3K4ZA

Crystal structure of the cellulosomal cbm4 from clostridium thermocellum cellulase cbha
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
280
structure length
275
Chain Sequence
MLEDNSSTLPPYKNDLLYERTFDEGLCYPWHTCEDSGGKCSFDVVDVPGQPGNKAFAVTVLDKGQNRWSVQMRHRGLTLEQGHTYRVRLKIWADASCKVYIKIGQMGEPYAEYWNNKWSPYTLTAGKVLEIDETFVMDKPTDDTCEFTFHLGGELAATPPYTVYLDDVSLYDPEYTKPVEYILPQPDVRVNQVGYLPEGKKVATVVCNSTQPVKWQLKNAAGVVVLEGYTEPKGLDYVHWLDFSDFATEGIGYYFELPTVNSPTNYSHPFDIRKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The unique binding mode of cellulosomal CBM4 from Clostridium thermocellum cellobiohydrolase A.
pubmed doi rcsb
source organism Clostridium thermocellum dsm 4150
molecule tags Sugar binding protein
molecule keywords Glycoside hydrolase family 9
total genus 62
structure length 275
sequence length 280
ec nomenclature
pdb deposition date 2009-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4zA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4zA01
2VNCA 1WLHA 2AJSL 4LU5H 2G5BB 2DWEA 2BNQB 1S9WB 3REWB 2IAMB 4BQBA 4GQ9L 1J0HA 1OP3K 4L8SB 1MVUB 3X11B 4LARL 4LLWB 1G9MH 5E2UH 4AMKL 2OQJA 3DUSB 3L3KA 1FSKC 4G9FE 3F12B 1V7NH 3O4OB 1RJCA 2XKSA 5JW5B 1OAXH 4D0CA 4A6YL 1QD0A 1U58B 1MFEH 5DEFB 2H6PA 4CN4A 1Q0YL 2IANB 1KJ2A 4DEPC 3GM0A 1S8DA 3O2DA 5EU6A 5ACLA 3ARBA 3UEZA 3CH8A 2CRZA 2IH3B 3OBAA 1R24B 5GGRB 5INDA 5ADOL 4JFYA 1W0YT 5IHUH 4AT6B 3OR7A 4HC1A 2FECI 2F5BL 3D9AL 1FZJB 1T7WA 3H8NA 4O51A 5B8CC 3SEPA 3NMEA 2VXUH 2P8LB 4KDVA 2XQXA 2YB7A 3GI9L 5E8NA 4WO4D 4Y4FB 1S7VA 1IKNA 2WQ8A 1NANH 5CEZD 1KENH 2JE8A 1JIBA 5BS0E 4XUTA 4A3ZA 1CGUA 1RUPL 5EOQL 3O11A 3C6LD 4APQC 1M05A 2EKSA 2VLKE 1CD1B 4NO2A 4LCWE 3VMNA 5GGVY 1P1ZB 1XIWD 4KTDL 1RQ5A 2P46B 3KPLB 2DTSA 1LO0L 4AT6A 5HGDA 3L5XH 1K8IA 2OCFD 4GSDL 4MQSB 4TULL 3RY6C 3UDWC 5MENE 4FA8A 4FABH 1QR1B 1RMFL 1HIML 4M6AA 5D7IA 4JZJB 3QIWC 1DLHB 1JF1B 1KCVH 4S0TD 1NGWB 4JPIB 1AD9B 4F37K 4R4FH 4DKEL 5J1AB 2VL5A 4JFDD 5FYLD 4OLZH 3BP4B 1G7PB 4FFYH 2I9TA 4JCMA 4M6OL 4DXRA 2FATL 1T22B 3Q1SH 4ZXBD 3WDJA 2VLMD 5F21B 3R0MA 5FCSH 3T1FA 2E6PA 3UYPA 3BRDA 4WJ5B 3K2UL 2Z0BA 3D1MC 3MRMA 4M62H 3L7EB 4QXGH 1US2A 3U0TB 4YHLH 5IMMA 5F7DB 3T8XB 4AQ1B 3DYMA 3TA3B 5IWLC 4PGCA 1UZ6E 3QG6B 1HH6B 1G1CA 2VR9A 4OV5B 5FF6A 4X9FA 3U1SH 2H9GA 1F6FB 4K71C 1VGEH 3DVNA 2XWTB 5DJYB 4XUNA 4N0UB 3FB6B 4KI5E 4PJAA 5DPNA 3TVMC 3TNNB 2H32A 4RWHA 1LDSA 4J4PA 5DUBB 4P49A 2NZIA 4X6BA 4MDIA 2J3SA 1OD7A 3TJHC 3QG6A 1ZSDB 4FFVD 1BREA 2IBBA 4PJGA 2JJTC 3VCLB 4U7SA 3GHEL 5C70A 1KTDB 2E31A 3HFML 3ACGA 2X1PA 1OCWL 3WN5C 8FABB 1CVRA 5IHZA 1GIGL 4OQTA 3ESUF 3BKMH 5HGBB 5IJKA 4PRNB 2D7MA 2QQQA 1OTTC 1KBGL 1FFPA 2FIKA 2DTMH 5E5UB 1AY1L 4GG6A 3SKOB 3LKQB 4TQEH 5I1CL 1SQ2N 4PJAE 3HPNA 2NY1B 2F53D 3H9SD 3IRPX 3MLUL 3UP1A 2QQNH 2FL5B 4W70A 1U8OB 3TBVA 3WNPA 5EBLA 1UYXA 4E0RB 2R2CA 5F1IA 1A21A 4HQQL 1R3JA 5SV3A 4MS8D 2QQLH 3VD3A 4O9HL 1MAJA 5F1OB 5MI0B 4WWKA 5CP7B 3IDIB 4KQ4L 2BVQA 4Z7QF 2E6QA 4NWTH 3DV4A 3N0PB 2FJHA 5I8EB 1C16A 3S4SA 1X44A 3WS6A 4DVBB 5C08E 4PJHB 2VAAB 3CXHJ 1TNNA 1UQSB 1ZS8A 5HYIA 5E8DH 1QBAA 2DWDB 3UJJL 5D7KD 5JW3L 4OMDA 1R3JB 2CXGA 3SY0B 2P5EE 3KPNA 4M4PA 4GUPB 1MRCL 4X7TA 1OP3H 4R8WL 3ZKND 5FGCB 2J1AA 4FQ1H 4RYDA 3EFDL 5DK2A 3MRJA 1LEIB 3HMXH 4WUKH 5B4XA 5DHVB 1C16B 4HPOL 1KYOK 3WKNA 1J18A 4YZFF 3JV6A 1VA9A 2QBWA 3U4BH 3Q5OA 1Q9KA 3NFNA 1S8DB 2HT2D 4Y2OA 1WCQA 3D3VD 3KJ6H 3AXLB 3OJDA 2RCSH 1NGZA 4JQIL 4OUUB 1WTLA 5ICZA 1TG7A 1A3QA 1AXTH 3HNVL 5DD1H 1A7PH 4KK8C 1FNEA 4OZGE 1P4LB 3WHXB 4RQQA 5D1ZB 3E8UL 1I8KB 2MQCA 3WBDA 1YNKL 2VE6A 5I1DB 4OGXL 2YRZA 1ADQH 1XF5A 3NABL 2W94A 1FO0L 4M1CC 1HOCB 4LKSA 1WICA 3WXVL 5GJSH 1KCSH 1FGVL 3PWPD 4M8VA 5DZOA 5EUKA 4N90E 3EJYD 3VXQA 3DYPA 2P5WE 1D5BB 1ONQA 5KVEH 4K8RH 5JOEA 1OAZL 2ARJB 4LVEA 1MNUL 1U8LB 3NIDE 1AGCB 3BO8B 1FBIL 2WANA 2J1SA 1MHPH 5IFAL 5LGJA 4XP1L 1QBMH 4K55A 5EUOB 4A42A 4DGYL 5GZNC 2DDQL 3TZVA 2A6KB 3FQTB 1R0AL 2V2TB 2A6DB 3O8XD 2IH1A 1U8PA 1G7PA 4Y0GA 4P46A 2GJ6E 3C8HA 1MAML 2DMCA 1L0YA 3G6AA 4NWUL 3V6OA 3VXSB 4PJ7F 2BHZA 3QQ4B 2F5AL 3IXAB 3CDYA 3L3IA 3TN0A 4PBVC 5DJCB 3IGAB 2WUBH 1W72L 2F19H 3WFHA 1RJLB 2QSVA 4JG0L 1RAMA 3O9WA 1YYLH 5ADPL 3A6OA 1IC5H 1S7QB 3V4UL 4LSRH 3GSQA 4NGHH 3WLBA 1IBGH 1EIBA 3ZKMC 3S88L 2HG5A 4LSSL 4DVRH 1PBYA 4DKEH 4D0DA 1OARH 5C8JB 5DURB 4PRHD 2X4UB 4ZFGH 5LKNA 4A44A 3CJJA 3PWNA 4I18B 3CPLA 4HJ0D 1ETZB 1PG7X 1LO3H 2VDNL 4LCIL 3KPOA 3ARDB 1HKLH 2DQHH 3IDJB 4AEIH 5D7LD 2UVFA 2LTQB 3GSNA 1XT5A 4N8PA 1H3PL 2UUDK 4NDMB 4J6RL 4O5LH 4UIMA 5IQ9A 3FQRA 5IEHB 12E8H 4OF5A 1X7QB 3UBXG 4UDTB 5IVNA 3FOLB 3VXPA 4QX3A 3S37L 3QXWA 5HHNA 3OHXB 3C2SA 1XZ0B 1MFAH 1U3HC 3QEQD 1CE6A 4PJFE 3S7GA 1YECH 4W4OC 4G80B 5JQ6H 5JR2A 2A0LC 2FL5A 5E8OB 5F7NC 2YD5A 4GXUM 4JRXA 4NJAL 3ZSTA 2EEBA 2VOTA 3WL9A 3RWIB 3L5JA 1G7MA 5F6HI 1EEYA 3U48A 3H3PH 5EB9A 5IK3A 1CFQA 3VH8B 2X2YA 1YN7A 1A4JB 2ESVA 3FO0L 4E8CA 4OLUH 5HHOB 1KELL 1QO3B 1NAKH 1HXMB 1NSNH 1MFEL 3U4EB 2IEPA 1IGFL 4DZ8B 1GZQA 2BXYA 3EYFA 1S7RB 4NT6B 1KXTB 3MRNB 4RMUA 1EEQA 4AEEA 4YIQB 5CD5C 4U0RC 4FG6D 5CP7A 2FGZA 1W72H 2F19L 3VW3H 4JRWA 3Q2CA 3DECA 5FO9B 1UCBL 4HW6A 3W0WA 