5FZLA

Crystal structure of the catalytic domain of human jarid1b in complex with 3d fragment 3-methyl-n-pyridin-4-yl-1,2-oxazole-5-carboxamide (n09954a) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
462
structure length
452
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with 3D Fragment 3-Methyl-N-Pyridin-4-Yl-1,2-Oxazole-5-Carboxamide (N09954A) (Ligand Modelled Based on Pandda Event Map, Sgc - Diamond I04-1 Fragment Screening)
rcsb
total genus 137
structure length 452
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzlA01
4LIUA 2XXZA 4BU2A 3OPWA 5FZHA 4CSWA 5F3CA 4QWNA 5F5AA 2GP3A 5FYHA 4D6RA 4GD4A 3DXTA 5FY1A 5LY1A 2XUEA 3KVBA 3N9MA 2W2IA 4HONA 5FZ7A 5FZIA 3N9LA 5IW0A 5FYBA 5K4LA 3UYJA 5FP9A 4CCMA 5F3GA 5FYYA 5FXXA 4EYUA 5F5IA 4D6QA 4IGQA 5A3WA 3LD8A 5FZEA 5LW9A 3PU8A 5FYMA 5A80A 2Q8DA 2XDVA 5FBJA 3K3NA 4GAZA 4CCOA 4UF0B 3KVAA 5FPAA 5ISLA 5FYSA 3PUSA 5F2SA 5FY0A 5FZOB 2YBPA 5A7WA 3KV6A 5A7QA 2YU1A 5FZ9A 3PDQA 4CCJA 5FUNA 5A7PA 2WWJA 3N9PA 3N9QA 4CCNA 5FZ3A 2OT7A 5FP7A 3AVRA 5LWBA 3N9OA 5A7NA 4QXBA 5FZ8A 5FZ0A 4XDOA 5FZLA 5FXZA 4GJZA 5A7SA 4DIQA 5FYCA 5FWEA 5FZDA 3ZPOA 2GP5A 5FPBA 4IGPA 5FZGA 2YBSA 4CUGA 5FZKA 3OPTA 4QX7A 5KR7A 5IVBA 4HOOA 5FY7A 5FJHA 2OQ6A 4LIVA 4NUBA 5FPVA 2Q8CA 4BISA 5IVEA 5F39A 5IVVA 5CEHA 5FUPA 5FZBA 5FZMA 3ZLIA 3PURA 2OS2A 4DO0A 5FZOA 2XMLA 2YU2A 4QXCA 3RVHA 5FYTA 3PUAA 5IVFA 4UF0A 4E4HA 5A1FA 5E6HA 4AI9A 4IGOA 1VRBA 5IVCA 4ASKA 4Y33A 4CCLA 5FXVA 5A3TA 5FPUA 4C8DA 5FY4A 4TN7A 5FZFA 5F2WA 5A3PA 3K2OA 4AAPA 5FZAA 5F3IA 4Y3OA 2Q8EA 3KV9A 5IVYA 4V2VA 4EZ4A 2YPDA 5IWFA 5FZ4A 5FP8A 5FYZA 4D6SA 5F3EA 4EZHA 5FYVA 5A1LA 5IVJA 5FZCA 3DXUA 4QXHA 5FPLA 5FZ6A 3AVSA 5FP4A 3AL6A 5FY8A 2PXJA 3U4SA 3AL5A 4Y4RA 5F5CA 5FV3A 5FY5A 4URAA 3KV4A 3U78A 3NJYA 2VD7A 5F37A 4XDPA 3PTRB 4QX8A 5FP3A 3LDBA 5LY2A 5FYIA 5A7WB 5FZ1A 2WWUA 2OX0A 5F32A 2P5BA 5ANQA 5A3NA 3PUQA 5FYUA 3PU3A 3K3OA 3KV5A 3N9NA 4LITA 5A7OA 5FWJA 5FXWA 2YBKA 5FY9A 4CCKA 5FJKA 4BXFA 2OQ7A 4GJYA 4LXLA 4QU1A 4V2WA
chains in the Genus database with same CATH superfamily
1ZBE1 1JYXA 3M70A 4KGGA 2VMIA 1PO11 3HN3A 3EJKA 4PIXA 1GWMA 2WZR1 2UWCA 1W9TA 1J3QA 2DUPA 3OOXA 3UL2A 1DYPA 1YFWA 4YG3A 1DQ5A 3MIGA 1F8VA 4CDQA 4CXWA 5FZIA 3WDXA 2E6VA 4XHBA 5K4LA 3WG1A 3KCYA 1SBEA 2XB6C 1TME2 2R043 4Q5OA 2W91A 3FFQA 1C3HA 2ILMA 3PVNA 1APNA 1PNGA 2YBPA 4DB5A 2P2KA 3SCGA 1IKPA 5ABJB 1JS9A 2DVAA 2HBUA 3W5MA 1D4M2 4CCEA 4QGMA 4AK3A 2WRAA 4I3PA 4IERA 4YVSA 1AF9A 4GMP0 4QPYA 3VDCA 4HSJA 3ACGA 3WUDA 2UYAA 2W68A 4AGGA 4QB2A 4GH4B 1VRH2 1XU2A 1ND2B 2CWMA 2DVGA 1I9RA 1AR72 3TN91 4TLGA 1NZCA 2QCSB 2WZEA 4BLJA 5JLVA 1AL22 1WGPA 5FZKA 1MACA 3ZYIB 4ZKTB 1LR5A 3DV8A 4EN0A 1NCQC 4GULA 3ZLIA 2JG8C 4GB31 2CNAA 2OS2A 3TNQA 3USSA 1CVNA 1LTEA 1G9FA 4MH0E 1YJLA 3HMYA 3UKNA 2QDRA 5DAPA 4AI9A 2CAUA 3H7JA 1H30A 4XETA 3R05A 3HNBM 5FKBA 3FBMA 2AYHA 4SLIA 4UFMA 3NV1A 3J7MA 4X8NA 2LALA 1N1TA 1NYWA 4LULA 3AYCA 4A4AA 2ARXA 2GH2A 1XE0A 2WINB 3CJIA 2OW4A 1FMD2 2B8MA 1PO23 1RHI3 5B4XA 3PTYA 2GAUA 1W0OA 4NHXA 4J1WA 1IPJA 3ATGA 1SMVA 3MGUA 4YM2A 1IPKA 5FZ6A 3WY6A 5K9YA 1M06G 3PJQA 5J37A 4UFIA 5CA6A 1AX1A 3DPRA 5CFCC 4AHZA 3OBAA 3WNOA 4QM9A 4BJ0A 5IK7A 3T0DA 2EF6A 4AEJA 1SDWA 1WD3A 5T5JA 2MEV3 1PGL2 5LY2A 3VD9A 4Y22B 3BTAA 1U5ZA 4GQ7A 3G6JB 4RQPA 3VBHB 1T2XA 3IIAA 4V1PA 3VD5A 4GB32 1PO21 2ZZJA 1EV13 1QJX3 4R52A 3ILRA 5JPNB 3CMGA 4UW6A 3D8CA 5JWPA 4GXLA 4GWMA 1CJPA 4YW5A 1X9PA 2OQ7A 5FY7A 5JZGA 1YFYA 2VBDA 3AP4A 4LKDA 1DGRN 5FLHA 1GNYA 4Y5TA 2RG4A 4NHMA 1HW5A 1LRHA 3NNLA 4K6BA 4ZZ8A 1F5JA 3EXUA 4JQRA 1RUH3 1OA3A 4IV3A 3F95A 2GN3A 1D4M1 1KS5A 1CIYA 2HWE1 5DAWA 3WDWA 2LRPA 1QJFA 5JI7A 4D6QA 3ME2A 2P1BA 1H2LA 1NXD1 4NAMA 1AYN2 3VLBB 3J8F3 3ORJA 1WMEA 2QQLA 5ISLA 2C6SA 4W8JA 1V6JA 2GALA 3WR0A 4QPGA 2UY8A 5BNNB 1C1FA 1K5JA 3INAA 1F4AA 4XMAA 3ZIXA 1SFNA 5CFCB 2JG8B 3N9PA 2WKKA 4N7UA 1XNAA 1NCQB 5AFBA 2ZMNA 1EP0A 4X6QB 4YRDA 5C5TA 3FBYA 3N9OA 4JGZB 4JV4A 3AZZA 4ITCA 1RUC3 3IB3A 2PTMA 2J1SA 2VZPA 4CTEA 3O1TA 4PLNA 3J9SA 4OZOA 4KU8A 4RS5C 3AFKA 1X9TA 2R073 5E16A 3U07A 2YBSA 3PVBB 1COV2 4LHNA 1A34A 4Y1UA 5D8AC 3WP6A 2LS6A 4EN6B 4TSVA 3FLPA 1VBD3 3LDKA 5DUWA 2WYSA 4EWDA 2VGDA 1PZ9A 1YCIA 4MG2A 1D4VB 1LHWA 1LU1A 5A3OA 3KD4A 4QXCA 3RVHA 5FYTA 1ZRIA 4YYOA 5HPOA 1JZ3A 3JCIA 4UF0A 5ABJC 2BVVA 2QVSB 3JBG2 4IGOA 3ZOIA 3TWIA 2V09A 3PJYA 1KXGA 1CQ9A 4K1YA 4MXVA 1W6OB 4BE3A 4P08A 3JBG1 4CUAA 3U1XA 4DEVA 1QOTA 2JDMA 4ET7A 4ZPIA 1PHMA 2PYTA 4V2VA 1N1SA 3JB4C 3SITA 2G4IA 3SKVA 1UU5A 4K3UA 2W94A 3H3ZA 4HXCA 5FP8A 4ASLA 2XJTA 1JZ6A 4E9KA 2QQPA 1ASJ3 4QX1A 5C9AC 3B93A 4D3WA 3AMNA 2JDPA 2ZXQA 2QE3A 1RYYA 3QACA 1FV2A 2NYYA 4HBNA 1G9CA 1KEXA 1Q3EA 4A6OA 2A70A 1E5RA 1JOJA 5HXVA 3LEIA 2JICA 1DHKB 1CAXB 1SFYA 1UYZA 3AL5A 3JB8A 4Y4RA 1NCRC 1LGNA 1MS0A 5FY5A 1WCQA 3GZEA 3MFCA 1O91A 1JYIA 3WNMA 3K4ZA 5C33A 5CISA 4N7IA 2RS11 1UOBA 1W99A 2JKXA 4QHBA 1VBA1 4OI0A 1DFQA 2Q1ZB 4M0HA 2BW8A 2WFF3 4RGKA 3T4VA 1XRUA 1S0JA 3GZAA 4JGYC 1GANA 4I09A 2ET1A 1YXWA 1JOBA 2BNNA 3OCPA 2BZDA 4XJAA 3VBSB 4DEQA 4FBFA 3OUHA 3H8XA 1H1MA 4QU1A 4KGQA 4V2WA 2W0XA 2V73A 4XIKA 3VHRA 2DCJA 4BQYA 4DRVA 2W39A 3M8LA 4LIUA 2VCBA 1TME3 4LHKA 4A41A 4Y24A 1LESA 1Z0HA 1AR81 3O0WA 3PIGA 4JRAA 1RUOA 3I2JA 3KVBA 5FPXA 5GLTA 2WC2A 2VMFA 5FYBA 3WNKA 5HCBA 2E33A 3P5BA 2VCCA 2A73B 2NM1A 3AYDA 5HBAA 1BJQA 2Y34A 2VOKA 2XJPA 5IFPA 1UMHA 1AR73 1ULPA 2Q8DA 3AXDA 1XQNA 2PHWA 4BQ1A 3PUSA 2ADEA 3VBOB 3ZKYA 3H8RA 4RS5B 3TYJA 2MPFA 1RUJ2 1W9SA 4Y22A 3OUIA 1W6OA 5DZFA 5APAA 3K4DA 4K1ZA 3QLQA 4YG6A 1S1AA 1TQ5A 4CDXB 4L0PA 2VR4A 4W50A 4DXRA 1CPMA 2SBAA 2WNVC 4TWTA 1Z7S1 1O3QA 4ZS2A 3F2ZA 1DZRA 3ZN4A 3CJIC 4PI0A 4FPCA 2IWGB 4YM0A 2Q1FA 3VZMA 1BQPA 5JXGA 4XDOA 5C8CB 1VBE2 2XJSA 3HQRA 2W92A 4FCAA 3ZPOA 3WINE 1YEWA 1HLCA 3WW1A 3HT2A 5FBZA 4CXYA 1SFPA 4PQQA 3ST7A 5T5OA 4FVVA 3T4HB 1PO22 4JC1A 4P9LA 2VVDA 5ABJA 5FPZA 1FMD1 1YI7A 4QHZA 2WQ8A 1Y9QA 3GGLA 2VNRA 2HEVF 4QB6A 1POV3 3DF0A 4IEYA 1BK0A 5FUIA 4QPIA 1SPPB 2XVGA 3M3IA 3OGJA 2H0BA 1DYKA 5I0UA 5ACA2 4QKDA 1VBD1 3FLTA 5E6HA 4P9WA 4RSUA 4LHLA 1NCQA 4CU7A 4AQTA 1RHI2 4JKLA 4JTNA 4R4ZA 5HXMA 1J3PA 2XBO1 2CSGA 3ZX7A 2BFUS 1KJLA 2WFF2 4KWUA 4QPGB 4W4ZA 5HCAA 2EVXA 5BXXA 3TEWA 4XBQA 1N1VA 2GC2A 1R091 4WM7B 4CEYB 4XFHA 1WLWA 2BNMA 5I0RA 1JBCA 5IYYA 1OI6A 5JOZA 1QWRA 4IEZA 4N53B 2A6VA 3ILFA 4CDUC 4DPNA 4H2AA 5F9TA 1TZOA 2VMDA 5HCFA 4FTEA 3BKZA 2WNUB 2Q1MA 1KS4A 3I2HA 1UY0A 1XSRA 5FFOC 3ZSLA 4ONUA 2VOXA 1AL21 2VMHA 3C2UA 4N53A 1WUVA 1NXMA 3U14A 2O0OA 2WNOA 5BV6A 5F5CA 3KZ4C 1DU3D 2CTVA 1GP6A 1IZ3A 3HOBA 1V6NA 4M00A 2HWE2 5F37A 3J8F1 3PTRB 4INDA 4EN9B 2J1RA 3WP3A 3VZNA 3WW3A 4CXXA 2R6QA 3FUQA 3VZOA 1EUUA 5F32A 4PDWB 3SNMA 5J09A 1DZQA 1MVQA 4KNCA 5EHDA 2D3PA 3MIDA 4FFFA 3ZXFA 2ZX0A 3WF4A 3E5XA 2DWRA 1QJZA 1S0CA 3MIHA 1W04A 4LKFA 1WD4A 3A21A 4BDVB 2FD8A 3MICA 1OKOA 3ACHA 4FO9A 1VAMA 2WO7A 1HV0A 1AYN3 2RMU3 2Z5WA 5LA2A 2BUKA 3BIEA 3MIBA 4Q4W1 4QB1A 4D6RA 2RS33 3GCXA 4XHXA 2XJUA 1RUC2 2VMCA 2VW1A 4AEKA 5FYYA 4WM7C 1F35A 1O6UA 1SEFA 2QBXA 4N90A 2ZX4A 5A3WA 3RWKX 4YNIA 5A80A 3B69A 4JDOA 5DDJ2 2O8OA 3MIEA 1O3TA 1LOGA 4O9GA 5KXDA 4FAGA 1JZ5A 2ARCA 4UBHA 5A33B 2W52A 4XJ8A 4P9IA 2XKPA 2J42A 2KR2A 5AC91 1YQCA 3BGAA 2A1XA 3CL1A 1HKDA 3IDEA 1HXS3 1VBA2 2OT7A 5FKCA 2R062 5JSPA 1E5SA 1PM4A 2IC1A 4Q4V2 3POEA 4JRLA 1YQ6A 1TG7A 1WMFA 2WYFA 2ZGNA 2VUJA 2WZR2 2QNKA 3RZLA 1XNDA 4BLIA 5K7PA 4R9AA 4UFHA 3EQEA 2F4LA 4QM8A 4W65A 3RI9A 1C4RA 1KDMA 5F8PA 4NIAA 2X5IC 4CUGA 1YFUA 2LM3A 1UY1A 2RMU1 2YYOA 2Q8CA 5FO7B 1ASJ2 1ND2A 1YLLA 4JGYA 5DN2A 4DNYA 4XFBA 1C57A 1OSGA 1U5XA 2WNUA 3DUIA 4A45A 5KXCA 4FPFA 3E6DA 3ZN6A 1ZA7A 1WWYA 3VBSA 1IGOA 3OYWB 1OXCA 5T54A 4XUTA 4XZPA 3ALQA 1I6XA 1AR71 2QQKA 3TN92 1OPMA 5CBLA 1H2MA 4H7MA 2C24A 4LBJA 3U37A 5FQ0A 2HH9A 2WLQA 4OQ9A 4BB3A 1NLQA 3ZKUA 1OA4A 4CCDA 2DVDA 3WG4A 3ZN5A 2JDNA 1I5ZA 2XWJB 1FNYA 2R30A 4JQTA 4QX2A 1S0GA 4K21A 3UV9A 5CKNA 1NX9A 4BWOA 3AKPA 4NPMA 2BBAA 3VZLA 3WX5A 5JCTA 4QKFA 1WKYA 1BBT1 1UW8A 2VY0A 4DZGA 1JUHA 3ZSMA 2JECA 2JDHA 1H2NA 3BIWE 4FPEA 3POIA 4DMIA 1AHSA 2Y0IA 5DUUA 1PIV3 4FOYA 3I3MA 3OBRA 3CDZB 1NUKA 2J1EA 5CG9A 4DQAA 1OOPA 4Q2FA 1XYOA 2XOMA 1AR92 4LA3A 4QXKA 2HWC3 4URAA 1DGLA 3NL1A 4URTA 3WF2A 5G05L 4MADA 1CZSA 4IV1C 4QX8A 1RJ8A 3CZUA 3T2PA 2OXBA 2OX0A 3AMHA 4GH4C 2HWD1 4LLFA 2HYKA 2JDUA 3NV3A 5JIAA 5LB6A 1W0PA 1Q8PA 4YW2A 4AFBA 4XYXA 5KC5A 3MLJA 5L9VA 4ORFA 1FPN1 1NLSA 1QEXA 4NPLA 1VAVA 2AREA 5I8SA 3VDBA 4W6WA 3THCA 3LFIA 4M3CE 1GWLA 3I2FA 2NMNA 1BLZA 1SLBA 4BHPA 4BZ4A 1AXKA 3CLPA 1HJFA 2WDBA 5F5AA 3WLUA 4CSWA 1TNFA 1W9WA 3HIFA 5A32A 1SG3A 4XFGA 5CU1A 4CU9A 4OLLA 4XJWA 3KB5A 3AZWA 3NVCA 4B7KA 4I3GA 3I49A 4XF9A 4ZU4A 1H9PA 4I30A 1MS4A 1UIKA 1PK6B 2WWSA 3WEZA 4COVA 3TEYA 4PLOA 2PAEA 1P8JA 4B3NA 3VDDA 1DF0A 4Q0VA 1PVC2 3VBUC 1WW7A 4P5HA 2FHRA 4YARA 1Y4WA 4Q0SA 3I2GA 3OG2A 4M3CF 4ES9A 4BK4A 4HPKA 1HRV1 1JHJA 4XW3A 4C91A 1GOHA 2FBEA 1OVSA 2A7AA 1RUI1 5EWSA 2Y6HA 5EPAA 3ITQA 2ZGKA 4LUMA 2B42B 1W3VA 2CWSA 5FZ0A 2DVFA 3K4AA 2ZX2A 1XJAA 1PX3A 1PMIA 4RR3B 1AUYA 4C90A 4GKXA 3GZUC 3K48A 2PHFA 2GNBA 2RJKA 3L2HA 4QDRA 5FWEA 2ATFA 5E88A 2RDRA 1MZ6A 3RFRA 3ZFEB 2O1QA 1PVXA 1WCDJ 2WS93 1BMV2 1POV1 5IVBA 5C5UA 2DTYA 1QY4A 5HV4A 2VXRA 5D8AA 3D5OA 4LR4A 1OURA 2RM22 2EAKA 