3K4ZA

Crystal structure of the cellulosomal cbm4 from clostridium thermocellum cellulase cbha
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
280
structure length
275
Chain Sequence
MLEDNSSTLPPYKNDLLYERTFDEGLCYPWHTCEDSGGKCSFDVVDVPGQPGNKAFAVTVLDKGQNRWSVQMRHRGLTLEQGHTYRVRLKIWADASCKVYIKIGQMGEPYAEYWNNKWSPYTLTAGKVLEIDETFVMDKPTDDTCEFTFHLGGELAATPPYTVYLDDVSLYDPEYTKPVEYILPQPDVRVNQVGYLPEGKKVATVVCNSTQPVKWQLKNAAGVVVLEGYTEPKGLDYVHWLDFSDFATEGIGYYFELPTVNSPTNYSHPFDIRKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Glycoside hydrolase family 9
publication title The unique binding mode of cellulosomal CBM4 from Clostridium thermocellum cellobiohydrolase A.
pubmed doi rcsb
source organism Clostridium thermocellum dsm 4150
total genus 62
structure length 275
sequence length 280
ec nomenclature
pdb deposition date 2009-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4zA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4zA01
3FQUB 5F7WC 5J3HC 1CGWA 3MRJA 4ZFOL 4HKBB 5E4EC 1P7QB 5FUZL 3WKMH 1F4HA 1BECA 1M7XA 3HC3H 4D2NA 3AY4A 2VN7A 5FDWA 1PD6A 1IAOB 2ARJQ 2VDQH 3MV9B 4M1DH 3WFCH 4MSWB 3VD7A 3OF6A 4KXZI 4OLUH 3H0TB 3MRQA 1PY4A 4ZD3L 4LPXA 1IMHC 1HH6B 2VR9A 1DBJH 3NIFE 4YDJA 2JTDA 4DGVH 4NWTL 4FMFA 5I1EL 3WIHA 4BQCA 2DQEH 3V6ZA 3JTSA 2XTJC 2IGFH 2EDWA 5CSGA 1AD9B 4YBQD 1A8JH 1F3DH 1NPUA 4QOKE 5H2BA 5JXJA 3VXUB 1SVCP 1UMIA 4I0CC 5HHNA 1A7PL 3HEIA 3DVNB 3IFLH 1KN4H 2VITA 4HUMB 4X6EB 3S7GA 4HUUB 3BFOA 1L7TL 4FFZH 1UWXK 1DE4A 1NBYB 4DTGL 3ROLA 5FECB 3CFEA 4KMTH 4Z9KB 3UZVB 3SKMA 4JFEB 1UADC 4P5TB 1WWWX 2AQ3A 2G75B 3A67H 1RHHA 4XBPA 4YAQB 3V6OE 3T8XB 2NPLX 2JCCF 1E4KC 1GC1L 4FQIL 1T83A 1QPXA 5GGRY 3MRJB 3NRUA 4NZRH 4PJ5B 4U6VH 2O5ZL 3QDHA 2W0FA 3RVVC 3MRKA 2DQJL 1MCCA 1HN1A 4Z0BH 5FUCE 4OZGF 3UETA 1S7TB 1NSNH 1IGMH 2XN9E 5EZLA 5E2WL 4S11A 4ORGA 3T1WA 2VXSH 3MRQB 1CK0H 2HFEB 4LRNH 1NFDA 3RIAK 4Y2DD 4XURA 5CBEA 2CKBL 4YDJB 3EZJB 3RZCD 1VACA 3KWWA 4L4VA 3KPSA 1QBML 4MMZC 3S96A 3V6ZB 3JTSB 4TTDD 4OZIA 4U1MA 3TO4C 1GRWA 1YPZA 2H9GB 4PJCE 1KFAL 3OJMB 1P9MC 1BJ1J 5H2BB 2GCYA 4NQTA 5EJZB 3C8DA 2W9LA 3NCCB 5HHNB 1I8MA 5C1MB 4Z6AT 2VITB 3FN0L 4C4KT 3OMZA 4ARXA 4Q9CA 5F9AC 3W39B 1ZGLM 4I9WD 5D2NC 1A7RL 5T3XD 1AXTL 1MJ7L 1EVTC 5IV2A 1G9MH 2V5TA 2DLEA 3ZT5A 1L9MA 4ZO9A 2PNDA 3SJVD 3O81A 1DE4B 4JFPA 4HG4K 3ROLB 4G3YL 1PY9A 3CFEB 1VEPA 1SYSA 3SKMB 1RHHB 4GOSA 4EEEA 5C6WH 4OF8A 2DIJA 4YC2C 4G6FB 4RMUA 1UY4A 1QUNA 3MBEB 3MODL 2DI8A 2CKNA 2ARWA 2MPAH 4JRXD 2DBLL 4U0QB 3SCMA 4K71B 4LAQH 1MCIA 5DJ0A 1QFPA 1RUML 1I5PA 2VXUL 2UZXB 1GOGA 1ZANL 4JG0L 1H3WM 4FZEH 4LEXH 2W0LA 5HPMB 1OAKH 2EKJA 2K3TA 5FA4A 5CBAA 5HI3C 4CMHC 4I9WE 3H7LA 3AMKA 1PKQA 3FN9A 5EZLB 4CL7A 4ORGB 3V5DA 3W11D 1NFDB 3RIAF 4ZPTA 5I0ZA 3FQNA 4NQCE 5CBEB 2OXGA 3HC4L 1T4KA 3LQAL 3G5YA 5HVHC 1VACB 1DSFL 3KWWB 5HGBA 3DTXB 4HGKC 4KI5D 5EO0A 1HCFX 3KPSB 2O93L 1UCBL 4O51B 4S1RL 5LWYH 2M1KA 4U1MB 4OZIB 2OJZL 4XMLH 1T7ZA 5KJRH 1HE7A 1YPZB 5J0BA 3WHXA 2GCYB 4WU5A 1IM3B 1F90H 1IT9H 1YEIH 3E0GA 3FCTA 5E4IA 1LMKA 3LIZL 4KUCF 1OF4A 2NY5L 3NACH 2APFA 3HE7C 4X9HA 1OPGL 1UGNA 4CU8A 3V4UH 2NMSA 3I3DA 5IHUH 4HH8A 3MLXL 4OZHF 4JFPB 1UJTA 3C08L 2CDEA 4HT1H 1MI5D 4KKBD 3OAYH 1SYSB 1TXKA 2EYRA 2IWGA 5K9OA 3FKUS 1GPOL 2D4DA 1EJ6A 3MJ6A 4P99A 4QTIL 3RWIA 5DJCA 1UZ6F 2BOCA 5FUZH 2EKSA 3UEZA 3U82B 1BD2A 2QEJA 2LFGA 3SDAC 4XPFL 4G9FD 1DBAL 3SE9H 3ARFB 5DJ0B 4U1GC 5A3ID 2JCCE 3EJZD 2BY1A 2WAOA 1UEYA 3CQOA 3MPCA 5ITBL 3AAZA 2D3VA 3O2DH 2R2EA 5FA4B 1MF2L 3ZO0A 1UACL 4ZD3H 1PKQB 4P9ML 4LSTL 3RU8L 3V5DB 3NH7L 1JHJA 4H0IA 5A2FA 4ZPTB 3D3VD 4UOJA 4NWTH 5GGQL 4L9LC 4OZGE 5I1EH 4MA7L 1M6OA 1T4KB 2F8OA 3HPLA 3OHXA 3LEIA 2BGPA 5HGBB 4MXQD 1HHIA 2NY4B 1KG0A 2YXFA 3UTTD 2XWTA 5EBMA 5I19L 2F5AL 4KK5C 2XZAH 1I9EA 1A7PH 1QSZA 3WHXB 5AYUL 4WU5B 4R7DA 2JB6A 1F3DJ 4PJ9A 5E6IB 2IBZX 3FCTB 5EIVA 5F88A 3HUJF 1L7TH 1J0ZA 1MHEA 4JM4L 3DO3A 3LEYL 1WIPA 4WHYG 5HYJA 5JPMA 4LVOC 1JN6A 1BVKA 1AIFB 4DTGH 2P8LA 2LE9A 1G6VK 3P11L 2RVAA 1K8IB 4MD4A 5F71A 4A2MA 4XWOD 2R39A 1T2XA 2CDEB 2EYRB 3CFJA 1GC1H 5K9OB 4FQIH 4JVPA 2FH8A 5I6XC 3T0VA 3A21A 3RWIB 3UTTE 4MA3A 5DJCB 2BOCB 4JE4B 4W68A 2EKSB 2O5ZH 5L0QB 4Z8FL 1BD2B 2Q1EA 4NKQB 2ADJA 3UTSE 2R1WA 3P2TA 3S88L 2DQJH 4WV1A 5IESL 3BHBA 3FB7B 2VLRB 2V5MA 4YHZL 3AAZB 1K85A 1TVBB 2R2EB 3AFLA 1Y6NR 5E2WH 4WUUB 4QEGA 4PJXA 3VFTA 3QEUB 1CFBA 4H1LH 1P7HL 1VB9A 4HJJH 4Z7WA 2CKBH 1CGVA 5J6HB 5DC4B 4JY6B 2DRUA 1K5NA 4PG9A 5C0IA 4KUCD 1M6OB 4CVZA 5HYEA 2WUCL 1QBMH 3HPLB 3OHXB 5DRWA 1TVDA 1SJEA 1IVLA 1HHIB 2NX5D 1KG0B 2C3VA 3L1OL 4IIQA 5IG7A 4NGHL 1YDPA 1KFAH 4QRRA 4B0MM 4YPGA 4ELMA 1YYLL 5E5UB 2XWTB 5EBMB 4XCYA 1YEGL 1EAPA 1OP3K 2JB5L 1IM9D 1GZQA 4G42A 4R7DB 4Y7MA 4CDHA 2DYPA 1LD9A 2JB6B 3FN0H 4PJ9B 2P42B 1WSST 2L7JA 3ET9F 2VZRA 3CCHA 1A7RH 1MHEB 1AXTH 1MJ7H 4R90L 3EOYG 5E9DE 5HYJB 3BXNA 3EBAA 1DEEA 5JPMB 1BVKB 2P8LB 2VLLA 4G3YH 1JNHA 4MD4B 1KPVA 3GEWB 1OM3L 3WS3A 4JQXA 3EFDL 5MERB 2X09A 3GJFA 3PE9A 2NX5E 3MODH 5EC2B 4MA3B 3V7MA 2DBLH 3RZCC 3FAXA 2DQIL 1RUMH 2VXUH 4PLKD 2ADJB 3MMEA 4I1NB 2R1WB 1ZANH 4JG0H 4TTDC 4WV1B 4D0BB 3AM8A 1UZ6E 4XWGL 4EOWL 4QAWA 3KVQA 2EEBA 