3BN6A

Crystal structure of the c2 domain of bovine lactadherin at 1.67 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
CTEPLGLKDNTIPNKQITASSYYKTWGLSAFSWFPYYARLDNQGKFNAWTAQTNSASEWLQIDLGSQKRVTGIITQGARDFGHIQYVAAYRVAYGDDGVTWTEYKDPGASESKIFPGNMDNNSHKKNIFETPFQARFVRIQPVAWHNRITLRVELLGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of lactadherin C2 domain at 1.7A resolution with mutational and computational analyses of its membrane-binding motif.
pubmed doi rcsb
source organism Bos taurus
molecule tags Blood clotting, cell adhesion
molecule keywords Lactadherin
total genus 42
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3bn6A00
3OBAA 2WBKA 2XOMA 4DUWA 2OKXA 1JU4A 1W8NA 2CDOA 3HNYM 3FHAA 3WNNA 1JYXA 2J7MA 2W3JA 5C71A 5EJ1B 4DXSA 1UY2A 5G05L 3T2QA 2X10A 1GMMA 3EYPA 5J1XA 4DXRA 3CQOA 3F2ZA 4QX1A 4CUBA 1RYYA 3C7HA 4ZXEA 1T2XA 2RVAA 2XQXA 3WEZA 2WZEA 3P6BA 4JX0A 4DXTA 1I5PA 4QAWA 2E32A 1US2A 4OZOA 3ZM8A 4UI9L 2J22A 2Y6LA 2R7EB 3K4DA 4AAXA 2ID4A 2QQOA 4XUOA 5DN2A 3HEIA 1CZVA 4FI9A 3MUZ1 5JMOA 3BGAA 1JZ5A 5G04L 3CMGA 1J83A 2W87A 3NQHA 2X09A 1GU3A 3PUIA 3IIIA 2E26A 1K45A 3MO4A 3MUY1 2V5DA 3C7GA 4MADA 2VMFA 2BGPA 4TTGA 1UY4A 3P1IA 1GQPA 5HPOA 3HNBM 2Y6HA 4KMQA 4KI5M 2VM9A 1GOHA 3WF2A 2HLEA 2ORXA 3A7QA 4W4ZA 5LA1A 2LW8A 5JXGA 4A44A 2ZXQA 2VMCA 4QDQA 2X05A 3IAQA 3A23A 2VCAA 2QQLA 4GZ9A 4QPWA 4MOAA 2W46A 1SHWB 1CZTA 3I2JA 3C8XA 1UMIA 3WNLA 5JXJA 3U37A 3JXSA 3EB7A 2YFUA 2W1WA 4P5YA 2WUHA 3FL7A 1JZ7A 5CZKA 3ETPA 3PUHA 1XNTA 1W9SA 1XC6A 2W9XA 4BJ0A 1OT5A 2VMEA 2WAOA 2VZPA 1EUUA 5IJRA 2L9LA 1BHGA 2WN3A 2WO3A 3K4AA 2J1TA 3CKHA 2VL4A 5C7GA 3K4ZA 5EJZB 2WQ8A 2VMDA 5EIYB 1PMHX 1JZ8A 2VZOA 4GWIA 3C7FA 3WSOA 3LEGA 3HOBA 1UXZA 2LS6A 2QQMA 3IAPA 1IQDC 3NNGA 1UY3A 4IUGA 3I3EA 4XVHA 2C26A 5JXHA 3HNMA 2YFZA 1L7RA 3NJVA 1R64A 1PX3A 1UX7A 3GDBA 1PX4A 3MBWA 3W5MA 1SDDB 5DPNA 3C7OA 1H6YA 3AC0A 1H6XA 1JYWA 1O59A 1GOGA 1ULPA 1W8OA 4CU9A 4JKMA 3I2IA 4OMDA 2YG0A 4XUPA 2J1SA 2VZUA 3VDBA 3VD3A 1JZ4A 2VJXA 2VOTA 1UY1A 2V4VA 4E8DA 5FUIA 3ECQA 5IFPA 2ZEYA 2W47A 4MGQA 1XNAA 3A22A 4M4RA 2CDPA 3D3AA 3VDCA 3CZJA 3NJXA 1W9WA 4LPLA 1HN1A 2WABA 2VZVA 2VCBA 3I2GA 2WZ8A 1OH4A 2VZRA 2QBXA 3IDAA 4ZZ8A 2Y8KA 1P8JA 2Y6JA 2BGOA 1O8PA 3DYOA 1W99A 4BDVB 3T0AA 3SKJE 1JZ2A 3E1F1 3ACHA 3GXUA 1ULOA 2B4KA 3NRUA 2JKXA 1US3A 2EIDA 4TXWA 3WNPA 3T08A 3GGLA 3J7HA 1UMHA 2WDBA 1K42A 1UYXA 1CIYA 4ZZ5A 2VZ3A 2W95A 3ACFA 2WYSA 2QQKA 2VQUA 2VQTA 2WN2A 2W1UA 3CIHA 2XHNA 4XUTA 3UETA 1W0NA 3THCA 4BK4A 4BK5A 1JU3A 3WF0A 1PMJX 3OG2A 3HN3A 4DUXA 1GUIA 2Y6KA 2C4XA 1L7QA 2KD7A 3LPGA 4L0PA 3T0DA 2BZDA 1JHJA 2C9KA 3UESA 4CU7A 2VCCA 3LQCA 3LPFA 2JD9A 2J1AA 4M4PA 4QX3A 1K3IA 3K77A 4DUVA 1JYVA 4A3ZA 4KWUA 3MV01 1KGYA 1D7PM 2VTFA 1DYOA 1UWWA 4JHZA 5DQ0A 4MGSA 2VZQA 1K12A 5LCWL 3I2KA 4W8JA 4QB2A 4RN5A 3HPNA 2W91A 4XUNA 1LNSA 1DP0A 5IHRA 2ZEWA 2WO2A 2W5FA 3OGVA 5IYYA 2JDAA 2ORZA 1DLCA 4QX2A 2VZ1A 3GM8A 4JKLA 4PT6A 4LKSA 3VD5A 1UYYA 3MV11 1JZ3A 1UYZA 5B4XA 3ABZA 1WKYA 3WNOA 4CU8A 4ET7A 2EIEA 2VC9A 4W50A 1NAEA 1TG7A 2RJ2A 4DEVA 2QQNA 2E33A 3W5NA 4ARYA 3DECA 4ARXA 5HXMA 4QDSA 3WNKA 3VD4A 4CUAA 3T2OA 1GNYA 3UNPA 4PF1A 4A4AA 3VD9A 1UZ0A 2DCJA 2Y64A 3DYPA 4PQQA 5LA2A 2Y6GA 3CZUA 1F4AA 4E8CA 3ACGA 5IFTA 3T09A 4D0QA 5C70A 3OEAA 2W92A 2B9VA 1KEXA 2VO5A 3CDZB 4QB1A 4BXSV 3I2HA 5JR2A 3IB3A 3I3DA 3WF1A 1TVGA 3HJRA 4CVUA 4XUQA 3FN9A 4P00B 3T2PA 3VD7A 4A45A 2VR4A 4UOJA 5A1AA 3WF4A 2ZEZA 2BBAA 2E31A 1UXXX 1GOFA 2ZEXA 1O8SA 3WQBA 2WAAA 4YPJA 2Z4FA 3OB8A 4HG6B 1MPXA 4P02B 5F7UA 5JUVA 1W9TA 2PQSA 1J84A 2W1QA 3OGSA 4Z2AA 5LA0A 1WCQA 2VZSA 2J1UA 1NX9A 2W1SA 3FHQA 2QQIA 4P08A 3BN6A 3DYMA 4CU6A 4UAPA 2YC4A 4CUCA 2RV9A 1JYNA 3SEEA 2YC2A 3VDAA 3OGRA 4AG4A 1OD3A 2J1RA 4JKKA 2EIBA 3ACIA 4QDRA 3LEKA 4OUEA 1XPWA 1OF3A 3K75B 3OEBA 2W94A 1CX1A 2V72A 3I97A 4MO3M 5DMYA 3LE0A 4LHSA 3WF3A 5I0DA 3T0BA 4OMCA 4ZY9A 2DCKA 4DEQA 5JXIA 2DDUA 4OYUA 2XONA 4GWJA 5B4NA 2J1EA 1YQ2A 2YB7A 3WNMA 2VZTA 3SEPA 3SKVA 1SG3A 2HYXA 1NUKA 4A6OA 1JI6A 1F4HA 1OF4A 3LEIA 4A42A 4A41A 2EICA 5CYYA 4LQRA 3I2FA 2QQJA 3A21A 1UY0A 4XURA 3K46A 3I3BA 4QB6A 1JZ6A 2BERA 1NKGA 2J1VA 4D8MA 2JE8A 1CZSA 4QX0A 1EUTA 4XZUG 3C7EA 3THDA 4RYDA 2WO1A
chains in the Genus database with same CATH superfamily
2ZAAA 5A3UA 2QKDA 1RGSA 4W6YA 3ZPYA 1ACCA 2TUNA 2DVGA 3V0BA 1KDMA 5EP9A 4LE3A 4KU8A 1O4TA 2P37A 5F37A 1POV1 2ZABA 1C8M2 5ANNA 3GZUC 1JW6A 4PJYA 4Z2WA 1OOPA 2RS31 1RC6A 3PTYA 3SNMA 3CJIC 3T2QA 4DFSA 5LBFA 2V4AA 3EYPA 5J1XA 2F4PA 1GBGA 5K4LA 3WD5A 3PVOA 3EXUA 4CUBA 1GZWA 4Q8LA 1W0PA 1W8WA 1RINA 1S0GA 2P3YA 3JZVA 3BVCA 2ZMLA 4ASMB 2D6NA 2YPJA 3WP6A 5KWRA 2XQXA 3AXDA 2FD8A 3T3YA 2QZ3A 3NAPB 2WZEA 1AXZA 1H2MA 3UYJA 4Q4V1 3RGBA 1DIWA 4QAWA 4Y1YA 2XQRA 1LU1A 1LU2A 2TEPA 2EXKA 4IEWA 4Q4Y3 3QD6A 4MG2A 1K5JA 2MEV2 3UKVA 4I2OA 2ID4A 3L2YA 4XUOA 1DGWA 3HBKA 1Z0HA 1W3XA 3ZDSA 1VPHA 5IT6A 1EAH1 5J7MA 1CZVA 4FI9A 2ILMA 5G04L 3VDDB 4IE4A 5FMCA 5CFCB 5C8CC 3WDXA 5C8CB 5KXDA 1WW4A 1IS3A 1XOYA 5L7OB 3GCXA 3OPZA 2XJVA 3E6DA 4PCRA 4PIYA 4HN0A 4HSLA 1QNYA 1O6UA 1A8DA 3ZYGA 1DQ6A 1ENQA 2VMFA 5DAVA 3ZYHA 2BGPA 1UY4A 5CU1A 1J3PA 2EAKA 4LBQA 3ZMOA 4AR2A 5HPOA 4X8PA 4DQAA 5HCBA 5FY5A 3M8LA 4CCCA 1JUHA 3KCCA 1GQHA 5FY4A 3NAPC 1NLSA 4GALA 2ZXQA 4QDQA 2A75A 2X05A 5A7OA 5DDJ3 2GH2A 1LCLA 3VL9A 4RD7A 4BQXA 2HBUA 1LESA 2WNVB 1TMF2 4AFDA 3HIFA 4QPWA 3LAGA 3H1YA 3HVDA 3ZR6A 3O1SA 2B42B 2ZGSA 4AK3A 4AI0A 5FZEA 3RZLA 3LA3A 2SBAA 2AR6A 3I2JA 2RS13 4M0NA 1UMIA 1I9RA 3VUOA 3WNLA 2BTVC 4CDQA 1AX0A 5JXJA 4ZONA 4MVTA 4YVSA 3U0ZA 1QXJA 1Q8QA 1TME1 2OS2A 3EB7A 3HT2A 2VUJA 1FMD2 5FXVA 1HRV3 4W65A 3AXEA 1DYPA 4GKXA 1VAMA 3PUHA 1XNTA 4OI1A 4A7ZA 1W9SA 2LTNA 4ONUA 1BQPA 3R4UA 1C5IA 4HPKA 1BK0A 1ZZ7A 3KHBA 2VZPA 4HOOA 1KFUL 2XG3A 5FYIA 4KWJA 1GV9A 3M1HA 2O1QA 3AYAA 1D4M2 5A3NA 1IQAA 5C8CA 5HCHA 1GWMA 5L36A 2A5ZA 4DS0A 1SACA 4TYSA 3R4DB 3UKTA 4YGCA 1XSQA 4I0WB 1O4ZA 1MQTB 3VBFC 2ZPXA 2WA3A 2ZBJA 3K3NA 4FFHA 4NHYA 1HXS2 1O5LA 5BNQA 3AYCA 1NZCA 4XF4A 3OY8A 4NOTA 4UYBA 2JIJA 1PMHX 2V5YA 1W9FA 4K1YA 4COWA 4C90A 1ND3C 4UFHA 2XHKA 5A3MA 4QPIA 3WSOA 4XF1A 3HOBA 1UXZA 2QQMA 5JCTA 1G9DA 4YG0A 4BIOA 1VAVA 4XDPA 1IKPA 3LKJA 5ACA2 3I3EA 1YI7A 4IW3A 4XVHA 5LZ6A 2C26A 2O8OA 3H0OA 2VTXA 1HQWA 5FPZA 3VKFC 2VBDA 3H8UA 4N53A 3TEZA 1PZ7A 1VMHA 1Q56A 1R64A 3H7YA 4AFBA 1OQ1A 1W2OA 3ILRA 1AZDA 1PX4A 4M01A 3M7AA 3MBWA 5DZEA 4E27A 4F8AA 2HH9A 3E6CC 4FO9A 3C7OA 1H6YA 1PZ9A 2GC2A 1OLMA 1CD3G 3ST7A 2Z69A 1XYNA 1O59A 4AGRA 5K9YA 2WYFA 1AR91 1HB4A 2R30A 5FBZA 3MW2A 3ZXFA 4EZHA 2PHUA 2VTXJ 5A6YA 3JUUA 5JSOA 1A34A 4XABA 2YGMA 4Y1VA 2J1SA 4LXLA 1WUVA 5JI9A 1STMA 4AI1A 1O3SA 1SBEA 5M0TA 2WO1A 1AXKA 5BNOA 1WCDJ 4HVOA 1JZ4A 4NWWA 1F5JA 2DVBA 2WT1A 4LA2A 4AVBA 4E8DA 2WLPA 1ZRDA 5FYZA 1MS0A 4MGQA 2OPKA 1COV1 1MZEA 3GJAA 2VXRA 3O7OA 1ZZ6A 2NN8A 1Z7S2 4M4RA 5FZ1A 1PO23 1YIFA 2YROA 1SCRA 4WVMB 4IL7A 4AWDA 5ACA1 1ZBE1 1GSLA 3KWVA 1S4CA 1W9WA 4QMAA 4COYA 3I49A 2WABA 4I30A 1VAKA 2UWBA 4ATEA 1KITA 4EV0A 1UN1A 3K48A 3CJXA 5FZMA 2PQQA 4YGDA 4UFJA 1AF9A 5KXEA 2D6KA 1CAWA 3ES4A 3QOPA 2QE3A 1UZYA 3CLPA 3JCIA 3WP3A 3LSDA 1LECA 4LLFA 3T0AA 5F9TA 2ZGNA 4IERA 2ZHMA 1ODNA 4C1WA 1G9BA 3H8OA 4JDNA 4XIOA 5LBEA 5DG2A 1HXS3 1ULOA 2G19A 4TXWA 5ERLA 2RR12 3WT3A 1Y7BA 1LEMA 2MEV1 1CX4A 2WO7A 4JQRA 4UF0B 1NT0A 2R1BA 4CCDA 1UYXA 5F3IA 4H55A 2XBO2 5B2GB 4QGMA 4FQZA 1UIKA 1HV1A 4QXKA 3E6BA 4HPKB 1RMU1 3J8F1 2RS11 5T54A 4KWKA 1QEXA 1X50A 3FFQA 4XBNA 2WYSA 2P4EA 2VQUA 4Z82A 4Q2FA 1X82A 2ES3A 1AX2A 2ZGLA 3SXWA 1F35A 2FDJA 1GWKA 1HRI1 2WNUC 4CXXA 1AYN3 3UETA 2Z79A 1REDA 5HV4A 2DF7A 3VBSC 2D44A 5FZHA 1KS5A 1RHI3 1C3HA 1AR82 4S2GA 4XZPA 2XVGA 3E5XA 1U0AA 2IFWA 2PHTA 2VPVA 3HAGA 3HN3A 1D4VB 2Y6KA 3MIGA 3FJSA 5AFBA 4Q0PA 5FYUA 4IEUA 1L7QA 4TWTA 1PIV2 5C9AC 2Q4SA 1C8M1 2FDFA 1W8TA 2WLQA 3J9SA 4CDWA 1JHJA 2C9KA 2HWF1 5JDBA 5LA9A 3O1RA 2AEZA 3ZYPA 1LHOA 4X6RB 5GZCA 4CU7A 1RUG1 2VCCA 3OYWA 2BRTA 5FP3A 3LPFA 4K7JA 4N53B 1OFSA 2WQ4A 3D4KA 4M4PA 2X8KA 4XBQA 1QJU1 1U5ZA 5AVPA 4UT5A 5FDBA 1BBT2 5JI7A 3GJBA 1LGCA 1HB3A 4XAAA 3FLRA 3K77A 1SDWA 3UK9A 1ZA7A 3T1MA 3NJYA 3D82A 2Y0OA 4MGTA 1NOVA 1W90A 1ZBE3 2D7FA 2VTFA 5GALA 1PVC1 3ZOIA 1DYOA 5BNPB 1XE0A 1RUI3 5KHGA 2GMPA 1QJY1 1PGSA 3MEPA 1FMD1 4J25A 4MHUA 5A32B 1XSRA 3VZNA 2NMOA 1W04A 1EV12 1XU2A 4ITCA 4EQVA 5ACA3 1GKBA 5CKNA 1OUXA 2BNNA 2N7GA 4QB2A 4RN5A 4YVWA 1QKQA 3HPNA 1EY2A 2D5FA 4NJ4A 5A6XA 3BOWA 4RS5B 4WVVA 1UZZA 4NMIA 2EA7A 1W6QA 1DP0A 4GQ7A 5F3EA 3GF6A 4BIFA 2ZEWA 1RUE2 3PDQA 4AEJA 4AGGA 5FZ6A 4P9WA 5J37A 4BDVB 4R9CA 1D2SA 2LM3A 2JDAA 4BMEA 2ZGTA 3ELNA 1DLCA 2XB6C 4QX2A 1HW5A 1XQNA 4FPHA 1FNYA 3HN1A 4PT6A 4KG8A 1GICA 3VD5A 3DXUA 1C5HA 2ZZJA 1UYYA 4WV8A 3BALA 1JZ3A 1UYZA 1FPN1 1ULGA 5B4XA 3S5QA 3VBUC 3JBG1 1CPNA 2XDVA 5A3OA 5A7WB 3N9QA 5FK8A 3USUA 5BNNB 1F8VA 3V64A 4Y3OA 4W50A 4OUSA 1NA1B 2XJQA 1S2BA 2RJ2A 4FPEA 3OYWB 3VKOA 2C9AA 5DDJ1 4DEVA 1ASJ1 3PUSA 3WDWA 1V6MA 5LEJA 1RUC3 4IDZA 2FHRA 5BNOC 5C5TA 1RUNA 1HX6A 4QDSA 1RVF1 2HWB2 1WMDA 4IGQA 1OOPB 1VBA2 2NLRA 3LDBA 4P9IA 1SFNA 5FIXA 3THPA 1O3QA 2H0VA 5SV5A 4S2DA 3AMNA 5J3UA 4DY3A 2ZX2A 1ZX5A 1KFXL 1UZ0A 3J7NA 4TN7A 5FY7A 5FZFA 1RVF3 2PN5A 2Y6GA 2X29A 1RTVA 3PUQA 4IEPA 4KU7A 1OUSA 2HBTA 2BNOA 1RUJ3 4AEMA 4Q4V2 4XTPA 1LGNA 1YRZA 4AL9A 2QTWB 3OCPA 1YQ8A 4YVWC 1AL23 1QDCA 1PM7A 3MICA 2XL7A 3OEAA 4N43B 4A7YA 5C70A 4RGGA 2HEYF 2RM22 1FOD3 3KF5A 4E9KA 4BXSV 1UPSA 1IHMA 4PLNA 3AFGA 1WGPA 2O14A 3AZVA 3WF1A 1TE1B 1TVGA 3ZIWA 4B7KA 4CVUA 1EV13 1OA3A 4EWEA 2CNAA 3FN9A 5DXDA 3KGZA 4CCOA 2R063 3FUOA 1POV0 5CBLA 2ZEZA 4XHBA 3ZFEB 2BBAA 5FZOA 1LJ7A 4Q4V3 1HXS1 2FBEA 3EMRA 3WXPA 5FOJB 1G6NA 1WCUA 3AVRA 4W6WA 2GNDA 5IVCA 1N1YA 1QOOA 1O8SA 3WZ1A 4Q4X1 3OGGA 2WAAA 3WQBA 2Z4FA 5BNPA 5CFCA 3USUB 5BNNA 4E4SA 1GYKA 1X7NA 3E97A 4AE2A 3U14A 1LOBA 1VRH2 4P02B 4QM8A 5I0TA 5CAZA 5HBAA 3FHIB 3I7DA 3KD4A 2W1QA 3CEWA 5BNOB 5LA0A 1C1FA 3ZLIA 1NX9A 1PO12 3BYWA 3POGA 4R8HA 3ZX7A 3CF6E 4WM7B 2X53S 3BTYA 4CU6A 2YC4A 4OQ8A 2WIIB 3HT1A 1DLLA 3OSDA 2D3RA 4YW3A 2FDKA 5JVVA 3N7JA 5KHHA 2Q8DA 1ENSA 4DXZA 4AG4A 4FOQA 5E8AA 3N9LA 1RJ7A 4UFIA 4AEDA 3BI3A 2IXCA 5FP9A 5FMOL 5EYYA 1QHDA 2CWMA 2RG4A 3GBGA 2HJIA 3OBTA 3LEKA 3ZPOA 3ZFGA 4OUEA 5I0RA 2DWRA 1OF3A 3K75B 3W59A 4UBHA 1CAUB 1F15A 3TEYA 1RUG2 2QZ2A 4FP2A 4I3PA 5JWPA 1TMF1 2V72A 3RPQA 4CEYB 3I97A 1W6MB 3IZOA 2K2SA 4EYUA 2Y26A 5FMBA 5A32A 5DMYA 1J3QA 2X5IB 3LE0A 5C8WA 1AR62 1XRUA 2ET1A 4LHSA 1W0OA 3WF3A 1MVEA 3N9OA 3B9IA 4ZU7A 2DCKA 3AVSA 1OURA 4DEQA 2I74A 2VD7A 2K9ZA 2XONA 2RS51 2YBSA 5A70A 2J1EA 1OBNA 2WL1A 3VV1A 5IVVA 3ZR5A 5JPMB 