3IWZA

The c-di-gmp responsive global regulator clp links cell-cell signaling to virulence gene expression in xanthomonas campestris
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
207
structure length
207
Chain Sequence
b'LDAGTIERFLAHSHRRRYPTRTDVFRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRTRTQCELAEISYERLQQLFQTSLSPDAPRILYAIGVQLSKRLLDTTRKASRLAFLDVTDRIVRTLHDLSKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite activation-like protein
publication title The cAMP receptor-like protein CLP is a novel c-di-GMP receptor linking cell-cell signaling to virulence gene expression in Xanthomonas campestris.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transcription
total genus 68
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF00325 Crp Bacterial regulatory proteins, crp family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwzA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3iwzA01
1KU9A 5JSPA 1FX7A 2XAFA 3U9GA 5KBFA 5K5OA 3VOEA 3RJPA 2PG4A 2CFXA 3ZP5A 2BEOA 2UY9A 3RYPA 3QP6A 2XLFA 5C6CA 4ZZLA 3P9CA 3WW2A 3USSA 1HBXG 5BS6A 4EJUA 1WSUA 3O6BB 2XLAA 3O14A 4ZZDA 3IC7A 4GYIA 2DU9A 3FFQA 4EGYA 4IERA 5A2QZ 4KIBA 3IKTA 4U0WA 2XASA 3SCGA 4S04A 1OYWA 2FNAA 2L02A 3E3VA 1FYLA 1SD4A 5FGMA 1LKNA 1LR5A 5BMZA 4KT5C 3BY6A 1HW1A 5CVJA 2QLZA 4H7LA 4Q0SA 3ML6A 4LUKA 4RD7A 3HSRA 2IA0A 3I71A 1P4XA 2Z33A 1GXQA 3BDDA 3K2ZA 4I0AA 2IXCA 3ZN0A 5I0SA 2V1XA 4KIFA 3D82A 5AIPA 1KYZA 1FSHA 2M30A 1IN8A 3SZTA 4U0YA 5TJJA 4TV7A 1YFWA 5A2QK 1LJ9A 2Y0OA 4L11A 1W7PD 4XFHA 3U10A 2FNPA 2YX4A 1B1BA 2O6GE 5JCTA 1J5YA 4MQVA 5D5WB 2F2EA 1XGSA 2RQPA 1UCXA 2P7CB 2DW4A 1TQIA 4G7OF 1HXDA 3OD0A 3M9AA 1ZRDA 4HF0A 1XSXA 1D5VA 5BOXA 4EJTA 2A6EF 4EM1A 4HYEA 1ON2A 2PMUA 1EYBA 2M45A 2PI0A 4XRFA 4HSJA 4KL1A 4PGHA 3M3IA 4X6QB 4XFAA 3BJOA 5JI6A 4DNCA 1IRFA 1YG2A 2E7XA 2PTMA 4A0YA 4LB6B 1RL3A 3NRVA 1NE6A 4M71A 4IF4A 3CLPA 2Y0MA 3L09A 1PDNC 1RUOA 3HQXA 4AXOA 1UHMA 3KCCA 2D93A 3HSEA 2GH2A 2NRAC 1OKRA 2K4JA 4Q0UA 4D7SA 4EM0B 3MZHA 1BI2A 1L0OC 4LK0F 2F4PA 5HLIA 2X0LA 3QRFF 5LLQA 4KWJA 1XD7A 2R7DA 4EQQA 2M5WA 2VE8A 3J7AO 4IEZA 4UV9A 4IETA 1I6XA 3VFZA 2Q2EA 2Q1ZB 2WTEA 3EQEA 4UHTA 3WU0A 4FX4A 1XMKA 2P5KA 3I58A 2X4HA 3FXUA 3B73A 1J3QA 2Q8KA 3H92A 3PFIA 4OU0A 1XGOA 3CLOA 3WTZA 2OA2A 2G7HA 2ZNYA 1P6RA 2QZ8A 1PMIA 3TNQA 1YW8A 2PJPA 4I7HA 1XSDA 2BV6A 4I98B 3NJZA 1PM7A 1MDMB 3ROUA 1DGWA 2KXLA 3F6OA 4UUVA 4OOIA 5JFRA 3PQKA 4OIRF 3E6DA 5EFUA 1ZZ6A 2JPBA 4MGIE 3SZPA 4RB2C 2E1NA 4EWAA 2PMHA 1BIAA 3R6SA 5ED4A 4G6QA 2V1UA 2FOKA 5EEHA 2Q0AA 1YIOA 4Q0PA 3GLXA 4ZYEA 1O3SA 1B4AA 4P5OA 3CUQA 4M9SA 3HTUA 1G4DA 1WQ2A 3H7YA 3NW4A 1ZZ9A 2R3SA 5E8IA 2E1CA 2GC3A 1FNNA 3KP6A 4HN0A 2P8TA 5BPDA 1DDNA 3U1DA 1UFMA 2A61A 4IEWA 4KFCA 3QAHA 4NHJA 3RDIA 3R61A 3WTTC 3F22A 4HN1A 2QM3A 2BGCA 4EROA 3KEQA 2XAJA 2HS5A 2LSOA 3HOTA 4QXKA 3ACLA 2CAVA 3KZZA 4YFXF 2WWYA 5BV6A 1K78A 3KFWX 2VBYA 1FYMA 1NE4A 2DK8A 4IVNA 1RC6A 1T0FA 3FHIB 2BNOA 3E97A 4KNYA 2VONA 2K4BA 1CAXB 1MD0A 3C18A 3RI4A 4IXAA 2PFWA 4QGNA 3P9IA 3ULQB 1FXZA 1Z05A 3ABTA 2KIMA 3BPXA 1FBSA 3CJNA 3ECOA 2PQQA 1CGPA 4Y13A 4RB1A 3RPUA 3ECHA 4HSLA 1S29A 1YWKA 3HSFA 4P9FA 3DPLC 3SMHA 5FPZA 1HKSA 4MEXF 5HDKA 5FDBA 1T98A 3W6JB 5K1YA 4PIXA 2QBYB 2BYVE 2K02A 3BB6A 5I8TA 2HGCA 4LLLA 3H7JA 1F1ZA 3I5UA 4L5IA 2PHLA 2DPUA 3FF5A 1OR7A 1T6SA 2UY8A 4RGXA 3LQRA 3HUGA 1CAWA 5BXXA 1TQMA 3RKXA 4Z2YA 4KU7A 4ZU4A 2ZMEA 4AWXB 2GC0A 3ISPA 2NS0A 4ON0A 2KJBA 3KP5A 4I2OA 1LEBA 4MV2A 3T8TA 1D3YA 3V7RA 1ZYRF 1QXRA 4IHSA 4UNOA 4L0ZB 2ESHA 3WU1B 1R00A 1SFXA 1KQ0A 1U5TC 4Q0QA 3WTXC 3GBFA 1ODDA 3MPBA 3VHRA 4MEYF 4R52A 1J2XA 3WTYC 1J59A 4ENJA 5I8YA 1QBJA 3JAMK 1UB9A 2H09A 4L5JA 4MTEA 2ELHA 3FJSA 4WX9A 2DAOA 3HTSB 1SD7A 3NQOA 3FX3A 5JAXA 1WKMA 1NXMA 3NEUA 3I0TA 3CJXA 4GCVA 3RKWA 4PCQA 3DPTA 1BBYA 1XCVA 3OOPA 3GX4X 1G6NA 1J3RA 1ZNPA 4HVOA 3LAPA 3BWGA 2MPFA 3F6VA 4LLNA 4U0VA 2UXXA 2VXZA 3HHHA 2CWEA 2OZJA 3CEWA 5D6FA 2Z69A 1U8RA 1U5TA 3GO5A 4XLNF 1NZCA 5FD5A 5KK1A 2ADUA 1ZN2A 3HOSA 1SD6A 4UBHA 2JPCA 1MDMA 4GYGA 1R5HA 1R1VA 3MFKA 2MNGA 2P17A 2HFHA 2XAQA 3FWEA 5HOOA 1X8MA 4ASNA 3TDUC 5D8KB 4M72A 1LDJA 3RKYA 1Q5OA 1NYWA 2UZKA 2BNNA 3BP8A 4HX8A 2PLYA 3ZMDA 1SFUA 1GHCA 1WRJA 4HA8A 1XE7A 2GU9A 3GF2A 3O2PE 4Q4ZF 3OGJA 5KVRA 4RB0A 3GVAA 2STWA 2UXNA 2XIGA 3F8BA 3WE3A 1RTVA 1UW8A 1YFUA 4EJWA 1FZPB 4B29A 1T39A 3T1BA 5K5RA 4KA4A 4KN7X 4XF1A 4P9UA 2VOOA 2RV8A 4BH9A 1XGMA 4N0BA 4LG0A 3O3KA 5F1RA 2CYYA 2A69F 1PP8F 2MA3A 3TGNA 3L00A 5JHUA 1IN4A 1ZH5A 4Z07A 2HTJA 4WCGA 1R58A 2XAHA 5E17F 1CAUA 2FQ3A 1C0WA 2XROA 4HVQA 4LUMA 3RYKA 1OYIA 1H9TA 1UIKA 1I5ZA 4JTOA 1SMYF 3DQVC 4AVAA 1ZHFA 4O6JA 4EWDA 5EEGA 4XF4A 4WWCA 1QNTA 2D1VA 2UWMA 3RNSA 5CVIA 4PJYA 4A12A 2ZKZA 3WTVC 2IA1A 1LNWA 2V1DA 4XF3A 4UVBA 1ZAOA 2MBFA 3CO2A 3HRSA 1I1SA 3E5UA 1WI9A 1J58A 1TTYA 3WODF 2GA2A 1B6AA 5LRSA 3KP7A 2K0GA 4L18B 1J1LA 2ISZA 1XB4A 4LA2A 4HX7A 1ZVFA 2RGVA 1QXJA 1XCBA 4RGSA 3IBMA 2YSRA 5E18F 1S7OA 3V8KA 2ZJ2A 2L01A 1DZTA 1SD5A 5DYMA 5D5VB 3S7EA 2P6TA 4RS8A 5D1IA 3MEXA 2EV0A 1EH8A 3TNPB 1QO0D 1BJAA 4HLYA 1SFEA 1EH6A 4HV5A 1W5TA 1OD5A 1K6OA 1KYWA 3CF6E 1UCRA 4FBFA 