3IWZA

The c-di-gmp responsive global regulator clp links cell-cell signaling to virulence gene expression in xanthomonas campestris
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
207
structure length
207
Chain Sequence
LDAGTIERFLAHSHRRRYPTRTDVFRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRTRTQCELAEISYERLQQLFQTSLSPDAPRILYAIGVQLSKRLLDTTRKASRLAFLDVTDRIVRTLHDLSKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The cAMP receptor-like protein CLP is a novel c-di-GMP receptor linking cell-cell signaling to virulence gene expression in Xanthomonas campestris.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transcription
molecule keywords Catabolite activation-like protein
total genus 68
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF00325 Crp Bacterial regulatory proteins, crp family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwzA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3iwzA01
2Y75A 4HSJA 4FX4A 5E1WA 1ZZBA 1P2FA 2UXXA 1Y3TA 3QP6A 2FNPA 5BUVA 5ICEA 3WU1B 3D82A 1I27A 4WXHA 5D4SA 2IXLA 3HOSA 1BM9A 2OZ6A 4AVPA 3DF8A 2QWWA 1WWXA 2XL9A 1IN7A 4UXAA 4L9NA 1KU2A 1CAVA 1X7NA 2GXGA 4UVBA 1TW3A 1S6LA 4EM2A 3D5LA 1K6OA 4QM8A 4KMFA 5HLGA 2WWYA 2VT2A 1YLFA 2BYVE 4YARA 2D5FA 1D5VA 4MGIE 4I09A 1O5UA 2BNNA 5D4RA 4HN1A 1WKMA 4EJUA 2FSWA 2EB7A 2PEXA 4KL1A 1O4TA 3I59B 1ON1A 1WA4A 3DKWA 3KZZA 1X82A 5E20A 3ZMUA 1SQ4A 3EBRA 2DW4A 1QWRA 4ZZLA 1R5HA 1TQIA 3L9FA 1I1GA 3UKVA 3KP6A 3S7IA 1G6NA 2STTA 3N4MA 4I01A 1WGPA 2GIVA 1FXZA 3U10A 3PQKA 3CUQC 2DLLA 2K4BA 1DDNA 3IRQA 2JPCA 2RQPA 1A04A 5F6FA 3L00A 4GCVA 1R5GA 2WTEA 3WGHA 1MDMB 2O8XA 3BCWA 3RNSA 1HQCA 5JAXA 2FQ3A 2XAJA 3FJSA 2HQNA 1VTNC 1R1VA 1U5TC 3I54A 3FF5A 2VODA 5CU1A 1IRGA 3ETQA 2V6CA 3P7NA 1IN4A 4RB0A 1HXDA 2H94A 1R1TA 5D1IA 4BH9A 3ABUA 1FSEA 4X6RB 1LDKB 3L09A 2PAEA 1MJBA 1CAWB 4H7LA 4P9UA 1HKQA 1DPUA 1U8RA 1YFXA 5KVRA 4RGXA 3QU3A 2Q0OA 4LG0B 5BY5A 1YS6A 3SHFA 2CYYA 3FE5A 5KHGA 3FXQA 1IW7F 4I0BA 1DZTA 5HI0A 3FX3A 5H6RA 2ELHA 3RI4A 4KUMA 4AXOA 5FD5A 5FQ0B 1F4KA 2DFIA 3IIAA 2IRFG 5F1RA 2DK8A 4AD9A 2MH9A 3E6DA 3F23A 3QP5A 4U0WA 4D7TA 5CADA 3ZMZA 2HYFA 2QZ8A 4AIHA 3TO6A 4RB1A 2GXBA 3GLXA 3GFIA 3DXJF 4OMZA 1CF7A 1USSA 2DT5A 1HKTA 1HW1A 1B1BA 4OMYA 3U0ZA 4ENNA 1CAWA 5K5QA 4LK0F 1MZBA 2BNMA 1OPCA 4JTOA 4XFBA 3JSPA 2IT0A 4P55A 2XLGA 3CO7C 1UCRA 1YYVA 3MCZA 4U88A 2PLYA 2H09A 2P5VA 3HTUA 2UY8A 2GA2A 2A68F 3WODF 1GHCA 5T3NA 5DCMA 4DQ2A 4EWAA 2M8EA 4P96A 4U0VA 2MBFA 2UYAA 3GW2A 2HTSA 1QY4A 2E9QA 2YU3A 1TQMA 1BIAA 1S29A 2QQ9A 3NEUA 3T1BA 4LG0A 6PAXA 4KWKA 3MPBA 4HVQA 1BI0A 2R7DA 3KZYA 2O61A 5FLJA 3FHZA 1ZHFA 4MHGA 2KXLA 2CG4A 2MHFA 1BJAA 1ZX5A 5HLHA 4M73A 2IPQX 3LFKA 2GAUA 2HR3A 2XRNA 3K0LA 3BPZA 4A6EA 2IXJA 1FY7A 3RYKA 4M6XA 2XHKA 1SFXA 4UVCA 1VP6A 1P92A 4WX9A 3QPTA 4IESA 3H1MA 3WW1A 1FBUA 5JSOA 2LF8A 4KYWA 3C7JA 2DPUA 3H7JA 5JSPA 2ET7A 3M70A 1TW2A 2E7WA 5HS7A 1FP2A 5J8CA 5TJJA 3FHIB 5LBQA 1PP7U 4AIJA 4OIQF 3WG9A 2K27A 3SCGA 1XGOA 2KKOA 4L18B 2FA5A 4BHPA 2K02A 4HW0A 2K0GA 4HVRA 4AQ2A 1H1MA 1XGMA 1FYMA 4ONUA 4EWEA 3SZPA 3WE3A 2HQRA 4NVPA 1PM7A 2CSOA 1SFNA 3T5XA 1HW2A 1MGTA 5I0UA 4UV9A 2D93A 3P9IA 1QGPA 3G3ZA 3HRSA 5BS6A 3D0JA 1G4DA 4G6DA 2X4HA 1Q43A 4MQ9F 1X3UA 1ZG3A 3KCCA 4HLTA 1SMTA 3T8TA 3E97A 1B59A 3U11A 1BC7C 2Y48A 2HFHA 3BJOA 2CGPA 1O57A 2BBYA 2W24A 4AIKA 2Z2SB 2EVXA 2B5HA 4EWDA 4WXDA 5L3EA 4HX7A 4HBNA 1STZA 5E17F 4OLLA 3P9CA 2OBPA 4PCQA 3CDHA 3GYHX 2Q30A 3K1MA 4PJYA 4XFAA 1O3RA 5AVPA 2L4AA 3KP2A 5CVRA 1V3FA 3VB2A 2EFPA 3R0JA 4QGNA 3EUHA 2ZXJA 1NE6A 3DPTA 4JTNA 4ENJA 4G7HF 1U2WA 3KFWX 1CAVB 5EZWA 5I0RA 2XLFA 3GZ6A 1LJ9A 4HN0A 4HQEA 2KIMA 4LB5A 3WW3A 3I64A 1W4MA 3JW4A 1E17A 1EP0A 1LEAA 3TO9A 4O9GA 4MNUA 1MD0A 3CUQA 1XDUA 2R7FA 3V8JA 4N0BA 1LKNA 1W7PB 5E16A 1DGRA 1OYIA 4PGGA 3ZDSA 4M71A 5KBFA 2QNKA 3JAMZ 5BPXA 5IT9Z 5J48A 4XFGA 3RYPA 2CWEA 1AWCA 4N9HA 2EFQA 2QYOA 1ZZ7A 3F72A 3RTRA 2EV5A 2FRHA 4KWLA 4MUVA 1YO5C 5L3DA 4K8FA 1F1ZA 4PDKA 4FHTA 4IERA 4HLXA 2QBYB 1DZRA 1B6AA 3E5UA 3LAGA 1L3LA 4IETA 5FPZA 3R6SA 2RNJA 3R61A 5JR3A 3K1NA 2PFBA 1GVJA 5HVQC 4IPAA 3QAHA 2J5OA 1ZRCA 3OTFA 3HSFA 4IVNA 5LHIA 1KU9A 4ENKA 1JGSA 4L0YB 1XMAA 2EJRA 4L0ZB 2IC1A 2PAKA 5H20A 4KN4X 1I1SA 4S04A 3H7YA 2R3SA 2OU2A 1OYWA 3I4PA 3MQ0A 2FEZA 2V1UA 3TNPB 3GZ5A 5BXXA 4MQVA 1DUXC 3H3ZA 2VC0A 1QPMA 3REOA 1Z9CA 5JR7B 4IEOA 3I5UA 3SMHA 2VBYA 2JTVA 4BHCA 2O3FA 3HT2A 1W5TA 3NVCA 3ZP5A 5DUIA 2M5WA 5I91A 3L7WA 5A2QK 2F5CA 4EJTA 2KJCA 2P6TA 1QZZA 3DQVC 1FZPB 3J81K 2UYBA 2EWNA 5HOOA 1QXJA 3FMQA 2V9VA 1J2XA 4ZU4A 4Q48A 1O3QA 1JHFA 4XLPF 4ZYGA 4KT5C 4RD7A 4ZYDA 1XGNA 4EMSA 3K1PA 5LEJA 3EO6A 4MH0E 4I98B 2O8QA 1H0MA 2PG4A 3MAJA 3GYDA 4MGZE 1RUOA 3WE2A 2M1BA 2Z3YA 3BJAA 2GU9A 1LDJA 4HV5A 3WTTC 2DCTA 3I7DA 1PMIA 1P4XA 4XF0A 1R22A 5DCFA 2HOEA 2PBIA 1OR7A 2NS0A 4WCGA 4CGZA 3M8EA 4KU7A 1WRJA 2NYXA 4WVZA 4LFUA 1ZRFA 4QGMA 3ROUA 2K9ZA 3HHGA 4A5MA 4CDGA 4QWQA 4LLNA 4JBAA 2DO7A 1ZZ9A 3LOIA 2RVCA 2VT3A 1EH8A 2DAOA 1UHMA 2QVSB 4IXAA 5FO5A 3KGZA 3PQJA 4FX0A 2QCSB 4D0PA 4TLFA 5LHGA 4U0YA 5FFZA 3BJ6A 1R1UA 3H3UA 4NQWA 3IWZA 4HSLA 1BI1A 2P7VB 1Y0UA 4IRIA 3I71A 2UXNA 4Z2YA 