3RWNA

Atomic structure of bacteriophage sf6 tail needle knob
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
155
Chain Sequence
FGSSRIDALEYATTRKKSEVVYSGVSVTIPTAPTNLVSLLKTLTPSSGTLAPFFDTVNNKMVVFNENKTLFFKLSIVGTWPSGTANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKDGFLATNGSTLTIQSNGASFTATTIKIIAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gene 9 protein
publication title Atomic structure of bacteriophage Sf6 tail needle knob.
pubmed doi rcsb
source organism Shigella phage sf6
total genus 36
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1120 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rwnA00
4K6BA 3RWNA
chains in the Genus database with same CATH superfamily
5AC91 5GLVA 1VBB2 1OXCA 5GLUA 1GWLA 3MFAA 5GLZA 4E4SA 3WQ1A 1UQXA 1UY3A 1WBFA 4HKLA 2DVGA 1OKQA 3TOJA 4LQRA 4I0AA 3AVSA 3WUDA 2YBSA 4RR3B 2JB4A 2NN8A 2YGLA 3ZFEC 1Q43A 2IVIB 3SKJE 4IL7A 2JIGA 4Z82A 2JXAA 1MEC2 4Q4V2 3ILRA 3GGLA 2XBO3 1BZWA 2QZ3A 1POV3 2IXJA 3NAPC 2YU2A 3A22A 3HQRA 4AFAA 4N43A 4Z8BA 1C57A 3N9PA 2RM22 3ZYGA 2R071 2PHWA 1AR63 1CPMA 2P3IA 1HXS1 1JI6A 1VMJA 4K20A 4AEDB 2XKOA 3NV1A 1VBD1 2FDKA 5FXWA 4Q4W1 3VGIA 1DP0A 2BP6A 5LATA 3USSA 5APAA 1AYN3 1UN1A 1UU5A 3OBRA 4WVMB 3VBOC 3ZMOA 2JD4A 4IEVA 4AFBA 2ZOEB 4JGZC 5F5QA 4IGOA 3UGHA 5B2GB 2BWAA 4JCKA 5CVRA 4YVWB 4DXZA 1NYWA 4HOOA 1HB1A 2QDRA 3KGLA 4MOAA 3PVOA 2OPKA 4RS5A 2VOVA 1YIPA 1UWWA 1EY2A 2Y60A 2QQIA 1SACA 3JB8A 3OGSA 5HI0A 4AVSA 1O7FA 5KC6A 2X29A 3QACA 1CAUA 1ZYBA 3J7NA 2NZ9A 3VZJA 4XUNA 2JECA 3ZVXA 4RSUA 4LIVA 3DXTA 4LOSA 4W6XA 5I0UA 3J4UH 2ET1A 3FL7A 5DQ0A 5A7WB 2Z42A 3I8TA 1NCRA 3H50A 1H8TC 2XLAA 4GZ9A 4KGQA 4ARXA 3KWVA 3U1XA 4CDUC 5A3WA 2ARAA 3TN91 3B02A 3E97A 1UZWA 3RWKX 2HWE2 2TNFA 5FZKA 5C9AB 3THTA 3ZFFA 3FLTA 3KV6A 4D7SA 3CF6E 5G04L 3MIDA 4IV3B 5GZEA 3WHTA 5IK7A 1XOYA 3O0VA 1S4CA 2YPDA 3DL3A 4JRLA 1BYHA 2FDIA 2RDNA 1YYNA 2BQPA 2JKXA 3CJXA 4ZXEA 3PUSA 4Q0QA 5FP7A 2K2SA 4HSJA 4GH4B 3LPGA 5FP9A 1MQTB 4NIGA 3RMYA 4NN0A 2VW0A 1L7QA 1QNWA 4QGNA 4QQOA 3S7EA 4CCNA 2VH9A 2XJRA 2LRPA 2QCSB 3ZFEA 3H3ZA 3LQCA 2YB7A 4ZXKA 3TRSB 3WQ7A 1GU3A 1RHI1 4Q4X1 5CADA 1RL3A 2QQVA 5F39A 1YQ8A 3F95A 4GALA 1GZWB 3V0BA 2W39A 3LDBA 4YNIA 3NAPA 3BODA 4YZ3A 3FBMA 2X10A 1JH5A 2BEOA 1RUG1 3B00A 4YG3A 3GALA 2R0HA 5T5OA 1VAVA 4OHYA 3LPFA 4JKMA 4LR4A 1ACCA 3KHBA 5JAXA 4WM8B 5FYMA 4BWOA 3E5UA 3VBOA 4GMP0 2ID4A 3D6EA 4E4HA 5BNQA 1US2A 5CFDC 4DPNA 2WO7A 4COZA 2BBAA 4BQ1A 1DLLA 2IC1A 3A0NA 5FYBA 2WQ8A 3DN7A 4GQ7A 3T4VA 1AXKA 4XFCA 5DAQA 1TNFA 3Q8BA 4M00A 2HWC3 4QQPA 4F83A 3GXUA 1UF2C 1AUYA 4SLIA 5EJ3A 3WF4A 4DOUA 2PHRA 2R7EB 4OHZA 1RUD1 1F8VA 5I0DA 3R4DB 2W46A 1LCLA 1NY71 1B35B 2VQUA 3DUIA 4ARYA 2P2KA 4P9YA 3DYMA 1OLQA 1ND3C 1H8TA 3FN9A 2VAUA 1BMV2 3PUHA 1S0GA 4CDUA 1K42A 2XLGA 4BH9A 2VCAA 4K8RB 4L92A 3I2DA 3D5OA 2IWGB 3LDKA 2B39A 1EPWA 2VQAA 3K2OA 4QX2A 2XBO1 2H0VA 5FZLA 2Q1FA 4LE4A 3CDZB 2UU8A 3MV11 4RQPB 5FPUA 3MZHA 3AL6A 2GNMA 3THCA 1JODA 1D4M3 1TQ5A 3RJ2X 3RZKA 2BERA 4I0WB 5CISA 2JENA 1CAXB 3I2GA 2DCJA 2QUOA 2XG3A 2XJQA 4IV1C 4YG0A 5L73A 1SLAA 1SFPA 2D3PA 3CKHA 2R041 1W6OA 5FZ1A 4CVUA 5HXMA 1DQ1A 4FOYA 3I4IA 2OQ6A 4CEYB 5CA6A 5BV6A 5HXVA 3V56A 4JTOA 3EO6A 4R9BA 5EJZB 4QX0A 4GJZA 3VL8A 5IK4A 3KT1A 1DF0A 1O59A 1DCSA 1QJY1 4YLZA 1RUE3 4UFJA 3BALA 5EHDA 5JR7B 1AJOA 1PM7A 2WWUA 3BPSA 5EYXA 4DXSA 3ZYIB 3P3PA 1AHSA 3AYAA 3GYDA 4N7UA 1R1A3 3KT7A 1AR82 5FDBA 2HKXA 1ZX5A 1QQP3 1PGW2 4WM7B 2WZ8A 3LB9A 1LTEA 2MEV2 4QQHA 2YC2A 4AGGA 5FO8B 4XVHA 4FAGA 1Q56A 5K0UC 3GNEA 4R52A 3N9LA 2QTWB 1F5JA 4XFFA 5IK8A 1GZ9A 1Q5OA 3MEPA 5CFDA 2EXJA 2VTXJ 2NP0A 4ASKA 3MIHA 4K8FA 1JOBA 3MUY1 2FZ2A 1IS3A 1NKGA 4B4QA 2IVJA 1XNDA 3ZYFA 1NLQA 2B5HA 2GNBA 1UPIA 2Y6HA 3MYXA 5A3UA 5KHGA 3MW3A 2XJPA 5HV4A 4D0QA 4GULA 5EP9A 2WQZC 1ASJ3 3HR9A 4IE6A 3C7EA 1W6QA 5F5AA 4OI4A 1KGYA 1WLWA 2JDPA 2R062 2JDZA 4XJ8A 4CP2A 4DINB 4MGQA 4NHXA 1EUTA 1JZ8A 1ND3A 1R64A 2BW8A 4LBQD 4BQ2A 3LEMA 4YRDA 2DUOA 2AUYA 4A3XA 4JKKA 1POQA 5DAWA 4XUTA 2BGPA 3EHKA 1ZRIA 1PK6A 1ULPA 2BVVA 2DFCA 3E5XA 4CP0A 4DRRA 4DY5A 1OURA 4Q4Y2 2N7GA 5FZ9A 3IWZA 5T55A 1K12A 1W8NA 1GKBA 2GC1A 2Z4FA 4QQLA 4P9IA 1N1YA 2WFF1 1JYIA 3IDAA 1V9U3 2F4LA 1AR73 2XJTA 1OVSA 4IV1A 3VKMA 1WMEA 2F4PA 4AF9A 2D97A 1CZTA 3T30A 1XB9A 1UMHA 3ELNA 2FCUA 2X05A 5BNPB 5C7GA 5A3TA 2JDHA 1DYOA 3E1F1 3FWEA 2HWB2 1MZFA 1MVQA 2BTVC 4MXWB 3FUQA 1PX3A 2Q8CA 3APBA 1OC1A 4NHKA 1JBCA 3WDTA 1GZTA 2C5DA 3NV3A 5C8WA 2V09A 1FOD3 1RUH3 3LSDA 5GLTA 2IFWA 5A32B 3VDDB 1UYXA 2RDQA 3JU9A 1GOHA 2DFBA 2WJSA 1OMIA 3M2MA 3VHPA 5K0UA 3H8UA 4HKOA 3POFA 4R4ZA 3UJOA 5F1RA 5IAVA 1XNAA 5GALA 5EJ1B 3ZKYA 5KXEA 3T08A 3SXWA 3OOXA 5AFEA 4DNYA 4QKFA 3JZVA 4EZ4A 4MYEA 2JD9A 2PHUA 3WQBA 3CJIC 1R093 1G86A 3LGRA 1O3QA 2F6BA 3GHMA 4JDMA 2YHJA 1QWRA 1X33A 1D4M1 5LASA 1O3RA 4AYUA 1LOAA 4L97A 3ZXDA 3NRUA 4CEWC 2J42A 4M3CE 3RZZA 1YRZA 1ENSA 2RS33 4KH9A 4HLTA 1RUNA 3TEZA 1BVVA 5A80A 1CIYA 3GBGA 1OA3A 4YFZA 1GP4A 1AL0G 4R9DA 1IKQA 1SCSA 2LW8A 1FNYA 3TAYA 1DFQA 1RUI2 2JEMA 5HCFA 3HNYM 2EIGA 4MGZE 3HEIA 1RUE1 4RD7A 2ZBJA 5JR2A 1C8M3 4BHPA 4Q0SA 1AF9A 1TME3 1LU1A 2QQKA 2ZXQA 4FI9A 