3FUOA 1ZBE3 5CZKA 2R042 3SH4A 2XQRA 3VBOA 5DZGA 1ENSA 2WNUC 1GFF2 1ZNPA 2HEYF 4OUSA 4QPWA 4BH9A 1OUXA 2JD4A 2JDYA 3AMPA 4NHLA 3VN4A 1A8DA 1YC61 4D69A 1XU1A 4C8DA 2HWE3 5FZFA 4RQPB 2V4VA 4AAPA 4ZHNA 2O14A 5GLWA 5IK4A 4BQXA 4HVOA 5JXJA 5T50A 1RTVA 1ODMA 5L73A 1QQP3 2N7GA 1PGW1 5FZ4A 1ASJ1 1ZZ7A 1RUF3 5F3EA 3OEAA 4CP9A 2LW8A 4LE4A 4UW3A 5A1LA 3WCRA 4QU2A 4K20A 5FLJA 5G04L 4ZY9A 1RUG2 2A75A 3H8OA 1YHFA 4UI9L 4Z92B 3WW4A 3ZYBA 2FCVA 3GCWA 1EV11 1FNZA 2D93A 4YW6A 5IAVA 4YW1A 2IXJA 5FMBA 5C4WB 1EYBA 2ADDA 3KWVA 1US3A 4Y5Z0 4KU7A 5JAXA 1U5YA 5K0UA 1E5IA 3VB9A 1UKGA 3GJAA 3CHXA 2WS91 4RN5A 5CVRA 4CP0A 3I4IA 4JAAA 2JG9C 3PU3A 1W2AX 2UURA 3N9NA 2FDJA 1GZWB 1GKBA 2VL4A 2FDIA 4FTSA 1XE8A 2P3KA 4WVMA 5GZDA 1R081 1X36A 2GNDA 3HAGA 1IS4A 2ET7A 1AL0G 1FV3A 1AYM1 3U10A 3I59B 4YVWA 3QD6A 3ENRA 3ZYPA 3ZM8A 4IEOA 4XUNA 4I0WB 4N43A 2YC0A 2XHKA 2GP3A 2XL7A 4LO4B 4M4RA 3AP9A 4QWNA 5BPXA 4XZUG 2WT1A 3DPRB 5IT6A 2RR12 3N7MA 4TXWA 5CFDA 5FP9A 5A6XA 2BGPA 5BNPC 5FXXA 2E31A 3RZGA 1V6MA 1YJKA 2LTNA 2IFRA 2G19A 4L97A 5EJ1B 5F5IA 3SC7X 1LEDA 3MO4A 3QH7A 1NE6A 2WAAA 5FZEA 4META 2Y6JA 3U75A 3KMHA 2G9ZA 3IDAA 1U5IA 4IXLA 3KVAA 3LSDA 1ZBE2 1WBFA 2P17A 2HWF2 2A3XA 3V56A 2X05A 4LQRA 2WLPA 1J1LA 1QDOA 2EIGA 4RHV2 4CEWB 5A7QA 1CAUA 1LHUA 1QJX2 4N8MA 4EWAA 1IHMA 1SACA 1H4HA 5FREA 1IQDC 1NA1C 5A7PA 1L7RA 2NP0A 2UU8A 2YPJA 1OH3A 1YI9A 4AQSA 4XILA 5BYNA 3POYA 1UU6A 2EA7A 5JR7B 4CDXC 4YW4A 3ZXKA 3DL3A 1UMIA 4SBVA 5FZLA 3WF3A 3M7AA 4MHUA 1W6MA 3SLIA 1DQ4A 1N1YA 1BVVA 3DKQA 1FPN2 1K45A 3GHNA 3NJXA 1UZZA 4HVRA 3AP6A 4IQPA 4HOOA 4RQPC 2FCTA 4B4QA 2VZQA 4XDQA 3KCCA 3N7JA 2A6ZA 2GNTA 4RL7A 5CKQA 1QJEA 4QHOA 1NLRA 4PCRA 2HWD2 1CPNA 1N3QA 5FZMA 4CUBA 2DCTA 5BNNA 3IT8A 1J59A 1HB3A 1Q8OA 1MR5A 2DUOA 2DU1A 3FJSA 4CCCA 3MI8A 1G9BA 1SLCA 2XBO2 3MV01 4LK6A 3IWZA 1JMUB 4LTAA 2C4XA 2NPIA 5A3TA 1VR3A 2YC4A 3LQCA 3POFA 4W6YA 1J3RA 1RVF2 3R4DB 2R16A 3MW3A 1AR83 2VW2A 3KGLA 2BV4A 1W8ZA 5EQUA 2BFUL 5DABA 5BNQA 5JPMB 1W8TA 2JIJA 1MS1A 3B9IA 4D6SA 3AYEA 5H9SA 3FFZA 4HETA 3APBA 4KWKA 3T09A 5JMOA 3WVJA 5IVJA 3S7EA 4I2OA 1PMJX 2EXJA 5BUVA 2EALA 3D82A 5LEKA 3LDRA 5JIUA 2CYFA 1RUF1 1HN0A 1OF3A 3IN9A 4IW3A 2VOWA 4K8RB 4E4ZA 5C71A 1WW5A 1H6YA 2PHUA 1E57A 2YUEA 3U78A 4RGGA 4HVQA 1Z7S2 4UBGA 1COV3 4GALA 5FP3A 2JB8A 2RV9A 1QXJA 4YSFA 4CP9B 2CV6A 1OQEA 1BVP1 2ZGTA 5IK5A 4X8PA 2OZ6A 4A44A 2AEZA 2CL2A 3FHIB 1HXS1 1CZTA 3OUJA 3H0OA 4IEUA 4MZUA 2IXHA 3SCFA 2RDNA 4IUGA 1MEC3 4Q26A 3S57A 2AUYA 2ZS6B 4Y26A 3NNMA 2XONA 5FZHA 3OD4A 4COWA 4HZFA 4Y1YA 2VMEA 4CEWC 4PBOA 4Q4Y1 5CG8A 4WVZA 1WMXA 3J4UH 4S2GA 4AFCA 3ZO0B 2ZHMA 1KD7A 4BQ4A 2XWBB 1I3HA 3UYJA 2WO2A 5JZGB 1GU3A 4EN8B 1VIWB 4JDMA 4EYUA 4AL9A 4KG0A 2W87A 4AEDA 4IDZA 4O9EA 3HNMA 3MW4A 5FBJA 4CCOA 5FPAA 2ZHNA 1O4TA 3O1SA 4BK5A 4FFIA 2PHLA 1RUI3 3PNAA 4PDWC 5FY0A 3R6SA 3WDUA 3ZFGC 3WNLA 4YZ4A 2AR6A 1VE0A 1DGWA 1SLLA 2WT0A 4AI3A 1BBT2 1QH7A 3MEPA 4Y1VA 1ENQA 1T6BX 3LFMA 2ZX3A 1YWKA 3O0XA 1UOGA 2W5FA 4CDUA 1X8EA 5LWBA 2Z79A 1CAVB 1FAYA 3QH6A 3NKGA 4KWLA 4Q4W2 3PHMA 3ZXDA 1AX2A 2G9FA 4DUXA 1GV9A 5T5LA 2JG9B 4LPLA 1PMHX 4JX0A 5FYCA 4GB33 1FYUA 1SBDA 1VBB2 4YVSB 1OFNA 1ZM1A 4IGPA 1NCRB 3HD8B 2BOJA 3CIHA 1UD1A 2GU9A 1QHDA 2ZHKA 1DDLA 4IEVA 3EBRA 3JUUA 5FPVA 5LBCA 1G9AA 5F39A 5CEHA 2QQVA 2FQPA 2J7MA 3AJYA 5FR3A 3TEZA 1Y9MA 5DUVA 1MEC1 3T0AA 4YPJA 1QJY2 1LODA 4ZZ5A 4HG6B 2JDZA 5I0DA 5IHRA 1RUG3 4Z82A 3E6CC 3DPRC 3FN9A 3PVEA 3THDA 5I0SA 3WUCA 5BNOC 1PNFA 1W8HA 2A6WA 4L2NA 3HJRA 1JU4A 2DFCA 2FCUA 4XFCA 3HQXA 3R0RA 3KQ4B 1DZTA 2WBKA 2HEWF 1OC1A 3WD5A 1S4CA 2B46X 1H1IA 1NE4A 5IVYA 5GZFA 3SHRA 1RMU1 5C3OA 1K5MB 1VBE3 4DUWA 2VVEA 3VL9A 3ZPYA 1M4WA 3K51A 3ZN6B 2X29A 1GLHA 2Y8KA 3SH5A 2H0VA 4FP3A 2Q5TA 3KF3A 3DXUA 3J7HA 3P3NA 4MXWB 5E89A 3B02A 1OD3A 3AFGA 3AVSA 3CJIB 3LPFA 5FPLA 3AZVA 4YZ5A 1QNYA 3AL6A 4AI8A 2W08A 4XUQA 2K9ZA 2XGXA 1UPSA 5DUXA 2XKOA 1TEIA 2BERA 1UZ0A 2P3JA 4CP2A 3B7MA 3BU0A 3LA7A 3W5NA 1RXFA 2RJ2A 4D7SA 1Y3TA 1V6LA 3NWKA 2J22A 2GMMA 3AC0A 1BCXA 1DIWA 3MBWA 4RR3C 4YFZA 1RB8G 1PO13 2QUOA 4Q8LA 3KV5A 5T52A 5GM0A 4YGCA 1IS5A 1G7YA 2JDKA 3J7NA 2P3IA 2RS31 3E5QA 1WCSA 2VBBA 3QOPA 4AZZA 1VMJA 3PUIA 4U2AA 5LBBA 2D97A 2RS13 1DP0A 4BM8A 4Y20A 4XCAA 5C70A 4Y4YA 5DG2A 3O0VA 4OMCA 2P34A 4Q1RA 5F3CA 5LK5A 1RUC1 2VNVA 2ZBJA 1Y7BA 3FC0A 3AKQA 2D43A 4NMIA 1H8TA 5I8YA 3N9MA 3OGVA 4LBQA 3N36A 4FP2A 1A78A 4XUPA 5C8CA 2RJLA 4H55A 2BTVC 5JUVA 3ZFFC 3LD8A 1UL9A 3HNYM 1XPWA 2XVKA 3OGGA 2G1MA 4UAPA 2I45A 4XAAA 4Z07A 4LORA 1ALYA 1C8M2 2H6BA 1EAH2 3N4MA 3KF5A 1NG0A 4CCJA 3RPQA 5F6KA 3VZKA 3RZKA 4XTPA 2CU5A 2WWJA 3LOBA 4XQDA 1J83A 4Y1XA 4QKBA 2WFF1 4QT6A 1ND3A 2IFWA 1SCRA 1RUE1 1S0DA 4WBBA 2CHHA 2D7FA 1SLAA 4HMZA 5GLUA 1AR91 3KGZA 1DCSA 1WZXA 3H8UA 5AFEA 5H9PA 1W05A 4OVEA 4RFT0 5HCHA 1ZRCA 3I2DA 5FLIA 4PF1A 3OPTA 3T1MA 2EIEA 1UQXA 3WOGA 3TB0A 2BWAA 5LASA 2J1TA 4QQLA 4Z1VA 4GWIA 1MPXA 3GHMA 4IEPA 5DDJ3 3J7LA 3JQWA 1IG3A 2X5IA 4COYA 4AFMA 1B35C 3PUAA 3ZFGB 5A3MA 1D0GA 2ZTNA 1S2KA 1V9U3 2VCMA 2VZSA 1JODA 2CDOA 4K7JA 1H6XA 1XE7A 1FMD3 4XXAA 5FXVA 4XF4A 4TN7A 3RJ2X 3K2OA 2D40A 5CNAA 5FZAA 4Q4V3 1R1A3 1J84A 3ZYGA 2VNGA 2Y6LA 1V70A 4J1XA 2AGSA 4HK9A 4AFDA 1D0HA 5CAZA 1CX4A 5KHGA 4PF5A 4EZHA 4Q0QA 1HRI1 3VKNA 3N7LA 2ZKNA 4PDWA 4F3JA 2ZGPA 3VV1A 3KQRA 3CBNA 1YYNA 2G9GA 4JTOA 3AKRA 1VBE1 2VECA 3MHZA 5FP4A 5LRRA 2HKXA 1W28A 1JTZX 3RGBA 3UESA 1NAEA 4FT8A 4M0NA 2TUNA 2JDAA 4GMP3 5FOBB 1NZIA 4MUVA 4NE9A 2VD7A 1LECA 3O1PA 4XPVA 4QMAA 3LDBA 1NT0A 4O61A 4G4FA 3A0KA 4Z2AA 3MF6A 3BTZA 5ANQA 4NIGA 2B7YA 2VOTA 2WSUA 4ARXA 4IEWA 4I0BA 2AH2A 3JXSA 1CONA 2PHDA 3UKTA 5DAXA 4HSLA 4MGQA 1RUH2 2V5DA 3RNSA 3SXWA 1GQPA 3Q8AA 4F7ZA 3UT0A 2A3WA 2IVIB 2Z42A 3CZJA 5EIYB 3TN93 3FX3A 3WV6A 3ILNA 1AZDA 3ZSJA 5ACA3 3VKFC 2I2SA 4MGYE 2A3YA 2D6KA 1POQA 3HVDA 1H8VA 2W1QA 5FYHA 3DXTA 5K0UC 3DYPA 3BPSA 1OLQA 1GP5A 2W2IA 1Q8QA 1AR63 1O59A 1PK6C 2PAMA 3N9LA 4MGKE 4WV8A 2RR11 4MX3A 5M0TA 5FRAA 4JKMA 4Q29A 2C0ZA 2Z4FA 4PQ9A 3VBFB 1BKZA 2YV8A 3JD72 1MZFA 4PT6A 4HK8A 1IOAA 1Q8SA 5JOYA 1W9YA 1AYM2 3HEIA 1W0NA 2XPJA 4XAEA 3K77A 1IS3A 2WN2A 1UOJA 1V9U2 2HWC1 4CDWB 5BY5A 4TZDA 1KDKA 1V00A 1VBB3 4OI1A 1XYNA 1OH4A 1DQ1A 4QQHA 1W8NA 2W95A 5AVAA 3RZMA 3TNPB 3M2MA 1XOYA 4YLZA 3UJOA 1QKQA 3WP4A 4FPHA 3OYWA 3RG0A 1YQ8A 3V0BA 4IV3C 2Y6KA 2R0FA 1JI6A 3O7OA 3RYRA 4QXBA 3T30A 3WDYA 4LKEA 3HR9A 2Z69A 1FOD2 4LEJA 4YGEA 2FDKA 2QQMA 4BIFA 1VRH3 2Q0AA 5FZGA 2F17A 4KG8A 1RUG1 1V0AA 1HRI2 1ZZCA 2GH8A 1GQHA 3S7IA 4NUBA 1K12A 3HT1A 4AEDB 1AL23 2Y26A 3C7OA 2E32A 3WHTA 1AX0A 3IPVA 4HN1A 5FZOA 4B1LA 1W6PA 2RMU2 5BNNC 2ZEYA 3O1OA 3POJA 4LBKA 1AXZA 4AQ2A 4CPBD 1WA6X 4PBPA 2JE8A 4DRRA 3KHCA 3RJRA 3QCWA 1QQP1 4NR1A 5IVCA 2R0HA 2B4KA 4CCLA 1QH6A 4AOCA 1RHI1 3M3QA 1VP6A 5CFCA 2GC1A 2DF7A 3VD7A 4L99A 4XCBA 5F3IA 2ZMKA 5KHHA 2BOIA 4UOJA 3V64A 2R061 3ZMOA 1HDKA 4AE2A 2AENA 1VB2A 2R041 2VUDA 2UYBA 4R4XA 2JJ6A 1W3XA 2JB4A 3ZFEC 1UXZA 4QX5A 2PELA 3LEGA 5C8WA 2D3SA 3NSTA 1ZYBA 5J1XA 4UXAA 5JI9A 3KM5A 3U0ZA 3I54A 4FFHA 2VAUA 5A6ZA 3ROUA 1GNZA 3WG3A 1NA1A 3E5UA 4PLMA 4IV3B 4K9SA 1UPIA 5J7MA 2WN3A 5KHKA 5FY8A 4BQ5A 2C26A 2E51A 1BEV1 2QQUA 1ZX5A 1JN2P 3BALA 3T08A 3WNPA 2WZR3 3UGGA 5CFDC 3VDDC 4CDQC 2ZEZA 4UFLA 4HKOA 2XLGA 4XBNA 2AC1A 4XJ9A 3BTYA 3ETQA 4AI2A 4ZONA 1UMZA 4D7YA 3U4XA 4G9SB 2KXLA 3CF6E 4X6RB 2GMPA 1SCSA 1GSLA 2JX9A 1LOFC 3PMSA 4LITA 2R1DA 2P6HA 1CAWB 5FWJA 1US2A 2BWCA 2VXJA 1HQNA 3CJXA 3M3OA 4CZSA 2VTXA 2Z2SB 4E27A 1N3PA 2UY9A 2NQYA 4NRPA 2ZGSA 5FJKA 4BQ3A 2VMGA 3I7DA 3EYPA 2V72A 4HKWA 4CU6A 1GZCA 1PVC1 5FAXA 1UZVA 3ZXGA 2CGPA 1MS5A 5LCWL 4BU2A 3VKMA 3L2YA 3R4UA 4DS0A 4CVUA 2EXIA 5F1RA 1UNBA 2A6YA 3NMBA 2XUEA 3N7KA 1NY71 5T55A 1A6CA 4ASMB 1C8M3 1R64A 1W2NA 4QQ2A 4XQWA 3Q8EA 1RUD1 1HRI3 5A3LA 4GH4A 1OVPA 1UF2C 4OMDA 3C8XA 1VBC1 5GALA 3GBWA 1MS8A 3GALA 2WUHA 1DYOA 4MLOA 1KQRA 4N9IA 2BU9A 4NRQA 4NRMA 3BODA 5FMOS 4N43B 3USUB 2LROA 1TME1 4HT1T 2RDSA 5AC93 3NAPC 2W1UA 4FTBA 4FXGB 1YIPA 2V4AA 3ZYHA 1ZBA1 2VZOA 3GF6A 5C3PA 1GICA 2XUMA 1PZ7A 3IKWA 3WT3A 2NLRA 3I3EA 3H9AA 4JHTA 4AYUA 3SISA 5GJ6A 2D6LX 3KT4A 5ERLA 1QJU2 1VB4A 4XF0A 4YG0A 4AHYA 4DFSA 3ES1A 1WW6A 4S2HA 1LOCA 1HQWA 2UWAA 1LOFA 4W6XA 1BZWA 2W3JA 4S2FA 1D2SA 4NROA 2DCZA 4BPZA 4QX7A 5L19A 5FJHA 4EQVA 3IAPA 4NHYA 1YIFA 3SEEA 4LUKA 4Q8KA 5T3NA 4NPRA 4GZ9A 4AVVA 4NWWA 4RR3A 3OTFA 4NN0A 4PIZA 2XMLA 1B35A 2PAKA 1CAVA 1ULCA 1TVGA 1S0FA 2CAVA 5DQ0A 4G3YC 1TMF3 4E4HA 1UIJA 2VTXJ 2ZEWA 4P02B 4JCKA 4WM8A 2VNOA 2D6MA 3FL7A 1B35B 2PQQA 5J98B 2JIGA 4YFWA 3VL8A 5FPUA 1QOOA 2L9LA 1R1A1 4Y3OA 3C7EA 2IZWA 1L7QA 1RIRA 4BQ2A 4EZ4A 4BQWA 4MHRA 5IWFA 1OHFA 5FO9B 4E4SA 1REFA 5DG1A 5LEJA 3SKJE 2YMZA 2XH6A 3ZMNA 1JZ2A 3DYMA 1OQDA 3T3YA 1COV1 3FLRA 4LO7A 3H3LA 1GZWA 1MQTB 1CIWA 1DQ2A 1X82A 3ZDVA 1VALA 2HWD3 1O3RA 1LJ7A 5FV3A 2FZ2A 5JXIA 3GJBA 2I74A 4P5YA 2ZJCA 4HANA 1UYXA 2YZ4A 1DGWX 3AKTA 2P5BA 2OZJA 5FMDA 1LHVA 4A7YA 2FDFA 3AMQA 2ZEXA 4WZFA 1F4HA 1SLIA 4M3CB 4OCTA 4C0HA 1RGSA 1ZBA2 3OY8B 3P3PA 4YZ3A 4XABA 4A42A 4N9HA 5I8TA 3WCSA 1AR62 5FY9A 4QGNA 1REDA 2RM23 4FPJA 4LT5A 1MZEA 1WLDA 2HLEA 2XJQA 5EFUA 1HQLA 3WSOA 4GKYA 4D0QA 1AR61 5ANNA 2I07B 3CNAA 1RINA 1BYHA 2J1UA 3LCPA 1GP4A 4MOAA 4J25A 5HI0A 4OI4A 1W6QA 5FUPA 2Y6FA 2OVUA 3KHBA 3NAPB 4S2DA 1HX6A 1NKGA 1POV0 1RUD2 4IV1A 