3IWZA

The c-di-gmp responsive global regulator clp links cell-cell signaling to virulence gene expression in xanthomonas campestris
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
207
structure length
207
Chain Sequence
LDAGTIERFLAHSHRRRYPTRTDVFRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRTRTQCELAEISYERLQQLFQTSLSPDAPRILYAIGVQLSKRLLDTTRKASRLAFLDVTDRIVRTLHDLSKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite activation-like protein
publication title The cAMP receptor-like protein CLP is a novel c-di-GMP receptor linking cell-cell signaling to virulence gene expression in Xanthomonas campestris.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transcription
total genus 68
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF00325 Crp Bacterial regulatory proteins, crp family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwzA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3iwzA01
3CO2A 5I0SA 5BV6A 1U6GA 2L3DA 3IWFA 2PFWA 1ZZCA 5E18F 2QZ8A 2OPKA 3MZYA 1O3QA 5HVQC 2XV4S 2ZBKA 3TDUC 1IRGA 1J2XA 4KT5C 2EFWA 3K1PA 3H92A 2DK8A 1O7LA 2STTA 2DU9A 4D7TA 4L11A 3M8FA 2FNAA 1WA4A 1RIOH 2XLFA 3WTWC 1FP1D 4LJZF 1HBXG 3LQQA 4NVPA 4MNUA 1QXJA 2VBWA 3LAGA 2FEZA 1IPKA 3SCGA 2DO7A 3ZP5A 5CJ9A 3ABUA 5HS9A 3MWMA 3HOSA 4EROA 3GF2A 3P9KA 1BI3A 1F1ZA 2Z2SB 2XL7A 3U0ZA 2KIFA 2B0LA 2JRTA 4QXKA 3RKYA 5FLJA 3B02A 1ZRCA 3N4MA 5D5VB 1MDMB 5JR3A 4HN0A 4YFKF 3DXJF 3H50A 2D2WA 3K2ZA 1Z1DA 1MJAA 3OGJA 3GVAA 1J5YA 3CTAA 3S2WA 4Y13A 2EV6A 4AVBA 3J81K 1XD7A 4LK0F 1XE8A 4J1XA 5BY5A 2GQQA 4XBFA 5IT9Z 2P17A 3LA7A 5KBFA 4KL1A 5LBQA 3CUOA 4IRGA 5FB2A 3RPUA 1IUYA 5J7MA 4BNCA 2BV6A 2B9UA 4Q5SF 4DQ2A 4TV7A 4M73A 4G9YA 3F8MA 1F5TA 3H7JA 5K5QA 4MUVA 2J5OA 1EYBA 2QBYA 2XAGA 4L9NA 2OU2A 2X0LA 3CF6E 2RNJA 1RGSA 1R5GA 2EA4A 2FU4A 1UIKA 1RNLA 3DPLC 3I59A 4A5MA 1SFNA 2YR2A 2Z3YA 4ENMA 4XF4A 4RGXA 3HYIA 4YNIA 4K2EA 2V09A 1XDUA 1L3LA 1PP7U 1IXCA 1BIBA 4ORFA 5CLSA 3GLXA 2R7FA 3GZ5A 2VODA 4HX4A 1Q43A 4IERA 2UXNA 2IC1A 2OAZA 4QM9A 3SFZA 1KYWA 1YIOA 4L2NA 1VTNC 4ZYEA 1JUHA 2RV8A 4PCQA 4Q0QA 4XSZF 4EJUA 3GEZA 2BNOA 4EJWA 3LWFA 3EYIA 3LA3A 1X82A 2BNNA 4EGZA 4P9UA 4IRHA 3KCCA 2LF8A 5KK1A 4M71A 4HZFA 4L9VA 4QLCU 1EY2A 3M3IA 5BQTA 5E1RA 3HRSA 1FOKA 1R36A 3I64A 4AVCA 3MQ0A 3IKTA 2PQQA 3ECOA 2K27A 2D1VA 3BB6A 2XGXA 4KNYA 3WTYC 4JV4A 1GQGA 2HFHA 4HN1A 4PIZA 4ZU4A 5JVTA 4S04A 4OIOF 1ZVFA 3BP8A 4RB2C 2PMHA 5H6RA 1DDNA 5I0RA 4JBAA 1W5TA 4FAGA 2Q0OA 4HV6A 1E2XA 2PG4A 5CYVA 4GO1A 4O6JA 1MZBA 3TO7A 2JTVA 1NE4A 2Q30A 1W4MA 2OZUA 3BROA 2GU9A 4N0BA 1TTYA 2BE5F 5DUKA 5CVVA 1TBXA 2A61A 3MYXA 4LA3A 2FMYA 3T0YA 4M9ZA 3T1BA 3ULQB 2KJCA 3H8UA 1AWCA 2VN2A 1LDKB 3REOA 3IWZA 1FX7A 5HS8A 2XL9A 2BGCA 4HX8A 1CAWA 3SZTA 3ES4A 4LB6B 1LNWA 1YFHA 1U8RA 1RUOA 1FT9A 4YFNF 1Y3TA 2UY9A 4MGKE 5I91A 1PMIA 2DI3A 2YPRA 4M72A 1FWZA 1D3YA 4Q48A 1P92A 3I5UA 2VOOA 2M8EA 5E17F 1Q1HA 2I45A 3O2PE 2ET1A 1H9TA 4PIYA 1WRJA 5ICCA 3SHRA 2GXGA 4ETSA 2FRHA 4HV5A 2VXZA 2DBBA 3EHKA 4YSFA 2V6CA 4UUVA 3C18A 5H20A 3OV8A 3CUQA 1GXQA 2WTEA 4AXOA 2EA2A 3I4PA 2ETEA 1YQAA 3V7SA 4QGLA 1WLTA 1BN5A 3LQRA 3CLOA 5EFUA 4IEZA 3ML6A 4L0YB 1O3SA 4MTEA 1XGOA 4XRFA 3R61A 4X6RB 1XSDA 2Q1ZB 4KDPA 3F3XA 2FBHA 2EFPA 3BPZA 4EJVA 3CDHA 2PQ8A 3NVCA 2L4AA 3E5UA 4HQMA 4IESA 1QO0D 1EPZA 4AQ6A 4HF2A 1S7AA 3RKWA 6PAXA 1I6XA 1BBYA 4L0ZB 3DFGA 3PQJA 4XF3A 2RGVA 3ZMUA 1Z91A 1REPC 3FMQA 3T8RA 2DPUA 1ZH5A 4YFXF 1GXPA 2D93A 2CGPA 1U5TC 1KQ0A 2L01A 4ZZDA 5DDGA 2PMUA 1YFXA 1YFYA 1W7PB 1OYWA 3GO5A 3JAMZ 5LHIA 1YS6A 2KXLA 4UXNA 2IXJA 4GULA 1O3TA 1RL3A 1I1GA 1MDMA 3FXUA 3PFIA 5L3FA 2IP2A 4MHGA 3U1DA 1XGNA 2PBIA 4WXDA 2MD5A 3NSTA 2H94A 3OOPA 2ZJ2A 1P4AA 5D8LB 2E7XA 2FF4A 3H3ZA 1YW9A 4OMYA 3M9AA 3IRRA 5L3EA 5BOXA 5A2QZ 2ZKLA 3KLNA 3WW2A 5FD6A 4WX9A 4OFGA 5HLGA 2BEOA 1J9IA 2VT2A 3BPVA 3SCHA 1D8KA 2HWVA 3ECHA 3IDCB 2MH2A 2M30A 4A12A 2IXCA 1USTA 5J3UA 3N97A 3WODF 2BBYA 1RUNA 4Z07A 5J48A 3JTHA 4XFIA 3EDPA 3MFKA 5L3GA 2WV0A 4XLPF 5D6FA 3V7CA 3S0MA 4IF4A 3VODA 1R1UA 4Q0PA 4EM1A 3E6BA 3QRFF 4MH0E 4NB5A 5BPIA 4RGRA 5FO5A 4OIRF 5LGNA 2UWMA 4A6DA 2P6TA 1ZX5A 5FLXZ 1OMIA 3AAFA 5D5XB 1UHWA 3U10A 1TQIA 3K69A 4ON0A 3HTSB 3LSTA 1GHCA 3E3VA 4M6YA 1UB9A 2GA2A 2M45A 2Z69A 5ILSA 4TLFA 1UPIA 3Q9SA 2F5DA 3BCWA 3VHRA 4CYDA 2FA5A 1B4AA 2ISYA 4MQ9F 4PGGA 3BY6A 1YS7A 1LVAA 1IN4A 3NKTA 1MJBA 3KLOA 2D40A 2UYBA 3ZMSA 4WK8F 2EAAA 1Q3EA 2OQRA 3F6VA 5JAXA 2E7WA 2X4HA 2EV5A 1ZZ6A 3HRTA 2C0ZA 2W57A 3ZMDA 3FF5A 4IEVA 3ZN0A 2STWA 3NQOA 3BZ6A 4CO8A 2PAEA 4ZU7A 2GC1A 3QP5A 5J6XA 3GBFA 3D0SA 1FXZA 1FY7A 1OR7A 3DF8A 1BOAA 4IEYA 1HXDA 5BPXA 1P4XA 4MV2A 4IEQA 4A0YA 2WFPA 3VOEA 1ZAOA 1RC6A 4QX5A 2OD5A 4I02A 4XETA 4FT8A 1OI6A 3W6JB 1J3QA 2A3SA 2GXBA 1FLIA 4KA4A 2F4PA 4EJTA 3IDBB 2RN7A 1QZYA 5AVPA 5LRRA 4RGUA 1YFUA 2DQLA 5HDNA 2HQNA 1HW2A 1CAVB 2PFBA 4DNCA 3LZZA 3TO9A 2B5HA 4QWQA 4XFBA 3HSFA 2HKOA 2H09A 3IL2A 1K6OA 3RIRA 4ENJA 2H0VA 1R1VA 2DCTA 3FM5A 5J8FA 3ZQ7A 5E16A 1O57A 4R1HA 4IRIA 5K8SA 3LAJA 3F8CA 4HDVA 2NRAC 3ELKA 3K1NA 4Q0SA 5DYMA 5KHKA 1TQPA 2E9QA 3QACA 4KWJA 1ZGAA 5JCTA 5TJJA 3H3UA 5BUVA 2QUFA 5BXXA 1WSUA 3JSOA 3LWCA 3NJZA 1H1IA 