3WY6A

Structure of hyperthermophilic family 12 endocellulase (e197a) from pyrococcus furiosus in complex with laminaribiose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQAVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase (E197A) from Pyrococcus furiosus in complex with laminaribiose
rcsb
source organism Pyrococcus furiosus
total genus 71
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wy6A00
1KS5A 2JENA 3VHPA 3WQ7A 2DCZA 1REFA 1BVVA 3EXUA 1REEA 1UU4A 1KS4A 3AKTA 3B7MA 1HV0A 3WP4A 2NQYA 2DFBA 2BWAA 1IGOA 1H1AA 1HV1A 4S2FA 1AXKA 2VG9A 1C5HA 4HKOA 3WT3A 1OLRA 2D98A 4XQWA 3WQ0A 3WX5A 3MF9A 5HXVA 1HIXA 2DCJA 3VZNA 4IXLA 2Z79A 1C5IA 5EJ3A 3VLBB 1XNCA 2JICA 1XYNA 1REDA 2BWCA 3VZOA 3VZMA 3M4FA 1XNDA 3MFCA 3AKQA 5K9YA 3VGIA 1TE1B 1PVXA 2DCYA 2VULA 3WQ1A 1ENXA 2VGDA 3AKSA 4HKWA 2BVVA 3AMNA 3WP3A 3B5LB 3VZJA 1XNKA 1OA4A 4S2DA 2B46X 3AMPA 3WXPA 2QZ3A 3MF6A 2F6BA 3RI9A 1UKRA 1F5JA 2B45X 1XYPA 1NLRA 3O7OA 4H7MA 1YNAA 3AKRA 1OA2A 3WP6A 3VL8A 1T6GC 1XYOA 3LB9A 3VZLA 1H4HA 1M4WA 1XNBA 3RI8A 1QH7A 3VZKA 2C1FA 3WY6A 1XXNA 2JEMA 3ZSEA 3AMHA 3WP5A 4XQ4A 3AKPA 5K7PA 2QZ2A 3LGRA 3AMQA 1H0BA 1W2UA 1UU5A 2BW8A 4HK9A 2D97A 4HKLA 4HK8A 4NPRA 4XQDA 4XPVA 1OA3A 3VHNA 2NLRA 3VL9A 1BCXA 2B42B 3HD8B 3AMMA 1H8VA 4S2GA 1BK1A 3WR0A 1H4GA 1OLQA 1UU6A 3MFAA 2DCKA 2DFCA 2VUJA 4S2HA 3VHOA 1QH6A
chains in the Genus database with same CATH superfamily
2BFUS 5F8PA 1GWKA 3V0BB 2DWRA 2ET1A 4UW5A 3KLSA 1VALA 4C91A 1JU3A 1DG6A 2LROA 5FY5A 1URXA 3KS7A 3WHTA 4XIOA 3H3UA 4NIAA 5CFCC 3S0MA 4ZS2A 3I3DA 3HNBM 5EWSA 2CDPA 4RFRB 2W47A 1UU4A 3R4SA 5FKCA 4NJ4A 2CGNA 2XH6A 2X05A 1JZ5A 3P3PA 2DFBA 2R071 1WMDA 3CO2A 2XKPA 4PJYA 2VNRA 3NQHA 2RS13 4MGTA 4E4HA 4XMIA 1RUE3 3ALQA 2LS6A 4RD7A 1G86A 2P3IA 3WSOA 1AR73 1AVBA 4AHZA 3O1MA 1ODNA 4MHRA 1BK0A 5DXDA 4HPKB 1GKBA 2JDUA 4Y5SA 3WW4A 1G9CA 3WLUA 4QKFA 4DNYA 3H9AA 3ACIA 1UN1A 4P14A 3VBHC 1TZOA 1OLMA 5F7UA 1CAUA 4QHZA 2QKDA 2XJSA 4QQ2A 3WG2A 1NZCA 1PIV3 2RDQA 4Q5OA 1W9WA 4A45A 4M4PA 5FCCA 1W9YA 1JYVA 1OH3A 3WCRA 3P1IA 1JI6A 1WCDJ 2XVKA 3PTYA 4LO7A 5FZ3A 2AACA 1NA1A 2G19A 3ZFGA 1AHSA 2MEV1 4I0BA 1UF2C 4P9XA 2PAEA 4C1XA 1TEIA 2EA7A 2ZOEB 1QJY3 1DZQA 3C7HA 3Q9OA 3WUDA 4EE2A 3POYA 1VIWB 3HNYM 1LHVA 1R093 4XHBA 1STMA 1X9TA 1TNRA 3PIJA 5A32A 1YFYA 1H30A 5FPXA 1GP6A 5F9TA 1H8TA 4MGIE 2HH9A 2O14A 5F39A 3RNSA 1L7LA 5D1IA 4CYDA 1VJ2A 1OA2A 3I2KA 2EXIA 2PLV3 3HBKA 3AK0A 3ES1A 4CDXA 5F37A 4N43B 3VV1A 1DFQA 2FHRA 2V4VA 5F32A 1S0DA 4NRMA 1WA6X 1AR91 2A70A 3DXUA 4LK6A 3O1VA 3AXDA 2XJRA 1FNYA 2C1FA 3W9AA 5EJ1B 3NV2A 2ZZJA 4DY5A 3O0XA 5F3EA 1DP0A 4FBFA 2VCCA 2VQ0A 3LGRA 4Z2AA 4PHZA 5EZWA 1ZM1A 1BEV2 3ILRA 4QAWA 2WR9A 3P5BA 3V64A 3AL5A 4EN0A 1Q8OA 3J4UH 5IVCA 4AVCA 2I74A 2VMGA 4KI5M 1DQ4A 5DG2A 4C90A 5KC5A 1LGCA 3DXTA 3DV8A 4LK7A 2JG9C 3VKLA 3ZN5A 2WAAA 1OLME 1SLBA 4DS0A 4I3PA 4GH4A 4R4ZA 3SQOA 1SHWB 2Q0AA 3MI8A 1FOD2 1H8VA 5FPAA 3U07A 4CP9A 4MOAA 1D4M3 3POSA 1K5MA 2QNKA 2R062 1RUH2 4URAA 2D44A 2NPIA 3FN9A 2HWC2 4XJWA 3AYEA 2AC1A 3K51A 3MIBA 1BMV1 4XF4A 2FDIA 1AR63 1VBD2 4AFBA 4XFBA 1MS1A 1O3QA 1JN2P 5CFDA 5C9AC 1UZYA 2RS33 2DCZA 2WNUC 1G9DA 3V0BA 2Y8KA 4CU9A 4LKEA 5FPVA 3LEIA 1OOPC 5EFUA 1LECA 4YYOA 1OMIA 1W8UA 1PM7A 1N3OA 1UZVA 2WLPA 1YQ6A 2BWAA 3RZJA 4UBGA 4S2FA 1AXKA 1UPSA 1GQHA 3KF5A 1WCUA 4Q0QA 1DLLA 5T54A 4C0BA 4NR1A 2KR2A 3BODA 1ND3B 5FOBB 4Y4YA 4DB5A 3AYDA 3R4DB 1MZEA 2XR4A 1C5IA 1XSQA 3PMSA 2WN3A 4Q8LA 4ZU5A 1C4RA 1XNCA 4N53C 1UY3A 4TXWA 2XWBB 4IEOA 3VZOA 4SLIA 5G05L 2VOXA 3N35A 4O9GA 5DAQA 1WW6A 4D6QA 1Y3TA 3BIWE 3PMEA 2BOIA 3V65A 4Q4W3 4AI9A 1VAVA 2PMWB 1LGNA 3FE5A 1QJY1 4ARYA 1O8PA 4KNCA 2DF7A 3ZXAC 5FBJA 5LA2A 3T30A 1R091 1NLQA 4MGQA 4Q4V2 4TTGA 4KWJA 1ZRRA 1LESA 1O59A 1DBNA 3B93A 1QXJA 1RC6A 2ENRA 2AH2A 4IEPA 3WQ1A 4CCDA 4Y1YA 2RDRA 5J98B 5F2SA 4Y3OA 3OGVA 4XZUG 3MUY1 4BISA 2PLV1 4CP2A 3AXEA 1S2EA 2QQMA 4U2AA 4NIIA 3OPZA 1MEC2 5LW9A 2R6QA 4MX3A 3WDXA 2BDRA 5A6ZA 3MO4A 2RM22 1TMF3 3KV4A 4MLOA 4E9KA 2DU1A 4AI3A 3OF1A 1HLCA 2R7EB 4YZ3A 1YNAA 5A3UA 2RJ2A 3LDKA 4D94A 1VRH2 4WVWA 4GXLA 5EQUA 2X8KA 3ZXLA 3WDTA 1XE0A 3FZ3A 5ACA2 4LHNA 1QQP2 3LB9A 2ADDA 3ZN6B 4AGGA 1H9WA 2J1TA 2DVBA 2JDPA 1BLZA 5T50A 3ZYJB 3RQ0A 1W0OA 4C0HA 3WDUA 2AUYA 1W9TA 1I3HA 5CZKA 2CDOA 5L73A 2YBSA 1RJ8A 3IIIA 4HN1A 5K7PA 1UY4A 5BNNB 4HANA 1UMZA 4OHWA 2DVDA 2XJUA 4I01A 3PJQA 4QX3A 4YVWB 5IAVA 1OA3A 2HWE1 3CJIB 1AR61 4O61A 4CDQC 4J25A 3JQWA 3KCYA 1QJZA 3NJXA 4AEDB 2XGXA 2WZPP 2ORXA 3KT7A 4LLOA 4F83A 1H4GA 4NPMA 2RMU2 4SBVA 1W28A 1MQTC 4R52A 4RQPB 3USUB 3VBUC 3PDQA 4LHLA 3B94A 4N7IA 3AX4A 1LEMA 1UY0A 4NHLA 1UMHA 2H6CA 4Q0PA 3GJAA 1JTZX 5D8AB 2BNOA 4RHV3 4CUGA 1AYN2 4IE7A 3QH6A 4LBQB 4MO3M 4QB6A 2ZACA 4CEWC 2OZJA 1GNZA 3ZSKA 4IGOA 1REEA 3AKTA 3B7MA 5CFCB 3VKNA 2Q8OA 1H6XA 3WP4A 3GCWA 3NV3A 1ULPA 4BLJA 4GWNA 2XJTA 1QXPA 2PHUA 1ASJ2 3PUQA 2CSGA 1ZRCA 1YQ8A 3POEA 1BXHA 4CDUC 2A6XA 2FZ1A 3J7MA 2PA7A 1MR5A 4IERA 4BK4A 2PHXA 3GALA 1HIXA 3U10A 3NNLA 2OQ6A 1EY2A 3AJZA 3IB3A 3PL0A 1HXS3 5EYYA 4B7EA 4GIQA 2GALA 3BYWA 3ZYPA 5DUVA 3ECQA 1ZX5A 1REDA 4QKNA 2HWB1 2VZTA 