3BN6A

Crystal structure of the c2 domain of bovine lactadherin at 1.67 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
b'CTEPLGLKDNTIPNKQITASSYYKTWGLSAFSWFPYYARLDNQGKFNAWTAQTNSASEWLQIDLGSQKRVTGIITQGARDFGHIQYVAAYRVAYGDDGVTWTEYKDPGASESKIFPGNMDNNSHKKNIFETPFQARFVRIQPVAWHNRITLRVELLGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactadherin
publication title Crystal structure of lactadherin C2 domain at 1.7A resolution with mutational and computational analyses of its membrane-binding motif.
pubmed doi rcsb
source organism Bos taurus
molecule tags Blood clotting, cell adhesion
total genus 42
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3bn6A00
3C7HA 1GOHA 2ID4A 3IB3A 4QDSA 2J22A 2WO3A 4D0QA 2VZTA 4CU6A 3WF4A 4A44A 4DUWA 1SHWB 5CZKA 1NX9A 2VJXA 2VMEA 2YFUA 3WSOA 1UXXX 3VD3A 4OYUA 3IAQA 1UMIA 2W1SA 1W0NA 1W9TA 4CUBA 1US3A 3GXUA 4M4RA 2OKXA 2E32A 4MGSA 3T2QA 3MUY1 2PQSA 1PX4A 2QQNA 2ORXA 4AAXA 5IYYA 2V5DA 3MUZ1 4KMQA 4RYDA 4CUCA 3HJRA 1UX7A 5CYYA 2W9XA 2W95A 1J84A 1W8NA 2C4XA 3I3EA 3OGRA 3VD9A 3C7EA 2BBAA 3CZJA 1OT5A 2VTFA 1H6XA 2XQXA 5B4XA 1GNYA 2L9LA 5C70A 1OD3A 3HN3A 3EB7A 4ZY9A 1NUKA 4A42A 5JMOA 3CKHA 1W99A 3ETPA 3GGLA 4ZZ8A 1O8SA 2VL4A 4XZUG 1JZ8A 4XUOA 3HEIA 3WNOA 2WN3A 1UYZA 3NJXA 3MO4A 2Z4FA 3HNMA 2E31A 1K12A 3I2HA 4JKLA 2VO5A 3I2KA 2DCKA 4TTGA 2Y6HA 1J83A 2BGPA 1L7QA 4QB2A 5LA1A 3NRUA 5EJZB 3HNBM 2VQUA 4JKMA 5FUIA 2WABA 4CUAA 1I5PA 3OEBA 3VDAA 1ULPA 4XUTA 3HNYM 2E26A 1CX1A 2X05A 3WF3A 3C7GA 2YC4A 3A7QA 1JZ5A 3FHQA 2W91A 4Z2AA 2C26A 1TG7A 4DXRA 2EIBA 4RN5A 5JXJA 2VOTA 1SG3A 5IHRA 2E33A 3HOBA 1ULOA 4XUQA 2X09A 1JYNA 4UAPA 4CU8A 1JHJA 2Y8KA 1OF3A 2W46A 1R64A 3I3BA 1O59A 1W9WA 4DUVA 1DP0A 4DEQA 4JKKA 4FI9A 1JU3A 1JYWA 2Y6JA 3GM8A 3MV11 2ZEZA 5JR2A 4W50A 3T2PA 1W9SA 3P6BA 2ZEXA 1GU3A 2B4KA 3JXSA 3LPFA 4DXTA 2VZUA 4LKSA 1OH4A 3OB8A 4LPLA 4BK4A 2VZPA 4QX0A 2VMCA 1YQ2A 4A3ZA 2VZSA 5DN2A 3ACIA 1HN1A 3OBAA 4BDVB 3A23A 2QQIA 5JXHA 2J1UA 1XPWA 2JKXA 3K4ZA 3VDCA 4M4PA 2VZOA 1WKYA 2B9VA 3LE0A 1US2A 3ACHA 3OG2A 4LQRA 3MBWA 5C71A 3I2IA 2W87A 2JD9A 3K46A 3FL7A 4P02B 3W5MA 1NKGA 2YG0A 5LA0A 4E8DA 3I2FA 1CZVA 1JI6A 2VZVA 3THCA 2W47A 5EJ1B 2YFZA 1UXZA 2QQKA 3F2ZA 4CVUA 4QAWA 3LEIA 4BK5A 4PQQA 3AC0A 5LA2A 1TVGA 4ET7A 4P08A 2XHNA 2J7MA 4KI5M 4TXWA 3MV01 1KGYA 2Y6GA 1RYYA 3A21A 5IFTA 1UY3A 3LQCA 5DMYA 3BGAA 2R7EB 3WQBA 1UY0A 1UYXA 3LEGA 4L0PA 4GWJA 2VMDA 2EIEA 1PX3A 3D3AA 3WNLA 5JXGA 3DECA 3GDBA 3WF0A 2VCBA 4OUEA 3CIHA 4ARXA 3T09A 3FHAA 2VCAA 1UMHA 2VCCA 1W8OA 3THDA 3T08A 3T0DA 1O8PA 3IAPA 4DXSA 2BERA 2J1TA 2WO1A 3OEAA 2EIDA 2W94A 4MO3M 4A45A 4OMCA 3PUHA 2W1QA 3OGVA 1KEXA 1UYYA 2VZQA 4A4AA 2X10A 3SEEA 1K3IA 4XUPA 5IFPA 3W5NA 3VD4A 2W3JA 5A1AA 2Y6LA 4UI9L 4XURA 2XOMA 4GWIA 2VM9A 1JZ6A 1XNAA 5DQ0A 3WNPA 2YC2A 1GQPA 2WUHA 3I97A 4XVHA 3SKJE 1T2XA 1JZ2A 5IJRA 1OF4A 3P1IA 3NJVA 1JZ7A 3WNNA 1NAEA 1GUIA 3IIIA 4QPWA 3UESA 2V72A 2ORZA 2HYXA 4ZXEA 2J1VA 4BJ0A 3WF1A 1L7RA 3K75B 4QDQA 5EIYB 5F7UA 5G04L 2RJ2A 2WAAA 2J1EA 2ZEWA 4QB6A 3LEKA 3VD7A 3ACGA 1F4HA 3ECQA 5HXMA 2Y6KA 2VR4A 2VZRA 2W1UA 4CU7A 4JHZA 1UY1A 2LW8A 2BZDA 1H6YA 4AG4A 2HLEA 1XNTA 1GMMA 1JYVA 3FN9A 1BHGA 3CMGA 1UY4A 3K4DA 1EUUA 4IUGA 4MGQA 3HPNA 2QQLA 1IQDC 3BN6A 2WDBA 1WCQA 4KWUA 3WNMA 4P00B 4DEVA 4QX1A 1JZ4A 4DUXA 2W92A 1JU4A 4QDRA 3ZM8A 4OMDA 1K42A 1PMJX 3K4AA 4JX0A 1P8JA 3CDZB 1K45A 3CQOA 5I0DA 3UNPA 2W1WA 3IDAA 4YPJA 4W8JA 4D8MA 3SKVA 4E8CA 3C7OA 2VC9A 3E1F1 5JXIA 3CZUA 3DYMA 3EYPA 2Y64A 1GOGA 2DDUA 2W5FA 3PUIA 3U37A 4W4ZA 1D7PM 2BGOA 2RV9A 4HG6B 4UOJA 1GOFA 2VQTA 3SEPA 4A41A 2VZ3A 2WBKA 1UZ0A 2J1AA 2WAOA 4PF1A 1CIYA 3ACFA 3DYOA 1EUTA 3K77A 2RVAA 2KD7A 3VDBA 4MADA 2WQ8A 3LPGA 4ARYA 3WNKA 1JZ3A 2ZXQA 2QQMA 2XONA 1JYXA 1XC6A 2WO2A 2JE8A 1MPXA 2QBXA 4CU9A 2C9KA 4OZOA 2J1SA 1SDDB 2VZ1A 5JUVA 5LCWL 4LHSA 3ABZA 1CZTA 4QB1A 4ZZ5A 2JDAA 5J1XA 2ZEYA 2QQOA 2QQJA 2WN2A 1UWWA 5G05L 2EICA 3C8XA 2LS6A 4QX3A 4P5YA 3OGSA 3I2GA 2CDOA 5HPOA 4XUNA 4MOAA 2V4VA 4GZ9A 4QX2A 5B4NA 2WZEA 3NQHA 1F4AA 2WZ8A 2WYSA 3A22A 2CDPA 3WF2A 1DLCA 3DYPA 5C7GA 1CZSA 3C7FA 4BXSV 5DPNA 1DYOA 2VMFA 3WEZA 3VD5A 1LNSA 1PMHX 3J7HA 3NNGA 3T0BA 2J1RA 4A6OA 2YB7A 3I3DA 1UY2A 3I2JA 3T2OA 3T0AA 2DCJA 4PT6A 3UETA
chains in the Genus database with same CATH superfamily
3IB3A 4D6SA 1OUSA 1RUJ1 5ABJB 1PO11 2AUYA 4AGGA 5A3TA 2CL2A 1O4TA 1DQ6A 3DPRC 1YI9A 1PVC3 3TB0A 4RS5C 3TYJA 3QCWA 2VJXA 3U10A 4QXKA 5IK4A 3TRSB 4XJUA 3AJYA 4S2GA 2VMEA 3KV5A 1LEMA 2RDRA 4L11A 3WSOA 5IVCA 1W2NA 3HBZA 4LHLA 5FXXA 4OYUA 4ZKTB 2CGPA 4HKWA 2W1SA 1JHNA 3DPRA 3BTXA 4GKXA 1WMDA 3RDIA 5A70A 5DXDA 1GWKA 2HWE1 2E32A 2BYVE 1ZREA 3T2TA 4HVQA 4JQTA 4MGSA 5AC91 5CA6A 5LEKA 2FCUA 1V6MA 2WZR3 1XSQA 3PURA 1FT9A 1S0GA 1X9TA 1PX4A 2ZGLA 3PVOA 4Y33A 5T5OA 4B4PA 1GYKA 1TME3 2NN8A 2ORXA 2QQNA 1AYM2 1H2LA 1YHFA 3AP4A 4JZRA 4NAOA 1W8TA 5F5QA 1HW5A 3LDBA 4OQ9A 5IYYA 1UX7A 2EXIA 2EF6A 2W9XA 3AZWA 4LBQA 2W95A 3HMYA 4KGQA 3UJQA 4CP1A 1J84A 3AP5A 3SHRA 2N7GA 2C4XA 3OGRA 4DS0A 5T52A 5F5CA 2JENA 1CONA 1CAXA 3AVSA 4LO4B 1OT5A 2VNGA 4IDZA 4WZCA 3RZHA 2VW1A 4V2VA 2K9ZA 1FMD1 2KR2A 2PAKA 1POV0 1SCSA 1OXCA 1VLNA 1T6BX 2D5FA 3IIAA 1HKDA 1W2UA 1SACA 1TNFA 4P5HA 4QHZA 4CCNA 5BYNA 5JMOA 3ZXJA 2ZGPA 3CU7A 2IXKA 2RS52 4MH0E 5LRRA 1QGLA 4FPOB 3AMMA 4RGGA 4E2GA 1QQP1 2TUNA 1W8FA 5J48A 5C3RA 1JZ8A 1DYPA 3ITQA 1ODNA 3MFCA 4YM1A 5FO8B 5DDJ2 1OPOA 5A80A 3I3MA 1I5ZA 4IE7A 5E1RA 2Q8OA 4L2NA 1DDLA 4C91A 1F31A 5FZ7A 1E57A 3VZJA 1LOAA 2LRPA 4BLIA 5I0SA 2NM1A 4LTAA 5DUVA 1ZNPA 5FK8A 2GAUA 1HRV2 2OX0A 5FZ1A 5FYSA 1K12A 3VZLA 4CDUC 1C5HA 1SLLA 1HQNA 1KS5A 4JKLA 3LA2A 5C3SA 3N7KA 5HCAA 2BGPA 5JOXA 1L7QA 3BYWA 2Q8DA 4ZPIA 1X9PA 2WR9A 1VRBA 1JOJA 1MZ5A 2XPJA 3PL0A 2D7FA 4FAGA 3BPSA 5EJZB 1MS9A 4M3CE 3BUCA 1YIFA 3HNYM 5ERLA 1A8DA 1C3HA 2E26A 3LIGA 1OQEA 1W04A 1AR93 1APNA 3M8LA 4QT6A 1WLCA 2YC4A 4MV2A 4C0HA 1ASJ2 3ON7A 4URTA 5E6HA 1H9WA 1DGWA 5F32A 1W6QA 4Z2AA 1R091 1TG7A 1VB2A 2EIBA 2VVEA 4BQXA 4QU1A 1REFA 4H7LA 2PFWA 5FZ9A 5IHRA 3QH7A 3NWKA 5J96B 3N36A 3UKVA 1JHJA 1ZBA1 3AJZA 4XFIA 1JUHA 4R9BA 3VL8A 3OF1A 5EJ3A 3J8F2 5FMOL 1V6OA 3ZFGB 4XMAA 4B7KA 4JCKA 1WBFA 4CEWA 1MZFA 1SBFA 4Q1PA 1O7FA 3MLKA 3BPZA 3ZYIB 3FLTA 5FZ8A 1WW6A 5IVJA 2WL1A 2ZEXA 4URAA 3JXSA 2VZUA 3INAA 3H8UA 1FOD1 4LORA 3SQOA 1YI7A 3LB9A 4UW3A 4OHXA 4YZ4A 4LO6B 2VMCA 3V65A 4B4RA 2JG8C 3JCIA 1EAH3 3ZFFB 3MEPA 1BBT2 1KS4A 4JGZC 1VMFA 2JIJA 4LA3A 4XXPA 1ZBA3 2XMLA 1NA1C 5I8YA 5K7PA 1EV12 2QQIA 2ZAAA 1RUD1 4DY3A 2YU1A 3U75A 1EY2A 1D2SA 3K4ZA 1Z78A 2JG8A 3S6PA 1OLQA 2VECA 2W0XA 1RUE1 2K2SA 2D43A 1POV1 2YGLA 1DGLA 4LQRA 3DEMA 3CL1A 1NA1A 3FFZA 3RPQA 5C71A 2MNGA 1NXMA 2W87A 4XF0A 3TEZA 2GC2A 2MPFA 4K6BA 2JIGA 4BLJA 2VBDA 1RB8G 3H1YA 5A33A 1LULA 1V6LA 5K0UC 5HBAA 4HXCA 5LA0A 3I2FA 2V5YA 2VZVA 1V9U1 3O14A 4W6XA 2W47A 3VBSB 3UGGA 4JC1A 4AEDC 5EJ1B 2QQUA 1CR7A 5FZHA 1IS4A 1JBCA 1Y9MA 4BOWA 2YFZA 4MUVA 4CCCA 3CJXA 1UXZA 2QQKA 3F2ZA 4QAWA 5K0UA 4K21A 5BV6A 4CA9A 1RUD3 4XMIA 3FZ3A 3POYA 2OVUA 4PCRA 4XJ8A 5KHJA 4P08A 4LE4A 3OBTA 1BLZA 1TMF1 2J7MA 2ZTNA 3DKQA 3IDEA 4IEQA 5GZEA 5KXEA 1LKNA 4O65A 1NOVA 1RUE3 5F39A 3U14A 3MV01 5JSRA 4QM9A 1RYYA 1FATA 3NV4A 3RQ0A 1AR63 4XBNA 2FDHA 1RUG1 2RMU1 5FQ0A 2P3IA 5A1FA 1QNYA 2AENA 3K3OA 4WVMB 1H2NA 5KHKA 4M0HA 2PAMA 3WR0A 4AQ6A 2ARBA 3O1MA 2WFPA 5DAQA 5FZAA 4QPIB 1WMFA 1UYXA 4L0PA 2CHHA 3ZYJB 2SLIA 4Q4V3 5FK7A 3B94A 2EIEA 2YC0A 3WNLA 4BQ3A 3LWCA 3DECA 2VCBA 2ARXA 5C3OA 1G7YA 2NPIA 4BQ2A 3HWJA 5JI9A 2A1XA 5C9AB 4JDNA 2F17A 5FXZA 4HSJA 4Q0PA 3ST7A 3VKOA 1J1TA 4Y20B 3T3YA 1VBB3 4AF9A 3O7OA 1FI2A 2ZGTA 5KHGA 1KITA 2R6QA 1COV3 4I09A 4O61A 4BA6A 2XBO1 4UFIA 2XLGA 1L7LA 3DXTA 3PTYA 2XJPA 4X6RB 5FYYA 2DBNA 4OMCA 2VOWA 2ET1A 3LA3A 1B09A 1QOTA 5D21A 1UYYA 4LJHA 3SEEA 2IC1A 3FWEA 2A71A 2R041 4HANA 4AI1A 3RZKA 3UGFA 4CXXA 1W6OB 2Y6LA 5JIUA 2A6ZA 1YCIA 2XQRA 4CDXB 4XURA 2XOMA 4GWIA 2PAEA 3K48A 2ZCWA 2ZHLA 1BEV2 1WZXA 3RRDA 3W9AA 3OD0A 4M3CA 5K8SA 5FREA 2RR12 2BVBA 2YC2A 3H42B 3OPTA 1HXS3 1RUC3 3DUIA 2K0GA 1VRH1 1XNCA 3UK9A 3A0NA 3KCXA 2HWC2 3LD8A 4L99A 3TOJA 1TEIA 1J59A 4LHKA 1OLME 1VE0A 3P3NA 1A78A 1YO8A 4Q27A 3OGJA 1OF4A 3HT1A 4LBJA 1W8WA 1QJY3 1UD1A 1QOOA 4ZHNA 4UYBA 4NHXA 3WNNA 4ASMB 1UNBA 4HMZA 3CF6E 4AK3A 4U2AA 1NAEA 4BE3A 2I07B 3IIIA 4IV3B 4CCOA 1YQ6A 2GN3A 4QPWA 1Y3TA 5AFEA 4XF4A 1GWLA 3MIHA 2ORZA 1S2KA 2G9ZA 1MVEA 4XJWA 3ZN4A 5T5JA 5ABJC 1NCQA 3FC0A 2XUEA 1ENQA 2ADDA 1RVF2 1W90A 3TBDA 1IG0A 2B46X 2FDGA 2J1VA 4BJ0A 1FPN3 1CJPA 3KVBA 2CWSA 2CYFA 2ZGMA 5GLZA 4LUMA 5APAA 2ARAA 3K2OA 3K75B 1NZIA 4COYA 5BUVA 4PF5A 5IT6A 4H7MA 1Z7S2 4BHPA 4A6SA 5FWEA 2PMWB 3NKTA 3N7LA 5L73A 4E27A 4RHV2 3DPRB 4NVPA 3ZXAC 1PVC2 5HXMA 4RQPC 4XYXA 2VR4A 2VZRA 2GNMA 2W1UA 4CU7A 2DYCA 3H9AA 4P14A 1H6YA 1S0JA 3VUOA 1YFXA 3N35A 4X8NA 4QHOA 2WC2A 4ATFA 3IT8A 3B01A 1JYVA 4YM3A 1AYM3 2VBBA 2JDKA 3S7EA 2UU8A 1UY4A 3ASIA 4RQPA 5C5TA 5GM0A 4JRLA 3G6JB 5I93A 1BKZA 1S0EA 2HWF1 2QQLA 3AFGA 4KWUA 1CAXB 2WZR2 3AXDA 4AVVA 2GN7A 3NVCA 4P00B 4XHXA 5FAXA 3DV8A 5E16A 4DUXA 4JRAA 5IAXA 4XDQA 1HJFA 1JU4A 3ZM8A 5C3QA 2VVDA 5FZ0A 5GZDA 2HBTA 3K4AA 4GJZA 2NMOA 1OKQA 1OSGA 4XIKA 5EWSA 5H9QA 1PNGA 1P8JA 2B39A 3CDZB 3IZOA 4P9GA 3SMHA 3WP6A 5I0DA 4E2SA 4YPJA 4HOOA 4YWAA 4D8MA 4E8CA 5IK5A 2RS53 2E7AA 3C7OA 5FZGA 2Q1FA 4C8DA 5HCFA 4F7ZA 1DU3D 4FVVA 3S5QA 5JXIA 4MHUA 5DDJ3 1G9AA 3EYPA 1O3QA 4H3WA 4HN0A 1ASJ1 1N3OA 4NIAA 1D4M2 2WJSA 3R4DB 4EE2A 5J37A 2DDUA 3PUIA 3O0WA 4OZXA 2ZX3A 5J98B 3U37A 4W4ZA 5JSOA 4E4DX 1D7PM 1QY4A 1HRV3 3WDYA 5KWRA 2PHFA 4UOJA 3T1LA 1L3JA 3SEPA 2IVJA 1CIYA 1W39A 3DYOA 3POJA 1OPMA 3K77A 1RMU1 3ZFEC 5HV0A 4E4SA 3V0BA 1VBD2 2H0VA 2RVAA 1XE0A 5L9RA 4D7SA 1SLAA 1XNBA 2WQ8A 5FOBB 4LR4A 2AGSA 1RTVA 1GP4A 4WM7A 5FYCA 5IWFA 2P5BA 3LDRA 5LBEA 2IXLA 3V0AA 2XJQA 3ZFEA 1XC6A 1QHDA 2DBIA 4IGPA 4UFMA 3WVJA 2J1SA 1N1YA 1ASJ3 1SDDB 2PLV3 3ILFA 5JUVA 1LOFC 4XQDA 1W6QB 4AHXA 4BMEA 1ZYBA 3ABZA 2QVSB 4XCBA 3LIHA 3ALQA 4NHLA 5G05L 3AMPA 3L2YA 1UMZA 2Z5WA 5FBZA 2WNEA 4QX3A 3I2GA 3RZGA 2Q30A 5A7QA 4U36A 5FP8A 2D98A 1EV11 4XTMA 1LOFA 3J8F3 1PZ7A 3WDUA 1G9FA 2BQPA 1NT0A 5F6KA 4XC9A 2WA4A 2HWB3 3MYXA 4CEWB 2V4VA 3ZSMA 3NQHA 5IVFA 1F4AA 2RG4A 4YYOA 5C4WA 1RUF2 5JVVA 1SPPA 3PVEA 4XDPA 4A7ZA 5CEHA 2R0HA 2FD8A 4XFCA 2B8MA 3IKWA 1MEC3 2YGMA 2ZGSA 4OQ8A 1HB1A 5GKAC 3WF2A 5CKNA 5CU1A 4AFDA 2HWD1 4CYDA 4NOTA 5C7GA 3VKMA 1C8M1 3C7FA 1O91A 2G9FA 1QXPA 1UL9A 1DYOA 4X6QB 3MLLA 3WEZA 5DUXA 1BBT3 3N9PA 2A3XA 1SFYA 4G4FA 3ZKYA 4HZFA 4A6OA 4XTPA 1OLMA 5EXOA 2FZ1A 3H7YA 1V0AA 4D3WA 1YFUA 1PGL2 1UU5A 4DFSA 2DVBA 3ACLA 2DCJA 2BUKA 2JG8B 1SLBA 