4HK9A

Crystal structures of mutant endo-beta-1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
188
Chain Sequence
IQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGHFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 57
structure length 188
sequence length 188
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hk9A00
2B42B 2BVVA 3WP3A 3VLBB 3AKQA 3WP6A 1H8VA 3RI8A 3WR0A 4S2DA 1QH7A 4XQDA 3LGRA 1XNDA 3MF9A 3RI9A 3AMNA 3MFAA 1PVXA 4XQ4A 2F6BA 1ENXA 2Z79A 3VZJA 2NLRA 3AKTA 4XQWA 2DFBA 1HV1A 2BWCA 1F5JA 3WT3A 3M4FA 3VL8A 4HKOA 1REFA 1H4HA 3VHPA 2VGDA 3B7MA 5EJ3A 3WP4A 2D97A 4HK8A 4H7MA 2NQYA 2DCYA 1XXNA 1OA3A 2JEMA 1HV0A 4HK9A 1OLQA 1H1AA 3VHOA 3VZKA 2QZ3A 1KS5A 3WQ7A 3VZOA 3VL9A 3ZSEA 2DCZA 1XNKA 3WQ0A 2JENA 3WXPA 1UU4A 1TE1B 3AKSA 3LB9A 2BW8A 2B46X 3VZLA 1YNAA 3AMPA 1HIXA 3MFCA 1BCXA 2C1FA 1BVVA 1H0BA 1BK1A 3VHNA 3VZMA 1UU6A 4HKWA 3WP5A 1XYPA 2VUJA 3AMQA 3MF6A 4S2FA 5K9YA 3VGIA 4HKLA 1QH6A 1REEA 2DCJA 4S2GA 1M4WA 1KS4A 1OA2A 4IXLA 4S2HA 1W2UA 2DFCA 1OA4A 1XYOA 3O7OA 2D98A 3B5LB 3VZNA 1OLRA 3AMMA 1NLRA 2QZ2A 2BWAA 1XNBA 1REDA 4NPRA 1H4GA 4XPVA 2JICA 1C5HA 2VULA 3WX5A 2VG9A 2DCKA 3WY6A 3EXUA 3AKPA 1XNCA 3AKRA 1T6GC 3AMHA 1UKRA 3HD8B 5K7PA 1IGOA 1UU5A 5HXVA 2B45X 1C5IA 3WQ1A 1XYNA 1AXKA
chains in the Genus database with same CATH superfamily
1WA4A 3ILFA 2JDZA 2VZ3A 4YGDA 4PBOA 2QKDA 1NT0A 3GXUA 5JMCA 2W52A 2HKXA 3J8F3 3WG3A 2LUWA 5A70A 2R063 2FMDA 1RHI1 2A5ZA 3PJQA 4XJAA 3RI8A 4FAGA 3WR0A 3VKLA 2GAUA 4AQTA 3TBDA 4CXXA 4OI0A 3AMNA 4I0WB 1IKPA 2BP6A 5CADA 4LBQB 2D6PA 2WFF1 5A3TA 5JOWA 1OOPA 2LS6A 2R7EB 3SH4A 5FBJA 1BMV2 3WT3A 1H30A 2XR4A 5CKMA 4JGYB 2Y6LA 5CKNA 1JH5A 1WD3A 1VRH2 3DF0A 3FLRA 4Q5OA 4ZXEA 1SCRA 4YARA 1IS5A 1HQNA 3DKQA 3H1MA 4KBBA 1QQP1 1R083 4BQYA 4BDVB 1POV0 2UY9A 2VTXJ 1JHJA 4M4RA 3AB0A 4FOVA 3SISA 2BBAA 4IW3A 4Q4Y3 4MHRA 2P4EA 4Y5TA 2BJSA 4UYBA 1GOHA 4DO0A 1IG0A 4RD7A 4YM1A 4RR3A 4FTBA 4Q4X3 4BPZA 1PVC3 1Z7S1 2R1DA 1UZZA 1WCSA 4D6SA 1PGSA 5ISLA 4LMFA 2WSVA 1IS6A 3ZFGC 3O12A 4YZ4A 3NRUA 3OPTA 3WXPA 5C6CA 1TE1B 1GSLA 2K46A 2XWBB 1VBE2 3JXSA 3ST7A 4BOWA 1URXA 2BW8A 2X53S 2XLGA 1WBFA 1F31A 2ADDA 2XJTA 5FXVA 5LBFA 1J58A 4CCEA 1FX5A 1GQPA 3JB4C 4BCUA 1UY4A 4H7LA 1DQ5A 1G9FA 3ACHA 3J8F1 4RHV3 5A3NA 2R061 3NO8A 4NE9A 5FPBA 3HN3A 1S0CA 1J3PA 1OLME 2HJIA 1CAXA 3IIIA 4YWAA 3ZYHA 4AQ6A 2A6ZA 5EYYA 3WG1A 4S2FA 1VE0A 4XXPA 4QX3A 2JDYA 2V4VA 5EXOA 1DGWX 1HJGA 4DY5A 4CE8A 4LNVA 1VBC3 1ASJ2 2VXJA 1OF4A 1YQCA 1XBFA 4KL1A 4NHXA 1LHWA 3CJIC 4JZRA 2DUOA 2D98A 3ECQA 4XAAA 4ASLA 1WCQA 4O9GA 1DGRA 1R081 1S0BA 1CWPA 4LT5A 3PIJA 1ACCA 1W6MB 3AFGA 3J7MA 4LBQA 4AVTA 2VZ1A 2IWGB 4Q0SA 4Q4Y1 5F2SA 3APBA 4CVUA 1W2TA 4LO8A 2YBKA 2ZZJA 3T08A 1OH4A 1LULA 4LOSA 1DYPA 1YQ5A 5FPAA 4LORA 1S2KA 2VXRA 4Y1ZA 4Q4X1 1PVC1 2WS92 5FOJB 2WO2A 2E6VA 2R6QA 3AMHA 3AZZA 3POJA 3FZ3A 5JSPA 4HFSA 1UU5A 2QJVA 4BA6A 5I91A 1UX7A 3CL1A 3THDA 3U78A 3VLBB 5LCWL 3MO4A 2HWC1 1RUG2 3POWA 5ABJC 1N3PA 1JMUB 1AXKA 5HV4A 2B42B 1OHFA 1Q5OA 3ATGA 4QT6A 4CCOA 2Z5WA 4Y24A 3N9MA 4AFCA 2E9QA 4U36A 1H8VA 5A7NA 2PYTA 3GCXA 4WVZA 2RJKA 4JQTA 4MX3A 4RHV1 1SACA 1ZA7A 4K8FA 1CAWB 3VBUB 4CEWC 4JCKA 5ERLA 2Y6FA 4BB3A 1F5JA 2WC2A 1WBLA 3AP4A 4AI9A 1OD5A 1PO12 4L11A 4W6XA 4ASKA 4DQAA 5EV7A 3UGFA 2HBTA 4I30A 4XURA 2UWCA 1SBDA 1O6UA 1VBB2 4IETA 2ZAHA 2EAAA 2XB6C 3GDBA 1VBC1 4HT1T 5J96B 4PF5A 2LW8A 4Y1XA 1DCSA 1XE0A 1CZVA 4Z82A 5C8CB 3AP5A 1Q56A 2QVSB 5C9AB 2CV6A 4L9BA 3BTAA 4CYDA 5F3GA 1E5RA 4BM8A 2NQYA 3BPZA 5BNPA 1QMJA 2XMLA 1GZ9A 1HLCA 4OHXA 4TWTA 3T4VA 5A6YA 1H1AA 2ADEA 3LDBA 4I3GA 5HCBA 5KR7A 3N4MA 2DBIA 5A3MA 1EY2A 2GP5A 2ORXA 1Q8QA 2DVBA 3ZFGB 3AXEA 2D3SA 3ZSEA 1NYWA 2ZGUA 4P9JA 3W5NA 2JKXA 1UYPA 3SQOA 4HPKA 1OVSA 5KXDA 1W6MA 2JIGA 2AGSA 2JDUA 4UWDA 2GC3A 2FDFA 3HNMA 4NR1A 3MDPA 3I2JA 3VKFC 3PUIA 1QNYA 1BK1A 3DUIA 4W6WA 4GB32 5FZAA 3MV11 4E4DX 2GC1A 2WZR3 3BB6A 3TEXA 1D4M2 1FMD2 2QQIA 4LK7A 3VKNA 2J1EA 4DRRA 4UW4A 2VVFA 3LCPA 5FP9A 3LE0A 2Y6KA 1POV3 4C0BA 2YBPA 1DYOA 3C7EA 3PURA 3VGIA 1PNGA 3ZYJB 4ZU4A 2QBXA 2JB8A 3W58A 4BH9A 4XJ9A 2WLPA 1SLIA 2WO3A 1ST8A 3FLPA 4NO4A 3CJIB 4Z2WA 2ZX0A 1IS3A 3M3EA 4ONUA 3U4SA 1HXS2 4YG3A 3S30A 3ZXGA 3QBQA 3WNNA 1CAWA 3B00A 2Q5TA 2QZ2A 2RR13 5A7QA 2JDKA 2I2SA 1MZ5A 2XJSA 4JDMA 1Y3TA 4ZU5A 4QKNA 3T2OA 2DVDA 4IEWA 1QF3A 2HLEA 3HAGA 1RUE3 2EIGA 2DCKA 2OXBA 3H0OA 1VAKA 3Q9OA 3GF6A 4HN1A 3O1TA 1ZBA2 4QX0A 5K7PA 1EUTA 4Y4YA 1RJ8A 1UNBA 2WZEA 3I3DA 1IPJA 4IEYA 2QQOA 5C8CA 3ZDSA 2W94A 4MUVA 5FJHA 2VAUA 1BEV3 2NN8A 2ZMLA 3B69A 5CZKA 1W90A 1UIKA 1J84A 4LKEA 4AR2A 1GWLA 2PAMA 2Q4SA 1F2NA 2VECA 4MXWA 4PIXA 4WM8B 4BHPA 2FHRA 1Q8SA 4D0QA 4FTSA 3LEMA 2NYYA 3IWZA 2VBBA 2JD4A 4LUMA 1ENQA 1KITA 3ZFGA 3O0XA 3V0AA 3IAPA 2WZR1 5F5CA 1PIV2 2VCCA 2IVJA 4P9XA 1OPMA 1POV1 1CX4A 3VHRA 4KG8A 4FTEA 1FXZA 1ULFA 2XGXA 4XUOA 2KR2A 2FDIA 2XJVA 4OZOA 1N3QA 1W06A 3DXUA 1A6CA 1DBNA 3V65A 3PVEA 4PT6A 4P08A 3LOBA 2W5FA 4YVSB 4FI9A 1HRI1 3SCHA 4R9AA 1WA6X 5FFOC 4A7KA 5J1XA 3KHCA 3DYOA 4TLGA 2XXZA 4FFGA 3MUZ1 4XF0A 2A75A 1RITA 2H6CA 3J7HA 4D69A 3RZKA 1HB3A 4NUBA 