4ASNA 3BPXA 3HRUA 4D7SA 1ZREA 1CAXA 2O0YA 3N97A 2Z99A 5KHKA 5BOXA 3NKTA 3E3VA 4XFCA 1FI2A 4QX5A 3FMSA 3HSRA 2FNAA 5DD8A 5L3FA 2ACJA 3LA2A 2W85A 1EYBA 4HMZA 2XAGA 5ED4A 1EV7A 4UVAA 4QLCU 3AAFA 2XAFA 4ESJA 1K7AA 1LNWA 1IPJA 3ECHA 3K2ZA 4YIFA 2CV6A 2HKOA 1QNTA 1U78A 4MV2A 4XF1A 1GXPA 4MEYF 2ATFA 4IF4A 4EJOA 2F4PA 2A5YB 5HDGA 4RGRA 1UB9A 4YG2F 4XSZF 3IKTA 2ADUA 4L5JA 2O6GE 1ZZ6A 2QQBA 2EV0A 1PDNC 2A3SA 3MZHA 2PQ8A 2BV6A 3KEOA 1RNLA 3F3XA 2XASA 3RPQA 4XLNF 4AVCA 1YS7A 4ESFA 2LSOA 2M87A 3F22A 5LGTA 3E6CC 2RC4A 5E1ZB 1CAUA 3J80Z 1W5SA 5FB2A 1W7PD 1KYZA 5E18F 1FBQA 1UW8A 3R4KA 3HT1A 4HZFA 2OAZA 4I0AA 2VOOA 4JQFA 4YNIA 3DN7A 1Z91A 3JSOA 4EGZA 1WQ2A 2EFWA 2A07F 2V1XA 2FMLA 4IEXA 4LK1F 3QOPA 4ETSA 4B8XA 5JHUA 1X8EA 2ZKZA 2JT1A 2D45A 2LDUA 3GBFA 1H9TA 3ST7A 2A6EF 2P6SA 4AWXB 5K5OA 5LHHA 3BALA 4EM0B 4IEVA 1J1LA 4L9TA 3HRMA 4KWJA 1JUHA 5LRSA 3GUDA 1LR5A 3CUQB 4ZH4F 1XMKA 3FZ3A 2XV4S 1FT9A 4LB6B 1TQPA 5I8SA 1T6SA 5D5VB 3ERED 3V7RA 5D5XB 3TO7A 2IA0A 3NSTA 4KN7X 2CQKA 4IEZA 2COMA 2NRAC 2UZKA 1FLIA 1FC3A 1GXQA 3VODA 5H6QA 2L54A 1BN5A 3TOAA 2NNNA 5ILUA 3Q5FA 2GC3A 4AVAA 3M1EA 4Y13A 1RC6A 3NJZA 3H9AA 5BPDA 1Z6TA 3SFZA 1XSXA 1ZVFA 1ZG5A 1Y9QA 1IZ1A 5DYMA 1LRHA 3GFLA 3C1DA 4JV4A 4ZU5A 3EDPA 2QVOA 4KMUX 3BDDA 2GZWA 5J6XA 2OQRA 1L3JA 2GQQA 5BMZA 5D6EA 3H1YA 1IXCA 1G3WA 2MC3A 4Q0UA 2PMHA 1PP8F 4A6DA 4B09A 3I59A 4UHTA 3QRFF 3HIFA 1LQ1A 4IRHA 2EFOA 4CXFA 3OCPA 4L9JA 1S8NA 3I58A 3CLOA 3H50A 4GXOA 2OQGA 2O03A 2MD5A 4EJWA 2XKOA 5CJ9A 2F5EA 2ET1A 4I3PA 5ICFA 4IRGA 3OV8A 2STWA 4IEYA 4ZU7A 4KA4A 4A0ZA 1TNSA 1J3QA 4MZUA 2E1CA 4XEZA 4HX8A 4WK8F 2IXHA 4AQ6A 3ML6A 3CLPA 3WGIA 4A0XA 2UWMA 2FQPA 2MNGA 5FLHA 4BQAA 3C18A 5AIPA 3LA7A 5I8YA 2Y0OA 3KMHA 3VFZA 3ZMTA 4BYYA 5DV5A 3ELKA 1SD4A 3DV8A 4ON0A 2FU4A 2RN7A 2DPDA 4Q0SA 1NXMA 5HDKA 3F8FA 4RGUA 5DCMB 4BAYA 2G7HA 2OZUA 2GA1A 2HEOA 5ILVA 4HV6A 2B0LA 4M72A 5KHHA 2LNBA 2VPVA 3HQXA 1UFMA 1NYWA 2JPBA 2VQAA 5FQ0A 4OIOF 1HBXG 1U12A 3F6OA 2ISYA 4HDVA 3BPVA 1R58A 1SFEA 3EETA 5BPIA 1IAWA 2BNOA 3L2HA 3FM3A 4HQMA 1FSHA 1OFNA 1SD5A 4M9XA 3MFKA 4Z82A 3U9GA 5K5RA 3CL1A 3ECOA 2CAVA 2ZJ2A 1MDMA 1XB4A 5TRDA 2ZNYA 4QMAA 1ZGAA 1J9IA 3Q9VA 4YSFA 2M30A 2QUFA 2IA1A 2VBZA 1YFWA 1V70A 3JTGA 3BP8A 3LAJA 3BZ6A 4MGYE 2VOPA 4Q29A 3LQRA 3S0MA 2HDCA 1TLHB 2C6YA 4M74A 4KIGA 4ZZDA 4XF3A 3WW2A 4A5NA 5CVIA 1IXSB 1ZLKA 1HW5A 4S05A 3GWZA 4Q0QA 3DPLC 2ISZA 2P4WA 1BOAA 1SD6A 4DNCA 4IEPA 2A6HF 3F8MA 1S3JA 3LQQA 3LZZA 3ZMVA 5E1XA 4U7DA 1UCXA 5HS9A 2AXLA 1MJAA 4UUVA 2DQLA 1L0OC 3ES1A 1O5LA 1MKMA 2HS5A 2IJLA 4Y15A 1I6XA 4G8XA 2F5FA 3ULQB 4G6QA 2K86A 1NHAA 2Q1ZB 4N9IA 1Z6RA 4GYGA 2PHDA 3SHRA 4Q0PA 4XRFA 3TGNA 2FXAA 3KP4A 2Y0MA 3HYIA 1H9GA 2FBKA 2HWVA 2RDPA 2IXCA 4XF4A 2CO5A 1ZRRA 4META 4J1XA 1D8JA 2Q4SA 2UY9A 3ES4A 2XUBA 2HTJA 1ZYRF 4P5OA 1C0WA 1XE8A 4KIFA 1K78A 4K2EA 5ICCA 1XRUA 2PYTA 3WW4A 3VOEA 1WLTA 2AS5F 3KP7A 5JVTA 5K8SA 1ZLJA 3BU7A 3MDPA 4M6YA 3CO2A 2VE9A 4FBFA 3WTVC 2VECA 1HSJA 3EJKA 3WTWC 1U3EM 1LDDA 2K7LA 1S7AA 5JI6A 4FAHA 2VONA 3F8BA 2VE8A 3O6BB 1YG2A 2V1DA 4P9GA 3HRTA 1ZARA 4L5IA 4MTEA 4XFIA 3H1WA 2VN2A 5JFRA 1T0FA 2RGVA 1V4RA 1RI7A 1HKSA 5KHJA 4Q5SF 2XVCA 1O3TA 4CZZA 1F9NA 1T98A 4UV8A 1R00A 3Q9SA 3SQNA 5D5UB 2P5LC 4LUMA 5LGNA 4IEWA 4MTDA 2O1QA 3NW4A 2GC1A 2EAAA 4LULA 3IBMA 4PIYA 2EA7A 4Q4ZF 5J3UA 3BROA 1G3SA 2L02A 2QLZA 4BXUA 2QJVA 2VBXA 5A2QZ 1IF1A 3CJXA 3MZYA 2YX7A 1NZCA 4E2SA 1SAXA 5I0TA 2VXZA 1ZGJA 1EPZA 4I2OA 1FP1D 2BEOA 2YX4A 5E8GA 2XGXA 3UKNA 3WTSC 3HOTA 2ESHA 5I93A 4HAMA 2PA7A 1J7KA 1BI3A 4KDPA 3KLNA 1I5ZA 4JK1X 3FFQA 4J1WA 1CF7B 1DPRA 3J81Z 4HF2A 3KP3A 2EA2A 4CO8A 4XSXF 3C3VA 5BQTA 2OYZA 1UIJA 4M9SA 4HLYA 5L3CA 1KGSA 1OYYA 2TDXA 1TTYA 3F8CA 3W6KB 3O2PE 4YFKF 2HYGD 2A69F 5IT3A 1F5TA 1TQ5A 3W6JB 2W25A 3TDUC 2GH2A 3VEPA 3ABTA 1J0RA 4Q0VA 2MLKA 5J7MA 1T38A 2IA2A 4EVIA 2D1VA 2PJPA 2QQAA 5C8WA 1ONVA 3V4GA 1ZAOA 4O9EA 1TNTA 2ZMEA 1R7JA 2D40A 1P4AA 4AVBA 1BI2A 4L2NA 3EQLF 5IT9K 3DP7A 2J5PA 4ZYEA 2PQQA 4DINB 4U7BA 3H92A 4OFGA 4OU0A 3ISPA 3BOQA 1GQHA 4XF9A 4RS8A 1E2XA 4MGRA 3KE2A 1CGPA 1B9NA 4HF0A 3ELNA 2YR2A 2GC0A 1BBYA 3FXRA 3LWFA 1SFUA 1R23A 2OA2A 5FLIA 4LLGF 1EY2A 1RUNA 3BWGA 1FBSA 1G3TA 4EV0A 5D5WB 3GX4X 4LUKA 4B29A 4F7ZA 1UHWA 3LAPA 3JTHA 4R79A 1RZ4A 1DP7P 1QXRA 3SCHA 4QGLA 3GFJA 5EEHA 4HDUA 3EYYA 2MH2A 2QDRA 3S7EA 2VBWA 3PFIA 3RJPA 3NQOA 3F8NA 5BV6A 1J3RA 4X6QB 1PUEE 2FBIA 3J7AO 3PLQA 2PN6A 3NL1A 3V8KA 1FWZA 3HSEA 5I0SA 5FFXA 1J59A 2Q2EA 4UBGA 4I02A 1O3SA 4YYOA 2OZJA 4PZJA 2E7XA 3NRVA 3B73A 4IEUA 3IRRA 2PHLA 3U1DA 1U5TB 4BHBA 4EGYA 4WZCA 2KRFA 3TOBA 3TNQA 3G73A 1RTVA 3KP5A 4QXKA 2G7UA 3FWEA 4Q47A 4BIFA 3SXWA 2V79A 4LA2A 4NHJA 1GQGA 1KA8A 5L3GA 1H1IA 1R36A 1B9MA 3GVAA 3KGLA 1J75A 2ZKLA 1FX7A 4G9YA 3E5QA 1BC8C 4KFCA 3V7SA 1KU7A 2E1NA 3ZQ7A 4M9ZA 4WXCA 4IEQA 3V7CA 1USTA 2DI3A 3TKYA 3JZVA 4ZYHA 4ORFA 2OA4A 5D6FA 1OMIA 1YLLA 1OKRA 4O6JA 1IUYA 3LSTA 3IDBB 1U5TA 3DFGA 3LA3A 2P17A 3QACA 2OPKA 2ETEA 1ULYA 3FM5A 1XE7A 4YFXF 1J3PA 1YW9A 5HDNA 3WTUC 3CJNA 5DD4A 5CLSA 3I53A 3GFMA 3U2RA 3VHRA 3F21A 2FF4A 2EK5A 3JAMK 3R0AA 1VJ2A 3CO6C 1XSDA 2DQRA 1QQIA 5CYVA 3R60A 2F2EA 4MEXF 1SEFA 3OGJA 4LA3A 4LMYA 