3WY6A

Structure of hyperthermophilic family 12 endocellulase (e197a) from pyrococcus furiosus in complex with laminaribiose
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQAVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase (E197A) from Pyrococcus furiosus in complex with laminaribiose
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 71
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wy6A00
3VZMA 2BW8A 1XYOA 1OA3A 3MF6A 1XNCA 4H7MA 2DCKA 3VZLA 3MF9A 3AMPA 3VHOA 3VL9A 1UU4A 1XXNA 2NQYA 3WQ7A 1PVXA 1XYPA 3VL8A 3ZSEA 1H0BA 3HD8B 4S2HA 1XNDA 1REDA 3VZJA 3WQ1A 1F5JA 3M4FA 1HIXA 2C1FA 4IXLA 1UKRA 2QZ3A 1REFA 3AMMA 1OLQA 2BVVA 3WP6A 2JICA 1AXKA 2DFCA 2DFBA 3VLBB 5K9YA 2BWCA 1M4WA 4HKWA 2VULA 3LB9A 4S2GA 4HKOA 1C5HA 2JENA 1QH6A 5HXVA 4S2FA 3VHNA 1H1AA 1OLRA 4XQ4A 1KS4A 3RI9A 1BCXA 1HV1A 3VHPA 3MFCA 3AKSA 3WQ0A 2Z79A 3VZOA 1BVVA 3RI8A 3VGIA 3VZNA 4HK9A 4XQWA 4HKLA 3AKTA 1QH7A 3VZKA 1C5IA 2BWAA 1OA4A 2B42B 5K7PA 3O7OA 4S2DA 3AMHA 2D98A 2B46X 2D97A 2JEMA 3WY6A 1TE1B 2NLRA 1NLRA 2DCJA 4NPRA 3AKPA 4HK8A 1BK1A 3EXUA 2VUJA 1XNBA 2F6BA 1IGOA 3WXPA 1H4GA 1REEA 5EJ3A 1OA2A 1H4HA 3AMQA 3B7MA 4XQDA 3AKRA 1XNKA 1ENXA 4XPVA 3WP4A 1W2UA 1UU5A 1YNAA 1XYNA 3AKQA 3WX5A 2QZ2A 3MFAA 3WT3A 3LGRA 2VGDA 3WP5A 2B45X 1UU6A 3AMNA 3B5LB 1KS5A 1HV0A 2VG9A 3WR0A 3WP3A 1H8VA 2DCZA 1T6GC 2DCYA
chains in the Genus database with same CATH superfamily
1DLCA 3VBUA 2NN8A 5T54A 1XNCA 1LEMA 1UX7A 2L9LA 3LFMA 4NIIA 5CIRA 2ZGQA 2A6XA 1AL21 3UETA 4I01A 3DGTA 4KBBA 2ZPXA 5I8YA 3VL9A 1NCRC 5EYYA 4XJZA 1MS3A 4XURA 1V6OA 1YQ2A 4QHZA 2JG9A 4COVA 1IS5A 3WQ7A 2Q30A 4HONA 2EIEA 2WFF1 5GZDA 1OPOA 1RUH1 1UN1A 3B9IA 4OULA 3VBSA 1RVF3 4MV2A 1RUF2 4AVSA 2W9XA 2RMU1 1RUI3 3LAGA 4JTOA 4Q4V2 3ZMOA 1H2MA 1KD7A 4LMFA 4Y22A 4B7KA 4DZGA 4TSVA 4A2UA 4NIHA 1BMV1 1NQDA 2XLAA 1HIXA 4CDUB 2PHTA 1LHOA 2ZHMA 4HXCA 1VBB3 1X9TA 2CDPA 1QQP1 1W3XA 3U10A 5C8CA 4AI1A 4PCRA 5FYZA 1AXKA 2DFCA 2R16A 2HWE1 2GMPA 4FXGB 5IAVA 2ZZQA 4H14A 2FQPA 2VULA 3TAYA 2QFEA 4CCEA 4B8EA 5AC93 1JXNA 1ZBA3 4GB32 4IV1C 4P00B 4XYXA 4S2FA 4YZ5A 4A4AA 5GLZA 3OSDA 3NAPA 3H3LA 3OEAA 3ZXLA 4RGKA 1U5XA 4YNIA 1DCSA 3J7HA 1QJY2 4MGIE 1EPZA 1WCQA 1WD4A 5JDBA 3HQUA 3RI8A 4N43A 4A3XA 3NSTA 2P6CA 2ET1A 5JOWA 3IZOA 1RUNA 1CX1A 4BDVB 2VM9A 3CJIA 3UGHA 1QH7A 1PGW1 3NKTA 4OUMA 3SHRA 2R49A 1LHUA 4YZ2A 2WR9A 2B42B 5DG1A 2DF7A 2H0BA 3MW2A 4CSWA 1MEC1 2PHFA 4AR2A 4CU6A 5A1FA 1JI6A 3OUHA 2B46X 3BKZA 2VW2A 4BHPA 1VBA3 1BEV3 2I45A 4QKBA 3LPGA 5GM0A 5JPMB 1SBEA 4PIZA 2IVJA 1RUC2 2Q0AA 3HT2A 4OVEA 3M3QA 4PF5A 1GZTA 2ZGLA 4R9DA 4SBVA 1LGNA 1NLRA 2HEYF 4RQPB 5E89A 1KGYA 5FWEA 4AEDC 5F9TA 3S57A 3RVHA 1VBD3 2Y6FA 3CZJA 4KL1A 1ND3B 4CPBD 2R072 3EJKA 4NIGA 5EXOA 1ZA7A 3ZYJB 1FAYA 4CTEA 2VMIA 1HLCA 4B7EA 1JYVA 2J1VA 1IS6A 3IIIA 4LEJA 5A3TA 5BUVA 1KITA 4LR4A 3VBFC 4AI2A 2I74A 3FBMA 4M0NA 5F32A 1VPHA 4GZ9A 2YFUA 4AFCA 3T30A 2BTVC 3J7LA 5G05L 2WWJA 1Z78A 2QQMA 3D4KA 4PDWB 4COYA 3DYMA 3ST7A 4CP1A 2QZ2A 3I2FA 1LOGA 2P2KA 1W8FA 2O8QA 3KGZA 3TB0A 5KHGA 3VKMA 3WP5A 2ZKLA 1UYXA 1JU4A 1W8HA 2VMEA 1W6NB 1ODMA 2LRPA 4BYYA 4DXZA 3KT1A 1H8TB 4ASKA 3NMBA 5L7OC 1UCXA 2XUEA 1T6GC 3H0OA 1W6PB 2GNMA 2RS12 1AJKA 4LUKA 1UYYA 1XYOA 5FXZA 5J7MA 1MQTB 2A6ZA 2HYKA 1FMD2 3BIWE 4Q0VA 5IK7A 1GNZA 3MF6A 2C26A 4P02B 4YZ4A 4YW5A 3OG2A 4Y5Z0 1XPWA 1D2QA 4QD2A 2QCSB 4EJRA 2ZKNA 3VKOA 4IEUA 3NJZA 4IW3A 1F4HA 3GZAA 1SCSA 4PLMA 4WVZA 4AFAA 4QQ2A 1Y9GA 4CRQA 4Y1XA 2Q8CA 1EPWA 2NMOA 1RUF1 1XYPA 2A73B 3ITQA 3MIDA 2YBPA 3Q8FA 3FUQA 4GH4B 3ZN4A 3GHNA 3VL8A 5GZEA 2WIIB 1DGLA 3ETQA 4AEJA 5C71A 5LW9A 4EYUA 2D6KA 4HVQA 2P6HA 2WNVC 4AG4A 4EE2A 3WUCA 2BP6A 1ALYA 2WKKA 4XFCA 3ZLIA 4E9KA 4AZZA 1PNGA 3OJBA 1REFA 4AHYA 4X8NA 3SCFA 4Y4RA 4AEKA 4Y1VA 1LHNA 4MUVA 3POSA 4BPZA 2GH8A 3M2MA 5A6QA 1FATA 4RQPA 5LCWL 2B9VA 4L0PA 4GB31 2XVLA 1ND3A 2I07B 5F5AA 5IVJA 3CBNA 1W04A 5A3PA 3SXWA 2VTXA 1RMU2 5FCCA 1UXZA 4FPGA 4O7XA 5FPBA 1KS4A 1QJFA 1RIRA 1V70A 1BCXA 2PHDA 4OI1A 3RI9A 1ODNA 4QXCA 3VHPA 2JG8C 4JCKA 4AFDA 2AYHA 2FD8A 3OGJA 1FV3A 3T3YA 2UYBA 5FPVA 1AYM3 2A6YA 2ETEA 2ZXQA 2AEZA 4XUTA 1QIQA 1O3SA 2LUWA 5F3IA 4GWIA 1UAIA 1ZM1A 2B39A 3V64A 2XWJB 2CTVA 1ND2B 2EA7A 2X53S 4QT6A 5CFDC 3VBOB 1QHDA 4XILA 1FOD2 5CKQA 2XBO3 1UYZA 2GAUA 2BOJA 2IXCA 3N7JA 5A70A 2XHKA 1R083 1W6NA 5BNOB 1JZ2A 3JD72 1H8TA 4LLOA 4QQLA 4LBQD 2P3JA 4CXXA 2R6QA 3JCIA 1W6PA 1PVC3 5JXHA 4UW6A 1O8SA 1DZQA 1QJEA 1RUC1 2RE9A 5I8TA 3JZVA 1BQPA 3ZN6B 1I3HA 2W3JA 5JWPA 4C90A 4I0AA 4QMAA 5IATA 3RZJA 1PO12 1GBGA 1LULA 2W46A 2FDGA 4OLLA 3AKPA 3J26N 2R071 1S4CA 2OS2A 4P5HA 2VMCA 4DO0A 4XZUG 1DF0A 2VUJA 5KR7A 1XE0A 2ZX0A 2O0OA 3I2DA 3UKNA 2BNMA 4XJ9A 4GQ7A 3JBG3 5E8AA 4BA6A 4LKDA 4HT1T 4R9AA 1REEA 3OY8B 4GH4A 1RTVA 2D6OX 3GCXA 1H30A 4LOSA 4YFWA 2ZEXA 4K21A 5FXWA 3O1SA 4ATFA 2UWAA 5IVEA 2ENRA 3SC7X 3ZPYA 4YVWC 1XYNA 2JX9A 2VVDA 3I4IA 4RGAA 4R9BA 1AZDA 2WN3A 3WT3A 4CDQB 2WNVA 4CP0A 3I2IA 2GN7A 4KWJA 3RJ2X 3ZFEB 1UU6A 4YZ3A 3UL2A 3B5LB 5DDJ1 5F39A 1HRV3 3HMYA 4QQOA 2RS11 3FJSA 2DCYA 4Y1YA 2DTYA 3SH5A 2C9AA 2JDMA 4KU8A 3BTYA 1EV11 3N9PA 3NJYA 