4HK9A

Crystal structures of mutant endo-beta-1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
188
Chain Sequence
b'IQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGHFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
molecule tags Hydrolase
source organism Trichoderma reesei
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
total genus 57
structure length 188
sequence length 188
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hk9A00
2VUJA 1H0BA 3AMNA 1C5IA 4HKOA 4S2GA 1PVXA 1OLRA 1OA4A 3WP5A 1KS5A 3WXPA 3LB9A 3M4FA 2B46X 2B42B 3AKSA 2BW8A 5K7PA 2JICA 4XQDA 3WP3A 3AKQA 2Z79A 3MF6A 1OA2A 3WQ0A 3VHNA 2F6BA 1F5JA 2DCYA 1HV0A 3AKTA 2DCJA 1BCXA 1REEA 2DFBA 1XNCA 1YNAA 3AKRA 3MFCA 2QZ2A 3RI8A 3VGIA 1XNKA 3EXUA 3HD8B 3VL9A 2BWAA 1W2UA 4H7MA 3WY6A 2QZ3A 3WQ7A 1HIXA 1REFA 1UU6A 3WP4A 3VZNA 3MFAA 3WR0A 1XYPA 5K9YA 4XQ4A 3B7MA 1XNDA 4S2FA 3VHPA 2VG9A 1HV1A 3VZJA 3LGRA 2VGDA 3VZOA 3WX5A 3B5LB 3VZMA 1XYNA 2BVVA 3VZLA 1REDA 1NLRA 4S2DA 4HK9A 2NQYA 3AMMA 5EJ3A 1BK1A 1XNBA 2BWCA 3ZSEA 1H4HA 5HXVA 4XQWA 1IGOA 1XXNA 2DCZA 1KS4A 1QH7A 3VLBB 3VHOA 3VZKA 3AMPA 4NPRA 1C5HA 1XYOA 3WQ1A 2D97A 4IXLA 3AMHA 4HKWA 3WP6A 2JEMA 2DCKA 4HKLA 1UU5A 1QH6A 3WT3A 1UKRA 3AKPA 1H4GA 2C1FA 3VL8A 4S2HA 1M4WA 2D98A 1ENXA 4HK8A 2B45X 3AMQA 1AXKA 3O7OA 1UU4A 4XPVA 3MF9A 3RI9A 1TE1B 2DFCA 1OA3A 2VULA 1OLQA 1BVVA 1T6GC 2JENA 1H1AA 1H8VA 2NLRA
chains in the Genus database with same CATH superfamily
1YXWA 4BQ5A 5A1FA 3ZXLA 3CZUA 4LBKA 4TXWA 2A6WA 3WDUA 4RR3A 3VB9A 1US3A 3BOWA 4D6SA 1XPWA 1C1FA 1NLQA 2NM1A 2WFF1 4ONUA 4MVTA 1ASJ3 2V5YA 1VAVA 4BOWA 3OTFA 1NZCA 3A0KA 1ZBE2 2HBTA 2A3WA 4FCAA 4GA9A 3ZIXA 3JXSA 1WLWA 2PHUA 3ZFFC 1POQA 1T6BX 3UJQA 1LHUA 3FN9A 2R072 2XOMA 3WQ0A 1HRI2 2BFUS 1RITA 3MYXA 2W46A 4L2NA 4YNIA 1LAJA 2YZ4A 4OMDA 2D6MA 4NE9A 3T2PA 2DCJA 4A44A 1FT9A 1TNFA 1DU3D 3D8CA 3W58A 1CIYA 2IXLA 4LT5A 2W91A 3IM0A 3ZOIA 2V5DA 3RG0A 1AVBA 1AYN2 5E6HA 2RMU2 1HXS1 5CFCA 4J1XA 1UD1A 4MGTA 5LBCA 3M1HA 1Q3EA 5LASA 3LA7A 4FT8A 1Z7S3 4U36A 1HKDA 4CU9A 3V64A 2FDFA 3ZFFA 3G7DA 1O3RA 3UKTA 5CISA 1XNDA 3KF3A 5A3NA 1VMFA 1VBB2 1RMU1 4NHXA 1BJQA 3QACA 3V56A 5T5LA 3Q8EA 1UY4A 1MZFA 3T4VA 2HWD3 1YYNA 4XFGA 4HPKB 3CF6E 1C1LA 1PX3A 3CJIB 4XHXA 1N1SA 2XBO3 2YY1A 3MW2A 1OQDA 5BUVA 2WABA 2VOKA 3DYOA 3VDAA 5CKNA 5JPNB 1V9U1 5FBJA 3UYJA 1VBA3 3AXEA 3CHXA 5IYYA 5APAA 2WO3A 4LR4A 1PZ7A 5LRSA 5LY1A 3ZXAC 4Y4RA 2DBIA 4B3NA 1O3QA 4FAHA 2WA3A 4NOTA 5CFDB 2IWGB 1A34A 3LOIA 1VBE3 2Q5TA 1IPKA 1FV3A 4LNVA 1PMJX 4X6QB 1DGLA 5F2SA 1TZOA 4JGZC 4W6XA 4OHZA 3FWEA 2VE1A 3VBUC 2E53A 1FI2A 3SH3A 1QH6A 4P5YA 3O1PA 2CL2A 4XIOA 4URAA 3U1XA 3LA2A 2ZZQA 3QH6A 1MS3A 1SLAA 2A6VA 2ET7A 5FP4A 3UGGA 4AQTA 4EZHA 2ZCWA 5FUPA 2EVXA 4RYDA 2ZGTA 4A41A 1J83A 1WMEA 3LEKA 3H3UA 4W8JA 2P3IA 4HN0A 3B01A 4H7LA 4R9DA 4Y1VA 4IEXA 3DF0A 1RUG3 2D40A 3ST7A 1ENXA 2QQKA 5T5OA 4UOJA 3V0AB 2GH2A 4IUGA 5KC6A 1OSGA 1W28A 1ND2C 2V09A 2WO1A 4DPNA 4Z07A 2Q8DA 1SLBA 4I02A 4TLGA 4AHYA 1DHKB 4IEWA 2XMLA 4DRRA 4AQ6A 4OMCA 4KQ7A 3I3MA 4AFAA 2I2SA 2NLRA 3EJKA 4K8FA 2D5FA 4FAGA 5C6CA 4F8AA 5FPUA 1QJY1 3WDWA 3MPPG 3B02A 4FOVA 4JV4A 4XIKA 3KT1A 1NXD1 3ZXJA 5J09A 2F4LA 4QD2A 5I0RA 1W8TA 1LOAA 2R1BA 4O61A 1XE0A 4NHLA 4Y5Z0 1I1EA 3AC0A 5JR2A 5JI9A 5ISLA 1RUD2 3J8F1 4EWDA 2IXIA 1H2NA 5A3LA 2WQ4A 3PMEA 5D2AA 2Y0IA 4RR3C 1V6LA 2RS31 3TEXA 5IAXA 1D4VB 4L92A 5BYNA 2VH9A 1OH4A 2D6LX 5CYYA 3KV9A 2W0XA 2UU8A 3EO6A 4AWDA 1UY0A 1XU1A 1NX9A 4FPOB 2DF7A 4K40A 5K0UA 1XE8A 2WFPA 1S0CA 3D82A 4XBLA 4PDWC 3U0ZA 1UPIA 3EHKA 3ACFA 5FZFA 5FXVA 1AR91 1S0JA 3I2FA 5FPZA 5LY2A 3WLUA 1RHI2 2AC1A 2Q1MA 2RJKA 3B9CA 1QJZA 2O8OA 1R093 2ZX3A 3INAA 4Y5SA 5FQ0A 2NP0A 4AOCA 5EFUA 4BA6A 2XWJB 5ANNA 2WSUA 3T0BA 2D3RA 1RB8G 4JDNA 1QEXA 4LKDA 3RMYA 3CQOA 4LOSA 1UMZA 3JB8A 4NHYA 4QGNA 1OT5A 2JDMA 4SLIA 5GKAC 3U4SA 4AI1A 5JOZA 1FMD1 1DQ4A 4ZXEA 1GP5A 1RUG2 4B7KA 1WW4A 4FXKB 4Q4W1 3ZKUA 1UZYA 2YFZA 2ZEZA 1DQ0A 1AXYA 2AZ5A 4LHNA 3DPRA 4AL9A 1UO9A 1R1A3 3B5LB 4JHTA 4LJHA 2BVVA 5CFDC 4XF3A 4QB6A 4CXYA 3U4XA 2BV4A 4IGOA 5H9RA 3OUJA 5LA2A 4CCJA 2JIGA 3K2OA 2BBVA 1AJOA 5L9BA 2C0ZA 3ON7A 5E89A 1TME2 2GNTA 3ZN5A 1COV1 2IC1A 2VVDA 4GQ7A 4YM1A 1IGOA 3POIA 1RTVA 4HSLA 2SLIA 5ABJA 5FOBB 2W1WA 2W9XA 1GZTA 3T4HB 2D6KA 5EYYA 2VMGA 2EALA 2VQ0A 4IGPA 4WBBA 4AVTA 2RS13 4AEJA 4CEWB 4CDWB 3NNFA 4LBMA 1LGBA 4W4ZA 3Q9OA 4EWEA 4OHWA 4E8CA 3UESA 5FMOS 1GLHA 5AFEA 2C9KA 1DYKA 4LHSA 4Y4YA 1VBD3 1NCRC 1ULPA 2W2IA 3DKQA 1SEFA 1RUH3 1R081 5EJZB 3TEZA 3F2ZA 4QQLA 1YRZA 1D4M1 4WV8A 4K8RB 2JE8A 4QM9A 3ZFGC 1F5FA 1C28A 1SHWB 1VBC1 2WZEA 3LF7A 5I8SA 4AK3A 1LENA 3ZDVA 1JW6A 3H8RA 2ZGKA 1NCQC 4IERA 4M01A 5FY9A 3T09A 3VHRA 1PO13 4MGZE 3T1LA 1IOAA 3AMQA 4D6QA 2VZOA 1MS5A 2ZKLA 5L9VA 1WA4A 1F2NA 1AR92 3MO4A 2VXJA 1OLMA 3KM5A 3FMGA 5JZGA 4XXAA 3USUA 1H1AA 5DAXA 1US2A 4EROA 3LSDA 3VBFA 5FYYA 5H9QA 2K2SA 1LU1A 1RUNA 4QX5A 1BZWA 2VR4A 1ZA4A 2R073 3AP7A 4IV3A 1MQTA 5EYXA 3ORJA 5T50A 4DEVA 4FFFA 5FP7A 4XF4A 1JZ2A 1W6NA 2RM22 3JQXA 1KS5A 4YYOA 1SLIA 1PK6A 1OLME 4JKLA 4MXWA 5FZIA 5CBLA 3OEBA 1XJAA 2JICA 1V6MA 1W3XA 