3WY6A

Structure of hyperthermophilic family 12 endocellulase (e197a) from pyrococcus furiosus in complex with laminaribiose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQAVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase (E197A) from Pyrococcus furiosus in complex with laminaribiose
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 71
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wy6A00
3WP5A 1YNAA 2QZ3A 1UU5A 4HKOA 3VZOA 4S2FA 4HKWA 3WQ7A 1TE1B 3VLBB 2JICA 1F5JA 3RI9A 5EJ3A 3AKRA 1H4GA 1HV0A 1OA4A 1UKRA 3MFCA 3AMMA 3M4FA 3VZJA 1NLRA 1AXKA 1ENXA 3VZKA 2JEMA 3VZNA 1QH7A 4XQWA 1REDA 3AMNA 3EXUA 1C5IA 3WR0A 1HV1A 3B7MA 2JENA 3WT3A 2Z79A 3MFAA 3VL9A 1T6GC 2B45X 2BWCA 1UU4A 2D98A 3AMHA 1C5HA 4HK9A 2NQYA 1IGOA 1REFA 1XYOA 2C1FA 2VUJA 1HIXA 1W2UA 2VG9A 2DCJA 1XYNA 3RI8A 1BCXA 3VGIA 4S2HA 3WQ1A 3VL8A 1KS5A 2DFCA 3ZSEA 3WP3A 3B5LB 4HK8A 3MF9A 1BK1A 1H4HA 3VHPA 2DCZA 1BVVA 4IXLA 1H0BA 5K9YA 1OA3A 3LB9A 4XQDA 1H1AA 2B46X 4XPVA 1OA2A 3VZMA 2BWAA 3VHNA 3WQ0A 5K7PA 2VGDA 3WX5A 1XYPA 1XXNA 2DFBA 3AKSA 2BW8A 2F6BA 1XNKA 1QH6A 4H7MA 3WXPA 1OLRA 3HD8B 4S2GA 4HKLA 2D97A 3AKQA 3WY6A 2BVVA 1M4WA 1XNBA 3MF6A 2VULA 2DCKA 2B42B 3AMPA 3VZLA 2DCYA 2QZ2A 4XQ4A 3WP6A 1XNDA 1OLQA 1KS4A 3AKTA 1REEA 1UU6A 3AMQA 1PVXA 4NPRA 3LGRA 1H8VA 5HXVA 3WP4A 3AKPA 3O7OA 3VHOA 2NLRA 4S2DA 1XNCA
chains in the Genus database with same CATH superfamily
2WZEA 3W20A 3JD73 3ZFGC 1UU5A 1A6CA 1GZCA 3F95A 2OUHA 4PJYA 2HWD2 1JOPA 1AYM1 3CO2A 3QH7A 4MXVA 1NXD1 4CUAA 3FJSA 2PELA 1VALA 4YZ4A 4RHV2 1SPPA 5FYSA 1ZBE3 3HOBA 1W2TA 3B02A 3OYWA 1AXYA 3FBMA 4GH4B 1IPJA 1MS1A 2P34A 4GWIA 4XF4A 2R7EB 3ENRA 4QKFA 3DUIA 5FZOA 1RVF2 2VCMA 4XYXA 5K0UA 1SFNA 3R6SA 4PDWA 3OUHA 1AHSA 1DQ0A 2JDNA 1NZIA 2IXCA 4QKNA 2QQVA 3ZFGB 5A6XA 4IEQA 5BNPC 3RZLA 2R073 3BIEA 3MICA 3MFAA 1T6GC 1WW5A 3RVHA 1OQ1A 3IT8A 1UZYA 3ABZA 1NX9A 2HEWF 3C7HA 5LEKA 1O3SA 1QJX3 1W39A 3BI3A 3POYA 3AMHA 1C28A 2R32A 4LR4A 5JOWA 4XAAA 5IUQA 4M3CB 5FP8A 1LOGA 2WIIB 1E5SA 3W9AA 4AVCA 2YC2A 1NOVA 4K6BA 4AW7A 5I93A 1I3HA 3K2OA 3Q8EA 3ZYGA 5T5PA 1AR82 4K3UA 4NPLA 5A7OA 2XWJB 5BNPB 4LE4A 1FMD3 3RWNA 4YG3A 1RB8G 2YMZA 2WRAA 4BQWA 2RS12 3T2QA 4MO3M 3ZIXA 5I0RA 3O1UA 3EMRA 4CCEA 2JKBA 1DQ1A 2VXJA 2V5DA 2VZOA 2AENA 4QPGC 5FZ7A 4JHZA 3T30A 1VBB1 1DG6A 2GP5A 3DYPA 2QTWB 1NCRA 4NRPA 4P5YA 2EA7A 3Q9OA 2XJRA 4XFFA 3LCPA 3SCHA 2QVSB 4JGYC 2EIGA 4M3CE 4N53C 4DUWA 4Q4Y3 2HWC2 4W65A 3RZKA 2IWGB 5DPNA 2BWAA 1RUI1 1HLCA 5FYMA 1SCRA 5BPXA 4BHPA 1NLQA 3O1SA 3OEAA 2D5HA 2P2KA 4JGZA 1J84A 2FBEA 3LSDA 2JB4A 3AKSA 2F6BA 3LDRA 1QIQA 2W1SA 4YM0A 1QH6A 1NAEA 4KU7A 4LMFA 5FZ8A 3T4VA 1C8M1 1G8WA 1K5MC 3S7IA 3ZXGA 4AYUA 1ZBA3 1RUJ3 3GGLA 3AP5A 3FLPA 1UY3A 3RSJA 2ZHLA 4CDWA 2JDPA 4D6SA 1O4TA 4TLGA 4N53B 2WO1A 3ZMNA 3AL6A 2C24A 5FCCA 1BEV2 4MV2A 1XJAA 1TNRA 1WA6X 3H3ZA 5C5UA 1VBA2 2RMU3 4A45A 3FUQA 2E51A 4FPYA 4HVRA 1UX7A 1RUF1 4BZ4A 3KLSA 3RZHA 1K5MB 3A22A 3JQXA 2AUYA 5HV4A 1CAUB 5FPUA 5F3EA 4ASKA 2B5HA 3OBRA 2GH8A 1V6LA 4AZZA 2QQLA 3HQXA 2XDVA 5F5AA 5A3UA 3IPVA 1GR3A 2OVUA 2VZRA 3DGTA 2EIEA 1W9FA 3IWZA 4HKOA 4IE0A 5FIXA 2DBIA 3QD6A 1AYM3 3OF1A 3QCWA 4UW5A 4AEDC 4HVOA 1LGNA 4Y4RA 2C5DA 3IN9A 3S57A 3B00A 3MGUA 2C9AA 2Y6GA 3WQ7A 1VBE3 3VLBB 2JICA 2PYTA 3K3NA 3N35A 3ZLIA 4BISA 4BQ1A 4WM8A 5FZ4A 1HV0A 2BUKA 1JZ5A 3ZPOA 2WINB 4HMZA 4XCAA 2ZGKA 5KXEA 2A5ZA 3I59B 2JDAA 5ISLA 3P5BA 3NMBA 3PDQA 3WR0A 4EWEA 4BA6A 3H8XA 2PAKA 1W9WA 1K42A 1UN1A 4HG6B 5I8YA 1YHFA 2P3JA 1J3PA 4WM7A 1EPZA 2YY1A 4L97A 5JAXA 3EQEA 2VVFA 1S0JA 2JG8A 1MVEA 3K75B 3NNFA 3VD3A 1D4M2 4LA2A 1NQDA 4MH0E 3LDKA 2A6ZA 3UGGA 3TNQA 5FPAA 3N3HA 1Z7S2 1SHWB 1ST8A 2C26A 3LSEA 4D8MA 1U5IA 5LA9A 3HT1A 2WAAA 3PLQA 4XJ8A 2RJKA 5A32B 3MIGA 1R082 2JE9A 4CU9A 5C3OA 1ULFA 4DXSA 2Z4FA 4A6OA 2I74A 3D5OA 1UX6A 1HB3A 1VBB3 1G9BA 1RUE2 2ZGPA 3WG4A 5FTTC 4Q0QA 3OPTA 3ZO0B 4KGGA 3UL2A 5IATA 1GICA 2ZZJA 2WA3A 4NPMA 4XJWA 4OI1A 1N3OA 1WLDA 1SBFA 1W9SA 4TYSA 3FZ3A 5F2SA 2A3YA 3Q8BA 4OHWA 5JIAA 3PUHA 2JG9B 1RUI3 3HVDA 2R0HA 1PVC2 1UY4A 5FP4A 1PZ9A 4LOSA 1CAWB 2WL1A 5AC93 4P00B 2X10A 4KG0A 3VKOA 3WNPA 4CEWC 4YG6A 1C8M3 4D3WA 4DO0A 4HSLA 4R9CA 1IG0A 3ZFFA 4N9HA 2NN8A 3VBHB 1IQDC 2AGSA 3AP9A 3GF6A 5F8PA 4P14A 4UF0B 1GZWB 3CEWA 5CBLA 4ITCA 3OJBA 4LORA 1Y4WA 2XL7A 4DEVA 3W59A 4IE6A 1C8NA 1ZZBA 5A3TA 4XF3A 1JZ3A 5BUVA 2DCKA 4R52A 2X05A 3VZLA 2A7AA 3GBWA 2CV6A 4CRQA 3JBG3 4XDPA 4PBOA 5FKCA 3WP6A 3ZSLA 1RUF3 4AE2A 3AXDA 4GMP1 2D6LX 1ACCA 4W6YA 5FMOL 5C6CA 1PVXA 5JIUA 1URXA 1S0IA 4IV1A 2KR2A 1RUOA 1G9AA 2ADEA 3WNKA 1WBFA 4XUTA 2JE8A 3O7OA 2BBAA 5ANQA 2J1RA 5BNOA 5JI7A 1E5HA 3ST7A 1LEDA 1W6OA 2P37A 4IETA 2RS51 2QKDA 1GNHA 2UYAA 4YNIA 5FLJA 1N3PA 3M3EA 5BNQA 2X09A 3THPA 4YZ2A 3HNBM 2BPA2 4I02A 4BE3A 1UKRA 5LATA 3JZVA 4QGLA 5CADA 1YCIA 2YB7A 3W58A 5C8CA 5IFPA 1QQP1 1IS5A 4BQ3A 3RYKA 1NCRC 3ATGA 3S5AA 1ULGA 2VD7A 4EJRA 1W6MB 2OIIA 3FX3A 1DP0A 1AL0G 2OX0A 5A3MA 1OUXA 1CJPA 1QDCA 4LBNA 3I49A 5HXMA 5JXJA 2ORXA 3BALA 3K77A 1OPOA 1SG3A 2I2SA 4ASLA 2PAMA 5JZGB 1EY2A 2ZHKA 1VAVA 3TRSB 2W1UA 3UNPA 2WT0A 1KRIA 1DLLA 1NG0A 