3WF1A 2RR11 3UJQA 4P9IA 2CWSA 4QD2A 1XXNA 3VUOA 3ZFEC 1JYTA 5A6QA 3VBFC 2WLQA 3VV1A 3JCIA 4N90A 3WQ7A 2C6SA 4A7YA 3CJIA 1RC6A 1IKQA 3N9PA 3UKVA 3WNOA 2JENA 1VLNA 3PTRB 5A3OA 3D8CA 1CONA 5GLTA 2JX9A 5DZFA 3IIAA 4LQRA 2B4KA 2JE7A 4AI0A 4KU8A 2WA4A 5FZGA 1WLDA 1BEV1 2WIIB 3B9IA 1LU1A 2WN2A 1C8NA 3KSCA 2JDPA 4GWIA 4MSVA 1RUNA 3MLJA 4ARYA 3HMYA 1H1MA 2TUNA 3LSDA 1WLTA 3FJSA 4GKXA 4RYDA 5LY1A 1K3IA 4XTPA 4XUNA 4L99A 2PHRA 2VUJA 5FZ6A 5LZ6A 5J37A 1SFNA 4OZXA 3NAPC 4KMQA 4EZHA 3BTZA 5DXDA 5ABJA 2XUMA 2IUWA 3TYJA 4B4RA 3ZYPA 2RS53 3AZYA 2CDOA 1AL23 1RYYA 1ZZBA 1OA2A 2NMNA 1NE4A 1WD4A 3CO2A 3NVCA 1I6XA 1QOSA 1YI7A 3PUHA 3RFRA 1US2A 3WINE 2GDFA 1JYNA 4W65A 3O0WA 1EAH2 1O3SA 2L9LA 2ET7A 1NZIA 2IZWA 2HYXA 3KT4A 3O1PA 2YU1A 3AK0A 1UMZA 3E5XA 4CEWA 1UKGA 4COUA 5CBLA 1ZM1A 1REDA 5IVYA 4EN7B 1R092 1FOD2 2PAEA 4ZU7A 1OUSA 2GNMA 3AL6A 1O4TA 4BQ2A 4M01A 5FZDA 3H42B 5EPAA 5EZWA 3AZWA 3MICA 5CIRA 3BI3A 2YGMA 3EXUA 3WDUA 4LO5B 5FYZA 1YJLA 3TWIA 1A8MA 2OW4A 3O1UA 1BZWA 1C8M2 3NWKA 4ET7A 4HONA 5A7OA 3OUHA 2X09A 2KA3A 3D5OA 4MGSA 3U37A 1RUF2 5F39A 1LJ7A 3CQOA 4FFIA 2QCSB 5T55A 5I0DA 3HIFA 3R05A 4UW3A 4OCTA 5JR7B 2WQ8A 4OI2A 2J42A 1DQ4A 1YFYA 2VZQA 1SMVA 3T0BA 1OQDA 5LWBA 4I01A 2AREA 4I0AA 3E5UA 1ULEA 4L0PA 5FUNA 1UPSA 1IHMA 4HVOA 3PVBB 4QXKA 3RWKX 1CPNA 2RV9A 2VW2A 4CDWB 5FLHA 5IYYA 2DTWA 1W6NA 2W08A 3BPSA 3NV4A 2HWE3 4FP2A 1LHVA 3LOIA 3NW4A 4YZ1A 3LFMA 3AVRA 3AP7A 4DNYA 2GSYA 2PHFA 3MW3A 4ZONA 4AL9A 2RS51 4XZPA 1VBB3 2PQSA 1XU1A 2IXLA 2VMHA 2WL1A 3CZJA 1ASJ1 2VD7A 3IPVB 1AYM3 1OBNA 2WZ8A 3THPA 4MGTA 4AHWA 4XBLA 3NL1A 2C24A 1GWMA 2D97A 2WNUC 2ZEXA 2UWBA 3ZN5A 4H7MA 2VVDA 3VBUC 3UT0A 3BN6A 2JG9C 2UYAA 2V09A 1W0NA 4XFCA 4EROA 3VBFB 5AC93 2F4LA 3M7AA 5FZ0A 4AFMA 1TMF3 5GKAC 5C5UA 3IMNA 1U5ZA 4K1YA 2QZ3A 5HV0A 2I45A 3HT2A 1JOPA 1GZCA 2OZJA 4QHBA 2RG4A 1S55A 4XFHA 1SLCA 3WQ0A 5IVFA 4KI5M 5JI7A 5AFEA 2XJRA 1RVF2 1IPSA 1GOFA 1DIWA 4R9BA 1NCQC 2GU9A 3OGRA 5JOYA 1YUDA 1AYN2 3GBGA 5C7GA 4I3PA 4RGAA 4WVWA 4OMDA 1BCXA 3DCQA 5FYYA 2YFZA 3BODA 4V2VA 4QM9A 1ZRFA 4FQ4A 2K9ZA 5E89A 1GFF2 4QX2A 3K4ZA 5LBEA 3NAPB 4B29A 1JHNA 2NPIA 3OEBA 4E8CA 2D43A 1D7PM 3K2OA 4XDQA 5T5OA 2BVBA 5J98B 3D4KA 4MGZE 2HWE1 2Y38A 3BOPA 3QCWA 5F9TA 1JZ4A 3FUOA 1KGYA 4OHWA 2B9UA 1TNFA 1WLWA 3WVJA 4XIOA 4EZ4A 3IAQA 1ODMA 4QQLA 4FXGB 1E5HA 1VBB1 4CCDA 1HXS3 1NLRA 1G6NA 3LZZA 1AYM1 4R9DA 4E27A 3OBRA 5BUVA 2UWAA 5FK8A 5JSOA 4KGQA 4O65A 2BWAA 1Y9MA 2PHXA 2E33A 2RMU3 4LE3A 4NPLA 5A1AA 3H1WA 5FZMA 2BOJA 3N7LA 1W8OA 5GZDA 4CU6A 3D82A 3LSEA 4KU7A 4G4FA 5FKCA 5AC91 1LU2A 1JYCA 1VR3A 3OGVA 2VMEA 1TMF1 1XNCA 1PGL1 2QFEA 2IXCA 2VBDA 4O9EA 3RZHA 3I8TA 2WBKA 4JKKA 2EAKA 4CCKA 3V64A 2GP3A 5CG8A 2E26A 3F2ZA 2PHTA 4AVSA 2ZABA 2D40A 2VNGA 3ZFEA 2ZEYA 3NJYA 4DINB 1RUD2 2VQAA 1HRV3 4YRDA 3VBFA 2BNNA 2QUOA 5FMDA 4DZGA 1WMEA 4L8QA 4NRMA 4GZ9A 1XNDA 1O3QA 1COV2 1W0OA 4AI3A 2GH8A 3T1MA 2ZGLA 4YLZA 1D4M1 3K3NA 3ACGA 1J3RA 2DUQA 1PGW2 4XJZA 4XQWA 4XIKA 3WD5A 1JZ7A 4XF3A 5GZGA 1S0GA 1DHKB 3SXWA 3WNKA 2WJSA 1W2OA 3IBMA 4NIIA 3EO6A 4R52A 1W8TA 2ZHLA 5KC5A 1CGPA 4TYSA 4PQ9A 3FBMA 3E6DA 1J3QA 1RINA 2ZAAA 2FQPA 3GZAA 3LA3A 2GNDA 2H0BA 3I49A 2WNUB 1XB9A 3TB0A 1OFNA 3PMSA 1DG6A 1HXS1 1PHMA 2EICA 4LBNA 3NAPA 4UF0A 4UOJA 1B35C 2JG9B 1V9U3 1PK6C 4QU1A 4BQ3A 4MXVA 1LHOA 3DKWA 5GZEA 4CDUC 4MGIE 3O1VA 1VB2A 4X6RB 4AAXA 1LECA 2RMU1 4HN0A 2F17A 2Q30A 4N7UA 4YG0A 5D8AC 1GWKA 3A22A 4YZ5A 5C8WA 3T0DA 1Q3EA 1OLQA 3WDTA 4A7ZA 1TEIA 4P5HA 3VHOA 1UN1A 2RS33 4WV8A 1YFUA 3ON7A 3UL2A 1QXJA 4FQZA 3FHQA 1OXCA 3ZSKA 2Y60A 1RUI2 3I2DA 2XBO3 1FT9A 3S5AA 1NCQB 3WF0A 3E6CC 2OX0A 3G6JB 4QGMA 3LB9A 4NHMA 4FXKB 5ANQA 4R9CA 1Q8OA 5DAXA 2Q8OA 4CUGA 3H3ZA 3RZMA 4XXAA 1LOEA 3ETQA 1WW6A 1POQA 4MH0E 3B9CA 2DYCA 3JUUA 4NMIA 3VKOA 1JYXA 1HRV1 1VB4A 3ZN4A 4Q8KA 3THCA 4JKMA 3ZXAC 4LXLA 4Y1YA 5SV5A 2PQQA 4ATEA 1VBD2 3NKTA 1D4VB 2V5DA 4XJWA 2VCMA 3BVCA 4RGKA 1W04A 5H9RA 2PELA 4B7KA 2N7GA 4BXSV 1V6IA 4AVAA 4TSVA 2D93A 1V6KA 5FYMA 1LCLA 2EIBA 1LEMA 4IXLA 3OD4A 3FLTA 3K4AA 4LHKA 4AWDA 2Q8DA 2VZTA 4AFBA 4GQ7A 4IE7A 4FO9A 4D7YA 3NV3A 1RMU2 1G9AA 1NUKA 2YB7A 1ZZ8A 3OSDA 3O1MA 3BTXA 5IATA 2VC9A 3VDCA 3VBHC 4H55A 1N1SA 3DV8A 1IG3A 3P1IA 5J36A 1HW5A 1H2KA 1V9U1 1HN0A 1VAMA 4CTEA 1K5JA 2K0GA 4XAEA 2MHFA 5K4LA 5BNNC 5JUVA 2GN3A 5FBZA 1AR93 4XW3A 4XE9A 5FZKA 1J59A 3WNPA 3EJKA 4CP2A 1BXHA 3OD0A 5LK5A 1UKRA 4RR3B 4X6QB 1IGOA 4CPBA 4GMP1 1W2AX 2WNUA 4RL7A 2XBO1 3POFA 3RMXA 3VBUA 4L2NA 2BQPA 3LWCA 4GULA 2JG9A 1OKQA 3B01A 4C90A 3D6EA 5FMOL 2BERA 1PNFA 3I3EA 1ULCA 4WZCA 4IV1C 1OF3A 1LEDA 5F3EA 1DQ2A 1UY3A 1Y9GA 2HWF2 3D3AA 4OUMA 5FZ3A 1EPZA 2E7AA 3BOWA 1CAVA 3LEKA 2PHLA 1X8MA 2ZZQA 3UJOA 1MVQA 3MFAA 1LGNA 2OQ7A 2OT7A 1PVXA 4IERA 4XF9A 1F15A 1U5XA 2YPDA 3WQBA 5FPUA 1DQ6A 2JKBA 5GLZA 2Z79A 2ZGMA 1W3VA 1AR73 2NLRA 3VZJA 1BKZA 1NCQA 2VOVA 4QQOA 1BBT2 1JW6A 1JBCA 2BWCA 4Y5SA 4ZHNA 2DVGA 4UBHA 1YCIA 5FLIA 3POYA 1AJOA 2P6HA 2RM22 2RVAA 2JB4A 2XVLA 4LA3A 4YZ3A 4CP9A 2AR6A 5LB6A 1HQWA 2OUJA 4FPKA 4JHTA 1QDOA 2D6NA 4CP1A 2A73B 4P5YA 5B2GB 5IFTA 2JWPA 2DVFA 3TRSB 3GHNA 3ZXFA 5BNQA 