4FSJA 1U0AA 1W6MB 2OUJA 4AVCA 4YW7A 5EYXA 2ZGQA 2VZVA 3AYAA 1L3JA 1JHNA 1IPSA 3MFAA 4I01A 4OZXA 3H50A 1EAH1 4FAHA 1JH5A 2EICA 2VU9A 3IMNA 1C8M1 3ZSKA 1HXS2 3ZR5A 4EV0A 1RUH1 4HLTA 3AP5A 2BVBA 1VBC2 3IPVB 1AYN1 5FZOB 1I1EA 1HRV3 1TMF2 2DTWA 4WZCA 1RUE3 3N9QA 2D98A 4XF3A 5IFTA 4OQ8A 3PMEA 4FQZA 4Q4X2 1FXZA 2R1BA 3AKSA 3H1MA 4WM8B 1HN1A 5J96B 1JYWA 1ZVFA 4NOTA 3IAQA 2WT2A 2UWBA 3WG2A 1PGL1 1NA1B 1XNKA 3K75B 4XFIA 4AVAA 4WVVA 2X5IB 2X09A 3MLLA 4H3WA 4HN0A 4QAWA 4ZS3A 5FXZA 4CDWA 2WAOA 2Y0OA 4Q0PA 3VBHC 3LE0A 2DCKA 4RGAA 4MGTA 3O14A 3VDDB 4XURA 4CEYC 4FQ4A 2A5ZA 5KBFA 3WZ1A 5A6QA 1LOEA 3WNNA 1QDCA 3THTA 5KC6A 3JU9A 4IE7A 3SH3A 1CD3G 1BEV3 1KJRA 5LA9A 4LJHA 4O65A 4P9JA 1PGSA 3RWNA 1A3KA 3OD0A 4PI2A 2RHPA 2XQXA 3M4FA 1W03A 4KQ7A 4CPBA 1XSQA 4ASKA 2HJIA 4Y33A 2O8QA 1J58A 1JZ4A 1T6GC 1QJU1 3DEMA 3NNFA 1DGRA 3CO2A 4DY3A 1W8OA 5GZGA 1ZZ9A 2W1WA 4IETA 5FQ0B 2BRTA 4UFJA 4AR2A 2WSVA 2VQUA 4ISRA 4AFAA 5J3UA 1QU0A 1R083 4RA0A 1W8FA 2OPKA 2BQPA 2PHTA 2WO1A 3EB7A 3ES4A 4AVTA 3C7GA 4YVSC 4E2GA 2CDPA 4XE9A 4XC9A 1EUTA 4RHV3 5FYVA 3WQ0A 1MS9A 1W2TA 5EV7A 5LRSA 4PJYA 3LAGA 5FZCA 3A7QA 4UW4A 2WQZC 1LENA 1NQJA 1OF4A 3VBRB 1MVEA 5CIRA 2DVBA 2VJXA 2P4EA 2WFPA 1FOD1 2XL9A 1L7LA 4LBNA 3BPZA 3TBDA 4P14A 3VBUA 5K8SA 5T5PA 2ZGMA 4HPKB 5F5QA 2MEV1 5A7WB 1G86A 4AI1A 2DURA 3NO8A 3S0MA 2VUAA 3TAYA 1C28A 2B9VA 4RHV1 3MPBA 5L7OA 3BYWA 5L36A 3C7FA 1TMF1 1GWKA 1AXYA 1UXXX 4OFGA 1WA4A 2BP6A 3LOIA 4MSVA 3Q8BA 4GJYA 4LXLA 3TEXA 4IL7A 3FWEA 4OHZA 2QFEA 2RS32 2K2SA 4NO4A 5GZEA 2YDEA 3VZJA 2VUCA 2ZPXA 4HKLA 1CN1A 1F9KA 1JOPA 5FOJB 1R093 3VGIA 2GZWA 2ZHLA 5F6LB 1SQ4A 4NIIA 4BYYA 3KSCA 4CCMA 1QJU3 1Y43B 2VW0A 4XUOA 1AR82 3BU7A 3I2OA 4JGYB 5FYMA 1D7PM 3ZXEA 3I8TA 2VZTA 4GAZA 2VQ0A 4EJRA 2GN7A 5EXOA 5FYSA 3FHAA 3NW4A 2KM2A 1CWPA 1VMHA 4CE8A 3HWJA 3KT7A 2XHNA 3S30A 3AXEA 2QQIA 2ARAA 2PFWA 1GZTA 5FZ9A 1K42A 4LOTA 5EYYA 2JE7A 3ABZA 3ZSEA 2JD9A 4DOUA 3O1MA 1EY2A 4FOVA 4LHSA 4QD2A 2CGOA 2QQOA 2RS12 3IDBB 4BOWA 5B2GB 3N35A 3RMXA 4QX3A 5HV0A 5H9QA 2DYCA 5FZ8A 1RUJ3 3NKTA 4YGBA 1PO12 2Q30A 2D5FA 2R063 1DG6A 3R4SA 1S2BA 1UX6A 4XMIA 3THPA 4BXSV 1W6NA 3M1HA 4CDQB 2QQNA 1UOFA 4QPIC 3V0AB 5IK8A 1S2EA 3UETA 4JVAA 1PM7A 2QDNA 5A32B 4NIHA 4GMP1 3E6BA 4IV1B 4DUVA 4IESA 4OHVA 2B39A 1R1ZA 1O8PA 1GOGA 3BOWA 4LIVA 1C8NA 1SZBA 3VBFC 1W6QB 5A6YA 5IVEA 4B7EA 1Z78A 2EXHA 2XJRA 3AB0A 2E7TA 4AVSA 4CUCA 1V6IA 1UX7A 3BOPA 4DO0A 1B09A 1MS3A 2NN8A 2XG3A 1OOPC 1UYPA 2WJSA 2YU2A 1SHWB 4IEQA 3I2IA 5IVFA 1UCXA 3DECA 4ARYA 4KBBA 1Q43A 1VMFA 1EAH3 3ZYJB 5TSWA 2WNEA 1HIXA 3S6PA 3SQOA 1QGLA 2YFZA 2WQ4A 3IMMA 3WP5A 1RUF2 1RC6A 4A3XA 5DZEA 2DBNA 5KXEA 2C1FA 5FZDA 1D2QA 5I91A 2BDRA 1OT5A 5B4NA 2VZ1A 1LEMA 3IDCB 3BB6A 2WNVA 2TEPA 1H8TB 5JSRA 5KWRA 3AZYA 1FT9A 3ZXLA 2D6NA 2RM21 2ZABA 1CZVA 4AWDA 4EN7B 4AHWA 3WF1A 1H4GA 4Q27A 1W6NB 3D0JA 1SPPA 2BYVE 1EPZA 2Y38A 4C1WA 4K8FA 4H7LA 5H9RA 5JSOA 3FE5A 1VBB1 1QNWA 2W9XA 4AEDC 1OPOA 3NQHA 1X8MA 4L8QA 1YNAA 4FPYA 5GKAC 1QF3A 2BJSA 1RUD3 4EWEA 2WR9A 4ZU5A 1RUNA 1GMMA 2JE9A 1HB1A 4M01A 1ZRFA 1AR93 1PIV1 3DKWA 1XXNA 3NJVA 4L9BA 2FDGA 2DBIA 3VHOA 1W2OA 4D94A 5FYUA 1UN1A 1XB9A 3AJZA 3PVOA 2D44A 3N3HA 3ETPA 3GBGA 1BHGA 1MQTC 4MGZE 1BK1A 2EIBA 5JOWA 1N47A 4ATFA 4BXFA 2IXLA 2GSYA 4P00B 4YWAA 3IIIA 3G7DA 5D1IA 5FDBA 4TYSA 4BA6A 5JOXA 4EE2A 3M3CA 1RUE2 5E8AA 1TE1B 1UY4A 5A1AA 3VD3A 1OOPB 4J6GA 2Q4SA 2C5DA 4GD4A 1F31A 2E7QA 3HQUA 3PIJA 2HWF3 1VBC3 4KMQA 2BNOA 3C3VA 5IW0A 4OULA 2ERFA 3JQXA 1ZRRA 4AF9A 4MVTA 3P6BA 4U36A 2DFBA 4OUEA 2J1VA 2ZGLA 3RS6A 3A23A 5LW9A 2VCAA 2B45X 1OLMA 5IJRA 3ZR6A 2XDVA 4XEZA 3BTXA 4NAOA 1U12A 4AVBA 4QPIB 3B5LB 1NCRA 5FCCA 1LGCA 2RE9A 5EJ3A 3NV2A 5A7WA 1VLNA 1YO8A 1X7NA 2MNGA 4FOQA 3PDQA 3VKLA 1DLCA 1OUSA 1HV1A 3RI8A 4CEWA 2IXIA 2XLFA 1KFUL 3SEPA 2HWB1 4RYDA 3T1LA 1QMJA 2JENA 1KGYA 4IEXA 2BPA2 1V6KA 2R071 2XJVA 1W8UA 5FP7A 3POWA 4XJUA 1RVF1 2ID4A 4IE6A 3WNXA 2RS51 3CQOA 1BEV2 2WABA 2WL1A 4DIQA 1XNBA 4IE5A 1Q8VA 1PX4A 3NNJA 5C3QA 4D8MA 3HBKA 1CESA 3OGRA 1GR3A 3BVCA 2XR4A 5CYYA 2E53A 2QTWB 3OEBA 4NJ4A 5JVVA 4A3ZA 4BMEA 5IVVA 2WS92 4B29A 3PURA 3I59A 4YVWB 1PZ8A 1ZZ8A 3EO6A 2OUHA 1H2KA 4XFFA 5SV5A 2WZPP 2DU0A 3O1RA 2GC0A 1RMU2 1OFSA 1F2NA 1KFXL 1RVF3 2VTFA 2VC9A 2YG0A 2GDFA 1CR7A 1HB4A 2OYZA 3D3AA 1FI2A 4B4RA 1JYCA 2XVLA 2IXCA 2GNMA 3UK9A 1HB2A 3W9AA 4D7TA 1C5HA 1STMA 3ZXAC 1RL3A 2NMOA 5FY4A 2R32A 1AYM3 1E5HA 5L9BA 4COZA 1QQP2 1ZREA 2VZUA 1G8WA 2YPDA 4CRQA 5BNPB 2VM9A 1NQDA 5FYZA 4FPGA 2AACA 4GWNA 1W90A 1QJX1 3LEKA 1VAKA 1JZ7A 5EJZB 4QXHA 4R9DA 4XQ4A 1GYKA 3CKHA 3LEMA 3LSEA 2YGLA 3OY8A 4FI9A 2X8KA 1QXPA 2PXJA 1OD5A 1FOD3 2WZ8A 4KWJA 4WM7A 3B3QE 3VD4A 4Z8BA 5BNPA 1ULDA 1VRH1 4AXOA 5I93A 2X10A 5DMYA 1OBNA 4Y20B 1ENRA 1K5MC 4LO6B 5BNOA 1CX1A 3ZFFA 1LOBA 1VJ2A 2VULA 1MEC2 2WWUA 3ACFA 3MUZ1 2XLAA 1IS6A 2ZMLA 2SLIA 4I0AA 3H1WA 5GLZA 5A7OA 1IKQA 1V9U1 2BGOA 2HWC2 2ZAAA 1LB2A 3AM2A 3S5QA 3T0BA 3LA2A 4UW5A 3GZTB 1ODNA 1O4ZA 3VBHA 4HFSA 4ZXEA 1CAUB 1UO9A 1QXRA 4E8CA 5BNOB 2GMEA 4YM1A 3H1YA 4LOSA 3USUA 3JD71 2Y60A 4XXPA 4XJZA 2VPVA 3J26N 4PHZA 4Y5SA 1W9FA 2X53S 3DN7A 5KHIA 1DQ6A 3GXUA 1XNCA 1G9DA 4M4PA 1CGPA 1RUI2 3MPPG 2W47A 3U11A 2JG9A 2D6PA 3DGTA 3NRUA 3RMYA 2K46A 1SBFA 4CYDA 2B9UA 2FMYA 2OA2A 2PLV3 3FHQA 3O5SA 1OKQA 4GIQA 4KBZA 3K3NA 3LIHA 4XIOA 3VHPA 4UF0B 5C8CC 2F4PA 3H42B 1W06A 5F2SA 2ZCWA 3POGA 4YM3A 2VZ3A 4K40A 3ZYRA 1ZA4A 3KV6A 3LGRA 2HBTA 4AGVA 3D6EA 3WQ1A 2W46A 3DYOA 4Q4Y3 2YHJA 2E7AA 3EMRA 3AX4A 5FUNA 4CCNA 3D0SA 3ZXJA 3DCQA 5CADA 1CAWA 1ULGA 2WA4A 2J1AA 4LA2A 4YVWC 3UGFA 3WF0A 5I0TA 3HBZA 4XACA 3MLKA 3WQ7A 1W6PB 4OI2A 4AQ6A 1FPN3 1S0IA 3RZZA 2PMWB 2QZ2A 1QOSA 4XF1A 5A7SA 3W21A 3X29B 1QJY3 5C7GA 5FPBA 5JMCA 4FPOB 1J1TA 4F83A 2OQ6A 4AW7A 1JXNA 2JG8A 5IUQA 3OB8A 5A3UA 2YY1A 1RXGA 4ISQA 4Q0UA 1UY2A 3VUOA 2XBO3 3B9CA 2ZGRA 4B1MA 2VO5A 1N3OA 4N53C 4XFAA 4CDUB 3RYKA 5IAXA 3PUHA 3ON7A 4M3CA 2OKXA 3ZIWA 5A1FA 3V0BB 1VRBA 3OGSA 5LBFA 2ZGOA 4YGDA 1EPWA 4NVPA 4DXZA 4MV2A 3TOJA 5A3PA 1UZWA 4RS5A 2FMDA 3WW2A 3KV9A 3A22A 4IE0A 2ZA9A 4LBMA 4LKSA 3T2QA 2VOVA 3W58A 3OSDA 3S5AA 3KS7A 5J48A 1YQ2A 5FIXA 1BXHA 4P9XA 1YUDA 4A6SA 5JXHA 1BMV1 5K0UB 1JYTA 3RYPA 4RD7A 5C6CA 3I97A 5D2AA 1WLCA 1JZ8A 1WBLA 1O4YA 2B5HA 2ES3A 4UFKA 4E8DA 1WCKA 4LMFA 3NAPA 1ULOA 1Z7S3 4QGLA 1GQGA 3RDIA 3URFA 2DUQA 4RFRB 3NJYA 4TLFA 3Q8CA 1V6OA 4L11A 2PQSA 4Q4X1 4OHWA 5FYIA 5FZ1A 1LOAA 2GC3A 3PUQA 4R9CA 3K3OA 1RUJ1 4KH9A 1O7FA 2ENRA 4QQOA 3WXPA 2YBKA 3LWCA 3FMGA 2WA3A 5LATA 1S0BA 1ND3C 3UJQA 2TBVA 3LKJA 2HWF1 2ZOEB 3UNPA 4UWDA 1S55A 1QIQA 2XXZA 5LA0A 3KCXA 4WVWA 3OPWA 1X50A 3ELNA 5D21A 2BEOA 5DAVA 2E26A 1ONAA 2OIIA 2QQJA 2EAAA 1MQTA 1LHOA 2W1SA 3CU7A 4NHKA 2P37A 4UYBA 3V65A 5JDBA 1WLTA 4HONA 4DXTA 1WCUA 2VQTA 5L7OC 3WDTA 3ZYFA 2JWPA 5SV8A 5F3GA 3MUY1 2VBPA 1ST8A 1RJ7A 3ASIA 4LNVA 3GYDA 4JGZA 4F8AA 5D8AB 3PU8A 3ZDSA 4YZ1A 4HL0A 2PLV1 1ZZ6A 1OA2A 4QQPA 5KHJA 1GZ9A 1LHNA 2Y64A 4JHZA 2ETEA 4E2SA 3AP7A 3OBTA 3OF1A 3POSA 1XBFA 2VVFA 3LA3A 3KLSA 4OHYA 3I3DA 2DV9A 1GUIA 3P1IA 4AG4A 4DINB 2OPWA 1XYPA 4FFGA 1F15A 4OHXA 4JGZC 3NV4A 2R7EB 1RMU3 1PIV2 1Q5OA 5CKMA 2VH9A 3UGHA 4FPKA 5FZ3A 2P3YA 2WO3A 1BBT3 2YROA 3MIFA 3RRDA 5KXBA 1WMDA 3ZFEA 3FZ3A 1OLRA 3BUCA 2PN5A 4XTMA 3T2OA 3LIGA 1ZBA3 1H0BA 2ZKLA 1H9WA 3SMHA 2GP5A 1S0EA 4B8EA 4LK7A 2PHXA 5FK7A 2AZ5A 1OQ1A 2CGNA 3GBFA 4BISA 3PLQA 1ENXA 3Q8FA 1IQAA 5FTTC 2ORZA 4A7ZA 4E4DX 4LBOA 5E1RA 2NZ9A 4C1XA 2E63A 2DCYA 1URXA 1PGW2 2QKDA 1D4M3 4MGIE 1R1A2 1A8MA 1JUIA 1LU2A 5C9AB 3I2KA 1NOVA 3A0NA 4JKKA 4COUA 1VPHA 3CEWA 1W2UA 4NWVA 3T2TA 3UKVA 2H6CA 5EP9A 4AHXA 2PA7A 5L9RA 2FZ1A 3ZFFB 2ZZQA 1GBGA 2F6BA 2RDQA 5FK8A 5LK7B 5F2WA 1Q56A 2YFUA 4AEMA 4JDNA 3Q9OA 1SLTA 1AVBA 5C4WA 4Z2WA 5GLVA 4R9BA 2ORXA 5A33A 1LKNA 3I3BA 3QBQA 1AJKA 1LULA 1QJY1 3IM0A 4LO5B 1PVC3 3RSJA 2A71A 5GZCA 3HPNA 5AC92 3HN1A 1O8SA 1ULEA 3MV11 4BCUA 3BI3A 4GWJA 5CFDB 3LF7A 3LB9A 5C4WC 3RZJA 3VHNA 2C9KA 2JXAA 3BCWA 1FATA 2VG9A 4JZRA 3U4SA 2YXSA 3I3QA 4ZU7A 3NNGA 4PIYA 4Q4V1 1HJGA 1UWWA 2YB7A 1X33A 3OPZA 3IZOA 1O5UA 4XDPA 1AJOA 4MYEA 4LBQD 3ACIA 4KL1A 4WVMB 4BMBA 3VBOC 3VKOA 4CU8A 3MZHA 2PHRA 5DAQA 2VE1A 4KI5M 4YZ2A 3POBA 1YFXA 4QDSA 1YRZA 1RITA 2RS53 2QQWA 3GDBA 4AAXA 4TTGA 2D5HA 5FXWA 3VBRC 3PL0A 3VBFA 4FPLA 4ES8A 5DXDA 1DBNA 1DQ0A 1VBA3 2BGCA 2HWB3 5DDJ1 4NIDA 2C9AA 1R082 1UY3A 1F5FA 1I5PA 3MYXA 4UT5A 1LAJA 4OYUA 2DDUA 2ZX1A 2EXKA 2PLV2 5A70A 3JD73 4O7XA 2WIIB 2Y33A 3RQ0A 2JKBA 3ECQA 4CDWC 5FY1A 4A2UA 5LY1A 4LBLA 3VBRA 1NY72 5FZ7A 2RVAA 5J36A 5FMOL 4E2QA 2AEYA 2MEV2 2Q8OA 3ZFGA 5JR2A 4QPGC 3VDAA 3O1VA 5IATA 1C5IA 4DY5A 4Q4Y2 1SDDB 3EHKA 4R8HA 4IGQA 3O1UA 3MF9A 1EV12 3W20A 5AVPA 3H7YA 1GOFA 1UU4A 3MW2A 4LLOA 3M3EA 4OUMA 3AZXA 1REEA 3V0AA 2TNFA 5F7UA 3LPGA 3GM8A 4L92A 3GNEA 5LA1A 2YU1A 2D6OX 3B00A 1OMIA 3ACLA 2QJVA 2YGMA 4QX0A 4AGRA 2KD7A 1ZZBA 3B94A 2ZAHA 5CB7A 5LZ6A 3J8F2 4QDQA 1O5LA 1UAIA 3LZZA 4MO3M 1LNSA 2QZ3A 1WW4A 3W59A 3AVRA 4Y1ZA 1PK6A 1Y9GA 3D4KA 5A7NA 3SCHA 1UZYA 1XC6A 3AMMA 4ZXKA 5C3RA 1YQ5A 3IBMA 1W39A 4GJZA 1JU3A 4IE4A 4DXSA 1W8WA 4P9YA 2VZRA 3E1F1 3VBUB 4AI0A 1ACCA 2D3RA 2HYXA 3A4UA 3OJBA 5KR7A 1MZ5A 1KRIA 4Q4W3 2WNVB 4QKNA 3BN6A 3K46A 3OBZA 4FXKB 5FZBA 3L9JT 4MXWA 1R092 1XNTA 2ARBA 1JYVA 2EIDA 2CY6A 1C1LA 5EZWA 3WDVA 4B4PA 1G6NA 2MHFA 1JW6A 3WHUA 5FMCA 1UYYA 2IXKA 5FO8B 2ZGUA 4MGSA 1FX5A 1K5MA 4XBLA 4C0BA 1O3SA 3TRSB 4CA9A 4YW3A 4CEYA 1LGBA 4EROA 2RR13 1LCLA 1VBD2 4CDXA 2E9QA 3C7HA 1TNRA 3O12A 2RS52 4LO8A 4LBQB 1GNHA 5ACA1 2FDHA 1OLME 3ZVXA 2Q8EA 4BIOA 2IUWA 2R072 2KA3A 2A6XA 1DLLA 1ZRDA 3JZVA 5C3SA 2HWB2 1CAXA 5L7OB 3JBG3 4XVHA 5C9AA 3RZHA 4FOWA 1HRV2 1JYNA 2ZACA 4ATEA 3E97A 5LBEA 1ND3B 4WM8C 4P9GA 2LUWA 4I02A 4Q4X3 3VBSC 4A7KA 4CP1A 2BBVA 1KITA 3AK0A 1ULFA 3KV4A 1UKRA 3H3UA 3MDPA 1ND2C 4H14A 5DPNA 2IVJA 2R49A 1CJDA 2Y6GA 4N43C 4Q1PA 2K0GA 4XOGA 1H1AA 5A3NA 3KT1A 2JEMA 2VQAA 3B01A 2YC2A 1K3IA 5JZGC 1H8TC 4LE3A 3WQBA 4CCKA 2P6CA 2V5YA 3NJZA 4GA9A 1IG0A
