4HK9A

Crystal structures of mutant endo-beta-1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
188
Chain Sequence
b'IQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGHFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 57
structure length 188
sequence length 188
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hk9A00
2D98A 4XQ4A 1W2UA 2BVVA 1IGOA 2DCJA 3AMMA 3VZJA 1UU6A 2B42B 1XNKA 1OA3A 3HD8B 3WY6A 1C5HA 5K9YA 1XNBA 3RI9A 4HK9A 3WQ1A 3VGIA 1HV0A 2C1FA 1XNDA 1YNAA 1UU5A 3WQ7A 4S2HA 1ENXA 1REFA 3LGRA 2DCYA 2QZ2A 1PVXA 3VZNA 3AKPA 3WP4A 2VULA 1AXKA 4HKOA 2QZ3A 3AMPA 1BK1A 5K7PA 3AMQA 1H8VA 2F6BA 4NPRA 4XPVA 2B46X 1XYNA 1F5JA 1XNCA 1UKRA 4IXLA 1REEA 3WXPA 1REDA 1T6GC 3WQ0A 2Z79A 2DFBA 1XXNA 2JICA 2NLRA 4S2GA 4XQWA 1OA2A 1QH7A 4XQDA 1M4WA 1QH6A 3B5LB 3AMNA 5EJ3A 3AMHA 2VG9A 5HXVA 3WR0A 2BWAA 3ZSEA 3M4FA 1H1AA 2BWCA 3VZKA 3O7OA 1OA4A 3EXUA 3RI8A 1HIXA 2NQYA 3WT3A 1H4HA 1UU4A 4H7MA 3B7MA 3VHNA 1H0BA 1C5IA 3AKQA 3VHOA 4HKLA 1OLQA 1XYOA 2B45X 3AKTA 3VLBB 2BW8A 1OLRA 3VZLA 3WP3A 3WX5A 2VGDA 1XYPA 3MF6A 3VL8A 1NLRA 2JENA 3MFCA 3VZMA 4S2FA 2DFCA 2JEMA 1KS4A 3WP5A 2D97A 1BVVA 1H4GA 4HK8A 1BCXA 2DCKA 4HKWA 1TE1B 3MF9A 3MFAA 3VHPA 3VL9A 2VUJA 1KS5A 3AKSA 4S2DA 3AKRA 3VZOA 3WP6A 2DCZA 1HV1A 3LB9A
chains in the Genus database with same CATH superfamily
3USSA 1BK0A 2JE8A 4TXWA 4UFJA 1LB2A 3T1MA 3SQOA 1LHNA 4YGEA 1MZ6A 4UW4A 4GKYA 4CA9A 4C91A 2DUPA 5FPZA 1AUYA 2X09A 1WMDA 1AYN1 1W6PA 3K2OA 5FIXA 5FYVA 2PHXA 3PDQA 4LKSA 4WZFA 4CRQA 5FUPA 2X8KA 5FY7A 1SBDA 1VBA3 3LEGA 1MQTA 3I2HA 4DRVA 3IT8A 1UOBA 4FOYA 5FO7B 1H1MA 1NZCA 3RPQA 3ZFEC 1HXS1 1MS9A 2ZBJA 2PXJA 3I3EA 4ZHNA 5LW9A 3CO2A 1MS8A 4LHNA 2BOIA 4OHXA 1XNAA 3NNGA 1O91A 1IS4A 2R6QA 2RMU3 4CDXA 1HQNA 4DXSA 4V2VA 5A6QA 4BQ1A 1UMZA 2XVGA 1ZBE1 2QKDA 3JBG3 5D8AA 5JWPA 2NM1A 5LZ6A 3AFKA 1VBD1 4COWA 5L7OB 4LHKA 1F5JA 2P37A 2IXHA 2ZCWA 1GUIA 3TNPB 3ZFFA 4AOCA 2ZOEB 5EIYB 2E6VA 4ATFA 4YW2A 1O4TA 1QU0A 1RUC1 2XH6A 4XJUA 3RS6A 3WDYA 3IKWA 5ACA3 2Y34A 3GYDA 3WDVA 1RHI2 2NP0A 1MZ5A 2WNUB 4YM0A 2UYBA 3TOJA 2R061 2R16A 4AFDA 1UPIA 1FPN3 3KCCA 1T2XA 1FATA 1A78A 5FP8A 3RJ2X 2PFWA 3TN93 4LHLA 3S5AA 1YO8A 4AVAA 1JHJA 3ZMOA 3E5QA 1V00A 3P3PA 1AJOA 1FMD1 2SLIA 4JVAA 1A3KA 2RJLA 1QOTA 2VC9A 5F6LB 4E4DX 5FPVA 2VOVA 2VO5A 2W0XA 3J7NA 2ZMLA 4LE4A 2E26A 4PLOA 3M3CA 5EFUA 5CFDA 2WZPP 2RJKA 3PL0A 1ZZ7A 5GM0A 4CCDA 3A23A 4AZZA 4D69A 1N1SA 1PO11 1DG6A 1N1YA 5H9QA 2PELA 4XYXA 1BBT1 5AC91 1UO9A 2HWE1 3UNPA 5IATA 2BQPA 3SCHA 1ND2A 5BNNA 3EO6A 4IV1A 4META 1UZYA 1TME3 5EHDA 5J36A 1KJLA 3WDXA 3ZR5A 1PIV1 5IVBA 3AZZA 3HEIA 4YYOA 1C8M3 1KXGA 3ZYIB 2VJXA 2VVFA 4BU2A 5DG1A 3GZUC 4ITCA 1YRZA 5A1LA 4XUQA 2J22A 4MG2A 5KBFA 3VN4A 4EQVA 3POWA 1D4M1 2D97A 1DIWA 3E6BA 3V0BB 2XOMA 3PVOA 3JD71 2OZ6A 2W1UA 1XU2A 3QH7A 2BTVC 4YVWB 2X53S 2ZEWA 1UX6A 5FYTA 3MEPA 1DQ5A 5BNOA 4XE9A 3G6JB 1LOAA 5J3UA 5DUUA 3PU3A 1JZ5A 3DN7A 5FY0A 4AVSA 2RR11 4K40A 4NPMA 3AP7A 2WINB 1GOHA 4K1ZA 4CTEA 1EV13 3WF1A 4C1WA 1CAVB 3UKTA 2GH2A 2Q1FA 1GZCA 4K21A 4FOQA 1CN1A 1NOVA 2Y6LA 3MLJA 4OUEA 4EE2A 4CXXA 1VBC2 1NQDA 2JD4A 1GYKA 2V5DA 2HWF3 5H9PA 4B8EA 3GM8A 4PQQA 3WQ1A 5GLWA 5DZFA 3VGIA 4D6SA 4EWDA 4IEWA 3ZLIA 2WZR2 1V9U3 2XBO2 3WUDA 5M0TA 2ZHKA 2XJSA 3H8OA 3E6DA 1ENXA 1SCRA 3LGRA 2QZ2A 3NJZA 5SV8A 4K8RB 1AR81 4L99A 5T52A 3RYKA 3WP4A 5FPLA 1RUF1 3BTXA 1DHKB 4Q4W2 1X82A 3KV6A 1D7PM 3S30A 1GU3A 1PX4A 4KMQA 2JECA 3FBMA 4P9LA 4SLIA 3PUQA 4GAZA 4NPLA 4UW5A 4Z82A 5GZCA 5IFTA 2KR2A 4RN5A 1F8VA 5CIRA 1AR71 5L73A 5FXWA 1WA4A 5T5JA 5T54A 2DVGA 3PVBB 5C3OA 5IVEA 4K6BA 2AC1A 2YU1A 2DFBA 3JUUA 1BLZA 3C7GA 4DXRA 5FWJA 1RINA 3EMRA 3M8LA 3OB8A 4NUBA 3OEAA 3IMMA 1YC61 2WS91 3WD5A 4FAGA 1NY71 1WZXA 3LSDA 3WDTA 3DYMA 4B29A 3B5LB 2CAUA 2FCTA 4AW7A 4IDZA 1RMU1 5EJ3A 2E9QA 4N53C 4IE5A 5GJ6A 4LO7A 1BMV2 1PK6B 2P6CA 2G19A 4HANA 1O6UA 2A6VA 2HEYF 1LRHA 3POIA 5EQUA 3A22A 5EJZB 5FMDA 1W6MA 1EUTA 4D8MA 2ZAHA 4E27A 4XHBA 4AVTA 5IK8A 4NWWA 1C5IA 1VAMA 1COV3 1QXJA 4DPNA 4BQYA 1SDDB 4XDPA 4AVCA 2A7AA 1HQLA 4FPEA 3VLBB 2YUEA 4CP1A 3VZLA 3WP3A 1V6IA 2QBXA 4KGGA 4OZOA 4BZ4A 2WT1A 1Q8SA 1FXZA 2E7AA 2VNVA 5FCCA 4MZUA 2DVDA 2WRAA 3O1TA 3NNFA 3QOPA 1DGLA 2DBNA 4CVUA 5FZLA 1XJAA 1JOJA 2HWD3 1BVVA 2Y6GA 4HK8A 3KV5A 4ZS3A 1NA1B 4P14A 4RR3A 2QQWA 2VMGA 1H6YA 1MS0A 2VMFA 4WV8A 5DQ0A 3PU8A 2XL9A 2VCBA 1OD3A 1KS5A 5A7SA 4XABA 5A33A 3AKSA 1POV1 4FPFA 5FYSA 5CISA 5L7OC 3W5NA 3B3QE 3OF1A 3VBOA 4JKMA 5F9TA 4ET7A 1PVC1 3A21A 4JKKA 4LE3A 1JYCA 3UL2A 4L97A 3HD8B 4GQ7A 2WNUC 1WCKA 2VVEA 4Y20A 3UKNA 4QGMA 3LA2A 5EWSA 4P5HA 4UF0A 3WNOA 2EAAA 1LHUA 1UY1A 3H1MA 4YW4A 3LOBA 3I7DA 1RUE1 4ZY9A 4J25A 3JXSA 4JRLA 1CAWB 4WBBA 5FAXA 3WNPA 1QXRA 2Q8EA 2QDNA 4NR1A 1VBB2 1J3RA 1W3XA 4O61A 4Y22B 4AFAA 2V4AA 4GH4C 2XJVA 2TUNA 4HN1A 4LBKA 2JKXA 1F5FA 2HEVF 4ZU4A 2ZAAA 4BYYA 5BNQA 1QEXA 5FY5A 2VVDA 3GJBA 1F35A 4OYUA 1QJZA 1GQPA 1S0BA 2J7MA 4XURA 1S0GA 1GR3A 2RS32 4JTOA 4Q0VA 1DZTA 4IE7A 4KL1A 4R9BA 3TYJA 4AHZA 3U0ZA 2YG0A 2R1DA 1WW7A 4BE3A 2BUKA 4NO4A 4HT1T 2YB7A 2EICA 3LKJA 1ENSA 2XVLA 2A5ZA 4HOOA 3ZFGA 