3K4ZA

Crystal structure of the cellulosomal cbm4 from clostridium thermocellum cellulase cbha
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
280
structure length
275
Chain Sequence
MLEDNSSTLPPYKNDLLYERTFDEGLCYPWHTCEDSGGKCSFDVVDVPGQPGNKAFAVTVLDKGQNRWSVQMRHRGLTLEQGHTYRVRLKIWADASCKVYIKIGQMGEPYAEYWNNKWSPYTLTAGKVLEIDETFVMDKPTDDTCEFTFHLGGELAATPPYTVYLDDVSLYDPEYTKPVEYILPQPDVRVNQVGYLPEGKKVATVVCNSTQPVKWQLKNAAGVVVLEGYTEPKGLDYVHWLDFSDFATEGIGYYFELPTVNSPTNYSHPFDIRKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 9
publication title The unique binding mode of cellulosomal CBM4 from Clostridium thermocellum cellobiohydrolase A.
pubmed doi rcsb
source organism Clostridium thermocellum dsm 4150
molecule tags Sugar binding protein
total genus 62
structure length 275
sequence length 280
ec nomenclature
pdb deposition date 2009-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4zA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4zA01
2YUWA 2OJEA 3T0EB 1MCPH 5D1ZA 3GI9L 4U3HA 2VISA 5IB3A 3UTSE 3BGMB 4JO3H 4P4KC 1JGLL 4M7JL 3CFDA 4BSWB 1M71A 2YMXH 4TVPH 3ULUH 2C1PA 4DAGL 3KHOA 1PZ5A 1RUQL 4KQ4L 5DHXB 2KD7A 1IQWL 5IIEB 2EKJA 1XGQB 3EJJX 3T8XB 3VXRA 3VXRD 2BZDA 1KB9J 3HNSL 1UQSA 2E33A 3P30H 4X6FA 4NM8L 5JPNA 5EUKA 1JF6A 5ICYB 4L4TB 5GS0D 1VDGA 4XVJH 2ZUSA 2W1WA 4OV5A 3MV8A 3MV8D 1HDMB 4KV5E 2CSPA 4OMCA 2EXWC 5KVGL 2VDOH 1CWVA 4XAWH 3MO1B 2F53E 1MCBA 2IQ9L 4Y88A 5CP7B 2FR4A 3C60B 1DDHA 2DLEA 2AK4E 4PLJC 4CVWA 5CD3A 5ITFB 1B6DA 1CXKA 4M8QA 5CYYA 3SPVB 1MWAB 3NA9L 1C7SA 3BHBB 3IGAB 4APQB 1FNAA 1AQDA 5IVZA 2Y5TB 2F5AH 5T3XL 3A23A 3IJSB 2B20A 4MX7A 5GGRA 2WLZA 1ZS8B 1DQJB 4OCRH 5DSCB 4M9OA 4AYFA 1KBGL 4GW4B 5E03A 1H15A 3MRBA 4UDUB 3BWAB 3HUJA 4TUJB 3QG7L 4A2MA 4HX1A 1PLGL 4YDIH 1MWAH 3RWIA 5JXAL 2AEQH 5E95B 2PKDA 2Z93B 4ORGB 1F3JB 5F89B 1I9EA 4N0FA 1Z9SA 5KZCB 3SY0A 1SYVA 3ROLB 1Q0YH 3ZTJH 5IB1A 1ZT1A 1JGEA 2JLLA 5D7IB 1IL1A 4LASH 4ZPTA 2FJGA 4IRZH 1N2RB 1MFDH 4Y5XC 4JO2H 4QRTA 5E5MB 2GSIB 2GK2A 3GK8H 3VI4E 1XF3A 1FFQA 3B43A 2NX5B 4S1RL 3MLXL 1VFBA 3O81A 2PR4L 1KB5A 1YYMH 4F58H 2DCJA 2R1XB 3IFPA 2X4PB 2DL2A 4QEGA 4HUVA 3D3VA 3EFFA 3D3VD 2GY5A 1G0XA 1KJMA 2UY7A 3DRTA 4H26A 3RVWC 3O6FB 4J2XA 3IKCB 1CFNB 4ZUTB 3BUTA 3PUIA 3WD5L 5C9JA 1UZ6E 4ZOAA 5CSGA 1BFOB 5B22A 1DQLL 1FCCA 3MLYL 3ZL4L 1SJXA 2XTLA 1OP3H 2XHNA 4NN7C 2IFGA 4QB1A 1T3FB 4GXUM 1T21A 3GSXB 3NFNA 5FYJH 3LDBC 3MOAH 5BZDA 1EVUA 1ZT7B 4HWZB 2YUVA 2BCKB 1IAIL 4KQ3H 3O9WA 5DZNA 3O9WD 1TVDA 3BO8A 4LPVA 3ES6B 1NCDH 4KRPD 4FFWC 1MFCL 3ARFC 4PBWD 4XC3H 2CK0H 3RRQA 2HFTA 3MRLA 5F9OH 2BOCB 4P59L 1YMMA 2PTTB 3GIZL 4M6OH 1YMMD 3F7YA 2DQCL 2R23B 4YHKH 3TZVD 5MI0B 4OM1L 1HKFA 2IMNA 4QTHA 3QCUH 3ZYOA 1TZHB 4NN5B 2N7BA 3AAZA 4IM8A 3RWJA 2OZ4A 3SKOB 3O3BB 1OWRM 2FJHA 2IQAB 4QRQB 1R3IH 5IYYA 2DWDB 5DJDA 2ORBH 1OY3B 5F1NB 3HC0B 3LQZB 2VLJD 1KIUA 4NBXB 4Z0BL 3I3DA 5I1DA 2YBRB 3WS6C 5DEZA 1UZ8B 4I8DA 5TGBB 1RPQA 1J86A 4OBSA 3TNMB 2BBAA 4DN4H 2CUIA 3FONB 2Y1VA 1HH9A 1A9EB 3GI8H 3OKLB 1D6VH 2DLIA 3K2UH 25C8L 2QSVA 4PJBA 1DL7L 1UWXH 1UY4A 4I3RL 1ZWIB 4RMQA 2NY0B 2NZ9C 5F96H 3ZE0E 4NQTA 4HT1H 3BKML 3IKKA 1RZKL 3X3GL 3IDJB 2AEPH 5JO5A 1ACZA 1WITA 5I1LB 5H35A 4HBQA 5EIYB 3MUGA 1NDGB 5HTSA 3GNML 2XWBB 1EHLL 2X1WL 4XPHH 1DLFH 2EEDA 4YFLI 1T6VN 1QA9B 4PRHA 5E4EB 5CMAB 2I27N 3FFCB 4JY6B 4PRHD 2HN7A 2VWEC 3OKEA 4OZGB 4G8FB 1I7TB 3GHBL 4Y5VB 1C12B 4F7PB 3LZFL 2E7HA 2NY4C 3I3EA 2XZQL 1QLRB 1SEBA 5EU7E 3ZDYE 4NKIL 5D7LA 5D7LD 3MJ8A 2ATPB 4GRLC 5J56B 4EXKA 5LGHL 5TF1L 1PDKA 1S7UB 3DNKA 4OM0L 4HAGA 2AI0L 2BHYA 2OLDA 1U6AH 3BPCB 1BAFH 3GBLA 3KPPA 5GRVL 3MRIA 4LHUB 4PBVC 1T20A 3OKKB 4X4YA 1DEDA 5KSVB 3TO4B 1H9VA 3QPXH 2DB8A 3WLBB 4RFNB 5K9JH 3TIEB 3OX8A 3WKML 1KLUA 2O5YL 3MCG1 4OLYH 4HG4J 4LAQH 5KG9B 1KTLB 4P08A 1UB5A 3UTPD 3VFMA 2NXZB 4F2MB 5C0BB 4MJIE 4N0YL 3RI5F 4U49A 3T1FB 4MLIA 4EBQH 3RHWF 1J05A 2DYPA 2DYPD 3BPNB 1CGYA 5KSUA 1QP1A 3UO1H 4ZNEE 1LE9B 1SBSL 1BVZA 3RWCB 4ETQA 3GSVA 4K3EL 4PJIB 1OAZL 5KVMC 2HJFA 1RULH 4GRWE 1LMKA 2FX7H 1U8LA 3QZWB 2V17H 4WWKA 4WWKD 5GXBB 4MA7L 5CJQH 4OI8A 1SJEB 1ZSDA 3BZFA 2AJVH 1IAOB 1UWEL 1DLCA 3QA3B 1US3A 5IV2B 4LSSL 1T2JA 2VDQH 1VEOA 4LQFH 3BXNB 1NJ9A 1XGUB 1U9KA 2ZJSH 4WTXA 2MCPL 4BK5A 4MMZC 2Z35B 5I8EB 3C7GA 4RMUA 1K8DB 5CKAA 2BVYA 4PV9A 4KVCH 3MLZH 5BZWB 1ZMYA 5IWLC 4PJDB 4WU7B 1H5BB 1SVCP 3MLPA 4PJCB 1QBAA 5F8RC 1KCUL 5M94B 2UZIL 4U6TA 3O41B 32C2B 4WO4C 1BM3H 3MYJB 2ZUQB 4GG6B 3W0WE 5DHVA 1ZLWH 3OTTA 2XI9A 2VZ1A 2K9UA 2J6EL 3CX5K 3WNLA 1BVLA 4XCNA 4U1SB 4YHMH 1BLNA 5FM5M 5E5UB 5BRZB 3LQAL 4W68A 4JN1H 1TVHA 4YBLB 1CU4L 4JO3L 1T0MA 3Q6GL 3IDXH 3HA0A 4N0CC 1CICB 2Y6KA 2JCCF 3CNKA 5J12C 4U6VH 3RNQA 4EJ1C 4KI5D 4NKQB 4QB6A 5I6XB 1X5YA 2B1AL 1UYWL 5C3LD 3S3PA 3HI5L 1BFVH 4OZHA 5GRVK 5I1AA 4PTTB 4D2NA 3OR7A 2R0ZL 1P4IH 2VH5H 2ZOKA 3ARBA 5J0BA 3ARBD 1FG9C 3B9KB 1RJYA 3D48R 4YBQD 1SM3L 3HG1A 2VITB 4MD5A 4XVJL 3HG1D 2DIAA 4KAQH 3WJJA 1YN7B 1T1ZB 3TN0C 3VCLB 5LGJB 4HW6A 2HWZL 2W5FA 4JFOB 3GMLB 4OMDA 2BMKA 4GAGL 2I25N 2MNUA 2A6DA 3B2UD 3BYTA 3HE6B 1OVZA 2IPKB 2I5YL 3RWGA 4HV8B 2X40A 5KSAA 1BMGA 2BNRA 2BNRD 4Z7VA 3JXAA 2O5XH 1QR1B 4OCRL 