4GS7C 1YJDC 2NY7L 5FYJD 3UPRA 4UAOC 4PJXB 3NCFB 3VFTB 5JA8B 2V5YA 5CS7A 1X6LA 4ZDHA 4Z7WB 3FO0L 2APXA 2P1YA 5DS8A 1DJSA 3HC4H 4CU6A 1IAMA 4S2SA 3QJFA 4DOHB 1BBJA 3LQAH 4HMEA 2GJ6E 3N9GL 1K5NB 4PG9B 1DSFH 2VSCA 5C0IB 5J13B 4CVZB 3RWEA 1UCBH 4S1RH 3CH8A 4TSCL 1SJEB 1VEMA 2OJZH 1INQA 4IIQB 5IG7B 4QRRB 3P4OA 4YPGB 4JRWA 2VXQL 5GISL 4XCYB 3JV6B 1LGVA 3RJQB 1D3CA 2QQKL 4G42B 1LD9B 3LIZH 1MCWM 2NY5H 1OPGH 3F5WA 3CCHB 5E8EA 4X5WA 1EFXA 4OFYA 3BXNB 1DEEB 1JWMB 2RIKA 2AXFA 2VLLB 3D2UD 3C08H 1JNHB 1KPVB 1OCWL 3ARTA 1X5LA 3HUJE 1GPOH 2CDFA 2Y25A 1T1WA 4GRWB 2VNCA 2X9WA 2P8PA 2H26A 4QTIH 3W11C 4LK4A 4M7KL 3GJFB 3IDJA 2ZOKB 1TQBB 4XPFH 4CADA 1EEUA 1DBAH 3AB0B 3G6JA 4KI5C 2BJML 2R1YA 1J0IA 1UC6A 1JMXA 3Q0HA 2AGJL 5F7LB 5ITBH 2MKWA 3EO0A 4U6HA 3N06B 3HB3C 1MF2H 1UACH 4P9MH 4LSTH 2MHAB 4FP8L 3UPRB 3RU8H 2DM7A 3NH7H 4ZDHB 1JZ2A 1JTPA 4G8IA 1F6LL 3QDJA 5DS8B 5FGCB 5GGQH 3VXOA 1NDMA 3BZFA 4WFGD 4S2SB 3QJFB 4XAWL 1BBJB 3GMPA 3H9SA 4L8BA 4K9EL 2YRZA 3L3HA 3RWEB 1FNHA 3VXTA 2LU7A 3O8XD 3VFOA 3WQBA 2DLFL 1T3FB 1PJ9A 1INQB 5IMMA 5I19H 5L9DL 2F5AH 3GM0A 4KKBC 1A6TA 5ILTL 2ERJC 1C7TA 1N6UA 4KUZL 5AYUH 1MUJA 5CHNA 5GJTL 4P23C 3W82A 3BZEA 3V4VL 4PJEF 4EQ3A 1PG7W 4JM4H 3LEYH 1IBGL 3U7YH 3BPNB 2Y06L 5E8EB 4X5WB 3TBVA 5C0JA 1EFXB 5A3IC 4MQXD 2BVTA 2EDOA 3P11H 5C9KA 4JDTL 5L2JB 3A6BL 4PJIA 3BO8A 4WFGE 2Y4SA 4PLNC 1P6FA 4W6YB 5EUKA 2R8SL 3UCRA 3SOBL 4GKSA 4ZNCD 2P8PB 1DQML 2IH3A 2CRZA 4WHCA 3QXWA 1XPWA 1GGBL 3VXSA 3IDJB 4Z8FH 4KY1L 2W46A 4X8XA 3S88H 4PBWD 1GIGL 4CMMA 2P43B 3B5HA 2NXZD 4QRPA 4X7TA 4YDKH 4MXQC 5IESH 4Z18A 4YHZH 3WN5B 2Z31B 4LVNC 4U6HB 1IFHL 4OF0A 1KT2B 4UQ3B 2NQCA 1IGYA 2BERA 4EQ2A 2Z4QA 2Q87A 2AQ1A 1FNGA 3UMTA 2AEWA 3KPPA 3QDJB 3FONB 1J8HA 3NPSB 4Q6YA 5H37H 1NDMB 3VXOB 5CEZE 4YFLI 2WO3A 2WUCH 4WCYL 4WW2F 3PV7A 1KJ2L 3H9SB 3CDCA 2HAZA 4L8BB 1I9JL 2W92A 5AG9A 2YUZA 2VZ1A 3T0DA 1ES0A 3L1OH 5DMJB 4NGHH 3I2CL 3T4YB 4U6YA 1UY3A 1YYLH 4MJIB 5IMMB 5JHLL 2E7LA 1XAUA 1YEGH 4CU7A 2EH8L 2JB5H 1MUJB 1V8HA 4NBZB 1S5HB 5CHNB 3CZFA 3BZEB 1OGAA 1DQJA 2JKXA 3V8CA 4XPBL 4OM1L 4R90H 1IGTB 3GFUA 4M7ZC 2NXYD 3TBVB 4JFHD 5C0JB 4ZZ5A 4NFDA 4BH8B 2F58L 4PJIB 5D1QD 3Q6GL 3BO8B 1YEDA 5JTWA 2CLRA 3BQUA 5EUKB 1OM3H 2EH7L 3FTGA 4TSAL 2PCPA 4WY7L 5E56A 3EFDH 5DJ2A 1ZHBA 4GKSB 1L9NA 1PQZA 2IH3B 3BYTA 3OKMA 3FT3A 3HKFA 5EJ1B 3SE3C 2DQIH 1F11A 4XNMA 5KSBF 1MCEA 5D6CB 5EU6A 4YHLL 4OYUA 4X7TB 4QRPB 4KK8D 4NOBA 1G7QA 4XWGH 4EOWH 4KKCC 2P5ED 2LW8A 4K9EC 5HHMB 3MCKA 4JVUA 5IHZB 2NY7H 1MH5A 1P5UA 2FB4L 1A1MA 1IGYB 1R6VA 3TN0B 3FO0H 3L3GA 3UBXG 5IF0A 2Z4QB 2ZUVA 1FNGB 3KPPB 3N9GH 1J8HB 8CGTA 3D9AL 1UWXH 4ZNEA 3BVNA 3OXRA 1QFWI 4TSCH 1NDGA 2EO1A 1I1AD 3L5WA 1ES0B 3BPOC 3WLWD 2EIDA 1HCVA 4U6YB 2VXQH 4R0LB 5DZNA 3O2DA 4ZAKA 5GISH 1H3XA 2FWOA 4FA8A 2B4KA 3UX9B 1HI6A 4I0PA 2QQKH 2RHEA 1CDIA 5D7SL 2CPCA 1QSFA 1OGAB 2D9CA 2F54D 2GK2A 1DQJB 3WIFA 1S9VA 4PLKC 2VSDA 4WWKC 3T2OA 5CEZL 3PWPB 2WNGA 3NA9L 1UXSA 3OV6A 1US2A 2IAMC 1OCWH 4PJEE 3MRLA 3QDMD 5HVFB 2CLRB 3BQUB 5IUSA 2PCPB 5C0DB 4PJDB 1J0KA 5DJ2B 4MX7A 4M7KH 1ZHBB 1NX9A 4IOFD 4J3SA 1WZKA 4ONFL 1PQZB 3OKMB 3FT3B 4HFUL 4RFOL 3UNPA 1F11B 2VMDA 1A1NA 2BJMH 1WIOA 3D39E 3IKKA 1WBZB 3MZGB 5EU6B 1G9NC 2AGJH 2FGZA 4N8VA 1SYVA 3FQWA 4UT7L 2J1TA 1F97A 4ONHB 1RZ8A 3VD3A 1WWBX 3MCKB 4FP8H 1MH5B 3STLA 4HC1A 1JHTB 4HLZG 1A1MB 3EW3B 2QSCL 3STZA 3L3GB 2Y5EA 5IF0B 1RU9L 5F8RC 3CVHL 5C07D 4ZFOB 2RGSA 4XAWH 4K9EH 2QQLA 2HKHL 2N4IA 2DM2A 3BVNB 3OXRB 4RRPG 2DKSA 5DD0L 2DLFH 1ULOA 5L9DH 5HVGB 4X4YA 5ILTH 4V1DA 3TCLB 4JFYA 4ZAKB 1PG7L 2XQYK 5GJTH 1KTLA 5BS0D 1HI6B 2WWMD 2YFZA 3LAFA 2QQIA 4I0PB 4MJ5A 1JU3A 3V4VH 1T2JA 3JV4A 2AJUL 1VFOA 1IBGH 2Y06H 3WIFB 3DRQA 2BSTB 5D2LF 3HZVA 2QADB 4XP6L 1S9VB 3OGVA 1C16B 4JDTH 4BM7A 2VMEA 2OXHA 3A6BH 4CGTA 5E1HB 3W9DA 4XUPA 4ZXEA 5J9PA 3DV6A 5C0AA 2R8SH 2VLJB 2NY2D 2EECA 5TE6L 2VUOA 3MRLB 3SOBH 2X44D 1DQMH 2E7HA 1UMHA 1CLZL 1DR9A 1K9TA 1GGBH 1CLCA 4KY1H 4KC3B 3T0ED 4W50A 1Z9LA 3GIZL 1WV7T 1GIGH 5IEHB 1N3NB 5BS0E 5F6HI 3KG5A 5KVEL 5LXGL 4E8DA 3O8XC 2WSKA 4N8VB 1SYVB 1IFHH 3FQWB 1BMGA 3PGDA 3MV8A 4PG2A 2OL3L 1RZ8B 1U92A 2IQAA 5KSBE 2XY1A 4KQ3L 1UY1A 3ZDZF 43C9A 1P4LA 4GSDL 5D1XB 4M3JA 4LMQI 2J5LB 5DHYA 3S3PA 1LNSA 5HD8D 4WCYH 3D3AA 1KJ2H 4A42A 1I9JH 3LEVL 3ROOA 3X12A 1S7XA 4MQXC 5IM7A 3LY6A 5FYLD 3LSOA 3I2CH 1I7TA 3K1DA 1NUFA 4NUGL 5JHLH 1OQXA 1WBXA 3PDGA 4BQ9A 4V1DB 2J8UA 1CYGA 1UXWA 1O0VA 2EH8H 3TVMA 5BOZG 1KTLB 5F72S 1CL7L 5I16B 4MJ5B 2CKBB 4XPBH 4UINL 5H35A 4OM1H 1CICC 3JV4B 1H8NA 3DRQB 25C8L 1DLFH 1RJCA 2IPKA 2F58H 3Q6GH 5CJXC 5D5MA 3W9DB 1HXMA 3DV6B 5C0AB 1WCBB 2EH7H 4TSAH 4WY7H 4AY0A 1AE6L 2PQSA 2KBGA 4MNQA 4X6CA 5EG6C 5HYIA 2YD8A 2WYSA 3CU7A 2ZNXA 3QULA 3AGVA 2DD8L 4MNHA 5JW4N 5KW9L 3G5VA 4YHLH 3BPCA 4L1DA 5DQ9A 2BGOA 4GKNA 2WZ8A 3GBML 1J83A 1B4JL 5C0FB 4B41A 2X89A 1K2DA 3LMJL 2XT1B 3MV8B 2FB4H 1U92B 3RWHA 1IQDA 1LP9F 4XUTA 4QOKB 43C9B 1P4LB 1EIBA 2DS4A 4R2GD 4YR6A 3D9AH 4XAKD 1J88A 3ROOB 2NXYC 5C7GA 1FZJB 2RJ2A 3X12B 1S7XB 5IM7B 3RX5A 3DPBA 3LSOB 5BXFA 1CQKA 1I7TB 5FCUL 5D1QC 4MA8L 2FGWL 1WBXB 3QI9A 2W38A 2J8UB 3U37A 1UXWB 1KXVC 1JI1A 3TVMB 4JKMA 3EJJX 5BV7C 1OB1A 1W2KT 