4HK9A

Crystal structures of mutant endo-beta-1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
188
Chain Sequence
IQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGHFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
total genus 57
structure length 188
sequence length 188
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hk9A00
2DFBA 2DCZA 3AMNA 4IXLA 4XQDA 4HKLA 2DFCA 2JICA 2B45X 3AMPA 4H7MA 3LB9A 2VG9A 4NPRA 2C1FA 2VUJA 3VZKA 3VGIA 1XNCA 2B46X 5EJ3A 1XYNA 2DCKA 2JENA 1HV1A 1XYPA 1C5HA 2JEMA 4XQ4A 3WX5A 2B42B 3O7OA 2NLRA 1H4HA 3RI9A 2NQYA 1PVXA 3WY6A 1REEA 2BW8A 3VHNA 2QZ2A 3VL9A 3WQ1A 2Z79A 1QH7A 1UU4A 2D98A 1BK1A 1H1AA 4HK8A 3AKRA 1BCXA 2VGDA 1AXKA 3VL8A 3WP6A 1YNAA 4HKWA 2DCYA 1W2UA 1QH6A 1HIXA 1XNDA 3AKTA 3WP3A 1XXNA 1UU5A 2VULA 2BWAA 2DCJA 1H4GA 2D97A 3AMHA 4S2HA 3VZOA 1OA4A 1T6GC 3AKQA 1REDA 3WT3A 4S2GA 1TE1B 3B5LB 3WQ7A 1BVVA 3VZJA 3MF9A 5K7PA 1KS4A 1H8VA 1C5IA 2BWCA 3MF6A 3AMMA 2F6BA 1H0BA 1HV0A 3MFCA 3VHOA 1UKRA 3EXUA 4HK9A 3WXPA 1F5JA 3WP4A 4S2DA 3MFAA 3WP5A 1XNKA 3WQ0A 3WR0A 1OA3A 3VLBB 4HKOA 1OLQA 2BVVA 3ZSEA 3B7MA 1UU6A 1M4WA 1NLRA 1KS5A 4S2FA 5K9YA 3AMQA 1XNBA 3AKSA 4XQWA 5HXVA 3VZLA 1REFA 3M4FA 3VZNA 3VZMA 3RI8A 1XYOA 2QZ3A 1IGOA 3LGRA 3HD8B 1OA2A 1ENXA 4XPVA 1OLRA 3AKPA 3VHPA
chains in the Genus database with same CATH superfamily
4QX0A 2CWMA 1O7FA 2EXJA 2GH8A 4XOGA 3NNLA 2JKXA 5EV7A 1DG6A 1NLSA 1S0JA 4CDUA 4GMP0 1VIWB 1H6XA 4LEJA 4JTNA 4WZCA 2PA7A 1G8WA 4CVUA 5L7OA 1LGCA 5L7OB 2PHFA 2LM3A 3D82A 3H9AA 3I7DA 3N35A 1KXGA 2VTXJ 5C7GA 1VB4A 2CU5A 4Y1VA 3VDCA 2ZZQA 2VMHA 2YY1A 5LATA 1Z78A 1SG3A 2OPWA 1OC1A 1UY4A 4KWJA 1D0GA 3FBMA 2J1AA 3QACA 3S0MA 4D3WA 2UYBA 1UZVA 2XJVA 1O5LA 2QQLA 3CF6E 5FZBA 5DABA 4CDWB 1REEA 2ZXQA 4KG8A 5IK7A 2YGMA 1QJX3 4OQ8A 2OW4A 1F4HA 1R1A1 4DOUA 1JOJA 4AFAA 3UKTA 3APBA 5FZDA 4WVZA 2VZPA 4CCKA 3NO8A 1UYXA 3OGJA 4R9DA 5C8WA 1WBFA 4QM9A 1N3PA 4HLTA 4ZZ5A 2XBO2 1WMXA 1SLIA 1TME3 3PJYA 4CRQA 1W8WA 3LEKA 5IVCA 2VW1A 1C28A 4YM3A 2W3JA 2TNFA 4HPKA 3T2TA 4HPKB 2D5FA 1US2A 4JGYC 3DYPA 1DLLA 3FBYA 2JIJA 2X05A 4RHV2 3RZGA 5F3IA 5J48A 4FPJA 2R32A 4B3NA 5FUIA 4COUA 1WLWA 4MGIE 3MF9A 1PMIA 2VNGA 3AM2A 1V6OA 4N43A 5LA0A 4QXCA 4ASMB 4YVWC 3POBA 1H0BA 2CTVA 5FZCA 4H2AA 1NY72 5FYZA 4RQPA 4AVSA 3USSA 3B9CA 2WZR2 5ACA1 1HRI1 1W9SA 2FZ2A 1SLTA 4Q0SA 1V6NA 4FI9A 4ZKTB 2XHKA 4U2AA 4YG0A 4A4AA 2WO3A 1LULA 4HETA 1BBT3 4J6GA 2ZACA 1W3VA 1KJLA 3AX4A 3VD4A 4GB32 5FIXA 2A6WA 5JSOA 1Y7BA 2WNUA 2WO1A 1VAVA 1O8PA 2WNUB 4ARXA 1JZ2A 1JYIA 5FJHA 2A6YA 1R092 2OPKA 1KJRA 4PJYA 5HV4A 5FO9B 4EZ4A 5DDJ1 2V5DA 5F5QA 3ZSJA 4Y3OA 1SEFA 4XQWA 1NZCA 5FTTC 4XDPA 3BN6A 4MHUA 4OULA 1PO21 5LB6A 2MEV1 2XDVA 4MXWB 5KXEA 1RHI1 2WIIB 5JOXA 3VZMA 1OOPC 1W9WA 3RI8A 2YC2A 4MX3A 2X5IC 4RS5C 2XJUA 5FK7A 1VRH3 2ENRA 5CKQA 4K8FA 4NHMA 4IE6A 5AFBA 1N1YA 1OH3A 3TN93 4QQ2A 1YQ8A 4BK5A 2IFRA 2PQSA 1RB8G 4K21A 4GZ9A 4LE3A 1FPN3 1R1ZA 1JOPA 4RR3A 4RR3B 3A4UA 2F4LA 3CDZB 4P5HA 4ZU7A 1NQJA 1AF9A 4Z92B 2ZGNA 2ADEA 1PIV2 4LBLA 4UFKA 2ZEZA 2JICA 1IKPA 2B45X 4Y1ZA 3S5QA 4KQ7A 4QGLA 4FQ4A 5JIAA 2DU1A 4QU1A 1RUJ3 2D3SA 2ZGSA 4HSLA 2FDKA 4A2UA 4XJZA 1RUC3 3TRSB 1XJAA 4IGPA 4QKFA 1NCRB 3KMHA 3ZFGA 1JW6A 4QDRA 3KT4A 3W5NA 1V70A 3OY8A 5KXBA 3FE5A 3GZTB 3KF5A 3JD71 1RJ8A 3BCWA 3H42B 1UIJA 3BTXA 1DZQA 3UGGA 5FPBA 1HXS1 1S2BA 5LK5A 1VBC2 1W0NA 4DY3A 4JKMA 4RFT0 5F39A 3VBHA 2VC9A 3LA7A 2W08A 4XC9A 2I45A 1D0HA 2HEWF 3H3ZA 4HFSA 3O1MA 2ES3A 3HAGA 1OLMA 4FQZA 4FPKA 4Y5SA 3RRDA 1YNAA 1V0AA 1YFUA 1SLAA 4DUVA 1YRZA 1W03A 4ATFA 2W52A 1ZZ9A 2HEYF 2HWE2 1I9RA 1YFWA 1DYOA 1XNDA 2IZWA 2R041 4I01A 2WQ4A 1UX6A 3PVOA 5BXXA 1V9U1 2NMNA 3IM0A 3SC7X 2UY9A 3NJZA 5JR2A 1N1SA 1RUI3 2XLFA 1NKGA 5J09A 4D6QA 3BVCA 1ZBA3 2BV4A 1BVVA 2DCTA 1RUD2 3H7JA 5L9VA 3ECQA 2CAVA 5LA1A 4UWDA 2C24A 2D7FA 5K7PA 1UL9A 2PLV1 5FZMA 1CGPA 3VHRA 5GKAC 3GNEA 1OD5A 2LRPA 2FBEA 1TMF2 2Z42A 2ZAAA 2IC1A 3LA2A 3KV9A 4Q2FA 2PYTA 2XBO3 1KQRA 2V4VA 2Y60A 4N7IA 3H1MA 3P3PA 2IXIA 1QJY2 4IETA 4V2VA 5GLUA 2PHUA 3MBWA 1V6JA 5JXJA 3ES1A 3HEIA 4W4ZA 5EYYA 4GKYA 3AL5A 2J1TA 3WDVA 4N53A 1FYUA 3KCCA 3HT1A 3LE0A 1H8TA 1H8TB 4B4QA 1SPPA 5FMOS 1SPPB 4N9HA 1A8DA 4BQWA 3K2OA 2GNMA 3HNBM 1Y43B 4XF4A 1OVPA 2Q0AA 2UURA 3NAPB 1Y4WA 2VCBA 5FP3A 1WCKA 2RMU1 4B1MA 1ASJ1 1ST8A 4LK6A 4W6YA 3W9AA 1YHFA 4KU7A 2C4XA 2ZJCA 2VNVA 3VZLA 1WCDJ 1GZ9A 5IWFA 3EB7A 2QJVA 1IS4A 3LFMA 4FPCA 1QJFA 4XF1A 5FZAA 3WLUA 3K3OA 2QZ3A 1IGOA 4CU8A 2W68A 1UPSA 2RM23 2XL7A 3HIFA 3K46A 1FV3A 2WN2A 1AR91 1YFXA 3AYAA 2R061 2JIGA 1HB1A 3MPPG 4COYA 2DVAA 5FPZA 3AKPA 1POV1 3O1UA 4E27A 4OQ9A 3DKWA 2ZGKA 4QKNA 2ZZJA 3AZXA 4JGZA 2Y6GA 1HKDA 1L7RA 4XFBA 4AFBA 4EWEA 5C71A 4AEKA 3BIEA 1HB4A 3UL2A 4PF5A 3T2OA 2EXHA 1X9TA 3HWJA 2W47A 4BMEA 3NV1A 5CKMA 2LROA 4CDXA 3RNSA 4CDXB 3MGUA 2B8MA 3UKNA 1BKZA 3BOPA 5I0RA 4PDWA 1COV1 4EJRA 4IV3A 4IV3B 3RQ0A 4C0BA 1C5HA 3POGA 4OFGA 2Y6HA 1RUE1 1RUNA 5BUVA 4AEDC 4GWNA 4DXTA 2WZPP 3WNXA 2HWC1 1KDKA 2LUWA 3DUIA 5F32A 1NZIA 1KFXL 2BTVC 4FPOB 2XHNA 4MYEA 4AFCA 3DPRB 1NA1C 3SEEA 2Y34A 4GD4A 5E8AA 2JDPA 3SISA 4EE2A 2FMYA 