3BN6A

Crystal structure of the c2 domain of bovine lactadherin at 1.67 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
CTEPLGLKDNTIPNKQITASSYYKTWGLSAFSWFPYYARLDNQGKFNAWTAQTNSASEWLQIDLGSQKRVTGIITQGARDFGHIQYVAAYRVAYGDDGVTWTEYKDPGASESKIFPGNMDNNSHKKNIFETPFQARFVRIQPVAWHNRITLRVELLGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of lactadherin C2 domain at 1.7A resolution with mutational and computational analyses of its membrane-binding motif.
pubmed doi rcsb
source organism Bos taurus
molecule tags Blood clotting, cell adhesion
molecule keywords Lactadherin
total genus 42
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3bn6A00
1UZ0A 4BXSV 3T0AA 1GUIA 4TTGA 1K45A 3C7EA 2EIEA 1JYXA 4A3ZA 2VQUA 3ACGA 4CVUA 3VD4A 2WO2A 2V72A 4A6OA 2W1SA 2WQ8A 2VO5A 5LA2A 4M4RA 4DUXA 1JYWA 4GWIA 2LS6A 3HNMA 1EUUA 4QX3A 1XPWA 2VQTA 2Y64A 5B4XA 3UESA 4KMQA 4BJ0A 4QDQA 4LKSA 2ORZA 2DDUA 2QQMA 3ACFA 4D0QA 2VJXA 2VCCA 1IQDC 1O8SA 4M4PA 1PMHX 4QB2A 2J7MA 2E26A 3VDCA 5JXHA 1UY4A 2VCBA 2J22A 3MV11 3HPNA 3NJXA 5DQ0A 5C7GA 1UX7A 1K42A 4JKKA 3ETPA 2J1AA 1O59A 1MPXA 2BGOA 3EYPA 4OMDA 2JDAA 2QQIA 4MOAA 3K4AA 1W8NA 1NX9A 4BDVB 1JZ3A 4PQQA 1PX4A 3I2IA 3OEAA 1XC6A 1OH4A 2EICA 2VM9A 3LEIA 2J1UA 1UYYA 2W1UA 2L9LA 2WO1A 2XONA 2VC9A 4OYUA 3MUZ1 4ZZ5A 3T0DA 3WQBA 3FL7A 2WZ8A 3ABZA 1W0NA 4IUGA 1BHGA 2W91A 3ECQA 2Y8KA 5C70A 4XUNA 5FUIA 3PUIA 3I2GA 4QAWA 2QQKA 4KWUA 4PT6A 1J84A 1L7QA 3I3EA 5DMYA 3I2FA 1YQ2A 2CDPA 3LEKA 3WF4A 4GZ9A 1JZ4A 3FHAA 2RVAA 4XUQA 3K77A 1W99A 4QDSA 2BBAA 3WNPA 2Y6GA 4CUBA 4E8DA 5IJRA 3OGSA 5JUVA 2WO3A 2VZRA 3AC0A 2V5DA 2WN3A 1HN1A 2VCAA 3THCA 4A45A 2VZVA 1OT5A 3T09A 2XHNA 2J1RA 5HXMA 2V4VA 2XQXA 4UAPA 5CYYA 4XURA 3DYMA 3THDA 2WZEA 1CZSA 3A22A 1KGYA 1NKGA 4UOJA 1UMIA 3C7HA 4XVHA 3GXUA 1W9WA 1JYVA 5DN2A 5EIYB 5LA0A 4QX2A 3WNKA 1TVGA 2VMCA 3I97A 1JZ6A 1JU4A 1ULPA 2VZSA 2QQJA 4QPWA 4DUWA 5EJ1B 2BERA 3WNLA 1OF4A 2E32A 2W1QA 3WNMA 3LEGA 2HYXA 3I2JA 3IAQA 4UI9L 4Z2AA 2DCKA 1NUKA 1XNAA 2ZEXA 2Z4FA 3HOBA 3A21A 5JXGA 1DLCA 2W5FA 2WABA 3IIIA 1CZVA 2QQOA 2VZUA 3VD3A 1UY2A 4CU9A 3LQCA 5C71A 4FI9A 1OF3A 4CUAA 2BZDA 2J1SA 3I3BA 3LE0A 5LA1A 3ZM8A 3CDZB 2X05A 3C7OA 2W3JA 1T2XA 5JXJA 3P1IA 3IAPA 3OGVA 1US3A 3CZJA 2WYSA 2ZEYA 2BGPA 1TG7A 3SEEA 4OZOA 4A44A 3HNYM 4TXWA 2C4XA 4LPLA 3I2KA 2VZ3A 4QB1A 3HJRA 2W87A 4RYDA 2YG0A 4DUVA 2DCJA 2J1VA 5A1AA 1F4AA 1UYXA 4CU7A 3T08A 1SHWB 2PQSA 3T2QA 4ZY9A 1W9SA 4DXSA 2C9KA 4P00B 5G05L 1JZ7A 3WF1A 2W9XA 2X09A 2EIDA 1JHJA 2RV9A 3P6BA 1XNTA 3E1F1 1RYYA 1R64A 4QB6A 1WCQA 3HN3A 3VD5A 4W4ZA 1GOFA 1CZTA 2WUHA 2VOTA 2WBKA 1O8PA 1PMJX 1UXZA 1GQPA 3JXSA 3A23A 5I0DA 3WNOA 3MV01 4D8MA 2Y6JA 3I3DA 3U37A 4QX0A 3BN6A 3HEIA 4RN5A 5IFPA 3WSOA 3GGLA 4ARYA 3ACIA 3WEZA 1L7RA 2WAAA 4JKLA 2XOMA 2VMDA 4LHSA 3MBWA 1P8JA 4BK4A 2W92A 3GM8A 4A41A 1JZ8A 1CX1A 5DPNA 1F4HA 2Y6HA 4DXTA 1PX3A 2WAOA 2W47A 4OUEA 3MO4A 3F2ZA 4OMCA 1K12A 4QX1A 5JXIA 2W46A 3K46A 2R7EB 1UY0A 3LPGA 4GWJA 3OEBA 4PF1A 1JI6A 2J1TA 1DP0A 1H6XA 4P02B 5IFTA 3EB7A 2Y6LA 5EJZB 3MUY1 2ZEZA 2LW8A 3IB3A 4A4AA 4E8CA 4CUCA 4QDRA 5B4NA 3CIHA 5LCWL 3NNGA 1KEXA 1UY3A 3W5NA 3CKHA 1W8OA 4ZXEA 1UMHA 3K4ZA 3VDBA 3OBAA 3NJVA 3DYPA 5CZKA 5JMOA 3DYOA 3J7HA 4DEQA 3WF0A 4HG6B 5G04L 4DXRA 2QBXA 4P08A 3W5MA 3LPFA 1H6YA 2YC4A 3D3AA 4ZZ8A 1K3IA 3OGRA 3OB8A 1JZ2A 3CQOA 3HNBM 2VR4A 2C26A 2OKXA 3NQHA 2W94A 1CIYA 1UXXX 2WN2A 2HLEA 1DYOA 3UNPA 3C7GA 1D7PM 4YPJA 3WNNA 1EUTA 3UETA 1SG3A 1SDDB 3DECA 5IHRA 2VZTA 2W1WA 1WKYA 2ZEWA 3PUHA 3FN9A 4W8JA 3VD9A 1NAEA 2VZQA 1I5PA 3I2HA 4MGSA 1US2A 3VDAA 4MO3M 2ZXQA 4XZUG 2WDBA 2QQNA 4MADA 5IYYA 1UYZA 2KD7A 3A7QA 2RJ2A 2J1EA 2X10A 3GDBA 3IDAA 1LNSA 1UWWA 1J83A 1GMMA 4XUPA 3T2OA 2E31A 4MGQA 2VMFA 5J1XA 4LQRA 4CU8A 2VL4A 3NRUA 2B9VA 2YFUA 3CZUA 2W95A 4A42A 3T2PA 4L0PA 5JR2A 3VD7A 3ACHA 1OD3A 4JKMA 3T0BA 3CMGA 2QQLA 1JZ5A 1UY1A 4P5YA 4KI5M 2YC2A 4CU6A 4ARXA 4W50A 2JKXA 4BK5A 2VZ1A 4AG4A 5F7UA 2VTFA 2VMEA 1GNYA 3OG2A 4DEVA 4JX0A 2YB7A 2JD9A 2JE8A 2ID4A 3FHQA 2YFZA 3C7FA 3K75B 3SEPA 3WF2A 2B4KA 2EIBA 3BGAA 2Y6KA 1W9TA 1ULOA 3SKVA 3SKJE 4JHZA 3K4DA 3C8XA 1JU3A 4ET7A 5HPOA 2VZPA 2ORXA 1JYNA 4AAXA 1GU3A 2E33A 4XUTA 1GOGA 4XUOA 2VZOA 3WF3A 1GOHA 2CDOA
chains in the Genus database with same CATH superfamily
1VAVA 4Q0SA 2OQ7A 5F37A 3JCIA 5K0UA 1EPWA 3PVOA 2ZX0A 4HK8A 4MSVA 4A7KA 1K45A 3C7EA 3NKTA 2WNUC 1IGOA 3M3OA 5F2WA 4A3ZA 4MGZE 4N7IA 4UW5A 2X53S 3ACGA 4CVUA 1DZRA 1MS9A 2ZBJA 2WO2A 3LF7A 3BTYA 3FJSA 2WQ8A 1AR83 2VO5A 5CAZA 4GWIA 2R1DA 5C5UA 4PLMA 4K20A 4LBNA 3ZVXA 3ILRA 5FP8A 5HCAA 1U5YA 1GZTA 3VZOA 5B4XA 1B09A 1VBE2 3S6PA 4CDWA 1W2TA 4XF9A 4KMQA 3BODA 2RS12 4BXFA 4TZDA 2DDUA 1SLCA 2QQMA 3Q8AA 2RMU3 3VBFA 4D0QA 4BM8A 4BZ4A 2A6WA 4N43A 4FPJA 3FLRA 4AF9A 5BNNB 1PMHX 2E26A 1UY4A 5FY4A 4CCJA 4Z92B 4ZHNA 3O0WA 2QQWA 3HPNA 3V0BB 5DZFA 2XJTA 1QJX1 2Q8OA 1OLRA 3ZX7A 5DQ0A 3MLJA 3SMHA 2CGPA 5C4WB 5FAXA 1MR5A 4LA3A 1STMA 1UX7A 2HWE3 1DFQA 3LOIA 4JKKA 1WCDJ 1ND2B 3VBOC 4AGVA 4IV3A 4QXKA 1RUI2 2GC0A 4AVVA 2V73A 4CUGA 3KQRA 4WVWA 2YYOA 3EYPA 1ODMA 2JDAA 4OMDA 5AC91 1HQWA 5IVYA 1NX9A 5FFOC 1LHOA 1UOBA 5DZGA 4BDVB 5KHKA 1GSLA 3IN9A 4IV1B 3RMXA 4CCDA 4QKDA 2EICA 2VM9A 1VMFA 4S2FA 2P1BA 1ZM1A 2OW4A 4HKWA 4W6YA 5KXEA 4FSJA 4QPGB 1W2NA 2PHRA 1VBE3 2WNEA 4OYUA 1BEV3 1ULCA 3AP6A 2IFRA 4AI2A 4FAHA 3MUZ1 4GKYA 4CCKA 3MIFA 1K5MC 1ZZCA 3JQWA 2PHFA 2WZR3 3KHCA 1PGL2 3VUOA 2WZR1 1H1MA 3WQBA 5CFCA 1KDKA 2NZ9A 3MW3A 4K8FA 4YZ4A 2R0FA 3GBWA 2YU1A 2WZ8A 5KR7A 5J98B 1BEV1 1FPN1 2R0HA 3B01A 4Y26A 4LNVA 2UYBA 3LDKA 5A32A 1J58A 1JOBA 3B69A 4JDOA 1FOD1 1S0FA 2BQPA 1JBCA 2Z5WA 1RXFA 3D0JA 4K6BA 2OS2A 2OZ6A 1H2LA 2FCVA 2HWB2 1COV1 4PT6A 3MIBA 3I3EA 3K3OA 3V65A 1H1AA 3MIHA 2Y34A 1VBA2 1QOSA 5AC93 3ASIA 3OPZA 5I91A 4MLOA 3W9AA 5L9BA 1UN1A 2P5BA 2BVVA 3WF4A 5EPAA 2C9AA 2XQRA 2UU8A 3OUJA 1PIV1 1W05A 1ENRA 2W68A 4RHV2 2W52A 1W8TA 3NJZA 5KBFA 3BU0A 2R061 2ATFA 3KGLA 3OBRA 4YZ1A 3K77A 3AMHA 3AM2A 2BBAA 2WS93 3OF1A 5F8PA 2JIJA 2Q8EA 3HR9A 4AVCA 3J4UH 2VBPA 1VAMA 3CLPA 4CUBA 3VL8A 2VZRA 3FWEA 5A7SA 1VBC2 4QHOA 5LW9A 4NIHA 1PVXA 1S4CA 3THCA 3H1WA 1R1A2 4CP9B 2IXIA 2VZVA 2Y26A 3GZTB 4YG0A 5FV3A 4OHZA 3RJ2X 3TRSB 3USUA 2ZHKA 1V70A 3DKQA 4W6XA 2J1RA 1GP6A 3DPRA 1CR7A 2FMYA 1VMJA 3MW4A 2MEV3 3OCPA 1SLLA 2ERFA 4BMBA 2P4EA 2XQXA 4JDNA 3KT1A 1CAWB 2A6ZA 4N9IA 4UAPA 5C8CC 2OXBA 1AR81 4XURA 1JUIA 3DYMA 5HI0A 2WZEA 4JV4A 5JCTA 1U5ZA 3A22A 1NKGA 3BPSA 3O7OA 4LBQD 1W9WA 1JYVA 4FO9A 1UZZA 3H3LA 1BBT2 4Q8LA 1MVQA 4R9CA 1F35A 1H8TC 2E6VA 1C3HA 2CAVA 1TZOA 3KCCA 4D7YA 4Q1PA 1RUNA 1XNDA 2WSUA 4PJYA 3LDRA 3POBA 1GYKA 2DUOA 3B00A 4WBBA 5I8TA 4ONUA 4SLIA 4GA9A 1IKQA 2VMHA 3WNMA 4MH0E 1KDMA 4MHRA 3QCWA 1B35C 1UO9A 3MF6A 1XYNA 1QJU2 2GZWA 2B45X 3HBZA 4AR2A 4EN7B 5A3PA 1SBFA 3J8F2 3MZHA 2JJ6A 3HOBA 1V9U3 3A21A 5C3RA 1D0HA 3DV8A 3NW4A 5FY8A 4DOUA 5JXGA 1CJDA 1DLCA 3HWJA 2WABA 1YFYA 5F5IA 1CZVA 2B42B 2QQOA 2VZUA 2XVLA 4FPCA 4GMP3 1Q56A 4IGQA 4JHTA 4Q27A 5I0TA 4NPMA 4ATEA 2D6KA 5CFCC 2GAUA 4CU9A 4BISA 3LQCA 5FYYA 5C3OA 3WG3A 5A3OA 4PIZA 2ILMA 1OF3A 3T3YA 1R1ZA 2BZDA 3I3BA 3VBRA 3LE0A 3M7AA 3LA3A 5CIRA 4LOSA 5LA1A 3PHMA 5FZOA 1AL23 3FMGA 2O14A 3FFQA 4IESA 2X05A 3ZFEB 2RR13 4DPNA 2LTNA 4E2GA 3VBSC 4XBLA 1T2XA 3P1IA 4ORFA 3RVHA 5CFDA 4LO4B 5L19A 2JICA 4PDWA 2Z69A 1AXYA 2ZEYA 5GZFA 3LZZA 4LBQB 4AXOA 1UZVA 2VGDA 4OZOA 1U12A 2D5HA 1WMEA 5CFCB 5L7OC 3MPPG 1EAH1 2A5ZA 1XNBA 3GF6A 5LRRA 1FATA 2D3SA 3ZYPA 3KV4A 5DG2A 4S2DA 5BNOC 3KGZA 4AAPA 5A1AA 1VBB3 2B9UA 1VB2A 4GWNA 1F15A 2PQSA 2AACA 4UFHA 4YVWA 2WIIB 5FY7A 5FZGA 4ZY9A 5ANQA 2R062 3AKPA 1RUI1 3OY8A 4RR3C 5E6HA 4MXWA 1LOCA 1YEWA 2VTXJ 2R043 3A0NA 5FPLA 4EE2A 1POV3 5IVJA 1JZ7A 2ZABA 3I59B 2XJRA 2H6CA 5E16A 1HRI2 4QU1A 1RVF2 1DHKB 1V00A 2LALA 2GMEA 1AR61 3E1F1 2BOJA 3WG2A 5AFBA 1Z78A 2XBO2 3ZIXA 3TNQA 3HN3A 3ZDSA 1S2BA 1G7YA 2WUHA 2VOTA 2WQ4A 2E63A 3O5SA 3KLSA 4NN0A 4YRDA 2BNOA 1PMJX 1GQPA 2RR11 2Y38A 4RR3B 5FZ7A 3JXSA 4N53B 1V6KA 4Z07A 4XJWA 4IV1A 1DLLA 4ASKA 3BOWA 2DV9A 1H4GA 1NLRA 4Q4W1 3D82A 2RM23 1B35A 3MYXA 3LSDA 4IEZA 1FPN2 4AEMA 4J1XA 2AEYA 4IV3B 3WSOA 4XEZA 3U11A 5A3NA 5E8AA 4AI3A 2WAAA 3UKTA 3TEZA 2Y0IA 4YW4A 3AVSA 1LHUA 1HKDA 3K2OA 1NE6A 4L8QA 2GNTA 3MBWA 1RUH1 5FZAA 2GMMA 1N3PA 2FBEA 1WW7A 4A41A 1PNFA 1VBD3 2KXLA 1JZ8A 1PVC3 3ZMOA 5DDJ1 2LROA 4LLFA 1PX3A 2YV8A 4Q2FA 3J8F1 3T1LA 4DXTA 1F8VA 5KHIA 2DVDA 2W2IA 1S0CA 5F5CA 1VP6A 5F2SA 1W2AX 2V5YA 2HEWF 1WA6X 4OMCA 2JG8C 3HVDA 1W6PA 5FLIA 4QX1A 3ZYGA 3J7MA 1LOFA 4META 4XFBA 1ZZ9A 2PXJA 1PIV2 5J3UA 3H8XA 1XU1A 2VMGA 4YW1A 4FQ4A 1X36A 4CP9A 1KFUL 1MQTB 4LJHA 2J1TA 1XYPA 4IEYA 5CADA 2I07B 4LITA 1DP0A 1VLNA 5FZHA 1HQLA 3ZN5A 4QT6A 2CV6A 1C28A 4WZCA 3MUY1 5EJZB 4CCCA 2A3XA 1U5IA 4E8CA 3IB3A 1XYOA 2MEV1 5FWEA 4MHUA 3TN92 2KM2A 1F5FA 1Y9MA 4RQPA 4NIGA 2P6HA 1QJY1 2CL2A 1E5IA 4ISRA 4K7JA 2A71A 1AXKA 4Q26A 4R9BA 4W65A 1ULDA 5BNPC 1TQ5A 1WW6A 2IXKA 3KV9A 4DZGA 1CAVA 1LOGA 1HW5A 4OLLA 3WNXA 5A1FA 1DBNA 2Q1MA 4TLFA 3WDVA 2GMPA 2VULA 5DZEA 1AL22 1C5HA 1HJFA 2OA2A 2UWCA 4ZXEA 4EN8B 2ZKNA 5DAPA 2XJSA 1F5JA 5C3SA 2TUNA 2DURA 1ONAA 4U36A 1G9FA 1CAXA 2R063 1QJFA 2HWC2 4IERA 1EY2A 3L2HA 4HG6B 2VXJA 3GCWA 3W5MA 3AYEA 3LPFA 1C4RA 1H6YA 2DVBA 4Q4X1 5A32B 3WVJA 1DQ1A 1BXHA 1M4WA 4UFJA 4FTBA 4BA6A 4L97A 1JOJA 1LCLA 3GHNA 3OGRA 3OB8A 3CQOA 3IDBB 3NO8A 3HNBM 5FP7A 1OUXA 4UW4A 3L2YA 4KQ7A 2VOWA 4Y22A 3RWKX 4RA0A 3NQHA 4EYUA 1TNFA 5FZKA 3H8UA 2CAUA 4XBQA 4IEXA 4AQSA 5GLZA 4OULA 2WT0A 4LORA 2VOXA 4FPYA 2WLPA 4ES9A 1VRBA 5L9RA 3AJYA 1AR73 2ZCWA 3C7GA 2QKDA 4R52A 1O3QA 5IT6A 1BBT3 1LB2A 2A6YA 1ZRFA 1V6NA 2EALA 3A0KA 3RYRA 1UZWA 3MPBA 3UETA 4UT5A 4BQ3A 4EJRA 2QZ2A 3PTRB 4YW5A 4FPLA 1R092 5FXWA 5IHRA 3PJQA 1UZYA 1ALYA 2TEPA 5JDBA 4XC9A 4EZHA 5DXDA 5C33A 4LKDA 1WKYA 2RS51 1W6NA 3FN9A 4LT5A 1EV11 5EWSA 4PBPA 1NAEA 5DABA 3ZPYA 1VBE1 1I5PA 2QZ3A 1BVVA 1QDOA 4QPIA 4AK3A 5F9TA 1ND3A 3I2HA 4XZPA 2A6XA 4MGSA 2ZOEB 1US2A 2DTWA 3AYCA 2PLV1 3VDAA 4XXAA 2ZXQA 4JQRA 4XZUG 1RVF3 2VG9A 2D3PA 1LENA 2WDBA 3G7DA 5F3IA 3WXPA 5IYYA 4FPFA 4LKFA 1QJU3 1WLCA 2J1EA 3NVCA 5FZ4A 2PYTA 5FYSA 4E4SA 2FDGA 1LNSA 4URTA 5F3EA 5FDBA 1X9PA 5A33B 4Q5OA 5BNNC 1RINA 3RI8A 4L9BA 3NV1A 4YWAA 3FZ3A 1OOPC 2BYVE 4IV3C 2VL4A 4Y33A 5L7OB 1NCRB 2YFUA 4IE0A 1NLSA 2D43A 2W95A 1WZXA 3MF9A 4FFHA 3H8RA 1QJX3 3ZSJA 3CU7A 3VD7A 1ZRCA 1RJ7A 1LU1A 4Y5TA 3ACHA 5EHDA 3T0BA 5HXVA 2WLQA 2QQLA 5A7WA 3VBSB 2RE9A 1JZ5A 2P6CA 4COZA 4FOYA 1UY1A 1QIQA 2AZ5A 4KI5M 4P5YA 4P9JA 4D6RA 3I4IA 1OLME 1LECA 4MX3A 5E88A 1DQ4A 1RMU2 4W50A 4WVZA 4XACA 2WFF1 5A80A 5T52A 3ZYJB 3POWA 4IV1C 3U14A 