2K A;  4OVE A;  4CDQ A;  1PM4 A;  4FT8 A;  1DGW A;  5AVA A;  3VBU A;  2IFR A;  2A6Y A;  2B39 A;  3HAG A;  4W50 A;  4UT5 A;  2WYF A;  4AGR A;  4AED C;  5BNO B;  3ZXL A;  2WA4 A;  4BM8 A;  4KQ7 A;  2BGP A;  4DXS A;  4NN0 A;  4RQP A;  3TBD A;  4TN7 A;  2WSV A;  2FDG A;  1F8V A;  2QQM A;  4LJH A;  1COV 3;  3ETQ A;  2EAK A;  2JDH A;  2V4A A;  2O8O A;  1DQ0 A;  1EPW A;  3U78 A;  4CEW A;  5DZG A;  1YYN A;  4XUN A;  4N53 C;  1I1E A;  1HIX A;  1C5I A;  4BIF A;  1WW4 A;  1QJE A;  3NV1 A;  3GZT B;  4OMC A;  5FKB A;  5FP4 A;  1US3 A;  2OQ7 A;  5FPB A;  2VD7 A;  4CXW A;  3CU7 A;  1FMD 3;  3BCW A;  1NA1 C;  2Z4F A;  2A7A A;  3ZPO A;  1PIV 3;  2XLG A;  5HCB A;  4AQ2 A;  1S0I A;  2WNO A;  3J4U H;  1NXM A;  2RS1 1;  2J1S A;  3SMH A;  2HWD 2;  3T2O A;  1B35 C;  3BGA A;  3GJA A;  1WLC A;  2C6S A;  3EBR A;  1YRZ A;  3POS A;  4A7Y A;  2B46 X;  1OD3 A;  1XNA A;  3HEI A;  4WVM B;  2VNO A;  1ACC A;  1GMM A;  4BWO A;  4UBG A;  5CG9 A;  4IND A;  3N9L A;  3THD A;  2XBO 3;  4ZXK A;  3ENR A;  1UKG A;  4HMZ A;  5FK8 A;  3UL2 A;  4UWD A;  2J1E A;  1PGW 2;  2Y33 A;  2QZ2 A;  4ZZ5 A;  5FZO B;  2GND A;  4NRP A;  2X5I C;  2DUQ A;  4Y4Y A;  3MW4 A;  1AYM 1;  2PHD A;  1UMZ A;  3LOB A;  5CKM A;  4E2Q A;  2JDU A;  2TUN A;  5IK7 A;  1QJY 2;  1TME 3;  5E89 A;  4PLO A;  5F6K A;  5F5Q A;  1XOY A;  4Y4R A;  1DF0 A;  2DBN A;  4B7K A;  1UPS A;  3VBO B;  4XAA A;  5JAX A;  4XMI A;  4Z82 A;  1WLW A;  1UYX A;  2ID4 A;  2IXK A;  4CE8 A;  1JMU B;  3BYW A;  2FD8 A;  3THP A;  2DCY A;  1ULD A;  4AFB A;  2HWC 1;  5A7W B;  5BNQ A;  4PJY A;  4BE3 A;  4PDW A;  2HYX A;  3OBA A;  4KL1 A;  4UW4 A;  1SBF A;  3VBH B;  2NZ9 A;  1SLC A;  2WL1 A;  4CCM A;  4C1W A;  4FAG A;  1FPN 3;  5FLJ A;  3BOD A;  3I2J A;  2IC1 A;  3AL5 A;  4HSJ A;  4JKM A;  1JZ4 A;  1RUC 3;  2Y6K A;  1MVQ A;  2VUA A;  3KWV A;  5J1X A;  2G9G A;  1PO2 1;  2VZR A;  2YYO A;  1UOF A;  2YFU A;  1G9D A;  3WG3 A;  5FQ0 A;  4EN7 B;  4QT6 A;  4UOJ A;  5C4W C;  1G9B A;  1HRI 1;  1C1L A;  2EA7 A;  2OPK A;  3KB5 A;  4S2H A;  2RMU 1;  2W92 A;  5I8T A;  1LEC A;  2QJV A;  4FOW A;  3U4X A;  4CCL A;  3JD7 1;  4IES A;  2RVA A;  2FDF A;  4ZU7 A;  4NUB A;  1MEC 2;  2GP5 A;  2WBK A;  3IMN A;  4O61 A;  4JDM A;  1H1I A;  3Q8A A;  3KCC A;  5I0T A;  2XVK A;  4MAD A;  4SBV A;  3OG2 A;  5CNA A;  4XFB A;  2Y6L A;  1BMV 1;  1W8U A;  1CAX A;  2Y0O A;  4CZS A;  4XF4 A;  1HKD A;  1QY4 A;  4AAP A;  1NCQ C;  2RJK A;  3AXE A;  2ATF A;  4AVS A;  1QQP 3;  1OD5 A;  4AED B;  3I7D A;  4D6R A;  1XU1 A;  4URT A;  1GIC A;  1RVF 3;  1XJA A;  5A1F A;  3M70 A;  2DU1 A;  1W3V A;  2VCC A;  1RUJ 3;  2YU1 A;  4FP2 A;  4LO7 A;  1I6X A;  4LNV A;  2K9Z A;  3AVS A;  4XE9 A;  3O1U A;  4OUS A;  1WLT A;  4D7T A;  1GZC A;  3CNA A;  1ZRF A;  1TVG A;  1V6L A;  4LBQ D;  5L9V A;  3OUH A;  2J1V A;  4P9W A;  4N53 B;  5LY2 A;  3RRD A;  4CCE A;  4DEQ A;  1S0G A;  4J6G A;  5BXX A;  1H8V A;  2UYA A;  4XAE A;  1HXS 2;  3S5A A;  1GV9 A;  1NA1 B;  2B42 B;  4QDQ A;  3R6S A;  4CCC A;  4COY A;  2YG0 A;  2R7E B;  3KT4 A;  1ZVF A;  4CTE A;  4JQT A;  1B35 B;  4E4Z A;  1C8N A;  3RJR A;  4E2G A;  4Q0Q A;  1IHM A;  4EN9 B;  1RUG 2;  3WDU A;  4FO9 A;  1JHN A;  2BYV E;  2WFP A;  3WIN E;  2QQW A;  3D3A A;  1KJR A;  3SIS A;  2DVA A;  3T1L A;  3WF4 A;  3VD9 A;  3ZKU A;  5IAT A;  1SFN A;  4RGK A;  1LHV A;  5GM0 A;  2R07 3;  2J1R A;  3AP6 A;  3HR9 A;  2DCT A;  1PZ9 A;  