3KPSD 3L6FA 1V3JA 4OZGF 2XXMB 4XGZA 5DK2B 1U93B 1T3FB 1U8MB 1LP9F 4F3FB 1NEZA 1EFXB 2ZOKB 4MQXD 3WMSA 4O4YH 4J3XA 4NJ9H 4CADA 3PIQB 2HFEB 5D7JD 3BEWA 3BGFB 4MADA 3CC5B 2XN9D 2NQCA 1I1YA 1EV2E 3T2NL 3F7PC 1DLCA 3C09C 1QFPA 1B90A 2V7NB 1OL0A 3Q6GH 3I84A 4IM8A 4R96A 3VFGH 1A1OA 1LK3L 1VEMA 4X8JA 5CGYD 5I19L 1LE5B 2ID5A 1ZGLA 3VXMD 1YEIL 2OZ4A 2ORBH 5HHVH 2EC9T 3B8SA 5C0RL 1Q0XL 5EZLB 3RP1A 1KC5H 3O6ML 1I3GH 1C08B 1R5VB 2W9DL 3CFDA 3THCA 3LE0A 1JP5A 1FPTH 4FMFA 3PGCB 5MEOB 5IIEB 4DJMA 3IXTA 3Q6FB 4GBXA 4M3JA 4MJ6A 1K5NB 5DVNA 4G6JL 2VDQL 4MGXA 3QDGE 3X3GH 2FR4A 1I7RA 1E28A 2FEDC 2NX5D 1PMJX 2AJXH 2X89A 3BO8A 1JFQH 4DFIA 4JDVA 4MZ3A 4NC2B 3SDAD 3HPJB 3MNVA 4YDKH 3VW3L 1SJVA 4XC3L 3IB4A 3QUXB 3LKNB 1WBYB 2IAND 3Q3GA 4BUGA 4JRYD 1BLNB 1F4WL 2EDEA 2FH8A 3RWDA 1RIHH 4L3EB 4WV1A 1OOAA 4O2EA 5EH1A 3PQYA 1PSKL 2B39A 2AJXL 1GAFH 3C2AH 1RUQH 1J5OH 1P53A 4DAGL 3U2SB 3FFCB 3WFDH 1LO2L 3BKCH 5BV7B 1CE1L 5GRJH 2HLAB 2E9BA 2P1YA 3S35L 3OG2A 4JFZL 4IRJD 2VUYA 2R29H 1QOKA 3BPLC 5D7JA 5DJ2A 5ILTL 1YQVL 4UI9L 3LDBB 2AQ1A 3AREA 2ZG3A 2XZCH 4PP1C 4BYHA 2DL9A 4OB5L 3O2VH 5I1LB 2VZSA 2W9DH 4QYOB 5K93A 1NGWA 3V5KA 3VGGA 4ODTH 5DRNA 3RL2B 1JWSB 5GZOC 4RMTA 4E5XB 3QJHB 1AJ7H 3DETD 2GTZA 3QUMA 2EXYD 5D9SA 3U7AA 1IM9D 1AO7B 2J1KA 2P5EA 2N1KA 1CDHA 2VN7A 2J8UB 3OKLB 4Q9QL 2CD0A 1CG9B 3G9VA 3RX5A 4JR9L 2ZSWB 2COQA 3QBTB 1LNUB 3S35X 3LRHA 2NY4C 1DUYB 3WIFA 3HCVB 1WWAX 4CMHC 3KHQA 3DMMC 2GFBB 1HH6A 5JMOC 5CP3A 5JXGA 1PD6A 3VG9B 1GVIA 3TYFA 3RRQA 3SDDA 4D9QE 1OAUL 1EBAA 5I76B 2XT1B 3RDTA 2D31A 4GJTB 5EU3A 3NCCB 4MMXC 3S6CA 2X4QA 1NBYA 4OD3H 4XZUB 5GRXG 1JHKH 4L8BB 2BY2A 4M5ZH 1T5XA 3ORJA 4PD4J 2BZDA 3WL9B 3QQNA 1OGAD 5GJTH 1A9EB 1AQDB 2F58L 4RBPK 3ZLQC 5HI5D 3L3OB 2HWZH 3VXOB 1GOFA 4EOWL 2OXGA 3EDJA 3IDYC 2VN4A 4WWKD 3C5SA 4KHXH 1TZGL 1BVZA 4L8DB 5TE6H 3EZJB 4MA1B 4M6OH 1KGCE 3QNXB 4JN1L 4S10A 3MQIA 1KJ2L 1ACYH 5D2NC 4R4NC 3BJLA 5SWSE 4YAQA 4Y19E 2WABA 1E4XL 3OR6B 3S36L 4AG4H 4FTVB 3TPUA 5C0EA 2V7HB 3QFDB 4QHUB 1WZMA 2PXYB 5HYSA 5CEXA 3VJ6A 2WIIB 4LGPB 3HZVA 3BESR 5C9KA 4WW2B 3TO4D 1G6RH 5KS9E 1A9BB 3ZE0F 2O5ZL 4F3FA 4LSVH 4GSDH 4HBCH 1PQZA 3MODH 1W0VA 2VC2L 3I2CL 3OB0H 3O3DB 5MHSE 2AEQH 4YDJB 2R0LL 2XWBA 4P23A 4PLJD 5FKAA 4WTZG 5DRZA 5JXHA 4RGND 1Q72H 1T20A 2GSGB 3HR5B 2PO6D 3NZ8A 4ONFL 2UZYB 4ODUA 3G5XA 4ZD3H 4IDJH 3VFMB 4XAKD 3D39B 4ESKA 1T0PB 2IPKB 3WE6A 1A3RH 4N0FB 5DMKB 3VI4F 3U6RA 4OM1L 4CVZB 3L5HA 3V6FA 3E0GA 1CYGA 5F6IB 2VZ1A 3S3SA 4WEBL 3QI9C 4NZDA 3BX7C 5JNYA 5AYUH 1RZJL 1KPVA 3OJVC 5DRXB 3CXDH 3LEYL 4LLQA 2DJSA 3CU7A 1FIGL 1AIFA 1TNMA 2PXYC 3IDMB 1SEBA 5JIKA 3I6KA 3HI1A 5I1JH 5DFTA 3ESVF 3NN8A 1Q9LA 3MXVL 1YN6B 4QT5B 1T21B 3QXDB 1R0AH 1HKFA 3QUYB 5FXCH 4X80H 3OAUL 4OCSL 4BK5A 4LCCB 3IRZA 3I02B 4Z18A 1T1ZB 5F9AC 1G6RL 1PG7W 4FI9A 2B2XH 4BELD 4I5BA 2HP4A 4IJ3C 4P48A 2WAAA 3HRPA 1LO5A 4JQVC 4MJ4A 2IANA 3W11C 1ZVSB 5HHQB 3K2MC 4GMTH 5HI4C 3OB0K 4YHIA 5C08B 2R56L 2QTEA 2I9LA 3FRUB 4R2GD 1QR4A 4XWOC 1UJ3A 3UZQA 5C0DB 3BYYA 4MOAA 3BVNB 4XWGH 5DD5H 1FZJA 2Q8BL 5ESAB 2ICWI 2O5XL 1PG7L 2X10A 4KVCL 1WAAE 1DVFB 5DDHB 4UNUA 3QQ9C 4P5TD 4I0PD 3U83A 4GW5B 5L88H 4MD0A 43C9B 5T1LD 1B0WA 1CF8L 1A7PL 5JUEL 3VRIB 3O8XC 3MBXL 3LQAH 1S9VA 1KB9K 4PBXA 1AR2A 2VJXA 1JZ2A 5HPMB 5ITBH 4HJJH 3U46A 4IHOB 1FL3B 2FATH 3HC3L 3RWCA 4NZRH 3GUTA 3I6LE 1CL7L 4F7EB 5CEZH 5EFIA 4HWEH 3D39E 1NPUA 3UPRB 5E6IC 4IEFB 5FKPA 1FJ1A 1MI5A 2E27H 2X4TA 2CRIA 3LPWA 3EOAA 3TO2B 5A3ID 1DEEB 5F7EH 5C0AB 1OY3B 5F7DA 3JV4B 4I3GA 4DKAA 4ONGL 1BP3B 4M1CD 5FA4A 4KRNA 4QRSB 1RZIB 1CFNB 1F4XL 3CVHH 1PDKA 5J3HD 3TV3L 3OX8B 4LKXB 3U82B 5JHLL 1UGNA 4POYA 3O6KH 4D0BA 2ATPA 1BZQK 5FKPB 3HG1B 3MRQA 1WWBX 4YHKH 4TVPL 1XF5B 4DEVA 3AS0A 3MJ8A 3WO4B 3STBA 1JGUH 3SE4A 4YFEA 5TJWK 2FJGB 3IFNL 5D7SL 3K4AA 3DVNB 2QQNL 2CSPA 2CO6B 1PEZA 1K4CB 1J8HB 3BXNB 3DTXB 3NPZB 3V79C 4NM8H 1F90H 4JKKA 3TCLB 4N1HB 5KANG 3I2GA 1V3KA 4MDJA 2E5EA 2IBGA 2XTJD 4UU9A 4W4NA 1IQDB 5GGRY 2J8OA 1ND0A 3BP7A 1P4BL 1XGYH 2UZIL 1E4WH 2EE6A 4NCC2 3HJRA 3WS6C 2Y1VA 4LLMB 4NC0B 4TN9A 2R1WB 3ZTNH 4DZ8A 2GUOA 4NO3B 1CXIA 5HJ3A 4IIQB 4LCIH 2B4KA 4DN4H 4OSUH 3ZKXC 2CIIA 1GNYA 2PW1A 2MOVA 3O6KL 4DGVH 3OF6D 5JPMA 4DVRL 4P23B 5DJAB 4HZLA 1CLYH 4WI2A 1OAKL 4P4KB 3X3GL 3I6GA 2VLKD 3GK8L 2Z92A 3U37A 1CK0L 2A6IA 1I9RH 1MI5D 3ULVF 4M9OA 1QFUL 4R3SB 5LCVL 2FX8H 3GSVA 5E5MA 3JWOC 3KPSB 1Q9WA 4WNQA 2YUXA 4DQOL 1HZHH 1I7ZB 3KJ4B 1SJHB 2NNAA 4DVBA 2JB5H 4PRIE 5LAXB 4MX7A 3UJIH 4GAFB 3ZT5A 3SGDH 1ZE3C 4CU7A 1TTFA 2YK1L 3D18B 2XN9B 4N0UE 3KPOB 2GJ6A 1HHGB 2VZTA 3ZT6A 1L0QA 3JVGC 4MQXC 4TVSa 5EA0L 1J1OH 2FX9L 3HRZB 1MPAL 4GW1A 3SO3C 2APBA 43CAB 3QXDA 4JGMA 4Q0XH 4NKQB 1IT9H 4XP6H 4AENB 5F97E 2ICWA 4RZCB 3QYCA 3PHQB 5FGBA 5GS0H 2K7QA 1VFUA 3GB7B 2FHFA 3T0AA 2YA1A 1G9EA 3QNYA 1AP2B 4J4PC 4HX1B 4HIIB 3WF3A 4FNLH 1N5AA 4KJPC 5IMLB 3ZKXB 4XBEL 2VDPH 3VXQB 5IB4A 1N8ZB 1RZJC 4WTZA 4M7LL 5KSBB 4H25A 1T03H 2VR4A 3CLEH 4P2RA 3C7EA 1NGPH 2W60B 1QFWM 2BOCB 1FNGA 4RMQA 1JU4A 5LGJB 4XXDA 2YKLL 3OAUH 4ELMB 5ACZB 1HYSC 5DYOA 2VB5A 4DTGH 3MRIA 4JHBA 5D72L 3MLTB 2O93L 3T1FB 4HT1H 3MXWL 4P3WA 3C6LA 4LEOB 5FGCE 5I1JL 5FO7A 5I30H 1AC6A 5I17B 3H9SE 