5FZLA

Crystal structure of the catalytic domain of human jarid1b in complex with 3d fragment 3-methyl-n-pyridin-4-yl-1,2-oxazole-5-carboxamide (n09954a) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
462
structure length
452
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with 3D Fragment 3-Methyl-N-Pyridin-4-Yl-1,2-Oxazole-5-Carboxamide (N09954A) (Ligand Modelled Based on Pandda Event Map, Sgc - Diamond I04-1 Fragment Screening)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 137
structure length 452
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzlA01
3N9NA 5FZ0A 3KV6A 5FZ4A 3PU8A 4EZHA 5F37A 5A3TA 4CCJA 5FY1A 5A7NA 3U4SA 5FZHA 5LWBA 3PU3A 5FZIA 5FWEA 4LXLA 5FZ6A 5ISLA 4AAPA 4GD4A 5A3WA 5FZ9A 4EZ4A 3N9QA 3PUAA 4GAZA 3PUSA 3KVAA 5FYIA 5A7WB 5FP4A 4LIVA 5A7WA 2Q8DA 5FWJA 5IVCA 5IW0A 3PURA 3PUQA 4HONA 3KVBA 5FZMA 5IVVA 3N9MA 4E4HA 3LDBA 4D6SA 4QXHA 4XDOA 5FY5A 5FZBA 5FP7A 5FUNA 4QU1A 3K3OA 5FV3A 2YBSA 2W2IA 3DXUA 5F5CA 1VRBA 4EYUA 4V2VA 5FYSA 5FZ1A 4TN7A 5IVBA 5F5AA 2YU1A 4URAA 4GJZA 5FYUA 2P5BA 5FYTA 5IVYA 4CCNA 4IGPA 5A1LA 5FZ7A 4CUGA 3RVHA 5FY9A 5A3NA 5FZLA 5LY1A 5F5IA 5A7OA 2OX0A 2PXJA 5IWFA 3K3NA 5FXVA 4AI9A 5KR7A 5F39A 2XXZA 2YBKA 4QX7A 2VD7A 5FJKA 3OPWA 4UF0B 5LW9A 4QWNA 3N9PA 5FYCA 5ANQA 2YBPA 3NJYA 5FZ3A 4IGOA 2XMLA 3U78A 4IGQA 2OQ6A 5A80A 5FXXA 3LD8A 5FZOB 5FBJA 5FPAA 5FZOA 3AVSA 5FYYA 2OQ7A 5FZEA 5A7QA 4D6RA 4QX8A 4QXCA 3K2OA 4DO0A 5IVFA 5K4LA 3UYJA 5F3EA 5IVJA 5A7SA 5FPVA 3KV4A 4C8DA 4Y4RA 4XDPA 5FY0A 5LY2A 5FPBA 3KV9A 5FY4A 5FYHA 3N9OA 5FP9A 4CCKA 4GJYA 5FY8A 2XUEA 3PDQA 5FJHA 2WWUA 5FXWA 5FYMA 4DIQA 5FYBA 2OS2A 2GP3A 5FP3A 3ZPOA 4BXFA 5A3PA 2GP5A 5FYVA 5FZDA 4CSWA 4UF0A 5IVEA 5E6HA 5FZGA 5F3IA 5A7PA 4CCMA 3ZLIA 4QXBA 5FPUA 4NUBA 4V2WA 2WWJA 2OT7A 4LITA 5FYZA 5FZAA 5FXZA 2YU2A 4BU2A 3AL5A 5F3GA 5F2WA 5CEHA 5FZ8A 3DXTA 4Y3OA 5FP8A 5FUPA 3AL6A 5FZKA 2YPDA 4Y33A 5F2SA 4ASKA 4D6QA 4BISA 5FZCA 2XDVA 3PTRB 3AVRA 5F32A 5FPLA 5FY7A 3KV5A 5FZFA 4CCLA 5F3CA 2Q8CA 5A1FA 2Q8EA 4LIUA 3N9LA 4HOOA 3OPTA 4CCOA
chains in the Genus database with same CATH superfamily
4EJRA 3WT3A 1GQPA 1QJY1 1PO22 3AFKA 3KV6A 1VR3A 2ZEZA 4H7MA 4Y24A 4GWNA 3T4HB 4QHBA 1X50A 4FAGA 2DBIA 3H3LA 3VBUB 3IDEA 1QEXA 1W03A 3HJRA 5JXHA 5HXMA 1AYN1 5GLVA 1ZA4A 4JGZA 1AL22 1US3A 3LEIA 5A3OA 4CDQA 5IUQA 1RINA 3TN92 5K7PA 2ZMKA 5KHIA 1GUIA 5APAA 2D93A 2W87A 2OIIA 2V4VA 4FPJA 2Q8DA 2ZS6B 3JD72 1NLSA 2BFUL 2BWCA 4IE6A 4K6BA 4XE9A 4CXYA 5H9RA 1US2A 1MS3A 3VBFC 3I49A 1NE6A 4I0WB 5JOYA 3O1VA 4D6SA 1L7RA 4XIKA 3SH4A 4RFRB 1OT5A 4YG3A 5FZBA 1GZWA 2V4AA 1H8TB 2XOMA 2ZKLA 1CGPA 4A6SA 2W2IA 4ZZ8A 1QKQA 4V2VA 2OUJA 5FZ1A 2D5FA 3AX4A 3LGRA 4QPGB 4GJZA 2IZWA 2BJSA 2VTXJ 5EV7A 5FYTA 5IVYA 5JWPA 4XVHA 3M3QA 1W8UA 3V64A 4FTSA 1FOD1 4YG6A 4P9JA 1AR83 5CBLA 4OUSA 1JZ2A 1RHI1 3AMHA 4CEYB 3ZIWA 4JKKA 4UBHA 4ZZ5A 1ND3C 1IPKA 4GWJA 1ZVFA 2GSYA 2YUEA 4BPZA 1F35A 2Z2SB 4FQ4A 3THPA 1JN2P 1GYKA 2GH2A 3N9PA 4NN0A 4CDUC 5ANQA 3AP7A 1W0NA 5F5QA 1VE0A 4NWVA 3NNLA 2A3WA 1NLRA 2ZGOA 3LIGA 1ACCA 2YPJA 2Y26A 2BVBA 2ET7A 2P37A 2WNVA 1W9WA 3O7OA 1X9PA 2XBO3 2VE1A 1GNHA 3VHOA 1PGW1 3GCXA 5FZOA 2EIEA 3T3YA 1WW6A 4UFIA 4LBJA 1UZ0A 3URFA 1HXS2 5EJ1B 2HWE2 3O0WA 3AP6A 1LOEA 1AR63 2DCJA 5F3EA 4QQPA 5IFTA 4FCAA 3ATGA 4L8QA 1W0OA 5IYYA 1W28A 3AB0A 3FN9A 1UIJA 2W1QA 2ZTNA 3H8XA 4GB33 2TEPA 5CFCB 2JXAA 1XNKA 4BQXA 4YNIA 2WT2A 4XQWA 1W6OB 1Q5OA 2C0ZA 4NHYA 3I59B 1WZXA 1OKOA 4CCCA 3MBWA 4Q4Y2 1F9KA 1U5IA 3AP4A 4P9YA 4RR3A 3ZLIA 4D0QA 2WS93 1JZ6A 1UWWA 2G19A 4Z82A 3Q9OA 1PVC1 4B4QA 5I8TA 4CDXA 2B5HA 2RS53 3AL5A 5GJ6A 4P9GA 3P3NA 2ORZA 3K77A 1WA6X 2HLEA 3ZXAC 5KHHA 4XFCA 4Y3OA 4L2NA 4Y33A 4RQPC 2VW1A 3OEBA 4I0AA 5J36A 2E33A 4XFIA 2BGCA 2HWD1 3MLKA 4A7KA 2VMHA 2GH8A 3VLBB 1RUE3 4WM7A 1WBFA 1SBFA 2GC2A 5BYNA 4R4XA 4LOTA 4CPBD 3ZFGB 1O3SA 2O0OA 2ZX3A 2SLIA 3WEZA 3LOBA 4HSLA 4NAOA 2WWSA 3GNEA 2HYKA 4Q29A 4XURA 1A78A 3UL2A 3ZM8A 4A45A 3GBGA 2DCKA 2YMZA 1K12A 4YFWA 3ZYRA 4N43C 1MEC2 2A70A 4HBNA 3ZSMA 4X6RB 1UQXA 1QJY2 3FUQA 3KCXA 1LOCA 2IXIA 2VQUA 2B8MA 1QOOA 1GOHA 4XFGA 2XR4A 4MGKE 4UYBA 5J7MA 5KHKA 5BV6A 4QQLA 1NOVA 3FBYA 4FVVA 3UV9A 1AYN2 1F5JA 2G9FA 4M0NA 5FP4A 1S4CA 3LSDA 1EAH2 3AZYA 4FOVA 5FOJB 2Z69A 1NKGA 4HONA 4LO5B 3MDPA 2V09A 2XQXA 5A33B 5DMYA 2IWGB 1J83A 5FP7A 1W9TA 1OD3A 3P1IA 1S0JA 1IS3A 4IEPA 2C9KA 4NPLA 5FOBB 1K5MA 4XBNA 1S0BA 2WQ4A 2VMFA 4UXAA 3W5MA 1S0IA 1HLCA 3AC0A 1E5RA 3WZ1A 5GALA 4E8CA 1LJ7A 3AYDA 3SNMA 2Q1FA 1LOGA 4D7TA 1O4ZA 3MW2A 3WW1A 1Z78A 5C71A 4YVSC 2E63A 4JTNA 2PXJA 3ZKYA 4QHOA 3I3MA 3GGLA 3N35A 4R9BA 2XJRA 4TYSA 1XU1A 3ZX7A 4NRQA 2R30A 5J1XA 1QHDA 3O1UA 3KHBA 3WOGA 2WLPA 3OCPA 1S0FA 4ASLA 2XJQA 3BALA 1A34A 1RHI2 2CGNA 4Q1RA 3VBOA 1W8NA 4M01A 3HN3A 1NCRA 5L19A 3HQXA 2X8KA 3I54A 1F4AA 3EB7A 1GQHA 4MGZE 3WW2A 3ZDSA 3MUZ1 4HXCA 4NJ4A 1GKBA 3AXEA 1SFNA 1RUJ1 1BBT3 4ATFA 4RD7A 3LDKA 3LCPA 2A75A 5DDJ3 4Q5OA 3VKOA 2XKPA 3FWEA 2W52A 1RUG1 3POBA 3KV9A 4H7LA 3NW4A 4LBOA 4MHRA 3JBG1 3VZNA 3LAGA 1C1LA 2VOKA 1DG6A 4D7SA 1RMU3 3RG0A 4NPMA 1HQLA 1TME1 2HEYF 1QJU2 1XSRA 2NMNA 3LFIA 4G9SB 4IXLA 5A3PA 5JCTA 4XF1A 2PHTA 1PNFA 1MVEA 1ZBA3 3M3IA 4H14A 5F1RA 2Y6HA 1SG3A 1SLCA 4JQRA 4JCKA 5GZDA 1D4M1 1MQTB 1X9TA 2RMU1 3TWIA 2G1MA 1XNCA 2HKXA 3CF6E 3NNGA 3ZXDA 5BPXA 3LOIA 1YJKA 1LENA 2XONA 2VZQA 1LOBA 4CVUA 3IWZA 1FMD2 2R32A 3EMRA 3P5BA 3I2IA 2X5IC 2B39A 3WW4A 2VJXA 3RQ0A 5FZKA 3HT1A 1PVC2 2JICA 3ZN6A 4OQ8A 1R1A3 4ORFA 1YFYA 2YGMA 2NN8A 1DQ0A 3AK0A 4LUKA 2BBAA 1BLZA 4DEVA 5A70A 3ILNA 2OVUA 5JDBA 5B4NA 1SLTA 2BFUS 1ST8A 3MFAA 3RFRA 1ONAA 2PQQA 1COV1 3GJBA 3FUOA 3IDBB 2BW8A 4LIUA 3ZMNA 4A7YA 1X36A 1IHMA 3OBRA 4L0PA 2HWD2 1FT9A 3Q8FA 1W04A 4NIIA 1J84A 2R1BA 3W20A 4MHUA 4XJ9A 4FPCA 2CDOA 5FZ4A 3B5LB 4LNVA 1QQP1 5DABA 3KSCA 1Y43B 4ASMB 3BUCA 1VBA1 3J4UH 4E4ZA 2GZWA 3HVDA 4UT5A 3CQOA 3R05A 1GMMA 1FPN2 3O0XA 4J6GA 4UBGA 3TEXA 4DXTA 4IL7A 5E88A 2R041 5FZ9A 1F2NA 4PDWC 1GZTA 4GH4C 1C5HA 3J8F1 2EXIA 4PBPA 2EAKA 3P3PA 2ZPXA 3AZXA 1AX0A 1AUYA 1XB9A 2C4XA 4W65A 3H7YA 4N7IA 2CGOA 4GMP1 1TMF1 2GC1A 4YFZA 1UYZA 2P1BA 3VBFB 2AEZA 2QQIA 3SITA 1W6MB 4Q8LA 4O9EA 4XW3A 1PM7A 3OBZA 3WW3A 2SBAA 3QACA 2IFWA 4FPKA 1GWLA 2XLFA 4BIOA 1JYWA 3ZXGA 2LS6A 3PUHA 1W8HA 1O4TA 5C5TA 2VQ0A 3NJZA 1UMHA 1QY4A 2QQKA 4CUGA 2CWMA 1AR71 2H6BA 2IXCA 2WR9A 4O61A 3ACIA 3WUDA 4JTOA 5IWFA 2WA3A 2VECA 3BVCA 5FR3A 2XLGA 1WCSA 2ZJCA 5E89A 1ND3B 1YI7A 1MR5A 2DCYA 2GNTA 2O1QA 4XTMA 2L9LA 4XJWA 4CP0A 4AG4A 4CDUB 3BCWA 3IAPA 5C8CC 3OF1A 4DINB 2JD9A 5FRAA 4LLFA 4CDWC 1KEXA 4LJHA 4B1LA 3ETQA 4Q4X1 5JI7A 3DYMA 3ZXJA 2HWC3 4LOSA 1W05A 1T2XA 2HEVF 2EXJA 4TSVA 5BNNA 1EV11 1OH4A 4S2HA 1RUJ2 4WZCA 4P02B 1UOFA 3RNSA 2YGLA 5BNOA 5FJHA 1Q8PA 1WUVA 2QDRA 2XWJB 5FYBA 4AEDA 3E97A 3C2UA 4QQ2A 4CEWC 1BCXA 5FYVA 1NY71 4BQ5A 4QX0A 4LBMA 2ZACA 2ZBJA 1X82A 3JBG2 1YYNA 3PVOA 5F6LB 3WQ1A 5CA6A 3O1PA 3I3DA 2R071 3LA7A 3TNQA 3M3OA 5I8SA 5FPUA 1YXWA 3VBSC 5BNPA 5LA2A 4KG8A 3VBRA 2OW4A 1UMIA 3OGRA 4OYUA 3WF4A 2Y34A 4HETA 3UKVA 1TVGA 2QQOA 1D4M2 2RMU2 2N7GA 2VULA 3D3AA 4ZS2A 4AVAA 4AOCA 1HN0A 4NOTA 4LTAA 4BISA 2Z79A 3WCRA 4TTGA 1SPPA 4RQPB 3N36A 5FY7A 1KD7A 4ZXKA 3DV8A 4UW3A 3SCFA 2A6XA 4FPHA 4Z2AA 1AR81 2VZRA 1ODMA 1W06A 4HL0A 5F37A 1DFQA 5A3TA 1PNGA 5J09A 3BPZA 