3PVBB 4BE3A 4A44A 1UN1A 2ORZA 4QXBA 3VL8A 4IE7A 3CIHA 4K9SA 4AI1A 3A0NA 5F3CA 1ZX5A 3GCWA 3LIGA 4PLMA 1QH6A 3ACLA 5FOBB 1E5HA 4Z1VA 3M70A 4HL0A 3WP3A 3N9NA 4P00B 2BFUS 2YB7A 1B35A 2Q5TA 3QD6A 1CX4A 1JHJA 5ACA2 1HRI2 1YJKA 4XFIA 2XGXA 1WLCA 5A3PA 5C33A 3N4MA 3EBRA 1TZOA 1MEC1 1WW6A 3CZJA 3PVEA 1HQWA 1SFYA 2VVFA 4IV1C 4KWKA 4D69A 2Q1FA 2H6BA 4UFJA 1H6YA 3WV6A 1RXFA 4CP2A 4OI0A 1MZFA 3O12A 4D7SA 1RXGA 2P37A 4Q26A 2WO7A 1PZ7A 3T3YA 4CDWC 2A73B 5F9TA 1JU4A 5KHJA 1JI6A 3V0BA 1PVC1 1UIKA 2OQ7A 5IUQA 1D4VB 1OF4A 3AC0A 5DDJ2 4BLJA 1PO11 5JZGA 1WLTA 5JZGB 3MFAA 1QKQA 1MS8A 1HQLA 4LBMA 1F4AA 3E6DA 1PK6A 1PO22 1PK6B 1AJOA 2MEV2 3RZMA 1BVP1 3OUIA 4YVSC 1RHI2 4CCNA 4W6XA 4MG2A 5E16A 5FZ8A 1LOAA 3LQCA 2FCUA 4BXSV 1ODNA 1XQNA 4UBGA 1OSGA 1EY2A 5DAPA 2RS51 2A7AA 3WHUA 3H3UA 2IVJA 4LBQB 5FBZA 4RFRB 5CFDC 1GWLA 1ZZ8A 2PAMA 3ZYPA 4LBJA 3THCA 1CZVA 3OBZA 4MSVA 3JQWA 4MLOA 4YG3A 4MH0E 5FYMA 1JYTA 1K5MA 1EYBA 1N47A 1K5MB 1REFA 4W50A 3M4FA 3BODA 1IHMA 5FP4A 2YPJA 4ATEA 1LR5A 1QIQA 1RUOA 3QLQA 3GZAA 4LJHA 1QJY3 4DXZA 4FOWA 1XE8A 3MIEA 3O0XA 4Y33A 3ZXEA 4AVAA 3H3LA 4A41A 3MI8A 4CSWA 4NE9A 1LESA 2E63A 2JE9A 2W94A 4XZPA 5DUVA 5C6CA 3E5QA 4B7KA 2SBAA 1RMU1 1IOAA 2R0FA 4Q0PA 3I2JA 3R4SA 1GFF2 1MVEA 1YWKA 3C7GA 1PM4A 5IHRA 2UWAA 3O5SA 4QPWA 4UBHA 4NIGA 5JCTA 1V6KA 4PBOA 5C8CA 5C8CB 3ABZA 1QGLA 2ATFA 4JKKA 1H1IA 4BB3A 5TSWA 3JD72 5CNAA 3WINE 3RWNA 4AAPA 3LB9A 4H14A 2IXCA 5A7OA 3X29B 1GSLA 2DVBA 2VUAA 1HXS2 2J7MA 4B4RA 4P9GA 3RG0A 1X7NA 2WSVA 2QBXA 4QPGB 4QPGA 4DXRA 4TWTA 3VB9A 1QHDA 1WUVA 3SNMA 4FTBA 4QDSA 1NT0A 4QAWA 4F3JA 4PF1A 5FYUA 3BYWA 4HMZA 5IFPA 1GWMA 5CISA 1UMZA 3GF6A 4QB2A 1HV1A 3N9OA 1GP6A 3L9JT 4LO8A 1AYN1 1CAXB 4KBBA 4BIOA 4FOQA 4ZU5A 2JECA 3AP4A 4I30A 2R042 2BW8A 2I74A 5FZFA 2FDJA 1OPOA 1C8NA 3B01A 3DF0A 3KSCA 4M3CE 3ZXFA 3OPZA 1GMMA 1DQ6A 3OGRA 3LEGA 2BZDA 1QNWA 4IE0A 4LA2A 2XKOA 4FXKB 1GNYA 4NMIA 4X6QB 3ZYHA 1UYYA 2DBIA 3JQXA 3LCPA 3P6BA 4HANA 5C3RA 1BK0A 3OTFA 3OOXA 2YBSA 2XUMA 3KV4A 3TEZA 1CVNA 4H7LA 2PLV2 1R1A3 2ZGPA 3RVHA 3PDQA 3WW1A 2EIEA 5FDBA 2YFUA 2QTWB 5FK8A 4I02A 4M01A 1JODA 1VMFA 1YIFA 3DYOA 1CESA 1GQGA 3MLJA 1W6PA 3IPVA 1W6PB 3WUDA 5FPLA 4B7EA 4XAEA 3AKQA 1VJ2A 1AYM1 1GOHA 1NCRC 4NPLA 4HOOA 2RE9A 2OVUA 2RV9A 3FWEA 3B94A 4LHSA 2DYCA 1VE0A 4Q1PA 4ZS3A 3ITQA 5K4LA 1BEV1 1MS4A 3B00A 2YG0A 1POQA 3JXSA 4RD7A 1O5UA 2WT1A 3ACFA 3M3CA 4MGSA 1HQNA 1U5XA 2VNOA 1QOSA 4UW3A 2RMU2 1ASJ2 4BISA 1QJU1 2TBVA 4HBNA 3DECA 5LK7B 2E7QA 3IDCB 5T3NA 1XNKA 1RGSA 3WR0A 1N1TA 5ABJA 3VBFA 2Z2SB 5ABJB 3PTRB 5FMCA 2Y0IA 4PHZA 3ZFFC 5T5JA 3NMBA 4H55A 4BIFA 4LOTA 2BVVA 1MZEA 3VV1A 3U78A 1O3RA 4Y1YA 1AX1A 5EPAA 1AR92 4XILA 5FYSA 2R062 2OUHA 5L19A 1IZ3A 1H30A 4Z2WA 3K3NA 2HWF1 4IERA 4E4ZA 2W2IA 2Z4FA 3D0SA 2TUNA 4IEWA 4LLOA 2UY8A 4AXOA 1X33A 1UAIA 3OBTA 3IWZA 3INAA 1NCQC 4R9AA 3AVRA 2X10A 5APAA 3VD5A 4AGGA 5DDJ3 3MDPA 2QE3A 3WQBA 1C8M1 3IMMA 4A7KA 4NRPA 4Y24A 1CJDA 2GSYA 4RSUA 2F17A 5FUNA 3NVCA 4KU8A 2WNEA 1J58A 4BWOA 2GC1A 3WZ1A 3VHPA 2R1DA 5B4XA 3ZDVA 1COV2 1NY71 4XQDA 1Q3EA 4HKLA 3IDEA 3TAYA 3KQ4B 1RUE2 1VBA1 5JXHA 4YZ4A 4BCUA 1VRBA 5DN2A 4ZXEA 1CD3G 1ZM1A 2HWC2 3VKOA 1JUIA 5AFEA 3K51A 5JMCA 2VUJA 5H9RA 2BVBA 1HRV3 4RGAA 4A6OA 3NAPC 1XNCA 2W1WA 4GB31 2BJSA 1TQ5A 3QOPA 4IESA 4R9CA 2RS33 3RZZA 1XYNA 2VOWA 4URTA 4YNIA 1ENSA 3M3OA 4XCBA 3RZJA 4Q0QA 1MS1A 4LKSA 1XC6A 4I0WB 1BZWA 5C3SA 5FY9A 2XJTA 2KM2A 2ZX2A 3VHNA 1LB2A 1LGNA 4FAHA 3MIBA 1AJKA 2RHPA 1C57A 3AZZA 2JDZA 4Q4Y3 1WW7A 4NHKA 1IKQA 4CEYA 2OZ6A 3A7QA 1MEC2 2JDNA 1OPMA 5A7SA 1W6MB 1EAH1 1DCSA 1ZZ7A 4LIVA 5G05L 5CADA 1DGWX 2IUWA 1HIXA 2BBVA 5FV3A 5L73A 5FY7A 4QHOA 3HN3A 1FXZA 5DAVA 2JG8C 1Q5OA 3AMHA 4WM7B 4WM7A 2YGLA 1QQP3 4DNYA 4KNCA 3CL1A 3DKQA 4YM1A 1PO12 1W9YA 3LSEA 2SLIA 2O14A 1J1LA 5FR3A 3VZJA 1V9U3 2VBDA 2ZA9A 2LS6A 2ZX4A 5DUXA 4AR2A 5BNPB 1OQEA 3N9MA 4JRAA 5JI7A 4YFZA 3E6CC 3R6SA 3I8TA 1HV0A 3MFCA 4KI5M 4Q4X1 4XUQA 4ASKA 1WZXA 3EXUA 2YU2A 3POJA 2JG9B 2RS52 2VAUA 4BLIA 1DQ2A 4TZDA 3DPRC 3GJAA 3OUHA 3TOJA 3ZN6B 4AI3A 3TYJA 4C0HA 1D4M3 2QDRA 2VE1A 3AZWA 1J59A 3SH5A 3ZFEB 2VMFA 5LBCA 3JUUA 1OA3A 3ZO0B 4ET7A 1LHNA 3OJBA 2D6LX 2JWPA 2O0OA 4IGOA 4B29A 1W8TA 1NE6A 2VQAA 1W8FA 4QPIA 1ZZBA 4QPIB 5A32B 4J25A 5A32A 1QJEA 2FD8A 4YLZA 5E6HA 5JR7B 2WDBA 3FHAA 4XETA 4IEVA 4L92A 1RMU2 5HXMA 2YDEA 1CJPA 2HWE1 2WNVA 2WNVB 3I2IA 3EMRA 3OEAA 5BV6A 2V4AA 4AQ2A 1MS3A 3LDKA 1OH4A 3RSJA 3Q9OA 4HONA 1RC6A 3JBG1 4YFWA 5F5IA 4YRDA 2RMU3 3E5XA 2E53A 5IVFA 2G9ZA 3NNMA 4AQ6A 5T52A 1GZWA 1GZWB 2A6ZA 1O4TA 3CHXA 4LMFA 2FCTA 5AC93 1KEXA 2HWB2 5CVRA 4AQTA 5FY1A 3T30A 1S4CA 4JHZA 2GDFA 4UFIA 4AF9A 3AMNA 5F2WA 4JQTA 5EP9A 3ACIA 3DEMA 4F7ZA 1UY2A 2AACA 2R063 1AYN2 5FPXA 2XLAA 1OT5A 3E97A 4XJ9A 2GALA 1XOYA 1S55A 1FMD3 4RGKA 3I97A 5EWSA 4P9JA 1Z7S1 3UJQA 3RDIA 3GBGA 1WD4A 1BMV1 2A6XA 4Y20A 2Q1MA 3TB0A 3E6BA 4Y20B 4YGDA 5EJZB 3OD4A 2XJRA 4LO5B 1RTVA 4CU9A 1SQ4A 2ZEWA 1A8MA 3MW2A 2BEOA 4LO4B 4NROA 4A45A 3RYPA 5FP7A 4HG6B 2V5YA 2ET7A 3RI9A 1ALYA 3BIWE 3KT1A 3H8RA 1WKYA 2QZ2A 5F5CA 1CWPA 2HWD1 2QCSB 1JTZX 4GKXA 3ZVXA 1CN1A 3KB5A 