2CLVA 1ZHNA 5GRZA 3NPSB 4QF1A 2QHLA 5B4NA 1BJ8A 3FFCD 3U7WH 3FB8A 3FHQA 5I73C 4XZUG 4S1DD 1JF5A 2C4FU 2GTWB 5FECA 1HSBB 3O3UN 1ORQA 4DGVL 4Z9KB 2AJSH 4LU5L 1YEEL 3LIZL 3EOBB 1I8MB 1I4FB 4ACPA 1H6XA 1IAOB 3F5WB 4NJAH 1I1YB 4Y4HB 3ULVL 5L7XL 1RJLA 4RMSA 3SDDD 2EZ0C 1VACA 3D5OF 3P4NA 1BQLH 1EAJA 3RIAF 3ILQC 4OZIE 1NAML 1P7HL 3W9EA 2EDQA 3QO0B 5ECJE 4DCQA 2X9YA 4JFQB 2GITA 3RUGE 3P9WB 5HGAA 1YEFL 3EW3B 3HLAB 2VLRE 4WFEE 3GMPA 4NZTL 2BOBA 3HE7A 5DXWA 3VGAC 1HN1A 4RWYL 3KWWB 3CH1A 3S36X 5DI8A 5HYEA 5KVFH 4ISVA 2VERN 2WUCH 1QSEA 3TBSA 5I75C 1JPTH 3ARGA 3GSUA 3DX8A 1KJMB 2ENYA 2YD9A 1BVLA 1R3KA 1I1CA 3TT1H 1JHLL 3OXSB 4F7PB 3VGDA 4KVNL 2E7HA 3PABA 5F96H 4QTIL 1AHWC 5E9DB 4G6ML 3VWKC 3JBG7 1F42A 1UEMA 2E3VA 1QBML 2ESVB 1OP9A 4PJHA 4Q58C 4XT1C 2VDMH 2A1WH 5DR5H 3L3JA 1MCKA 4QOKD 3HPLB 3G04A 3QAZB 3UMTA 1KIQA 3FT4A 4NWUH 3VD9A 5LGKA 1I9IL 1YEGL 4XNYH 3VH8A 1XGPB 1ORSB 2CKNA 4F7PA 3HI5H 5T1MA 5GGRA 4OGYL 4FQXC 1KUMA 1FN4B 2XNAB 5GS1A 5F96L 5CJ5A 3MV11 4HEPG 4XP1H 2EYTB 3K4DA 2V6HA 3V6OE 2EYSB 4IIQC 1CU4H 4U1LA 2B0SH 2AK4E 3G5YA 3GFUA 5DMIL 5C92A 4OLZL 4I48B 1VEPA 1IQWH 1U6AH 4ZUSA 5DQJB 2HT2C 4LVOB 1JPGB 2A9MH 4GMSH 4LEXL 4K9EL 3HR5A 1MRFH 2V5RA 2AV1A 4I8DA 4HKJA 3STLA 3CZUA 2I27N 4MCZA 4ZUVB 2XNAA 4ODUB 4C54A 1L6XA 1LGVA 3V7AE 2C7UA 3O45B 3K81A 5FOJA 4HH9B 1GC1C 3LKOA 2G60L 2XXCB 4V2CB 1AQKH 4A41A 3BWAB 5IF0A 1S7WA 3MRFB 2NY5C 1MQ8A 2XZQL 4ZUUA 1QSVA 4JM2F 1NJ9B 3HZYB 3MA7A 5CJ8A 2YC4A 3SJVE 4XP4H 3TH2T 2YPLE 3W2DL 5DJZA 2GIYA 3L95B 1AFVL 5MEOA 1T89A 4TNWF 1CFVL 2DBJA 5K9JH 4UOJA 1JL8A 1OTUC 3EB7A 1RVFL 4MS8C 2VDLL 1BWWA 5J3HC 2OJZL 4HIIA 2Y6LA 1RZFL 4HXBL 2EDJA 5ISZA 2EKJA 2QEJA 3ZDXE 4H26A 2A6DA 4DXTA 5F6HJ 3KPRD 3QG7L 5ICXA 1F4AA 2NY7H 3MO1B 1RHHB 1ODAA 2C9AA 2D0HA 3UO1H 3MV7B 1VKXB 1T7XA 2FBJH 4PRPD 4HWEL 1FRGH 2Y4SA 4YE4L 3ARQA 3A21A 1ZLWH 2CJUH 1H8NA 35C8H 1HILA 3IFLL 1FYTA 3K1DA 1W72B 1A6TA 3QNZB 4UT7L 4XNZB 1G9NL 3C8DA 1W8NA 3CSYA 5AZ2H 5I18L 4BH7B 2FWOB 1DLFH 4OGYH 4KRPB 4OTXH 1MCNA 5BRZE 4HIEB 3EYSL 4TNVF 5TFSH 4U1NB 5D7IB 3BHBA 3TJHD 3ROLA 2HG5B 1GUIA 5ISZE 3EYUH 4M8QA 2BERA 3MRHA 1I9EA 2ICES 4LIQL 5IUSA 2CH8A 2VDML 4D0DB 4TSCH 1FL6A 4TRPL 5C0JA 2CLZB 3LV3A 3OPZL 1NGYB 2WSKA 2X1OA 1KV3A 2HVKB 3NNGA 2YUWA 2ZXQA 4N8VB 1A6WH 5DSCB 1B2WL 4S0SD 4MD4A 2B7DT 3BZ4B 2OJEB 4Y7MA 3WV0A 1IJ9A 5E2TL 1FL3A 4GQPH 3OKDA 4J3SA 3T0WA 1XF3B 1JGDA 5CCKH 2PYEB 4XVHA 4P5KB 4L4VD 2VQUA 1NC4A 1IQWL 1HSAA 3I75A 1AHWA 5JTWA 3WUWA 3T0EE 4M6NH 1BIHA 4U1GC 3EYOA 4PREB 3U7YL 4JLRA 1CTOA 2JB6B 3EYVB 1A0QH 3KXFE 3FB6A 4G6KL 3WIHL 4OD1H 5EO0A 3DV6B 4WFHD 2BVOA 3WFBH 1IGCL 3GBLA 2YRLA 2Z4QB 3WXWL 1EVTC 2KDGA 1Y6NR 3RY6A 3UDWA 1Y0LB 1QSFD 3VXME 2ZUYA 2LVEA 4FFYL 3VCLA 2IH3A 5BZWA 3LQAC 1P5VA 5TDPB 4DWHA 3HCVA 1CLZH 5CIPB 1WBZB 5FYLL 3ZKNC 4D9LH 3KJ4C 1TPXC 3DX6A 4OF0A 4UNVA 3V9FA 1YZZA 3GMMA 2IFFL 4EVNA 4FXGA 1KJ3L 2GJJA 1CDJA 2ZKHH 3LEVH 5ICZB 1QP1A 3H0TA 3GM8A 1FYTD 15C8H 5IMOA 2ATKA 5IR1B 3MRCA 4S1QH 4UU9B 4XPGL 4V1DE 5EPMB 2ED8A 3DXAE 1RFDH 4QRTA 2HH0H 3MA9H 1KEGL 1MLCB 4BFIA 4HG4K 3QPQC 1SJXA 4HK3N 1G7LA 5I1AA 4EVNB 4NRYA 5EOTA 4ZUSB 1U3HD 4HLZG 5TDOA 2C3XA 4NQCB 2YXMA 2V7NA 2C3GA 2VLRB 4HKJB 5IVZB 1JPSH 3STLB 1KG0A 4PB9L 1YYML 1EHAA 1UQSA 1ZS8B 1Q9OA 2ZEYA 1ZGLB 4PGBA 5BOPA 1ONQB 2L9LA 3CKHA 4NBYB 3QPQD 1R5WB 1UY1A 4AG4L 3BZEA 2VXUL 4MQTB 4A6YH 3BH9B 3MLXH 2AJVH 2J7LA 4X7CC 1KGYA 3AMKA 1XCTA 2FEDD 3TBWB 4NUGL 1CZSA 5IIEA 1JYXA 3DI2B 4P2QE 5FYKU 4JN2A 3RWCB 2VLKB 5FV2A 4MXVE 1F11A 3MROA 2IG2H 3LZFL 4XTRC 2VDKH 4HS8L 4QDRA 2BP3A 3MRMB 2PCPB 4YGVA 1WUNT 3F58H 3PV6B 1MWAB 1OP5K 2ADGA 1I7RB 2BY1A 3NRUA 4FQXD 2QL1A 5DJ6A 2XQBL 3TO2A 2NXZB 5FK9A 1S78D 5KVMC 1F3JA 1V7MH 4YHOH 1MELA 4OIAA 4XBEH 2HKFH 1S7XA 2YD3A 3CFCH 3EDKA 4S1RL 3RPIA 4Q9CA 1BWMA 5CINH 1AC0A 5D93B 3OKMB 4ZUWA 4P46D 5SX5H 4PJBA 4N5UA 3QIBB 1DE4B 1XH3A 5DK0B 4OCXL 1F2XK 1KB9J 5CJXC 2VXQH 2O5YH 3VWKD 2H6PB 2XZAH 2DI9A 4R0LB 4J3OC 3LD8B 3WEZA 1OAYH 3UPCA 3G6JA 2YMXL 4H1LH 5JOPD 1I3VA 1E4XI 4HLZH 1HZHL 5IROC 1HINL 1XGTB 5BRZB 3TP4A 3DRQA 3L9RB 4X98A 3AUVA 3FFCA 4Y89A 2PF6A 2HFGH 3PDOB 4S1RH 5EO9B 4K3GA 2ORXA 1HQ4A 4LPWA 1P7QA 3WHE0 1GH7A 2V2XB 3EYQD 1NFIB 3EO0A 3OGCB 4XCNB 4AK1A 1G7QB 1FGVH 2X1QA 4Y1AE 3W0WE 2Q86B 3LOWA 1JN6B 3TA3D 1JPSL 1JWSA 3S4SB 2GT9A 2X1XR 4MD4B 4PJDE 3IVKB 1LO5B 3T2NH 5GQBA 5KG9B 4IS6B 4ZXEA 5CBEA 3MV9E 5A2IH 3LEXB 5JR1H 3I50L 2IGFH 4UBDC 2CLVB 1JBJA 4GUPA 3EYUL 2WINB 5ETUB 3QH3B 2FGWH 4NKIH 4IRZH 3MYJB 4K8RD 1UJ3C 1W8OA 1DP0A 3LSOB 2F8OA 4HS8H 4OZHA 4I0KA 5F7HA 4LLAA 5C07B 4GAJL 5JMRA 3FOMB 1MREH 2V5MA 4X9IA 5F3HA 3EZ8A 3UJTL 4LNRA 1NAEA 1RUMH 4PJEE 2R1YB 3Q0HA 1N4XL 1T2QH 2ZNWA 4QGYA 1E6OH 4HS3B 4RGNE 3TA3A 2C1PA 1RZJH 2H8PB 1T1WB 1XGYL 4NQED 1BFVH 3HMWH 5I0ZA 1BQHB 5KVGH 4WFGE 1ITBB 3CVHL 3CLEL 4N5ED 5J7CC 3SGJC 3BGMA 3ULUL 5F3HB 2F54A 2VDQH 4LBEB 4WI9A 5L2KB 3VRLE 5ID1B 2X4TB 3KYKH 4OZIA 5C0BE 4FNLL 3FN3A 3CZFA 4U1MA 5F93C 1TZHA 3P6BA 1T04A 3NFSH 2Y25A 2DQUL 3DROB 3KYAA 3T4YA 1JMZA 3FN0H 2DQGH 1VFAB 2Y36L 3S96A 3ARED 4KGLA 4X8XA 4X6DE 4GG6B 3SDCA 3ULUF 4LGRB 4HJGA 2NX5A 1K5NA 4BH8B 1R3LB 3RZWA 1FFNA 3OXRB 2BMKB 1FL5B 3PGDB 