5F3EA

Crystal structure of human kdm4a in complex with compound 54a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
349
structure length
337
Chain Sequence
ETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 337
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f3eA01
2XXZA 3DXTA 4V2VA 5FZBA 3AVSA 5A80A 5FZMA 4ASKA 5A7NA 5FYMA 5FZLA 4QX8A 4D6RA 4C8DA 4GJYA 5FZ7A 5FY5A 2P5BA 2PXJA 3PTRB 5FY8A 5FZOB 5IWFA 5FYUA 4HONA 4UF0B 5FZFA 5LY2A 2YBSA 5FZ0A 4QXHA 5F2WA 3DXUA 5A1LA 4CSWA 4LITA 5E6HA 5A7OA 5FWJA 5A7WA 4IGOA 2OX0A 3PUQA 5LW9A 5FUNA 5IVCA 5FXWA 3K2OA 2GP3A 2WWUA 5F3GA 5FP3A 2XMLA 5A3WA 5A3PA 5A1FA 3PURA 2YU2A 5FYTA 4Y3OA 3RVHA 5FZ4A 5FP4A 4BU2A 5FY4A 5FY7A 5F5CA 4EZHA 5FYBA 3KV5A 4QXCA 4D6SA 5FPBA 4D6QA 2VD7A 5A7SA 5LY1A 5FP7A 5K4LA 4GJZA 3U78A 2Q8EA 5FYIA 3K3OA 3N9OA 4Y4RA 5FUPA 2OQ7A 2OQ6A 5FYZA 5FXZA 4AI9A 3ZLIA 5A3TA 4QWNA 5LWBA 4URAA 3LDBA 4XDOA 5ANQA 5F37A 5FJHA 2XDVA 3PDQA 3PUSA 5FZCA 4Y33A 5F5IA 5A7QA 4QX7A 3OPWA 3KV4A 5IVYA 5F32A 5F39A 3N9MA 3N9QA 5FYYA 5FZEA 4CCJA 3KVAA 2YU1A 2YBKA 3LD8A 5FZGA 3PU8A 3UYJA 4V2WA 5FZOA 5IVEA 5F2SA 5A3NA 5FZ3A 4AAPA 4TN7A 3ZPOA 4UF0A 5FXVA 5A7PA 3KV9A 5F5AA 5FZ1A 4EYUA 2Q8DA 4LIUA 5FYHA 5IVJA 3KV6A 3N9PA 5FY0A 5FZKA 2GP5A 1VRBA 4LIVA 4NUBA 5FBJA 2YPDA 4BISA 5IW0A 4LXLA 4GAZA 4IGQA 5F3IA 2WWJA 3N9LA 5A7WB 3AL5A 4CCKA 3PU3A 5FZHA 4BXFA 4DIQA 4QXBA 5IVVA 5FPAA 5FPLA 4IGPA 2Q8CA 4EZ4A 3KVBA 5FZ8A 5FWEA 3NJYA 5FYSA 5FZ9A 5ISLA 5FY1A 4CCLA 5FZAA 3AVRA 5FJKA 5IVBA 4GD4A 3N9NA 4XDPA 5FPUA 5IVFA 5FXXA 4E4HA 2W2IA 5F3EA 5CEHA 4CCMA 4CCOA 3AL6A 2OT7A 4HOOA 2XUEA 5FV3A 5FYVA 5FYCA 3PUAA 4QU1A 5F3CA 5FZDA 4DO0A 5KR7A 5FZIA 4CUGA 2OS2A 3U4SA 3K3NA 2YBPA 5FZ6A 5FP8A 5FPVA 4CCNA 5FY9A 3OPTA 5FP9A
chains in the Genus database with same CATH superfamily
3K46A 3KQ4B 4UXAA 4CCEA 5IT6A 4TWTA 4Y1ZA 2IVIB 4WVWA 1QJY1 1VBB3 2YV8A 4MUVA 4MHRA 4D6RA 4ZU7A 4MGIE 4R4ZA 1W06A 5FZ7A 4BB3A 2TBVA 2NM1A 1DF0A 1JOPA 4K3UA 4W50A 1ULDA 5DAQA 4YZ4A 2XB6C 4LO6B 3W58A 4OUSA 2KXLA 4FXKB 4WV8A 1UPIA 1V0AA 3CHXA 4CCDA 4CDWA 2VMIA 1FOD1 3QH6A 3WF0A 5FWJA 1UZYA 3D0SA 4ZXEA 4FVVA 1W9YA 1FV3A 3M7AA 3ZXLA 5DMYA 4Q4V3 5FXWA 4HVQA 1JH5A 1UY4A 4AYUA 1H2LA 1RIRA 4QQHA 5IK7A 4GKXA 3P6BA 3K4DA 4YM3A 4GB32 3E1F1 2OYZA 3VKLA 4R9AA 4L92A 5FPBA 3K75B 1Y7BA 1Z78A 3HNBM 4DINB 2WO7A 5AVPA 1AYM3 3IKWA 3ORJA 4JTNA 3HN1A 4LK7A 3AKSA 4UBGA 1MS8A 1F4HA 1WW4A 4JRLA 2Q8EA 5E1RA 3BPSA 3N9OA 4JQTA 5FUPA 5JZGC 4QKBA 3MW3A 1VBB1 1BQPA 2N7GA 3OBTA 1D0GA 4AEDA 2VO5A 4P9XA 2DWRA 2R042 1BEV3 1LHVA 1MS1A 2ZX2A 4QX3A 2I74A 4K40A 1GZWB 4QX7A 4HZFA 4PLOA 2A6ZA 5EXOA 1O3QA 5F39A 3DYMA 2FZ2A 1FI2A 2IXLA 3N9QA 1NLSA 3KVAA 4LBQA 3SHRA 3LFIA 4ZZ5A 1YUDA 1O91A 1PO22 4YG0A 2HJIA 4Z92B 5E16A 3WNNA 3LZZA 2D6NA 2RMU2 3RQ0A 3J4UH 1LOBA 1ENSA 4CU9A 4FAGA 4XFAA 2PHRA 4NRQA 4NUBA 4XZUG 3T2TA 4DNYA 1HX6A 2VULA 1AYN1 2FMYA 1H2NA 4AI2A 1ND2C 3AP4A 5EP9A 3CO2A 2QQWA 1W6PB 3VKOA 4DUXA 3LPFA 3QACA 4R8HA 3OD0A 3EB7A 3JD73 3NJZA 1AYM1 4GWJA 5EHDA 4XQWA 2HWE1 2RDQA 1I1EA 4ES8A 1TMF1 5ANNA 3UL2A 4E4HA 5IJRA 5IYYA 4RYDA 1O4TA 1C1LA 3AL6A 4GWIA 4X8PA 4RS5B 2JG9C 3WNLA 1XOYA 1A3KA 4M01A 4NWWA 1UN1A 1ZBA3 4RFT0 1TME3 3TEWA 1NY72 3PUHA 3WOGA 1LTEA 4F3JA 5I8TA 2IFRA 1YYNA 1AR73 3LKJA 1WWYA 2WKKA 4Q4Y1 2QNKA 2DFCA 3HAGA 5FBZA 3W21A 1SLLA 3Q8EA 5GKAC 2YC2A 4M0HA 2XGXA 2ZEZA 2C0ZA 5FZMA 3U10A 4CDUA 2VMEA 1RJ8A 2HWD2 2FDIA 3O14A 3A7QA 3OGRA 3ZR6A 2FQPA 4BIFA 5FQ0A 3TEYA 2CL2A 1K5MB 4C1XA 1OXCA 3OD4A 1REDA 1NCQB 4AI1A 1QH7A 1H6XA 2JB8A 2VZPA 2MHFA 2VW0A 3M3CA 5HCBA 3UGHA 3ZDVA 3CEWA 4QB1A 1YQCA 4Y22A 4LA3A 4NO4A 3JD71 3T2QA 2PHDA 1ASJ3 3ZSEA 3GBGA 2IWGB 2ID4A 4FFIA 4M00A 5JI9A 4CPBA 4JKLA 4QX5A 2JIJA 1DQ4A 3AP6A 4HANA 3FL7A 5FIXA 1QEXA 4LNVA 3UT0A 4I0WB 2WSVA 3EMRA 1VMJA 2PMWB 3BTAA 1ZBA1 1ZZBA 2AACA 3DUIA 5FY7A 5LA2A 1QDCA 4EZHA 5AC92 2WNVB 5C70A 1I3HA 3H1WA 3BTXA 1PMJX 1AR71 1ZZ6A 1S55A 5HPOA 2RE9A 1GOHA 4WM7B 4EWEA 3CJIC 4FPHA 4A44A 2WO3A 1AL23 3SISA 5FXZA 3WXPA 1ZRDA 1KITA 5BYNA 3JU9A 3SCHA 4AVTA 3DEMA 1DYKA 5FJHA 3OUHA 3F95A 3JQXA 2R16A 4MGKE 5DZFA 1CAVB 1YFWA 2D3PA 4XACA 4EN6B 3SITA 4M4RA 4CDXA 1IG3A 3GJBA 2LUWA 2PA7A 3HVDA 1OI6A 2VMCA 3DCQA 5F2SA 2JDNA 3ENRA 1KD7A 1RUI2 2F4PA 5E89A 3WNXA 3ZPOA 1UY3A 1OQDA 5FZ1A 2Q8DA 4NRMA 1W39A 4OCTA 2BOIA 3ZYFA 2YPDA 3IMNA 3O0XA 4YG6A 5C4WC 1ZRRA 2Z2SB 2HWB2 3UV9A 2XBO3 3RZHA 3ZYPA 5FLHA 2ZMKA 3NJVA 4CCCA 3RNSA 1F2NA 3J9SA 2UWBA 5DPNA 5FCCA 4RHV2 2A6VA 2ILMA 3T0BA 3NJYA 2O8QA 3ZFGC 1CONA 5FY1A 2YXSA 5BNPA 1OT5A 2RS32 3ZXGA 4NPMA 1LULA 1AL21 4UW5A 1Y3TA 4KNCA 1X33A 1S0CA 3ITQA 5KXBA 1UXXX 1VRH3 1XE0A 5KHJA 5FYVA 1DIWA 3V0AA 4LKEA 1AX2A 3KQRA 1IS6A 3MUY1 3VD5A 2WZR3 1NUKA 1HRI3 3I59B 3IDEA 3KGZA 3NSTA 4XJAA 1T2XA 3VHPA 4AHYA 2VQAA 1C28A 1MACA 2GSYA 3L2HA 2W91A 5C3OA 3ZOIA 2R6QA 4OMDA 3TEXA 3EXUA 1HIXA 1UXZA 1NCRC 2WFF3 4H7LA 2KM2A 2P4EA 3DPRC 1W6NB 1VBE1 2E32A 2BV4A 1NA1C 1DDLA 4MVTA 5A7NA 3OBZA 2Q30A 1XXNA 1C4RA 4OZOA 3SC7X 5FY8A 4NHYA 2D5FA 1A8DA 1UMZA 2DV9A 2E33A 2IFWA 2XBO1 3FZ3A 4GIQA 3SKJE 2EXJA 4UF0B 1GLHA 4W6WA 4WZFA 5FZ0A 4JGYB 2DTYA 4WM8A 1LECA 2C4XA 3H3UA 2CDPA 4YLZA 5BNQA 4GKYA 3VBOA 1RUD3 4EN9B 2Y6KA 1ALYA 1H0BA 1KEXA 5A7OA 2H0BA 4BXSV 4BQXA 1VPHA 2BRTA 2FCUA 1EUTA 1CR7A 3ES1A 5C33A 2JG8A 1OF3A 2YGLA 2R072 1HB3A 3B69A 1SBDA 4S2DA 2AEZA 3ACGA 4RD7A 1EYBA 4PBOA 3FC0A 3RVHA 3OBRA 4IETA 4YVWA 1N47A 3R4SA 2Y6FA 3AFGA 4CE8A 4Z2AA 1UZWA 2QQNA 1YQ5A 1HRI1 1ULOA 2WZR1 1QDOA 3N36A 4FOYA 4Y20A 1SFPA 2PQSA 1XC6A 3O7OA 1W2AX 2BOJA 1V6KA 2DVBA 1UIKA 3AMNA 3GCXA 3I4IA 1N3PA 4QGMA 3M1HA 4X6RB 5EFUA 4ES9A 1K12A 1TNFA 1J3QA 5FP7A 2XVKA 5C3PA 3FFQA 1SBEA 1VAKA 1AUYA 3RS6A 1NKGA 2WFF1 5SV8A 1CPMA 3ZFGA 2WS92 4CDQB 4TTGA 2VOWA 1HB1A 4I0AA 2VGDA 2BVBA 2W1WA 4COWA 2ZAAA 3H0OA 3KS7A 4XDQA 1SHWB 1W3XA 4ONUA 2GMMA 2GC0A 3GJAA 5T54A 1VBD3 4QKNA 1W2TA 4CXXA 1H8TB 2BDRA 5FO8B 3N7LA 3FJSA 4U2AA 1LJ7A 1STMA 1QKQA 4COUA 5JXJA 1RUD1 4ZZ8A 2JD4A 3HT2A 3P3NA 1SLTA 2IXKA 1LOGA 3I2JA 5B4XA 4UFKA 5ERLA 1CAXB 3MW2A 1RUE3 2HBUA 3WCRA 3O1VA 3OGJA 4LIVA 2RM23 4S2HA 1RUJ1 1PX4A 4HXCA 3N9LA 3VBRC 4MO3M 1GKBA 2XOMA 2JD9A 4D7SA 2Y34A 1W05A 3O0WA 3ZSMA 3MICA 4MGSA 4A3XA 2SBAA 1CZSA 3NV1A 3N7KA 4FQZA 2XJUA 4LE3A 4V1PA 4I01A 1OHFA 1AXYA 2GC1A 3ZFFB 3J8F3 1UZVA 5JAXA 4R52A 4BCUA 2HYXA 4YG3A 1WLWA 3N4MA 1CJDA 3GBWA 2QQOA 2O14A 4CCMA 3B9IA 3VKMA 2HWF3 1HB4A 3J7MA 2VVFA 1B35B 4TYSA 3OGGA 2GDFA 4YVSB 5FV3A 4L11A 1PZ9A 4FPJA 1S1AA 5C9AC 1MZ5A 4NOTA 3ZDSA 4QU1A 4OHXA 2EIDA 5L36A 2JDKA 3VKFC 1CPNA 1VBD1 4FPEA 5CB7A 1GWMA 1YIFA 2QJVA 4OHVA 5D8AC 3ZXEA 4BQYA 4E8DA 1AR83 4E4ZA 2XHNA 5LCWL 5FZ6A 2ZMNA 3LA2A 1F5JA 1GZWA 4MADA 4XVHA 1V6OA 3Q9OA 2E53A 5T3NA 3LSDA 1ZA7A 5FTTC 1GNHA 1Y9QA 3HEIA 5FYMA 4B4PA 5LBBA 1RUE1 2XJRA 3O1PA 1ND3C 2A6WA 2PHLA 1QQP2 4C8DA 2RM21 2TUNA 4NJ4A 5H9SA 3J7NA 3U0ZA 1DLLA 4PF1A 3B94A 2WZEA 4PI2A 4QHOA 2VMGA 1BK1A 2EAKA 2JJ6A 5IAVA 4QQLA 4W65A 5A1LA 3KT4A 1OBNA 2JDAA 3N3HA 1PGL2 3VDDC 1ZYBA 4NIDA 4E4SA 2GN3A 1ENRA 4PLMA 1VBC3 1X9PA 1PGW2 2B8MA 2RS13 4HKWA 4LO5B 2O1QA 1DFQA 3PIGA 4A7KA 1W6PA 3LFMA 2VC9A 1OQEA 2HWF1 2ZABA 4CVUA 3C7HA 3OEAA 3H7YA 2YU2A 3LWCA 3FFZA 4KBBA 1DQ5A 5FY4A 2CYFA 4KG0A 1DU3D 4YW3A 4A42A 2G9GA 5J98B 5ACA2 4RS5A 4MSVA 1AR81 2RS51 1LEDA 2TNFA 4BE3A 4DY5A 3BKZA 3WVJA 1X50A 1UCXA 4CA9A 5A6QA 1YHFA 4LHNA 1WMEA 3RGBA 3IIAA 4CEWB 3WDXA 4AI9A 1NLQA 3ZLIA 2Y6GA 1OLRA 1D4M1 2CTVA 1UF2C 2C9KA 2C5DA 3HQUA 4FPCA 5CFCB 5FR3A 2VOXA 1WBFA 1X8EA 1EY2A 3H8XA 3NV2A 3PUIA 5AVAA 3MV11 5D21A 5K0UC 5HCHA 4W4ZA 1SQ4A 1QJU2 3T2PA 3FX3A 4J25A 3RSJA 1W0PA 2KR2A 3AC0A 1MZEA 5FKCA 3ILNA 1UYPA 3MEPA 4NHLA 1OPOA 5G04L 3WW3A 3C7EA 4HVRA 4XAEA 3TB0A 5KXCA 2VCCA 3I2GA 1TZOA 1OOPB 2VXJA 3CMGA 3IAQA 1O5LA 1K5MA 4K20A 4Y1YA 1NCQA 1BBT1 2HWC2 1F9KA 1VBC1 3K48A 3WF2A 3WZ1A 4H14A 2RS11 3D5OA 3B7MA 1GZ9A 2K46A 3JQWA 1NZCA 3ACFA 3VLBB 3WW1A 5IVJA 2GP5A 3B02A 3D3AA 5DDJ2 1G9AA 3P5BA 4KWKA 4A4AA 5B4NA 3PU3A 3MV01 1JXNA 2JIGA 1DLCA 2W95A 2XVLA 4WVZA 2ZJCA 2RJ2A 4Q0PA 4JDNA 4UFHA 3VGIA 2ZGKA 3HR9A 2JB4A 4LKFA 5FZ9A 1LCLA 1W8ZA 4RGAA 2ZPXA 3OCPA 5FZAA 3AVRA 5IVBA 3BIWE 3H3LA 4GD4A 1WCKA 1FPN2 2ZAHA 5FMCA 1QXRA 5FPUA 5T55A 1OPMA 2WNVA 2W2IA 3GZTB 3LIGA 4PQ9A 1YI9A 4CCOA 1H4HA 2W87A 1VMHA 1ZBE1 2F17A 1DGRA 3I2OA 4WM7A 1AR61 4BQ4A 2DCYA 2QQKA 4P00B 3HOBA 4IEWA 5LEKA 1ZZ7A 3ECQA 1K45A 1OA2A 2PHFA 1E5RA 2NMNA 2ZZJA 3OOXA 3T3YA 1KJLA 3ACIA 4UFJA 4OZXA 3JXSA 2CAUA 2VR4A 1JUIA 4AFDA 1CAVA 5IK8A 4AHZA 3LEKA 2J1TA 2DVGA 1TNRA 4B7KA 1G9BA 1Y4WA 2JX9A 4OVEA 3E6CC 2ZKLA 1SG3A 2UWAA 3C7GA 3B5LB 5EJ3A 3ZSJA 4DUWA 3L2YA 3PMEA 3ZKYA 4C0BA 1PO11 5JSOA 2WFPA 3TEZA 1W90A 2BZDA 3MI8A 4LT5A 1RUH3 3DXUA 2K9ZA 4LITA 4IEPA 4XFHA 1Q8OA 3OG2A 2R062 4P9LA 1N3QA 2WQ8A 3MZHA 4HFSA 1WCDJ 2AYHA 1W6OB 2NZ9A 1RXGA 3APBA 1VJ2A 3OF1A 1UIJA 3SQOA 3T08A 5HXVA 2BBAA 1KGYA 5DXDA 3RZMA 2PAKA 1JBCA 3NL1A 4L99A 4QM8A 2UURA 5CVRA 4CDXB 4ASMB 4W8JA 1OSGA 2FHRA 5A7SA 2Y64A 1IGOA 1LGCA 1SPPB 2AGSA 3GZEA 5FLJA 2PAEA 2A73B 4EQVA 4QX0A 3I59A 5FYZA 4IV1B 1O7FA 1F5FA 4MZUA 4YW7A 1CZVA 3LDBA 3VBSC 3E5QA 2SLIA 5K9YA 3PDQA 3MPBA 1EAH1 1EV11 3AYDA 3CQOA 3O12A 5L7OB 1OLQA 1W6NA 4ZS3A 4ZU4A 1DZQA 3VD4A 3N9MA 1D7PM 3IM0A 2XJVA 2ZZQA 5FYYA 1JS9A 4BQ5A 