1YC61 5JIUA 1J84A 1W9SA 2A6ZA 1YHFA 3AFKA 1RINA 3FMGA 3K4ZA 3VD5A 4BIOA 4CP1A 2AH2A 1G7YA 1AL21 2XJSA 2JDNA 3MIEA 3QH7A 1M4WA 2RMU1 1PO12 3H3UA 3PTYA 2A6XA 4BJ0A 5LA9A 3RGBA 1YFUA 2VTXA 2GNTA 1QJEA 1VBB3 3WW1A 1DHKB 3N36A 4IUGA 2B8MA 1DGWX 3U4SA 2X5IB 4XDPA 3WZ1A 2FCVA 2P17A 2AGSA 2J1EA 2JICA 4H2AA 3ZFGB 4CU9A 3LF7A 3POBA 4YZ1A 3MIGA 1LHWA 2HWF3 2G9ZA 3CMGA 4YW4A 2PXJA 4I02A 4Q1RA 3ZXAC 2AEZA 1MEC3 4Q4V3 4QXBA 3K4DA 5J96B 1TVGA 1X8EA 3OCPA 5FYHA 3VDCA 1GQHA 4M3CA 5IVYA 3MLJA 4M4RA 1SFNA 4DXTA 3MW4A 2OYZA 1DQ0A 3ZYJB 1PVC2 1FMD2 2ZGTA 5EWSA 4XJUA 3H8OA 3T1LA 3ITQA 3N3HA 4CCKA 4QPGC 5L19A 5EQUA 4HMZA 4I01A 4FFFA 1DG6A 4P5YA 1JZ3A 4AVVA 1KFUL 1NQDA 4PIXA 2Q8DA 3CJIA 5FYVA 2D6PA 4LO6B 1ND2C 2E7QA 4EYUA 4FOQA 1Y9MA 4NAMA 5FY5A 1SZBA 5JOWA 4OCTA 1GICA 2IXHA 3K75B 5CFCB 1WBLA 4BE3A 5FY9A 2A3YA 4GWIA 1H2LA 1H6YA 3AVRA 3IIIA 2CY6A 3MIBA 4UW4A 5ANQA 1AR93 4F3JA 3HVDA 3T2QA 3AZWA 4CEWA 5AVAA 2EAKA 2LUWA 2PLV2 1XNTA 1AR71 3GHNA 3K77A 1A8DA 3OBZA 3MPBA 1WCSA 4IDZA 4P9JA 5KHHA 1G8WA 1MS8A 2B9UA 1VBC2 1PVXA 5LRRA 4IERA 5BNOB 5KXDA 3GCXA 1YNAA 1JU3A 1W8WA 2VBBA 3ZXFA 4R9AA 4TXWA 2E33A 2YC0A 2DCZA 1UMZA 4ZPIA 4OHXA 1JUIA 4AW7A 3L9JT 3O1RA 2WDBA 3WEZA 1RUOA 3ASIA 1PGL2 2Z69A 4UW3A 4Y20B 2HWE3 2BZDA 1HB3A 2FCTA 4IETA 5DAVA 2BGCA 5KWRA 1ZRDA 5LRSA 2WWSA 1W2TA 2ADEA 3ILNA 4L2NA 2HWC2 1LOEA 5IVFA 1JYWA 4OQ9A 1FX5A 3NJVA 5FPBA 3EYPA 1ENQA 1JYTA 2W08A 3AP5A 1GANA 3M3IA 4AAPA 1W2OA 2IZWA 5JZGB 2IXCA 2WKKA 2D93A 3WW3A 4DRVA 3KHCA 5HCHA 1IPSA 5A6QA 3RNSA 1IG3A 5DUXA 2E32A 3T1MA 4B4PA 2V5DA 3D8CA 1C28A 1I6XA 2I74A 4QPIB 3DCQA 3SH3A 4E9KA 1QJX1 4B8EA 2CGNA 3CQOA 1R083 5C5UA 1NCQB 1SQ4A 1UMIA 4OLLA 1MS4A 1YJKA 4G9SB 3FJSA 5FK7A 4E4DX 5C3SA 3WDYA 3P3NA 4JX0A 3O1MA 2PELA 3IIAA 1J83A 3WNKA 4ZU7A 1J58A 4HT1T 2RS31 1H4HA 1V0AA 4LKSA 4Q29A 1QH6A 4YM1A 3T0AA 5F3IA 1DYPA 3VKFC 4A41A 4M01A 5DUVA 4YW2A 4MXVA 4QPGA 5IWFA 3THPA 3WCRA 4NO4A 1I3HA 4PF5A 5FO9B 5JLVA 4XILA 3ZMNA 1AX1A 2ZGMA 1ND2A 3OPWA 4U2AA 2BBVA 1H9WA 3OYWA 1QMJA 2YV8A 4YVSC 4LXLA 4ATFA 1RUF1 3LEIA 1ENXA 1XQNA 3OGGA 3HBKA 2C9KA 3LSEA 5A3OA 4AVCA 2J1VA 4CCEA 1R1A2 1A8MA 3KMHA 3I3DA 1KDMA 4DY3A 3B93A 4ORFA 1NOVA 1QQP2 2A73B 5L9BA 5FWJA 3ACIA 3WHUA 1DQ4A 4YW1A 1VBB1 2V4AA 1SLLA 2JDKA 5FLJA 2JG9B 3UL2A 2WQ4A 2FHRA 2AREA 1YI7A 3I54A 5GZCA 3I2HA 4LBMA 2W91A 3RSJA 1SLTA 1UXZA 3WNNA 4LLOA 4HG6B 2DVBA 1D7PM 3MGUA 4H7LA 4PF1A 3PJQA 1JTZX 1OVPA 1S0BA 3VD4A 5KBFA 2FDJA 1CX1A 2JDUA 4U36A 3AC0A 2VMIA 2BFUL 2BU9A 5FZ3A 2WS92 4CCMA 3KT4A 3J26N 1OHFA 3SHRA 2RM21 2BNOA 3NO8A 3QH6A 1WMXA 4MGSA 5JOZA 1ASJ2 5T5LA 3BTYA 4F7ZA 2QDNA 4EROA 1CAWA 5FP3A 5FZ4A 1SDDB 2G4IA 4YYOA 1OA4A 4HONA 5T5JA 2AEYA 1PO22 4P9GA 1BEV2 1CIWA 4Y1UA 4UW6A 1VB2A 2W52A 5IJRA 4CCJA 3OSDA 2X09A 3A23A 2AACA 2A1XA 5IT6A 2I45A 2Q30A 2GH8A 4QB6A 3VBSC 5F2WA 2WZR3 3HJRA 1LU2A 2DVFA 5AFBA 2VMHA 5JXIA 2HH9A 3KLSA 4ES8A 4FFGA 4LA2A 3WG3A 5EZWA 3WR0A 4UI9L 2A3XA 2PN5A 4UBGA 3WV6A 2D5HA 4ZU4A 4PI0A 1V9U2 4M3CF 3KCYA 4J1WA 2OVUA 3D0JA 4KWKA 1U5ZA 3LA3A 1VBA2 1H1MA 2RS12 4LITA 1ULFA 1NX9A 1QJU2 2PAKA 4XJZA 1DZRA 3SITA 5C33A 2G9GA 3PL0A 4WVVA 1O8SA 2HWE1 1EAH2 4N53C 1WW6A 4Y22A 1S1AA 3VLBB 4YVSA 3SH4A 2DF7A 4QX5A 1BK0A 2ZEZA 4XIOA 1AX2A 2CDOA 2OKXA 1E5HA 4JC1A 1ZZ6A 4RYDA 3UKNA 4BK4A 4MG2A 2PA7A 4CUGA 2XJUA 2GU9A 3IBMA 3POGA 4UFIA 2YBPA 2CAVA 1F4HA 5CNAA 1IPJA 3C7OA 2D40A 1RMU1 1WCKA 1DZTA 2R063 1ZZBA 3K3OA 4XMIA 3NMBA 3RYRA 4NIDA 2WO2A 1SLBA 4MHRA 2YFUA 3ZSEA 1P8JA 1COV3 2GDFA 1M06G 1OLRA 4TLFA 2EVXA 1WZXA 3BVCA 4B7KA 1VRH2 1R092 5IFTA 2GMEA 4GMP3 1S0EA 3WF2A 1FNZA 4AEKA 4LULA 5F3GA 3JD72 2W1UA 5GLWA 1W6NA 1Z7S3 4COYA 3PIJA 3VZOA 1TMF3 1V6IA 3VKOA 1JZ2A 3N7LA 1UZZA 1ENRA 3POJA 4QX3A 5A6YA 1UIKA 4P9XA 3ZLIA 1FI2A 1HN0A 2FMYA 3WY6A 1PMHX 4PDWB 2BVBA 3IPVA 1B09A 1YWKA 3RRDA 1W9TA 1BJQA 1MPXA 3NSTA 3LAGA 4XE9A 3VUOA 4CCDA 4JDOA 2BWCA 3LEGA 4BOWA 2A6WA 4IEWA 1LENA 2AC1A 4QMAA 4W65A 3VBHC 3WP5A 4N43B 2GH2A 4XFGA 3WG2A 2RE9A 1D0HA 1ZZ8A 2GC3A 3PVEA 2JIJA 2W94A 3VBSA 1LEMA 4ES9A 4XIKA 5CIRA 4L0PA 2R1DA 4FP3A 4LUKA 1TME2 2WNUC 3DYOA 1LHUA 1YI9A 3M1HA 3H0OA 1W6PB 3NV2A 1CZSA 4AQ6A 1OT5A 1DQ5A 3AMHA 3B01A 3GF6A 5FREA 1HV1A 2XONA 1KJLA 2VZRA 3J7HA 5JUVA 1SPPB 1FV3A 4MSVA 5J36A 2EF6A 2EIEA 1IS4A 1H0BA 4RS5B 3S30A 2P4EA 3RZMA 1GNHA 4NIHA 1G9BA 5FYCA 4GB32 2VECA 4IE5A 1GR3A 1MS9A 3N9QA 4FCAA 4PBPA 1CPNA 3J7MA 3VV1A 5C3PA 5FRAA 4ZHNA 3O1SA 4O7XA 4AHXA 4JGYC 3ILFA 3BOWA 1XE0A 1CAUB 1HX6A 2HWF2 3FBYA 3FHQA 3M3EA 4N53A 4WBBA 4XQWA 2CSGA 5LBEA 4AI1A 5A3MA 2QQNA 1XPWA 1VP6A 1S0JA 4H7MA 5FKCA 4MUVA 3H7YA 1Y9GA 4CU7A 3FUOA 3H3LA 1NCRB 4QU2A 2Q8OA 4BMEA 2DVDA 5J37A 3OTFA 5FZ7A 5BUVA 4CDXB 3IB3A 5J3UA 5D2AA 4EN7B 4NPRA 4ZS2A 2D44A 1ZBE1 1W9YA 2VOXA 2G19A 1S0FA 1KITA 1F2NA 2OA2A 4HPKA 1W2UA 3ZFFB 3DEMA 3I3BA 2Q4SA 3B7MA 4DFSA 5BYNA 1N1VA 1W8FA 4X8PA 1C8NA 3PU8A 3W9AA 1RUI3 4W4ZA 1SHWB 1S0DA 4E2QA 2BOJA 1CQ9A 2RR11 2DBNA 3WP3A 4Q5OA 5A70A 3DPRC 1HJGA 4AZZA 2FDHA 4Y1YA 1YQ2A 3BTAA 1AR81 2DTWA 1AR92 2VJXA 4QX8A 1PGW1 2BOIA 3AP7A 3N9NA 4XBQA 3UESA 1ODNA 2MEV1 3DKQA 3JBG3 3ZFEB 4ZS3A 1HB2A 1PO13 1AYM3 3B3QE 3VBFC 5A6XA 