5L73A 1D0HA 3ES4A 1XYPA 3M3CA 1H4HA 2YC2A 3O14A 1OUSA 3WLUA 2PTMA 4Y4YA 4AK3A 4CZSA 1AYM1 1QQP2 3LE0A 4N43B 4FI9A 3ZXKA 4B1MA 2XBO1 1N3QA 3M2MA 2UURA 4YGBA 3RYPA 2A7AA 4N9IA 4P5YA 4LIVA 5JOXA 3SH5A 4NPRA 1W39A 2QQUA 3CL1A 4BIFA 3H3ZA 1AR61 1CAWB 3E5UA 5FZMA 1D2QA 1G9DA 3V0AB 4UOJA 4KWJA 1XXNA 1N47A 1B35C 4GB31 4KWKA 1LR5A 2HWB2 2XHNA 5L7OC 4JC1A 1BEV3 4HPKB 1QJU3 5KC6A 3AP5A 2VZSA 4IEUA 3ZN4A 2J1VA 3DPRC 1VMFA 1S0DA 4SLIA 3B9IA 3JCIA 4KU7A 4AYUA 3UKNA 5LCWL 4PIXA 4YZ3A 4NHLA 1QH6A 2D6MA 1UYPA 3PVEA 2VZPA 3K3NA 2D7FA 3TBDA 2RS51 2C9AA 1W9YA 5EHDA 5GLUA 1CAUB 1CJDA 1RB8G 5I0SA 1S2KA 4YVSB 1PX3A 5I0DA 1HRI1 2VUCA 5C7GA 5AVAA 5GZGA 5FZ3A 3NJYA 5ABJC 3U78A 4LKEA 3N7MA 4W50A 3MW3A 2C6SA 1RGSA 2BNOA 1V9U2 2K0GA 4GA9A 4Q4W2 2VMDA 1TEIA 1UNBA 2O8QA 1UL9A 4OI1A 1OF3A 4W6YA 2VOWA 3ASIA 4LKFA 3KF5A 2E7QA 3K2OA 5IVFA 3ITQA 3UYJA 2EALA 4NIHA 2VNOA 2PA7A 3MLLA 1RUD3 4IV3C 1UY3A 2PELA 3VKFC 4XOGA 1OVPA 3H1MA 2WUHA 5JZGB 2VOVA 5EYYA 3JUUA 1CAXB 1HV1A 4XBLA 2ZGNA 1FV3A 2K9ZA 4DZGA 5FXWA 4CXWA 4AE2A 1JUIA 2P4EA 2R16A 1H0BA 1Q8SA 3NNMA 4MYEA 3ZPOA 2AC1A 1YO8A 4HG6B 4CSWA 1HB1A 2JJ6A 1CONA 3WVJA 2KM2A 5FZGA 1MS1A 1V6KA 5ACA3 1DGRA 2Y33A 1SBEA 3LWCA 5DZGA 1UYYA 4QPWA 1UOGA 2BRTA 3VBHA 5HPOA 1VIWB 4BB3A 4Y5TA 4ONUA 5J96B 5C9AA 5CEHA 1QH7A 2LROA 5A32A 2QQWA 2E7AA 4XF0A 2DYCA 5C3PA 3LDRA 1LGCA 5C5UA 3ORJA 1KITA 1O5LA 1LB2A 4XABA 1ALYA 1UXXX 1QWRA 2PHFA 2X5IB 3VDDA 3BKZA 1PK6A 2R6QA 2ZZJA 4YZ1A 1DYKA 3KT7A 1LTEA 2VCMA 4CCOA 5C33A 3KT1A 4JKLA 3R4UA 2BTVC 1A8DA 4I0BA 1SLLA 4GKXA 4MZUA 4XXPA 3VV1A 2P3IA 3M70A 1M4WA 1DGWA 1CWPA 4PIZA 5LWBA 4LO7A 3OD4A 1AR82 1MS5A 1HN1A 4W6XA 3I7DA 1X7NA 2DV9A 4JDOA 2WJSA 1CAVB 1NX9A 3UK9A 5A1AA 2ARXA 1LHWA 4N9HA 5T3NA 1SACA 4S2GA 4IE7A 2P6HA 2WL1A 1VB2A 1VP6A 2XHKA 5EPAA 3RI8A 1JMUB 1OKQA 3ZYBA 1LU2A 4UFLA 1PO21 2R1DA 4PDWB 5TSWA 4AI2A 2PHDA 2PHUA 4GH4B 1XOYA 1O3TA 2BDRA 3BOWA 2RS13 2XBO2 4FFIA 1WCDJ 5GZEA 3LDBA 5J48A 4WM8C 3RZGA 4FTEA 1LU1A 3AFGA 1S0EA 3OJBA 2BNNA 4RS5C 2J1TA 1CIYA 2NM1A 5DAQA 4AL9A 1E5HA 3AJZA 1AL21 2ARBA 4MG2A 1H8TA 1AR62 5LA1A 4FPFA 2Y64A 3TN91 2WZ8A 5L9BA 4AEKA 2VW0A 4QPGA 1LHVA 4GB32 1GNZA 2ZX0A 4YRDA 2XWBB 3VHNA 4HVOA 3CNAA 1V70A 1Q8VA 3JD71 4LBQD 1XE7A 4J1WA 2QJVA 2WZPP 1F31A 3T2QA 4FPGA 1DLLA 4QX1A 2C24A 2W5FA 3CKHA 5FMBA 1JUHA 2WA4A 5IK8A 3S5AA 4R9CA 4QX7A 1UY4A 2WS92 4UF0B 4BH9A 1SBDA 2XMLA 1NCQC 1AL0G 1UMZA 3ZSJA 2RS52 3UT0A 5CAZA 4OMCA 1R093 4AAXA 2BOJA 4YSFA 3U14A 4LHNA 3T0DA 4IE0A 3EHKA 3OGSA 4H2AA 3WY6A 4RGGA 1XSQA 3AJYA 5C8CB 4QXCA 5HXVA 4CUCA 2RDRA 5EZWA 4CDWB 1RUE2 2G9GA 4AXOA 5LY2A 4JQTA 1S2BA 3N9OA 1F8VA 2VOXA 1W8OA 4AW7A 1ASJ3 4K3UA 4FPLA 5CFCA 3CBNA 1ZRIA 2D3SA 2RJLA 1W6OA 4NIDA 5FMOL 3FJSA 2GP5A 3I59A 3G6JB 4PIYA 3GJAA 5CZKA 5KXEA 2E6VA 2H0BA 2UWBA 3OSDA 4MSVA 4FPYA 4XJZA 4RA0A 4CEWB 4LORA 2BPA2 5GZFA 3OGJA 1J58A 4P9LA 4EN0A 2YXSA 3W59A 4N8MA 1RIRA 1CJPA 2WAOA 3C7GA 2CTVA 2D97A 4W6WA 3MICA 4HK9A 4QKNA 2XJUA 4CU9A 4YARA 5SV5A 2EVXA 3Q8EA 4KU8A 4XUTA 3VBSB 3MPPG 3B7MA 2O8OA 1TE1B 1ZBE3 1C28A 1KS5A 3HT2A 2IXJA 3LPFA 3POFA 4HLTA 3D6EA 1BQPA 1PZ7A 3D0SA 3WNMA 5C6CA 1EUUA 3N9LA 1VBD3 4I3PA 2VVFA 5T50A 1CVNA 1MS4A 2JKXA 3HR9A 4AQSA 1N3PA 2AGSA 3ZFGA 4XJ8A 1NLQA 3CZJA 4RGAA 1RUH3 2YDEA 3L2YA 4HKLA 1UZVA 3SCHA 1O3RA 1IZ3A 1H2MA 5DAXA 1N1YA 1OOPA 3C7HA 1AXYA 1V9U3 4XUQA 4AQ2A 3ME2A 4YVWC 1GSLA 2AENA 2RDSA 5A3WA 2Y0OA 1RUC3 5AFBA 1X8MA 1OLMA 4ZU4A 1W6PB 2Q4SA 3RPQA 3LEKA 3B00A 1OQDA 2WZR3 1GICA 3J26N 4LHSA 1OQ1A 2OYZA 3USUB 2FMYA 2J22A 4XQ4A 2VO5A 4B8EA 4JZRA 2B42B 4I30A 3WUCA 2OKXA 4QXHA 2JB8A 3GZEA 1JYNA 5IK4A 1BBT2 1QIQA 3KCCA 5A33A 3WF2A 1YUDA 3RZZA 5DDJ2 1MS8A 3NKGA 1YLLA 1IPSA 3OB8A 1B35B 1IQAA 5D21A 4AGRA 5L7OB 4JDNA 2D3RA 4FOYA 2VTFA 2F6BA 5HCBA 1EAH1 2JEMA 4ES8A 2VVDA 3DPRB 1RMU2 2WSVA 1NXMA 2OX0A 4DUXA 4KQ7A 1MACA 4OI0A 1ZBA2 1HRV3 4AI9A 2BGOA 3VDCA 1R1ZA 3GM8A 2VD7A 3MYXA 4LEJA 4UFMA 5FJKA 1XYNA 1DGLA 4DB5A 4QQOA 3T0AA 5JOWA 3IIAA 3KT4A 4PLOA 1Z7S3 1H1IA 4FOQA 1UOJA 1KFUL 4PI0A 5FO8B 3UGHA 5ABJB 1UY2A 5AFEA 4DY3A 4MGSA 1R1A2 5FYYA 2OQ7A 4FPEA 2D3PA 4WVWA 4D6RA 4BM8A 4ES9A 4M3CF 2OA2A 3VHPA 1V6NA 1G9BA 4FP2A 4MGTA 1N1TA 4QX2A 4EN6B 3LEGA 4NE9A 1WW5A 2Q1ZB 5AVPA 1K3IA 1RVF3 5A6ZA 1BYHA 4IV3B 1H4GA 4JHTA 3SMHA 2JDYA 3M3EA 2V5YA 4AI0A 1MZ6A 1W0PA 1MVQA 4KH9A 1UU4A 2NZ9A 3ZYHA 2OPKA 4V1PA 3SEEA 2WQ8A 4TXWA 4FOWA 3KF3A 2VUJA 4NHKA 2DUPA 3D82A 5I93A 2D44A 2QKDA 4MGIE 3BGAA 5M0TA 1Q56A 3JB4C 2FDFA 4CRQA 5F2SA 1LHNA 4YWAA 3HQUA 5LBEA 1Y9GA 1QJU1 5C3RA 1SCSA 2D6KA 3EQEA 4PF5A 4JAAA 3WD5A 3AMQA 2YFUA 4P9IA 4CP9A 2DUQA 5LA0A 3AVRA 4QPIC 1ZRFA 2GU9A 1JZ7A 2A6ZA 1APNA 5A1FA 2ZMNA 5LBFA 2JKBA 3OPTA 3POJA 4C1XA 5KHGA 2NQYA 1TNFA 2OPWA 2BNMA 3B93A 2P17A 4QX5A 1FMD1 4FPOB 4IEWA 3HAGA 3T0BA 5A7NA 5IK7A 2CV6A 1U12A 5FKBA 1QDCA 4LXLA 3WNXA 4ZU7A 2EXHA 3QOPA 1POV1 4RYDA 3RRDA 4O7XA 1JYIA 2BV4A 3THTA 1O4YA 3S57A 4GAZA 1QGLA 3PUSA 2O14A 1Q8OA 3KVAA 4BYYA 5LEKA 1HQNA 3H0OA 4QGLA 1OC1A 1O8PA 4PQQA 4YW3A 1PGL2 2RE9A 2VQTA 2XG3A 1QJX3 4DXZA 4OUEA 3KD4A 3O1MA 1RUD1 4AFMA 1C1FA 5JUVA 2EIBA 4FFHA 3AKSA 2Y38A 1QOSA 5FUNA 4CP1A 1ULCA 2HWC2 3VBFA 5DAPA 5JMOA 1FPN1 2JIGA 4WM8B 1W6MA 3O12A 3KWVA 5F5CA 2E9QA 3IPVB 1RXFA 3MEPA 5IVBA 1DP0A 4RS5B 2QZ3A 1O5UA 2CDPA 3CJIC 2P5BA 4QKFA 3AZZA 5C70A 3VZMA 5FQ0B 4B4PA 2H6CA 5FY9A 4KI5M 1ZZCA 3U75A 1VB4A 4FFFA 5GLTA 1WCKA 1SFYA 1LOFC 1SCRA 3MW4A 2JX9A 3LEMA 2E31A 3EYPA 3W21A 3GZUC 3K46A 2VZTA 4YGCA 1SLAA 5FMOS 3OPWA 2DFCA 1FYUA 4H3WA 4UFKA 2YBPA 2QQNA 4F8AA 2FZ1A 3K4ZA 1NZIA 1ND3A 4I01A 2E51A 1IPJA 4IETA 4CDUA 1J59A 1NCQB 1OF4A 3CJXA 5FBJA 3GHNA 3C7FA 5CNAA 1LULA 4YGDA 4DS0A 2KR2A 3AVSA 3TNPB 2DDUA 3ZFFC 4GKYA 4X8NA 2C26A 2VG9A 4K21A 1TNRA 1GV9A 1H9PA 1XNDA 3HEIA 3N4MA 3WDXA 2WO7A 3DYOA 1WLWA 3A23A 3JZVA 5FY4A 2XVKA 3WNPA 3MFCA 3MIHA 5CYYA 2RJ2A 4YZ2A 5JSRA 1HDKA 3LB9A 4M0HA 3PDQA 2JWPA 2MEV3 2D98A 3ZYFA 1HJGA 2EA7A 3AYAA 4QB6A 2X05A 1KRIA 3OTFA 3FZ3A 3O1TA 3N3HA 4KGQA 2X53S 3RZLA 1I9RA 4LKSA 4NUBA 4BMEA 1OH3A 1UZWA 2IUWA 2JDKA 2ZCWA 4QDRA 3VL9A 1BJQA 5FXZA 4AI1A 1DDLA 1RUI3 2RS11 2VR4A 5FUIA 3WP4A 4CDQB 1I5ZA 4PQ9A 5AC93 4S2FA 3WQ0A 1SDDB 3R6SA 5JZGC 2YPDA 5J98B 3BU0A 3WNKA 4XYXA 4B29A 3ENRA 3KMHA 2X29A 4QX3A 3I4IA 5FPLA 1JBCA 2A6YA 4KG0A 4RQPA 4B3NA 4CE8A 1BEV2 1UZYA 2E32A 2Y6FA 4D7YA 3ACGA 1XRUA 2W0XA 4W4ZA 4XPVA 5GLZA 1UO9A 4COWA 3INAA 2B46X 4BHPA 1WMDA 4XILA 5HI0A 1QJEA 2RM23 1TG7A 2HJIA 5D8AC 2JD4A 1ZRDA 1DU3D 1D7PM 2ZGRA 3T1MA 2VAUA 1JOBA 2J1AA 4URTA 1A3KA 4OQ9A 1R091 4AAPA 3N9QA 4F7ZA 4N43A 4K1ZA 2IC1A 1AJOA 3NJXA 4YVWB 3THDA 2ZKNA 4IERA 2VZUA 1BZWA 4IEOA 4COYA 5FMCA 2VUAA 1Y9QA 2FDGA 1OLME 2RS33 1W99A 4N53A 1CAWA 3V0AA 1OXCA 2VXRA 2ZABA 4CA9A 5H9PA 2J1SA 4AFAA 1DZQA 3HPNA 1DZTA 5FK7A 1U5XA 1F5FA 3CO2A 3PL0A 1VBE3 4X8PA 4XJUA 1VRBA 5DUWA 5BNNC 2R063 4Q27A 1RUD2 1R64A 4HPKA 3T4VA 2ZGUA 4MLOA 2GAUA 1XPWA 4A6OA 3AXDA 3NRUA 1URXA 4E27A 2WO2A 3DEMA 2NPIA 4AFCA 1REEA 2BU9A 1U0AA 2EIGA 4XJAA 5T5OA 4FQZA 5FZLA 1OURA 2VCBA 2ZOEB 1CAUA 5ACA2 1VMHA 1WD4A 2JDZA 1JYTA 2HWB1 3B3QE 5LW9A 1S2EA 1AF9A 4YVSA 2Q8OA 4IGOA 2MHFA 1IS4A 3D0JA 4XUNA 1ZBE1 2XJSA 4EN8B 1UZZA 1NG0A 5C4WC 1U5ZA 3J7MA 5FAXA 3BTYA 1GBGA 1H8VA 2QQMA 3FC0A 1VRH3 1VBD1 2A5ZA 1ULDA 1XE8A 3OY8B 4AVCA 5LBBA 4Y1XA 