1ENSA 3AP7A 4M4RA 4QX1A 5JI9A 4OZOA 3M3IA 2ZXQA 4HK9A 1C3HA 4ZY9A 1W06A 4META 4JGZC 1W8TA 4LQRA 3UT0A 4Y20A 3T2PA 4J25A 3PVBB 1KJRA 2Y0IA 1SLTA 4R4XA 1W8NA 1QXPA 1HRI1 4CUCA 2G9GA 2YROA 4I0WB 4SLIA 4XFAA 3CLPA 1GP6A 1PGW2 1RHI1 4LULA 1H2NA 1OPMA 1CPNA 1FXZA 5CISA 3FFQA 1AVBA 4KGQA 3AJYA 5DAQA 3ZR6A 1YYNA 2AC1A 2VMCA 4TXWA 2WNVC 4AQ2A 4OCTA 3M2MA 2ZGMA 3VBSA 1W2NA 4AQ6A 1H1AA 1LOAA 1HN0A 2BQPA 2Y34A 5ACA2 1HX6A 2XLGA 4XUQA 5CNAA 1QNWA 2HH9A 2VH9A 3HBZA 1V6OA 3BYWA 3W5MA 3WX5A 1JOBA 2VZ1A 3I3QA 2A1XA 4KWKA 2O8QA 2GH2A 2DDUA 2XKPA 4BMEA 1DF0A 2WWSA 3INAA 2MEV2 5FZ1A 4CU7A 1YQ5A 2WABA 2HWD1 2WNUA 3HD8B 3OD4A 5J09A 1X36A 3O1VA 5FXWA 4C8DA 4MGQA 2WNVB 4RS5C 4RHV1 5FV3A 4NUBA 3AX4A 4ZU4A 5FKBA 5F5IA 4H14A 5EZWA 2XVLA 1RVF1 4KWUA 1ZZCA 1PZ8A 3ZXEA 3PTRB 5I91A 4LUKA 5DAWA 3VHRA 1N47A 2WQZC 2OPKA 4GMP3 1MEC3 1PIV2 4AI3A 5A7WA 4CDUC 1HXS2 5EQUA 2D6PA 1KITA 4XBLA 3TBDA 4AR2A 3POJA 4QGNA 2IVIB 4GD4A 2LS6A 5G05L 4YVWA 4RS5B 1ZRDA 2EALA 4BJ0A 1GSLA 1X8EA 2DVAA 2JG8C 2VCAA 2WDBA 3J7LA 4QMAA 1FNYA 2SBAA 3H9AA 4S2DA 2JX9A 3WP5A 4F8AA 4OUMA 2RS53 2QZ3A 3WHUA 4P02B 5F6KA 1G9DA 4IDZA 1W90A 4MADA 4EWDA 3KV5A 4L99A 5SV8A 3J7MA 2XB6C 1AR81 3AZWA 1K45A 4CDUB 4RFRB 4LO8A 3BGAA 4PLNA 4Q4W2 5A6ZA 1GOHA 3MEPA 3WNLA 2RS11 3RRDA 1EUUA 3MV01 4H7LA 2CWSA 3QACA 5FYIA 3A0KA 3WF4A 1W05A 1L7QA 1C5IA 1O3QA 4N43A 1LHWA 4P9LA 3B01A 5FY9A 5DAXA 5CKMA 2WQ8A 3MIDA 4QB2A 4EN7B 4EQVA 4QU2A 4M3CF 1YIFA 2JDHA 1VAMA 2HWC1 1W8HA 1KJLA 4KQ7A 3I54A 5F6LB 1X82A 2Y64A 2VU9A 1G6NA 3B94A 2C1FA 3M8LA 5I8SA 2VW2A 3ECQA 1W6QB 1ZZ7A 2V5YA 5FZAA 3P3NA 2DCJA 3EYPA 3OEBA 4RQPC 4KG8A 4V1PA 2JIJA 3SHRA 4AF9A 4HN0A 5FZ0A 4EYUA 4JDOA 4AQSA 1A34A 4BQ4A 5FWJA 5FYYA 1RHI3 4UBHA 4DPNA 3POIA 3LDBA 1SLBA 4Q4V2 3WUCA 5JUVA 4CXYA 5A1AA 5ABJA 1BEV1 4MGZE 1OOPA 3HQRA 2PHLA 1F9KA 1VBA1 2IC1A 4WVVA 4CEYA 3KMHA 3C8XA 2W87A 2XL9A 1LULA 5EJ1B 1YUDA 2V4AA 1OA3A 1X9PA 3POWA 1S2KA 3NAPA 4FT8A 1W9YA 2JECA 3IB3A 2D7FA 3ZKUA 2WA4A 4HLTA 5DUUA 3SCGA 4QXKA 4RQPB 3TEYA 2DUPA 2VMFA 4N9IA 2EAAA 2WKKA 1G9CA 4J6GA 5A1LA 3KSCA 1XXNA 3WEZA 4A41A 4X6RB 1QKQA 2I45A 2DTWA 3ZSMA 1VR3A 2ZEXA 4YFWA 1X9TA 2H0VA 1X33A 2HWD3 1JXNA 2VNVA 3ACFA 4XBQA 5DG2A 3WXPA 4NO4A 2A3WA 4Q2FA 3WW3A 2Q1MA 5B4XA 4NHKA 4XEZA 4LUMA 2Y6HA 3AKQA 3GM8A 2A73B 1RUNA 3RZZA 1UMZA 1RVF3 5CKNA 1MVQA 2O8OA 5IW0A 2WAOA 4K7JA 4MHUA 1VP6A 3ILNA 4MXWA 4Y22A 1UIJA 2DCYA 1W3VA 1CESA 3VDDA 2W3JA 4YW3A 4A44A 1LAJA 4X8PA 4HVQA 3N9OA 1OLQA 1OLME 2QJVA 2VXRA 4JZRA 3CJIC 1NCQA 1JYVA 1X8MA 4M3CA 3POFA 1UAIA 2BGCA 4LO6B 5L73A 3A23A 5C4WC 5C5TA 2WN2A 5LWBA 4FQZA 1BKZA 4LBJA 1D4M1 1TMF2 2J22A 2XUEA 3SLIA 1TZOA 1XNTA 3APBA 2VMGA 1PK6A 1Z7S1 3WF3A 5L9RA 1AR83 2C0ZA 2VPVA 4DS0A 1JW6A 2Q8EA 4AWDA 3GZAA 1XSRA 3DCQA 3CJIB 1R081 3DPRB 3WG3A 2KD7A 4Y3OA 3RJRA 1ALYA 1WCQA 2YZ4A 5DDJ2 5C4WB 1XE0A 4UI9L 1RUE1 4Y5TA 3R0RA 5JOYA 2BNNA 3CNAA 5LK7B 1VMHA 1JZ8A 2FDIA 2PTMA 1Z0HA 4K8RB 3AVSA 1WA4A 3ZYFA 5FP3A 3ZM8A 1S55A 2Q4SA 4DY5A 1CAXA 1CR7A 4IUGA 4GMP0 5AVAA 1CQ9A 2ZX0A 5FUPA 2C4XA 5M0TA 3NNJA 3VBSC 3RQ0A 4QDRA 4E2SA 3DF0A 4P9JA 5IVBA 3FUOA 1CWPA 3OY8A 2WO3A 4DEQA 4NN0A 1PVC1 3WDXA 3EHKA 3LOIA 4B8EA 5JCTA 3LFIA 4XF1A 4CCJA 5LRRA 3T3YA 3HEIA 3G7DA 2XJUA 4BH9A 2WNUC 3MLLA 4K40A 3VGIA 3WOGA 3BUCA 3GJAA 4QQHA 5HCBA 1ULPA 2OPWA 4AOCA 3AL5A 1B35B 2ZMNA 4ZXKA 1O59A 4FVVA 1BYHA 1BEV3 1DQ6A 2HWF2 4OLLA 3VBFC 1OD5A 4XJ9A 1KEXA 3LEIA 3MF9A 4BM8A 5B2GB 5J7MA 1BQPA 1JHNA 2PXJA 3J26N 4IEXA 1PMHX 3PVOA 2OUJA 1FOD2 4MGKE 1MACA 2XQXA 3CMGA 3C3VA 5EWSA 4OFGA 1Q5OA 3K4DA 2NYYA 3BODA 2O0OA 4K8FA 1H9WA 5FP9A 5FWEA 2XONA 3AC0A 2DWRA 4GULA 2ID4A 5GLUA 4NVPA 4COUA 1KDKA 4AEJA 2WYSA 2OW4A 3C7EA 4QB1A 1HQLA 1XE8A 2ZEWA 3VBFB 1KQRA 3ZN6B 4YVSA 3IDEA 3AYCA 5GLZA 3CU7A 3POSA 2ET7A 4Y5Z0 1K12A 3PJYA 5FO7B 2BNMA 3CF6E 2FDFA 2ZGNA 3PUQA 4RYDA 1EV13 4GA9A 1W8ZA 5BYNA 1XNBA 3SMHA 4MGTA 3Q8FA 2ATFA 5GZDA 1MZ6A 1QJFA 4FPCA 4IGQA 4GWJA 5KR7A 3WG2A 5A1FA 3ITQA 1F2NA 3ZSJA 2D5FA 2YGMA 1US3A 3AMQA 4GJZA 1GOFA 4NJ4A 2ET1A 4QQLA 2X53S 1IHMA 3M1HA 4OHXA 5FY7A 1PO13 1KFXL 2Q1FA 3VD5A 4DQAA 1MQTA 3HQUA 5A3WA 2E63A 3AKPA 1CZTA 3NWKA 1LOBA 1WLTA 4YM1A 4OHZA 1D4M3 2ZBJA 2R062 5GM0A 2QQUA 4AGRA 1RJ8A 5CKQA 1UY1A 1JU3A 4XTPA 5FZBA 2W1QA 4CXXA 4YFZA 3WW2A 5IVVA 5LA0A 1KFUL 4XE9A 1AF9A 2EXIA 4HKWA 1JH5A 4NAMA 3DXUA 2R0FA 3WV6A 1R083 1RXFA 3GZEA 1SDDB 3AKRA 3ZXJA 1O7FA 1EAH2 4BIFA 3SITA 1STMA 4ISRA 4XVHA 4AEMA 5BY5A 1U5ZA 4P9WA 4CXWA 1RUE3 3H0OA 2VOWA 3I3EA 1PGW1 1WCKA 3PJQA 4LITA 1WLCA 1JU4A 1RINA 1QOOA 1F15A 1N1SA 2VY0A 3Q8CA 1U0AA 2VECA 4X6QB 4YW1A 4Y26A 1UO9A 5H9SA 3VKNA 3LOBA 4GXLA 1O5LA 2UY9A 3WD5A 4LLFA 1QWRA 2Y0OA 3U0ZA 3WNNA 1VE0A 2XQRA 2FZ2A 2DF7A 5ACA1 3CQOA 1Y9GA 1ZZ9A 2UWCA 2WJSA 2ZJCA 4AQTA 2A75A 1F8VA 5IVJA 5J48A 1EUTA 2JJ6A 2D3SA 3VBHA 4HFSA 4L11A 2VZUA 4SBVA 3KCYA 5J37A 2YPDA 5EYYA 2X29A 3B9IA 2CGPA 1UW8A 5FZ3A 2BVBA 3R4DB 1HIXA 3MBWA 1YIPA 1ZRIA 3T09A 4ZKTB 5EXOA 4YM2A 4PLMA 4YZ3A 5DG1A 2X5IC 1OT5A 5FY0A 1EP0A 3NKTA 4YARA 5JOZA 1BCXA 1PO22 3ILFA 4CSWA 2D3RA 2YFZA 4CP9A 5KXBA 4TWTA 2DVFA 3LEKA 1WZXA 1QF3A 3MZHA 3JUUA 