3E5QA 3CUQB 2DTRA 3RPQA 1U12A 2OBPA 1S8NA 2D5HA 3V7SA 4U7DA 1X82A 1P4WA 1BC8C 3DP7A 3R0AA 2H27A 2K86A 3EO6A 1FOKA 4MH0E 4PGGA 3ELKA 1FBUA 3I59A 2ZBKA 3TOBA 2EFNA 4G94A 1T38A 2Q4SA 3LAJA 1FLIA 5ILSA 1FI2A 4ZU5A 3GXOA 3M8EA 1PP7U 5E8GA 2AXLA 1IAWA 2IP2A 3MAJA 2HYGD 1JGSA 3P9KA 5BPIA 4KICA 2AS5F 4MHGA 4AIKA 1K78B 5BQTA 3UKNA 4OIOF 1TNSA 3C7JA 4HBLA 5LGNA 3IIAA 4M6YA 1UHWA 2BE5F 4R79A 2ET7A 3KLOA 4ENMA 4YYOA 4MQ9F 1SMTA 3SCFA 3CDHA 2GAUA 3QP5A 3WTWC 1J3PA 1ZRCA 4IEYA 1Y9QA 4B09A 1ZRFA 5KHGA 5E1ZB 4CYDA 1HSJA 3PNAA 1V3FA 5DUKA 1ZZCA 4LJZF 2COMA 1ULYA 1FSEA 3I53A 4LEJA 1R1TA 4U7BA 3W6KB 3QU6A 3GYHX 5FLJA 2Q30A 1ZLJA 4R8HA 1ZLKA 5J3UA 4MNUA 4HQEA 2VPVA 5E1RA 2EFQA 1W4MA 5IT9Z 1EY2A 2D1HA 3QU3A 1YFXA 3EHKA 5CVRA 2O8QA 3DEUA 4IRGA 2O3FA 2VN2A 4ZYHA 1Q1HA 1IN6A 2CSOA 3MYXA 4K8FA 3K0LA 4WXDA 3G73A 1CAWB 5FQ0A 3M7GA 2E7WA 4I0BA 1CX4A 2PYTA 2V6CA 4OIPF 3WE2A 2ZMEB 5DCFA 5FB2A 3DN7A 5K5QA 3F8NA 2CO5A 5L3GA 2JZYA 3EUHA 5HLGA 1CF7B 1TQ5A 2GZWA 4QMAA 3BPVA 2Z5UA 1J75A 2WFPA 4AIJA 4G8XA 4YFKF 5FO5A 2GXGA 1L3LA 5E16A 4EJVA 3DF8A 5IT9K 2PFBA 2LF7A 2HZTA 1BN5A 4N9IA 4ENNA 1YW9A 4EJOA 3ZMTA 2ISYA 2FBHA 3GFIA 2VODA 2Z2SB 3MWMA 5CVUA 3IWZA 1O5UA 4O9EA 4CXFA 1LQ1A 1SQ4A 2FE3A 3G3ZA 3LSTA 2QVSB 3DV8A 1Z1DA 2CAUA 5D6EA 2EA2A 4K2EA 3PLQA 2M87A 1X7NA 4OMYA 1ZG3A 3TO9A 4I02A 3FE5A 2OZ6A 4JBAA 2B8MA 2CV6A 1HSTA 2IVMA 1U5TB 4A5MA 2IT0A 1B59A 4QM8A 3ZDSA 4EVIA 4GULA 4IJAA 4EMSA 4ESJA 3D0JA 5ICCA 1STZA 2QJVA 1LB2A 2A5YB 4L9TA 4CZZA 2FSWA 3OV8A 5J6XA 2EAAA 2DI3A 4A0XA 2MLKA 2F5EA 3VODA 2LNBA 5L3CA 1O3TA 2KIFA 1I1GA 4AIHA 2D40A 5ERIA 2ESNA 1U2WA 1Z7UA 3FZVA 3M8FA 4AD9A 3F72A 2FU4A 1JXSA 4IHTA 2STTA 4UV8A 1ONVA 1YO5C 1QWRA 4ORFA 5J48A 4ZYGA 4MUVA 1GVJA 2J5OA 4G9YA 1H1IA 2B0LA 2I45A 4LG0B 2PAMA 4LLGF 3LA3A 1MGTA 3I4PA 3LA7A 4HW0A 2VBXA 2A68F 2EA4A 5JR3A 1CAUB 1Z6RA 2RDPA 5JVTA 2NNYA 2F5FA 1SFNA 3KLNA 1KU2A 4ESFA 2WC2A 4XEZA 2HEOA 2QQ9A 1XRUA 3S2WA 3FZ3A 1ZGAA 4HLTA 1SEFA 4Q5SF 3RZZA 1ZZBA 5F64A 1KQ9A 5HS8A 2EB7A 3ZMZA 2DT5A 3QOPA 5CADA 1RZ4A 5T3NA 4KN4X 4XLPF 3T8RA 4IEPA 1IF1A 2K27A 1ZRRA 4HMZA 3GEZA 3JAMZ 2XHKA 2HOEA 2QNKA 2ATFA 1YQAA 1QZYA 1IUYA 3F3XA 4PDKA 4NQWA 5DUIA 5L3EA 3EYIA 2IXIA 4OIQF 3DXJF 4I01A 2VOPA 2RN7A 1CF7A 4KIGA 3ES1A 2UYAA 1G3YA 4CDGA 2H94A 2OPKA 2EWNA 2OYZA 2PAKA 5K8SA 2CQKA 5H6QA 3SHRA 1WGPA 2KJCA 4UXAA 3F21A 3ZMVA 2DCTA 4MGYE 5D4RA 4L2NA 1U78A 3COAC 1AOYA 3GYDA 1S7AA 4OINF 3K9TA 4N9HA 3GZ5A 4M6XA 2H0VA 3VEPA 1BC7C 2M8EA 5AIQA 1FWZA 3WW4A 3UKVA 5FD6A 3I59B 2W25A 1ZX5A 2RKHA 5FFXA 3OTFA 2ZFWA 3OCPA 1E2XA 3C1DA 4A5NA 3F8FA 5ICFA 5J8FA 1ZARA 2M1BA 2D2WA 3E6CC 4GXOA 2W85A 3REOA 5ILVA 3WTUC 5KHJA 5KHHA 3BROA 1U3EM 2MH9A 2IA2A 3B02A 4L9JA 3SHFA 2JSCA 1IPJA 3TOAA 5JSRA 4MGZE 3SXYA 4O5VA 2GWRA 2Z9OA 4RGUA 3TO7A 3H1WA 4HX4A 2A3SA 4Y15A 5ICGA 4HV6A 4NB5A 2OQGA 5DCMA 2IXHA 1JUHA 3H8UA 1P92A 4UVAA 4S05A 5JR7B 2JTVA 2RNJA 5I93A 3J80K 2DK5A 4KMFA 5AVPA 2O03A 3V8LA 2EFPA 2HKOA 1TLHB 2FF4A 3ES4A 2IJLA 3L7WA 2L54A 3JSPA 1DUXC 4JTNA 4KU8A 4LK1F 1VR3A 1K79A 2IXKA 2IXLA 1O4TA 1BI0A 4LTAA 2OA4A 2ZKLA 2O0YA 3CO7C 5FQ0B 3EQLF 2QCSB 3R4KA 1OPCA 5HLHA 1JHFA 3RTRA 2FMYA 3CTAA 3K1NA 1XGNA 1YS6A 4BAYA 1Z9CA 2O61A 2NAZA 3R0JA 3Q9SA 2EJRA 4G6DA 1TW3A 1QY4A 3GZ6A 4LFUA 2YU3A 3EJKA 4PIZA 3HRTA 3KSCA 4UBGA 1Y0UA 2P5VA 2V9VA 2E9QA 3GFJA 3EBRA 1WWXA 3H3UA 4J1WA 2PN6A 5H6RA 2OAZA 3FMQA 2RC4A 4D0PA 3FM5A 1JHHA 2WV0A 4X6RB 1H9GA 5L3BA 4DINB 1WLTA 1VJ2A 3N4MA 4HF1A 3NVCA 2QWWA 5D5XB 3E5XA 2CG4A 1FBQA 1S6LA 4A0ZA 2W57A 5CU1A 5L3FA 4QX5A 4AVPA 3D0SA 1NHAA 4E2SA 3F23A 3M70A 4IRHA 3D5LA 5IT3A 4M73A 3P7NA 3H1YA 1KQ8A 3I64A 4ZYDA 3FXQA 4M9ZA 4BXUA 2H6CA 1J0RA 3KGZA 3F8MA 1IPKA 1XMAA 3C3VA 4P55A 3JTGA 4XSZF 2LKPA 2QENA 4YIIA 2XUBA 2MLGA 3IRRA 4Q0VA 1DP7P 1XDUA 2Y75A 2N7GA 3N97A 3GUDA 2GIVA 4ESBA 1D8KA 2F5CA 4FAGA 2LDUA 4IPAA 3WW1A 4NVPA 1R1UA 3HRMA 1YFYA 1O7LA 4BIFA 1AWCA 4LGWA 2O1QA 2YR2A 3H50A 3QPTA 4L9NA 2NYXA 4AVBA 3HHGA 1ZZ8A 4EV0A 2RVCA 3ELNA 2XAGA 2Q0OA 3KP4A 5LBQA 1OMIA 3ZMSA 2P4WA 2JRTA 1BM9A 4HZFA 3HT2A 5FLXZ 5LHHA 2KIUA 3K1MA 1SAXA 1Q43A 3ETQA 4DQ2A 2IPQX 1IXRC 1W5SA 2VECA 1HKQA 3K1PA 1J9IA 1UPIA 3H3ZA 4P9GA 4OFGA 3I54A 5E20A 3KE2A 2QQBA 3TO6A 5LHGA 4GO1A 3SQNA 2UYBA 3V4GA 4A6DA 1YTYA 4E2GA 1I27A 1XN7A 2A6HF 4M9XA 2GQQA 1LVAA 1F4KA 3J81K 4WXCA 2C6YA 4O9GA 2QVOA 2QQAA 5CJ9A 3NL1A 2CW0F 3R60A 2DLLA 4I3PA 1RGSA 1EP0A 2C0ZA 1QPMA 1VTNC 1MJ9A 2G9WA 2PQ8A 3GFMA 3V7CA 2VC0A 2OZUA 5D5UB 2L3DA 3ERED 3NKTA 4A6EA 5FLXK 5C8WA 4R1HA 4CICA 5KHKA 1O3RA 3HRUA 1XDSA 3ZQ7A 2H6BA 5D8LB 3T5XA 1FP1D 1HW5A 4MZUA 3LWCA 3NSTA 1R7JA 2ZXJA 2GC2A 1O57A 3KETA 4XSXF 4XFBA 4ENKA 1TNTA 4I09A 3GWZA 2PHDA 3E6MA 3TKYA 3F8CA 4QGLA 1R5GA 1X3UA 4META 2Z3YA 2W24A 3S7IA 5I0UA 5I0RA 3IDCB 3T0YA 1KA8A 2VC1A 2P5LC 4BYYA 2BBYA 1R23A 4WVZA 4ZH4F 3U11A 3SXWA 2Z99A 1MJAA 4XBFA 2IC1A 1O5LA 5HDNA 3S0MA 2DBBA 4JQFA 4OLLA 4LLOA 3LA2A 2VE9A 3ST7A 5LRRA 5HI0A 4XFGA 1YFHA 5FPXA 4O3MA 2EV5A 4CO8A 5EZWA 3K69A 1FP2A 5CYVA 2ZO4A 5BY5A 2HYFA 2HTSA 1ZGJA 1RUNA 5FLIA 3CUOA 3M1EA 3MZYA 2ETEA 3CO6C 1LDDA 1RNLA 2ZNZA 2NNNA 4XFCA 4EGZA 3QPHA 2L4MA 5FCCA 4FX0A 4HBNA 4RAZA 3LFKA 4OMZA 