chains in the Genus database with same CATH topology
4LIUA 2XXZA 4BU2A 3OPWA 5FZHA 4CSWA 5F3CA 4QWNA 5F5AA 2GP3A 5FYHA 4D6RA 4GD4A 3DXTA 5FY1A 5LY1A 2XUEA 3KVBA 3N9MA 2W2IA 4HONA 5FZ7A 5FZIA 3N9LA 5IW0A 5FYBA 5K4LA 3UYJA 5FP9A 4CCMA 5F3GA 5FYYA 5FXXA 4EYUA 5F5IA 4D6QA 4IGQA 5A3WA 3LD8A 5FZEA 5LW9A 3PU8A 5FYMA 5A80A 2Q8DA 2XDVA 5FBJA 3K3NA 4GAZA 4CCOA 4UF0B 3KVAA 5FPAA 5ISLA 5FYSA 3PUSA 5F2SA 5FY0A 5FZOB 2YBPA 5A7WA 3KV6A 5A7QA 2YU1A 5FZ9A 3PDQA 4CCJA 5FUNA 5A7PA 2WWJA 3N9PA 3N9QA 4CCNA 5FZ3A 2OT7A 5FP7A 3AVRA 5LWBA 3N9OA 5A7NA 4QXBA 5FZ8A 5FZ0A 4XDOA 5FZLA 5FXZA 4GJZA 5A7SA 4DIQA 5FYCA 5FWEA 5FZDA 3ZPOA 2GP5A 5FPBA 4IGPA 5FZGA 2YBSA 4CUGA 5FZKA 3OPTA 4QX7A 5KR7A 5IVBA 4HOOA 5FY7A 5FJHA 2OQ6A 4LIVA 4NUBA 5FPVA 2Q8CA 4BISA 5IVEA 5F39A 5IVVA 5CEHA 5FUPA 5FZBA 5FZMA 3ZLIA 3PURA 2OS2A 4DO0A 5FZOA 2XMLA 2YU2A 4QXCA 3RVHA 5FYTA 3PUAA 5IVFA 4UF0A 4E4HA 5A1FA 5E6HA 4AI9A 4IGOA 1VRBA 5IVCA 4ASKA 4Y33A 4CCLA 5FXVA 5A3TA 5FPUA 4C8DA 5FY4A 4TN7A 5FZFA 5F2WA 5A3PA 3K2OA 4AAPA 5FZAA 5F3IA 4Y3OA 2Q8EA 3KV9A 5IVYA 4V2VA 4EZ4A 2YPDA 5IWFA 5FZ4A 5FP8A 5FYZA 4D6SA 5F3EA 4EZHA 5FYVA 5A1LA 5IVJA 5FZCA 3DXUA 4QXHA 5FPLA 5FZ6A 3AVSA 5FP4A 3AL6A 5FY8A 2PXJA 3U4SA 3AL5A 4Y4RA 5F5CA 5FV3A 5FY5A 4URAA 3KV4A 3U78A 3NJYA 2VD7A 5F37A 4XDPA 3PTRB 4QX8A 5FP3A 3LDBA 5LY2A 5FYIA 5A7WB 5FZ1A 2WWUA 2OX0A 5F32A 2P5BA 5ANQA 5A3NA 3PUQA 5FYUA 3PU3A 3K3OA 3KV5A 3N9NA 4LITA 5A7OA 5FWJA 5FXWA 2YBKA 5FY9A 4CCKA 5FJKA 4BXFA 2OQ7A 4GJYA 4LXLA 4QU1A 4V2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LIU A;  2XXZ A;  4BU2 A;  3OPW A;  5FZH A;  4CSW A;  5F3C A;  4QWN A;  5F5A A;  2GP3 A;  5FYH A;  4D6R A;  4GD4 A;  3DXT A;  5FY1 A;  5LY1 A;  2XUE A;  3KVB A;  3N9M A;  2W2I A;  4HON A;  5FZ7 A;  5FZI A;  3N9L A;  5IW0 A;  5FYB A;  5K4L A;  3UYJ A;  5FP9 A;  4CCM A;  5F3G A;  5FYY A;  5FXX A;  4EYU A;  5F5I A;  4D6Q A;  4IGQ A;  5A3W A;  3LD8 A;  5FZE A;  5LW9 A;  3PU8 A;  5FYM A;  5A80 A;  2Q8D A;  2XDV A;  5FBJ A;  3K3N A;  4GAZ A;  4CCO A;  4UF0 B;  3KVA A;  5FPA A;  5ISL A;  5FYS A;  3PUS A;  5F2S A;  5FY0 A;  5FZO B;  2YBP A;  5A7W A;  3KV6 A;  5A7Q A;  2YU1 A;  5FZ9 A;  3PDQ A;  4CCJ A;  5FUN A;  5A7P A;  2WWJ A;  3N9P A;  3N9Q A;  4CCN A;  5FZ3 A;  2OT7 A;  5FP7 A;  3AVR A;  5LWB A;  3N9O A;  5A7N A;  4QXB A;  5FZ8 A;  5FZ0 A;  4XDO A;  5FZL A;  5FXZ A;  4GJZ A;  5A7S A;  4DIQ A;  5FYC A;  5FWE A;  5FZD A;  3ZPO A;  2GP5 A;  5FPB A;  4IGP A;  5FZG A;  2YBS A;  4CUG A;  5FZK A;  3OPT A;  4QX7 A;  5KR7 A;  5IVB A;  4HOO A;  5FY7 A;  5FJH A;  2OQ6 A;  4LIV A;  4NUB A;  5FPV A;  2Q8C A;  4BIS A;  5IVE A;  5F39 A;  5IVV A;  5CEH A;  5FUP A;  5FZB A;  5FZM A;  3ZLI A;  3PUR A;  2OS2 A;  4DO0 A;  5FZO A;  2XML A;  2YU2 A;  4QXC A;  3RVH A;  5FYT A;  3PUA A;  5IVF A;  4UF0 A;  4E4H A;  5A1F A;  5E6H A;  4AI9 A;  4IGO A;  1VRB A;  5IVC A;  4ASK A;  4Y33 A;  4CCL A;  5FXV A;  5A3T A;  5FPU A;  4C8D A;  5FY4 A;  4TN7 A;  5FZF A;  5F2W A;  5A3P A;  3K2O A;  4AAP A;  5FZA A;  5F3I A;  4Y3O A;  2Q8E A;  3KV9 A;  5IVY A;  4V2V A;  4EZ4 A;  2YPD A;  5IWF A;  5FZ4 A;  5FP8 A;  5FYZ A;  4D6S A;  5F3E A;  4EZH A;  5FYV A;  5A1L A;  5IVJ A;  5FZC A;  3DXU A;  4QXH A;  5FPL A;  5FZ6 A;  3AVS A;  5FP4 A;  3AL6 A;  5FY8 A;  2PXJ A;  3U4S A;  3AL5 A;  4Y4R A;  5F5C A;  5FV3 A;  5FY5 A;  4URA A;  3KV4 A;  3U78 A;  3NJY A;  2VD7 A;  5F37 A;  4XDP A;  3PTR B;  4QX8 A;  5FP3 A;  3LDB A;  5LY2 A;  5FYI A;  5A7W B;  5FZ1 A;  2WWU A;  2OX0 A;  5F32 A;  2P5B A;  5ANQ A;  5A3N A;  3PUQ A;  5FYU A;  3PU3 A;  3K3O A;  3KV5 A;  3N9N A;  4LIT A;  5A7O A;  5FWJ A;  5FXW A;  2YBK A;  5FY9 A;  4CCK A;  5FJK A;  4BXF A;  2OQ7 A;  4GJY A;  4LXL A;  4QU1 A;  4V2W A; 
#chains in the Genus database with same CATH topology
 1ZBE 1;  1JYX A;  3M70 A;  4KGG A;  2VMI A;  1PO1 1;  3HN3 A;  3EJK A;  4PIX A;  1GWM A;  2WZR 1;  2UWC A;  1W9T A;  1J3Q A;  2DUP A;  3OOX A;  3UL2 A;  1DYP A;  1YFW A;  4YG3 A;  1DQ5 A;  3MIG A;  1F8V A;  4CDQ A;  4CXW A;  5FZI A;  3WDX A;  2E6V A;  4XHB A;  5K4L A;  3WG1 A;  3KCY A;  1SBE A;  2XB6 C;  1TME 2;  2R04 3;  4Q5O A;  2W91 A;  3FFQ A;  1C3H A;  2ILM A;  3PVN A;  1APN A;  1PNG A;  2YBP A;  4DB5 A;  2P2K A;  3SCG A;  1IKP A;  5ABJ B;  1JS9 A;  2DVA A;  2HBU A;  3W5M A;  1D4M 2;  4CCE A;  4QGM A;  4AK3 A;  2WRA A;  4I3P A;  4IER A;  4YVS A;  1AF9 A;  4GMP 0;  4QPY A;  3VDC A;  4HSJ A;  3ACG A;  3WUD A;  2UYA A;  2W68 A;  4AGG A;  4QB2 A;  4GH4 B;  1VRH 2;  1XU2 A;  1ND2 B;  2CWM A;  2DVG A;  1I9R A;  1AR7 2;  3TN9 1;  4TLG A;  1NZC A;  2QCS B;  2WZE A;  4BLJ A;  5JLV A;  1AL2 2;  1WGP A;  5FZK A;  1MAC A;  3ZYI B;  4ZKT B;  1LR5 A;  3DV8 A;  4EN0 A;  1NCQ C;  4GUL A;  3ZLI A;  2JG8 C;  4GB3 1;  2CNA A;  2OS2 A;  3TNQ A;  3USS A;  1CVN A;  1LTE A;  1G9F A;  4MH0 E;  1YJL A;  3HMY A;  3UKN A;  2QDR A;  5DAP A;  4AI9 A;  2CAU A;  3H7J A;  1H30 A;  4XET A;  3R05 A;  3HNB M;  5FKB A;  3FBM A;  2AYH A;  4SLI A;  4UFM A;  3NV1 A;  3J7M A;  4X8N A;  2LAL A;  1N1T A;  1NYW A;  4LUL A;  3AYC A;  4A4A A;  2ARX A;  2GH2 A;  1XE0 A;  2WIN B;  3CJI A;  2OW4 A;  1FMD 2;  2B8M A;  1PO2 3;  1RHI 3;  5B4X A;  3PTY A;  2GAU A;  1W0O A;  4NHX A;  4J1W A;  1IPJ A;  3ATG A;  1SMV A;  3MGU A;  4YM2 A;  1IPK A;  5FZ6 A;  3WY6 A;  5K9Y A;  1M06 G;  3PJQ A;  5J37 A;  4UFI A;  5CA6 A;  1AX1 A;  3DPR A;  5CFC C;  4AHZ A;  3OBA A;  3WNO A;  4QM9 A;  4BJ0 A;  5IK7 A;  3T0D A;  2EF6 A;  4AEJ A;  1SDW A;  1WD3 A;  5T5J A;  2MEV 3;  1PGL 2;  5LY2 A;  3VD9 A;  4Y22 B;  3BTA A;  1U5Z A;  4GQ7 A;  3G6J B;  4RQP A;  3VBH B;  1T2X A;  3IIA A;  4V1P A;  3VD5 A;  4GB3 2;  1PO2 1;  2ZZJ A;  1EV1 3;  1QJX 3;  4R52 A;  3ILR A;  5JPN B;  3CMG A;  4UW6 A;  3D8C A;  5JWP A;  4GXL A;  4GWM A;  1CJP A;  4YW5 A;  1X9P A;  2OQ7 A;  5FY7 A;  5JZG A;  1YFY A;  2VBD A;  3AP4 A;  4LKD A;  1DGR N;  5FLH A;  1GNY A;  4Y5T A;  2RG4 A;  4NHM A;  1HW5 A;  1LRH A;  3NNL A;  4K6B A;  4ZZ8 A;  1F5J A;  3EXU A;  4JQR A;  1RUH 3;  1OA3 A;  4IV3 A;  3F95 A;  2GN3 A;  1D4M 1;  1KS5 A;  1CIY A;  2HWE 1;  5DAW A;  3WDW A;  2LRP A;  1QJF A;  5JI7 A;  4D6Q A;  3ME2 A;  2P1B A;  1H2L A;  1NXD 1;  4NAM A;  1AYN 2;  3VLB B;  3J8F 3;  3ORJ A;  1WME A;  2QQL A;  5ISL A;  2C6S A;  4W8J A;  1V6J A;  2GAL A;  3WR0 A;  4QPG A;  2UY8 A;  5BNN B;  1C1F A;  1K5J A;  3INA A;  1F4A A;  4XMA A;  3ZIX A;  1SFN A;  5CFC B;  2JG8 B;  3N9P A;  2WKK A;  4N7U A;  1XNA A;  1NCQ B;  5AFB A;  2ZMN A;  1EP0 A;  4X6Q B;  4YRD A;  5C5T A;  3FBY A;  3N9O A;  4JGZ B;  4JV4 A;  3AZZ A;  4ITC A;  1RUC 3;  3IB3 A;  2PTM A;  2J1S A;  2VZP A;  4CTE A;  3O1T A;  4PLN A;  3J9S A;  4OZO A;  4KU8 A;  4RS5 C;  3AFK A;  1X9T A;  2R07 3;  5E16 A;  3U07 A;  2YBS A;  3PVB B;  1COV 2;  4LHN A;  1A34 A;  4Y1U A;  5D8A C;  3WP6 A;  2LS6 A;  4EN6 B;  4TSV A;  3FLP A;  1VBD 3;  3LDK A;  5DUW A;  2WYS A;  4EWD A;  2VGD A;  1PZ9 A;  1YCI A;  4MG2 A;  1D4V B;  1LHW A;  1LU1 A;  5A3O A;  3KD4 A;  4QXC A;  3RVH A;  5FYT A;  1ZRI A;  4YYO A;  5HPO A;  1JZ3 A;  3JCI A;  4UF0 A;  5ABJ C;  2BVV A;  2QVS B;  3JBG 2;  4IGO A;  3ZOI A;  3TWI A;  2V09 A;  3PJY A;  1KXG A;  1CQ9 A;  4K1Y A;  4MXV A;  1W6O B;  4BE3 A;  4P08 A;  3JBG 1;  4CUA A;  3U1X A;  4DEV A;  1QOT A;  2JDM A;  4ET7 A;  4ZPI A;  1PHM A;  2PYT A;  4V2V A;  1N1S A;  3JB4 C;  3SIT A;  2G4I A;  3SKV A;  1UU5 A;  4K3U A;  2W94 A;  3H3Z A;  4HXC A;  5FP8 A;  4ASL A;  2XJT A;  1JZ6 A;  4E9K A;  2QQP A;  1ASJ 3;  4QX1 A;  5C9A C;  3B93 A;  4D3W A;  3AMN A;  2JDP A;  2ZXQ A;  2QE3 A;  1RYY A;  3QAC A;  1FV2 A;  2NYY A;  4HBN A;  1G9C A;  1KEX A;  1Q3E A;  4A6O A;  2A70 A;  1E5R A;  1JOJ A;  5HXV A;  3LEI A;  2JIC A;  1DHK B;  1CAX B;  1SFY A;  1UYZ A;  3AL5 A;  3JB8 A;  4Y4R A;  1NCR C;  1LGN A;  1MS0 A;  5FY5 A;  1WCQ A;  3GZE A;  3MFC A;  1O91 A;  1JYI A;  3WNM A;  3K4Z A;  5C33 A;  5CIS A;  4N7I A;  2RS1 1;  1UOB A;  1W99 A;  2JKX A;  4QHB A;  1VBA 1;  4OI0 A;  1DFQ A;  2Q1Z B;  4M0H A;  2BW8 A;  2WFF 3;  4RGK A;  3T4V A;  1XRU A;  1S0J A;  3GZA A;  4JGY C;  1GAN A;  4I09 A;  2ET1 A;  1YXW A;  1JOB A;  2BNN A;  3OCP A;  2BZD A;  4XJA A;  3VBS B;  4DEQ A;  4FBF A;  3OUH A;  3H8X A;  1H1M A;  4QU1 A;  4KGQ A;  4V2W A;  2W0X A;  2V73 A;  4XIK A;  3VHR A;  2DCJ A;  4BQY A;  4DRV A;  2W39 A;  3M8L A;  4LIU A;  2VCB A;  1TME 3;  4LHK A;  4A41 A;  4Y24 A;  1LES A;  1Z0H A;  1AR8 1;  3O0W A;  3PIG A;  4JRA A;  1RUO A;  3I2J A;  3KVB A;  5FPX A;  5GLT A;  2WC2 A;  2VMF A;  5FYB