3WSOA 5J36A 3PIJA 1TQ5A 4QKBA 1UXZA 2HWB3 1CIWA 2KM2A 3H1MA 3OBAA 3BTZA 4UXAA 3HWJA 3NSTA 1PIV1 2KXLA 2W95A 1DFQA 1HXS1 3LB9A 3ZXLA 4KH9A 2X5IB 3MIEA 3KWVA 1OA2A 4Z82A 1ZA7A 4UWDA 4NOTA 1W2OA 2VOVA 2Z5WA 2IXIA 5LA2A 1AL23 4H7MA 1RJ7A 2CHHA 1YFUA 4FP3A 3GCXA 2PHTA 4Q0UA 4QXHA 1DGLA 4EZ4A 4IV3C 5A7QA 4LHLA 2EIDA 4Q29A 4RR3C 4HETA 3V64A 5CFCA 4Q4W1 2VNOA 4I01A 1UYZA 2BVVA 2XR4A 1AYN2 1NT0A 3HR9A 5J98B 3OGVA 4P9IA 3IBMA 4YW4A 1GWKA 3DKWA 1RUC2 5DXDA 4LBQB 4XFBA 2MPFA 3KS7A 3DN7A 1RUD2 1D2SA 5GKAC 2OZ6A 4L0PA 3TN92 4GJYA 3ZXAC 4QPGB 3LE0A 5H9PA 3KF5A 5FXXA 4IV3B 1YFXA 3S7EA 4RR3B 4FPGA 3HPNA 5AC91 3ZFEC 1JYTA 4FOYA 4IL7A 3BVCA 1UYXA 4Q26A 2ILMA 1H2KA 1YNAA 4PT6A 5A3OA 3HN3A 5CFDA 5T52A 3RYRA 3T1MA 3FFZA 4XETA 5IHRA 5F3IA 1ONAA 4JGYB 1DYKA 3VV1A 4DRRA 3N4MA 1KGYA 2BTVC 5GLWA 4Y1ZA 4DINB 1XPWA 2GMMA 2RVAA 2WNEA 1JYXA 3VZJA 1NLRA 1LOCA 4HSJA 4Q4V1 1RMU2 3ZR5A 2PHUA 3JU9A 3NV4A 4IEZA 3KZ4C 1F5FA 1RC6A 4C0HA 3Q8AA 1W6PA 1OKQA 2W94A 4J1WA 4IE7A 4YM3A 1RTVA 1UY0A 1V6KA 5FY8A 5LB6A 4LLOA 3UJOA 1S0CA 2VNRA 1S0EA 5T3NA 5ACA3 4Q5OA 4YGCA 1ND3A 2GZWA 2OQ7A 2PQQA 3OBTA 5FUNA 3UKVA 4XIKA 3V0BB 3KV6A 2CAUA 1QU0A 1JYIA 2CTVA 5DAVA 2RE9A 1LOFC 1CAVA 4XF0A 4HONA 3L2HA 5FMBA 5IK8A 2NQYA 2VZSA 2D6KA 1QXRA 5FP7A 3ZYBA 1HB2A 3ACLA 5FZEA 3KD4A 1MZFA 1O91A 2TNFA 3R4SA 3KGZA 1GWMA 2DUOA 4FXKB 1UNBA 1LU2A 3V0AB 3DV8A 1UCXA 4HK8A 3AZXA 3OBZA 4XJUA 3VBOA 3D8CA 1VIWB 4OHVA 4AEDB 3VD4A 4NIHA 1RL3A 4P9YA 3U1XA 4AEKA 2ARCA 3D0JA 4D7TA 3U37A 5HCAA 1YFWA 5CAZA 1HXS3 1OH4A 5D8AC 3RNSA 4QHZA 5J3UA 1XBFA 4XQDA 3K4AA 1ZRCA 4M4PA 4B29A 3WZ1A 4QXBA 2VCCA 3VBUC 2CWMA 3ZDVA 4CDQB 2CGOA 1GV9A 3WQ0A 2IVJA 1CX4A 3GJBA 2D44A 3I2FA 1VMJA 5KC5A 1UOFA 1TMF1 2BW8A 4YGBA 3NJYA 4GB32 1H8TC 1Q8VA 3KT7A 4G3YC 4A3XA 3ZYJB 4B4PA 4NHLA 4Z92B 1R1A2 5DN2A 2VAUA 5L7OC 1GBGA 3AYDA 3HN1A 3LQCA 2KA3A 2Y6LA 5GALA 4Q4W3 5D8AB 4XOGA 4WVMB 2D97A 1WKYA 2QQJA 5F3CA 3AFGA 3D0SA 3VBUB 2XGXA 5GLTA 4O9GA 4OYUA 2H6BA 4NHXA 3LEMA 3NRUA 4O61A 5DDJ1 1GNZA 2A6XA 2OYZA 1ND2A 5KC6A 3U11A 5FLIA 3VD7A 1UWWA 2R042 1XNDA 2ZMKA 4D6RA 5IJRA 2B9UA 1PNFA 1H8TB 1ZVFA 5DQ0A 1W28A 1YRZA 1JMUB 2K2SA 4YLZA 5FR3A 2IZWA 4CTEA 3RFRA 4IGPA 4AI9A 3BCWA 3I2IA 3LAGA 1NA1A 1CGPA 4C0BA 4CEWA 4Y4YA 2GSYA 3ZMOA 2ETEA 5FY5A 2D43A 3PMSA 3GALA 2DU0A 2D93A 3ZSKA 1BJQA 1F5JA 4GKYA 4XAEA 1C57A 4PIZA 2VW1A 4BOWA 1NZCA 4DMIA 5C3RA 5K0UC 4PDWC 3PUSA 5FXZA 1UYYA 1AJKA 2VOKA 3I3BA 2XH6A 4CEWB 1T6BX 2YUEA 5H9QA 4V2VA 4YRDA 2HWF1 2QQOA 3BTYA 5LBBA 4JTOA 3POEA 2GMEA 1X50A 1NLSA 4OUSA 1FOD1 3E97A 3AYEA 2BGPA 3WG1A 2ZAAA 1SPPB 4GWMA 5KXCA 3HJRA 3OYWB 3UYJA 3VBRA 3VKLA 5EP9A 5DABA 1D7PM 1SCSA 5FZOB 4MGSA 5K0UB 2BERA 5GJ6A 2WWUA 4PDWB 4Y1VA 1WUVA 4NAOA 1REFA 4LBMA 1CONA 4Q1PA 1C4RA 1WCUA 3MO4A 5E88A 2ZHMA 4XFGA 2W46A 1YI9A 3HIFA 2V72A 1LKNA 3A0NA 5DMYA 4XUNA 5CVRA 4RGGA 5B4NA 3I3DA 1LR5A 1LGCA 4DY3A 1BBT1 4LO5B 4B3NA 4CP0A 5CFCC 2YXSA 4ZZ5A 5JPMB 3I2GA 3WP3A 5FZCA 5T5LA 3WDWA 1FMD2 1H9PA 4HPKA 2D6MA 4EV0A 3NJXA 2UYBA 4LT5A 3K4ZA 3BPZA 4I30A 2J1UA 4KI5M 1R092 2GNMA 1A78A 1LHVA 4IGOA 4COVA 4L8QA 1UMIA 4DNYA 3IM0A 1WBLA 3A4UA 5DZFA 2R16A 1COV2 3VZMA 5CB7A 5FPZA 4AFDA 3MIFA 1OC1A 1NCRB 2BNOA 4FXGB 4LKFA 3IDAA 1TMF3 2R061 2G1MA 5FMDA 2ZKNA 3J7HA 1WD4A 4EN8B 4LPLA 4F83A 4H55A 3S6PA 2WSVA 3TEZA 4CDWC 1O3TA 4QX2A 1YC61 3UKNA 4A7KA 1RUG2 5DZGA 4BK5A 3WUDA 4E4ZA 2QDRA 2PLV2 3N9PA 4UW4A 2XKOA 2P3YA 4HL0A 3KCXA 3EBRA 3WY6A 1VPHA 2ZS6B 1EAH1 2JDZA 3H1WA 3LF7A 4JGZB 3TEXA 2BJSA 2VQ0A 5DDJ3 3NL1A 5A7NA 1QXJA 3R4UA 4QPIA 1F4AA 2GP3A 4AK3A 5CG9A 3VN4A 5C9AA 3FLTA 1K5JA 2EF6A 4QHOA 3UESA 5CZKA 2LW8A 3AKTA 2Y33A 2QQPA 4CDWB 4AHXA 2AH2A 1GOGA 3SISA 1IPSA 2ENRA 3BU0A 5HPOA 3ZXDA 4YSFA 5IFTA 2IUWA 3LKJA 2CY6A 4B4QA 1GQGA 1DGWX 1GQHA 4AL9A 5BNNA 2LALA 3WCSA 1BMV2 3BOWA 4CPBD 3ES4A 2WO2A 2A71A 2YV8A 1MZEA 3ES1A 4WM8C 4ZZ8A 4HANA 1T2XA 2FDJA 2CL2A 3N9MA 5JR7B 5F2WA 2BOIA 3WF1A 3POBA 4I0AA 4IEVA 3ZYHA 3SNMA 3OUJA 5JSRA 1XRUA 2F17A 1PO21 2A6YA 4AHYA 3MFCA 3MW2A 3IPVB 1YLLA 3RYPA 1GNYA 1VBE2 3NV2A 3VZKA 1QH7A 3NW4A 2ZKLA 4XQWA 4AFMA 3FBYA 2GN3A 3AMNA 3VBOC 4FI9A 3DXTA 4WM7C 1FOD3 5JR2A 4ET7A 3H8OA 3PVNA 5EIYB 5IVYA 3H50A 2CDPA 3AZYA 3I2HA 3WF0A 4UFIA 3B93A 2VUDA 2BWCA 1UU4A 3I4IA 5EYXA 1TNFA 5LW9A 2VQAA 4HBNA 3ZN6A 3ZOIA 4E4DX 5FZKA 1MS0A 4ZPIA 1UYPA 1GANA 3P3PA 3ELNA 3S30A 1B09A 5JMCA 3BN6A 4ARXA 1ASJ2 4PLOA 5IVEA 1GYKA 2W1WA 4L9BA 1MS8A 4MVTA 1QQP3 1W0OA 1SLIA 3MLKA 4QXCA 2W08A 4NE9A 3RI8A 3PTYA 3UK9A 3MPBA 4FPOB 1G86A 2WUHA 2YDEA 2CAVA 2JG8B 3RWKX 3WQ1A 4A7YA 1BBT3 5D1IA 4B4RA 2QQMA 5F3GA 5F5QA 3ACGA 3ZSEA 5BV6A 3E6CC 3TNPB 4CDQA 1O6UA 2ZMLA 4BLJA 4L92A 3QH6A 4IEWA 1AYN1 2WS92 3HMYA 4GALA 5FQ0A 1BK1A 2V73A 2ZGLA 4LBKA 4M0HA 1H4HA 1QEXA 4KWLA 3ZN5A 4LHSA 1WMEA 5C8WA 1RUC1 1VBB2 3A7QA 3H3UA 3IZOA 2YPJA 3IKWA 3IDCB 1W6NA 3USUB 4AGVA 1ZZ8A 4DXZA 5K9YA 4XUOA 1PZ7A 1RUD1 4OVEA 1OFNA 5FRAA 3TN91 1CX1A 3U07A 3ETQA 1BHGA 5FYBA 5K7PA 2L9LA 3FE5A 2R063 2VO5A 3ZFFC 3C7FA 1HRI3 1O5UA 2GC2A 4BIOA 2D3PA 2BFUL 1JHJA 1HJFA 1XNKA 4AI2A 4ZXEA 3RZGA 3FC0A 5SV5A 5FO8B 5FYVA 2A6WA 4U36A 