3CHXA 2UWCA 4FFGA 4Y5Z0 2I07B 4LORA 3SKVA 1W6PA 2HYXA 3H42B 1H4HA 1JMUB 1NUKA 3N9NA 4LOSA 3KGLA 3RQ0A 4C0BA 1OF4A 5L73A 4DO0A 1L3JA 2GALA 5JOWA 5FYVA 1XNDA 3SCGA 1LOGA 3I2FA 2QQJA 4LIVA 4BQWA 5L7OA 4OULA 3P3PA 4CDUA 5CNAA 1UPIA 1GZWB 1Z7S3 4R9BA 2EXHA 4C8DA 1ULEA 4HXCA 2AEYA 2FCVA 2IWGB 2ARAA 2BERA 2W08A 4N43A 4FXKB 4NWVA 2LROA 5GZFA 3RI8A 4ES9A 1NCRC 3AP9A 2PHXA 2R1DA 1HB2A 4P9YA 1PK6C 1GZTA 4MX3A 5A1FA 4QKNA 3THDA 4RYDA 4FPFA 3OBAA 2WBKA 5FP4A 4DUWA 1NLQA 4R9AA 1W06A 1RUH1 4NPRA 5GLWA 5L9BA 1PO13 4AEDC 1JHNA 1V6JA 2WC2A 2ZGUA 3HNYM 3WNNA 5C3OA 4LLOA 1WCKA 3VBOC 2GC1A 2GH8A 2W3JA 2WSUA 1R1ZA 5EJ1B 4A2UA 2ARCA 1PMIA 1UY2A 3M3IA 2VMHA 4PBPA 5EPAA 5FY9A 1VB4A 5JSRA 5D1IA 4COUA 1PGL1 1NE6A 3F2ZA 4Z92B 3Q8FA 2JDZA 3HR9A 4UWDA 4QX1A 3ORJA 1RYYA 1WW5A 1AL22 3DL3A 2JWPA 4N7UA 4ZXEA 4OHVA 3ZFFA 3VBHA 5FMOS 3WEZA 4AFAA 5KHJA 1BKZA 2D97A 3H1MA 1OLQA 4DPNA 1LHNA 3P6BA 2UU8A 4LBJA 4DXTA 4D69A 5EV7A 1FPN2 1SLAA 3RMYA 4BMBA 3NO8A 4Y33A 1FXZA 3AMHA 4LKDA 1G9CA 3UT0A 5FYSA 1TZOA 3OD4A 4K3UA 2R7EB 5FZ3A 2WFF1 3O1UA 3K4DA 2WS93 2G1MA 2QQOA 4AAXA 4BISA 4CCNA 5K0UB 3MPBA 3QLQA 4GWNA 2WZPP 3BCWA 4DRRA 1TME3 2ERFA 3HEIA 4NHLA 3ZFEA 3ETQA 3M70A 3H3LA 2OQ7A 4M3CF 5DABA 1FV2A 1J1TA 2JENA 5L7OC 4GA9A 3RJRA 5AC92 5CFDB 5CFDC 3CJIA 2X09A 3POYA 1LULA 1YUDA 3PUIA 5KC5A 2F6BA 1W6NA 2ZHLA 1BBT3 4OI4A 4V2WA 4NIIA 3KMHA 4QQLA 4ZS2A 2HWC1 2A71A 4Q4W1 3WG3A 5D21A 5CKMA 1J58A 1IS4A 2W68A 1Q3EA 5DAQA 2Z5WA 3SHRA 2XWBB 1QJY2 4DMIA 1GQPA 5BNNC 1ZA4A 3HNBM 2Y6HA 3SCHA 4KMQA 2VM9A 1EYBA 1GOHA 3CO2A 3WF2A 1VBB1 1XE8A 3A7QA 3KT7A 2LW8A 4V1PA 5JXGA 2AENA 5JZGC 2ZX3A 3V0BB 1K5MA 3HWJA 3RYPA 3A23A 4LO5B 4I0BA 4AYUA 3H8RA 2QQLA 4GZ9A 1CJDA 1LAJA 1LOAA 5A7NA 4IV1C 4CDXC 2VECA 1AR81 3AMQA 3TN91 2QNKA 2W46A 4QU1A 2XXZA 1JBCA 4QX7A 5EJ3A 3ZXKA 3RFRA 1HRI2 2NQYA 1S0BA 5DUUA 2PLV1 3H7JA 5FPVA 3RSJA 4BPZA 1AR73 4YZ5A 1OLRA 4ZHNA 1SFYA 3JXSA 1VBE2 3JD73 3S7EA 2RDSA 4XW3A 2PHWA 1POV3 2GMEA 3FL7A 1QQP1 1JS9A 4XACA 3OBZA 5K0UC 3UGGA 3KF3A 4P14A 3A0NA 3RYRA 4K6BA 4BOWA 1LHWA 3I59B 2JG8B 1Q8PA 3IDBB 3Q8EA 5BPXA 1UQXA 2WAOA 1LKNA 4YZ3A 3WDYA 4Q8KA 3N4MA 3QH7A 1CQ9A 5EYXA 1XNBA 5FY0A 4JGZC 2L9LA 1R1A2 1BHGA 2XJTA 1TEIA 1RUD3 4Y26A 4NIDA 1GNHA 1MS4A 2YDEA 1ONAA 1WW7A 2Q1FA 2J1TA 2MHFA 5TSWA 1Y9MA 3ZYFA 2CL2A 3C3VA 3K4ZA 1HQNA 2Y6FA 5EJZB 2WQ8A 4FPJA 3RMXA 2VMDA 3J4UH 4Q4Y2 4JGZB 3FBMA 4JCKA 1S2EA 3LFIA 1C57A 4IEZA 4YVWB 3VHOA 1EP0A 5D8AA 5DZGA 2E7TA 3VZKA 2VW2A 3LEGA 3ILNA 3MYXA 1AJOA 1AR83 2LS6A 3IAPA 4QGNA 1UY3A 2UYBA 4FOYA 4R9DA 1VP6A 5FFOC 3WINE 4OQ9A 3BB6A 2DUQA 3EHKA 2VGDA 3IKWA 3ZSLA 5JZGA 5FZ0A 1MS9A 2YFZA 3JQWA 2A70A 1L7RA 2R073 3NJVA 4HT1T 1NQJA 5H9RA 3RZKA 1XYPA 1SFPA 1PX3A 3GDBA 1DGRA 4XF9A 4Y20B 5DZFA 1VBB3 4G4FA 4PLOA 4Q4Y1 1J59A 2A6XA 4Q29A 1YYNA 2XBO1 1GOGA 1CAWB 1W8OA 4XYXA 1PO21 4X6QB 3BTZA 1F9KA 2K0GA 2JKBA 3I2IA 2YG0A 3MLKA 1W2TA 1COV3 2H6BA 4QWNA 1VBA1 2GNTA 2ZAHA 4INDA 2RMU3 1NZIA 2V4VA 4GH4A 5JPNB 1R092 2PAMA 3TN93 3GCWA 4YW7A 3TB0A 2OZ6A 1AR72 3ZSEA 1ASJ2 2ADDA 2D93A 1SBFA 1HRI3 4AXOA 4WM8C 4GJZA 2WNUA 2AREA 2ZGKA 2CDPA 1ZYBA 4QHZA 2Y60A 5JOZA 3VDCA 2BOJA 3AL6A 3CZJA 3M2MA 4F7ZA 1FI2A 3BIEA 3NJXA 4LPLA 4EWAA 4H7LA 1HN1A 1R082 3J7LA 3AP5A 3TRSB 2ZHNA 1SLBA 3I2GA 4J1WA 2PXJA 3VBSA 1P8JA 1H0BA 1YFXA 4QPGA 2XKOA 1IPKA 1W99A 3DYOA 5T5OA 1W39A 3GZAA 5F5CA 3WP4A 2VNRA 3ROUA 3R4SA 1ND3B 1V6NA 1NLRA 1RIRA 5C9AA 2JB4A 1D4M1 3KM5A 4QM9A 4AHZA 1OC1A 2B4KA 1Y3TA 2EXIA 2ARXA 3AZXA 1US3A 3FE5A 2D40A 1D2QA 4NRPA 4YZ4A 3WOGA 3WNPA 5FLHA 4PI0A 4XEZA 4CEWC 3J7HA 4NPLA 2AZ5A 1UMHA 2Z2SB 3ME2A 4B4QA 3AB0A 2BJSA 2YU1A 4MUVA 2AC1A 5FP7A 1CIYA 3C2UA 3UJOA 4PF5A 2ENRA 2R0HA 4ZZ5A 4PBOA 4WVMA 4YG3A 3JB8A 2W95A 1WA4A 3WCRA 2QQKA 1PIV3 1R081 2VQTA 4QD2A 2W1UA 1G9FA 2H6CA 5FZ4A 2D43A 2CHHA 4M3CE 2R16A 4AVCA 5F3CA 1NCQC 2D3SA 4XUTA 2IXHA 4WVWA 2PELA 4RGKA 1SLCA 4K1ZA 1W0NA 4XETA 4U36A 5FZIA 2ZHKA 4LBQD 2AUYA 4XFIA 4L97A 2ET7A 5E6HA 1JU3A 4XPVA 5FYMA 2IXIA 5HCFA 4DUXA 1GUIA 4IV1A 2ZKLA 3LPGA 4IEQA 3UKNA 3T0DA 5A33A 2PHLA 1RUJ2 1GFF2 2XJRA 3CBNA 1UCXA 2R041 3UESA 3TN92 5DG1A 3MDPA 1RUI2 2DBIA 2EIGA 1WLDA 1WLWA 2DCTA 1PHMA 3MLJA 5FYYA 2BPA2 4B1MA 2HWD2 3MZHA 3LQCA 1D4M3 1VBE3 1GP4A 3DN7A 1BBT1 3KV6A 4WM7A 4C0HA 1X9PA 2Q0AA 3RS6A 5I8TA 5IATA 2H0BA 1VBC3 3M3OA 2JICA 1BMV2 3BU0A 2RE9A 4DUVA 4EROA 4QPGB 3PL0A 1ZRFA 1A8MA 4CCLA 1RUF1 4H3WA 1CAUA 3VZLA 4MGKE 2R042 2XJPA 3CNAA 2VOWA 5EHDA 4A3ZA 1KGYA 1D7PM 2BW8A 2WFPA 5IK7A 3O0XA 2ZJCA 1H2NA 4FPYA 3ZFGB 5GLUA 1SCSA 1QXPA 4NAOA 3SMHA 2GZWA 1LR5A 2YU2A 1AX1A 3FLPA 5F39A 2E51A 1I6XA 3VN4A 3WQ7A 1QJEA 1CAVA 1LRHA 5F6LB 5FXXA 3POSA 3SISA 2Q8CA 4B8EA 4FFFA 1AXYA 1QDOA 1ND2B 1W2AX 1CAXB 4Y1ZA 3RYKA 2XJSA 2EF6A 4H7MA 1URXA 4NHMA 3S30A 3OGVA 5F1RA 1FMD3 3E5UA 4WBBA 4CSWA 2RR11 1MEC1 1W8HA 4ISQA 1YNAA 3IPVA 2QQPA 5ABJC 4JKLA 5JAXA 3W58A 1G7YA 3B5LB 4M0HA 3AZWA 5JR7B 4AW7A 1PNGA 1L7LA 1V9U1 1F31A 4K8FA 2F17A 1V6LA 5IAXA 4XHXA 3WNOA 4YM3A 4ET7A 1DZTA 1E5RA 1E5HA 2VC9A 5KC6A 1Y9QA 2J42A 2Q1ZB 3AL5A 4EJRA 1U12A 5JIUA 2W39A 1UOJA 4E4HA 4EWDA 1BEV2 1PGW1 1IKQA 2A1XA 4NIHA 4YGEA 1Z7S1 2ZX0A 2VAUA 4HKOA 2OVUA 4FTSA 4OI0A 3AK0A 3FLTA 1GNZA 4Y5SA 2ZGQA 4RQPC 2WT0A 4D7SA 2RJKA 2QQVA 3OUJA 2ZOEB 2YY1A 1NYWA 1UAIA 4UW5A 1QH6A 3VD4A 2HWF2 3UJQA 1GNYA 3UNPA 1G9AA 5T3NA 1FT9A 1RUH2 3A0KA 4KBZA 3NSTA 3VD9A 2X5IC 3ZO0B 3M3QA 5LA2A 3VBSB 4FSJA 4NRQA 5H9PA 1M06G 1QWRA 3TEWA 3G7DA 4FPCA 4IEYA 1IS6A 2A3WA 2W2IA 3VBUA 4BQ2A 5KBFA 1HJFA 5CG8A 2B9VA 4L92A 3CDZB 3EQEA 1BZWA 3TNQA 4QQPA 3WG4A 3WUDA 3LSEA 2BEOA 3URFA 1ULDA 3I3DA 1S1AA 4YM1A 3FX3A 1YIPA 2KA3A 4IGPA 3VD7A 4CA9A 1IGOA 5A1AA 2VW1A 3WF4A 4CEWA 1VE0A 1WMFA 4AGVA 1CIWA 2ZX1A 4D7TA 4QQOA 4UFLA 2CTVA 2VMIA 2YHJA 3VKLA 5LK7B 2TNFA 5EQUA 5APAA 3L9JT 3SCFA 3SITA 4P9GA 1MS1A 5ISLA 4YPJA 4MXWA 3BUCA 4ZU5A 1V6KA 4HG6B 5KR7A 4KGGA 5LW9A 1NCQA 1VBD1 1RUD2 3KZ4C 3ZKUA 2EAAA 1DGWX 1XJAA 5FMDA 1BJQA 2EALA 4HONA 3I3MA 2D6MA 2VUDA 2VZSA 2P2KA 4HBNA 4HN1A 4O61A 3JB4C 1RITA 1A78A 5LB6A 4AAPA 1POQA 1QF3A 2QCSB 2W1SA 2QQIA 5A3PA 2HWE1 5KXBA 3SH5A 5FY1A 3ES1A 1W6OA 4CUCA 4RQPA 1JYNA 1HIXA 2YC2A 2HWC3 2R32A 3VDAA 3OGRA 4YSFA 3GHNA 4LBOA 1ENRA 4BHPA 1UF2C 1OD3A 4JKKA 4AQSA 4LHLA 4K20A 4CDQC 4MHRA 4N43C 1IZ3A 4BWOA 4A3XA 1VBA3 2DYCA 2JDNA 2PHDA 1VMJA 4PLMA 1QJX3 4HVRA 5FK7A 1OVPA 3OEBA 3GBWA 2YC0A 3GZEA 3WW2A 5KHIA 4WZCA 5FUPA 1Z78A 2NZ9A 4EZ4A 5FBJA 4AQ6A 5FXZA 2OZJA 4BLJA 1U5IA 5DAWA 1NCRA 1FX5A 4OMCA 1WMXA 3WR0A 4YWAA 4FQ4A 1Y4WA 3PJQA 5JXIA 5FP8A 5AC93 4BB3A 1F2NA 4YRDA 2A6VA 3KSCA 4JGYA 3I2OA 3O12A 3FUQA 5C33A 3L2HA 3R0RA 3I3QA 1YQ2A 5B4NA 2YB7A 3WNMA 3KS7A 3USSA 1RXFA 5H9QA 3FWEA 3MW3A 4B7EA 4U2AA 2Z42A 5DUVA 2A7AA 5J48A 1LODA 4CP0A 2P17A 4MYEA 4JHTA 5FZBA 4FOWA 3T2TA 2WNVC 4A6OA 1F4HA 3ZFFC 1H8TB 4HKWA 3LF7A 4IESA 3U07A 3JBG2 3GYDA 2EICA 4OUMA 3RDIA 4NROA 1G8WA 3A21A 4BH9A 1MACA 1XBFA 2RDNA 1M4WA 4IV3B 4AOCA 1RUF2 4QB6A 3O1OA 1VR3A 1JZ6A 3O1TA 2KR2A 5T5LA 4N53C 2JG8C 3VHRA 4M3CB 5EXOA 5C3QA 1C1LA 2A73B 2WZR2 3IMNA 4QGLA 3RRDA 3ZYJB 4QX0A 4JVAA 4XZUG 3C7EA 1OA2A 3OUIA 1B35B 3KT1A 4XJUA 4NE9A 2OKXA 3S5AA 1JU4A 3I8TA 4XILA 2CDOA 1FPN3 3H3UA 3OPTA 1RUOA 1ENXA 1JYXA 4JDMA 1YFUA 4RS5C 4ASKA 2G9FA 3UV9A 1LEDA 4MGYE 3VBRC 1H1MA 3RG0A 4DNYA 5FZDA 3KVAA 4HMZA 2HWB1 1BXHA 3B01A 2MEV3 1OH3A 4OI2A 1GMMA 2FMYA 4GMP3 4CCJA 3QCWA 4YLZA 1PVC2 3AJZA 4JDOA 2OW4A 3CQOA 4DXRA 3OBRA 1LTEA 1UOBA 5FZ7A 2QJVA 3IMMA 4QKBA 5A7QA 4QXBA 5IK8A 4B4RA 5FRAA 2X5IA 1RUD1 2XVKA 3MF6A 4JC1A 1CPMA 1VBE1 2RS32 2IC1A 1YFWA 4TLFA 3VZJA 2G9ZA 3ZVXA 2JD4A 1O4YA 1I5PA 2XMLA 1ZZ9A 3KQ4B 1AHSA 1CAVB 3ZKYA 1KRIA 1US2A 1B09A 2XUMA 3I54A 4KQ7A 3ZM8A 3D0JA 4NHXA 4UI9L 1UZVA 1ALYA 3ASIA 2Y6LA 3APBA 1RHI2 3RI9A 2WA4A 4D3WA 5FXWA 4LBNA 4R52A 1GQGA 4UW3A 1PVC3 2BV4A 4Q0QA 1VBD3 2R49A 1UO9A 3MIDA 1ND2C 3MUZ1 1C8M3 4JTOA 5JMOA 3BGAA 1RUE1 4AZZA 3CMGA 2PAKA 1UX6A 1YI9A 3AJYA 3DPRA 4HK9A 4IEVA 2GN7A 4KBBA 3LWCA 2BFUS 1RUC1 2XVLA 1GU3A 3DKWA 1HDKA 3VZMA 3WW4A 2E26A 1K45A 1NXD1 2DURA 2V5DA 3MUY1 4AHYA 3JD72 1NCQB 1PVXA 2JDHA 4GIQA 3B00A 1H1AA 4LJHA 2XPJA 2VNGA 1ND3A 3H9AA 4IQPA 1B35A 2VBPA 4LIUA 1D0GA 5JMCA 4JRAA 4KI5M 4FP3A 1SLTA 3ILFA 4FFIA 5JZGB 2ORXA 1YWKA 4W4ZA 1KS4A 4AQTA 4FAHA 5LA1A 3LFMA 1YHFA 2VUCA 4RFT0 2ZGRA 4E2GA 5I0UA 1W3VA 2IXLA 2B39A 2P5BA 3IAQA 2VCAA 2PA7A 3MI8A 2C24A 5T52A 3WY6A 4AVTA 4BQ3A 1NE4A 3MLLA 5DUWA 4DIQA 1RVF2 4NR1A 4B4PA 1DYKA 2VNVA 4HZFA 4MOAA 5A3WA 3CJIB 2DTWA 1QXRA 3EO6A 4LO8A 1BEV1 1PGW2 2CWSA 1PO22 1AL0G 3AKPA 1SHWB 4Q0SA 4BU2A 4CDWC 4RL7A 3PHMA 1IG0A 3C8XA 4IV3A 4XAEA 3RJ2X 1JUIA 2B8MA 2WQZC 1QNWA 2B46X 1OKOA 2VCMA 3WW3A 1UZWA 1H2KA 4OHWA 5ANQA 3MHZA 3KLSA 4S2HA 3RWNA 5E16A 2W1WA 4N7IA 3BKZA 1PGL2 4P5YA 1U5XA 2WUHA 1JZ7A 5FY8A 3WDVA 3NNMA 4Y1UA 2AYHA 4ZKTB 2CSGA 4P5HA 4HL0A 2WNUB 3LDKA 1XC6A 5A3TA 3LEMA 2ZTNA 4BJ0A 1E5IA 3TEXA 2VMEA 3D5OA 3ZYRA 3AKQA 4OVEA 3M3EA 1BLZA 4AQ2A 4D7YA 3ZN6A 1TQ5A 3Q8AA 5FPAA 2EXJA 2XJUA 1R091 2OUJA 3CL1A 5IJRA 4QXCA 1N3PA 1T6GC 2WN3A 1Q8OA 5EZWA 3S7IA 3K2OA 1ULCA 2V09A 2WS92 4BQ1A 5BV6A 5A3LA 5JOYA 1UU5A 1FNZA 1BYHA 1HRV1 1WLCA 2VL4A 4CDXA 3MFCA 4XTMA 2RHPA 4DB5A 3QBQA 5FAXA 5D2AA 5CEHA 5GZGA 3NNFA 3WLUA 1JOPA 2CGPA 3Q9OA 2NYYA 4CP2A 1JZ8A 2VZOA 3PIGA 2WJSA 5BYNA 1AYN1 1SQ4A 1R1A3 5FV3A 4IUGA 1QU0A 1WZXA 5FYBA 1FAYA 2C1FA 1EPZA 5FR3A 4Y5TA 4NO4A 2Q5TA 5CB7A 4QT6A 4PDWC 1BK1A 5JSPA 4Q1RA 1YLLA 4RQPB 1OPMA 3B93A 4Y1XA 1UMZA 4OCTA 4XJWA 1ZM1A 1SDDB 1SBDA 4DZGA 1ULFA 4V2VA 1H9WA 1QY4A 3AC0A 3PMEA 1H6XA 3S6PA 4FBFA 1JYWA 1UOGA 2GU9A 4IV3C 3VGIA 1XXNA 4CU9A 4CDQB 1I1EA 4OMDA 4RR3B 2QDRA 1TNFA 1YCIA 4JGZA 2VZUA 3U78A 4LBKA 1YJKA 3GALA 2VOTA 1UY1A 3OUHA 4CRQA 4QXHA 1OLME 2W52A 3B94A 3ZFFB 4G3YC 5GKAC 2QDNA 3AZYA 3OF1A 3WG1A 5FUIA 5FWEA 1OA4A 1IPJA 3ECQA 4JQTA 1LOEA 1H9PA 2W47A 2IXJA 3KCXA 5IUQA 2OYZA 5IFPA 3B7MA 3KV5A 1XNAA 5FZLA 3A22A 1J3RA 1WD4A 2YV8A 3D3AA 4IEXA 4LOTA 2E7AA 2ZKNA 4LR4A 5FTTC 4LO7A 3POIA 4EN6B 4O7XA 1ZBA1 2Q8OA 4BQ5A 1OH4A 2VZRA 1MS3A 2JDPA 2QBXA 5GZEA 4ZZ8A 3S57A 2Y8KA 2D98A 5C3PA 3NV1A 2BGOA 1IOAA 1U5YA 2R071 3N7LA 4FT8A 4D6RA 4BM8A 4QX5A 1GLHA 1ASJ3 2DVAA 2ZZQA 1VRH1 3ACHA 3GXUA 3DPRC 4IV1B 1CGPA 3FC0A 2ETEA 3NRUA 4HKLA 2EIDA 2RMU2 5FCCA 4NRMA 2BVVA 3NMBA 1JYIA 1RUE3 2JXAA 4L9BA 4UFMA 4XCAA 1K42A 5L9VA 1AR93 1OQDA 4GMP0 4FPGA 4NUBA 4WM7C 5A1LA 3CU7A 2VH9A 2P3JA 2DUOA 4CP1A 4CZSA 2WSVA 3ITQA 1CR7A 1DDLA 2K46A 3CIHA 2DCYA 1WA6X 2XHNA 5E88A 1DHKB 3WV6A 3IIAA 1AL21 3NV3A 4HANA 4E2QA 2R072 3LZZA 5F8PA 2WWJA 3TOJA 1V6IA 4BK4A 4Z07A 1XNCA 2DTYA 2RS33 4LUMA 3WF0A 4AI9A 1PMJX 