5D7SH 2X9YA 1CG9A 5EN2B 5ESQB 3SE8L 3UDWC 1R0AL 1MQKL 4XPHL 5H35B 4LRIC 1KPRA 1TCMA 3LRSA 5CEZH 4POYA 4FQQA 3NA9H 4X7DC 3IJYA 1NGXA 4JZNB 1FG9C 4KK8C 2N7BA 5SX4I 3EFFA 4Y4HA 2HWZL 1QSEE 2IPKB 3PWJB 1Z9SA 5A43C 1JWSB 1UH3A 1X44A 3EYUL 5I17A 2ZEYA 1HXMB 5C0EA 1U41A 2LU3A 2XQBL 4UNUA 5D2LE 4MNQB 4X6CB 5I75C 4ONFH 4NZTL 2UVEA 1MOEA 3X11A 2XN9B 4HFUH 3QULB 4RFOH 2DDUA 4H88H 5HXMA 1NC2A 3SO5A 2HA1A 2ICWJ 3KS0H 1G1YA 1XEDA 3G5VB 4P2OA 2JK5B 4P2RA 4UT7H 4Q74A 3WLWC 1HYRC 4PIRF 1OP3H 3MNVB 1K2DB 5LGJA 3MSPA 1MCQA 2QSCH 5KANG 4WENB 1IQDB 3K75B 1RU9H 3WF2A 3CVHH 3O4LA 3QUZA 4QDRA 1I8KA 1MJJA 4HWUA 3CJJA 5C0BA 4J3UA 2HKHH 3LKQA 1MLCA 4RWHA 4R3SA 4ZTPL 1WZ1L 2DMKA 1C08A 1J10A 4LASL 3CK0L 4OFIA 5DD0H 4U3XA 4QRQA 3DUHA 5C92A 4KJYA 3ZDZE 4X9FA 3S3SA 3ZYOA 2ZEXA 1U8LA 4HG4J 4MD0B 1PG7H 2R23A 1CDGA 3QI9B 1QNZL 3WBDA 5FCSH 4IOFC 5T1MA 1OB1B 3BUYA 5DC0A 1CG9B 2AJUH 3ARDA 3BMVA 5DFWH 4XP6H 1KPRB 3LRSB 4NO5A 4YHKL 4FTVE 3IJYB 5DK2A 2EDNA 3PJSA 5LQBL 3AU1B 3EFFB 4Y4HB 4GG6A 5C0GA 5HI5D 1I7UA 1ZVSB 1JYVA 3KXFD 5TE6H 5I17B 3OKYA 5C0EB 4NO0A 3NBNA 3EHBD 3LB6D 1CLZH 5I76B 4GXUN 4CVXB 3X11B 1YA5A 4LARL 3GIZH 1NC2B 4YDLB 3JWOC 2P46B 2E26A 4NQCB 2YMXL 5KVEH 5LXGH 2AEPL 1WFOA 4TQEH 4P2OB 4LFHD 4P2RB 4ODUB 1DLCA 1UKSA 4PJFA 2OL3H 5SWSE 4X0KB 5D7LA 1S9WA 4NQSB 5LGJB 2HTKD 2XNAA 1CE6B 2WWMC 4GSDH 5IB2A 3Q6FA 2W1UA 4B7LA 3QUZB 4LSSL 4PRIE 4ZFFA 1I8KB 1NCTA 3LEVH 1MLCB 3WD5L 4R3SB 3UTPD 4M4PA 1C08B 4G6KL 2H41A 3WFEL 3QP3A 4QRQB 3SDCB 1LP9E 5D96C 4KJYB 4NUGH 4Y5XC 5JHDD 2DICA 1FPTL 2FJFB 4YGAB 4Y4KD 2NY2C 1U8LB 1H5BA 3T1FA 2R23B 5CZKA 5I8CB 1CL7H 3WDIA 1J7VR 5AD0A 1FBIH 3B9AA 5T1MB 4R97B 4UINH 1TZIA 3BUYB 4FXGA 4JZJB 3T0EC 3ARDB 5D4QA 1HZHL 5C3LD 3QIWB 5ISZA 3H3BC 5F1NA 1KTDA 3EAKA 4NO5B 3LD8B 1T1YA 5DK2B 3PJSB 3RY6A 3DX6A 4GG6B 5C0GB 5ETUA 1B88A 3L5XL 1AE6H 2BNRD 3OKOA 2XKNA 2RFXB 1N6VA 1ND0B 3H8NA 4NO0B 3FQRA 4X6DA 1EV2E 1UJ3C 1EEZA 1Y6MR 3WJJC 3GZKA 5KZCD 2QQKA 5DJYA 2ZUUA 2DD8H 1EEQA 5L6YL 2DQGL 5HD8C 3PHQA 4YGVB 5KW9H 3BZ4A 3SKUD 1FYHB 3SGJA 1RFDL 2IANE 2HLAA 4WI5A 5IQ9A 4D0DB 2EDYA 3GBMH 4QB1A 1B4JH 4N8PA 3HE6B 2UWEF 3LMJH 3EOBB 4PJFB 4I2XA 3ZT7A 5D7LB 4X9IA 1ZEAL 4BKLB 1JPFA 3MUZ1 2E9WA 4BZYA 2XNAB 4DKDC 3EO1A 5IT2L 4XVSL 5IB2B 2OI9C 4H25B 3KJ4B 3TT3L 1KEXA 4ZFFB 1CGSL 4OZOA 2APTA 3ACIA 1NAKL 3DO7A 3LS5L 1FZMB 2W95A 5DTFB 4TNVK 5FCUH 3VDCA 4BA8A 4OZFA 2WN3A 4MA8H 2FGWH 1OL0A 2VCBA 3WIIL 3TBSA 1QSVA 1H5BB 4KRPB 4LKSA 3KPMA 3VGAB 5F7NC 3SE8H 3RTQD 3OAUL 5AD0B 1R0AH 2XXMB 1MQKH 4XPHH 1TZIB 4FXGB 1WK0A 4P4KA 1YEJL 2B2XL 5ISZB 1GGIL 4OZHA 3WMSA 1KTDB 2HWZH 1WAAA 1T1YB 3EYUH 3UTSB 4XPTL 3DX6B 3ULSA 4PRAB 4P5YA 5IKCB 2XQBH 4OLZL 4XNQA 3OKOB 1BIHA 3FQRB 4NZTH 4X6DB 1EEZB 3Q3GB 4BELD 4OD3L 2GJZA 4XCNB 1GMMA 2W60A 3QNZB 5DJYB 4DXRA 3L5JA 5GSRA 1A02N 3BKYL 3PHQB 3BT2L 5A2KH 5IQ9B 2HLAB 3QIUD 2WO1A 4LHUD 3GK8L 3S37X 4JO3L 5DSCA 2HT4D 4HMDA 1MEXL 2RCSH 2QSTA 4I2XB 3ZTNH 1JPFB 3EO1B 5DJDA 2VRAA 3O3EA 3VFWA 5KVFH 3SDDD 4L8SC 4QNPF 1IAKA 4ZTPH 2CRYA 1WZ1H 3GM8A 4J6RL 4WHTA 4QYOA 5F8QC 4LASH 4TRPL 4NRZA 5IMLA 3DXAE 4HKJA 3MRFB 3GDBA 3DO7B 2DWDA 3DYMA 4TNVF 1MHPL 4IDLA 4IRZL 2VZVA 4OZFB 1VGKA 5E9DB 5BVPL 3GI9L 3TBSB 1FN4A 1QNZH 4X7CC 5B38A 1XIWD 1JUFA 3I84A 4XNZB 3HPJA 4R4FL 2XHNA 2GYSA 1FVCA 1NBZA 4QXGH 4U2ZA 3KPMB 4XVJL 5G04L 4GH7B 4XXCC 4RDQG 2GFBB 4L3EA 4P4KB 4OLYL 4ZUTB 1KJ2A 3WKNA 3VXNA 1ACYL 2R0LL 3IYLW 3SGEI 5LQBH 4OZHB 2A77L 5D6DA 3S4SG 4OAWA 2DQCL 3RPIB 4FQLL 1O8PA 3L7EB 3ULSB 4K3EL 4G8GA 3V5HA 4XNQB 5CSBA 1W72A 5F9OL 1GAFL 4F9PC 5LCWL 1RIUL 3C09B 2GJZB 4LARH 2W60B 4OIIL 4K2UL 3MRNA 5GSRB 1NUNB 4IJ3C 1OLLA 2YMXH 2AEPH 3DUSB 1VADA 3U79A 3A6OA 2GJ6B 4XP9L 3C6LB 2R69L 3E6HA 5DSCB 4H26A 3ZE2E 4PRHE 3RWFA 3JUZA 2QQMA 3B2UD 1U3HB 3F8UB 4LCUA 1IAII 1QRND 4LSSH 4OV6F 2X1WL 3OKEA 2NLJA 3H9HA 4LLDA 3VFWB 3ACFA 3TNMA 2UWEE 2QQNA 3WD5H 1IAKB 2ED9A 4WHTB 5TGBB 4G6KH 3SO3B 3AS1A 4C58B 4NRZB 5KVMC 5IMLB 4HKJB 1KIQA 4QX1A 2MWCA 2ZJSL 4MAYB 1FPTH 4XCEA 2VE6A 4LVHC 5F7EL 4UZGA 3MOAL 1NEUA 1VGKB 5MENA 3GSWA 3VFVB 4GKOA 1QVOA 3EHBC 3LB6C 2Y72A 5HYSG 5B38B 4HWBA 1ITBB 1JUFB 3GJEA 3HPJB 3ILPA 2C9KA 5HYQA 1T5XA 3VH8A 1NBZB 4NQVB 1HZHH 2J1VA 3QCTL 1KTKE 2J1EA 5EORL 4UU9A 4L3EB 3ISWA 4KU1A 1KJ2B 1KIRA 3DX7B 4G7VL 4OAWB 4RIRB 1F5WA 3L5XH 4NQDA 5J11C 3I6GA 4XCCL 5CEXB 1T0MB 2YPLA 4P2CG 2HTKC 4PREA 4LLWA 1W72B 3C6SB 1LILA 3O3AA 1CDBA 2H2PD 1RJYA 5L6YH 2DQGH 5ERWA 4LPTA 3OR6A 3FRPG 3MRNB 1XNTA 1RFDH 1MFBH 4FQXD 1H0DA 3QUYA 4M4RA 3NAAL 3ARBA 1UG9A 5SWZD 5I1DB 4L0PA 1VADB 4I8DA 2E31A 4GO6B 4Y4KC 2G5BB 3MJ9L 1ROWA 1Z9OA 3E6HB 3DIFB 4QT5A 1ZEAH 3VWJA 1DQLL 5JUEL 4A3ZA 5BOPA 3J7HA 5JUVA 5IT2H 1FNAA 4OF5A 4XVSH 4L1HA 4DK3A 4LCUB 5CJBA 4DUXA 4UNVA 2NLJB 1CGSH 1CDCA 3BISA 5JXHA 3TNMB 1NAKH 3KNBB 3LS5H 4LF3B 5E1AA 4RDQF 2ICEA 4I3GA 3VRJA 3HG1A 4Y5YA 3LVEA 1KIQB 2CK2A 4G80A 3UZQA 1NGWA 4IMLA 3VGBA 2PETA 5IMOA 1YUHA 4XCEB 3WIIH 4NN6B 2ORXA 3V7AG 1CFTA 4QNPE 5MENB 3MREA 5BRZA 4HLZH 5DD3L 1QVOB 3CSBA 1TJGL 5SWZE 3LPFA 2F53A 2BHZA 3ILPB 3OAUH 5HYQB 1T5XB 4NYLA 4ZSOA 4CUBA 5FGBA 1PMHX 1YEJH 5E5MA 3V5KA 5J1TC 2B2XH 3D18A 4UU9B 1HKLL 1GGIH 2AEQL 4LPVA 2DQTL 