5F5AA 1DIWA 3RFRA 1RL3A 2OA2A 4NJ4A 4CDUB 1AYM2 4AEDA 1BCXA 5FZLA 3AYCA 4WM8A 1AXKA 2VOKA 4WM8B 4YG6A 4BQ1A 4CEWC 3ZMNA 4Q8LA 1TEIA 4FPYA 2OYZA 3W21A 4JTOA 4QWNA 2XH6A 1BEV2 1LEDA 3WNOA 1LHOA 2WS93 2Y64A 2BWAA 3ZXJA 1Y9MA 1UOFA 1YIPA 1Y3TA 2QQVA 3PIGA 1CPMA 5A3LA 5EIYB 1F9KA 1W8ZA 3LZZA 5FMDA 3T1LA 2FQPA 2WWJA 1CZTA 1QJU2 3AP9A 1P8JA 1JHNA 3B5LB 3IDBB 3OYWA 1LOFC 2J1VA 1QOOA 3OYWB 1J1TA 2QQUA 4UYBA 1QXPA 4UFMA 5JIUA 3POWA 1X8EA 3MF6A 3QH6A 2E6VA 1ULDA 3OGSA 1JOBA 4Q4V1 2BGPA 3VHOA 2R071 3LOBA 2R30A 4HK9A 2Q8CA 4NO4A 4I2OA 4BQ5A 1DBNA 3NRUA 5EYXA 1QU0A 3GYDA 2HWF2 2OKXA 4AFMA 2A3XA 4META 4YM0A 2WZ8A 4UAPA 2WA4A 1UOJA 5EJ1B 1B09A 2CY6A 3CKHA 3MICA 4FP3A 1PVC3 3RPQA 4DB5A 3ROUA 1UZZA 4HKOA 5HCFA 3AYDA 1OKOA 2VMEA 1RUF3 1X8MA 1C8M2 3I2GA 4YM2A 3ZSEA 3PU3A 4XCAA 4NHXA 1UU6A 4AEJA 5LBEA 4BXFA 4N43B 3C7HA 1VP6A 1XNBA 3LD8A 3FLPA 2Y8KA 4XUOA 3VBRA 5A3UA 1VBD1 2D3PA 4LUMA 2HBTA 4R52A 4RQPB 4AGRA 1IG0A 1OMIA 1BYHA 1VBA2 4IDZA 5CFCA 1GQPA 5CFCB 4PI2A 3HD8B 3J4UH 4CP0A 1ENXA 2OT7A 2CSGA 2XXZA 5BNNA 4XABA 5BNNB 2NM1A 2VVEA 3OGGA 3VBUC 2W0XA 1D2QA 1ZA4A 5GZDA 3U37A 4P02B 1UY3A 1ZRDA 2XG3A 3CJIC 4GJYA 5JOWA 4RN5A 1AR71 3K75B 1LENA 4AI0A 1UXXX 4ZPIA 3KCYA 2VQ0A 4ZHNA 2PHWA 2DVGA 1V00A 4XBLA 5FKBA 3BOWA 4Y22A 4Y22B 3ZPOA 5FLIA 4MHRA 2VZVA 3HQUA 3THTA 1H2KA 3CJXA 4GXLA 5IAXA 1NYWA 4I3GA 4XVHA 1MS9A 1SLLA 5IAVA 4D7TA 1K42A 1YEWA 1LOEA 2CGOA 4D6SA 4KH9A 4QQPA 4AHZA 3MIHA 3O7OA 1EAH2 3WD5A 4R8HA 2WRAA 1HDKA 1Q8VA 2NQYA 4QDQA 4IEYA 5DAWA 3ZXLA 4L0PA 3ZN5A 3N9QA 3PHMA 5T5LA 1DYPA 4DEQA 1JU3A 2J1UA 4XACA 2FDHA 1UU4A 1A3KA 4QT6A 1AYN3 2E9QA 3HMYA 1GANA 1XU2A 4GH4C 1LNSA 2NYYA 3ZX7A 2LW8A 5A7WA 5IJRA 4XF3A 3AYEA 4Q27A 5A7WB 3WP6A 2YYOA 2Y6JA 1O91A 2W91A 5C9AA 5C9AB 3HJRA 3ZFGB 3WW2A 4Q4X2 5AVPA 4PBPA 3KD4A 2DCJA 5IVYA 1GOGA 5FWEA 3OY8B 4S2HA 1NE4A 1FOD3 3VZOA 1QDCA 2VUCA 3FFZA 3RZKA 3C3VA 4MADA 3O0VA 2NP0A 2VBBA 4QGMA 5DG2A 3WDXA 2A3YA 4CCCA 3VBHB 3LEMA 2JE8A 4YZ2A 1SBFA 4QU2A 1Q8SA 2UWCA 4GA9A 4OHWA 2XJSA 2P4EA 5FY5A 3G6JB 3J7HA 1A34A 1OLME 1ZA7A 2BGOA 5A6QA 5C4WC 4E2SA 2VU9A 1W9TA 1GP4A 4IUGA 1H1MA 2RS12 1R081 1PM7A 2W1SA 2PXJA 3KF3A 4JDOA 1BEV3 1OQDA 4MXVA 5J1XA 1YI9A 4I09A 2FMDA 2C9AA 1S2KA 2WFF1 3GDBA 1JN2P 3MV11 3WSOA 4BK4A 3JBG2 4L97A 3I2HA 2P1BA 4XFAA 4IW3A 1JYWA 1UZWA 2AGSA 2DUOA 2YHJA 3OPTA 1Y9GA 4XTPA 4XXAA 2DUPA 2P17A 5D8AA 5D8AB 3HOBA 1D2SA 4D0QA 5A1AA 1SFNA 3Q8EA 1AL21 4COWA 1DGLA 1ND3C 5HXVA 3MLLA 1ND2C 2ZCWA 3MIGA 2EAAA 4U36A 4XJ8A 2Y26A 4SLIA 4UFLA 5H9QA 1VLNA 5BNPC 2VCAA 2D6MA 4AOCA 1AR81 2NZ9A 4MGYE 5FZHA 4RA0A 5I93A 2ILMA 4FPFA 4EZHA 4YW5A 2Q30A 4AHXA 3H8XA 1JYCA 5DXDA 2JG9C 4N53B 3IKWA 1Z7S2 5FP9A 2C6SA 3E5UA 3KV5A 4RHV3 3U14A 5FPUA 1BMV2 1X9PA 4DINB 3ZFEC 4AVVA 4BHPA 1A78A 2EAKA 2Y38A 5JWPA 5IYYA 4BM8A 2WQ8A 2VCMA 4Q4W1 5FP8A 2VCCA 3WG1A 4G3YC 5DMYA 1RJ7A 2ZHKA 1GZCA 1LECA 1DQ4A 1PZ8A 2HWD2 2VD7A 4JKLA 3VGIA 2PN5A 4RGGA 5JXIA 3MO4A 3WEZA 4MZUA 4CDQA 1UPIA 2WZR3 5FY0A 2VZ1A 4CDQB 4IEOA 1F8VA 2ZTNA 5FZGA 2Q8DA 4DMIA 1VBB1 2PHXA 2XMLA 3WX5A 2JENA 3RMYA 1W05A 4XQ4A 5C3PA 1G9DA 3IIIA 5A3TA 1O8SA 3C7FA 5DAQA 1MS0A 1ENQA 4AG4A 3BU0A 1PVXA 4GB33 1RUG2 4KGQA 2OZJA 3BPZA 1DGRA 5KHKA 3F95A 4DY5A 2VZTA 2EXIA 4FT8A 1WCQA 3SMHA 1R093 4JGZB 4HN0A 2EF6A 5JPNB 2D3RA 4NR1A 4CZSA 5DQ0A 1ONAA 1FAYA 1VB2A 4UXAA 1AR61 3VKNA 2EIDA 2JJ6A 3GCXA 2CHHA 3AJZA 3NKTA 4LOSA 1DLCA 4ZY9A 5A33A 5A33B 2R1BA 2Q8OA 2VXRA 3SLIA 4ISQA 1OFNA 3NNGA 4N9IA 5A6ZA 4PDWB 4Q4V2 2ZAHA 2W92A 2R072 1RUH1 1WD3A 2CV6A 3AK0A 1X82A 1GLHA 1CONA 4PQ9A 3T08A 2P2KA 2P3KA 3UGFA 2XPJA 4UI9L 4MO3M 1DP0A 5FZIA 3K48A 3OSDA 1W8OA 1SCRA 4FVVA 4BQXA 1DGWA 2AEZA 2PFWA 4V2WA 1QXRA 2BWCA 4O9GA 3AMMA 4FFHA 5BNOA 1PIV3 4LR4A 1YC61 3VBOC 2QQPA 3VKMA 4JV4A 4UFHA 4COVA 1UKRA 1OFSA 3I2OA 3KHBA 1I6XA 3TNQA 1I1EA 4XUNA 3UJOA 3T2PA 2HLEA 5GZGA 3KHCA 4AEMA 2GU9A 2I2SA 4CDUC 3NJVA 2ZHNA 1QY4A 4K6BA 2LTNA 3WDTA 3WP5A 4KBZA 4PT6A 1VBD2 3NL1A 1B35B 3D5OA 4BMBA 5F37A 1UZYA 5L7OC 4D6RA 2WWSA 5K0UA 1HN0A 2G9FA 1LODA 5K0UB 4TLFA 5ISLA 1VBC3 1KS5A 5LBFA 2QQWA 1YO8A 2VMCA 3AMQA 1K12A 5FPVA 2G19A 2KD7A 1MQTA 5CG8A 1MQTB 2WSUA 4C8DA 3B9IA 2ZABA 2VJXA 3POEA 1AR72 1UCXA 3V0BB 1S0GA 3W59A 4HT1T 4XJUA 5EZWA 4CPBD 1QJX1 2DBNA 4I0AA 2BNNA 1WGPA 2QQOA 5FQ0A 1OA2A 2HWE3 2D40A 2RDRA 4JX0A 5FQ0B 1RVF2 3CU7A 3WW4A 4L11A 4O7XA 3ZYJB 2IXJA 4J1XA 5JI9A 1EP0A 4HVOA 3KVAA 1HJFA 1OBNA 1UO9A 4IXLA 5C3QA 2YFZA 1WCSA 1TME1 2W9XA 2BRTA 1RUD3 1UXZA 4M0NA 3WG4A 1N1VA 1BXHA 3PMEA 4H7MA 2PQQA 4P9YA 1YQCA 3LF7A 1UOBA 3VBSA 1TMF3 5KHHA 5FXVA 3PUAA 4E2QA 1VMJA 2DV9A 2HH9A 5JLVA 1EUTA 1IS3A 5GM0A 2IXLA 1XPWA 2JXAA 2FZ1A 3LPFA 4N43C 1PNFA 4XBQA 2DCKA 2W87A 1XYPA 4OVEA 3VDDA 2YBKA 3VDDB 3LDBA 4CCEA 1W2TA 1TG7A 4LBOA 3M3IA 4RQPC 2IWGB 3ZXGA 5A1FA 1J3PA 4JCKA 1HW5A 1ZREA 2GP3A 3N9LA 5FZ6A 3M8LA 2Q8EA 4K1YA 3VL9A 5FFOC 1LKNA 2JDKA 1C4RA 2GC3A 2BNMA 2JDMA 3FLTA 4M4RA 5J7MA 1BK1A 1BBT1 4R9BA 3OPWA 2YC4A 3IT8A 1G9BA 2WNUC 4PCRA 3VDBA 2ET1A 5F8PA 2G4IA 3ZKUA 2HWB1 1DQ1A 4GJZA 2GMEA 2ZGTA 3DGTA 1S0CA 4OHZA 5I0UA 3B3QE 3J8F1 1UU5A 4OMDA 