3IWZA

The c-di-gmp responsive global regulator clp links cell-cell signaling to virulence gene expression in xanthomonas campestris
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
207
structure length
207
Chain Sequence
LDAGTIERFLAHSHRRRYPTRTDVFRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRTRTQCELAEISYERLQQLFQTSLSPDAPRILYAIGVQLSKRLLDTTRKASRLAFLDVTDRIVRTLHDLSKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The cAMP receptor-like protein CLP is a novel c-di-GMP receptor linking cell-cell signaling to virulence gene expression in Xanthomonas campestris.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transcription
molecule keywords Catabolite activation-like protein
total genus 68
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF00325 Crp Bacterial regulatory proteins, crp family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwzA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3iwzA01
2IA1A 1UD1A 2ZCWA 5IT9K 5BPXA 3FHZA 1V4RA 1P2FA 1GVJA 2IA0A 4XF3A 3SCFA 3KCCA 3K1NA 5E16A 2F5CA 5BMZA 2GZWA 1TQIA 2EJRA 3Q9SA 3MAJA 1FZPB 3ZN1A 4MV2A 5BS6A 4R8HA 4LK0F 5C6CA 3GFIA 2FRHA 4KWKA 3UKVA 3I59B 4MQ9F 1P4AA 2UXNA 4U88A 4IETA 2PLYA 4IXAA 2VBYA 4BHPA 3PQJA 4HA8A 1A04A 1ZARA 3MZHA 3TNPB 1R58A 4AVAA 2IPQX 5FPXA 3JAMZ 4LULA 4YYOA 1FPQA 1BIBA 1FP2A 3WODF 1Z6RA 1FOKA 2IXJA 5LHGA 5HDNA 4K2EA 4AQ6A 4Q48A 1W7PA 2CG4A 1R1VA 3N97A 1C0WA 3NW4A 1J3RA 6PAXA 5D5XB 2XRNA 2EFPA 3L9FA 2ELHA 5BQTA 1BI2A 4QWQA 1HW1A 4TLFA 1TTYA 2JRTA 2W57A 3NEUA 4G6QA 4HSLA 2FXAA 2LF7A 4MGYE 3C3VA 4JK1X 2IT0A 2HYGD 3KP5A 3GW2A 4BNCA 3KP3A 3ZQ7A 2WTEA 1CAWA 4XEZA 5JSOA 1XCBA 1FP1D 2EFNA 2D5HA 3JW4A 1DP7P 3W6KB 1B9MA 4PIYA 2RKHA 4DQ2A 3DEUA 2B8MA 3REOA 4HYEA 2F4PA 5E20A 4HSJA 4ZH4F 3FMQA 3K1PA 4ZU5A 4Q0PA 1SFUA 2NRAC 4I0BA 3IKTA 3F72A 2DI3A 2WFPA 2O03A 2HYFA 1OMIA 1Z6TA 2KJCA 5FFXA 3WTSC 4K8FA 3ST7A 4XSXF 3H7YA 4QX5A 4KNYA 2ET1A 5A2QK 1IRFA 4I01A 2C6YA 2K9ZA 3KEOA 2CQKA 5CLSA 3DFGA 4KMUX 1XN7A 2P8TA 3JTHA 1EP0A 3RYKA 2MHFA 3ZDSA 3FJSA 3QP6A 1F5TA 2BV6A 5LHHA 1DDNA 3E6CC 1KYWA 3FX3A 2UWMA 1G4DA 5DCFA 1XDSA 2HTSA 1Y0UA 4G6DA 3V7CA 3C1DA 4UV8A 5KHJA 3V8KA 1TNTA 4AIJA 1KU3A 3U11A 2PQ8A 2YSRA 2L4AA 3FMRA 4PGGA 4G7ZF 4UXAA 3KLOA 1P92A 2KIMA 2Y75A 3R4KA 4HQEA 4QM9A 1X7NA 3V4GA 5EZWA 1U5TC 4MGZE 2EFWA 5ERIA 2QWWA 1JUHA 2A68F 3G73A 3CUQC 3FXQA 1R00A 4EWAA 3E5XA 5I0RA 4QXKA 1IPKA 1B9NA 4ESFA 3GZ6A 3CO2A 2DT5A 4G94A 4A6DA 3F8BA 3SFZA 3CUQA 5JHUA 1MZBA 1FYMA 4MTDA 1SFEA 2EK5A 2GA1A 1U6GA 1PM7A 3H92A 2VECA 4DINB 2EVXA 4KICA 1XDUA 3V8JA 1YYVA 2PG4A 1HKTA 3M1EA 5KHHA 1UCRA 5J48A 3LFKA 4LTAA 2UY9A 1O3QA 3WW3A 2JZYA 4N9IA 3TGNA 4HQMA 3HYIA 4WX9A 1J75A 4BIFA 3G7DA 3WGIA 3LZZA 3RKYA 3LSTA 2FSWA 4CHUA 1QBJA 3BP8A 1JE8A 3FWEA 5E18F 1QXJA 1Q5OA 4LGWA 3KSCA 3RPQA 1XSXA 5DCMA 3KEQA 2ZNZA 1XMKA 4P55A 2ZKZA 1G3YA 2HFHA 4RGUA 1NXMA 4I02A 4MGKE 3FM3A 1LJ9A 2IXLA 3USSA 3M70A 3OV8A 4KWJA 1XSVA 2XKOA 4LMYA 1SMYF 3HHHA 1S6LA 5HLGA 3CDHA 3BROA 4XRFA 2J5OA 4PGHA 1K6OA 2STWA 3CJXA 1LDKB 1YIOA 2G7HA 4IHSA 2D1VA 4E2GA 2V6CA 5AONA 2IXHA 3EHKA 5KVRA 1JXSA 4KT5C 4PIZA 2ZNYA 2YPRA 4J1WA 2OD5A 2VONA 2BE5F 1TLHB 5TJJA 5C8WA 4UNOA 3WGHA 4ZYHA 2BNNA 2DPUA 1R7JA 2HQRA 3WW4A 3Q5FA 4XFFA 1ULYA 5ICCA 5LBQA 1SMTA 2RDPA 2A5YB 1WSUA 5KBFA 4H0EA 1Y9QA 2BGCA 2CW0F 4ON0A 5HLHA 5FPZA 4QGMA 3N4MA 2DPDA 3KP2A 4Y17A 4XFCA 3KLNA 3KZYA 2ISZA 4OFGA 1WA4A 1CF7A 1QO0D 3ELKA 3MWMA 1J5YA 4EWDA 4IHTA 1KQ8A 4XFHA 3GBFA 2QCSB 4WXDA 5FO5A 2DBBA 3HRTA 3I0TA 1PUEE 3R0JA 3T0YA 2E1CA 1DZRA 4IERA 1R23A 2P5KA 2YX4A 3KP6A 4GULA 2ACJA 5E1ZB 4EGYA 4Q0VA 4ORFA 4BHCA 3F8NA 2W84A 3CTAA 1XB4A 3PVBB 4ESJA 1I27A 2QENA 4IEQA 4MTEA 1G6NA 4HVOA 1KQ0A 2IVMA 1I1SA 4X6RB 4F8AA 4I0AA 2A61A 2VBZA 1T2KA 5D4SA 4JTOA 2V1DA 2JT1A 3RI4A 2QUFA 1O57A 2QVSB 4A6EA 5HI0A 1SFXA 4GGGA 1HQCA 4L0ZB 1EYBA 1LDDA 4IEOA 5CVRA 4I2OA 1T98A 1YFWA 4UV9A 2OPKA 4XF1A 2QZ8A 3TO9A 2H27A 3FM5A 5ILVA 5JAXA 2PTMA 5KHIA 4A12A 4LLNA 4UHTA 5JFRA 3FXRA 2RN7A 1KQ9A 1MDMB 1BI0A 1ZZ6A 3VOEA 5JVTA 2UYAA 1IXRC 1G3SA 1SD4A 2Z2SB 4HBLA 3EBRA 4KL1A 3H1YA 1DPUA 4CDGA 1O7FA 1ZZ7A 4IEVA 1G3TA 1UHMA 2EA7A 4M9ZA 4ZZLA 1ZRFA 3H7JA 4HBNA 1MD0A 5F64A 1QGPA 4AVPA 4AQ2A 3K2ZA 3C7JA 4IRHA 1FT9A 1ZZCA 1REPC 4EJWA 4F7ZA 1TQ5A 2M5WA 3E5UA 1H1MA 4L9TA 3KFWX 3BU7A 4S05A 4RAYA 2KIUA 3IDBB 2ZJ2A 4I3PA 2CAVA 4HW0A 4RGRA 2VT3A 4KIBA 3WGGA 3SCHA 1RUNA 2EV0A 3HRMA 3GVAA 1ZH5A 2D1HA 2P7VB 3ROUA 4S04A 1J3PA 3H8UA 3WU1B 4D0PA 3VFZA 5FQ0B 1OYIA 1CAXB 1SD5A 1RC6A 1Y3TA 3SHFA 3WE2A 1X8EA 3FZVA 3FHIB 2A07F 3CF6E 3EYYA 3TO6A 2IXKA 5CJ9A 1IUYA 4HV6A 2YX7A 4KMFA 4GYIA 4OIPF 4LLOA 2R7DA 3P9IA 3LAJA 1LB2A 3RYPA 1ZVFA 1ZG3A 3BPZA 2UXXA 2HOEA 3QAHA 3E6BA 4B09A 3UKNA 1FBUA 1YO5C 4FAHA 2Y48A 2JPBA 1JHHA 3M3IA 2Q4SA 1XGNA 3GX4X 3H1WA 3B73A 3I64A 3ECHA 1EY2A 2CO5A 2MPFA 4ENKA 4G7HF 5L3EA 1HXDA 4LEJA 3D5LA 4G9YA 4I98B 2ET7A 3NVCA 2O0YA 2KKOA 4Y13A 1LNWA 2OA2A 4I09A 3IKVA 2XUBA 2W25A 3BWGA 4LFUA 1LR5A 2PFWA 1O4TA 4YFXF 1BJAA 4JQFA 3V7SA 1YFXA 2PJPA 5CYVA 5A2QZ 2MH2A 3I4PA 3T8RA 2D40A 4RB3C 1USTA 4QGNA 1G3WA 3JTGA 1CAVA 5IT9Z 1IF1A 2F5FA 1WI9A 3E97A 4FT8A 3QRFF 