1Y0UA 3FZVA 3D5LA 3VEPA 2R7DA 3KGLA 1TW3A 4ESFA 3IRQA 2EVXA 4HLXA 2FNPA 3WG9A 2GZWA 4H7LA 1WI9A 2ELHA 3JZVA 3K1MA 1NHAA 2DLLA 1KGSA 4G7OF 1W7PD 1HSTA 2ZXJA 5E1WA 2ACJA 4EVIA 2EFNA 2UXXA 1YG2A 4R52A 1NE6A 3GW2A 3JSPA 4Q29A 3ZN1A 3TNQA 2ET7A 3QPTA 4KWKA 1U78A 3KGZA 1ZREA 3F8FA 3FJSA 4CHUA 2GWRA 4O9EA 1MGTA 2V9VA 1WWXA 2N7GA 2HKXA 4ZYGA 2VBYA 1SQ4A 3M8EA 1BM9A 1ZZ9A 3SHFA 1LKNA 1ZZ8A 1WGPA 3KSCA 4S05A 3H1YA 2DTRA 4UV8A 3E5QA 4UVAA 3WGGA 5ED4A 1DPUA 1G3TA 4EGYA 1ON1A 4AQ2A 4QGMA 3CEWA 5F1RA 4P9GA 5FPZA 2ZCWA 3IIAA 4XF0A 5HOOA 2LNBA 2C6YA 3FMSA 3M1EA 1W7PA 2VONA 1YLFA 4YRDA 3O14A 5BMZA 1H9GA 1GVJA 1HW1A 2Z33A 1LEAA 4CGZA 4MGZE 1A04A 1FBUA 3MAJA 5JSRA 1B6AA 4ONUA 4PIXA 1CAXB 2K4JA 4CXFA 4ENKA 1LEBA 3JW4A 2DK5A 3C1DA 1BIAA 1R22A 2W24A 2W25A 2XRNA 4MGRA 1SFUA 1JHFA 2O03A 5DCFA 5LHHA 4R79A 1XN7A 1ZZ7A 1G3SA 5JI6A 4XFHA 3SXWA 2ISZA 2Y0OA 1LRHA 1EH8A 3E5XA 1KA8A 1KU9A 3G7DA 3KE2A 2CFXA 1ZG1A 4KN4X 3ABTA 2GA1A 1ZHFA 2M87A 5KHIA 2ETHA 3GWZA 5D4RA 5J8CA 3ES1A 2O8QA 2LF7A 1R00A 2P5LC 4AWXB 1TNTA 2O6GE 2LKPA 1S3JA 1QGPA 5A2QK 3OD0A 4N9IA 5FQ0B 2PTMA 4HF1A 2MNGA 3CUQC 2XHKA 4UBGA 2E1CA 4Q4ZF 4M74A 4B8XA 4BHPA 3S7EA 2K02A 4KU8A 4AVPA 4ZZLA 3C3WA 4HDUA 1R7JA 2MPFA 3BJ6A 4FX4A 2QCSB 1UD1A 2XLAA 5T3NA 2GAUA 2IXKA 4CDGA 1YTYA 1G4DA 1ZARA 1WKMA 5HLHA 4N9HA 3HT2A 1PP8F 4XSXF 2HYGD 5HS7A 3LAPA 3LFKA 4ESBA 3GFIA 5ICFA 1FYKA 4AIKA 1S7OA 3HHHA 1KU3A 4OOIA 1L3JA 3GUDA 4ZYDA 3L2HA 1U12A 3R0JA 4EM2A 5I0TA 4GCVA 1CX4A 1TQMA 5FFXA 3ZPLA 4M9SA 3HOTA 3RNSA 2EK5A 3ELNA 5E20A 1U2WA 5CVRA 3ZMZA 1IPJA 3I54A 5FFZA 4A0ZA 1EH7A 1O3RA 2A07F 4F8AA 2F2EA 4A5NA 1J58A 1RI7A 1DZTA 2A6HF 1ZN2A 1FNNA 4P9FA 3UKNA 2OA4A 2A68F 4G6DA 4WXCA 3QU3A 3M70A 2FQ3A 1BI1A 4CZZA 4LFUA 3HRUA 5LGUA 2P6SA 1VR3A 1BI0A 4BYYA 3COAC 2FBIA 4JQFA 4ZYHA 1GQHA 3L9FA 3R60A 5AONA 4AD9A 3UKVA 3O3KA 1YLLA 1CAVA 4KUMA 2M5WA 2QVOA 3RYRA 4ASNA 5L3CA 4LLOA 4MGIE 4IETA 1USSA 2CAUA 3RDIA 1G3WA 4MEXF 1OYIA 2CQKA 4LMYA 2TDXA 3OCPA 4KFCA 5ICEA 4RB3C 3EBRA 5H6QA 3WE2A 3ST7A 2QNKA 1J0RA 4NHJA 1KU7A 4Q47A 4I01A 2Z99A 4PGHA 1SMTA 1MD0A 3R6SA 5DD4A 2FSWA 4OMZA 3BOQA 2KIMA 3ISPA 4KMUX 1ZRRA 2EFOA 3ZMVA 4HSJA 3J80K 4A0XA 4KMFA 3DP7A 1XMAA 3DKWA 4PJYA 4P96A 3B73A 3ERED 1XSXA 3E6MA 3I58A 1ZYRF 3E6CC 3H1WA 1XGSA 3KETA 3GYHX 2Q4SA 4UBHA 2EB7A 2L02A 1BI2A 1FPQA 2DAOA 3I71A 1Z6RA 1QQIA 3RJPA 4L5JA 1UCXA 2DW4A 2OBPA 3BJAA 4GXOA 2IXLA 1FBQA 3WTZA 2EFQA 3NRVA 4HVRA 2XAJA 2XKOA 3HRMA 5HLIA 5JFRA 2V79A 2IW5A 4O5VA 1XCVA 3GFLA 4EWEA 1BC8C 2OZ6A 2RVCA 3IC7A 5KHGA 1FP2A 4WXHA 5L3BA 2NAZA 2CW0F 3EYYA 2IA2A 4L18B 1IN6A 4I0AA 3D0JA 5ERIA 3JTGA 5D5UB 2HTSA 2Y48A 3RYPA 1LDJA 1S8NA 2EA7A 1QY4A 4P55A 2CYYA 2DFIA 3F23A 1SD7A 1HKQA 3EETA 4XFCA 2IXIA 1OKRA 4NQWA 1J3RA 4U0WA 2XKPA 3VB2A 2RKHA 4MQVA 2Z9OA 1OPCA 1E17A 4LLNA 1R58A 3HIFA 1O4TA 3J7AO 3EQEA 4LA2A 2MBFA 2KIUA 2CAVA 3H9AA 1LB2A 2ZMEB 2MC3A 5HI0A 1TW2A 1R23A 3IHUA 3O6BB 2YX7A 1JGSA 2IXHA 3RKXA 3T5XA 1YHFA 3BALA 4I2OA 2IVMA 1RTVA 2XAQA 5IT9K 3MPBA 2ADUA 1Z05A 1CAXA 4P5OA 1YFWA 3F72A 3HQXA 4MEYF 5JSPA 5HDGA 1HKTA 1FBSA 4BH9A 2PJPA 2CWEA 3W6KB 1NXMA 2OZJA 1L0OC 1QZZA 4UXAA 1SFEA 4HYEA 4WBBA 3MDPA 3DPTA 2W85A 1ZGJA 4HOBA 1QWRA 2J5PA 2ESHA 1SD4A 5C8WA 1B1BA 1KQ9A 3WTSC 2OQGA 2EWNA 4LK1F 4XEZA 5JR7B 1ZLKA 1Z9CA 5LRSA 2DT5A 4HQEA 5K5OA 2K86A 5BPDA 1ZLJA 1G6NA 3RI4A 2ZKZA 1VJ2A 3TO6A 4L9TA 2GC0A 2K7LA 1F9NA 1SD5A 2ZO4A 1OD5A 1TQ5A 1J59A 2VBXA 4RB1A 5AIPA 5FQ0A 4WWCA 2Z5UA 4PZJA 5DEQA 3TDZC 3CL1A 1QPMA 3QOPA 1G3YA 3WW4A 4IJAA 4UVCA 1YUDA 3WGIA 3K9TA 1LJ9A 1JE8A 1B9NA 1J1LA 2PYTA 2AS5F 4EWDA 2G7HA 2O3FA 2KRFA 3G3ZA 3FXRA 1Q5OA 4DINB 3HT1A 3K0LA 2LDUA 4G94A 3TQNA 2O61A 3ACLA 1XB4A 4IHTA 1DZRA 1IRFA 1ZRFA 1C0WA 1TLHB 1LDDA 2CO5A 1Z6TA 3I7DA 2W84A 2V1UA 4QM8A 1X7NA 4E70A 2MHFA 4WF2A 3WU0A 4OU0A 2PN6A 4Q0VA 4GGGA 2ZFWA 1J7KA 3V8JA 3WTXC 4G6QA 4LULA 2GC2A 1DGRA 4LGWA 1FI2A 2CV6A 2Y0MA 4U7DA 1X8EA 4LLLA 1IN7A 4BHBA 4WZCA 4BAYA 2A5YB 4JTOA 2Q2EA 5I0UA 4M9XA 1EH6A 4AIHA 2ESNA 3C7JA 5LEKA 3F21A 2HYFA 4Q0UA 2RQPA 4UNOA 2HR3A 4E2SA 2QVSB 3U2RA 4UHTA 2FOKA 1DGWA 2NNNA 1STZA 2ZNYA 4GYGA 5E1ZB 1EV7A 1H0MA 1KYZA 1W5SA 2UY8A 3EJKA 3ETQA 4E2GA 1XDSA 1XSVA 5KVRA 1UCRA 4KWLA 4IEWA 3L00A 4M6XA 2JPBA 2XVCA 3BDDA 2NS0A 1KQ8A 4GYIA 3RYKA 1XRUA 3WW3A 1FSHA 2ATFA 3QU6A 3GZ6A 2WWYA 2XAFA 2HTJA 3L09A 2XASA 2D5HA 4HAMA 3WU1B 2KJBA 5DUIA 3P9CA 4XF9A 4LG0B 3IKVA 4EV0A 1CAUB 4EWAA 3FHZA 3KP5A 1XE7A 3F8BA 2QQ9A 4B29A 4U88A 3D82A 3VFZA 3USSA 1DP7P 3EUHA 2HS5A 1EP0A 2PHDA 4IHSA 4CICA 2IT0A 1ODDA 1MJ9A 3U9GA 3CLPA 4JVAA 2PHLA 2VBZA 2P7VB 4LEJA 3PNAA 1I27A 1T0FA 3LOIA 5F64A 4D7SA 4D0PA 4KU7A 2B8MA 2O0YA 5EEHA 1XMKA 3FM3A 4FX0A 2QJVA 5LHGA 3ZDSA 3SXYA 5DD8A 5FCCA 1DUXC 1MKMA 4EMSA 3KP6A 1I1SA 3I0TA 2PLYA 2HZTA 3WTUC 1JHHA 2V1DA 2FE3A 2YX4A 4RAZA 1K7AA 3F8NA 3WGHA 2QWWA 1VP6A 1S29A 1IN8A 4HX7A 5CVJA 4Y17A 2HOEA 4EM0B 4I98B 1T39A 3TGNA 2HEOA 3QAHA 2VOPA 3FFQA 2YU3A 1SMYF 1LR5A 4ENNA 5EZWA 2QLZA 3CJNA 2JZYA 3ROUA 2JSCA 3MZHA 1H1MA 3BJOA 3JAMK 4RB0A 2YSRA 1HSJA 3H7YA 2XAHA 1V4RA 2OA2A 4I09A 4BQAA 2D5FA 5EEGA 2XROA 4EQQA 1O5UA 4KICA 4IVNA 5D1IA 3F22A 2G9WA 5HDKA 2ZMEA 4WCGA 4YIFA 