4XUPA 3ZMOA 2WKKA 4QKBA 4BPZA 4V1PA 2DURA 3W58A 4W65A 2XVLA 2ARCA 1XNAA 2HKXA 1R082 1BHGA 3RMXA 1FX5A 5F7UA 2ZEYA 3O1SA 1TE1B 2ZKLA 3L2YA 1LHWA 4AL9A 2JE7A 2WFF2 4JHTA 3N3HA 1QDOA 3AP5A 3A23A 3J9SA 5A1LA 5IK8A 4ZU4A 3OCPA 1OUSA 1SFPA 2UYAA 4IEQA 4WV8A 3UESA 4CTEA 4JAAA 5FLJA 3TN91 4SBVA 1UNBA 3OD0A 1G9AA 1WMFA 1XBFA 2CGNA 3A22A 2QVSB 4RR3C 1ENRA 1FPN1 1GV9A 1UOGA 3H50A 4UW4A 3OEBA 3UK9A 4OZOA 2Z5WA 1SLCA 1AL22 1QF3A 1JZ8A 4BQ2A 2XKPA 4HN1A 4Q4V3 5JAXA 4QB6A 2TEPA 5I91A 3R05A 3E1F1 3IPVB 1H2NA 4XFCA 2ZGOA 3VD7A 2OQ6A 1AR82 1BJQA 5FRAA 3ZFGC 1WA6X 3M7AA 4M3CA 4LUKA 3WF1A 4M3CB 5J96B 2XB6C 3BB6A 2ZMKA 3MEPA 4X8NA 4CCOA 4DRRA 4XDOA 5K9YA 1RITA 4XFGA 3UKVA 2P6CA 4YPJA 4JGYA 4JGYB 5HCHA 3ASIA 1PGW1 2DF7A 1UYPA 2PMWB 3VZNA 5EXOA 4JC1A 4FP2A 3OB8A 3VBHC 2D5HA 1XYOA 4LORA 2Y0OA 1YJLA 5KC5A 2C0ZA 3AP7A 1VALA 4Q4W2 3I3MA 1CAVA 4O61A 4YVWA 3Q8CA 4Q8KA 5JSRA 1ZBE2 2RJ2A 4AYUA 2E32A 3WHTA 1YFYA 5ACA3 1HRI3 3VBFB 4W6WA 2DFBA 1WA4A 1VBB2 3FMGA 3HR9A 1AVBA 1Q8OA 4KMQA 4Y4YA 4UW5A 3ACGA 1UYZA 2GC2A 3GJBA 2VG9A 4NPRA 3GZUC 3KLSA 1O3SA 1RUI1 1AL0G 1W8NA 3VZKA 1LOBA 1J3RA 3POFA 2X29A 4E8DA 1AR73 1ZBA1 2BOJA 4CCJA 3O14A 5SV5A 1EPWA 1TNRA 2ARBA 4COZA 3FC0A 2FDFA 1AR62 1YLLA 5F3GA 1PNGA 5L9RA 4NIDA 1PO23 5FJKA 3N7LA 2MEV3 3R4UA 4C1WA 2IXHA 1RHI3 1TNFA 1YYNA 4URAA 5CBLA 1I5ZA 1OOPA 1RUH2 4FOVA 4Y1XA 1NX9A 1V6MA 1WBLA 2VNRA 2X5IA 4C91A 2GMMA 2WAAA 4RS5A 1SACA 2P6HA 4RS5B 3LEIA 4FFGA 4N53C 4PIZA 2JB8A 1H8TC 4DFSA 2VGDA 3UGHA 1J3QA 2J1RA 3ZM8A 4YW6A 1S0DA 1VBE1 5FXXA 3U11A 4Q0UA 4CP9A 2WUHA 3CO2A 3LWCA 1SDDB 3I49A 1S1AA 2P3IA 4Q29A 2CDOA 3GBFA 1L7QA 1SCSA 2D97A 4NN0A 4XXPA 3ZYBA 4WVVA 4ES8A 4HVRA 4YWAA 3AB0A 4CE8A 4KG0A 1W28A 2WYFA 1REDA 3T0AA 5LA2A 1AXZA 1RYYA 2AREA 2CAUA 4XFFA 3VD3A 1GQHA 1KDMA 2ZHMA 1IG3A 3Q8FA 3VUOA 5JOYA 2E7AA 4E9KA 2RM21 5A80A 2F6BA 1ZNPA 4WVMA 5J3UA 2C9KA 3KGZA 5FBJA 3I2KA 4LNVA 1H2MA 3JD73 1LGBA 5CG9A 2RDSA 4XBNA 4CEYB 4IQPA 4QXHA 2ZS6B 5HBAA 1LU2A 1PX4A 1HXS3 3T09A 5FYYA 3K4ZA 4JDMA 4JGZC 3ZOIA 4S2DA 4EN9B 2ETEA 3DL3A 5T5PA 1AX2A 1W2NA 1AHSA 3J7NA 5EQUA 2X8KA 2VQUA 3HNMA 3WQ0A 4QX3A 2P3YA 5I8TA 4NVPA 5FO8B 4CDXC 1ULOA 4TXWA 1QOTA 1QJX2 1XSRA 1MPXA 4XDQA 4PDWC 4XW3A 2JKBA 4N7UA 4NOTA 2R043 3TBDA 1G7YA 3MLKA 4IV3C 3SCHA 1LEMA 2AYHA 5FAXA 4S2FA 2RDNA 2QFEA 5CIRA 4FO9A 1UZ0A 4PI0A 3NQHA 5L9BA 2DDUA 2V09A 2Y33A 2Q1ZB 1PMJX 4JRLA 4JVAA 4MV2A 4MGKE 1TME2 2D6NA 2WR9A 2AR6A 4H3WA 5GLZA 1QJZA 1AXYA 2GNBA 3KS7A 3ZSMA 2VQTA 3HBZA 2PLV3 1GP5A 1W90A 1E57A 2OS2A 5F1RA 1GBGA 3O1OA 4UW6A 3C7EA 2EXKA 4CUAA 1WW5A 3IMNA 2W39A 4LTAA 1O3TA 2GC0A 2JDYA 1NAEA 5FMBA 1PMHX 5IVBA 4B8EA 4YGCA 4IL7A 1CAWA 1CAWB 1VAKA 1Y9QA 3CBNA 3T2QA 4NIAA 3OBRA 1AUYA 4AVCA 3NV2A 2B7YA 1KGYA 5F2SA 5FXZA 4LT5A 2LALA 4EQVA 1B35C 4QD2A 1IQDC 2EIBA 5IT6A 2RS11 1YQ5A 1W2AX 3SITA 5FYVA 1EV11 1K3IA 5FZEA 3FUQA 5I0SA 3KZ4C 1LOCA 3MIDA 3A21A 5KHGA 4BA6A 5LWBA 2JDAA 3WDYA 3O0WA 1BBT2 4N8MA 2Y6LA 4WVWA 5FXWA 2BU9A 4FPGA 4PLOA 1ASJ3 1T2XA 2ORXA 2WN3A 2JEMA 3JZVA 4QX2A 1QXJA 1GKBA 3CLPA 1IQAA 1CIYA 4Q1RA 3FFQA 3D6EA 4K3UA 2R49A 1QWRA 3ZLIA 3IBMA 3MW3A 4XF9A 3WY6A 1JMUB 2W95A 2CGPA 2K2SA 1CPNA 2O1QA 2QUOA 2YXSA 4Y5Z0 3J8F2 5JZGC 1NQDA 4QKDA 3OGVA 4QQHA 3W5MA 1AR93 1PK6C 1NOVA 2CL2A 2OX0A 4J1WA 3UETA 5DG1A 5CZKA 5H9PA 3ZR5A 4AVBA 1GNZA 4QXKA 1POV3 3SH3A 2R6QA 3PMSA 4JZRA 3I3DA 2O8OA 3SXWA 4M0HA 1OD3A 1UKGA 4GQ7A 5FPAA 2VW2A 2ZMNA 4L2NA 5LCWL 1W2UA 4HVQA 1VRH2 4LHNA 3AKTA 4YW2A 3TN92 2VULA 1NXD1 1AR63 1QMJA 1DZRA 1K5MC 5FZ0A 3OBAA 1FPN2 4GMP1 4EWAA 4XJWA 2BDRA 5L36A 4Z82A 3WT3A 1HX6A 5LZ6A 2ZGMA 4M00A 3DV8A 1DQ0A 2PHDA 4XFHA 4DZGA 1COV3 4DO0A 5CA6A 4DQAA 4QQLA 3U07A 1RUE3 1RUJ2 2MPFA 4P14A 1DGRN 2QQJA 5FOJB 1RUC2 3LKJA 4AEDB 3GHNA 2AEYA 2HWC3 2QNKA 2W1QA 3WXPA 4CU7A 5FWJA 1JZ7A 2D6OX 2D6KA 4R4ZA 5C8CC 3AXDA 4ZONA 5IK5A 3OUJA 1ZRFA 4PIYA 2DU0A 3D0JA 1RUG1 3GXUA 3PIJA 1SBDA 3IZOA 1EUUA 1H9PA 1NA1A 4Y4RA 5GLWA 1NA1B 1PZ9A 4CPBA 4D94A 1PGW2 1RIRA 4QPGC 5KHIA 4LPLA 5D1IA 1J84A 5F3EA 2VOXA 2HYXA 4A42A 1UY0A 5HV0A 4LBQD 2WBKA 2KXLA 5GALA 4QB1A 4IEZA 5A7NA 3I4IA 3KM5A 4AVTA 2W5FA 4EN0A 1V6IA 1VPHA 1W9FA 4ITCA 4NIIA 4MUVA 1LJ7A 3SCFA 3S30A 4A7YA 1JZ3A 1SZBA 4FCAA 3BGAA 5FYHA 3ORJA 4AW7A 4GWMA 3WVJA 2VECA 5I0DA 5J98B 1MEC3 4K8RB 4IV1A 2V72A 3HQXA 4IV1B 4JDNA 4O9EA 3LGRA 2BGCA 4UF0A 5F6LB 4UF0B 1DYKA 2E31A 4GAZA 5BY5A 2JB4A 4KWUA 1RUI2 4FTSA 2QQNA 4Y1UA 5BYNA 5T5OA 5JSPA 2E26A 4CDWA 4Q5OA 1O59A 1OLRA 1ZBA2 3QBQA 4D8MA 1WMDA 4RYDA 3AZVA 2B9UA 3F2ZA 5GJ6A 1PO13 2V73A 1DHKB 1JZ6A 3ON7A 4ASLA 2YUEA 2GNTA 3I3QA 5IK4A 4YZ3A 5T50A 2A75A 2VR4A 1URXA 1W0PA 3HBKA 4YVSA 4AI9A 4XUTA 1KFUL 4XE9A 3CZUA 4YVSB 3VBRB 5FYBA 2B46X 3KVBA 4A6SA 2RS53 1JYXA 5EJ3A 5E1RA 2D93A 1W0OA 2B5HA 4LULA 3S7EA 5K8SA 3AJYA 3T0DA 1Q8QA 1ACCA 1MZ6A 5CFDA 3RGBA 5CFDB 1O4YA 2B39A 2ARAA 5IVVA 3KCXA 1UMHA 1VBE2 2NLRA 3AL6A 3EO6A 3LPGA 3ELNA 3KQRA 4CUCA 5KXCA 5D2AA 4QX5A 2WLPA 3BTZA 2Z79A 5GLTA 4FXGB 2QQKA 2D98A 2YC0A 3USUA 3USUB 2B4KA 3AKRA 5ABJC 3VBFC 1RMU3 3WG3A 3WDUA 2K46A 4OUMA 3U1XA 3EJKA 4XMAA 4A3ZA 3WG2A 1RVF1 3WDWA 