4LBMA 5CADA 3AZYA 1ODMA 5C5TA 1FOD2 3M3EA 5ABJB 2ZACA 3LIGA 1OA2A 4EN8B 1N47A 5FRAA 1G86A 5HV0A 2KXLA 2TNFA 1GNHA 4YZ5A 1RGSA 1ZNPA 3NNJA 5KHGA 1W90A 2W1SA 1JOPA 4QB6A 4RQPA 5FZCA 1W3VA 3VDDC 1OKOA 1X8MA 2G4IA 2P3IA 1LEDA 5DXDA 4YVWC 3ILRA 4CUAA 2XWJB 3B94A 2J1TA 4PIZA 1AYN3 1S0CA 3IM0A 4DXTA 3GZTB 2R7EB 3OD4A 1Y9GA 5LBCA 1HIXA 3TB0A 1G9CA 3J8F2 2G9FA 3LA7A 5LB6A 4ARYA 5LA0A 4JGZA 3R4SA 3VHOA 4LA3A 1ND3C 1HXS3 1XPWA 2DTYA 2X5IB 3AXDA 2CSGA 5FK8A 3W58A 1VP6A 4Q8LA 4QU2A 1L7QA 2D6PA 5JR7B 4ASMB 3BYWA 4HMZA 2R1BA 4YSFA 1ZYBA 5F5AA 4EZHA 2ZZJA 1ZBE3 3VL8A 1CAUA 1SG3A 2WO1A 3LZZA 1VBE2 5DDJ1 3S7EA 3WDUA 3WF2A 4E4SA 5JZGB 4ZXEA 2Y6FA 1VBD3 4IGPA 2JG9B 3O1PA 2BYVE 2JJ6A 4KWLA 3V56A 2R0HA 3ZFFB 2XJPA 2P4EA 2YBPA 1HB3A 3KSCA 5I0TA 3LPFA 2JE7A 4LO6B 1RUC3 1HQWA 2Y0IA 3MF9A 3MFAA 3EJKA 2UYAA 2IFRA 3LAGA 4WM8C 4CE8A 1VMHA 1U5IA 1UYZA 3H8UA 2R063 5HCBA 5LK7B 2VBBA 4CYDA 2RDRA 3ACGA 1CPMA 1MR5A 5FPBA 3FZ3A 1LAJA 1UL9A 2ZEZA 4Q4X1 4XDOA 5J09A 2XMLA 5BNPA 5FY9A 4GZ9A 2BNNA 1O8PA 1QQP2 1Y4WA 4AXOA 2P3YA 3UT0A 1OA3A 1H2KA 1FMD3 5KHJA 1JW6A 1TNRA 1OUSA 4PHZA 3OCPA 1CQ9A 5GKAC 4HVOA 5I93A 4UFLA 2ADDA 4M4PA 1PO13 3QD6A 5ANQA 2YY1A 4YPJA 4O9EA 4BMBA 1BBT3 3VBSB 1H8TB 5AC93 2HWE3 4KWJA 1XQNA 1PK6C 2E51A 4I3GA 4TWTA 5C71A 4Q0UA 2MEV2 5BNNB 3O5SA 1I3HA 4AR2A 2VXRA 1PIV3 5E16A 3VZNA 3ACHA 2VOTA 2JG8C 4B7EA 2W95A 3KHCA 4FTBA 3AMQA 4QD2A 2F6BA 4Q0QA 3WW4A 4BPZA 1JZ8A 1KDKA 5LRSA 2ZMNA 2A70A 1D4M3 2BU9A 2C9KA 2JD9A 2F4LA 2GDFA 2K46A 5F6KA 4UXAA 3JD73 2VCCA 3CZUA 3KF3A 2XDVA 5JOYA 4DB5A 4TSVA 1YHFA 1YQ5A 2XHKA 1AYM2 2VW2A 2J1UA 4OFGA 4C0HA 4YM1A 3GBGA 5LA1A 2JDKA 3BTYA 3O14A 3T0BA 4AYUA 4LO5B 3N9MA 4X6RB 2RR13 4QGLA 5CYYA 4JC1A 4Y4YA 5DAQA 4M0HA 1S55A 1WCDJ 3OTFA 3PTRB 4JDNA 5A32B 3WCRA 1C4RA 1I6XA 2WSUA 5C8CA 1S0DA 4FOWA 2HWB3 2VG9A 1J3PA 1JYIA 1W2NA 1NA1C 4R4XA 1DDLA 4HBNA 2GN7A 1ASJ2 3BIWE 2QQOA 1DYPA 4QX5A 4DUWA 4UFKA 1BEV2 4YM2A 3C3VA 5JPNB 1ZA4A 2YZ4A 5C3PA 2QUOA 2FDJA 4H7MA 2VOKA 4Q5OA 4ZU7A 3V0BA 5CG9A 1QIQA 3MBWA 4E2SA 1UMIA 4QQLA 2BGOA 3CJXA 4L9BA 3GJAA 1FYUA 2G1MA 2VL4A 3BOPA 2P2KA 1IS5A 5FOBB 4WVZA 4YM3A 3V0AA 1IPSA 4UBHA 1AR83 1YFUA 3BGAA 5F1RA 3AK0A 3MW3A 1PGL2 4A3ZA 4I01A 3ME2A 5EPAA 1EUUA 5LA2A 4B3NA 2ZGOA 4DEVA 1ZRCA 2VD7A 5G04L 4P02B 5H9RA 4R9DA 3IDBB 3RZMA 4YGCA 2W46A 4Q4V2 1YQ2A 2VZVA 2EIBA 1A8MA 3CJIC 4QHZA 2D6KA 5IWFA 1H4GA 2Y0OA 2OYZA 3FX3A 3K3NA 5HCFA 3NV2A 1X8EA 2R043 5TSWA 1UY4A 2WS93 1IPKA 3ZSMA 4IL7A 4S2DA 1US2A 4PDWB 2Q5TA 4BMEA 1O5LA 2P34A 4CP0A 2E53A 1RMU3 1AX0A 1HV1A 2Y8KA 1VB4A 1XOYA 2OQ6A 3FC0A 4XQ4A 1PZ8A 4QQHA 4XFIA 4NWVA 1G9DA 4OHWA 3KGZA 1UU6A 4GA9A 5G05L 3WY6A 1W03A 2WWJA 3M7AA 1K5MA 1W6MB 2OZJA 4J6GA 4Y5SA 1WW5A 1VJ2A 3UGHA 1VBC1 5LY1A 1PMJX 2W9XA 1JOBA 1WLCA 2GALA 1XNBA 3MIGA 1Q3EA 1FAYA 4OUSA 1YYNA 2QQNA 2UU8A 2WNVB 2QQUA 5A3OA 3MI8A 4AI8A 3R6SA 1OMIA 3USUB 3FFQA 4A44A 1DBNA 1LKNA 1W6NA 2WZR1 4RD7A 2XBO1 4W4ZA 1MS5A 1FNYA 1GNZA 4XF1A 5BXXA 1P8JA 3ZYBA 1SACA 2YYOA 3I49A 4XUPA 3DPRB 3WNMA 4XDQA 3WNXA 5LASA 4HSJA 4AEDB 1DGRN 2ZGSA 1Y9QA 1MQTC 5K7PA 1YFXA 1LJ7A 2YPDA 4Q4W1 1QOSA 5C4WB 3POYA 4YZ3A 5FKCA 3X29B 1RVF1 1UY2A 3I2IA 3NAPB 1S0JA 4XETA 2VMDA 4YZ4A 5FYBA 4DY5A 3HOBA 5I91A 2ZA9A 3VBFB 4IXLA 2VMCA 1O3TA 1S4CA 2YFUA 4CDXC 5A7PA 2YC0A 2BBVA 1I9RA 2BP6A 3VBHA 3NSTA 3PTYA 5D8AC 1POV3 3MLLA 3NNLA 4OUMA 5FV3A 3U10A 1WW4A 1VIWB 2VZ1A 1PO22 2DYCA 4LIUA 1GWMA 5FZBA 4FPJA 3ZFFC 4IE4A 1V6JA 3VBOB 1VMJA 1PVC3 4QXCA 4GWJA 3PHMA 5C9AB 5IVFA 1PHMA 3NMBA 4M3CA 2GC0A 4QU1A 3SLIA 4E4HA 1BMV1 3NV1A 3EXUA 1ZVFA 4IV3A 2BGCA 1ACCA 1RUE3 1W99A 1PNGA 2NQYA 2AUYA 2GAUA 1SLAA 2BOJA 4WVMA 5LCWL 5FZ4A 1LU1A 3ACLA 3AL6A 4RGAA 2PHTA 1CIWA 3D4KA 4HFSA 2W39A 3EB7A 4QX7A 2QQPA 2VH9A 3H7YA 4A6SA 5BY5A 2BEOA 4UWDA 3RVHA 3WF0A 2F17A 1O4YA 3KF5A 4Y26A 3ZIXA 4IE0A 1RUD3 1SEFA 2ATFA 1WLTA 1V70A 5JIAA 2VW1A 5CFDC 1XYPA 3VKOA 2D6MA 2JIJA 4COUA 1NLRA 4Q26A 1MZFA 1QJU2 5CG8A 3MFCA 1JZ2A 2Q0AA 1OQDA 3SHRA 2WUHA 1ND2C 1GP4A 4IV1C 4N43B 4LBJA 5BNNC 2WABA 1GOFA 5JLVA 2VW0A 3JB8A 3DYOA 5FBJA 1RUH2 4Y24A 3ZFGB 4SBVA 4Y33A 3VBUB 1J1TA 4YFZA 1UZVA 1CAWA 4BWOA 3CF6E 4QX3A 4CDWA 5C5UA 4QPWA 4AHYA 3V65A 5CKMA 2AEYA 3BB6A 1R1A2 2ZTNA 3R05A 1K42A 2VXJA 4FOVA 1LENA 1KDMA 3BOWA 5BV6A 1OH4A 4IEVA 5C8WA 5FZIA 1GQHA 2Y64A 4U2AA 1L3JA 3N7KA 4BISA 1MS3A 4FT8A 2A6YA 4G3YC 2WWSA 5BNOC 3ATGA 3POSA 4RL7A 3WG4A 5JXGA 2D40A 2ARCA 2XUMA 2ZPXA 2WZ8A 1JUIA 3I3MA 3FBYA 4LITA 2DVBA 5FXXA 1WD4A 3ZYRA 2QJVA 2Z69A 3RI9A 1PMHX 3N9QA 1WKYA 1IQDC 1RJ8A 4R8HA 5FP9A 4LO4B 4MV2A 4P08A 2CDOA 5FK7A 4XXAA 1NCRA 2RS52 3K3OA 4AWDA 1F15A 2FCVA 1RXFA 2Q30A 4DMIA 5FR3A 1VBB1 2LROA 4A6OA 5SV5A 4YGDA 4S2HA 3VDAA 4XJZA 5ABJA 5KR7A 2VQAA 2O14A 3BUCA 3L2YA 2UWBA 3AJZA 2VZSA 5AFEA 5DDJ3 4E9KA 5KXCA 1C1FA 2B9UA 2D5FA 4HN0A 4HKOA 1AXKA 2W68A 2XONA 1BK1A 2VMHA 1KFXL 2WJSA 3K77A 1PZ9A 2JDAA 3M3QA 3KV4A 3NQHA 4BLIA 2RS31 2BFUL 3SC7X 4H7LA 3O1RA 4X8NA 2VBDA 3NKTA 1VR3A 2MNGA 1H9WA 4XFFA 3UGGA 2VCAA 4Q0SA 4AEJA 3WXPA 1AL22 2GU9A 1R1ZA 2J1EA 3IDEA 2VM9A 3LFMA 1JTZX 4FPOB 1UKGA 3T0DA 2ZGKA 1FOD1 1IG3A 