2XR4A 3OY8B 3OG2A 4YZ2A 4LHKA 1W03A 2KD7A 3KB5A 3AKSA 4EE2A 1YEWA 2JE7A 5C4WB 4YM0A 1HQLA 5DAXA 1C28A 5GLVA 2FMDA 3NNLA 4G9SB 5A7SA 3FBYA 3TNPB 4DINB 5ABJA 2VMGA 4RFRB 1MS5A 1DQ2A 2VNOA 2BQPA 1LHVA 2AH2A 5F2WA 1FOD1 4QX3A 1MZFA 4B1LA 4NHKA 1K3IA 2GC0A 4KWLA 2XUEA 4ISRA 3ZXGA 3B69A 2FDIA 3WUCA 4JZRA 4NAMA 1VRBA 4RSUA 5FKCA 1W05A 1N3OA 5KXCA 1JYTA 2YBPA 4L99A 5F32A 4LEJA 4QKFA 5F5QA 1N1VA 1EAH3 1SPPB 3N3HA 1PIV1 1R083 2GN3A 4JHZA 1W6MA 5DQ0A 1NG0A 4MGSA 1LB2A 2DUPA 5DDJ2 1JXNA 2DFCA 4N9HA 1QOTA 5E1RA 1AR63 3NKGA 4META 2GAUA 5C4WC 3OPWA 3B9CA 5CA6A 2W91A 1LOFC 1I3HA 1D0HA 2B9UA 5FQ0A 4XUNA 5FPUA 1N1SA 1ZRCA 4LE4A 1JH5A 1BEV3 2B5HA 1APNA 1SZBA 3JBG3 3LIHA 4GB32 2YGLA 4CTEA 2LRPA 4Y20A 4XBLA 4BQ4A 1DQ4A 1HV0A 4TLGA 1NA1C 1EAH2 5BXXA 1F5FA 4LKEA 4B3NA 4K21A 3ZMNA 4BCUA 2UYAA 2VZ1A 1AR61 5GLZA 1ZRIA 1QQP3 4LKSA 1EV11 5EIYB 3LGRA 1ZRRA 4ATFA 3MV11 1O5UA 1RB8G 3LOBA 1REFA 3ABZA 1WKYA 1DGLA 3R6SA 4IE6A 2JE9A 1NAEA 3ZXLA 3PVBB 3V56A 3ZSJA 4CP9B 1TG7A 4UF0A 5A7PA 1Q8SA 2QQNA 2VVDA 2E33A 3T30A 3VKMA 4ARYA 1LOCA 2RS52 5FPBA 4D6SA 2PYTA 1UU4A 2HWE2 1K5MB 2XKPA 3HBZA 4HSJA 4ARXA 5K8SA 2NPIA 4LBMA 1WCSA 3VBRB 4PHZA 4CUAA 1BMV1 1OMIA 1X8EA 2GC3A 3DV8A 3ZXJA 3DYPA 2GP5A 2Y64A 1YC61 3EBRA 2Y38A 3MGUA 3PVEA 3CZUA 4MZUA 2VULA 1F4AA 3TWIA 4E8CA 4MXWB 2HWD1 3ACGA 3ZFGC 4GKYA 1WMEA 2OPWA 2IXKA 4XQDA 1UKGA 3MFAA 2CGNA 4I3GA 2C5DA 5FZKA 3POJA 4YFZA 3FZ3A 4Q4W2 4XF3A 3UGFA 3J26N 1KEXA 1NY71 2VO5A 3DCQA 4QB1A 3I2HA 4P9JA 4JTNA 5JR2A 4YW4A 1SLIA 2FZ1A 2XBO3 3HJRA 3DF0A 2PMWB 3BODA 2IUWA 1H8TC 3NV4A 3RZHA 4TSVA 1KDKA 1OSGA 1KQRA 3TAYA 3G6JB 2CU5A 2VVFA 1MEC2 2JG9C 3PU3A 3WDUA 4CXYA 5FREA 5CADA 1YQCA 5FZAA 4QQ2A 5AVAA 1UNBA 1GOFA 3J7MA 3D8CA 4YFWA 1GR3A 1HRV2 5F6KA 3K51A 1Y43B 1W8ZA 1BVP1 4Z1VA 5BUVA 3PUAA 1SPPA 2VOKA 3OB8A 3M4FA 1S0FA 3N36A 4P9LA 4XF0A 2WZR1 2OIIA 4CDUB 3MIEA 2R0FA 2OT7A 1NCRB 3NW4A 1J84A 1ZBA3 3SC7X 2WS91 4HLTA 5FZ8A 1K5MC 3V65A 4Z2AA 4FVVA 4GJYA 5T55A 3UGHA 4CDWB 2E6VA 3I2DA 4JGYC 2J1UA 5FQ0B 1QJY3 4P08A 4Q4X2 2VU9A 1TMF3 2PHRA 2VVEA 4LUKA 2C6SA 2RJLA 4HFSA 2DU1A 3MPPG 3SEEA 4MLOA 3LD8A 3U75A 4AEKA 2WNVA 5EFUA 3ALQA 4CEWB 2Q30A 2WWUA 1CONA 4KH9A 2DV9A 2E63A 2OXBA 2XLAA 3ZIXA 3NL1A 4QDRA 4AHXA 4XQWA 2DFBA 4RHV1 5H9SA 3KHCA 3MIFA 4XIKA 3NWKA 1AYM2 4NIAA 4Q1PA 2W94A 1TME2 1S0DA 3TYJA 1W6NB 1VLNA 4MO3M 1V00A 2RR13 3HQXA 2ATFA 4KG0A 2GNBA 5IK5A 5I0DA 1QH7A 3T0BA 3FFZA 1H30A 2D6PA 1ST8A 1VMFA 4ZY9A 3ZXDA 4GD4A 3ZYBA 4BYYA 4TZDA 5FUNA 3BTXA 4L11A 2DDUA 4OYUA 1RUF3 2IZWA 4XC9A 5FO7B 4ZXKA 4ZPIA 1NXMA 1VJ2A 1W6QB 1T6BX 2C0ZA 1CESA 3OOXA 4XJ8A 4Q4W3 1QJX1 3ATGA 2CYFA 1BVVA 4PIZA 3VBRA 1DZQA 4J6GA 3N9MA 1LOFA 1S0EA 2A6WA 4QU2A 3W20A 4URAA 2A3YA 1JI6A 4IE0A 5A80A 3LEIA 2ZA9A 4A42A 1CN1A 3PLQA 3NVCA 4A41A 4EN0A 3PVNA 4R4ZA 2OUHA 3JD71 1MZ6A 5CYYA 2CAUA 4LQRA 1H1IA 2OQ6A 4FAGA 1DFQA 4KL1A 2KM2A 3BTAA 3NV2A 4XFGA 2BU9A 4XURA 5DUXA 3UL2A 5CG9A 4OLLA 1O3RA 5D8AB 2WWSA 1OI6A 1NKGA 4CYDA 2J1VA 4FPLA 4D8MA 3AMMA 3EJKA 1CZSA 5FLIA 4CP9A 4Y22A 2VG9A 1EUTA 1JTZX 1Q5OA 4PDWB 2I2SA 3N7MA 1O91A 2XOMA 3O14A 3O1VA 3FMGA 1V9U3 1W8NA 2MPFA 2VOXA 3FHAA 1UU6A 4S2FA 2J7MA 4XXPA 4Q26A 1LENA 2QFEA 5C71A 4DXSA 5J96B 4MV2A 5FO8B 5E89A 5G05L 2ZMKA 3VL8A 2X10A 4HETA 2JEMA 3VLBB 4RR3A 5FWJA 1V0AA 4YGBA 3NKTA 2R6QA 4LULA 3VBFB 2FQPA 4OHYA 4OZXA 3C7HA 4OHXA 1RUH3 4WM8A 1T2XA 3AFKA 2RVAA 1O7FA 3BOPA 3VBUB 5EWSA 4BXFA 5I8YA 4JX0A 4NIGA 4LBQB 1GP5A 2E32A 3P5BA 2YBKA 4Q5OA 2FDGA 2VOVA 2IFRA 4OZOA 3OJBA 1A6CA 4QX8A 1KJLA 2J22A 2XH6A 1TNRA 1Q8VA 4LO6B 2YYOA 2BFUL 4XFAA 4ASLA 2JG8A 5FZGA 1QMJA 1ZREA 5DN2A 4OFGA 3Q8CA 1DQ0A 2G9GA 3V0AB 3AP4A 1MS8A 1WWYA 1JZ5A 1H8TA 1J83A 1OOPC 4AHWA 1X33A 1IG3A 4JV4A 2PTMA 2W87A 3NQHA 4I02A 1MR5A 2P3KA 5HV0A 1YJLA 3VDDC 5FKBA 2GSYA 5FOBB 1XB9A 4GULA 3N9PA 2EVXA 3IIIA 3MO4A 4E2SA 5FJHA 4FCAA 5I0SA 1KD7A 3B3QE 4I09A 3C7GA 1RXGA 4UW6A 3ZN5A 3O1MA 3P3NA 4MADA 1RMU3 3J8F3 4GMP1 1Q43A 4TTGA 2FDHA 5BNPC 5D8AC 1QJFA 3P1IA 2RS12 5LK5A 2PAEA 4RGAA 2RDQA 4P9XA 3RZMA 5L19A 3AYEA 1ZNPA 2HLEA 5HCAA 1RUI1 1ZZBA 4YM2A 2HEVF 2E53A 2RM21 4A44A 2JB8A 1AR71 4Q0UA 2VMCA 1W6OB 2BP6A 4XQ4A 2YMZA 4CCMA 2XGXA 1AYN2 1LHUA 2OX0A 1R1A1 1S0JA 4GB33 4QPYA 4QHOA 1RMU2 3J8F2 1UL9A 3PURA 2Q1MA 3ZSKA 3KCYA 4LMFA 3RZJA 3PNAA 3W21A 2CV6A 1JYCA 2TBVA 1CZTA 3H8XA 4W6XA 4YG6A 2W0XA 4I01A 5LASA 3WQ1A 1OFNA 1YO8A 2R062 4QPIC 3U37A 2VBBA 2WNEA 3U4XA 2YFUA 2NMNA 4LTAA 1DF0A 4ORFA 2P1BA 4MH0E 4UFKA 4GH4C 4NVPA 4RHV2 1HJGA 4Q27A 5CZKA 3ETPA 1PK6B 3LA2A 3B02A 5J36A 2W9XA 4PDWA 2YPDA 1WD3A 1OT5A 2QVSB 2JG9B 5FYTA 3ZFEC 5FLJA 1HKDA 2DCZA 2GNMA 3RNSA 1W28A 1EUUA 4GXLA 3VHPA 4COZA 2WO3A 4Q0VA 5CFDA 5IK4A 3K4AA 1LGBA 2XWJB 5DAPA 3D6EA 1WBLA 1KXGA 1VBD2 2HYKA 3AP7A 4LA3A 3VDDA 5J09A 3CKHA 3WX5A 5C7GA 3O1PA 5AFEA 4DRVA 4FTEA 3MIBA 3OTFA 1V6OA 3ACLA 4CXWA 2XL9A 2HKXA 1XE7A 4K40A 5LBBA 2DU0A 2HWB3 4GWIA 3C7FA 1ZBA2 5LATA 4YVSC 4FTBA 1YQ6A 4GAZA 4A7KA 5C9AB 3NNGA 4O9GA 1IQDC 3T4HB 3OGJA 4CDUC 3U4SA 1VBC1 3PJYA 4M3CA 5FYHA 5JXHA 2CY6A 3JU9A 2Q8EA 2PHFA 3H1WA 3HNMA 3HQUA 4AVSA 1AJKA 2D5HA 1JOJA 1DZRA 4QHBA 5HI0A 4SLIA 4E4DX 3F95A 1UX7A 2JX9A 4XFFA 4YARA 3W5MA 1NY72 5DPNA 2XLGA 3BIWE 5LY2A 1WBFA 2WNOA 3WCSA 5LRSA 1G86A 1UD1A 2WFF2 3KV9A 4LHNA 1ULPA 4KNCA 3GNEA 1E57A 4CDXB 5A6QA 2WKKA 4JKMA 1QOSA 1YFYA 4O9EA 4LK7A 4XUPA 3U10A 3VBFA 4DOUA 3SQOA 2A6YA 1X9TA 2JIGA 3VD3A 3VDBA 2SLIA 5F2SA 4CUGA 2ZMNA 2A6ZA 1FATA 2VJXA 3PTRB 4I0AA 3VBHB 4QKDA 4RR3C 4LK6A 3DXTA 4H14A 4XFHA 4BQYA 4F3JA 5FPLA 4IXLA 2UURA 3WW1A 2ZEYA 3SLIA 4CCKA 2ARBA 1VB2A 4XMIA 1QGLA 3IDEA 3RZGA 5ABJB 1NQDA 1FYUA 1E5SA 1VBB2 1W2UA 2AGSA 2BYVE 1DQ5A 1CJPA 3POEA 1SEFA 1CAXA 4ZS3A 2GDFA 4RA0A 4XCBA 2BWCA 2XLFA 2VZVA 2VCBA 3VKNA 4F83A 2WZ8A 3GHMA 2NM1A 3IDAA 1W9YA 4LKFA 1OPOA 3WQ0A 2Y6JA 4Y24A 4K8RB 1O8PA 1S2KA 4FOVA 1JOBA 1MQTA 3QH6A 4AVVA 1V9U2 3SKJE 1JZ2A 2O8QA 1GWLA 3E1F1 4YW5A 1VALA 4D6QA 2FZ2A 3U1XA 1EPWA 2ADEA 2JKXA 4COVA 2WR9A 4GB31 3N7KA 3WHTA 2OA2A 3T08A 2P34A 3O0WA 3GGLA 2WDBA 4N9IA 1AUYA 2HEWF 3ZDVA 1ODMA 5I91A 4LITA 2PLV3 3MIHA 3W9AA 4C1XA 1GANA 1QQP2 3MW4A 2WRAA 1DBNA 2P6CA 2VZ3A 4ES8A 2G4IA 1YQ5A 3ACFA 3DUIA 5FZOB 3ZSMA 2WN2A 2UY8A 3GZTB 2B45X 3O0VA 2I45A 4XE9A 1VRH3 4IGOA 5CIRA 4DY5A 2FCUA 5SV8A 2DBNA 3THCA 3R05A 1WW6A 4LNVA 1XYOA 3I4IA 4PI2A 3WP5A 3T4VA 4BK5A 1C8NA 5BY5A 4ZU4A 5A7WA 3AX4A 3M3CA 3POFA 3PMSA 4M00A 1HN0A 2JJ6A 4JRLA 4H2AA 3U11A 4FXGB 4NPMA 1X36A 2C4XA 2VXJA 2JECA 2ZCWA 5I8SA 2Y0IA 4L0PA 4GWMA 2BZDA 1NA1A 2KXLA 3SH3A 1PNFA 5FO9B 4O65A 1AR92 1COV2 2JDKA 5FZCA 2YUEA 3N35A 3S0MA 2D6LX 1IS5A 2VE1A 2WZR3 2BWAA 1IPSA 2B7YA 4XJ9A 2JD9A 2J1AA 1FOD2 1N1TA 2PFWA 1AYM3 1OVSA 2CAVA 4PIXA 4UBGA 5IWFA 2QQUA 5CISA 5IVBA 1N47A 5K0UA 3ZN6B 4AVAA 3WHUA 1QIQA 1JYVA 3H50A 1RUG3 4YW6A 5F5AA 2LALA 4KWUA 3MV01 4YYOA 3VZOA 3V0AA 4HVQA 4AFMA 3DEMA 5C6CA 5HXVA 1UWWA 4AI8A 4E4ZA 4CPBD 2E9QA 4BLIA 1S0IA 4L8QA 1S55A 2VZQA 1K12A 1J1LA 1FV3A 3VHNA 3I2KA 2P3IA 3AKTA 4LBLA 5T5JA 3RWKX 3LCPA 5LCWL 3PIJA 5LEKA 4GH4B 1A3KA 4W8JA 1UIJA 1UW8A 2JDYA 3ON7A 1RUC2 2ZGOA 3NNJA 1LNSA 3BU7A 5C3SA 2WT2A 2P6HA 5C5UA 3HMYA 1H8VA 5IHRA 2RMU1 1ZZCA 2FCTA 3AM2A 2WO2A 5GLTA 4XDQA 4MGZE 1KJRA 3LOIA 2W5FA 4K9SA 4SBVA 5IYYA 2ORZA 1ZVFA 1Y9GA 2Y34A 4CEYC 4X8NA 2R043 3HQRA 2BGCA 4QQHA 2HWF3 3GM8A 3THTA 3VB9A 1WLTA 4YW2A 4N90A 4OHZA 1OKQA 3IWZA 1XU1A 3IBMA 5JIAA 2NP0A 3AP6A 4CPBA 1OD5A 1QJU3 5A33B 1R093 4CU8A 3O5SA 2EIEA 3AMPA 3SH4A 5LWBA 4Y22B 5C4WA 3WVJA 1OQEA 4RHV3 3WNXA 4RS5A 4URTA 2UY9A 5LRRA 3BPZA 4UXAA 1PM4A 4JGYB 5IW0A 3W5NA 2GP3A 4WVZA 3DECA 4L2NA 4CCEA 5HXMA 2F4LA 4CE8A 1HLCA 2BBVA 4MXVA 1QJZA 5T50A 3WNKA 5F5IA 3ENRA 2JG9A 4IE7A 5FYCA 1OXCA 2BNMA 4AEDB 3IDCB 1JN2P 3D0SA 5LBCA 5T5PA 3T2OA 1HB1A 4PF1A 4A4AA 2DCJA 3X29B 4PQQA 3NJZA 5GZDA 5IVYA 1AYM1 3HD8B 5IFTA 1SLLA 2ZGMA 4HK8A 5CKQA 4WM8B 4IETA 2VQ0A 4YVSB 3T09A 5KHKA 1DQ1A 2JDUA 1UYPA 5FZ9A 3RVHA 2RS53 4KGQA 4D0QA 2E7QA 2D3PA 4PQ9A 3WDTA 1YXWA 2W92A 4LO4B 4QPGC 4WZFA 1C4RA 4JAAA 2ZACA 5I93A 2IVIB 4XFBA 1MQTC 2VY0A 2O0OA 3JQXA 4J1XA 3RZZA 4XJAA 3IB3A 3ZXAC 4AF9A 1ND2A 3PU8A 3IM0A 1RL3A 5JLVA 4XUQA 4A6SA 1GZCA 2VW0A 4XOGA 3ZYIB 3A4UA 4P00B 3T2PA 4A45A 2RDRA 1O3TA 2VR4A 1DU3D 4Z8BA 5F3GA 4UOJA 5FJKA 1PZ8A 5GJ6A 1V70A 1DGRN 4N8MA 4XDOA 1H4GA 2ZS6B 3VBOB 2DVFA 1UXXX 1OHFA 2E31A 1QJX2 2ZX4A 3BPSA 3LB9A 4IEOA 4R4XA 2A3XA 1REEA 2ZEXA 1W8UA 3WG2A 1S0CA 4EN8B 5IVJA 1UKRA 3KT4A 1B35C 1ZZ8A 2Y33A 1UOFA 3POWA 2QQWA 1MPXA 3K3OA 4QPIB 5C3RA 5F7UA 5JUVA 1W9TA 3IN9A 4UW4A 3KQRA 5JOXA 2PQSA 4YNIA 3NAPA 3OGSA 1CWPA 4EN7B 1WCQA 4YW1A 3FHQA 3MF9A 3LA7A 3BN6A 3DYMA 2UWAA 4UAPA 1GP6A 2D6OX 2RV9A 3AYDA 1BCXA 3QACA 4NN0A 4XXAA 1AVBA 2WINB 3POBA 1X8MA 4AI2A 3AZZA 1W6PB 3ZN4A 4IE5A 1H2LA 3E5QA 1W2NA 2J1RA 4XJZA 5CVRA 2EIBA 3IPVB 3ACIA 1DCSA 1N3QA 1QJU2 3DPRB 4AFCA 1ZBE2 4BZ4A 1SMVA 2PLV2 1MVQA 1XPWA 3H3ZA 5K7PA 2QUOA 2WFF3 4AI3A 4D94A 2VUAA 2BDRA 1CX1A 2HWE3 4Y4YA 2R061 1VIWB 3T1LA 3OD0A 3GBFA 3DKQA 4BA6A 1GZ9A 1PK6A 5GM0A 1XNKA 4Q4X3 4FPKA 5IVFA 1RJ8A 5CFCC 4LT5A 2BUKA 3INAA 4GWJA 4C91A 1MZ5A 3LDRA 2VZTA 2CGOA 1RUJ1 3SEPA 1W8FA 4MGIE 2V73A 3I59A 5FPXA 3VBOA 2MNGA 2HWC2 1SG3A 4B29A 3VBHC 3IT8A 5LY1A 4XMAA 2GMMA 5AC91 4EN9B 1PO11 2BVBA 2RM23 2JDMA 4BE3A 4Y4RA 3ZXEA 5A6ZA 2LUWA 2DVDA 1MEC3 2YZ4A 1UY0A 1JODA 2AACA 3K46A 3KVBA 3LIGA 4FPOB 4CEYA 2VQAA 1VBC2 3I3BA 3DGTA 1I5ZA 3KV4A 4XFCA 2IVJA 5L9RA 3TBDA 5IVEA 1RHI1 2YXSA 2ZGPA 3AKRA 2HWD3 2JE8A 4MSVA 3Q8BA 2BOIA 5IAVA 4YZ1A 1DG6A 5J98B 1CVNA
chains in the Genus database with same CATH topology