4GULA 1D3YA 4HF1A 1OD5A 2B8MA 1FYKA 2QM3A 4HOBA 2EA4A 5EEGA 3E6MA 5LRRA 5J8FA 1WI9A 1ZZCA 4UNOA 4OINF 3RKWA 4UBHA 5AONA 1O7LA 5LGUA 2EFNA 1CAUB 2M45A 2RKHA 1WSUA 4R52A 2HZTA 3OF1A 2Q0AA 5JCTA 2ZNZA 2IVMA 5F64A 1ZN2A 2FBHA 2L3DA 3ZMSA 3IHUA 4G94A 1X8MA 4QM9A 1SD7A 1IN6A 5ICGA 1QZYA 2A61A 4GO1A 2QBYA 5L3BA 3CTAA 1U6GA 2P8TA 2PI0A 2CFXA 3RYRA 3FXUA 2KJBA 4OOIA 2LF7A 1FPQA 4CYDA 1YQAA 5CVVA 2ETHA 3WTYC 5DEQA 4O3MA 2XL7A 2Z33A 1YW8A 2FMYA 3QU6A 4MGKE 2V09A 1P6RA 4OIRF 4FAGA 2IW5A 3E5XA 1YHFA 2MA3A 3L2CA 1VR3A 3IKVA 3V8LA 2ZCWA 3FMRA 3ZMDA 3D0SA 1CX4A 5I8TA 2L4MA 4Z07A 3KETA 1Z05A 1UIKA 1YUDA 1IN5A 1S7OA 4KICA 1UD1A 3RKXA 4WWCA 5FDBA 2MPFA 5CVUA 3WU0A 1W7PA 4I7HA 3OOPA 4NB5A 1B4AA 3M8FA 3KSCA 5LLQA 4OIPF 1EH7A 2EV6A 3CF6E 2Q8KA 2MLGA 5AIQA 5K1YA 1Z1DA 5KK1A 2ZO4A 1YTYA 4L11A 2W57A 2C0ZA 3OD0A 1RIOH 4XFFA 3GEZA 4RAYA 1ZG1A 3WGGA 4E2GA 4JVAA 2CW0F 5E1RA 5EFUA 4ESBA 3BY6A 3MYXA 3SXYA 1SMYF 1KQ0A 1YFYA 1OI6A 3H8UA 1T2KA 1MJ9A 2ZFWA 2F5DA 3I0TA 4HBLA 2H6BA 4KU8A 2ZMEB 2D2WA 3GXOA 3IDCB 2BE5F 2YPRA 1XDSA 3COAC 2G9WA 3CUOA 5DDGA 3M3IA 3ZN0A 2Z69A 4EM1A 1HSTA 1ZRDA 1EH6A 2WFPA 2HKXA 1ODDA 3RIRA 4GYIA 1Q1HA 1YIOA 1YFUA 4LJZF 4G7OF 2DK5A 5FLXK 1RL3A 3IC7A 3O14A 3GO5A 4BNCA 2H0VA 3TDZC 3EHKA 1YFHA 2GC2A 5LEKA 3J80K 5D8LB 2JSCA 5FCCA 1D8KA 3RDIA 3EYIA 4LD5A 2PFWA 4E2QA 1Q5OA 1KYWA 4A12A 2IP2A 4EQQA 3WTXC 1T39A 4P9FA 3BB6A 3T0YA 2YSRA 4IHSA 4YIIA 1Z7UA 3EQEA 2DTRA 4ENMA 3F6VA 2ZBKA 2HGCA 4YRDA 1FNNA 2X0LA 5FGMA 4RB2C 1K79A 2Z9OA 1XGSA 3T8RA 3LWCA 2P5KA 2OD5A 3P9KA 4HA8A 2B9UA 3O3KA 2P7CB 4R1HA 2K4JA 2XLAA 1ZH5A 2XAQA 5C6CA 4LGWA 3KLOA 3UKTA 2QENA 1G3YA 1XCVA 3ACLA 1DGWA 3CEWA 3DEUA 2WC2A 5HLIA 4EROA 1KQ9A 3KEQA 3ZN1A 1FOKA 4CHUA 1YW7A 2DU9A 2LKPA 3QPHA 4RAZA 4XFHA 4MX3A 4KNYA 2HJIA 3B02A 2I45A 4RB3C 2GWRA 3IWFA 5FD6A 3FZVA 4PIXA 2BGCA 3ZPLA 2PAMA 2FOKA 2IXIA 1JHHA 4WF2A 4LLLA 3SCFA 3C3WA 1XSVA 2L01A 1J58A 1REPC 5ILSA 1CAXB 4H0EA 1JXSA 1YWKA 1IXRC 4PIZA 2PTMA 1RGSA 4HYEA 3PVBB 1TBXA 2NNYA 1QO0D 1XD7A 4TV7A 2JZYA 2XIGA 4O5VA 1JE8A 2JRTA 1J5YA 2FE3A 4CICA 2NAZA 4IHTA 2RV8A 1FYLA 5D8KB 4E70A 5DUKA 2XROA 3WTZA 5KHIA 2DBBA 4FT8A 5JSRA 3G7DA 1KQ8A 3GF2A 3S2WA 4GGGA 2VC1A 4RGSA 5HS8A 1IN8A 4PGHA 3PNAA 3K69A 3K9TA 4L9VA 1UPIA 1P4WA 1XN7A 2KIUA 2XAHA 4EJVA 1ON2A 4LLOA 2PMUA 4G7ZF 4XETA 3SZTA 2IXKA 2D5HA 3RPUA 3TQNA 1IPKA 4HVOA 3RKYA 3M7GA 4Y17A 1NE4A 4YFNF 1LB2A 5FLXZ 5ERIA 2ESNA 5FPXA 5CVJA 2N7GA 1BIBA 4LEJA 3DL3A 2W84A 2D1HA 4IJAA 4UXNA 2H6CA 3HTSB 1ZZ8A 3HUGA 1AOYA 4R8HA 2KIFA 1QBJA 1LEBA 1IRFA 2CAUA 4XBFA 1K78B 1XCBA 3E6BA 3USSA 2WV0A 4KIBA 2XKPA 4F8AA 2Z5UA 3M9AA 1KU3A 5E8IA 1LVAA 1ZNPA 4A0YA 4LTAA 4WBBA 3IL2A 4A2UA 4HX4A 3MWMA 3MEXA 3RZZA 1O7FA 2H27A 3HHHA 1Q3EA
chains in the Genus database with same CATH superfamily
2Y75A 2V9KA 4HSJA 1S55A 1UX7A 3AL0B 5M5YJ 2XF7A 3AMMA 3CC7I 4FPHA 2FNPA 2VZVA 3C2HA 5CPRB 3WU1B 3D82A 1I27A 3ZFGA 5D4SA 5DQ0A 5LW9A 1H8TC 1DQUA 5JPMB 4XNFA 4ZHNA 1SLTA 4LE3A 4H3WA 2XL9A 4XQFA 3M8LA 4M3CA 3A1YA 4N53C 1AL23 3RRDA 1OVSA 4S2GA 1TW3A 1S6LA 4IQ4A 2WWYA 1TZOA 4YARA 2PN5A 4G3YC 3UGGA 2ADDA 5D4RA 2X51A 2DCYA 1X3ZB 5FPVA 2PEXA 2R7WA 5CB7A 1DG6A 1O4TA 5C4WA 2KMUA 3P1IA 3KZZA 1X82A 4DBRA 5E20A 3ZMUA 2VQLA 2XMLA 1S2KA 3EBRA 2DW4A 3FLRA 1TQIA 3UKVA 3VSLA 2UWBA 2VMIA 1ETVA 4P08A 1SEUA 2PLV3 3CUQC 5FXXA 1DDNA 4XXPA 1M4WA 5F0HA 2JPCA 1KEXA 1A04A 4UB6C 2HPIA 4GCVA 1R5GA 2WTEA 3M4OJ 3B9CA 3BCWA 2JIJA 4QPIA 3WHUA 3OYAA 1VTNC 3JRFA 3QYBA 1XC5A 2G9GA 3I54A 3SISA 2VODA 1UY1A 3PM1A 2DODA 4KGQA 3ETQA 2V6CA 1LCLA 1LNSA 1QJX2 1IN4A 1R1TA 5CQEA 2WJSA 1Y0NA 4GKYA 4QTRA 4H7LA 1CQTA 3W2WA 1DLLA 2DT6A 3KHBA 3QU3A 1VRH1 3WU2C 1U0AA 2X85A 2RR11 1D4M2 5KHGA 2CYYA 3FXQA 3ON7A 5F6LB 5AC91 3FX3A 2PELA 5H6RA 2LK2A 4MIMA 1LHNA 4X8NA 3TEXA 1WJBA 3OY9A 4NC6A 1W6OA 5FKCA 3KZIC 5IPAA 3F23A 1WLCA 2NZ9A 3ZMZA 2WO7A 2HYFA 2NP0A 4XORA 5FYIA 1YIFA 4YWAA 1Z3YA 4JDNA 5FY8A 1HW1A 1B1BA 1QHDA 1KJRA 3ZRGA 4XIKA 4DNYA 2YUSA 2A75A 3WP3A 1RVF1 3H35A 3JSPA 3CF5F 4YVWB 3CO7C 2H09A 2GA2A 3WODF 1ZRIA 1R1A1 1OLMA 3LQCA 2W82A 1RXGA 3GM8A 2X9DA 2HTSA 1B09A 4IZZA 3K4ZA 2EZLA 3NEUA 3BT9A 6PAXA 3N9PA 3MPBA 1KRIA 4F3QA 3CIHA 5K4LA 2O61A 2WY8Q 4BKXA 1ZHFA 3I4NJ 2KXLA 1HA8A 3EB7A 4P9JA 4N4NB 4I0WB 1BJAA 1NZIA 4Z2WA 3LDRA 2IPQX 3VV1A 2HR3A 3KZ4C 4A6EA 5GZGA 3RYKA 2XHKA 1G7YA 1GV9A 1P92A 4OAYA 2EXIA 4COVA 5JSOA 1PX3A 2KFDA 2C1FA 4KYWA 1A31A 5EPAA 4XTPA 2DPUA 3MV11 3CMAI 5JSPA 4NQWB 2E7WA 4E27A 5LBQA 1PP7U 2TRTA 3WG9A 2VZPA 5FOBB 2K02A 3L2VA 4Q4V3 4AQ2A 1H1MA 3WE3A 4Q4Y2 2VOXA 2LP0A 4NVPA 2OQ6A 4CDQA 1SAUA 1HW2A 3LB9A 4UV9A 2D93A 4ZZ5A 3HRSA 4LHKA 3D0JA 2RS33 5JI7A 1X3UA 1ZG3A 1SMTA 3IMNA 1KFXL 5FMOL 3QQAA 3HEIA 3FHAA 4CSWA 3EYPA 5EZHA 2BBYA 4M3BA 1LPQA 2Y6JA 1LFUP 1C5IA 2B5HA 2V4VA 5L3EA 4HX7A 2FDKA 1D4VB 1J1TA 3VL8A 1X36A 3WP4A 2OBPA 3AKZA 2JG8C 3CDHA 2CH0A 2DFHA 1ETKA 1IS5A 4XFAA 4Y1XA 2JKXA 3NAPC 2L4AA 2QQNA 3T0AA 3J7YJ 3PL8A 3VB2A 3R0JA 1QPIA 4B3NA 2LOOA 1SG3A 1EV13 1H6XA 4IHVA 2CUFA 4EZHA 3A21A 4G7HF 1U2WA 3KFWX 5A7WA 4XRMA 4PF5A 2YPDA 3I3MA 2ORXA 2A5WA 2VOVA 1EP0A 1FPN3 4GRIA 5CBLA 5L9RA 3WVJA 1MD0A 4KJZA 1X4PA 2R7FA 1C8M2 2NMNA 