2RE9A 3KM5A 4QPIB 1J1LA 2X5IA 1K5JA 2O8QA 3WVJA 3TEWA 1SFNA 3QLQA 4XFBA 3VKMA 2IC1A 5E1RA 5FZ8A 1H2LA 3WW1A 1D2SA 5FP7A 3RDIA 5BNPB 4B7KA 4NIAA 1TG7A 2WWUA 3R0RA 4NN0A 4YWAA 4QQ2A 3WR0A 4CDUA 1R092 2PLV2 4LTAA 3B9CA 5JZGA 3OOXA 1BQPA 1V6OA 3FL7A 3PMSA 5LEKA 3ZOIA 4QKDA 2JG9A 4HVRA 1HN0A 1I5ZA 3FLTA 4FBFA 5HXMA 2PMWB 3WV6A 2A71A 3J8F1 5A1AA 3BODA 3SEEA 3MGUA 3PURA 3F95A 3C7HA 4XTMA 3S6PA 5ACA2 3GZAA 1AHSA 1CVNA 3O1UA 2J42A 3W5MA 3ROUA 3JU9A 5KXBA 4XFGA 4LA2A 3KMHA 4AAPA 4MO3M 1OLRA 5F2SA 5FY4A 1OOPB 5E8AA 5BPXA 1ZZBA 3CDZB 5F3IA 3I3QA 1H2NA 4NAOA 3NL1A 4YFWA 1UIKA 1VE0A 2FBEA 1G9BA 1VBE1 1UZWA 2VECA 5KHKA 4L8QA 1XU1A 1OKQA 5CNAA 5C3RA 1VAVA 3KT7A 2RM23 3WP5A 4BQWA 5I0DA 1NCQB 5FLIA 2O1QA 3ILNA 5T55A 3RMYA 1BCXA 3PUIA 2XJUA 1C3HA 4Z2AA 2Q8CA 4P9XA 1F2NA 2ZX1A 1T6BX 4K9SA 1A8DA 1W06A 3ETPA 1H8TA 4K20A 1W9YA 5F5CA 3VBSA 3JCIA 1QY4A 2RJ2A 3ACIA 1J58A 1DF0A 1GKBA 3VZOA 4EN7B 5C3SA 4COYA 4I09A 1TME2 1W9SA 2VE1A 3LB9A 5C8CB 5F3CA 1OLMA 3HQRA 3POJA 4RR3C 2K0GA 3QH6A 4MLOA 4LBQB 4MGQA 1UXXX 1R64A 3OBTA 1UIJA 3WW3A 5A3MA 1U0AA 1QQP1 1RB8G 2ARBA 1OVPA 3PUSA 1CONA 4QQPA 5JVVA 2B7YA 1XRUA 5HV4A 2UWAA 3VBOC 3SH4A 5GZFA 2XXZA 3BI3A 2GZWA 4NAMA 2UWCA 4LULA 4D7SA 4C90A 3N35A 4QX2A 5LEJA 3HNMA 2QTWB 4IE6A 4MHUA 4RFT0 4FP2A 1QHDA 4U36A 3NVCA 1SDWA 3DECA 1XE8A 3ZM8A 5LRRA 4AK3A 4CU8A 1VAKA 2PHRA 5FMCA 4BQ4A 3LDKA 3V0AB 2BRTA 1WWYA 1VB2A 2MEV1 3C7OA 1DZQA 3D3AA 1KGYA 1PVXA 4XF4A 4ZPIA 4RHV2 2R49A 5A32A 3ZXAC 3U1XA 1GP5A 1XNTA 2VULA 4QM8A 1FT9A 2QZ3A 4DY3A 2VY0A 2PHFA 2R32A 3RZZA 4AFCA 4CCJA 1B35B 4NOTA 1AR92 2GSYA 1QJY2 5JMCA 3AP4A 2R30A 2OVUA 3AL5A 3LQCA 3MW2A 1OF4A 4PIXA 4GWMA 2GNBA 1RJ7A 2PYTA 2ZHLA 4CXWA 4OQ8A 4MHRA 1AYM1 3TRSB 5FZGA 2C5DA 3H3ZA 2ES3A 4KQ7A 4XQDA 1K12A 2EIDA 4UYBA 5DUVA 3ZSLA 1GICA 2W52A 3DF0A 3AP5A 5FO8B 1J59A 1JI6A 3ZFGC 4CCMA 3DYPA 3LDBA 1LHWA 1QKQA 1JZ7A 4PJYA 3H9AA 5JIUA 2BWAA 4AI3A 2EVXA 2RS13 1ASJ1 1K5MB 1VBC3 2EF6A 3APBA 4XF3A 3ON7A 4RS5C 2DURA 3RWKX 5BYNA 1BEV1 3RI8A 3HWJA 3KGLA 1CZSA 5EYYA 3KV9A 1XB9A 1KITA 3N7JA 4QQOA 2VZRA 4RQPC 4MGIE 2WZR3 1OC1A 2XBO3 1UD1A 1W6NB 2B9VA 4EN0A 5FZMA 4NE9A 4IETA 2JX9A 3AKTA 3VHRA 4LNVA 4J1WA 4CEWC 2QQJA 5E88A 4KBBA 3ZYGA 4JGZC 4BQ5A 2EXIA 4PDWA 4QXBA 4ONUA 3ZYFA 3IIAA 1PGL1 4Q4W3 3CIHA 1AXYA 2RDQA 2NZ9A 1DGRA 2DUQA 1RVF3 4MUVA 1ALYA 1NQJA 4MH0E 5F37A 3ASIA 2WYSA 1SHWB 3VZMA 1BHGA 3OG2A 2W92A 3ZYHA 1Y3TA 2HEWF 3AM2A 1TZOA 4I30A 4XUOA 2YPJA 5I0UA 4N9IA 4Q4V1 1LGBA 3KCYA 5HPOA 4XOGA 2Q1ZB 5JOXA 4G9SB 4YG0A 2DTWA 5IVJA 4N90A 3VBHB 2WNVA 1TE1B 2OIIA 3IZOA 2ZX4A 2WL1A 4P5YA 4GULA 3USUA 4XEZA 1S2BA 3IAQA 2E7TA 5K0UB 1DGWX 4CCOA 2OT7A 1IKQA 4OI1A 4AL9A 2DCZA 4GWNA 4Q8KA 3DPRA 1MEC3 2F4PA 1AZDA 2A6ZA 3RZLA 1POQA 4FXGB 4Y4RA 1D4VB 4AEDA 4COZA 3ZXEA 4M3CB 5KXDA 1KFUL 4OVEA 5FMOL 1X9TA 4LBNA 4M3CE 5C4WA 4D3WA 2JDUA 4IV3B 3W20A 2WT2A 3NAPA 4DUXA 1GANA 4XMAA 2LS6A 3F2ZA 3H42B 4WVMB 4Q4Y2 5FJHA 4KU7A 4LPLA 1HDKA 4QPGB 3VBFA 4JGYA 4BM8A 5BNPC 3MZHA 4IUGA 1ZA7A 4YNIA 5DAVA 4CPBD 3KQ4B 3T1LA 5F32A 4W6YA 3AYDA 2XJTA 1U5XA 3PVNA 3H3LA 1I5PA 3EYPA 2A3XA 1IQAA 1UU5A 1ZM1A 2WLPA 1YCIA 1E5SA 4IEYA 1JUHA 4NMIA 3HQUA 3MW4A 5FZ1A 2H0VA 4NIGA 2D3SA 3OEBA 2HBUA 3Q8CA 1HKDA 3I8TA 1RUJ2 4YW3A 2GC1A 2HWC2 5C9AA 1RC6A 4LMFA 3U14A 4BOWA 1JXNA 3P1IA 3DGTA 4XTPA 1E5RA 1OBNA 3UV9A 1XSQA 1XYNA 4GMP1 1REEA 2YC4A 5J98B 5F2WA 5FUNA 2VUAA 4AGGA 1MACA 4BK4A 2VPVA 1ULGA 4HETA 4BIOA 4GXLA 3R4UA 4IGQA 5C33A 2JICA 4CDWB 1ZRFA 3H8XA 4E8DA 4LOSA 1FV3A 4QWNA 4OMCA 2VU9A 1M06G 1GMMA 1WLDA 1PO21 1LR5A 4H3WA 1HN1A 4FFFA 3ZKYA 2ET7A 3ACFA 2DCTA 2VTXJ 1QH6A 5FMBA 1MS1A 3MLKA 2XLAA 2V72A 4DNYA 1SLIA 2YFZA 4GD4A 4GJYA 4WZCA 1H30A 1W9FA 3CZJA 2BVBA 1GNYA 1OPOA 3E97A 1O7FA 5A7OA 5C8CC 4N43A 1O4ZA 1ONAA 1OFSA 2QE3A 3O0WA 5APAA 3IPVB 5FXVA 1NCRB 4HL0A 4KWKA 3VD9A 3M3IA 3AZVA 3C8XA 3VBUA 3I3BA 3I2GA 3Q8EA 1YI7A 4MSVA 4YVSB 1AR62 3ZIWA 5GALA 1RL3A 3U78A 1ENQA 3T4HB 4I2OA 2E63A 2CWSA 2C0ZA 4UFMA 5IT6A 4CU6A 2WFF3 1D0GA 4NIIA 2OQ7A 3RJRA 4AI0A 3SH5A 2D6LX 4YW7A 5A3WA 1MPXA 2HJIA 4GB32 3DCQA 5A7NA 2RS33 3CLPA 3P5BA 1ZRDA 1TQ5A 1QJU1 4AVVA 1W8TA 1POV0 4Y5TA 2VNGA 1NE4A 3ITQA 3DXUA 1K45A 3I4IA 1QJX2 3OUHA 1LESA 3ZX7A 4CSWA 1ZRRA 5FTTC 3OPWA 4I0BA 2XVKA 1W8OA 1UN1A 2Z5WA 1RUH1 3K48A 1KD7A 4M01A 5IK5A 1FOD3 3ECQA 4LBOA 2DVAA 1KEXA 3GBWA 1WBLA 4DEQA 2FD8A 3MIHA 5JDBA 4AI1A 2OPKA 3WINE 2FHRA 4AAXA 2OX0A 1R1A1 5A1FA 1G8WA 2BJSA 3DUIA 5CU1A 3ZN6A 4F8AA 2WQ4A 1RUI2 4JHZA 2WO3A 2DCJA 3FE5A 2C26A 4FFHA 4Q0PA 4CDUB 3JZVA 5FYUA 4XFAA 3HNBM 1XNKA 2A1XA 2IXJA 1RUG2 1UOJA 3O1MA 4N8MA 4X6QB 4NJ4A 4E2QA 3M70A 4BQ2A 2W3JA 5GLVA 2QCSB 3J8F3 1DLCA 1WMEA 2I45A 2D3RA 1CESA 1LHVA 4ZKTB 3VDBA 2GNTA 4N53A 5DAWA 3MPPG 4IEOA 4AQ6A 1W6OB 2A3WA 2PHDA 5IAVA 1DQ6A 2C1FA 2KM2A 4DXZA 5A70A 2RS51 1K5MC 1WBFA 3LEMA 3O0VA 5FBZA 3QCWA 4QPIA 4GIQA 2ILMA 1DFQA 2JKBA 2RVAA 5KHHA 2WIIB 2VCMA 3KQRA 3RMXA 1VBE3 5EJ1B 2J1VA 4D0QA 4EJRA 4CCCA 1RIRA 2C4XA 4CP9B 4XPVA 4CUGA 1H1IA 5A6XA 2FDGA 1JHNA 1W9TA 3T3YA 1XC6A 1XE7A 4EYUA 2B39A 1AL21 3RSJA 1SLTA 1ZZCA 4RSUA 5JUVA 1US3A 1YJLA 