3IWZA

The c-di-gmp responsive global regulator clp links cell-cell signaling to virulence gene expression in xanthomonas campestris
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
207
structure length
207
Chain Sequence
LDAGTIERFLAHSHRRRYPTRTDVFRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRTRTQCELAEISYERLQQLFQTSLSPDAPRILYAIGVQLSKRLLDTTRKASRLAFLDVTDRIVRTLHDLSKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite activation-like protein
publication title The cAMP receptor-like protein CLP is a novel c-di-GMP receptor linking cell-cell signaling to virulence gene expression in Xanthomonas campestris.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transcription
total genus 68
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF00325 Crp Bacterial regulatory proteins, crp family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwzA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3iwzA01
4ZYHA 4LB6B 5HDGA 5BPDA 4O6JA 2YR2A 2HTSA 3ZP5A 2RNJA 2DFIA 2F5CA 2D5FA 3KGLA 2QBYB 3R6SA 3W6JB 2B8MA 5BQTA 5FO5A 5F1RA 4OFGA 1XSVA 5CU1A 3DXJF 2K27A 3G73A 1J59A 3KE2A 2XV4S 2Z2SB 3OCPA 5D1IA 2R7FA 4M9XA 3ZMDA 1IXCA 3ZMTA 3KP3A 2PAMA 1BM9A 3RKXA 2XL9A 3LAPA 4AVAA 3MWMA 3L7WA 1EY2A 2H6BA 2IXIA 1FYMA 4YSFA 5E1RA 2PMHA 4AVBA 3RZZA 1AOYA 3WTZA 5LEKA 3JZVA 4CGZA 1O3RA 4E2SA 2GAUA 1HW1A 4O3MA 4QLCU 3ST7A 3K1PA 5E1WA 2TDXA 4A5MA 5BUVA 3NJZA 3ABUA 1CAXB 4P5OA 3MDPA 1UIJA 3FHIB 4WWCA 1FBSA 4UVCA 2GIVA 5TRDA 3RYPA 1V4RA 3FM3A 1J0RA 1F1ZA 1O7FA 4L5IA 2JPCA 2P5VA 2PBIA 3F6VA 4Z2YA 1QXRA 4UVBA 4YIIA 2W25A 2PTMA 1RGSA 4CYDA 2P7VB 2ESNA 4HBLA 5CADA 4F8AA 1UIKA 4U0VA 4HOBA 5LRRA 2GXGA 5E1ZB 3HSEA 3VB2A 2BGCA 1CF7B 4H7LA 1Z7UA 4Q0VA 1OR7A 5L3GA 1IF1A 3E6CC 4J1XA 3LQRA 1SEFA 2AS5F 4Q48A 4MX3A 4I0BA 1WRJA 1B4AA 3O2PE 4BH9A 2B5HA 3OF1A 3FWEA 2JT1A 5FLHA 2R7DA 1QGPA 5LRSA 5C8WA 2XLFA 3DL3A 2LNBA 5JSPA 4G94A 1WGPA 4U0WA 1HKQA 2K0GA 2XAGA 1B9MA 3IDBB 3V7RA 2A07F 1HXDA 4Q0QA 4AIJA 1ON1A 1QY4A 1TW3A 1TNSA 5K1YA 2DW4A 1UW8A 2F2EA 4XFGA 2PYTA 4ASNA 4HX7A 3QRFF 2YX4A 3WTXC 4OIPF 1DPRA 3F8BA 3COAC 2CO5A 3FMSA 3REOA 2ATFA 1R23A 4KICA 1C0WA 5FLJA 1EP0A 4ON0A 3R0JA 3GXOA 1G3TA 3CJNA 1ZX5A 5FQ0B 1R5HA 1GQHA 4I0AA 5ILUA 1CAVA 4KNYA 2HOEA 3CO6C 2OZ6A 1T98A 1MD0A 1O3SA 4META 2DT5A 5K8SA 1G3WA 3J7AO 3UKVA 2RC4A 5EZWA 3GFIA 3GFMA 3OD0A 4G6DA 1YFYA 2VECA 1BJAA 1V70A 4LUMA 1JUHA 4UXNA 4M73A 3SXWA 1PM7A 2HQRA 4KT5C 1X7NA 4EM1A 1L3LA 4M9ZA 4EJWA 2RGVA 3ABTA 1BC8C 1YQAA 2PHLA 5ICFA 2UXXA 1UCXA 5JHUA 4L0ZB 1GXQA 4IEVA 5H20A 2W57A 1KGSA 1O5LA 3USSA 3I5UA 4OIQF 1Y9QA 2UWMA 3QU6A 1J3QA 3HTSB 2EAAA 2M1BA 1EH7A 3M7GA 2HDCA 4EJVA 5CVVA 1ZHFA 4Y17A 3S2WA 3V4GA 2HKOA 2ZXJA 4S05A 4UBHA 1FC3A 1XN7A 2GQQA 1PUEE 5I0RA 5CVUA 1LKNA 5L3BA 2D40A 1L0OC 4L2NA 2HQNA 5KBFA 4ORFA 4L18B 3CUQC 4BYYA 1KA8A 1K79A 2Y48A 3I71A 1FBUA 4ONUA 4LLLA 2GC2A 3V8KA 3EETA 5DUKA 1T2KA 2P4WA 1S8NA 1ZZ8A 2H09A 1W5SA 3EYYA 3IKTA 3ML6A 3LWCA 1Q43A 3K69A 4RGUA 1K7AA 4IEWA 5AIQA 2O6GE 1YS7A 1I5ZA 1ODDA 3H92A 4AWXB 1XGMA 4LD5A 4Q5SF 2KIFA 3TNQA 5L3CA 1BIBA 4UV8A 2DCTA 3GZ6A 4IRIA 2O3FA 5FLXK 4LGWA 3QAHA 3GO5A 1ZLKA 3O3KA 2HGCA 5C6CA 1JGSA 3BOQA 2MA3A 1ZARA 1SD4A 5TJJA 1WLTA 5J7MA 2EFNA 3TO9A 4PGGA 4QWQA 2HS5A 5K5QA 5DCMA 2WV0A 5DYMA 1PP7U 4KMUX 2CAUA 4GCVA 2FMYA 4XETA 2X0LA 2PN6A 2RN7A 4EM2A 4IHSA 5E1XA 4IEQA 5FFZA 2C6YA 2ET7A 2MHFA 3QACA 3C7JA 3MFKA 3FMRA 2G9WA 4LULA 2ZMEB 2J5OA 4EWEA 4KWLA 2FQPA 2CAVA 3DP7A 2G7HA 5KHKA 1U12A 4UVAA 2LKPA 3E3VA 4MEYF 1ZZBA 2BE5F 1D8JA 3IKVA 3U9GA 5JI6A 1FSHA 1K78A 3SQNA 1FWZA 2CQKA 3IDCB 3PLQA 1A04A 3D5LA 2DAOA 4CXFA 4WXDA 1NYWA 4BAYA 4B09A 3KZYA 2MLKA 1U3EM 2A69F 3V8LA 2O0YA 2CFXA 2EK5A 3WGIA 4XF9A 2K4BA 4GO1A 2ET1A 2NS0A 4KU7A 1U5TC 4O9EA 3SZPA 4XFCA 1USSA 2NNYA 5D5WB 4MGIE 1O57A 4HX4A 2UY9A 2V1DA 2WTEA 2Y75A 4HVQA 5FLXZ 4P9FA 1FYLA 2QYOA 4HQEA 4RGXA 2M30A 1F5TA 1FZPB 2XASA 5DUIA 3KP6A 1SFXA 2K7LA 1BI2A 5J3UA 3BJAA 2IXKA 1XGSA 5HDKA 1YUDA 2EFQA 2NAZA 2OPKA 1SMTA 2L4MA 1YG2A 2HFHA 4ESBA 3KFWX 1BIAA 1B9NA 3VOEA 2JRTA 2K86A 5CYVA 3MZYA 2P5LC 3TO7A 4HDUA 2B0LA 2P8TA 4NB5A 4WF2A 3LQQA 2HTJA 2QLZA 4M72A 3CJXA 4IERA 1DDNA 2MC3A 3RPQA 4L9TA 1ZGJA 4HW0A 3FX3A 4IXAA 1VR3A 4F7ZA 3U10A 3F8CA 2WFPA 1SMYF 3S7EA 1BI0A 3M8FA 4HV5A 1D8KA 5LGTA 5D5XB 4YFKF 3ZDSA 3P7NA 3FE5A 1YHFA 2L3DA 1KQ0A 3DV8A 3O6BB 1IXSB 4R79A 4N9HA 2L02A 2QJVA 2K02A 2DU9A 3E5XA 1MJAA 4R1HA 5LGUA 4IRGA 3FHZA 4LK1F 1XSXA 3OV8A 2A3SA 3ACLA 3IBMA 2Z9OA 3FM5A 1NXMA 4P9GA 4XF4A 4ETSA 5I93A 5EEGA 1SD7A 3H1WA 1LDKB 2MLGA 1B1BA 1F9NA 2F5FA 5J48A 3PFIA 1ZRDA 2PQQA 1TTYA 1ZG3A 1W7PA 2GXBA 2GA2A 3N4MA 1S6LA 1WKMA 3CTAA 3NEUA 4Q0SA 3V7CA 2UZKA 1U2WA 3GVAA 1O3QA 2P6SA 2PJPA 1OYIA 4HF2A 1TLHB 3OGJA 1S7OA 2OQRA 4Q29A 3BCWA 5I0SA 1KU3A 4QM8A 3GF2A 4ESFA 2R3SA 1R1UA 3HTUA 4BNCA 4YFNF 3CLOA 2FU4A 1UHWA 1UD1A 5DD4A 1O4TA 1NE6A 1FT9A 2MD5A 3E6DA 1ZN2A 2FNPA 2IPQX 3IRQA 2IT0A 1E2XA 3C3WA 4PIZA 1LB2A 2ZJ2A 4HA8A 1YO5C 4KMFA 3LA2A 1IPKA 4A6EA 5KHHA 3V7SA 4HSJA 1VTNC 5HDNA 3M3IA 5BPIA 2ZKLA 1Z05A 4KYWA 2Z69A 5HI0A 5CVJA 2A5YB 2FMLA 2QQ9A 3E5QA 2A68F 3FXUA 5E8IA 2BBYA 2OA2A 3VFZA 4TLFA 