3O1OA 3MLKA 4A45A 1AXYA 2ZGSA 2HWD1 4CU6A 4UAPA 5KR7A 3K46A 4UXAA 2VZOA 4AI8A 3V0BB 3CBNA 3KVAA 5FZFA 1OUSA 3NAPB 2HEVF 1RJ7A 3VBHA 3ZSJA 5FYYA 4O65A 3W21A 4CCLA 3BOPA 1KQRA 2ZS6B 4K1ZA 4PI2A 5JI9A 2Y6GA 5I8SA 4C90A 1HQNA 1W90A 5D8AC 2WNUA 4D3WA 3H42B 1K5MC 3SQOA 2RDRA 3VBOB 1UOFA 5JXHA 4NPMA 1W6MB 1YO8A 3AM2A 5IAXA 1NA1C 4I3GA 1WCUA 2BNMA 4JGZB 1GMMA 3HPNA 5C8CC 1PVC3 1FMD3 5FXXA 4BQWA 3OUIA 3V64A 2BNNA 1MVEA 2H6CA 3W58A 5LY2A 4BQ3A 4LMFA 3VZNA 4A7YA 3B5LB 2EXHA 3S7IA 1UU6A 2VBDA 5EV7A 1C1LA 3LIHA 4NIAA 3DV8A 2VO5A 4AG4A 1W99A 4JGYA 4C1WA 1R082 1JYXA 1D4VB 3WNPA 5DUUA 4Q4Y1 1VR3A 4Y5SA 5J1XA 1LJ7A 4WVMA 5L7OC 3VBRC 2FD8A 3O14A 1YJLA 3LD8A 1LHOA 1UO9A 1H8TB 2J1TA 2XLFA 3FFZA 5T54A 4A42A 4CDUB 2R0FA 1V6NA 4LHNA 2DDUA 2PLV3 5E1RA 1LR5A 2PHTA 4CTEA 4XCBA 4XUQA 1OQ1A 2VGDA 3GCWA 3M8LA 2YYOA 1VBC3 3NNGA 2BPA2 1J1LA 1O5UA 1GNYA 4YGCA 1LOGA 2HWB1 3NL1A 1VRBA 2OS2A 4HANA 2VNGA 1OQDA 3KCXA 3LZZA 5FO7B 3C8XA 1XJAA 3LE0A 5DAXA 4ZY9A 4LTAA 2D98A 1H1AA 1MACA 1H2MA 3J8F3 3VZKA 4X8NA 2DV9A 5FY8A 2CDPA 2FBEA 3FZ3A 3DPRA 3M3OA 5FQ0A 3UGGA 4Q0VA 4QHBA 2Y6LA 1VLNA 1C4RA 2HYKA 4XYXA 4XBNA 3JXSA 1W9WA 2QQJA 1E5IA 4JVAA 1QXRA 1XSRA 1NT0A 1EV12 5FMOL 3VBFA 5EIYB 4RQPC 2CU5A 3ZN6A 4EZHA 4IV3A 5DZFA 1SBDA 4AR2A 4LHSA 5LZ6A 1QGLA 4N9IA 2GMPA 1YIFA 5LK7B 3I7DA 1Q8OA 1VBE3 5FOJB 4YW5A 4LT5A 1UKGA 5FP4A 2XH6A 3HAGA 1XXNA 3PDQA 4XUOA 1XU1A 5KXCA 2W9XA 3VHOA 1MR5A 1PK6C 5BPXA 3JQXA 1N1TA 1W9FA 2A7AA 3MI8A 1PNGA 4UT5A 4KGGA 5D8AA 1V00A 2O1QA 1POV1 2V5YA 1K5MA 2I07B 1ZRRA 1V6LA 5I8YA 1ZVFA 5L36A 1NA1A 1AR61 2ZHLA 5CFDB 2PHLA 3RI8A 5A7QA 1RGSA 4BLJA 5C8CA 4KG8A 4QXCA 5AC92 1YQ6A 3KGZA 1GZWA 5HBAA 3OUHA 5JSRA 4Z92B 3ORJA 4RGAA 4JQTA 4C0HA 4ONUA 2WFPA 1XE8A 1AYN1 2EALA 2QE3A 2VUDA 4LHLA 4QHOA 5F32A 2JDYA 3A21A 1F35A 1PX4A 5GM0A 3NNJA 3AP4A 4YM2A 3W59A 2UYAA 1C1FA 3VD9A 3DXUA 3AJZA 4AHWA 1W6QB 4IGPA 1KFXL 4CUAA 4BDVB 1VB4A 2WZR2 3UGFA 4JRAA 2DU1A 5L7OA 2KR2A 3HQXA 2ZACA 2GP3A 3AMQA 1D2SA 4XXAA 3VBRA 3SCGA 1V6MA 1AX0A 1ZZ9A 1J3QA 1WA6X 4OMDA 1WD4A 3SKVA 5JPNB 1X9TA 4B4RA 3ZYPA 1HXS2 5LBFA 3OEAA 4HBNA 2GN7A 1EYBA 1VBD2 1OPOA 2Y34A 1PZ8A 1DDLA 1D0GA 3DECA 4CPBD 1DBNA 1PIV2 3OD4A 5FZ8A 4FP2A 4YSFA 2O14A 5GKAC 3NKTA 5IVJA 2Z2SB 2Y33A 5FMCA 4DB5A 1BVP1 1FYUA 1AZDA 1RUC3 2PHFA 2WL1A 4MH0E 4DUXA 1CONA 2BUKA 4HK8A 2HBUA 4HFSA 3KZ4C 2AYHA 2SLIA 3ACHA 4LE3A 2WS93 1MS1A 4XBLA 2ORXA 5H9RA 4OUEA 1FMD1 5FKBA 1CGPA 3SNMA 4BYYA 3R4SA 3DYPA 4RQPA 5LA2A 2K0GA 3TNQA 5F9TA 4KG0A 5E6HA 2ZGPA 2XUEA 3IAPA 3L2YA 3VZLA 1PO23 1BEV3 2YC4A 1COV2 3KSCA 1XYNA 3OGVA 4FPOB 4P14A 1LODA 5E16A 4YZ5A 3T09A 5IVBA 2VZTA 3ZIWA 1ZBA2 4EN9B 3MO4A 2J1RA 5GZGA 1Z7S2 3OPZA 4JAAA 5K0UB 3AP6A 1XNBA 5A33B 1SMVA 1TMF2 3ECQA 2VZ1A 4YWAA 3NNMA 4CP9A 5C70A 3V0AB 1WLDA 1T6BX 4IGQA 1HRV2 3ABZA 3R05A 3QLQA 3TEXA 2PLV1 3BKZA 1WD3A 4Q1PA 4M0NA 3BB6A 3ZN5A 2GP5A 1VBC1 4A44A 5FYIA 1VBA3 1CJPA 1VMHA 1F4AA 2RS13 2VZQA 4Y4YA 3SEPA 3ZOIA 3O0XA 2WO1A 3CNAA 4XCAA 1QJU3 3IDEA 2VPVA 1PGL1 2MPFA 3WNLA 1OI6A 4K7JA 2A70A 3P6BA 3WSOA 1WCQA 1EAH3 2XVKA 1QDCA 3U37A 3WXPA 5K7PA 3WW4A 3URFA 2HWC1 2YU1A 5LA1A 1UPSA 3T2TA 1QDOA 2YUEA 4LO7A 5F8PA 2ZKLA 3G6JB 1JXNA 1NLRA 1RJ8A 4O61A 3I3MA 1RUG2 1J59A 3EMRA 2JE8A 4Q26A 4AI3A 4E8CA 3U78A 3CLPA 4IEUA 5HCBA 3VZMA 1H4GA 2W0XA 4OI1A 1HB4A 5FMOS 4AI2A 1KD7A 1UKRA 2QQWA 3ES4A 5H9SA 4AEJA 2DU0A 4AXOA 5J09A 1YCIA 1F15A 4YW7A 5TSWA 3RDIA 4IE0A 4QGLA 1RITA 1VRH3 1BHGA 4LBOA 1OF4A 3G7DA 4YGBA 1IQDC 2BYVE 4IE7A 3ZO0B 5LA0A 3JD73 4HL0A 1CX4A 5GZDA 4CCOA 5F3CA 4XF4A 2Y6JA 2XUMA 1ZNPA 3ATGA 1O3TA 3EB7A 4Q27A 1GOGA 4B1MA 1FATA 5CAZA 1UY0A 1VIWB 1X82A 1RUD2 2K9ZA 4XQ4A 5ISLA 1LHVA 1OUXA 4PHZA 4R4XA 3RYKA 1A34A 1DQ6A 1L7RA 4KBZA 3NW4A 1OKOA 4LOTA 4OFGA 1XE7A 1PNFA 3SEEA 4C91A 2WZEA 1OPMA 4HVOA 3U11A 3H9AA 3DKWA 2IUWA 5CZKA 1LOCA 3VKLA 2B45X 1JN2P 5F5IA 3O5SA 5BNPA 1YLLA 4MGYE 4UFHA 5FZ0A 2X5IC 3I2KA 3OY8A 4N8MA 4O9EA 2LROA 1SBFA 2NMNA 5T5PA 3ZFGC 1R1A1 4BIFA 2HJIA 3AB0A 5ABJC 1QQP1 2AR6A 3B9CA 4NUBA 1I5PA 3CJIB 3A4UA 2XQXA 3JBG2 1FPN3 1HLCA 4LBQB 4CXWA 2RJKA 1AYM2 2DTYA 2I2SA 2C24A 2R042 4CUCA 3F2ZA 4NRQA 2YBKA 4NAOA 2E31A 3UKTA 3VD3A 1NZIA 2VMEA 4AQ2A 3AL5A 1YFWA 4ZKTB 4PLOA 4W6WA 3PMEA 2EAAA 4GB33 1OH4A 2JG8C 2OUHA 3CL1A 4CPBA 4PJYA 4CEWB 1NAEA 4CRQA 4XOGA 3POSA 3PLQA 1ZZ7A 4ISRA 2RVAA 1WLCA 2ORZA 4COUA 1PZ9A 4EJRA 1AVBA 5LBCA 2XWJB 2NMOA 1F5FA 1LAJA 4LUMA 1MS0A 1OOPC 4NJ4A 4NR1A 4GA9A 1NZCA 1DGLA 1QXJA 2ILMA 4OUSA 2JKBA 1ASJ1 2E51A 4IEPA 3ZN4A 4D6SA 2XOMA 4V1PA 1U5YA 3BU0A 3GDBA 2C9AA 4GJYA 5FYZA 4L99A 1PO21 5EPAA 5FY1A 2IXLA 4PIYA 3VDBA 4HZFA 1E5SA 2D5FA 2ZGKA 1DGWA 3AKSA 4EQVA 2Q0AA 1RUJ2 4L11A 3TYJA 5A1LA 1X9PA 4XZUG 4E27A 3ACGA 2DBIA 2LTNA 4RHV3 5H9QA 3WDVA 4OI2A 4XXPA 2ZX3A 1XNCA 2ZHNA 1FV2A 2Q8EA 3MDPA 2D6LX 1CAVA 4K3UA 4EWDA 1RVF2 3UETA 1WW7A 1C5IA 5GZFA 5I0TA 3OBTA 3O1VA 4HVRA 2CGPA 1V9U1 4LBKA 2GSYA 1IZ3A 4GD4A 4ASMB 3U10A 1VBA1 3ALQA 4QXKA 1W28A 4XF9A 2RS11 4MHUA 1GP5A 1N47A 1QJU1 2Q1ZB 4AVAA 4S2DA 1QOSA 1SLIA 5FYTA 5HCAA 5FPLA 2VY0A 1JYNA 3WT3A 4AAXA 2B9VA 1EAH1 4DQAA 4URAA 4FO9A 1QJFA 4QD2A 1GP6A 3J8F2 3IMNA 1VPHA 