4QB2A 4AFBA 4R4ZA 1WGPA 3I2JA 5IVJA 4FTBA 4P5HA 4AQTA 5FY0A 1W6NB 3GCWA 3MZHA 2WKKA 1IKQA 4TZDA 5FP9A 5FLHA 3CLPA 1XQNA 5E1RA 5EIYB 1GZ9A 3OGVA 3NAPC 3KGZA 1FNZA 4GMP0 3ST7A 1V9U1 4Q4W1 2E7TA 1H6YA 3AMNA 3ILRA 2JG8C 3SISA 1ZYBA 3E6BA 4RHV3 1RUC1 5IVEA 1AXZA 5E6HA 5F3IA 4AGGA 2WZR1 3FFQA 3HNMA 2XQRA 1JS9A 4C91A 2Q30A 4LITA 5FYZA 3ZXLA 3DL3A 1PVXA 2WNEA 4LBLA 1UD1A 5JSOA 2AH2A 3D4KA 1AR93 4I09A 5DZEA 4YW2A 4LBQA 1H1MA 5FUPA 5FZ8A 3W9AA 5IK5A 2W92A 2FD8A 2V5DA 5F6KA 4AHZA 4DRRA 1OQEA 2VBPA 2EICA 2RS12 2ID4A 1UKGA 4YM2A 1ND2A 4NR1A 2XDVA 2B4KA 4LPLA 2J1EA 4LBNA 4I2OA 4E9KA 5FDBA 2VZ1A 2ZAAA 3CMGA 1U5YA 2QQVA 3A0NA 5DAVA 2Q8EA 1JHJA 5JR7B 1WLTA 3DECA 3KQRA 5LBCA 4QPIB 5IT6A 5JMCA 2GDFA 3R4DB 3R0RA 5LATA 1HRV1 4EZHA 4CCJA 1FXZA 2JE9A 3U4SA 4LO4B 2XJVA 1NXD1 3VZLA 4PF1A 3WG3A 2BBVA 4OCTA 3FHAA 2JENA 1K5JA 1CAVA 1RUF3 1DYPA 4ZPIA 2K2SA 3SCGA 5JIAA 3PUAA 2ZHLA 4HMZA 3RGBA 4AR2A 3S5QA 3EXUA 1NE4A 1DQ2A 1DHKB 5BXXA 1C3HA 3FLPA 2UWCA 3MF6A 5KHJA 3CDZB 1R092 4GQ7A 1H6XA 1HB2A 4PDWA 5IATA 4QDQA 4IEXA 1Y3TA 1NCRB 4GH4A 3ROUA 2GC0A 2VH9A 2VVEA 1BKZA 2W1UA 4A4AA 1AXKA 1XNTA 4XCBA 4JGYC 4KNCA 3VKMA 3K3OA 2FMDA 2XLAA 5FLIA 2YG0A 3KZ4C 1XNBA 5JI9A 1GZCA 4XF3A 1YNAA 2IXHA 2PLV3 3A22A 4E2SA 5B2GB 5JIUA 4DNYA 4A2UA 2DFBA 4K1YA 2D6LX 2A1XA 1FATA 4QT6A 1ASJ2 4IGPA 3KQ4B 1G8WA 2LRPA 3NJVA 3RVHA 3CJIB 2UY9A 1QJZA 4Y5SA 1W90A 1GFF2 1R083 3RWKX 5LK5A 5EJZB 1KXGA 1ZRRA 5KR7A 2ZGSA 2VQAA 3AKQA 4Y1YA 2BZDA 2VBDA 4R8HA 2ES3A 2P3JA 3VD7A 2DVFA 4DEQA 4YLZA 4D94A 1CX4A 4IESA 1S1AA 3B69A 1WBLA 2CNAA 4AEJA 1FOD3 1ULEA 4M3CB 1YQ2A 4FFGA 2JG9A 5LZ6A 2NP0A 3U11A 5FTTC 5JXIA 1ZREA 3MPBA 5FK8A 1AZDA 2ATFA 2H0VA 3NV4A 1PHMA 2VBBA 2WN3A 3KHCA 2KXLA 4L9BA 1C4RA 2EXKA 3HQRA 1ZBE2 4XAEA 3VDDC 2ILMA 1LEMA 4BQ4A 4EE2A 5K4LA 1I6XA 1NA1C 3W5NA 3E6CC 4C8DA 4YW4A 4CDWA 3OGGA 3ZFFB 4LO6B 3MGUA 4BQWA 2WS91 2NLRA 1UKRA 3BPSA 1VBD2 3HN1A 3NQHA 2GMMA 1ZZ6A 4GJYA 2RG4A 3E1F1 2DCZA 3GXUA 4NAMA 3BU7A 4WVMB 1UXZA 1TZOA 2WWUA 2ZXQA 3ZR6A 4OHVA 5JXJA 5SV8A 1RUH2 2PYTA 1OPMA 2ARCA 3AKPA 2DTYA 5E8AA 4B4RA 3RZKA 4Y22B 1JZ4A 4FBFA 1XJAA 3DN7A 3V0BB 1REFA 2WWJA 1RUE1 5CG9A 1JI6A 1N1VA 3ZIXA 1QJX1 1RUC2 5C3OA 2TBVA 1W3XA 1DCSA 2G4IA 5F2WA 2WZR2 2BP6A 5A3MA 1S55A 1J3RA 1UIKA 2VUDA 1BMV1 3GZAA 3KLSA 1PIV3 5CIRA 5CFDA 3ZYPA 3VBSA 2XVGA 4NO4A 1KJLA 4PI2A 4XUPA 4XMIA 3T30A 1K42A 4A3ZA 2Y6KA 2A6VA 2JECA 5F32A 3WDYA 4OI4A 3WR0A 3H50A 2FDKA 1WA4A 4GZ9A 1H1AA 4DMIA 3N9NA 4G3YC 1JOPA 3F2ZA 5CU1A 1Y7BA 2PHWA 4JDMA 4MX3A 2VPVA 4ARYA 3U0ZA 1G86A 1O3QA 1YWKA 4JV4A 4DY5A 1SLBA 3PMSA 2RR13 1HRV2 2VOTA 5FZ6A 2D43A 2F4PA 2R7EB 3HWJA 5D8AB 3ZR5A 2CGPA 3C8XA 3EBRA 1YIPA 3TEWA 3H1YA 1W9FA 3B9CA 3QD6A 4IV1C 1W6PA 1Z7S2 2A3YA 1RUNA 3AMPA 1LHUA 4WV8A 5EFUA 4WVVA 2JIJA 2W91A 4Y1VA 1LGBA 1J1TA 4QGNA 2CSGA 4BCUA 2ETEA 5DUUA 2YZ4A 5FV3A 4LKDA 4CYDA 1C57A 1CR7A 1UPSA 1YIFA 3VKNA 3ZKUA 5JR2A 3BTXA 5FBZA 4E2GA 4TN7A 1Z0HA 2AUYA 2MEV1 2W68A 5F5AA 5LASA 3J9SA 3VBUA 1RVF2 1EP0A 1W8FA 5BNNB 5L7OA 2ZX2A 3W58A 4NRMA 2D6NA 3MV01 4ZU5A 3KM5A 1W2TA 1H2NA 2DVGA 3VD9A 4Y20B 4HVRA 4P00B 4MXWB 3FMGA 2P3YA 4K8FA 1BBT1 2RV9A 3UJQA 3SH3A 3LF7A 1WD3A 4BE3A 1KJRA 3NL1A 5DDJ1 1V6LA 2ZGTA 4DQAA 5KC5A 1XYOA 2WAAA 1UYXA 2QNKA 2WT0A 3GDBA 4XFFA 5DZFA 5FKCA 5LRRA 2ZEWA 1EUTA 2MNGA 4LMFA 4Y26A 1FV2A 1T6BX 5ABJA 1WW4A 1E5IA 1RMU1 3AYEA 4MOAA 2WNUC 4U2AA 5C4WB 3PJYA 1JOJA 4FXKB 5K0UC 1ZBA1 4QB1A 3IN9A 5FPVA 3WF3A 3T2OA 3O0VA 2ZAHA 2JB4A 2CU5A 3PLQA 3IAQA 4M4PA 4AWDA 4D69A 5I0TA 3U4XA 4GWIA 4CEYA 3PVNA 3ZFEC 1D0GA 4DIQA 4QM9A 3OG2A 3RZHA 1OHFA 1PZ9A 4Z07A 5FZDA 4WBBA 3NAPB 3POSA 1REDA 4QGMA 2B9UA 1R1A1 4RGKA 4IEVA 2WFF3 4YW6A 2GN7A 1RUG3 2JG8B 4TLGA 4YW1A 1NAEA 5EJ3A 3MLJA 4AZZA 5FZAA 4PBOA 5GLWA 5GKAC 4A42A 3V65A 4E4SA 1IQDC 1TME3 4OLLA 2RJKA 5IFPA 2TUNA 4HVQA 1EY2A 3JQXA 1QJX2 2UU8A 2P34A 4D6QA 3WDTA 4OHXA 4QXKA 4CU7A 3HD8B 3H8RA 1QNYA 1YC61 1CPNA 1ULOA 4UW4A 4HKWA 3HNBM 2YFZA 4K8RB 5CKQA 5FZFA 4YM0A 1BMV2 3I2HA 1LOAA 4UFJA 4CXXA 2HWF3 3HBZA 4HKOA 1XE0A 3I3QA 3WG4A 1JYCA 1GP6A 4CU8A 1IOAA 2ZGPA 1X33A 4ARXA 3PU8A 4R52A 4JGZC 2JDNA 1W2UA 5FY1A 4CDQC 4XUOA 1CZSA 1SQ4A 2PAEA 3I2DA 3U37A 2MPFA 5EQUA 1RTVA 4WZFA 1LODA 4GD4A 2DURA 1AVBA 1QNWA 4UI9L 3WDUA 3NV3A 5HBAA 3VD5A 1AJKA 2GN3A 5LB6A 5FWJA 4U36A 4CUAA 1RUOA 1QXPA 2VMGA 4HANA 1VBA3 5IVCA 5IW0A 3PUQA 5DUVA 1LAJA 1ZX5A 2QCSB 2B45X 4BQ1A 2R043 1AX2A 2FCTA 5L9VA 4NRPA 1GOFA 4ET7A 5J3UA 3J8F3 2QBXA 3KB5A 2AREA 3LA2A 3FBMA 1OPOA 3IPVA 4LA3A 4MXVA 4JGYB 5D1IA 4URAA 4RS5A 1UOBA 4CCNA 3DKWA 4GMP3 1TMF3 3GHMA 4IUGA 5FZ7A 3WP3A 5A1LA 1PGL1 5FQ0A 4JRAA 1GU3A 1JYVA 3RZJA 1JODA 2MEV2 2PHRA 5FREA 1VAVA 4RN5A 5EXOA 1LNSA 1W9SA 3OUIA 1WWYA 1OFNA 2GC3A 3I3BA 4IEZA 4LQRA 1KS4A 1UX7A 1OLRA 5F39A 1AR91 5JXGA 2CHHA 2DVBA 2XB6C 2WNVC 4X6QB 1LKNA 2HWC1 1YQ5A 2FCVA 4KMQA 2FQPA 4DFSA 2FDIA 2CY6A 1RUI2 4QM8A 3U1XA 3ZMOA 4AF9A 1AR73 4GWMA 1BVP1 1RJ7A 1G9CA 5FIXA 5KBFA 4OZXA 4UW5A 5AC92 1J1LA 3H8UA 4OUMA 1ENSA 2QZ2A 2WC2A 5GZCA 2ZGKA 1NCQA 5T5PA 5JOZA 1RITA 4EWDA 2R0HA 5BUVA 3NNFA 1QMJA 5A32B 4MH0E 2UYAA 2GNBA 3ACLA 5A7SA 3SLIA 3IDAA 2ET1A 5D2AA 3T09A 3VDDB 3BTZA 5DG1A 1HX6A 1NYWA 1VBC2 1NQDA 2ZEXA 2Y0IA 1NA1B 2UY8A 4LE3A 1SZBA 2LUWA 1NZCA 3AYCA 4RR3C 2VW2A 2VZ3A 3T2TA 5IHRA 4Q4X3 5FP3A 4BXFA 2X10A 2RM22 2YROA 1JYXA 4CDXC 3MI8A 1W6QB 1HB3A 3WHUA 5ANNA 1EV13 5G04L 1W8TA 4PCRA 3NV1A 4N7UA 2RDNA 2Z5WA 4GIQA 4HN1A 2Y6JA 1ZZ9A 1WMFA 4MO3M 2QVSB 1BHGA 5LK7B 4MV2A 3VDAA 5CG8A 5H9SA 4B7EA 4WM7C 4XHXA 2RS32 4DPNA 3AKTA 2R073 3IMNA 3HNYM 3U07A 2PLV1 1XU2A 4XTPA 3OYWB 4R9DA 4OHYA 2F4LA 2WSUA 4EV0A 1Q43A 1VBE2 1PMJX 2R062 5E16A 3WQ7A 2J1RA 1O6UA 4HZFA 3MUY1 3NNJA 1R081 2PHLA 2C1FA 2DU1A 1DQ1A 2WO3A 3RZMA 4XEZA 2YV8A 4OFGA 3O1RA 3I3EA 3H8OA 1XNAA 1Q8QA 2XKOA 1MQTA 2ZHKA 3IDCB 4Q26A 4CU6A 3WXPA 1KFXL 3CHXA 3L2HA 3LQCA 4IDZA 5LRSA 5A3UA 4TWTA 1GNYA 3UGFA 1SMVA 3FL7A 1G7YA 2BOIA 5L9RA 4QPYA 1C5IA 1W8WA 1FNYA 3JXSA 3QLQA 1BEV1 5DUXA 1KDMA 1SLIA 5A7WB 2WT1A 4Q4V2 4QQHA 4XFHA 1PO13 1VAKA 3BODA 4YVWA 3TEZA 4YM1A 4Z92B 5DN2A 3IMMA 3VZKA 4Z2WA 5T54A 4IV1B 3S7IA 4MADA 3WP6A 4Q0QA 1K5MC 2ZX1A 2ZGMA 3VHRA 1AYM3 5JAXA 1VRH2 1WMEA 3ALQA 3N7LA 2C5DA 1OA2A 3I2GA 5IAVA 2AACA 1I3HA 1N1SA 4M00A 3AZVA 5FYSA 4YYOA 1RYYA 1WCUA 5FYUA 3SQOA 4C90A 2YHJA 3KGLA 3P6BA 3JB8A 4XIOA 4C0BA 4OHWA 1QOTA 4OULA 2DF7A 3POYA 1YQ6A 4JRLA 1UY1A 5F5IA 1Y4WA 2VY0A 1JW6A 2PQSA 4RHV2 5IJRA 4OHZA 3VBOC 3RSJA 2W9XA 1BXHA 1BVVA 1NCRC 2R0FA 2B7YA 2R49A 4O9GA 3SKJE 1DYOA 4QWNA 3RMXA 2CAUA 1OMIA 1PIV1 2LM3A 2FDHA 4Q8KA 1CZVA 4A3XA 1GWKA 4XF4A 1N3OA 2FCUA 4Q2FA 3WG1A 4DXSA 1AR92 3I8TA 2WBKA 4LT5A 3BIEA 1POV0 3MIBA 4XFBA 3K51A 3Q8BA 3NV2A 3DCQA 4JX0A 1JZ3A 3K4DA 4FAHA 2BGPA 1HRI3 2ZHMA 3OY8A 4DXRA 1NQJA 5CB7A 3BN6A 4LHLA 1H9WA 2WNUB 1C8M3 3FLTA 1O91A 3ETPA 4KL1A 1UU5A 4FP3A 5A6YA 5ACA1 3USSA 1W6NA 5K0UB 1OUXA 4WVZA 5FY8A 2IXKA 2HBTA 2CL2A 2P3KA 2RR11 2F17A 2VU9A 3QH6A 2PAKA 2WINB 4XAAA 3WF0A 3ZSEA 3NVCA 3I2OA 4YG0A 4YW7A 1LCLA 3GF6A 3DF0A 2VC9A 3ECQA 4O65A 3ZFEB 1V6JA 4QXBA 4N90A 1DF0A 3APBA 1RUF2 3WSOA 5K8SA 1ENXA 1OOPB 3I2FA 3C7OA 3K75B 1AHSA 3PIJA 4PLNA 1DBNA 2A71A 1G6NA 1A6CA 4XFAA 4I3GA 3POWA 2GMPA 3OBTA 4HN0A 1H2LA 1HJFA 4XC9A 4LHKA 3WNNA 4XZUG 4ASKA 5A3LA 2NYYA 2CYFA 4N53C 2JDHA 2ZX4A 