3CUQB 4AXOA 5DCFA 4XFIA 4WXCA 4I3PA 2ELHA 1RNLA 2W85A 3WGGA 3E5UA 2QQAA 1FX7A 1D5VA 5FB2A 2NYXA 3F22A 5KHIA 1ULYA 3BJ6A 1JHHA 3T1BA 3IRRA 4RB1A 1S7AA 1T6SA 4Y13A 2XUBA 3LAJA 3KP2A 3BDDA 4UV9A 4A0XA 5LHHA 4E2GA 4Q0PA 2IRFG 3CL1A 2YPRA 2ZFWA 3TDZC 3WODF 3DPLC 3ELNA 2Z99A 3K1MA 3LAGA 2YU3A 5A2QZ 3TDUC 4L5JA 4RAYA 3I64A 3KLOA 1EPZA 4NHJA 4RGSA 1IN4A 5D5UB 3NVCA 5D6FA 4IEOA 3R61A 1ZG5A 2VBXA 1WI9A 3Q5FA 1LJ9A 2QCSB 5CLSA 2KKOA 3FJSA 3JSOA 5D4RA 3HT1A 2KXLA 2Q4SA 2QUFA 4LUKA 2EA4A 1R5GA 4Q4ZF 5D5VB 2FNAA 5ICEA 1BC7C 2Y0OA 3H9AA 3F8NA 3BPVA 1O5UA 3GFLA 2I45A 1P2FA 1ZYRF 3JAMK 3ZN1A 4FX4A 1XCBA 3K1NA 5K5RA 1RTVA 3P9KA 1KYZA 5D6EA 4QGNA 1R1TA 3C1DA 5D8LB 2RV8A 2F4PA 3CUOA 1VJ2A 3HHGA 2PAKA 3WU1B 3GW2A 4HLXA 2MBFA 2VC1A 2JSCA 3EYIA 1HKTA 4X6RB 4I2OA 4A2UA 1U5TB 2IXCA 2ETEA 4LJZF 1YTYA 3ZN0A 1YW8A 4XFAA 4IRHA 1O7LA 1YFXA 4NVPA 1FSEA 2OZUA 1W4MA 5DEQA 5JSOA 4IJAA 3WTUC 1CAUA 1FXZA 1TQMA 4KIGA 2IXHA 3T0YA 1ONVA 5JSRA 2EV0A 2GC3A 3L2CA 3P9IA 1YFUA 1QZYA 4YIFA 3H1YA 4PCQA 2FBKA 2DTRA 1J75A 2LDUA 3SZTA 1ZREA 4EROA 3GZ5A 2EV5A 2PAEA 4G9YA 4LLOA 4XF3A 2XKPA 3WGHA 1G3SA 2EFPA 4O9GA 1WQ2A 3QU3A 3J80K 1ZGAA 4KDPA 1KQ8A 3EQEA 1Y3TA 2QVSB 1YW9A 2GU9A 2V79A 3I59A 3HUGA 3VHRA 2XHKA 4L9JA 1QXJA 2PEXA 3LOIA 4U7DA 4EVIA 5JFRA 2Q0OA 3JAMZ 3SFZA 3CLPA 2OAZA 1TW2A 1YLLA 5HLHA 3BU7A 4MUVA 4AVCA 1OFNA 2V1UA 2OA4A 1X8EA 5JVTA 4D7TA 5BOXA 1YS6A 1J9IA 3HYIA 1DUXC 2VONA 4PZJA 3J81K 4LG0A 1J7KA 1RIOH 4XF1A 4KFCA 2EJRA 5ILSA 4YG2F 5BXXA 1MJBA 2GC1A 3KEQA 1IN8A 1Z9CA 1UPIA 3WG9A 4J1WA 3ECHA 1R58A 4FT8A 1MDMA 5FGMA 3ZQ7A 3BWGA 2IC1A 1CAWA 2VOPA 5AONA 2VBWA 4XBFA 4S04A 4IEUA 1ZRCA 4MTDA 2KRFA 2FA5A 2D45A 1SD5A 3E6BA 4IEZA 4ZH4F 3U0ZA 2HYFA 2UYAA 2G7UA 4P96A 3WW3A 2M5WA 4UXAA 2PG4A 3LFKA 1ZZ7A 4RS8A 4XFHA 3KEOA 2GH2A 1KYWA 4IESA 4QX5A 2W84A 1OYWA 5LGNA 4MQVA 2CSOA 5LHGA 2CWEA 5L3DA 1H1IA 4QXKA 1R1VA 3RDIA 1T38A 4A0YA 4Z07A 1T0FA 4K8FA 4IHTA 1OKRA 3PQKA 4UHTA 3TOAA 4YARA 4ENMA 3M8EA 1GXPA 1FLIA 4GGGA 4HVRA 1UB9A 1GQGA 2VQAA 2VN2A 3QPTA 4A6DA 3WE3A 5J8FA 1IXRC 4UBGA 5E16A 2Q1ZB 4G7HF 1IZ1A 2JZYA 2QWWA 1SQ4A 3N97A 4MGZE 3L2HA 2E9QA 2RDPA 3K0LA 4MGKE 1HQCA 3T5XA 3EO6A 1P92A 1B59A 4WVZA 1CX4A 2F5EA 3KGZA 2QBYA 5HLGA 3EDPA 3G3ZA 5ED4A 4EV0A 3J81Z 2EFOA 1RUOA 3WTVC 4HMZA 3BP8A 3I54A 2XAQA 4KU8A 2L01A 2P7CB 2IXLA 3BJOA 2M45A 4GYIA 1J3RA 1X8MA 1HSTA 4PJYA 1YFWA 4MGYE 5H6RA 3QPHA 2VE9A 1CAVB 1ZH5A 3U11A 1XMAA 1TNTA 1H9TA 4G8XA 1RUNA 3I53A 4AIKA 3ZMVA 3U2RA 1ZG1A 1JE8A 1IAWA 4Y15A 2ZBKA 2AXLA 4XRFA 1I27A 3HRMA 3JTHA 3UKNA 2DO7A 4JBAA 3F8FA 2HYGD 2HEOA 2KJCA 4OMYA 4O5VA 2D2WA 4EJOA 1CAXA 2DQRA 2CGPA 3Q9SA 3SCFA 4BIFA 2OYZA 1YLFA 3PNAA 3GEZA 5E17F 4I98B 4RGRA 4H0EA 5F6FA 2LSOA 1QZZA 4BHPA 1XDUA 2DPUA 2VODA 3KP4A 4A12A 3BPXA 4HAMA 1XD7A 1XRUA 1MZBA 4N9IA 3KSCA 1R36A 1BI1A 1USTA 1WSUA 3GWZA 2M8EA 3ES1A 2FSWA 2DQLA 3KP5A 4QGMA 3DF8A 4UUVA 1CF7A 2FBIA 3H7JA 5FPXA 2XKOA 2A6EF 2STWA 1G4DA 4RB3C 1U6GA 3QOPA 1SD6A 2PFWA 2VT3A 5LLQA 4U0YA 3B73A 2IA1A 3DEUA 2Z33A 1NHAA 3NW4A 3M1EA 2L54A 4KWKA 1LEAA 1ZNPA 4HLTA 2FQ3A 1PDNC 2CYYA 4OU0A 3ZMZA 2ACJA 3NKTA 3GYDA 4LEJA 4MTEA 3SMHA 4B8XA 2VT2A 4M6YA 2IA2A 1I1SA 3FFQA 1DZTA 2IXJA 4XFFA 2ZO4A 3I7DA 4LK0F 5BMZA 4KIFA 1E17A 3HRTA 4CICA 5FLIA 1J58A 1H9GA 2JTVA 1J1LA 1IN5A 4MHGA 3LA7A 2W24A 3ETQA 1RC6A 2Q0AA 1RZ4A 3D0JA 4E70A 2ZKZA 5HVQC 5LEJA 3CDHA 3H1MA 2OQGA 4LLNA 4JV4A 3FXQA 5F64A 2Y0MA 2P6TA 2B9UA 4E2QA 1IN7A 4OINF 4PIYA 2EFWA 1ZAOA 3T8TA 4OLLA 2GA1A 5DCMB 4CHUA 5FQ0A 1S3JA 3Q9VA 2E7WA 4OIRF 2H27A 1KU9A 2GZWA 1LVAA 4AQ2A 1DGRA 4GXOA 4HQMA 2UYBA 1GVJA 3I58A 4QMAA 2XVCA 3E6MA 1LNWA 2UXNA 4G7ZF 2VC0A 4IVNA 3MPBA 2N7GA 4DNCA 2O1QA 2MNGA 4WK8F 5FD6A 2RKHA 2OZJA 4ZU4A 5HS9A 3K9TA 6PAXA 4N0BA 1W7PD 3QP6A 3R60A 2FBHA 1B6AA 3EHKA 1Q3EA 2XGXA 1K78B 4EGYA 4TV7A 2LF8A 1Q1HA 5HLIA 3LSTA 2D1VA 2IVMA 3CO2A 2XRNA 1WA4A 3MQ0A 3EUHA 4JVAA 2D1HA 4JQFA 2ESHA 2COMA 3RTRA 3BALA 1Z91A 3RIRA 5I8TA 2QENA 3HOTA 4R8HA 3ISPA 3S0MA 3GUDA 1IRGA 1J5YA 2XAHA 4KUMA 4ENNA 3VODA 1QBJA 3GBFA 2E1CA 4ZZDA 4HDVA 3R4KA 3WE2A 3MEXA 5FD5A 4IEXA 4DINB 5CJ9A 3ECOA 4WBBA 4PDKA 4HF1A 3WW1A 1ZVFA 1XGNA 3F8MA 5ICCA 5K5OA 1SFNA 4HN0A 4Q47A 2OU2A 2PMUA 4ZYEA 2D93A 2PI0A 3G7DA 1QQIA 2QVOA 3NL1A 5E8GA 1K6OA 4XLPF 1T39A 4RB0A 1S29A 3F72A 2XLGA 3BB6A 5JAXA 3DN7A 2QM3A 4YFXF 3IL2A 4HBNA 3RNSA 2RQPA 1LRHA 5D4SA 3C3VA 4MQ9F 2JPBA 4IETA 4LMYA 1J3PA 4MNUA 2BV6A 2DLLA 3IHUA 1REPC 4PIXA 1YFHA 2BNOA 1IPJA 2EVXA 2RVCA 4QM9A 2HR3A 4EJTA 1X3UA 2VOOA 4LTAA 3TNPB 4HN1A 3F21A 2NNNA 4KN4X 2EB7A 3ERED 2WC2A 2DK8A 3CF6E 3IIAA 1RI7A 4MEXF 3KMHA 4P55A 2ETHA 2Q30A 1PP8F 3M70A 3KLNA 4LLGF 4IEYA 4L9VA 2EWNA 4B29A 2YSRA 2PHDA 1FP1D 3DQVC 1VP6A 3SCGA 1FP2A 4CDGA 1YYVA 1SAXA 2ZMEA 1IW7F 1HSJA 2GWRA 3ES4A 3CO7C 1YW7A 2EA2A 4L9NA 4A0ZA 3WTSC 3RYRA 4FAHA 1IUYA 1W7PB 4HLYA 1Y0UA 2FF4A 1DP7P 2Q2EA 3HIFA 5FPZA 5IT9K 2V09A 3DPTA 1I6XA 1OYYA 3KCCA 2A61A 5CVIA 4EMSA 4RD7A 4M9SA 1UHMA 3O14A 2A6HF 5E18F 2QDRA 2EA7A 1LQ1A 4UNOA 5DDGA 3IC7A 3T8RA 2K4JA 5HOOA 5JR3A 3H3UA 4MH0E 2PFBA 2ZCWA 4ZZLA 4MZUA 4EM0B 4XF0A 3EJKA 3JSPA 2J5PA 5E20A 3HHHA 4LB5A 4I09A 1KU7A 1TQ5A 4WCGA 5BS6A 5FFXA 