4OVEA 3RDIA 2FDGA 4META 5FZ7A 1J1TA 1B35B 1PK6B 5FR3A 1AX2A 3OUJA 4B4PA 4CDUB 4Y33A 1O91A 1UOJA 2GC2A 4Q0UA 3E6BA 1QGLA 2LROA 3C8XA 1OA3A 3DN7A 1NQDA 1FOD1 1GKBA 2C0ZA 3KCXA 4AI1A 2WWSA 2ZEZA 2Y26A 3DEMA 1XQNA 3ME2A 3I54A 2WNOA 1AR91 5FZ1A 3WG4A 1H1IA 1U12A 4Q1PA 3AJYA 3LQCA 1RUJ3 1GV9A 2QQUA 2VZOA 3H8OA 4IESA 1FPN2 3PNAA 5L7OC 4YW2A 3RRDA 1W05A 2PLV2 2VMDA 3LDRA 1CX1A 2JDAA 3KQRA 2WQ4A 3N9OA 3FL7A 2VNRA 4RFRB 2XQXA 4N9HA 1I3HA 4IEXA 2ZGSA 3VHNA 1P8JA 1L7LA 2EXKA 3ES1A 2GH2A 4RQPC 4GIQA 3N36A 4N43C 1NOVA 3KMHA 1GYKA 4F8AA 2FBEA 2EF6A 3EB7A 4A2UA 5K9YA 1AF9A 5C70A 1AR71 2A1XA 4QU2A 3VDAA 1WWYA 2DCJA 1F9KA 4MV2A 1QJX2 2HH9A 4QPIC 3M70A 2BZDA 1AL0G 2AEZA 2HWC3 1MPXA 2DCTA 2R32A 4FPFA 3HQXA 2E32A 1R64A 1LHNA 1W99A 2B8MA 2ZHKA 3B5LB 2KD7A 4HMZA 5KXBA 3IDAA 4E9KA 3P5BA 5I8SA 1WKYA 2E7TA 2Y33A 2RS12 2QQWA 2PN5A 3CZUA 4QX1A 4IEOA 3FUQA 5EFUA 1LB2A 1XNBA 4LBQD 4AVVA 2Z2SB 4NPRA 1UYYA 5BNNB 1KXGA 1VP6A 1ZBE3 4XVHA 4CXWA 5EHDA 1TQ5A 5FWEA 1Y4WA 3LEGA 5IVCA 5JXHA 2B39A 1ZZ6A 1ZRDA 5BNPB 3KD4A 2HWB3 5IAVA 3T0AA 2XPJA 2YC0A 3H3UA 3KV4A 2A6YA 3PUSA 4Z2AA 1RUJ1 1B35A 3RZJA 3JZVA 1PK6A 3J7LA 4GA9A 1RVF1 2ZGTA 1MS5A 4K20A 3CU7A 4UT5A 3ZVXA 4CDUA 5A32B 4COYA 4IV1B 4QQHA 1W9TA 1C1LA 1PO22 5D8AA 2ZX3A 1AYN1 1NY71 1RUD3 4HPKB 5FJKA 5A7SA 4JVAA 5D2AA 4JDNA 3J26N 5LK7B 2NZ9A 4NWWA 2YYOA 4DUXA 1ZNPA 2VTFA 1JYVA 2I74A 3OG2A 1MQTC 1OSGA 1YWKA 4GAZA 3AKTA 3VD3A 1O8PA 1RUH3 3DGTA 4IE5A 3ZFFC 1Q8VA 2C5DA 4TXWA 1MVEA 4Y3OA 1LAJA 1JU3A 5FO7B 4LHLA 1NA1C 2W95A 3A0NA 5FOBB 2PHDA 3HNBM 1S0IA 5HCFA 4ES8A 4IE4A 2DV9A 5A6XA 1PX4A 3USSA 4FSJA 3P6BA 3M8LA 4CDXC 2J1UA 1NXD1 1IOAA 1HJFA 3NNLA 2GMPA 2OPKA 4IQPA 1UWWA 1ZZCA 2VW1A 4W4ZA 1ND2C 5IW0A 3ZYBA 4YNIA 3AXDA 1AJKA 2AC1A 3B02A 1DQ1A 1N1VA 3H7JA 3L9JT 5FYHA 2BDRA 3Q8AA 2XLFA 2VQUA 4YFWA 2W3JA 1MS9A 1UZYA 2ARCA 1ZZ7A 1GNZA 1JYWA 1Z0HA 3THTA 4A4AA 1NX9A 1ZBE1 4M0HA 3V0BA 3PLQA 2EXHA 1JODA 4V2WA 5F5QA 1GANA 1LODA 1CN1A 3D0SA 5L7OB 5FZEA 2HWB1 3VBHA 2DU1A 1LRHA 4DIQA 4LLFA 4SLIA 4BQ4A 3ORJA 5FY7A 5I93A 2E31A 4Q4V3 2W68A 2G9FA 1SG3A 1XE7A 2JDMA 3MFCA 4SBVA 5BNNA 5G04L 2CWMA 3ZSJA 1RUC2 1WZXA 2G9ZA 4XF4A 2FZ2A 1RUD1 2TBVA 3VZMA 4RQPB 4UI9L 4N43B 2FMYA 3KCCA 4HANA 4EN9B 4ES9A 3EHKA 2C9AA 3M3CA 2CYFA 4MXWB 5FUIA 1LOAA 1VBD3 4KNCA 2WUHA 4M3CF 5T3NA 2VUCA 3IDEA 2A70A 1AX0A 1JTZX 3GHMA 1IPKA 3UESA 1PGW1 1RUH1 3KCYA 1YFWA 3LPFA 4QPIB 3V0AB 5A32A 4IV1A 2HWD3 2JD9A 1V70A 4K7JA 1DU3D 1YO8A 4XDPA 3BIEA 1EP0A 4LBJA 4DUWA 4YSFA 2WO1A 3C7OA 2BFUL 3N9NA 1DGRN 5CFCC 1ZRCA 1LTEA 1DGLA 2VUDA 4DMIA 1GP6A 1NLQA 4PIYA 1GBGA 4AOCA 2YG0A 5A3UA 1H2MA 4K8RB 4CU7A 5JLVA 4RGGA 3UNPA 2Z4FA 5ANNA 3GGLA 2J1RA 4XFIA 3ZYGA 2ZJCA 1VALA 1E5IA 1G9CA 1UF2C 1CIWA 2VG9A 1HB2A 1LGCA 1MZFA 3MYXA 1J1LA 3ZXKA 3T2QA 5FYTA 4MVTA 5IK7A 1QXPA 1KD7A 5C3RA 5ACA2 4MO3M 2D5FA 3WQ1A 3PJYA 1XYNA 1HRI3 1MEC3 2KM2A 3ETPA 4QDRA 2ZX4A 2YXSA 4LBLA 1DZRA 3RSJA 4Q4V1 4Q4W3 3WP6A 4OHYA 3CF6E 3TEYA 1UY0A 5FMCA 1WCKA 3LGRA 4XQDA 2WYFA 4DXSA 3BUCA 3VBRC 1A34A 1MQTB 5FREA 1D2QA 1NKGA 3PHMA 4L92A 2VZUA 1XC6A 4XOGA 1QIQA 1ENXA 3HPNA 3ZFFB 5L7OA 4XCAA 2DFBA 4KWKA 4D6RA 3KLSA 3TEZA 4QX5A 1BBT3 1VBD1 1XSRA 5LEJA 4ISRA 1NA1B 3MHZA 1V6JA 4JTNA 2RM23 5JZGC 2V5YA 4B1MA 3MIGA 5F5IA 5GLVA 1H4HA 5T52A 2ZGNA 1W9YA 1AR82 2HWD1 4BXFA 4CDXB 4EE2A 5ABJB 3B7MA 2TNFA 5FDBA 4BIOA 4RQPA 2YV8A 4N43A 3DYMA 5FMBA 1JZ6A 2WSUA 4C1WA 4J6GA 4HK8A 2R042 5DABA 4OUEA 1OPOA 5FPXA 2I07B 2WDBA 2VUAA 4QM8A 4FPCA 5KWRA 2SLIA 4QPIA 4CEWB 1F8VA 2ZCWA 3LD8A 5L36A 4HSLA 5LY2A 2EA7A 4Q0VA 4NIHA 2YC2A 3VKMA 1S0EA 3KGLA 4LOTA 2RJLA 5C71A 3C2UA 5EJZB 4Q0PA 1LOCA 5FY9A 1LOGA 1VRH3 2Z69A 3NSTA 1T2XA 1V00A 1XSQA 2B46X 4H2AA 5DZEA 5HI0A 5F3IA 4CCMA 2VCAA 4JGZC 1MEC1 3SITA 3NJVA 3RMYA 5FY0A 1AUYA 3RYRA 3LAGA 4Q4W1 3UK9A 2DWRA 2JE8A 5DAQA 1YI9A 4EYUA 1UU6A 1UCXA 3AP9A 1S4CA 2PHUA 1RTVA 1W9SA 2VOKA 2BGPA 1F4HA 3BCWA 3KV9A 1WGPA 3MF6A 4WVVA 1J83A 2WT2A 4WVMB 5C3OA 2XKPA 1UMIA 2VZRA 1TG7A 3WW4A 2D6MA 4MLOA 1BBT1 2B9VA 3BU0A 4S2GA 2QQPA 1UOBA 4Q2FA 1NE6A 4PLOA 2RM21 3SMHA 3KT1A 1VBE3 1W6NB 5JXIA 1QWRA 3O7OA 5CFCB 3SCFA 4UFHA 3MBWA 1LKNA 1CZTA 1MQTA 3JQWA 4N8MA 2BOIA 4QKFA 5EP9A 5FMOS 3A0KA 1LOFC 3GYDA 4ATFA 5LBBA 3ZFFA 3WF4A 2PFWA 5FY8A 2FCTA 4AW7A 2GALA 3K4DA 3JBG2 4MZUA 3T2TA 1QJU2 1NA1A 4DXRA 1WMFA 2XHKA 3ITQA 5GM0A 3RNSA 4MGYE 4NVPA 1VPHA 2VE1A 3KVBA 4B8EA 1TNRA 2GMEA 1W8HA 4N7IA 1SBFA 5CG9A 4FPOB 4CDXA 4YZ2A 5A3LA 4FBFA 1K45A 2BNOA 1OMIA 1YFXA 2XONA 3Q8BA 1ND2A 2BEOA 3ZR5A 1BMV1 4PJYA 3VDDC 2WO7A 3O0VA 3POGA 3LPGA 1ASJ3 4X8NA 5FZ9A 4UBGA 1VRH1 2BVVA 3ZM8A 4PIZA 1PM7A 2R49A 2XL9A 4CCJA 1SDWA 1EV12 1H2NA 3MIHA 4P02B 1APNA 2ZS6B 2E7QA 2WFPA 4EWDA 1OI6A 1ZA4A 3LIGA 2E63A 1WMXA 2J1SA 5K8SA 1C4RA 4JHZA 3W9AA 3I2KA 3OYWA 3USUB 5IVBA 1JOBA 1QHDA 2DU0A 2PA7A 3RPQA 3AYEA 5T54A 3L2YA 2WS93 1WW5A 4QKDA 3VBSC 1BK0A 1G7YA 4RS5C 2P6CA 3C7HA 3O5SA 1ULGA 1F4AA 3SKVA 4COWA 1OH3A 1SQ4A 1PM4A 3SC7X 1GU3A 2ZOEB 3LDKA 1FV2A 1ULDA 4PBPA 2EVXA 2Y6HA 3U07A 4F83A 1RUG3 1VBE1 1RHI2 1YYNA 1GNYA 4I02A 1WLCA 1KEXA 1OQ1A 4AGVA 3GALA 5AFBA 2CU5A 