2CWMA 2WT2A 2X5IA 4YGDA 2CWSA 1W0OA 2VZPA 2ZKNA 4QPGB 1FOD1 1Y43B 3LA7A 5FZOB 3ZFGA 1RUH1 5CB7A 4BZ4A 5I0SA 2CTVA 2DCTA 4ZZ8A 2VZ3A 2WFF2 5ABJA 5C6CA 1L7LA 2UYBA 1NCQC 3PTRB 3K48A 4A6SA 2J7MA 4IEYA 3PMSA 4QDRA 5JVVA 2O8OA 2K46A 3VBUB 3WF0A 5B4NA 3OYWB 2ZMNA 1HRI3 3H7JA 1BBT3 4I09A 1J3RA 2O0OA 1X36A 3AXDA 2VCBA 3P1IA 3E6BA 3OD0A 2W47A 4P5HA 5EYYA 3RMXA 1VBE2 3O12A 4QKDA 3OG2A 4BMBA 1GFF2 4Z07A 3VHRA 2JG8A 1L3JA 1R091 4DXRA 5FXVA 2QQMA 2B4KA 5C5TA 1TEIA 1ONAA 2R30A 3JD71 4I2OA 1MZ6A 2GALA 5C4WC 3WD5A 1A6CA 1APNA 1OOPA 1ZRCA 3UJQA 1YUDA 2XHKA 3AZZA 1D2QA 4FQZA 1F9KA 4RGGA 3FHAA 4FPYA 2VVFA 1QY4A 1WW5A 1CR7A 2E63A 2YFZA 1O5LA 3KQRA 4Y1XA 1CZVA 5F37A 1QXPA 3PHMA 4JQRA 3ZR6A 1UZVA 3HT1A 1O4TA 3VDAA 3E6CC 1S55A 1HJFA 5FIXA 2OT7A 1GWMA 1YFXA 2VZVA 2QQOA 2C26A 3K51A 1CAWB 4IQPA 3Q8EA 1C8M1 2WA4A 1TME1 4E2GA 4OVEA 1DQ2A 4XFAA 3HOBA 2EA7A 2VMCA 2VUJA 2VW2A 4YGEA 4A6OA 3LOIA 1W39A 4C0BA 3AKRA 5KC5A 1VALA 1OH3A 5DG1A 4Y20A 2P34A 1JZ6A 1KS5A 4L8QA 4WVWA 1EV13 2D6MA 3B69A 2W5FA 2VQ0A 2ZGUA 3SCHA 2OQ7A 4PQ9A 4HSLA 4GB31 2H6BA 4AHZA 3OGRA 3ZXEA 1NG0A 1WKYA 1TE1B 4JHTA 3POYA 1REDA 1X8MA 2HWF1 3GBFA 4HXCA 2VD7A 4UYBA 1GUIA 1VMFA 5C3RA 3RZGA 1ST8A 1RXGA 4QWNA 3VKNA 1MEC1 4Q4V1 4CDQC 4Q2FA 1OBNA 1RUC2 3BPZA 3SH5A 5FOBB 4BISA 5IFPA 4J6GA 1OSGA 1ULCA 2VVDA 3CZJA 2ARCA 2X8KA 2DWRA 4AE2A 3I2FA 1OQEA 1NCQA 5BNNC 2JWPA 5FBJA 2HEYF 2RMU2 4AK3A 4QQ2A 1V6KA 1JOJA 2YROA 3FX3A 3KS7A 3NJXA 4Y22B 3FLRA 3AYDA 2ETEA 2WNVC 4YVSB 5AC93 3M70A 2BDRA 4V2WA 4P9WA 4TSVA 4PBOA 5L9RA 3ZXLA 2VUAA 4FFIA 3PJYA 1KEXA 2JDMA 4P08A 1HN1A 2ZMKA 1T2XA 4IXLA 1UU4A 1UNBA 1CVNA 3BUCA 1FXZA 1DU3D 4FTEA 2A6VA 2H0BA 1W0NA 2P5BA 2VXRA 4TZDA 4CDWC 3PURA 5C4WA 2VUCA 3HWJA 1GOFA 5JXJA 4B1LA 4XF1A 3ZSLA 4DEVA 2QJVA 4YM3A 4RFT0 4A4AA 2V72A 3R4UA 2NYYA 1AR91 1U12A 1SCRA 4W8JA 1HXS3 3ZXGA 2ZEYA 1VBD3 3U75A 1A78A 1W6NB 1RYYA 5FUNA 4CZSA 1PIV3 3Q8FA 4KNCA 2P6HA 2Y26A 4WZFA 3ZYRA 2ZGLA 2PHDA 4PCRA 3IPVB 1UY4A 2JG9A 3CEWA 5AVPA 4BCUA 1GSLA 1QJZA 3KVBA 4AGVA 2XR4A 2WC2A 1KDKA 1UOBA 4NVPA 4GKYA 1N1SA 4SBVA 5FZGA 3N35A 4Y26A 3W20A 4AFMA 4NWVA 5KHJA 5JDBA 2XQRA 1O6UA 4YM0A 4JHZA 3VBSB 4OHVA 3K3NA 2X53S 2XL9A 3CO2A 3DGTA 3KV9A 2RS52 4PDWC 5LBBA 3HQUA 3PUQA 1N3PA 1R081 1ZBA3 3FLPA 5IVEA 1ULOA 3C7HA 1JOPA 2WBKA 4QX7A 5CYYA 4PIZA 5JIAA 4CDQA 2Y8KA 4NHLA 1W3XA 3OEBA 1O8PA 4BPZA 4UW5A 5T50A 3GZAA 1H9PA 3LA2A 3TEYA 2CL2A 1HRV3 1LHNA 2OZJA 2QNKA 5BNNA 1WCDJ 4Q8LA 2VE1A 1Y3TA 5ACA2 5DABA 2P1BA 3RYPA 1U0AA 4K21A 4N53B 3I49A 3WG4A 1VAKA 3AJYA 2WNVA 3W5NA 2J1UA 3BYWA 1O91A 4UF0A 4YG6A 4EE2A 1OF3A 3QOPA 3UV9A 3I2OA 2QQUA 1IQAA 1YFYA 4AL9A 2R16A 5BY5A 4XUPA 5CKMA 4CDWA 2XVLA 1AJKA 4HETA 1UX7A 3NKGA 4JDNA 5FFOC 3T4HB 2C4XA 1IGOA 3V65A 4EWEA 1OD3A 4HPKB 2GC2A 2ZJCA 2YZ4A 4MGIE 4OMCA 2ERFA 2QQLA 1LGCA 4RR3C 2GZWA 3PVBB 3TBDA 4D6RA 4LBNA 1RUG3 5LEKA 2JB8A 1FPN2 1S0CA 4L9BA 4A7ZA 1JZ5A 1EV11 4A3ZA 5FBZA 4DUVA 2ATFA 4UFMA 4QT6A 4PLMA 4Z2WA 1HQWA 4XFIA 3WQ0A 2A5ZA 1ULEA 1WWYA 1LESA 4KI5M 5FZAA 4LJHA 4LORA 1BMV1 4K9SA 1GNZA 1H8VA 2VU9A 4QM9A 4AEDC 4FPKA 3B94A 4LK7A 5DDJ2 1KXGA 1U5IA 3WNMA 3HNMA 4YW3A 3ZPOA 3Q8AA 4FPEA 2IXIA 4ET7A 2P3YA 1DIWA 3PUIA 5HV0A 3NVCA 4MV2A 2WR9A 2BFUS 1V6OA 3USUA 2UWBA 5FTTC 4YVWC 3AKPA 1RUD3 2VULA 4OULA 1UYZA 4HN1A 3KV5A 4LKDA 4UFKA 1W8UA 2WNUB 4XABA 4JV4A 1UCXA 1XU2A 3T2PA 2EXIA 4KU7A 5FPXA 2ZX4A 4PDWA 5E8AA 2SBAA 2VMDA 2WAAA 4YZ4A 5FZCA 3NWKA 5FZDA 4RHV2 5FUIA 4BA6A 1K3IA 2WZR1 1NE6A 2FMDA 1Y7BA 3MHZA 4GWNA 2LM3A 3SC7X 2E53A 2MHFA 5DG2A 2OUJA 4EN8B 1UY1A 4NOTA 1CN1A 1W0PA 4FOVA 2Y6FA 1JZ7A 3D3AA 2TUNA 3K4AA 3HN3A 3KM5A 2P3KA 5A3NA 1ULDA 4JGYB 4UOJA 3H1WA 5C9AC 3ZPYA 3HNBM 2R043 5DZGA 3S6PA 5A3LA 1W6PA 4FQ4A 4IV3C 3BN6A 4ZZ5A 1GWKA 1PIV1 4LO8A 1N3QA 3AKTA 4LNVA 1Z78A 4W50A 2VMFA 3H1MA 4XFBA 2ZGOA 1C5HA 3I59A 4FSJA 2QBXA 1SPPA 2D6NA 5FY7A 3BIEA 2FDFA 2VQTA 4M4PA 1QJY3 4GH4C 4NHYA 3ZSKA 1W8OA 4FBFA 3IM0A 1MQTC 3JCIA 4XPVA 2GAUA 2J1AA 2KXLA 4XHBA 1Y9QA 3EXUA 4RR3A 4AQSA 3FFQA 4N7IA 3RWNA 3VD7A 4HKWA 3O1UA 2WABA 3T2OA 5JMCA 3PU3A 4Z1VA 1SEFA 2E7TA 4XACA 2R061 1QEXA 2VBPA 3ROUA 2O8QA 2BV4A 5FZ6A 1HRI2 4D6QA 1BBT2 1MS5A 2D3SA 4LIUA 4DIQA 1F31A 1QOOA 1TG7A 3DPRB 5FQ0B 1COV1 4CDXA 2WYFA 1ZBA1 3MICA 4GMP1 1RUJ3 3E5QA 1WMDA 4ISQA 4NRMA 2OPWA 4OZXA 3UK9A 3FHIB 3N9OA 3ZM8A 4AEDA 5CU1A 1Z7S1 3VBFB 2WLPA 5D21A 5CBLA 3ZN6B 4WM8C 3W5MA 1TMF1 3BTZA 1RVF3 2XGXA 1HRV1 2VG9A 3RZJA 4X6RB 2CHHA 4IEXA 4N90A 5ERLA 2ZPXA 1S2BA 2WLQA 3N7JA 3GM8A 4XJWA 1DZQA 4YVWA 3ZX7A 1WUVA 3LEKA 1RMU2 4FOWA 5LB6A 3NJZA 1H2NA 4A7KA 1NUKA 2ZA9A 4FXGB 3X29B 1BLZA 3T3YA 2WNOA 2VMGA 5D8AB 4QAWA 4JZRA 5F2SA 1K5MB 2G9FA 2D6OX 1NA1B 5IYYA 4QU1A 4WVZA 4EWAA 5C8CB 2VCMA 2ZHKA 2RJLA 4OZOA 1B35C 1VJ2A 2YPJA 1LGNA 5A7WA 5F5CA 1G9DA 1W6OB 2J22A 4H55A 2CAUA 5FWEA 2WWJA 1XYPA 4IEZA 2JE9A 2PHXA 3GJBA 2RJ2A 3ZDVA 2WFF3 1Q8VA 4TLGA 2FZ1A 1W06A 2Q1MA 4DO0A 3OJBA 2NLRA 1UYYA 5C9AA 3I2JA 2C0ZA 4KMQA 3MUZ1 1YXWA 2DCYA 2WRAA 3PVNA 4D94A 2D43A 5L7OB 3OBAA 3VBRB 1W6MA 2QVSB 2XL7A 4Y1ZA 5FPZA 4JGZA 5CG9A 1W8TA 5F6LB 3AXEA 3AKQA 5IVVA 1WMFA 5K4LA 5K9YA 5LWBA 2WA3A 4IEOA 4W6YA 1ALYA 2Z5WA 