2YPD A;  1Y7B A;  5FY4 A;  1DZQ A;  4LKE A;  5FZ1 A;  5FMO L;  1OHF A;  1GQP A;  3KHB A;  4AF9 A;  2X5I B;  3RFR A;  4XAB A;  1MZ5 A;  3KV6 A;  3O1P A;  4R8H A;  1LNS A;  4M3C A;  5B2G B;  4M4P A;  4D0Q A;  2HWE 2;  2Z2S B;  4YM1 A;  5AFE A;  1FNZ A;  3AFK A;  3B5L B;  4TWT A;  3HJR A;  1GLH A;  2ZX4 A;  5JXH A;  1PM7 A;  4XBN A;  4YLZ A;  3AP5 A;  3T08 A;  2DVF A;  3N9M A;  1W9F A;  2FHR A;  4HK8 A;  4N90 A;  4FOQ A;  5K4L A;  3B9I A;  5A33 A;  5T5P A;  3VBF C;  4FOV A;  1R08 1;  4QM9 A;  5EJ1 B;  3VHN A;  2VH9 A;  1VPH A;  4YVS A;  4Q0P A;  1COV 2;  2CWS A;  1VBD 3;  2RDN A;  4DY5 A;  4DZG A;  5A6Y A;  1AYN 1;  4A42 A;  4L0P A;  2C5D A;  1O91 A;  5F5I A;  4R4Z A;  4QPG A;  3VBS A;  4NIG A;  4KWL A;  1A6C A;  2XVL A;  3I2F A;  4FPO B;  1ENR A;  5E1R A;  4EE2 A;  2FDJ A;  4M00 A;  3AYA A;  4CA9 A;  3TEY A;  4TTG A;  2Q8O A;  4OHW A;  3NQH A;  3ZFF A;  4YSF A;  3EB7 A;  3PU8 A;  4B29 A;  5C4W B;  1PIV 2;  1G9A A;  2RHP A;  5ACA 2;  4B1M A;  3DKQ A;  4HAN A;  1QGL A;  2VNG A;  3Q8B A;  2BDR A;  1ULC A;  4ZS3 A;  1E5R A;  3MIH A;  1W03 A;  4Y24 A;  1IZ3 A;  3LFI A;  3K2O A;  1YQ5 A;  4XJ9 A;  5KXC A;  3POF A;  4RGA A;  5ABJ C;  3WF2 A;  1UKR A;  4OZO A;  4R9A A;  4QQL A;  4CPB A;  1RUF 3;  3A4U A;  1SHW B;  4ASM B;  3WHU A;  3FUO A;  1NCQ B;  1ZBE 1;  3JB8 A;  4LBJ A;  1WCU A;  3RZJ A;  4AQ6 A;  3USU A;  2TBV A;  4X8P A;  3VDD C;  4GZ9 A;  1PO1 2;  1LU1 A;  1TME 2;  3POG A;  4L9B A;  1OH3 A;  4D6Q A;  1TQ5 A;  4EJR A;  1OC1 A;  1RHI 2;  2RM2 2;  4NPL A;  2P6H A;  4BB3 A;  3VL8 A;  5JLV A;  5I0R A;  1X9T A;  1BJQ A;  5FZM A;  3KS7 A;  3NNL A;  5CZK A;  2CHH A;  4LA3 A;  1HLC A;  2Y26 A;  4XJA A;  3UNP A;  2A6W A;  4BQX A;  1D7P M;  2WIN B;  3FLR A;  3AK0 A;  5LBF A;  5A32 B;  2CAU A;  4IL7 A;  4L2N A;  1GNZ A;  5DG2 A;  5FFO C;  3UGG A;  1V6N A;  1H8T C;  4IV1 C;  3KLS A;  3IM0 A;  2WQ8 A;  2AUY A;  2CDP A;  4B4R A;  3B9C A;  2JB8 A;  2P34 A;  5A80 A;  2WS9 1;  2WZR 1;  5EWS A;  1QKQ A;  2VMC A;  4FFG A;  4LHK A;  1WLD A;  4JRL A;  3CZJ A;  1VMJ A;  4Z92 B;  1AR9 2;  1LOC A;  2FMD A;  2GN3 A;  2AEZ A;  4OI4 A;  5FZ9 A;  1LOF A;  1J83 A;  3BU7 A;  4EWA A;  1NLR A;  2OKX A;  2XQR A;  1FOD 2;  2VZO A;  1UZV A;  4HSL A;  2WKK A;  3IDB B;  2GDF A;  4LO8 A;  4NRO A;  1F5J A;  4FPH A;  5C9A A;  2Y6F A;  2JG8 A;  3CKH A;  3EXU A;  4JGY A;  1ASJ 2;  1JYI A;  1JS9 A;  1QQP 2;  2IZW A;  2XB6 C;  4NOT A;  5FJK A;  1KFX L;  2OW4 A;  2PQS A;  3VBF B;  3HT2 A;  4KBB A;  1RVF 2;  4ORF A;  3PU3 A;  1RUJ 2;  2D3S A;  1X8E A;  2FCU A;  3WQ0 A;  4MV2 A;  3ZSM A;  3BU0 A;  4YGC A;  4XUT A;  1PK6 C;  2VCM A;  4ZU5 A;  4LBN A;  3VKN A;  4AHY A;  3K4A A;  1X8M A;  3AZV A;  3WVJ A;  2CAV A;  1QJX 3;  1W2N A;  1UXZ A;  2HWB 3;  1FT9 A;  3T2Q A;  3QAC A;  3NV3 A;  3C7H A;  3NNG A;  2R06 1;  3LA3 A;  1YJL A;  1RED A;  1HV0 A;  2GAL A;  4LK6 A;  1WCD J;  2ZTN A;  3H9A A;  2LAL A;  2X8K A;  1HN0 A;  4AFA A;  1S2K A;  4P9G A;  4YW4 A;  3E97 A;  1OOP C;  5FZB A;  3FN9 A;  3J8F 1;  2ZJC A;  2D97 A;  4PIZ A;  4MGZ E;  5BNO A;  5ABJ B;  1OVS A;  2R07 2;  4R9D A;  3OOX A;  1YFW A;  1BEV 2;  1C28 A;  1N47 A;  3M7A A;  4FCA A;  5BNP C;  1ZRD A;  3LA2 A;  1ZZ8 A;  1NCR C;  2V72 A;  3VDB A;  4CUG A;  2VUD A;  2Y64 A;  1RUD 3;  4W8J A;  1W6N B;  4K6B A;  3UT0 A;  1UX7 A;  5F3C A;  3PJY A;  2YXS A;  4V2W A;  4OMD A;  3VDD B;  4NMI A;  