4A7YA 1W06A 2EXHA 4AVAA 1EAH2 2XL7A 1C5IA 2P3YA 2WO3A 2PHLA 3HT2A 3Q9OA 1V00A 4D0QA 4EN0A 4YZ5A 4OHVA 4CU6A 1KFUL 4P9IA 4QQPA 1NA1B 3WF4A 2WFF2 4DMIA 1I6XA 1TZOA 1UPSA 3IMNA 3OBRA 5CG9A 3LEMA 4UXAA 4BQYA 5A33B 3MDPA 3ZN5A 2QQWA 3MIGA 4I30A 3OUJA 1UZZA 2JE9A 5AVPA 4XDOA 3VBSC 5CFDC 3POSA 1UMIA 4PLNA 1WW5A 1M4WA 1US3A 3M1HA 2PHUA 5FCCA 1YQ8A 4H2AA 5T50A 1OVPA 3VKLA 3T2QA 2GSYA 3ILNA 2VMGA 5DUUA 3QH6A 1S2EA 1LJ7A 5A7WA 5LBBA 3UT0A 4BPZA 5CFDA 1A34A 3PJYA 2PQSA 2BFUS 3PIGA 2B42B 4XACA 3VLBB 3GYDA 3E6DA 2XWJB 2W52A 1W6NA 1OI6A 4RYDA 4CUCA 2DF7A 5SV8A 3PUSA 2OPKA 3AMHA 5FQ0B 4GH4A 1W8NA 2X5IC 3I3EA 5FOJB 1WBLA 2AEZA 3U4SA 3CZJA 4OFGA 4R52A 1GV9A 4AI3A 1H6XA 1PVXA 1V6KA 1VALA 2DU1A 5C70A 2BRTA 1OQDA 5JWPA 2AZ5A 3J7LA 3GNEA 4N9IA 1ZM1A 4RA0A 2X5IA 4LO5B 3EB7A 3MIFA 4XBLA 1OQ1A 3BOWA 1NUKA 1V6NA 4A42A 5C9AC 1NE6A 2GP5A 3LFMA 1AL0G 1PZ9A 3MIBA 4LKFA 5BNQA 4AI0A 3R05A 2KXLA 2VL4A 4Y5SA 1OURA 2RR11 2OZ6A 5I8SA 3SCHA 1AR71 3HEIA 1HLCA 4I0BA 5A3WA 2Y6FA 1DCSA 2ES3A 2MEV1 2WQZC 3BU7A 4GAZA 4NHKA 3WNOA 2HWC1 1BCXA 2BJSA 1DGRA 2IFWA 3MHZA 5A6QA 3UJOA 3NJXA 3H8XA 4GJYA 4FP2A 2JDPA 1OUXA 1WCSA 1SFPA 4V1PA 3I2HA 3B69A 1VBB2 2ATFA 2VO5A 5FLJA 4OI4A 2DCKA 5KC5A 2GNBA 2Y6HA 2FZ2A 1J83A 2VOKA 4IGQA 3WHUA 3B3QE 4QMAA 2AH2A 3HNBM 2VQUA 1PIV3 4CDXC 4JKMA 5IVVA 4IE0A 1ZX5A 3OEBA 5I0TA 3J26N 4CUAA 3T1MA 1OOPC 4XUTA 1NZCA 1CX1A 1BEV3 3WXPA 4WVVA 3WF3A 2EA7A 3C7GA 4INDA 3BKZA 2RDNA 2RR13 3A7QA 4IW3A 4M3CB 4TYSA 1JZ5A 2ZBJA 3TEYA 1IPSA 3ME2A 3S57A 1JYTA 2W91A 1Z7S1 2ZZJA 5FO9B 3UYJA 1RXFA 3ZXKA 3VBUA 4E9KA 1G6NA 4JVAA 1OOPA 1SG3A 4XFBA 1O4ZA 1MS8A 5JXJA 4N7UA 4XAAA 1QOSA 1QU0A 1SLCA 2ZGNA 4K8RB 4AQSA 2OYZA 1A3KA 1ULOA 4XUQA 1PVC1 1JYNA 1UU6A 2ZHMA 3O0XA 3KVAA 1OF3A 3SCFA 2W46A 2DUOA 5A7NA 5BNOB 1R082 3MW2A 3M3CA 1DIWA 5FP7A 4QKDA 1HXS2 1O59A 1AJOA 4GIQA 1AR82 3QACA 3AXEA 4IE5A 3PU3A 4XJAA 3MV11 4PI2A 4LMFA 1IPKA 5JR2A 3O1OA 1WW4A 1VBC3 5EV7A 2JDNA 1NCQB 1RVF3 3P3PA 4YVWA 1DZTA 2VOVA 4F83A 4JHTA 4Z1VA 1VMJA 4UT5A 1MS4A 2VNVA 1LOEA 3MIEA 4W65A 1W3VA 2WWJA 1QJEA 2DV9A 2BWAA 1Z7S3 2WZR1 3VZNA 5FZ4A 5IAVA 2UWAA 4H55A 3OB8A 1TME1 4LPLA 5FY5A 1C1FA 1SBEA 2VZPA 1ODMA 4FCAA 4RHV3 4AI8A 1YQ2A 2EIGA 5DABA 4P9LA 1Z0HA 5DN2A 4AEMA 1FPN2 4FT8A 4IEUA 1HN1A 3OBAA 4WZFA 3AMNA 5A3OA 2GMMA 1JMUB 1YEWA 2ZMNA 3POIA 5JXHA 3WDVA 4QM8A 1KD7A 2XJTA 1YQCA 1Y9GA 2XKPA 1XPWA 4N9HA 3S0MA 4AGRA 3R0RA 3JBG3 1AXKA 3KMHA 4NHMA 2JICA 1S0IA 1D4M1 5LBCA 4EROA 2B9VA 2C1FA 1US2A 3ACHA 4RQPB 1H2MA 2ZGQA 3NAPC 3VN4A 5JOZA 1GZCA 3WCRA 1Q8SA 2GH2A 2P6HA 5KC6A 2YY1A 3URFA 3W20A 4P02B 4MX3A 2YG0A 3KT7A 1CZVA 4MVTA 2D5HA 4EWEA 4DXZA 1V70A 3WNXA 1A8MA 4BQ5A 1AHSA 3Q8CA 3QBQA 3NAPA 2MHFA 2ZZQA 4NIDA 5KBFA 1ZBE2 1DG6A 3NSTA 2QQPA 2ZMKA 2FCVA 1QH7A 1XE7A 3LEIA 4ASLA 5LK5A 2GZWA 1UIJA 4OCTA 3D8CA 2R49A 3AC0A 3CHXA 4J1XA 4Y22A 4I02A 4HVRA 4Z8BA 3OGGA 3IWZA 2ZMLA 3U0ZA 2ZS6B 4I3PA 1RINA 4GMP3 4V2WA 4XIOA 4TZDA 4WV8A 3TWIA 2FDIA 1D4M3 1MQTC 4IXLA 1W8HA 2ZX2A 4NPLA 2HJIA 1OD5A 3V56A 2VGDA 3PNAA 5L9VA 1IS5A 4MYEA 3ZX7A 2EXKA 3FHIB 3LQCA 4FPLA 5AFBA 2A3YA 2O8OA 1OH3A 1SFNA 1VB4A 3N7MA 3PUAA 2OT7A 4PBOA 4RGKA 1IG3A 1S4CA 1AR91 4D69A 3KD4A 1UY0A 5T5PA 1MQTA 2DU0A 4DY5A 4BIFA 4BQWA 5FY1A 2VMDA 1VBD3 2R073 3IDBB 4HETA 3V0BB 3D3AA 3D0SA 5F3IA 5JXGA 2WT2A 4IV1C 1RIRA 3CIHA 3CNAA 5T3NA 1RHI2 1RXGA 5F8PA 3VZMA 4LKEA 4KG0A 5ANNA 2ILMA 3O5SA 4WM7B 3ZSJA 1UMHA 2VCCA 5C3PA 2JB4A 2YROA 1EPZA 3AL6A 4CE8A 3V0AB 3ZFEB 4LEJA 4HK9A 1UZYA 4OHWA 1X36A 4IV1A 5D1IA 3T0DA 4MGTA 4GWMA 1O8PA 3LKJA 1OA3A 4NHYA 5EQUA 1N47A 5JI7A 4COUA 1IHMA 4QQOA 4DXSA 2LUWA 2EIDA 4FOWA 4MO3M 2FBEA 4JDOA 3EXUA 3RS6A 5CNAA 5FY4A 2DFBA 2ZABA 3OTFA 2JKBA 2W1QA 3OGVA 4S2DA 2WSUA 1FXZA 2ZGUA 5EPAA 3VB9A 5C8WA 2PLV2 3AZYA 3WINE 5IFPA 3B9CA 5L36A 1ZZCA 5IK7A 1AZDA 3W5NA 4XXAA 5BNPC 1PGL1 4CRQA 3BIWE 4NPRA 4CEWC 1DGRN 1U5YA 3POBA 2AC1A 1EAH1 5GZCA 1JXNA 1PMIA 2DCTA 2VM9A 3RMYA 3KT4A 4DPNA 1UZVA 1X33A 2LROA 3WZ1A 1OHFA 1HDKA 5DG2A 1JZ6A 1RUF3 5C4WB 1H9PA 1SPPB 1N1SA 2DUQA 5KXBA 5BNPA 3O1UA 2VCMA 2HWB2 1CX4A 2WUHA 4LUKA 3KZ4C 2XR4A 3R6SA 3VHRA 1HV1A 3SKJE 1GP5A 1GP6A 1T2XA 2JE7A 2UURA 3GBFA 2CAVA 3MPPG 1J3QA 5FZMA 3JB8A 4YG3A 1WWYA 5LY2A 3ES1A 2GALA 3ZMOA 1W2AX 3SC7X 4BXFA 1DBNA 1MEC2 3GJAA 1CAUA 2FQPA 2VPVA 1GUIA 1UU4A 3LSEA 3MPBA 3Q8FA 1YJLA 4B29A 1UOFA 4LLOA 4FAHA 3UESA 2HYXA 5FLIA 3E6BA 1LOGA 1LGNA 3QLQA 2WFF3 4B4QA 3AP9A 1DZQA 3WF1A 1Y4WA 1BQPA 5SV5A 1L7RA 4QDQA 5F7UA 2XVGA 5ISLA 3ZIWA 2RJ2A 5ANQA 2CGNA 2WAAA 3LDKA 3USUA 4CCMA 2WQ4A 3ZYGA 2J1EA 2ZEWA 1Q43A 4Y3OA 4CXWA 3LEKA 1AR61 3APBA 1XYNA 2RJKA 3ACGA 4WVZA 4GB33 1UCXA 3ECQA 3WUCA 4Y4RA 4LBMA 4MXVA 1ND3C 3ES4A 1URXA 3H1WA 4IERA 3MF6A 4XFGA 4JHZA 3L9JT 2BZDA 5A7WB 3RNSA 2Q1ZB 5FY7A 5CFDB 4Q4V1 3SH4A 2XB6C 4YZ2A 3HBKA 2WNOA 2OPWA 2R16A 2WWSA 4J1WA 1ULDA 4GXLA 3K4DA 4Z82A 1W6NB 2BOIA 4LOTA 4XAEA 2JDHA 1ND3A 4XF1A 4FSJA 1DQ4A 3WW3A 2WKKA 3WW1A 4PJYA 2JJ6A 2P37A 4GH4B 1KQRA 3D0JA 3POGA 1IQDC 1WCUA 4Y4YA 2Z2SB 5FYBA 4XFFA 1VBB1 3WNMA 3F95A 2Y34A 2Y60A 5JR7B 3QD6A 2W92A 4QDRA 1COV1 1QDOA 1K42A 3FFQA 1PMJX 2P17A 2P1BA 3IPVA 4FP3A 2X5IB 3ZXLA 2QZ2A 3IDAA 3IN9A 4K20A 1UQXA 4W8JA 3SKVA 4PIZA 4AFBA 2O1QA 3D82A 4R8HA 5CBLA 4XQWA 3N4MA 4UF0A 2BTVC 2DCZA 5HCHA 2VC9A 4FPKA 3ZLIA 2Q5TA 3CZUA 3DYMA 4H14A 1QNWA 4Q8KA 1GOGA 4CUGA 2OUHA 3EHKA 3JQWA 3KGZA 4ONUA 4XBQA 3LCPA 1DHKB 4DO0A 5C5UA 1KFXL 2PQQA 1UKGA 4NROA 2LTNA 2WAOA 1IKQA 3KQRA 4PF1A 4R9CA 4DRRA 3RI9A 2B7YA 3B9IA 2XG3A 5DG1A 1N3QA 1HXS1 3NNLA 1PM4A 1RUC1 1GZWA 5FV3A 3A4UA 4QGMA 4EYUA 4Q4W3 3VDBA 4MADA 4FPHA 3LPGA 2ZKLA 3WNKA 4CDQC 1ALYA 2YBKA 3A0KA 1Q8OA 1Q5OA 1PK6A 1QJY1 1UZWA 3N9QA 1ZZ7A 3BVCA 4PI0A 5F3EA 2KM2A 1MPXA 1AXYA 2FMDA 1ZA7A 5FYIA 1QJU3 2VZ1A 4QQLA 4AI2A 5JZGC 4O7XA 3AM2A 4LHSA 4LIVA 1KDKA 2GNDA 4CDQA 4COVA 4QB1A 5JSPA 5LASA 2E53A 4Z2WA 3RYPA 1PIV2 1LHWA 3J7MA 3PVBB 1HN0A 2WN2A 3VBUB 1OOPB 1ULGA 3GCWA 2EICA 4WM8B 1GQGA 4ES8A 4EZ4A 2LS6A 1FPN1 3LGRA 5JZGA 1R083 4F3JA 5BNOC 3ZSKA 1U5ZA 4YM0A 5HPOA 2IFRA 1DZRA 1AR83 4K3UA 4UFJA 4F8AA 5EYYA 4IETA 5FYUA 1ZZ9A 4XUNA 3I2DA 4MOAA 1GLHA 3PTRB 4LBNA 4QX2A 1OLRA 1NCQC 3LOIA 4YVWB 3BALA 5BNOA 5JPNB 3NV2A 2ERFA 4E4ZA 3D4KA 3ZXDA 2GC3A 2CNAA 4FXGB 3A22A 2ZGRA 4GALA 4PQ9A 4IEWA 3WD5A 5FZDA 5BY5A 2P34A 3DYPA 4IEXA 3PUQA 1FAYA 4FBFA 1ZRFA 1AYM1 4BXSV 4XZPA 2BNMA 2DTWA 3RMXA 1W0PA 1VBC2 2X29A 2YUEA 1KJRA 4HK8A 2EXJA 3O1RA 4NWWA 1U5XA 4QKNA 1YXWA 5JCTA 3O12A 2VMHA 1S0CA 1S0FA 1LNSA 3NNGA 5FZCA 2XLFA 4AEKA 1YIPA 1Q3EA 4WBBA 2VE1A 1C57A 1OC1A 3UKTA 1UY2A 3I2JA 1VAMA 5FPXA 5FMOS 1CJDA 2Q8CA 2A6YA 3PMSA 3C7HA 1WLWA 3KV9A 1LENA 2B45X 3AKSA 1IGOA 3PHMA 3O1VA 2J22A 4FO9A 3X29B 1NQDA 3ETQA 3WY6A 4AYUA 4C0BA 2VBPA 3ATGA 4FPFA 1OA2A 2IXHA 1PGSA 2RS51 4QX5A 5A3PA 3SCGA 2OUJA 3E5QA 1HX6A 3I8TA 5FJHA 5FPZA 4AXOA 5DDJ1 4PBPA 2JEMA 3AYCA 1UXXX 3JBG2 1UOGA 4LO8A 4Q1RA 3IAQA 1F9KA 4TSVA 1OFSA 1YNAA 4JTNA 1W0NA 1UW8A 1W9TA 3NAPB 4MLOA 1VBE3 1ZBE3 2G19A 2IUWA 2IXIA 1J1LA 5FLHA 4CUBA 1RHI1 2OKXA 5LK7B 1HRV1 1C1LA 4B8EA 3AYEA 3M7AA 1ULFA 2P3KA 4L9BA 4Y22B 4XHBA 4AWDA 3AKQA 3MUY1 4Q4Y2 2GC1A 3ZYBA 4JAAA 2QKDA 1XYOA 2YPJA 2IWGB 3MUZ1 2W39A 3KV6A 1ST8A 4KMQA 2I2SA 3HJRA 3J4UH 5CYYA 4FQZA 1CAVA 2BNOA 5FMDA 2QQVA 2YBPA 3ZN6A 1AUYA 2AACA 1W2TA 2TNFA 2DVAA 1W8UA 5LBFA 5IK8A 3RZLA 5FXWA 3WQ7A 1RUNA 2BBAA 4LK6A 2HBUA 4NN0A 4YLZA 4XW3A 5FZLA 2VTFA 3WQ1A 1RUH3 3RJRA 1D0HA 1MQTB 5B4XA 4AHYA 1GNYA 2L9LA 2PLV1 2RM23 2IVIB 2SBAA 4N8MA 1NLQA 1I3HA 3H3ZA 1RUJ2 1JTZX 1PHMA 5LA9A 1OD3A 1RHI3 2UWCA 4CZSA 1X7NA 5FYHA 4UW6A 5AVAA 3CKHA 4WM7C 3LFIA 1W99A 3ETPA 1JODA 4CPBD 3GGLA 4QPYA 1ULCA 1SZBA 1O8SA 1W6MA 3AP6A 1GQHA 3J8F1 4JQRA 4XZUG 4ZZ8A 1JH5A 1FNYA 2R072 4QKBA 4AFMA 3ZO0B 2HWB1 4IV1B 4ZS3A 1QDCA 5FP3A 2WN3A 2CAUA 2R062 2D44A 5F6LB 2ZGKA 2YXSA 4XFHA 2ENRA 2Z4FA 4M00A 4XETA 5FXVA 2E31A 4R9DA 1IS3A 4IGOA 2GMPA 1AYN3 3I2KA 3VBHA 1MEC1 2PHTA 4ATEA 4TTGA 4QB2A 3WP4A 3FBYA 5LA1A 1REDA 1KDMA 1W0OA 2GNTA 3NRUA 3WX5A 4IESA 2OS2A 5FPBA 5T55A 2DUPA 4Q8LA 5FUIA 1BBT1 1I5PA 1ULPA 4YZ3A 2PA7A 3H8OA 5A7PA 3H0OA 5KHIA 1F5FA 2VNRA 3PVNA 4HPKA 5C4WC 1LR5A 4LULA 5FZEA 3W21A 3WDTA 4EN6B 2VXRA 3ZPOA 5BNPB 4TLGA 1XU1A 2WNVA 4JGYC 2VY0A 5JMCA 2HKXA 2PELA 3WP3A 1YUDA 4RN5A 2HYKA 2VH9A 3L2HA 2VOTA 1JYIA 2E33A 5DZGA 4X8PA 4OVEA 4Y5Z0 5HCBA 4B1MA 2X09A 3WG4A 5J36A 3N7JA 4Y1YA 2Y8KA 2C5DA 2ZPXA 4AEJA 3T30A 4AHZA 3OJBA 1R64A 1HQLA 3H50A 3I3BA 4JGYA 1W9WA 1CAUB 2C9AA 2JDUA 1VMHA 2B5HA 2QCSB 5A3MA 5KXDA 4JKKA 3DKWA 4FI9A 1PZ8A 4LA2A 2AR6A 4XPVA 1JYWA 1H1AA 2GMEA 3AZXA 3GM8A 1NCRA 2D6PA 4FPEA 2ZACA 5JOYA 3O0VA 4BYYA 3KV4A 1W28A 1KRIA 4PIYA 3VDDC 3T2PA 3KWVA 4P9WA 2JECA 4QPGC 3LPFA 4KBZA 4DXTA 4YG6A 1Y7BA 5DAVA 4JDMA 4K1ZA 1OMIA 4K7JA 1OH4A 4GQ7A 2YU2A 3USUB 4CPBA 4Q0QA 4CSWA 5F9TA 3VDDA 4QX8A 3IBMA 1A6CA 4MGZE 4MHRA 1KXGA 4NO4A 3W58A 4A7KA 1C8NA 4QPGA 1JYCA 5C6CA 4LT5A 4BDVB 3VBOA 3FJSA 1GZ9A 1MZEA 3A23A 3GBWA 3J9SA 4I3GA 3WV6A 2GDFA 4TWTA 1XOYA 2J1UA 1KJLA 2W68A 4ASKA 1AX1A 4CDWA 4QWNA 4IL7A 5DZFA 3WLUA 3ZYRA 3VDCA 1OFNA 4Q2FA 5FO7B 1WKYA 5FZOA 3LE0A 4GB32 1QWRA 3MBWA 2FDFA 1H4GA 1ND3B 2CWMA 3FBMA 4A2UA 4XE9A 2JD9A 3K46A 2WNUB 2AYHA 3HR9A 4GA9A 4GH4C 4GKYA 3JUUA 3RYKA 3VBRC 3GZTB 4E8DA 4EQVA 1JI6A 3THCA 4JTOA 4K40A 4L92A 4Y1ZA 3M70A 4HVOA 2WLQA 3V64A 1EYBA 3BB6A 4QU2A 5GLVA 1Q8QA 3GJBA 4XF3A 2WINB 3S30A 1RUOA 5F5IA 4SBVA 4BM8A 4XEZA 2CGOA 3IPVB 4CVUA 1GZTA 3AFKA 1DQ1A 2WT0A 1R1A3 3VBRA 5C8CC 3I3QA 4WVWA 2JX9A 1LRHA 3LAGA 1AJKA 1TVGA 2D6MA 3M3IA 5FY0A 4GMP0 5LA2A 3RZZA 4UF0B 4CCKA 2XHNA 4DINB 2VVFA 4KI5M 2D6OX 1VBA3 4UW5A 5GJ6A 4OHYA 4TXWA 2AEYA 1KGYA 2Y6GA 4OI0A 3B5LB 5JIAA 3FX3A 3KB5A 4AGVA 1BJQA 5GLUA 1TNRA 1PIV1 3A21A 5CVRA 4AVTA 5C8CA 4FTSA 3OSDA 3VGIA 5DMYA 4Q4X2 5IW0A 1GNHA 1WGPA 2R7EB 1BEV1 1CIWA 4DIQA 2V73A 5A3NA 1NG0A 4RSUA 1W03A 2R1DA 1IPJA 5KR7A 1C28A 3WG3A 4GWJA 3OPWA 1NLRA 5LEJA 1LOBA 1PX3A 2P2KA 5JDBA 1GZWB 1F5JA 1FV2A 1LECA 3GDBA 3NNMA 5FZ3A 3MF9A 3OPZA 1AXZA 1HV0A 2ZAHA 2ZHKA 3NJZA 3OD4A 2PHDA 3T09A 3DGTA 4CCJA 2RHPA 3FHAA 4ZS2A 1PK6B 1W8OA 1U12A 3SH3A 3GZEA 4FPJA 1LHOA 2HH9A 1V9U2 3T08A 1Q8PA 3JD73 3N9NA 4L97A 4Q4W2 4M3CF 4CDQB 5L7OC 2VQ0A 4UFLA 2QE3A 1LU2A 1Y43B 2BERA 2XJRA 3OEAA 4BMBA 5FDBA 1VBC1 5L9BA 2ZKNA 3KSCA 3VBUC 1RVF1 1OVSA 1JUIA 4A45A 2G9GA 4WM8C 1YRZA 3KT1A 4YARA 3RGBA 2XUMA 3ZXGA 2CSGA 1QJU2 2VZQA 4A4AA 2X10A 2RDQA 5JZGB 2BDRA 5IVYA 5L7OA 1V6IA 2Q4SA 4LKDA 2HEYF 4YG0A 5A1AA 1LGCA 4XJZA 2XDVA 1VAKA 4KBBA 4RHV1 5FZBA 4GULA 4AVSA 3HN1A 4WM8A 1RUG2 2RMU2 3OYWA 1E5SA 3J7NA 3FLPA 2XWBB 4EWAA 1QJFA 4IEVA 4YVWC 