4AVCA 4LBJA 1RUH1 2BNOA 1WW5A 4V2WA 3BTZA 4LTAA 3I8TA 4TN7A 1RVF3 3L9JT 4UF0A 4C1WA 1QJX3 5BY5A 4JGYA 3AZWA 1AR93 3SMHA 3VBFB 5CKMA 3ZFFC 4S2FA 3V0AB 4PCRA 4AHXA 3RZGA 2BTVC 1J1LA 1XU1A 4Q1PA 4CCKA 4BOWA 4H7MA 4JZRA 4M3CF 2LRPA 4OHYA 1VBA3 2XL7A 3BPZA 4A6OA 5DABA 4IGPA 2VY0A 2D6KA 2QDRA 4NVPA 3BOWA 3FUQA 2ZS6B 2RVAA 5IK5A 4FPYA 5FYSA 5JMCA 1MEC2 2Y6HA 4CDWC 4CU6A 5FJKA 4XDPA 5C7GA 3GZUC 5HXMA 5LA9A 3I2KA 1W9SA 2Y33A 3BN6A 2PHWA 4UAPA 4S2GA 2ATFA 1QJY3 3FBMA 4AVSA 1QJEA 3KWVA 4DB5A 1J83A 4W6YA 3RDIA 4CDQA 1RMU2 3PJYA 1H1MA 2J7MA 3Q8AA 3M3OA 3ME2A 4FPFA 3ILFA 3BYWA 4CRQA 1BCXA 1V9U2 4FP3A 5J7MA 1OC1A 1K3IA 1HB2A 2VOKA 4W6XA 2JWPA 3T4VA 4JDMA 5LY2A 4META 1HN0A 1RUG1 1RVF1 1JZ4A 1NZIA 1QJX1 1H8TA 1KJRA 4QD2A 4AEKA 4XJUA 3FHQA 1Z7S2 4XZPA 1UNBA 1RUF1 3R05A 4LMFA 1K42A 1VALA 1NX9A 1S0DA 1UOJA 1LHUA 3MPPG 4AEDC 2WL1A 4EWDA 3RZJA 3T0DA 4D69A 2TEPA 5CA6A 1CAXA 4EN8B 2UY9A 2YBSA 1VBA1 2Q1FA 1BHGA 4L8QA 4BWOA 1GQGA 1RUC2 1C8M3 2B42B 4Q4X2 1JYVA 4XJ8A 2V5DA 2J1UA 3PTYA 1GZCA 1W8TA 2IXHA 2Z69A 1FMD3 2Q1MA 5J1XA 3K2OA 1XNTA 4AHWA 4XF3A 4XTMA 2QZ3A 3MBWA 3H42B 3DECA 3RI8A 2WN3A 5JXGA 1HQLA 5J36A 3W20A 1F15A 2WABA 2VZOA 4L2NA 3ZFFA 2I2SA 1G9FA 4A7ZA 3WDYA 3USSA 4I30A 1PGSA 1NXD1 4A6SA 5LBFA 4D6SA 4ATEA 2BGCA 1EP0A 1NT0A 2YC4A 1B35A 3V64A 1JZ6A 1I9RA 2ZOEB 4YVSA 3U14A 4AFMA 2HH9A 3MIHA 1UW8A 3PL0A 1P8JA 4MYEA 3UJQA 3VB9A 1JYWA 1HRV3 1WA4A 2P6CA 2QQMA 4FPLA 4K1ZA 5BNNB 1L3JA 5AFEA 1JOBA 1OOPC 2DCZA 3MF9A 4XE9A 3ALQA 4YZ3A 4IE7A 4RR3B 2YGMA 4QPGB 2WWSA 3ZXKA 1GP5A 4G3YC 4DXTA 1SACA 1OF4A 2JEMA 3NNJA 1O8PA 3AYEA 1VIWB 4N9HA 4QX1A 3ZPYA 1YCIA 3OSDA 1VAMA 1AYN3 5FMOL 2BP6A 3S7EA 4ZONA 3KLSA 1C8M1 2XG3A 1LNSA 5FMDA 3UYJA 3WQ1A 1W6MB 5I93A 5IVEA 2HEYF 4CXWA 2J22A 1HQNA 3ZXDA 1FMD1 2A1XA 2ZGRA 4KGGA 3WEZA 5DUUA 2W08A 3NRUA 2HWE3 4LOSA 2XLFA 1L7RA 4CDUC 1TMF3 4RQPA 5FBJA 4QKFA 4AE2A 4IGQA 4N53B 3VZKA 3CLPA 1L7QA 4ARXA 1CAWB 3AZZA 4QXBA 3MUZ1 4AXOA 3O1SA 1PK6A 4NHKA 2Q8CA 3ZSKA 3T4HB 2WZ8A 4RGKA 4X8NA 4GALA 2OPKA 3SKVA 2GU9A 4JRAA 1DCSA 2PHUA 3BOPA 1LEMA 1C8NA 2BJSA 2YYOA 1OKQA 1G9DA 1D4VB 1HRV1 3BALA 4Q4Y3 5EJZB 2CGOA 3AP9A 2P3IA 2OT7A 4QQ2A 3ZFEB 5CADA 1GP4A 5KHHA 1UY0A 3WF3A 4R9BA 3WW4A 1O3TA 2OIIA 1MS9A 1YQ2A 1C3HA 5EPAA 2EALA 4LE4A 5F6KA 4CEWA 5A33B 2BWCA 5LBCA 5CFCA 1VBB2 4XF9A 2CSGA 5FLIA 3NNFA 2ZX1A 1D2QA 4AOCA 1CGPA 2Y60A 3OB8A 1COV3 3DXTA 3FBYA 5A32B 2ZGUA 4Y4YA 2ZX4A 3EHKA 2B46X 4BQ3A 3HWJA 3MF6A 1QF3A 2XQXA 4GJYA 3PTRB 5EYYA 1OOPA 3TBDA 1LENA 3POEA 2LALA 4YW6A 4R9DA 4QB6A 1IPSA 4Q4V2 5F2WA 3H9AA 4WBBA 4B3NA 2B5HA 2D97A 2X8KA 1IHMA 2C1FA 2GC3A 5GLUA 1N3OA 4AQTA 4B1MA 4CDXC 4CP9A 1G7YA 1XNKA 2XPJA 1LR5A 3WQBA 2JE8A 3NAPB 2JE9A 3IDAA 4OHWA 3W59A 3POWA 5DAVA 5EQUA 1O4YA 5C3SA 3URFA 5LA1A 4Q26A 2HWD1 1AYM2 2VOVA 2VZTA 4GMP1 1CWPA 2XR4A 4DS0A 2E51A 2QQIA 2CGPA 3PLQA 4D6QA 3T1LA 5I8YA 4JQRA 1DP0A 1QU0A 3SCGA 4IV3B 5EV7A 1SDWA 4FQ4A 1BEV2 1MQTB 2G19A 3X29B 1COV1 2JDPA 2QE3A 5BNPC 4QDSA 5ISLA 1SCRA 2GH2A 1SLIA 2XJTA 2Y0OA 2Y6JA 4O9EA 1LOAA 1LOCA 3R4DB 4N7IA 2VCMA 4Y5Z0 5FKBA 4ASLA 3E97A 2IC1A 1XNDA 3AZVA 2FCVA 3NJXA 4YGCA 4AI0A 2YUEA 2WJSA 4FXGB 5BXXA 4RSUA 4OI1A 1XSRA 1CX1A 3AJZA 1FX5A 1TE1B 5H9RA 4AVVA 3Q8CA 4FTSA 5JOXA 3I97A 1NLRA 4BIOA 5CFDB 2BNMA 3PHMA 4DQAA 4Y1UA 5F5AA 3LA3A 1KRIA 4XBQA 1W03A 1RHI3 4J6GA 3RFRA 4ZS2A 4AK3A 5I0RA 1PVXA 5TSWA 1H30A 1J59A 1A78A 4GAZA 1U5IA 5HV4A 1O3RA 2WNUA 3POYA 1MZ6A 1W6OA 4XQDA 2BPA2 1SBFA 4LO8A 3SEEA 3AM2A 2WLPA 2B9UA 1PMIA 4WM8C 4GZ9A 2B39A 1AL0G 3VBOC 4LLFA 4N43B 1YNAA 3HNYM 5LEJA 2BWAA 1I5PA 3OBAA 4BQWA 4DOUA 2QQJA 1ZBA2 1IKPA 1TME2 1RUI1 3E5UA 4FT8A 2VCBA 1PNGA 2JG8C 3A0KA 4JGZB 4XURA 4AFAA 4P02B 1AR72 1VBE3 1SPPA 3GHMA 4YGBA 4CYDA 4LO4B 1UMIA 3N35A 4HVOA 3A23A 1FV2A 4LKDA 4IV1A 4Y1VA 1HXS3 4FOWA 3BUCA 3I3EA 4YVWC 1G86A 4QB2A 1GQPA 2J1VA 2YFZA 3VBHA 2RR13 5I0DA 5L7OA 5CNAA 3OYWB 1SCSA 2WSUA 4CU7A 1W28A 1LOFA 3LEIA 2OPWA 4QM9A 4XCBA 1RJ7A 4XF4A 5A80A 3GM8A 3JCIA 1AJKA 1RHI1 2P2KA 1O6UA 4QX8A 4DEVA 4YZ1A 3H8RA 1IZ3A 4Z82A 1ENXA 1CD3G 2Z5WA 2G9ZA 1US2A 3KM5A 1ASJ2 2DDUA 1NQJA 1WKYA 3VBFA 1S2EA 3ZM8A 1E5HA 4P5HA 4CSWA 1JMUB 4NIHA 4B1LA 1OVPA 2WQ4A 2XH6A 2GMPA 3R6SA 2D7FA 2VZVA 5GLWA 2W47A 2WS93 3FN9A 2FDFA 1R082 2EXKA 3C3VA 5FP3A 4PJYA 4P14A 1WD4A 4F8AA 5KWRA 5FYTA 4IE5A 4IW3A 4G4FA 3OUIA 1R093 2VG9A 4BU2A 1QH6A 2VMFA 1HXS1 1PM4A 2E26A 2EXIA 2ENRA 1H1AA 1GNYA 3LQCA 2RR11 1Y9MA 2E7QA 2NP0A 2A70A 1H8VA 5KC5A 5FYIA 4Z1VA 4HLTA 4KQ7A 3K3OA 4GH4B 4OFGA 5KC6A 3LB9A 3S0MA 3USUB 4QMAA 4Z07A 5ANQA 4QGLA 2X5IB 1OLME 3CJXA 2LTNA 3T1MA 3LEGA 1LHOA 3H50A 2RJKA 1RUJ3 1BZWA 1H2MA 1Q3EA 5DQ0A 1RL3A 2BVVA 3LGRA 1GICA 1UPSA 1S0EA 2YBKA 1NXMA 3ZYHA 1ACCA 4JKMA 4MG2A 4QPIB 3VDCA 4AI8A 1CESA 1XNBA 1FATA 2VNRA 2WBKA 5A7PA 1SFYA 2FD8A 2FZ1A 1VMFA 5FDBA 5AFBA 4BK4A 5J37A 2WS91 3ILRA 2BGOA 1C5HA 2ZX0A 5IW0A 2EAAA 3RYRA 3WF1A 1EPZA 4BISA 5JPNB 5FREA 1REEA 2DUOA 5FZHA 2YFUA 1R091 2VM9A 1MVEA 2X53S 4ATFA 1CAUB 3O1TA 2P37A 4QKDA 4Z8BA 3INAA 4AVAA 4AF9A 1HLCA 4PDWB 2OUJA 4AAXA 1UU6A 3LDKA 3M3EA 1VRH2 1XSQA 4AGGA 4YPJA 2F4LA 5FOBB 4L9BA 4E4DX 3Q8BA 3WNPA 3MIEA 4YW1A 1YXWA 5A3LA 2WZR2 4GMP0 1HRI2 1V6NA 1AVBA 5F3EA 4QU2A 1AX1A 1PVC3 5M0TA 2Q5TA 1GWKA 3ETPA 2R49A 1YEWA 2XJSA 3RWKX 2WNOA 4HOOA 1SDDB 5C5TA 2QVSB 2EIEA 2YDEA 5T50A 3NKTA 2EIBA 2WFF2 3TNPB 1E5SA 5KR7A 3DF0A 5BNNA 4X6QB 3H3ZA 4ITCA 4UWDA 5DG1A 4YM1A 2QUOA 1HN1A 1ULPA 3FHIB 1KQRA 4RR3A 4QPGA 4XC9A 3WINE 5FOJB 4RS5C 1S0IA 3UKNA 4KWUA 4TXWA 5BPXA 2Y8KA 3LPGA 3FLRA 4FTEA 1UX6A 1VB2A 4XPVA 2Y38A 2JKBA 4P9JA 4B4QA 5FZLA 1JI6A 2DURA 5J3UA 4KGQA 4AQ6A 1W6MA 5JMOA 3AMQA 2PXJA 3WR0A 1IOAA 2KA3A 5FFOC 3WF4A 3WDUA 4BZ4A 5T5JA 4LUMA 2VMHA 1GV9A 5JIAA 4YZ5A 3H7JA 2D43A 4MLOA 3D8CA 4CEYB 2D6MA 4YW2A 4YZ2A 3HIFA 2QBXA 2WZPP 2P17A 4N53A 4HN1A 4D7YA 3WDVA 4IGOA 5F5QA 5DN2A 1CAWA 3CU7A 4XIOA 2RS53 3ST7A 5KHGA 2JDZA 3CIHA 4IV3C 5DAXA 1K5MC 2W46A 1NCQC 1PVC1 2P34A 4QQPA 4BQ1A 2WWUA 5E88A 2ZTNA 2J42A 1XNCA 5A3WA 2GH8A 3LEMA 2RDNA 4LBLA 1R1A2 1QIQA 5LRRA 1OD5A 3D6EA 1D4M3 1W9FA 1QQP1 4QDQA 2PN5A 1UU4A 2UY8A 4QXCA 4FOVA 1QGLA 1AXKA 3ZKUA 2R32A 3ZFEA 2VUDA 3S30A 1YJKA 2WT2A 5C71A 4GJZA 1VAVA 2WAOA 3AMHA 5E8AA 3POGA 3UKVA 2VH9A 5A33A 1PGL1 1VBD2 5A3TA 1ODNA 1NOVA 4RQPB 3GBFA 4A41A 2VBPA 2WNVC 4URAA 1PGW1 3I3QA 1BBT3 2GC2A 1OKOA 5C5UA 5A32A 4COZA 4AR2A 1PK6B 1JOJA 1W9WA 4WM7C 3AFKA 4XFFA 4XUOA 1ZNPA 5F32A 4A2UA 3RRDA 3W5MA 1G8WA 1RUE2 1NAEA 3TOJA 3O1UA 1MPXA 1IS3A 2J1EA 2RM22 2BU9A 3DKQA 3IDCB 3S6PA 5IFPA 5ACA1 2ET1A 3MIDA 4ZKTB 4QX2A 2OVUA 5C3RA 3C8XA 1LB2A 2WAAA 4N43C 4A7YA 4Q0QA 4OI0A 2AH2A 2VAUA 3N9PA 5FZKA 5GLTA 5JR7B 3GNEA 1JZ7A 3ZN4A 1UY2A 5F3IA 3SH5A 1HDKA 1JW6A 3NAPA 1S0GA 2ZMLA 1ZRCA 4QQOA 3B00A 3J8F2 1ZBE3 3BB6A 5BUVA 1CZTA 4LBKA 4XF1A 4AZZA 5GZEA 2W1SA 1AR63 3QH7A 3JBG2 1XB9A 2HWF2 5GZDA 4FBFA 4NRPA 1S0JA 4M3CB 3ZYJB 3VZMA 3AP7A 5T5OA 3WNKA 2ZGSA 5I0TA 1JUHA 2BEOA 3V56A 1S2BA 1AR82 4IV3A 1MQTA 3N7JA 2VBDA 5FAXA 2X29A 2CDOA 3AKTA 1IS5A 1BYHA 1J84A 1XYOA 4BM8A 2YPJA 2HLEA 2WT0A 2WRAA 4CP9B 3LA7A 4XF0A 3AXEA 4LO7A 2HBTA 1REFA 2AREA 2CNAA 2ZGNA 1PO13 2DCKA 3ZXAC 4XETA 4IL7A 4MHUA 4YGEA 4U36A 4N7UA 3OPTA 1ULGA 2VZ1A 3WY6A 2XXZA 2ZA9A 2GNMA 2D3RA 3GYDA 2R063 1ODMA 1OA4A 3LDRA 3CZJA 2AC1A 2P3JA 1Q8PA 1ST8A 1YIPA 2PLV3 2ZEXA 1FPN1 3OTFA 3POSA 2E7TA 3PVBB 4KWLA 1VP6A 5C3QA 2PQQA 4IUGA 3WV6A 1WMXA 1JN2P 2ZHMA 1UX7A 5FZOB 2BERA 5CFDA 4AL9A 3ON7A 2BFUL 5A6ZA 1VBC2 5F8PA 2D6LX 2ORZA 2WO2A 3AXDA 1H9PA 4NAMA 5ABJA 1Q56A 2W68A 2OX0A 5C8CA 4ET7A 4KI5M 1W9TA 3MO4A 5H9PA 4CP1A 1WLTA 3WHTA 3DGTA 4XQ4A 2XUMA 4QDRA 2GP3A 3RYPA 2WR9A 3WCSA 2QQPA 3DYPA 4JGYC 3HN3A 3UGFA 4XXPA 4GH4C 2KD7A 4P9GA 3GHNA 4N43A 4JKKA 3I2FA 4E27A 3KMHA 5FZ4A 5HI0A 5FP4A 5CKNA 4ZPIA 1ULFA 3D82A 5DUWA 2PHTA 4JGZA 1EAH3 1EV13 2VNVA 2WIIB 4IESA 1LKNA 5FPZA 3ACHA 4LQRA 1XBFA 3U4XA 2H0VA 4NR1A 4GWMA 3ZYRA 4Y1XA 2MEV2 2NMOA 1XJAA 4FPKA 3WNOA 1LRHA 2VNGA 2RDSA 2R061 5FK7A 3E5XA 3BTYA 2PLV1 1Q43A 1FT9A 3ZYBA 3ZXFA 1T6BX 4ARYA 2WNUB 3OYWA 4AI3A 2QKDA 2A3XA 1N1SA 3WG1A 4OUEA 1HW5A 2B4KA 3UK9A 1OH4A 4CDQC 4XUPA 5H9QA 5FO7B 1MS0A 2CWMA 4IEQA 4B7EA 1RGSA 1GR3A 1WCQA 1XU2A 2ARCA 5IUQA 1M4WA 3TN93 3VBSB 2RHPA 4E9KA 1ND2B 5A3NA 2FDKA 4LHKA 3J7HA 1XRUA 1DGLA 3PNAA 1JYNA 3HBZA 2CWSA 4NHMA 2CGNA 3OPZA 4RN5A 2W1UA 4BYYA 3ZIWA 2EVXA 3NNGA 4I3PA 5HV0A 1H8TC 1PIV3 3AYAA 3OY8A 1B09A 4HG6B 4LK6A 3I2IA 4OYUA 2YY1A 3W9AA 2V73A 1O3SA 1V6JA 3VBHB 5FPLA 3UJOA 1RMU3 1WGPA 3T30A 3K4ZA 1X7NA 1LGBA 3FUOA 4XOGA 3LOIA 1W8NA 3MIBA 2UYAA 3M70A 3VD3A 4CCLA 5IAXA 1Z0HA 5JXIA 2R1DA 2FCTA 1GOFA 1F31A 1A6CA 1IQDC 1Y9GA 3KT7A 1RUG3 1UZ0A 3A4UA 3RG0A 3S5QA 5CU1A 2MPFA 1RUF3 4GH4A 5FZDA 5F3CA 4HKOA 1RXFA 2VUJA 4DRRA 4K8FA 1E57A 2ZKNA 4QHZA 4Q8KA 4FTBA 3USUA 3O1OA 5JUVA 2W5FA 2X5IA 3WNMA 4MXVA 1V6IA 3K3NA 3U4SA 3WG4A 1W2UA 1G9CA 3WHUA 2W1QA 4CCNA 4C90A 1B35C 1RUC3 3VV1A 2BNNA 4BK5A 1AF9A 3TN91 4YVSC 4EV0A 5LZ6A 3I3MA 4DXZA 5FZBA 2WYFA 2JDUA 5BNOA 3WLUA 2VZ3A 4XHXA 4M3CE 4Q4W2 1VLNA 1JYTA 1BVVA 4QPIA 4QAWA 1GNZA 1PIV1 2P5BA 3AK0A 5IWFA 5HCFA 4YSFA 2YG0A 1W6QB 3BGAA 4FI9A 1ULCA 5FZFA 4D7TA 2GNTA 1LESA 5FMBA 2Z79A 3ZSLA 2CY6A 1RMU1 5SV5A 1GUIA 3EQEA 2OW4A 5J96B 3RJRA 2P6HA 4NIIA 4D0QA 4E2QA 