4LKDA 2RR11 1XSQA 4CCDA 4AQSA 3PLQA 2RG4A 2RM22 3DXTA 3DXUA 5FYCA 2WQZC 1SHWB 2WFPA 3PVNA 1W99A 3FHQA 2BNOA 2IFWA 1HB3A 3WF2A 1US3A 3NWKA 2VY0A 3VDAA 1G86A 1T6GC 4QX7A 4CYDA 2VMDA 4OUSA 2VM9A 1K5JA 2HWB3 2EVXA 2GZWA 4TYSA 4B1LA 4IEUA 3N9PA 1G9FA 3WNMA 3FL7A 3J8F3 5BNQA 1NXMA 1U5ZA 5B4NA 4OI2A 4HXCA 5KBFA 1PGL1 1KRIA 4XTMA 1XRUA 2XQRA 4MXWA 1ULEA 1OXCA 4LKEA 1WCUA 1X50A 4MGQA 4XURA 2JDHA 1F5JA 2XR4A 4K20A 5A3WA 5FUPA 5ERLA 3B69A 5JDBA 1S2EA 2D43A 4TTGA 1CX1A 3D3AA 3M2MA 1ZYBA 1J83A 3MPBA 4B4PA 1PX3A 4N90A 4I3PA 4AI2A 1MS5A 4G4FA 3NSTA 4M3CF 3JCIA 5F6KA 3BKZA 4CUBA 1HRV1 4MVTA 5A6XA 4Y26A 3TEXA 3I59A 3I59B 3ZN4A 2QDNA 5GLVA 4BU2A 3ES4A 2RS31 1L7LA 5A70A 3BI3A 2VOVA 2VZOA 4Z07A 5IATA 4IGQA 1AYM3 1SLBA 2YV8A 3S5AA 1MACA 3BTYA 1NCRA 3I54A 4Q0VA 4P9LA 5JUVA 4LLFA 1N3QA 1S0FA 4K40A 3M3QA 4Q4Y1 1EV12 1M06G 1W39A 4CEYC 2PTMA 1GYKA 2A5ZA 4CCMA 1FV2A 2GN3A 2I07B 2Y6KA 1STMA 2HBUA 4PIXA 3SH4A 3ZPYA 4HZFA 2VOTA 4YZ1A 1QJU3 2DFCA 1E5RA 1C1FA 1W8HA 4P5YA 2BQPA 1EPZA 5DPNA 3U0ZA 1FNYA 4YW7A 1JZ4A 2Z69A 3AMPA 4WM7C 3MUY1 3ZDSA 4EN6B 3ETQA 1XE7A 3DCQA 1DQ5A 1QQP1 3PU8A 1O4ZA 1ODMA 4MOAA 2DUQA 2VMIA 5C5UA 4DPNA 1IS5A 5AVAA 3ZFFA 3ZFFB 3MYXA 4EROA 1GU3A 3GALA 3LA3A 1LHVA 3FN9A 3URFA 3I2FA 4L9BA 2DVFA 4F83A 4NHLA 4XIOA 2HWF3 2AH2A 4NAMA 1H4HA 4ORFA 4LHLA 4WZFA 5IW0A 3ILNA 3V64A 2AZ5A 2WA3A 1NCQA 1ULCA 2NN8A 1NCQB 4OZXA 1C8M3 4Y5TA 1D4M1 1QH7A 4FPHA 4ZZ8A 2IVIB 4AK3A 1UMIA 4QX8A 2B9VA 4XAAA 3P3NA 4OYUA 1GZTA 5LRSA 1SMVA 3T4HB 2A3WA 2X53S 4RL7A 3RJRA 3RS6A 4QPIC 4BH9A 4X8PA 2ZX3A 4QHBA 1ZBE1 2DCYA 1WMEA 2YPDA 1LTEA 1L3JA 1VBA3 2QQMA 2YU1A 4FPEA 4OHVA 2C26A 3POYA 1FNZA 2WNVC 5DUWA 1S0BA 3SHRA 3MIFA 3BUCA 3AFGA 1VBE3 1FATA 1ZRCA 2PELA 3O1TA 1IPJA 2WC2A 4ISRA 4S2GA 2ADDA 3NAPA 3R4DB 4W8JA 1WW4A 4AWDA 1O3QA 2W46A 1UWWA 3VKFC 1KS4A 3MUZ1 2E51A 3VKLA 2HYKA 4BYYA 2IXKA 3WCRA 5FKCA 1CIWA 3ILFA 4YYOA 3ZXKA 3ZIWA 4OLLA 2WLQA 5C70A 3RYRA 4DXSA 5AC91 1ZZCA 3GM8A 2J1EA 3LDRA 1W6QA 1W6QB 1FT9A 5CB7A 3WP4A 3BTAA 2VMGA 3KV6A 2WYSA 3B02A 4NIHA 4AAXA 5FZKA 1JBCA 3N36A 3I3EA 5I0TA 3NJXA 1C3HA 2K0GA 2W1UA 2GH2A 1AX0A 2H0VA 4XIKA 2WT0A 3U75A 4PLNA 1EAH3 1GNHA 2F4PA 1FMD1 4WBBA 4DIQA 5GZEA 3NNJA 2X09A 1HLCA 2A70A 4TLGA 1F5FA 1M4WA 2XJPA 1DF0A 1XB9A 2G1MA 3C2UA 2DTWA 4XYXA 2VTXA 4OHXA 5BNOB 2JG8A 5KWRA 2JG8B 3SEPA 1POV0 4ZS2A 4YARA 5CU1A 4ONUA 4QPYA 1R1A2 3EQEA 3J26N 1G9CA 2AENA 2ZGQA 1W06A 1LOGA 3MW4A 1W6NA 1W6NB 4G9SB 4Q4X3 4WM8C 1F15A 4BZ4A 4LA3A 5I8SA 1H9WA 2D6PA 3WNLA 2JX9A 5J37A 3RZLA 1E5IA 2ERFA 3CQOA 3S57A 2UWBA 3DPRA 1D7PM 3NNFA 4A7ZA 3CNAA 5KC6A 1K45A 2WS91 4E4DX 1W8UA 5EFUA 1VMHA 5FLHA 5FZ7A 2EICA 1FI2A 3PURA 4C1XA 4R4XA 3WOGA 5CEHA 3HNYM 1BQPA 2VL4A 4P9WA 3MV01 1XNTA 1HN1A 4P9XA 3ALQA 5BPXA 5JVVA 5FO7B 3I2DA 1UF2C 4ARYA 4EV0A 2WT2A 2RS13 1OI6A 2VO5A 2RVAA 3O1RA 4PQQA 1EV13 2RR12 2VZSA 3T1MA 5FZOA 1JZ5A 3RYKA 1UW8A 1XE0A 5FZOB 4FAGA 4P08A 4XEZA 5LY2A 4EN8B 3JBG3 3SQOA 3N7KA 3WQ1A 2K9ZA 2H6CA 4UOJA 3RJ2X 5LW9A 3JB8A 4LBNA 4EYUA 2QKDA 3G7DA 4GULA 5A3MA 2VBPA 5FY4A 1H1AA 4HK8A 1GR3A 2XVGA 5DAXA 3VBSB 3D4KA 3AP6A 2ZHLA 1YI7A 2JDUA 1TVGA 3H1YA 4CCLA 1RUF1 2J42A 2FDIA 1PGL2 3TEWA 5ANNA 2ZGUA 5C5TA 4E2GA 1GICA 2EIGA 3WF4A 3K77A 3ZYFA 3ILRA 3Q8AA 2VZUA 4FSJA 1HB2A 3MHZA 3K4AA 2ZX1A 3VBRC 4YGBA 5JXGA 3PUIA 3ST7A 3SKJE 3TWIA 1SBEA 1Z7S3 3ENRA 4CU6A 2ZGLA 4OUEA 1W3XA 5CFCC 1JYNA 4NUBA 4LBQA 3M1HA 2H0BA 1NUKA 3V0AA 3V0AB 3U4SA 2YBPA 4GMP3 4NWWA 3HVDA 2C5DA 5BNNC 1HRV2 5HPOA 5FMOL 4BOWA 4GIQA 4NHYA 2HWD3 2RS32 1U5IA 3ZXAC 5EHDA 4QGNA 2XWJB 3HPNA 2BPA2 2DWRA 4DEVA 3N7MA 2QQIA 2CDPA 3LOIA 1C1LA 5DUUA 1U12A 3JU9A 1MR5A 1F35A 2D44A 2ZBJA 3PUHA 4XHBA 5LRRA 4JQRA 1W04A 4CEWA 2A6VA 1OLQA 2XOMA 4CEWB 2ZEXA 1RUG3 4OCTA 4Q4Y2 1XU1A 3FHIB 3GGLA 4L8QA 4LITA 1YCIA 4OMCA 5HI0A 1OHFA 4LIUA 2VPVA 1T6BX 3S6PA 4CP1A 4GALA 1VRH1 3IAQA 5JOZA 4MGTA 3V56A 3LIHA 2WABA 4EWDA 3VD9A 2OXBA 1A6CA 1RINA 3EYPA 3WNKA 4BJ0A 4Z2AA 4C90A 5A7PA 1LOFA 3T0BA 2FDGA 3C7OA 1QNYA 2GP5A 2KR2A 1ULFA 4K1ZA 1QQP2 3WUCA 1JYVA 1AZDA 4FTEA 2XL9A 1CAXA 3FZ3A 2R073 2UU8A 4XJAA 3U4XA 4LXLA 4E8CA 1Q8PA 3FX3A 4IEXA 2VVDA 3WCSA 1RUJ1 2DCZA 1V9U2 2MNGA 1DDLA 4DUWA 1RUC1 4E4SA 3KT7A 5C9AC 1S0EA 2XJQA 2VZRA 2NPIA 4D7YA 1APNA 4AZZA 2ZKNA 2XWBB 1VR3A 1PGSA 2C1FA 3DN7A 3LAGA 1FOD1 3SCGA 3UYJA 5FYTA 2XLGA 5JPMB 1D4M2 4XMIA 2RJKA 5G04L 3LFIA 1SDWA 4QX1A 5FZ4A 4LO7A 4Z8BA 1CAVB 5FZ9A 2B42B 3IAPA 4YSFA 1YUDA 3TNPB 4YVWB 1BLZA 1VBD3 2Y6FA 2VZ3A 3L2HA 2CYFA 4AE2A 3THDA 2EALA 3ME2A 4FOYA 5CYYA 2HEVF 1OVSA 2BFUL 3BALA 2VXJA 5FZ1A 5LY1A 1ZRIA 2A71A 2L9LA 3B93A 1HJGA 3KWVA 1O6UA 2VUDA 4IEPA 4XZUG 3O1PA 2DTYA 2XUEA 3HT2A 4NAOA 3VBUA 4K7JA 4HKWA 3VBUB 3A0KA 4TSVA 4QQOA 3WF0A 5D8AC 3U10A 1Z0HA 2BBAA 3CJIA 3CJIB 3HQRA 1IPKA 3NW4A 4KL1A 4DRVA 1IS6A 1UQXA 5AC92 1JH5A 1GWKA 1H4GA 2RJLA 3IN9A 3JB4C 1ULGA 3ZKYA 1RVF3 2CNAA 2VZQA 3LSDA 3T4VA 1OA4A 2RR13 1DFQA 3QH7A 4IE4A 3ZXDA 4BQ4A 2YZ4A 1JS9A 3WQ7A 2XBO1 4TN7A 5ANQA 3UV9A 1OOPB 3K4DA 2X5IB 3NJYA 3OF1A 3J7LA 5DZGA 2GAUA 1FMD2 2AC1A 3AFKA 1LU1A 4DS0A 3H0OA 2J22A 2BERA 1W6OA 2R0HA 4RHV1 