4AFCA 4FTEA 4RL7A 1XNAA 3IDCB 3PU8A 1J3RA 4YGBA 2PYTA 4NWVA 1GQPA 4MGYE 4HKLA 4TN7A 2D3SA 2JB8A 2V4AA 2RDSA 3JBG1 4QXBA 3THPA 2BPA2 2F4LA 3DXUA 3N9LA 1JZ2A 1CAWB 3NNJA 4QQ2A 1BZWA 1F15A 4N43B 2CU5A 3AYAA 1K5JA 3ROUA 1ACCA 4C1XA 3JU9A 2OQ6A 4FPGA 2RS12 4PHZA 5FRAA 2CY6A 2WO7A 4S2FA 4FQ4A 4UBHA 1RGSA 4LHNA 2XBO2 5HI0A 3FMGA 1V6JA 1BK1A 2YYOA 4W6WA 2V72A 5CISA 3CJIA 4KWLA 4FOVA 2P4EA 5GALA 3S7IA 4AI9A 1DFQA 4NJ4A 1H8TC 4OI1A 4N90A 4Y24A 3R4SA 4RFRB 5CKMA 2R042 1HQWA 3POFA 4GMP1 1ZRIA 4Q29A 5FYTA 2NZ9A 2Z42A 3OOXA 4OUSA 3MZHA 1PGW2 1AX2A 3G7DA 1O5UA 2A6WA 3HQXA 3RG0A 3VD7A 5J09A 1H8TA 3PJQA 4JV4A 1UO9A 3THTA 3ZSLA 2Q1MA 1LB2A 2P3JA 1XYPA 2VXJA 1VAVA 2Y6KA 3RI8A 3ZR5A 2A70A 3LF7A 2A73B 3ORJA 3NMBA 5F3CA 5DUWA 2LW8A 4DOUA 4Q4Y3 2VTXA 5B2GB 2WS93 3KF5A 1H4HA 1VBD1 1GMMA 1VRH2 2R071 4ITCA 3TNPB 2E7TA 3FN9A 4Y26A 3CMGA 1VBE2 2A3WA 2OIIA 5BNNC 1DQ2A 2R061 3RJ2X 4BQ4A 4Q0SA 1CAVB 2VOXA 3TN93 4RS5A 3AKRA 4IUGA 4MGQA 3ZN6B 4XCAA 1W3XA 1H0BA 1BMV2 3CLPA 4AAPA 1LHNA 5F3GA 1WCQA 2WDBA 3BN6A 3EBRA 3NNFA 2Y0IA 3VKNA 3EJKA 1JZ4A 4QX1A 2JG9C 3UGHA 4KL1A 4YVSC 2EAAA 5BNNA 3MLJA 3NV1A 3VZOA 4NUBA 1C4RA 1RUJ3 1PO13 2RS32 1CPMA 1EPWA 4HN1A 2WYFA 4JX0A 3KM5A 5M0TA 3CQOA 4AE2A 4BH9A 1NE4A 1QJZA 4CEYB 3FLRA 3C2UA 5DZEA 5FZ6A 1UX6A 1SQ4A 4YW5A 3B02A 4FFGA 4PIXA 2JG9A 5GZFA 1RUH2 1LU1A 2VG9A 4IEZA 4YVSA 3K3NA 1W6MB 1XE8A 2C6SA 2RM22 5EP9A 5CAZA 1CESA 1IZ3A 2Y64A 3E97A 4CCLA 4FOQA 3H3LA 2R063 2FDKA 1VPHA 4ZU7A 3VBFC 3GHNA 1E5HA 1YLLA 2BGOA 2HWE3 3JZVA 4D6RA 1N1TA 2VQTA 5AC93 1RUF1 2VZ3A 4D7YA 2PN5A 1X82A 1UZ0A 4W6YA 5E88A 2XVKA 2XGXA 3LZZA 5TSWA 3VBHB 3TEWA 1WCKA 2XJSA 4AQ2A 2IZWA 1H1MA 2DVFA 4META 3FUOA 4UW4A 3VBFA 5JPMB 4OHZA 1BVP1 2OZJA 1S55A 3JB4C 4ARYA 4NAMA 4NPMA 3MICA 4FOYA 2ZXQA 2XONA 3KLSA 3ZKUA 3BTAA 2HWF2 4LXLA 1AYN2 4KWKA 1JYXA 2WO2A 2JE8A 3OY8A 1GICA 2VUDA 2WLPA 3AX4A 4HPKB 4QX7A 5EYXA 4CU9A 1FMD3 3HVDA 3M3QA 1O3TA 4OI2A 1FNZA 4EWDA 2WNVB 4NR1A 1EP0A 4NE9A 2JDAA 2ZA9A 4RD7A 2ZEYA 4COWA 1IKPA 2QQJA 2QQOA 2A6VA 2BNNA 4UWDA 2Z69A 1UWWA 2Y38A 5FP9A 5A7OA 5FP4A 3T4HB 2TEPA 1B35C 3C8XA 2WFF1 3HQUA 1XBFA 4CDUA 3OGSA 5FIXA 4ZXKA 1QQP3 3LA7A 3AKTA 3ZOIA 1U0AA 3QOPA 4CP9A 2CDOA 4QGNA 4JGYB 4XQ4A 2ZOEB 4ISQA 3BTYA 1RL3A 2D93A 1OKOA 3I2OA 1XU2A 3WW2A 1NCRB 1B35A 5IVBA 4AR2A 2WZEA 5H9SA 1JOBA 3U11A 1NY72 4A3XA 2XVLA 4GB31 3ZYHA 1SLTA 1BK0A 1XSRA 1JOPA 3NO8A 4O9EA 5A6ZA 1SMVA 3TEXA 4IEOA 4OLLA 1RJ8A 4Q5OA 2DURA 5J3UA 1ZZ8A 2UYAA 4BISA 1CWPA 1WD3A 2YDEA 5FPLA 5CFCC 1RMU2 5EZWA 1CPNA 2ET7A 2JDMA 3I54A 5A3LA 2VAUA 1CZSA 2QDNA 1QJX2 3VDDB 1DLLA 5DPNA 4O9GA 4LBOA 1HRI2 3WG1A 4LBLA 1YFYA 4QPGB 1PMHX 3ZMNA 2YV8A 1QKQA 3T0BA 5A32A 1XNKA 2J1RA 4Q0VA 2YB7A 3I3DA 3VBOB 5CFCA 1ZRCA 3ZYFA 2D40A 1GBGA 5FZKA 5E8AA 2NYYA 5F37A 3RZJA 4IE6A 1N3PA 4CDWB 5FWJA 4PT6A 4QDSA 1GOHA 1R093 1YJKA 2ID4A 2QDRA 2E63A 1O6UA 4M0NA 4D6QA 1CQ9A 3HQRA 5FZOB 5LB6A 2VZTA 4UFKA 5FZIA 4AVBA 1F8VA 1I1EA 4MXWA 4A44A 4FFIA 2QJVA 4OUMA 4DUWA 2WNUC 1SHWB 4Q4X1 5CZKA 1CD3G 2OQ7A 3BODA 1NX9A 2R32A 5FTTC 1WUVA 5C33A 3LSDA 3WCSA 1AL22 5LATA 4DNYA 1K5MC 5HV4A 5CB7A 2YFUA 4R4ZA 3VD3A 5FY9A 1W9FA 5JAXA 2PHXA 1CGPA 2C24A 4ISRA 5IATA 2NMNA 2VTXJ 4QXCA 4JGZA 4YW3A 3TNQA 3GXUA 1JW6A 2V09A 2WNUA 4M4RA 3AP7A 1ENRA 2BEOA 3VBRB 1RUI2 1K5MA 5A6YA 1ZZ6A 1YWKA 2OW4A 1SCRA 5D2AA 1FOD3 2HWD2 3ZDSA 1T6GC 3I59A 4KWJA 3ZPYA 1C8M2 2VUAA 4Q4W1 1ENXA 2V5DA 4CTEA 5C8CB 2JDZA 1R1A2 4N53C 1SBDA 4Q4X3 3DN7A 4YW7A 1O3RA 3VD9A 3C7EA 1YC61 3IMMA 2UYBA 4B3NA 2ARCA 4QKFA 2WZPP 4Y5TA 1VBA2 1QJU1 2XQXA 3Q8EA 5CKQA 1SDWA 4IQPA 4AEDA 2RE9A 1WA6X 3LOBA 2B9UA 2E9QA 1W6PA 2H6BA 1POV3 2YHJA 4N53A 4AW7A 2XXZA 3HN3A 1S2BA 5LRSA 2NLRA 4ZY9A 1LAJA 2ZJCA 4QQHA 1H30A 1AF9A 2G1MA 1H2KA 4HLTA 1PK6C 1RJ7A 3KCYA 2JDYA 3KQ4B 4PDWC 4QD2A 1R081 3RYRA 3U07A 3ZR6A 2OA2A 5LY1A 1V9U3 2DVGA 2F6BA 1AR81 1LHUA 4XUOA 4YGDA 3RVHA 3ELNA 3D5OA 1O3SA 3POWA 4YSFA 5ACA2 1UYZA 2W08A 4CP0A 2XJUA 2TBVA 4YW1A 2G4IA 3E5UA 3OCPA 1O4YA 3MO4A 1ENSA 2BVVA 5D8AC 4PDWA 1G8WA 4GD4A 4IEPA 4OULA 2Y26A 2PTMA 3HNMA 2R30A 2KA3A 4FFFA 3R4UA 4LITA 5FYZA 4G9SB 1YFWA 1VJ2A 2I45A 1TMF3 2VUCA 3AL5A 3KHCA 1IQAA 3JD72 3ZXFA 3NL1A 5L7OB 2RS11 4NIGA 4YRDA 2AREA 3U1XA 3DL3A 1JN2P 5D8AA 3M3OA 1QIQA 1TE1B 1RUG3 1FYUA 1ZZBA 2RMU3 2VW2A 5F2SA 2Q8EA 4D7TA 2WABA 2A5ZA 3OYWB 4R4XA 3VDAA 4KH9A 1FX5A 4ZU4A 1MACA 2WT1A 4Y1UA 5GLTA 4LOSA 3KGLA 2X05A 3VHNA 1ULEA 1W2OA 1OBNA 4K8FA 3U78A 2D6NA 3FHQA 3O1TA 1QF3A 4CCEA 1I9RA 4YFWA 3WDXA 4XOGA 2C26A 2EVXA 4DXRA 2ZX0A 5FR3A 3RSJA 4AHWA 4BCUA 3MGUA 1PGW1 2EAKA 1GANA 3HOBA 4BB3A 3VL9A 5FPVA 2QFEA 4S2HA 1GWMA 3ILRA 4N43C 2W2IA 4PLOA 4UAPA 4CU8A 4Q0UA 4LE3A 5FPUA 4AL9A 1PO22 1DF0A 2FMYA 2RS13 4DUVA 1DP0A 2H0BA 4HFSA 1F2NA 1AR72 1MZ6A 4Q26A 4DEQA 1JU3A 5K9YA 4Z07A 2XBO3 2Y6JA 5CADA 2MEV2 1F35A 2ZEZA 1CAWA 1VIWB 2VD7A 4W50A 1VBE1 1ZBE1 3CJIB 3ENRA 4N43A 4FTBA 1XQNA 1W9SA 3P6BA 5I0UA 4RR3C 3AZZA 1X8EA 4YNIA 5KXCA 1GU3A 2B4KA 2R1BA 1GKBA 1BMV1 2PHRA 4NRQA 3HAGA 2UY9A 2R043 4LKSA 1ND2C 1W05A 5BXXA 2DFCA 4BK4A 4QX0A 3GCXA 2RS31 4RR3A 4A3ZA 2DVDA 2VZSA 3HD8B 4RGAA 1E5IA 1UOJA 1H8TB 4FPCA 3SNMA 3ACIA 1W8ZA 3OUIA 1U5IA 1UPIA 2O8QA 2A7AA 3WP5A 2GU9A 3SXWA 1ND2A 3CBNA 2ZGOA 2BFUL 3WG2A 1RUH1 3PIJA 4Y1VA 5T5LA 1STMA 2JKXA 2WA3A 1VRH3 2RM21 4MG2A 5ABJA 4M4PA 2VZOA 4CCDA 4J6GA 5H9RA 3BIEA 3ZIXA 4FFHA 3AKPA 2VU9A 2ZX1A 3OG2A 4PLMA 2BV4A 1YYNA 3SITA 3I2IA 2H6CA 4RS5B 5J7MA 1NQJA 2D6KA 2NQYA 3FL7A 4IEYA 5FUNA 3W5MA 1NKGA 3H1MA 1VP6A 2WS92 4LK7A 4UFHA 3GZUC 2BWCA 2A75A 4MZUA 3EMRA 2LALA 1WW7A 5BNNB 2RS33 5EHDA 1GFF2 2VMIA 3TN92 4AAXA 4I0WB 3ZVXA 5CIRA 5KHHA 1MS5A 4LBQB 4BK5A 4CEYC 4PQQA 1GNZA 4NIIA 2YPDA 3ZDVA 4B7EA 5DAPA 2JG9B 4ET7A 2XJVA 1AYN1 2CV6A 4QHBA 1XJAA 4YVSB 4HT1T 1UIKA 1TME2 4HL0A 2IXJA 1PO12 1G9DA 1TQ5A 2D3PA 3NV3A 1HB4A 4AVCA 2QZ3A 4CEYA 5FFOC 5FMBA 5IFTA 1UY3A 5BPXA 4ORFA 2X8KA 1Q56A 1S0DA 2HEVF 3BGAA 4KU8A 4XJ9A 3WQBA 2DWRA 3LEGA 3MW4A 4J25A 4I01A 1JS9A 1WMEA 3VBHC 2JXAA 1QH6A 1E5RA 1ZRRA 3VBFB 3WF0A 4ARXA 4OUEA 2GC0A 4LO7A 3RWKX 4C90A 3WUDA 1LCLA 4COZA 2HWE2 2K46A 4YM2A 4BQ1A 1NY71 5AC92 1ZVFA 1RITA 2VCAA 3I7DA 1S0BA 3M3EA 3N9MA 2HWF3 5A7SA 4ES9A 4HKOA 4NIHA 4YGCA 5IVEA 1LHVA 3OY8B 3PLQA 3THDA 4I2OA 2OXBA 2ETEA 3H7JA 4AFAA 5FMCA 2WNVC 1OA4A 3FE5A 5HXVA 4ZU5A 2DCYA 3IAPA 1QJX1 2J1TA 2JWPA 2WO1A 2DTYA 1DQ5A 2J42A 3BOPA 5K4LA 4E4HA 4KNCA 2W94A 2C0ZA 3BCWA 1HRI1 2XKOA 4CDUB 3MIDA 3PUHA 4CP2A 2VW0A 1KEXA 2Y33A 1IS6A 2ZHNA 4CP9B 1FMD2 1K3IA 2D6LX 3EO6A 4P9JA 4XUPA 1UN1A 1AVBA 1DGWX 3MW3A 4MGIE 2W3JA 4YGEA 3SLIA 3VD4A 4UI9L 4YW4A 4EV0A 5A3UA 3BI3A 1POQA 3E6CC 1NCRC 1B35B 4FXKB 4N7IA 2BOJA 3KHBA 2XH6A 4E2QA 3AVRA 2BU9A 1Q8VA 4BWOA 3KF3A 1QQP2 5DAXA 1NXD1 5DQ0A 4K9SA 3I49A 3WNPA 1AR92 3AYDA 3GBGA 2P6CA 2YBSA 5L19A 1H1IA 4ZONA 1X50A 3VHOA 1RMU3 3Q8AA 1AL21 4KGGA 2VQAA 1SLIA 3EQEA 3I97A 3ZFGC 1QJX3 2FCTA 4LNVA 4QXHA 4TLFA 4XVHA 5F5AA 2VNOA 5A1LA 4MGKE 4EN7B 2WIIB 2BBVA 1HRI3 4IE4A 5IJRA 1XNDA 4HBNA 1J58A 2X53S 3P1IA 5A32B 3M4FA 5LWBA 3SISA 1XXNA 2E51A 3NJVA 3VBOC 1JZ7A 5CFCB 1ZRDA 3RWNA 1RUI1 1PNFA 1CVNA 1MS1A 1H8VA 3NW4A 3UKNA 1BXHA 3ZFGA 2WRAA 3WT3A 4YZ1A 4AZZA 2YMZA 1QEXA 1XB9A 5DAWA 1ZA4A 4YW6A 4CDWC 1BYHA 2QTWB 5IUQA 4D94A 3DF0A 3PMEA 3SH5A 1Y9QA 4NRMA 1SEFA 4ZXEA 1CN1A 2FDJA 4P9XA 3H8RA 1ONAA 3ZFFC 2YZ4A 3KS7A 1R1A1 4MXWB 1X8MA 3T4VA 5GZGA 1EV13 5EIYB 1R1ZA 1AL23 2Y0OA 5G04L 2NP0A 1HJGA 1R092 1VBA1 2D97A 1UF2C 3PDQA 1WCDJ 3ZXEA 4QB6A 3M2MA 2XL9A 4P9YA 4RFT0 3ZFFA 2A6XA 3USSA 3FUQA 2BW8A 4JGZB 1F4HA 4KG8A 1QXRA 5E89A 2F4PA 2QNKA 3H3UA 2R0FA 1ZBA2 4BU2A 1RUI3 1NYWA 1QMJA 1LESA 3B7MA 1K5MB 1UY1A 2Z79A 4C1WA 1UAIA 4AG4A 1IOAA 5F2WA 2HLEA 4LLFA 5FKCA 5I0RA 1HB3A 2HWD3 2XLAA 1XNTA 3AZVA 3GHMA 3VV1A 3NJYA 4XFAA 2UY8A 3I59B 1BHGA 1C8M3 4AOCA 1LTEA 2UWBA 2O0OA 5F1RA 1EUUA 5ACA1 4Z92B 1G86A 5FYMA 2CTVA 4UBGA 5EFUA 4EN9B 4FPYA 3ZSEA 4YFZA 2VUJA 3P5BA 3B93A 3HPNA 4I0AA 5K0UB 4DB5A 4KQ7A 3OBZA 1MVQA 1WD4A 1FOD2 1XRUA 4NMIA 3W59A 4DEVA 3VBSA 4AEDB 1UOBA 3JD71 1D0GA 3MFAA 3WQ0A 3CO2A 4OMDA 1LEDA 1W6PB 2WWUA 4N53B 1K45A 3C3VA 4G3YC 3UNPA 2W1WA 3MI8A 5FUPA 5T54A 3VKFC 3GALA 1RUD2 4XABA 1G9CA 3E1F1 3O1SA 4B1LA 2WSVA 2ADEA 2PXJA 2ZX4A 2XHKA 4QPIC 1RUE2 4EZHA 4HONA 4XILA 3I4IA 3WHTA 1WA4A 5ACA3 3U4XA 2W5FA 4AQTA 5JOWA 1AR62 3IM0A 1M06G 2D3RA 3ZYPA 1BVVA 1O5LA 1LODA 4HSLA 3Q8BA 1N1VA 2RV9A 4LBKA 4WVMA 4HG6B 4MSVA 4NRPA 1GOFA 1W9YA 4KU7A 4PDWB 5I8TA 5CG8A 1MR5A 4A41A 3O1PA 2WBKA 1RC6A 1DYKA 2J1AA 4QPIA 2VULA 3ACFA 4BZ4A 4L8QA 1G9BA 1EUTA 1PO21 3RFRA 4M01A 4Q4V2 5FZFA 3UL2A 1S1AA 4K1YA 3NKGA 2KD7A 5LW9A 1JZ3A 3S5AA 5D8AB 5C9AA 1MS3A 1D4VB 1FV3A 4LIUA 2IXCA 2QQMA 4Y1XA 3KCCA 2LM3A 3WOGA 1LGBA 1GR3A 4EJRA 4Y20A 1TMF2 2QBXA 2EALA 1UYPA 2C9KA 4OZOA 4QGLA 5FY8A 3JQXA 1NLSA 5LCWL 1YQ5A 3AK0A 1COV2 1CZTA 3WW4A 4ZZ5A 5J1XA 3VHPA 4DZGA 4BIOA 3CEWA 3BU0A 3N3HA 2BGCA 3D6EA 4P5YA 5JLVA 2BP6A 1UKRA 3WDWA 5GLWA 1PO23 1GSLA 1LOCA 4R9AA 1W6OA 1AR73 4LBQD 3UV9A 3AB0A 3K51A 2MEV3 4GWNA 4SLIA 5LZ6A 3TAYA 4CDXA 1PM7A 1REEA 1QXJA 2E6VA 2HWC3 4GZ9A 5FYVA 4DRVA 5B4NA 1D2QA 2QUOA 3OUHA 1WLDA 3CJIC 1MS0A 1VR3A 2WZ8A 3BTZA 3POEA 3GF6A 3N9OA 2HEWF 1DQ0A 2Q0AA 2PHWA 2WYSA 3RZMA 3GZAA 4YW2A 1AX0A 2JD4A 3AMQA 3HIFA 4Q4Y1 2CDPA 5FKBA 1WLTA 2WS91 1DLCA 5H9PA 5I91A 5FPAA 1RUC2 2RJLA 5FJKA 4IV3C 2VMFA 2E7QA 2O14A 3DCQA 4RR3B 2GP3A 3VD5A 1HB2A 3TN91 4EN8B 2GH8A 3J7HA 1QJY2 1J3PA 3E5XA 5A6XA 3VZKA 4XF9A 5FBJA 1ND2B 4CXYA 2I74A 4IV3A 3T2OA 3T0AA 4DQAA 1HIXA 2FHRA 3B00A 3UETA 1WMXA
chains in the Genus database with same CATH topology