2R30A 3P3PA 4GMP0 4CU9A 1IQAA 4DEQA 4WVMA 3NNGA 4P9LA 1BHGA 1CAUB 2WFF2 5FRAA 3FBYA 2XUEA 2Q0AA 1HV0A 1UIJA 3WEZA 3RZGA 4AI2A 2R16A 4RFT0 4NAOA 4CA9A 1QQP2 2FCUA 3R0RA 1DLCA 1JUIA 5G05L 5A7PA 3E5QA 5CFCA 5F1RA 1PO13 4AQSA 2ERFA 3N7MA 4QDSA 5FP3A 3AYCA 3GCWA 4JRLA 4XTMA 4ZS2A 5FYSA 1JZ8A 3VZLA 2DF7A 4J25A 2D6LX 4QGNA 1DYKA 2FDKA 4AK3A 2WKKA 3A7QA 1W8FA 2DDUA 1L7RA 1I1EA 4H14A 1OURA 2OUHA 2VVEA 3EYPA 3MI8A 4XUQA 3U4XA 4FPLA 3ELNA 4FAHA 3MUY1 3WCRA 1Z7S2 1O4YA 4XC9A 3ZFEB 1N1YA 3OBTA 4FPHA 1L3JA 4A3XA 3BALA 5FYIA 1XYPA 4WM7C 2VOWA 4NRQA 1F35A 3SNMA 5T5PA 2ARXA 4QPWA 2WS91 3TAYA 1H6XA 3I4IA 3AYAA 3WG2A 2O1QA 1W6QB 3DPRC 1OA4A 1MS3A 3TEWA 4YW1A 5KXEA 1FI2A 3OPWA 2YDEA 3VBRA 5KHIA 2WABA 3J8F2 5HCHA 1GZWB 1RUG1 2G4IA 2R062 2YMZA 3WDWA 1QNWA 3USUA 1VMFA 4KWJA 2AACA 1VRBA 4K6BA 3R6SA 4GB33 1YQ8A 1JI6A 5GALA 3RJRA 1D4M3 5JZGA 1FMD3 4NRPA 5FLJA 4UF0B 4D3WA 4W50A 5KHGA 1QY4A 5DAWA 2UURA 3AKPA 1MZ6A 4BQ1A 4XFGA 1CZSA 1IS4A 3NV1A 3S6PA 3AL5A 3VDDB 1VIWB 2OPWA 5DN2A 3U75A 4AI8A 2B45X 1R082 2Y6GA 1PO11 4AHZA 2ETEA 1CAUA 4IGQA 2QTWB 4F3JA 4QHZA 3AKQA 4V1PA 4GWJA 4AFDA 1E57A 1ODNA 3H8UA 3T4HB 1I9RA 2CGOA 1RUC1 4MGQA 4KBZA 4A44A 3MIDA 2J7MA 1HB1A 2O8OA 1JS9A 5BY5A 5F5AA 4XHBA 5FZLA 3VBSB 3BU7A 3V56A 1AXZA 4W6YA 4JGZA 2VJXA 1Q8PA 5JMOA 1PMJX 1ZBA3 5M0TA 3IZOA 3MIBA 1GNHA 4BWOA 4Y4RA 4B7EA 3ZMOA 5FY5A 3VHPA 1DZQA 3I3BA 4YYOA 1YIFA 1ENRA 5CVRA 2ZGPA 3LEIA 5FP4A 4UFIA 4IGPA 5DMYA 4RHV2 4XF1A 3I97A 4BK5A 2EXIA 2Y0OA 4PLNA 3ZDVA 1CIYA 4LKSA 5A7WA 1PZ9A 4XILA 2LALA 2DTYA 2ZPXA 4DY3A 2UU8A 3EBRA 2PXJA 4GB31 4H3WA 1FMD1 1A3KA 5DAPA 4BLJA 3OUIA 5BV6A 3U10A 5J09A 1PIV3 1W6QA 3B93A 3ALQA 4PI2A 5FYCA 4IEVA 3QH7A 1LOBA 1STMA 1VBC2 5LEKA 3AKSA 1GZWA 4Y5Z0 5DDJ2 1BYHA 4CUCA 1LOFA 3TNQA 4UAPA 4CRQA 1QU0A 1YNAA 5JVVA 2W91A 3ZLIA 3AMPA 3WV6A 2OIIA 4OI4A 3ZYRA 1A8DA 2BFUS 3PIGA 4QQPA 1H0BA 4J1XA 5DUUA 5BNOC 2ZHMA 2ZMNA 3QACA 3WHUA 2VH9A 1CVNA 1GR3A 3C3VA 5CYYA 5F32A 3M3IA 3T30A 2YPJA 4HKWA 5DG2A 4HBNA 4FFHA 1VMHA 3JU9A 3OOXA 1QJEA 3VDDA 4MHUA 3RWNA 5JDBA 1CAVB 4IEZA 4XJUA 3OBAA 1QOOA 2IXKA 1HDKA 4M4PA 4GMP3 5FY4A 2R0HA 4YW4A 2XVGA 2A3WA 3K75B 3NKGA 3UGHA 1G86A 1GMMA 4L97A 1ZBA1 5FUPA 3RJ2X 2ZGQA 5A6ZA 4JRAA 5LASA 5LRRA 3UKTA 1OLRA 2WNEA 1X7NA 3Q8FA 4YGEA 2QDNA 4CP9B 4LTAA 2J1VA 5JI9A 3WZ1A 2D3PA 2XJQA 4Q8LA 3VBSA 2VL4A 3JD72 3LF7A 4RS5A 5B4NA 1H4GA 1R1A2 1SPPB 2Y34A 3IM0A 3ZIXA 5L19A 4XZUG 3WW2A 1UPIA 2VMIA 2P3JA 3PL0A 1W0PA 2WT0A 3WY6A 4Q29A 4DXZA 4RA0A 1NLSA 2O8QA 4Y1VA 3AKRA 1T6GC 4QB1A 4E8DA 5HXMA 3MW4A 4PI0A 1PIV1 4A45A 4EN6B 2BGCA 4JGYC 3NMBA 5E16A 4EWEA 4CPBD 4JAAA 1C28A 3Q8EA 4XBNA 1C5IA 5HXVA 4EN0A 1C57A 2GMMA 3UYJA 2AYHA 3I2FA 3HEIA 1EAH3 2QQMA 3VD9A 1AXYA 2JIJA 2JXAA 2IXJA 3KF3A 3MIEA 4GWNA 4QDQA 3GBFA 4NAMA 5FZOB 2VZVA 1X9PA 2CNAA 1YIPA 3U0ZA 3I2GA 2WA3A 4W8JA 2RE9A 2W39A 2ZKNA 2D5HA 1R093 2R072 1FOD3 4GKYA 4YW7A 2JJ6A 5C3QA 1XE8A 5LA1A 5EJ1B 2OYZA 4FOQA 1S1AA 1RGSA 4LBMA 3HWJA 1OVPA 2RHPA 2E51A 4XDOA 5FIXA 3WOGA 3PVOA 3VB9A 2WRAA 3PU8A 4ARXA 4D7TA 1C8M3 4Z07A 1UQXA 1LESA 4IE6A 4QXCA 3ZX7A 2XDVA 5GZCA 3RZLA 4LIVA 4YVWC 1RUF3 5FAXA 3VD5A 4CXYA 3AX4A 1K42A 1IQDC 2CGPA 4WM7A 1LENA 3ACIA 4LHSA 4A42A 1W8WA 3KVAA 3ZKUA 4OQ8A 5LW9A 5IVEA 1NQJA 4PLMA 5FPVA 2WQZC 5LATA 4AGGA 3AFKA 3LFIA 4YM0A 4CCLA 3DPRA 2HEVF 1UAIA 1W6PB 4CU8A 4EWAA 4AEMA 1UU4A 5E6HA 1TME2 3KWVA 2O14A 5HCAA 4R4XA 5LA0A 3D0JA 4C0HA 5A1FA 5JWPA 1UOGA 5FPZA 1HQLA 4LK6A 5IFPA 4R8HA 4FOWA 2WAAA 2QQJA 2RR12 1EAH1 1SFPA 1SPPA 4FPEA 4OULA 5F6LB 2YBSA 5A3PA 1GP4A 5BNOB 2W2IA 1ENSA 1H8TC 1LR5A 2DUPA 3S57A 5H9QA 1RXFA 3QOPA 2XJUA 4R4ZA 5D8AB 3WUCA 5IK8A 1VBA2 2D7FA 2W0XA 1RUE2 3VD7A 3U11A 1R091 3W59A 3RYPA 1DZTA 4QPYA 4HL0A 5GZFA 2WN3A 1UX6A 1KFUL 2BNMA 1ZRIA 4MADA 2TEPA 2EIEA 4TTGA 2XWJB 4AE2A 3ES4A 3JQXA 5IUQA 2Y6JA 4NHYA 3KF5A 2VOTA 1RVF3 1W2UA 2XHNA 3KS7A 5FZOA 4BYYA 1BEV2 1Y7BA 2VOXA 4YG6A 5FTTC 3CHXA 1C8M1 1V6LA 1W6OB 3AC0A 1AYN3 1K12A 1WW4A 2A7AA 3ZR6A 3SLIA 4QX7A 1RUF1 2P3KA 4AQ2A 4XJ8A 3E97A 1AHSA 4OMCA 4CCCA 3Q8CA 4HVQA 2OA2A 3H50A 2G9GA 3SEEA 2LRPA 4CSWA 1O5LA 4NHKA 4XPVA 1O7FA 4QB6A 2R0FA 1PX3A 4UFLA 3WX5A 2QNKA 1X8EA 3GJBA 3AJZA 3H8RA 1QJZA 3NV2A 3AP6A 1UOFA 3OGGA 4KGGA 3HNYM 2C9KA 5BYNA 2F4PA 3KQ4B 1DP0A 3JB8A 4QGLA 3V0BB 2A6WA 2X10A 1YRZA 5J48A 1V6MA 1ULOA 1UZWA 3FHAA 4CEYC 4A41A 4XMAA 5C8CC 2VMFA 4AAPA 2VTXA 1VJ2A 3VBHB 3ZXLA 3C7FA 1BQPA 3HOBA 5C9AC 1QH7A 4COZA 1X82A 4IUGA 2J22A 3PMEA 4Y22B 4KG0A 2A3YA 3UKNA 4AVCA 2YGLA 3OY8B 1W6PA 3NNMA 2FD8A 5DAVA 4C8DA 1N47A 3ZPYA 3CNAA 2ZX2A 2VZPA 4AYUA 4IL7A 2GC0A 2R1BA 2H6BA 2P37A 5GLUA 5LA9A 3VL8A 1ZX5A 3A4UA 3MGUA 5JAXA 5IVJA 3WDXA 5BNOA 2CGNA 4YVWB 3A21A 4XFAA 4ZY9A 2VPVA 4LPLA 2W1UA 1YJKA 4QKBA 3SKJE 5IT6A 3QH6A 4IDZA 1S0FA 5I8TA 3CKHA 3DYPA 2YFUA 4XABA 4A3ZA 3POIA 1COV3 4M00A 3I2HA 4AEKA 4RN5A 3ZSMA 4M3CA 2ZXQA 2QQKA 4KH9A 4AF9A 3VZKA 1SLLA 2GNBA 3DECA 4OFGA 3VL9A 2RS52 2Y0IA 1AR62 1AL22 3WUDA 1W6OA 2H0VA 4INDA 4BMBA 5DDJ3 3VBOC 2PTMA 2ZBJA 4P00B 1N1TA 1GICA 2VCBA 1JU4A 2NMOA 2P34A 4QAWA 4BMEA 1TVGA 2EXJA 4KQ7A 1YLLA 3LKJA 1BVVA 