1YIFA 2ENRA 2VAUA 3EHKA 3Q9OA 4XZPA 1VRH2 2ET1A 1OOPA 1OLME 2VQUA 3NWKA 4XFCA 2JXAA 3RFRA 1DGWA 4AGRA 3Q8FA 4JCKA 5LATA 5B4NA 4CCNA 1HB1A 2BWCA 1R091 3O7OA 2PLV1 3AYCA 4QGNA 4LKFA 2VQTA 3AVRA 1B09A 3TEZA 4PF5A 4E4ZA 1IG0A 1NXD1 4XCAA 1QJFA 1UU4A 2DV9A 2Q8OA 2YBSA 4YLZA 1UPSA 3MIDA 1NCQA 2ZGLA 4MX3A 4BH9A 2X05A 1U12A 1HX6A 3A4UA 4H14A 3NNMA 4KNCA 2ETEA 5ACA1 4LT5A 2MEV3 3KZ4C 4HG6B 1RHI1 3GCXA 2VMEA 2OKXA 5FMOS 4W8JA 3KT1A 4NHLA 3MUY1 1G9AA 5JSPA 4Q1PA 3THCA 2HWB2 1F4AA 1W6QA 2J1AA 2A75A 1PX3A 3BCWA 4RYDA 1XSRA 1YIPA 4OQ9A 2DBIA 5KHIA 4LBQA 3SNMA 3J4UH 2NYYA 5L9VA 2DFCA 3ES1A 4GH4A 4QT6A 3ZSKA 3HJRA 1V6MA 5IFPA 3P3NA 4L11A 2X10A 4DOUA 1YWKA 1E57A 1HRI2 2B4KA 3AYAA 4BIFA 5I8SA 5IVCA 2XHNA 2NMNA 1AYM3 3ILFA 3C2UA 5FKBA 4LQRA 3VKFC 2FDFA 2GNMA 2WNOA 4RGKA 3VUOA 3AKRA 5E6HA 5AFBA 4AQTA 5FZKA 5DAPA 3SKJE 3MHZA 1HLCA 5C70A 3WOGA 1TME1 1HW5A 1RUF3 1OF3A 3W59A 2WR9A 1STMA 1CX1A 1ASJ3 1LULA 3AMMA 4PQ9A 5DN2A 2ZZQA 4CDWC 3HMYA 3CL1A 4FTEA 1BEV3 3WQBA 4JZRA 1C5HA 1QWRA 3P6BA 5D1IA 3VB9A 1B35A 4BJ0A 5K9YA 3K75B 3WG3A 1AR73 1FNZA 2HLEA 2YDEA 4ASLA 1ULDA 1JS9A 5CFCB 4H55A 1Q8VA 4I3PA 1ULEA 3SMHA 1MZEA 3T09A 5GLTA 4L92A 1UYXA 1SFPA 4M0NA 5LBEA 3RZGA 4DFSA 4MXVA 2D6OX 2R042 1SQ4A 2CGPA 3WCSA 1JH5A 2L9LA 4LIVA 1Y7BA 4AG4A 4Y1UA 1A34A 1H9PA 1N3PA 1GSLA 1FX5A 1N1VA 1REFA 1VALA 5FZAA 5FZ6A 2Z4FA 1ULOA 4BQXA 5DAXA 2AH2A 4RHV1 2XL7A 4OLLA 3BTAA 1ND3A 1NCRC 2A73B 2ZX2A 5B4XA 1LOFA 3I2KA 4KG8A 3LSEA 5A3NA 4WM7A 3H8RA 4QMAA 4XF9A 3UKVA 5ABJC 3AZWA 2PQSA 2IXIA 2BBAA 5FZOA 1NLQA 4FPCA 1AR91 1UY0A 1REDA 2ARXA 1QJY1 2RDSA 3KVBA 3VKNA 3ES4A 2P17A 4JRAA 3WQ0A 3RWNA 4MGKE 3IB3A 3VBRA 4AHWA 2VUCA 2LW8A 5KXEA 4HPKB 1WCSA 2CL2A 5JSRA 1IKPA 1R082 3O12A 1ZREA 1NYWA 2V73A 2Y6KA 2Y6HA 4Z1VA 1KJRA 3VD3A 1VPHA 3M3OA 1BVP1 4R52A 1HRV2 1CJDA 4YW5A 3RYRA 5ISLA 2X5IC 3DV8A 5FLJA 1OH3A 1CR7A 1RITA 3BVCA 4RFRB 4XF0A 4IGOA 4XBNA 5F3EA 1SZBA 3KWVA 4KG0A 1KQRA 3GALA 4FPGA 4JGYB 1WMXA 3IIIA 5FREA 1MVEA 3OBZA 4Y1VA 5CEHA 1O3SA 3FWEA 3TNQA 1OLQA 3NRUA 4CDUC 2E32A 2IVIB 3MV11 5JZGC 2JDMA 3ZXFA 1O5UA 2JWPA 3ENRA 3O1VA 1W0OA 2JG9C 3U37A 2VNOA 3RGBA 2FDIA 5K0UA 5LY2A 4P00B 5FZDA 3MF6A 3MDPA 4TYSA 1LTEA 3VDCA 3B93A 4EN6B 4S2FA 2A6XA 4GMP3 2ORXA 1TMF2 1WLWA 2B8MA 4RA0A 5GZEA 4LBLA 4FP3A 4PCRA 3BKZA 4F3JA 2CU5A 4QKFA 4K1YA 1YXWA 3WG1A 2XG3A 2DCKA 5CZKA 4QPGA 4QXKA 4E8CA 1H6XA 1GOGA 1LHOA 1PO23 3FMGA 4D7TA 4EWAA 2MPFA 2Y26A 4R4ZA 1DQ0A 4P9WA 3TBDA 1RUD2 3TWIA 1ULCA 4HXCA 3TAYA 2EXKA 3JQXA 5JXJA 2D98A 4PI0A 4CDQA 2CGNA 1J84A 4UAPA 4L0PA 4DIQA 2BNMA 2G9ZA 3GNEA 3VBSC 1H8TC 3RNSA 4CZSA 2WN2A 4Y5Z0 3ZDVA 4A3XA 1O3RA 4FPHA 4XHXA 3HT2A 3E6CC 4DQAA 3UK9A 2J1RA 1Z7S2 3NO8A 4HK9A 4Q4Y1 2CY6A 1A6CA 3MICA 4QKBA 4OHZA 3D5OA 2C24A 1OPMA 1ZZ8A 2WBKA 4JAAA 4BLJA 3LEKA 3Q8BA 1GP6A 1IZ3A 2PAKA 2H0BA 2R072 2TBVA 2WAAA 4FPYA 2XJRA 4E2GA 2E31A 3U07A 2WKKA 1IHMA 1WW6A 1GZTA 3ELNA 3KS7A 2PHLA 2DCYA 4FVVA 4Q2FA 1YFWA 1EYBA 3N9LA 5DG2A 5J1XA 2J1SA 1QJU3 2ADEA 4OZXA 1W8HA 2VNRA 1WUVA 3J26N 3LOIA 3GHNA 2A3YA 4GALA 2LTNA 4L2NA 4TLGA 3GGLA 1RUJ1 3I59B 4QB2A 3N4MA 2HWC1 4IERA 5FZEA 1E5IA 1JYWA 2IUWA 2YU2A 3B01A 2NN8A 1IS3A 3FN9A 3ZYJB 1EAH2 3L9JT 4N7UA 1RUH3 4BHPA 4XIKA 2FMDA 1OT5A 2ZS6B 3B9IA 3ZO0B 2HBTA 5K8SA 3FFZA 3CHXA 3FJSA 3T08A 1ST8A 3IPVA 3UYJA 4YZ2A 1Q8OA 1R1A3 3RQ0A 4FPKA 4D7YA 4ZONA 1ZBA2 4YVSA 1BXHA 1UCXA 3OBAA 2ZEXA 3U4SA 4UBGA 3SEPA 3ZN6B 1ODNA 4QX1A 1YLLA 2VZ3A 2YC2A 1QGLA 3LWCA 4OHVA 1ZZ6A 3HN1A 4EZ4A 1UQXA 2BERA 5CBLA 1S0EA 5A6ZA 4R9AA 1TVGA 4ZZ8A 5I0SA 1BKZA 3T2PA 3N9OA 2VZUA 3HBZA 5GLZA 3WT3A 4C0BA 3UJOA 4CEYA 5KC6A 4N53B 3AP9A 4NRPA 2FQPA 4QDRA 2RS53 1VBA2 1XYOA 1QOOA 2AENA 2B45X 3FUQA 2HH9A 3PIGA 4LXLA 5FO9B 5GZGA 1SPPA 3NV4A 4YGBA 1AR61 4B4QA 3LD8A 4ZU5A 5A3UA 2JDPA 5C6CA 2ZGTA 4HONA 4Q4X3 4F83A 3HVDA 3ABZA 1AL0G 3R4DB 4GB31 2RMU2 1RXGA 3T0AA 2H6BA 2CTVA 5LBFA 1Y9MA 2YXSA 3DXTA 1LCLA 3OYWA 2MHFA 3JBG2 4NIHA 3S57A 4MGYE 2YROA 2DU0A 2ZGQA 4HSLA 4PDWC 1VLNA 1QJX1 5A3LA 5HCHA 1RUOA 1AL23 3ST7A 4AI9A 1Z78A 3URFA 2JE9A 4I0WB 4H2AA 2YHJA 3VHPA 1GZWA 1CJPA 2WN3A 5D21A 1JMUB 2JDYA 2VOXA 2Z42A 5F39A 2WA4A 1W6OA 4CCLA 2V5YA 3BIEA 1SLLA 5DZGA 4XCBA 1FPN2 1JZ6A 2TEPA 2WNVC 1IGOA 1RUI1 3TN92 1KRIA 3VZJA 1R093 4M3CF 2PLV3 3WZ1A 5FYHA 1DYKA 3UESA 1RUG1 1VRBA 4XBLA 2GNDA 4CP9A 3PJYA 1IS6A 3DPRC 2RM22 1N1TA 3E5UA 2W1WA 2V09A 2XGXA 4AEDC 4GWIA 2W5FA 2D44A 2XKOA 3ZXJA 1U5YA 4CXYA 3T2TA 5C4WC 1RHI3 2JDNA 3OUJA 1UZZA 1DP0A 3NAPC 5K4LA 3S5QA 3UGFA 5FYIA 3VBFC 1UY3A 4JGYC 2FZ1A 4M4RA 1W6QB 2JB8A 2GMMA 3POBA 1G6NA 3HIFA 4NPRA 1C8M2 4XW3A 2JDZA 3I97A 5A3PA 1UF2C 4GH4B 2G9GA 3MIBA 4CCKA 1GLHA 3D6EA 3RZJA 1UNBA 2EA7A 3BU0A 2VR4A 4PBPA 2Y6JA 4FTSA 1C28A 4LKEA 5FY1A 5A7QA 1XXNA 4N7IA 5C9AC 3PLQA 4O65A 2WZEA 3IWZA 4MXWB 3FHAA 1QH7A 2QVSB 4LK7A 2YBKA 4O9GA 4B4RA 5ERLA 2XKPA 4NHXA 4MOAA 1WCUA 2GC3A 4MGZE 3ZSJA 5FPXA 2ARAA 4QB1A 3OY8A 4D6QA 1VRH1 1YUDA 3ETQA 5CAZA 2WT0A 2XWBB 2PHUA 4YW1A 3KD4A 1EV12 2AGSA 4NHYA 2QQVA 3ZSEA 3M4FA 4IW3A 4AQSA 1LODA 2NMOA 2P5BA 2WQZC 2ZGPA 3IDCB 3N9NA 1D2QA 3UJQA 1PGW2 1YQ8A 