3C7HA 1GOHA 2ID4A 3IB3A 4QDSA 2J22A 2WO3A 4D0QA 2VZTA 4CU6A 3WF4A 4A44A 4DUWA 1SHWB 5CZKA 1NX9A 2VJXA 2VMEA 2YFUA 3WSOA 1UXXX 3VD3A 4OYUA 3IAQA 1UMIA 2W1SA 1W0NA 1W9TA 4CUBA 1US3A 3GXUA 4M4RA 2OKXA 2E32A 4MGSA 3T2QA 3MUY1 2PQSA 1PX4A 2QQNA 2ORXA 4AAXA 5IYYA 2V5DA 3MUZ1 4KMQA 4RYDA 4CUCA 3HJRA 1UX7A 5CYYA 2W9XA 2W95A 1J84A 1W8NA 2C4XA 3I3EA 3OGRA 3VD9A 3C7EA 2BBAA 3CZJA 1OT5A 2VTFA 1H6XA 2XQXA 5B4XA 1GNYA 2L9LA 5C70A 1OD3A 3HN3A 3EB7A 4ZY9A 1NUKA 4A42A 5JMOA 3CKHA 1W99A 3ETPA 3GGLA 4ZZ8A 1O8SA 2VL4A 4XZUG 1JZ8A 4XUOA 3HEIA 3WNOA 2WN3A 1UYZA 3NJXA 3MO4A 2Z4FA 3HNMA 2E31A 1K12A 3I2HA 4JKLA 2VO5A 3I2KA 2DCKA 4TTGA 2Y6HA 1J83A 2BGPA 1L7QA 4QB2A 5LA1A 3NRUA 5EJZB 3HNBM 2VQUA 4JKMA 5FUIA 2WABA 4CUAA 1I5PA 3OEBA 3VDAA 1ULPA 4XUTA 3HNYM 2E26A 1CX1A 2X05A 3WF3A 3C7GA 2YC4A 3A7QA 1JZ5A 3FHQA 2W91A 4Z2AA 2C26A 1TG7A 4DXRA 2EIBA 4RN5A 5JXJA 2VOTA 1SG3A 5IHRA 2E33A 3HOBA 1ULOA 4XUQA 2X09A 1JYNA 4UAPA 4CU8A 1JHJA 2Y8KA 1OF3A 2W46A 1R64A 3I3BA 1O59A 1W9WA 4DUVA 1DP0A 4DEQA 4JKKA 4FI9A 1JU3A 1JYWA 2Y6JA 3GM8A 3MV11 2ZEZA 5JR2A 4W50A 3T2PA 1W9SA 3P6BA 2ZEXA 1GU3A 2B4KA 3JXSA 3LPFA 4DXTA 2VZUA 4LKSA 1OH4A 3OB8A 4LPLA 4BK4A 2VZPA 4QX0A 2VMCA 1YQ2A 4A3ZA 2VZSA 5DN2A 3ACIA 1HN1A 3OBAA 4BDVB 3A23A 2QQIA 5JXHA 2J1UA 1XPWA 2JKXA 3K4ZA 3VDCA 4M4PA 2VZOA 1WKYA 2B9VA 3LE0A 1US2A 3ACHA 3OG2A 4LQRA 3MBWA 5C71A 3I2IA 2W87A 2JD9A 3K46A 3FL7A 4P02B 3W5MA 1NKGA 2YG0A 5LA0A 4E8DA 3I2FA 1CZVA 1JI6A 2VZVA 3THCA 2W47A 5EJ1B 2YFZA 1UXZA 2QQKA 3F2ZA 4CVUA 4QAWA 3LEIA 4BK5A 4PQQA 3AC0A 5LA2A 1TVGA 4ET7A 4P08A 2XHNA 2J7MA 4KI5M 4TXWA 3MV01 1KGYA 2Y6GA 1RYYA 3A21A 5IFTA 1UY3A 3LQCA 5DMYA 3BGAA 2R7EB 3WQBA 1UY0A 1UYXA 3LEGA 4L0PA 4GWJA 2VMDA 2EIEA 1PX3A 3D3AA 3WNLA 5JXGA 3DECA 3GDBA 3WF0A 2VCBA 4OUEA 3CIHA 4ARXA 3T09A 3FHAA 2VCAA 1UMHA 2VCCA 1W8OA 3THDA 3T08A 3T0DA 1O8PA 3IAPA 4DXSA 2BERA 2J1TA 2WO1A 3OEAA 2EIDA 2W94A 4MO3M 4A45A 4OMCA 3PUHA 2W1QA 3OGVA 1KEXA 1UYYA 2VZQA 4A4AA 2X10A 3SEEA 1K3IA 4XUPA 5IFPA 3W5NA 3VD4A 2W3JA 5A1AA 2Y6LA 4UI9L 4XURA 2XOMA 4GWIA 2VM9A 1JZ6A 1XNAA 5DQ0A 3WNPA 2YC2A 1GQPA 2WUHA 3I97A 4XVHA 3SKJE 1T2XA 1JZ2A 5IJRA 1OF4A 3P1IA 3NJVA 1JZ7A 3WNNA 1NAEA 1GUIA 3IIIA 4QPWA 3UESA 2V72A 2ORZA 2HYXA 4ZXEA 2J1VA 4BJ0A 3WF1A 1L7RA 3K75B 4QDQA 5EIYB 5F7UA 5G04L 2RJ2A 2WAAA 2J1EA 2ZEWA 4QB6A 3LEKA 3VD7A 3ACGA 1F4HA 3ECQA 5HXMA 2Y6KA 2VR4A 2VZRA 2W1UA 4CU7A 4JHZA 1UY1A 2LW8A 2BZDA 1H6YA 4AG4A 2HLEA 1XNTA 1GMMA 1JYVA 3FN9A 1BHGA 3CMGA 1UY4A 3K4DA 1EUUA 4IUGA 4MGQA 3HPNA 2QQLA 1IQDC 3BN6A 2WDBA 1WCQA 4KWUA 3WNMA 4P00B 4DEVA 4QX1A 1JZ4A 4DUXA 2W92A 1JU4A 4QDRA 3ZM8A 4OMDA 1K42A 1PMJX 3K4AA 4JX0A 1P8JA 3CDZB 1K45A 3CQOA 5I0DA 3UNPA 2W1WA 3IDAA 4YPJA 4W8JA 4D8MA 3SKVA 4E8CA 3C7OA 2VC9A 3E1F1 5JXIA 3CZUA 3DYMA 3EYPA 2Y64A 1GOGA 2DDUA 2W5FA 3PUIA 3U37A 4W4ZA 1D7PM 2BGOA 2RV9A 4HG6B 4UOJA 1GOFA 2VQTA 3SEPA 4A41A 2VZ3A 2WBKA 1UZ0A 2J1AA 2WAOA 4PF1A 1CIYA 3ACFA 3DYOA 1EUTA 3K77A 2RVAA 2KD7A 3VDBA 4MADA 2WQ8A 3LPGA 4ARYA 3WNKA 1JZ3A 2ZXQA 2QQMA 2XONA 1JYXA 1XC6A 2WO2A 2JE8A 1MPXA 2QBXA 4CU9A 2C9KA 4OZOA 2J1SA 1SDDB 2VZ1A 5JUVA 5LCWL 4LHSA 3ABZA 1CZTA 4QB1A 4ZZ5A 2JDAA 5J1XA 2ZEYA 2QQOA 2QQJA 2WN2A 1UWWA 5G05L 2EICA 3C8XA 2LS6A 4QX3A 4P5YA 3OGSA 3I2GA 2CDOA 5HPOA 4XUNA 4MOAA 2V4VA 4GZ9A 4QX2A 5B4NA 2WZEA 3NQHA 1F4AA 2WZ8A 2WYSA 3A22A 2CDPA 3WF2A 1DLCA 3DYPA 5C7GA 1CZSA 3C7FA 4BXSV 5DPNA 1DYOA 2VMFA 3WEZA 3VD5A 1LNSA 1PMHX 3J7HA 3NNGA 3T0BA 2J1RA 4A6OA 2YB7A 3I3DA 1UY2A 3I2JA 3T2OA 3T0AA 2DCJA 4PT6A 3UETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7H A;  1GOH A;  2ID4 A;  3IB3 A;  4QDS A;  2J22 A;  2WO3 A;  4D0Q A;  2VZT A;  4CU6 A;  3WF4 A;  4A44 A;  4DUW A;  1SHW B;  5CZK A;  1NX9 A;  2VJX A;  2VME A;  2YFU A;  3WSO A;  1UXX X;  3VD3 A;  4OYU A;  3IAQ A;  1UMI A;  2W1S A;  1W0N A;  1W9T A;  4CUB A;  1US3 A;  3GXU A;  4M4R A;  2OKX A;  2E32 A;  4MGS A;  3T2Q A;  3MUY 1;  2PQS A;  1PX4 A;  2QQN A;  2ORX A;  4AAX A;  5IYY A;  2V5D A;  3MUZ 1;  4KMQ A;  4RYD A;  4CUC A;  3HJR A;  1UX7 A;  5CYY A;  2W9X A;  2W95 A;  1J84 A;  1W8N A;  2C4X A;  3I3E A;  3OGR A;  3VD9 A;  3C7E A;  2BBA A;  3CZJ A;  1OT5 A;  2VTF A;  1H6X A;  2XQX A;  5B4X A;  1GNY A;  2L9L A;  5C70 A;  1OD3 A;  3HN3 A;  3EB7 A;  4ZY9 A;  1NUK A;  4A42 A;  5JMO A;  3CKH A;  1W99 A;  3ETP A;  3GGL A;  4ZZ8 A;  1O8S A;  2VL4 A;  4XZU G;  1JZ8 A;  4XUO A;  3HEI A;  3WNO A;  2WN3 A;  1UYZ A;  3NJX A;  3MO4 A;  2Z4F A;  3HNM A;  2E31 A;  1K12 A;  3I2H A;  4JKL A;  2VO5 A;  3I2K A;  2DCK A;  4TTG A;  2Y6H A;  1J83 A;  2BGP A;  1L7Q A;  4QB2 A;  5LA1 A;  3NRU A;  5EJZ B;  3HNB M;  2VQU A;  4JKM A;  5FUI A;  2WAB A;  4CUA A;  1I5P A;  3OEB A;  3VDA A;  1ULP A;  4XUT A;  3HNY M;  2E26 A;  1CX1 A;  2X05 A;  3WF3 A;  3C7G A;  2YC4 A;  3A7Q A;  1JZ5 A;  3FHQ A;  2W91 A;  4Z2A A;  2C26 A;  1TG7 A;  4DXR A;  2EIB A;  4RN5 A;  5JXJ A;  2VOT A;  1SG3 A;  5IHR A;  2E33 A;  3HOB A;  1ULO A;  4XUQ A;  2X09 A;  1JYN A;  4UAP A;  4CU8 A;  1JHJ A;  2Y8K A;  1OF3 A;  2W46 A;  1R64 A;  3I3B A;  1O59 A;  1W9W A;  4DUV A;  1DP0 A;  4DEQ A;  4JKK A;  4FI9 A;  1JU3 A;  1JYW A;  2Y6J A;  3GM8 A;  3MV1 1;  2ZEZ A;  5JR2 A;  4W50 A;  3T2P A;  1W9S A;  3P6B A;  2ZEX A;  1GU3 A;  2B4K A;  3JXS A;  3LPF A;  4DXT A;  2VZU A;  4LKS A;  1OH4 A;  3OB8 A;  4LPL A;  4BK4 A;  2VZP A;  4QX0 A;  2VMC A;  1YQ2 A;  4A3Z A;  2VZS A;  5DN2 A;  3ACI A;  1HN1 A;  3OBA A;  4BDV B;  3A23 A;  2QQI A;  5JXH A;  2J1U A;  1XPW A;  2JKX A;  3K4Z A;  3VDC A;  4M4P A;  2VZO A;  1WKY A;  2B9V A;  3LE0 A;  1US2 A;  3ACH A;  3OG2 A;  4LQR A;  3MBW A;  5C71 A;  3I2I A;  2W87 A;  2JD9 A;  3K46 A;  3FL7 A;  4P02 B;  3W5M A;  1NKG A;  2YG0 A;  5LA0 A;  4E8D A;  3I2F A;  1CZV A;  1JI6 A;  2VZV A;  3THC A;  2W47 A;  5EJ1 B;  2YFZ A;  1UXZ A;  2QQK A;  3F2Z A;  4CVU A;  4QAW A;  3LEI A;  4BK5 A;  4PQQ A;  3AC0 A;  5LA2 A;  1TVG A;  4ET7 A;  4P08 A;  2XHN A;  2J7M A;  4KI5 M;  4TXW A;  3MV0 1;  1KGY A;  2Y6G A;  1RYY A;  3A21 A;  5IFT A;  1UY3 A;  3LQC A;  5DMY A;  3BGA A;  2R7E B;  3WQB A;  1UY0 A;  1UYX A;  3LEG A;  4L0P A;  4GWJ A;  2VMD A;  2EIE A;  1PX3 A;  3D3A A;  3WNL A;  5JXG A;  3DEC A;  3GDB A;  3WF0 A;  2VCB A;  4OUE A;  3CIH A;  4ARX A;  3T09 A;  3FHA A;  2VCA A;  1UMH A;  2VCC A;  1W8O A;  3THD A;  3T08 A;  3T0D A;  1O8P A;  3IAP A;  4DXS A;  2BER A;  2J1T A;  2WO1 A;  3OEA A;  2EID A;  2W94 A;  4MO3 M;  4A45 A;  4OMC A;  3PUH A;  2W1Q A;  3OGV A;  1KEX A;  1UYY A;  2VZQ A;  4A4A A;  2X10 A;  3SEE A;  1K3I A;  4XUP A;  5IFP A;  3W5N A;  3VD4 A;  2W3J A;  5A1A A;  2Y6L A;  4UI9 L;  4XUR A;  2XOM A;  4GWI A;  2VM9 A;  1JZ6 A;  1XNA A;  5DQ0 A;  3WNP A;  2YC2 A;  1GQP A;  2WUH A;  3I97 A;  4XVH A;  3SKJ E;  1T2X A;  1JZ2 A;  5IJR A;  1OF4 A;  3P1I A;  3NJV A;  1JZ7 A;  3WNN A;  1NAE A;  1GUI A;  3III A;  4QPW A;  3UES A;  2V72 A;  2ORZ A;  2HYX A;  4ZXE A;  2J1V A;  4BJ0 A;  3WF1 A;  1L7R A;  3K75 B;  4QDQ A;  5EIY B;  5F7U A;  5G04 L;  2RJ2 A;  2WAA A;  2J1E A;  2ZEW A;  4QB6 A;  3LEK A;  3VD7 A;  3ACG A;  1F4H A;  3ECQ A;  5HXM A;  2Y6K A;  2VR4 A;  2VZR A;  2W1U A;  4CU7 A;  4JHZ A;  1UY1 A;  2LW8 A;  2BZD A;  1H6Y A;  4AG4 A;  2HLE A;  1XNT A;  1GMM A;  1JYV A;  3FN9 A;  1BHG A;  3CMG A;  1UY4 A;  3K4D A;  1EUU A;  4IUG A;  4MGQ A;  3HPN A;  2QQL A;  1IQD C;  3BN6 A;  2WDB A;  1WCQ A;  4KWU A;  3WNM A;  4P00 B;  4DEV A;  4QX1 A;  1JZ4 A;  4DUX A;  2W92 A;  1JU4 A;  4QDR A;  3ZM8 A;  4OMD A;  1K42 A;  1PMJ X;  3K4A A;  4JX0 A;  1P8J A;  3CDZ B;  1K45 A;  3CQO A;  5I0D A;  3UNP A;  2W1W A;  3IDA A;  4YPJ A;  4W8J A;  4D8M A;  3SKV A;  4E8C A;  3C7O A;  2VC9 A;  3E1F 1;  5JXI A;  3CZU A;  3DYM A;  3EYP A;  2Y64 A;  1GOG A;  2DDU A;  2W5F A;  3PUI A;  3U37 A;  4W4Z A;  1D7P M;  2BGO A;  2RV9 A;  4HG6 B;  4UOJ A;  1GOF A;  2VQT A;  3SEP A;  4A41 A;  2VZ3 A;  2WBK A;  1UZ0 A;  2J1A A;  2WAO A;  4PF1 A;  1CIY A;  3ACF A;  3DYO A;  1EUT A;  3K77 A;  2RVA A;  2KD7 A;  3VDB A;  4MAD A;  2WQ8 A;  3LPG A;  4ARY A;  3WNK A;  1JZ3 A;  2ZXQ A;  2QQM A;  2XON A;  1JYX A;  1XC6 A;  2WO2 A;  2JE8 A;  1MPX A;  2QBX A;  4CU9 A;  2C9K A;  4OZO A;  2J1S A;  1SDD B;  2VZ1 A;  5JUV A;  5LCW L;  4LHS A;  3ABZ A;  1CZT A;  4QB1 A;  4ZZ5 A;  2JDA A;  5J1X A;  2ZEY A;  2QQO A;  2QQJ A;  2WN2 A;  1UWW A;  5G05 L;  2EIC A;  3C8X A;  2LS6 A;  4QX3 A;  4P5Y A;  3OGS A;  3I2G A;  2CDO A;  5HPO A;  4XUN A;  4MOA A;  2V4V A;  4GZ9 A;  4QX2 A;  5B4N A;  2WZE A;  3NQH A;  1F4A A;  2WZ8 A;  2WYS A;  3A22 A;  2CDP A;  3WF2 A;  1DLC A;  3DYP A;  5C7G A;  1CZS A;  3C7F A;  4BXS V;  5DPN A;  1DYO A;  2VMF A;  3WEZ A;  3VD5 A;  1LNS A;  1PMH X;  3J7H A;  3NNG A;  3T0B A;  2J1R A;  4A6O A;  2YB7 A;  3I3D A;  1UY2 A;  3I2J A;  3T2O A;  3T0A A;  2DCJ A;  4PT6 A;  3UET A; 
#chains in the Genus database with same CATH topology
 3IB3 A;  4D6S A;  1OUS A;  1RUJ 1;  5ABJ B;  1PO1 1;  2AUY A;  4AGG A;  5A3T A;  2CL2 A;  1O4T A;  1DQ6 A;  3DPR C;  1YI9 A;  1PVC 3;  3TB0 A;  4RS5 C;  3TYJ A;  3QCW A;  2VJX A;  3U10 A;  4QXK A;  5IK4 A;  3TRS B;  4XJU A;  3AJY A;  4S2G A;  2VME A;  3KV5 A;  1LEM A;  2RDR A;  4L11 A;  3WSO A;  5IVC A;  1W2N A;  3HBZ A;  4LHL A;  5FXX A;  4OYU A;  4ZKT B;  2CGP A;  4HKW A;  2W1S A;  1JHN A;  3DPR A;  3BTX A;  4GKX A;  1WMD A;  3RDI A;  5A70 A;  5DXD A;  1GWK A;  2HWE 1;  2E32 A;  2BYV E;  1ZRE A;  3T2T A;  4HVQ A;  4JQT A;  4MGS A;  5AC9 1;  5CA6 A;  5LEK A;  2FCU A;  1V6M A;  2WZR 3;  1XSQ A;  3PUR A;  1FT9 A;  1S0G A;  1X9T A;  1PX4 A;  2ZGL A;  3PVO A;  4Y33 A;  5T5O A;  4B4P A;  1GYK A;  1TME 3;  2NN8 A;  2ORX A;  2QQN A;  1AYM 2;  1H2L A;  1YHF A;  3AP4 A;  4JZR A;  4NAO A;  1W8T A;  5F5Q A;  1HW5 A;  3LDB A;  4OQ9 A;  5IYY A;  1UX7 A;  2EXI A;  2EF6 A;  2W9X A;  3AZW A;  4LBQ A;  2W95 A;  3HMY A;  4KGQ A;  3UJQ A;  4CP1 A;  1J84 A;  3AP5 A;  3SHR A;  2N7G A;  2C4X A;  3OGR A;  4DS0 A;  5T52 A;  5F5C A;  2JEN A;  1CON A;  1CAX A;  3AVS A;  4LO4 B;  1OT5 A;  2VNG A;  4IDZ A;  4WZC A;  3RZH A;  2VW1 A;  4V2V A;  2K9Z A;  1FMD 1;  2KR2 A;  2PAK A;  1POV 0;  1SCS A;  1OXC A;  1VLN A;  1T6B X;  2D5F A;  3IIA A;  1HKD A;  1W2U A;  1SAC A;  1TNF A;  4P5H A;  4QHZ A;  4CCN A;  5BYN A;  5JMO A;  3ZXJ A;  2ZGP A;  3CU7 A;  2IXK A;  2RS5 2;  4MH0 E;  5LRR A;  1QGL A;  4FPO B;  3AMM A;  4RGG A;  4E2G A;  1QQP 1;  2TUN A;  1W8F A;  5J48 A;  5C3R A;  1JZ8 A;  1DYP A;  3ITQ A;  1ODN A;  3MFC A;  4YM1 A;  5FO8 B;  5DDJ 2;  1OPO A;  5A80 A;  3I3M A;  1I5Z A;  4IE7 A;  5E1R A;  2Q8O A;  4L2N A;  1DDL A;  4C91 A;  1F31 A;  5FZ7 A;  1E57 A;  3VZJ A;  1LOA A;  2LRP A;  4BLI A;  5I0S A;  2NM1 A;  4LTA A;  5DUV A;  1ZNP A;  5FK8 A;  2GAU A;  1HRV 2;  2OX0 A;  5FZ1 A;  5FYS A;  1K12 A;  3VZL A;  4CDU C;  1C5H A;  1SLL A;  1HQN A;  1KS5 A;  4JKL A;  3LA2 A;  5C3S A;  3N7K A;  5HCA A;  2BGP A;  5JOX A;  1L7Q A;  3BYW A;  2Q8D A;  4ZPI A;  1X9P A;  2WR9 A;  1VRB A;  1JOJ A;  1MZ5 A;  2XPJ A;  3PL0 A;  2D7F A;  4FAG A;  3BPS A;  5EJZ B;  1MS9 A;  4M3C E;  3BUC A;  1YIF A;  3HNY M;  5ERL A;  1A8D A;  1C3H A;  2E26 A;  3LIG A;  1OQE A;  1W04 A;  1AR9 3;  1APN A;  3M8L A;  4QT6 A;  1WLC A;  2YC4 A;  4MV2 A;  4C0H A;  1ASJ 2;  3ON7 A;  4URT A;  5E6H A;  1H9W A;  1DGW A;  5F32 A;  1W6Q A;  4Z2A A;  1R09 1;  1TG7 A;  1VB2 A;  2EIB A;  2VVE A;  4BQX A;  4QU1 A;  1REF A;  4H7L A;  2PFW A;  5FZ9 A;  5IHR A;  3QH7 A;  3NWK A;  5J96 B;  3N36 A;  3UKV A;  1JHJ A;  1ZBA 1;  3AJZ A;  