3TJHD 1T2QH 1P7KA 3NPSC 3QQ9C 5FGCB 1BZ7B 5E8EA 3FB7B 2DQUL 1DANU 3ECBB 1LEIA 3VWJA 3LEYL 3VWJD 4OFVA 1I3RB 4JZJB 4Q6IB 1UWWA 2ADJA 1W2KT 1JPTH 3VGBA 3HNYM 4PJ7F 5TE7H 4GXUN 1NMAL 4WRLA 1MRDH 1J1PL 3MJ6A 4NQDB 3ZM8A 1MAML 2NW2A 4ENEC 4HIIB 1CR9H 2CUMA 4LPXA 4ODWB 1UM6L 5J9PA 2LABA 2A9NL 4YEEA 4FQXB 4XBGB 4OUEA 2B39A 5KOVC 4O2EB 3WS3B 5DRNB 4LP4A 5F3BB 3D0LA 2F54A 1F2XK 2IBBA 4EUPB 2F54D 4XXCA 5A2KH 2EDYA 4CMMA 2HJLA 4RAVB 1R6VA 3PP3K 1U8QA 3DO7B 1ZT4B 1KCRH 4JZOA 2VZSA 1XC6A 2VLRB 2D31A 2R69H 4I3GA 3GSRA 2E9WA 5IROC 1OTTC 4ZO9A 2AABH 5HY9B 3UYPA 4A41A 3AB0C 3QG6B 4PJXB 3BSZL 3NABL 1AO7A 3EYVA 1AO7D 4EUPH 4PJEA 2JE8A 5C2BL 3GSOB 5F7MC 1ZVYA 1I8KA 4QRPA 4X5WA 1FV1A 1G6RB 4QRPD 5E94B 3VXUB 1PKOA 3B8YA 1JBJA 1MSPA 2WP3T 4I77L 4P4RA 3KJ6H 4I9WD 4MGXA 1PD6A 1S7TB 1MHHB 3QEQB 2CLZA 4YX2H 2P5EA 4IDJL 2P5ED 2QQKA 5FYKE 5ECJE 4Y2DB 2EYTB 2JIXB 3MOAL 5D2LB 1BX2A 1G6RH 1K6QL 4ZQKA 5HHQB 1U36A 1FYTA 2R0KH 1I4FA 1FYTD 1DUZB 3F12B 3DV6A 3QI9B 3QSKB 4XVUD 2IF7A 5DMGD 1P9MC 2X1XR 4QGYA 4WHTA 1MJUH 4HULB 1MI5E 3RNKB 1NCDL 3M1BB 3MA9L 1DBKL 2BSTA 4EI5B 5DA4A 2MMXA 3BGFC 1H3PL 2CK0L 2Q76A 3HMWH 4HPOH 1IC5H 4KGJA 4QWWD 1YNLH 5F9OL 1CLOL 5IQ7L 4EDWL 5H2BA 4M93B 1QRKA 4M7KH 4X8JA 3G04A 1KXTB 1DTUA 1OGTB 2YPKA 2DRUA 2ENSA 4PB0L 3WJLA 3RY5A 2X44D 5GGUA 1KPRB 1HYSD 1WZKA 2ZUTA 3I97A 2ICEA 4FXGB 4JFHE 2OJZH 3P9LB 1IT9H 3MRGB 1P8JA 5FHBH 1KCVL 3CK0L 4HIXL 5HYIA 3FQRA 1D5ZB 4P5TB 1WKYA 1JWUB 5MERA 3C5JA 1R3LB 2GCYB 5EU4B 3OKNB 5IOPB 1A6WH 1BHGA 1MCSA 4CUBA 1EUTA 5DJ2A 2UUDH 2PQSA 3C8KA 4Z0XB 3MUZ1 3E2HB 3KG5A 5F72S 1F90H 2B4CH 3PDOA 4OLUL 3ZSSA 4DN4L 3MGOA 1K42A 1WEJH 4DZBB 3UESA 1NKOA 5FV2A 2XTJE 2A6KA 2NY3B 4LHSA 1J8HE 2Y5EA 3GI8L 4W6XB 5F7LB 2YXFA 4PG9A 1AH1A 3K2UL 3I6LE 1I1FA 2XZCH 4CADA 5DJ6A 2LU4A 4NKMA 3QUYC 4V1DB 3CDCA 4M43L 5JUEL 5CBEA 3MV7A 1M05A 3MV7D 1OT5A 3MRMB 4GUPA 5JNYA 4NQCA 4NQCD 3TBWB 1LO4L 3IFNH 4ZNEA 1OP9A 2WNGA 1PKQE 2F19H 4DGIH 1NUKA 2P48B 1JWMA 3G08B 4LSPL 4U1LA 3WBDA 3ZO0A 1FG2B 3DI2B 3GJEB 1CFVH 3GHEH 4PRDB 4IRJC 2M1KA 5T3XE 2WM0A 2X42A 4ODSL 4P2YA 1A14H 7FABL 2PYEB 5H37H 2J1AA 4ZUWB 3GMOB 5HHOA 2CGRH 5HHOD 2KKQA 4ZXBD 4LCWB 4PGDB 1KJ2B 3L7EB 4DK6A 4IS6B 3QFJA 1MHEB 3QFJD 4XP1H 5CJ5A 2AK1H 1GAFH 2ZUYA 5B8CB 2Z91A 1UB6B 3B9VA 1JTPA 3WSQL 1QFWH 3VRLE 4OUUA 1P6FA 4E8DA 3TP4A 2WO1A 1WCBB 1BAFL 3AY4C 1ZVSA 3VGFA 1Z5LA 1UFUA 4JHWH 4MA1B 4JPVL 2J22A 3EYQC 1KJ2H 5K9JL 3RDTB 3FQNB 4FQPA 4AG4A 2JJUA 5JW4R 3UBXB 1R64A 3BZ4B 3ULUC 4AT6B 4YHYB 3BEWB 5F44A 3VFVB 2BNQE 1GGBH 1YEJL 3ULSB 4U31A 4HH9B 3T0EC 4Z7UE 3HNTH 4G6FD 2QKIB 2KBGA 3EO0B 2A6IB 1DQQB 2EC9T 5CLTA 1YPZA 2YD3A 1XMWA 1LE5B 2NY6D 3GMQA 3VDAA 3G5ZA 3VFNB 4PGBA 5D6DA 2A9ML 3KR3H 2RJ2A 1RULL 3T0XA 5GISH 4X7CC 1WFTA 2W94A 5AD0A 3L3OA 3L3HA 5CJQL 4LDOB 3KPRE 4PJ5E 2CK2A 2OXHA 3QDMA 1FZKA 3QDMD 4ODVH 2ITCA 4YHIA 3WFHA 2ZSWA 3KPOA 1UM5L 2IALB 1FRGH 5LQBH 1FZJB 1FZOB 4L9DA 4POZD 1CLCA 3C60C 1OGAA 3MC0A 1OGAD 1RFDH 4UTBH 2XWJA 3MLZL 4OFIA 4K23H 5E2UH 3TFKC 2QQMA 2J12B 1AGCA 5C0AE 4APQC 3NZ8B 4I2XE 2VQ1B 1KLFA 2EIDA 3UTOA 5C0GB 4Z9KB 1F4XL 1W9WA 4MDIB 2CQVA 1ETZA 2DLFH 2NY1D 5HI5D 4DTGL 5IM7B 3MFGB 1S9VB 1QTYT 1UG9A 1OD3A 4Y1AB 1SJHB 1FAIL 3K8LA 1ITBB 2C7UB 5JXGA 2W60B 3W82A 4JLRB 4MAUH 5DRXB 1JU4A 3QUZC 3BKYL 3REVB 3QBTB 5IVXF 1HQRA 4PJ9C 3MRNB 4NKOA 2VZQA 2R1YA 1HHKB 1CF8L 1M7IB 3KPNB 4QHMB 1CZVA 2PO6B 2OR9L 2X4OB 3QDJB 1UY2A 5E7FA 3IXTA 3JXSA 1JGVL 2YZ8A 3BE1L 2OSLA 4GKZB 4JFFE 1YEFH 2YKLH 3GMPB 3SGEH 2E7LA 2VZ3A 2H9GB 3AM8C 5G05L 3RGVA 4F3FA 3RGVD 4JX0A 3ZHDA 4K3JL 4NQVB 1X5IA 4OF7A 5C7XL 3LEKA 3S36L 5E9DB 1P2CA 5I1EH 5ICXA 1LILA 1QYGH 3MRDB 4BFIA 4XMLL 2Y36L 3VGDA 4KPHH 1T6WA 4LSTL 2VNCA 5HYEA 1JV5A 3SE9H 3DLQR 3SBWC 5IW6B 4HC1A 3V7AE 3SE4A 1DEEB 1WC7A 1YEDA 2YB7A 3DIFB 4ODXB 1B0GB 5JW5A 3X11A 1C08B 2I60H 4QTIH 3QHFH 4L0PA 4XMKL 1NAMB 3QFDA 2YD7A 4UNTA 4RN5A 3SN6N 2CR3A 4MCZB 2FBJL 3O6FC 4TOYL 3RU8L 3TA3A 3TA3D 2M2DA 2O5XL 3CVIH 2ZP0T 5EOCH 2HVJB 3KS0J 4KWUA 4PJGF 3GO1H 1QSFB 3LN4A 4GZ9A 1V3KA 1K12A 4WFGE 5MEPB 3O4LA 2L9LA 3T3ME 3O4LD 2GKIA 4H0GA 3VFTA 5BW7C 4WNQA 1QFUH 2QJDA 1BOYA 4LCIH 1JPTL 5SX5H 3ARRA 1BZ9A 3OGCA 3FO2A 1PMJX 2V2TB 2FWOB 1UXXX 3W39A 3QQNA 4XCYB 4M1DL 4NWUH 2X4SB 2B1HL 1EHNA 1JK8B 4Y4HA 5DS8A 4Y4HD 1JHLL 4D9QE 5D70H 2OBGA 2BDNH 1T66D 5EULV 1EGJA 2VLLB 3OJVC 4YFLF 3IYLW 5GHWL 2EDQA 1SY6A 12E8H 4EEEA 2IH1B 4OKVB 2RQ8A 1EFQA 1NEUA 3OAZH 3IU3B 1B6UA 2YN5A 5MI0C 2GJZA 3A6BH 1JE6A 5E8PB 3ZT5A 1WT5C 4XCCH 4GH7B 3KWWA 4J12A 3C6SA 4PJHE 2J1RA 5GJSL 1NH6A 2R69L 2YSSB 5E00B 1IGCL 4NM4H 3P11H 3I2CH 2BX5A 5EDXA 1QSEE 1YYLH 2AABL 4Y19D 3HMXH 2OMNA 4JEGB 1I7UA 4YDVA 5FA4B 3ROOA 4RMWA 5KVEL 5D8JL 5DT1H 3PWUB 5T3ZL 3A7QA 5KSBA 1WBYA 2H6PA 4JZNB 3T0AA 3CZUA 3CVHB 1OF4A 4NSKA 3JTSA 3QH3A 4BSVA 1TCRA 4X6EA 1U8MB 5T1KA 5T1KD 3K4AA 3BEVB 4YX2L 4Y8AA 5DVKA 4X4ZA 1A64A 3WHXA 5ALBL 2RGSA 3A67H 3FAWA 1MNUH 3U2SA 2HYXA 2NY0C 2ICWI 3GKZA 4ZSOB 1CD1B 3CVHH 2YEZA 2XTJD 1ITCA 1J8HA 1ZHBA 2WAAA 3BN6A 2ZUVA 4N5ED 1I3VA 4WUUE 5FYLL 3ZZ1A 4OT1L 5HPOA 1FNFA 3MLUH 3GSNL 3ZKSD 4UU9A 4KMQA 5E4EC 1FIGH 1JYXA 1NAEA 4MJ5B 3KXFA 2CO6B 3KXFD 3V6OC 3KVQA 5I16A 