2FBKA 5E8GA 3V8LA 2NYXA 4LLGF 3OF1A 2H6BA 4XFAA 5FPXA 3L7WA 5ILVA 5DV5A 2FQPA 1U5TB 5K1YA 4OLLA 4RD7A 1QNTA 3M7GA 3GXOA 1PM7A 3OTFA 3MEXA 2MLKA 1V3FA 4HBLA 2P8TA 4O3MA 1O7FA 2H27A 4B09A 1ONVA 2RDPA 5D8KB 2PAMA 4IPAA 4ESJA 5DCMB 2RC4A 5E1XA 5I93A 2QQAA 3SZPA 2KKOA 5FLXK 5IT3A 1FYLA 2VQAA 1P2FA 4KIFA 1FSEA 4JTNA 1QBJA 2DQRA 2WC2A 4XFGA 2ZNZA 3KZZA 1CF7B 3T8TA 4YARA 2A6EF 2A69F 4BXUA 1K78B 1IXSB 1P4WA 4A2UA 1ZG5A 2LSOA 3RTRA 4LUKA 3SMHA 1IZ1A 5CADA 2P5KA 1Y9QA 1BJAA 3P7NA 5CVUA 2EJRA 1D8JA 3P9IA 3R4KA 3DQVC 2MH9A 3F6OA 3RPQA 2IJLA 4FAHA 3WE3A 3BU7A 5ILUA 2XLGA 5LGTA 3DEUA 3GFMA 4R8HA 3TKYA 1U3EM 5FLHA 1YW8A 2G7UA 3KP3A 4META 4I0BA 2K4BA 3WW1A 3V4GA 3KEQA 2JPCA 3QPHA 3L2CA 3R0AA 3GFJA 4AVAA 4Z82A 5KHJA 4LUMA 5JSOA 4HSLA 1HW5A 1IXRC 1LQ1A 3DN7A 4QGNA 4HA8A 1JXSA 1IAWA 2AXLA 3C3VA 1ZNPA 2F5EA 1IF1A 1UFMA 4BHCA 3PQKA 4KYWA 4G8XA 2O1QA 4G7HF 1V70A 4I3PA 2HQRA 2UYAA 4OIQF 2K0GA 3J81Z 3KZYA 2PAKA 3BPXA 5CVIA 2GC3A 1XGMA 4ZH4F 1T98A 3PLQA 2PEXA 4EJOA 2F5FA 3DV8A 4IEXA 1ULYA 2L54A 2PI0A 4IXAA 2PA7A 5K5RA 4IEOA 4A6EA 3DL3A 1PUEE 4XFFA 2XIGA 4HF0A 3KFWX 5F6FA 2VE8A 4WVZA 2HDCA 2CSOA 1CGPA 3FMRA 3KMHA 2P5VA 5E8IA 2COMA 3EO6A 1X8MA 3CJXA 1WQ2A 4LG0A 1CAUA 2IA1A 2HJIA 3FHIB 4L5IA 1R5HA 1B9MA 3E6DA 3EQLF 3TOBA 1IW7F 3IBMA 2MLGA 2QBYB 3LA2A 1NYWA 5FGMA 2VECA 4J1WA 4HLYA 3S7IA 4RS8A 4IEUA 2VT3A 1ON2A 3RZZA 3FWEA 3I59B 3FE5A 4U0YA 2D45A 5TRDA 4YIIA 1BC7C 4UV9A 1I5ZA 1QXRA 2VE9A 2Q0AA 3KEOA 4OIPF 4HLTA 2M1BA 3FXQA 3KP2A 4IEPA 3I53A 1FZPB 5AIQA 5D5WB 1TNSA 2QYOA 3G73A 2GH2A 2FMLA 2BNMA 3KP7A 5CU1A 4LD5A 3KP4A 2IA0A 4KIBA 4FHTA 1PDNC 1Z7UA 1J75A 5I8TA 1O5LA 1DPRA 3HTUA 5FDBA 4AIJA 3HUGA 2D1HA 4Z2YA 3QP6A 4JK1X 3SQNA 2VC1A 3HSRA 4PDKA 5JHUA 1T2KA 3CO6C 1ZRDA 4O9GA 2P4WA 2QQBA 1HQCA 4L9JA 1AOYA 1D5VA 5I8SA 3MCZA 2QM3A 3NW4A 1ZG3A 2QENA 1K79A 4MZUA 1J3PA 3V8KA 4U0VA 4HVQA 3V7RA 4MX3A 1SD6A 4H0EA 5C6CA 3NEUA 3FZ3A 1YYVA 2XUBA 2IPQX 1YW7A 4Y15A 1R1TA 2E1NA 4XLNF 3WTVC 2H6CA 3PVBB 2EV0A 2DPDA 1U5TA 2UZKA 1KU2A 2GIVA 3TOAA 5D4SA 1UIJA 1ZZBA 4YYOA 2L4MA 4LTAA 4QMAA 4UVBA 3SCFA 4FBFA 1T38A 2V1XA 1SEFA 5ICGA 4U7BA 3U11A 2O8XA 3H1MA 5FLIA 1OYYA 2HGCA 3HHGA 1X3UA 3TNPB 1YO5C 4G7ZF 4LB5A 5KHHA 2BYVE 3Q9VA 1IN5A 3CO7C 1RZ4A 4HBNA 2IRFG 4XF1A 3BWGA 5LLQA 5DCMA 4KIGA 1CAWB 3NL1A 4BIFA 2CG4A 4I7HA 2OYZA 1HKSA 5L3DA 4HW0A 4KN7X 2F5CA 2Q8KA 3WTTC 3FX3A 4ZU5A 2JT1A 1S6LA 1FYMA 1OFNA 2K9ZA 2NNYA 1UW8A 3HSEA 1T6SA 2R3SA 1CF7A 3Q5FA 5D6EA 4K8FA 4X6QB 1FC3A 1K78A 1UHMA 3GYDA 4E2QA 5I8YA 5BS6A 4OINF 3GX4X 3J80Z 5FD5A 2MA3A 4YG2F 1B59A 5LEJA 4HMZA 1SFXA 2Y75A 3CUQB 1SAXA 1P6RA 2VPVA 3E97A 4MGYE 2P7CB 4RGSA 2FXAA 1F4KA 1XCBA 4HVOA 1YWKA 1NZCA 4RAYA 4MTDA 4F7ZA 3UKTA 2VC0A 2QDRA 3ZMTA
chains in the Genus database with same CATH superfamily
1FEXA 3CO2A 1GP5A 2P37A 4JZRA 3A0NA 2XVGA 5CKTA 5L7OA 4LBQB 3T0BA 5DPNA 4ZZ5A 1VNDA 1GMMA 5IVCA 4F91B 1O3QA 2XV4S 2ZBKA 3HKZN 2YGLA 4ZS3A 2Q8OA 4A42A 2XG3A 5FKNA 2R6QA 1Z7S2 2KRHA 1W2UA 1O7LA 3OYHA 3IDAA 1MEC3 4W1UA 1Q8PA 1R1A3 4B3XA 3MKYB 4D7TA 1YYNA 2VW0A 2XLFA 3WTWC 1JUMA 2JVGA 2VBWA 5B2GB 4NWVA 5EZHA 4LHKA 3ZP5A 2QSFX 1AX0A 3OYWA 3MWMA 1V54H 4JGYC 4Z6YA 3P9KA 1BI3A 1F1ZA 2X05A 3U0ZA 3DKQA 5J1RA 3Q0UA 4OYUA 5GLVA 2IAIA 5FLJA 5FPVA 3B02A 1PO23 1MDMB 3H50A 2D2WA 1SANA 4S2FA 2QZ2A 2P6CA 3OGJA 3SJMA 3AFHA 3K75B 3O1OA 4Y33A 1XE8A 3NMBA 2WO7A 5ERLA 3OYIA 1VBB1 4BEHB 1A6CA 4L0PA 3CUOA 4Y20B 5FB2A 1VBA1 5J7MA 2AYHA 1GZTA 4BNCA 1JYNA 3JB4C 2LKSA 2CDOA 3M3YJ 4CVUA 4PJNA 4OUEA 1EYBA 3MF9A 2XAGA 4CUCA 2X0LA 5JOXA 3CF6E 3POIA 3DLAA 2F48A 2DMUA 3OSFA 4Y52J 2FU4A 1AJKA 4CZCA 1MBEA 3K4JA 1SFNA 1W6PA 3O8GA 4XF4A 4RGXA 1A78A 4QPYA 4YNIA 4MOAA 4PJ0C 5EJZB 1VPHA 4U2AA 1RJ7A 3FBIB 2UWBA 3H35A 2YBKA 5CLSA 4FPJA 1GSLA 5B4XA 2BWAA 2ARXA 2WNVC 2Z16A 3T2QA 2R7FA 2DCJA 4IERA 3UNPA 2UXNA 5JMOA 2IC1A 2OAZA 3ABMH 1KYWA 3G4SI 1LCLA 1JUHA 1B8IB 5F2WA 4AQSA 5HCBA 4EJUA 4QPIB 3VZNA 3I4NJ 2BNOA 4QWNA 2QQJA 3EYIA 3AYCA 2R16A 4DXSA 1YCIA 1UOFA 3KCCA 1GFF2 4L9VA 5JDBA 2QQOA 1WD4A 3I64A 2OUHA 5DAWA 3IKTA 2K27A 1AVBA 3BB6A 4TTGA 1BBT2 4AEDA 4JV4A 4HN1A 4PIZA 4CCLA 4ZU4A 1DYKA 4S04A 4OIOF 3BTIA 4IQJA 5IK8A 1DDNA 5I0RA 1W5TA 4RR3C 4HV6A 4FOVA 2F4IA 1E2XA 3JD73 2XUEA 2EIJH 5FYTA 2PG4A 2VMHA 4CP1A 4BOWA 4LG3A 1YI2I 4FTEA 3TO7A 1ND3C 3Q8AA 2GU9A 4N0BA 5J40A 3OYKA 5CVVA 3CCJI 3RFRA 1DQ0A 3GGLA 4PFPA 3T1BA 3ULQB 4W6WA 3H8UA 2BBAA 2XPWA 3WZ1A 4MYEA 1KJRA 3ASOH 2JG8C 1LDKB 4IGQA 4I76A 3REOA 3BLYA 4Z1VA 1YRNA 5JLXA 2ZEYA 5A3OA 5IK7A 2Q2EB 3LSDA 1TZLA 3A01A 2Y6GA 5TSWA 4LB6B 3PL0A 2VQHA 2QQVA 1LNWA 3RJ2X 2WB1N 3IB3A 1PMIA 2ADDA 4E7HA 2FJ1A 2VOOA 5E17F 3W20A 1LOFA 1WRJA 1K45A 2GXGA 4ETSA 4XXAA 3WEZA 4A7KA 3EHKA 4BWOA 1MR5A 1RUE3 4XYXA 1CJDA 1VBB2 3QYBA 2EA2A 3V7SA 1WWYA 3C2UA 5JOWA 4A6SA 3J7ZI 1VBA2 1SCRA 4A3GJ 5BNPB 1RR8C 1O3SA 1W8ZA 2Q1ZB 4F55A 2JB8A 4DOUA 3F3XA 2EFPA 2BGOA 3BPZA 2WFF3 3NWKA 2P1BA 4IESA 3VYRB 5L73A 4AQ6A 3BTCA 2ZXHA 1OPOA 3HC7A 2V6EA 3PQJA 1SCSA 1WJFA 4UFHA 1N25A 1REPC 1WMEA 3FMQA 2ZHNA 3T8RA 1S0IA 1ZBA1 1H2LA 5BNGA 3HQUA 2VJ5A 1OOPB 4N7UA 4XILA 4XCAA 4I6ZA 4ZPIA 4ZZDA 2JJ7A 4GMP0 4EN9B 1YFXA 4GIQA 4XABA 1QEXA 