2DIJA 4LSTL 4U1GB 3VRJA 4DK6A 5IKCB 5KSBF 3P0GB 5I1HH 5GZND 4FZ8L 3P2TA 2A83A 5E9DD 3LAFA 2YUVA 2ESVD 5GS0D 3MRIB 1K45A 2Z31B 1K8IB 4KAQL 2QR0B 5CBAA 4XHQA 4ODWB 2A73B 4PJIB 1C12B 5GPRA 3V6ZA 2XPGB 1RI8A 5BO1H 4KMTH 1OWWA 5GSVA 3E2HB 3FZUC 4MJ5A 4Y16B 3GHBH 4W4OA 4L9LC 1MNUH 2B4CC 3QCVL 1TENA 4QRRD 1GZPA 1TVDA 4YPGB 4KRMB 5HTSA 5JW4R 1KPUB 1S3KH 4JPWL 4P08A 3IDMA 1MCQA 1L7QA 5GS0C 4PP2B 1G9NH 4Y1AA 5I1KH 1D7PM 1JHLH 5TE4H 4CVWA 3SDCD 3UX9B 2BVUA 2VAJA 1NMBL 2H3NA 2L7JA 5J4MA 4QYOA 4HK3J 2NY6D 2QSQA 2ZOLB 4RGMB 5L8JB 4G3YL 4XXCA 3C6SB 3DMMB 3MLVH 2NNAB 5C0CB 1NCCH 2J1EA 3HAEH 4RQQB 3QDAA 4NNPH 2PETA 2EDBA 1CTNA 4R0LA 5GGTH 4DOHB 4KJYA 3ARWA 5KN5B 2VKWA 3SEEA 1MCCA 4R90H 1WEJH 3VXSD 5KAQF 2FZ3B 4OTXL 3FTGB 4KTDH 2IJ0C 3FN0L 5EC2A 5DA4A 1UWXK 3LKNA 5D1QD 3V4VL 2DI8A 2JCCA 4KKBD 4I18C 4TSCL 1IGJA 2XOMA 1N59A 5SWZD 3T4AA 2R4RL 3VWJD 3B9KB 3X3FH 1RHHA 5D7IF 3PG2A 1N0XL 5FHBL 3SQOL 1WKYA 2Z91B 4LSSH 4DFHA 3HOBA 5EOCL 4WUUB 1PFCA 1FZKB 3NCJL 1MCRA 3RUGA 3PP4L 4HBCL 4DKDC 3RVUD 3KNBB 1DN2A 1X4ZA 1KIUA 3FJTA 4M48H 1WWWX 1AGBA 2VSCA 3SDYL 5T1KD 3X14A 2LU4A 4JY4B 3FONB 1NCCL 1KIQB 1GYAA 2X7LB 3RNQA 5E08L 1N4XH 2XTJE 3CDFA 3HAEB 3GUTB 4R7NA 3P9LB 1BFOB 3P11L 3IXAA 1ACYL 4WUUA 1MI5B 4LEOA 1T3FA 4ZG1A 1S9KC 5ACMA 2EYTA 4GAJH 4OZFH 4D9RD 4NM4H 3MV8B 1DEEA 3QFJA 4Y4FD 3IF1A 2HLFD 3JTSB 3QUXC 1V5JA 5HGDB 4KQ4H 3GRWH 3NTCH 3OWEA 1XF4A 2HFEA 3BP6B 3FRPG 3AMLA 1ORQB 3RVWC 3OKEB 3SGKC 4FFVC 4IRZL 3ACFA 1A4KB 4OIBA 3UTSE 3PWJA 4P3DB 4A6YA 1J1PL 3QUZB 4MXWL 3MR9B 4P5MB 4PQQA 2R0LH 3W9DB 3BP4A 1BVKA 5BVJA 4YR6A 1L7TH 2AK1H 5C0FA 4X6DF 4Y8AA 2Z8SA 2OR9H 3CZFB 1PYWB 1DQDL 1XGQA 3ZO0A 3SPVA 1AGEA 4MA7H 2J5LC 4ZUTB 1ZHBA 2D03H 5C09E 3CFKB 4KHXL 4NQDB 5D5MF 3OPZH 1SMAA 1ZKAA 4NUJB 3KPSE 4L8BA 5A2KH 1BVKB 4PJCB 1EK3A 1AXTL 4QO1A 4FTVE 3JVGA 4C56D 5L2KE 3K8MA 2RQ8A 4LHSA 1AD0B 5FA3B 1U8IA 2R1WA 2XKNA 1MFNA 2J88H 3PGDA 1RUAH 4JZJC 5KSAD 4RCAA 4HWBL 4XH2A 3O9WD 3ZE1E 2BNUB 4X6CE 4ONOA 3H9ZA 3UJIL 5KSVB 1ZA3B 2DQUH 2O5YL 4LLQB 5T33L 3RZCD 2BMKA 2FBJL 2DS4A 1B88A 1K2DB 1U58A 5FDWB 3WSOA 3UTQB 5FA3A 5E2WL 3K4ZA 1DFBH 5FUIA 1CGWA 1AR1C 2KQNA 2R0KL 4YEFA 2KKQA 2R7EB 2D7NA 3QI9D 3PP4H 3V5KB 2VCAA 3T3PF 5GSVB 4YDJA 5AWNH 5A2FA 2RAMA 1GC1L 5F7YC 1PX4A 3CCHB 3OTTA 1DZBA 4NQDE 1ULOA 3QDJD 1SG3A 3F7RA 1R5WA 4LSUH 3QXVA 3G5XB 3OKKA 1X5AA 4XCEA 5JXAL 4OT1H 4ZNEA 4Y4HD 3NVQA 4U1KA 2BVQB 2IANE 5EU7E 3RVVD 3O3EB 2Q6WB 4GRLB 2GFBA 4GG8A 4LQRA 1CICB 4MCZB 4ZUVA 1IQDC 4WEMB 1GPOL 3QULB 4NQCE 1WK0A 2IAMC 2P7TA 2FZ3A 1IMHC 3TO4C 5D2NA 5DQJA 5B3JE 1A3LH 3HB3D 4GRLC 4QNPE 1T2QL 5BMFH 4WW1A 1PKOA 1JYNA 5HVFB 4PGDA 1EEZB 4QY8B 4WWID 4X6DB 2Q7YB 1C08A 1R5VA 3IFNH 2R4SL 3GO1H 4P2QA 2AXJA 2QLVB 4ZUUB 1NMBH 2C7UB 1ZGLM 5GRJL 1RIUH 1I75A 2ZCHH 2OI9C 1QRNE 2AGJH 4XPHH 1T0NB 1X5IA 1NC2B 4FQXB 5CJOH 1YEEH 3LIZH 3P3YA 3QIBA 1NCDH 1IFHH 1Z2KA 3QULA 4OGAC 5DK3A 3UTPE 1T4KB 1IEBB 4N0UA 5EU4A 4YHYC 1KEMH 2NPLX 3U0WH 4S1SL 5BXFA 4G80A 4QHLB 2NYYD 1QHOA 1U9KA 5DYOB 1CZ8L 4LHJB 2HRPH 3VWKB 5ITFB 5MEND 1WC7B 5DJYA 1DEDA 2FH6A 4G6MH 1HWGB 2FJFB 1T89C 5E1HB 1BLNA 4JKPH 3RWDB 1HDMA 4DZBB 1CGXA 3TNMB 5JHDE 1IM9B 1AO7D 1QRNA 4G6AD 3TT3L 4ZS6C 3F6IA 5J13B 2PNDA 5A1AA 5H94A 4EDXB 4AIZA 5KANI 1BGXH 3A0OA 4U3CA 5D7JC 1OQOA 3QI9A 4BKLA 3QDMB 3QIWB 2IG2L 3C5JA 5C6WH 3L3HB 4HLJA 2BVEA 4LSPH 3VWKA 3LKPB 1J0ZA 2Q3ZA 5DGQA 3MJ9L 4U1NA 3T0EB 4Z0BL 1BQSA 4MVBD 3P4MB 3ARUA 5T3ZD 4JFEE 4GKOA 4EQ2A 3L3GA 1HINH 4OCWH 4O2CB 2X4RB 5C0CE 4M7ZC 4IOSD 3BP6A 3L5WB 1DVFC 1J83A 5D8JL 3WJJC 1NDGB 4Z7VE 3LY6A 1NMCC 1EH9A 3VFGL 4LCWD 3RWHB 4IIQA 4PGEB 2UY6A 4K94C 1NUKA 2GTZB 3QUMB 4J8RA 3QJFA 3MRBB 1YECL 4Z77A 1CCZA 3BEVA 1WFOA 2W65B 4N0FA 4I0PA 4K3DH 4MNHB 4JKMA 2ENSA 1RSFA 2IADB 2DD8H 1LNUA 4P02B 2WLZA 3HI1B 3NAAH 3T0BA 3N1GC 2Y8KA 1GGBL 1JMXA 5DJ6B 5B38A 9CGTA 3FO0H 2H2PC 4CL7A 3MLYL 2MCPH 3NPSC 1ZXQA 2M8XA 2KPNA 5EIIB 5FO8B 3HZMA 4NP4L 4X7TB 1D7FA 4S1DC 5CD3A 4LL9A 1AXSB 2FECL 3CDGB 4Z7WA 3TO4B 2WO2A 2MPAL 4OMCA 4O51B 2JB6A 1EVUA 3EYVA 1JZ8A 1WZKA 3OL2A 3ZMRA 2W59A 3SE3C 2JK5B 4U6VL 2H2PD 3QG7H 1OAQH 1OGAA 2X05A 3PNWA 4HUMB 4TPRH 1OD3A 1G9NC 3BGAA 1WFNA 2YD2A 5IFPA 1OT1A 1H0DA 1VDGA 2I07A 3FO1A 1VFAA 5HD8D 4L29A 5FHAH 4JKLA 3KVQA 4D9LL 5JR1L 5D7SH 3S5LG 4X99B 2ADIA 2AQ3A 1KEGH 1LO3L 4G42B 2DQEH 4RX4D 4HMEA 3SHSA 3RA7L 4U6HA 5C0EB 3ES6B 4U6TA 4JM4H 1AQKL 1B0GA 2X89D 2GT9B 5E8EB 4FS0A 4JQXC 4MB5A 4KKCD 3F7VB 3E6FB 1ZOXA 1V3LA 2IH1B 2ARJA 4PG2C 4Y2DC 1S9VB 2OXHA 2Z9TA 2XONA 3MJGX 4LHUD 2PYED 4KDWA 4GMTL 5HHXL 2Y72A 4ZTOH 2Z31D 3ZL4L 3O8XB 3BE1H 1T20B 2GSGA 3MRKB 5ISZD 2V2TA 4Z7VF 3F7YA 3DHMA 1FC2D 4U7MA 5FF6B 1F4HA 1X5HA 5KTEH 1RK0B 1QZ1A 4PJ7B 2IBZY 3BSZL 4HBQA 3V0VB 4QRSA 4LSDA 5IQ7L 4OCLC 2QADD 2EH7L 2J8UA 4J3WA 1I8LA 4OQTL 1YYLL 4NCDA 5IFAH 4ZSOA 3O6FA 2HRPL 5C08D 1KIPA 4YDIL 3HRZA 2BNQD 4U3HA 3JWOL 4ODXB 2ZUSA 4LIQH 5DC9B 3BKJL 2B2XL 1UWGH 2J1TA 2Q20A 2GCYB 4PTTB 4RIRB 3EJZD 4OD3L 4L9LB 4XCYB 5EBMB 1P7KB 4X5LA 4XWGL 1QSED 3ECBA 4PRHB 5I1IH 1XR8A 5GJSL 2P24B 5EZLA 5E99H 5T1LB 3DMMD 3WFCH 4GKZB 3RHWF 1WCBA 4KK8D 5F7FA 4P3CL 5DD0L 3FO9A 3TESA 1EXUB 1MRCH 3G6JB 4X7EC 1U8OA 2HLFC 