4NHX A;  2YBP A;  1ST8 A;  2P3I A;  1MVE A;  1J58 A;  2J42 A;  4C90 A;  4QWN A;  4YWA A;  3V0B B;  1H1A A;  2KR2 A;  1WW6 A;  1XNB A;  3TNP B;  5FIX A;  2ZX1 A;  5I91 A;  5F5A A;  2QQV A;  4HKW A;  2A3W A;  4WVM A;  2RDS A;  4P5H A;  1H8T B;  3I3M A;  2DBI A;  4LOT A;  4GXL A;  4IV1 B;  5FWE A;  4HET A;  2W95 A;  1WD4 A;  3ES1 A;  5FXV A;  4HG6 B;  1RTV A;  1W28 A;  4JGZ C;  4OYU A;  4Y1Y A;  2XDV A;  3Q8E A;  2VC9 A;  1XYN A;  2ZZQ A;  3JXS A;  4UFL A;  3ZR5 A;  1YC6 1;  1UF2 C;  5FZO A;  3NJY A;  4Q29 A;  3VD3 A;  1WW7 A;  1MZF A;  4JQR A;  4ZON A;  1Z7S 1;  2W94 A;  1JOD A;  3MV0 1;  3JCI A;  4NPM A;  4YPJ A;  2DYC A;  2OA2 A;  3ORJ A;  3DYM A;  3WDV A;  4WM7 C;  3BAL A;  2XPJ A;  2WFF 1;  3B3Q E;  5A3M A;  2L9L A;  2C9K A;  3VBO A;  5BV6 A;  1MS5 A;  1ZBA 1;  3HN1 A;  1XE7 A;  2E31 A;  2E26 A;  5DDJ 1;  1QHD A;  2V4V A;  4BQ4 A;  2J1T A;  5C6C A;  2OT7 A;  1D4M 3;  2DCK A;  2EID A;  3GBF A;  4P9X A;  2ENR A;  2YV8 A;  4Y5Z 0;  1RUF 2;  5G05 L;  3NV2 A;  2XUM A;  5A7W A;  2WZ8 A;  5KXE A;  3BOP A;  5DUW A;  3VBH A;  1UOG A;  4N9H A;  5LRR A;  4AI0 A;  1NLS A;  2J1U A;  1JH5 A;  3WP3 A;  4EV0 A;  2OYZ A;  2PHT A;  1J3Q A;  3MIE A;  3T4V A;  4IEW A;  2RS5 1;  4UW6 A;  1KGY A;  5T3N A;  3BTX A;  2C24 A;  2LM3 A;  3R4S A;  3ME2 A;  1A78 A;  2JEM A;  5H9Q A;  4MGY E;  1UL9 A;  3OGG A;  1PK6 B;  1LRH A;  1SQ4 A;  2P3Y A;  4D7Y A;  4BQ3 A;  1YIF A;  4Q1P A;  3HBZ A;  5A3N A;  5HV4 A;  3O1S A;  1UY0 A;  3BB6 A;  3O1T A;  1PZ8 A;  1QOO A;  1QOS A;  3T0A A;  3T2P A;  1TEI A;  1FXZ A;  1HRV 1;  3PVO A;  4HKO A;  4DNY A;  2WAO A;  4E27 A;  4P02 B;  3U14 A;  2VOT A;  1GNY A;  2SBA A;  4IE0 A;  3HQX A;  2D43 A;  4NHY A;  3A21 A;  4XFC A;  5GZF A;  3ZYF A;  5IVV A;  3ACI A;  1Q56 A;  1IS3 A;  3O0X A;  4XUP A;  5K9Y A;  2O8Q A;  5FPZ A;  3JBG 3;  1OOP B;  2D6P A;  3R05 A;  1ND3 C;  2JD9 A;  1XNC A;  3MIF A;  3WLU A;  5CKN A;  1X9P A;  4BK4 A;  4AED A;  2CL2 A;  3T30 A;  2DV9 A;  1L7Q A;  3LA7 A;  5IVC A;  4Y22 B;  4PT6 A;  2B7Y A;  1S0B A;  2DCZ A;  5DZF A;  4FAH A;  4XDQ A;  5BNP B;  1ENQ A;  1N1V A;  1Q8P A;  4JC1 A;  1NCR B;  2XKO A;  3RZM A;  3WDT A;  3O1M A;  1WA6 X;  3F2Z A;  5KHJ A;  3UJO A;  4GAL A;  4QMA A;  4AQT A;  2HJI A;  2VQT A;  3S57 A;  4L92 A;  1O4T A;  1WKY A;  1ULP A;  2R0F A;  5BNN C;  2FCT A;  1XXN A;  4N53 A;  4Q4Y 1;  5FXX A;  4YYO A;  4AEK A;  1W8T A;  3AKT A;  2NP0 A;  3W5M A;  2VW1 A;  3IAP A;  3ST7 A;  2BPA 2;  5CIS A;  4ZS2 A;  1JI6 A;  1IG0 A;  3KM5 A;  1NA1 A;  3A0N A;  4OHZ A;  3IDE A;  1UMH A;  5IK4 A;  2J7M A;  1CAV B;  5CVR A;  1GSL A;  4Q27 A;  1B35 A;  2B4K A;  3POI A;  2E63 A;  1UU6 A;  2F4L A;  4XYX A;  5J37 A;  4Q2F A;  3I4I A;  2XHN A;  3LOI A;  4LLO A;  3H7Y A;  5SV8 A;  1JU4 A;  1TG7 A;  2LRP A;  1ULE A;  5H9S A;  3VKM A;  1JYN A;  5C70 A;  1Q8O A;  3IB3 A;  5GAL A;  2WYS A;  3U0Z A;  1HX6 A;  3P1I A;  3PL0 A;  1QJX 2;  5F3I A;  1SFP A;  3VL9 A;  2PFW A;  4YZ5 A;  4GB3 3;  2ES3 A;  3HMY A;  2WO7 A;  1AHS A;  1K12 A;  2X5I A;  3JQW A;  2DVB A;  5FCC A;  2AH2 A;  2TNF A;  3LWC A;  3RNS A;  2E51 A;  2KD7 A;  4AXO A;  1OFS A;  2RR1 3;  1QJU 3;  5FY8 A;  2R30 A;  1NLQ A;  1TMF 3;  4DMI A;  1UU4 A;  4WM7 B;  1LHN A;  3H3U A;  2ET7 A;  3KV4 A;  3O12 A;  3H8X A;  5FP3 A;  2A6Z A;  3ZXF A;  4M3C F;  2XG3 A;  4BDV B;  5J7M A;  3AFG A;  3ACF A;  4FFF A;  3K4Z A;  4AI8 A;  