3IRQA 4H0EA 2R7FA 4L9VA 3IDBB 2EFWA 1UD1A 2ACJA 1USTA 2GC1A 1QZZA 3ZMUA 3EDPA 4YG2F 1V4RA 4YARA 1G3WA 1HKTA 3CUQC 2XKOA 4M74A 4L0YB 1O7FA 3I7DA 2VQAA 1W7PA 3GW2A 3HT1A 4YIFA 3KZYA 1TW2A 3JZVA 2G7UA 3BJ6A 1IN5A 3KP3A 3WGIA 2CGPA 2OQRA 3H9AA 2IRFG 4LD5A 2OU2A 5DCMB 4XFFA 4AVCA 2EV6A 4HOBA 4YFNF 1PUEE 5ICEA 3WGHA 2FBIA 6PAXA 1QGPA 5ILUA 2PEXA 3UKTA 4F7ZA 2HDCA 1EPZA 4WF2A 4JVAA 3JTHA 1DPUA 3L2CA 5BUVA 1YLFA 2IW5A 4BHCA 3JW4A 2O8XA 3SCHA 4AQ6A 1MKMA 1F9NA 2GA1A 1R36A 1V70A 3TQNA 3IKVA 3VB2A 2MD5A 3KGLA 4YRDA 3L9FA 5HVQC 4HVRA 3FHZA 3KEOA 5LGTA 2EA7A 3WG9A 4KWKA 1JE8A 2EVXA 1RI7A 2HQRA 2K7LA 2VBWA 4EM2A 1KU7A 2ET1A 4KYWA 5FFZA 4IEVA 3JSOA 3LAGA 1F5TA 2XKPA 2DO7A 4E70A 1RIOH 3RYRA 3SFZA 2K9ZA 1FC3A 4JV4A 5LEJA 1J7KA 5I91A 4HAMA 1A04A 3BPZA 2MH2A 4UXNA 4LMYA 5DEQA 4E2QA 4ONUA 3U2RA 1XE8A 4MGRA 4UVCA 4B8XA 2FQPA 2FA5A 1LRHA 1YW7A 4WZCA 4MGKE 4XF9A 2FRHA 5AONA 2F5DA 4HQMA 1B9NA 3IWFA 1K7AA 2DQLA 4EWEA 2XVCA 2IXJA 2P7VB 2DFIA 5F6FA 1BI3A 1CAVB 4BHPA 1S3JA 3EETA 3MDPA 1T2KA 2HR3A 2D5FA 1IN7A 2VT2A 4BQAA 3WGGA 1BI1A 4FHTA 3TDZC 1X8EA 2MHFA 1IZ1A 4KWLA 1E17A 2YX7A 1IRGA 3U0ZA 1MJBA 1GQGA 2VT3A 1IW7F 3IL2A 3Q9VA 1HW2A 1FYKA 1WA4A 4MTDA 2V09A 3KP2A 1BOAA 2XLGA 3PQJA 4ZU7A 4QLCU 1KU3A 4D7TA 2HQNA 4KDPA 4PZJA 2PA7A 2MC3A 4HF2A 4IEQA 5D4SA 3PVBB 2XL9A 4KMUX 1VP6A 5CVVA 1L3JA 3L2HA 1P4AA 1TQPA 1YHFA 3FMSA 4MX3A 1O3QA 4WK8F 1EV7A 3EYYA 1DPRA 4YSFA 1ZG1A 3HYIA 3J80Z 3DFGA 4CHUA 4XFIA 1FY7A 1QQIA 3LQQA 3ABUA 3OF1A 4IEOA 4HDVA 1P2FA 4Z82A 3ZN1A 5DD4A 5LHIA 3DL3A 1ZREA 3AAFA 3IHUA 1ZG5A 4BNCA 1Z91A 3BALA 5CLSA 1OYYA 4GGGA 3BCWA 1IXSB 2KKOA 5J7MA 2BNMA 3MCZA 3RIRA 1LEAA 2W84A 2D45A 4IEXA 2FBKA 1FT9A 2FMLA 2JT1A 1GQHA 4PIYA 4Y17A 2P6SA 5DD8A 4KUMA 1OFNA 1GXPA 4P96A 4G7ZF 4Q47A 1HQCA 4RB3C 4IRIA 2XGXA 1H0MA 5DDGA 2QDRA 1LDKB 4BHBA 5E1WA 1YYVA 4LA3A 2DQRA 4JK1X 4RGRA 3DKWA 2OD5A 3FM3A 4ETSA 1MZBA 5E1XA 4TLFA 5BPXA 3BJAA 3WW3A 1XSVA 1FPQA 4FT8A 5H20A 5I0TA 4QWQA 4LULA 1USSA 2EK5A 4Q29A 4Q48A 2HJIA 3Q5FA 5I8SA 2HWVA 4U88A 5HS7A 4QM9A 4WXHA 3FXRA 5JSOA 4RAYA 3LOIA 2FEZA 2L4AA 2XRNA 4G7HF 3H1MA 2PBIA 2J5PA 1BIBA 3FMRA 2B9UA 3BOQA 2LF8A 2V79A 1IXCA 3LWFA 3QACA 3WTSC 1G3TA 4QGMA 4IESA 5HDGA 5L3DA 3E6BA 5J8CA 5LGUA 4XETA 5HS9A 1Q3EA 3BZ6A 1CAXA 4XF0A 1REPC 2TDXA 2DPDA 5DV5A 1OI6A 3MQ0A 1UIJA 1DZRA 3LZZA 1EH7A 1TBXA 4YNIA 5TRDA 2PAEA 1YS7A 4F8AA 4HLXA 1H1MA 4HDUA 1CAVA 2YPRA 2ZCWA 1KGSA 2B5HA 5LEKA 1W7PB 5KHIA 1G3SA 4LB5A 2QBYA 1U6GA 3CL1A 1Z6TA 4A2UA 2KRFA 3GFLA 3BU7A 1R22A 4J1XA 1D8JA 1B9MA 1Y3TA 3ZPLA 4FAHA 1DGRA 4WBBA 4IEUA 1YLLA 4AQ2A 2XV4S 4CGZA 5FLHA 2A07F 2ETHA 3HIFA 3V8JA 2EFOA 3KMHA 2QUFA 2GXBA 2FXAA 2HKXA 3G7DA 1ON1A 2Y48A 3C3WA 2QYOA 1YUDA 1ZZ7A 2VBZA 2XL7A 3J81Z
chains in the Genus database with same CATH superfamily
2MSYA 1KU9A 1FX7A 3KT4A 4FASD 5K5OA 3VOEA 3RG0A 2QA4I 3FKJA 1VQ4I 2UV1A 2CFXA 4IUGA 3WHUA 1W8TA 2UY9A 5CBLA 3T4VA 3QP6A 3ZIXA 4CSWA 4ZZLA 4XIDA 1BBT1 4EJUA 1G86A 3O6BB 3O14A 3IC7A 4XRSA 4GYIA 4UWDA 3OGRA 1UF2C 3SCGA 3H3LA 4IXLA 1UKGA 5DTDA 2FNAA 2L02A 1K61A 5FGMA 1LR5A 5BMZA 4KT5C 5FRMA 3BY6A 2X53S 3JD71 2HQAA 1V0AA 2QLZA 4H7LA 4LUKA 5H9RA 2IA0A 1GXQA 3BDDA 1SLIA 4YG6A 4RM2A 2XHNA 3TP3A 4LIVA 1RUF2 1UXZA 3CMGA 2KR2A 3U75A 1RYYA 4U0YA 1BVP1 2WV1A 5TJJA 4WVMB 4CDUC 3LCPA 1CQ9A 1YFWA 5A2QK 4B1LA 2VIXA 1HB3A 3KV5A 1JI6A 2VB6A 3BI3A 1UMZA 4MQVA 1VQ5I 5CKTA 1OCZH 5D5WB 5CIRA 4HSTA 1PGSA 1XGSA 3ZQFA 1UCXA 2P7CB 4CP0A 5C4WA 4BMBA 5HBAA 2DW4A 3FXKA 1RHI3 1TQIA 2W39A 2WO2A 4E7HA 4G7OF 4LHSA 4F83A 1AF9A 1X3ZB 4HF0A 1XSXA 4Q4X3 5DG1A 4AG4A 2ZHNA 2PMUA 2QQ8A 4HSJA 4XRFA 2L0KA 5ISLA 1RINA 4ZXEA 1W8ZA 3M3IA 2C26A 4XFAA 3BJOA 1JOPA 5JI6A 3AVRA 3PU3A 1V5EA 2IGNA 2PTMA 1GV2A 5J1YA 4LB6B 3NRVA 2B46X 4IF4A 3CLPA 2Y0MA 3VB9A 3KT1A 3L09A 2ORZA 3KV6A 1X3WB 4AXOA 1UHMA 1NA1B 4FFFA 3HSEA 2DOEA 2NRAC 4YVSB 4QHOA 3ZYGA 4A3DJ 1U5XA 3HMYA 1PVXA 3ZXEA 4K8RB 3W59A 3QYBA 3CF5F 1GNYA 1MACA 2F4PA 1K5MB 4CCJA 4Z2AA 3M8JA 2WYFA 2W7NA 4BE3A 2DMTA 3VFZA 2MEV2 2VQ0A 5DS9A 1SZBA 1IG0A 3AG2H 4FX4A 3K75B 3I58A 2X4HA 1XXNA 3JRDA 2Q8KA 1VE0A 3H92A 3PFIA 4OU0A 3WTZA 2OA2A 1P6RA 2QZ8A 1PMIA 3LEKA 4JKKA 4Q4Y3 3WOGA 1FMVA 3DF0A 4PDWB 1MSFC 4WM7B 1K12A 3NJZA 2A7AA 5K0UB 5C4XJ 1ZBA1 1DGWA 2ORXA 3F6OA 4UUVA 4OOIA 3QLQA 1KZHA 2JPBA 1IZ3A 4RB2C 3QH7A 2X6YA 1BIAA 1H8AC 3R6SA 1QJX3 4CPBD 1BMV2 4ANJA 4XRSG 2V1UA 2FOKA 2Q0AA 1PMHX 1BW6A 4CYCA 5ERLA 5FZBA 4P5OA 2C6SA 3CUQA 4S2FA 4BJ5C 4XJ8A 1WQ2A 1DGRN 2PXJA 3DKXA 3NW4A 1ZZ9A 2R3SA 1IKQA 1FNNA 3KP6A 2P8TA 4BBSJ 3RZMA 4HKWA 2WL1A 3GM8A 4IEWA 3GZUC 3RDIA 1PK6A 2PN5A 5FP9A 3KEQA 1F15A 4MG2A 4IQ4A 2AC1A 3HOTA 1LCLA 3KZZA 4KBBA 1K78A 4RGGA 4W6XA 3K46A 3DEWA 1RC6A 1T0FA 2M4KA 2BNOA 3PUSA 2VKVA 4EZ4A 4OCTA 1K3IA 3LPGA 2Z5WA 3P9IA 1LU1A 2KIMA 4CZCA 3ECOA 4Y13A 3LMMA 5F2SA 3CESA 1S29A 1YWKA 5FPZA 1HKSA 4LO8A 3W6JB 3R05A 1S9HA 1X1AA 1OA3A 2DVFA 2WWUA 5FWJA 2ZA9A 2FQ4A 1RIRA 3B00A 2K02A 1HCRA 3ZFGB 3RZLA 1ZA4A 1F1ZA 2A5ZA 4W1UA 1SLBA 1OR7A 2RMU1 3WHBA 3RKXA 1NOVA 5FYZA 4V19K 2VL4A 4AWXB 4FQGA 1GP5A 5SV5A 3KP5A 5KXEA 5IYBJ 3WDYA 4QKDA 3L2WA 4D1QA 5JZGA 3V7RA 1ZYRF 2DDAA 2Y8KA 2VKDA 4J01A 4XOGA 4IHSA 