2D3SA 3AP5A 5CBLA 3UETA 3WDWA 1V9U1 1YFXA 3M3IA 3NV4A 1HV1A 2QCSB 1EPWA 5IVCA 2XWBB 3RYKA 1CAUA 2ZEWA 5EYXA 4H3WA 5A3UA 2GNBA 2VNOA 3O1MA 1ZZ8A 4C0HA 1GZTA 4PDWA 2OZJA 5APAA 2XWJB 2ES3A 1UL9A 3CJIB 4RQPC 4YM2A 4NPRA 4YNIA 5FYBA 1RUNA 2DVDA 1V6LA 1PK6C 4K9SA 3VZLA 1JYCA 2LM3A 4GB33 2AUYA 3U78A 4B8EA 1BMV1 1RUC1 4Q4X1 2W3JA 2RV9A 2I07B 1UY1A 4KBZA 3NKGA 3S57A 3POFA 2JXAA 4XTPA 3MW4A 4LR4A 1YLLA 4L0PA 4XDOA 5GJ6A 3WP6A 1AHSA 2ZGLA 5JSPA 3BU0A 5K7PA 3V0BB 4UBHA 1S4CA 3OEBA 5F5IA 3ROUA 5KBFA 1RITA 3KV4A 3OPWA 4J1WA 4P5YA 2H6BA 3TAYA 4DPNA 1QJX2 3AZXA 3EJKA 4CUBA 4CEWC 5IATA 1DG6A 3GZAA 4INDA 1IS4A 1AR92 3FLPA 5C4WB 5CFCC 2R043 1LAJA 2IXCA 1BK0A 3JB8A 4IXLA 2RDRA 3O5SA 4AAPA 1QXJA 3I54A 2JDYA 5JDBA 4K21A 4L97A 1VBA2 4CEYA 2RJLA 1WZXA 4P9WA 5L9VA 4UW3A 3S5AA 5DAPA 1CVNA 1PO23 4Y26A 3LCPA 3EBRA 1CIWA 5LK7B 1JYXA 5CG9A 3WUDA 3TWIA 2HYKA 4DIQA 4SLIA 2RMU3 3RZZA 3WX5A 4JX0A 4BMBA 1VR3A 1LU2A 3HMYA 2R7EB 5FWEA 2V4AA 4KU7A 4MH0E 2QQVA 4GB31 1QJY2 5CISA 4WVMB 5EWSA 2ERFA 2A7AA 4CP2A 4NE9A 2PAMA 2VZQA 4NROA 2LW8A 3SH4A 1LU1A 4MX3A 2BQPA 1UQXA 1NCRB 2VQUA 4IEOA 4KH9A 1LHWA 1IQAA 3DPRB 3PUAA 1Q8SA 3MHZA 1NA1B 3HBKA 1FOD2 1OVSA 5A6YA 4OHZA 2XJQA 1O59A 1UO9A 1OFSA 4XEZA 2ARBA 4AFCA 4XJZA 4QXKA 2R041 4IEXA 4SBVA 5FP8A 5FY9A 3GDBA 2X09A 4AFBA 4NN0A 2AR6A 5EIYB 4V2VA 1UOBA 2WLQA 2B9VA 5JCTA 1RB8G 4FFFA 3U11A 2WYSA 5J48A 3WUCA 5GLZA 2R1BA 2VXRA 1C8M2 3NWKA 1PO21 2DVFA 4PI0A 4PIXA 5FY5A 4COYA 4UT5A 3Q8FA 4A45A 4Q8LA 1FMD2 1UYXA 2RMU1 4N9IA 3VHOA 4AW7A 2HWD3 1X8MA 2GZWA 2VQTA 1U12A 2VMDA 1V00A 3IDBB 4GMP3 3I49A 2OUHA 4LORA 1UOGA 1RUOA 1MZFA 2IXIA 4LULA 3VBUA 4WZCA 5FUNA 4K7JA 2YHJA 2VECA 5CG8A 5IFTA 3R4UA 1NE6A 4OQ9A 3HQXA 5JLVA 4AGRA 5D1IA 3WQ7A 1ZA4A 3J26N 4Q5OA 5A3PA 1UU5A 1MVQA 3PURA 4M3CA 1BXHA 2XLAA 3TNQA 3RMXA 1MR5A 2WNUC 4N90A 1C5IA 4Q29A 4B29A 1HRV2 1YFUA 2EA7A 4COVA 4MV2A 3VD9A 2VD7A 2JDHA 4I0BA 4M0NA 4Q4V1 2G9FA 3BVCA 4IQPA 5LY1A 1JODA 1Q8VA 3BODA 5K4LA 1GBGA 2VTXJ 3MLLA 3HT1A 4O61A 5AC93 4Y4RA 2OQ6A 1SLCA 5CZKA 3IT8A 4QGNA 1NY71 2D44A 3IAPA 4XHBA 1AXZA 1W0NA 4UFIA 1PHMA 3HPNA 5F7UA 4DFSA 5F37A 1AYN2 2DCTA 1OH3A 2B45X 4IEYA 2P3KA 3POBA 4OULA 2W94A 4UI9L 5T5PA 2JICA 4DMIA 2D40A 4CXYA 3A22A 4IV1C 3C7OA 1FNZA 2JECA 4YARA 2FDJA 1CN1A 2BUKA 3O0VA 2HWE2 3FWEA 1WLDA 4IE0A 1KXGA 5DZGA 5FZGA 1R64A 1TMF2 3FE5A 2E9QA 3VBHC 5FZOA 3VBRB 4Y5TA 1EUUA 5L7OC 4JV4A 1GANA 4NWVA 2XL9A 3ASIA 5BV6A 2DTWA 1F35A 1LOFC 3HQRA 4P9YA 4O9GA 1BEV1 3KV9A 4Q1RA 2VJXA 5FYHA 4ORFA 3AZYA 2XKOA 4NHXA 5I8SA 5HCAA 1S2KA 5FY0A 3M3QA 1VRBA 3POIA 3QOPA 4XFBA 1RUI3 3FLTA 4UFMA 5IVVA 4BXFA 1IKQA 4DEQA 4OQ8A 3VZOA 4PIYA 3MIGA 1DQ2A 1KS5A 1POV0 1UMHA 1V6MA 3PIJA 3VD7A 4Q4Y2 1XNAA 5CAZA 4JTOA 1WUVA 2ADEA 5FZ8A 4R9CA 3VBFC 2ZHNA 1KFXL 1DZRA 2HWB3 5C9AB 3VDBA 1I6XA 2C26A 4YWAA 3BCWA 4MXWB 4BLJA 4KL1A 5JZGA 3HNMA 2V72A 3KCYA 4BDVB 3VUOA 3ES4A 5D8AB 5L9RA 5AC91 3AJYA 5CEHA 2DBIA 4RHV3 3C7FA 4LA2A 4LPLA 4TSVA 1QXPA 3POJA 2RS33 2V4VA 2Q4SA 1COV2 4O65A 1WMFA 3MLKA 5FRAA 5GM0A 4C91A 1RTVA 4DO0A 3WP4A 5ABJB 3GALA 1ND3B 4GA9A 4K8RB 1W8UA 2NPIA 3HJRA 3JD72 1DGRN 2A5ZA 5C8CB 2WC2A 3HD8B 4DY3A 2V09A 1QNWA 1ENQA 2A71A 4IERA 5FP9A 2LROA 1VE0A 2VVEA 1NYWA 4LOTA 3ZMNA 4M4PA 2FMDA 4R4XA 1HJGA 3MFAA 4RFRB 1KS4A 4ASKA 1TME1 3VDDB 4XABA 1R083 2D6OX 1WMDA 1ND2A 2VU9A 4BJ0A 4FPGA 5JOWA 3ZYGA 3T09A 1ONAA 1JZ3A 1GQHA 4HONA 2W9XA 5DAWA 3SLIA 4AVBA 4ISRA 1OUXA 5KXEA 2ZHLA 3M2MA 4UYBA 4BMEA 2J1RA 4HPKA 1GP6A 2HWB1 3SXWA 1LGNA 3PUQA 4XFCA 4UOJA 1ZZCA 3N7MA 4Q27A 4RA0A 3THPA 2O8OA 3BU7A 4N8MA 2NN8A 1UKRA 2JG9A 4H55A 4A3ZA 4RHV1 1QJFA 2ZGMA 3CL1A 2OXBA 5JI7A 3MLJA 1X36A 1W8WA 1RC6A 2RS31 2IZWA 1CX4A 2R073 1DZTA 3SH3A 1MS5A 4Z2WA 1W8FA 1YQ6A 3PJQA 4LUKA 1ASJ1 1AJOA 1J3RA 4MGYE 4XUQA 2BBVA 3P1IA 4MGQA 5K0UB 4LLOA 4FO9A 4PT6A 3VKNA 4XBLA 3RI9A 4Q0UA 2Y0IA 2OQ7A 1UD1A 3H8UA 3OY8B 2CU5A 4QWNA 3LAGA 2A6XA 3OUJA 5J09A 2VCAA 4RL7A 4CU8A 4O7XA 2F6BA 1WW6A 1JHNA 2ZEYA 3MFCA 1R081 1IG0A 5C6CA 5HBAA 5LASA 5IVYA 5A3MA 4JHTA 4YGDA 5JVVA 3UNPA 1FYUA 5FZEA 4AEJA 5BNNC 1RHI2 3LD8A 1TG7A 4EROA 2NQYA 4RR3C 3IB3A 4QPGC 2ORXA 1W6QA 1AL22 1OMIA 4XILA 3ATGA 3RJ2X 1H2KA 4NIAA 3THDA 3VZJA 2NLRA 4XW3A 5L9BA 4DZGA 3U07A 1O8SA 1JU4A 4EYUA 5FUIA 3KV6A 1SEFA 4TZDA 1HQWA 2UWCA 4LBQD 4AWDA 4XJ9A 2Y6LA 2BFUS 5A7WB 3WW2A 1DQ1A 3VDAA 2VZSA 2VZUA 2Q8OA 2LS6A 3H8OA 3AMPA 2R071 2XVGA 2DU0A 4KU8A 2OZ6A 4EZ4A 1H6YA 4DRVA 5JSRA 5FPXA 5JXHA 3KCCA 4LJHA 4XAAA 3WT3A 3CJIA 3ZYIB 1VBE2 4FSJA 2XONA 5F9TA 5F1RA 5BNOB 1I5ZA 1DQ6A 2XJPA 4FFHA 4N53C 4OI2A 4YFWA 1YFYA 5DZEA 1N1YA 3ZVXA 4BPZA 1HXS2 3UGGA 1YI7A 2PHXA 4GULA 2DUPA 2XBO2 4LKSA 2RR12 4HK9A 2XUEA 3G6JB 3KF5A 4GWNA 1O5UA 1JZ2A 1J1TA 1TEIA 4BA6A 2WINB 1UWWA 3IZOA 5I0SA 4GXLA 5L73A 2DU1A 2QZ2A 4HETA 2XKPA 3EO6A 4FOQA 4JAAA 3WG3A 2YBPA 2JKXA 3A0NA 2WUHA 3KT1A 3V0BA 1MS4A 1WA6X 3ZFEC 4LHLA 2EIGA 4EN0A 1R1ZA 2DUQA 1VRH1 3AVSA 1DGWX 1DYPA 2VUCA 2JDMA 4F83A 5C4WA 4GQ7A 5FO9B 4D3WA 1OD3A 1N1TA 2YB7A 5T5LA 2Q1ZB 1CJPA 2K2SA 1C1FA 1R1A3 3KHBA 5FYUA 2FBEA 1XQNA 1OURA 1URXA 4XFGA 3GCWA 3K4AA 4I02A 4XMIA 1QQP3 1ZZ9A 4G9SB 3RZKA 3ETQA 2R0FA 4PIZA 1UKGA 2DYCA 1SFNA 4HSLA 4P9IA 3CBNA 3PVEA 1TVGA 1R092 1U0AA 2OA2A 2P3YA 4WVVA 4BLIA 2WA3A 2C9AA 1ULEA 2EXHA 2XMLA 3I2HA 3E6DA 3ABZA 4OLLA 5A1FA 4XJWA 1PM7A 4WVMA 4AGVA 3ZN6B 3CF6E 1IPJA 3WQ0A 3NAPC 5F5CA 3KV5A 1SLBA 2YMZA 1RUD2 1O4ZA 2D5HA 2Z42A 1POQA 3DL3A 4HL0A 1WCSA 3IPVB 3OGVA 1NCRA 2WNEA 2ZGTA 2IUWA 1QHDA 4CPBD 1YC61 3DPRA 1J3PA 1W0OA 3VHRA 3NMBA 1NA1A 2EICA 4HBNA 1BJQA 5F6LB 1W04A 3MYXA 1RUJ2 2QTWB 5ACA3 4JC1A 1JU3A 3FMGA 2DBNA 2UU8A 2YROA 4KG8A 4QPYA 4D8MA 4HKLA 2YZ4A 3A21A 5G05L 5JOYA 3WDTA 4Y33A 2PELA 3J7LA 3LOBA 1QOOA 3ZIXA 1MQTC 3THTA 1X82A 1R1A1 4Y24A 5DUVA 5KXDA 3KD4A 4QPWA 4ISQA 3I3BA 3KGLA 4H2AA 5A3OA 3SNMA 3RZLA 3JBG3 2QFEA 1V70A 5EJ1B 1OA3A 1AX0A 1QJU3 5LA0A 5K8SA 1WW7A 2D6PA 1WLCA 2BW8A 1XYPA 1YO8A 2VW1A 2GMEA 3IMMA 4BQ2A 2ZHKA 2PFWA 3DKWA 4AEMA 1X9TA 4CDWB 1ZRFA 5I91A 3K51A 5CIRA 4QT6A 3LIHA 2WWJA 4NPLA 2XHKA 3WG2A 2HWC3 3QBQA 4XUNA 5A6XA 2WT1A 4F7ZA 3B9CA 3K77A 1SZBA 2JENA 2B7YA 4LBNA 3RWNA 1PVC2 5CFDC 1XYNA 2HEVF 1TQ5A 5DDJ3 2JE7A 4E8CA 2GAUA 5ABJC 4Y5SA 2X05A 4DXSA 3VHNA 3N9NA 2G1MA 3B01A 3I7DA 5DG2A 3ZN5A 5FXXA 2D93A 5C8CC 1W3VA 2EF6A 5JPMB 1FAYA 1ZRIA 3THCA 2WN2A 3VZNA 4OI4A 1W2OA 2XQRA 2I45A 3CKHA 5FYCA 2ETEA 1C57A 1FPN3 2IVJA 5IHRA 2VPVA 4KWJA 4DUVA 2FDGA 4ZU5A 2BYVE 3EYPA 4YW4A 2E6VA 3J8F1 3WD5A 5GALA 4JGZC 3SCFA 4AEDB 3VBUB 3D4KA 3U1XA 1Q5OA 2BGPA 4AQSA 1OLMA 3JBG1 5CYYA 2WQZC 1MS3A 1QJU1 2VOTA 3VL8A 4XYXA 4LBQB 2GALA 1BLZA 1WD3A 3NNLA 5GLVA 3VBRA 2VBBA 1APNA 1JYIA 4XBNA 4JDOA 2ET7A 1QY4A 4LEJA 1W2NA 2HWC1 2RS52 3KCXA 1QOTA 5LK5A 5DUXA 5T52A 1US3A 4JCKA 2ZGQA 2D98A 3F2ZA 3DN7A 1LOEA 4Q2FA 1CQ9A 3S7IA 5DDJ1 2Q0AA 2CV6A 3PVNA 4FFGA 3ACLA 2WDBA 1UZZA 1GU3A 1D4M2 1KFUL 2MEV3 1ZVFA 4TLFA 3M8LA 1OQ1A 1CIYA 3AKQA 1YRZA 1NQDA 5F3GA 2UYBA 4XMAA 5C9AA 5A70A 1GFF2 4MXWA 3M4FA 3IWZA 1U5XA 5GZCA 2VUAA 3AKRA 2DF7A 5D8AA 1NG0A 2DFBA 4ZXKA 3U37A 1JHJA 3PVOA 2ARXA 4JHZA 1UAIA 4NIGA 5EZWA 2H6CA 1KDKA 2XLGA 4LHSA 2QDNA 1H4GA 1BBT2 3I2DA 1W8HA 3TYJA 2IXJA 5FMOS 2RS12 2A6YA 4HT1T 2W92A 1ND3A 2WO1A 1S0FA 4IEZA 5LWBA 3TRSB 4YFZA 2W52A 3LSEA 2XDVA 1U5YA 2K0GA 3ZO0B 3PUSA 3AYCA 2DCJA 2E31A 4IDZA 4I09A 3NV3A 5A7QA 3AX4A 3O1RA 3U75A 2R0HA 2ZBJA 2L9LA 4ZHNA 1W99A 4CP0A 3LE0A 1L7LA 3QCWA 4YM0A 4CDUB 4CCJA 2YU1A 3NQHA 4IEUA 3WP5A 2VTXA 5IK4A 3VDDA 5JZGB 1S0BA 3VN4A 1QNYA 2X5IC 2ZCWA 2J1AA 3ZMOA 5FZ3A 4HK8A 5FQ0B 1GYKA 5FXVA 1M06G 1ZBE2 1IPKA 2MEV1 4Q0SA 4P08A 3GXUA 3RPQA 1A34A 2C6SA 4IE4A 1VB4A 4LBMA 4AG4A 3ZXJA 5BNOC 1AR62 4Y22B 1NE4A 4LXLA 1UYYA 4QPIC 4E2SA 2A3WA 3AL5A 1UYZA 2HEWF 2QQLA 4OUMA 5FPAA 4YYOA 1WBLA 3T0AA 1KDMA 3KVBA 1LODA 2ADDA 1K5JA 1RYYA 2HKXA 3GF6A 3QD6A 4J1XA 3JB4C 5CKQA 3AB0A 1W8OA 1DBNA 3C2UA 3E6BA 3OJBA 3SEPA 1D0HA 1GSLA 4IEVA 2OKXA 1T6GC 1QOSA 1DYOA 4Q4W3 1GWLA 1OUSA 3IIIA 1MEC3 1PO12 3CDZB 4XCAA 1PMHX 5K0UA 4PDWC 1PZ8A 3GGLA 3W5NA 3KZ4C 1BVP1 4HMZA 3IN9A 4ZY9A 2VE1A 5FZIA 4FAHA 1YQ8A 1ZX5A 2PLV2 4HPKB 1DGWA 2ZGPA 5C8WA 1WCUA 4YW5A 1F8VA 1HV0A 1N1VA 4URTA 1PX3A 2JG9B 2PYTA 3ZX7A 3RMYA 3CNAA 2NYYA 1V9U3 2DVAA 2MNGA 1POV3 2A75A 2X10A 4MGTA 2E7AA 1JTZX 3FHAA 4XIKA 4EN7B 1XPWA 3ELNA 2ZXQA 1G6NA 4MOAA 3JZVA 4QXHA 1Z7S3 2GNDA 3NNMA 2O0OA 4MGZE 1E5IA 3OGSA 5E6HA 5L19A 1QWRA 1UOFA 5A7WA 4TLGA 3WP3A 5B2GB 5LW9A 3KHCA 2VTFA 3H1MA 5JR2A 3KSCA 1GOGA 2Y26A 3KF3A 4JVAA 1EAH2 1EV12 4Q4X3 2ARAA 2VW2A 4NAOA 4CEYC 2CHHA 1D2SA 4Q4W1 1MEC1 4XXAA 1Q8QA 5BNPB 5LB6A 4Y3OA 2P1BA 4HN0A 4I3GA 4YRDA 1RUH2 4PBPA 4FCAA 5A1AA 5LRSA 3VL9A 4IE6A 1DHKB 2J1SA 4D94A 5JIUA 4AQ2A 3CZUA 1Y43B 2A3YA 4CUCA 4B4RA 1DQ0A 3R0RA 4I2OA 4QHBA 4UW4A 4FPOB 3MIFA 3QLQA 2E63A 1QMJA 3D0JA 5LBEA 3LF7A 3DV8A 4PF5A 1POV1 1U5ZA 1XE7A 3NW4A 1AZDA 3I3DA 4LBOA 5FZCA 4CTEA 3TN92 1PZ7A 1JZ8A 2V5YA 3B93A 3H1YA 5KHIA 2G4IA 4CUAA 3BIEA 3AMMA 1FNYA 4UW6A 1Z7S1 4XFIA 5JOZA 4KMQA 5KHKA 2ZX3A 1PIV2 3PU8A 4E2GA 4K1YA 1H9WA 1HKDA 3T2OA 1F4AA 1XE8A 4BH9A 4CZSA 1LHNA 4EJRA 4EE2A 2VL4A 2AENA 3KB5A 4LIUA 4Q0VA 4WM8B 4FP2A 3B3QE 4PLNA 3G7DA 3P3PA 3VBOB 1BKZA 2R30A 2W0XA 2W39A 4OMCA 3DYOA 3NVCA 4XUTA 3MGUA 1YJLA 1A8MA 2Z4FA 2JG8B 2VZRA 1SLAA 2CAVA 2ZACA 1ZM1A 3UKTA 2RG4A 2ZGOA 2AZ5A 5FK8A 4BHPA 1JZ5A 1FOD3 5GZFA 1FXZA 3V65A 5I0UA 1RUG2 4RGGA 1RVF2 4UFLA 1RINA 3ZN6A 1AR91 3AKPA 2PTMA 2WA4A 3ZR5A 3BI3A 1GMMA 4YVWB 3IBMA 1RUF2 5IVFA 4PHZA 3VBUC 2FDHA 1OFNA 3VBSA 4Y20B 5JWPA 2GN7A 3JUUA 1SMVA 3IPVA 4NMIA 4DXRA 4HSJA 5D2AA 4K6BA 2VQ0A 2YC0A 1HJFA 2VVDA 4EWAA 1H1IA 1PNFA 1BMV2 3MDPA 1QJZA 2QQUA 3NO8A 5LATA 2C24A 3ZFGB 1ZREA 1YWKA 4CUGA 2OS2A 3PMSA 3WSOA 2AEYA 5GZGA 1J58A 5FPVA 4PQQA 3UESA