3TBVB 4MXQD 3L3OA 2B1HH 3GSNB 4I3RH 4MA8H 4DN3L 1A1NA 3D3VA 5HGAB 3ZTJH 1BX2B 3I6LD 1ZLVK 3UTZA 3X13B 2NY4B 2W92A 1HEZA 4PRIB 3RNKB 4MDJB 4CUAA 1FYHB 4ZS7H 3DPBA 1U92B 1EJ6A 3BW9A 3SGDI 5F3BA 1FIEA 1CR9L 4N9GB 1NBZB 1TJHL 3CH1B 3C5JB 2OTWA 2VR5A 2WZPD 1QO3A 1YPZE 4QXUL 1RUPH 4HZLB 5EOQH 5DJDB 2FEEI 4NC1C 4HWZB 4C55A 1EAPA 5E00B 3OMZA 2V7HA 3IAQA 2WO1A 1FIGH 2P45B 5GHWH 4LEXH 4S1QL 3UCRA 3DVGA 4K2UL 2N7AA 3LQZB 1DTUA 3VWJC 1N3NB 4QRPB 4Q74A 4X4YB 3EDEA 2HJLA 1CIUA 1D9KC 4KJWD 4L3ED 3DVIA 4MNHA 4P2OC 4CBPA 2D7QA 1E4JA 4ONGH 3DX9B 2Y64A 5I1GL 4J8RB 2EE3A 5F1IB 2IAMA 2HYMA 5HDQL 1LWRA 2ZCKL 3SGJA 4O9HH 3MZGB 2D4DA 1CZVA 3DUSA 3L3KB 3EO9L 4QRQA 4M93C 4WEBH 3QEUB 4GAGL 2MSPA 4BSWA 2R8SL 2QSTA 1YY9C 1K8DA 3SDAC 2G5BA 5F7WC 2H2SD 1L6ZA 2H45A 3O9WC 4NP4H 2DYPA 1J8HE 4WW2C 3DX9A 3VMPA 3OEBA 1QQDB 3FQWB 3MOQA 3HE7B 4P2QD 4Y4KC 4R97C 4KC3B 5DHYB 3BIKA 3U1SL 1ZLVH 3SY0A 3PNWB 1ZT7A 3IFOA 1AI1L 3C7HA 3JWOH 3A67L 1AP2A 4YHLL 1I7TB 2XYCA 4PG2A 3GSWB 1BQHA 4ZPVB 3TA3C 4TQEL 1I7UA 1Z5LA 2Y07H 1CBVL 4P4KD 3D2UA 1G84A 2C3WA 1W9WA 5CGMA 4TSAL 4NZTH 1NGZB 1SEQL 3FZUD 2QQJA 3RX8A 1E28B 4EN3A 5C7XL 5D1QA 3MMEB 3IS1X 3EKCA 3PUHA 4PJ5B 3MRLA 3MV8E 4ZODA 2HKHL 3P9MA 1QR1A 5DR5L 3SE9L 2NX5B 2V5SA 1PJ9A 1VB9A 3ELAT 3K74B 3S97C 4QXTA 4F2MA 3CUPB 4UTBH 4XMLH 1DLHA 1JF1A 4DKFL 4QXWA 3IJSB 2XN9E 4TNVK 2VXSL 1I1FA 5MEPA 1UACL 4LPVA 1DVFA 3MRLB 4BA8A 1F11B 3MROB 5KZCB 1RU9H 1RZKH 3LD8C 1MCBA 1U8NB 5F7UA 2KZ1B 3I85A 5F9WC 5DJAA 4Y1AD 1UM4L 4O2EB 4UINH 2XA3A 1F58H 3IDGA 1BF8A 2XZCL 1MHEB 4OCRH 5ID0A 4G43B 3BUTA 1KIPB 4HD9A 6FABH 4K3EL 5E5MB 4PGCB 4FABL 3WFDL 1W0VB 2CQVA 3SKVA 5LGHH 1UVQB 1AJ7L 4POUB 5J06A 3KYNA 5K9JL 1A4KA 3C08H 4JDZB 3FQRB 5IEHA 4W6XB 4YC2C 4R4FL 2AEIT 2DLGA 4ZQKA 3D0VA 3A6BL 3NZ8B 4JO2L 4TOYH 3AM8C 1PGRB 3P0VL 4M7LH 4PJEA 3HB3C 4GRLD 1KULA 1QPPA 3OKLA 3FFDA 1TQBB 4X98B 4Z7WF 4G7VH 1H5BA 2BHUA 3QSKB 5F7LB 4RGNB 2VWEC 1E4WL 3RWJB 1UH3A 3KLHC 2QQKA 1SDDB 4P2YA 4F33A 5AAWA 5GGTL 1E4KA 1ZHKB 1HHIA 5D5MB 3NCMA 3DO7A 3M8OL 4R6UA 1SY6H 3VFNB 5D7IE 5IGXH 2P4AB 4M6MH 2ZWLT 5BZDA 3RGHA 3BRGC 5A2JH 4XXCC 2YG0A 4AEIL 4HGWB 3NFPA 5AD0B 1OW0C 4YHZH 4XURA 3CX5J 5JQHC 4MD5A 1TIUA 2FIKB 4HT1L 1A47A 5H35A 5ITFA 3GZKA 2E8YA 3BYTA 5EIVA 1ZLSH 4YQXL 3ZDXF 1LDPH 3VXRB 4BJ0A 5E1AB 2I24N 1N64H 4ORGA 3S37X 5TE7L 3U9UB 3K77A 4OFPA 4M7KL 3L6FB 5DJDA 3BP5A 1B6DA 4H1LA 2NX5E 2BOCA 1AQDA 4GKNA 3KNBA 1DSFL 4ALAH 1FLRH 1RURH 1IC5L 4ARXA 2P5WB 4C56A 3PUCA 1WIPA 3BN9C 3PIQA 4JHAH 3C09B 4LARH 1U8QB 4G7YL 4GO6B 2X70B 4MO3M 4Y16D 1FZOA 1IC1A 4ELMF 1KC5L 3QDMD 2CKBA 3O6MH 5E6IB 5A16B 3AS2A 3T77A 3U9PH 5DHXB 3OKDB 4F7MB 3MNWB 5GS0L 1BM3H 1M71B 4I48A 3WNMA 1GZQB 1YEIH 4FQ2L 2N4IA 2PTVA 4ZFOB 1SBSL 2DB8A 3TPUB 1UXXX 5I9QC 1JPTL 2EICA 2V9RA 3C7OA 4FQHA 4HCRA 3T0DA 4G6AC 5IFJA 4ZXBA 4F8QA 3GO1L 1MCHA 3WHXA 5CSZA 1VENA 3MV01 4XPAL 3NCEB 4I0PB 1N5YL 1KB5H 4XWOD 1NEZB 4OAWB 3BH8A 1UXZA 5DQDH 5EU5A 3DROA 3KDMB 3FKUS 4UV4L 4KK5D 4KKNA 4JAMB 4UNTA 5DJ8B 5GGQH 2ITDB 5BS0B 3CMOL 4LFHD 4OJFL 4ZUTA 5E6YA 1LK2B 2B1AH 4YZFE 1M7IA 3B2VL 5IB2B 2KZWA 3P73B 5IW1B 5IV2B 4EUPB 2C9KA 4PJAF 3VXTA 4LDLB 1B3JA 3CD4A 5DEFA 4PTUA 3JV4A 5BV7C 5EN2A 1AGEB 1RZIA 1INEL 3ARBB 1SEBB 4Y19D 4TVPH 5INCB 2QQKH 5AYQA 3C5ZB 3DO3A 5C09B 3NCBB 2AVGA 2EIEA 3B9KD 1YN6A 1R24A 2H32H 5DRXA 1RD6A 2E9JA 1YEHL 4DXSA 4YXKH 4TTDC 1IGTB 1BJ1H 4X5XB 3IDUA 3IXTB 1HCVA 4X9GA 4C59B 2IFFH 2GYSA 2HH0L 1WJ3A 5JQ6L 1DFBL 5KVDH 1ULVA 1J8KA 4DTGL 3DGCR 3QQ4A 2WNGA 4UTAL 2MCPL 2NTFA 1XGRA 3BDYH 3RKPA 4MZ2A 4OD2B 1NGYA 4PJ5E 3BN6A 1A5FH 2VM9A 1RZFH 4HXBH 5CGTA 2VDLH 3IETA 2IPTH 3IU4L 2DD8L 3FL7A 5TH2B 4LLMA 4PLKD 2J22A 2AI0L 3VMOA 5FYJU 3HNBM 1JV5A 4K23L 1INQB 3CGTA 1KGCD 3MOBH 1E6JH 3ALWA 1ZGLP 2JELH 2XTJB 5I6XB 3FRUA 2HT4D 2WWMC 4K8RL 3PWNB 5D71H 5ALCH 2I25N 1MFCL 5IESL 3QRGH 3MRKA 4E41A 4ZFZB 1QYGL 5EULV 5E2JA 4S2SA 4U1SB 2VXSH 5C7XH 3CFBA 4DGYH 4ODSH 3SO3B 1TPXB 5JLZA 3ILPA 1DANU 4PJ8C 1DBBH 3UTSA 3VXMB 3IB3A 2YWYA 1OT2A 4ZFFB 5L0QC 3MBXH 5EA0H 4YHZL 5FYJE 2X4QB 4OF3A 2HTKD 2QQMA 4WTWA 2XWJB 3VA2C 4NJ9L 5FUOH 1UADC 1U6AL 3GHEH 1M7DA 3QDGB 2Q8BH 1JI2A 2FEEL 5C0AA 5D96B 1KN2H 3MGAA 2HRLA 4C57C 2DLFL 1P7KA 3DGGA 2DICA 5TDPA 1FJ1B 3TH4T 4LPCA 2ZG1A 4KV5F 4LNRB 3W39A 3IDXH 5E8PA 5J6GA 3MRDA 4J3VA 4HFWB 5E8OA 2HKFL 5LG1A 4ELME 3MCKA 4OLXH 3DSFH 2VZUA 3T09A 1CS6A 2C4FT 1IEAB 4P4KC 4HGMA 1XNTA 2BSSA 3WKML 4DW2L 2CRYA 1D5XB 2CDFB 1FV1A 5GGSB 3V52L 4KK9D 1G0DA 1U8KA 1JZ5A 4OLVH 3HG1D 5BCAA 4NKMA 2X4OB 5C0AE 4BQCA 5I1EL 4QB1A 2NMSA 1LEKA 1J87A 5T5NG 1IM9A 1QRNB 2OL3L 2D3VA 3HMXL 4JCLA 5DJ0B 2P5WA 3O81A 1L7IH 1T5XB 2DL2A 1YMMD 5H94B 1CN4A 5JXJA 1KTLA 4D0QA 3MOAL 4GWJA 1GHFL 1F3RB 3BQUD 3BHBB 4OKVB 5TGBB 5JW3H 2P8MB 3CX2A 3EJJX 4OLYL 4AZ8A 4P3DA 3FB7A 3QIUC 4TVPE 5DWUL 1R3HA 3W9DA 1OSZB 4G8IA 3OGVA 2VC2H 3H3KA 2EEDA 3MUHL 5IROA 4TUJB 3BH8B 1NH6A 4XVTL 3C60C 1MWAA 4RAHA 3I3DA 1J1XL 1OTUD 2VZRA 1TZIB 3G5VA 2YPLA 5ERWA 4G9FB 5F7KC 2E7CA 1H8OA 1NBVL 4PGEA 1RK0A 3OZ9H 4PRHE 2CK2A 3GSVB 3PQYD 3JV0A 1YQVH 4NQVB 4PJ9B 4OI7A 2KD7A 3UROR 4RDQG 2JLLA 1DBJL 3FCTA 3MRGA 3ZT7A 1BD2E 4MB3A 2XIDA 4XNUH 1P8JA 3RBSA 1JNJA 4MJ5B 