1N3OA 4LK7A 4CXWA 5FO9B 1GP5A 2YB7A 4IE5A 2JD9A 3D5OA 2IC1A 2HWD3 4CDUA 4O61A 3CJXA 1G9BA 2VBBA 1YQ5A 3O1VA 3WF2A 4OHXA 1NT0A 3KS7A 3FLPA 2A7AA 2W08A 3P3NA 3WHTA 5KC6A 1NA1B 5D8AB 1H2MA 2JE7A 4ET7A 5C8CB 1JU3A 4HANA 5IWFA 2OYZA 1BKZA 3APBA 1JYNA 3ZFFA 4KWLA 4XUTA 3WF3A 1GOGA 3E97A 4AAXA 1ZRDA 2CDOA 3IM0A 1PO22 2JENA 1OA3A 2WNVC 1UZ0A 4YW3A 3PVNA 3HQRA 3N35A 3HN1A 3OD4A 4D3WA 3VHRA 4Z1VA 2VBDA 3KCYA 1SZBA 3BI3A 4Q4V1 2XGXA 2EIEA 5FLHA 3ZN6B 1JYXA 2XJQA 4BQXA 1GQHA 2BGCA 3I59A 2K0GA 3PURA 2AR6A 2JX9A 1R082 4LBQA 5LA2A 5A70A 1E5HA 2VNRA 2LS6A 3ZXLA 2AEZA 1O5UA 1C8M1 2PLV3 1VRH1 1OMIA 2G19A 4M3CE 4V2WA 3RSJA 4QXCA 3BTAA 2C0ZA 3ACFA 2VUAA 2VJXA 1EV13 4AHZA 4JRAA 2RS53 3UGGA 1XNKA 2WO7A 3ZKYA 4EQVA 5F5QA 1XNCA 4M4PA 4NRQA 5APAA 1YJLA 2XL7A 2RS52 2VCBA 3SQOA 4Y22B 2V09A 1SCRA 4UFMA 2WNVB 4KG8A 3MV11 1QU0A 5FZDA 1BBT1 1ULFA 2K46A 2PFWA 1NCQA 1RUJ2 3B94A 1UU5A 5DG1A 5IK7A 1Y7BA 1FYUA 1W6MB 2J1AA 3BYWA 4HN1A 1OFNA 3WDTA 1MPXA 2A3YA 4GJYA 2LUWA 4HVOA 5A6YA 2D6OX 3HBKA 1OVSA 2DF7A 5ABJA 2WS92 3NNLA 4DY3A 3WW1A 4QQPA 4MVTA 4AFCA 3FUQA 2V4AA 5DAWA 4CEYC 1PX4A 1TME1 1XC6A 3I2IA 1OH4A 3OEAA 4XCBA 5FYUA 3LEIA 5K4LA 1BVP1 3U4SA 2YGMA 2WT2A 2Y33A 4COYA 1D2SA 1YC61 2JKBA 4IEVA 2ZMLA 4Q4X3 3VBOB 4PIYA 1RJ8A 4TN7A 1W0OA 5C9AA 1Y9QA 5BUVA 1RUG1 2XUMA 4AEKA 1ZBA2 4BQ5A 1H9WA 4OQ9A 3U1XA 1CAWA 2RMU2 5TSWA 1UYPA 2XXZA 4Q4Y3 4EV0A 5FZ8A 4Q29A 5E89A 3KT7A 5FZ0A 4Y4YA 1RITA 4N7UA 1NCRC 5T3NA 3WQ1A 4YVSA 2UURA 1BHGA 1SLBA 3SCHA 4LLOA 1O5LA 3ECQA 2Y8KA 3H3UA 2FDHA 3ZYIB 1RMU3 4XF1A 2Q8DA 1SLAA 2PA7A 2Y60A 3QH7A 1PGSA 5FMOL 5FUIA 2J42A 3N3HA 3ZFFC 5GLWA 5JSRA 1W6PB 2H0BA 3E5XA 3I2GA 3RFRA 3RZLA 5FJKA 5LY1A 1NLQA 4LBOA 4BMEA 2VNGA 5EFUA 5HCHA 1A34A 3LSEA 4R9DA 2VOVA 4EWAA 4NWVA 1WWYA 2DBIA 3WZ1A 2JECA 4LXLA 1SEFA 5K8SA 4IDZA 5JSPA 1YQCA 4M00A 3AFKA 1Y4WA 4LHKA 1LJ7A 5HV4A 1JZ4A 3RJRA 1MS3A 1POQA 4YM1A 1UOFA 2A73B 5DAQA 1MZFA 2CTVA 1LEMA 2PHDA 5FK7A 1SDWA 4QDSA 3WNPA 1XE8A 5FXXA 2Y6GA 1AYN3 2JG9B 5A7PA 3OGSA 4P9LA 4NPLA 1X33A 2GC1A 1GQGA 5LY2A 2CHHA 4QPIC 1GICA 3KB5A 2WN3A 3BPZA 3M3IA 4FTSA 1PO13 1MS0A 2GNDA 4RR3A 4DRRA 2ZACA 5I0SA 2ZX2A 4M0HA 3HIFA 2XHNA 3ZYFA 1BZWA 2QJVA 1JHNA 3JD73 2R1BA 4A6SA 2D93A 3PIGA 1AYM2 2E9QA 2V4VA 4H3WA 1LGBA 4RSUA 3O0XA 1HQNA 4QXHA 4TLGA 3THDA 1H2KA 1CPMA 3FUOA 1CZSA 3C3VA 2ZA9A 3ZYBA 4XVHA 4R4ZA 3SHRA 5EIYB 4QX2A 3ZFGA 4NRMA 1RUC1 1AR72 1W8ZA 1XU2A 2ZGOA 1ULPA 4QPGA 4WVMA 5T5PA 5ERLA 1VAKA 2QQJA 2P3IA 2WJSA 4QPWA 2GC3A 4XFCA 2CWMA 1LGCA 3CHXA 1EPZA 1WMXA 5FR3A 1PNGA 2JB4A 4M3CF 5A7QA 5T54A 2TNFA 5CA6A 3FFZA 2ZZQA 2A3WA 4BCUA 2W1QA 2ZGSA 3K51A 3LEGA 4LO5B 4Y1VA 2BUKA 2GN3A 4Y4RA 3VKMA 4BQ2A 5FPVA 4CYDA 4Q4W2 1OOPB 4UI9L 5BV6A 4Z2AA 4AVAA 3MIDA 2WNUA 1H4HA 2LM3A 4NIDA 3DL3A 5GKAC 3Q8FA 2WC2A 1DG6A 1IG0A 4OFGA 3VKNA 4AI8A 3L9JT 4K3UA 4XPVA 4CDUC 1S2EA 1ENQA 3PU8A 1OUSA 4CP1A 1RL3A 4KU7A 4AZZA 1N1VA 5C71A 3JB4C 2XUEA 5K0UC 2J1SA 3TOJA 3DXTA 5C3QA 4FPEA 4YYOA 1W0PA 3GJBA 2DVAA 1Q8PA 4YGDA 5LB6A 2AH2A 3CDZB 3C7OA 2HJIA 3EXUA 3ZXDA 3NL1A 1EAH3 1LULA 3E6BA 3FE5A 4N8MA 1X8EA 5L9VA 5JXJA 3IAPA 3KZ4C 4IGOA 5FYMA 3V0AB 1BYHA 3OGVA 4FXKB 5D2AA 3O1RA 2RS11 1QOTA 4AFAA 4CDWC 5ACA1 1O3RA 3GBFA 3M8LA 3RQ0A 2BGPA 1L7LA 5FOJB 1MZ6A 4P9WA 1TG7A 5C4WA 3SEEA 4MGYE 4TXWA 3VBFC 2OUJA 3RZJA 5JZGB 1PZ9A 1HXS2 1JYTA 4QB1A 4RGKA 1RUE2 5A7WB 4RYDA 2YG0A 4BLIA 2YU2A 4Y1ZA 5J96B 1O4YA 5KC5A 2JDZA 1QJX2 2DCJA 2P3KA 2WWUA 2J1VA 4NO4A 4XOGA 1F4AA 5JPNB 1UYXA 2IXLA 4CU7A 1APNA 2HWC1 3T08A 1SHWB 3IPVA 4XF4A 3UJOA 2ZGUA 3ZXKA 2B8MA 2K2SA 3O14A 4YVSB 1YLLA 2RDRA 3NWKA 3IBMA 4QMAA 3VKFC 3WLUA 1QF3A 2C9KA 4BQ1A 1MQTC 4R9AA 2ZGQA 2R073 5JR7B 1NYWA 3MLLA 3WF1A 1PVC2 3B9IA 2GH2A 1KJLA 4V1PA 3MHZA 2NMOA 1I3HA 1N47A 4IXLA 4XAAA 1JHJA 2RV9A 4XMIA 1JH5A 1W39A 2QE3A 1QEXA 2ADEA 3V56A 4FPOB 5CVRA 5I8YA 1GOFA 2FDJA 2DUQA 1NZIA 4FOQA 3EHKA 4D94A 2WBKA 1O8PA 3SCFA 1OLQA 3RZMA 2EAAA 2OVUA 4YVSC 3N9OA 3A23A 1NE4A 1XJAA 3BALA 1R093 4C8DA 2VCMA 5I0DA 1RUF1 2D6LX 3JUUA 3TEXA 1IS4A 1CESA 4XJUA 3ZIWA 1QDCA 4D8MA 3BUCA 4IW3A 3LA7A 1TMF2 3SH3A 3GZAA 3U37A 3AKSA 3GCXA 2YPDA 2HBTA 4ZU5A 2ARCA 3GGLA 2YDEA 4YSFA 3ACIA 3WEZA 2JDHA 1LESA 4QU2A 3DF0A 4JKLA 1HV1A 4AGRA 2XOMA 1OPMA 1YJKA 2VNVA 4LHSA 2ZGKA 1GZCA 1P8JA 1K5MA 2OZJA 1CX1A 1Q8VA 2Y6HA 4YFZA 2RG4A 2RR12 5F6KA 4KBBA 4PCRA 2O1QA 2WAOA 4CCMA 2W47A 3LDBA 2F6BA 2WA3A 4OUEA 4QQLA 3KF3A 3ZN6A 4AE2A 2ARBA 2PHLA 4RL7A 2ZGTA 1K12A 4D6SA 5JXIA 5HCFA 1LOEA 4I2OA 2UWBA 2VUJA 1CWPA 4R4XA 3ZFFB 1YYNA 1PIV3 4AI1A 1DQ5A 1LOAA 1GFF2 3JQXA 1OD5A 1JI6A 3OEBA 4K1YA 4B29A 3IT8A 3U78A 4YG3A 3GYDA 5FP9A 1I9RA 1YQ6A 1H6XA 4P02B 4DXZA 1ZZ6A 1O4TA 5BXXA 1OFSA 5JIAA 3C2UA 1S0DA 1GWLA 3RZKA 4BPZA 1OLMA 2GALA 1AYN2 4COVA 1FI2A 3PUAA 3WP3A 1VJ2A 1W6OB 1X8MA 3N36A 1R1A1 1QOOA 4QDRA 5JI9A 2H6BA 3RYPA 3O1SA 2A6VA 5L36A 2WKKA 1Y9GA 3CIHA 3NNGA 4IE4A 4CRQA 4CZSA 1FPN3 5F3CA 1YI7A 1OQDA 2ZGMA 1H8TA 1RHI1 3DXUA 4UFKA 2O8OA 1D4M1 4XE9A 1BMV2 1MVEA 2Y6FA 3HT1A 1HJGA 4C91A 3WUCA 4M3CB 4CXYA 2WZPP 1UMHA 2VUCA 3K4ZA 5CB7A 1HB4A 2C6SA 2F4PA 2C1FA 2WWJA 3ZSKA 2XB6C 3BIEA 3CBNA 1SFNA 2I45A 5CZKA 5JMOA 2YY1A 3J7NA 3KCXA 1HXS3 3J7HA 1WMDA 1MQTA 4PLNA 1BQPA 1RHI3 1I6XA 1VMHA 2MEV2 3WF0A 5G04L 1CJPA 2VVDA 4XDOA 2QBXA 3S5QA 4DXRA 3NKGA 4FQZA 2TBVA 4JTOA 2YC4A 1HX6A 2E51A 3D3AA 4ZZ8A 4NOTA 3JBG2 3WDUA 4FBFA 3LOBA 2GNBA 1A3KA 1R1A3 1K3IA 3FX3A 1ZZBA 4NAMA 2FDFA 2WINB 1NQJA 3GZEA 1DZQA 4GH4C 1REEA 1UKGA 3T30A 1J3RA 3Q8BA 1ZNPA 3ME2A 5A7OA 1V6IA 3V0BA 2FDIA 1VBD2 1SPPA 2XJVA 3J26N 4HKLA 4J6GA 1CIYA 1BK1A 3EBRA 3JB8A 3RZGA 1R081 2VECA 4BE3A 1D4VB 3J9SA 2WN2A 2HLEA 2XVKA 2ETEA 3KF5A 2OPKA 2HWE1 1C8M2 5BPXA 2VQAA 1B35B 3OGGA 2P34A 4BHPA 2BTVC 2NPIA 1GNZA 1I1EA 3OPTA 3DECA 3VBRC 2ZGLA 3LFIA 3POGA 3ZXEA 2C24A 5LBBA 4GKXA 2DU1A 5FBJA 4WM8A 2P3YA 5KHHA 1IPSA 5ABJB 4LOTA 2YGLA 1Q8SA 3ZFEC 3PUHA 3VD9A 2CNAA 1A6CA 4CPBD 3AL5A 3PMEA 1C57A 2JIGA 1VRH2 3Q8CA 4AFMA 4UYBA 3POSA 5EV7A 2P3JA 5C6CA 5K0UB 1YWKA 2W0XA 5BNQA 1QXPA 4I09A 4CCNA 3WDYA 2HWF1 1HRI3 4UXAA 1UAIA 5GLTA 4KGQA 3LGRA 4IEUA 1UYZA 4KWKA 5FZ1A 3TNPB 4XXPA 2VNOA 2WNOA 2X10A 3OUHA 4Q4Y2 5A1LA 1RUD1 2QQVA 1NCQC 1R091 2JDMA 2VTXA 3AB0A 4I3PA 3NMBA 4IE6A 1UWWA 4XUPA 3T2OA 1I5ZA 1XSQA 1YNAA 4HMZA 2VMFA 4LQRA 4ZS2A 4PDWC 3U4XA 4TWTA 2E53A 1XB9A 4LR4A 4A42A 1W8UA 5IVVA 1LR5A 1MEC1 5BNOB 2PELA 1WLWA 4I0BA 4DEQA 1PO12 2BNMA 5J7MA 4MZUA 1X82A 2QDNA 3CMGA 1UNBA 3I49A 3WW3A 4F8AA 2G9FA 5LBFA 4HSJA 2R071 2E7AA 3AJZA 3HMYA 3MIEA 1ZYBA 4G3YC 5FZ6A 4CU6A 4LUMA 4BK5A 5F7UA 3LAGA 2BRTA 1BJQA 4HVQA 3M1HA 3ZSLA 4FOVA 1JOPA 4DEVA 4E2SA 1F2NA 2JDKA 3S30A 2B7YA 2BV4A 1POV0 2UYAA 3H50A 4QKBA 3FHQA 1ZBA1 2YFZA 1W3VA 4XF0A 3I2OA 3AZXA 3SEPA 4C0HA 3CJIB 3TB0A 1NA1A 5D8AA 2WZR2 2EIBA 2DVFA 4XTPA 3ZXGA 4DY5A 1JW6A 2G1MA 2Y6KA 4HVRA 1ULOA 1C1FA 3K4DA 3V64A 1AYM3 4AEDA 2ZAHA 2VZPA 4ZS3A 2XH6A 4EWDA 2ORXA 2RS13 1GU3A 1KD7A 1KQRA 2RJKA 4XUOA 1YI9A 1E5SA 1MZ5A 4Q0QA 5FQ0A 3KVBA 1VALA 2HBUA 5FYTA 4BXSV 1GZWA 1DGWA 3N9QA 4TTGA 1VBC3 2NYYA 4AHWA 3TEYA 1Z0HA 1SPPB 2DBNA 3USSA 1W04A 2R32A 4KL1A 4A6OA 3VBSA 2W1SA 2QQUA 4M4RA 4BB3A 4JDMA 4L99A 4DUXA 3ZR5A 3ZXFA 1JYWA 4AYUA 3K3NA 1W6QA 3ZPOA 4RHV1 4XHXA 3FBMA 3NAPB 2ZX4A 4QX3A 1HRV1 1LOFC 1MZEA 2ZTNA 4KGGA 4YFWA 1X7NA 5FYCA 3KV6A 1AR92 5FP4A 4E9KA 4QDQA 3VHOA 5L7OA 2DVGA 1QQP3 2RHPA 2VW1A 4KU8A 4FXGB 2RS32 2B5HA 2VCCA 2NP0A 2J7MA 1V0AA 3AZVA 3OGJA 4JGYA 4GMP0 4L92A 3BTZA 5JZGA 2JG8A 5H9RA 3A4UA 3NJXA 2WT1A 5EZWA 3DPRB 2DFCA 4CPBA 2HWD2 1W28A 4YVWC 5C7GA 2YC0A 4FFGA 4QX7A 1RIRA 3OYWA 3UV9A 4HPKA 1K42A 4Y5Z0 3O1TA 4DB5A 4N9HA 3FHIB 4PLOA 2GP3A 5F5AA 1O59A 3EQEA 1NG0A 4LO7A 4YM0A 3IWZA 3M70A 4QX5A 4MOAA 3K4AA 4ISQA 1W8NA 5FRAA 4BQ4A 4JGZB 4PQQA 1RUC2 3AKQA 1W2UA 4I0AA 3ETQA 1UYYA 4YZ3A 5BNPA 1DF0A 2W1UA 1QJEA 4CDQB 2IFWA 3POEA 4QGNA 3VZKA 1NY71 1AL0G 3LD8A 1LOBA 2L9LA 1DGLA 2BEOA 2WO1A 2XONA 4INDA 2VC9A 3WG1A 2IWGB 4NJ4A 4XF3A 2DU0A 1NOVA 4C1WA 2ADDA 3KSCA 5LBCA 3AFGA 1J3PA 3KHBA 3BTXA 4WM7B 4EN0A 2GC2A 3ZO0B 2ENRA 3O1UA 3P5BA 3U0ZA 1QQP2 4CE8A 3SISA 5JOZA 2ZZJA 3LFMA 4HSLA 5CISA 1NA1C 2JE9A 5D8AC 1K5MB 4CCLA 2D44A 4RS5A 3FL7A 1HDKA 4RGGA 5IK5A 4PDWB 3KV5A 1OC1A 4GIQA 1DGRA 5IVEA 3JZVA 3ALQA 2MPFA 2W91A 4NHYA 2VD7A 3WQ0A 3R4UA 5C70A 2BFUL 1OA2A 2X5IB 4XUNA 2D6PA 1V6OA 4ZKTB 1ND3C 1FNYA 4EROA 1GV9A 3RPQA 2QQKA 3T2TA 4LO6B 3ZSEA 2WR9A 3NV4A 4FCAA 1JXNA 3VDDA 3RWNA 1L7QA 3AP4A 2ZAAA 4B4QA 4UF0A 1RUE1 5FY1A 4H2AA 3W59A 1YQ2A 3M4FA 5SV5A 4DO0A 1MS5A 3D6EA 3LEKA 4GB31 4YW6A 3WG4A 4CDQA 5F1RA 4EN9B 4GALA 4XUQA 4GD4A 1LKNA 2PMWB 4CCEA 5KWRA 2E7QA 3B5LB 1AR82 2XHKA 3WDWA 1PK6B 1W99A 1WCKA 2XVGA 3MGUA 4LK6A 3CNAA 1T6GC 4Y24A 2Q1FA 5JUVA 3ACLA 4KH9A 1WMFA 3DCQA 4LHLA 2EXHA 4HT1T 2JDNA 2VCAA 4JRLA 3I2DA 5JZGC 1OT5A 4XW3A 1JN2P 3T09A 3W21A 1HRV3 5HXMA 5JOXA 3KVAA 3ZLIA 1F9KA 2XLAA 1UF2C 4IL7A 5A3WA 2Q8CA 1TME3 1Q8OA 2R49A 4LE3A 3ZSMA 3AXEA 2Z42A 4XTMA 3B3QE 2KR2A 4AHXA 5BNNA 3RRDA 1KGYA 4UOJA 5C9AB 4N43B 1GZ9A 3O12A 3N9MA 1C8NA 2AC1A 3LA2A 3RMYA 3RDIA 1JU4A 2XBO1 1TMF1 3VN4A 2B46X 1W2OA 2VZSA 4H55A 3NAPA 2HYKA 2ZMNA 3MFCA 4PIXA 5FY0A 4B1MA 3JBG3 4Q0VA 1M06G 2JDUA 5IW0A 3BCWA 1WGPA 1AYM1 2HYXA 2ZHNA 1N1YA 3TYJA 4JC1A 3KM5A 4Y1XA 3UT0A 2FCUA 4GQ7A 4AQ6A 2XJPA 5GZEA 2B39A 3POJA 2DCKA 1NUKA 1OVPA 1XNAA 2ZEXA 5JOWA 2Z4FA 3PTYA 1L3JA 4HLTA 4AQTA 2PTMA 3CO2A 3S57A 1KFXL 1SFYA 2AREA 2AENA 2NN8A 5FYHA 2QDRA 1H1IA 1VRH3 5CG9A 3RZHA 4AVBA 1UY2A 1Z7S1 2QFEA 4LHNA 3QBQA 2WNVA 4Y3OA 4FI9A 5EYXA 1PZ8A 2O8QA 4IGPA 4CUAA 1VIWB 1PM4A 1W9YA 3TBDA 5A6XA 1AF9A 3M2MA 4HXCA 4H7MA 1ENXA 4AL9A 2XPJA 2GDFA 3ZM8A 2PAEA 4UFLA 2RJLA 2ZGNA 2R042 1W90A 2CWSA 3SCGA 3WP4A 3MIGA 4XIKA 3WX5A 1MEC3 5FPUA 2A75A 3R6SA 1UCXA 3CZJA 4FPHA 5JIUA 1ASJ3 2WYSA 1W03A 4WVMB 3WCRA 3GHMA 4FP3A 5T50A 4DFSA 3HNYM 3ZFGB 4OHVA 2CGNA 2ES3A 4DMIA 4OI4A 4LPLA 1U0AA 5I0UA 3SXWA 1JTZX 1FV3A 3WP5A 4BQWA 3IZOA 2O0OA 4P9XA 1IHMA 2W87A 4IEQA 5DUXA 1RUD3 2BPA2 3TN91 2FQPA 5LASA 4U2AA 4AFBA 1OOPA 2WYFA 5JOYA 1SBDA 1ZREA 2HWD1 4JCKA 3WUDA 1G8WA 2BW8A 5EXOA 2JXAA 3B7MA 5FK8A 4NRPA 4OVEA 4BWOA 4CCOA 1RHI2 4HOOA 4P9YA 3OUIA 4YLZA 4B4RA 4QHZA 1D4M2 4MXVA 1DQ0A 1RTVA 4QM8A 4Z2WA 1QH6A 4XDPA 4CDXC 3DN7A 3TN93 3CF6E 1IS6A 1V6MA 3FBYA 3QLQA 4QXBA 4P00B 5FYVA 5IK8A 1CVNA 5ABJC 4COUA 1XE7A 3MI8A 3BIWE 4MV2A 2JEMA 4FVVA 5FP3A 3VBHC 1J1TA 4E4ZA 2W9XA 1GR3A 3ES1A 2X09A 2EIDA 1SBEA 1BLZA 1DQ2A 3TAYA 3UKNA 3VBRB 1DU3D 4HPKB 1RYYA 1R64A 4LIUA 4QB6A 1PGW2 3VKOA 5B2GB 1HN0A 3RG0A 1WCQA 3AZWA 5CG8A 3VD5A 1RUH2 3LCPA 2QUOA 4QQOA 5FYIA 5FWJA 4DNYA 2MNGA 2D5FA 1UXZA 4KWJA 