4GH4A 1G9FA 1BXHA 4LBLA 1O3SA 1MQTA 3AMNA 3WDUA 4CEYC 1JW6A 4E4ZA 2VOWA 3ES1A 3FE5A 4GWMA 2VOKA 2ZGRA 2ZZJA 4G3YC 2EXKA 4IEQA 5DXDA 4H3WA 2YXSA 5IVCA 2CYFA 4R8HA 2PQQA 3KB5A 4JTNA 4RFRB 3R0RA 3D0SA 1SG3A 4N9HA 4IW3A 4URTA 2DVAA 4HK9A 1GYKA 3JQWA 2XDVA 4COVA 1JYVA 4WM7C 4QGMA 5IUQA 5JXGA 2VC9A 1RUI1 3TB0A 4D8MA 1Q3EA 2ZX2A 4Y33A 2KM2A 1I9RA 4AFDA 2PMWB 4WM8A 5DN2A 3POIA 4XQDA 5A7NA 4J25A 5CEHA 3T0BA 1VAMA 5FUPA 4XTPA 5E89A 1ULGA 3O1PA 4XZPA 3MFCA 1ND3B 5FMBA 5DUWA 3C3VA 2QQPA 1AXZA 1W04A 3JBG1 2R072 5A6ZA 4LO5B 1PO11 1AYM1 1ZBE2 1TNRA 1PK6B 2VNOA 3AMPA 4Q4W2 3R6SA 3WVJA 1W2AX 2E6VA 4LPLA 3WW2A 3WNOA 2D7FA 4CP9B 1EP0A 3OF1A 4FPLA 3RZHA 2XWBB 3VHNA 3N4MA 1W8ZA 2YMZA 5LK5A 1I5ZA 1EPZA 3GZEA 3RI9A 5LW9A 3ZIXA 4OUMA 2RR12 1POV0 2W95A 1B35A 1W3VA 4IV1B 1GV9A 2XXZA 4NE9A 4UFLA 3KF5A 3MIFA 4YFWA 1U5XA 3EJKA 2Y6KA 4A2UA 3WF1A 2QZ2A 4LO4B 2WZPP 1AL23 3IDBB 2DUPA 3N7MA 3NQHA 2RMU3 1PVC1 5FZHA 2VCCA 1XRUA 1IS5A 4QDSA 4B29A 2HWD2 4HVQA 2HLEA 5L9VA 2ZEWA 2Y64A 3TEWA 2KA3A 3AX4A 5I93A 4XAEA 3AP9A 4XDQA 5CKQA 3UKVA 2VTFA 4D69A 4EN0A 2WYSA 3Q9OA 1JHJA 1UOGA 1RUJ1 4G4FA 5DPNA 3TN92 1CAXA 1PMJX 1LKNA 3PUAA 2VR4A 4MVTA 1UAIA 1CWPA 4LA3A 4BXSV 3NNFA 1PZ7A 2WT0A 5BNPC 4CEYA 1RVF1 5FLIA 1BQPA 1DGRA 5FY4A 1NLSA 3ENRA 1NXMA 4XURA 1CESA 1T6GC 1ZZCA 1UYPA 4AWDA 2W92A 2WN2A 4FPFA 1WA4A 3H1YA 2ADDA 3LWCA 1Q8QA 3AFGA 4XTMA 2XKPA 1XYOA 2XJVA 2NPIA 3P5BA 2D3RA 3MPPG 4P02B 5H9PA 2ET7A 2YG0A 3A7QA 4QKNA 4WM7A 3VDDC 2A71A 3M4FA 4Y4RA 1RHI2 4Q4X2 5LCWL 1ZM1A 3UT0A 2JJ6A 2DURA 3RQ0A 3J8F1 5IK5A 1LGBA 4HN0A 4K40A 3RZLA 3ZYBA 1QF3A 1UIJA 4QX1A 3IT8A 4XETA 2JX9A 4QKBA 4BU2A 4GIQA 5JPMB 3ME2A 5FPAA 3WF3A 4CCCA 4IE4A 3U14A 2OIIA 3IDCB 2ES3A 1GBGA 4AFCA 4C8DA 2CNAA 4CSWA 1UW8A 4V2VA 4BQ5A 1MZEA 1JZ4A 4D7YA 4CU8A 5KHKA 3ZXJA 1RTVA 4DZGA 3AZXA 2ZABA 5FYSA 2J1SA 3OY8B 4DS0A 3RG0A 4D7TA 1VBE1 1WGPA 5JCTA 1W8HA 2RHPA 2ZCWA 2RS53 4TN7A 2TEPA 4BXFA 2WUHA 1LNSA 4LK6A 3B9IA 3CZUA 2R1BA 5FR3A 4YW6A 2E26A 2EIBA 4QPWA 2PFWA 2ZGQA 3MLLA 3KCCA 4QXHA 4FFHA 4XFHA 5JMOA 1ZA7A 5J48A 1KS4A 4BQ4A 4LBJA 2ZGNA 3GJAA 2B42B 3IZOA 1OFSA 4YPJA 4XDOA 5ACA3 1MS3A 2UY9A 4QPYA 2VNVA 5A33A 2C6SA 1NY72 4RL7A 4X6QB 3V0AA 4Q8KA 4FXKB 2VW1A 3AYEA 4S2GA 4AI9A 4Q0UA 2W1WA 3KQ4B 3C7GA 2Y0OA 3OPTA 3AZYA 3CIHA 4M3CB 5JSPA 2HYXA 1QJX3 4XHXA 2NQYA 1LEDA 2GN3A 5ANNA 3RPQA 1CD3G 1S0IA 4LEJA 2XBO2 3C2UA 4OQ8A 1W03A 4E2SA 2ZEXA 2LALA 2WN3A 1QH7A 2GC0A 3NV4A 4QM8A 5IHRA 4DMIA 2WAOA 1NQJA 1US3A 3RFRA 2BJSA 1DGRN 4MXWA 5A7PA 1AR62 1IG0A 4QHZA 3J7LA 4MX3A 2BRTA 4H14A 4XC9A 1QKQA 4NIIA 4OYUA 5C71A 3WNXA 4BB3A 1GZCA 1O4YA 1QNYA 1AYN2 4NHMA 1CAVB 3WX5A 3UNPA 3S57A 5A32A 2IFRA 1BK1A 1UZYA 3HMYA 1EUUA 3VDDA 5FZBA 1OFNA 2AENA 1NXD1 3AYCA 1SLCA 1HDKA 3A0KA 1LULA 2PYTA 2VL4A 5DDJ3 1PM4A 5A3PA 1QHDA 1QJY2 1LB2A 1UXXX 1RUC1 1RUF3 1PGSA 3LDRA 2EIDA 2VVEA 4AEMA 5E88A 2WS91 3IKWA 3J9SA 4PT6A 5FZIA 5FP8A 3I97A 3ZXKA 4MADA 4PLNA 3O1TA 2AZ5A 2NM1A 4WV8A 3ZR5A 1PMIA 1KRIA 3LOBA 3M7AA 1LRHA 2WIIB 4FPJA 4AGRA 1SFYA 5CFCC 2G1MA 4OI0A 5K8SA 2ZAHA 1BEV1 5FCCA 1J1TA 1SDWA 5ABJB 5FLHA 2W87A 1BKZA 2UY8A 2XMLA 5F3EA 3UYJA 3MBWA 5C3QA 5B4XA 1W05A 3JB4C 4LLFA 3E6DA 5BNOC 5FZEA 4K6BA 5JOYA 3O7OA 4TTGA 2DYCA 2W1QA 2E7AA 4KL1A 3WP4A 1REFA 3BCWA 3H8XA 3LKJA 1QU0A 2DCKA 3EQEA 1BCXA 1UD1A 1LOBA 2ZZQA 1Y4WA 3ZDSA 2RM23 2JG8B 2Y0IA 2YGMA 4DEQA 3LFMA 2UWCA 4FPCA 1K5JA 4F8AA 3GBWA 4M0HA 1OD5A 4FTSA 1N3OA 1OOPB 2ZX0A 1J3PA 4Y24A 1QIQA 1Q8PA 3LIGA 4J1XA 4LBQA 2RG4A 5A1AA 4KU8A 3VBUC 3U4XA 5JI7A 1S2EA 2GNDA 2XB6C 3OGJA 4MGKE 5JZGC 1UZ0A 1G6NA 4GKXA 1XSQA 3CHXA 4MO3M 2CV6A 4QPIC 2BGOA 4Y3OA 3D4KA 4FPGA 5A7SA 1JS9A 1H30A 1JMUB 1ND2B 4KBBA 5IATA 3KV4A 3TNPB 3BIWE 3BU7A 2OXBA 4RGKA 3WDXA 1RIRA 5DAPA 3S5AA 2F17A 4Y5TA 4MLOA 3LCPA 1UOJA 4UWDA 3FC0A 2RS51 4Y5Z0 5M0TA 4LKFA 1S2KA 4AOCA 1XC6A 3QBQA 4LHKA 1VRH1 4BM8A 4XAAA 2Q5TA 4ASLA 1IHMA 2A6YA 4EV0A 3N9MA 4QB2A 2ZHMA 2HEWF 1UY2A 5F6KA 2D6KA 2W2IA 3SCFA 4EN6B 2P37A 3M3CA 5FPVA 1NE4A 1Z0HA 5CG8A 5HPOA 2LS6A 2P3JA 3WG1A 5ACA1 4I0BA 2C1FA 3MW2A 1HQLA 3NNLA 5T52A 1RMU3 2PAMA 3ST7A 3U0ZA 1MZ5A 4UBHA 5CFCA 3ZKUA 2ZTNA 1HKDA 2R49A 4P9LA 3ON7A 5FK8A 2OZ6A 2VM9A 3ZSMA 4NPLA 3VB9A 5J7MA 5I8TA 4S2HA 5DMYA 4CYDA 3KD4A 2V4VA 3MF6A 4GXLA 1GQPA 2JG9C 2OW4A 4AVTA 2RDSA 4ITCA 5BNOA 5FAXA 4XF3A 3O0WA 4XJ9A 1D4M2 1ODMA 3H8RA 1LECA 1UL9A 3HD8B 4BLIA 5J98B 2JE7A 3KF3A 1FPN1 3VN4A 2ZMLA 4CUBA 1JHNA 3LFIA 4OHWA 2PTMA 3AZVA 3QD6A 4XF0A 5C4WB 1X50A 5FZOA 1PHMA 3WUCA 4YARA 4FAHA 1YQCA 5FJHA 4WZCA 5JSOA 1G9AA 4FVVA 4CXYA 3POEA 4Y1VA 2WT1A 1H6XA 5DZEA 4AQTA 5LY1A 3HBZA 1X7NA 3BGAA 4B7EA 5JOXA 3VBUA 5DDJ1 5JZGA 1SBEA 1GLHA 3AK0A 5G05L 1RUE2 4NRPA 1K45A 2EICA 4KWJA 2GMMA 2VZUA 3M3QA 2A75A 3D82A 1WLTA 5C3OA 4ZU5A 2E9QA 3U07A 4KWUA 3EBRA 4NMIA 4LKEA 3RS6A 4QPIA 4COWA 2UWAA 3I3EA 3WCSA 2YY1A 4I3PA 4I30A 1AL22 2XVGA 1IPKA 1Q8SA 5A7OA 1E5RA 2PQSA 1RXFA 1RC6A 2UURA 4ATEA 1JYCA 2ENRA 3CU7A 2XPJA 3IMMA 1URXA 4O9GA 3MF9A 5T3NA 4ZONA 4RHV1 1HV0A 5SV5A 3DF0A 2TBVA 1LOFC 2ZX1A 3N7KA 3GZUC 4AVBA 3WDWA 4MGTA 1V6JA 1IOAA 3INAA 4P00B 2R6QA 2V73A 1RB8G 2ZAAA 5FXZA 2DUQA 3I3QA 2PAEA 