2W1SA 3HMWL 4Y4KB 1WBXB 1YNLL 3RL2B 4Y5VC 3AU1B 1PQZA 4AM0B 1A5FL 4P2RE 3M17B 1CDJA 5DK2A 4PP2A 5J11B 1P53A 4U1MB 3X12B 4K2UL 3VI4F 5K93A 1OP5K 4NO0B 1ORSA 1UEYA 1JPGA 4NO3B 5CGTA 1INEH 1XF5A 5J7CC 3KNBA 3P0VH 4M61A 4F7MA 4LKXA 1NC4D 2CLVA 5FV1L 3G6JE 1W0VA 4Q97A 4E5XA 3TO4C 3CZJA 2HH0H 3TGXA 4KU1A 4RFNC 1IGML 5DO2C 5DC0A 2VQTA 4JKPH 1AC6A 3HI1A 3MRCB 2BVQA 4NOBA 2VXTL 1U8KA 4P46A 2YPLA 4P46D 2YPLD 2EDNA 2NXZC 2B4CL 4LSRH 1UZ6F 5CWSA 3V52H 4OSUL 4UT9H 1NAKH 2DI9A 4PUBH 5EO0A 4Q9CA 1VFAB 2VDNH 1P84J 3LKNB 5JW3H 2ICWA 3DUUA 3BPNC 4Z78B 2BXYA 2QL1A 5HYFA 1AC0A 1DFBL 4KMTH 4L29A 1MAJA 3RUGE 1N59A 1QFPA 4GXVH 3NFSH 1ZV5A 1XF4A 3S88L 5F7DA 3BP6B 2GJ6B 3MXWH 1J7VR 1LO5A 2FX8H 2ZNXA 4J4PA 4J4PD 1EXUA 3V6FB 1NBZA 2GTWB 1MCOL 4G8GE 4QNPE 5F9AC 1FNSH 2ENYA 1YMHB 3MV9A 3MV9D 4HXBH 4LSQH 4CVXB 1A7OH 3CDFA 3FHAA 1A14L 3QNZA 1AY1L 1S9YB 3ZTNL 3SGKC 1CG9B 3SGDI 2YD1A 3DSNA 1H5BC 2LAGB 1KYOK 2ED9A 3QAZC 4PS4H 1KUMA 2C4FU 3UZVB 2V4VA 1ORQA 3ZKMC 3GM0A 4Y7MA 5JORB 4ZAKB 2R29H 3TH4T 4HD9A 3PNWB 1OSZA 4GAFB 4HKBA 3WN5A 5C0AA 1LDSA 5BS0E 3KPLA 3HPJA 2PYFB 3WFEH 4I2XA 1MY7A 3BT2L 5SWQA 3ZDZF 2C9AA 3BQUA 1MCWW 1GGBL 3BQUD 3TJEL 4X6DA 5EBWA 2PETA 3GMNA 3HNTL 4G7VH 5T33L 4S0SD 3T2NL 3WFBH 3NIFE 4QHNA 4YHZH 2JJVA 5MENB 5ISZB 5HHNA 1GC1L 1WWAX 4JFDA 4JFDD 4CU6A 4JQXA 3ZE0F 4PP1D 4S0TD 5C9KA 4RIRA 1A2YA 3NN8B 4FQIL 4C83B 4G42A 5I6XC 3H42H 5GISL 2W65A 4LOUD 4FQCH 3N50A 3EYFA 2VXQL 4M7ZC 1H8SA 4JFFA 2V9RA 3FRPG 2WUBH 2UV3A 4O2FB 4X9GA 2HRPH 5EORL 5BMFL 1FFNA 3FT4B 1ZKAA 5I1HH 2A73B 1M7XA 1PJ9A 2WZPD 1OLZA 1NBYA 3LB6D 3UJTH 2Y7QB 2NY2D 3ZDYF 4K23L 4TNWK 1BWMA 3P4OB 3HE6C 3I02A 4NFBA 4OD2A 4PYHA 1VACB 5C6TH 4K55A 1RZ7H 3NAAL 5DJAA 1CBVH 3AC0A 4ACPA 4P5MB 4Q9RL 4JPWH 1CT8B 2DLFL 1I75A 3GKWH 3KPMA 4JG1L 3GBNH 4LLQA 2O93L 3VFSB 1BD2E 1MRCH 4HKJB 1B4JL 1XH3B 3OJDB 4LF3A 4XNQA 4JZJC 3RZWA 4Q6IC 4LCUB 3GSQB 1A6UL 2JF1A 4O5LH 4L3AA 1E4XH 4OLVL 1CN4A 2WUCL 3TNNA 3OKMA 1A7QL 4U6HB 5JOPE 5L0QB 3BJ91 4RBPH 3AREC 4DZ8B 1V05A 3IFOB 3RWHA 1E0OB 1NCNA 1OW0C 2HT4C 5JLZA 2B0SL 1YEFL 4FQXC 1LP9A 2Q86B 2GTZB 3ULVD 1AP2B 1N4XL 4GRWF 1U93A 5IMMA 5DFVD 3MGTB 2YFZA 1QYGL 2QR0A 1MH5A 1QLFB 5CEXB 2IBZY 5DTFA 3RZCA 3SDXE 3RZCD 3BKJH 2MHAA 5AZEH 4R3SA 4YIQB 4L8DB 4GWIA 3B5GA 1GYAA 4R7DB 4K3DH 2DKMA 1NGWB 1MVUB 3LEXA 4LRNH 3DECA 4IMLB 1A6VH 1WICA 3PL6B 5EPMB 2ARJB 1NEZG 4P23B 5SV4A 4P9ML 3ARGB 4HGWA 4CN4A 1LK3H 2O5ZL 1Q38A 4Q74A 4WUKH 4MOAA 1AR1D 2OTPA 4L8CB 1T1XB 2ZUUA 1HCFX 3AVEA 2IANA 4YDLB 2IAND 3FHQA 5LGKA 1E4JA 4XNZB 2PNDA 2K7PA 5DZOA 2VDRH 5D6CA 2GYSA 3EW3B 3N1PC 3VFRB 5DURD 5F3HB 5LJYH 4Y2DC 1NAML 3O8XC 3B6SB 5F7KC 2H3NB 1FBIL 1Z3GH 1E6OH 3Q5OA 5JDJA 5JQHC 5IUSA 6FABH 5DDHA 2X4RA 2FJFB 3HAEG 1CLZL 3B5TA 1NUFA 1RZGB 3EJYC 3UZQA 3OHXA 2P8MA 1OAXL 3GBMH 1LO2H 4EI5C 3JWDH 2KDGA 4I18A 4DXSA 1TZIB 2GW5A 1U2CA 2FD6H 5FUZH 1J1XL 1J0YA 5HVHB 4WUUA 2UYLB 1P7QA 4HJGA 4YC2B 3F58L 1P7QD 4V2BA 5IB5A 4WTZA 2IPTH 2V6HA 4M93C 3CFKA 5CAYB 3QDGE 3U0TB 3TBVA 1L6ZA 2ZCHH 1UXSA 4RMTA 4HBCL 4NQXA 5HVWA 3SQOL 2EKSB 2AXHA 4U1HB 4GLRI 2NR6C 4LSUL 4XNMB 3FOMA 3AUVA 2B4CC 2ZSVB 3F7RA 4NPYA 5BO1H 3P11L 1UY1A 1Q9OA 1YYLL 1FO0B 4P5TC 2VL5B 3I75B 2VKXA 4U1JA 4X80H 3FQXB 3VH8B 5I2IA 5I18L 3E2HC 3I85A 2VXVL 5EA0L 3OMZA 3ETBF 4EQ2A 1JNNH 3MJ9H 1FO0H 2NY3C 3HPLB 1H3WM 4X6CA 1Z0NA 4CU8A 1D3CA 1Z0MA 5C08A 3M07A 3SE8H 1SHMA 1D5BB 5C08D 1IZKA 2P47B 5IMLA 3V8CA 3PV7A 1K4DA 3C5ZB 4JDVB 2BSSA 3ET9F 5FKPB 3FQWB 43C9A 1RZJH 3FQTB 5E2TH 15C8L 4IMKC 4OGAD 3GJFA 5ANME 2AJZB 2ZPKH 3VGHA 4BK4A 1QEWB 5DD5H 5HPMA 5J3HD 5IEHB 2BNUA 1FIGL 2FX9L 4PG2C 3CZFB 3CKHA 1MQ8A 1W8OA 3VD5A 3QNYA 3FOLB 4QY8B 1Y18B 2XWTB 4HUXA 2FIKA 1FC2D 1RIHL 4LSVL 2IC2A 3FFDA 4LLWA 1S7RA 4GBXA 4GBXD 4HK3J 3IIIA 2EC9U 3WNPA 5CEYB 4PRIB 4CW1A 5LBSL 4PJDE 3VFUB 4WW2A 5B8CC 1JF1A 5CIPB 2H41A 1RK0B 2EIZB 3RWFA 1FL5B 5C0RL 3H2WA 4HPYL 3LRSB 4LSDA 4P3WA 1WIPA 2VR4A 3NQHA 4FP8H 4MA1C 4WI6A 2VB5A 3NCYP 1TVGA 4NP4L 5EO9B 5ITBL 1AE6H 3RDTC 4JKPL 5C07B 5FA3B 1RIVH 3RGHA 3MODH 3B8SA 3IJYB 5CIPH 3VRIA 4YHYC 2WW8A 4JJ5B 3S35X 1U0QA 3G5VA 4MYWB 5EBMB 5DJZB 5FYJU 4LSRL 4PY7A 1DBJL 3AXLB 4BH7B 3IF1B 3PABB 4KUCF 1IC4H 4PLNC 3PWPB 4NO5B 3OXRA 1C8PA 2XA3A 3F7VB 1G7MB 2YRZA 3V5DB 1J12A 3OAZK 3VXPB 5C0FA 1IAKA 4ET7A 2QHLA 2ICCA 2ERJB 3OEBA 2EDOA 1FGNH 3U4EA 2QQLH 2GAZA 3E8UH 1F6AA 3IDAA 3EFDL 4NJ9L 1U3HA 4OLEA 1U3HD 3QJHB 2JCCB 3FT3A 1F11A 2D4DA 3MFFB 4ZS7L 3V5KA 3GUTA 2B2XL 5I66B 4DEPB 3FMGL 4ODBD 1KXVC 1KPVB 3WXVL 1GIGL 4O51A 3X14A 4B53A 3EYUH 4LSQL 1I1AB 1A7OL 5D93B 4ZFOA 1YNKL 4LVOC 2E27H 4M62L 1T1WA 4K8RD 3S35H 3HLAB 4LLYA 3S9DB 2WQRA 3D25A 4X98A 1KEML 3ACGA 4AEFA 5T1MA 35C8L 4MMXC 5EC1B 4E41A 4E41D 2Y07L 3QEGL 2CKNA 3C6LB 2X4UA 3TT3H 2FDBP 1L7RA 1IEAA 4HWBL 3V4VH 2RAMA 5K9QI 4HSQA 3HEIA 4AMKL 1L0YA 2VC2H 4JFYA 4HXAH 3HZVA 5DMKA 1U92B 4ONGH 3TBTB 4GT7A 4R4FL 1XF2A 4FQ2L 4BZ1H 4GKSB 4W50A 2EDEA 3EIFA 2H32A 1CGUA 5AZ2H 4RRPA 1N0XL 5D2NA 4F80A 1Q94B 5ACZA 4H20H 3NFPB 3EO1A 3O6LH 1BD2A 1BD2D 4G7VL 1W0NA 1KNOB 4JE4B 1B0RA 2PO6C 5BXFA 1MLBA 3FTGB 3QO1A 5AUMA 4LLVA 2VLME 4HQQL 4Y16A 1W0WB 4Y16D 1NGQH 2BOBA 4PJ7B 3IB4A 1AJ7L 1R5VB 