2W39A 1IPKA 3H42B 2GN7A 3SITA 1QY4A 1MS4A 2D98A 3H0OA 4JGZA 4X8NA 1N3QA 4A3XA 5GZGA 2WQZC 2Y6JA 3WHUA 5I93A 3AKRA 1QJU1 2DCTA 3I3DA 3TWIA 2MHFA 4D7TA 1H2NA 4OI0A 1YQ8A 1LHNA 2DYCA 3BN6A 3HEIA 4GH4B 4LBJA 1RVF1 4RN5A 1NCRA 1L7RA 3OYWB 2NMNA 2VMDA 3VHNA 3PMSA 4WM8C 5FZ3A 1RGSA 3IIAA 5FOBB 3AP7A 4HETA 4BU2A 1Q3EA 1OQ1A 1N1SA 2YXSA 4LUKA 4N43C 4JGYB 3WOGA 5HBAA 4YW2A 1FAYA 3MO4A 5CKQA 5LA9A 3I3MA 1YIFA 5FJHA 1QJY2 1IPJA 1D4M3 1S0BA 5IATA 4GB32 2W46A 3KWVA 1Z7S2 2D97A 1FX5A 1O6UA 4AI9A 3LPGA 4B7EA 5A3UA 1TMF3 2WL1A 1O91A 1KXGA 3IKWA 3IMNA 1UMZA 3H7JA 3VDDC 5BYNA 1GNHA 5DUUA 3ENRA 2PHXA 4HFSA 5D21A 5EYYA 3T4VA 4C1XA 3LKJA 5E1RA 5IFTA 2XR4A 5KHJA 2Y6LA 1CONA 2LW8A 4MGKE 4X8PA 2D6NA 2YHJA 4TYSA 2GU9A 1GZWB 2JDPA 4PQ9A 5B4NA 4RD7A 1UIKA 3VBOA 2CSGA 1KEXA 1NCQB 5FZLA 4A7YA 5JSOA 3KQ4B 4LTAA 4QPIB 5FY5A 4QPGC 3W5NA 2RM22 4FP2A 1W8OA 4P5HA 3ILFA 1S0EA 3NAPC 3E6CC 5GJ6A 2ZGRA 3VDDB 1A8DA 3NJVA 1W8WA 3DYPA 4FPKA 4Q1RA 5GLVA 4DRVA 1KJRA 3SH4A 4AOCA 2GH8A 3D4KA 3BU7A 2EF6A 3U75A 4P08A 4GB33 5DAXA 1QJY3 3TEWA 2YBKA 2VY0A 3EJKA 5C9AC 1RUE3 4LULA 4FPGA 3VGIA 3LWCA 4DS0A 1YXWA 5C5TA 2OKXA 1WCUA 2XLGA 3PL0A 1RUF3 1ST8A 1NXD1 3DEMA 3GALA 1YRZA 1DYPA 2BNNA 2OIIA 2CU5A 3NSTA 4WM7A 4Y1YA 1QKQA 3ROUA 4O9GA 4N53C 4IQPA 2KA3A 1PGW1 1IQAA 2BP6A 1PO21 1ULEA 3IMMA 4V2VA 1D0GA 3AXDA 1BEV2 4Q0UA 3U07A 3WV6A 5LEKA 1S1AA 2WRAA 1DYOA 4PHZA 1HRV2 4PI0A 2RDSA 1G6NA 3B02A 3CEWA 3WW2A 4Y5SA 3BOPA 5F3GA 4RFRB 3WNNA 2N7GA 4NPRA 1V9U2 5LRSA 4HBNA 4ES8A 5ISLA 1X50A 2RS31 1DGRN 3J8F3 3M3CA 1O7FA 2ZHMA 4SBVA 2HWB1 5DDJ3 4I30A 5C8WA 3SH5A 1LHWA 4C0BA 1TEIA 1QH7A 1VBD1 2R6QA 3IDEA 4LBKA 4LMFA 3LIGA 3E6DA 4W8JA 4S2GA 1FXZA 4ZXKA 4QGMA 4NHLA 1QJZA 5FO7B 2EXJA 1ND2A 1JS9A 5J37A 5ACA2 5IK4A 4MO3M 3LEMA 4E4HA 2QQNA 5I0RA 1AZDA 2GSYA 2JD4A 3AK0A 2E7TA 3HQXA 5C4WC 1K5JA 2D6MA 3POIA 3A7QA 1W3XA 2KD7A 3N9NA 4Q4W3 3AMQA 4O7XA 1J3QA 1QMJA 2VOKA 3GDBA 2XWBB 3R0RA 5C8CA 4IEOA 1PM7A 4WM8B 1WW4A 1LRHA 4RFT0 1GMMA 4H7LA 4YW7A 1RUJ1 2WFPA 5HCBA 2D7FA 1DGWX 5FPBA 3VBFB 1CPNA 5J1XA 1EV12 4MUVA 3NRUA 3VBHA 3AL6A 3H7YA 3DPRC 4HK9A 4NIAA 5A3MA 2C5DA 3T2PA 5FZCA 1AR63 5JR2A 3H8OA 1CD3G 4QX8A 4CP2A 4MGTA 1OD3A 3AMPA 4LBMA 1J1LA 1WBFA 1W8FA 4XFIA 2YC2A 3GJAA 5GZDA 3MEPA 2CGOA 2HEVF 1QQP1 3S7IA 2YROA 1H8TB 5F6LB 3OTFA 2VZ1A 1PMIA 1NY72 2VTFA 2VMEA 1H0BA 1QWRA 3MW2A 2BDRA 3OG2A 4XFHA 4CEYB 4C90A 1CIWA 4RHV3 1XXNA 1LHVA 3O1MA 4FFFA 4XQDA 5I8SA 1WA4A 2JE8A 2ID4A 2IVIB 3G6JB 4Q4X2 1EP0A 1VB4A 3WP6A 3VBHB 1CAUB 1GANA 5H9SA 1W06A 3ZYRA 5A3LA 3NV2A 1AHSA 1W9TA 5FYZA 2QQPA 3SKVA 2RDQA 4UW6A 3N7KA 3ZYHA 4F3JA 3AP9A 4M3CA 4YM3A 1J59A 4JHZA 2VVFA 1YFXA 1TNRA 1UKRA 1WLTA 4XJZA 2DFBA 5GALA 5HPOA 5J09A 3PIJA 2EXIA 4WM7C 3M3EA 2VZOA 4COWA 1GOHA 5J36A 1AJOA 1OKOA 3H1YA 3RNSA 3VKLA 3CL1A 1AJKA 3T0AA 1GUIA 1SLIA 2AUYA 4HONA 4MGIE 2G9GA 3Q8EA 1RUC3 1RUJ3 4NWWA 4QD2A 4DINB 2YUEA 3KMHA 4NMIA 5LBEA 5KXCA 5M0TA 1QXJA 2VQUA 3N7LA 4XQ4A 2VW0A 3NJYA 3VD4A 5A7NA 3N9PA 2V72A 3VBUA 1ZBA3 4URAA 2HEYF 5CFDC 1QXRA 1NZCA 5FZFA 1IZ3A 5BNOA 1ZA7A 3OY8B 1SLTA 3HNMA 1EUUA 3JD71 1XPWA 2VQTA 2Y64A 5LWBA 3UESA 2HH9A 4BJ0A 4LKSA 2ORZA 4OCTA 3WD5A 1ND2C 2PLV2 5T5OA 4AVTA 1V9U1 5IAVA 1RUOA 1PHMA 4BOWA 1GWKA 2X5IC 4Q0PA 2FZ2A 1UD1A 2H0VA 1IQDC 3URFA 4Q4V2 1O8SA 4DIQA 4QB2A 3ITQA 5T55A 2ARXA 2HWB3 5FXVA 3VDCA 5JXHA 3AMNA 2RS33 5ANNA 1AYN1 3JU9A 5JI7A 2ARAA 2J22A 2IZWA 5FTTC 1S0JA 1OPOA 1V6LA 1QGLA 1YIPA 3I8TA 1UQXA 5FLJA 1DIWA 1PO23 5CBLA 1SACA 3ETPA 3AMMA 2XG3A 4JTNA 4Z8BA 1SMVA 3I3QA 5LEJA 2BGOA 2YMZA 3VD3A 1HV0A 1C1LA 4YNIA 2ZMKA 4NR1A 4BLJA 2QQIA 5FZ9A 2DCYA 2JG9A 4QQ2A 5DUVA 1PGL1 1YFWA 1G9DA 1JZ3A 3GBGA 3LB9A 4YARA 4MG2A 4KG0A 4L2NA 1HRI1 2HWF3 2J1UA 5H9QA 2DCZA 4NE9A 3ZN4A 1KITA 4AW7A 2VH9A 3T1MA 1AR62 1RMU1 1CAVB 1AX2A 1OURA 4K21A 3W20A 1A8MA 2Z79A 3UYJA 5FZMA 4I3GA 5LATA 4ZZ5A 4Y1UA 1OH3A 3B9CA 5CEHA 4A7ZA 3AZYA 2OT7A 1E57A 3N7MA 3T0DA 2WS91 4NUBA 1JODA 2ET1A 1REDA 2P37A 4NIIA 4S2HA 1JYCA 2IXCA 3MICA 4AI0A 5FMBA 3ABZA 1UL9A 3V0AA 1W0NA 2EXKA 4IUGA 4JQTA 4Y20B 4Y20A 1AX0A 2R16A 3S0MA 2ZX1A 5IVFA 1R083 4NAOA 2IUWA 4GH4A 1N1TA 1UOGA 3IPVB 3ES4A 1Q5OA 3PUIA 4QWNA 5FBZA 3VL9A 3SC7X 4QAWA 1T6BX 2IXJA 4GXLA 4KWUA 3VLBB 1HB2A 1COV3 1RUG2 1J84A 1G86A 2VXRA 2BWCA 2DUPA 2X8KA 3H1MA 5DMYA 1IS3A 4N53A 3I2FA 5CKMA 4Q8KA 1LAJA 4WZFA 5FCCA 3ST7A 4D6QA 1FOD3 4QQHA 4XYXA 1AX1A 1SCSA 4LE4A 1HLCA 4GJZA 2FD8A 2CDPA 2QCSB 5LZ6A 4XMAA 4GZ9A 4RQPC 1FNZA 2HWF2 3FHAA 1EYBA 2RVAA 2CYFA 2ZS6B 3LIHA 3OD0A 4Z82A 5F32A 4XJ9A 4EZ4A 1OHFA 4UF0B 3WINE 1CX4A 1HXS1 1G9CA 2EA7A 1Q43A 3X29B 1WUVA 5D1IA 2VQ0A 4E8DA 5IJRA 1SFPA 1RXGA 2WO3A 3AVRA 4P9IA 2X5IA 3AC0A 2V5DA 4A45A 1HN1A 4LBLA 3ZDVA 3OPWA 2P2KA 4H14A 2EVXA 1GBGA 3GZUC 4YVWB 1WBLA 5A6ZA 1OQEA 1C8M3 2ZJCA 1O4ZA 2CY6A 5SV8A 1YFUA 2DWRA 3VZLA 1QNYA 4NVPA 3ZMNA 4I0WB 1PK6C 3UL2A 5CYYA 1QHDA 5J48A 3I54A 1PZ7A 4HN0A 4AEJA 4PF5A 4BQYA 1W8HA 3WT3A 3BKZA 1UMIA 3C7HA 3UGFA 3GXUA 4XCAA 2YZ4A 5DN2A 5LA0A 1D2QA 3WNKA 3EO6A 1TVGA 2VMCA 3I97A 3J7LA 4B7KA 1W9FA 1OI6A 1UU6A 3POFA 5T5JA 1JZ6A 5LK7B 1KS5A 4HZFA 4JAAA 2PHWA 2ZX3A 3WW4A 1KRIA 4WV8A 3DGTA 4GWMA 4OZXA 4MXWB 2YBSA 4YZ5A 4NHMA 4XIOA 2RDNA 5EJ1B 5FPAA 4DUWA 2UY8A 2BERA 1FV2A 3FLTA 3WNLA 1OF4A 2XJUA 4W6WA 5CFDB 5K7PA 1CGPA 4NHXA 4JGZC 1Y43B 2BVBA 2E32A 4RS5B 2EIGA 3OSDA 5FMCA 3I2JA 3W58A 3IAQA 2ZPXA 3WQ7A 4G9SB 1O3TA 1Y3TA 4D69A 1DQ6A 2NM1A 5FY9A 4G4FA 1VR3A 2WSVA 4XHBA 1YO8A 1WLDA 2RMU1 4YGBA 4FFIA 3CJIC 3QOPA 3WDXA 2W5FA 3IIIA 2VUDA 2G4IA 5JWPA 5GLUA 2FDKA 4IETA 3VBUC 2XDVA 5LK5A 1CN1A 3SNMA 2I74A 2PN5A 2XMLA 2IVJA 2JG8B 2PQQA 5JLVA 5K9YA 5IAXA 2FMDA 5FZIA 2WFF3 4F7ZA 1YCIA 4FT8A 2FHRA 3NNJA 4ASLA 1GP4A 4X6RB 1S0IA 1F31A 3O0VA 4YGCA 5FPZA 3VZMA 3ZFEA 2W3JA 4AEDC 2G9ZA 3H3ZA 4XETA 4B4PA 2FZ1A 2BBVA 4E2QA 4EWEA 1UU4A 4OHYA 5FIXA 4UWDA 4UBHA 3PVEA 1ASJ1 3AX4A 3QD6A 2D3RA 3EMRA 1AR91 1JMUB 2PAKA 1US3A 3I7DA 5EP9A 2VAUA 1IOAA 3FC0A 4HL0A 1DZTA 2NQYA 3K48A 4RGAA 3UGHA 4A44A 1IKPA 2C4XA 1XOYA 4QGLA 2AYHA 1VBB2 1DCSA 1ZBE2 3ZKUA 3I2KA 3ON7A 2VZ3A 3E5QA 3HJRA 1VBA1 4X6QB 4B8EA 4XAEA 5AVPA 4DUVA 2ZHLA 4ZU4A 5DUWA 2Y0OA 3THTA 1GKBA 1U5XA 1XE0A 1O3SA 2JG9C 1H9PA 4OUMA 1ZZ7A 5CNAA 4D7SA 1S0GA 5FUNA 5EJ3A 2GP5A 1Z7S3 2WA4A 5T5LA 3T2QA 2HWC3 5FO8B 1X9TA 4XDQA 4LIVA 1VPHA 1W9SA 1FT9A 1W6QB 3N4MA 1C5IA 1AUYA 4XJ8A 5FREA 4DXSA 5A33A 1OA4A 4NHKA 1NQDA 1RUF2 5G05L 5CKNA 1NXMA 1RB8G 1LODA 1XRUA 2QVSB 2ZKLA 1PK6A 1ENSA 5A6QA 2FCTA 3VHPA 3WCSA 4PI2A 3SLIA 4GAZA 3P6BA 3AP5A 1XNTA 2WFF2 2ZGPA 5IVCA 5ACA3 2DTYA 3JBG1 3IDCB 3AYDA 3NNFA 3GNEA 1AR71 3QH6A 5FYBA 1UIJA 1XQNA 4W4ZA 1CZTA 1VE0A 1OXCA 3USUB 5C3PA 4CEWC 2F17A 2XBO3 5JPMB 2WNUB 5DDJ2 1ULGA 5IUQA 3HQUA 2NLRA 4M01A 4K1ZA 1BCXA 1FMD3 3DKWA 3O1OA 4CDXB 3WNOA 3MV01 2Q30A 3F95A 4E4DX 3VZNA 1ZBE3 3B93A 1HIXA 5L73A 3RGBA 3HAGA 4J25A 2K9ZA 4QKNA 3PLQA 2P17A 4AGGA 4QX0A 4ASMB 3AYAA 2JB8A 3NV3A 4AFDA 4DQAA 5IFPA 3RI9A 1YHFA 4I01A 4ARYA 2A1XA 5GZCA 1DDLA 2Q0AA 1QNWA 1MS8A 4FAGA 4BK4A 2W92A 4XFGA 3GM8A 4CA9A 4CDQC 3MDPA 5DPNA 1F4HA 4NROA 4CEWB 1S2KA 2OPWA 3PU3A 4ZU7A 2QTWB 1ZX5A 2XKOA 1FMD2 4RS5C 3F2ZA 5FXZA 5FPXA 3Q9OA 2IXHA 2LRPA 3WY6A 4XFFA 3OJBA 5KXDA 3RS6A 2AGSA 1BK0A 1E5RA 3QACA 2OX0A 3K46A 4QHBA 4K8RB 2R7EB 4AWDA 4BIFA 4P9GA 1UY0A 3P3PA 4GWJA 5IVBA 5HV0A 5BNPB 4PF1A 2BU9A 4N90A 5FKCA 3MFAA 1LEDA 4XQWA 3PJYA 1RUD2 4K40A 3VBUB 4JGYC 3U10A 3EB7A 4UBGA 1YUDA 5FZBA 5FKBA 2ZEZA 3ILNA 3N9LA 3ZR6A 1RC6A 4A4AA 2Q5TA 2X29A 2SLIA 4CUCA 1ACCA 1ASJ2 3E5UA 4QPYA 2R30A 2XLFA 1MEC2 5KHGA 4AVSA 4A2UA 1URXA 4O65A 5LCWL 4RQPB 1PO11 1OKQA 3RZZA 3M3QA 5DAVA 1EAH2 1UY3A 3CKHA 4E27A 1H8VA 2R072 4KBZA 5GM0A 3MLKA 4XFAA 1IS5A 2JWPA 4F83A 5AC92 3VDBA 3HT2A 3OBAA 1DYKA 5AVAA 3DYOA 5FUPA 1TME2 1PVC1 1UPIA 2VE1A 2VW2A 4QM9A 3H9AA 4ZONA 5FMOS 2I2SA 4LEJA 3T4HB 1V6JA 5KXBA 4JZRA 1RUH3 3OBTA 4L11A 4TSVA 4XABA 3INAA 3O1PA 4I02A 1IG3A 4M0NA 2JDYA 3ELNA 1GWMA 4HKOA 4CTEA 4CEYA 1CQ9A 4XILA 3R4DB 1JZ2A 1WCSA 3KT4A 3N7JA 5F39A 2VR4A 2RM21 2UY9A 4PBOA 4OI1A 5CU1A 1A78A 1LTEA 1G9AA 2C26A 2EAKA 4BYYA 3HD8B 4BH9A 4MYEA 2W94A 3ZXAC 5AFEA 3VB9A 1UXXX 3PNAA 2PHTA 1ODNA 4QKFA 2PAMA 3ZXJA 3R05A 3S7EA 2VVEA 1JUHA 1XBFA 5FQ0B 3NNMA 3THPA 3UK9A 1HB3A 1WD4A 5A3TA 3UNPA 4OQ8A 1XSRA 3JD72 1SQ4A 4IEPA 1D7PM 4CDWB 1OBNA 1FOD2 1W6NB 3PVBB 4AQ2A 4ZPIA 4YPJA 1TE1B 1EUTA 3VZJA 4Q4Y1 1SG3A 1SDDB 1REFA 3OOXA 3RYKA 4ATFA 4CXXA 2UWAA 2W1WA 2VZTA 4OHWA 1COV2 1RUG3 3PUQA 4J1WA 3UKVA 3VV1A 5JVVA 3CJIA 1POV1 3S5AA 2ZEWA 2YPJA 1OSGA 2R041 2WWSA 3R4SA 4FTEA 5JAXA 2VZQA 4CSWA 1W6MA 4UFIA 1UX6A 2BOIA 1RUI3 3PUSA 2SBAA 1ZVFA 1ZZ8A 1UPSA 4B3NA 1Q8QA 2XL9A 4CP0A 2OUHA 4IE7A 1ZRRA 4FOWA 4LKEA 4MADA 4OUSA 1ND3B 2HWE2 3ATGA 5H9PA 1VBB1 1W6OA 4K9SA 1KS4A 1ZBE1 4AEDB 2RJ2A 4XBNA 2HKXA 3ZOIA 3IDAA 1GLHA 3D0SA 1FMD1 5BY5A 2VU9A 4O9EA 4ITCA 2BFUS 1J83A 3BB6A 2E31A 1VBC1 4MGQA 4LA2A 4JVAA 4CU8A 1MACA 2XKPA 3KD4A 2Q4SA 2B9VA 3DUIA 1MS1A 3CZUA 4IEWA 1AVBA 3POYA 4L0PA 1LU2A 1CAXB 2BJSA 1AXZA 4JKMA 4CDXA 1UOJA 4BIOA 4YZ2A 1S55A 3UJQA 3WR0A 5JMCA 4XJAA 1UW8A 2VMIA 1BMV1 3D8CA 4WVVA 1AL21 4R8HA 4CEWA 3ZFGC 4AHYA 4GULA 4ARXA 5FMDA 2JKXA 3BVCA 4AG4A 2PHUA 4OI2A 1GNYA 3AZZA 4JX0A 2Z2SB 4GMP1 1HB1A 5FZEA 2YBPA 3C7FA 3K75B 4EN6B 2A70A 1ZRIA 3PDQA 2OQ6A 4YM2A 1VBA3 1H30A 2B4KA 2XWJB 3BGAA 1LGNA 1JYIA 1WD3A 2ET7A 4UW3A 4KNCA 5FZOB 1WW5A 5EQUA 4Q4V3 4B1LA 4YGEA 4YG6A 3SKJE 2VPVA 3ORJA 4P14A 2QNKA 1ZA4A 3C8XA 1CAUA 3AKTA 2GNMA 2Q1ZB 4LO8A 2D40A 2BWAA 4CDUB 3OBZA 1AR93 2E33A 2F4LA
chains in the Genus database with same CATH topology