3OBAA 2WBKA 2XOMA 4DUWA 2OKXA 1JU4A 1W8NA 2CDOA 3HNYM 3FHAA 3WNNA 1JYXA 2J7MA 2W3JA 5C71A 5EJ1B 4DXSA 1UY2A 5G05L 3T2QA 2X10A 1GMMA 3EYPA 5J1XA 4DXRA 3CQOA 3F2ZA 4QX1A 4CUBA 1RYYA 3C7HA 4ZXEA 1T2XA 2RVAA 2XQXA 3WEZA 2WZEA 3P6BA 4JX0A 4DXTA 1I5PA 4QAWA 2E32A 1US2A 4OZOA 3ZM8A 4UI9L 2J22A 2Y6LA 2R7EB 3K4DA 4AAXA 2ID4A 2QQOA 4XUOA 5DN2A 3HEIA 1CZVA 4FI9A 3MUZ1 5JMOA 3BGAA 1JZ5A 5G04L 3CMGA 1J83A 2W87A 3NQHA 2X09A 1GU3A 3PUIA 3IIIA 2E26A 1K45A 3MO4A 3MUY1 2V5DA 3C7GA 4MADA 2VMFA 2BGPA 4TTGA 1UY4A 3P1IA 1GQPA 5HPOA 3HNBM 2Y6HA 4KMQA 4KI5M 2VM9A 1GOHA 3WF2A 2HLEA 2ORXA 3A7QA 4W4ZA 5LA1A 2LW8A 5JXGA 4A44A 2ZXQA 2VMCA 4QDQA 2X05A 3IAQA 3A23A 2VCAA 2QQLA 4GZ9A 4QPWA 4MOAA 2W46A 1SHWB 1CZTA 3I2JA 3C8XA 1UMIA 3WNLA 5JXJA 3U37A 3JXSA 3EB7A 2YFUA 2W1WA 4P5YA 2WUHA 3FL7A 1JZ7A 5CZKA 3ETPA 3PUHA 1XNTA 1W9SA 1XC6A 2W9XA 4BJ0A 1OT5A 2VMEA 2WAOA 2VZPA 1EUUA 5IJRA 2L9LA 1BHGA 2WN3A 2WO3A 3K4AA 2J1TA 3CKHA 2VL4A 5C7GA 3K4ZA 5EJZB 2WQ8A 2VMDA 5EIYB 1PMHX 1JZ8A 2VZOA 4GWIA 3C7FA 3WSOA 3LEGA 3HOBA 1UXZA 2LS6A 2QQMA 3IAPA 1IQDC 3NNGA 1UY3A 4IUGA 3I3EA 4XVHA 2C26A 5JXHA 3HNMA 2YFZA 1L7RA 3NJVA 1R64A 1PX3A 1UX7A 3GDBA 1PX4A 3MBWA 3W5MA 1SDDB 5DPNA 3C7OA 1H6YA 3AC0A 1H6XA 1JYWA 1O59A 1GOGA 1ULPA 1W8OA 4CU9A 4JKMA 3I2IA 4OMDA 2YG0A 4XUPA 2J1SA 2VZUA 3VDBA 3VD3A 1JZ4A 2VJXA 2VOTA 1UY1A 2V4VA 4E8DA 5FUIA 3ECQA 5IFPA 2ZEYA 2W47A 4MGQA 1XNAA 3A22A 4M4RA 2CDPA 3D3AA 3VDCA 3CZJA 3NJXA 1W9WA 4LPLA 1HN1A 2WABA 2VZVA 2VCBA 3I2GA 2WZ8A 1OH4A 2VZRA 2QBXA 3IDAA 4ZZ8A 2Y8KA 1P8JA 2Y6JA 2BGOA 1O8PA 3DYOA 1W99A 4BDVB 3T0AA 3SKJE 1JZ2A 3E1F1 3ACHA 3GXUA 1ULOA 2B4KA 3NRUA 2JKXA 1US3A 2EIDA 4TXWA 3WNPA 3T08A 3GGLA 3J7HA 1UMHA 2WDBA 1K42A 1UYXA 1CIYA 4ZZ5A 2VZ3A 2W95A 3ACFA 2WYSA 2QQKA 2VQUA 2VQTA 2WN2A 2W1UA 3CIHA 2XHNA 4XUTA 3UETA 1W0NA 3THCA 4BK4A 4BK5A 1JU3A 3WF0A 1PMJX 3OG2A 3HN3A 4DUXA 1GUIA 2Y6KA 2C4XA 1L7QA 2KD7A 3LPGA 4L0PA 3T0DA 2BZDA 1JHJA 2C9KA 3UESA 4CU7A 2VCCA 3LQCA 3LPFA 2JD9A 2J1AA 4M4PA 4QX3A 1K3IA 3K77A 4DUVA 1JYVA 4A3ZA 4KWUA 3MV01 1KGYA 1D7PM 2VTFA 1DYOA 1UWWA 4JHZA 5DQ0A 4MGSA 2VZQA 1K12A 5LCWL 3I2KA 4W8JA 4QB2A 4RN5A 3HPNA 2W91A 4XUNA 1LNSA 1DP0A 5IHRA 2ZEWA 2WO2A 2W5FA 3OGVA 5IYYA 2JDAA 2ORZA 1DLCA 4QX2A 2VZ1A 3GM8A 4JKLA 4PT6A 4LKSA 3VD5A 1UYYA 3MV11 1JZ3A 1UYZA 5B4XA 3ABZA 1WKYA 3WNOA 4CU8A 4ET7A 2EIEA 2VC9A 4W50A 1NAEA 1TG7A 2RJ2A 4DEVA 2QQNA 2E33A 3W5NA 4ARYA 3DECA 4ARXA 5HXMA 4QDSA 3WNKA 3VD4A 4CUAA 3T2OA 1GNYA 3UNPA 4PF1A 4A4AA 3VD9A 1UZ0A 2DCJA 2Y64A 3DYPA 4PQQA 5LA2A 2Y6GA 3CZUA 1F4AA 4E8CA 3ACGA 5IFTA 3T09A 4D0QA 5C70A 3OEAA 2W92A 2B9VA 1KEXA 2VO5A 3CDZB 4QB1A 4BXSV 3I2HA 5JR2A 3IB3A 3I3DA 3WF1A 1TVGA 3HJRA 4CVUA 4XUQA 3FN9A 4P00B 3T2PA 3VD7A 4A45A 2VR4A 4UOJA 5A1AA 3WF4A 2ZEZA 2BBAA 2E31A 1UXXX 1GOFA 2ZEXA 1O8SA 3WQBA 2WAAA 4YPJA 2Z4FA 3OB8A 4HG6B 1MPXA 4P02B 5F7UA 5JUVA 1W9TA 2PQSA 1J84A 2W1QA 3OGSA 4Z2AA 5LA0A 1WCQA 2VZSA 2J1UA 1NX9A 2W1SA 3FHQA 2QQIA 4P08A 3BN6A 3DYMA 4CU6A 4UAPA 2YC4A 4CUCA 2RV9A 1JYNA 3SEEA 2YC2A 3VDAA 3OGRA 4AG4A 1OD3A 2J1RA 4JKKA 2EIBA 3ACIA 4QDRA 3LEKA 4OUEA 1XPWA 1OF3A 3K75B 3OEBA 2W94A 1CX1A 2V72A 3I97A 4MO3M 5DMYA 3LE0A 4LHSA 3WF3A 5I0DA 3T0BA 4OMCA 4ZY9A 2DCKA 4DEQA 5JXIA 2DDUA 4OYUA 2XONA 4GWJA 5B4NA 2J1EA 1YQ2A 2YB7A 3WNMA 2VZTA 3SEPA 3SKVA 1SG3A 2HYXA 1NUKA 4A6OA 1JI6A 1F4HA 1OF4A 3LEIA 4A42A 4A41A 2EICA 5CYYA 4LQRA 3I2FA 2QQJA 3A21A 1UY0A 4XURA 3K46A 3I3BA 4QB6A 1JZ6A 2BERA 1NKGA 2J1VA 4D8MA 2JE8A 1CZSA 4QX0A 1EUTA 4XZUG 3C7EA 3THDA 4RYDA 2WO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBA A;  2WBK A;  2XOM A;  4DUW A;  2OKX A;  1JU4 A;  1W8N A;  2CDO A;  3HNY M;  3FHA A;  3WNN A;  1JYX A;  2J7M A;  2W3J A;  5C71 A;  5EJ1 B;  4DXS A;  1UY2 A;  5G05 L;  3T2Q A;  2X10 A;  1GMM A;  3EYP A;  5J1X A;  4DXR A;  3CQO A;  3F2Z A;  4QX1 A;  4CUB A;  1RYY A;  3C7H A;  4ZXE A;  1T2X A;  2RVA A;  2XQX A;  3WEZ A;  2WZE A;  3P6B A;  4JX0 A;  4DXT A;  1I5P A;  4QAW A;  2E32 A;  1US2 A;  4OZO A;  3ZM8 A;  4UI9 L;  2J22 A;  2Y6L A;  2R7E B;  3K4D A;  4AAX A;  2ID4 A;  2QQO A;  4XUO A;  5DN2 A;  3HEI A;  1CZV A;  4FI9 A;  3MUZ 1;  5JMO A;  3BGA A;  1JZ5 A;  5G04 L;  3CMG A;  1J83 A;  2W87 A;  3NQH A;  2X09 A;  1GU3 A;  3PUI A;  3III A;  2E26 A;  1K45 A;  3MO4 A;  3MUY 1;  2V5D A;  3C7G A;  4MAD A;  2VMF A;  2BGP A;  4TTG A;  1UY4 A;  3P1I A;  1GQP A;  5HPO A;  3HNB M;  2Y6H A;  4KMQ A;  4KI5 M;  2VM9 A;  1GOH A;  3WF2 A;  2HLE A;  2ORX A;  3A7Q A;  4W4Z A;  5LA1 A;  2LW8 A;  5JXG A;  4A44 A;  2ZXQ A;  2VMC A;  4QDQ A;  2X05 A;  3IAQ A;  3A23 A;  2VCA A;  2QQL A;  4GZ9 A;  4QPW A;  4MOA A;  2W46 A;  1SHW B;  1CZT A;  3I2J A;  3C8X A;  1UMI A;  3WNL A;  5JXJ A;  3U37 A;  3JXS A;  3EB7 A;  2YFU A;  2W1W A;  4P5Y A;  2WUH A;  3FL7 A;  1JZ7 A;  5CZK A;  3ETP A;  3PUH A;  1XNT A;  1W9S A;  1XC6 A;  2W9X A;  4BJ0 A;  1OT5 A;  2VME A;  2WAO A;  2VZP A;  1EUU A;  5IJR A;  2L9L A;  1BHG A;  2WN3 A;  2WO3 A;  3K4A A;  2J1T A;  3CKH A;  2VL4 A;  5C7G A;  3K4Z A;  5EJZ B;  2WQ8 A;  2VMD A;  5EIY B;  1PMH X;  1JZ8 A;  2VZO A;  4GWI A;  3C7F A;  3WSO A;  3LEG A;  3HOB A;  1UXZ A;  2LS6 A;  2QQM A;  3IAP A;  1IQD C;  3NNG A;  1UY3 A;  4IUG A;  3I3E A;  4XVH A;  2C26 A;  5JXH A;  3HNM A;  2YFZ A;  1L7R A;  3NJV A;  1R64 A;  1PX3 A;  1UX7 A;  3GDB A;  1PX4 A;  3MBW A;  3W5M A;  1SDD B;  5DPN A;  3C7O A;  1H6Y A;  3AC0 A;  1H6X A;  1JYW A;  1O59 A;  1GOG A;  1ULP A;  1W8O A;  4CU9 A;  4JKM A;  3I2I A;  4OMD A;  2YG0 A;  4XUP A;  2J1S A;  2VZU A;  3VDB A;  3VD3 A;  1JZ4 A;  2VJX A;  2VOT A;  1UY1 A;  2V4V A;  4E8D A;  5FUI A;  3ECQ A;  5IFP A;  2ZEY A;  2W47 A;  4MGQ A;  1XNA A;  3A22 A;  4M4R A;  2CDP A;  3D3A A;  3VDC A;  3CZJ A;  3NJX A;  1W9W A;  4LPL A;  1HN1 A;  2WAB A;  2VZV A;  2VCB A;  3I2G A;  2WZ8 A;  1OH4 A;  2VZR A;  2QBX A;  3IDA A;  4ZZ8 A;  2Y8K A;  1P8J A;  2Y6J A;  2BGO A;  1O8P A;  3DYO A;  1W99 A;  4BDV B;  3T0A A;  3SKJ E;  1JZ2 A;  3E1F 1;  3ACH A;  3GXU A;  1ULO A;  2B4K A;  3NRU A;  2JKX A;  1US3 A;  2EID A;  4TXW A;  3WNP A;  3T08 A;  3GGL A;  3J7H A;  1UMH A;  2WDB A;  1K42 A;  1UYX A;  1CIY A;  4ZZ5 A;  2VZ3 A;  2W95 A;  3ACF A;  2WYS A;  2QQK A;  2VQU A;  2VQT A;  2WN2 A;  2W1U A;  3CIH A;  2XHN A;  4XUT A;  3UET A;  1W0N A;  3THC A;  4BK4 A;  4BK5 A;  1JU3 A;  3WF0 A;  1PMJ X;  3OG2 A;  3HN3 A;  4DUX A;  1GUI A;  2Y6K A;  2C4X A;  1L7Q A;  2KD7 A;  3LPG A;  4L0P A;  3T0D A;  2BZD A;  1JHJ A;  2C9K A;  3UES A;  4CU7 A;  2VCC A;  3LQC A;  3LPF A;  2JD9 A;  2J1A A;  4M4P A;  4QX3 A;  1K3I A;  3K77 A;  4DUV A;  1JYV A;  4A3Z A;  4KWU A;  3MV0 1;  1KGY A;  1D7P M;  2VTF A;  1DYO A;  1UWW A;  4JHZ A;  5DQ0 A;  4MGS A;  2VZQ A;  1K12 A;  5LCW L;  3I2K A;  4W8J A;  4QB2 A;  4RN5 A;  3HPN A;  2W91 A;  4XUN A;  1LNS A;  1DP0 A;  5IHR A;  2ZEW A;  2WO2 A;  2W5F A;  3OGV A;  5IYY A;  2JDA A;  2ORZ A;  1DLC A;  4QX2 A;  2VZ1 A;  3GM8 A;  4JKL A;  4PT6 A;  4LKS A;  3VD5 A;  1UYY A;  3MV1 1;  1JZ3 A;  1UYZ A;  5B4X A;  3ABZ A;  1WKY A;  3WNO A;  4CU8 A;  4ET7 A;  2EIE A;  2VC9 A;  4W50 A;  1NAE A;  1TG7 A;  2RJ2 A;  4DEV A;  2QQN A;  2E33 A;  3W5N A;  4ARY A;  3DEC A;  4ARX A;  5HXM A;  4QDS A;  3WNK A;  3VD4 A;  4CUA A;  3T2O A;  1GNY A;  3UNP A;  4PF1 A;  4A4A A;  3VD9 A;  1UZ0 A;  2DCJ A;  2Y64 A;  3DYP A;  4PQQ A;  5LA2 A;  2Y6G A;  3CZU A;  1F4A A;  4E8C A;  3ACG A;  5IFT A;  3T09 A;  4D0Q A;  5C70 A;  3OEA A;  2W92 A;  2B9V A;  1KEX A;  2VO5 A;  3CDZ B;  4QB1 A;  4BXS V;  3I2H A;  5JR2 A;  3IB3 A;  3I3D A;  3WF1 A;  1TVG A;  3HJR A;  4CVU A;  4XUQ A;  3FN9 A;  4P00 B;  3T2P A;  3VD7 A;  4A45 A;  2VR4 A;  4UOJ A;  5A1A A;  3WF4 A;  2ZEZ A;  2BBA A;  2E31 A;  1UXX X;  1GOF A;  2ZEX A;  1O8S A;  3WQB A;  2WAA A;  4YPJ A;  2Z4F A;  3OB8 A;  4HG6 B;  1MPX A;  4P02 B;  5F7U A;  5JUV A;  1W9T A;  2PQS A;  1J84 A;  2W1Q A;  3OGS A;  4Z2A A;  5LA0 A;  1WCQ A;  2VZS A;  2J1U A;  1NX9 A;  2W1S A;  3FHQ A;  2QQI A;  4P08 A;  3BN6 A;  3DYM A;  4CU6 A;  4UAP A;  2YC4 A;  4CUC A;  2RV9 A;  1JYN A;  3SEE A;  2YC2 A;  3VDA A;  3OGR A;  4AG4 A;  1OD3 A;  2J1R A;  4JKK A;  2EIB A;  3ACI A;  4QDR A;  3LEK A;  4OUE A;  1XPW A;  1OF3 A;  3K75 B;  3OEB A;  2W94 A;  1CX1 A;  2V72 A;  3I97 A;  4MO3 M;  5DMY A;  3LE0 A;  4LHS A;  3WF3 A;  5I0D A;  3T0B A;  4OMC A;  4ZY9 A;  2DCK A;  4DEQ A;  5JXI A;  2DDU A;  4OYU A;  2XON A;  4GWJ A;  5B4N A;  2J1E A;  1YQ2 A;  2YB7 A;  3WNM A;  2VZT A;  3SEP A;  3SKV A;  1SG3 A;  2HYX A;  1NUK A;  4A6O A;  1JI6 A;  1F4H A;  1OF4 A;  3LEI A;  4A42 A;  4A41 A;  2EIC A;  5CYY A;  4LQR A;  3I2F A;  2QQJ A;  3A21 A;  1UY0 A;  4XUR A;  3K46 A;  3I3B A;  4QB6 A;  1JZ6 A;  2BER A;  1NKG A;  2J1V A;  4D8M A;  2JE8 A;  1CZS A;  4QX0 A;  1EUT A;  4XZU G;  3C7E A;  3THD A;  4RYD A;  2WO1 A; 
#chains in the Genus database with same CATH topology
 2ZAA A;  5A3U A;  2QKD A;  1RGS A;  4W6Y A;  3ZPY A;  1ACC A;  2TUN A;  2DVG A;  3V0B A;  1KDM A;  5EP9 A;  4LE3 A;  4KU8 A;  1O4T A;  2P37 A;  5F37 A;  1POV 1;  2ZAB A;  1C8M 2;  5ANN A;  3GZU C;  1JW6 A;  4PJY A;  4Z2W A;  1OOP A;  2RS3 1;  1RC6 A;  3PTY A;  3SNM A;  3CJI C;  3T2Q A;  4DFS A;  5LBF A;  2V4A A;  3EYP A;  5J1X A;  2F4P A;  1GBG A;  5K4L A;  3WD5 A;  3PVO A;  3EXU A;  4CUB A;  1GZW A;  4Q8L A;  1W0P A;  1W8W A;  1RIN A;  1S0G A;  2P3Y A;  3JZV A;  3BVC A;  2ZML A;  4ASM B;  2D6N A;  2YPJ A;  3WP6 A;  5KWR A;  2XQX A;  3AXD A;  2FD8 A;  3T3Y A;  2QZ3 A;  3NAP B;  2WZE A;  1AXZ A;  1H2M A;  3UYJ A;  4Q4V 1;  3RGB A;  1DIW A;  4QAW A;  4Y1Y A;  2XQR A;  1LU1 A;  1LU2 A;  2TEP A;  2EXK A;  4IEW A;  4Q4Y 3;  3QD6 A;  4MG2 A;  1K5J A;  2MEV 2;  3UKV A;  4I2O A;  2ID4 A;  3L2Y A;  4XUO A;  1DGW A;  3HBK A;  1Z0H A;  1W3X A;  3ZDS A;  1VPH A;  5IT6 A;  1EAH 1;  5J7M A;  1CZV A;  4FI9 A;  2ILM A;  5G04 L;  3VDD B;  4IE4 A;  5FMC A;  5CFC B;  5C8C C;  3WDX A;  5C8C B;  5KXD A;  1WW4 A;  1IS3 A;  1XOY A;  5L7O B;  3GCX A;  3OPZ A;  2XJV A;  3E6D A;  4PCR A;  4PIY A;  4HN0 A;  4HSL A;  1QNY A;  1O6U A;  1A8D A;  3ZYG A;  1DQ6 A;  1ENQ A;  2VMF A;  5DAV A;  3ZYH A;  2BGP A;  1UY4 A;  5CU1 A;  1J3P A;  2EAK A;  4LBQ A;  3ZMO A;  4AR2 A;  5HPO A;  4X8P A;  4DQA A;  5HCB A;  5FY5 A;  3M8L A;  4CCC A;  1JUH A;  3KCC A;  1GQH A;  5FY4 A;  3NAP C;  1NLS A;  4GAL A;  2ZXQ A;  4QDQ A;  2A75 A;  2X05 A;  5A7O A;  5DDJ 3;  2GH2 A;  1LCL A;  3VL9 A;  4RD7 A;  4BQX A;  2HBU A;  1LES A;  2WNV B;  1TMF 2;  4AFD A;  3HIF A;  4QPW A;  3LAG A;  3H1Y A;  3HVD A;  3ZR6 A;  3O1S A;  2B42 B;  2ZGS A;  4AK3 A;  4AI0 A;  5FZE A;  3RZL A;  3LA3 A;  2SBA A;  2AR6 A;  3I2J A;  2RS1 3;  4M0N A;  1UMI A;  1I9R A;  3VUO A;  3WNL A;  2BTV C;  4CDQ A;  1AX0 A;  5JXJ A;  4ZON A;  4MVT A;  4YVS A;  3U0Z A;  1QXJ A;  1Q8Q A;  1TME 1;  2OS2 A;  3EB7 A;  3HT2 A;  2VUJ A;  1FMD 2;  5FXV A;  1HRV 3;  4W65 A;  3AXE A;  1DYP A;  4GKX A;  1VAM A;  3PUH A;  1XNT A;  4OI1 A;  4A7Z A;  1W9S A;  2LTN A;  4ONU A;  1BQP A;  3R4U A;  1C5I A;  4HPK A;  1BK0 A;  1ZZ7 A;  3KHB A;  2VZP A;  4HOO A;  1KFU L;  2XG3 A;  5FYI A;  4KWJ A;  1GV9 A;  3M1H A;  2O1Q A;  3AYA A;  1D4M 2;  5A3N A;  1IQA A;  5C8C A;  5HCH A;  1GWM A;  5L36 A;  2A5Z A;  4DS0 A;  1SAC A;  4TYS A;  3R4D B;  3UKT A;  4YGC A;  1XSQ A;  4I0W B;  1O4Z A;  1MQT B;  3VBF C;  2ZPX A;  2WA3 A;  2ZBJ A;  3K3N A;  4FFH A;  4NHY A;  1HXS 2;  1O5L A;  5BNQ A;  3AYC A;  1NZC A;  4XF4 A;  3OY8 A;  4NOT A;  4UYB A;  2JIJ A;  1PMH X;  2V5Y A;  1W9F A;  