4XFI A;  1JUH A;  4R9B A;  3VL8 A;  3OF1 A;  5EJ3 A;  3J8F 2;  5FMO L;  1V6O A;  3ZFG B;  4XMA A;  4B7K A;  4JCK A;  1WBF A;  4CEW A;  1MZF A;  1SBF A;  4Q1P A;  1O7F A;  3MLK A;  3BPZ A;  3ZYI B;  3FLT A;  5FZ8 A;  1WW6 A;  5IVJ A;  2WL1 A;  2ZEX A;  4URA A;  3JXS A;  2VZU A;  3INA A;  3H8U A;  1FOD 1;  4LOR A;  3SQO A;  1YI7 A;  3LB9 A;  4UW3 A;  4OHX A;  4YZ4 A;  4LO6 B;  2VMC A;  3V65 A;  4B4R A;  2JG8 C;  3JCI A;  1EAH 3;  3ZFF B;  3MEP A;  1BBT 2;  1KS4 A;  4JGZ C;  1VMF A;  2JIJ A;  4LA3 A;  4XXP A;  1ZBA 3;  2XML A;  1NA1 C;  5I8Y A;  5K7P A;  1EV1 2;  2QQI A;  2ZAA A;  1RUD 1;  4DY3 A;  2YU1 A;  3U75 A;  1EY2 A;  1D2S A;  3K4Z A;  1Z78 A;  2JG8 A;  3S6P A;  1OLQ A;  2VEC A;  2W0X A;  1RUE 1;  2K2S A;  2D43 A;  1POV 1;  2YGL A;  1DGL A;  4LQR A;  3DEM A;  3CL1 A;  1NA1 A;  3FFZ A;  3RPQ A;  5C71 A;  2MNG A;  1NXM A;  2W87 A;  4XF0 A;  3TEZ A;  2GC2 A;  2MPF A;  4K6B A;  2JIG A;  4BLJ A;  2VBD A;  1RB8 G;  3H1Y A;  5A33 A;  1LUL A;  1V6L A;  5K0U C;  5HBA A;  4HXC A;  5LA0 A;  3I2F A;  2V5Y A;  2VZV A;  1V9U 1;  3O14 A;  4W6X A;  2W47 A;  3VBS B;  3UGG A;  4JC1 A;  4AED C;  5EJ1 B;  2QQU A;  1CR7 A;  5FZH A;  1IS4 A;  1JBC A;  1Y9M A;  4BOW A;  2YFZ A;  4MUV A;  4CCC A;  3CJX A;  1UXZ A;  2QQK A;  3F2Z A;  4QAW A;  5K0U A;  4K21 A;  5BV6 A;  4CA9 A;  1RUD 3;  4XMI A;  3FZ3 A;  3POY A;  2OVU A;  4PCR A;  4XJ8 A;  5KHJ A;  4P08 A;  4LE4 A;  3OBT A;  1BLZ A;  1TMF 1;  2J7M A;  2ZTN A;  3DKQ A;  3IDE A;  4IEQ A;  5GZE A;  5KXE A;  1LKN A;  4O65 A;  1NOV A;  1RUE 3;  5F39 A;  3U14 A;  3MV0 1;  5JSR A;  4QM9 A;  1RYY A;  1FAT A;  3NV4 A;  3RQ0 A;  1AR6 3;  4XBN A;  2FDH A;  1RUG 1;  2RMU 1;  5FQ0 A;  2P3I A;  5A1F A;  1QNY A;  2AEN A;  3K3O A;  4WVM B;  1H2N A;  5KHK A;  4M0H A;  2PAM A;  3WR0 A;  4AQ6 A;  2ARB A;  3O1M A;  2WFP A;  5DAQ A;  5FZA A;  4QPI B;  1WMF A;  1UYX A;  4L0P A;  2CHH A;  3ZYJ B;  2SLI A;  4Q4V 3;  5FK7 A;  3B94 A;  2EIE A;  2YC0 A;  3WNL A;  4BQ3 A;  3LWC A;  3DEC A;  2VCB A;  2ARX A;  5C3O A;  1G7Y A;  2NPI A;  4BQ2 A;  3HWJ A;  5JI9 A;  2A1X A;  5C9A B;  4JDN A;  2F17 A;  5FXZ A;  4HSJ A;  4Q0P A;  3ST7 A;  3VKO A;  1J1T A;  4Y20 B;  3T3Y A;  1VBB 3;  4AF9 A;  3O7O A;  1FI2 A;  2ZGT A;  5KHG A;  1KIT A;  2R6Q A;  1COV 3;  4I09 A;  4O61 A;  4BA6 A;  2XBO 1;  4UFI A;  2XLG A;  1L7L A;  3DXT A;  3PTY A;  2XJP A;  4X6R B;  5FYY A;  2DBN A;  4OMC A;  2VOW A;  2ET1 A;  3LA3 A;  1B09 A;  1QOT A;  5D21 A;  1UYY A;  4LJH A;  3SEE A;  2IC1 A;  3FWE A;  2A71 A;  2R04 1;  4HAN A;  4AI1 A;  3RZK A;  3UGF A;  4CXX A;  1W6O B;  2Y6L A;  5JIU A;  2A6Z A;  1YCI A;  2XQR A;  4CDX B;  4XUR A;  2XOM A;  4GWI A;  2PAE A;  3K48 A;  2ZCW A;  2ZHL A;  1BEV 2;  1WZX A;  3RRD A;  3W9A A;  3OD0 A;  4M3C A;  5K8S A;  5FRE A;  2RR1 2;  2BVB A;  2YC2 A;  3H42 B;  3OPT A;  1HXS 3;  1RUC 3;  3DUI A;  2K0G A;  1VRH 1;  1XNC A;  3UK9 A;  3A0N A;  3KCX A;  2HWC 2;  3LD8 A;  4L99 A;  3TOJ A;  1TEI A;  1J59 A;  4LHK A;  1OLM E;  1VE0 A;  3P3N A;  1A78 A;  1YO8 A;  4Q27 A;  3OGJ A;  1OF4 A;  3HT1 A;  4LBJ A;  1W8W A;  1QJY 3;  1UD1 A;  1QOO A;  4ZHN A;  4UYB A;  4NHX A;  3WNN A;  4ASM B;  1UNB A;  4HMZ A;  3CF6 E;  4AK3 A;  4U2A A;  1NAE A;  4BE3 A;  2I07 B;  3III A;  4IV3 B;  4CCO A;  1YQ6 A;  2GN3 A;  4QPW A;  1Y3T A;  5AFE A;  4XF4 A;  1GWL A;  3MIH A;  2ORZ A;  1S2K A;  2G9Z A;  1MVE A;  4XJW A;  3ZN4 A;  5T5J A;  5ABJ C;  1NCQ A;  3FC0 A;  2XUE A;  1ENQ A;  2ADD A;  1RVF 2;  1W90 A;  3TBD A;  1IG0 A;  2B46 X;  2FDG A;  2J1V A;  4BJ0 A;  1FPN 3;  1CJP A;  3KVB A;  2CWS A;  2CYF A;  2ZGM A;  5GLZ A;  4LUM A;  5APA A;  2ARA A;  3K2O A;  3K75 B;  1NZI A;  4COY A;  5BUV A;  4PF5 A;  5IT6 A;  4H7M A;  1Z7S 2;  4BHP A;  4A6S A;  5FWE A;  2PMW B;  3NKT A;  3N7L A;  5L73 A;  4E27 A;  4RHV 2;  3DPR B;  4NVP A;  3ZXA C;  1PVC 2;  5HXM A;  4RQP C;  4XYX A;  2VR4 A;  2VZR A;  2GNM A;  2W1U A;  4CU7 A;  2DYC A;  3H9A A;  4P14 A;  1H6Y A;  1S0J A;  3VUO A;  1YFX A;  3N35 A;  4X8N A;  4QHO A;  2WC2 A;  4ATF A;  3IT8 A;  3B01 A;  1JYV A;  4YM3 A;  1AYM 3;  2VBB A;  2JDK A;  3S7E A;  2UU8 A;  1UY4 A;  3ASI A;  4RQP A;  5C5T A;  5GM0 A;  4JRL A;  3G6J B;  5I93 A;  1BKZ A;  1S0E A;  2HWF 1;  2QQL A;  3AFG A;  4KWU A;  1CAX B;  2WZR 2;  3AXD A;  4AVV A;  2GN7 A;  3NVC A;  4P00 B;  4XHX A;  5FAX A;  3DV8 A;  5E16 A;  4DUX A;  4JRA A;  5IAX A;  4XDQ A;  1HJF A;  1JU4 A;  3ZM8 A;  5C3Q A;  2VVD A;  5FZ0 A;  5GZD A;  2HBT A;  3K4A A;  4GJZ A;  2NMO A;  1OKQ A;  1OSG A;  4XIK A;  5EWS A;  5H9Q A;  1PNG A;  1P8J A;  2B39 A;  3CDZ B;  3IZO A;  4P9G A;  3SMH A;  3WP6 A;  5I0D A;  4E2S A;  4YPJ A;  4HOO A;  4YWA A;  4D8M A;  4E8C A;  5IK5 A;  2RS5 3;  2E7A A;  3C7O A;  5FZG A;  2Q1F A;  4C8D A;  5HCF A;  4F7Z A;  1DU3 D;  4FVV A;  3S5Q A;  5JXI A;  4MHU A;  5DDJ 3;  1G9A A;  3EYP A;  1O3Q A;  4H3W A;  4HN0 A;  1ASJ 1;  1N3O A;  4NIA A;  1D4M 2;  2WJS A;  3R4D B;  4EE2 A;  5J37 A;  2DDU A;  3PUI A;  3O0W A;  4OZX A;  2ZX3 A;  5J98 B;  3U37 A;  4W4Z A;  5JSO A;  4E4D X;  1D7P M;  1QY4 A;  1HRV 3;  3WDY A;  5KWR A;  2PHF A;  4UOJ A;  3T1L A;  1L3J A;  3SEP A;  2IVJ A;  1CIY A;  1W39 A;  3DYO A;  3POJ A;  1OPM A;  3K77 A;  1RMU 1;  3ZFE C;  5HV0 A;  4E4S A;  3V0B A;  1VBD 2;  2H0V A;  2RVA A;  1XE0 A;  5L9R A;  4D7S A;  1SLA A;  1XNB A;  2WQ8 A;  5FOB B;  4LR4 A;  2AGS A;  1RTV A;  1GP4 A;  4WM7 A;  5FYC A;  5IWF A;  2P5B A;  3LDR A;  5LBE A;  2IXL A;  3V0A A;  2XJQ A;  3ZFE A;  1XC6 A;  1QHD A;  2DBI A;  4IGP A;  4UFM A;  3WVJ A;  2J1S A;  1N1Y A;  1ASJ 3;  1SDD B;  2PLV 3;  3ILF A;  5JUV A;  1LOF C;  4XQD A;  1W6Q B;  4AHX A;  4BME A;  1ZYB A;  3ABZ A;  2QVS B;  4XCB A;  3LIH A;  3ALQ A;  4NHL A;  5G05 L;  3AMP A;  3L2Y A;  1UMZ A;  2Z5W A;  5FBZ A;  2WNE A;  4QX3 A;  3I2G A;  3RZG A;  2Q30 A;  5A7Q A;  4U36 A;  5FP8 A;  2D98 A;  1EV1 1;  4XTM A;  1LOF A;  3J8F 3;  1PZ7 A;  3WDU A;  1G9F A;  2BQP A;  1NT0 A;  5F6K A;  4XC9 A;  2WA4 A;  2HWB 3;  3MYX A;  4CEW B;  2V4V A;  3ZSM A;  3NQH A;  5IVF A;  1F4A A;  2RG4 A;  4YYO A;  5C4W A;  1RUF 2;  5JVV A;  1SPP A;  3PVE A;  4XDP A;  4A7Z A;  5CEH A;  2R0H A;  2FD8 A;  4XFC A;  2B8M A;  3IKW A;  1MEC 3;  2YGM A;  2ZGS A;  4OQ8 A;  1HB1 A;  5GKA C;  3WF2 A;  5CKN A;  5CU1 A;  4AFD A;  2HWD 1;  4CYD A;  4NOT A;  5C7G A;  3VKM A;  1C8M 1;  3C7F A;  1O91 A;  2G9F A;  1QXP A;  1UL9 A;  1DYO A;  4X6Q B;  3MLL A;  3WEZ A;  5DUX A;  1BBT 3;  3N9P A;  2A3X A;  1SFY A;  4G4F A;  3ZKY A;  4HZF A;  4A6O A;  4XTP A;  1OLM A;  5EXO A;  2FZ1 A;  3H7Y A;  1V0A A;  4D3W A;  1YFU A;  1PGL 2;  1UU5 A;  4DFS A;  2DVB A;  3ACL A;  2DCJ A;  2BUK A;  2JG8 B;  1SLB A;  4A7Y A;  1W06 A;  2EXH A;  4AVA A;  1EAH 2;  2XL7 A;  1C5I A;  2P3Y A;  2WO3 A;  2PHL A;  3HT2 A;  3Q9O A;  1V00 A;  4D0Q A;  4EN0 A;  4YZ5 A;  4OHV A;  4CU6 A;  1KFU L;  4P9I A;  4QQP A;  1NA1 B;  3WF4 A;  2WFF 2;  4DMI A;  1I6X A;  1TZO A;  1UPS A;  3IMN A;  3OBR A;  5CG9 A;  3LEM A;  4UXA A;  4BQY A;  5A33 B;  3MDP A;  3ZN5 A;  2QQW A;  3MIG A;  4I30 A;  3OUJ A;  1UZZ A;  2JE9 A;  5AVP A;  4XDO A;  3VBS C;  5CFD C;  3POS A;  1UMI A;  4PLN A;  1WW5 A;  1M4W A;  1US3 A;  3M1H A;  2PHU A;  5FCC A;  1YQ8 A;  4H2A A;  5T50 A;  1OVP A;  3VKL A;  3T2Q A;  2GSY A;  3ILN A;  2VMG A;  5DUU A;  3QH6 A;  1S2E A;  1LJ7 A;  5A7W A;  5LBB A;  3UT0 A;  4BPZ A;  5CFD A;  1A34 A;  3PJY A;  2PQS A;  2BFU S;  3PIG A;  2B42 B;  4XAC A;  3VLB B;  3GYD A;  3E6D A;  2XWJ B;  2W52 A;  1W6N A;  1OI6 A;  4RYD A;  4CUC A;  2DF7 A;  5SV8 A;  3PUS A;  2OPK A;  3AMH A;  5FQ0 B;  4GH4 A;  1W8N A;  2X5I C;  3I3E A;  5FOJ B;  1WBL A;  2AEZ A;  3U4S A;  3CZJ A;  4OFG A;  4R52 A;  1GV9 A;  4AI3 A;  1H6X A;  1PVX A;  1V6K A;  1VAL A;  2DU1 A;  5C70 A;  2BRT A;  1OQD A;  5JWP A;  2AZ5 A;  3J7L A;  3GNE A;  4N9I A;  1ZM1 A;  4RA0 A;  2X5I A;  4LO5 B;  3EB7 A;  3MIF A;  4XBL A;  1OQ1 A;  3BOW A;  1NUK A;  1V6N A;  4A42 A;  5C9A C;  1NE6 A;  2GP5 A;  3LFM A;  1AL0 G;  1PZ9 A;  3MIB A;  4LKF A;  5BNQ A;  4AI0 A;  3R05 A;  2KXL A;  2VL4 A;  4Y5S A;  1OUR A;  2RR1 1;  2OZ6 A;  5I8S A;  3SCH A;  1AR7 1;  3HEI A;  1HLC A;  4I0B A;  5A3W A;  2Y6F A;  1DCS A;  2ES3 A;  2MEV 1;  2WQZ C;  3BU7 A;  4GAZ A;  4NHK A;  3WNO A;  2HWC 1;  1BCX A;  2BJS A;  1DGR A;  2IFW A;  3MHZ A;  5A6Q A;  3UJO A;  3NJX A;  3H8X A;  4GJY A;  4FP2 A;  2JDP A;  1OUX A;  1WCS A;  1SFP A;  4V1P A;  3I2H A;  3B69 A;  1VBB 2;  2ATF A;  2VO5 A;  5FLJ A;  4OI4 A;  2DCK A;  5KC5 A;  2GNB A;  2Y6H A;  2FZ2 A;  1J83 A;  2VOK A;  4IGQ A;  3WHU A;  3B3Q E;  4QMA A;  2AH2 A;  3HNB M;  2VQU A;  1PIV 3;  4CDX C;  4JKM A;  5IVV A;  4IE0 A;  1ZX5 A;  3OEB A;  5I0T A;  3J26 N;  4CUA A;  3T1M A;  1OOP C;  4XUT A;  1NZC A;  1CX1 A;  1BEV 3;  3WXP A;  4WVV A;  3WF3 A;  2EA7 A;  3C7G A;  4IND A;  3BKZ A;  2RDN A;  2RR1 3;  3A7Q A;  4IW3 A;  4M3C B;  4TYS A;  1JZ5 A;  2ZBJ A;  3TEY A;  1IPS A;  3ME2 A;  3S57 A;  1JYT A;  2W91 A;  1Z7S 1;  2ZZJ A;  5FO9 B;  3UYJ A;  1RXF A;  3ZXK A;  3VBU A;  4E9K A;  1G6N A;  4JVA A;  1OOP A;  1SG3 A;  4XFB A;  1O4Z A;  1MS8 A;  5JXJ A;  4N7U A;  4XAA A;  1QOS A;  1QU0 A;  1SLC A;  2ZGN A;  4K8R B;  4AQS A;  2OYZ A;  1A3K A;  1ULO A;  4XUQ A;  1PVC 1;  1JYN A;  1UU6 A;  2ZHM A;  3O0X A;  3KVA A;  1OF3 A;  3SCF A;  2W46 A;  2DUO A;  5A7N A;  5BNO B;  1R08 2;  3MW2 A;  3M3C A;  1DIW A;  5FP7 A;  4QKD A;  1HXS 2;  1O59 A;  1AJO A;  4GIQ A;  1AR8 2;  3QAC A;  3AXE A;  4IE5 A;  3PU3 A;  4XJA A;  3MV1 1;  4PI2 A;  4LMF A;  1IPK A;  5JR2 A;  3O1O A;  1WW4 A;  1VBC 3;  5EV7 A;  2JDN A;  1NCQ B;  1RVF 3;  3P3P A;  4YVW A;  1DZT A;  2VOV A;  4F83 A;  4JHT A;  4Z1V A;  1VMJ A;  4UT5 A;  1MS4 A;  2VNV A;  1LOE A;  3MIE A;  4W65 A;  1W3V A;  2WWJ A;  1QJE A;  2DV9 A;  2BWA A;  1Z7S 3;  2WZR 1;  3VZN A;  5FZ4 A;  5IAV A;  2UWA A;  4H55 A;  3OB8 A;  1TME 1;  4LPL A;  5FY5 A;  1C1F A;  1SBE A;  2VZP A;  1ODM A;  4FCA A;  4RHV 3;  4AI8 A;  1YQ2 A;  2EIG A;  5DAB A;  4P9L A;  1Z0H A;  5DN2 A;  4AEM A;  1FPN 2;  4FT8 A;  4IEU A;  1HN1 A;  3OBA A;  4WZF A;  3AMN A;  5A3O A;  2GMM A;  1JMU B;  1YEW A;  2ZMN A;  3POI A;  5JXH A;  3WDV A;  4QM8 A;  1KD7 A;  2XJT A;  1YQC A;  1Y9G A;  2XKP A;  1XPW A;  4N9H A;  3S0M A;  4AGR A;  3R0R A;  3JBG 3;  1AXK A;  3KMH A;  4NHM A;  2JIC A;  1S0I A;  1D4M 1;  5LBC A;  4ERO A;  2B9V A;  2C1F A;  1US2 A;  3ACH A;  4RQP B;  1H2M A;  2ZGQ A;  3NAP C;  3VN4 A;  