chains in the Genus database with same CATH topology
2XXZA 3DXTA 4V2VA 5FZBA 3AVSA 5A80A 5FZMA 4ASKA 5A7NA 5FYMA 5FZLA 4QX8A 4D6RA 4C8DA 4GJYA 5FZ7A 5FY5A 2P5BA 2PXJA 3PTRB 5FY8A 5FZOB 5IWFA 5FYUA 4HONA 4UF0B 5FZFA 5LY2A 2YBSA 5FZ0A 4QXHA 5F2WA 3DXUA 5A1LA 4CSWA 4LITA 5E6HA 5A7OA 5FWJA 5A7WA 4IGOA 2OX0A 3PUQA 5LW9A 5FUNA 5IVCA 5FXWA 3K2OA 2GP3A 2WWUA 5F3GA 5FP3A 2XMLA 5A3WA 5A3PA 5A1FA 3PURA 2YU2A 5FYTA 4Y3OA 3RVHA 5FZ4A 5FP4A 4BU2A 5FY4A 5FY7A 5F5CA 4EZHA 5FYBA 3KV5A 4QXCA 4D6SA 5FPBA 4D6QA 2VD7A 5A7SA 5LY1A 5FP7A 5K4LA 4GJZA 3U78A 2Q8EA 5FYIA 3K3OA 3N9OA 4Y4RA 5FUPA 2OQ7A 2OQ6A 5FYZA 5FXZA 4AI9A 3ZLIA 5A3TA 4QWNA 5LWBA 4URAA 3LDBA 4XDOA 5ANQA 5F37A 5FJHA 2XDVA 3PDQA 3PUSA 5FZCA 4Y33A 5F5IA 5A7QA 4QX7A 3OPWA 3KV4A 5IVYA 5F32A 5F39A 3N9MA 3N9QA 5FYYA 5FZEA 4CCJA 3KVAA 2YU1A 2YBKA 3LD8A 5FZGA 3PU8A 3UYJA 4V2WA 5FZOA 5IVEA 5F2SA 5A3NA 5FZ3A 4AAPA 4TN7A 3ZPOA 4UF0A 5FXVA 5A7PA 3KV9A 5F5AA 5FZ1A 4EYUA 2Q8DA 4LIUA 5FYHA 5IVJA 3KV6A 3N9PA 5FY0A 5FZKA 2GP5A 1VRBA 4LIVA 4NUBA 5FBJA 2YPDA 4BISA 5IW0A 4LXLA 4GAZA 4IGQA 5F3IA 2WWJA 3N9LA 5A7WB 3AL5A 4CCKA 3PU3A 5FZHA 4BXFA 4DIQA 4QXBA 5IVVA 5FPAA 5FPLA 4IGPA 2Q8CA 4EZ4A 3KVBA 5FZ8A 5FWEA 3NJYA 5FYSA 5FZ9A 5ISLA 5FY1A 4CCLA 5FZAA 3AVRA 5FJKA 5IVBA 4GD4A 3N9NA 4XDPA 5FPUA 5IVFA 5FXXA 4E4HA 2W2IA 5F3EA 5CEHA 4CCMA 4CCOA 3AL6A 2OT7A 4HOOA 2XUEA 5FV3A 5FYVA 5FYCA 3PUAA 4QU1A 5F3CA 5FZDA 4DO0A 5KR7A 5FZIA 4CUGA 2OS2A 3U4SA 3K3NA 2YBPA 5FZ6A 5FP8A 5FPVA 4CCNA 5FY9A 3OPTA 5FP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXZ A;  3DXT A;  4V2V A;  5FZB A;  3AVS A;  5A80 A;  5FZM A;  4ASK A;  5A7N A;  5FYM A;  5FZL A;  4QX8 A;  4D6R A;  4C8D A;  4GJY A;  5FZ7 A;  5FY5 A;  2P5B A;  2PXJ A;  3PTR B;  5FY8 A;  5FZO B;  5IWF A;  5FYU A;  4HON A;  4UF0 B;  5FZF A;  5LY2 A;  2YBS A;  5FZ0 A;  4QXH A;  5F2W A;  3DXU A;  5A1L A;  4CSW A;  4LIT A;  5E6H A;  5A7O A;  5FWJ A;  5A7W A;  4IGO A;  2OX0 A;  3PUQ A;  5LW9 A;  5FUN A;  5IVC A;  5FXW A;  3K2O A;  2GP3 A;  2WWU A;  5F3G A;  5FP3 A;  2XML A;  5A3W A;  5A3P A;  5A1F A;  3PUR A;  2YU2 A;  5FYT A;  4Y3O A;  3RVH A;  5FZ4 A;  5FP4 A;  4BU2 A;  5FY4 A;  5FY7 A;  5F5C A;  4EZH A;  5FYB A;  3KV5 A;  4QXC A;  4D6S A;  5FPB A;  4D6Q A;  2VD7 A;  5A7S A;  5LY1 A;  5FP7 A;  5K4L A;  4GJZ A;  3U78 A;  2Q8E A;  5FYI A;  3K3O A;  3N9O A;  4Y4R A;  5FUP A;  2OQ7 A;  2OQ6 A;  5FYZ A;  5FXZ A;  4AI9 A;  3ZLI A;  5A3T A;  4QWN A;  5LWB A;  4URA A;  3LDB A;  4XDO A;  5ANQ A;  5F37 A;  5FJH A;  2XDV A;  3PDQ A;  3PUS A;  5FZC A;  4Y33 A;  5F5I A;  5A7Q A;  4QX7 A;  3OPW A;  3KV4 A;  5IVY A;  5F32 A;  5F39 A;  3N9M A;  3N9Q A;  5FYY A;  5FZE A;  4CCJ A;  3KVA A;  2YU1 A;  2YBK A;  3LD8 A;  5FZG A;  3PU8 A;  3UYJ A;  4V2W A;  5FZO A;  5IVE A;  5F2S A;  5A3N A;  5FZ3 A;  4AAP A;  4TN7 A;  3ZPO A;  4UF0 A;  5FXV A;  5A7P A;  3KV9 A;  5F5A A;  5FZ1 A;  4EYU A;  2Q8D A;  4LIU A;  5FYH A;  5IVJ A;  3KV6 A;  3N9P A;  5FY0 A;  5FZK A;  2GP5 A;  1VRB A;  4LIV A;  4NUB A;  5FBJ A;  2YPD A;  4BIS A;  5IW0 A;  4LXL A;  4GAZ A;  4IGQ A;  5F3I A;  2WWJ A;  3N9L A;  5A7W B;  3AL5 A;  4CCK A;  3PU3 A;  5FZH A;  4BXF A;  4DIQ A;  4QXB A;  5IVV A;  5FPA A;  5FPL A;  4IGP A;  2Q8C A;  4EZ4 A;  3KVB A;  5FZ8 A;  5FWE A;  3NJY A;  5FYS A;  5FZ9 A;  5ISL A;  5FY1 A;  4CCL A;  5FZA A;  3AVR A;  5FJK A;  5IVB A;  4GD4 A;  3N9N A;  4XDP A;  5FPU A;  5IVF A;  5FXX A;  4E4H A;  2W2I A;  5F3E A;  5CEH A;  4CCM A;  4CCO A;  3AL6 A;  2OT7 A;  4HOO A;  2XUE A;  5FV3 A;  5FYV A;  5FYC A;  3PUA A;  4QU1 A;  5F3C A;  5FZD A;  4DO0 A;  5KR7 A;  5FZI A;  4CUG A;  2OS2 A;  3U4S A;  3K3N A;  2YBP A;  5FZ6 A;  5FP8 A;  5FPV A;  4CCN A;  5FY9 A;  3OPT A;  5FP9 A; 
#chains in the Genus database with same CATH topology
 3K46 A;  3KQ4 B;  4UXA A;  4CCE A;  5IT6 A;  4TWT A;  4Y1Z A;  2IVI B;  4WVW A;  1QJY 1;  1VBB 3;  2YV8 A;  4MUV A;  4MHR A;  4D6R A;  4ZU7 A;  4MGI E;  4R4Z A;  1W06 A;  5FZ7 A;  4BB3 A;  2TBV A;  2NM1 A;  1DF0 A;  1JOP A;  4K3U A;  4W50 A;  1ULD A;  5DAQ A;  4YZ4 A;  2XB6 C;  4LO6 B;  3W58 A;  4OUS A;  2KXL A;  4FXK B;  4WV8 A;  1UPI A;  1V0A A;  3CHX A;  4CCD A;  4CDW A;  2VMI A;  1FOD 1;  3QH6 A;  3WF0 A;  5FWJ A;  1UZY A;  3D0S A;  4ZXE A;  4FVV A;  1W9Y A;  1FV3 A;  3M7A A;  3ZXL A;  5DMY A;  4Q4V 3;  5FXW A;  4HVQ A;  1JH5 A;  1UY4 A;  4AYU A;  1H2L A;  1RIR A;  4QQH A;  5IK7 A;  4GKX A;  3P6B A;  3K4D A;  4YM3 A;  4GB3 2;  3E1F 1;  2OYZ A;  3VKL A;  4R9A A;  4L92 A;  5FPB A;  3K75 B;  1Y7B A;  1Z78 A;  3HNB M;  4DIN B;  2WO7 A;  5AVP A;  1AYM 3;  3IKW A;  3ORJ A;  4JTN A;  3HN1 A;  4LK7 A;  3AKS A;  4UBG A;  1MS8 A;  1F4H A;  1WW4 A;  4JRL A;  2Q8E A;  5E1R A;  3BPS A;  3N9O A;  4JQT A;  5FUP A;  5JZG C;  4QKB A;  3MW3 A;  1VBB 1;  1BQP A;  2N7G A;  3OBT A;  1D0G A;  4AED A;  2VO5 A;  4P9X A;  2DWR A;  2R04 2;  1BEV 3;  1LHV A;  1MS1 A;  2ZX2 A;  4QX3 A;  2I74 A;  4K40 A;  1GZW B;  4QX7 A;  4HZF A;  4PLO A;  2A6Z A;  5EXO A;  1O3Q A;  5F39 A;  3DYM A;  2FZ2 A;  1FI2 A;  2IXL A;  3N9Q A;  1NLS A;  3KVA A;  4LBQ A;  3SHR A;  3LFI A;  4ZZ5 A;  1YUD A;  1O91 A;  1PO2 2;  4YG0 A;  2HJI A;  4Z92 B;  5E16 A;  3WNN A;  3LZZ A;  2D6N A;  2RMU 2;  3RQ0 A;  3J4U H;  1LOB A;  1ENS A;  4CU9 A;  4FAG A;  4XFA A;  2PHR A;  4NRQ A;  4NUB A;  4XZU G;  3T2T A;  4DNY A;  1HX6 A;  2VUL A;  1AYN 1;  2FMY A;  1H2N A;  4AI2 A;  1ND2 C;  3AP4 A;  5EP9 A;  3CO2 A;  2QQW A;  1W6P B;  3VKO A;  4DUX A;  3LPF A;  3QAC A;  4R8H A;  3OD0 A;  3EB7 A;  3JD7 3;  3NJZ A;  1AYM 1;  4GWJ A;  5EHD A;  4XQW A;  2HWE 1;  2RDQ A;  1I1E A;  4ES8 A;  1TMF 1;  5ANN A;  3UL2 A;  4E4H A;  5IJR A;  5IYY A;  4RYD A;  1O4T A;  1C1L A;  3AL6 A;  4GWI A;  4X8P A;  4RS5 B;  2JG9 C;  3WNL A;  1XOY A;  1A3K A;  4M01 A;  4NWW A;  1UN1 A;  1ZBA 3;  4RFT 0;  1TME 3;  3TEW A;  1NY7 2;  3PUH A;  3WOG A;  1LTE A;  4F3J A;  5I8T A;  2IFR A;  1YYN A;  1AR7 3;  3LKJ A;  1WWY A;  2WKK A;  4Q4Y 1;  2QNK A;  2DFC A;  3HAG A;  5FBZ A;  3W21 A;  1SLL A;  3Q8E A;  5GKA C;  2YC2 A;  4M0H A;  2XGX A;  2ZEZ A;  2C0Z A;  5FZM A;  3U10 A;  4CDU A;  2VME A;  1RJ8 A;  2HWD 2;  2FDI A;  3O14 A;  3A7Q A;  3OGR A;  3ZR6 A;  2FQP A;  4BIF A;  5FQ0 A;  3TEY A;  2CL2 A;  1K5M B;  4C1X A;  1OXC A;  3OD4 A;  1RED A;  1NCQ B;  4AI1 A;  1QH7 A;  1H6X A;  2JB8 A;  2VZP A;  2MHF A;  2VW0 A;  3M3C A;  5HCB A;  3UGH A;  3ZDV A;  3CEW A;  4QB1 A;  1YQC A;  4Y22 A;  4LA3 A;  4NO4 A;  3JD7 1;  3T2Q A;  2PHD A;  1ASJ 3;  3ZSE A;  3GBG A;  2IWG B;  2ID4 A;  4FFI A;  4M00 A;  5JI9 A;  4CPB A;  4JKL A;  4QX5 A;  2JIJ A;  1DQ4 A;  3AP6 A;  4HAN A;  3FL7 A;  5FIX A;  1QEX A;  4LNV A;  3UT0 A;  4I0W B;  2WSV A;  3EMR A;  1VMJ A;  2PMW B;  3BTA A;  1ZBA 1;  1ZZB A;  2AAC A;  3DUI A;  5FY7 A;  5LA2 A;  1QDC A;  4EZH A;  5AC9 2;  2WNV B;  5C70 A;  1I3H A;  3H1W A;  3BTX A;  1PMJ X;  1AR7 1;  1ZZ6 A;  1S55 A;  5HPO A;  2RE9 A;  1GOH A;  4WM7 B;  4EWE A;  3CJI C;  4FPH A;  4A44 A;  2WO3 A;  1AL2 3;  3SIS A;  5FXZ A;  3WXP A;  1ZRD A;  1KIT A;  5BYN A;  3JU9 A;  3SCH A;  4AVT A;  3DEM A;  1DYK A;  5FJH A;  3OUH A;  3F95 A;  3JQX A;  2R16 A;  4MGK E;  5DZF A;  1CAV B;  1YFW A;  2D3P A;  4XAC A;  4EN6 B;  3SIT A;  4M4R A;  4CDX A;  1IG3 A;  3GJB A;  2LUW A;  2PA7 A;  3HVD A;  1OI6 A;  2VMC A;  3DCQ A;  5F2S A;  2JDN A;  3ENR A;  1KD7 A;  1RUI 2;  2F4P A;  5E89 A;  3WNX A;  3ZPO A;  1UY3 A;  1OQD A;  5FZ1 A;  2Q8D A;  4NRM A;  1W39 A;  4OCT A;  2BOI A;  3ZYF A;  2YPD A;  3IMN A;  3O0X A;  4YG6 A;  5C4W C;  1ZRR A;  2Z2S B;  2HWB 2;  3UV9 A;  2XBO 3;  3RZH A;  3ZYP A;  5FLH A;  2ZMK A;  3NJV A;  4CCC A;  3RNS A;  1F2N A;  3J9S A;  2UWB A;  5DPN A;  5FCC A;  4RHV 2;  2A6V A;  2ILM A;  3T0B A;  3NJY A;  2O8Q A;  3ZFG C;  1CON A;  5FY1 A;  2YXS A;  5BNP A;  1OT5 A;  2RS3 2;  3ZXG A;  4NPM A;  1LUL A;  1AL2 1;  4UW5 A;  1Y3T A;  4KNC A;  1X33 A;  1S0C A;  3ITQ A;  5KXB A;  1UXX X;  1VRH 3;  1XE0 A;  5KHJ A;  5FYV A;  1DIW A;  3V0A A;  4LKE A;  1AX2 A;  3KQR A;  1IS6 A;  3MUY 1;  3VD5 A;  2WZR 3;  1NUK A;  1HRI 3;  3I59 B;  3IDE A;  3KGZ A;  3NST A;  4XJA A;  1T2X A;  3VHP A;  4AHY A;  2VQA A;  1C28 A;  1MAC A;  2GSY A;  3L2H A;  2W91 A;  5C3O A;  3ZOI A;  2R6Q A;  4OMD A;  3TEX A;  3EXU A;  1HIX A;  1UXZ A;  1NCR C;  2WFF 3;  4H7L A;  2KM2 A;  2P4E A;  3DPR C;  1W6N B;  1VBE 1;  2E32 A;  2BV4 A;  1NA1 C;  1DDL A;  4MVT A;  5A7N A;  3OBZ A;  2Q30 A;  1XXN A;  1C4R A;  4OZO A;  3SC7 X;  5FY8 A;  4NHY A;  2D5F A;  1A8D A;  1UMZ A;  2DV9 A;  2E33 A;  2IFW A;  2XBO 1;  3FZ3 A;  4GIQ A;  3SKJ E;  2EXJ A;  4UF0 B;  1GLH A;  4W6W A;  4WZF A;  5FZ0 A;  