4RFEB 3U0PA 3H42L 2FATL 3OZ9L 1CDGA 2H2PD 1FN4A 2CIKB 5BOZG 4PPTA 2G5BA 4OJFH 2ATKA 4OTXH 5T3ZE 2W46A 5HHVL 3PWVA 2BXZA 5TF0A 3HZMA 3VW3H 4Z7NF 2G2RA 3BP5B 2VLRE 1O7SA 1QNZH 4KKBD 4P3DB 5I1HL 5E1AB 1XGTB 5EFIB 4ZTOL 3U36B 3UJTL 1AGFA 2VDPL 4MCYB 4HIEA 3HOBA 5I1GH 2I07B 4OCYL 5IHUH 1N5AB 5E8OB 2HLAA 3MREB 3VRLF 2YK1L 5D7JA 4OLXL 5D7JD 5KN5B 1JWSB 4LLDB 5E24E 1JI1A 4HS3B 4EVNB 2V5TA 3QEQE 4LIQH 2WWKT 5FYLE 5I74B 3HZKA 1HCVA 4R0LB 3RX5A 3ILQD 1ZK9A 4HCRA 3O11B 1NC2A 1L6XA 4L3EE 1H3UA 1U3ZA 2VMFA 5ABDE 1CE6B 4N90E 4XNYH 4QT5A 2JJTA 4EI6B 1AHWB 4Z7UF 5D1ZB 3IU4L 1L7TL 2VISB 1JN6B 2QQNL 1IARB 4NJAH 3CFBB 3CFDB 4MNHA 1J0IA 1M71B 4TN9A 5HJ3B 5ADOL 1NL0H 4OCXH 3QIWA 1ACYL 3QIWD 1G7JA 2V5RA 2C1PB 3O3UN 4K7PX 1MFBL 3BIAX 4DUWA 2XOMA 1S7QA 4BQ9A 3C87A 2A1WH 2VLKA 2VLKD 4C4KT 2CUHA 5GRJL 3TWCL 5FCSH 4TQEH 4ZUSA 5ESVA 4X6FB 1EFXA 1EFXD 5JPNB 1JFQH 1T83A 4JM2A 5C09E 4JM2D 2W0FB 4J3SA 2OR7A 4JY5H 5EOQH 4XZUG 1CZSA 3QRGL 3PP4H 3QDGA 4QHLA 2BC4A 3MV8B 3QDGD 1YEEH 2ZZUT 5DVOA 4GAYA 4LRNL 4XI5C 4TNVF 1A6VL 2P44B 5I15H 2VOTA 1I7ZA 4H88L 2D03H 2HTLC 2FR4B 1DDHB 4LLAA 4ERSL 5IG7A 1JYVA 1BOGA 5TE6L 1IGFL 3UTZA 3I3BA 1LK3L 1MEXH 4M8QB 3RWDA 4Z8FH 3VE0A 4U6XB 4XWOC 5GS0H 4MQ7A 4XAKD 2NXYD 1TJGL 3CU1A 4DXRA 1HH6B 1Q1JH 5JZ7D 3IDMB 3D9AH 1A22B 4K7PH 1EBAA 1JTTA 1U3YA 3VXOA 2ADFL 1P4LB 2DJSA 1RK1A 1MFNA 1MVFA 3EZJB 1GGIL 2D7OA 3F8UB 4HX1B 4V1DE 5DC4B 3MLSH 5EOCJ 3G9AB 2IGFL 4HFWA 5SWSA 6FABL 3HTLX 1KG0A 5SWSD 4ZMAT 2FHBA 4ODUA 3QIBA 4N0FB 4WW1B 3QIBD 2FZ3B 1VCAA 1C1EL 1A6AA 1OTSC 5TH2A 1HI6A 4HKXA 5IB1B 4GAJL 1ZT1B 1JGEB 5CEZH 2EZ0C 2DQTH 1IL1B 3K1DA 1EZVY 4BYHA 5LKNA 4XC1H 1LEKB 2MQCA 4Y4KC 1GPOH 4ZPTB 5ANMA 4U2YA 2OK0H 2PYEE 2CRYA 2MTPA 5D1QB 1J9CT 5J11C 4R26H 3RAJH 2Z8WC 1IGYA 4AEIH 4EN3B 1A4KB 1A7NH 1XF3B 1KIQA 1T7WA 2AERT 1HHHB 5F7YC 1EO8H 1VFBB 2F5BL 3MV11 5EOTA 1PMHX 5ESQB 2CDPA 5I8KH 5C2UB 5JR2A 4LHJB 3K1KC 3NRUA 2R56H 1OF2A 5ID1B 3IFPB 3TVMC 5GRZA 3K77A 4HUVB 4RBPK 1KJMB 2ESVA 1YY9D 2ESVD 3DRTB 4H26B 3K0WA 4HUWA 3Q6FB 4YR6B 4YFEA 2DLTA 3MACH 3S7GA 1MCEA 3DRQB 5B38A 3UTTB 4R9HA 3BN3B 1UKSA 1GGCL 2G5RA 3ZKQD 2PW2A 2YA1A 2IH3B 4AQOA 3T3MF 2D7TL 3T0BA 1T21B 3TIDB 1E27A 3NFNB 3KLHD 5BZDB 2UY6A 1CTOA 1OLLA 1SYSA 1INDL 3U9PL 2VE6B 3BGAA 1TJIH 1LP9F 1LD9A 5TPWL 3U9UA 2EICA 3O9WB 3WE6B 3SOBL 3WUZA 3ULVF 2GSGB 2CLRA 2LFGA 3BO8B 4FN0A 3Q5YA 5GGSA 1QRNA 2V72A 1QRND 5IBLD 2IG2H 5GZNC 4X9BA 5B39G 4WGVB 4XNXH 3QNXA 1IGTB 2DS4A 5CSZA 3V7AG 3MRLB 4YXHH 1YMMB 2AJ3A 3WNNA 3DTXA 4X6BA 2O26U 4QRUA 3V0WH 1AXTL 1S3KH 1PX3A 2QSCH 5FECA 3VG0L 2Y4SA 4PJHF 2DBJA 2WSKA 2N7AA 3AAZB 4Z7OE 4P48A 1M7DA 4LNRA 4ZAKC 2R0LH 4XP6H 1EHXA 2ADIA 2P5WA 2P5WD 2P4AB 2X10A 1T5XA 2C4XA 2UZYB 4WVRA 4QXUL 1RIVL 2EDWA 1JNHB 3UTQB 5JMOA 5I1DB 4XVTL 3X13B 1FVCA 1G7HA 2XG5A 5CJOL 4WFHD 1DYOA 5LG1A 3D1MC 3GRWA 3RP1A 3OL2A 3TBYA 2ARWA 3MNWA 4N8VA 1HH9B 3N85H 4B7IA 2F8XC 1CFQA 1XZ0A 1J8KA 3MUJA 4CU9A 4ZS6C 3QDJE 4OD1L 5FAAA 1G9NH 5IFAH 2IAMB 1XNTA 1YY8B 4D0QA 2VDLL 1MCCA 3NCEB 2W38A 5JO5B 3BKCH 2HA1A 3KPQA 1HILA 2IPUK 4KZDL 2EXWD 1NFDA 2P49B 5E9DE 1QLEL 5KS9A 2DBLH 3GB7A 3CFEA 3RWEB 2YXMA 3IFLL 5DWUL 4PLJD 5TFSL 2OQJA 3S4SA 1DCLA 4HF5H 1WJ3A 4JHAL 1ULOA 1INQA 3MBEB 1RV6X 2HN7B 1AKJA 2E27L 1AKJD 3WUWG 5JHLL 3QT2A 3WXWH 2QQQA 2CXKA 3LKOA 1MCHA 1Q72H 3PE9A 5CFHA 1SEBB 3AS2A 4P2QB 4MAYB 3V0VA 5F1OB 1K4CA 3MJ8B 2HG5A 3SHSA 4FMFA 1G9ML 4M1CC 5E8NB 1HSBA 3SDDA 3G6JF 1NFIA 4TTGA 1OAUH 1FDLH 2O61A 1HINH 2WINB 4M5YL 1T20B 4MNQB 2ZUXA 4BZ1L 4KDTC 3V8OA 1L7IH 5TQ2L 1CGSL 1D5XA 2W9EH 5KAQF 3FCTB 3OX8B 1KLUB 4KRNA 4X6CF 2GUOB 1DN0A 1KFAH 2DTML 3TCLB 5EU3A 1R24A 3VFMB 4PJGB 1QBMH 3DWTA 4Y5XA 5L0QC 1FORL 1FFPB 4L3EA 4L3ED 1T03H 1HHIA 3CUPA 4PJFE 2ZCKL 1B90A 5DMIL 3VMOA 4ZFGH 1TMCB 2EDHA 3RUGF 2LW8A 1OB1A 4WEBH 5LWYL 4YAQB 2F58L 2KL6A 3UTSB 3VD9A 4JG0L 3QP3A 1KOAA 4OJFL 1T1YA 1CDHA 4MLSA 4GMTH 1NCCH 3CC5A 1U8LB 5BCAA 3CXDH 4KKAC 4ELME 5IW1A 1T7ZA 1ZSDB 4UNVA 3DX8B 4ZYKB 3DV4B 1O8PA 4KY1H 5HSFA 4JFEA 5T5NF 3QQ3A 1GZPA 4JFED 4NZDA 3DPBA 3RVWD 3I9GH 5A3IC 2QADB 1QKZH 3PL6C 4JFPA 4P23C 5HYSA 5BVPL 5IHUL 2IEPA 3QO0B 1G7IA 4NHUA 1N5YL 2JD9A 4JPIA 2J8UA 4PD4J 5C0CA 2F53B 1LVEA 5C0CD 2M8XA 3FO9B 3DARA 4NNYB 4YDLC 4R8WH 4CRPA 4XNZC 2AV7A 2JK5B 5EZJA 3C7FA 4N0UA 1CIDA 4Q0XH 4LRIA 3JWDC 2W91A 5A43C 4AJ0A 1OPGL 3MBWA 3SDCB 4FFWD 5E0QA 3ARFA 3ARFD 4UQ3A 3BZEB 3SKUD 4XCNB 3DGGA 4RQQA 3V7MA 1BLNB 4LMQE 3E3QE 5DJ0A 3LS5L 3IXAB 2Y9RT 3MTRA 3UROR 3FB6A 5DGRA 3QYCA 3NIFF 4D9RE 5L2KA 4LL9A 5L2KD 3PGDA 1FL3B 4P9HH 3L7FA 4TTDC 2VN4A 4G8IB 5FM8A 5DF0A 4ZPVA 2XQYK 2XXCB 3RNQB 5HVHC 2FO4B 1OTUC 2CJUL 2CDGA 4FXLA 4YC2C 2FECL 4D3CL 2FYYA 3THMH 2Z8SA 4OZHB 1KELL 4WGWB 2XFXA 3NCJL 3OR7B 1ZGLM 3EHBD 5K9OB 4XGZA 3HC4H 5ADPH 4WI5A 1KPUA 4XP9L 1GL4B 4RFOL 1QHOA 1JHKH 4UZGA 1T0NB 2XA8L 4G6JL 3HG1B 4MD5B 2E7BA 3WS6A 1KJVA 1QFOA 4PRBA 2NYYC 5GGTA 5I15L 5GRUH 2DDQH 2V2WA 4ONHA 2E31A 5C0DA 1U8PB 2BMKB 4D0DA 2W95A 3U7AA 5EZLB 5DMJB 5A2JH 2NZ9D 5GS0L 4Z8FL 5KSAB 1X6LA 3HPNA 1RZJC 5F9JB 2J88L 4JKMA 2RFXA 1BF8A 1S5IH 3PF2A 1Q9WA 1P7KB 5J8OA 1DBMH 3L5IA 5EWIH 1M1SA 1LEIB 4OQTA 1AGBA 4J8RB 1I8MA 1A1OB 