3ROUA 2IJLA 2CW0F 1NE4A 3S7IA 1QO0D 5HS8A 4M74A 3I0TA 3M9AA 4HSLA 4FX0A 2Q8KA 4DQ2A 2V1XA 3BY6A 4KN7X 4HVOA 1FPQA 2C0ZA 5DV5A 3DFGA 3FF5A 4K2EA 3B02A 3HOSA 4LA3A 3H50A 2IW5A 2STTA 3L9FA 1ZRFA 5AVPA 2LF7A 4CZZA 1H1MA 2XROA 1YIOA 1P4XA 4JK1X 5JCTA 1DPUA 4G6QA 2BYVE 5EEHA 4BXUA 1RL3A 1LR5A 1SFUA 1FY7A 3UKTA 4Q0UA 1ZRRA 1ZZ6A 2GC0A 3VEPA 3ELKA 4XLNF 3WTTC 3CEWA 4AQ6A 3GYHX 1AWCA 3FZ3A 2VBYA 1ZZ9A 4WXHA 3RKWA 1OI6A 2PA7A 3W6KB 5ICGA 1XGOA 1PMIA 2F5DA 1MKMA 1P4WA 3TO6A 1UCRA 2YX7A 1MGTA 5H6QA 5IT9Z 1FI2A 4GULA 1QPMA 1UFMA 1XSDA 5BPXA 4AD9A 3HRSA 1Z6RA 2FE3A 1STZA 4G7OF 2BNMA 5CVRA 4RAZA 1JHFA 4KIBA 4ZYDA 1TQPA 3DKWA 3OTFA 5ILVA 5KVRA 3NRVA 4I7HA 4IPAA 3H7YA 4JTOA 3LWFA 2VPVA 3LA3A 4OOIA 1Z1DA 4MGRA 3KZZA 3L00A 2BNNA 3KP7A 5LHIA 4LFUA 2O8QA 4NQWA 4FBFA 3R0AA 2H0VA 3KETA 1XCVA 3D82A 3J80Z 3L09A 2ISZA 1EH6A 5I8YA 3H3ZA 5J8CA 1EYBA 1P4AA 3MAJA 2V6CA 1R7JA 3FMQA 3ZMSA 3RJPA 3WTWC 1NZCA 2EV6A 3LZZA 5HS7A 2D5HA 5I91A 4GYGA 5D8KB 1HW5A 1O3TA 1XB4A 5LBQA 1V3FA 1XMKA 4HYEA 2FOKA 4FHTA 2KIMA 2M87A 2PLYA 3IWZA 2ZNYA 3F6OA 2E1NA 3U1DA 4WX9A 1ON2A 1R00A 3BPZA 2XLAA 3F23A 1L3JA 1Q5OA 1FYKA 2P5KA 1GHCA 2PQ8A 3RI4A 2ZNZA 1I1GA 4AIHA 4ENJA 2BEOA 3C18A 3ZPLA 4L0YB 4I01A 5I8SA 2KJBA 1XE8A 4BQAA 3NQOA 1BN5A 4HF0A 3CUQA 1G6NA 3RKYA 1EH8A 4JTNA 2UY8A 3BROA 4XSZF 5FDBA 2CV6A 3D0SA 1W5TA 4A5NA 1BBYA 2P17A 5BY5A 1FBQA 1CAUB 1SFEA 1CGPA 2HJIA 3MCZA 1OPCA 4ESJA 4KL1A 1FOKA 1IN6A 4YRDA 2O03A 3RPUA 4YYOA 2V9VA 2IP2A 1U8RA 3HQXA 1TBXA 3JTGA 3BZ6A 4Z82A 4LA2A 5FCCA 2OBPA 1ZLJA 1H0MA 1U78A 4ZU7A 1EV7A 5KK1A 1HKSA 5BV6A 3ZMUA 3IWFA 1FNNA 3I59B 2WWYA 3RYKA 2E7XA 2MH9A 3JW4A 4KWJA 3PQJA 2Z3YA 3FXRA 4XFBA 4XSXF 3ULQB 4D7SA 2VE8A 4R52A 3HRUA 1X82A 1Z6TA 2O61A 3I4PA 3SHFA 3FZVA 1D3YA 2XIGA 3V8JA 5KHJA 1MJ9A 1ZZCA 1HBXG 4IEPA 2XAFA 1LDDA 2MH2A 5JR7B 1R22A 1LEBA 4XEZA 4YNIA 2X4HA 1DGWA 2H6CA 2O8XA 2VXZA 2FEZA 2K9ZA 2ADUA 1LDJA 3H8UA 2DBBA 3AAFA 1WWXA 4HV6A 4RB2C 4MV2A 4LG0B 3MYXA 3WW4A 5EFUA 4PGHA 3E97A 4D0PA 1BOAA 3HSRA 4EQQA 4CO8A 5J6XA 2QZ8A 4BHCA 2FRHA 3HT2A 4EWDA 3GFJA 1QNTA 3NSTA 4FAGA 4HZFA 1MDMB 5I0UA 4EWAA 3TKYA 1CAWB 1TQIA 4AVPA 2HWVA 1XE7A 2OD5A 4L11A 1HW2A 3PVBB 3QP5A 2KIUA 5ERIA 4EJUA 3SHRA 4IF4A 3HSFA 1OD5A 1YWKA 2NRAC 1KQ9A 5L3EA 1IRFA 2HKXA 1JXSA 3TQNA 5I0TA 2FXAA 2MPFA 5KHGA 2DPDA 3GLXA 2HZTA 4WZCA 5IT3A 4HX8A 1U5TA 1DZRA 1P6RA 3SXYA 5DD8A 3TGNA 1F4KA 3MZHA 1KU2A 3TOBA 4I02A 5T3NA 4OMZA 2H94A 3P9CA 2IA0A 3WTYC 4ZU5A 4BHBA 3WW2A 4P9UA 3F3XA 4ENKA 5L3FA 5A2QK 4X6QB 3OOPA 3WU0A 2QQBA 4M6XA 3GX4X 4U88A 4QGLA 3K2ZA 1J2XA 2DK5A 2ISYA 1XDSA 3EBRA 4KA4A 2L4AA 4OIOF 1OMIA 2Z5UA 5AIPA 4U7BA 4EGZA 3SCHA 2XL7A 1BI3A 2CG4A 3EQLF 2QNKA 2XAJA 1G3YA 2VBZA 2DI3A 4ZYGA 1QWRA 4M71A
chains in the Genus database with same CATH superfamily
4LIVA 2R0QC 4QB2A 3I2IA 4O6JA 1EV13 2RNJA 1QPIA 4QAWA 3R6SA 3W6JB 2B8MA 1GNYA 4OFGA 2YBKA 4E6KG 1OJLA 3G73A 1OH3A 1D0YA 3CJTB 3VD5A 3WDVA 2AC1A 4GXLA 3U37A 3LSEA 3OCPA 5F2SA 3ZMDA 3ZMTA 2PAMA 1HXS1 3ON7A 4PBPA 3MV01 2XL9A 4A69C 4AVAA 3MWMA 1QJX1 1XJAA 1CWPA 2ZMKA 2W1SA 2HOAA 4D7NA 3IIIA 1D1AA 2VO5A 1G9BA 3RZZA 4XLHA 3WTZA 2F4LA 5D21A 4F83A 4CGZA 4QLCU 1YI2I 3CU7A 3A0KA 1DP3A 4DZJA 4BMEA 5E1WA 2TDXA 4OYUA 2OS2A 1WZXA 4BQXA 5IFPA 3J7ZI 3FM3A 4RGAA 2VUMJ 1GMMA 1UKRA 2JPCA 2VMIA 2P5BA 1RC9A 3OYFA 1QXRA 4LHSA 4YIIA 2DA5A 3EMRA 2ESNA 1TNRA 4QHZA 5CADA 3U4XA 2VVDA 4U0VA 3QYEA 5LRRA 2QQJA 3BR3A 2P6CA 3D1NI 3PSIA 1E5HA 1Z7UA 4R4ZA 3POYA 5FKKA 3LQRA 2L9RA 4MX3A 4Q48A 5SV5A 1B4AA 3O2PE 1COV1 4UW4A 3VD3A 2EH3A 3L2WA 2M8GX 4X6AJ 1AXKA 3BTXA 5IK5A 1FNYA 1MMSA 3UYJA 1RR7A 1R9TJ 2LNBA 2QQUA 5JSPA 3CJIA 2R7ZJ 3CCRI 3TYJA 3VDXA 3S2HJ 4U0WA 4R4XA 2K0GA 2XAGA 2VZVA 2HH9A 3IDBB 1W28A 3GZNB 1S72I 3POEA 2IUWA 3SJMA 2BXZA 4AIJA 1QJEA 2O8OA 3USUB 4NROA 1QY4A 2L7KA 1TNSA 5ANNA 5HNHA 1UW8A 2F2EA 1M4WA 3OPTA 2A71A 2E1MC 2YX4A 2YDEA 1AR91 2BGOA 1R71A 2CO5A 1R23A 1C0WA 4EN9B 1EP0A 4ON0A 3GZEA 1BR1A 2JICA 1G3TA 3CJNA 1LGNA 1L7LA 1I3HA 5E6HA 4FPLA 3CNAA 3ILFA 3K10A 3H42B 3OYEA 4UYBA 1B8IB 5K8SA 1G3WA 1JW6A 1BJQA 1EPWA 3GFIA 1GANA 2CU7A 1UMIA 5JMOA 3OD0A 1YFYA 4LUMA 1V70A 2RM21 1JUHA 1COV3 4KT5C 5IP6A 1PZ8A 4EJWA 3ABTA 3ONQA 3DBRB 5ICFA 2UXXA 1UCXA 4PLOA 5JHUA 4L0ZB 5H20A 3WV6A 1O5LA 3J8F1 3VL9A 4F52A 3ZCOA 2UWMA 4CEYB 2DDUA 5FUIA 2BHYA 1OCTC 2EAAA 5LA9A 1W0UA 1NLRA 3Q8AA 4AQSA 4EJVA 4NOTA 2D43A 1NG6A 3SKVA 4Y17A 3WDYA 5DQ0A 4S2GA 2HKOA 5DUWA 3FUQA 1IGOA 3HOZJ 2DTWA 3SH5A 4RAFA 2EZHA 2D40A 5KBFA 3I55I 2RR12 4JX0A 4P14A 2X51A 1QJU1 2NOJB 5FYHA 1FBUA 3DEEA 3A01B 4OHWA 3WF2A 4A41A 1YJWI 1CESA 2P4WA 1ZZ8A 1W5SA 3F2ZA 4RGUA 4Q4V3 1F5FA 1YS7A 1I5ZA 1QJY1 2MD0A 4AWXB 1POV1 1BIBA 3GZ6A 5FAXA 1AYM1 4E4ZA 1OBNA 2VMGA 3BOQA 4Q2FA 1ZARA 5TJJA 1VB2A 5J7MA 1G8WA 4MXWA 4V2VA 2LY1A 2ELKA 4PGGA 3GTLJ 1LODA 5FYVA 3IAS2 3N05A 5EG0A 1GKBA 5K5QA 3CQZJ 3D8CA 1PP7U 4M3BA 2VR4A 4XJAA 4XETA 2J1SA 2RN7A 3THDA 5FFZA 2ZACA 3FLPA 1X9PA 3C7FA 2HVRA 1OQEA 3A23A 3D6EA 4XM3A 3AL0B 5FV3A 4Y1ZA 3VN4A 3KPHA 3AG2H 2H1LA 1DGRN 3DP7A 3HMYA 5A7PA 3HC7A 1U12A 3CMGA 4MEYF 1FSHA 5JI6A 1K78A 2Q2EB 2GSYA 2VKVA 2DCZA 1H8AC 3HXLA 1CPNA 2CQNA 2DAOA 1LNSA 1NYWA 