1OA4A 3BU7A 1LOGA 1YQ6A 3DKWA 4ISRA 4JV4A 4XIOA 4BK5A 3H3UA 3THDA 3U4XA 3QACA 2FDHA 3GDBA 4QKNA 5F7UA 2CWMA 2HWF2 4LUKA 3VDDB 2SBAA 4F7ZA 2I07B 1SFYA 3WF3A 1W8WA 4HZFA 4Q27A 1BJQA 4AE2A 3PJQA 1V9U2 4LLOA 4A7ZA 5CVRA 5JSOA 1NKGA 3D8CA 1V6KA 2WFPA 3SISA 1SLCA 3NJXA 5FWEA 4N43C 5D2AA 4RHV3 5JAXA 1Y43B 1YJKA 2YV8A 4AFBA 1ND3B 4LJHA 4BQ3A 1WMFA 2HWB1 3KCXA 2XR4A 3ZKUA 1LGCA 3T30A 3VBUC 2QQKA 1FI2A 4AEKA 4QHOA 5HBAA 2RS12 4WM7B 5AVPA 2HYXA 1NUKA 1SBFA 1PM7A 4QHBA 5FZOB 2IVJA 4XJWA 1AR93 4FQ4A 1QJY3 2D7FA 5T3NA 5I0RA 2QDRA 4LO8A 1ULPA 3I2JA 2D6NA 4NVPA 3VBRB 5CFCA 3B00A 1BYHA 4Y1ZA 1HRI1 4XVHA 1LEMA 2WAOA 4P9JA 5EXOA 3WNNA 3A7QA 1UOFA 3VL9A 3U75A 2W87A 1QJEA 4UOJA 3POGA 1W39A 4FPLA 2ZX3A 4LOTA 4XXPA 1J3QA 1X50A 3HR9A 4Q29A 4ARXA 3THTA 4XJAA 5DPNA 4EV0A 1JYNA 1UW8A 3WHTA 4D94A 3SH3A 1RVF2 4WM8B 5FYYA 5LK5A 2WNEA 3Q8AA 1Q8QA 3HBKA 3KLSA 1EY2A 2DVFA 3OGJA 3B69A 4UW6A 5FXZA 3ZFEA 2QQLA 3SITA 2V4VA 2LRPA 4MADA 4MVTA 3FUOA 3K51A 5FQ0B 2XQRA 4FI9A 1W8ZA 3LPGA 3H1WA 5JR2A 4A45A 2X29A 2P6HA 1GWLA 1OI6A 2RV9A 4TTGA 4KI5M 1COV2 5C3QA 4XAEA 3VD7A 2R041 4K7JA 4UFHA 2BDRA 5EZWA 3A0NA 1W2TA 4LHSA 4HPKA 4NRQA 3HQXA 2PN5A 3OGSA 2BFUS 3S7IA 3BTZA 5CB7A 4BCUA 1MEC2 4Q1RA 1ZX5A 3N3HA 2CHHA 3HNYM 4BDVB 3ZXGA 1H8VA 1OUXA 1ULFA 3GF6A 5I8TA 2CV6A 3A0KA 1CGPA 2WQ8A 3LF7A 3OSDA 2RG4A 1PGSA 4QPIC 4JDMA 1GZ9A 1C8NA 2DUOA 2PA7A 2LALA 2WO7A 2W08A 2EALA 2W2IA 2JG8B 1CZVA 2HWD2 4WVWA 5A7WB 5KC5A 1WD3A 4NRMA 3GCWA 3WNLA 5L9BA 2NPIA 4S2GA 4LORA 2JDHA 3GHMA 3OPTA 3HN3A 5J7MA 1NLSA 3EQEA 2LUWA 1SMVA 5C7GA 1UMHA 5FOJB 1M4WA 2W91A 1I1EA 1W05A 5DUWA 1R081 4INDA 4CDQB 3PIJA 3OGVA 4DRRA 4ZZ5A 4QXHA 5KWRA 2P3JA 5JI7A 1Z0HA 2UY8A 4HVQA 4AI2A 4AQ2A 3N7MA 3IAPA 1H1AA 2VTFA 3AJYA 4MYEA 3AC0A 1HRV1 4MGSA 1CZTA 3ZPOA 1CAXA 1NE6A 1AX2A 2BPA2 3LCPA 3LEIA 2OS2A 4YG3A 1DU3D 1O8SA 4ORFA 4Q4Y3 5E89A 5J96B 1H4HA 4IEPA 4V1PA 1OOPC 3WNKA 1HJFA 3OD0A 4GKXA 4QDSA 4CPBA 3TEXA 2WA3A 1DYOA 1L7RA 4GJZA 5FZ9A 1HB4A 1D0HA 1YI9A 3AVSA 4YW6A 1NG0A 4PF1A 4XJ8A 4EWEA 1UZ0A 2VGDA 4C1XA 1NCQC 1APNA 1PZ7A 3T4VA 1RUJ3 1O59A 2HWC3 1W2OA 2OXBA 4YG6A 2XJQA 5L9RA 4Y3OA 2GP5A 3WSOA 5IK7A 1QXPA 5LWBA 1CIYA 1TMF1 1PM4A 1G7YA 1KS4A 3T2QA 4W6WA 1E5HA 1N3QA 2DWRA 5FYCA 3ZYPA 4XAAA 5B2GB 4AHXA 4HKWA 2WDBA 1VBB3 1S2KA 1V0AA 5L36A 3CJIB 2WFF2 1RUD1 4P9IA 3M2MA 4DO0A 1Q8PA 2BVVA 1IOAA 2BZDA 4W6XA 2B42B 4CU9A 2QQIA 3WW2A 3OPZA 4PIYA 4NIDA 3I59A 5FJKA 1WGPA 1AYN2 3D82A 4Z8BA 1LOCA 1LU2A 4OULA 5IW0A 1JU4A 1OQ1A 3ORJA 1OSGA 4CEYB 4FSJA 1Z7S1 4UI9L 1GFF2 1HV0A 1FV2A 1DQ2A 1ZRIA 2YGLA 3N7LA 2YGMA 5JXIA 5ANNA 3K4AA 1HXS2 4KH9A 4KU8A 1AR63 4G4FA 1SPPB 1XNDA 4ATEA 3RG0A 2R071 1LOBA 4MGTA 1B35C 1GBGA 1S0IA 2D5HA 2ZKNA 2ID4A 4GMP0 4RS5A 4O7XA 1URXA 2ZJCA 2OUJA 5AVAA 3W9AA 1JZ3A 4I0AA 2KD7A 4GB33 3AKPA 4K8FA 2RDNA 1ZBE2 3AMPA 3J7MA 3MPBA 2BGPA 2OUHA 3OYWB 1O3QA 3D0SA 5LBBA 1VBD2 2FDKA 3RYPA 2WO2A 1MS4A 2B46X 1QJX3 1W6PB 1K3IA 4CEWA 3GXUA 1ZZ9A 3VD5A 4XILA 1EAH1 2K9ZA 1MQTB 1CPNA 1RUC2 2OA2A 4UT5A 4W50A 3DKQA 2ZEYA 1GZWB 3I2DA 3O0XA 4NHMA 1LOFC 1JYVA 1YQCA 1LGNA 4WM7C 1AX1A 1QNYA 4UFIA 3H0OA 4DUVA 2WYFA 2R062 3BPSA 4AVBA 5JOZA 3BN6A 1ZBA1 4CDXB 2VMIA 1RUI3 3DEMA 3PMEA 3VBRC 2GN3A 4XJ9A 5T5LA 1XE0A 4B1MA 3O1SA 2C6SA 1DZRA 5D8AB 5HXVA 3D0JA 5A80A 4AEMA 5DMYA 1RUG3 4XUNA 3VZKA 2AEZA 4KBZA 1FMD2 1LECA 3G7DA 1UYYA 1LOEA 2EAKA 1C1LA 3BPZA 1AJKA 3VHNA 1PO12 2E7QA 1UYPA 1NT0A 3CEWA 1BBT2 1VBA1 3KHBA 3ZR6A 2CGOA 4EROA 2P1BA 2QFEA 2IZWA 4ASKA 2HWE2 3NJYA 5AC92 5IYYA 4IQPA 1RUNA 3DL3A 2ZGRA 3NV3A 3PUHA 2DF7A 3HT1A 3WX5A 1Q56A 1PIV2 1UXZA 4JTNA 3LE0A 2QNKA 2ZGUA 1W8FA 3O1OA 4YARA 2JENA 3LFIA 2RMU1 1OFNA 1QQP3 3VBHC 5A6YA 4AF9A 1W04A 2BV4A 5IK4A 2IFWA 2OPWA 2I2SA 2IXKA 2ORZA 3JBG1 4OMDA 5FFOC 4QAWA 1D4M2 1F31A 1W8NA 4FQZA 4R9CA 1VMFA 5F5IA 5CFDB 3CU7A 5K0UC 5L7OA 4Y1YA 1YEWA 2D43A 3JD72 1UAIA 2GMPA 5FZ3A 5DUXA 4HLTA 3FHQA 4FFGA 1TEIA 4N9HA 4X8PA 4XMIA 5FYMA 5HCAA 4EN9B 4Z2WA 4TLFA 2VUJA 1RTVA 1ND2B 4IV1B 2WNUA 4FAHA 4IV3C 5A3TA 2UURA 1SCSA 2RR12 4JQRA 4KGQA 3ZXLA 1VRH3 3GBFA 3OY8B 3ZXDA 4QPGC 1FPN1 2YMZA 3SXWA 4B4PA 2CDPA 3IDAA 2QQMA 3NKGA 3TN91 3INAA 4LBQD 1DQ4A 4WVVA 3KB5A 2IWGB 1MVQA 3W21A 4XBQA 4JDOA 4IEQA 1JYXA 2RM21 2XLFA 1UWWA 3MV01 4CUBA 1GV9A 4CDQC 3H7JA 3CNAA 4ISQA 2Z2SB 4M00A 4OI2A 3CKHA 4QX0A 4OI4A 5JXHA 5BUVA 4XZUG 5BNOB 4JX0A 4P9YA 2Q8DA 2AR6A 3SCFA 1YNAA 1BZWA 1NAEA 3FLRA 4IEZA 4LKDA 4YZ1A 3OGGA 4DZGA 1IPJA 4I02A 4MXWA 1CX4A 1J83A 5H9SA 4ES9A 1AR82 1RUF2 1SBEA 1Q43A 4A7KA 1X33A 2JIGA 2ZGNA 1S2EA 3PUAA 5T50A 5FYZA 1C8M1 5GZDA 3ZN4A 1W2AX 2Q1MA 1QF3A 4LR4A 2I74A 1RYYA 5FLHA 4D6RA 3SCGA 1XNCA 2GH8A 4XUTA 1AR72 1V6LA 5IVYA 3PNAA 5IVVA 3KT4A 3OUIA 3V64A 1HRI3 1T6GC 1JN2P 2HYKA 3I2OA 4OHYA 2Z79A 2P3KA 3I3DA 1X9PA 2NLRA 2GC2A 2ERFA 3POEA 3VDDA 4PLMA 4KWUA 4YVWA 2EXJA 5FP3A 5FPAA 2FZ2A 1OXCA 2WS92 5FY8A 4DS0A 1N3OA 1NY72 3HAGA 2EXHA 1RMU2 3ZMNA 3AMNA 3FLPA 4CP2A 4J1XA 3AMHA 3ZDSA 3AX4A 4OCTA 3AXEA 4QDQA 1W0PA 2Y38A 1W0NA 2W94A 3AB0A 1CAVA 1EV11 3LIHA 3NJVA 4LK6A 4PBOA 2XUEA 3ZFEB 3ZVXA 5CA6A 1NX9A 2VUDA 4URAA 2EIEA 4YVSC 