1UZ0A 4BXSV 3T0AA 1GUIA 4TTGA 1K45A 3C7EA 2EIEA 1JYXA 4A3ZA 2VQUA 3ACGA 4CVUA 3VD4A 2WO2A 2V72A 4A6OA 2W1SA 2WQ8A 2VO5A 5LA2A 4M4RA 4DUXA 1JYWA 4GWIA 2LS6A 3HNMA 1EUUA 4QX3A 1XPWA 2VQTA 2Y64A 5B4XA 3UESA 4KMQA 4BJ0A 4QDQA 4LKSA 2ORZA 2DDUA 2QQMA 3ACFA 4D0QA 2VJXA 2VCCA 1IQDC 1O8SA 4M4PA 1PMHX 4QB2A 2J7MA 2E26A 3VDCA 5JXHA 1UY4A 2VCBA 2J22A 3MV11 3HPNA 3NJXA 5DQ0A 5C7GA 1UX7A 1K42A 4JKKA 3ETPA 2J1AA 1O59A 1MPXA 2BGOA 3EYPA 4OMDA 2JDAA 2QQIA 4MOAA 3K4AA 1W8NA 1NX9A 4BDVB 1JZ3A 4PQQA 1PX4A 3I2IA 3OEAA 1XC6A 1OH4A 2EICA 2VM9A 3LEIA 2J1UA 1UYYA 2W1UA 2L9LA 2WO1A 2XONA 2VC9A 4OYUA 3MUZ1 4ZZ5A 3T0DA 3WQBA 3FL7A 2WZ8A 3ABZA 1W0NA 4IUGA 1BHGA 2W91A 3ECQA 2Y8KA 5C70A 4XUNA 5FUIA 3PUIA 3I2GA 4QAWA 2QQKA 4KWUA 4PT6A 1J84A 1L7QA 3I3EA 5DMYA 3I2FA 1YQ2A 2CDPA 3LEKA 3WF4A 4GZ9A 1JZ4A 3FHAA 2RVAA 4XUQA 3K77A 1W99A 4QDSA 2BBAA 3WNPA 2Y6GA 4CUBA 4E8DA 5IJRA 3OGSA 5JUVA 2WO3A 2VZRA 3AC0A 2V5DA 2WN3A 1HN1A 2VCAA 3THCA 4A45A 2VZVA 1OT5A 3T09A 2XHNA 2J1RA 5HXMA 2V4VA 2XQXA 4UAPA 5CYYA 4XURA 3DYMA 3THDA 2WZEA 1CZSA 3A22A 1KGYA 1NKGA 4UOJA 1UMIA 3C7HA 4XVHA 3GXUA 1W9WA 1JYVA 5DN2A 5EIYB 5LA0A 4QX2A 3WNKA 1TVGA 2VMCA 3I97A 1JZ6A 1JU4A 1ULPA 2VZSA 2QQJA 4QPWA 4DUWA 5EJ1B 2BERA 3WNLA 1OF4A 2E32A 2W1QA 3WNMA 3LEGA 2HYXA 3I2JA 3IAQA 4UI9L 4Z2AA 2DCKA 1NUKA 1XNAA 2ZEXA 2Z4FA 3HOBA 3A21A 5JXGA 1DLCA 2W5FA 2WABA 3IIIA 1CZVA 2QQOA 2VZUA 3VD3A 1UY2A 4CU9A 3LQCA 5C71A 4FI9A 1OF3A 4CUAA 2BZDA 2J1SA 3I3BA 3LE0A 5LA1A 3ZM8A 3CDZB 2X05A 3C7OA 2W3JA 1T2XA 5JXJA 3P1IA 3IAPA 3OGVA 1US3A 3CZJA 2WYSA 2ZEYA 2BGPA 1TG7A 3SEEA 4OZOA 4A44A 3HNYM 4TXWA 2C4XA 4LPLA 3I2KA 2VZ3A 4QB1A 3HJRA 2W87A 4RYDA 2YG0A 4DUVA 2DCJA 2J1VA 5A1AA 1F4AA 1UYXA 4CU7A 3T08A 1SHWB 2PQSA 3T2QA 4ZY9A 1W9SA 4DXSA 2C9KA 4P00B 5G05L 1JZ7A 3WF1A 2W9XA 2X09A 2EIDA 1JHJA 2RV9A 3P6BA 1XNTA 3E1F1 1RYYA 1R64A 4QB6A 1WCQA 3HN3A 3VD5A 4W4ZA 1GOFA 1CZTA 2WUHA 2VOTA 2WBKA 1O8PA 1PMJX 1UXZA 1GQPA 3JXSA 3A23A 5I0DA 3WNOA 3MV01 4D8MA 2Y6JA 3I3DA 3U37A 4QX0A 3BN6A 3HEIA 4RN5A 5IFPA 3WSOA 3GGLA 4ARYA 3ACIA 3WEZA 1L7RA 2WAAA 4JKLA 2XOMA 2VMDA 4LHSA 3MBWA 1P8JA 4BK4A 2W92A 3GM8A 4A41A 1JZ8A 1CX1A 5DPNA 1F4HA 2Y6HA 4DXTA 1PX3A 2WAOA 2W47A 4OUEA 3MO4A 3F2ZA 4OMCA 1K12A 4QX1A 5JXIA 2W46A 3K46A 2R7EB 1UY0A 3LPGA 4GWJA 3OEBA 4PF1A 1JI6A 2J1TA 1DP0A 1H6XA 4P02B 5IFTA 3EB7A 2Y6LA 5EJZB 3MUY1 2ZEZA 2LW8A 3IB3A 4A4AA 4E8CA 4CUCA 4QDRA 5B4NA 3CIHA 5LCWL 3NNGA 1KEXA 1UY3A 3W5NA 3CKHA 1W8OA 4ZXEA 1UMHA 3K4ZA 3VDBA 3OBAA 3NJVA 3DYPA 5CZKA 5JMOA 3DYOA 3J7HA 4DEQA 3WF0A 4HG6B 5G04L 4DXRA 2QBXA 4P08A 3W5MA 3LPFA 1H6YA 2YC4A 3D3AA 4ZZ8A 1K3IA 3OGRA 3OB8A 1JZ2A 3CQOA 3HNBM 2VR4A 2C26A 2OKXA 3NQHA 2W94A 1CIYA 1UXXX 2WN2A 2HLEA 1DYOA 3UNPA 3C7GA 1D7PM 4YPJA 3WNNA 1EUTA 3UETA 1SG3A 1SDDB 3DECA 5IHRA 2VZTA 2W1WA 1WKYA 2ZEWA 3PUHA 3FN9A 4W8JA 3VD9A 1NAEA 2VZQA 1I5PA 3I2HA 4MGSA 1US2A 3VDAA 4MO3M 2ZXQA 4XZUG 2WDBA 2QQNA 4MADA 5IYYA 1UYZA 2KD7A 3A7QA 2RJ2A 2J1EA 2X10A 3GDBA 3IDAA 1LNSA 1UWWA 1J83A 1GMMA 4XUPA 3T2OA 2E31A 4MGQA 2VMFA 5J1XA 4LQRA 4CU8A 2VL4A 3NRUA 2B9VA 2YFUA 3CZUA 2W95A 4A42A 3T2PA 4L0PA 5JR2A 3VD7A 3ACHA 1OD3A 4JKMA 3T0BA 3CMGA 2QQLA 1JZ5A 1UY1A 4P5YA 4KI5M 2YC2A 4CU6A 4ARXA 4W50A 2JKXA 4BK5A 2VZ1A 4AG4A 5F7UA 2VTFA 2VMEA 1GNYA 3OG2A 4DEVA 4JX0A 2YB7A 2JD9A 2JE8A 2ID4A 3FHQA 2YFZA 3C7FA 3K75B 3SEPA 3WF2A 2B4KA 2EIBA 3BGAA 2Y6KA 1W9TA 1ULOA 3SKVA 3SKJE 4JHZA 3K4DA 3C8XA 1JU3A 4ET7A 5HPOA 2VZPA 2ORXA 1JYNA 4AAXA 1GU3A 2E33A 4XUTA 1GOGA 4XUOA 2VZOA 3WF3A 1GOHA 2CDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZ0 A;  4BXS V;  3T0A A;  1GUI A;  4TTG A;  1K45 A;  3C7E A;  2EIE A;  1JYX A;  4A3Z A;  2VQU A;  3ACG A;  4CVU A;  3VD4 A;  2WO2 A;  2V72 A;  4A6O A;  2W1S A;  2WQ8 A;  2VO5 A;  5LA2 A;  4M4R A;  4DUX A;  1JYW A;  4GWI A;  2LS6 A;  3HNM A;  1EUU A;  4QX3 A;  1XPW A;  2VQT A;  2Y64 A;  5B4X A;  3UES A;  4KMQ A;  4BJ0 A;  4QDQ A;  4LKS A;  2ORZ A;  2DDU A;  2QQM A;  3ACF A;  4D0Q A;  2VJX A;  2VCC A;  1IQD C;  1O8S A;  4M4P A;  1PMH X;  4QB2 A;  2J7M A;  2E26 A;  3VDC A;  5JXH A;  1UY4 A;  2VCB A;  2J22 A;  3MV1 1;  3HPN A;  3NJX A;  5DQ0 A;  5C7G A;  1UX7 A;  1K42 A;  4JKK A;  3ETP A;  2J1A A;  1O59 A;  1MPX A;  2BGO A;  3EYP A;  4OMD A;  2JDA A;  2QQI A;  4MOA A;  3K4A A;  1W8N A;  1NX9 A;  4BDV B;  1JZ3 A;  4PQQ A;  1PX4 A;  3I2I A;  3OEA A;  1XC6 A;  1OH4 A;  2EIC A;  2VM9 A;  3LEI A;  2J1U A;  1UYY A;  2W1U A;  2L9L A;  2WO1 A;  2XON A;  2VC9 A;  4OYU A;  3MUZ 1;  4ZZ5 A;  3T0D A;  3WQB A;  3FL7 A;  2WZ8 A;  3ABZ A;  1W0N A;  4IUG A;  1BHG A;  2W91 A;  3ECQ A;  2Y8K A;  5C70 A;  4XUN A;  5FUI A;  3PUI A;  3I2G A;  4QAW A;  2QQK A;  4KWU A;  4PT6 A;  1J84 A;  1L7Q A;  3I3E A;  5DMY A;  3I2F A;  1YQ2 A;  2CDP A;  3LEK A;  3WF4 A;  4GZ9 A;  1JZ4 A;  3FHA A;  2RVA A;  4XUQ A;  3K77 A;  1W99 A;  4QDS A;  2BBA A;  3WNP A;  2Y6G A;  4CUB A;  4E8D A;  5IJR A;  3OGS A;  5JUV A;  2WO3 A;  2VZR A;  3AC0 A;  2V5D A;  2WN3 A;  1HN1 A;  2VCA A;  3THC A;  4A45 A;  2VZV A;  1OT5 A;  3T09 A;  2XHN A;  2J1R A;  5HXM A;  2V4V A;  2XQX A;  4UAP A;  5CYY A;  4XUR A;  3DYM A;  3THD A;  2WZE A;  1CZS A;  3A22 A;  1KGY A;  1NKG A;  4UOJ A;  1UMI A;  3C7H A;  4XVH A;  3GXU A;  1W9W A;  1JYV A;  5DN2 A;  5EIY B;  5LA0 A;  4QX2 A;  3WNK A;  1TVG A;  2VMC A;  3I97 A;  1JZ6 A;  1JU4 A;  1ULP A;  2VZS A;  2QQJ A;  4QPW A;  4DUW A;  5EJ1 B;  2BER A;  3WNL A;  1OF4 A;  2E32 A;  2W1Q A;  3WNM A;  3LEG A;  2HYX A;  3I2J A;  3IAQ A;  4UI9 L;  4Z2A A;  2DCK A;  1NUK A;  1XNA A;  2ZEX A;  2Z4F A;  3HOB A;  3A21 A;  5JXG A;  1DLC A;  2W5F A;  2WAB A;  3III A;  1CZV A;  2QQO A;  2VZU A;  3VD3 A;  1UY2 A;  4CU9 A;  3LQC A;  5C71 A;  4FI9 A;  1OF3 A;  4CUA A;  2BZD A;  2J1S A;  3I3B A;  3LE0 A;  5LA1 A;  3ZM8 A;  3CDZ B;  2X05 A;  3C7O A;  2W3J A;  1T2X A;  5JXJ A;  3P1I A;  3IAP A;  3OGV A;  1US3 A;  3CZJ A;  2WYS A;  2ZEY A;  2BGP A;  1TG7 A;  3SEE A;  4OZO A;  4A44 A;  3HNY M;  4TXW A;  2C4X A;  4LPL A;  3I2K A;  2VZ3 A;  4QB1 A;  3HJR A;  2W87 A;  4RYD A;  2YG0 A;  4DUV A;  2DCJ A;  2J1V A;  5A1A A;  1F4A A;  1UYX A;  4CU7 A;  3T08 A;  1SHW B;  2PQS A;  3T2Q A;  4ZY9 A;  1W9S A;  4DXS A;  2C9K A;  4P00 B;  5G05 L;  1JZ7 A;  3WF1 A;  2W9X A;  2X09 A;  2EID A;  1JHJ A;  2RV9 A;  3P6B A;  1XNT A;  3E1F 1;  1RYY A;  1R64 A;  4QB6 A;  1WCQ A;  3HN3 A;  3VD5 A;  4W4Z A;  1GOF A;  1CZT A;  2WUH A;  2VOT A;  2WBK A;  1O8P A;  1PMJ X;  1UXZ A;  1GQP A;  3JXS A;  3A23 A;  5I0D A;  3WNO A;  3MV0 1;  4D8M A;  2Y6J A;  3I3D A;  3U37 A;  4QX0 A;  3BN6 A;  3HEI A;  4RN5 A;  5IFP A;  3WSO A;  3GGL A;  4ARY A;  3ACI A;  3WEZ A;  1L7R A;  2WAA A;  4JKL A;  2XOM A;  2VMD A;  4LHS A;  3MBW A;  1P8J A;  4BK4 A;  2W92 A;  3GM8 A;  4A41 A;  1JZ8 A;  1CX1 A;  5DPN A;  1F4H A;  2Y6H A;  4DXT A;  1PX3 A;  2WAO A;  2W47 A;  4OUE A;  3MO4 A;  3F2Z A;  4OMC A;  1K12 A;  4QX1 A;  5JXI A;  2W46 A;  3K46 A;  2R7E B;  1UY0 A;  3LPG A;  4GWJ A;  3OEB A;  4PF1 A;  1JI6 A;  2J1T A;  1DP0 A;  1H6X A;  4P02 B;  5IFT A;  3EB7 A;  2Y6L A;  5EJZ B;  3MUY 1;  2ZEZ A;  2LW8 A;  3IB3 A;  4A4A A;  4E8C A;  4CUC A;  4QDR A;  5B4N A;  3CIH A;  5LCW L;  3NNG A;  1KEX A;  1UY3 A;  3W5N A;  3CKH A;  1W8O A;  4ZXE A;  1UMH A;  3K4Z A;  3VDB A;  3OBA A;  3NJV A;  3DYP A;  5CZK A;  5JMO A;  3DYO A;  3J7H A;  4DEQ A;  3WF0 A;  4HG6 B;  5G04 L;  4DXR A;  2QBX A;  4P08 A;  3W5M A;  3LPF A;  1H6Y A;  2YC4 A;  3D3A A;  4ZZ8 A;  1K3I A;  3OGR A;  3OB8 A;  1JZ2 A;  3CQO A;  3HNB M;  2VR4 A;  2C26 A;  2OKX A;  3NQH A;  2W94 A;  1CIY A;  1UXX X;  2WN2 A;  2HLE A;  1DYO A;  3UNP A;  3C7G A;  1D7P M;  4YPJ A;  3WNN A;  1EUT A;  3UET A;  1SG3 A;  1SDD B;  3DEC A;  5IHR A;  2VZT A;  2W1W A;  1WKY A;  2ZEW A;  3PUH A;  3FN9 A;  4W8J A;  3VD9 A;  1NAE A;  2VZQ A;  1I5P A;  3I2H A;  4MGS A;  1US2 A;  3VDA A;  4MO3 M;  2ZXQ A;  4XZU G;  2WDB A;  2QQN A;  4MAD A;  5IYY A;  1UYZ A;  2KD7 A;  3A7Q A;  2RJ2 A;  2J1E A;  2X10 A;  3GDB A;  3IDA A;  1LNS A;  1UWW A;  1J83 A;  1GMM A;  4XUP A;  3T2O A;  2E31 A;  4MGQ A;  2VMF A;  5J1X A;  4LQR A;  4CU8 A;  2VL4 A;  3NRU A;  2B9V A;  2YFU A;  3CZU A;  2W95 A;  4A42 A;  3T2P A;  4L0P A;  5JR2 A;  3VD7 A;  3ACH A;  1OD3 A;  4JKM A;  3T0B A;  3CMG A;  2QQL A;  1JZ5 A;  1UY1 A;  4P5Y A;  4KI5 M;  2YC2 A;  4CU6 A;  4ARX A;  4W50 A;  2JKX A;  4BK5 A;  2VZ1 A;  4AG4 A;  5F7U A;  2VTF A;  2VME A;  1GNY A;  3OG2 A;  4DEV A;  4JX0 A;  2YB7 A;  2JD9 A;  2JE8 A;  2ID4 A;  3FHQ A;  2YFZ A;  3C7F A;  3K75 B;  3SEP A;  3WF2 A;  2B4K A;  2EIB A;  3BGA A;  2Y6K A;  1W9T A;  1ULO A;  3SKV A;  3SKJ E;  4JHZ A;  3K4D A;  3C8X A;  1JU3 A;  4ET7 A;  5HPO A;  2VZP A;  2ORX A;  1JYN A;  4AAX A;  1GU3 A;  2E33 A;  4XUT A;  1GOG A;  4XUO A;  2VZO A;  3WF3 A;  1GOH A;  2CDO A; 
#chains in the Genus database with same CATH topology
 1VAV A;  4Q0S A;  2OQ7 A;  5F37 A;  3JCI A;  5K0U A;  1EPW A;  3PVO A;  2ZX0 A;  4HK8 A;  4MSV A;  4A7K A;  1K45 A;  3C7E A;  3NKT A;  2WNU C;  1IGO A;  3M3O A;  5F2W A;  4A3Z A;  4MGZ E;  4N7I A;  4UW5 A;  2X53 S;  3ACG A;  4CVU A;  1DZR A;  1MS9 A;  2ZBJ A;  2WO2 A;  3LF7 A;  3BTY A;  3FJS A;  2WQ8 A;  1AR8 3;  2VO5 A;  5CAZ A;  4GWI A;  2R1D A;  5C5U A;  4PLM A;  4K20 A;  4LBN A;  3ZVX A;  3ILR A;  5FP8 A;  5HCA A;  1U5Y A;  1GZT A;  3VZO A;  5B4X A;  1B09 A;  1VBE 2;  3S6P A;  4CDW A;  1W2T A;  4XF9 A;  4KMQ A;  3BOD A;  2RS1 2;  4BXF A;  4TZD A;  2DDU A;  1SLC A;  2QQM A;  3Q8A A;  2RMU 3;  3VBF A;  4D0Q A;  4BM8 A;  4BZ4 A;  2A6W A;  4N43 A;  4FPJ A;  3FLR A;  4AF9 A;  5BNN B;  1PMH X;  2E26 A;  1UY4 A;  5FY4 A;  4CCJ A;  4Z92 B;  4ZHN A;  3O0W A;  2QQW A;  3HPN A;  3V0B B;  5DZF A;  2XJT A;  1QJX 1;  2Q8O A;  1OLR A;  3ZX7 A;  5DQ0 A;  3MLJ A;  3SMH A;  2CGP A;  5C4W B;  5FAX A;  1MR5 A;  4LA3 A;  1STM A;  1UX7 A;  2HWE 3;  1DFQ A;  3LOI A;  4JKK A;  1WCD J;  1ND2 B;  3VBO C;  4AGV A;  4IV3 A;  4QXK A;  1RUI 2;  2GC0 A;  4AVV A;  2V73 A;  4CUG A;  3KQR A;  4WVW A;  2YYO A;  3EYP A;  1ODM A;  2JDA A;  4OMD A;  5AC9 1;  1HQW A;  5IVY A;  1NX9 A;  5FFO C;  1LHO A;  1UOB A;  5DZG A;  4BDV B;  5KHK A;  1GSL A;  3IN9 A;  4IV1 B;  3RMX A;  4CCD A;  4QKD A;  2EIC A;  2VM9 A;  1VMF A;  4S2F A;  2P1B A;  1ZM1 A;  2OW4 A;  4HKW A;  4W6Y A;  5KXE A;  4FSJ A;  4QPG B;  1W2N A;  2PHR A;  1VBE 3;  2WNE A;  4OYU A;  1BEV 3;  1ULC A;  3AP6 A;  2IFR A;  4AI2 A;  4FAH A;  3MUZ 1;  4GKY A;  4CCK A;  3MIF A;  1K5M C;  1ZZC A;  3JQW A;  2PHF A;  2WZR 3;  3KHC A;  1PGL 2;  3VUO A;  2WZR 1;  1H1M A;  3WQB A;  5CFC A;  1KDK A;  2NZ9 A;  3MW3 A;  4K8F A;  4YZ4 A;  2R0F A;  3GBW A;  2YU1 A;  2WZ8 A;  5KR7 A;  5J98 B;  1BEV 1;  1FPN 1;  2R0H A;  3B01 A;  4Y26 A;  4LNV A;  2UYB A;  3LDK A;  5A32 A;  1J58 A;  1JOB A;  3B69 A;  4JDO A;  1FOD 1;  1S0F A;  2BQP A;  1JBC A;  2Z5W A;  1RXF A;  3D0J A;  4K6B A;  2OS2 A;  2OZ6 A;  1H2L A;  2FCV A;  2HWB 2;  1COV 1;  4PT6 A;  3MIB A;  3I3E A;  3K3O A;  3V65 A;  1H1A A;  3MIH A;  2Y34 A;  1VBA 2;  1QOS A;  5AC9 3;  3ASI A;  3OPZ A;  5I91 A;  4MLO A;  3W9A A;  5L9B A;  1UN1 A;  2P5B A;  2BVV A;  3WF4 A;  5EPA A;  2C9A A;  2XQR A;  2UU8 A;  3OUJ A;  1PIV 1;  1W05 A;  1ENR A;  2W68 A;  4RHV 2;  2W52 A;  1W8T A;  3NJZ A;  5KBF A;  3BU0 A;  2R06 1;  2ATF A;  3KGL A;  3OBR A;  4YZ1 A;  3K77 A;  3AMH A;  3AM2 A;  2BBA A;  2WS9 3;  3OF1 A;  5F8P A;  2JIJ A;  2Q8E A;  3HR9 A;  4AVC A;  3J4U H;  2VBP A;  1VAM A;  3CLP A;  4CUB A;  3VL8 A;  2VZR A;  