4R52 A;  1WMF A;  3AXD A;  5FP7 A;  3QD6 A;  3WOG A;  2W87 A;  4XPV A;  5FYV A;  1IGO A;  2EAA A;  1NX9 A;  4QXH A;  4XF3 A;  5JSR A;  2VCA A;  1O5L A;  1VJ2 A;  5LK7 B;  3T09 A;  3C3V A;  2Q8C A;  4XXA A;  5EYY A;  3WW1 A;  4GWM A;  3H3L A;  4P5Y A;  4XDO A;  3HIF A;  1GP6 A;  2C26 A;  5C8W A;  5L7O C;  5GZG A;  3MLK A;  5A3T A;  1VRH 3;  1LEN A;  1W8H A;  2BGO A;  1DIW A;  2WLQ A;  5C4W A;  3ILF A;  2H0B A;  4XIL A;  1QEX A;  3URF A;  4GQ7 A;  1WZX A;  5J48 A;  1DQ4 A;  4JVA A;  3GHM A;  3M1H A;  2RS3 3;  2VOW A;  4D6S A;  4LPL A;  4Y1V A;  3TN9 3;  1SCR A;  2DF7 A;  2D98 A;  2AGS A;  4NRQ A;  5CKQ A;  1OA3 A;  2QQO A;  4I3P A;  4A7Z A;  3CEW A;  3WQ1 A;  2XLF A;  2MHF A;  4JTN A;  5T50 A;  1PGL 1;  4OI2 A;  1W39 A;  2QKD A;  1SEF A;  1ND3 B;  2ZPX A;  5FYB A;  5FY1 A;  3KZ4 C;  3P5B A;  1NCQ A;  2XKP A;  3DUI A;  3TYJ A;  4EN6 B;  1LR5 A;  1M06 G;  1W04 A;  2I2S A;  1DDL A;  4XUR A;  2WA3 A;  1CR7 A;  4LE4 A;  4V2V A;  2W47 A;  1XB9 A;  2FMY A;  3E5Q A;  3DGT A;  4AVV A;  1UY4 A;  3LEI A;  4EQV A;  1S55 A;  5BNN B;  3DXT A;  5FZ6 A;  2FDK A;  4AI2 A;  4CU8 A;  1D4M 2;  4LIT A;  2BNM A;  4XJU A;  5D21 A;  4Y20 B;  5FY9 A;  4HVQ A;  5BY5 A;  5JZG C;  1OF3 A;  3ZOI A;  1BYH A;  1BK0 A;  2HWD 1;  3M3E A;  4IE6 A;  1LJ7 A;  4ZPI A;  5A32 A;  2Q30 A;  3VBR C;  2NMO A;  1LHO A;  2RDQ A;  1JZ5 A;  1NQD A;  2Y6J A;  4A3X A;  3AMP A;  1N1T A;  3I3D A;  3OPW A;  4Q4W 2;  5FZL A;  4CUA A;  3V64 A;  4BQY A;  3D8C A;  1QOT A;  4QHZ A;  5BPX A;  4CXY A;  2RG4 A;  2WO1 A;  5ERL A;  4CDW C;  1RUI 2;  3OY8 A;  5EJ3 A;  4NVP A;  2VTF A;  4UFI A;  4BIO A;  4CP9 B;  1RYY A;  1ODM A;  5A3O A;  5IAX A;  1PGW 1;  1SMV A;  2E33 A;  4ARX A;  1VP6 A;  1L7L A;  3D6E A;  4J25 A;  3RDI A;  4A4A A;  1NG0 A;  3GGL A;  3P3N A;  3RZZ A;  5FPX A;  2NN8 A;  5H9P A;  4GIQ A;  1QJY 1;  4CPB D;  2W91 A;  1GZ9 A;  2BFU L;  1ZZC A;  4GWJ A;  5IVB A;  1RGS A;  1YWK A;  4LIV A;  1RMU 3;  4AW7 A;  2D40 A;  3ON7 A;  4B7E A;  4LT5 A;  1U0A A;  3NW4 A;  4FI9 A;  4LK7 A;  5FMO S;  3JBG 2;  1W06 A;  2ZMN A;  1AXZ A;  3GCX A;  4AFD A;  2JE9 A;  3WW3 A;  1FV2 A;  4MGI E;  5F7U A;  1TZO A;  2ZEW A;  2F6B A;  1W9T A;  3KD4 A;  5KXB A;  4Y5S A;  3VBF A;  4QPI C;  3H8R A;  1JTZ X;  4XTM A;  3RWN A;  2MEV 2;  4CCO A;  4URA A;  1ND2 C;  3BTZ A;  1D2S A;  2XJV A;  3PNA A;  3N7M A;  3O1O A;  2JKB A;  4CUB A;  2ORX A;  2XH6 A;  1SLI A;  3T1M A;  1GQG A;  1W0P A;  1FYU A;  2QFE A;  1Q43 A;  2VME A;  3KF3 A;  4U2A A;  5JR2 A;  2YHJ A;  1O4Z A;  1YNA A;  5L7O B;  4JRA A;  3SCG A;  1DGR A;  4RR3 C;  1O8P A;  2XXZ A;  5FYZ A;  3WF3 A;  4D69 A;  4YW7 A;  3PLQ A;  2EXH A;  2CSG A;  2N7G A;  2WN3 A;  2ZXQ A;  2A1X A;  2HEY F;  1WBL A;  3LD8 A;  5T5O A;  3JUU A;  4FQZ A;  1YI9 A;  2KA3 A;  1O3S A;  3C7E A;  4A41 A;  4YGE A;  1DQ6 A;  4Q4V 2;  5LZ6 A;  2VMI A;  2RJ2 A;  5J98 B;  1X82 A;  2OUH A;  5ABJ A;  3KCY A;  1S2B A;  5A6X A;  1HB2 A;  2JDM A;  1W9S A;  3PVE A;  3ZXG A;  4A7K A;  3SXW A;  2ZOE B;  1R09 3;  1OI6 A;  1SLA A;  3VN4 A;  3WX5 A;  4GB3 2;  1N1S A;  1YQC A;  2BNO A;  2XML A;  2X29 A;  1KS5 A;  1S0E A;  2ZCW A;  2WSU A;  2RS1 3;  3PDQ A;  2CU5 A;  1HB4 A;  1J1T A;  1W6N A;  2BOJ A;  2V09 A;  3NJX A;  3TNQ A;  1UNB A;  1QJU 2;  2PQQ A;  3FL7 A;  4XFI A;  1TMF 2;  4QGN A;  3VDD A;  3PMS A;  1Q8V A;  4IER A;  1JZ8 A;  5FP8 A;  4XFA A;  1UYY A;  