4COVA 1PGW1 4V2WA 4Q4V3 4XC9A 4IESA 4BXFA 4BA6A 4URTA 2ZX0A 1JU3A 5FZFA 1SLBA 3B7MA 2HWF1 3QBQA 2DDUA 3AKQA 5FUIA 2Q4SA 3E5XA 2C9AA 1C57A 1XBFA 4HKLA 4LEJA 3POFA 2D93A 3K46A 1V9U1 3WLUA 5CKNA 5HI0A 1GQGA 2O0OA 3VD4A 4NHKA 2H6CA 1PMIA 2BW8A 2ZGMA 3FHIB 2ZABA 4XFHA 1EPZA 5EYXA 2E33A 4W65A 4CEYC 1W28A 1F9KA 3IBMA 3JQWA 3CQOA 3K4ZA 2UY9A 1ENRA 2ZXQA 1AF9A 1JYTA 3K4DA 3I2FA 3MYXA 4B1LA 3AP6A 2VZPA 5FZ0A 2IXCA 1CWPA 5CKQA 1QNWA 4WM8A 4BB3A 2AREA 2RS11 2PTMA 5JI9A 2FMYA 3S0MA 1F4HA 2DU1A 2ZKLA 4ES8A 3M1HA 4JKLA 3J9SA 5J37A 2CAVA 3VV1A 5FQ0A 2IXLA 1HJGA 2AACA 2VOWA 2VZTA 2Y33A 4ZXKA 3WUCA 3VKLA 2ZMKA 4TN7A 3KVAA 4P9GA 4FO9A 3RZKA 5IJRA 1X36A 1OVSA 3IN9A 3LA3A 5LA9A 5I8YA 2KA3A 5JCTA 1R083 1OHFA 3B02A 5F3GA 3RRDA 1S0FA 2VQ0A 1JBCA 1PVC2 2K2SA 1W2UA 1HRV3 3PVEA 1LNSA 4Y1XA 1CAXB 4NROA 1PNFA 1JODA 1PK6A 4AGVA 5JPMB 3SKVA 2XB6C 2GMEA 4BXSV 1RUE2 4RR3B 1U5ZA 3EBRA 5F8PA 1G9FA 3CBNA 2JG8A 1YFYA 2HKXA 5A7WA 1OD5A 1JZ4A 4Z92B 2FCUA 5A33B 1COV1 1UX7A 2VZOA 3N36A 5IAXA 4TZDA 3E1F1 4Z07A 2EIGA 4CU7A 3WQ7A 1QMJA 5T5OA 3H1YA 3WF4A 3TEYA 3HPNA 2XLGA 1WA6X 1OURA 4PT6A 4QX8A 4UW3A 4CCEA 4CUCA 1MEC1 1V6NA 3MIEA 5FDBA 1NZIA 3BALA 5FP4A 4FXKB 4RGGA 4Y20B 1QDOA 2WLQA 4LLFA 4LUMA 1L7LA 1TMF3 4UF0B 4YRDA 1HB2A 4QPYA 5L19A 1UKRA 5GLUA 1AXZA 2O8OA 3C7FA 5IHRA 1CD3G 4A41A 2PHWA 3WG2A 2HWD1 4DINB 3THPA 2ZHMA 4OI0A 1DCSA 1NA1A 3AFGA 3J7LA 4XQWA 2CNAA 1Q5OA 2CYFA 3RZHA 4A42A 1QDCA 5J48A 5T5PA 2RHPA 2VBPA 5F5QA 4IEXA 2VZQA 4JQTA 4IEUA 2Y60A 2XQXA 5DZEA 3JB4C 1H2MA 2OW4A 2PAEA 2A6WA 2PAMA 5JMOA 2XPJA 4JHTA 3MO4A 3CMGA 3I54A 5FZHA 2ZHNA 1Z7S3 1W9WA 3WEZA 3U11A 2N7GA 4XACA 1H0BA 5DABA 4A7YA 1DLLA 3ALQA 3ZXKA 2R073 2W47A 4A4AA 5FPUA 5JOWA 1UOGA 3N9PA 1X7NA 2B5HA 4RS5B 4Y22A 2LM3A 2JB4A 3H50A 3L2HA 3MIFA 4PLNA 2D3PA 2WC2A 3AYEA 1AVBA 3IMNA 4RQPB 2AZ5A 1DQ1A 3CJIA 3MUZ1 4ZS2A 5DDJ2 3UETA 2R0FA 4QM9A 3OBRA 4C8DA 1TNFA 2PQQA 3NW4A 4PI2A 4AFMA 3J7HA 3ZPYA 2VTXA 4CEWB 3LDRA 5EV7A 1S1AA 2WSVA 2JEMA 3C7EA 1EAH3 2GP3A 3OGRA 3T2OA 4JGZB 4FCAA 5FZ7A 1OQEA 3WDWA 4A2UA 1EP0A 1WCQA 3GZEA 3OJBA 5EP9A 2AYHA 1GWKA 1W8UA 4K3UA 3ZN5A 1EPWA 5IUQA 1ZBA3 4FFIA 3WHUA 3WP6A 4Q4X2 3AZXA 2BNOA 1NXMA 2WFF1 2W1QA 1CAUB 5CFCC
chains in the Genus database with same CATH topology
3USSA 1LB2A 3T1MA 1LHNA 4YGEA 1MZ6A 4UW4A 4GKYA 4C91A 2DUPA 5FPZA 1AUYA 1WMDA 1AYN1 1W6PA 2PHXA 4WZFA 4CRQA 2X8KA 1SBDA 1VBA3 4DRVA 1MQTA 3IT8A 4FOYA 5FO7B 1H1MA 1NZCA 3RPQA 3ZFEC 1HXS1 1MS9A 2ZBJA 3CO2A 1MS8A 4LHNA 4OHXA 1O91A 1IS4A 2R6QA 2RMU3 4CDXA 1HQNA 4BQ1A 1UMZA 2XVGA 1ZBE1 2QKDA 3JBG3 5D8AA 5JWPA 2NM1A 3AFKA 1VBD1 4COWA 5L7OB 4LHKA 1F5JA 2P37A 2IXHA 2ZCWA 3TNPB 3ZFFA 2ZOEB 2E6VA 4ATFA 4YW2A 1O4TA 1QU0A 1RUC1 2XH6A 4XJUA 3RS6A 3WDYA 3IKWA 5ACA3 3GYDA 3WDVA 1RHI2 2NP0A 1MZ5A 2WNUB 4YM0A 2UYBA 3TOJA 2R061 2R16A 4AFDA 1UPIA 1FPN3 3KCCA 1FATA 1A78A 3RJ2X 2PFWA 3TN93 4LHLA 1YO8A 4AVAA 3ZMOA 3E5QA 1V00A 3P3PA 1AJOA 1FMD1 2SLIA 4JVAA 1A3KA 2RJLA 1QOTA 5F6LB 4E4DX 2VOVA 2W0XA 4LE4A 2ZMLA 4PLOA 5CFDA 2WZPP 3M3CA 5EFUA 2RJKA 5GM0A 1ZZ7A 4D69A 1N1SA 1PO11 1DG6A 1N1YA 5H9QA 2PELA 4XYXA 1BBT1 5AC91 2HWE1 2BQPA 3SCHA 1ND2A 5BNNA 3EO6A 4IV1A 4META 1UZYA 1TME3 5J36A 1KJLA 3WDXA 1PIV1 3AZZA 4YYOA 1C8M3 1KXGA 3ZYIB 2VVFA 5DG1A 3GZUC 4ITCA 1YRZA 5KBFA 3VN4A 3POWA 1D4M1 2D97A 1DIWA 3E6BA 3V0BB 3PVOA 3JD71 2OZ6A 1XU2A 3QH7A 2BTVC 4YVWB 2X53S 1UX6A 3MEPA 1DQ5A 5BNOA 4XE9A 3G6JB 1LOAA 5J3UA 5DUUA 3DN7A 4AVSA 2RR11 4K40A 3AP7A 2WINB 4CTEA 4K1ZA 1EV13 4C1WA 1CAVB 3UKTA 2GH2A 1GZCA 4K21A 4FOQA 1CN1A 1NOVA 3MLJA 1VBC2 1NQDA 2JD4A 1GYKA 2HWF3 5H9PA 4B8EA 3WQ1A 5GLWA 5DZFA 3VGIA 4EWDA 4IEWA 2WZR2 1V9U3 2XBO2 2ZHKA 2XJSA 3E6DA 1ENXA 1SCRA 3LGRA 2QZ2A 3NJZA 5SV8A 1AR81 4L99A 5T52A 3RYKA 3WP4A 1RUF1 1DHKB 4Q4W2 1X82A 3S30A 4SLIA 2JECA 3FBMA 4P9LA 4UW5A 4Z82A 5GZCA 1F8VA 5CIRA 1AR71 5L73A 5T5JA 1WA4A 5T54A 2DVGA 3PVBB 4K6BA 3JUUA 2DFBA 1RINA 3M8LA 2WS91 3WD5A 4FAGA 1NY71 3LSDA 3WDTA 4B29A 3B5LB 2CAUA 4AW7A 1RMU1 5EJ3A 2E9QA 4N53C 5GJ6A 4LO7A 1BMV2 1PK6B 4HANA 2A6VA 2HEYF 1LRHA 1W6MA 2ZAHA 4E27A 4XHBA 4AVTA 5IK8A 4NWWA 1C5IA 1VAMA 1COV3 1QXJA 4DPNA 4AVCA 2A7AA 1HQLA 4FPEA 3VLBB 2YUEA 4CP1A 3VZLA 3WP3A 1V6IA 4KGGA 4BZ4A 2WT1A 1Q8SA 1FXZA 2E7AA 5FCCA 4MZUA 2DVDA 3QOPA 1DGLA 1JOJA 2HWD3 1BVVA 4HK8A 1NA1B 4P14A 4RR3A 2VMGA 1MS0A 4WV8A 2XL9A 1KS5A 5A33A 3AKSA 1POV1 4FPFA 5L7OC 3B3QE 3OF1A 3VBOA 5F9TA 1PVC1 4LE3A 3UL2A 1JYCA 4L97A 3HD8B 4GQ7A 2WNUC 1WCKA 2VVEA 4Y20A 3UKNA 4QGMA 3LA2A 5EWSA 4P5HA 2EAAA 1LHUA 3LOBA 3H1MA 4YW4A 3I7DA 1RUE1 4JRLA 1CAWB 4WBBA 5FAXA 1QXRA 2QDNA 4NR1A 1VBB2 1J3RA 4Y22B 4AFAA 4GH4C 2XJVA 2TUNA 4HN1A 4LBKA 1F5FA 2HEVF 4ZU4A 2ZAAA 4BYYA 5BNQA 2VVDA 1QJZA 1S0BA 1S0GA 1GR3A 2RS32 4JTOA 4Q0VA 1DZTA 4KL1A 4R9BA 3TYJA 4AHZA 3U0ZA 2R1DA 1WW7A 4BE3A 2BUKA 4NO4A 4HT1T 3LKJA 1ENSA 2XVLA 2A5ZA 3ZFGA 4LBMA 5CADA 3AZYA 1FOD2 3M3EA 5ABJB 2ZACA 1OA2A 4EN8B 1N47A 5FRAA 1G86A 2KXLA 2TNFA 1GNHA 4YZ5A 1RGSA 1ZNPA 5KHGA 4RQPA 3VDDC 1X8MA 2G4IA 2P3IA 1LEDA 5DXDA 4YVWC 3ILRA 2XWJB 3B94A 4PIZA 1AYN3 1S0CA 3IM0A 3GZTB 3OD4A 1G9CA 1HIXA 