5H6QA 2LDUA 5K1YA 4LLLA 2H0VA 4PDKA 3H3ZA 2O1QA 5E1WA 3KZZA 3GEZA 3WTXC 3VHRA 4ENJA 1QZZA 4FX4A 2STTA 4OMZA 2VXZA 4KN7X 4XBFA 1ZGAA 3IRQA 1FI2A 2MNGA 1J59A 5CVUA 3NQOA 4KU7A 5FLXZ 1OYYA 2KJBA 3DV8A 5TRDA 2AS5F 2PA7A 2NYXA 1RL3A 4OIOF 3J80Z 1P4XA 5CADA 2VE9A 2DO7A 2L01A 1YW8A 4KA4A 3ZPLA 4LUKA 3QU3A 1R1UA 1J58A 2Y0OA 2DAOA 2Z99A 3M8FA 3CJNA 2OZJA 3H50A 1ODDA 4OOIA 3IBMA 1KU7A 3MDPA 1OR7A 4EJTA 5J6XA 3F3XA 3IRRA 1OYWA 3ZMTA 3U9GA 2LF8A 4Z07A 4FHTA 5LGUA 5LLQA 1YW7A 5CVIA 3HT1A 1XD7A 2JSCA 5K5RA 2ZXJA 2J5PA 2Q2EA 2E7XA 2IW5A 3QOPA 4GO1A 1KU9A 2FNPA 1U12A 3HT2A 3KGLA 4EM1A 5J8FA 2JPCA 3LQRA 1IAWA 3T8TA 2E9QA 4HLXA 4HF2A 1V70A 3K0LA 2D2WA 3WTVC 1F9NA 1HSJA 2Z9OA 3IWFA 4RD7A 1BN5A 4IEZA 4XETA 1OKRA 2HQNA 2P7CB 1LRHA 5FD5A 4OIQF 1WLTA 2FBHA 3WU0A 3OCPA 4ZYGA 4YRDA 2FBIA 4WXHA 4O3MA 4MUVA 3J80K 1TW2A 2DCTA 3ZMZA 5LGTA 4U0YA 3MFKA 5F6FA 5AIPA 5CVJA 2IXCA 2MH9A 1H9TA 1YFUA 3ZMUA 2O61A 3H1MA 2VODA 1FYKA 3BDDA 3BJAA 3D0SA 5I0SA 4ENNA 3KGZA 1U5TA 4L9VA 2Y0MA 4IVNA 2GC2A 2NNYA 3HSFA 3NRVA 3TKYA 1RZ4A 1QPMA 1DUXC 2GA2A 4RB2C 2IRFG 4L5IA 1W5TA 1YW9A 3MEXA 1SEFA 2EV5A 1FYLA 4IRIA 2HEOA 4BAYA 1BI1A 2FQ3A 3CUQB 5ICGA 4WBBA 3R0AA 2HR3A 2TDXA 3D82A 4XLPF 2FNAA 3OTFA 3DXJF 1HKSA 4OINF 3RKXA 4B29A 1YS6A 3BALA 3ELNA 1VJ2A 4M73A 3HTUA 2NAZA 1YLLA 5D6EA 3ECOA 2FBKA 3CO6C 1EV7A 1KA8A 4EQQA 3M8EA 4CZZA 3HRSA 3U10A 1ZG5A 1K7AA 2H94A 1LKNA 5E17F 5HOOA 4HV5A 5J7MA 2PFBA 1Z05A 4QLCU 3SXWA 2A6EF 3SQNA 1KYZA 4KIGA 4O9EA 4LB5A 1Z91A 2M30A 4Z82A 1D5VA 5T3NA 3HQXA 2OA4A 4LJZF 5HVQC 2QJVA 1KGSA 2H6CA 2MD5A 1I5ZA 3E3VA 2GWRA 2GXGA 2EFQA 3J81Z 1L0OC 3IIAA 1PMIA 4I7HA 2ESNA 3KP7A 5KHKA 1J2XA 1IW7F 5L3GA 2GC0A 3OF1A 1YFYA 5HS8A 2RGVA 4A2UA 2VE8A 2XL9A 4N0BA 1WKMA 4HX7A 2D93A 4MNUA 5D1IA 3RNSA 4KU8A 1Z7UA 2VT2A 1IN6A 4IPAA 3V7RA 4WCGA 2M87A 3SXYA 4HMZA 5K5QA 4FAGA 4R52A 1WQ2A 5HDKA 1Z1DA 5I0UA 5I91A 1JGSA 3ABTA 1ZZ9A 1S7AA 3LAPA 4LB6B 3DPTA 1XRUA 1MKMA 4IEWA 2RVCA 3BY6A 3TO7A 1LDJA 2EA2A 4XFBA 3BJOA 5KK1A 4M6YA 3SCGA 5BXXA 2MBFA 3RZZA 3TOAA 3EJKA 1I6XA 2IC1A 2Q8KA 3IWZA 3F22A 5H6RA 2QBYB 2OYZA 2MLGA 4L18B 3GF2A 2ISYA 5FD6A 1IN8A 5AIQA 2AXLA 1USSA 2P6SA 1SD7A 4MEYF 4PCQA 3HOTA 1ZRCA 2X4HA 3J81K 2ZMEA 3U0ZA 3WTUC 1YTYA 1T0FA 1IPJA 4EM2A 3EYIA 1W4MA 2F5EA 2PQQA 2OQGA 3VEPA 1UIJA 2PHDA 3P9CA 2ZFWA 4TV7A 3R61A 2PMUA 3AAFA 1W7PB 3OD0A 1FSEA 5D5WB 4A5MA 4JVAA 4MEXF 1PP8F 3CO7C 3IDCB 3WTTC 1R5HA 1ZHFA 4KWLA 1GQHA 2QQ9A 3TDZC 3ZMSA 2WV0A 1UW8A 4O5VA 2YR2A 4HZFA 4YFNF 2WC2A 4AD9A 5FQ0A 2HS5A 1HSTA 1IN5A 4CO8A 2XHKA 3ULQB 2HWVA 5I0TA 4ETSA 2DU9A 1MDMA 1ZZ8A 3L2HA 1S3JA 1TQPA 1W7PD 3GUDA 4AIHA 2Q0OA 5FCCA 5K8SA 2HTJA 4XF4A 2P5LC 1PP7U 1UFMA 1ZG1A 4QGLA 2PN6A 4KN4X 2QQAA 5BPDA 2Z3YA 4HOBA 4ZU4A 1XGSA 3NSTA 1ZLKA 3GFJA 2O8XA 3B02A 2PEXA 2QQBA 4NVPA 1Q1HA 4Y15A 4L9NA 4EVIA 4ZU7A 4P9FA 3RTRA 3E6DA 1FXZA 2RQPA 1ZZBA 3BPVA 4RGSA 3HUGA 4LLGF 3S0MA 1H1IA 4OMYA 4ZYEA 3HOSA 2UZKA 5ILSA 3KE2A 4BXUA 4XFIA 1ZLJA 4R1HA 1EH6A 3ACLA 4Q4ZF 3K9TA 3GFMA 2K4JA 2XKPA 3BCWA 3LWFA 5ILUA 3RYRA 5BPIA 5D8LB 2K27A 2MLKA 4Q0SA 2OU2A 2B9UA 2FMLA 2H09A 1VTNC 5FLIA 5DDGA 1XGOA 4FBFA 1XMAA 5FGMA 3DL3A 4QM8A 2BBYA 1T39A 5ICEA 2PMHA 2RC4A 5D5UB 3RKWA 1XSDA 4AXOA 1TQMA 5D6FA 3COAC 5J8CA 3I5UA 1R5GA 5BV6A 5DUIA 5LGNA 2O3FA 2A3SA 2P4WA 1B6AA 2P6TA 1OPCA 2H6BA 3I58A 5FFZA 4Z2YA 1R22A 3GYHX 4GYGA 1RTVA 3NJZA 4HDUA 4M6XA 4ONUA 1IN4A 1VR3A 2O6GE 1ONVA 3I59A 4QMAA 4N9HA 4L0YB 2R3SA 4LD5A 2GC3A 1UIKA 3S2WA 4E70A 3WW1A 4CYDA 1B4AA 3PLQA 4GXOA 1BBYA 2L54A 4CGZA 4BYYA 2HKXA 1BC7C 3NL1A 2K86A 3C18A 2XAJA 4IRGA 1AWCA 3MQ0A 4XFGA 1F4KA 4ZZDA 3EETA 2GAUA 4WZCA 3QACA 5IT3A 1J0RA 2P5VA 1HW2A 1STZA 4NQWA 1Z9CA 3BB6A 2MA3A 1XGMA 4IESA 2RV8A 3ZMVA 1R36A 2M8EA 3JSOA 1HBXG 2HGCA 1YLFA 1OD5A 3RJPA 4LG0A 1EH8A 3DKWA 3ZP5A 2EA4A 2PYTA 3VB2A 2C0ZA 4A5NA 4EMSA 1D8JA 4L11A 1YWKA 2W24A 1FSHA 3WW2A 1ZAOA 1O7LA 2ESHA 4EROA 3T5XA 2XAFA 3QU6A 3EDPA 2VQAA 3CEWA 2OBPA 2GXBA 3LQQA 4E2QA 3V8LA 2L02A 1IZ1A 3IC7A 3BJ6A 4JTNA 5LRRA 2OZUA 2EFOA 1NYWA 1FLIA 2JTVA 1E2XA 1FC3A 1B59A 5EEGA 3DP7A 3HTSB 3I54A 3Q9VA 2OQRA 5I8SA 2A69F 4WK8F 3GXOA 1EH7A 5L3DA 1T6SA 3GLXA 1U8RA 4O9GA 5BY5A 3IL2A 1SAXA 4WWCA 1S7OA 3JAMK 4JV4A 3HSEA 4EV0A 3H9AA 3WTZA 1Q3EA 4HLTA 3F6OA 2FEZA 2CSOA 4RAZA 5ICFA 4IJAA 5FDBA 3K1MA 3KMHA 3ZN0A 4UBGA 1MJBA 1J1LA 3OOPA 1GXPA 3HHGA 4PZJA 2HJIA 5E1XA 3MPBA 1E17A 2L3DA 1DZTA 4IEYA 2CWEA 1V3FA 3MCZA 4RS8A 2PBIA 4A0ZA 3LA2A 2VBXA 3F8MA 4M74A 2FOKA 2OZ6A 2V9VA 3CLOA 1ON2A 3P9KA 5JSRA 1RI7A 2W85A 1QWRA 1IRGA 4EWEA 3WE3A 1X82A 1H9GA 3HSRA 2XVCA 3FF5A 3F8CA 5JR3A 1S8NA 3HIFA 3K69A 5I8YA 3TNQA 1MGTA 1YFHA 4EJVA 5K5OA 5LEJA 1YHFA 1B1BA 1UB9A 2IA2A 1K79A 4U0VA 1J9IA 3BOQA 1BOAA 1NZCA 1ZYRF 1X8MA 4RB0A 1RNLA 4KIFA 1CAWB 1FWZA 1O3SA 1AOYA 2VPVA 5EFUA 5FB2A 3RDIA 2E7WA 5D5VB 1CAUA 2EAAA 5ED4A 3IHUA 4HAMA 5BOXA 3GYDA 4HN1A 4RB1A 1ZN2A 3WTYC 4MX3A 2ATFA 3ES4A 3O2PE 2RNJA 5JR7B 2DTRA 4P9UA 3GFLA 1OI6A 2CAUA 2XAHA 2YU3A 4ENMA 3W6JB 1W5SA 2K7LA 3SHRA 2ZBKA 4M9SA 3WTWC 1LVAA 1ZRRA 3J7AO 1S29A 3F8FA 3LA3A 3R6SA 2V1UA 3ERED 5KHGA 2V1XA 2KRFA 4CICA 1ZNPA 5LEKA 4OLLA 3QPTA 2EV6A 5LRSA 4ASNA 1FY7A 2GC1A 2UY8A 