1YNTA 2J1VA 4LLVA 4LASH 5JORB 2X9XA 4LLYB 4ZS7L 3VDAA 5JO5A 3D25B 5I74C 1JK8A 4L4TD 1S7XB 3N50A 3RPIB 4LCCA 4R8WH 1GOGA 1OAQL 1DCLA 3BUYB 4URTB 3HZYA 5LQBL 1JU3A 4WRLA 3T3PE 4H88L 4P9HH 3EFFA 1I7ZA 5T3ZL 1CXLA 4ONFH 3VFMA 1ZT7B 4NQCD 1A6PA 3M45A 3RZCC 5FAAA 2D4FA 3OSKA 5FB8B 4M5ZL 4PJDF 1HQ4B 1MREL 1F00I 2AXHA 2DM2A 3FT2B 4H5SB 5CUSH 1MAKA 2EDDA 4KV5E 3VD7A 5MENB 3DRQB 3IYLW 1N0LA 1WAAA 1KBGH 4X5WB 3TVMB 3SKMA 4K7PY 3VFTA 2RBLA 4G9DB 1K4DA 2HFFA 1D5BA 2X4PB 3GXUA 43CAA 4A2LA 3FO1B 3RIFF 4D0CB 3DWTA 4GW4A 4L3CB 4CVXA 4QHKJ 2VDPL 2ZCKH 4LSTH 4F7TA 2VABB 2ICEB 4OBRA 4FHBD 1MEXL 1KCSL 1DQQA 1MLCA 1X4YA 1NC4D 4GH7B 3THML 1OAUH 4JFFA 5GGQL 4NRYB 2UZXB 4U0QB 5C0RH 4U6HB 4HWZA 3RY5A 4E42B 4GRLA 4G6FB 2BHYA 5C9JA 4P46B 2YS4A 2ADIB 4NO5B 2UWEE 3DVFA 1EO5A 3DX7A 4Z0XA 4QRUB 2DQEL 3VFRB 5MERB 3BMVA 2Y5TA 2FX7L 1RMFH 3KJ6L 4Y4KD 2Z31C 3VRLF 2YPKA 4HDIB 3QUYC 1FHGA 2R29L 3GMQB 5HYSG 1SBSH 4QAWA 4Y1AB 3P0YL 3GMLA 1Z9OA 4JFED 3L3DA 5GGUA 5C07E 2BRQA 1MFBH 3TN0D 2GW5A 3C2AL 5EDXA 2VXQL 2PYFB 5F1NB 2DQFB 1CDBA 1D5ZA 4K7PX 2E33A 4MJIA 5GRYA 2NY7L 1E6JL 5L6YL 5ILTH 5F6IC 1RIHL 3RWEB 1GGCH 3L7EA 4PJGF 4P3CH 2Q8AH 3D85B 3H7BA 3QHFL 4M5YH 4ZOCA 1A9EA 1IAOA 3AVEA 3MV7E 5CMAB 4PRDA 5D4QA 2J8UF 1ZEAH 1SHMA 4XTRD 3FQNB 4YDKL 2WBJB 3SKNA 4ZSOB 1J7VR 4H0HB 1RZ7L 1U42A 2GQHA 4R9HA 4A2MA 4DW2H 1U3HA 3FOLA 1HI6B 4ZOBA 3SKJL 3VXPB 1GU3A 1IE5A 3AB0B 2R69H 1OPGH 3RWEA 1UC6A 3BPLB 3B5GA 4KI5M 2G9HB 3VXOA 1X5XA 3MFGB 2VLJE 3OXRA 1YUHA 1KTLB 1OF4A 1LO0H 3VFOB 5BMFL 4PRHA 3DUUA 3IDAA 2EH7H 3DX8B 5IK3B 4KI5C 5IKCA 3SKNB 2BVPB 4JFFD 4QGTA 4U6XB 3UTTD 3MBWA 4OZHE 5JW4M 4P5TA 1AKJD 1MHCB 1QSZA 4WVRA 3ISWA 4L0PA 5TQ2L 2QR0A 5D1XD 4U31A 1T7VA 1G7QA 1XR9A 3ARGB 3GSUB 4LCYB 2EC8A 4FFWD 4LFHG 4JFXB 2X44D 4YDLB 4I3RL 4MA8L 3I6GB 5F9JA 2J6EH 4R7NB 1FSKB 3ALXA 2XY2A 4K8RC 5EOTB 2AV7B 4TTGA 1X5JA 3MA9L 4F80A 1LQSR 4YDVA 5B39B 4N9GA 2LQRA 3LS5L 5KJRH 1JWUB 1L4IA 4MGQA 4P5TB 2JD9A 2BCKA 3B6SA 5D96C 5IM7B 1RZ7H 4JM2B 5DVOA 4PGBB 3AY4C 3S5LA 3FCTB 2ILLA 4EOWH 5LXGH 5EORH 1EZVY 2P8PA 1HQRB 3RTQB 1TDQA 2X4NA 1EBPA 3ARSA 4ZO8A 5E0QA 1O7SA 2G75B 2R2BB 3TZVD 4J12A 5EIIA 3D39A 5E6ID 3LN5A 4XNMB 4JJ5B 2OBGA 1EO7A 4R96B 5E94B 3TGXA 2HVKA 5IWLA 2C1OA 1S7TA 4GQ9H 2QADC 2VITA 4ERSL 2R9HC 3V8CA 2K7PA 1LILA 4L8CB 4X8JB 3V6FB 3QEUA 1OAKH 1YEDB 3WEXB 5LXGL 1C8PA 2O26U 5DQ9A 1HQRA 3RTQA 1WT5A 2P47B 2BK8A 5E9DE 3ETBF 3EFFB 1JZ7A 3G6JE 4HWNA 5DFVC 1P2CB 5BW7C 3KPSA 4XPHL 1RYYA 4KMLB 3MRFA 3AXLA 4WI3A 5ABDE 3NH7L 4HZAA 4QPWA 3OR7B 3RWJA 1Z0MA 1FNAA 1TJGL 2R0ZH 1IGJB 4L4VB 5IB2A 1UXSB 3PWLA 1J0JA 1A7OL 3LKOB 4PY7B 2J6EL 4GBXB 3WO3B 2AXGA 2BNQE 3QFJD 3DBXA 3DV6A 5IJKC 5HHQA 2UZIH 2OSLA 2UWEF 4V1DB 3VFNA 3GMOA 3BIKB 4ZPTB 3RQ3A 4U1IB 5IESH 4PYHA 4PB9H 1IVLA 1LP9B 4U0RB 3ARFD 3H42H 4YBHA 3R4DA 3UTOA 4A6OA 1EZVX 1MJJB 1NQBA 4EXKA 2OR9L 4Z7WE 4JFPB 3WNLA 2J1RA 5CSBA 2NY3C 4CKVX 5JXIA 5I8CB 4Y8DC 3KYKL 1QSFB 4AENA 3VG0H 5DDHA 1P4BH 2X5PA 2KUTA 4FP8H 3CZJA 2DQIL 3ZYJA 2A0LD 4IJ3B 4HK0B 3QEQA 4UAOC 4CU9A 1NBQA 2RVAA 4HH8A 5L2JA 2W5FA 3MMEA 3RDTC 3F62A 1A7RL 3JZ7A 4HGKC 4NM8L 4PUBL 4I1NB 1CLOH 3U7WL 1B4JL 1X5GA 2EDOA 4Y19A 2VLME 4P9ML 4WUKL 2BJMH 4ORZC 5GGUB 1RHFA 4Q2ZB 4P23D 1FYTB 3RVVC 1ZT4A 3C87A 5DUPL 3AFLA 4XPGH 5B22A 3LQCA 5D7LA 5FYLH 4AH2B 5BJTA 1T7ZA 4HK0A 5KW9L 5GGVL 2F5AH 5E5RB 3W9EB 1VPOL 1H5BC 4NIKB 1KJ3H 3L3HA 5FYKD 5H8DA 4E41B 3MSPA 2BRRL 1S9XB 4LSRL 4UBDD 4E5XA 4KDTC 3C6LB 2P24A 1A64A 4X6EB 1QLEL 1CD9B 3QZWB 5AG9A 4UTBL 4LPYA 1N0XH 2D7TH 3LVEA 4N8VA 1EX0A 3QHZH 5BJTB 1PZ5A 4WFFD 5JPNB 4EI5B 2H8PA 1VCAA 4MSWA 3KPRE 3WUWB 4NKOA 8FABA 5IHZB 2BVTA 4P4RA 5GRUL 1KN4L 5IVXF 1TITA 3ABZA 3S88H 4HJJL 3N1QC 4I18A 1XAUA 3GI8H 3PABB 1B6UA 4H1LG 4M6NL 1CFSA 2OLDA 3S98A 4HFWA 1S7UB 3UBXA 5JUVA 3DTXA 3T2PA 5I2IA 1QEWA 3VWJA 1E0OB 1NEUA 5DJXB 3SBWC 2Z35B 5JA9A 3C7GA 1OWRM 4J7RA 5HHNB 1ZV5A 5SWQB 1ED3B 2CIKB 2VISB 1CBVH 3QUZD 3VFSB 2MJWA 3TO4A 3I2IA 2EEAA 2VCBA 4G7VL 5IMOB 5HYJB 2W0FA 2VH5H 3GMMB 3BZDA 4PGZA 3G5YB 4FXGB 1YDPB 4AL8L 3EO0B 3VXRA 5TE7H 2PXYA 1MSPA 2ZPKH 4F7CA 5HYSB 5TPWH 4BZ2L 2Q86A 1J86A 3TM6A 5CEYB 1A9BA 2X4NB 2APFA 3BQUB 3BPCB 3OF6A 5FYKH 3B4NA 5DMJB 4WFHE 2W1QA 3ME0A 2PUQT 3MLXL 5J6HB 4TUKH 1IAMA 3BKYL 3OJDB 1PKQE 2NW3A 1MCJA 3R06B 2GJ6B 2NY1D 3H9SB 4Z7UA 1T66C 3QO1A 3VXUA 5JHDB 3BEWB 5T33H 5HHPB 4B50A 2EDKA 1UB5A 1KB5A 5ANME 2WQRA 1NLBL 4XNZC 1X6LA 3LSOA 4TULH 1QVOB 4ZOEA 3HNMA 5SWZA 3PDDA 1T2JA 2PO6A 4HMDA 2OSLB 4V1DA 1OQXA 3BDBA 5IFJB 4BFEA 2R4RH 3HEIA 4UQ2B 1FDLH 5FYJH 1LP9A 1FVDA 3JWDH 5JDSB 2XFXB 1Y18A 4X7DC 2BDNH 4KXZH 3OAYH 2J12B 2DQCL 5EU6D 1KCRH 1GHFH 1KJ2B 5E7FA 3MV7A 4OV6F 1KACB 3N1MC 5TQ0H 4N0RA 4L4TB 2XY1A 1QSFA 2G60H 2A77H 4O00A 4HUVB 1CT8A 2E9IA 2E9WA 4LPTA 1JVKA 1X5FA 4UQ2A 1AKJA 5TPWL 2RB8A 4EBQH 3WNOA 1GIGH 3UESA 4G8GD 2HVJA 2W1WA 2VXTL 3G5ZA 4R26H 4N1CA 4N8CH 3BPOB 4H0GA 1P69B 1S5HB 5GJTL 5M95B 3KYOA 4OIIL 3I3BA 5DJCA 3T4YB 3Q5YA 3PL6B 1DUZB 1ZT1B 1G7IB 3GRWL 3NTCL 1Y6MR 4QOKB 3IAGC 4XUOA 4X6BB 1ROWA 3I2JA 5D2NE 2FO1A 1NDGA 1YEGH 1CX1A 4EIZC 1P9MC 3T0XA 1FL5A 1DQJA 4UZGA 4FZ8H 4WV1B 3IJYA 1NC2D 5TH2A 1JWMA 4JY6A 2ZNXA 1MPXA 