1YLLA 4QHOA 4KL1A 4ZS3A 3SC7X 2D5HA 1W8UA 3MLKA 5HCHA 4UBGA 5LA0A 1Y9GA 4K3UA 1ASJ1 5E88A 3S57A 3AK0A 1VBE1 2XVLA 3RI8A 4IE4A 2OZJA 1AYM1 1GFF2 3AB0A 5ACA3 1RGSA 2X5IC 3VL9A 3NAPC 4J25A 3W20A 3H1WA 2E26A 1I5ZA 1UPSA 1LEMA 2QFEA 2HYKA 2WO2A 1ULDA 1X50A 2XLGA 4AFBA 1HW5A 2LTNA 2Y33A 3OPZA 1HJFA 1VMJA 3KQRA 1G86A 3NKGA 4FOQA 4GALA 3UL2A 3WSOA 5LEJA 2VW0A 2BP6A 2UWAA 3O1TA 4MGKE 4NMIA 1O3TA 4XVHA 3LKJA 3PU8A 4NPMA 2IUWA 5C3SA 2XBO2 5FFOC 2RR13 3ENRA 5BNQA 2JE7A 1XB9A 4IE5A 2RG4A 2AEYA 3ZLIA 5FYMA 3ZM8A 3OGSA 2ET1A 2ADDA 3VBUB 2QBXA 5DPNA 1JXNA 3FJSA 3WX5A 1HX6A 1POV3 1F4HA 4EN7B 1J84A 3J7HA 5IVCA 1YI9A 2BNMA 3ES1A 1BK1A 1NQDA 1XRUA 3PDQA 4P9IA 1QQP3 2E9QA 4XILA 3NNLA 3AL5A 5AC91 2GP3A 5HCBA 3WEZA 4E2GA 3AP4A 1LOGA 4IE6A 3GBWA 5FMDA 1Y9MA 5L7OA 4NPRA 1PGL2 4QX2A 1GBGA 2WN3A 1CAUB 2J1AA 3AYCA 1SLTA 3I3EA 1J58A 4AEDC 4DY5A 4EQVA 5FZCA 2ES3A 2WNOA 3WDXA 4I01A 4PDWB 3PUQA 3N7KA 1R64A 4HZFA 1A3KA 3K4ZA 4MX3A 4DZGA 1BEV2 1EY2A 3K75B 1ZBA1 1V6NA 3IT8A 4GH4C 5ABJC 1W6NB 2J42A 3E6BA 3PVBB 3H3ZA 1W6MB 1FOD1 4CCNA 2AENA 4XOGA 1C8M3 2H0BA 3ZMOA 2OPKA 5BXXA 5DZFA 1EV11 4DY3A 1SCSA 4XJWA 5ACA1 2QJVA 2D7FA 1AL0G 4RGAA 1UXXX 4XFAA 5JSOA 5J96B 4HBNA 2VMDA 4AEDA 5CADA 1DG6A 5DABA 1AR82 2EICA 2Y6HA 2YFUA 1OA3A 3JBG2 1HRI1 1W90A 5C5TA 3FHAA 1JYNA 1SBFA 2VC9A 5FZ1A 4GMP0 3WVJA 4ET7A 3LEMA 4AI9A 1UZ0A 3CLPA 3U37A 2P17A 3K51A 2KR2A 4BHPA 1J3RA 1QNWA 3TYJA 1L3JA 2VTFA 1W04A 2UY9A 2WWUA 3LCPA 1H6XA 2KD7A 3LFMA 4UWDA 3N9NA 4COYA 1NCRA 4OI2A 3NNMA 4CDUB 3WXPA 3GALA 4QPWA 4XFIA 5JVVA 4DXRA 3AJYA 3LEGA 1HRV1 3ZPOA 2LS6A 3U10A 5C9AC 1GICA 3AZVA 3E5XA 4A7KA 4CDQB 4L8QA 1DQ6A 2XJSA 1JU3A 5CKQA 3WNPA 2PQQA 2UWBA 4IEVA 3HNMA 3POWA 5FYSA 3FX3A 3NJYA 5FYIA 4N8MA 5FZ3A 1KJLA 3FUOA 4Y24A 1Y43B 2VZRA 4EZ4A 5B4XA 4RHV3 3ACLA 1ZZ6A 4XCBA 4KWKA 4XDOA 5LZ6A 1NCQB 3AZWA 1HDKA 4JDMA 3WDYA 1GZWA 3C7FA 2ZEWA 1NY71 1XYPA 3ZXDA 5JWPA 1AR72 1JH5A 5FK8A 1ULOA 1W6QB 4FI9A 5SV8A 3GJAA 4RD7A 4HG6B 5FY0A 3HQXA 5T5PA 3TN92 5FXZA 1C8M1 4V1PA 2ZHNA 5G04L 4EYUA 5L9RA 5B4NA 1HV1A 3IDAA 3K3OA 1PK6C 4DS0A 3SLIA 2CHHA 5DXDA 3ASIA 4MADA 1TME3 1YFXA 2WUHA 2MEV1 4COWA 2C26A 2HWC1 1X8MA 2W1SA 2X09A 4N9HA 4NWWA 5BNPB 3GBGA 4JTOA 3IB3A 5C8WA 4DMIA 1RVF2 2BWCA 1UYZA 5FZBA 1HB2A 5FPVA 4Q4W2 3GZTB 5J3UA 2DVFA 3LWCA 1CAVA 5DUVA 3MZHA 1QH7A 5GZEA 1FMD3 1JN2P 4OYUA 3SKVA 3ABZA 3OD4A 4FPCA 1S0IA 5F39A 2WT2A 4RL7A 3U11A 2JKBA 2VBDA 4GXLA 4QHZA 3GBFA 3B93A 5A3OA 4JKMA 2JD4A 4E27A 1GNYA 2QDRA 4MHUA 2OYZA 4L9BA 2J1UA 3MHZA 3G6JB 1UKRA 2ZZJA 1DGWA 2XJVA 3URFA 3WV6A 5IVFA 3ECQA 3LOBA 3GXUA 1M06G 3S7IA 2WZR2 1R091 2XUEA 2JDKA 4Q0UA 4Q0PA 3NW4A 4Y22A 3ZFFB 2B39A 5FLJA 1U12A 2OS2A 3POFA 3AL6A 4J6GA 5F5CA 2XKOA 1NG0A 3FL7A 4RHV2 2ZTNA 4YW5A 5C8CB 2IZWA 4QX8A 5A1LA 5KHJA 1R082 4YM3A 2JG9B 1UU4A 3NV2A 5HCFA 1O8PA 1F35A 3O0VA 1PZ9A 2XJUA 1I3HA 2W39A 3KCCA 3KV5A 3R6SA 1CPNA 2ZPXA 4HVQA 3RWKX 3VDDB 4MGSA 5JMCA 1ZREA 3N7JA 1CPMA 1WD3A 2G9FA 3KLSA 3TN91 1SLCA 3RZKA 4MV2A 4BYYA 4YW2A 3LDBA 3BPSA 3MIFA 2PHFA 2FZ1A 3PUAA 1MS4A 1TME1 4XE9A 1Z78A 2A6ZA 1QWRA 1RHI1 3FLTA 1NUKA 3M4FA 2B46X 3AZXA 2ARXA 1RVF3 4LKFA 3OBAA 4AFCA 4BXSV 5LBBA 2V4AA 3LPFA 4ISQA 4BWOA 3JB4C 4E4HA 3FZ3A 5JSPA 3KT4A 3VBOC 5F32A 1G6NA 3VD5A 4GKYA 4DXZA 3RJRA 2BNOA 3OGGA 5F8PA 3KF5A 3KV6A 4XCAA 5FAXA 1NE4A 4GB32 4PIXA 4ZPIA 5JI7A 5LA1A 2VO5A 1DQ5A 1AYN1 2FD8A 1S1AA 4P9XA 3V0AA 2VTXJ 1QF3A 2W95A 1PNFA 4M4RA 2UYAA 4XXPA 1QXJA 1RJ7A 1SPPB 4LLFA 4C1WA 3NKTA 2WLPA 4NIDA 2A75A 5FJHA 4YW1A 2WFF2 3OPWA 4NN0A 3DGTA 3FLRA 4AHWA 5C3PA 4XQ4A 1KDMA 1KFUL 1APNA 4QAWA 2GZWA 2YHJA 3VBOA 4Z1VA 1C57A 1W06A 1X9TA 4DRVA 3O1MA 1U5ZA 3ZSLA 1YQCA 4DO0A 2LROA 4HETA 3U14A 5C3RA 4RS5B 2HKXA 1MEC2 1HRI3 4KGGA 3NWKA 1RUI1 4NAOA 3ZYGA 5K8SA 1J1LA 2W68A 4NRQA 5A3MA 2XBO1 1OH3A 4AQSA 1JHNA 4IV1A 1G9AA 2DVGA 1CAXA 1V0AA 3WG4A 3GF6A 1WA6X 1LESA 2CTVA 4YG0A 1OPOA 1MVQA 1X33A 2DCZA 3KMHA 2JG9A 2ZX2A 2B8MA 2G1MA 2RS51 4PQ9A 5C7GA 4IEQA 2A5ZA 1LULA 4WM7B 3PLQA 4RS5A 3IDCB 2VNVA 3GZUC 5CG8A 3VBHA 3BODA 1KQRA 1Z0HA 5FQ0B 2YV8A 3O0XA 5AC92 3I2JA 2VZUA 4RA0A 3T0DA 4CDQA 1QDOA 1VBB3 5D8AC 2BUKA 4O9EA 3KHCA 3TRSB 1TEIA 5CZKA 1GZ9A 1WLTA 3NL1A 1JS9A 2JECA 2C1FA 4W6WA 5EPAA 5F5AA 1PO22 2ZKNA 2HWD2 3JQWA 2UWCA 1ZZBA 4MO3M 3S7EA 3RZJA 1JOJA 1QKQA 4WVVA 4CCMA 4NVPA 2WWJA 5FZ7A 2ETEA 1OOPB 4OHXA 1VMHA 1LOEA 4XF1A 3H8XA 1FOD2 1OKOA 2YBPA 3D0JA 4CDXB 3BU0A 3AP9A 1HXS3 4UYBA 4YPJA 4KU7A 1SFNA 2HLEA 1OBNA 3M70A 5F1RA 3POYA 3VD4A 3KVAA 2ORZA 2QE3A 5KXBA 5FWJA 3NNJA 1YJLA 5CIRA 3ZXEA 1VBE2 3WW1A 4UFMA 3AMNA 1RUC1 1UYPA 2A3XA 1CJPA 2FHRA 4W50A 4R4XA 4AI3A 2ERFA 3LPGA 1ZM1A 1FX5A 1Q8PA 3ILFA 4Y1UA 5EP9A 4YG6A 5J98B 3KD4A 2O1QA 3BU7A 5A7QA 3USSA 4Q0SA 5KHHA 5IATA 4HMZA 1Y3TA 5A6QA 2A3YA 4A4AA 1X9PA 1GR3A 1YWKA 3J8F2 5H9PA 1UF2C 1KD7A 4PF1A 5FZAA 1OFSA 5F3CA 1BYHA 3CMGA 3AJZA 3OG2A 1DLCA 1REEA 2CY6A 4L11A 5FYTA 3WHUA 2R1DA 3E1F1 3ROUA 2E51A 1YC61 3BGAA 1NYWA 4UF0B 2VOVA 1JUHA 3EMRA 3A23A 1YFUA 1ULGA 3MBWA 4H7MA 1UCXA 1OOPC 5E1RA 1IQAA 2XL9A 4UW5A 2PHXA 2XONA 1FPN3 1ULCA 2ZABA 3CZJA 2JG8A 3HR9A 3RMXA 5FRAA 1V70A 