3SZPA 2Q1ZB 2CV6A 1K78A 3I53A 2PHLA 4CXFA 1PDNC 2M45A 2CGPA 2BNMA 4YG2F 4J1XA 5L3BA 3SMHA 3EO6A 5LHIA 4AVBA 3L00A 4PIXA 2COMA 1BC8C 4Q0QA 4LA2A 5DV5A 2NNNA 3ES1A 3GO5A 5DD4A 1O3TA 3ISPA 2IJLA 3ETQA 4L5JA 4YFKF 2XV4S 4YNIA 3CLPA 4A0YA 2ETHA 3F21A 3DN7A 3S7IA 4ESBA 2IXIA 4A0XA 2B0LA 1ZREA 5JSPA 3LAGA 4G7OF 4E2SA 1FX7A 3U1DA 1DPRA 2XASA 2V79A 2FQPA 4UVAA 4NHJA 1YG2A 2B5HA 4MQVA 1H0MA 1U3EM 2K0GA 1D8KA 1IXCA 3UKTA 3TQNA 1GQGA 4NB5A 3C3WA 2I45A 4FX0A 1U78A 4LA3A 2ETEA 4YSFA 1F1ZA 1ZGJA 2LNBA 4RGXA 4H7LA 4PJYA 3G3ZA 2UYBA 4XSZF 1VP6A 3EUHA 2WWYA 5CVVA 2DQRA 3ABUA 4KFCA 3D0JA 2QVOA 3E6MA 2XLGA 4XF0A 4IEUA 2CYYA 4Q0UA 4IEXA 4BH9A 1RIOH 4BQAA 1UCXA 1R1TA 5L3FA 2EB7A 4LK1F 2VBWA 4M9XA 2XROA 1IXSB 5BUVA 4M72A 3QPHA 4HVRA 1YUDA 2HKOA 2QBYA 3QP5A 3KETA 2NS0A 1WGPA 1O5LA 3I7DA 3EQLF 1QQIA 4D7TA 5DCMB 4MGRA 1ZX5A 2QM3A 3HRUA 2OAZA 4ZYDA 1L3LA 4O6JA 4L9JA 1CX4A 1J3QA 3RIRA 1QNTA 3LOIA 2ZMEB 4EGZA 1UPIA 2GU9A 3PFIA 2O8QA 1RUOA 1K78B 1J7KA 1CAVB 3U2RA 2FF4A 1OFNA 1GHCA 2BYVE 2CFXA 4WVZA 3GWZA 3BPXA 3MZYA 2G7UA 2M1BA 4D7SA 1U2WA 3OGJA 4U7DA 1UHWA 2K4BA 3R60A 3JSPA 3FMSA 5E8GA 4KUMA 2N7GA 5CU1A 3KP4A 5EEHA 4P9GA 2VC1A 3VODA 4META 3WG9A 4MGIE 2VOPA 4UVCA 2F5DA 4UUVA 1LEAA 5HS9A 2L4MA 3H3UA 1XE8A 2LSOA 4GCVA 4UXNA 4P96A 2LKPA 2GQQA 1LQ1A 3LA7A 4BHBA 4X6QB 4G8XA 2FA5A 2K02A 5F1RA 1U5TB 2PI0A 4KDPA 2Q0AA 2ZKLA 3E5QA 4EJUA 4KYWA 2Q30A 1I1GA 1P4WA 1FNNA 3LWCA 1SD6A 3O6BB 1YS7A 4LUMA 3EQEA 3GZ5A 2R7FA 4R79A 4HN0A 3L7WA 1IN7A 3TOBA 1XE7A 3O3KA 1GXQA 1P6RA 1SQ4A 2G9WA 5DYMA 1NE4A 2DW4A 2PAEA 4M71A 4DNCA 1DGWA 3NKTA 2F2EA 4YIFA 2KIFA 4EJOA 1MJ9A 4HX8A 2DK5A 2GH2A 4P5OA 1ON1A 2P17A 4IEPA 4MZUA 2EWNA 4AWXB 1CGPA 1YQAA 2FMYA 2A6HF 2ADUA 2XLAA 2DK8A 2D45A 5FLHA 2XIGA 1TNSA 1HKQA 2DQLA 4AIKA 3ML6A 4U7BA 5FLJA 4U0WA 2BNOA 2XAQA 4AVCA 4L2NA 2D5FA 3CL1A 2IP2A 5HDGA 1QXRA 3L2CA 4XFAA 4HLYA 3PNAA 5D4RA 1T38A 1D3YA 2E1NA 1O3RA 2HDCA 1EPZA 4Q5SF 3MYXA 5DEQA 3S7EA 4XLNF 3L09A 1QZYA 2VC0A 3RPUA 4UBHA 1WWXA 3FXUA 3CUOA 5JI6A 3BZ6A 1TW3A 3FFQA 5JCTA 2XL7A 1LEBA 1NE6A 2MC3A 1JHFA 5J3UA 3F23A 2PAMA 2VOOA 4YIIA 1NHAA 4MHGA 3FZ3A 2DFIA 4IF4A 4Q29A 2Z33A 4Q47A 3PQKA 2X0LA 2DLLA 4JBAA 3TDUC 3M7GA 1BM9A 1X3UA 4XF9A 4HF0A 1RGSA 1O5UA 5H20A 5DD8A 3F6VA 5I93A 2Z69A 4OU0A 1KU2A 5FLXK 1Q43A 2KXLA 4OIRF 1QY4A 3DF8A 2QLZA 2FU4A 2BEOA 1BIAA 3FE5A 5E1RA 2PAKA 3JZVA 5HS7A 1FBQA 2ZO4A 4HDVA 1CAUB 2GIVA 4LG0B 1L3JA 1CAXA 1MJAA 4UVBA 4HF1A 3DPLC 2FE3A 4B8XA 3P7NA 5AVPA 1WRJA 4EM0B 2QNKA 3DQVC 3M9AA 5L3CA 2HZTA 1BI3A 3T1BA 1TBXA 1XCVA 3ZMDA 4MH0E 1DGRA 4WXCA 2V09A 5D8KB 3SZTA 4YARA 2Z5UA 1SFNA 1CF7B 4WF2A 5HLIA 2XLFA 4HX4A 3I71A 1HW5A 2QYOA 3O14A 2QDRA 1FBSA 4HVQA 2VN2A 5I8TA 5E8IA 2XAGA 5DUKA 2XGXA 1ZRDA
chains in the Genus database with same CATH superfamily
1NQJA 5FYBA 2JRMA 2NPIA 5IT9K 2BV4A 5BPXA 4CDUC 1GVJA 4XF3A 2QQKA 1VFCA 3SCFA 1XMXA 3KCCA 1YQCA 3S1RJ 2F5CA 4CUBA 2VL8A 1CQTA 1C8NA 3CCVI 2VW2A 3WINE 3A7QA 5A6QA 2ZMLA 3MAJA 1N1TA 4K1ZA 1W2TA 4ATEA 3DPRC 4KWKA 4C3IJ 3MLJA 4U88A 2FZ1A 3A4CA 3MI8A 3I2GA 1N3QA 2V72A 3ABMH 1O59A 3TNPB 4HRIA 5FK7A 1R58A 3D6EA 3JRIA 2IPQX 5FK8A 4Y3OA 1SLBA 2QZ2A 3JAMZ 3GCMA 3WODF 2EALA 1SG3A 3WD5A 2IXJA 1NLQA 5LHGA 4K2EA 2ARCA 1W7PA 2CG4A 1R1VA 3NW4A 3H0OA 3AP5A 4R9DA 3CNAA 3H42B 1PVXA 6PAXA 5M5XJ 2ELHA 1BI2A 3MIEA 5JPMB 4JP0A 1TTYA 5F39A 2JD9A 1STMA 1BYHA 4N43A 1R1A1 3RZJA 2IT0A 1V6MA 1QF3A 4XNFA 3N9LA 3ZXDA 5FZIA 2BU9A 2JG9A 4GWJA 3VBHB 5GLVA 4Y5SA 1FP1D 4N4NB 4DS0A 1WD3A 1DGWX 2K2SA 1DP7P 4BPZA 3DF0A 1B9MA 4DQ2A 1RUF2 4HYEA 2K9SA 1MSFC 2AGSA 4WM7B 3KWVA 3K1PA 4Q5OA 2W46A 4OWRB 2ZGKA 4R9AA 4CCOA 1UOJA 4HPKA 1CZTA 2CYFA 2NRAC 2KRCA 4NUBA 1JYIA 3TP3A 4LT5A 1Z6TA 3FHQA 2R073 3VWBA 3DPUA 4AAPA 2ZX2A 1X9TA 3I3LA 2VNOA 2JD4A 5AFEA 3DKYA 4AFCA 3VDCA 3KEOA 4JHTA 3KQRA 1ACCA 1XN7A 4DXZA 2MHFA 1J1TA 2VY0A 4YM1A 2IAIA 1JZ6A 1D1BA 2JA2A 4NN0A 4AG4A 5FKLA 4AZZA 1KYWA 5T50A 1XYNA 4CDQA 2UWMA 3OMYA 2EQRA 1JJ6C 5DCFA 3V65A 1XDSA 1FNZA 2VKVA 3V8KA 1PNFA 1R083 4AIJA 2G19A 1PO13 3CP8A 5FPLA 2TRTA 3V4GA 5EZWA 5B4NA 3OS2A 1QKQA 1U5TC 3S5AA 1DP3A 1OSGA 4IEJA 3KT1A 4HETA 1OKQA 3FXQA 1GV5A 5BNQA 1RC9A 2BDRA 5KAIC 4QXKA 3GZ6A 4QHOA 2Y6GA 4G94A 4YW6A 2WAAA 4A6DA 4HSRA 5IK5A 3SFZA 1G9CA 3WHBA 1W6NA 5JHUA 1NCRC 5JOYA 1MS3A 5T54A 1U6GA 2B7EA 4QHZA 1HRV2 1RUD2 4DINB 4KICA 4DPNA 3JB4C 3G1MA 1UCRA 5A3LA 2RR13 1XNDA 2B9VA 1F9KA 4WX9A 3WZ1A 2R6QA 1OCRH 2NMOA 2XJQA 3ZIWA 3WGIA 2NM1A 3RKYA 5A3TA 3LSTA 4CHUA 1QBJA 3BP8A 4V19K 1JE8A 5E18F 5ABJA 1Z3YA 1V6LA 3I2OA 2PLV2 2E2JJ 5DCMA 4A6OA 3SH3A 3FKJA 2BVVA 4A45A 4C2UA 3VYTB 2JUCA 4FPLA 4RGUA 1NXMA 4QU1A 2XJPA 1LJ9A 1K4SA 2IXLA 1TWFJ 1XNKA 1XSVA 2K85A 4LMYA 1R4NB 3R0RA 4RS5A 1U5XA 3HHHA 3IH4A 2DMPA 5HLGA 2XR4A 2QZ3A 1K6OA 1PVC1 3VDDB 5IYBJ 5CBLA 2KISA 2ZS6B 2VPLA 1LDKB 1DG6A 4YVSC 3WP4A 2LROA 4XJZA 4E2GA 2D1VA 3LSEA 2LK2A 2V6CA 1AYM3 4PIZA 5LBBA 4J1WA 4RR3B 2A70A 5TJJA 5C8WA 4PBPA 1HRI1 3H0DA 2E26A 2ZGUA 3UL2A 1YIPA 1NCRA 4XFFA 1JZ2A 3WNKA 5KBFA 2W52A 1K5JA 2WFF3 1Y9QA 5CKNA 3Q9OA 3IP4B 4F92B 2ISZA 3WQ0A 3HPHA 4AVVA 2OIIA 1TMF3 1H1AA 4DEQA 2PQSA 4RFRB 4XFHA 4HNTA 4DW6A 5KXBA 1W0PA 3ZO0B 2BZDA 