3FWE A;  5A7S A;  1VBC 2;  4QHO A;  5LW9 A;  4NIH A;  1PVX A;  1S4C A;  3THC A;  3H1W A;  1R1A 2;  4CP9 B;  2IXI A;  2VZV A;  2Y26 A;  3GZT B;  4YG0 A;  5FV3 A;  4OHZ A;  3RJ2 X;  3TRS B;  3USU A;  2ZHK A;  1V70 A;  3DKQ A;  4W6X A;  2J1R A;  1GP6 A;  3DPR A;  1CR7 A;  2FMY A;  1VMJ A;  3MW4 A;  2MEV 3;  3OCP A;  1SLL A;  2ERF A;  4BMB A;  2P4E A;  2XQX A;  4JDN A;  3KT1 A;  1CAW B;  2A6Z A;  4N9I A;  4UAP A;  5C8C C;  2OXB A;  1AR8 1;  4XUR A;  1JUI A;  3DYM A;  5HI0 A;  2WZE A;  4JV4 A;  5JCT A;  1U5Z A;  3A22 A;  1NKG A;  3BPS A;  3O7O A;  4LBQ D;  1W9W A;  1JYV A;  4FO9 A;  1UZZ A;  3H3L A;  1BBT 2;  4Q8L A;  1MVQ A;  4R9C A;  1F35 A;  1H8T C;  2E6V A;  1C3H A;  2CAV A;  1TZO A;  3KCC A;  4D7Y A;  4Q1P A;  1RUN A;  1XND A;  2WSU A;  4PJY A;  3LDR A;  3POB A;  1GYK A;  2DUO A;  3B00 A;  4WBB A;  5I8T A;  4ONU A;  4SLI A;  4GA9 A;  1IKQ A;  2VMH A;  3WNM A;  4MH0 E;  1KDM A;  4MHR A;  3QCW A;  1B35 C;  1UO9 A;  3MF6 A;  1XYN A;  1QJU 2;  2GZW A;  2B45 X;  3HBZ A;  4AR2 A;  4EN7 B;  5A3P A;  1SBF A;  3J8F 2;  3MZH A;  2JJ6 A;  3HOB A;  1V9U 3;  3A21 A;  5C3R A;  1D0H A;  3DV8 A;  3NW4 A;  5FY8 A;  4DOU A;  5JXG A;  1CJD A;  1DLC A;  3HWJ A;  2WAB A;  1YFY A;  5F5I A;  1CZV A;  2B42 B;  2QQO A;  2VZU A;  2XVL A;  4FPC A;  4GMP 3;  1Q56 A;  4IGQ A;  4JHT A;  4Q27 A;  5I0T A;  4NPM A;  4ATE A;  2D6K A;  5CFC C;  2GAU A;  4CU9 A;  4BIS A;  3LQC A;  5FYY A;  5C3O A;  3WG3 A;  5A3O A;  4PIZ A;  2ILM A;  1OF3 A;  3T3Y A;  1R1Z A;  2BZD A;  3I3B A;  3VBR A;  3LE0 A;  3M7A A;  3LA3 A;  5CIR A;  4LOS A;  5LA1 A;  3PHM A;  5FZO A;  1AL2 3;  3FMG A;  2O14 A;  3FFQ A;  4IES A;  2X05 A;  3ZFE B;  2RR1 3;  4DPN A;  2LTN A;  4E2G A;  3VBS C;  4XBL A;  1T2X A;  3P1I A;  4ORF A;  3RVH A;  5CFD A;  4LO4 B;  5L19 A;  2JIC A;  4PDW A;  2Z69 A;  1AXY A;  2ZEY A;  5GZF A;  3LZZ A;  4LBQ B;  4AXO A;  1UZV A;  2VGD A;  4OZO A;  1U12 A;  2D5H A;  1WME A;  5CFC B;  5L7O C;  3MPP G;  1EAH 1;  2A5Z A;  1XNB A;  3GF6 A;  5LRR A;  1FAT A;  2D3S A;  3ZYP A;  3KV4 A;  5DG2 A;  4S2D A;  5BNO C;  3KGZ A;  4AAP A;  5A1A A;  1VBB 3;  2B9U A;  1VB2 A;  4GWN A;  1F15 A;  2PQS A;  2AAC A;  4UFH A;  4YVW A;  2WII B;  5FY7 A;  5FZG A;  4ZY9 A;  5ANQ A;  2R06 2;  3AKP A;  1RUI 1;  3OY8 A;  4RR3 C;  5E6H A;  4MXW A;  1LOC A;  1YEW A;  2VTX J;  2R04 3;  3A0N A;  5FPL A;  4EE2 A;  1POV 3;  5IVJ A;  1JZ7 A;  2ZAB A;  3I59 B;  2XJR A;  2H6C A;  5E16 A;  1HRI 2;  4QU1 A;  1RVF 2;  1DHK B;  1V00 A;  2LAL A;  2GME A;  1AR6 1;  3E1F 1;  2BOJ A;  3WG2 A;  5AFB A;  1Z78 A;  2XBO 2;  3ZIX A;  3TNQ A;  3HN3 A;  3ZDS A;  1S2B A;  1G7Y A;  2WUH A;  2VOT A;  2WQ4 A;  2E63 A;  3O5S A;  3KLS A;  4NN0 A;  4YRD A;  2BNO A;  1PMJ X;  1GQP A;  2RR1 1;  2Y38 A;  4RR3 B;  5FZ7 A;  3JXS A;  4N53 B;  1V6K A;  4Z07 A;  4XJW A;  4IV1 A;  1DLL A;  4ASK A;  3BOW A;  2DV9 A;  1H4G A;  1NLR A;  4Q4W 1;  3D82 A;  2RM2 3;  1B35 A;  3MYX A;  3LSD A;  4IEZ A;  1FPN 2;  4AEM A;  4J1X A;  2AEY A;  4IV3 B;  3WSO A;  4XEZ A;  3U11 A;  5A3N A;  5E8A A;  4AI3 A;  2WAA A;  3UKT A;  3TEZ A;  2Y0I A;  4YW4 A;  3AVS A;  1LHU A;  1HKD A;  3K2O A;  1NE6 A;  4L8Q A;  2GNT A;  3MBW A;  1RUH 1;  5FZA A;  2GMM A;  1N3P A;  2FBE A;  1WW7 A;  4A41 A;  1PNF A;  1VBD 3;  2KXL A;  1JZ8 A;  1PVC 3;  3ZMO A;  5DDJ 1;  2LRO A;  4LLF A;  1PX3 A;  2YV8 A;  4Q2F A;  3J8F 1;  3T1L A;  4DXT A;  1F8V A;  5KHI A;  2DVD A;  2W2I A;  1S0C A;  5F5C A;  1VP6 A;  5F2S A;  1W2A X;  2V5Y A;  2HEW F;  1WA6 X;  4OMC A;  2JG8 C;  3HVD A;  1W6P A;  5FLI A;  4QX1 A;  3ZYG A;  3J7M A;  1LOF A;  4MET A;  4XFB A;  1ZZ9 A;  2PXJ A;  1PIV 2;  5J3U A;  3H8X A;  1XU1 A;  2VMG A;  4YW1 A;  4FQ4 A;  1X36 A;  4CP9 A;  1KFU L;  1MQT B;  4LJH A;  2J1T A;  1XYP A;  4IEY A;  5CAD A;  2I07 B;  4LIT A;  1DP0 A;  1VLN A;  5FZH A;  1HQL A;  3ZN5 A;  4QT6 A;  2CV6 A;  1C28 A;  4WZC A;  3MUY 1;  5EJZ B;  4CCC A;  2A3X A;  1U5I A;  4E8C A;  3IB3 A;  1XYO A;  2MEV 1;  5FWE A;  4MHU A;  3TN9 2;  2KM2 A;  1F5F A;  1Y9M A;  4RQP A;  4NIG A;  2P6H A;  1QJY 1;  2CL2 A;  1E5I A;  4ISR A;  4K7J A;  2A71 A;  1AXK A;  4Q26 A;  4R9B A;  4W65 A;  1ULD A;  5BNP C;  1TQ5 A;  1WW6 A;  2IXK A;  3KV9 A;  4DZG A;  1CAV A;  1LOG A;  1HW5 A;  4OLL A;  3WNX A;  5A1F A;  1DBN A;  2Q1M A;  4TLF A;  3WDV A;  2GMP A;  2VUL A;  5DZE A;  1AL2 2;  1C5H A;  1HJF A;  2OA2 A;  2UWC A;  4ZXE A;  4EN8 B;  2ZKN A;  5DAP A;  2XJS A;  1F5J A;  5C3S A;  2TUN A;  2DUR A;  1ONA A;  4U36 A;  1G9F A;  1CAX A;  2R06 3;  1QJF A;  2HWC 2;  4IER A;  1EY2 A;  3L2H A;  4HG6 B;  2VXJ A;  3GCW A;  3W5M A;  3AYE A;  3LPF A;  1C4R A;  1H6Y A;  2DVB A;  4Q4X 1;  5A32 B;  3WVJ A;  1DQ1 A;  1BXH A;  1M4W A;  4UFJ A;  4FTB A;  4BA6 A;  4L97 A;  1JOJ A;  1LCL A;  3GHN A;  3OGR A;  3OB8 A;  3CQO A;  3IDB B;  3NO8 A;  3HNB M;  5FP7 A;  1OUX A;  4UW4 A;  3L2Y A;  4KQ7 A;  2VOW A;  4Y22 A;  3RWK X;  4RA0 A;  3NQH A;  4EYU A;  1TNF A;  5FZK A;  3H8U A;  2CAU A;  4XBQ A;  4IEX A;  4AQS A;  5GLZ A;  4OUL A;  2WT0 A;  4LOR A;  2VOX A;  4FPY A;  2WLP A;  4ES9 A;  1VRB A;  5L9R A;  3AJY A;  1AR7 3;  2ZCW A;  3C7G A;  2QKD A;  4R52 A;  1O3Q A;  5IT6 A;  1BBT 3;  1LB2 A;  2A6Y A;  1ZRF A;  1V6N A;  2EAL A;  3A0K A;  3RYR A;  1UZW A;  3MPB A;  3UET A;  4UT5 A;  4BQ3 A;  4EJR A;  2QZ2 A;  3PTR B;  4YW5 A;  4FPL A;  1R09 2;  5FXW A;  5IHR A;  3PJQ A;  1UZY A;  1ALY A;  2TEP A;  5JDB A;  4XC9 A;  4EZH A;  5DXD A;  5C33 A;  4LKD A;  1WKY A;  2RS5 1;  1W6N A;  3FN9 A;  4LT5 A;  1EV1 1;  5EWS A;  4PBP A;  1NAE A;  5DAB A;  3ZPY A;  1VBE 1;  1I5P A;  2QZ3 A;  1BVV A;  1QDO A;  4QPI A;  4AK3 A;  5F9T A;  1ND3 A;  3I2H A;  4XZP A;  2A6X A;  4MGS A;  2ZOE B;  1US2 A;  2DTW A;  3AYC A;  2PLV 1;  3VDA A;  4XXA A;  2ZXQ A;  4JQR A;  4XZU G;  1RVF 3;  2VG9 A;  2D3P A;  1LEN A;  2WDB A;  3G7D A;  5F3I A;  3WXP A;  5IYY A;  4FPF A;  4LKF A;  1QJU 3;  1WLC A;  2J1E A;  3NVC A;  5FZ4 A;  2PYT A;  5FYS A;  4E4S A;  2FDG A;  1LNS A;  4URT A;  5F3E A;  5FDB A;  1X9P A;  5A33 B;  4Q5O A;  5BNN C;  1RIN A;  3RI8 A;  4L9B A;  3NV1 A;  4YWA A;  3FZ3 A;  1OOP C;  2BYV E;  4IV3 C;  2VL4 A;  4Y33 A;  5L7O B;  1NCR B;  2YFU A;  4IE0 A;  1NLS A;  2D43 A;  2W95 A;  1WZX A;  3MF9 A;  4FFH A;  3H8R A;  1QJX 3;  3ZSJ A;  3CU7 A;  3VD7 A;  1ZRC A;  1RJ7 A;  1LU1 A;  4Y5T A;  3ACH A;  5EHD A;  3T0B A;  5HXV A;  2WLQ A;  2QQL A;  5A7W A;  3VBS B;  2RE9 A;  1JZ5 A;  2P6C A;  4COZ A;  4FOY A;  1UY1 A;  1QIQ A;  2AZ5 A;  4KI5 M;  4P5Y A;  4P9J A;  4D6R A;  3I4I A;  1OLM E;  1LEC A;  4MX3 A;  5E88 A;  1DQ4 A;  1RMU 2;  4W50 A;  4WVZ A;  4XAC A;  2WFF 1;  5A80 A;  5T52 A;  3ZYJ B;  3POW A;  4IV1 C;  3U14 A;  1N3O A;  4LK7 A;  4CXW A;  5FO9 B;  1GP5 A;  2YB7 A;  4IE5 A;  2JD9 A;  3D5O A;  2IC1 A;  2HWD 3;  4CDU A;  4O61 A;  3CJX A;  1G9B A;  2VBB A;  1YQ5 A;  3O1V A;  3WF2 A;  4OHX A;  1NT0 A;  3KS7 A;  3FLP A;  2A7A A;  2W08 A;  3P3N A;  3WHT A;  5KC6 A;  1NA1 B;  5D8A B;  1H2M A;  2JE7 A;  4ET7 A;  5C8C B;  1JU3 A;  4HAN A;  5IWF A;  2OYZ A;  1BKZ A;  3APB A;  1JYN A;  3ZFF A;  4KWL A;  4XUT A;  3WF3 A;  1GOG A;  3E97 A;  4AAX A;  1ZRD A;  2CDO A;  3IM0 A;  1PO2 2;  2JEN A;  1OA3 A;  2WNV C;  1UZ0 A;  4YW3 A;  3PVN A;  3HQR A;  3N35 A;  3HN1 A;  3OD4 A;  4D3W A;  3VHR A;  4Z1V A;  2VBD A;  3KCY A;  1SZB A;  3BI3 A;  4Q4V 1;  2XGX A;  2EIE A;  5FLH A;  3ZN6 B;  1JYX A;  2XJQ A;  4BQX A;  1GQH A;  2BGC A;  3I59 A;  2K0G A;  3PUR A;  2AR6 A;  2JX9 A;  1R08 2;  4LBQ A;  5LA2 A;  5A70 A;  1E5H A;  2VNR A;  2LS6 A;  3ZXL A;  2AEZ A;  1O5U A;  1C8M 1;  2PLV 3;  1VRH 1;  1OMI A;  2G19 A;  4M3C E;  4V2W A;  3RSJ A;  4QXC A;  3BTA A;  2C0Z A;  3ACF A;  2VUA A;  2VJX A;  1EV1 3;  4AHZ A;  4JRA A;  2RS5 3;  3UGG A;  1XNK A;  2WO7 A;  3ZKY A;  4EQV A;  5F5Q A;  1XNC A;  4M4P A;  4NRQ A;  5APA A;  1YJL A;  2XL7 A;  2RS5 2;  2VCB A;  3SQO A;  4Y22 B;  2V09 A;  1SCR A;  4UFM A;  2WNV B;  4KG8 A;  3MV1 1;  1QU0 A;  5FZD A;  1BBT 1;  1ULF A;  2K46 A;  2PFW A;  1NCQ A;  1RUJ 2;  3B94 A;  1UU5 A;  5DG1 A;  5IK7 A;  1Y7B A;  1FYU A;  1W6M B;  2J1A A;  3BYW A;  4HN1 A;  1OFN A;  3WDT A;  1MPX A;  2A3Y A;  4GJY A;  2LUW A;  4HVO A;  5A6Y A;  2D6O X;  3HBK A;  1OVS A;  2DF7 A;  5ABJ A;  2WS9 2;  3NNL A;  4DY3 A;  3WW1 A;  4QQP A;  4MVT A;  4AFC A;  3FUQ A;  2V4A A;  5DAW A;  4CEY C;  1PX4 A;  1TME 1;  1XC6 A;  3I2I A;  1OH4 A;  3OEA A;  4XCB A;  5FYU A;  3LEI A;  5K4L A;  1BVP 1;  3U4S A;  2YGM A;  2WT2 A;  2Y33 A;  4COY A;  1D2S A;  1YC6 1;  2JKB A;  4IEV A;  2ZML A;  4Q4X 3;  3VBO B;  4PIY A;  1RJ8 A;  4TN7 A;  1W0O A;  5C9A A;  1Y9Q A;  5BUV A;  1RUG 1;  2XUM A;  4AEK A;  1ZBA 2;  4BQ5 A;  1H9W A;  4OQ9 A;  3U1X A;  1CAW A;  2RMU 2;  5TSW A;  1UYP A;  2XXZ A;  4Q4Y 3;  4EV0 A;  5FZ8 A;  4Q29 A;  5E89 A;  3KT7 A;  5FZ0 A;  4Y4Y A;  1RIT A;  4N7U A;  1NCR C;  5T3N A;  3WQ1 A;  4YVS A;  2UUR A;  1BHG A;  1SLB A;  3SCH A;  4LLO A;  1O5L A;  3ECQ A;  2Y8K A;  3H3U A;  2FDH A;  3ZYI B;  1RMU 3;  4XF1 A;  2Q8D A;  1SLA A;  2PA7 A;  2Y60 A;  3QH7 A;  1PGS A;  5FMO L;  5FUI A;  2J42 A;  3N3H A;  3ZFF C;  5GLW A;  5JSR A;  1W6P B;  2H0B A;  3E5X A;  3I2G A;  3RFR A;  3RZL A;  5FJK A;  5LY1 A;  1NLQ A;  4LBO A;  4BME A;  2VNG A;  5EFU A;  5HCH A;  1A34 A;  3LSE A;  4R9D A;  2VOV A;  4EWA A;  4NWV A;  1WWY A;  2DBI A;  3WZ1 A;  2JEC A;  4LXL A;  1SEF A;  5K8S A;  4IDZ A;  5JSP A;  1YQC A;  4M00 A;  3AFK A;  1Y4W A;  4LHK A;  1LJ7 A;  5HV4 A;  1JZ4 A;  3RJR A;  1MS3 A;  1POQ A;  4YM1 A;  1UOF A;  2A73 B;  5DAQ A;  1MZF A;  2CTV A;  1LEM A;  2PHD A;  5FK7 A;  1SDW A;  4QDS A;  3WNP A;  1XE8 A;  5FXX A;  2Y6G A;  1AYN 3;  2JG9 B;  5A7P A;  3OGS A;  4P9L A;  4NPL A;  1X33 A;  2GC1 A;  1GQG A;  5LY2 A;  2CHH A;  4QPI C;  1GIC A;  3KB5 A;  2WN3 A;  3BPZ A;  3M3I A;  4FTS A;  1PO1 3;  1MS0 A;  2GND A;  4RR3 A;  4DRR A;  2ZAC A;  5I0S A;  2ZX2 A;  4M0H A;  3HIF A;  2XHN A;  3ZYF A;  1BZW A;  2QJV A;  1JHN A;  3JD7 3;  2R1B A;  4A6S A;  2D93 A;  3PIG A;  1AYM 2;  2E9Q A;  2V4V A;  4H3W A;  1LGB A;  4RSU A;  3O0X A;  1HQN A;  4QXH A;  4TLG A;  3THD A;  1H2K A;  1CPM A;  3FUO A;  1CZS A;  3C3V A;  2ZA9 A;  3ZYB A;  4XVH A;  4R4Z A;  3SHR A;  5EIY B;  4QX2 A;  3ZFG A;  4NRM A;  1RUC 1;  1AR7 2;  1W8Z A;  1XU2 A;  2ZGO A;  1ULP A;  4QPG A;  4WVM A;  5T5P A;  5ERL A;  1VAK A;  2QQJ A;  2P3I A;  2WJS A;  4QPW A;  2GC3 A;  4XFC A;  2CWM A;  1LGC A;  3CHX