A;  3WNK A;  5HCB A;  2E33 A;  3P5B A;  2VCC A;  2A73 B;  2NM1 A;  3AYD A;  5HBA A;  1BJQ A;  2Y34 A;  2VOK A;  2XJP A;  5IFP A;  1UMH A;  1AR7 3;  1ULP A;  2Q8D A;  3AXD A;  1XQN A;  2PHW A;  4BQ1 A;  3PUS A;  2ADE A;  3VBO B;  3ZKY A;  3H8R A;  4RS5 B;  3TYJ A;  2MPF A;  1RUJ 2;  1W9S A;  4Y22 A;  3OUI A;  1W6O A;  5DZF A;  5APA A;  3K4D A;  4K1Z A;  3QLQ A;  4YG6 A;  1S1A A;  1TQ5 A;  4CDX B;  4L0P A;  2VR4 A;  4W50 A;  4DXR A;  1CPM A;  2SBA A;  2WNV C;  4TWT A;  1Z7S 1;  1O3Q A;  4ZS2 A;  3F2Z A;  1DZR A;  3ZN4 A;  3CJI C;  4PI0 A;  4FPC A;  2IWG B;  4YM0 A;  2Q1F A;  3VZM A;  1BQP A;  5JXG A;  4XDO A;  5C8C B;  1VBE 2;  2XJS A;  3HQR A;  2W92 A;  4FCA A;  3ZPO A;  3WIN E;  1YEW A;  1HLC A;  3WW1 A;  3HT2 A;  5FBZ A;  4CXY A;  1SFP A;  4PQQ A;  3ST7 A;  5T5O A;  4FVV A;  3T4H B;  1PO2 2;  4JC1 A;  4P9L A;  2VVD A;  5ABJ A;  5FPZ A;  1FMD 1;  1YI7 A;  4QHZ A;  2WQ8 A;  1Y9Q A;  3GGL A;  2VNR A;  2HEV F;  4QB6 A;  1POV 3;  3DF0 A;  4IEY A;  1BK0 A;  5FUI A;  4QPI A;  1SPP B;  2XVG A;  3M3I A;  3OGJ A;  2H0B A;  1DYK A;  5I0U A;  5ACA 2;  4QKD A;  1VBD 1;  3FLT A;  5E6H A;  4P9W A;  4RSU A;  4LHL A;  1NCQ A;  4CU7 A;  4AQT A;  1RHI 2;  4JKL A;  4JTN A;  4R4Z A;  5HXM A;  1J3P A;  2XBO 1;  2CSG A;  3ZX7 A;  2BFU S;  1KJL A;  2WFF 2;  4KWU A;  4QPG B;  4W4Z A;  5HCA A;  2EVX A;  5BXX A;  3TEW A;  4XBQ A;  1N1V A;  2GC2 A;  1R09 1;  4WM7 B;  4CEY B;  4XFH A;  1WLW A;  2BNM A;  5I0R A;  1JBC A;  5IYY A;  1OI6 A;  5JOZ A;  1QWR A;  4IEZ A;  4N53 B;  2A6V A;  3ILF A;  4CDU C;  4DPN A;  4H2A A;  5F9T A;  1TZO A;  2VMD A;  5HCF A;  4FTE A;  3BKZ A;  2WNU B;  2Q1M A;  1KS4 A;  3I2H A;  1UY0 A;  1XSR A;  5FFO C;  3ZSL A;  4ONU A;  2VOX A;  1AL2 1;  2VMH A;  3C2U A;  4N53 A;  1WUV A;  1NXM A;  3U14 A;  2O0O A;  2WNO A;  5BV6 A;  5F5C A;  3KZ4 C;  1DU3 D;  2CTV A;  1GP6 A;  1IZ3 A;  3HOB A;  1V6N A;  4M00 A;  2HWE 2;  5F37 A;  3J8F 1;  3PTR B;  4IND A;  4EN9 B;  2J1R A;  3WP3 A;  3VZN A;  3WW3 A;  4CXX A;  2R6Q A;  3FUQ A;  3VZO A;  1EUU A;  5F32 A;  4PDW B;  3SNM A;  5J09 A;  1DZQ A;  1MVQ A;  4KNC A;  5EHD A;  2D3P A;  3MID A;  4FFF A;  3ZXF A;  2ZX0 A;  3WF4 A;  3E5X A;  2DWR A;  1QJZ A;  1S0C A;  3MIH A;  1W04 A;  4LKF A;  1WD4 A;  3A21 A;  4BDV B;  2FD8 A;  3MIC A;  1OKO A;  3ACH A;  4FO9 A;  1VAM A;  2WO7 A;  1HV0 A;  1AYN 3;  2RMU 3;  2Z5W A;  5LA2 A;  2BUK A;  3BIE A;  3MIB A;  4Q4W 1;  4QB1 A;  4D6R A;  2RS3 3;  3GCX A;  4XHX A;  2XJU A;  1RUC 2;  2VMC A;  2VW1 A;  4AEK A;  5FYY A;  4WM7 C;  1F35 A;  1O6U A;  1SEF A;  2QBX A;  4N90 A;  2ZX4 A;  5A3W A;  3RWK X;  4YNI A;  5A80 A;  3B69 A;  4JDO A;  5DDJ 2;  2O8O A;  3MIE A;  1O3T A;  1LOG A;  4O9G A;  5KXD A;  4FAG A;  1JZ5 A;  2ARC A;  4UBH A;  5A33 B;  2W52 A;  4XJ8 A;  4P9I A;  2XKP A;  2J42 A;  2KR2 A;  5AC9 1;  1YQC A;  3BGA A;  2A1X A;  3CL1 A;  1HKD A;  3IDE A;  1HXS 3;  1VBA 2;  2OT7 A;  5FKC A;  2R06 2;  5JSP A;  1E5S A;  1PM4 A;  2IC1 A;  4Q4V 2;  3POE A;  4JRL A;  1YQ6 A;  1TG7 A;  1WMF A;  2WYF A;  2ZGN A;  2VUJ A;  2WZR 2;  2QNK A;  3RZL A;  1XND A;  4BLI A;  5K7P A;  4R9A A;  4UFH A;  3EQE A;  2F4L A;  4QM8 A;  4W65 A;  3RI9 A;  1C4R A;  1KDM A;  5F8P A;  4NIA A;  2X5I C;  4CUG A;  1YFU A;  2LM3 A;  1UY1 A;  2RMU 1;  2YYO A;  2Q8C A;  5FO7 B;  1ASJ 2;  1ND2 A;  1YLL A;  4JGY A;  5DN2 A;  4DNY A;  4XFB A;  1C57 A;  1OSG A;  1U5X A;  2WNU A;  3DUI A;  4A45 A;  5KXC A;  4FPF A;  3E6D A;  3ZN6 A;  1ZA7 A;  1WWY A;  3VBS A;  1IGO A;  3OYW B;  1OXC A;  5T54 A;  4XUT A;  4XZP A;  3ALQ A;  1I6X A;  1AR7 1;  2QQK A;  3TN9 2;  1OPM A;  5CBL A;  1H2M A;  4H7M A;  2C24 A;  4LBJ A;  3U37 A;  5FQ0 A;  2HH9 A;  2WLQ A;  4OQ9 A;  4BB3 A;  1NLQ A;  3ZKU A;  1OA4 A;  4CCD A;  2DVD A;  3WG4 A;  3ZN5 A;  2JDN A;  1I5Z A;  2XWJ B;  1FNY A;  2R30 A;  4JQT A;  4QX2 A;  1S0G A;  4K21 A;  3UV9 A;  5CKN A;  1NX9 A;  4BWO A;  3AKP A;  4NPM A;  2BBA A;  3VZL A;  3WX5 A;  5JCT A;  4QKF A;  1WKY A;  1BBT 1;  1UW8 A;  2VY0 A;  4DZG A;  1JUH A;  3ZSM A;  2JEC A;  2JDH A;  1H2N A;  3BIW E;  4FPE A;  3POI A;  4DMI A;  1AHS A;  2Y0I A;  5DUU A;  1PIV 3;  4FOY A;  3I3M A;  3OBR A;  3CDZ B;  1NUK A;  2J1E A;  5CG9 A;  4DQA A;  1OOP A;  4Q2F A;  1XYO A;  2XOM A;  1AR9 2;  4LA3 A;  4QXK A;  2HWC 3;  4URA A;  1DGL A;  3NL1 A;  4URT A;  3WF2 A;  5G05 L;  4MAD A;  1CZS A;  4IV1 C;  4QX8 A;  1RJ8 A;  3CZU A;  3T2P A;  2OXB A;  2OX0 A;  3AMH A;  4GH4 C;  2HWD 1;  4LLF A;  2HYK A;  2JDU A;  3NV3 A;  5JIA A;  5LB6 A;  1W0P A;  1Q8P A;  4YW2 A;  4AFB A;  4XYX A;  5KC5 A;  3MLJ A;  5L9V A;  4ORF A;  1FPN 1;  1NLS A;  1QEX A;  4NPL A;  1VAV A;  2ARE A;  5I8S A;  3VDB A;  4W6W A;  3THC A;  3LFI A;  4M3C E;  1GWL A;  3I2F A;  2NMN A;  1BLZ A;  1SLB A;  4BHP A;  4BZ4 A;  1AXK A;  3CLP A;  1HJF A;  2WDB A;  5F5A A;  3WLU A;  4CSW A;  1TNF A;  1W9W A;  3HIF A;  5A32 A;  1SG3 A;  4XFG A;  5CU1 A;  4CU9 A;  4OLL A;  4XJW A;  3KB5 A;  3AZW A;  3NVC A;  4B7K A;  4I3G A;  3I49 A;  4XF9 A;  4ZU4 A;  1H9P A;  4I30 A;  1MS4 A;  1UIK A;  1PK6 B;  2WWS A;  3WEZ A;  4COV A;  3TEY A;  4PLO A;  2PAE A;  1P8J A;  4B3N A;  3VDD A;  1DF0 A;  4Q0V A;  1PVC 2;  3VBU C;  1WW7 A;  4P5H A;  2FHR A;  4YAR A;  1Y4W A;  4Q0S A;  3I2G A;  3OG2 A;  4M3C F;  4ES9 A;  4BK4 A;  4HPK A;  1HRV 1;  1JHJ A;  4XW3 A;  4C91 A;  1GOH A;  2FBE A;  1OVS A;  2A7A A;  1RUI 1;  5EWS A;  2Y6H A;  5EPA A;  3ITQ A;  2ZGK A;  4LUM A;  2B42 B;  1W3V A;  2CWS A;  5FZ0 A;  2DVF A;  3K4A A;  2ZX2 A;  1XJA A;  1PX3 A;  1PMI A;  4RR3 B;  1AUY A;  4C90 A;  4GKX A;  3GZU C;  3K48 A;  2PHF A;  2GNB A;  2RJK A;  3L2H A;  4QDR A;  5FWE A;  2ATF A;  5E88 A;  2RDR A;  1MZ6 A;  3RFR A;  3ZFE B;  2O1Q A;  1PVX A;  1WCD J;  2WS9 3;  1BMV 2;  1POV 1;  5IVB A;  5C5U A;  2DTY A;  1QY4 A;  5HV4 A;  2VXR A;  5D8A A;  3D5O A;  4LR4 A;  1OUR A;  2RM2 2;  2EAK A;  3FUO A;  1ZBE 3;  5CZK A;  2R04 2;  3SH4 A;  2XQR A;  3VBO A;  5DZG A;  1ENS A;  2WNU C;  1GFF 2;  1ZNP A;  2HEY F;  4OUS A;  4QPW A;  4BH9 A;  1OUX A;  2JD4 A;  2JDY A;  3AMP A;  4NHL A;  3VN4 A;  1A8D A;  1YC6 1;  4D69 A;  1XU1 A;  4C8D A;  2HWE 3;  5FZF A;  4RQP B;  2V4V A;  4AAP A;  4ZHN A;  2O14 A;  5GLW A;  5IK4 A;  4BQX A;  4HVO A;  5JXJ A;  5T50 A;  1RTV A;  1ODM A;  5L73 A;  1QQP 3;  2N7G A;  1PGW 1;  5FZ4 A;  1ASJ 1;  1ZZ7 A;  1RUF 3;  5F3E A;  3OEA A;  4CP9 A;  2LW8 A;  4LE4 A;  4UW3 A;  5A1L A;  3WCR A;  4QU2 A;  4K20 A;  5FLJ A;  5G04 L;  4ZY9 A;  1RUG 2;  2A75 A;  3H8O A;  1YHF A;  4UI9 L;  4Z92 B;  3WW4 A;  3ZYB A;  2FCV A;  3GCW A;  1EV1 1;  1FNZ A;  2D93 A;  4YW6 A;  5IAV A;  4YW1 A;  2IXJ A;  5FMB A;  5C4W B;  1EYB A;  2ADD A;  3KWV A;  1US3 A;  4Y5Z 0;  4KU7 A;  5JAX A;  1U5Y A;  5K0U A;  1E5I A;  3VB9 A;  1UKG A;  3GJA A;  3CHX A;  2WS9 1;  4RN5 A;  5CVR A;  4CP0 A;  3I4I A;  4JAA A;  2JG9 C;  3PU3 A;  1W2A X;  2UUR A;  3N9N A;  2FDJ A;  1GZW B;  1GKB A;  2VL4 A;  2FDI A;  4FTS A;  1XE8 A;  2P3K A;  4WVM A;  5GZD A;  1R08 1;  1X36 A;  2GND A;  3HAG A;  1IS4 A;  2ET7 A;  1AL0 G;  1FV3 A;  1AYM 1;  3U10 A;  3I59 B;  4YVW A;  3QD6 A;  3ENR A;  3ZYP A;  3ZM8 A;  4IEO A;  4XUN A;  4I0W B;  4N43 A;  2YC0 A;  2XHK A;  2GP3 A;  2XL7 A;  4LO4 B;  4M4R A;  3AP9 A;  4QWN A;  5BPX A;  4XZU G;  2WT1 A;  3DPR B;  5IT6 A;  2RR1 2;  3N7M A;  4TXW A;  5CFD A;  5FP9 A;  5A6X A;  2BGP A;  5BNP C;  5FXX A;  2E31 A;  3RZG A;  1V6M A;  1YJK A;  2LTN A;  2IFR A;  2G19 A;  4L97 A;  5EJ1 B;  5F5I A;  3SC7 X;  1LED A;  3MO4 A;  3QH7 A;  1NE6 A;  2WAA A;  5FZE A;  4MET A;  2Y6J A;  3U75 A;  3KMH A;  2G9Z A;  3IDA A;  1U5I A;  4IXL A;  3KVA A;  3LSD A;  1ZBE 2;  1WBF A;  2P17 A;  2HWF 2;  2A3X A;  3V56 A;  2X05 A;  4LQR A;  2WLP A;  1J1L A;  1QDO A;  2EIG A;  4RHV 2;  4CEW B;  5A7Q A;  1CAU A;  1LHU A;  1QJX 2;  4N8M A;  4EWA A;  1IHM A;  1SAC A;  1H4H A;  5FRE A;  1IQD C;  1NA1 C;  5A7P A;  1L7R A;  2NP0 A;  2UU8 A;  2YPJ A;  1OH3 A;  1YI9 A;  4AQS A;  4XIL A;  5BYN A;  3POY A;  1UU6 A;  2EA7 A;  5JR7 B;  4CDX C;  4YW4 A;  3ZXK A;  3DL3 A;  1UMI A;  4SBV A;  5FZL A;  3WF3 A;  3M7A A;  4MHU A;  1W6M A;  3SLI A;  1DQ4 A;  1N1Y A;  1BVV A;  3DKQ A;  1FPN 2;  1K45 A;  3GHN A;  3NJX A;  1UZZ A;  4HVR A;  3AP6 A;  4IQP A;  4HOO A;  4RQP C;  2FCT A;  4B4Q A;  2VZQ A;  4XDQ A;  3KCC A;  3N7J A;  2A6Z A;  2GNT A;  4RL7 A;  5CKQ A;  1QJE A;  4QHO A;  1NLR A;  4PCR A;  2HWD 2;  1CPN A;  1N3Q A;  5FZM A;  4CUB A;  2DCT A;  5BNN A;  3IT8 A;  1J59 A;  1HB3 A;  1Q8O A;  1MR5 A;  2DUO A;  2DU1 A;  3FJS A;  4CCC A;  3MI8 A;  1G9B A;  1SLC A;  2XBO 2;  3MV0 1;  4LK6 A;  3IWZ A;  1JMU B;  4LTA A;  2C4X A;  2NPI A;  5A3T A;  1VR3 A;  2YC4 A;  3LQC A;  3POF A;  4W6Y A;  1J3R A;  1RVF 2;  3R4D B;  2R16 A;  3MW3 A;  1AR8 3;  2VW2 A;  3KGL A;  2BV4 A;  1W8Z A;  5EQU A;  2BFU L;  5DAB A;  5BNQ A;  5JPM B;  1W8T A;  2JIJ A;  1MS1 A;  3B9I A;  4D6S A;  3AYE A;  5H9S A;  3FFZ A;  4HET A;  3APB A;  4KWK A;  3T09 A;  5JMO A;  3WVJ A;  5IVJ A;  3S7E A;  4I2O A;  1PMJ X;  2EXJ A;  5BUV A;  2EAL A;  3D82 A;  5LEK A;  3LDR A;  5JIU A;  2CYF A;  1RUF 1;  1HN0 A;  1OF3 A;  3IN9 A;  4IW3 A;  2VOW