3TB0A 3J8F2 2G9FA 3LA7A 4JGZA 3R4SA 3VHOA 4LA3A 1ND3C 1HXS3 2DTYA 2X5IB 3AXDA 3W58A 1VP6A 4Q8LA 4QU2A 5JR7B 2D6PA 4ASMB 4HMZA 2R1BA 4YSFA 1ZYBA 2ZZJA 1ZBE3 3VL8A 1CAUA 3LZZA 5DDJ1 3S7EA 1VBE2 4E4SA 3WDUA 5JZGB 1VBD3 2JG9B 2BYVE 2JJ6A 4KWLA 3V56A 2R0HA 3ZFFB 2XJPA 3KSCA 5I0TA 2JE7A 4LO6B 1RUC3 1HQWA 2Y0IA 3MF9A 3MFAA 3EJKA 2UYAA 2IFRA 3LAGA 4WM8C 1U5IA 3H8UA 2R063 5HCBA 5LK7B 4CYDA 1CPMA 1MR5A 3FZ3A 1UL9A 4Q4X1 5J09A 5BNPA 2BNNA 1QQP2 4AXOA 1OA3A 1H2KA 1FMD3 5KHJA 1JW6A 1TNRA 3OCPA 1CQ9A 5GKAC 4HVOA 5I93A 1PO13 3QD6A 2YY1A 4O9EA 4BMBA 1BBT3 3VBSB 1H8TB 5AC93 2HWE3 4KWJA 1XQNA 1PK6C 2E51A 4I3GA 4TWTA 4Q0UA 2MEV2 5BNNB 3O5SA 1I3HA 2VXRA 1PIV3 5E16A 3VZNA 2JG8C 4B7EA 4FTBA 3AMQA 4QD2A 2F6BA 4Q0QA 3WW4A 4BPZA 1KDKA 5LRSA 2ZMNA 2A70A 1D4M3 2GDFA 5F6KA 4UXAA 3JD73 5JOYA 4DB5A 4TSVA 1YHFA 2XHKA 1AYM2 2VW2A 4C0HA 4OFGA 4YM1A 3GBGA 3O14A 4AYUA 4LO5B 4X6RB 2RR13 4QGLA 4JC1A 4Y4YA 4M0HA 1S55A 1WCDJ 3OTFA 4JDNA 5A32B 3WCRA 1C4RA 1I6XA 2WSUA 5C8CA 1S0DA 4FOWA 2HWB3 2VG9A 1J3PA 1JYIA 1DDLA 1NA1C 4R4XA 4HBNA 2GN7A 1ASJ2 3BIWE 1DYPA 4QX5A 1BEV2 4YM2A 3C3VA 5JPNB 1ZA4A 2YZ4A 2QUOA 4H7MA 2VOKA 4ZU7A 3V0BA 5CG9A 4E2SA 4QQLA 3CJXA 4L9BA 1FYUA 3BOPA 5FOBB 2P2KA 1IS5A 4WVZA 4YM3A 3V0AA 4UBHA 1AR83 1YFUA 5F1RA 3AK0A 3MW3A 1PGL2 4I01A 3ME2A 4B3NA 2ZGOA 1ZRCA 5H9RA 4R9DA 3IDBB 4YGCA 4Q4V2 1A8MA 3CJIC 2D6KA 1H4GA 2Y0OA 2OYZA 3FX3A 5HCFA 3NV2A 1X8EA 2R043 5TSWA 2WS93 1IPKA 3ZSMA 4IL7A 4S2DA 4PDWB 2Q5TA 4BMEA 1O5LA 2P34A 4CP0A 2E53A 1RMU3 1AX0A 1HV1A 1VB4A 3FC0A 4XQ4A 1PZ8A 4QQHA 4XFIA 4NWVA 1G9DA 4OHWA 3KGZA 1UU6A 4GA9A 3WY6A 3M7AA 1K5MA 1W6MB 2OZJA 4J6GA 1WW5A 1VJ2A 1VBC1 1WLCA 2GALA 1XNBA 3MIGA 1Q3EA 1FAYA 4OUSA 1YYNA 2UU8A 2WNVB 4AI8A 3MI8A 3R6SA 1OMIA 3USUB 3FFQA 1DBNA 1LKNA 1W6NA 2WZR1 4RD7A 2XBO1 1MS5A 1FNYA 1GNZA 4XF1A 5BXXA 1SACA 2YYOA 3DPRB 4XDQA 3WNXA 4HSJA 4AEDB 1DGRN 2ZGSA 1Y9QA 1MQTC 5K7PA 1YFXA 1LJ7A 4Q4W1 1QOSA 5C4WB 3POYA 4YZ3A 3X29B 1RVF1 3NAPB 4XETA 4YZ4A 1S0JA 4DY5A 5I91A 2ZA9A 3VBFB 4IXLA 1O3TA 4CDXC 2YC0A 2BBVA 1I9RA 3VBHA 3NSTA 3PTYA 5D8AC 1POV3 3MLLA 4OUMA 3U10A 1WW4A 1VIWB 1PO22 2DYCA 4FPJA 3ZFFC 1V6JA 3VBOB 1PVC3 3PHMA 5C9AB 1PHMA 4M3CA 2GC0A 3SLIA 1BMV1 3NV1A 3EXUA 1ZVFA 4IV3A 2BGCA 1RUE3 1PNGA 2NQYA 2AUYA 2GAUA 1SLAA 4WVMA 1LU1A 3ACLA 4RGAA 2PHTA 1CIWA 3D4KA 4HFSA 2W39A 2QQPA 2VH9A 3H7YA 5BY5A 2BEOA 1O4YA 4Y26A 3ZIXA 1RUD3 1SEFA 2ATFA 1WLTA 1V70A 5JIAA 2VW1A 5CFDC 1XYPA 3VKOA 2D6MA 4COUA 1NLRA 4Q26A 1MZFA 1QJU2 5CG8A 3MFCA 2Q0AA 1OQDA 3SHRA 1ND2C 5BNNC 4IV1C 4N43B 4LBJA 5JLVA 2VW0A 3JB8A 1RUH2 4Y24A 3ZFGB 4SBVA 3VBUB 1J1TA 4YFZA 1CAWA 4BWOA 3CF6E 4CDWA 4AHYA 3V65A 3BB6A 1R1A2 2ZTNA 3R05A 4FOVA 1LENA 1KDMA 3BOWA 5BV6A 4IEVA 5C8WA 1GQHA 4U2AA 1L3JA 3N7KA 1MS3A 4FT8A 2A6YA 4G3YC 2WWSA 5BNOC 3ATGA 3POSA 4RL7A 3WG4A 2D40A 2ZPXA 2XUMA 1JUIA 3FBYA 2DVBA 1WD4A 3ZYRA 2QJVA 2Z69A 3RI9A 4R8HA 1RJ8A 4LO4B 4MV2A 4XXAA 1NCRA 2RS52 4AWDA 2Q30A 4DMIA 1VBB1 5SV5A 4YGDA 4S2HA 4XJZA 5ABJA 2VQAA 3L2YA 2UWBA 3AJZA 5AFEA 5DDJ3 4E9KA 5KXCA 1C1FA 2B9UA 2D5FA 4HN0A 4HKOA 1AXKA 2W68A 1BK1A 2VMHA 1KFXL 2WJSA 3M3QA 1PZ9A 4BLIA 2RS31 2BFUL 4H7LA 4X8NA 3NKTA 1VR3A 2MNGA 1H9WA 4XFFA 4Q0SA 4AEJA 3WXPA 1AL22 2GU9A 1R1ZA 3IDEA 1JTZX 4FPOB 1UKGA 2ZGKA 1FOD1 3KM5A 2RE9A 4QPIB 1J1LA 2X5IA 2O8QA 3WVJA 1SFNA 3QLQA 4XFBA 3VKMA 2IC1A 5E1RA 1H2LA 3WW1A 1D2SA 3RDIA 5BNPB 4B7KA 4NN0A 3R0RA 4QQ2A 3WR0A 4CDUA 1R092 2PLV2 4LTAA 3B9CA 5JZGA 1BQPA 1V6OA 3PMSA 5LEKA 2JG9A 4HVRA 4FBFA 1I5ZA 3FLTA 3WV6A 2A71A 3J8F1 3BODA 3MGUA 4XTMA 3S6PA 5ACA2 3GZAA 1AHSA 1CVNA 3ROUA 3JU9A 5KXBA 4XFGA 4LA2A 3KMHA 1OLRA 1OOPB 5E8AA 5BPXA 1ZZBA 1H2NA 3NL1A 4YFWA 1UIKA 2FBEA 1G9BA 1VBE1 2VECA 5KHKA 4L8QA 1XU1A 1OKQA 5CNAA 1VAVA 3KT7A 2RM23 3WP5A 1NCQB 5FLIA 2O1QA 3ILNA 5T55A 3RMYA 1BCXA 2XJUA 1C3HA 4P9XA 1F2NA 2ZX1A 4K9SA 1A8DA 3VBSA 1H8TA 4K20A 3JCIA 1QY4A 1J58A 1DF0A 1GKBA 3VZOA 4EN7B 4COYA 4I09A 1TME2 3LB9A 5C8CB 4RR3C 2K0GA 3QH6A 4MLOA 4LBQB 5A3MA 3OBTA 1UIJA 3WW3A 1U0AA 1QQP1 1RB8G 2ARBA 1CONA 4QQPA 5JVVA 2B7YA 1XRUA 2UWAA 3VBOC 3SH4A 5GZFA 2GZWA 4D7SA 2UWCA 4LULA 4C90A 3N35A 5LEJA 4RFT0 4FP2A 1QHDA 4U36A 3NVCA 1SDWA 1XE8A 5LRRA 4AK3A 1VAKA 2PHRA 3V0AB 1VB2A 2MEV1 1DZQA 1PVXA 4XF4A 4RHV2 2R49A 5A32A 3ZXAC 4QM8A 2VULA 4DY3A 1FT9A 2QZ3A 2VY0A 2PHFA 2R32A 3RZZA 4AFCA 1B35B 4NOTA 1AR92 2GSYA 1QJY2 5JMCA 3AP4A 2R30A 2OVUA 3MW2A 4PIXA 4GWMA 2GNBA 1RJ7A 2PYTA 2ZHLA 1AYM1 3TRSB 2C5DA 3H3ZA 2ES3A 4KQ7A 4XQDA 5DUVA 3ZSLA 1GICA 2W52A 3DF0A 3AP5A 5FO8B 1J59A 3ZFGC 1LHWA 1QKQA 4PJYA 3H9AA 5JIUA 2BWAA 4AI3A 2EVXA 2RS13 1ASJ1 1K5MB 1VBC3 2EF6A 3APBA 4XF3A 4RS5C 2DURA 5BYNA 1BEV1 3RI8A 3HWJA 3KGLA 5EYYA 1KITA 3N7JA 4QQOA 4RQPC 4MGIE 2WZR3 2XBO3 1UD1A 1W6NB 4EN0A 4IETA 2JX9A 3AKTA 3VHRA 4LNVA 4J1WA 4CEWC 5E88A 4KBBA 3ZYGA 4JGZC 2EXIA 4PDWA 4ONUA 3IIAA 1PGL1 4Q4W3 1AXYA 2NZ9A 1DGRA 2DUQA 1RVF3 4MUVA 1ALYA 1NQJA 4MH0E 3ASIA 3VZMA 1Y3TA 2HEWF 3AM2A 4I30A 2YPJA 5I0UA 4N9IA 4Q4V1 1LGBA 3KCYA 4XOGA 2Q1ZB 5JOXA 4G9SB 4YG0A 2DTWA 4N90A 3VBHB 2WNVA 1TE1B 2OIIA 2ZX4A 2WL1A 4GULA 3USUA 4XEZA 1S2BA 2E7TA 