3BN6A

Crystal structure of the c2 domain of bovine lactadherin at 1.67 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
CTEPLGLKDNTIPNKQITASSYYKTWGLSAFSWFPYYARLDNQGKFNAWTAQTNSASEWLQIDLGSQKRVTGIITQGARDFGHIQYVAAYRVAYGDDGVTWTEYKDPGASESKIFPGNMDNNSHKKNIFETPFQARFVRIQPVAWHNRITLRVELLGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of lactadherin C2 domain at 1.7A resolution with mutational and computational analyses of its membrane-binding motif.
pubmed doi rcsb
source organism Bos taurus
molecule tags Blood clotting, cell adhesion
molecule keywords Lactadherin
total genus 42
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3bn6A00
4RN5A 3NRUA 3CKHA 4RYDA 3IAQA 2YC2A 3FHAA 4BK5A 3ABZA 5IFTA 1JZ7A 2Y6HA 2E32A 4BDVB 4A4AA 3GGLA 3DYMA 3K46A 4HG6B 3FL7A 1XC6A 3CMGA 3ZM8A 3K75B 3MBWA 2QQLA 2J1VA 2JE8A 1UXXX 1WCQA 2RJ2A 2VQUA 3HJRA 4P02B 1CX1A 4P08A 1PX4A 1JYNA 3GM8A 1KEXA 3CZJA 5JXGA 3OEAA 3PUIA 2WDBA 2VZ1A 2WN2A 3C7EA 3OG2A 2JD9A 5HPOA 3WQBA 4OMCA 1D7PM 3LE0A 2V72A 1JZ6A 2W1QA 3ECQA 5LCWL 2VMDA 2J1UA 2QQIA 3K4DA 2B9VA 4QAWA 1GOFA 2C9KA 2OKXA 2XOMA 1LNSA 2VZOA 5F7UA 4JHZA 1L7RA 1MPXA 2ZEXA 2W1SA 3FN9A 4CUBA 3C7GA 1OF4A 2YC4A 2VMEA 3IDAA 3I3BA 4XVHA 1W9SA 1NUKA 1O8PA 2L9LA 2WAOA 2VZUA 1NKGA 2C4XA 5DPNA 2YB7A 3VD9A 2BGPA 3ACGA 5C70A 4QDQA 4CVUA 4DXRA 2XQXA 4E8DA 5FUIA 1EUUA 4D0QA 2J7MA 2VTFA 3C8XA 1UY0A 3CDZB 2WAAA 4MO3M 5EJ1B 3F2ZA 3VDBA 4XUQA 4M4PA 4W4ZA 2WN3A 3NNGA 3HNBM 3T2PA 2ZXQA 4E8CA 2WO2A 3SKJE 1T2XA 3T0DA 2QQNA 3D3AA 1WKYA 2VO5A 2VL4A 4GZ9A 2ORXA 4UAPA 4XZUG 1NX9A 2ZEZA 3HPNA 2VMCA 4DEVA 3E1F1 3IB3A 4MGQA 4CU8A 1ULOA 3SKVA 2QQOA 3I2KA 3WNNA 5JUVA 3A23A 4ARYA 2X09A 4W50A 4M4RA 2VR4A 3I3EA 2VC9A 2VCAA 2W1UA 3C7FA 3LQCA 2JDAA 5JR2A 2WUHA 2W1WA 2X05A 3SEPA 2W94A 1OT5A 3FHQA 4ZZ8A 1CZSA 1F4HA 1K3IA 3K4AA 3JXSA 1K45A 1OH4A 5I0DA 1XNTA 3I3DA 3MV01 4QX1A 1JU3A 4QDRA 4DUXA 3WF3A 2YG0A 4A6OA 1J84A 5B4NA 2VZPA 3GXUA 5CYYA 3OGVA 2W95A 2KD7A 2E33A 3DECA 1DLCA 3I2HA 2XHNA 3DYPA 2W47A 3I2GA 2WO1A 2BZDA 5G05L 4OYUA 4BJ0A 4XUPA 3THCA 4FI9A 1UMHA 4LKSA 3ACFA 4DUWA 2J1RA 2LW8A 4YPJA 4LQRA 2BERA 1DYOA 5EIYB 1JZ2A 1I5PA 2VM9A 4QX2A 3EYPA 3OB8A 3T0AA 5LA2A 3VD3A 1W99A 2E31A 5IFPA 1UY4A 2WQ8A 4A3ZA 2QBXA 4DXSA 3OGRA 1CZTA 3DYOA 2Y6JA 2HLEA 3WNMA 2WZ8A 4PT6A 2BGOA 4LHSA 4JX0A 3BGAA 4QB1A 2VCBA 2Y6GA 4MADA 4DUVA 3HOBA 4CU6A 3WSOA 4IUGA 3WF1A 4L0PA 4ZXEA 3WNPA 3VDCA 2V5DA 3CZUA 2VOTA 5C7GA 2JKXA 5IYYA 1JZ3A 1O59A 1JZ5A 3LPFA 5EJZB 1UY1A 3I2FA 4AG4A 1P8JA 1HN1A 2EIEA 2CDOA 1BHGA 3LEKA 4PQQA 1CZVA 1SHWB 4ZZ5A 5IJRA 3WEZA 2VCCA 1RYYA 3IAPA 4DEQA 2WO3A 4MGSA 5LA1A 3ACIA 2ZEYA 3U37A 2ZEWA 5JMOA 3ETPA 4KWUA 4OUEA 4A44A 1UMIA 4AAXA 4P5YA 3T09A 2QQMA 4BXSV 1JYVA 2W5FA 2B4KA 3W5NA 2W9XA 4TXWA 4CU7A 3HN3A 3LEGA 3ACHA 5DMYA 4OMDA 3NJXA 2W91A 1UZ0A 4QB2A 4PF1A 4QDSA 3THDA 2J1SA 4KI5M 1XPWA 2DCKA 1GQPA 2X10A 3OGSA 3I97A 4A45A 4JKKA 3T0BA 2W87A 1K42A 1PMJX 3P6BA 3VD4A 4CUAA 2LS6A 3I2IA 4BK4A 3GDBA 1L7QA 5CZKA 4ARXA 5A1AA 2CDPA 3WF2A 2WZEA 1R64A 4GWJA 3VDAA 5C71A 1JZ4A 1OF3A 5JXIA 1H6XA 4JKMA 5G04L 1ULPA 1JHJA 3LEIA 4OZOA 2WBKA 5LA0A 3P1IA 2HYXA 3MUZ1 1UY3A 3K77A 1F4AA 3MO4A 2Y6LA 3T08A 2RV9A 1W0NA 3K4ZA 1IQDC 1GOGA 3VD7A 1JZ8A 3IIIA 4QX0A 4UI9L 5HXMA 3UNPA 2WYSA 3PUHA 2BBAA 2VZVA 2ID4A 1US2A 3AC0A 1SDDB 1UX7A 2YFUA 2WABA 2Z4FA 1H6YA 3OEBA 1K12A 4A41A 3BN6A 2W3JA 3LPGA 1W8NA 4UOJA 1JI6A 4XUOA 1UXZA 2DCJA 4JKLA 1JYWA 1KGYA 3NJVA 4QPWA 1W9WA 1EUTA 1GOHA 2VZQA 4MOAA 1YQ2A 1JU4A 5JXJA 4Z2AA 1UYYA 2J1EA 2E26A 1O8SA 5IHRA 3WNLA 3W5MA 3C7OA 3HEIA 1OD3A 3A21A 2VZTA 3HNMA 2R7EB 1DP0A 3UETA 3WNOA 4QX3A 2PQSA 4XURA 4XUNA 3I2JA 2J1AA 2VMFA 2Y6KA 4TTGA 2EICA 1UY2A 2QQJA 3NQHA 3A22A 2V4VA 1GUIA 2VZSA 4DXTA 3CQOA 3WF4A 1J83A 4CU9A 2Y64A 2VJXA 4D8MA 3T2QA 4XUTA 3MV11 1NAEA 2XONA 1UYXA 2QQKA 1CIYA 2W46A 3C7HA 4P00B 5B4XA 5J1XA 1UYZA 3WF0A 3MUY1 2DDUA 3J7HA 4LPLA 3T2OA 1W8OA 1TVGA 3UESA 2EIBA 3OBAA 1GMMA 3HNYM 2W92A 1PMHX 2J22A 2VZ3A 2YFZA 2J1TA 1UWWA 3EB7A 3CIHA 1PX3A 4GWIA 3SEEA 4ZY9A 3WNKA 2Y8KA 1W9TA 4QB6A 4CUCA 1XNAA 1TG7A 1GNYA 2RVAA 1GU3A 1SG3A 4A42A 3VD5A 2ORZA 3A7QA 4ET7A 5DN2A 5DQ0A 5JXHA 2VQTA 2VZRA 2C26A 1US3A 4W8JA 2EIDA 1JYXA 4KMQA
chains in the Genus database with same CATH superfamily
1REFA 4YGBA 3OOXA 1IPSA 5GALA 1PK6C 3KVBA 3AL6A 3ES1A 2VVEA 3IAQA 5A7WA 4NOTA 3FHAA 3ACLA 2KXLA 1SPPB 1NA1A 4UBHA 4BK5A 4YZ4A 1PIV1 5IFTA 2BNNA 3M3EA 4CEYB 5CFCA 1AYN3 4N53A 4AEDB 1PVC3 4PQ9A 1W3XA 2WA3A 5AFBA 1VBD1 5LATA 1S0BA 5L7OC 2J1VA 2AEYA 1WCQA 2QDNA 2VUDA 2VQUA 4IESA 3FUOA 4UWDA 3SXWA 3WD5A 2O0OA 2OPKA 5JXGA 3SHRA 2PHDA 1QJEA 5FP7A 3BKZA 1ZA4A 1OOPA 3N9OA 4R9AA 5C9AC 3PUQA 1YHFA 1D2SA 1R1ZA 1FNYA 1MZ5A 4QQ2A 1MEC1 5J98B 3H8OA 1QHDA 1OBNA 2WN2A 3M4FA 4OMCA 4LUMA 2WWUA 5A3OA 4Q4V3 3B01A 1OI6A 1BBT3 3LE0A 3PMSA 3MI8A 3WP5A 3ZR6A 3RWKX 2JX9A 3ZFGC 5AVPA 3CJXA 4HOOA 3VBHB 4D7YA 1AHSA 2A6YA 2HWE1 4UFIA 4QAWA 3K4DA 5FOBB 5FZLA 2C9KA 2XOMA 1RUE1 4PHZA 4YW3A 3ZSLA 1OHFA 3FN9A 1ULFA 2W1SA 4LXLA 4YM2A 2IFWA 1OF4A 2R32A 2OW4A 1W90A 2RS33 3H1MA 2B39A 2VMEA 3WVJA 4XVHA 5E6HA 5F9TA 1O8PA 4XACA 3BU7A 1RUD2 2JE9A 4NHLA 2ZGTA 1MQTC 5CFDC 5A1FA 4ITCA 4MGKE 3PUSA 2YB7A 5DPNA 3VD9A 5CG8A 5C70A 2D3SA 1BLZA 5LK5A 3VZNA 5LRSA 1S0JA 2XHKA 4XFGA 5K8SA 5M0TA 4CVUA 2ZGRA 4E8DA 4GJZA 5LZ6A 4BHPA 3JBG2 1Z7S2 3VBOB 3WQ7A 4IETA 1UMZA 3J26N 4FPCA 1ULGA 2RMU3 3QH7A 5IK5A 2SLIA 4MO3M 1ND3B 5F6LB 2W52A 4QHZA 3F2ZA 3WW1A 4K8FA 2FCVA 2A5ZA 2A73B 3TN91 1ZRCA 2K9ZA 3NNGA 2OYZA 1WMXA 2KA3A 3AJZA 4JVAA 4KGQA 1C1FA 4E8CA 1AYM2 3SKJE 1T2XA 3T0DA 1DZQA 2QQNA 2YC0A 4AOCA 4P9JA 3D3AA 2E7TA 4LTAA 3ZFFB 5E88A 3ZXEA 3SITA 2ORXA 1GZCA 5A7OA 3MIEA 3RRDA 1S2KA 2ZEZA 5A33B 1JOJA 2YBSA 2VMCA 3HPNA 1TE1B 5FFOC 1NCRA 1OKQA 5FCCA 2ZKLA 2DU0A 5FY8A 3IB3A 3POYA 4Q0QA 1W06A 1YYNA 1X8EA 2VTXA 4JRLA 3KF3A 1ZZ6A 5CU1A 2TNFA 5FY1A 2E9QA 4GXLA 5FZOA 5D2AA 2R061 5H9PA 2R071 2BVVA 3W21A 4ARYA 1RXGA 5K9YA 4M4RA 1PO23 1XRUA 2WLPA 3OTFA 2W1UA 5FBZA 1GNHA 5JR2A 4AQ2A 1F5FA 1RUI3 5A32B 5T5LA 2BQPA 1AR81 5CB7A 3FHQA 4WVZA 1CZSA 1F4HA 3D0JA 3WW2A 1Z7S3 5FYTA 2FMDA 3JXSA 2PQQA 3DN7A 1KS4A 2R072 1L7LA 5I8SA 2Z5WA 5EFUA 4S2GA 1YIFA 2A6ZA 2D6PA 3BALA 3MV01 4H14A 4MXWA 1O3RA 4A2UA 2F17A 4EV0A 3RYKA 1VBD3 5ACA3 1S0DA 3NSTA 4AWDA 3B7MA 4A6OA 1DHKB 1XYNA 3OGVA 4HPKB 4ZS3A 3DECA 4X6RB 5LBFA 4CCLA 3POFA 5FLIA 1BK1A 1O6UA 2UWCA 3S7EA 2VW0A 1HXS3 1ZNPA 2XHNA 2W47A 1W9YA 1JW6A 2Y6FA 3ORJA 2DFBA 3FFQA 4RHV3 1F2NA 4BJ0A 2BBVA 4XUPA 4B4RA 1UZVA 3KF5A 2YGLA 4G9SB 1TZOA 1S0GA 5E8AA 1D4M3 2LW8A 1MS3A 4P9IA 4YPJA 1EY2A 1B35B 3PU8A 4FXKB 4LIVA 1AJKA 1FPN1 5L9BA 1V0AA 4CA9A 1AXKA 1YUDA 1KITA 4BH9A 4C8DA 3AZWA 1JZ2A 3BTZA 3ZXAC 1I5PA 3VBFC 1FV3A 1HB1A 2BVBA 2BWCA 2DVDA 2VM9A 5IUQA 3ZN4A 4QX2A 3EYPA 4Y22A 3OB8A 2D97A 1R093 2WWJA 5KHJA 3V0BB 5FKBA 4N7IA 2HEYF 2WQ8A 3VBFA 1UU4A 4AF9A 2VQAA 3HIFA 4RFRB 2QQUA 1VBC3 1UQXA 3TEXA 3ATGA 4M3CF 4XFCA 2B8MA 2JG9B 4BIFA 4YGEA 1MQTA 1VIWB 1W2AX 3I2OA 2WLQA 3PJYA 3ZXKA 1RUJ1 4Q4W3 4GH4A 4LHSA 4XFFA 4O7XA 2Q8DA 2RS32 4RR3B 2PYTA 1AL22 5FPUA 5A6ZA 2YPJA 4MADA 3IDEA 4M0HA 1QH6A 5EHDA 5IFPA 5JDBA 4AFCA 3S7IA 5GKAC 4RQPB 2VNVA 3WF1A 5FYCA 2PXJA 4BQ2A 2R042 4UW3A 3NV3A 3CZUA 1OSGA 4GMP0 1H9WA 3WHTA 1FV2A 5IYYA 1JZ3A 1JZ5A 3LPFA 4JDMA 1F5JA 1XOYA 2VY0A 3Q9OA 2D6KA 1UY1A 3LA7A 4NIHA 1V6NA 4V2WA 4FT8A 4ISRA 2HWB3 3FLRA 5D21A 5A7QA 5IVBA 1KFXL 4OHYA 2VGDA 1XE7A 2XBO1 3MIGA 1Y9GA 3PVBB 5L73A 3VZOA 3ZMNA 2LTNA 2CYFA 2AH2A 4QHBA 4ZPIA 4AI2A 2QFEA 3OY8A 2VCCA 2BWAA 1H2LA 3IAPA 5FUNA 5KXBA 5I8TA 3AMMA 3J7NA 2WO3A 1A8MA 4LMFA 3NV2A 3KCXA 1E57A 4JZRA 5CFCC 1Q3EA 3AYDA 4AI1A 3U37A 4BE3A 2BFUS 2R073 2BYVE 5JMOA 3HD8B 4OUEA 1UMIA 4P5YA 3AZZA 3SC7X 2BUKA 1WD3A 3AXEA 3N9PA 1NXD1 1GFF2 4LO5B 1JYVA 5ACA2 3O1SA 1B35C 1U12A 2ZCWA 4NHMA 3VBOC 2P1BA 1PNFA 3BOPA 3HN3A 4LEJA 4AGRA 4QD2A 4AYUA 1Z7S1 5F3EA 5C9AA 4EROA 5CISA 4QXHA 5FK8A 2DWRA 3UV9A 2JG9A 2W91A 4XF0A 1LOCA 5IVJA 4G3YC 4AVCA 2DCYA 4F3JA 4M0NA 5KXCA 4XF3A 3HBZA 1XPWA 2X10A 3ME2A 1EPWA 3RZLA 1ZZ9A 3T0BA 1H1AA 4D7SA 1OH3A 1V70A 2YUEA 5L36A 1J3PA 1C5IA 2E6VA 4N43C 1CX4A 2A3WA 1U0AA 3T4VA 5F39A 4RR3C 3ZSEA 3VD4A 1WD4A 1BEV2 3IKWA 4X8PA 3WLUA 2XWJB 4BYYA 4CUAA 2EAKA 3KCCA 1SBEA 3S5AA 2ZAHA 4ZU5A 5F3IA 1QMJA 4UFJA 5HCAA 5T54A 2RDNA 3GDBA 4GIQA 5FMOL 1RUG3 2ZTNA 1QXPA 5CZKA 1R082 2ET1A 3G6JB 1E5SA 2AZ5A 3OUHA 3POBA 4KG0A 2WZEA 2VMGA 1OVSA 1BXHA 4X8NA 1UOBA 4V2VA 3VDAA 5C3OA 1JZ4A 5FOJB 2VOVA 3ZKUA 1QH7A 3O12A 4PF5A 4HL0A 2LROA 1LOFA 4XAAA 1WA4A 1UIKA 1WMDA 2RE9A 4ASLA 2WNEA 5FJKA 2Z69A 3VBUC 3EMRA 1NOVA 1DBNA 3NL1A 3P1IA 3ZN6B 4I2OA 1B09A 1ZRRA 3WX5A 4EN7B 4FBFA 1QJY3 3LOBA 5KHIA 1RUG2 2VNOA 1K5JA 4FFGA 4IE6A 4M3CB 3VV1A 2FCTA 1RUNA 3MO4A 3GCXA 1TEIA 3KS7A 1V6OA 4K3UA 4X6QB 1IQDC 1GOGA 3VD7A 5FMDA 3IIIA 1LHVA 1RVF2 4MGZE 1UO9A 3VKLA 4AQTA 1W8FA 2PAKA 3LB9A 4QQLA 2WYSA 1ZVFA 3AZXA 3B00A 4AGVA 3NJYA 3RZKA 1GNZA 2ID4A 1OMIA 2IVJA 2Y34A 3I2DA 1SDDB 1W6NA 4TN7A 2PA7A 4KL1A 3WW3A 1UU5A 4AXOA 2WABA 3PDQA 4RGAA 4CP1A 1YFUA 2R30A 3EO6A 3FZ3A 1IOAA 4D6QA 4AL9A 1RUC2 1LENA 1YRZA 3M3IA 3AYAA 1IZ3A 3BN6A 2ENRA 4XFHA 3WG2A 1W8NA 3RGBA 3POIA 3RJRA 1TME1 2PHTA 1UPIA 3NNFA 1JYWA 1HRV2 3N7LA 3H0OA 1ND2A 3DKQA 1AR63 5L7OA 3USSA 1LHWA 4YYOA 5CADA 4OI2A 4YZ5A 1N1VA 4CSWA 3LFIA 1VE0A 2ZGUA 3IMNA 4FFFA 4LORA 3V64A 5DUVA 5IHRA 1RUI1 2WYFA 3CL1A 3TNQA 3WW4A 1W8ZA 1BBT1 1LEDA 3PVEA 1A6CA 3HEIA 2A6XA 3PUAA 3ZDVA 1MS1A 3LDKA 2P37A 1DQ6A 2YPDA 4UFKA 1HW5A 4P9GA 4NRMA 2VZTA 1V6MA 2HWB2 4I3GA 4NMIA 1PZ9A 4R8HA 2IXLA 3PTYA 1DP0A 1CAXA 1VBB1 1AJOA 5T5OA 3JU9A 4K21A 3JQXA 4LA3A 3WNOA 3M8LA 1RUF1 1GZ9A 3FWEA 3MFAA 5FKCA 1HQWA 3VDDC 4Y1XA 5CBLA 3RNSA 1LHOA 5C5UA 2WFF1 1CWPA 5CIRA 5HV4A 2I74A 4KGGA 2JG9C 1SLTA 2Y6KA 1BK0A 3OD4A 3TB0A 2GN3A 1FXZA 1WWYA 1XNBA 1S2BA 2VZSA 5FZ3A 3ZFGA 4E9KA 1QQP2 4JGYA 1B35A 1J83A 3PTRB 2ES3A 3HR9A 2ZX4A 4LBQA 4OHWA 4YVWB 4FPHA 3ZN6A 2VBPA 2YHJA 4RQPC 5I0TA 2XGXA 5FZOB 5JOXA 2HJIA 5DZFA 2JE7A 3T2QA 3MIDA 5C3QA 1UN1A 3Q8EA 5FYBA 3N36A 1DG6A 3NJZA 5J3UA 2R041 3DCQA 4DY5A 4P00B 4QX8A 5FPLA 1HKDA 5K7PA 4IEYA 2DFCA 4YW5A 3VBRB 3WF0A 1RJ8A 2EAAA 3T2OA 1W6NB 3IPVA 3H3LA 3VBHC 4K40A 5A33A 3OBAA 1AXZA 1ZRFA 3VDDB 5BPXA 2PLV2 3SQOA 1GMMA 3WDWA 2VW2A 3B5LB 2FQPA 2Z79A 1W6PA 2CWMA 3HNYM 1Y9MA 3N9QA 3USUB 1EP0A 1UIJA 4LA2A 2CU5A 4RQPA 2VZ3A 1QQP1 4NE9A 4AE2A 2GZWA 4BQ5A 5KC5A 1XE0A 2I2SA 5ABJC 1H2KA 1R092 4FPOB 5A3UA 1ONAA 1PX3A 1COV1 3SEEA 3N3HA 2RS51 1CAUB 3WNKA 1W9TA 3ZFEC 4AFAA 4LUKA 3VBUA 5CFCB 1F8VA 5DUWA 3M70A 5LBBA 1GNYA 5FY4A 2EIGA 4UW6A 2WT1A 5DDJ2 