4AEMA 4AGRA 4CRQA 3LZZA 2OUJA 4N43C 4JRLA 3WR0A 5BNOA 4RGKA 5FZGA 3RQ0A 2Q1FA 3BB6A 2FDGA 1D2QA 2XHNA 1OURA 4DXTA 1U0AA 4N7IA 1PO23 1UOBA 3WZ1A 2K9ZA 5FKCA 4CCCA 4F7ZA 4K21A 3ZXGA 4TWTA 4D7SA 1PO21 4YRDA 4EN6B 3MIEA 1KGYA 2RVAA 1WKYA 4Q4W3 4CCEA 1XSQA 5A7OA 5A3WA 1VRBA 3UKNA 3VZOA 4FFHA 2RS32 1XE7A 4FQZA 3MW3A 5GZFA 1V6IA 4AGGA 2Q1ZB 3N36A 4WM7C 5FPLA 1H2MA 2BGPA 2FDJA 2JDYA 4P9YA 3VBHC 4E2SA 3BALA 1DBNA 5FIXA 1XBFA 2GN7A 3WINE 3W21A 5L7OB 1POV1 3OD0A 1H4HA 2WA4A 3JU9A 4XFCA 2HWC2 2VOWA 2XJPA 4LMFA 5HXVA 5IVVA 2BERA 1JZ3A 4BQWA 4LE3A 4CEYA 1C8NA 1QQP1 2WNVA 3LE0A 4M00A 4WM8C 4BB3A 4XBQA 5FZMA 4TTGA 1DIWA 5DDJ1 1K42A 1ND3A 2DUPA 2BEOA 2BOJA 2GALA 2X05A 4Q27A 5ANQA 1QJX3 2QCSB 2YUEA 2ZGOA 4OVEA 3KQ4B 5LWBA 2VNRA 1GYKA 3S30A 2PHWA 3UK9A 4K7JA 1PM4A 1H8TC 3EBRA 3ILRA 5FWEA 5HCAA 1D4M2 1W8FA 4C1XA 4MXWB 2A6YA 4PJYA 1AR61 3SQOA 1TVGA 1A6CA 2YGMA 1AUYA 5DMYA 4BQ3A 1RUJ2 4ZXKA 2VECA 3TOJA 2VVEA 2WNUB 4QKDA 4Z8BA 2L9LA 2XLFA 1B35A 3HQRA 4MHRA 5CA6A 3KVBA 5BNPC 2YPJA 3X29B 4HT1T 1HRV2 2ZMNA 4LBNA 1AYM3 1QOOA 3H8UA 3ZSKA 2WRAA 4LIUA 3IAPA 3OBRA 1OLQA 2YC2A 3USUB 1T6GC 5BNPA 4HL0A 4Y1YA 4H14A 1ODMA 4LK6A 2RS12 5JCTA 2ZGLA 4UFIA 5DUUA 5AVAA 3WDVA 4MUVA 3J26N 4PBPA 4S2GA 3ZYBA 4NRPA 1OHFA 1WMXA 4FBFA 5J36A 2WZPP 1OA4A 1NT0A 3PMSA 4LO4B 5A33A 5JXIA 3RZLA 3V65A 3PTRB 2FBEA 4DINB 4IV3C 1D7PM 2ZXQA 4GB33 2DV9A 4P02B 4C8DA 4KG8A 4CA9A 3LQCA 4CTEA 5F2WA 3LB9A 3SCHA 4FO9A 1VBC2 1FATA 4XJZA 3NO8A 4XQDA 1W9FA 1B35C 1NY72 4YGDA 1AR71 2UYBA 5T52A 3ZXFA 2ARAA 1VJ2A 1GOFA 1QNYA 4LO8A 1URXA 4RFT0 3UETA 2H6CA 1H8TB 5A3TA 3OUHA 4QB1A 1UNBA 2X8KA 2WFF3 2VY0A 2GNBA 3HQUA 1MVEA 3KV4A 1H1MA 2J1TA 5FJKA 2TBVA 1QJY3 1YO8A 3OY8A 4XTMA 2QZ3A 3WQ7A 2TNFA 3A21A 3Q8BA 5FZDA 1TMF3 5EJ1B 5I0SA 1RVF1 1QJX2 1VBD1 4Q4V3 2CNAA 1GOHA 4AVAA 2OKXA 3AYEA 1LOFA 3GHMA 1DP0A 4XUQA 1A8MA 1D4M3 2FCVA 2Q0AA 3GZEA 4YZ4A 1ULEA 3LIGA 4NIAA 1UX7A 4ZONA 4AGVA 3DYPA 1OOPA 2VTXA 1RUJ3 5FCCA 3M3CA 3KSCA 1WW7A 4YFWA 2VGDA 5FO7B 4CXWA 1OC1A 2ZX4A 3TNPB 1OI6A 2CDOA 2R49A 4CEWC 5CB7A 1WZXA 3ETQA 1UIJA 4CP0A 4EE2A 1AYM2 3KWVA 4C0BA 1V6OA 4NPLA 3ZYHA 1JOBA 3O5SA 4QX0A 3I59A 4QGLA 1VAKA 3V0BA 4Q2FA 1XXNA 5FOJB 4JQRA 5L19A 5LK5A 5EIYB 3VLBB 3MLLA 3VHOA 1F15A 2XKPA 3HBKA 5CAZA 2ZGPA 5DG2A 4BPZA 1XYOA 3EB7A 1GZCA 3L2HA 5IHRA 3OUIA 4PLMA 5JOWA 3U78A 2OXBA 1WCKA 2D6PA 1JYCA 3KB5A 1JZ5A 3LEIA 1YQ5A 2IVIB 3BTAA 5ERLA 2RE9A 4EJRA 1FOD3 3OEAA 4LXLA 3SEPA 4D69A 4X6RB 4Q0VA 5LBFA 4A45A 2CAVA 5I93A 5JUVA 1ZRRA 1AX2A 2MNGA 3NV3A 4OZOA 3THCA 5G05L 2XVKA 3SCGA 4BDVB 4LHKA 1VALA 2X29A 5C9AB 1JHJA 1K12A 1PIV2 4ZZ5A 2BGCA 1FPN1 1HB3A 2VUDA 4IL7A 4Q8LA 1HN1A 1DZRA 3C7HA 5BY5A 2WNEA 2JG8B 1R1ZA 1WMDA 4B7EA 4JGYA 4KH9A 1UY3A 4IQPA 4YZ5A 2DDUA 4ARXA 5JDBA 4CDUA 1YQ6A 4B4QA 3VBUA 1EPZA 2MHFA 2NMNA 3I49A 1RIRA 1RUI2 4E4ZA 3H3LA 2Q8CA 1SBDA 4E4DX 5JMOA 1BEV1 3AFGA 4Z82A 3UT0A 4Q5OA 2ENRA 3THTA 2R061 5GLUA 3VUOA 2ARBA 4I3PA 1BEV3 2WN2A 1QMJA 3WD5A 4QQ2A 5I8YA 3HAGA 2WYFA 3RJ2X 3IPVA 4YVWA 3ZFEC 1RUE2 4BU2A 4R9CA 2E63A 5JR7B 4BM8A 3TB0A 1RUC3 2LALA 3AFKA 4LLOA 4FP3A 4X8NA 2XXZA 2VMIA 2P6CA 2VXRA 3BTXA 3HN1A 1Q8QA 1GOGA 3HEIA 1YIPA 2LM3A 3I3QA 3FHQA 2VAUA 2WO7A 2ZGNA 1RUF1 1POV0 3SISA 1LOFC 2GNMA 3M3IA 4XJAA 4A3ZA 1W0OA 3IMMA 2WWSA 3RFRA 1AR83 3O14A 2RDRA 3TEYA 2J1VA 4IESA 1UOGA 5F6KA 2RDNA 5FUNA 1W6MA 4QXKA 2DVDA 4XETA 1OFNA 4IDZA 1JOPA 3BOPA 1HIXA 2D6NA 3SH5A 5K0UC 2WNUC 3WUDA 1O3SA 1VBA1 5FO9B 2RS33 4M3CB 1BBT3 2BPA2 4YVWC 2VOXA 3N7LA 4KBZA 3ZFEA 5K9YA 4P9JA 4K20A 2YMZA 3FBYA 2MPFA 2J1SA 3CJIA 2YROA 3M7AA 4CUBA 1CIWA 1DLLA 1S55A 2RS52 1QDCA 5FZEA 1XC6A 4LBJA 1O91A 4AEKA 4A7ZA 1JUIA 2VZ3A 5M0TA 1PIV1 2VW2A 1UZWA 2JWPA 2P5BA 2CAUA 5C4WC 4CVUA 4I2OA 2JX9A 2WNVB 1OMIA 3OJBA 4ZZ8A 1CZTA 2JXAA 3W59A 1EUUA 2IVJA 1ST8A 3DN7A 5FZLA 1CGPA 4QKBA 2B5HA 2WNUA 2DU0A 1OVSA 1RUI3 1W9TA 1SFPA 4I09A 1CX4A 3ALQA 5FYVA 4QPGC 5EHDA 1Q8VA 1WW5A 1VIWB 4MLOA 4YFZA 1SACA 4GWMA 4TYSA 5EV7A 3VZKA 1W0NA 5IK8A 2VQAA 1VP6A 4Q29A 1W8NA 4Y1ZA 1O6UA 1AR73 1IKPA 2P6HA 4IXLA 2D93A 2J1EA 2OT7A 4COUA 3OYWB 3C7OA 5A7WB 4MYEA 1LTEA 4D6RA 2IXJA 2PELA 4CDWC 3BI3A 3NAPB 3DPRC 3VV1A 3O1UA 1RUE1 5DQ0A 3RYKA 5L36A 3VBFC 4JTNA 3EQEA 3QD6A 4QQPA 1VLNA 5GALA 4UAPA 4G9SB 3T0AA 1DZQA 3I2DA 3NJZA 1QJU1 4JC1A 4K9SA 1AZDA 2WT0A 3PIJA 1ZX5A 3R05A 1DQ2A 1RUF2 4OUMA 4OUSA 1JTZX 4IE0A 4YGBA 1TMF1 1UAIA 3I2HA 1FAYA 5FZHA 2D98A 4Q0QA 2UURA 3PJQA 4AE2A 1V6JA 3H42B 4HK8A 4JAAA 4ES9A 3S6PA 2HWB3 4FTBA 3CJXA 1BMV2 3PUIA 5BNNC 4DOUA 2FDKA 4Y20B 1BBT2 1D2SA 3VKFC 1N3QA 2AEZA 3GCWA 3H9AA 5IK4A 1FXZA 5DN2A 4D7YA 3C2UA 4FPYA 2BRTA 4IV1B 4JKKA 4XZUG 5D21A 1EAH1 2DTWA 1QHDA 1OKQA 1YEWA 5FXWA 3WCRA 5HBAA 3IIAA 1ULFA 3J7LA 4V2WA 2XL7A 2QTWB 1PHMA 1OLRA 4CP1A 2VM9A 4GULA 1AL22 4N53B 2Z2SB 4NUBA 3WP5A 1KJRA 2J7MA 2HBUA 5C8CC 2ADEA 2AYHA 1RHI3 5C33A 1R092 2B42B 5DUXA 4CDUC 2HWE3 3A4UA 1MS0A 1FYUA 4GWJA 4RSUA 5A80A 1IHMA 3N9LA 1UZZA 2GC1A 2HWE1 1OA2A 3BCWA 4LIVA 5GZDA 5IAVA 1O4TA 1WBFA 2P3YA 2PMWB 3KCXA 4FOWA 4LBQB 4GB31 2PTMA 3WNLA 2D3SA 1YUDA 4QXBA 3ZPYA 3NRUA 1W9WA 1UYYA 1UXZA 1UIKA 4CU6A 3JCIA 