1V00A 3O1UA 2IXJA 2OX0A 3BR0A 4KBBA 1TVGA 4QSHA 3U1DA 1XGNA 2V5DA 1K5MA 1P4AA 5D8LB 3I9V2 1FOD1 4OAYA 3I2HA 2E7XA 1OH3A 2LP0A 4GH4B 3BIWE 2Y0IA 1NA1A 1J83A 2BHYA 4WX9A 4OFGA 1NK2P 2ZX1A 5FZCA 2BBVA 3NQHA 3LL7A 2HWVA 3ECHA 5IVFA 4CZSA 1VZ0A 3V0AB 4RMNA 1UZVA 4XFIA 3EDPA 1SPPA 3MFKA 2J1UA 5FRMA 5D6FA 3WNNA 3SKJE 4IF4A 1OCCH 3VODA 4Q0PA 2JDPA 5FV3A 4FTSA 5BPIA 4OIRF 4QHZA 4ATFA 3CIHA 3AAFA 3U78A 1UHWA 4OULA 4E8DA 1G2HA 4WM7C 5GLWA 1LJ7A 1CIWA 4M6YA 1UB9A 4C9YA 4TLFA 3ORJA 3LFMA 2MW8A 4JDNA 2HWC1 2V7FA 2R7WA 3D8CA 2ISYA 2ZMNA 1OVSA 1XX5A 1F8VA 3FDYA 3HMYA 3BY6A 1FOWA 2ZGQA 2ZGNA 4ABZA 3MKZA 2D6PA 2VZUA 1V9U3 5T5PA 3FHQA 4AQTA 3ZMSA 4CDUA 1Q3EA 2OQRA 1DQUA 5EJ3A 4LOCA 3N9QA 2XVLA 1WVRA 4R9AA 4YM3A 5BNNB 2W57A 3ZMDA 3FF5A 3GTKJ 3FFZA 4CO8A 3QP5A 1ULFA 1DQ4A 2JDZA 2ZACA 3D0SA 1PJRA 1GDTA 1P4XA 5AC93 1N1SA 5FWEA 2HEVF 4A0YA 4IV1A 2OQ6A 3HGYA 2DA5A 4MXWB 4QX5A 5FYCA 5HXVA 1OI6A 2W3JA 2DDAA 1V6IA 1GT0C 1J3QA 5T5LA 3DEWA 4A3IJ 3HBZA 3IM0A 1XOYA 1HDPA 1W36D 1YFUA 3AKRA 2Y6JA 2DQLA 5HDNA 2V4VA 3NV4A 5M5YJ 2VUMJ 3H9GA 4RQPC 1V6NA 3M8LA 2FDGA 2YYOA 5JXJA 3CDIA 1ZBA2 3OYBA 1C1LA 4QB6A 2LROA 2W0XA 5A33A 1AYM3 5JOZA 3H5RA 5JCTA 5TJJA 1DU6A 3NNGA 2QKDA 5BXXA 3BQYA 4UW3A 5CEHA 4XPVA 2K40A 3KGLA 2DF7A 2FNPA 1AZDA 4PCRA 1FOD2 1DGWY 1LGBA 1WI9A 2EXHA 3BU0A 3TB0A 2I07B 5JXIA 3KQRA 2Z42A 4GQ7A 1FX5A 5T52A 1W7PD 1W5CC 1H8VA 4YFZA 5E1WA 4OHXA 2VU9A 4MO3M 4Q29A 4DZPA 3TNQA 2ET7A 1WHUA 3QPTA 4AEJA 1JKOC 5IK4A 3OR1C 5A3PA 2OXBA 1Y1VJ 1R6RA 4CHUA 1MGTA 4CEWB 5HCHA 1WWXA 5AFBA 2E7TA 4ZYGA 3AG1H 5LBBA 3PJYA 3M8EA 2BXYA 3SHFA 1QJY3 3VB9A 4NQWB 3HOBA 4QXBA 5E89A 3KQ4B 4OMDA 4KBZA 1QMJA 3I3LA 3E5QA 4OQ8A 4DUXA 4UVAA 3WGGA 5FROA 1LHNA 2IVIB 4EGYA 4AQ2A 2XPVA 3J8F1 4OWRB 2ZCWA 4XL9A 4XF0A 4UUSA 1E5HA 2HWC2 3FMSA 1W7PA 3AVSA 5FZ7A 1MH4A 4YRDA 2MSYA 2X53S 3O14A 1H9GA 5DG1A 2OT7A 3T3YA 4FTHA 4YZ3A 4MGZE 3WG4A 4UF0B 1R1ZA 1A04A 4MFDA 5HLTA 4L99A 4M3CB 2O5RA 2WNEA 4F52A 3OL4A 2GALA 2K4JA 4HETA 4D5CA 5C33A 1LEBA 1QQP3 2W24A 1RJ8A 2CUFA 3DYOA 1V55H 2LALA 1XN7A 4J19A 4BQ4A 1ZZ7A 2A3XA 4XFHA 4DXRA 3SXWA 2XVKA 1EH8A 3N36A 3VN4A 5M5XJ 2B42B 4KN4X 3ATGA 1N78A 2GA1A 1RUE1 1ZHFA 2AENA 1XBFA 5FZOA 5KHIA 1UOGA 3M1CA 2I8DA 4JP0A 3ES1A 3QBQA 2E60A 1IDZA 3KEYA 5J1XA 3ZIWA 1TNTA 2O6GE 4C2UA 1S3JA 2V72A 2XXZA 2VIXA 4N9IA 3KZIC 3DECA 4X8PA 4Q4ZF 4M74A 3O8HA 2GOXB 4B8XA 3ZSKA 2Y0SN 2K02A 4KU8A 1X1AA 4Q4V1 4AVSA 5F5QA 4HDUA 1WCQA 1H0BA 3BJ6A 5T3NA 2GAUA 1WKMA 4UWDA 4N9HA 3HT2A 3V56A 2XB0X 1AR63 2VNVA 4R4ZA 1XYOA 4ESBA 1W05A 1RUF1 1S7OA 1KU3A 4WVMA 1L3JA 2Y9ZA 1C28A 1RIRA 2XR4A 2JUGA 1TQMA 4KJZA 3PVEA 2D44A 2H1KA 4BQNA 5J09A 1WBLA 1PGSA 5AVAA 2Y6FA 4RAGA 1MS3A 2VZVA 1UMIA 3I54A 4A0ZA 5FYUA 1O3RA 4NC8A 3O0WA 2KDOA 4CDQB 2RR13 5GKAC 4A5NA 4FP2A 1J58A 4D1QA 3IZOA 1VRH3 4LBQD 2A6HF 2XWJB 4Y4YA 1NG0A 2G0EA 4B48A 4WXCA 1MS1A 4C1WA 4ATEA 1A6QA 1VMFA 4CZZA 3VBSB 1JTXA 3THDA 3AP7A 5LGUA 1BI0A 2ZA9A 2JJ6A 5A6ZA 1GQPA 5EG0B 4AD9A 1VQ4I 1CAVA 2M5WA 5FR3A 5DS9A 4MGIE 4ASNA 2JDMA 2VG9A 2DMPA 4MEXF 3RQ0A 5KXCA 1IGOA 1AA7A 4RB3C 4PQQA 3ST7A 1WW6A 3KHCA 3VL9A 3JREA 4QU2A 1KU7A 4Q47A 2X85A 2E7AA 2JDUA 2ZGPA 3K4DA 4PGHA 1GV5A 1SMTA 3J8F2 1MD0A 3R6SA 3HAGA 4ZY9A 3UGFA 1NCRC 3BOQA 2AACA 2W91A 1ZRRA 3ZMVA 4HSJA 4A0XA 4KMFA 3GTOJ 1QOOA 1VB2A 1NOVA 3DP7A 2WLQA 1W0TA 3B73A 5B4NA 1XSXA 3E6MA 1ZYRF 1DQ1A 3TN91 1RB8G 1LE8A 3GYHX 1RUG3 4ASLA 2J1AA 2L02A 2ORZA 2DAOA 4HKOA 1Z6RA 1QQIA 5CFCA 4L5JA 1DCSA 2WO2A 4PJLA 3BJAA 1FPN1 2EQRA 3JQWA 4GWNA 3H5NA 5CG9A 2XKOA 1IKPA 3HRMA 4CCCA 1UG2A 2V79A 3MUZ1 4O5VA 4B4PA 4DYCA 3ME2A 4FTBA 2VLAA 3S1MJ 1FP2A 4M3CE 2NAZA 4AVTA 1QVUA 1RUE2 2FCTA 4L18B 1IN6A 3K4AA 4IGOA 1CJPA 2W95A 2YHJA 3KWVA 3RYPA 5AC91 2VASA 4DJAA 2EA7A 3WF1A 3CCSI 2EXKA 1LFPA 1OR7C 1SD7A 3QODA 1IQDC 2Y6KA 3GZAA 4XFCA 1OKRA 4OUSA 4UW6A 1UZCA 2XF5A 4O65A 3U1KA 3VB2A 4D7MA 1P9QC 3N3HA 1UX7A 1J84A 3EQEA 2MBFA 4FPEA 2KMUA 3H9AA 3I2FA 1LB2A 3ZFEC 5HI0A 5B1AH 2KA3A 3O6BB 2YX7A 4DB5A 5FUIA 3T5XA 1RUF2 2NS8A 4CH7A 2IVMA 1WPKA 4QX8A 2ADUA 1UMZA 1YFWA 1AYM1 1JT6A 4LNVA 4JGYB 2DFEA 2HQ5A 3TEZA 1W8OA 3RZHA 2JRMA 1QZZA 3CZJA 3OSDA 4V19K 4UXAA 5FJ8J 3I3MA 1SFEA 2K9QA 4BK5A 4WBBA 1XNKA 2WZEA 4AR2A 1ZGJA 2J5PA 2ESHA 1SD4A 5C8WA 1B1BA 3G6EI 3WTSC 2X09A 3PUHA 5LRSA 2DT5A 2K86A 1G6NA 2RMU3 4COUA 1VJ2A 4A4AA 1F9NA 1HDDC 2ZO4A 1TQ5A 5AIPA 5FQ0A 3GLLA 4WWCA 4BJ0A 2RDRA 1WJDA 2WAAA 3CL1A 1X3WB 2DOFA 3WW4A 1G3YA 2CTVA 1YUDA 4E27A 3VHNA 4EWDA 3T0AA 4XUQA 1BXHA 3NV2A 4SBVA 2GP3A 1QJY1 3K0LA 4PLOA 3HOZJ 1QXPA 3ACLA 1XB4A 3WF0A 3K4ZA 1IRFA 4UB6C 1TLHB 2CO5A 1Z6TA 2W84A 3WG7H 1X7NA 1XU2A 4QPGA 4WF2A 2WNVB 3HVDA 3MZ8A 4BXSV 4OU0A 2HYJA 3CCEI 2E36A 4Q0VA 2ZFWA 3DPRA 5FBJA 4IEJA 1FAYA 3TN92 3MIEA 2ZABA 1H9WA 1U8BA 2CV6A 1X8EA 3WHCA 2HBUA 3CMGA 4BAYA 1C5HA 4AGVA 2W48A 1FPN2 1FV3A 4LKSA 2Q2EA 2CV0A 1Z3XA 1QQP1 2XAUA 5LEKA 2V73A 3GTPJ 4CCKA 4Q0UA 4UNOA 3MKLA 4JDMA 4BE3A 5HCAA 3D6EA 3TW7A 2FD5A 2FOKA 1N1TA 2JN6A 3BR2A 3OBAA 1XNDA 1H0MA 2ZSIB 3DTIA 2UY8A 5FZBA 3OGGA 5AC92 1ZR2A 1W2NA 2XPUA 1TMF3 1XDSA 2JA7J 1LHOA 1UCRA 2JE7A 1K12A 1UHSA 4N53C 4RR3B 2XVCA 5LASA 3O1VA 1PVXA 4K20A 5AFEA 3WW3A 2RDSA 