2CTV A;  3UJQ A;  4HN1 A;  3OTF A;  1HXS 1;  1IG3 A;  3V0B A;  2WII B;  2ZGK A;  1BKZ A;  4MXV A;  4ASL A;  1UOB A;  5JZG B;  3RI8 A;  1W8O A;  2PAE A;  1AYM 3;  3EQE A;  4LBL A;  3VBR B;  4CP1 A;  1H8T A;  4B8E A;  4IV1 A;  4QX8 A;  3GYD A;  4IET A;  3UK9 A;  4TLF A;  2VNR A;  3EHK A;  2V5Y A;  2XWB B;  4BOW A;  4CDW B;  3ALQ A;  5I8S A;  3WDW A;  2JKX A;  4AZZ A;  3T4H B;  3TEX A;  3WR0 A;  3S0M A;  2DTY A;  4XAC A;  1EAH 3;  1VBC 1;  1VRB A;  2PHR A;  4YZ3 A;  2HWC 3;  2ET1 A;  2V73 A;  3IWZ A;  5HCA A;  3UYJ A;  1WD3 A;  1DLL A;  4AQS A;  2HWE 1;  3TN9 2;  5FRA A;  1O59 A;  2QQP A;  1IKQ A;  1FX5 A;  3LSD A;  5E8A A;  2ZHN A;  5F1R A;  1SBD A;  3FLT A;  1ZZ6 A;  2XJU A;  1NT0 A;  2XL7 A;  2P37 A;  5FPV A;  1HRI 3;  1XNT A;  2RMU 3;  1VBA 3;  3M8L A;  4QPI B;  2BWA A;  2XR4 A;  1AUY A;  1S4C A;  5B4N A;  4QB1 A;  1W99 A;  3DV8 A;  1ND2 B;  5DPN A;  1NAE A;  5IT6 A;  1PK6 A;  2JDZ A;  1YI7 A;  4XXP A;  5C3R A;  4RHV 2;  4AFC A;  4BQ1 A;  2ZX0 A;  1IS4 A;  1W0N A;  1RXG A;  5A7P A;  3MIC A;  3POY A;  1PIV 1;  1NY7 2;  3MEP A;  3QCW A;  5ACA 1;  2Y0I A;  1GZW B;  3M3I A;  1W9W A;  5T5L A;  3ZFG C;  5K7P A;  4RR3 B;  2PTM A;  4PQQ A;  1H2N A;  4ISR A;  4QX7 A;  2DCJ A;  3GBW A;  2B5H A;  2VZQ A;  4YZ2 A;  1WCQ A;  2GP3 A;  4QKF A;  2A75 A;  2O14 A;  2O1Q A;  2K46 A;  4TYS A;  1Q8S A;  1OUS A;  1IS5 A;  3MF6 A;  5A7N A;  5CFD C;  3I49 A;  2AAC A;  3RWK X;  1LOG A;  1OOP A;  2ZZJ A;  1NZI A;  2WZE A;  3WNN A;  4Q4X 1;  2WUH A;  3LDK A;  3OUI A;  3ACH A;  4GH4 C;  4YRD A;  4AWD A;  3OUJ A;  5FZ7 A;  2VW0 A;  5KWR A;  1MS0 A;  2BQP A;  4Y22 A;  1US2 A;  2A6V A;  2GMP A;  3PUS A;  1F31 A;  4LEJ A;  2PHL A;  1PMI A;  5BNP A;  2W1Q A;  1DYK A;  1KFU L;  1ZRI A;  3IT8 A;  5A70 A;  1PO1 1;  4DUW A;  1SDD B;  1AL2 1;  1C3H A;  1RXF A;  4UFH A;  4OHY A;  2XOM A;  2JDP A;  4OLL A;  1RHI 1;  2RM2 1;  4NPR A;  2BRT A;  1F4H A;  1C1F A;  4MGQ A;  3ZDV A;  2BBV A;  1MZE A;  4YGD A;  3ZR6 A;  5DXD A;  4YGB A;  4HPK B;  4AI3 A;  1RB8 G;  1NE6 A;  1YO8 A;  2XJP A;  1W6P B;  1RUE 2;  2GNM A;  4IEO A;  2E7Q A;  1BQP A;  1CAV A;  5DUX A;  3H7J A;  1EV1 3;  2R1D A;  5A1A A;  5F8P A;  4WZF A;  1J3P A;  3H0O A;  4XJW A;  2E7A A;  2ETE A;  3DPR C;  4QGL A;  3VD7 A;  3H3Z A;  3FBM A;  2Z69 A;  1DG6 A;  1XYO A;  2ZA9 A;  3LE0 A;  4NIH A;  1LU2 A;  4DRR A;  1O3R A;  2VZS A;  4JGZ A;  1JYW A;  1W2T A;  4IV3 C;  2C9A A;  1AR9 1;  3ZSK A;  5ANN A;  1IPJ A;  2YDE A;  1KD7 A;  2BWC A;  2VAU A;  5FZF A;  3HNM A;  1O3T A;  2HEV F;  1H9P A;  5LA9 A;  4RFR B;  5L73 A;  5FTT C;  1R08 3;  3DEM A;  3IKW A;  4EYU A;  3AKQ A;  1FOD 1;  1WMD A;  4GKX A;  4WM7 A;  1AYN 3;  1LED A;  4KMQ A;  3AVR A;  3ZFE C;  4CXX A;  3N7K A;  3NJV A;  3QH7 A;  4JHZ A;  1V0A A;  3RYP A;  3LPF A;  4FXK B;  2WC2 A;  2FZ1 A;  2R0H A;  1DP0 A;  1ZNP A;  4MGS A;  1J84 A;  3GBG A;  4Z8B A;  4IW3 A;  5AC9 1;  1ASJ 1;  4UF0 A;  2BP6 A;  5LEJ A;  3SCF A;  1QQP 1;  4IGQ A;  4OQ8 A;  5JWP A;  1R09 2;  4A6O A;  3DXU A;  1XQN A;  1OPO A;  3MID A;  4EZH A;  2P3K A;  4OFG A;  5EP9 A;  1XND A;  3I8T A;  1RVF 1;  3WHT A;  4M0N A;  1UPI A;  2RS1 2;  2WWU A;  3ZIW A;  4MUV A;  4UFJ A;  3D0J A;  3EYP A;  3O1R A;  3CJI C;  5DUU A;  1VR3 A;  2UY9 A;  2VVE A;  4NWV A;  4XIO A;  4BXF A;  5FZ3 A;  4RS5 C;  4CU9 A;  1KEX A;  1DBN A;  1BBT 1;  2QNK A;  2X09 A;  4RGG A;  1AVB A;  