2WQZC 3OGRA 1DZTA 2YXSA 1CN1A 4J1WA 5D1IA 2VZTA 3ZXKA 5LK7B 4UW3A 3MIHA 5C8CA 5IW0A 3WP4A 4EV0A 1WW6A 1NZIA 3GDBA 3TAYA 4BLJA 4CP2A 1F31A 1GWLA 1BQPA 2GC2A 2QQJA 3THPA 4N90A 2WS91 2PHLA 1TNRA 3D3AA 4BXFA 4PCRA 2YBKA 3I7DA 4QKFA 1OVPA 1VR3A 2GU9A 4MXVA 1DQ1A 5B2GB 4OI1A 2CWMA 1HJGA 2YPDA 1U5IA 1GQGA 4DNYA 1ENRA 1DGRN 2RS11 1ZZ8A 1XU2A 4I30A 4XDPA 5D8AA 2V73A 3O12A 1RUH1 5J37A 2XPJA 2ATFA 2G4IA 2VCBA 4HVRA 3IKWA 4IGQA 1ZRFA 2VNOA 1UN1A 4FP2A 5JIUA 4Q1RA 1MR5A 4BQXA 2WT1A 4LK7A 3D4KA 4I3GA 1VB2A 4PDWA 3OOXA 4CCKA 4KWUA 2GNDA 1AL23 4D3WA 1PO12 1C5HA 5KR7A 2QQLA 3POSA 3J4UH 3WF0A 3ZYIB 4LE4A 4HKWA 1COV2 2MEV3 4XC9A 3QH7A 3ATGA 5BNOB 4RS5C 1RINA 1YI7A 2IXKA 2EIGA 1H30A 4HKLA 4CUGA 3JD71 4MZUA 3MI8A 2IXHA 4GAZA 5GJ6A 4M3CE 3QLQA 5FPAA 2XUMA 2HWD1 3H1MA 3IPVB 1I6XA 4UF0A 1MEC3 4YVWB 3U75A 3WUCA 4QX7A 5A7WA 2VW1A 4U2AA 4BLIA 1HLCA 3AXDA 3MEPA 2QQUA 2ZS6B 2TEPA 2RMU1 3CDZB 3IAQA 1LGCA 3A7QA 1N3PA 1GQHA 2LRPA 2R6QA 3WCSA 5J7MA 4H2AA 1AXKA 1CAVB 3ZSJA 2DFCA 2OZ6A 1W2AX 4YW4A 4B8EA 4BE3A 4E8DA 2VMFA 2A7AA 4B29A 1YJKA 1RL3A 2DBNA 3B3QE 4GZ9A 4Y33A 1IS5A 3MIBA 1DYOA 2JJ6A 2YC0A 2EF6A 5FZ6A 5SV5A 4XFHA 1UL9A 3VBOB 3UJOA 3WNNA 3AZYA 3WG2A 1LNSA 4QMAA 2UY8A 3L9JT 4QQOA 3OBZA 4CZSA 2YU1A 4ZU4A 1UW8A 1ZZ9A 1SMVA 2JKXA 3GJBA 4XDQA 4B1MA 2Z4FA 2HEYF 2CGNA 4RFRB 3ME2A 1ZZCA 3AYAA 1LHOA 1S0GA 3ZYFA 4FPKA 4AZZA 3MIDA 4TLFA 4XABA 2VZQA 1IG0A 2R063 2XWBB 2EAAA 3AKQA 3MF6A 2JDHA 4M4PA 5DAPA 3T2QA 4OFGA 5FR3A 5IFTA 4ATEA 4XJ9A 3T2OA 1LECA 2O8QA 3FBMA 4AI8A 1WLCA 2QQWA 1WCSA 4QPIC 1V00A 4IEYA 4CCDA 2BYVE 3F95A 3SHRA 4HSJA 5GZGA 2B7YA 4D8MA 1U5YA 2RS53 3VKNA 4XUTA 5I0TA 1S0FA 1W6OB 1X36A 5FPBA 4Y22B 1VBB1 1GP4A 1UU6A 3CU7A 4GMP1 1ZBE3 2AR6A 3RWNA 3SEEA 1WCDJ 5LEKA 2ZACA 3TBDA 4FTSA 2ZMKA 1S2BA 2QNKA 4Q4X2 1JYWA 4O7XA 4FTEA 4FVVA 4RQPA 3ZFGB 4CPBD 1PMIA 4DXSA 2EIBA 4LITA 4Z2WA 2JDUA 1HN0A 1GANA 2VQUA 1GU3A 1NCRB 2YGLA 3OYWA 4LUKA 3S0MA 3IWZA 2CWSA 2NZ9A 1BHGA 3T1MA 1PMHX 1KFXL 2ZAHA 2W92A 1CAXB 3M2MA 1BKZA 4HONA 4M3CF 1JYTA 2C5DA 1K5MB 1OD3A 4MSVA 2XJQA 1EYBA 1W05A 2DURA 5EQUA 1ZBA3 2YU2A 1I9RA 4IEUA 4XFBA 2EA7A 1OQEA 2EIDA 2JDZA 4QXCA 4CSWA 2QQIA 4LQRA 2QDNA 3E5QA 3Q8CA 4BK5A 4GJYA 3I54A 2W47A 1FPN2 3H7YA 4XJ8A 4XW3A 5JXHA 1OUXA 1YFYA 2R0HA 4IEOA 2Q8OA 1MZEA 4FOYA 5IT6A 1ZVFA 1IS4A 2RDQA 3AMHA 1QOSA 5AVPA 3ACHA 5CG9A 2NPIA 2EAKA 1QXPA 1RUF3 2TUNA 3ELNA 3FLPA 2JEMA 3NV1A 4TSVA 4XBNA 3CEWA 2X5IB 5FREA 4XAEA 1HB1A 4OQ9A 1FV2A 4LULA 4LUMA 1PVC1 3P6BA 4LO5B 5A6ZA 2ZHLA 1PVC3 5IJRA 5F6LB 1L7RA 1L7QA 1VB4A 1ZYBA 3LSEA 3OB8A 5DZGA 3CNAA 1JBCA 4CU7A 4QXHA 3WNMA 2ARCA 5JIAA 3SITA 4EN9B 1LCLA 4F83A 2YDEA 1G7YA 3MLJA 2ZEYA 4KGQA 2XQXA 4ISRA 4WVWA 3WF4A 1K5JA 5F9TA 1EV12 4Y5TA 3I4IA 2D6OX 2VULA 2YYOA 3IN9A 1DF0A 4Q4X3 5F3EA 4JHZA 2EXIA 3DXTA 3WW2A 4CXXA 2CYFA 4N9IA 1J3QA 1W6OA 4B4RA 4FPGA 5CNAA 4RR3B 1B35B 1PVXA 3HN3A 1CESA 1YCIA 4HN1A 4ZU7A 5IVEA 1JZ7A 1BMV1 1MS9A 1PGL1 1RUG1 2VJXA 3WF1A 4QX3A 3HT2A 1TG7A 3OPTA 4UFJA 1OF3A 2PAMA 4GH4A 5H9SA 2BQPA 4M3CA 5TSWA 2W52A 4W6YA 5CKMA 2JB4A 4QB2A 3KGZA 5K7PA 3QBQA 1AF9A 1ZBA2 1H9PA 1N1TA 1E57A 2X10A 4QPIB 3I8TA 4QQHA 2WAOA 3DL3A 3MUZ1 3TN93 1AL21 1GNHA 3LDKA 3QCWA 2OW4A 1F5JA 1KITA 1LGNA 1Z7S1 1WLDA 3AKTA 2OVUA 2Y6JA 3WDTA 2VZVA 4GIQA 4R52A 3VGIA 3B00A 1ACCA 1QXRA 3VBRA 4CEWA 2W87A 4NJ4A 4ASLA 3AM2A 2VZPA 3I59B 4MGIE 2X53S 1ND2B 4GWIA 4JRAA 2C9AA 3FFQA 4Q4Y3 5FZKA 3WG1A 1Y7BA 5EZWA 5J48A 3S5AA 3AVSA 5E16A 4LA2A 3NV4A 3PL0A 1O5LA 1UMIA 5KC5A 1UY1A 1FNYA 2VMEA 3NNGA 3N7MA 2DU1A 2VNGA 3VN4A 1PVC2 5IVYA 3PNAA 1IQDC 2HWB1 3GM8A 2Y26A 3HIFA 1BVP1 4GKXA 2E7AA 3VHPA 4S2FA 2VPVA 4YVSC 3O1SA 3BUCA 1DDLA 2JIJA 4GWNA 1S0EA 4GH4B 1QY4A 1EP0A 1SBEA 3I3BA 1O4YA 4PF5A 3VDCA 2EIEA 5DAQA 1EAH2 4N43A 5BNOC 5C4WB 5A3UA 5FLHA 3L2YA 1UOFA 5IK7A 4IE7A 2HEWF 4AEDB 1GNZA 3UKVA 5AFBA 5FDBA 1E5RA 4A3XA 2AACA 1OQ1A 2FCTA 3AVRA 5F7UA 4PBOA 4D94A 2Y6GA 1UOJA 2E32A 2WR9A 2WZR3 4FPJA 5GM0A 3VBHB 1W03A 1H8TA 3P5BA 1TMF2 3VD3A 3R4UA 3FHIB 4WZCA 3I3DA 1F9KA 5LATA 3MV11 3K4AA 4JCKA 4NR1A 4KWLA 4OHVA 1N3OA 4YZ2A 1Y9QA 1NQJA 2BNNA 1XNAA 3ZMNA 4OCTA 1GWMA 5FTTC 5KHIA 4WVMA 1X7NA 5FY5A 5FLIA 3ZYJB 2PFWA 2PYTA 3VD9A 5KBFA 1UY2A 4FSJA 3OGJA 1NA1A 2WS92 4PT6A 1GMMA 5JZGB 3RZZA 5HI0A 2VZ1A 2Z69A 1D0GA 5FY8A 4CPBA 1PM7A 4YGEA 2WIIB 1YFWA 3WOGA 4JDOA 3BN6A 1J3PA 3NMBA 1H8VA 1QJEA 4RHV1 4XFFA 4BZ4A 3LD8A 4L0PA 1H0BA 2R062 2Z42A 5I8TA 4LBQD 1LKNA 4A6OA 1EAH3 2J1RA 1MZ5A 2JG8C 5A1AA 2R32A 2XG3A 2BZDA 3N9PA 2GC3A 1E5IA 4IEZA 4GD4A 4LPLA 4AAXA 4BIOA 5A33B 2PLV1 2BW8A 2QQMA 1FNZA 1SLLA 1LOBA 3FUQA 1F8VA 1ND2A 3OF1A 3CIHA 3D0SA 4K1ZA 1JZ8A 4K1YA 4HVOA 1ZRDA 5FO8B 3M3QA 2DFBA 5JOXA 2WZR1 4XF0A 4ATFA 3AKRA 2IXCA 4IETA 3CO2A 1TQ5A 4AVSA 1BLZA 2VVFA 3HD8B 4JX0A 1W2OA 4QT6A 3AP5A 3DECA 3AP6A 2IFRA 1KXGA 4LORA 2XDVA 4BH9A 4MGQA 3BPZA 3T3YA 1REFA 5KWRA 3RGBA 4R9AA 2WYSA 4BQ4A 1GWKA 1CZSA 2GP5A 2Y34A 1ZNPA 3I97A 4CCLA 2FDHA 5FZ9A 3PVNA 5DG1A 1ENQA 1VRH1 4Y20A 1WBLA 4FXGB 4LKSA 2VBPA 2OQ7A 1DFQA 1IS6A 3VBFB 1RUE3 2WS93 3LGRA 3M8LA 3CJIC 1ND3C 4XJUA 3ZDSA 5ACA2 3V0BB 5BNNB 2W08A 3HJRA 