4GMP0 5AVPA 1Y43B 2VW1A 4H7MA 2BFUL 5JOXA 4N53C 2VNGA 1LOFC 5FRAA 2DYCA 2BUKA 2VNRA 3FHIB 1LU2A 4GKXA 5F5QA 3WDXA 5ACA3 4AWDA 4QX3A 2O1QA 3E5QA 5E1RA 5LY1A 2JG8A 1LOCA 1RJ7A 1S0FA 4EN8B 1DZTA 3NJXA 5ANQA 3F2ZA 4UW4A 1PMIA 1AL0G 5JI7A 4IE6A 4KQ7A 4XXAA 3VBOA 3ACGA 1IZ3A 5D8AC 2VQ0A 1UY2A 2ZEYA 1LU1A 1GKBA 3K4DA 3LKJA 3R0RA 5BNOA 1F15A 5JLVA 3MIHA 1W8WA 2BOIA 1W03A 1N3OA 5FFOC 4E8CA 1DQ1A 2CDOA 1POV0 3VD9A 2QQWA 3AP7A 3ZX7A 3AYEA 3INAA 3ZN6A 2BWCA 4D69A 1DQ5A 1ZVFA 2PLV3 3RS6A 3ES4A 2QTWB 4ZU7A 2XWBB 2WQ8A 3AYAA 5C3PA 4P9IA 1EYBA 2X5IB 1BBT2 5ANNA 2B8MA 4BU2A 2MHFA 1K12A 2XJQA 1OLRA 3KVAA 4XQ4A 4FPHA 2VY0A 1FPN2 4YG0A 4OHYA 1XE7A 5DMYA 1JHJA 4QWNA 3U14A 5TSWA 3UNPA 1Z7S2 3SEPA 4Q4Y2 4ONUA 1PGL2 4Q8LA 2Y33A 1CAUB 5A6XA 4NO4A 4XQWA 4PIYA 1JW6A 3T0AA 1X8EA 4CDQA 5CB7A 1FOD1 3Q8EA 5KHJA 3FE5A 1V9U2 1CR7A 3AJZA 3LA3A 3R05A 3ZFEA 2ID4A 2P37A 1OPMA 2VVFA 3JD71 3O7OA 3T0DA 1L3JA 3VBHC 3N35A 4UBGA 4M01A 3N4MA 2CGOA 1NY72 2WT2A 1ZRIA 2D97A 4IESA 1S2BA 3D82A 1C8M1 2BJSA 1SPPB 4UW5A 4CZSA 3B01A 2ZGUA 1PO11 4AF9A 2D6LX 3LEKA 4XJ8A 1GP4A 4ARYA 4CCKA 5FPUA 1RHI2 3ILNA 5DPNA 2AACA 5EJ1B 1VIWB 2FCTA 1CPNA 3A0KA 2BBAA 5CNAA 3ZXEA 1Z0HA 5JVVA 4IEYA 4YGEA 2WQ4A 4O61A 4AFBA 5HPOA 4RR3C 3EMRA 2RS52 3W5NA 3NV2A 2R1BA 5D8AA 2VMHA 5FZOA 2ET7A 4UAPA 3AP9A 4GWMA 4YG6A 2XLGA 5FO9B 1Q8SA 2VUAA 5JZGB 3AMNA 1TNFA 3RGBA 3KV9A 3WP3A 3SCHA 3RZGA 1H8VA 4FPFA 3OD4A 4L11A 2X5IA 1H2NA 1QXRA 1G86A 2D3RA 2DV9A 2K0GA 5F5CA 2VNVA 2FDHA 2RDRA 1WCSA 4XC9A 2B9UA 3MPBA 4K1YA 3VKFC 1V6MA 2VPVA 4XJUA 3TYJA 3WNPA 2ZEZA 4JQTA 2GP3A 2ZMLA 1PK6B 2ERFA 2XGXA 3WW1A 3GNEA 4CCJA 1SDWA 2XJUA 2YC0A 3MICA 3VD5A 2G9GA 1HB4A 1PM4A 1CAUA 2V4VA 3J7MA 1QJU1 1LOEA 3AP5A 5HCBA 3WF0A 5K0UB 2VBPA 2BGPA 4XFIA 4XE9A 1GQGA 3WF1A 4H3WA 3J7NA 1S0IA 3FLPA 3VN4A 1YQ6A 3WNOA 1REDA 4HVRA 3VZJA 4QXKA 4UW3A 2K9ZA 4NHKA 2FMYA 5GZCA 3ZIWA 1QNWA 2GC1A 4MSVA 3MHZA 5FYCA 5DUUA 3U4XA 3LF7A 1IPSA 4BIFA 5CADA 5FYUA 3VKLA 4WM8C 4LHSA 1LRHA 2BFUS 1SLCA 1AUYA 4LHNA 3NNMA 4R9CA 2MPFA 4XMAA 5A7WA 4TTGA 3AJYA 1BBT1 3S7IA 2FMDA 5GJ6A 3ECQA 1G9AA 4URAA 1VBE2 3WW4A 2ZGNA 4Q4V3 5FK7A 4OHWA 4BXFA 1FPN1 1UL9A 3P1IA 5FLHA 5FV3A 2RS33 4E4DX 1O4YA 1ULGA 3SLIA 1Z7S1 2VQUA 3AFGA 2YDEA 4Q4Y1 4RGGA 5F2WA 5FYBA 4COWA 5CISA 4O9GA 5FZ9A 5LEKA 3MLKA 5KBFA 4XCBA 4RHV2 3CJXA 4RR3A 4BCUA 5CVRA 2F4PA 4ZU4A 1WMXA 4PBOA 2HWD2 1V9U1 1AR82 4LORA 4UT5A 4C8DA 1F4AA 5JZGA 2GC0A 3I3BA 1A78A 1UMHA 1YFXA 5ISLA 3HN1A 1HQWA 1COV2 2UY9A 3LIGA 4LBOA 4ZXKA 3T2QA 5IK5A 3NKGA 3BI3A 2JEMA 2ARXA 4XW3A 4QKFA 5FY0A 5HXMA 3LWCA 4LA2A 1QJY3 1NYWA 4PF1A 4QX2A 1EAH3 1QJX2 2QVSB 3AL5A 3FZ3A 2ZGTA 1PK6A 4YW1A 3LCPA 1GWKA 3C3VA 4FQZA 1RHI1 5HI0A 3DYPA 2XJTA 1JODA 2VBBA 1K42A 1SFNA 5K0UA 2RJKA 1U12A 4HBNA 1HX6A 4JC1A 4CXWA 1V0AA 1OOPB 2Z5WA 1R091 1QDCA 2WYFA 3AFKA 4W6XA 1ZRFA 2RS51 5FIXA 1LOBA 3ABZA 2QQPA 3PUHA 1NXD1 1Y9MA 3RYRA 4W65A 3IB3A 5J48A 1TNRA 2VZUA 2ZHNA 1AX0A 3BYWA 4FO9A 3PURA 4JHTA 1VAKA 4Y5SA 4UF0B 5G04L 4BB3A 4YPJA 4UXAA 2HLEA 3HJRA 2B45X 4NMIA 5LEJA 1V6JA 2Z2SB 1I5PA 5FWJA 2GMMA 5C3OA 2PAEA 3QBQA 3AVSA 1E5HA 4XCAA 3HEIA 3RMXA 3A0NA 3POIA 3O14A 1QNYA 1ACCA 3BGAA 3E6DA 4PLOA 2DCKA 1C8NA 3ZXGA 1R1A2 3I8TA 3WQBA 4HETA 4XETA 2XOMA 3AMPA 4NAOA 2XPJA 1AR62 2IXHA 2ZAAA 4CXYA 3D5OA 4KG8A 1CONA 3K51A 3KF5A 2W2IA 4Y24A 5JMCA 4FFFA 3B00A 3DKWA 4ES8A 2OQ6A 2N7GA 4BQ1A 5BV6A 2D40A 2RV9A 4GULA 4TZDA 3J8F2 3V0AB 1UKGA 1NZIA 3A7QA 4X8PA 5LATA 1ASJ3 2WL1A 4XUNA 1S0DA 3K48A 3WQ1A 5IHRA 1NQJA 1AR92 1FMD3 1YJLA 2YMZA 3KCYA 4NAMA 5GZFA 1YC61 5IK8A 4JGZC 3WW2A 1Q3EA 3U1XA 3FLRA 4KGGA 1YQ5A 3ZYPA 1ZREA 4N7IA 3IKWA 2WS93 3FMGA 3PMEA 3OPWA 3BOWA 2R7EB 3BIEA 2JDYA 3C7GA 2XJVA 3M3EA 2JDZA 4MGYE 2FDIA 1GQHA 1OFNA 4S2GA 1DP0A 3DXUA 5JPNB 1Q8OA 4AL9A 4MGZE 4XF3A 4ARXA 3WNLA 3UKVA 3VHNA 1B35B 4AVAA 4BIOA 2XQXA 5FPLA 2VOTA 1STMA 3K75B 3OCPA 1Y3TA 1AYN2 1UF2C 1RUH2 2DCTA 1DYKA 5H9PA 3OTFA 2JXAA 4P5YA 4HN0A 5KC5A 2D5HA 3MW4A 4NPMA 2YC4A 5CZKA 5E16A 1RUE3 4ITCA 4H7LA 4RHV1 1XBFA 4NN0A 3T2PA 1ZNPA 3ME2A 2Q8DA 2WA3A 1AR81 3ALQA 2BPA2 4IL7A 3VZKA 3ZOIA 4UF0A 1TG7A 3UESA 3QH7A 1VBC3 5K7PA 4YLZA 3GZUC 2ES3A 3I3QA 1COV1 1RMU3 1NX9A 3OBAA 2QBXA 1OKOA 1W0NA 2WABA 4IEZA 1VRH1 1UZZA 2RDNA 2B5HA 4J25A 3HBKA 5FZ6A 3GZEA 1W8TA 2JDHA 3PIGA 3I3EA 4E2SA 3MYXA 4LIUA 2P17A 1WCKA 2BU9A 2JG9C 2ZBJA 1PO21 3KZ4C 3MV01 1J84A 3UGFA 2YGMA 4Q1RA 4QX7A 5A80A 3VBSC 5BNNB 1RXGA 5DAQA 3ZXKA 1V6NA 1TMF3 5J37A 4PI2A 4LA3A 3LSEA 1AR73 1UQXA 3D3AA 4NWVA 1A6CA 1GR3A 3IMNA 5GLUA 4FFIA 3R6SA 1H4GA 4OUEA 3U0ZA 2NP0A 3MLJA 3JD73 4K40A 3V0AA 4COUA 4CDWB 4FPCA 1PHMA 2H0VA 2EAKA 3HT1A 4OYUA 2GP5A 2VOWA 2W52A 4A45A 1ENXA 2JDAA 2Y6KA 3VD4A 1JUHA 1WBFA 4DMIA 3IMMA 2XG3A 4HSLA 2LM3A 4HSJA 3NL1A 1V6LA 1DYPA 3ELNA 2D7FA 4P9YA 1H1IA 1PIV1 3DCQA 4WM7B 3JXSA 3QH6A 3JQXA 4HLTA 1SHWB 1KS5A 3K2OA 1OSGA 4ASLA 2R0FA 4OHVA 4Z82A 3NAPC 2WT1A 2JE8A 5EHDA 3WR0A 4QHOA 4JGYB 3USSA 1WD3A 5FYHA 1JYTA 1B35A 3I3DA 4GXLA 2ZGRA 5KHKA 3E5UA 5A33B 3EQEA 4BQYA 1R1A1 5FPZA 5KXEA 1YUDA 4N43C 5I8SA 5LB6A 1MZFA 4WVVA 4YW6A 3GM8A 5DAPA 1AR61 2VUCA 3IT8A 