1A3RL 1UXWA 3C5ZC 4RX4A 4B5EA 2BHUA 4M6NH 1TJHH 4RX4D 4Y8DC 5ACMA 1FNGA 3O45A 3WV0A 2UWEA 5IMOA 5JW4M 3OGOE 5D7KE 2NY4D 3O2WL 3QULA 2IJ0C 2ZG1A 4C56A 2NW2B 4C56D 2DL9A 2AGJL 3P0YH 3F6LA 4KH2A 3H9SA 3H9SD 4FQLH 4OCWH 4GG8B 1FJ1A 2P24A 3JWOL 3HS0A 4D8PA 3D0LB 2RBLA 3DXAA 2F54B 3DXAD 4NNXA 4AEIL 4WU5A 3SDXF 1A7NL 3FRUB 2HJLB 3L3KA 3TCXA 1CXLA 1U8QB 4JZOB 5DYOB 1LK2A 2D31B 3GSRB 4TVSa 4PB9H 1P6AB 4X4ME 3RPIA 1VFOA 4UT6H 1GGTA 5HDQL 3G6AA 1QO3A 2DQDL 1A7PH 3EOAA 2BGOA 4RWYH 1AO7B 5HDLA 3CFJA 1SEQL 3QXUA 1I8KB 4QRPB 1FV1B 3SEEA 1F3RB 1FGVH 3QCVH 5DJYA 1B4RA 4AEHH 3QUMA 1AXIB 4Q2ZA 4Z76B 2D3VA 1KB5L 4R2GB 3D18A 4FQJH 1JRHI 2HTKC 5MENE 1H6YA 3SKVA 1Y6MR 5I73B 3I2KA 2ERJC 4FFZH 4WCYH 3HCVA 1RY7B 4J1UA 5AYUH 4NQED 4LARH 1BX2B 1EAPA 5E99H 3EYSL 4KC3B 1HXYA 4RMRA 4U1IA 1AI1H 1F6LL 2G60H 5IT2L 2Z4QA 2VL4A 3F65A 1MCFA 3FO1B 4WHTB 4DEPC 2X4QB 4JHBA 2R39A 2QQKH 4G5ZH 5HHPB 2BSTB 3DMMB 4XP5L 3MJ7A 1GUIA 3GMMB 2Y6LA 5K9QG 3TT1H 5K9KB 1I1AC 5D93C 5L6YL 4CKVX 3MRRA 4WO4A 4WO4D 5FDYA 5H2BB 4JGUA 2W92A 5DMYA 4OAWB 5KTEH 5LXGH 3QHZL 3C6LC 5GGUB 5EG6C 4FNLH 3STZA 2ICEB 3OPZH 4IOSD 1XCQA 2CMRH 5JQ6L 3RBGA 3QRFM 5JR1L 2BY1A 4PRPD 3L3IB 3FQRB 4F9LC 4YHLH 5MERB 3LKQA 3WO4B 1U8JA 4RMSA 1NGYA 2XICA 1ADQA 4G6MH 4N0CD 3CH1A 4G9DB 5HGDA 4UV7H 1V7NL 1NMBL 1I8IA 4H1LG 5HYJA 2OZ4L 4Q9QH 1FE8H 3QEHA 5HYJD 3UC0L 1K45A 3MGOB 4YNYA 3ZT7A 5I8OL 1NEZB 3NACH 2P8LA 2A6KB 2NLJA 2QV2A 1CQKA 1OAQH 5DJCA 1I1FB 1G9NL 1WFUA 2XRAL 4WJ5B 2VERN 3NTCH 4MJIB 2E7CA 1QVOB 2GY7B 3LS4H 4JRYA 4JRYD 4NKMB 3NCMA 1WBZB 4LMQI 4D94A 3WQBA 5CBEB 3MV7B 4OIBA 4Q9BA 1M05B 4WI4A 5JNYB 1NBQA 2ZCLH 3L9RA 4NQCB 3H0TA 4LHQB 1P1ZA 2JB6B 3TN0A 3TN0D 4AIOA 5EUOE 5IQ9B 1LGVA 2DJUA 4HFUH 1F3DH 3S5LA 3GGLA 2WIIB 2NNAA 4DN3L 2KZ1B 2J1KA 3CPLA 3DOSA 2MPAH 4HF5L 4JM4L 5EBLB 4GRWB 4AIZA 4CN6A 2C1OA 4G9FE 4PREB 1I7RA 4LEOA 1BBJA 1BQLH 3VJ6B 2HAZA 5GGQH 4JFZH 4L8SA 2WBJA 3OKDA 3D39E 3PIQA 3F2ZA 4JKKA 4FRWA 3QQ9D 3RQ3A 1BBDL 1YA5A 4XVSH 3V6ZA 4JANA 1D6EA 2Z91B 3B5HA 1DQTA 3OAYH 4UIMB 3GSUA 4G3YH 3DBXA 4DKDC 5CD5C 4GRWH 1WUNT 1BECA 3ETPA 2JB5L 3VXME 4NRYB 2VAAA 2YWYA 2X4TA 5I74C 2VCAA 5D1XC 1G0YR 4RA3A 3NJXA 1K5NA 1NDMA 1NGXB 4XCEB 4W4OC 2W9EL 5EB9A 4F7EB 3W2DH 1OCWL 3TLRA 1CFBA 4ENED 4IIQA 1AXSB 5IFJA 1AHWC 1EK3A 3W0WB 4N1CA 1QBML 1WAAE 1ERNA 4P57B 5D1ZC 5MHSE 4IDLA 2EE3A 1VHPA 2IFFL 1T03L 4RGMB 3D85A 4UINH 1B9ZA 3D85D 4ZFGL 4XHQA 4C55A 2NY6B 4AG4H 3MOBL 4BQCA 3BMWA 1ZA3B 4D9RD 3HRPA 5IROA 1OTTD 4MB4A 1D7PM 1UCBL 2V5DA 1RAMA 1BIHA 3CXDL 5AD0B 5ICZB 2RCSL 1WZMA 3L3HB 4D0CA 1FZKB 5GS0C 5IR1B 2Q6WB 3SGJC 1IBGH 1QKZL 5HGAA 1YJDH 4IOIA 2ITDA 2DQGL 1A7BA 1EJOL 4KUZH 2FSEA 2OM5A 3V9FA 4DW2H 2A77L 1TFHA 2XWJB 1VA9A 3K8MA 2Z4FA 1J1OL 5DQ9A 4TUOB 5I8CB 3BWUC 3C08H 4OF8A 1NCBH 1R5WA 3R0NA 1IM3A 1HQ4B 2VCBA 3I2GA 1P9MA 1ETZB 4NC2B 1ZLVH 2ARJQ 4BH8A 4F57L 3BH8A 4ONOA 3N1MC 3DHMA 3KJ4B 4P5KB 2VJXA 1BQHA 1A3LH 1XGRA 1XGYH 5D7SL 1HQRB 4OZ4A 4MD4B 1ZTXL 4NKOB 1XIWA 1RIUH 1XIWD 3IXTB 4ODHH 5KS9F 5GSVB 3OB0H 4ZD3H 1I85C 2B9VA 2BVOA 3RGVB 4HWNA 2B8OT 1T7XA 5E8DH 3VMPA 5D1QC 1IZJA 1P2CB 2VXUH 4HWBA 3HC4L 5FCUL 4EN3C 1VKXB 4YHNA 1CGVA 4HJJH 4I4WA 1CE1H 1G84A 1JV5B 1CL7H 4YHOH 1AGDA 1WC7B 1YEDB 1Q0XH 3EOTH 3W9EA 3STLB 1LDPL 5BVJB 5JW5B 3X11B 1KT2B 4YE4H 1MF2L 4X0KB 4QHUB 2K1MA 2D7QA 2AXJA 5HBBA 4JQIH 1YQVH 2VSCA 5SWZE 3PGCA 3QUYA 3TA3B 4MD0A 3QUYD 2Y64A 3U4BL 1MFEL 2OL3A 2QQJA 3U6RA 2FIRT 1DBML 4WV1B 1R3HA 1A8JH 2HFEB 3MLRH 3D2UA 3D2UD 1UJ3A 4WNQB 4JRXA 4JRXD 1S7WA 5DN2A 1BZ9B 2HT2C 4IRJA 3L3DA 4IRJD 2AXFA 2D0HA 3AGVA 1NUGA 3BYYA 4X99A 3O9WC 3BP7A 3LEVH 5I1KL 1A1MB 3HR5B 4TULL 3C9NA 5F1IA 3NZHH 2YZ1A 3N1GC 4JVPA 5CHNA 3B3IA 4MWFA 4G8EB 4OCWL 1MI5B 4DKEL 3AY4A 2EDXA 1UWGH 3UYRL 5JPMA 1R3KB 1GMMA 4L4VE 4ODTL 4CUAA 1IKFL 3EYQD 4UTAL 1TZGL 3P0GB 3MZGB 5DC9B 4TVPD 3E6FA 1F4WL 3ULUD 5HDBE 5E08H 1SY6H 3NGBC 4QXWA 2J1UA 5FK9A 3MUY1 2J8UF 3VXTB 3ZHKA 3T0EA 3T0ED 1A7PL 4YDJA 4XH2A 3T3PE 4F9PC 3ROOB 3QCTH 4OUOA 3BGMA 1G9NC 2L7JA 4A6YB 5KSBB 2QTEA 2DIJA 1WBYB 2H6PB 3BDXA 3JTSB 3LN5B 4AEHL 4BSVB 1TCRB 5T1KB 1V7ML 5TQ0H 5IIEA 1XGQA 4XT1C 4WFEE 1R0AL 3QXAB 3HKFA 1X6NA 4A6YH 4H5SB 2IAMC 1E28A 1PW3A 5ICYA 4L4TA 1EMTL 1WV7T 5E99L 2RB8A 4FFYL 4L4TD 3SDAB 2XTJB 3IRPX 3RIFK 2YEZB 1RZ8A 1J8HB 1ZHBB 3GI9H 1HDMA 5BV7B 4M7JH 3MO1A 3MCLL 3F7QA 4NUGL 3C60A 3C60D 1NPUA 2QQKL 4UU9B 1WTLA 3TFKD 4DAGH 1RUQH 4KQ4H 3MBEC 1SHWB 3CDYA 1IQWH 2B7DT 1O5DT 2OTWB 3IGAA 4QCIA 3WIHA 4APQA 4APQD 1PKQB 1PQZB 1WIUA 4LPCA 3GIVB 1ND0A 5B3JE 4NM8H 4ARXA 4PP2B 1ZS8A 1ZHLA 3T2PA 1T4KA 5DSCA 4MAYC 2OXGA 3QQ4B 2E5EA 5FOBA 4UDUA 1KTKE 3OPZL 2W9LA 3SJVA 4Z7WA 2N56A 5KVGH 3SJVD 1Y0LB 2CIIB 3LKRB 1XF5B 3PG2A 4M61B 4KHXL 2IQ9H 1C5DB 4F7MB 3D39A 4LKXB 2HFFB 4ORGA 2CLVB 4NUJB 4UDTB 3T2OA 3QUZA 3QUZD 2JELH 1PZUB 4E5XB 5KZCD 4PJ9A 4PJ9D 2P1YA 1S9XB 5ERWB 3NA9H 4XZUB 5FGBC 5ID0A 1KGCD 3HI1B 4IBLT 1RZIA 4G6AC 1U8KB 5T3XH 4LPYA 4O2CB 5TE4L 5CWSB 3O6ML 1I1RA 2XY1A 3RX7A 3AM8A 1KBGH 1UADC 2EDFA 4N9GA 1OAQL 2ICWB 2GSIA 4TSBH 4TYUA 2UWEF 1PLGH 2BNQB 4KROC 3NTCL 5JXAH 3CMOL 3OB8A 3LS4L 1YUHA 4KKCC 3TYGL 2NX5A 2NX5D 2DD8L 1N59B 4PQQA 5FO9B 4NNPL 1XR8B 