4QX5A 5LY2A 5LBFA 3ZYPA 3CKHA 4ES8A 3WINE 1FV2A 5A3PA 2YC4A 1XU2A 3LIGA 4FQ4A 4CDXA 5C3PA 4JVAA 4XBNA 1HKDA 3D4KA 1A8DA 1EAH3 1O4ZA 3U75A 5I8TA 4KWJA 1LU1A 4W4ZA 1W8FA 2ZTNA 3P1IA 4V2WA 1RMU1 2B42B 2PQSA 1IPKA 4Q0VA 1GP5A 1VJ2A 3L9JT 4WV8A 4IV1C 3ZYIB 3NNLA 3UGHA 3NJZA 2JB8A 1WMDA 4XC9A 1I1EA 1VLNA 2XJQA 3TWIA 1ZZ6A 2XLAA 4WZFA 1UIKA 5FYZA 2P6CA 4DIQA 2H6CA 5BNOC 3JBG2 1FYUA 1CZVA 3E5QA 4GH4A 5C3SA 1NKGA 3LPFA 1SEFA 1N1VA 5IWFA 3GHMA 1AR72 1LENA 4UW3A 2W52A 4RHV3 2F4LA 3ME2A 5JSOA 4UAPA 5JPNB 1FAYA 1IS4A 2UWAA 1DQ4A 1HRV2 2RR12 1DQ5A 3ZFGA 4IV1B 1TE1B 2DCTA 2VL4A 2G9ZA 2XHNA 3MW3A 1PO23 1CJDA 2ADDA 2BFUS 2XUMA 3RI9A 1JZ2A 5C8CC 4YW6A 4OQ9A 4P5HA 4RL7A 1FT9A 1LHNA 3IIAA 4CCLA 1ZREA 5BNOB 3M4FA 5FOJB 5KHKA 2LROA 5E16A 3T08A 1REDA 3EXUA 2AEZA 4PQ9A 4AXOA 1RYYA 3N7KA 5EHDA 2JENA 5FPVA 4OI0A 3JB8A 2ZGRA 4CU8A 1UOBA 4CP2A 3DEMA 4FAGA 2QFEA 2ZCWA 4M01A 1OXCA 3BB6A 2YU2A 1BLZA 3I2KA 3T4HB 5BNPA 4LEJA 4WVWA 4JHTA 2DU1A 1BVP1 3OCPA 4QPYA 1IKQA 4QT6A 5C8CB 1LECA 3LA3A 1HJGA 2R1BA 2VW0A 1HN1A 5FREA 4W8JA 5A6QA 5FXVA 5FZHA 2BV4A 3GBGA 2BRTA 4TLFA 2RS13 4GB31 3HNYM 2O1QA 3FHAA 4XDQA 1GFF2 1ZA4A 1MR5A 3TEWA 4NIDA 4CCNA 3ZXKA 4D0QA 4YZ1A 4X8NA 2BBVA 4ORFA 4EZHA 3LIHA 4YWAA 1AR92 1AYN3 2P6HA 3CHXA 3KCCA 5C71A 3CIHA 1ZRRA 3G6JB 2WO7A 2OKXA 1BK0A 1RUC3 4QPGA 4Y20B 3MHZA 2Y26A 3IIIA 4Y5SA 2HWC3 4I0BA 5C9AC 2R041 1RUD3 2PAEA 2Y6KA 4D69A 5F39A 3K51A 3TN93 4IERA 2JDKA 4LE3A 2Z42A 5FFOC 1YQCA 1Q3EA 3OOXA 4U2AA 5KXDA 4IEUA 3L2YA 4JGYA 1W99A 2J1VA 1GMMA 4N53A 1UF2C 3BPSA 1QJU2 3BTAA 1IOAA 2DFBA 1SFPA 4QHBA 4XJZA 5DAPA 2ZAHA 2A6VA 3OB8A 5BNNC 2WR9A 3ZKYA 4Z1VA 4A3ZA 4B1MA 3BOPA 2RS32 1QJY2 3C7GA 3VBSB 4HN1A 3VDAA 4XDOA 1QJEA 2K46A 2CDOA 2VMHA 2ZX1A 3OGRA 4QWNA 3RGBA 1K5MA 1VBA3 4YGEA 4BQ5A 1O8SA 2RHPA 4FFGA 1CAUA 3JB4C 1POQA 2B8MA 2ZX3A 2VVEA 3J8F2 3ORJA 1JTZX 3CDZB 2W47A 1RMU3 2ZOEB 3ON7A 1OD3A 2VOTA 3S0MA 2BP6A 3V65A 4QAWA 2N7GA 2WNUB 1UZ0A 1UZVA 3ACHA 1JZ6A 2UY8A 2VMIA 2VMEA 1TVGA 4LKSA 4YVWC 1IS6A 4LO7A 3QLQA 3KB5A 5IT6A 3WP4A 4ZHNA 4YW2A 4CCDA 5LA1A 1MEC2 4PF1A 3VHOA 1UQXA 1Y9MA 2P17A 1DCSA 3E6DA 4LTAA 1V70A 4C91A 2VZQA 3OG2A 3O1RA 1SMVA 1WMXA 1C1LA 1RGSA 3PL0A 2VBPA 3I59A 3T0AA 3RS6A 4S2FA 5C70A 4RFT0 1PMJX 4BWOA 2XJPA 1W3XA 2MHFA 2AR6A 1I6XA 3O0WA 3B3QE 2ZABA 2WBKA 4IW3A 4R9DA 5EJ3A 3KQ4B 4LK6A 1YQ2A 4UFHA 5APAA 1QMJA 1W0NA 3KVBA 4YVWB 4YW7A 4C1XA 1Q56A 2ZPXA 3D3AA 5FYCA 4NIIA 4N43C 1ENXA 5KHJA 1O4YA 4CPBA 1FMD1 1VBD2 4XHBA 3OD0A 1PX4A 1DZRA 1UOGA 4JDMA 4LJHA 4OMCA 3U78A 3SH4A 4BU2A 2W9XA 1GQPA 3GZUC 1R091 4QQPA 3ZN4A 3WNMA 1ODMA 2J1TA 5FJKA 3OGJA 4ZS2A 5A32A 3RG0A 1W8UA 1Z7S3 4NR1A 4DOUA 2D6OX 3VD9A 1COV1 3O1OA 4XTMA 4M0NA 1W2AX 4IE4A 1IGOA 2ZX2A 4MUVA 4N43B 4YPJA 4GB33 3F2ZA 3C2UA 4JKLA 1XYOA 2R6QA 3FHQA 4MYEA 2DUQA 4YGDA 1J58A 2DURA 1QGLA 1ZNPA 3P6BA 1RUG1 1SBEA 2QBXA 1XYNA 3VDBA 4URAA 5IVCA 5LZ6A 2K9ZA 2PLV1 5ABJC 1CN1A 1LHUA 4K9SA 1OOPC 5F37A 3J9SA 2LUWA 2JG9A 4JTNA 4LK7A 4QD2A 1MZ5A 1V6MA 3ACIA 3DL3A 4MGIE 4OULA 4CEYC 3BKZA 2Q8DA 4QQ2A 1CAWA 2PHRA 2TEPA 2W68A 3NAPC 3E5UA 2DCZA 4IXLA 3MYXA 1PVC3 1TG7A 2PMWB 2NPIA 4HOOA 2ARBA 2NZ9A 3UGFA 4TZDA 4UF0A 1GZWA 1XQNA 2JD9A 3VHNA 1MS9A 1W8WA 4NWVA 5ABJB 5G04L 3I3MA 1OOPB 3TYJA 2MEV1 2ARXA 2J1SA 5JMOA 4BK4A 1PHMA 2ERFA 3VB9A 4CEYB 1BMV1 4K1ZA 1NXMA 4D94A 2Y6JA 3NAPB 2V4VA 2YG0A 2E9QA 1V6NA 4LNVA 1VRH2 3OGGA 4ZS3A 2ZGSA 4JV4A 3VDDC 1TME2 4QU1A 1L7RA 1VBE1 4UBGA 2CGNA 2YGLA 3H8RA 1KDMA 1NCQC 1YWKA 4XQ4A 5E8AA 1AJOA 1J83A 4DZGA 3V56A 2DV9A 1H8VA 1ZYBA 2R1DA 4AI0A 5JLVA 3B69A 2NP0A 1W8OA 5E89A 3RPQA 1PK6C 3OTFA 5FBJA 5A7PA 2NLRA 1DBNA 4AI1A 3RZJA 4MXWB 5L9VA 1P8JA 4Y22B 4MGYE 4FPLA 3VDDB 2HWE2 3T2TA 3VZOA 1NY72 4D6QA 1F4HA 1D0HA 1ASJ1 1MS3A 1W6MA 2WFF2 2XBO2 1DZQA 1GZTA 1RUH2 5FPXA 1NCQB 3H1YA 1AZDA 1V9U2 4W6WA 4Y1XA 1DYOA 3FWEA 3MUZ1 5CU1A 2WZ8A 5GLVA 4DXTA 2DBNA 3OGSA 4PI0A 4CCKA 1OURA 2CSGA 5IVFA 5JZGA 4OHYA 1UD1A 5I0SA 1VB2A 3N7LA 2NM1A 1PK6B 1HQWA 2FMDA 3FN9A 2WS91 1V6JA 1N1YA 1SLCA 3H7JA 4JDNA 4E8DA 1LHOA 3O12A 4O7XA 1G7YA 1TEIA 3WT3A 5JDBA 1R093 4A6SA 5H9RA 1A3KA 2AZ5A 4CE8A 1PMIA 1OI6A 2A70A 3VKMA 4CU6A 4K20A 1I5ZA 1COV3 3M3CA 2RG4A 3GDBA 2ZGQA 3I2DA 1XOYA 1KD7A 1JZ7A 1Y7BA 3LFMA 2PHWA 5C33A 1I5PA 3S5QA 4INDA 5FZFA 3KGLA 3USSA 4PIYA 1CAXB 1W2UA 2LTNA 1RUG3 3HBKA 4B1LA 4BQ2A 5KBFA 3RZMA 2E7AA 2PLV3 2ZZQA 2VZVA 3MIBA 3ZFEB 2WC2A 3OY8B 1XSQA 2XHKA 1KS5A 1RITA 2CNAA 3TOJA 4FTBA 1JYCA 2JDYA 2Y38A 3LD8A 2JXAA 1H1IA 4N7UA 1V00A 2W2IA 1UXXX 2E26A 3NO8A 4LXLA 4W6XA 4AFBA 4FPJA 3WNXA 4XURA 4Q1RA 3VHPA 3ZFFB 4MOAA 1QNYA 1OFSA 1BVVA 3ZPYA 3MV11 3UJQA 2VUCA 4C1WA 3WDUA 4N90A 3H7YA 4QKDA 2WNVA 3PURA 3JBG1 4K1YA 1AR62 4CCOA 5KWRA 1OUSA 2R30A 2MEV3 1DHKB 5T5OA 4XCBA 2SLIA 3KQRA 3JQWA 4YVSC 3N9LA 2XJVA 4MLOA 3O1PA 1DGWA 2J7MA 4BXFA 1AR71 1JZ4A 4FOVA 3FLRA 4AVVA 2IFRA 2QQWA 3TAYA 1DLCA 1N3QA 4XXAA 1WMFA 4IE5A 1HRV1 2W5FA 2RR11 3SH5A 4KNCA 1JBCA 2B7YA 5EV7A 1XB9A 3WDTA 3ALQA 1IG3A 4QGMA 4ZONA 2RDSA 5FY1A 2DVGA 4BQXA 3MI8A 2EXJA 5KHHA 4HKLA 1OBNA 4GZ9A 4DXRA 5JSPA 5FAXA 4AFCA 4JX0A 5GZFA 1M4WA 1PIV3 3MW4A 4RS5A 