3RZKA 4X6AJ 1R23A 2P5KA 1TME2 1RUH3 2HNHA 4GULA 2ACJA 2CQQA 4Q0VA 5BNPB 4AEDB 2IVIB 3PJYA 2QKMB 2XJSA 4IHWA 4CDQC 2AYHA 1XB4A 4ESJA 1H0BA 1KQ0A 4UB6C 1C8M3 1I1SA 4X8PA 2YU2A 3CJIB 3J7AY 2VBZA 5FMOL 4R9BA 1V5EA 3V42A 2RHPA 4JTOA 2V1DA 4INDA 3BR1A 2WZ8A 4FPKA 1S7EA 5D8AC 1MNDA 1S0EA 1O57A 1F31A 2QVSB 5HI0A 4DUWA 5FKNA 3JCUC 1HQCA 2FCVA 3U4XA 4L0ZB 3JQWA 3WDTA 3RZMA 1EYBA 1T8IA 4D8MA 4FXKB 1P7IA 4XF1A 4UYBA 4MGQA 2QZ8A 2W1UA 2XONA 1QMJA 3AL5A 2HOSA 2LP0A 1Z7S1 3ILFA 2P2KA 2Z16A 2V4JC 4LBNA 3D5OA 3TW6A 4AAXA 3VOEA 4IDZA 1AX0A 2Z2SB 1R5ID 1LGNA 2X29A 3EBRA 1ZZ7A 2MSYA 2WT1A 4D5CA 2WO7A 5FFOC 4ZZLA 5C3QA 1MD0A 5F64A 2DBIA 4AVPA 1ETKA 1BLZA 4IRHA 2OPTA 4A7KA 3E5UA 4B1MA 1LENA 2D3RA 5A1AA 3IDBB 1MH3A 1J83A 2ZJ2A 4E8CA 1S0GA 3AX4A 5CISA 4RGRA 3K4LA 5IP7J 3HVDA 1G7YA 2RS12 1RUNA 2EV0A 2D1HA 1J3PA 5IATA 3WU1B 2ES3A 3ZN5A 2DCJA 5BNOC 3FZVA 4UB8C 3CF6E 4ZONA 3TO6A 4HV6A 2W1SA 4LLOA 2R7DA 3P9IA 1RUC3 1JGGA 5J47A 2HBUA 2VUDA 3S57A 3BPZA 2F4OB 4XLAA 2HOEA 4B09A 4CZSA 3NV2A 2JPBA 1JHHA 2Y6JA 3AYEA 1SVLA 3I64A 1SAUA 4D7YA 1LFPA 2I2SA 3VZJA 3KIOA 4GQ7A 1EY2A 5A3PA 3RWKX 3ZYJB 1C5HA 4ENKA 4G7HF 2XGDA 2FBEA 2ET7A 2YU9J 3NVCA 2KKOA 4Y13A 2NS8A 4I09A 3IKVA 2VBDA 4DZJA 3H9QA 2XUBA 2W25A 2PFWA 4M3CB 5H9RA 1Z7S2 5DZFA 4EN8B 1YFXA 1H8VA 3I3BA 1UMIA 2PJPA 2FDKA 3HNYM 4K1YA 4F91B 2QEXI 1XYPA 4F93B 4ZDPA 5FZOA 5C3SA 2D40A 4RB3C 1USTA 4QGNA 2Y6LA 4SLIA 2FOWA 2BW3B 3BKZA 2F5FA 2HWE2 5T55A 4FT8A 3H3LA 3QRFF 3TL4X 4CCEA 3WG2A 3R4SA 3GEZA 2VMHA 4QPGC 3GF6A 4FTEA 1D0ZA 1QZZA 4FX4A 1V6IA 4QPIC 4QQOA 3WNMA 3D5SC 4XBFA 3VSKA 4Q4X1 3BLYA 1FI2A 1ULFA 3IAM2 1NKGA 5FLXZ 1E57A 2KJBA 2XRLA 5TRDA 1Y0NA 1CZSA 2WY8Q 5IAXA 3J80Z 2VE9A 3VKMA 4BK4A 3NNGA 5FOJB 1GV2A 3MV01 4CH7A 4ARXA 1R1UA 2R5ZB 1ASJ2 1J58A 3MEPA 2WO1A 3ACIA 5D2AA 5KAFC 3M07A 4AHZA 1K5MC 3WLUA 2R7ZJ 2J1AA 4A4AA 3IBMA 5ANNA 1ULDA 1HB3A 3F3XA 3IRRA 3WY6A 1F43A 3H5AA 4RLQA 4Z07A 4FHTA 3AG3H 4XOPA 1YW7A 3MFAA 4FPGA 1XD7A 2JSCA 2ZXJA 2J5PA 2D6KA 3RRDA 4JGYA 1U12A 3RSNA 1UOBA 2LC2A 2HWF2 2P81A 1EPWA 3BOWA 3PVOA 1VBA1 1IAWA 1ZA4A 3T8TA 4LE4A 5B1BH 4HF2A 4E7ZA 1UXZA 3I49A 3VPRA 4RD7A 2HQNA 1K12A 5FD5A 2A3XA 2W92A 1Y39A 1ND2A 3S30A 3IMMA 2FBHA 2ZOEB 2Y9ZA 3HN1A 4WXHA 4COWA 2DCTA 3DLLF 3MFKA 1NX9A 1UAIA 5AIPA 1VE0A 2IXCA 4Q8KA 1YFUA 3ZMUA 4P9XA 2O61A 3H1MA 2VODA 1IJWC 2A73B 3ZN6A 1RVF2 3KGZA 3C7EA 4LBMA 1F5FA 1ETXA 2RS13 4GMP0 3TKYA 5LWBA 2GA2A 2IRFG 2P37A 1T0FC 3CJRB 5EGOA 1S55A 2B46X 1BI1A 3C7HA 2FQ3A 1TME3 1HOMA 3N7JA 4II3A 3AYCA 5LA1A 2VQ0A 5CNAA 3DXJF 4DYQA 2M8GX 4AVTA 1YS6A 2ID6A 5F3IA 4V2GA 1VJ2A 4BKXA 3HTUA 4A42A 1YLLA 5D6EA 3K70D 1YOVB 3CO6C 1Z21A 1WCKA 5FZ6A 4PJNA 4HKOA 3HRSA 4FETA 2WLPA 2HI3A 4RBOA 4YG0A 3DBHB 3TN92 2H94A 5E17F 5HOOA 2PJRA 3VDDC 4HV5A 2PFBA 1Z05A 2G0EA 2WJSA 4J00A 2JDZA 3VBOC 1VIWB 5CFDB 1W0UA 1UMZA 5T5JA 1ND3B 3PUHA 4LPLA 1WJFA 5FKBA 4ASMB 1Z91A 3ILNA 1OUXA 4UFKA 5HVQC 3MMYB 2QJVA 4LBJA 4PF5A 2GXGA 1L0OC 1W3XA 2QQWA 1E5IA 2ESNA 3KP7A 3B6AA 3M3YJ 2DVFA 1LU1A 5L3GA 4B43A 2DFFA 1YFYA 1BA5A 2ZFUA 2K3PA 5EEAA 2IGKA 2XL9A 3VYUB 1WKMA 1X4OA 3WX5A 2FHRA 4Q4X2 3SC7X 4XXPA 4G3YC 4COYA 3HGYA 2LUWA 1IS4A 1IN6A 4MXVA 3SXYA 4FAGA 1WQ2A 4QPYA 1ZZ9A 2JSPA 1DLCA 3TEXA 3QPLA 1D2SA 4AFDA 2PHWA 1XRUA 3O5SA 2RVCA 3KF5A 4J25A 2O7OA 2R30A 2V5YA 4XFBA 5BXXA 4F55A 2AC1A 3RI8A 4CDXA 5FZAA 3EJKA 2IC1A 3F22A 5H6RA 2QBYB 3A21A 2ISYA 1HJGA 2DCKA 3VBOA 1S0CA 1USSA 2P6SA 4MEYF 4PCQA 3HOTA 2V6EA 3J81K 2WSUA 4DB5A 3GGLA 3U0ZA 3BODA 5F6LB 4DY3A 4EM2A 1JZ5A 3EYIA 1W4MA 3WNXA 5FR3A 1GWMA 2OQGA 4XHBA 2IUWA 1G8XA 2ZFWA 3G2BA 2RDSA 1MMGA 1LHUA 1W7PB 2VZTA 1FSEA 4RGGA 2EZLA 5D5WB 1E3HA 2VNVA 5ACA3 3CO7C 4Q4V2 4GB33 5EYYA 3OIPA 3GM8A 4OUSA 3SYTA 1GQHA 4UFLA 1RUJ1 3TDZC 2C26A 2WV0A 1UW8A 2YR2A 1PO12 4HZFA 3KPHA 1ETYA 5K0UB 4AD9A 5CKTA 5B4XA 5I0TA 2D5VA 1ZZ8A 4A3FJ 1JZ3A 3GUDA 1TQPA 1UU6A 4AIHA 2ZMEC 2Q0OA 5FCCA 4NIDA 4XF4A 1SBDA 3N36A 1VF9A 1XBFA 5FREA 1AR63 3ZYIB 4XAAA 1X9PA 2PN6A 5BPDA 2AEZA 2XB0X 3OR1C 3NSTA 1BCXA 2O8XA 2QQBA 1AX2A 2W1QA 4A3MJ 3KX2A 3O1VA 5ABJC 4EVIA 3RTRA 1ONAA 1VAVA 2RR11 3MO4A 5C3PA 4IE4A 3BPVA 4RGSA 4LBLA 5IVJA 5GTIC 3I97A 2WN3A 2FZ2A 4I6ZA 1C8M2 5LY1A 1B35A 2WB1N 2OCEA 3HOSA 2X09A 2UZKA 3OYDA 1SPPA 2RJLA 4XFIA 3RI9A 2R92J 4B7KA 2WO3A 4XM3A 4Q4ZF 3S2HJ 4HXCA 3K9TA 1XB9A 2IXSA 3GFMA 2K4JA 2VVDA 2XKPA 1P7JA 4WVVA 4Q0SA 2H0BA 4BY7J 1XGOA 2MC4A 1XMAA 5FGMA 1T39A 1ASJ3 1A8MA 1Z0XA 5ICEA 5D5UB 4AXOA 5D6FA 4CP9A 1UKGA 5EXOA 1QJX1 3COAC 1RUE2 3I5UA 2HOTA 4QQPA 1ZQ3P 5LGNA 3M1CA 1Q8QA 2P6TA 2VQHA 1GNYA 1OOPB 4XL9A 4Z2YA 2N8GA 3ECQA 1R22A 3L2WA 4DYCA 1W8NA 2VMCA 4YM0A 1H2NA 2AUYA 4M6XA 2DMTA 3LOCA 2DURA 3MF9A 4QMAA 2OVUA 1HJFA 4RFT0 2VG9A 1AYN3 2WZR1 1X33A 2Y9YA 5FUNA 1AL23 5L73A 1TNFA 4CGZA 1OH3A 5IK7A 5A6YA 2XAJA 4RHV1 3KD4A 1AWCA 1MNMC 4XFGA 4AHXA 5DAWA 1GUIA 2Y6FA 4BBSJ 1C57A 1APLC 3PL8A 1Z9CA 1QJX2 2LLKA 2W68A 2Y26A 2MA3A 2VCAA 1SLLA 1NCRB 3JSOA 2VCBA 1UY0A 3CCMI 5FY1A 3KT7A 3T1MA 4LG0A 2AENA 5C71A 5FRMA 1X50A 2OUHA 2XF6A 1I3HA 5FPAA 4QPGA 3K4BA 2W24A 1W8ZA 2F5VA 1XC6A 1LFBA 3PUIA 1GOGA 2RNGA 3EDPA 3CEWA 2OBPA 2BZTA 3VD4A 1SLIA 5F9TA 3LQQA 4GMP3 5JHFA 1DU0A 