2LRPA 2P1BA 1E57A 3M4FA 2C26A 3ITQA 5K4LA 4KG8A 4BMEA 3BU0A 3JD73 2WO7A 2ILMA 3LPGA 5K9YA 2D93A 3VBHB 2F4PA 1Q3EA 5I0SA 4LUMA 1VAMA 2BBAA 2G4IA 4IEVA 4CRQA 2VVDA 1YJKA 2EIBA 4IE0A 1VBC2 3N4MA 3VD7A 1ULGA 3ASIA 1RUI1 5BNOA 4N9IA 2QQUA 2WSUA 1DCSA 3H8XA 1W6PB 5IFTA 5J09A 4JRLA 2BVVA 2JJ6A 3K46A 3I3EA 4OUSA 4V1PA 5CG8A 1JOPA 2RS52 1LJ7A 1QIQA 3C8XA 3WXPA 2WKKA 3H8RA 4XJ9A 5LA9A 4MGYE 1VBB2 3LCPA 2HEVF 2P6CA 1HRI1 1GUIA 1OFSA 3HAGA 3JCIA 4OQ9A 2IXJA 2HWD3 3SISA 4XFAA 4ZPIA 5C4WC 1GNYA 3O5SA 4BQ3A 1NZIA 4Z82A 1CN1A 2CHHA 1QMJA 1F2NA 1GZTA 4FFIA 2ZKNA 2H6BA 1VLNA 5E1RA 3BU7A 2ERFA 2KXLA 1XXNA 2XONA 1HRV3 2ZMNA 1K12A 3ZN6A 4U36A 1PVC1 4AHYA 2WO2A 5AC93 4XURA 4PT6A 2D6LX 3AMQA 3VBOC 1PO13 3KWVA 3WEZA 2B5HA 1SFNA 1ZNPA 2R1BA 3A21A 1G7YA 1SG3A 3OTFA 2PAKA 3PU3A 5E8AA 4B3NA 2O8OA 5BNQA 3I2HA 5BNNA 3AP4A 1A6CA 2OPKA 3KF3A 5LRRA 2J1SA 5FYHA 5BPXA 4BH9A 2OUJA 5AVAA 5A7OA 3VL9A 3FBMA 4RHV1 1WW7A 2F4LA 2JG9B 4META 1RUNA 3N9NA 3B02A 1B35B 2VQTA 4P00B 5IK7A 4M4RA 3FMGA 2JIGA 4GWIA 4MXWB 2R32A 1LODA 4KU7A 3U0ZA 4NAOA 3P3NA 5L9VA 2XMLA 5JXIA 2XG3A 2NM1A 2QQWA 1C8M3 4GMP3 4Y5TA 3USUA 4NIGA 3WQ7A 4AQTA 5HBAA 2VZVA 1NY72 5JMCA 3HEIA 4BQ5A 1Q56A 4RR3C 5D8AA 1CAWB 3OBRA 3WNLA 1COV3 5AFBA 2QDRA 3N7MA 4FFHA 4A41A 3T0DA 1O5LA 2KA3A 3S5QA 2VQUA 5C9AB 1OD5A 1LOGA 5CKQA 2WNUB 1KS4A 2A3WA 3PJYA 3C7EA 3BTYA 2LALA 1JS9A 1BZWA 2HBUA 5FZ8A 3HQUA 1OOPB 4QX2A 3LOBA 4QQLA 3VKMA 1QDCA 4UAPA 1JYXA 3TEWA 3NRUA 5CFCA 1CAVA 3ACGA 1IKPA 1BVP1 4UF0B 4C8DA 1JBCA 4OZOA 3AVSA 2VG9A 4A4AA 4BA6A 5FUIA 1E5IA 3JD71 1XQNA 4IESA 1ULCA 2WT2A 4JQTA 5HXVA 1VBE2 4FPHA 1D0HA 5J3UA 2WNOA 4OYUA 1NT0A 2WS93 2GNTA 1OUXA 1ZBE2 2Y6GA 5JSPA 4XF3A 1AL23 4IEWA 4PCRA 5FLIA 2IZWA 2RVAA 3GBWA 3VZMA 4F3JA 2VXJA 4XETA 1C3HA 1CIYA 2QQVA 3GNEA 4IW3A 4N53B 5LY2A 3TOJA 5IT6A 1CAXB 2D40A 4JKMA 4XW3A 3BIEA 1OD3A 4QM9A 2W95A 4R8HA 1Q5OA 1XE8A 2BOJA 3KZ4C 3K2OA 3WOGA 2DCYA 4LBKA 5C8WA 1E5RA 2WWSA 4UW4A 5LZ6A 1ENXA 4OFGA 3ZKUA 1IS5A 3Q8EA 2ZGOA 2E6VA 1MS5A 4DXRA 4N90A 2D3SA 4XFGA 3U4SA 4L99A 2J1VA 2P5BA 3DF0A 3UETA 5FPUA 5IK5A 4BQWA 3MF6A 4CCMA 2VCBA 3CF6E 2P3YA 3IPVA 1LRHA 2FMDA 2ZGPA 3PVBB 3UGHA 2VOTA 3HJRA 3GDBA 4H7MA 1WBLA 4TN7A 2VZSA 4HVRA 1HRV1 1XOYA 2WBKA 1VAKA 5FMCA 2E33A 1JHNA 1YWKA 5AC91 4BCUA 2JDMA 3KT4A 2WFF2 2JDNA 1O4ZA 4FPOB 1PO11 1UPIA 1WLDA 4I0AA 5FV3A 2VR4A 1SBDA 3ME2A 4Z07A 5FZFA 2WRAA 5J1XA 3KV9A 3TEXA 5IWFA 4GB32 5DZEA 5FZ6A 3THDA 3O12A 4JGZA 3ZFEA 2P17A 1BYHA 3WP5A 1J1LA 3AKPA 2XHKA 5KXBA 4XAAA 2E7QA 2Y60A 2LW8A 2R16A 4AEKA 2BU9A 1CQ9A 4AI8A 1DYKA 3WDWA 1UD1A 1CONA 1LCLA 3IMNA 1RVF2 2XB6C 4CCKA 5FO9B 1HJFA 2HYXA 4IL7A 2IXIA 2R041 1XU1A 4W65A 1LKNA 4OHZA 5T5PA 4XIKA 4YZ5A 1R083 2PAMA 1W6QB 1GWMA 2WT0A 4GZ9A 1ZREA 1GQPA 4CDQB 3Q8CA 1HJGA 1W05A 2XWJB 4OHVA 5F3IA 5GLZA 3I7DA 3NJZA 4GMP0 2QCSB 1UAIA 4WM7A 5LBBA 4P08A 5LRSA 4Q4Y2 5GJ6A 3K3NA 3VHOA 5A3NA 3SH5A 3PVOA 1LU1A 4UFLA 1FATA 1MQTB 1W6OB 2VTXJ 3QLQA 4QX0A 5SV5A 3VBUB 4B8EA 4XACA 4DMIA 2D6NA 2C5DA 1UY1A 3ZR6A 2V5YA 2CL2A 1DQ2A 2D5HA 1WKYA 1IS6A 3USSA 1W2TA 3N3HA 2W2IA 1CAWA 1GZ9A 3TWIA 1OVSA 4UBHA 2XLGA 4QPGC 2WS91 1OF3A 5C9AA 3J9SA 1ODMA 1AL21 1TME1 2WNUA 4XE9A 1HV1A 5LEJA 4M3CB 3NV4A 2HKXA 2YU1A 3KSCA 3ACHA 1RUF3 4XDPA 4XUNA 1IPSA 3A22A 1OH4A 2J7MA 3BB6A 4UF0A 3RWKX 2W3JA 4MSVA 1Q8SA 4CDUB 4AVAA 4EN7B 4DUVA 4YW3A 1BBT1 1SEFA 5DAWA 3OGJA 5BNPC 3AFGA 1CESA 4D69A 1CX4A 3UKNA 4NE9A 2OW4A 4OI4A 4CUBA 2WO3A 1HQLA 1K45A 1PO22 3FX3A 1U5XA 3IMMA 2WNVC 3JQXA 2CGPA 2MPFA 2VVEA 4BQXA 5FY0A 2CV6A 1RHI2 2WLQA 2CY6A 2YBKA 1FPN2 1RUJ2 5FYZA 4MUVA 3MDPA 4FPCA 4ZU4A 3GZAA 1JYIA 2DDUA 4A2UA 5DMYA 5GZGA 4H2AA 4HKWA 4DINB 2CWSA 4Y20B 3CIHA 4TZDA 3KMHA 4E4ZA 4YM2A 4LJHA 1POV3 2RR12 4AQSA 1P8JA 4ASLA 3AP5A 1LOFC 3L2HA 4OI2A 4FP3A 4HLTA 4E8DA 2ZGQA 5FZIA 1ENSA 3ZFFC 1NX9A 5FZOB 5HCAA 5C5TA 5L36A 5J48A 2Y33A 3ZR5A 3RG0A 4QGMA 3VL8A 1M06G 1PK6A 1YC61 5C4WB 5T55A 1LGBA 3BOWA 2E26A 4KGQA 3K3OA 2EIEA 3OPTA 3JZVA 2RJLA 2JDZA 4YWAA 5I8SA 2H0VA 1RIRA 3GZEA 1DQ1A 4XABA 2FD8A 4H3WA 1ENRA 2YC2A 2AEZA 4GJYA 4QPIC 5DZFA 4J1XA 2B9UA 4IEQA 4IGPA 4NHXA 5KHIA 4AXOA 3MIFA 1S1AA 1EPWA 3IIAA 1R1A2 3VBOB 3K77A 3OEBA 3MPBA 4EQVA 3JB8A 3AZXA 3H1WA 5A80A 4NRQA 3SH3A 4EZHA 2HEYF 1R1ZA 2QVSB 1YLLA 2WDBA 1JZ2A 1YI7A 1LULA 5BUVA 1OKOA 2VD7A 3WR0A 5JOWA 2HYKA 3MLLA 1FMD2 3OJBA 1OUSA 4GKYA 3FFQA 3QCWA 3V0AB 1YQ2A 2VCMA 2KD7A 5EP9A 1G8WA 2WZR2 4IEZA 2WQ8A 2P4EA 2X53S 5BY5A 3VBFC 1O3RA 1OF4A 4ZY9A 1MQTA 3BPSA 4L9BA 3RZLA 3KQRA 1BVVA 4M0NA 1OXCA 3TBDA 4WVMB 5FZHA 3A23A 4RR3B 4BJ0A 3AFKA 4LBNA 1HN1A 4K1ZA 2HBTA 1OBNA 1F4AA 1QU0A 5JZGA 4Q0SA 3O1SA 2JIJA 5KXDA 4CEWA 2XXZA 3RMYA 2EIGA 2ZKLA 2ZMLA 2J1UA 3WNNA 3FWEA 2G1MA 2NN8A 4D0QA 3NKGA 5A7NA 2HWF1 4M3CA 3UJQA 1AYM1 5L19A 4OQ8A 1D4VB 2IWGB 1V6NA 3ZM8A 5D21A 1QJX1 5F3CA 5FZ9A 3IM0A 2Q8EA 4CDWC 3SH4A 3KQ4B 5SV8A 5JXHA 3VD4A 3FC0A 1V6JA 4PIYA 1G6NA 1UY2A 4HXCA 1DHKB 1Z7S1 2WN2A 3POWA 5A7WA 3WZ1A 3S57A 2GNBA 4CSWA 1BEV3 3LEKA 3RGBA 3TYJA 4BE3A 5T5LA 2WQZC 1POV1 1QNWA 1S4CA 3R05A 4XCBA 5LK5A 4CEYC 2H0BA 2DUOA 5FRAA 5FP3A 2JKXA 4YLZA 4K3UA 2VJXA 