4K1Y A;  4COW A;  4C90 A;  1ND3 C;  4UFH A;  2XHK A;  5A3M A;  4QPI A;  3WSO A;  4XF1 A;  3HOB A;  1UXZ A;  2QQM A;  5JCT A;  1G9D A;  4YG0 A;  4BIO A;  1VAV A;  4XDP A;  1IKP A;  3LKJ A;  5ACA 2;  3I3E A;  1YI7 A;  4IW3 A;  4XVH A;  5LZ6 A;  2C26 A;  2O8O A;  3H0O A;  2VTX A;  1HQW A;  5FPZ A;  3VKF C;  2VBD A;  3H8U A;  4N53 A;  3TEZ A;  1PZ7 A;  1VMH A;  1Q56 A;  1R64 A;  3H7Y A;  4AFB A;  1OQ1 A;  1W2O A;  3ILR A;  1AZD A;  1PX4 A;  4M01 A;  3M7A A;  3MBW A;  5DZE A;  4E27 A;  4F8A A;  2HH9 A;  3E6C C;  4FO9 A;  3C7O A;  1H6Y A;  1PZ9 A;  2GC2 A;  1OLM A;  1CD3 G;  3ST7 A;  2Z69 A;  1XYN A;  1O59 A;  4AGR A;  5K9Y A;  2WYF A;  1AR9 1;  1HB4 A;  2R30 A;  5FBZ A;  3MW2 A;  3ZXF A;  4EZH A;  2PHU A;  2VTX J;  5A6Y A;  3JUU A;  5JSO A;  1A34 A;  4XAB A;  2YGM A;  4Y1V A;  2J1S A;  4LXL A;  1WUV A;  5JI9 A;  1STM A;  4AI1 A;  1O3S A;  1SBE A;  5M0T A;  2WO1 A;  1AXK A;  5BNO A;  1WCD J;  4HVO A;  1JZ4 A;  4NWW A;  1F5J A;  2DVB A;  2WT1 A;  4LA2 A;  4AVB A;  4E8D A;  2WLP A;  1ZRD A;  5FYZ A;  1MS0 A;  4MGQ A;  2OPK A;  1COV 1;  1MZE A;  3GJA A;  2VXR A;  3O7O A;  1ZZ6 A;  2NN8 A;  1Z7S 2;  4M4R A;  5FZ1 A;  1PO2 3;  1YIF A;  2YRO A;  1SCR A;  4WVM B;  4IL7 A;  4AWD A;  5ACA 1;  1ZBE 1;  1GSL A;  3KWV A;  1S4C A;  1W9W A;  4QMA A;  4COY A;  3I49 A;  2WAB A;  4I30 A;  1VAK A;  2UWB A;  4ATE A;  1KIT A;  4EV0 A;  1UN1 A;  3K48 A;  3CJX A;  5FZM A;  2PQQ A;  4YGD A;  4UFJ A;  1AF9 A;  5KXE A;  2D6K A;  1CAW A;  3ES4 A;  3QOP A;  2QE3 A;  1UZY A;  3CLP A;  3JCI A;  3WP3 A;  3LSD A;  1LEC A;  4LLF A;  3T0A A;  5F9T A;  2ZGN A;  4IER A;  2ZHM A;  1ODN A;  4C1W A;  1G9B A;  3H8O A;  4JDN A;  4XIO A;  5LBE A;  5DG2 A;  1HXS 3;  1ULO A;  2G19 A;  4TXW A;  5ERL A;  2RR1 2;  3WT3 A;  1Y7B A;  1LEM A;  2MEV 1;  1CX4 A;  2WO7 A;  4JQR A;  4UF0 B;  1NT0 A;  2R1B A;  4CCD A;  1UYX A;  5F3I A;  4H55 A;  2XBO 2;  5B2G B;  4QGM A;  4FQZ A;  1UIK A;  1HV1 A;  4QXK A;  3E6B A;  4HPK B;  1RMU 1;  3J8F 1;  2RS1 1;  5T54 A;  4KWK A;  1QEX A;  1X50 A;  3FFQ A;  4XBN A;  2WYS A;  2P4E A;  2VQU A;  4Z82 A;  4Q2F A;  1X82 A;  2ES3 A;  1AX2 A;  2ZGL A;  3SXW A;  1F35 A;  2FDJ A;  1GWK A;  1HRI 1;  2WNU C;  4CXX A;  1AYN 3;  3UET A;  2Z79 A;  1RED A;  5HV4 A;  2DF7 A;  3VBS C;  2D44 A;  5FZH A;  1KS5 A;  1RHI 3;  1C3H A;  1AR8 2;  4S2G A;  4XZP A;  2XVG A;  3E5X A;  1U0A A;  2IFW A;  2PHT A;  2VPV A;  3HAG A;  3HN3 A;  1D4V B;  2Y6K A;  3MIG A;  3FJS A;  5AFB A;  4Q0P A;  5FYU A;  4IEU A;  1L7Q A;  4TWT A;  1PIV 2;  5C9A C;  2Q4S A;  1C8M 1;  2FDF A;  1W8T A;  2WLQ A;  3J9S A;  4CDW A;  1JHJ A;  2C9K A;  2HWF 1;  5JDB A;  5LA9 A;  3O1R A;  2AEZ A;  3ZYP A;  1LHO A;  4X6R B;  5GZC A;  4CU7 A;  1RUG 1;  2VCC A;  3OYW A;  2BRT A;  5FP3 A;  3LPF A;  4K7J A;  4N53 B;  1OFS A;  2WQ4 A;  3D4K A;  4M4P A;  2X8K A;  4XBQ A;  1QJU 1;  1U5Z A;  5AVP A;  4UT5 A;  5FDB A;  1BBT 2;  5JI7 A;  3GJB A;  1LGC A;  1HB3 A;  4XAA A;  3FLR A;  3K77 A;  1SDW A;  3UK9 A;  1ZA7 A;  3T1M A;  3NJY A;  3D82 A;  2Y0O A;  4MGT A;  1NOV A;  1W90 A;  1ZBE 3;  2D7F A;  2VTF A;  5GAL A;  1PVC 1;  3ZOI A;  1DYO A;  5BNP B;  1XE0 A;  1RUI 3;  5KHG A;  2GMP A;  1QJY 1;  1PGS A;  3MEP A;  1FMD 1;  4J25 A;  4MHU A;  5A32 B;  1XSR A;  3VZN A;  2NMO A;  1W04 A;  1EV1 2;  1XU2 A;  4ITC A;  4EQV A;  5ACA 3;  1GKB A;  5CKN A;  1OUX A;  2BNN A;  2N7G A;  4QB2 A;  4RN5 A;  4YVW A;  1QKQ A;  3HPN A;  1EY2 A;  2D5F A;  4NJ4 A;  5A6X A;  3BOW A;  4RS5 B;  4WVV A;  1UZZ A;  4NMI A;  2EA7 A;  1W6Q A;  1DP0 A;  4GQ7 A;  5F3E A;  3GF6 A;  4BIF A;  2ZEW A;  1RUE 2;  3PDQ A;  4AEJ A;  4AGG A;  5FZ6 A;  4P9W A;  5J37 A;  4BDV B;  4R9C A;  1D2S A;  2LM3 A;  2JDA A;  4BME A;  2ZGT A;  3ELN A;  1DLC A;  2XB6 C;  4QX2 A;  1HW5 A;  1XQN A;  4FPH A;  1FNY A;  3HN1 A;  4PT6 A;  4KG8 A;  1GIC A;  3VD5 A;  3DXU A;  1C5H A;  2ZZJ A;  1UYY A;  4WV8 A;  3BAL A;  1JZ3 A;  1UYZ A;  1FPN 1;  1ULG A;  5B4X A;  3S5Q A;  3VBU C;  3JBG 1;  1CPN A;  2XDV A;  5A3O A;  5A7W B;  3N9Q A;  5FK8 A;  3USU A;  5BNN B;  1F8V A;  3V64 A;  4Y3O A;  4W50 A;  4OUS A;  1NA1 B;  2XJQ A;  1S2B A;  2RJ2 A;  4FPE A;  3OYW B;  3VKO A;  2C9A A;  5DDJ 1;  4DEV A;  1ASJ 1;  3PUS A;  3WDW A;  1V6M A;  5LEJ A;  1RUC 3;  4IDZ A;  2FHR A;  5BNO C;  5C5T A;  1RUN A;  1HX6 A;  4QDS A;  1RVF 1;  2HWB 2;  1WMD A;  4IGQ A;  1OOP B;  1VBA 2;  2NLR A;  3LDB A;  4P9I A;  1SFN A;  5FIX A;  3THP A;  1O3Q A;  2H0V A;  5SV5 A;  4S2D A;  3AMN A;  5J3U A;  4DY3 A;  2ZX2 A;  1ZX5 A;  1KFX L;  1UZ0 A;  3J7N A;  4TN7 A;  5FY7 A;  5FZF A;  1RVF 3;  2PN5 A;  2Y6G A;  2X29 A;  1RTV A;  3PUQ A;  4IEP A;  4KU7 A;  1OUS A;  2HBT A;  2BNO A;  1RUJ 3;  4AEM A;  4Q4V 2;  4XTP A;  1LGN A;  1YRZ A;  4AL9 A;  2QTW B;  3OCP A;  1YQ8 A;  4YVW C;  1AL2 3;  1QDC A;  1PM7 A;  3MIC A;  2XL7 A;  3OEA A;  4N43 B;  4A7Y A;  5C70 A;  4RGG A;  2HEY F;  2RM2 2;  1FOD 3;  3KF5 A;  4E9K A;  4BXS V;  1UPS A;  1IHM A;  4PLN A;  3AFG A;  1WGP A;  2O14 A;  3AZV A;  3WF1 A;  1TE1 B;  1TVG A;  3ZIW A;  4B7K A;  4CVU A;  1EV1 3;  1OA3 A;  4EWE A;  2CNA A;  3FN9 A;  5DXD A;  3KGZ A;  4CCO A;  2R06 3;  3FUO A;  1POV 0;  5CBL A;  2ZEZ A;  4XHB A;  3ZFE B;  2BBA A;  5FZO A;  1LJ7 A;  4Q4V 3;  1HXS 1;  2FBE A;  3EMR A;  3WXP A;  5FOJ B;  1G6N A;  1WCU A;  3AVR A;  4W6W A;  2GND A;  5IVC A;  1N1Y A;  1QOO A;  1O8S A;  3WZ1 A;  4Q4X 1;  3OGG A;  2WAA A;  3WQB A;  2Z4F A;  5BNP A;  5CFC A;  3USU B;  5BNN A;  4E4S A;  1GYK A;  1X7N A;  3E97 A;  4AE2 A;  3U14 A;  1LOB A;  1VRH 2;  4P02 B;  4QM8 A;  5I0T A;  5CAZ A;  5HBA A;  3FHI B;  3I7D A;  3KD4 A;  2W1Q A;  3CEW A;  5BNO B;  5LA0 A;  1C1F A;  3ZLI A;  1NX9 A;  1PO1 2;  3BYW A;  3POG A;  4R8H A;  3ZX7 A;  3CF6 E;  4WM7 B;  2X53 S;  3BTY A;  4CU6 A;  2YC4 A;  4OQ8 A;  2WII B;  3HT1 A;  1DLL A;  3OSD A;  2D3R A;  4YW3 A;  2FDK A;  5JVV A;  3N7J A;  5KHH A;  2Q8D A;  1ENS A;  4DXZ A;  4AG4 A;  4FOQ A;  5E8A A;  3N9L A;  1RJ7 A;  4UFI A;  4AED A;  3BI3 A;  2IXC A;  5FP9 A;  5FMO L;  5EYY A;  1QHD A;  2CWM A;  2RG4 A;  3GBG A;  2HJI A;  3OBT A;  3LEK A;  3ZPO A;  3ZFG A;  4OUE A;  5I0R A;  2DWR A;  1OF3 A;  3K75 B;  3W59 A;  4UBH A;  1CAU B;  1F15 A;  3TEY A;  1RUG 2;  2QZ2 A;  4FP2 A;  4I3P A;  5JWP A;  1TMF 1;  2V72 A;  3RPQ A;  4CEY B;  3I97 A;  1W6M B;  3IZO A;  2K2S A;  4EYU A;  2Y26 A;  5FMB A;  5A32 A;  5DMY A;  1J3Q A;  2X5I B;  3LE0 A;  5C8W A;  1AR6 2;  1XRU A;  2ET1 A;  4LHS A;  1W0O A;  3WF3 A;  1MVE A;  3N9O A;  3B9I A;  4ZU7 A;  2DCK A;  3AVS A;  1OUR A;  4DEQ A;  2I74 A;  2VD7 A;  2K9Z A;  2XON A;  2RS5 1;  2YBS A;  5A70 A;  2J1E A;  1OBN A;  2WL1 A;  3VV1 A;  5IVV A;  3ZR5 A;  5JPM B;  3CHX A;  2UWC A;  4FFG A;  4Y5Z 0;  2I07 B;  4LOR A;  3SKV A;  1W6P A;  2HYX A;  3H42 B;  1H4H A;  1JMU B;  1NUK A;  3N9N A;  4LOS A;  3KGL A;  3RQ0 A;  4C0B A;  1OF4 A;  5L73 A;  4DO0 A;  1L3J A;  2GAL A;  5JOW A;  5FYV A;  1XND A;  3SCG A;  1LOG A;  3I2F A;  2QQJ A;  4LIV A;  4BQW A;  5L7O A;  4OUL A;  3P3P A;  4CDU A;  5CNA A;  1UPI A;  1GZW B;  1Z7S 3;  4R9B A;  2EXH A;  4C8D A;  1ULE A;  4HXC A;  2AEY A;  2FCV A;  2IWG B;  2ARA A;  2BER A;  2W08 A;  4N43 A;  4FXK B;  4NWV A;  2LRO A;  5GZF A;  3RI8 A;  4ES9 A;  1NCR C;  3AP9 A;  2PHX A;  2R1D A;  1HB2 A;  4P9Y A;  1PK6 C;  1GZT A;  4MX3 A;  5A1F A;  4QKN A;  3THD A;  4RYD A;  4FPF A;  3OBA A;  2WBK A;  5FP4 A;  4DUW A;  1NLQ A;  4R9A A;  1W06 A;  1RUH 1;  4NPR A;  5GLW A;  5L9B A;  1PO1 3;  4AED C;  1JHN A;  1V6J A;  2WC2 A;  2ZGU A;  3HNY M;  3WNN A;  5C3O A;  4LLO A;  1WCK A;  3VBO C;  2GC1 A;  2GH8 A;  2W3J A;  2WSU A;  1R1Z A;  5EJ1 B;  4A2U A;  2ARC A;  1PMI A;  1UY2 A;  3M3I A;  2VMH A;  4PBP A;  5EPA A;  5FY9 A;  1VB4 A;  5JSR A;  5D1I A;  4COU A;  1PGL 1;  1NE6 A;  3F2Z A;  4Z92 B;  3Q8F A;  2JDZ A;  3HR9 A;  4UWD A;  4QX1 A;  3ORJ A;  1RYY A;  1WW5 A;  1AL2 2;  3DL3 A;  2JWP A;  4N7U A;  4ZXE A;  4OHV A;  3ZFF A;  3VBH A;  5FMO S;  3WEZ A;  4AFA A;  5KHJ A;  1BKZ A;  2D97 A;  3H1M A;  1OLQ A;  4DPN A;  1LHN A;  3P6B A;  2UU8 A;  4LBJ A;  4DXT A;  4D69 A;  5EV7 A;  1FPN 2;  1SLA A;  3RMY A;  4BMB A;  3NO8 A;  4Y33 A;  1FXZ A;  3AMH A;  4LKD A;  1G9C A;  3UT0 A;  5FYS A;  1TZO A;  3OD4 A;  4K3U A;  2R7E B;  5FZ3 A;  2WFF 1;  3O1U A;  3K4D A;  2WS9 3;  2G1M A;  2QQO A;  4AAX A;  4BIS A;  4CCN A;  5K0U B;  3MPB A;  3QLQ A;  4GWN A;  2WZP P;  3BCW A;  4DRR A;  1TME 3;  2ERF A;  3HEI A;  4NHL A;  3ZFE A;  3ETQ A;  3M70 A;  3H3L A;  2OQ7 A;  4M3C F;  5DAB A;  1FV2 A;  1J1T A;  2JEN A;  5L7O C;  4GA9 A;  3RJR A;  5AC9 2;  5CFD B;  5CFD C;  3CJI A;  2X09 A;  3POY A;  1LUL A;  1YUD A;  3PUI A;  5KC5 A;  2F6B A;  1W6N A;  2ZHL A;  1BBT 3;  4OI4 A;  4V2W A;  4NII A;  3KMH A;  4QQL A;  4ZS2 A;  2HWC 1;  2A71 A;  4Q4W 1;  3WG3 A;  5D21 A;  5CKM A;  1J58 A;  1IS4 A;  2W68 A;  1Q3E A;  5DAQ A;  2Z5W A;  3SHR A;  2XWB B;  1QJY 2;  4DMI A;  1GQP A;  5BNN C;  1ZA4 A;  3HNB M;  2Y6H A;  3SCH A;  4KMQ A;  2VM9 A;  1EYB A;  1GOH A;  3CO2 A;  3WF2 A;  1VBB 1;  1XE8 A;  3A7Q A;  3KT7 A;  2LW8 A;  4V1P A;  5JXG A;  2AEN A;  5JZG C;  2ZX3 A;  3V0B B;  1K5M A;  3HWJ A;  3RYP A;  3A23 A;  4LO5 B;  4I0B A;  4AYU A;  3H8R A;  2QQL A;  4GZ9 A;  1CJD A;  1LAJ A;  1LOA A;  5A7N A;  4IV1 C;  4CDX C;  2VEC A;  1AR8 1;  3AMQ A;  3TN9 1;  2QNK A;  2W46 A;  4QU1 A;  2XXZ A;  1JBC A;  4QX7 A;  5EJ3 A;  3ZXK A;  3RFR A;  1HRI 2;  2NQY A;  1S0B A;  5DUU A;  2PLV 1;  3H7J A;  5FPV A;  3RSJ A;  4BPZ A;  1AR7 3;  4YZ5 A;  1OLR A;  4ZHN A;  1SFY A;  3JXS A;  1VBE 2;  3JD7 3;  3S7E A;  2RDS A;  4XW3 A;  2PHW A;  1POV 3;  2GME A;  3FL7 A;  1QQP 1;  1JS9 A;  4XAC A;  3OBZ A;  5K0U C;  3UGG A;  3KF3 A;  4P14 A;  3A0N A;  3RYR A;  4K6B A;  4BOW A;  1LHW A;  3I59 B;  2JG8 B;  1Q8P A;  3IDB B;  3Q8E A;  5BPX A;  1UQX A;  2WAO A;  1LKN A;  4YZ3 A;  3WDY A;  4Q8K A;  3N4M A;  3QH7 A;  1CQ9 A;  5EYX A;  1XNB A;  5FY0 A;  4JGZ C;  2L9L A;  1R1A 2;  1BHG A;  2XJT A;  1TEI A;  1RUD 3;  4Y26 A;  4NID A;  1GNH A;  1MS4 A;  2YDE A;  1ONA A;  1WW7 A;  2Q1F A;  2J1T A;  2MHF A;  5TSW A;  1Y9M A;  3ZYF A;  2CL2 A;  3C3V A;  3K4Z A;  1HQN A;  2Y6F A;  5EJZ B;  2WQ8 A;  4FPJ A;  3RMX A;  2VMD A;  3J4U H;  4Q4Y 2;  4JGZ B;  3FBM A;  4JCK A;  1S2E A;  3LFI A;  1C57 A;  4IEZ A;  4YVW B;  3VHO A;  1EP0 A;  5D8A A;  5DZG A;  2E7T A;  3VZK A;  2VW2 A;  3LEG A;  3ILN A;  3MYX A;  1AJO A;  1AR8 3;  2LS6 A;  3IAP