3IWZA

The c-di-gmp responsive global regulator clp links cell-cell signaling to virulence gene expression in xanthomonas campestris
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
207
structure length
207
Chain Sequence
LDAGTIERFLAHSHRRRYPTRTDVFRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRTRTQCELAEISYERLQQLFQTSLSPDAPRILYAIGVQLSKRLLDTTRKASRLAFLDVTDRIVRTLHDLSKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Catabolite activation-like protein
publication title The cAMP receptor-like protein CLP is a novel c-di-GMP receptor linking cell-cell signaling to virulence gene expression in Xanthomonas campestris.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 68
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF00325 Crp Bacterial regulatory proteins, crp family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwzA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3iwzA01
1XE8A 1YFUA 2Z69A 4O9EA 4QGLA 3W6JB 3EYYA 4Y13A 4IRHA 2QBYA 6PAXA 3V4GA 1U5TA 4XFHA 2Q1ZB 3OTFA 1NZCA 5LHGA 2W84A 1FPQA 3BP8A 2OYZA 2VC1A 1USSA 1FT9A 2XAHA 4X6RB 4LTAA 3E5XA 5E1XA 1ZRCA 2IA2A 1D8JA 5BOXA 2GWRA 1H1MA 2PYTA 4MGKE 1TNTA 2L02A 3SMHA 5I8YA 2GIVA 2E1CA 5E16A 3DPLC 2PJPA 2HGCA 4LMYA 4ASNA 3BWGA 5D5VB 1J58A 4Q0UA 1FZPB 1HW5A 2XL7A 5CLSA 5K5RA 2O1QA 3SXWA 1C0WA 5FFXA 2Q4SA 3NJZA 1YYVA 1EH8A 1SD5A 2M8EA 4JVAA 2GAUA 1HKTA 3CTAA 3ZMVA 2OZJA 1ZNPA 2ZFWA 4XFAA 5C8WA 2DQRA 3FMSA 1STZA 2Y48A 1Z6RA 3UKNA 4MX3A 1SMYF 3PLQA 4P5OA 2PFBA 4IEOA 5HLGA 5KHJA 4MGIE 3FXQA 5E1ZB 1IXCA 3WE3A 4HSLA 2DK5A 5LRRA 4CZZA 3U10A 5FLXZ 5DD4A 2XLGA 3L2CA 5E1WA 3DFGA 2QM3A 2OA4A 1O5UA 4RB1A 2GQQA 2Z2SB 1TQMA 3IL2A 1QZZA 1CF7B 1Q1HA 1XDSA 1KQ8A 5BV6A 3H3UA 3F8FA 3WU0A 3GLXA 2CG4A 2ZMEA 3FHIB 2O8QA 3CUOA 4NB5A 1B9MA 1F1ZA 2OA2A 5CJ9A 2QQAA 4NQWA 4D7TA 5DV5A 1SD6A 3L09A 3BDDA 5ILSA 2QVOA 1T39A 2M87A 3QP6A 4I2OA 4YSFA 1TLHB 3KP4A 5FLIA 3F8CA 2RDPA 4OIRF 2ACJA 4M72A 2IXHA 4FAHA 4IXAA 2NYXA 1GQGA 1TTYA 4IJAA 1EY2A 5D1IA 3CO6C 2RN7A 3I53A 2PQ8A 1YW7A 2ZKZA 5BQTA 4M71A 2LNBA 1BOAA 3C3WA 4XRFA 2Z33A 3ZMDA 1EH6A 1FBUA 1YFYA 5DEQA 1ZZ6A 3K2ZA 3I4PA 1XGSA 3M7GA 4HOBA 3NL1A 4RB3C 2XKPA 1OMIA 5LHHA 2EV0A 5F6FA 4RB2C 3RYKA 2E7WA 4TLFA 2PAEA 1JHHA 3RKXA 3GFIA 1CF7A 2QENA 2HTJA 1FYMA 2HWVA 4Z07A 1KU2A 4PJYA 4P9GA 3IC7A 4LLOA 1R7JA 4KIFA 5I0SA 3DV8A 2CQKA 2D40A 2IC1A 5EEHA 3ZPLA 3H1MA 3QRFF 1DP7P 4IPAA 4UVBA 4LB6B 3K0LA 2UYAA 1K79A 1H9TA 2M1BA 1I27A 3R61A 2B9UA 4HAMA 2P6TA 2FBIA 2EVXA 3KGZA 4ZU5A 1PP7U 2H0VA 3Q9VA 4R1HA 2XLFA 3GFLA 4AVPA 3IRQA 4PCQA 3GWZA 3RZZA 2Q0OA 4IEZA 2R7FA 4ZYHA 3O2PE 4LK1F 2H27A 2EJRA 3RPQA 1UIKA 3F23A 4HSJA 1KQ9A 3V8LA 1TQPA 4Q0QA 2HYGD 2QNKA 3COAC 1SD4A 1F4KA 2JRTA 2DPUA 4J1WA 2WC2A 3UKTA 4DNCA 2DTRA 3U1DA 3BOQA 5BPDA 2QZ8A 5KVRA 2R7DA 3M8FA 1E2XA 3E5QA 3V7CA 4EWDA 2KIUA 4HX8A 5H6QA 5HS7A 3FFQA 2VOOA 2UWMA 3QACA 4IEXA 5J7MA 1OYIA 1OYWA 3UKVA 1G6NA 3WTTC 1X8MA 2G7HA 3EJKA 5LGNA 4RGSA 5ICCA 5AIPA 2A68F 3TO9A 1L3LA 2IA0A 2XAJA 4F7ZA 1P6RA 3EDPA 1XGMA 3R60A 2W85A 4HDUA 4EJTA 1MD0A 4ESBA 4P96A 1A04A 3VB2A 2PHDA 3E6MA 3P9IA 1JXSA 2DO7A 3QAHA 4IEPA 3LFKA 2J5OA 4A5NA 4H0EA 4KICA 3FXRA 2EFNA 1F5TA 4JBAA 3T8TA 4QLCU 3CDHA 2W24A 3GFMA 2RKHA 2H6BA 4HA8A 3I64A 4KYWA 3EQEA 5JI6A 2JT1A 4MGYE 4ESFA 2XGXA 5D5WB 2COMA 2PEXA 3WODF 3WGIA 3HSEA 2OD5A 5IT9Z 3JAMZ 2CFXA 3PQJA 3KZYA 4HMZA 4YIIA 3DP7A 2GZWA 3IHUA 5LGTA 3J81Z 4IERA 4OMZA 4A0ZA 4HF1A 3CUQB 2OAZA 5FLJA 2STTA 2GU9A 4ZU7A 4G7OF 4XLPF 3WTYC 1B59A 4ZZDA 4MTEA 1ZZ7A 5D6FA 1OFNA 5FLHA 2XROA 2HS5A 1OD5A 2IXKA 1FNNA 3RTRA 4IHTA 2XL9A 1P2FA 3IDCB 4NVPA 4YG2F 1SFEA 1IN6A 3ACLA 1ZLKA 1UHMA 2YX7A 4LEJA 2V09A 3F21A 3JTGA 2RGVA 2CWEA 4CYDA 3LAPA 4HV5A 4ORFA 2WTEA 2E7XA 4BIFA 5HS9A 2L54A 1Z05A 4BAYA 1P92A 1G3YA 4MUVA 3VEPA 1UCRA 2UXNA 1S3JA 1UD1A 2ZJ2A 3NVCA 3NKTA 5DUKA 1VP6A 3CUQC 1KU7A 1JE8A 4GGGA 1FP1D 4IEQA 4EWAA 4KA4A 2ET1A 1LDDA 1SFXA 4LG0B 3S7EA 5J48A 3RKWA 4J1XA 1ZVFA 3IWZA 1ZARA 4WXDA 5I8TA 3HOTA 1H9GA 2D45A 5EEGA 2OPKA 1R1UA 4KDPA 2HFHA 3FE5A 4M73A 4ZYGA 3WTXC 3CUQA 4GCVA 1AWCA 4WXCA 2HOEA 2VE8A 5LLQA 3N4MA 1MJAA 4CHUA 2GH2A 4U88A 4IEYA 3QU3A 2A3SA 1FP2A 4UHTA 5FLXK 3V8JA 1AOYA 3QP5A 4PIZA 3KP5A 3VOEA 1YW8A 5JVTA 5J8FA 3SHFA 1EH7A 3FWEA 3B02A 1R5GA 2Z3YA 2VPVA 3RYPA 5HI0A 3F22A 4ESJA 3E97A 4YIFA 4A0YA 4WK8F 3CEWA 3BALA 1B4AA 2ZNYA 2RC4A 1IRGA 4WF2A 4Q48A 1XMAA 3RKYA 1DPUA 4MEXF 1O5LA 2O8XA 4HN0A 1SMTA 4FX4A 3ZMUA 1Z7UA 4ON0A 5EFUA 5DCMB 4XFFA 3ZN0A 2IA1A 4GYIA 4RS8A 5K1YA 4N0BA 1YS6A 1J59A 3J80Z 2EA4A 1U78A 4LG0A 2QVSB 3EQLF 4HX4A 2LF8A 2M5WA 2VECA 5LBQA 2VC0A 4XF0A 5DD8A 3WE2A 4QX5A 1L3JA 3DN7A 4I09A 2D2WA 3FJSA 3CL1A 3HIFA 4EQQA 1YLFA 1B9NA 3OV8A 4I7HA 2FMLA 2P17A 1FXZA 4D7SA 4GO1A 3ZQ7A 3MEXA 2A07F 4PZJA 1O7FA 4HQMA 4XEZA 5D4SA 5L3CA 1YFXA 3HRSA 4ZZLA 3U9GA 5FGMA 4OFGA 5HLHA 4O9GA 1IN4A 3BPZA 4XFGA 1KU3A 5BMZA 4UXNA 4O3MA 2ETEA 2D1HA 4EGYA 4KU7A 1I6XA 4LUMA 5L3EA 4UNOA 4TV7A 2QLZA 2ISYA 4R79A 1HKSA 4QM8A 1P4WA 1R1VA 3JZVA 3PQKA 3IRRA 3PNAA 3FM3A 2DK8A 2F2EA 2B8MA 4Q0SA 3HTSB 1R58A 4OU0A 2MHFA 1YG2A 1PDNC 4A6EA 3FXUA 5DCMA 4WZCA 1D3YA 3IDBB 4NHJA 3SQNA 