3LSEA 5DAWA 5JLVA 2IVJA 4ATEA 1JTZX 2VCAA 1QU0A 1T6GC 3ZSLA 3BYWA 4FXGB 1VPHA 1DZRA 3TYJA 1WCQA 2PN5A 3BTAA 5CKMA 3SHRA 3UETA 4MUVA 2PLV2 4EWAA 5BNQA 3D8CA 4QPIA 4OVEA 4RL7A 4PT6A 4UWDA 2E26A 2OZ6A 2VNGA 1HIXA 5FZHA 1VALA 5FPZA 1WLCA 3MHZA 4BLJA 1KQRA 4JGZB 1R082 5EYXA 1H2KA 1RJ8A 4META 1CPMA 4Y5Z0 4A44A 2PFWA 3ACHA 3WQBA 5FLJA 3FFZA 3VZJA 3M8LA 3I97A 2I45A 5FYIA 1VBB3 5G05L 1O7FA 2Z4FA 4BQ3A 3M1HA 1FOD2 5I8YA 5FO9B 2WO1A 2ERFA 1V00A 2AEYA 1CX1A 1VAMA 2VGDA 4LA2A 1DLCA 1SHWB 1GZWB 1VBC3 1YHFA 2Q0AA 3IIIA 4QU1A 3IKWA 3MIFA 5EWSA 5EP9A 1LGNA 3VZOA 4AVSA 2YBSA 3BOPA 3DXUA 1JZ5A 1CESA 1W3VA 2RDQA 3KS7A 1UF2C 3FHQA 2YU1A 4P9XA 1PO23 2JDMA 1CZTA 1GOGA 2WFF1 4ZHNA 1PGW2 3E6DA 1UAIA 1PM4A 4RFT0 5A7OA 3CJIA 3PTYA 4BK4A 4XHBA 2VCCA 1AL23 2QTWB 4Q0VA 4SBVA 4AVVA 4YM3A 1YRZA 1ZZ7A 3TN93 1VMJA 2W95A 2JE7A 3WF1A 5C8WA 1MZFA 1KGYA 1LOFA 3J7LA 4YW5A 3HIFA 3JD73 4IGQA 2XH6A 5H9QA 2WNVB 3H9AA 4QMAA 4E8DA 5CKNA 5JSPA 2WNOA 4JHZA 1OI6A 4M3CA 2D6OX 5FZOB 2W1SA 1ASJ1 3LFMA 5FPAA 2UWAA 1PIV2 4PLMA 5F7UA 1POQA 2HWF1 1ND2C 4AHWA 4E4DX 1OFSA 4W8JA 3AKRA 4AVBA 1GWMA 5BNOC 2ZHNA 4NHMA 3FX3A 4Y4RA 2YY1A 1J3QA 3ELNA 5FPBA 4AEDC 4CP9B 5BY5A 3ZFFA 2BERA 3SKVA 3UJOA 4BLIA 4XETA 4ISRA 4D8MA 2BVVA 3LKJA 4K20A 4WVMA 4A41A 3QH7A 4XCAA 3WV6A 2VNVA 3J7HA 3LIHA 4RR3B 4Q4V3 3ZSKA 3VBRC 5BNPC 4CTEA 4K40A 4LULA 1K45A 5A7PA 2RR12 4KWLA 4Y22A 4D3WA 3WX5A 4OZOA 4CDXB 3V0BA 4EN9B 4CCEA 2DU0A 3VKLA 4BU2A 2Y6LA 4Q0SA 4BQ2A 4COZA 1ZZBA 5A6QA 3THCA 4ISQA 1OVSA 2DWRA 2ZGQA 3AL6A 4Z1VA 1QDOA 3WG2A 5HV0A 2JDUA 3TB0A 1RUH1 2CAVA 1YI9A 2WFPA 4NMIA 2VMIA 1HXS3 5T52A 1BK0A 2HWE3 4WM7B 3CU7A 5FZCA 4EN7B 4BZ4A 4CCLA 5FPXA 2KD7A 5JZGA 1RL3A 2VL4A 4DRVA 2Z42A 1CAXA 1JXNA 2OUHA 2W47A 2AR6A 3DKQA 4FT8A 3KCYA 4HOOA 4Q0PA 3H3UA 1PGSA 1STMA 5KXDA 4OI2A 1W8ZA 2RHPA 1YFXA 4Q4Y3 3AMMA 3BIWE 1YQ8A 3M4FA 4XBQA 3A4UA 3VDBA 2BQPA 1YFWA 2P6CA 3MV11 2ZGLA 3ZN5A 1I5PA 4EZ4A 5D8AA 3WHTA 4NVPA 3M7AA 4AEMA 2ADEA 4QHZA 1WW7A 1IKPA 2HEWF 3HOBA 2DUOA 3WDVA 2JG9C 1JZ8A 2PAMA 2X5IA 3PURA 4CP2A 1L7LA 4HSJA 1ODNA 5IVVA 3PMEA 3N9MA 1JHNA 1JU3A 3OD0A 5F8PA 4AI3A 5K9YA 4XDOA 3FLRA 3NKTA 1B09A 3RYKA 3HMYA 3TRSB 1K5MB 3ZO0B 3V56A 3IT8A 1QJFA 4OMDA 1CIWA 1MZEA 2XVLA 3GBFA 4YZ4A 4EYUA 1LRHA 1A8MA 3ES1A 5FMDA 4BWOA 2JDAA 1KDKA 2W94A 2WQZC 2BWAA 1Z7S1 2UYBA 2OXBA 3ZXEA 2WLQA 1MEC3 3J7NA 1RXGA 1WLDA 4LBKA 3UGGA 1QJY3 1GLHA 3CIHA 1ULPA 4IEQA 4Y1UA 3TOJA 4Y20A 5FXVA 3X29B 3N7JA 3VUOA 1L7QA 2FHRA 2IXLA 2WFF2 2XL7A 2YBKA 4IE5A 4MXWA 1RUG2 2ENRA 3UKTA 2IFRA 1AYN3 2VMEA 4KWUA 4XMAA 3VBOB 3ZYGA 1E57A 1EAH3 3ZXFA 3LD8A 1RVF1 1TME2 1WKYA 1HB4A 4LUMA 5CFDC 1UX6A 1LECA 2HYXA 3PVBB 5HCHA 3RI9A 5FZEA 2VM9A 3ZOIA 4DO0A 5JVVA 5C4WA 4AHXA 4ZY9A 1HQWA 1SEFA 4Z8BA 3FE5A 1PMHX 3S6PA 2V73A 3NSTA 4S2DA 3GZTB 3TAYA 3PUIA 2HWF2 2VXJA 1JH5A 1VJ2A 2Q1MA 4J25A 2I07B 4XF9A 4CCKA 3VN4A 4XZPA 4XQDA 4IEYA 5KXCA 2WN2A 3EJKA 2XUEA 1YEWA 2RVAA 2BYVE 3RS6A 2A6WA 3SC7X 2GP3A 3PIGA 2EF6A 1M06G 1QXRA 1GQGA 4UF0A 3VBHC 2W46A 3NAPA 2CWSA 4CCMA 1COV2 1YCIA 1PO11 5C9AC 1EPWA 1D4VB 1HKDA 2JG8A 2W39A 3PHMA 4BK5A 1RHI3 2YU2A 2Y60A 3GALA 4IQPA 3OBAA 4IE4A 1CN1A 1PK6C 3DXTA 1IGOA 1Y9MA 1W2AX 3ZN6B 1VBA2 5C8CA 1UPIA 3S0MA 4ITCA 5KWRA 2YYOA 2YC0A 2Y6GA 5ERLA 1MZ5A 3D5OA 4XDQA 5B4XA 2R042 3LA3A 3KV5A 4N53B 3UESA 2VMCA 3J8F2 1XC6A 1GP4A 1OA4A 2GALA 4HK8A 1ZNPA 2AZ5A 3VBUC 5FZ0A 1FX5A 3T08A 2ZMLA 1ENRA 3DGTA 3I2KA 3SXWA 5HCAA 1LESA 5IAXA 1I1EA 3H7JA 1TMF2 2E53A 1Q3EA 4A7ZA 4CEWA 5FWEA 3NMBA 2FZ2A 3H42B 4C1WA 4KGGA 2DBNA 1OD5A 2W1WA 2WABA 4NROA 4PJYA 3BB6A 4K7JA 4LLOA 4RSUA 3VD4A 4Q0UA 5ISLA 2LW8A 4GXLA 4MGQA 1FMD3 4EQVA 1OSGA 3ILFA 2D6PA 2NMOA 3ACFA 3OEAA 4NIGA 1AR72 3U10A 2A3XA 1PVC3 1ZM1A 4QD2A 5I0UA 2K46A 1BK1A 1H8TC 1POV3 1C8M1 1G9FA 5JPNB 1UY0A 1CQ9A 5FCCA 4QPGC 5J37A 3GYDA 2WYFA 3OUJA 4ZS3A 2WIIB 5FFOC 3MIDA 2DVAA 2HWD3 3C3VA 3IM0A 1UU6A 4AGVA 4AVTA 2HBUA 3VL8A 4M4RA 1H30A 4NHXA 4JGYA 1V0AA 1RC6A 4BOWA 4COVA 4BA6A 4CEYC 2WRAA 2EIDA 1P8JA 3ZVXA 2LTNA 5A3NA 3AM2A 4Q4X2 1LEDA 2D5HA 4G4FA 1FPN3 2ORXA 2I74A 4UW6A 4Y1ZA 3S30A 4EWEA 2ZA9A 3DYPA 1EV12 1GR3A 3USUA 1DQ6A 5FYCA 1W2NA 3LPGA 4R9AA 1IS5A 5T5JA 2QQPA 2GMEA 4XACA 5FXXA 2BEOA 1HW5A 1S0CA 2ZEYA 1NY72 3B01A 3WCSA 4BJ0A 4AHYA 2EAAA 3POEA 3AZWA 4AQ6A 4LBQB 3ZYIB 2TNFA 4M3CE 3RJRA 5CADA 2R072 1B35A 4NWWA 1W2OA 4QX8A 4LK7A 3E5QA 5CFCC 1DIWA 1ZZ8A 1UCXA 5CISA 1E5SA 4L97A 1XBFA 1YFUA 1ND2B 3F95A 3KV4A 4ZONA 3T2PA 4QKDA 3DPRA 5BNOB 2P2KA 4KBZA 5C3QA 2DCTA 1RUI1 1NA1A 1ULFA 2QE3A 2Y8KA 4AEDB 4YZ5A 1G9AA 2AYHA 5AC91 5I0RA 2DVDA 5T5LA 1ZRCA 2WDBA 3WP5A 1UW8A 3E5XA 2Q5TA 3O5SA 3IBMA 4NIAA 1VBB1 4AI8A 5DPNA 3PJQA 4EROA 2W08A 4TLFA 5DQ0A 1YQCA 1W6QA 4COUA 5LA9A 3Q8AA 4V2WA 2FDJA 3MIEA 1V6MA 4AFDA 5BNPB 3VBRB 2VTXA 3OPZA 5HV4A 1DGRN 4YPJA 5F3GA 2XJPA 1VBC1 3ON7A 1PO12 2PHXA 4FO9A 1PX4A 3CEWA 3TEYA 2VZOA 3RDIA 1OLQA 1J3PA 1QF3A 2ZZQA 2YC4A 1F4HA 4H55A 1SPPB 2JE8A 4L92A 4ZXEA 2RM21 2J42A 3NWKA 2XUMA 3SEPA 1AYM2 3ZFGC 3PTRB 4ZKTB 1JU4A 2VZVA 2XPJA 3DUIA 3NO8A 3OYWA 2QQJA 2Q8CA 4QAWA 3RJ2X 3WNLA 4IV3A 3BI3A 1RUJ3 1GP5A 1V6OA 4BMBA 1OOPC 2XL9A 2GNDA 1HV0A 1SFPA 4P08A 4DUWA 1IG0A 3PU3A 5FZIA 1QXJA 3JBG3 1SDWA 2RS31 3C7EA 3JQWA 5I91A 3WDWA 2QQLA 4P14A 1VBE1 3HBKA 2J1UA 4LE4A 2R061 2ADDA 1D4M3 2WYSA 5A7WA 2RMU3 1WMXA 4I02A 4CPBA 1VLNA 3KVBA 4YGEA 4UAPA 5T55A 3VD3A 1IS6A 3UNPA 4E4HA 4F3JA 2JG9B 4IV1A 4MGYE 1UN1A 1C8NA 5FY5A 1CD3G 3B94A 2FBEA 4BQYA 4DUVA 5FO7B 3OUHA 1HRI2 4UFHA 3MO4A 3L9JT 1C8M2 4IW3A 1NT0A 4CCDA 4FSJA 3IZOA 3ZDVA 1X8EA 3POGA 3QBQA 1COV3 2QFEA 2WZEA 4LR4A 2G9ZA 4JKMA 4Q1PA 4Q4V1 5DG2A 3VB9A 2XJTA 3ZPYA 4BXSV 5LY1A 1MS0A 3LZZA 4J1XA 2X09A 4P9WA 5LEJA 1VRH1 3K4AA 1QQP3 4K9SA 3VGIA 2XXZA 1V6IA 1IG3A 3WINE 3GBWA 3WNOA 1PZ8A 5KXBA 2V72A 3RYRA 2A73B 2I2SA 3MIGA 1YJLA 2QUOA 3A7QA 2OQ6A 4QKBA 2JDPA 5HCFA 5A80A 2VNRA 1HXS1 3ABZA 1ENQA 2HWE1 3A21A 3N7KA 3AP9A 3B02A 4MVTA 4C0HA 1DQ4A 1S0GA 2LALA 4INDA 4WM8A 4CUBA 5F9TA 4HT1T 5A7QA 2ARAA 4KBBA 3FHIB 1MPXA 1OBNA 2HWB3 4RHV1 5CFDB 1OA3A 2B9VA 2PMWB 3EO6A 5CVRA 1TQ5A 4XDPA 1GANA 4DOUA 2WNUA 2HH9A 3JU9A 3MF9A 5FYHA 4JVAA 1D2SA 1NUKA 4LK6A 4Q4Y1 2QDNA 5K0UA 3ZYJB 1EPZA 2OZJA 3A0KA 3G7DA 4L99A 4BDVB 5FYMA 3IB3A 2OS2A 3R4SA 4QU2A 3OOXA 1MQTC 3K48A 3PNAA 4PHZA 1PMIA 5DXDA 2IVIB 5JPMB 3S7EA 2W3JA 4L11A 4GALA 3ZFEA 3T1LA 4QDSA 5A6XA 5L36A 3O1OA 2OT7A 3VBHB 1L3JA 1DGWX 1F15A 2GNMA 2J7MA 2D40A 2XGXA 5C9AB 4Q4W3 1VBB2 1DQ5A 2KA3A 4E2QA 3H1WA 3Q8CA 5FP8A 2DTWA 3QCWA 4HFSA 1FAYA 1MS9A 3O1SA 3RWNA 1O59A 1ZA7A 3POIA 5GM0A 1EYBA 4GULA 1PK6B 4F83A 1LHOA 2BUKA 1FI2A 2YB7A 5C3SA 4XXAA 3RMYA 3CZUA 5F3CA 1RUF1 1O8SA 1ULGA 4LO8A 1AX1A 4B7KA 1MEC1
chains in the Genus database with same CATH topology