4JGY B;  2DTY A;  4WM8 A;  1LEC A;  2C4X A;  3H3U A;  2CDP A;  4YLZ A;  5BNQ A;  4GKY A;  3VBO A;  1RUD 3;  4EN9 B;  2Y6K A;  1ALY A;  1H0B A;  1KEX A;  5A7O A;  2H0B A;  4BXS V;  4BQX A;  1VPH A;  2BRT A;  2FCU A;  1EUT A;  1CR7 A;  3ES1 A;  5C33 A;  2JG8 A;  1OF3 A;  2YGL A;  2R07 2;  1HB3 A;  3B69 A;  1SBD A;  4S2D A;  2AEZ A;  3ACG A;  4RD7 A;  1EYB A;  4PBO A;  3FC0 A;  3RVH A;  3OBR A;  4IET A;  4YVW A;  1N47 A;  3R4S A;  2Y6F A;  3AFG A;  4CE8 A;  4Z2A A;  1UZW A;  2QQN A;  1YQ5 A;  1HRI 1;  1ULO A;  2WZR 1;  1QDO A;  3N36 A;  4FOY A;  4Y20 A;  1SFP A;  2PQS A;  1XC6 A;  3O7O A;  1W2A X;  2BOJ A;  1V6K A;  2DVB A;  1UIK A;  3AMN A;  3GCX A;  3I4I A;  1N3P A;  4QGM A;  3M1H A;  4X6R B;  5EFU A;  4ES9 A;  1K12 A;  1TNF A;  1J3Q A;  5FP7 A;  2XVK A;  5C3P A;  3FFQ A;  1SBE A;  1VAK A;  1AUY A;  3RS6 A;  1NKG A;  2WFF 1;  5SV8 A;  1CPM A;  3ZFG A;  2WS9 2;  4CDQ B;  4TTG A;  2VOW A;  1HB1 A;  4I0A A;  2VGD A;  2BVB A;  2W1W A;  4COW A;  2ZAA A;  3H0O A;  3KS7 A;  4XDQ A;  1SHW B;  1W3X A;  4ONU A;  2GMM A;  2GC0 A;  3GJA A;  5T54 A;  1VBD 3;  4QKN A;  1W2T A;  4CXX A;  1H8T B;  2BDR A;  5FO8 B;  3N7L A;  3FJS A;  4U2A A;  1LJ7 A;  1STM A;  1QKQ A;  4COU A;  5JXJ A;  1RUD 1;  4ZZ8 A;  2JD4 A;  3HT2 A;  3P3N A;  1SLT A;  2IXK A;  1LOG A;  3I2J A;  5B4X A;  4UFK A;  5ERL A;  1CAX B;  3MW2 A;  1RUE 3;  2HBU A;  3WCR A;  3O1V A;  3OGJ A;  4LIV A;  2RM2 3;  4S2H A;  1RUJ 1;  1PX4 A;  4HXC A;  3N9L A;  3VBR C;  4MO3 M;  1GKB A;  2XOM A;  2JD9 A;  4D7S A;  2Y34 A;  1W05 A;  3O0W A;  3ZSM A;  3MIC A;  4MGS A;  4A3X A;  2SBA A;  1CZS A;  3NV1 A;  3N7K A;  4FQZ A;  2XJU A;  4LE3 A;  4V1P A;  4I01 A;  1OHF A;  1AXY A;  2GC1 A;  3ZFF B;  3J8F 3;  1UZV A;  5JAX A;  4R52 A;  4BCU A;  2HYX A;  4YG3 A;  1WLW A;  3N4M A;  1CJD A;  3GBW A;  2QQO A;  2O14 A;  4CCM A;  3B9I A;  3VKM A;  2HWF 3;  1HB4 A;  3J7M A;  2VVF A;  1B35 B;  4TYS A;  3OGG A;  2GDF A;  4YVS B;  5FV3 A;  4L11 A;  1PZ9 A;  4FPJ A;  1S1A A;  5C9A C;  1MZ5 A;  4NOT A;  3ZDS A;  4QU1 A;  4OHX A;  2EID A;  5L36 A;  2JDK A;  3VKF C;  1CPN A;  1VBD 1;  4FPE A;  5CB7 A;  1GWM A;  1YIF A;  2QJV A;  4OHV A;  5D8A C;  3ZXE A;  4BQY A;  4E8D A;  1AR8 3;  4E4Z A;  2XHN A;  5LCW L;  5FZ6 A;  2ZMN A;  3LA2 A;  1F5J A;  1GZW A;  4MAD A;  4XVH A;  1V6O A;  3Q9O A;  2E53 A;  5T3N A;  3LSD A;  1ZA7 A;  5FTT C;  1GNH A;  1Y9Q A;  3HEI A;  5FYM A;  4B4P A;  5LBB A;  1RUE 1;  2XJR A;  3O1P A;  1ND3 C;  2A6W A;  2PHL A;  1QQP 2;  4C8D A;  2RM2 1;  2TUN A;  4NJ4 A;  5H9S A;  3J7N A;  3U0Z A;  1DLL A;  4PF1 A;  3B94 A;  2WZE A;  4PI2 A;  4QHO A;  2VMG A;  1BK1 A;  2EAK A;  2JJ6 A;  5IAV A;  4QQL A;  4W65 A;  5A1L A;  3KT4 A;  1OBN A;  2JDA A;  3N3H A;  1PGL 2;  3VDD C;  1ZYB A;  4NID A;  4E4S A;  2GN3 A;  1ENR A;  4PLM A;  1VBC 3;  1X9P A;  1PGW 2;  2B8M A;  2RS1 3;  4HKW A;  4LO5 B;  2O1Q A;  1DFQ A;  3PIG A;  4A7K A;  1W6P A;  3LFM A;  2VC9 A;  1OQE A;  2HWF 1;  2ZAB A;  4CVU A;  3C7H A;  3OEA A;  3H7Y A;  2YU2 A;  3LWC A;  3FFZ A;  4KBB A;  1DQ5 A;  5FY4 A;  2CYF A;  4KG0 A;  1DU3 D;  4YW3 A;  4A42 A;  2G9G A;  5J98 B;  5ACA 2;  4RS5 A;  4MSV A;  1AR8 1;  2RS5 1;  1LED A;  2TNF A;  4BE3 A;  4DY5 A;  3BKZ A;  3WVJ A;  1X50 A;  1UCX A;  4CA9 A;  5A6Q A;  1YHF A;  4LHN A;  1WME A;  3RGB A;  3IIA A;  4CEW B;  3WDX A;  4AI9 A;  1NLQ A;  3ZLI A;  2Y6G A;  1OLR A;  1D4M 1;  2CTV A;  1UF2 C;  2C9K A;  2C5D A;  3HQU A;  4FPC A;  5CFC B;  5FR3 A;  2VOX A;  1WBF A;  1X8E A;  1EY2 A;  3H8X A;  3NV2 A;  3PUI A;  5AVA A;  3MV1 1;  5D21 A;  5K0U C;  5HCH A;  4W4Z A;  1SQ4 A;  1QJU 2;  3T2P A;  3FX3 A;  4J25 A;  3RSJ A;  1W0P A;  2KR2 A;  3AC0 A;  1MZE A;  5FKC A;  3ILN A;  1UYP A;  3MEP A;  4NHL A;  1OPO A;  5G04 L;  3WW3 A;  3C7E A;  4HVR A;  4XAE A;  3TB0 A;  5KXC A;  2VCC A;  3I2G A;  1TZO A;  1OOP B;  2VXJ A;  3CMG A;  3IAQ A;  1O5L A;  1K5M A;  4K20 A;  4Y1Y A;  1NCQ A;  1BBT 1;  2HWC 2;  1F9K A;  1VBC 1;  3K48 A;  3WF2 A;  3WZ1 A;  4H14 A;  2RS1 1;  3D5O A;  3B7M A;  1GZ9 A;  2K46 A;  3JQW A;  1NZC A;  3ACF A;  3VLB B;  3WW1 A;  5IVJ A;  2GP5 A;  3B02 A;  3D3A A;  5DDJ 2;  1G9A A;  3P5B A;  4KWK A;  4A4A A;  5B4N A;  3PU3 A;  3MV0 1;  1JXN A;  2JIG A;  1DLC A;  2W95 A;  2XVL A;  4WVZ A;  2ZJC A;  2RJ2 A;  4Q0P A;  4JDN A;  4UFH A;  3VGI A;  2ZGK A;  3HR9 A;  2JB4 A;  4LKF A;  5FZ9 A;  1LCL A;  1W8Z A;  4RGA A;  2ZPX A;  3OCP A;  5FZA A;  3AVR A;  5IVB A;  3BIW E;  3H3L A;  4GD4 A;  1WCK A;  1FPN 2;  2ZAH A;  5FMC A;  1QXR A;  5FPU A;  5T55 A;  1OPM A;  2WNV A;  2W2I A;  3GZT B;  3LIG A;  4PQ9 A;  1YI9 A;  4CCO A;  1H4H A;  2W87 A;  1VMH A;  1ZBE 1;  2F17 A;  1DGR A;  3I2O A;  4WM7 A;  1AR6 1;  4BQ4 A;  2DCY A;  2QQK A;  4P00 B;  3HOB A;  4IEW A;  5LEK A;  1ZZ7 A;  3ECQ A;  1K45 A;  1OA2 A;  2PHF A;  1E5R A;  2NMN A;  2ZZJ A;  3OOX A;  3T3Y A;  1KJL A;  3ACI A;  4UFJ A;  4OZX A;  3JXS A;  2CAU A;  2VR4 A;  1JUI A;  4AFD A;  1CAV A;  5IK8 A;  4AHZ A;  3LEK A;  2J1T A;  2DVG A;  1TNR A;  4B7K A;  1G9B A;  1Y4W A;  2JX9 A;  4OVE A;  3E6C C;  2ZKL A;  1SG3 A;  2UWA A;  3C7G A;  3B5L B;  5EJ3 A;  3ZSJ A;  4DUW A;  3L2Y A;  3PME A;  3ZKY A;  4C0B A;  1PO1 1;  5JSO A;  2WFP A;  3TEZ A;  1W90 A;  2BZD A;  3MI8 A;  4LT5 A;  1RUH 3;  3DXU A;  2K9Z A;  4LIT A;  4IEP A;  4XFH A;  1Q8O A;  3OG2 A;  2R06 2;  4P9L A;  1N3Q A;  2WQ8 A;  3MZH A;  4HFS A;  1WCD J;  2AYH A;  1W6O B;  2NZ9 A;  1RXG A;  3APB A;  1VJ2 A;  3OF1 A;  1UIJ A;  3SQO A;  3T08 A;  5HXV A;  2BBA A;  1KGY A;  5DXD A;  3RZM A;  2PAK A;  1JBC A;  3NL1 A;  4L99 A;  4QM8 A;  2UUR A;  5CVR A;  4CDX B;  4ASM B;  4W8J A;  1OSG A;  2FHR A;  5A7S A;  2Y64 A;  1IGO A;  1LGC A;  1SPP B;  2AGS A;  3GZE A;  5FLJ A;  2PAE A;  2A73 B;  4EQV A;  4QX0 A;  3I59 A;  5FYZ A;  4IV1 B;  1O7F A;  1F5F A;  4MZU A;  4YW7 A;  1CZV A;  3LDB A;  3VBS C;  3E5Q A;  2SLI A;  5K9Y A;  3PDQ A;  3MPB A;  1EAH 1;  1EV1 1;  3AYD A;  3CQO A;  3O12 A;  5L7O B;  1OLQ A;  1W6N A;  4ZS3 A;  4ZU4 A;  1DZQ A;  3VD4 A;  3N9M A;  1D7P M;  3IM0 A;  2XJV A;  2ZZQ A;  5FYY A;  1JS9 A;  4BQ5 A;  4AVC A;  4LBJ A;  1RUH 1;  2BNO A;  1WW5 A;  4V2W A;  3BTZ A;  4LTA A;  3I8T A;  4TN7 A;  1RVF 3;  3L9J T;  4UF0 A;  4C1W A;  1QJX 3;  5BY5 A;  4JGY A;  3AZW A;  1AR9 3;  3SMH A;  3VBF B;  5CKM A;  3ZFF C;  4S2F A;  3V0A B;  4PCR A;  4AHX A;  3RZG A;  2BTV C;  1J1L A;  1XU1 A;  4Q1P A;  4CCK A;  4BOW A;  4H7M A;  4JZR A;  4M3C F;  2LRP A;  4OHY A;  1VBA 3;  2XL7 A;  3BPZ A;  4A6O A;  5DAB A;  4IGP A;  2VY0 A;  2D6K A;  2QDR A;  4NVP A;  3BOW A;  3FUQ A;  2ZS6 B;  2RVA A;  5IK5 A;  4FPY A;  5FYS A;  5JMC A;  1MEC 2;  2Y6H A;  4CDW C;  4CU6 A;  5FJK A;  4XDP A;  5C7G A;  3GZU C;  5HXM A;  5LA9 A;  3I2K A;  1W9S A;  2Y33 A;  3BN6 A;  2PHW A;  4UAP A;  4S2G A;  2ATF A;  1QJY 3;  3FBM A;  4AVS A;  1QJE A;  3KWV A;  4DB5 A;  1J83 A;  4W6Y A;  3RDI A;  4CDQ A;  1RMU 2;  3PJY A;  1H1M A;  2J7M A;  3Q8A A;  3M3O A;  3ME2 A;  4FPF A;  3ILF A;  3BYW A;  4CRQ A;  1BCX A;  1V9U 2;  4FP3 A;  5J7M A;  1OC1 A;  1K3I A;  1HB2 A;  2VOK A;  4W6X A;  2JWP A;  3T4V A;  4JDM A;  5LY2 A;  4MET A;  1HN0 A;  1RUG 1;  1RVF 1;  1JZ4 A;  1NZI A;  1QJX 1;  1H8T A;  1KJR A;  4QD2 A;  4AEK A;  4XJU A;  3FHQ A;  1Z7S 2;  4XZP A;  1UNB A;  1RUF 1;  3R05 A;  4LMF A;  1K42 A;  1VAL A;  1NX9 A;  1S0D A;  1UOJ A;  1LHU A;  3MPP G;  4AED C;  2WL1 A;  4EWD A;  3RZJ A;  3T0D A;  4D69 A;  2TEP A;  5CA6 A;  1CAX A;  4EN8 B;  2UY9 A;  2YBS A;  1VBA 1;  2Q1F A;  1BHG A;  4L8Q A;  4BWO A;  1GQG A;  1RUC 2;  1C8M 3;  2B42 B;  4Q4X 2;  1JYV A;  4XJ8 A;  2V5D A;  2J1U A;  3PTY A;  1GZC A;  1W8T A;  2IXH A;  2Z69 A;  1FMD 3;  2Q1M A;  5J1X A;  3K2O A;  1XNT A;  4AHW A;  4XF3 A;  4XTM A;  2QZ3 A;  3MBW A;  3H42 B;  3DEC A;  3RI8 A;  2WN3 A;  5JXG A;  1HQL A;  5J36 A;  3W20 A;  1F15 A;  2WAB A;  2VZO A;  4L2N A;  3ZFF A;  2I2S A;  1G9F A;  4A7Z A;  3WDY A;  3USS A;  4I30 A;  1PGS A;  1NXD 1;  4A6S A;  5LBF A;  4D6S A;  4ATE A;  2BGC A;  1EP0 A;  1NT0 A;  2YC4 A;  1B35 A;  3V64 A;  1JZ6 A;  1I9R A;  2ZOE B;  4YVS A;  3U14 A;  4AFM A;  2HH9 A;  3MIH A;  1UW8 A;  3PL0 A;  1P8J A;  4MYE A;  3UJQ A;  3VB9 A;  1JYW A;  1HRV 3;  1WA4 A;  2P6C A;  2QQM A;  4FPL A;  4K1Z A;  5BNN B;  1L3J A;  5AFE A;  1JOB A;  1OOP C;  2DCZ A;  3MF9 A;  4XE9 A;  3ALQ A;  4YZ3 A;  4IE7 A;  4RR3 B;  2YGM A;  4QPG B;  2WWS A;  3ZXK A;  1GP5 A;  4G3Y C;  4DXT A;  1SAC A;  1OF4 A;  2JEM A;  3NNJ A;  1O8P A;  3AYE A;  1VIW B;  4N9H A;  4QX1 A;  3ZPY A;  1YCI A;  3OSD A;  1VAM A;  1AYN 3;  5FMO L;  2BP6 A;  3S7E A;  4ZON A;  3KLS A;  1C8M 1;  2XG3 A;  1LNS A;  5FMD A;  3UYJ A;  3WQ1 A;  1W6M B;  5I93 A;  5IVE A;  2HEY F;  4CXW A;  2J22 A;  1HQN A;  3ZXD A;  1FMD 1;  2A1X A;  2ZGR A;  4KGG A;  3WEZ A;  5DUU A;  2W08 A;  3NRU A;  2HWE 3;  4LOS A;  2XLF A;  1L7R A;  4CDU C;  1TMF 3;  4RQP A;  5FBJ A;  4QKF A;  4AE2 A;  4IGQ A;  4N53 B;  3VZK A;  3CLP A;  1L7Q A;  4ARX A;  1CAW B;  3AZZ A;  4QXB A;  3MUZ 1;  4AXO A;  3O1S A;  1PK6 A;  4NHK A;  2Q8C A;  3ZSK A;  3T4H B;  2WZ8 A;  4RGK A;  4X8N A;  