1H8TB 2ZX1A 5CU1A 4RSUA 3K77A 2A6VA 3U1XA 2W9XA 3KV6A 4P14A 4JGYA 2WZPP 4URTA 4PQQA 3H7YA 2ZTNA 1GOGA 5JR2A 4AXOA 1H9WA 2IC1A 5IHRA 1SHWB 2YU2A 3S7IA 3T2PA 5DUXA 1H6YA 2B5HA 5B4XA 4QQ2A 1HN1A 1RUI3 4NIDA 4S2HA 1YHFA 1FAYA 3MPPG 5GJ6A 1FNZA 2OZ6A 3RS6A 3MEPA 3UETA 1AX1A 3CJXA 1ND3C 4Y22A 1EUUA 3WNMA 2XG3A 5FZHA 1XRUA 2Q1FA 3OY8A 4HZFA 4WM8C 5LA2A 4GXLA 5FZCA 1S2BA 1G8WA 1Q43A 2K2SA 3PU3A 1ONAA 2GZWA 4HVRA 5I0SA 2PHWA 2G19A 2RDNA 3JD73 4AFAA 2JG8C 4GJYA 1R1A3 2WWJA 1YEWA 2JICA 1C5HA 4YGBA 4Z8BA 5C3SA 5JPMB 1COV1 2IFRA 3IKWA 2HWE2 4PCRA 1ZYBA 5JOZA 2P3IA 3R4UA 4QXHA 1KFXL 4YVWA 3R4DB 2JDNA 4OQ9A 1S0JA 1QJY2 3BIWE 2RDQA 1O8SA 3R4SA 4LR4A 4BQ5A 4JTOA 5JXJA 1AYM2 1HX6A 1RB8G 5DDJ1 1QDCA 4YVSC 2OKXA 2QE3A 3WLUA 4CEYB 1Y43B 3HQRA 2NP0A 1RMU3 1KJLA 4K1ZA 3TN92 1G9DA 3ZYIB 4S2DA 4WZFA 5LRSA 4FPYA 3RI9A 5EYXA 4LE4A 3ZXJA 1NAEA 3K51A 5DQ0A 5AC92 2R073 4HSJA 4IE0A 1TMF2 3POBA 3ACFA 2VNOA 4GD4A 1ULPA 4AZZA 1PGL2 3H9AA 5FXZA 3SH3A 2P2KA 2VW0A 4PHZA 2LTNA 1X9TA 3ACLA 4QX8A 2VQ0A 4BLIA 5FZ8A 1MS0A 4EQVA 1WCUA 1REFA 2FDJA 2VQTA 2X8KA 3IB3A 4WBBA 3SEPA 3WW1A 4DFSA 5GLWA 4E4ZA 1RUI1 1H8TA 2VMCA 3OEAA 4GH4C 3W21A 3FMGA 1US3A 3H3LA 2XVKA 4PDWC 1S2EA 3WDYA 3VDBA 1D2SA 4Y1UA 2HWF3 1QXRA 2MEV2 3NNFA 3OGJA 5KBFA 4X8PA 2VNVA 4OLLA 4DPNA 2KXLA 2MNGA 3JD71 1R1A1 3N35A 4UFMA 2D6OX 3GNEA 2Y64A 4K9SA 5FP7A 2CHHA 1RUOA 2JECA 1XNKA 2FCVA 4I2OA 3VBOB 4EN8B 3KGZA 1TME3 1SEFA 1VMJA 2LM3A 4CCNA 1OLMA 3NNJA 1W8NA 5JOXA 1UO9A 2W46A 3HN1A 1BVP1 2SBAA 4LLOA 4D6QA 1SZBA 4QWNA 3ZOIA 1H9PA 2GN7A 2X29A 4QXBA 1ND2B 5FO8B 4U2AA 2C1FA 1EYBA 2RMU2 2ZEWA 2RDRA 3IDBB 4ITCA 4Y26A 1RMU1 2CY6A 5A1LA 5JXGA 3A23A 3CLPA 4LKDA 4LUKA 3ZN6B 1LHUA 2ARAA 1VBA3 3C7GA 1SDDB 1KDKA 2R071 2ZGKA 3AMQA 2RJ2A 3WW3A 5F37A 5DUVA 4QPGC 1FATA 3AZXA 4HKLA 4AEDC 1QH6A 5FWJA 3OYWB 4CEYA 1KS4A 3MIFA 4E2SA 3MLLA 5C9AA 2DFCA 4QHOA 5CISA 1XYOA 1FPN3 1ND3B 5L9BA 4P9WA 2DURA 1CJPA 3M3OA 4XCBA 4LITA 3B3QE 1BLZA 1O59A 1HRV2 2Y8KA 2PLV3 1ZRRA 2AEYA 2C26A 4JC1A 2D6KA 2W92A 3ZXEA 3K3OA 2JG8B 5FXWA 2HWF1 1X33A 2P3YA 2ILMA 3FFZA 3OF1A 4BIFA 4DOUA 4CDWC 5FZ4A 3WHTA 2AH2A 4A6OA 3HD8B 2J1AA 3U14A 3S5QA 1PZ8A 2HEYF 1QJX3 1XNTA 1XJAA 2X05A 3I7DA 2WYSA 2IXIA 3HR9A 1TME1 2ORZA 1JZ3A 1QOTA 5I8YA 2P5BA 1D0GA 1VAVA 2AZ5A 2RDSA 3LA2A 3POEA 3W20A 1W8UA 2XL7A 4YGCA 3ENRA 1PMHX 3FX3A 1MS1A 1OQEA 2WINB 4AHYA 1V9U2 4YPJA 2WWUA 4E4SA 2RS13 3I3QA 2Q1MA 4JX0A 4UFJA 5FQ0B 4DRVA 4ZKTB 1AZDA 4JV4A 4CP0A 2AENA 2PMWB 5FXXA 2RS32 1SLTA 3NQHA 3T1LA 1VBA1 3VBOA 3KM5A 1RUE1 3ABZA 4DB5A 1CESA 1OUXA 4FCAA 1UW8A 3M4FA 2XBO2 3BGAA 3I3MA 3ZIWA 5E88A 4HKOA 1OC1A 5A33B 2P17A 2WT1A 4GH4B 4E2QA 5F2WA 3UGGA 1V6OA 3O14A 3IDCB 5IAXA 1FPN1 4YW6A 2OS2A 5FK7A 3CMGA 4PDWB 3ZN6A 5EJ3A 4JKLA 1PO23 3L2HA 2D44A 1M06G 1V6NA 2UYBA 2XLAA 2PLV1 2WAOA 5FV3A 3IN9A 3VBRB 1GLHA 2DCYA 4UXAA 3BTYA 5CKQA 4HK9A 1Z78A 3RYKA 2OQ6A 2AUYA 2YY1A 2V4AA 4XFFA 4C91A 3EQEA 1W9WA 4G9SB 5L73A 1KS5A 4YM3A 3VZOA 4ORFA 1IZ3A 5F6KA 1AR63 1ND3A 2WNVC 5JZGB 4Q26A 2BRTA 4XFBA 1KQRA 4WM8A 3ZXDA 1PMIA 1QJX1 5KHHA 3K46A 4FP3A 2ES3A 4KWLA 3FN9A 5FKBA 5FZBA 5BXXA 4E4HA 3N9QA 1PZ7A 2QDRA 2JG8A 3CDZB 4UFKA 3MZHA 4B4QA 3TNPB 1ZREA 1UZ0A 4LIUA 3FFQA 2VM9A 1JXNA 1NZCA 2RS11 3WP5A 1DDLA 1B09A 4YW3A 1AR92 1F5FA 5IK4A 2BGOA 4QPGB 3WP4A 3KZ4C 2HBUA 4AEDB 1MZEA 2XH6A 4QMAA 5K0UC 5E8AA 2Q8CA 4YVSA 5C4WC 4LULA 4CZSA 1M4WA 4OUSA 4K40A 1KRIA 4YFZA 2CL2A 1DGWA 5F8PA 3E1F1 3X29B 4OHVA 3HJRA 4BJ0A 1JYIA 4DUVA 3MLKA 1E5SA 2ZHNA 3WCSA 4JGZB 5J7MA 4O7XA 4N53C 4XYXA 5FQ0A 1UMHA 3G7DA 5FYVA 4ZXKA 5DUWA 2ARBA 2Z42A 5CFDC 1PO21 1HB4A 1RUC3 3HBKA 4P9YA 2WR9A 4COVA 1ZVFA 5JPNB 2ENRA 1XNAA 1XPWA 2XJPA 5H9SA 3GJAA 5HPOA 1O5UA 1OFSA 1AR72 1HKDA 4FPJA 5FY1A 1RXGA 2W1QA 5A33A 1FNYA 1LGBA 1N3OA 5A7WB 4GH4A 4NIGA 4NIAA 2BU9A 2QQNA 4J1WA 4QB2A 4F7ZA 2CAUA 4MGKE 4HETA 5IK5A 2D3RA 1AR61 1QJY3 1AL21 4PDWA 1NG0A 1UXZA 4LEJA 3KV5A 4DXTA 3AVSA 2A3XA 1W39A 3KT7A 4XBQA 3MPBA 3ZSLA 1KJRA 3TN93 2BTVC 4K3UA 5FYUA 1SBEA 5HBAA 2DBNA 5DPNA 1ZZ9A 3WF3A 4JQRA 5JSRA 3FWEA 2F6BA 4BQXA 4MYEA 4IV3C 1I5ZA 3ZYFA 1HV1A 2YC4A 1RUJ2 4XUPA 3PUAA 3B94A 4URAA 5FP8A 3WF2A 4CDQC 2X5IC 2YUEA 4XEZA 5AVAA 5ACA3 3O1OA 1GP5A 3OPZA 5CA6A 1NY72 1UD1A 1W2NA 2BYVE 1TZOA 1T6BX 2MPFA 2ZA9A 4NN0A 1K5MC 1FYUA 4XUTA 4LO7A 4Q4Y2 5IJRA 3T09A 1NXMA 1W03A 2GNTA 1UYZA 4CUAA 5JCTA 4NHLA 4QPGA 1QEXA 2BUKA 3ROUA 1O3TA 1NCRC 1YQ6A 2MEV3 1A78A 2VO5A 3CEWA 1QKQA 3AZVA 5EQUA 4AEDA 5DZGA 1W3XA 2IXHA 2JEMA 4Q4X2 1WUVA 5L9RA 4Z92B 1PVC2 3BKZA 1UZVA 4HXCA 1GQGA 3GM8A 4GJZA 4BU2A 2WNVB 2VZSA 2DCZA 4RS5B 3GZEA 3I2OA 3M1HA 1YC61 1JN2P 1OKOA 2HWC2 3BYWA 3PUQA 4OYUA 2P1BA 3CIHA 5KC6A 4AGRA 3VN4A 1OOPC 1QJY1 4FPGA 2PAKA 2VBPA 1OT5A 2VR4A 3URFA 2XQRA 1AR83 3OCPA 4ZPIA 3J4UH 1CQ9A 4LKFA 2CDPA 4XHXA 4I0BA 1CPMA 3RQ0A 2G1MA 4MOAA 2BPA2 4CDWA 1Y9QA 3INAA 2R043 3ZMNA 2ET1A 3TN91 2QQLA 1DFQA 4Q27A 1ZBE2 1AVBA 3KHBA 4ISQA 1C3HA 4FT8A 1BJQA 4HG6B 5K0UB 4TN7A 4UW5A 4E2GA 1V0AA 3HVDA 2UY8A 1GUIA 2FDHA 3I59B 5C4WB 1U5YA 3IPVA 2HWB2 2ZKLA 3AYDA 2DVAA 4ZS3A 1OD3A 4RR3C 2IVIB 3DL3A 5A80A 5FO9B 