2WWYA 1ND3B 2HTJA 3C7EA 4KG8A 3L09A 2XASA 5E8AA 5D21A 3P9CA 1GV9A 4EV0A 3GJBA 1KS5A 4AYUA 1XE7A 2JG8B 3FXJA 3VFZA 4K7JA 1N3QA 1EP0A 1WJCA 4CICA 3WX5A 5D8AC 2IT0A 1MJ9A 1WCKA 4YVSC 1R5ID 2FDHA 1AYM2 2KZVA 2P7VB 1PUFB 1VQMI 1H6XA 4FP3A 2E26A 5F64A 4D7SA 3O1TA 2O0YA 4C91A 5EEHA 1XMKA 3FM3A 4U36A 4D8MA 1T08B 5DD8A 3KP6A 4E9KA 5FY8A 2DT7B 3ZO0B 1GNYA 2ILMA 5K4LA 5FWJA 3ZXFA 1YO8A 5EV7A 4RAZA 2W47A 2DU1A 2RR11 2JUCA 2QWWA 3POEA 3HUGB 1VP6A 4HX7A 3D5OA 4EM0B 1ASJ3 2KIQA 4P9IA 3QAHA 3UETA 2VOPA 4V1PA 5EZWA 1JZ8A 2BZDA 4ARXA 1N3OA 3ROUA 3HQRA 4LXLA 3ZYIB 2R5ZB 4HKLA 5FUPA 3QQAA 3J7HA 5C9AA 2VCCA 2XAHA 2OA2A 1W8FA 2VGDA 2D5FA 1QJY2 2EIKH 4OAZA 4P9XA 1GUUA 3GZNB 4FVVA 4YIFA 2C4XA 1UU5A 4ISQA 5E8GA 2V5YA 2NYXA 1GOHA 2XSJC 3KX2A 4HK9A 1X4OA 1S7EA 5GZFA 2B9VA 4XBLA 3WNXA 4YZ2A 1A34A 3ZN6B 2O8OA 1S2EA 2W52A 3MEXA 2DYCA 5LA0A 1X1DA 2WR9A 3CF2A 2W46A 5J1UA 3ZSLA 3WHTA 2RDPA 4L8QA 1CX1A 5LBCA 3ZYFA 2K85A 5E1XA 2QQAA 1QQP2 5CKQA 1PK6C 4IOAF 1TT5B 3QLQA 1JGGA 2VQAA 1AX1A 1P2FA 1UL9A 1D4VB 2HQAA 1RUH3 1QBJA 2BZTA 4AIDA 4XFGA 3ZPYA 3FBMA 4QX7A 3M4FA 1K78B 1P4WA 2LBFB 4A2UA 2LSOA 2BP6A 3SMHA 1IZ1A 5CVUA 1D8JA 4MADA 3OR2C 4OZOA 3POJA 2MH9A 2DA6A 4RM2A 4YG3A 5E88A 4FAHA 1VF9A 3ZXLA 2H0BA 3M2MA 3GFMA 4MXWA 4WM7B 1LGNA 4R8HA 2XJUA 3FXOA 1DU0A 3KP3A 1HRI1 1K61A 5A7WA 4I0BA 2JKXA 2J1EA 2K4BA 2JPCA 5FO8B 3THCA 1FMVA 4GFBA 1TNRA 3GFJA 4AVAA 3MGUA 1UYPA 3DN7A 3DYPA 4XBNA 1YE9A 2EH3A 2LH9A 3PVNA 1ZNPA 3PO2J 4S2HA 1UFMA 3PQKA 4ET7A 1RUJ1 4G8XA 2O1QA 4COWA 4G7HF 4I3PA 4A3ZA 2WDBA 3OSGA 5FZIA 3K70D 4TSVA 2A6WA 4GXLA 1XGMA 1GOFA 3Q8FA 1ENXA 4O7XA 2YUEA 2L0KA 2XRLA 2RR12 3RI8A 1T98A 1Z3YA 5EYYA 2ZB9A 3SC7X 5A6QA 3ZFFA 1QHHD 4EJOA 1XYPA 5KNLA 4QPOA 2FCUA 1ULYA 5FXZA 2DXIA 3CJIA 2L54A 2RMU1 1ULOA 2QQNA 1UWWA 4C2MJ 5K5RA 3ZYHA 3PU8A 2YC2A 4AE2A 2XIGA 3KFWX 2IXSA 2DV9A 3FMRA 2DDBA 1AR73 5E8IA 3U75A 1LFBA 2VULA 3CJXA 2D3RA 4CU8A 3OMYA 1CAUA 2IA1A 2GXAA 2HJIA 2ZJRF 4CTEA 1R5HA 4RQPB 1GOGA 4L9BA 2XC7A 3AL0C 1WJ5A 2BW3A 4BUPA 1Z78A 1QJZA 4HRIA 4HLYA 3GTGJ 4IV3C 3S7IA 3T4HB 1UYXA 2ZOEB 3CDLA 3VBUC 2VOXA 3WNMA 2NOJB 3RRDA 3I59B 2X5IC 4U0YA 4XZUG 4NUBA 1I5ZA 1QXRA 2PX9A 3S2HJ 3GCMA 3DXTA 5FOBB 3KEOA 4HLTA 2BVLA 2VPRA 3I53A 5FZLA 3W5NA 5AIQA 5KC5A 5D5WB 3IN9A 2NOGA 2GH2A 5A7OA 2FMLA 2DURA 3KP7A 4KIBA 1PDNC 5LA9A 3CMAI 5FDBA 4AIJA 2D1HA 2JG9C 1SLCA 3OBZA 1H89C 1OQ1A 3HSRA 1QRYA 1T2KA 2EAKA 4L5EA 5C70A 3L9JT 2ES3A 5A32B 1QHDA 1HV0A 2QQBA 3B93A 5GADJ 1Z0HA 3BTYA 1K79A 2LG4A 1J3PA 2VZ1A 4U0VA 1JZ2A 4A93J 4HVQA 3CHXA 1SD6A 3A0KA 3FZ3A 2XUBA 2WZ8A 1MNDA 1S0BA 1ULPA 3NAUA 3O5SA 3WTVC 4XDQA 4MLOA 3ZYGA 5A1AA 1KQRA 1HRI2 3R05A 1U5TA 1FNZA 2WAQA 3TOAA 4K21A 5IFTA 1ZZBA 1W2OA 2QEXI 2R4GA 3SCFA 3DYMA 5FYYA 4LBKA 4FBFA 2ZGMA 1T38A 5F27A 3U11A 2O8XA 3FK6A 3HHGA 1X3UA 3TNPB 4GD4A 4X6AJ 4E8CA 4PDWC 2W82A 3WHUA 1RUJ2 4H3WA 2J1VA 5CISA 2DMTA 3LOCA 3EUHC 4BL0B 3BCBA 5F39A 5K0UC 4LHSA 3OYNA 2OVUA 2JIJA 1WW7A 1LOGA 2F5CA 1MQTA 1VAKA 4TXWA 2BY0A 1FYMA 4QPWA 1UW8A 3HSEA 3GHMA 5D6EA 4K8FA 4CP2A 1JHJA 2VVFA 3BZCA 2G19A 3ILFA 1NG6A 1N47A 2RMU2 4N8MA 3RQ4A 3LGRA 3ZYRA 4QU1A 1ASJ1 1OKQA 1R71A 3NJVA 4EE2A 2DYRH 4AFMA 1O59A 2EF6A 2Y75A 3PM1A 2O8KA 3C7HA 1YQCA 4MGYE 4PBOA 2DA2A 1XCBA 4HVOA 1YWKA 4ZDPA 4RAYA 1NZCA 4F7ZA 4XKCA 2R7UA 2QDRA 5J37A 3ZMTA 1AR93 2CYFA 3OGSA 4FPOB 5BV6A 2XONA 2GOMA 5JWPA 3TEYA 2PFWA 1ZZCA 5E18F 4XJAA 1MVQA 4ASMB 4ZZ8A 2OPKA 5HVQC 3WY6A 2P6HA 2BOIA 5IFPA 2YB7A 4KGGA 4KT5C 3AMHA 4OHYA 2EFWA 1RKWA 3K1PA 1OISA 4LKDA 2STTA 1ETWA 3LEGA 3A4CA 2ZMEC 3CJRB 1HJFA 3AJYA 2R7SA 3M8FA 2FNAA 3I97A 3HGGA 3LQQA 4IW3A 1BEV3 1RC9A 4MNUA 1KITA 3E1F1 3VBHC 1W6MA 5GLTA 1MS0A 2ZXIA 1D0GA 2OCEA 4DY5A 3J7AY 3OPTA 4AGRA 3VD9A 1OLME 1M4WA 2B0LA 4QXKA 1BOBA 4KMQA 3RKYA 1ZRCA 4ITCA 3N4MA 1CONA 1SDWA 1G59A 2GNMA 1QJX3 4YFKF 2CW8A 5IJRA 5B1BH 3VZMA 4HEA2 5IT6A 4YW3A 2WT0A 3TWIA 2ZJPF 1JOJA 1EA3A 1J5YA 2Q8CA 3S2WA 4Y13A 5DXDA 3J81K 1XD7A 3OYCA 1S55A 4LK0F 1NUKA 4JGZA 2WL1A 1W8WA 4XLCA 3RI9A 1PZ7A 2AHQA 2GQQA 1H30A 4YGCA 3LA7A 1YOVB 1V6KA 1H88C 2ZZJA 2CNAA 3VL8A 5ISLA 1APLC 3RZDJ 5F9TA 3LQCA 4HNUA 3OIPA 1GZWB 2BV6A 1W1WE 1EPWA 2R30A 1F5TA 3DXUA 2QCOA 1PYVA 2WSUA 1JYVA 1WD3A 4MUVA 4BQ1A 5A6XA 4P9LA 5CFDA 2HDWA 3ENRA 2EA4A 4HOOA 1UIKA 1NCRB 4R9CA 4A5MA 4Q4W3 4UI9L 4FFIA 4K2EA 3BI3A 4QAWA 1PP7U 4NRMA 1S4CA 1BL0A 4LPLA 2LTPA 1P7JA 4GB31 1G9DA 4AI2A 5LCWL 1H8TA 5DZGA 1P8JA 4TYSA 1B35A 4QM9A 3SFZA 4L2NA 1VTNC 4ZYEA 3KM5A 5LWBA 4BM8A 3HNMA 4PCQA 2Q8EA 1AL23 3GEZA 5F1JA 4EJWA 2ZEXA 3USUB 4Y1VA 5J4YA 2YS9A 2WN2A 4AVZA 2I74A 1X82A 3K51A 2LKXA 1DQ5A 2VQCA 5KK1A 4M71A 2VD7A 1ONAA 3GXUA 3M3IA 1ASJ2 5BQTA 3HRSA 2XBO1 1FOKA 1C5IA 2VW2A 1D5YA 4AVCA 2EZIA 2TCTA 3MQ0A 2D1VA 2LW8A 4RHV1 1FJLA 1GQGA 4XUOA 2JICA 5JVTA 1BLZA 3DCFA 1ZVFA 2VBBA 4JBAA 3RVHA 1AR71 3JRBA 3FUQA 1JYIA 1ERDA 2R7TA 2PHUA 5DMYA 2L5QA 2XHNA 2QA4I 2CQXA 3ZFEB 4O6JA 5C3OA 3VBRC 1MZBA 1NE4A 3VD3A 3BROA 1MZFA 5DUKA 4EN7B 1UJ8A 3P3PA 4UW5A 2J7MA 4LA3A 4M9ZA 2KJCA 4LK6A 3AZZA 2C1FA 4KISA 1UY4A 2LYCA 4IHYA 3IWZA 1SVMA 5HS8A 1E5SA 3SZTA 1ZBE3 4R9BA 5C3QA 3FN9A 4CDXC 1RUOA 4MGKE 5I91A 3TW6A 4M72A 3FC0A 4FFGA 1JZ5A 1BA5A 