1GU3A 2V09A 3THTA 4MGYE 1SG3A 2EA7A 4Q4W2 2ZMKA 4A42A 4AEMA 1E5HA 2P3KA 3RZJA 3FBMA 3A7QA 3AYEA 4AVAA 4ET7A 3JQWA 2C26A 2ADEA 3APBA 4PDWC 4KWKA 2Y0IA 3RPQA 2EIDA 1ZZBA 1J3RA 2Q8OA 1JYXA 3LSDA 3TN92 4BA6A 2E7QA 3PMEA 1SCSA 1DQ0A 3BI3A 1XYPA 5JI9A 2UURA 1FOD3 1SDWA 2YDEA 3CKHA 3IM0A 4RYDA 4CCJA 1W03A 3T2TA 4CP2A 1BKZA 3LIGA 4ZS2A 3NAPB 1JZ7A 2E32A 4IEPA 4A4AA 1BEV1 3DYMA 3Q8CA 3H42B 3FL7A 4HG6B 3PL0A 3SH4A 1XC6A 1ZRDA 1PM4A 1CJPA 2RR13 1PVXA 1OKOA 3K75B 3A0KA 2E51A 4Y20A 5JZGA 4M3CE 4Z92B 2AENA 3H1WA 1GLHA 1PX4A 3D4KA 3GM8A 1W0OA 3AKQA 5FXWA 1W2TA 3WHUA 4FO9A 4BQYA 3LCPA 5DZEA 2LRPA 4FPYA 4Q1RA 3VBSA 5F5CA 3RMYA 2B45X 4J25A 5BNQA 3HQXA 4H7LA 1ACCA 1Y3TA 2Y0OA 3C3VA 2VZ1A 4XE9A 1IHMA 2ZZQA 1GWLA 5A7WB 1G9AA 1TMF2 2A6WA 5F3GA 2X29A 3VHOA 2OQ7A 4WVVA 1D4M1 3TEWA 1XB9A 4O9GA 2WZPP 4W6YA 4I0AA 4CCCA 2QZ2A 3H8XA 4UFHA 2J1UA 3P3NA 2QQIA 1DQ5A 1MS4A 2B9VA 4IERA 5J48A 5C33A 2OKXA 1AYM3 3V65A 4LKFA 5ACA1 2WWSA 1L7RA 3M2MA 1MPXA 2RDQA 2ZEXA 4AEDC 3U07A 4B7KA 1NQJA 2WFF3 4D69A 3O0XA 1BMV2 4IEUA 1OOPC 2G4IA 3IDAA 3I3BA 4CCEA 1W9SA 2VVDA 2VZUA 3BPZA 5FO9B 1S0EA 1YJKA 1W05A 5BUVA 2MNGA 1E5RA 2ET7A 2NMOA 4QDQA 3RDIA 4OHVA 1RIRA 4AVSA 4DXZA 5JSOA 2XJRA 4XJUA 4DXRA 2HKXA 5FUIA 3ILNA 2W2IA 4IEZA 4QPGB 1VBE1 1LOGA 3W59A 2J7MA 1ZZ7A 3MIFA 4N90A 4GQ7A 4SBVA 1AUYA 1RINA 5EJ1B 4Q4V2 3KMHA 3W9AA 5FZ7A 3POWA 2R043 1TMF1 1VRH1 2HBTA 1V9U3 4BISA 4YARA 2Y60A 3LGRA 2OIIA 3QD6A 4W4ZA 4BIOA 4BCUA 1CD3G 2JKBA 1N3PA 3HNBM 4IE5A 2PHLA 1HRV1 2H0BA 2WO2A 4K6BA 2IXCA 1PNGA 4KWJA 1F9KA 2BU9A 4Y20B 1TNFA 5JZGB 3ZMOA 2JB8A 3KGZA 4RSUA 4U2AA 3FLPA 2ZZJA 4GZ9A 3N9LA 4P9LA 4IE7A 1WLTA 1REDA 4LT5A 1RHI2 1VMFA 1AL0G 4FTBA 3KM5A 4QPYA 1RUD3 5FQ0B 1YNAA 2XL9A 3E1F1 2FDHA 3WDTA 3CO2A 1H8TA 3OGGA 1VBE2 2TEPA 2R063 2NM1A 4IGQA 2ZPXA 2BFUL 4M01A 1O7FA 2I07B 2QQOA 4LBMA 5FZAA 4MG2A 3I2KA 1LTEA 3SCGA 1BQPA 4E4ZA 5JVVA 1ZBA3 1HXS2 2VR4A 3R4DB 4AI0A 3UKVA 3J8F1 3BVCA 4R9DA 3ROUA 4CEWB 1J3QA 1A3KA 4GULA 2AUYA 3VN4A 1CJDA 3G7DA 4Z8BA 1N3QA 5JAXA 4ZZ8A 4F7ZA 2DF7A 1NYWA 1H1MA 5DAXA 5JIAA 3K4AA 4QQPA 5JZGC 1K45A 2HYKA 3AMHA 2FDKA 4FVVA 4CDWA 3LKJA 4LO4B 3O1PA 1O4TA 4IL7A 4AFMA 5ANQA 4YFZA 3VBRC 4NIGA 5DXDA 5BV6A 4HKWA 4OFGA 1PK6B 3AKTA 3IDBB 4QDRA 5F37A 3WF3A 2YG0A 4Y3OA 5E16A 3QH6A 3VHRA 2G9GA 3KZ4C 5F5IA 5B4NA 1J1LA 1VLNA 3GXUA 1W8WA 2KD7A 2WC2A 2DCTA 1YXWA 3AFGA 5HI0A 1U5IA 4LKDA 4RHV1 5L9RA 5A70A 5CEHA 2PLV1 1XSRA 1Q5OA 3TWIA 4BXFA 3I2HA 4QXBA 2WO1A 2D43A 3VKNA 3LA3A 2BZDA 5FZCA 5G05L 2D5FA 5K0UA 3RI8A 4E2QA 2ZX2A 1AR82 5FJHA 4FI9A 2QTWB 5T3NA 1UMHA 2Q30A 3AK0A 4LKSA 3GJBA 4ZXKA 4DINB 2X53S 4DUWA 1ZZCA 3LSEA 1OA4A 3CLPA 5AC91 1GANA 2D40A 2XXZA 1I3HA 1VBA2 2JG8B 4UW4A 2JDKA 5EIYB 2VXRA 4XF4A 4QM8A 1RL3A 1X82A 2B9UA 2RM21 5IAVA 5KWRA 5FZDA 4IV1C 1HX6A 2WNVA 2CGOA 3K51A 3GNEA 3MICA 3ZIXA 1NLSA 2JDYA 3MGUA 2QBXA 3UGHA 4FOVA 1H4HA 1UAIA 4JTNA 3WINE 5CKNA 1EAH3 2NYYA 1H0BA 4AHWA 2IXJA 4A3XA 3PLQA 5CG9A 1VPHA 1XU1A 4YM0A 3NV1A 1OLRA 1G7YA 1JOBA 4N43B 1W6OB 5FPZA 4NJ4A 4JX0A 4FPJA 4OZXA 4YW2A 3VHNA 4CEWA 2VCBA 2Y6GA 3W58A 2HWD1 1G6NA 3OY8B 3ZYJB 3HOBA 4CCNA 4GAZA 2D6NA 3KV6A 1O4YA 1X8MA 4XOGA 5C8CA 2R0HA 2WFPA 1FATA 1JYTA 3UJOA 4IUGA 4L0PA 2DYCA 3WNPA 4UT5A 3D82A 5FMBA 1JN2P 2VOTA 2RM22 5C7GA 1TME3 2JKXA 2IXHA 1D0GA 4MH0E 4YZ2A 2GNTA 1UOGA 3B9IA 5EJZB 1AR61 3VBFB 1HRV3 1OC1A 3I2FA 3OYWA 1LGCA 1R1A1 3VZMA 2EIEA 2MEV3 5ANNA 3HBKA 1ZBA2 3LEKA 3ENRA 4ES9A 4PQQA 1RTVA 1CZVA 1SHWB 1DGLA 5J09A 1GICA 1C5HA 5IJRA 3RZHA 5C8CC 1VBA3 4XTPA 2G19A 1O4ZA 2WL1A 3VBRA 5GJ6A 5T52A 1JYIA 1IKQA 2ZMLA 4DEQA 1M4WA 4NVPA 2HWC1 2PHWA 1BEV3 1UW8A 2PN5A 1JBCA 3RS6A 1XNCA 2P17A 3ELNA 3S5QA 5FP4A 2WJSA 1FYUA 2EALA 3FUQA 4YFWA 4Z82A 1C4RA 1SLIA 2BV4A 2BW8A 1ND3A 2JDUA 3ETPA 4Y1UA 4AEJA 3RZMA 3E6CC 3T09A 2QQMA 4QXKA 4BXSV 1H30A 2GC1A 1UOFA 2B4KA 3W5NA 2WA4A 3IDCB 3MLJA 4TXWA 1MACA 4AGGA 4K1ZA 4URTA 2RJLA 4GB32 4CDUB 3ZSKA 2R6QA 3KV9A 3KHCA 2CY6A 4IV1B 2IFRA 4OMDA 4YW7A 2ZACA 5FZ1A 5DMYA 2XPJA 1UZ0A 2FCUA 4YG0A 1C1LA 4FPLA 2K0GA 4O9EA 5FDBA 4QDSA 1HLCA 1GZWA 1UKRA 2IC1A 3HN1A 4N43A 1BVP1 3NKTA 4ASKA 1YI9A 4KI5M 2DCKA 3OGSA 1CIWA 2EXHA 3ZR5A 5D8AB 1BZWA 1NE4A 2HBUA 1K42A 3T3YA 5FZKA 4PI0A 1BCXA 4M00A 4DZGA 1G9FA 3T1LA 5IK8A 5JPNB 3KVAA 3DPRA 4OULA 3OJBA 1Y9QA 3JBG3 4JRAA 4M3CA 2LS6A 1X9TA 2PLV3 2IUWA 3I2IA 4BLIA 1LOBA 1ALYA 3J9SA 1YO8A 4CCKA 5HV0A 4QT6A 1RUC1 2VD7A 3B9CA 1PO11 5DUXA 1L7QA 1XBFA 4HT1T 4XJ9A 4ARXA 2W39A 5BNPA 1DDLA 3GHMA 1VMHA 4FAHA 4DO0A 5FK7A 4MUVA 4Q0SA 1SACA 1EYBA 5JXIA 1BVVA 1I6XA 2D6LX 3AKRA 5H9QA 3KT1A 5EZWA 1H8VA 4JKMA 2H6BA 4FQZA 4QM9A 5G04L 1I1EA 4FTEA 3I8TA 1D4VB 4H55A 1G8WA 4Q2FA 3BB6A 1JHJA 4CXYA 2WBKA 2ZHLA 2RG4A 3HQUA 3VZLA 1NZIA 1LHUA 2XQRA 5LA0A 2WQZC 3OGJA 1RUH2 4QKBA 2O14A 5FV3A 3BUCA 2HYXA 1KDKA 4YSFA 2VOWA 3MUZ1 2DCZA 1UY3A 4CDXC 5FQ0A 2OPWA 3KQ4B 3K77A 1F4AA 1C3HA 3T08A 4INDA 4AFDA 4HPKA 2ZHKA 4IEXA 3VHPA 3WDUA 4QX0A 4AI9A 4CCDA 3VL9A 1DZRA 2PTMA 3SISA 1LOAA 1C57A 2Q8EA 3ES4A 4WVMB 3VKFC 3UNPA 2GALA 5KR7A 3FHIB 4RGKA 2BBAA 2E63A 1QGLA 4WM7B 4AFBA 1US2A 4JGZC 1CAXB 3FBYA 5F2WA 4A7ZA 3S57A 1H6YA 3LD8A 3KV4A 2DVGA 3OEBA 1R083 1K12A 2VUCA 4NUBA 4Z07A 5C5TA 3MEPA 2HH9A 3PURA 2W3JA 2A1XA 5DDJ1 4YVSC 2YGMA 2C9AA 4OVEA 4IGOA 4FCAA 2UYAA 4XF9A 4JKLA 5F32A 1J1TA 4C1WA 3LF7A 2BNMA 1KGYA 2DVBA 1W9WA 3H3ZA 4ZHNA 4PI2A 1GOHA 3DL3A 3ZFGB 4IXLA 1YQ2A 1VJ2A 3TOJA 3ZXDA 1JU4A 1R1A3 2RDSA 3NVCA 3H1YA 2H6CA 2C24A 4B8EA 3N4MA 3WNLA 2AEZA 3W5MA 4RS5A 1N47A 2QUOA 4EWDA 4NPRA 3ITQA 5FZ9A 5A80A 3DXUA 3WCRA 1LGNA 1VBA1 1UPSA 1KJLA 5FZFA 2XJUA 1AYN1 1LESA 4GH4B 5FZ0A 4JAAA 2ATFA 3PU3A 3I49A 1YQ6A 4FXGB 4Q4Y1 4S2FA 3GHNA 2PQSA 4WM7C 4AHXA 2CGNA 3BTXA 3WXPA 2QNKA 5K0UB 2RDRA 3I2JA 1W0PA 2J1AA 4Y1ZA 2B5HA 2QQJA 4B4QA 4D7TA 5T50A 1RB8G 3A22A 4FP3A 4GD4A 5JIUA 4DXTA 3CU7A 4JHTA 1W8UA 5JSRA 3VKOA 1LHNA 4HLTA 4RS5C 5B2GB 5JOZA 1S1AA 5A6YA 4Y33A 3VL8A 1ODNA 1MZFA 1W8HA 1C8M2 2VJXA 2XVLA 3ZYHA 2PFWA 2ZX0A 4MVTA 3D0SA 4XUTA 3VGIA 3ST7A 3CJIC 2XONA 3UK9A 4EN0A 5FPVA 4JC1A 3PVOA 5FP3A 4FOYA 1ULEA 5BNOC 5B4XA 3M1HA 1RUF2 3N7KA 1UYZA 2P3IA 4CRQA 3MUY1 2D98A 5J96B 1MS5A 1HJFA 4LPLA 3KT4A 1DGWX 3O5SA 2GN7A 2Y38A 3VLBB 5LWBA 1DLLA 5BNNB 4Q8LA 1YFYA 3R4SA 1HRI3 1REEA 1UU6A 5FP9A 4MGTA 1STMA 2JXAA 1LKNA 4JGYB 3RQ0A 3VBHA 2IXIA 1OQEA 2FMYA 2J1TA 2ADDA 5FWJA 1PK6A 1EAH1 4K1YA 3GALA 3V0BA 5IVVA 4B3NA 2XJPA 1GKBA 2X8KA 2Y8KA 1W6MA 3GJAA 2W0XA 1GBGA 1XNAA 2R16A 4OQ9A 1TG7A 3VB9A 4WM8A 2XL7A 2IXKA 2XB6C 2DUQA 5C3RA 5GLUA 4YM1A 1DCSA 3BTAA 1JS9A 4YG6A 2WNVC 4LOSA 5DQ0A 5JLVA 4LO7A 1RHI1 4HXCA 4D6SA 2ZGLA 1QU0A 2C5DA 5LEKA 5FZ4A 3OSDA 4QKDA 1SMVA 4R9CA 2YU2A 4RN5A 5A7SA 4QGMA 1HDKA 1MZEA 3T1MA 3P5BA 5FAXA 1K5MA 5EP9A 3USUA 3RVHA 1W04A 4AI8A 5A3NA 5GZGA 1LB2A 2YBKA 5DG1A 3W20A 1DQ1A 3SCHA 2JEMA 4F8AA 1DGRN 3AFKA 4BDVB 2TBVA 3D5OA 1HV0A 3K46A 2XBO3 3Q8AA 5D8AC 4B1MA 5FP8A 4KG8A 2AACA 5DAQA 1OPOA 4Q4X1 4NN0A 2Q1FA 3MBWA 1OVPA 1XXNA 2QQLA 3V56A 2JE8A 2ZAAA 2O8QA 2RJ2A 1KXGA 3H7JA 4NIIA 1CX1A 5EXOA 5JMCA 1G9BA 1JYNA 4XMIA 3AJYA 1JXNA 5T5JA 1KEXA 5DDJ3 4HKOA 1AR93 1W6OA 5FLJA 3WP6A 1GYKA 4MX3A 1PGW1 1J59A 4PDWB 3RYRA 1GZWB 3NV4A 1UD1A 1VBD2 2A3XA 1Y43B 3C7EA 2XBO2 4FOQA 3E5UA 4HK8A 4QGNA 5T55A 5HPOA 1DQ4A 1JZ6A 2OS2A 4XMAA 4YW6A 2W1QA 1AYM1 4NRQA 3ECQA 3J4UH 5BNPC 2C1FA 5LCWL 1FX5A 1YJLA 2BRTA 3R4UA 4XF1A 4QXCA 5GZEA 2UY9A 5JSPA 4JQTA 2F4PA 2VULA 1EPZA 2WR9A 4Q5OA 3O0VA 1LNSA 2VZOA 3MF9A 4GWMA 4KNCA 3TRSB 4JGYC 4CDXB 5F7UA 3C7GA 2KM2A 3M3OA 4P14A 2WSUA 4ORFA 1CPNA 1RUE3 4XQ4A 1HN0A 4B1LA 2XVGA 2L9LA 1ST8A 4I01A 1VR3A 3UGGA 3VBSB 4ZU7A 2HWF1 3H50A 2BPA2 1NKGA 3JD72 1OQ1A 2C4XA 5BNOA 4MHRA 4MGIE 3WT3A 2BGPA 3FLTA 2G9ZA 4H2AA 1A78A 2EXIA 4W65A 2A71A 2GH2A 2HWD3 4D0QA 2QJVA 3VZJA 1PO13 2VTFA 1OLMA 2AGSA 1X7NA 3C8XA 1HRI2 3CF6E 3HQRA 1TMF3 4FPGA 4PLNA 2GP5A 3K2OA 5I0RA 2WT0A 4Z1VA 1ZA7A 3RZZA 1HB4A 4YVWC 2QDRA 4I09A 2DVAA 2OXBA 1RUE2 4XCAA 4OCTA 4LHNA 2RMU1 4YGCA 5DZGA 4CTEA 4XFBA 5DAVA 3ZXFA 2RM23 3CEWA 2ERFA 3L2YA 4XDQA 4AHZA 4LLOA 2A3YA 5A6QA 1QY4A 1XQNA 1QEXA 3RZGA 1VAMA 2K46A 2GC0A 3NWKA 3H9AA 3E5XA 1UZZA 4QKFA 3ZOIA 2VO5A 4OI1A 1QIQA 2VL4A 1EV13 1ZBE2 3KCYA 2Y26A 3PVNA 1BBT2 3CBNA 4UAPA 4AQSA 1RUI2 2VOKA 1LJ7A 2HEVF 3ZXLA 5FYZA 1LU1A 2VBDA 1W39A 2VOXA 1ASJ3 1ULOA 4PDWA 1VP6A 3BPSA 1C8NA 4K20A 1Y7BA 2GH8A 5KHKA 1PO21 5SV8A 2Q1ZB 2RS52 3J8F3 4R52A 3A0NA 4QPGC 4FP2A 5CNAA 5IAXA 5JUVA 1C8M1 1GP6A 2X09A 2ETEA 3ZPYA 1CN1A 3GZAA 3I3EA 2X5IA 5A7NA 4AAPA 2VC9A 2VCAA 1V6JA 2N7GA 2NPIA 5IVYA 4YW4A 3LQCA 1A8DA 2VUJA 3WCSA 5J37A 2W1WA 2VU9A 4KBZA 2V73A 1YQCA 2W94A 4XJAA 4CXXA 4K7JA 1CONA 4FAGA 4PIXA 3CJIB 1S0IA 3VZKA 2A75A 2ZGKA 2ZGMA 4AR2A 2AR6A 1RVF1 5C3SA 5I91A 1OH4A 3ZLIA 1XNDA 1OURA 2D6OX 4AI3A 3GZTB 3HWJA 1AL23 4XQDA 1AR71 2RR12 1X33A 1XU2A 3VBSC 1VB2A 3UYJA 1VB4A 5FY7A 4B7EA 2VUAA 2CV6A 4GMP3 1LU2A 1V6KA 1PZ7A 2GAUA 1CAUA 1GP4A 1J84A 1EAH2 3NAPC 1AVBA 3FE5A 2W95A 5CYYA 3UKTA 1D2QA 2E33A 4QX7A 2ZHNA 3ZPOA 3UKNA 4BB3A 4Q4Y3 2B7YA 2BP6A 4URAA 1DGWA 1DLCA 4QU1A 4HVQA 5A3WA 5KC6A 2P6CA 2XJVA 2YBPA 4BMBA 1JODA 5ISLA 3I2GA 3MHZA 4UW5A 4YM3A 2LUWA 2B42B 1HXS1 2CNAA 3THCA 4TWTA 4P9YA 3KSCA 1IPKA 4H7MA 5C4WA 1NE6A 2BJSA 4ES8A 4UF0A 3OUJA 1Z78A 4EJRA 2BERA 4YVWA 1QNYA 1DYOA 1R091 4MZUA 3HT2A 1D0HA 1VBC1 2VVFA 4HBNA 3T0AA 2QQVA 3VD3A 3AKPA 1SCRA 3FFZA 1W99A 2IZWA 1H2NA 2EXKA 3AXDA 1CZTA 3JBG1 4L99A 4NO4A 4CE8A 2Y6JA 2XLGA 3WNMA 2WZ8A 3DEMA 4PT6A 4YWAA 3LDRA 5FRAA 1O3QA 4YNIA 4IEOA 4GJYA 3BGAA 4XILA 1VALA 4CXWA 3OPTA 1XSQA 3MIHA 5A1LA 3U1XA 3MFCA 3MLLA 4DUVA 2YY1A 5CAZA 3ZSJA 3RWNA 3WSOA 1LCLA 1Q8SA 4AQ6A 1SLAA 3U4SA 3O1TA 4ZXEA 3VDCA 3WG3A 2ZGNA 3IIAA 2Q1MA 1WMFA 1YFWA 3OUIA 4I02A 3ZYGA 3QCWA 5EQUA 4XBLA 5KHGA 1H1IA 1VBC2 1O59A 1JMUB 1AXYA 5FPXA 5EPAA 4QU2A 2FZ1A 4Y1YA 2P3YA 5F2SA 3WQ1A 4XC9A 2WNUA 4AG4A 4IGPA 2P4EA 5GZDA 4Q1PA 1IG3A 2VMHA 1RJ7A 1RMU1 2YZ4A 2ZGQA 2ZHMA 3I3QA 4OI4A 1O3SA 2FHRA 2JJ6A 4FSJA 4LO6B 3U4XA 4XBQA 3AP5A 3WEZA 1ENRA 2GC2A 3GBWA 4J1XA 1VBB2 4AVTA 2GNBA 2IWGB 4A7KA 4PBOA 1VAVA 2X5IC 3QACA 4YRDA 3TNPB 3I54A 1X36A 5I8YA 1EV12 1FI2A 1ZBE3 3AVSA 1POV3 5LA1A 4LKEA 1N1YA 1YI7A 2WZR3 1WA6X 1R081 1IS3A 5E1RA 5LBCA 2ZEYA 3MLKA 2ZEWA 5LA9A 3O1UA 4UYBA 2DVFA 4Y4RA 4B29A 3E6BA 4A44A 5BY5A 2JDMA 3M7AA 3KGLA 1TME2 5F3CA 3PIJA 1IS5A 5FY0A 2W9XA 4CU7A 4PBPA 4YVSB 5LW9A 3TYJA 3WQ0A 1WCKA 4EWAA 3LEGA 3GZUC 1RVF3 3ACHA 1V00A 4FPFA 1NY71 1I9RA 3ZX7A 3DKWA 2P3JA 2MEV2 3RJ2X 2GSYA 1FPN3 3JB8A 4S2HA 5GZCA 2GMPA 1S4CA 2A6VA 2J1SA 3AMQA 3I97A 1WUVA 4RHV2 2Z2SB 1VAKA 3QOPA 1YFXA 5JWPA 5FYUA 4GMP1 1LAJA 