2D1VA 2F5EA 4Q29A 1RUOA 3GW2A 1FYLA 2IT0A 2NS0A 3EUHA 2DCTA 1HW1A 3E3VA 4WWCA 3T0YA 2MNGA 3T1BA 2C6YA 1WRJA 5A2QZ 3SCFA 1UCXA 1S7OA 4ZYDA 4YFKF 2XAGA 1FSHA 2PG4A 4WBBA 4Q0PA 1MGTA 2FMYA 1S29A 3ZMZA 3DF8A 3GO5A 1D5VA 4UVCA 2HQRA 4KWJA 1BC8C 2UY9A 4M9SA 2BBYA 4KMFA 4AVBA 4AQ6A 4OIPF 3RDIA 1W7PD 1CAWB 1Z1DA 2K4JA 2JPBA 3LWFA 3DXJF 5CVRA 2IXCA 4UV9A 2GXGA 1L0OC 5E8IA 4META 1XSXA 2FBKA 4RAZA 4U7BA 5E20A 3MQ0A 3OGJA 2GC2A 2P7VB 5AONA 1WKMA 5BS6A 3HQXA 1YLLA 5E17F 1WWXA 5CVVA 2RQPA 2XAFA 3N97A 5JCTA 2WWYA 5ILVA 1H0MA 1SAXA 4JQFA 3M8EA 3VHRA 2MBFA 1S8NA 3KE2A 1XSDA 2F4PA 3VODA 3JSPA 4BHCA 3HSRA 4KN4X 2PAKA 1O4TA 4MGRA 4AWXB 3KSCA 3RNSA 3TOBA 2G7UA 2K4BA 4LB5A 3LA3A 3ELKA 3V7RA 1ZGAA 4EJUA 3WW4A 4MTDA 3FF5A 1I5ZA 4XLNF 3SZPA 1ZG1A 4HF2A 3KZZA 2FEZA 2EFOA 1O3SA 1U2WA 3OOPA 1CAWA 2O3FA 2E9QA 4GYGA 1R23A 3M9AA 5IT9K 4EVIA 2XLAA 1T6SA 5E18F 4EGZA 2MLKA 1G4DA 5T3NA 5HS8A 3B73A 4IEUA 3J81K 1J5YA 4O5VA 4HLTA 2BGCA 2NAZA 5J8CA 1HQCA 1BM9A 4A0XA 3TKYA 2AS5F 1RNLA 1S7AA 4MGZE 2D5HA 1OPCA 2FXAA 4IVNA 1J2XA 4LLNA 2VBWA 1QBJA 5L3FA 2XHKA 1IF1A 2GA2A 1ZZ9A 2VQAA 3F8BA 1WGPA 2HYFA 3H8UA 3BB6A 1BIBA 3T8RA 2GA1A 5FD6A 1U6GA 2A6HF 2IJLA 1HBXG 5I91A 2DU9A 2YR2A 4U0VA 1YTYA 3SXYA 4DINB 2KIFA 4RGXA 5LEJA 3WU1B 4JTNA 1OYYA 3KLNA 2FNPA 4A12A 3HSFA 4OIQF 2VBZA 3H9AA 4HDVA 2EFWA 1CGPA 3RIRA 4YFNF 3MPBA 4Y17A 1DUXC 5L3DA 1QXJA 2BNNA 1NYWA 1CAXB 3D82A 4RB0A 1YWKA 1LR5A 3CLOA 3GYHX 3TO7A 2PAMA 2J5PA 3BU7A 2OQRA 1K7AA 5FD5A 5L3GA 1ZZCA 5J3UA 3HRMA 4KWLA 2P6SA 1FBSA 5JSRA 1ZGJA 2VODA 3ZMTA 3NEUA 3E6BA 3QPTA 5D5XB 2NRAC 2ETHA 3SCGA 1WA4A 1QGPA 4GULA 2HKOA 2QCSB 3ZDSA 2IW5A 3GZ5A 1ZRFA 4BH9A 1LDJA 2Z5UA 3FX3A 2V6CA 1XMKA 2Q0AA 3F6VA 4R52A 4EWEA 2JZYA 2EAAA 2CO5A 1PM7A 4FT8A 1VR3A 1RI7A 4MHGA 3MFKA 5I8SA 1ZLJA 1RIOH 4YARA 4KIGA 2H6CA 2UZKA 1P4XA 2ZCWA 1BJAA 2HDCA 2QYOA 2A6EF 3ULQB 2WFPA 1QPMA 4HVRA 4HX7A 2IXIA 1TW2A 4IRIA 1Y3TA 3KP2A 1OKRA 5KHHA 3P9KA 4I0BA 3EO6A 3J80K 4LK0F 1SFUA 1BI2A 5I93A 1LVAA 4XFIA 1IN7A 1T98A 2V9VA 4L9TA 3KGLA 3NRVA 3HYIA 3M3IA 3TOAA 5J6XA 5JSOA 4WX9A 1O57A 4ENJA 4AVAA 1PMIA 2VXZA 3QPHA 2K02A 2GC1A 4U0WA 4JV4A 5D4RA 2DPDA 1XGOA 4QMAA 3W6KB 1XDUA 2EA7A 1UFMA 4L9NA 3ERED 3F3XA 1JHFA 1RC6A 3P7NA 3T5XA 3S0MA 3AAFA 2DLLA 1TW3A 2F5DA 4HN1A 4AVCA 4IRGA 1J75A 1G3WA 3WTVC 2Z9OA 2IPQX 4A2UA 1UIJA 4AIKA 1QNTA 2IXJA 1W5SA 2W57A 3GBFA 1R1TA 3F8MA 2HKXA 2QQBA 1ZG5A 2QWWA 4QM9A 4G6DA 4XFCA 4PDKA 4HV6A 5JFRA 2BV6A 4CICA 2Q2EA 5ICGA 3GVAA 3KP3A 2V1DA 1J3QA 2PBIA 1W4MA 3FZ3A 1GXPA 3I0TA 5FFZA 5FB2A 1EV7A 2P5LC 4Z2YA 3LWCA 3QOPA 3HRUA 3OF1A 3U0ZA 4OIOF 3DQVC 4Y15A 3H1YA 4I01A 4UUVA 3JW4A 1DGRA 3C7JA 4L18B 1FWZA 1QWRA 4UBHA 1FBQA 1WQ2A 2OQGA 3KETA 3D0SA 1X82A 4CXFA 4BYYA 2B5HA 3C3VA 2F5FA 5A2QK 3LQRA 1Q43A 3G73A 3FMQA 2EK5A 2W25A 1IW7F 1I1GA 1K6OA 5ILUA 1RZ4A 4A5MA 1Q3EA 2MA3A 3DPTA 3SZTA 2GC3A 4OINF 4QGMA 1IUYA 4EJVA 4KU8A 1EPZA 5K5QA 4GXOA 4LA2A 4CGZA 3H7YA 1FI2A 2CV6A 5E8GA 4R8HA 4BHBA 2GC0A 3BJ6A 1KYZA 5BPIA 3WTWC 1J3PA 4E70A 2D5FA 2EFQA 3TO6A 2XAQA 4ENNA 5F64A 2HJIA 3C1DA 1IXRC 2XV4S 1G3TA 1DPRA 3L7WA 3BY6A 2ET7A 2JPCA 2HQNA 1J9IA 4AD9A 2IP2A 1YIOA 2M45A 2OU2A 2X4HA 4XF3A 2EFPA 3CF6E 3ML6A 2IXLA 2P8TA 3CLPA 4KIBA 5BXXA 3GF2A 2PMUA 1YQAA 2K0GA 3FHZA 3O14A 1K78B 1IPJA 1LKNA 4EROA 4L5JA 2C0ZA 3OD0A 1HSJA 4S04A 4CO8A 4L2NA 4EJOA 4LGWA 3HOSA 2XASA 3KFWX 3C18A 2EB7A 3O3KA 3IBMA 2O0YA 4N9IA 2HR3A 2P4WA 1EYBA 4PGGA 4MNUA 3JTHA 4EV0A 4M6YA 2YU3A 3WTSC 1OR7A 1DZTA 2FU4A 1SEFA 3FZVA 4ENKA 1HSTA 2OBPA 1ZH5A 1QQIA 1CAUB 2FBHA 4YFXF 4G6QA 2L3DA 2ISZA 4H7LA 1JGSA 3CJNA 1QY4A 3DL3A 5KBFA 1BBYA 2L4AA 1KQ0A 2X0LA 3FM5A 2FRHA 4EM1A 2K7LA 3L2HA 4Q4ZF 1O3TA 1ODDA 1LEBA 4RGUA 3WW1A 2D93A 5HVQC 2Y0OA 4M6XA 3ES1A 3BCWA 4XF1A 4N9HA 5HDKA 1P4AA 5CVUA 4OMYA 1R36A 4L0ZB 3H1WA 2FF4A 4QGNA 1VTNC 3ELNA 1MJBA 3KP7A 3D5LA 3WGGA 4EJWA 1K78A 5JSPA 1ZAOA 4HYEA 1J1LA 2ZNZA 2LSOA 4KN7X 4O6JA 4LA3A 3M1EA 2LDUA 1YHFA 4XETA 2CSOA 3SHRA 4RGRA 2MC3A 3PVBB 3JSOA 1UB9A 3KCCA 3Q5FA 5FQ0B 2EWNA 4HQEA 5TRDA 4IETA 4P9UA 2VT2A 4HZFA 1U3EM 4HBNA 1ONVA 1G3SA 2LKPA 4U7DA 3EBRA 2Z99A 3IWFA 1BC7C 2V1UA 4M9XA 2BNMA 1CAUA 5I0RA 1NXMA 4PIYA 3IKTA 2VN2A 1X7NA 5BPXA 3I59B 1Y0UA 2NNNA 2MD5A 2F5CA 4BXUA 3KEQA 2VOPA 4HLYA 2FE3A 3FMRA 3TGNA 2CYYA 4D0PA 3K9TA 2VE9A 3DEUA 3TDUC 5KHKA 4K8FA 2ZMEB 3ROUA 1R5HA 3ABTA 3REOA 1FYKA 3PFIA 3ZMSA 1LNWA 3S7IA 1GHCA 1FSEA 1KGSA 3LA7A 3D0JA 4FAGA 4AXOA 3IIAA 3K69A 1J7KA 4AIHA 4MEYF 3MYXA 2VBYA 1Q5OA 5C6CA 1U8RA 1BIAA 2E1NA 2G9WA 5FPXA 1ON2A 2PMHA 4M74A 3U2RA 4F8AA 4B09A 1UPIA 1GQHA 2BE5F 2FOKA 4E2SA 5FQ0A 2PN6A 1YO5C 4WXHA 3V7SA 4E2GA 1WSUA 2PHLA 3TDZC 4AIJA 2L01A 4KL1A 1B6AA 2L4MA 3E5UA 4L9JA 5FCCA 1EP0A 1J0RA 4ZH4F 4LUKA 4HW0A 3MZHA 5HOOA 3R6SA 2DQLA 3HRTA 4KT5C 3BZ6A 5D8KB 2FNAA 2N7GA 1TQ5A 5D8LB 3I59A 4HVQA 2CGPA 2UXXA 3I71A 4B29A 2RNJA 4IHSA 1FLIA 2VONA 5ERIA 3RI4A 1FOKA 3BROA 4JTOA 2CAVA 4XSZF 2NNYA 2ESHA 4HLXA 2EV6A 3USSA 2CAUA 3WG9A 2FQPA 1QXRA 5DCFA 1T0FA 1S6LA 2QQ9A 4G94A 5DDGA 3R0JA 3JAMK 4Q47A 3MZYA 1I1SA 1XE7A 4K2EA 2KKOA 3HTUA 3LZZA 4UBGA 1WLTA 5CVIA 4KNYA 1Y9QA 3EETA 4MH0E 4PGHA 5CVJA 1XGNA 1KU9A 3E6CC 3SCHA 4M9ZA 