5A80A 1XNCA 2YMZA 2OW4A 3S6PA 2M8EA 3HD8B 2LREA 4UT5A 5GALA 5ICCA 1NCQA 3SHRA 5JLVA 2VXZA 2XQXA 4Y1ZA 4XLFA 2V6CA 4UUVA 3Q3SA 2YU1A 5H20A 3CCVI 3ZN5A 2WAEA 3OV8A 4KITB 2WTEA 2RVAA 3RJRA 4P02B 2WYFA 3AJZA 5J47A 1F5JA 3LQRA 4CU7A 2HVSA 5EFUA 1EKEA 1TWAJ 4L0YB 2HXIA 4BDYA 1PM4A 1X2MA 4GMP3 2DU0A 4MTEA 2FDIA 1XB9A 5JZGA 1XGOA 4B7EA 3AC0A 4X6RB 2E33A 2VUCA 5HBAA 3S8PA 4NIGA 1QU0A 2JDNA 1XPXA 3BG7A 5C4WC 1DFQA 2J1SA 1QJFA 1Y39A 4HF2A 2A6XA 5LK5A 2CRGA 5HV0A 1S7AA 2ZJQF 3RKWA 6PAXA 1I6XA 2OIIA 3DFGA 4K6BA 2RGVA 4V2FA 1Z91A 3B01A 4B4CA 4OQ9A 5CBLA 2DPUA 1ZH5A 2DVAA 2LTNA 3MIGA 1YHQI 1GXPA 3W2AA 4QX1A 4B7KA 3MN2A 2A5WA 3ZQGA 4GB32 3JAMZ 3GO5A 3PDQA 2B7EA 1HDKA 2KXLA 1RL3A 3EUKL 3CMYA 3FXUA 2X51A 1ZRIA 2PBIA 5A3UA 3MIDA 2MD5A 3NSTA 2H94A 3OOPA 5FYMA 3AZXA 1POV3 2DCEA 3H3ZA 3M9AA 3IRRA 5BOXA 2HU9A 3WW2A 4G6TB 4AEKA 3PJQA 3HOXJ 5DZEA 1J9IA 2VT2A 5GM0A 3BPVA 3SCHA 2RV9A 2DCYA 2XBO2 3ZXSA 1HB3A 3ZR5A 3LSKA 3WP6A 4A12A 2IXCA 4ANJA 4N53B 1E5IA 4RHV2 3WODF 2BFUL 4NPLA 3SNMA 4AU7A 5L3GA 3GBWA 4IL6C 2AQEA 3WG2A 3S93A 1AR72 4NB5A 5FO5A 2TBVA 4UFJA 1BK1A 4PBPA 2UWMA 4B1MA 4A6DA 1LUJB 5FLXZ 1OMIA 1ACCA 2R32A 2R061 4AF9A 4FQZA 2ZGUA 1JUSA 2QQIA 4QIWN 4MGSA 3FXKA 3IV5A 1SHWB 4ON0A 3GNEA 3HTSB 3LSTA 1GHCA 1RUI1 2VL4A 2CU5A 4BIOA 5FP7A 1EUUA 5ILSA 2Z69A 5D8AB 4YVSB 1MBHA 3Q9SA 2F5DA 1EV13 3S17J 3M3CA 5IVBA 2C9AA 4WVVA 2A1XA 3VHRA 1BW6A 4MQ9F 1T2XA 1SLLA 4W6XA 3NNFA 4A7ZA 5EGOA 2HDDA 4YIRX 4M6VA 5C8CA 2LY2A 2R7VA 3NKTA 1MJBA 2FDKA 4CRQA 2UYBA 2JA8J 3AKSA 2EAAA 3F6VA 2TEPA 2XF6A 4XAAA 2IEKA 2C0ZA 3JBG1 5GZDA 1RHI1 3RMXA 2STWA 3NWTA 2GC1A 1VQOI 2VUAA 5BNPC 1MBJA 4M3FA 2E63A 1NG7A 4IEYA 4WVWA 3WQ1A 3TBIA 1NLSA 4BA6A 5FPBA 2X29A 4IEQA 2WFPA 3I3DA 5FXWA 4Y7NJ 3FXMA 4HSTA 2BERA 2OD5A 4FT8A 2K3PA 3VSLA 3TP3A 1HXS3 4FPYA 1GANA 5DTDA 4CCEA 4S2GA 4QXCA 1FLIA 2BJSA 3IDBB 5DG2A 4OUMA 2RN7A 5F8PA 5LRRA 4RGUA 3SH3A 3A23A 1W6QA 4FASD 2A5ZA 2B5HA 4QWQA 3POBA 3HSFA 3IL2A 4ENJA 1R1VA 5J8FA 3CNAA 4PLMA 5E16A 4BQ2A 4Q27A 3LAJA 5FJKA 4HDVA 2NRAC 4F93B 5DYMA 3WV6A 3QACA 2A75A 2ZGRA 4KWJA 3KCXA 3H3UA 4GA9A 2QUFA 1GNZA 2R0HA 5FZ3A 2WO3A 3LWCA 2JB4A 2ADEA 3D5LA 3VEPA 2R7DA 3DLLF 1TW3A 1GZCA 1W90A 2ZX4A 4GZ9A 1PK6B 4ESFA 3IRQA 2EVXA 4HLXA 5FREA 2ENRA 1FNYA 4N43A 4E7ZA 2RS53 4B4RA 2HWB3 2VJ4A 4A41A 1WMFA 3PL8A 3C7FA 3JZVA 1NHAA 4G7OF 5EZGA 1JMUB 3N7MA 3RMYA 4QPQA 2ACJA 4A3FJ 2UXXA 2R92J 3T0DA 3GW2A 3JSPA 3KYDB 1H1AA 1PZ8A 1DDLA 1U78A 1Y9MA 4DS0A 3FJSA 5FUNA 4O9EA 4FETA 2N7GA 2HKXA 3OYDA 4XOTA 1D7PM 3S1RJ 4XHBA 2YZ4A 1LKNA 1WGPA 2R062 5T55A 1CZTA 1Z67A 3E1SA 4UB8C 4DUWA 2EBIA 1RUI2 3K10A 3MF6A 3ABLH 4XQ4A 4QGMA 3T1LA 2ZFUA 5HOOA 2LNBA 3RWKX 2PJRB 2VONA 1MVEA 4BQQA 4CCJA 1GVJA 3OG2A 2OPTA 4CGZA 1OC1A 2FBEA 4PIXA 1NLQA 1CAXB 2Y38A 2DJIA 3JW4A 4MSVA 2DMNA 3L2QA 2VR4A 1IRXA 4YVWA 2VI6A 2W25A 1QF3A 4XKVA 3JBG2 3S1NJ 1RHI2 3KLSA 1SLIA 1MMGA 2Y8KA 4KG0A 1C8M3 5FZ9A 3HM5A 2BY2A 3E5XA 1KA8A 1ZG1A 1C3HA 1PGL1 3S1QJ 4BQWA 1FOYA 4XUPA 1LOFC 3THTA 2X9DA 3HB9A 4XK4A 1AUYA 2P5LC 3WCRA 2LKPA 1WGXA 1QGPA 5CG8A 3OD0A 2JECA 2WAOA 3NKGA 2OUJA 2PTMA 4HF1A 4URAA 3MV11 2XHKA 4GMP1 1IC8A 2E1CA 4YG6A 3NAPA 4DUVA 3BR3A 4HKWA 3S7EA 5FXXA 2QSGX 3AL0B 3IAQA 3C3WA 3KT4A 3PIPF 1R7JA 2MPFA 4FX4A 2QCSB 4IV3B 2XLAA 2CGNA 4M01A 1G4DA 2RS13 3VBUB 5HLHA 3CC2I 2AREA 3BG6A 2X5IB 2Q1FA 4PI0A 4NHLA 5HS7A 5K7ZA 5JVVA 4YW1A 3FLPA 4BBSJ 4NWWA 1H2MA 1F4HA 3HHHA 4ZKTB 3CCMI 2IS6A 3L2HA 1U12A 1XC6A 3F0CA 3R0JA 5I0TA 1LOCA 4GCVA 1IKQA 3S16J 3E7LA 1EUTA 5DUUA 5BNOA 2PLV1 3KF5A 4NC6A 2JG9B 3ELNA 1U2WA 5CVRA 1HQWA 5JVGF 3ZMZA 3ZFGA 3ZYPA 3HR9A 1W6OB 4AI9A 2W1WA 3POGA 3U21A 1L7LA 4HT1T 2VPLA 5FY1A 1W9YA 4DYRA 2RREA 5M0TA 1DZTA 1K5MC 4LMFA 3UKNA 3T2OA 4CXXA 2BU9A 2A68F 4BACA 2YBSA 4A3KJ 1BI1A 3I3EA 1PMHX 4M0HA 1NA1C 1VR3A 4NPRA 2DUQA 3P5JA 9ANTA 4ZYHA 4XORA 3CESA 1TEIA 5AONA 5F5IA 1RMU3 2DVFA 3AYDA 5FRNA 1YLLA 4KUMA 2OTLI 3RYRA 5L3CA 3ERMA 1CZSA 3RDIA 3OCPA 2CQKA 2TDXA 4CCNA 4KFCA 3OBTA 2RM23 4IO9F 5A1LA 5M3MJ 1H6YA 3WE2A 2QNKA 4LBJA 3MW4A 4NHJA 4HPKA 3FL7A 4I01A 2Z99A 4N4NB 1VAVA 5F08A 2FSWA 4WM8A 3ZQIA 2KIMA 3ISPA 2EFOA 4Y5TA 4PDWB 3WG3A 1EV11 2HH9A 4JAAA 2YPJA 2A73B 2IGMA 4D94A 5JOYA 3MMYB 3H9QA 3ERED 3I58A 3K6GA 4FFFA 1XTAA 4BS9A 5K0UB 5M5WJ 4XIOA 1BI2A 2IFRA 2ZS6B 3I71A 4UFMA 4CUBA 2DW4A 2VBPA 4GXOA 1FBQA 1JU4A 1K6YA 4H55A 3KT1A 3EYPA 1HKDA 5JFRA 3B94A 4CE8A 2IW5A 1XCVA 3LSHA 4EWEA 1D1CA 3VKLA 2RVCA 4OI4A 1CVNA 4CDUC 4WXHA 1WW4A 2FX0A 1PGL2 4RA0A 2CW0F 3EYYA 2IA2A 2WB1A 1DP3A 2D97A 3U37A 2OKXA 4A3CJ 4COVA 4OCTA 5D5UB 5EQUA 2YFUA 2Y48A 5A3WA 3AYAA 1LDJA 4GALA 4QQOA 1FATA 3MW3A 3CDZB 4P55A 2DFIA 5B5EC 3F23A 2VJJA 1HKQA 3EETA 5K7FA 5J96B 4XNFA 1RESA 1J3RA 4AYBA 1S72I 5KXEA 1XSQA 2ELJA 1HIXA 4XC9A 2RKHA 4EJRA 1ULGA 2Z9OA 4BPZA 2WWJA 1MH3A 1H4HA 4AI0A 3O1SA 3H8RA 5T50A 2CAVA 1KZHA 4QX0A 2ZMEB 3QYEA 4M0NA 4U87A 1VQ5I 2ZSHB 3GJAA 3CF5F 3RKXA 1YHFA 3WOGA 2DJNA 3VBHB 2B7YA 2XAQA 3HEFA 2XDVA 3VDDA 2NLRA 4MEYF 5FZFA 5CKNA 3Q8CA 3CCUI 1HKTA 3I4MJ 4F83A 5FK7A 4BMBA 5FKBA 3W6KB 2PLV2 2HI3A 1NXMA 1GUIA 2WZR3 1L0OC 4W65A 4Q5OA 2E71A 4HYEA 4G9SB 3MDPA 2HWF3 4FCAA 3DPTA 1VBE3 4HOBA 4CP9B 