1RUF3 4JKKA 2W87A 4FTSA 1DFQA 3P6BA 4QQHA 1SBDA 3U0ZA 5LY2A 2QKDA 4NAOA 1RUG1 1SPPA 4E2GA 3SLIA 2VBBA 3ZFEB 2ILMA 1PM7A 2DBIA 2VAUA 2PAEA 4OHXA 4LNVA 1QJU1 4XEZA 2PHRA 4L92A 1MEC2 1NCQA 3HVDA 2NN8A 2XUEA 5L9VA 3BTYA 1FPN2 4Y5Z0 3MZHA 2YU1A 2OZ6A 4DS0A 3WF2A 1PMIA 4Q4Y2 1R64A 4GWJA 3WP3A 4LITA 5C71A 1C28A 1OF3A 4LLFA 3TN93 1H6XA 2PHXA 1DGRA 2P34A 3SMHA 1ULPA 3TBDA 2RS13 4CP9B 5KXDA 3AX4A 1COV2 2NMNA 1NQDA 2WIIB 2HWD2 1QJY1 1QKQA 5HXVA 3ZDSA 4QPGA 1RHI3 3OF1A 4FPKA 2DTYA 1H2MA 4I3PA 4LBQB 4D3WA 3N7JA 4XABA 5KHHA 2XWBB 4W6WA 1NCRB 4WM8C 5CFDA 2HWB1 2JG8C 2Y6LA 4Y4YA 2RV9A 2LM3A 3U75A 1W0NA 1WCSA 2WS93 1HRI1 2HEWF 4H3WA 5FZ8A 5C3PA 1QJU2 2VH9A 2JDPA 4UI9L 4J1WA 2VECA 2D3PA 1WMEA 2VZVA 1GWMA 1AX2A 2RS12 2E53A 4LOTA 1K5MC 3GCWA 4Q4X3 1RUD1 3E6DA 3MIBA 4GA9A 1FT9A 4ISQA 4N9HA 4BMEA 1NXMA 4A41A 2V4AA 1OFNA 2VG9A 1CAWA 1FOD2 3IT8A 3LPGA 1HIXA 3POGA 4DY3A 4UOJA 5GZFA 1ASJ2 4A7YA 1ZREA 1JI6A 1W3VA 2DBNA 4XUOA 2AYHA 2V5YA 3BYWA 1GR3A 4OI0A 4WZFA 1EUTA 5FXZA 2VZQA 5EV7A 4YW1A 3WDYA 3BIEA 2KR2A 5JXJA 4FPEA 1UYYA 2WNVB 4TSVA 2J1EA 1WW4A 2E26A 3PHMA 4IE4A 2XR4A 1W2NA 5FYSA 1PO22 5A3MA 5IWFA 2ZMNA 4LR4A 1YWKA 3B69A 3N35A 4LULA 1Q8QA 2WNOA 1OD3A 2VQ0A 1W9FA 3B94A 4TYSA 3A21A 4KQ7A 4BQWA 3AB0A 1GP5A 2XJTA 4BQ3A 2R7EB 5HCFA 1WBLA 2D93A 3GZEA 1ZBE1 1BMV1 3NW4A 1POV1 4XURA 1AX1A 5FYYA 2ZOEB 3ZFFA 1WLCA 2H0VA 2XG3A 3KHBA 4JGZB 2QQWA 4AW7A 4LBJA 1VBB3 2ZGOA 4ATFA 5C8CB 1AX0A 1AZDA 2EICA 3H8RA 2QQPA 1IQAA 1ZM1A 2WS92 1GUIA 2HWF3 2JDHA 3NNMA 4GB31 1GQGA 3NAPA 3LOIA 4CP9A 5C4WB 3CQOA 2WSVA 1O91A 3WF4A 3ZXGA 3AP4A 2TUNA 1SEFA 4MXVA 5A7PA 4CU9A 1MS0A 5FTTC 5JPMB 2BTVC 5L19A 3AKSA 4D8MA 2E7AA 2IVIB 4BU2A 4MSVA 5TSWA 5IATA 2UWBA 2VNGA 4EE2A 1NAEA 4WM8B 4DFSA 4HSLA 1OA3A 2QQKA 1UNBA 1WW5A 3C7HA 2ARBA 2GNMA 3NNJA 5IK4A 4CDUC 5J1XA 4XDPA 5A32A 3JD71 2HWF2 4BPZA 3J7HA 4XFIA 5BXXA 5F6KA 4BQXA 1M06G 1O5UA 2NLRA 4JQRA 1KQRA 4COYA 5A3LA 3H8UA 3MYXA 1GWKA 2O1QA 1ZZ8A 2W92A 3DV8A 5K0UC 3AMPA 4YZ1A 1JH5A 1COV3 1PGL2 1AYN2 1PMHX 2J22A 3I7DA 5HCBA 5A3TA 5T5PA 1UWWA 5FO7B 2VXJA 4BM8A 4XJZA 1OQDA 5C4WC 5HCHA 2WQ4A 5APAA 4GWIA 1CAVA 4LE4A 3TEYA 4ZY9A 3O1OA 4N9IA 3N9NA 3LAGA 4NPMA 4I30A 4DMIA 4QB6A 4YG3A 3H7YA 2JDNA 2BNOA 4L11A 1MVEA 1YCIA 2RVAA 4CYDA 4D94A 1ZRIA 5EYYA 3VD5A 1C8M3 1DYPA 3PIGA 5FZBA 4TLGA 4NWWA 2UYBA 5DN2A 5A3PA 2VQTA 2VZRA 3KB5A 4BWOA 1US3A 2LALA 1IS6A 3R0RA 5LY1A 2Q4SA 3GBFA 1UZWA 4BOWA 1BJQA 3QLQA 4WZCA 1X9PA 2GU9A 2YXSA 4HKLA 4IEWA 3NRUA 4JGZA 2R1DA 4DRRA 1GQHA 3D6EA 4COWA 1ODMA 2YC2A 3WG4A 5BNNC 2FZ2A 5JOYA 5H9RA 3ABZA 1MS8A 4BZ4A 3N7MA 4LBKA 4OHZA 1O3TA 3UT0A 2Y6HA 4CDQC 3GGLA 1QJX1 3LWCA 3WDVA 1ASJ1 4META 4Y22B 2SBAA 1RGSA 1DU3D 3ZKYA 3S0MA 1PIV3 3CMGA 3B3QE 3ZM8A 4IDZA 3WUCA 4HFSA 2XMLA 4CZSA 1UXXX 3AZYA 3HJRA 1SLCA 1OA2A 4P02B 2P2KA 4K8RB 4Q0UA 1W2UA 4P08A 1PVC1 2OQ6A 1Q8VA 1AR72 2RR11 2JB4A 5LB6A 1A34A 1MQTB 2Q8CA 2P5BA 1UL9A 2D3RA 3CZJA 4LK6A 1L3JA 4YVSA 4FFHA 4HK9A 1G9CA 2WZR1 2FDJA 3U10A 3VUOA 1HB3A 1W2OA 4L97A 2PHFA 2MHFA 1DIWA 1QOSA 3ASIA 3OEAA 3PUIA 4Y26A 2WDBA 5FZMA 1JTZX 1R1A2 1V6IA 4K9SA 3HMYA 2VW1A 4NIAA 3K48A 3S30A 1N1SA 5JR7B 2A70A 3IPVB 3E5QA 2JD9A 3OG2A 2OUJA 4HETA 3WQBA 4DQAA 1D7PM 2BOIA 3V0AA 3ILFA 1GZTA 5FPAA 3RI9A 2V72A 3VBOA 4CEYA 2GMEA 2VMDA 1QDOA 2JWPA 1XNKA 3OBTA 4IV3B 4P5HA 4JTOA 1AR73 2ZX1A 1JUIA 1GOFA 4XCBA 4CDQB 4HMZA 1PGW2 1CAVB 4JHZA 4IV1A 1SFPA 4WM7A 4CUBA 3HT1A 4O61A 1QNWA 1OUSA 2YC4A 2G9FA 4W6XA 3E97A 4XJ8A 4NRPA 1NUKA 2QZ3A 1QF3A 4KBBA 2WAOA 4LO8A 5CKMA 1OLME 3MW3A 4NHKA 2I45A 4O65A 3LEMA 3ZSMA 3ACGA 4COVA 2W68A 1JYCA 1YLLA 1YQ8A 4GKXA 4D6RA 1AR92 1H4GA 1U5YA 1S0FA 3DPRB 3OBRA 4I0BA 5FIXA 3N9MA 4Q0VA 3T4HB 1ENXA 3WOGA 4CUGA 2XQXA 2RS53 3J8F2 1EUUA 2Q0AA 1CR7A 4L9BA 3SNMA 4QMAA 2CL2A 1RUH3 1UY0A 3CDZB 4PIYA 4YLZA 1T6GC 5FR3A 5JCTA 3WR0A 2WAAA 1T6BX 4L8QA 4RS5B 5ERLA 1VBE3 4NHYA 2EVXA 2XKOA 1GSLA 1NG0A 3JB4C 4XQWA 4COZA 3ZVXA 2CSGA 5BNPB 3VDBA 4XUQA 1FNZA 4M4PA 2WN3A 3T2PA 2EF6A 3L9JT 2ZXQA 4UXAA 1NT0A 3AP7A 4KU7A 1PGSA 3RYPA 1RXFA 1UF2C 1WW6A 1WCDJ 3EHKA 1WKYA 4ONUA 3WUDA 1RMU3 3O0WA 1FOD1 5BNOB 4NIDA 2YROA 3M3CA 4XZUG 1UYPA 1HQLA 1NX9A 1Z0HA 1POQA 3POJA 2JG8A 5LASA 4DEVA 5A6XA 4GH4C 1SFNA 5D1IA 1S55A 3PJQA 4MGQA 4CU8A 2FD8A 5IVEA 1MS9A 3SKVA 1ZBA1 2C6SA 5FMOS 5FZHA 1FMD1 1LOEA 3ZYRA 5FY5A 4AVVA 4LE3A 1KJRA 1ND2B 1H9PA 2YYOA 5ABJB 3WNNA 5LEJA 3A23A 3O1RA 4W50A 5DAWA 4MHUA 4XIKA 3BOWA 1F15A 3AP9A 4IV3A 5IW0A 3ETQA 3C7FA 3LZZA 1SQ4A 2JDAA 2RHPA 3C2UA 3U14A 4C0BA 4E27A 5AFEA 2WUHA 2X05A 1MR5A 4AEKA 1ULDA 4Z2WA 2NP0A 4IV3C 3SEPA 3LA2A 4TLFA 1OT5A 3BIWE 4XBNA 4XW3A 1K3IA 4YZ3A 1AF9A 1LR5A 4HONA 5H9SA 4DPNA 5BNNA 4XXAA 5FXXA 2FDFA 2RJKA 3AVRA 2D6MA 5GLZA 5I0DA 1XNTA 3Q8BA 4EZHA 3I3DA 2XH6A 4NPLA 2EXJA 4QX1A 2XJQA 1JU3A 4DUXA 3EBRA 2XLAA 3JZVA 4Y24A 4MYEA 2HWC3 5CFDB 3I59A 2F6BA 2ZJCA 2PAMA 3TEZA 2VZPA 4RGGA 4P9WA 3IMMA 2XVKA 2X5IB 1PGL1 1ND2C 1RC6A 2JECA 2DV9A 1XYOA 3LIHA 3A4UA 2NZ9A 4PCRA 1CPMA 3DXTA 4PLMA 2OZJA 3ILRA 3R6SA 3DYPA 1UX6A 4QPIC 1W8TA 4MV2A 3KT7A 4OYUA 1OXCA 4QWNA 1MEC3 2CTVA 4IEVA 1LRHA 1LODA 4QQOA 1MVQA 4RR3A 1RUOA 2R062 4E4DX 4HN1A 5JI7A 5F1RA 1U5XA 2DURA 3ACFA 3J7LA 2DU1A 4XDOA 1LGBA 2J1RA 2D7FA 1ULCA 1O5LA 5FY9A 5EJ3A 3O1MA 4LQRA 1HJGA 4UBGA 2ARAA 5DAPA 4MXWB 1QJFA 2F4LA 4ZKTB 1NA1B 5FWEA 3ZFFC 1LULA 1OD5A 2PMWB 1V9U1 3I3MA 4Q26A 1POV0 2R0FA 3NKGA 5GLVA 4N53B 1QXRA 2R1BA 3O14A 1QJX2 4AEDA 5LA2A 2Z42A 2ZABA 2E31A 4LBLA 2WO7A 3U11A 1UY4A 3ZIWA 4CDUA 2VNRA 1UOJA 1BYHA 2P6HA 3OPWA 1YIPA 2QCSB 4A3ZA 4DXSA 3OGRA 4RFT0 4LHLA 1CGPA 1IS4A 2D44A 2WS91 4E4HA 5I93A 3DYOA 4XIOA 2JD4A 2HLEA 4JCKA 4DOUA 2BGOA 1QJU3 3POEA 2DUOA 4XHBA 5F5AA 1DQ2A 2WFF2 3DUIA 5I0SA 5FUPA 4NROA 3L2HA 3LDBA 1OOPB 4QB1A 4CPBD 4OQ8A 4QPIB 2J42A 1S2EA 2DTWA 3I4IA 4CU6A 2B46X 2XKPA 4CCOA 3AMNA 4C91A 4PLOA 5DUUA 5JOWA 3NNLA 2V5DA 3AYCA 4TZDA 1OUXA 3M3QA 2Q5TA 1D4M2 3S6PA 2BOJA 1W6MB 5K4LA 1FMD2 5EYXA 3T30A 4EZ4A 5CKQA 2FDIA 4P9XA 1ENSA 4V1PA 3AL5A 1KFUL 1P8JA 4R9BA 3I59B 3AP6A 4KWLA 1AR83 1HN1A 3MW4A 3UL2A 3RG0A 4A6SA 1APNA 2K2SA 2CDOA 1BHGA 3RFRA 3WZ1A 1WLDA 1LECA 1V9U2 5FYIA 4HN0A 5IVCA 2ZS6B 1WBFA 4KH9A 1JUHA 3TAYA 3Q8FA 1RUJ2 2MEV1 4LHKA 4ZZ5A 1NCRC 1IG0A 4IEQA 4LIUA 4BQ4A 1W6QA 4LK7A 4C0HA 3IZOA 1PZ8A 1RYYA 1DZTA 1CESA 2HWE2 3QBQA 4EQVA 4E2SA 2VPVA 4MGSA 1FMD3 3IN9A 3NMBA 5I0UA 3VDDA 1QJX3 3R05A 1UKGA 2WT2A 3ACIA 1W6PB 2CAUA 1OFSA 3MPPG 3BU0A 4XAEA 4Y1VA 4SLIA 1DF0A 2VE1A 3POSA 3BODA 4KWUA 4XJWA 2MPFA 5KXEA 4AAXA 5GLTA 4WVMA 4AVBA 1JHNA 2WNUB 2ZX3A 3DPRC 3EXUA 3IBMA 1ZX5A 3MPBA 2W5FA 4U36A 5CA6A 1Q8PA 4Q4V1 2XJSA 5J7MA 1AR91 2UY8A 4GALA 2YMZA 3OPZA 4DRVA 4WBBA 1NA1C 4ZU4A 3JCIA 3ZN5A 1SLLA 1WCUA 4CDQA 3B02A 4IQPA 2HWE3 4RA0A 4N53C 3NJXA 2CGPA 3HAGA 4CDWC 1SLBA 5AVAA 5AC93 4QB2A 3WG1A 4WVWA 2GDFA 4PF1A 4HSJA 1F35A 3THDA 1W28A 1QJY2 1GQPA 2UWAA 4KU8A 4MLOA 1J58A 2OT7A 1G86A 3JD73 5FREA 4A45A 5FYHA 1QJZA 4CEYC 5HBAA 1UZYA 2OUHA 4NAMA 4QPIA 3O1VA 1LEMA 1PMJX 1KD7A 2QVSB 4J6GA 4R4XA 3AM2A 4B4PA 4Q27A 1QDCA 2XUMA 4NR1A 2GMMA 3X29B 3GBGA 4QKNA 3U78A 2W08A 2GP3A 4GB33 4EN6B 3SCFA 4AHYA 2HWC2 4XYXA 4BK4A 1RUJ3 4Q4X2 2Y33A 4LJHA 4HANA 4EYUA 3ZO0B 5AC92 4Q29A 5C9AB 4WV8A 5A1AA 2CDPA 5FMCA 3UGFA 1X50A 4ZONA 1RUC3 2RS11 2VMIA 2R49A 4G4FA 1SBFA 1VRH3 3UJQA 2OA2A 2AC1A 2JIGA 3CJIA 3OCPA 3SH5A 5DG2A 3PNAA 1JOPA 1YQ5A 1YEWA 4GKYA 1CAWB 4RD7A 1W6QB 3LEIA 1AR62 4OZOA 4NHXA 3AZVA 3KQRA 4XPVA 1Q43A 1IKPA 3ZYPA 3ALQA 4CP0A 3WY6A 4Q8KA 2CAVA 2GC3A 3WP4A 1NY72 2NQYA 3LFMA 3V0AB 1HQNA 1S0CA 3MDPA 3ZFEA 4CPBA 4HZFA 5SV5A 1TQ5A 1URXA 1U5ZA 1WZXA 3FMGA 3DGTA 3K4ZA 1JZ8A 3WDXA 1QXJA 4XTMA 3KV5A 5FZIA 5FXVA 1NCQB 5IK7A 2DUPA 3O7OA 4AZZA 1N3OA 4Q0PA 5HXMA 4AK3A 1EV11 3EQEA 3PUHA 3RMXA 3MW2A 2AREA 2YV8A 1OLQA 3CHXA 4Y5TA 2FDGA 2BGCA 3AC0A 1UX7A 1YC61 2YFUA 2JICA 2Z4FA 1OPMA 1QOOA 2O8OA 4YGDA 3OBZA 2WINB 3IWZA 4FFIA 4QGLA 1E5IA 4UF0B 1ND3C 1KS5A 4XFAA 5C8WA 1UXZA 2DCJA 3VKMA 5FYMA 3NJVA 3K3NA 4QPWA 5IT6A 5FZ6A 4CDWB 2ZGPA 4HVOA 2G1MA 4MOAA 5D8AA 3H3UA 4Z2AA 2CHHA 2C0ZA 2ZKNA 1GV9A 1UCXA 1HV1A 1O8SA 4BLJA 4DIQA 2GNDA 3P3PA 3EJKA 4OUSA 1WW7A 4QX5A 2ARXA 3C7OA 4PIZA 2QE3A 4N7UA 3MF6A 5J36A 2A7AA 4N8MA 3ZXJA 1I5ZA 1ENQA 3HNMA 1HB2A 3ZYFA 2XLFA 2BEOA 4IW3A 4FOWA 4QHOA 3UETA 2WZR2 5CVRA 4QX3A 1Q8OA 5LK7B 1ZYBA 4XUNA 1Y4WA 1AL21 2OVUA 2UU8A 5FLHA 3URFA 3GF6A 2RS31 1K5MB 4S2DA 4XZPA 2JIJA 2VMFA 5F8PA 3BCWA 5KBFA 3DF0A 4L2NA 3K3OA 4TTGA 1UY2A 3THPA 1TNRA 3NQHA 2V4VA 2PELA 1PO12 1CVNA 2JENA 5LRRA 5L7OB 1H8TB 3D8CA 1MZ6A 5FZGA 4C90A 4LBOA 3RSJA 4FQ4A 1FAYA 2VCMA 1PHMA 2Y64A 4XHXA 3ZYIB 4ASMB 2XDVA 3FJSA 4R4ZA 1WGPA 1NLRA 1SFYA 1VRBA 3JUUA 5ABJA 3VBUB 1F31A 2VTXJ 1KRIA 3MV11 3WV6A 5FYVA 1QOTA 2D5HA 1UYXA 4Y5SA 4BQ1A 1CIYA 4I0WB 2W46A 4EN9B 3WNXA 2FBEA 2WKKA 4GWNA 3INAA 5E89A 5F5QA 1DYKA 1RITA 2ARCA 1VMJA 2PHUA 4DB5A 1G9DA 1NCQC 2DDUA 4UFLA 4F83A 1W8OA 1NLQA 5GLWA 5FO8B 2CWSA 1TVGA 3UESA 2EIBA 3B93A 3ON7A 4LBQD 4Q4W1 1N1TA 4COUA 1IGOA 1XE8A 2ZGSA 2RMU2 3GYDA 4NWVA 2ZA9A 4RL7A 5GM0A 1XJAA 2OX0A 1RMU2 5DABA 4E4SA 5BYNA 4XETA 2JDZA 1PIV2 2YFZA 4EN8B 5LBEA 3OD0A 1V6LA 4IE0A 5FPBA 3EB7A 2ZBJA 3CNAA 3CIHA 4PJYA 1Q56A 3KLSA 4CDXA 1H8TC 1SZBA 4CCMA 4EWEA 3SH3A 1NZCA 5C6CA 1KDMA 1QQP3 3KWVA 2WRAA 4JDOA 4CUCA 3FX3A 4C1XA 1RUH1 1WLWA 4JV4A 4JDNA 3ZYBA 4CEWC 4UFMA 2BDRA 5FZEA 3NO8A 3OYWB 3F95A 4XXPA 3J7MA 4OUMA 1LOFC 4LBNA 1PVC2 2ORZA 4ATEA 2WNUC 4DNYA 5JXHA 1QWRA 3KD4A 4HVRA 1IPJA 1CQ9A 4W8JA 3FC0A 5FBJA 5IVFA 1VRH2 5EWSA 4OLLA 4KMQA
chains in the Genus database with same CATH topology