3HT1A 4BISA 3I2IA 4NOTA 5FZFA 4D7SA 2OVUA 4IEPA 4LHNA 2J1TA 3VZNA 2A71A 5ACA1 3N7KA 5T5JA 3AMMA 4G3YC 4N53B 3T3YA 3J7NA 3IMMA 2VU9A 4D8MA 5JIUA 4AG4A 1FV3A 1L7QA 1JZ5A 5CFDB 3HBZA 5FPLA 5CAZA 2XKOA 4GWMA 4AHXA 3SHRA 3RVHA 3FHIB 5H9PA 5APAA 2MEV1 1W28A 2VULA 4WM7B 1RUH2 2A6XA 2CSGA 5T50A 4MG2A 5C33A 2JE9A 1W9FA 3WSOA 3W5MA 3M2MA 3UV9A 4YW5A 1WMDA 1SCSA 5L9VA 3AM2A 3FC0A 5F7UA 3HQUA 2HEWF 4OHZA 3ASIA 3DPRB 1U0AA 1YQ2A 2CAVA 3K48A 5A3WA 1I5PA 1DLLA 5LBCA 2YHJA 4XETA 3WP3A 1XU2A 1AR81 1SFYA 1MS4A 3LA7A 1JUHA 3PVNA 5D21A 4AEJA 4DS0A 2V72A 5C3PA 5DG1A 3OJBA 3ZPOA 4TZDA 1O4ZA 4BK4A 2BV4A 3S0MA 1QJFA 2VMGA 3MF9A 4KWUA 4BZ4A 2WNVA 1U5IA 2R041 3M3QA 2Q1ZB 4XQ4A 5CEHA 3RG0A 3VD4A 3O1SA 3JBG3 4IV3B 1SLBA 1QJU3 2ZMKA 1C1FA 1MACA 4HOOA 2VY0A 3J9SA 5TSWA 3O1RA 3LIHA 5C5TA 4P9GA 4DEVA 2O0OA 4CDQB 2X5IB 1JZ2A 5SV8A 4Y20B 5FYBA 1JOJA 3N7JA 1CJDA 3N3HA 4NROA 5EWSA 4CUBA 4LO6B 2XOMA 3IT8A 4C1XA 1WCDJ 3OTFA 4FFFA 4Q4V2 2VGDA 4XACA 1K5MB 1GQHA 1RIRA 4NPMA 4N9IA 4O61A 3KB5A 2ZGRA 5CNAA 5E1RA 1R1ZA 3ILRA 3H1YA 3PDQA 4I09A 4EV0A 3EMRA 1EV13 3NJXA 1NCRB 3GZUC 3GBWA 4B1LA 5K0UA 1CD3G 4GALA 2ID4A 2QQVA 3I59A 5C4WA 2FZ1A 3QLQA 4NJ4A 1EPWA 1UY2A 5CB7A 2EIDA 2YZ4A 4ZZ5A 1WW7A 4EJRA 3GZTB 3WNXA 1O3RA 2HWD2 4IGOA 2YROA 4N53A 4UW6A 5IWFA 1OOPB 1LNSA 1ALYA 2CTVA 3OGSA 5D1IA 4LO4B 4ASMB 4K21A 5CFDA 4IEQA 4D94A 1RL3A 1XOYA 4M0NA 3S7EA 4YM2A 4M3CE 4PF1A 1HIXA 2ATFA 4LBOA 1RHI3 5EIYB 2NM1A 5I0UA 5I0TA 2JDHA 5KHJA 3OB8A 3SCGA 1S0DA 2W1WA 4HLTA 5J3UA 1DQ0A 3NJZA 2WZR2 3PTYA 3N9LA 2WFF3 3CBNA 4OI1A 3RGBA 4ZZ8A 3ZKYA 1UL9A 3ILNA 2BBVA 3WNLA 4AVBA 3DXTA 3JBG1 4TLFA 1QJU1 2RS31 1RJ7A 1UY1A 1CR7A 1REEA 5KXCA 4IEUA 3F95A 5BNPC 2ZACA 4Z1VA 3H8XA 5I0RA 1QQP3 2C4XA 2W47A 2W1SA 2Q8EA 1UXXX 1GZTA 4LBKA 1HRI2 1MEC2 3TOJA 3WDVA 1G9BA 1X50A 1SLAA 3ZO0B 4Q4W2 3POSA 5IVVA 2B7YA 2E53A 2IFWA 1H2LA 3P3NA 4IV3A 3QD6A 4Q0QA 1EV11 3MW2A 3OBZA 2V73A 3MV01 4NWVA 3FE5A 4JDOA 4XMIA 1Z7S3 1D0HA 5FCCA 5AVPA 1MR5A 5T5LA 4CDQA 2X5IA 4BE3A 4A6SA 4Y20A 5F3CA 1DF0A 4Q1RA 4LA2A 4LJHA 4FVVA 5FZIA 4BQWA 2HYKA 5KHKA 5BPXA 4B3NA 2ZGOA 1CAXB 1UYXA 1K5MA 2EALA 3SH5A 1MS8A 2W87A 1KDMA 4M3CB 1W8ZA 1YXWA 4FOYA 3RZZA 5JIAA 1X36A 1NCRA
chains in the Genus database with same CATH topology
1WA4A 3ILFA 2JDZA 4YGDA 4PBOA 2QKDA 5JMCA 2W52A 2HKXA 3J8F3 3WG3A 2LUWA 2R063 2FMDA 1RHI1 2A5ZA 3PJQA 4XJAA 3RI8A 4FAGA 3WR0A 3VKLA 2GAUA 4AQTA 3TBDA 4OI0A 3AMNA 4I0WB 1IKPA 5CADA 4LBQB 2D6PA 2WFF1 5JOWA 1OOPA 3SH4A 1BMV2 3WT3A 1H30A 4JGYB 1JH5A 1WD3A 1VRH2 3DF0A 3FLRA 4YARA 1SCRA 1IS5A 1HQNA 3H1MA 4KBBA 1QQP1 1R083 1POV0 2UY9A 3AB0A 4FOVA 3SISA 4Q4Y3 4RD7A 4YM1A 4RR3A 4FTBA 4Q4X3 4BPZA 1PVC3 1Z7S1 2R1DA 1UZZA 1WCSA 1PGSA 2WSVA 1IS6A 3ZFGC 3O12A 4YZ4A 3WXPA 5C6CA 1TE1B 1GSLA 2XWBB 3ST7A 1VBE2 4BOWA 1URXA 2BW8A 2X53S 2XLGA 1WBFA 1F31A 2XJTA 1J58A 1FX5A 3JB4C 4BCUA 4H7LA 1DQ5A 1G9FA 3J8F1 4RHV3 2R061 3NO8A 1S0CA 1J3PA 2HJIA 1CAXA 4AQ6A 2A6ZA 5EYYA 3WG1A 4S2FA 4XXPA 5EXOA 1DGWX 4DY5A 4LNVA 1VBC3 1ASJ2 4KL1A 1LHWA 3CJIC 2DUOA 2D98A 3ECQA 4ASLA 4O9GA 1DGRA 1R081 1S0BA 4LT5A 1W6MB 3AFGA 4LBQA 4AVTA 4Q0SA 2IWGB 4Q4Y1 3APBA 4LO8A 2ZZJA 1LULA 1DYPA 1S2KA 2VXRA 4Y1ZA 4Q4X1 1PVC1 2WS92 5FOJB 2E6VA 2R6QA 3AMHA 3AZZA 3FZ3A 5JSPA 4HFSA 1UU5A 2QJVA 4BA6A 5I91A 3CL1A 2HWC1 1RUG2 3POWA 5ABJC 1N3PA 1AXKA 2B42B 1OHFA 1Q5OA 3ATGA 4QT6A 2Z5WA 4Y24A 4AFCA 2E9QA 4U36A 1H8VA 2PYTA 4WVZA 2RJKA 4MX3A 4RHV1 1SACA 4K8FA 1CAWB 4CEWC 4JCKA 1F5JA 2WC2A 1WBLA 3AP4A 1OD5A 1PO12 4L11A 4W6XA 4DQAA 5EV7A 4I30A 2UWCA 1SBDA 1VBB2 4IETA 2ZAHA 2EAAA 2XB6C 4HT1T 1VBC1 5J96B 4PF5A 4Y1XA 4Z82A 5C8CB 3AP5A 1Q56A 2QVSB 5C9AB 2CV6A 4L9BA 3BTAA 4CYDA 4BM8A 2NQYA 3BPZA 5BNPA 1QMJA 1GZ9A 1HLCA 4OHXA 4TWTA 1H1AA 4I3GA 3N4MA 5HCBA 5A3MA 1EY2A 1Q8QA 2DVBA 3ZFGB 3AXEA 2D3SA 3ZSEA 1NYWA 2ZGUA 4P9JA 4HPKA 5KXDA 1W6MA 2AGSA 2GC3A 4NR1A 3MDPA 3VKFC 1QNYA 1BK1A 3DUIA 4W6WA 4GB32 4E4DX 2GC1A 2WZR3 3BB6A 1D4M2 1FMD2 3VKNA 4DRRA 4UW4A 2VVFA 3LCPA 1POV3 4C0BA 3VGIA 1PNGA 3ZYJB 4ZU4A 4BH9A 3W58A 4XJ9A 2WLPA 1SLIA 3FLPA 4NO4A 3CJIB 4Z2WA 2ZX0A 1IS3A 3M3EA 4ONUA 1HXS2 4YG3A 3S30A 3ZXGA 3QBQA 1CAWA 3B00A 2Q5TA 2QZ2A 2RR13 2I2SA 1MZ5A 2XJSA 4JDMA 1Y3TA 4ZU5A 2DVDA 4IEWA 1QF3A 3HAGA 1RUE3 2EIGA 2DCKA 3H0OA 1VAKA 3Q9OA 3GF6A 4HN1A 1ZBA2 5K7PA 4Y4YA 1RJ8A 1IPJA 4IEYA 5C8CA 3ZDSA 4MUVA 1BEV3 2NN8A 2ZMLA 3B69A 1UIKA 2PAMA 2Q4SA 1F2NA 2VECA 4MXWA 4PIXA 4WM8B 4BHPA 2FHRA 1Q8SA 4FTSA 2NYYA 3IWZA 2JD4A 4LUMA 1ENQA 1KITA 3ZFGA 3O0XA 3V0AA 2WZR1 1PIV2 4P9XA 1OPMA 1POV1 1CX4A 3VHRA 4KG8A 4FTEA 1FXZA 1ULFA 2XGXA 2XJVA 1N3QA 1A6CA 1DBNA 3V65A 3PVEA 3LOBA 4YVSB 4A7KA 1HRI1 3SCHA 4R9AA 5FFOC 4XF0A 2A75A 1RITA 2H6CA 4D69A 2RR11 3UJQA 4P9IA 2CWSA 4QD2A 1XXNA 3VUOA 3ZFEC 3VBFC 2WLQA 3VV1A 3JCIA 4N90A 3WQ7A 4A7YA 3CJIA 1RC6A 1IKQA 3UKVA 2JENA 1VLNA 3D8CA 1CONA 5GLTA 2JX9A 5DZFA 3IIAA 4AI0A 2JE7A 4KU8A 2WA4A 1WLDA 1BEV1 2WIIB 3B9IA 1LU1A 1C8NA 3KSCA 4MSVA 1RUNA 3MLJA 3HMYA 1H1MA 2TUNA 3LSDA 1WLTA 3FJSA 4GKXA 4XTPA 4L99A 2PHRA 2VUJA 5J37A 1SFNA 4OZXA 3NAPC 5DXDA 5ABJA 2XUMA 4B4RA 3TYJA 3ZYPA 2RS53 