1KIRB 3WNKA 1E27B 4XPTH 3T0WA 4NQEA 3RGVA 4XGZA 4OLZH 3KPRD 5FA3A 4F15C 3Q5OA 1BQLL 5C6TL 3MJ7A 4RWYL 4E0RA 1ZK9A 4PREB 4LLWB 2EC9U 3BKJL 3O3AB 3RIFK 1A7QL 4F9LA 1RJYB 1E0OB 1XF4A 1K3ZA 5J57B 3BKYH 3QFDA 3I6KA 5ERWB 1KIPA 3BT2H 1H0DB 5SV4A 4A4AA 1MFNA 3ARBB 2VZQA 1H8OA 1N2RA 3GK8H 4PJGA 4J4PD 3RRQA 4JO3H 3ME0A 1EX0A 2GK0A 4HCRA 4S0SD 1C12A 4ZXBA 1D6EA 4J1UA 4QT5B 3VWJB 2H32A 2ITCB 3FB5A 2JIXB 4AIZA 2D0GA 3RTQC 4YHYB 5HHPA 3CLEL 4HXAL 4J6RH 2V2TB 2VLKD 4TRPH 3GSNL 4XX1E 3VD5A 5BVJA 5BW7A 4M93C 4WU7A 1I75A 5E1AB 1Q9WA 3HG1B 4Y5YB 4QO1A 4G80B 1MHPH 4IRZH 1TITA 1NGWB 5BVPH 5DVKA 5IMOB 1YUHB 3GI9H 5FKPA 3C60A 1A14L 1CFTB 2OL3A 3PV6A 4R4FH 5BRZB 4JFFD 2BSRA 2HYMA 4MXVF 5C7XL 4XVJH 4WEUD 3MNZA 4EJ1C 1OT1A 2F53B 5JXEA 3F2ZA 1MCOL 4N5UA 5K33A 5CYYA 4MXWL 3QEQD 4NYLB 4ZSOB 1JYWA 4OLYH 5E5MB 3U4EA 3V5KB 1ACYH 2PW1A 2R0LH 1BREA 2A77H 1BIIA 1TCRA 2AJZA 5EIYB 3QIUC 3RNQA 2DQCH 1BJ8A 4F7EA 5C0CA 4FQLH 4NBXB 3E2HB 3FN3A 4X80L 4Z78A 2HT4C 3CFCL 3HCVA 3RGVB 4K3EH 3HJRA 4XGZB 3QEHB 3IDYB 5FA3B 4JFDE 5F9OH 1GAFH 3DX8A 3ZYJA 1X3DA 3HFMH 3MJ7B 7CGTA 1RIUH 5KSAA 4E0RB 3TPUA 4OIIH 4K2UH 3RIFF 3SDDC 3T2NL 1JFQL 3O0RL 2W65B 4GFTB 3I6KB 3UBXI 1KIPB 2CIIB 4JFFE 5FF6A 3TA3A 4XP9H 1EXUA 2R69H 4F37F 3R0MA 4PJGB 3W9EA 5F7UA 3QEQE 2GK0B 4R4ND 2J1UA 5AAWA 1XIWC 1OH4A 2WUHA 1D6EB 1PX3A 2A6DA 3IB4A 4J1UB 4P59L 3TH2T 5CP7A 2H32B 3FB5B 4AIZB 2ZP0T 2IMMA 4IHOB 1JV5B 5HHPB 5E5RB 5BVJB 4WU7B 4KRNA 4LBEA 4C56E 1HQ4A 2ZJSH 3ZE0F 1Q9WB 5F7EH 3MOAH 2GITB 5FKPB 1Y0LA 2OL3B 3PV6B 5DURB 4QTHB 2BSRB 1IL1A 1FIEA 3MNZB 3QCTH 5I74B 2PXYD 5EORH 4NNYA 2CDGB 4JN1L 3U4EB 3BMWA 3KYKL 4G7VH 4OKVB 3SKVA 2FJGA 3JZ7A 1BIIB 1TCRB 2AJZB 3QHZL 4IRJA 5DK3A 3RNQB 3LQCA 3NJXA 4XCCH 2AXGA 4Z78B 4PJBA 2YRPA 4TXWA 3DX8B 3T0XA 1LK3L 4XZUA 2HJFA 3B2UC 3DMMD 5KSAB 3TPUB 1CS6A 5TF1L 3LH2L 4NKDA 3REVA 4YWGL 5HHXH 1RK0B 1S7VA 1GQPA 1N6QL 2A74B 3NAAH 2X4QA 3DOSA 4MQSB 5FF6B 2B5IC 3TA3B 4I3RL 4BQBA 1KN2L 5HHQA 4LQ1A 4PRPB 1WBYA 3MJ9H 3W9EB 1X5YA 1KNOA 1FV1A 2I60L 5CWSA 1DQLH 5JUEH 3N1GC 5D71L 3JVGC 2A6DB 2P5WD 3V52L 5CP7B 5DFVC 3NCYP 3NOIA 5JIHA 3VGHA 5IIEA 2IPTL 3HS0A 1I8LC 4GUPA 3X13A 1JPTL 1CF8H 1G6RL 2JJSC 4JB9L 4LBEB 4MNGE 1X4XA 3HZYA 5IHRA 5C08D 5GJSL 5SWQB 4DXSA 3QAZB 1QYGL 1EDQA 5C09D 3IDNB 3QG7L 3QQNA 5DD3H 1Y0LB 3OAZH 4DZBB 2VDPL 1TJGH 3RVTD 5EPMA 2ORBL 3VD4A 2H2PC 1IL1B 1PBYA 3IXAB 1E4KA 3LDBC 2A9NL 2C7UA 1JRHI 2CD0A 3NFNA 4NNYB 3WFHA 1HKLH 2AEQH 4NFCA 2DQTH 3KLHD 2X7LA 5HHOA 4H20L 4U0RC 1DLHA 4MXVE 1JJUA 4WI7A 4IRJB 4QPWA 2HTLD 2I9LA 2UUDK 3S36X 1N5AA 1BQLH 2AXGB 1MCJA 5C6TH 1U8HA 1KCVH 1MWAH 4PJBB 5JDSB 4RWYH 3NZ8A 4PY8J 2FX8L 3QQ3A 3BKJH 4XZUB 2DJ4A 5L8JB 2ZUQB 3X17A 4WO4D 4NQUA 4PGZA 2VZUA 3REVB 5C09E 2ZCKL 4LU5L 4PLJD 4YHOL 2NZ9D 4C55A 2X4QB 2IBBA 1A64A 5B8CB 5D7KD 3TZVD 5HHQB 1KNOB 1FV1B 3P0YH 5CWSB 2PYEE 4LCYA 3VXMA 4QXTA 1B90A 1P9MA 3IAGC 4WWID 4H8WL 5IIEB 3CLEH 4HXAH 3HS0B 3GSNH 4GUPB 3IFOB 5KVDL 5FK9A 3OPZL 2J22A 4NKIL 2ICES 3D85B 1U2CA 5D2NA 5E08H 2HT3D 3HZYB 4FABL 5AZ2L 1QPPA 5GS2H 1A14H 2OQJA 2QQQA 2A38A 4WHDA 5C7XH 2VKWA 2AJ3A 4NQXA 3MUY1 2Q8BL 2CSPA 5EPMB 5FUIA 1A22B 4OQTA 1MCOH 5DK0A 1Y6KR 3ILQD 3ZE0E 2FHFA 4MXWH 3RP1A 2ZCLL 4KHXL 5EWIL 2C7UB 2VDNL 1IZKA 3NFNB 3ZKXC 3M1BB 3WFHB 4MDJA 2X7LB 2EIZB 3G6DL 1AKJD 5HHOB 4D0CA 4J4PC 4NIKB 1DLHB 4X80H 3MRIA 5TE7L 3LEKA 1FCCA 4U1LA 3CFCH 1O5DT 2VZPA 1EFQA 2OS7A 1U8HB 4M9OA 3NZ8B 5IGXL 3REWB 2YD1A 4J3TA 1YNTA 2QSQA 1JFQH 4N0YL 3RZWA 3T2NH 3O0RH 3MV7A 1HILA 1TQCB 2UY6A 3F7PC 4DN3L 1HHGA 2I25N 3BH9A 1BF8A 1ZHLA 4KDWA 1D7PM 4G9DA 3WF3A 3OSKA 5CD5C 1OWWA 5MHSD 1XGQB 4P59H 4YHIA 4QDSA 1KLUA 2LU4A 2J1SA 4LCYB 3VXMB 4QXTB 3TLRA 3QJHA 3BEWA 4CRPA 3QXVA 5CJ8A 1RURL 5DMIL 1AGEB 2Y6KA 1WTLA 3WV0A 4KQ4L 5IB3A 2NTSP 3G6AA 4G6ML 4YK4C 2CQVA 4ENED 4K8RL 4BFIA 1OWRM 4LCCC 2IFGA 1JGUL 2OQJB 1ZHKA 1CZ8L 4OCWL 2AJ3B 1ZLSL 4P5MB 5DK0B 1BFOA 1JK8A 5T3ZE 1A3RL 2AVGA 4GRLB 4JN1H 4IMKC 3VXUD 4NUJA 5GGTL 1NFDF 3QHZH 3SDAA 2MTPA 5EBLB 4N8CL 3MV9E 1T6WA 2H8PA 4D0CB 4ZQKA 4ISVB 4U1LB 1ZLUK 1FP5A 3DI3B 4R4NC 4OM0L 2Y5TA 4BK5A 1HNFA 1LK3H 2DIAA 4CMHB 1UWGL 4OZIF 3QDGE 5TF1H 4FOMA 1F3JA 3VRIA 1YNTB 1YEHL 4YWGH 3LPGA 5KANI 1C1EL 3MV7B 2A6KA 1N6QH 1HILB 1UM6L 2OMNA 4JFED 4P5TD 4NM8L 3OB8A 4L9LA 3TCXA 2BSSB 4H8WC 1ZHLB 1PVHA 4I3RH 1KN2H 4G9DB 4A45A 1HHHA 2LTQC 4IM8A 1T0PB 2I60H 1NANH 5D71H 4PJ5D 1D9KB 3V52H 5I8OL 1KLUB 2EYTA 5EZOL 2IPTH 3ARSA 3VXRA 3QJHB 3BEWB 1MCLA 2PXYC 1JPTH 2HJKA 3K46A 4MA1C 3RWJB 3QEGL 1G6RH 4JB9H 1UKQA 2NY1C 3BEVA 2D7OA 3B9VA 1HHKA 3J8F7 2WN2A 4UV7L 5GJSH 3C8KA 3G6AB 1QYGH 3S6CA 4BFIB 2GUOB 4NO3A 4JFEE 4FTVB 3QG7H 3QUMA 2VDPH 2ORBH 1WZMA 1B0WA 3FT4A 3ZLQC 2XIDA 3DMMC 1L7QA 2A9NH 3C5SA 1IEHA 5GRVK 3JTTB 1K42A 1JK8B 1U8IA 1ORSA 4AG4A 1U8PA 4NUJB 4P3DA 4H20H 3SDAB 2HRPL 1KCSL 1U93B 4NRXA 2EEAA 1J12A 2H8PB 4U1GB 1UM5L 4ACPA 1E4XI 1I4FA 3T2PA 3EYFA 2FX8H 2PF6A 5DEGB 4WGWB 4XPGL 3SKNA 4YUEH 1BM3L 3D6GA 1QR1A 2ZCKH 3VRIB 3RL1A 4LU5H 4OIAA 2AP2A 2A6KB 2FZ3A 1CXEA 5T3ZL 1LO5A 4L9LB 3THDA 5F1IA 4PRIB 5DQ0A 2DTSA 3UO1L 4CN6A 3MLYL 4NC2B 3MBED 1HHJB 1NMCC 5K9QI 1AQKL 4WIQA 4M6OL 3HAEH 1U3JA 4LSRL 1LP9B 