4RN5A 3NRUA 3CKHA 4RYDA 3IAQA 2YC2A 3FHAA 4BK5A 3ABZA 5IFTA 1JZ7A 2Y6HA 2E32A 4BDVB 4A4AA 3GGLA 3DYMA 3K46A 4HG6B 3FL7A 1XC6A 3CMGA 3ZM8A 3K75B 3MBWA 2QQLA 2J1VA 2JE8A 1UXXX 1WCQA 2RJ2A 2VQUA 3HJRA 4P02B 1CX1A 4P08A 1PX4A 1JYNA 3GM8A 1KEXA 3CZJA 5JXGA 3OEAA 3PUIA 2WDBA 2VZ1A 2WN2A 3C7EA 3OG2A 2JD9A 5HPOA 3WQBA 4OMCA 1D7PM 3LE0A 2V72A 1JZ6A 2W1QA 3ECQA 5LCWL 2VMDA 2J1UA 2QQIA 3K4DA 2B9VA 4QAWA 1GOFA 2C9KA 2OKXA 2XOMA 1LNSA 2VZOA 5F7UA 4JHZA 1L7RA 1MPXA 2ZEXA 2W1SA 3FN9A 4CUBA 3C7GA 1OF4A 2YC4A 2VMEA 3IDAA 3I3BA 4XVHA 1W9SA 1NUKA 1O8PA 2L9LA 2WAOA 2VZUA 1NKGA 2C4XA 5DPNA 2YB7A 3VD9A 2BGPA 3ACGA 5C70A 4QDQA 4CVUA 4DXRA 2XQXA 4E8DA 5FUIA 1EUUA 4D0QA 2J7MA 2VTFA 3C8XA 1UY0A 3CDZB 2WAAA 4MO3M 5EJ1B 3F2ZA 3VDBA 4XUQA 4M4PA 4W4ZA 2WN3A 3NNGA 3HNBM 3T2PA 2ZXQA 4E8CA 2WO2A 3SKJE 1T2XA 3T0DA 2QQNA 3D3AA 1WKYA 2VO5A 2VL4A 4GZ9A 2ORXA 4UAPA 4XZUG 1NX9A 2ZEZA 3HPNA 2VMCA 4DEVA 3E1F1 3IB3A 4MGQA 4CU8A 1ULOA 3SKVA 2QQOA 3I2KA 3WNNA 5JUVA 3A23A 4ARYA 2X09A 4W50A 4M4RA 2VR4A 3I3EA 2VC9A 2VCAA 2W1UA 3C7FA 3LQCA 2JDAA 5JR2A 2WUHA 2W1WA 2X05A 3SEPA 2W94A 1OT5A 3FHQA 4ZZ8A 1CZSA 1F4HA 1K3IA 3K4AA 3JXSA 1K45A 1OH4A 5I0DA 1XNTA 3I3DA 3MV01 4QX1A 1JU3A 4QDRA 4DUXA 3WF3A 2YG0A 4A6OA 1J84A 5B4NA 2VZPA 3GXUA 5CYYA 3OGVA 2W95A 2KD7A 2E33A 3DECA 1DLCA 3I2HA 2XHNA 3DYPA 2W47A 3I2GA 2WO1A 2BZDA 5G05L 4OYUA 4BJ0A 4XUPA 3THCA 4FI9A 1UMHA 4LKSA 3ACFA 4DUWA 2J1RA 2LW8A 4YPJA 4LQRA 2BERA 1DYOA 5EIYB 1JZ2A 1I5PA 2VM9A 4QX2A 3EYPA 3OB8A 3T0AA 5LA2A 3VD3A 1W99A 2E31A 5IFPA 1UY4A 2WQ8A 4A3ZA 2QBXA 4DXSA 3OGRA 1CZTA 3DYOA 2Y6JA 2HLEA 3WNMA 2WZ8A 4PT6A 2BGOA 4LHSA 4JX0A 3BGAA 4QB1A 2VCBA 2Y6GA 4MADA 4DUVA 3HOBA 4CU6A 3WSOA 4IUGA 3WF1A 4L0PA 4ZXEA 3WNPA 3VDCA 2V5DA 3CZUA 2VOTA 5C7GA 2JKXA 5IYYA 1JZ3A 1O59A 1JZ5A 3LPFA 5EJZB 1UY1A 3I2FA 4AG4A 1P8JA 1HN1A 2EIEA 2CDOA 1BHGA 3LEKA 4PQQA 1CZVA 1SHWB 4ZZ5A 5IJRA 3WEZA 2VCCA 1RYYA 3IAPA 4DEQA 2WO3A 4MGSA 5LA1A 3ACIA 2ZEYA 3U37A 2ZEWA 5JMOA 3ETPA 4KWUA 4OUEA 4A44A 1UMIA 4AAXA 4P5YA 3T09A 2QQMA 4BXSV 1JYVA 2W5FA 2B4KA 3W5NA 2W9XA 4TXWA 4CU7A 3HN3A 3LEGA 3ACHA 5DMYA 4OMDA 3NJXA 2W91A 1UZ0A 4QB2A 4PF1A 4QDSA 3THDA 2J1SA 4KI5M 1XPWA 2DCKA 1GQPA 2X10A 3OGSA 3I97A 4A45A 4JKKA 3T0BA 2W87A 1K42A 1PMJX 3P6BA 3VD4A 4CUAA 2LS6A 3I2IA 4BK4A 3GDBA 1L7QA 5CZKA 4ARXA 5A1AA 2CDPA 3WF2A 2WZEA 1R64A 4GWJA 3VDAA 5C71A 1JZ4A 1OF3A 5JXIA 1H6XA 4JKMA 5G04L 1ULPA 1JHJA 3LEIA 4OZOA 2WBKA 5LA0A 3P1IA 2HYXA 3MUZ1 1UY3A 3K77A 1F4AA 3MO4A 2Y6LA 3T08A 2RV9A 1W0NA 3K4ZA 1IQDC 1GOGA 3VD7A 1JZ8A 3IIIA 4QX0A 4UI9L 5HXMA 3UNPA 2WYSA 3PUHA 2BBAA 2VZVA 2ID4A 1US2A 3AC0A 1SDDB 1UX7A 2YFUA 2WABA 2Z4FA 1H6YA 3OEBA 1K12A 4A41A 3BN6A 2W3JA 3LPGA 1W8NA 4UOJA 1JI6A 4XUOA 1UXZA 2DCJA 4JKLA 1JYWA 1KGYA 3NJVA 4QPWA 1W9WA 1EUTA 1GOHA 2VZQA 4MOAA 1YQ2A 1JU4A 5JXJA 4Z2AA 1UYYA 2J1EA 2E26A 1O8SA 5IHRA 3WNLA 3W5MA 3C7OA 3HEIA 1OD3A 3A21A 2VZTA 3HNMA 2R7EB 1DP0A 3UETA 3WNOA 4QX3A 2PQSA 4XURA 4XUNA 3I2JA 2J1AA 2VMFA 2Y6KA 4TTGA 2EICA 1UY2A 2QQJA 3NQHA 3A22A 2V4VA 1GUIA 2VZSA 4DXTA 3CQOA 3WF4A 1J83A 4CU9A 2Y64A 2VJXA 4D8MA 3T2QA 4XUTA 3MV11 1NAEA 2XONA 1UYXA 2QQKA 1CIYA 2W46A 3C7HA 4P00B 5B4XA 5J1XA 1UYZA 3WF0A 3MUY1 2DDUA 3J7HA 4LPLA 3T2OA 1W8OA 1TVGA 3UESA 2EIBA 3OBAA 1GMMA 3HNYM 2W92A 1PMHX 2J22A 2VZ3A 2YFZA 2J1TA 1UWWA 3EB7A 3CIHA 1PX3A 4GWIA 3SEEA 4ZY9A 3WNKA 2Y8KA 1W9TA 4QB6A 4CUCA 1XNAA 1TG7A 1GNYA 2RVAA 1GU3A 1SG3A 4A42A 3VD5A 2ORZA 3A7QA 4ET7A 5DN2A 5DQ0A 5JXHA 2VQTA 2VZRA 2C26A 1US3A 4W8JA 2EIDA 1JYXA 4KMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RN5 A;  3NRU A;  3CKH A;  4RYD A;  3IAQ A;  2YC2 A;  3FHA A;  4BK5 A;  3ABZ A;  5IFT A;  1JZ7 A;  2Y6H A;  2E32 A;  4BDV B;  4A4A A;  3GGL A;  3DYM A;  3K46 A;  4HG6 B;  3FL7 A;  1XC6 A;  3CMG A;  3ZM8 A;  3K75 B;  3MBW A;  2QQL A;  2J1V A;  2JE8 A;  1UXX X;  1WCQ A;  2RJ2 A;  2VQU A;  3HJR A;  4P02 B;  1CX1 A;  4P08 A;  1PX4 A;  1JYN A;  3GM8 A;  1KEX A;  3CZJ A;  5JXG A;  3OEA A;  3PUI A;  2WDB A;  2VZ1 A;  2WN2 A;  3C7E A;  3OG2 A;  2JD9 A;  5HPO A;  3WQB A;  4OMC A;  1D7P M;  3LE0 A;  2V72 A;  1JZ6 A;  2W1Q A;  3ECQ A;  5LCW L;  2VMD A;  2J1U A;  2QQI A;  3K4D A;  2B9V A;  4QAW A;  1GOF A;  2C9K A;  2OKX A;  2XOM A;  1LNS A;  2VZO A;  5F7U A;  4JHZ A;  1L7R A;  1MPX A;  2ZEX A;  2W1S A;  3FN9 A;  4CUB A;  3C7G A;  1OF4 A;  2YC4 A;  2VME A;  3IDA A;  3I3B A;  4XVH A;  1W9S A;  1NUK A;  1O8P A;  2L9L A;  2WAO A;  2VZU A;  1NKG A;  2C4X A;  5DPN A;  2YB7 A;  3VD9 A;  2BGP A;  3ACG A;  5C70 A;  4QDQ A;  4CVU A;  4DXR A;  2XQX A;  4E8D A;  5FUI A;  1EUU A;  4D0Q A;  2J7M A;  2VTF A;  3C8X A;  1UY0 A;  3CDZ B;  2WAA A;  4MO3 M;  5EJ1 B;  3F2Z A;  3VDB A;  4XUQ A;  4M4P A;  4W4Z A;  2WN3 A;  3NNG A;  3HNB M;  3T2P A;  2ZXQ A;  4E8C A;  2WO2 A;  3SKJ E;  1T2X A;  3T0D A;  2QQN A;  3D3A A;  1WKY A;  2VO5 A;  2VL4 A;  4GZ9 A;  2ORX A;  4UAP A;  4XZU G;  1NX9 A;  2ZEZ A;  3HPN A;  2VMC A;  4DEV A;  3E1F 1;  3IB3 A;  4MGQ A;  4CU8 A;  1ULO A;  3SKV A;  2QQO A;  3I2K A;  3WNN A;  5JUV A;  3A23 A;  4ARY A;  2X09 A;  4W50 A;  4M4R A;  2VR4 A;  3I3E A;  2VC9 A;  2VCA A;  2W1U A;  3C7F A;  3LQC A;  2JDA A;  5JR2 A;  2WUH A;  2W1W A;  2X05 A;  3SEP A;  2W94 A;  1OT5 A;  3FHQ A;  4ZZ8 A;  1CZS A;  1F4H A;  1K3I A;  3K4A A;  3JXS A;  1K45 A;  1OH4 A;  5I0D A;  1XNT A;  3I3D A;  3MV0 1;  4QX1 A;  1JU3 A;  4QDR A;  4DUX A;  3WF3 A;  2YG0 A;  4A6O A;  1J84 A;  5B4N A;  2VZP A;  3GXU A;  5CYY A;  3OGV A;  2W95 A;  2KD7 A;  2E33 A;  3DEC A;  1DLC A;  3I2H A;  2XHN A;  3DYP A;  2W47 A;  3I2G A;  2WO1 A;  2BZD A;  5G05 L;  4OYU A;  4BJ0 A;  4XUP A;  3THC A;  4FI9 A;  1UMH A;  4LKS A;  3ACF A;  4DUW A;  2J1R A;  2LW8 A;  4YPJ A;  4LQR A;  2BER A;  1DYO A;  5EIY B;  1JZ2 A;  1I5P A;  2VM9 A;  4QX2 A;  3EYP A;  3OB8 A;  3T0A A;  5LA2 A;  3VD3 A;  1W99 A;  2E31 A;  5IFP A;  1UY4 A;  2WQ8 A;  4A3Z A;  2QBX A;  4DXS A;  3OGR A;  1CZT A;  3DYO A;  2Y6J A;  2HLE A;  3WNM A;  2WZ8 A;  4PT6 A;  2BGO A;  4LHS A;  4JX0 A;  3BGA A;  4QB1 A;  2VCB A;  2Y6G A;  4MAD A;  4DUV A;  3HOB A;  4CU6 A;  3WSO A;  4IUG A;  3WF1 A;  4L0P A;  4ZXE A;  3WNP A;  3VDC A;  2V5D A;  3CZU A;  2VOT A;  5C7G A;  2JKX A;  5IYY A;  1JZ3 A;  1O59 A;  1JZ5 A;  3LPF A;  5EJZ B;  1UY1 A;  3I2F A;  4AG4 A;  1P8J A;  1HN1 A;  2EIE A;  2CDO A;  1BHG A;  3LEK A;  4PQQ A;  1CZV A;  1SHW B;  4ZZ5 A;  5IJR A;  3WEZ A;  2VCC A;  1RYY A;  3IAP A;  4DEQ A;  2WO3 A;  4MGS A;  5LA1 A;  3ACI A;  2ZEY A;  3U37 A;  2ZEW A;  5JMO A;  3ETP A;  4KWU A;  4OUE A;  4A44 A;  1UMI A;  4AAX A;  4P5Y A;  3T09 A;  2QQM A;  4BXS V;  1JYV A;  2W5F A;  2B4K A;  3W5N A;  2W9X A;  4TXW A;  4CU7 A;  3HN3 A;  3LEG A;  3ACH A;  5DMY A;  4OMD A;  3NJX A;  2W91 A;  1UZ0 A;  4QB2 A;  4PF1 A;  4QDS A;  3THD A;  2J1S A;  4KI5 M;  1XPW A;  2DCK A;  1GQP A;  2X10 A;  3OGS A;  3I97 A;  4A45 A;  4JKK A;  3T0B A;  2W87 A;  1K42 A;  1PMJ X;  3P6B A;  3VD4 A;  4CUA A;  2LS6 A;  3I2I A;  4BK4 A;  3GDB A;  1L7Q A;  5CZK A;  4ARX A;  5A1A A;  2CDP A;  3WF2 A;  2WZE A;  1R64 A;  4GWJ A;  3VDA A;  5C71 A;  1JZ4 A;  1OF3 A;  5JXI A;  1H6X A;  4JKM A;  5G04 L;  1ULP A;  1JHJ A;  3LEI A;  4OZO A;  2WBK A;  5LA0 A;  3P1I A;  2HYX A;  3MUZ 1;  1UY3 A;  3K77 A;  1F4A A;  3MO4 A;  2Y6L A;  3T08 A;  2RV9 A;  1W0N A;  3K4Z A;  1IQD C;  1GOG A;  3VD7 A;  1JZ8 A;  3III A;  4QX0 A;  4UI9 L;  5HXM A;  3UNP A;  2WYS A;  3PUH A;  2BBA A;  2VZV A;  2ID4 A;  1US2 A;  3AC0 A;  1SDD B;  1UX7 A;  2YFU A;  2WAB A;  2Z4F A;  1H6Y A;  3OEB A;  1K12 A;  4A41 A;  3BN6 A;  2W3J A;  3LPG A;  1W8N A;  4UOJ A;  1JI6 A;  4XUO A;  1UXZ A;  2DCJ A;  4JKL A;  1JYW A;  1KGY A;  3NJV A;  4QPW A;  1W9W A;  1EUT A;  1GOH A;  2VZQ A;  4MOA A;  1YQ2 A;  1JU4 A;  5JXJ A;  4Z2A A;  1UYY A;  2J1E A;  2E26 A;  1O8S A;  5IHR A;  3WNL A;  3W5M A;  3C7O A;  3HEI A;  1OD3 A;  3A21 A;  2VZT A;  3HNM A;  2R7E B;  1DP0 A;  3UET A;  3WNO A;  4QX3 A;  2PQS A;  4XUR A;  4XUN A;  3I2J A;  2J1A A;  2VMF A;  2Y6K A;  4TTG A;  2EIC A;  1UY2 A;  2QQJ A;  3NQH A;  3A22 A;  2V4V A;  1GUI A;  2VZS A;  4DXT A;  3CQO A;  3WF4 A;  1J83 A;  4CU9 A;  2Y64 A;  2VJX A;  4D8M A;  3T2Q A;  4XUT A;  3MV1 1;  1NAE A;  2XON A;  1UYX A;  2QQK A;  1CIY A;  2W46 A;  3C7H A;  4P00 B;  5B4X A;  5J1X A;  1UYZ A;  3WF0 A;  3MUY 1;  2DDU A;  3J7H A;  4LPL A;  3T2O A;  1W8O A;  1TVG A;  3UES A;  2EIB A;  3OBA A;  1GMM A;  3HNY M;  2W92 A;  1PMH X;  2J22 A;  2VZ3 A;  2YFZ A;  2J1T A;  1UWW A;  3EB7 A;  3CIH A;  1PX3 A;  4GWI A;  3SEE A;  4ZY9 A;  3WNK A;  2Y8K A;  1W9T A;  4QB6 A;  4CUC A;  1XNA A;  1TG7 A;  1GNY A;  2RVA A;  1GU3 A;  1SG3 A;  4A42 A;  3VD5 A;  2ORZ A;  3A7Q A;  4ET7 A;  5DN2 A;  5DQ0 A;  5JXH A;  2VQT A;  2VZR A;  2C26 A;  1US3 A;  4W8J A;  2EID A;  1JYX A;  4KMQ A; 
#chains in the Genus database with same CATH topology
 1REF A;  4YGB A;  3OOX A;  1IPS A;  5GAL A;  1PK6 C;  3KVB A;  3AL6 A;  3ES1 A;  2VVE A;  3IAQ A;  5A7W A;  4NOT A;  3FHA A;  3ACL A;  2KXL A;  1SPP B;  1NA1 A;  4UBH A;  4BK5 A;  4YZ4 A;  1PIV 1;  5IFT A;  2BNN A;  3M3E A;  4CEY B;  5CFC A;  1AYN 3;  4N53 A;  4AED B;  1PVC 3;  4PQ9 A;  1W3X A;  2WA3 A;  5AFB A;  1VBD 1;  5LAT A;  1S0B A;  5L7O C;  2J1V A;  2AEY A;  1WCQ A;  2QDN A;  2VUD A;  2VQU A;  4IES A;  3FUO A;  4UWD A;  3SXW A;  3WD5 A;  2O0O A;  2OPK A;  5JXG A;  3SHR A;  2PHD A;  1QJE A;  5FP7 A;  3BKZ A;  1ZA4 A;  1OOP A;  3N9O A;  4R9A A;  5C9A C;  3PUQ A;  1YHF A;  1D2S A;  1R1Z A;  1FNY A;  1MZ5 A;  4QQ2 A;  1MEC 1;  5J98 B;  3H8O A;  1QHD A;  1OBN A;  2WN2 A;  3M4F A;  4OMC A;  4LUM A;  2WWU A;  5A3O A;  4Q4V 3;  3B01 A;  1OI6 A;  1BBT 3;  3LE0 A;  3PMS A;  3MI8 A;  3WP5 A;  3ZR6 A;  3RWK X;  2JX9 A;  3ZFG C;  5AVP A;  3CJX A;  4HOO A;  3VBH B;  4D7Y A;  1AHS A;  2A6Y A;  2HWE 1;  4UFI A;  4QAW A;  3K4D A;  5FOB B;  5FZL A;  2C9K A;  2XOM A;  1RUE 1;  4PHZ A;  4YW3 A;  3ZSL A;  1OHF A;  3FN9 A;  1ULF A;  2W1S A;  4LXL A;  4YM2 A;  2IFW A;  1OF4 A;  2R32 A;  2OW4 A;  1W90 A;  2RS3 3;  3H1M A;  2B39 A;  2VME A;  3WVJ A;  4XVH A;  5E6H A;  5F9T A;  1O8P A;  4XAC A;  3BU7 A;  1RUD 2;  2JE9 A;  4NHL A;  2ZGT A;  1MQT C;  5CFD C;  5A1F A;  4ITC A;  4MGK E;  3PUS A;  2YB7 A;  5DPN A;  3VD9 A;  5CG8 A;  5C70 A;  2D3S A;  1BLZ A;  5LK5 A;  3VZN A;  5LRS A;  1S0J A;  2XHK A;  4XFG A;  5K8S A;  5M0T A;  4CVU A;  2ZGR A;  4E8D A;  4GJZ A;  5LZ6 A;  4BHP A;  3JBG 2;  1Z7S 2;  3VBO B;  3WQ7 A;  4IET A;  1UMZ A;  3J26 N;  4FPC A;  1ULG A;  2RMU 3;  3QH7 A;  5IK5 A;  2SLI A;  4MO3 M;  1ND3 B;  5F6L B;  2W52 A;  4QHZ A;  3F2Z A;  3WW1 A;  4K8F A;  2FCV A;  2A5Z A;  2A73 B;  3TN9 1;  1ZRC A;  2K9Z A;  3NNG A;  2OYZ A;  1WMX A;  2KA3 A;  3AJZ A;  4JVA A;  4KGQ A;  1C1F A;  4E8C A;  1AYM 2;  3SKJ E;  1T2X A;  3T0D A;  1DZQ A;  2QQN A;  2YC0 A;  4AOC A;  4P9J A;  3D3A A;  2E7T A;  4LTA A;  3ZFF B;  5E88 A;  3ZXE A;  3SIT A;  2ORX A;  1GZC A;  5A7O A;  3MIE A;  3RRD A;  1S2K A;  2ZEZ A;  5A33 B;  1JOJ A;  2YBS A;  2VMC A;  3HPN A;  1TE1 B;  5FFO C;  1NCR A;  1OKQ A;  5FCC A;  2ZKL A;  2DU0 A;  5FY8 A;  3IB3 A;  3POY A;  4Q0Q A;  1W06 A;  1YYN A;  1X8E A;  2VTX A;  4JRL A;  3KF3 A;  1ZZ6 A;  5CU1 A;  2TNF A;  5FY1 A;  2E9Q A;  4GXL A;  5FZO A;  5D2A A;  2R06 1;  5H9P A;  2R07 1;  2BVV A;  3W21 A;  4ARY A;  1RXG A;  5K9Y A;  4M4R A;  1PO2 3;  1XRU A;  2WLP A;  3OTF A;  2W1U A;  5FBZ A;  1GNH A;  5JR2 A;  4AQ2 A;  1F5F A;  1RUI 3;  5A32 B;  5T5L A;  2BQP A;  1AR8 1;  