5K0UB 1DGWX 4Q8KA 4OI1A 1IKQA 2DCZA 4GWNA 3DPRA 1MEC3 2F4PA 1AZDA 2A6ZA 4FXGB 4COZA 1D4VB 4AEDA 5KXDA 3ZXEA 4M3CB 1KFUL 4OVEA 5FMOL 4LBNA 4M3CE 5C4WA 4D3WA 4IV3B 2WT2A 3NAPA 1GANA 4XMAA 4WVMB 4Q4Y2 4KU7A 4QPGB 1HDKA 3VBFA 4BM8A 4JGYA 5BNPC 3MZHA 4YNIA 3T1LA 4W6YA 3AYDA 2XJTA 1U5XA 3PVNA 3WUDA 2A3XA 1IQAA 1UU5A 1ZM1A 2WLPA 1YCIA 4IEYA 1O3RA 1JUHA 3MW4A 2H0VA 2D3SA 1HKDA 3I8TA 1RUJ2 4YW3A 2GC1A 2HWC2 5C9AA 1RC6A 4BOWA 1JXNA 3DGTA 4XTPA 3UV9A 1XYNA 4GMP1 1REEA 5J98B 2VUAA 4AGGA 1MACA 2VPVA 1ULGA 4HETA 4BIOA 4GXLA 3R4UA 5C33A 2JICA 4CDWB 1ZRFA 1FV3A 2VU9A 1M06G 4H3WA 1WLDA 1PO21 1LR5A 2ET7A 2DCTA 1QH6A 1MS1A 3MLKA 2XLAA 4DNYA 1SLIA 4WZCA 1H30A 2BVBA 1OPOA 3E97A 1O7FA 5C8CC 4N43A 1O4ZA 1ONAA 1OFSA 2QE3A 3O0WA 3IPVB 1NCRB 4HL0A 4KWKA 3M3IA 3AZVA 3VBUA 4MSVA 1YI7A 4YVSB 1AR62 3ZIWA 5GALA 1RL3A 1ENQA 4I2OA 2E63A 2CWSA 2C0ZA 5IT6A 2WFF3 1D0GA 3RJRA 4AI0A 3SH5A 2D6LX 2HJIA 4GB32 2RS33 3CLPA 1ZRDA 1TQ5A 1QJU1 4AVVA 1POV0 2VNGA 1NE4A 3I4IA 1QJX2 1LESA 3ZX7A 1ZRRA 5FTTC 4I0BA 2XVKA 1UN1A 2Z5WA 1RUH1 3K48A 1KD7A 4M01A 5IK5A 1FOD3 3ECQA 4LBOA 2DVAA 3GBWA 1WBLA 3MIHA 5JDBA 4AI1A 2OPKA 3WINE 2FHRA 1R1A1 1G8WA 3DUIA 5CU1A 3ZN6A 4F8AA 2WQ4A 1RUI2 2DCJA 3FE5A 4Q0PA 4CDUB 3JZVA 4XFAA 1XNKA 2IXJA 1RUG2 4X6QB 4E2QA 3M70A 5GLVA 2QCSB 3J8F3 1WMEA 2I45A 2D3RA 1CESA 1LHVA 4ZKTB 2GNTA 4N53A 3MPPG 4IEOA 4AQ6A 1W6OB 2A3WA 2PHDA 4DXZA 1DQ6A 2C1FA 2KM2A 2RS51 1K5MC 1WBFA 3O0VA 5FBZA 3QCWA 4QPIA 4GIQA 2ILMA 1DFQA 2JKBA 5KHHA 2WIIB 3KQRA 3RMXA 1VBE3 4EJRA 1RIRA 4XPVA 1H1IA 1JHNA 1XE7A 2B39A 1AL21 3RSJA 1SLTA 1ZZCA 4RSUA 1YJLA 1YIFA 2ENRA 4XZPA 3EHKA 3Q9OA 1VRH2 2ET1A 1OOPA 3NWKA 4XFCA 2JXAA 1DGWA 4AGRA 4JCKA 2BWCA 1R091 3O7OA 2PLV1 3AYCA 4QGNA 1B09A 4PF5A 4E4ZA 1NXD1 1UU4A 2DV9A 2Q8OA 4YLZA 1UPSA 3MIDA 1NCQA 2ZGLA 4MX3A 4BH9A 1U12A 1HX6A 3A4UA 4H14A 4KNCA 5ACA1 2ETEA 4LT5A 2MEV3 3KZ4C 1RHI1 5FMOS 3KT1A 4NHLA 1G9AA 5JSPA 4Q1PA 2HWB2 1W6QA 2A75A 3BCWA 1YIPA 5KHIA 4LBQA 3SNMA 3J4UH 2NYYA 2DFCA 3ES1A 4GH4A 4QT6A 3ZSKA 1V6MA 3P3NA 4L11A 4DOUA 1YWKA 1E57A 1HRI2 3AYAA 4BIFA 5I8SA 3VKFC 2NMNA 1AYM3 3ILFA 3C2UA 2GNMA 3VUOA 3AKRA 5AFBA 4AQTA 1HLCA 3WOGA 1TME1 1HW5A 1RUF3 3W59A 1ASJ3 1LULA 3AMMA 4PQ9A 4CDWC 2ZZQA 3HMYA 3CL1A 4FTEA 1BEV3 1C5HA 1QWRA 5D1IA 1B35A 5K9YA 3WG3A 1AR73 1FNZA 2YDEA 4ASLA 1ULDA 5CFCB 4H55A 1Q8VA 4I3PA 1ULEA 3SMHA 1MZEA 5GLTA 4L92A 4M0NA 4DFSA 4MXVA 2D6OX 2R042 1SQ4A 2CGPA 3WCSA 1JH5A 1Y7BA 4AG4A 4Y1UA 1H9PA 1N3PA 1GSLA 1FX5A 1N1VA 1REFA 1VALA 2AH2A 4RHV1 2XL7A 4OLLA 3BTAA 1ND3A 1NCRC 2A73B 2ZX2A 1LOFA 4KG8A 3LSEA 4WM7A 4QMAA 4XF9A 3UKVA 5ABJC 3AZWA 2IXIA 4FPCA 1AR91 1REDA 2ARXA 1QJY1 3VKNA 3ES4A 2P17A 4JRAA 3WQ0A 3RWNA 4MGKE 3VBRA 4AHWA 5KXEA 4HPKB 1WCSA 2CL2A 5JSRA 1IKPA 1R082 3O12A 1ZREA 1NYWA 2V73A 4Z1VA 1KJRA 3M3OA 1BVP1 4R52A 1HRV2 1CJDA 4YW5A 3RYRA 2X5IC 3DV8A 5FLJA 4XF0A 1CR7A 1RITA 4XBNA 4KG0A 1KQRA 3GALA 4FPGA 4JGYB 5FREA 1MVEA 4Y1VA 1O3SA 3FWEA 3TNQA 1OLQA 4CDUC 5JZGC 3ZXFA 1O5UA 3ENRA 1W0OA 2JG9C 2VNOA 5K0UA 3MF6A 3MDPA 4TYSA 1LTEA 3B93A 4EN6B 4S2FA 2A6XA 4GMP3 1TMF2 1WLWA 2B8MA 4RA0A 5GZEA 4LBLA 4FP3A 4PCRA 4F3JA 4K1YA 1YXWA 3WG1A 2XG3A 2DCKA 4QPGA 4QXKA 1LHOA 3FMGA 1PO23 4D7TA 4EWAA 2MPFA 2Y26A 4R4ZA 1DQ0A 4P9WA 3TBDA 1RUD2 3TWIA 1ULCA 3TAYA 2EXKA 3JQXA 2D98A 4CDQA 2CGNA 2BNMA 3VBSC 3GNEA 1H8TC 3RNSA 4CZSA 4Y5Z0 4A3XA 4FPHA 4XHXA 3HT2A 3E6CC 4DQAA 3UK9A 1Z7S2 3NO8A 4HK9A 4Q4Y1 2CY6A 1A6CA 3MICA 4OHZA 3D5OA 1OPMA 1ZZ8A 4JAAA 4BLJA 1IZ3A 2PAKA 2H0BA 2R072 2TBVA 4E2GA 4FPYA 2XJRA 3U07A 2WKKA 1IHMA 1WW6A 3ELNA 3KS7A 2PHLA 2DCYA 4FVVA 4Q2FA 1YFWA 1EYBA 5DG2A 1QJU3 4OZXA 2VNRA 3J26N 1WUVA 3LOIA 4L2NA 3GHNA 2A3YA 4GALA 2LTNA 3N4MA 1RUJ1 3I59B 2HWC1 4IERA 3B01A 2NN8A 1IS3A 3ZYJB 1EAH2 3L9JT 4N7UA 1RUH3 4BHPA 4XIKA 2FMDA 2ZS6B 3B9IA 3ZO0B 5K8SA 3FFZA 3FJSA 3IPVA 4YZ2A 1Q8OA 1R1A3 3RQ0A 4FPKA 4D7YA 4YVSA 1ZBA2 1BXHA 1UCXA 4UBGA 3ZN6B 1YLLA 1QGLA 3LWCA 4OHVA 1ZZ6A 3HN1A 5CBLA 1S0EA 4R9AA 5I0SA 1BKZA 3HBZA 5GLZA 3WT3A 4C0BA 3UJOA 4CEYA 5KC6A 4N53B 3AP9A 2FQPA 2RS53 1VBA2 1XYOA 1QOOA 2AENA 2B45X 3FUQA 5GZGA 5FO9B 3NV4A 4YGBA 1AR61 4B4QA 5C6CA 4ZU5A 2ZGTA 4Q4X3 4F83A 1AL0G 3R4DB 4GB31 2RMU2 2H6BA 2CTVA 2YXSA 1LCLA 3OYWA 2MHFA 3JBG2 4MGYE 2YROA 2DU0A 2ZGQA 4HSLA 4PDWC 1VLNA 1QJX1 5A3LA 1RUOA 1AL23 3ST7A 1Z78A 3URFA 2JE9A 4I0WB 2YHJA 3VHPA 1GZWA 1CJPA 2VOXA 2Z42A 2WA4A 1W6OA 2V5YA 1SLLA 5DZGA 1FPN2 2TEPA 2WNVC 1IGOA 1RUI1 3TN92 1KRIA 3VZJA 1R093 4M3CF 2PLV3 3WZ1A 1DYKA 1RUG1 4XBLA 2GNDA 3PJYA 1IS6A 3DPRC 2RM22 1N1TA 3E5UA 2V09A 2XGXA 4AEDC 2D44A 2XKOA 3ZXJA 1U5YA 3T2TA 5C4WC 1RHI3 1UZZA 3NAPC 3VBFC 4JGYC 2FZ1A 1W6QB 2GMMA 1G6NA 3HIFA 4NPRA 1C8M2 4XW3A 2JDZA 1UF2C 4GH4B 2G9GA 3MIBA 1GLHA 3D6EA 2EA7A 4PBPA 4FTSA 1C28A 1XXNA 4N7IA 5C9AC 3PLQA 3IWZA 4MXWB 1QH7A 2QVSB 4O9GA 4B4RA 2XKPA 2GC3A 4MGZE 3ZSJA 5FPXA 3OY8A 1VRH1 1YUDA 3ETQA 5CAZA 2WT0A 2XWBB 2PHUA 4YW1A 3KD4A 1EV12 2AGSA 3ZSEA 4AQSA 3M4FA 1LODA 2NMOA 2WQZC 2ZGPA 3IDCB 3UJQA 1D2QA 1PGW2 3DKWA 1OA4A 3BU7A 1LOGA 4ISRA 4JV4A 4XIOA 3H3UA 3U4XA 3QACA 2CWMA 2HWF2 4LUKA 3VDDB 2SBAA 4F7