3N9NA 5FZ0A 3KV6A 5FZ4A 3PU8A 4EZHA 5F37A 5A3TA 4CCJA 5FY1A 5A7NA 3U4SA 5FZHA 5LWBA 3PU3A 5FZIA 5FWEA 4LXLA 5FZ6A 5ISLA 4AAPA 4GD4A 5A3WA 5FZ9A 4EZ4A 3N9QA 3PUAA 4GAZA 3PUSA 3KVAA 5FYIA 5A7WB 5FP4A 4LIVA 5A7WA 2Q8DA 5FWJA 5IVCA 5IW0A 3PURA 3PUQA 4HONA 3KVBA 5FZMA 5IVVA 3N9MA 4E4HA 3LDBA 4D6SA 4QXHA 4XDOA 5FY5A 5FZBA 5FP7A 5FUNA 4QU1A 3K3OA 5FV3A 2YBSA 2W2IA 3DXUA 5F5CA 1VRBA 4EYUA 4V2VA 5FYSA 5FZ1A 4TN7A 5IVBA 5F5AA 2YU1A 4URAA 4GJZA 5FYUA 2P5BA 5FYTA 5IVYA 4CCNA 4IGPA 5A1LA 5FZ7A 4CUGA 3RVHA 5FY9A 5A3NA 5FZLA 5LY1A 5F5IA 5A7OA 2OX0A 2PXJA 5IWFA 3K3NA 5FXVA 4AI9A 5KR7A 5F39A 2XXZA 2YBKA 4QX7A 2VD7A 5FJKA 3OPWA 4UF0B 5LW9A 4QWNA 3N9PA 5FYCA 5ANQA 2YBPA 3NJYA 5FZ3A 4IGOA 2XMLA 3U78A 4IGQA 2OQ6A 5A80A 5FXXA 3LD8A 5FZOB 5FBJA 5FPAA 5FZOA 3AVSA 5FYYA 2OQ7A 5FZEA 5A7QA 4D6RA 4QX8A 4QXCA 3K2OA 4DO0A 5IVFA 5K4LA 3UYJA 5F3EA 5IVJA 5A7SA 5FPVA 3KV4A 4C8DA 4Y4RA 4XDPA 5FY0A 5LY2A 5FPBA 3KV9A 5FY4A 5FYHA 3N9OA 5FP9A 4CCKA 4GJYA 5FY8A 2XUEA 3PDQA 5FJHA 2WWUA 5FXWA 5FYMA 4DIQA 5FYBA 2OS2A 2GP3A 5FP3A 3ZPOA 4BXFA 5A3PA 2GP5A 5FYVA 5FZDA 4CSWA 4UF0A 5IVEA 5E6HA 5FZGA 5F3IA 5A7PA 4CCMA 3ZLIA 4QXBA 5FPUA 4NUBA 4V2WA 2WWJA 2OT7A 4LITA 5FYZA 5FZAA 5FXZA 2YU2A 4BU2A 3AL5A 5F3GA 5F2WA 5CEHA 5FZ8A 3DXTA 4Y3OA 5FP8A 5FUPA 3AL6A 5FZKA 2YPDA 4Y33A 5F2SA 4ASKA 4D6QA 4BISA 5FZCA 2XDVA 3PTRB 3AVRA 5F32A 5FPLA 5FY7A 3KV5A 5FZFA 4CCLA 5F3CA 2Q8CA 5A1FA 2Q8EA 4LIUA 3N9LA 4HOOA 3OPTA 4CCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9N A;  5FZ0 A;  3KV6 A;  5FZ4 A;  3PU8 A;  4EZH A;  5F37 A;  5A3T A;  4CCJ A;  5FY1 A;  5A7N A;  3U4S A;  5FZH A;  5LWB A;  3PU3 A;  5FZI A;  5FWE A;  4LXL A;  5FZ6 A;  5ISL A;  4AAP A;  4GD4 A;  5A3W A;  5FZ9 A;  4EZ4 A;  3N9Q A;  3PUA A;  4GAZ A;  3PUS A;  3KVA A;  5FYI A;  5A7W B;  5FP4 A;  4LIV A;  5A7W A;  2Q8D A;  5FWJ A;  5IVC A;  5IW0 A;  3PUR A;  3PUQ A;  4HON A;  3KVB A;  5FZM A;  5IVV A;  3N9M A;  4E4H A;  3LDB A;  4D6S A;  4QXH A;  4XDO A;  5FY5 A;  5FZB A;  5FP7 A;  5FUN A;  4QU1 A;  3K3O A;  5FV3 A;  2YBS A;  2W2I A;  3DXU A;  5F5C A;  1VRB A;  4EYU A;  4V2V A;  5FYS A;  5FZ1 A;  4TN7 A;  5IVB A;  5F5A A;  2YU1 A;  4URA A;  4GJZ A;  5FYU A;  2P5B A;  5FYT A;  5IVY A;  4CCN A;  4IGP A;  5A1L A;  5FZ7 A;  4CUG A;  3RVH A;  5FY9 A;  5A3N A;  5FZL A;  5LY1 A;  5F5I A;  5A7O A;  2OX0 A;  2PXJ A;  5IWF A;  3K3N A;  5FXV A;  4AI9 A;  5KR7 A;  5F39 A;  2XXZ A;  2YBK A;  4QX7 A;  2VD7 A;  5FJK A;  3OPW A;  4UF0 B;  5LW9 A;  4QWN A;  3N9P A;  5FYC A;  5ANQ A;  2YBP A;  3NJY A;  5FZ3 A;  4IGO A;  2XML A;  3U78 A;  4IGQ A;  2OQ6 A;  5A80 A;  5FXX A;  3LD8 A;  5FZO B;  5FBJ A;  5FPA A;  5FZO A;  3AVS A;  5FYY A;  2OQ7 A;  5FZE A;  5A7Q A;  4D6R A;  4QX8 A;  4QXC A;  3K2O A;  4DO0 A;  5IVF A;  5K4L A;  3UYJ A;  5F3E A;  5IVJ A;  5A7S A;  5FPV A;  3KV4 A;  4C8D A;  4Y4R A;  4XDP A;  5FY0 A;  5LY2 A;  5FPB A;  3KV9 A;  5FY4 A;  5FYH A;  3N9O A;  5FP9 A;  4CCK A;  4GJY A;  5FY8 A;  2XUE A;  3PDQ A;  5FJH A;  2WWU A;  5FXW A;  5FYM A;  4DIQ A;  5FYB A;  2OS2 A;  2GP3 A;  5FP3 A;  3ZPO A;  4BXF A;  5A3P A;  2GP5 A;  5FYV A;  5FZD A;  4CSW A;  4UF0 A;  5IVE A;  5E6H A;  5FZG A;  5F3I A;  5A7P A;  4CCM A;  3ZLI A;  4QXB A;  5FPU A;  4NUB A;  4V2W A;  2WWJ A;  2OT7 A;  4LIT A;  5FYZ A;  5FZA A;  5FXZ A;  2YU2 A;  4BU2 A;  3AL5 A;  5F3G A;  5F2W A;  5CEH A;  5FZ8 A;  3DXT A;  4Y3O A;  5FP8 A;  5FUP A;  3AL6 A;  5FZK A;  2YPD A;  4Y33 A;  5F2S A;  4ASK A;  4D6Q A;  4BIS A;  5FZC A;  2XDV A;  3PTR B;  3AVR A;  5F32 A;  5FPL A;  5FY7 A;  3KV5 A;  5FZF A;  4CCL A;  5F3C A;  2Q8C A;  5A1F A;  2Q8E A;  4LIU A;  3N9L A;  4HOO A;  3OPT A;  4CCO A; 
#chains in the Genus database with same CATH topology
 4EJR A;  3WT3 A;  1GQP A;  1QJY 1;  1PO2 2;  3AFK A;  3KV6 A;  1VR3 A;  2ZEZ A;  4H7M A;  4Y24 A;  4GWN A;  3T4H B;  4QHB A;  1X50 A;  4FAG A;  2DBI A;  3H3L A;  3VBU B;  3IDE A;  1QEX A;  1W03 A;  3HJR A;  5JXH A;  5HXM A;  1AYN 1;  5GLV A;  1ZA4 A;  4JGZ A;  1AL2 2;  1US3 A;  3LEI A;  5A3O A;  4CDQ A;  5IUQ A;  1RIN A;  3TN9 2;  5K7P A;  2ZMK A;  5KHI A;  1GUI A;  5APA A;  2D93 A;  2W87 A;  2OII A;  2V4V A;  4FPJ A;  2Q8D A;  2ZS6 B;  3JD7 2;  1NLS A;  2BFU L;  2BWC A;  4IE6 A;  4K6B A;  4XE9 A;  4CXY A;  5H9R A;  1US2 A;  1MS3 A;  3VBF C;  3I49 A;  1NE6 A;  4I0W B;  5JOY A;  3O1V A;  4D6S A;  1L7R A;  4XIK A;  3SH4 A;  4RFR B;  1OT5 A;  4YG3 A;  5FZB A;  1GZW A;  2V4A A;  1H8T B;  2XOM A;  2ZKL A;  1CGP A;  4A6S A;  2W2I A;  4ZZ8 A;  1QKQ A;  4V2V A;  2OUJ A;  5FZ1 A;  2D5F A;  3AX4 A;  3LGR A;  4QPG B;  4GJZ A;  2IZW A;  2BJS A;  2VTX J;  5EV7 A;  5FYT A;  5IVY A;  5JWP A;  4XVH A;  3M3Q A;  1W8U A;  3V64 A;  4FTS A;  1FOD 1;  4YG6 A;  4P9J A;  1AR8 3;  5CBL A;  4OUS A;  1JZ2 A;  1RHI 1;  3AMH A;  4CEY B;  3ZIW A;  4JKK A;  4UBH A;  4ZZ5 A;  1ND3 C;  1IPK A;  4GWJ A;  1ZVF A;  2GSY A;  2YUE A;  4BPZ A;  1F35 A;  2Z2S B;  4FQ4 A;  3THP A;  1JN2 P;  1GYK A;  2GH2 A;  3N9P A;  4NN0 A;  4CDU C;  5ANQ A;  3AP7 A;  1W0N A;  5F5Q A;  1VE0 A;  4NWV A;  3NNL A;  2A3W A;  1NLR A;  2ZGO A;  3LIG A;  1ACC A;  2YPJ A;  2Y26 A;  2BVB A;  2ET7 A;  2P37 A;  2WNV A;  1W9W A;  3O7O A;  1X9P A;  2XBO 3;  2VE1 A;  1GNH A;  3VHO A;  1PGW 1;  3GCX A;  5FZO A;  2EIE A;  3T3Y A;  1WW6 A;  4UFI A;  4LBJ A;  1UZ0 A;  3URF A;  1HXS 2;  5EJ1 B;  2HWE 2;  3O0W A;  3AP6 A;  1LOE A;  1AR6 3;  2DCJ A;  5F3E A;  4QQP A;  5IFT A;  4FCA A;  3ATG A;  4L8Q A;  1W0O A;  5IYY A;  1W28 A;  3AB0 A;  3FN9 A;  1UIJ A;  2W1Q A;  2ZTN A;  3H8X A;  4GB3 3;  2TEP A;  5CFC B;  2JXA A;  1XNK A;  4BQX A;  4YNI A;  2WT2 A;  4XQW A;  1W6O B;  1Q5O A;  2C0Z A;  4NHY A;  3I59 B;  1WZX A;  1OKO A;  4CCC A;  3MBW A;  4Q4Y 2;  1F9K A;  1U5I A;  3AP4 A;  4P9Y A;  4RR3 A;  3ZLI A;  4D0Q A;  2WS9 3;  1JZ6 A;  1UWW A;  2G19 A;  4Z82 A;  3Q9O A;  1PVC 1;  4B4Q A;  5I8T A;  4CDX A;  2B5H A;  2RS5 3;  3AL5 A;  5GJ6 A;  4P9G A;  3P3N A;  2ORZ A;  3K77 A;  1WA6 X;  2HLE A;  3ZXA C;  5KHH A;  4XFC A;  4Y3O A;  4L2N A;  4Y33 A;  4RQP C;  2VW1 A;  3OEB A;  4I0A A;  5J36 A;  2E33 A;  4XFI A;  2BGC A;  2HWD 1;  3MLK A;  4A7K A;  2VMH A;  2GH8 A;  3VLB B;  1RUE 3;  4WM7 A;  1WBF A;  1SBF A;  2GC2 A;  5BYN A;  4R4X A;  4LOT A;  4CPB D;  3ZFG B;  1O3S A;  2O0O A;  2ZX3 A;  2SLI A;  3WEZ A;  3LOB A;  4HSL A;  4NAO A;  2WWS A;  3GNE A;  2HYK A;  4Q29 A;  4XUR A;  1A78 A;  3UL2 A;  3ZM8 A;  4A45 A;  3GBG A;  2DCK A;  2YMZ A;  1K12 A;  4YFW A;  3ZYR A;  4N43 C;  1MEC 2;  2A70 A;  4HBN A;  3ZSM A;  4X6R B;  1UQX A;  1QJY 2;  3FUQ A;  3KCX A;  1LOC A;  2IXI A;  2VQU A;  2B8M A;  1QOO A;  1GOH A;  4XFG A;  2XR4 A;  4MGK E;  4UYB A;  5J7M A;  5KHK A;  5BV6 A;  4QQL A;  1NOV A;  3FBY A;  4FVV A;  3UV9 A;  1AYN 2;  1F5J A;  2G9F A;  4M0N A;  5FP4 A;  1S4C A;  3LSD A;  1EAH 2;  3AZY A;  4FOV A;  5FOJ B;  2Z69 A;  1NKG A;  4HON A;  4LO5 B;  3MDP A;  2V09 A;  2XQX A;  5A33 B;  5DMY A;  2IWG B;  1J83 A;  5FP7 A;  1W9T A;  1OD3 A;  3P1I A;  1S0J A;  1IS3 A;  4IEP A;  2C9K A;  4NPL A;  5FOB B;  1K5M A;  4XBN A;  1S0B A;  2WQ4 A;  2VMF A;  4UXA A;  3W5M A;  1S0I A;  1HLC A;  3AC0 A;  1E5R A;  3WZ1 A;  5GAL A;  4E8C A;  1LJ7 A;  3AYD A;  3SNM A;  2Q1F A;  1LOG A;  4D7T A;  1O4Z A;  3MW2 A;  3WW1 A;  1Z78 A;  5C71 A;  4YVS C;  2E63 A;  4JTN A;  2PXJ A;  3ZKY A;  4QHO A;  3I3M A;  3GGL A;  3N35 A;  4R9B A;  2XJR A;  4TYS A;  1XU1 A;  3ZX7 A;  4NRQ A;  2R30 A;  5J1X A;  1QHD A;  3O1U A;  3KHB A;  3WOG A;  2WLP A;  3OCP A;  1S0F A;  4ASL A;  2XJQ A;  3BAL A;  1A34 A;  1RHI 2;  2CGN A;  4Q1R A;  3VBO A;  1W8N A;  4M01 A;  3HN3 A;  1NCR A;  5L19 A;  3HQX A;  2X8K A;  3I54 A;  1F4A A;  3EB7 A;  1GQH A;  4MGZ E;  3WW2 A;  3ZDS A;  