5CB7 A;  3FHQ A;  4WVZ A;  1CZS A;  1F4H A;  3D0J A;  3WW2 A;  1Z7S 3;  5FYT A;  2FMD A;  3JXS A;  2PQQ A;  3DN7 A;  1KS4 A;  2R07 2;  1L7L A;  5I8S A;  2Z5W A;  5EFU A;  4S2G A;  1YIF A;  2A6Z A;  2D6P A;  3BAL A;  3MV0 1;  4H14 A;  4MXW A;  1O3R A;  4A2U A;  2F17 A;  4EV0 A;  3RYK A;  1VBD 3;  5ACA 3;  1S0D A;  3NST A;  4AWD A;  3B7M A;  4A6O A;  1DHK B;  1XYN A;  3OGV A;  4HPK B;  4ZS3 A;  3DEC A;  4X6R B;  5LBF A;  4CCL A;  3POF A;  5FLI A;  1BK1 A;  1O6U A;  2UWC A;  3S7E A;  2VW0 A;  1HXS 3;  1ZNP A;  2XHN A;  2W47 A;  1W9Y A;  1JW6 A;  2Y6F A;  3ORJ A;  2DFB A;  3FFQ A;  4RHV 3;  1F2N A;  4BJ0 A;  2BBV A;  4XUP A;  4B4R A;  1UZV A;  3KF5 A;  2YGL A;  4G9S B;  1TZO A;  1S0G A;  5E8A A;  1D4M 3;  2LW8 A;  1MS3 A;  4P9I A;  4YPJ A;  1EY2 A;  1B35 B;  3PU8 A;  4FXK B;  4LIV A;  1AJK A;  1FPN 1;  5L9B A;  1V0A A;  4CA9 A;  1AXK A;  1YUD A;  1KIT A;  4BH9 A;  4C8D A;  3AZW A;  1JZ2 A;  3BTZ A;  3ZXA C;  1I5P A;  3VBF C;  1FV3 A;  1HB1 A;  2BVB A;  2BWC A;  2DVD A;  2VM9 A;  5IUQ A;  3ZN4 A;  4QX2 A;  3EYP A;  4Y22 A;  3OB8 A;  2D97 A;  1R09 3;  2WWJ A;  5KHJ A;  3V0B B;  5FKB A;  4N7I A;  2HEY F;  2WQ8 A;  3VBF A;  1UU4 A;  4AF9 A;  2VQA A;  3HIF A;  4RFR B;  2QQU A;  1VBC 3;  1UQX A;  3TEX A;  3ATG A;  4M3C F;  4XFC A;  2B8M A;  2JG9 B;  4BIF A;  4YGE A;  1MQT A;  1VIW B;  1W2A X;  3I2O A;  2WLQ A;  3PJY A;  3ZXK A;  1RUJ 1;  4Q4W 3;  4GH4 A;  4LHS A;  4XFF A;  4O7X A;  2Q8D A;  2RS3 2;  4RR3 B;  2PYT A;  1AL2 2;  5FPU A;  5A6Z A;  2YPJ A;  4MAD A;  3IDE A;  4M0H A;  1QH6 A;  5EHD A;  5IFP A;  5JDB A;  4AFC A;  3S7I A;  5GKA C;  4RQP B;  2VNV A;  3WF1 A;  5FYC A;  2PXJ A;  4BQ2 A;  2R04 2;  4UW3 A;  3NV3 A;  3CZU A;  1OSG A;  4GMP 0;  1H9W A;  3WHT A;  1FV2 A;  5IYY A;  1JZ3 A;  1JZ5 A;  3LPF A;  4JDM A;  1F5J A;  1XOY A;  2VY0 A;  3Q9O A;  2D6K A;  1UY1 A;  3LA7 A;  4NIH A;  1V6N A;  4V2W A;  4FT8 A;  4ISR A;  2HWB 3;  3FLR A;  5D21 A;  5A7Q A;  5IVB A;  1KFX L;  4OHY A;  2VGD A;  1XE7 A;  2XBO 1;  3MIG A;  1Y9G A;  3PVB B;  5L73 A;  3VZO A;  3ZMN A;  2LTN A;  2CYF A;  2AH2 A;  4QHB A;  4ZPI A;  4AI2 A;  2QFE A;  3OY8 A;  2VCC A;  2BWA A;  1H2L A;  3IAP A;  5FUN A;  5KXB A;  5I8T A;  3AMM A;  3J7N A;  2WO3 A;  1A8M A;  4LMF A;  3NV2 A;  3KCX A;  1E57 A;  4JZR A;  5CFC C;  1Q3E A;  3AYD A;  4AI1 A;  3U37 A;  4BE3 A;  2BFU S;  2R07 3;  2BYV E;  5JMO A;  3HD8 B;  4OUE A;  1UMI A;  4P5Y A;  3AZZ A;  3SC7 X;  2BUK A;  1WD3 A;  3AXE A;  3N9P A;  1NXD 1;  1GFF 2;  4LO5 B;  1JYV A;  5ACA 2;  3O1S A;  1B35 C;  1U12 A;  2ZCW A;  4NHM A;  3VBO C;  2P1B A;  1PNF A;  3BOP A;  3HN3 A;  4LEJ A;  4AGR A;  4QD2 A;  4AYU A;  1Z7S 1;  5F3E A;  5C9A A;  4ERO A;  5CIS A;  4QXH A;  5FK8 A;  2DWR A;  3UV9 A;  2JG9 A;  2W91 A;  4XF0 A;  1LOC A;  5IVJ A;  4G3Y C;  4AVC A;  2DCY A;  4F3J A;  4M0N A;  5KXC A;  4XF3 A;  3HBZ A;  1XPW A;  2X10 A;  3ME2 A;  1EPW A;  3RZL A;  1ZZ9 A;  3T0B A;  1H1A A;  4D7S A;  1OH3 A;  1V70 A;  2YUE A;  5L36 A;  1J3P A;  1C5I A;  2E6V A;  4N43 C;  1CX4 A;  2A3W A;  1U0A A;  3T4V A;  5F39 A;  4RR3 C;  3ZSE A;  3VD4 A;  1WD4 A;  1BEV 2;  3IKW A;  4X8P A;  3WLU A;  2XWJ B;  4BYY A;  4CUA A;  2EAK A;  3KCC A;  1SBE A;  3S5A A;  2ZAH A;  4ZU5 A;  5F3I A;  1QMJ A;  4UFJ A;  5HCA A;  5T54 A;  2RDN A;  3GDB A;  4GIQ A;  5FMO L;  1RUG 3;  2ZTN A;  1QXP A;  5CZK A;  1R08 2;  2ET1 A;  3G6J B;  1E5S A;  2AZ5 A;  3OUH A;  3POB A;  4KG0 A;  2WZE A;  2VMG A;  1OVS A;  1BXH A;  4X8N A;  1UOB A;  4V2V A;  3VDA A;  5C3O A;  1JZ4 A;  5FOJ B;  2VOV A;  3ZKU A;  1QH7 A;  3O12 A;  4PF5 A;  4HL0 A;  2LRO A;  1LOF A;  4XAA A;  1WA4 A;  1UIK A;  1WMD A;  2RE9 A;  4ASL A;  2WNE A;  5FJK A;  2Z69 A;  3VBU C;  3EMR A;  1NOV A;  1DBN A;  3NL1 A;  3P1I A;  3ZN6 B;  4I2O A;  1B09 A;  1ZRR A;  3WX5 A;  4EN7 B;  4FBF A;  1QJY 3;  3LOB A;  5KHI A;  1RUG 2;  2VNO A;  1K5J A;  4FFG A;  4IE6 A;  4M3C B;  3VV1 A;  2FCT A;  1RUN A;  3MO4 A;  3GCX A;  1TEI A;  3KS7 A;  1V6O A;  4K3U A;  4X6Q B;  1IQD C;  1GOG A;  3VD7 A;  5FMD A;  3III A;  1LHV A;  1RVF 2;  4MGZ E;  1UO9 A;  3VKL A;  4AQT A;  1W8F A;  2PAK A;  3LB9 A;  4QQL A;  2WYS A;  1ZVF A;  3AZX A;  3B00 A;  4AGV A;  3NJY A;  3RZK A;  1GNZ A;  2ID4 A;  1OMI A;  2IVJ A;  2Y34 A;  3I2D A;  1SDD B;  1W6N A;  4TN7 A;  2PA7 A;  4KL1 A;  3WW3 A;  1UU5 A;  4AXO A;  2WAB A;  3PDQ A;  4RGA A;  4CP1 A;  1YFU A;  2R30 A;  3EO6 A;  3FZ3 A;  1IOA A;  4D6Q A;  4AL9 A;  1RUC 2;  1LEN A;  1YRZ A;  3M3I A;  3AYA A;  1IZ3 A;  3BN6 A;  2ENR A;  4XFH A;  3WG2 A;  1W8N A;  3RGB A;  3POI A;  3RJR A;  1TME 1;  2PHT A;  1UPI A;  3NNF A;  1JYW A;  1HRV 2;  3N7L A;  3H0O A;  1ND2 A;  3DKQ A;  1AR6 3;  5L7O A;  3USS A;  1LHW A;  4YYO A;  5CAD A;  4OI2 A;  4YZ5 A;  1N1V A;  4CSW A;  3LFI A;  1VE0 A;  2ZGU A;  3IMN A;  4FFF A;  4LOR A;  3V64 A;  5DUV A;  5IHR A;  1RUI 1;  2WYF A;  3CL1 A;  3TNQ A;  3WW4 A;  1W8Z A;  1BBT 1;  1LED A;  3PVE A;  1A6C A;  3HEI A;  2A6X A;  3PUA A;  3ZDV A;  1MS1 A;  3LDK A;  2P37 A;  1DQ6 A;  2YPD A;  4UFK A;  1HW5 A;  4P9G A;  4NRM A;  2VZT A;  1V6M A;  2HWB 2;  4I3G A;  4NMI A;  1PZ9 A;  4R8H A;  2IXL A;  3PTY A;  1DP0 A;  1CAX A;  1VBB 1;  1AJO A;  5T5O A;  3JU9 A;  4K21 A;  3JQX A;  4LA3 A;  3WNO A;  3M8L A;  1RUF 1;  1GZ9 A;  3FWE A;  3MFA A;  5FKC A;  1HQW A;  3VDD C;  4Y1X A;  5CBL A;  3RNS A;  1LHO A;  5C5U A;  2WFF 1;  1CWP A;  5CIR A;  5HV4 A;  2I74 A;  4KGG A;  2JG9 C;  1SLT A;  2Y6K A;  1BK0 A;  3OD4 A;  3TB0 A;  2GN3 A;  1FXZ A;  1WWY A;  1XNB A;  1S2B A;  2VZS A;  5FZ3 A;  3ZFG A;  4E9K A;  1QQP 2;  4JGY A;  1B35 A;  1J83 A;  3PTR B;  2ES3 A;  3HR9 A;  2ZX4 A;  4LBQ A;  4OHW A;  4YVW B;  4FPH A;  3ZN6 A;  2VBP A;  2YHJ A;  4RQP C;  5I0T A;  2XGX A;  5FZO B;  5JOX A;  2HJI A;  5DZF A;  2JE7 A;  3T2Q A;  3MID A;  5C3Q A;  1UN1 A;  3Q8E A;  5FYB A;  3N36 A;  1DG6 A;  3NJZ A;  5J3U A;  2R04 1;  3DCQ A;  4DY5 A;  4P00 B;  4QX8 A;  5FPL A;  1HKD A;  5K7P A;  4IEY A;  2DFC A;  4YW5 A;  3VBR B;  3WF0 A;  1RJ8 A;  2EAA A;  3T2O A;  1W6N B;  3IPV A;  3H3L A;  3VBH C;  4K40 A;  5A33 A;  3OBA A;  1AXZ A;  1ZRF A;  3VDD B;  5BPX A;  2PLV 2;  3SQO A;  1GMM A;  3WDW A;  2VW2 A;  3B5L B;  2FQP A;  2Z79 A;  1W6P A;  2CWM A;  3HNY M;  1Y9M A;  3N9Q A;  3USU B;  1EP0 A;  1UIJ A;  4LA2 A;  2CU5 A;  4RQP A;  2VZ3 A;  1QQP 1;  4NE9 A;  4AE2 A;  2GZW A;  4BQ5 A;  5KC5 A;  1XE0 A;  2I2S A;  5ABJ C;  1H2K A;  1R09 2;  4FPO B;  5A3U A;  1ONA A;  1PX3 A;  1COV 1;  3SEE A;  3N3H A;  2RS5 1;  1CAU B;  3WNK A;  1W9T A;  3ZFE C;  4AFA A;  4LUK A;  3VBU A;  5CFC B;  1F8V A;  5DUW A;  3M70 A;  5LBB A;  1GNY A;  5FY4 A;  2EIG A;  4UW6 A;  2WT1 A;  5DDJ 2;  1GU3 A;  2V09 A;  3THT A;  4MGY E;  1SG3 A;  2EA7 A;  4Q4W 2;  2ZMK A;  4A42 A;  4AEM A;  1E5H A;  2P3K A;  3RZJ A;  3FBM A;  3A7Q A;  3AYE A;  4AVA A;  4ET7 A;  3JQW A;  2C26 A;  2ADE A;  3APB A;  4PDW C;  4KWK A;  2Y0I A;  3RPQ A;  2EID A;  1ZZB A;  1J3R A;  2Q8O A;  1JYX A;  3LSD A;  3TN9 2;  4BA6 A;  2E7Q A;  3PME A;  1SCS A;  1DQ0 A;  3BI3 A;  1XYP A;  5JI9 A;  2UUR A;  1FOD 3;  1SDW A;  2YDE A;  3CKH A;  3IM0 A;  4RYD A;  4CCJ A;  1W03 A;  3T2T A;  4CP2 A;  1BKZ A;  3LIG A;  4ZS2 A;  3NAP B;  1JZ7 A;  2E32 A;  4IEP A;  4A4A A;  1BEV 1;  3DYM A;  3Q8C A;  3H42 B;  3FL7 A;  4HG6 B;  3PL0 A;  3SH4 A;  1XC6 A;  1ZRD A;  1PM4 A;  1CJP A;  2RR1 3;  1PVX A;  1OKO A;  3K75 B;  3A0K A;  2E51 A;  4Y20 A;  5JZG A;  4M3C E;  4Z92 B;  2AEN A;  3H1W A;  1GLH A;  1PX4 A;  3D4K A;  3GM8 A;  1W0O A;  3AKQ A;  5FXW A;  1W2T A;  3WHU A;  4FO9 A;  4BQY A;  3LCP A;  5DZE A;  2LRP A;  4FPY A;  4Q1R A;  3VBS A;  5F5C A;  3RMY A;  2B45 X;  4J25 A;  5BNQ A;  3HQX A;  4H7L A;  1ACC A;  1Y3T A;  2Y0O A;  3C3V A;  2VZ1 A;  4XE9 A;  1IHM A;  2ZZQ A;  1GWL A;  5A7W B;  1G9A A;  1TMF 2;  2A6W A;  5F3G A;  2X29 A;  3VHO A;  2OQ7 A;  4WVV A;  1D4M 1;  3TEW A;  1XB9 A;  4O9G A;  2WZP P;  4W6Y A;  4I0A A;  4CCC A;  2QZ2 A;  3H8X A;  4UFH A;  2J1U A;  3P3N A;  2QQI A;  1DQ5 A;  1MS4 A;  2B9V A;  4IER A;  5J48 A;  5C33 A;  2OKX A;  1AYM 3;  3V65 A;  4LKF A;  5ACA 1;  2WWS A;  1L7R A;  3M2M A;  1MPX A;  2RDQ A;  2ZEX A;  4AED C;  3U07 A;  4B7K A;  1NQJ A;  2WFF 3;  4D69 A;  3O0X A;  1BMV 2;  4IEU A;  1OOP C;  2G4I A;  3IDA A;  3I3B A;  4CCE A;  1W9S A;  2VVD A;  2VZU A;  3BPZ A;  5FO9 B;  1S0E A;  1YJK A;  1W05 A;  5BUV A;  2MNG A;  1E5R A;  2ET7 A;  2NMO A;  4QDQ A;  3RDI A;  4OHV A;  1RIR A;  4AVS A;  4DXZ A;  5JSO A;  2XJR A;  4XJU A;  4DXR A;  2HKX A;  5FUI A;  3ILN A;  2W2I A;  4IEZ A;  4QPG B;  1VBE 1;  1LOG A;  3W59 A;  2J7M A;  1ZZ7 A;  3MIF A;  4N90 A;  4GQ7 A;  4SBV A;  1AUY A;  1RIN A;  5EJ1 B;  4Q4V 2;  3KMH A;  3W9A A;  5FZ7 A;  3POW A;  2R04 3;  1TMF 1;  1VRH 1;  2HBT A;  1V9U 3;  4BIS A;  4YAR A;  2Y60 A;  3LGR A;  2OII A;  3QD6 A;  4W4Z A;  4BIO A;  4BCU A;  1CD3 G;  2JKB A;  1N3P A;  3HNB M;  4IE5 A;  2PHL A;  1HRV 1;  2H0B A;  2WO2 A;  4K6B A;  2IXC A;  1PNG A;  4KWJ A;  1F9K A;  2BU9 A;  4Y20 B;  1TNF A;  5JZG B;  3ZMO A;  2JB8 A;  3KGZ A;  4RSU A;  4U2A A;  3FLP A;  2ZZJ A;  4GZ9 A;  3N9L A;  4P9L A;  4IE7 A;  1WLT A;  1RED A;  4LT5 A;  1RHI 2;  1VMF A;  1AL0 G;  4FTB A;  3KM5 A;  4QPY A;  1RUD 3;  5FQ0 B;  1YNA A;  2XL9 A;  3E1F 1;  2FDH A;  3WDT A;  3CO2 A;  1H8T A;  3OGG A;  1VBE 2;  2TEP A;  2R06 3;  2NM1 A;  4IGQ A;  2ZPX A;  2BFU L;  4M01 A;  1O7F A;  2I07 B;  2QQO A;  4LBM A;  5FZA A;  4MG2 A;  3I2K A;  1LTE A;  3SCG A;  1BQP A;  4E4Z A;  5JVV A;  1ZBA 3;  1HXS 2;  2VR4 A;  3R4D B;  4AI0 A;  3UKV A;  3J8F 1;  3BVC A;  4R9D A;  3ROU A;  4CEW B;  1J3Q A;  1A3K A;  4GUL A;  2AUY A;  3VN4 A;  1CJD A;  3G7D A;  4Z8B A;  1N3Q A;  5JAX A;  4ZZ8 A;  4F7Z A;  2DF7 A;  1NYW A;  1H1M A;  5DAX A;  5JIA A;  3K4A A;  4QQP A;  5JZG C;  1K45 A;  2HYK A;  3AMH A;  2FDK A;  4FVV A;  4CDW A;  3LKJ A;  4LO4 B;  3O1P A;  1O4T A;  4IL7 A;  4AFM A;  5ANQ A;  4YFZ A;  3VBR C;  4NIG A;  5DXD A;  5BV6 A;  4HKW A;  4OFG A;  1PK6 B;  3AKT A;  3IDB B;  4QDR A;  5F37 A;  3WF3 A;  2YG0 A;  4Y3O A;  5E16 A;  3QH6 A;  3VHR A;  2G9G A;  3KZ4 C;  5F5I A;  5B4N A;  1J1L A;  1VLN A;  3GXU A;  1W8W A;  2KD7 A;  2WC2 A;  2DCT A;  1YXW A;  3AFG A;  5HI0 A;  1U5I A;  4LKD A;  4RHV 1;  5L9R A;  5A70 A;  5CEH A;  2PLV 1;  1XSR A;  1Q5O A;  3TWI A;  4BXF A;  3I2H A;  4QXB A;  2WO1 A;  2D43 A;  3VKN A;  3LA3 A;  2BZD A;  5FZC A;  5G05 L;  2D5F A;  5K0U