3OEAA 1AVBA 1FTTA 3B69A 3UV9A 2CFXA 4IV3B 1G7YA 4MHUA 3HOYJ 5FZCA 3I2GA 4O9EA 3SZPA 4XFCA 2NNYA 4MGIE 4BEHA 2BY1A 2UY9A 1AYM3 1FYLA 2QYOA 2AO9A 4NC6A 2ZGOA 4AHYA 1GR3A 2XASA 3CCVI 3KP6A 1SFXA 3ECQA 3ZXKA 3QOEA 1R1A1 1VI0A 1RUG1 1PNGA 2DA2A 3BJAA 2QA4I 2KM2A 2X9DA 5HDKA 5AC91 3M2MA 3ZXJA 4S2DA 3MF6A 2ADDA 3I3DA 3E7LA 3WG4A 3WF3A 3I3MA 3MZYA 1LU2A 1BBT3 3CC2I 2P8TA 4EQVA 4A3KJ 3UGGA 4WF2A 2VZOA 2ZHKA 3E0JB 2MC3A 1T08B 3AZWA 4L9TA 1ZGJA 4Y20B 2OUHA 4H3WA 1FMD1 2DOAA 4YW3A 1SG3A 3U10A 4CEYC 2E7AA 2HWB1 5IHRA 2WFPA 1BI0A 3M8FA 1D8KA 5LGTA 4YFKF 4B7EA 5HNFA 2CWSA 3O0VA 3IDAA 4B44A 3LE0A 5FZBA 2MEV3 4R79A 3PTRB 2E36A 3Q8BA 2F5VA 3DU5A 1G9FA 2K02A 4R1HA 1CJPA 1HQLA 4HSRA 2WBMA 4JX4A 3LB9A 4P9GA 1AZDA 1YQ5A 4XORA 4NRPA 1DFQA 1W8HA 1VBE3 4RFRB 1D2SA 1N25A 3DTEA 1SD7A 1Y0NA 1XC6A 3I2KA 2MLGA 1B1BA 1PZ9A 4XICA 5FRNA 2GOXB 5HV4A 1ZRDA 2PQQA 1ZG3A 3M8JA 1W90A 1WKMA 1G86A 3ZR5A 3VD7A 1QRYA 4NHMA 1U2WA 5TGTA 4OHVA 2YPDA 3B93A 4HF2A 2QQVA 1S7OA 4XMYA 3J4UH 1TVGA 2XC7A 1R6RA 1Y56A 4ESFA 4UFLA 1R1UA 4Y5SA 2LR8A 4YFNF 3WNPA 2FU4A 3BG7A 3Q8CA 2YGMA 2AZ5A 1D1BA 4PDWC 5EXOA 1VPHA 3J7HA 4YVSB 4OZOA 1ZN2A 4N7UA 3IRQA 2IT0A 1MPXA 1W6NA 4CRQA 1AR83 1BK0A 2P1BA 4UFKA 4GZ9A 4RR3A 3M3IA 1Z05A 2V72A 4I0WB 2W82A 4H7MA 1O8PA 3E5QA 2K46A 3FXUA 3W9AA 4IE7A 2HWB2 2L9VA 2JA6J 2J7MA 2ID3A 4WXCA 1UOJA 3HAGA 3UL2A 4I3PA 3TW6A 3AL0C 3FHAA 3BT9A 3WGGA 2JA7J 1YRNA 2KPMA 3ACIA 3E5UA 1AYN2 3AX4A 3B7MA 1OF4A 2GMMA 3SC7X 1K83J 2BZDA 2W87A 3F22A 2OTJI 2VZ3A 1VE0A 2RS31 4YLZA 3IRRA 2DBNA 4YZ3A 3ZXSA 3MKZA 5KXDA 2PELA 5CBLA 2R92J 4UV9A 4WM7B 5EPAA 2Y26A 1K5MA 3MHZA 5IVFA 5GZFA 3TDZC 5SV8A 2V4AA 3ELNA 4FTBA 4QB1A 1PGL1 1ACIA 4XILA 5A2QZ 3TDUC 1GWKA 3I64A 4ES8A 4NHJA 4RGSA 2ZHNA 1IN4A 2R041 4NWVA 2E5NA 5E3OA 1XYNA 1ZG5A 2R073 5GPAA 4OHYA 4XKCA 2DT7B 2VKDA 3K6GA 3JSOA 3FXJA 5D4RA 1DGLA 3A0HC 4ZTFA 3WDUA 2DFHA 3ZR6A 4A44A 1UOBA 3QD6A 3FKIJ 2QUFA 3OG2A 2EA4A 1R5GA 1MBKA 3VD9A 2FNAA 1JKPC 3S1MJ 4XBQA 5IJRA 2OW4A 2BBAA 2CH0A 2RDRA 5GLTA 2I45A 3WNMA 2WJSA 4Y3OA 1I39A 4FQZA 2FQ4A 2ID4A 2R6QA 2ERFA 4FTEA 2NM1A 1YI9A 1CR7A 3DXTA 1RTVA 2QQMA 1ULDA 2VJJA 5J1YA 1DIWA 3AXEA 3ZXFA 3IB3A 4HNUA 4UUSA 1VJ2A 3WU1B 4HLXA 3NV3A 2WO2A 3EYIA 4X6RB 4NHLA 1W8UA 2XGDA 1YITI 4LJZF 1QGLA 3SKJE 1YJ9I 1VALA 4D5CA 1UX7A 1YFXA 1JZ8A 1W4MA 3BC8A 4KISA 1TQMA 1C3HA 3T2PA 3VZJA 4AR2A 5JSRA 2EV0A 3P9IA 1QZYA 1X4PA 3H1YA 4R9AA 1J75A 2D98A 2LDUA 4HSTA 4RHV2 2VQCA 1SBFA 3DBHB 4Q4X3 4BQWA 3T2QA 4ZXEA 3J80K 1GP6A 3POGA 2DYCA 1Y3TA 3CLQA 5J4VA 5CG8A 3HUGA 4CDXA 4L9JA 1APNA 4IL7A 4CDWC 4EVIA 5JFRA 1Z7S1 2CUEA 2OAZA 1YLLA 5FY5A 2EINH 3BU7A 4AVCA 2VMEA 3CF5F 1UMHA 3P3PA 1SLCA 5F9TA 4RSUA 3MI8A 1MMNA 1K3IA 1J9IA 2ZZJA 5J40A 1VBA1 4NIHA 3J7LA 4PZJA 4PJNA 5IYYA 1A5JA 2JVGA 4XF1A 3CD6I 2BU9A 4J19A 3LPGA 4GWNA 2LTNA 2GC1A 3KEQA 3WG9A 3RKQA 3I49A 4NC7A 2KR2A 1UF2C 1UZCA 1AX1A 1HF0A 1XBFA 4FXGB 1JKQC 4TTGA 1QF3A 3J9SA 4IEUA 1ZRCA 2XVLA 4Y24A 2R5ZB 3NJXA 3PUFA 1YQCA 1JS9A 3MW2A 5B4NA 5J3LA 4WM7C 2VZ1A 4CDUA 3IZOA 4YW5A 2D45A 4IEZA 1D4M1 4IE4A 2CQ7A 2HYFA 2UYAA 3GZTB 2G7UA 5IP9J 3WT3A 3A0NA 3BUCA 3WW3A 2M5WA 3OPZA 2PG4A 3LFKA 4IV1A 1IUFA 4AEDA 2KQRA 3SLIA 2M7BA 1PGSA 1KYWA 4IESA 5FYSA 3WDTA 5LGNA 2XBO3 2WFF1 5L3DA 1KITA 1LHUA 4QXKA 1R1VA 3OPWA 1KJLA 4MGSA 5FP7A 2DCYA 2VTXJ 3M3QA 5FZHA 1OKRA 3HB9A 3PQKA 4UHTA 2V6EA 4DOUA 1UY0A 2GP3A 3QODA 2RS51 1BA5A 1FLIA 4GGGA 2A6VA 2KLOA 2QUOA 4HVRA 2OC6A 1L7RA 1UYYA 3HOWJ 3WE3A 3KV9A 5GAHJ 2Q1ZB 3L2HA 2W1WA 3CESA 3AKPA 4ITCA 4COWA 3H0OA 2CQXA 2BVBA 3ZYRA 3HPNA 5FO7B 4YGDA 3KWVA 1B59A 1CX4A 1F35A 2J1EA 3L2QA 4AI3A 1FMVA 3EDPA 3G3ZA 5ED4A 2YU1A 4FXKB 1UYZA 1WI3A 2EFOA 2JDYA 3BP8A 4DY3A 3K7AJ 1ZBE1 3DEWA 2IXLA 2P7CB 3BJOA 1ND2A 2M45A 1UOFA 1PVC1 1W0NA 3K3OA 4CUAA 4PJ0C 1JZ3A 4MGYE 4BM8A 5H6RA 4QPIC 4Q4Y1 2ZGSA 4QKBA 2ZSIB 1LU1A 3BR0A 1N1YA 3I2DA 1TNTA 4XHBA 3LL7A 2PLV3 4CCOA 2R49A 1BHGA 1D4M2 5CFDA 5FBZA 2EXJA 2DO7A 4DUVA 1H2LA 3F8FA 2QQOA 4Q4W3 2KJCA 4O5VA 1LVKA 4EJOA 1CAXA 2V4VA 4QQLA 2K3FA 2DQRA 5DS9A 4BIFA 4YVWA 1ULOA 2WDBA 3PNAA 5E17F 1MZEA 4RM2A 4DYQA 5FYUA 5A7OA 4BHPA 2VODA 3R0RA 5BYNA 4AFCA 1ZA7A 3KD4A 1R36A 1WSUA 4B7KA 3NJYA 2E63A 3KP5A 1W9YA 1RR8C 4QGMA 1OURA 3I3BA 3W5MA 3H7JA 1YE9A 2STWA 2A6EF 3PJYA 3CZUA 4RB3C 1MS9A 2FDGA 1H1AA 4XABA 5LLQA 3PURA 1VQMI 2IA1A 2L54A 4KWKA 3PHMA 4HLTA 1H6YA 2XWBB 5JZGB 4QQOA 1R093 3K4KA 3EUAA 4B8XA 4M6YA 4BQ5A 1DZTA 2XJTA 4UFIA 3DBLB 2E1OA 5GTIC 4DNYA 4XFFA 2ZO4A 3I7DA 4UFHA 4LK0F 3EYPA 2XJVA 2W48A 1DCSA 3C2GA 1PX3A 5EGOA 4AEJA 4EYUA 1V6IA 5FYZA 3S2DJ 1D0ZA 2NMOA 3BTYA 1SC7A 4MHGA 5A3NA 3FXLA 4FASD 5A1FA 2R7VA 2VW0A 3ETQA 2ZJPF 2JIJA 4IQJA 2ZKZA 5EJ3A 5LEJA 4PJLA 4P08A 2XQXA 2WIIB 1OVPA 4JV4A 4JGZA 5F64A 2Y0MA 2P6TA 1LFPA 5IY5H 4OINF 1V6KA 3H5NA 4G6TB 2EFWA 1ZAOA 4YM1A 4OUEA 5DCMB 4CP0A 4HK9A 1S3JA 1MZFA 2CQQA 5IW0A 2M9HA 1N47A 4CP1A 2WS91 3NWKA 4AQ2A 3PNTA 4YW1A 4GXOA 2WAFA 1GVJA 3T2OA 2VVFA 2ZX0A 5IT6A 1D2QA 3FBYA 3AKTA 5CYYA 1OQ1A 1Y1WJ 3MLKA 4F3QA 3DPRC 3MPBA 1WMXA 5K0UB 3FBMA 3IPVA 4YM2A 3S6PA 3VHOA 2X6WA 2OZJA 4XBNA 3RSJA 3K9TA 1W7PD 3C2UA 3R60A 4BQQA 1QNWA 1HDPA 1HB3A 1W2OA 5M5XJ 3KS7A 1Q1HA 