3MUZ 1;  4HXC A;  4NJ4 A;  1GKB A;  3AXE A;  1SFN A;  1RUJ 1;  1BBT 3;  4ATF A;  4RD7 A;  3LDK A;  3LCP A;  2A75 A;  5DDJ 3;  4Q5O A;  3VKO A;  2XKP A;  3FWE A;  2W52 A;  1RUG 1;  3POB A;  3KV9 A;  4H7L A;  3NW4 A;  4LBO A;  4MHR A;  3JBG 1;  3VZN A;  3LAG A;  1C1L A;  2VOK A;  1DG6 A;  4D7S A;  1RMU 3;  3RG0 A;  4NPM A;  1HQL A;  1TME 1;  2HEY F;  1QJU 2;  1XSR A;  2NMN A;  3LFI A;  4G9S B;  4IXL A;  5A3P A;  5JCT A;  4XF1 A;  2PHT A;  1PNF A;  1MVE A;  1ZBA 3;  3M3I A;  4H14 A;  5F1R A;  2Y6H A;  1SG3 A;  1SLC A;  4JQR A;  4JCK A;  5GZD A;  1D4M 1;  1MQT B;  1X9T A;  2RMU 1;  3TWI A;  2G1M A;  1XNC A;  2HKX A;  3CF6 E;  3NNG A;  3ZXD A;  5BPX A;  3LOI A;  1YJK A;  1LEN A;  2XON A;  2VZQ A;  1LOB A;  4CVU A;  3IWZ A;  1FMD 2;  2R32 A;  3EMR A;  3P5B A;  3I2I A;  2X5I C;  2B39 A;  3WW4 A;  2VJX A;  3RQ0 A;  5FZK A;  3HT1 A;  1PVC 2;  2JIC A;  3ZN6 A;  4OQ8 A;  1R1A 3;  4ORF A;  1YFY A;  2YGM A;  2NN8 A;  1DQ0 A;  3AK0 A;  4LUK A;  2BBA A;  1BLZ A;  4DEV A;  5A70 A;  3ILN A;  2OVU A;  5JDB A;  5B4N A;  1SLT A;  2BFU S;  1ST8 A;  3MFA A;  3RFR A;  1ONA A;  2PQQ A;  1COV 1;  3GJB A;  3FUO A;  3IDB B;  2BW8 A;  4LIU A;  3ZMN A;  4A7Y A;  1X36 A;  1IHM A;  3OBR A;  4L0P A;  2HWD 2;  1FT9 A;  3Q8F A;  1W04 A;  4NII A;  1J84 A;  2R1B A;  3W20 A;  4MHU A;  4XJ9 A;  4FPC A;  2CDO A;  5FZ4 A;  3B5L B;  4LNV A;  1QQP 1;  5DAB A;  3KSC A;  1Y43 B;  4ASM B;  3BUC A;  1VBA 1;  3J4U H;  4E4Z A;  2GZW A;  3HVD A;  4UT5 A;  3CQO A;  3R05 A;  1GMM A;  1FPN 2;  3O0X A;  4J6G A;  4UBG A;  3TEX A;  4DXT A;  4IL7 A;  5E88 A;  2R04 1;  5FZ9 A;  1F2N A;  4PDW C;  1GZT A;  4GH4 C;  1C5H A;  3J8F 1;  2EXI A;  4PBP A;  2EAK A;  3P3P A;  2ZPX A;  3AZX A;  1AX0 A;  1AUY A;  1XB9 A;  2C4X A;  4W65 A;  3H7Y A;  4N7I A;  2CGO A;  4GMP 1;  1TMF 1;  2GC1 A;  4YFZ A;  1UYZ A;  2P1B A;  3VBF B;  2AEZ A;  2QQI A;  3SIT A;  1W6M B;  4Q8L A;  4O9E A;  4XW3 A;  1PM7 A;  3OBZ A;  3WW3 A;  2SBA A;  3QAC A;  2IFW A;  4FPK A;  1GWL A;  2XLF A;  4BIO A;  1JYW A;  3ZXG A;  2LS6 A;  3PUH A;  1W8H A;  1O4T A;  5C5T A;  2VQ0 A;  3NJZ A;  1UMH A;  1QY4 A;  2QQK A;  4CUG A;  2CWM A;  1AR7 1;  2H6B A;  2IXC A;  2WR9 A;  4O61 A;  3ACI A;  3WUD A;  4JTO A;  5IWF A;  2WA3 A;  2VEC A;  3BVC A;  5FR3 A;  2XLG A;  1WCS A;  2ZJC A;  5E89 A;  1ND3 B;  1YI7 A;  1MR5 A;  2DCY A;  2GNT A;  2O1Q A;  4XTM A;  2L9L A;  4XJW A;  4CP0 A;  4AG4 A;  4CDU B;  3BCW A;  3IAP A;  5C8C C;  3OF1 A;  4DIN B;  2JD9 A;  5FRA A;  4LLF A;  4CDW C;  1KEX A;  4LJH A;  4B1L A;  3ETQ A;  4Q4X 1;  5JI7 A;  3DYM A;  3ZXJ A;  2HWC 3;  4LOS A;  1W05 A;  1T2X A;  2HEV F;  2EXJ A;  4TSV A;  5BNN A;  1EV1 1;  1OH4 A;  4S2H A;  1RUJ 2;  4WZC A;  4P02 B;  1UOF A;  3RNS A;  2YGL A;  5BNO A;  5FJH A;  1Q8P A;  1WUV A;  2QDR A;  2XWJ B;  5FYB A;  4AED A;  3E97 A;  3C2U A;  4QQ2 A;  4CEW C;  1BCX A;  5FYV A;  1NY7 1;  4BQ5 A;  4QX0 A;  4LBM A;  2ZAC A;  2ZBJ A;  1X82 A;  3JBG 2;  1YYN A;  3PVO A;  5F6L B;  3WQ1 A;  5CA6 A;  3O1P A;  3I3D A;  2R07 1;  3LA7 A;  3TNQ A;  3M3O A;  5I8S A;  5FPU A;  1YXW A;  3VBS C;  5BNP A;  5LA2 A;  4KG8 A;  3VBR A;  2OW4 A;  1UMI A;  3OGR A;  4OYU A;  3WF4 A;  2Y34 A;  4HET A;  3UKV A;  1TVG A;  2QQO A;  1D4M 2;  2RMU 2;  2N7G A;  2VUL A;  3D3A A;  4ZS2 A;  4AVA A;  4AOC A;  1HN0 A;  4NOT A;  4LTA A;  4BIS A;  2Z79 A;  3WCR A;  4TTG A;  1SPP A;  4RQP B;  3N36 A;  5FY7 A;  1KD7 A;  4ZXK A;  3DV8 A;  4UW3 A;  3SCF A;  2A6X A;  4FPH A;  4Z2A A;  1AR8 1;  2VZR A;  1ODM A;  1W06 A;  4HL0 A;  5F37 A;  1DFQ A;  5A3T A;  1PNG A;  5J09 A;  3BPZ A;  5L73 A;  1D0H A;  3ES4 A;  1XYP A;  3M3C A;  1H4H A;  2YC2 A;  3O14 A;  1OUS A;  3WLU A;  2PTM A;  4Y4Y A;  4AK3 A;  4CZS A;  1AYM 1;  1QQP 2;  3LE0 A;  4N43 B;  4FI9 A;  3ZXK A;  4B1M A;  2XBO 1;  1N3Q A;  3M2M A;  2UUR A;  4YGB A;  3RYP A;  2A7A A;  4N9I A;  4P5Y A;  4LIV A;  5JOX A;  3SH5 A;  4NPR A;  1W39 A;  2QQU A;  3CL1 A;  4BIF A;  3H3Z A;  1AR6 1;  1CAW B;  3E5U A;  5FZM A;  1D2Q A;  1G9D A;  3V0A B;  4UOJ A;  4KWJ A;  1XXN A;  1N47 A;  1B35 C;  4GB3 1;  4KWK A;  1LR5 A;  2HWB 2;  2XHN A;  5L7O C;  4JC1 A;  1BEV 3;  4HPK B;  1QJU 3;  5KC6 A;  3AP5 A;  2VZS A;  4IEU A;  3ZN4 A;  2J1V A;  3DPR C;  1VMF A;  1S0D A;  4SLI A;  3B9I A;  3JCI A;  4KU7 A;  4AYU A;  3UKN A;  5LCW L;  4PIX A;  4YZ3 A;  4NHL A;  1QH6 A;  2D6M A;  1UYP A;  3PVE A;  2VZP A;  3K3N A;  2D7F A;  3TBD A;  2RS5 1;  2C9A A;  1W9Y A;  5EHD A;  5GLU A;  1CAU B;  1CJD A;  1RB8 G;  5I0S A;  1S2K A;  4YVS B;  1PX3 A;  5I0D A;  1HRI 1;  2VUC A;  5C7G A;  5AVA A;  5GZG A;  5FZ3 A;  3NJY A;  5ABJ C;  3U78 A;  4LKE A;  3N7M A;  4W50 A;  3MW3 A;  2C6S A;  1RGS A;  2BNO A;  1V9U 2;  2K0G A;  4GA9 A;  4Q4W 2;  2VMD A;  1TEI A;  1UNB A;  2O8Q A;  1UL9 A;  4OI1 A;  1OF3 A;  4W6Y A;  2VOW A;  3ASI A;  4LKF A;  3KF5 A;  2E7Q A;  3K2O A;  5IVF A;  3ITQ A;  3UYJ A;  2EAL A;  4NIH A;  2VNO A;  2PA7 A;  3MLL A;  1RUD 3;  4IV3 C;  1UY3 A;  2PEL A;  3VKF C;  4XOG A;  1OVP A;  3H1M A;  2WUH A;  5JZG B;  2VOV A;  5EYY A;  3JUU A;  1CAX B;  1HV1 A;  4XBL A;  2ZGN A;  1FV3 A;  2K9Z A;  4DZG A;  5FXW A;  4CXW A;  4AE2 A;  1JUI A;  2P4E A;  2R16 A;  1H0B A;  1Q8S A;  3NNM A;  4MYE A;  3ZPO A;  2AC1 A;  1YO8 A;  4HG6 B;  4CSW A;  1HB1 A;  2JJ6 A;  1CON A;  3WVJ A;  2KM2 A;  5FZG A;  1MS1 A;  1V6K A;  5ACA 3;  1DGR A;  2Y33 A;  1SBE A;  3LWC A;  5DZG A;  1UYY A;  4QPW A;  1UOG A;  2BRT A;  3VBH A;  5HPO A;  1VIW B;  4BB3 A;  4Y5T A;  4ONU A;  5J96 B;  5C9A A;  5CEH A;  1QH7 A;  2LRO A;  5A32 A;  2QQW A;  2E7A A;  4XF0 A;  2DYC A;  5C3P A;  3LDR A;  1LGC A;  5C5U A;  3ORJ A;  1KIT A;  1O5L A;  1LB2 A;  4XAB A;  1ALY A;  1UXX X;  1QWR A;  2PHF A;  2X5I B;  3VDD A;  3BKZ A;  1PK6 A;  2R6Q A;  2ZZJ A;  4YZ1 A;  1DYK A;  3KT7 A;  1LTE A;  2VCM A;  4CCO A;  5C33 A;  3KT1 A;  4JKL A;  3R4U A;  2BTV C;  1A8D A;  4I0B A;  1SLL A;  4GKX A;  4MZU A;  4XXP A;  3VV1 A;  2P3I A;  3M70 A;  1M4W A;  1DGW A;  1CWP A;  4PIZ A;  5LWB A;  4LO7 A;  3OD4 A;  1AR8 2;  1MS5 A;  1HN1 A;  4W6X A;  3I7D A;  1X7N A;  2DV9 A;  4JDO A;  2WJS A;  1CAV B;  1NX9 A;  3UK9 A;  5A1A A;  2ARX A;  1LHW A;  4N9H A;  5T3N A;  1SAC A;  4S2G A;  4IE7 A;  2P6H A;  2WL1 A;  1VB2 A;  1VP6 A;  2XHK A;  5EPA A;  3RI8 A;  1JMU B;  1OKQ A;  3ZYB A;  1LU2 A;  4UFL A;  1PO2 1;  2R1D A;  4PDW B;  5TSW A;  4AI2 A;  2PHD A;  2PHU A;  4GH4 B;  1XOY A;  1O3T A;  2BDR A;  3BOW A;  2RS1 3;  2XBO 2;  4FFI A;  1WCD J;  5GZE A;  3LDB A;  5J48 A;  4WM8 C;  3RZG A;  4FTE A;  1LU1 A;  3AFG A;  1S0E A;  3OJB A;  2BNN A;  4RS5 C;  2J1T A;  1CIY A;  2NM1 A;  5DAQ A;  4AL9 A;  1E5H A;  3AJZ A;  1AL2 1;  2ARB A;  4MG2 A;  1H8T A;  1AR6 2;  5LA1 A;  4FPF A;  2Y64 A;  3TN9 1;  2WZ8 A;  5L9B A;  4AEK A;  2VW0 A;  4QPG A;  1LHV A;  4GB3 2;  1GNZ A;  2ZX0 A;  4YRD A;  2XWB B;  3VHN A;  4HVO A;  3CNA A;  1V70 A;  1Q8V A;  3JD7 1;  4LBQ D;  1XE7 A;  4J1W A;  2QJV A;  2WZP P;  1F31 A;  3T2Q A;  4FPG A;  1DLL A;  4QX1 A;  2C24 A;  2W5F A;  3CKH A;  5FMB A;  1JUH A;  2WA4 A;  5IK8 A;  3S5A A;  4R9C A;  4QX7 A;  1UY4 A;  2WS9 2;  4UF0 B;  4BH9 A;  1SBD A;  2XML A;  1NCQ C;  1AL0 G;  