1W6OB 4AGVA 5CAZA 1I3HA 3CMGA 4CP9B 4XHXA 1ZRRA 2G9GA 1LRHA 4AI8A 1VAMA 1OQ1A 2KA3A 2PHTA 2E7TA 3CEWA 1LHUA 3SKVA 4GH4A 2NMOA 4GH4B 3VLBB 3ETPA 4CXWA 3C8XA 5FYIA 5IVJA 4CDQC 2P34A 1YQ6A 1YXWA 4GWJA 4XF0A 2JD9A 3WNPA 3P5BA 5LEJA 2WZR1 3B7MA 5LA9A 4IE5A 3ZSKA 3PUSA 1ZZ6A 1GOFA 1MVQA 1NLRA 2VH9A 2GMPA 1N3OA 1GUIA 3PUQA 4AHWA 3IIAA 3BPSA 4QHZA 3TEYA 3AKSA 4INDA 2O8QA 5LBBA 4KGGA 1E5SA 2OIIA 1OUXA 4WVMB 4A3XA 5LASA 2ZX0A 1NG0A 4YZ5A 4M4PA 4QMAA 5FREA 4ES9A 2YMZA 1U0AA 2WS92 3UNPA 1R091 2CWSA 4MGZE 2WWUA 4CUGA 4LQRA 4NWVA 5KR7A 4XPVA 3FUOA 5E89A 3IDAA 5C4WA 2MHFA 3PTYA 2YROA 5C4WB 5CKNA 5A6YA 2ZMLA 4FPLA 4AHYA 1R083 1UD1A 3J7MA 4YW1A 4CXXA 3ZYRA 3H8OA 2PHRA 2WFF3 2PAEA 3RZHA 3S7IA 3M3EA 2WJSA 1W6MA 4E4HA 1WLDA 3H7YA 2WNOA 2PAKA 3MZHA 1WWYA 2ID4A 2ZGRA 3BU7A 4ZXKA 2JD4A 4FFIA 3RWKX 3QCWA 5H9SA 4GWIA 2PHLA 5FZ3A 4OI1A 2ARXA 1AL23 5BNOC 1YQ2A 1DU3D 1PVC2 3KGLA 3OG2A 2DVDA 2WZEA 1PIV1 2WO2A 1ND3A 1OF3A 1X36A 1ND3B 5FY8A 3ZIXA 1ZVFA 4NRQA 1CQ9A 1ND2A 1RUF2 2WINB 1ND2B 2ZPXA 4KWLA 4X6RB 5KXDA 2BUKA 2OUJA 1AR83 3GZEA 2HJIA 5BNPA 2A1XA 3IB3A 5HCBA 1DZTA 2E33A 2GNDA 4OHYA 5T55A 1CZSA 5A7QA 1MZ5A 3PNAA 3DYMA 3GHMA 4LK7A 4DUXA 2R16A 5HCAA 1UY1A 5A3OA 2JG9A 1JXNA 2WAOA 4FBFA 3ZN6A 4AFDA 5K0UC 1R64A 3WF3A 3PL0A 2RDQA 5JMOA 1G6NA 5M0TA 3Q8BA 3ZFEA 3GBWA 1ULPA 3H1WA 1PHMA 1VBC1 3P1IA 3THPA 1XXNA 2P5BA 3I3BA 1OURA 3W20A 4Q4W3 5DZEA 3ACHA 1KITA 1LAJA 3HN1A 4HSJA 1MQTC 3AXEA 2ZOEB 5DZFA 2WL1A 3WNNA 1ZBE3 3NV4A 1Q56A 2VTFA 4LE4A 4BQYA 4YW4A 2FHRA 3N7JA 3WW3A 1JUHA 5IVEA 3PJQA 1NLQA 1OKQA 5J36A 1VBB3 4LBKA 1H8VA 4O65A 5D21A 1F2NA 1C5IA 2FCVA 5A3NA 3ZYGA 4F8AA 5GZCA 5LEKA 4OI4A 1UX7A 3H8UA 1W2OA 2VW0A 2BYVE 3NKGA 4QM8A 4EN7B 5I8YA 4LHKA 1Q43A 5C3OA 3V65A 3O1VA 1IPSA 3POSA 1RUD1 2GN7A 4LKFA 4I0BA 3VBSC 3R0RA 3VN4A 3ZSLA 3FLRA 4UT5A 1CR7A 5E88A 1LCLA 1TMF1 3ZYIB 4BDVB 1H2LA 5FCCA 5GZFA 3ZR6A 3D8CA 4BQ3A 3POIA 2J1SA 3VDDC 1RUH3 1QJY1 4CXYA 2XQXA 4YGEA 2EA7A 2XONA 4LO6B 2XVKA 3EHKA 2P3JA 1U5YA 5SV8A 2BOIA 1CAUA 4P9IA 1CAUB 1S0IA 1I5PA 3AZYA 4NRMA 4YW3A 5B2GB 4L99A 2BP6A 1F31A 1KD7A 3UT0A 4CA9A 2AUYA 5IFTA 1FOD2 3VBOA 2Q4SA 3ATGA 2R7EB 2N7GA 3AVSA 4FFFA 5T54A 3VBOB 1V6LA 3NV3A 3FJSA 1QEXA 4NPMA
chains in the Genus database with same CATH topology
2CWMA 1O7FA 2EXJA 2GH8A 4XOGA 5EV7A 1DG6A 1NLSA 1S0JA 4CDUA 4GMP0 1VIWB 4LEJA 4JTNA 4WZCA 2PA7A 1G8WA 5L7OA 1LGCA 5L7OB 2PHFA 2LM3A 3D82A 3H9AA 3I7DA 3N35A 1KXGA 1VB4A 4Y1VA 2ZZQA 2VMHA 2YY1A 1Z78A 4KWJA 1D0GA 3FBMA 3QACA 3S0MA 4D3WA 2UYBA 2XJVA 1O5LA 3CF6E 4CDWB 1REEA 4KG8A 5IK7A 2YGMA 1QJX3 2OW4A 1R1A1 4DOUA 1JOJA 4AFAA 3UKTA 3APBA 4WVZA 3NO8A 3OGJA 4R9DA 5C8WA 1WBFA 4QM9A 1N3PA 4HLTA 2XBO2 1SLIA 1TME3 3PJYA 4CRQA 2VW1A 1C28A 4YM3A 2TNFA 4HPKA 3T2TA 4HPKB 2D5FA 4JGYC 1DLLA 3FBYA 4RHV2 5J48A 4FPJA 2R32A 4B3NA 4COUA 1WLWA 4MGIE 3MF9A 1PMIA 2VNGA 3AM2A 1V6OA 4N43A 4ASMB 4YVWC 1H0BA 2CTVA 1NY72 4RQPA 4AVSA 3USSA 3B9CA 2WZR2 5ACA1 1HRI1 2FZ2A 1SLTA 4Q0SA 1V6NA 4ZKTB 2XHKA 4U2AA 4YG0A 1LULA 4HETA 1BBT3 4J6GA 2ZACA 1KJLA 3AX4A 4GB32 2A6WA 5JSOA 1Y7BA 2WNUA 1VAVA 2WNUB 1JYIA 2A6YA 1R092 2OPKA 1KJRA 4PJYA 5FO9B 5DDJ1 5F5QA 3ZSJA 1SEFA 4XQWA 1NZCA 5FTTC 4OULA 1PO21 2MEV1 4MXWB 5KXEA 1RHI1 2WIIB 5JOXA 3VZMA 1OOPC 3RI8A 4MX3A 2X5IC 4RS5C 2XJUA 1VRH3 2ENRA 4K8FA 4NHMA 5AFBA 1N1YA 3TN93 4QQ2A 2IFRA 1RB8G 4K21A 4LE3A 1FPN3 1R1ZA 4RR3A 4RR3B 3A4UA 4P5HA 4ZU7A 1NQJA 1AF9A 4Z92B 2ZGNA 1PIV2 4LBLA 2JICA 1IKPA 2B45X 4Y1ZA 4KQ7A 4QGLA 4FQ4A 5JIAA 2DU1A 1RUJ3 2D3SA 2ZGSA 4HSLA 4A2UA 4XJZA 1RUC3 3TRSB 1NCRB 3KMHA 3ZFGA 1JW6A 3KT4A 1V70A 3OY8A 5KXBA 3FE5A 3GZTB 3JD71 1RJ8A 3BCWA 1UIJA 1DZQA 1HXS1 1S2BA 5LK5A 1VBC2 4DY3A 4RFT0 3VBHA 3LA7A 2W08A 2I45A 1D0HA 2HEWF 3H3ZA 4HFSA 2ES3A 3HAGA 4FQZA 4FPKA 3RRDA 1YNAA 1YFUA 1SLAA 1YRZA 4ATFA 2W52A 1ZZ9A 2HEYF 2HWE2 1I9RA 1YFWA 2IZWA 1XNDA 2R041 4I01A 2WQ4A 1UX6A 3PVOA 5BXXA 1V9U1 2NMNA 3IM0A 2UY9A 3NJZA 1N1SA 1RUI3 2XLFA 5J09A 1ZBA3 1BVVA 2DCTA 1RUD2 3H7JA 3ECQA 2CAVA 5K7PA 2D7FA 1UL9A 2PLV1 1CGPA 3VHRA 5GKAC 3GNEA 1OD5A 2FBEA 1TMF2 2Z42A 2ZAAA 2IC1A 3LA2A 4Q2FA 2PYTA 2XBO3 1KQRA 4N7IA 3H1MA 3P3PA 2IXIA 1QJY2 4IETA 5GLUA 2PHUA 1V6JA 3ES1A 5EYYA 4GKYA 3WDVA 4N53A 1FYUA 3KCCA 3HT1A 1H8TA 1H8TB 4B4QA 5FMOS 4N9HA 1A8DA 2GNMA 4XF4A 1Y43B 2Q0AA 2UURA 3NAPB 1WCKA 2RMU1 1ASJ1 4W6YA 3W9AA 1YHFA 4KU7A 2ZJCA 3VZLA 1WCDJ 1GZ9A 2QJVA 1IS4A 4FPCA 4XF1A 3WLUA 2QZ3A 1IGOA 2W68A 1UPSA 2XL7A 2RM23 3HIFA 1FV3A 1AR91 1YFXA 3AYAA 2R061 3MPPG 4COYA 2DVAA 5FPZA 3AKPA 1POV1 4E27A 3DKWA 2ZGKA 2ZZJA 3AZXA 4JGZA 1HKDA 4AFBA 4XFBA 4EWEA 4AEKA 3UL2A 4PF5A 2EXHA 3HWJA 4BMEA 3NV1A 4CDXA 3RNSA 4CDXB 3MGUA 2B8MA 3UKNA 1BKZA 3BOPA 5I0RA 4PDWA 1COV1 4EJRA 4IV3A 4IV3B 3RQ0A 4C0BA 1C5HA 4OFGA 1RUE1 5BUVA 4AEDC 4GWNA 2WZPP 3WNXA 2HWC1 1KDKA 2LUWA 3DUIA 1KFXL 2BTVC 4FPOB 4MYEA 4AFCA 3DPRB 1NA1C 5E8AA 3SISA 2FMYA 3PVBB 4BE3A 1UN1A 3VL8A 4K9SA 4AI1A 3A0NA 1ZX5A 4PLMA 1QH6A 3ACLA 5FOBB 4Z1VA 3M70A 4HL0A 3WP3A 2BFUS 1B35A 2Q5TA 3QD6A 1CX4A 5ACA2 1HRI2 1YJKA 4XFIA 2XGXA 1WLCA 5C33A 3N4MA 3EBRA 1MEC1 1WW6A 3PVEA 4IV1C 1HQWA 