1QWRA 4KGQA 2F4LA 4JOMA 1AJOA 1KQ9A 4LK1F 3OS1A 2HWB1 1ZLKA 4QKNA 2XMLA 3UYJA 4HQEA 2R0QC 1W36C 3RI4A 3VKFC 2W68A 4L9TA 4IZZA 4NAMA 1VALA 1W6NA 4CYCB 2CWSA 4Z2WA 2W94A 4RLFA 3TDZC 2YC4A 4IE7A 4IJAA 4UVCA 2KHMA 3WGIA 1LJ9A 1UZYA 2PYTA 2KRFA 3FIWA 3G3ZA 5B66C 4BGDA 4DRRA 1HF0A 1IS6A 2LDUA 2ARCA 4G94A 4KNCA 2WO1A 1W0OA 4IHTA 1NQJA 1G9AA 1C0WA 3B3QE 1ENQA 3DBHB 3IKWA 1OT5A 1BK0A 2PN6A 1EV12 1ULDA 2GMMA 1GYKA 3IT8A 3WTXC 2GC2A 1DGRA 3DU6A 5F3GA 2M4GA 1WLWA 4U7DA 1L7QA 1AKHB 1T6GC 3OIQA 3WQ7A 2JXAA 3MD2A 3DTEA 3MI8A 3KV5A 3AKZA 4M9XA 5L9RA 1JZ7A 1YQ6A 2ELKA 2ZZQA 4XR6A 4BKXA 3PIOF 3IH3A 3F21A 3IAS2 1Z77A 3X29B 2RHPA 2RQPA 3KHBA 4XJUA 4DXTA 1MNMC 1ZGWA 3LCPA 1DGWA 2NNNA 3VGIA 4JCKA 1STZA 2WS93 3ACFA 1EV7A 2HEYF 1KYZA 1YIJI 1W5SA 3EJKA 1TL8A 4OVEA 5IUQA 1BHGA 1XSVA 3SYTA 1NQDA 1ITYA 3DEMA 4M6XA 3HPGA 4YW7A 1VBC3 3BDDA 2NS0A 1KQ8A 4GYIA 2HYKA 3BTXA 2KLOA 4D6QA 1W8NA 2RJLA 3QU6A 1U0JA 3VBRB 3BTLA 1X33A 4HAMA 2KJBA 4Y22B 1YC61 4XF9A 5IATA 4LG0B 3U07A 1W39A 3IKVA 2D6KA 5FLMJ 3FHZA 3KP5A 4B29A 5FP3A 2RE9A 5JI7A 3W3CA 3USSA 1DP7P 5FZ6A 4IHSA 1OH4A 1ODDA 1MS8A 1KGYA 1UZWA 3ZDVA 5CPRB 4CDXB 3GDBA 1YJ9I 3RZJA 3PNAA 1PIV3 1I27A 3F2ZA 1T95A 1A5JA 5GJ6A 5ANQA 2VZ3A 1C57A 1SVOA 1D0ZA 5LHGA 3F9KA 4BDZA 2IZWA 3ZDSA 1MKMA 3DTKA 2MEV3 1N75A 3VBOA 1JHHA 3JRIA 3WF2A 1TWCJ 2HWB2 3F8NA 2E6VA 1IN8A 4AHYA 2HOEA 2BUKA 3GHNA 1OFCX 3MVPA 3GTMJ 2J1RA 4I3GA 3GCWA 1A36A 5JIAA 2VQTA 3GALA 3FMGA 2YU3A 1LR5A 3ECQA 4ENNA 3ZN4A 1BR2A 3CJNA 2JZYA 1DLCA 4Q4X1 2K9MA 3MBWA 4E4HA 1H1MA 1ULCA 4RB0A 1KFUL 3H7YA 3CMEI 3OUIA 4LO5B 2W2IA 3CCQI 3SLIA 1RMU1 2WLPA 5C4WB 1AU7A 4I09A 1REDA 4YFWA 5HCFA 2XROA 5GAEJ 3JRFA 3V0BA 4EQQA 1O5UA 3F22A 2IWGB 2RM21 3BG9A 2M0CA 1OURA 4CU9A 3UK9A 4LIUA 3OYLA 2PHWA 1VBD1 4BK4A 2BVMA 2V4AA 5FPXA 5A6YA 5ILVA 2XJVA 2ZGOA 4YZ1A 2KZGA 1GNHA 1QJEA 2KD7A 1AXKA 2QE3A 2D6NA 2I10A 3LIHA 3GXOA 1PM7A 1AX2A 2KT0A 3W9AA 2W39A 2HWE3 3DKYA 4HBLA 1BQPA 4NBQA 2EIBA 4D5FA 3KD4A 4O3MA 4C3IJ 1O7FA 4B09A 1IS3A 4JKKA 3H8OA 5D8KB 2XB5A 3SEEA 1B72A 4IPAA 4ESJA 5TGTA 3POYA 4GAZA 1OHFA 1DYPA 4PFOA 5IWFA 1S0FA 1S2BA 1RUD1 1FYLA 5L9VA 2PMZA 2ME0A 4KIFA 5FO7B 2YU2A 5CFCC 4YW2A 2R7QA 2F4MB 2VQUA 3KZZA 1CF7B 2WQZC 2A69F 1ZQ3P 4BXUA 4MG2A 1X4PA 3HPHA 5ABJA 5CADA 5FZAA 3G1OA 3P7NA 1X9TA 4XKBA 3F6OA 4CA0A 3AZVA 4DGWB 3BIEA 4MGTA 1ND2A 5ILUA 3DEUA 1GBGA 1UO9A 5FLHA 4BXFA 2GN7A 3PIJA 4EYUA 1REFA 1U9NA 4META 1EAH3 1IG0A 2DA7A 5L7OB 2F6CA 1D1BA 3V4GA 3EUAA 4M4RA 1LNSA 4IX7A 4Z82A 1AXYA 4LUMA 2VOKA 2DCZA 1HW5A 3I8TA 1URXA 4E7IA 3A22A 4HA8A 3PTRB 5F6KA 2Q8DA 4AG4A 3DU5A 1V70A 2HQRA 2AXTC 3LPGA 4YM2A 2K0GA 3J81Z 3KZYA 1QJU1 4A3JJ 1FIAA 1PO13 5CVIA 1MBGA 3G71I 2DOEA 3OYWB 3O7OA 2HWD3 4E6KG 1R081 1NKGA 1F35A 3NRUA 2PEXA 3H5AA 3FUOA 1ZA4A 2GM4A 2VNOA 3DV8A 4IEXA 5IAXA 4Q2FA 4IXAA 3T1MA 2P2KA 5APAA 5HXMA 4Q4X2 3I49A 2GP5A 3PTYA 4G12A 1PUEE 1PX3A 1IGNA 3PO3J 1OCOH 3E0JB 4HF0A 4AVVA 5F6FA 3AFGA 2VE8A 3DUIA 4P1WA 2CSOA 3C2HA 3S5AA 3KMHA 3M4OJ 5H9RA 3KPHA 3OS2A 1TNFA 2RS33 3J4UH 1RMU2 3VYUB 3EO6A 3TRSB 4AHXA 4JRLA 3PSIA 1WQ2A 4BU2A 4L5IA 2RM22 3MW2A 5JMCA 3E6DA 3LDBA 4C3JJ 4PSWA 1VBD2 3IBMA 2PXJA 2VMFA 1T33A 3LD8A 4LIVA 4J1WA 4LKEA 2WABA 4PF1A 1KJLA 1XXNA 3WUCA 4IEUA 2JENA 3H42B 2A70A 4PI2A 1W6PB 1O8SA 4B44A 1Q1VA 2VKHA 5TRDA 1NXD1 4XTMA 2CUJA 5I0DA 1X1PA 3NO8A 4OIPF 4XRMA 3TP0A 1JTYA 3FXQA 4QPGC 1U9OA 2I2SA 3H1CA 2WINB 1LTEA 1NH3A 5L36A 2NXNB 4ES9A 2QYOA 3GM8A 3DPRC 3D3AA 5FY4A 3G73A 2VMCA 2BNMA 5CU1A 3KP4A 1RUD2 3T2TA 4YM1A 4Z2YA 4E7JA 3HN3A 4JK1X 4B4QA 4DOZA 3SQNA 1Y43B 1W8HA 3KV9A 4BE2A 4FQ4A 4PUSA 3CO6C 3BTJA 3GTJJ 3LFUA 3FXLA 3PNVA 2OF7A 1HQCA 1D5VA 2VOWA 2VH9A 2AUYA 4XURA 2WS91 1POV0 3K48A 4RN5A 2QM3A 2QKLB 3C7GA 5GZEA 4NOTA 3BKZA 3V8KA 1UY1A 3OEAA 1HV1A 2P3JA 1QHGA 1YYVA 2IPQX 5F3CA 2E51A 3CD6I 4XLNF 1MEC1 1CQTA 1R1A1 4XJ9A 3ZOIA 3SEQA 3PVBB 1LHUA 1TME3 3WQBA 2D5VA 2EV0A 4XKWA 5GTHC 2BXZA 3WR0A 4HNVA 2UZKA 2GIVA 5D4SA 5EJ1B 4YYOA 2L4MA 3ZKYA 5E6HA 2Y33A 1O4XA 4J25A 1SEFA 2NYYA 4U7BA 4LOTA 3H1MA 1OYYA 3B6AA 1YO5C 1PO21 4G7ZF 2D6OX 1GLHA 5KHHA 2BYVE 4UFKA 1IN5A 1YRNB 5DCMA 2WA4A 2J1TA 3NL1A 2A6TA 3A01B 3K77A 4S0HB 1QJU2 2OYZA 1HKSA 4PF5A 2FDFA 4QX2A 1WW5A 2DFCA 4HK8A 3WTTC 4B1RA 3FX3A 3OYEA 4YM0A 1QU3A 1S6LA 2Y31A 1GP4A 2NNYA 1R082 4ZYAA 2M0MA 1VMJA 2R3SA 5IVEA 1XPWA 3M07A 2QQ8A 3POSA 1UHMA 3GYDA 4E2QA 3WNLA 5I8YA 1LHVA 2OUMA 4OINF 3VHPA 4QB1A 1QNYA 1SBDA 3J80Z 5EEAA 3OY8A 4YG2F 4XIDA 4BISA 1IPSA 2KL4A 4Q8KA 4LO6B 4RGSA 2AEYA 2FXAA 1KEXA 2AO9A 2VC0A 2NVTJ 2R5YA 2CQ7A 3V64A 1T6BX 3S14J 4RA2A 2L3DA 2PHXA 2VUJA 4ZJZA 5CZKA 3SEZA 1VB4A 2ZPXA 4GWMA 2QQWA 5C9AC 5DM7F 1IRGA 1J2XA 2JA5J 1MMSA 3BN6A 2DK8A 1SACA 2DU9A 2WKKA 4L11A 1RIOH 1FP1D 4LJZF 1KONA 1JXNA 3K4MA 3LAGA 1N77A 2FEZA 2HWE1 5JXGA 1IPKA 3SCGA 3ZKUA 1RUC3 4MGQA 3B69A 5CJ9A 5HS9A 3HOSA 4EROA 3SDBA 2Z2SB 5GLZA 1U0AA 2CUEA 1TE1B 1X2NA 1M06G 2Z4FA 5D5VB 5JR3A 4TLGA 3NNMA 3DXJF 1QH7A 2XQRA 3P3NA 1K5MB 1MJAA 2M3AA 2VZTA 3GVAA 2HZDA 4AVBA 2IS4A 2EV6A 1SAUA 1VQPI 3MIFA 1SFOJ 4QX3A 1UYZA 2WS92 3LSMA 1NA1B 3JD71 2DBNA 2ZXWH 5BY5A 3W2VA 4XBFA 3ZCOA 5IT9Z 2P17A 2KR2A 3IAM2 2IVJA 5KBFA 4KL1A 