3DBLB 5CZKA 5E88A 1J09A 1W7PB 2RE9A 5T5OA 2WN3A 3HPNA 1RESA 3IAQA 3S17J 2FCTA 4PGGA 5KBFA 3BCBA 3VKMA 4XFGA 4GWJA 5EJZB 5FBZA 4N9HA 3ZO0B 1ZZ7A 5FP9A 2EV5A 2DCZA 4GWNA 2JA6J 2GNBA 1YO5C 4CDQB 4QX3A 4W97A 3CMEI 1F36A 4IERA 3HBKA 3SH3A 4E4SA 1X9PA 3H8OA 1DZRA 1WMXA 3AMNA 4FVVA 3ZSJA 1L3LA 3VBSA 3WDYA 2B45X 2IBDA 1VQOI 5FPZA 3WV6A 5JR3A 1XSRA 2PFBA 2Z79A 1GVJA 3KF3A 4LOSA 5HVQC 3ZQHA 3QAHA 2J5OA 3B93A 3W5NA 4IVNA 4ENKA 4L0YB 4L0ZB 2PAKA 1I1SA 4S04A 5T52A 4E9KA 2OU2A 4YW1A 1V6LA 3TNPB 2XGDA 3RSNA 3B9IA 2LTPA 3APBA 1YJWI 3D5SC 1Z9CA 2KDOA 1GWMA 4Q4W2 2JECA 5JR7B 4OHWA 1FAYA 2VNVA 5F32A 3I5UA 4XMYA 1MEC3 2F4OB 4ARXA 1ULEA 4RL7A 1SFOJ 4CPBA 5FZEA 2H8RA 4IGOA 5DUIA 2B4KA 4B7EA 3MI8A 2UYBA 1GNHA 2R042 2XB5A 3OYEA 4EN7B 5JIAA 2R071 1H8VA 4C3HJ 4XONA 1PVC1 3C2GA 3K3OA 1OD3A 1UHSA 1LFBA 2F6CA 4EMSA 3K1PA 4ZZ8A 4F92B 3EO6A 1WJFA 2WIIB 1H0MA 2DVAA 4MGZE 2M1BA 5EJ1B 4R9AA 2VQGA 1V6NA 3BZKA 4UUTA 3A23A 4HV5A 4WVMA 1CZTA 1PMIA 1P4XA 1OR7A 2NS0A 4CGZA 4Q5OA 5BNQA 1WRJA 3J7LA 2FD8A 3WD5A 4N43C 3OGRA 3ROUA 2K9ZA 2X6XA 4A5MA 4QWQA 3CNAA 1FV2A 2YU1A 1VE0A 4FXGB 1POQA 1UHMA 2QVSB 4IXAA 4OUSA 5HV0A 4FX0A 3NNMA 4TLFA 4U0YA 3OSFA 1AX0A 1LHWA 4HPKB 3BJ6A 1R1UA 2Y60A 2P7VB 5IY5H 4ZY9A 3TAYA 2WADA 4ASNA 2RM21 1ZREA 3JRCA 2O0YA 1FI2A 4IHYA 1D7PM 1DQ2A 1ACCA 1Z77A 5DD8A 3MIGA 5D8AA 1ASJ2 3LA2A 3K4DA 4LO4B 1EYBA 4XOPA 1R092 4XUOA 5ED4A 4ZS2A 4QLCU 3AXEA 4NIGA 1IS4A 3OB8A 3K2ZA 3BC8A 5GPAA 1W8HA 1Y9MA 1QNTA 4MV2A 4XF1A 4MEYF 4LK6A 2Y69H 4EJOA 3NJVA 2RS31 5HDGA 2GIZA 3PUIA 3PL0A 4RGRA 3I2IA 1UB9A 4P02B 3IKTA 2XRLA 1ZZ6A 2P34A 1JKRC 1X2MA 2VMFA 3OSDA 1RNLA 2AGSA 3F3XA 2M34A 2JEMA 5FZKA 2XASA 3CU7A 4NAOA 4IV3C 2A73B 3RPQA 4AFDA 5CFCC 4XLNF 1X50A 3AYAA 1RB8G 3E6CC 4I30A 1TMF1 3WHTA 1CAUA 4UY8I 1W5SA 2B9VA 3V0AA 3ZOIA 4Y5Z0 2W7NA 3JBG3 1VQ8I 4JQFA 1GZCA 5DZFA 4BXSV 3JSOA 2IEKA 4EGZA 1O91A 2W87A 4IEXA 3VD7A 4UW4A 4XXAA 5FZCA 3LPFA 4LJHA 4XLCA 3K2OA 5FMBA 4EATA 3LEGA 5JHUA 1YEWA 2ZKZA 2ZFUA 3ST7A 1H9TA 1EAH2 2FZ2A 4QT6A 1H2KA 4KG8A 4Y20B 2CS3A 1OF4A 4IEVA 2V5YA 1WD3A 2ID6A 5GKAC 1JUHA 3BZCA 4ZXEA 4BJ5C 3CUQB 3Q8CA 2XV4S 4LB6B 1AXYA 1WI3A 1SLLA 3TO7A 2IA0A 1N1YA 4XJAA 2ZEYA 1OCTC 4IEZA 1WCSA 2AEZA 3TBIA 2P2KA 3FKIJ 4PJ0C 5IYYA 4D94A 1W2OA 5FMDA 4CZSA 1G9FA 1BN5A 5ILUA 3Q5FA 4IE6A 2UU8A 1OISA 4LK7A 3H9AA 5BPDA 1T6GC 1Z6TA 3GBWA 3SFZA 2JE9A 1XSXA 4BBSJ 2HWD3 4Y52J 1Y9QA 1QH7A 4LPLA 2HVQA 2F5VA 3NO8A 1RUD2 4R9DA 3ZXLA 2QVOA 2P1BA 1YJ9I 4QX2A 2OQRA 3WHCA 1DP3A 3DU5A 3N7JA 2X1EA 5D6EA 3H1YA 2R7EB 4UYBA 1MH3A 3DBRB 4I6ZA 4B09A 4IHXA 3RG0A 3I59A 3QRFF 3HIFA 5JOZA 2GDFA 2YU9J 2R062 1WW7A 3AZYA 3I58A 1YJLA 4GXOA 1ZKGA 4BE3A 4GA9A 1SLCA 3UR3C 2MD5A 5CJ9A 1KD7A 5ICFA 3O1UA 2CFOA 1NCRA 4DOUA 2WT1A 4A0ZA 3ZN6B 3AMPA 3T0BA 4GJYA 2IXHA 1LKXA 3PNVA 3S8PA 1H8TA 3CCJI 2UWMA 2G19A 2BY2A 3DGTA 5ANNA 2W48A 3T4HB 1ZBA1 3LA7A 5I8YA 1N3PA 3A01B 1COV2 1QVUA 3M3YJ 3HKZN 3R0RA 1SD4A 1HJGA 4CDXA 5F0CA 3P3PA 4B1MA 4FPYA 2FU4A 4Q0SA 2AZ5A 3SFIA 3PJRA 2OZUA 2HEOA 4XQ4A 5ILVA 2B0LA 1VB4A 2Y8KA 2PJRA 2B46X 2MEV3 2JPBA 2VQAA 3U14A 2V5DA 2JICA 1ZR2A 1U9NA 1HBXG 2XWBB 4HDVA 4YM1A 4AHYA 2X6YA 5LA1A 2CW8A 1AR61 2VOTA 3L2HA 5E3LA 3N35A 5FYSA 4ATEA 3MFKA 3X2QH 2ES3A 5FYTA 2ZJ2A 4Q4X3 1ZGAA 1J9IA 2YMZA 5GZCA 4NPLA 4K21A 3OS0A 4DEVA 2IA1A 4YG0A 2C4XA 3MGUA 4AHXA 3BP8A 4BA6A 2VL8A 3BZ6A 1COV3 4NRPA 5JDBA 1D1AA 5FFOC 4JP0A 1JGGA 2Y26A 1ITYA 4AWDA 3NJXA 3ZDVA 1NTCA 4KIGA 5DAWA 4XF3A 3LSIA 4P9IA 2W47A 1ZLKA 1W2NA 3GWZA 1OLRA 1QJU3 2ISZA 3POYA 4PSWA 1NA1A 4E8DA 3AKPA 2A6HF 1WVRA 4M3DA 3H42B 1S3JA 4FP2A 3LZZA 3LQQA 4H14A 5BNOB 5F5IA 1RPWA 5A70A 5HS9A 1U0JA 5K9YA 1EF4A 3N9QA 5ISLA 1VBC1 2PHUA 3ES1A 1UOGA 2DCJA 2IJLA 1M06G 1A3KA 4Y15A 3ZSLA 2CMPA 4OUMA 4G6QA 2EIKH 2Y9YA 4N9IA 3DTKA 2BY1A 4GYGA 3SHRA 2IGKA 3MLJA 3BOWA 2XF5A 5JOWA 1G9DA 5FZDA 1LECA 2FBKA 2HWVA 2IXCA 4XF4A 3S14J 1T08B 4Y3OA 1KS4A 4COUA 1Q8SA 2HTJA 5JIUA 4YW4A 3J26N 1AYM1 4AVVA 1IQDC 2BW3A 4XUQA 2XAUA 1W6NA 4YZ4A 2VQ0A 3AL6A 1FNYA 4ZJZA 3TRSB 4XKCA 2AS5F 3KCXA 1DQ1A 1BLZA 2R061 4IV1B 5JVTA 5K8SA 2MSYA 3MDPA 1OA2A 4FSJA 4AE2A 3CO2A 3ABZA 4EJRA 2VE9A 1YYNA 1ETOA 1BZWA 4ISQA 4HNUA 3WTWC 2G9FA 4UB8C 4XRSG 1PZ8A 2GBYA 2RJKA 2LG4A 2BBAA 2LR8A 4XFIA 1CESA 3W21A 2VW0A 2JDMA 5A7SA 4AW7A 1GZTA 4CZZA 5L19A 4XKBA 1V6KA 3SQNA 2VLAA 1ND2B 1S0DA 2BVMA 3S93A 2LVSA 2HWD1 1XMXA 5LY1A 4LULA 3N9OA 3EUHC 5J3UA 3FXJA 1G3SA 2L02A 2QLZA 2PLV2 1IF1A 3VDDC 2YX7A 1SAXA 3I56I 1ASJ3 2YX4A 5E8GA 2RDQA 1VMHA 1YX3A 3M4FA 5FZ6A 4HAMA 2IVJA 2PA7A 3OYJA 1J7KA 2RMU2 3FFQA 1LGBA 3D6EA 1CPMA 1QNWA 4H2AA 4XSXF 1OQ1A 2VBBA 4HLYA 5L3CA 2YBSA 1KGSA 3W6KB 1YNAA 2K46A 1WWYA 1L7LA 1F5TA 5JWPA 2GH2A 5A32B 2M4KA 1J0RA 2HOAA 2MLKA 2WABA 4CXWA 4EVIA 5F2SA 3CD6I 3C2UA 1ONVA 4J00A 1JU4A 4OI2A 1SDWA 1LVKA 3ZMOA 3BVCA 5IVEA 5FRMA 2CUJA 3EQLF 4HETA 1UKGA 4CCLA 1MS5A 2VUJA 3ISPA 3N9MA 4EN8B 5HBAA 3BOQA 4RS8A 2LFBA 3BTXA 3NAUA 4PI2A 2W46A 3ELNA 1RXFA 2GOMA 2MEV1 4Y22B 1SFUA 3ZR6A 2WBKA 3ZYRA 3MFAA 2MW8A 2HXIA 1VQ4I 4MXVA 3W2AA 3DYMA 1FBSA 3GX4X 4LUKA 2VZ3A 2W1OA 2B42B 3VUOA 1RUI1 1G59A 4R79A 1QXRA 2XQRA 3SCHA 3IUOA 3GFJA 2XB6C 1BJQA 2CUZA 3OYFA 2QDRA 