1UMZ A;  3ZSJ A;  2RS5 2;  3UT0 A;  5CAZ A;  4OMC A;  1R09 3;  4AAX A;  2BOJ A;  4YSF A;  3U14 A;  4LHN A;  3T0D A;  4IE0 A;  3EHK A;  3OGS A;  4H2A A;  3WY6 A;  4RGG A;  1XSQ A;  3AJY A;  5C8C B;  4QXC A;  5HXV A;  4CUC A;  2RDR A;  5EZW A;  4CDW B;  1RUE 2;  2G9G A;  4AXO A;  5LY2 A;  4JQT A;  1S2B A;  3N9O A;  1F8V A;  2VOX A;  1W8O A;  4AW7 A;  1ASJ 3;  4K3U A;  4FPL A;  5CFC A;  3CBN A;  1ZRI A;  2D3S A;  2RJL A;  1W6O A;  4NID A;  5FMO L;  3FJS A;  2GP5 A;  3I59 A;  3G6J B;  4PIY A;  3GJA A;  5CZK A;  5KXE A;  2E6V A;  2H0B A;  2UWB A;  3OSD A;  4MSV A;  4FPY A;  4XJZ A;  4RA0 A;  4CEW B;  4LOR A;  2BPA 2;  5GZF A;  3OGJ A;  1J58 A;  4P9L A;  4EN0 A;  2YXS A;  3W59 A;  4N8M A;  1RIR A;  1CJP A;  2WAO A;  3C7G A;  2CTV A;  2D97 A;  4W6W A;  3MIC A;  4HK9 A;  4QKN A;  2XJU A;  4CU9 A;  4YAR A;  5SV5 A;  2EVX A;  3Q8E A;  4KU8 A;  4XUT A;  3VBS B;  3MPP G;  3B7M A;  2O8O A;  1TE1 B;  1ZBE 3;  1C28 A;  1KS5 A;  3HT2 A;  2IXJ A;  3LPF A;  3POF A;  4HLT A;  3D6E A;  1BQP A;  1PZ7 A;  3D0S A;  3WNM A;  5C6C A;  1EUU A;  3N9L A;  1VBD 3;  4I3P A;  2VVF A;  5T50 A;  1CVN A;  1MS4 A;  2JKX A;  3HR9 A;  4AQS A;  1N3P A;  2AGS A;  3ZFG A;  4XJ8 A;  1NLQ A;  3CZJ A;  4RGA A;  1RUH 3;  2YDE A;  3L2Y A;  4HKL A;  1UZV A;  3SCH A;  1O3R A;  1IZ3 A;  1H2M A;  5DAX A;  1N1Y A;  1OOP A;  3C7H A;  1AXY A;  1V9U 3;  4XUQ A;  4AQ2 A;  3ME2 A;  4YVW C;  1GSL A;  2AEN A;  2RDS A;  5A3W A;  2Y0O A;  1RUC 3;  5AFB A;  1X8M A;  1OLM A;  4ZU4 A;  1W6P B;  2Q4S A;  3RPQ A;  3LEK A;  3B00 A;  1OQD A;  2WZR 3;  1GIC A;  3J26 N;  4LHS A;  1OQ1 A;  2OYZ A;  3USU B;  2FMY A;  2J22 A;  4XQ4 A;  2VO5 A;  4B8E A;  4JZR A;  2B42 B;  4I30 A;  3WUC A;  2OKX A;  4QXH A;  2JB8 A;  3GZE A;  1JYN A;  5IK4 A;  1BBT 2;  1QIQ A;  3KCC A;  5A33 A;  3WF2 A;  1YUD A;  3RZZ A;  5DDJ 2;  1MS8 A;  3NKG A;  1YLL A;  1IPS A;  3OB8 A;  1B35 B;  1IQA A;  5D21 A;  4AGR A;  5L7O B;  4JDN A;  2D3R A;  4FOY A;  2VTF A;  2F6B A;  5HCB A;  1EAH 1;  2JEM A;  4ES8 A;  2VVD A;  3DPR B;  1RMU 2;  2WSV A;  1NXM A;  2OX0 A;  4DUX A;  4KQ7 A;  1MAC A;  4OI0 A;  1ZBA 2;  1HRV 3;  4AI9 A;  2BGO A;  3VDC A;  1R1Z A;  3GM8 A;  2VD7 A;  3MYX A;  4LEJ A;  4UFM A;  5FJK A;  1XYN A;  1DGL A;  4DB5 A;  4QQO A;  3T0A A;  5JOW A;  3IIA A;  3KT4 A;  4PLO A;  1Z7S 3;  1H1I A;  4FOQ A;  1UOJ A;  1KFU L;  4PI0 A;  5FO8 B;  3UGH A;  5ABJ B;  1UY2 A;  5AFE A;  4DY3 A;  4MGS A;  1R1A 2;  5FYY A;  2OQ7 A;  4FPE A;  2D3P A;  4WVW A;  4D6R A;  4BM8 A;  4ES9 A;  4M3C F;  2OA2 A;  3VHP A;  1V6N A;  1G9B A;  4FP2 A;  4MGT A;  1N1T A;  4QX2 A;  4EN6 B;  3LEG A;  4NE9 A;  1WW5 A;  2Q1Z B;  5AVP A;  1K3I A;  1RVF 3;  5A6Z A;  1BYH A;  4IV3 B;  1H4G A;  4JHT A;  3SMH A;  2JDY A;  3M3E A;  2V5Y A;  4AI0 A;  1MZ6 A;  1W0P A;  1MVQ A;  4KH9 A;  1UU4 A;  2NZ9 A;  3ZYH A;  2OPK A;  4V1P A;  3SEE A;  2WQ8 A;  4TXW A;  4FOW A;  3KF3 A;  2VUJ A;  4NHK A;  2DUP A;  3D82 A;  5I93 A;  2D44 A;  2QKD A;  4MGI E;  3BGA A;  5M0T A;  1Q56 A;  3JB4 C;  2FDF A;  4CRQ A;  5F2S A;  1LHN A;  4YWA A;  3HQU A;  5LBE A;  1Y9G A;  1QJU 1;  5C3R A;  1SCS A;  2D6K A;  3EQE A;  4PF5 A;  4JAA A;  3WD5 A;  3AMQ A;  2YFU A;  4P9I A;  4CP9 A;  2DUQ A;  5LA0 A;  3AVR A;  4QPI C;  1ZRF A;  2GU9 A;  1JZ7 A;  2A6Z A;  1APN A;  5A1F A;  2ZMN A;  5LBF A;  2JKB A;  3OPT A;  3POJ A;  4C1X A;  5KHG A;  2NQY A;  1TNF A;  2OPW A;  2BNM A;  3B93 A;  2P17 A;  4QX5 A;  1FMD 1;  4FPO B;  4IEW A;  3HAG A;  3T0B A;  5A7N A;  5IK7 A;  2CV6 A;  1U12 A;  5FKB A;  1QDC A;  4LXL A;  3WNX A;  4ZU7 A;  2EXH A;  3QOP A;  1POV 1;  4RYD A;  3RRD A;  4O7X A;  1JYI A;  2BV4 A;  3THT A;  1O4Y A;  3S57 A;  4GAZ A;  1QGL A;  3PUS A;  2O14 A;  1Q8O A;  3KVA A;  4BYY A;  5LEK A;  1HQN A;  3H0O A;  4QGL A;  1OC1 A;  1O8P A;  4PQQ A;  4YW3 A;  1PGL 2;  2RE9 A;  2VQT A;  2XG3 A;  1QJX 3;  4DXZ A;  4OUE A;  3KD4 A;  3O1M A;  1RUD 1;  4AFM A;  1C1F A;  5JUV A;  2EIB A;  4FFH A;  3AKS A;  2Y38 A;  1QOS A;  5FUN A;  4CP1 A;  1ULC A;  2HWC 2;  3VBF A;  5DAP A;  5JMO A;  1FPN 1;  2JIG A;  4WM8 B;  1W6M A;  3O12 A;  3KWV A;  5F5C A;  2E9Q A;  3IPV B;  1RXF A;  3MEP A;  5IVB A;  1DP0 A;  4RS5 B;  2QZ3 A;  1O5U A;  2CDP A;  3CJI C;  2P5B A;  4QKF A;  3AZZ A;  5C70 A;  3VZM A;  5FQ0 B;  4B4P A;  2H6C A;  5FY9 A;  4KI5 M;  1ZZC A;  3U75 A;  1VB4 A;  4FFF A;  5GLT A;  1WCK A;  1SFY A;  1LOF C;  1SCR A;  3MW4 A;  2JX9 A;  3LEM A;  2E31 A;  3EYP A;  3W21 A;  3GZU C;  3K46 A;  2VZT A;  4YGC A;  1SLA A;  5FMO S;  3OPW A;  2DFC A;  1FYU A;  4H3W A;  4UFK A;  2YBP A;  2QQN A;  4F8A A;  2FZ1 A;  3K4Z A;  1NZI A;  1ND3 A;  4I01 A;  2E51 A;  1IPJ A;  4IET A;  4CDU A;  1J59 A;  1NCQ B;  1OF4 A;  3CJX A;  5FBJ A;  3GHN A;  3C7F A;  5CNA A;  1LUL A;  4YGD A;  4DS0 A;  2KR2 A;  3AVS A;  3TNP B;  2DDU A;  3ZFF C;  4GKY A;  4X8N A;  2C26 A;  2VG9 A;  4K21 A;  1TNR A;  1GV9 A;  1H9P A;  1XND A;  3HEI A;  3N4M A;  3WDX A;  2WO7 A;  3DYO A;  1WLW A;  3A23 A;  3JZV A;  5FY4 A;  2XVK A;  3WNP A;  3MFC A;  3MIH A;  5CYY A;  2RJ2 A;  4YZ2 A;  5JSR A;  1HDK A;  3LB9 A;  4M0H A;  3PDQ A;  2JWP A;  2MEV 3;  2D98 A;  3ZYF A;  1HJG A;  2EA7 A;  3AYA A;  4QB6 A;  2X05 A;  1KRI A;  3OTF A;  3FZ3 A;  3O1T A;  3N3H A;  4KGQ A;  2X53 S;  3RZL A;  1I9R A;  4LKS A;  4NUB A;  4BME A;  1OH3 A;  1UZW A;  2IUW A;  2JDK A;  2ZCW A;  4QDR A;  3VL9 A;  1BJQ A;  5FXZ A;  4AI1 A;  1DDL A;  1RUI 3;  2RS1 1;  2VR4 A;  5FUI A;  3WP4 A;  4CDQ B;  1I5Z A;  4PQ9 A;  5AC9 3;  4S2F A;  3WQ0 A;  1SDD B;  3R6S A;  5JZG C;  2YPD A;  5J98 B;  3BU0 A;  3WNK A;  4XYX A;  4B29 A;  3ENR A;  3KMH A;  2X29 A;  4QX3 A;  3I4I A;  5FPL A;  1JBC A;  2A6Y A;  4KG0 A;  4RQP A;  4B3N A;  4CE8 A;  1BEV 2;  1UZY A;  2E32 A;  2Y6F A;  4D7Y A;  3ACG A;  1XRU A;  2W0X A;  4W4Z A;  4XPV A;  5GLZ A;  1UO9 A;  4COW A;  3INA A;  2B46 X;  4BHP A;  1WMD A;  4XIL A;  5HI0 A;  1QJE A;  2RM2 3;  1TG7 A;  2HJI A;  5D8A C;  2JD4 A;  1ZRD A;  1DU3 D;  1D7P M;  2ZGR A;  3T1M A;  2VAU A;  1JOB A;  2J1A A;  4URT A;  1A3K A;  4OQ9 A;  1R09 1;  4AAP A;  3N9Q A;  4F7Z A;  4N43 A;  4K1Z A;  2IC1 A;  1AJO A;  3NJX A;  4YVW B;  3THD A;  2ZKN A;  4IER A;  2VZU A;  1BZW A;  4IEO A;  4COY A;  5FMC A;  2VUA A;  1Y9Q A;  2FDG A;  1OLM E;  2RS3 3;  1W99 A;  4N53 A;  1CAW A;  3V0A A;  1OXC A;  2VXR A;  2ZAB A;  4CA9 A;  5H9P A;  2J1S A;  4AFA A;  1DZQ A;  3HPN A;  1DZT A;  5FK7 A;  1U5X A;  1F5F A;  3CO2 A;  3PL0 A;  1VBE 3;  4X8P A;  4XJU A;  1VRB A;  5DUW A;  5BNN C;  2R06 3;  4Q27 A;  1RUD 2;  1R64 A;  4HPK A;  3T4V A;  2ZGU A;  4MLO A;  2GAU A;  1XPW A;  4A6O A;  3AXD A;  3NRU A;  1URX A;  4E27 A;  2WO2 A;  3DEM A;  2NPI A;  4AFC A;  1REE A;  2BU9 A;  1U0A A;  2EIG A;  4XJA A;  5T5O A;  4FQZ A;  5FZL A;  1OUR A;  2VCB A;  2ZOE B;  1CAU A;  5ACA 2;  1VMH A;  1WD4 A;  2JDZ A;  1JYT A;  2HWB 1;  3B3Q E;  5LW9 A;  1S2E A;  1AF9 A;  4YVS A;  2Q8O A;  4IGO A;  2MHF A;  1IS4 A;  3D0J A;  4XUN A;  1ZBE 1;  2XJS A;  4EN8 B;  1UZZ A;  1NG0 A;  5C4W C;  1U5Z A;  3J7M A;  5FAX A;  3BTY A;  1GBG A;  1H8V A;  2QQM A;  3FC0 A;  1VRH 3;  1VBD 1;  2A5Z A;  1ULD A;  1XE8 A;  3OY8 B;  4AVC A;  5LBB A;  