3O8XA 2FSEA 5SX5K 1IAKB 2BGPA 4KMTL 1OSZA 5C0IA 1ETZA 5EUOA 3JTSA 4HUKB 4RA3A 1I3GL 2APTA 5E2VH 4JKWA 4GRWH 1U8PB 3S9DB 2IMNA 4Y4HA 4N68A 4WJ5A 1M1SA 4NPYB 1L7TL 2V2WB 5DD6A 4F7EA 5B38B 1DQJB 5C0BB 5I19H 3ZL4H 3CFBB 3RU8H 4HS6B 2FSEB 3BD3A 2DN7A 2IADA 4LAQL 3V5HB 4WWKB 2WMPA 4JFQA 4BM7A 3HA0A 4FQLL 2Y5EA 1A14L 1URLA 4LOUD 5C0FB 5BZDB 4Z7WB 2FYYA 3VGHA 5F89A 3SPVB 2CDPA 3L5XL 2F5BH 4F9PC 1NMAH 5L7XH 3QIWD 3ULUD 5I2IB 4JQXA 3UXFA 1T1WA 3U4AA 3Q1SL 2W87A 1OAYL 2H2SC 2YD1A 5FIEA 1Q8MA 2Z35A 2H3NB 1IAIM 2HJFB 1AIFB 3B9AA 2V9QA 4FG6C 4YHPB 2X4SB 4HXAH 4G7YH 4LDOB 3REVB 3KYMB 3CXDL 2B1HL 2EDRA 1IGML 4QRTB 4C58B 3ACIA 2DCJA 1U8HB 2AJUH 1K4CA 3JV6B 3DUHA 1KYOJ 5HHOE 2N56A 2XA8L 1QFWH 5IMKA 3RVUC 3BXNA 1II4E 3A22A 1FNEB 3KPTA 4OLVL 2AJZB 4EJ1C 3W0WB 1P1ZA 5CJXA 1MHCA 4ZD3L 5FDWA 3G6DL 1FN4A 5GS3A 2OTUA 2CDOA 1NX9A 2CUIA 2BSRB 2I9LB 3UTTB 4DEQA 2OP4H 4X4ME 1TQBC 2FHBA 3M1BB 5GSRB 4JANB 5EOCJ 5FUZL 1FZKA 1K3ZA 1EHNA 1N6UA 1F3DJ 3P4MA 4AEHH 5FGBC 4JPKH 4HFUL 2E7LA 2LW8A 5CJQH 3HZVB 1R3LA 4KI1A 2DQIH 4YC2B 2OS7A 3WIHA 3DX7B 1WF5A 1MH5B 3BKML 4WI7A 4XP5H 3WF2A 5DVLA 2NY3B 1HHHB 4FXKA 4KDTA 3H9SA 4LLDA 1LK3H 4NBZB 1ZANH 6CGTA 4KKLC 3DXAA 1TJGH 2R0ZL 4GBXC 3QUYD 4XPBH 3FB5B 4ENEC 4YFLF 3U30B 2D2OA 2RJ2A 3MJ9H 1ERNA 3MV9D 2R69L 3HUJB 3B9VA 3QIUA 2N7BA 3OKMA 1FQ9C 1PLGH 1FCCA 1F5WA 2PYFA 5F1NA 2YK1H 2XN9A 1QA9A 1L9NA 3QDGD 4XNYL 2BBAA 4FQCL 1F6AB 2OR8A 3FQXB 4M3KB 1G6VK 4PJBF 3IFOB 4UV7H 4XRCA 5IB1A 5DMKA 5J13C 4Q9RL 2VLJB 4NRZA 4PRBB 3HPJA 1I7TA 2IPUK 4R2GB 5K9QG 3GIVA 3MOBL 5BV7L 1XFPA 2YC1B 1QLEH 3EYQC 1I7UB 1Z5LB 5D93C 5KSUA 3KYNB 3MJ6A 4YGVB 5EUOE 4L3EA 1RUKL 4RFNB 4KPHL 4RFNC 5C3LD 4BZYA 1LEGB 4P2OA 3OGCA 4XCNA 2NY6B 1HHKA 3ZYOA 4NQEE 1A6TB 3CPLB 3WSQL 4WFGD 2P43B 4PJEB 3NCYP 2MMXA 5HHXH 1EGJL 3MACH 3UTZB 3LN4B 1RZGA 4Q7DA 1KXVC 3O41A 5D2LB 4YBLB 4Y2DD 3EHBC 1MCWM 4U6XA 1C5DA 3QWRA 3OG6B 4PV9A 5CP3H 1ZTXH 2YXFA 3NIGE 2FLBT 3VU2A 5IBLD 4K3HA 4QOKE 3L1OH 3NA9L 3ROOB 5CS7A 4OQ1A 5IG7B 4M43H 1B9ZA 1CDGA 4JPKL 3HE7C 4ZSOE 5EO1A 5HI4D 5HPOA 5DMGC 5EO9A 4J6RH 1DDHB 3GDBA 2AJ3A 5C0AD 1FO0H 4OZ4A 1J05B 2F74B 2VLRD 4HHAB 3O9WB 1ADQL 3NABH 5JXEC 4PV9B 3ZE2F 1A2YA 4OM0H 1ZHLB 4NN7C 1GGIL 1MIEL 3ARPA 4GW5A 2OMNA 2KBGA 2W38A 1HH9B 3FQUA 2OJEA 4MAYC 5DD3H 1AD9A 4J2XA 4QX1A 2AXFA 3AAZA 4MAYB 2Z92B 1PX3A 1FNSH 4OCSH 4NT6A 5AZ2L 4R3SA 2V72A 4QRRA 4K9EC 1UWWA 4OKDA 5IHLB 5D2LE 3V5HA 3LEXA 3O4OC 1VEOA 3GMRB 3WIIH 5JXAH 5IFTA 2MWCA 2NW2A 4GWIA 6FABL 3RI5K 4D3CH 1FP5A 1WISA 1BOYA 2VXVH 3D6GA 1I8KA 5E2WH 3LKSB 1G7HB 4MNGB 2GITB 5IMMB 4H8WH 3HMXA 3WHE1 3QDJB 4KJQD 5IOPA 1OGAE 4Q6IA 1FG2B 1JNNL 4HMCA 4R4BB 2OZ4L 2BSSB 4YK4B 5GS1C 3X11A 2LTQC 4KPHH 5ESVB 5D9SB 1U91A 1YNLL 2R2HA 3ARDC 3F12A 1N7MH 4HIHA 3VFWA 5K9QI 3IKCB 1CICD 4I2XA 1EO8L 4KJPD 1UJTA 3T04D 3CSBA 1A14H 1A6VL 5SWSD 1EEYB 4OAWA 2GJZA 1FDLL 4PJCA 4HCRL 5EORL 4F9LC 3UTTA 1J9CT 4PS4H 2FB4L 3KLAB 1AE6H 5FM5M 2R2HB 3CVHA 2K9UA 2R1XA 1EHLL 3EHBD 2YSSA 3CNKA 4LRNH 5CJBA 4AJ0A 4YXLL 3VXSE 4XUPA 1K42A 1Z6JT 2QQNA 4D9RE 2RHEA 4ODWA 3V95A 2FNBA 2VZQA 4XHJC 4FQLH 5IB4B 1ZA6A 5KSAB 5K33A 5D70L 4Z8FH 3UPAA 1TETH 5TDOB 3H9HB 4IOFD 5I8OH 1BJ1J 1ADQA 3O6LL 1JE6A 1PG7H 3ES6A 1SY6L 1YEJH 4G43A 1DL7L 2XZZA 3QP3A 1NL0L 3RGVC 4FQQA 3RVXC 2XZAL 1IARB 4BJLA 3WXVH 1ZWIA 4LRNL 1Q1JL 4KZEH 4Y4KB 2F15A 4OF7A 1JNHB 1WZ1L 1CIYA 4QX0A 3DARA 1DQLL 35C8L 1F6AA 1J1PH 1UWGL 4HCRH 3RZCA 2CDEB 2X4UA 3MFFB 3GJEB 2QJDA 5CSZB 5D7KE 1IL1A 3PWVB 3SDAA 2Y7QB 3C6SA 5IM7A 2P5ED 1NSNL 4WW2A 1JUFB 1KIRA 4HULB 1CICC 3GSOB 2HT4C 5LQBH 4OLUL 3K46A 3T0ED 2JF1A 2Y6JA 1CD0A 4FTVD 5HHPA 3QT2A 4Y4KA 3D0VB 3GSXB 1FNHA 1EDQA 4GG8B 1JTOA 3MBED 1FNFA 4M5YL 1LEGA 4P2OB 3TWCL 5JPNA 5EC2B 1OB1A 3SQOH 2WBJD 3D3VE 4U1KB 1RV6X 2EDFA 8CGTA 2UYLB 4C4KT 4NKOB 3SOBL 2CLRB 4OLWL 25C8H 1NLDH 5C0GA 5CKGA 3ECBB 1NEZG 1XIWC 3TNNA 5GZOD 5LA0A 1DANT 1NCAL 2V2XA 2R39A 3MUGA 2LU7A 5BRZA 3MNZA 4DKFH 3WLWC 2ICWB 1IGTA 1FAIH 1IC4H 2ZSWA 4RZCA 3JXAA 3TBSB 3O4LA 3Q3GB 1WZLA 3NIFF 3MUJA 1AKJB 4I13B 3PWUB 1KOAA 1U0QA 3W81A 4UUJB 4O58H 1J1XH 3U36A 5C2UB 3RU8L 1ZAGA 4HX1A 3S36H 4QCIB 4KUZH 4Z7OE 4HHAA 5JXED 1UFUA 2ZSVB 3QHTC 3ZYIA 3DXAD 4YIQA 1IGYB 3OB8A 1DYOA 5FHAL 4XCFL 1IEBA 5EU4B 2W0KA 3MUGB 3GGWA 3SKOA 4LDEB 3BWUC 3R1GL 1EFQA 1HDMB 3BIAX 4DZBA 1ES0A 4OFVA 4U6YA 3IF1B 1MF2L 2ITCB 3QWQB 2BY3A 4OLYH 3HPLA 4HIEA 4XAWH 2CGRL 4OLWH 5C1MB 2WAHA 4JM2D 4M4RA 5H2BB 2V5DA 1S3KL 3M07A 1WIUA 4L5FH 3MREA 3JUYA 3PWJB 3QA3B 3MLTA 1L7IL 3GHBL 5DRNB 2CLZA 3RL2A 1JHKL 3KXFA 5L2JB 5I1KL 5ID0B 4ZFOA 4M1GL 2YN5A 4ODVH 4MAUL 3OKNA 5D6CB 5J12B 5JW4N 4KZEL 7CGTA 4KHTL 4LOUC 2C26A 5LA2A 3VXMA 3ARZA 1BZ7A 1JPGA 4XBPB 1IM3A 1UA6L 1G1YA 3G08A 3KPNB 3LEGA 2P8MA 4JZOA 5JDJA 2WIIA 4Z5RA 3VXNB 4HKXB 3IFPB 4LPUA 5CLWA 1JGLL 3WD5H 5CCKL 1VGKB 5EO0B 1CFTA 2A74B 5D6CA 1VADB 1TZHB 3BGMB 5L0QB 1RZ8A 3PL6C 1I1AA 1Z9MA 2NY0C 3K0WA 4UT6L 4OZIB 1C1EL 4NN5C 3CAFA 4HKZA 1RULH 3W11D 4Z78A 1IQDA 1FE8L 2QADB 4K94L 2JDAA 2ID4A 1O5DT 2A74A 4XPBL 3KYMA 4RWYH 1H6YA 4QDSA 1ZANL 4WGWB 4P4RB 2X6MA 1EPFA 3E3QC 2RIKA 3HAEG 2VQTA 3TFKC 4NOFA 3F6LA 4XBGA 5T3XH 3VG9C 3T08A 3VWJB 4A4AA 3HC0A 