3RZGA 1F9KA 1R71A 3ITQA 3OL4A 3S7EA 3QYEA 1H4GA 3R4UA 3NQOA 2LLKA 3PTRB 3PJYA 4Y24A 4X6QB 1F8VA 1CZSA 4NC8A 4LOTA 3BTYA 2R7RA 1DCSA 5EP9A 1LODA 3V8KA 1FWZA 3RZJA 2Q2EA 1O8SA 4YYOA 2OZJA 4PZJA 1V5FA 2IWGB 2VPRA 1UF2C 1UWWA 4B3XA 1WGXA 4ITVA 5F5AA 1RR7A 4XJUA 4BHBA 4EGYA 4WZCA 3NWTA 1GMMA 2B63J 1WLWA 2IGNA 3TNQA 1IV8A 4MFEA 1QJU1 4Q47A 4OI0A 4CDUC 4HT1T 1CJPA 1F5JA 4BJTA 4BL0B 1H1IA 1Z7S1 1PGW2 5FZGA 5FKBA 1DYPA 5FZ9A 1TWCJ 2E53A 5BNNA 5F3EA 2KZVA 1BC8C 3HL2A 3V7SA 4XDQA 4UFHA 4RGGA 4XJZA 3HM5A 3V7CA 2DI3A 4A3BJ 4ORFA 5GTHC 4MVTA 1OHFA 3DFGA 1W03A 4FCAA 5B2GB 1YI2I 1XC6A 2GN3A 2OPKA 1ULYA 3ZVXA 4HXCA 1XE7A 3CMMA 2UWCA 4BU2A 4BQ1A 4A3LJ 1AYM3 1OUXA 1Z21A 4ATFA 2BWCA 2E1MB 3LE0A 4YVWC 5L73A 5F3GA 1SCRA 3F21A 2BOJA 2FF4A 4A3CJ 1V00A 2JB8A 3WF0A 2GMMA 3TEYA 2DQRA 2ZSHB 2ENRA 5M5XJ 2F2EA 2A1XA 5C8CB 1PVC3 4QPGA 1QMJA 4LMYA 1W6PB 2QQJA 3MKZA 2ZEXA 1QXPA 1DU6A 1OA3A 4HF1A 2EF6A 1MZ5A 4RAGA 1W1WE 5C33A 3D5OA 4LNVA 4HOBA 1H88C 4CCDA 2JDZA 3WSOA 4GMP1 1OXCA 2EA4A 5EEGA 2QSHX 3IN9A 3V64A 1WI9A 1ZZCA 4UNOA 2WNEA 1UNBA 1NY71 1XNCA 4XICA 3SNMA 5AONA 3AVSA 4URAA 1CAUB 5IYCJ 3I4MJ 2LMDA 4RFT0 1YQ5A 1DYOA 2EILH 2ZNZA 1X9TA 2VAUA 2IVMA 4YZ3A 5F64A 2FBHA 2KQRA 3IHUA 1HN0A 4G94A 3MPPG 1AVBA 5ICGA 1OOPC 2JG9C 1W9SA 3ILNA 4D0QA 2HEYF 2X8KA 1U6GA 3N05A 2PI0A 2CFXA 1GSLA 2KJBA 3OY8B 3KQRA 2LF7A 2O7OA 5FRAA 2Z42A 1Q8QA 4O3MA 2XL7A 1YW8A 2FMYA 3I4IA 4MGKE 4C1WA 1P6RA 2IW5A 2BTVC 4XACA 1N1VA 2QUOA 4J25A 2MA3A 1IRZA 2JKBA 3D8CA 2ZCWA 5A80A 4M00A 1RRJA 2L4MA 3MIEA 4C8DA 5CFCA 1HDKA 2HBUA 4I76A 1Z05A 1UIKA 1T0FC 4C0HA 2W39A 4CCEA 3IH3A 4F52A 3I3EA 4KWUA 1S7OA 1UD1A 1OQYA 2LM3A 5CVUA 3OOPA 4PFPA 1B4AA 3M8FA 3T1MA 1FOXA 2EV6A 1OKQA 3H1CA 3HQRA 2ICWG 2WUHA 2E6VA 1YTYA 2AREA 3LDKA 1VRH3 2RR13 3T30A 1ZG1A 3D1NI 4E2GA 4CEYA 5EFUA 3S6PA 3CZUA 4FPFA 3EXUA 1KQ0A 1YFYA 3OBTA 3A4CA 3D3AA 1S0FA 1OCPA 3A03A 4RGAA 4HBLA 1IPSA 1PM4A 3NAPB 2NOGA 1SFYA 1OCOH 2ZMEB 2D2WA 3Q8BA 3SEEA 1W90A 2EH3A 3ZN0A 3PO2J 5H9SA 5IK7A 5EDNA 4ABZA 3VZMA 4Y7NJ 4M3CE 5LCWL 1RVF3 1O4ZA 3UKGA 1YIOA 2KLOA 3DKQA 1R64A 4LJZF 4G7OF 5FLXK 1RL3A 3O14A 3DYPA 3GO5A 4FASD 3TEDA 1YFHA 3LPGA 4A7ZA 3PIOF 5D8LB 3E7LA 1UY4A 2JSCA 3M1HA 3L1PA 1DGRM 3NAPA 3KV5A 2QQVA 2RMU1 4ASKA 2SLIA 2YU2A 1ULCA 3DKYA 4QQHA 2WNVB 5HXMA 3BQZA 4HFSA 1ULFA 4XBNA 3OYHA 4ENMA 1D2QA 3FC0A 4YRDA 2X0LA 1G2HA 4RB2C 3ZKUA 2Z9OA 4QPGB 3RWNA 3T8RA 2P5KA 4JX0A 1BBT3 1RUJ1 3O3KA 4Y5TA 3WG2A 1C28A 3LSMA 4R1HA 2VVDA 1Z0HA 3A22A 5FP8A 5DG1A 3KLOA 1ZBE1 4IGQA 1MS4A 1NCRB 3OYKA 3VBOC 1WMEA 1G3YA 3CEWA 3LFIA 5HLIA 3HOBA 3KS7A 3J7ZI 3CJRB 3KEQA 4CHUA 3OPZA 4QKNA 3H5RA 1CJDA 4AI9A 2DU9A 2WS92 4D69A 4FQ4A 3EMRA 2R30A 3FBMA 1GZWB 3CCYA 2DF7A 5EYXA 4WF2A 2XHNA 4JHTA 1REPC 5DUVA 1VQLI 4XKWA 4IV1C 1X2NA 3POEA 4W6YA 4GXLA 4PIZA 2PTMA 5DZGA 4YW2A 4DMIA 3PVBB 4A42A 1JE8A 4O5VA 4M3CF 2JRTA 1J5YA 1TZLA 4GH4C 4GWIA 1APLC 3GTMJ 4CICA 3OEAA 2NAZA 2QQIA 4HOOA 1U5ZA 1W3VA 2R0FA 2AH2A 2R0QC 4EN0A 4E70A 2RR12 2XROA 5IVBA 4K6BA 5KHIA 3MLLA 4WM7B 1Q8PA 2V4AA 4FT8A 3CJIC 2JX9A 4GMP3 4AHWA 5C3SA 3AKSA 4BWOA 4GD4A 4URTA 5A7WB 4GGGA 5LBEA 4N43B 1MSFC 1ND2C 3ZSEA 1JMUB 1UPIA 4XDOA 5F8PA 3G6EI 2KIUA 2XAHA 1IG7A 1LFPA 4LO6B 2ZGUA 1FOWA 1QJU2 4G7ZF 3SZTA 1AR93 2D5HA 4HVOA 1IPKA 3RKYA 3GJBA 4Y17A 3AZXA 3S1RJ 4YFNF 1LB2A 3U37A 3VDDB 4XQDA 1QQP3 3SLIA 2XJRA 3SDGA 5ERIA 3WNLA 1KZHA 3LEIA 1KS5A 5FO9B 4CVUA 2H6CA 2OV7A 1QBJA 5FXVA 3GZAA 1BK1A 3FBNB 1XCBA 1K78B 3USSA 2WV0A 4KIBA 2NYYA 1RUD3 4M01A 4F8AA 1JJ8C 3ZQIA 3M9AA 1KU3A 1LVAA 3CQZJ 4LTAA 4WBBA 1HB2A 4V19K 2P3JA 1HXS2 4CCCA 3RZZA 1ZH5A 1WSUA 3HHHA 1Q3EA 2K2SA 3RSJA 4UFMA 5KCMA 4JYKA 5BUVA 4P9WA 3WOGA 5GJ6A 3OYWB 4GIQA 2IXLA 3HOSA 2LW8A 1Q56A 1DYKA 1LTEA 1BKZA 3NNGA 2QWWA 4UXAA 1IN7A 1KU2A 1KITA 5ANQA 2GXGA 4EM2A 1K6OA 3DXUA 1ZYBA 2WT0A 5JLWA 2VT2A 3GMEA 1YLFA 1O5UA 1NY72 4HN1A 1GU3A 4EE2A 3VYUB 4D6QA 1MEC1 1AU7A 4KL1A 4RYDA 4XHBA 1HQLA 5FUNA 5IFTA 2L5QA 2HU9A 1ON1A 3DKWA 1W9YA 4B4RA 2UV1A 1SQ4A 1PGW1 5GADJ 3HXLA 2DOFA 4BE2A 2LROA 4D5CA 3VYTB 1LHUA 3GZEA 3KP6A 1XB9A 3OOUA 5JHFA 3N4MA 4I01A 1XPXA 1F5FA 1FXZA 3KYCB 4BGDA 3IRQA 1K83J 3L00A 2O14A 3K4CA 2ARBA 2N8GA 3WINE 4ZTFA 3HBLA 4FPEA 5IW0A 2XAJA 3FJSA 3H5NA 3C7EA 5IP6A 3KLSA 4FP3A 1GP6A 1VAMA 3FF5A 2H8WA 1IRGA 2RS32 1PIV2 4Z1VA 3GTPJ 4OQ8A 2AC1A 2VD7A 3M3QA 3I8TA 3PHMA 4Y1YA 3P3NA 4ZONA 2MFZA 5JZGB 2LYCA 1LDKB 2CSGA 2PAEA 1CAWB 4P9UA 2XPJA 1JTYA 5EYYA 5KVRA 4MHRA 5FBJA 4RGXA 4LG0B 2IAIA 1LAJA 2KA3A 1D0HA 1YS6A 3SHFA 3FE5A 2JA8J 2IXSA 5HI0A 4IQJA 4G6TB 1GVDA 2ELHA 4KUMA 4AXOA 1OSGA 5FD5A 1F4KA 2DFIA 3IIAA 5F1RA 1HN1A 2OUMA 1W8TA 1FEXA 1ASJ1 2C9AA 4U0WA 4D7TA 4YFZA 4FTHA 1VQPI 5FYBA 2CU5A 5LATA 2GXBA 5TISC 2ZEWA 4Q1RA 2R7ZJ 3GLXA 2H0BA 5K7HA 4DXZA 4YM0A 2WZEA 3EPZA 1CF7A 1USSA 3J8F3 4IL7A 3OOXA 2QA4I 2DJIA 1MZBA 2IS1A 2BNMA 1OPCA 4IUGA 3WUCA 4WVMB 4P55A 2XLGA 1YYVA 3MCZA 2BGOA 2PLYA 3HTUA 3WZ1A 4EWAA 5C8CC 2M8EA 3QOEA 1TG7A 2MBFA 2UYAA 1U5IA 1QY4A 2YU3A 3G1OA 1TQMA 1BIAA 5AVAA 4FFHA 4LG0A 4KWKA 3NV1A 3WF1A 1BI0A 3IMMA 5CFDC 3KZYA 3H0OA 4IOCF 4ZKTB 1GT0C 2CG4A 1QJEA 2VB6A 2IS4A 1X33A 2MHFA 4P00B 2Y30A 3Q0WA 1HRV2 1ZX5A 1MIJA 