4XFGA 4XF0A 4HFSA 2NQYA 3CJIC 2X09A 1C1LA 1Y7BA 2Q5TA 3GCWA 4DOUA 2ZHLA 3BPSA 3J8F1 3KT4A 4Q4W2 5FKBA 4EROA 2FCVA 3FFQA 1F8VA 1AR91 4I0BA 4RL7A 3FBYA 5HCHA 4M3CB 4I30A 2VO5A 3LDKA 4OI4A 3KS7A 2WSUA 4N90A 4FP2A 4PLNA 4Q2FA 2VQAA 3WDUA 1O5LA 5A32A 2VJXA 5K9YA 3VDBA 1HQNA 1JOJA 5CKNA 5FP4A 4FTEA 2GNDA 3POBA 2JDUA 3JUUA 3MIGA 1C5HA 3NW4A 4QPIB 1F35A 4EWDA 5BNNA 2BYVE 4W8JA 4HPKB 3KQRA 3U78A 3TEWA 3BCWA 4Q29A 1GP5A 1AYN1 4F7ZA 4Y3OA 3RRDA 2QJVA 1N1VA 1UD1A 4XF1A 2OA2A 2XKOA 4GMP1 4X6RB 1OLME 2DU0A 4CDUC 4CDWA 5IK4A 1OH4A 1QU0A 1U5YA 2DURA 2MEV3 2VECA 4M4RA 3WG2A 2A5ZA 4FAGA 5C3RA 3AZVA 4A7ZA 1S2KA 4OMCA 3FHAA 5I0DA 1QEXA 2WLQA 4MGQA 4AVVA 4LITA 4SLIA 1HB1A 2OXBA 4WM7A 2WZR3 1AJOA 5DAWA 4XXPA 3U4SA 4YSFA 2ZMNA 3BUCA 1PNFA 4B3NA 5GLWA 1A3KA 1WLWA 1YFWA 4QB2A 4JGYA 4KI5M 1FPN3 1S0CA 4OI2A 1OHFA 1XSQA 5D1IA 2D44A 4B1MA 1GZWB 4YYOA 1CIWA 2E9QA 1W8OA 1DYOA 1POV1 4XZPA 5C4WB 4XUOA 2PELA 4Y20B 2W47A 3SCGA 1O59A 1VRBA 5FDBA 1V9U3 3SITA 3AZWA 4FAHA 3TEXA 3I49A 1H2KA 1CN1A 4KWLA 5CAZA 5EV7A 1OA2A 4A7YA 4CUBA 3S0MA 1KFXL 1W90A 2Q1MA 3OF1A 2HJIA 4JDMA 4LUMA 2EICA 2DBNA 1HRI3 4H55A 1QXJA 4QGLA 3TNPB 1JZ4A 3D6EA 3RG0A 4QPYA 1DDLA 3W59A 2J7MA 1IOAA 3C2UA 1ZYBA 2VOXA 4UFLA 1O4ZA 4RQPC 3Q8AA 4QDSA 1SLBA 5GKAC 5A7SA 5B4NA 2VCBA 1WBLA 3O1OA 1ND3C 3VDDB 4Y26A 1TME3 1HJGA 5AVAA 2YB7A 4RA0A 4D6QA 2C9KA 4BWOA 1AXZA 1UY0A 1LHWA 1UZWA 3WF4A 2H6CA 3CU7A 2WNUB 4FOYA 4HPKA 1OA3A 5F5IA 1DGRN 1GUIA 4MXVA 1ULDA 4FOVA 1L7RA 2W5FA 4DS0A 1XJAA 4C1WA 4C1XA 4FPOB 1AHSA 4CUAA 3L2HA 4P9JA 3TNQA 3ZDVA 4PDWC 4D8MA 5T55A 4PI0A 1JN2P 4LBJA 4NHYA 2ZAHA 1NXMA 2IXIA 2WNEA 1Q56A 2PMWB 2QQLA 4AGRA 1GV9A 4CDUA 5A3NA 4Z92B 4XAAA 4XDPA 5HV4A 5JSPA 4Q4W1 1GICA 2R063 1H8TC 3PJQA 1YIPA 3A23A 4CCOA 3KVBA 2ZABA 4D0QA 4M3CF 3MUZ1 1WLTA 1D4M2 5GZGA 1MQTC 1F5JA 2WSVA 4YM3A 5DDJ2 1K3IA 3MIBA 3TN93 4CP9B 3ZO0B 1NLSA 2C0ZA 2WUHA 3CNAA 2BVVA 1EV12 4IEVA 4BMBA 1DZRA 1GZWA 5BNPB 3RQ0A 1PMHX 5C4WA 3KM5A 4Y20A 1XRUA 3UGGA 2KA3A 4BH9A 5DUXA 5SV8A 5ABJB 2AUYA 3P3NA 2XONA 1VB2A 4GH4C 3H8RA 2FCUA 2QQJA 4Z07A 4CCDA 2PHRA 3AXDA 5LBBA 4D3WA 4D6RA 4FBFA 3AKSA 4QKNA 3WDWA 5FZ8A 1LCLA 5I0TA 3LD8A 2V4AA 1CQ9A 1JMUB 4NJ4A 3AKTA 1Q5OA 4IEPA 3FC0A 3U11A 1W8ZA 4JDNA 3I97A 3ROUA 2W87A 2ZX4A 4Y33A 4EZHA 1PZ9A 4YZ1A 3T2TA 1H6YA 4JQRA 4LBLA 1RB8G 4CA9A 3VDDA 4YGDA 2YPJA 2JECA 4IGOA 1VBE3 4F83A 4JKMA 1RJ8A 3DL3A 4CU7A 1UO9A 3UJQA 4V2VA 1WCDJ 4AQSA 2HWC3 4G4FA 5EPAA 2QQKA 1N3PA 1W0OA 2JKXA 3IPVB 4IV3B 5FZ0A 5IVCA 1EP0A 1BKZA 2WDBA 3C7FA 4P9WA 4Q5OA 1BK1A 5F8PA 3WCSA 1RUD3 1C4RA 1ND2C 2HWD3 4ZXEA 1UW8A 1XNBA 1LEDA 3P6BA 2NPIA 2GZWA 4PDWA 3CO2A 3VBOC 1J1LA 2SBAA 1DFQA 1OURA 2ZHKA 1MS8A 1SCRA 4P9GA 5BNOC 1GYKA 3WXPA 5IAXA 1UPIA 3ZYRA 4B4PA 3AMQA 2E63A 2PQSA 2VNOA 3O0WA 1W6QB 3CZUA 1YNAA 5JXGA 1R1ZA 4YRDA 2JB4A 3WX5A 4R52A 3F95A 4CP9A 5IT6A 5LA1A 1C8M2 3ZKUA 1MQTA 4I2OA 1QJX3 1ZZBA 2Y6GA 1KDKA 2K2SA 2W91A 3PIJA 4COZA 3NWKA 5BNPA 1K5JA 3VDCA 5F2SA 4Q26A 3K46A 5FXVA 4YGBA 5JIUA 3KSCA 3ZFFB 2F17A 5ABJA 1LENA 4AW7A 2LW8A 1PMJX 2Z4FA 3BB6A 1YJKA 2Y60A 2V72A 4ZY9A 4YFZA 1SMVA 4E8DA 2W08A 5EZWA 1LHVA 3WF3A 2OQ7A 4Y1ZA 3HVDA 1ZZ8A 3ON7A 3VHOA 2ZA9A 4LO7A 1DQ2A 5JI9A 4CDQC 5CBLA 1FX5A 3ZFEC 1NE6A 4P9XA 3SH3A 4DUVA 4UI9L 4JX0A 5DAXA 3HD8B 4W4ZA 1RUG1 3WUDA 3M8LA 1D4M1 3T1LA 4DUXA 1OVPA 3EYPA 3LA7A 4XACA 2ZJCA 4Y4YA 3QACA 2C1FA 2XJPA 1GSLA 2A75A 5KWRA 1R1A3 3AMMA 2CYFA 3HN3A 2JWPA 3WHUA 1QXPA 5IW0A 3POGA 4LKEA 3S5AA 4FSJA 1MS5A 5HCAA 3IPVA 4IV3A 4OZOA 4XF4A 5L36A 2RR13 2ADEA 4HOOA 4Q8KA 3LEIA 4F3JA 4LOTA 3CF6E 4L92A 2WQZC 1UOJA 4RN5A 3O1MA 2BGCA 2CHHA 1C3HA 1VMFA 3PDQA 4JRLA 4CDXB 2WBKA 4Z2AA 1UY4A 1QJU2 2FDJA 4IEOA 5DAVA 3MPPG 3USUB 1ND2A 4RS5B 1W2TA 3RJRA 3M70A 4QX8A 2P5BA 3I2KA 2IZWA 5FJKA 1W6OB 1W6QA 4WVWA 1I9RA 3VZNA 2W0XA 2R1DA 3POWA 4LO4B 4MXWB 5A3LA 1WA6X 3WHTA 2FDFA 4C0BA 1HKDA 2LS6A 2XJSA 3PUAA 5FYYA 1HB2A 2VTXJ 2W1SA 3B9CA 2K46A 1AL23 1VALA 3P5BA 1V00A 1APNA 2X5IC 5FYTA 1ZRDA 4DY3A 4I3GA 4AVTA 1CX4A 2PYTA 1RL3A 2P3IA 1SG3A 4W6WA 3VV1A 4GJYA 1JZ3A 4ZHNA 2BZDA 2WFF3 3CKHA 3MW3A 1GMMA 1RUH3 4M00A 4LK6A 2KXLA 2RMU3 1QWRA 4JKLA 4LLFA 1MZ5A 1NKGA 2GSYA 1G7YA 2YFZA 1RVF2 1DGRA 3OY8A 1RUI2 3D0SA 2W1UA 5FZCA 4AAXA 3EBRA 2O14A 3KMHA 1IKQA 2GH2A 4BLIA 2XDVA 1OT5A 4Z2WA 3KF3A 2ZGMA 3KQ4B 1CWPA 1OD3A 3FL7A 1QQP3 3BOPA 2F6BA 5FBZA 1VBB2 3RZKA 5DN2A 2VCMA 5KXCA 2HWE3 5CA6A 3WOGA 4KWKA 1D0HA 4CYDA 4K1ZA 1JU3A 1GZ9A 1GP6A 5IJRA 2Y6JA 2VUDA 1MZ6A 3O1UA 4TWTA 5AC92 1ZBA2 3OGRA 5ERLA 5JAXA 3AXEA 5H9RA 5A1LA 4DNYA 3EHKA 2A7AA 4A3ZA 3NV4A 5FZEA 3A4UA 5C8WA 1W8UA 2ILMA 1UZVA 4MG2A 2HWB2 2XVKA 3H7YA 1MPXA 2BW8A 1D0GA 3CHXA 4XTMA 4ZKTB 1GOFA 1KDMA 4CEYB 1NCQB 4CDXA 1OFSA 5FOBB 1W05A 1ENQA 1F31A 1PX4A 3USUA 1ZZ7A 4RS5A 3ZR6A 3EB7A 1MEC3 1C28A 1SACA 5FR3A 1UU4A 2J1EA 1R092 1ST8A 2ZS6B 2ARAA 1W6OA 1PVXA 4MXWA 4R8HA 5FZHA 2NYYA 1X36A 1MS4A 3M3IA 1BEV2 3WVJA 5JZGC 4AVCA 1LR5A 3GJAA 3THCA 4R4XA 3ZYBA 2VZVA 4LE3A 5LBEA 1SLTA 1JOBA 4LIVA 5GLTA 4XDQA 1N1TA 3HWJA 3ORJA 2BGOA 3M4FA 5FPXA 1IQAA 1VBD2 3N9NA 4KMQA 4ZZ5A 4TLFA 4LXLA 4XJWA 4YW4A 4QB6A 1HXS1 