4FO9A 3ZQQA 1QJFA 1R00A 1KQ0A 4Y20A 4JGZC 5CFCC 2BDRA 1A34A 1VRBA 4IZZA 3FHQA 3LFUA 1NH3A 1RJ7A 3BOPA 4HL0A 2EZLA 4NC8A 5GZDA 2Y34A 4N90A 4QDSA 2GDFA 1D1AA 2YGLA 2CU7A 3FX3A 1WKMA 5DAXA 1NXMA 3NEUA 3ZFFC 2A6XA 2SLIA 2R7EB 1PGW1 3HQRA 4PCQA 2HVSA 5LA1A 3K77A 4QQ2A 1XCVA 1LULA 1G9FA 5B4XA 1X36A 1W2TA 3M1CA 3F6VA 4LLNA 2NVTJ 4A7YA 2UXXA 1XPXA 1ND3C 2G9GA 2CWSA 3HHHA 2XBO3 2FD8A 2CGOA 1U8RA 2ZHKA 3POBA 3BTAA 5KK1A 1MR5A 5KHDA 3HOSA 4CDXC 1MDMA 4DRVA 1R5HA 3I3EA 4LBOA 5JXJA 4XTPA 1Q5OA 1PVC3 5FZOA 3BR1A 1J83A 1O4YA 5JVVA 1VBD1 4F52A 1XE7A 4HXCA 4XN0A 4Q4ZF 4RDUA 2R0HA 3I3DA 4NO4A 3HGYA 1ZGWA 3AMMA 1OBNA 3PM1A 1JYWA 1AXYA 3CCUI 1T39A 4KA4A 4P9UA 2VOOA 2CYFA 1H8VA 1VQNI 1HLVA 4LKEA 3OY8B 1X9TA 3O3KA 4RQPB 2CYYA 2XR4A 3TGNA 5FYBA 3L00A 3HOYJ 1IN4A 4Z07A 2KDOA 2HTJA 4E4SA 1UMIA 3JBG3 1R58A 2E35A 2GN7A 2FQ3A 1DQ6A 2M3AA 5GLVA 1W2OA 1OH4A 1AR72 3RYKA 1W36D 1OYIA 3GNEA 1I5ZA 4PF1A 1SMYF 1O8SA 4Y5Z0 2R7ZJ 4O6JA 3LE0A 4ZZ5A 4XF4A 4WWCA 1FMD2 4YGDA 1MQTA 2W3JA 1RVF2 2D1VA 2UWMA 2VQTA 5FXVA 2LMDA 4A12A 1WW4A 2ZKZA 2WFF3 1C1FA 1I6HJ 2HWD3 2V1DA 3ZO0B 2YFUA 5FKNA 4QPGB 3HRSA 1TME3 1WI9A 4MSVA 2JICA 1TTYA 3WNXA 2AXTC 2JKBA 2WT1A 1SACA 4NHYA 2HZDA 4I6ZA 3OYFA 2YFZA 1QXJA 1C4RA 5E18F 3OBZA 1A35A 3V8KA 3JCIA 2L01A 1DZTA 4KGQA 3S7EA 1OQ1A 1Y8RB 5BNGA 1EH8A 1QO0D 2P0WA 1RHI1 3FIWA 4IV3A 2ZX1A 4YW2A 2ZEWA 2RS32 4YELA 1UCRA 1W6MB 4FBFA 3OL3A 4Q4X1 4LBQA 2OBPA 1WMDA 5L36A 4J25A 3DP7A 1DF0A 5GPAA 4UW5A 4PGGA 1O4ZA 4FSJA 3I59A 3CZ6A 4G94A 2XDVA 1T38A 5ILSA 2DVDA 2Y0SA 4ZU5A 3UR3C 1W90A 4CCLA 1IAWA 5FZ8A 2GSYA 1JGSA 5BNNB 5DAWA 2ZZQA 3IMNA 3VD5A 2PHTA 2AS5F 1D4M2 4MHGA 2R0FA 4DZJA 2ES3A 4BZ4A 3ZXDA 2OC6A 2V73A 4M6YA 2RDRA 2ET7A 3KLOA 3EUHC 3SCFA 2GAUA 3WTWC 2B45X 1J3PA 4IEYA 5J36A 1MVQA 1Y9QA 2DA2A 1GP4A 1ZZCA 1A5JA 3KWVA 5IFPA 2A75A 3W6KB 2OVUA 5FLJA 3WNLA 4NAOA 4FVVA 4R8HA 3M4OJ 3FK6A 4AC0A 5C3EJ 2RJKA 4HQEA 5E1RA 1Z7S2 2QQUA 4JGYB 4Q4Y1 5IT9Z 4F3JA 1YFXA 3BZCA 3ZXAC 4FISA 2VN2A 1JT6A 1Q1HA 1NCRC 2ZGUA 3MYXA 4AVTA 3K0LA 4WXDA 3HUGB 1O4XA 2YUEA 5KAFC 1QJX1 4OIPF 3WE2A 1WUVA 2ZMEB 3FN9A 3H8OA 2PX9A 2P81A 5L3GA 3H42B 2VO5A 2I8DA 3BPVA 1W9WA 2Z5UA 3RI9A 3H0GJ 4AHXA 4AIJA 4G8XA 1NY72 1ODMA 4YFKF 1L3LA 4XUPA 3JRFA 3VPRA 1VBC2 3W21A 1CZTA 3L2RA 4RA0A 2JG9C 4CDUA 4FCAA 3S93A 1VQPI 2HZTA 1BN5A 4ENNA 4NAMA 3OYNA 2M0MA 1ND2B 4GIQA 4CEYA 1YI9A 3GFIA 2Z2SB 1E5HA 2VUJA 3IWZA 2WAEA 4XCBA 4BQQA 3I2FA 2FE3A 4FPCA 4YGEA 3ETPA 4RHV3 2ZGNA 1GLNA 2IEKA 4K2EA 1QU3A 2Y9YA 2M87A 1HKDA 5HCBA 4BUPA 3LOCA 3G6EI 2FBEA 1KRIA 2WZR2 1PM4A 4IGPA 2ZACA 4CUCA 1I3AA 3VBOB 4BK4A 1W99A 2IZWA 4QM8A 3NV3A 4EVIA 4ESJA 1M1EB 4QX8A 2P3IA 3THCA 3OV8A 1US2A 2WQ4A 2DJNA 3A7QA 3AP4A 4BU2A 1MS9A 2WBMA 2CGNA 5L3CA 1O3TA 1R5ID 1I1GA 4AIHA 1FX5A 3S6PA 2E51A 1N3OA 3THPA 4Q4V2 1U2WA 3K2OA 3BR6A 1QRYA 5CQEA 3ZSLA 3N9PA 2D6PA 1QWRA 4ORFA 4MUVA 1GVJA 5FZCA 2J5OA 3GHNA 3F0CA 4G9YA 1H1IA 1MGTA 4XKCA 3CZUA 3VDDB 1ST8A 1CAUB 1Z6RA 2WAOA 3TEYA 3WSOA 5LY1A 2JB4A 3HAGA 2ELKA 2NNYA 2OW4A 5FUPA 3SC7X 3KLNA 4DPNA 2WC2A 5H9SA 5KAIC 3GTGJ 2DMPA 2UURA 3BKZA 4LKDA 1W8OA 4MGTA 2EBIA 3H1CA 2HXOA 1ZZBA 2X09A 2Y0SN 3AMHA 2AZ5A 1KQ9A 1NQJA 2E6VA 4FOVA 2GALA 2UWAA 2RR13 2OT7A 1WZXA 2R4GA 1IQDC 4OVEA 3VN4A 1W06A 5T3NA 3POSA 2JB8A 2BV4A 4GALA 3T8RA 4IEPA 4UF0B 1YIPA 1LE8A 3GBGA 3U1XA 2HOEA 3TEZA 3LSDA 4Y33A 1IUYA 3DU5A 1PVC1 3K2AA 2GNTA 3PMSA 5L3EA 1YRNA 1DQUA 3PVOA 3A0HC 2CQXA 5FKLA 1BBT2 2YY1A 4AL9A 1QQP3 1VB2A 3UGHA 4CDGA 4IV1B 3GZAA 2H94A 2WO3A 2JA7J 1QA6A 2VMCA 5H6QA 1R1A3 4UXAA 3UJOA 1OCTC 2DCTA 1I50J 3RSNA 3NQHA 5D4RA 2WA3A 3COAC 1AOYA 3GYDA 4E27A 3FXMA 2WLPA 1TEIA 3OGGA 4N9HA 3GZ5A 4MVTA 4M6XA 2HPMA 5T5PA 5D8AB 2H0VA 5C5UA 3WW4A 1FWZA 3JD72 1C8M3 5FD6A 2W25A 3S5AA 3R0RA 1SLLA 4QU1A 2BVBA 2ZFWA 4M4RA 3ZYBA 3ACIA 2SBAA 5FKOA 3JBG1 5T52A 3TB0A 1DU6A 4FXGB 1REEA 1LGNA 5KC5A 2OJED 2J1EA 4BY7J 1XNBA 2D2WA 4W65A 2VE1A 1UXXX 5KHJA 1ETOA 1VAVA 1U3EM 2NVQJ 4CDQC 4JGZA 2IA2A 2VCBA 2YU1A 2DBNA 3FISA 2W5FA 2WFF1 5JSRA 3ZMNA 3NJXA 2HWD1 2Z9OA 2GWRA 5L7OB 2A3SA 1TME1 4HV6A 5IP7J 2DA4A 4NB5A 1IOAA 2DUOA 2OTJI 3UYJA 3WD5A 1JUHA 3H8UA 1P92A 4UVAA 5A3NA 4XLHA 2RNJA 4X1EA 2LKXA 3CJIB 4UB6C 4BS9A 1TLHB 4E4HA 5FZ7A 2CDPA 3JSPA 1DUXC 4JTNA 3AX4A 3IP4B 1LODA 2OUHA 4L5EA 2IXLA 2BWAA 5A80A 3LEGA 2ZKLA 2QCSB 2GMPA 2YU9J 1R6RA 4PFPA 3DPRB 4BAYA 2NAZA 1TWCJ 4CDXA 3EXUA 3RVHA 3GZ6A 4HG6B 1IS4A 1UKRA 2ECBA 3EJKA 4PIZA 1S2BA 3KSCA 1Y0UA 2E9QA 2CUEA 1VFCA 1WWXA 4FTSA 1SDWA 1ZTRA 3FBMA 3ZFGC 5H6RA 5M0TA 3WINE 4A41A 3FM5A 2V4AA 4JDOA 2FDKA 4XONA 3RMYA 2JUGA 3TL4X 5L3BA 4M6VA 1VBE3 1VJ2A 4HF1A 4MXVA 4YM0A 2HWF3 3OS1A 2QWWA 2M9HA 3E5XA 4A0ZA 1K4SA 1ZBA2 2P3JA 4E2SA 1WBFA 5F0FA 4M73A 1FPN3 5K7ZA 3B6AA 3K4BA 5ABJB 2A1XA 1SFKA 1IPKA 1OOPC 5FK7A 3ZYPA 4DOUA 3NAPB 2B63J 1W36C 3ESWB 3VBRC 4YIIA 2EPFA 3WDWA 2MLGA 4Q0VA 3R4DB 2WSUA 3T3YA 1XDUA 2PQSA 1HX6A 3ZYIB 3TEXA 4DUWA 4HKOA 4FAGA 2LDUA 1S72I 2I74A 1MZ6A 4BIFA 1RUH3 2KM2A 2O1QA 1VF9A 1V6IA 4L9NA 4OUMA 1POQA 4Z1VA 1JODA 3S8PA 2YC2A 1BKZA 5J4VA 3VKNA 3HT2A 5LHHA 4A7ZA 1SG3A 2BFUS 4GDFA 2IPQX 4IE0A 1W5SA 2JWPA 5LB6A 1HKQA 3K1PA 4E7LA 2X9DA 3ZVXA 3IH4A 4Z6YA 