4YM0A 2I45A 3MV01 4Q4X1 1UWWA 1YQ2A 4P00B 1IZ3A 2ID4A 5A6YA 4D0QA 2Y0OA 1LR5A 1XQNA 3BIWE 1W99A 2R043 3T30A 4DEQA 4Q8KA 5A7NA 4Z2AA 2D3PA 4BK4A 1PNGA 2C4XA 4OULA 2R041 5I0DA 5CFCC 4KBBA 5EXOA 4CP9B 2ZGSA 2HWF3 3GCXA 1LODA 3BIEA 5FZ4A 2RR12 1C4RA 2Y6KA 2HWF1 3DPRB 2HEVF 4CU8A 1T2XA 2ZBJA 3RYPA 3RNSA 5JAXA 2WNVC 2R30A 3R4SA 1BXHA 2PAKA 1UKGA 3LIHA 1W9YA 5JOYA 2DCKA 4XAAA 4M0NA 1J1TA 2WL1A 5I0UA 5GLZA 3IBMA 3WNKA 4UW6A 4YGCA 4RQPB 3ZFGA 2JD9A 1O5UA 3AYDA 4UI9L 3C8XA 4BMEA 3WG3A 2PAEA 1CQ9A 4QPGB 5LRRA 2XB6C 4LEJA 1QJU2 1IKQA 3VL8A 5C71A 4AF9A 1AR81 1ZBE1 3DV8A 1W8WA 2YG0A 4QPYA 3ZN4A 1RMU3 4CEYC 4N53A 2BFUL 2JDPA 1UZVA 2R071 5K0UB 4C91A 1J59A 1DYPA 1KEXA 2GMEA 4FQ4A 3O7OA 4N53C 3J8F3 3BTYA 1BBT1 3PUSA 2A6XA 5JSRA 1S0DA 1TE1B 5IWFA 3OSDA 5FMBA 3VDBA 1BVVA 1A78A 4PI0A 5FZOB 2HH9A 3MDPA 2V72A 5KHGA 5A3PA 4LBQA 5HXMA 1C8M2 1MS8A 2ZMLA 3UNPA 3A0NA 4HFSA 3FFZA 1JMUB 3VKOA 4YM2A 2E7TA 4XF9A 3GZAA 2D44A 3I2KA 1G9BA 1W0PA 3POEA 5FY1A 3N9MA 1HB4A 3AKSA 3KT7A 1GSLA 3WNXA 3N9OA 3IIIA 1X82A 2CDPA 3CBNA 4Q4Y2 1ALYA 2Y6FA 5CFDA 3VD7A 4A42A 1QGLA 3OCPA 4LHLA 2F6BA 3LA3A 4AYUA 2J22A 2GDFA 4GJZA 3B94A 2ORXA 4XUPA 4AW7A 3RZHA 1XNCA 1YNAA 3RPQA 3C7GA 1NAEA 4XZPA 5FZOA 5IVBA 1LJ7A 4XACA 3H8OA 1ZRIA 4XYXA 2BOIA 5C3OA 5C3QA 1S2EA 4FFIA 5A6XA 3IMNA 1V9U2 3NJXA 3WY6A 4COVA 2F4PA 3BYWA 4TN7A 5FP3A 3ES4A 5FZ8A 4CP9A 4NIHA 3BKZA 3SCFA 3APBA 3HPNA 4FFGA 3KGLA 4ZKTB 2ZAAA 2RJLA 4CDWA 1RJ8A 1QJU3 5JPMB 1VE0A 3BTZA 4JGYB 4XURA 1W39A 4HOOA 1N1VA 1QU0A 3ZKYA 3JD73 1RMU2 2G9ZA 2HWE2 1RYYA 2XVGA 3HBZA 1W8HA 2C6SA 1NKGA 4CDXC 5LCWL 4JGZB 4XUNA 1JZ6A 3N3HA 4NIGA 3ZX7A 4KMQA 2QVSB 4S2DA 4HK9A 4CDXA 3AMMA 2NYYA 2OX0A 3J9SA 1K3IA 2VL4A 3E97A 3K77A 3VDDA 4QU2A 4O65A 2GH8A 3WW4A 2P3JA 2R7EB 1JODA 4UFLA 1W2TA 5FY7A 3VBSB 1S2KA 4AFDA 5L7OC 4FPLA 3RZMA 2DWRA 3RDIA 2CGOA 2XGXA 3H7JA 2BVBA 5FYZA 1GV9A 5D8AB 5FP9A 4CUAA 5JLVA 5KXDA 1PO11 2WDBA 1SQ4A 2R0FA 1DGWX 4JGZA 4I0BA 1AXZA 4URTA 4NIIA 2D97A 3WQ1A 4YSFA 2WSVA 5CEHA 3DKWA 1CX1A 4KG0A 5FYCA 2WINB 2WKKA 3B9IA 2W94A 3PTYA 2FCUA 3FE5A 4Q26A 5F3IA 5T55A 2NN8A 3P3NA 3WF2A 1CZVA 5A7SA 1WCUA 1RXGA 3MICA 3AKPA 4Q4Y1 3MUY1 4DUVA 3ZR5A 5DDJ2 1PGSA 4AXOA 4QWNA 4QKNA 2JDAA 1V6KA 4YLZA 1JYVA 1XOYA 4OQ8A 3ZSMA 2ZGQA 1LEDA 2K0GA 3ZFEB 4S2HA 2I07B 3I2GA 2P2KA 1V9U3 4AI0A 5FPXA 5C70A 4BQ1A 1SCRA 4COZA 4EWAA 2DYCA 5F3GA 5LB6A 4XPVA 2QKDA 3RI9A 3ACIA 4ARYA 2DUQA 2JENA 3TWIA 2E33A 2VBBA 1ZZ7A 2DUOA 4L97A 2VUJA 3B69A 5FV3A 4ASKA 1C5IA 3IDBB 3JD72 5IK5A 1AJKA 4OLLA 2NMOA 1QJY2 1XNTA 2W1QA 4LBOA 3MIGA 2VOTA 2PN5A 2VZSA 3J7NA 4AHZA 1G9DA 3VBRB 3HWJA 2E31A 4ZS2A 1QIQA 5KHKA 5LW9A 2FDIA 4Q4V2 4QGMA 4C0HA 3NAPA 4YWAA 3POBA 4JZRA 3O1OA 2CSGA 1UYXA 1SPPA 1R083 4QM8A 3NVCA 3WP3A 4MGYE 2E6VA 4HXCA 1RUD1 3RZGA 4MG2A 1R1A2 2Q4SA 3FC0A 4PHZA 4X8PA 5LBEA 1JYXA 1MQTC 2VCCA 2DCYA 1NCQA 2PQSA 2DCTA 4I0WB 4IV1C 2BBAA 4OUEA 1AR62 2HYXA 2QZ2A 3ZR6A 4W65A 2ZX0A 2H0VA 2IFWA 4QX1A 3T08A 1PZ8A 1OF4A 4R8HA 3SMHA 5KXCA 2BWAA 1W2UA 4XMIA 5JZGC 4G4FA 4WZFA 4WVZA 3IDEA 2RV9A 2RDSA 2P37A 2R16A 4YW6A 1PX4A 1RUOA 3P1IA 5F37A 1NXMA 1NA1B 4QPGA 4SBVA 5I91A 4A2UA 1ZRCA 4NRMA 5DDJ3 2F17A 1MEC1 1E5HA 3VDDC 2Y8KA 4ES8A 3KS7A 4WVMB 3PJYA 1QJX1 1VBD2 3DXUA 1WGPA 5C4WA 4AVCA 4BIFA 2WZ8A 1A8DA 1Q56A 3WNOA 1B09A 3AX4A 3M3EA 3T2TA 3VBSA 3WF3A 1AHSA 2Y38A 2ZEXA 4AQ2A 1X8EA 1STMA 4AVBA 1YHFA 1Y4WA 4INDA 4RGGA 2PHTA 1MPXA 3GGLA 5CVRA 2QQNA 4WM8B 1HQLA 5FYBA 1DCSA 4BQYA 3ZSEA 4P9LA 1CAWA 1L7LA 1UMHA 4Y1XA 2KA3A 3VKLA 1SZBA 4CCOA 1IG3A 4G3YC 3POGA 1AR93 1PIV3 2FMDA 2B9UA 1Q8OA 4JQTA 3SH4A 2QQOA 4KNCA 1PGW1 4OZXA 1H6YA 4UFHA 2BDRA 4XEZA 2QUOA 4IW3A 3HNYM 4QU1A 1LHNA 5FP8A 2A1XA 5BNNA 1UQXA 1WD4A 2CGPA 2WQ8A 4EN0A 1U5XA 3CKHA 1WUVA 3WP6A 4PLOA 1E5SA 4LBLA 4O9GA 4QDQA 2Y60A 4YZ3A 2KXLA 4OI0A 2XLAA 1H9WA 2RM23 3WT3A 3UV9A 1VAMA 3Q8AA 2RR11 5BV6A 5CFCB 1C3HA 4JVAA 2RM21 3ZN6A 1D0HA 4CUCA 5F5IA 1S4CA 3QOPA 2PHDA 2VMCA 4LTAA 2ZGMA 4BQ2A 3R4DB 1VPHA 1VRH2 1M4WA 1W2NA 1NLSA 2W1UA 4ZY9A 4PI2A 1RC6A 5GZCA 4MH0E 4OHYA 1JI6A 4IV3B 4NAMA 2GC0A 4P9WA 1RUC2 4E4SA 4XUOA 2BGOA 5F5QA 2DVAA 1HQNA 2VCMA 4N7UA 5AC93 4UBHA 3H1YA 4ZHNA 4A6SA 4LO7A 4HLTA 2JB8A 4K6BA 1O7FA 1H2KA 4DFSA 3E5UA 3N35A 2G19A 3VKMA 5C9AA 5A32A 4HKOA 2BU9A 5IUQA 1WWYA 2QQVA 5FUIA 5T54A 4N43B 2ILMA 3E6DA 5GLWA 1LHVA 1EUTA 2O0OA 1W6PB 4QDSA 4P9GA 4DUXA 4MOAA 3ZIWA 3W5MA 4V2VA 2B4KA 3WQBA 3DYMA 1NE6A 1W6PA 1HXS2 1ODNA 2Z79A 3N4MA 4YVSA 2P3KA 1Q43A 1KRIA 2A73B 1N1YA 1HV0A 3W9AA 3D5OA 5GLTA 1ASJ2 2N7GA 2OA2A 2XR4A 3C7EA 4NHMA 3JZVA 3LDRA 3MFCA 5IFPA 1OPMA 4LKEA 1QQP2 1XNKA 3EXUA 3PVOA 1EV13 1PGW2 4ZU5A 4AI2A 4L99A 1RXFA 5J1XA 4E2QA 2GSYA 2YC4A 1Q8SA 4H3WA 4KWJA 4CEYB 1GKBA 1ZA7A 2JDNA 3IZOA 2ZX1A 4CYDA 5E8AA 4RN5A 3LFIA 4PQQA 4DUWA 1ENSA 5FY4A 4F3JA 4P08A 5C5UA 1W3VA 3JUUA 4E9KA 1O59A 2VMHA 1QJFA 3A22A 2XJRA 3PUHA 3HMYA 4HANA 2XHKA 5DAWA 2XH6A 3O1RA 3DCQA 2ZGUA 5DZEA 1VRH3 2JE9A 1JZ4A 3O0WA 1UX6A 1Z7S2 4QDRA 2OPWA 1O4ZA 2X5IA 3ZVXA 3VZMA 1XYNA 2FZ2A 3VZLA 1REDA 1NLRA 2O14A 4B1LA 1ND3B 5LA9A 3RS6A 2Y6LA 1SDDB 3OY8B 1XNBA 2ZHMA 3OGVA 3H50A 5K4LA 