3RVTC 3HTLX 4OCRL 1CLYL 1H15A 4H8WH 3VXRB 3ZTJH 5E8OA 5KVDH 2HJKB 3OPZH 3L95B 2IFFL 4NKIH 3BEVB 1HHKB 3A6CL 4JDVA 4FABH 2VZTA 5AZ2H 4MQ7B 2HTLC 2A73A 3K2MC 2BOBA 3IDAA 4NO3B 3CSGA 2BXZA 2YWYA 2Q8BH 4DCQA 1W0WA 2IBZY 3FT4B 4P2QB 1M05A 2ZCLH 5EC1A 4IRSD 4KHXH 4WO4C 2YEZA 2EE2A 5EWIH 1QKZL 2VDNH 1A9EA 3C5SB 5FEBA 4Y2DA 4IOIA 2WMPA 1U8IB 4LIQE 4DEVA 2HH0L 1S3KL 5A1AA 1ORSB 4PLJC 1J0HA 2NZ9C 2OCFD 3VG9B 3G6DH 1U8PB 4WTXA 5E2VL 5TE7H 5A2LH 1UB5A 2DOCA 4NRXB 3TZVC 3MTRA 4X4MA 4UI2A 4RSVA 3MLRL 4Y1AB 1J9CT 1I4FB 4EXPX 5DXWA 3TBYA 5IGXH 1NFDE 3NABL 4N0YH 3MRCA 1EUTA 3IFPB 2OTWA 3QPXL 4DN3H 3RL1B 4CJ1A 1JGEB 2PTVA 2A6JA 1A7BA 4L4VE 2FZ3B 3FO1B 3KPSE 1RUPL 1LO5B 5MI0C 4OUOA 5F1IB 3BSZL 3SE4C 1F13A 2HT3C 4OZIE 2YA1A 2X10A 5EB9A 5GZOD 1B3JA 1FFQA 3SJVA 4RGND 1YPZE 5ABDE 4ZUSA 5BQ7A 1A4JA 3VWKD 3ARFD 2DTML 4LQFH 3P73A 5C6PB 1H15B 3ILQC 4MMXC 5AEAA 1RURH 5D7JB 3MO4A 1MCSA 5DMIH 3GB7A 3PP3H 4LLUB 3NFPA 4KGJA 1S8DB 4EUPH 2WAAA 1SM3L 3IS0X 4KQ4H 1DUYB 4JRXA 3CDFA 3GJFK 4G6MH 4XH2A 3WIHL 4K8RH 4JDVB 4XVHA 1JGUH 2A73B 3E6FA 1CZ8H 1I7RA 4OCWH 2KKQA 4DW2L 5HDOA 1ZLSH 1PDKA 4DCQB 1U8JA 2YOCA 5I71B 3B4NA 3M8OL 2NY4D 2WUBL 1X5ZA 5EC1B 1A3RH 4K7PX 2YEZB 1L4IA 4Y2DB 5F3BB 3WNOA 4IOIB 4PJXF 5GGTH 4K7FA 2VC2L 4Z7WF 1BBDL 4N8CH 4UV4L 1IJ9A 5E6ID 4PT6A 1UB5B 1YEFL 5ANMA 4OM0H 1ULPA 2CRIA 4HIXH 4OCYL 5LAXB 1PKQE 3TBYB 1UWGH 4WVRA 2OR9L 4Y4FD 4XXDB 1YEHH 5KBNC 4UAOB 3MRCB 1C1EH 1IGFL 1UM6H 4ELMF 3JSSA 4NM8H 4PJHA 2BHUA 1FYTD 3EZ8A 1M1SA 5E2JA 4QF1A 1MRCL 3PDOA 4LIQL 1VSCA 3GNML 4YHNA 2VAJA 5B39G 3CFDA 4ALAH 4ENEC 5ICYA 4H0GA 1UVQA 5L2KD 1VGEL 4TUKL 4ZO8A 2VO5A 3C5ZB 3SJVB 2VKXA 1GOFA 4K3GA 1BD2D 5I8OH 4XRCA 4ZUSB 5BQ7B 1MPAL 3MGAA 1MWAA 1MI5A 3EYSH 4MGXA 5EZOH 3P73B 2VLRD 5CCKL 5I1JL 3QEGH 2ORZA 2NR6C 3GB7B 4ODVL 4MOAA 5C8JA 3NFPB 4WUUD 4UV7H 3V2AR 4N9GA 3GI8L 4G9FA 4DEPB 4XH2B 5SX5K 2CK0L 1HINL 2FDBP 1PYWB 2VL5B 1OAXL 3B6SA 3WHE0 1X4ZA 4NKOA 3HNMA 3VA2C 1U8JB 1C7SA 3L7FB 1CQYA 1CLOL 1P5VA 4LSPL 1BD2E 3ZKND 4P5TC 3D3VA 3KR3L 1YY8A 4K7FB 1KCSH 1TZHA 2VDRL 4DFIA 3NTCL 4TVPL 1Q72L 4KHTL 4XPGH 3AY4C 3C87A 1BM3H 5ICZA 1S7SB 3VGEA 1KB5A 4YXKL 1Q94A 5K93A 1IC1A 4PJHB 4N90D 1M7IA 3UO1H 3MLYH 4QF1B 2C3WA 3PDOB 4XUOA 2YPVL 4YDVA 4CN4A 1AQKH 5ICYB 4M6OH 4GLRH 1UVQB 4LSRH 1MHCA 5GS0L 2ZXQA 2R4SL 4XRCB 4J8RA 4FS0A 4OCRH 1CLYH 3FHQA 1IC4L 1MWAB 3OKDA 3B9KD 2VUYA 3UPAA 2ERJB 2CUIA 3I9GL 4Y19D 5DVLA 4G43B 4KVCL 4RFNB 2IFFH 3N0PB 5E0QA 5C8JB 4K94L 5HYJE 1UY0A 3A6CH 1BHGA 4N9GB 4JQVC 1EBPA 3V6BR 3B6SB 3G6JF 4N90E 1JIBA 5D7IA 4PGJA 3ARVA 5A2JH 4BQ6A 1QKZH 1KENL 4RA3A 1OD7A 1S3KH 4RZCA 3ZDXF 3SE3A 3SQOL 3D3VB 5EFIA 5IB1A 5KTEL 5J1AA 2IBGA 5EO1A 1YY8B 5E2VH 5E8DH 1BFTA 2E8ZA 3IU3A 1TZHB 3MBEC 3MLRH 1Z5LB 3QQ4A 4MZ2A 4O02L 4LVNB 4PJXE 3TYFA 3NABH 4Z7WE 4HS8L 3BPLB 4EDXA 5ICZB 1RYYA 1BVLA 1MLBA 4JAMB 3QPXH 1KB5B 5I1KL 1Q94B 5K59F 3RKDD 1RD6A 2MQCA 3P3YA 1RUPH 2PW2B 3BSZH 3QWRD 1M7IB 5DI8A 4MCYA 4QGYA 2J88L 3FFCD 4JEGB 3Q48A 4QHNB 4YDVB 4Q9QL 2FECI 1MAJA 4KZDL 4QRRE 4DZ8A 1Q9KB 1MHCB 4JLRA 2DTMH 1DQQA 3BGFC 1K6QL 3O9WD 4J8RB 5GRVL 1IILE 1F8TL 5GGSA 4UMGA 3OKDB 1X5XA 4PJIF 4WI2A 3BE1L 4CN1A 1RZIA 1PKOA 5A2IH 4AIOA 1SM3H 1U8OA 1NC4B 5E24E 2ZSVB 3VW3L 4XP1L 2UUDH 3WIHH 1CD0A 2AABL 2DLTA 1FO0A 3MLWL 4N0FB 5AUMB 5FGRA 2B1AL 4YHPB 3PIQA 5EZIL 1UA6L 4LLVA 4BK4A 3MUHL 2HFFA 3CSPA 1G7HB 3U7AA 2KD7A 4LLAA 1S7UB 3U7WL 4DW2H 1P8JA 2AQ2A 1X9QA 5D7IB 3M8OH 2WUBH 5C86A 3K2UL 3VFNA 2AK1L 4LEOB 3OAYK 4JANA 2VC2H 1BBDH 4N1EA 1DBKL 3IJSB 4UV4H 5IB1B 5J1AB 5EO1B 3A0OA 1TPXC 1YEFH 5GZOC 4WW1A 2CJUL 4KJWD 4WFED 2Z91A 1MIEL 4RGNC 4OCYH 4N8VG 3QQ4B 4YO0B 4F3FB 3VWKC 3ARFC 2OR9H 5EU7C 3D25B 1NAMA 3TYFB 1FDLL 4OUUB 4EDXB 1X5JA 1IGFH 5FGCE 4Z7NF 5ICXA 3WSOA 1BVLB 1MLBB 4NZUL 1JZ3A 1S78D 4RMVA 3RWCA 2XG5A 1MRFL 2Q76A 3WFBL 1MRCH 4LIQH 2VL4A 3RDTA 1RIHL 3SY0A 2Z93B 5DI8B 2Z9TA 4P46B 4I4WA 2ILLA 1VGEH 3H3PH 4Z77A 4TUKH 1OD9A 2RBLA 1MPAH 3D2UA 1FHGA 2Q86A 3U46A 4BSVB 3QB7C 4JLRB 3DECA 3LKSA 3IRZA 1YECL 2NY4C 5GGSB 5CCKH 1YC7A 2Z31D 4RISL 4WFEE 5F6IB 5FIEA 4ODVH 3KPNA 4PV8A 1U8OB 5CP3A 1A6AA 1DEDA 2QJDA 3QFJA 3GI8H 3WSQL 2DWEA 2CK0H 5E6IC 1HINH 3PIQB 1FJ1A 3QDJD 1OAXH 2HFFB 4JPWL 2G2RA 1PLGL 1QFHA 3HAEA 4P9HC 1ZLWK 3H9SD 4DJMA 1TJHL 4XUQA 4A6YA 5KG9A 2IPUG 4RN5A 2MQ3A 4N9OB 1CLOH 4LSPH 3VFNB 4JCLA 4MJID 3VGDA 5JPNA 3IDIB 2OP4L 3KR3H 3S3JA 5DUPL 4ELKB 5C9JA 1J5OL 1G6RB 4WNQA 2VDRH 3NTCH 4RNRA 1NUKA 1QACA 4TVPH 1Q72H 4WW1B 3O8XA 2Z91B 5L0QC 1FFOA 4KHTH 2WWKO 3ZDXE 2FX7L 1NAMB 1MCDA 2AJXL 4YXKH 3QDJE 1FNFA 5IBUB 5ICXB 4H0HB 3TO2A 3P9LA 1HWHB 4LHSA 2IMNA 3NCYS 3H9SE 2OM5A 2BCKA 4XHJD 1CXLA 2HJLB 3RDTB 2C4XA 2YD4A 3SY0B 4I77L 5F93C 5GS0H 2GSGA 2R4SH 2DCJA 5EOQL 4ZOCA 5K59E 3PABA 3D2UB 2Q86B 3U46B 3V6FA 1NCUA 1IC4H 1CU4L 3ZKSD 3I9GH 1Y18A 3S8WA 4ZUWB 3P9MA 2XXCB 4KVCH 3ZKNC 1D5BA 2PR4L 4I18B 4K94H 1M4KA 3KPNB 4ODHL 3NCBB 3PHOA 4NO2A 3TN0D 4LCIL 1A3LL 3QFJB 4FQHA 4NM4L 4W81A 4QRTA 1JE6A 4PJ9C 4PJIE 2AI0L 1FJ1B 1J8HD 4S10A 5CJXA 2APVA 4MJ6A 2G2RB 3HAEB 3C8XA 3IJHA 2VXVL 2YKLL 5AWNL 1KCRL 4A6YB 4G8FA 1KENH 3VFPA 3E3QE 5I66B 4U1NA 3VXSE 5CILL 5TFSL 3L3IA 3SQOH 1XGRA 3MRHB 