5LBQA 4IRGA 1RETA 3OYFA 4YEJA 1IUYA 4W6YA 4Q5SF 1XC5A 1SPPB 1MEC2 4FPGA 1R1A2 1IOAA 3H7JA 5K5QA 2BVVA 3HJEA 2L2OA 2ME6A 2QBYA 4L9NA 1J1TA 1A3KA 2ZEZA 5KWRA 1LOBA 2RNJA 1BBT3 1RGSA 5FZHA 4CDWA 1RNLA 3CQZJ 2DDUA 3BR1A 1H9PA 3PJRA 1Q8QA 2YR2A 2Z3YA 2R7OA 5F6LB 3C8XA 4NHMA 2EICA 3L2YA 2JDHA 3DKXA 1GLNA 1PO22 3BTZA 2QGUA 5FTTC 4GKXA 1Q43A 1PVC3 1CIYA 1YIOA 4A3XA 2ECBA 2P81A 2G4IA 1S0DA 2ZEWA 3BC8A 3UL2A 2C26A 1Y0NA 4E7SA 2QTWB 3KYLA 2B63J 1PO11 2XJPA 3VBFA 1I5PA 1YQ8A 1G8XA 4XJWA 3G1MA 1OLTA 4CDUB 3INAA 4C2TA 3D5RC 4P9UA 1NK3P 4YZ4A 4HZFA 2ZC2A 2X8KA 5DQ0A 5E1RA 3IDEA 2ZAAA 3ECOA 2WFF1 1Y6IA 2XGXA 3T09A 3ZFFC 2R073 3AKQA 1SLAA 4IV1B 3KF3A 2L7ZA 2BHZA 2GIZA 3CJIC 1SVLA 2PMHA 5H6RA 2JQ7A 4XM3A 2ORXA 4H4KC 4FAGA 5HPOA 2Q0OA 3GZEA 5HODA 1VBB3 2VW1A 5C44J 1OCZH 2JTVA 2Q30A 1VBA3 1W4MA 2EXIA 1TTYA 2BE5F 3VYSB 2OPWA 2A61A 1K4SA 3T0YA 5J1YA 1UAIA 1XSRA 1IV8A 2AQFA 4NO4A 2VN2A 3IAPA 3K70C 1FX7A 2BGCA 3PUQA 1CAWA 2IUWA 3QPSA 4GJZA 3M3EA 1D1AA 1I1EA 1JUIA 2HWE2 1YFHA 5A33B 1W2AX 2UY9A 3JXSA 4YW4A 1WJAA 3MEPA 2YPDA 4FISA 1RXGA 1UAAA 4CEYA 3I5UA 1RRJA 1W03A 3A21A 2ET1A 5JR2A 4RLQA 2MABA 2FRHA 2CS3A 1BJZA 4E7LA 2W9XA 4YSFA 2VKEA 2ID3A 3UKGA 3C18A 5T5JA 1U5IA 2DUPA 4ES8A 4RS5A 1TT0A 3CUQA 1GXQA 3JD72 4XLEA 1SDDB 3I4PA 1YQAA 5IYCJ 4D7NA 4QGLA 1WLTA 2WNUA 3CLOA 2V4JC 2TUNA 2QBXA 3I3BA 5FBZA 5FZDA 4CXWA 3WINE 1ETOA 4XRFA 4LBQA 2L9RA 2P0WA 1XSDA 4QKDA 4KDPA 4NIIA 3IMMA 1E0EA 1IZ3A 2BVBA 1QDCA 1S2KA 2PQ8A 2L4AA 3ZMNA 4E4SA 4HQMA 4XJZA 5C4XJ 4DEVA 1TME1 2IFWA 4HL0A 2DBIA 1WH7A 3KVAA 2QQUA 4BBRJ 2EPFA 3VBRA 2K3FA 2Y69H 2JA2A 3LMMA 3CZ6A 1V9U1 1W06A 1JU3A 1F43A 4ZHNA 2CGPA 1U5TC 5C71A 1KQ0A 4N7IA 2L01A 4UUSB 1DGRM 5DDGA 1W7PB 1OYWA 1YS6A 3N7KA 4UXNA 1BYHA 3HEIA 1I1GA 3H9JA 1MDMA 3PFIA 2IP2A 4WXDA 1PO12 5A3LA 1OSGA 2VKDA 2XGEA 2VXRA 2GMEA 3KLNA 2EZHA 5HLGA 4A44A 2ZHKA 4BEHA 2DUOA 2BEOA 1MQTC 3VZOA 4Y20A 2E2HJ 2M30A 4K9SA 4DPNA 1USTA 4AGGA 2WFF2 5J3UA 2NS7A 5CA6A 2BBYA 1RUNA 2VY0A 5FZOB 3ABZA 2WV0A 1GVDA 4XLPF 3V7CA 3RSNA 3CCRI 3S0MA 2FDJA 3OOUA 4IGPA 1WCDJ 4MH0E 1OF4A 4IUGA 4RGRA 5HNFA 2NVXJ 5LGNA 3WP4A 3S5QA 4C0BA 5EXOA 1ZX5A 5T5OA 3Q8EA 2LVSA 3AXEA 5EYXA 3CP2A 3NWSA 5DUWA 3U10A 3K69A 3J7MA 5FZGA 3O1MA 2GA2A 1AXZA 2M45A 1PZ9A 1HN0A 1U5YA 3OYAA 1PHMA 1R093 3MIBA 1BR1A 4CYDA 3W5MA 1OCPA 2FA5A 1B4AA 5LW9A 1JZ3A 4PGGA 2UWAA 3LIGA 1GWLA 4GRIA 1B8IA 4XE9A 2O7OA 1YS7A 1XU1A 3I2KA 5EWSA 4QPIA 1WLCA 4WVMB 1X3ZB 1RUC1 3K4NA 2D40A 1ZBA3 2OC6A 5C7GA 4WK8F 4JYKA 3KZ4C 2M34A 1HCRA 1ZZ6A 3HRTA 4D69A 3PMEA 4V2WA 4E4ZA 4QHOA 4IEVA 3ZN0A 3NQOA 4ZU7A 2IGOA 5J6XA 3QOEA 5G05L 2D6MA 1FY7A 1N1VA 1BOAA 1HXDA 5KAFC 4FPCA 1FOD3 2VZPA 4MV2A 2ZGTA 1LHWA 2PHRA 3UT0A 1RC6A 3VDCA 1W0PA 2VZSA 4I02A 4EN8B 3AMQA 2CW7A 4LQRA 2F6BA 1N3PA 4JGZC 3SEPA 4IE4A 3NARA 2EIGA 5D2AA 2A3SA 1IUFA 1NLRA 1QZYA 4RL7A 4W8JA 1IV6A 1HW2A 1Y8QB 1CAVB 4DNCA 3TO9A 1TME2 2HKOA 4IOCF 1R49A 2NMNA 3K7AJ 2DCTA 2QFEA 3FM5A 1QIQA 4BMEA 4IRIA 5K8SA 1V9U2 4P5YA 3CC4I 5CFDC 3B9IA 3K1NA 1TZOA 1OQDA 3ZXDA 5KHKA 1JHNA 2E9QA 4C3HJ 2MG4A 5BUVA 1UPSA 3JSOA 4DW6A 4AOCA 3SZGA 2ZMKA 1SFKA 3NJZA 1H1IA 3OYMA 1PVC1 5F0FA 3FZVA 3ASNH 4FI9A 1KD7A 1P7IA 2HWC3 3ZQLA 1LE8B 4DBRA 3GF6A 5EP9A 4Y24A 4C0HA 1Z7LA 1H8TC 2WZPP 5CFCB 1B35C 3PNYA 3RKQA 4H7LA 1W0NA 4XQFA 2E2JJ 2J42A 2ELHA 3AXDA 3NNJA 4ITVA 2KPMA 2DLLA 1KGSA 1OLRA 4P9JA 4DNYA 1LGCA 2L7FP 1E57A 5FP9A 3VZKA 3EPZA 2ZXJA 4EVIA 2EFNA 2M4KA 4FQGA 3S30A 1VFCA 1NE6A 1TWHJ 3ZN1A 5BNPA 4KWKA 2D3SA 3B7MA 3KGZA 1ZREA 5FMOS 2GWRA 2WV1A 5A3TA 3IIIA 2JVHA 2R071 2VBYA 1SQ4A 2WQ8A 3OB8A 4A3MJ 2P3IA 1BM9A 1OQYA 1JJ8C 1ZZ9A 2XJTA 4C90A 1AR61 3KSCA 3WUDA 4S05A 4UV8A 1W0UA 4XCBA 3LEKA 4RFRB 5FJHA 1Y8RB 1VQ7I 3JR9A 5ED4A 1W8TA 1DPUA 1LEMA 2TNFA 4LOSA 1G3TA 2VE1A 1ON1A 1OOPA 4DBQA 1MPXA 2QQKA 4XIKA 5FPZA 2BFUS 2RJ2A 2C6YA 4DYQA 4KQ7A 2WA3A 3M1EA 4Y5Z0 1KDMA 3D4KA 2DVBA 5EDNA 2J22A 3RQIA 3BG5A 1HW1A 2Z33A 3MAJA 5JSRA 4ONUA 1ZR4A 2BWCA 3MIHA 1RUC2 1O4ZA 3DF0A 1VRH1 2GNTA 4CXFA 2JWPA 3QYFA 3I2JA 1WJEA 4D9JA 3ZMOA 3DBLB 4GH4A 4XLAA 1R22A 5A7PA 1UQXA 1JHFA 3MO4A 1OQEA 1YJNI 5DCFA 4YW6A 3AMPA 3ZIXA 2WSVA 5JI6A 3OYJA 5JPMB 2V9PA 2Y0OA 1LRHA 5TISC 1KU9A 4BJ5C 1WMDA 2X1DA 2Y60A 3WF3A 4LO4B 3CC7I 3I3QA 3V0AA 5F7UA 2M87A 2ETHA 2HLEA 3GWZA 2ERFA 2K9LA 3ZYJB 1NCQC 5J8CA 1R00A 5DM6F 1XNTA 4AWXB 2L9SA 5IYYA 1UMHA 5A2QK 1G9FA 5FQ0B 1ORKA 4A3EJ 4UBGA 2JDKA 1MZ5A 3R4SA 1D0HA 5E3MA 4BHPA 3SQOA 4NE9A 4JX4A 4ZZLA 3MUY1 3THPA 3JRGA 1MMDA 4XW3A 1UD1A 4UW4A 3R4DB 4CDGA 5JZGC 3LSIA 1ZARA 1A35A 1T8IA 1RUG1 3FBYA 4XSXF 2EINH 2G9FA 4UFLA 4AAXA 4IE0A 2R49A 3LFKA 2KRCA 2OQ7A 3ITQA 4AIKA 2CWMA 3URFA 4HANA 4LBLA 2IGKA 4QPGB 4P9WA 4OOIA 4RAFA 2Z79A 5EHDA 3RZOJ 1PVC2 3DPRB 1CX4A 5GAHJ 2V26A 5C3RA 4H7MA 3J8F3 3N7LA 3TYJA 4MFEA 1ZM1A 5FFXA 3ZPLA 1WJBA 2IS2A 4M9SA 3WG1A 3HOTA 2I5UA 3RNSA 4BLIA 4LE4A 5BNNA 1XNBA 1C1FA 2A6YA 5FFZA 1NZIA 3NJXA 1EH7A 4QQPA 2F4OB 2A07F 3ACGA 5C3EJ 4XOPA 1Y9GA 1X19A 3DPUA 3BG3A 1FNNA 4P9FA 2OA4A 1TC3C 5DZFA 3SH5A 4G6DA 5EIYB 2X48A 2FQ3A 4BQ5A 3VDXA 3VLBB 3SH4A 2P6SA 2VUDA 5IW0A 2VJXA 1HRV3 4AYBN 3K4LA 4JQFA 1GQHA 2R072 3R60A 5FY7A 4XN0A 2Y9YA 4LLOA 2HPMA