5JOZ A;  1GZC A;  3WCR A;  1Q8S A;  2GH2 A;  2P6H A;  5KC6 A;  2YY1 A;  3URF A;  3W20 A;  4P02 B;  4MX3 A;  2YG0 A;  3KT7 A;  1CZV A;  4MVT A;  2D5H A;  4EWE A;  4DXZ A;  1V70 A;  3WNX A;  1A8M A;  4BQ5 A;  1AHS A;  3Q8C A;  3QBQ A;  3NAP A;  2MHF A;  2ZZQ A;  4NID A;  5KBF A;  1ZBE 2;  1DG6 A;  3NST A;  2QQP A;  2ZMK A;  2FCV A;  1QH7 A;  1XE7 A;  3LEI A;  4ASL A;  5LK5 A;  2GZW A;  1UIJ A;  4OCT A;  3D8C A;  2R49 A;  3AC0 A;  3CHX A;  4J1X A;  4Y22 A;  4I02 A;  4HVR A;  4Z8B A;  3OGG A;  3IWZ A;  2ZML A;  3U0Z A;  2ZS6 B;  4I3P A;  1RIN A;  4GMP 3;  4V2W A;  4XIO A;  4TZD A;  4WV8 A;  3TWI A;  2FDI A;  1D4M 3;  1MQT C;  4IXL A;  1W8H A;  2ZX2 A;  4NPL A;  2HJI A;  1OD5 A;  3V56 A;  2VGD A;  3PNA A;  5L9V A;  1IS5 A;  4MYE A;  3ZX7 A;  2EXK A;  3FHI B;  3LQC A;  4FPL A;  5AFB A;  2A3Y A;  2O8O A;  1OH3 A;  1SFN A;  1VB4 A;  3N7M A;  3PUA A;  2OT7 A;  4PBO A;  4RGK A;  1IG3 A;  1S4C A;  1AR9 1;  4D69 A;  3KD4 A;  1UY0 A;  5T5P A;  1MQT A;  2DU0 A;  4DY5 A;  4BIF A;  4BQW A;  5FY1 A;  2VMD A;  1VBD 3;  2R07 3;  3IDB B;  4HET A;  3V0B B;  3D3A A;  3D0S A;  5F3I A;  5JXG A;  2WT2 A;  4IV1 C;  1RIR A;  3CIH A;  3CNA A;  5T3N A;  1RHI 2;  1RXG A;  5F8P A;  3VZM A;  4LKE A;  4KG0 A;  5ANN A;  2ILM A;  3O5S A;  4WM7 B;  3ZSJ A;  1UMH A;  2VCC A;  5C3P A;  2JB4 A;  2YRO A;  1EPZ A;  3AL6 A;  4CE8 A;  3V0A B;  3ZFE B;  4LEJ A;  4HK9 A;  1UZY A;  4OHW A;  1X36 A;  4IV1 A;  5D1I A;  3T0D A;  4MGT A;  4GWM A;  1O8P A;  3LKJ A;  1OA3 A;  4NHY A;  5EQU A;  1N47 A;  5JI7 A;  4COU A;  1IHM A;  4QQO A;  4DXS A;  2LUW A;  2EID A;  4FOW A;  4MO3 M;  2FBE A;  4JDO A;  3EXU A;  3RS6 A;  5CNA A;  5FY4 A;  2DFB A;  2ZAB A;  3OTF A;  2JKB A;  2W1Q A;  3OGV A;  4S2D A;  2WSU A;  1FXZ A;  2ZGU A;  5EPA A;  3VB9 A;  5C8W A;  2PLV 2;  3AZY A;  3WIN E;  5IFP A;  3B9C A;  5L36 A;  1ZZC A;  5IK7 A;  1AZD A;  3W5N A;  4XXA A;  5BNP C;  1PGL 1;  4CRQ A;  3BIW E;  4NPR A;  4CEW C;  1DGR N;  1U5Y A;  3POB A;  2AC1 A;  1EAH 1;  5GZC A;  1JXN A;  1PMI A;  2DCT A;  2VM9 A;  3RMY A;  3KT4 A;  4DPN A;  1UZV A;  1X33 A;  2LRO A;  3WZ1 A;  1OHF A;  1HDK A;  5DG2 A;  1JZ6 A;  1RUF 3;  5C4W B;  1H9P A;  1SPP B;  1N1S A;  2DUQ A;  5KXB A;  5BNP A;  3O1U A;  2VCM A;  2HWB 2;  1CX4 A;  2WUH A;  4LUK A;  3KZ4 C;  2XR4 A;  3R6S A;  3VHR A;  1HV1 A;  3SKJ E;  1GP5 A;  1GP6 A;  1T2X A;  2JE7 A;  2UUR A;  3GBF A;  2CAV A;  3MPP G;  1J3Q A;  5FZM A;  3JB8 A;  4YG3 A;  1WWY A;  5LY2 A;  3ES1 A;  2GAL A;  3ZMO A;  1W2A X;  3SC7 X;  4BXF A;  1DBN A;  1MEC 2;  3GJA A;  1CAU A;  2FQP A;  2VPV A;  1GUI A;  1UU4 A;  3LSE A;  3MPB A;  3Q8F A;  1YJL A;  4B29 A;  1UOF A;  4LLO A;  4FAH A;  3UES A;  2HYX A;  5FLI A;  3E6B A;  1LOG A;  1LGN A;  3QLQ A;  2WFF 3;  4B4Q A;  3AP9 A;  1DZQ A;  3WF1 A;  1Y4W A;  1BQP A;  5SV5 A;  1L7R A;  4QDQ A;  5F7U A;  2XVG A;  5ISL A;  3ZIW A;  2RJ2 A;  5ANQ A;  2CGN A;  2WAA A;  3LDK A;  3USU A;  4CCM A;  2WQ4 A;  3ZYG A;  2J1E A;  2ZEW A;  1Q43 A;  4Y3O A;  4CXW A;  3LEK A;  1AR6 1;  3APB A;  1XYN A;  2RJK A;  3ACG A;  4WVZ A;  4GB3 3;  1UCX A;  3ECQ A;  3WUC A;  4Y4R A;  4LBM A;  4MXV A;  1ND3 C;  3ES4 A;  1URX A;  3H1W A;  4IER A;  3MF6 A;  4XFG A;  4JHZ A;  3L9J T;  2BZD A;  5A7W B;  3RNS A;  2Q1Z B;  5FY7 A;  5CFD B;  4Q4V 1;  3SH4 A;  2XB6 C;  4YZ2 A;  3HBK A;  2WNO A;  2OPW A;  2R16 A;  2WWS A;  4J1W A;  1ULD A;  4GXL A;  3K4D A;  4Z82 A;  1W6N B;  2BOI A;  4LOT A;  4XAE A;  2JDH A;  1ND3 A;  4XF1 A;  4FSJ A;  1DQ4 A;  3WW3 A;  2WKK A;  3WW1 A;  4PJY A;  2JJ6 A;  2P37 A;  4GH4 B;  1KQR A;  3D0J A;  3POG A;  1IQD C;  1WCU A;  4Y4Y A;  2Z2S B;  5FYB A;  4XFF A;  1VBB 1;  3WNM A;  3F95 A;  2Y34 A;  2Y60 A;  5JR7 B;  3QD6 A;  2W92 A;  4QDR A;  1COV 1;  1QDO A;  1K42 A;  3FFQ A;  1PMJ X;  2P17 A;  2P1B A;  3IPV A;  4FP3 A;  2X5I B;  3ZXL A;  2QZ2 A;  3IDA A;  3IN9 A;  4K20 A;  1UQX A;  4W8J A;  3SKV A;  4PIZ A;  4AFB A;  2O1Q A;  3D82 A;  4R8H A;  5CBL A;  4XQW A;  3N4M A;  4UF0 A;  2BTV C;  2DCZ A;  5HCH A;  2VC9 A;  4FPK A;  3ZLI A;  2Q5T A;  3CZU A;  3DYM A;  4H14 A;  1QNW A;  4Q8K A;  1GOG A;  4CUG A;  2OUH A;  3EHK A;  3JQW A;  3KGZ A;  4ONU A;  4XBQ A;  3LCP A;  1DHK B;  4DO0 A;  5C5U A;  1KFX L;  2PQQ A;  1UKG A;  4NRO A;  2LTN A;  2WAO A;  1IKQ A;  3KQR A;  4PF1 A;  4R9C A;  4DRR A;  3RI9 A;  2B7Y A;  3B9I A;  2XG3 A;  5DG1 A;  1N3Q A;  1HXS 1;  3NNL A;  1PM4 A;  1RUC 1;  1GZW A;  5FV3 A;  3A4U A;  4QGM A;  4EYU A;  4Q4W 3;  3VDB A;  4MAD A;  4FPH A;  3LPG A;  2ZKL A;  3WNK A;  4CDQ C;  1ALY A;  2YBK A;  3A0K A;  1Q8O A;  1Q5O A;  1PK6 A;  1QJY 1;  1UZW A;  3N9Q A;  1ZZ7 A;  3BVC A;  4PI0 A;  5F3E A;  2KM2 A;  1MPX A;  1AXY A;  2FMD A;  1ZA7 A;  5FYI A;  1QJU 3;  2VZ1 A;  4QQL A;  4AI2 A;  5JZG C;  4O7X A;  3AM2 A;  4LHS A;  4LIV A;  1KDK A;  2GND A;  4CDQ A;  4COV A;  4QB1 A;  5JSP A;  5LAS A;  2E53 A;  4Z2W A;  3RYP A;  1PIV 2;  1LHW A;  3J7M A;  3PVB B;  1HN0 A;  2WN2 A;  3VBU B;  1OOP B;  1ULG A;  3GCW A;  2EIC A;  4WM8 B;  1GQG A;  4ES8 A;  4EZ4 A;  2LS6 A;  1FPN 1;  3LGR A;  5JZG A;  1R08 3;  4F3J A;  5BNO C;  3ZSK A;  1U5Z A;  4YM0 A;  5HPO A;  2IFR A;  1DZR A;  1AR8 3;  4K3U A;  4UFJ A;  4F8A A;  5EYY A;  4IET A;  5FYU A;  1ZZ9 A;  4XUN A;  3I2D A;  4MOA A;  1GLH A;  3PTR B;  4LBN A;  4QX2 A;  1OLR A;  1NCQ C;  3LOI A;  4YVW B;  3BAL A;  5BNO A;  5JPN B;  3NV2 A;  2ERF A;  4E4Z A;  3D4K A;  3ZXD A;  2GC3 A;  2CNA A;  4FXG B;  3A22 A;  2ZGR A;  4GAL A;  4PQ9 A;  4IEW A;  3WD5 A;  5FZD A;  5BY5 A;  2P34 A;  3DYP A;  4IEX A;  3PUQ A;  1FAY A;  4FBF A;  1ZRF A;  1AYM 1;  4BXS V;  4XZP A;  2BNM A;  2DTW A;  3RMX A;  1W0P A;  1VBC 2;  2X29 A;  2YUE A;  1KJR A;  4HK8 A;  2EXJ A;  3O1R A;  4NWW A;  1U5X A;  4QKN A;  1YXW A;  5JCT A;  3O12 A;  2VMH A;  1S0C A;  1S0F A;  1LNS A;  3NNG A;  5FZC A;  2XLF A;  4AEK A;  1YIP A;  1Q3E A;  4WBB A;  2VE1 A;  1C57 A;  1OC1 A;  3UKT A;  1UY2 A;  3I2J A;  1VAM A;  5FPX A;  5FMO S;  1CJD A;  2Q8C A;  2A6Y A;  3PMS A;  3C7H A;  1WLW A;  3KV9 A;  1LEN A;  2B45 X;  3AKS A;  1IGO A;  3PHM A;  3O1V A;  2J22 A;  4FO9 A;  3X29 B;  1NQD A;  3ETQ A;  3WY6 A;  4AYU A;  4C0B A;  2VBP A;  3ATG A;  4FPF A;  1OA2 A;  2IXH A;  1PGS A;  2RS5 1;  4QX5 A;  5A3P A;  3SCG A;  2OUJ A;  3E5Q A;  1HX6 A;  3I8T A;  5FJH A;  5FPZ A;  4AXO A;  5DDJ 1;  4PBP A;  2JEM A;  3AYC A;  1UXX X;  3JBG 2;  1UOG A;  4LO8 A;  4Q1R A;  3IAQ A;  1F9K A;  4TSV A;  1OFS A;  1YNA A;  4JTN A;  1W0N A;  1UW8 A;  1W9T A;  3NAP B;  4MLO A;  1VBE 3;  1ZBE 3;  2G19 A;  2IUW A;  2IXI A;  1J1L A;  5FLH A;  4CUB A;  1RHI 1;  2OKX A;  5LK7 B;  1HRV 1;  1C1L A;  4B8E A;  3AYE A;  3M7A A;  1ULF A;  2P3K A;  4L9B A;  4Y22 B;  4XHB A;  4AWD A;  3AKQ A;  3MUY 1;  4Q4Y 2;  2GC1 A;  3ZYB A;  4JAA A;  2QKD A;  1XYO A;  2YPJ A;  2IWG B;  3MUZ 1;  2W39 A;  3KV6 A;  1ST8 A;  4KMQ A;  2I2S A;  3HJR A;  3J4U H;  5CYY A;  4FQZ A;  1CAV A;  2BNO A;  5FMD A;  2QQV A;  2YBP A;  3ZN6 A;  1AUY A;  2AAC A;  1W2T A;  2TNF A;  2DVA A;  1W8U A;  5LBF A;  5IK8 A;  3RZL A;  5FXW A;  3WQ7 A;  1RUN A;  2BBA A;  4LK6 A;  2HBU A;  4NN0 A;  4YLZ A;  4XW3 A;  5FZL A;  2VTF A;  3WQ1 A;  1RUH 3;  3RJR A;  1D0H A;  1MQT B;  5B4X A;  4AHY A;  1GNY A;  2L9L A;  2PLV 1;  2RM2 3;  2IVI B;  2SBA A;  4N8M A;  1NLQ A;  1I3H A;  3H3Z A;  1RUJ 2;  1JTZ X;  1PHM A;  5LA9 A;  1OD3 A;  1RHI 3;  2UWC A;  4CZS A;  1X7N A;  5FYH A;  4UW6 A;  5AVA A;  3CKH A;  4WM7 C;  3LFI A;  1W99 A;  3ETP A;  1JOD A;  4CPB D;  3GGL A;  4QPY A;  1ULC A;  1SZB A;  1O8S A;  1W6M A;  3AP6 A;  1GQH A;  3J8F 1;  4JQR A;  4XZU G;  4ZZ8 A;  1JH5 A;  1FNY A;  2R07 2;  4QKB A;  4AFM A;  3ZO0 B;  2HWB 1;  4IV1 B;  4ZS3 A;  1QDC A;  5FP3 A;  2WN3 A;  2CAU A;  2R06 2;  2D44 A;  5F6L B;  2ZGK A;  2YXS A;  4XFH A;  2ENR A;  2Z4F A;  4M00 A;  4XET A;  5FXV A;  2E31 A;  4R9D A;  1IS3 A;  4IGO A;  2GMP A;  1AYN 3;  3I2K A;  3VBH A;  1MEC 1;  2PHT A;  4ATE A;  4TTG A;  4QB2 A;  3WP4 A;  3FBY A;  5LA1 A;  1RED A;  1KDM A;  1W0O A;  2GNT A;  3NRU A;  3WX5 A;  4IES A;  2OS2 A;  5FPB A;  5T55 A;  2DUP A;  4Q8L A;  5FUI A;  1BBT 1;  1I5P A;  1ULP A;  4YZ3 A;  2PA7 A;  3H8O A;  5A7P A;  3H0O A;  5KHI A;  1F5F A;  2VNR A;  3PVN A;  4HPK A;  5C4W C;  1LR5 A;  4LUL A;  5FZE A;  3W21 A;  3WDT A;  4EN6 B;  2VXR A;  3ZPO A;  5BNP B;  4TLG A;  1XU1 A;  2WNV A;  4JGY C;  2VY0 A;  5JMC A;  2HKX A;  2PEL A;  3WP3 A;  1YUD A;  4RN5 A;  2HYK A;  2VH9 A;  3L2H A;  2VOT A;  1JYI A;  2E33 A;  5DZG A;  4X8P A;  4OVE A;  4Y5Z 0;  5HCB A;  4B1M A;  2X09 A;  3WG4 A;  5J36 A;  3N7J A;  4Y1Y A;  2Y8K A;  2C5D A;  2ZPX A;  4AEJ A;  3T30 A;  4AHZ A;  3OJB A;  1R64 A;  1HQL A;  3H50 A;  3I3B A;  4JGY A;  1W9W A;  1CAU B;  2C9A A;  2JDU A;  1VMH A;  2B5H A;  2QCS B;  5A3M A;  5KXD A;  4JKK A;  3DKW A;  4FI9 A;  1PZ8 A;  4LA2 A;  2AR6 A;  4XPV A;  1JYW A;  1H1A A;  2GME A;  3AZX A;  3GM8 A;  1NCR A;  2D6P A;  4FPE A;  2ZAC A;  5JOY A;  3O0V A;  4BYY A;  3KV4 A;  1W28 A;  1KRI A;  4PIY A;  3VDD C;  3T2P A;  3KWV A;  4P9W A;  2JEC A;  4QPG C;  3LPF A;  4KBZ A;  4DXT A;  4YG6 A;  1Y7B A;  5DAV A;  4JDM A;  4K1Z A;  1OMI A;  4K7J A;  1OH4 A;  4GQ7 A;  2YU2 A;  3USU B;  4CPB A;  4Q0Q A;  4CSW A;  5F9T A;  3VDD A;  4QX8 A;  3IBM A;  1A6C A;  4MGZ E;  4MHR A;  1KXG A;  4NO4 A;  3W58 A;  4A7K A;  1C8N A;  4QPG A;  1JYC A;  5C6C A;  4LT5 A;  4BDV B;  3VBO A;  3FJS A;  1GZ9 A;  1MZE A;  3A23 A;  3GBW A;  3J9S A;  4I3G A;  3WV6 A;  2GDF A;  4TWT A;  1XOY A;  2J1U A;  1KJL A;  2W68 A;  4ASK A;  1AX1 A;  4CDW A;  4QWN A;  4IL7 A;  5DZF A;  3WLU A;  3ZYR A;  3VDC A;  1OFN A;  4Q2F A;  5FO7 B;  1WKY A;  5FZO A;  3LE0 A;  4GB3 2;  1QWR A;  3MBW A;  2FDF A;  1H4G A;  1ND3 B;  2CWM A;  3FBM A;  4A2U A;  4XE9 A;  2JD9 A;  3K46 A;  2WNU B;  2AYH A;  3HR9 A;  4GA9 A;  4GH4 C;  4GKY A;  3JUU A;  3RYK A;  3VBR C;  3GZT B;  4E8D A;  4EQV A;  1JI6 A;  3THC A;  4JTO A;  4K40 A;  4L92 A;  4Y1Z A;  3M70 A;  4HVO A;  2WLQ A;  3V64 A;  1EYB A;  3BB6 A;  4QU2 A;  5GLV A;  1Q8Q A;  3GJB A;  4XF3 A;  2WIN B;  3S30 A;  1RUO A;  5F5I A;  4SBV A;  4BM8 A;  4XEZ A;  2CGO A;  3IPV B;  4CVU A;  1GZT A;  3AFK A;  1DQ1 A;  2WT0 A;  1R1A 3;  3VBR A;  5C8C C;  3I3Q A;  4WVW A;  2JX9 A;  1LRH A;  3LAG A;  1AJK A;  1TVG A;  2D6M A;  3M3I A;  5FY0 A;  4GMP 0;  5LA2 A;  3RZZ A;  4UF0 B;  4CCK A;  2XHN A;  4DIN B;  2VVF A;  4KI5 M;  2D6O X;  1VBA 3;  4UW5 A;  