2VZTA 3MQ0A 3PJQA 1VBC1 4C2MJ 3FKJA 1YCIA 3RTRA 3DPUA 2OUMA 2DWRA 1W8OA 3MUY1 3PM1A 2FJ1A 3N9PA 3BG9A 1POQA 5FP3A 1V55H 2DU0A 5I8TA 3S0MA 1IRGA 3KZ4C 1GNHA 4ENNA 3VHNA 1FPN2 4ZZDA 5FUNA 3R4KA 1X4OA 1FEXA 2W52A 3U1KA 1VMHA 5CJ9A 2DMTA 3ECOA 4WBBA 4PDKA 2ZX1A 1XGNA 3CDLA 4YZ4A 2JG8B 4CU6A 3W6VA 4XLPF 4JGYC 1T39A 2X6YA 5FMBA 1S2KA 4A3CJ 3G1OA 4YFXF 2VW2A 4LBQA 2JJ7A 4H2AA 3AFGA 4HBNA 2RQPA 2J1AA 4ZKTB 2FDFA 3C3VA 2A75A 1TME1 3IHUA 5K7PA 3NNJA 1YFHA 3LEIA 2EVXA 3ILRA 3LDBA 2RVCA 4N4OB 3PO2J 2YU9J 4XJWA 4EJTA 1X3UA 3AMHA 3PUQA 4HN1A 5E79C 1NQDA 3ERED 3CF6E 1SHWB 4I3GA 1CZVA 2Q30A 4JP0A 3H0DA 1PP8F 1HLCA 4MXVA 4AI1A 1FOYA 3VDBA 5E89A 2E19A 4LLGF 4IEYA 4CU9A 1CPMA 5A3WA 1VBC2 5JZGC 4B29A 1VQNI 2PHDA 5IYDJ 1YYVA 5CFCB 3AL5A 3RZDJ 4AHXA 3CJRB 1IW7F 2P34A 1UY2A 1NCRB 1LUJB 3CO7C 1YW7A 1ENHA 3ZMOA 1W6PB 3WTSC 5DM7F 1LHNA 1IUYA 4HLYA 4C3HJ 1Y0UA 3OBTA 5FPZA 3CF2A 5IT9K 3GHNA 3PVNA 3AYEA 5JI7A 5L36A 1OYYA 3A22A 4RD7A 4NMIA 3O14A 2AACA 1FTZA 3A4UA 1LQ1A 4UNOA 5ACA1 3S5AA 2DBIA 2CW7A 3BIEA 2WZR2 4FPCA 2DV9A 4QQHA 3ZOBA 1A36A 2RMU1 2ID6A 4AM3A 4MH0E 2ZCWA 1A31A 1PIV1 1CQTA 4YG0A 3EJKA 3JSPA 5F5CA 4DUWA 4AI0A 3HHHA 2CSGA 3VDDC 2ARXA 4I09A 1WA6X 1ZKGA 5BS6A 5FFXA 2IWGB 1JGGA 1B35C 5TSWA 3S7IA 4EN8B 2C4XA 1HKDA 3I0TA 4HSLA 1S2EA 4DQ2A 2Y6KA 4OULA 4G9SB 4OUMA 3B00A 4AEKA 2QDNA 5K0UC 4W50A 1XOYA 3ZQLA 1QMJA 4K2EA 4LA3A 2RR13 5FZ9A 2IW5A 3L9FA 3U07A 2LF7A 4CZZA 1YIOA 1W05A 1P4XA 4QU2A 3RQ0A 5JCTA 2ZAAA 2Q8EA 3M3YJ 3ZQFA 3HBKA 2BYVE 2ZJQF 5C9AB 1FY7A 1KXGA 4V1PA 4Q0UA 1ZRRA 2CUFA 2M7AA 4QXBA 4AQ6A 2X85A 4XLEA 2VBYA 4QX7A 3RKWA 4RQPA 2PA7A 3W6KB 5ICGA 4HG6B 1J1TA 5F3GA 2VCBA 4UW3A 1OCRH 3TO6A 5DM6F 2KA3A 4W6XA 4B43A 4RLQA 5IT9Z 1QPMA 3ZFGB 1UX6A 3JBG3 2A1XA 5FKOA 5BPXA 1DQ5A 3HRSA 4AW7A 5L7OC 1KJRA 5C8CA 1AL0G 1KD7A 4A3JJ 5ILVA 3ZXEA 3GBGA 2E26A 3LWFA 1UAIA 2RMU3 1Z1DA 4MGRA 3VYUB 5GZEA 4LFUA 2CTVA 2O8QA 4NQWA 1OLRA 4QPWA 2CDPA 1BOBA 3L09A 2ISZA 1NK2P 1EYBA 1P4AA 2V6CA 2WQZC 2CYFA 3FXOA 3RJPA 5FXVA 3MGUA 1QQP1 5HS7A 2IS2A 5D8KB 1LEMA 1HW5A 3AXDA 3G1LA 2TRTA 1S5LC 3ENRA 3S93A 3X2QH 4FHTA 2VULA 2GIZA 1WPKA 5C3QA 4AVZA 2WV1A 4GAZA 5BNNB 1HC8A 4D3WA 1U5YA 2E1NA 2GNTA 4MSVA 4NIIA 1R00A 2O0OA 5JLWA 5FTTC 1IV8A 4C2UA 1RINA 2WADA 1W9SA 5A32A 2VBBA 2XMLA 2LBFA 5FPBA 1AL21 2NS7A 2X05A 1Q8PA 3CP2A 3C18A 3FUOA 4IEJA 1PO21 2FCTA 4FPJA 1XE8A 4WVMA 4FPYA 2EALA 1BN5A 3C7EA 5FWEA 1G6NA 3VB9A 1EH8A 3AKRA 5FDBA 3D0SA 3EUKL 1UJ8A 2AXTC 3U75A 1CAUB 4ZONA 5FZDA 2FOWA 1PX4A 2VMCA 5FUPA 3DKYA 4K1ZA 3ZPYA 2V9VA 1U8RA 2VC9A 3HQXA 3JTGA 2PX9A 3AVSA 1X1DA 2Y64A 2OCCH 1BW6A 3GCWA 3VBUB 1CN1A 5J4YA 4W1UA 1GU3A 4FE4A 4AHWA 3OY8B 3IMMA 3UGHA 1EV7A 1JJ8C 2DUQA 3ZMUA 5F04A 2JMWA 2XG3A 2D3RA 2MH9A 3JW4A 5DZFA 1WH7A 2Z3YA 3BTCA 2LG4A 2JG8A 3S30A 5G04L 2BFUL 3RWNA 4BCUA 3VKOA 4XSXF 4R52A 3HRUA 1LJ7A 4XLFA 4P9JA 1GWMA 2EIKH 2XF6A 1GQPA 4H14A 4L92A 3WP5A 4E7JA 2E51A 5JR7B 2H6CA 3N9MA 4I30A 1RUJ1 1G9DA 2K9ZA 2ADUA 1ONAA 3OMYA 4TXWA 2HWE2 4V2GA 5JIAA 4KMQA 2FCUA 2VZSA 3AKQA 4RB2C 3U78A 3QPLA 2Y30A 4LG0B 5BNOB 3WW4A 1ASJ2 2BW3A 4PGHA 3LDKA 1MQTB 1S0BA 3HSRA 1K5JA 1TC3C 5J6XA 1BLZA 3BOWA 5M0TA 3NSTA 4FAGA 2GH8A 5C9AC 3TKYA 3M3EA 3WU2C 4AVPA 2R5YA 3MKYB 4BPZA 1RHI1 2A70A 3GXUA 4L11A 3PVBB 3QP5A 5CQEA 2JRMA 3SHRA 2LUWA 4IF4A 3HSFA 1OD5A 3W2VA 3LSIA 1KQ9A 3N36A 3L2UA 3JD72 5D8AA 4YZ5A 1IRFA 4IDZA 4PUSA 2DFFA 1JXSA 3MIEA 5I0TA 4HRIA 2MPFA 2DPDA 3ZFGC 4HX8A 1DZRA 5FPAA 1VMFA 3ZYBA 3MZHA 4P9XA 1G9AA 4RAGA 5CA6A 2VOWA 3WW2A 5JDBA 2VGDA 1TP4A 1IDYA 4CYCB 4XMIA 3WU0A 5IOZA 4M6XA 3VPRA 2CGOA 1ETWA 5CNAA 2GXAA 2KT0A 4XW3A 4OIOF 1OC1A 1RUC1 5AIPA 4U7BA 4EGZA 1K4TA 3CC4I 4LBMA 3O12A 2WBKA 1WJBA 4QX0A 1WVRA 3CCEI 2DDBA 4ZYGA 2IFRA 1CZSA 1QVUA 4XHXA 1QWRA 3ZSKA 4L8QA 4ZYHA 1RUJ3 5HDGA 2HTSA 2MABA 2D5FA 3KGLA 4GB32 1RUF2 1BEV2 2YC4A 1AYN3 3S3NA 5CU1A 1XSVA 4K40A 5L9RA 5EIYB 1J59A 3KE2A 3B94A 2VTXA 4XJZA 2Z2SB 4B48A 4GH4B 3MW3A 3OR2C 4M9XA 2I74A 2WYFA 3RKXA 2HI3A 4CEWB 2ZMEC 3L7WA 1EY2A 4FOQA 1YQ6A 4OQ8A 2DOFA 3IH4A 4QDQA 2M0MA 2PMHA 3QYBA 1SFPA 4AVBA 1MBJA 1V5GA 1LOFC 5JOWA 1O3RA 1HW1A 4O3MA 3HQRA 2AQEA 2FDHA 3K1PA 5DAXA 4LOCA 5A6ZA 3NAPA 4WWCA 1NAEA 3G71I 2GIVA 2MW8A 5TRDA 2EAKA 2R7QA 4XVHA 1J0RA 1F1ZA 2NPIA 3LSPA 4QX1A 2WNEA 4Y1UA 3GGLA 2W25A 1RGSA 4NIDA 4CYDA 1QHHD 5IVVA 4HBLA 3VBUC 2EIBA 3SQOA 5FOBB 2BRTA 3RSNA 3I4NJ 2GXGA 5C4XJ 3HSEA 2CU5A 4OI2A 1VAKA 3GZAA 4JX5A 1OR7A 5L3GA 3QH6A 5KCMA 1SEFA 3IUOA 1U5ZA 4PDWA 2AS5F 5KR7A 4I0BA 4BH9A 1TL8A 2B5HA 3L9JT 2QQIA 3OF1A 1ACCA 3FWEA 3HJRA 2JT1A 5FLHA 2R0FA 3VBOB 3LPFA 2XLFA 3DL3A 3MIBA 1PUFA 5C5TA 1XNKA 1EAH3 3RI9A 5FLVA 2YC2A 1ETQA 1HKQA 4CA9A 4CA0A 1K6YA 2NLRA 2AEZA 2BY0A 2DF7A 1HB4A 1ON1A 5BNOC 3I2JA 1MQTC 3THPA 3HN3A 4M3CB 2ZEWA 4XFGA 4COUA 1R4NB 4QSHA 2QGUA 3QRFF 2YGLA 2R16A 3VBRB 3REOA 1E0EA 2ATFA 2ZMLA 4P00B 1MIJA 3ZSEA 3TL4X 4AAXA 3B9CA 1PMJX 3R0JA 3ZXGA 3K4LA 3BTJA 3OYBA 4Q1PA 3RMXA 2DA3A 2RS12 3EXUA 2QTWB 5FQ0B 4DY5A 3AMMA 2GOMA 4I0AA 1CAVA 4KNYA 4IHYA 2OZ6A 1T98A 3OR1C 1MD0A 2HEYF 4META 4LE3A 2W94A 3J7AO 2RC4A 2NP0A 2PQSA 1WCSA 4HL0A 4G6DA 2VECA 1BJAA 2E33A 1W5CC 1G8XA 4DYCA 3MO4A 2KFDA 5EJCA 4UXNA 