3WGHA 2M30A 5IT3A 1CX4A 4Q0VA 4QWQA 3WW2A 2IVMA 3P9CA 4ONUA 3NW4A 1NE6A 1SQ4A 4XBFA 2Q8KA 4I02A 4MQVA 5D5UB 5ICEA 4XSXF 3H3ZA 1IPKA 3WTZA 3HT2A 3K1PA 3M70A 3I5UA 1XCVA 2PFWA 3H50A 1PP8F 5LEKA 2IRFG 3ES4A 3KEOA 5CADA 4MQ9F 2KIMA 1B1BA 1QO0D 3TNQA 3K1MA 5EZWA 1O7LA 2FA5A 2O03A 1ZYRF 4Q5SF 4L11A 4ZYEA 1GXQA 2MPFA 3O6BB 3Q9SA 3F8NA 4QXKA 2XVCA 3HUGA 3V8KA 3VFZA 3KMHA 1V4RA 1TNSA 3NQOA 4LD5A 2MLGA 1R22A 3EYIA 5ED4A 4IEWA 5JR7B 2A5YB 3OCPA 4EM2A 2ZBKA 5LHIA 2JSCA 5FDBA 5KHIA 4RD7A 4P9FA 4E2QA 4KMUX 3F6OA 1YS7A 1ZRRA 3H7JA 4G7HF 3L00A 4LLLA 2QDRA 1BI0A 2DFIA 1F9NA 4OOIA 5H20A 4S05A 2K9ZA 1JUHA 5E1RA 5HLIA 3GFJA 3RJPA 3GYDA 3R0AA 3BPXA 2KRFA 5FO5A 5JR3A 4WVZA 4EMSA 1XD7A 4YRDA 1WI9A 1YUDA 3S2WA 1YFWA 5LGUA 4WCGA 1XCBA 1KYWA 3KP6A 4JK1X 5KHGA 1XSVA 5HDGA 1DGWA 3I58A 4OLLA 2OZUA 1PUEE 1X3UA 5FPZA 1MZBA 5AVPA 2HZTA 2VT3A 4FX0A 3HHGA 1LQ1A 1MJ9A 2V79A 1IAWA 1Z91A 3MDPA 1ON1A 1CAXA 1H1IA 3EHKA 3ZP5A 2LF7A 3CO7C 2RVCA 5I0TA 2A61A 2RV8A 4L5IA 1REPC 4FHTA 4I3PA 1ZREA 1CAVB 3H92A 3I7DA 3LAGA 1NHAA 1HXDA 2KXLA 2HTSA 4UVAA 3LAJA 3GXOA 3GX4X 4UXAA 4HF0A 1V70A 2H94A 1LDKB 4U0YA 1V3FA 3WTUC 3I54A 2B0LA 4ENMA 3QU6A 2XIGA 1ZHFA 1ZRDA 1IRFA 1BN5A 2EA2A 2KJBA 1U12A 4CDGA 1Z6TA 1FC3A 3F72A 2ZO4A 2ELHA 1T2KA 3WW3A 5H6RA 2HEOA 2PQQA 2XUBA 1UHWA 3SFZA 1W5TA 2K27A 2DAOA 4BQAA 2Y0MA 5HDNA 1IN5A 2Q30A 2YX4A 1RL3A 3U11A 4ETSA 5F1RA 5JAXA 2QJVA 3J7AO 1YFHA 1UW8A 2ADUA 1RTVA 2FSWA 2TDXA 3ZN1A 1LRHA 1QZYA 3R4KA 2UY8A 2XRNA 4UV8A 3CJXA 1LB2A 2VBXA 2PA7A 4YNIA 2DT5A 1MDMB 2P5KA 4P55A 2V1XA 1E17A 4G7ZF 5DYMA 1DDNA 1D8KA 3NSTA 3CO2A 1R00A 2ZXJA 1CAVA 4Z82A 4YYOA 3MAJA 2BEOA 5LRSA 2K86A 1HKQA 3G3ZA 4KFCA 2P7CB 2XKOA 4FBFA 4ZU4A 1BI1A 1HW2A 3LOIA 3ECOA 2ZKLA 1ULYA 3MWMA 4MZUA 2OZ6A 4G9YA 2YSRA 4KWKA 3E6DA 3RYRA 2QUFA 1ZX5A 4KUMA 1FY7A 2ATFA 4HVOA 4BNCA 1DZRA 1XRUA 2JTVA 2GXBA 4IEVA 4LJZF 3IKVA 5BUVA 2DI3A 5K8SA 2CW0F 2ESNA 1RGSA 3GZ6A 4XF4A 3ISPA 1W7PB 2YPRA 1ZZ8A 2MH2A 1SFNA 3K1NA 3GUDA 4XFBA 3HT1A 1KA8A 3LA2A 5D6EA 1IXSB 4I0AA 1XN7A 2Y75A 3ETQA 2AXLA 4L9VA 4AQ2A 1FX7A 3ABUA 4L0YB 4RAYA 2FQ3A 5BY5A 1X8EA 2DW4A 1MDMA 1ZN2A 2P5VA 3TQNA 5I0UA 1TBXA 2O6GE 3BJOA 3ECHA 1IN8A 1ZZBA 1T38A 4IESA 5CU1A 1BI3A 3GEZA 4EM0B 2R3SA 5DUIA 2QBYB 4LLGF 1GVJA 1U5TB 4MV2A 1USTA 1Z9CA 2EV5A 4BHPA 4XF9A 4G8XA 4A6DA 5AIQA 3L9FA 3HHHA 4HBLA 2I45A 3BJAA 4B8XA 4I98B 5KK1A 3RPUA 5CYVA 1NE4A 3KLOA 2O61A 2PLYA 1MKMA 2STWA 1W7PA 2PI0A 4LULA 4IF4A 1XB4A 1J3RA 3G7DA 1OI6A 1LEAA 2MH9A 5K5OA 1RUNA 2WV0A 1IZ1A 5JHUA 5TJJA 4X6QB 3DKWA 4DQ2A 3ST7A 2DBBA 3TNPB 5L3BA 1TQIA 2UYBA 3MCZA 5ICFA 1LJ9A 3BPVA 1U5TC 4LFUA 1ZG3A 2BNOA 2KJCA 2A69F 1VJ2A 1O3RA 4PIXA 2PTMA 1O3QA 2BYVE 1YW9A 3LQQA 3LSTA 1SD7A 2H09A
chains in the Genus database with same CATH superfamily
2Z69A 1NUKA 3EYYA 4IHYA 4IRHA 1UY4A 2W9XA 6PAXA 5L9BA 5A6ZA 5BNOC 4XFHA 3OTFA 1HB4A 4CCMA 1BEV1 3OIPA 2JDUA 2W84A 5FYCA 5FR3A 5D8AC 3TAYA 2X9DA 2RDQA 4C2TA 5AFBA 1USSA 4X6RB 5LK5A 5E1XA 2X5IC 1W39A 3POWA 2TEPA 1FOYA 1CWPA 4IQPA 1TNTA 2L02A 3OY9A 5FKMA 3BG5A 1F5JA 1WW7A 2GIVA 2RMU2 4AFDA 4LMYA 2M4KA 2QKLB 5M0TA 1J58A 2GOXB 1HW5A 5CLSA 1C0WA 5FJKA 5FFXA 4ANJA 2X5IA 2NS7A 2Q4SA 3ZOBA 3BCAA 1EH8A 4UW3A 1SD5A 4V1PA 1HXS1 2VCAA 4S0HB 1R49A 4XOGA 2DBNA 3ZMVA 4V2VA 3GTJJ 3B00A 1D2SA 2ZZJA 4XFAA 2R7XA 1VBE1 2W4SA 2Y48A 2VNGA 4IKFA 3UKNA 4MX3A 4C30A 4P5OA 2VQUA 1VQ9I 2HH9A 3VDBA 4MGIE 1VBA2 2WDBA 4CDUC 3FXQA 4Z1VA 3WE3A 5LRRA 1W04A 2QDNA 3L2CA 2XGEA 4BQ5A 2RMU3 4GMP1 4MHRA 4MVTA 4Q5OA 1ETOA 3Q0UA 4NPMA 1O5UA 3OY8A 2C4XA 3HG9A 1VPHA 4D6SA 2W2IA 1DQ6A 4ASMB 3I3DA 1J1TA 4JDOA 3H3UA 4NHLA 3F8FA 1HLVA 4CDUA 2WY7Q 1JYNA 1MACA 2JDPA 1BQPA 2W1WA 3FHIB 2O8QA 4ES8A 1B9MA 4RLFA 4FP2A 2OA2A 4AR2A 5CJ9A 2QQAA 1YNAA 4XRMA 4D7TA 5ILSA 3BDDA 2QVOA 4BQ2A 3ZFFC 2MG4A 1LVKA 1XBFA 1W3XA 2M87A 2E7TA 5IUQA 5FRNA 1MBHA 1VBA3 2ES3A 3A0NA 3KP4A 4QU2A 2ACJA 4YW5A 5FLIA 5FMOL 2QQIA 1ENRA 1EY2A 5D1IA 1LKXA 1VB2A 2ZS6B 1OQDA 3MV11 5DG1A 3HOZJ 1YW7A 3JXSA 3LEIA 3BVCA 1BOAA 1CR7A 3HJEA 2Z33A 1FBUA 3X2QH 1Y1VJ 3HN1A 4E7KA 3K2ZA 3DTEA 1IG3A 4XZUG 3BN6A 2WY8Q 4HOBA 4RB3C 4XJWA 1GOFA 1OH3A 1RYYA 1X4OA 4MFEA 4AC0A 3AYDA 4C2MJ 2LLKA 1W0TA 2DMNA 3H5RA 2LBFB 1FYMA 2HWVA 1QJFA 4P9GA 2W46A 3SH3A 3CCVI 4EJRA 1KFUL 4JZRA 2CQKA 4XBNA 3H1MA 1V9U2 5FZ9A 1DP7P 4UVBA 1W6PB 3GJBA 1AKHB 3FL7A 2H0VA 3Q9VA 2DMTA 4AVPA 3GWZA 2R49A 2HWC1 2V73A 1W28A 3TP0A 4BQ3A 4LK1F 2EJRA 2WAFA 3AMNA 4UF0B 2QNKA 4AHYA 3ZFGC 1KITA 1C4RA 1N1YA 3OS1A 5EJ1B 2JRTA 3EXUA 4J1WA 3UKTA 2DTRA 3CJIB 4OVEA 2H8WA 3E5QA 4AEJA 1Q56A 1WHUA 3V7CA 4YFZA 5K0UB 2GIZA 2WFF1 2KIUA 3FFQA 3VKLA 5H9RA 2MYSA 4RQPB 3ZFGA 2XBO2 4FTSA 1OYWA 3S3OA 1ENSA 4G9SB 3WTTC 1FJLA 1KEXA 4M3CA 3VYTB 3ABLH 5FMOS 3EJKA 1N3OA 2Q1MA 4II2A 5AIPA 2QSHX 1X3ZB 4F7ZA 2ZSIB 1GICA 3HKZN 2QGUA 3R60A 1K5MC 2A6VA 1TWHJ 2LMDA 2OUJA 4NIDA 2E2IJ 4MHUA 3WF2A 3PVNA 2WA0A 1OCRH 3HB9A 1H88C 3SDGA 1S0JA 4A5NA 2WZEA 5FXVA 3FXRA 2HPMA 1F5TA 4QLCU 3GFMA 2RKHA 3UK9A 4DOUA 1O8PA 4DMIA 3I64A 1HQNA 1RUC1 1AHDP 3IKWA 5JI6A 1K5MA 4XKBA 2XGXA 5D5WB 2COMA 5J4VA 1I50J 5A33B 4S2FA 3AG1H 4RN5A 3THTA 3WODF 2OQ7A 3AJZA 4AI0A 1AR82 3WGIA 2XBO3 3CBNA 