A;  4K8R B;  4E4Z A;  5C71 A;  1WW5 A;  1H6Y A;  2PHU A;  1E57 A;  2YUE A;  3U78 A;  4RGG A;  4HVQ A;  1Z7S 2;  4UBG A;  1COV 3;  4GAL A;  5FP3 A;  2JB8 A;  2RV9 A;  1QXJ A;  4YSF A;  4CP9 B;  2CV6 A;  1OQE A;  1BVP 1;  2ZGT A;  5IK5 A;  4X8P A;  2OZ6 A;  4A44 A;  2AEZ A;  2CL2 A;  3FHI B;  1HXS 1;  1CZT A;  3OUJ A;  3H0O A;  4IEU A;  4MZU A;  2IXH A;  3SCF A;  2RDN A;  4IUG A;  1MEC 3;  4Q26 A;  3S57 A;  2AUY A;  2ZS6 B;  4Y26 A;  3NNM A;  2XON A;  5FZH A;  3OD4 A;  4COW A;  4HZF A;  4Y1Y A;  2VME A;  4CEW C;  4PBO A;  4Q4Y 1;  5CG8 A;  4WVZ A;  1WMX A;  3J4U H;  4S2G A;  4AFC A;  3ZO0 B;  2ZHM A;  1KD7 A;  4BQ4 A;  2XWB B;  1I3H A;  3UYJ A;  2WO2 A;  5JZG B;  1GU3 A;  4EN8 B;  1VIW B;  4JDM A;  4EYU A;  4AL9 A;  4KG0 A;  2W87 A;  4AED A;  4IDZ A;  4O9E A;  3HNM A;  3MW4 A;  5FBJ A;  4CCO A;  5FPA A;  2ZHN A;  1O4T A;  3O1S A;  4BK5 A;  4FFI A;  2PHL A;  1RUI 3;  3PNA A;  4PDW C;  5FY0 A;  3R6S A;  3WDU A;  3ZFG C;  3WNL A;  4YZ4 A;  2AR6 A;  1VE0 A;  1DGW A;  1SLL A;  2WT0 A;  4AI3 A;  1BBT 2;  1QH7 A;  3MEP A;  4Y1V A;  1ENQ A;  1T6B X;  3LFM A;  2ZX3 A;  1YWK A;  3O0X A;  1UOG A;  2W5F A;  4CDU A;  1X8E A;  5LWB A;  2Z79 A;  1CAV B;  1FAY A;  3QH6 A;  3NKG A;  4KWL A;  4Q4W 2;  3PHM A;  3ZXD A;  1AX2 A;  2G9F A;  4DUX A;  1GV9 A;  5T5L A;  2JG9 B;  4LPL A;  1PMH X;  4JX0 A;  5FYC A;  4GB3 3;  1FYU A;  1SBD A;  1VBB 2;  4YVS B;  1OFN A;  1ZM1 A;  4IGP A;  1NCR B;  3HD8 B;  2BOJ A;  3CIH A;  1UD1 A;  2GU9 A;  1QHD A;  2ZHK A;  1DDL A;  4IEV A;  3EBR A;  3JUU A;  5FPV A;  5LBC A;  1G9A A;  5F39 A;  5CEH A;  2QQV A;  2FQP A;  2J7M A;  3AJY A;  5FR3 A;  3TEZ A;  1Y9M A;  5DUV A;  1MEC 1;  3T0A A;  4YPJ A;  1QJY 2;  1LOD A;  4ZZ5 A;  4HG6 B;  2JDZ A;  5I0D A;  5IHR A;  1RUG 3;  4Z82 A;  3E6C C;  3DPR C;  3FN9 A;  3PVE A;  3THD A;  5I0S A;  3WUC A;  5BNO C;  1PNF A;  1W8H A;  2A6W A;  4L2N A;  3HJR A;  1JU4 A;  2DFC A;  2FCU A;  4XFC A;  3HQX A;  3R0R A;  3KQ4 B;  1DZT A;  2WBK A;  2HEW F;  1OC1 A;  3WD5 A;  1S4C A;  2B46 X;  1H1I A;  1NE4 A;  5IVY A;  5GZF A;  3SHR A;  1RMU 1;  5C3O A;  1K5M B;  1VBE 3;  4DUW A;  2VVE A;  3VL9 A;  3ZPY A;  1M4W A;  3K51 A;  3ZN6 B;  2X29 A;  1GLH A;  2Y8K A;  3SH5 A;  2H0V A;  4FP3 A;  2Q5T A;  3KF3 A;  3DXU A;  3J7H A;  3P3N A;  4MXW B;  5E89 A;  3B02 A;  1OD3 A;  3AFG A;  3AVS A;  3CJI B;  3LPF A;  5FPL A;  3AZV A;  4YZ5 A;  1QNY A;  3AL6 A;  4AI8 A;  2W08 A;  4XUQ A;  2K9Z A;  2XGX A;  1UPS A;  5DUX A;  2XKO A;  1TEI A;  2BER A;  1UZ0 A;  2P3J A;  4CP2 A;  3B7M A;  3BU0 A;  3LA7 A;  3W5N A;  1RXF A;  2RJ2 A;  4D7S A;  1Y3T A;  1V6L A;  3NWK A;  2J22 A;  2GMM A;  3AC0 A;  1BCX A;  1DIW A;  3MBW A;  4RR3 C;  4YFZ A;  1RB8 G;  1PO1 3;  2QUO A;  4Q8L A;  3KV5 A;  5T52 A;  5GM0 A;  4YGC A;  1IS5 A;  1G7Y A;  2JDK A;  3J7N A;  2P3I A;  2RS3 1;  3E5Q A;  1WCS A;  2VBB A;  3QOP A;  4AZZ A;  1VMJ A;  3PUI A;  4U2A A;  5LBB A;  2D97 A;  2RS1 3;  1DP0 A;  4BM8 A;  4Y20 A;  4XCA A;  5C70 A;  4Y4Y A;  5DG2 A;  3O0V A;  4OMC A;  2P34 A;  4Q1R A;  5F3C A;  5LK5 A;  1RUC 1;  2VNV A;  2ZBJ A;  1Y7B A;  3FC0 A;  3AKQ A;  2D43 A;  4NMI A;  1H8T A;  5I8Y A;  3N9M A;  3OGV A;  4LBQ A;  3N36 A;  4FP2 A;  1A78 A;  4XUP A;  5C8C A;  2RJL A;  4H55 A;  2BTV C;  5JUV A;  3ZFF C;  3LD8 A;  1UL9 A;  3HNY M;  1XPW A;  2XVK A;  3OGG A;  2G1M A;  4UAP A;  2I45 A;  4XAA A;  4Z07 A;  4LOR A;  1ALY A;  1C8M 2;  2H6B A;  1EAH 2;  3N4M A;  3KF5 A;  1NG0 A;  4CCJ A;  3RPQ A;  5F6K A;  3VZK A;  3RZK A;  4XTP A;  2CU5 A;  2WWJ A;  3LOB A;  4XQD A;  1J83 A;  4Y1X A;  4QKB A;  2WFF 1;  4QT6 A;  1ND3 A;  2IFW A;  1SCR A;  1RUE 1;  1S0D A;  4WBB A;  2CHH A;  2D7F A;  1SLA A;  4HMZ A;  5GLU A;  1AR9 1;  3KGZ A;  1DCS A;  1WZX A;  3H8U A;  5AFE A;  5H9P A;  1W05 A;  4OVE A;  4RFT 0;  5HCH A;  1ZRC A;  3I2D A;  5FLI A;  4PF1 A;  3OPT A;  3T1M A;  2EIE A;  1UQX A;  3WOG A;  3TB0 A;  2BWA A;  5LAS A;  2J1T A;  4QQL A;  4Z1V A;  4GWI A;  1MPX A;  3GHM A;  4IEP A;  5DDJ 3;  3J7L A;  3JQW A;  1IG3 A;  2X5I A;  4COY A;  4AFM A;  1B35 C;  3PUA A;  3ZFG B;  5A3M A;  1D0G A;  2ZTN A;  1S2K A;  1V9U 3;  2VCM A;  2VZS A;  1JOD A;  2CDO A;  4K7J A;  1H6X A;  1XE7 A;  1FMD 3;  4XXA A;  5FXV A;  4XF4 A;  4TN7 A;  3RJ2 X;  3K2O A;  2D40 A;  5CNA A;  5FZA A;  4Q4V 3;  1R1A 3;  1J84 A;  3ZYG A;  2VNG A;  2Y6L A;  1V70 A;  4J1X A;  2AGS A;  4HK9 A;  4AFD A;  1D0H A;  5CAZ A;  1CX4 A;  5KHG A;  4PF5 A;  4EZH A;  4Q0Q A;  1HRI 1;  3VKN A;  3N7L A;  2ZKN A;  4PDW A;  4F3J A;  2ZGP A;  3VV1 A;  3KQR A;  3CBN A;  1YYN A;  2G9G A;  4JTO A;  3AKR A;  1VBE 1;  2VEC A;  3MHZ A;  5FP4 A;  5LRR A;  2HKX A;  1W28 A;  1JTZ X;  3RGB A;  3UES A;  1NAE A;  4FT8 A;  4M0N A;  2TUN A;  2JDA A;  4GMP 3;  5FOB B;  1NZI A;  4MUV A;  4NE9 A;  2VD7 A;  1LEC A;  3O1P A;  4XPV A;  4QMA A;  3LDB A;  1NT0 A;  4O61 A;  4G4F A;  3A0K A;  4Z2A A;  3MF6 A;  3BTZ A;  5ANQ A;  4NIG A;  2B7Y A;  2VOT A;  2WSU A;  4ARX A;  4IEW A;  4I0B A;  2AH2 A;  3JXS A;  1CON A;  2PHD A;  3UKT A;  5DAX A;  4HSL A;  4MGQ A;  1RUH 2;  2V5D A;  3RNS A;  3SXW A;  1GQP A;  3Q8A A;  4F7Z A;  3UT0 A;  2A3W A;  2IVI B;  2Z42 A;  3CZJ A;  5EIY B;  3TN9 3;  3FX3 A;  3WV6 A;  3ILN A;  1AZD A;  3ZSJ A;  5ACA 3;  3VKF C;  2I2S A;  4MGY E;  2A3Y A;  2D6K A;  1POQ A;  3HVD A;  1H8V A;  2W1Q A;  5FYH A;  3DXT A;  5K0U C;  3DYP A;  3BPS A;  1OLQ A;  1GP5 A;  2W2I A;  1Q8Q A;  1AR6 3;  1O59 A;  1PK6 C;  2PAM A;  3N9L A;  4MGK E;  4WV8 A;  2RR1 1;  4MX3 A;  5M0T A;  5FRA A;  4JKM A;  4Q29 A;  2C0Z A;  2Z4F A;  4PQ9 A;  3VBF B;  1BKZ A;  2YV8 A;  3JD7 2;  1MZF A;  4PT6 A;  4HK8 A;  1IOA A;  1Q8S A;  5JOY A;  1W9Y A;  1AYM 2;  3HEI A;  1W0N A;  2XPJ A;  4XAE A;  3K77 A;  1IS3 A;  2WN2 A;  1UOJ A;  1V9U 2;  2HWC 1;  4CDW B;  5BY5 A;  4TZD A;  1KDK A;  1V00 A;  1VBB 3;  4OI1 A;  1XYN A;  1OH4 A;  1DQ1 A;  4QQH A;  1W8N A;  2W95 A;  5AVA A;  3RZM A;  3TNP B;  3M2M A;  1XOY A;  4YLZ A;  3UJO A;  1QKQ A;  3WP4 A;  4FPH A;  3OYW A;  3RG0 A;  1YQ8 A;  3V0B A;  4IV3 C;  2Y6K A;  2R0F A;  1JI6 A;  3O7O A;  3RYR A;  4QXB A;  3T30 A;  3WDY A;  4LKE A;  3HR9 A;  2Z69 A;  1FOD 2;  4LEJ A;  4YGE A;  2FDK A;  2QQM A;  4BIF A;  1VRH 3;  2Q0A A;  5FZG A;  2F17 A;  4KG8 A;  1RUG 1;  1V0A A;  1HRI 2;  1ZZC A;  2GH8 A;  1GQH A;  3S7I A;  4NUB A;  1K12 A;  3HT1 A;  4AED B;  1AL2 3;  2Y26 A;  3C7O A;  2E32 A;  3WHT A;  1AX0 A;  3IPV A;  4HN1 A;  5FZO A;  4B1L A;  1W6P A;  2RMU 2;  5BNN C;  2ZEY A;  3O1O A;  3POJ A;  4LBK A;  1AXZ A;  4AQ2 A;  4CPB D;  1WA6 X;  4PBP A;  2JE8 A;  4DRR A;  3KHC A;  3RJR A;  3QCW A;  1QQP 1;  4NR1 A;  5IVC A;  2R0H A;  2B4K A;  4CCL A;  1QH6 A;  4AOC A;  1RHI 1;  3M3Q A;  1VP6 A;  5CFC A;  2GC1 A;  2DF7 A;  3VD7 A;  4L99 A;  4XCB A;  5F3I A;  2ZMK A;  5KHH A;  2BOI A;  4UOJ A;  3V64 A;  2R06 1;  3ZMO A;  1HDK A;  4AE2 A;  2AEN A;  1VB2 A;  2R04 1;  2VUD A;  2UYB A;  4R4X A;  2JJ6 A;  1W3X A;  2JB4 A;  3ZFE C;  1UXZ A;  4QX5 A;  2PEL A;  3LEG A;  5C8W A;  2D3S A;  3NST A;  1ZYB A;  5J1X A;  4UXA A;  5JI9 A;  3KM5 A;  3U0Z A;  3I54 A;  4FFH A;  2VAU A;  5A6Z A;  3ROU A;  1GNZ A;  3WG3 A;  1NA1 A;  3E5U A;  4PLM A;  4IV3 B;  4K9S A;  1UPI A;  5J7M A;  2WN3 A;  5KHK A;  5FY8 A;  4BQ5 A;  2C26 A;  2E51 A;  1BEV 1;  2QQU A;  1ZX5 A;  1JN2 P;  3BAL A;  3T08 A;  3WNP A;  2WZR 3;  3UGG A;  5CFD C;  3VDD C;  4CDQ C;  2ZEZ A;  4UFL A;  4HKO A;  2XLG A;  4XBN A;  2AC1 A;  4XJ9 A;  3BTY A;  3ETQ A;  4AI2 A;  4ZON A;  1UMZ A;  4D7Y A;  3U4X A;  4G9S B;  2KXL A;  3CF6 E;  4X6R B;  2GMP A;  1SCS A;  1GSL A;  2JX9 A;  1LOF C;  3PMS A;  4LIT A;  2R1D A;  2P6H A;  1CAW B;  5FWJ A;  1US2 A;  2BWC A;  2VXJ A;  1HQN A;  3CJX A;  3M3O A;  4CZS A;  2VTX A;  2Z2S B;  4E27 A;  1N3P A;  2UY9 A;  2NQY A;  4NRP A;  2ZGS A;  5FJK A;  4BQ3 A;  2VMG A;  3I7D A;  3EYP A;  2V72 A;  4HKW A;  4CU6 A;  1GZC A;  1PVC 1;  5FAX A;  1UZV A;  3ZXG A;  2CGP A;  1MS5 A;  5LCW L;  4BU2 A;  3VKM A;  3L2Y A;  3R4U A;  4DS0 A;  4CVU A;  2EXI A;  5F1R A;  1UNB A;  2A6Y A;  3NMB A;  2XUE A;  3N7K A;  1NY7 1;  5T55 A;  1A6C A;  4ASM B;  1C8M 3;  1R64 A;  1W2N A;  4QQ2 A;  4XQW A;  3Q8E A;  1RUD 1;  1HRI 3;  5A3L A;  4GH4 A;  1OVP A;  1UF2 C;  4OMD A;  3C8X A;  1VBC 1;  5GAL A;  3GBW A;  1MS8 A;  3GAL A;  2WUH A;  1DYO A;  4MLO A;  1KQR A;  4N9I A;  2BU9 A;  4NRQ A;  4NRM A;  3BOD A;  5FMO S;  4N43 B;  3USU B;  2LRO A;  1TME 1;  4HT1 T;  2RDS A;  5AC9 3;  3NAP C;  2W1U A;  4FTB A;  4FXG B;  1YIP A;  2V4A A;  3ZYH A;  1ZBA 1;  2VZO A;  3GF6 A;  5C3P A;  1GIC A;  2XUM A;  1PZ7 A;  3IKW A;  3WT3 A;  2NLR A;  3I3E A;  3H9A A;  4JHT A;  4AYU A;  3SIS A;  5GJ6 A;  2D6L X;  3KT4 A;  5ERL A;  1QJU 2;  1VB4 A;  4XF0 A;  4YG0 A;  4AHY A;  4DFS A;  3ES1 A;  1WW6 A;  4S2H A;  1LOC A;  1HQW A;  2UWA A;  1LOF A;  4W6X A;  1BZW A;  2W3J A;  4S2F A;  1D2S A;  4NRO A;  2DCZ A;  4BPZ A;  4QX7 A;  5L19 A;  5FJH A;  4EQV A;  3IAP A;  4NHY A;  1YIF A;  3SEE A;  4LUK A;  4Q8K A;  5T3N A;  4NPR A;  4GZ9 A;  4AVV A;  4NWW A;  4RR3 A;  3OTF A;  4NN0 A;  4PIZ A;  2XML A;  1B35 A;  2PAK A;  1CAV A;  1ULC A;  1TVG A;  1S0F A;  