3T08A 3PU3A 5FZ1A 4LO5B 1WWYA 3WP6A 4ZS3A 3T1MA 4E4HA 1PK6C 1ZBE1 5FZGA 4OMDA 4QU1A 5JMOA 4HKWA 1BLZA 3THDA 2IXLA 1XQNA 3N9OA 4Q4X2 2WT0A 4RFT0 5K0UC 4DEQA 2VTFA 4KBZA 2YPDA 1I5ZA 4Q4W3 4RD7A 1JTZX 4CUCA 3OOXA 2P4EA 2RHPA 2WLPA 4GIQA 5FYIA 5J96B 3CEWA 3DECA 4GKYA 4ES9A 4ZZ8A 2DVBA 2A1XA 3POEA 5APAA 1RGSA 5KHHA 3T4HB 5FLJA 4KH9A 1S0JA 2DVDA 2FHRA 4XUPA 1O7FA 3PVBB 1UMZA 4XHBA 5C5TA 2BQPA 4WZCA 4XBNA 4DIQA 3AC0A 4L99A 3NV3A 1DU3D 1SPPA 3TOJA 5JXJA 4AI0A 4CCMA 2QKDA 3PLQA 1CAVB 2Y38A 1MS9A 5T5OA 3DF0A 5C70A 2VZQA 4QGNA 2AENA 5T5PA 5T3NA 2VCAA 1RUF3 3ACFA 5EP9A 3WY6A 5BYNA 1NZCA 4CEYA 2EALA 1NCQA 2QDRA 3OBRA 5EIYB 1RVF1 1RUI1 3W20A 3HNBM 4P9LA 1N3QA 4XFFA 2E51A 5DZGA 4K3UA 3E5XA 3RMYA 2C4XA 2IUWA 4D94A 3ATGA 4XF9A 1F9KA 1VBB1 5BXXA 2DBIA 2J42A 3N3HA 4LJHA 3RWKX 1N1YA 4EWAA 2ARBA 4FOWA 5DQ0A 1GANA 1H4HA 4LBNA 5EJ3A 5FUIA 3WSOA 4AQTA 1UOFA 4UFKA 2X10A 3AKRA 3BPZA 1B09A 4GB33 1W9WA 1LNSA 3WNKA 2JD9A 3WNXA 3ZXAC 5AC91 1ZBA1 2Q8EA 3NJVA 3KCXA 1JZ5A 1VRH2 4E2GA 3KHBA 1UNBA 5GLVA 3N9MA 1QDOA 2D3PA 1NOVA 4U36A 3H3ZA 4B4RA 2VG9A 1OC1A 2HWB1 1NUKA 3ZFGB 1PO22 2DU1A 2UWCA 1AYM2 4OUSA 1QOTA 4YM2A 3AVRA 4OHZA 2QUOA 3VZMA 5IVBA 3U37A 2VU9A 5IYYA 2JDNA 4XDOA 1OOPC 4D7YA 1ENRA 3SNMA 3LA2A 5CKMA 2CSGA 3S6PA 5M0TA 1R082 4HVOA 5FY7A 3PVEA 4FOQA 3DUIA 1JZ8A 2C5DA 2PA7A 1VBA1 1BEV1 1RUC3 2VAUA 4XFBA 3QOPA 1W9FA 2GC2A 3HIFA 4Q27A 5A3OA 3T0BA 5FZ3A 1PIV2 4S2HA 2XKPA 5A7OA 1IPJA 3U07A 2B4KA 2R073 2P34A 3H9AA 2OUHA 4PJYA 5L9BA 1XOYA 1VBD1 3BU7A 3FHQA 4KU7A 4I3PA 5I93A 2A3XA 1X50A 3MI8A 4RFRB 4HANA 4AI3A 1KRIA 4TYSA 3V56A 3ASIA 3I7DA 4BK5A 1U5IA 3D8CA 3JBG2 1PZ8A 2DFBA 1XNTA 2DWRA 3NNGA 3OGVA 3LPFA 4B29A 3I2OA 4RYDA 1US2A 1OQ1A 2IXKA 2ADDA 1DHKB 1AVBA 3ENRA 1ZZCA 3KT7A 1JOPA 4IGPA 4Q4X1 1UY3A 5CG8A 2A6VA 3BODA 2GALA 3KV6A 3OPZA 1CJPA 2J1TA 3AYDA 3ACHA 4NHLA 3VUOA 1NE4A 4R4ZA 5FTTC 5DDJ3 4D7TA 2Y0OA 1CESA 2DVGA 2BRTA 2D5FA 2RS13 3VZOA 2VH9A 3VGIA 4N9IA 3WG1A 1HRV2 1EV13 4QPGB 3H3UA 2YZ4A 3VBRB 2KD7A 2LTNA 4J6GA 4YW2A 5FZLA 1QOSA 5EWSA 1X7NA 1C5IA 4C91A 1WCUA 1V6KA 3B02A 1Y9QA 4CU8A 3EO6A 5FZBA 3QD6A 4S2DA 3IDCB 4JAAA 1NT0A 3AMHA 1B35C 4EN6B 3ZFGA 3PJYA 5ACA2 1HDKA 1JZ6A 2Y26A 5L19A 2IVIB 2CY6A 5J98B 1LKNA 3POYA 4YM0A 2R30A 1QKQA 1TE1B 1AX2A 2WINB 1JH5A 5EQUA 3IDAA 1A8DA 4K6BA 1IG0A 4BM8A 2FDKA 4AOCA 3LSDA 1NA1B 1OOPA 4HK8A 2ZX3A 3DPRB 3K4ZA 4IGQA 3ZPOA 1LJ7A 5A3MA 4QPWA 2AZ5A 5DXDA 2KR2A 3C7OA 3L2YA 4AE2A 3SQOA 4EQVA 1L7LA 2ZOEB 5CFCB 1RITA 2LALA 2PLV2 2BV4A 4GWJA 2VZ1A 3MBWA 3WP4A 2WFPA 5FMCA 2PAMA 5LY2A 1WUVA 4OHXA 3ZXFA 3AKQA 5C3SA 2YGLA 1SFYA 2XL7A 3E97A 4DUWA 2HKXA 1JYXA 5FYSA 5C7GA 1YQ8A 3IAPA 4AVBA 2UU8A 4XOGA 2WYSA 5BNNC 1U0AA 2ZGKA 4JZRA 5FXXA 1AYM1 1H6XA 1WW6A 1OF4A 4FTBA 1MACA 2XUMA 2VC9A 1FOD3 4FT8A 3ZXJA 1CVNA 4NHMA 3N7MA 4CDWC 1O3QA 1W8NA 1M06G 1LB2A 1N1SA 4QB1A 2CAVA 5J09A 3ETPA 3MF9A 4JRAA 1R081 2A71A 3PUIA 5FY8A 1SLLA 1C8M3 3VBUB 4WM7C 4LKSA 4QPGA 3VBRA 2R042 3ZXDA 2AH2A 3T2OA 1PVC1 4LO6B 2EF6A 3SEEA 2FZ2A 3DEMA 1PO13 5C9AB 3ZSEA 1SFPA 1O4TA 3WW3A 3ZVXA 2WZPP 4LHKA 1F2NA 2X8KA 4JGYC 2HEWF 5FZ7A 3JB8A 3TEYA 1JBCA 4NR1A 4Y1UA 5A1AA 4YVSB 1UKRA 2XHNA 4AQ2A 2XQRA 2EXKA 3JU9A 3DV8A 4MLOA 1OLQA 1GNYA 1MS0A 2G4IA 2IC1A 4ISRA 3JBG1 1W2OA 5FQ0B 2GNTA 1BVP1 3URFA 4Y22B 2EAAA 1VMJA 2FBEA 1UWWA 2JIJA 1CJDA 3LB9A 1NA1A 4PHZA 5IFTA 1UOBA 4EN9B 3WZ1A 4LO8A 5C8CB 1WKYA 1V6IA 3OUJA 1GOGA 5SV5A 4CCLA 2QNKA 1XNAA 1DQ4A 5T5JA 3N9QA 1SDDB 3G7DA 1TQ5A 3N7LA 2BVBA 2YC2A 1Q8PA 1AF9A 2W92A 3I54A 4LPLA 4XBLA 1OQDA 3OB8A 4NROA 3ZSLA 4W50A 2YG0A 1AX1A 3HNYM 3A21A 5HCFA 3RYKA 2QDNA 3VD3A 5CFCA 3FLTA 3HOBA 1SZBA 2OPKA 1HRV1 3AM2A 3W21A 4DRRA 3RYPA 4JV4A 1OBNA 2ZZJA 2BERA 4NVPA 3B3QE 1R64A 2IXJA 1G6NA 1YQCA 3OD0A 1K5MB 4QPIC 3FWEA 4ISQA 1RYYA 2QE3A 3PTRB 4IE5A 5ACA1 1A34A 1UXXX 1C57A 3LOBA 1VMHA 1QJU3 3ZM8A 2VE1A 4CEWB 5A6YA 1LTEA 5LBCA 5J3UA 1GLHA 4IE0A 2QQNA 1G9FA 2LROA 5FYVA 5AFEA 3FX3A 1BZWA 3NO8A 4GWNA 3NNJA 2WNOA 2D43A 1LESA 3O1PA 4Z1VA 3C7EA 1GWLA 1JS9A 4MHRA 3PHMA 3BALA 4E27A 4BE3A 1E57A 3WF2A 3VHRA 5FAXA 3THPA 1W9TA 5C9AA 3B93A 2VZOA 4AGVA 4DQAA 3B7MA 4QKDA 2PLV1 4N9HA 2NM1A 1BBT3 2E6VA 1WW7A 5FOJB 1YO8A 1W2UA 4LBMA 1UU5A 3BTXA 4YVSA 1NCRB 3HQRA 4ET7A 1YXWA 4OQ9A 3HR9A 4XIKA 4HMZA 4QDQA 5KC6A 1A8MA 5C4WC 3SKVA 5FQ0A 1Z7S3 1URXA 5A33A 1CPMA 2OW4A 5FZFA 2RS32 1UZ0A 1OVSA 4IERA 4Q4Y3 3T4VA 4EV0A 2ARCA 3APBA 2P1BA 4OI0A 2TEPA 5I0UA 2F4LA 2Q1ZB 4TLGA 5C6CA 4M0HA 2HEVF 3K77A 4QM8A 2UURA 3I3MA 2CV6A 1GU3A 4C0HA 3HAGA 1W6MB 2DUPA 2MNGA 2VMDA 3R4DB 4WZFA 1JYIA 3UJOA 2E7AA 1CGPA 1O91A 5J36A 1XXNA 4MO3M 2EXJA 1VJ2A 4CE8A 4A6SA 2R041 4PT6A 2A6WA 4GJZA 5LRRA 1FT9A 4MOAA 3R4UA 4M3CA 3N9LA 4IV1B 1QGLA 3VDDC 4JDOA 2YROA 4IE4A 5LWBA 1H0BA 2HWB3 1XNDA 1K5MA 3WNNA 4BQ4A 4YGCA 3KWVA 5C33A 1EAH2 1RHI3 1L7QA 2WNUC 5C5UA 1BK0A 3H1WA 3ACLA 4QPIA 1IKPA 2AC1A 4CEWA 1ZRRA 1VAVA 4I02A 2HH9A 3AZYA 1LGCA 4N8MA 1JZ7A 2RM22 1HW5A 1JYCA 3MDPA 1R093 1LGBA 4PQ9A 4DINB 1M4WA 2C24A 2ZCWA 5I0RA 1GQPA 2RS53 3I2HA 4XBQA 5FK8A 3GDBA 1J3QA 1Q43A 2ZACA 4BJ0A 4H2AA 1LECA 3ZYFA 3BVCA 3NNLA 2OVUA 3PU8A 