1OQEA 4QIWN 2ARXA 5IT9Z 5FK8A 1XYOA 2P2KA 3IHUA 5CZKA 3E0JB 1N78A 4A0ZA 3MW3A 4XILA 4LPLA 1RHI2 4CP2A 2ZGUA 5FLJA 2STTA 4QPIB 1K6YA 1OLMA 4PSXA 4XLPF 1AYN1 1W2OA 1Y1WJ 4UWDA 4F3JA 1L7LA 4BPZA 2YU2A 3J7HA 2EICA 1P2FA 4NVPA 2YX7A 5A70A 3JTGA 2AREA 4HSRA 1F8VA 3LAPA 4JX5A 4ORFA 1ZYBA 2WTEA 1VRH2 4B4RA 2Q8CA 1VQ8I 5IK4A 1FMVA 2HXIA 2Z16A 5HS9A 4XLEA 1Z05A 3VEPA 3VBFC 5DUKA 1PVC1 5EV7A 4JRLA 1H2KA 1JE8A 4EWAA 4IV1C 3GTKJ 2E31A 4LG0B 2C5DA 1YITI 5J48A 4XK4A 2VOXA 2EILH 1MS3A 3A02A 1RHI3 2HU9A 5EEGA 2P5BA 3VBFA 4RLQA 2DMQA 4ZYGA 2VKEA 5F08A 1AWCA 4IV1A 4ZC3A 1ETYA 2WNVB 3N4MA 2MC4A 5FO9B 4NN0A 3C2GA 1I5PA 2CUFA 3QU3A 1NZIA 3VD5A 3ZIWA 1ZA7A 4X1EA 5JVTA 5G05L 5J8FA 4WV8A 1EH7A 3JB4C 1VRH3 3B02A 2UU8A 3F22A 5FKLA 1ALYA 1SAUA 3BG3A 5LA2A 3K4ZA 2TCTA 1H4HA 4YIFA 4A0YA 5IY5H 3BALA 1B4AA 3AKSA 3ZXDA 4Q4Y3 2RC4A 1W05A 1IRGA 4IL7A 1X3WB 1E5IA 2WLQA 2RS12 1RUF2 4FX4A 3ZMUA 3HM5A 2JG8A 5EFUA 2ADDA 3VBRC 1OD3A 5K1YA 1YS6A 3RS6A 3D8CA 4FO9A 1V54H 1KXGA 2PJRB 2VECA 5LBQA 5BNOB 1PYVA 4JGYC 2Y60A 3SKVA 1L3JA 5IYCJ 4FQZA 3BR3A 3HIFA 4V2FA 4M3GA 2OF7A 2P17A 5FY5A 4D7SA 2PN5A 1IGNA 4P02B 4FE7A 3ZQ7A 1AX0A 1ULCA 4AVZA 2EXJA 2RAEA 5L3CA 3CCEI 4ZZLA 2Y6HA 5HLHA 1W03A 4XORA 1IN4A 3A0KA 2PLV3 3VHOA 2RS51 1NXD1 1W0PA 2RS13 2O8OA 1X2NA 1JUMA 2VM9A 2ISYA 1HKSA 4QM8A 3JZVA 4PDWC 3PNAA 3FM3A 3OD4A 3AL0C 2B8MA 2GP5A 5HODA 2WO3A 3DGTA 4XJAA 1JZ8A 2VZ1A 1W8FA 2ZX4A 4OU0A 3QOEA 4DXZA 3ZXKA 2VJXA 5DCMA 2R93J 1D3YA 3IDBB 1US3A 4YGDA 4NHJA 2ZB9A 3TN93 2D1VA 2AZ5A 3OYLA 3AYAA 1S9HA 1SFPA 4XJ8A 1WLDA 4OI1A 2IT0A 1VBD1 5F6LB 2NS0A 1V6IA 3RI8A 3F2ZA 4WWCA 4CUBA 3T1BA 1DU0A 5A2QZ 3DEEA 3HPGA 2L7ZA 1JMUB 5TGTA 2XAGA 4WBBA 3PUSA 1MGTA 4K8RB 4Q0PA 3KWVA 1JOJA 3SQOA 4UVCA 1MH4A 4KWJA 1HQWA 3THPA 4IGPA 4AI8A 2X6OA 4K21A 5GAEJ 1U5ZA 4DYRA 4AQ6A 1LTEA 1CAWB 1Z1DA 2KL4A 3LWFA 2WN3A 5CVRA 3RCOA 3VYRB 2XOMA 5L73A 3CCQI 2ZPXA 2GXGA 3TWIA 3JQXA 4CCCA 4GJZA 4RAZA 4U7BA 5CFDA 2FMDA 3M1HA 3ZQHA 3KEYA 1SVMA 4NWVA 5BS6A 3HQXA 3IMMA 1R1A2 5KR7A 1YLLA 5K7PA 2JICA 3K2AA 1GZCA 1JS9A 2WWYA 1ETXA 1RUH2 3P5JA 1SAXA 3M8EA 2HWD3 3VHRA 5EGOB 3ECQA 2ICWG 4BM8A 4MGQA 2R061 3KE2A 3C7GA 4UW4A 1LCLA 1JOPA 3BOWA 3S93A 3T09A 5IVYA 4GALA 5ANNA 2P4EA 4LO4B 3RNSA 1MMDA 3TOBA 4MGSA 2AACA 1ND3C 5IAVA 3UL2A 3RWNA 3OYEA 2XSJC 3JD72 3WW4A 1RESA 4HF2A 2DYSH 1U0AA 4X8NA 2ZGPA 1U2WA 4ZDLA 3WX5A 2BTVC 3OOPA 4AZZA 2YG0A 1JKRC 1R1A3 4LO8A 4EVIA 2XLAA 1ZKGA 5E18F 3KPHA 4QU1A 1G4DA 5T3NA 3BTAA 4P14A 3B73A 1RUH3 3TRSB 2ZGRA 1Z3YA 3HPHA 3QPLA 3FBNB 2AS5F 1OHFA 4AYBN 2D5HA 4TSVA 4FQGA 2R071 2E71A 2VBWA 2DA3A 2D6LX 2BERA 4E7IA 2GA2A 4WZFA 1WGPA 2HYFA 3BB6A 1FMD3 2BZTA 3K3NA 2V5DA 2ZXHA 3RQIA 2R041 2HOSA 1HBXG 1TE1B 2YR2A 4RBOA 1UHSA 1REEA 4D1QA 2VBZA 3RZHA 2BWAA 4Q4W1 3H9AA 3PURA 4ZY9A 4HONA 4HDVA 3L2UA 1PIV2 1W3VA 2EFWA 1CGPA 4Y17A 3WNMA 1CAXB 1CZVA 3BU7A 2J5PA 2OQRA 1K7AA 2BGOA 3IPVA 4YG6A 5L3GA 1RUJ2 5EYRA 1ZBA1 1WD3A 3ZMTA 3PO3J 1JXNA 5EJZB 4RAGA 2NRAC 5D5XB 1WCKA 3SCGA 1WA4A 4GULA 5E3LA 3GZ5A 1ZRFA 3FX3A 2V6CA 4R52A 4EWEA 4QQLA 3IAS2 2EAAA 2CFOA 4FT8A 1XYNA 4COYA 1RI7A 2DFEA 3MFKA 4PHZA 4KIGA 5EZGA 4JAAA 4GA9A 1C8M1 1WCDJ 3THDA 4GMP0 2QYOA 2LK2A 5C4JJ 5DZGA 1A6QA 5FIXA 4HVRA 3DPRB 1A6CA 4IRIA 2YFZA 2LH9A 3P9KA 4I0BA 3GGLA 3N7MA 5HBAA 4HKWA 2W82A 2L9LA 2VZ3A 4BDVB 3K6GA 1SFUA 2KT0A 2NS8A 4N43C 2YC4A 2V9VA 4L9TA 3KGLA 4BE2A 3NRVA 3GCXA 3AZWA 5J6XA 1SFYA 5JSOA 1O57A 1UY0A 4D6RA 4ENJA 1OA3A 4NJ4A 2QZ3A 3F3XA 3P7NA 4EN6B 3S0MA 1W36C 4IE6A 5F32A 4AVCA 1QIQA 4N43A 2AYHA 4CYCB 4B1MA 1G3WA 3VKFC 1D4M3 4AIKA 4XCAA 5FAXA 1IC8A 1BJZA 1QQP2 4PLOA 2VZRA 1ZR2A 4QKNA 2OPTA 1V00A 3F8MA 1C1LA 3V56A 3ZPOA 5FYIA 3APBA 1ZG5A 2QZ2A 2G9ZA 4XFCA 5GTIC 4CDWC 2CS3A 5JFRA 3I3QA 2BV6A 2UWCA 2W1QA 4K40A 1VLNA 3KP3A 2DFCA 1W4MA 3WD5A 1GXPA 3FDYA 5FFZA 3M3CA 5FB2A 3HRUA 4OIOF 4I01A 1FWZA 2R7WA 1ZRIA 1TL8A 3K3OA 4COZA 1HV1A 1WQ2A 2MFZA 4JGZC 3WOGA 1X82A 4GWNA 3ZPYA 1UYZA 3MIFA 2F5FA 3K4KA 4YZ4A 2VW1A 3N3HA 2EK5A 2BGPA 1IW7F 1LU1A 4F92B 4DO0A 2O5RA 3I3LA 3SZTA 2DCJA 1XU1A 3ZN6A 4P08A 5FWJA 2YROA 4QGMA 2VGDA 5H9SA 3WEZA 4EJVA 5K5QA 5A7QA 4M4PA 1WW4A 1RRJA 4CGZA 1V5EA 1OLRA 2XPUA 1FI2A 4JGZA 1KS4A 5IYYA 5E8GA 4R8HA 1FOD1 3BJ6A 3USUB 4DFSA 2QSGX 1SG3A 5B3SH 2EFQA 4ITCA 2F4OB 1TZOA 3C1DA 2Y6KA 5JDBA 3VBRB 1RETA 3PJRA 1BOBA 1H1AA 2OTJI 3PUIA 5IJRA 2ET7A 2JPCA 2CDOA 2HQNA 2J1RA 3VYUB 4AD9A 4QPIA 4BK4A 1JUSA 2IP2A 1YIOA 1JT0A 3AP5A 3CLPA 4URTA 3NO8A 3PFYA 2EIDA 1C1FA 3O14A 5IVJA 1O59A 2XUEA 2JUGA 4L5JA 4LOSA 2VY0A 5FZ3A 1SDDB 1R091 4YW6A 4NUBA 5KNLA 2ILMA 3T2OA 3O3KA 1SVOA 2HQ5A 3IBMA 1WBLA 4FP3A 1VMFA 1EYBA 1YJWI 3OSDA 3JTHA 1RUG3 1H2NA 4FPYA 5L9RA 5FZIA 2YU3A 4PDWB 4GKXA 1QA6A 1HRV1 4LR4A 4OMDA 1SEFA 4ENKA 1DQ4A 2VZPA 5FPUA 3DYPA 2OBPA 1OF3A 5F2SA 3PM1A 2A05A 1VB4A 4CCKA 2QEXI 2VO5A 5IK8A 2X0LA 2VCBA 4WM7A 4LK7A 2J7MA 3L2HA 1N1VA 1ODDA 3GJAA 3LB9A 2D93A 2WNUB 3B9IA 4N9HA 5HDKA 4Z2WA 2QQWA 2NVTJ 2X85A 1R36A 4J01A 3H1WA 3KP7A 3D5LA 4EJWA 3ZQCA 1K78A 5JSPA 1ZAOA 2ZGNA 1W2TA 4ZTJA 4Y5TA 4A45A 2LSOA 4QWNA 2LDUA 1K61A 4Y20A 3I4MJ 3LF7A 4Y4YA 3QH7A 3SHRA 3VDXA 4RGRA 4OHZA 5FXZA 4LIUA 1YQ8A 3PVBB 1UB9A 3KCCA 