A;  1EPZ A;  1WMX A;  5FR3 A;  1PNG A;  2JB4 A;  4M3C F;  5A7Q A;  5T54 A;  2TNF A;  5CA6 A;  3FFZ A;  2ZZQ A;  2A3W A;  4BCU A;  2W1Q A;  2ZGS A;  3K51 A;  3LEG A;  4LO5 B;  4Y1V A;  2BUK A;  2GN3 A;  4Y4R A;  3VKM A;  4BQ2 A;  5FPV A;  4CYD A;  4Q4W 2;  1OOP B;  4UI9 L;  5BV6 A;  4Z2A A;  4AVA A;  3MID A;  2WNU A;  1H4H A;  2LM3 A;  4NID A;  3DL3 A;  5GKA C;  3Q8F A;  2WC2 A;  1DG6 A;  1IG0 A;  4OFG A;  3VKN A;  4AI8 A;  3L9J T;  4K3U A;  4XPV A;  4CDU C;  1S2E A;  1ENQ A;  3PU8 A;  1OUS A;  4CP1 A;  1RL3 A;  4KU7 A;  4AZZ A;  1N1V A;  5C71 A;  3JB4 C;  2XUE A;  5K0U C;  2J1S A;  3TOJ A;  3DXT A;  5C3Q A;  4FPE A;  4YYO A;  1W0P A;  3GJB A;  2DVA A;  1Q8P A;  4YGD A;  5LB6 A;  2AH2 A;  3CDZ B;  3C7O A;  2HJI A;  3EXU A;  3ZXD A;  3NL1 A;  1EAH 3;  1LUL A;  3E6B A;  3FE5 A;  4N8M A;  1X8E A;  5L9V A;  5JXJ A;  3IAP A;  3KZ4 C;  4IGO A;  5FYM A;  3V0A B;  1BYH A;  3OGV A;  4FXK B;  5D2A A;  3O1R A;  2RS1 1;  1QOT A;  4AFA A;  4CDW C;  5ACA 1;  1O3R A;  3GBF A;  3M8L A;  3RQ0 A;  2BGP A;  1L7L A;  5FOJ B;  1MZ6 A;  4P9W A;  1TG7 A;  5C4W A;  3SEE A;  4MGY E;  4TXW A;  3VBF C;  2OUJ A;  3RZJ A;  5JZG B;  1PZ9 A;  1HXS 2;  1JYT A;  4QB1 A;  4RGK A;  1RUE 2;  5A7W B;  4RYD A;  2YG0 A;  4BLI A;  2YU2 A;  4Y1Z A;  5J96 B;  1O4Y A;  5KC5 A;  2JDZ A;  1QJX 2;  2DCJ A;  2P3K A;  2WWU A;  2J1V A;  4NO4 A;  4XOG A;  1F4A A;  5JPN B;  1UYX A;  2IXL A;  4CU7 A;  1APN A;  2HWC 1;  3T08 A;  1SHW B;  3IPV A;  4XF4 A;  3UJO A;  2ZGU A;  3ZXK A;  2B8M A;  2K2S A;  3O14 A;  4YVS B;  1YLL A;  2RDR A;  3NWK A;  3IBM A;  4QMA A;  3VKF C;  3WLU A;  1QF3 A;  2C9K A;  4BQ1 A;  1MQT C;  4R9A A;  2ZGQ A;  2R07 3;  5JR7 B;  1NYW A;  3MLL A;  3WF1 A;  1PVC 2;  3B9I A;  2GH2 A;  1KJL A;  4V1P A;  3MHZ A;  2NMO A;  1I3H A;  1N47 A;  4IXL A;  4XAA A;  1JHJ A;  2RV9 A;  4XMI A;  1JH5 A;  1W39 A;  2QE3 A;  1QEX A;  2ADE A;  3V56 A;  4FPO B;  5CVR A;  5I8Y A;  1GOF A;  2FDJ A;  2DUQ A;  1NZI A;  4FOQ A;  3EHK A;  4D94 A;  2WBK A;  1O8P A;  3SCF A;  1OLQ A;  3RZM A;  2EAA A;  2OVU A;  4YVS C;  3N9O A;  3A23 A;  1NE4 A;  1XJA A;  3BAL A;  1R09 3;  4C8D A;  2VCM A;  5I0D A;  1RUF 1;  2D6L X;  3JUU A;  3TEX A;  1IS4 A;  1CES A;  4XJU A;  3ZIW A;  1QDC A;  4D8M A;  3BUC A;  4IW3 A;  3LA7 A;  1TMF 2;  3SH3 A;  3GZA A;  3U37 A;  3AKS A;  3GCX A;  2YPD A;  2HBT A;  4ZU5 A;  2ARC A;  3GGL A;  2YDE A;  4YSF A;  3ACI A;  3WEZ A;  2JDH A;  1LES A;  4QU2 A;  3DF0 A;  4JKL A;  1HV1 A;  4AGR A;  2XOM A;  1OPM A;  1YJK A;  2VNV A;  4LHS A;  2ZGK A;  1GZC A;  1P8J A;  1K5M A;  2OZJ A;  1CX1 A;  1Q8V A;  2Y6H A;  4YFZ A;  2RG4 A;  2RR1 2;  5F6K A;  4KBB A;  4PCR A;  2O1Q A;  2WAO A;  4CCM A;  2W47 A;  3LDB A;  2F6B A;  2WA3 A;  4OUE A;  4QQL A;  3KF3 A;  3ZN6 A;  4AE2 A;  2ARB A;  2PHL A;  4RL7 A;  2ZGT A;  1K12 A;  4D6S A;  5JXI A;  5HCF A;  1LOE A;  4I2O A;  2UWB A;  2VUJ A;  1CWP A;  4R4X A;  3ZFF B;  1YYN A;  1PIV 3;  4AI1 A;  1DQ5 A;  1LOA A;  1GFF 2;  3JQX A;  1OD5 A;  1JI6 A;  3OEB A;  4K1Y A;  4B29 A;  3IT8 A;  3U78 A;  4YG3 A;  3GYD A;  5FP9 A;  1I9R A;  1YQ6 A;  1H6X A;  4P02 B;  4DXZ A;  1ZZ6 A;  1O4T A;  5BXX A;  1OFS A;  5JIA A;  3C2U A;  1S0D A;  1GWL A;  3RZK A;  4BPZ A;  1OLM A;  2GAL A;  1AYN 2;  4COV A;  1FI2 A;  3PUA A;  3WP3 A;  1VJ2 A;  1W6O B;  1X8M A;  3N36 A;  1R1A 1;  1QOO A;  4QDR A;  5JI9 A;  2H6B A;  3RYP A;  3O1S A;  2A6V A;  5L36 A;  2WKK A;  1Y9G A;  3CIH A;  3NNG A;  4IE4 A;  4CRQ A;  4CZS A;  1FPN 3;  5F3C A;  1YI7 A;  1OQD A;  2ZGM A;  1H8T A;  1RHI 1;  3DXU A;  4UFK A;  2O8O A;  1D4M 1;  4XE9 A;  1BMV 2;  1MVE A;  2Y6F A;  3HT1 A;  1HJG A;  4C91 A;  3WUC A;  4M3C B;  4CXY A;  2WZP P;  1UMH A;  2VUC A;  3K4Z A;  5CB7 A;  1HB4 A;  2C6S A;  2F4P A;  2C1F A;  2WWJ A;  3ZSK A;  2XB6 C;  3BIE A;  3CBN A;  1SFN A;  2I45 A;  5CZK A;  5JMO A;  2YY1 A;  3J7N A;  3KCX A;  1HXS 3;  3J7H A;  1WMD A;  1MQT A;  4PLN A;  1BQP A;  1RHI 3;  1I6X A;  1VMH A;  2MEV 2;  3WF0 A;  5G04 L;  1CJP A;  2VVD A;  4XDO A;  2QBX A;  3S5Q A;  4DXR A;  3NKG A;  4FQZ A;  2TBV A;  4JTO A;  2YC4 A;  1HX6 A;  2E51 A;  3D3A A;  4ZZ8 A;  4NOT A;  3JBG 2;  3WDU A;  4FBF A;  3LOB A;  2GNB A;  1A3K A;  1R1A 3;  1K3I A;  3FX3 A;  1ZZB A;  4NAM A;  2FDF A;  2WIN B;  1NQJ A;  3GZE A;  1DZQ A;  4GH4 C;  1REE A;  1UKG A;  3T30 A;  1J3R A;  3Q8B A;  1ZNP A;  3ME2 A;  5A7O A;  1V6I A;  3V0B A;  2FDI A;  1VBD 2;  1SPP A;  2XJV A;  3J26 N;  4HKL A;  4J6G A;  1CIY A;  1BK1 A;  3EBR A;  3JB8 A;  3RZG A;  1R08 1;  2VEC A;  4BE3 A;  1D4V B;  3J9S A;  2WN2 A;  2HLE A;  2XVK A;  2ETE A;  3KF5 A;  2OPK A;  2HWE 1;  1C8M 2;  5BPX A;  2VQA A;  1B35 B;  3OGG A;  2P34 A;  4BHP A;  2BTV C;  2NPI A;  1GNZ A;  1I1E A;  3OPT A;  3DEC A;  3VBR C;  2ZGL A;  3LFI A;  3POG A;  3ZXE A;  2C24 A;  5LBB A;  4GKX A;  2DU1 A;  5FBJ A;  4WM8 A;  2P3Y A;  5KHH A;  1IPS A;  5ABJ B;  4LOT A;  2YGL A;  1Q8S A;  3ZFE C;  3PUH A;  3VD9 A;  2CNA A;  1A6C A;  4CPB D;  3AL5 A;  3PME A;  1C57 A;  2JIG A;  1VRH 2;  3Q8C A;  4AFM A;  4UYB A;  3POS A;  5EV7 A;  2P3J A;  5C6C A;  5K0U B;  1YWK A;  2W0X A;  5BNQ A;  1QXP A;  4I09 A;  4CCN A;  3WDY A;  2HWF 1;  1HRI 3;  4UXA A;  1UAI A;  5GLT A;  4KGQ A;  3LGR A;  4IEU A;  1UYZ A;  4KWK A;  5FZ1 A;  3TNP B;  4XXP A;  2VNO A;  2WNO A;  2X10 A;  3OUH A;  4Q4Y 2;  5A1L A;  1RUD 1;  2QQV A;  1NCQ C;  1R09 1;  2JDM A;  2VTX A;  3AB0 A;  4I3P A;  3NMB A;  4IE6 A;  1UWW A;  4XUP A;  3T2O A;  1I5Z A;  1XSQ A;  1YNA A;  4HMZ A;  2VMF A;  4LQR A;  4ZS2 A;  4PDW C;  3U4X A;  4TWT A;  2E53 A;  1XB9 A;  4LR4 A;  4A42 A;  1W8U A;  5IVV A;  1LR5 A;  1MEC 1;  5BNO B;  2PEL A;  1WLW A;  4I0B A;  4DEQ A;  1PO1 2;  2BNM A;  5J7M A;  4MZU A;  1X82 A;  2QDN A;  3CMG A;  1UNB A;  3I49 A;  3WW3 A;  4F8A A;  2G9F A;  5LBF A;  4HSJ A;  2R07 1;  2E7A A;  3AJZ A;  3HMY A;  3MIE A;  1ZYB A;  4G3Y C;  5FZ6 A;  4CU6 A;  4LUM A;  4BK5 A;  5F7U A;  3LAG A;  2BRT A;  1BJQ A;  4HVQ A;  3M1H A;  3ZSL A;  4FOV A;  1JOP A;  4DEV A;  4E2S A;  1F2N A;  2JDK A;  3S30 A;  2B7Y A;  2BV4 A;  1POV 0;  2UYA A;  3H50 A;  4QKB A;  3FHQ A;  1ZBA 1;  2YFZ A;  1W3V A;  4XF0 A;  3I2O A;  3AZX A;  3SEP A;  4C0H A;  3CJI B;  3TB0 A;  1NA1 A;  5D8A A;  2WZR 2;  2EIB A;  2DVF A;  4XTP A;  3ZXG A;  4DY5 A;  1JW6 A;  2G1M A;  2Y6K A;  4HVR A;  1ULO A;  1C1F A;  3K4D A;  3V64 A;  1AYM 3;  4AED A;  2ZAH A;  2VZP A;  4ZS3 A;  2XH6 A;  4EWD A;  2ORX A;  2RS1 3;  1GU3 A;  1KD7 A;  1KQR A;  2RJK A;  4XUO A;  1YI9 A;  1E5S A;  1MZ5 A;  4Q0Q A;  5FQ0 A;  3KVB A;  1VAL A;  2HBU A;  5FYT A;  4BXS V;  1GZW A;  1DGW A;  3N9Q A;  4TTG A;  1VBC 3;  2NYY A;  4AHW A;  3TEY A;  1Z0H A;  1SPP B;  2DBN A;  3USS A;  1W04 A;  2R32 A;  4KL1 A;  4A6O A;  3VBS A;  2W1S A;  2QQU A;  4M4R A;  4BB3 A;  4JDM A;  4L99 A;  4DUX A;  3ZR5 A;  3ZXF A;  1JYW A;  4AYU A;  3K3N A;  1W6Q A;  3ZPO A;  4RHV 1;  4XHX A;  3FBM A;  3NAP B;  2ZX4 A;  4QX3 A;  1HRV 1;  1LOF C;  1MZE A;  2ZTN A;  4KGG A;  4YFW A;  1X7N A;  5FYC A;  3KV6 A;  1AR9 2;  5FP4 A;  4E9K A;  4QDQ A;  3VHO A;  5L7O A;  2DVG A;  1QQP 3;  2RHP A;  2VW1 A;  4KU8 A;  4FXG B;  2RS3 2;  2B5H A;  2VCC A;  2NP0 A;  2J7M A;  1V0A A;  3AZV A;  3OGJ A;  4JGY A;  4GMP 0;  4L92 A;  3BTZ A;  5JZG A;  2JG8 A;  5H9R A;  3A4U A;  3NJX A;  2WT1 A;  5EZW A;  3DPR B;  2DFC A;  4CPB A;  2HWD 2;  1W28 A;  4YVW C;  5C7G A;  2YC0 A;  4FFG A;  4QX7 A;  1RIR A;  3OYW A;  3UV9 A;  4HPK A;  1K42 A;  4Y5Z 0;  3O1T A;  4DB5 A;  4N9H A;  3FHI B;  4PLO A;  2GP3 A;  5F5A A;  1O59 A;  3EQE A;  1NG0 A;  4LO7 A;  4YM0 A;  3IWZ A;  3M70 A;  4QX5 A;  4MOA A;  3K4A A;  4ISQ A;  1W8N A;  5FRA A;  4BQ4 A;  4JGZ B;  4PQQ A;  1RUC 2;  3AKQ A;  1W2U A;  4I0A A;  3ETQ A;  1UYY A;  4YZ3 A;  5BNP A;  1DF0 A;  2W1U A;  1QJE A;  4CDQ B;  2IFW A;  3POE A;  4QGN A;  3VZK A;  1NY7 1;  1AL0 G;  3LD8 A;  1LOB A;  2L9L A;  1DGL A;  2BEO A;  2WO1 A;  2XON A;  4IND A;  2VC9 A;  3WG1 A;  2IWG B;  4NJ4 A;  4XF3 A;  2DU0 A;  1NOV A;  4C1W A;  2ADD A;  3KSC A;  5LBC A;  3AFG A;  1J3P A;  3KHB A;  3BTX A;  4WM7 B;  4EN0 A;  2GC2 A;  3ZO0 B;  2ENR A;  3O1U A;  3P5B A;  3U0Z A;  1QQP 2;  4CE8 A;  3SIS A;  5JOZ A;  2ZZJ A;  3LFM A;  4HSL A;  5CIS A;  1NA1 C;  2JE9 A;  5D8A C;  1K5M B;  4CCL A;  2D44 A;  4RS5 A;  3FL7 A;  1HDK A;  4RGG A;  5IK5 A;  4PDW B;  3KV5 A;  1OC1 A;  4GIQ A;  1DGR A;  5IVE A;  3JZV A;  3ALQ A;  2MPF A;  2W91 A;  4NHY A;  2VD7 A;  3WQ0 A;  3R4U A;  5C70 A;  2BFU L;  1OA2 A;  2X5I B;  4XUN A;  2D6P A;  1V6O A;  4ZKT B;  1ND3 C;  1FNY A;  4ERO A;  1GV9 A;  3RPQ A;  2QQK A;  3T2T A;  4LO6 B;  3ZSE A;  2WR9 A;  3NV4 A;  4FCA A;  1JXN A;  3VDD A;  3RWN A;  1L7Q A;  3AP4 A;  2ZAA A;  4B4Q A;  4UF0 A;  1RUE 1;  5FY1 A;  4H2A A;  3W59 A;  1YQ2 A;  3M4F A;  5SV5 A;  4DO0 A;  1MS5 A;  3D6E A;  3LEK A;  4GB3 1;  4YW6 A;  3WG4 A;  4CDQ A;  5F1R A;  4EN9 B;  4GAL A;  4XUQ A;  4GD4 A;  1LKN A;  2PMW B;  4CCE A;  5KWR A;  2E7Q A;  3B5L B;  1AR8 2;  2XHK A;  3WDW A;  1PK6 B;  1W99 A;  1WCK A;  2XVG A;  3MGU A;  4LK6 A;  3CNA A;  1T6G C;  4Y24 A;  2Q1F A;  5JUV A;  3ACL A;  4KH9 A;  1WMF A;  3DCQ A;  4LHL A;  2EXH A;  4HT1 T;  2JDN A;  2VCA A;  4JRL A;  3I2D A;  5JZG C;  1OT5 A;  4XW3 A;  1JN2 P;  3T09 A;  3W21 A;  1HRV 3;  5HXM A;  5JOX A;  3KVA A;  3ZLI A;  1F9K A;  2XLA A;  1UF2 C;  4IL7 A;  5A3W A;  2Q8C A;  1TME 3;  1Q8O A;  2R49 A;  4LE3 A;  3ZSM A;  3AXE A;  2Z42 A;  4XTM A;  3B3Q E;  2KR2 A;  4AHX A;  5BNN A;  3RRD A;  1KGY A;  4UOJ A;  5C9A B;  4N43 B;  1GZ9 A;  3O12 A;  3N9M A;  1C8N A;  2AC1 A;  3LA2 A;  3RMY A;  3RDI A;  1JU4 A;  2XBO 1;  1TMF 1;  3VN4 A;  2B46 X;  1W2O A;  2VZS A;  4H55 A;  3NAP A;  2HYK A;  2ZMN A;  3MFC A;  4PIX A;  5FY0 A;  4B1M A;  3JBG 3;  4Q0V A;  1M06 G;  2JDU A;  5IW0 A;  3BCW A;  1WGP A;  1AYM 1;  2HYX A;  2ZHN A;  1N1Y A;  3TYJ A;  4JC1 A;  3KM5 A;  4Y1X A;  3UT0 A;  2FCU A;  4GQ7 A;  4AQ6 A;  2XJP A;  5GZE A;  2B39 A;  3POJ A;  2DCK A;  1NUK A;  1OVP A;  1XNA A;  2ZEX A;  5JOW A;  2Z4F A;  3PTY A;  1L3J A;  4HLT A;  4AQT A;  2PTM A;  3CO2 A;  3S57 A;  1KFX L;  1SFY A;  2ARE A;  2AEN A;  2NN8 A;  5FYH A;  2QDR A;  1H1I A;  1VRH 3;  5CG9 A;  3RZH A;  4AVB A;  1UY2 A;  1Z7S 1;  2QFE A;  4LHN A;  3QBQ A;  2WNV A;  4Y3O A;  4FI9 A;  5EYX A;  1PZ8 A;  2O8Q A;  4IGP A;  4CUA A;  1VIW B;  1PM4 A;  1W9Y A;  3TBD A;  5A6X A;  1AF9 A;  3M2M A;  4HXC A;  4H7M A;  1ENX A;  4AL9 