3WNOA 2VE1A 2ZX4A 5K0UC 2I07B 2VVFA 5FZDA 1W8WA 3E6BA 1POV0 2VTXA 4YW1A 5FP9A 1FOD3 2ZBJA 2HLEA 1ZBA2 3GZUC 3KHBA 3MW4A 4V2WA 1H2LA 2C6SA 5ANQA 2BP6A 2R063 3EYPA 1RUH3 3W58A 4YM1A 3VKOA 3WG3A 4CXYA 1W8NA 2GMPA 1J59A 3QH7A 1V6MA 1VBD3 1W8FA 3BTZA 4X6QB 4XF9A 1BJQA 3VD3A 4TSVA 3ZXJA 5C7GA 1V9U2 3D82A 2D3RA 2MNGA 1S55A 2NZ9A 3U14A 2YFZA 3AJYA 2X09A 1C8NA 3RYPA 3FL7A 1QJU1 3UL2A 5BXXA 3C7GA 5A3PA 4LHKA 4YW5A 1F35A 1V6OA 2AR6A 4L0PA 2VW1A 5FK7A 1I1EA 1D0GA 2GC3A 2JDYA 1EV13 4NHYA 3RRDA 4CCEA 5DAVA 2W94A 3UESA 5FPBA 1XNBA 4FPGA 3VHRA 3N7LA 3POGA 1O8SA 4EN6B 1GMMA 4AE2A 1E5SA 3BI3A 1DGLA 4M3CE 4EWEA 2AEYA 4ARXA 3M2MA 1H0BA 4B4PA 2MEV2 3O1OA 1N1SA 5IVJA 2GNMA 3E5XA 5JSRA 4CP0A 4XJZA 3THTA 3HN3A 5IFPA 4AEJA 1DGRA 2W87A 3BUCA 2EXKA 1S2KA 4GALA 3IDAA 3VBRC 3HD8B 2X29A 5JR7B 2PN5A 4O65A 5IATA 1EAH1 5GZEA 3WDVA 1MVEA 4IV3A 5I91A 3H7JA 4XJ8A 2VZ3A 2DCKA 4XOGA 4AGVA 3O0VA 3SC7X 5GLWA 4Q4V3 2VU9A 1J3RA 1ND2A 4QDQA 3P6BA 2WABA 3A7QA 3JBG1 5D2AA 4KBBA 4LNVA 1AR92 5K8SA 1A78A 3SKJE 1ZA7A 3KCCA 2IFRA 3IWZA 2YDEA 3NMBA 4Q26A 1IQAA 4UYBA 1PGL1 1MEC3 5CISA 1TVGA 4JTOA 3WW3A 5KHJA 4NIHA 1DGWX 2RM23 2CGOA 3AVRA 3LFIA 1GP5A 5AVPA 3TN92 1B35C 2RE9A 1ZZ9A 3J26N 4RR3A 1EUTA 4X8PA 1H1AA 1VRH3 5EV7A 4JDOA 4QPGB 1JZ6A 2XQRA 1BEV1 3NNFA 5ACA3 5CEHA 2JDKA 2UYBA 1QQP3 4YG0A 2X10A 2W68A 3OPWA 4V2VA 4LE4A 4XQWA 5TSWA 3VBSA 4A6SA 2XOMA 2D6PA 3N9PA 3VZNA 2O1QA 2VOVA 4IV1A 5FUPA 3RSJA 4ZKTB 2BWCA 2ETEA 2PFWA 1BMV2 2RS11 5G04L 4PI2A 4CPBA 2B39A 5BNPB 1RUE1 1UOGA 2GC2A 4DEQA 3EQEA 4Y22B 3UJOA 2R061 3LAGA 1RUH1 1AR71 1WLTA 1VB4A 2ZA9A 5AFEA 2O8QA 2OYZA 1GZWB 4ZXEA 5JCTA 5J36A 3T4HB 3LDRA 3OY8B 2WNVB 2VZPA 2DU0A 1H1MA 3PUHA 2C9KA 1W8OA 4DRRA 3ZO0B 1J1TA 5JDBA 1XPWA 2JG8C 2OVUA 1S0JA 2VGDA 4YVSC 4QKBA 2D6KA 2D43A 4COUA 5L7OC 1A34A 3W21A 2RMU3 2WWUA 2GC1A 3B5LB 2ORZA 1PIV1 3VZJA 1LU2A 4S2DA 1OQEA 4PLNA 4K8RB 1EV11 3N9MA 3H1MA 4HL0A 4XXAA 2VNGA 4HPKA 4BXFA 1YHFA 1AYN3 3T08A 3UYJA 5C3OA 2ARXA 2GDFA 4IDZA 1WLCA 3O1PA 3ZFFB 3MLKA 3MIDA 3DPRB 1Z0HA 3WP6A 1QGLA 4AGRA 4TYSA 1OSGA 5A7PA 1NQDA 1CPMA 3C7FA 5FO7B 5IHRA 5HPOA 3H3ZA 1JYTA 2PHTA 2EXJA 1ASJ3 1R092 4PF5A 3L2YA 3NNGA 4FAHA 3F2ZA 4YM3A 3H8OA 3AMHA 1IPJA 1SLLA 3KVBA 4HFSA 4AFDA 4EWAA 1Y7BA 2UY9A 2BW8A 1UU5A 5DPNA 2QQNA 4QPIB 4ZU7A 2PLV2 2AYHA 4HK8A 4Q4V1 4XC9A 3PVNA 4XQDA 2K0GA 1X36A 3I4IA 4HBNA 4XPVA 5T5OA 3WW1A 2W91A 2L9LA 5A6QA 3POJA 3ST7A 2P37A 1BKZA 1ZVFA 3EO6A 3ENRA 5FOJB 3AMMA 4LOSA 1HB3A 3RVHA 5I0UA 2HEWF 1S0BA 2W0XA 4YARA 4M0HA 3K4ZA 4INDA 4FPFA 3OYWB 3VKFC 4XBQA 1GSLA 1CD3G 3T1MA 2DTYA 4L97A 3LKJA 4WBBA 1X33A 2EAAA 1YIPA 1XNAA 1LTEA 2X5IC 3AB0A 4N43A 1TG7A 1TNFA 3JUUA 3QACA 1AR82 3I97A 4CUAA 4FO9A 2VZQA 4LLFA 3U75A 1VPHA 2IVIB 2WYFA 1D4M1 1F31A 2PYTA 2RS53 5FXZA 3VBFB 1C28A 5ACA1 3T2OA 2YPDA 4JHZA 3WW2A 2OXBA 1VBB3 3HBZA 3SCFA 3SKVA 3SEPA 2VMCA 3N36A 2YHJA 2XBO2 4TWTA 1Q43A 1BHGA 2BV4A 4QPYA 3RJRA 4AZZA 1GQGA 1W04A 2CTVA 2HWE2 1DF0A 1HX6A 3WNPA 1YFWA 2RS31 1FX5A 2UWBA 3ZSJA 4HKOA 2VQAA 5FWEA 5JR2A 3S5AA 1U0AA 1W2OA 3AZZA 1ZRIA 3B00A 3HOBA 5EXOA 3VN4A 3WX5A 1OFNA 1QNYA 5FLHA 4YG3A 4D8MA 4GWJA 5EJ3A 3VLBB 4RA0A 1NCQC 3DL3A 5FZKA 1W6MB 5F3GA 1O6UA 4CDWB 1AX2A 1RXGA 2C4XA 4LBOA 4YZ1A 1ZZ8A 4ISRA 5F6LB 2WYSA 5DZGA 4UWDA 1ST8A 1RMU2 1U12A 2GMEA 4JGYC 4LT5A 4B1LA 4HVQA 5BNPA 3ORJA 4CEYB 5IVEA 4WM8C 4E8CA 3MIGA 2QDNA 2I45A 4RFT0 1DDLA 1JUIA 2VCAA 3KT1A 5K0UB 3UGGA 3OY8A 4YGEA 2FMYA 4NWVA 2YG0A 4LUKA 4Q4W1 4MYEA 3AM2A 3EJKA 4CE8A 1DLCA 5DUWA 5FMDA 3N9LA 1XNKA 4F8AA 3PUSA 4COVA 2QZ3A 1ND3A 2F6BA 2O0OA 3FFZA 3MW2A 4HONA 1CZTA 1F4HA 4Y33A 2QQLA 5FAXA 1G9AA 1C1LA 5H9RA 3MICA 1ASJ1 3BKZA 4LEJA 1SDWA 4YZ4A 2WT1A 2HWB2 1ULEA 1LOFA 2FQPA 1GV9A 1JYNA 1FYUA 1ZRFA 4Z92B 4FPJA 2K9ZA 5FREA 3ZFFA 5I93A 3NAPC 2GN3A 2DYCA 2XQXA 2VUCA 3Q8AA 1TMF1 2Q5TA 5H9SA 2YGMA 1S0CA 2D5FA 3I59B 5A1FA 1OI6A 4XDOA 3ZSEA 1RUI2 3NWKA 1NYWA 3GF6A 3PTRB 1Y43B 1YYNA 4LHSA 1LNSA 1LOBA 5FDBA 1VBE3 3BTXA 5E6HA 3LD8A 2DBNA 1MPXA 1APNA 3IZOA 4HK9A 1ZBE3 4DPNA 5F5CA 3GHMA 4HKLA 4MGKE 3T2TA 2AENA 5CYYA 2ZPXA 4OI1A 3CJXA 4M00A 4NMIA 3GM8A 1V0AA 2Y6KA 5A7QA 5LCWL 1UX7A 5JIAA 4Q2FA 1HRI2 4D6SA 3U78A 4S2GA 1PNFA 1QOSA 5KR7A 1WBFA 2B8MA 5CB7A 3VBRB 4Q1RA 4OHYA 2XVGA 4LITA 1PNGA 3M3EA 2VOKA 4JQRA 1W6NB 3D0SA 2EVXA 1FT9A 4Y1ZA 3WDYA 5DAPA 4L92A 2TUNA 1O3TA 4QXHA 3W20A 1ZA4A 5A6YA 1S0EA 4A3XA 1S0GA 2OA2A 3W5MA 2UWCA 2ZMKA 2Y26A 1PVC2 1GANA 1NOVA 3ES4A 1SBFA 4AHWA 3CKHA 1RINA 1RUC2 1NA1C 2YC0A 5CKMA 3ZFGC 4UOJA 1UYZA 3VBFA 1SPPB 2PHLA 4LO6B 4YVWA 3IDBB 5FMOS 5FBZA 1IGOA 4Y5Z0 2XL9A 2BZDA 2ZHKA 3CJIA 4QPWA 5C8CC 2WFF3 3C7OA 3DGTA 2FDHA 1C5HA 4RHV2 4WZCA 5FMOL 1H8TC 3DEMA 1UXXX 4AEDA 1KXGA 2XUEA 2YUEA 3D5OA 1KITA 2IXHA 5IJRA 5CKNA 2CNAA 4LR4A 1ACCA 4GB33 4RQPA 1N1YA 4COWA 5IYYA 3J8F3 1SMVA 2VNOA 1KDKA 1GU3A 4Q0VA 1Z78A 2EXHA 4XVHA 4XCAA 1W39A 2W46A 3T09A 3A0KA 5FJHA 5JSOA 1LAJA 1UXZA 5T52A 4P9YA 3ZX7A 3SMHA 4LBQA 2Y6FA 2DUQA 1HXS1 4BDVB 1MVQA 3T0BA 2Q4SA 1IZ3A 1CR7A 4LIUA 1T6BX 1XSRA 1YCIA 1GOFA 2WJSA 4HVOA 1XE7A 4K7JA 4FQZA 2DBIA 3KD4A 4M01A 4KMQA 4YW7A 5I8TA 4MGSA 