2CU5A 5HCBA 2E63A 2JJ7A 5FYMA 1EUUA 1IRZA 1ZELA 2E53A 4MXWA 2WT1A 1R081 1G3SA 3DPUA 3EBRA 2G1MA 3A1YA 2Z99A 3IWFA 3HKZA 1BC7C 2CTVA 1WCUA 1W5CC 4Q1PA 2BNMA 5T5JA 5I0RA 4PIYA 3IKTA 2WAEA 5GAGJ 1M06G 5BNPC 2NNNA 1HKDA 5J1UA 1SCSA 1YQ6A 2QUOA 3AFGA 3FMRA 3TGNA 4D0PA 4FE4A 3IZOA 4BBSJ 2VE9A 5FOJB 3DEUA 3TDUC 3JR9A 1OPOA 1SANA 4Y3OA 4F93B 3L1PA 4B3NA 3BI3A 4Q4Y1 1ND3B 5SV5A 4FAGA 4IDZA 5BNPA 3OYGA 3IIAA 3K69A 1J7KA 1HB2A 2JG9C 4FFGA 4MEYF 3DU5A 3BPSA 3QODA 4LBNA 2V7FA 1U8RA 1MEC1 4C90A 3U2RA 5FPAA 1R9TJ 2FOKA 2DF7A 5FQ0A 2Y64A 2PN6A 1JYTA 2DODA 1WSUA 2IXSA 4CA0A 4SLIA 4K7JA 2B63J 4CP0A 3G1OA 4HW0A 2ZMEC 5HOOA 3HRTA 1R4NB 2N7GA 1TQ5A 4L8QA 2DT7B 3I59A 2R7UA 3IH3A 2ID6A 2BQPA 1FLIA 5ERIA 1FOKA 1IUFA 2MD0A 3FK6A 3J7AY 5A3NA 2E60A 4HLXA 2PLV1 3VBSC 3USSA 3O1VA 2FQPA 1WA6X 5CKMA 2QQ9A 2IVIB 5FZ8A 5GLVA 1I1SA 3JBG1 1WD4A 4D8MA 3ZYPA 1WLTA 4NC6A 4KNYA 3EETA 5CVJA 2KMUA 1SPPA 4KGGA 2M30A 1ETQA 4Q0VA 4Z8BA 2IVMA 4PJJA 2DJNA 3P9CA 1OLME 3S1RJ 3VBSA 4XSXF 1DP3A 3ON7A 4NHYA 1IPKA 3TN91 1R64A 3K1PA 1IS4A 1JTZX 1DCSA 1COV2 2JD9A 3MLJA 4UW6A 5LEKA 1AF9A 3ES4A 3KEOA 3K70C 1B1BA 1QO0D 1KS5A 3K1MA 5EZWA 5DMYA 1O7LA 3EMRA 4TWTA 2FA5A 1BK0A 5EPAA 1X33A 4A3ZA 5FY0A 3O6BB 5ACA2 5CEHA 1PO21 4QPYA 1XNAA 3F8NA 2H0BA 3N9LA 4IOAF 2DA4A 1UG2A 3LFIA 2IZWA 1TNSA 4I76A 2MLGA 1YX5A 5C4WB 1GZWB 2ZZQA 2Y0SN 3GTPJ 4BE0A 4LBJA 2JSCA 2GNDA 2HPIA 3LDKA 1O4ZA 4JRAA 1RB8G 4P9FA 1YS7A 1ZRRA 3ZMOA 3L00A 2OIIA 4LLLA 3WP6A 2W95A 1COV3 1MNMC 4S05A 3VDDB 1QOTA 3HOYJ 3BG9A 2HWD1 2QQPA 4BOWA 3CP8A 3S1QJ 5IP9J 1RITA 5ACA3 4ATFA 3WVJA 1QDOA 4YVWC 2IAIA 1YFWA 1TP4A 5FO8B 3KP6A 4JK1X 2DA1A 2E51A 1LNSA 5JVGF 1AR71 2WZR2 3RI9A 5A6QA 5GP9A 5HDGA 4F91B 2R5YA 3ZQFA 1H9WA 3HGGA 3T08A 1C28A 4AG4A 4EN7B 1YXWA 3LFMA 3MDPA 3ILNA 2JWPA 4YVWA 1TEIA 1CAXA 5K7HA 2K85A 3ZP5A 1OOPB 2LF7A 3QH6A 4CDWB 2RVCA 2A61A 4G12A 1HA8A 1A35A 1H8VA 1CPMA 1REPC 4I3PA 2ZFUA 3LAGA 1POV3 2HYKA 5E3OA 2KXLA 1ASJ2 4M4RA 4XN0A 2B9VA 3VBOB 3J9SA 3JQWA 1LDKB 1V3FA 4U87A 2E5ZA 3BOPA 2DOAA 5FZ7A 1OQYA 4ENMA 4Y22A 4EE2A 3QD6A 1TME2 3AFKA 1ZRDA 3FKIJ 2HWE2 2WR9A 3I49A 2BFUS 4CDGA 1Z6TA 1FMD1 1HLCA 1GV5A 2LY1A 3WW3A 3OL3A 3VHPA 2XR4A 1UHWA 3OYWB 1WJ5A 2ZHKA 5T52A 2YX4A 5IFPA 4QPWA 5F1RA 1EUTA 4AI3A 4L92A 1CD3G 2R30A 3UESA 2JDHA 2KP6A 4LBQB 2TDXA 1FTZA 1V6OA 3ZMNA 3R4KA 2UY8A 2AENA 1ASJ3 2ME0A 3WF4A 2VBXA 1W8ZA 4YNIA 2P5KA 4UOJA 1E17A 3MO4A 1D8KA 3NSTA 1NCQC 1GZ9A 2CQXA 3MAJA 2BEOA 4BGDA 1TME3 3ZVXA 3HOXJ 2HWE3 4FBFA 1UZVA 4ZU4A 1BI1A 1VAKA 2QE3A 1VBC2 1JUIA 4JCKA 2C26A 4MZUA 4G9YA 1WJBA 4R4XA 1FY7A 1DQUA 1W8OA 4HVOA 3KQRA 2JTVA 4FFIA 4LJZF 5BUVA 4NBQA 4MOAA 1FEXA 5E3NA 5K8SA 2VTXA 5LY2A 1RGSA 3GZ6A 2HVSA 4Q26A 2RDSA 4NNJA 4N53C 2OX0A 2MH2A 3I56I 3VWBA 3ZR5A 3FHNA 3K1NA 2A6YA 2M3AA 4JDNA 3WQ7A 3K46A 4L9VA 2CHHA 5J98B 1LOGA 3HBZA 1Z7S2 4L0YB 3JRCA 2GMPA 1H0BA 4QHBA 2R16A 3W21A 2ARCA 2VUAA 4C1WA 3AG2H 2VMCA 1X8EA 2GSYA 5HV4A 4N53A 3GBWA 2P5VA 2FD5A 4WM8B 3WLUA 1VBC3 3ECHA 3CDIA 2V4VA 1UWWA 5CU1A 3A03A 1BI3A 3OBTA 3GEZA 5EG0A 1FV3A 3N9MA 1JUPA 4J25A 2R3SA 1OJLA 1D4M1 2ZEWA 2KDZA 1U5TB 4MV2A 1USTA 3PUAA 1Z9CA 1S0BA 1Q8QA 4A6DA 5E6HA 3L9FA 3HHHA 4HBLA 4CU6A 2I45A 3BJAA 3RG0A 3U14A 3CQZJ 5CYVA 4FPGA 5FROA 4DQAA 4MGTA 2STWA 1Z7S3 2PI0A 4IF4A 1BMV2 4AF9A 1D1BA 2XJUA 1RUNA 4HK8A 1B72B 5JHUA 3FK7A 2ECBA 4X6QB 5TISC 4QX7A 3TNPB 3TL4X 1TQIA 2UYBA 5JXHA 5ICFA 2BNOA 5DTDA 1CX1A 3TW6A 5E79C 1ULGA 1T2XA 2BYVE 1KD7A 1SBFA 3LQQA 1I3QJ 3LSTA 1LOCA 1HC8A 3GTMJ 2DA7A 4TTGA 3HDDA 3W6JB 3NWTA 1KGYA 4Y13A 3I9V2 1ULDA 2JENA 2X09A 5ABJA 2WLPA 3MHZA 5DDJ3 4FPEA 1NZCA 5LHGA 3PIJA 2DJIA 2H1KA 4XQ4A 2D44A 2OYZA 3CCRI 1W2AX 4LITA 5FZMA 2FJ1A 5FZ1A 2VC1A 4BXXJ 5FY8A 1FT9A 1MMGA 2WWJA 3O1TA 4LTAA 1UU4A 2BY2A 1ZRCA 1JYCA 2IA2A 1D8JA 1AR63 4LBKA 1WCMJ 2BHZA 2VJIA 1WH7A 3SMHA 5I8YA 3S30A 2P1BA 2VVDA 2WNUA 1D2QA 3POEA 1VIWB 2HGCA 2F48A 1EF4A 4ASNA 3G6JB 3BWGA 1JI8A 3CLQA 1TT5B 1Y8RB 2XL7A 5K5RA 5A1LA 1MSFC 3MFAA 2LS6A 1QJU3 4NQWB 4D5FA 3W20A 1S0EA 4AWDA 5FMDA 2NQYA 1ZNPA 5AC91 3E1SA 3PMEA 5KXBA 3L9JT 2XF5A 2DQRA 1Z6RA 1RUG1 1MVQA 2VJ4A 3N9NA 3PLQA 4UFKA 1U5IA 1W6NA 4D7YA 2PFBA 3O1PA 5KHJA 5LBCA 1BW6A 3UNGC 2Q8OA 5FREA 5F5QA 1Z67A 5FLXZ 2XLGA 5E1WA 3PUQA 5E89A 3DFGA 4YG0A 2QM3A 1UO9A 2OA4A 3OWTA 3ABMH 1I3HA 1EV12 4RB1A 1LJ7A 2GQQA 3K4NA 1TQMA 3IL2A 1QZZA 1CF7B 4S2HA 3RZJA 1GUUA 1X9PA 3WU0A 1WVRA 4QKDA 2IVJA 3MEPA 1X1CA 1BK1A 2ZGSA 4NB5A 4I6ZA 4CP1A 2GN7A 3OEAA 3KCXA 5CQGA 3JRHA 3W5MA 3C7FA 4BQXA 5CIRA 5DV5A 3O0VA 3P6BA 2X1DA 3L09A 5CA6A 3DKYA 4YZ2A 1EAH1 3QP6A 5DAXA 4I2OA 5F5CA 4YZ1A 3BTXA 3F8CA 1GP6A 4QPOA 3FBYA 4M72A 5C8CC 4IXAA 2NYXA 1PZ9A 1TTYA 1CJDA 2QQKA 1IS3A 2PQ8A 3ME2A 1EV13 4XRFA 3DXTA 1EH6A 3BR5A 1ZZ6A 4BLJA 1W99A 2FHRA 5FYSA 5C3EJ 4HSTA 3KT7A 4R9DA 3BGAA 1IOAA 1BYHA 5C3SA 2IS1A 1S2BA 2XKPA 2DCEA 3WNXA 5LHHA 5F6FA 2FDJA 3RYKA 2E7WA 3FXJA 3WHBA 1YI7A 2QENA 2HTJA 1W6MA 1G9DA 4Z07A 1UELB 1D0GA 3MUY1 1O4YA 3VD3A 2VB6A 1R7JA 1R6RA 1YJ9I 4GWMA 4KIFA 1VAVA 3S5QA 3VYSB 4MIMA 5EEHA 3ZPLA 1C8NA 4IPAA 1RKTA 2M1BA 3N7JA 1I27A 3GLLA 5JI7A 3HXLA 4Z92B 2EVXA 3GFLA 1A31A 3POIA 2FDFA 5FYVA 2Q0OA 3KV5A 2WWUA 3O2PE 