1R3KB 4LLUA 1JWUA 2FB4H 4NQSA 1CWVA 1MCLA 1ZVHA 3LRSB 1OM3H 1U8JA 1UZ8B 1QSEB 5SWQA 3IIIA 4G8EB 5AZEH 3KYOB 1EERB 3B3IB 1YMHA 4QHMB 3C60B 4G8FB 1QNZL 2P8PB 4HIXL 3D87B 4GXUN 3C6LC 4APQD 4FZEH 3VFUB 32C2A 3C8XA 2DLHA 5C2BL 3MCLH 1TFHA 3KPQA 2DQTH 3HC4L 3VFPB 2J4WL 4XB8A 2JTDA 5ICYB 1T6VN 2BX5A 3GK8H 1C12A 4Y5YB 1E27B 5I8KH 3GKWL 5DHVH 1U8JB 2EDNA 4PRID 4Z95H 1K2DA 1I3RB 2HTLD 4MA3A 3S34H 5DQ9B 5KVDL 3VE0B 1RUML 2ZCHL 1UY3A 3C5ZC 3D18A 2CK0L 4XCCL 2PO6C 4G6JH 4ELKB 4JG1H 3L7FA 4CNIA 1OP5H 3D69A 2YA0A 3AC0A 1MJUL 1UKTA 4BFGA 1NFDE 1JFQL 3HTLX 4H0IA 4DEPB 4CGTA 3U6RB 1IZJA 2I9TB 4B41A 4KY1H 1CGYA 4LHUB 4M43L 2FDBP 4MYWB 1UXWB 2PCPA 5JA8B 1GGIH 1MIEH 5J6HA 3L1OL 2IGFL 1O8PA 3M17A 5FM4A 1K85A 2FYYB 1TVHA 1U2HA 2DQDH 2X41A 5FYKE 3HUJF 4Z7UB 5BXFB 2VMFA 4UAPA 2YD7A 4OT1L 2XI9A 4DUWA 3MRDB 3D69B 5AG8A 3MLSL 3GMQA 1JGUL 2CPCA 3P0VH 1FE8H 3WNNA 5DK0A 4ODXA 1JPST 4HH9A 5CILL 3L3DB 4ZUWB 4Y4FA 1JRHH 3S8WA 5C71A 2DDUA 4H25B 2Y6SC 4GS7C 3O4LB 1MCIA 5G04L 2DM7A 4JJHA 2X1WL 5D71L 1Q38A 3RPKA 1A6VH 3BPNB 4MNQB 1LMKA 1SBBA 1QLFB 3I97A 3MNVB 1ZVSA 1QLRA 1TCRA 5TF1H 5B38G 1G7MB 2NTSP 2XQYG 2KQMA 1K12A 1FFRA 5HYJD 1DSFH 3ULUH 3PUIA 3MREB 2MKLC 2NY5L 3GSRA 1KEML 4HWBA 2OZ4H 4NO0D 4FMKA 1UM6H 4LSQH 4X7SL 2QKIB 2EDTA 1T7YA 4GRWB 3GIZH 1N64L 1E6OL 1OHQA 3C8KA 3KHOA 1M4KA 3ALPA 1I8MA 1BBDL 2FWOA 3RIFK 1A0QL 1KXQE 2AK4B 3H3PL 5KJRL 4JR9H 3P9LA 5F88B 5F7MC 3QCTL 4GKSB 1KJVB 4W6WB 3UJTH 2AJ3B 3MC0A 5A43C 5ETUA 5A16A 4ZAKA 1GOHA 1FL6B 3LEKA 3MRPB 2F54D 5GS2H 1NANI 1C5CH 1C1EH 3B83A 4J3TA 4KTYA 2A9NH 2A6JB 1BMGA 4GXVL 4TSAH 3EIFA 4FP8L 2AK4A 4X4ZA 5E2VL 4G9FA 1VSCA 4DN4L 4L1DA 4Z5RB 3FB5A 1S7SA 3D48R 2E6JA 2VSDA 4HV8A 3TC9A 1NUDA 5DD6B 1WFTA 4QRPD 3ARGC 4PB0H 3O3AB 4X4YA 2V17H 2GY7B 4E9LA 1EMTH 1I8IA 1CLCA 3VDBA 5HGGS 3V5DA 1ZHBB 5EZIL 4NYLB 3EOYG 1DUYA 4UAOB 4MQ7A 3GJFH 4KJQC 3ARBC 5EU6B 1U8IB 4KKBC 3RWHA 4PRBA 4PJFF 3TYFB 1UH2A 3QXTA 5LGHL 1OAXL 3QJFB 3IS0X 4IMLB 2YA2A 2YC1A 1D9KB 4RSVA 2BGOA 4MWFB 1MPAH 4TTDD 5J1XA 3V4UH 4LSUL 3MCLL 2VITB 3VFWB 5H37H 1CGTA 4WU7B 3IU3B 2X4SA 5FDYA 4AMKH 1BBDH 3C5ZA 1UWEH 5HDQH 4G8GB 1BGXL 5CWSA 1JGEA 2JJSA 4X4XA 1SVCP 4PV8B 3ZKSD 4KQ3L 4YWGL 4MXQC 2PN5A 4NZRL 3MBEC 3O11B 1HHGA 4G9DA 1SJEA 3C5SB 3H9YA 2DM3A 4G9FD 4MWFA 3WFBL 2A77L 4L3CA 4NWTL 4CVXB 4JO4L 1Z9LA 4Y5YA 3UTQA 2J88L 3IU3A 4JREB 1NFDF 2AEWA 3ZE1F 5GHWL 4L4TE 5JZ7D 1AH1A 4ZAKD 3QEGH 4LHUG 2D7PA 3HE6B 5L88L 5IG7A 3MJ9A 3AU1A 4GRMA 3BZFA 3NA4A 5DT1L 1H15A 3OAZH 1JF6A 3U2SA 3WXWH 4JFHD 1XCQA 4YPJA 1L0XA 2CR6A 5T3XL 5CLTA 3AS3A 1SM3H 4HWBH 4JFYB 1WGOA 4OZ4B 1HYRC 3PXHA 4NCC1 1ZLSL 1I1FB 3GBMH 2AAVA 3GMLB 3VFRA 3ZYZA 3N85H 2DLEA 3VXRD 3K1KC 3MLSH 2J8UE 2VL4A 4M00A 4F37F 1XNAA 4Q97A 25C8L 2ZUVA 1JYVA 3FT4B 4XX1E 1E4XH 2ED9A 4CW1B 3WFHB 2CKBB 4U1SA 4OZHB 3QWOB 5E95B 2V4VA 4FFZH 5KAQG 4QHNA 3VD4A 1M71A 4I9WE 3QQ9D 4P5TC 3V4PH 4QWWD 1D5ZB 1PMHX 4Y5VC 4FQIH 5DTFB 2W9EH 4GRWE 4JHWH 1S5IL 2VDRH 3MLRL 4ODVL 3J8F7 2ZPKL 4PFEA 5CUSL 1AE6L 3OX8A 5F70A 3V52H 2YBRB 5EZOL 1QFUH 1F6LL 5LCVH 3TBWA 4JRXD 4XRCB 5IB1B 4U1JA 3EDFA 4LQ1A 4GT7A 5JNYB 3MGOA 4CAGA 1W99A 1MHHB 5A2LH 1MIML 4RAUA 1CLYL 3T0VA 2IFGA 2HYXA 2F53B 4PRNA 3DYOA 3GKWH 5EJZB 1INDH 3ARVA 3KPMA 4X0KA 1OD9A 4IRJC 3R0NA 2AKRB 1NDMA 4OIIH 4YE4H 3GIVB 3P73A 5IV2A 2B4CL 2ZJSH 2JCCB 2E27L 4H88H 4P9HL 3NJVA 3T2OA 4ODHL 3BDXA 4UB0L 2XWTA 3CVHB 4CN1A 3L3IB 5HHME 3TN0B 4WY7H 3DO7B 1MFBL 5I66B 4XVTH 1A1MA 4JVPA 3WIIL 4JDVB 4YXLH 5T1LA 5C08A 1MQKH 4EI6B 3WIHH 1CFQB 2DQGL 3EAKA 5TQ0L 1CFSB 3WFEH 3ARBD 4Y19B 5EIQA 3WLBB 4JRYA 3V8OA 1KSRA 2MHAB 5C09D 1IGIH 5EWIH 4OI8A 1JGDB 3D85D 2UY7A 4RISL 4QB6A 1JN6A 1WIOA 1ZT4B 5DLML 1BZ9A 4L9DA 1D6EA 1EMTL 3VG0L 1CL7I 1SYSA 2JIXD 4BUHA 3RWGA 2D7TL 3I9GH 1MY5A 2GY5A 3KPRB 4WHTA 4Q9BA 3INUH 3MRJB 2W65A 5L2KD 2IC2A 3DIFB 1CU4L 1AY1H 1CE1H 1M6OA 1S9XA 4MA7L 4EZMA 2HMID 3JV5A 3QH3A 3KXFD 4J4PD 4PLJC 1XPWA 4NYLA 3PHOA 5F7EL 1A5FL 1EAPB 4AY0A 1TZIA 2PTTB 5F44A 1CDCA 4K9EH 5LBSH 3O3AA 1U95A 3UZEA 1ZTXL 4LIQE 1PZ5B 1I9IH 4XVJH 4P0DA 2HJFA 3CSPA 3QO0A 2Y23A 4OZGA 1OTTD 4IMLA 3PF2A 5CEZL 5BVJB 3QCVH 4OCYL 4HAFA 5EBWA 1CIDA 5J8OA 1W9TA 2EXWC 5E99L 3EOAB 5F1KC 1DBAL 4L4VA 4MVBC 5D1XB 5ALBH 1G9ML 5E2UL 3QJHA 3LMJL 1G7HA 4MNGA 1XF3A 3D2UB 3GIZL 3GRWA 4HS3A 4IOFC 4F9LA 3CVIH 1JGEB 4X4XB 5T1DH 1L9MA 2C3HA 1QG3A 1RUKH 3RIAK 2NXYC 2R9HD 4MJIE 3O2DL 4BSJA 4D2NA 1UM5H 1S7UA 5C0GB 5I15L 1R5IA 1HXMA 2VXTH 1QTYT 4UI2A 5F9DC 1KJMA 3B2UC 1T5WA 4Q6IB 1C5BH 2NY0D 2CR3A 5EU5B 2B5IB 1F45A 2OM5A 1QQDA 3FQWA 1N6QH 4G42A 3GI8L 2SEBB 1H0DB 2OL3B 3R1GH 4RFEB 4Y2DB 5I9QB 1J8HA 4X5WA 3TVMA 3IJSA 3VGAB 4XVUC 4FQCH 3TZVB 5IYYA 3GJFB 3INUL 1G6RB 1YEJL 2IALB 3OJMB 5HYJA 1FZMB 1R5IB 4YLQT 2JJVA 2AJYH 1KCVL 1KENL 4OGAD 4UDUB 4HKBB 2E7MA 2Z91A 4PY8I 2B20A 3WN5A 3CFEB 3SGEI 4PJ8B 2FX9H 5FOBB 3K7UA 4WO4A 5C6PB 1T1XB 4PG9B 4D8PA 1CT8B 5HY9B 4P2RE 2WIMA 4M1DH 3KPQB 4WENB 2NZ9D 4WI6A 2YPVH 3E6FA 1CR9H 3IU4H 2NR6D 1FZMA 2HJKA 3MO1A 4MHHG 4ZFOL 2W1NA 1PW3A 5C0CD 2IWGA 4NNPL 2J2ZA 4HKBA 3SCMB 5D7LB 5J1TC 3VDCA 1D5IH 4HUXA 1X9QA 4DN3H 5C0NC 4UTAH 5C6TH 4X6EA 2OI9B 4XC1H 1MJ8L 5HPMA 1MI5E 1G7IA 3CFCL 5CEXB