5CKMA 3PJQA 2JENA 3ZKUA 3OYWA 1IZ1A 3S16J 4XMYA 4JTNA 5LRRA 1QH7A 3W20A 1ST8A 1US2A 1W9TA 4SBVA 3PIJA 1WCSA 4BXFA 4MHUA 4LOSA 3O1PA 4TYSA 3DP7A 3HTSB 1FPN3 1WCDJ 2O8KA 2OQRA 4XABA 2A69F 1FJLA 4QTRA 2IEKA 3OS0A 2WABA 1YNAA 4O9GA 4S0HB 1AYN2 3IL2A 3JRCA 3WG1A 3IKWA 1IOAA 3RG0A 4EV0A 1V9U2 3VBSB 5A1FA 2CSOA 5EJ1B 3O7OA 3GHNA 3WXPA 2MW8A 4XKVA 1LOEA 3ZN0A 4UBGA 1J1LA 5A6XA 5JPNB 3OOPA 5IUQA 1MS0A 3HHGA 4PZJA 2HJIA 5E1XA 1E17A 2L3DA 2NXNB 3MCZA 4Z6YA 4FPJA 4M01A 3F8MA 3IM0A 1CONA 1RITA 1VBE2 3KF3A 1D4M3 2VW1A 1N3PA 1OQ1A 1KITA 4ZZ8A 3DCQA 1FOD3 3OYHA 3UJOA 4MVTA 3WE3A 1X82A 3HSRA 2XVCA 1IRZA 1RHI2 1S8NA 2DA1A 3TNQA 2KL4A 1MGTA 1YFHA 4DBQA 2X6YA 1B1BA 1UB9A 2DXIA 2Z4FA 4U0VA 2PMWB 2GALA 5F2SA 3BOQA 2YROA 3CCYA 1RUE1 1X3WB 4YEJA 1BBT1 1RNLA 2VBPA 1PNGA 1VBB2 3NARA 4KIFA 1TZLA 3HZJA 1O3SA 4XW3A 1LEDA 3EUAA 3MN2A 5EFUA 5F2WA 3RDIA 4QX0A 2WNEA 3H1CA 4NPMA 4P5YA 3H8OA 3GYDA 3JRAA 2CSGA 1QRYA 1ZN2A 4RB1A 1UYXA 3ES4A 4M3EA 1POGA 1VQPI 5JR7B 3LMMA 1MMNA 1LOBA 3I2JA 4Q4V1 3UV9A 1N77A 2YU3A 3WQ7A 4NIIA 3WSOA 2KHMA 1YI9A 4RR3C 1ZRRA 2P0WA 3KYLA 1W6QB 3BQYA 1APNA 4YZ3A 1X1BA 4FFHA 1C3HA 2VQUA 3BTLA 1ZNPA 2A6ZA 5LRSA 4LHKA 4ASNA 1FY7A 5TSWA 2WZEA 2FCUA 2YY1A 3I53A 5GAHJ 3I3QA 4B4RA 3VBUC 2M45A 4J1XA 3WNPA 5FZLA 3EO6A 3M3OA 4A3EJ 1IUFA 2Y6HA 4BE3A 3L00A 5DV5A 1O3TA 3ZYRA 2IJLA 5FXXA 4QX2A 1PUFA 4YFKF 2C24A 4YNIA 3CLPA 2VKEA 1E5HA 4XKBA 2GN7A 1GR3A 4PDWB 2BY1A 1JW6A 5BNPC 2DA5A 2IXIA 3LAGA 1XYOA 3ZYGA 2V79A 2FQPA 1WW7A 1YG2A 4EATA 4MQVA 2K9MA 2QFEA 1VBD2 3POWA 1N75A 1D8KA 4EN9B 1IXCA 3WF0A 1G9FA 3B9CA 1GQGA 2X1CA 1AR83 1C1LA 3C3WA 2I45A 5GALA 4PLMA 4XMAA 1PVC2 3AFKA 2FUG2 1WWYA 1SZBA 1EV13 1RUJ3 3AZZA 1FPN1 3MGUA 2IZWA 1RUD3 1OVPA 3GBWA 4PJYA 3X29B 1VP6A 5CVVA 5HBAA 4LXLA 1AHSA 2KR2A 1EAH3 4KFCA 5DDJ3 4XF0A 3C7FA 1ALYA 1UCXA 2EB7A 4LK1F 1BK1A 3OBAA 4CDWC 5FLMJ 3WHCA 1UYZA 5DG1A 1JOPA 2B42B 2HKOA 2YG0A 1WGPA 1T95A 3BIWE 3WNOA 4QXHA 3EQLF 5DCMB 4MG2A 2JA5J 2QM3A 3HRUA 2CL2A 3JR9A 3ILRA 2MYSA 1CPNA 4O6JA 4L9JA 1CX4A 5FY5A 5L9BA 2Q1MA 1K78B 1CAVB 2WAEA 1OFNA 1S2KA 2CFXA 3I8TA 4BE0A 4RM3A 4LNVA 3H35A 2HWF1 4C91A 2M0CA 4GWNA 3AKZA 4E27A 1R093 3OGJA 3WG7H 3R60A 5CU1A 3KP4A 4B8EA 2JIGA 4MGIE 2XUMA 5A3MA 3SEPA 2JEMA 4UVCA 3K4KA 4PI0A 4QKDA 2R7WA 2NVTJ 1LEAA 4GCVA 4UXNA 2HWC3 4P96A 2E5ZA 3LPGA 3ZN4A 3ZMNA 4NC6A 4FE7A 2FA5A 4MADA 4GH4C 1U5TB 1YXWA 2ZX3A 1LOFC 4CUCA 3ZXEA 2BXYA 4PQ9A 2Q30A 1WW5A 1FNNA 4CUAA 3HEIA 1SD6A 5CFCC 4E7JA 1MACA 4N4OB 4HN0A 5T5PA 1GXQA 1SQ4A 3ZXGA 2PAEA 3T08A 3Q8FA 2E7TA 1H89C 2ZXIA 2R7TA 4EJOA 1MJ9A 2DK5A 3FL7A 3QYBA 4P5OA 3CJTB 4IX7A 1R1ZA 4AWXB 1CGPA 3M8LA 2ZJPF 1OCCH 2FMYA 1IV6A 1UZVA 5FLHA 2Z42A 1W06A 1TNSA 5FLJA 4U0WA 1W04A 2BNOA 3HC7A 3D3AA 2AXTC 1QXRA 3GTGJ 2ERFA 1ENHA 4MGSA 1NK2P 1D3YA 1KS5A 2HDCA 3HKZA 1JMUB 4E4HA 1EF4A 5DTDA 3MYXA 3POEA 3JRBA 5DEQA 5JZGB 3N9NA 4QDRA 3AMPA 1RRJA 4BQ5A 4N43C 3CUOA 3VD7A 4BISA 4IV1C 1JT6A 4CP0A 2R062 5JI6A 3FFQA 1ZBE2 4KBBA 3BG9A 2ORXA 2PAMA 3PHMA 4JGYC 3JBG3 1ULPA 1TP4A 2E1MB 4MHGA 3AMNA 1FOD2 2DFIA 2JA7J 3PQKA 4W4ZA 3W9AA 1QVUA 3TDUC 1ZBA1 4WM7A 4Y24A 3F2ZA 3SZGA 1VBD3 4HG6B 4UW5A 1SFOJ 2X6XA 4A3LJ 4S2DA 2ENRA 4C30A 2IS4A 2KXLA 5HV4A 4OIRF 4IV3B 2FU4A 4RYDA 1BIAA 5FY4A 4Y22B 2EIBA 4I99C 2R5ZA 2VZRA 2DOAA 1PVEA 4LO6B 1OLRA 2ZO4A 1CAUB 3LDBA 2M34A 1L3JA 1CAXA 5DDJ2 1WA6X 4DZPA 4HF1A 2Y33A 1KGYA 2HVRA 4GZ9A 4B8XA 3P7NA 4ZPIA 1WRJA 3MBWA 2TBVA 3PVNA 1RUG1 5EZHA 4MH0E 2RM22 2RS33 4BQQA 4FQ4A 1M1EB 1DU6A 4YARA 5E3NA 2Z5UA 1UZCA 1HLVA 1HC8A 4FCYA 3S17J 2QSFX 1LGBA 5BNPA 5H2FC 2P3KA 4LBOA 5DUKA 4YFWA 1ZRDA 1VQ6I 1PGL2 3DBLB 1UD1A 3AJYA 3FBMA 3FHZA 5ISLA 5A7NA 2DT6A 3PSIA 4FP3A 5IOYA 4XTMA 4B3XA 2E2IJ 3K1NA 1XOYA 1J84A 3HBLA 4IGQA 5BMZA 4A7ZA 4Z92B 4IOCF 4CCNA 4KI5M 3FUOA 2RQQA 3DWLE 5BS6A 5C6CA 3K4NA 3GFIA 1VQLI 4JC1A 1RMU1 4AI3A 4KMQA 3I59B 4DQAA 5GZEA 3EUKL 2EIDA 3MW2A 2XPWA 4AQSA 3O0WA 3FXJA 2PLYA 1AR71 4IXAA 3PQJA 4FTBA 3WF2A 4MSVA 4XJUA 4HA8A 1A04A 1ZARA 1HN1A 5IYCJ 1NLSA 1S9HA 3AZVA 1JYWA 1PGW1 2JG9C 4LULA 4NROA 4E4SA 5IAVA 2JIJA 3BGAA 2WKKA 3OYAA 4AQ6A 4JQTA 3SJMA 4XHXA 1FIAA 5C9AB 4DRVA 4DY5A 3UR3C 5BQTA 4LHSA 2TUNA 1HW1A 4OCTA 4G6QA 5FZEA 3BUCA 3ITQA 3N9OA 1OURA 4DIQA 3C3VA 1Z3XA 4Q2FA 4BDZA 1VMJA 5KR7A 1QHGA 3KP3A 4Y7NJ 3GCWA 2WTEA 3RVHA 2WY7Q 4XEZA 5JSOA 1U9OA 3ZYPA 1SCSA 3OYNA 4K8RB 3JW4A 1PO21 1VALA 3W6KB 2KMUA 3BTYA 3TEYA 2D6OX 4ITCA 2NN8A 3DKXA 2ME6A 3FMQA 4ZU5A 1JUIA 2PHRA 5AC93 2IGNA 1IKQA 1AUYA 5C9AA 1Z67A 3A01B 3C7GA 1R1A2 1JUPA 2O03A 1PIV3 1T56A 1OMIA 2HYFA 2LS6A 1FATA 4XYXA 3ETPA 1B8IB 4K8FA 3PNYA 2R063 3PMEA 5EHDA 3VD5A 1OQDA 4XSXF 2BBAA 4XUPA 2ET1A 3NRUA 4I01A 2C6YA 5EJCA 1K61A 2CQKA 1BHGA 4AFAA 3JTHA 4KJZA 3ZDSA 2W47A 2XSJC 3TRSB 2BV6A 2CTVA 4QKBA 2DUQA 5FZHA 1DZQA 4R4ZA 2WBKA 2M7AA 2X5IB 1W6PA 2IS2A 4G6DA 2R7UA 3I3DA 3SEQA 1XXNA 1OLQA 1VBB1 3ERMA 1LNSA 4K40A 2PQ8A 2YSRA 4N53A 2LKSA 1A31A 1TT5B 3R4KA 2WAQN 4QM9A 3RGBA 3PUAA 1EUTA 3RZHA 4IL7A 1SFKA 2EFWA 2QWWA 4IQ4A 1JUHA 1FMVA 1UU5A 2XF5A 1IPKA 1B9NA 2C4XA 1VQ8I 2W7NA 4IGOA 5IOZA 3CO2A 4AC0A 1R091 4Q1PA 4M6VA 3SNMA 1UN1A 1UPSA 1MZBA 1FYMA 1DGLA 4MTDA 2EK5A 5JI7A 3S8PA 