5IUQA 3GCXA 4CEYA 4LBLA 2ID4A 2JB8A 1US2A 4PQ9A 3HMYA 5EJZB 4ZZ8A 3VUOA 1V70A 3LF7A 4LTAA 2JG8B 4DXSA 4YVSB 1LOAA 4Q4Y3 5L7OB 1OA4A 5GLUA 2VMIA 2XLAA 2ZEYA 4Y26A 2ZGKA 2ZGSA 1RTVA 1U5IA 1UKRA 2DTWA 4OULA 4CU7A 1K5MC 1NLRA 4LPLA 4YW4A 5B4NA 1F9KA 2OIIA 2ZEZA 1RUG2 3O1TA 3HT2A 4FTEA 2QQIA 4P9WA 2P2KA 4XUOA 3K48A 2ADEA 4UT5A 5CFDC 4LOTA 4CCJA 3VBHA 1ZBE1 1NE6A 2P3JA 3HN1A 1VBA2 3B69A 4J6GA 3JB4C 4LORA 1Q8PA 3UNPA 1H6YA 2HWD1 2Y6LA 1JZ8A 1O4TA 1W6PA 2QZ2A 4BWOA 4D6RA 2VOWA 4D7SA 1K3IA 1QJFA 3ZYRA 4EZ4A 1NCRC 3LA7A 3OB8A 3FLRA 4R9CA 3ZXDA 4BB3A 4OMDA 2XJVA 4Q8KA 5C3RA 5B4XA 4AFCA 1XRUA 5JI7A 3URFA 1PZ9A 3UGFA 4AEMA 1MZFA 3ON7A 4W6XA 2WINB 2PTMA 4XJUA 1PO23 5FZGA 3OD0A 4MH0E 4E27A 1HRV2 1WMEA 2W1QA 1YQCA 4ONUA 5FWJA 1NG0A 1OURA 1O4YA 1ULFA 1W90A 3ZN4A 5AC92 4KH9A 4XHXA 1RHI3 1FPN3 1RUJ3 1PO12 3A4UA 3HQXA 2LM3A 3BCWA 1N3QA 3OUIA 5H9PA 3ACLA 1QY4A 1UNBA 2YU2A 1HN0A 2VC9A 4FSJA 2JENA 3HT1A 4MADA 3GBFA 3BALA 3BN6A 4NRPA 2X5IB 2C0ZA 2RR13 2XVLA 1X82A 2VM9A 3D0JA 2Y6HA 3CMGA 4ET7A 2SBAA 4PLMA 1PHMA 4QX7A 4QXBA 2JXAA 4L2NA 4QX1A 5F6KA 4B4RA 4GMP1 4QGNA 4QWNA 1C8M1 5LBCA 2VNVA 3J8F1 3LQCA 5FQ0B 2R042 4I30A 1KEXA 3T2QA 1COV1 4AI0A 3K4DA 5C3SA 1IOAA 1JUHA 4DZGA 2J22A 1FV3A 2JG9A 2E7AA 3AZVA 2E9QA 4BU2A 1B35A 4XFFA 2G9FA 5HCBA 3OD4A 2DCJA 4J1WA 4NO4A 3SCGA 4AL9A 2QQKA 2Y0OA 5CNAA 3LA3A 4XTPA 4MXWA 2NYYA 3POIA 2JICA 1WW5A 4YGCA 1DZTA 2ARAA 4RS5C 1LHWA 1UO9A 2RG4A 2YC4A 1NCQB 1NKGA 3D3AA 5HCFA 3ZMOA 5FZ7A 2Q8CA 4YW6A 2G9ZA 1R1A3 3MW3A 2V73A 1LEDA 4Q4Y1 4X6RB 3KV5A 1AJKA 4P9IA 5DDJ3 2R49A 1NUKA 1UYPA 1YQ5A 2QQJA 2A73B 4R9BA 3N7KA 4JGYB 3SITA 4BHPA 5JPNB 5LA0A 3KHCA 2K2SA 1ZZBA 2VZRA 5E16A 2IXKA 3ACFA 1OOPA 2NMOA 2WUHA 3ILNA 3LE0A 4K20A 3O0WA 4WM8B 4YGBA 5J7MA 2VL4A 1TME2 4B1MA 4KBZA 1RL3A 3ZSMA 3ZYGA 4BOWA 4YNIA 1PGW1 3PUAA 4CP1A 4NN0A 2WZR3 1I9RA 3RI9A 4COYA 4YVSA 2BERA 3KVAA 4ZZ5A 4BK5A 5IVBA 5DG1A 5ANNA 3IAPA 2TEPA 4FAGA 1BBT2 4XMAA 5KC6A 3GYDA 4N53A 5EYXA 2W92A 3I49A 2W5FA 1CAXA 4IE5A 4ZHNA 4AR2A 2VW2A 3FLPA 5KBFA 4G9SB 1GOGA 3HQRA 1YUDA 4QT6A 3DCQA 1H2KA 3NAPB 3RI8A 1GYKA 1QH7A 3WY6A 3O1RA 2BGCA 1ZYBA 4Q29A 4FP2A 2W08A 2ZCWA 1JOBA 4PDWC 4ZXKA 4DEVA 2W1UA 3MGUA 5C33A 1CIWA 1PO21 3ZVXA 2FDJA 4XBNA 2E31A 5FJKA 4B7KA 1UYYA 2IFWA 5FP7A 3G7DA 4R9AA 4PIZA 2JD9A 3U37A 1UIKA 3NVCA 3DPRC 3R4UA 3M70A 2BJSA 2NLRA 2YV8A 2XJQA 4YG6A 3AP6A 1MS0A 1AXYA 4E4DX 1IG0A 1U5YA 2VMHA 4Q4X2 1FV2A 2WC2A 4CZSA 5FYVA 4ASMB 3JU9A 5GM0A 1OLQA 2BQPA 2XKOA 1RYYA 3MFAA 4QGLA 3THCA 5A1LA 5HV0A 4FTSA 2MHFA 2UYAA 3NNMA 4KGGA 3NJVA 1VMFA 3CU7A 3LOIA 3PU8A 1U5ZA 1UZWA 1ZBA3 3VHPA 2YZ4A 2CAVA 4NWWA 1J58A 1R081 1CAUB 1HKDA 3KB5A 4IEYA 4JV4A 4AOCA 4IETA 1OHFA 2XDVA 5BNOC 5JLVA 4A42A 4LO8A 2X5IA 4QB1A 1DQ6A 4GQ7A 4K1YA 1QHDA 4BXSV 1V9U3 5E88A 3ZIWA 2WWJA 1KRIA 1NA1B 3ZFGB 3T4VA 2WZ8A 5JUVA 1CGPA 3D8CA 5LB6A 5FYBA 3TRSB 3BGAA 1WMFA 4CCLA 5HV4A 2W1WA 1WW4A 3SCHA 1W6QA 1SFYA 1RUD2 3ELNA 3M3QA 5FY8A 3RFRA 1H9PA 1SLTA 5A32B 4CDQA 5FQ0A 5DDJ1 1Q8QA 4LQRA 1CVNA 3AP7A 1H8TB 2JKBA 3ZXFA 1ENQA 3CBNA 3UKTA 1LOCA 4CU8A 4RYDA 3BOPA 3FBYA 4NAMA 5FZLA 4JVAA 5A3LA 2YYOA 1W6OA 3VBUA 3MPPG 1YXWA 4PBOA 5L9BA 3IAQA 1RUF1 3VDCA 4CTEA 3FJSA 1ALYA 1C1FA 4JZRA 5ABJC 1O3SA 1SLCA 1OVPA 1D7PM 2FDGA 5FYSA 1ULDA 4DUXA 1F5FA 1AF9A 3E5QA 3I2JA 3RJ2X 5FYMA 4E4SA 2ATFA 1S0IA 4JGYA 5IK8A 1W3XA 5BV6A 2D6MA 2R0HA 4AVTA 4JX0A 3WP3A 5I8YA 4Y1XA 1VMHA 3M3CA 3RZHA 4KWKA 2A6WA 4WM8A 3DYPA 1L7RA 4QM8A 5CVRA 2CYFA 1WCKA 2HWF2 1AYM2 3ZDVA 1F5JA 2A7AA 2FCUA 5A6XA 3WVJA 4CDUA 3ABZA 5EIYB 1AR93 1QJX2 3ETPA 4FOYA 5JXGA 4DQAA 1DZRA 1SCRA 2ZEXA 4EN8B 4P5HA 3HPNA 4W6WA 3AKRA 1HB1A 2DCTA 4E2GA 1K5MB 4LKSA 1Z7S2 4BM8A 1J3QA 3LEGA 1QOOA 1DQ0A 1XYOA 2YMZA 1GR3A 2ZGMA 4NOTA 3TN93 1G9BA 2BPA2 4Y1UA 5A7SA 1J84A 2CAUA 1M4WA 5CFDB 2XUMA 4DXTA 2R072 5FY9A 1QOTA 5DAXA 2K46A 3THPA 4CPBD 2Y38A 4UXAA 3BPZA 4YRDA 2HWC3 2E51A 1UOFA 2A3XA 2PXJA 3NAPA 4UFIA 2BFUL 4XJAA 3RYRA 4Y20A 3PLQA 2YXSA 1H2MA 4GKXA 4CA9A 4YFZA 3WF0A 4OZXA 4AWDA 4CCCA 1JZ3A 2A71A 1CJPA 3OSDA 4FXKB 1NCRB 3UK9A 5A1AA 1ZBA1 4LA3A 4A7YA 1J83A 3EMRA 5FZOA 2P34A 4XUPA 3E5UA 3GXUA 3KV6A 3B3QE 2LUWA 1BK1A 2VMFA 2XLFA 4I3GA 1QJU2 1UU6A 4AVBA 4JAAA 4P9JA 5C4WA 2GP3A 4BQ1A 4MVTA 1ZZCA 1V9U1 3E6CC 2DVAA 3IDEA 2P3KA 1UZ0A 2VUDA 2JECA 2ZZQA 3DYMA 1RJ7A 3QD6A 4E2SA 5FZ1A 1UCXA 3GBGA 5JOYA 4AFMA 4BIFA 5JXJA 1RGSA 1JOJA 3ZIXA 5FZ4A 1XB9A 4B29A 3RZKA 2YY1A 3VBOA 1WCSA 3NNJA 4QQHA 1W8ZA 1JMUB 1XNTA 3RZZA 1QF3A 2EF6A 3TNPB 1VMJA 5FP8A 3ZDSA 4O7XA 1CPNA 3FLTA 3WT3A 1EAH2 2JDHA 3WHUA 3MF9A 2RHPA 2EALA 3C2UA 3IN9A 5J96B 5C8CA 2VBBA 4DUWA 1CX1A 2ARBA 4JHTA 4KG0A 3V0AA 2IXCA 4OVEA 1WD3A 3JBG2 3LDBA 3AL6A 1SCSA 4NROA 4OHXA 4RS5B 4YM0A 4BQYA 1PX3A 3U11A 3VGIA 3OG2A 2AZ5A 3PVEA 4JGZC 4N7UA 3ZFEC 3OUHA 2IVJA 5C5UA 3I2DA 4WVMA 1PGL2 3T1LA 3AP9A 3I2FA 1A3KA 1DIWA 1HQWA 1UL9A 3E97A 3EBRA 3I2GA 3N9QA 2E7TA 3H50A 4XF0A 5FR3A 5DQ0A 4QKDA 1SFPA 1KGYA 3DKQA 2V09A 4H55A 2Q30A 2W1SA 4BPZA 2VZOA 2JWPA 4GD4A 4ZONA 3TN91 4GWMA 3OGSA 3UV9A 4KWUA 3ZMNA 1XYPA 4HZFA 1AR83 1FOD1 2WO1A 4WM7C 3WNXA 1I6XA 3FHQA 4W4ZA 3DUIA 