5A3PA 1MBHA 2R6QA 2E1MB 2QQBA 3TO6A 1JKPC 1LFUP 3KYCB 2A6WA 4E2GA 4QQLA 3CNAA 2E5NA 5BNOA 1KS5A 4B4RA 1SEUA 4N43C 4RL7A 4RHV1 3N7MA 3GCMA 4O9GA 3VKOA 1XYPA 3H0DA 1AL23 5C4JJ 3S15J 4Y3OA 1IS3A 3N36A 1WCMJ 2RMU2 2PQ8A 1VTNC 3C2UA 3WVJA 4XACA 4H2AA 3UNGC 4KBZA 2BFUL 2JECA 1LKXA 3LEMA 3NARA 1AKHA 3ZQ7A 1FP1D 2JJ6A 1RUJ2 1HW5A 3LWCA 1R7JA 3ZXGA 3ZX7A 4QPWA 3K4JA 4DEQA 4XSXF 5A1AA 2XVGA 3E6MA 3TKYA 1BW5A 3F8CA 3W2AA 5I0UA 3RSJA 3KM5A 1KA8A 2VC1A 1MMNA 2RJLA 2XXZA 3U11A 2IC1A 5HDNA 1SBDA 3BR5A 1UNBA 1DG6A 5LRRA 3AL0B 1DCSA 3POYA 1PGW2 1TZLA 3AXDA 3N35A 4LOSA 1MBJA 1FP2A 5FYTA 5LZ6A 2LKSA 2O0OA 5BY5A 2HYFA 4GZ9A 1Q8OA 2VOWA 1X19A 1RUNA 5FLIA 3FFZA 3B9CA 4II2A 2NNNA 3WNPA 3BTZA 2GIZA 4EGZA 3QPHA 3AMQA 3PSIA 4PJ0C 4RAZA 2LYCA 4H0EA 2EFWA 2R93J 4RS5C 5E8AA 2XRLA 2GC1A 1OCCH 1POV3 2ZXQA 1OQDA 4EQVA 1WJBA 3MV01 5KNLA 3ZR8X 3PUAA 1O7FA 4A93J 1VBD2 2VQAA 3S32A 3HT1A 2RR11 3JB4C 2JG9A 4COWA 1TW2A 1A6CA 1H0BA 3BJ6A 2CGPA 2G4IA 4NBQA 3H9AA 4CXYA 2OU2A 5DCMB 5FWEA 3HBZA 2EV6A 4HOBA 2A6YA 2FBIA 2CL2A 5ILUA 1MZEA 4LE3A 3LIGA 4D7YA 5EYXA 2K9LA 4F7ZA 1EPZA 4WF2A 3IAS2 3S16J 2FCTA 4UW4A 4AEJA 5BUVA 2IW5A 4C9YA 3SCHA 2BY1A 5FIXA 4C1WA 3L2YA 3ZFEC 1QQP1 3IKVA 5JUVA 1R1A1 2E26A 1WJAA 3L9FA 4A3CJ 1FOXA 1GOFA 5LGTA 3NWKA 2EA7A 2RHPA 4R9DA 1QDCA 4KWKA 1FOWA 1CZSA 2JDHA 4EM2A 4XHXA 1T8IA 1WJCA 3PJQA 1C8M1 3ORJA 5IATA 4PLOA 4E70A 1VQLI 1Y4WA 1CESA 3K4CA 4QX2A 3IN9A 1UG0A 4ONUA 3U2RA 1XE8A 2TNFA 2FA5A 1OA2A 3EMRA 1LRHA 2WNVC 4HSRA 5B5EC 4WZCA 4MGKE 3HOVJ 1JBCA 2FRHA 5AONA 1YI2I 4HQMA 3IWFA 4B4PA 3A4UA 2XVCA 2IXJA 5IAVA 4UYBA 1TWGJ 4WVMA 3Q9OA 4Q27A 4QPOA 5JXGA 5FXZA 1CAVB 4BHPA 4CPBA 1RHI2 4PLNA 3OSGA 4HT1T 2HR3A 4HG2A 2W95A 4YGBA 4AQTA 1BI1A 4Q4X2 5FYHA 4FHTA 3TDZC 3WG1A 3I56I 5EJ3A 4KWLA 3UL2A 3ZKUA 5BYNA 1IW7F 2IGKA 1P9QC 1N75A 3PNVA 3ASNH 1T6GC 4GMP0 4AI8A 2VMEA 2BVVA 4ZU7A 4QLCU 4A6OA 2HQNA 4KDPA 2PA7A 2MC3A 2WAQA 2X6OA 1YQ8A 1VMFA 3AM2A 4KMUX 3LKJA 3L2HA 1P4AA 1TQPA 3BR2A 1VAMA 3Q8EA 1QJU3 4L92A 3FMSA 3ZDVA 1ULDA 1QGLA 4WK8F 4Z2WA 1UOBA 1ZG1A 4CA0A 4E9KA 4HETA 1NA1A 1R093 2JDMA 4YVSA 3UV9A 2E7QA 2ADEA 1IO2A 1W39A 3LQQA 3AL5A 3OF1A 4XJ9A 4YM3A 1ETKA 4Q2FA 3ZN1A 3OYBA 4GD4A 1K5MA 1J1TA 2HEWF 1VBE1 1DLCA 4OHZA 2XPWA 4R4ZA 2HWF1 4Q4Y2 4GGGA 3BCWA 2EILH 4MADA 2HNHA 4KT6A 2KKOA 1UYYA 2AEZA 2X05A 1XG1A 2D45A 1QHGA 1FPN1 5B2GB 5T50A 2FMLA 2C1FA 1GQHA 4H55A 4PIYA 1QJX2 4PDWA 4WM7A 3K4KA 4LK7A 1HN0A 1GXPA 4G7ZF 5K0UA 4Q47A 3QQAA 4BDYA 2QDRA 4XOPA 4X0GA 3LNQA 4B47A 1ORKA 3RJRA 4RGRA 2OD5A 3FM3A 1D0HA 1MZFA 3PUBA 3LSRA 4QX0A 1QF3A 5KR7A 4XJZA 3AFHA 4A44A 2W48A 3WCSA 4LULA 1USSA 4E8CA 2MC4A 4CVUA 1RUH1 4QM9A 1W28A 3FXRA 3LOIA 5BNQA 4G7HF 1ULOA 2PBIA 1FV2A 1BIBA 1BLZA 1JUPA 3J7NA 1UJ8A 2D7FA 2OV7A 2FOWA 1FATA 3RRDA 5B1BH 1X1BA 1L7RA 1IXCA 5CKQA 4PQQA 3RZKA 1OVPA 2LTNA 2VXRA 5L3DA 2JDAA 1JUIA 3E6BA 5J8CA 1AR83 1PZ8A 3CJRB 4M3CF 1U9NA 1S0BA 4CP2A 4L0PA 2DPDA 2JG8C 5DV5A 1OI6A 4RAGA 3SITA 1UIJA 4YNIA 4QX3A 4WM8B 2J22A 4F8AA 1H1MA 2ZCWA 1AL21 5FYMA 1KGSA 4EZHA 2FD5A 4E7JA 4M3FA 3L1PA 3WG4A 2BU9A 1D8JA 3ZFGA 1Y3TA 3ZPLA 4IEUA 3WF3A 1YLLA 2WSVA 5FLHA 2A07F 2ETHA 3APBA 4CCCA 4GRIA 2XPUA 2EIMH 3B01A 2GXBA 4DFSA 1MVEA 3ZOIA 3C3WA 2QYOA 1YUDA 5FXWA 2ZGPA 1F8VA 4FPFA 1MZ5A 2K40A 1UWWA 1JT0A 2D43A 3FC0A 3PO2J 5FY1A 2E33A 5KBFA 3JRIA 1AYM3 1AU7A 4B1RA 2PG4A 1RXGA 4GKYA 4N53B 3JRAA 1OOPA 1H2NA 1OA4A 2XLFA 3P1IA 2R5ZB 5C6CA 3P9CA 3WW2A 4XLFA 3VBUB 4EEFG 5BS6A 5A32B 2P6HA 1MS5A 2JDPA 3AKSA 2IVIB 3CDIA 3WF0A 1VQMI 2BY3A 1VQ9I 2WAQN 3ZR5A 1NLRA 2D44A 2ARBA 2ERFA 2H1KA 3IKTA 4U0WA 4S04A 4LHKA 4FQ4A 1FIPA 1OYWA 2KMUA 3AG4H 1FYLA 1SD4A 2VOXA 1TT5B 3IDEA 1HW1A 2EINH 2K9SA 1RUE2 4Q0SA 5IWFA 1WH5A 3ML6A 4HNVA 2J1RA 2VCMA 5GZEA 3I71A 1POV1 1P4XA 1PVC2 2K9MA 3WF1A 4I0AA 2WRAA 4OMDA 4D0QA 4F3QA 2X10A 4LBNA 5EEAA 1JW6A 2M30A 1IN8A 4AR2A 3SZTA 5F37A 2XC7A 3GTPJ 4TV7A 3DYPA 3WDVA 4L11A 5IFTA 1V54H 5DDJ3 4FCYA 4E7SA 3WHTA 5HV0A 1S55A 1O59A 4XFHA 3U10A 2YX4A 1XMXA 2PELA 2O6GE 3VDBA 2RQPA 2WQ8A 4N43A 5EHDA 4Z92B 3DYMA 1ZR4A 1ZRDA 1UZYA 2CUFA 1CPMA 1BK0A 4W97A 1V6NA 1LEDA 2JXAA 4EM1A 3W6VA 3JBG2 4HYEA 1ON2A 4K3UA 1EYBA 3K7AJ 4R9AA 3OY8A 5EF6A 1ENXA 4RQPA 2QTWB 3UGGA 4NHXA 2O8KA 3GCXA 4DNCA 2HI3A 3EB7A 3W58A 2W1WA 1GYKA 4QXCA 4AEDB 1PDNC 4EATA 1RUOA 3KCCA 2GH2A 1OKRA 5F5IA 3BLYA 2WB1A 2K4JA 3CCRI 2WFF2 1BJQA 2HWD2 3WDXA 4DXTA 4Q8KA 3BTXA 3DKYA 3K6GA 1TME2 1X4PA 5HLIA 1B35C 5FY7A 2BERA 1HV0A 5LLQA 4KWJA 2PLV3 1XD7A 4NJ4A 2R7DA 5B66C 5F8PA 2QQLA 5JXIA 3J7AO 4IEZA 4UV9A 2R7OA 4QPGA 2DBIA 3EQEA 5BNPB 3JB8A 3WU0A 1XMKA 3CCJI 1L7LA 1J3QA 4LMFA 3KEYA 4M3DA 2ZNYA 2OPWA 4PBOA 3C2GA 4CDWB 2A05A 2DA1A 2F4IA 1Q56A 4AYUA 2HQ5A 1MDMB 2OXBA 4GQ7A 3SEQA 4OIRF 1ZZ6A 4EWAA 4RS5A 5ED4A 4FTBA 3HPHA 4F93B 4TN7A 3P3PA 1QIQA 1YIOA 4Q0PA 4MO3M 4ZYEA 5FY5A 4KISA 1W6MA 1JZ4A 3HTUA 1BQPA 3J7HA 3H7YA 3IIIA 1OKOA 4JOMA 2HWE3 4QWNA 2DODA 2E1CA 2GC3A 2XH6A 4AI1A 1ZBE3 5BPDA 1DDNA 1RXFA 1UYZA 2A61A 1QJU1 3CF2A 1YJ9I 2Y6HA 2FDIA 3QAHA 2VMFA 2B42B 4E4DX 3R61A 2VJ4A 2QM3A 1TT0A 2BGCA 4LG3A 2VR4A 4DXRA 2HS5A 2GBYA 3IT8A 5BNNA 1R091 1GR3A 1YIFA 5J4YA 4QXKA 3QOEA 2CAVA 5AFBA 3H5AA 