3WU2C 5EWSA 2QKDA 3THPA 1V6KA 2JDMA 2PHXA 1KD7A 3ZXSA 5KHHA 4QU2A 3I4IA 1OJLA 2A6YA 2VJ4A 4LTAA 2QSHX 2UY9A 4Y52J 4EN7B 3RMYA 1OD3A 3WW3A 3DEEA 2JZYA 3TGNA 2YU1A 1QJFA 4NRPA 3G7DA 3NNLA 1D4M2 4S2HA 2LKXA 2FSWA 3FWEA 1QXJA 2ZZQA 3CJIC 3C7OA 3VKLA 5DM6F 5AVAA 3KEQA 4AL9A 1XMKA 1AJOA 2HXOA 3POGA 5GZCA 1RUD1 2HFHA 3GTPJ 1SFYA 4XJ8A 2R7VA 2XWJB 4MGKE 3FM3A 4I3GA 4XZPA 4KWJA 3OV8A 2WFF2 2EPFA 2XMLA 5E3OA 2J42A 4BEHB 1SMYF 1S6LA 5FZ1A 3CDHA 5DS9A 1U5YA 4PGHA 3UT0A 1SFPA 5FOBB 4CEWB 1YIOA 4BDYA 3B3QE 3U37A 2ZSHB 3EHKA 5A1LA 2KZGA 3GALA 2ZNYA 2YPRA 2VZPA 3RFRA 3NJVA 2JDYA 1LJ7A 3VZKA 2ZXHA 1C4RA 1W8HA 3WGHA 4ZYHA 4EEFG 3X2QH 5A7WA 1R7JA 2BY0A 2UUZA 3WW4A 5LBQA 1POV0 2A5YB 3N7MA 1S0DA 2CQNA 2BGCA 4JRAA 5HLHA 5FXWA 5FPZA 4QGMA 3KP2A 4Y17A 2DPDA 3J8F1 3KZYA 4BXXJ 2JICA 1QO0D 3ELKA 3GMEA 1KQ8A 3WVJA 3B9IA 1KS4A 3HRTA 4FOQA 1NA1C 4JKMA 4IERA 2I5UA 4IKFA 2BOIA 3KP6A 4EGYA 4FVVA 2ILMA 1GNZA 4BHCA 2A71A 5GPAA 1A5JA 2WV1A 4GAZA 4ISRA 1I27A 4MTEA 2ZPXA 1D0XA 3G1LA 3OYJA 2WNVC 1PIV2 5BNNB 3POJA 1QQP1 2YC4A 5EYRA 3BTCA 1A34A 4FSJA 3BTZA 1T2KA 5D4SA 4J19A 4BLIA 2BXZA 4E8DA 5JMOA 1DQ0A 1XS9A 1NY72 2QKLB 2ZC2A 5CVRA 1T98A 3ZFGC 3AG1H 3LSDA 4UV9A 2OPKA 2LFBA 3ESWB 3TO9A 1ZRIA 5FYIA 2XJRA 3WEZA 3ABLH 2H27A 4W6XA 4GRIA 1GP5A 1UY3A 2CU5A 2PTMA 4ABZA 2BGPA 1NCQB 4LLNA 3IV5A 4Y20B 3PNVA 3HQUA 5JFRA 1NT0A 4F52A 2WNUC 1ZZ6A 1AVBA 4P9YA 2EICA 5JVTA 2UYAA 4AI1A 4XUNA 1IXRC 1SD4A 1A6QA 3S3NA 2R7QA 2WZR2 1DPUA 2XF7A 1O7FA 2BFUS 4IEVA 1RETA 4GB32 3T2TA 4Q27A 1LOGA 3LSGA 1MBHA 3RQ0A 1ZRFA 3H7JA 2OC6A 1R49A 1WMFA 1REPC 3F9KA 4EJWA 3K4AA 1TQ5A 1RXFA 5FZ0A 1Z78A 1H1MA 3BU7A 1ND3C 4S05A 4GWMA 3K7AJ 4BJ6C 4XCAA 2WT0A 3Q0VA 1VRBA 2ZB9A 4KIBA 3NQHA 3SCHA 1HXS2 4OQ9A 1ZH5A 3OIOA 2FD5A 2P7VB 4YLZA 1VQ5I 1E0EA 5DN2A 2E35A 1SD5A 1V9U1 1X8EA 2GH8A 3M3EA 3FHIB 3AJZA 2QQNA 3EYYA 2YGLA 4H2AA 2YX7A 4KMFA 1DGWY 4GYIA 1C5IA 4BOWA 3LAJA 3RYPA 1AYN1 2VIXA 1R1A3 4PLOA 2UXXA 4KISA 3WHUA 3UKNA 5FIXA 1W2NA 3V64A 2GN3A 5C8CA 3GX4X 3H1WA 5KC6A 3DTIA 3E1SA 5FY0A 1LECA 3IAQA 1FPN2 4CXXA 1ITYA 3IH3A 4QX1A 5L3EA 3Q3SA 3G71I 3D5LA 5DXDA 4I98B 5IWFA 4BB3A 1UOFA 4GJZA 3USUB 2E32A 1DYKA 3IPVB 2HPIA 1Y9MA 2X9DA 5J1YA 3OY9A 4YFXF 1BJAA 1C28A 1PO22 3ZPYA 5C4WC 3J7MA 2A3YA 4M0NA 5CYVA 4O61A 2MH2A 3GHMA 4N7IA 4XAEA 2B4KA 5FRAA 2BJSA 1OR7C 3JTGA 3Q8BA 2QQUA 2NQYA 3APBA 1YJNI 3ME2A 2JKBA 4LBQA 2VXJA 1D0HA 2CDOA 3SEEA 4E4ZA 2LDUA 4A7YA 4DXRA 4LLLA 5FP4A 3VHNA 4F83A 4ES8A 2XDVA 3J7YJ 4B3NA 5E1WA 4DO0A 5FYSA 5JIUA 3P5JA 1W6QA 4ENJA 4CU6A 2STTA 4ET7A 4OMZA 3KT4A 2VXZA 5G05L 4CDXC 3M3CA 2A3WA 4NAMA 1MH4A 4K9SA 4NHXA 1J59A 3CJQB 3HN3A 2XG3A 1OYYA 3DV8A 4CDUB 3POIA 2AS5F 1AR61 3K70C 3AZXA 3EPZA 1UX7A 1N47A 2L01A 4KA4A 3ZPLA 2O14A 5FYZA 4CEYC 4LUKA 3QU3A 1VBB3 2Y0OA 1NQDA 4XIDA 2XGEA 4TXWA 4PFOA 2L7MP 4PSWA 1OVSA 3LSHA 4V2FA 3MICA 1VZ0A 3FISA 3KV5A 2WAOA 2I8DA 3MDPA 1OR7A 1Q8OA 3SISA 5KNLA 2Y6KA 1ND2B 2VPRA 3A02A 4W6WA 1OYWA 4OI4A 3ZMTA 3U9GA 3FK6A 3DTEA 5TISC 5LGUA 2JMWA 1HRV3 5CVIA 2O0OA 3QBQA 5K5RA 3V0AB 2E7XA 1GSLA 3QOPA 1VBC2 2FNPA 3HT2A 3VYSB 2JPCA 4RAGA 4MOAA 4KG8A 1ZKGA 1XQNA 2E9QA 2M0MA 4HLXA 3AKSA 4Q4W2 4QQHA 5FRNA 1LFUP 1FMD1 3VBUB 4BCUA 2X48A 4IEZA 1OKRA 3T2PA 2P7CB 5C8CC 1K42A 1QJY2 3OCPA 5GLWA 3TEZA 3CC4I 4MUVA 1TW2A 4HFSA 1XSRA 1VAKA 2X85A 5LGTA 4U0YA 1N3OA 3K3NA 2CQ7A 3J7HA 5F6FA 3PUBA 1V54H 1X1CA 2KDZA 5GAGJ 5KHDA 1LULA 3BDDA 2R042 4AOCA 4OHWA 4LLFA 5J98B 4ENNA 1QU3A 1U5TA 4B4CA 2QTWB 4L9VA 2NNYA 4FE4A 3NV1A 3NRVA 5J40A 4HNVA 2P4EA 4IHVA 1DUXC 1OLMA 3NAUA 4RB2C 5J09A 2PN5A 1UU4A 4Q4W1 3C2BA 3D82A 1SVMA 1DYPA 5K7ZA 3NNFA 2FNAA 2KA3A 4B29A 2QA4I 2CFOA 1RHI3 4M73A 1SDDB 2WWUA 2IS1A 1I3AA 4XKCA 5FZ9A 4QQLA 1KA8A 2Q1FA 4MGTA 4CZZA 2E1OA 4E7LA 3WQ1A 4G9SB 5CQGA 4V2VA 5HXVA 1YC61 1QJZA 2DJIA 1GNHA 2DFBA 3LFUA 3SXWA 2OS2A 2W94A 1KYZA 4A69C 1TEIA 4KIGA 4LB5A 2M30A 2H1KA 5EIYB 4LJZF 2NVUB 2MD5A 1I5ZA 4BK5A 1X36A 1SDWA 5FPBA 3J81Z 2EFQA 4JZRA 1HB2A 4CE8A 3L2QA 2JE9A 3AP4A 5KHKA 1J2XA 1A6IA 1IC8A 3CMAI 2R4GA 3W21A 4UUSA 5GM0A 2R043 4HX7A 5D1IA 1JXNA 4FOVA 3DU6A 4KU8A 1Z7UA 4IO9F 4R52A 2G9FA 2WIIB 5C3EJ 4MXWA 1Z1DA 3ZSMA 3OPTA 3MV11 2IGMA 1CQ9A 5AFBA 3CDIA 1LGCA 4YW5A 2MGQA 3VN4A 3BI3A 4C3JJ 1MKMA 4CYCB 2DU0A 4XBNA 3BY6A 1S1AA 1LDJA 2EA2A 4QX7A 3BJOA 3H5RA 4M6YA 1IQAA 5C5TA 3KCXA 1JTXA 2MBFA 3RZZA 3MVPA 5FXVA 3AK0A 4KBZA 3A1YA 4RN5A 2CJJA 3IWZA 1RIRA 2OYZA 2MLGA 3LIHA 2KT0A 4M4RA 5FD6A 3CMMA 3WT3A 2X05A 4AF9A 4AE2A 3TEDA 3E7LA 4B4QA 2YBSA 3URFA 4K20A 3ZLIA 3AKPA 4IQJA 4HANA 1JODA 4DBRA 3K4CA 2PQQA 1AR62 4BDVB 3VEPA 2PJRB 4FFFA 3MIGA 4CPBA 3A22A 2RVAA 1I3QJ 2CUZA 3FFZA 4JVAA 4MEXF 1Y8RB 4A3KJ 1R5HA 1ZHFA 1AHDP 1L7QA 1WJ5A 3FC0A 4KWLA 1JTZX 1AA7A 1XPXA 4B7EA 3K3OA 5FQ0A 3ZXJA 3ZPOA 4Q4W3 4CO8A 1W05A 2JXAA 2XHKA 5D8AA 1E3OC 4ETSA 1MDMA 3L2HA 1W7PD 2HTJA 4CA0A 2L7ZA 5FZDA 3U21A 2P5LC 1PP7U 1LHNA 1E5SA 4QGLA 2DCEA 1QJY3 1W03A 4E7KA 3H3VK 1R6RA 4XILA 1XGSA 3RWNA 1H88C 2DMNA 4ASLA 1Q1HA 4Y15A 2F4LA 1OBNA 1JYXA 4P9FA 3J7NA 3E6DA 1FXZA 1ZZBA 3MKYB 3RZOJ 3HUGA 1AXZA 1WKYA 4M3CF 4NMIA 3DBRB 1V55H 4QPOA 4RHV3 4ANJA 3B7MA 3JBG2 3N9PA 2HWD3 1ZLJA 1HLCA 1XSQA 4R1HA 