4RGAA 4RN5A 5GZFA 3LZZA 2A6VA 2GH8A 2RS12 3RS6A 2HWC1 3H0OA 5FUNA 1RUE2 1T6GC 4H14A 3WNKA 3CHXA 4K8FA 1VBD1 3OBTA 4MXVA 4PQQA 2XBO3 1AR72 2TBVA 4LIVA 2J1AA 4Y24A 2DUPA 5FY4A 1OPMA 4MHUA 4NPLA 3WV6A 2XHNA 1LHUA 3QOPA 2HWE3 1N3PA 2VTFA 4KQ7A 5F5QA 4TLFA 5GKAC 5DUUA 4W8JA 2N7GA 4G3YC 2QBXA 3WF3A 5IW0A 1IS3A 4PDWB 3E6DA 2ZGTA 2R0FA 2D97A 1EPZA 1PIV2 4K40A 5C71A 4LKDA 1EV12 2ARCA 2ZX1A 1WD4A 1LHNA 2B42B 1WLWA 2EAKA 2WSVA 4QQOA 2FZ2A 2JDAA 5FZEA 2ZX3A 4QQPA 1LOEA 1RMU3 1W0PA 1NCRA 1IHMA 5DN2A 3I3MA 1MZ6A 2DFCA 2D7FA 3ZOIA 2BNNA 1X8EA 1QJY2 2YGLA 4EV0A 2ZAAA 4HSJA 4S2HA 3ZSLA 4C1WA 4DFSA 5KXCA 1VE0A 2W39A 3DECA 4FFGA 2BBVA 1WGPA 1X50A 4H7LA 3VDDC 5LK7B 5DUXA 4AQ6A 2OT7A 3LSDA 2OUHA 4LE3A 4TLGA 4K21A 2A75A 4UFKA 5LA1A 2J1EA 2JX9A 2BGOA 2W52A 4DXZA 1MS8A 4N8MA 1HV0A 5BNOB 1G9FA 1N47A 4XDQA 2A3YA 1D2SA 2NP0A 3I2IA 1FAYA 1HB2A 1AX0A 1QJEA 2HWB3 3NO8A 3NW4A 4LO5B 3MZHA 4QMAA 2R1DA 5FLJA 1MEC1 1OLRA 2Z4FA 3E1F1 3I8TA 2D98A 1VBC3 3WQ0A 2YBPA 1YJLA 3M1HA 5FXXA 2RM21 2GC0A 4BQ2A 4QXKA 2QQPA 2IUWA 3MUZ1 4AVVA 1VR3A 2PHDA 1PK6C 1DYOA 1VRH1 3SXWA 4BIOA 3L9JT 1RUI3 1XNDA 4CVUA 2VMEA 1AZDA 1X7NA 4ISQA 1HB4A 4YGDA 1QQP1 4WVZA 1CJDA 2VMDA 4YW2A 5B2GB 4BQ4A 5FO8B 1D4M2 1HW5A 1XC6A 4QU1A 4RS5A 4EJRA 5IVVA 1S0FA 3ZYHA 3HNMA 2Q1ZB 4URTA 5ABJB 4IE6A 1FNZA 2VZUA 2C9AA 4OMCA 5ERLA 5GZDA 1AR81 4PI0A 1HRI3 1AR62 2ZHLA 4BLIA 4AG4A 3R6SA 1LENA 4QPGA 3RZGA 2RS32 2XJPA 4FPLA 2B46X 2IXLA 3AMPA 3KGZA 3APBA 3N7JA 1RITA 1POQA 5FTTC 2QJVA 3S7EA 1NE4A 2XBO1 1UMIA 1PZ7A 3VDAA 4M3CF 4FFFA 2Z2SB 3O7OA 4LBMA 3ROUA 2GNDA 3ZPYA 1PVC3 2RMU1 3CZJA 5A3OA 3CLPA 4FPEA 3EB7A 4PIXA 1RUC3 2FBEA 2WAOA 1DGRN 1YEWA 1UQXA 2CU5A 2WA4A 4ORFA 3POFA 4Y22A 5LEKA 2TNFA 3GJBA 2CWMA 1W2AX 2D3PA 1PMIA 4XILA 3VZLA 1YO8A 1GZWA 1SZBA 1AYN1 3A0NA 1GBGA 3J7LA 4LBJA 5KHGA 5GZCA 4KL1A 4AYUA 1UYXA 2WNVA 1D2QA 4AAXA 5FZMA 1ZRDA 1W3VA 5A33B 5JI9A 1JH5A 5CA6A 4IEXA 1MS9A 1RMU1 2LTNA 4LBQD 1GZCA 1W2UA 5JZGC 3CZUA 2BNMA 2WZEA 4Q4W2 2PHFA 1Y4WA 2VECA 3PUIA 3G6JB 1SLIA 4NPRA 4I0WB 4PDWA 4NHMA 4FVVA 1IS4A 1CAVB 2PHRA 3HWJA 1LHOA 3KCXA 2EIDA 2Y0IA 1XJAA 1PGSA 4A44A 5CAZA 3KM5A 1W2NA 4ASKA 3JXSA 4YSFA 4LMFA 4HN0A 3PURA 3DPRA 2D6OX 3TAYA 1MS4A 3OBZA 1RB8G 2ZABA 4MV2A 1W9FA 4D3WA 3RPQA 3TNQA 3LIHA 3WD5A 4AI2A 4ZS3A 4FOQA 3WNMA 4QX5A 1TMF2 4CU6A 5M0TA 4JTNA 4R9DA 1AX1A 1W03A 5GALA 1JYWA 3WG1A 2VUAA 1I5PA 3X29B 1DYPA 1VBC1 5FPLA 2JE9A 4ITCA 3OCPA 2VAUA 5DABA 3WINE 1GWLA 1YRZA 4QPIA 2PQSA 2WQ4A 2ET7A 2OZ6A 4DIQA 4I02A 5ISLA 1W9SA 1GICA 1RUG3 1NXD1 1K5JA 3DN7A 3LFMA 1IG3A 4JCKA 5LBEA 5CBLA 4XYXA 1PZ8A 2Z5WA 3ATGA 3D6EA 5F5IA 5JPMB 2RS51 2W9XA 1F8VA 4EYUA 1Y9QA 2E63A 4GAZA 5CU1A 5CADA 3K4AA 1JZ7A 3RYKA 3IPVB 1VBB1 1VBA3 3C3VA 4YZ2A 4YFWA 4Z1VA 2VH9A 4IXLA 3OYWA 4CCNA 5LASA 1OC1A 2ZGNA 3POBA 3OGRA 3RDIA 1J3PA 1QDOA 1XU2A 5A70A 1KJRA 1EUUA 5LWBA 4G4FA 4Z8BA 3ZXEA 3NV1A 2ZHNA 2GMMA 4OLLA 1QXRA 1SDDB 2A6ZA 2XPJA 5A3MA 4CUCA 1PVXA 2NMNA 4JGZB 1GNHA 3ZFEB 4OI0A 4FPKA 4W6YA 4PBPA 4EWDA 1JHJA 3WCSA 2AGSA 1PX4A 1UX6A 3AKSA 1W8HA 5FPZA 3SEEA 3WF1A 3V56A 4O9EA 5ABJA 4LA2A 4NUBA 2GH2A 1AL0G 3AZWA 2V72A 3WQBA 1RUC1 5J37A 3RWNA 2VY0A 1SQ4A 3MEPA 4HG6B 5FY7A 4IV3C 1PM4A 4CDXC 1OQDA 5BYNA 2GN7A 5JOXA 1O7FA 3TB0A 4AQ2A 4DRVA 1SACA 5APAA 1O91A 1N1VA 1IKQA 1HQNA 1W6MA 4IEUA 1ND2C 2AREA 1H1IA 4WM7B 5HXMA 4GULA 4CDWA 1RVF3 5JWPA 5C70A 2BYVE 1RXFA 2BTVC 5IK4A 1OT5A 1KD7A 5FFOC 2JE8A 5A3WA 2UY8A 4IQPA 1L7QA 1HXS2 1NY71 2R043 1YFUA 3GGLA 4JDMA 5FYIA 5C3QA 3BVCA 2QTWB 4JC1A 4UI9L 2Q1FA 5FYUA 5F1RA 5KHKA 3B9IA 5K0UA 5C3PA 3WUCA 3MYXA 4GH4C 1OKQA 3JD72 4FPYA 5A33A 4COZA 2OS2A 4LXLA 4AHXA 1LB2A 1GOHA 3MV01 5KHHA 5C6CA 1A8MA 1Y9GA 4HT1T 1SLAA 3Q8FA 3H7YA 1W8TA 5H9QA 3VBSC 1QWRA 2ZX2A 4QU2A 5IVYA 2GSYA 5F5AA 3VD9A 3ZKYA 2JD4A 1OPOA 5A3TA 4IV1C 1VBE1 5LBFA 1WCQA 3ZXGA 4NIDA 1TQ5A 1F15A 1T2XA 1UIJA 4P9GA 1AJOA 3CEWA 2VUJA 3QBQA 5E89A 3VB9A 1JW6A 4LULA 4X8NA 4AW7A 1WA4A 2DURA 2VBPA 5FKBA 4MZUA 4RGKA 1RUG1 1TME3 2OX0A 2BUKA 1Y9MA 2Y64A 1I5ZA 3DKWA 4DOUA 3I59A 3CQOA 3VDDB 2Q8DA 2HWD2 5FIXA 2A1XA 3R0RA 4LKFA 3AYCA 4OCTA 5FXVA 1H2NA 1V00A 1VBA1 3UT0A 4AK3A 3TEYA 4XAEA 4W50A 4QX8A 2I2SA 3MHZA 5FK8A 1UZZA 1BBT3 1KJLA 4XFHA 4Q1PA 2ZGLA 1UKGA 3U1XA 4AFAA 2E53A 1YFXA 4Y4RA 5FZBA 3I2OA 2A6YA 1KFUL 3VBRA 1DGWA 4OUMA 4XTMA 2YPJA 3B9CA 3ZYFA 1MZ5A 1W0NA 2PQQA 2Z79A 2QE3A 2P6HA 3OEAA 2V4AA 4JRAA 1IQDC 4I09A 3T3YA 1W6NA 1XYNA 3LWCA 4FCAA 4IGQA 4EROA 2OKXA 4I2OA 4RL7A 5FYYA 2OPWA 2WFF1 5KXEA 3NSTA 4QHBA 1N1TA 1PK6B 2WIIB 5I0DA 1V6LA 1TE1B 3WF4A 3NJYA 2E32A 4LO4B 2FDFA 3HVDA 4GB31 1C57A 4KWLA 2A5ZA 1WZXA 3AYAA 3Q8BA 2YFUA 1JU4A 2Z42A 2JB4A 2B4KA 2PELA 3FHAA 3HR9A 3NKTA 4EN9B 1SPPA 2QUOA 1PMHX 5IAXA 1C8M2 4Q4X3 3T0AA 4CXXA 1VRBA 1DQ5A 3J8F2 2B9VA 3FUOA 4UFJA 2RDSA 4FOWA 1QEXA 1RVF1 1O5UA 1COV2 2Q1MA 4JKKA 1XBFA 2RJKA 4Q0UA 4QD2A 3U4XA 4P02B 2FCVA 4FOVA 2WL1A 3MLJA 4WVVA 2YROA 4XEZA 1JZ4A 3VDBA 5CG9A 2BVBA 3SHRA 2B45X 1IPKA 3LSEA 1V6KA 2ZGUA 4AVSA 4ES8A 1EP0A 1OQ1A 1KFXL 1X8MA 1YI9A 3INAA 4N43C 4XXPA 3EHKA 4N9HA 5F2WA 2JE7A 1GP4A 3GHNA 2F17A 2PHWA 3TEZA 3W5NA 2ZTNA 