A;  2XPJ A;  2GDF A;  3ZM8 A;  2PAE A;  4UFL A;  2RJL A;  2ZGN A;  2R04 2;  1W90 A;  2CWS A;  3SCG A;  3WP4 A;  3MIG A;  4XIK A;  3WX5 A;  1MEC 3;  5FPU A;  2A75 A;  3R6S A;  1UCX A;  3CZJ A;  4FPH A;  5JIU A;  1ASJ 3;  2WYS A;  1W03 A;  4WVM B;  3WCR A;  3GHM A;  4FP3 A;  5T50 A;  4DFS A;  3HNY M;  3ZFG B;  4OHV A;  2CGN A;  2ES3 A;  4DMI A;  4OI4 A;  4LPL A;  1U0A A;  5I0U A;  3SXW A;  1JTZ X;  1FV3 A;  3WP5 A;  4BQW A;  3IZO A;  2O0O A;  4P9X A;  1IHM A;  2W87 A;  4IEQ A;  5DUX A;  1RUD 3;  2BPA 2;  3TN9 1;  2FQP A;  5LAS A;  4U2A A;  4AFB A;  1OOP A;  2WYF A;  5JOY A;  1SBD A;  1ZRE A;  2HWD 1;  4JCK A;  3WUD A;  1G8W A;  2BW8 A;  5EXO A;  2JXA A;  3B7M A;  5FK8 A;  4NRP A;  4OVE A;  4BWO A;  4CCO A;  1RHI 2;  4HOO A;  4P9Y A;  3OUI A;  4YLZ A;  4B4R A;  4QHZ A;  1D4M 2;  4MXV A;  1DQ0 A;  1RTV A;  4QM8 A;  4Z2W A;  1QH6 A;  4XDP A;  4CDX C;  3DN7 A;  3TN9 3;  3CF6 E;  1IS6 A;  1V6M A;  3FBY A;  3QLQ A;  4QXB A;  4P00 B;  5FYV A;  5IK8 A;  1CVN A;  5ABJ C;  4COU A;  1XE7 A;  3MI8 A;  3BIW E;  4MV2 A;  2JEM A;  4FVV A;  5FP3 A;  3VBH C;  1J1T A;  4E4Z A;  2W9X A;  1GR3 A;  3ES1 A;  2X09 A;  2EID A;  1SBE A;  1BLZ A;  1DQ2 A;  3TAY A;  3UKN A;  3VBR B;  1DU3 D;  4HPK B;  1RYY A;  1R64 A;  4LIU A;  4QB6 A;  1PGW 2;  3VKO A;  5B2G B;  1HN0 A;  3RG0 A;  1WCQ A;  3AZW A;  5CG8 A;  3VD5 A;  1RUH 2;  3LCP A;  2QUO A;  4QQO A;  5FYI A;  5FWJ A;  4DNY A;  2MNG A;  2D5F A;  1UXZ A;  4KWJ A;  2W39 A;  1IPK A;  3H42 B;  2GN7 A;  3SIT A;  1QY4 A;  1MS4 A;  2D98 A;  3H0O A;  4JGZ A;  4X8N A;  1N3Q A;  4A3X A;  5GZG A;  2WQZ C;  2Y6J A;  3WHU A;  5I93 A;  3AKR A;  1QJU 1;  2DCT A;  3I3D A;  3TWI A;  2MHF A;  4D7T A;  1H2N A;  4OI0 A;  1YQ8 A;  1LHN A;  2DYC A;  3BN6 A;  3HEI A;  4GH4 B;  4LBJ A;  1RVF 1;  4RN5 A;  1NCR A;  1L7R A;  3OYW B;  2NMN A;  2VMD A;  3VHN A;  3PMS A;  4WM8 C;  5FZ3 A;  1RGS A;  3IIA A;  5FOB B;  3AP7 A;  4HET A;  4BU2 A;  1Q3E A;  1OQ1 A;  1N1S A;  2YXS A;  4LUK A;  4N43 C;  4JGY B;  3WOG A;  5HBA A;  4YW2 A;  1FAY A;  3MO4 A;  5CKQ A;  5LA9 A;  3I3M A;  1YIF A;  5FJH A;  1QJY 2;  1IPJ A;  1D4M 3;  1S0B A;  5IAT A;  4GB3 2;  2W46 A;  3KWV A;  1Z7S 2;  2D97 A;  1FX5 A;  1O6U A;  4AI9 A;  3LPG A;  4B7E A;  5A3U A;  1TMF 3;  2WL1 A;  1O91 A;  1KXG A;  3IKW A;  3IMN A;  1UMZ A;  3H7J A;  3VDD C;  5BYN A;  1GNH A;  5DUU A;  3ENR A;  2PHX A;  4HFS A;  5D21 A;  5EYY A;  3T4V A;  4C1X A;  3LKJ A;  5E1R A;  5IFT A;  2XR4 A;  5KHJ A;  2Y6L A;  1CON A;  2LW8 A;  4MGK E;  4X8P A;  2D6N A;  2YHJ A;  4TYS A;  2GU9 A;  1GZW B;  2JDP A;  4PQ9 A;  5B4N A;  4RD7 A;  1UIK A;  3VBO A;  2CSG A;  1KEX A;  1NCQ B;  5FZL A;  4A7Y A;  5JSO A;  3KQ4 B;  4LTA A;  4QPI B;  5FY5 A;  4QPG C;  3W5N A;  2RM2 2;  4FP2 A;  1W8O A;  4P5H A;  3ILF A;  1S0E A;  3NAP C;  3E6C C;  5GJ6 A;  2ZGR A;  3VDD B;  1A8D A;  3NJV A;  1W8W A;  3DYP A;  4FPK A;  4Q1R A;  5GLV A;  4DRV A;  1KJR A;  3SH4 A;  4AOC A;  2GH8 A;  3D4K A;  3BU7 A;  2EF6 A;  3U75 A;  4P08 A;  4GB3 3;  5DAX A;  1QJY 3;  3TEW A;  2YBK A;  2VY0 A;  3EJK A;  5C9A C;  1RUE 3;  4LUL A;  4FPG A;  3VGI A;  3LWC A;  4DS0 A;  1YXW A;  5C5T A;  2OKX A;  1WCU A;  2XLG A;  3PL0 A;  1RUF 3;  1ST8 A;  1NXD 1;  3DEM A;  3GAL A;  1YRZ A;  1DYP A;  2BNN A;  2OII A;  2CU5 A;  3NST A;  4WM7 A;  4Y1Y A;  1QKQ A;  3ROU A;  4O9G A;  4N53 C;  4IQP A;  2KA3 A;  1PGW 1;  1IQA A;  2BP6 A;  1PO2 1;  1ULE A;  3IMM A;  4V2V A;  1D0G A;  3AXD A;  1BEV 2;  4Q0U A;  3U07 A;  3WV6 A;  5LEK A;  1S1A A;  2WRA A;  1DYO A;  4PHZ A;  1HRV 2;  4PI0 A;  2RDS A;  1G6N A;  3B02 A;  3CEW A;  3WW2 A;  4Y5S A;  3BOP A;  5F3G A;  4RFR B;  3WNN A;  2N7G A;  4NPR A;  1V9U 2;  5LRS A;  4HBN A;  4ES8 A;  5ISL A;  1X50 A;  2RS3 1;  1DGR N;  3J8F 3;  3M3C A;  1O7F A;  2ZHM A;  4SBV A;  2HWB 1;  5DDJ 3;  4I30 A;  5C8W A;  3SH5 A;  1LHW A;  4C0B A;  1TEI A;  1QH7 A;  1VBD 1;  2R6Q A;  3IDE A;  4LBK A;  4LMF A;  3LIG A;  3E6D A;  4W8J A;  4S2G A;  1FXZ A;  4ZXK A;  4QGM A;  4NHL A;  1QJZ A;  5FO7 B;  2EXJ A;  1ND2 A;  1JS9 A;  5J37 A;  5ACA 2;  5IK4 A;  4MO3 M;  3LEM A;  4E4H A;  2QQN A;  5I0R A;  1AZD A;  2GSY A;  2JD4 A;  3AK0 A;  2E7T A;  3HQX A;  5C4W C;  1K5J A;  2D6M A;  3POI A;  3A7Q A;  1W3X A;  2KD7 A;  3N9N A;  4Q4W 3;  3AMQ A;  4O7X A;  1J3Q A;  1QMJ A;  2VOK A;  3GDB A;  2XWB B;  3R0R A;  5C8C A;  4IEO A;  1PM7 A;  4WM8 B;  1WW4 A;  1LRH A;  4RFT 0;  1GMM A;  4H7L A;  4YW7 A;  1RUJ 1;  2WFP A;  5HCB A;  2D7F A;  1DGW X;  5FPB A;  3VBF B;  1CPN A;  5J1X A;  1EV1 2;  4MUV A;  3NRU A;  3VBH A;  3AL6 A;  3H7Y A;  3DPR C;  4HK9 A;  4NIA A;  5A3M A;  2C5D A;  3T2P A;  5FZC A;  1AR6 3;  5JR2 A;  3H8O A;  1CD3 G;  4QX8 A;  4CP2 A;  4MGT A;  1OD3 A;  3AMP A;  4LBM A;  1J1L A;  1WBF A;  1W8F A;  4XFI A;  2YC2 A;  3GJA A;  5GZD A;  3MEP A;  2CGO A;  2HEV F;  1QQP 1;  3S7I A;  2YRO A;  1H8T B;  5F6L B;  3OTF A;  2VZ1 A;  1PMI A;  1NY7 2;  2VTF A;  2VME A;  1H0B A;  1QWR A;  3MW2 A;  2BDR A;  3OG2 A;  4XFH A;  4CEY B;  4C90 A;  1CIW A;  4RHV 3;  1XXN A;  1LHV A;  3O1M A;  4FFF A;  4XQD A;  5I8S A;  1WA4 A;  2JE8 A;  2ID4 A;  2IVI B;  3G6J B;  4Q4X 2;  1EP0 A;  1VB4 A;  3WP6 A;  3VBH B;  1CAU B;  1GAN A;  5H9S A;  1W06 A;  3ZYR A;  5A3L A;  3NV2 A;  1AHS A;  1W9T A;  5FYZ A;  2QQP A;  3SKV A;  2RDQ A;  4UW6 A;  3N7K A;  3ZYH A;  4F3J A;  3AP9 A;  4M3C A;  4YM3 A;  1J59 A;  4JHZ A;  2VVF A;  1YFX A;  1TNR A;  1UKR A;  1WLT A;  4XJZ A;  2DFB A;  5GAL A;  5HPO A;  5J09 A;  3PIJ A;  2EXI A;  4WM7 C;  3M3E A;  2VZO A;  4COW A;  1GOH A;  5J36 A;  1AJO A;  1OKO A;  3H1Y A;  3RNS A;  3VKL A;  3CL1 A;  1AJK A;  3T0A A;  1GUI A;  1SLI A;  2AUY A;  4HON A;  4MGI E;  2G9G A;  3Q8E A;  1RUC 3;  1RUJ 3;  4NWW A;  4QD2 A;  4DIN B;  2YUE A;  3KMH A;  4NMI A;  5LBE A;  5KXC A;  5M0T A;  1QXJ A;  2VQU A;  3N7L A;  4XQ4 A;  2VW0 A;  3NJY A;  3VD4 A;  5A7N A;  3N9P A;  2V72 A;  3VBU A;  1ZBA 3;  4URA A;  2HEY F;  5CFD C;  1QXR A;  1NZC A;  5FZF A;  1IZ3 A;  5BNO A;  1ZA7 A;  3OY8 B;  1SLT A;  3HNM A;  1EUU A;  3JD7 1;  1XPW A;  2VQT A;  2Y64 A;  5LWB A;  3UES A;  2HH9 A;  4BJ0 A;  4LKS A;  2ORZ A;  4OCT A;  3WD5 A;  1ND2 C;  2PLV 2;  5T5O A;  4AVT A;  1V9U 1;  5IAV A;  1RUO A;  1PHM A;  4BOW A;  1GWK A;  2X5I C;  4Q0P A;  2FZ2 A;  1UD1 A;  2H0V A;  1IQD C;  3URF A;  4Q4V 2;  1O8S A;  4DIQ A;  4QB2 A;  3ITQ A;  5T55 A;  2ARX A;  2HWB 3;  5FXV A;  3VDC A;  5JXH A;  3AMN A;  2RS3 3;  5ANN A;  1AYN 1;  3JU9 A;  5JI7 A;  2ARA A;  2J22 A;  2IZW A;  5FTT C;  1S0J A;  1OPO A;  1V6L A;  1QGL A;  1YIP A;  3I8T A;  1UQX A;  5FLJ A;  1DIW A;  1PO2 3;  5CBL A;  1SAC A;  3ETP A;  3AMM A;  2XG3 A;  4JTN A;  4Z8B A;  1SMV A;  3I3Q A;  5LEJ A;  2BGO A;  2YMZ A;  3VD3 A;  1HV0 A;  1C1L A;  4YNI A;  2ZMK A;  4NR1 A;  4BLJ A;  2QQI A;  5FZ9 A;  2DCY A;  2JG9 A;  4QQ2 A;  5DUV A;  1PGL 1;  1YFW A;  1G9D A;  1JZ3 A;  3GBG A;  3LB9 A;  4YAR A;  4MG2 A;  4KG0 A;  4L2N A;  1HRI 1;  2HWF 3;  2J1U A;  5H9Q A;  2DCZ A;  4NE9 A;  3ZN4 A;  1KIT A;  4AW7 A;  2VH9 A;  3T1M A;  1AR6 2;  1RMU 1;  1CAV B;  1AX2 A;  1OUR A;  4K21 A;  3W20 A;  1A8M A;  2Z79 A;  3UYJ A;  5FZM A;  4I3G A;  5LAT A;  4ZZ5 A;  4Y1U A;  1OH3 A;  3B9C A;  5CEH A;  4A7Z A;  3AZY A;  2OT7 A;  1E57 A;  3N7M A;  3T0D A;  2WS9 1;  4NUB A;  1JOD A;  2ET1 A;  1RED A;  2P37 A;  4NII A;  4S2H A;  1JYC A;  2IXC A;  3MIC A;  4AI0 A;  5FMB A;  3ABZ A;  1UL9 A;  3V0A A;  1W0N A;  2EXK A;  4IUG A;  4JQT A;  4Y20 B;  4Y20 A;  1AX0 A;  2R16 A;  3S0M A;  2ZX1 A;  5IVF A;  1R08 3;  4NAO A;  2IUW A;  4GH4 A;  1N1T A;  1UOG A;  3IPV B;  3ES4 A;  1Q5O A;  3PUI A;  4QWN A;  5FBZ A;  3VL9 A;  3SC7 X;  4QAW A;  1T6B X;  2IXJ A;  4GXL A;  4KWU A;  3VLB B;  1HB2 A;  1COV 3;  1RUG 2;  1J84 A;  1G86 A;  2VXR A;  2BWC A;  2DUP A;  2X8K A;  3H1M A;  5DMY A;  1IS3 A;  4N53 A;  3I2F A;  5CKM A;  4Q8K A;  1LAJ A;  4WZF A;  5FCC A;  3ST7 A;  4D6Q A;  1FOD 3;  4QQH A;  4XYX A;  1AX1 A;  1SCS A;  4LE4 A;  1HLC A;  4GJZ A;  2FD8 A;  2CDP A;  2QCS B;  5LZ6 A;  4XMA A;  4GZ9 A;  4RQP C;  1FNZ A;  2HWF 2;  3FHA A;  1EYB A;  2RVA A;  2CYF A;  2ZS6 B;  3LIH A;  3OD0 A;  4Z82 A;  5F32 A;  4XJ9 A;  4EZ4 A;  1OHF A;  4UF0 B;  3WIN E;  1CX4 A;  1HXS 1;  1G9C A;  2EA7 A;  1Q43 A;  3X29 B;  1WUV A;  5D1I A;  2VQ0 A;  4E8D A;  5IJR A;  1SFP A;  1RXG A;  2WO3 A;  3AVR A;  4P9I A;  2X5I A;  3AC0 A;  2V5D A;  4A45 A;  1HN1 A;  4LBL A;  3ZDV A;  3OPW A;  2P2K A;  4H14 A;  2EVX A;  1GBG A;  3GZU C;  4YVW B;  1WBL A;  5A6Z A;  1OQE A;  1C8M 3;  2ZJC A;  1O4Z A;  2CY6 A;  5SV8 A;  1YFU A;  2DWR A;  3VZL A;  1QNY A;  4NVP A;  3ZMN A;  4I0W B;  1PK6 C;  3UL2 A;  5CYY A;  1QHD A;  5J48 A;  3I54 A;  1PZ7 A;  4HN0 A;  4AEJ A;  4PF5 A;  4BQY A;  1W8H A;  3WT3 A;  3BKZ A;  1UMI A;  3C7H A;  3UGF A;  3GXU A;  4XCA A;  2YZ4 A;  5DN2 A;  5LA0 A;  1D2Q A;  3WNK A;  3EO6 A;  1TVG A;  2VMC A;  3I97 A;  3J7L A;  4B7K A;  1W9F A;  1OI6 A;  1UU6 A;  3POF A;  5T5J A;  1JZ6 A;  5LK7 B;  1KS5 A;  4HZF A;  4JAA A;  2PHW A;  2ZX3 A;  3WW4 A;  1KRI A;  4WV8 A;  3DGT A;  4GWM A;  4OZX A;  4MXW B;  2YBS A;  4YZ5 A;  4NHM A;  4XIO A;  2RDN A;  5EJ1 B;  5FPA A;  4DUW A;  2UY8 A;  2BER A;  1FV2 A;  3FLT A;  3WNL A;  1OF4 A;  2XJU A;  4W6W A;  5CFD B;  5K7P A;  1CGP A;  4NHX A;  4JGZ C;  1Y43 B;  2BVB A;  2E32 A;  4RS5 B;  2EIG A;  3OSD A;  5FMC A;  3I2J A;  3W58 A;  3IAQ A;  2ZPX A;  3WQ7 A;  4G9S B;  1O3T A;  1Y3T A;  4D69 A;  1DQ6 A;  2NM1 A;  5FY9 A;  4G4F A;  1VR3 A;  2WSV A;  4XHB A;  1YO8 A;  1WLD A;  2RMU 1;  4YGB A;  4FFI A;  3CJI C;  3QOP A;  3WDX A;  2W5F A;  3III A;  2VUD A;  2G4I A;  5JWP A;  5GLU A;  2FDK A;  4IET A;  3VBU C;  2XDV A;  5LK5 A;  1CN1 A;  3SNM A;  2I74 A;  2PN5 A;  2XML A;  2IVJ A;  2JG8 B;  2PQQ A;  5JLV A;  5K9Y A;  5IAX A;  2FMD A;  5FZI A;  2WFF 3;  4F7Z A;  1YCI A;  4FT8 A;  2FHR A;  3NNJ A;  4ASL A;  1GP4 A;  4X6R B;  1S0I A;  1F31 A;  3O0V A;  4YGC A;  5FPZ A;  3VZM A;  3ZFE A;  2W3J A;  4AED C;  2G9Z A;  3H3Z A;  4XET A;  4B4P A;  2FZ1 A;  2BBV A;  4E2Q A;  4EWE A;  1UU4 A;  4OHY A;  5FIX A;  4UWD A;  4UBH A;  3PVE A;  1ASJ 1;  3AX4 A;  3QD6 A;  2D3R A;  3EMR A;  1AR9 1;  1JMU B;  2PAK A;  1US3 A;  3I7D A;  5EP9 A;  2VAU A;  1IOA A;  3FC0 A;  4HL0 A;  1DZT A;  2NQY A;  3K48 A;  4RGA A;  3UGH A;  4A44 A;  1IKP A;  2C4X A;  1XOY A;  4QGL A;  2AYH A;  1VBB 2;  1DCS A;  1ZBE 2;  3ZKU A;  3I2K A;  3ON7 A;  