1EH6A 5T5OA 3TEWA 2LY9A 3B94A 3D5RC 2KP6A 4AYUA 1W6OA 3VKNA 1UJ8A 1AF9A 3G1OA 3SH5A 3RYRA 4C90A 5D8LB 2K27A 3TMOA 2OU2A 5LB6A 1VQOI 4H7MA 4QKNA 1WMEA 4QB1A 5FLIA 4FBFA 3DL3A 3BCBA 5F08A 2QQVA 5C4WB 3K4JA 2RC4A 1XSDA 4N53B 1RXGA 1LHVA 5FP9A 1WVRA 4GDFA 4D3WA 5DUIA 1BR1A 2HQAA 4O65A 2P4WA 5GTHC 1B6AA 3R05A 1VQ9I 5CIRA 5E3LA 2EXJA 5KXEA 5FFZA 3ZYBA 5LASA 2VH9A 5IHRA 1W39A 4BWOA 3VBSA 4HDUA 1RUE3 1VR3A 2RS32 3I59A 4FFIA 1VBC3 2ZGRA 4IV1B 3DYOA 3AKQA 4L0YB 2R3SA 3OGSA 4LD5A 5EV7A 1UIKA 4E70A 3VBSC 4CYDA 1B4AA 3PLQA 1W5CC 4X8NA 4GXOA 1VQNI 2QQIA 3BR0A 4AHYA 2OCCH 4BYYA 4CP1A 2KDOA 2DVBA 2VUCA 3L9JT 2JDHA 2UWAA 3CCEI 3MQ0A 4YZ2A 2QF7A 2CQXA 4PLNA 1WGXA 5IT3A 2B9SA 5F0HA 2L7KA 3ZM8A 4QX3A 1XGMA 2RV8A 3ZMVA 1R36A 3S32A 2VVFA 3AKRA 2HGCA 2EZKA 4NHYA 1OD5A 3RJPA 3ZYFA 1EH8A 1AKHA 2OQ6A 5H9QA 4A3JJ 3OG2A 1FSHA 2X5IC 1U0JA 2XJVA 1ZAOA 5CAZA 5FMBA 3IDEA 5FMDA 3S5QA 1GLHA 5KC5A 3OBZA 1UG2A 4PQQA 4WM8B 3I2DA 2OZUA 2EFOA 1KJRA 3THDA 1JOBA 1BK0A 1OXCA 1BVVA 1IG7A 4ZS3A 5EEGA 1BR4A 2R1BA 3P3PA 3Q9VA 4IOAF 5I8SA 2ZGTA 4WK8F 3GXOA 1EH7A 4CA9A 3J7LA 1HQNA 2ZGOA 3GZEA 5J1UA 3GLXA 4BACA 2VI6A 5BNGA 2QSGX 4MYEA 1SAXA 4XXAA 1TWAJ 1S7OA 1FTZA 4JV4A 3VBRC 5FUPA 2ECCA 4RAZA 1YQ8A 2V26A 4IE5A 2H8RA 1V6JA 1PZ9A 3CBNA 2UURA 4CPBD 1GBGA 1V3FA 1XNAA 2PBIA 4XLCA 3BT9A 2AREA 2VBXA 2WDBA 4M74A 2OZ6A 2PHTA 3CLOA 1SLCA 3ZRGA 4LKSA 5DAXA 4E9KA 2JDAA 3CCUI 5K9YA 1QXPA 5C8CB 3S1QJ 3NWSA 3K69A 2E51A 5I8YA 1FOYA 1POV1 2DCYA 1YJWI 2K40A 3FXOA 1SC7A 4AYBN 4EJVA 1D7PM 3ZXAC 2IA2A 1K79A 1OC1A 3ZQCA 3GCXA 4LJHA 5GLZA 1BOAA 2WZPP 1ZYRF 1X4PA 1X8MA 2G9ZA 4RGAA 5IP6A 2A1XA 1S0BA 3BPSA 1AOYA 3QYFA 2VPVA 5FB2A 2EINH 4BXSV 1GKBA 2VZOA 1CAUA 2Q2EB 5F3CA 3WP3A 5FMCA 3W58A 1NY71 4HN1A 3QH6A 2A6TA 1KDMA 1MEC1 5F37A 5F04A 3O2PE 1YI2I 1DU3D 2QQMA 2DTRA 3L2RA 4P9UA 4CEWC 2WINB 4BGDA 3GFLA 4ENMA 2DA4A 2K7LA 5B2GB 3VL9A 3K4MA 1XTAA 3ZIXA 3LA3A 2VO5A 4FOYA 1GZWB 2V1UA 3KQ4B 3OSDA 1V6NA 3KV6A 3BZCA 4CICA 2D43A 5FKKA 5E6HA 2FDJA 4Q4Y2 2RJKA 4NIAA 2LG4A 2UY8A 1B72A 3ZXLA 4ES9A 2DCZA 2RR12 5J4YA 1URXA 5L3BA 4GA9A 3SMHA 5L7OB 4N8MA 2WS92 4PIXA 1BC8C 1KONA 4LA2A 2J1SA 1H2KA 3ISPA 2CDPA 3ETQA 4L5JA 4XURA 2XV4S 4P1WA 3L2YA 4IXLA 2E5NA 2CGNA 3DU5A 4XUQA 4A0YA 4Q26A 2ETHA 4NOTA 1V6OA 4ESBA 4L5EA 2B0LA 4CUGA 1ZREA 5JSPA 4Q4V3 3U1DA 1DPRA 3P6BA 3ZQFA 2LRPA 3FXMA 3KM5A 4UVAA 4NHJA 1UMHA 1ZBA2 2GMEA 2BVLA 1D0GA 5M3FJ 3UKTA 3TQNA 4NB5A 3GTLJ 1YE9A 4FX0A 3OUIA 3ZDVA 4BIOA 4PCRA 1U78A 1KQRA 3I2IA 2Y38A 2ETEA 3DLAA 3MKWB 2LNBA 1XU2A 3NMBA 2LMDA 2DFCA 4BQOA 4XSZF 4YG3A 3EUHA 4YVSA 2E2HJ 3HXLA 4OHXA 2FDFA 2XH6A 1F4HA 3UJQA 5LA0A 3E6MA 1LAJA 1FAYA 1RPWA 5J1XA 1RIOH 1UY1A 1F5JA 5L3FA 1YQ5A 4D7NA 2XROA 1CJDA 3QPHA 1YUDA 5A7OA 3KETA 4AVZA 2NS0A 2D6PA 1EAH2 1O5LA 3VDXA 1TMF2 1ZX5A 2ZACA 1L3LA 4OVEA 1RJ7A 4RA2A 1YIJI 2ZA9A 1YHQI 1J3QA 3RIRA 3HQRA 4EGZA 2GU9A 2O8QA 4DRRA 5CA6A 1DGRN 2HWB1 4NJ4A 2Y30A 5D21A 5A3NA 1JHJA 2ADDA 4WVZA 4UF0B 1JYNA 2CRGA 3GWZA 3BPXA 4G6TB 2M7BA 4QPIB 4D7SA 3WHTA 1S0IA 3J9SA 2FMDA 1UHWA 2VW0A 2K4BA 4GFBA 1ODMA 1OCPA 3FMSA 1RKWA 4KH9A 4P9GA 3WG9A 2DUOA 5FXZA 2VOPA 1UY4A 2JDKA 5A32B 1OT5A 3O1UA 1BKZA 1VI0A 2F5DA 2L4MA 3N35A 3H3UA 5CPRB 2YFZA 2VOXA 1U0AA 5HPOA 4YGCA 3F95A 5E3MA 1OCTC 4G8XA 4X6QB 2PLV1 4FPYA 2D6LX 5F1RA 5ACA2 4KDPA 4AK3A 3WOGA 4HNUA 4C1XA 1X58A 4K3UA 1OA3A 3LWCA 3H5NA 4PJLA 2W3JA 4LUMA 1T6BX 4XLEA 3MKZA 2R7FA 1Y6IA 4R79A 3L7WA 1XE7A 1IN7A 1SLTA 3O3KA 1P6RA 2RG4A 1UG0A 1CWPA 3BG7A 3I9V2 4DNCA 1MIJA 3ACFA 2F2EA 4ZDOA 2TEPA 1AXKA 4NNJA 2WA3A 1ON1A 2P17A 1NUKA 3IN9A 1J09A 3ZQLA 1IV8A 1ZR2A 2XLAA 2A6HF 1R092 2DK8A 1WZXA 3UNPA 2RDRA 1HKQA 4AIKA 4HPKB 1W9WA 4NHMA 2RS11 1V5GA 2A5ZA 3CL1A 2IP2A 1R71A 3L2CA 3BZKA 4H14A 3LSRA 1UY2A 3RZLA 4XKWA 2JN6A 1IRXA 1G9BA 1KXGA 2G9GA 3UGHA 5IFTA 1SACA 5F5QA 3K4ZA 3H9JA 1WUVA 3S7EA 2LYCA 3I2FA 3BVCA 2JG9B 1WCMJ 4CU7A 4CEYB 3FXUA 2VAUA 1MZ6A 2H1LA 3BZ6A 1TW3A 2Y0IA 4BJ0A 5TGTA 1BW5A 4QXBA 2XL7A 3PUQA 2DDAA 4QT6A 1JHFA 4Y5TA 1YEWA 5L7OA 2VZQA 2AACA 4YIIA 2KPMA 3FZ3A 2LREA 2JB4A 5C44J 5EGOB 2JWPA 4JBAA 1VLNA 1X3UA 2BW3A 5I93A 2Z69A 1ZELA 4GKYA 1AXYA 4UOJA 1Q43A 3DF8A 2QLZA 5ERLA 3FUQA 3OUHA 5E1RA 3ACHA 2R041 3JZVA 1E5RA 1HXS3 4WVMB 4NC8A 4PDWC 2VGDA 4UVBA 1NK3P 3HB9A 5FYCA 4CDWA 4EM0B 3DQVC 3M9AA 1G9DA 3QODA 3LIGA 2HZTA 1BI3A 2ID4A 1TBXA 3ACGA 1XCVA 2DOFA 3UESA 1DGRA 3RZGA 4WXCA 1DBNA 1RUI3 2V09A 2VB6A 1L7LA 1HF0A 1Y1WJ 1W2AX 1A3KA 2KZVA 2YYOA 3D4KA 4CCLA 2WZR3 3MIDA 3OYLA 2OX0A 2J1VA 1HW5A 2GNDA 3O14A 1RESA 3E0JB 2ZABA 4HVQA 2VN2A 1QDOA 5E8IA 3S6PA 5CG8A 2DTZA 2XGXA 4KT5C 1YIFA 2IA1A 2R16A 1V4RA 2ZEWA 2OT7A 2IA0A 3IT8A 5JZGC 5HNFA 5CG9A 2KQRA 4XQWA 2XXZA 2Q8CA 5IVBA 4JAAA 2VQGA 3ON7A 4ZY9A 3DXTA 1BBT2 2VZ3A 2EH3A 2EJRA 4MV2A 2Y31A 3CIHA 2F17A 2BVBA 4Y33A 1H6XA 1D1AA 2FRHA 3UKVA 2UXNA 1GOFA 4IETA 1JUMA 4E7SA 2VOVA 4BHPA 4FTSA 2Y34A 3FLPA 4TTGA 3KHCA 1OOPA 1MNEA 2IVJA 4AVAA 2HWF3 1BIBA 1FP2A 5A3OA 1FOKA 3WP5A 4TSVA 1WJEA 2WRAA 1D0YA 3WUCA 1C0WA 2ZHKA 1CJPA 1J3RA 4YW7A 4RGKA 4AQTA 5A6ZA 5D5XB 2XRNA 5DABA 2EFPA 1SLAA 4QWQA 4LK6A 2Z79A 3DEMA 4TLFA 2MEV3 3NEUA 2JDPA 1H2LA 4NHLA 2HEYF 2SBAA 1JI8A 1MMAA 1HRI3 