3PNAA 2W91A 1S0DA 5FUIA 4P9GA 3RDIA 4XJAA 3OPZA 4YVSB 2YBKA 4FFFA 3UV9A 4CUGA 1EV12 1OMIA 4NHYA 4XW3A 1MQTC 4Y1YA 1J3QA 2HBTA 3N9NA 5CEHA 2ZGOA 2AACA 2HLEA 2RDRA 2RM22 3D82A 1R1ZA 2BGOA 1AX1A 4CDUA 3DKQA 4NIAA 5K8SA 2DVDA 5IK4A 2GAUA 1W04A 1XNAA 5FYUA 4G4FA 1PO12 4ONUA 1GP4A 5LASA 2W0XA 5C7GA 4AVBA 5JWPA 4KBBA 1ASJ3 2ZHNA 2P4EA 5FJHA 3AP6A 3EJKA 2XMLA 3GXUA 4UT5A 1JUHA 1AUYA 5FDBA 1LB2A 4RA0A 1V6IA 2GALA 1MS4A 2QNKA 3O0VA 1MQTB 2PHDA 3K3OA 4W50A 1HB1A 1LODA 1IS3A 3USUA 2BOJA 2VUAA 3KT4A 4Q4X2 1AXKA 4QDSA 1IKPA 5T50A 2JG9C 3VZNA 5LY1A 1AR91 2VTFA 2WS93 4Q0PA 2Z2SB 4FFHA 4CYDA 2GMPA 2E7QA 2WT2A 5L7OB 3B7MA 3W21A 3VUOA 1AX2A 4KMQA 1DGRA 1L3JA 2GC1A 4Q8KA 1YI7A 1FPN2 2C6SA 2Z79A 2ZEYA 1W6QA 3KF3A 5FZ6A 3E1F1 5FY4A 1S0GA 3PU8A 3VBHC 2WZR2 1VBC2 2D98A 5JXIA 3MLJA 2HJIA 1QOTA 4BYYA 3IDBB 3RJ2X 4FBFA 1ZM1A 3AFKA 1Y3TA 2UWBA 5LRSA 4PI2A 4I2OA 4WVZA 2WNOA 1G9FA 1QJU1 1Z78A 2VC9A 3JD72 3BTXA 5DZEA 2XOMA 1RIRA 5F32A 5HV0A 2VMDA 1UZWA 2WFPA 2XXZA 5CA6A 3I2OA 5A33B 1PGL2 2WYFA 2RS31 1QJY1 1XU1A 3K48A 2VG9A 4NRQA 4Q4V3 5HBAA 4S2HA 1UPSA 3THCA 2OS2A 1ZBE2 4BXSV 4MG2A 4DUXA 5T5JA 4AHWA 4CCMA 1H2MA 1LESA 1YQ8A 4RQPA 4XXPA 3AXEA 3W5NA 3J8F1 1OLMA 1LJ7A 2Y60A 4H3WA 3GHNA 4BPZA 4EWAA 1OF4A 5LCWL 4RGAA 4ASMB 5T54A 3AYAA 2OQ6A 5J1XA 2QDNA 2R072 4LBQD 1NE6A 2C9KA 2OA2A 2UURA 2VQTA 4COWA 4CP9B 2HWB2 3O5SA 3NVCA 3N9QA 1S2BA 1S0FA 5FPLA 2YC0A 2RJLA 1QJX2 2AYHA 1MEC1 1QJZA 3AJZA 2XJTA 3KT1A 2WZPP 4JRLA 2W92A 1HB4A 1AR73 3POGA 1Q8PA 4Z2AA 4EN9B 4XZUG 1HDKA 3AM2A 1HRV3 2V09A 2RR13 1JI6A 3GCWA 5FYHA 5IK7A 2ARAA 1D4VB 4LHKA 3GZTB 3NNMA 3SEPA 4E2QA 5CG8A 1AL22 1L7LA 3X29B 5JZGC 1YO8A 5LK5A 2FMYA 2XLFA 1Y9QA 4Q27A 1WW6A 3AMPA 3PHMA 5FBZA 2JDMA 1NQJA 1VBD1 4XMIA 4A42A 4GWNA 1KXGA 4AVAA 2GNBA 2K0GA 3HT2A 3KHCA 2FQPA 2ZX4A 4XFCA 4EN0A 4ISQA 5HCHA 5CFCB 4Q4Y2 1U5XA 2ZGTA 3CJIA 4CZSA 1Q8OA 1Y43B 3DPRA 5CFDC 2EICA 1APNA 2B4KA 1I9RA 4CVUA 4AVSA 4CP1A 5C4WA 4C90A 4O9EA 1O3RA 5T55A 2YYOA 3UKTA 4AAXA 3IMNA 2P3KA 4ZU5A 5FMOS 1J1TA 1ZBA2 1RUJ2 2Y8KA 1OVSA 1QOSA 4XILA 4FSJA 2VCBA 2P5BA 2WT1A 2VZ3A 4DUVA 1AX0A 1H4GA 1OA4A 3JXSA 5HCFA 3J4UH 3ILRA 4UFMA 1ZX5A 4IEPA 2HBUA 5FZIA 5EJZB 3KV9A 4MSVA 1AR93 3ZIWA 1POV1 5CFDB 1WW7A 1W9TA 3SQOA 4F3JA 4EE2A 5DUWA 2RMU2 5LEJA 1H6XA 3E6BA 3D6EA 5GZCA 1XE7A 1ND3C 4BCUA 3FL7A 2QQIA 4TN7A 5ANNA 5AVPA 1OKOA 2HYXA 2B45X 3H8UA 2ZACA 3WDVA 5FZ9A 5FZMA 2PFWA 4XMAA 3WW1A 5F1RA 5GZEA 2EVXA 5A3LA 3OPWA 4Y1UA 1B35A 2PN5A 4DFSA 1QJU3 3PUAA 4F7ZA 2GC3A 2QQNA 4RGKA 4OUEA 2JIGA 1W6PB 4O65A 5IYYA 2VUJA 1AYM2 2YHJA 4Q8LA 2RS33 1QJY3 3MPPG 4XABA 1NYWA 3J7NA 2MNGA 2HWF3 5FOBB 1ND3B 3ZYRA 3AVRA 1YJKA 1AXZA 1C1FA 1WCDJ 2UU8A 2WN3A 3I2JA 2OXBA 3IAPA 1GKBA 1GU3A 1JUIA 1VRH1 3THDA 1CAVB 1MS5A 2Q0AA 3J8F3 1ULOA 3ETPA 2JE7A 4QX8A 4BDVB 1TME1 4E2GA 4LBLA 3T2OA 4WM8B 1DZTA 3M70A 5BXXA 3VBFA 1CVNA 1EYBA 1LGBA 4ARYA 4E4SA 2FHRA 2FD8A 3PUIA 1QY4A 4HT1T 1GUIA 1WCSA 5HI0A 5KHGA 3I7DA 1S1AA 3O1TA 3DECA 1QDOA 4QB6A 4P08A 4R9AA 1JOJA 2B46X 4XIOA 2G19A 2IXHA 1F35A 3LEGA 1SLLA 2VGDA 3IAQA 4Y33A 3HNMA 3VBOB 4WM7B 4LIVA 4NWWA 2VTXA 4JQTA 4UOJA 4EN6B 5FO9B 2FZ1A 4RSUA 4NROA 1Q8QA 1H6YA 2G4IA 2HWE1 2VBBA 4COZA 1LCLA 1NY71 4QQOA 1NE4A 1SFYA 1OLRA 2WFF1 2XBO1 1RUH1 4PF5A 4XFHA 3JCIA 5LBCA 1V9U1 2BEOA 4FPEA 1CPMA 2GU9A 3KM5A 3I97A 4JRAA 1LRHA 4CUBA 4KBZA 2BZDA 2E33A 1ND2C 3RMXA 2RDQA 3BU7A 4E8CA 1DYPA 3PU3A 3T1LA 5KHIA 4A7ZA 5L36A 2NMOA 3FMGA 4H2AA 3WQBA 1LNSA 5C3QA 4E9KA 1VBD3 2YFUA 3AP4A 3WF2A 3SCFA 5EPAA 2E6VA 1FI2A 2BDRA 1PNGA 2XPJA 2P3IA 2VE1A 1DGRN 2RDNA 2ZEZA 1UOJA 3U4XA 5IK5A 5IAVA 1NA1C 4UW6A 2VOXA 4UFLA 5E6HA 4LKDA 1RUI2 3A21A 3OSDA 3SH3A 1WLWA 1FV3A 3PMEA 1YFYA 4R8HA 5I0UA 4NRMA 1W03A 2FCTA 4KL1A 2JDUA 1QHDA 2I07B 1Q8SA 2XVKA 1DIWA 1ND2B 1XNCA 2VNGA 5AC92 2XVGA 4RN5A 2R49A 1C8M2 2EXHA 5FZLA 4WBBA 3SKVA 5ERLA 3ZXFA 4AI8A 2GDFA 3C7OA 3MDPA 4COYA 2Z69A 3WDYA 4GKXA 4AG4A 3NNGA 5F7UA 1OF3A 2CU5A 1ULEA 3AZZA 3ASIA 3SEEA 1HQNA 4NMIA 1NA1B 3WCRA 2RV9A 3EB7A 3QBQA 2AEYA 2WSUA 1JODA 1POV3 4FPKA 4JCKA 4M00A 5AFBA 1JN2P 2JEMA 3KV4A 1LTEA 2E53A 4OQ8A 1WGPA 1DQ2A 4BB3A 1HV1A 1H30A 2H0BA 2YBPA 3VBRC 1HW5A 1RUF2 2VZPA 4G9SB 3VL9A 2E7TA 1EPWA 2P1BA 4FAHA 4WZCA 1OQDA 1BZWA 2GNDA 1AR61 2VJXA 2TUNA 4QX0A 2Y6FA 1C5HA 2B39A 3BIWE 1DDLA 1SACA 3KHBA 4AAPA 1OQEA 3O1MA 3LWCA 4QM8A 2VZTA 2WWJA 4E27A 3H42B 4YZ5A 3H3LA 1YJLA 4PQQA 4JC1A 5TSWA 3CBNA 4J1XA 4Y24A 3WNOA 3VBRB 3MIHA 2FDHA 4B7EA 5FYTA 2PHXA 4FP2A 1W6OB 3DYOA 2TBVA 3URFA 1VRH3 5GZGA 2X5IA 4HXCA 4K21A 1GLHA 3PVEA 2Q8OA 1TME3 5E1RA 3B5LB 2WQ4A 1F31A 2YU1A 4E4HA 2BU9A 4PIXA 1UL9A 2A3XA 1D0GA 2D6NA 5D21A 1CZSA 5EFUA 3ROUA 4AVTA 4D7SA 4HZFA 1EV11 2ORZA 2IXKA 2EIBA 1CD3G 1M06G 1H0BA 2Q8CA 4XF9A 3R05A 1S0BA 4ES9A 4I09A 4XPVA 2XWBB 2RM21 2J1AA 1J59A 1SBDA 4YG0A 5A80A 1K3IA 2QQKA 3DPRC 4HPKB 3TB0A 1R1A1 1SZBA 5I0DA 1UPIA 4FPHA 4JQRA 2HWE3 2HEYF 1S4CA 5JXHA 1PO11 1OSGA 5A7SA 4URTA 2EXKA 2WFF3 2XBO3 4TSVA 1RUH3 2QUOA 4LBQA 4R9BA 1V9U3 1UMHA 2E31A 2FDGA 4S2GA 4TTGA 1PGSA 3UETA 3ZX7A 1CIYA 1UY2A 5IAXA 1PX3A 3U4SA 2B9VA 4QPIC 1ENQA 4D7YA 1IZ3A 4IV3A 