4FQHB 3VXRE 4HFUL 1LO5B 2R1XA 2YD8A 4HLJA 1EXUB 2X4PA 1FQ9C 4HEME 3C7HA 2MPAL 5FYJD 1ES0A 3JVGA 2QADC 3MV8E 1EPFA 1BZQK 4KK9C 4AH2A 3PHOA 4ONFH 3KPRB 4PJ5B 2OYPA 2YA2A 4FFVC 1BFOA 2E6JA 4Y4FA 1JYNA 1I3GL 4DXTA 3WFCL 5C6PB 3MLXH 5BW7A 2R2BA 2PR4H 4HHAB 1MY5A 4N8CL 5LA1A 1VADA 4TUKL 4JKLA 1I8LC 2BCKA 3PWJB 2N4IA 4S10A 4JN2A 1PGRB 2WDBA 4P9HC 5JXEC 5J1SC 4HKBB 2EDDA 3ES6A 5C0AB 5DPNA 1U58A 3HPJB 3KPLB 3FN9A 4I2XB 4LFHD 4GOSA 3SDCC 3WD5H 3HUJE 3BQUB 1DQLH 3MLYH 2BOCA 3GMNB 2P8PB 2D9CA 1S78C 5GGRY 5HHNB 4KZEL 5JHDA 5JHDD 3V4PL 4WI8A 3IAPA 4AG4L 1TZHA 1A2YB 4YXKL 1IAIH 3SKOA 3O3BA 4F37K 4QRQA 2IQAA 2NY5L 3A22A 1F58L 2W65B 2DWDA 1MFCH 5F1NA 2R1WA 3EYFB 5IMKA 2RIKA 3LQZA 1URLA 1GU3A 4JFFB 1MPAL 4YBQC 1MCRA 3G5XB 2YBRA 4P59H 3GIZH 4OFPA 4G80A 3TNMA 4OM1H 3H3PL 3P4LA 3SCMB 1NBYB 2MFNA 1S7SA 4O02L 2NY2B 43CAA 3SKJH 1LHZA 1OQOA 3I02B 4OD2B 3D3VE 3EDEA 4O9HH 1YEHL 2NY0D 5B4MD 5KSAC 1MCIA 1PG7L 1DBBL 3MNZA 4YK4B 3I2FA 5DJAB 4OF5A 5I1LA 4PR5A 2EC8A 3SGDH 5DUML 1NDGA 4J3TA 3LEGA 3T08A 4LLQB 3R0MA 2XWBA 4JDTL 4Z0BH 4YJZL 5C6WH 5JDSA 1ZANL 2HFGL 3T4AA 2Y6SC 1KN4L 4XNQB 4EIZC 5E2VL 1UENA 1QA9A 4I0CC 3FFCA 3MRHA 4JY6A 3FFCD 4CJ0A 2AJUL 3ELAT 4DFIA 5T5FH 1R5IB 3DROB 1I7TA 3HN3A 4Y5VA 3TNNB 1C12A 3H7LA 25C8H 1DSFL 4QYOA 1CQYA 1DL7H 4F7PA 4MQSB 4I3RH 5IFTA 5J6HB 2E9BA 1RURL 2G75A 4RISH 1MJ8L 1RZKH 4PJFF 3X3GH 3RWHB 4KKLC 2FEDC 5J57B 2ATPA 3CLEL 1A4JA 3L5JA 3INUL 4ZD3L 5JLZB 1CYGA 1S7UA 1LP9B 3BP4A 3VFGH 3GNMH 4GW5B 5J1TC 3X17A 4U6YA 1YMME 1U93B 2VAJA 5IMMB 5GPRA 4LHUA 5IEKA 4LHUD 5DA0B 4XXCC 1CFTA 1MH5B 4ELMF 5DTFB 3TIEA 1F4AA 3IETA 2MHAB 4R3SB 1CE1L 3GHBH 3LZFH 2DI8A 3K80A 4F2MA 4K9EL 2NXZD 5C0BA 3ULVH 5C0BD 5CKGA 2YN3A 3LEXB 1OOAA 3AROA 4XPFH 4NKIH 1HHJA 3T1FA 4LPWA 4LEXL 2ADGB 5LGHH 2VLJE 1U8IB 5TF1H 4HGWB 1B2WL 4OM0H 2AI0H 1LE9A 2G9HA 1QSEB 4NBZB 3RWCA 3WUWB 2H45A 4PJIA 4HC1L 2FLRT 4R2GC 2E9JA 1M6OB 3WKMH 2O5YH 5I73C 5D6CB 3QZWA 4PJBE 1SJEA 4N0YH 1DP0A 1TQBB 4MVBC 2BVTA 5CJXC 5IV2A 2FECI 3BXNA 1RU9L 2XACC 4JDZB 3MMEB 4YPGB 2MCG1 1K8DA 3PV6A 5FOJA 2XZZA 1SBSH 4TSCL 3SGKA 1JYWA 4U33A 3OHXB 5BZWA 1G7PB 4QDRA 3DMMC 1H5BA 2VMDA 4K3EH 4PJCA 4PRHE 3TV3L 3RA7L 3W9DA 3FAXA 4WUUB 3ILPA 4HJGB 3ZKMD 3MLWL 4JFXA 1UWGL 4UUJA 4FZEH 3CFKB 5F93C 1UWEH 3W11D 4GG6A 1UXSB 5D7LE 1HYSC 1EEYB 1ZLVK 1EGJL 1VFUA 2LE9A 1MPXA 2MCPH 2LAAA 4P2RB 4NPYB 4U1SA 3DYOA 5BRZA 5BRZD 5EU7C 4ZDHB 1YEGL 1P7HL 1QBBA 3WO4C 3QCTL 4TRPL 1ULPA 2UZIH 2P45B 2GK0A 1VEMA 4LNVA 1FLRL 1VB9A 5MEQA 5I2IB 5A2FA 3G6JB 3UTPE 3OB0K 4MZ2A 4LLMB 5HI3C 1TG7A 1F13A 4NGHL 3PP3H 4X6CB 3PWNA 4PTTA 1V5JA 1XCTA 4OD3L 3LQAH 2VITA 3BN9C 5DR5L 2BSSB 3TYFB 1CU4H 2X09A 3LQCA 1T1ZA 3Q6GH 3VCLA 3VXNB 1PYWB 3GJFB 4KI5M 2HRLA 3RUGB 3T4YA 3FL7A 3S3SA 1ZEAL 3IB3A 5HD8D 4UQ2A 5CP3H 2B1AH 1F5WA 2A6JA 1UYWH 2IPKA 3HI5H 4GRMA 2FIKB 1IC7L 2R0ZH 1I1YA 1QR1A 3FFDB 4LLWB 1GXEA 1S7RB 5BV7L 4UOW0 4G8GB 4IRSB 4OIIL 3GJFH 1SM3H 1BZ7A 1X5GA 3FB7A 3ECBA 3DHJA 1T0PB 1JF1B 4NHCL 1I3RA 4JZJA 4R4NC 4HJ0C 2AJYL 3RWFB 2HWZH 3CFCL 2BGPA 3QXTA 4GAGH 2JELL 2KQNA 3T77A 5EZOL 5AWNH 3ZDXE 4X7FC 2XKUA 5FEBA 5DVMA 2I5YH 4NQDA 4ZOEA 4GLRH 5JIIA 4NQDD 3AREA 1DLHB 3ARED 3LPFA 4HIIA 1RZFH 1G1CA 3CCHA 4LBEA 1OW0A 2HT4D 3ARVA 2GT9A 4XBGA 5BS0B 2ZXQA 4O2EA 2QSTA 3WS3A 2ZEXA 2DQUH 5DRNA 3OXRB 2Z8VC 3WL9B 3LEYH 4TSBL 4RGMC 4CMHB 4EUPA 5C0FB 5EN2B 4GQPH 2BVPA 2NY6C 4OFYA 1NMAH 4KI5E 3JV4B 4OFYD 3U4EB 3K4ZA 4G6KL 5D6DC 1YJDC 4GSDL 1J1PH 3CU7A 5HY9A 5L2JB 1MAMH 3QDAA 1ODAA 4B41A 4OZHE 4S1SL 5BJTA 3QG6A 4KKNA 2W1UA 3FT3B 1F11B 4PJXA 3O3DA 4PGZA 1UM6H 3MRKB 2VYRE 2A9NH 4WI3A 2J4WL 3GSOA 1BP3B 1G6RA 3HG1E 1LO3H 3VXUD 4L9LB 2W47A 1F3DJ 4ONFL 3EBAA 4RA0C 3D25B 1MHHA 3P9MB 4E41B 4RNRA 1J84A 1FHGA 5TDPA 5DQJA 4Z18A 1H3VA 2AQ3A 4NC1E 1TLKA 4Y2DA 4AL8L 2JIXA 4LCYA 4RAUB 4Y2DD 2JIXD 1J0JA 2DLHA 2VKWA 3O8XA 1IEAB 3O8XD 5D2LA 1S7XB 2BNRE 5HHQA 3BD4A 4Z7VE 5IGXL 3BSZH 3HZVB 3NABH 5DMKB 5JOFA 1OARH 3HNVH 5C2BH 1XF2B 1EO7A 4HK0A 4KK5C 3HI6L 3B83A 2IBZX 4EI5A 4EI5D 3HC3L 5GRWA 1MFAL 4I77H 3KJ4C 5ACZB 1UT9A 4IDJH 3EO1B 5GGVY 2FLBT 3ARZA 1BD2B 5IK3A 1OAKL 2NZIA 3OEAA 5F7EL 2GIYA 4HWUA 2K3TA 3OGRA 5BXFB 1MAKA 1K6QH 3QO1B 5E6IC 4LLVB 3VG9B 1KPRA 2FEEL 4AENA 3QXDA 4FXGA 5T1LB 4XCFL 2NR6D 3P9LA 2E7LC 3MRGA 4IOFC 5F7HA 4BM7A 1OD7A 4R97B 5D5MA 1D5ZA 1JL8A 1QFHA 4P5TA 1JWUA 3G6DL 3MA9H 3F5WA 1DBKH 4P5TD 5EUOF 3UP1A 3OKNA 2P7TB 4F7TA 2V7HB 2EO9A 1KIRB 1H3PH 2F54E 3FB8B 4JREB 5FXCH 4LVHC 3HZMB 5IQ7H 4JO1H 4KVNH 1CLOH 1I9RL 5FKAA 1N6QL 4U1GC 1JZ3A 4EDWH 3O2DA 1AIFB 3TZVA 3A6CH 5HYQA 5FDWB 4Z7WF 1MCDA 3EOYG 3FKUS 4PB0H 1MRFL 3SDXB 1S7VA 2VC9A 4A2LA 1RJCA 4UOW1 3QXWA 3SKJL 4HIEB 2APTA 1AO7E 5KJRH 4M7LL 4PJEE 4O9HL 1P4BL 1KCVH 3CK0H 1ED3A 4QRPE 4HIXH 4X7SL 5D7JB 2CRZA 2AJSH 4I9WE 4CAGA 2VLJA 4IMKA 3RL1B 2P5EE 4UV4L 3QPQC 3N0PB 4WV1C 4ZG1A 1W8NA 3ZDZE 5BQ7B 2ZEZA 4FQ1L 5DHYA 1NC2B 1MHPL 4OLUH 3CXHJ 1A1NB 3GJEA 1FYTE 2HKFL 2V7NB 4PRDA 1RHFA 1FL6A 4HMEA 5T5FL 3SE3C 1WAAF 2R2EA 4CVZA 3KPSA 3ESUF 3KPSD 4DGYL 5HHMD 4J3WA 4RISL 2WUHA 4LCWA 4PGDA 1KJ2A 3L7EA 4LCWD 1UH4A 4M9PA 4MS8C 4IS6A 4MNHB 4M43H 3KDMA 1WZLA 5JUEH 5CGYD 4MGSA 1FPTH 5IHZA 1N6VA 