1O59A 2HQRA 3ZN6B 1RVF2 2B9VA 2RGVA 1OLTA 1BC8C 4I76A 1YQAA 2PHLA 3DXUA 4LKSA 5C3PA 2P6HA 2EXHA 3ZGKA 2ME6A 3ZQGA 3MIHA 4E8DA 3RJ2X 3A1YA 4OQ9A 3BODA 1D0GA 3I5UA 3S1NJ 1Y9QA 1ZR2A 1MH4A 2M1BA 1EH7A 1PNFA 3M7GA 3PUBA 3OUIA 2HDCA 5FO8B 1XNTA 5CVVA 4A3GJ 3S2WA 3V4GA 1VQ6I 1JI8A 4Z6YA 4XXPA 2W1QA 5F27A 2WWSA 3OS1A 3V65A 1GZWA 2ZS6B 1BYHA 1LKNA 1L0OC 4L2NA 3U14A 5F3CA 4CU8A 4YRVA 3GM8A 1XU2A 1OA4A 2R7TA 3OBZA 3H9QA 1AKHA 5DUKA 4YELA 2LTPA 5A3LA 1HRI1 2VCAA 3K69A 5JPNB 1UZVA 1ENQA 4IEWA 1K7AA 1XQNA 5AIQA 2O6GE 2C1FA 1ENRA 2VNRA 3ETPA 1JH5A 2KIFA 4DMIA 4NUBA 3WP6A 2O3FA 3GO5A 1P7JA 1ENSA 3BCBA 2ZKNA 3HKZA 4B8EA 2L2OA 2MA3A 3NV4A 1WLTA 3SH3A 2HWF1 4BZ4A 2JDMA 1MW7A 4QWQA 3TBDA 1AR72 2HS5A 3W2AA 2WV0A 3WG3A 1OQDA 5GLWA 1LHWA 3K4AA 4GCVA 4BQNA 5FXXA 2X0LA 1W2UA 3HN1A 4II3A 2LS6A 1H8TB 5E1XA 3K4ZA 1U0AA 4GWJA 3O0WA 4IEQA 2X6XA 3VBOC 4LORA 2G4IA 4NAMA 4CDWA 2MHFA 3K70C 4E27A 2A5ZA 5A7WA 1W9FA 3OYMA 3C7JA 1D5YA 2G9WA 4CE8A 4MVTA 3KQ4B 4EWEA 3LIHA 2C9KA 2FQPA 3FHQA 4PSWA 1KQRA 2CAVA 4YW6A 5KHKA 2LKPA 5ABJB 2GMPA 1D8JA 3IKVA 3U9GA 1JOBA 3VBSB 2OT7A 2EXIA 5CQGA 2HZDA 3K75B 4LT5A 4BUPA 3PLQA 2HU9A 3KF5A 4CXFA 1AJOA 4COVA 4B09A 5KXBA 1LHVA 3AKSA 4LO5B 3VZKA 3WGIA 3VBRC 4XF9A 4GO1A 5KC5A 3O1RA 2XPUA 5FZ8A 5B2GB 1KS5A 2HOSA 1NOVA 4HX4A 2WTEA 1RUI1 4HQEA 1T56A 4OI1A 4KGGA 1NCQB 4FP3A 2DMQA 1DQ4A 3VBFB 2Z5WA 5J3UA 1W0TA 1VBB2 1XGSA 4FFIA 1YUDA 1GP4A 1PVXA 4ESBA 1YG2A 2HFHA 1KFXL 4HPQA 1B9NA 4OCTA 2WO3A 2ECBA 4NB5A 2JDAA 4XJUA 1MEC2 1NLQA 3PUHA 2HTJA 2CGNA 2BBVA 4IGOA 5GM0A 1SLIA 4HW0A 3FX3A 4IXAA 4KBZA 3H8XA 3F8CA 3N3HA 1FIAA 3EUHC 1XYPA 4HPKB 1SMYF 2IFWA 3S7EA 5FZOB 5FFOC 3BG6A 3O8HA 4LIUA 5JVGF 4QQPA 1TG7A 2W1OA 3DV8A 3VYTB 2DTYA 1HN0A 2VI6A 1XSQA 4HFSA 2JK3A 3L2VA 2L02A 4FETA 5HPOA 2QSFX 3E5XA 2KP6A 5LGUA 3OV8A 3IBMA 3FM5A 1NXMA 4GD4A 3OIPA 5I93A 4QPIA 4QPGA 1X1BA 1F36A 4ANJA 3SEEA 1LDKB 4AEMA 1F9NA 1KS4A 2YHJA 1MS0A 1BZWA 1TTYA 1W7PA 2EBIA 1OH4A 1KRIA 1W6QA 2DVDA 1OSGA 4YW7A 3NEUA 4Q0SA 1W6MA 3WUDA 3GVAA 1O3QA 1OYIA 2LK2A 3DF0A 3RZMA 2OQRA 2WAAA 3OYWB 3KVAA 2JIGA 3BCWA 2R3SA 4BNCA 5E3LA 3CLOA 4CZSA 5JOZA 2RJ2A 1NE6A 1FT9A 3E6DA 5M5YJ 1Z3XA 5B5EC 3AP4A 2IPQX 1E2XA 3N35A 2HWD2 1U5XA 2ZJ2A 4HA8A 2ZBJA 1YO5C 4KMFA 3LA2A 3RZKA 5FY4A 4AYUA 3V7SA 4HSJA 2I5UA 4XNFA 4XRSG 4KYWA 5A3MA 4UB6C 4CP2A 3ZFFA 2A68F 1GWLA 2HYJA 2OA2A 3VFZA 1YXWA 4D69A 3M1HA 3CUQB 3TN91 5DCFA 4XFIA 5FO9B 1AX0A 3S8PA 1US2A 4PSXA 4LBJA 2W85A 1QZEA 3VUOA 1FPN3 1F2NA 1GYKA 5ABJC 2QQAA 3UR3C 3N9QA 4DOZA 2NYXA 2ENRA 1ULYA 2VL4A 1STMA 1JHHA 4RS5B 3VBSC 3T1BA 4YWAA 1MBHA 5FZ7A 1S7AA 2RJKA 3JRFA 3LAJA 3KP2A 1E3OC 4A0XA 4UW6A 4E2GA 4Q0PA 5EHDA 4NHYA 3T1MA 3M7AA 2ZFWA 3FFZA 3KQRA 3K1MA 3KCYA 3S16J 1HLVA 1OPMA 1EPZA 1V54H 3NVCA 1W9WA 5D6FA 1YRZA 1JXNA 1NCQC 3R61A 3NARA 4K7JA 4A6SA 1WI9A 3VBFC 4QXCA 3VBHB 3OIQA 5FYYA 3LMMA 2KKOA 3FJSA 5FMDA 4EN0A 5IAVA 1VNDA 4LUKA 5D5VB 1U9OA 2XSDC 1DLCA 3DPRA 4NPLA 1BC7C 4ASMB 2WNUA 2EZKA 4FOYA 1O5UA 2D6MA 4MG2A 2JD4A 5K7FA 5DDJ2 4GMP0 4LK6A 4PCRA 4N43B 3DLAA 3A21A 1Z21A 4FX4A 1B72B 1ZBA1 2YY1A 1VF9A 3CMAI 2XGCA 4HNTA 1N1VA 1ST8A 2NYYA 4M00A 4XTPA 3C7HA 2B63J 4QGNA 2RV8A 3DEMA 2F4PA 4GFBA 4D0QA 3BR5A 3GW2A 1D7PM 1XSRA 2SBAA 2MBFA 4J01A 1IGNA 4QKFA 1HKTA 4PQ9A 4A2UA 1U5TB 2WLPA 4XQWA 2IXCA 3NV2A 4OMCA 1HRV1 2EZIA 3ZN0A 1RUD2 1PO12 3APBA 3FLTA 2WZR3 1YW8A 1JZ2A 2ZPXA 1UWWA 4LO7A 1VQPI 4IRHA 2HDDA 4NVPA 1FSEA 1CIWA 1VRH1 2EXKA 2HLEA 3WQ1A 2B9SA 1FXZA 5EDNA 4KIGA 2IXHA 3T0YA 3SEPA 2TEPA 1XXNA 1WBLA 2AEYA 1GLHA 3L2CA 1YFUA 2ECCA 2DTRA 1X2MA 1C8M3 2PMZA 1JUSA 3SZTA 4JGYA 5FRMA 4G9YA 1ND3A 2DXIA 4M0HA 2EFPA 1QOTA 4O9GA 3QU3A 1M06G 3QYFA 3GF6A 1ZGAA 2M34A 4E4SA 4GA9A 1IRXA 1YW9A 1DQ6A 3FXMA 3I59A 2VTFA 3FXKA 4D6RA 1X1CA 3ZYPA 2IGKA 3LOIA 3D5RC 2LYCA 1MBFA 3WXPA 4LHKA 5A3PA 4BJ0A 1UY3A 1OFNA 4RM3A 2OA4A 1X8EA 5JVTA 2GN7A 2HXOA 4A7ZA 2RE9A 2COBA 2XVGA 3PO3J 1HJFA 1DUXC 4AK3A 2VQ0A 2W91A 4TZDA 4RBOA 1J7KA 1RIOH 4XZUG 2VUCA 4YG2F 5H9PA 1UPIA 1HRV3 3ECHA 1MDMA 5FGMA 1ZK8A 1I6HJ 2WKKA 4RS5C 1LPQA 4GALA 2Q8DA 2ARAA 2VOPA 5AONA 2VBWA 5IATA 2R061 2JXAA 1VRH3 3SDGA 3BR2A 4YW2A 1SD5A 2ZFUA 5TISC 2ZXQA 4ZH4F 5CEHA 3UESA 3H8RA 4LBLA 4RS8A 4XFHA 1PGW2 5HBAA 4CZCA 4QX5A 1OYWA 2CSOA 1RJ7A 5LHGA 4QU1A 3U1XA 1IDZA 2Z79A 1R082 2D97A 4K3UA 3VBHC 3BQZA 4A0YA 2RV9A 4Z07A 1VQ9I 3CJIB 3VDDA 4YARA 3KX2A 1Z3YA 3H8OA 3O1MA 2A6TA 3POJA 1SFKA 1GXPA 2R7EB 4PF5A 1OFSA 4XC9A 2HWC2 3F9KA 2VQAA 2VN2A 4A6DA 3PVEA 4IQPA 4COZA 5J8FA 3SEQA 3OUJA 3N9OA 1XNCA 1RUH2 3ATGA 2K9SA 3DWLE 4MGZE 2E9QA 2RDPA 2JDHA 4DZGA 3G1MA 2TNFA 4UFJA 2G9ZA 4MGKE 2ZSHB 1U5IA 2KZGA 3KYLA 1P92A 2QBYA 4FISA 1A3KA 3SZGA 1Q8SA 4EV0A 4ATEA 5A33A 1RUOA 4URAA 5F7UA 1RUE3 4KU8A 5EWSA 1OVSA 2GP5A 2XPVA 5FZIA 1X8MA 4XQFA 3ZXDA 2VE9A 3BQYA 3GJAA 2GBYA 3QLQA 2R062 4QDSA 1QVTA 3GTPJ 5L7OA 2EICA 3FN9A 5FZ4A 3UKNA 3LSGA 2HYGD 2L7MP 4OMYA 2D2WA 4IHXA 2OYZA 1UHSA 2B4KA 4S2HA 4CP9A 2K5CA 4CXWA 4LE4A 5LY2A 3MIGA 3ZO0B 4RGRA 2V1NA 5F6FA 1FJLA 4FFHA 1QZZA 4FP2A 3OYKA 1LTEA 3KP4A 4A12A 2XB6C 3V56A 3BPXA 1XRUA 1XD7A 3HEFA 1YHQI 4W65A 5T55A 4LO8A 3KSCA 3LD8A 4AGVA 3GWZA 1QXPA 2DQLA 3ZYIB 2HWE3 