2YC2A 5JPNB 5KTEH 4EUPA 1DBJL 3MLSL 4OF6A 4L8DA 3CZJA 4QRPE 5C9JB 2V7HA 4WNQB 5AZEL 1TG7A 5HHME 5HI4D 1MFCL 4JY4A 4LOUD 4O02H 3NIGF 3O8XB 4ZFGL 1JF1A 1FFOB 1FGNL 5F7DA 5GIRA 4JFOA 3VFUA 3PWPD 1FL5B 4HS8H 1UCTA 3VMPA 1CD8A 1QTYT 4J7RA 4WV1C 5I1KH 4ZS6D 2BVUA 1J8HE 1CXFA 3IGAA 2FJHA 3P9LB 2G9HA 3RY5A 3QUXB 2Y6GA 5GGTA 2CR3A 2J88H 2BCKB 2YG0A 3ECQA 4Q9QH 5FO7B 3SKOB 4DVBB 4KZDH 4Z7NE 1UZ0A 4Q97A 4EVNB 1K6QH 5D1QA 3PABB 4OBSA 4JY5L 3V6FB 2V2XB 1F8TH 3D0VA 2EDEA 3BE1H 3L3OA 3G5XB 4JN2A 4JPKL 1OGAE 4CU9A 5FOJA 1Y18B 3P9MB 3ABZA 3VFSA 1D5BB 3IXTB 4JREC 3VW3H 3PWPE 4XP1H 1R3HB 4LRIA 4CW1A 3MLWH 2XZQL 3PHOB 2B1AH 2NW3A 5EZIH 1UA6H 4FQHB 1I3GL 1CN4A 4QRTB 2NXZB 4PP2A 1U91A 5KS9A 3RNKA 1EVUA 2P5EA 4AL8L 3VU2A 4MJ6B 5CUSL 4PJ8B 1CFNA 3HC0A 3K2UH 2YD9A 5BZDA 4G8FB 1NAEA 2AK1H 5DA4A 4HF5L 4U1NB 1RIVL 2CR6A 3L3IB 3RKDC 2WW8A 4IS6A 1XGRB 2ID4A 3NZHL 4EUPB 1FAIL 5I73C 1B4RA 5EU6E 1KSRA 3VXPA 3MOBL 4JQXC 4L8DB 4I0PD 5FOBA 4PGDA 2V7HB 2CJUH 1MIEH 3K0WA 1I1AA 2Y7QA 4JY4B 4NN7C 3VCLA 3AB0C 5F7DB 5GIRB 3IT8D 1FDLH 3O9WC 1J0JA 3VFUB 3ZYIA 4JHBA 3LE0A 2HYXA 4NZUH 4NT6B 1RVFL 2PYEB 3AM8C 4OIBA 3C5JA 5IWLA 1MRFH 3IGAB 2VLJD 2J8UF 2FJHB 3WFBH 4QY8A 1KLGA 2F54A 4ZNEE 2G9HB 4HH9A 1RIHH 2XV6B 4M43L 2H3NB 4JRYD 2F8XC 2YD6A 2NXYB 5I18L 1ADQA 3KGRA 4K55A 4JGJA 5FYJU 1G7LA 1QFUL 3QDMA 1W9SA 1YECH 3D0VB 3MR9A 4HW6A 4RISH 5D5MF 3L3OB 1GUIA 4JN2B 1QSFE 4TVSa 4L5FL 5TJWK 1HDMA 4GG8A 1LEIB 4P3WA 5IFHL 2W1WA 3HR5B 1U58A 2VQTA 5TDPA 3WSQH 5H37G 4Y0GA 5D1XD 2NW3B 4KFZC 4X7SL 3NIDF 1RZFL 2ZSWB 1N26A 5ALCL 5B4XA 4JPWH 2V7NA 4PP2B 1U91B 1PLGH 5KS9B 1QZ1A 5T5FL 2P48B 1TJHH 3RNKB 3BPNC 5D93B 3W0WD 4IEFB 3VXQA 2X5PA 1NGZA 3MUJA 1CFNB 3BRGC 5BZDB 1BQSA 1S78C 1F2QA 4E41D 4M62L 5I75B 2CGRL 4KROD 3RX7A 2OP4H 2B8OT 5DUPH 4HX1A 5C07A 1XF3A 4IS6B 1WFNA 1J5OH 3VXPB 5FOBB 4PGDB 3GIVB 1LO0L 1I1AB 2Y7QB 3MXWL 4U3HA 2FX7H 3LPWA 1TTUA 3VCLB 2ED7A 1WZLA 5FAAA 4M02A 1MCKA 2AJXH 4YNYA 3WN5C 2Z31C 1B2WL 1UH2A 3GJFH 3NIGE 1R3KA 2F54B 4GJTB 1F58L 1OW0C 1LDPL 2XFXB 2VDKL 2FNBA 2MKLC 3NPSC 5EOQH 5DJ6A 4A6OA 4V1DE 3RVWD 3MXVL 1U8MA 1A6VL 5JW4Q 3JUYA 1CU4H 1G7LB 3QDMB 4XC1L 4GW5B 5J12B 3MR9B 4M1CC 3TIDA 5IR1A 2YRLA 2MFNA 4X8JA 2PR4H 1HDMB 4ODHH 4L29A 1HSAB 2NY3B 4GT7A 3T0EA 2W59A 4LCIH 1A3LH 1U58B 4NM4H 4QOKD 5TDPB 2FO4A 4R26L 1MPXA 3PWNA 1CDHA 2AI0H 5JR1L 1W9WA 3SE9L 5C0AE 1P4BL 3W2DL 1GU3A 2V7NB 1CCZA 5ID0A 1AY1L 2VXVH 2YKLH 5AWNH 1KCRH 5L88L 2D4FA 3VXQB 2ADGA 1NGZB 3O2DL 2IC2A 4L4TA 1JGDA 3CLFL 1IKFL 5CILH 1UJ3A 2X4NA 5TFSH 3WJJA 1UQSA 2BNQA 1AP2A 1DFBL 2Y9RT 3QDGB 1U0QA 3MLSH 5C07B 4HX1B 1XF3B 3TVMD 4XHJC 2VC9A 3CDGA 5AZEH 3CX2A 2NW2B 3E3QC 1MFCH 5B3JF 12E8L 3M45A 4KH2A 4MB5A 4ZFGH 1FGNH 3MV8E 1OY3B 4JHWL 4WTZG 3WO3B 3EDEA 5GS1C 1G9MC 4YNYB 2XZAL 3F7RA 5EU3B 2Q7YA 5SX5H 3S35X 1R3KB 1X6NA 3TN0C 4GAYA 5C2BL 2XN9D 3QSKB 2FL5B 4PGCA 1NJ9B 4ZS7L 4XHQA 3CDZB 2J8UE 4JY5H 1JGVL 2VQ1A 4OZFG 1U8MB 5CJQL 2WP3O 4OCLC 4JPKH 4GG6F 4HC1L 4Z95L 2BHYA 2JJTC 4X8JB 5DEZA 5FO8A 4R0LC 1X7QA 2E7LC 4L29B 3B83A 2XZQH 4UAPA 4NC0B 1I3GH 2QQLL 4DKFL 1NGQL 3PWNB 5D5ME 3U36A 5HI4C 4ZYKA 4LOUC 4AL8H 5FDWB 5CUSH 3MA9L 4MNQE 4X6CE 5ID0B 3CXDH 5GGUA 1YEEL 4C83A 2ADGB 3LKPA 4L4TB 4HF5H 4ZS6C 1DZBA 2X4NB 1RIVH 3NIDE 4PJFF 1UQSB 3ULUF 2BNQB 1AP2B 4HJJL 3NZHH 1URLA 3QI9D 1FAIH 5A16A 2R2BA 3MOBH 3FL7A 1A5FL 3UXFA 2X2YA 3CDGB 1QHPA 1BJMA 4OT1L 1U3YA 1A21A 3QZWA 1K8DA 4Y8AA 1FCGA 5D70L 1AXIB 2YZ8A 4DK6A 1RVFH 1LEGA 2IALA 4Y4HD 4FQ1L 4HGMA 1KCLA 1RUAL 3ARRA 2Q7YB 1AO7A 4BJLA 1CFSA 4M43H 3Q1SL 3SPVA 3FB8A 1HXYA 4GAYB 5I18H 2ZOLA 3STBA 4OZ4A 4PGCB 3CPLA 1D5ZA 4HZLA 1AFVL 2ZG2A 4JKKA 2VISA 1QFUH 4NQCD 1WTGT 2VQ1B 4XBPB 5B38G 4L5FH 4G8EA 2W91A 3G08A 3U0TA 5IFHH 1JWUA 3T3PF 1ZTXL 1U36A 5FO8B 5EO9A 1X7QB 4XXCA 1OTUD 4N0UA 4X6DF 4AMKL 1INEL 1T7WA 1H3UA 1NQBA 4I0PC 4X7SH 1LO4L 4J23A 4YXHL 1RZFH 5ALCH 2I26N 3OL2A 5IQ7L 4A2LA 5F9WB 5T5FH 3U36B 2W0FB 4ZYKB 1DL7L 3MRKB 2QADC 3PUHA 2JLLA 1JPSL 5GGUB 5IB4A 3SDCD 3EYQD 2FEEI 2Y07L 4M62H 3LKPB 2CGRH 4F9PA 4L3CA 4JGUA 1U6AH 4R2GB 3UJIL 4Z0XA 1I1RA 5D1ZD 2BP3A 1BWMA 5A16B 1YN7A 2R2BB 2BVOA 2E7MA 3MO1A 4P2RE 1D6VH 1LO0H 3OGCA 2YN5A 4L4VB 5T1DL 4PBVC 4BZ2L 3IDMA 2DQDL 3H2WA 4KRLB 3MXWH 3QZWB 3S96B 1K8DB 3QIWD 4OLWL 1T0NA 3ZHDA 3HB3D 2X4TA 2C1OA 3O4LE 1B2WH 1LEGB 2IALB 4EN3D 4YXLL 5B3JE 5C0BE 4BJ0A 4YX2L 4JGMA 3PUCA 1NKGA 2VXTL 3HNVL 1F58H 1I8MB 4NO0D 1LDPH 4J3OC 2Q3AA 1AO7B 1WFUA 1CFSB 3SPVB 1GC1C 2EE3A 2VDKH 5D1XC 1HXYB 3ULVF 3OJ2C 2J5LC 2YR3A 3SDXA 1SJXA 2ZOLB 5IV2B 3DVGA 3CPLB 3MXVH 1A6VH 1D5ZB 4HZLB 5C71A 3IVKA 3KXFA 2VISB 1EGJL 2YB7A 4XC1H 1WAAF 2ZPKL 2COQA 4HFWA 3HE6D 3FOMA 4KROC 4G8EB 1O59A 4P23D 3G08B 3U0TB 1JWUB 5EO9B 5D7LD 5HTSA 2DKMA 2YFUA 4D94A 2NY0B 4N0UB 2CH8A 4R26H 4OKDA 5JR1H 4PLOB 3LQMA 3SCMB 4GG6E 3W2DH 1P4BH 5L7XL 1Z0MA 1LNUA 1AY1H 2HVJA 5L88H 4H5SA 4JZOA 3MLZL 3WO4B 3CLFH 5I1AA 1IKFH 5CBAB 5IB4B 3P1IA 1DFBH 5JR2A 5DA0B 4GBXD 1FFPA 4L3CB 4UTAL 1J05A 4KRPD 4Z0XB 2GIYA 3FQNB 3GSQA 2C3XA 1YN7B 2BVOB 2Q6WA 4OD1H 12E8H 3G5YB 1HNGA 3OGCB 2QBWA 5DJXA 3GKZA 3IDMB 4PJFE 5EO0B 5JHDA 3ULUE 2O26U 4JHWH 5D7LE 1CD1A 3RVWC 4HV8A 4Y4KA 5ISZD 5L8LB 