4GAL A;  2OPK A;  3SKV A;  2GU9 A;  4JRA A;  1DCS A;  2PHU A;  3BOP A;  1LEM A;  1C8N A;  2BJS A;  2YYO A;  1OKQ A;  1G9D A;  1D4V B;  1HRV 1;  3BAL A;  4Q4Y 3;  5EJZ B;  2CGO A;  3AP9 A;  2P3I A;  2OT7 A;  4QQ2 A;  3ZFE B;  5CAD A;  1GP4 A;  5KHH A;  1UY0 A;  3WF3 A;  4R9B A;  3WW4 A;  1O3T A;  2OII A;  1MS9 A;  1YQ2 A;  1C3H A;  5EPA A;  2EAL A;  4LE4 A;  5F6K A;  4CEW A;  5A33 B;  2BWC A;  5LBC A;  5CFC A;  1VBB 2;  4XF9 A;  2CSG A;  5FLI A;  3NNF A;  2ZX1 A;  1D2Q A;  4AOC A;  1CGP A;  2Y60 A;  3OB8 A;  1COV 3;  3DXT A;  3FBY A;  5A32 B;  2ZGU A;  4Y4Y A;  2ZX4 A;  3EHK A;  2B46 X;  4BQ3 A;  3HWJ A;  3MF6 A;  1QF3 A;  2XQX A;  4GJY A;  3PTR B;  5EYY A;  1OOP A;  3TBD A;  1LEN A;  3POE A;  2LAL A;  4YW6 A;  4R9D A;  4QB6 A;  1IPS A;  4Q4V 2;  5F2W A;  3H9A A;  4WBB A;  4B3N A;  2B5H A;  2D97 A;  2X8K A;  1IHM A;  2C1F A;  2GC3 A;  5GLU A;  1N3O A;  4AQT A;  4B1M A;  4CDX C;  4CP9 A;  1G7Y A;  1XNK A;  2XPJ A;  1LR5 A;  3WQB A;  2JE8 A;  3NAP B;  2JE9 A;  3IDA A;  4OHW A;  3W59 A;  3POW A;  5DAV A;  5EQU A;  1O4Y A;  5C3S A;  3URF A;  5LA1 A;  4Q26 A;  2HWD 1;  1AYM 2;  2VOV A;  2VZT A;  4GMP 1;  1CWP A;  2XR4 A;  4DS0 A;  2E51 A;  2QQI A;  2CGP A;  3PLQ A;  4D6Q A;  3T1L A;  5I8Y A;  4JQR A;  1DP0 A;  1QU0 A;  3SCG A;  4IV3 B;  5EV7 A;  1SDW A;  4FQ4 A;  1BEV 2;  1MQT B;  2G19 A;  3X29 B;  1COV 1;  2JDP A;  2QE3 A;  5BNP C;  4QDS A;  5ISL A;  1SCR A;  2GH2 A;  1SLI A;  2XJT A;  2Y0O A;  2Y6J A;  4O9E A;  1LOA A;  1LOC A;  3R4D B;  4N7I A;  2VCM A;  4Y5Z 0;  5FKB A;  4ASL A;  3E97 A;  2IC1 A;  1XND A;  3AZV A;  2FCV A;  3NJX A;  4YGC A;  4AI0 A;  2YUE A;  2WJS A;  4FXG B;  5BXX A;  4RSU A;  4OI1 A;  1XSR A;  1CX1 A;  3AJZ A;  1FX5 A;  1TE1 B;  5H9R A;  4AVV A;  3Q8C A;  4FTS A;  5JOX A;  3I97 A;  1NLR A;  4BIO A;  5CFD B;  2BNM A;  3PHM A;  4DQA A;  4Y1U A;  5F5A A;  3LA3 A;  1KRI A;  4XBQ A;  1W03 A;  1RHI 3;  4J6G A;  3RFR A;  4ZS2 A;  4AK3 A;  5I0R A;  1PVX A;  5TSW A;  1H30 A;  1J59 A;  1A78 A;  4GAZ A;  1U5I A;  5HV4 A;  1O3R A;  2WNU A;  3POY A;  1MZ6 A;  1W6O A;  4XQD A;  2BPA 2;  1SBF A;  4LO8 A;  3SEE A;  3AM2 A;  2WLP A;  2B9U A;  1PMI A;  4WM8 C;  4GZ9 A;  2B39 A;  1AL0 G;  3VBO C;  4LLF A;  4N43 B;  1YNA A;  3HNY M;  5LEJ A;  2BWA A;  1I5P A;  3OBA A;  4BQW A;  4DOU A;  2QQJ A;  1ZBA 2;  1IKP A;  1TME 2;  1RUI 1;  3E5U A;  4FT8 A;  2VCB A;  1PNG A;  2JG8 C;  3A0K A;  4JGZ B;  4XUR A;  4AFA A;  4P02 B;  1AR7 2;  1VBE 3;  1SPP A;  3GHM A;  4YGB A;  4CYD A;  4LO4 B;  1UMI A;  3N35 A;  4HVO A;  3A23 A;  1FV2 A;  4LKD A;  4IV1 A;  4Y1V A;  1HXS 3;  4FOW A;  3BUC A;  3I3E A;  4YVW C;  1G86 A;  4QB2 A;  1GQP A;  2J1V A;  2YFZ A;  3VBH A;  2RR1 3;  5I0D A;  5L7O A;  5CNA A;  3OYW B;  1SCS A;  2WSU A;  4CU7 A;  1W28 A;  1LOF A;  3LEI A;  2OPW A;  4QM9 A;  4XCB A;  1RJ7 A;  4XF4 A;  5A80 A;  3GM8 A;  3JCI A;  1AJK A;  1RHI 1;  2P2K A;  1O6U A;  4QX8 A;  4DEV A;  4YZ1 A;  3H8R A;  1IZ3 A;  4Z82 A;  1ENX A;  1CD3 G;  2Z5W A;  2G9Z A;  1US2 A;  3KM5 A;  1ASJ 2;  2DDU A;  1NQJ A;  1WKY A;  3VBF A;  1S2E A;  3ZM8 A;  1E5H A;  4P5H A;  4CSW A;  1JMU B;  4NIH A;  4B1L A;  1OVP A;  2WQ4 A;  2XH6 A;  2GMP A;  3R6S A;  2D7F A;  2VZV A;  5GLW A;  2W47 A;  2WS9 3;  3FN9 A;  2FDF A;  1R08 2;  2EXK A;  3C3V A;  5FP3 A;  4PJY A;  4P14 A;  1WD4 A;  4F8A A;  5KWR A;  5FYT A;  4IE5 A;  4IW3 A;  4G4F A;  3OUI A;  1R09 3;  2VG9 A;  4BU2 A;  1QH6 A;  2VMF A;  1HXS 1;  1PM4 A;  2E26 A;  2EXI A;  2ENR A;  1H1A A;  1GNY A;  3LQC A;  2RR1 1;  1Y9M A;  2E7Q A;  2NP0 A;  2A70 A;  1H8V A;  5KC5 A;  5FYI A;  4Z1V A;  4HLT A;  4KQ7 A;  3K3O A;  4GH4 B;  4OFG A;  5KC6 A;  3LB9 A;  3S0M A;  3USU B;  4QMA A;  4Z07 A;  5ANQ A;  4QGL A;  2X5I B;  1OLM E;  3CJX A;  2LTN A;  3T1M A;  3LEG A;  1LHO A;  3H50 A;  2RJK A;  1RUJ 3;  1BZW A;  1H2M A;  1Q3E A;  5DQ0 A;  1RL3 A;  2BVV A;  3LGR A;  1GIC A;  1UPS A;  1S0E A;  2YBK A;  1NXM A;  3ZYH A;  1ACC A;  4JKM A;  4MG2 A;  4QPI B;  3VDC A;  4AI8 A;  1CES A;  1XNB A;  1FAT A;  2VNR A;  2WBK A;  5A7P A;  1SFY A;  2FD8 A;  2FZ1 A;  1VMF A;  5FDB A;  5AFB A;  4BK4 A;  5J37 A;  2WS9 1;  3ILR A;  2BGO A;  1C5H A;  2ZX0 A;  5IW0 A;  2EAA A;  3RYR A;  3WF1 A;  1EPZ A;  4BIS A;  5JPN B;  5FRE A;  1REE A;  2DUO A;  5FZH A;  2YFU A;  1R09 1;  2VM9 A;  1MVE A;  2X53 S;  4ATF A;  1CAU B;  3O1T A;  2P37 A;  4QKD A;  4Z8B A;  3INA A;  4AVA A;  4AF9 A;  1HLC A;  4PDW B;  2OUJ A;  4AAX A;  1UU6 A;  3LDK A;  3M3E A;  1VRH 2;  1XSQ A;  4AGG A;  4YPJ A;  2F4L A;  5FOB B;  4L9B A;  4E4D X;  3Q8B A;  3WNP A;  3MIE A;  4YW1 A;  1YXW A;  5A3L A;  2WZR 2;  4GMP 0;  1HRI 2;  1V6N A;  1AVB A;  5F3E A;  4QU2 A;  1AX1 A;  1PVC 3;  5M0T A;  2Q5T A;  1GWK A;  3ETP A;  2R49 A;  1YEW A;  2XJS A;  3RWK X;  2WNO A;  4HOO A;  1SDD B;  5C5T A;  2QVS B;  2EIE A;  2YDE A;  5T50 A;  3NKT A;  2EIB A;  2WFF 2;  3TNP B;  1E5S A;  5KR7 A;  3DF0 A;  5BNN A;  4X6Q B;  3H3Z A;  4ITC A;  4UWD A;  5DG1 A;  4YM1 A;  2QUO A;  1HN1 A;  1ULP A;  3FHI B;  1KQR A;  4RR3 A;  4QPG A;  4XC9 A;  3WIN E;  5FOJ B;  4RS5 C;  1S0I A;  3UKN A;  4KWU A;  4TXW A;  5BPX A;  2Y8K A;  3LPG A;  3FLR A;  4FTE A;  1UX6 A;  1VB2 A;  4XPV A;  2Y38 A;  2JKB A;  4P9J A;  4B4Q A;  5FZL A;  1JI6 A;  2DUR A;  5J3U A;  4KGQ A;  4AQ6 A;  1W6M A;  5JMO A;  3AMQ A;  2PXJ A;  3WR0 A;  1IOA A;  2KA3 A;  5FFO C;  3WF4 A;  3WDU A;  4BZ4 A;  5T5J A;  4LUM A;  2VMH A;  1GV9 A;  5JIA A;  4YZ5 A;  3H7J A;  2D43 A;  4MLO A;  3D8C A;  4CEY B;  2D6M A;  4YW2 A;  4YZ2 A;  3HIF A;  2QBX A;  2WZP P;  2P17 A;  4N53 A;  4HN1 A;  4D7Y A;  3WDV A;  4IGO A;  5F5Q A;  5DN2 A;  1CAW A;  3CU7 A;  4XIO A;  2RS5 3;  3ST7 A;  5KHG A;  2JDZ A;  3CIH A;  4IV3 C;  5DAX A;  1K5M C;  2W46 A;  1NCQ C;  1PVC 1;  2P34 A;  4QQP A;  4BQ1 A;  2WWU A;  5E88 A;  2ZTN A;  2J42 A;  1XNC A;  5A3W A;  2GH8 A;  3LEM A;  2RDN A;  4LBL A;  1R1A 2;  1QIQ A;  5LRR A;  1OD5 A;  3D6E A;  1D4M 3;  1W9F A;  1QQP 1;  4QDQ A;  2PN5 A;  1UU4 A;  2UY8 A;  4QXC A;  4FOV A;  1QGL A;  1AXK A;  3ZKU A;  2R32 A;  3ZFE A;  2VUD A;  3S30 A;  1YJK A;  2WT2 A;  5C71 A;  4GJZ A;  1VAV A;  2WAO A;  3AMH A;  5E8A A;  3POG A;  3UKV A;  2VH9 A;  5A33 A;  1PGL 1;  1VBD 2;  5A3T A;  1ODN A;  1NOV A;  4RQP B;  3GBF A;  4A41 A;  2VBP A;  2WNV C;  4URA A;  1PGW 1;  3I3Q A;  1BBT 3;  2GC2 A;  1OKO A;  5C5U A;  5A32 A;  4COZ A;  4AR2 A;  1PK6 B;  1JOJ A;  1W9W A;  4WM7 C;  3AFK A;  4XFF A;  4XUO A;  1ZNP A;  5F32 A;  4A2U A;  3RRD A;  3W5M A;  1G8W A;  1RUE 2;  1NAE A;  3TOJ A;  3O1U A;  1MPX A;  1IS3 A;  2J1E A;  2RM2 2;  2BU9 A;  3DKQ A;  3IDC B;  3S6P A;  5IFP A;  5ACA 1;  2ET1 A;  3MID A;  4ZKT B;  4QX2 A;  2OVU A;  5C3R A;  3C8X A;  1LB2 A;  2WAA A;  4N43 C;  4A7Y A;  4Q0Q A;  4OI0 A;  2AH2 A;  2VAU A;  3N9P A;  5FZK A;  5GLT A;  5JR7 B;  3GNE A;  1JZ7 A;  3ZN4 A;  1UY2 A;  5F3I A;  3SH5 A;  1HDK A;  1JW6 A;  3NAP A;  1S0G A;  2ZML A;  1ZRC A;  4QQO A;  3B00 A;  3J8F 2;  1ZBE 3;  3BB6 A;  5BUV A;  1CZT A;  4LBK A;  4XF1 A;  4AZZ A;  5GZE A;  2W1S A;  1AR6 3;  3QH7 A;  3JBG 2;  1XB9 A;  2HWF 2;  5GZD A;  4FBF A;  4NRP A;  1S0J A;  4M3C B;  3ZYJ B;  3VZM A;  3AP7 A;  5T5O A;  3WNK A;  2ZGS A;  5I0T A;  1JUH A;  2BEO A;  3V56 A;  1S2B A;  1AR8 2;  4IV3 A;  1MQT A;  3N7J A;  2VBD A;  5FAX A;  2X29 A;  2CDO A;  3AKT A;  1IS5 A;  1BYH A;  1J84 A;  1XYO A;  4BM8 A;  2YPJ A;  2HLE A;  2WT0 A;  2WRA A;  4CP9 B;  3LA7 A;  4XF0 A;  3AXE A;  4LO7 A;  2HBT A;  1REF A;  2ARE A;  2CNA A;  2ZGN A;  1PO1 3;  2DCK A;  3ZXA C;  4XET A;  4IL7 A;  4MHU A;  4YGE A;  4U36 A;  4N7U A;  3OPT A;  1ULG A;  2VZ1 A;  3WY6 A;  2XXZ A;  2ZA9 A;  2GNM A;  2D3R A;  3GYD A;  2R06 3;  1ODM A;  1OA4 A;  3LDR A;  3CZJ A;  2AC1 A;  2P3J A;  1Q8P A;  1ST8 A;  1YIP A;  2PLV 3;  2ZEX A;  1FPN 1;  3OTF A;  3POS A;  2E7T A;  3PVB B;  4KWL A;  1VP6 A;  5C3Q A;  2PQQ A;  4IUG A;  3WV6 A;  1WMX A;  1JN2 P;  2ZHM A;  1UX7 A;  5FZO B;  2BER A;  5CFD A;  4AL9 A;  3ON7 A;  2BFU L;  5A6Z A;  1VBC 2;  5F8P A;  2D6L X;  2ORZ A;  2WO2 A;  3AXD A;  1H9P A;  4NAM A;  5ABJ A;  1Q56 A;  2W68 A;  2OX0 A;  5C8C A;  4ET7 A;  4KI5 M;  1W9T A;  3MO4 A;  5H9P A;  4CP1 A;  1WLT A;  3WHT A;  3DGT A;  4XQ4 A;  2XUM A;  4QDR A;  2GP3 A;  3RYP A;  2WR9 A;  3WCS A;  2QQP A;  3DYP A;  4JGY C;  3HN3 A;  3UGF A;  4XXP A;  4GH4 C;  2KD7 A;  4P9G A;  3GHN A;  4N43 A;  4JKK A;  3I2F A;  4E27 A;  3KMH A;  5FZ4 A;  5HI0 A;  5FP4 A;  5CKN A;  4ZPI A;  1ULF A;  3D82 A;  5DUW A;  2PHT A;  4JGZ A;  1EAH 3;  1EV1 3;  2VNV A;  2WII B;  4IES A;  1LKN A;  5FPZ A;  3ACH A;  4LQR A;  1XBF A;  3U4X A;  2H0V A;  4NR1 A;  4GWM A;  3ZYR A;  4Y1X A;  2MEV 2;  2NMO A;  1XJA A;  4FPK A;  3WNO A;  1LRH A;  2VNG A;  2RDS A;  2R06 1;  5FK7 A;  3E5X A;  3BTY A;  2PLV 1;  1Q43 A;  1FT9 A;  3ZYB A;  3ZXF A;  1T6B X;  4ARY A;  2WNU B;  3OYW A;  4AI3 A;  2QKD A;  2A3X A;  1N1S A;  3WG1 A;  4OUE A;  1HW5 A;  2B4K A;  3UK9 A;  1OH4 A;  4CDQ C;  4XUP A;  5H9Q A;  5FO7 B;  1MS0 A;  2CWM A;  4IEQ A;  4B7E A;  1RGS A;  1GR3 A;  1WCQ A;  1XU2 A;  2ARC A;  5IUQ A;  1M4W