4JVAA 1KQRA 4L9BA 1QF3A 4XABA 5DUWA 4JTNA 4MGTA 2X05A 1HV1A 4QXHA 1IPKA 5B4XA 4LQRA 4FPLA 4BK4A 2YUEA 5KXDA 3M1HA 3W58A 5JR7B 1RUG2 4D6SA 1RUOA 4AEDB 5LA2A 4QX1A 4FVVA 4HK9A 5FY1A 3SMHA 4BXSV 1NCRA 5BNPC 1OI6A 2GU9A 1ULPA 4XJAA 2Q1FA 5A3WA 1G9BA 4Q4X3 3GHMA 1W39A 1XSRA 3VBFB 5ABJC 3O0VA 1FNZA 2ZGSA 3B69A 1BHGA 5FUPA 4XUQA 2VZ3A 1FXZA 3PVNA 2GC3A 3U75A 4EN0A 3TBDA 5F6LB 2VD7A 5H9QA 2NLRA 1W6MA 3KV5A 5A7QA 2PN5A 3RFRA 1IQDC 4L8QA 4NPRA 1ASJ2 4QU2A 1QMJA 5L7OB 1EY2A 3LDBA 4WV8A 4DEVA 3N36A 4IV1A 2WS92 2HYXA 4E4SA 1IG3A 1W06A 1RUJ2 1H9PA 3S30A 1I6XA 2WJSA 2ZGOA 1MVEA 2DTWA 4QM9A 1H9WA 1J3RA 2ZEWA 4J1WA 3GZTB 2W1WA 2VXJA 4KNCA 5F1RA 4IV3C 2JJ6A 4K8FA 5FZAA 3TEZA 2WNUA 4Q4V1 2TUNA 2YBKA 2J1AA 2RS31 3WDYA 2SLIA 4LE4A 4B4QA 5JSOA 4V2WA 4M4PA 5FY5A 3O1RA 4RHV3 1GNHA 2PHXA 1ZZ6A 1RUE2 2WNVB 5AFBA 1AR83 4FP3A 3L9JT 1FV2A 1HJFA 2AREA 4O65A 1CAWB 1VR3A 2Y64A 4IEXA 3WINE 2E7QA 5CYYA 2V5DA 1COV3 1DLLA 3BTZA 2VOKA 1VBC2 3PUSA 2PTMA 4LKFA 3HQXA 2EIBA 4AEDA 4NIAA 3VKNA 1VRH3 2UYAA 4HL0A 1DQ0A 1UIJA 3HNMA 1I1EA 2ZX1A 2Q8OA 1WLDA 4V1PA 4AI8A 1QJY1 4LULA 4RSUA 4CP2A 1PO23 4XEZA 3ZFFC 1T2XA 1ONAA 1POQA 2BNNA 1EAH1 2JG8B 4TXWA 3VBFA 1UYPA 1G8WA 2GNBA 2PAKA 3PTYA 4AHWA 3BTAA 2YY1A 2AEYA 3IWZA 3LEMA 3LFIA 5FZIA 1EUTA 4IXLA 3VB9A 1TZOA 2WA4A 3H8XA 4ZONA 4NIDA 1TMF2 1XU2A 2RM21 1CZTA 4J1XA 2WZEA 1AR72 3VLBB 3H8UA 1UY1A 4Q1PA 2VCCA 1LODA 4YM1A 3WD5A 1NG0A 5CFDB 1J3PA 1YI9A 3H7JA 1VP6A 4L2NA 2CAUA 1WMFA 3AX4A 3V65A 1ULEA 4BQWA 1S2EA 3QCWA 2BBVA 2P3YA 3DKQA 4BLJA 2J1SA 4QQHA 1J59A 1S0EA 5L7OA 1O6UA 3ZSKA 2CWMA 1PIV3 4JKKA 4K7JA 2WAOA 3IBMA 5FZMA 4NWWA 1TVGA 1SEFA 2JDKA 4D7SA 1G9DA 3RZLA 2HBUA 1VAMA 3NRUA 5GALA 3NQHA 2VMGA 2IFRA 1O3RA 2NMNA 5EFUA 5EYXA 5DZEA 2PHLA 1PGSA 1HXS2 2YU2A 2YHJA 3ZSMA 4EZ4A 2I2SA 4M3CE 2YXSA 4QQPA 1AR63 1ZBE2 4MGKE 3ZYGA 4UFIA 2HWF2 5BNQA 3ZYIB 4UOJA 4CDXC 2D6MA 2W39A 4BOWA 2WN2A 1RC6A 1SQ4A 2VBDA 3RZZA 1ZA4A 4RS5C 3IDEA 4I0WB 2XVGA 3J8F3 4YVWB 2ATFA 3GYDA 2CGPA 1CAWA 2J1RA 1AR93 2BEOA 1ASJ1 1PM7A 3KB5A 2D3SA 2ZTNA 1E5SA 2WO2A 5JCTA 1FMD1 3C7HA 5A6ZA 1SLAA 1S0BA 3CL1A 4IETA 4XFAA 3G6JB 1IGOA 2VZPA 2WRAA 3LIHA 3RDIA 4ASMB 2WS91 1FNYA 2GMEA 5IVYA 4AXOA 3KHCA 4W6YA 1X82A 3POFA 1BJQA 1RUJ1 2EIDA 3OYWB 2PXJA 3TRSB 5IVVA 1HB3A 3LQCA 2JDPA 2Y6LA 4HN1A 4N53B 4ORFA 4TN7A 4DXRA 2FZ1A 1XNKA 4XPVA 4CPBA 2R0HA 3IN9A 2D6NA 3KLSA 4KWUA 1VE0A 1SBDA 3ZFFA 2CNAA 1AYN3 1DGWA 2PHUA 3POJA 5FP9A 1W2AX 3S7EA 4GMP3 4QHBA 4FFGA 2AGSA 2PFWA 1JUIA 3W5MA 2RDSA 5CFDA 2XR4A 4DXTA 5D8AB 2YYOA 2QQVA 5FZOB 4O9EA 3ZYHA 2MEV2 2A70A 1RUE1 4UFHA 3BN6A 3H1MA 2CU5A 4IQPA 4QXBA 4HG6B 5FUNA 3MLLA 1YLLA 4IUGA 5D2AA 4CVUA 1YWKA 3IDBB 1YRZA 3VZLA 5JUVA 4OFGA 5FZKA 3GXUA 2WZR2 1UMIA 1VLNA 4P14A 2JIGA 1VBC1 5T50A 1RXFA 4QAWA 3PNAA 1AXYA 1RMU1 2JKBA 4LBQB 1OD5A 2V09A 2OKXA 1YFYA 5JXIA 2G9ZA 2KM2A 4EN7B 1HQLA 3WLUA 3W9AA 4BQ3A 4G3YC 4YW7A 1POV3 1OQEA 3RZMA 2TBVA 1D7PM 3ILFA 5DUVA 4CCNA 2RJ2A 2D6PA 1HN1A 3GBFA 4Q0SA 3PMSA 4AEMA 2NZ9A 2YBSA 3WNMA 4CEYC 4E4ZA 1NCQC 2XB6C 3UYJA 1ENSA 3DYOA 3UK9A 1TMF1 1QOOA 2VOVA 5A7PA 1AR71 4YVWA 1MR5A 4BQ5A 3CIHA 1CD3G 3M3CA 4I09A 4XHXA 3RSJA 2E26A 1Y4WA 3RZHA 2J22A 1YCIA 2R043 3FN9A 5E88A 1T6BX 5HXVA 4XAEA 1HRI2 5FZ4A 3VBHB 3Q9OA 1KEXA 2WWSA 2V73A 4AK3A 1VBA2 2QQIA 2XXZA 4K8RB 5A7WB 3WDVA 5J1XA 3OYWA 2XJRA 4N53A 1LOFA 1OUSA 2OPWA 3KCCA 4GD4A 2RDQA 3THTA 1TME2 1WZXA 1F5FA 3ACIA 2W94A 3N7KA 3SKJE 4BQXA 2WAAA 4OCTA 2VVEA 4DY5A 4Q0UA 2BWAA 2OIIA 1O5UA 1OA4A 2DVFA 4XMIA 5FJHA 1CIYA 4CCCA 2WO3A 2HWF1 1D2SA 3AK0A 1W2NA 3GBWA 3K3OA 1XC6A 3I2GA 1JHNA 4RR3B 4AFMA 1MZEA 5C3QA 1YEWA 2OUJA 3TWIA 5FPAA 5K4LA 1XB9A 2TNFA 5FBJA 1WW4A 2DCJA 2R062 4MX3A 2ORZA 3SISA 1GWMA 2WO7A 3WCRA 4NE9A 1FYUA 2V5YA 2RJLA 4LBQA 1PZ7A 2A3WA 5F6KA 3TN92 4DXSA 5JOYA 5LZ6A 3O5SA 5L73A 1Q8QA 2OT7A 2OX0A 1BYHA 4KG0A 5IUQA 4XQDA 4P08A 5I91A 4AAPA 3LDRA 1IHMA 1IS3A 1ZZ9A 2J1UA 3R4SA 5DABA 5LK5A 4CUGA 1ZX5A 2Z42A 3MFAA 2ORXA 5T5LA 4NRMA 3LE0A 5F7UA 3MEPA 4FQ4A 3AZXA 5B2GB 1YIFA 2WWUA 4PQQA 1DQ6A 1W9SA 2E32A 3AZZA 2VL4A 4ZPIA 2Q4SA 3JB4C 3O1VA 2MEV1 3DN7A 1Q8VA 2W68A 3B94A 3E6BA 3JQWA 4GA9A 4YW3A 3VBHA 3GBGA 1CAXB 2E7TA 2H6BA 3AP6A 4IE7A 3NV1A 1UX6A 4FCAA 1LOAA 1MVQA 1ULOA 1W9YA 2GDFA 2WZR1 2W95A 2XL9A 3WV6A 1RINA 4WM8B 3I59B 5D21A 5FO8B 5F3CA 1DGWX 3V0BB 2IFWA 5FREA 4A6OA 4DPNA 4FTSA 1PX3A 3UV9A 4B1LA 5FLIA 3PUQA 3ZN5A 4IDZA 2HWC2 5IWFA 3OBTA 1H1MA 1O3TA 4MZUA 1E5RA 3ZFGC 1NLQA 3NVCA 3ZDSA 4NOTA 4ZS2A 3LEGA 5BPXA 1PGL1 5DG2A 2EVXA 1GFF2 3OUIA 1SBFA 3D0JA 1YHFA 1E5IA 2VW0A 3C8XA 2Y34A 3X29B 2DDUA 4ZU5A 1RUD2 3K4AA 4XVHA 2QZ3A 1OH3A 1UIKA 1WW5A 5LBFA 3FUOA 2BDRA 4XTPA 2Z69A 1WLCA 3GJBA 1ZRCA 2JICA 3ZR5A 3M3OA 2VZRA 3H50A 3KGLA 3ZIXA 2WZ8A 1W28A 2G1MA 1NY71 1X8MA 1KXGA 2DVAA 1J83A 2XBO2 1UOGA 2YU1A 3PVOA 3MV11 1HRI1 4U2AA 2JD4A 2ZX2A 2JE7A 3BU0A 3CQOA 4PIXA 2CGNA 2AR6A 5FZDA 2ZMKA 1J1TA 2A3YA 3M7AA 4XIOA 1PVC2 3T09A 1P8JA 2JE9A 3WQ0A 1CAVA 1X33A 1KJRA 4MVTA 3UKTA 4AHZA 2YV8A 3MUY1 4LNVA 1HN0A 1TME1 2VMFA 2PHWA 2VXRA 5FP8A 3RWNA 1O8PA 1US3A 4HKLA 1ULFA 3DXTA 2RM23 2CWSA 4META 3AL6A 4BZ4A 