4PLMA 3M3OA 3G2BA 3LFKA 3BPZA 2EZKA 2HDWA 3FFZA 4RQPA 3V0BB 1SFXA 3I3DA 3W3CA 4WX9A 3QPTA 1UQXA 2LF8A 3U78A 2W4SA 1QOOA 1AR91 2ET7A 2PHRA 3M70A 4E6KG 5CKMA 1GR3A 3FHIB 1V6IA 4BOWA 3T09A 4AIJA 4OIQF 2J1EA 3AYDA 4YW3A 1MQTC 4LXLA 3AFHA 2ZGTA 2FA5A 4HW0A 4HVRA 1FYMA 1SACA 4EWEA 2NVUB 2HQRA 3KT1A 4YM3A 1IS6A 3SJMA 5DG2A 2CSOA 1SFNA 5FROA 3T5XA 4W50A 1MGTA 1WHUA 1QGPA 1C57A 5FKMA 1FPN2 3G3ZA 1G4DA 4BACA 3SZGA 4Q8KA 1NAEA 1MMGA 1BEV2 2O8OA 3T8TA 1B59A 3W59A 4C3IJ 4NO4A 4HSTA 3S16J 1HQNA 4L99A 1K5MC 3D5RC 2W24A 4AIKA 2EVXA 2QQKA 2VNOA 3DECA 2FUG2 1NT0A 4OLLA 2ELJA 4AIDA 1LESA 3DEMA 4PFOA 4NRMA 4PCQA 5J98B 4KI5M 3K1MA 4E7ZA 1O3RA 1TWHJ 3KP2A 3SEPA 5T5LA 3U07A 4QDRA 1V9U3 2BVVA 2ZXJA 4PHZA 2WO3A 5BNGA 3FK6A 1ZBA2 2WSUA 1I9RA 1Y39A 5EZWA 3OYIA 4IOAF 3GZ6A 1H30A 4LB5A 3A4UA 1GOFA 3I64A 4RQPB 3JW4A 3OY8A 1LEAA 2DFBA 2R1BA 3WF2A 2ECBA 2TUNA 2HZDA 3IT8A 3RPUD 5E16A 4MHUA 1RUF2 2XBO2 3TP3A 2L7KA 1Q8OA 5BPXA 4U2AA 3VD3A 2C9KA 1PO22 3RYPA 1AWCA 3VBUC 5IK5A 2EFQA 2WRAA 3CJTB 3RTRA 1AR62 3O12A 5L3DA 3ZKYA 4K8FA 3HN3A 4D1QA 5IWFA 4FHTA 2QBYB 3NQHA 3CLQA 2W95A 3DKXA 4FXKB 4B44A 1Z67A 4IETA 2CQQA 4ZPIA 3K1NA 4BQOA 4V2VA 3O1OA 2VKDA 1MZEA 4N8MA 4Y1UA 5F08A 1XMAA 2EJRA 2IC1A 4ET7A 3BIEA 5F2WA 4KN4X 3CCLI 1WFXA 3MQ0A 2V1UA 3B00A 1OT5A 1WW6A 1QPMA 1LOCA 2Z5WA 3ILFA 2O3FA 3JCIA 4JKKA 2HI3A 5FKKA 3K48A 2F5CA 1BK0A 2W2IA 3CDIA 1RUG1 2ZX4A 3J81K 5HOOA 5SV8A 5DN2A 2ZZQA 2Y6FA 3FMQA 4ZU4A 1J2XA 1O3QA 5EEAA 3KV4A 3FXOA 4ZYDA 3OPWA 1FJLA 4ES8A 2W91A 3MLKA 4Y4RA 4RS5A 5LEJA 4MH0E 4I98B 2L7ZA 3MAJA 3GYDA 1VBC3 2Z3YA 2WWSA 3BJAA 1HV0A 2GU9A 1LJ7A 5J3LA 4YVWA 2BFUL 2X48A 2VKHA 4WM7C 3VKLA 3CKHA 2R7OA 3WTTC 1Y9GA 2OKXA 2WAQA 1PK6B 4WCGA 1MPXA 4A6OA 5G05L 3WEZA 4KU7A 3VBOA 2KT0A 4BXXJ 3GTQJ 1SPPB 2VNGA 3AYCA 1ZRFA 4ITCA 4PJNA 2XSJC 4AGGA 2A71A 4LLNA 4JBAA 1JS9A 5K0UB 1IRXA 2DO7A 3JUUA 3QH7A 3LOIA 1EH8A 3KGZA 3K6GA 4D0PA 2JDNA 1KXGA 3GF6A 5FFZA 2R5ZB 3ETPA 4A3IJ 3OYLA 4OI1A 3PMSA 1BI1A 1Y0UA 2WZR2 5F04A 1JTXA 4Z2YA 2E34A 2XOMA 2R063 3QH6A 4D7SA 3KT7A 3W58A 3AVRA 2IFWA 5KHKA 3VDDA 4WVVA 2D6NA 3GZTB 4FPCA 3JXSA 2XPWA 4U36A 1W0NA 4HMZA 3PSFA 2XAGA 3S32A 1W8FA 1EV7A 3AAFA 1VMJA 4XPVA 4YIFA 4FPGA 4Y26A 4FO9A 2ZC2A 2CV6A 1IV6A 2HKOA 2RMU3 4FPLA 4A45A 1Y6IA 2ATFA 3O1TA 5D2AA 1AF9A 4CDUB 1CWPA 4UF0A 2ZJPF 4GB32 4YGCA 3F9KA 3OYBA 4V2FA 2O6GE 2QQBA 4DZGA 4FOVA 4JGZB 3KEOA 1QDCA 2EZHA 4XRSA 1H8TB 2OCCH 1I3HA 2LSOA 2M87A 4PQQA 3OD4A 4PCRA 3J80Z 3RJ2X 5FV3A 1ST8A 1UW8A 3ZXKA 2QQWA 2A3YA 2ZJQF 3HT1A 1D0ZA 2VOOA 1GQPA 3DN7A 1Z91A 2O8KA 1WQ2A 1LGNA 1WCMJ 2QQ8A 4B3AA 3VB9A 1VRBA 3PUFA 3QOPA 4LBKA 3UNPA 4ETSA 2W1SA 3ZXDA 2FCVA 5A33A 4LBMA 5KHDA 1X8EA 2JT1A 2D45A 2ILMA 2LDUA 3MF9A 2A6EF 2WQ8A 5D8AC 1EJ9A 4AWXB 2Z16A 2BRTA 4LR4A 5DTDA 5LA2A 2HWE2 4ZH4F 3FZ3A 2DYRH 1MBKA 1FT9A 5C71A 1T6SA 3I9V2 4HRIA 4CEWA 1MBHA 2DFFA 2QKLB 1DQ6A 4JZRA 3HKZA 1ETXA 2GH8A 3E1F1 5FYMA 3WDXA 4BPZA 5JXHA 2UZKA 5HCBA 2K40A 1GXQA 1QKQA 4CP9B 3LOCA 4HKLA 1MVEA 4MO3M 3MHZA 1HF0A 4JKMA 3M1EA 3FISA 3NJZA 1V5GA 3JBG1 1IZ1A 4BE0A 1MMNA 3GFLA 2VTFA 1PGL2 4JV4A 1Y1WJ 1VBA2 3A0BC 5IP9J 2GQQA 1H9WA 1OOPB 2EIBA 5BMZA 1R1A2 2PMZN 1RUI3 1IXCA 3ZYFA 4MSVA 1SMVA 3G6JB 3BU0A 4UOJA 4YZ1A 3MO4A 1LQ1A 1QQP1 1RUH3 4QKBA 1DGLA 4WVWA 4NWWA 3CP2A 1O59A 5G04L 1S8NA 3CLOA 5IUQA 3VL9A 2WLQA 2XKOA 2F5EA 4I3PA 4IRGA 3OV8A 4D9JA 4KA4A 1VNDA 1BEV3 3CJQB 2ZAHA 5LBFA 2IVIB 4XEZA 4WK8F 4LBJA 4TZDA 3ML6A 3CLPA 5GTIC 4A0XA 4MXWB 2ZZJA 4YZ5A 2DFEA 2MNGA 2JG9A 1N1SA 5FLHA 5E3MA 3C18A 5TSWA 2W9XA 5AIPA 3WDTA 4Q8LA 1POV1 1C8NA 3G1LA 1JYVA 4DYQA 3ELKA 5IK8A 4UUSA 2R7UA 2NS7A 4ON0A 1HC8A 9ANTA 4A3MJ 5C9AB 5HDKA 3F8FA 5DCMB 1PX4A 2G7HA 2Y34A 2P3YA 1RR8C 3UV9A 5F3CA 2MABA 5KHHA 2BBVA 4KQ7A 1RHI2 5DDJ2 1UFMA 2W1UA 5FQ0A 4FPOB 3PUHA 2R5YB 4XILA 2VCCA 4OIOF 1JZ4A 1U12A 3F6OA 4XJWA 2JJ6A 3BPVA 3DWLE 3QCWA 1IKQA 3O0WA 5KAIC 1XSQA 3BTJA 3A02A 3FM3A 2PHTA 1FSHA 1SD5A 1XYNA 4S2DA 3U9GA 5LA9A 4ZDLA 1LU1A 1X1BA 5CYYA 2ZNYA 1DLCA 1NQJA 1ND2A 4C0BA 1ETWA 2FMDA 2QGUA 3ZOBA 1RKWA 1YFWA 2LKXA 3AJYA 1RETA 3HEFA 3WG7H 3WDUA 2ZX0A 4Q29A 3LQRA 2HDCA 5HV4A 1TLHB 2C6YA 3GXUA 4QX8A 1OBNA 1N3OA 2E19A 4A5NA 4Q4W1 3RVHA 1GV5A 3DPLC 2I07B 3P5JA 3GNEA 4XR6A 2J1SA 2RS12 2E7TA 2GMPA 2DURA 3LMMA 3DTEA 5FUIA 1UELB 2COBA 2MEV2 2RV9A 5FR3A 3M2MA 2E71A 4N4OB 1VALA 1O5LA 1MKMA 3AZVA 4QU2A 2DDBA 2BQPA 5HXVA 2X29A 3INAA 4CP0A 4IKFA 3I3QA 1HB3A 1EPWA 2Q1ZB 1Z6RA 2PHDA 4Q0PA 4QD2A 4Q4X1 2FXAA 1DP0A 1H9GA 2RDPA 1IDZA 1ZTRA 1ZRRA 3ONQA 4TWTA 5GZDA 4P9XA 2UY9A 3IDEA 4XZPA 4P5OA 3MUZ1 1C0WA 1XE8A 5J4YA 4OHYA 4XYXA 1QRYA 1Z3XA 3OWTA 4K2EA 2D6KA 1XRUA 3OYMA 1JKOC 1WLTA 1W8OA 3KP7A 4L9BA 1WCDJ 5EHDA 3O0XA 1E0EA 5LWBA 1AR83 5FYZA 1MACA 3WTVC 4KBBA 3EJKA 2XH6A 4OWRB 3J7MA 5JI6A 3BG5A 4F55A 3POSA 3F8BA 3H36A 3O6BB 1YG2A 1IDYA 2RM22 4P9GA 5CA6A 4AOCA 3TYJA 3HGYA 3HRTA 1TVGA 1PO12 1ZARA 4L5IA 2VULA 3AG1H 2E5ZA 2E5NA 3C7FA 1T0FA 2RGVA 1V4RA 2IFRA 2W0XA 1RI7A 1HKSA 4RR3B 1O3TA 3IV5A 4OVEA 2RS51 4UV8A 2ZGSA 2SBAA 2W52A 2X1CA 4IGPA 2OPTA 1AXKA 1RUG2 4IEWA 1KGYA 1OLQA 4I99C 4P1WA 3NW4A 5GALA 2GC1A 4PLNA 2E31A 4AI8A 2W94A 3RZDJ 4PIYA 3JREA 4ARYA 4DIQA 