4NP4L 3FO2A 2X4TB 1DN0A 1QHOA 2XKSA 5DD6A 3UTSD 3RX8A 1X5IA 3BD3A 4RYDA 1T21A 5M7QA 1VPOL 1VDGA 2ZZUT 4PG2C 2HP4A 4C4KO 4P48A 4AM0A 1I3RA 3BP4A 3KDMA 4QWWC 5C2BH 2DL2A 1ZLWH 1JHLL 3U7YL 1X5FA 1RZ7L 1SVZA 4ZS7H 3DVGB 1JGVH 1SDDB 4QCIA 5CJQH 1ZLVK 3IVKB 3KXFB 2YN3A 2BNRA 2Z4FA 5CIPA 1WEJL 4HC1H 2A1WL 3ALXA 4Z95H 5LKNA 3LZFL 5SV3A 1LE5A 1IC5L 4HFWB 3FOMB 3ETBF 4LLQA 4GRMA 2FBOJ 4D8MA 5ISZE 2BC4A 3TVMC 2QQLH 3WYRA 5IBLD 4ZTOL 4R7NA 1BLNA 4DKFH 3V6OC 1NGQH 4DVRL 3ARQA 5DHVH 2CIKA 1QLFA 3S5LA 4N1CA 3LKRA 4YDKL 3MA9H 4LKCA 1LNUB 1Z9MA 3T3PE 2XA3A 2R56L 3LQAC 4H5SB 1YEEH 1WISA 4X6DE 4NN5B 5LJYH 4J2XA 5I1AB 3V0VA 4TOYL 5E9DD 3QHTC 1FFPB 3ARWA 2DCKA 3RL2A 2ZUSA 1J05B 2AK4A 4IUGA 2I07A 1A5FH 5FUCC 3EYVA 4OT1H 2I9TA 4RFEA 4TSBL 5DJXB 2FLBT 2DI9A 5B22A 4I2XE 5FHAL 2NY5C 1WGOA 5D70H 4HV8B 4KKCD 1UX7A 1R64A 2CRMA 4CJ0A 4TYUA 1MVUA 1ZVYA 2VABA 4LPCA 3FO2B 4FQ1H 1DN0B 5J7CC 4KKNA 3ZKQD 5DD6B 1UXZA 1RUAH 4Z7VA 1KLFA 1T21B 3MV11 3Q1SH 5LCVL 2V5SA 1ZSDA 5F88B 3OKKA 1I3RB 3BP4B 2IG2L 1ZWIA 3HA0A 1AFVH 4NRYA 1JN6B 3ZHKA 3QBTB 3ULUL 2BNRB 4KV5F 4U7MA 5F44A 2GJ6D 2XZCL 3C6LD 5CIPB 4KDTC 3ULVE 3CFJB 1NUDA 5KZCB 2FX9L 4JX0A 1YC8A 1ZTXH 1LE5B 4G7YL 5H8DA 3EJYC 3QI9C 4LLQB 4AMKH 1INEH 4GRMB 2YPKA 2BC4B 4YZFF 4OZHE 1RZKL 4HWZA 1LO4H 4W6XB 5BZWA 1U3HD 4YXHH 5IQ7H 5J06A 3MRGA 1WAAE 4X9BA 5HGHA 3A22A 1BLNB 5HGGS 1GHFL 4BYHA 4WWKD 1H8SA 1JZ5A 4PGEA 3HLAA 2CIKB 3F7QA 1DL7H 3QIUA 4LHUA 1QLFB 4Z7UA 3S5LB 3LKRB 4LKCB 2IAMD 1ACZA 3BHBB 2F19L 1JPSH 4HJGA 3U6RA 4F15B 2Y07H 1PAMA 2DMBA 4MAYD 4Y4HC 2YK1L 2DQUL 4B5EA 2ZG1A 3V0VB 3UJIH 4HPYL 4ERSL 3QIBD 4FN0A 2GTWA 3LOWA 4BFBD 4RAVA 3VE0A 2AK4B 3ZE1F 2V72A 2I07B 3ZKMD 2ZEWA 4M7LL 3EYVB 5T1DH 1OAUL 4BZ2H 2DQDH 4RMSA 4AJ0A 2I9TB 1WICA 5DRWB 2RQ8A 5EA0L 4RFEB 2DQHL 4YDLC 4L3ED 4OLWH 4KAQL 3ZM8A 2C3VB 1YDPB 1HOCA 1XIWA 4ELMB 1MVUB 4YXLH 2Y23A 3I3EA 4Y89A 4YX2H 2VXTH 1EAPB 3VGFA 3HNVH 4Z7VB 4LVEA 1GZQB 1OTUC 1K4CA 2DYPB 2SEBA 2W5FA 1BZ7A 3DWTA 1ZSDB 3RAJL 3C7OA 4M93B 3OKKB 3QUZC 1J1XL 1ZWIB 2Z0BA 2YD5A 5I15L 3RUGA 4NRYB 5FM5M 1EGJH 3WDJA 5EIIA 1SJHA 2VAAA 2ZPKH 3SDCC 1IE5A 3EYQC 4QX2A 3ARED 4U6TA 3WS3B 3CIHA 4L3EE 2EEDA 5D1ZC 5JOFA 1YMMA 2YPKB 1N8ZA 4L8CA 4A41A 3FRUA 5BZWB 5DVNA 3MRGB 5L7XH 4R97C 3QHFL 1T89A 4HPOL 4PY7A 4JZJC 3MMEB 1TDQA 4CUCA 3HLAB 1ORQA 4LHUB 3MLZH 3QIWC 3TT1L 4G8GE 1BOYA 3T08A 1T22A 5I1GL 2N1KA 3L3JA 3LD8C 4HJGB 4PJGF 4KZEL 3PUIA 2D7NA 2HG5A 4EN3C 4Y5VA 1QRNA 1NEZA 2EDXA 4UTAH 4ZPVA 3ULVL 4QHKJ 5E8NA 2GTWB 3ACHA 4RAVB 1I3UA 3VE0B 1FNLA 2EIEA 3V4PL 1SEBA 3NA4A 4FFYL 3F12A 2D7PA 4NP4H 1JTOA 1WUNT 1HOCB 4JJHA 1P84K 3P4OB 2GY5A 1KELL 3U1SL 1JPGA 4Z7OF 3OKNA 3HE6C 1F4YL 3GSRA 1VPOH 3QR2A 3NCJH 3ULUC 1KF9B 5CZXD 1I8LA 1K4CB 2SEBB 4FNLL 1JHLH 3NCEB 1BZ7B 3F5WB 4AEHL 2JJSA 1ITCA 2BRRL 1RZ7H 4HWEL 3KJ4C 1U9KA 5FB8A 3F62A 5MENE 3RUGB 3GSVA 1P1ZA 4LCWA 3GGLA 3PWVA 5EIIB 1J84A 1CGUA 2AXFB 1SJHB 1WEJH 2YD2A 2VAAB 5CEZD 2A1WH 1TLKA 1AGFA 4I0KA 4X98A 2CDFB 4HIEA 1T1WB 3LZFH 1OF2A 1IC5H 4XI5C 4JKWA 1V3MA 1WLHA 4PJ7A 4GBXC 2H26B 1H5BC 2X4OA 2EE9A 4KRPC 2EDTA 3H9ZA 4A44A 4ZTOH 5JOFB 1CICD 1YMMB 3I02A 4FQXA 4MS8D 1N8ZB 4DVRH 2JIXD 1JZ7A 2QV2A 4KV5E 3FRUB 4CADB 4LP4A 3G6JB 4NQDE 1HK6A 2R1YB 2R56H 1ORQB 2YPLE 3O6FA 5T1LA 3EO0B 1T22B 4W6WB 4YZFE 3L3JB 2OKXA 3RGHA 4QHLA 2L4OA 4TOYH 2HG5B 1UM4L 4Y5VB 1NEZB 4ZPVB 4MJ2A 1NMBL 5DJZA 4PV9A 4PRBA 4G8IB 5E8NB 3BZFB 4O2FA 3GRWA 2QL1A 5LA1A 1CX1A 3GMPB 5DF0A 4TSBH 3DRTA 4HIJA 5CJOL 1SEBB 3L3HB 5FHAH 4AYFA 3VXTB 3PP4L 3HI1A 3VFOB 5ITFA 3F12B 3ZE1E 2KQMA 2G60H 3WHE1 1A6TB 1W72L 1JPGB 1UH4A 3RGVD 3GSRB 3O11A 5LCVH 3U83A 5IBLC 1L6XA 3HG1E 2IG2H 3DX9A 1RK1A 2XA8L 4TUJA 2YUVA 1PSKL 1DLFL 3W5MA 3GSVB 4LCWB 5BRZE 3ULUH 3PWVB 2JJWA 3KPRA 3VMOA 2BY3A 2XZCH 2F53E 3O3DA 4FQPA 2PUQT 4X98B 1IARB 1E28A 2FX9H 1L0XA 4HIEB 1OF2B 4ZSOE 2PO6A 4G7YH 4PJ7B 4PJBF 1IEAA 3LDBB 2X4OB 1RZKH 3VXSB 1H3TA 3WFDL 2QQNL 4JPVL 2QR0A 1GHFH 4FQXB 5ADPL 3JWNC 4NQEE 1QA9A 5IROC 4CMMB 4Q9RL 4J4PA 4P4KC 2F19H 3O6FB 2RAMA 1QR4A 5T1LB 1REIA 2YK1H 4KWUA 2DQUH 4QHLB 4HWBL 2JELL 5DJAA 1JPST 4HPYH 4ERSH 3I2FA 1AGDA 1CXIA 5DJZB 5KAQG 2VLKA 5DURD 3QO1A 4PRBB 4ZO7A 4M7LH 1OAUH 3K4AA 2QBXA 3C09C 4PJGE 5EA0H 2DQHH 2MOVA 3P4NA 1C5DA 4M8VA 1SMOA 3DRTB 2WBJD 5E00A 4UDUA 1N5YL 4KAQH 3TM6A 3HI1B 3MCG1 5ITFB 4X6FA 3PG2A 4PD4J 3C6LC 3WXWL 1L0YA 2E8YA 4PS4L 3D39D 3BN3B 5IFJA 3RBGA 3CZFB 3LN4A 5FXCH 3O11B 1BZQK 2XWJA 3FB6A 4IOSD 3RAJH 1U3HC 2EDJA 2PTTA 5KSAD 1J1XH 3DX9B 1RK1B 1GYAA 5I15H 5CKAA 4CAGA 4Z7OE 4TUJB 4NZJA 1ZKAA 5IYYA 2VWEE 3U0WL 2XQYG 1U2HA 3SGKA 3TA3D 1YEDB 4MAYC 3FTGB 4PRPD 3SQBA 1VCAA 1E28B 1S9XA 1FRGL 2PO6B 4FZ8L 2NTFA 3QIBC 1LVEA 1NCDL 1IEAB 1WWCA 4AENA 3DROA 3ZKMC 4H88L 3MFGB 2A9ML 4IMKA 3QHFH 2QR0B 4HPOH 3SGDH 5C0CE 3CZUA 4XNMB 4QLRA 5JXAL 1QA9B 4OGYL 3TT1H 4OZFH 1G7QB 3DVIA 5I1GH 1WT5A 4G5ZL 3RPKA 4KZEH 1BF2A 3MA7A 4D9RE 5D6DC 1BAFL 1CIDA 3KLSA 5DJAB 3ESVF 3K4ZA 5JO5A 3ULVH 3LKOA 3OG2A 1AGDB 1WQVT 4ONOA 2D03L 3IFNL 1V3LA 2VLKB 3QO1B 2D2OA 4OSUL 2VQUA 4PRPE 3SKJE 3V4PH 4RMWA 2WBKA 5J1SC 2R0ZL 1L0QA 5DHVA 3P4NB 4FFYH 1C5DB 1NDGB 2E6QA 3L5WB 1FNEA 5E00B 3JBG7 3K3QA 1KELH 