4TZDA 4P14A 2ZGRA 1K45A 3K4DA 2VCAA 4M0HA 1GQPA 1I5PA 3I2OA 1YIFA 2ZJCA 4XQWA 5BPXA 3RRDA 3VBSC 5HV4A 3ITQA 1KS4A 1NA1C 4BCUA 3JBG3 1MACA 5FK7A 2ZHKA 4Q1PA 5FKBA 2C24A 4NWVA 3DUIA 3UGHA 5FYHA 3JBG1 1MZ6A 2HWB2 3EYPA 3CL1A 2ZOEB 1VBA2 2AUYA 3W5NA 3O1VA 1PK6B 3P3PA 2P4EA 3MW4A 1OD5A 1UU5A 1RUJ1 2EXJA 1S0BA 2FMYA 3M3OA 1CAUA 4ITCA 4BISA 1MQTB 1CR7A 1H4GA 4B4PA 2B9VA 2GAUA 2RJ2A 2DVBA 2EXHA 3S5QA 5A32B 4YARA 2HWC3 3ETPA 5JXJA 1SFYA 3ZYPA 1G9CA 2A70A 3UGFA 2SBAA 3I2IA 5FMOL 5HPOA 3THDA 3H0OA 3Q8FA 2VUCA 1ONAA 5FXXA 3PIGA 5JXGA 3TNQA 3NJVA 2GN3A 1SDWA 3PURA 3VBRC 5IVJA 1IS3A 2WC2A 4YZ1A 1KDKA 4DQAA 4YVSB 4UFKA 3OBTA 4H55A 3SNMA 3PHMA 3K48A 4CDQC 2PHRA 1W8OA 4QPIA 5T5JA 2LW8A 4Y26A 3ZN6B 4LO6B 3GNEA 5T3NA 2Q8EA 3RYRA 4I0AA 4KI5M 2Z5WA 1AR63 3HOBA 4CE8A 4XMAA 5FZ0A 2OIIA 2BTVC 2PLV2 4R9BA 3N9QA 3ZO0B 2ZA9A 3LAGA 1HRV3 2OQ6A 4NHKA 1CJDA 4FPFA 2WJSA 4XHBA 3ZYRA 3POJA 5CU1A 1GP6A 1LU2A 3VHNA 2VQTA 1W9SA 2GMPA 2DTYA 4OI4A 1QOTA 5FYUA 1YQ8A 2EXKA 1BCXA 3DEMA 1JU4A 2RHPA 5ABJB 3PU3A 1F4AA 4DB5A 1HQWA 1W8ZA 4LA3A 3AZZA 1CAWB 4WM7A 4FPEA 1OUSA 2QQPA 3D6EA 1RUD3 4A7YA 2CU5A 3ACGA 1Q5OA 4AVVA 2AREA 1FMD2 1G9FA 1O8SA 4PIYA 2XJTA 3VZNA 3MFAA 3SXWA 1VBC3 2Y64A 2AH2A 3C3VA 3J7MA 4AFMA 2P34A 2XQRA 2I74A 2D43A 3B7MA 2KM2A 2WLQA 3MPBA 4UT5A 4BMBA 2PXJA 2YB7A 2VG9A 3K3NA 3SKJE 4BJ0A 4KU8A 3BVCA 5A70A 2H6BA 3VZJA 1BK0A 4DIQA 3NQHA 2VU9A 4AG4A 2JG9C 3E6CC 1COV3 2MEV2 4GMP3 2A71A 4UW4A 4UXAA 1LHWA 2FQPA 3RSJA 4AAPA 2NQYA 5EWSA 2E7QA 4PIZA 1CD3G 1XSRA 3HNBM 4META 3NSTA 5EJ3A 4LOTA 4PLNA 1G8WA 1LOCA 4YW7A 4YW3A 2G9GA 1CVNA 4JGYC 4AR2A 4IEPA 2CV6A 4Q4V1 2OUHA 1H1IA 5A7PA 4NROA 3RVHA 4WM8A 5DAVA 2W3JA 3ILNA 4RQPC 4ASMB 3R0RA 4AHXA 1K5MA 1WMFA 3AMPA 2WBKA 3TEWA 5FBZA 1JYIA 1AYN3 1EPWA 2RMU3 4FPHA 3KCYA 3HVDA 4YG3A 2PLV3 4HPKA 2VD7A 4Y3OA 2Q30A 1IPSA 2LUWA 2PA7A 4NO4A 2BJSA 3WHTA 2VUAA 4EN8B 1N47A 3GHNA 5FMCA 5HV0A 2YBSA 2WAAA 1DGRA 1SG3A 3K46A 3MGUA 4D7TA 3HT1A 2AGSA 4R4ZA 4XTPA 4C90A 4Z92B 5L73A 5GLVA 5KXEA 1WCQA 1OXCA 1LRHA 1NOVA 3KHBA 1CONA 1K5MC 1IPJA 2R042 4QHBA 2HJIA 4P5HA 2B45X 3WW3A 2V4VA 1RUH2 3U07A 1H2LA 1CWPA 3GYDA 1GUIA 3PVEA 1W6QA 1AX0A 5DUWA 3MF9A 2W5FA 1LB2A 2HWF2 1P8JA 2GMMA 1R1A1 3KZ4C 1GZWB 2P1BA 4ORFA 2K46A 1AX1A 1MS1A
chains in the Genus database with same CATH topology
1YXWA 3ZXLA 4LBKA 3WDUA 2A6WA 4RR3A 3BOWA 1C1FA 2NM1A 2WFF1 4ONUA 4MVTA 1ASJ3 2V5YA 1VAVA 4BOWA 3OTFA 1NZCA 3A0KA 1ZBE2 4FCAA 2A3WA 4GA9A 3ZIXA 1WLWA 2PHUA 3ZFFC 3UJQA 1LHUA 2R072 3WQ0A 1HRI2 2BFUS 1RITA 3MYXA 4L2NA 4YNIA 2YZ4A 2D6MA 2DCJA 1FT9A 1TNFA 1DU3D 3D8CA 3W58A 2IXLA 4LT5A 3IM0A 3RG0A 1AVBA 1AYN2 2RMU2 1HXS1 5CFCA 4J1XA 1UD1A 3M1HA 1Q3EA 3LA7A 4FT8A 1Z7S3 4U36A 1HKDA 3V64A 3ZFFA 3G7DA 1O3RA 3UKTA 1XNDA 1VBB2 1RMU1 1BJQA 3QACA 3V56A 5T5LA 1MZFA 2HWD3 1YYNA 4XFGA 4HPKB 3CF6E 1C1LA 3CJIB 4XHXA 1N1SA 2XBO3 2YY1A 3MW2A 1OQDA 5BUVA 2VOKA 5JPNB 1V9U1 1VBA3 3AXEA 4LR4A 1PZ7A 5LRSA 3ZXAC 4B3NA 1O3QA 4FAHA 2WA3A 4NOTA 5CFDB 2IWGB 3LOIA 1VBE3 2Q5TA 1IPKA 1FV3A 4LNVA 4X6QB 1DGLA 4JGZC 4W6XA 4OHZA 3FWEA 3VBUC 2E53A 1FI2A 3SH3A 1QH6A 2CL2A 4XIOA 3LA2A 2ZZQA 3QH6A 1MS3A 1SLAA 2A6VA 2ET7A 4AQTA 2ZCWA 2EVXA 2ZGTA 1WMEA 3H3UA 2P3IA 4HN0A 3B01A 4H7LA 4R9DA 4Y1VA 4IEXA 3DF0A 1RUG3 2D40A 3ST7A 1ENXA 5T5OA 3V0AB 2GH2A 5KC6A 1OSGA 1ND2C 2V09A 4DPNA 4Z07A 1SLBA 4I02A 4AHYA 1DHKB 4IEWA 4DRRA 4AQ6A 4KQ7A 4AFAA 2I2SA 2NLRA 3EJKA 4K8FA 2D5FA 4FAGA 5C6CA 4F8AA 1QJY1 3WDWA 3MPPG 3B02A 4FOVA 4JV4A 4XIKA 3KT1A 1NXD1 3ZXJA 5J09A 4QD2A 5I0RA 1LOAA 2R1BA 4NHLA 4Y5Z0 1I1EA 5JI9A 1RUD2 3J8F1 4EWDA 2IXIA 1H2NA 5A3LA 2WQ4A 3PMEA 2Y0IA 4RR3C 1V6LA 2RS31 1D4VB 4L92A 5BYNA 2VH9A 2D6LX 2W0XA 2UU8A 3EO6A 4AWDA 1XU1A 4FPOB 2DF7A 4K40A 5K0UA 1XE8A 2WFPA 1S0CA 3D82A 4XBLA 4PDWC 3U0ZA 1UPIA 3EHKA 1AR91 1S0JA 5FPZA 3WLUA 1RHI2 2Q1MA 3B9CA 2RJKA 1QJZA 2O8OA 1R093 2ZX3A 3INAA 5FQ0A 2NP0A 5EFUA 4BA6A 2XWJB 2WSUA 1RB8G 2D3RA 4JDNA 3RMYA 1UMZA 3JB8A 4QGNA 5GKAC 4AI1A 4SLIA 5JOZA 1FMD1 1DQ4A 1RUG2 4B7KA 1WW4A 4FXKB 4Q4W1 1UZYA 1DQ0A 1AXYA 2AZ5A 4LHNA 3DPRA 3B5LB 1R1A3 5CFDC 2BVVA 4XF3A 3U4XA 5H9RA 2BBVA 1AJOA 2C0ZA 5E89A 1TME2 2GNTA 3ZN5A 1COV1 2IC1A 2VVDA 4GQ7A 4YM1A 1IGOA 4HSLA 1RTVA 5ABJA 2SLIA 5FOBB 2D6KA 5EYYA 2VMGA 2EALA 2VQ0A 4WBBA 4AVTA 2RS13 4AEJA 4CEWB 4CDWB 4LBMA 1LGBA 3Q9OA 4EWEA 4OHWA 5FMOS 1GLHA 5AFEA 1DYKA 4Y4YA 1VBD3 1NCRC 1SEFA 1RUH3 1R081 4QQLA 1YRZA 1D4M1 4WV8A 3ZFGC 4QM9A 1F5FA 1C28A 1VBC1 4AK3A 5I8SA 1LENA 1JW6A 2ZGKA 1NCQC 4IERA 4M01A 3VHRA 1PO13 4MGZE 3T1LA 1IOAA 3AMQA 1MS5A 2ZKLA 1WA4A 1F2NA 1AR92 3KM5A 3FMGA 5JZGA 4XXAA 3USUA 1H1AA 4EROA 3LSDA 3VBFA 5H9QA 2K2SA 1LU1A 1RUNA 4QX5A 1BZWA 3AP7A 1ZA4A 2R073 4IV3A 1MQTA 5EYXA 5T50A 4XF4A 1W6NA 2RM22 3JQXA 1KS5A 4YYOA 1SLIA 1PK6A 4MXWA 5CBLA 2JICA 1V6MA 1YLLA 4KL1A 2D5HA 3MLKA 4UBGA 4K3UA 1ASJ1 5E88A 3AK0A 1VBE1 2XVLA 3RI8A 5ACA3 1AYM1 1GFF2 2OZJA 3AB0A 1RGSA 2X5IC 3VL9A 3NAPC 3H1WA 1I5ZA 1UPSA 1LEMA 2QFEA 2HYKA 4AFBA 1ULDA 1X50A 2XLGA 1HW5A 2LTNA 3OPZA 3KQRA 3NKGA 4GALA 1G86A 4FOQA 3UL2A 5LEJA 2VW0A 2UWAA 4MGKE 1O3TA 3LKJA 2XBO2 5FFOC 2RR13 3ENRA 5BNQA 