5GALA 2WWYA 5BV6A 2HPIA 2Y30A 1OKQA 3BGAA 4C3HJ 5FZ1A 1NTCA 4AOCA 4W4ZA 3C2BA 1CR7A 3OYAA 4IVNA 2P2KA 4FOYA 2K4BA 3DTKA 1CAXB 1MD0A 3SDBA 2ZJRF 2ZAHA 1ASJ3 3ALQA 3BPXA 2JMWA 1CGPA 5K4LA 1JOJA 3KYLA 4B48A 3OIPA 3DPLC 3RWNA 3SMHA 4A4AA 4MEXF 5FDBA 4JGYA 5K1YA 4PIXA 3OBTA 2BYVE 1IHMA 2P6CA 4YM2A 4P5YA 3HN3A 2HGCA 2DUPA 4A3IJ 3CCMI 3H7JA 4RR3B 1DU0A 2PHLA 1GZTA 3LQRA 3HUGA 3WHCA 5BXXA 3NRUA 2LR8A 4KU7A 2ZMEA 1H6XA 1VMJA 2DVGA 2NS0A 4ON0A 4MV2A 1VALA 2VKHA 4OUEA 3CC4I 3O1MA 3I4MJ 1QXRA 2BZTA 2ZX3A 3FBIB 3BN6A 1U5TC 3PTRB 4FPEA 2WY8Q 3MPBA 3VHRA 5K7HA 4R52A 1SVMA 2X51A 4V1PA 4LBQB 3WTYC 5FPVA 2R7VA 1ND2A 1UOFA 1J59A 3OBRA 5T5OA 1NAEA 4RHV2 4K40A 1WMXA 1SC7A 4L5JA 2J1UA 4MTEA 4BACA 5A7SA 2AR6A 5D21A 1OH3A 3U21A 5FZEA 5M5XJ 2DAOA 2VMHA 4WZFA 2MFZA 4V2GA 2W1SA 3I0TA 3ZSMA 3RKWA 4V2VA 2NVXJ 3DPTA 1AR81 3H5RA 3OOPA 2E2JJ 4AEMA 3AJZA 1G6NA 1ZNPA 2KP6A 2Y9ZA 3WZ1A 4U0VA 3JR9A 2H8RA 1XJAA 2DFBA 3CEWA 3LDKA 1CIYA 3F9KA 2WB1N 3OGVA 5FD5A 4JX6A 4NRQA 3ITQA 3LL7A 4UBHA 1HIXA 1LHWA 4BJTA 2MNGA 3LSPA 3MFKA 5ACA3 2P17A 2HFHA 1SLTA 2QFEA 2XAQA 1IQAA 2Y6KA 4ASNA 5FV3A 2K3FA 4K6BA 2VNRA 2DFCA 1HC8A 2UZKA 4HX8A 4NPLA 3S1NJ 4AQSA 1WRJA 2NYYA 2WR9A 3W5MA 3H35A 1BHGA 3GF2A 3RFRA 1DZQA 2CW7A 4RB0A 2WA0A 3GVAA 2EALA 2QSGX 2WT2A 3WE3A 1Y8QB 1UW8A 1YFUA 2I2SA 4EJWA 1APNA 3BODA 3T1BA 3D1NI 1ZR2A 1QH7A 1AYM1 2Z1DA 2QF7A 4N0BA 2PHWA 1J84A 3BQYA 5C33A 4CU8A 5F1RA 1OSGA 3M4FA 4LBLA 2MA3A 3ZYHA 3HKZN 3MFCA 1AR93 1W3VA 1ZH5A 4KMQA 2XAHA 1J09A 1CAUA 1Y43B 4CDUB 2ZEZA 1C0WA 2W68A 2XROA 4QDQA 2RR12 4LT5A 4HVQA 4B43A 4LUMA 1MMDA 1H9TA 2DYRH 4XUOA 4JTOA 2RDNA 2ZGQA 1GV5A 1N1SA 2VU9A 4YFZA 4EWDA 1N3QA 1LOCA 2ELJA 1QNTA 2UUZA 2H0BA 4FPLA 5CVIA 5IUQA 1Y9GA 3OYHA 3WP5A 2IA1A 1LNWA 1OJLA 4XF3A 1PJRA 2Q2EB 1AHSA 4D5CA 2QKLB 2EZHA 1OD3A 2GMMA 4UF0A 3WODF 1WHUA 1MS0A 2YBPA 4XM3A 3MIDA 5LRSA 1XB9A 3HOXJ 1QQP2 1J1LA 1XB4A 4L9BA 1E5SA 5FZHA 1ZVFA 2RGVA 3K4MA 2WZEA 4MLOA 4RGSA 1R1A2 1JU4A 1NLSA 5DDJ1 4SBVA 4DZGA 4LR4A 4Y1UA 4HOOA 1SD5A 2A6TA 1DYPA 4IV1A 2P6TA 5FZLA 4RS8A 1H89C 2EV0A 1BJAA 3AC0A 1EH6A 4HV5A 1W5TA 1OD5A 3Q0UA 1C8M2 2ZJCA 3CF6E 3KV9A 4XKWA 2DCEA 2DTRA 4IE7A 5E3NA 4U7DA 1JHNA 1P4WA 1BC8C 5B1AH 2E7AA 2H27A 5D8AA 1FOKA 1VBB3 2XJVA 3I3MA 4PI2A 3TOBA 4ZTJA 3S2HJ 1WCDJ 2EFNA 2Q4SA 3C7FA 2RE9A 3PJRA 3GXOA 3M8EA 1ITYA 4HPQA 4DYQA 2AXLA 3ABKH 2IP2A 2JE8A 5A7OA 4LHNA 4KICA 2DTWA 4AIKA 2EXHA 1TNSA 2NMNA 3PTYA 3H8XA 1L7QA 3D8CA 4HBLA 4YZ1A 1UHWA 4AHWA 4R79A 2VAUA 4S0HB 4ENMA 5T5JA 4MQ9F 3VDCA 2PLV1 1G8XA 3A0BC 1JH5A 3QP5A 1ZRCA 3BYWA 1W0TA 5EG0B 3GCWA 1V3FA 3AKTA 5F08A 5GKAC 4PCRA 4OYUA 3QU6A 2VZQA 2CUJA 1ZQ3P 3CJIA 4CRQA 3OSDA 1G9CA 4LHLA 1W4MA 5ANNA 4NMIA 5A3MA 2NVUB 2D1HA 2X5IC 5DPNA 2K2SA 5HNFA 3EHKA 5CVRA 4IHYA 3DEUA 2OCCH 3EUAA 1F43A 2TRTA 2JIGA 3OOXA 3M3CA 1CAWB 5IT6A 1CX4A 1VQKI 4P14A 3S14J 5A7QA 1QVUA 5JOYA 1A31A 5K5QA 3F8NA 2XF7A 2JZYA 3MIEA 1NX9A 2QQWA 1T08B 4XN3A 1N47A 2HWE1 1RUG3 5FZFA 3ZYRA 2V4JC 3HNYM 1SBFA 4EJVA 1VBE2 2LF7A 5KC6A 1V6OA 1W8NA 4QTRA 5FP8A 2HWF2 2HU9A 2VPRA 3QYEA 1YW9A 4EJOA 2JVHA 5LA0A 2FBHA 4N7IA 1YC61 1WPKA 1FPN2 1H8TC 2HBTA 1D4VB 5F9TA 1H6YA 3LSTA 3DV8A 2WNOA 3UK9A 1U5ZA 4YG3A 3TN93 1Z1DA 2CAUA 5HNHA 2VUMJ 4WVVA 2W82A 4BY1J 3PLQA 1R083 4OMYA 1ZG3A 3P6BA 1S1AA 4JHTA 5ABJA 1ASJ1 4XKVA 4YPJA 2XONA 1HSTA 3CJQB 4JGZB 5FTTC 3HBKA 4UFLA 2VBDA 3NAPA 5CFCB 2VQUA 5T5LA 2DXIA 2IT0A 1B59A 4GULA 4IJAA 5FRAA 3PURA 4QXHA 4EMSA 1NK2P 3HJRA 1CX1A 4O65A 1RUH2 1WD4A 2KLOA 2L7KA 4L9TA 4CZZA 2EAAA 5J6XA 1GWKA 4DS0A 2DI3A 2BBVA 4A0XA 1B35A 2MLKA 4KITB 3VODA 2DVAA 4RYDA 2LNBA 3SEZA 3ZFFB 2RS53 3O8GA 5ERIA 3THDA 3CCSI 3IAQA 1JZ7A 5J1RA 1UZ0A 3G1OA 2HWB3 3FZVA 4AD9A 4F92B 3F72A 2ZZJA 4UV8A 1ONVA 3C7GA 1ND3B 1MIJA 1VMHA 1YO5C 3FLPA 5J48A 4ZYGA 1CJPA 1MBFA 2I45A 2PAMA 2W9XA 1U0AA 2Q8DA 4LLGF 4Y22B 3VBSC 4XHBA 5JMCA 1T95A 5JR3A 4ZDPA 4I30A 5LK5A 1AL22 3Q8AA 2CU5A 3IMMA 2OUJA 1XBFA 1SFNA 3AYAA 4AI0A 2XQXA 4ESFA 4CCMA 2HEOA 3O1TA 1JU3A 4JQTA 5FP3A 5IOZA 3OYWA 5JIAA 3AP9A 2DURA 2EB7A 1SLCA 4C2MJ 3S1QJ 5KXDA 1T2XA 2QBXA 5K7FA 3MI8A 2VMDA 2ARCA 1IS6A 3SKJE 2MG4A 1IF1A 1ONAA 1ZRRA 4AEDC 5ACA1 2XHKA 3PUFA 2XUEA 2FCUA 1EF4A 3WQ0A 1R49A 4BBRJ 4NQWA 5L73A 5DUIA 1IG7A 2XJPA 2IXIA 1S2KA 4OIQF 5LK7B 3DXJF 2VOPA 2RM23 5FO8B 1CF7A 2IS1A 2IVJA 3KQRA 2BOJA 3TRSB 1PO23 5CNAA 2J7MA 3P3NA 1OQYA 4Q4W3 4GJZA 3KCXA 5FBZA 3ASOH 3SHRA 1WGPA 4G12A 2KJCA 2LH9A 4XICA 3I8TA 1TWFJ 1RETA 2DWRA 3FL7A 1SANA 2ME0A 2RREA 2LY1A 2UWBA 1XC6A 1FOYA 4YEJA 4JP0A 2OKXA 4A3GJ 3ZXKA 1ZX5A 3A21A 1AR91 3OCPA 4FTHA 4A5NA 4K1YA 1WMFA 2VQGA 3G4SI 2Q8EA 5ICFA 1ZARA 1AA7A 3CMMA 4HK9A 2W00A 4GXOA 2W85A 4INDA 1FYUA 5KHHA 4XZUG 3BROA 4DJAA 2EZIA 2MH9A 2GLOA 3HWJA 1DDLA 2BXYA 3RMXA 2JSCA 2Y2ZA 1IPJA 5JLXA 1HRI3 4MGZE 1KQRA 3SXYA 1K83J 3N9OA 2X6XA 4P02B 2KHMA 4XAEA 4ASKA 4M3BA 1QNWA 2OQGA 5DCMA 2JX9A 2ZKNA 3DYOA 4C3IJ 2Y33A 4S05A 4N4OB 5JR7B 2JTVA 2XOMA 5C9AC 5I93A 2QCOA 5AVPA 5EZHA 2HKOA 4OULA 3ZN6B 2Q1MA 2FF4A 4P9XA 1AKHB 2IJLA 4C3JJ 2L54A 4KU8A 2D3SA 1ACIA 4BKXA 1VR3A 2LREA 2OPTA 3OYGA 2IXKA 2I5UA 3H9QA 4MXWB 5LATA 3SISA 2OA4A 1YEWA 3CO7C 5FQ0B 1RR8C 1OPCA 1DYOA 3RTRA 5DABA 