2FH6A 4X6FB 4ZO6A 3U1SH 3S36L 4IRJD 1F4YH 3AREC 2FWOB 3CH1A 5AG8A 5IFJB 3KPQA 2PXYA 4FNLH 3LN4B 5EU5A 1QSFB 4JM2A 2XWJB 3BW9A 3FB6B 3NN8A 2BRRH 4RGMB 2LQRA 4AEHH 4HWEH 4FI9A 2PTTB 3ORJA 2MCG1 1M7DA 3WNNA 2R9HC 4E9LA 1UXSB 3I85A 2WQRA 3QNXA 4HCRL 1EMTL 3I50L 3WF0A 1A7OL 3DMMA 1BX2A 4NN6C 1S9XB 4MX7B 3IKCA 2NTFB 5J89A 3L6FA 4AENB 3DROB 2E3VA 1A1NB 5KAQF 1CE1L 2C1PA 2WV3A 3G9AB 4Y16A 1FH5L 4PJBE 4TQEL 1UYXA 1OSZA 3F7VA 3N1PC 3D85D 3MA7B 1UM4H 2P5WA 3R06A 4N68A 4M61A 3STLB 3G5ZA 3D87B 1NMBH 3PHSA 3STZB 5CZXC 3LKOB 1LK2A 1NCWL 4NZDA 2FHBA 1G84A 1UYYA 1OOAA 2XTJE 5KVGL 4RAUA 5CJOH 4O5LL 5C08A 3FRPA 5DHVB 2P7TA 2B0SL 1CVRA 3PP4H 5MEOA 3TJEL 1OSPL 4L3AA 1FNEB 3BGMA 5DWUL 4X4YB 3ARBC 1W72H 4JFYB 1TJIL 3BP7A 3GMLA 3UTZA 5JA9A 3KPQB 3PWLA 1FBIL 2PXYB 3VWJC 4FRWA 5EU5B 2ENYA 4MS8C 2XA8H 4JM2B 3NN8B 3BW9B 4HBCL 4YHYC 3D69A 3HZVB 1PSKH 1CD9B 5TQ0L 4JCMA 3SKJL 4M8QA 4HJ0D 4QB2A 2C4FT 4PGBA 5J9PB 3QNXB 4OLEA 4Y5YC 5JLZA 3B2VL 4KXZH 4O4YL 1BX2B 4WO4A 1F3RB 3D0LA 2DAVA 3WFDH 2GAZA 2QQNH 4JPVH 2V5DA 3WCYA 3L6FB 1R3JA 3F7YA 5HHOE 5ADPH 4Q9RH 2C1PB 4Y16B 5FGBC 3TZVA 1EGJA 3CDYA 1OSZB 5HDQL 2VIRA 3PGDB 5CAYB 4HWBH 2YSSA 2JELH 3E2HC 2WDBA 2P5WB 3MGTA 1R3IL 2IQAB 3RGVC 1V3JA 3LEGA 15C8L 3G5ZB 2A6IA 5DDHA 2PN5A 1QSED 3F58L 1J87A 5JW3L 5DHYB 4XB7A 2ICWI 3K8MA 1ZLVH 4XBGA 1CGTA 4RAUB 3LV3A 3QCVL 1N5YH 4GRLD 5C08B 4QHUA 5ACMA 5MEOB 3IB3A 3VXME 1N64L 4Q58C 4YFLF 3BGMB 4X7EC 3VDAA 3WXWH 4DUWA 2E9BA 4PS4H 1VEOA 3BP7B 3UTZB 1OP9A 1IKNA 1ZHNA 5FV1L 2F74A 2B4CL 1ZA3A 2V17L 1XGYL 5D2NE 1RMFL 3IRPX 4WJ5A 1U95A 4PJAA 1AKJA 2F15A 1F2XK 1XT5A 5BW7C 4JVWA 3U0WH 4M8QB 5D5MB 1JL8A 2YBRA 4PGBB 4DAGL 3NQHA 1YEKL 3RWDA 1FRGH 4FZ8H 3RHWK 2GEEA 5JLZB 3P9WB 1NCDH 1D9KD 3WF1A 3MYJA 2A9MH 5FYKE 2VWEC 3THCA 1R3JB 3F7YB 1RSFA 3FQUA 4MNHB 2J8OA 5JXAH 3L9RA 5I74C 3BPCB 4OGYH 3CX5K 5DQ9B 4HKBA 2WBJC 3V79C 2OTPA 5HDBF 2GI7A 4GKNB 4RMTA 4G5ZH 2N7AA 1JHKL 4LSUL 5JXIA 2J12B 2VIRB 4MQTB 4JFQA 3T2QA 1BAFH 2RCSL 2YSSB 3CD4A 3ZTNL 5DPNA 3MV7E 3RWHB 3MGTB 4FTVD 4MD5A 2D03H 3IFNH 2A6IB 2HT2D 4MSWA 4YR6B 3MX0A 1PMJX 5KVFL 4OSUH 2HFTA 2DLIA 5KSAC 4BSWA 2R0ZH 3GO1L 3C7EA 4TUOA 3GUTA 1IGCL 2M2DA 8FABA 5BXFB 2RJMA 1SEQL 3S34L 2CLZA 3S36H 3TA3C 1MIML 1KC5L 2CDPA 5JXGA 4UI9L 3BD4A 1FFRA 4QXGL 2YUWA 1ZHNB 2F74B 1T1ZA 1ZA3B 2X05A 3VXUA 5SWSD 1NLBL 3EKCA 4FQQB 4WJ5B 4WW2C 1U95B 1VFUA 1NGXB 1AKJB 3DVNA 3NGBB 4PJAB 5KOVC 1QFOA 1EBAA 4HCRH 1EMTH 3I50H 4HUUA 4PRID 2H32H 4HHAA 1A7OH 5DZLA 5J56B 1CVSC 3RY4A 1XGUA 3QAZC 3D48R 3RHWF 5FECA 1TTFA 3HRZA 3OAZK 1YYML 4M6NL 5JOPD 1BOGA 1V5JA 4S1DD 2D0HA 1CE1H 3VXRD 1Q0YL 2VDOL 3L9RB 2CDOA 1FH5H 4JKLA 3U48A 1WWAX 2Q3ZA 5EH1A 1CDYA 4PJ5A 4K7PY 3VJ6A 1XCTA 1ETZA 4IRJC 4JFQB 3WNMA 4OQTL 3P4MA 4MD5B 1NCNA 3O4LB 1NCWH 1S7TA 1MJJB 5HGDA 2AERT 5C0BB 3MCLL 4P2QD 2Y8KA 3LKQB 2ZUQC 5KVGH 4XVTL 4O5LH 2HFEA 5FYKL 4BSWB 2B0SH 2ID5A 1KIUA 2B4CC 3I75A 3TJEH 1OSPH 4TUOB 3GUTB 8FABB 5DWUH 5JOPE 1KV3A 1XGPA 3BAEL 5ESAA 2CLZB 5B8CC 1TJIH 3VXRE 3GGWA 4OCMC 4KKAD 2IAND 4Y1AD 4XC3L 5CMAA 2R0KL 5BJTA 2H9GA 1KOAA 1T1ZB 4HBCH 3NJVA 5TQ0H 3HN3A 1FLRL 3SKJH 4HKZA 4JQVA 1FSKB 5B4NA 1T04A 1MHHA 1I7UB 4P2QE 3W39A 4KI5F 3MZTA 1W0NA 3B2VH 3ARXA 2XOTA 4HHAB 1KXTB 4O4YH 2W9XA 1XGUB 3UROR 3GMNA 3HRZB 4F58L 2XRAL 3U4BL 1BOGB 3V0WH 1RUKL 2XWBA 3WJLC 4ET7A 5D7JD 1MFBL 4N0RA 4Y1AE 4PJHF 3MBEA 1FG2A 2H1PL 3GSUA 4P0DA 5HDQH 5DYOA 5JIPA 3F65A 3VJ6B 1O8SA 1WCQA 1S9WB 1R3IH 1XCTB 1ETZB 3O6LH 15C8H 2OTUA 5HPMA 3Q6FB 3F58H 3P4MB 3ZSTA 5JW3H 5HDBE 1F6FB 1SBBA 2A0LD 4K7PL 5HGDB 1KPUA 4C57C 1SY6A 3QCVH 1QG3A 1TQCC 4XX1G 2YUXA 3I75B 4MLIA 1HKFA 1N64H 1KGYA 4HJ0C 1L6ZA 3JWDL 1XGPB 1XF1A 5ESAB 3KYAA 4J12A 3T1FB 3DTXA 2J6EA 3GGWB 4Z7QF 2N56A 2BY2A 5E6YA 4O51A 4DGIL 3OR7A 3V95A 1JNLL 4IRSA 3MRRA 5F1KC 2B4CH 5CMAB 2V17H 5IVNA 5BJTB 1G0YR 1XGYH 2XKUA 1RMFH 3P0GB 1IM3A 4L9DA 5HJ3A 5F1NB 1T6VN 3O41A 1W99A 4HKZB 4NBYB 1T04B 3BP5A 4DAGH 1ONQA 1YEKH 2CMRL 5ETUB 1MHHB 2KL6A 5MP6L 2XKNB 2LABA 1G9EA 3DXAD 1UENA 3C5ZD 4LSDA 3GMNB 1KEGL 3ZMRA 3B9EA 5FKAA 2XWBB 3BZ4B 1MY5A 1RPQA 2R29H 4X4ME 4GRLC 3O4OB 5C2UB 1FG2B 4NPYA 1JI2A 3QT2A 1A0QL 1JHKH 3GSUB 4LSUH 2GHWB 2X1QA 5DYOB 5JQHC 3KS0J 3QUML 4YBLB 3VWKA 2V4VA 1W8NA 2LAAA 3ARFA 3TIEA 1ZS8A 4N5ED 1S7QA 2OTUB 5IBUG 4LKXA 3DHJA 3R4DA 5T3XE 1UFUA 3GO1H 1KPUB 4AG4L 4U1KA 4R8WL 4B50A 1IGCH 3SJVE 5DRNA 3X3FL 1EZVX 4PYHA 4ESKA 1SEQH 3S34H 1MIMH 1KC5H 4KJPD 3BGFB 3UC0L 2CUMA 4PTTA 4F7PA 1XZ0A 3OR7B 5F7KC 4IRSB 3MRRB 1D9KC 4MVBD 1X4YA 5D7IF 4JFXA 4JRXE 1FC1A 4U6XA 1NLBH 1MFDL 4YEFA 1ERNA 3TFKD 1J1PL 4MJ4A 4PRHD 5EUOA 5HJ3B 5E6IA 3O41B 3KYOA 4P2YA 1Q0XL 1DUZA 3IU4L 4TNWK 3BP5B 2O5YL 1ONQB 2XTLA 4L4JA 3HAEG 5I1HL 4PPTA 5ACZA 4AEIL 5F9DC 1AIFA 1BPVA 4Y4FA 4EIGB 3HFML 1K8IA 1YYMH 4UTBL 4EI6A 5F7FA 2Q7NA 4M6NH 1QEWA 5IJKA 2HT2C 2ZUWA 1NGYA 4X83A 1FYTA 5CSZA 5GRWA 1ZA6A 3BWUC 3ZTJG 3F6LA 2HN7A 1Q0YH 1CL7I 4KI5E 2VDOH 5FKAB 4FFVD 5I1LA 4MLSA 4U31A 4LHQB 5ANME 1QOKA 4F7TA 1TPXB 3ECBA 4OGZA 3Q5YA 5L2KA 1QFWL 4NPYB 4RGNB 2MCPL 1MFAL 3I6LD 3O3BA 3VWKB 2APBA 3TIEB 3UJJL 4HIHA 4OQTH 1ZS8B 2QHRL 4PJHE 3FB7A 2VLRA 1S7QB 4NFBA 3JWDC 3DSFL 5DJDB 3O3EB 1TVBA