4AHXA 5KHIA 4INDA 5HV0A 1LAJA 4NHXA 4K9SA 3A22A 1BXHA 4PBPA 4UWDA 5A3UA 1S55A 2D98A 5FMOL 4AI9A 3ILRA 3ZKYA 1KJLA 4URTA 5CEHA 5KXBA 2EIGA 3GGLA 1CZSA 4N7UA 1CAXA 3OGSA 1RUG3 2G9FA 2R061 4FPKA 1D4M3 3H1YA 5FMBA 3MGUA 1C1FA 3WG4A 3VBRC 4QPGC 4A44A 4WM8A 1QY4A 3AB0A 4WVMB 3I59A 4BISA 4QGMA 4OQ8A 1N47A 2RG4A 5K8SA 4Q0QA 3TN91 3V0BA 1OLMA 5DZFA 1WA4A 4K20A 1OKQA 4NRPA 2JB8A 3J4UH 3S5QA 2B7YA 2C6SA 3CDZB 4QX5A 5E6HA 3RNSA 2X29A 3PL0A 1D4VB 1WMDA 3OPTA 2VZSA 1NAEA 2RR12 2DUOA 3LZZA 4Y5TA 1SLIA 4AQ6A 1W0PA 3LGRA 3AP4A 2Y0IA 4IEQA 4AYUA 1NA1C 4LK7A 5L9RA 2D93A 3VDAA 4ATEA 3DPRC 4EWEA 1GOHA 4HZFA 4LHLA 4A42A 1WMEA 2VQTA 3GALA 3QLQA 4L97A 4MYEA 3O12A 3MFCA 5H9SA 1K45A 4LT5A 1XU1A 3IIAA 3Q8CA 4BQ2A 3RPQA 2ZGPA 3GF6A 5FY9A 4E2QA 4JGZB 3SH4A 5JR2A 1RUJ3 5CFCC 4QDRA 4A41A 1WGPA 2UWBA 1ULCA 4NRQA 1AL22 2UY8A 1DBNA 2RVAA 1W3VA 3WEZA 1OUXA 2E31A 1VBE1 4F8AA 3ZSJA 1U5ZA 2IWGB 5FYMA 3HPNA 5L9VA 2WFF2 2HWC1 5A7NA 2EXIA 4UFMA 1KFUL 2RMU2 3Q8BA 4MADA 4MGSA 1CZVA 3O1TA 1J58A 5IVFA 2OYZA 1EUUA 4WBBA 4FFHA 1BMV2 1RUD1 1QJZA 1UZYA 3O0XA 4DRVA 1OXCA 5JIAA 5T52A 2HWD1 1QQP2 3MZHA 3NNFA 2OZ6A 4QX0A 5JSRA 2P3KA 5LRSA 2HWE2 4X6QB 5CU1A 5FKCA 2XBO1 3VBUC 1UPSA 2BNOA 2JENA 1TEIA 4HKOA 4WVMA 5F3EA 4BMEA 2XH6A 1QH6A 4YG3A 4GALA 3K3NA 4UYBA 5LASA 3P3PA 1H1AA 4DFSA 5C9AC 3HBZA 5LA0A 4AGGA 4MHUA 5A32B 3FFZA 4G9SB 5IFPA 1QJX1 4LTAA 5FP3A 4YVSC 2Z79A 4FPYA 5I0SA 3IM0A 1BVVA 2JG9B 5EJZB 5CG9A 2QQUA 3MIFA 3VBSB 3H8OA 5FP7A 1IS4A 2WO1A 4MH0E 1MS1A 2Y6HA 2Y8KA 1PGW2 2G19A 2CL2A 3WDTA 5LK7B 1S0GA 4GAZA 3ZMNA 3OEBA 1OMIA 1XE8A 4Z8BA 5C8CC 1MEC2 3LOIA 3E1F1 3UT0A 1YFUA 1YI7A 5F37A 1X9PA 5HBAA 3DPRA 5JOZA 2E33A 1DIWA 4UBHA 3VD7A 1DG6A 5FMDA 2HBTA 4JGZA 2VR4A 3MIEA 4YWAA 2OZJA 4FPEA 1JYWA 2R32A 3IAQA 2VZTA 3H42B 3KV4A 3EXUA 1HXS3 4LBKA 1W99A 3NAPB 4A7KA 2GN3A 4FI9A 4KGQA 1K5MC 1ZBE3 3E6CC 5BY5A 3OGGA 1OF3A 2HWF3 4IEWA 4YARA 1VB4A 1GZCA 5FY4A 3AYCA 2XMLA 4NPLA 2RR11 4DB5A 1YYNA 4N43B 5FO7B 2WC2A 3KD4A 1FI2A 2O8OA 4FPJA 3WG3A 4CU9A 4CEWC 2XLFA 5FMOS 4OZXA 2PQQA 1S1AA 3CMGA 3CLPA 4UFJA 5LA9A 3OBZA 3MO4A 1JYNA 2VGDA 3CJIB 2E53A 5F3GA 2W1QA 1G9CA 4JHZA 2QQOA 3ES1A 4FXKB 4NUBA 2DUQA 1H2LA 3I2JA 4XFHA 1HV0A 2EXHA 2DCZA 4Q0PA 3J9SA
chains in the Genus database with same CATH topology
3VBUA 2NN8A 5T54A 1XNCA 1LEMA 5CIRA 2ZGQA 2A6XA 1AL21 4I01A 3DGTA 4KBBA 2ZPXA 5I8YA 3VL9A 1NCRC 5EYYA 4XJZA 1MS3A 1V6OA 2JG9A 4COVA 1IS5A 3WQ7A 2Q30A 2WFF1 5GZDA 1OPOA 1RUH1 1UN1A 3B9IA 4OULA 3VBSA 1RVF3 4MV2A 1RUF2 4AVSA 2RMU1 1RUI3 3LAGA 4JTOA 4Q4V2 3ZMOA 1H2MA 1KD7A 4DZGA 4Y22A 4B7KA 4TSVA 4A2UA 1BMV1 1NQDA 2XLAA 1HIXA 4CDUB 2PHTA 1LHOA 2ZHMA 1VBB3 1QQP1 3U10A 5C8CA 4AI1A 4PCRA 1AXKA 2DFCA 2R16A 2HWE1 2GMPA 4FXGB 2ZZQA 4H14A 2FQPA 2VULA 3TAYA 2QFEA 4B8EA 5AC93 1JXNA 1ZBA3 4GB32 4IV1C 4XYXA 4YZ5A 4S2FA 5GLZA 3NAPA 3ZXLA 1U5XA 4YNIA 1QJY2 4MGIE 1EPZA 1WD4A 5JDBA 3RI8A 4N43A 4A3XA 3NSTA 2ET1A 5JOWA 1RUNA 3CJIA 1QH7A 1PGW1 3NKTA 4OUMA 3SHRA 2R49A 1LHUA 4YZ2A 2B42B 5DG1A 2DF7A 2H0BA 3MW2A 1MEC1 2PHFA 2B46X 2VW2A 4BHPA 1VBA3 1BEV3 2I45A 5GM0A 5JPMB 1SBEA 4PIZA 1RUC2 2Q0AA 3HT2A 4OVEA 3M3QA 4PF5A 4R9DA 2ZGLA 4SBVA 5E89A 1LGNA 1NLRA 2HEYF 4RQPB 4AEDC 5F9TA 1VBD3 4KL1A 1ND3B 2R072 3EJKA 5EXOA 3ZYJB 1FAYA 4CTEA 2VMIA 1HLCA 4B7EA 1IS6A 5BUVA 4LEJA 1KITA 4LR4A 3VBFC 4AI2A 2I74A 3FBMA 4M0NA 4AFCA 2BTVC 1Z78A 4COYA 3D4KA 4PDWB 3ST7A 4CP1A 2QZ2A 1LOGA 2P2KA 3KGZA 2O8QA 3TB0A 5KHGA 3VKMA 3WP5A 2ZKLA 1W6NB 4DXZA 4BYYA 3KT1A 1H8TB 5L7OC 1UCXA 1T6GC 3H0OA 1W6PB 2GNMA 2RS12 1AJKA 4LUKA 5J7MA 1XYOA 4FTBA 1MQTB 2A6ZA 2HYKA 1FMD2 3BIWE 4Q0VA 5IK7A 1GNZA 3MF6A 4YW5A 4YZ4A 4Y5Z0 1D2QA 4QD2A 2QCSB 4EJRA 2ZKNA 3VKOA 4IEUA 3NJZA 4PLMA 3GZAA 1SCSA 4WVZA 4AFAA 4QQ2A 4CRQA 4Y1XA 1EPWA 2NMOA 1RUF1 1XYPA 2A73B 3MIDA 3FUQA 4GH4B 3ZN4A 3GHNA 3VL8A 5GZEA 2WIIB 1DGLA 3ETQA 4AEJA 4HVQA 2D6KA 2WNVC 4AG4A 3WUCA 4XFCA 1ALYA 2WKKA 4E9KA 1PNGA 3OJBA 1REFA 4AHYA 4X8NA 3SCFA 4AEKA 4Y1VA 1LHNA 4MUVA 3POSA 4BPZA 2GH8A 3M2MA 1FATA 4RQPA 4GB31 2XVLA 1ND3A 2I07B 3SXWA 1RMU2 5FCCA 3TOJA 4FPGA 3WDTA 1KS4A 1RIRA 1V70A 2PHDA 1BCXA 4OI1A 3RI9A 3VHPA 2JG8C 4JCKA 4AFDA 2AYHA 3OGJA 1FV3A 2UYBA 1AYM3 2A6YA 2ETEA 1O3SA 2LUWA 1UAIA 1ZM1A 2B39A 3V64A 2XWJB 2CTVA 1ND2B 2EA7A 2X53S 4QT6A 5CFDC 3VBOB 1QHDA 4XILA 1FOD2 2XBO3 3N7JA 2GAUA 5BNOB 2IXCA 2XHKA 1R083 1W6NA 3JD72 1H8TA 4LLOA 4QQLA 4LBQD 2P3JA 2R6QA 3JCIA 1W6PA 1PVC3 4UW6A 1DZQA 1RUC1 2RE9A 5I8TA 3JZVA 1BQPA 3ZN6B 1I3HA 5JWPA 4C90A 4I0AA 4QMAA 1PO12 1GBGA 1LULA 4OLLA 3AKPA 3J26N 2R071 4P5HA 1DF0A 2VUJA 2ZX0A 2O0OA 3I2DA 3UKNA 2BNMA 4XJ9A 4GQ7A 3JBG3 5E8AA 4BA6A 4HT1T 4R9AA 1REEA 3OY8B 4GH4A 1RTVA 2D6OX 1H30A 4YFWA 4K21A 4ATFA 2UWAA 2ENRA 3ZPYA 4YVWC 1XYNA 2JX9A 2VVDA 3I4IA 4RGAA 4R9BA 1AZDA 3WT3A 4CDQB 2WNVA 4CP0A 2GN7A 4KWJA 3RJ2X 3ZFEB 1UU6A 4YZ3A 3UL2A 3B5LB 5DDJ1 1HRV3 3HMYA 4QQOA 2RS11 3FJSA 2DCYA 4Y1YA 2DTYA 3SH5A 2C9AA 4KU8A 1EV11 4GMP0 5AVPA 1Y43B 2VW1A 4H7MA 2BFUL 5JOXA 4N53C 2VNGA 1LOFC 5FRAA 2DYCA 2BUKA 2VNRA 3FHIB 1LU2A 4GKXA 5F5QA 3WDXA 5ACA3 4AWDA 2O1QA 3E5QA 5E1RA 2JG8A 1LOCA 1RJ7A 