4R4XA 4A3ZA 2ZXQA 4QDSA 4Z2WA 4K6BA 3M3IA 4WV8A 3K75B 3J7NA 3OOXA 5JIUA 3BTAA 3OGGA 1H4HA 3FUQA 4BMBA 4XFCA 2WS92 3VZKA 2ZS6B 1AXZA 1AL22 4FQ4A 3H3LA 2BEOA 2GAUA 3S6PA 1FMD3 2GZWA 2FDKA 1RUD3 2UU8A 1R64A 1CZVA 4QDRA 1W06A 4UW6A 4GJZA 2JG8A 5FZCA 3J7HA 4NVPA 5L7OA 3SLIA 4E2QA 5JAXA 5JZGB 1JYCA 4F7ZA 1PGW2 4CEWB 3VHNA 2VXRA 4P9LA 4MG2A 3LPFA 4K9SA 3ZXKA 4KU8A 3MIEA 4JKLA 4L11A 2BRTA 4AI1A 2RDNA 5FXWA 3ZYBA 2GP5A 1UOJA 4A6OA 1FXZA 3AC0A 2ZJCA 3I3QA 4A7KA 5C8CB 2OQ7A 5FMBA 5JVVA 3F95A 1GLHA 1JODA 1AUYA 4D7YA 3MBWA 1CZSA 1KDMA 1KS5A 2BGPA 3MIHA 5A7WB 3WF2A 1NLSA 5EHDA 1SBEA 1REFA 2Z69A 1K42A 4XZPA 1WMXA 3W59A 1RHI1 3EXUA 2HWF3 2J1RA 5KWRA 1AYM3 1BQPA 1FPN1 1RUJ1 2VW0A 3MV11 4YPJA 3VDDA 3DYOA 1QJX3 3ZPOA 3IDCB 2SLIA 2VPVA 2NQYA 4PF1A 4PLOA 4A7ZA 1GFF2 5L9RA 3T2PA 4QXCA 2RR11 3B01A 5I0TA 3H8UA 3IBMA 1ND3C 3OBAA 1Z7S3 4B4QA 4DY3A 3OUJA 1UW8A 1CWPA 3IT8A 3FHIB 1HDKA 1NAEA 1NXMA 3S7IA 3WG4A 4AF9A 4HOOA 3CNAA 2V5DA 5EPAA 1FI2A 2ZGRA 1VP6A 2XL7A 4P5YA 2R073 1DU3D 1EYBA 2ZEWA 2GU9A 2UWAA 5GLVA 5LATA 1UWWA 3N9OA 1ULOA 4HETA 3KGLA 4XFIA 2J42A 1YIFA 1B09A 4Q4X1 3H42B 3ILFA 3MFCA 2VBDA 4D7TA 2HJIA 3I3BA 1R082 3AKQA 3SNMA 2G9GA 2QQOA 4FT8A 2VZ1A 5I0RA 4MGZE 2YB7A 2FCTA 2KM2A 3I54A 3M3OA 2Y6JA 4RGGA 1ZZ7A 3S30A 1MS3A 3AZYA 3VD5A 1NQJA 2VULA 3IKWA 4HSLA 4UFMA 4XF1A 2DV9A 1W99A 4XUTA 3AMNA 2UURA 1QJU3 5JMOA 5HI0A 1ONAA 1R1A1 4UW3A 5FP4A 5CIRA 1V6IA 5IVFA 4GA9A 4QB2A 5FZAA 4XBLA 2QFEA 4ES9A 1S2BA 4DO0A 5DDJ2 4FTBA 3CL1A 1JXNA 1UOBA 5FYCA 5T3NA 3UKVA 4IV3B 4CDXB 2MEV3 4HMZA 4JDNA 3LIGA 1FMD1 3LEMA 1L3JA 3PHMA 1RUD1 3O1UA 2EICA 1NCQA 1LR5A 1RUF2 1ND2B 1ZZ6A 4IE4A 4ATFA 4CXWA 4AAPA 2WZR1 3H1YA 2IC1A 4IUGA 4QHOA 3RZMA 1WWYA 4XUQA 4WZFA 3PIGA 3HIFA 2B7YA 3O14A 3CDZB 5T5JA 3LA2A 4ATEA 5FY1A 5BNNC 1US3A 2WFPA 1X9PA 3NL1A 2JEMA 1KQRA 2WA3A 3GZTB 2WNEA 2ZX0A 4XQ4A 1Q8VA 2VO5A 1EAH3 1QKQA 4YVWC 4NHKA 4Y1VA 1RUOA 4BYYA 2ZHMA 3CJIC 3D4KA 3ZLIA 1PMJX 5GLTA 4FI9A 4GH4B 1MACA 2ES3A 5FYTA 5JOZA 2Y34A 4OUEA 5FZ0A 3PNAA 4AEDC 3M8LA 4L8QA 4CCOA 1BCXA 4CP9B 3JBG3 3ZYIB 4Q27A 4UFHA 4FXGB 1A8DA 2ZAHA 3RMXA 2DVGA 1VB2A 2R30A 1WUVA 4RQPC 3VBSB 2DVFA 2C24A 3ETQA 4BZ4A 5HCHA 5LY1A 5D8AC 4RSUA 3M7AA 4IV1B 1QH6A 1E5HA 2RV9A
chains in the Genus database with same CATH topology
2BFUS 3V0BB 2DWRA 2ET1A 4UW5A 3KLSA 1VALA 4C91A 1DG6A 1URXA 3KS7A 3WHTA 4XIOA 3H3UA 5CFCC 3S0MA 5EWSA 1UU4A 3R4SA 2CGNA 2XH6A 3P3PA 2DFBA 2R071 1WMDA 3CO2A 2XKPA 4PJYA 2VNRA 2RS13 4XMIA 1RUE3 3ALQA 4RD7A 1G86A 2P3IA 1AR73 1AVBA 4AHZA 5DXDA 4HPKB 1GKBA 3WW4A 1G9CA 3WLUA 4DNYA 3H9AA 1UN1A 4P14A 3VBHC 1CAUA 2QKDA 2XJSA 4QQ2A 3WG2A 1NZCA 1PIV3 5FCCA 3WCRA 1WCDJ 2XVKA 3PTYA 4LO7A 1NA1A 3ZFGA 1AHSA 2MEV1 4I0BA 1UF2C 4P9XA 2PAEA 4C1XA 1TEIA 2EA7A 2ZOEB 1QJY3 1DZQA 3Q9OA 3WUDA 3POYA 1VIWB 1LHVA 1R093 4XHBA 5A32A 5FPXA 1TNRA 1YFYA 1H30A 5F9TA 1H8TA 4MGIE 3RNSA 5D1IA 4CYDA 1VJ2A 1OA2A 2EXIA 2PLV3 3AK0A 3ES1A 4CDXA 4N43B 3VV1A 1DFQA 2FHRA 1S0DA 1AR91 2A70A 3AXDA 2XJRA 1FNYA 2C1FA 3W9AA 3NV2A 2ZZJA 4DY5A 3O0XA 4FBFA 2VQ0A 3LGRA 5EZWA 1ZM1A 1BEV2 3ILRA 3V64A 4EN0A 1Q8OA 3J4UH 4AVCA 2I74A 2VMGA 5DG2A 1DQ4A 4C90A 5KC5A 1LGCA 3DV8A 2JG9C 3VKLA 3ZN5A 4DS0A 1SLBA 4I3PA 4GH4A 4R4ZA 2Q0AA 3MI8A 1FOD2 1H8VA 3U07A 1D4M3 3POSA 1K5MA 2QNKA 2R062 1RUH2 2D44A 2NPIA 2HWC2 4XJWA 3AYEA 3K51A 3MIBA 1BMV1 4XF4A 1AR63 1VBD2 4AFBA 4XFBA 1MS1A 1O3QA 1JN2P 5CFDA 5C9AC 1UZYA 2RS33 2DCZA 2WNUC 1G9DA 3V0BA 1OOPC 5EFUA 1LECA 4YYOA 1OMIA 1PM7A 1N3OA 2WLPA 2BWAA 4UBGA 4S2FA 1AXKA 1UPSA 1GQHA 4Q0QA 1DLLA 5T54A 4NR1A 3BODA 1ND3B 5FOBB 4Y4YA 4DB5A 3AYDA 3R4DB 1MZEA 1C5IA 3PMSA 4Q8LA 4ZU5A 1C4RA 1XNCA 4N53C 2XWBB 4IEOA 3VZOA 4SLIA 2VOXA 3N35A 4O9GA 1WW6A 1Y3TA 3BIWE 3PMEA 3V65A 4Q4W3 1VAVA 1LGNA 3FE5A 1QJY1 4KNCA 2DF7A 3ZXAC 1R091 4Q4V2 4KWJA 1ZRRA 1LESA 3B93A 1DBNA 3WQ1A 1QXJA 1RC6A 2ENRA 2AH2A 4IEPA 4Y1YA 5J98B 4CP2A 2PLV1 3AXEA 4U2AA 3OPZA 1MEC2 2R6QA 4MX3A 3WDXA 2RM22 1TMF3 4MLOA 4E9KA 2DU1A 4AI3A 3OF1A 1HLCA 4YZ3A 1YNAA 4D94A 1VRH2 4WVWA 4GXLA 2X8KA 3ZXLA 3WDTA 3FZ3A 5ACA2 4LHNA 1QQP2 3LB9A 3ZN6B 4AGGA 1H9WA 2DVBA 5T50A 3ZYJB 3RQ0A 1W0OA 4C0HA 3WDUA 2AUYA 1I3HA 5L73A 4HN1A 1RJ8A 5K7PA 5BNNB 4HANA 1UMZA 4OHWA 2DVDA 2XJUA 4I01A 3PJQA 4YVWB 1OA3A 2HWE1 3CJIB 1AR61 4CDQC 3JQWA 3KCYA 1QJZA 4AEDB 2XGXA 2WZPP 3KT7A 4LLOA 4F83A 1H4GA 2RMU2 4SBVA 1MQTC 4R52A 4RQPB 3USUB 3VBUC 4LHLA 3B94A 4N7IA 3AX4A 1LEMA 4NHLA 2H6CA 4Q0PA 5D8AB 1JTZX 2BNOA 4RHV3 1AYN2 3QH6A 4LBQB 2ZACA 4CEWC 2OZJA 1GNZA 3ZSKA 1REEA 3AKTA 3B7MA 5CFCB 3VKNA 2Q8OA 3WP4A 3NV3A 4BLJA 4GWNA 2XJTA 1QXPA 2PHUA 1ASJ2 1ZRCA 1BXHA 4CDUC 2A6XA 2FZ1A 2PA7A 1MR5A 4IERA 2PHXA 3GALA 1HIXA 3U10A 3AJZA 1EY2A 4B7EA 5EYYA 1HXS3 4GIQA 2GALA 3ZYPA 5DUVA 3ECQA 1ZX5A 1REDA 2HWB1 1E57A 3M4FA 4BMEA 4KG8A 3JD73 2ILMA 5K9YA 2D93A 3VBHB 2F4PA 1Q3EA 5I0SA 4LUMA 1VAMA 2G4IA 4IEVA 4CRQA 2VVDA 1YJKA 1VBC2 3N4MA 1ULGA 3ASIA 1RUI1 5BNOA 4N9IA 2WSUA 1W6PB 5J09A 4JRLA 2BVVA 2JJ6A 4OUSA 4V1PA 5CG8A 2RS52 1LJ7A 3WXPA 2WKKA 4XJ9A 4MGYE 1VBB2 3LCPA 2HEVF 1HRI1 1OFSA 3HAGA 3JCIA 2IXJA 2HWD3 3SISA 4XFAA 5C4WC 3O5SA 