2R073 3WINE 3Q8CA 3ZYHA 2WINB 3HT2A 1ZBE3 2W3JA 2B7YA 2YDEA 1FAYA 3SISA 4IESA 3POWA 4Q4W3 4CDQB 2XHNA 3S0MA 1FT9A 2FDGA 5FV3A 2A3WA 1OLME 3BI3A 2WO3A 2JDAA 4TWTA 5BNNB 3ETPA 4YZ2A 1DYKA 2R32A 2RV9A 4B3NA 1STMA 4XW3A 4CA9A 2RR13 2WNVB 4XMAA 2HBTA 3AMMA 1CJDA 1V70A 1IS6A 5I0RA 4UF0B 5D1IA 1AR83 3SLIA 1YEWA 3JUUA 2MEV3 1AR72 1HIXA 4BK5A 4R9CA 4RN5A 4CDWB 1R1ZA 1HRI1 1YQ5A 5FJKA 2HWD3 1BBT1 1W2NA 2QFEA 4MZUA 4NROA 3T0DA 1G9CA 1C3HA 3ACFA 4DUWA 1HW5A 5I91A 4FTBA 2ARXA 4S2FA 3THDA 3TN93 4CE8A 2MNGA 1REEA 4KQ7A 4KWLA 1H1IA 5FMDA 3NJYA 2VZSA 1ZA4A 1ZRFA 4RA0A 1FOD2 3HIFA 3GZTB 1RUH2 2QKDA 4QDQA 2FQPA 2WNEA 3C7FA 4K1YA 4N43C 2KD7A 5GJ6A 3PIGA 4GAZA 2VNRA 5F7UA 2VXJA 4INDA 3OUJA 5CKNA 2W1SA 1VE0A 5BXXA 1ZREA 3ETQA 2WSVA 4BQYA 1OLMA 5EXOA 2B46X 1JU4A 5EFUA 2ARBA 4TYSA 1H2KA 3OB8A 2P6CA 4CXXA 3RJRA 1QJX2 3USUB 1QOTA 3TWIA 3BTXA 1RHI3 1LOFA 1E57A 2CGOA 4Q4X3 1O4ZA 4QB1A 4Q4Y3 5LEJA 3QCWA 1JUHA 4RS5C 5KXBA 3I2IA 4GWJA 4Z2AA 4META 5FYUA 3ACLA 1OA2A 3VL9A 2RS32 4NWWA 5JWPA 1KJRA 3IAQA 4PQQA 3PNAA 3HN1A 4XEZA 1NCRC 2OX0A 2Y38A 5KHIA 1I1EA 3RVHA 2HWB3 1UX6A 4CDXC 1TZOA 3WLUA 1GQGA 3SMHA 3MV01 3L2HA 3S5QA 4JKLA 5SV8A 1C8M2 4AHYA 4E8DA 4Q0PA 2IXKA 1RUF2 3WP6A 3ZFFC 1XBFA 5FZMA 1IKPA 1WW4A 1DLCA 1XNKA 5FY0A 2WSUA 4BQXA 4AI0A 5IW0A 1A3KA 2L9LA 3VBHB 2VOTA 3WOGA 4C1XA 5A1FA 2Z79A 3IN9A 4FPHA 4FT8A 2W68A 3I59B 4XJAA
chains in the Genus database with same CATH topology
5AC91 5GLVA 1VBB2 5GLUA 3MFAA 5GLZA 4E4SA 3WQ1A 1WBFA 4HKLA 2DVGA 1OKQA 3TOJA 4I0AA 3WUDA 4RR3B 2NN8A 2YGLA 3ZFEC 1Q43A 4IL7A 4Z82A 2JXAA 1MEC2 4Q4V2 3ILRA 2XBO3 1BZWA 2QZ3A 1POV3 2IXJA 3NAPC 4AFAA 4N43A 4Z8BA 1C57A 2RM22 3ZYGA 2R071 2PHWA 1AR63 1CPMA 2P3IA 1HXS1 4K20A 4AEDB 2XKOA 3NV1A 1VBD1 4Q4W1 3VGIA 3USSA 1AYN3 1UN1A 1UU5A 3OBRA 4WVMB 3VBOC 3ZMOA 2JD4A 4IEVA 4AFBA 2ZOEB 4JGZC 5F5QA 5B2GB 2BWAA 4JCKA 5CVRA 4YVWB 4DXZA 1NYWA 2QDRA 4RS5A 3KGLA 3PVOA 2OPKA 2VOVA 1YIPA 1EY2A 3JB8A 5HI0A 1SACA 4AVSA 1O7FA 5KC6A 2X29A 3QACA 1CAUA 1ZYBA 2NZ9A 3VZJA 2JECA 3ZVXA 4RSUA 4W6XA 5I0UA 3J4UH 2ET1A 2Z42A 3I8TA 1NCRA 3H50A 1H8TC 2XLAA 4KGQA 4CDUC 3TN91 3B02A 3E97A 2HWE2 2TNFA 5C9AB 3THTA 3ZFFA 3FLTA 4D7SA 3CF6E 5GZEA 3MIDA 4IV3B 3WHTA 5IK7A 3O0VA 4JRLA 3DL3A 1BYHA 1YYNA 2BQPA 3CJXA 4Q0QA 2K2SA 4HSJA 4GH4B 1MQTB 3RMYA 4NN0A 2VW0A 4QGNA 1QNWA 4QQOA 3S7EA 2VH9A 2XJRA 2QCSB 3ZFEA 3H3ZA 3WQ7A 3TRSB 4ZXKA 1RHI1 4Q4X1 5CADA 1RL3A 4GALA 1GZWB 3V0BA 2W39A 4YNIA 3NAPA 3BODA 4YZ3A 3FBMA 1JH5A 2BEOA 1RUG1 3B00A 4YG3A 3GALA 2R0HA 5T5OA 1VAVA 4OHYA 4LR4A 5JAXA 4WM8B 4BWOA 3E5UA 3VBOA 4GMP0 5BNQA 3D6EA 5CFDC 4DPNA 4COZA 4BQ1A 1DLLA 2IC1A 3A0NA 3DN7A 4GQ7A 1AXKA 4XFCA 1TNFA 4M00A 2HWC3 4QQPA 4F83A 1UF2C 1AUYA 4SLIA 5EJ3A 4DOUA 2PHRA 4OHZA 1RUD1 1F8VA 3R4DB 1LCLA 1NY71 1B35B 3DUIA 2P2KA 4P9YA 1OLQA 1ND3C 1H8TA 1BMV2 4CDUA 1S0GA 2XLGA 4BH9A 4L92A 3I2DA 3D5OA 2IWGB 2B39A 1EPWA 2VQAA 2XBO1 2H0VA 4LE4A 4RQPB 2UU8A 3MZHA 2GNMA 1D4M3 1TQ5A 3RJ2X 4I0WB 2JENA 1CAXB 2DCJA 2QUOA 2XG3A 2XJQA 4IV1C 4YG0A 5L73A 1SLAA 2D3PA 2R041 1W6OA 1DQ1A 4FOYA 3I4IA 4CEYB 5CA6A 5BV6A 5HXVA 3V56A 4JTOA 3EO6A 4R9BA 5IK4A 3VL8A 3KT1A 1DF0A 1QJY1 4YLZA 1RUE3 3BALA 5JR7B 1AJOA 1PM7A 5EYXA 3ZYIB 3P3PA 1AHSA 3AYAA 3GYDA 4N7UA 1R1A3 3KT7A 1AR82 5FDBA 2HKXA 1ZX5A 1QQP3 1PGW2 4WM7B 3LB9A 1LTEA 2MEV2 4QQHA 4AGGA 5FO8B 4FAGA 1Q56A 5K0UC 3GNEA 4R52A 1F5JA 4XFFA 5IK8A 1GZ9A 1Q5OA 3MEPA 5CFDA 2EXJA 2NP0A 3MIHA 4K8FA 2FZ2A 1IS3A 4B4QA 1XNDA 2GNBA 2B5HA 1UPIA 3MYXA 5KHGA 3MW3A 2XJPA 4GULA 2WQZC 1ASJ3 3HR9A 1W6QA 4OI4A 4DINB 1WLWA 2R062 2JDZA 4XJ8A 4CP2A 1ND3A 2BW8A 4LBQD 4YRDA 2DUOA 2AUYA 4A3XA 3EHKA 3E5XA 1PK6A 2BVVA 2DFCA 4CP0A 4DRRA 4DY5A 4Q4Y2 2N7GA 3IWZA 5T55A 1GKBA 2GC1A 4QQLA 4P9IA 1N1YA 2WFF1 1JYIA 1V9U3 1AR73 2XJTA 4IV1A 3VKMA 1WMEA 2F4PA 4AF9A 2D97A 3ELNA 5BNPB 3FWEA 2HWB2 1MZFA 1MVQA 2BTVC 4MXWB 3FUQA 3APBA 4NHKA 1JBCA 3WDTA 2C5DA 3NV3A 5C8WA 2V09A 1FOD3 1RUH3 3LSDA 5GLTA 2IFWA 5A32B 3VDDB 3JU9A 2DFBA 2WJSA 1OMIA 3M2MA 3VHPA 5K0UA 3H8UA 4HKOA 4R4ZA 3UJOA 5F1RA 5GALA 5KXEA 3SXWA 5AFEA 4DNYA 3JZVA 4MYEA 2PHUA 3CJIC 1R093 1G86A 3LGRA 2F6BA 3GHMA 4JDMA 2YHJA 1QWRA 1X33A 1D4M1 1O3RA 4AYUA 1LOAA 4L97A 3ZXDA 4CEWC 4M3CE 3RZZA 1YRZA 1ENSA 2RS33 4KH9A 4HLTA 1RUNA 1BVVA 3GBGA 1OA3A 4YFZA 1AL0G 4R9DA 1IKQA 1SCSA 1FNYA 3TAYA 1DFQA 1RUI2 2JEMA 5HCFA 2EIGA 4MGZE 1RUE1 4RD7A 2ZBJA 1C8M3 4BHPA 4Q0SA 1AF9A 1TME3 1LU1A 5JIUA 2A6ZA 1YHFA 3AFKA 1RINA 3FMGA 4BIOA 4CP1A 2AH2A 1G7YA 1AL21 2XJSA 3MIEA 3QH7A 1M4WA 2RMU1 1PO12 3H3UA 3PTYA 2A6XA 1YFUA 2GNTA 1VBB3 3WW1A 1DHKB 3N36A 2B8MA 1DGWX 3WZ1A 2X5IB 3ZFGB 2P17A 2AGSA 2JICA 4YZ1A 3MIGA 1LHWA 2HWF3 4YW4A 4I02A 4Q1RA 3ZXAC 1MEC3 4Q4V3 5J96B 1X8EA 3OCPA 1GQHA 4M3CA 3MLJA 1SFNA 3MW4A 2OYZA 1DQ0A 3ZYJB 1PVC2 1FMD2 2ZGTA 5EWSA 4XJUA 3T1LA 3N3HA 4QPGC 5L19A 4HMZA 4I01A 1DG6A 4AVVA 1KFUL 1NQDA 4PIXA 3CJIA 2D6PA 4LO6B 1ND2C 2E7QA 4FOQA 5JOWA 1GICA 2IXHA 5CFCB 1WBLA 4BE3A 2A3YA 1H2LA 3MIBA 2CY6A 4UW4A 1AR93 4F3JA 3AZWA 4CEWA 5AVAA 2EAKA 2LUWA 2PLV2 1AR71 3GHNA 1A8DA 3MPBA 1WCSA 4P9JA 5KHHA 1G8WA 1MS8A 2B9UA 1VBC2 1PVXA 5LRRA 4IERA 5BNOB 5KXDA 1YNAA 3ZXFA 