1S0FA 4EN8B 1DZTA 4UW4A 1PMIA 1AL0G 5JI7A 4KQ7A 4XXAA 3VBOA 5D8AC 1IZ3A 2VQ0A 3R0RA 1LU1A 1GKBA 3LKJA 5BNOA 5JLVA 3MIHA 1N3OA 5FFOC 1DQ1A 1POV0 3AP7A 3ZX7A 3AYEA 3INAA 3ZN6A 2BWCA 4D69A 1DQ5A 1ZVFA 2PLV3 3RS6A 3ES4A 4ZU7A 2XWBB 3AYAA 4P9IA 1EYBA 2X5IB 1BBT2 2B8MA 2MHFA 2XJQA 1OLRA 4XQ4A 4FPHA 2VY0A 1FPN2 4YG0A 4OHYA 1XE7A 5TSWA 1Z7S2 4Q4Y2 4ONUA 1PGL2 4Q8LA 1CAUB 4NO4A 4XQWA 4PIYA 1JW6A 1X8EA 4CDQA 5CB7A 1FOD1 5KHJA 3FE5A 1V9U2 1CR7A 3AJZA 3LA3A 3R05A 3ZFEA 2P37A 1OPMA 2VVFA 3JD71 3O7OA 1L3JA 3VBHC 3N35A 4UBGA 4M01A 3N4MA 2CGOA 1NY72 2WT2A 2D97A 4IESA 1S2BA 3D82A 1C8M1 4UW5A 4CZSA 3B01A 2ZGUA 1PO11 4AF9A 2D6LX 4XJ8A 1RHI2 3ILNA 1VIWB 1CPNA 3A0KA 5CNAA 3ZXEA 1Z0HA 5JVVA 4IEYA 4YGEA 2WQ4A 4AFBA 4RR3C 2RS52 3NV2A 2R1BA 5D8AA 2VMHA 2ET7A 3AP9A 4GWMA 4YG6A 2XLGA 5FO9B 1Q8SA 2VUAA 5JZGB 3AMNA 1TNFA 3WP3A 3SCHA 1H8VA 4FPFA 3OD4A 4L11A 2X5IA 1H2NA 1QXRA 1G86A 2D3RA 2DV9A 2K0GA 1WCSA 2B9UA 3MPBA 4K1YA 3VKFC 1V6MA 2VPVA 4XJUA 3TYJA 2ZMLA 3WW1A 1PK6B 2ERFA 2XGXA 3GNEA 1SDWA 2XJUA 2YC0A 3MICA 2G9GA 1CAUA 1QJU1 1LOEA 3AP5A 5HCBA 5K0UB 4XFIA 4XE9A 1GQGA 4H3WA 3VN4A 1S0IA 3FLPA 1REDA 4HVRA 3VZJA 4QXKA 4UW3A 2K9ZA 4NHKA 2FMYA 5GZCA 3ZIWA 1QNWA 2GC1A 4MSVA 5DUUA 3U4XA 4BIFA 5CADA 3VKLA 4WM8C 1LRHA 2BFUS 1SLCA 1AUYA 4LHNA 4R9CA 2MPFA 4XMAA 3AJYA 1BBT1 3S7IA 2FMDA 5GJ6A 3ECQA 1G9AA 1VBE2 3WW4A 2ZGNA 4Q4V3 4OHWA 1FPN1 1UL9A 5FLHA 4E4DX 2RS33 1O4YA 1ULGA 3SLIA 1Z7S1 3AFGA 2YDEA 4Q4Y1 4RGGA 4COWA 4O9GA 5LEKA 3MLKA 5KBFA 4RHV2 3CJXA 4RR3A 4BCUA 5CVRA 2F4PA 4ZU4A 4PBOA 2HWD2 1V9U1 1AR82 5JZGA 2GC0A 1A78A 1YFXA 3HN1A 1HQWA 1COV2 2UY9A 4LBOA 4ZXKA 5IK5A 3NKGA 2JEMA 2ARXA 4XW3A 3LWCA 4LA2A 1QJY3 1NYWA 1EAH3 1QJX2 2QVSB 3FZ3A 2ZGTA 1PK6A 4YW1A 3LCPA 3C3VA 4FQZA 1RHI1 5HI0A 2XJTA 1SFNA 5K0UA 2RJKA 1U12A 4HBNA 1HX6A 4JC1A 1OOPB 2Z5WA 1R091 1QDCA 3AFKA 4W6XA 1ZRFA 2RS51 2QQPA 1LOBA 1NXD1 3RYRA 4W65A 5J48A 1TNRA 2ZHNA 1AX0A 4FO9A 1VAKA 4UXAA 2B45X 5LEJA 1V6JA 2Z2SB 2GMMA 2PAEA 3QBQA 3RMXA 3A0NA 3O14A 1QNYA 3E6DA 4PLOA 3ZXGA 2DCKA 1C8NA 1R1A2 3I8TA 4HETA 4XETA 3AMPA 2XPJA 1AR62 2IXHA 2ZAAA 3D5OA 4KG8A 1CONA 3K51A 4Y24A 5JMCA 3B00A 3DKWA 4ES8A 2N7GA 4BQ1A 5BV6A 2D40A 4GULA 4TZDA 3J8F2 3V0AB 1UKGA 4X8PA 1ASJ3 2WL1A 1S0DA 3K48A 3WQ1A 1NQJA 1AR92 1FMD3 1YJLA 2YMZA 3KCYA 5GZFA 5IK8A 4JGZC 3WW2A 1Q3EA 3FLRA 4KGGA 3ZYPA 1ZREA 4N7IA 3IKWA 2WS93 3FMGA 3PMEA 3BOWA 2XJVA 3M3EA 2JDZA 4MGYE 1GQHA 1OFNA 4S2GA 5JPNB 1Q8OA 4MGZE 4XF3A 3UKVA 3VHNA 1B35B 4AVAA 4BIOA 3OCPA 1Y3TA 1AYN2 1UF2C 1RUH2 2DCTA 1DYKA 5H9PA 3OTFA 2JXAA 4HN0A 5KC5A 2D5HA 3MW4A 5E16A 1RUE3 4ITCA 4H7LA 4RHV1 4NN0A 1ZNPA 3ME2A 2WA3A 1AR81 3ALQA 2BPA2 4IL7A 3VZKA 3QH7A 1VBC3 5K7PA 4YLZA 3GZUC 2ES3A 1COV1 1RMU3 4IEZA 1VRH1 1UZZA 2B5HA 4E2SA 3MYXA 2P17A 1WCKA 2ZBJA 2JG9C 1PO21 3KZ4C 2YGMA 4Q1RA 3VBSC 5BNNB 3ZXKA 1V6NA 1TMF3 5J37A 4LA3A 3LSEA 1AR73 5GLUA 4NWVA 1A6CA 1GR3A 3IMNA 3U0ZA 3R6SA 2NP0A 1H4GA 3MLJA 3JD73 4K40A 3V0AA 4COUA 4CDWB 4FPCA 1PHMA 2H0VA 2EAKA 3HT1A 2VOWA 2W52A 1ENXA 1JUHA 1WBFA 4DMIA 2XG3A 4HSLA 2LM3A 4HSJA 3NL1A 1V6LA 1DYPA 3ELNA 2D7FA 4P9YA 1H1IA 1PIV1 4WM7B 3QH6A 3JQXA 4HLTA 1KS5A 1OSGA 4ASLA 2R0FA 4OHVA 4Z82A 3NAPC 2WT1A 3WR0A 4JGYB 3USSA 1WD3A 1B35A 4GXLA 2ZGRA 5KHKA 3E5UA 5A33B 3EQEA 1R1A1 5FPZA 5KXEA 1YUDA 4N43C 5I8SA 1MZFA 4WVVA 1AR61 3IT8A 4XF0A 4XFGA 4HFSA 2NQYA 3CJIC 1C1LA 1Y7BA 2Q5TA 4DOUA 2ZHLA 3J8F1 3KT4A 4Q4W2 4EROA 3FFQA 1F8VA 1AR91 4I0BA 4RL7A 3FBYA 4M3CB 4I30A 4OI4A 3KS7A 2WSUA 4N90A 4FP2A 4PLNA 4Q2FA 2VQAA 3WDUA 1O5LA 5A32A 5K9YA 1HQNA 1JOJA 4FTEA 2GNDA 3JUUA 3MIGA 1C5HA 3NW4A 4QPIB 4EWDA 5BNNA 2BYVE 4HPKB 3KQRA 3BCWA 4Q29A 4F7ZA 1AYN1 3RRDA 2QJVA 1N1VA 1UD1A 4XF1A 2OA2A 2XKOA 4GMP1 4X6RB 2DU0A 4CDWA 4CDUC 5IK4A 2VECA 1QU0A 1U5YA 2DURA 2MEV3 3WG2A 2A5ZA 4FAGA 3AZVA 4A7ZA 1S2KA 2WLQA 4AVVA 4SLIA 4WM7A 2WZR3 1AJOA 4XXPA 4YSFA 2ZMNA 1PNFA 4B3NA 5GLWA 1A3KA 1WLWA 1YFWA 4JGYA 1FPN3 1S0CA 4OI2A 1OHFA 5D1IA 2D44A 1GZWB 4YYOA 1CIWA 2E9QA 1POV1 4XZPA 5C4WB 2PELA 4Y20B 3SCGA 5FDBA 1V9U3 3SITA 3AZWA 4FAHA 1H2KA 1CN1A 4KWLA 5CAZA 5EV7A 1OA2A 4A7YA 3S0MA 1KFXL 2Q1MA 3OF1A 2HJIA 4JDMA 4LUMA 3TNPB 1HRI3 4H55A 1QXJA 4QGLA 3D6EA 3RG0A 4QPYA 1DDLA 3W59A 1IOAA 3C2UA 1ZYBA 2VOXA 5GKAC 1O4ZA 4RQPC 1SLBA 1WBLA 1ND3C 3VDDB 4Y26A 1TME3 5AVAA 4RA0A 4BWOA 1AXZA 1LHWA 2H6CA 3CU7A 2WNUB 4FOYA 4HPKA 1OA3A 1DGRN 4MXVA 1ULDA 4FOVA 4DS0A 4C1WA 4C1XA 4FPOB 1AHSA 3L2HA 4P9JA 3TNQA 4PDWC 5T55A 1JN2P 4LBJA 2ZAHA 1NXMA 2IXIA 2WNEA 1Q56A 4CDUA 4AGRA 1GV9A 4Z92B 5JSPA 4Q4W1 1GICA 2R063 1H8TC 3PJQA 1YIPA 2ZABA 4M3CF 1WLTA 1D4M2 5GZGA 1MQTC 1F5JA 2WSVA 4YM3A 5DDJ2 3MIBA 3TN93 3ZO0B 1NLSA 2C0ZA 3CNAA 2BVVA 1EV12 4IEVA 4BMBA 1DZRA 1GZWA 5BNPB 3RQ0A 5C4WA 3KM5A 4Y20A 1XRUA 2KA3A 4BH9A 5DUXA 5SV8A 5ABJB 2AUYA 3P3NA 1VB2A 4GH4C 4Z07A 2PHRA 3AXDA 4D3WA 4FBFA 3AKSA 3WDWA 1LCLA 5I0TA 1CQ9A 3AKTA 1Q5OA 4IEPA 3FC0A 3U11A 4JDNA 3ROUA 2ZX4A 1PZ9A 4YZ1A 3T2TA 4JQRA 4LBLA 1RB8G 3VDDA 4YGDA 2YPJA 2JECA 1VBE3 4F83A 1RJ8A 3DL3A 3UJQA 4AQSA 1WCDJ 2HWC3 4G4FA 1N3PA 1W0OA 3IPVB 4IV3B 1EP0A 1BKZA 4P9WA 1BK1A 3WCSA 1RUD3 1C4RA 1ND2C 