3DF8A 4UUVA 1CF7A 2C6SA 2FBIA 3C2HA 2JSPA 1WLDA 1G4DA 1SVOA 1ASJ3 2XRLA 3J7MA 1UN1A 3QOPA 2Y0SA 2VD7A 3PJRA 2G9GA 2IS6A 5C71A 3CDIA 3B73A 3DEUA 1UXXX 3CC7I 1RKTA 3NW4A 3M1EA 1K61A 1NK3P 4FPKA 2XF5A 1LEAA 2FQ3A 2FCVA 1PDNC 3ZM8A 2CYYA 1EV11 4OU0A 4A3LJ 3BN6A 3ZMZA 2ACJA 3GYDA 2BHZA 4LEJA 4MTEA 3SMHA 3RWKX 1XX5A 1W8WA 3MIFA 2JJ6A 3MN2A 1A8DA 2LVSA 5EV7A 4RN5A 2IXJA 5HXMA 3JD73 3HBLA 1RXGA 3RZGA 4UWDA 1OLQA 1DG6A 2VQUA 4KIFA 3GZUC 2B45X 2V4JC 5EP9A 2JTVA 3IT8A 1IN5A 1W6OA 1LE8A 3WVJA 1WJ5A 2Q0AA 5F3EA 3D0JA 5F5AA 1H9WA 3VKMA 4SLIA 3VWBA 3CDHA 3H1MA 4MXWB 4JDOA 2GLOA 2QE3A 4E2QA 2WO7A 1PYVA 5EG0B 2MFZA 2NVYJ 1UMQA 2D44A 3ESWB 4IE0A 1DP0A 1W2TA 3O8GA 3Q9VA 4RDUA 2VJXA 1VBD2 2NMNA 3TBIA 2TBVA 4KBBA 2WA4A 4ZDLA 2CMPA 2ZGQA 4W8JA 4GB33 1BEV3 1POV0 3ZKYA 3WX5A 3W2WA 3CJIC 2BWAA 3KT1A 3B9IA 3N7JA 1V6NA 4DNCA 3MW4A 4A3MJ 4IOCF 2O1QA 2MNGA 2R93J 2VMFA 1YJNI 3CJQB 3HWJA 2B39A 1IKPA 5CIRA 3QP6A 1OPOA 4QIWN 3OBRA 1S0FA 1B6AA 1K78B 4EGYA 1W2NA 3S3MA 4GIQA 4DQAA 3GHMA 4FPEA 2XRNA 3HOUJ 4JQFA 1JUMA 1Z91A 3T3YA 1WLCA 1SLBA 4XUNA 2CW8A 2XQRA 2VU9A 3A03A 3MPPG 3SH4A 1J5YA 1GUIA 5IVJA 4BEHB 1V9U1 4BU2A 4AZZA 3WE2A 1UZZA 1G59A 1FOD2 4AYBA 3H1CA 1T95A 1ZVFA 5C3OA 3GTJJ 5IPAA 3UGFA 5K5OA 4ZHNA 1KDKA 4XKWA 3DYMA 1O4YA 4FPOB 2D93A 2PI0A 3G7DA 2NOGA 2QFEA 1WMFA 5GLZA 3I8TA 3OY9A 1K6OA 2IBDA 2I2SA 4XUQA 1S29A 3ZFEC 2WB1A 2AH2A 5JAXA 3DN7A 3IL2A 1W99A 1ULPA 4E9KA 1JUIA 3NAUA 1RMU1 4Y1YA 2GM4A 4IETA 3KZIC 2BV6A 4K20A 2DLLA 4PIXA 1A6QA 5FKNA 2GNDA 4D1QA 3QH7A 2HR3A 2E2IJ 1Z67A 1Z78A 2FBEA 3VDAA 1AR62 5A7QA 2VBDA 3MD2A 3F21A 2JG9C 2UUZA 2EB7A 4B4PA 2DK8A 4MEXF 3AZZA 3HKZN 5T52A 3K4BA 4YM3A 2WT1A 2DCKA 2M2EA 1G9CA 1DGRM 3V0BA 4M3CE 3KLNA 2HXIA 2QQNA 3CZ6A 4L9VA 2LRPA 4S0HB 1JZ5A 3RZLA 4H4KC 2MG4A 1I3AA 3WHBA 1LAJA 2OF7A 3SCGA 1FP2A 4CDGA 3H9GA 3D5OA 4RLFA 1HXS2 4XUOA 2ZMEA 1QJX2 2GWRA 3IP4B 3P5JA 4S2FA 4LBQD 2V26A 2RS13 5J37A 2EA2A 1V9U3 5GLUA 4A0ZA 1FOXA 4XQDA 3FC0A 4UOJA 1CQ9A 2V09A 3LOBA 4ABZA 1ZYBA 4AE2A 1OFCX 3IDEA 4XIKA 4Q4V1 5E18F 4MADA 3VSLA 1FV3A 3HOBA 3W59A 2WAQA 3IC7A 2QKMB 5A7NA 1RVF3 3J26N 4M4RA 2K4JA 3H3UA 3JB8A 4ZZLA 1W6NB 2HDWA 1QKQA 4MZUA 5L9BA 1RMU3 3CDZB 4RR3B 1GT0C 2IXSA 5C3EJ 3JRBA 1UXZA 1KU7A 4WCGA 2VAUA 3ROUA 2IJLA 2CW0F 1UYXA 2D7FA 1QO0D 1PK6C 2X5IB 1COV2 3T0BA 2D6PA 3M9AA 5JPMB 4FX0A 2Q8KA 5JLVA 4GKXA 2XVKA 2BOLA 2EIMH 4ZZ8A 2IAIA 3FF5A 4BQOA 1YRNB 5IFTA 3B02A 1JZ7A 3KLSA 1H1MA 3BPSA 1OHFA 5LBCA 2XJRA 2LY9A 1DPUA 2PJRA 4BXUA 2CDOA 3UKTA 2CV0A 1V5FA 2EIEA 5GAEJ 3WTTC 3CEWA 2ZGTA 4MO7A 3NO8A 4HXCA 1ZZ9A 4WXHA 3VZMA 1K5MB 4BB3A 2E7TA 1XGOA 1PMIA 4OAYA 4J00A 2DJIA 2HVQA 3D4KA 2K9MA 1AR92 1MGTA 5H6QA 4N4NB 1W8NA 3I4MJ 1Z6RA 2FE3A 4M6VA 3WNNA 1STZA 5CVRA 4C1XA 3BGAA 4YGEA 3H7YA 3MLJA 3LA3A 1UZ0A 4OOIA 2QQPA 1W03A 3KZZA 3L00A 1AR73 1SEUA 2ES3A 1WJCA 3O1SA 1XCVA 3MAJA 1SDDB 5F1JA 1E5SA 2O7OA 3FMQA 2Y8KA 2EV6A 3LZZA 2AUYA 4YIRX 5I91A 3WQ0A 2RM22 4CDQA 1XB4A 1OLME 4HYEA 2M87A 2R7UA 4WV8A 4AVVA 2A3WA 3NMBA 3F6OA 4O65A 3T1LA 1MH3A 4C0HA 5DUUA 3J8F2 2XLAA 1BBT1 4O7XA 1L3JA 1FYKA 4UUSB 3OGRA 4FTSA 1AA7A 3RI4A 4C3IJ 5JMCA 1N78A 5EZHA 3CKHA 1I1GA 2BEOA 2VNVA 2LKXA 4I01A 4QKDA 5I8SA 4XURA 3NQOA 3OL3A 4NBQA 2A05A 3UNGC 3AZYA 5IVYA 3RKYA 1SBDA 5F32A 2WNVB 3QBQA 2MEV1 1W5TA 2L7ZA 1QJU2 4W6YA 3J7NA 1TE1B 5FJHA 1V5EA 5M3MJ 4P9IA 4XOPA 4KL1A 3Q8FA 1FOKA 1IN6A 2Y6LA 4YRDA 5F0HA 4YYOA 5LWBA 4L99A 1QJY2 1VBE1 1S1AA 1VBB3 3URFA 2OBPA 1ZLJA 4ZU7A 1KDMA 1T2XA 5KK1A 1AYM2 1E5IA 1HKSA 3PL8A 2AQFA 3HUGB 2DMNA 4JC1A 2WWYA 2RREA 3P6BA 4CDXB 1WCKA 4FVVA 1BMV1 1MEC3 2E7XA 3HNBM 2JQ7A 3PQJA 2E31A 4LOSA 4A93J 3FXRA 1REFA 1YC61 2V73A 4XFBA 4RR3C 1X1PA 4DXTA 2XIGA 5F5IA 1LDDA 3CP8A 1LEBA 4XEZA 4YNIA 2X4HA 2W95A 3JUUA 2VXZA 1AR81 2NQYA 3MFCA 5LFAA 4FE7A 4Y1XA 1HOMA 4LJHA 3AFHA 4D0PA 1BOAA 3PMSA 4EQQA 4AU7A 4BHCA 2P4EA 3HT2A 4XRSA 4EWDA 3Q8EA 4HZFA 4N7IA 1TQIA 4ISRA 3D5SC 5DG2A 3UJQA 2HEWF 3BTIA 4FTHA 3KHBA 2ZGPA 4CDUB 4RMNA 4DBRA 2KIUA 5ERIA 4EJUA 1K5MC 4RL7A 5FXZA 4XUTA 2Q1FA 4FOWA 5L3EA 1I1EA 4QB6A 4QQ2A 3T08A 3ABLH 4IV1B 4AEDB 3PMEA 4FO9A 5KHGA 4ZTJA 1UL9A 5FJ8J 1UY4A 5L19A 5DD8A 2GDFA 1F4KA 1KU2A 3TOBA 5T3NA 2H94A 2IA0A 3PIGA 3WTYC 2KDZA 4I6ZA 3CMMA 1HDDC 5A2QK 2HWD3 4X6QB 3OOPA 4M3GA 3QWLA 1GZ9A 3MVPA 3JXSA 3ZKUA 1BMV2 1R1A2 1K12A 1RUG2 2JE7A 2VUJA 4DFSA 5DMYA 4KA4A 2L4AA 3OBAA 3MICA 5AC92 4IW3A 3SCHA 2R071 1BI3A 2CG4A 2YBPA 4A3XA 3K4DA 4QWNA 2P3YA 2NXNB 3TP0A 1AX2A 2FD5A 3F95A 4FQ4A 1SPPA 5BNPA 5EYRA 3AFKA 2VQHA 2F5CA 2W39A 5BQTA 1OKOA 4JKMA 4XJ9A 5F1RA 1G2HA 1D4VB 3DXJF 2PMZN 5FZEA 2K27A 3LKJA 1FMD2 4B3AA 4F91B 1DQUA 1D1CA 2X5IA 1ND2B 4WM8A 2O14A 4CU7A 3UETA 1OUSA 3LAPA 4XZPA 1TWGJ 4B1RA 2WY7Q 2H6BA 1RPWA 3QPSA 5K9YA 2IXIA 4UAPA 1FYMA 5E1RA 2ZGLA 3OGSA 2A73B 5DG1A 2NZ9A 4E2SA 2ICWG 2ZOEB 5CFDB 1FATA 4QX2A 5BUVA 1CAXB 4P5OA 3LCPA 1UIJA 4YVWB 2Y6GA 4AWDA 2QEXI 4DO0A 3RYPA 2YB7A 1O7FA 2R30A 5FY1A 1JOPA 3TMOA 4ATFA 3W58A 4L5IA 2JEMA 2P5VA 2BQPA 2VOTA 1H2KA 5T5JA 3PIOF 4IV3C 3SITA 2Y34A 2PTMA 2QQKA 4AFMA 2Q5TA 4F8AA 4HOBA 3HOVJ 2WZEA 1WJAA 3VB2A 4DRRA 1VQOI 2K40A 4H7LA 2BVMA 4C8DA 4Y1VA 5DDJ3 4QD2A 3R4UA 1WRJA 4Q4X1 3OIOA 5FZAA 3CZJA 2D3PA 1LENA 3V0AA 4L0PA 2FUG2 5LRSA 2UWCA 4DEVA 2G19A 3DGTA 1OT5A 2VASA 2E7QA 3P3NA 3UJOA 4YEJA 2DFBA 1HXDA 3I2FA 1H2NA 5GALA 3LSMA 4D6QA 1TW3A 5EGOB 1F9KA 2KHMA 1JYIA 1TEIA 1US3A 1RUD3 1PO13 4ASNA 5IVEA 1WJFA 1SBEA 4F3JA 4OIPF 4JOMA 1DPRA 3F8BA 3FMSA 2RS32 2RQQA 4KJZA 4JGZB 1XC5A 2NS8A 2CUZA 4BACA 2BZTA 1ZX5A 4HONA 1Y9GA 4IV1C 1R5HA 2WSUA 3GTMJ 5ILUA 2FD8A 2WNVA 4LBNA 2GMEA 4CVUA 1QU3A 4CCEA 4P1WA 1O3SA 2WY8Q 1PGL2 3NWTA 2DT5A 2HOTA 3O1VA 1TMF3 3UKVA 2LMDA 3DTKA 3MUZ1 5FJKA 2HVSA 3FK7A 4AGRA 4AFBA 2R042 1ETOA 4M73A 4Q27A 3IPVB 1L3LA 2XBO1 4M9ZA 1MNEA 3AM2A 5FPVA 4CCJA 1W36D 1S0JA 3IAQA 3W20A 2LALA 4F92B 1X1AA 1DQ1A 4IEVA 1GXQA 4YVSC 1KGSA 4Y22A 5KWRA 1C28A 3OYDA 3USSA 5HCFA 4KG0A 3JRHA 5C4WA 2Y2ZA 2I07B 1J3QA 1JZ4A 3HTSB 4DRVA 2D6LX 1WMDA 2NVXJ 4ASKA 4CXYA 5GP9A 4S05A 4UBHA 1FC3A 1V6MA 2MGQA 1XN7A 2GQQA 1PUEE 4HT1T 2DVFA 5L3BA 2O8KA 1ND2C 4ORFA 4L18B 5CZKA 2I10A 1EJ9A 1UYPA 2X10A 4LLLA 4AVTA 2OJED 3POFA 3V8KA 2VLAA 3S14J 2Y0SN 1T2KA 2H09A 3EYYA 3IKTA 3ML6A 2XGEA 2AR6A 3LWCA 1Q43A 2X53S 2LREA 3X29B 1SLAA 4NR1A 2GNBA 3MKLA 1HIXA 1VQKI 4PBOA 1BR2A 1ODDA 3AP6A 5LCWL 4Q5SF 4YVWC 5L3CA 3HPGA 4YZ2A 2PLV1 2DCTA 3ZN5A 4IRIA 4LBQB 5FLXK 3CMEI 1R083 3O3KA 5C6CA 4PFPA 4QHBA 1SD4A 4OMDA 4Q4W1 5APAA 1KZHA 3I3LA 4QX3A 3LOCA 4DXSA 2PHUA 1NA1A 2HWC3 2R7WA 4M0NA 3HZJA 4NE9A 4C1WA 5FZFA 2LM3A 4BY7J 1W39A 3AC0A 4YGBA 3ZSLA 2FMYA 1RUH3 5FZ1A 3TWIA 1YQ8A 2PN6A 4EM2A 4IHSA 2I8DA 4NDLA 2WYSA 1JI6A 4YG3A 4LBKA 5F8PA 2ET7A 1OCOH 2LY2A 3GCMA 3KYDB 3QACA 1Z7S2 1W0OA 2XUMA 3FMRA 3G2BA 2JUCA 2G7HA 2XF7A 1VBA2 3PUSA 1ORKA 1R091 4GJZA 5JXIA 1W3VA 1HJGA 4XRMA 3IDCB 3WDXA 3ZXAC 1KEXA 3D5LA 3M4FA 4ARXA 3C7OA 1JU3A 3A02A 1U3EM 2NVUB 2A69F 3V8LA 2K4BA 2W4SA 2ET1A 4M3DA 4JGZC 2Y0IA 4KU7A 1OOPA 2XJQA 1TWAJ 2VNGA 3NKGA 5D5WB 2VXJA 1Y43B 4GRIA 4BGDA 2V1DA 2Y75A 3PNYA 2DVAA 5FLXZ 4HVQA 1DYKA 3LGRA 4LKFA 4RGXA 2M30A 1F5TA 3LFUA 1Y4WA 2K9NA 2DMUA 4FFGA 5DUIA 4DUXA 4M3CF 1ZQ3P 3LFIA 4RA2A 4Q4W2 3BTZA 3PDQA 2K7LA 5A70A 1BI2A 5FYMA 3IAPA 3VKFC 2IXKA 3BZKA 3L1PA 4URTA 2WFF2 2EFQA 4IL6C 3CMYA 2VBPA 2WN2A 2OPKA 3R4SA 1JTZX 3KFWX 1R49A 1H89C 1WCQA 1BIAA 2W3JA 4AYBN 3ZQIA 1TNFA 4HDUA 2B0LA 2QZ3A 1OXCA 1IG7A 1C4RA 2RS52 4TWTA 5JR2A 1IG0A 1R1ZA 2QLZA 4M72A 3AJYA 4Y33A 1WFXA 2LLKA 2KDOA 1ZGWA 1YI7A 4F7ZA 4PI0A 2EIDA 2WUHA 4D7YA 3ZDVA 4HV5A 3AZXA 2XOMA 4RQPB 1YHFA 2GNMA 2E1MB 3I4IA 1XPWA 1KQ0A 1C1FA 3CIHA 3O6BB 1IXSB 4N9HA 1XB9A 2LD5A 9ANTA 1SVLA 2PXJA 1TZOA 2DU9A 3C8XA 1MJAA 5E3MA 3OJBA 2JKXA 1WWYA 4RFT0 4IRGA 3FHZA 1ZBE2 1OA2A 1YIJI 4IHWA 1XSXA 2A3SA 3BTAA 4B3NA 3VDCA 5C8CB 1LESA 1PVC2 4XF4A 4M3FA 3CCUI 2BTVC 1GFF2 3CCQI 4BLIA 2BVLA 2DA7A 4Q4Y2 1EUUA 3M3OA 4NQWB 4A3EJ 3PFIA 4GMP3 2GA2A 1S6LA 1VBD3 3K4CA 2UZKA 5B66C 2PJPA 1ETYA 3ZYHA 2VPLA 4QM8A 3GF2A 4B47A 1UU6A 1YX5A 3IV5A 1I5PA 2VXRA 2MD5A 4J25A 4AFDA 2EIGA 4Q8KA 2FNPA 3C3WA 1QHGA 4LQRA 4PIZA 5A32B 1LB2A 2LBFB 5KHHA 4P9YA 5BPIA 2ZKLA 4IGQA 2WAQN 2Z69A 5KHDA 2A5YB 2FMLA 5FYTA 1REEA 4BJ6C 3Q0UA 3JB4C 2QQ9A 1HV1A 2BBYA 1NQJA 4WVMB 3JU9A 2VUAA 4TLFA 4AXOA 3PIPF 1A6IA 4GDFA 3ACGA 4ZDPA 2ELHA 4C9YA 5D2AA 2W08A 3WHCA 1UO9A 4IQ4A 2YUEA 1FX7A 1D5VA 1FOD3 4BDVB 4XACA 4NRQA 4RB1A 4Y13A 3N7KA 2XUBA 4NAOA 2E2HJ 5E88A 5LHHA 2M0CA 5FZLA 4ARYA 2IRFG 2A3XA 3U21A 3TEXA 1DBNA 1ULEA 3WODF 3QCWA 2E34A 1JT0A 1Y6IA 3PVOA 1LGCA 3F0CA 4D6SA 1MMGA 1W8TA 4FOVA 2NVTJ 2ZABA 4L5JA 5A3UA 4RAYA 5FMOS 1ZELA 4AIDA 2OVUA 5D5UB 2VY0A 3MFAA 1XYOA 2XPJA 2ZMNA 1LJ9A 2VZPA 5CLSA 1AR63 1FX5A 2WS92 4JHZA 2Y33A 3HT1A 2KXLA 4QKNA 1FV2A 5KNLA 4N53A 3PUIA 5CAZA 5ICEA 2Y0OA 3BPVA 2BW3B 2J1UA 3AP5A 1TT0A 2P0WA 1P2FA 1ZYRF 3JAMK 3KT7A 3ZN1A 3WUCA 4BISA 1HXS3 3K1NA 5K5RA 1PMHX 4XE9A 2R5YB 1QJX3 2CWMA 3P9KA 5EEAA 5D6EA 4FPHA 4DXZA 4DBQA 3MZ8A 1IS3A 2K9LA 1GDTA 2RR11 1SLTA 4RQPC 5LASA 2MSYA 1X58A 1YJLA 4EZHA 2ZX3A 1JYNA 4DGWB 2VCCA 2K9QA 5D8AB 4SBVA 1GV9A 3WHUA 2VC1A 1PJRA 4FCAA 4BE3A 4IXLA 2W00A 3KHCA 2ETEA 4BXXJ 1YTYA 2ARBA 5C8CC 3GTOJ 4QTRA 3ZN4A 1O7LA 3JCIA 2VIXA 2OZUA 5HODA 3FDYA 5DEQA 3PFYA 2WLQA 3Q0WA 3JBG1 5FOJB 2JENA 1ONVA 3AZVA 4YIFA 2LOOA 4AAPA 3B6CA 4PCQA 3LDRA 3GZ5A 2EV5A 2PAEA 2CS3A 1FYUA 4XF3A 3ZFEA 2BUKA 2XXZA 3CQOA 4PHZA 5DUXA 4KDPA 1V00A 4XBLA 4Z92B 5A3OA 3EQEA 1RESA 1MZ5A 1TME2 4QX8A 3HG9A 4ZPIA 4A7KA 2P3JA 4OUSA 2XHKA 2O5RA 3KCXA 1NT0A 2JG9A 2Q0OA 3JAMZ 1TW2A 4UF0A 2OXBA 3E1F1 1YOVB 1JYWA 4MUVA 3JREA 1JYXA 1W04A 5HCBA 4K1YA 3T4HB 1U8BA 2DT6A 3WY6A 4IKFA 5BOXA 1OCZH 1UKGA 1SMVA 1WD4A 2CV2A 4EATA 1AR93 4IE6A 2QSGX 4IE5A 1JU4A 3NAPB 4AC0A 4KFCA 2EJRA 3AP7A 1GVDA 5LATA 3TB0A 3AYAA 5BXXA 1C57A 1OA3A 1WGXA 3FISA 1Z9CA 4J1WA 1Q56A 1R58A 5K7ZA 1VAVA 4WVVA 2JDNA 4FT8A 2WSVA 3BWGA 3Q9OA 1R5ID 1CAWA 4XBFA 4AHZA 4MTDA 1O4XA 2HBTA 2KRFA 3EB7A 1S0GA 2FA5A 5C70A 3ZR8X 3E6BA 4MOAA 3VLBB 3BU0A 3RZHA 3ZLIA 3U0ZA 3JBG2 5DAVA 4C91A 3OS0A 4P96A 1OD3A 2Y60A 3K77A 5L73A 1HDKA 4UFMA 4UXAA 1ZZ7A 4BOWA 3KEOA 1RITA 1WKYA 2RM23 5ACA2 5KC6A 4PDWB 5GJ6A 1ERDA 2KRCA 2DN0A 1IKQA 4MQVA 2JG8C 4BE2A 5J98B 2OIIA 2RMU2 3LF7A 3RCOA 1PIV2 4XOGA 3WF0A 2YU2A 5FP8A 1PUFB 4BIOA 5H9SA 5M5WJ 3J8F3 4K8FA 5FR3A 2EIJH 5DAPA 3A2KA