4Z82A 1CN1A 1QMJA 1F2NA 2ZKNA 2H6BA 1VLNA 5E1RA 3BU7A 2ERFA 2KXLA 1XXNA 3ZN6A 1HRV3 2ZMNA 4AVAA 4U36A 1PVC1 4AHYA 5AC93 3VBOC 2D6LX 3AMQA 1PO13 2B5HA 1SFNA 1ZNPA 2R1BA 1G7YA 4B3NA 3OTFA 2PAKA 5E8AA 5BNQA 2O8OA 5BNNA 3AP4A 1A6CA 2OPKA 5LRRA 4BH9A 5BPXA 2OUJA 5AVAA 3VL9A 3FBMA 4RHV1 1WW7A 2JG9B 4META 1RUNA 3B02A 1B35B 5IK7A 3FMGA 4MXWB 2R32A 1LODA 4KU7A 3U0ZA 3P3NA 2XG3A 2NM1A 4GMP3 1C8M3 3USUA 3WQ7A 4AQTA 5HBAA 1NY72 5JMCA 1Q56A 4RR3C 5D8AA 1CAWB 3OBRA 1COV3 5AFBA 2QDRA 3N7MA 1O5LA 2KA3A 5C9AB 1OD5A 1LOGA 2WNUB 1KS4A 2A3WA 3PJYA 2LALA 1BZWA 1OOPB 3LOBA 4QQLA 3VKMA 1QDCA 5CFCA 1CAVA 1IKPA 1BVP1 1JBCA 2VG9A 4BA6A 3JD71 1XQNA 4IESA 1ULCA 2WT2A 5HXVA 1VBE2 4FPHA 1D0HA 5J3UA 2WS93 2GNTA 5JSPA 1ZBE2 4XF3A 1AL23 4IEWA 4PCRA 5FLIA 2IZWA 3VZMA 3GBWA 4F3JA 4XETA 1C3HA 3GNEA 4N53B 5IT6A 3TOJA 1CAXB 2D40A 4XW3A 4QM9A 4R8HA 1Q5OA 1XE8A 3KZ4C 3WOGA 2DCYA 4LBKA 5C8WA 2WWSA 4UW4A 1ENXA 4OFGA 1IS5A 2ZGOA 2E6VA 1MS5A 4N90A 2D3SA 4XFGA 4L99A 3DF0A 5IK5A 3MF6A 3CF6E 3IPVA 1LRHA 2FMDA 2ZGPA 3PVBB 4H7MA 1WBLA 4HVRA 1HRV1 1VAKA 1JHNA 1YWKA 5AC91 4BCUA 3KT4A 2WFF2 1O4ZA 4FPOB 1PO11 1UPIA 1WLDA 4I0AA 3ME2A 1SBDA 4Z07A 4GB32 5DZEA 3O12A 4JGZA 3ZFEA 2P17A 1BYHA 3WP5A 1J1LA 3AKPA 2XHKA 5KXBA 2E7QA 2R16A 4AEKA 1CQ9A 4AI8A 4C0BA 1DYKA 3WDWA 1UD1A 1CONA 1LCLA 3IMNA 1RVF2 2XB6C 5FO9B 4IL7A 2IXIA 2R041 1XU1A 4W65A 1LKNA 4OHZA 5T5PA 4XIKA 4YZ5A 1R083 2PAMA 1W6QB 1ZREA 2WT0A 4CDQB 2XWJB 5GLZA 4OHVA 3I7DA 3NJZA 4GMP0 2QCSB 1UAIA 4WM7A 5LRSA 4Q4Y2 5GJ6A 3VHOA 3SH5A 3PVOA 1LU1A 1FATA 1MQTB 1W6OB 3QLQA 5SV5A 3VBUB 4B8EA 4DMIA 2D6NA 2C5DA 2V5YA 2CL2A 1DQ2A 2D5HA 1IS6A 3USSA 3N3HA 3TWIA 1CAWA 1GZ9A 4UBHA 2XLGA 4QPGC 2WS91 5C9AA 3J9SA 1AL21 1TME1 2WNUA 4XE9A 1HV1A 5LEJA 4M3CB 3NV4A 2HKXA 3KSCA 1RUF3 3BB6A 4MSVA 1Q8SA 4CDUB 4EN7B 4YW3A 1BBT1 1SEFA 5BNPC 3OGJA 3AFGA 1CESA 4D69A 1CX4A 3UKNA 2OW4A 4OI4A 1HQLA 1PO22 3FX3A 1U5XA 2WNVC 3JQXA 2CGPA 2MPFA 2VVEA 2CV6A 1RHI2 2WLQA 2CY6A 1FPN2 1RUJ2 4MUVA 3MDPA 4FPCA 4ZU4A 3GZAA 1JYIA 4A2UA 5GZGA 4DINB 4HKWA 2CWSA 4Y20B 4TZDA 3KMHA 4E4ZA 4YM2A 1POV3 2RR12 4AQSA 4ASLA 3AP5A 1LOFC 3L2HA 4OI2A 4FP3A 4HLTA 2ZGQA 1ENSA 3ZFFC 5HCAA 5L36A 5J48A 3RG0A 4QGMA 3VL8A 1M06G 1PK6A 5C4WB 5T55A 1LGBA 3BOWA 4KGQA 3JZVA 2RJLA 2JDZA 5I8SA 2H0VA 1RIRA 1DQ1A 4H3WA 1ENRA 4QPIC 5DZFA 4J1XA 2B9UA 4IEQA 5KHIA 4AXOA 3MIFA 1S1AA 1EPWA 3IIAA 1R1A2 3VBOB 3MPBA 3JB8A 3AZXA 3H1WA 3SH3A 2HEYF 1R1ZA 2QVSB 1YLLA 1YI7A 1LULA 5BUVA 3WR0A 5JOWA 2HYKA 3MLLA 1FMD2 3OJBA 4GKYA 3FFQA 3QCWA 3V0AB 1G8WA 2WZR2 4IEZA 2X53S 5BY5A 3VBFC 1O3RA 1MQTA 4L9BA 3KQRA 1BVVA 4M0NA 3TBDA 4WVMB 4RR3B 3AFKA 4LBNA 4K1ZA 1QU0A 5JZGA 4Q0SA 5KXDA 4CEWA 3RMYA 2EIGA 2ZKLA 2ZMLA 3FWEA 2NN8A 3NKGA 2HWF1 4M3CA 3UJQA 1AYM1 5L19A 1D4VB 2IWGB 1V6NA 1QJX1 3IM0A 4CDWC 3SH4A 5SV8A 3FC0A 1V6JA 4PIYA 1G6NA 1DHKB 1Z7S1 3POWA 3WZ1A 2GNBA 1BEV3 3TYJA 4BE3A 5T5LA 2WQZC 1POV1 1QNWA 5LK5A 3R05A 4CEYC 2H0BA 2DUOA 5FRAA 4YLZA 4K3UA 2ZX4A 5K0UC 2I07B 2VVFA 3E6BA 1POV0 4YW1A 1FOD3 2ZBJA 1ZBA2 3GZUC 3MW4A 1H2LA 2R063 1RUH3 3W58A 4YM1A 3VKOA 3WG3A 2GMPA 1J59A 3QH7A 1V6MA 1VBD3 4X6QB 4XF9A 1BJQA 3ZXJA 4TSVA 1V9U2 3D82A 2D3RA 2MNGA 1S55A 2NZ9A 3AJYA 1C8NA 3RYPA 3UL2A 1QJU1 5BXXA 4LHKA 4YW5A 1V6OA 2AR6A 2VW1A 1I1EA 1D0GA 2GC3A 1EV13 3RRDA 1XNBA 4FPGA 3VHRA 3N7LA 4EN6B 4AE2A 1DGLA 4M3CE 4EWEA 3M2MA 1H0BA 4B4PA 2MEV2 1N1SA 2GNMA 3E5XA 5JSRA 4CP0A 4XJZA 3THTA 4AEJA 1DGRA 2EXKA 1S2KA 4GALA 3VBRC 3HD8B 2X29A 5JR7B 2PN5A 1EAH1 5GZEA 3WDVA 1MVEA 4IV3A 5I91A 3H7JA 4XJ8A 2DCKA 4XOGA 4AGVA 3O0VA 5GLWA 4Q4V3 2VU9A 1J3RA 1ND2A 3JBG1 4KBBA 4LNVA 1AR92 5K8SA 1A78A 3KCCA 2IFRA 3IWZA 2YDEA 4Q26A 1IQAA 1PGL1 1MEC3 5KHJA 4JTOA 3WW3A 1DGWX 2RM23 2CGOA 3TN92 5AVPA 1B35C 2RE9A 1ZZ9A 3J26N 4RR3A 4X8PA 1H1AA 1VRH3 5EV7A 4JDOA 4QPGB 1BEV1 5ACA3 2UYBA 1QQP3 4YG0A 5TSWA 2W68A 4XQWA 3VBSA 4LE4A 2D6PA 3VZNA 2O1QA 2VOVA 4IV1A 3RSJA 4ZKTB 2BWCA 2ETEA 2PFWA 1BMV2 2RS11 2B39A 5BNPB 1RUE1 2GC2A 3EQEA 4Y22B 3UJOA 2R061 3LAGA 1RUH1 1AR71 1WLTA 1VB4A 2ZA9A 5AFEA 2O8QA 2OYZA 1GZWB 5JCTA 5J36A 3OY8B 2WNVB 4DRRA 1H1MA 2DU0A 3ZO0B 1J1TA 5JDBA 2JG8C 2OVUA 1S0JA 2VGDA 4YVSC 5L7OC 2D6KA 2D43A 4COUA 2RMU3 2GC1A 3B5LB 1PIV1 3VZJA 1LU2A 4S2DA 1OQEA 4PLNA 1EV11 3H1MA 4HL0A 4XXAA 2VNGA 4HPKA 1YHFA 1AYN3 2ARXA 2GDFA 1WLCA 3ZFFB 3MLKA 3MIDA 3DPRB 1Z0HA 3WP6A 1QGLA 4AGRA 4TYSA 1OSGA 1NQDA 1CPMA 5FO7B 3H3ZA 2PHTA 2EXJA 1ASJ3 1R092 4PF5A 3L2YA 4FAHA 4YM3A 3AMHA 1IPJA 1SLLA 4HFSA 4AFDA 4EWAA 1Y7BA 2UY9A 2BW8A 1UU5A 4QPIB 4ZU7A 2PLV2 2AYHA 4HK8A 4Q4V1 3PVNA 4XQDA 2K0GA 1X36A 3I4IA 4HBNA 4XPVA 5T5OA 3WW1A 3ST7A 2P37A 1BKZA 1ZVFA 3EO6A 3ENRA 5FOJB 3AMMA 5I0UA 2HEWF 1S0BA 2W0XA 4YARA 4M0HA 4INDA 4FPFA 3OYWB 3VKFC 4XBQA 1GSLA 1CD3G 3T1MA 2DTYA 4L97A 3LKJA 4WBBA 1X33A 2EAAA 1YIPA 1LTEA 2X5IC 3AB0A 4N43A 1TNFA 3JUUA 3QACA 1AR82 4FO9A 4LLFA 1D4M1 1F31A 2PYTA 2RS53 3VBFB 1C28A 5ACA1 3WW2A 3SCFA 1VBB3 3HBZA 3N36A 2YHJA 2XBO2 4TWTA 1Q43A 4QPYA 3RJRA 1GQGA 2CTVA 2HWE2 1DF0A 1HX6A 3ZSJA 1YFWA 2RS31 1FX5A 2UWBA 4HKOA 2VQAA 1U0AA 5EXOA 3AZZA 3B00A 3VN4A 3WX5A 1OFNA 1QNYA 5FLHA 4YG3A 