2HWD3 1O3RA 1UW8A 1XNBA 1LEDA 3VBOC 2NPIA 2GZWA 4PDWA 3CO2A 1J1LA 2SBAA 1DFQA 2ZHKA 4P9GA 1MS8A 1SCRA 5BNOC 1GYKA 3WXPA 1UPIA 3ZYRA 4B4PA 3AMQA 2E63A 2VNOA 3O0WA 1W6QB 1YNAA 1R1ZA 4YRDA 5IT6A 3WX5A 4R52A 1C8M2 1MQTA 4I2OA 1QJX3 1ZZBA 1KDKA 2K2SA 4COZA 3NWKA 5BNPA 4Q26A 4YGBA 5JIUA 3KSCA 3ZFFB 5ABJA 1LENA 4AW7A 3BB6A 1YJKA 4YFZA 1SMVA 2W08A 5EZWA 1LHVA 4Y1ZA 3VHOA 1ZZ8A 2ZA9A 4LO7A 1DQ2A 5JI9A 4CDQC 5CBLA 1FX5A 3ZFEC 1NE6A 4P9XA 3SH3A 3HD8B 1RUG1 3WUDA 3M8LA 1D4M1 3T1LA 3LA7A 2ZJCA 4Y4YA 3QACA 2C1FA 2XJPA 1GSLA 2A75A 5KWRA 1R1A3 3AMMA 2CYFA 3WHUA 1QXPA 4FSJA 1MS5A 5HCAA 3IPVA 4IV3A 4XF4A 5L36A 2RR13 4Q8KA 4F3JA 3CF6E 4L92A 2WQZC 2BGCA 1C3HA 4JRLA 4CDXB 1QJU2 4IEOA 3MPPG 3USUB 1ND2A 4RS5B 3RJRA 3M70A 2IZWA 1W6OB 1W6QA 4WVWA 1I9RA 3VZNA 2W0XA 2R1DA 3POWA 4LO4B 4MXWB 5A3LA 3WHTA 4C0BA 1HKDA 2XJSA 3B9CA 1AL23 1VALA 1V00A 1APNA 2X5IC 1ZRDA 4DY3A 4I3GA 4AVTA 1CX4A 2PYTA 1RL3A 2P3IA 4W6WA 3VV1A 2WFF3 3MW3A 1RUH3 4M00A 2KXLA 2RMU3 1QWRA 4LLFA 1MZ5A 2GSYA 1G7YA 1RVF2 1DGRA 3OY8A 1RUI2 3D0SA 3EBRA 3KMHA 4BLIA 1IKQA 2GH2A 4Z2WA 2ZGMA 1QQP3 3BOPA 2F6BA 5FBZA 1VBB2 5KXCA 2HWE3 5CA6A 3WOGA 4KWKA 1D0HA 4CYDA 4K1ZA 1GZ9A 1MZ6A 4TWTA 5AC92 1ZBA2 5JAXA 3AXEA 5H9RA 4DNYA 3EHKA 2A7AA 3NV4A 3A4UA 5C8WA 2ILMA 2HWB2 2XVKA 3H7YA 2BW8A 1D0GA 4XTMA 4ZKTB 1KDMA 4CEYB 1NCQB 4CDXA 1OFSA 5FOBB 1ENQA 1F31A 3USUA 1ZZ7A 4RS5A 1MEC3 1C28A 1SACA 1UU4A 1R092 2ZS6B 1W6OA 1PVXA 4MXWA 4R8HA 2NYYA 1X36A 1MS4A 3M3IA 1BEV2 3WVJA 5JZGC 4AVCA 1LR5A 4R4XA 4LE3A 1SLTA 5GLTA 4XDQA 1N1TA 3HWJA 3M4FA 5FPXA 1IQAA 1VBD2 4TLFA 4XJWA 4YW4A 1HXS1 4LO5B 3WP6A 3T1MA 1PK6C 1ZBE1 4HKWA 2IXLA 1XQNA 4Q4X2 2WT0A 4RFT0 5K0UC 1I5ZA 4Q4W3 4RD7A 1JTZX 2RHPA 2WLPA 4GIQA 5J96B 3CEWA 4GKYA 4ES9A 2DVBA 5KHHA 1RGSA 5FLJA 4KH9A 1S0JA 2DVDA 2FHRA 1O7FA 3PVBB 1UMZA 4XHBA 2BQPA 4WZCA 4XBNA 4L99A 3NV3A 1DU3D 4AI0A 2QKDA 3PLQA 1CAVB 2Y38A 1MS9A 5T5OA 3DF0A 4QGNA 2AENA 5T5PA 5T3NA 3WY6A 1RUF3 5BYNA 1NZCA 4CEYA 2EALA 1NCQA 2QDRA 3OBRA 1RVF1 1RUI1 4P9LA 1N3QA 4XFFA 2E51A 5DZGA 4K3UA 3E5XA 3RMYA 4D94A 3ATGA 4XF9A 1F9KA 1VBB1 5BXXA 3N3HA 1N1YA 4EWAA 2ARBA 4FOWA 5EJ3A 1GANA 1H4HA 4LBNA 4AQTA 3AKRA 3BPZA 1B09A 4GB33 3ZXAC 3WNXA 5AC91 1ZBA1 3KCXA 1VRH2 4E2GA 5GLVA 1QDOA 2D3PA 1NOVA 4U36A 3H3ZA 4B4RA 2VG9A 2HWB1 3ZFGB 1PO22 2DU1A 2UWCA 1AYM2 4OUSA 1QOTA 4YM2A 4OHZA 2QUOA 3VZMA 2VU9A 1OOPC 4D7YA 1ENRA 3SNMA 3LA2A 3S6PA 1R082 4HVOA 3PVEA 4FOQA 3DUIA 2C5DA 2PA7A 1VBA1 1BEV1 1RUC3 4XFBA 3QOPA 2GC2A 3HIFA 4Q27A 1PIV2 4S2HA 2XKPA 3U07A 1IPJA 2R073 2P34A 3H9AA 2OUHA 4PJYA 4KU7A 1VBD1 3BU7A 4I3PA 5I93A 2A3XA 1X50A 3MI8A 4HANA 4AI3A 1KRIA 4TYSA 3V56A 3ASIA 3I7DA 1U5IA 3D8CA 3JBG2 1PZ8A 2DFBA 2DWRA 4B29A 1OQ1A 2IXKA 1DHKB 1AVBA 3ENRA 1ZZCA 3KT7A 4Q4X1 5CG8A 2A6VA 3BODA 2GALA 3OPZA 1CJPA 3AYDA 4NHLA 3VUOA 1NE4A 4R4ZA 5FTTC 5DDJ3 4D7TA 2Y0OA 1CESA 2DVGA 3VZOA 2D5FA 2RS13 2VH9A 3VGIA 4N9IA 3WG1A 1HRV2 1EV13 4QPGB 3H3UA 2YZ4A 3VBRB 2LTNA 4J6GA 4YW2A 1QOSA 5EWSA 1X7NA 1C5IA 4C91A 1V6KA 3B02A 1Y9QA 3EO6A 3QD6A 4S2DA 3IDCB 4JAAA 3AMHA 4EN6B 1B35C 3ZFGA 3PJYA 5ACA2 1HDKA 2Y26A 5L19A 2CY6A 5J98B 1LKNA 3POYA 4YM0A 2R30A 1QKQA 1TE1B 1AX2A 2WINB 1JH5A 1A8DA 4K6BA 4BM8A 3LSDA 1NA1B 1OOPA 4HK8A 2ZX3A 3DPRB 1LJ7A 5A3MA 2AZ5A 5DXDA 3L2YA 4AE2A 2ZOEB 5CFCB 1RITA 2LALA 2PLV2 3WP4A 2WFPA 2PAMA 1WUVA 4OHXA 3ZXFA 3AKQA 2YGLA 1SFYA 2XL7A 3E97A 2HKXA 4AVBA 2UU8A 4XOGA 5BNNC 1U0AA 2ZGKA 1AYM1 1WW6A 1MACA 2XUMA 1FOD3 4FT8A 3ZXJA 1CVNA 4NHMA 3N7MA 4CDWC 1O3QA 1M06G 1LB2A 1N1SA 2CAVA 5J09A 3MF9A 4JRAA 1R081 2A71A 1SLLA 1C8M3 3VBUB 4WM7C 3VBRA 4QPGA 3ZXDA 2R042 2AH2A 1PVC1 4LO6B 2EF6A 2FZ2A 1PO13 5C9AB 3ZSEA 1O4TA 3WW3A 3ZVXA 2WZPP 4LHKA 1F2NA 2X8KA 4JGYC 2HEWF 3JB8A 1JBCA 4NR1A 4Y1UA 4YVSB 1UKRA 4AQ2A 2EXKA 3JU9A 3DV8A 4MLOA 1OLQA 1MS0A 2G4IA 2IC1A 4ISRA 3JBG1 5FQ0B 2GNTA 1BVP1 3URFA 4Y22B 2EAAA 2FBEA 3LB9A 1CJDA 1NA1A 4EN9B 3WZ1A 4LO8A 5C8CB 1V6IA 5SV5A 2QNKA 1DQ4A 5T5JA 4KNCA 3G7DA 1TQ5A 3N7LA 2BVBA 3I54A 1Q8PA 1AF9A 4XBLA 1OQDA 3ZSLA 1AX1A 3RYKA 5HCFA 2QDNA 5CFCA 3FLTA 2OPKA 1HRV1 3AM2A 4DRRA 3RYPA 4JV4A 2ZZJA 4NVPA 3B3QE 2IXJA 1G6NA 3OD0A 1K5MB 4QPIC 3FWEA 4ISQA 2QE3A 5ACA1 3LOBA 1C57A 1QJU3 4CEWB 1LTEA 5J3UA 1GLHA 1G9FA 5AFEA 3FX3A 1BZWA 3NO8A 4GWNA 2D43A 1LESA 4Z1VA 3PHMA 3BALA 4E27A 4BE3A 1E57A 3VHRA 5FAXA 3THPA 5C9AA 3B93A 4AGVA 4DQAA 3B7MA 2PLV1 4N9HA 2NM1A 1BBT3 2E6VA 1WW7A 5FOJB 1YO8A 1W2UA 4LBMA 1UU5A 4YVSA 1NCRB 1YXWA 3HR9A 4XIKA 4HMZA 5KC6A 1A8MA 5C4WC 5FQ0A 1Z7S3 1URXA 5A33A 1CPMA 2OW4A 2RS32 4IERA 4Q4Y3 4EV0A 3APBA 4OI0A 2TEPA 5I0UA 2Q1ZB 5C6CA 4M0HA 2HEVF 4QM8A 2UURA 2CV6A 4C0HA 3HAGA 1W6MB 2DUPA 2MNGA 3R4DB 4WZFA 1JYIA 3UJOA 2E7AA 1CGPA 1O91A 5J36A 1XXNA 2EXJA 1VJ2A 2R041 5LRRA 2A6WA 1FT9A 3R4UA 4M3CA 4IV1B 1QGLA 3VDDC 4JDOA 2YROA 1H0BA 2HWB3 1XNDA 1K5MA 4YGCA 5C33A 1EAH2 1RHI3 2WNUC 3H1WA 3ACLA 4QPIA 1IKPA 4CEWA 1ZRRA 1VAVA 4I02A 3AZYA 1LGCA 2RM22 1HW5A 1JYCA 3MDPA 1R093 1LGBA 4PQ9A 4DINB 1M4WA 2ZCWA 5I0RA 2RS53 4XBQA 1J3QA 1Q43A 2ZACA 1LECA 4JVAA 4L9BA 2OVUA 1KQRA 1QF3A 5DUWA 4JTNA 1HV1A 1IPKA 4FPLA 5KXDA 2YUEA 3M1HA 3W58A