2DV9A 1VMFA 4PDWC 1EPZA 2ZGRA 4I2OA 1FP1D 3ZXEA 3CF2A 2ERFA 4E7LA 2XGXA 4OI4A 5FJHA 1P8JA 3WTSC 2VZOA 3UKNA 4BLIA 2VQHA 1MVQA 4PK4A 1SLAA 4GZ9A 2BJSA 3K75B 3KLNA 4JK1X 1CF7B 2PHXA 3KP3A 2YB7A 4B1RA 2VBPA 1FX5A 3MUY1 4QPIB 3H0DA 2HNHA 1UU5A 3C3VA 2J1UA 5HNFA 3FXMA 3OGGA 4GKXA 3F8CA 2EQRA 4YG3A 1TQ5A 1E5IA 4DY3A 3ZFGB 2BHZA 3KVBA 3IZOA 3TEZA 3QLQA 4YW5A 2D1VA 4S0HB 2QQAA 3AL0C 1IZ3A 3HN1A 5C8WA 3LSEA 4O9EA 1TNTA 4X0GA 3MW4A 2QFEA 1K4SA 1P4AA 4AVBA 3A7QA 1MS3A 1RUJ3 4L2NA 4KBZA 1A6QA 2PQQA 4DINB 5C5UA 4U7BA 3HG9A 5K7ZA 1YC61 4ZTJA 4OU0A 1DHKB 1GQHA 4M4RA 4IXLA 1G8WA 4JX4A 1CGPA 2K9QA 4RFRB 3UGHA 1M1EB 4QDSA 2XJPA 2W1QA 1BBYA 3FXRA 5A3OA 1R23A 2OA2A 1V0AA 1V55H 5FLIA 4BK5A 2RREA 4LLGF 5EG0B 1EY2A 1RUNA 2Y9ZA 5D5WB 4B29A 4F7ZA 1D0GA 1XNDA 1V9U1 1FOD1 1A78A 2FZ1A 1PMJX 5F39A 3JTHA 1DP7P 4MGSA 5C7GA 2DBIA 2W00A 3AFKA 4XMIA 5FKLA 2KISA 4HNVA 3BKZA 3F8NA 2LY2A 5ACA1 1JYNA 2L7FP 1PUEE 3PLQA 2BHYA 4LIUA 2BWAA 2VZ1A 4M3EA 3A0NA 4JKLA 3HSEA 5I0SA 2DOAA 4PSXA 4L8QA 1O3SA 2G1MA 3ZR5A 3U1DA 3POFA 2KRFA 4Q4W3 1ZA4A 3KP5A 4QXKA 2G7UA 3M07A 3SXWA 4LA2A 5JZGC 1GQGA 3OEBA 5KC6A 4LBLA 5IAVA 1R36A 1XU2A 4CZCA 3KGLA 1J75A 3ZXSA 3MW2A 4DUWA 3HVDA 1VBB2 4G9YA 1IG3A 2BY3A 4X6AJ 1NCQC 1C8M3 1UOFA 3ZQ7A 5B5EC 1XS9A 3H8XA 4QXHA 5IVVA 4IEQA 4WV8A 2QEXI 4CUCA 4ZYHA 2QSFX 3TB0A 2OA4A 5D6FA 4DQAA 3ZX7A 1OMIA 1IUYA 2HEWF 1B72A 2JE8A 4KT6A 2BU9A 2R6QA 3M8JA 5FAXA 5CISA 1YQ6A 4JRLA 1JZ8A 3FM5A 4YFXF 3VBRB 1J3PA 2VZSA 2AR6A 3K4KA 2GSYA 3ZFEC 1JH5A 2LUWA 1TC3C 3CJNA 3M3EA 1WUVA 1RUD1 4NHLA 2JQ7A 3OYWA 1AUYA 3S1QJ 2EK5A 2WA4A 3RFRA 3R0AA 4AFAA 3CO6C 2DA5A 4JX6A 1HB1A 3K10A 1TT0A 1YHQI 4MEXF 1W8ZA 2VMDA 3OGJA 4LA3A 2CQ7A 1ND3B 2YG0A 4GULA 2ZEZA 3GCXA 3O8HA 1Z7S3 4NOTA 1ENSA 2B8MA 1FYKA 2ZAAA 2JXAA 3OL3A 1PUFA 1REFA 3ZIWA 4YELA 1JW6A 4L92A 5IT6A 2JDHA 3OUIA 2NVXJ 5BNNC 2E2IJ 4OINF 5L36A 4D6RA 3ABMH 2DVGA 2VJ4A 2I10A 4EQVA 5DUUA 3JRIA 2EFNA 2M45A 2I2SA 3N7MA 2HZTA 2AACA 2W3JA 5LZ6A 3SKJE 1KQRA 3ACIA 1E5RA 2R043 5CKNA 2IS6A 2L3DA 3ZMSA 1BR1A 4QM9A 1SD7A 2OTJI 2A61A 3FHQA 3WQBA 1LULA 2NPIA 2YFUA 2GXAA 4GO1A 3RGBA 3DCFA 4N53A 5LD2C 3LSKA 3GCWA 1GDTA 2BPA2 4BDVB 4MADA 5EIYB 4OOIA 2TNFA 3JRAA 2V73A 2JRMA 4BY7J 5CVVA 4RDUA 5HLTA 2KIQA 5DEQA 2JDUA 2YDEA 2IUWA 4B4QA 3P5BA 2HWC1 2JWPA 2VJIA 2V09A 4OIRF 4CEWC 4DBQA 2R5YA 4BQ5A 1VR3A 1RVF2 2Y64A 5IOYA 1UMQA 1MBFA 5I8TA 4R9CA 4LBNA 2ZABA 1YUDA 4Z6YA 4NHMA 2GALA 2VCAA 1IN5A 4KICA 3ZQQA 4WWCA 2FJ1A 3VWBA 2MPFA 5IVCA 1N1TA 2E51A 3AMQA 1PNGA 2RDNA 5FZOB 2HVSA 2K3PA 3KSCA 1EH7A 3UK9A 2XXZA 2MLGA 2ZO4A 1GZWA 4JDOA 4MXWA 3OD0A 1RIOH 5C9AC 1JYCA 4UAPA 3POGA 5DUWA 4Q26A 3THCA 1CD3G 4ESBA 3H9QA 1OI6A 4P9LA 2JG8B 2EZIA 1T2KA 4XK4A 2CV1A 4K9SA 5FP3A 4LHSA 2LC2A 5B1BH 1W9FA 2V9PA 4XVHA 1HRI3 4Y1ZA 3RZHA 1WCUA 2BE5F 1YIPA 4DUVA 3USUA 1CR7A 1EA3A 1SFKA 4EM1A 1FOD3 3RIRA 4DYRA 1Q1HA 4RQPC 1DIWA 3U75A 4FTBA 4RM3A 2FHRA 2VMEA 2DYCA 5M3MJ 2H0VA 1S2EA 1RINA 2GC2A 3J80K 1XOYA 2MYSA 1D8KA 3RDIA 4COWA 3OBAA 3H9GA 2XGEA 2IP2A 3T2OA 2DU1A 4QQOA 5FZHA 4BQXA 5T5PA 4CDQC 3OYDA 3EQEA 5TGTA 4AM3A 5JR2A 3JD73 2ZBKA 1FNNA 5FGMA 3VDXA 1GNZA 3NV3A 3DF0A 3HWJA 3TL4X 3LWCA 2OD5A 3OUHA 4HA8A 2FDGA 2P81A 1HRI2 1WH5A 1F35A 2P7CB 4B48A 5C4WB 3ASOH 2K4JA 2XLAA 3O7OA 2XAQA 5C6CA 1K5MA 3E0JB 1GV2A 4HPKA 2QENA 1XCVA 1S4CA 1DGWA 3DEUA 4EROA 1W04A 4AI0A 3ZQFA 4W1UA 1KQ9A 3ZN1A 2B7EA 4AI3A 2LKPA 3ACFA 5DPNA 4BY1J 4XFHA 2FD5A 3WNOA 1OLME 3KX2A 2RS52 1BMV2 4XBLA 4BEHA 3KV6A 4NIHA 3JQWA 2L9NA 1N78A 1YIJI 2I74A 4RLQA 3L2WA 3NV2A 1S0CA 2L01A 3N9NA 4H0EA 1JXSA 1D0YA 2AHQA 2ZGPA 1VBE2 3VBSB 1IXRC 4HYEA 4AAXA 2NNYA 1XD7A 2JZYA 2XIGA 1BVP1 4QHBA 2DA4A 2R93J 1L7QA 4IHTA 4EZ4A 1RUF1 1GKBA 1KDKA 1HKDA 1BBT1 1FYLA 5D8KB 2HPMA 5DUKA 3ME2A 4W8JA 3HNYM 4QHZA 2DBBA 3B6AA 2DTYA 5EJ3A 1X19A 1JYWA 1RIRA 4N90A 3CMYA 1MMSA 2Y31A 1JUSA 4ISRA 2VC1A 5HS8A 1IN8A 3FBYA 4PGHA 1B35A 3K69A 2R32A 5FLMJ 4OAZA 4R9BA 3UYJA 4DY5A 5A6YA 2VXRA 3AP7A 3RPUA 2EIEA 4FPKA 3ALQA 5F6KA 4RS5C 2P6HA 1LEDA 5FLXZ 1A6CA 2M8GX 3MIDA 2XBO1 2GNDA 3ZSKA 1B72B 1QHGA 1BIBA 4LEJA 1R1ZA 3DL3A 2D1HA 4IJAA 1UG0A 2EIGA 1Y43B 3HNMA 1ZZ8A 3HUGA 4JX5A 3RZKA 5KXCA 4QPQA 2WAAA 2HWC3 3A0HC 1AA7A 4XBFA 1UOBA 4CDWC 5BNPC 3VD4A 2XKPA 1SVLA 4RA0A 5E8IA 4F91B 3DPRC 1JU3A 2A3XA 1J84A 1R6RA 1V9U2 1RKTA 2X53S 2VW1A 2PHFA 1TE1B 2VZTA 3QWLA 1YXWA 4FX4A 1W6QB 2WO1A 1P2FA 2UXXA 4FISA 3VKOA 3QP6A 2VPLA 3GGLA 4MLOA 5ICEA 3FBIB 5ACA2 4XABA 1UYPA 1W0PA 3KF5A 1WLDA 5GM0A 3FN9A 1UY0A 1BM9A 2OZ6A 3IH4A 1W28A 1CAVA 1PZ9A 4FQZA 1X7NA 3F0CA 4AVTA 4HPQA 3D5LA 4QM8A 2JD9A 5HLGA 1ETYA 3OJBA 2D5FA 2J1AA 1D5VA 4MGIE 4I09A 2BNNA 4NNJA 1HRI1 4QIWN 2Y6HA 1OVPA 4ZYAA 2RHPA 3PUSA 1SBDA 3FXLA 4LIVA 2E35A 1OKOA 3I59B 3J7HA 1PVC2 3VDBA 3ZFFC 4Y1VA 5HNHA 1WA4A 4CU7A 1B35B 1O4YA 4XW3A 1Z7S2 1RUG3 4ZZLA 1R5HA 4K3UA 3S7IA 1G6NA 2LTNA 2VZQA 2ADEA 3PMEA 3M7AA 2K4BA 2ORZA 2OJED 2VMHA 1RUC2 3WGHA 2O8XA 4FI9A 4C2UA 3RNSA 1HQCA 5JAXA 4JRAA 1CX1A 2FQ3A 4AEMA 4XLHA 4XC9A 5E3OA 1R1VA 1UZCA 4HG2A 1U5TC 4BQQA 2ZXIA 2CTVA 4PDWA 3G4SI 3WP5A 3P7NA 2Y6LA 4RB0A 4BISA 1WW5A 1HXDA 2NN8A 3B94A 4BH9A 4K40A 3UJQA 1LGCA 3ABUA 4X6RB 4E7SA 2XJVA 1O8PA 