A;  3TN9 3;  3VBS B;  2RHP A;  4E9K A;  1ND2 B;  5A3N A;  2FDK A;  4LHK A;  3J7H A;  1XRU A;  1DGL A;  3PNA A;  1JYN A;  3HBZ A;  2CWS A;  4NHM A;  2CGN A;  3OPZ A;  4RN5 A;  2W1U A;  4BYY A;  3ZIW A;  2EVX A;  3NNG A;  4I3P A;  5HV0 A;  1H8T C;  1PIV 3;  3AYA A;  3OY8 A;  1B09 A;  4HG6 B;  4LK6 A;  3I2I A;  4OYU A;  2YY1 A;  3W9A A;  2V73 A;  1O3S A;  1V6J A;  3VBH B;  5FPL A;  3UJO A;  1RMU 3;  1WGP A;  3T30 A;  3K4Z A;  1X7N A;  1LGB A;  3FUO A;  4XOG A;  3LOI A;  1W8N A;  3MIB A;  2UYA A;  3M70 A;  3VD3 A;  4CCL A;  5IAX A;  1Z0H A;  5JXI A;  2R1D A;  2FCT A;  1GOF A;  1F31 A;  1A6C A;  1IQD C;  1Y9G A;  3KT7 A;  1RUG 3;  1UZ0 A;  3A4U A;  3RG0 A;  3S5Q A;  5CU1 A;  2MPF A;  1RUF 3;  4GH4 A;  5FZD A;  5F3C A;  4HKO A;  1RXF A;  2VUJ A;  4DRR A;  4K8F A;  1E57 A;  2ZKN A;  4QHZ A;  4Q8K A;  4FTB A;  3USU A;  3O1O A;  5JUV A;  2W5F A;  2X5I A;  3WNM A;  4MXV A;  1V6I A;  3K3N A;  3U4S A;  3WG4 A;  1W2U A;  1G9C A;  3WHU A;  2W1Q A;  4CCN A;  4C90 A;  1B35 C;  1RUC 3;  3VV1 A;  2BNN A;  4BK5 A;  1AF9 A;  3TN9 1;  4YVS C;  4EV0 A;  5LZ6 A;  3I3M A;  4DXZ A;  5FZB A;  2WYF A;  2JDU A;  5BNO A;  3WLU A;  2VZ3 A;  4XHX A;  4M3C E;  4Q4W 2;  1VLN A;  1JYT A;  1BVV A;  4QPI A;  4QAW A;  1GNZ A;  1PIV 1;  2P5B A;  3AK0 A;  5IWF A;  5HCF A;  4YSF A;  2YG0 A;  1W6Q B;  3BGA A;  4FI9 A;  1ULC A;  5FZF A;  4D7T A;  2GNT A;  1LES A;  5FMB A;  2Z79 A;  3ZSL A;  2CY6 A;  1RMU 1;  5SV5 A;  1GUI A;  3EQE A;  2OW4 A;  5J96 B;  3RJR A;  2P6H A;  4NII A;  4D0Q A;  4E2Q A;  2D3S A;  3AP5 A;  5CBL A;  3UET A;  3WDW A;  1V9U 1;  1YFX A;  3M3I A;  3NV4 A;  1HV1 A;  2QCS B;  1EPW A;  5IVC A;  2XWB B;  3RYK A;  1CAU A;  2ZEW A;  5EYX A;  4H3W A;  5A3U A;  2GNB A;  2VNO A;  3O1M A;  1ZZ8 A;  4C0H A;  1GZT A;  4PDW A;  2OZJ A;  5APA A;  2XWJ B;  2ES3 A;  1UL9 A;  3CJI B;  4RQP C;  4YM2 A;  4NPR A;  4YNI A;  5FYB A;  1RUN A;  2DVD A;  1V6L A;  1PK6 C;  4K9S A;  3VZL A;  1JYC A;  2LM3 A;  4GB3 3;  2AUY A;  3U78 A;  4B8E A;  1BMV 1;  1RUC 1;  4Q4X 1;  2W3J A;  2RV9 A;  2I07 B;  1UY1 A;  4KBZ A;  3NKG A;  3S57 A;  3POF A;  2JXA A;  4XTP A;  3MW4 A;  4LR4 A;  1YLL A;  4L0P A;  4XDO A;  5GJ6 A;  3WP6 A;  1AHS A;  2ZGL A;  5JSP A;  3BU0 A;  5K7P A;  3V0B B;  4UBH A;  1S4C A;  3OEB A;  5F5I A;  3ROU A;  5KBF A;  1RIT A;  3KV4 A;  3OPW A;  4J1W A;  4P5Y A;  2H6B A;  3TAY A;  4DPN A;  1QJX 2;  3AZX A;  3EJK A;  4CUB A;  4CEW C;  5IAT A;  1DG6 A;  3GZA A;  4IND A;  1IS4 A;  1AR9 2;  3FLP A;  5C4W B;  5CFC C;  2R04 3;  1LAJ A;  2IXC A;  1BK0 A;  3JB8 A;  4IXL A;  2RDR A;  3O5S A;  4AAP A;  1QXJ A;  3I54 A;  2JDY A;  5JDB A;  4K21 A;  4L97 A;  1VBA 2;  4CEY A;  2RJL A;  1WZX A;  4P9W A;  5L9V A;  4UW3 A;  3S5A A;  5DAP A;  1CVN A;  1PO2 3;  4Y26 A;  3LCP A;  3EBR A;  1CIW A;  5LK7 B;  1JYX A;  5CG9 A;  3WUD A;  3TWI A;  2HYK A;  4DIQ A;  4SLI A;  2RMU 3;  3RZZ A;  3WX5 A;  4JX0 A;  4BMB A;  1VR3 A;  1LU2 A;  3HMY A;  2R7E B;  5FWE A;  2V4A A;  4KU7 A;  4MH0 E;  2QQV A;  4GB3 1;  1QJY 2;  5CIS A;  4WVM B;  5EWS A;  2ERF A;  2A7A A;  4CP2 A;  4NE9 A;  2PAM A;  2VZQ A;  4NRO A;  2LW8 A;  3SH4 A;  1LU1 A;  4MX3 A;  2BQP A;  1UQX A;  1NCR B;  2VQU A;  4IEO A;  4KH9 A;  1LHW A;  1IQA A;  3DPR B;  3PUA A;  1Q8S A;  3MHZ A;  1NA1 B;  3HBK A;  1FOD 2;  1OVS A;  5A6Y A;  4OHZ A;  2XJQ A;  1O59 A;  1UO9 A;  1OFS A;  4XEZ A;  2ARB A;  4AFC A;  4XJZ A;  4QXK A;  2R04 1;  4IEX A;  4SBV A;  5FP8 A;  5FY9 A;  3GDB A;  2X09 A;  4AFB A;  4NN0 A;  2AR6 A;  5EIY B;  4V2V A;  1UOB A;  2WLQ A;  2B9V A;  5JCT A;  1RB8 G;  4FFF A;  3U11 A;  2WYS A;  5J48 A;  3WUC A;  5GLZ A;  2R1B A;  2VXR A;  1C8M 2;  3NWK A;  1PO2 1;  2DVF A;  4PI0 A;  4PIX A;  5FY5 A;  4COY A;  4UT5 A;  3Q8F A;  4A45 A;  4Q8L A;  1FMD 2;  1UYX A;  2RMU 1;  4N9I A;  3VHO A;  4AW7 A;  2HWD 3;  1X8M A;  2GZW A;  2VQT A;  1U12 A;  2VMD A;  1V00 A;  3IDB B;  4GMP 3;  3I49 A;  2OUH A;  4LOR A;  1UOG A;  1RUO A;  1MZF A;  2IXI A;  4LUL A;  3VBU A;  4WZC A;  5FUN A;  4K7J A;  2YHJ A;  2VEC A;  5CG8 A;  5IFT A;  3R4U A;  1NE6 A;  4OQ9 A;  3HQX A;  5JLV A;  4AGR A;  5D1I A;  3WQ7 A;  1ZA4 A;  3J26 N;  4Q5O A;  5A3P A;  1UU5 A;  1MVQ A;  3PUR A;  4M3C A;  1BXH A;  2XLA A;  3TNQ A;  3RMX A;  1MR5 A;  2WNU C;  4N90 A;  1C5I A;  4Q29 A;  4B29 A;  1HRV 2;  1YFU A;  2EA7 A;  4COV A;  4MV2 A;  3VD9 A;  2VD7 A;  2JDH A;  4I0B A;  4M0N A;  4Q4V 1;  2G9F A;  3BVC A;  4IQP A;  5LY1 A;  1JOD A;  1Q8V A;  3BOD A;  5K4L A;  1GBG A;  2VTX J;  3MLL A;  3HT1 A;  4O61 A;  5AC9 3;  4Y4R A;  2OQ6 A;  1SLC A;  5CZK A;  3IT8 A;  4QGN A;  1NY7 1;  2D44 A;  3IAP A;  4XHB A;  1AXZ A;  1W0N A;  4UFI A;  1PHM A;  3HPN A;  5F7U A;  4DFS A;  5F37 A;  1AYN 2;  2DCT A;  1OH3 A;  2B45 X;  4IEY A;  2P3K A;  3POB A;  4OUL A;  2W94 A;  4UI9 L;  5T5P A;  2JIC A;  4DMI A;  2D40 A;  4CXY A;  3A22 A;  4IV1 C;  3C7O A;  1FNZ A;  2JEC A;  4YAR A;  2FDJ A;  1CN1 A;  2BUK A;  3O0V A;  2HWE 2;  3FWE A;  1WLD A;  4IE0 A;  1KXG A;  5DZG A;  5FZG A;  1R64 A;  1TMF 2;  3FE5 A;  2E9Q A;  3VBH C;  5FZO A;  3VBR B;  4Y5T A;  1EUU A;  5L7O C;  4JV4 A;  1GAN A;  4NWV A;  2XL9 A;  3ASI A;  5BV6 A;  2DTW A;  1F35 A;  1LOF C;  3HQR A;  4P9Y A;  4O9G A;  1BEV 1;  3KV9 A;  4Q1R A;  2VJX A;  5FYH A;  4ORF A;  3AZY A;  2XKO A;  4NHX A;  5I8S A;  5HCA A;  1S2K A;  5FY0 A;  3M3Q A;  1VRB A;  3POI A;  3QOP A;  4XFB A;  1RUI 3;  3FLT A;  4UFM A;  5IVV A;  4BXF A;  1IKQ A;  4DEQ A;  4OQ8 A;  3VZO A;  4PIY A;  3MIG A;  1DQ2 A;  1KS5 A;  1POV 0;  1UMH A;  1V6M A;  3PIJ A;  3VD7 A;  4Q4Y 2;  1XNA A;  5CAZ A;  4JTO A;  1WUV A;  2ADE A;  5FZ8 A;  4R9C A;  3VBF C;  2ZHN A;  1KFX L;  1DZR A;  2HWB 3;  5C9A B;  3VDB A;  1I6X A;  2C26 A;  4YWA A;  3BCW A;  4MXW B;  4BLJ A;  4KL1 A;  5JZG A;  3HNM A;  2V72 A;  3KCY A;  4BDV B;  3VUO A;  3ES4 A;  5D8A B;  5L9R A;  5AC9 1;  3AJY A;  5CEH A;  2DBI A;  4RHV 3;  3C7F A;  4LA2 A;  4LPL A;  4TSV A;  1QXP A;  3POJ A;  2RS3 3;  2V4V A;  2Q4S A;  1COV 2;  4O65 A;  1WMF A;  3MLK A;  5FRA A;  5GM0 A;  4C91 A;  1RTV A;  4DO0 A;  3WP4 A;  5ABJ B;  3GAL A;  1ND3 B;  4GA9 A;  4K8R B;  1W8U A;  2NPI A;  3HJR A;  3JD7 2;  1DGR N;  2A5Z A;  5C8C B;  2WC2 A;  3HD8 B;  4DY3 A;  2V09 A;  1QNW A;  1ENQ A;  2A71 A;  4IER A;  5FP9 A;  2LRO A;  1VE0 A;  2VVE A;  1NYW A;  4LOT A;  3ZMN A;  4M4P A;  2FMD A;  4R4X A;  1HJG A;  3MFA A;  4RFR B;  1KS4 A;  4ASK A;  1TME 1;  3VDD B;  4XAB A;  1R08 3;  2D6O X;  1WMD A;  1ND2 A;  2VU9 A;  4BJ0 A;  4FPG A;  5JOW A;  3ZYG A;  3T09 A;  1ONA A;  1JZ3 A;  1GQH A;  4HON A;  2W9X A;  5DAW A;  3SLI A;  4AVB A;  4ISR A;  1OUX A;  5KXE A;  2ZHL A;  3M2M A;  4UYB A;  4BME A;  2J1R A;  4HPK A;  1GP6 A;  2HWB 1;  3SXW A;  1LGN A;  3PUQ A;  4XFC A;  4UOJ A;  1ZZC A;  3N7M A;  4Q27 A;  4RA0 A;  3THP A;  2O8O A;  3BU7 A;  4N8M A;  2NN8 A;  1UKR A;  2JG9 A;  4H55 A;  4A3Z A;  4RHV 1;  1QJF A;  2ZGM A;  3CL1 A;  2OXB A;  5JI7 A;  3MLJ A;  1X36 A;  1W8W A;  1RC6 A;  2RS3 1;  2IZW A;  1CX4 A;  2R07 3;  1DZT A;  3SH3 A;  1MS5 A;  4Z2W A;  1W8F A;  1YQ6 A;  3PJQ A;  4LUK A;  1ASJ 1;  1AJO A;  1J3R A;  4MGY E;  4XUQ A;  2BBV A;  3P1I A;  4MGQ A;  5K0U B;  4LLO A;  4FO9 A;  4PT6 A;  3VKN A;  4XBL A;  3RI9 A;  4Q0U A;  2Y0I A;  2OQ7 A;  1UD1 A;  3H8U A;  3OY8 B;  2CU5 A;  4QWN A;  3LAG A;  2A6X A;  3OUJ A;  5J09 A;  2VCA A;  4RL7 A;  4CU8 A;  4O7X A;  2F6B A;  1WW6 A;  1JHN A;  2ZEY A;  3MFC A;  1R08 1;  1IG0 A;  5C6C A;  5HBA A;  5LAS A;  5IVY A;  5A3M A;  4JHT A;  4YGD A;  5JVV A;  3UNP A;  1FYU A;  5FZE A;  4AEJ A;  5BNN C;  1RHI 2;  3LD8 A;  1TG7 A;  4ERO A;  2NQY A;  4RR3 C;  3IB3 A;  4QPG C;  2ORX A;  1W6Q A;  1AL2 2;  1OMI A;  4XIL A;  3ATG A;  3RJ2 X;  1H2K A;  4NIA A;  3THD A;  3VZJ A;  2NLR A;  4XW3 A;  5L9B A;  4DZG A;  3U07 A;  1O8S A;  1JU4 A;  4EYU A;  5FUI A;  3KV6 A;  1SEF A;  4TZD A;  1HQW A;  2UWC A;  4LBQ D;  4AWD A;  4XJ9 A;  2Y6L A;  2BFU S;  5A7W B;  3WW2 A;  1DQ1 A;  3VDA A;  2VZS A;  2VZU A;  2Q8O A;  2LS6 A;  3H8O A;  3AMP A;  2R07 1;  2XVG A;  2DU0 A;  4KU8 A;  2OZ6 A;  4EZ4 A;  1H6Y A;  4DRV A;  5JSR A;  5FPX A;  5JXH A;  3KCC A;  4LJH A;  4XAA A;  3WT3 A;  3CJI A;  3ZYI B;  1VBE 2;  4FSJ A;  2XON A;  5F9T A;  5F1R A;  5BNO B;  1I5Z A;  1DQ6 A;  2XJP A;  4FFH A;  4N53 C;  4OI2 A;  4YFW A;  1YFY A;  5DZE A;  1N1Y A;  3ZVX A;  4BPZ A;  1HXS 2;  3UGG A;  1YI7 A;  2PHX A;  4GUL A;  2DUP A;  2XBO 2;  4LKS A;  2RR1 2;  4HK9 A;  2XUE A;  3G6J B;  3KF5 A;  4GWN A;  1O5U A;  1JZ2 A;  1J1T A;  1TEI A;  4BA6 A;  2WIN B;  1UWW A;  3IZO A;  5I0S A;  4GXL A;  5L73 A;  2DU1 A;  2QZ2 A;  4HET A;  2XKP A;  3EO6 A;  4FOQ A;  4JAA A;  3WG3 A;  2YBP A;  2JKX A;  3A0N A;  2WUH A;  3KT1 A;  3V0B A;  1MS4 A;  1WA6 X;  3ZFE C;  4LHL A;  2EIG A;  4EN0 A;  1R1Z A;  2DUQ A;  1VRH 1;  3AVS A;  1DGW X;  1DYP A;  2VUC A;  2JDM A;  4F83 A;  5C4W A;  4GQ7 A;  5FO9 B;  4D3W A;  1OD3 A;  1N1T A;  2YB7 A;  5T5L A;  2Q1Z B;  1CJP A;  2K2S A;  1C1F A;  1R1A 3;  3KHB A;  5FYU A;  2FBE A;  1XQN A;  1OUR A;  1URX A;  4XFG A;  3GCW A;  3K4A A;  4I02 A;  4XMI A;  1QQP 3;  