2JE7A 2ET1A 3VBUB 1JXNA 3FJSA 3WX5A 1HX6A 1POV3 4EN7B 1YI9A 2BNMA 3ES1A 1BK1A 1NQDA 1XRUA 4P9IA 1QQP3 2E9QA 4XILA 5AC91 5HCBA 4E2GA 3AP4A 1LOGA 3GBWA 1PGL2 5L7OA 4NPRA 1GBGA 1CAUB 3AYCA 1SLTA 1J58A 4AEDC 4DY5A 2ES3A 3WDXA 4I01A 4PDWB 3N7KA 4HZFA 1A3KA 4MX3A 4DZGA 1BEV2 1EY2A 1ZBA1 1V6NA 3IT8A 4GH4C 5ABJC 1W6NB 3E6BA 3PVBB 3H3ZA 1W6MB 1FOD1 2AENA 4XOGA 1C8M3 2H0BA 3ZMOA 2OPKA 5BXXA 5DZFA 1EV11 4DY3A 1SCSA 4XJWA 5ACA1 2QJVA 2D7FA 1AL0G 4RGAA 4XFAA 5JSOA 5J96B 4HBNA 4AEDA 5CADA 1DG6A 1AR82 1OA3A 3JBG2 1HRI1 1SBFA 3WVJA 4GMP0 3CLPA 2P17A 3K51A 4BHPA 1J3RA 1QNWA 3TYJA 1L3JA 2UY9A 3LCPA 4COYA 1NCRA 4OI2A 4CDUB 3WXPA 3GALA 4XFIA 5JVVA 3AJYA 1HRV1 3U10A 5C9AC 1GICA 3AZVA 3E5XA 4A7KA 4CDQB 4L8QA 1DQ6A 2XJSA 2PQQA 2UWBA 4IEVA 3POWA 3FX3A 1KJLA 3FUOA 4Y24A 1Y43B 4RHV3 3ACLA 1ZZ6A 4KWKA 1NCQB 3AZWA 1HDKA 4JDMA 3WDYA 1GZWA 3ZXDA 5JWPA 1NY71 1XYPA 1AR72 1JH5A 1W6QB 5SV8A 4RD7A 3HQXA 5T5PA 3TN92 1C8M1 4V1PA 2ZHNA 1HV1A 4DS0A 1PK6C 3SLIA 5DXDA 3ASIA 1TME3 1YFXA 2MEV1 4COWA 2HWC1 4N9HA 1X8MA 5BNPB 4NWWA 3GBGA 4JTOA 5C8WA 4DMIA 1RVF2 2BWCA 4Q4W2 3GZTB 5J3UA 2DVFA 3LWCA 1CAVA 5DUVA 3MZHA 1QH7A 5GZEA 1FMD3 1JN2P 3OD4A 4FPCA 1S0IA 2WT2A 4RL7A 3U11A 2JKBA 4GXLA 3GBFA 3B93A 2JD4A 4E27A 2QDRA 2OYZA 4L9BA 3G6JB 1UKRA 2ZZJA 1DGWA 2XJVA 3URFA 3WV6A 3ECQA 3LOBA 1M06G 3S7IA 2WZR2 1R091 4Q0UA 4Q0PA 4Y22A 3ZFFB 3NW4A 2B39A 5FLJA 1U12A 4J6GA 2XKOA 1NG0A 4RHV2 4YW5A 2ZTNA 5C8CB 5KHJA 2IZWA 1R082 4YM3A 2JG9B 1UU4A 3NV2A 5HCFA 3O0VA 1PZ9A 2XJUA 1I3HA 2W39A 3KCCA 3R6SA 1CPNA 2ZPXA 4HVQA 3VDDB 5JMCA 1ZREA 3N7JA 1CPMA 1WD3A 2G9FA 3KLSA 3TN91 1SLCA 4MV2A 4BYYA 4YW2A 3MIFA 2PHFA 2FZ1A 1MS4A 1TME1 4XE9A 1Z78A 2A6ZA 1QWRA 1RHI1 3FLTA 3M4FA 2B46X 3AZXA 2ARXA 1RVF3 4AFCA 4ISQA 4BWOA 3JB4C 3FZ3A 5JSPA 3KT4A 3VBOC 1G6NA 4DXZA 4GKYA 3RJRA 2BNOA 3OGGA 5FAXA 1NE4A 4GB32 4PIXA 5JI7A 1DQ5A 1AYN1 1S1AA 4P9XA 3V0AA 1QF3A 1PNFA 2UYAA 4XXPA 1QXJA 1RJ7A 4LLFA 4C1WA 3NKTA 2WLPA 2A75A 4YW1A 2WFF2 4NN0A 3DGTA 3FLRA 4AHWA 4XQ4A 1KDMA 1KFUL 1APNA 2GZWA 2YHJA 3VBOA 4Z1VA 1C57A 4DRVA 1U5ZA 3ZSLA 4HETA 4RS5B 2HKXA 1MEC2 1HRI3 4KGGA 3NWKA 1RUI1 3ZYGA 5K8SA 1J1LA 2W68A 5A3MA 2XBO1 4AQSA 1JHNA 4IV1A 1G9AA 2DVGA 1CAXA 3WG4A 3GF6A 2CTVA 1LESA 4YG0A 1OPOA 1MVQA 1X33A 2DCZA 3KMHA 2JG9A 2ZX2A 2B8MA 2RS51 4PQ9A 4IEQA 2A5ZA 1LULA 4WM7B 3PLQA 4RS5A 3IDCB 3GZUC 5CG8A 3VBHA 3BODA 1KQRA 1Z0HA 5FQ0B 2YV8A 3O0XA 5AC92 4RA0A 4CDQA 1QDOA 1VBB3 5D8AC 2BUKA 4O9EA 3TRSB 1TEIA 1GZ9A 1WLTA 3NL1A 2JECA 2C1FA 4W6WA 1PO22 2ZKNA 2HWD2 3JQWA 2UWCA 1ZZBA 3S7EA 1JOJA 1QKQA 4WVVA 4NVPA 2ETEA 1OOPB 4OHXA 1LOEA 4XF1A 1FOD2 3D0JA 4CDXB 3AP9A 1HXS3 4KU7A 1SFNA 3M70A 5F1RA 3POYA 2QE3A 5KXBA 1YJLA 5CIRA 3ZXEA 1VBE2 3WW1A 3AMNA 1RUC1 2A3XA 1CJPA 2FHRA 4R4XA 4AI3A 2ERFA 1ZM1A 1FX5A 1Q8PA 3ILFA 4Y1UA 4YG6A 5J98B 3KD4A 2O1QA 3BU7A 3USSA 4Q0SA 5KHHA 4HMZA 1Y3TA 2A3YA 1YWKA 1GR3A 3J8F2 5H9PA 1UF2C 1KD7A 1OFSA 1BYHA 3AJZA 1REEA 2CY6A 4L11A 3WHUA 2R1DA 3ROUA 2E51A 1NYWA 2VOVA 1JUHA 1YFUA 1ULGA 4H7MA 1UCXA 1OOPC 5E1RA 1IQAA 2XL9A 4UW5A 2PHXA 1FPN3 1ULCA 2ZABA 3HR9A 2JG8A 3RMXA 4AEMA 5FRAA 1V70A 4AGRA 4CRQA 3LZZA 2OUJA 4N43C 4JRLA 3WR0A 5BNOA 3RQ0A 3BB6A 1D2QA 1U0AA 4N7IA 1PO23 3WZ1A 2K9ZA 4F7ZA 4K21A 3ZXGA 4TWTA 4D7SA 1PO21 4YRDA 4EN6B 3MIEA 4Q4W3 3UKNA 3VZOA 2RS32 1XE7A 4FQZA 3MW3A 5GZFA 1V6IA 4AGGA 2Q1ZB 3N36A 4WM7C 1H2MA 4P9YA 3VBHC 4E2SA 3BALA 1DBNA 3WINE 2GN7A 5L7OB 1POV1 3OD0A 1H4HA 2WA4A 3JU9A 4XFCA 2HWC2 2VOWA 2XJPA 5HXVA 4LE3A 4CEYA 1C8NA 1QQP1 2WNVA 4M00A 4WM8C 4XBQA 1DIWA 5DDJ1 1ND3A 2DUPA 2BEOA 2GALA 4Q27A 1QJX3 2QCSB 2ZGOA 2YUEA 4OVEA 2VNRA 1GYKA 3S30A 2PHWA 3UK9A 4K7JA 1H8TC 3EBRA 3ILRA 5HCAA 1D4M2 4C1XA 4MXWB 2A6YA 4PJYA 1AR61 1A6CA 2YGMA 1AUYA 1RUJ2 4ZXKA 2VECA 3TOJA 2VVEA 2WNUB 4Z8BA 2XLFA 1B35A 5CA6A 5BNPC 2YPJA 3X29B 4HT1T 1HRV2 2ZMNA 4LBNA 1AYM3 1QOOA 3H8UA 3ZSKA 3OBRA 1OLQA 3USUB 1T6GC 5BNPA 4HL0A 4Y1YA 4H14A 5JCTA 2RS12 2ZGLA 5DUUA 5AVAA 3WDVA 4MUVA 3J26N 4PBPA 4S2GA 4FBFA 1OHFA 5J36A 2WZPP 1OA4A 3PMSA 4LO4B 5A33A 3V65A 2FBEA 4DINB 4IV3C 4GB33 2DV9A 4CTEA 4KG8A 3SCHA 3LB9A 4FO9A 1VBC2 1FATA 4XJZA 3NO8A 4XQDA 1B35C 1NY72 4YGDA 1AR71 2UYBA 5T52A 3ZXFA 1VJ2A 4RFT0 1QNYA 4LO8A 1URXA 2H6CA 1H8TB 2X8KA 2WFF3 2VY0A 2GNBA 1MVEA 1H1MA 2TBVA 1QJY3 1YO8A 3OY8A 4XTMA 2QZ3A 3WQ7A 2TNFA 1TMF3 5I0SA 1RVF1 1QJX2 1VBD1 4Q4V3 2CNAA 4AVAA 3AYEA 1LOFA 3GHMA 1A8MA 1D4M3 2Q0AA 4YZ4A 1ULEA 4AGVA 1OOPA 1RUJ3 5FCCA 3M3CA 3KSCA 1WW7A 4YFWA 2VGDA 5FO7B 2ZX4A 3TNPB 1OI6A 2R49A 4CEWC 5CB7A 3ETQA 1UIJA 4CP0A 1AYM2 4C0BA 1V6OA 3O5SA 3I59A 4QGLA 1VAKA 3V0BA 4Q2FA 1XXNA 5L19A 4JQRA 5LK5A 3VLBB 3MLLA 3VHOA 2XKPA 5CAZA 2ZGPA 5DG2A 4BPZA 1XYOA 1GZCA 3L2HA 4PLMA 5JOWA 1WCKA 1JYCA 2D6PA 3KB5A 3BTAA 2RE9A 4EJRA 1FOD3 4D69A 4X6RB 4Q0VA 2CAVA 5I93A 1ZRRA 1AX2A 2MNGA 3NV3A 2XVKA 3SCGA 4LHKA 1VALA 2X29A 5C9AB 1PIV2 2BGCA 1FPN1 4IL7A 4Q8LA 1DZRA 5BY5A 2WNEA 2JG8B 1R1ZA 1WMDA 4B7EA 4JGYA 4KH9A 4IQPA 4YZ5A 5JDBA 4CDUA 4B4QA 3VBUA 1EPZA 2MHFA 2NMNA 1RIRA 1RUI2 4E4ZA 4E4DX 1SBDA 1BEV1 3AFGA 4Z82A 2ENRA 3THTA 2R061 5GLUA 3VUOA 2ARBA 4I3PA 1BEV3 1QMJA 3WD5A 