2ZMKA 5F8PA 5ANQA 2HYGD 3GW2A 4BNCA 4HKLA 5GKAC 4XCBA 2TCTA 1CAWA 5GPCA 5JLXA 2XQRA 2JG8C 2EFNA 3T4VA 3CCSI 2D5HA 4ZC3A 4PIYA 4QQ2A 3ZN6B 3DEUA 1DYOA 1LKXA 2F4PA 5E20A 4HSJA 5FWEA 4ZH4F 2DA3A 2QQJA 4Q0PA 3ZQQA 3I2HA 1XC5A 1SFUA 1PM4A 4I0BA 3IKTA 2WFPA 2DI3A 2WBMA 4W8JA 3B00A 3WTSC 1VBE1 4QX5A 4IE6A 2JG8B 4XOGA 1MS9A 1MQTC 5CLSA 4KMUX 2P8TA 4IW3A 2MFZA 3RYKA 3QP6A 3KCYA 4FPFA 1NA1B 2Q8OA 3OB8A 1Y8QB 1DDNA 3TWIA 1UELB 3OIQA 3E6CC 3PVEA 1KFXL 1T33A 3KZ4C 2ZJQF 2HTSA 2RMU1 5J4VA 4KNCA 3QCWA 4X1EA 4AEKA 1F4AA 3LDKA 3C1DA 1ENRA 3VKOA 3PSFA 2E34A 4K7JA 3ZSLA 1KU3A 3FMRA 4PGGA 4G7ZF 1EAH1 3KLOA 4Z1VA 2KIMA 1N25A 2Y75A 4HQEA 1X7NA 1UAAA 4J6GA 4EJRA 3HJRA 2A68F 3BIEA 3G73A 1O4ZA 1R00A 4EWAA 4XBQA 4C0HA 4ESFA 2CGOA 3VBOB 3BN6A 2VASA 4BE2A 3KV9A 4UUSB 1ULCA 1JZ4A 2ZGQA 1POV3 1SPPB 1SFEA 2LOOA 3I55I 4M3FA 4DUVA 1PM7A 3H92A 2EVXA 1U5ZA 2BP6A 3MW4A 2R0FA 4M0HA 2DTWA 5K0UA 1XDUA 3V8JA 3S3OA 5GADJ 1PZ8A 2A6VA 4Y1UA 4AM3A 5FYUA 3LFKA 3RQ4A 1VNDA 1O3QA 3F0CA 2R7SA 4HQMA 3HYIA 1J75A 2DVGA 4BIFA 4CDXB 1W8FA 1MBKA 3LZZA 3CC2I 2JVHA 2OUJA 1DQ5A 1F8VA 1H4HA 4LGWA 1EV12 2QGUA 1YRNB 1Q8SA 3RPQA 1XSXA 3ZR6A 4XRSG 1EJ9A 2GNBA 4LKFA 4KQ7A 4I02A 3RSJA 1LEMA 3OY8B 2ZJRF 5EJ3A 1UX6A 5HV0A 2DYRH 2XKOA 3DEWA 4XIOA 4AYBA 1DHKB 3JD73 3ZFFA 5BNNC 3LGRA 4F3JA 4YW4A 1SCRA 2BY3A 3DYPA 1AR92 1ULOA 2STWA 3CJXA 1ETQA 3VSLA 2DN0A 3BCAA 4UUTA 4Y4RA 4IHSA 5AONA 1JXSA 2VMDA 4Y22A 1TC3C 2DFHA 4LKEA 2PX9A 2HEWF 2F6BA 2OD5A 1PMHX 3ORJA 2BE5F 4JGZA 1JZ7A 1QJX3 3K51A 3DTKA 4QDSA 1VRH3 1GLNA 2VOTA 3GTJJ 1ZBE3 1ULYA 4KITB 5ICCA 2FD8A 2RDPA 1WSUA 4H0EA 1GANA 2ZXQA 3UKGA 3N4MA 3HEFA 1K4TA 4OFGA 3O8GA 1CF7A 1VQMI 2YB7A 3HOYJ 3MWMA 1GQPA 4EWDA 4IHTA 2IS6A 1JH5A 5FYMA 3GBFA 3GZAA 3WF4A 2OTJI 2CUEA 2HYJA 5FO5A 5C4WA 2DBBA 5F6KA 3I0TA 3R0JA 3T0YA 5I0DA 5DZEA 3LL7A 2EIKH 4PJMA 2HWC2 2GLOA 3VHOA 2W84A 1X2NA 4UY8I 3OYGA 4D0QA 4XN0A 3OGRA 2HBTA 4ZTJA 1G59A 3PVBB 4ZXKA 2KD7A 2C6SA 1G6NA 3TYJA 3JRGA 2L9NA 4F8AA 1Y56A 4HK9A 4I0AA 2A61A 2AQFA 3HM5A 2VXRA 2HVQA 3N7LA 2JT1A 1UOGA 4NR1A 2QUFA 1FEXA 1MS8A 1V9U3 2GNMA 4GMP1 4A6EA 4GGGA 5K7FA 2P34A 4XOTA 4IEOA 1H2MA 1QJU1 1YFWA 4G12A 3RMXA 2GNTA 3T2OA 2GOMA 5LW9A 1IG3A 3KZIC 5ILVA 3IZOA 2OTLI 2RV9A 5KHIA 4A12A 4CEYA 3WCSA 4UHTA 1VBE3 4L0PA 5GJ6A 2XBO2 3AB0A 2RN7A 1KQ9A 1MDMB 1WFXA 3EYPA 4CCJA 2CUFA 4JOMA 1HN0A 1AYM2 3MLKA 2XVLA 1OH4A 3T0BA 4CDGA 4II2A 5B3SH 3WDXA 1UHMA 4Z2AA 4AI2A 1QDCA 1SMVA 1FMWA 3K2ZA 1JBCA 3C7JA 1FT9A 2AHQA 2NYYA 1W6OB 3KFWX 3AL0B 1VB2A 4RAYA 2KIUA 1X3ZB 1IQDC 2CAVA 3MUZ1 1W6MA 2VT3A 2BPA2 3PNTA 2E36A 1JI6A 2GMMA 3HRMA 1NCQA 2HDWA 5CZKA 1GZCA 3H8UA 3BTXA 4S04A 3SEZA 4D0PA 5FQ0B 4BL0B 1RC6A 3RKQA 2CW8A 3WE2A 3PO2J 4IE7A 5JUVA 2A07F 2ICWG 5CJ9A 1IUYA 3KEYA 1AL21 2V73A 4GWIA 4OHVA 2LALA 1ZVFA 1JU4A 1ZG3A 1W8UA 4BBRJ 4FAHA 2Y48A 1WH5A 2YC0A 2Q4SA 5LATA 1DQ4A 5IVVA 3B73A 2LTPA 3ECHA 2CY6A 2WNUB 1ZYBA 5BNOA 3A03A 4LEJA 5FYHA 2CU7A 1H9WA 1G2HA 1LNWA 2V4VA 3PFYA 1MBEA 1N1YA 4ASKA 3JREA 4O7XA 3TB0A 4D7MA 1LR5A 1XNBA 1O4TA 3FXKA 4JQFA 2HWB2 1O8PA 3HOWJ 5A2QZ 1UF2C 1B8IA 1HDPA 2VXDA 5FKCA 5FP3A 3HG9A 3NWTA 1U8BA 5IT9Z 1IF1A 2M3AA 3FHNA 3JQXA 4S2FA 4RQPA 1SBEA 5K1YA 1HRV1 4HL0A 5A33B 4PDKA 2O1QA 3KZZA 3LFMA 1ZTRA 3AMQA 3VHRA 3OJBA 1I1EA 4KN7X 3CU7A 3HJEA 1D5YA 3H8RA 4XJ9A 4V1PA 1RB8G 1ZGAA 4XDOA 3IRQA 1VQ7I 2PHFA 3ZKYA 5H9PA 4KT6A 2L0KA 3NQOA 1C8M1 1U5IA 4QB6A 1I39A 4JGYB 5FTTC 3HPGA 4YGEA 4NWVA 2BRTA 1WHUA 5DAQA 5LK7B 2WFF1 5DG2A 2XPVA 2K9QA 4EN0A 2DAOA 4LHNA 4ZKTB 2MEV1 1HV0A 3CJNA 3H50A 1KU7A 5FZ3A 4EJTA 5J6XA 5LBFA 4BS9A 2C9AA 3WG3A 1ND2C 4OI1A 2LF8A 2A6WA 5LLQA 2OF7A 3NNJA 4HONA 5FZGA 3FKIJ 2YPDA 4XE9A 2IW5A 4GO1A 1PMJX 3K2AA 4I76A 1MVEA 1CN1A 1V70A 4K6BA 4UW6A 4COVA 4PBOA 2M4KA 3WTVC 5G04L 2Z9OA 3IWFA 4Q4Y3 3FIWA 2EXKA 2W91A 1BN5A 1K3IA 2VOKA 1OA4A 1LRHA 1QJU2 4OIQF 3NV4A 2FJ1A 4AI0A 1QNYA 1WLTA 3R4DB 4AUXA 1X1PA 3ZMZA 1W36D 2WS93 2VC9A 2DYSH 1H9TA 3PU8A 1RUH1 2V9KA 1FYKA 3IUOA 3BJAA 4EZ4A 2VL4A 3D0SA 4Z8BA 2JQ7A 4Q1RA 5J96B 2DMUA 3NV3A 5FROA 3CMGA 4I30A 4IVNA 1O4YA 2GC2A 3HSFA 3VB9A 1BEV1 2VTXJ 1RZ4A 1QPMA 1OKOA 3TN91 1GT0C 5C70A 1W5TA 1YW9A 4IV3C 2EV5A 1FYLA 4IRIA 2HEOA 4BAYA 4NDLA 4AEDA 1S4CA 1PVC3 3OSGA 2LVSA 1N78A 2CMPA 4QPIA 1DGRM 2K46A 1HKSA 1FOD1 3RKXA 5CFCB 3KYDB 1H8TC 2VCCA 3BALA 3ELNA 3WG4A 1NG0A 3U1XA 2FBKA 4M3CE 1O8SA 5DQ0A 3CQOA 4EQQA 4IHYA 3M8EA 5C7GA 4L8QA 1GVDA 4XQFA 3N7KA 1ZG5A 3OYIA 3ZSKA 1MS5A 4ZJZA 1LKNA 3ZFGA 5J7MA 3LSJA 4QLCU 4GD4A 5FZCA 2A6EF 2IFRA 5C9AC 2DA7A 4O9EA 2XSDC 3AFGA 3FN9A 4Z82A 5T3NA 3HQXA 4FPEA 2YGMA 1W99A 1KGSA 2H6CA 3OPZA 4LO4B 2PMZA 3E3VA 2GWRA 1GWLA 1CX1A 4NHKA 1WH7A 4B48A 4BMBA 3VBUA 3W5MA 3OF1A 2R7RA 2IGOA 5F7UA 4AWDA 3MIBA 2VE8A 3ZQIA 4LBQD 2D93A 4MNUA 2D3SA 4H55A 1HRI2 2Y0SN 1UZYA 1KFUL 4RS5B 3LDRA 2VT2A 2ELKA 4IPAA 3V7RA 4WCGA 2M87A 2ZGNA 5K5QA 4HMZA 4OMDA 4YELA 3HOVJ 5I0UA 5DAPA 4HG2A 5I91A 3ABTA 1S7AA 3HOZJ 1RUG3 2I10A 2WN2A 4HSTA 2O5RA 4IEWA 2B63J 3TO7A 3EUHC 3OPWA 1ULGA 3IAPA 1D4VB 5KK1A 2VR4A 3O12A 3SFIA 1Y43B 2GP5A 5K4LA 5IK4A 2BHYA 1OFCX 2FCTA 2VBBA 2Q8KA 4YG6A 4YM3A 1Z77A 4WM7C 3PDQA 1IN8A 3AM2A 4K21A 2M9HA 2X4HA 3ATGA 3WTUC