1H1MA 1SLAA 4N7IA 4RR3A 2DTYA 5FZGA 4FO9A 3GYDA 4Q4X1 3MF6A 4B7KA 1U5YA 1H2LA 2VULA 3O0XA 4CCCA 3I8TA 4P9XA 2OZJA 2QZ2A 3SKJE 2JD4A 2ES3A 1DU3D 4DB5A 3N7MA 4Z07A 1UU6A 4PCRA 5FZDA 1FPN1 1VMFA 2NMNA 2Q30A 4FCAA 3AZVA 4NPRA 2J42A 4PBPA 3WLUA 2OT7A 4NIGA 5A33A 2WZR1 1VBC1 1ZRFA 4XZPA 3B9CA 1REEA 3WHTA 3CZJA 3WW4A 2GN7A 4QPIB 1FNZA 4OZXA 5AFEA 1B35C 4MZUA 5C9AB 3CZUA 4XUPA 3ZFEA 3JD71 3WVJA 3T0DA 4LKEA 3CJXA 2XJSA 2EAKA 4IESA 5FMCA 1UKGA 4BQYA 4ZU7A 1PGL1 4LOTA 1GZ9A 4UFJA 4I3PA 4FOQA 2IXJA 4FTEA 3AB0A 4IEYA 1ZBE1 2JKXA 4XFIA 3T0BA 3AMMA 2F4PA 3V0BA 3GNEA 1E5RA 4JKMA 1IQAA 1LOEA 1FATA 3ZVXA 5BNNB 2LM3A 3NKGA 1D2QA 2LRPA 1E57A 2XG3A 1XC6A 1PM7A 2PHFA 3VKFC 3LZZA 3MUY1 5I0TA 5K4LA 2YBSA 3LA7A 1R64A 2R071 4CA9A 5FK8A 4PHZA 4BLIA 2HWB1 5L19A 1YXWA 4MX3A 3GBFA 4RD7A 1AR63 5D2AA 1WWYA 3EO6A 1X7NA 3SC7X 5A6YA 4I3GA 5A7WB 4Z2WA 1GWLA 1VAKA 1QJX1 4MHRA 1MPXA 3SXWA 1JYWA 4ATEA 3V0AA 2RS52 1JS9A 2X8KA 4AEDA 2IFWA 1LOFA 3LPGA 1FX5A 5JXGA 2G9FA 1S2EA 2O14A 2GC0A 3KVAA 1N1TA 3N36A 2D40A 2QE3A 1YQ6A 4LO4B 1J3RA 1Q43A 4CDQC 4DRVA 3NV1A 3CL1A 3VL8A 2DFCA 3M3OA 1AL21 2JWPA 1QQP2 4GAZA 4UFKA 3QOPA 2HYKA 4YW5A 2WLPA 1POV0 4QPWA 5J96B 1U12A 1V0AA 1BBT2 1WW4A 1YEWA 3K46A 4QX3A 5FLHA 1RXGA 5F9TA 5FPBA 1OH3A 4R4ZA 2IXLA 5L9BA 2CYFA 2FDKA 4KU8A 3U14A 4NHMA 5JOXA 2AREA 2J1EA 1E5IA 4UYBA 3NJVA 4XHXA 1UZZA 2RM23 4A2UA 2HKXA 4OMDA 4QM9A 1A8MA 1ODNA 1VB4A 3M3QA 4IQPA 3NV3A 4Q4Y1 4WVMA 1PM4A 1US2A 5D8AA 1R1A3 1SQ4A 2WLQA 4IEOA 5FQ0B 5CYYA 1LEMA 2RJ2A 5CIRA 4OI4A 3VBUA 1XYPA 4FPFA 3FHIB 1W0PA 3DYMA 2W39A 2VR4A 5A3NA 1W6NB 4CDXC 2QCSB 4LBOA 3LA2A 3IMMA 2FCUA 1NUKA 1O8PA 1J1LA 1HRI2 2E32A 5FK7A 4AGGA 4EROA 1H8TA 2HEVF 2VQUA 1ZBA1 1RUJ1 3NQHA 3PIGA 4LIUA 4AFAA 4BMBA 4YYOA 4FFIA 1OVPA 2DVBA 4QX7A 1OHFA 5L7OA 3E5XA 4N8MA 4GIQA 5LBEA 3M7AA 1RHI2 2R043 4Q4X3 4QDQA 5DUVA 1BXHA 1ULDA 2Q1ZB 3OUIA 3O14A 1ENRA 2VBDA 4OI2A 3VDCA 4A4AA 2DYCA 3AK0A 1VRBA 5JVVA 5A70A 3HAGA 2RMU1 3U10A 1SDWA 2BYVE 3ZDSA 2VVDA 1FPN3 1KS4A 4CDXB 4XACA 3N7JA 4GH4C 2ZGUA 3THTA 4JAAA 4Q0SA 2VM9A 3LGRA 4LHNA 2ZA9A 5HXVA 4ATFA 4GQ7A 4JKKA 2WZR3 1VBC3 2Q5TA 5F5CA 4LA3A 5DUXA 3RMYA 2PA7A 1JYNA 4FTSA 4L2NA 2FCVA 4AHZA 1ULCA 4Z8BA 2GNTA 1WD3A 4FOWA 2VTXJ
chains in the Genus database with same CATH topology
3JD73 3ZFGC 1UU5A 1A6CA 1GZCA 2OUHA 4PJYA 2HWD2 1AYM1 3CO2A 3QH7A 4MXVA 1NXD1 3FJSA 2PELA 1VALA 4YZ4A 4RHV2 1ZBE3 3OYWA 3B02A 4GH4B 1AXYA 3FBMA 1IPJA 1MS1A 2P34A 4XF4A 3ENRA 3DUIA 1RVF2 4XYXA 5K0UA 1SFNA 3R6SA 4PDWA 1AHSA 1DQ0A 2IXCA 3ZFGB 5BNPC 4IEQA 2R073 3MICA 3MFAA 1T6GC 1WW5A 1OQ1A 3IT8A 1UZYA 2HEWF 5LEKA 1O3SA 1QJX3 1W39A 3POYA 3AMHA 1C28A 2R32A 4LR4A 5JOWA 5IUQA 4M3CB 1LOGA 2WIIB 3W9AA 4AVCA 1NOVA 4K6BA 4AW7A 5I93A 1I3HA 3ZYGA 5T5PA 1AR82 4K3UA 2XWJB 5BNPB 4LE4A 1FMD3 3RWNA 4YG3A 1RB8G 2YMZA 2RS12 3ZIXA 5I0RA 2JKBA 1DQ1A 4QPGC 2AENA 1VBB1 1DG6A 1NCRA 2EA7A 3Q9OA 2XJRA 4XFFA 3LCPA 3SCHA 2QVSB 4JGYC 2EIGA 4M3CE 4N53C 4Q4Y3 2HWC2 4W65A 2IWGB 2BWAA 1RUI1 1HLCA 1SCRA 5BPXA 4BHPA 2D5HA 2P2KA 4JGZA 2FBEA 3LSDA 3AKSA 2F6BA 4YM0A 4AHWA 5AC91 1QH6A 4KU7A 1C8M1 1G8WA 1K5MC 3S7IA 3ZXGA 4AYUA 1ZBA3 1RUJ3 3AP5A 3FLPA 3RSJA 2ZHLA 4CDWA 1O4TA 4N53B 3ZMNA 5FCCA 1BEV2 4MV2A 1TNRA 3H3ZA 1VBA2 2RMU3 3FUQA 2E51A 4FPYA 4HVRA 1RUF1 4BZ4A 3KLSA 1K5MB 3JQXA 2AUYA 1CAUB 2B5HA 3OBRA 2GH8A 1V6LA 3HQXA 3IPVA 1GR3A 2OVUA 3DGTA 3IWZA 4HKOA 3QD6A 4UW5A 1AYM3 3OF1A 3QCWA 4AEDC 4HVOA 1LGNA 2C5DA 3IN9A 3B00A 3MGUA 2C9AA 3WQ7A 1VBE3 3VLBB 2JICA 2PYTA 3N35A 4BQ1A 4WM8A 1HV0A 2BUKA 2WINB 4HMZA 2ZGKA 5KXEA 2A5ZA 3I59B 3WR0A 4EWEA 4BA6A 2PAKA 1UN1A 5I8YA 1YHFA 2P3JA 1J3PA 4WM7A 1EPZA 2YY1A 4L97A 5JAXA 3EQEA 2VVFA 1S0JA 2JG8A 1MVEA 1D4M2 4LA2A 1NQDA 4MH0E 2A6ZA 3TNQA 3N3HA 1Z7S2 3LSEA 1U5IA 3HT1A 3PLQA 4XJ8A 2RJKA 5A32B 3MIGA 1R082 2JE9A 1ULFA 2I74A 3D5OA 1UX6A 1VBB3 1G9BA 1RUE2 2ZGPA 3WG4A 5FTTC 4Q0QA 3ZO0B 4KGGA 3UL2A 1GICA 2ZZJA 2WA3A 4XJWA 4OI1A 1N3OA 1WLDA 1SBFA 4TYSA 3FZ3A 2A3YA 4OHWA 5JIAA 2JG9B 1RUI3 2R0HA 1PVC2 1PZ9A 1CAWB 2WL1A 5AC93 4KG0A 3VKOA 4CEWC 4YG6A 1C8M3 4D3WA 4HSLA 4R9CA 3ZFFA 4N9HA 2NN8A 3VBHB 2AGSA 3AP9A 3GF6A 4P14A 1GZWB 3CEWA 5CBLA 4ITCA 3OJBA 2XL7A 3W59A 1C8NA 1ZZBA 4XF3A 5BUVA 2DCKA 4R52A 3VZLA 2A7AA 3GBWA 2CV6A 4CRQA 3JBG3 4PBOA 3WP6A 3ZSLA 4AE2A 1RUF3 3AXDA 4GMP1 2D6LX 4W6YA 5C6CA 5FMOL 1PVXA 5JIUA 1URXA 1S0IA 4IV1A 1RUOA 1G9AA 1WBFA 3O7OA 5BNOA 5JI7A 3ST7A 1LEDA 1W6OA 2P37A 4IETA 2RS51 2QKDA 1GNHA 2UYAA 4YNIA 5FLJA 1N3PA 3M3EA 5BNQA 3THPA 4YZ2A 2BPA2 4I02A 4BE3A 1UKRA 3JZVA 4QGLA 5CADA 1YCIA 3W58A 5C8CA 1QQP1 1IS5A 3RYKA 1NCRC 3ATGA 1ULGA 4EJRA 1W6MB 2OIIA 3FX3A 1AL0G 5A3MA 1CJPA 1QDCA 4LBNA 3BALA 1OPOA 2I2SA 4ASLA 2PAMA 5JZGB 1EY2A 2ZHKA 1VAVA 3TRSB 1KRIA 2WT0A 1DLLA 1NG0A 1ENSA 3AP7A 5JI9A 3M3IA 4HK9A 1C3HA 4META 4JGZC 4Y20A 3PVBB 1KJRA 2Y0IA 1SLTA 4R4XA 1QXPA 1HRI1 2G9GA 2YROA 4I0WB 4SLIA 4XFAA 3CLPA 1PGW2 1RHI1 4LULA 1H2NA 1OPMA 1CPNA 1FXZA 3FFQA 1AVBA 4KGQA 3AJYA 1YYNA 4AQ2A 2WNVC 3M2MA 2ZGMA 3VBSA 5ACA2 4AQ6A 1H1AA 1LOAA 2BQPA 1HX6A 2XLGA 5CNAA 1QNWA 2VH9A 3HBZA 1V6OA 3WX5A 4KWKA 2O8QA 2GH2A 