5B8CA 4H1LB 4NZUL 3VFGL 1G7JB 1LO4H 1S9KC 4F15B 1WCBA 4HMCA 1BIIB 1NCAL 2VLKB 4BQBA 4LSPH 3D0VA 3MLTA 1CFSA 3V95A 3RDTA 2F9BT 3RDTD 1UYZA 3UBXA 4ODSH 4P00B 4H1LH 4AT6A 7FABH 4HGMA 5C0JA 3QDGB 3MYZA 2BC4B 3ULVL 3V5HB 3G5YA 1HXMB 4NO2A 4TNVK 4XPFL 1OSPL 2VZPA 4K71B 1DQQA 3WSQH 3UTZB 2W9DH 5L9DL 2Q7YA 3PQYA 3QWQB 3PQYD 1X5KA 1LE5A 5DD1L 2VO5A 4MQ7B 1PEWA 4JPVH 2CRMA 3HZYA 3VXOB 4FABL 4LGRB 1VGEL 1YEJH 1OT1A 5C0IA 3QEUA 4OYUA 1RK1B 3SDAC 2IPUG 2XTJC 1TQCB 1UJTA 3MV7E 4N5EC 1KG0B 4NQCE 3UAJC 1DBAL 4ODUB 3QIBB 1X7QA 4ZODA 1A6AB 4XB8A 5TH2B 3QR2A 4XUQA 4HKXB 2A9MH 4OZFG 2DWEA 5FO8B 1GZQB 4P2OA 3VGGA 5ANMB 4P2OD 2VR5A 4FZEL 5HHOE 4MDIA 1IGYB 2E7MA 3QFJE 3VH8G 1J18A 1SJHA 1UM5H 3HB3C 4NQSB 2C7UA 2W60A 5HGGS 3QUKA 5EOTB 4U7KA 2LVEA 1XEDA 4MDJB 2Z0BA 3MRNA 3BPOB 1HHKA 5DK0B 1M7IA 5F88A 4QHMA 3W81A 2X4OA 2PO6D 4RGOL 1A7RL 3S36X 3KLAB 4XX1E 4J7RA 3L6FA 4GKZA 4HUWB 4ZFFA 1F4XH 1RUPH 3BAEH 3OR6B 3DX6B 2Q3AA 2EYSB 2H9GA 4DTGH 2GEEA 5B38B 1G0DA 3KLDA 1FAIH 1HOCB 2I26N 1YPZE 2E3VA 1JI2A 1KTDA 3BKYH 4BFGA 3CGTA 2NY7L 2X89D 1CF8H 1KJ3L 4YDKL 2OR9H 4WIQA 1LD9B 3AS3A 3U9UB 3UJIL 1FNEA 4F8QA 1JGVH 3DIFA 2CLRB 1B0GA 2VQUA 3BE1H 4ODXA 5CZVL 3MOQA 3C8HA 5GGSB 1QRNB 1C08A 2VMEA 1JPFA 2Q8BL 4X8XA 3QDME 5DGQA 4ZNCD 5EU6A 5IB2A 5EU6D 4K3JH 5C8JB 1J5OL 3ALPA 5C7XH 1FZMB 2BRRL 3S36H 3H3BC 4TPRH 2AJ3B 3DVGA 4XTRC 4YHPA 2HVJA 2Y36H 3FO0L 4X6BB 4XMLH 1OGAE 3KYMA 1QSFA 4LSTH 5B21A 2WV3A 1QSFD 4QRUB 1AD9B 5MEPA 1C7TA 1QHPA 4I48B 3ARPA 4CN1A 5FECB 5HDBF 4Y5YA 3LSOB 1M7DB 2V2TA 2FWOA 4LNRB 2P42B 2Y6JA 1JF5A 2X4SA 2ADIB 5AWNL 4XMKH 3T3PF 2FB4L 1D5MA 3L3GA 4JVUA 3ALXA 3THDA 3OXSB 2GJJA 1IGIH 3RU8H 2FBJH 4TOYH 4F7CB 2VLLA 2X6MA 2LV4A 1RZFL 4UILL 5J06A 1G7HB 3BQUC 4UAOB 5EH1A 2C26A 3GGWB 3VXQA 3WFDL 1DQML 2J3SA 4NOFA 2H2SC 3TBYB 4OKVA 3HMXA 4N8VB 1OP5H 1J88A 3IU3A 4A45A 2XQYG 4DQOH 2XKNA 4ISVB 1OF3A 2HP4A 3MRPB 4QO1A 5E8PA 2XPGB 1UX7A 2FCBA 4HZLA 3BD5A 1YECL 4M1DH 1JPSL 2D0FA 2B1HH 1WLHA 3NOIA 2F74B 2YSSA 3KPQB 1JHLH 4ELKA 1SVZA 4L3CB 4G43B 3BDYL 4XI5D 2C3XA 5KS9B 5FA4A 3GB7B 3L5WB 1YN6A 2CKBL 4H0HB 1EERB 5GHWH 2OQJB 5EIQA 4XUTA 1C16A 4JZNA 1LO3L 3EAKA 3CVHA 2EDLA 4HKZB 1AKJB 4OCNC 3SCMC 3CFIC 1U8MA 3N9GL 5B3JF 5HGHB 2NY2C 1EJ6A 4JAMB 4Y89A 5GJSH 4YQXH 5J13B 1IGCH 2A83A 3C5SA 3WNOA 4ZSOA 5GJTL 4JCMA 4YK4C 3MA7B 4ZFOL 2OI9B 4K8RL 1OARL 3HNVL 3QWOA 5D8JH 3SDDB 5KVEH 5T3ZH 1JVKA 3FQUB 1MQKL 1RZKC 3E6HA 4YXLL 1YNTA 1D5XB 3O4LE 1OTSD 1DN0B 1CXEA 5IJVB 1R24B 2EZ0D 4M6MH 3KYKL 1WBXA 4Y4KD 3MO4A 4NWTL 4YZFE 5ALBH 4AM0A 5GRXG 2W0KA 3GSNB 4Y5XB 3IS0X 2X1QA 1NLDL 3WHE1 1IMHC 1RJLB 4L3EB 5FUCE 1HHIB 3LKSA 1T22B 3GJFK 3X3FL 1ZHNA 4JY4A 3WEZA 4X4XA 4NO0A 4IHOB 4HIJA 4NO0D 4TSAH 3ULVC 4LPTA 4O00A 5FYLH 2J7LA 5DZLA 2FGWL 4OT1H 5DFVC 4A4AA 4BQ6A 3UPRB 3GSNH 2BHZA 2D7NA 2DAVA 5FM5O 3TVMA 1HWHB 3TVMD 1ZLSL 1O59A 2VZUA 4JO1L 1U8HB 4KVNL 3MRCA 2YD6A 4OF6A 1A5FH 4UT7L 5DJXB 1GZPB 3A6CL 3VWKB 3RVTC 4Y19E 4K2UH 1VFAA 5C09B 5L7XL 3JUZA 2W1NA 5KJRL 2ILLA 4J3XA 5HYSB 5KSBE 1G7IB 2VUOA 4NHUB 1UVQA 1UY3A 2Z31B 3I84A 2J8UB 3CDZB 3EGSA 2CD0A 1EZVX 3BUYA 2AJSL 2YC1B 1IGMH 3LV3A 5H94A 4MZ3A 1OD9A 2AV7B 5CZXD 3BP6A 4BZYA 2FBOJ 2VXTH 1KC5L 4WTWA 3V6FA 2LTQB 2GTWA 1KGYA 3HUJF 5GZND 1TQBC 4JB9L 4OSUH 4W8JA 4UQ3B 5G04L 3BIKA 3DJ9A 4CVXA 4YO0A 5DJ0B 1CD8A 3UX9B 1HEZB 2GQHA 5CSBA 4J6RL 2JJWA 3FB6B 1VERA 1YQ2A 1RHHA 5L2KB 1SQ2N 1RQ5A 3U7YL 4DVBA 3L7FB 1DFBH 4CDHA 4HCRL 4W4NA 1FPTL 4ZPVB 3ZMRA 3KXFE 3QISA 3S88H 2YPVL 5INDA 2CDGB 1PFCA 1A47A 1RUKL 1FNLA 4RZCB 5EIIA 5JORA 2C3VB 4U7SA 2W1QA 1MCOH 1A0QL 4KHTL 4MB5A 2DQIL 1KACB 4Z7NE 1HIML 1KPUB 2I9LA 1U91B 1F8TH 5E6YA 1H8OA 2QHRL 1D9KC 1I9JL 1NCWL 2Y6GA 3VRJB 4ZXBA 1KN2H 4PRBB 1AY1H 3ZTNH 4NT6B 3CX5J 1EX0A 1JPST 1IRAY 5MEOB 5T1DL 4ONHB 2OCFD 2AAVA 5C0DB 4QOKE 2W9DL 3CSYB 4D0DB 3LQAC 4ZS6D 5M7QA 2WMPA 2YPLE 1DQDH 1EO5A 1GHFL 4LU5L 4C83A 5GGTH 1E4WL 4KTYA 1Q9WB 3EJZC 3BT2H 4DVRL 1IKNA 2FL5A 1AGBB 4O2FA 3TJEH 3LCYA 1UXWB 3OWEA 5T33H 3I6GB 5DEFB 3T2NH 1EH9A 2J1EA 5C3TA 5D71L 1FNGB 3O45B 4NRXB 1XR9B 3RJQB 2UWEB 1N8ZB 5IMOB 5LVEA 3WLWD 1GC1H 2NY4B 3QULB 2Y7QA 2PTUA 5D5MF 1U95A 3GZKA 1CVRA 4FQIH 4WEMB 2ID5A 1V3MA 4XPTL 3MV9E 1WFOA 3DETC 2DIBA 3H9SB 2VXQH 4UOJA 1UKTA 1FJ1B 5HXMA 2P24B 3CH8A 3OG2A 4IRSC 4P5MA 5F70A 3HS0B 4FS0A 1CT8A 3CD4A 3FZUC 3DXAB 3VFSA 4NNXB 5EORH 4WU5B 5BMFH 3OJDA 3L3KB 2R8SL 4BFBD 6CGTA 4YUEH 4Z5RA 4X9HA 4NFDA 5I19H 3GSQA 2CDEA 2EEBA 1NGPL 1G7LB 4E42B 4U4BA 4LCCB 4LPUA 4DZ8A 2BJML 3IFOA 3NAAH 4AIXA 3BJLA 3HRZB 4ZUUB 2W3JA 1CDYA 1RUPL 3BAEL 1KCSL 4Q9RH 1S5HB 4X6DE 4JG1H 1AP2A 3HFML 1JNJA 1B4JH 3MGTA 5M95B 5GS3A 4CMHC 4MQXD 1QLFA 4PJBF 3RY6C 4I5BA 5CEXA 3P77B 3O6KL 4KKAD 1A6UH 4JFDE 3HCVB 1WZ1H 4J1UB 2DQHL 4OLVH 2WUCH 1EAPB 4GW1A 3S34L 4J3UA 2EECA 4L8DA 4KJWC 1A7QH 1HXYB 1PSKL 5A3ID 4POYA 4R7DA 3UETA 1NGWA 1MVUA 2QLVB 2E32A 2Z4QB 2AJXL 4IMLA 3PL6A 3I6KB 3SDYL 3SKJE 3PL6D 5EPMA 2ARJA 5FYKU 2CO7B 5IFHH 4P23A 4HLZH 2B0SH 4FXKB 4P23D 1K9TA 4HH8A 5AEAA 2AV1A 4HAFA 1N4XH 3DSFL 4L9LC 1T1XA 3ARDB 4PBXA 3MRRB 2X41A 4HIHB 4TPRL 5J6GB 5K59E 1X5LA 2L0DA 3ARQA 1IQDA 3QIUB 5F3HA 3PUHA 1RVFH 2OX5A 3STZB 1XCQB 4KJYA 