1ZZ9 A;  4G9S B;  3RZK A;  3ETQ A;  2R0F A;  4PIZ A;  1UKG A;  2DYC A;  1SFN A;  4HSL A;  4P9I A;  3CBN A;  3PVE A;  1TVG A;  1R09 2;  1U0A A;  2OA2 A;  2P3Y A;  4WVV A;  4BLI A;  2WA3 A;  2C9A A;  1ULE A;  2EXH A;  2XML A;  3I2H A;  3E6D A;  3ABZ A;  4OLL A;  5A1F A;  4XJW A;  1PM7 A;  4WVM A;  4AGV A;  3ZN6 B;  3CF6 E;  1IPJ A;  3WQ0 A;  3NAP C;  5F5C A;  3KV5 A;  1SLB A;  2YMZ A;  1RUD 2;  1O4Z A;  2D5H A;  2Z42 A;  1POQ A;  3DL3 A;  4HL0 A;  1WCS A;  3IPV B;  3OGV A;  1NCR A;  2WNE A;  2ZGT A;  2IUW A;  1QHD A;  4CPB D;  1YC6 1;  3DPR A;  1J3P A;  1W0O A;  3VHR A;  3NMB A;  1NA1 A;  2EIC A;  4HBN A;  1BJQ A;  5F6L B;  1W04 A;  3MYX A;  1RUJ 2;  2QTW B;  5ACA 3;  4JC1 A;  1JU3 A;  3FMG A;  2DBN A;  2UU8 A;  2YRO A;  4KG8 A;  4QPY A;  4D8M A;  4HKL A;  2YZ4 A;  3A21 A;  5G05 L;  5JOY A;  3WDT A;  4Y33 A;  2PEL A;  3J7L A;  3LOB A;  1QOO A;  3ZIX A;  1MQT C;  3THT A;  1X82 A;  1R1A 1;  4Y24 A;  5DUV A;  5KXD A;  3KD4 A;  4QPW A;  4ISQ A;  3I3B A;  3KGL A;  4H2A A;  5A3O A;  3SNM A;  3RZL A;  3JBG 3;  2QFE A;  1V70 A;  5EJ1 B;  1OA3 A;  1AX0 A;  1QJU 3;  5LA0 A;  5K8S A;  1WW7 A;  2D6P A;  1WLC A;  2BW8 A;  1XYP A;  1YO8 A;  2VW1 A;  2GME A;  3IMM A;  4BQ2 A;  2ZHK A;  2PFW A;  3DKW A;  4AEM A;  1X9T A;  4CDW B;  1ZRF A;  5I91 A;  3K51 A;  5CIR A;  4QT6 A;  3LIH A;  2WWJ A;  4NPL A;  2XHK A;  3WG2 A;  2HWC 3;  3QBQ A;  4XUN A;  5A6X A;  2WT1 A;  4F7Z A;  3B9C A;  3K77 A;  1SZB A;  2JEN A;  2B7Y A;  4LBN A;  3RWN A;  1PVC 2;  5CFD C;  1XYN A;  2HEV F;  1TQ5 A;  5DDJ 3;  2JE7 A;  4E8C A;  2GAU A;  5ABJ C;  4Y5S A;  2X05 A;  4DXS A;  3VHN A;  3N9N A;  2G1M A;  3B01 A;  3I7D A;  5DG2 A;  3ZN5 A;  5FXX A;  2D93 A;  5C8C C;  1W3V A;  2EF6 A;  5JPM B;  1FAY A;  1ZRI A;  3THC A;  2WN2 A;  3VZN A;  4OI4 A;  1W2O A;  2XQR A;  2I45 A;  3CKH A;  5FYC A;  2ETE A;  1C57 A;  1FPN 3;  2IVJ A;  5IHR A;  2VPV A;  4KWJ A;  4DUV A;  2FDG A;  4ZU5 A;  2BYV E;  3EYP A;  4YW4 A;  2E6V A;  3J8F 1;  3WD5 A;  5GAL A;  4JGZ C;  3SCF A;  4AED B;  3VBU B;  3D4K A;  3U1X A;  1Q5O A;  2BGP A;  4AQS A;  1OLM A;  3JBG 1;  5CYY A;  2WQZ C;  1MS3 A;  1QJU 1;  2VOT A;  3VL8 A;  4XYX A;  4LBQ B;  2GAL A;  1BLZ A;  1WD3 A;  3NNL A;  5GLV A;  3VBR A;  2VBB A;  1APN A;  1JYI A;  4XBN A;  4JDO A;  2ET7 A;  1QY4 A;  4LEJ A;  1W2N A;  2HWC 1;  2RS5 2;  3KCX A;  1QOT A;  5LK5 A;  5DUX A;  5T52 A;  1US3 A;  4JCK A;  2ZGQ A;  2D98 A;  3F2Z A;  3DN7 A;  1LOE A;  4Q2F A;  1CQ9 A;  3S7I A;  5DDJ 1;  2Q0A A;  2CV6 A;  3PVN A;  4FFG A;  3ACL A;  2WDB A;  1UZZ A;  1GU3 A;  1D4M 2;  1KFU L;  2MEV 3;  1ZVF A;  4TLF A;  3M8L A;  1OQ1 A;  1CIY A;  3AKQ A;  1YRZ A;  1NQD A;  5F3G A;  2UYB A;  4XMA A;  5C9A A;  5A70 A;  1GFF 2;  4MXW A;  3M4F A;  3IWZ A;  1U5X A;  5GZC A;  2VUA A;  3AKR A;  2DF7 A;  5D8A A;  1NG0 A;  2DFB A;  4ZXK A;  3U37 A;  1JHJ A;  3PVO A;  2ARX A;  4JHZ A;  1UAI A;  4NIG A;  5EZW A;  2H6C A;  1KDK A;  2XLG A;  4LHS A;  2QDN A;  1H4G A;  1BBT 2;  3I2D A;  1W8H A;  3TYJ A;  2IXJ A;  5FMO S;  2RS1 2;  2A6Y A;  4HT1 T;  2W92 A;  1ND3 A;  2WO1 A;  1S0F A;  4IEZ A;  5LWB A;  3TRS B;  4YFZ A;  2W52 A;  3LSE A;  2XDV A;  1U5Y A;  2K0G A;  3ZO0 B;  3PUS A;  3AYC A;  2DCJ A;  2E31 A;  4IDZ A;  4I09 A;  3NV3 A;  5A7Q A;  3AX4 A;  3O1R A;  3U75 A;  2R0H A;  2ZBJ A;  2L9L A;  4ZHN A;  1W99 A;  4CP0 A;  3LE0 A;  1L7L A;  3QCW A;  4YM0 A;  4CDU B;  4CCJ A;  2YU1 A;  3NQH A;  4IEU A;  3WP5 A;  2VTX A;  5IK4 A;  3VDD A;  5JZG B;  1S0B A;  3VN4 A;  1QNY A;  2X5I C;  2ZCW A;  2J1A A;  3ZMO A;  5FZ3 A;  4HK8 A;  5FQ0 B;  1GYK A;  5FXV A;  1M06 G;  1ZBE 2;  1IPK A;  2MEV 1;  4Q0S A;  4P08 A;  3GXU A;  3RPQ A;  1A34 A;  2C6S A;  4IE4 A;  1VB4 A;  4LBM A;  4AG4 A;  3ZXJ A;  5BNO C;  1AR6 2;  4Y22 B;  1NE4 A;  4LXL A;  1UYY A;  4QPI C;  4E2S A;  2A3W A;  3AL5 A;  1UYZ A;  2HEW F;  2QQL A;  4OUM A;  5FPA A;  4YYO A;  1WBL A;  3T0A A;  1KDM A;  3KVB A;  1LOD A;  2ADD A;  1K5J A;  1RYY A;  2HKX A;  3GF6 A;  3QD6 A;  4J1X A;  3JB4 C;  5CKQ A;  3AB0 A;  1W8O A;  1DBN A;  3C2U A;  3E6B A;  3OJB A;  3SEP A;  1D0H A;  1GSL A;  4IEV A;  2OKX A;  1T6G C;  1QOS A;  1DYO A;  4Q4W 3;  1GWL A;  1OUS A;  3III A;  1MEC 3;  1PO1 2;  3CDZ B;  4XCA A;  1PMH X;  5K0U A;  4PDW C;  1PZ8 A;  3GGL A;  3W5N A;  3KZ4 C;  1BVP 1;  4HMZ A;  3IN9 A;  4ZY9 A;  2VE1 A;  5FZI A;  4FAH A;  1YQ8 A;  1ZX5 A;  2PLV 2;  4HPK B;  1DGW A;  2ZGP A;  5C8W A;  1WCU A;  4YW5 A;  1F8V A;  1HV0 A;  1N1V A;  4URT A;  1PX3 A;  2JG9 B;  2PYT A;  3ZX7 A;  3RMY A;  3CNA A;  2NYY A;  1V9U 3;  2DVA A;  2MNG A;  1POV 3;  2A75 A;  2X10 A;  4MGT A;  2E7A A;  1JTZ X;  3FHA A;  4XIK A;  4EN7 B;  1XPW A;  3ELN A;  2ZXQ A;  1G6N A;  4MOA A;  3JZV A;  4QXH A;  1Z7S 3;  2GND A;  3NNM A;  2O0O A;  4MGZ E;  1E5I A;  3OGS A;  5E6H A;  5L19 A;  1QWR A;  1UOF A;  5A7W A;  4TLG A;  3WP3 A;  5B2G B;  5LW9 A;  3KHC A;  2VTF A;  3H1M A;  5JR2 A;  3KSC A;  1GOG A;  2Y26 A;  3KF3 A;  4JVA A;  1EAH 2;  1EV1 2;  4Q4X 3;  2ARA A;  2VW2 A;  4NAO A;  4CEY C;  2CHH A;  1D2S A;  4Q4W 1;  1MEC 1;  4XXA A;  1Q8Q A;  5BNP B;  5LB6 A;  4Y3O A;  2P1B A;  4HN0 A;  4I3G A;  4YRD A;  1RUH 2;  4PBP A;  4FCA A;  5A1A A;  5LRS A;  3VL9 A;  4IE6 A;  1DHK B;  2J1S A;  4D94 A;  5JIU A;  4AQ2 A;  3CZU A;  1Y43 B;  2A3Y A;  4CUC A;  4B4R A;  1DQ0 A;  3R0R A;  4I2O A;  4QHB A;  4UW4 A;  4FPO B;  3MIF A;  3QLQ A;  2E63 A;  1QMJ A;  3D0J A;  5LBE A;  3LF7 A;  3DV8 A;  4PF5 A;  1POV 1;  1U5Z A;  1XE7 A;  3NW4 A;  1AZD A;  3I3D A;  4LBO A;  5FZC A;  4CTE A;  3TN9 2;  1PZ7 A;  1JZ8 A;  2V5Y A;  3B93 A;  3H1Y A;  5KHI A;  2G4I A;  4CUA A;  3BIE A;  3AMM A;  1FNY A;  4UW6 A;  1Z7S 1;  4XFI A;  5JOZ A;  4KMQ A;  5KHK A;  2ZX3 A;  1PIV 2;  3PU8 A;  4E2G A;  4K1Y A;  1H9W A;  1HKD A;  3T2O A;  1F4A A;  1XE8 A;  4BH9 A;  4CZS A;  1LHN A;  4EJR A;  4EE2 A;  2VL4 A;  2AEN A;  3KB5 A;  4LIU A;  4Q0V A;  4WM8 B;  4FP2 A;  3B3Q E;  4PLN A;  3G7D A;  3P3P A;  3VBO B;  1BKZ A;  2R30 A;  2W0X A;  2W39 A;  4OMC A;  3DYO A;  3NVC A;  4XUT A;  3MGU A;  1YJL A;  1A8M A;  2Z4F A;  2JG8 B;  2VZR A;  1SLA A;  2CAV A;  2ZAC A;  1ZM1 A;  3UKT A;  2RG4 A;  2ZGO A;  2AZ5 A;  5FK8 A;  4BHP A;  1JZ5 A;  1FOD 3;  5GZF A;  1FXZ A;  3V65 A;  5I0U A;  1RUG 2;  4RGG A;  1RVF 2;  4UFL A;  1RIN A;  3ZN6 A;  1AR9 1;  3AKP A;  2PTM A;  2WA4 A;  3ZR5 A;  3BI3 A;  1GMM A;  4YVW B;  3IBM A;  1RUF 2;  5IVF A;  4PHZ A;  3VBU C;  2FDH A;  1OFN A;  3VBS A;  4Y20 B;  5JWP A;  2GN7 A;  3JUU A;  1SMV A;  3IPV A;  4NMI A;  4DXR A;  4HSJ A;  5D2A A;  4K6B A;  2VQ0 A;  2YC0 A;  1HJF A;  2VVD A;  4EWA A;  1H1I A;  1PNF A;  1BMV 2;  3MDP A;  1QJZ A;  2QQU A;  3NO8 A;  5LAT A;  2C24 A;  3ZFG B;  1ZRE A;  1YWK A;  4CUG A;  2OS2 A;  3PMS A;  3WSO A;  2AEY A;  5GZG A;  1J58 A;  5FPV A;  4PQQ A;  3UES A; 
#chains in the Genus database with same CATH homology
 2XXZ A;  3DXT A;  4V2V A;  5FZB A;  3AVS A;  5A80 A;  5FZM A;  4ASK A;  5A7N A;  5FYM A;  5FZL A;  4QX8 A;  4D6R A;  4C8D A;  4GJY A;  5FZ7 A;  5FY5 A;  2P5B A;  2PXJ A;  3PTR B;  5FY8 A;  5FZO B;  5IWF A;  5FYU A;  4HON A;  4UF0 B;  5FZF A;  5LY2 A;  2YBS A;  5FZ0 A;  4QXH A;  5F2W A;  3DXU A;  5A1L A;  4CSW A;  4LIT A;  5E6H A;  5A7O A;  5FWJ A;  5A7W A;  4IGO A;  2OX0 A;  3PUQ A;  5LW9 A;  5FUN A;  5IVC A;  5FXW A;  3K2O A;  2GP3 A;  2WWU A;  5F3G A;  5FP3 A;  2XML A;  5A3W A;  5A3P A;  5A1F A;  3PUR A;  2YU2 A;  5FYT A;  4Y3O A;  3RVH A;  5FZ4 A;  5FP4 A;  4BU2 A;  5FY4 A;  5FY7 A;  5F5C A;  4EZH A;  5FYB A;  3KV5 A;  4QXC A;  4D6S A;  5FPB A;  4D6Q A;  2VD7 A;  5A7S A;  5LY1 A;  5FP7 A;  5K4L A;  4GJZ A;  3U78 A;  2Q8E A;  5FYI A;  3K3O A;  3N9O A;  4Y4R A;  5FUP A;  2OQ7 A;  2OQ6 A;  5FYZ A;  5FXZ A;  4AI9 A;  3ZLI A;  5A3T A;  4QWN A;  5LWB A;  4URA A;  3LDB A;  4XDO A;  5ANQ A;  5F37 A;  5FJH A;  2XDV A;  3PDQ A;  3PUS A;  5FZC A;  4Y33 A;  5F5I A;  5A7Q A;  4QX7 A;  3OPW A;  3KV4 A;  5IVY A;  5F32 A;  5F39 A;  3N9M A;  3N9Q A;  5FYY A;  5FZE A;  4CCJ A;  3KVA A;  2YU1 A;  2YBK A;  3LD8 A;  5FZG A;  3PU8 A;  3UYJ A;  4V2W A;  5FZO A;  5IVE A;  5F2S A;  5A3N A;  5FZ3 A;  4AAP A;  4TN7 A;  3ZPO A;  4UF0 A;  5FXV A;  5A7P A;  3KV9 A;  5F5A A;  5FZ1 A;  4EYU A;  2Q8D A;  4LIU A;  5FYH A;  5IVJ A;  3KV6 A;  3N9P A;  5FY0 A;  5FZK A;  2GP5 A;  1VRB A;  4LIV A;  4NUB A;  5FBJ A;  2YPD A;  4BIS A;  5IW0 A;  4LXL A;  4GAZ A;  4IGQ A;  5F3I A;  2WWJ A;  3N9L A;  5A7W B;  3AL5 A;  4CCK A;  3PU3 A;  5FZH A;  4BXF A;  4DIQ A;  4QXB A;  5IVV A;  5FPA A;  5FPL A;  4IGP A;  2Q8C A;  4EZ4 A;  3KVB A;  5FZ8 A;  5FWE A;  3NJY A;  5FYS A;  5FZ9 A;  5ISL A;  5FY1 A;  4CCL A;  5FZA A;  3AVR A;  5FJK A;  5IVB A;  4GD4 A;  3N9N A;  4XDP A;  5FPU A;  5IVF A;  5FXX A;  4E4H A;  2W2I A;  5F3E A;  5CEH A;  4CCM A;  4CCO A;  3AL6 A;  2OT7 A;  4HOO A;  2XUE A;  5FV3 A;  5FYV A;  5FYC A;  3PUA A;  4QU1 A;  5F3C A;  5FZD A;  4DO0 A;  5KR7 A;  5FZI A;  4CUG A;  2OS2 A;  3U4S A;  3K3N A;  2YBP A;  5FZ6 A;  5FP8 A;  5FPV A;  4CCN A;  5FY9 A;  3OPT A;  5FP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...