2XKPA 4BMEA 1DF0A 2WWSA 3INAA 2MEV2 2WNUA 3OD4A 2HWD1 3HD8B 5J09A 1X36A 2WNVB 4RS5C 4RHV1 3AX4A 4ZU4A 4H14A 5EZWA 2XVLA 1RVF1 1ZZCA 1PZ8A 3ZXEA 5I91A 4LUKA 3VHRA 1N47A 2WQZC 2OPKA 4GMP3 1MEC3 1PIV2 4AI3A 4CDUC 1HXS2 2D6PA 1KITA 4XBLA 3TBDA 4QGNA 4YVWA 4RS5B 1ZRDA 2EALA 1GSLA 1X8EA 2DVAA 2JG8C 4QMAA 4S2DA 1FNYA 2SBAA 3H9AA 3WP5A 2JX9A 4F8AA 4OUMA 2RS53 2QZ3A 3WHUA 5F6KA 1G9DA 4EWDA 4L99A 5SV8A 2XB6C 1AR81 3AZWA 4CDUB 4LO8A 4PLNA 4Q4W2 3MEPA 2RS11 4H7LA 2CWSA 3QACA 3A0KA 1C5IA 1O3QA 4N43A 1LHWA 4P9LA 3B01A 3MIDA 4EN7B 4QU2A 4M3CF 1YIFA 1VAMA 2HWC1 1KJLA 4KQ7A 3I54A 5F6LB 1X82A 2VU9A 1G6NA 3B94A 2C1FA 3M8LA 5I8SA 2VW2A 3ECQA 1W6QB 1ZZ7A 2V5YA 3P3NA 2DCJA 4RQPC 4KG8A 4V1PA 4AF9A 3SHRA 4HN0A 4JDOA 4AQSA 1RHI3 4UBHA 4DPNA 4Q4V2 1SLBA 3WUCA 5ABJA 1BEV1 4MGZE 1OOPA 2PHLA 1F9KA 1VBA1 2IC1A 4WVVA 4CEYA 3KMHA 2XL9A 1LULA 1YUDA 1OA3A 3POWA 1S2KA 3NAPA 4FT8A 2JECA 2D7FA 2WA4A 4HLTA 5DUUA 3SCGA 4QXKA 4RQPB 2DUPA 4N9IA 2EAAA 2WKKA 1G9CA 4J6GA 3KSCA 1XXNA 4X6RB 1QKQA 2I45A 2DTWA 3ZSMA 1VR3A 4YFWA 2H0VA 1X33A 2HWD3 1JXNA 4XBQA 5DG2A 3WXPA 4NO4A 2A3WA 4Q2FA 3WW3A 2Q1MA 4NHKA 4XEZA 4LUMA 3AKQA 2A73B 1RUNA 3RZZA 1UMZA 1RVF3 1MVQA 2O8OA 4K7JA 1VP6A 3ILNA 4MXWA 4Y22A 1UIJA 2DCYA 1CESA 3VDDA 4YW3A 4X8PA 4HVQA 1OLQA 2QJVA 2VXRA 3CJIC 1NCQA 1X8MA 4M3CA 1UAIA 2BGCA 4LO6B 5L73A 5C4WC 4FQZA 1BKZA 4LBJA 1D4M1 1TMF2 3SLIA 3APBA 2VMGA 1PK6A 1Z7S1 1AR83 2C0ZA 2VPVA 4DS0A 1JW6A 4AWDA 3GZAA 3CJIB 1R081 3DPRB 3WG3A 3RJRA 1ALYA 2YZ4A 5DDJ2 5C4WB 1RUE1 3R0RA 5JOYA 2BNNA 3CNAA 5LK7B 2PTMA 1Z0HA 1WA4A 1S55A 2Q4SA 4DY5A 1CAXA 1CR7A 4GMP0 5AVAA 1CQ9A 2ZX0A 3VBSC 3RQ0A 4E2SA 3DF0A 4P9JA 3FUOA 3OY8A 4NN0A 1PVC1 3WDXA 3EHKA 3LOIA 4B8EA 5JCTA 4XF1A 5LRRA 3G7DA 2XJUA 4BH9A 2WNUC 3MLLA 4K40A 3VGIA 3WOGA 5HCBA 4QQHA 1B35B 2ZMNA 4ZXKA 4FVVA 1BYHA 1BEV3 1DQ6A 2HWF2 4OLLA 3VBFC 1OD5A 4XJ9A 3MF9A 4BM8A 5J7MA 1BQPA 1JHNA 3J26N 4IEXA 3PVOA 2OUJA 1FOD2 4MGKE 1MACA 5EWSA 3C3VA 4OFGA 1Q5OA 2NYYA 3BODA 2O0OA 4K8FA 1H9WA 2DWRA 4GULA 5GLUA 4NVPA 4COUA 1KDKA 4AEJA 2OW4A 1HQLA 1XE8A 3VBFB 1KQRA 3ZN6B 4YVSA 3IDEA 3AYCA 5GLZA 3CU7A 3POSA 2ET7A 4Y5Z0 3PJYA 5FO7B 2BNMA 3CF6E 2ZGNA 1EV13 4GA9A 5BYNA 1XNBA 3SMHA 2ATFA 5GZDA 1MZ6A 4FPCA 3WG2A 1F2NA 3ZSJA 2D5FA 2YGMA 3AMQA 4QQLA 2ET1A 2X53S 1IHMA 3M1HA 4OHXA 1PO13 1KFXL 4DQAA 1MQTA 2E63A 3AKPA 3NWKA 1LOBA 1WLTA 4YM1A 4OHZA 1D4M3 2ZBJA 2R062 5GM0A 4AGRA 1RJ8A 4XTPA 4YFZA 3WW2A 1KFUL 4XE9A 1AF9A 2EXIA 4HKWA 1JH5A 2R0FA 3WV6A 1R083 3AKRA 3ZXJA 1O7FA 1EAH2 4BIFA 3SITA 4ISRA 4AEMA 5BY5A 1U5ZA 4P9WA 1RUE3 3H0OA 2VOWA 1PGW1 1WCKA 3PJQA 1WLCA 1RINA 1QOOA 1N1SA 2VY0A 1U0AA 2VECA 4X6QB 4YW1A 4Y26A 5H9SA 3VKNA 3LOBA 4GXLA 1O5LA 2UY9A 3WD5A 4LLFA 1QWRA 2Y0OA 3U0ZA 2FZ2A 2DF7A 5ACA1 1ZZ9A 2UWCA 2WJSA 2ZJCA 4AQTA 1F8VA 2A75A 5J48A 2JJ6A 2D3SA 3VBHA 4HFSA 4L11A 4SBVA 3KCYA 5J37A 5EYYA 2X29A 3B9IA 2CGPA 1UW8A 2BVBA 3R4DB 1HIXA 4ZKTB 1YIPA 5EXOA 4YM2A 4PLMA 4YZ3A 5DG1A 2X5IC 1EP0A 3NKTA 4YARA 5JOZA 1BCXA 1PO22 3ILFA 2D3RA 5KXBA 4TWTA 2DVFA 1QF3A 3MZHA 3JUUA 5J36A 1TQ5A 2HWB3 1CIWA 2KM2A 3H1MA 4UXAA 3HWJA 3NSTA 1PIV1 2KXLA 1DFQA 1HXS1 3LB9A 3ZXLA 4KH9A 2X5IB 3MIEA 1OA2A 4Z82A 4NOTA 2VOVA 2Z5WA 2IXIA 1AL23 4H7MA 1RJ7A 1YFUA 4FP3A 2PHTA 4Q0UA 1DGLA 4IV3C 4LHLA 4Q29A 4RR3C 4HETA 3V64A 5CFCA 4Q4W1 2VNOA 4I01A 2BVVA 1AYN2 3HR9A 5J98B 4P9IA 3IBMA 4YW4A 3DKWA 1RUC2 5DXDA 4LBQB 4XFBA 2MPFA 3KS7A 3DN7A 1RUD2 1D2SA 5GKAC 2OZ6A 3TN92 3ZXAC 4QPGB 5H9PA 4IV3B 1YFXA 3S7EA 4RR3B 4FPGA 3ZFEC 4FOYA 4IL7A 4Q26A 2ILMA 1H2KA 1YNAA 5CFDA 3T1MA 5T52A 3RYRA 3FFZA 4XETA 1ONAA 4JGYB 1DYKA 3VV1A 4DRRA 3N4MA 5GLWA 2BTVC 4Y1ZA 4DINB 2GMMA 2WNEA 3VZJA 1NLRA 1LOCA 4HSJA 4Q4V1 1RMU2 2PHUA 3JU9A 3NV4A 4IEZA 3KZ4C 1F5FA 1RC6A 4C0HA 1W6PA 1OKQA 4J1WA 4YM3A 1RTVA 1V6KA 3UJOA 4LLOA 1S0CA 2VNRA 1S0EA 5T3NA 5ACA3 4YGCA 1ND3A 2GZWA 2PQQA 3OBTA 3UKVA 4XIKA 3V0BB 2CAUA 1QU0A 1JYIA 2CTVA 2RE9A 1LOFC 1CAVA 4XF0A 5IK8A 3L2HA 2NQYA 2D6KA 1QXRA 3ACLA 3KD4A 1MZFA 1O91A 2TNFA 3R4SA 3KGZA 2DUOA 4FXKB 1LU2A 3V0AB 3DV8A 1UCXA 4HK8A 3AZXA 4XJUA 3VBOA 3D8CA 1VIWB 4OHVA 4AEDB 1RL3A 4P9YA 4AEKA 3D0JA 4D7TA 5HCAA 1YFWA 5CAZA 1HXS3 5D8AC 3RNSA 5J3UA 4XQDA 1ZRCA 4B29A 3WZ1A 3VBUC 2CWMA 2CGOA 1GV9A 3WQ0A 1CX4A 2D44A 5KC5A 1TMF1 2BW8A 4YGBA 4GB32 1H8TC 1Q8VA 3KT7A 4G3YC 4A3XA 3ZYJB 4B4PA 4NHLA 4Z92B 1R1A2 5L7OC 1GBGA 3AYDA 3HN1A 2KA3A 5GALA 4Q4W3 5D8AB 4XOGA 4WVMB 2D97A 3AFGA 3D0SA 3VBUB 2XGXA 5GLTA 4O9GA 3T1LA 2H6BA 5DDJ1 1GNZA 2A6XA 2OYZA 1ND2A 5KC6A 3U11A 5FLIA 2R042 1XNDA 2ZMKA 2B9UA 1PNFA 1H8TB 1ZVFA 1YRZA 2K2SA 4YLZA 2IZWA 4CTEA 3BCWA 3LAGA 1NA1A 1CGPA 4C0BA 4Y4YA 2GSYA 3ZMOA 2ETEA 2D43A 3PMSA 3GALA 2DU0A 2D93A 3ZSKA 1BJQA 1F5JA 4GKYA 1C57A 4PIZA 2VW1A 4BOWA 1NZCA 4DMIA 5K0UC 4PDWC 1AJKA 2VOKA 4CEWB 2XH6A 2YUEA 5H9QA 4YRDA 2HWF1 4JTOA 2GMEA 1X50A 1NLSA 4OUSA 1FOD1 3E97A 3AYEA 3WG1A 2ZAAA 5KXCA 4GWMA 3OYWB 3VBRA 3VKLA 1SCSA 5K0UB 5GJ6A 4PDWB 4Y1VA 1WUVA 1REFA 4LBMA 1CONA 4Q1PA 1C4RA 5E88A 2ZHMA 4XFGA 1YI9A 3HIFA 1LKNA 3A0NA 5CVRA 4RGGA 1LR5A 1LGCA 4DY3A 1BBT1 4LO5B 4B3NA 4CP0A 5CFCC 2YXSA 5JPMB 3WP3A 3WDWA 5T5LA 