3GXUA 3D5SC 2H27A 2AQEA 4G6TB 3F23A 1E3HA 1RVF2 1JKQC 2E6VA 3COAC 3LEGA 2E34A 2VJJA 3T3YA 1TNFA 1SD4A 4FQ4A 1DG6A 1C5HA 2WC2A 1L7QA 3BOQA 2Y38A 4B47A 2R7ZJ 4IE4A 3K2OA 5KVRA 1J83A 2R7DA 2IFWA 4NROA 1NG6A 3FISA 2AUYA 4XBQA 4O7XA 2ZMNA 2HLEA 4XUQA 5H6QA 5HS7A 1F4AA 1OYIA 3S2DJ 3BODA 1G6NA 5J1RA 2VUDA 1AYM2 1MQTC 1D4VB 2A68F 4DBRA 2DDUA 1N3QA 3O8HA 1L3LA 2XAJA 2KDOA 1UOBA 3QCWA 2R7VA 2OV7A 1C5IA 3I55I 2W85A 1VRBA 1RVF3 1MD0A 4ESBA 4P96A 2ARBA 2PHDA 3E6MA 3P9IA 1OURA 3IB3A 3IUOA 1XE0A 2YMZA 4IEPA 1JTXA 3OBRA 1MQTA 2FCVA 4DXSA 2KZGA 4AEDA 5J4YA 4KICA 1E3OC 1G8XA 3CDHA 1ULEA 4FISA 4XMAA 5B4NA 1MVEA 4QPGC 2HWF2 4MGYE 4ESFA 2PQSA 3JB8A 2PEXA 2B7EA 4JX4A 3HSEA 1X19A 1NTCA 2OD5A 4QHZA 2CFXA 3PQJA 5BYNA 3W3CA 1AYM3 3GTQJ 3J81Z 2VULA 1HJFA 1BEV2 1JH5A 4HF1A 4IERA 2XF6A 2OAZA 5FP4A 1OOPA 1RUD1 1YYNA 4QPGA 5EDNA 3TEWA 2Z1DA 4G7OF 2D3SA 1SFOJ 4ZZDA 4LO7A 4MTEA 1OFNA 2JB4A 3J26N 2P37A 2OUHA 5J09A 2IXKA 3RTRA 3DYMA 4KQ7A 5F3EA 2XL9A 1SFEA 1IN6A 1ZLKA 1AXYA 3F21A 4BBRJ 2RGVA 4P9XA 1QXPA 1GNHA 1AL21 5A3OA 4PBOA 2E7XA 1TC3C 2HWF3 3TBIA 3I4NJ 1P92A 1G3YA 1S2KA 4RYDA 1UCRA 1S3JA 3NVCA 2ZJ2A 3NKTA 5HXMA 1VP6A 3CUQC 1FP1D 3T1MA 2JA7J 4KA4A 3KS7A 1LDDA 4ASLA 2YB7A 3RKWA 1HXS2 4J1XA 4E7SA 1BEV3 1ZVFA 4XUNA 4WXDA 4GQ7A 1HB1A 2VD7A 1QHDA 2D45A 4WVMB 1VBE2 3SEEA 3FE5A 3LSIA 2A6ZA 4M73A 4K1YA 3NARA 5CG9A 3AP9A 5L7OC 2RR11 1MS4A 1MW7A 3CUQA 4WXCA 3HR9A 5LLQA 4CHUA 2GH2A 4W1UA 4U88A 5B4XA 3AC0A 2A3SA 1QEXA 1POV1 4CP9B 5FYZA 4PIZA 4LK6A 4QX1A 5FZCA 3SHFA 4X0GA 1BR4A 4NIGA 5L7OA 4CPBA 3E97A 3BU0A 1VMJA 4WK8F 2GM4A 4FOYA 3CMGA 2ZNYA 3O0XA 5A7SA 3Q8CA 3RQ0A 4YVSB 4WF2A 1HJGA 1GSLA 3OGGA 1W8UA 2VNVA 3QQAA 1DPUA 2L9VA 1LOEA 5JUVA 2O8XA 1YRNB 1HXS3 3AXDA 1Z7UA 4ON0A 2Y6GA 4XFFA 2N8GA 3IIIA 4RS8A 4UFIA 2JMWA 1ND2C 2OPWA 1J59A 3J80Z 2XJQA 1VBE3 2Y0SA 1D1AA 2HWB1 2LF8A 2EXKA 2K9NA 1OCZH 2XPJA 4XF0A 5BNNC 3NAPC 4AOCA 3TEDA 1B9NA 3OV8A 4I7HA 3ILRA 3ZSJA 1FXZA 2I5UA 3OYHA 3BR6A 4GMP3 2D6KA 3MEXA 4W65A 1V6NA 5IPAA 1OC1A 2DMPA 5D4SA 1YFXA 2Y9YA 4XJUA 2WRAA 2DV9A 3BPZA 1PHMA 4C9YA 3R4DB 4OHVA 3HNMA 4XFGA 5BNNA 4UXNA 3NAPA 1HOMA 5EIYB 5JOYA 1YX3A 1TWFJ 4HOOA 4DYQA 1AZDA 2HWE1 3HOBA 4KU7A 1I6XA 5L3EA 3THCA 5CBLA 4TV7A 2XJTA 4NO4A 2Y34A 3AM2A 2GN3A 1OT5A 4FPHA 4ZDOA 1LOBA 4LBQD 1X1AA 4MFDA 2K9MA 2VZVA 2Y8KA 3FXUA 5DUWA 3FUOA 2VQ0A 3AKQA 3SQNA 4AE2A 4GB33 1YIPA 3VBHB 4Q29A 2K9SA 1QVUA 1RUOA 1ODMA 2C9AA 1H4GA 1D0YA 4JKMA 3CMAI 2GALA 1HW1A 3DLAA 3E3VA 3VDAA 4IHXA 2TBVA 4AI9A 3T0YA 4J00A 2C6YA 1GMMA 3ZFEB 1B72A 2Q5TA 3LOCA 4ZYDA 2HWC2 2PG4A 2FMYA 4PF5A 3DF8A 3GO5A 1D5VA 3B3QE 1AHSA 2CNAA 1MS1A 1BC8C 1VBB1 2UY9A 2ZA9A 4AVBA 1RPWA 1CN1A 4NIHA 3D4KA 3RPUD 2AHQA 3MW2A 4OIPF 2CMPA 3AP4A 5F0HA 1V55H 3WQ1A 3DXJF 3V0AB 4P1WA 1YQ5A 4XL9A 3ZCOA 4LO5B 1RJ8A 1WW5A 4UV9A 3POSA 5F37A 1F2NA 1NCRB 2FBKA 2W48A 2WFF2 3MQ0A 3ACIA 4NR1A 1Q1VA 2Q8EA 4OAZA 5T55A 2RQPA 3ZYJB 5JCTA 5ILVA 1GVDA 1QMJA 1LOFC 4YFWA 4ZKTB 4A3GJ 2IWGB 2BY3A 4M3EA 4BY7J 3H3LA 3U4XA 1UU6A 2DUPA 4ZTFA 2HWC3 2I74A 1S8NA 1XSDA 2JKBA 3LL7A 5C8CB 4BHCA 3HSRA 3U75A 4Z2AA 2I2SA 1KDKA 4PSWA 1FOWA 4MO7A 5T5OA 2RV9A 2G7UA 2K4BA 4TXWA 5J1YA 1LOFA 3PIGA 2E2JJ 4QPQA 3LDBA 3ELKA 3HZJA 3A0HC 1OLTA 1FYUA 3S5AA 2ZXQA 5LA0A 1RUC2 1I5ZA 2F6CA 5FP3A 2FEZA 1O3SA 3VZNA 2WFF3 4CTEA 2CWSA 2YC2A 1UNBA 3W59A 5IT9K 4EGZA 2MLKA 2R0HA 1HRI1 1JW6A 2X10A 2YY1A 5HS8A 5DDJ1 4O5VA 3HQRA 5J37A 1HQCA 4A0XA 2M7BA 1RNLA 1S7AA 3PJYA 3LSMA 3KM5A 1ZM1A 3IN9A 4PFOA 3POBA 3RZGA 1AYN2 1X2MA 2WYSA 4ITVA 4QSHA 3CU7A 4LLNA 1QBJA 5L3FA 2EIBA 3J7YJ 1AR61 1PK6B 3OOXA 1ZZ9A 1YJKA 2GNTA 2OCEA 1U6GA 3OYCA 2LOOA 4YPJA 3AL6A 1RUC3 2IJLA 5I91A 1YTYA 1K4TA 3ZSEA 1XC6A 2ZXWH 2FNPA 3WV6A 3IH2A 3TEYA 2IUWA 1PVC2 2LROA 3MUZ1 1FIPA 5C5UA 4KBBA 1QJU1 3RIRA 4YFNF 2GDFA 3MPBA 1DUXC 5L3DA 1DIWA 1WCSA 2D98A 3CLOA 2X05A 1A78A 2PAMA 4XDOA 1QOSA 2JDMA 5FD5A 1ZZCA 2RS32 1I3AA 1K5JA 1JYXA 1AYN3 2VODA 2EIKH 2PMZN 3QPTA 1Y4WA 1VI0A 1SBDA 1FPN1 4L9BA 4X8PA 5E88A 2IW5A 5FTTC 1B35C 2Z5UA 4NDLA 3MN2A 4OUSA 2QQVA 2JZYA 1GWLA 4QX8A 4P9YA 1PM7A 2ENRA 4YW2A 4OQ8A 4KNCA 1RIOH 4XLFA 2H6CA 1BKZA 1G9BA 2UZKA 5JI9A 1PVC3 2XVKA 1HN1A 1B35A 3M8LA 4HX7A 2Q2EB 2FCTA 4CU9A 5T5PA 1Y3TA 1SFKA 3KP2A 1OKRA 4COWA 1JKOC 3EO6A 3K4MA 4LK0F 1H6XA 4NHXA 2RS33 3N36A 1IN7A 3GNEA 5DAVA 4HPKB 1NQDA 1G2HA 1WZ2A 2CQQA 2JRMA 3M3IA 1S0DA 3JCUC 4WX9A 1R1ZA 4OZXA 2M8GX 2VXZA 3QPHA 2R5ZB 4QMAA 1XDUA 4NC7A 1UFMA 4DYCA 5FZDA 4L9NA 3ZXLA 3T5XA 1UKRA 2HOAA 3RQ4A 2Z9OA 2IPQX 1IKPA 2MABA 1QNTA 5C7GA 4I30A 2GBYA 4CDQC 2J22A 2RS52 1VQ4I 4XYXA 3KIOA 3MF6A 1QJX1 2ELJA 4XDQA 2JD4A 2Y33A 1WPKA 5JZGB 4G6DA 4PDKA 4HV6A 4II3A 4HNVA 4CICA 4YM2A 1V5GA 2V4AA 2V1DA 4XAEA 4RAFA 3BQYA 2EH3A 1OFSA 2P5LC 3DBLB 2AH2A 1GR3A 3RSNA 3OF1A 3DQVC 4Y15A 5CISA 2LFBA 3C7JA 4IV3B 4AVTA 4UBHA 1GP4A 3BQZA 4G4FA 5E8AA 3AMMA 1MZ6A 4H3WA 4BYYA 3C3VA 5A2QK 3LQRA 3FUQA 3PNTA 4LBLA 3VZOA 1I1GA 4XNFA 1K6OA 1Q3EA 1RZ4A 4A5MA 5ILUA 5CFCC 2MA3A 5LBBA 4PFPA 3IMNA 5IT6A 2RS53 3JRBA 1IUYA 3J4UH 4CRQA 2BRTA 2Y0IA 3V42A 2B4KA 1PVXA 3WHUA 3DBRB 5BPIA 3HJRA 1LUJB 5IFTA 1TT0A 3Q8FA 1POGA 4RR3B 2XAQA 5CFCA 4CXWA 5F64A 2HJIA 2XGCA 