A;  3RI8 A;  4E2Q A;  2ZX2 A;  1AR8 2;  5FJH A;  4FI9 A;  2QTW B;  5T3N A;  1UMH A;  2Q30 A;  3AK0 A;  4LKS A;  3GJB A;  4ZXK A;  4DIN B;  2X53 S;  4DUW A;  1ZZC A;  3LSE A;  1OA4 A;  3CLP A;  5AC9 1;  1GAN A;  2D40 A;  2XXZ A;  1I3H A;  1VBA 2;  2JG8 B;  4UW4 A;  2JDK A;  5EIY B;  2VXR A;  4XF4 A;  4QM8 A;  1RL3 A;  1X82 A;  2B9U A;  2RM2 1;  5IAV A;  5KWR A;  5FZD A;  4IV1 C;  1HX6 A;  2WNV A;  2CGO A;  3K51 A;  3GNE A;  3MIC A;  3ZIX A;  1NLS A;  2JDY A;  3MGU A;  2QBX A;  3UGH A;  4FOV A;  1H4H A;  1UAI A;  4JTN A;  3WIN E;  5CKN A;  1EAH 3;  2NYY A;  1H0B A;  4AHW A;  2IXJ A;  4A3X A;  3PLQ A;  5CG9 A;  1VPH A;  1XU1 A;  4YM0 A;  3NV1 A;  1OLR A;  1G7Y A;  1JOB A;  4N43 B;  1W6O B;  5FPZ A;  4NJ4 A;  4JX0 A;  4FPJ A;  4OZX A;  4YW2 A;  3VHN A;  4CEW A;  2VCB A;  2Y6G A;  3W58 A;  2HWD 1;  1G6N A;  3OY8 B;  3ZYJ B;  3HOB A;  4CCN A;  4GAZ A;  2D6N A;  3KV6 A;  1O4Y A;  1X8M A;  4XOG A;  5C8C A;  2R0H A;  2WFP A;  1FAT A;  1JYT A;  3UJO A;  4IUG A;  4L0P A;  2DYC A;  3WNP A;  4UT5 A;  3D82 A;  5FMB A;  1JN2 P;  2VOT A;  2RM2 2;  5C7G A;  1TME 3;  2JKX A;  2IXH A;  1D0G A;  4MH0 E;  4YZ2 A;  2GNT A;  1UOG A;  3B9I A;  5EJZ B;  1AR6 1;  3VBF B;  1HRV 3;  1OC1 A;  3I2F A;  3OYW A;  1LGC A;  1R1A 1;  3VZM A;  2EIE A;  2MEV 3;  5ANN A;  3HBK A;  1ZBA 2;  3LEK A;  3ENR A;  4ES9 A;  4PQQ A;  1RTV A;  1CZV A;  1SHW B;  1DGL A;  5J09 A;  1GIC A;  1C5H A;  5IJR A;  3RZH A;  5C8C C;  1VBA 3;  4XTP A;  2G19 A;  1O4Z A;  2WL1 A;  3VBR A;  5GJ6 A;  5T52 A;  1JYI A;  1IKQ A;  2ZML A;  4DEQ A;  1M4W A;  4NVP A;  2HWC 1;  2PHW A;  1BEV 3;  1UW8 A;  2PN5 A;  1JBC A;  3RS6 A;  1XNC A;  2P17 A;  3ELN A;  3S5Q A;  5FP4 A;  2WJS A;  1FYU A;  2EAL A;  3FUQ A;  4YFW A;  4Z82 A;  1C4R A;  1SLI A;  2BV4 A;  2BW8 A;  1ND3 A;  2JDU A;  3ETP A;  4Y1U A;  4AEJ A;  3RZM A;  3E6C C;  3T09 A;  2QQM A;  4QXK A;  4BXS V;  1H30 A;  2GC1 A;  1UOF A;  2B4K A;  3W5N A;  2WA4 A;  3IDC B;  3MLJ A;  4TXW A;  1MAC A;  4AGG A;  4K1Z A;  4URT A;  2RJL A;  4GB3 2;  4CDU B;  3ZSK A;  2R6Q A;  3KV9 A;  3KHC A;  2CY6 A;  4IV1 B;  2IFR A;  4OMD A;  4YW7 A;  2ZAC A;  5FZ1 A;  5DMY A;  2XPJ A;  1UZ0 A;  2FCU A;  4YG0 A;  1C1L A;  4FPL A;  2K0G A;  4O9E A;  5FDB A;  4QDS A;  1HLC A;  1GZW A;  1UKR A;  2IC1 A;  3HN1 A;  4N43 A;  1BVP 1;  3NKT A;  4ASK A;  1YI9 A;  4KI5 M;  2DCK A;  3OGS A;  1CIW A;  2EXH A;  3ZR5 A;  5D8A B;  1BZW A;  1NE4 A;  2HBU A;  1K42 A;  3T3Y A;  5FZK A;  4PI0 A;  1BCX A;  4M00 A;  4DZG A;  1G9F A;  3T1L A;  5IK8 A;  5JPN B;  3KVA A;  3DPR A;  4OUL A;  3OJB A;  1Y9Q A;  3JBG 3;  4JRA A;  4M3C A;  2LS6 A;  1X9T A;  2PLV 3;  2IUW A;  3I2I A;  4BLI A;  1LOB A;  1ALY A;  3J9S A;  1YO8 A;  4CCK A;  5HV0 A;  4QT6 A;  1RUC 1;  2VD7 A;  3B9C A;  1PO1 1;  5DUX A;  1L7Q A;  1XBF A;  4HT1 T;  4XJ9 A;  4ARX A;  2W39 A;  5BNP A;  1DDL A;  3GHM A;  1VMH A;  4FAH A;  4DO0 A;  5FK7 A;  4MUV A;  4Q0S A;  1SAC A;  1EYB A;  5JXI A;  1BVV A;  1I6X A;  2D6L X;  3AKR A;  5H9Q A;  3KT1 A;  5EZW A;  1H8V A;  4JKM A;  2H6B A;  4FQZ A;  4QM9 A;  5G04 L;  1I1E A;  4FTE A;  3I8T A;  1D4V B;  4H55 A;  1G8W A;  4Q2F A;  3BB6 A;  1JHJ A;  4CXY A;  2WBK A;  2ZHL A;  2RG4 A;  3HQU A;  3VZL A;  1NZI A;  1LHU A;  2XQR A;  5LA0 A;  2WQZ C;  3OGJ A;  1RUH 2;  4QKB A;  2O14 A;  5FV3 A;  3BUC A;  2HYX A;  1KDK A;  4YSF A;  2VOW A;  3MUZ 1;  2DCZ A;  1UY3 A;  4CDX C;  5FQ0 A;  2OPW A;  3KQ4 B;  3K77 A;  1F4A A;  1C3H A;  3T08 A;  4IND A;  4AFD A;  4HPK A;  2ZHK A;  4IEX A;  3VHP A;  3WDU A;  4QX0 A;  4AI9 A;  4CCD A;  3VL9 A;  1DZR A;  2PTM A;  3SIS A;  1LOA A;  1C57 A;  2Q8E A;  3ES4 A;  4WVM B;  3VKF C;  3UNP A;  2GAL A;  5KR7 A;  3FHI B;  4RGK A;  2BBA A;  2E63 A;  1QGL A;  4WM7 B;  4AFB A;  1US2 A;  4JGZ C;  1CAX B;  3FBY A;  5F2W A;  4A7Z A;  3S57 A;  1H6Y A;  3LD8 A;  3KV4 A;  2DVG A;  3OEB A;  1R08 3;  1K12 A;  2VUC A;  4NUB A;  4Z07 A;  5C5T A;  3MEP A;  2HH9 A;  3PUR A;  2W3J A;  2A1X A;  5DDJ 1;  4YVS C;  2YGM A;  2C9A A;  4OVE A;  4IGO A;  4FCA A;  2UYA A;  4XF9 A;  4JKL A;  5F32 A;  1J1T A;  4C1W A;  3LF7 A;  2BNM A;  1KGY A;  2DVB A;  1W9W A;  3H3Z A;  4ZHN A;  4PI2 A;  1GOH A;  3DL3 A;  3ZFG B;  4IXL A;  1YQ2 A;  1VJ2 A;  3TOJ A;  3ZXD A;  1JU4 A;  1R1A 3;  2RDS A;  3NVC A;  3H1Y A;  2H6C A;  2C24 A;  4B8E A;  3N4M A;  3WNL A;  2AEZ A;  3W5M A;  4RS5 A;  1N47 A;  2QUO A;  4EWD A;  4NPR A;  3ITQ A;  5FZ9 A;  5A80 A;  3DXU A;  3WCR A;  1LGN A;  1VBA 1;  1UPS A;  1KJL A;  5FZF A;  2XJU A;  1AYN 1;  1LES A;  4GH4 B;  5FZ0 A;  4JAA A;  2ATF A;  3PU3 A;  3I49 A;  1YQ6 A;  4FXG B;  4Q4Y 1;  4S2F A;  3GHN A;  2PQS A;  4WM7 C;  4AHX A;  2CGN A;  3BTX A;  3WXP A;  2QNK A;  5K0U B;  2RDR A;  3I2J A;  1W0P A;  2J1A A;  4Y1Z A;  2B5H A;  2QQJ A;  4B4Q A;  4D7T A;  5T50 A;  1RB8 G;  3A22 A;  4FP3 A;  4GD4 A;  5JIU A;  4DXT A;  3CU7 A;  4JHT A;  1W8U A;  5JSR A;  3VKO A;  1LHN A;  4HLT A;  4RS5 C;  5B2G B;  5JOZ A;  1S1A A;  5A6Y A;  4Y33 A;  3VL8 A;  1ODN A;  1MZF A;  1W8H A;  1C8M 2;  2VJX A;  2XVL A;  3ZYH A;  2PFW A;  2ZX0 A;  4MVT A;  3D0S A;  4XUT A;  3VGI A;  3ST7 A;  3CJI C;  2XON A;  3UK9 A;  4EN0 A;  5FPV A;  4JC1 A;  3PVO A;  5FP3 A;  4FOY A;  1ULE A;  5BNO C;  5B4X A;  3M1H A;  1RUF 2;  3N7K A;  1UYZ A;  2P3I A;  4CRQ A;  3MUY 1;  2D98 A;  5J96 B;  1MS5 A;  1HJF A;  4LPL A;  3KT4 A;  1DGW X;  3O5S A;  2GN7 A;  2Y38 A;  3VLB B;  5LWB A;  1DLL A;  5BNN B;  4Q8L A;  1YFY A;  3R4S A;  1HRI 3;  1REE A;  1UU6 A;  5FP9 A;  4MGT A;  1STM A;  2JXA A;  1LKN A;  4JGY B;  3RQ0 A;  3VBH A;  2IXI A;  1OQE A;  2FMY A;  2J1T A;  2ADD A;  5FWJ A;  1PK6 A;  1EAH 1;  4K1Y A;  3GAL A;  3V0B A;  5IVV A;  4B3N A;  2XJP A;  1GKB A;  2X8K A;  2Y8K A;  1W6M A;  3GJA A;  2W0X A;  1GBG A;  1XNA A;  2R16 A;  4OQ9 A;  1TG7 A;  3VB9 A;  4WM8 A;  2XL7 A;  2IXK A;  2XB6 C;  2DUQ A;  5C3R A;  5GLU A;  4YM1 A;  1DCS A;  3BTA A;  1JS9 A;  4YG6 A;  2WNV C;  4LOS A;  5DQ0 A;  5JLV A;  4LO7 A;  1RHI 1;  4HXC A;  4D6S A;  2ZGL A;  1QU0 A;  2C5D A;  5LEK A;  5FZ4 A;  3OSD A;  4QKD A;  1SMV A;  4R9C A;  2YU2 A;  4RN5 A;  5A7S A;  4QGM A;  1HDK A;  1MZE A;  3T1M A;  3P5B A;  5FAX A;  1K5M A;  5EP9 A;  3USU A;  3RVH A;  1W04 A;  4AI8 A;  5A3N A;  5GZG A;  1LB2 A;  2YBK A;  5DG1 A;  3W20 A;  1DQ1 A;  3SCH A;  2JEM A;  4F8A A;  1DGR N;  3AFK A;  4BDV B;  2TBV A;  3D5O A;  1HV0 A;  3K46 A;  2XBO 3;  3Q8A A;  5D8A C;  4B1M A;  5FP8 A;  4KG8 A;  2AAC A;  5DAQ A;  1OPO A;  4Q4X 1;  4NN0 A;  2Q1F A;  3MBW A;  1OVP A;  1XXN A;  2QQL A;  3V56 A;  2JE8 A;  2ZAA A;  2O8Q A;  2RJ2 A;  1KXG A;  3H7J A;  4NII A;  1CX1 A;  5EXO A;  5JMC A;  1G9B A;  1JYN A;  4XMI A;  3AJY A;  1JXN A;  5T5J A;  1KEX A;  5DDJ 3;  4HKO A;  1AR9 3;  1W6O A;  5FLJ A;  3WP6 A;  1GYK A;  4MX3 A;  1PGW 1;  1J59 A;  4PDW B;  3RYR A;  1GZW B;  3NV4 A;  1UD1 A;  1VBD 2;  2A3X A;  1Y43 B;  3C7E A;  2XBO 2;  4FOQ A;  3E5U A;  4HK8 A;  4QGN A;  5T55 A;  5HPO A;  1DQ4 A;  1JZ6 A;  2OS2 A;  4XMA A;  4YW6 A;  2W1Q A;  1AYM 1;  4NRQ A;  3ECQ A;  3J4U H;  5BNP C;  2C1F A;  5LCW L;  1FX5 A;  1YJL A;  2BRT A;  3R4U A;  4XF1 A;  4QXC A;  5GZE A;  2UY9 A;  5JSP A;  4JQT A;  2F4P A;  2VUL A;  1EPZ A;  2WR9 A;  4Q5O A;  3O0V A;  1LNS A;  2VZO A;  3MF9 A;  4GWM A;  4KNC A;  3TRS B;  4JGY C;  4CDX B;  5F7U A;  3C7G A;  2KM2 A;  3M3O A;  4P14 A;  2WSU A;  4ORF A;  1CPN A;  1RUE 3;  4XQ4 A;  1HN0 A;  4B1L A;  2XVG A;  2L9L A;  1ST8 A;  4I01 A;  1VR3 A;  3UGG A;  3VBS B;  4ZU7 A;  2HWF 1;  3H50 A;  2BPA 2;  1NKG A;  3JD7 2;  1OQ1 A;  2C4X A;  5BNO A;  4MHR A;  4MGI E;  3WT3 A;  2BGP A;  3FLT A;  2G9Z A;  4H2A A;  1A78 A;  2EXI A;  4W65 A;  2A71 A;  2GH2 A;  2HWD 3;  4D0Q A;  2QJV A;  3VZJ A;  1PO1 3;  2VTF A;  1OLM A;  2AGS A;  1X7N A;  3C8X A;  1HRI 2;  3CF6 E;  3HQR A;  1TMF 3;  4FPG A;  4PLN A;  2GP5 A;  3K2O A;  5I0R A;  2WT0 A;  4Z1V A;  1ZA7 A;  3RZZ A;  1HB4 A;  4YVW C;  2QDR A;  4I09 A;  2DVA A;  2OXB A;  1RUE 2;  4XCA A;  4OCT A;  4LHN A;  2RMU 1;  4YGC A;  5DZG A;  4CTE A;  4XFB A;  5DAV A;  3ZXF A;  2RM2 3;  3CEW A;  2ERF A;  3L2Y A;  4XDQ A;  4AHZ A;  4LLO A;  2A3Y A;  5A6Q A;  1QY4 A;  1XQN A;  1QEX A;  3RZG A;  1VAM A;  2K46 A;  2GC0 A;  3NWK A;  3H9A A;  3E5X A;  1UZZ A;  4QKF A;  3ZOI A;  2VO5 A;  4OI1 A;  1QIQ A;  2VL4 A;  1EV1 3;  1ZBE 2;  3KCY A;  2Y26 A;  3PVN A;  1BBT 2;  3CBN A;  4UAP A;  4AQS A;  1RUI 2;  2VOK A;  1LJ7 A;  2HEV F;  3ZXL A;  5FYZ A;  1LU1 A;  2VBD A;  1W39 A;  2VOX A;  1ASJ 3;  1ULO A;  4PDW A;  1VP6 A;  3BPS A;  1C8N A;  4K20 A;  1Y7B A;  2GH8 A;  5KHK A;  1PO2 1;  5SV8 A;  2Q1Z B;  2RS5 2;  3J8F 3;  4R52 A;  3A0N A;  4QPG C;  4FP2 A;  5CNA A;  5IAX A;  5JUV A;  1C8M 1;  1GP6 A;  2X09 A;  2ETE A;  3ZPY A;  1CN1 A;  3GZA A;  3I3E A;  2X5I A;  5A7N A;  4AAP A;  2VC9 A;  2VCA A;  1V6J A;  2N7G A;  2NPI A;  5IVY A;  4YW4 A;  3LQC A;  1A8D A;  2VUJ A;  3WCS A;  5J37 A;  2W1W A;  2VU9 A;  4KBZ A;  2V73 A;  1YQC A;  2W94 A;  4XJA A;  4CXX A;  4K7J A;  1CON A;  4FAG A;  4PIX A;  3CJI B;  1S0I A;  3VZK A;  2A75 A;  2ZGK A;  2ZGM A;  4AR2 A;  2AR6 A;  1RVF 1;  5C3S A;  5I91 A;  1OH4 A;  3ZLI A;  1XND A;  1OUR A;  2D6O X;  4AI3 A;  3GZT B;  3HWJ A;  1AL2 3;  4XQD A;  1AR7 1;  2RR1 2;  1X33 A;  1XU2 A;  3VBS C;  1VB2 A;  3UYJ A;  1VB4 A;  5FY7 A;  4B7E A;  2VUA A;  2CV6 A;  4GMP 3;  1LU2 A;  1V6K A;  1PZ7 A;  2GAU A;  1CAU A;  1GP4 A;  1J84 A;  1EAH 2;  3NAP C;  1AVB A;  3FE5 A;  2W95 A;  5CYY A;  3UKT A;  1D2Q A;  2E33 A;  4QX7 A;  2ZHN A;  3ZPO A;  3UKN A;  4BB3 A;  4Q4Y 3;  2B7Y A;  2BP6 A;  4URA A;  1DGW A;  1DLC A;  4QU1 A;  4HVQ A;  5A3W A;  5KC6 A;  2P6C A;  2XJV A;  2YBP A;  4BMB A;  1JOD A;  5ISL A;  3I2G A;  3MHZ A;  4UW5 A;  4YM3 A;  2LUW A;  2B42 B;  1HXS 1;  2CNA A;  3THC A;  4TWT A;  4P9Y A;  3KSC A;  1IPK A;  4H7M A;  5C4W A;  1NE6 A;  2BJS A;  4ES8 A;  4UF0 A;  3OUJ A;  1Z78 A;  4EJR A;  2BER A;  4YVW A;  1QNY A;  1DYO A;  1R09 1;  4MZU A;  3HT2 A;  1D0H A;  1VBC 1;  2VVF A;  4HBN A;  3T0A A;  2QQV A;  3VD3 A;  3AKP A;  1SCR A;  3FFZ A;  1W99 A;  2IZW A;  1H2N A;  2EXK A;  3AXD A;  1CZT A;  3JBG 1;  4L99 A;  4NO4 A;  4CE8 A;  2Y6J A;  2XLG A;  3WNM A;  2WZ8 A;  3DEM A;  4PT6 A;  4YWA A;  3LDR A;  5FRA A;  1O3Q A;  4YNI A;  4IEO A;  4GJY A;  3BGA A;  4XIL A;  1VAL A;  4CXW A;  3OPT A;  1XSQ A;  3MIH A;  5A1L A;  3U1X A;  3MFC A;  3MLL A;  4DUV A;  2YY1 A;  5CAZ A;  3ZSJ A;  