1FMD2 1H9PA 4HPKA 2D6MA 4EV0A 2UYBA 4LT5A 3BPZA 4I30A 1R092 2GNMA 1A78A 1LHVA 4COVA 4L8QA 4DNYA 3IM0A 1WBLA 3A4UA 5DZFA 2R16A 1COV2 3VZMA 5CB7A 5FPZA 4AFDA 3MIFA 1NCRB 2BNOA 4FXGB 1TMF3 2R061 2ZKNA 1WD4A 4EN8B 4F83A 4H55A 3S6PA 2WSVA 4CDWC 1O3TA 3UKNA 4A7KA 1RUG2 5DZGA 3WUDA 4E4ZA 2QDRA 2PLV2 4UW4A 2XKOA 4HL0A 3KCXA 3EBRA 3WY6A 2ZS6B 1EAH1 2JDZA 3H1WA 4JGZB 5DDJ3 2VQ0A 3NL1A 1QXJA 3R4UA 4QPIA 4AK3A 5CG9A 3VN4A 5C9AA 3FLTA 2EF6A 3AKTA 2QQPA 4CDWB 4AHXA 2AH2A 3SISA 2ENRA 3ZXDA 4YSFA 3LKJA 2CY6A 4B4QA 1GQGA 1DGWX 1GQHA 5BNNA 1BMV2 2LALA 3WCSA 3BOWA 3ES4A 2A71A 2YV8A 1MZEA 3ES1A 4WM8C 4HANA 2CL2A 5JR7B 4I0AA 4IEVA 3SNMA 5JSRA 1XRUA 1PO21 2A6YA 4AHYA 3MFCA 3MW2A 3IPVB 1YLLA 3RYPA 1VBE2 3NV2A 3VZKA 1QH7A 3NW4A 2ZKLA 4XQWA 4AFMA 3FBYA 2GN3A 3AMNA 3VBOC 4WM7C 1FOD3 3PVNA 3H50A 3AZYA 3B93A 2BWCA 1UU4A 3I4IA 5EYXA 1TNFA 2VQAA 4HBNA 3ZN6A 4E4DX 1MS0A 1GANA 3P3PA 3ELNA 3S30A 1B09A 5JMCA 1ASJ2 4PLOA 1GYKA 4L9BA 1MS8A 4MVTA 1QQP3 1W0OA 1SLIA 3MLKA 2W08A 3RI8A 3UK9A 3PTYA 3MPBA 4FPOB 1G86A 2YDEA 4A7YA 2CAVA 2JG8B 3WQ1A 1BBT3 5D1IA 4B4RA 5F5QA 3ZSEA 5BV6A 3E6CC 3TNPB 4CDQA 2ZMLA 4BLJA 4L92A 3QH6A 4IEWA 1AYN1 2WS92 3HMYA 4GALA 5FQ0A 1BK1A 2V73A 2ZGLA 4LBKA 4M0HA 1H4HA 3ZN5A 4KWLA 1WMEA 5C8WA 1RUC1 1VBB2 3H3UA 3USUB 4DXZA 2YPJA 3IKWA 3IDCB 1W6NA 4AGVA 5B2GB 1ZZ8A 5K9YA 1PZ7A 1RUD1 4OVEA 1OFNA 5FRAA 3TN91 3U07A 3ETQA 5K7PA 3FE5A 4BIOA 2R063 3ZFFC 1HRI3 1O5UA 2GC2A 2D3PA 2BFUL 4AI2A 1XNKA 3FC0A 5SV5A 5FO8B 2A6WA 4U36A 4QX5A 3ZYPA 4ES8A 3WINE 1FV2A 1XU2A 4CDXA 4FQ4A 4JVAA 4XBNA 1HKDA 3D4KA 1A8DA 1EAH3 1O4ZA 5I8TA 4KWJA 1LU1A 2ZTNA 1RMU1 2B42B 4Q0VA 1IPKA 1VJ2A 3L9JT 4WV8A 4IV1C 3ZYIB 3NJZA 1WMDA 1I1EA 1VLNA 2XJQA 3TWIA 1ZZ6A 2XLAA 4WZFA 1UIKA 2H6CA 5BNOC 3JBG2 1FYUA 3E5QA 4GH4A 1SEFA 1N1VA 3GHMA 1AR72 1LENA 4UW3A 2W52A 4RHV3 5JSOA 3ME2A 5JPNB 1FAYA 2UWAA 1IS4A 1DQ4A 1HRV2 2RR12 1DQ5A 3ZFGA 4IV1B 1TE1B 2DCTA 3MW3A 1PO23 1CJDA 3RI9A 2BFUS 2XUMA 5C8CC 4P5HA 4RL7A 1FT9A 1LHNA 3IIAA 1ZREA 5BNOB 3M4FA 5FOJB 5KHKA 5E16A 1REDA 3EXUA 4PQ9A 4AXOA 3N7KA 2JENA 4OI0A 3JB8A 2ZGRA 4CP2A 4FAGA 2QFEA 2ZCWA 4M01A 3BB6A 5BNPA 4LEJA 4WVWA 2DU1A 1BVP1 3OCPA 4QPYA 1IKQA 4QT6A 5C8CB 1LECA 3LA3A 2R1BA 2VW0A 5FREA 3GBGA 4TLFA 2RS13 4GB31 2O1QA 4XDQA 1GFF2 1ZA4A 1MR5A 3ZXKA 4YZ1A 4X8NA 2BBVA 4ORFA 1AR92 1AYN3 3KCCA 1ZRRA 3G6JB 1RUC3 4QPGA 4Y20B 2Y26A 5C9AC 2HWC3 4I0BA 2R041 1RUD3 2PAEA 4D69A 3K51A 3TN93 4IERA 4LE3A 2Z42A 5FFOC 4U2AA 1Q3EA 5KXDA 4IEUA 3L2YA 4JGYA 4N53A 1UF2C 1QJU2 3BTAA 1IOAA 2DFBA 4QHBA 4XJZA 2ZAHA 2A6VA 5BNNC 4Z1VA 3BOPA 2RS32 1QJY2 3VBSB 4HN1A 2ZX1A 2VMHA 1K5MA 1VBA3 4YGEA 2RHPA 1CAUA 3JB4C 2B8MA 2ZX3A 2VVEA 3J8F2 1JTZX 1RMU3 2ZOEB 3S0MA 3V65A 2N7GA 2WNUB 2UY8A 2VMIA 4YVWC 1IS6A 4LO7A 3QLQA 3KB5A 5IT6A 3WP4A 4YW2A 1MEC2 3VHOA 2P17A 3E6DA 4LTAA 1V70A 4C91A 1SMVA 1C1LA 1RGSA 3I59A 3RS6A 4S2FA 4RFT0 4BWOA 2XJPA 2MHFA 2AR6A 1I6XA 3O0WA 3B3QE 2ZABA 4R9DA 5EJ3A 4YVWB 1QMJA 4C1XA 1Q56A 2ZPXA 4N43C 1ENXA 5KHJA 1O4YA 1FMD1 1VBD2 4XHBA 3OD0A 4JDMA 1DZRA 3SH4A 3GZUC 1R091 4QQPA 3ZN4A 3OGJA 5A32A 3RG0A 1Z7S3 4NR1A 4DOUA 2D6OX 1COV1 4XTMA 4M0NA 1IGOA 2ZX2A 4MUVA 4N43B 4GB33 3C2UA 1XYOA 2R6QA 4MYEA 4YGDA 2DUQA 1J58A 2DURA 1QGLA 1ZNPA 1RUG1 1SBEA 1XYNA 2K9ZA 2PLV1 5ABJC 1CN1A 1LHUA 4K9SA 1OOPC 3J9SA 2LUWA 2JG9A 4JTNA 4QD2A 1MZ5A 1V6MA 3DL3A 4OULA 4MGIE 4CEYC 4QQ2A 1CAWA 2PHRA 2TEPA 2W68A 3NAPC 3E5UA 2DCZA 4IXLA 3MYXA 1PVC3 2NPIA 2ARBA 2NZ9A 4TZDA 1GZWA 1XQNA 3VHNA 1MS9A 4NWVA 5ABJB 1OOPB 3TYJA 2MEV1 2ARXA 1PHMA 2ERFA 4CEYB 1BMV1 4K1ZA 1NXMA 4D94A 3NAPB 2E9QA 1V6NA 4LNVA 1VRH2 3OGGA 2ZGSA 4JV4A 3VDDC 1TME2 1VBE1 4UBGA 2CGNA 2YGLA 1KDMA 1NCQC 1YWKA 4XQ4A 5E8AA 1AJOA 4DZGA 3V56A 2DV9A 1H8VA 1ZYBA 2R1DA 4AI0A 5JLVA 3B69A 2NP0A 5E89A 3RPQA 1PK6C 3OTFA 2NLRA 1DBNA 4AI1A 4MXWB 4Y22B 4MGYE 4FPLA 3VDDB 2HWE2 3T2TA 3VZOA 1NY72 1D0HA 1ASJ1 1MS3A 1W6MA 2WFF2 2XBO2 1DZQA 1RUH2 5FPXA 1NCQB 3H1YA 1AZDA 1V9U2 4W6WA 4Y1XA 3FWEA 5CU1A 5GLVA 4OHYA 5JZGA 1UD1A 5I0SA 1VB2A 3N7LA 2NM1A 1PK6B 1HQWA 2FMDA 2WS91 1V6JA 1N1YA 1SLCA 3H7JA 4JDNA 1LHOA 3O12A 1G7YA 1TEIA 3WT3A 5JDBA 1R093 5H9RA 1A3KA 2AZ5A 1PMIA 1OI6A 2A70A 3VKMA 4K20A 1I5ZA 1COV3 3M3CA 2ZGQA 3I2DA 1KD7A 1Y7BA 2PHWA 5C33A 4INDA 3KGLA 3USSA 4PIYA 1CAXB 1W2UA 2LTNA 1RUG3 5KBFA 2E7AA 2PLV3 2ZZQA 3MIBA 3ZFEB 2WC2A 3OY8B 2XHKA 1KS5A 1RITA 2CNAA 3TOJA 4FTBA 1JYCA 2Y38A 2JXAA 1H1IA 4N7UA 1V00A 3NO8A 4AFBA 4W6XA 4FPJA 3WNXA 4Q1RA 3VHPA 1QNYA 1OFSA 1BVVA 3ZPYA 3UJQA 4C1WA 3WDUA 4N90A 3H7YA 2WNVA 4K1YA 3JBG1 1AR62 2R30A 2MEV3 1DHKB 5T5OA 2SLIA 3KQRA 3JQWA 4YVSC 4MLOA 2XJVA 1DGWA 1AR71 4FOVA 3FLRA 4AVVA 2IFRA 3TAYA 1N3QA 4XXAA 1WMFA 1HRV1 3SH5A 2RR11 4KNCA 1JBCA 2B7YA 5EV7A 3WDTA 3ALQA 4QGMA 2DVGA 3MI8A 2EXJA 5KHHA 4HKLA 5JSPA 5FAXA 4AFCA 5GZFA 1M4WA 1PIV3 3MW4A 4RS5A 3PNAA 1S0DA 4P9GA 3RDIA 4XJAA 3OPZA 4YVSB 3UV9A 1EV12 1OMIA 4XW3A 1MQTC 4Y1YA 1J3QA 2ZGOA 3D82A 2RM22 4CDUA 1R1ZA 1AX1A 5K8SA 2DVDA 5IK4A 2GAUA 4G4FA 1PO12 4ONUA 5JWPA 2W0XA 4KBBA 1ASJ3 2ZHNA 3AP6A 3EJKA 5FDBA 1LB2A 1JUHA 1AUYA 4RA0A 1V6IA 2GALA 1MS4A 2QNKA 3O0VA 1MQTB 2PHDA