4DGWB 5JIUA 3E1SA 5M3FJ 4R4XA 1ULFA 2YC4A 3Q9SA 2I07B 2GXAA 4G6DA 1MH4A 1HLCA 3DXUA 2VZ3A 4LFUA 1LJ7A 3OUJA 1VBB1 5CFDC 3UNPA 4CA9A 1EAH3 2AACA 3GFJA 3H8RA 1I3QJ 3H3UA 2X6WA 3VHOA 3AG1H 2FDHA 1PZ7A 2HYKA 4V2FA 5FY0A 3WF2A 3CZJA 5GTIC 4A3ZA 3PL0A 4D0PA 5GLWA 4UY8I 2WV0A 4X6RB 4NHMA 1NCRB 4YZ3A 3ZXSA 5E3MA 2BRTA 3NVCA 1QOOA 1APLC 5L3FA 4QX5A 3CP8A 3F23A 5IT3A 5JOWA 2LALA 2E31A 3H1YA 3OWTA 5FLVA 4ZYDA 5DN2A 2H6CA 3NNGA 2IFRA 4RFT0 1ZA7A 2H8WA 4WV8A 3C3VA 4OUSA 2P37A 1VI0A 4IE4A 3RQ0A 4XSZF 3R4SA 2Z79A 4P9JA 4YZ2A 2Y75A 2N7GA 4BOWA 5C44J 3N97A 2EQRA 3TEDA 1OUSA 1D8KA 1QJU2 3OBAA 4IPAA 1SAUA 3VDXA 1R1UA 3HRMA 4W50A 3WNMA 4EE2A 1E3OC 1AWCA 2JD4A 4AHZA 4E4ZA 3H50A 1R092 3QPTA 1QXPA 3RZOJ 1O6UA 2NYXA 4LLFA 3HPGA 1UZVA 1AJKA 1UG2A 1ZZ8A 4EV0A 2RVCA 4BCUA 3W5NA 1W05A 2BWCA 3CBNA 2P4WA 3TEWA 5IP6A 4IX7A 1BM9A 4BGDA 5FLXZ 5GP9A 3PJYA 4JX0A 1AYN3 2I10A 3W2VA 1YQ6A 2D97A 1ZRIA 1W0OA 4CU7A 2VECA 1UPIA 4JHZA 1JKQC 2FZ1A 2YHJA 3I54A 3CCYA 2VM9A 4ABZA 3AP7A 4OI0A 1JUSA 4CEWC 3DUIA 4GO1A 3SQNA 3V4GA 3IH3A 1YTYA 1XN7A 4NR1A 1Q8SA 3MUZ1 4M9XA 1ZK8A 2HEYF 1F4KA 3TN91 3J81K 2C6YA 4C2UA 2J1VA 2WNEA 1R081 2QQAA 5CJ9A 3NL1A 4Y1XA 4TYSA 2CW0F 1QKQA 2DLLA 3HR9A 3Q3SA 1QPMA 4NN0A 2G9WA 3V7CA 4S2HA 4X8PA 1M06G 5D5UB 2L3DA 4XMAA 2KPMA 2AREA 3PMEA 4KQ7A 4A6EA 1PX4A 1H88C 5JLWA 1O3RA 2CV1A 2H6BA 5D8LB 3T5XA 4BQ4A 1C3HA 2VQHA 3NSTA 3PIOF 1BR1A 1O57A 3KETA 1VBA3 4XFBA 4ENKA 2K85A 2VXJA 2VTXA 1HRV3 3THTA 1T33A 1R5GA 3KX2A 2W08A 4LNVA 3OUHA 4META 3RI8A 3ACFA 3S7IA 2ZJPF 1LOFA 2RS51 3T0YA 3IDCB 3PDQA 1A78A 1OUXA 1KDMA 4BYYA 1R23A 2Z99A 1O5LA 2DBBA 2ZJQF 4QQOA 2E19A 2HWB1 1NQDA 5IK7A 2BOLA 3FLTA 1F5JA 4BIOA 3VZLA 5FPXA 3VD4A 2EV5A 5A6XA 3K69A 1AR82 2CRGA 1YHQI 5FJHA 2EXJA 3A01B 2X5IA 3WP4A 2HTSA 3MZYA 2VW0A 1Z78A 3ATGA 2ZNZA 2PHFA 2QQVA 5JR2A 4BQ3A 5FCCA 1BZWA 3ZPYA 2VJIA 4FX0A 4OMZA 2EIEA 3N05A 3CD6I 3A03A 3VYUB 5DUVA 1UD1A 5C3QA 2L9NA 3ZMUA 3RZHA 3RGBA 4WM8A 4AHYA 4XL9A 1V4RA 1G3WA 2XKOA 4M74A 3KF5A 4BDVB 4BQ5A 5J3LA 4P9LA 2YGMA 4YIFA 1IC8A 4FOQA 1URXA 3KP3A 1W9YA 4LD5A 4DQAA 4YFWA 4YFNF 5ICEA 3WGHA 3RZGA 1LAJA 6PAXA 2EZKA 4GH4C 2N8GA 1AYM2 2HDCA 2ENRA 4JVAA 5AVAA 1G9DA 1X9PA 4BHCA 3CJTB 2RM21 4XJWA 2P3YA 4AQ6A 1PO21 2YU2A 2FX0A 4Q4W1 2COBA 4OHWA 2HWC3 2MD5A 4N53A 4LQRA 1UO9A 1VRH3 4CDQB 1LHVA 3VD9A 2R5ZA 3ME2A 3WG9A 3J7LA 1KITA 1RI7A 3VBUA 3MKYB 5A32A 5JPNB 2HQRA 2K7LA 2VBWA 3EPZA 2XB5A 2CTVA 2LP0A 4A3LJ 1C8NA 3LAGA 4BB3A 1LEMA 5CKNA 1RC9A 5A1FA 4GKXA 1FC3A 4JV4A 1J7KA 3IV5A 4HAMA 1A04A 3WLUA 5A33B 4UXNA 4RLFA 4ZS3A 4DBQA 2Y38A 1YW7A 3RZJA 4IL7A 2EIGA 2E53A 4YWAA 4XF9A 5DDJ2 3LSJA 2JKXA 1K7AA 4EWEA 1HRI1 5M5YJ 5L9VA 1HXS3 4X8NA 3V56A 1S3JA 4D8MA 1C57A 1T2KA 3VBFC 4YVWC 5IOYA 4CTEA 4BQAA 1Q1VA 2XPJA 5T55A 1X8EA 3MMYB 1WCQA 4B44A 3G1MA 5LWBA 1YJNI 2MHFA 1IZ1A 4D6QA 1E17A 2YX7A 3U0ZA 3JRHA 3IL2A 2RG4A 1HW2A 1DQ5A 3HBLA 3QPLA 4MTDA 3JRGA 5FFOC 3VYTB 1V9U3 3CHXA 4DOZA 2XLGA 3PQJA 2R30A 2A70A 2E2HJ 3BUCA 4HF2A 5DAQA 4IEQA 2XB0X 2XL9A 3WEZA 4XILA 1YHFA 3VHPA 4BQWA 3N9LA 1XYOA 1FNZA 2D3RA 3OL4A 3A2KA 5B4NA 1HDPA 4MX3A 1O3QA 4AEDA 2P5BA 1DPRA 2Y6JA 4LO6B 1OOPB 1EAH1 4QQHA 2PLV2 1STMA 3VBRB 5FKMA 5IK5A 1D0ZA 3W3CA 3ABZA 2HXIA 1FEXA 2YC0A 5JXHA 3FKIJ 1ZG5A 1C5HA 3WNOA 1Z91A 4GWMA 2IUWA 2QUOA 4NWWA 5BNPA 1LEAA 2W84A 2KQRA 2FBKA 5JHFA 2GNBA 3B3QE 5C3OA 2ZX2A 3NV2A 1FT9A 2KL4A 2BVLA 5CA6A 2DU0A 4OAYA 2D6MA 4EN0A 4KUMA 4CDWA 1HQCA 2R7UA 4RB3C 3WXPA 5DDGA 4BHBA 1XC5A 3MF9A 5E1WA 1YYVA 4LA3A 4JK1X 2HWE2 5A7PA 3DKWA 4UFIA 4XZPA 4JCKA 5LBBA 2HDDA 5F39A 2ZOEB 1Z7S3 1MZBA 5BPXA 2V4VA 2QGUA 5FYCA 3K4LA 5H20A 3W2WA 2XQRA 1GZWB 4Q29A 1W6PB 4I76A 2HJIA 3IH2A 4N43B 3VZJA 4U88A 1VB4A 5FZ6A 1H1AA 2A6VA 4FE4A 5JSOA 4N8MA 5K9YA 1YNAA 4RAYA 2L4AA 1GFF2 4BL0B 2DDUA 2VC9A 2R7SA 1YQCA 2B9UA 3VYSB 3KZ4C 1MNMC 3BOQA 3VZNA 5EJZB 3T0DA 4C1XA 1TWAJ 3LWFA 3QPSA 1NK3P 4F55A 2ME6A 1AYN1 1SCRA 1G3TA 1ASJ2 4IESA 1YQ2A 4RGAA 1WCSA 3OR1C 4KJZA 5GLZA 4D7MA 2AO9A 3J7YJ 3OMYA 1CAXA 1VQ7I 5LA2A 4Y52J 1DZRA 3LZZA 4IHXA 5TRDA 2PAEA 4HLXA 2JK3A 1N1TA 3NWTA 1GU3A 1ERDA 5C71A 4NWVA 3TMOA 3ACGA 1VNDA 3HOZJ 3GFLA 3BU7A 2FUG2 4J1XA 3S2DJ 3I3BA 4JC1A 3J8F3 1O8PA 2XV4S 4RR3A 5A3LA 1QHDA 2VJXA 3WCRA 3V8JA 1PGL1 2YBKA 1VBA1 2FXAA 2HKXA 3G7DA 4AFDA 1JYVA 1TE1B 3BG3A 1HRV1 1DLLA 5HCAA 5C3RA 4PHZA 4PF5A 3MLKA 3J81Z 1Z21A 3AYEA 4RS5B 5JSPA 3U9GA 3OOUA 5FYYA 3RJPA 3O5SA 1G2HA 3ZP5A 4B7EA 1SFYA 3GZNB 4Q4V3 2Q8CA 4JX5A 2VZOA 1CQTA 1HBXG 2E60A 2NPIA 4IEJA 1WSUA 1VAKA 2XLAA 2LLKA 2DU9A 4IERA 2WO1A 2XSJC 5A2QZ 4KIBA 2JENA 4XIKA 5HCFA 3GTMJ 3VDAA 1VZ0A 4PK4A 2G1MA 4Z8BA 3MW4A 4EN9B 1EA3A 5C4WC 4QPYA 2A5WA 1YE9A 4E8DA 3HEIA 5ACA2 1FNYA 4PJJA 2AGSA 2RVAA 4JZRA 5CVJA 1YO8A 1Y9MA 2Q8OA 2J42A 4NNJA 1WZ2A 3ZFEB 2K46A 2Z33A 4XMIA 3I3QA 3KLSA 2IXCA 4BQOA 2Y26A 2E34A 3D82A 2VD7A 2K3PA 5AIPA 1WA6X 5FOBB 1FSHA 2ZEYA 5FPBA 1WW5A 3Q8CA 3H9GA 1JS9A 2LUWA 1I1EA 4YLZA 5FPLA 2Y0OA 4AW7A 3OIQA 1W8WA 5FLMJ 4DYRA 3O1UA 4HRIA 1J5YA 4J6GA 3M3OA 1FIAA 1LFPA 5FKCA 3OD0A 3M9AA 1UMHA 1OQEA 3LIHA 4AU7A 1AR92 1W6OB 5BOXA 3PUIA 4GWIA 1TG7A 3CCEI 2A6EF 2ZXWH 5DUUA 1E5RA 2WNVB 2HWC1 3MICA 1LPQA 1VRH1 5GZGA 