1U8RA 4XN0A 1YFXA 1X58A 3OGSA 1JKPC 5BY5A 3N7KA 4DS0A 1IW7F 4I0BA 1DZTA 2VZUA 3UL2A 1TME1 4AL9A 5F5CA 2DMUA 2OPWA 3PSIA 4V2WA 2IRFG 3ZYGA 2HWF2 4AFBA 3E6DA 5H9RA 3QP5A 1PO13 5CADA 4C90A 2QZ8A 2X6WA 4RB1A 4UW6A 1ALYA 2D3SA 4W6XA 1KFUL 3JB8A 3ZM8A 3FXKA 4OMZA 2DT5A 1HKTA 4OMYA 3U0ZA 1OFCX 2R7XA 4ENNA 5K5QA 1F2NA 3ZFEB 2D5VA 4JAAA 2E1MC 4JTOA 1S7EA 2IT0A 5JVGF 1UCRA 3RKQA 1YRNB 4MFDA 4U88A 2WNUB 2P5VA 2UY8A 1U5XA 2A68F 1GHCA 2VUCA 5T3NA 1WCQA 3DTIA 3K4MA 3IAS2 1IC8A 3AB0A 5FMOS 3ZIXA 4D5FA 2H1LA 3OBZA 1RUF3 2QQ9A 3MVPA 1GWLA 3KM5A 4Z92B 5FLJA 3RS6A 1X4OA 4MHGA 1JT0A 4LLFA 4BB3A 3K51A 2M4GA 5HLHA 4M73A 3LNQA 2GAUA 3K0LA 2IXJA 4FTSA 5K0UA 4LE4A 5FY7A 4XUTA 1YI9A 4UVCA 3J8F1 4IV3A 4NPMA 1BW5A 3H1MA 3VLBB 1FBUA 2DCEA 3WUDA 4DXSA 3C7JA 1H8AC 5JLVA 2BV4A 1VQNI 2VE1A 1TW2A 3W5MA 3ESWB 5HS7A 1JTZX 1FP2A 5J8CA 2YUEA 3OMYA 4RMNA 5TJJA 4B43A 2WR9A 3BR1A 1TWFJ 1RUJ2 3SEZA 2K27A 3SCGA 2DA1A 1XGMA 4ONUA 3K4JA 2QQOA 3SZPA 3CMGA 1A35A 2OUJA 1PM7A 3AM2A 2E1OA 3VBHC 1S2BA 5I0UA 5CKTA 3P9IA 4HNTA 1RJ8A 3GTKJ 4GALA 3S1NJ 1VQKI 4PBPA 3VDCA 1NCQA 4G6DA 2ELKA 4A3FJ 2ID4A 2QKDA 3HDDA 4HLTA 3RMYA 2A7AA 2ZX2A 5FPUA 1ODNA 2VCMA 3NNJA 1Q8VA 2HFHA 1O57A 3ZYIB 3BLYA 3LSDA 4IL6C 1MR5A 1D4M3 5FZ1A 4QQLA 3C7GA 4EWDA 4I3GA 2KRCA 2DTWA 1MS1A 5FZOA 2CJJA 5J1YA 1WH7A 3P9CA 4HL0A 2D98A 4AI2A 2Q30A 1JBCA 3N7LA 4XAEA 5IAXA 2ZXQA 1RUH1 1E5SA 1YRZA 3S30A 3PNYA 4CU9A 5AVPA 1CONA 2JK3A 1H2MA 4QB1A 4K1ZA 4S2FA 5EG0A 1H0BA 5CVRA 3ZQCA 1UU4A 4QGNA 2RS11 2EAKA 2P37A 5JXJA 4OMDA 2XLFA 2AO9A 4JC1A 1AJOA 1LJ9A 2XF6A 5A3LA 2RJLA 2R1DA 2V6EA 3TO9A 3B69A 1VLNA 2BOIA 1SC7A 4TYSA 3T0DA 4WM8C 4CCKA 4GB31 4JGYC 2G4IA 4N0BA 1POV3 5KAFC 1DGRA 4A3EJ 2ZHNA 2EIDA 2F48A 4J19A 2GMEA 4PUSA 4M71A 2QNKA 5J48A 5IT9Z 1C1FA 1ULDA 2GP3A 2VQTA 2J1RA 1WJ5A 4W4ZA 3AZWA 3T2QA 5A1LA 4MUVA 1AR73 3LF7A 2QQMA 1FTZA 1QDOA 3O0VA 4HLXA 4F93B 1S1AA 2Y2ZA 2VASA 3VD5A 5JXIA 1B6AA 3E5UA 3LAGA 2J22A 2WB1N 2UWAA 5K7FA 1UL9A 5IATA 3R6SA 3RZOJ 4SLIA 1OR7C 4IPAA 5B3SH 2RJ2A 1FTTA 2HLEA 1AKHB 4S2HA 3OTFA 5LHIA 1JT6A 1KU9A 3HOWJ 1JGSA 4L0PA 1V54H 4E7KA 3H7YA 3PVEA 2FEZA 5LBCA 3GZ5A 1HDDC 3W2VA 4MQVA 4FFGA 2VI6A 2WAFA 1PO11 2CV2A 4C2MJ 3H3ZA 2VC0A 1UU6A 3MZ8A 3JCUC 5JOXA 3K4AA 1E3OC 3SMHA 2VBYA 3I2OA 3NKGA 2WA0A 5JI9A 4DJAA 3NVCA 2M5WA 3DUIA 3L7WA 5A2QK 4A93J 1JYXA 2KJCA 2XPVA 2P6TA 1QEXA 1QZZA 3IPVB 3KHCA 2EWNA 4DXTA 4B47A 4XMAA 4Q48A 3ZFGC 4XLPF 4ZYGA 1OQDA 4FPJA 4KT5C 1NXD1 5A3TA 1GLHA 4RD7A 1LHVA 3NNLA 2ZHMA 4QX7A 2O5RA 5AFEA 4LOCA 3I97A 3KVAA 4IW3A 2O8QA 4UUSB 5I0DA 1D0XA 2PG4A 2VC9A 3WQ0A 1VBA1 2P6CA 3CP8A 1W36C 3CHXA 4RBOA 1U9OA 2ZXHA 3N9LA 3I3LA 2ZMNA 1JODA 2M9HA 3HUGB 3I7DA 1WJEA 2CDPA 4CCMA 1R22A 4LKFA 3M8EA 4ASLA 2BGPA 4WVZA 1JOBA 3GBGA 2ZJCA 2CQXA 4QGMA 4LBQA 3AG4H 1XNAA 3KEYA 4COYA 3H5AA 3LEKA 3AP9A 2QBXA 5HODA 5FY9A 1ZZ9A 1WCKA 2RVCA 2RQQA 2VT3A 3PQJA 2R7TA 3C2BA 2QCSB 2E33A 5E3NA 2E26A 5CEHA 1ZQ3P 4BQ4A 4CE8A 3H3UA 3IWZA 2TEPA 4HSLA 4QQPA 3K2AA 5A3MA 2AENA 2DYSH 4IRIA 2WFF2 2UXNA 2R7VA 3HRUA 5KXEA 4CA9A 4HSRA 1K6YA 1YQCA 2ZA9A 1RJ7A 1AR81 3MF6A 5C3QA 2YPJA 3W9AA 3E3VA 3UGFA 1MNMC 4QX5A 2YHJA 1ENRA 2E32A 4CCOA 5L3FA 5T55A 2W85A 1REDA 5BYNA 4CDWB 3WNPA 2XAFA 4ESJA 1K7AA 1LNWA 5DAXA 2M7AA 3DPRB 2VNRA 4QDQA 1IOAA 1U78A 1GXPA 3NMBA 4IF4A 2HXOA 2F4PA 4AF9A 2A5YB 1QJX1 2RS53 3VHPA 4XSZF 4RHV1 4L5JA 5IYBJ 2EV0A 2CWMA 1PDNC 1HLVA 1VAKA 4FQGA 4QKFA 3MZHA 2PQ8A 2M3AA 3SC7X 4TLGA 3R4SA 2ZSIB 1SLBA 3F22A 5LGTA 2XC7A 2RC4A 4AEKA 5FB2A 1W7PD 4CUGA 1V5EA 1WZXA 5E18F 3BR2A 2VTXA 1FBQA 1PNFA 3R4KA 4CDXC 2VKEA 3QPLA 2OAZA 4I0AA 1XNBA 1SLIA 2A07F 3S5QA 2FMLA 1PIV1 2L9LA 2AEYA 2FDIA 1QJY3 1YQ8A 3VBRC 4NE9A 4B8XA 3ZFFB 3U1XA 2XB0X 1QA6A 1Q1VA 3WQ1A 2P6SA 5LHHA 3BALA 2GN7A 3VZOA 2W08A 4L9TA 1QF3A 3H3VK 3HRMA 4KWJA 1H9PA 4EN9B 5LRSA 1LR5A 4YGEA 2GNTA 4QSHA 3K70D 1XMKA 4GB33 1TQPA 5I8SA 5D5XB 3NSTA 4A69C 1DF0A 1GZ9A 2CQKA 3WR0A 2COMA 2NRAC 3AX4A 1FLIA 1FC3A 1LHOA 5H6QA 2L54A 2NNNA 1I39A 1VQ6I 2GC3A 1JOPA 3SITA 2C5DA 4AVAA 2WYSA 4PQ9A 2L0KA 1TNRA 4GJZA 1A6IA 2HOSA 1AR71 2DMQA 4DEQA 1JZ3A 2D6PA 1MS0A 3O1VA 5DYMA 3C1DA 2NVQJ 3THTA 4KISA 1E3PA 3JRGA 5J6XA 1L3JA 5EWSA 1ULOA 2F4IA 3PDQA 2VOWA 3TMOA 4GFBA 2MGQA 2PMHA 2NMOA 5KC5A 3IIIA 4HK9A 4UHTA 4IRHA 2P3KA 2EFOA 1DQ4A 1A8DA 3K77A 3QPSA 3K7AJ 1W2UA 2LS6A 2JIGA 4L9JA 3EUAA 4BQ2A 5ACA3 4RGKA 2O03A 4EJWA 2CGNA 4LO5B 2STWA 4IEYA 1ULGA 4O7XA 5T50A 3VDAA 4QPOA 1TNSA 2YGLA 3KV9A 2E1CA 2XVLA 5A3WA 1QZEA 2HWB3 4CUAA 4BQ3A 4AQ6A 1W0TA 3WGIA 4X1EA 4QB6A 5FZIA 1TT5B 4XTMA 2FQPA 3LIHA 5FZLA 4JOMA 3F2ZA 1AR92 5FY5A 3KMHA 3ZFEA 3AZZA 4BLJA 3ZMTA 4BYYA 4EYUA 5DV5A 5F3IA 1DQ5A 4QU1A 2PX9A 2WAEA 4DRRA 1R091 2V4JC 1WJAA 1POV0 2A6YA 2LRPA 2DPDA 1NXMA 5CFDB 1IJWC 5A33B 2E36A 1C8M1 3R05A 4MYEA 3O1MA 2GA1A 3B3QE 1BYHA 1UXXX 1WBLA 4LBOA 4JQTA 2LNBA 2ME0A 2VIXA 5GZFA 3I2KA 3PNTA 1ZGWA 2CNAA 2LALA 2V1NA 3CDLA 1VIWB 2ISYA 2NS8A 4BJ6C 4NHKA 4Y5SA 3GLLA 3LIGA 1SFEA 3ZXGA 1IAWA 5FZ7A 1BEV1 2BNOA 2IS2A 2HYKA 1OFNA 4M9XA 3CL1A 2CAVA 3V0AB 1XJAA 2L9SA 1XB4A 4CP9A 3OG2A 2KD7A 4YSFA 2QUFA 4CTEA 1C5HA 4HONA 4ZDPA 2VXJA 3VYSB 3OGVA 2VBZA 3JTGA 1C3HA 3LAJA 1QOSA 1LUJB