2CAV A;  5DQ0 A;  4G3Y C;  1TMF 3;  4E4H A;  1UIJ A;  2VTX J;  2ZEW A;  4P02 B;  4JCK A;  4WM8 A;  2VNO A;  2D6M A;  3FL7 A;  1B35 B;  2PQQ A;  5J98 B;  2JIG A;  4YFW A;  3VL8 A;  5FPU A;  1QOO A;  2L9L A;  1R1A 1;  4Y3O A;  3C7E A;  2IZW A;  1L7Q A;  1RIR A;  4BQ2 A;  4EZ4 A;  4BQW A;  4MHR A;  5IWF A;  1OHF A;  5FO9 B;  4E4S A;  1REF A;  5DG1 A;  5LEJ A;  3SKJ E;  2YMZ A;  2XH6 A;  3ZMN A;  1JZ2 A;  3DYM A;  1OQD A;  3T3Y A;  1COV 1;  3FLR A;  4LO7 A;  3H3L A;  1GZW A;  1MQT B;  1CIW A;  1DQ2 A;  1X82 A;  3ZDV A;  1VAL A;  2HWD 3;  1O3R A;  1LJ7 A;  5FV3 A;  2FZ2 A;  5JXI A;  3GJB A;  2I74 A;  4P5Y A;  2ZJC A;  4HAN A;  1UYX A;  2YZ4 A;  1DGW X;  3AKT A;  2P5B A;  2OZJ A;  5FMD A;  1LHV A;  4A7Y A;  2FDF A;  3AMQ A;  2ZEX A;  4WZF A;  1F4H A;  1SLI A;  4M3C B;  4OCT A;  4C0H A;  1RGS A;  1ZBA 2;  3OY8 B;  3P3P A;  4YZ3 A;  4XAB A;  4A42 A;  4N9H A;  5I8T A;  3WCS A;  1AR6 2;  5FY9 A;  4QGN A;  1RED A;  2RM2 3;  4FPJ A;  4LT5 A;  1MZE A;  1WLD A;  2HLE A;  2XJQ A;  5EFU A;  1HQL A;  3WSO A;  4GKY A;  4D0Q A;  1AR6 1;  5ANN A;  2I07 B;  3CNA A;  1RIN A;  1BYH A;  2J1U A;  3LCP A;  1GP4 A;  4MOA A;  4J25 A;  5HI0 A;  4OI4 A;  1W6Q A;  5FUP A;  2Y6F A;  2OVU A;  3KHB A;  3NAP B;  4S2D A;  1HX6 A;  1NKG A;  1POV 0;  1RUD 2;  4IV1 A;  4FSJ A;  1U0A A;  1W6M B;  2OUJ A;  4AVC A;  4YW7 A;  5EYX A;  2ZGQ A;  2VZV A;  3AYA A;  1L3J A;  1JHN A;  1IPS A;  3MFA A;  4I01 A;  4OZX A;  3H50 A;  1EAH 1;  4FAH A;  1JH5 A;  2EIC A;  2VU9 A;  3IMN A;  1C8M 1;  3ZSK A;  1HXS 2;  3ZR5 A;  4EV0 A;  1RUH 1;  4HLT A;  3AP5 A;  2BVB A;  1VBC 2;  3IPV B;  1AYN 1;  5FZO B;  1I1E A;  1HRV 3;  1TMF 2;  2DTW A;  4WZC A;  1RUE 3;  3N9Q A;  2D98 A;  4XF3 A;  5IFT A;  4OQ8 A;  3PME A;  4FQZ A;  4Q4X 2;  1FXZ A;  2R1B A;  3AKS A;  3H1M A;  4WM8 B;  1HN1 A;  5J96 B;  1JYW A;  1ZVF A;  4NOT A;  3IAQ A;  2WT2 A;  2UWB A;  3WG2 A;  1PGL 1;  1NA1 B;  1XNK A;  3K75 B;  4XFI A;  4AVA A;  4WVV A;  2X5I B;  2X09 A;  3MLL A;  4H3W A;  4HN0 A;  4QAW A;  4ZS3 A;  5FXZ A;  4CDW A;  2WAO A;  2Y0O A;  4Q0P A;  3VBH C;  3LE0 A;  2DCK A;  4RGA A;  4MGT A;  3O14 A;  3VDD B;  4XUR A;  4CEY C;  4FQ4 A;  2A5Z A;  5KBF A;  3WZ1 A;  5A6Q A;  1LOE A;  3WNN A;  1QDC A;  3THT A;  5KC6 A;  3JU9 A;  4IE7 A;  3SH3 A;  1CD3 G;  1BEV 3;  1KJR A;  5LA9 A;  4LJH A;  4O65 A;  4P9J A;  1PGS A;  3RWN A;  1A3K A;  3OD0 A;  4PI2 A;  2RHP A;  2XQX A;  3M4F A;  1W03 A;  4KQ7 A;  4CPB A;  1XSQ A;  4ASK A;  2HJI A;  4Y33 A;  2O8Q A;  1J58 A;  1JZ4 A;  1T6G C;  1QJU 1;  3DEM A;  3NNF A;  1DGR A;  3CO2 A;  4DY3 A;  1W8O A;  5GZG A;  1ZZ9 A;  2W1W A;  4IET A;  5FQ0 B;  2BRT A;  4UFJ A;  4AR2 A;  2WSV A;  2VQU A;  4ISR A;  4AFA A;  5J3U A;  1QU0 A;  1R08 3;  4RA0 A;  1W8F A;  2OPK A;  2BQP A;  2PHT A;  2WO1 A;  3EB7 A;  3ES4 A;  4AVT A;  3C7G A;  4YVS C;  4E2G A;  2CDP A;  4XE9 A;  4XC9 A;  1EUT A;  4RHV 3;  5FYV A;  3WQ0 A;  1MS9 A;  1W2T A;  5EV7 A;  5LRS A;  4PJY A;  3LAG A;  5FZC A;  3A7Q A;  4UW4 A;  2WQZ C;  1LEN A;  1NQJ A;  1OF4 A;  3VBR B;  1MVE A;  5CIR A;  2DVB A;  2VJX A;  2P4E A;  2WFP A;  1FOD 1;  2XL9 A;  1L7L A;  4LBN A;  3BPZ A;  3TBD A;  4P14 A;  3VBU A;  5K8S A;  5T5P A;  2ZGM A;  4HPK B;  5F5Q A;  2MEV 1;  5A7W B;  1G86 A;  4AI1 A;  2DUR A;  3NO8 A;  3S0M A;  2VUA A;  3TAY A;  1C28 A;  2B9V A;  4RHV 1;  3MPB A;  5L7O A;  3BYW A;  5L36 A;  3C7F A;  1TMF 1;  1GWK A;  1AXY A;  1UXX X;  4OFG A;  1WA4 A;  2BP6 A;  3LOI A;  4MSV A;  3Q8B A;  4GJY A;  4LXL A;  3TEX A;  4IL7 A;  3FWE A;  4OHZ A;  2QFE A;  2RS3 2;  2K2S A;  4NO4 A;  5GZE A;  2YDE A;  3VZJ A;  2VUC A;  2ZPX A;  4HKL A;  1CN1 A;  1F9K A;  1JOP A;  5FOJ B;  1R09 3;  3VGI A;  2GZW A;  2ZHL A;  5F6L B;  1SQ4 A;  4NII A;  4BYY A;  3KSC A;  4CCM A;  1QJU 3;  1Y43 B;  2VW0 A;  4XUO A;  1AR8 2;  3BU7 A;  3I2O A;  4JGY B;  5FYM A;  1D7P M;  3ZXE A;  3I8T A;  2VZT A;  4GAZ A;  2VQ0 A;  4EJR A;  2GN7 A;  5EXO A;  5FYS A;  3FHA A;  3NW4 A;  2KM2 A;  1CWP A;  1VMH A;  4CE8 A;  3HWJ A;  3KT7 A;  2XHN A;  3S30 A;  3AXE A;  2QQI A;  2ARA A;  2PFW A;  1GZT A;  5FZ9 A;  1K42 A;  4LOT A;  5EYY A;  2JE7 A;  3ABZ A;  3ZSE A;  2JD9 A;  4DOU A;  3O1M A;  1EY2 A;  4FOV A;  4LHS A;  4QD2 A;  2CGO A;  2QQO A;  2RS1 2;  3IDB B;  4BOW A;  5B2G B;  3N35 A;  3RMX A;  4QX3 A;  5HV0 A;  5H9Q A;  2DYC A;  5FZ8 A;  1RUJ 3;  3NKT A;  4YGB A;  1PO1 2;  2Q30 A;  2D5F A;  2R06 3;  1DG6 A;  3R4S A;  1S2B A;  1UX6 A;  4XMI A;  3THP A;  4BXS V;  1W6N A;  3M1H A;  4CDQ B;  2QQN A;  1UOF A;  4QPI C;  3V0A B;  5IK8 A;  1S2E A;  3UET A;  4JVA A;  1PM7 A;  2QDN A;  5A32 B;  4NIH A;  4GMP 1;  3E6B A;  4IV1 B;  4DUV A;  4IES A;  4OHV A;  2B39 A;  1R1Z A;  1O8P A;  1GOG A;  3BOW A;  4LIV A;  1C8N A;  1SZB A;  3VBF C;  1W6Q B;  5A6Y A;  5IVE A;  4B7E A;  1Z78 A;  2EXH A;  2XJR A;  3AB0 A;  2E7T A;  4AVS A;  4CUC A;  1V6I A;  1UX7 A;  3BOP A;  4DO0 A;  1B09 A;  1MS3 A;  2NN8 A;  2XG3 A;  1OOP C;  1UYP A;  2WJS A;  2YU2 A;  1SHW B;  4IEQ A;  3I2I A;  5IVF A;  1UCX A;  3DEC A;  4ARY A;  4KBB A;  1Q43 A;  1VMF A;  1EAH 3;  3ZYJ B;  5TSW A;  2WNE A;  1HIX A;  3S6P A;  3SQO A;  1QGL A;  2YFZ A;  2WQ4 A;  3IMM A;  3WP5 A;  1RUF 2;  1RC6 A;  4A3X A;  5DZE A;  2DBN A;  5KXE A;  2C1F A;  5FZD A;  1D2Q A;  5I91 A;  2BDR A;  1OT5 A;  5B4N A;  2VZ1 A;  1LEM A;  3IDC B;  3BB6 A;  2WNV A;  2TEP A;  1H8T B;  5JSR A;  5KWR A;  3AZY A;  1FT9 A;  3ZXL A;  2D6N A;  2RM2 1;  2ZAB A;  1CZV A;  4AWD A;  4EN7 B;  4AHW A;  3WF1 A;  1H4G A;  4Q27 A;  1W6N B;  3D0J A;  1SPP A;  2BYV E;  1EPZ A;  2Y38 A;  4C1W A;  4K8F A;  4H7L A;  5H9R A;  5JSO A;  3FE5 A;  1VBB 1;  1QNW A;  2W9X A;  4AED C;  1OPO A;  3NQH A;  1X8M A;  4L8Q A;  1YNA A;  4FPY A;  5GKA C;  1QF3 A;  2BJS A;  1RUD 3;  4EWE A;  2WR9 A;  4ZU5 A;  1RUN A;  1GMM A;  2JE9 A;  1HB1 A;  4M01 A;  1ZRF A;  1AR9 3;  1PIV 1;  3DKW A;  1XXN A;  3NJV A;  4L9B A;  2FDG A;  2DBI A;  3VHO A;  1W2O A;  4D94 A;  5FYU A;  1UN1 A;  1XB9 A;  3AJZ A;  3PVO A;  2D44 A;  3N3H A;  3ETP A;  3GBG A;  1BHG A;  1MQT C;  4MGZ E;  1BK1 A;  2EIB A;  5JOW A;  1N47 A;  4ATF A;  4BXF A;  2IXL A;  2GSY A;  4P00 B;  4YWA A;  3III A;  3G7D A;  5D1I A;  5FDB A;  4TYS A;  4BA6 A;  5JOX A;  4EE2 A;  3M3C A;  1RUE 2;  5E8A A;  1TE1 B;  1UY4 A;  5A1A A;  3VD3 A;  1OOP B;  4J6G A;  2Q4S A;  2C5D A;  4GD4 A;  1F31 A;  2E7Q A;  3HQU A;  3PIJ A;  2HWF 3;  1VBC 3;  4KMQ A;  2BNO A;  3C3V A;  5IW0 A;  4OUL A;  2ERF A;  3JQX A;  1ZRR A;  4AF9 A;  4MVT A;  3P6B A;  4U36 A;  2DFB A;  4OUE A;  2J1V A;  2ZGL A;  3RS6 A;  3A23 A;  5LW9 A;  2VCA A;  2B45 X;  1OLM A;  5IJR A;  3ZR6 A;  2XDV A;  4XEZ A;  3BTX A;  4NAO A;  1U12 A;  4AVB A;  4QPI B;  3B5L B;  1NCR A;  5FCC A;  1LGC A;  2RE9 A;  5EJ3 A;  3NV2 A;  5A7W A;  1VLN A;  1YO8 A;  1X7N A;  2MNG A;  4FOQ A;  3PDQ A;  3VKL A;  1DLC A;  1OUS A;  1HV1 A;  3RI8 A;  4CEW A;  2IXI A;  2XLF A;  1KFU L;  3SEP A;  2HWB 1;  4RYD A;  3T1L A;  1QMJ A;  2JEN A;  1KGY A;  4IEX A;  2BPA 2;  1V6K A;  2R07 1;  2XJV A;  1W8U A;  5FP7 A;  3POW A;  4XJU A;  1RVF 1;  2ID4 A;  4IE6 A;  3WNX A;  2RS5 1;  3CQO A;  1BEV 2;  2WAB A;  2WL1 A;  4DIQ A;  1XNB A;  4IE5 A;  1Q8V A;  1PX4 A;  3NNJ A;  5C3Q A;  4D8M A;  3HBK A;  1CES A;  3OGR A;  1GR3 A;  3BVC A;  2XR4 A;  5CYY A;  2E53 A;  2QTW B;  3OEB A;  4NJ4 A;  5JVV A;  4A3Z A;  4BME A;  5IVV A;  2WS9 2;  4B29 A;  3PUR A;  3I59 A;  4YVW B;  1PZ8 A;  1ZZ8 A;  3EO6 A;  2OUH A;  1H2K A;  4XFF A;  5SV5 A;  2WZP P;  2DU0 A;  3O1R A;  2GC0 A;  1RMU 2;  1OFS A;  1F2N A;  1KFX L;  1RVF 3;  2VTF A;  2VC9 A;  2YG0 A;  2GDF A;  1CR7 A;  1HB4 A;  2OYZ A;  3D3A A;  1FI2 A;  4B4R A;  1JYC A;  2XVL A;  2IXC A;  2GNM A;  3UK9 A;  1HB2 A;  3W9A A;  4D7T A;  1C5H A;  1STM A;  3ZXA C;  1RL3 A;  2NMO A;  5FY4 A;  2R32 A;  1AYM 3;  1E5H A;  5L9B A;  4COZ A;  1QQP 2;  1ZRE A;  2VZU A;  1G8W A;  2YPD A;  4CRQ A;  5BNP B;  2VM9 A;  1NQD A;  5FYZ A;  4FPG A;  2AAC A;  4GWN A;  1W90 A;  1QJX 1;  3LEK A;  1VAK A;  1JZ7 A;  5EJZ B;  4QXH A;  4R9D A;  4XQ4 A;  1GYK A;  3CKH A;  3LEM A;  3LSE A;  2YGL A;  3OY8 A;  4FI9 A;  2X8K A;  1QXP A;  2PXJ A;  1OD5 A;  1FOD 3;  2WZ8 A;  4KWJ A;  4WM7 A;  3B3Q E;  3VD4 A;  4Z8B A;  5BNP A;  1ULD A;  1VRH 1;  4AXO A;  5I93 A;  2X10 A;  5DMY A;  1OBN A;  4Y20 B;  1ENR A;  1K5M C;  4LO6 B;  5BNO A;  1CX1 A;  3ZFF A;  1LOB A;  1VJ2 A;  2VUL A;  1MEC 2;  2WWU A;  3ACF A;  3MUZ 1;  2XLA A;  1IS6 A;  2ZML A;  2SLI A;  4I0A A;  3H1W A;  5GLZ A;  5A7O A;  1IKQ A;  1V9U 1;  2BGO A;  2HWC 2;  2ZAA A;  1LB2 A;  3AM2 A;  3S5Q A;  3T0B A;  3LA2 A;  4UW5 A;  3GZT B;  1ODN A;  1O4Z A;  3VBH A;  4HFS A;  4ZXE A;  1CAU B;  1UO9 A;  1QXR A;  4E8C A;  5BNO B;  2GME A;  4YM1 A;  3H1Y A;  4LOS A;  3USU A;  3JD7 1;  2Y60 A;  4XXP A;  4XJZ A;  2VPV A;  3J26 N;  4PHZ A;  4Y5S A;  1W9F A;  2X53 S;  3DN7 A;  5KHI A;  1DQ6 A;  3GXU A;  1XNC A;  1G9D A;  4M4P A;  1CGP A;  1RUI 2;  3MPP G;  2W47 A;  3U11 A;  2JG9 A;  2D6P A;  3DGT A;  3NRU A;  3RMY A;  2K46 A;  1SBF A;  4CYD A;  2B9U A;  2FMY A;  2OA2 A;  2PLV 3;  3FHQ A;  3O5S A;  1OKQ A;  4GIQ A;  4KBZ A;  3K3N A;  3LIH