2VZ3 A;  3E5Q A;  3HJR A;  1VBA 1;  4X6Q B;  4B8E A;  4XAE A;  5AVP A;  4DUV A;  2ZHL A;  4ZU4 A;  5DUW A;  2Y0O A;  3THT A;  1GKB A;  1U5X A;  1XE0 A;  1O3S A;  2JG9 C;  1H9P A;  4OUM A;  1ZZ7 A;  5CNA A;  4D7S A;  1S0G A;  5FUN A;  5EJ3 A;  2GP5 A;  1Z7S 3;  2WA4 A;  5T5L A;  3T2Q A;  2HWC 3;  5FO8 B;  1X9T A;  4XDQ A;  4LIV A;  1VPH A;  1W9S A;  1FT9 A;  1W6Q B;  3N4M A;  1C5I A;  1AUY A;  4XJ8 A;  5FRE A;  4DXS A;  5A33 A;  1OA4 A;  4NHK A;  1NQD A;  1RUF 2;  5G05 L;  5CKN A;  1NXM A;  1RB8 G;  1LOD A;  1XRU A;  2QVS B;  2ZKL A;  1PK6 A;  1ENS A;  5A6Q A;  2FCT A;  3VHP A;  3WCS A;  4PI2 A;  3SLI A;  4GAZ A;  3P6B A;  3AP5 A;  1XNT A;  2WFF 2;  2ZGP A;  5IVC A;  5ACA 3;  2DTY A;  3JBG 1;  3IDC B;  3AYD A;  3NNF A;  3GNE A;  1AR7 1;  3QH6 A;  5FYB A;  1UIJ A;  1XQN A;  4W4Z A;  1CZT A;  1VE0 A;  1OXC A;  3USU B;  5C3P A;  4CEW C;  2F17 A;  2XBO 3;  5JPM B;  2WNU B;  5DDJ 2;  1ULG A;  5IUQ A;  3HQU A;  2NLR A;  4M01 A;  4K1Z A;  1BCX A;  1FMD 3;  3DKW A;  3O1O A;  4CDX B;  3WNO A;  3MV0 1;  2Q30 A;  3F95 A;  4E4D X;  3VZN A;  1ZBE 3;  3B93 A;  1HIX A;  5L73 A;  3RGB A;  3HAG A;  4J25 A;  2K9Z A;  4QKN A;  3PLQ A;  2P17 A;  4AGG A;  4QX0 A;  4ASM B;  3AYA A;  2JB8 A;  3NV3 A;  4AFD A;  4DQA A;  5IFP A;  3RI9 A;  1YHF A;  4I01 A;  4ARY A;  2A1X A;  5GZC A;  1DDL A;  2Q0A A;  1QNW A;  1MS8 A;  4FAG A;  4BK4 A;  2W92 A;  4XFG A;  3GM8 A;  4CA9 A;  4CDQ C;  3MDP A;  5DPN A;  1F4H A;  4NRO A;  4CEW B;  1S2K A;  2OPW A;  3PU3 A;  4ZU7 A;  2QTW B;  1ZX5 A;  2XKO A;  1FMD 2;  4RS5 C;  3F2Z A;  5FXZ A;  5FPX A;  3Q9O A;  2IXH A;  2LRP A;  3WY6 A;  4XFF A;  3OJB A;  5KXD A;  3RS6 A;  2AGS A;  1BK0 A;  1E5R A;  3QAC A;  2OX0 A;  3K46 A;  4QHB A;  4K8R B;  2R7E B;  4AWD A;  4BIF A;  4P9G A;  1UY0 A;  3P3P A;  4GWJ A;  5IVB A;  5HV0 A;  5BNP B;  4PF1 A;  2BU9 A;  4N90 A;  5FKC A;  3MFA A;  1LED A;  4XQW A;  3PJY A;  1RUD 2;  4K40 A;  3VBU B;  4JGY C;  3U10 A;  3EB7 A;  4UBG A;  1YUD A;  5FZB A;  5FKB A;  2ZEZ A;  3ILN A;  3N9L A;  3ZR6 A;  1RC6 A;  4A4A A;  2Q5T A;  2X29 A;  2SLI A;  4CUC A;  1ACC A;  1ASJ 2;  3E5U A;  4QPY A;  2R30 A;  2XLF A;  1MEC 2;  5KHG A;  4AVS A;  4A2U A;  1URX A;  4O65 A;  5LCW L;  4RQP B;  1PO1 1;  1OKQ A;  3RZZ A;  3M3Q A;  5DAV A;  1EAH 2;  1UY3 A;  3CKH A;  4E27 A;  1H8V A;  2R07 2;  4KBZ A;  5GM0 A;  3MLK A;  4XFA A;  1IS5 A;  2JWP A;  4F83 A;  5AC9 2;  3VDB A;  3HT2 A;  3OBA A;  1DYK A;  5AVA A;  3DYO A;  5FUP A;  1TME 2;  1PVC 1;  1UPI A;  2VE1 A;  2VW2 A;  4QM9 A;  3H9A A;  4ZON A;  5FMO S;  2I2S A;  4LEJ A;  3T4H B;  1V6J A;  5KXB A;  4JZR A;  1RUH 3;  3OBT A;  4L11 A;  4TSV A;  4XAB A;  3INA A;  3O1P A;  4I02 A;  1IG3 A;  4M0N A;  2JDY A;  3ELN A;  1GWM A;  4HKO A;  4CTE A;  4CEY A;  1CQ9 A;  4XIL A;  3R4D B;  1JZ2 A;  1WCS A;  3KT4 A;  3N7J A;  5F39 A;  2VR4 A;  2RM2 1;  2UY9 A;  4PBO A;  4OI1 A;  5CU1 A;  1A78 A;  1LTE A;  1G9A A;  2C26 A;  2EAK A;  4BYY A;  3HD8 B;  4BH9 A;  4MYE A;  2W94 A;  3ZXA C;  5AFE A;  3VB9 A;  1UXX X;  3PNA A;  2PHT A;  1ODN A;  4QKF A;  2PAM A;  3ZXJ A;  3R05 A;  3S7E A;  2VVE A;  1JUH A;  1XBF A;  5FQ0 B;  3NNM A;  3THP A;  3UK9 A;  1HB3 A;  1WD4 A;  5A3T A;  3UNP A;  4OQ8 A;  1XSR A;  3JD7 2;  1SQ4 A;  4IEP A;  1D7P M;  4CDW B;  1OBN A;  1FOD 2;  1W6N B;  3PVB B;  4AQ2 A;  4ZPI A;  4YPJ A;  1TE1 B;  1EUT A;  3VZJ A;  4Q4Y 1;  1SG3 A;  1SDD B;  1REF A;  3OOX A;  3RYK A;  4ATF A;  4CXX A;  2UWA A;  2W1W A;  2VZT A;  4OHW A;  1COV 2;  1RUG 3;  3PUQ A;  4J1W A;  3UKV A;  3VV1 A;  5JVV A;  3CJI A;  1POV 1;  3S5A A;  2ZEW A;  2YPJ A;  1OSG A;  2R04 1;  2WWS A;  3R4S A;  4FTE A;  5JAX A;  2VZQ A;  4CSW A;  1W6M A;  4UFI A;  1UX6 A;  2BOI A;  1RUI 3;  3PUS A;  2SBA A;  1ZVF A;  1ZZ8 A;  1UPS A;  4B3N A;  1Q8Q A;  2XL9 A;  4CP0 A;  2OUH A;  4IE7 A;  1ZRR A;  4FOW A;  4LKE A;  4MAD A;  4OUS A;  1ND3 B;  2HWE 2;  3ATG A;  5H9P A;  1VBB 1;  1W6O A;  4K9S A;  1KS4 A;  1ZBE 1;  4AED B;  2RJ2 A;  4XBN A;  2HKX A;  3ZOI A;  3IDA A;  1GLH A;  3D0S A;  1FMD 1;  5BY5 A;  2VU9 A;  4O9E A;  4ITC A;  2BFU S;  1J83 A;  3BB6 A;  2E31 A;  1VBC 1;  4MGQ A;  4LA2 A;  4JVA A;  4CU8 A;  1MAC A;  2XKP A;  3KD4 A;  2Q4S A;  2B9V A;  3DUI A;  1MS1 A;  3CZU A;  4IEW A;  1AVB A;  3POY A;  4L0P A;  1LU2 A;  1CAX B;  2BJS A;  1AXZ A;  4JKM A;  4CDX A;  1UOJ A;  4BIO A;  4YZ2 A;  1S55 A;  3UJQ A;  3WR0 A;  5JMC A;  4XJA A;  1UW8 A;  2VMI A;  1BMV 1;  3D8C A;  4WVV A;  1AL2 1;  4R8H A;  4CEW A;  3ZFG C;  4AHY A;  4GUL A;  4ARX A;  5FMD A;  2JKX A;  3BVC A;  4AG4 A;  2PHU A;  4OI2 A;  1GNY A;  3AZZ A;  4JX0 A;  2Z2S B;  4GMP 1;  1HB1 A;  5FZE A;  2YBP A;  3C7F A;  3K75 B;  4EN6 B;  2A70 A;  1ZRI A;  3PDQ A;  2OQ6 A;  4YM2 A;  1VBA 3;  1H30 A;  2B4K A;  2XWJ B;  3BGA A;  1LGN A;  1JYI A;  1WD3 A;  2ET7 A;  4UW3 A;  4KNC A;  5FZO B;  1WW5 A;  5EQU A;  4Q4V 3;  4B1L A;  4YGE A;  4YG6 A;  3SKJ E;  2VPV A;  3ORJ A;  4P14 A;  2QNK A;  1ZA4 A;  3C8X A;  1CAU A;  3AKT A;  2GNM A;  2Q1Z B;  4LO8 A;  2D40 A;  2BWA A;  4CDU B;  3OBZ A;  1AR9 3;  2E33 A;  2F4L A; 
#chains in the Genus database with same CATH homology
 1UZ0 A;  4BXS V;  3T0A A;  1GUI A;  4TTG A;  1K45 A;  3C7E A;  2EIE A;  1JYX A;  4A3Z A;  2VQU A;  3ACG A;  4CVU A;  3VD4 A;  2WO2 A;  2V72 A;  4A6O A;  2W1S A;  2WQ8 A;  2VO5 A;  5LA2 A;  4M4R A;  4DUX A;  1JYW A;  4GWI A;  2LS6 A;  3HNM A;  1EUU A;  4QX3 A;  1XPW A;  2VQT A;  2Y64 A;  5B4X A;  3UES A;  4KMQ A;  4BJ0 A;  4QDQ A;  4LKS A;  2ORZ A;  2DDU A;  2QQM A;  3ACF A;  4D0Q A;  2VJX A;  2VCC A;  1IQD C;  1O8S A;  4M4P A;  1PMH X;  4QB2 A;  2J7M A;  2E26 A;  3VDC A;  5JXH A;  1UY4 A;  2VCB A;  2J22 A;  3MV1 1;  3HPN A;  3NJX A;  5DQ0 A;  5C7G A;  1UX7 A;  1K42 A;  4JKK A;  3ETP A;  2J1A A;  1O59 A;  1MPX A;  2BGO A;  3EYP A;  4OMD A;  2JDA A;  2QQI A;  4MOA A;  3K4A A;  1W8N A;  1NX9 A;  4BDV B;  1JZ3 A;  4PQQ A;  1PX4 A;  3I2I A;  3OEA A;  1XC6 A;  1OH4 A;  2EIC A;  2VM9 A;  3LEI A;  2J1U A;  1UYY A;  2W1U A;  2L9L A;  2WO1 A;  2XON A;  2VC9 A;  4OYU A;  3MUZ 1;  4ZZ5 A;  3T0D A;  3WQB A;  3FL7 A;  2WZ8 A;  3ABZ A;  1W0N A;  4IUG A;  1BHG A;  2W91 A;  3ECQ A;  2Y8K A;  5C70 A;  4XUN A;  5FUI A;  3PUI A;  3I2G A;  4QAW A;  2QQK A;  4KWU A;  4PT6 A;  1J84 A;  1L7Q A;  3I3E A;  5DMY A;  3I2F A;  1YQ2 A;  2CDP A;  3LEK A;  3WF4 A;  4GZ9 A;  1JZ4 A;  3FHA A;  2RVA A;  4XUQ A;  3K77 A;  1W99 A;  4QDS A;  2BBA A;  3WNP A;  2Y6G A;  4CUB A;  4E8D A;  5IJR A;  3OGS A;  5JUV A;  2WO3 A;  2VZR A;  3AC0 A;  2V5D A;  2WN3 A;  1HN1 A;  2VCA A;  3THC A;  4A45 A;  2VZV A;  1OT5 A;  3T09 A;  2XHN A;  2J1R A;  5HXM A;  2V4V A;  2XQX A;  4UAP A;  5CYY A;  4XUR A;  3DYM A;  3THD A;  2WZE A;  1CZS A;  3A22 A;  1KGY A;  1NKG A;  4UOJ A;  1UMI A;  3C7H A;  4XVH A;  3GXU A;  1W9W A;  1JYV A;  5DN2 A;  5EIY B;  5LA0 A;  4QX2 A;  3WNK A;  1TVG A;  2VMC A;  3I97 A;  1JZ6 A;  1JU4 A;  1ULP A;  2VZS A;  2QQJ A;  4QPW A;  4DUW A;  5EJ1 B;  2BER A;  3WNL A;  1OF4 A;  2E32 A;  2W1Q A;  3WNM A;  3LEG A;  2HYX A;  3I2J A;  3IAQ A;  4UI9 L;  4Z2A A;  2DCK A;  1NUK A;  1XNA A;  2ZEX A;  2Z4F A;  3HOB A;  3A21 A;  5JXG A;  1DLC A;  2W5F A;  2WAB A;  3III A;  1CZV A;  2QQO A;  2VZU A;  3VD3 A;  1UY2 A;  4CU9 A;  3LQC A;  5C71 A;  4FI9 A;  1OF3 A;  4CUA A;  2BZD A;  2J1S A;  3I3B A;  3LE0 A;  5LA1 A;  3ZM8 A;  3CDZ B;  2X05 A;  3C7O A;  2W3J A;  1T2X A;  5JXJ A;  3P1I A;  3IAP A;  3OGV A;  1US3 A;  3CZJ A;  2WYS A;  2ZEY A;  2BGP A;  1TG7 A;  3SEE A;  4OZO A;  4A44 A;  3HNY M;  4TXW A;  2C4X A;  4LPL A;  3I2K A;  2VZ3 A;  4QB1 A;  3HJR A;  2W87 A;  4RYD A;  2YG0 A;  4DUV A;  2DCJ A;  2J1V A;  5A1A A;  1F4A A;  1UYX A;  4CU7 A;  3T08 A;  1SHW B;  2PQS A;  3T2Q A;  4ZY9 A;  1W9S A;  4DXS A;  2C9K A;  4P00 B;  5G05 L;  1JZ7 A;  3WF1 A;  2W9X A;  2X09 A;  2EID A;  1JHJ A;  2RV9 A;  3P6B A;  1XNT A;  3E1F 1;  1RYY A;  1R64 A;  4QB6 A;  1WCQ A;  3HN3 A;  3VD5 A;  4W4Z A;  1GOF A;  1CZT A;  2WUH A;  2VOT A;  2WBK A;  1O8P A;  1PMJ X;  1UXZ A;  1GQP A;  3JXS A;  3A23 A;  5I0D A;  3WNO A;  3MV0 1;  4D8M A;  2Y6J A;  3I3D A;  3U37 A;  4QX0 A;  3BN6 A;  3HEI A;  4RN5 A;  5IFP A;  3WSO A;  3GGL A;  4ARY A;  3ACI A;  3WEZ A;  1L7R A;  2WAA A;  4JKL A;  2XOM A;  2VMD A;  4LHS A;  3MBW A;  1P8J A;  4BK4 A;  2W92 A;  3GM8 A;  4A41 A;  1JZ8 A;  1CX1 A;  5DPN A;  1F4H A;  2Y6H A;  4DXT A;  1PX3 A;  2WAO A;  2W47 A;  4OUE A;  3MO4 A;  3F2Z A;  4OMC A;  1K12 A;  4QX1 A;  5JXI A;  2W46 A;  3K46 A;  2R7E B;  1UY0 A;  3LPG A;  4GWJ A;  3OEB A;  4PF1 A;  1JI6 A;  2J1T A;  1DP0 A;  1H6X A;  4P02 B;  5IFT A;  3EB7 A;  2Y6L A;  5EJZ B;  3MUY 1;  2ZEZ A;  2LW8 A;  3IB3 A;  4A4A A;  4E8C A;  4CUC A;  4QDR A;  5B4N A;  3CIH A;  5LCW L;  3NNG A;  1KEX A;  1UY3 A;  3W5N A;  3CKH A;  1W8O A;  4ZXE A;  1UMH A;  3K4Z A;  3VDB A;  3OBA A;  3NJV A;  3DYP A;  5CZK A;  5JMO A;  3DYO A;  3J7H A;  4DEQ A;  3WF0 A;  4HG6 B;  5G04 L;  4DXR A;  2QBX A;  4P08 A;  3W5M A;  3LPF A;  1H6Y A;  2YC4 A;  3D3A A;  4ZZ8 A;  1K3I A;  3OGR A;  3OB8 A;  1JZ2 A;  3CQO A;  3HNB M;  2VR4 A;  2C26 A;  2OKX A;  3NQH A;  2W94 A;  1CIY A;  1UXX X;  2WN2 A;  2HLE A;  1DYO A;  3UNP A;  3C7G A;  1D7P M;  4YPJ A;  3WNN A;  1EUT A;  3UET A;  1SG3 A;  1SDD B;  3DEC A;  5IHR A;  2VZT A;  2W1W A;  1WKY A;  2ZEW A;  3PUH A;  3FN9 A;  4W8J A;  3VD9 A;  1NAE A;  2VZQ A;  1I5P A;  3I2H A;  4MGS A;  1US2 A;  3VDA A;  4MO3 M;  2ZXQ A;  4XZU G;  2WDB A;  2QQN A;  4MAD A;  5IYY A;  1UYZ A;  2KD7 A;  3A7Q A;  2RJ2 A;  2J1E A;  2X10 A;  3GDB A;  3IDA A;  1LNS A;  1UWW A;  1J83 A;  1GMM A;  4XUP A;  3T2O A;  2E31 A;  4MGQ A;  2VMF A;  5J1X A;  4LQR A;  4CU8 A;  2VL4 A;  3NRU A;  2B9V A;  2YFU A;  3CZU A;  2W95 A;  4A42 A;  3T2P A;  4L0P A;  5JR2 A;  3VD7 A;  3ACH A;  1OD3 A;  4JKM A;  3T0B A;  3CMG A;  2QQL A;  1JZ5 A;  1UY1 A;  4P5Y A;  4KI5 M;  2YC2 A;  4CU6 A;  4ARX A;  4W50 A;  2JKX A;  4BK5 A;  2VZ1 A;  4AG4 A;  5F7U A;  2VTF A;  2VME A;  1GNY A;  3OG2 A;  4DEV A;  4JX0 A;  2YB7 A;  2JD9 A;  2JE8 A;  2ID4 A;  3FHQ A;  2YFZ A;  3C7F A;  3K75 B;  3SEP A;  3WF2 A;  2B4K A;  2EIB A;  3BGA A;  2Y6K A;  1W9T A;  1ULO A;  3SKV A;  3SKJ E;  4JHZ A;  3K4D A;  3C8X A;  1JU3 A;  4ET7 A;  5HPO A;  2VZP A;  2ORX A;  1JYN A;  4AAX A;  1GU3 A;  2E33 A;  4XUT A;  1GOG A;  4XUO A;  2VZO A;  3WF3 A;  1GOH A;  2CDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...