4QQ2A 5I8YA 3HAGA 3RJ2X 3IPVA 4YVWA 3ZFEC 1RUE2 4R9CA 2E63A 5JR7B 4BM8A 3TB0A 1RUC3 2LALA 3AFKA 4LLOA 4FP3A 4X8NA 2VMIA 2VXRA 3HN1A 1Q8QA 1YIPA 2LM3A 2ZGNA 1RUF1 1POV0 3SISA 1LOFC 2GNMA 3M3IA 4XJAA 1W0OA 2WWSA 1AR83 3O14A 4IESA 5F6KA 1W6MA 4QXKA 2DVDA 4XETA 1OFNA 3BOPA 1HIXA 2D6NA 3SH5A 5K0UC 2WNUC 3WUDA 1O3SA 1VBA1 5FO9B 2RS33 4M3CB 1BBT3 2BPA2 4YVWC 2VOXA 3N7LA 3ZFEA 5K9YA 4P9JA 4K20A 2YMZA 3FBYA 2MPFA 3CJIA 2YROA 3M7AA 1CIWA 1DLLA 1S55A 2RS52 1QDCA 4LBJA 1O91A 4AEKA 4A7ZA 1JUIA 1PIV1 2VW2A 2CAUA 5C4WC 4I2OA 2JX9A 2WNVB 1OMIA 3OJBA 2JXAA 3W59A 3DN7A 1CGPA 2B5HA 2WNUA 2DU0A 1RUI3 4I09A 1CX4A 3ALQA 4QPGC 1Q8VA 1WW5A 1VIWB 4MLOA 4YFZA 1SACA 4GWMA 4TYSA 5EV7A 3VZKA 5IK8A 2VQAA 1VP6A 4Q29A 4Y1ZA 4IXLA 1AR73 1IKPA 4COUA 2D93A 3OYWB 4MYEA 1LTEA 2IXJA 2PELA 4CDWC 3NAPB 3DPRC 3VV1A 1RUE1 3RYKA 5L36A 3VBFC 4JTNA 3EQEA 3QD6A 4QQPA 1VLNA 5GALA 4G9SB 1DZQA 3I2DA 3NJZA 1QJU1 4JC1A 4K9SA 1AZDA 2WT0A 1ZX5A 3R05A 1DQ2A 1RUF2 4OUMA 4OUSA 1JTZX 4YGBA 1TMF1 1UAIA 1FAYA 2D98A 4Q0QA 2UURA 3PJQA 4AE2A 1V6JA 4HK8A 4JAAA 4ES9A 4FTBA 3S6PA 2HWB3 3CJXA 1BMV2 5BNNC 4DOUA 4Y20B 1BBT2 1D2SA 3VKFC 1N3QA 5IK4A 3H9AA 1FXZA 4D7YA 3C2UA 4FPYA 4IV1B 1EAH1 2DTWA 1QHDA 1OKQA 3WCRA 5HBAA 3IIAA 1ULFA 2XL7A 1PHMA 1OLRA 4CP1A 4GULA 1AL22 4N53B 2Z2SB 3WP5A 1KJRA 5C8CC 2AYHA 1RHI3 5C33A 1R092 2B42B 5DUXA 4CDUC 2HWE3 3A4UA 1MS0A 1FYUA 4RSUA 1IHMA 1UZZA 2GC1A 2HWE1 1OA2A 3BCWA 5GZDA 1O4TA 1WBFA 3KCXA 4FOWA 4LBQB 4GB31 2PTMA 2D3SA 1YUDA 3ZPYA 1UIKA 3JCIA 2WQZC 1DZTA 2YXSA 1CN1A 4J1WA 5D1IA 5LK7B 3ZXKA 4UW3A 3MIHA 5C8CA 3WP4A 4EV0A 1WW6A 3TAYA 4BLJA 4CP2A 1F31A 1BQPA 2GC2A 3THPA 4N90A 2WS91 2PHLA 1TNRA 4PCRA 3I7DA 1VR3A 2GU9A 4MXVA 1DQ1A 5B2GB 4OI1A 2CWMA 1U5IA 1GQGA 4DNYA 1ENRA 1DGRN 2RS11 1ZZ8A 1XU2A 4I30A 5D8AA 2V73A 3O12A 1RUH1 5J37A 2XPJA 2ATFA 2G4IA 4HVRA 3IKWA 1ZRFA 2VNOA 1UN1A 4FP2A 5JIUA 4Q1RA 1MR5A 2WT1A 3D4KA 4I3GA 1VB2A 4PDWA 2GNDA 1AL23 4D3WA 1PO12 1C5HA 3POSA 3J4UH 3ZYIB 4LE4A 4HKWA 1COV2 2MEV3 3QH7A 3ATGA 5BNOB 4RS5C 1RINA 1YI7A 2IXKA 2EIGA 1H30A 4HKLA 3JD71 4MZUA 3MI8A 2IXHA 5GJ6A 4M3CE 3QLQA 2XUMA 2HWD1 3H1MA 3IPVB 1I6XA 4YVWB 1MEC3 3WUCA 2VW1A 4U2AA 4BLIA 1HLCA 3AXDA 3MEPA 2ZS6B 2TEPA 2RMU1 1LGCA 1N3PA 1GQHA 2R6QA 3WCSA 5J7MA 1AXKA 1CAVB 3ZSJA 2DFCA 2OZ6A 4YW4A 4B8EA 4BE3A 2A7AA 4B29A 1YJKA 1RL3A 3B3QE 1IS5A 3MIBA 2JJ6A 2YC0A 2EF6A 5SV5A 4XFHA 1UL9A 3VBOB 3UJOA 3AZYA 3WG2A 4QMAA 2UY8A 3L9JT 4QQOA 4CZSA 4ZU4A 1UW8A 1ZZ9A 1SMVA 4XDQA 2HEYF 2CGNA 3ME2A 1ZZCA 3AYAA 1LHOA 1S0GA 4FPKA 3MIDA 4TLFA 2XWBB 3AKQA 2R063 2EAAA 3MF6A 4OFGA 4ATEA 4XJ9A 1LECA 2O8QA 3FBMA 4AI8A 1WLCA 1WCSA 4QPIC 1V00A 4IEYA 2BYVE 3SHRA 4HSJA 5GZGA 2B7YA 1U5YA 2RS53 3VKNA 5I0TA 1S0FA 1W6OB 1X36A 4Y22B 1VBB1 1UU6A 3CU7A 4GMP1 1ZBE3 2AR6A 3RWNA 1WCDJ 5LEKA 2ZACA 3TBDA 4FTSA 2ZMKA 1S2BA 2QNKA 4Q4X2 4FTEA 4FVVA 4RQPA 3ZFGB 1PMIA 4Z2WA 1GANA 1NCRB 2YGLA 3OYWA 4LUKA 3S0MA 3IWZA 2CWSA 2NZ9A 3T1MA 1KFXL 2ZAHA 3M2MA 1CAXB 1BKZA 4M3CF 2C5DA 1K5MB 4MSVA 2XJQA 1EYBA 2DURA 1ZBA3 1I9RA 4IEUA 4XFBA 2EA7A 1OQEA 2JDZA 2QDNA 3E5QA 3I54A 1FPN2 3H7YA 4XJ8A 4XW3A 1YFYA 2R0HA 4IEOA 2Q8OA 1MZEA 4FOYA 5IT6A 1ZVFA 1IS4A 3AMHA 1QOSA 5AVPA 5CG9A 2NPIA 2EAKA 1QXPA 1RUF3 2TUNA 3ELNA 3FLPA 2JEMA 3NV1A 4TSVA 4XBNA 3CEWA 2X5IB 5FREA 1FV2A 4LULA 4LUMA 1PVC1 4LO5B 2ZHLA 1PVC3 5F6LB 1VB4A 1ZYBA 3LSEA 5DZGA 3CNAA 1JBCA 5JIAA 3SITA 4EN9B 1LCLA 4F83A 2YDEA 1G7YA 3MLJA 4KGQA 4WVWA 4ISRA 5F9TA 1EV12 3I4IA 2D6OX 2VULA 2YYOA 3IN9A 1DF0A 4Q4X3 2EXIA 3WW2A 2CYFA 4N9IA 1J3QA 1W6OA 4B4RA 4FPGA 5CNAA 4RR3B 1B35B 1PVXA 4ZU7A 1CESA 1YCIA 4HN1A 1BMV1 1PGL1 1MS9A 1RUG1 3HT2A 4GH4A 2PAMA 5H9SA 5TSWA 2BQPA 4M3CA 2W52A 4W6YA 3KGZA 5K7PA 3QBQA 1AF9A 1ZBA2 1H9PA 1N1TA 1E57A 4QPIB 4QQHA 3I8TA 3DL3A 3TN93 1AL21 1GNHA 3QCWA 2OW4A 1F5JA 1KITA 1LGNA 1Z7S1 1WLDA 3AKTA 2OVUA 3WDTA 4GIQA 4R52A 3VGIA 3B00A 3VBRA 1QXRA 4CEWA 4ASLA 3AM2A 3I59B 4MGIE 2X53S 1ND2B 4JRAA 2C9AA 3FFQA 4Q4Y3 3WG1A 1Y7BA 5EZWA 5J48A 5E16A 4LA2A 3NV4A 5KC5A 1O5LA 1FNYA 3N7MA 2DU1A 2VNGA 3VN4A 1PVC2 3PNAA 2HWB1 2Y26A 3HIFA 1BVP1 4GKXA 2E7AA 3VHPA 4S2FA 2VPVA 4YVSC 1DDLA 4GWNA 1S0EA 4GH4B 1QY4A 1EP0A 1SBEA 4PF5A 1O4YA 1EAH2 4N43A 5BNOC 5C4WB 5FLHA 3L2YA 5IK7A 2HEWF 4AEDB 1GNZA 3UKVA 5AFBA 5FDBA 4A3XA 1OQ1A 4PBOA 4D94A 2WZR3 4FPJA 5GM0A 3VBHB 1H8TA 1TMF2 3R4UA 3FHIB 4WZCA 1F9KA 4JCKA 4NR1A 4KWLA 4OHVA 1N3OA 4YZ2A 1Y9QA 1NQJA 2BNNA 3ZMNA 5FTTC 5KHIA 4WVMA 1X7NA 5FLIA 3ZYJB 2PFWA 2PYTA 5KBFA 4FSJA 3OGJA 1NA1A 2WS92 5JZGB 3RZZA 5HI0A 2Z69A 1D0GA 1PM7A 4YGEA 2WIIB 1YFWA 3WOGA 4JDOA 1J3PA 1H8VA 4XFFA 4RHV1 4BZ4A 1H0BA 2R062 2Z42A 5I8TA 4LBQD 1LKNA 1EAH3 1MZ5A 2JG8C 2R32A 2XG3A 4IEZA 2GC3A 5A33B 4BIOA 2PLV1 2BW8A 1FNZA 1SLLA 1LOBA 3FUQA 1F8VA 1ND2A 3OF1A 3D0SA 4K1ZA 4K1YA 4HVOA 1ZRDA 5FO8B 3M3QA 2DFBA 5JOXA 2WZR1 4XF0A 4ATFA 3AKRA 2IXCA 4IETA 3CO2A 1TQ5A 4AVSA 3HD8B 2VVFA 4QT6A 3AP5A 3AP6A 2IFRA 1KXGA 4BH9A 3BPZA 1REFA 5KWRA 4R9AA 1ZNPA 3PVNA 5DG1A 1ENQA 1VRH1 4Y20A 1WBLA 4FXGB 1DFQA 1IS6A 3VBFB 1RUE3 2WS93 3LGRA 3M8LA 3CJIC 1ND3C 4XJUA 3ZDSA 5ACA2 3V0BB 5BNNB 2W08A 4YM0A 2I45A 4Q4X1 1IZ