3RWN A;  3WSO A;  1LCL A;  1Q8S A;  4AQ6 A;  1SLA A;  3U4S A;  3O1T A;  4ZXE A;  3VDC A;  3WG3 A;  2ZGN A;  3IIA A;  2Q1M A;  1WMF A;  1YFW A;  3OUI A;  4I02 A;  3ZYG A;  3QCW A;  5EQU A;  4XBL A;  5KHG A;  1H1I A;  1VBC 2;  1O59 A;  1JMU B;  1AXY A;  5FPX A;  5EPA A;  4QU2 A;  2FZ1 A;  4Y1Y A;  2P3Y A;  5F2S A;  3WQ1 A;  4XC9 A;  2WNU A;  4AG4 A;  4IGP A;  2P4E A;  5GZD A;  4Q1P A;  1IG3 A;  2VMH A;  1RJ7 A;  1RMU 1;  2YZ4 A;  2ZGQ A;  2ZHM A;  3I3Q A;  4OI4 A;  1O3S A;  2FHR A;  2JJ6 A;  4FSJ A;  4LO6 B;  3U4X A;  4XBQ A;  3AP5 A;  3WEZ A;  1ENR A;  2GC2 A;  3GBW A;  4J1X A;  1VBB 2;  4AVT A;  2GNB A;  2IWG B;  4A7K A;  4PBO A;  1VAV A;  2X5I C;  3QAC A;  4YRD A;  3TNP B;  3I54 A;  1X36 A;  5I8Y A;  1EV1 2;  1FI2 A;  1ZBE 3;  3AVS A;  1POV 3;  5LA1 A;  4LKE A;  1N1Y A;  1YI7 A;  2WZR 3;  1WA6 X;  1R08 1;  1IS3 A;  5E1R A;  5LBC A;  2ZEY A;  3MLK A;  2ZEW A;  5LA9 A;  3O1U A;  4UYB A;  2DVF A;  4Y4R A;  4B29 A;  3E6B A;  4A44 A;  5BY5 A;  2JDM A;  3M7A A;  3KGL A;  1TME 2;  5F3C A;  3PIJ A;  1IS5 A;  5FY0 A;  2W9X A;  4CU7 A;  4PBP A;  4YVS B;  5LW9 A;  3TYJ A;  3WQ0 A;  1WCK A;  4EWA A;  3LEG A;  3GZU C;  1RVF 3;  3ACH A;  1V00 A;  4FPF A;  1NY7 1;  1I9R A;  3ZX7 A;  3DKW A;  2P3J A;  2MEV 2;  3RJ2 X;  2GSY A;  1FPN 3;  3JB8 A;  4S2H A;  5GZC A;  2GMP A;  1S4C A;  2A6V A;  2J1S A;  3AMQ A;  3I97 A;  1WUV A;  4RHV 2;  2Z2S B;  1VAK A;  3QOP A;  1YFX A;  5JWP A;  5FYU A;  4GMP 1;  1LAJ A;  1RUF 3;  4JKK A;  2W87 A;  4FTS A;  1DFQ A;  3P6B A;  4QQH A;  1SBD A;  3U0Z A;  5LY2 A;  2QKD A;  4NAO A;  1RUG 1;  1SPP A;  4E2G A;  3SLI A;  2VBB A;  3ZFE B;  2ILM A;  1PM7 A;  2DBI A;  2VAU A;  2PAE A;  4OHX A;  4LNV A;  1QJU 1;  4XEZ A;  2PHR A;  4L92 A;  1MEC 2;  1NCQ A;  3HVD A;  2NN8 A;  2XUE A;  5L9V A;  3BTY A;  1FPN 2;  4Y5Z 0;  3MZH A;  2YU1 A;  2OZ6 A;  4DS0 A;  3WF2 A;  1PMI A;  4Q4Y 2;  1R64 A;  4GWJ A;  3WP3 A;  4LIT A;  5C71 A;  1C28 A;  1OF3 A;  4LLF A;  3TN9 3;  1H6X A;  2PHX A;  1DGR A;  2P34 A;  3SMH A;  1ULP A;  3TBD A;  2RS1 3;  4CP9 B;  5KXD A;  3AX4 A;  1COV 2;  2NMN A;  1NQD A;  2WII B;  2HWD 2;  1QJY 1;  1QKQ A;  5HXV A;  3ZDS A;  4QPG A;  1RHI 3;  3OF1 A;  4FPK A;  2DTY A;  1H2M A;  4I3P A;  4LBQ B;  4D3W A;  3N7J A;  4XAB A;  5KHH A;  2XWB B;  4W6W A;  1NCR B;  4WM8 C;  5CFD A;  2HWB 1;  2JG8 C;  2Y6L A;  4Y4Y A;  2RV9 A;  2LM3 A;  3U75 A;  1W0N A;  1WCS A;  2WS9 3;  1HRI 1;  2HEW F;  4H3W A;  5FZ8 A;  5C3P A;  1QJU 2;  2VH9 A;  2JDP A;  4UI9 L;  4J1W A;  2VEC A;  2D3P A;  1WME A;  2VZV A;  1GWM A;  1AX2 A;  2RS1 2;  2E53 A;  4LOT A;  1K5M C;  3GCW A;  4Q4X 3;  1RUD 1;  3E6D A;  3MIB A;  4GA9 A;  1FT9 A;  4ISQ A;  4N9H A;  4BME A;  1NXM A;  4A41 A;  2V4A A;  1OFN A;  2VG9 A;  1CAW A;  1FOD 2;  3IT8 A;  3LPG A;  1HIX A;  3POG A;  4DY3 A;  4UOJ A;  5GZF A;  1ASJ 2;  4A7Y A;  1ZRE A;  1JI6 A;  1W3V A;  2DBN A;  4XUO A;  2AYH A;  2V5Y A;  3BYW A;  1GR3 A;  4OI0 A;  4WZF A;  1EUT A;  5FXZ A;  2VZQ A;  5EV7 A;  4YW1 A;  3WDY A;  3BIE A;  2KR2 A;  5JXJ A;  4FPE A;  1UYY A;  2WNV B;  4TSV A;  2J1E A;  1WW4 A;  2E26 A;  3PHM A;  4IE4 A;  2XR4 A;  1W2N A;  5FYS A;  1PO2 2;  5A3M A;  5IWF A;  2ZMN A;  4LR4 A;  1YWK A;  3B69 A;  3N35 A;  4LUL A;  1Q8Q A;  2WNO A;  1OD3 A;  2VQ0 A;  1W9F A;  3B94 A;  4TYS A;  3A21 A;  4KQ7 A;  4BQW A;  3AB0 A;  1GP5 A;  2XJT A;  4BQ3 A;  2R7E B;  5HCF A;  1WBL A;  2D93 A;  3GZE A;  1ZBE 1;  1BMV 1;  3NW4 A;  1POV 1;  4XUR A;  1AX1 A;  5FYY A;  2ZOE B;  3ZFF A;  1WLC A;  2H0V A;  2XG3 A;  3KHB A;  4JGZ B;  2QQW A;  4AW7 A;  4LBJ A;  1VBB 3;  2ZGO A;  4ATF A;  5C8C B;  1AX0 A;  1AZD A;  2EIC A;  3H8R A;  2QQP A;  1IQA A;  1ZM1 A;  2WS9 2;  1GUI A;  2HWF 3;  2JDH A;  3NNM A;  4GB3 1;  1GQG A;  3NAP A;  3LOI A;  4CP9 A;  5C4W B;  3CQO A;  2WSV A;  1O91 A;  3WF4 A;  3ZXG A;  3AP4 A;  2TUN A;  1SEF A;  4MXV A;  5A7P A;  4CU9 A;  1MS0 A;  5FTT C;  5JPM B;  2BTV C;  5L19 A;  3AKS A;  4D8M A;  2E7A A;  2IVI B;  4BU2 A;  4MSV A;  5TSW A;  5IAT A;  2UWB A;  2VNG A;  4EE2 A;  1NAE A;  4WM8 B;  4DFS A;  4HSL A;  1OA3 A;  2QQK A;  1UNB A;  1WW5 A;  3C7H A;  2ARB A;  2GNM A;  3NNJ A;  5IK4 A;  4CDU C;  5J1X A;  4XDP A;  5A32 A;  3JD7 1;  2HWF 2;  4BPZ A;  3J7H A;  4XFI A;  5BXX A;  5F6K A;  4BQX A;  1M06 G;  1O5U A;  2NLR A;  4JQR A;  1KQR A;  4COY A;  5A3L A;  3H8U A;  3MYX A;  1GWK A;  2O1Q A;  1ZZ8 A;  2W92 A;  3DV8 A;  5K0U C;  3AMP A;  4YZ1 A;  1JH5 A;  1COV 3;  1PGL 2;  1AYN 2;  1PMH X;  2J22 A;  3I7D A;  5HCB A;  5A3T A;  5T5P A;  1UWW A;  5FO7 B;  2VXJ A;  4BM8 A;  4XJZ A;  1OQD A;  5C4W C;  5HCH A;  2WQ4 A;  5APA A;  4GWI A;  1CAV A;  4LE4 A;  3TEY A;  4ZY9 A;  3O1O A;  4N9I A;  3N9N A;  3LAG A;  4NPM A;  4I30 A;  4DMI A;  4QB6 A;  4YG3 A;  3H7Y A;  2JDN A;  2BNO A;  4L11 A;  1MVE A;  1YCI A;  2RVA A;  4CYD A;  4D94 A;  1ZRI A;  5EYY A;  3VD5 A;  1C8M 3;  1DYP A;  3PIG A;  5FZB A;  4TLG A;  4NWW A;  2UYB A;  5DN2 A;  5A3P A;  2VQT A;  2VZR A;  3KB5 A;  4BWO A;  1US3 A;  2LAL A;  1IS6 A;  3R0R A;  5LY1 A;  2Q4S A;  3GBF A;  1UZW A;  4BOW A;  1BJQ A;  3QLQ A;  4WZC A;  1X9P A;  2GU9 A;  2YXS A;  4HKL A;  4IEW A;  3NRU A;  4JGZ A;  2R1D A;  4DRR A;  1GQH A;  3D6E A;  4COW A;  1ODM A;  2YC2 A;  3WG4 A;  5BNN C;  2FZ2 A;  5JOY A;  5H9R A;  3ABZ A;  1MS8 A;  4BZ4 A;  3N7M A;  4LBK A;  4OHZ A;  1O3T A;  3UT0 A;  2Y6H A;  4CDQ C;  3GGL A;  1QJX 1;  3LWC A;  3WDV A;  1ASJ 1;  4MET A;  4Y22 B;  2SBA A;  1RGS A;  1DU3 D;  3ZKY A;  3S0M A;  1PIV 3;  3CMG A;  3B3Q E;  3ZM8 A;  4IDZ A;  3WUC A;  4HFS A;  2XML A;  4CZS A;  1UXX X;  3AZY A;  3HJR A;  1SLC A;  1OA2 A;  4P02 B;  2P2K A;  4K8R B;  4Q0U A;  1W2U A;  4P08 A;  1PVC 1;  2OQ6 A;  1Q8V A;  1AR7 2;  2RR1 1;  2JB4 A;  5LB6 A;  1A34 A;  1MQT B;  2Q8C A;  2P5B A;  1UL9 A;  2D3R A;  3CZJ A;  4LK6 A;  1L3J A;  4YVS A;  4FFH A;  4HK9 A;  1G9C A;  2WZR 1;  2FDJ A;  3U10 A;  3VUO A;  1HB3 A;  1W2O A;  4L97 A;  2PHF A;  2MHF A;  1DIW A;  1QOS A;  3ASI A;  3OEA A;  3PUI A;  4Y26 A;  2WDB A;  5FZM A;  1JTZ X;  1R1A 2;  1V6I A;  4K9S A;  3HMY A;  2VW1 A;  4NIA A;  3K48 A;  3S30 A;  1N1S A;  5JR7 B;  2A70 A;  3IPV B;  3E5Q A;  2JD9 A;  3OG2 A;  2OUJ A;  4HET A;  3WQB A;  4DQA A;  1D7P M;  2BOI A;  3V0A A;  3ILF A;  1GZT A;  5FPA A;  3RI9 A;  2V72 A;  3VBO A;  4CEY A;  2GME A;  2VMD A;  1QDO A;  2JWP A;  1XNK A;  3OBT A;  4IV3 B;  4P5H A;  4JTO A;  1AR7 3;  2ZX1 A;  1JUI A;  1GOF A;  4XCB A;  4CDQ B;  4HMZ A;  1PGW 2;  1CAV B;  4JHZ A;  4IV1 A;  1SFP A;  4WM7 A;  4CUB A;  3HT1 A;  4O61 A;  1QNW A;  1OUS A;  2YC4 A;  2G9F A;  4W6X A;  3E97 A;  4XJ8 A;  4NRP A;  1NUK A;  2QZ3 A;  1QF3 A;  4KBB A;  2WAO A;  4LO8 A;  5CKM A;  1OLM E;  3MW3 A;  4NHK A;  2I45 A;  4O65 A;  3LEM A;  3ZSM A;  3ACG A;  4COV A;  2W68 A;  1JYC A;  1YLL A;  1YQ8 A;  4GKX A;  4D6R A;  1AR9 2;  1H4G A;  1U5Y A;  1S0F A;  3DPR B;  3OBR A;  4I0B A;  5FIX A;  3N9M A;  4Q0V A;  3T4H B;  1ENX A;  3WOG A;  4CUG A;  2XQX A;  2RS5 3;  3J8F 2;  1EUU A;  2Q0A A;  1CR7 A;  4L9B A;  3SNM A;  4QMA A;  2CL2 A;  1RUH 3;  1UY0 A;  3CDZ B;  4PIY A;  4YLZ A;  1T6G C;  5FR3 A;  5JCT A;  3WR0 A;  2WAA A;  1T6B X;  4L8Q A;  4RS5 B;  5ERL A;  1VBE 3;  4NHY A;  2EVX A;  2XKO A;  1GSL A;  1NG0 A;  3JB4 C;  4XQW A;  4COZ A;  3ZVX A;  2CSG A;  5BNP B;  3VDB A;  4XUQ A;  1FNZ A;  4M4P A;  2WN3 A;  3T2P A;  2EF6 A;  3L9J T;  2ZXQ A;  4UXA A;  1NT0 A;  3AP7 A;  4KU7 A;  1PGS A;  3RYP A;  1RXF A;  1UF2 C;  1WW6 A;  1WCD J;  3EHK A;  1WKY A;  4ONU A;  3WUD A;  1RMU 3;  3O0W A;  1FOD 1;  5BNO B;  4NID A;  2YRO A;  3M3C A;  4XZU G;  1UYP A;  1HQL A;  1NX9 A;  1Z0H A;  1POQ A;  3POJ A;  2JG8 A;  5LAS A;  4DEV A;  5A6X A;  4GH4 C;  1SFN A;  5D1I A;  1S55 A;  3PJQ A;  4MGQ A;  4CU8 A;  2FD8 A;  5IVE A;  1MS9 A;  3SKV A;  1ZBA 1;  2C6S A;  5FMO S;  5FZH A;  1FMD 1;  1LOE A;  3ZYR A;  5FY5 A;  4AVV A;  4LE3 A;  1KJR A;  1ND2 B;  1H9P A;  2YYO A;  5ABJ B;  3WNN A;  5LEJ A;  3A23 A;  3O1R A;  4W50 A;  5DAW A;  4MHU A;  4XIK A;  3BOW A;  1F15 A;  3AP9 A;  4IV3 A;  5IW0 A;  3ETQ A;  3C7F A;  3LZZ A;  1SQ4 A;  2JDA A;  2RHP A;  3C2U A;  3U14 A;  4C0B A;  4E27 A;  5AFE A;  2WUH A;  2X05 A;  1MR5 A;  4AEK A;  1ULD A;  4Z2W A;  2NP0 A;  4IV3 C;  3SEP A;  3LA2 A;  4TLF A;  1OT5 A;  3BIW E;  4XBN A;  4XW3 A;  1K3I A;  4YZ3 A;  1AF9 A;  1LR5 A;  4HON A;  5H9S A;  4DPN A;  5BNN A;  4XXA A;  5FXX A;  2FDF A;  2RJK A;  3AVR A;  2D6M A;  5GLZ A;  5I0D A;  1XNT A;  3Q8B A;  4EZH A;  3I3D A;  2XH6 A;  4NPL A;  2EXJ A;  4QX1 A;  2XJQ A;  1JU3 A;  4DUX A;  3EBR A;  2XLA A;  3JZV A;  4Y24 A;  4MYE A;  2HWC 3;  5CFD B;  3I59 A;  2F6B A;  2ZJC A;  2PAM A;  3TEZ A;  2VZP A;  4RGG A;  4P9W A;  3IMM A;  2XVK A;  2X5I B;  1PGL 1;  1ND2 C;  1RC6 A;  2JEC A;  2DV9 A;  1XYO A;  3LIH A;  3A4U A;  2NZ9 A;  4PCR A;  1CPM A;  3DXT A;  4PLM A;  2OZJ A;  3ILR A;  3R6S A;  3DYP A;  1UX6 A;  4QPI C;  1W8T A;  4MV2 A;  3KT7 A;  4OYU A;  1OXC A;  4QWN A;  1MEC 3;  2CTV A;  4IEV A;  1LRH A;  1LOD A;  4QQO A;  1MVQ A;  4RR3 A;  1RUO A;  2R06 2;  4E4D X;  4HN1 A;  5JI7 A;  5F1R A;  1U5X A;  2DUR A;  3ACF A;  3J7L A;  2DU1 A;  4XDO A;  1LGB A;  2J1R A;  2D7F A;  1ULC A;  1O5L A;  5FY9 A;  5EJ3 A;  3O1M A;  4LQR A;  1HJG A;  4UBG A;  2ARA A;  5DAP A;  4MXW B;  1QJF A;  2F4L A;  4ZKT B;  1NA1 B;  5FWE A;  3ZFF C;  1LUL A;  1OD5 A;  2PMW B;  1V9U 1;  3I3M A;  4Q26 A;  1POV 0;  2R0F A;  3NKG A;  5GLV A;  4N53 B;  1QXR A;  2R1B A;  3O14 A;  1QJX 2;  4AED A;  5LA2 A;  2Z42 A;  2ZAB A;  2E31 A;  4LBL A;  2WO7 A;  3U11 A;  1UY4 A;  3ZIW A;  4CDU A;  2VNR A;  1UOJ A;  1BYH A;  2P6H A;  3OPW A;  1YIP A;  2QCS B;  4A3Z A;  4DXS A;  3OGR A;  4RFT 0;  4LHL A;  1CGP A;  1IS4 A;  2D44 A;  2WS9 1;  4E4H A;  5I93 A;  3DYO A;  4XIO A;  2JD4 A;  2HLE A;  4JCK A;  4DOU A;  2BGO A;  1QJU 3;  3POE A;  2DUO A;  4XHB A;  5F5A A;  1DQ2 A;  2WFF 2;  3DUI A;  5I0S A;  5FUP A;  4NRO A;  3L2H A;  3LDB A;  1OOP B;  4QB1 A;  4CPB D;  4OQ8 A;  4QPI B;  2J42 A;  1S2E A;  2DTW A;  3I4I A;  4CU6 A;  2B46 X;  2XKP A;  4CCO A;  3AMN A;  4C91 A;  4PLO A;  5DUU A;  5JOW A;  3NNL A;  2V5D A;  3AYC A;  4TZD A;  1OUX A;  3M3Q A;  2Q5T A;  1D4M 2;  3S6P A;  2BOJ A;  1W6M B;  5K4L A;  1FMD 2;  5EYX A;  3T30 A;  4EZ4 A;  5CKQ A;  2FDI A;  4P9X A;  1ENS A;  4V1P A;  3AL5 A;  1KFU L;  1P8J A;  4R9B A;  3I59 B;  3AP6 A;  4KWL A;  1AR8 3;  1HN1 A;  3MW4 A;  3UL2 A;  