1SFYA 2VVFA 4KWKA 4D69A 2H6BA 3WV6A 4CP2A 4OI0A 1MZFA 3O12A 4D7SA 2P37A 4Q26A 1PZ7A 4CDWC 2A73B 5F9TA 5KHJA 3V0BA 1PVC1 1UIKA 5IUQA 1D4VB 5DDJ2 4BLJA 1PO11 5JZGA 1WLTA 5JZGB 3MFAA 1QKQA 1MS8A 1HQLA 4LBMA 3E6DA 1PK6A 1PO22 1PK6B 1AJOA 2MEV2 1BVP1 4YVSC 1RHI2 4W6XA 5E16A 1LOAA 1XQNA 4UBGA 1OSGA 1EY2A 2RS51 2A7AA 3WHUA 3H3UA 4LBQB 5FBZA 5CFDC 1ZZ8A 2PAMA 3ZYPA 4LBJA 4MSVA 4YG3A 3JQWA 4MLOA 4MH0E 1K5MA 1EYBA 1N47A 1K5MB 1REFA 3M4FA 3BODA 1IHMA 4ATEA 2YPJA 1RUOA 1LR5A 3QLQA 3GZAA 1QJY3 4DXZA 4FOWA 1XE8A 3MIEA 3O0XA 3ZXEA 4AVAA 3MI8A 1LESA 2E63A 2JE9A 4XZPA 5DUVA 5C6CA 3E5QA 4B7KA 2SBAA 1RMU1 1IOAA 2R0FA 4Q0PA 3R4SA 1GFF2 1MVEA 1YWKA 2UWAA 3O5SA 4UBHA 5JCTA 1V6KA 4PBOA 5C8CA 5C8CB 1QGLA 2ATFA 1H1IA 5TSWA 3JD72 5CNAA 3WINE 3RWNA 3LB9A 4H14A 2IXCA 3X29B 4B4RA 1GSLA 2DVBA 2VUAA 1HXS2 4P9GA 3RG0A 1X7NA 2WSVA 4QPGA 4QPGB 4TWTA 1QHDA 1WUVA 3SNMA 4FTBA 4F3JA 4HMZA 1UMZA 3GF6A 1HV1A 3L9JT 4LO8A 1AYN1 1CAXB 4KBBA 4BIOA 4FOQA 4ZU5A 2JECA 3AP4A 4I30A 2R042 2BW8A 2I74A 1OPOA 1C8NA 3B01A 3DF0A 3KSCA 4M3CE 3ZXFA 3OPZA 1DQ6A 1QNWA 4LA2A 2XKOA 4FXKB 4X6QB 3JQXA 3LCPA 4HANA 3OTFA 2XUMA 1CVNA 4H7LA 2PLV2 1R1A3 2ZGPA 3WW1A 5FDBA 4I02A 4M01A 1YIFA 1CESA 1GQGA 3MLJA 1W6PA 3IPVA 1W6PB 3WUDA 4B7EA 3AKQA 1VJ2A 1AYM1 1NCRC 2RE9A 2OVUA 3FWEA 3B94A 2DYCA 4Q1PA 1BEV1 1MS4A 3B00A 4RD7A 1O5UA 2WT1A 3M3CA 1HQNA 1U5XA 2VNOA 1QOSA 4UW3A 2RMU2 1ASJ2 1QJU1 2TBVA 4HBNA 5LK7B 2E7QA 3IDCB 5T3NA 1XNKA 1RGSA 3WR0A 1N1TA 5ABJA 3VBFA 2Z2SB 5ABJB 2Y0IA 3ZFFC 5T5JA 4H55A 4BIFA 3VV1A 2BVVA 1MZEA 1O3RA 4Y1YA 1AX1A 1AR92 4XILA 2R062 2OUHA 5L19A 1IZ3A 1H30A 4Z2WA 4IERA 2HWF1 4E4ZA 3D0SA 4LLOA 2TUNA 4IEWA 2UY8A 4AXOA 1X33A 1UAIA 3OBTA 3IWZA 3INAA 1NCQC 4R9AA 4AGGA 5DDJ3 3MDPA 2QE3A 1C8M1 4A7KA 4Y24A 1CJDA 2GSYA 4RSUA 3NVCA 4KU8A 2WNEA 1J58A 4BWOA 2GC1A 3WZ1A 3VHPA 2R1DA 1COV2 1NY71 4XQDA 1Q3EA 4HKLA 3IDEA 3TAYA 1RUE2 1VBA1 4YZ4A 4BCUA 1CD3G 1ZM1A 2HWC2 3VKOA 1JUIA 5AFEA 3K51A 5JMCA 2VUJA 5H9RA 2BVBA 1HRV3 4RGAA 3NAPC 1XNCA 4GB31 1TQ5A 3QOPA 4IESA 4R9CA 2RS33 3RZZA 1XYNA 2VOWA 4URTA 4YNIA 1ENSA 3M3OA 4Q0QA 1MS1A 4I0WB 1BZWA 2XJTA 2KM2A 2ZX2A 3VHNA 1LB2A 1LGNA 4FAHA 3MIBA 1AJKA 2RHPA 1C57A 3AZZA 2JDZA 4Q4Y3 1WW7A 4NHKA 1IKQA 4CEYA 2OZ6A 1MEC2 1OPMA 1W6MB 1EAH1 5CADA 1ZZ7A 1DGWX 1HIXA 2BBVA 5L73A 1FXZA 2JG8C 1Q5OA 3AMHA 4WM7B 4WM7A 2YGLA 1QQP3 4DNYA 4KNCA 3CL1A 4YM1A 1PO12 3LSEA 2SLIA 1J1LA 3VZJA 1V9U3 2ZA9A 5DUXA 2ZX4A 5BNPB 1OQEA 4JRAA 5JI7A 4YFZA 3E6CC 3R6SA 3I8TA 1HV0A 3MFCA 4Q4X1 3EXUA 2JG9B 2RS52 4BLIA 1DQ2A 4TZDA 3DPRC 3TOJA 3ZN6B 4AI3A 3TYJA 4C0HA 1D4M3 2QDRA 3AZWA 1J59A 3SH5A 3ZFEB 3JUUA 1OA3A 3ZO0B 1LHNA 3OJBA 2D6LX 2O0OA 4B29A 1NE6A 2VQAA 4QPIA 5A32A 1ZZBA 4QPIB 5A32B 4YLZA 5JR7B 4XETA 4IEVA 4L92A 1RMU2 2YDEA 1CJPA 2HWE1 2WNVA 2WNVB 5BV6A 4AQ2A 1MS3A 3RSJA 3Q9OA 1RC6A 3JBG1 4YFWA 4YRDA 2RMU3 3E5XA 2E53A 4AQ6A 5T52A 1GZWA 1GZWB 2A6ZA 1O4TA 5AC93 2HWB2 5CVRA 4AQTA 2GDFA 4AF9A 3AMNA 4F7ZA 2R063 1AYN2 5FPXA 2XLAA 3E97A 4XJ9A 2GALA 1S55A 1FMD3 5EWSA 4P9JA 1Z7S1 3UJQA 3RDIA 3GBGA 1WD4A 1BMV1 2A6XA 4Y20A 2Q1MA 3TB0A 3E6BA 4Y20B 4YGDA 3OD4A 2XJRA 4LO5B 1RTVA 1SQ4A 1A8MA 3MW2A 2BEOA 4LO4B 3RYPA 3RI9A 2V5YA 2ET7A 1ALYA 3BIWE 3KT1A 2QZ2A 2HWD1 2QCSB 1JTZX 4GKXA 3ZVXA 1CN1A 3KB5A 1DIWA 1RL3A 2OA2A 4CDUB 1AYM2 4AEDA 1BCXA 3AYCA 4WM8A 1AXKA 2VOKA 4WM8B 4YG6A 4BQ1A 4CEWC 3ZMNA 4Q8LA 1TEIA 4FPYA 2OYZA 4JTOA 2XH6A 1BEV2 1LEDA 1LHOA 2WS93 2BWAA 3ZXJA 1YIPA 1Y3TA 5A3LA 1CPMA 1F9KA 3LZZA 3T1LA 2FQPA 1QJU2 3AP9A 1JHNA 3B5LB 3IDBB 3OYWA 1LOFC 3OYWB 1QOOA 1J1TA 1QXPA 5JIUA 3POWA 1X8EA 3MF6A 3QH6A 2E6VA 1ULDA 4Q4V1 3VHOA 2R071 2R30A 4HK9A 4NO4A 4I2OA 1DBNA 5EYXA 1QU0A 3GYDA 2HWF2 4AFMA 2A3XA 4META 4YM0A 2WA4A 3RPQA 1B09A 2CY6A 3MICA 4FP3A 1PVC3 4DB5A 3ROUA 1UZZA 4HKOA 5HCFA 3AYDA 1RUF3 1X8MA 1C8M2 4YM2A 3ZSEA 1UU6A 4AEJA 4N43B 1VP6A 1XNBA 3FLPA 3VBRA 1VBD1 2D3PA 4LUMA 4R52A 4RQPB 4AGRA 1OMIA 1BYHA 1VBA2 5CFCA 5CFCB 3HD8B 3J4UH 4CP0A 1ENXA 5BNNA 5BNNB 2NM1A 2VVEA 3OGGA 3VBUC 2W0XA 1D2QA 1ZA4A 5GZDA 1ZRDA 2XG3A 3CJIC 5JOWA 1AR71 4AI0A 1LENA 3KCYA 2VQ0A 2PHWA 2DVGA 1V00A 4XBLA 3BOWA 4Y22A 4Y22B 5FLIA 3THTA 1H2KA 3CJXA 4GXLA 1NYWA 4I3GA 1MS9A 1SLLA 4D7TA 1LOEA 2CGOA 4KH9A 4QQPA 4AHZA 3MIHA 3O7OA 1EAH2 3WD5A 4R8HA 1HDKA 1Q8VA 2NQYA 4IEYA 3ZXLA 3ZN5A 3PHMA 5T5LA 1DYPA 1UU4A 1A3KA 4QT6A 1AYN3 2E9QA 3HMYA 1GANA 1XU2A 4GH4C 3ZX7A 2NYYA 3WP6A 4XF3A 3AYEA 4Q27A 2YYOA 1O91A 5C9AA 5C9AB 3ZFGB 3WW2A 4Q4X2 5AVPA 4PBPA 3KD4A 2DCJA 3OY8B 4S2HA 1NE4A 1FOD3 3VZOA 1QDCA 3FFZA 3C3VA 3O0VA 2NP0A 3WDXA 4QGMA 5DG2A 4YZ2A 2A3YA 3VBHB 1SBFA 4QU2A 1Q8SA 2UWCA 4GA9A 4OHWA 2XJSA 3G6JB 5C4WC 4E2SA 2VU9A 1H1MA 2RS12 1R081 1PM7A 4JDOA 1BEV3 1OQDA 4MXVA 1YI9A 4I09A 2FMDA 2C9AA 1S2KA 2WFF1 1JN2P 3JBG2 4L97A 4XFAA 2DUOA 2AGSA 2YHJA 4XTPA 4XXAA 5D8AA 5D8AB 2DUPA 2P17A 1D2SA 1SFNA 1AL21 4COWA 1DGLA 1ND3C 5HXVA 3MLLA 1ND2C 2ZCWA 3MIGA 2EAAA 4U36A 4XJ8A 2Y26A 4SLIA 5H9QA 1VLNA 5BNPC 2D6MA 1AR81 2NZ9A 4MGYE 5I93A 4RA0A 2ILMA 4FPFA 4YW5A 2Q30A 4AHXA 1JYCA 5DXDA 2JG9C 4N53B 3IKWA 1Z7S2 3E5UA 4RHV3 1BMV2 4DINB 3ZFEC 4AVVA 