3BOVA 3GDBA 1JZ2A 4V2CB 4QXTA 3RJDA 5A2IH 3U37A 3N1QC 4P9MH 4CNIB 1A3QA 1FFOA 3WKNA 3LKQB 3RTQA 2VDMH 4PGCA 3RTQD 1U8JB 5I30L 2FJFA 2O5ZH 1IGIL 3P4MB 1RZGA 1MREL 3IVKA 3O3AB 1T04A 3CH1B 4UAPA 1TZIA 5E5RB 5DEGB 1I8IB 2UYLA 1FVDB 3QEHB 2VN7A 1TNNA 1NAMH 4DQOL 2P43B 3S37L 1FBIH 3VG9C 4HMDA 4POUB 2LS6A 4R7NB 4U1HA 2EDKA 3QB7C 1U3JA 2ZSVA 1LP9E 3ULVE 3VFPA 1JZ8A 1CLZH 3MJ9A 3HJRA 1FO0A 3L9RB 2NYYD 4R97C 3GRWL 3H0TB 3TN0B 1P1ZB 4PJFB 1OAXH 2VL5A 1N3NB 2UZXB 3L95B 2NNAB 4JREC 1J1XH 3Q1SL 3QHTC 4Q6YA 5DLMH 1E6JL 1JGDA 1KB9K 4R90L 3FQXA 4WY7L 3CPLB 3F58H 2C1OB 4K7PY 1US2A 3B2VL 4ELMB 4PRAB 1BBJB 1BVKB 4HBCH 4AZ8A 3HPLA 4JCLA 4NN5C 3SQOH 1A9BA 4L8SB 2WBJB 1AR2A 2EE2A 3OKDB 4LSUH 4MA3B 5I0DA 4YQXL 4FI9A 3EYOB 5J1XA 4JANB 4Y19A 3UZEA 3GSUB 3K74B 3C5ZA 5D7JC 3C5ZD 1DVFB 1WF5A 1YEIL 3FQWA 2BSRA 4ZXEA 2E6QA 2IANE 1Z9LA 3ZDXF 2H26A 1JUFA 1K5NB 1NDMB 2AJZA 3M8OL 3QUXB 5I18H 5INCB 5IEHA 4G7YH 2VXVH 5EA0H 5FGRA 4IIQB 4M6ML 5LCVH 5IFJB 3FOLA 3RVXD 3LEIA 4JFQA 3KPTA 5IHLB 4HS8L 2E8YA 3OSKA 5CEYA 3D85B 4PRIA 4PRID 1LWRA 3RIFF 2VSDA 5KOMC 5CIPA 1DANT 1RK0A 3ARSA 2EIZA 4KI5F 3WF0A 4TSAL 15C8H 4OCSH 1FL5A 5EU5A 4F15C 1JNLL 2WZ8A 1GJIA 4O58L 1W99A 4OZHF 3H9HA 4QRRA 4QRRD 3G9VA 1HZHL 2FX9H 5E56A 2X70A 5EO9A 1I1CA 3O4OB 4D0CB 5C07A 1T83C 4MADA 5FA3A 5C07D 4LSVH 1RIHH 4K3HA 2QQLA 5DJZA 4XP4L 3I50L 3S96B 3AXLA 3MCKA 4IOIB 5LBSH 4S1QL 3HE7B 4NO5A 4U7MA 2FSEB 3F7VA 1G7MA 3ZE1F 4PRNA 2HTKD 5FFLA 5FUOL 1NC4A 5C0RH 4HPYH 5DQ9B 1MIEL 2XQBL 3RPKA 2QBWA 4NKDB 4Z7VF 1LNUB 2R9HD 4NP4H 5ITBH 2EH8L 1R5WB 1IM3B 4QOKA 3SKMA 1AQKL 3U0WL 4QOKD 3UDWC 5JZ7C 2R4RL 4PV8B 4TXWA 4X6CE 3MFFA 1F02I 8CGTA 5C08E 2FEEI 4RDQF 1DBJH 2EYRA 1KPVA 1TENA 3EKCA 2MWCA 1D5IL 1TQCC 3D3AA 1FCGA 1I1AA 4NDMA 1I1AD 2XOTA 5FGSA 4L8BB 1BQHB 1N26A 1XGRB 3QIBC 1NSNL 1XIWB 4S2SA 4P3CL 5AAMA 1HWGB 4NZJA 3CIHA 2WO2A 1CXHA 3C6LA 4L5FL 3C6LD 3EFDH 4NJ9H 1VPOL 5GS1B 1UACL 3OG4B 2BVOB 4ZFZA 4ZS7H 1RMFL 2B2XH 2DQJL 3FMGH 4F9LA 5FB8A 3NJVA 1ZGLB 3WXVH 1GIGH 4KK6C 5ILTL 4FG6D 2WWMD 5JIKA 4YHNB 1F8TL 3LRHA 1YNKH 2FHFA 4M62H 1F00I 1KN2L 2WP3O 3VU2A 1KEMH 35C8H 1BGXL 1JMXA 1AGDB 3R06A 2Y07H 3QEGH 4QXGL 3W9EB 3BPOC 2ZUWA 4KK8C 4HWBH 4PJEF 4RDQG 3FTGA 3MBXH 4AMKH 4MJ6A 4GKNB 1UM4L 1W0WA 1KIPA 2F15A 1MELA 1DQDL 2HJKA 2WBWB 2ZUQC 4FTVA 4RFEA 3K7UA 4FTVD 4R4FH 3VXSE 4FQ2H 2OL3B 5GGTL 2X7LB 3Q3GA 3D69B 2DKSA 3U6RB 2CIKA 1MUJA 2J2ZA 3LH2H 1N0XH 4Z95L 1R3HB 2L7UA 4S1DC 1IEBB 5C0EA 1UJ3B 3ALWA 5IBTL 4QRSA 1S7WB 2GITA 3BP5A 5ENWA 4YBLC 5I1IL 4JRWA 3L3DB 2AXFB 1CICC 5EFIA 3U36A 2IWGA 4HQQH 3BP7B 1Z6JT 1AJ7H 3F6IA 1BPVA 4UIKH 3P2TA 3JV6B 4OQTL 5F1IB 2FATH 3OZ9H 4F37F 1NGZA 3B3IB 3MREA 2ID4A 5CD5D 5KN5A 1JWSA 4NZRL 5D9SA 5GZOD 2BY0A 5JPMB 4EVNA 5HHVH 3B9KC 5DRWA 4E41E 5D1XA 2VABA 5D1XD 1P5UA 3O11A 1U8NA 4W4OA 2R0WL 4YUEL 2IADA 1KENL 2WANA 4ZTOH 2AVGA 5I19L 1CE6A 2XNAA 4EI6A 5FK9B 2VDPH 1PX4A 5E2WH 4I0PA 4I0PD 2GHWB 2PN5A 4OCYH 4YDJB 5EO1B 5D1ZD 4XH2B 1JN6A 4PJ8A 2GFBB 2DQFA 4PJ8D 5I1JL 3CFBA 2YK1H 4OLXH 3IT8D 1BJMA 2KPNA 4HEPG 3RIAF 4FQQA 2OTUB 5HJ3A 4UAOC 5D2NE 2P46B 1MHCA 1X9QA 4HG4K 2YS4A 4LLUA 1Q9KA 3WFZA 5DD0H 4M5ZL 1F2QA 1WZ1L 1JIBA 1GSMA 4PGEA 1E28B 2W0FA 4NZTL 1TXKA 1TVBA 3DUHA 3WDJA 1C5CL 3SGJA 1K3IA 1RZ8B 3IU4H 2DM7A 3DX7B 1L7TH 3QUML 2QQNH 4Z2AA 1A6ZB 4RCAA 3J8F7 3P4NB 1H0DB 5IFHL 5ADOH 3KS0H 1ONQB 3LIZL 4XPGL 2NTSP 1ACYH 5D72H 1MFBH 4M3KB 1WIOA 4U6XA 5EUOB 1QG3A 4QCIB 3KLSA 1U41A 5GRJH 3TWCH 1RJZA 4OZIA 1ND0B 5L8JB 1HH6A 5C7GA 1E4KC 2KZWA 3IDMA 1ZHLB 1T4KB 3IDGB 3WNKA 2M26A 3JV0A 5J13C 3QRGH 4G9FB 2WN2A 3MZTA 1RVFL 2EH7L 5FOBB 1P4LA 4Z7QE 5CEZD 3SJVB 4Z7WB 1QBLL 1NMCB 2Z92B 4ZTPH 4H88H 2OI9C 3D39B 3WIHH 3CJJA 3SDDC 4ERSH 3QUZB 4MXVE 5TE6H 1IGFH 2A74A 2VDML 1HHGB 4WW1A 2FZ3A 4PJ9B 1R3JA 3OJMB 5ID0B 3DI3B 3VXMB 1RZIB 4I3SL 4H25A 1TJGH 1X4ZA 5GSRB 1I85A 2A2QT 1LEKA 3IDNA 1S9WB 2XN9E 2ADFH 4N9GB 1N64L 5D1QA 5D1QD 3DGCR 1GOFA 1GGIH 1YDPA 1YPZF 1ADQL 4EN3A 1A4KA 4EN3D 2CR6A 1LQSR 3QI9C 1DE4B 3DVFA 1YUHB 2IGFH 4BFEA 4XPAH 2EXYD 1MIML 3C2AL 3U46B 1HHHA 3MUHL 3U82B 4M48L 2AKRA 9CGTA 1JRHL 5ESQA 1C1EH 3BMVA 3BW9B 4BKLA 3IJHA 2VLKE 4KGLA 4GAJH 3OKOA 5ID1A 5DLML 3WIFB 3VFWB 1EUUA 3OJ2C 2H8PA 4PTUA 3UPAA 1ES0B 3UPCA 3Q6FA 4YR6A 3VWKC 1IFHL 3TBSA 3O3EB 3DRQA 4AH2B 2PCPA 3PHOB 3UTTA 3UTTD 4ALAL 4Y4FB 5DD3L 1W72A 2IH3A 3VD4A 4OZFB 3FB5A 1H3XA 4XX1G 1V3LA 2Z31C 2R2BB 2EDRA 2F5BH 3TIDA 1TETL 3TPUB 2FO1A 2D9QB 4XAKE 1U8OA 1VADB 2HT2D 2VE6A 4JN2B 3WE6A 1UYYA 5KW9L 2GSGA 1PAMA 1A6TA 2NW3B 4LRIC 1WGOA 1U58B 2LTQC 4OZFH 4G7YL 2DLGA 3MRQA 3R1GL 1IGTA 1AFVL 5LCVL 1GGCH 1UGNA 5FHAL 5SWSE 5FUIA 3PWLB 3C2SA 3WEXB 2D7TH 1G7QB 3HR6A 1KEGL 2WN3A 2D0GA 4ZZ8A 5HHXL 5JHDB 3U9PH 1INDH 4XBPA 4OCSL 5TPWH 2YRPA 3SOBH 1KYOJ 3RVUC 3VMNA 5B3NA 2ZG3A 4KJPC 4M1GL 2DF3A 2R1WB 3EHBC 5EZIL 5IMKB 1CK0L 2NTFB 4F9PA 1YZZA 3PUCA 1JI6A 1JNHA 3UTQA 5ETUA 4Z77B 3X13A 1WQVT 2PXYB 4G80B 4WFFD 4PGJA 1AXTH 2MOVA 3MV01 5A2LH 4EOWL 1S7SB 43CAB 3VG0H 5GS2H 3ARWA 2ESVE 1QSZA 2IAMA 1FC1A 2ICES 1YY8A 2IAMD 1MOEA 1Q9LA 4XHJC 1MJJA 5HI4C 3MNZB 4HWEL 5IVXA 3IDYB 2D2OA 3ARTA 4JPKL 4PR5B 1GC1C 3L1OL 4HDIA 4QXUH 3TEUA 4F33A 4RGNE