2UWC A;  4GUL A;  2IVJ A;  2K0G A;  4Q0V A;  3UET A;  1JZ7 A;  3NJZ A;  1BCX A;  4K1Z A;  2VQA A;  3MDP A;  2OVU A;  3VHP A;  3ZFG B;  1MR5 A;  3NAP B;  1ZBE 3;  2ZS6 B;  1AYM 2;  1FMD 2;  2UYB A;  1LCL A;  1K42 A;  4LOR A;  3H50 A;  5JR7 B;  1XPW A;  1SLL A;  3W20 A;  3MZH A;  4PF5 A;  1KDM A;  4AGG A;  4IGO A;  4M01 A;  1H2K A;  5CFD B;  4ITC A;  3EO6 A;  3NV4 A;  3D0S A;  3M3C A;  5FO9 B;  2HYK A;  2R07 1;  5T5J A;  3I2H A;  1ND3 A;  1BEV 1;  5FLI A;  2NLR A;  4GH4 B;  1V9U 1;  4CDU C;  3A22 A;  1ZM1 A;  1EAH 2;  2P3J A;  2BBA A;  2F17 A;  2XBO 2;  4KBZ A;  2D6N A;  5JXG A;  4FPJ A;  5FYS A;  4YFW A;  5F32 A;  4YM3 A;  2J1A A;  2YBS A;  3MIB A;  3SKJ E;  2W2I A;  3I2O A;  4C8D A;  5J3U A;  2ARC A;  2YZ4 A;  3LQC A;  5BNN A;  4Y5T A;  3RYK A;  5C3P A;  4FP3 A;  3FC0 A;  1CWP A;  2RV9 A;  2WS9 3;  2WZR 3;  1UIJ A;  2YU2 A;  3N3H A;  1YQ6 A;  4E4D X;  1WGP A;  1CX1 A;  1CQ9 A;  1LGN A;  3AB0 A;  5BUV A;  5LCW L;  1HRI 2;  2Y34 A;  1UY1 A;  4O7X A;  5JDB A;  2RMU 2;  1VBA 2;  5I0S A;  1AR6 1;  1UYZ A;  4Y26 A;  2GNB A;  5FPL A;  1YQ2 A;  5GLZ A;  3RZK A;  3DPR B;  4H14 A;  1JU3 A;  2VMD A;  4XW3 A;  4QXB A;  4CP9 A;  1AJO A;  4ES8 A;  1FPN 2;  3KV9 A;  1OUR A;  2IVI B;  2PLV 3;  2W1S A;  2ZGP A;  1R1A 3;  1UY2 A;  2VOV A;  4PQ9 A;  5HV0 A;  4AHX A;  1RUC 2;  2DVD A;  2ZEZ A;  1BMV 2;  4IV3 B;  3BI3 A;  4YFZ A;  4GAZ A;  2PHF A;  1LEM A;  1QNW A;  5DAP A;  2Q8E A;  2JEN A;  3T0B A;  1LOA A;  3ZVX A;  5C33 A;  1R64 A;  1EY2 A;  1JBC A;  1DCS A;  1D2Q A;  2UWB A;  3VV1 A;  2E7T A;  4YZ1 A;  1XC6 A;  3MI8 A;  1A8D A;  1POV 1;  3VKF C;  1VMF A;  3BVC A;  3ZFE B;  1O3Q A;  3LEG A;  3V56 A;  2XL9 A;  1KJL A;  1RUF 1;  1UU5 A;  3ILN A;  5FMB A;  4CU7 A;  4LKD A;  2WWS A;  5IFT A;  4ZY9 A;  4DO0 A;  4S2G A;  3N9Q A;  3ACG A;  2ZGS A;  3AM2 A;  4C0H A;  1YUD A;  5FZK A;  1ZZ7 A;  4P9L A;  5JXJ A;  4XFG A;  2R06 3;  1G86 A;  2QQI A;  2XLA A;  4CU6 A;  3CQO A;  2R32 A;  5JOW A;  1UX6 A;  4NID A;  5DMY A;  1GU3 A;  3MYX A;  4AI9 A;  2GN7 A;  2E32 A;  1O6U A;  3CJI B;  5FKC A;  3V0A B;  3O0W A;  5C3S A;  5L7O A;  4W65 A;  3J8F 3;  4RSU A;  3OEB A;  1AR7 3;  4RS5 B;  4QQ2 A;  2HBU A;  2VZ1 A;  2R04 3;  1W8Z A;  1KXG A;  5I93 A;  1I5Z A;  1EV1 2;  5F5C A;  2UU8 A;  3K46 A;  2Y38 A;  2GC1 A;  2NYY A;  3H8U A;  3N35 A;  3AKP A;  3POB A;  3ZXJ A;  3KQR A;  5FMD A;  3VD5 A;  2D5H A;  5IHR A;  4PF1 A;  4OUM A;  1S1A A;  2JDA A;  3FBY A;  3IZO A;  4YW6 A;  1IPK A;  4KG0 A;  1AXY A;  3ZDS A;  2AEY A;  4MSV A;  3UGF A;  4BIS A;  4TXW A;  3MFC A;  1G8W A;  5IVE A;  5FY0 A;  4L97 A;  2A70 A;  3M3O A;  3GZE A;  3MPP G;  3AKS A;  1Y9M A;  2HEW F;  2HWF 3;  3AMQ A;  1DGR N;  4OUL A;  3RYR A;  4CDU B;  1MS4 A;  4ES9 A;  4QKD A;  4UXA A;  2Y6G A;  3FJS A;  1R08 2;  3OF1 A;  1QF3 A;  3KVB A;  4AVA A;  4WZC A;  2YBK A;  4ZKT B;  2GAU A;  1AYN 2;  3ASI A;  4Y33 A;  4XHB A;  2ZHK A;  2IXL A;  3C7G A;  2EVX A;  3CMG A;  1NXD 1;  1APN A;  2VMH A;  1QJZ A;  4HLT A;  3AMM A;  5JZG A;  1CD3 G;  3HNB M;  4GMP 3;  4OHV A;  4QD2 A;  3IDA A;  3ZYI B;  3I3B A;  4HKL A;  3UES A;  3L2Y A;  4I02 A;  1FV3 A;  3H42 B;  1UIK A;  1Z7S 3;  1Y4W A;  2YRO A;  2I45 A;  4PIX A;  2MNG A;  1ZRE A;  3VZO A;  3D82 A;  3Q9O A;  1F5F A;  3C2U A;  1LHU A;  3MV1 1;  3CBN A;  2ZGM A;  4XJZ A;  4H2A A;  2X05 A;  4CDW A;  1QXP A;  4FVV A;  3UV9 A;  4I0W B;  