1RESA 4BXFA 1Q8PA 1RL3A 3MW2A 1OFCX 1NE6A 4M71A 1AZDA 3DKQA 3VD7A 1LTEA 3GXUA 4OI1A 4QAWA 3AKPA 4K21A 4TLGA 2D93A 4RLQA 2IS2A 4Q0UA 1H30A 2NM1A 4D7SA 4EM0B 1QMJA 3MZHA 1JYCA 2YXSA 1L0OC 1N1YA 2M5WA 4BXSV 2VE8A 3URFA 2G9FA 4XORA 1US3A 2QZ3A 4IETA 3RJ2X 5FO9B 2Q2EA 2XAUA 2WTEA 3BTIA 4UHTA 3ZPOA 2P5KA 3FBYA 5GADJ 4KG8A 1S0DA 1XGOA 1DQ4A 3GALA 2G7HA 1HXS1 3NNMA 1YW8A 1LUJB 5DM7F 1PK6C 4FFIA 3WG2A 4I7HA 3SYTA 4YZ5A 2VZRA 1XSDA 1X33A 5IHRA 3GF6A 5F04A 1PM7A 3O1SA 5DG2A 4MFEA 3ROUA 1GZ9A 4CCKA 3GHMA 5JFRA 3PQKA 1JJ6C 3E6DA 5EFUA 1JXNA 1OXCA 4MGIE 3SZPA 2PMHA 1X50A 3G6JB 1VBB2 5EEHA 1T0FC 3BIWE 3T2QA 1KD7A 2O8OA 3WG7H 1O3SA 2ZXIA 5FRNA 1B4AA 1V9U1 1IGOA 3PVEA 2V6EA 2JA2A 1WBLA 5J47A 3HDDA 4M9SA 4DY3A 4CU6A 1G4DA 1CVNA 4LO5B 3GJAA 3KVAA 2CS3A 3GLLA 1YOVB 3J26N 3AL6A 4AZZA 2ZHLA 4JX4A 4KFCA 1BCXA 1UY4A 3WTTC 3F22A 4YW5A 5E6HA 3RS6A 3DBLB 4RFRB 1HV1A 4OHVA 1BXHA 1MBEA 4W6YA 3ACLA 2D6NA 2TUNA 2BHZA 4YFXF 1OR7C 2DA5A 1W0UA 1BR2A 5LBCA 4GXLA 2DK8A 1LENA 4W8JA 3E97A 4KNYA 4BQNA 4UT5A 4SLIA 5JZGC 2YROA 3WY6A 1NXD1 4IXAA 5EG0A 4PJLA 2PFWA 2FDGA 1NZIA 2DN0A 4YM1A 4RB1A 1F9KA 5L9BA 3ECHA 2XBO1 3HSFA 5HDKA 1T98A 4A3EJ 1JI8A 1R71A 2DYSH 5GZFA 3OR2C 4P1WA 3C7HA 5CPRB 3BB6A 4ZY9A 2E5ZA 4L5IA 4H14A 2DPUA 4M3GA 2ZX4A 2UY8A 1T6SA 1UU4A 1CAWA 4QQPA 1TQMA 4AUXA 2NQYA 1LOGA 4Z2YA 1SHWB 4ZU4A 5FR3A 1B8IB 1DFQA 1YJKA 2GC0A 3ISPA 1Z7S1 4TXWA 1C1LA 2DDBA 4I2OA 5GJ6A 1D3YA 2D98A 4XE9A 5F2WA 2VNVA 3ILFA 4M3CB 3JUUA 4G6TB 2JA6J 2JG8B 4L0ZB 2ESHA 4FPOB 1KXGA 3LSMA 1K42A 2MYSA 2Y69H 4TSVA 4UUTA 1CPNA 2GP3A 2IXSA 3VBFA 4ZC3A 3TN92 4ENJA 4XQFA 2HVRA 3JAMK 2H09A 2JDNA 1R082 1S0JA 2ELHA 3OYMA 1RITA 2Z4FA 4Q1RA 3NQOA 2P3KA 5JAXA 3CJXA 4GCVA 5IVEA 2E2IJ 1ENRA 5IYDJ 2WNUB 3QH6A 3GX4X 2AENA 1XSQA 2WT0A 4HVOA 3BWGA 2MPFA 2BW3B 2VXZA 1E0EA 5DXDA 2CWEA 3S5QA 4FOWA 1NZCA 4AI3A 3GZTB 4B4QA 5CFCA 4XABA 2ADUA 1W6QB 1SD6A 2JPCA 3FXOA 2WWJA 1REDA 2C9KA 3HNBM 2RS52 1HQWA 5HOOA 1X8MA 2OX0A 5IK4A 3TDUC 1JKOC 5D8KB 3RKYA 1AX2A 3J8F1 1WD3A 2HWB2 3KHBA 5CAZA 3ZMDA 2QQIA 1MNEA 4HA8A 2GU9A 3S3OA 3ZFFA 3FUQA 4CE8A 1R9TJ 1RUJ3 5KVRA 3CQOA 4XXPA 2STWA 3M3YJ 4OWRB 1MQTC 3CCQI 2UXNA 2XPVA 3I2IA 3F8BA 1RTVA 2LROA 4OQ9A 1ND3A 4BQ1A 2ICWG 4LK6A 2DFFA 2XVKA 4XF1A 5K5RA 5C8CB 4KN7X 3B69A 2DT7B 1V5GA 1XGMA 5EJCA 3LQCA 3FXJA 2IAIA 4Y22A 2A69F 3ZXJA 2QQJA 4OHYA 5JHUA 2KA3A 2YB7A 3A22A 4WCGA 5E17F 2NN8A 1OF3A 1XNKA 3U07A 4A3KJ 5EWSA 2VPLA 4HPKB 1PUFB 4BPZA 1UIKA 5C5TA 2ZTNA 2GMEA 2QE3A 4IV3C 1DIWA 1GP6A 3RNSA 1I3HA 4PJYA 2R7WA 3WTVC 5GAGJ 4UVBA 3AYDA 1ZAOA 2PMWB 1I1SA 4NIAA 4P9IA 4QKBA 5FPAA 3MW3A 1S7EA 3WF4A 5F6KA 2RM22 2GA2A 4LJHA 1B6AA 1IJWC 3NMBA 4XDPA 2K0GA 1PO22 4L18B 2MD0A 4NC6A 2NS7A 2ISZA 2HVQA 4LA2A 4B3AA 3VZKA 3RWKX 3TP0A 3MF6A 4FXKB 2YSRA 1S7OA 3K4NA 3T1MA 2WN3A 1W2AX 3O7OA 2WUHA 3M3EA 5D5VB 3CC2I 3POJA 1X2NA 5D1IA 2VZUA 3BC8A 1S0EA 1B35B 1KYWA 1RPWA 4G9SB 2ZGSA 1UPSA 2HOSA 1A8MA 5G04L 1WLDA 1U12A 2D5HA 1S8NA 1W2NA 4BE1A 5CG9A 3V7SA 5GM0A 5HXMA 2CW8A 1X82A 5EXOA 3R0AA 3EO6A 3ELKA 3RQ4A 2JDUA 2KFDA 2VW1A 1YQ5A 3LAJA 4BE0A 1FI2A 4LKFA 1MMSA 1PP7U 5E8GA 5F5QA 1WH7A 2PJRB 5JWPA 2DMQA 4E7IA 3MAJA 2HYGD 3B5LB 1U5IA 2J1AA 5ANQA 1HRI2 1SMVA 1TVGA 4XYXA 1K45A 4D6SA 3UKNA 4FETA 2X1CA 5J1XA 4PFOA 4B7KA 3C7JA 1P7IA 5LGNA 1P8JA 3A1YA 5LA9A 4YYOA 1SMTA 1ULCA 3HJEA 5KHGA 4B09A 4CYDA 1HSJA 4LJZF 2VLAA 1ULYA 3I53A 1SBEA 4LEJA 4UB8C 3OYWB 2Q30A 1GOGA 5FUNA 4M0HA 1ZLKA 1COV3 1D0YA 1GWMA 3TBDA 2VPVA 2EFQA 3ZN6A 1EY2A 4CEYC 3QU3A 2O8QA 4ZDOA 5IP9J 1ENSA 2K9QA 4A3BJ 1IN6A 2CSOA 4K8FA 1D5YA 1BK1A 2AQFA 5EQUA 3VL9A 4AYBN 4MXWA 3T0AA 1VIWB 3G73A 5FQ0A 3M7GA 2E7WA 2PYTA 4NQWB 4D3WA 1HB1A 3D5SC 5DCFA 5FB2A 4UFKA 1EAH2 3KB5A 3EUHA 1CF7B 3PL8A 3BCBA 1DP0A 2YDEA 2GZWA 4QMAA 2WFPA 2YZ4A 1XSRA 5FO5A 2P1BA 3U1KA 2X1DA 1A3KA 4OHXA 5IT9K 3AJYA 1U5YA 4ZPIA 4N9IA 4J00A 4NRMA 3WNNA 2R1DA 3ZMTA 1FJLA 1GVDA 2ISYA 2VODA 2QZ2A 3O12A 3MWMA 3USUB 1MS8A 1NCRA 3O0VA 2CHHA 4CXFA 1HN1A 3PHMA 1SQ4A 1ETQA 3AFKA 3KCYA 3RKQA 5FZ4A 2EA2A 2JUCA 1LESA 2BPA2 3QWLA 3U4SA 2HYXA 2O5RA 4P08A 3BU0A 3FE5A 3I4NJ 2DJIA 4G3YC 2B8MA 4DIQA 2O9LA 1RRJA 1F4HA 1Z3YA 2CV6A 3WR0A 2IVMA 1U5TB 4DBRA 4A5MA 1MBGA 3D0JA 1O91A 1FAYA 1MNDA 2QJVA 1LB2A 3RPUD 4BM8A 1JTXA 2LC2A 2FSWA 1W1WE 2NZ9A 1CD3G 2JDZA 1GOHA 2F5EA 1LU2A 2D40A 3JCUC 1CJDA 4ES8A 1QJEA 2QDNA 1AYN2 1Z7UA 5FO7B 2FU4A 1JXSA 2VVEA 2STTA 3M8LA 1WJDA 3UETA 5FOJB 5B3SH 4LG0B 3LA3A 3LA7A 3I4PA 4HW0A 1MS1A 2VBXA 3OSFA 1LGCA 3NO8A 4MFDA 1H2KA 2X48A 2W2IA 4H7MA 4AFBA 3OYIA 1RUC3 1GV9A 5IVJA 2F5FA 2WADA 3TW6A 2GNMA 1GWLA 4XDOA 1H9WA 4BE2A 1QU0A 4ZHNA 1KU2A 4A3FJ 1JJ8C 3K3NA 5HV4A 4XEZA 5CEHA 2QQ9A 1ZGAA 4HLTA 3CMYA 4Q5SF 2XGCA 3ZSEA 1QOSA 4QHZA 4OI2A 4NIHA 3ZKYA 3ZMZA 3SZGA 1PGL2 1MMGA 1VBA2 3BG5A 4NROA 3CCLI 4DW6A 1HRV2 1FMWA 4XLPF 5CB7A 4HMZA 1ULEA 3GEZA 3JAMZ 2JVGA 1RUI3 1W6NB 2QNKA 2ATFA 1N25A 4AM3A 4NPRA 4UI9L 5IPAA 2ZGOA 1QOTA 3LDBA 5A6YA 1HA8A 1V5FA 1POV0 2VZPA 5J96B 1YCIA 2RN7A 2XSDC 4BJ0A 2LRPA 2R073 1RUJ1 2OPKA 2EWNA 2OYZA 2Y64A 2VL8A 2LVSA 2M34A 3ZMVA 3NV4A 4MGYE 2V72A 4Y26A 4L2NA 1U78A 3WQ7A 4QPQA 2QKDA 4AEKA 4M4PA 3K9TA 3OEBA 1Y6IA 3A01A 1ETYA