4R9AA 2YC0A 2DCZA 1UMZA 4OHXA 1JUIA 4AW7A 3L9JT 1RUOA 1PGL2 3ASIA 2Z69A 4UW3A 4Y20B 2HWE3 4IETA 2BGCA 5KWRA 1ZRDA 5LRSA 2WWSA 3ILNA 4L2NA 2HWC2 1LOEA 1FX5A 1ENQA 2W08A 3AP5A 1GANA 3M3IA 2IZWA 5JZGB 2IXCA 2WKKA 2D93A 3WW3A 4DRVA 3RNSA 3T1MA 5DUXA 4B4PA 3D8CA 1C28A 1I6XA 2I74A 4QPIB 3SH3A 4E9KA 1QJX1 4B8EA 2CGNA 1R083 1NCQB 1SQ4A 4OLLA 1MS4A 1YJKA 4G9SB 3FJSA 4E4DX 3WDYA 3P3NA 2PELA 3IIAA 4ZU7A 1J58A 4HT1T 2RS31 1H4HA 4Q29A 4YM1A 1QH6A 3VKFC 1DYPA 4M01A 5DUVA 4YW2A 4MXVA 4QPGA 3THPA 3WCRA 4NO4A 1I3HA 4PF5A 5FO9B 5JLVA 4XILA 3ZMNA 1AX1A 2ZGMA 1ND2A 4U2AA 2BBVA 1H9WA 3OYWA 1QMJA 2YV8A 4YVSC 4ATFA 1RUF1 1ENXA 1XQNA 3OGGA 3LSEA 4AVCA 1R1A2 1A8MA 3KMHA 4DY3A 1KDMA 3B93A 4ORFA 1NOVA 1QQP2 2A73B 3WHUA 1DQ4A 4YW1A 1VBB1 1SLLA 5FLJA 2JG9B 3UL2A 2WQ4A 2FHRA 2AREA 1YI7A 3I54A 5GZCA 4LBMA 3RSJA 1SLTA 4LLOA 2DVBA 3MGUA 4H7LA 3PJQA 1JTZX 1S0BA 5KBFA 4U36A 2VMIA 2BFUL 2WS92 3KT4A 3J26N 1OHFA 3SHRA 2RM21 2BNOA 3NO8A 3QH6A 5JOZA 1ASJ2 5T5LA 4F7ZA 2QDNA 4EROA 1CAWA 2G4IA 4YYOA 1OA4A 5T5JA 1PO22 4P9GA 1BEV2 1CIWA 4Y1UA 4UW6A 1VB2A 2W52A 5IT6A 2I45A 2Q30A 2GH8A 3VBSC 2WZR3 5AFBA 1LU2A 2DVFA 2VMHA 4ES8A 3KLSA 3WG3A 4LA2A 5EZWA 3WR0A 2A3XA 2PN5A 4UBGA 3WV6A 2D5HA 4ZU4A 1V9U2 4M3CF 3KCYA 4J1WA 2OVUA 3D0JA 4KWKA 1U5ZA 3LA3A 1VBA2 1H1MA 2RS12 1ULFA 1QJU2 2PAKA 4XJZA 1DZRA 3SITA 5C33A 2G9GA 4WVVA 2HWE1 1EAH2 4N53C 1WW6A 4Y22A 1S1AA 3VLBB 4YVSA 3SH4A 2DF7A 4QX5A 4XIOA 1AX2A 4JC1A 1ZZ6A 3UKNA 2PA7A 2XJUA 2GU9A 3IBMA 2CAVA 5CNAA 1IPJA 2D40A 1RMU1 1WCKA 1DZTA 2R063 1ZZBA 4XMIA 3RYRA 1SLBA 3ZSEA 1COV3 2GDFA 1M06G 1OLRA 4TLFA 2EVXA 4B7KA 1VRH2 1R092 2GMEA 4GMP3 1S0EA 1FNZA 4AEKA 4LULA 3JD72 5GLWA 1W6NA 1Z7S3 4COYA 3VZOA 1TMF3 1V6IA 3VKOA 3N7LA 1UZZA 1ENRA 1UIKA 4P9XA 1FI2A 2FMYA 3WY6A 4PDWB 2BVBA 3IPVA 1B09A 1YWKA 3RRDA 1BJQA 3NSTA 3LAGA 4XE9A 3VUOA 4JDOA 2BWCA 4BOWA 2A6WA 4IEWA 1LENA 4QMAA 4W65A 3VBHC 3WP5A 4N43B 2GH2A 4XFGA 3WG2A 2RE9A 1D0HA 1ZZ8A 2GC3A 3PVEA 3VBSA 1LEMA 4ES9A 4XIKA 5CIRA 2R1DA 4FP3A 4LUKA 1TME2 2WNUC 1LHUA 1YI9A 3M1HA 3H0OA 1W6PB 3NV2A 4AQ6A 1DQ5A 3AMHA 3B01A 3GF6A 5FREA 1HV1A 1KJLA 4MSVA 1FV3A 5J36A 2EF6A 1IS4A 1H0BA 4RS5B 3S30A 1GNHA 1G9BA 4GB32 2VECA 1GR3A 1MS9A 4PBPA 4FCAA 3VV1A 1CPNA 5FRAA 4AHXA 4JGYC 3ILFA 3BOWA 3M3EA 1CAUB 1HX6A 2HWF2 3FBYA 4N53A 4WBBA 5A3MA 4XQWA 4AI1A 1VP6A 1S0JA 4H7MA 4MUVA 3H7YA 3FUOA 1NCRB 4QU2A 2Q8OA 4BMEA 2DVDA 5J37A 3OTFA 5BUVA 4CDXB 5J3UA 4EN7B 4NPRA 2D44A 1ZBE1 2VOXA 1S0FA 1KITA 1F2NA 2OA2A 4HPKA 1W2UA 3ZFFB 2Q4SA 3B7MA 4DFSA 5BYNA 1N1VA 4X8PA 1C8NA 3W9AA 1RUI3 1S0DA 4E2QA 1CQ9A 2RR11 3WP3A 3DPRC 4Y1YA 3BTAA 1AR81 2DTWA 1AR92 1PGW1 3AP7A 4XBQA 2MEV1 3JBG3 3ZFEB 1PO13 1AYM3 3B3QE 3VBFC 3MLKA 1AXYA 2ZGSA 2HWD1 4AI8A 4UXAA 3V0BB 3NAPB 1RJ7A 2HEVF 3VBHA 3ZSJA 3BOPA 1KQRA 2ZS6B 4K1ZA 5JI9A 5I8SA 4C90A 1HQNA 5D8AC 2WNUA 4D3WA 1K5MC 3VBOB 1W6MB 1YO8A 3AM2A 1NA1C 4I3GA 2BNMA 4JGZB 5C8CC 1PVC3 1FMD3 3V64A 2BNNA 1MVEA 2H6CA 3W58A 3VZNA 4A7YA 3B5LB 2EXHA 3S7IA 1UU6A 5EV7A 1C1LA 3DV8A 4AG4A 4JGYA 4C1WA 1R082 1D4VB 5DUUA 4Q4Y1 1VR3A 1LJ7A 4WVMA 5L7OC 3VBRC 3O14A 1YJLA 1LHOA 1H8TB 2XLFA 3FFZA 5T54A 4CDUB 2R0FA 1V6NA 4LHNA 2PLV3 5E1RA 1LR5A 2PHTA 4CTEA 1OQ1A 2VGDA 3M8LA 2YYOA 1VBC3 2BPA2 1J1LA 1O5UA 4YGCA 1LOGA 2HWB1 3NL1A 4HANA 2VNGA 1OQDA 3KCXA 3LZZA 5FO7B 4LTAA 2D98A 1H1AA 1MACA 1H2MA 3J8F3 3VZKA 4X8NA 2DV9A 3FZ3A 2FBEA 3DPRA 3M3OA 5FQ0A 4Q0VA 4QHBA 1VLNA 1C4RA 2HYKA 4XYXA 4XBNA 4JVAA 1QXRA 1EV12 5FMOL 3VBFA 4RQPC 3ZN6A 4IV3A 5DZFA 1SBDA 1QGLA 4N9IA 2GMPA 1YIFA 5LK7B 3I7DA 1Q8OA 1VBE3 5FOJB 4YW5A 4LT5A 1UKGA 2XH6A 3HAGA 1XXNA 1XU1A 5KXCA 3VHOA 1MR5A 1PK6C 5BPXA 3JQXA 1N1TA 2A7AA 3MI8A 1PNGA 5D8AA 4KGGA 1V00A 2O1QA 1POV1 2V5YA 1K5MA 2I07B 1ZRRA 1V6LA 5I8YA 1ZVFA 5L36A 1NA1A 1AR61 2ZHLA 5CFDB 2PHLA 3RI8A 1RGSA 4BLJA 5C8CA 4KG8A 5AC92 3KGZA 1GZWA 5HBAA 5JSRA 4Z92B 4RGAA 4C0HA 4ONUA 2WFPA 1XE8A 1AYN1 2EALA 2QE3A 4LHLA 5GM0A 3AP4A 4YM2A 3W59A 2UYAA 1C1FA 3AJZA 4AHWA 1W6QB 1KFXL 1VB4A 2WZR2 4JRAA 2DU1A 5L7OA 3HQXA 2ZACA 3AMQA 3VBRA 1D2SA 4XXAA 3SCGA 1V6MA 1AX0A 1J3QA 1ZZ9A 5JPNB 1WD4A 4B4RA 3ZYPA 1HXS2 4HBNA 2GN7A 1EYBA 1VBD2 1OPOA 1PZ8A 1DDLA 1D0GA 1DBNA 1PIV2 3OD4A 4FP2A 4YSFA 5GKAC 3NKTA 2Z2SB 4DB5A 1BVP1 1FYUA 1AZDA 1RUC3 2PHFA 2WL1A 4MH0E 1CONA 2BUKA 4HK8A 4HFSA 3KZ4C 2AYHA 2SLIA 4LE3A 2WS93 1MS1A 4XBLA 5H9RA 1FMD1 1CGPA 3SNMA 4BYYA 3R4SA 4RQPA 2K0GA 3TNQA 5F9TA 4KG0A 2ZGPA 3L2YA 3VZLA 1PO23 1BEV3 1COV2 3KSCA 1XYNA 4FPOB 4P14A 5E16A 1LODA 4YZ5A 3ZIWA 1ZBA2 4EN9B 5GZGA 1Z7S2 3OPZA 4JAAA 5K0UB 3AP6A 1XNBA 5A33B 1SMVA 1TMF2 3ECQA 3V0AB 1WLDA 1HRV2 3R05A 3QLQA 2PLV1 1WD3A 4Q1PA 4M0NA 3BB6A 3ZN5A 1VBC1 1VBA3 1CJPA 2RS13 4Y4YA 3O0XA 3CNAA 1QJU3 3IDEA 2VPVA 1PGL1 2MPFA 1OI6A 4K7JA 2A70A 1EAH3 2XVKA 1QDCA 3WXPA 5K7PA 3WW4A 3URFA 2HWC1 1UPSA 3T2TA 1QDOA 2YUEA 4LO7A 2ZKLA 3G6JB 1JXNA 1NLRA 1RJ8A 1RUG2 1J59A 4Q26A 4AI3A 3CLPA 4IEUA 5HCBA 3VZMA 1H4GA 2W0XA 4OI1A 5FMOS 4AI2A 1KD7A 1UKRA 5H9SA 3ES4A 4AEJA 2DU0A 4AXOA 5J09A 1YCIA 5TSWA 3RDIA 4QGLA 1RITA 1VRH3 4LBOA 3G7DA 4YGBA 2BYVE 3ZO0B 3JD73 4HL0A 1CX4A 5GZDA 4XF4A 2XUMA 1ZNPA 3ATGA 1O3TA 4Q27A 5CAZA 