A;  4QGN A;  1UY3 A;  2UYB A;  4FOY A;  4R9D A;  1VP6 A;  5FFO C;  3WIN E;  4OQ9 A;  3BB6 A;  2DUQ A;  3EHK A;  2VGD A;  3IKW A;  3ZSL A;  5JZG A;  5FZ0 A;  1MS9 A;  2YFZ A;  3JQW A;  2A70 A;  1L7R A;  2R07 3;  3NJV A;  4HT1 T;  1NQJ A;  5H9R A;  3RZK A;  1XYP A;  1SFP A;  1PX3 A;  3GDB A;  1DGR A;  4XF9 A;  4Y20 B;  5DZF A;  1VBB 3;  4G4F A;  4PLO A;  4Q4Y 1;  1J59 A;  2A6X A;  4Q29 A;  1YYN A;  2XBO 1;  1GOG A;  1CAW B;  1W8O A;  4XYX A;  1PO2 1;  4X6Q B;  3BTZ A;  1F9K A;  2K0G A;  2JKB A;  3I2I A;  2YG0 A;  3MLK A;  1W2T A;  1COV 3;  2H6B A;  4QWN A;  1VBA 1;  2GNT A;  2ZAH A;  4IND A;  2RMU 3;  1NZI A;  2V4V A;  4GH4 A;  5JPN B;  1R09 2;  2PAM A;  3TN9 3;  3GCW A;  4YW7 A;  3TB0 A;  2OZ6 A;  1AR7 2;  3ZSE A;  1ASJ 2;  2ADD A;  2D93 A;  1SBF A;  1HRI 3;  4AXO A;  4WM8 C;  4GJZ A;  2WNU A;  2ARE A;  2ZGK A;  2CDP A;  1ZYB A;  4QHZ A;  2Y60 A;  5JOZ A;  3VDC A;  2BOJ A;  3AL6 A;  3CZJ A;  3M2M A;  4F7Z A;  1FI2 A;  3BIE A;  3NJX A;  4LPL A;  4EWA A;  4H7L A;  1HN1 A;  1R08 2;  3J7L A;  3AP5 A;  3TRS B;  2ZHN A;  1SLB A;  3I2G A;  4J1W A;  2PXJ A;  3VBS A;  1P8J A;  1H0B A;  1YFX A;  4QPG A;  2XKO A;  1IPK A;  1W99 A;  3DYO A;  5T5O A;  1W39 A;  3GZA A;  5F5C A;  3WP4 A;  2VNR A;  3ROU A;  3R4S A;  1ND3 B;  1V6N A;  1NLR A;  1RIR A;  5C9A A;  2JB4 A;  1D4M 1;  3KM5 A;  4QM9 A;  4AHZ A;  1OC1 A;  2B4K A;  1Y3T A;  2EXI A;  2ARX A;  3AZX A;  1US3 A;  3FE5 A;  2D40 A;  1D2Q A;  4NRP A;  4YZ4 A;  3WOG A;  3WNP A;  5FLH A;  4PI0 A;  4XEZ A;  4CEW C;  3J7H A;  4NPL A;  2AZ5 A;  1UMH A;  2Z2S B;  3ME2 A;  4B4Q A;  3AB0 A;  2BJS A;  2YU1 A;  4MUV A;  2AC1 A;  5FP7 A;  1CIY A;  3C2U A;  3UJO A;  4PF5 A;  2ENR A;  2R0H A;  4ZZ5 A;  4PBO A;  4WVM A;  4YG3 A;  3JB8 A;  2W95 A;  1WA4 A;  3WCR A;  2QQK A;  1PIV 3;  1R08 1;  2VQT A;  4QD2 A;  2W1U A;  1G9F A;  2H6C A;  5FZ4 A;  2D43 A;  2CHH A;  4M3C E;  2R16 A;  4AVC A;  5F3C A;  1NCQ C;  2D3S A;  4XUT A;  2IXH A;  4WVW A;  2PEL A;  4RGK A;  1SLC A;  4K1Z A;  1W0N A;  4XET A;  4U36 A;  5FZI A;  2ZHK A;  4LBQ D;  2AUY A;  4XFI A;  4L97 A;  2ET7 A;  5E6H A;  1JU3 A;  4XPV A;  5FYM A;  2IXI A;  5HCF A;  4DUX A;  1GUI A;  4IV1 A;  2ZKL A;  3LPG A;  4IEQ A;  3UKN A;  3T0D A;  5A33 A;  2PHL A;  1RUJ 2;  1GFF 2;  2XJR A;  3CBN A;  1UCX A;  2R04 1;  3UES A;  3TN9 2;  5DG1 A;  3MDP A;  1RUI 2;  2DBI A;  2EIG A;  1WLD A;  1WLW A;  2DCT A;  1PHM A;  3MLJ A;  5FYY A;  2BPA 2;  4B1M A;  2HWD 2;  3MZH A;  3LQC A;  1D4M 3;  1VBE 3;  1GP4 A;  3DN7 A;  1BBT 1;  3KV6 A;  4WM7 A;  4C0H A;  1X9P A;  2Q0A A;  3RS6 A;  5I8T A;  5IAT A;  2H0B A;  1VBC 3;  3M3O A;  2JIC A;  1BMV 2;  3BU0 A;  2RE9 A;  4DUV A;  4ERO A;  4QPG B;  3PL0 A;  1ZRF A;  1A8M A;  4CCL A;  1RUF 1;  4H3W A;  1CAU A;  3VZL A;  4MGK E;  2R04 2;  2XJP A;  3CNA A;  2VOW A;  5EHD A;  4A3Z A;  1KGY A;  1D7P M;  2BW8 A;  2WFP A;  5IK7 A;  3O0X A;  2ZJC A;  1H2N A;  4FPY A;  3ZFG B;  5GLU A;  1SCS A;  1QXP A;  4NAO A;  3SMH A;  2GZW A;  1LR5 A;  2YU2 A;  1AX1 A;  3FLP A;  5F39 A;  2E51 A;  1I6X A;  3VN4 A;  3WQ7 A;  1QJE A;  1CAV A;  1LRH A;  5F6L B;  5FXX A;  3POS A;  3SIS A;  2Q8C A;  4B8E A;  4FFF A;  1AXY A;  1QDO A;  1ND2 B;  1W2A X;  1CAX B;  4Y1Z A;  3RYK A;  2XJS A;  2EF6 A;  4H7M A;  1URX A;  4NHM A;  3S30 A;  3OGV A;  5F1R A;  1FMD 3;  3E5U A;  4WBB A;  4CSW A;  2RR1 1;  1MEC 1;  1W8H A;  4ISQ A;  1YNA A;  3IPV A;  2QQP A;  5ABJ C;  4JKL A;  5JAX A;  3W58 A;  1G7Y A;  3B5L B;  4M0H A;  3AZW A;  5JR7 B;  4AW7 A;  1PNG A;  1L7L A;  1V9U 1;  1F31 A;  4K8F A;  2F17 A;  1V6L A;  5IAX A;  4XHX A;  3WNO A;  4YM3 A;  4ET7 A;  1DZT A;  1E5R A;  1E5H A;  2VC9 A;  5KC6 A;  1Y9Q A;  2J42 A;  2Q1Z B;  3AL5 A;  4EJR A;  1U12 A;  5JIU A;  2W39 A;  1UOJ A;  4E4H A;  4EWD A;  1BEV 2;  1PGW 1;  1IKQ A;  2A1X A;  4NIH A;  4YGE A;  1Z7S 1;  2ZX0 A;  2VAU A;  4HKO A;  2OVU A;  4FTS A;  4OI0 A;  3AK0 A;  3FLT A;  1GNZ A;  4Y5S A;  2ZGQ A;  4RQP C;  2WT0 A;  4D7S A;  2RJK A;  2QQV A;  3OUJ A;  2ZOE B;  2YY1 A;  1NYW A;  1UAI A;  4UW5 A;  1QH6 A;  3VD4 A;  2HWF 2;  3UJQ A;  1GNY A;  3UNP A;  1G9A A;  5T3N A;  1FT9 A;  1RUH 2;  3A0K A;  4KBZ A;  3NST A;  3VD9 A;  2X5I C;  3ZO0 B;  3M3Q A;  5LA2 A;  3VBS B;  4FSJ A;  4NRQ A;  5H9P A;  1M06 G;  1QWR A;  3TEW A;  3G7D A;  4FPC A;  4IEY A;  1IS6 A;  2A3W A;  2W2I A;  3VBU A;  4BQ2 A;  5KBF A;  1HJF A;  5CG8 A;  2B9V A;  4L92 A;  3CDZ B;  3EQE A;  1BZW A;  3TNQ A;  4QQP A;  3WG4 A;  3WUD A;  3LSE A;  2BEO A;  3URF A;  1ULD A;  3I3D A;  1S1A A;  4YM1 A;  3FX3 A;  1YIP A;  2KA3 A;  4IGP A;  3VD7 A;  4CA9 A;  1IGO A;  5A1A A;  2VW1 A;  3WF4 A;  4CEW A;  1VE0 A;  1WMF A;  4AGV A;  1CIW A;  2ZX1 A;  4D7T A;  4QQO A;  4UFL A;  2CTV A;  2VMI A;  2YHJ A;  3VKL A;  5LK7 B;  2TNF A;  5EQU A;  5APA A;  3L9J T;  3SCF A;  3SIT A;  4P9G A;  1MS1 A;  5ISL A;  4YPJ A;  4MXW A;  3BUC A;  4ZU5 A;  1V6K A;  4HG6 B;  5KR7 A;  4KGG A;  5LW9 A;  1NCQ A;  1VBD 1;  1RUD 2;  3KZ4 C;  3ZKU A;  2EAA A;  1DGW X;  1XJA A;  5FMD A;  1BJQ A;  2EAL A;  4HON A;  3I3M A;  2D6M A;  2VUD A;  2VZS A;  2P2K A;  4HBN A;  4HN1 A;  4O61 A;  3JB4 C;  1RIT A;  1A78 A;  5LB6 A;  4AAP A;  1POQ A;  1QF3 A;  2QCS B;  2W1S A;  2QQI A;  5A3P A;  2HWE 1;  5KXB A;  3SH5 A;  5FY1 A;  3ES1 A;  1W6O A;  4CUC A;  4RQP A;  1JYN A;  1HIX A;  2YC2 A;  2HWC 3;  2R32 A;  3VDA A;  3OGR A;  4YSF A;  3GHN A;  4LBO A;  1ENR A;  4BHP A;  1UF2 C;  1OD3 A;  4JKK A;  4AQS A;  4LHL A;  4K20 A;  4CDQ C;  4MHR A;  4N43 C;  1IZ3 A;  4BWO A;  4A3X A;  1VBA 3;  2DYC A;  2JDN A;  2PHD A;  1VMJ A;  4PLM A;  1QJX 3;  4HVR A;  5FK7 A;  1OVP A;  3OEB A;  3GBW A;  2YC0 A;  3GZE A;  3WW2 A;  5KHI A;  4WZC A;  5FUP A;  1Z78 A;  2NZ9 A;  4EZ4 A;  5FBJ A;  4AQ6 A;  5FXZ A;  2OZJ A;  4BLJ A;  1U5I A;  5DAW A;  1NCR A;  1FX5 A;  4OMC A;  1WMX A;  3WR0 A;  4YWA A;  4FQ4 A;  1Y4W A;  3PJQ A;  5JXI A;  5FP8 A;  5AC9 3;  4BB3 A;  1F2N A;  4YRD A;  2A6V A;  3KSC A;  4JGY A;  3I2O A;  3O12 A;  3FUQ A;  5C33 A;  3L2H A;  3R0R A;  3I3Q A;  1YQ2 A;  5B4N A;  2YB7 A;  3WNM A;  3KS7 A;  3USS A;  1RXF A;  5H9Q A;  3FWE A;  3MW3 A;  4B7E A;  4U2A A;  2Z42 A;  5DUV A;  2A7A A;  5J48 A;  1LOD A;  4CP0 A;  2P17 A;  4MYE A;  4JHT A;  5FZB A;  4FOW A;  3T2T A;  2WNV C;  4A6O A;  1F4H A;  3ZFF C;  1H8T B;  4HKW A;  3LF7 A;  4IES A;  3U07 A;  3JBG 2;  3GYD A;  2EIC A;  4OUM A;  3RDI A;  4NRO A;  1G8W A;  3A21 A;  4BH9 A;  1MAC A;  1XBF A;  2RDN A;  1M4W A;  4IV3 B;  4AOC A;  1RUF 2;  4QB6 A;  3O1O A;  1VR3 A;  1JZ6 A;  3O1T A;  2KR2 A;  5T5L A;  4N53 C;  2JG8 C;  3VHR A;  4M3C B;  5EXO A;  5C3Q A;  1C1L A;  2A73 B;  2WZR 2;  3IMN A;  4QGL A;  3RRD A;  3ZYJ B;  4QX0 A;  4JVA A;  4XZU G;  3C7E A;  1OA2 A;  3OUI A;  1B35 B;  3KT1 A;  4XJU A;  4NE9 A;  2OKX A;  3S5A A;  1JU4 A;  3I8T A;  4XIL A;  2CDO A;  1FPN 3;  3H3U A;  3OPT A;  1RUO A;  1ENX A;  1JYX A;  4JDM A;  1YFU A;  4RS5 C;  4ASK A;  2G9F A;  3UV9 A;  1LED A;  4MGY E;  3VBR C;  1H1M A;  3RG0 A;  4DNY A;  5FZD A;  3KVA A;  4HMZ A;  2HWB 1;  1BXH A;  3B01 A;  2MEV 3;  1OH3 A;  4OI2 A;  1GMM A;  2FMY A;  4GMP 3;  4CCJ A;  3QCW A;  4YLZ A;  1PVC 2;  3AJZ A;  4JDO A;  2OW4 A;  3CQO A;  4DXR A;  3OBR A;  1LTE A;  1UOB A;  5FZ7 A;  2QJV A;  3IMM A;  4QKB A;  5A7Q A;  4QXB A;  5IK8 A;  4B4R A;  5FRA A;  2X5I A;  1RUD 1;  2XVK A;  3MF6 A;  4JC1 A;  1CPM A;  1VBE 1;  2RS3 2;  2IC1 A;  1YFW A;  4TLF A;  3VZJ A;  2G9Z A;  3ZVX A;  2JD4 A;  1O4Y A;  1I5P A;  2XML A;  1ZZ9 A;  3KQ4 B;  1AHS A;  1CAV B;  3ZKY A;  1KRI A;  1US2 A;  1B09 A;  2XUM A;  3I54 A;  4KQ7 A;  3ZM8 A;  3D0J A;  4NHX A;  4UI9 L;  1UZV A;  1ALY A;  3ASI A;  2Y6L A;  3APB A;  1RHI 2;  3RI9 A;  2WA4 A;  4D3W A;  5FXW A;  4LBN A;  4R52 A;  1GQG A;  4UW3 A;  1PVC 3;  2BV4 A;  4Q0Q A;  1VBD 3;  2R49 A;  1UO9 A;  3MID A;  1ND2 C;  3MUZ 1;  1C8M 3;  4JTO A;  5JMO A;  3BGA A;  1RUE 1;  4AZZ A;  3CMG A;  2PAK A;  1UX6 A;  1YI9 A;  3AJY A;  3DPR A;  4HK9 A;  4IEV A;  2GN7 A;  4KBB A;  3LWC A;  2BFU S;  1RUC 1;  2XVL A;  1GU3 A;  3DKW A;  1HDK A;  3VZM A;  3WW4 A;  2E26 A;  1K45 A;  1NXD 1;  2DUR A;  2V5D A;  3MUY 1;  4AHY A;  3JD7 2;  1NCQ B;  1PVX A;  2JDH A;  4GIQ A;  3B00 A;  1H1A A;  4LJH A;  2XPJ A;  2VNG A;  1ND3 A;  3H9A A;  4IQP A;  1B35 A;  2VBP A;  4LIU A;  1D0G A;  5JMC A;  4JRA A;  4KI5 M;  4FP3 A;  1SLT A;  3ILF A;  4FFI A;  5JZG B;  2ORX A;  1YWK A;  4W4Z A;  1KS4 A;  4AQT A;  4FAH A;  5LA1 A;  3LFM A;  1YHF A;  2VUC A;  4RFT 0;  2ZGR A;  4E2G A;  5I0U A;  1W3V A;  2IXL A;  2B39 A;  2P5B A;  3IAQ A;  2VCA A;  2PA7 A;  3MI8 A;  2C24 A;  5T52 A;  3WY6 A;  4AVT A;  4BQ3 A;  1NE4 A;  3MLL A;  5DUW A;  4DIQ A;  1RVF 2;  4NR1 A;  4B4P A;  1DYK A;  2VNV A;  4HZF A;  4MOA A;  5A3W A;  3CJI B;  2DTW A;  1QXR A;  3EO6 A;  4LO8 A;  1BEV 1;  1PGW 2;  2CWS A;  1PO2 2;  1AL0 G;  3AKP A;  1SHW B;  4Q0S A;  4BU2 A;  4CDW C;  4RL7 A;  3PHM A;  1IG0 A;  3C8X A;  4IV3 A;  4XAE A;  3RJ2 X;  1JUI A;  2B8M A;  2WQZ C;  1QNW A;  2B46 X;  1OKO A;  2VCM A;  3WW3 A;  1UZW A;  1H2K A;  4OHW A;  5ANQ A;  3MHZ A;  3KLS A;  4S2H A;  3RWN A;  5E16 A;  2W1W A;  4N7I A;  3BKZ A;  1PGL 2;  4P5Y A;  1U5X A;  2WUH A;  1JZ7 A;  5FY8 A;  3WDV A;  3NNM A;  4Y1U A;  2AYH A;  4ZKT B;  2CSG A;  4P5H A;  4HL0 A;  2WNU B;  3LDK A;  1XC6 A;  5A3T A;  3LEM A;  2ZTN A;  4BJ0 A;  1E5I A;  3TEX A;  2VME A;  3D5O A;  3ZYR A;  3AKQ A;  4OVE A;  3M3E A;  1BLZ A;  4AQ2 A;  4D7Y A;  3ZN6 A;  1TQ5 A;  3Q8A A;  5FPA A;  2EXJ A;  2XJU A;  1R09 1;  2OUJ A;  3CL1 A;  5IJR A;  4QXC A;  1N3P A;  1T6G C;  2WN3 A;  1Q8O A;  5EZW A;  3S7I A;  3K2O A;  1ULC A;  2V09 A;  2WS9 2;  4BQ1 A;  5BV6 A;  5A3L A;  5JOY A;  1UU5 A;  1FNZ A;  1BYH A;  1HRV 1;  1WLC A;  2VL4 A;  4CDX A;  3MFC A;  4XTM A;  2RHP A;  4DB5 A;  3QBQ A;  5FAX A;  5D2A A;  5CEH A;  5GZG A;  3NNF A;  3WLU A;  1JOP A;  2CGP A;  3Q9O A;  2NYY A;  4CP2 A;  1JZ8 A;  2VZO A;  3PIG A;  2WJS A;  5BYN A;  1AYN 1;  1SQ4 A;  1R1A 3;  5FV3 A;  4IUG A;  1QU0 A;  1WZX A;  5FYB A;  1FAY A;  2C1F A;  1EPZ A;  5FR3 A;  4Y5T A;  4NO4 A;  2Q5T A;  5CB7 A;  4QT6 A;  4PDW C;  1BK1 A;  5JSP A;  4Q1R A;  1YLL A;  4RQP B;  1OPM A;  3B93 A;  4Y1X A;  1UMZ A;  4OCT A;  4XJW A;  1ZM1 A;  1SDD B;  1SBD A;  4DZG A;  1ULF A;  4V2V A;  1H9W A;  1QY4 A;  3AC0 A;  3PME A;  1H6X A;  3S6P A;  4FBF A;  1JYW A;  1UOG A;  2GU9 A;  4IV3 C;  3VGI A;  1XXN A;  4CU9 A;  4CDQ B;  1I1E