1IXRC 2HEYF 5EEAA 1G3TA 5FKKA 1HN0A 1ND2B 2EBIA 1STMA 1JOBA 5FKBA 3L7WA 2WBMA 2PHUA 2E7QA 3DEWA 4XF3A 2EFPA 3ML6A 3D5RC 3DUIA 2IXLA 2P8TA 2DA5A 4KIBA 3OUHA 3GF2A 2X6XA 2K40A 2R062 3RJRA 1YQAA 1Y9MA 5JLWA 3OGSA 3UKGA 1L7RA 5AFEA 5B5EC 3IAM2 2VTXJ 2C0ZA 2ZX3A 4L2NA 2Z4FA 3CZUA 4EJOA 4LGWA 3HOSA 5JIAA 1MNDA 2XB6C 5JIUA 3UGGA 3C18A 3Q9OA 4RS5B 4LLFA 2HR3A 2B45X 1A3KA 3OYNA 1HV0A 3N9QA 4KBZA 4EV0A 3J7LA 4NAOA 4D9JA 4FOVA 4H7MA 2D3PA 5J36A 4OYUA 3ZXAC 3NNMA 4DZPA 1QQIA 4A3EJ 4AI2A 1CAUB 1OSGA 2FBHA 1BBT1 1W6QB 5DZFA 4YFXF 1JN2P 1JGSA 2AXTC 5DM7F 3CJNA 1QY4A 4L5EA 2R063 3I2KA 5KBFA 5FYTA 2VXDA 4K3UA 1KQ0A 2C24A 2HBTA 4EM1A 2ZACA 5CG8A 4RL7A 2R072 3VZKA 3GCWA 1JU3A 4AAPA 2E1MB 4ZPIA 5CVUA 1XPXA 4HEA2 2FF4A 3ELNA 4GZ9A 3S14J 4GKYA 1J1LA 2R042 3VBUB 4YVSA 4O6JA 2HWF1 3SLIA 4BK5A 4Q4W2 3GZEA 1YQ2A 3LSEA 4PJNA 3JSOA 2VMGA 3WQ0A 2RREA 4HQEA 3A0BC 4EN9B 3A4UA 1MBEA 3OBZA 1ONVA 3LEKA 2EAKA 1DGRM 2WS93 2LKPA 1ZBA2 5J47A 3DECA 2R073 1CESA 3ZXSA 2VBDA 5BPXA 5FZLA 1Y0UA 1UOFA 1O8SA 2F5CA 3A01B 2TUNA 3KEQA 2VOPA 4HLYA 5K7ZA 2CYYA 3BZCA 4CCDA 4XCBA 2R043 4M3BA 4NIAA 3ROUA 1OCTC 1R5HA 3REOA 4DUWA 1OLQA 1YI2I 3ZMSA 2XJSA 1POV0 1C8M2 2OKXA 2D5VA 2IEKA 3K51A 5FWEA 4Q4W3 3GHMA 4AXOA 4DNYA 2DU1A 2PXJA 3WP5A 3A21A 2CUZA 3T2PA 5SV8A 2YDEA 4H2AA 1SCRA 2G9WA 5FPXA 4M74A 4F8AA 5JXIA 4B09A 4E2SA 1ZBA3 1YO5C 3WF1A 2HZDA 2PHLA 4IEJA 3TDZC 4AIJA 3MLKA 4KL1A 5EQUA 1N3PA 5FCCA 3E1F1 1EP0A 4ZH4F 1PMHX 2Y9ZA 5F04A 3MZHA 3R6SA 2AO9A 4OAYA 1XPWA 3ZYRA 1OH4A 1RUE1 5D8KB 2FNAA 3A22A 2BOLA 1LEMA 4HVQA 1J84A 3HUGB 4IHSA 2VONA 3RI4A 1C8M3 3BROA 2WZ8A 4A93J 2VZSA 5AVAA 4A41A 2HI3A 1GANA 3VL9A 2ESHA 5EWSA 3WG9A 5KHDA 3HOWJ 1QXRA 1S6LA 3S3NA 1ONAA 5DDGA 4YW3A 3V0AA 3MZYA 4K2EA 2KKOA 4UBGA 2DYCA 1V5FA 4CEYB 2FZ2A 4MH0E 2CGOA 1NCRA 5CNAA 2X51A 3TW7A 2VQGA 1UKGA 3B7MA 5FZ4A 3E6CC 2OUMA 1MBFA 5HV0A 1E57A 4UYBA 1S55A 1TNRA 4ZHNA 4ONUA 3NW4A 1QF3A 1SQ4A 4I02A 4YWAA 3VZLA 3VV1A 4GB31 2XJRA 4BQOA 2M2EA 2XPVA 2ZKNA 1PP8F 4F55A 4CDXC 5CADA 4MQ9F 3WDVA 3NNLA 4L11A 1GXQA 1S2EA 2MPFA 3Q9SA 4KH9A 2QTWB 5F0FA 5H9PA 2YGLA 3VFZA 2ORXA 3SEZA 2CUEA 3DKQA 4CDXA 3IT8A 2Y6LA 1KJRA 4R9CA 4IE7A 5ED4A 4IEWA 1FOD2 4NIIA 3OCPA 2R32A 5C9AC 3PUHA 5KHIA 2RE9A 4E2QA 1OISA 1EJ9A 4ZXEA 1A34A 1LE8A 3GZTB 4LBOA 3KHCA 5DM6F 2ZX2A 1F9NA 2K9ZA 3NRUA 3OMYA 5E1RA 5GZGA 3LQCA 1Z0XA 3SISA 1GWKA 4Y5SA 2FX0A 3R0AA 1MZ5A 5C9AA 4Q8LA 1YC61 3BPXA 3B01A 1H8TA 2LM3A 2KRFA 3FBMA 5JR3A 4WVZA 4EMSA 1ENHA 3AZVA 1SZBA 4YRDA 1OUXA 1J09A 4HKOA 3ABZA 4ABZA 5LGUA 1W9SA 1KYWA 3ZR6A 2ZMLA 2Y6JA 3RMXA 4YM3A 5KHGA 1K45A 4DXRA 1QHGA 4JHTA 1JKPC 3S1NJ 2LRPA 1R092 5A32A 1DGWA 1FOD3 5A1FA 1GOHA 4AGGA 3LSHA 3GTLJ 2JUCA 1MZBA 5F7UA 3TB0A 1FTTA 1MJ9A 2V79A 1Z91A 1H1IA 2HDWA 1HRV2 1W8NA 1RMU1 2R1BA 1T08B 4L5IA 3M4OJ 1POQA 1F5FA 3WP3A 4GXLA 2WB1N 3I7DA 5FYBA 2HQAA 1NHAA 2HTSA 4UVAA 3VSLA 2XC7A 4C91A 3DEMA 5C3OA 1K3IA 4Y1ZA 2H94A 2DWRA 3S17J 2KM2A 2B0LA 1VQLI 1PUFB 2K5CA 1U0JA 2W7NA 1IRFA 2KJBA 2K9LA 1R093 1FC3A 2ZO4A 2ELHA 5JHFA 4AQSA 3DWLE 2HEOA 2PQQA 3SFZA 1W5TA 2DDAA 2K27A 3P3PA 4BQAA 4DXTA 4DY5A 4KT6A 3NQHA 3CJRB 3JREA 4ETSA 4ES9A 1HRV3 3J7AO 1DYOA 1UW8A 1RTVA 4S2GA 3ZN1A 1FX5A 1LRHA 1PO13 4HK9A 3VN4A 1VALA 1YI9A 3J7MA 1QU0A 2P3IA 2PX9A 1LB2A 1MDMB 2ZGTA 1R082 3K4AA 4AVVA 1DDNA 2F5VA 2K3FA 2W5FA 1CAVA 4Z82A 4YYOA 4YGEA 2VMHA 5A1AA 3G3ZA 2P7CB 2XKOA 2QQ8A 1HW2A 2ZKLA 3LFUA 2BW3A 4H4KC 2QFEA 2A5ZA 4CVUA 3E6DA 4PLMA 4B4QA 3RYRA 1ZX5A 2ATFA 1DQ2A 5F5IA 4UUSB 4GH4A 1F15A 5FKNA 1DGLA 3Q8EA 4IEVA 3CDLA 5LASA 1WJAA 3JRIA 1RJ7A 2CW0F 2ESNA 4BS9A 1NG0A 2HXOA 5CQEA 4Q4Y2 1BVVA 1X1BA 2BJSA 4AFBA 4DOZA 4XF4A 5JZGA 3JRFA 2FDHA 1W7PB 1ZZ8A 3AX4A 4DBQA 4LE3A 3ZGKA 3PIOF 4JHZA 4M00A 2W1UA 1KA8A 2ERFA 1PNGA 3T4HB 2Y75A 1ETWA 3ETQA 1MEC2 1R083 1FX7A 2JA8J 2RS31 1JTYA 5J1XA 3CESA 4IV3A 2DOFA 1IV6A 1ZN2A 2A5WA 1JT6A 3OSGA 3TQNA 3HEIA 4NE9A 2R1DA 2CJJA 5FPBA 1FATA 1NA1B 2JG8C 1IN8A 4JDMA 1ZZBA 4PQQA 1MNEA 2NOGA 5DUIA 2VKVA 4PLNA 1XS9A 3AMPA 3D1NI 1E3PA 1NKGA 1GVJA 2PLV2 1UPSA 4COUA 2BOIA 2VOKA 2EV5A 4BHPA 4XF9A 5FMBA 5KWRA 2ZX0A 2DTWA 4JQTA 3HNYM 4E4DX 5IW0A 3JBG2 3W2VA 4AHZA 4I98B 3O0WA 1GOGA 4XKCA 1MEC3 3MIHA 4UAPA 3CMMA 3KLOA 4A3LJ 2O61A 3U21A 2PLYA 1Y56A 4LULA 1DF0A 1RR8C 2NP0A 3BTYA 3FXLA 5B1BH 4BISA 2PMZA 2G9FA 1LEAA 3TN92 3PU3A 1H89C 4RA0A 5D8AB 1WMDA 1IG0A 5GLUA 2L9SA 5FY4A 3C7OA 2F4MB 3CHXA 3ST7A 3T2QA 2DBBA 5FBZA 2O8KA 5DXDA 5L3BA 2CH0A 1PZ7A 4WVWA 3DTIA 4JP0A 3Q0VA 4CH7A 1VJ2A 2EF6A 4XICA 2X5IB 3CQOA 1OFCX 2PTMA 4QXBA 3AMQA 1RUI3 2G19A 2H09A 3AG3H 4XLAA 1XE8A 1YFUA 1PO22 1OCOH 5F39A 4A6SA 4AK3A 4CEWA 3JBG3 3N9PA 4IOCF 2QQNA 2QBYA 1W9FA 3WDUA 3V4GA 2BXZA 3ZDVA 2VCCA 2NMNA 4XLHA 3H42B 3BP8A 1O6UA 2W94A 3JU9A 3EUKL 2J1EA 3E5XA 2WKKA 4XDPA 1WKYA 4IE5A 4IHVA 1B8IA 3SEQA 3O1OA 5BOXA 1YJNI 3OY8B 2GWRA 2PYTA 4MGKE 1TWGJ 2LW8A 3MPPG 2HWD2 2X6WA 5ANQA 4CDUB 2OVUA 2PJPA 5JOZA 1PGSA 4GWIA 3ZYFA 4BACA 5EJ3A 5D5VB 2X29A 4Q0UA 1FZPB 1PO23 5CFDC 4M0NA 4D69A 1G7YA 4Y26A 1AR72 1YYVA 4B1LA 1HKTA 3K48A 1QGLA 3GZNB 2E1OA 4XONA 4UY8I 2OZJA 2EIMH 2XXZA 1FNZA 3FMSA 1STZA 3CJTB 1UYYA 4ZZ5A 3OYFA 2VAUA 1SVLA 1ORKA 4LHSA 