5GJ6 A;  4OHY A;  4TXW A;  2AEY A;  1KGY A;  2Y6G A;  4OI0 A;  3B5L B;  5JIA A;  3FX3 A;  3KB5 A;  4AGV A;  1BJQ A;  5GLU A;  1TNR A;  1PIV 1;  3A21 A;  5CVR A;  4AVT A;  5C8C A;  4FTS A;  3OSD A;  3VGI A;  5DMY A;  4Q4X 2;  5IW0 A;  1GNH A;  1WGP A;  2R7E B;  1BEV 1;  1CIW A;  4DIQ A;  2V73 A;  5A3N A;  1NG0 A;  4RSU A;  1W03 A;  2R1D A;  1IPJ A;  5KR7 A;  1C28 A;  3WG3 A;  4GWJ A;  3OPW A;  1NLR A;  5LEJ A;  1LOB A;  1PX3 A;  2P2K A;  5JDB A;  1GZW B;  1F5J A;  1FV2 A;  1LEC A;  3GDB A;  3NNM A;  5FZ3 A;  3MF9 A;  3OPZ A;  1AXZ A;  1HV0 A;  2ZAH A;  2ZHK A;  3NJZ A;  3OD4 A;  2PHD A;  3T09 A;  3DGT A;  4CCJ A;  2RHP A;  3FHA A;  4ZS2 A;  1PK6 B;  1W8O A;  1U12 A;  3SH3 A;  3GZE A;  4FPJ A;  1LHO A;  2HH9 A;  1V9U 2;  3T08 A;  1Q8P A;  3JD7 3;  3N9N A;  4L97 A;  4Q4W 2;  4M3C F;  4CDQ B;  5L7O C;  2VQ0 A;  4UFL A;  2QE3 A;  1LU2 A;  1Y43 B;  2BER A;  2XJR A;  3OEA A;  4BMB A;  5FDB A;  1VBC 1;  5L9B A;  2ZKN A;  3KSC A;  3VBU C;  1RVF 1;  1OVS A;  1JUI A;  4A45 A;  2G9G A;  4WM8 C;  1YRZ A;  3KT1 A;  4YAR A;  3RGB A;  2XUM A;  3ZXG A;  2CSG A;  1QJU 2;  2VZQ A;  4A4A A;  2X10 A;  2RDQ A;  5JZG B;  2BDR A;  5IVY A;  5L7O A;  1V6I A;  2Q4S A;  4LKD A;  2HEY F;  4YG0 A;  5A1A A;  1LGC A;  4XJZ A;  2XDV A;  1VAK A;  4KBB A;  4RHV 1;  5FZB A;  4GUL A;  4AVS A;  3HN1 A;  4WM8 A;  1RUG 2;  2RMU 2;  3OYW A;  1E5S A;  3J7N A;  3FLP A;  2XWB B;  4EWA A;  1QJF A;  4IEV A;  4YVW C;  4AFC A;  4FTE A;  4RL7 A;  1XNA A;  3IDC B;  3PU8 A;  1J3R A;  4YGB A;  2PYT A;  4NWV A;  1GQP A;  4MGY E;  4HKL A;  4TN7 A;  2D3S A;  2JB8 A;  2V4A A;  2RDS A;  3JBG 1;  4QXB A;  3THP A;  2BPA 2;  2F4L A;  3DXU A;  3N9L A;  1JZ2 A;  1CAW B;  3NNJ A;  4QQ2 A;  1BZW A;  1F15 A;  4N43 B;  2CU5 A;  3AYA A;  1K5J A;  3ROU A;  1ACC A;  4C1X A;  3JU9 A;  2OQ6 A;  4FPG A;  2RS1 2;  4PHZ A;  5FRA A;  2CY6 A;  2WO7 A;  4S2F A;  4FQ4 A;  4UBH A;  1RGS A;  4LHN A;  2XBO 2;  5HI0 A;  3FMG A;  1V6J A;  1BK1 A;  2YYO A;  4W6W A;  2V72 A;  5CIS A;  3CJI A;  4KWL A;  4FOV A;  2P4E A;  5GAL A;  3S7I A;  4AI9 A;  1DFQ A;  4NJ4 A;  1H8T C;  4OI1 A;  4N90 A;  4Y24 A;  3R4S A;  4RFR B;  5CKM A;  2R04 2;  1HQW A;  3POF A;  4GMP 1;  1ZRI A;  4Q29 A;  5FYT A;  2NZ9 A;  2Z42 A;  3OOX A;  4OUS A;  3MZH A;  1PGW 2;  1AX2 A;  3G7D A;  1O5U A;  2A6W A;  3HQX A;  3RG0 A;  3VD7 A;  5J09 A;  1H8T A;  3PJQ A;  4JV4 A;  1UO9 A;  3THT A;  3ZSL A;  2Q1M A;  1LB2 A;  2P3J A;  1XYP A;  2VXJ A;  1VAV A;  2Y6K A;  3RI8 A;  3ZR5 A;  2A70 A;  3LF7 A;  2A73 B;  3ORJ A;  3NMB A;  5F3C A;  5DUW A;  2LW8 A;  4DOU A;  4Q4Y 3;  2VTX A;  5B2G B;  2WS9 3;  3KF5 A;  1H4H A;  1VBD 1;  1GMM A;  1VRH 2;  2R07 1;  4ITC A;  3TNP B;  2E7T A;  3FN9 A;  4Y26 A;  3CMG A;  1VBE 2;  2A3W A;  2OII A;  5BNN C;  1DQ2 A;  2R06 1;  3RJ2 X;  4BQ4 A;  4Q0S A;  1CAV B;  2VOX A;  3TN9 3;  4RS5 A;  3AKR A;  4IUG A;  4MGQ A;  3ZN6 B;  4XCA A;  1W3X A;  1H0B A;  1BMV 2;  3CLP A;  4AAP A;  1LHN A;  5F3G A;  1WCQ A;  2WDB A;  3BN6 A;  3EBR A;  3NNF A;  2Y0I A;  3VKN A;  3EJK A;  1JZ4 A;  4QX1 A;  2JG9 C;  3UGH A;  4KL1 A;  4YVS C;  2EAA A;  5BNN A;  3MLJ A;  3NV1 A;  3VZO A;  4NUB A;  1C4R A;  1RUJ 3;  1PO1 3;  2RS3 2;  1CPM A;  1EPW A;  4HN1 A;  2WYF A;  4JX0 A;  3KM5 A;  5M0T A;  3CQO A;  4AE2 A;  4BH9 A;  1NE4 A;  1QJZ A;  4CEY B;  3FLR A;  3C2U A;  5DZE A;  5FZ6 A;  1UX6 A;  1SQ4 A;  4YW5 A;  3B02 A;  4FFG A;  4PIX A;  2JG9 A;  5GZF A;  1RUH 2;  1LU1 A;  2VG9 A;  4IEZ A;  4YVS A;  3K3N A;  1W6M B;  1XE8 A;  2C6S A;  2RM2 2;  5EP9 A;  5CAZ A;  1CES A;  1IZ3 A;  2Y64 A;  3E97 A;  4CCL A;  4FOQ A;  3H3L A;  2R06 3;  2FDK A;  1VPH A;  4ZU7 A;  3VBF C;  3GHN A;  1E5H A;  1YLL A;  2BGO A;  2HWE 3;  3JZV A;  4D6R A;  1N1T A;  2VQT A;  5AC9 3;  1RUF 1;  2VZ3 A;  4D7Y A;  2PN5 A;  1X82 A;  1UZ0 A;  4W6Y A;  5E88 A;  2XVK A;  2XGX A;  3LZZ A;  5TSW A;  3VBH B;  3TEW A;  1WCK A;  2XJS A;  4AQ2 A;  2IZW A;  1H1M A;  2DVF A;  4MET A;  3FUO A;  4UW4 A;  3VBF A;  5JPM B;  4OHZ A;  1BVP 1;  2OZJ A;  1S55 A;  3JB4 C;  4ARY A;  4NAM A;  4NPM A;  3MIC A;  4FOY A;  2ZXQ A;  2XON A;  3KLS A;  3ZKU A;  3BTA A;  2HWF 2;  4LXL A;  1AYN 2;  4KWK A;  1JYX A;  2WO2 A;  2JE8 A;  3OY8 A;  1GIC A;  2VUD A;  2WLP A;  3AX4 A;  4HPK B;  4QX7 A;  5EYX A;  4CU9 A;  1FMD 3;  3HVD A;  3M3Q A;  1O3T A;  4OI2 A;  1FNZ A;  4EWD A;  2WNV B;  4NR1 A;  1EP0 A;  4NE9 A;  2JDA A;  2ZA9 A;  4RD7 A;  2ZEY A;  4COW A;  1IKP A;  2QQJ A;  2QQO A;  2A6V A;  2BNN A;  4UWD A;  2Z69 A;  1UWW A;  2Y38 A;  5FP9 A;  5A7O A;  5FP4 A;  3T4H B;  2TEP A;  1B35 C;  3C8X A;  2WFF 1;  3HQU A;  1XBF A;  4CDU A;  3OGS A;  5FIX A;  4ZXK A;  1QQP 3;  3LA7 A;  3AKT A;  3ZOI A;  1U0A A;  3QOP A;  4CP9 A;  2CDO A;  4QGN A;  4JGY B;  4XQ4 A;  2ZOE B;  4ISQ A;  3BTY A;  1RL3 A;  2D93 A;  1OKO A;  3I2O A;  1XU2 A;  3WW2 A;  1NCR B;  1B35 A;  5IVB A;  4AR2 A;  2WZE A;  5H9S A;  1JOB A;  3U11 A;  1NY7 2;  4A3X A;  2XVL A;  4GB3 1;  3ZYH A;  1SLT A;  1BK0 A;  1XSR A;  1JOP A;  3NO8 A;  4O9E A;  5A6Z A;  1SMV A;  3TEX A;  4IEO A;  4OLL A;  1RJ8 A;  4Q5O A;  2DUR A;  5J3U A;  1ZZ8 A;  2UYA A;  4BIS A;  1CWP A;  1WD3 A;  2YDE A;  5FPL A;  5CFC C;  1RMU 2;  5EZW A;  1CPN A;  2ET7 A;  2JDM A;  3I54 A;  5A3L A;  2VAU A;  1CZS A;  2QDN A;  1QJX 2;  3VDD B;  1DLL A;  5DPN A;  4O9G A;  4LBO A;  1HRI 2;  3WG1 A;  4LBL A;  1YFY A;  4QPG B;  1PMH X;  3ZMN A;  2YV8 A;  1QKQ A;  3T0B A;  5A32 A;  1XNK A;  2J1R A;  4Q0V A;  2YB7 A;  3I3D A;  3VBO B;  5CFC A;  1ZRC A;  3ZYF A;  2D40 A;  1GBG A;  5FZK A;  5E8A A;  2NYY A;  5F37 A;  3RZJ A;  4IE6 A;  1N3P A;  4CDW B;  5FWJ A;  4PT6 A;  4QDS A;  1GOH A;  1R09 3;  1YJK A;  2ID4 A;  2QDR A;  2E63 A;  1O6U A;  4M0N A;  4D6Q A;  1CQ9 A;  3HQR A;  5FZO B;  5LB6 A;  2VZT A;  4UFK A;  5FZI A;  4AVB A;  1F8V A;  1I1E A;  4MXW A;  4A44 A;  4FFI A;  2QJV A;  4OUM A;  4DUW A;  2WNU C;  1SHW B;  4Q4X 1;  5CZK A;  1CD3 G;  2OQ7 A;  3BOD A;  1NX9 A;  2R32 A;  5FTT C;  1WUV A;  5C33 A;  3LSD A;  3WCS A;  1AL2 2;  5LAT A;  4DNY A;  1K5M C;  5HV4 A;  5CB7 A;  2YFU A;  4R4Z A;  3VD3 A;  5FY9 A;  1W9F A;  5JAX A;  2PHX A;  1CGP A;  2C24 A;  4ISR A;  5IAT A;  2NMN A;  2VTX J;  4QXC A;  4JGZ A;  4YW3 A;  3TNQ A;  3GXU A;  1JW6 A;  2V09 A;  2WNU A;  4M4R A;  3AP7 A;  1ENR A;  2BEO A;  3VBR B;  1RUI 2;  1K5M A;  5A6Y A;  1ZZ6 A;  1YWK A;  2OW4 A;  1SCR A;  5D2A A;  1FOD 3;  2HWD 2;  3ZDS A;  1T6G C;  3I59 A;  4KWJ A;  3ZPY A;  1C8M 2;  2VUA A;  4Q4W 1;  1ENX A;  2V5D A;  4CTE A;  5C8C B;  2JDZ A;  1R1A 2;  4N53 C;  1SBD A;  4Q4X 3;  3DN7 A;  4YW7 A;  1O3R A;  3VD9 A;  3C7E A;  1YC6 1;  3IMM A;  2UYB A;  4B3N A;  2ARC A;  4QKF A;  2WZP P;  4Y5T A;  1VBA 2;  1QJU 1;  2XQX A;  3Q8E A;  5CKQ A;  1SDW A;  4IQP A;  4AED A;  2RE9 A;  1WA6 X;  3LOB A;  2B9U A;  2E9Q A;  1W6P A;  2H6B A;  1POV 3;  2YHJ A;  4N53 A;  4AW7 A;  2XXZ A;  3HN3 A;  1S2B A;  5LRS A;  2NLR A;  4ZY9 A;  1LAJ A;  2ZJC A;  4QQH A;  1H30 A;  1AF9 A;  2G1M A;  1H2K A;  4HLT A;  1PK6 C;  1RJ7 A;  3KCY A;  2JDY A;  3KQ4 B;  4PDW C;  4QD2 A;  1R08 1;  3RYR A;  3U07 A;  3ZR6 A;  2OA2 A;  5LY1 A;  1V9U 3;  2DVG A;  2F6B A;  1AR8 1;  1LHU A;  4XUO A;  4YGD A;  3RVH A;  3ELN A;  3D5O A;  1O3S A;  3POW A;  4YSF A;  5ACA 2;  1UYZ A;  2W08 A;  4CP0 A;  2XJU A;  2TBV A;  4YW1 A;  2G4I A;  3E5U A;  3OCP A;  1O4Y A;  3MO4 A;  1ENS A;  2BVV A;  5D8A C;  4PDW A;  1G8W A;  4GD4 A;  4IEP A;  4OUL A;  2Y26 A;  2PTM A;  3HNM A;  2R30 A;  2KA3 A;  4FFF A;  3R4U A;  4LIT A;  5FYZ A;  4G9S B;  1YFW A;  1VJ2 A;  2I45 A;  1TMF 3;  2VUC A;  3AL5 A;  3KHC A;  1IQA A;  3JD7 2;  3ZXF A;  3NL1 A;  5L7O B;  2RS1 1;  4NIG A;  4YRD A;  2ARE A;  3U1X A;  3DL3 A;  1JN2 P;  5D8A A;  3M3O A;  1QIQ A;  1TE1 B;  1RUG 3;  1FYU A;  1ZZB A;  2RMU 3;  2VW2 A;  5F2S A;  2Q8E A;  4D7T A;  2WAB A;  2A5Z A;  3OYW B;  4R4X A;  3VDA A;  4KH9 A;  1FX5 A;  4ZU4 A;  1MAC A;  2WT1 A;  4Y1U A;  5GLT A;  4LOS A;  3KGL A;  2X05 A;  3VHN A;  1ULE A;  1W2O A;  1OBN A;  4K8F A;  3U78 A;  2D6N A;  3FHQ A;  3O1T A;  1QF3 A;  4CCE A;  1I9R A;  4YFW A;  3WDX A;  4XOG A;  2C26 A;  2EVX A;  4DXR A;  2ZX0 A;  5FR3 A;  3RSJ A;  4AHW A;  4BCU A;  3MGU A;  1PGW 1;  2EAK A;  1GAN A;  3HOB A;  4BB3 A;  3VL9 A;  5FPV A;  2QFE A;  4S2H A;  1GWM A;  3ILR A;  4N43 C;  2W2I A;  4PLO A;  4UAP A;  4CU8 A;  4Q0U A;  4LE3 A;  5FPU A;  4AL9 A;  1PO2 2;  1DF0 A;  2FMY A;  2RS1 3;  4DUV A;  1DP0 A;  2H0B A;  4HFS A;  1F2N A;  1AR7 2;  1MZ6 A;  4Q26 A;  4DEQ A;  1JU3 A;  5K9Y A;  4Z07 A;  2XBO 3;  2Y6J A;  5CAD A;  2MEV 2;  1F35 A;  2ZEZ A;  1CAW A;  1VIW B;  2VD7 A;  4W50 A;  1VBE 1;  1ZBE 1;  3CJI B;  3ENR A;  4N43 A;  4FTB A;  1XQN A;  1W9S A;  3P6B A;  5I0U A;  4RR3 C;  3AZZ A;  1X8E A;  4YNI A;  5KXC A;  1GU3 A;  2B4K A;  2R1B A;  1GKB A;  1BMV 1;  2PHR A;  4NRQ A;  3HAG A;  2UY9 A;  2R04 3;  4LKS A;  1ND2 C;  1W05 A;  5BXX A;  2DFC A;  4BK4 A;  4QX0 A;  3GCX A;  2RS3 1;  4RR3 A;  4A3Z A;  2DVD A;  2VZS A;  3HD8 B;  4RGA A;  1E5I A;  1UOJ A;  1H8T B;  4FPC A;  3SNM A;  3ACI A;  1W8Z A;  3OUI A;  1U5I A;  1UPI A;  2O8Q A;  2A7A A;  3WP5 A;  2GU9 A;  3SXW A;  1ND2 A;  3CBN A;  2ZGO A;  2BFU L;  3WG2 A;  1RUH 1;  3PIJ A;  4Y1V A;  5T5L A;  1STM A;  2JKX A;  2WA3 A;  1VRH 3;  2RM2 1;  4MG2 A;  5ABJ A;  4M4P A;  2VZO A;  4CCD A;  4J6G A;  5H9R A;  3BIE A;  3ZIX A;  4FFH A;  3AKP A;  2VU9 A;  2ZX1 A;  3OG2 A;  4PLM A;  2BV4 A;  1YYN A;  3SIT A;  3I2I A;  2H6C A;  4RS5 B;  5J7M A;  1NQJ A;  2D6K A;  2NQY A;  3FL7 A;  4IEY A;  5FUN A;  3W5M A;  1NKG A;  3H1M A;  1VP6 A;  2WS9 2;  4LK7 A;  4UFH A;  3GZU C;  2BWC A;  2A75 A;  4MZU A;  3EMR A;  2LAL A;  1WW7 A;  5BNN B;  2RS3 3;  5EHD A;  1GFF 2;  2VMI A;  3TN9 2;  4AAX A;  4I0W B;  3ZVX A;  5CIR A;  5KHH A;  1MS5 A;  4LBQ B;  4BK5 A;  4CEY C;  4PQQ A;  1GNZ A;  4NII A;  2YPD A;  3ZDV A;  4B7E A;  5DAP A;  2JG9 B;  4ET7 A;  2XJV A;  1AYN 1;  2CV6 A;  4QHB A;  1XJA A;  4YVS B;  4HT1 T;  1UIK A;  1TME 2;  4HL0 A;  2IXJ A;  1PO1 2;  1G9D A;  1TQ5 A;  2D3P A;  3NV3 A;  1HB4 A;  4AVC A;  2QZ3 A;  4CEY A;  5FFO C;  5FMB A;  5IFT A;  1UY3 A;  5BPX A;  4ORF A;  2X8K A;  1Q56 A;  1S0D A;  2HEV F;  3BGA A;  4KU8 A;  4XJ9 A;  3WQB A;  2DWR A;  3LEG A;  3MW4 A;  4J25 A;  4I01 A;  1JS9 A;  1WME A;  3VBH C;  2JXA A;  1QH6 A;  1E5R A;  1ZRR A;  3VBF B;  3WF0 A;  4ARX A;  4OUE A;  2GC0 A;  4LO7 A;  3RWK X;  4C90 A;  3WUD A;  