1RUH 3;  1VBD 2;  3III A;  1ULO A;  4FTE A;  2CDO A;  4CYD A;  4AFM A;  3E5X A;  3SCH A;  4BCU A;  1OH4 A;  4E8D A;  3SH5 A;  1FI2 A;  5CAZ A;  3N9P A;  1UQX A;  1RIN A;  4IEY A;  4TLG A;  5HXM A;  3MUY 1;  3QOP A;  4O9G A;  1VB2 A;  3HNY M;  4Q1R A;  1T6B X;  3VUO A;  3RQ0 A;  4MGT A;  2MPF A;  4Q0S A;  3ZO0 B;  1UOJ A;  3OB8 A;  4L99 A;  3JQX A;  5F3G A;  3AP4 A;  2PAK A;  3RPQ A;  4QX5 A;  1AXK A;  3R0R A;  3MW2 A;  4LHL A;  5LWB A;  2BFU S;  2QVS B;  4OZX A;  1CAU B;  1VBE 3;  1HV1 A;  1YJK A;  3AZZ A;  4MX3 A;  5D2A A;  1WWY A;  1DLC A;  3O5S A;  5HPO A;  4YG3 A;  4IEQ A;  5EPA A;  3VLB B;  1DU3 D;  3NNM A;  1YLL A;  3BUC A;  4QPI A;  4CUC A;  4F3J A;  1PMJ X;  5J09 A;  4XDP A;  1ND2 A;  4K40 A;  3H1W A;  4XF1 A;  4I01 A;  4CCN A;  4LHN A;  4QX3 A;  5FXW A;  2YC0 A;  1W6M B;  3HN3 A;  5GZD A;  3K48 A;  4AVC A;  2G19 A;  4FFI A;  3R4U A;  1H1M A;  3ACL A;  1GZW A;  3UKN A;  2FDH A;  2EXK A;  5DAW A;  1D0G A;  2CGP A;  3FX3 A;  3ZXK A;  5FUP A;  2XVG A;  3BIW E;  4RR3 A;  1ZRR A;  2DDU A;  2C1F A;  1NE4 A;  1VAK A;  3GNE A;  2ZAB A;  3GAL A;  1AX0 A;  2VTX J;  2D5F A;  2YMZ A;  1REF A;  1OSG A;  1A8M A;  1O7F A;  1PVC 3;  4CDX C;  1GYK A;  3ZN4 A;  3HT1 A;  4UW3 A;  4HON A;  1W6Q B;  4MXW B;  4EWD A;  1M4W A;  4OUE A;  3PUI A;  2PLV 2;  5DG1 A;  2JEC A;  4E4H A;  1R1A 2;  4I30 A;  4AEM A;  2GU9 A;  5APA A;  4XET A;  4YNI A;  5D8A C;  1H2L A;  3AKR A;  3C7O A;  1OUX A;  2P17 A;  1SAC A;  1O5U A;  1ULG A;  1WUV A;  2WNU C;  2BEO A;  2GZW A;  4GMP 0;  5FV3 A;  1W2A X;  5KC5 A;  1L7R A;  3GF6 A;  2JIG A;  3WQ7 A;  2DFC A;  4LIU A;  5F9T A;  2VOX A;  1D4M 1;  1LOB A;  1YEW A;  2JDY A;  4HPK A;  4K7J A;  3NKT A;  1DGW X;  4HXC A;  1AJK A;  4PBP A;  1W6P A;  5C8C C;  2ZGT A;  3BKZ A;  2ZGU A;  1W6O B;  2PMW B;  2ZAH A;  3M4F A;  4P00 B;  1VE0 A;  2GMM A;  3VZK A;  3MPB A;  4ZXE A;  3J7H A;  5JSP A;  1MS3 A;  1XE8 A;  4LUK A;  2A73 B;  4JHT A;  4QXK A;  4UYB A;  2ZGR A;  2ZKL A;  4Q4W 1;  2ZAA A;  3WF1 A;  2PEL A;  5A3U A;  2A3Y A;  2J22 A;  1U5I A;  2GC0 A;  5IWF A;  1RUI 1;  4AHW A;  5FY5 A;  4N8M A;  4NRM A;  3CDZ B;  3ZN5 A;  1AR7 2;  5GLW A;  3WG4 A;  1VBB 3;  1HQN A;  4PCR A;  1CAX B;  2R04 2;  2W46 A;  2BZD A;  1YIP A;  3Q8F A;  1HB1 A;  4AE2 A;  5KC6 A;  2A71 A;  1WW5 A;  1HB3 A;  1SDW A;  2HWB 2;  1UCX A;  5A7O A;  1OVP A;  2JIJ A;  2WNV C;  5IYY A;  4ATE A;  4W6Y A;  5FBZ A;  5FMC A;  2ZHL A;  3VB9 A;  3W58 A;  4QX1 A;  4QPY A;  3TOJ A;  3TEW A;  1N3Q A;  5KBF A;  1UD1 A;  2VUC A;  4COZ A;  4LKS A;  3KHC A;  4S2D A;  3N36 A;  2B45 X;  1IPS A;  1JUH A;  2HLE A;  5F2S A;  5C5U A;  4GD4 A;  3VZN A;  4OHX A;  1EYB A;  2HWF 2;  1DQ2 A;  2MEV 1;  2NMN A;  3IN9 A;  3E6B A;  1O4Y A;  1GP5 A;  1BXH A;  2WDB A;  3L2H A;  4LTA A;  5IAV A;  4B4Q A;  2B9V A;  4QHB A;  1V00 A;  5JXI A;  3OBZ A;  1OLM E;  3WV6 A;  3W5N A;  2DVG A;  1N3P A;  3K3O A;  3QLQ A;  1QH7 A;  5E88 A;  1LTE A;  1GWM A;  3ATG A;  4MO3 M;  1RUD 2;  4YW3 A;  4CRQ A;  5FDB A;  1XU2 A;  5FYC A;  3B7M A;  2X53 S;  3CO2 A;  3ZYJ B;  5J36 A;  4NHK A;  2OXB A;  3USS A;  3ZFG A;  5DAV A;  4OQ9 A;  4X8N A;  4BHP A;  3RSJ A;  3OBR A;  4XFF A;  4DEV A;  4DOU A;  1H6X A;  4Q4V 1;  1QU0 A;  3U75 A;  2IXI A;  5A7Q A;  4XJ8 A;  1GWL A;  3K4D A;  4NO4 A;  5CFD A;  4BZ4 A;  4CDX B;  2CGN A;  3HQR A;  1RUH 2;  5CEH A;  1F15 A;  4IEU A;  2YFZ A;  2RE9 A;  4IEP A;  3MIG A;  2WO2 A;  3ZYG A;  4GH4 A;  3RG0 A;  4A45 A;  1UXX X;  5FR3 A;  1BVP 1;  1V6O A;  2QBX A;  3ABZ A;  4FTS A;  2VUJ A;  2VY0 A;  3RI9 A;  5D8A B;  5FZD A;  5L19 A;  4UFM A;  2NM1 A;  5C3Q A;  2CY6 A;  4RYD A;  1QNY A;  1TMF 1;  5L36 A;  1VB4 A;  3JZV A;  1GNH A;  3LZZ A;  4XBL A;  1HJG A;  4NHL A;  3ZN6 B;  3C8X A;  3ZXA C;  3I3E A;  3SLI A;  1JYV A;  1QWR A;  2WNU B;  5FOJ B;  3BTY A;  3B00 A;  4QPG B;  3W21 A;  3DN7 A;  5CAD A;  1OLR A;  5FP9 A;  3THC A;  2W9X A;  2YPJ A;  1RC6 A;  1VBE 2;  4KNC A;  5C8C B;  5I0U A;  1LB2 A;  1GOF A;  2GC2 A;  4B4P A;  4FPG A;  2C4X A;  1VAV A;  4RFT 0;  2ZGQ A;  2BGC A;  2OX0 A;  1IS6 A;  5F39 A;  1RL3 A;  3DKW A;  4BA6 A;  3DPR A;  1C8M 3;  4FPL A;  1BZW A;  1QJY 3;  3N9O A;  4DRV A;  5JUV A;  1F4A A;  5CB7 A;  1Q5O A;  4JCK A;  4DIQ A;  2ARA A;  4I0B A;  1AR8 3;  1S0J A;  4O9E A;  4IV3 A;  3ILR A;  2WR9 A;  5DAB A;  1VLN A;  3E5U A;  2RDR A;  4RL7 A;  5I0D A;  2AEN A;  1T2X A;  3ZKY A;  2JDN A;  3TN9 1;  2EF6 A;  2JJ6 A;  4ET7 A;  1Z0H A;  1PVC 2;  3WNM A;  1PZ7 A;  2ZKN A;  2BER A;  1UZZ A;  4JDN A;  5E16 A;  2WNV B;  4U36 A;  2VO5 A;  4DQA A;  1JZ2 A;  4YW2 A;  3ZFE A;  3NNF A;  3VZM A;  3GHN A;  2QTW B;  5FYH A;  3JB4 C;  4COW A;  4IEZ A;  2JWP A;  4PI2 A;  3WW4 A;  4QU1 A;  4P9Y A;  1RUN A;  1QIQ A;  4LO6 B;  3ZMO A;  3LDB A;  5C7G A;  2GH2 A;  1NOV A;  2YC2 A;  4K9S A;  5F37 A;  4HN0 A;  3GJB A;  1JZ3 A;  3WP5 A;  4ASK A;  5A6Z A;  2H6C A;  1Q3E A;  3EJK A;  3O1V A;  2VVD A;  4BQ2 A;  4XCA A;  1HQL A;  3SH3 A;  3CJI A;  3UKT A;  3OYW B;  3RZG A;  3KT1 A;  3B94 A;  4RHV 1;  3V0A A;  1B09 A;  4QDR A;  1X50 A;  4NII A;  5FAX A;  4RS5 A;  2XJT A;  2XON A;  3WEZ A;  2OS2 A;  2BV4 A;  1ULF A;  5EIY B;  3FHA A;  5LEK A;  3GXU A;  3QH6 A;  3MGU A;  4CSW A;  4HFS A;  3C7F A;  2PA7 A;  1J59 A;  2IXH A;  3T2T A;  1RIT A;  1C57 A;  1G7Y A;  2W3J A;  5EJZ B;  4ATF A;  2FDI A;  1RIR A;  2QDR A;  3NO8 A;  2IFW A;  2YC4 A;  3FZ3 A;  5LAT A;  3PJQ A;  4FQ4 A;  3WNX A;  5FPU A;  4PIY A;  2VL4 A;  1YCI A;  5C71 A;  1UWW A;  1N1Y A;  1MEC 1;  4XBQ A;  2OII A;  2UUR A;  1GP4 A;  1G9C A;  4Q8K A;  3ZSE A;  5CBL A;  5HCF A;  1VBB 2;  3RZH A;  5L9R A;  1HW5 A;  2BVV A;  1Q8Q A;  4QQH A;  4CDU A;  1TNF A;  1GOG A;  2WT2 A;  1QJF A;  5A7S A;  3IAQ A;  3WW2 A; 
#chains in the Genus database with same CATH homology
 3HQR A;  3HQU A;  4XAA A;  4XCB A;  5DAW A;  2OPW A;  3ITQ A;  4ZPI A;  5DAQ A;  4XAC A;  2RDQ A;  4IW3 A;  4MHR A;  2FCT A;  3DKQ A;  4BQY A;  5EP9 A;  4NHL A;  2RG4 A;  5ERL A;  2HBU A;  5EQU A;  4NHM A;  5LBB A;  3W21 A;  2G1M A;  5IAX A;  4J25 A;  4Q5O A;  5DAX A;  4NMI A;  4NHX A;  5L9B A;  2FCV A;  5LBE A;  2JIG A;  3PL0 A;  5M0T A;  3GZE A;  3W20 A;  5LBC A;  4Y5S A;  2RDS A;  2RDR A;  3NNL A;  5A3U A;  4BQX A;  5LBF A;  4KBZ A;  4ZON A;  3NNF A;  5L9V A;  4BQW A;  3OUH A;  3OUI A;  4Y5T A;  3OUJ A;  2A1X A;  2JIJ A;  4XC9 A;  2V4A A;  3GJB A;  3KT4 A;  5C5T A;  3NNJ A;  2Y34 A;  4XCA A;  4JZR A;  3KT1 A;  4NAO A;  3KT7 A;  5C5U A;  5IAT A;  4MHU A;  3GJA A;  3MGU A;  5IAV A;  5LAS A;  5HV0 A;  3OBZ A;  4XAB A;  5HV4 A;  5LAT A;  2FCU A;  5DAP A;  5EPA A;  3NNM A;  4UWD A;  4NHK A;  2Y33 A;  5LB6 A;  4NHY A;  5DAV A;  5L9R A;  3BVC A;  2HBT A;  3EMR A;  5LA9 A;  2G19 A;  2RDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...