3RG0 A;  4A6S A;  1APN A;  2K2S A;  2CDO A;  1BHG A;  3RFR A;  3WZ1 A;  1WLD A;  1LEC A;  1V9U 2;  5FYI A;  4HN0 A;  5IVC A;  2ZS6 B;  1WBF A;  4KH9 A;  1JUH A;  3TAY A;  3Q8F A;  1RUJ 2;  2MEV 1;  4LHK A;  4ZZ5 A;  1NCR C;  1IG0 A;  4IEQ A;  4LIU A;  4BQ4 A;  1W6Q A;  4LK7 A;  4C0H A;  3IZO A;  1PZ8 A;  1RYY A;  1DZT A;  1CES A;  2HWE 2;  3QBQ A;  4EQV A;  4E2S A;  2VPV A;  4MGS A;  1FMD 3;  3IN9 A;  3NMB A;  5I0U A;  3VDD A;  1QJX 3;  3R05 A;  1UKG A;  2WT2 A;  3ACI A;  1W6P B;  2CAU A;  1OFS A;  3MPP G;  3BU0 A;  4XAE A;  4Y1V A;  4SLI A;  1DF0 A;  2VE1 A;  3POS A;  3BOD A;  4KWU A;  4XJW A;  2MPF A;  5KXE A;  4AAX A;  5GLT A;  4WVM A;  4AVB A;  1JHN A;  2WNU B;  2ZX3 A;  3DPR C;  3EXU A;  3IBM A;  1ZX5 A;  3MPB A;  2W5F A;  4U36 A;  5CA6 A;  1Q8P A;  4Q4V 1;  2XJS A;  5J7M A;  1AR9 1;  2UY8 A;  4GAL A;  2YMZ A;  3OPZ A;  4DRV A;  4WBB A;  1NA1 C;  4ZU4 A;  3JCI A;  3ZN5 A;  1SLL A;  1WCU A;  4CDQ A;  3B02 A;  4IQP A;  2HWE 3;  4RA0 A;  4N53 C;  3NJX A;  2CGP A;  3HAG A;  4CDW C;  1SLB A;  5AVA A;  5AC9 3;  4QB2 A;  3WG1 A;  4WVW A;  2GDF A;  4PF1 A;  4HSJ A;  1F35 A;  3THD A;  1W28 A;  1QJY 2;  1GQP A;  2UWA A;  4KU8 A;  4MLO A;  1J58 A;  2OT7 A;  1G86 A;  3JD7 3;  5FRE A;  4A45 A;  5FYH A;  1QJZ A;  4CEY C;  5HBA A;  1UZY A;  2OUH A;  4NAM A;  4QPI A;  3O1V A;  1LEM A;  1PMJ X;  1KD7 A;  2QVS B;  4J6G A;  4R4X A;  3AM2 A;  4B4P A;  4Q27 A;  1QDC A;  2XUM A;  4NR1 A;  2GMM A;  3X29 B;  3GBG A;  4QKN A;  3U78 A;  2W08 A;  2GP3 A;  4GB3 3;  4EN6 B;  3SCF A;  4AHY A;  2HWC 2;  4XYX A;  4BK4 A;  1RUJ 3;  4Q4X 2;  2Y33 A;  4LJH A;  4HAN A;  4EYU A;  3ZO0 B;  5AC9 2;  4Q29 A;  5C9A B;  4WV8 A;  5A1A A;  2CDP A;  5FMC A;  3UGF A;  1X50 A;  4ZON A;  1RUC 3;  2RS1 1;  2VMI A;  2R49 A;  4G4F A;  1SBF A;  1VRH 3;  3UJQ A;  2OA2 A;  2AC1 A;  2JIG A;  3CJI A;  3OCP A;  3SH5 A;  5DG2 A;  3PNA A;  1JOP A;  1YQ5 A;  1YEW A;  4GKY A;  1CAW B;  4RD7 A;  1W6Q B;  3LEI A;  1AR6 2;  4OZO A;  4NHX A;  3AZV A;  3KQR A;  4XPV A;  1Q43 A;  1IKP A;  3ZYP A;  3ALQ A;  4CP0 A;  3WY6 A;  4Q8K A;  2CAV A;  2GC3 A;  3WP4 A;  1NY7 2;  2NQY A;  3LFM A;  3V0A B;  1HQN A;  1S0C A;  3MDP A;  3ZFE A;  4CPB A;  4HZF A;  5SV5 A;  1TQ5 A;  1URX A;  1U5Z A;  1WZX A;  3FMG A;  3DGT A;  3K4Z A;  1JZ8 A;  3WDX A;  1QXJ A;  4XTM A;  3KV5 A;  5FZI A;  5FXV A;  1NCQ B;  5IK7 A;  2DUP A;  3O7O A;  4AZZ A;  1N3O A;  4Q0P A;  5HXM A;  4AK3 A;  1EV1 1;  3EQE A;  3PUH A;  3RMX A;  3MW2 A;  2ARE A;  2YV8 A;  1OLQ A;  3CHX A;  4Y5T A;  2FDG A;  2BGC A;  3AC0 A;  1UX7 A;  1YC6 1;  2YFU A;  2JIC A;  2Z4F A;  1OPM A;  1QOO A;  2O8O A;  4YGD A;  3OBZ A;  2WIN B;  3IWZ A;  4FFI A;  4QGL A;  1E5I A;  4UF0 B;  1ND3 C;  1KS5 A;  4XFA A;  5C8W A;  1UXZ A;  2DCJ A;  3VKM A;  5FYM A;  3NJV A;  3K3N A;  4QPW A;  5IT6 A;  5FZ6 A;  4CDW B;  2ZGP A;  4HVO A;  2G1M A;  4MOA A;  5D8A A;  3H3U A;  4Z2A A;  2CHH A;  2C0Z A;  2ZKN A;  1GV9 A;  1UCX A;  1HV1 A;  1O8S A;  4BLJ A;  4DIQ A;  2GND A;  3P3P A;  3EJK A;  4OUS A;  1WW7 A;  4QX5 A;  2ARX A;  3C7O A;  4PIZ A;  2QE3 A;  4N7U A;  3MF6 A;  5J36 A;  2A7A A;  4N8M A;  3ZXJ A;  1I5Z A;  1ENQ A;  3HNM A;  1HB2 A;  3ZYF A;  2XLF A;  2BEO A;  4IW3 A;  4FOW A;  4QHO A;  3UET A;  2WZR 2;  5CVR A;  4QX3 A;  1Q8O A;  5LK7 B;  1ZYB A;  4XUN A;  1Y4W A;  1AL2 1;  2OVU A;  2UU8 A;  5FLH A;  3URF A;  3GF6 A;  2RS3 1;  1K5M B;  4S2D A;  4XZP A;  2JIJ A;  2VMF A;  5F8P A;  3BCW A;  5KBF A;  3DF0 A;  4L2N A;  3K3O A;  4TTG A;  1UY2 A;  3THP A;  1TNR A;  3NQH A;  2V4V A;  2PEL A;  1PO1 2;  1CVN A;  2JEN A;  5LRR A;  5L7O B;  1H8T B;  3D8C A;  1MZ6 A;  5FZG A;  4C90 A;  4LBO A;  3RSJ A;  4FQ4 A;  1FAY A;  2VCM A;  1PHM A;  2Y64 A;  4XHX A;  3ZYI B;  4ASM B;  2XDV A;  3FJS A;  4R4Z A;  1WGP A;  1NLR A;  1SFY A;  1VRB A;  3JUU A;  5ABJ A;  3VBU B;  1F31 A;  2VTX J;  1KRI A;  3MV1 1;  3WV6 A;  5FYV A;  1QOT A;  2D5H A;  1UYX A;  4Y5S A;  4BQ1 A;  1CIY A;  4I0W B;  2W46 A;  4EN9 B;  3WNX A;  2FBE A;  2WKK A;  4GWN A;  3INA A;  5E89 A;  5F5Q A;  1DYK A;  1RIT A;  2ARC A;  1VMJ A;  2PHU A;  4DB5 A;  1G9D A;  1NCQ C;  2DDU A;  4UFL A;  4F83 A;  1W8O A;  1NLQ A;  5GLW A;  5FO8 B;  2CWS A;  1TVG A;  3UES A;  2EIB A;  3B93 A;  3ON7 A;  4LBQ D;  4Q4W 1;  1N1T A;  4COU A;  1IGO A;  1XE8 A;  2ZGS A;  2RMU 2;  3GYD A;  4NWV A;  2ZA9 A;  4RL7 A;  5GM0 A;  1XJA A;  2OX0 A;  1RMU 2;  5DAB A;  4E4S A;  5BYN A;  4XET A;  2JDZ A;  1PIV 2;  2YFZ A;  4EN8 B;  5LBE A;  3OD0 A;  1V6L A;  4IE0 A;  5FPB A;  3EB7 A;  2ZBJ A;  3CNA A;  3CIH A;  4PJY A;  1Q56 A;  3KLS A;  4CDX A;  1H8T C;  1SZB A;  4CCM A;  4EWE A;  3SH3 A;  1NZC A;  5C6C A;  1KDM A;  1QQP 3;  3KWV A;  2WRA A;  4JDO A;  4CUC A;  3FX3 A;  4C1X A;  1RUH 1;  1WLW A;  4JV4 A;  4JDN A;  3ZYB A;  4CEW C;  4UFM A;  2BDR A;  5FZE A;  3NO8 A;  3OYW B;  3F95 A;  4XXP A;  3J7M A;  4OUM A;  1LOF C;  4LBN A;  1PVC 2;  2ORZ A;  4ATE A;  2WNU C;  4DNY A;  5JXH A;  1QWR A;  3KD4 A;  4HVR A;  1IPJ A;  1CQ9 A;  4W8J A;  3FC0 A;  5FBJ A;  5IVF A;  1VRH 2;  5EWS A;  4OLL A;  4KMQ A; 
#chains in the Genus database with same CATH homology
 4RN5 A;  3NRU A;  3CKH A;  4RYD A;  3IAQ A;  2YC2 A;  3FHA A;  4BK5 A;  3ABZ A;  5IFT A;  1JZ7 A;  2Y6H A;  2E32 A;  4BDV B;  4A4A A;  3GGL A;  3DYM A;  3K46 A;  4HG6 B;  3FL7 A;  1XC6 A;  3CMG A;  3ZM8 A;  3K75 B;  3MBW A;  2QQL A;  2J1V A;  2JE8 A;  1UXX X;  1WCQ A;  2RJ2 A;  2VQU A;  3HJR A;  4P02 B;  1CX1 A;  4P08 A;  1PX4 A;  1JYN A;  3GM8 A;  1KEX A;  3CZJ A;  5JXG A;  3OEA A;  3PUI A;  2WDB A;  2VZ1 A;  2WN2 A;  3C7E A;  3OG2 A;  2JD9 A;  5HPO A;  3WQB A;  4OMC A;  1D7P M;  3LE0 A;  2V72 A;  1JZ6 A;  2W1Q A;  3ECQ A;  5LCW L;  2VMD A;  2J1U A;  2QQI A;  3K4D A;  2B9V A;  4QAW A;  1GOF A;  2C9K A;  2OKX A;  2XOM A;  1LNS A;  2VZO A;  5F7U A;  4JHZ A;  1L7R A;  1MPX A;  2ZEX A;  2W1S A;  3FN9 A;  4CUB A;  3C7G A;  1OF4 A;  2YC4 A;  2VME A;  3IDA A;  3I3B A;  4XVH A;  1W9S A;  1NUK A;  1O8P A;  2L9L A;  2WAO A;  2VZU A;  1NKG A;  2C4X A;  5DPN A;  2YB7 A;  3VD9 A;  2BGP A;  3ACG A;  5C70 A;  4QDQ A;  4CVU A;  4DXR A;  2XQX A;  4E8D A;  5FUI A;  1EUU A;  4D0Q A;  2J7M A;  2VTF A;  3C8X A;  1UY0 A;  3CDZ B;  2WAA A;  4MO3 M;  5EJ1 B;  3F2Z A;  3VDB A;  4XUQ A;  4M4P A;  4W4Z A;  2WN3 A;  3NNG A;  3HNB M;  3T2P A;  2ZXQ A;  4E8C A;  2WO2 A;  3SKJ E;  1T2X A;  3T0D A;  2QQN A;  3D3A A;  1WKY A;  2VO5 A;  2VL4 A;  4GZ9 A;  2ORX A;  4UAP A;  4XZU G;  1NX9 A;  2ZEZ A;  3HPN A;  2VMC A;  4DEV A;  3E1F 1;  3IB3 A;  4MGQ A;  4CU8 A;  1ULO A;  3SKV A;  2QQO A;  3I2K A;  3WNN A;  5JUV A;  3A23 A;  4ARY A;  2X09 A;  4W50 A;  4M4R A;  2VR4 A;  3I3E A;  2VC9 A;  2VCA A;  2W1U A;  3C7F A;  3LQC A;  2JDA A;  5JR2 A;  2WUH A;  2W1W A;  2X05 A;  3SEP A;  2W94 A;  1OT5 A;  3FHQ A;  4ZZ8 A;  1CZS A;  1F4H A;  1K3I A;  3K4A A;  3JXS A;  1K45 A;  1OH4 A;  5I0D A;  1XNT A;  3I3D A;  3MV0 1;  4QX1 A;  1JU3 A;  4QDR A;  4DUX A;  3WF3 A;  2YG0 A;  4A6O A;  1J84 A;  5B4N A;  2VZP A;  3GXU A;  5CYY A;  3OGV A;  2W95 A;  2KD7 A;  2E33 A;  3DEC A;  1DLC A;  3I2H A;  2XHN A;  3DYP A;  2W47 A;  3I2G A;  2WO1 A;  2BZD A;  5G05 L;  4OYU A;  4BJ0 A;  4XUP A;  3THC A;  4FI9 A;  1UMH A;  4LKS A;  3ACF A;  4DUW A;  2J1R A;  2LW8 A;  4YPJ A;  4LQR A;  2BER A;  1DYO A;  5EIY B;  1JZ2 A;  1I5P A;  2VM9 A;  4QX2 A;  3EYP A;  3OB8 A;  3T0A A;  5LA2 A;  3VD3 A;  1W99 A;  2E31 A;  5IFP A;  1UY4 A;  2WQ8 A;  4A3Z A;  2QBX A;  4DXS A;  3OGR A;  1CZT A;  3DYO A;  2Y6J A;  2HLE A;  3WNM A;  2WZ8 A;  4PT6 A;  2BGO A;  4LHS A;  4JX0 A;  3BGA A;  4QB1 A;  2VCB A;  2Y6G A;  4MAD A;  4DUV A;  3HOB A;  4CU6 A;  3WSO A;  4IUG A;  3WF1 A;  4L0P A;  4ZXE A;  3WNP A;  3VDC A;  2V5D A;  3CZU A;  2VOT A;  5C7G A;  2JKX A;  5IYY A;  1JZ3 A;  1O59 A;  1JZ5 A;  3LPF A;  5EJZ B;  1UY1 A;  3I2F A;  4AG4 A;  1P8J A;  1HN1 A;  2EIE A;  2CDO A;  1BHG A;  3LEK A;  4PQQ A;  1CZV A;  1SHW B;  4ZZ5 A;  5IJR A;  3WEZ A;  2VCC A;  1RYY A;  3IAP A;  4DEQ A;  2WO3 A;  4MGS A;  5LA1 A;  3ACI A;  2ZEY A;  3U37 A;  2ZEW A;  5JMO A;  3ETP A;  4KWU A;  4OUE A;  4A44 A;  1UMI A;  4AAX A;  4P5Y A;  3T09 A;  2QQM A;  4BXS V;  1JYV A;  2W5F A;  2B4K A;  3W5N A;  2W9X A;  4TXW A;  4CU7 A;  3HN3 A;  3LEG A;  3ACH A;  5DMY A;  4OMD A;  3NJX A;  2W91 A;  1UZ0 A;  4QB2 A;  4PF1 A;  4QDS A;  3THD A;  2J1S A;  4KI5 M;  1XPW A;  2DCK A;  1GQP A;  2X10 A;  3OGS A;  3I97 A;  4A45 A;  4JKK A;  3T0B A;  2W87 A;  1K42 A;  1PMJ X;  3P6B A;  3VD4 A;  4CUA A;  2LS6 A;  3I2I A;  4BK4 A;  3GDB A;  1L7Q A;  5CZK A;  4ARX A;  5A1A A;  2CDP A;  3WF2 A;  2WZE A;  1R64 A;  4GWJ A;  3VDA A;  5C71 A;  1JZ4 A;  1OF3 A;  5JXI A;  1H6X A;  4JKM A;  5G04 L;  1ULP A;  1JHJ A;  3LEI A;  4OZO A;  2WBK A;  5LA0 A;  3P1I A;  2HYX A;  3MUZ 1;  1UY3 A;  3K77 A;  1F4A A;  3MO4 A;  2Y6L A;  3T08 A;  2RV9 A;  1W0N A;  3K4Z A;  1IQD C;  1GOG A;  3VD7 A;  1JZ8 A;  3III A;  4QX0 A;  4UI9 L;  5HXM A;  3UNP A;  2WYS A;  3PUH A;  2BBA A;  2VZV A;  2ID4 A;  1US2 A;  3AC0 A;  1SDD B;  1UX7 A;  2YFU A;  2WAB A;  2Z4F A;  1H6Y A;  3OEB A;  1K12 A;  4A41 A;  3BN6 A;  2W3J A;  3LPG A;  1W8N A;  4UOJ A;  1JI6 A;  4XUO A;  1UXZ A;  2DCJ A;  4JKL A;  1JYW A;  1KGY A;  3NJV A;  4QPW A;  1W9W A;  1EUT A;  1GOH A;  2VZQ A;  4MOA A;  1YQ2 A;  1JU4 A;  5JXJ A;  4Z2A A;  1UYY A;  2J1E A;  2E26 A;  1O8S A;  5IHR A;  3WNL A;  3W5M A;  3C7O A;  3HEI A;  1OD3 A;  3A21 A;  2VZT A;  3HNM A;  2R7E B;  1DP0 A;  3UET A;  3WNO A;  4QX3 A;  2PQS A;  4XUR A;  4XUN A;  3I2J A;  2J1A A;  2VMF A;  2Y6K A;  4TTG A;  2EIC A;  1UY2 A;  2QQJ A;  3NQH A;  3A22 A;  2V4V A;  1GUI A;  2VZS A;  4DXT A;  3CQO A;  3WF4 A;  1J83 A;  4CU9 A;  2Y64 A;  2VJX A;  4D8M A;  3T2Q A;  4XUT A;  3MV1 1;  1NAE A;  2XON A;  1UYX A;  2QQK A;  1CIY A;  2W46 A;  3C7H A;  4P00 B;  5B4X A;  5J1X A;  1UYZ A;  3WF0 A;  3MUY 1;  2DDU A;  3J7H A;  4LPL A;  3T2O A;  1W8O A;  1TVG A;  3UES A;  2EIB A;  3OBA A;  1GMM A;  3HNY M;  2W92 A;  1PMH X;  2J22 A;  2VZ3 A;  2YFZ A;  2J1T A;  1UWW A;  3EB7 A;  3CIH A;  1PX3 A;  4GWI A;  3SEE A;  4ZY9 A;  3WNK A;  2Y8K A;  1W9T A;  4QB6 A;  4CUC A;  1XNA A;  1TG7 A;  1GNY A;  2RVA A;  1GU3 A;  1SG3 A;  4A42 A;  3VD5 A;  2ORZ A;  3A7Q A;  4ET7 A;  5DN2 A;  5DQ0 A;  5JXH A;  2VQT A;  2VZR A;  2C26 A;  1US3 A;  4W8J A;  2EID A;  1JYX A;  4KMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...