4BHPA 1A78A 2EAKA 2Y38A 5JWPA 4BM8A 4Q4W1 3WG1A 4G3YC 1RJ7A 2ZHKA 1GZCA 1LECA 1DQ4A 1PZ8A 2HWD2 3VGIA 2PN5A 4RGGA 4CDQA 4MZUA 4CDQB 1UPIA 2WZR3 4IEOA 1F8VA 2ZTNA 4DMIA 1VBB1 2PHXA 3LOBA 3WX5A 2JENA 3RMYA 1G9DA 4XQ4A 1MS0A 1ENQA 4AG4A 1PVXA 4GB33 1RUG2 4KGQA 2OZJA 3BPZA 1DGRA 5KHKA 4DY5A 2EXIA 4FT8A 3SMHA 1R093 4JGZB 4HN0A 2EF6A 5JPNB 2D3RA 4NR1A 4CZSA 1ONAA 1FAYA 1VB2A 4UXAA 1AR61 3VKNA 2JJ6A 5A33A 3AJZA 3NKTA 5A33B 2R1BA 2Q8OA 2VXRA 3SLIA 4ISQA 1OFNA 4N9IA 4PDWB 4Q4V2 2ZAHA 2R072 1RUH1 1WD3A 2CV6A 3AK0A 1X82A 1GLHA 1CONA 4PQ9A 2P2KA 2P3KA 2XPJA 3K48A 1SCRA 4FVVA 1DGWA 2PFWA 1QXRA 2BWCA 4O9GA 3AMMA 5BNOA 1PIV3 4LR4A 3VBOC 2QQPA 3VKMA 4JV4A 4COVA 1UKRA 1OFSA 1I6XA 3TNQA 1I1EA 3UJOA 5GZGA 4AEMA 2GU9A 2I2SA 4CDUC 2ZHNA 1QY4A 4K6BA 2LTNA 3WDTA 3WP5A 1VBD2 3NL1A 1B35B 3D5OA 4BMBA 1UZYA 5L7OC 2WWSA 5K0UA 5K0UB 2G9FA 1LODA 4TLFA 1VBC3 1KS5A 1YO8A 3AMQA 1MQTA 5CG8A 1MQTB 2WSUA 3B9IA 2ZABA 1AR72 1UCXA 3V0BB 1S0GA 3W59A 4HT1T 4XJUA 5EZWA 1QJX1 4I0AA 2BNNA 1WGPA 5FQ0A 1OA2A 2HWE3 2D40A 5FQ0B 3WW4A 1RVF2 3CU7A 3ZYJB 4L11A 2IXJA 4J1XA 5JI9A 1EP0A 4HVOA 4IXLA 1WCSA 1TME1 1RUD3 4M0NA 3WG4A 1N1VA 1BXHA 3PMEA 4H7MA 2PQQA 4P9YA 3VBSA 1TMF3 5KHHA 4E2QA 2DV9A 5JLVA 1IS3A 5GM0A 2IXLA 2JXAA 2FZ1A 4N43C 1PNFA 4XBQA 2DCKA 3VDDA 1XYPA 4OVEA 3VDDB 4LBOA 3M3IA 4RQPC 2IWGB 3ZXGA 1J3PA 4JCKA 1HW5A 1ZREA 3M8LA 4K1YA 3VL9A 5FFOC 1LKNA 1C4RA 2GC3A 2BNMA 3FLTA 5J7MA 1BK1A 1BBT1 4R9BA 3IT8A 1G9BA 2WNUC 4PCRA 2ET1A 2G4IA 2HWB1 1DQ1A 2GMEA 2ZGTA 3DGTA 1S0CA 4OHZA 5I0UA 3B3QE 3J8F1 1UU5A 3ZMOA 2WKKA 4BPZA 4V1PA 2DURA 3W58A 4W65A 2XVLA 2HKXA 1R082 3RMXA 1FX5A 1TE1B 2ZKLA 3L2YA 1LHWA 2JE7A 2WFF2 3N3HA 1QDOA 3AP5A 3J9SA 5IK8A 4ZU4A 3OCPA 2UYAA 4WV8A 4CTEA 4IEQA 4JAAA 5FLJA 3TN91 4SBVA 3OD0A 1G9AA 1WMFA 2CGNA 4RR3C 2QVSB 3UK9A 1ENRA 1FPN1 1GV9A 3H50A 4UW4A 2Z5WA 1SLCA 1AL22 1QF3A 2XKPA 4HN1A 4Q4V3 5JAXA 5I91A 2TEPA 3R05A 3IPVB 1H2NA 4XFCA 2ZGOA 1AR82 1BJQA 5FRAA 3ZFGC 3M7AA 4M3CA 4LUKA 5J96B 4M3CB 2XB6C 3BB6A 2ZMKA 3MEPA 4X8NA 4DRRA 5K9YA 1RITA 4XFGA 3UKVA 4JGYA 4JGYB 3ASIA 1PGW1 2DF7A 3VZNA 5EXOA 4JC1A 4FP2A 3VBHC 2D5HA 1XYOA 2Y0OA 1YJLA 5KC5A 2C0ZA 3AP7A 1VALA 4Q4W2 1CAVA 4YVWA 4Q8KA 5JSRA 1ZBE2 4AYUA 5ACA3 3WHTA 1YFYA 1HRI3 3VBFB 4W6WA 2DFBA 1WA4A 1VBB2 3FMGA 3HR9A 1AVBA 1Q8OA 4Y4YA 4UW5A 2GC2A 2VG9A 4NPRA 3GZUC 3KLSA 1O3SA 1RUI1 1AL0G 3VZKA 1LOBA 1J3RA 2X29A 1AR73 1ZBA1 3O14A 5SV5A 1EPWA 1TNRA 2ARBA 4COZA 3FC0A 1AR62 1YLLA 1PNGA 1PO23 3N7LA 2MEV3 3R4UA 4C1WA 2IXHA 1RHI3 1TNFA 1YYNA 5CBLA 1I5ZA 1OOPA 1RUH2 4FOVA 4Y1XA 1V6MA 1WBLA 2VNRA 1RUNA 2X5IA 4C91A 2GMMA 4RS5A 1SACA 4RS5B 4N53C 4PIZA 1H8TC 4DFSA 2VGDA 1J3QA 1S0DA 1VBE1 3U11A 4Q0UA 3CO2A 3LWCA 1S1AA 2P3IA 4Q29A 3GBFA 1SCSA 2D97A 4NN0A 4XXPA 4ES8A 4WVVA 4HVRA 3AB0A 4KG0A 1REDA 1AXZA 2AREA 2CAUA 4XFFA 1GQHA 1KDMA 2ZHMA 3VUOA 5JOYA 2E7AA 4E9KA 2RM21 2F6BA 1ZNPA 4WVMA 5J3UA 3KGZA 4LNVA 1H2MA 3JD73 1LGBA 5CG9A 4CEYB 4XBNA 4IQPA 2ZS6B 5HBAA 1LU2A 1HXS3 4JDMA 4JGZC 4S2DA 4EN9B 2ETEA 3DL3A 5T5PA 1AX2A 1AHSA 2X8KA 5I8TA 3WQ0A 4NVPA 5FO8B 4CDXC 1QOTA 1QJX2 4XDQA 4PDWC 4XW3A 2JKBA 4N7UA 4NOTA 2R043 3TBDA 1G7YA 3MLKA 4IV3C 3SCHA 1LEMA 2AYHA 5FAXA 4S2FA 2QFEA 5CIRA 4FO9A 2V09A 4JRLA 2Q1ZB 4MV2A 4JVAA 4MGKE 1TME2 2D6NA 5GLZA 2AR6A 4H3WA 3ZSMA 1QJZA 1AXYA 2GNBA 3KS7A 3HBZA 2PLV3 1E57A 5F1RA 1GBGA 4UW6A 2EXKA 1WW5A 3IMNA 2W39A 4LTAA 1O3TA 2GC0A 4B8EA 4YGCA 4IL7A 1CAWA 1CAWB 1VAKA 1Y9QA 3OBRA 1AUYA 4AVCA 3NV2A 2B7YA 4LT5A 2LALA 1B35C 4QD2A 5IT6A 2RS11 3SITA 1EV11 3FUQA 5I0SA 3KZ4C 1LOCA 3MIDA 5KHGA 4BA6A 3WDYA 3O0WA 1BBT2 4WVWA 5BPXA 4FPGA 4PLOA 1ASJ3 2JEMA 3JZVA 1QXJA 1GKBA 3CLPA 1IQAA 4Q1RA 3FFQA 3D6EA 4K3UA 2R49A 1QWRA 3IBMA 3MW3A 4XF9A 3WY6A 2CGPA 2K2SA 1CPNA 2O1QA 2QUOA 2YXSA 4Y5Z0 3J8F2 5JZGC 1NQDA 4QQHA 1AR93 1PK6C 1NOVA 2CL2A 4J1WA 5DG1A 5H9PA 4AVBA 1GNZA 4QXKA 1POV3 3SH3A 2R6QA 3PMSA 3SXWA 2O8OA 4M0HA 1UKGA 4GQ7A 2VW2A 2ZMNA 4L2NA 1W2UA 4HVQA 1VRH2 4LHNA 3AKTA 4YW2A 3TN92 2VULA 1NXD1 1AR63 1QMJA 1DZRA 1K5MC 4GMP1 1FPN2 4EWAA 4XJWA 5L36A 4Z82A 3WT3A 1HX6A 2ZGMA 4M00A 3DV8A 1DQ0A 2PHDA 4XFHA 4DZGA 1COV3 5CA6A 4DQAA 4QQLA 3U07A 1RUE3 1RUJ2 2MPFA 4P14A 1DGRN 5FOJB 1RUC2 3LKJA 4AEDB 3GHNA 2HWC3 2QNKA 3WXPA 2D6OX 2D6KA 4R4ZA 5C8CC 3AXDA 1ZRFA 5IK5A 4PIYA 2DU0A 3D0JA 1RUG1 1SBDA 5GLWA 1H9PA 1NA1A 1NA1B 1PZ9A 4D94A 1PGW2 1RIRA 4QPGC 5KHIA 5D1IA 2VOXA 4LBQD 2KXLA 5GALA 4IEZA 3I4IA 3KM5A 4AVTA 4EN0A 1V6IA 4ITCA 4MUVA 1LJ7A 3SCFA 3S30A 4A7YA 4FCAA 4AW7A 4GWMA 3WVJA 2VECA 5J98B 1MEC3 4IV1A 3HQXA 4IV1B 4JDNA 4O9EA 3LGRA 2BGCA 5F6LB 1DYKA 5BY5A 1RUI2 4FTSA 4Y1UA 5BYNA 5T5OA 5JSPA 4CDWA 1OLRA 1ZBA2 3QBQA 1WMDA 3AZVA 2B9UA 5GJ6A 1PO13 2V73A 1DHKB 4ASLA 2YUEA 2GNTA 5IK4A 4YZ3A 5T50A 2A75A 1URXA 1W0PA 4YVSA 4YVSB 1KFUL 4XE9A 3VBRB 2B46X 2RS53 5EJ3A 5E1RA 2D93A 1W0OA 2B5HA 4LULA 3S7EA 5K8SA 3AJYA 1Q8QA 1MZ6A 5CFDA 5CFDB 1O4YA 2B39A 3KCXA 1VBE2 2NLRA 3EO6A 3ELNA 3KQRA 5KXCA 4QX5A 2WLPA 2Z79A 5GLTA 4FXGB 2D98A 2YC0A 3USUA 3USUB 3AKRA 5ABJC 3VBFC 1RMU3 3WG3A 3WDUA 4OUMA 3EJKA 4XMAA 3WG2A 1RVF1 3WDWA 2RR11 4AQSA 3PLQA 2RM22 </