4AQTA 5FZHA 4E8CA 2VVEA 4IEOA 3OJBA 1H9PA 1MS5A 1LHVA 3ZFFB 2Y31A 3KZ4C 2BUKA 2LKSA 1FAYA 4M01A 2XG3A 3ACHA 2B39A 5KCMA 2Z2SB 1XDSA 1D5YA 1AR73 5LBEA 1CQ9A 2SLIA 4E27A 2CG4A 3PVEA 4HNTA 2VQCA 2NN8A 1F1ZA 2G9GA 1FMD2 2E32A 2WABA 5GAHJ 1REFA 2XRLA 1LU2A 4XIKA 2YUSA 2ORZA 2W52A 4FTBA 1W06A 2WSUA 4PUSA 1E0EA 4KG0A 1SD6A 1AR91 1T39A 1TLHB 2OQ6A 2E7AA 3WG7H 2L0KA 3KYDB 2IXHA 1Z21A 4FAHA 3CNAA 2KPMA 4IJAA 1XQNA 2R7RA 2YPDA 2KRHA 3I53A 2JE9A 2ZKZA 5JLXA 5BQTA 1PJRA 3GHNA 2WS91 4M71A 2LNBA 3MD2A 1YFYA 5DEQA 4PT6A 5GPAA 1UXZA 3I4PA 1T56A 1XGSA 3M7GA 3NL1A 5F6KA 3LOBA 2XPWA 3VPRA 5LD2C 1OMIA 5LW9A 5LFAA 3UR3C 4TLFA 2PAEA 3RKXA 1AUYA 3GFIA 5FZ0A 4BQYA 5HPOA 1WUVA 3ZFGB 2C6SA 2JB8A 3KB5A 3A4CA 3IC7A 2FBEA 3ZSKA 3JRDA 5I0SA 3DV8A 3PNVA 2D40A 4XQWA 4XLCA 2XUMA 1RXGA 2IC1A 2CY6A 1NX9A 3QRFF 4LB6B 3K0LA 5FXWA 1EPWA 3D5OA 2RJKA 1H9TA 2JKXA 3K4CA 2NMOA 3R61A 3P1IA 3SDBA 4HAMA 2FBIA 3OG2A 2DOEA 1PP7U 3J8F1 4R1HA 4HNUA 3RZZA 2RDRA 2VC9A 5EYXA 3RPQA 2ELKA 2CYFA 4HSJA 2L2OA 5DN2A 1DHKB 4HL0A 3V8LA 3VD7A 1XNKA 3RZKA 3WUCA 4DW6A 5DZEA 4Q4X3 1F4KA 1K5MB 1JYWA 2DPUA 4Q1RA 4YGBA 3HAGA 4DNCA 5IVCA 3U1DA 2EIJH 2QZ8A 5F27A 4XIOA 5FP9A 2Z5WA 3CCUI 3LSDA 1D4M2 5GZFA 3M8FA 1E2XA 5HCAA 4LBMA 1T95A 4EWDA 2W91A 4HX8A 2LBFA 2VOOA 4IEXA 5J7MA 3UKVA 4JC1A 1X8MA 2WA3A 2V26A 4RGSA 5ICCA 1S0GA 3I3MA 3NJYA 1W6PA 4RHV3 1AKHA 1P6RA 3EDPA 4LT5A 3G71I 1XGMA 4IZZA 4HDUA 4EJTA 4YEJA 2I10A 2YC0A 2XMLA 3X29B 1P7IA 2VASA 3QAHA 4IGQA 3CJIC 2ZJPF 3P5BA 3ONQA 3AK0A 3LFKA 2J5OA 5K0UC 2EFNA 3T8TA 1SLIA 4UF0A 3KT1A 1H2LA 4HA8A 5CB7A 4RQPC 1GDTA 4KYWA 2RNGA 2HYXA 2W87A 4DUVA 1VQMI 4A3XA 1NK3P 1JZ4A 3CJIA 2GOMA 1QOOA 5DG2A 4HMZA 4YIIA 2GZWA 3VBFB 4IQ4A 4FVVA 1Z78A 5K0UA 1YJLA 4IV1B 3RZDJ 2CWMA 4RQPA 2JDYA 4QKFA 1RXFA 5LCWL 3AL5A 2GU9A 1VQ5I 4ZU7A 3VLBB 3WTYC 2DCYA 3GBGA 2ZABA 2HS5A 2KLOA 4YZ3A 1OD5A 4IHWA 3WNOA 4YLZA 3ZQIA 4KWUA 2WIIB 3ACLA 1UHMA 2V09A 2QSFX 3OGRA 2ZGQA 4HV5A 4D7MA 3RZOJ 4BY1J 4RM3A 4BIFA 2L54A 2IFRA 4XJ9A 4BAYA 5D2AA 2UXNA 2LKXA 4J6GA 3BR2A 3PSFA 4E4HA 4XACA 2R7SA 3NWKA 4IEQA 4GGGA 1GV9A 2TNFA 1JBCA 4FFHA 2ET1A 2VBBA 1SFXA 2FCUA 2WO2A 4A3JJ 1ERDA 4QPIC 3IWZA 5GJ6A 5A33A 1G9FA 2RDNA 2PHFA 3UV9A 1XX5A 3ZN5A 2V6EA 2YYOA 5AC92 3IP4B 1R1UA 2KRCA 4KDPA 1G9AA 2HFHA 1RUG2 1K83J 2OT7A 2K2SA 2WT0A 4GCVA 2NPIA 2DVGA 2HOEA 2VE8A 5JXJA 3CCLI 1MJAA 3NV3A 3BTIA 4IEYA 1JZ3A 5FLXK 1AXKA 1AOYA 4JGYB 3QP5A 4LKSA 1QKQA 3KP5A 3VOEA 1YW8A 1I39A 3FWEA 1UZZA 2W47A 5HI0A 2Z3YA 3RYPA 1VMHA 4ESJA 3CEWA 4QDQA 1U9NA 4HFSA 3OYKA 4MEXF 1B09A 1IG7A 5JMCA 4HN0A 3QBQA 1SMTA 2PHXA 3GMEA 1R5ID 5DCMB 3ZN0A 4W8JA 2IA1A 4GYIA 5AC93 4N0BA 1XNCA 2ZOEB 4NRPA 4TYSA 1U78A 4WM7C 2WNVC 1LHUA 4LG0A 3EQLF 1Z7LA 3MKZA 1IDZA 2M5WA 1PGL1 3PVOA 2JIJA 1EAH2 3B93A 3AL0B 3WE2A 4I09A 3FJSA 4EQQA 1YLFA 3NNGA 4UUTA 1PO11 3LSGA 5A3WA 4GO1A 1MZEA 5CKNA 4PZJA 2WNVA 1O7FA 2GXAA 4XEZA 1NLQA 1WLCA 3AFHA 4OFGA 1MS0A 4DRVA 4O9GA 1DYPA 3BR0A 1KU3A 1T33A 4QX0A 2JVHA 3ZO0B 2CV2A 2ETEA 3RVHA 1A8DA 4UNOA 3ABKH 2Y6FA 2MEV1 4R79A 3WUDA 1R1VA 5CFDB 3PQKA 1NG7A 4XVHA 2DK8A 2F2EA 2Q1FA 3HBKA 2KISA 4MSVA 1R58A 2MHFA 1PDNC 1EAH3 9ANTA 2ZGLA 3G2BA 2JDZA 3OPWA 3RJ2X 2F5EA 3GW2A 1FYLA 1NY71 2PJRA 2WB1A 2DCTA 4FPCA 1LULA 4UFLA 5BNOA 2QQMA 2MNGA 3L2VA 3M3OA 1WRJA 4XUTA 4KITB 5D8AA 3SCFA 2A71A 3CCJI 1UCXA 1S7OA 3L2WA 1N1SA 1UZWA 3I2GA 4JQRA 1S29A 3ZMZA 3ILFA 2BY1A 2X1CA 3VKNA 3MKLA 1NH3A 2W08A 5B2GB 3OB8A 1QJY1 1U5YA 3BUCA 3NV4A 2IBDA 3RDIA 1W7PD 5IWFA 2K4JA 2XVLA 2JPBA 4QD2A 1I6HJ 2VQLA 3KV6A 4RGKA 3RRDA 4GWJA 3HC7A 5FZOB 1UY3A 4META 5DS9A 1XSXA 5E20A 2GLOA 2GC2A 2P7VB 4DRRA 2LC2A 2DDBA 5A3PA 4M3CE 3HPNA 3OBAA 3H9QA 4NMIA 3N97A 4LE4A 1H0MA 4JQFA 4C2UA 1JHNA 2MBFA 3VODA 5HNFA 3JSPA 3SJMA 5C5TA 5LZ6A 4FCYA 4KN4X 4XJZA 3WG3A 3V64A 1O4TA 4MGRA 3J7NA 4NWWA 3S1MJ 1UQXA 4LB5A 3OUJA 3LEMA 5KXCA 2UURA 4GDFA 3C7HA 3I3EA 3RGBA 1IGOA 4EJUA 4MTDA 3FF5A 1RUI1 1SLLA 1LAJA 1XSQA 4QAWA 3GTOJ 1CAWA 4GYGA 3S57A 3T0DA 1CQTA 3IPVB 1E5RA 3POFA 1T6SA 3EUAA 3RZLA 4P9JA 2J1TA 2JJ6A 1KDMA 2LR8A 2W68A 4IEUA 2DT6A 3J81K 3KV9A 4W6XA 3J7ZI 1IHMA 2BGCA 4HLTA 5M5WJ 2XQRA 3SFIA 3TKYA 1RUD2 1SBEA 3LE0A 1QPIA 2BVLA 2FXAA 1N1TA 3H8XA 3QYEA 4IVNA 2A73B 2D43A 3ZFFA 5A6YA 3ACGA 3QWLA 3NNJA 2DTZA 5EGOA 1IF1A 3EYPA 4HG2A 3VSKA 2VQAA 3POJA 3F8BA 3PTRB 2XGDA 3A23A 3H8UA 5M5YJ 2MW8A 3OPZA 3MI8A 1BIBA 4RA2A 4M3DA 2GA1A 4AEKA 1AL22 4U0VA 4RGXA 3WU1B 2YHJA 1OYYA 2JWTA 4UW5A 3HSFA 2BFUL 3MKYB 1XNBA 2BHYA 3VUOA 3I97A 1QXJA 2BNNA 1NYWA 3S6PA 4QXHA 4BLIA 3GYHX 2CQ7A 3B94A 3TO7A 1RUD3 1QH6A 5EF6A 3HN3A 3BCBA 2DBIA 5J3UA 3HRMA 3QLQA 2P6SA 1FBSA 5JSRA 1ZGJA 3BR1A 3LD8A 2RR12 3E6BA 3CCMI 1BR2A 1HQLA 4FXKB 4N43B 2QCSB 3ZDSA 1IRXA 1JZ7A 1CIWA 2Q0AA 1XMKA 3F6VA 2ZGMA 4A3DJ 4MLOA 2CO5A 2A3YA 3LPFA 1VR3A 2A1XA 5FKCA 4MHGA 2R7EB 1ZGWA 2YBPA 1AL23 4FOQA 4P9LA 4BJ0A 3FLTA 1M1EB 3TBDA 2HVQA 5FMCA 5FPLA 1ULFA 1P4XA 1BJAA 2HDCA 1GNYA 3ULQB 2WFPA 3N05A 1V9U3 3ASIA 3KF3A 1Z3XA 5HLTA 2IXIA 1VQ6I 2JVGA 4RGAA 1W2NA 4V19K 3J80K 5FUNA 3BC8A 2CRGA 2K3PA 1AU7A 5I93A 1LVAA 2HWB2 4XFIA 3R4UA 2D3RA 1T98A 3ZQQA 4NHMA 2RR13 4BIOA 3TOAA 3RZMA 4BU2A 5F3IA 1ZA4A 4LJHA 1MBJA