A;  4XIO A;  3VHP A;  4UF0 B;  5C8C C;  2F4P A;  3H42 B;  1W06 A;  5F2S A;  2ZCW A;  3POG A;  4YM3 A;  2VZ3 A;  4K40 A;  3ZYR A;  1ZA4 A;  3KV6 A;  3LGR A;  2HBT A;  4AGV A;  3D6E A;  3WQ1 A;  2W46 A;  3DYO A;  4Q4Y 3;  2YHJ A;  2E7A A;  3EMR A;  3AX4 A;  5FUN A;  4CCN A;  3D0S A;  3ZXJ A;  3DCQ A;  5CAD A;  1CAW A;  1ULG A;  2WA4 A;  2J1A A;  4LA2 A;  4YVW C;  3UGF A;  3WF0 A;  5I0T A;  3HBZ A;  4XAC A;  3MLK A;  3WQ7 A;  1W6P B;  4OI2 A;  4AQ6 A;  1FPN 3;  1S0I A;  3RZZ A;  2PMW B;  2QZ2 A;  1QOS A;  4XF1 A;  5A7S A;  3W21 A;  3X29 B;  1QJY 3;  5C7G A;  5FPB A;  5JMC A;  4FPO B;  1J1T A;  4F83 A;  2OQ6 A;  4AW7 A;  1JXN A;  2JG8 A;  5IUQ A;  3OB8 A;  5A3U A;  2YY1 A;  1RXG A;  4ISQ A;  4Q0U A;  1UY2 A;  3VUO A;  2XBO 3;  3B9C A;  2ZGR A;  4B1M A;  2VO5 A;  1N3O A;  4N53 C;  4XFA A;  4CDU B;  3RYK A;  5IAX A;  3PUH A;  3ON7 A;  4M3C A;  2OKX A;  3ZIW A;  5A1F A;  3V0B B;  1VRB A;  3OGS A;  5LBF A;  2ZGO A;  4YGD A;  1EPW A;  4NVP A;  4DXZ A;  4MV2 A;  3TOJ A;  5A3P A;  1UZW A;  4RS5 A;  2FMD A;  3WW2 A;  3KV9 A;  3A22 A;  4IE0 A;  2ZA9 A;  4LBM A;  4LKS A;  3T2Q A;  2VOV A;  3W58 A;  3OSD A;  3S5A A;  3KS7 A;  5J48 A;  1YQ2 A;  5FIX A;  1BXH A;  4P9X A;  1YUD A;  4A6S A;  5JXH A;  1BMV 1;  5K0U B;  1JYT A;  3RYP A;  4RD7 A;  5C6C A;  3I97 A;  5D2A A;  1WLC A;  1JZ8 A;  1WBL A;  1O4Y A;  2B5H A;  2ES3 A;  4UFK A;  4E8D A;  1WCK A;  4LMF A;  3NAP A;  1ULO A;  1Z7S 3;  4QGL A;  1GQG A;  3RDI A;  3URF A;  2DUQ A;  4RFR B;  3NJY A;  4TLF A;  3Q8C A;  1V6O A;  4L11 A;  2PQS A;  4Q4X 1;  4OHW A;  5FYI A;  5FZ1 A;  1LOA A;  2GC3 A;  3PUQ A;  4R9C A;  3K3O A;  1RUJ 1;  4KH9 A;  1O7F A;  2ENR A;  4QQO A;  3WXP A;  2YBK A;  3LWC A;  3FMG A;  2WA3 A;  5LAT A;  1S0B A;  1ND3 C;  3UJQ A;  2TBV A;  3LKJ A;  2HWF 1;  2ZOE B;  3UNP A;  4UWD A;  1S55 A;  1QIQ A;  2XXZ A;  5LA0 A;  3KCX A;  4WVW A;  3OPW A;  1X50 A;  3ELN A;  5D21 A;  2BEO A;  5DAV A;  2E26 A;  1ONA A;  2OII A;  2QQJ A;  2EAA A;  1MQT A;  1LHO A;  2W1S A;  3CU7 A;  4NHK A;  2P37 A;  4UYB A;  3V65 A;  5JDB A;  1WLT A;  4HON A;  4DXT A;  1WCU A;  2VQT A;  5L7O C;  3WDT A;  3ZYF A;  2JWP A;  5SV8 A;  5F3G A;  3MUY 1;  2VBP A;  1ST8 A;  1RJ7 A;  3ASI A;  4LNV A;  3GYD A;  4JGZ A;  4F8A A;  5D8A B;  3PU8 A;  3ZDS A;  4YZ1 A;  4HL0 A;  2PLV 1;  1ZZ6 A;  1OA2 A;  4QQP A;  5KHJ A;  1GZ9 A;  1LHN A;  2Y64 A;  4JHZ A;  2ETE A;  4E2S A;  3AP7 A;  3OBT A;  3OF1 A;  3POS A;  1XBF A;  2VVF A;  3LA3 A;  3KLS A;  4OHY A;  3I3D A;  2DV9 A;  1GUI A;  3P1I A;  4AG4 A;  4DIN B;  2OPW A;  1XYP A;  4FFG A;  1F15 A;  4OHX A;  4JGZ C;  3NV4 A;  2R7E B;  1RMU 3;  1PIV 2;  1Q5O A;  5CKM A;  2VH9 A;  3UGH A;  4FPK A;  5FZ3 A;  2P3Y A;  2WO3 A;  1BBT 3;  2YRO A;  3MIF A;  3RRD A;  5KXB A;  1WMD A;  3ZFE A;  3FZ3 A;  1OLR A;  3BUC A;  2PN5 A;  4XTM A;  3T2O A;  3LIG A;  1ZBA 3;  1H0B A;  2ZKL A;  1H9W A;  3SMH A;  2GP5 A;  1S0E A;  4B8E A;  4LK7 A;  2PHX A;  5FK7 A;  2AZ5 A;  1OQ1 A;  2CGN A;  3GBF A;  4BIS A;  3PLQ A;  1ENX A;  3Q8F A;  1IQA A;  5FTT C;  2ORZ A;  4A7Z A;  4E4D X;  4LBO A;  5E1R A;  2NZ9 A;  4C1X A;  2E63 A;  2DCY A;  1URX A;  1PGW 2;  2QKD A;  1D4M 3;  4MGI E;  1R1A 2;  1A8M A;  1JUI A;  1LU2 A;  5C9A B;  3I2K A;  1NOV A;  3A0N A;  4JKK A;  4COU A;  1VPH A;  3CEW A;  1W2U A;  4NWV A;  3T2T A;  3UKV A;  2H6C A;  5EP9 A;  4AHX A;  2PA7 A;  5L9R A;  2FZ1 A;  3ZFF B;  2ZZQ A;  1GBG A;  2F6B A;  2RDQ A;  5FK8 A;  5LK7 B;  5F2W A;  1Q56 A;  2YFU A;  4AEM A;  4JDN A;  3Q9O A;  1SLT A;  1AVB A;  5C4W A;  4Z2W A;  5GLV A;  4R9B A;  2ORX A;  5A33 A;  1LKN A;  3I3B A;  3QBQ A;  1AJK A;  1LUL A;  1QJY 1;  3IM0 A;  4LO5 B;  1PVC 3;  3RSJ A;  2A71 A;  5GZC A;  3HPN A;  5AC9 2;  3HN1 A;  1O8S A;  1ULE A;  3MV1 1;  4BCU A;  3BI3 A;  4GWJ A;  5CFD B;  3LF7 A;  3LB9 A;  5C4W C;  3RZJ A;  3VHN A;  2C9K A;  2JXA A;  3BCW A;  1FAT A;  2VG9 A;  4JZR A;  3U4S A;  2YXS A;  3I3Q A;  4ZU7 A;  3NNG A;  4PIY A;  4Q4V 1;  1HJG A;  1UWW A;  2YB7 A;  1X33 A;  3OPZ A;  3IZO A;  1O5U A;  4XDP A;  1AJO A;  4MYE A;  4LBQ D;  3ACI A;  4KL1 A;  4WVM B;  4BMB A;  3VBO C;  3VKO A;  4CU8 A;  3MZH A;  2PHR A;  5DAQ A;  2VE1 A;  4KI5 M;  4YZ2 A;  3POB A;  1YFX A;  4QDS A;  1YRZ A;  1RIT A;  2RS5 3;  2QQW A;  3GDB A;  4AAX A;  4TTG A;  2D5H A;  5FXW A;  3VBR C;  3PL0 A;  3VBF A;  4FPL A;  4ES8 A;  5DXD A;  1DBN A;  1DQ0 A;  1VBA 3;  2BGC A;  2HWB 3;  5DDJ 1;  4NID A;  2C9A A;  1R08 2;  1UY3 A;  1F5F A;  1I5P A;  3MYX A;  4UT5 A;  1LAJ A;  4OYU A;  2DDU A;  2ZX1 A;  2EXK A;  2PLV 2;  5A70 A;  3JD7 3;  4O7X A;  2WII B;  2Y33 A;  3RQ0 A;  2JKB A;  3ECQ A;  4CDW C;  5FY1 A;  4A2U A;  5LY1 A;  4LBL A;  3VBR A;  1NY7 2;  5FZ7 A;  2RVA A;  5J36 A;  5FMO L;  4E2Q A;  2AEY A;  2MEV 2;  2Q8O A;  3ZFG A;  5JR2 A;  4QPG C;  3VDA A;  3O1V A;  5IAT A;  1C5I A;  4DY5 A;  4Q4Y 2;  1SDD B;  3EHK A;  4R8H A;  4IGQ A;  3O1U A;  3MF9 A;  1EV1 2;  3W20 A;  5AVP A;  3H7Y A;  1GOF A;  1UU4 A;  3MW2 A;  4LLO A;  3M3E A;  4OUM A;  3AZX A;  1REE A;  3V0A A;  2TNF A;  5F7U A;  3LPG A;  3GM8 A;  4L92 A;  3GNE A;  5LA1 A;  2YU1 A;  2D6O X;  3B00 A;  1OMI A;  3ACL A;  2QJV A;  2YGM A;  4QX0 A;  4AGR A;  2KD7 A;  1ZZB A;  3B94 A;  2ZAH A;  5CB7 A;  5LZ6 A;  3J8F 2;  4QDQ A;  1O5L A;  1UAI A;  3LZZ A;  4MO3 M;  1LNS A;  2QZ3 A;  1WW4 A;  3W59 A;  3AVR A;  4Y1Z A;  1PK6 A;  1Y9G A;  3D4K A;  5A7N A;  3SCH A;  1UZY A;  1XC6 A;  3AMM A;  4ZXK A;  5C3R A;  1YQ5 A;  3IBM A;  1W39 A;  4GJZ A;  1JU3 A;  4IE4 A;  4DXS A;  1W8W A;  4P9Y A;  2VZR A;  3E1F 1;  3VBU B;  4AI0 A;  1ACC A;  2D3R A;  2HYX A;  3A4U A;  3OJB A;  5KR7 A;  1MZ5 A;  1KRI A;  4Q4W 3;  2WNV B;  4QKN A;  3BN6 A;  3K46 A;  3OBZ A;  4FXK B;  5FZB A;  3L9J T;  4MXW A;  1R09 2;  1XNT A;  2ARB A;  1JYV A;  2EID A;  2CY6 A;  1C1L A;  5EZW A;  3WDV A;  4B4P A;  1G6N A;  2MHF A;  1JW6 A;  3WHU A;  5FMC A;  1UYY A;  2IXK A;  5FO8 B;  2ZGU A;  4MGS A;  1FX5 A;  1K5M A;  4XBL A;  4C0B A;  1O3S A;  3TRS B;  4CA9 A;  4YW3 A;  4CEY A;  1LGB A;  4ERO A;  2RR1 3;  1LCL A;  1VBD 2;  4CDX A;  2E9Q A;  3C7H A;  1TNR A;  3O12 A;  2RS5 2;  4LO8 A;  4LBQ B;  1GNH A;  5ACA 1;  2FDH A;  1OLM E;  3ZVX A;  2Q8E A;  4BIO A;  2IUW A;  2R07 2;  2KA3 A;  2A6X A;  1DLL A;  1ZRD A;  3JZV A;  5C3S A;  2HWB 2;  1CAX A;  5L7O B;  3JBG 3;  4XVH A;  5C9A A;  3RZH A;  4FOW A;  1HRV 2;  1JYN A;  2ZAC A;  4ATE A;  3E97 A;  5LBE A;  1ND3 B;  4WM8 C;  4P9G A;  2LUW A;  4I02 A;  4Q4X 3;  3VBS C;  4A7K A;  4CP1 A;  2BBV A;  1KIT A;  3AK0 A;  1ULF A;  3KV4 A;  1UKR A;  3H3U A;  3MDP A;  1ND2 C;  4H14 A;  5DPN A;  2IVJ A;  2R49 A;  1CJD A;  2Y6G A;  4N43 C;  4Q1P A;  2K0G A;  4XOG A;  1H1A A;  5A3N A;  3KT1 A;  2JEM A;  2VQA A;  3B01 A;  2YC2 A;  1K3I A;  5JZG C;  1H8T C;  4LE3 A;  3WQB A;  4CCK A;  2P6C A;  2V5Y A;  3NJZ A;  4GA9 A;  1IG0 A; 
#chains in the Genus database with same CATH homology
 4LIU A;  2XXZ A;  4BU2 A;  3OPW A;  5FZH A;  4CSW A;  5F3C A;  4QWN A;  5F5A A;  2GP3 A;  5FYH A;  4D6R A;  4GD4 A;  3DXT A;  5FY1 A;  5LY1 A;  2XUE A;  3KVB A;  3N9M A;  2W2I A;  4HON A;  5FZ7 A;  5FZI A;  3N9L A;  5IW0 A;  5FYB A;  5K4L A;  3UYJ A;  5FP9 A;  4CCM A;  5F3G A;  5FYY A;  5FXX A;  4EYU A;  5F5I A;  4D6Q A;  4IGQ A;  5A3W A;  3LD8 A;  5FZE A;  5LW9 A;  3PU8 A;  5FYM A;  5A80 A;  2Q8D A;  2XDV A;  5FBJ A;  3K3N A;  4GAZ A;  4CCO A;  4UF0 B;  3KVA A;  5FPA A;  5ISL A;  5FYS A;  3PUS A;  5F2S A;  5FY0 A;  5FZO B;  2YBP A;  5A7W A;  3KV6 A;  5A7Q A;  2YU1 A;  5FZ9 A;  3PDQ A;  4CCJ A;  5FUN A;  5A7P A;  2WWJ A;  3N9P A;  3N9Q A;  4CCN A;  5FZ3 A;  2OT7 A;  5FP7 A;  3AVR A;  5LWB A;  3N9O A;  5A7N A;  4QXB A;  5FZ8 A;  5FZ0 A;  4XDO A;  5FZL A;  5FXZ A;  4GJZ A;  5A7S A;  4DIQ A;  5FYC A;  5FWE A;  5FZD A;  3ZPO A;  2GP5 A;  5FPB A;  4IGP A;  5FZG A;  2YBS A;  4CUG A;  5FZK A;  3OPT A;  4QX7 A;  5KR7 A;  5IVB A;  4HOO A;  5FY7 A;  5FJH A;  2OQ6 A;  4LIV A;  4NUB A;  5FPV A;  2Q8C A;  4BIS A;  5IVE A;  5F39 A;  5IVV A;  5CEH A;  5FUP A;  5FZB A;  5FZM A;  3ZLI A;  3PUR A;  2OS2 A;  4DO0 A;  5FZO A;  2XML A;  2YU2 A;  4QXC A;  3RVH A;  5FYT A;  3PUA A;  5IVF A;  4UF0 A;  4E4H A;  5A1F A;  5E6H A;  4AI9 A;  4IGO A;  1VRB A;  5IVC A;  4ASK A;  4Y33 A;  4CCL A;  5FXV A;  5A3T A;  5FPU A;  4C8D A;  5FY4 A;  4TN7 A;  5FZF A;  5F2W A;  5A3P A;  3K2O A;  4AAP A;  5FZA A;  5F3I A;  4Y3O A;  2Q8E A;  3KV9 A;  5IVY A;  4V2V A;  4EZ4 A;  2YPD A;  5IWF A;  5FZ4 A;  5FP8 A;  5FYZ A;  4D6S A;  5F3E A;  4EZH A;  5FYV A;  5A1L A;  5IVJ A;  5FZC A;  3DXU A;  4QXH A;  5FPL A;  5FZ6 A;  3AVS A;  5FP4 A;  3AL6 A;  5FY8 A;  2PXJ A;  3U4S A;  3AL5 A;  4Y4R A;  5F5C A;  5FV3 A;  5FY5 A;  4URA A;  3KV4 A;  3U78 A;  3NJY A;  2VD7 A;  5F37 A;  4XDP A;  3PTR B;  4QX8 A;  5FP3 A;  3LDB A;  5LY2 A;  5FYI A;  5A7W B;  5FZ1 A;  2WWU A;  2OX0 A;  5F32 A;  2P5B A;  5ANQ A;  5A3N A;  3PUQ A;  5FYU A;  3PU3 A;  3K3O A;  3KV5 A;  3N9N A;  4LIT A;  5A7O A;  5FWJ A;  5FXW A;  2YBK A;  5FY9 A;  4CCK A;  5FJK A;  4BXF A;  2OQ7 A;  4GJY A;  4LXL A;  4QU1 A;  4V2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...