A;  4OMD A;  4RR3 B;  2QDR A;  1TNF A;  1YCI A;  4JGZ A;  2VZU A;  3U78 A;  4LBK A;  1YJK A;  3GAL A;  2VOT A;  1UY1 A;  3OUH A;  4CRQ A;  4QXH A;  1OLM E;  2W52 A;  3B94 A;  3ZFF B;  4G3Y C;  5GKA C;  2QDN A;  3AZY A;  3OF1 A;  3WG1 A;  5FUI A;  5FWE A;  1OA4 A;  1IPJ A;  3ECQ A;  4JQT A;  1LOE A;  1H9P A;  2W47 A;  2IXJ A;  3KCX A;  5IUQ A;  2OYZ A;  5IFP A;  3B7M A;  3KV5 A;  1XNA A;  5FZL A;  3A22 A;  1J3R A;  1WD4 A;  2YV8 A;  3D3A A;  4IEX A;  4LOT A;  2E7A A;  2ZKN A;  4LR4 A;  5FTT C;  4LO7 A;  3POI A;  4EN6 B;  4O7X A;  1ZBA 1;  2Q8O A;  4BQ5 A;  1OH4 A;  2VZR A;  1MS3 A;  2JDP A;  2QBX A;  5GZE A;  4ZZ8 A;  3S57 A;  2Y8K A;  2D98 A;  5C3P A;  3NV1 A;  2BGO A;  1IOA A;  1U5Y A;  2R07 1;  3N7L A;  4FT8 A;  4D6R A;  4BM8 A;  4QX5 A;  1GLH A;  1ASJ 3;  2DVA A;  2ZZQ A;  1VRH 1;  3ACH A;  3GXU A;  3DPR C;  4IV1 B;  1CGP A;  3FC0 A;  2ETE A;  3NRU A;  4HKL A;  2EID A;  2RMU 2;  5FCC A;  4NRM A;  2BVV A;  3NMB A;  1JYI A;  1RUE 3;  2JXA A;  4L9B A;  4UFM A;  4XCA A;  1K42 A;  5L9V A;  1AR9 3;  1OQD A;  4GMP 0;  4FPG A;  4NUB A;  4WM7 C;  5A1L A;  3CU7 A;  2VH9 A;  2P3J A;  2DUO A;  4CP1 A;  4CZS A;  2WSV A;  3ITQ A;  1CR7 A;  1DDL A;  2K46 A;  3CIH A;  2DCY A;  1WA6 X;  2XHN A;  5E88 A;  1DHK B;  3WV6 A;  3IIA A;  1AL2 1;  3NV3 A;  4HAN A;  4E2Q A;  2R07 2;  3LZZ A;  5F8P A;  2WWJ A;  3TOJ A;  1V6I A;  4BK4 A;  4Z07 A;  1XNC A;  2DTY A;  2RS3 3;  4LUM A;  3WF0 A;  4AI9 A;  1PMJ X;  2XR4 A;  3OY8 B;  3OG2 A;  4YZ2 A;  4LHK A;  1W03 A;  2KD7 A;  3KB5 A;  3AKS A;  4EE2 A;  1YEW A;  2JE7 A;  5C4W B;  4YM0 A;  1HQL A;  5DAX A;  1C28 A;  5GLV A;  2FMD A;  3NNL A;  4G9S B;  5A7S A;  3FBY A;  3TNP B;  4DIN B;  5ABJ A;  2VMG A;  4RFR B;  1MS5 A;  1DQ2 A;  2VNO A;  2BQP A;  1LHV A;  2AH2 A;  5F2W A;  1FOD 1;  4QX3 A;  1MZF A;  4B1L A;  4NHK A;  1K3I A;  2GC0 A;  4KWL A;  2XUE A;  4ISR A;  3ZXG A;  3B69 A;  2FDI A;  3WUC A;  4JZR A;  4NAM A;  1VRB A;  4RSU A;  5FKC A;  1W05 A;  1N3O A;  5KXC A;  1JYT A;  2YBP A;  4L99 A;  5F32 A;  4LEJ A;  4QKF A;  5F5Q A;  1N1V A;  1EAH 3;  1SPP B;  3N3H A;  1PIV 1;  1R08 3;  2GN3 A;  4JHZ A;  1W6M A;  5DQ0 A;  1NG0 A;  4MGS A;  1LB2 A;  2DUP A;  5DDJ 2;  1JXN A;  2DFC A;  4N9H A;  1QOT A;  5E1R A;  1AR6 3;  3NKG A;  4MET A;  2GAU A;  5C4W C;  3OPW A;  3B9C A;  5CA6 A;  2W91 A;  1LOF C;  1I3H A;  1D0H A;  2B9U A;  5FQ0 A;  4XUN A;  5FPU A;  1N1S A;  1ZRC A;  4LE4 A;  1JH5 A;  1BEV 3;  2B5H A;  1APN A;  1SZB A;  3JBG 3;  3LIH A;  4GB3 2;  2YGL A;  4CTE A;  2LRP A;  4Y20 A;  4XBL A;  4BQ4 A;  1DQ4 A;  1HV0 A;  4TLG A;  1NA1 C;  1EAH 2;  5BXX A;  1F5F A;  4LKE A;  4B3N A;  4K21 A;  3ZMN A;  4BCU A;  2UYA A;  2VZ1 A;  1AR6 1;  5GLZ A;  1ZRI A;  1QQP 3;  4LKS A;  1EV1 1;  5EIY B;  3LGR A;  1ZRR A;  4ATF A;  3MV1 1;  1O5U A;  1RB8 G;  3LOB A;  1REF A;  3ABZ A;  1WKY A;  1DGL A;  3R6S A;  4IE6 A;  2JE9 A;  1NAE A;  3ZXL A;  3PVB B;  3V56 A;  3ZSJ A;  4CP9 B;  1TG7 A;  4UF0 A;  5A7P A;  1Q8S A;  2QQN A;  2VVD A;  2E33 A;  3T30 A;  3VKM A;  4ARY A;  1LOC A;  2RS5 2;  5FPB A;  4D6S A;  2PYT A;  1UU4 A;  2HWE 2;  1K5M B;  2XKP A;  3HBZ A;  4HSJ A;  4ARX A;  5K8S A;  2NPI A;  4LBM A;  1WCS A;  3VBR B;  4PHZ A;  4CUA A;  1BMV 1;  1OMI A;  1X8E A;  2GC3 A;  3DV8 A;  3ZXJ A;  3DYP A;  2GP5 A;  2Y64 A;  1YC6 1;  3EBR A;  2Y38 A;  3MGU A;  3PVE A;  3CZU A;  4MZU A;  2VUL A;  1F4A A;  3TWI A;  4E8C A;  4MXW B;  2HWD 1;  3ACG A;  3ZFG C;  4GKY A;  1WME A;  2OPW A;  2IXK A;  4XQD A;  1UKG A;  3MFA A;  2CGN A;  4I3G A;  2C5D A;  5FZK A;  3POJ A;  4YFZ A;  3FZ3 A;  4Q4W 2;  4XF3 A;  3UGF A;  3J26 N;  1KEX A;  1NY7 1;  2VO5 A;  3DCQ A;  4QB1 A;  3I2H A;  4P9J A;  4JTN A;  5JR2 A;  4YW4 A;  1SLI A;  2FZ1 A;  2XBO 3;  3HJR A;  3DF0 A;  2PMW B;  3BOD A;  2IUW A;  1H8T C;  3NV4 A;  3RZH A;  4TSV A;  1KDK A;  1OSG A;  1KQR A;  3TAY A;  3G6J B;  2CU5 A;  2VVF A;  1MEC 2;  2JG9 C;  3PU3 A;  3WDU A;  4CXY A;  5FRE A;  5CAD A;  1YQC A;  5FZA A;  4QQ2 A;  5AVA A;  1UNB A;  1GOF A;  3J7M A;  3D8C A;  4YFW A;  1GR3 A;  1HRV 2;  5F6K A;  3K51 A;  1Y43 B;  1W8Z A;  1BVP 1;  4Z1V A;  5BUV A;  3PUA A;  1SPP A;  2VOK A;  3OB8 A;  3M4F A;  1S0F A;  3N36 A;  4P9L A;  4XF0 A;  2WZR 1;  2OII A;  4CDU B;  3MIE A;  2R0F A;  2OT7 A;  1NCR B;  3NW4 A;  1J84 A;  1ZBA 3;  3SC7 X;  2WS9 1;  4HLT A;  5FZ8 A;  1K5M C;  3V65 A;  4Z2A A;  4FVV A;  4GJY A;  5T55 A;  3UGH A;  4CDW B;  2E6V A;  3I2D A;  4JGY C;  2J1U A;  5FQ0 B;  1QJY 3;  4P08 A;  4Q4X 2;  2VU9 A;  1TMF 3;  2PHR A;  2VVE A;  4LUK A;  2C6S A;  2RJL A;  4HFS A;  2DU1 A;  3MPP G;  3SEE A;  4MLO A;  3LD8 A;  3U75 A;  4AEK A;  2WNV A;  5EFU A;  3ALQ A;  4CEW B;  2Q30 A;  2WWU A;  1CON A;  4KH9 A;  2DV9 A;  2E63 A;  2OXB A;  2XLA A;  3ZIX A;  3NL1 A;  4QDR A;  4AHX A;  4XQW A;  2DFB A;  4RHV 1;  5H9S A;  3KHC A;  3MIF A;  4XIK A;  3NWK A;  1AYM 2;  4NIA A;  4Q1P A;  2W94 A;  1TME 2;  1S0D A;  3TYJ A;  1W6N B;  1VLN A;  4MO3 M;  1V00 A;  2RR1 3;  3HQX A;  2ATF A;  4KG0 A;  2GNB A;  5IK5 A;  5I0D A;  1QH7 A;  3T0B A;  3FFZ A;  1H30 A;  2D6P A;  1ST8 A;  1VMF A;  4ZY9 A;  3ZXD A;  4GD4 A;  3ZYB A;  4BYY A;  4TZD A;  5FUN A;  3BTX A;  4L11 A;  2DDU A;  4OYU A;  1RUF 3;  2IZW A;  4XC9 A;  5FO7 B;  4ZXK A;  4ZPI A;  1NXM A;  1VJ2 A;  1W6Q B;  1T6B X;  2C0Z A;  1CES A;  3OOX A;  4XJ8 A;  4Q4W 3;  1QJX 1;  3ATG A;  2CYF A;  1BVV A;  4PIZ A;  3VBR A;  1DZQ A;  4J6G A;  3N9M A;  1LOF A;  1S0E A;  2A6W A;  4QU2 A;  3W20 A;  4URA A;  2A3Y A;  1JI6 A;  4IE0 A;  5A80 A;  3LEI A;  2ZA9 A;  4A42 A;  1CN1 A;  3PLQ A;  3NVC A;  4A41 A;  4EN0 A;  3PVN A;  4R4Z A;  2OUH A;  3JD7 1;  1MZ6 A;  5CYY A;  2CAU A;  4LQR A;  1H1I A;  2OQ6 A;  4FAG A;  1DFQ A;  4KL1 A;  2KM2 A;  3BTA A;  3NV2 A;  4XFG A;  2BU9 A;  4XUR A;  5DUX A;  3UL2 A;  5CG9 A;  4OLL A;  1O3R A;  5D8A B;  2WWS A;  1OI6 A;  1NKG A;  4CYD A;  2J1V A;  4FPL A;  4D8M A;  3AMM A;  3EJK A;  1CZS A;  5FLI A;  4CP9 A;  4Y22 A;  2VG9 A;  1EUT A;  1JTZ X;  1Q5O A;  4PDW B;  2I2S A;  3N7M A;  1O91 A;  2XOM A;  3O14 A;  3O1V A;  3FMG A;  1V9U 3;  1W8N A;  2MPF A;  2VOX A;  3FHA A;  1UU6 A;  4S2F A;  2J7M A;  4XXP A;  4Q26 A;  1LEN A;  2QFE A;  5C71 A;  4DXS A;  5J96 B;  4MV2 A;  5FO8 B;  5E89 A;  5G05 L;  2ZMK A;  3VL8 A;  2X10 A;  4HET A;  2JEM A;  3VLB B;  4RR3 A;  5FWJ A;  1V0A A;  4YGB A;  3NKT A;  2R6Q A;  4LUL A;  3VBF B;  2FQP A;  4OHY A;  4OZX A;  3C7H A;  4OHX A;  1RUH 3;  4WM8 A;  1T2X A;  3AFK A;  2RVA A;  1O7F A;  3BOP A;  3VBU B;  5EWS A;  4BXF A;  5I8Y A;  4JX0 A;  4NIG A;  4LBQ B;  1GP5 A;  2E32 A;  3P5B A;  2YBK A;  4Q5O A;  2FDG A;  2VOV A;  2IFR A;  4OZO A;  3OJB A;  1A6C A;  4QX8 A;  1KJL A;  2J22 A;  2XH6 A;  1TNR A;  1Q8V A;  4LO6 B;  2YYO A;  2BFU L;  4XFA A;  4ASL A;  2JG8 A;  5FZG A;  1QMJ A;  1ZRE A;  5DN2 A;  4OFG A;  3Q8C A;  1DQ0 A;  2G9G A;  3V0A B;  3AP4 A;  1MS8 A;  1WWY A;  1JZ5 A;  1H8T A;  1J83 A;  1OOP C;  4AHW A;  1X33 A;  1IG3 A;  4JV4 A;  2PTM A;  2W87 A;  3NQH A;  4I02 A;  1MR5 A;  2P3K A;  5HV0 A;  1YJL A;  3VDD C;  5FKB A;  2GSY A;  5FOB B;  1XB9 A;  4GUL A;  3N9P A;  2EVX A;  3III A;  3MO4 A;  4E2S A;  5FJH A;  4FCA A;  5I0S A;  1KD7 A;  3B3Q E;  4I09 A;  3C7G A;  1RXG A;  4UW6 A;  3ZN5 A;  3O1M A;  3P3N A;  4MAD A;  1RMU 3;  3J8F 3;  4GMP 1;  1Q43 A;  4TTG A;  2FDH A;  5BNP C;  5D8A C;  1QJF A;  3P1I A;  2RS1 2;  5LK5 A;  2PAE A;  4RGA A;  2RDQ A;  4P9X A;  3RZM A;  5L19 A;  3AYE A;  1ZNP A;  2HLE A;  5HCA A;  1RUI 1;  1ZZB A;  4YM2 A;  2HEV F;  2E53 A;  2RM2 1;  4A44 A;  2JB8 A;  1AR7 1;  4Q0U A;  2VMC A;  1W6O B;  2BP6 A;  4XQ4 A;  2YMZ A;  4CCM A;  2XGX A;  1AYN 2;  1LHU A;  2OX0 A;  1R1A 1;  1S0J A;  4GB3 3;  4QPY A;  4QHO A;  1RMU 2;  3J8F 2;  1UL9 A;  3PUR A;  2Q1M A;  3ZSK A;  3KCY A;  4LMF A;  3RZJ A;  3PNA A;  3W21 A;  2CV6 A;  1JYC A;  2TBV A;  1CZT A;  3H8X A;  4W6X A;  4YG6 A;  2W0X A;  4I01 A;  5LAS A;  3WQ1 A;  1OFN A;  1YO8 A;  2R06 2;  4QPI C;  3U37 A;  2VBB A;  2WNE A;  3U4X A;  2YFU A;  2NMN A;  4LTA A;  1DF0 A;  4ORF A;  2P1B A;  4MH0 E;  4UFK A;  4GH4 C;  4NVP A;  4RHV 2;  1HJG A;  4Q27 A;  5CZK A;  3ETP A;  1PK6 B;  3LA2 A;  3B02 A;  5J36 A;  2W9X A;  4PDW A;  2YPD A;  1WD3 A;  1OT5 A;  2QVS B;  2JG9 B;  5FYT A;  3ZFE C;  5FLJ A;  1HKD A;  2DCZ A;  2GNM A;  3RNS A;  1W28 A;  1EUU A;  4GXL A;  3VHP A;  4COZ A;  2WO3 A;  4Q0V A;  5CFD A;  5IK4 A;  3K4A A;  1LGB A;  2XWJ B;  5DAP A;  3D6E A;  1WBL A;  1KXG A;  1VBD 2;  2HYK A;  3AP7 A;  4LA3 A;  3VDD A;  5J09 A;  3CKH A;  3WX5 A;  5C7G A;  3O1P A;  5AFE A;  4DRV A;  4FTE A;  3MIB A;  3OTF A;  1V6O A;  3ACL A;  4CXW A;  2XL9 A;  2HKX A;  1XE7 A;  4K40 A;  5LBB A;  2DU0 A;  2HWB 3;  4GWI A;  3C7F A;  1ZBA 2;  5LAT A;  4YVS C;  4FTB A;  1YQ6 A;  4GAZ A;  4A7K A;  5C9A B;  3NNG A;  4O9G A;  1IQD C;  3T4H B;  3OGJ A;  4CDU C;  3U4S A;  1VBC 1;  3PJY A;  4M3C A;  5FYH A;  5JXH A;  2CY6 A;  3JU9 A;  2Q8E A;  2PHF A;  3H1W A;  3HNM A;  3HQU A;  4AVS A;  1AJK A;  2D5H A;  1JOJ A;  1DZR A;  4QHB A;  5HI0 A;  4SLI A;  4E4D X;  3F95 A;  1UX7 A;  2JX9 A;  4XFF A;  4YAR A;  3W5M A;  1NY7 2;  5DPN A;  2XLG A;  3BIW E;  5LY2 A;  1WBF A;  2WNO A;  3WCS A;  5LRS A;  1G86 A;  1UD1 A;  2WFF 2;  3KV9 A;  4LHN A;  1ULP A;  4KNC A;  3GNE A;  1E57 A;  4CDX B;  5A6Q A;  2WKK A;  4JKM A;  1QOS A;  1YFY A;  4O9E A;  4LK7 A;  4XUP A;  3U10 A;  3VBF A;  4DOU A;  3SQO A;  2A6Y A;  1X9T A;  2JIG A;  3VD3 A;  3VDB A;  2SLI A;  5F2S A;  4CUG A;  2ZMN A;  2A6Z A;  1FAT A;  2VJX A;  3PTR B;  4I0A A;  3VBH B;  4QKD A;  4RR3 C;  4LK6 A;  3DXT A;  4H14 A;  4XFH A;  4BQY A;  4F3J A;  5FPL A;  4IXL A;  2UUR A;  3WW1 A;  2ZEY A;  3SLI A;  4CCK A;  2ARB A;  1VB2 A;  4XMI A;  1QGL A;  3IDE A;  3RZG A;  5ABJ B;  1NQD A;  1FYU A;  1E5S A;  1VBB 2;  1W2U A;  2AGS A;  2BYV E;  1DQ5 A;  1CJP A;  3POE A;  1SEF A;  1CAX A;  4ZS3 A;  2GDF A;  4RA0 A;  4XCB A;  2BWC A;  2XLF A;  2VZV A;  2VCB A;  3VKN A;  4F83 A;  2WZ8 A;  3GHM A;  2NM1 A;  3IDA A;  1W9Y A;  4LKF A;  1OPO A;  3WQ0 A;  2Y6J A;  4Y24 A;  4K8R B;  1O8P A;  1S2K A;  4FOV A;  1JOB A;  1MQT A;  3QH6 A;  4AVV A;  1V9U 2;  3SKJ E;  1JZ2 A;  2O8Q A;  1GWL A;  3E1F 1;  4YW5 A;  1VAL A;  4D6Q A;  2FZ2 A;  3U1X A;  1EPW A;  2ADE A;  2JKX A;  4COV A;  2WR9 A;  4GB3 1;  3N7K A;  3WHT A;  2OA2 A;  3T08 A;  2P34 A;  3O0W A;  3GGL A;  2WDB A;  4N9I A;  1AUY A;  2HEW F;  3ZDV A;  1ODM A;  