5EJ3A 3VLBB 4RA0A 1NCQC 3DL3A 1W6MB 4CDWB 1AX2A 4LBOA 4YZ1A 1ZZ8A 4ISRA 5F6LB 5DZGA 1U12A 1RMU2 2GMEA 4LT5A 4JGYC 4HVQA 5BNPA 4CEYB 4WM8C 3MIGA 2QDNA 2I45A 4RFT0 1DDLA 1JUIA 3KT1A 5K0UB 3OY8A 4YGEA 2FMYA 4NWVA 4Q4W1 4LUKA 4MYEA 3AM2A 3EJKA 5DUWA 1XNKA 4F8AA 4COVA 2QZ3A 1ND3A 2F6BA 2O0OA 3FFZA 3MW2A 5FAXA 1G9AA 1C1LA 5H9RA 3MICA 1ASJ1 4LEJA 1SDWA 4YZ4A 2WT1A 1ULEA 2HWB2 1LOFA 2FQPA 1GV9A 1FYUA 1ZRFA 4Z92B 4FPJA 2K9ZA 5FREA 3ZFFA 5I93A 3NAPC 2GN3A 2DYCA 1TMF1 2Q5TA 5H9SA 2YGMA 1S0CA 2D5FA 3I59B 1OI6A 3ZSEA 1RUI2 3NWKA 1NYWA 3GF6A 1Y43B 1YYNA 1LOBA 5FDBA 1VBE3 1APNA 4HK9A 1ZBE3 4DPNA 3GHMA 4HKLA 4MGKE 3T2TA 2AENA 2ZPXA 4OI1A 3CJXA 4M00A 5JIAA 4Q2FA 1HRI2 4S2GA 1PNFA 1QOSA 1WBFA 2B8MA 5CB7A 3VBRB 4Q1RA 4OHYA 2XVGA 1PNGA 3M3EA 2VOKA 4JQRA 1W6NB 3D0SA 2EVXA 1FT9A 4Y1ZA 3WDYA 4L92A 2TUNA 1O3TA 1ZA4A 1S0EA 4A3XA 1S0GA 2OA2A 2UWCA 2ZMKA 2Y26A 1PVC2 1GANA 1NOVA 3ES4A 1SBFA 4AHWA 1RINA 1RUC2 1NA1C 2YC0A 3ZFGC 3VBFA 2PHLA 4LO6B 4YVWA 3IDBB 5FMOS 5FBZA 1IGOA 4Y5Z0 2XL9A 2ZHKA 3CJIA 5C8CC 2WFF3 3DGTA 1C5HA 4RHV2 4WZCA 5FMOL 1H8TC 4AEDA 1KXGA 2YUEA 3D5OA 1KITA 2IXHA 2CNAA 4LR4A 4COWA 4GB33 4RQPA 1N1YA 3J8F3 1SMVA 2VNOA 1KDKA 4Q0VA 1Z78A 2EXHA 1W39A 5JSOA 3A0KA 5T52A 4P9YA 3ZX7A 3SMHA 4LBQA 2DUQA 1HXS1 1MVQA 2Q4SA 1IZ3A 1CR7A 1YCIA 2WJSA 4HVOA 1XE7A 4K7JA 4FQZA 3KD4A 4M01A 5I8TA 5IUQA 4CEYA 4LBLA 4PQ9A 3VUOA 3HMYA 1V70A 4LTAA 2JG8B 4YVSB 1LOAA 4Q4Y3 5L7OB 1OA4A 5GLUA 2VMIA 2XLAA 4Y26A 2ZGKA 2ZGSA 1RTVA 1U5IA 1UKRA 2DTWA 4OULA 1K5MC 1NLRA 4YW4A 1F9KA 2OIIA 1RUG2 4FTEA 3HT2A 4P9WA 2P2KA 3K48A 5CFDC 3VBHA 1ZBE1 1NE6A 2P3JA 3HN1A 1VBA2 3B69A 4J6GA 3JB4C 1Q8PA 2HWD1 1O4TA 1W6PA 2QZ2A 4BWOA 2VOWA 4D7SA 3ZYRA 1NCRC 3LA7A 4R9CA 3FLRA 3ZXDA 4Q8KA 2XJVA 4AFCA 1XRUA 5JI7A 3URFA 1PZ9A 4AEMA 1MZFA 4W6XA 2WINB 2PTMA 4XJUA 1PO23 3OD0A 4MH0E 4E27A 1HRV2 1WMEA 4ONUA 1NG0A 3ZN4A 1O4YA 1ULFA 5AC92 4KH9A 4XHXA 1RHI3 1FPN3 1RUJ3 1PO12 3A4UA 3HQXA 2LM3A 3BCWA 1N3QA 5H9PA 3ACLA 1QY4A 4FSJA 2JENA 3HT1A 3GBFA 3BALA 2X5IB 2C0ZA 2RR13 2XVLA 1X82A 3D0JA 2SBAA 4PLMA 1PHMA 2JXAA 4L2NA 5F6KA 4B4RA 4GMP1 4QGNA 1C8M1 3J8F1 5FQ0B 2R042 4I30A 1COV1 4AI0A 1IOAA 1JUHA 4DZGA 1FV3A 2JG9A 2E7AA 3AZVA 2E9QA 1B35A 4XFFA 2G9FA 5HCBA 3OD4A 2DCJA 4J1WA 4NO4A 3SCGA 2Y0OA 5CNAA 3LA3A 4XTPA 4MXWA 2NYYA 2JICA 1WW5A 4YGCA 1DZTA 4RS5C 1LHWA 1NCQB 3ZMOA 5HCFA 1R1A3 3MW3A 2V73A 1LEDA 4Q4Y1 4X6RB 4P9IA 1AJKA 5DDJ3 2R49A 2A73B 4R9BA 3N7KA 4JGYB 3SITA 4BHPA 5JPNB 2K2SA 1ZZBA 5E16A 2IXKA 1OOPA 2NMOA 3ILNA 4K20A 4YGBA 3O0WA 4WM8B 5J7MA 1TME2 1RL3A 3ZSMA 3ZYGA 4BOWA 4YNIA 1PGW1 4CP1A 4NN0A 2WZR3 1I9RA 3RI9A 4COYA 4YVSA 5DG1A 2TEPA 4FAGA 1BBT2 4XMAA 5KC6A 3GYDA 4N53A 5EYXA 1CAXA 2VW2A 3FLPA 5KBFA 4G9SB 1YUDA 4QT6A 1H2KA 3NAPB 3RI8A 1GYKA 1QH7A 3WY6A 2BGCA 1ZYBA 4Q29A 4FP2A 2W08A 2ZCWA 4PDWC 4ZXKA 5C33A 3MGUA 1CIWA 1PO21 3ZVXA 4XBNA 4B7KA 2IFWA 3G7DA 4R9AA 4PIZA 1UIKA 3NVCA 3DPRC 3R4UA 3M70A 2NLRA 2YV8A 2XJQA 4YG6A 3AP6A 1MS0A 1AXYA 4E4DX 2VMHA 1U5YA 4Q4X2 1FV2A 2WC2A 4CZSA 4ASMB 3JU9A 5GM0A 1OLQA 2BQPA 2XKOA 3MFAA 4QGLA 4FTSA 2MHFA 2UYAA 4KGGA 3CU7A 3LOIA 1U5ZA 1ZBA3 3VHPA 2YZ4A 2CAVA 4NWWA 1J58A 1R081 1CAUB 1HKDA 3KB5A 4IEYA 4JV4A 4IETA 1OHFA 5BNOC 5JLVA 4LO8A 2X5IA 1DQ6A 4GQ7A 4K1YA 1QHDA 1V9U3 5E88A 3ZIWA 1KRIA 1NA1B 3ZFGB 1CGPA 3D8CA 3TRSB 1WMFA 1WW4A 3SCHA 1W6QA 1SFYA 1RUD2 3ELNA 3M3QA 5C8CB 5FQ0A 1H9PA 1SLTA 5A32B 4CDQA 5DDJ1 1Q8QA 1CVNA 3AP7A 1H8TB 2JKBA 3ZXFA 1ENQA 3UKTA 1LOCA 3BOPA 3FBYA 5A3LA 4JVAA 2YYOA 1W6OA 3VBUA 3MPPG 1YXWA 4PBOA 1RUF1 4CTEA 3FJSA 1ALYA 1C1FA 5ABJC 1O3SA 1SLCA 1ULDA 1F5FA 1AF9A 3E5QA 3RJ2X 4E4SA 2ATFA 1S0IA 4JGYA 5IK8A 5BV6A 2D6MA 2R0HA 4AVTA 3WP3A 5I8YA 4Y1XA 3M3CA 4KWKA 2A6WA 4WM8A 4QM8A 5CVRA 2CYFA 1WCKA 2HWF2 1AYM2 1F5JA 2A7AA 3WVJA 4CDUA 1AR93 1QJX2 4FOYA 4DQAA 1DZRA 1SCRA 4EN8B 4P5HA 4W6WA 4E2GA 3AKRA 2DCTA 1K5MB 1Z7S2 4BM8A 1J3QA 1QOOA 1DQ0A 1XYOA 2YMZA 1GR3A 2ZGMA 4NOTA 3TN93 1G9BA 2BPA2 4Y1UA 2CAUA 1M4WA 5CFDB 2XUMA 2R072 1QOTA 3THPA 2Y38A 4UXAA 3BPZA 4YRDA 2E51A 2HWC3 2A3XA 3NAPA 4XJAA 3RYRA 2BFUL 4Y20A 3PLQA 2YXSA 1H2MA 4GKXA 4YFZA 4OZXA 4AWDA 2A71A 1CJPA 4FXKB 3UK9A 1NCRB 1ZBA1 4LA3A 4A7YA 2P34A 3E5UA 3B3QE 2LUWA 1BK1A 2XLFA 4I3GA 1QJU2 1UU6A 4AVBA 4JAAA 4P9JA 5C4WA 4BQ1A 4MVTA 1ZZCA 1V9U1 3E6CC 2DVAA 3IDEA 2P3KA 2JECA 2ZZQA 1RJ7A 3QD6A 4E2SA 1UCXA 3GBGA 5JOYA 4AFMA 4BIFA 1RGSA 1JOJA 3ZIXA 4B29A 2YY1A 3VBOA 1WCSA 4QQHA 3RZZA 1QF3A 2EF6A 3TNPB 3ZDSA 1CPNA 3FLTA 3WT3A 1EAH2 3WHUA 3MF9A 2RHPA 2EALA 3C2UA 3IN9A 5J96B 5C8CA 2ARBA 4KG0A 3V0AA 2IXCA 4OVEA 1WD3A 3JBG2 1SCSA 4OHXA 4RS5B 4YM0A 3U11A 3VGIA 2AZ5A 3PVEA 4JGZC 4N7UA 3ZFEC 3I2DA 4WVMA 1PGL2 3T1LA 3AP9A 1A3KA 1DIWA 1HQWA 1UL9A 3E97A 3EBRA 2E7TA 3H50A 4XF0A 2V09A 4H55A 2Q30A 4BPZA 3TN91 4GWMA 3UV9A 3ZMNA 1XYPA 4HZFA 1AR83 1FOD1 4WM7C 3WNXA 1I6XA 3DUIA 4RGAA 5GZFA 3LZZA 2A6VA 2GH8A 2RS12 3RS6A 2HWC1 3H0OA 1RUE2 1T6GC 4H14A 4K8FA 1VBD1 3OBTA 4MXVA 2XBO3 1AR72 2TBVA 4Y24A 2DUPA 1OPMA 3WV6A 1LHUA 3QOPA 2HWE3 1N3PA 5F5QA 4KQ7A 5GKAC 4TLFA 5DUUA 2N7GA 4G3YC 1IS3A 4PDWB 3E6DA 2ZGTA 2R0FA 2D97A 1EPZA 1PIV2 4K40A