1LCL A;  4COZ A;  2HWE 2;  2K46 A;  4YM2 A;  4BQ1 A;  1NY7 1;  5AC9 2;  1ZVF A;  1RIT A;  2VCA A;  3I7D A;  1S0B A;  3M3E A;  3N9M A;  2HWF 3;  5A7S A;  4ES9 A;  4HKO A;  4NIH A;  4YGC A;  5IVE A;  1LHV A;  3OY8 B;  3PLQ A;  3THD A;  4I2O A;  2OXB A;  2ETE A;  3H7J A;  4AFA A;  5FMC A;  2WNV C;  1OA4 A;  3FE5 A;  5HXV A;  4ZU5 A;  2DCY A;  3IAP A;  1QJX 1;  2J1T A;  2JWP A;  2WO1 A;  2DTY A;  1DQ5 A;  2J42 A;  3BOP A;  5K4L A;  4E4H A;  4KNC A;  2W94 A;  2C0Z A;  3BCW A;  1HRI 1;  2XKO A;  4CDU B;  3MID A;  3PUH A;  4CP2 A;  2VW0 A;  1KEX A;  2Y33 A;  1IS6 A;  2ZHN A;  4CP9 B;  1FMD 2;  1K3I A;  2D6L X;  3EO6 A;  4P9J A;  4XUP A;  1UN1 A;  1AVB A;  1DGW X;  3MW3 A;  4MGI E;  2W3J A;  4YGE A;  3SLI A;  3VD4 A;  4UI9 L;  4YW4 A;  4EV0 A;  5A3U A;  3BI3 A;  1POQ A;  3E6C C;  1NCR C;  1B35 B;  4FXK B;  4N7I A;  2BOJ A;  3KHB A;  2XH6 A;  4E2Q A;  3AVR A;  2BU9 A;  1Q8V A;  4BWO A;  3KF3 A;  1QQP 2;  5DAX A;  1NXD 1;  5DQ0 A;  4K9S A;  3I49 A;  3WNP A;  1AR9 2;  3AYD A;  3GBG A;  2P6C A;  2YBS A;  5L19 A;  1H1I A;  4ZON A;  1X50 A;  3VHO A;  1RMU 3;  3Q8A A;  1AL2 1;  4KGG A;  2VQA A;  1SLI A;  3EQE A;  3I97 A;  3ZFG C;  1QJX 3;  2FCT A;  4LNV A;  4QXH A;  4TLF A;  4XVH A;  5F5A A;  2VNO A;  5A1L A;  4MGK E;  4EN7 B;  2WII B;  2BBV A;  1HRI 3;  4IE4 A;  5IJR A;  1XND A;  4HBN A;  1J58 A;  2X53 S;  3P1I A;  5A32 B;  3M4F A;  5LWB A;  3SIS A;  1XXN A;  2E51 A;  3NJV A;  3VBO C;  1JZ7 A;  5CFC B;  1ZRD A;  3RWN A;  1RUI 1;  1PNF A;  1CVN A;  1MS1 A;  1H8V A;  3NW4 A;  3UKN A;  1BXH A;  3ZFG A;  2WRA A;  3WT3 A;  4YZ1 A;  4AZZ A;  2YMZ A;  1QEX A;  1XB9 A;  5DAW A;  1ZA4 A;  4YW6 A;  4CDW C;  1BYH A;  2QTW B;  5IUQ A;  4D94 A;  3DF0 A;  3PME A;  3SH5 A;  1Y9Q A;  4NRM A;  1SEF A;  4ZXE A;  1CN1 A;  2FDJ A;  4P9X A;  3H8R A;  1ONA A;  3ZFF C;  2YZ4 A;  3KS7 A;  1R1A 1;  4MXW B;  1X8M A;  3T4V A;  5GZG A;  1EV1 3;  5EIY B;  1R1Z A;  1AL2 3;  2Y0O A;  5G04 L;  2NP0 A;  1HJG A;  1R09 2;  1VBA 1;  2D97 A;  1UF2 C;  3PDQ A;  1WCD J;  3ZXE A;  4QB6 A;  3M2M A;  2XL9 A;  4P9Y A;  4RFT 0;  3ZFF A;  2A6X A;  3USS A;  3FUQ A;  2BW8 A;  4JGZ B;  1F4H A;  4KG8 A;  1QXR A;  5E89 A;  2F4P A;  2QNK A;  3H3U A;  2R0F A;  1ZBA 2;  4BU2 A;  1RUI 3;  1NYW A;  1QMJ A;  1LES A;  3B7M A;  1K5M B;  1UY1 A;  2Z79 A;  4C1W A;  1UAI A;  4AG4 A;  1IOA A;  5F2W A;  2HLE A;  4LLF A;  5FKC A;  5I0R A;  1HB3 A;  2HWD 3;  2XLA A;  1XNT A;  3AZV A;  3GHM A;  3VV1 A;  3NJY A;  4XFA A;  2UY8 A;  3I59 B;  1BHG A;  1C8M 3;  4AOC A;  1LTE A;  2UWB A;  2O0O A;  5F1R A;  1EUU A;  5ACA 1;  4Z92 B;  1G86 A;  5FYM A;  2CTV A;  4UBG A;  5EFU A;  4EN9 B;  4FPY A;  3ZSE A;  4YFZ A;  2VUJ A;  3P5B A;  3B93 A;  3HPN A;  4I0A A;  5K0U B;  4DB5 A;  4KQ7 A;  3OBZ A;  1MVQ A;  1WD4 A;  1FOD 2;  1XRU A;  4NMI A;  3W59 A;  4DEV A;  3VBS A;  4AED B;  1UOB A;  3JD7 1;  1D0G A;  3MFA A;  3WQ0 A;  3CO2 A;  4OMD A;  1LED A;  1W6P B;  2WWU A;  4N53 B;  1K45 A;  3C3V A;  4G3Y C;  3UNP A;  2W1W A;  3MI8 A;  5FUP A;  5T54 A;  3VKF C;  3GAL A;  1RUD 2;  4XAB A;  1G9C A;  3E1F 1;  3O1S A;  4B1L A;  2WSV A;  2ADE A;  2PXJ A;  2ZX4 A;  2XHK A;  4QPI C;  1RUE 2;  4EZH A;  4HON A;  4XIL A;  3I4I A;  3WHT A;  1WA4 A;  5ACA 3;  3U4X A;  2W5F A;  4AQT A;  5JOW A;  1AR6 2;  3IM0 A;  1M06 G;  2D3R A;  3ZYP A;  1BVV A;  1O5L A;  1LOD A;  4HSL A;  3Q8B A;  1N1V A;  2RV9 A;  4LBK A;  4WVM A;  4HG6 B;  4MSV A;  4NRP A;  1GOF A;  1W9Y A;  4KU7 A;  4PDW B;  5I8T A;  5CG8 A;  1MR5 A;  4A41 A;  3O1P A;  2WBK A;  1RC6 A;  1DYK A;  2J1A A;  4QPI A;  2VUL A;  3ACF A;  4BZ4 A;  4L8Q A;  1G9B A;  1EUT A;  1PO2 1;  3RFR A;  4M01 A;  4Q4V 2;  5FZF A;  3UL2 A;  1S1A A;  4K1Y A;  3NKG A;  2KD7 A;  5LW9 A;  1JZ3 A;  3S5A A;  5D8A B;  5C9A A;  1MS3 A;  1D4V B;  1FV3 A;  4LIU A;  2IXC A;  2QQM A;  4Y1X A;  3KCC A;  2LM3 A;  3WOG A;  1LGB A;  1GR3 A;  4EJR A;  4Y20 A;  1TMF 2;  2QBX A;  2EAL A;  1UYP A;  2C9K A;  4OZO A;  4QGL A;  5FY8 A;  3JQX A;  1NLS A;  5LCW L;  1YQ5 A;  3AK0 A;  1COV 2;  1CZT A;  3WW4 A;  4ZZ5 A;  5J1X A;  3VHP A;  4DZG A;  4BIO A;  3CEW A;  3BU0 A;  3N3H A;  2BGC A;  3D6E A;  4P5Y A;  5JLV A;  2BP6 A;  1UKR A;  3WDW A;  5GLW A;  1PO2 3;  1GSL A;  1LOC A;  4R9A A;  1W6O A;  1AR7 3;  4LBQ D;  3UV9 A;  3AB0 A;  3K51 A;  2MEV 3;  4GWN A;  4SLI A;  5LZ6 A;  3TAY A;  4CDX A;  1PM7 A;  1REE A;  1QXJ A;  2E6V A;  2HWC 3;  4GZ9 A;  5FYV A;  4DRV A;  5B4N A;  1D2Q A;  2QUO A;  3OUH A;  1WLD A;  3CJI C;  1MS0 A;  1VR3 A;  2WZ8 A;  3BTZ A;  3POE A;  3GF6 A;  3N9O A;  2HEW F;  1DQ0 A;  2Q0A A;  2PHW A;  2WYS A;  3RZM A;  3GZA A;  4YW2 A;  1AX0 A;  2JD4 A;  3AMQ A;  3HIF A;  4Q4Y 1;  2CDP A;  5FKB A;  1WLT A;  2WS9 1;  1DLC A;  5H9P A;  5I91 A;  5FPA A;  1RUC 2;  2RJL A;  5FJK A;  4IV3 C;  2VMF A;  2E7Q A;  2O14 A;  3DCQ A;  4RR3 B;  2GP3 A;  3VD5 A;  1HB2 A;  3TN9 1;  4EN8 B;  2GH8 A;  3J7H A;  1QJY 2;  1J3P A;  3E5X A;  5A6X A;  3VZK A;  4XF9 A;  5FBJ A;  1ND2 B;  4CXY A;  2I74 A;  4IV3 A;  3T2O A;  3T0A A;  4DQA A;  1HIX A;  2FHR A;  3B00 A;  3UET A;  1WMX A; 
#chains in the Genus database with same CATH homology
 3C7H A;  1GOH A;  2ID4 A;  3IB3 A;  4QDS A;  2J22 A;  2WO3 A;  4D0Q A;  2VZT A;  4CU6 A;  3WF4 A;  4A44 A;  4DUW A;  1SHW B;  5CZK A;  1NX9 A;  2VJX A;  2VME A;  2YFU A;  3WSO A;  1UXX X;  3VD3 A;  4OYU A;  3IAQ A;  1UMI A;  2W1S A;  1W0N A;  1W9T A;  4CUB A;  1US3 A;  3GXU A;  4M4R A;  2OKX A;  2E32 A;  4MGS A;  3T2Q A;  3MUY 1;  2PQS A;  1PX4 A;  2QQN A;  2ORX A;  4AAX A;  5IYY A;  2V5D A;  3MUZ 1;  4KMQ A;  4RYD A;  4CUC A;  3HJR A;  1UX7 A;  5CYY A;  2W9X A;  2W95 A;  1J84 A;  1W8N A;  2C4X A;  3I3E A;  3OGR A;  3VD9 A;  3C7E A;  2BBA A;  3CZJ A;  1OT5 A;  2VTF A;  1H6X A;  2XQX A;  5B4X A;  1GNY A;  2L9L A;  5C70 A;  1OD3 A;  3HN3 A;  3EB7 A;  4ZY9 A;  1NUK A;  4A42 A;  5JMO A;  3CKH A;  1W99 A;  3ETP A;  3GGL A;  4ZZ8 A;  1O8S A;  2VL4 A;  4XZU G;  1JZ8 A;  4XUO A;  3HEI A;  3WNO A;  2WN3 A;  1UYZ A;  3NJX A;  3MO4 A;  2Z4F A;  3HNM A;  2E31 A;  1K12 A;  3I2H A;  4JKL A;  2VO5 A;  3I2K A;  2DCK A;  4TTG A;  2Y6H A;  1J83 A;  2BGP A;  1L7Q A;  4QB2 A;  5LA1 A;  3NRU A;  5EJZ B;  3HNB M;  2VQU A;  4JKM A;  5FUI A;  2WAB A;  4CUA A;  1I5P A;  3OEB A;  3VDA A;  1ULP A;  4XUT A;  3HNY M;  2E26 A;  1CX1 A;  2X05 A;  3WF3 A;  3C7G A;  2YC4 A;  3A7Q A;  1JZ5 A;  3FHQ A;  2W91 A;  4Z2A A;  2C26 A;  1TG7 A;  4DXR A;  2EIB A;  4RN5 A;  5JXJ A;  2VOT A;  1SG3 A;  5IHR A;  2E33 A;  3HOB A;  1ULO A;  4XUQ A;  2X09 A;  1JYN A;  4UAP A;  4CU8 A;  1JHJ A;  2Y8K A;  1OF3 A;  2W46 A;  1R64 A;  3I3B A;  1O59 A;  1W9W A;  4DUV A;  1DP0 A;  4DEQ A;  4JKK A;  4FI9 A;  1JU3 A;  1JYW A;  2Y6J A;  3GM8 A;  3MV1 1;  2ZEZ A;  5JR2 A;  4W50 A;  3T2P A;  1W9S A;  3P6B A;  2ZEX A;  1GU3 A;  2B4K A;  3JXS A;  3LPF A;  4DXT A;  2VZU A;  4LKS A;  1OH4 A;  3OB8 A;  4LPL A;  4BK4 A;  2VZP A;  4QX0 A;  2VMC A;  1YQ2 A;  4A3Z A;  2VZS A;  5DN2 A;  3ACI A;  1HN1 A;  3OBA A;  4BDV B;  3A23 A;  2QQI A;  5JXH A;  2J1U A;  1XPW A;  2JKX A;  3K4Z A;  3VDC A;  4M4P A;  2VZO A;  1WKY A;  2B9V A;  3LE0 A;  1US2 A;  3ACH A;  3OG2 A;  4LQR A;  3MBW A;  5C71 A;  3I2I A;  2W87 A;  2JD9 A;  3K46 A;  3FL7 A;  4P02 B;  3W5M A;  1NKG A;  2YG0 A;  5LA0 A;  4E8D A;  3I2F A;  1CZV A;  1JI6 A;  2VZV A;  3THC A;  2W47 A;  5EJ1 B;  2YFZ A;  1UXZ A;  2QQK A;  3F2Z A;  4CVU A;  4QAW A;  3LEI A;  4BK5 A;  4PQQ A;  3AC0 A;  5LA2 A;  1TVG A;  4ET7 A;  4P08 A;  2XHN A;  2J7M A;  4KI5 M;  4TXW A;  3MV0 1;  1KGY A;  2Y6G A;  1RYY A;  3A21 A;  5IFT A;  1UY3 A;  3LQC A;  5DMY A;  3BGA A;  2R7E B;  3WQB A;  1UY0 A;  1UYX A;  3LEG A;  4L0P A;  4GWJ A;  2VMD A;  2EIE A;  1PX3 A;  3D3A A;  3WNL A;  5JXG A;  3DEC A;  3GDB A;  3WF0 A;  2VCB A;  4OUE A;  3CIH A;  4ARX A;  3T09 A;  3FHA A;  2VCA A;  1UMH A;  2VCC A;  1W8O A;  3THD A;  3T08 A;  3T0D A;  1O8P A;  3IAP A;  4DXS A;  2BER A;  2J1T A;  2WO1 A;  3OEA A;  2EID A;  2W94 A;  4MO3 M;  4A45 A;  4OMC A;  3PUH A;  2W1Q A;  3OGV A;  1KEX A;  1UYY A;  2VZQ A;  4A4A A;  2X10 A;  3SEE A;  1K3I A;  4XUP A;  5IFP A;  3W5N A;  3VD4 A;  2W3J A;  5A1A A;  2Y6L A;  4UI9 L;  4XUR A;  2XOM A;  4GWI A;  2VM9 A;  1JZ6 A;  1XNA A;  5DQ0 A;  3WNP A;  2YC2 A;  1GQP A;  2WUH A;  3I97 A;  4XVH A;  3SKJ E;  1T2X A;  1JZ2 A;  5IJR A;  1OF4 A;  3P1I A;  3NJV A;  1JZ7 A;  3WNN A;  1NAE A;  1GUI A;  3III A;  4QPW A;  3UES A;  2V72 A;  2ORZ A;  2HYX A;  4ZXE A;  2J1V A;  4BJ0 A;  3WF1 A;  1L7R A;  3K75 B;  4QDQ A;  5EIY B;  5F7U A;  5G04 L;  2RJ2 A;  2WAA A;  2J1E A;  2ZEW A;  4QB6 A;  3LEK A;  3VD7 A;  3ACG A;  1F4H A;  3ECQ A;  5HXM A;  2Y6K A;  2VR4 A;  2VZR A;  2W1U A;  4CU7 A;  4JHZ A;  1UY1 A;  2LW8 A;  2BZD A;  1H6Y A;  4AG4 A;  2HLE A;  1XNT A;  1GMM A;  1JYV A;  3FN9 A;  1BHG A;  3CMG A;  1UY4 A;  3K4D A;  1EUU A;  4IUG A;  4MGQ A;  3HPN A;  2QQL A;  1IQD C;  3BN6 A;  2WDB A;  1WCQ A;  4KWU A;  3WNM A;  4P00 B;  4DEV A;  4QX1 A;  1JZ4 A;  4DUX A;  2W92 A;  1JU4 A;  4QDR A;  3ZM8 A;  4OMD A;  1K42 A;  1PMJ X;  3K4A A;  4JX0 A;  1P8J A;  3CDZ B;  1K45 A;  3CQO A;  5I0D A;  3UNP A;  2W1W A;  3IDA A;  4YPJ A;  4W8J A;  4D8M A;  3SKV A;  4E8C A;  3C7O A;  2VC9 A;  3E1F 1;  5JXI A;  3CZU A;  3DYM A;  3EYP A;  2Y64 A;  1GOG A;  2DDU A;  2W5F A;  3PUI A;  3U37 A;  4W4Z A;  1D7P M;  2BGO A;  2RV9 A;  4HG6 B;  4UOJ A;  1GOF A;  2VQT A;  3SEP A;  4A41 A;  2VZ3 A;  2WBK A;  1UZ0 A;  2J1A A;  2WAO A;  4PF1 A;  1CIY A;  3ACF A;  3DYO A;  1EUT A;  3K77 A;  2RVA A;  2KD7 A;  3VDB A;  4MAD A;  2WQ8 A;  3LPG A;  4ARY A;  3WNK A;  1JZ3 A;  2ZXQ A;  2QQM A;  2XON A;  1JYX A;  1XC6 A;  2WO2 A;  2JE8 A;  1MPX A;  2QBX A;  4CU9 A;  2C9K A;  4OZO A;  2J1S A;  1SDD B;  2VZ1 A;  5JUV A;  5LCW L;  4LHS A;  3ABZ A;  1CZT A;  4QB1 A;  4ZZ5 A;  2JDA A;  5J1X A;  2ZEY A;  2QQO A;  2QQJ A;  2WN2 A;  1UWW A;  5G05 L;  2EIC A;  3C8X A;  2LS6 A;  4QX3 A;  4P5Y A;  3OGS A;  3I2G A;  2CDO A;  5HPO A;  4XUN A;  4MOA A;  2V4V A;  4GZ9 A;  4QX2 A;  5B4N A;  2WZE A;  3NQH A;  1F4A A;  2WZ8 A;  2WYS A;  3A22 A;  2CDP A;  3WF2 A;  1DLC A;  3DYP A;  5C7G A;  1CZS A;  3C7F A;  4BXS V;  5DPN A;  1DYO A;  2VMF A;  3WEZ A;  3VD5 A;  1LNS A;  1PMH X;  3J7H A;  3NNG A;  3T0B A;  2J1R A;  4A6O A;  2YB7 A;  3I3D A;  1UY2 A;  3I2J A;  3T2O A;  3T0A A;  2DCJ A;  4PT6 A;  3UET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...