5I91 A;  4LIT A;  2PLV 3;  3MIH A;  3W9A A;  4C1X A;  1GAN A;  1QQP 2;  3MW4 A;  2WRA A;  1DBN A;  2P6C A;  2VZ3 A;  4ES8 A;  2G4I A;  1YQ5 A;  3ACF A;  3DUI A;  5FZO B;  3ZSM A;  2WN2 A;  2UY8 A;  3GZT B;  2B45 X;  3O0V A;  2I45 A;  4XE9 A;  1VRH 3;  4IGO A;  5CIR A;  4DY5 A;  2FCU A;  5SV8 A;  2DBN A;  3THC A;  3R05 A;  1WW6 A;  4LNV A;  1XYO A;  3I4I A;  4PI2 A;  3WP5 A;  3T4V A;  4BK5 A;  1C8N A;  5BY5 A;  4ZU4 A;  5A7W A;  3AX4 A;  3M3C A;  3POF A;  3PMS A;  4M00 A;  1HN0 A;  2JJ6 A;  4JRL A;  4H2A A;  3U11 A;  4FXG B;  4NPM A;  1X36 A;  2C4X A;  2VXJ A;  2JEC A;  2ZCW A;  5I8S A;  2Y0I A;  4L0P A;  4GWM A;  2BZD A;  1NA1 A;  2KXL A;  3SH3 A;  1PNF A;  5FO9 B;  4O65 A;  1AR9 2;  1COV 2;  2JDK A;  5FZC A;  2YUE A;  3N35 A;  3S0M A;  2D6L X;  1IS5 A;  2VE1 A;  2WZR 3;  2BWA A;  1IPS A;  2B7Y A;  4XJ9 A;  2JD9 A;  2J1A A;  1FOD 2;  1N1T A;  2PFW A;  1AYM 3;  1OVS A;  2CAV A;  4PIX A;  4UBG A;  5IWF A;  2QQU A;  5CIS A;  5IVB A;  1N47 A;  5K0U A;  3ZN6 B;  4AVA A;  3WHU A;  1QIQ A;  1JYV A;  3H50 A;  1RUG 3;  4YW6 A;  5F5A A;  2LAL A;  4KWU A;  3MV0 1;  4YYO A;  3VZO A;  3V0A A;  4HVQ A;  4AFM A;  3DEM A;  5C6C A;  5HXV A;  1UWW A;  4AI8 A;  4E4Z A;  4CPB D;  2E9Q A;  4BLI A;  1S0I A;  4L8Q A;  1S55 A;  2VZQ A;  1K12 A;  1J1L A;  1FV3 A;  3VHN A;  3I2K A;  2P3I A;  3AKT A;  4LBL A;  5T5J A;  3RWK X;  3LCP A;  5LCW L;  3PIJ A;  5LEK A;  4GH4 B;  1A3K A;  4W8J A;  1UIJ A;  1UW8 A;  2JDY A;  3ON7 A;  1RUC 2;  2ZGO A;  3NNJ A;  1LNS A;  3BU7 A;  5C3S A;  2WT2 A;  2P6H A;  5C5U A;  3HMY A;  1H8V A;  5IHR A;  2RMU 1;  1ZZC A;  2FCT A;  3AM2 A;  2WO2 A;  5GLT A;  4XDQ A;  4MGZ E;  1KJR A;  3LOI A;  2W5F A;  4K9S A;  4SBV A;  5IYY A;  2ORZ A;  1ZVF A;  1Y9G A;  2Y34 A;  4CEY C;  4X8N A;  2R04 3;  3HQR A;  2BGC A;  4QQH A;  2HWF 3;  3GM8 A;  3THT A;  3VB9 A;  1WLT A;  4YW2 A;  4N90 A;  4OHZ A;  1OKQ A;  3IWZ A;  1XU1 A;  3IBM A;  5JIA A;  2NP0 A;  3AP6 A;  4CPB A;  1OD5 A;  1QJU 3;  5A33 B;  1R09 3;  4CU8 A;  3O5S A;  2EIE A;  3AMP A;  3SH4 A;  5LWB A;  4Y22 B;  5C4W A;  3WVJ A;  1OQE A;  4RHV 3;  3WNX A;  4RS5 A;  4URT A;  2UY9 A;  5LRR A;  3BPZ A;  4UXA A;  1PM4 A;  4JGY B;  5IW0 A;  3W5N A;  2GP3 A;  4WVZ A;  3DEC A;  4L2N A;  4CCE A;  5HXM A;  2F4L A;  4CE8 A;  1HLC A;  2BBV A;  4MXV A;  1QJZ A;  5T50 A;  3WNK A;  5F5I A;  3ENR A;  2JG9 A;  4IE7 A;  5FYC A;  1OXC A;  2BNM A;  4AED B;  3IDC B;  1JN2 P;  3D0S A;  5LBC A;  5T5P A;  3T2O A;  1HB1 A;  4PF1 A;  4A4A A;  2DCJ A;  3X29 B;  4PQQ A;  3NJZ A;  5GZD A;  5IVY A;  1AYM 1;  3HD8 B;  5IFT A;  1SLL A;  2ZGM A;  4HK8 A;  5CKQ A;  4WM8 B;  4IET A;  2VQ0 A;  4YVS B;  3T09 A;  5KHK A;  1DQ1 A;  2JDU A;  1UYP A;  5FZ9 A;  3RVH A;  2RS5 3;  4KGQ A;  4D0Q A;  2E7Q A;  2D3P A;  4PQ9 A;  3WDT A;  1YXW A;  2W92 A;  4LO4 B;  4QPG C;  4WZF A;  1C4R A;  4JAA A;  2ZAC A;  5I93 A;  2IVI B;  4XFB A;  1MQT C;  2VY0 A;  2O0O A;  3JQX A;  4J1X A;  3RZZ A;  4XJA A;  3IB3 A;  3ZXA C;  4AF9 A;  1ND2 A;  3PU8 A;  3IM0 A;  1RL3 A;  5JLV A;  4XUQ A;  4A6S A;  1GZC A;  2VW0 A;  4XOG A;  3ZYI B;  3A4U A;  4P00 B;  3T2P A;  4A45 A;  2RDR A;  1O3T A;  2VR4 A;  1DU3 D;  4Z8B A;  5F3G A;  4UOJ A;  5FJK A;  1PZ8 A;  5GJ6 A;  1V70 A;  1DGR N;  4N8M A;  4XDO A;  1H4G A;  2ZS6 B;  3VBO B;  2DVF A;  1UXX X;  1OHF A;  2E31 A;  1QJX 2;  2ZX4 A;  3BPS A;  3LB9 A;  4IEO A;  4R4X A;  2A3X A;  1REE A;  2ZEX A;  1W8U A;  3WG2 A;  1S0C A;  4EN8 B;  5IVJ A;  1UKR A;  3KT4 A;  1B35 C;  1ZZ8 A;  2Y33 A;  1UOF A;  3POW A;  2QQW A;  1MPX A;  3K3O A;  4QPI B;  5C3R A;  5F7U A;  5JUV A;  1W9T A;  3IN9 A;  4UW4 A;  3KQR A;  5JOX A;  2PQS A;  4YNI A;  3NAP A;  3OGS A;  1CWP A;  4EN7 B;  1WCQ A;  4YW1 A;  3FHQ A;  3MF9 A;  3LA7 A;  3BN6 A;  3DYM A;  2UWA A;  4UAP A;  1GP6 A;  2D6O X;  2RV9 A;  3AYD A;  1BCX A;  3QAC A;  4NN0 A;  4XXA A;  1AVB A;  2WIN B;  3POB A;  1X8M A;  4AI2 A;  3AZZ A;  1W6P B;  3ZN4 A;  4IE5 A;  1H2L A;  3E5Q A;  1W2N A;  2J1R A;  4XJZ A;  5CVR A;  2EIB A;  3IPV B;  3ACI A;  1DCS A;  1N3Q A;  1QJU 2;  3DPR B;  4AFC A;  1ZBE 2;  4BZ4 A;  1SMV A;  2PLV 2;  1MVQ A;  1XPW A;  3H3Z A;  5K7P A;  2QUO A;  2WFF 3;  4AI3 A;  4D94 A;  2VUA A;  2BDR A;  1CX1 A;  2HWE 3;  4Y4Y A;  2R06 1;  1VIW B;  3T1L A;  3OD0 A;  3GBF A;  3DKQ A;  4BA6 A;  1GZ9 A;  1PK6 A;  5GM0 A;  1XNK A;  4Q4X 3;  4FPK A;  5IVF A;  1RJ8 A;  5CFC C;  4LT5 A;  2BUK A;  3INA A;  4GWJ A;  4C91 A;  1MZ5 A;  3LDR A;  2VZT A;  2CGO A;  1RUJ 1;  3SEP A;  1W8F A;  4MGI E;  2V73 A;  3I59 A;  5FPX A;  3VBO A;  2MNG A;  2HWC 2;  1SG3 A;  4B29 A;  3VBH C;  3IT8 A;  5LY1 A;  4XMA A;  2GMM A;  5AC9 1;  4EN9 B;  1PO1 1;  2BVB A;  2RM2 3;  2JDM A;  4BE3 A;  4Y4R A;  3ZXE A;  5A6Z A;  2LUW A;  2DVD A;  1MEC 3;  2YZ4 A;  1UY0 A;  1JOD A;  2AAC A;  3K46 A;  3KVB A;  3LIG A;  4FPO B;  4CEY A;  2VQA A;  1VBC 2;  3I3B A;  3DGT A;  1I5Z A;  3KV4 A;  4XFC A;  2IVJ A;  5L9R A;  3TBD A;  5IVE A;  1RHI 1;  2YXS A;  2ZGP A;  3AKR A;  2HWD 3;  2JE8 A;  4MSV A;  3Q8B A;  2BOI A;  5IAV A;  4YZ1 A;  1DG6 A;  5J98 B;  1CVN A; 
#chains in the Genus database with same CATH homology
 3OBA A;  2WBK A;  2XOM A;  4DUW A;  2OKX A;  1JU4 A;  1W8N A;  2CDO A;  3HNY M;  3FHA A;  3WNN A;  1JYX A;  2J7M A;  2W3J A;  5C71 A;  5EJ1 B;  4DXS A;  1UY2 A;  5G05 L;  3T2Q A;  2X10 A;  1GMM A;  3EYP A;  5J1X A;  4DXR A;  3CQO A;  3F2Z A;  4QX1 A;  4CUB A;  1RYY A;  3C7H A;  4ZXE A;  1T2X A;  2RVA A;  2XQX A;  3WEZ A;  2WZE A;  3P6B A;  4JX0 A;  4DXT A;  1I5P A;  4QAW A;  2E32 A;  1US2 A;  4OZO A;  3ZM8 A;  4UI9 L;  2J22 A;  2Y6L A;  2R7E B;  3K4D A;  4AAX A;  2ID4 A;  2QQO A;  4XUO A;  5DN2 A;  3HEI A;  1CZV A;  4FI9 A;  3MUZ 1;  5JMO A;  3BGA A;  1JZ5 A;  5G04 L;  3CMG A;  1J83 A;  2W87 A;  3NQH A;  2X09 A;  1GU3 A;  3PUI A;  3III A;  2E26 A;  1K45 A;  3MO4 A;  3MUY 1;  2V5D A;  3C7G A;  4MAD A;  2VMF A;  2BGP A;  4TTG A;  1UY4 A;  3P1I A;  1GQP A;  5HPO A;  3HNB M;  2Y6H A;  4KMQ A;  4KI5 M;  2VM9 A;  1GOH A;  3WF2 A;  2HLE A;  2ORX A;  3A7Q A;  4W4Z A;  5LA1 A;  2LW8 A;  5JXG A;  4A44 A;  2ZXQ A;  2VMC A;  4QDQ A;  2X05 A;  3IAQ A;  3A23 A;  2VCA A;  2QQL A;  4GZ9 A;  4QPW A;  4MOA A;  2W46 A;  1SHW B;  1CZT A;  3I2J A;  3C8X A;  1UMI A;  3WNL A;  5JXJ A;  3U37 A;  3JXS A;  3EB7 A;  2YFU A;  2W1W A;  4P5Y A;  2WUH A;  3FL7 A;  1JZ7 A;  5CZK A;  3ETP A;  3PUH A;  1XNT A;  1W9S A;  1XC6 A;  2W9X A;  4BJ0 A;  1OT5 A;  2VME A;  2WAO A;  2VZP A;  1EUU A;  5IJR A;  2L9L A;  1BHG A;  2WN3 A;  2WO3 A;  3K4A A;  2J1T A;  3CKH A;  2VL4 A;  5C7G A;  3K4Z A;  5EJZ B;  2WQ8 A;  2VMD A;  5EIY B;  1PMH X;  1JZ8 A;  2VZO A;  4GWI A;  3C7F A;  3WSO A;  3LEG A;  3HOB A;  1UXZ A;  2LS6 A;  2QQM A;  3IAP A;  1IQD C;  3NNG A;  1UY3 A;  4IUG A;  3I3E A;  4XVH A;  2C26 A;  5JXH A;  3HNM A;  2YFZ A;  1L7R A;  3NJV A;  1R64 A;  1PX3 A;  1UX7 A;  3GDB A;  1PX4 A;  3MBW A;  3W5M A;  1SDD B;  5DPN A;  3C7O A;  1H6Y A;  3AC0 A;  1H6X A;  1JYW A;  1O59 A;  1GOG A;  1ULP A;  1W8O A;  4CU9 A;  4JKM A;  3I2I A;  4OMD A;  2YG0 A;  4XUP A;  2J1S A;  2VZU A;  3VDB A;  3VD3 A;  1JZ4 A;  2VJX A;  2VOT A;  1UY1 A;  2V4V A;  4E8D A;  5FUI A;  3ECQ A;  5IFP A;  2ZEY A;  2W47 A;  4MGQ A;  1XNA A;  3A22 A;  4M4R A;  2CDP A;  3D3A A;  3VDC A;  3CZJ A;  3NJX A;  1W9W A;  4LPL A;  1HN1 A;  2WAB A;  2VZV A;  2VCB A;  3I2G A;  2WZ8 A;  1OH4 A;  2VZR A;  2QBX A;  3IDA A;  4ZZ8 A;  2Y8K A;  1P8J A;  2Y6J A;  2BGO A;  1O8P A;  3DYO A;  1W99 A;  4BDV B;  3T0A A;  3SKJ E;  1JZ2 A;  3E1F 1;  3ACH A;  3GXU A;  1ULO A;  2B4K A;  3NRU A;  2JKX A;  1US3 A;  2EID A;  4TXW A;  3WNP A;  3T08 A;  3GGL A;  3J7H A;  1UMH A;  2WDB A;  1K42 A;  1UYX A;  1CIY A;  4ZZ5 A;  2VZ3 A;  2W95 A;  3ACF A;  2WYS A;  2QQK A;  2VQU A;  2VQT A;  2WN2 A;  2W1U A;  3CIH A;  2XHN A;  4XUT A;  3UET A;  1W0N A;  3THC A;  4BK4 A;  4BK5 A;  1JU3 A;  3WF0 A;  1PMJ X;  3OG2 A;  3HN3 A;  4DUX A;  1GUI A;  2Y6K A;  2C4X A;  1L7Q A;  2KD7 A;  3LPG A;  4L0P A;  3T0D A;  2BZD A;  1JHJ A;  2C9K A;  3UES A;  4CU7 A;  2VCC A;  3LQC A;  3LPF A;  2JD9 A;  2J1A A;  4M4P A;  4QX3 A;  1K3I A;  3K77 A;  4DUV A;  1JYV A;  4A3Z A;  4KWU A;  3MV0 1;  1KGY A;  1D7P M;  2VTF A;  1DYO A;  1UWW A;  4JHZ A;  5DQ0 A;  4MGS A;  2VZQ A;  1K12 A;  5LCW L;  3I2K A;  4W8J A;  4QB2 A;  4RN5 A;  3HPN A;  2W91 A;  4XUN A;  1LNS A;  1DP0 A;  5IHR A;  2ZEW A;  2WO2 A;  2W5F A;  3OGV A;  5IYY A;  2JDA A;  2ORZ A;  1DLC A;  4QX2 A;  2VZ1 A;  3GM8 A;  4JKL A;  4PT6 A;  4LKS A;  3VD5 A;  1UYY A;  3MV1 1;  1JZ3 A;  1UYZ A;  5B4X A;  3ABZ A;  1WKY A;  3WNO A;  4CU8 A;  4ET7 A;  2EIE A;  2VC9 A;  4W50 A;  1NAE A;  1TG7 A;  2RJ2 A;  4DEV A;  2QQN A;  2E33 A;  3W5N A;  4ARY A;  3DEC A;  4ARX A;  5HXM A;  4QDS A;  3WNK A;  3VD4 A;  4CUA A;  3T2O A;  1GNY A;  3UNP A;  4PF1 A;  4A4A A;  3VD9 A;  1UZ0 A;  2DCJ A;  2Y64 A;  3DYP A;  4PQQ A;  5LA2 A;  2Y6G A;  3CZU A;  1F4A A;  4E8C A;  3ACG A;  5IFT A;  3T09 A;  4D0Q A;  5C70 A;  3OEA A;  2W92 A;  2B9V A;  1KEX A;  2VO5 A;  3CDZ B;  4QB1 A;  4BXS V;  3I2H A;  5JR2 A;  3IB3 A;  3I3D A;  3WF1 A;  1TVG A;  3HJR A;  4CVU A;  4XUQ A;  3FN9 A;  4P00 B;  3T2P A;  3VD7 A;  4A45 A;  2VR4 A;  4UOJ A;  5A1A A;  3WF4 A;  2ZEZ A;  2BBA A;  2E31 A;  1UXX X;  1GOF A;  2ZEX A;  1O8S A;  3WQB A;  2WAA A;  4YPJ A;  2Z4F A;  3OB8 A;  4HG6 B;  1MPX A;  4P02 B;  5F7U A;  5JUV A;  1W9T A;  2PQS A;  1J84 A;  2W1Q A;  3OGS A;  4Z2A A;  5LA0 A;  1WCQ A;  2VZS A;  2J1U A;  1NX9 A;  2W1S A;  3FHQ A;  2QQI A;  4P08 A;  3BN6 A;  3DYM A;  4CU6 A;  4UAP A;  2YC4 A;  4CUC A;  2RV9 A;  1JYN A;  3SEE A;  2YC2 A;  3VDA A;  3OGR A;  4AG4 A;  1OD3 A;  2J1R A;  4JKK A;  2EIB A;  3ACI A;  4QDR A;  3LEK A;  4OUE A;  1XPW A;  1OF3 A;  3K75 B;  3OEB A;  2W94 A;  1CX1 A;  2V72 A;  3I97 A;  4MO3 M;  5DMY A;  3LE0 A;  4LHS A;  3WF3 A;  5I0D A;  3T0B A;  4OMC A;  4ZY9 A;  2DCK A;  4DEQ A;  5JXI A;  2DDU A;  4OYU A;  2XON A;  4GWJ A;  5B4N A;  2J1E A;  1YQ2 A;  2YB7 A;  3WNM A;  2VZT A;  3SEP A;  3SKV A;  1SG3 A;  2HYX A;  1NUK A;  4A6O A;  1JI6 A;  1F4H A;  1OF4 A;  3LEI A;  4A42 A;  4A41 A;  2EIC A;  5CYY A;  4LQR A;  3I2F A;  2QQJ A;  3A21 A;  1UY0 A;  4XUR A;  3K46 A;  3I3B A;  4QB6 A;  1JZ6 A;  2BER A;  1NKG A;  2J1V A;  4D8M A;  2JE8 A;  1CZS A;  4QX0 A;  1EUT A;  4XZU G;  3C7E A;  3THD A;  4RYD A;  2WO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...