3AZYA 1AL23 1ZZBA 1OA2A 2NMNA 1NE4A 1WD4A 3CO2A 3NVCA 1I6XA 1QOSA 1YI7A 1O3SA 3WINE 2GDFA 4W65A 3O0WA 1EAH2 2ET7A 3KT4A 2IZWA 3AK0A 1UMZA 3E5XA 4CEWA 1UKGA 4COUA 5CBLA 1ZM1A 1REDA 4EN7B 1R092 1FOD2 2PAEA 4ZU7A 2GNMA 1O4TA 4M01A 5EZWA 3AZWA 3MICA 5CIRA 2YGMA 3EXUA 3WDUA 4LO5B 1YJLA 3TWIA 1A8MA 2OW4A 1BZWA 1C8M2 3NWKA 3D5OA 2KA3A 1RUF2 1LJ7A 5T55A 2QCSB 3HIFA 3R05A 4UW3A 5JR7B 4OI2A 1DQ4A 1YFYA 1SMVA 1OQDA 4I01A 2AREA 4I0AA 3E5UA 1ULEA 1UPSA 1IHMA 4HVOA 3PVBB 4QXKA 1CPNA 2VW2A 4CDWB 5FLHA 2DTWA 1W6NA 2W08A 3NV4A 4FP2A 2HWE3 1LHVA 3LOIA 3NW4A 4YZ1A 3AP7A 4DNYA 2GSYA 2PHFA 3MW3A 2RS51 4XZPA 1VBB3 1XU1A 2IXLA 2VMHA 2WL1A 3IPVB 1ASJ1 3THPA 1AYM3 4AHWA 4XBLA 3NL1A 2D97A 2WNUC 3ZN5A 2UWBA 4H7MA 2VVDA 3VBUC 2JG9C 2UYAA 2V09A 4XFCA 4EROA 3VBFB 5AC93 3M7AA 4AFMA 1TMF3 5GKAC 3IMNA 1U5ZA 4K1YA 2QZ3A 2I45A 3HT2A 1GZCA 2OZJA 4QHBA 1S55A 4XFHA 1SLCA 3WQ0A 5AFEA 5JI7A 2XJRA 1RVF2 1DIWA 4R9BA 1NCQC 2GU9A 5JOYA 1YUDA 1AYN2 3GBGA 4I3PA 4RGAA 4WVWA 1BCXA 3BODA 4QM9A 1ZRFA 4FQ4A 2K9ZA 5E89A 1GFF2 3NAPB 4B29A 1JHNA 2NPIA 2D43A 4XDQA 5T5OA 2BVBA 5J98B 3D4KA 4MGZE 2HWE1 2Y38A 3BOPA 3QCWA 5F9TA 3FUOA 4OHWA 2B9UA 1TNFA 1WLWA 3WVJA 4XIOA 4QQLA 4FXGB 1VBB1 1HXS3 1NLRA 1G6NA 3LZZA 1AYM1 4R9DA 4E27A 3OBRA 5BUVA 2UWAA 5JSOA 4KGQA 2BWAA 2PHXA 2RMU3 4LE3A 3H1WA 3N7LA 5GZDA 3D82A 3LSEA 4KU7A 4G4FA 5AC91 1LU2A 1JYCA 1VR3A 1TMF1 1XNCA 1PGL1 2QFEA 2IXCA 4O9EA 3I8TA 2EAKA 3V64A 5CG8A 2PHTA 4AVSA 2ZABA 2D40A 2VNGA 3ZFEA 4DINB 1RUD2 2VQAA 1HRV3 4YRDA 3VBFA 2BNNA 2QUOA 4DZGA 1WMEA 4L8QA 1XNDA 1O3QA 1COV2 1W0OA 4AI3A 2GH8A 3T1MA 2ZGLA 4YLZA 1D4M1 1J3RA 2DUQA 1PGW2 4XJZA 4XQWA 4XIKA 3WD5A 4XF3A 5GZGA 1S0GA 1DHKB 3SXWA 2WJSA 3IBMA 3EO6A 4R52A 2ZHLA 5KC5A 1CGPA 4TYSA 4PQ9A 3FBMA 3E6DA 1J3QA 1RINA 2ZAAA 2FQPA 3GZAA 3LA3A 2GNDA 2H0BA 2WNUB 3TB0A 5LRSA 1OFNA 3PMSA 1DG6A 1HXS1 1PHMA 4LBNA 3VBUB 3NAPA 3WP4A 1B35C 2JG9B 1V9U3 1PK6C 4MXVA 1LHOA 3DKWA 5GZEA 4CDUC 4MGIE 1VB2A 4X6RB 1LECA 2RMU1 4HN0A 4YG0A 2Q30A 4N7UA 5D8AC 5C8WA 4YZ5A 1Q3EA 1OLQA 3WDTA 4A7ZA 1TEIA 4P5HA 3VHOA 1UN1A 2RS33 4WV8A 1YFUA 3UL2A 1QXJA 4FQZA 3ZSKA 1RUI2 3I2DA 2XBO3 1FT9A 1NCQB 3E6CC 3G6JB 4QGMA 3LB9A 4NHMA 4FXKB 4R9CA 1Q8OA 2Q8OA 3H3ZA 4XXAA 1LOEA 3ETQA 1WW6A 4MH0E 3B9CA 2DYCA 3JUUA 3VKOA 1HRV1 1VB4A 3ZN4A 4Q8KA 3ZXAC 4Y1YA 5SV5A 2PQQA 4ATEA 1VBD2 3NKTA 1D4VB 4XJWA 5H9RA 2PELA 4B7KA 2N7GA 1V6IA 4AVAA 4TSVA 2D93A 1V6KA 1LCLA 1LEMA 4IXLA 3OD4A 3FLTA 4LHKA 4AWDA 4AFBA 4GQ7A 4FO9A 4D7YA 3NV3A 1RMU2 1G9AA 1ZZ8A 3VBHC 4H55A 1N1SA 3DV8A 5J36A 1HW5A 1H2KA 1V9U1 1VAMA 4CTEA 2K0GA 2MHFA 5BNNC 2GN3A 5FBZA 1AR93 4XW3A 4XE9A 1J59A 3EJKA 4CP2A 1BXHA 3OD0A 5LK5A 1UKRA 4RR3B 4X6QB 1IGOA 4GMP1 2WNUA 4RL7A 2XBO1 3RMXA 3VBUA 4L2NA 2BQPA 3LWCA 4GULA 2JG9A 1OKQA 3B01A 4C90A 3D6EA 5FMOL 1PNFA 1ULCA 4WZCA 4IV1C 1LEDA 1DQ2A 2HWF2 4OUMA 1EPZA 2E7AA 3BOWA 1CAVA 2PHLA 1X8MA 2ZZQA 3UJOA 1MVQA 3MFAA 1LGNA 4IERA 1PVXA 4XF9A 1U5XA 1DQ6A 2JKBA 5GLZA 2Z79A 2ZGMA 3VZJA 1AR73 2NLRA 1BKZA 1NCQA 2VOVA 4QQOA 1BBT2 1JW6A 1JBCA 2BWCA 2DVGA 4UBHA 1YCIA 5FLIA 3POYA 1AJOA 2RM22 2XVLA 4LA3A 4YZ3A 2AR6A 1HQWA 2OUJA 4FPKA 1QDOA 2D6NA 4CP1A 2A73B 5B2GB 2DVFA 3TRSB 3GHNA 3ZXFA 5BNQA 4OVEA 3RDIA 4META 1J1TA 1B35B 1PK6B 1AX2A 4B4PA 4CDUB 1O91A 2GC2A 4Q0UA 3E6BA 1QGLA 1OA3A 3DN7A 1NQDA 1FOD1 1GKBA 2C0ZA 3KCXA 4AI1A 2WWSA 3ME2A 2Y26A 1XQNA 3I54A 1AR91 3WG4A 1H1IA 1U12A 4Q1PA 3AJYA 1RUJ3 1GV9A 4IESA 1FPN2 3PNAA 5L7OC 4YW2A 3RRDA 2PLV2 3KQRA 2WQ4A 2VNRA 4N9HA 1I3HA 4IEXA 2ZGSA 3VHNA 3ES1A 2EXKA 2GH2A 4RQPC 4GIQA 3N36A 4N43C 1NOVA 3KMHA 1GYKA 4F8AA 2FBEA 2EF6A 4A2UA 5K9YA 1AF9A 1AR71 4QU2A 2DCJA 1F9KA 4MV2A 1QJX2 4QPIC 3M70A 1AL0G 2HWC3 2DCTA 2R32A 4FPFA 3HQXA 2B8MA 1LHNA 2ZHKA 3B5LB 4HMZA 5KXBA 4E9KA 5I8SA 2E7TA 2RS12 2PN5A 4IEOA 3FUQA 5EFUA 1LB2A 1XNBA 4LBQD 4AVVA 2Z2SB 4NPRA 5BNNB 1KXGA 1VP6A 1ZBE3 1TQ5A 2B39A 1ZZ6A 1ZRDA 5BNPB 3KD4A 2HWB3 2XPJA 2YC0A 3H3UA 2A6YA 1RUJ1 1B35A 3JZVA 1PK6A 4GA9A 1RVF1 2ZGTA 1MS5A 4K20A 3CU7A 3ZVXA 4CDUA 5A32B 4COYA 4IV1B 4QQHA 1C1LA 1PO22 5D8AA 2ZX3A 1AYN1 1NY71 1RUD3 4HPKB 4JVAA 4JDNA 3J26N 5LK7B 2NZ9A 4NWWA 2YYOA 1ZNPA 2I74A 1MQTC 1OSGA 1YWKA 3AKTA 1RUH3 3DGTA 3ZFFC 1Q8VA 2C5DA 1MVEA 5FO7B 4LHLA 1NA1C 3A0NA 5FOBB 2PHDA 1S0IA 5HCFA 4ES8A 2DV9A 3USSA 4FSJA 4CDXC 3M8LA 1NXD1 1IOAA 2GMPA 2OPKA 4IQPA 1ZZCA 2VW1A 1ND2C 4YNIA 3AXDA 1AJKA 3B02A 1DQ1A 1N1VA 3H7JA 3L9JT 2XLFA 4YFWA 1MS9A 1UZYA 1ZZ7A 1GNZA 1Z0HA 3THTA 1ZBE1 4M0HA 3V0BA 3PLQA 2EXHA 5F5QA 1GANA 1LODA 1CN1A 3D0SA 5L7OB 2HWB1 3VBHA 2DU1A 1LRHA 5I93A 4LLFA 4SLIA 4Q4V3 2W68A 2G9FA 1XE7A 4SBVA 3MFCA 5BNNA 2CWMA 3ZSJA 1RUC2 4XF4A 2FZ2A 1RUD1 2TBVA 3VZMA 4RQPB 4N43B 2FMYA 3KCCA 4HANA 4EN9B 4ES9A 3EHKA 2C9AA 3M3CA 2CYFA 4MXWB 1LOAA 1VBD3 4KNCA 4M3CF 5T3NA 3IDEA 2A70A 1AX0A 1JTZX 3GHMA 1IPKA 1PGW1 1RUH1 3KCYA 1YFWA 4QPIB 3V0AB 5A32A 4IV1A 2HWD3 1V70A 4K7JA 1DU3D 1YO8A 1EP0A 4LBJA 4YSFA 2BFUL 1DGRN 5CFCC 1ZRCA 1LTEA 1DGLA 4DMIA 4PIYA 1GBGA 5JLVA 1H2MA 4RGGA 3ZYGA 4XFIA 2ZJCA 1VALA 1G9CA 1UF2C 1CIWA 2VG9A 3MYXA 1LGCA 1MZFA 1J1LA 3ZXKA 4MVTA 5IK7A 1QXPA 1KD7A 