1FATA 1VIWB 1X82A 1RUD2 2K9ZA 4XQ4A 1LHVA 3RYKA 4R4XA 1DQ6A 3NW4A 4OFGA 1XE7A 1PNFA 4C91A 1OPMA 4HVOA 3U11A 3H9AA 3DKWA 1LOCA 3VKLA 2B45X 1JN2P 3O5SA 5BNPA 1YLLA 4MGYE 2X5IC 4O9EA 3OY8A 3ZFGC 5T5PA 1SBFA 2NMNA 1R1A1 4BIFA 2HJIA 3AB0A 5ABJC 1QQP1 2AR6A 3B9CA 3CJIB 3A4UA 3JBG2 1FPN3 1HLCA 4LBQB 2RJKA 1AYM2 2DTYA 2I2SA 2R042 3UKTA 4AQ2A 1YFWA 4ZKTB 4PLOA 4W6WA 3PMEA 2EAAA 4GB33 3CL1A 2JG8C 2OUHA 4PJYA 4CEWB 4CRQA 4XOGA 3POSA 3PLQA 1ZZ7A 4ISRA 1WLCA 4COUA 1PZ9A 4EJRA 1AVBA 2XWJB 2NMOA 1F5FA 4LUMA 1MS0A 1OOPC 4NR1A 4GA9A 1NZCA 1DGLA 1QXJA 2ILMA 4OUSA 2JKBA 1ASJ1 2E51A 4IEPA 3ZN4A 4V1PA 1U5YA 2C9AA 4L99A 1PO21 2IXLA 4PIYA 4HZFA 2D5FA 2ZGKA 1DGWA 3AKSA 2Q0AA 1RUJ2 4L11A 3TYJA 4E27A 3WDVA 2LTNA 4RHV3 5H9QA 4OI2A 4XXPA 2ZX3A 1XNCA 2ZHNA 1FV2A 3MDPA 2D6LX 1CAVA 4K3UA 4EWDA 1RVF2 1WW7A 1C5IA 5GZFA 5I0TA 3OBTA 4HVRA 2CGPA 1V9U1 4LBKA 2GSYA 1IZ3A 4ASMB 3U10A 1VBA1 3ALQA 4QXKA 4XF9A 2RS11 1N47A 1QJU1 2Q1ZB 4AVAA 4S2DA 1QOSA 1SLIA 5HCAA 2VY0A 3WT3A 1EAH1 4DQAA 4FO9A 4QD2A 3J8F2 3IMNA 2CWMA 2WT2A 2X5IA 4YGDA 2CWSA 1W0OA 2ZKNA 3ZFGA 4QPGB 1FOD1 1Y43B 3LA7A 4BZ4A 1RUH1 5CB7A 5I0SA 2CTVA 2DCTA 5C6CA 5ABJA 2WFF2 2UYBA 1NCQC 3K48A 4IEYA 3PMSA 5JVVA 2O8OA 3VBUB 3OYWB 2ZMNA 1HRI3 3H7JA 1BBT3 4I09A 1J3RA 2O0OA 1X36A 3AXDA 3RMXA 3E6BA 3OD0A 4P5HA 5EYYA 1VBE2 3O12A 4BMBA 1GFF2 4Z07A 3VHRA 2JG8A 1L3JA 1R091 1TEIA 1ONAA 2R30A 3JD71 4I2OA 1MZ6A 2GALA 5C4WC 3WD5A 1A6CA 1APNA 1OOPA 1ZRCA 3UJQA 1YUDA 2XHKA 3AZZA 1D2QA 4FQZA 1F9KA 4RGGA 4FPYA 2VVFA 1QY4A 1WW5A 1CR7A 2E63A 1O5LA 3KQRA 4Y1XA 1QXPA 3PHMA 4JQRA 3HT1A 1O4TA 3E6CC 1S55A 1YFXA 3K51A 1CAWB 4IQPA 1C8M1 2WA4A 1TME1 4E2GA 4OVEA 1DQ2A 4XFAA 2EA7A 2VUJA 2VW2A 4YGEA 3LOIA 1W39A 4C0BA 3AKRA 5KC5A 1VALA 5DG1A 4Y20A 2P34A 1KS5A 4L8QA 4WVWA 1EV13 2D6MA 3B69A 2VQ0A 2ZGUA 3SCHA 4PQ9A 4HSLA 4GB31 2H6BA 4AHZA 3ZXEA 1NG0A 1TE1B 3POYA 1REDA 1X8MA 2HWF1 3GBFA 3VKNA 1MEC1 4Q4V1 4CDQC 4Q2FA 1RUC2 3BPZA 3SH5A 5FOBB 4J6GA 1OSGA 1ULCA 2VVDA 2X8KA 2DWRA 4AE2A 1OQEA 1NCQA 5BNNC 2HEYF 2RMU2 4AK3A 4QQ2A 1V6KA 1JOJA 2YROA 3FX3A 3KS7A 4Y22B 5AC93 3FLRA 3AYDA 2ETEA 2WNVC 4YVSB 3M70A 4P9WA 4TSVA 4PBOA 3ZXLA 2VUAA 3PJYA 2ZMKA 4IXLA 1UU4A 1CVNA 1FXZA 1DU3D 4FTEA 2A6VA 2H0BA 2VXRA 4TZDA 4CDWC 5C4WA 3HWJA 4XF1A 3ZSLA 2QJVA 4YM3A 4RFT0 3R4UA 2NYYA 1AR91 1U12A 1SCRA 1HXS3 3ZXGA 1VBD3 1A78A 1W6NB 4CZSA 1PIV3 4KNCA 2Y26A 4WZFA 3ZYRA 2ZGLA 2PHDA 4PCRA 3IPVB 2JG9A 3CEWA 5AVPA 4BCUA 1GSLA 1QJZA 4AGVA 2WC2A 1KDKA 4NVPA 4SBVA 4GKYA 1N1SA 3N35A 4Y26A 4AFMA 4NWVA 5KHJA 5JDBA 4YM0A 3VBSB 4OHVA 2X53S 2XL9A 3CO2A 3DGTA 2RS52 4PDWC 1N3PA 1R081 1ZBA3 3FLPA 4PIZA 5JIAA 4CDQA 4NHLA 4BPZA 4UW5A 5T50A 3GZAA 1H9PA 3LA2A 2CL2A 1HRV3 1LHNA 2OZJA 2QNKA 5BNNA 1WCDJ 4Q8LA 1Y3TA 5ACA2 3RYPA 1U0AA 4K21A 4N53B 3WG4A 1VAKA 3AJYA 2WNVA 1O91A 4YG6A 3QOPA 3UV9A 1IQAA 1YFYA 2R16A 5BY5A 4CDWA 2XVLA 1AJKA 4HETA 5FFOC 3NKGA 4JDNA 1IGOA 3V65A 4EWEA 4HPKB 2GC2A 2ZJCA 2YZ4A 4MGIE 2ERFA 1LGCA 4RR3C 2GZWA 3PVBB 3TBDA 4LBNA 1RUG3 5LEKA 1FPN2 1S0CA 4L9BA 4A7ZA 1EV11 5FBZA 2ATFA 4QT6A 4PLMA 4Z2WA 1HQWA 4XFIA 3WQ0A 1ULEA 2A5ZA 1BMV1 1LESA 4K9SA 1GNZA 1H8VA 2VU9A 4QM9A 4AEDC 4FPKA 3B94A 5DDJ2 1KXGA 1U5IA 4YW3A 4FPEA 2IXIA 1DIWA 3NVCA 4MV2A 2BFUS 1V6OA 3USUA 2UWBA 5FTTC 4YVWC 3AKPA 1RUD3 2VULA 4OULA 4HN1A 2WNUB 4JV4A 1UCXA 1XU2A 2EXIA 4KU7A 5FPXA 2ZX4A 4PDWA 5E8AA 2SBAA 4YZ4A 3NWKA 4RHV2 4BA6A 2WZR1 1NE6A 2FMDA 1Y7BA 4GWNA 2LM3A 2E53A 2MHFA 5DG2A 2OUJA 4EN8B 4NOTA 1CN1A 1W0PA 4FOVA 2TUNA 3KM5A 2P3KA 1ULDA 4JGYB 3H1WA 5C9AC 3ZPYA 2R043 5DZGA 3S6PA 5A3LA 1W6PA 4FQ4A 4IV3C 1PIV1 4LO8A 1N3QA 3AKTA 4LNVA 1Z78A 3H1MA 4XFBA 2ZGOA 1C5HA 3I59A 4FSJA 2D6NA 1QJY3 4GH4C 3ZSKA 4FBFA 3IM0A 1MQTC 3JCIA 4XPVA 2GAUA 2KXLA 4XHBA 1Y9QA 3EXUA 4RR3A 4AQSA 3FFQA 4N7IA 3RWNA 4HKWA 5JMCA 4Z1VA 1SEFA 2E7TA 2R061 3ROUA 2O8QA 1HRI2 1BBT2 1MS5A 2D3SA 1F31A 1QOOA 3DPRB 5FQ0B 1COV1 4CDXA 1ZBA1 3MICA 4GMP1 1RUJ3 3E5QA 1WMDA 4ISQA 4OZXA 3UK9A 4AEDA 4AVBA 3FHIB 5CU1A 1Z7S1 3VBFB 2WLPA 5CBLA 3ZN6B 4WM8C 1TMF1 1RVF3 2XGXA 1HRV1 2VG9A 4X6RB 4N90A 4IEXA 2ZPXA 1S2BA 2WLQA 3N7JA 4XJWA 4YVWA 1DZQA 3ZX7A 1WUVA 4A7KA 1RMU2 4FOWA 3NJZA 1H2NA 4FXGB 2ZA9A 3X29B 2VMGA 5D8AB 1K5MB 2G9FA 2D6OX 1NA1B 4WVZA 4EWAA 5C8CB 2ZHKA 2RJLA 1B35C 1VJ2A 2YPJA 1LGNA 1G9DA 1W6OB 4H55A 2CAUA 1XYPA 4IEZA 2JE9A 2PHXA 2WFF3 1Q8VA 2FZ1A 2Q1MA 3OJBA 2NLRA 5C9AA 2C0ZA 4D94A 1YXWA 2DCYA 3PVNA 2D43A 5L7OB 3VBRB 1W6MA 2QVSB 2XL7A 4Y1ZA 5FPZA 4JGZA 5CG9A 5F6LB 3AXEA 3AKQA 5K9YA 1WMFA 2WA3A 4IEOA 4W6YA 1ALYA 2Z5WA 4GH4A 1G9FA 1BXHA 4LBLA 1O3SA 1MQTA 3AMNA 3WDUA 4CEYC 1JW6A 4E4ZA 2VOWA 3ES1A 3FE5A 4GWMA 2VOKA 2ZGRA 2ZZJA 4G3YC 2EXKA 4IEQA 5DXDA 4H3WA 2YXSA 2CYFA 4R8HA 2PQQA 3KB5A 4JTNA 3R0RA 3D0SA 4N9HA 4URTA 2DVAA 4HK9A 1GYKA 3JQWA 4COVA 4WM7C 4QGMA 5IUQA 1RUI1 3TB0A 1Q3EA 2ZX2A 2KM2A 1I9RA 4AFDA 4WM8A 4XQDA 1VAMA 4XTPA 5E89A 1ULGA 4XZPA 3MFCA 1ND3B 5DUWA 3C3VA 2QQPA 1AXZA 3JBG1 2R072 4LO5B 1PO11 1AYM1 1ZBE2 1TNRA 1PK6B 2VNOA 3AMPA 4Q4W2 3R6SA 3WVJA 2E6VA 3WW2A 2D7FA 1EP0A 3OF1A 4FPLA 2XWBB 3VHNA 3N4MA 5LK5A 2YMZA 1I5ZA 1EPZA 3RI9A 3ZIXA 4OUMA 2RR12 1POV0 1B35A 4IV1B 5FAXA 1GV9