5ACA2 2D5FA 3WQ1A 3PJYA 1XYNA 1HRI3 1MEC3 2KM2A 2ZX4A 2YXSA 4LBLA 1DZRA 3RSJA 4Q4V1 4Q4W3 3WP6A 4OHYA 3CF6E 1WCKA 3LGRA 4XQDA 3VBRC 1MQTB 5FREA 1D2QA 3PHMA 4L92A 4XOGA 1ENXA 3ZFFB 5L7OA 2DFBA 4KWKA 3KLSA 4QX5A 1BBT3 1VBD1 5LEJA 4ISRA 1NA1B 1V6JA 4JTNA 2RM23 5JZGC 2V5YA 3MIGA 5GLVA 5T52A 1H4HA 2ZGNA 5ABJB 1AR82 2HWD1 4CDXB 3B7MA 2TNFA 5FDBA 4BIOA 4RQPA 2YV8A 4N43A 2WSUA 4C1WA 4J6GA 4HK8A 2R042 1OPOA 5FPXA 2I07B 2VUAA 4QM8A 4FPCA 5KWRA 2SLIA 4QPIA 4CEWB 1F8VA 2ZCWA 5L36A 4HSLA 2EA7A 4Q0VA 3VKMA 1S0EA 3KGLA 2RJLA 3C2UA 4Q0PA 1LOCA 1LOGA 1VRH3 2Z69A 3NSTA 1V00A 2B46X 5DZEA 5HI0A 4JGZC 1MEC1 3SITA 3RMYA 3RYRA 1AUYA 3LAGA 4Q4W1 3UK9A 2DWRA 1YI9A 1UU6A 1UCXA 3AP9A 2PHUA 1RTVA 3BCWA 2VOKA 4WVMB 1WGPA 3MF6A 4WVVA 2WT2A 2XKPA 3WW4A 2D6MA 4MLOA 1BBT1 4S2GA 2QQPA 4Q2FA 1NE6A 4PLOA 2RM21 3SMHA 3KT1A 1VBE3 1W6NB 1QWRA 3O7OA 5CFCB 3SCFA 1LKNA 1MQTA 3JQWA 5FMOS 3A0KA 1LOFC 3GYDA 4ATFA 3ZFFA 2PFWA 4AW7A 2GALA 3JBG2 4MZUA 3T2TA 1QJU2 1NA1A 1WMFA 2XHKA 5GM0A 3RNSA 4MGYE 4NVPA 4B8EA 1TNRA 2GMEA 4N7IA 1SBFA 5CG9A 4FPOB 4CDXA 4YZ2A 5A3LA 4FBFA 2BNOA 1OMIA 1YFXA 1ND2A 2BEOA 1BMV1 4PJYA 3VDDC 3O0VA 1ASJ3 4X8NA 4UBGA 1VRH1 2BVVA 4PIZA 1PM7A 2R49A 2XL9A 1SDWA 1EV12 1H2NA 3MIHA 1APNA 2ZS6B 2E7QA 2WFPA 4EWDA 1OI6A 1ZA4A 2E63A 5K8SA 1C4RA 3W9AA 3OYWA 3USUB 1QHDA 2DU0A 2PA7A 3RPQA 3AYEA 5T54A 3L2YA 2WS93 1WW5A 3VBSC 1G7YA 4RS5C 3O5SA 1ULGA 4COWA 1SQ4A 2ZOEB 4PBPA 1FV2A 1ULDA 3U07A 2EVXA 4F83A 1RUG3 1VBE1 1RHI2 1YYNA 4I02A 1WLCA 5AFBA 1OQ1A 4AGVA 3GALA 2R30A 3P3PA 4GMP0 1IQAA 4WVMA 4P9LA 1CAUB 2WFF2 5FRAA 3FBYA 2Q0AA 1HV0A 1UIJA 4AI2A 2R16A 4RFT0 1QQP2 3R0RA 5CFCA 1JUIA 5F1RA 3E5QA 1PO13 4AQSA 2ERFA 3N7MA 3AYCA 4JRLA 4XTMA 3VZLA 2DF7A 4QGNA 2D6LX 1DYKA 4AK3A 2WKKA 1I1EA 4H14A 2OUHA 2VVEA 3MI8A 3U4XA 4FPLA 3ELNA 4FAHA 3WCRA 1Z7S2 1O4YA 3ZFEB 1N1YA 3OBTA 4FPHA 1L3JA 4A3XA 3BALA 1XYPA 4WM7C 2VOWA 3SNMA 5T5PA 2ARXA 2WS91 3TAYA 3I4IA 3AYAA 3WG2A 2O1QA 1W6QB 3DPRC 1OA4A 1MS3A 4YW1A 5KXEA 1FI2A 2YDEA 3VBRA 5KHIA 3J8F2 1GZWB 1RUG1 2G4IA 2R062 2YMZA 3WDWA 1QNWA 3USUA 4KWJA 3R6SA 4K6BA 4GB33 3RJRA 5GALA 1D4M3 5JZGA 1FMD3 5FLJA 4D3WA 5KHGA 1QY4A 2UURA 3AKPA 1MZ6A 4BQ1A 4XFGA 1IS4A 3NV1A 3S6PA 3VDDB 1VIWB 4AI8A 2B45X 1R082 1PO11 4AHZA 2ETEA 1CAUA 4F3JA 3AKQA 4V1PA 4AFDA 1E57A 3H8UA 1I9RA 2CGOA 1RUC1 3MIDA 2O8OA 5BY5A 4XHBA 3VBSB 3BU7A 3V56A 1AXZA 4W6YA 4JGZA 1Q8PA 1ZBA3 3MIBA 1GNHA 4BWOA 4B7EA 3ZMOA 3VHPA 1DZQA 4YYOA 1YIFA 1ENRA 5CVRA 2ZGPA 4RHV2 4XF1A 2EXIA 2Y0OA 4PLNA 1PZ9A 4XILA 2LALA 2DTYA 2ZPXA 4DY3A 2UU8A 3EBRA 4GB31 4H3WA 1FMD1 1A3KA 4BLJA 5BV6A 3U10A 5J09A 1PIV3 1W6QA 3B93A 3ALQA 4IEVA 3QH7A 1LOBA 1VBC2 5LEKA 3AKSA 1GZWA 4Y5Z0 5DDJ2 1BYHA 1LOFA 3TNQA 4CRQA 1QU0A 1YNAA 5JVVA 3AMPA 3WV6A 2OIIA 4OI4A 3ZYRA 1A8DA 2BFUS 4QQPA 1H0BA 4J1XA 5DUUA 5BNOC 2ZHMA 2ZMNA 3QACA 3WHUA 2VH9A 1CVNA 1GR3A 3C3VA 3M3IA 2YPJA 4HKWA 5DG2A 4HBNA 3JU9A 3VDDA 3RWNA 5JDBA 1CAVB 4IEZA 4XJUA 1QOOA 2IXKA 1HDKA 4GMP3 2R0HA 4YW4A 2XVGA 2A3WA 3NKGA 1G86A 4L97A 1ZBA1 3RJ2X 2ZGQA 4JRAA 5LRRA 3UKTA 1OLRA 2WNEA 1X7NA 4YGEA 2QDNA 4LTAA 5JI9A 3WZ1A 2D3PA 2XJQA 4Q8LA 3VBSA 3JD72 4RS5A 1H4GA 1R1A2 3IM0A 3ZIXA 5L19A 3WW2A 1UPIA 2VMIA 2P3JA 1W0PA 2WT0A 3WY6A 4Q29A 4DXZA 4RA0A 1NLSA 2O8QA 4Y1VA 3AKRA 1T6GC 3MW4A 1PIV1 2BGCA 4JGYC 5E16A 4EWEA 4JAAA 1C28A 5HXVA 4XBNA 1C5IA 4EN0A 1C57A 2GMMA 2AYHA 1EAH3 1AXYA 2JXAA 3MIEA 2IXJA 3VLBB 4GWNA 3GBFA 2CNAA 1YIPA 3U0ZA 2WA3A 2RE9A 2W39A 2ZKNA 2D5HA 1R093 2R072 1FOD3 4GKYA 2JJ6A 1XE8A 2OYZA 4FOQA 1S1AA 1RGSA 4LBMA 3HWJA 2RHPA 2E51A 3WOGA 3PVOA 4D7TA 1C8M3 4Z07A 1LESA 3ZX7A 5GZCA 4YVWC 1RUF3 5FAXA 3AX4A 2CGPA 4WM7A 1LENA 1NQJA 4PLMA 2WQZC 4AGGA 3AFKA 4YM0A 3DPRA 2HEVF 1UAIA 1W6PB 4EWAA 4AEMA 1UU4A 1TME2 5HCAA 4R4XA 3D0JA 4C0HA 5JWPA 5FPZA 1HQLA 4R8HA 4FOWA 2RR12 1EAH1 4FPEA 5BNOB 4OULA 5F6LB 1ENSA 1H8TC 1LR5A 2DUPA 5H9QA 3QOPA 2XJUA 4R4ZA 5D8AB 3WUCA 5IK8A 1VBA2 2D7FA 2W0XA 1RUE2 3U11A 1R091 3W59A 3RYPA 1DZTA 4QPYA 4HL0A 5GZFA 1UX6A 1KFUL 2BNMA 2TEPA 2XWJB 4AE2A 3ES4A 3JQXA 5IUQA 4EN6B 1RVF3 1W2UA 4BYYA 3KS7A 1BEV2 1Y7BA 2VOXA 4YG6A 5FTTC 1C8M1 1V6LA 1W6OB 1AYN3 1WW4A 2A7AA 3SLIA 1RUF1 2P3KA 4AQ2A 4XJ8A 3E97A 1AHSA 4HVQA 2OA2A 3H50A 2G9GA 1O5LA 4NHKA 4XPVA 1O7FA 2R0FA 3WX5A 2QNKA 1X8EA 3AJZA 1QJZA 3NV2A 3AP6A 3OGGA 4KGGA 5BYNA 2F4PA 3JB8A 4QGLA 3V0BB 2A6WA 1YRZA 5J48A 1V6MA 4CEYC 4XMAA 5C8CC 3VBHB 1VJ2A 3ZXLA 5C9AC 1BQPA 1QH7A 4COZA 1X82A 4Y22B 3PMEA 4KG0A 2A3YA 3UKNA 4AVCA 2YGLA 3OY8B 1W6PA 1N47A 3ZPYA 3CNAA 2ZX2A 4AYUA 4IL7A 2GC0A 2R1BA 2H6BA 2P37A 5GLUA 3VL8A 1ZX5A 3A4UA 3MGUA 5JAXA 3WDXA 5BNOA 2CGNA 4YVWB 4XFAA 2VPVA 1YJKA 5IT6A 3QH6A 5I8TA 1S0FA 1COV3 4M00A 4AEKA 3ZSMA 4M3CA 4KH9A 4AF9A 3VZKA 1SLLA 2GNBA 4OFGA 3VL9A 2RS52 2Y0IA 1AR62 1AL22 3WUDA 1W6OA 2H0VA 4INDA 4BMBA 5DDJ3 3VBOC 2PTMA 2ZBJA 1N1TA 1GICA 2NMOA 2P34A 4BMEA 2EXJA 4KQ7A 1YLLA 3LKJA 1BVVA 1H8TB 2ZX1A 5CU1A 4RSUA 2A6VA 4P14A 4JGYA 2WZPP 4URTA 3H7YA 2ZTNA 4AXOA 1H9WA 2IC1A 3S7IA 5DUXA 2B5HA 4QQ2A 1RUI3 4S2HA 1YHFA 1FAYA 3MPPG 5GJ6A 1FNZA 2OZ6A 3RS6A 3MEPA 1AX1A 3CJXA 1ND3C 4Y22A 2XG3A</