4Y1X A;  4QB2 A;  4AFB A;  4R4Z A;  1WGP A;  3I2J A;  5IVJ A;  4FTB A;  4P5H A;  4AQT A;  5FY0 A;  1W6N B;  3GCW A;  3MZH A;  2WKK A;  1IKQ A;  4TZD A;  5FP9 A;  5FLH A;  3CLP A;  1XQN A;  5E1R A;  5EIY B;  1GZ9 A;  3OGV A;  3NAP C;  3KGZ A;  1FNZ A;  4GMP 0;  3ST7 A;  1V9U 1;  4Q4W 1;  2E7T A;  1H6Y A;  3AMN A;  3ILR A;  2JG8 C;  3SIS A;  1ZYB A;  3E6B A;  4RHV 3;  1RUC 1;  5IVE A;  1AXZ A;  5E6H A;  5F3I A;  4AGG A;  2WZR 1;  3FFQ A;  3HNM A;  2XQR A;  1JS9 A;  4C91 A;  2Q30 A;  4LIT A;  5FYZ A;  3ZXL A;  3DL3 A;  1PVX A;  2WNE A;  4LBL A;  1UD1 A;  5JSO A;  2AH2 A;  3D4K A;  1AR9 3;  4I09 A;  5DZE A;  4YW2 A;  4LBQ A;  1H1M A;  5FUP A;  5FZ8 A;  3W9A A;  5IK5 A;  2W92 A;  2FD8 A;  2V5D A;  5F6K A;  4AHZ A;  4DRR A;  1OQE A;  2VBP A;  2EIC A;  2RS1 2;  2ID4 A;  1UKG A;  4YM2 A;  1ND2 A;  4NR1 A;  2XDV A;  2B4K A;  4LPL A;  2J1E A;  4LBN A;  4I2O A;  4E9K A;  5FDB A;  2VZ1 A;  2ZAA A;  3CMG A;  1U5Y A;  2QQV A;  3A0N A;  5DAV A;  2Q8E A;  1JHJ A;  5JR7 B;  1WLT A;  3DEC A;  3KQR A;  5LBC A;  4QPI B;  5IT6 A;  5JMC A;  2GDF A;  3R4D B;  3R0R A;  5LAT A;  1HRV 1;  4EZH A;  4CCJ A;  1FXZ A;  2JE9 A;  3U4S A;  4LO4 B;  2XJV A;  1NXD 1;  3VZL A;  4PF1 A;  3WG3 A;  2BBV A;  4OCT A;  3FHA A;  2JEN A;  1K5J A;  1CAV A;  1RUF 3;  1DYP A;  4ZPI A;  2K2S A;  3SCG A;  5JIA A;  3PUA A;  2ZHL A;  4HMZ A;  3RGB A;  4AR2 A;  3S5Q A;  3EXU A;  1NE4 A;  1DQ2 A;  1DHK B;  5BXX A;  1C3H A;  3FLP A;  2UWC A;  3MF6 A;  5KHJ A;  3CDZ B;  1R09 2;  4GQ7 A;  1H6X A;  1HB2 A;  4PDW A;  5IAT A;  4QDQ A;  4IEX A;  1Y3T A;  1NCR B;  4GH4 A;  3ROU A;  2GC0 A;  2VH9 A;  2VVE A;  1BKZ A;  2W1U A;  4A4A A;  1AXK A;  1XNT A;  4XCB A;  4JGY C;  4KNC A;  3VKM A;  3K3O A;  2FMD A;  2XLA A;  5FLI A;  2YG0 A;  3KZ4 C;  1XNB A;  5JI9 A;  1GZC A;  4XF3 A;  1YNA A;  2IXH A;  2PLV 3;  3A22 A;  4E2S A;  5B2G B;  5JIU A;  4DNY A;  4A2U A;  2DFB A;  4K1Y A;  2D6L X;  2A1X A;  1FAT A;  4QT6 A;  1ASJ 2;  4IGP A;  3KQ4 B;  1G8W A;  2LRP A;  3NJV A;  3RVH A;  3CJI B;  2UY9 A;  1QJZ A;  4Y5S A;  1W90 A;  1GFF 2;  1R08 3;  3RWK X;  5LK5 A;  5EJZ B;  1KXG A;  1ZRR A;  5KR7 A;  2ZGS A;  2VQA A;  3AKQ A;  4Y1Y A;  2BZD A;  2VBD A;  4R8H A;  2ES3 A;  2P3J A;  3VD7 A;  2DVF A;  4DEQ A;  4YLZ A;  4D94 A;  1CX4 A;  4IES A;  1S1A A;  3B69 A;  1WBL A;  2CNA A;  4AEJ A;  1FOD 3;  1ULE A;  4M3C B;  1YQ2 A;  4FFG A;  2JG9 A;  5LZ6 A;  2NP0 A;  3U11 A;  5FTT C;  5JXI A;  1ZRE A;  3MPB A;  5FK8 A;  1AZD A;  2ATF A;  2H0V A;  3NV4 A;  1PHM A;  2VBB A;  2WN3 A;  3KHC A;  2KXL A;  4L9B A;  1C4R A;  2EXK A;  3HQR A;  1ZBE 2;  4XAE A;  3VDD C;  2ILM A;  1LEM A;  4BQ4 A;  4EE2 A;  5K4L A;  1I6X A;  1NA1 C;  3W5N A;  3E6C C;  4C8D A;  4YW4 A;  4CDW A;  3OGG A;  3ZFF B;  4LO6 B;  3MGU A;  4BQW A;  2WS9 1;  2NLR A;  1UKR A;  3BPS A;  1VBD 2;  3HN1 A;  3NQH A;  2GMM A;  1ZZ6 A;  4GJY A;  2RG4 A;  3E1F 1;  2DCZ A;  3GXU A;  4NAM A;  3BU7 A;  4WVM B;  1UXZ A;  1TZO A;  2WWU A;  2ZXQ A;  3ZR6 A;  4OHV A;  5JXJ A;  5SV8 A;  1RUH 2;  2PYT A;  1OPM A;  2ARC A;  3AKP A;  2DTY A;  5E8A A;  4B4R A;  3RZK A;  4Y22 B;  1JZ4 A;  4FBF A;  1XJA A;  3DN7 A;  3V0B B;  1REF A;  2WWJ A;  1RUE 1;  5CG9 A;  1JI6 A;  1N1V A;  3ZIX A;  1QJX 1;  1RUC 2;  5C3O A;  2TBV A;  1W3X A;  1DCS A;  2G4I A;  5F2W A;  2WZR 2;  2BP6 A;  5A3M A;  1S55 A;  1J3R A;  1UIK A;  2VUD A;  1BMV 1;  3GZA A;  3KLS A;  1PIV 3;  5CIR A;  5CFD A;  3ZYP A;  3VBS A;  2XVG A;  4NO4 A;  1KJL A;  4PI2 A;  4XUP A;  4XMI A;  3T30 A;  1K42 A;  4A3Z A;  2Y6K A;  2A6V A;  2JEC A;  5F32 A;  3WDY A;  4OI4 A;  3WR0 A;  3H50 A;  2FDK A;  1WA4 A;  4GZ9 A;  1H1A A;  4DMI A;  3N9N A;  4G3Y C;  1JOP A;  3F2Z A;  5CU1 A;  1Y7B A;  2PHW A;  4JDM A;  4MX3 A;  2VPV A;  4ARY A;  3U0Z A;  1G86 A;  1O3Q A;  1YWK A;  4JV4 A;  4DY5 A;  1SLB A;  3PMS A;  2RR1 3;  1HRV 2;  2VOT A;  5FZ6 A;  2D43 A;  2F4P A;  2R7E B;  3HWJ A;  5D8A B;  3ZR5 A;  2CGP A;  3C8X A;  3EBR A;  1YIP A;  3TEW A;  3H1Y A;  1W9F A;  3B9C A;  3QD6 A;  4IV1 C;  1W6P A;  1Z7S 2;  2A3Y A;  1RUN A;  3AMP A;  1LHU A;  4WV8 A;  5EFU A;  4WVV A;  2JIJ A;  2W91 A;  4Y1V A;  1LGB A;  1J1T A;  4QGN A;  2CSG A;  4BCU A;  2ETE A;  5DUU A;  2YZ4 A;  5FV3 A;  4LKD A;  4CYD A;  1C57 A;  1CR7 A;  1UPS A;  1YIF A;  3VKN A;  3ZKU A;  5JR2 A;  3BTX A;  5FBZ A;  4E2G A;  4TN7 A;  1Z0H A;  2AUY A;  2MEV 1;  2W68 A;  5F5A A;  5LAS A;  3J9S A;  3VBU A;  1RVF 2;  1EP0 A;  1W8F A;  5BNN B;  5L7O A;  2ZX2 A;  3W58 A;  4NRM A;  2D6N A;  3MV0 1;  4ZU5 A;  3KM5 A;  1W2T A;  1H2N A;  2DVG A;  3VD9 A;  4Y20 B;  4HVR A;  4P00 B;  4MXW B;  3FMG A;  2P3Y A;  4K8F A;  1BBT 1;  2RV9 A;  3UJQ A;  3SH3 A;  3LF7 A;  1WD3 A;  4BE3 A;  1KJR A;  3NL1 A;  5DDJ 1;  1V6L A;  2ZGT A;  4DQA A;  5KC5 A;  1XYO A;  2WAA A;  1UYX A;  2QNK A;  2WT0 A;  3GDB A;  4XFF A;  5DZF A;  5FKC A;  5LRR A;  2ZEW A;  1EUT A;  2MNG A;  4LMF A;  4Y26 A;  1FV2 A;  1T6B X;  5ABJ A;  1WW4 A;  1E5I A;  1RMU 1;  3AYE A;  4MOA A;  2WNU C;  4U2A A;  5C4W B;  3PJY A;  1JOJ A;  4FXK B;  5K0U C;  1ZBA 1;  4QB1 A;  3IN9 A;  5FPV A;  3WF3 A;  3T2O A;  3O0V A;  2ZAH A;  2JB4 A;  2CU5 A;  3PLQ A;  3IAQ A;  4M4P A;  4AWD A;  4D69 A;  5I0T A;  3U4X A;  4GWI A;  4CEY A;  3PVN A;  3ZFE C;  1D0G A;  4DIQ A;  4QM9 A;  3OG2 A;  3RZH A;  1OHF A;  1PZ9 A;  4Z07 A;  5FZD A;  4WBB A;  3NAP B;  3POS A;  1RED A;  4QGM A;  2B9U A;  1R1A 1;  4RGK A;  4IEV A;  2WFF 3;  4YW6 A;  2GN7 A;  1RUG 3;  2JG8 B;  4TLG A;  4YW1 A;  1NAE A;  5EJ3 A;  3MLJ A;  4AZZ A;  5FZA A;  4PBO A;  5GLW A;  5GKA C;  4A42 A;  3V65 A;  4E4S A;  1IQD C;  1TME 3;  4OLL A;  2RJK A;  5IFP A;  2TUN A;  4HVQ A;  1EY2 A;  3JQX A;  1QJX 2;  2UU8 A;  2P34 A;  4D6Q A;  3WDT A;  4OHX A;  4QXK A;  4CU7 A;  3HD8 B;  3H8R A;  1QNY A;  1YC6 1;  1CPN A;  1ULO A;  4UW4 A;  4HKW A;  3HNB M;  2YFZ A;  4K8R B;  5CKQ A;  5FZF A;  4YM0 A;  1BMV 2;  3I2H A;  1LOA A;  4UFJ A;  4CXX A;  2HWF 3;  3HBZ A;  4HKO A;  1XE0 A;  3I3Q A;  3WG4 A;  1JYC A;  1GP6 A;  4CU8 A;  1IOA A;  2ZGP A;  1X33 A;  4ARX A;  3PU8 A;  4R52 A;  4JGZ C;  2JDN A;  1W2U A;  5FY1 A;  4CDQ C;  4XUO A;  1CZS A;  1SQ4 A;  2PAE A;  3I2D A;  3U37 A;  2MPF A;  5EQU A;  1RTV A;  4WZF A;  1LOD A;  4GD4 A;  2DUR A;  1AVB A;  1QNW A;  4UI9 L;  3WDU A;  3NV3 A;  5HBA A;  3VD5 A;  1AJK A;  2GN3 A;  5LB6 A;  5FWJ A;  4U36 A;  4CUA A;  1RUO A;  1QXP A;  2VMG A;  4HAN A;  1VBA 3;  5IVC A;  5IW0 A;  3PUQ A;  5DUV A;  1LAJ A;  1ZX5 A;  2QCS B;  2B45 X;  4BQ1 A;  2R04 3;  1AX2 A;  2FCT A;  5L9V A;  4NRP A;  1GOF A;  4ET7 A;  5J3U A;  3J8F 3;  2QBX A;  3KB5 A;  2ARE A;  3LA2 A;  3FBM A;  1OPO A;  3IPV A;  4LA3 A;  4MXV A;  4JGY B;  5D1I A;  4URA A;  4RS5 A;  1UOB A;  4CCN A;  3DKW A;  4GMP 3;  1TMF 3;  3GHM A;  4IUG A;  5FZ7 A;  3WP3 A;  5A1L A;  1PGL 1;  5FQ0 A;  4JRA A;  1GU3 A;  1JYV A;  3RZJ A;  1JOD A;  2MEV 2;  2PHR A;  5FRE A;  1VAV A;  4RN5 A;  5EXO A;  1LNS A;  1W9S A;  3OUI A;  1WWY A;  1OFN A;  2GC3 A;  3I3B A;  4IEZ A;  4LQR A;  1KS4 A;  1UX7 A;  1OLR A;  5F39 A;  1AR9 1;  5JXG A;  2CHH A;  2DVB A;  2XB6 C;  2WNV C;  4X6Q B;  1LKN A;  2HWC 1;  1YQ5 A;  2FCV A;  4KMQ A;  2FQP A;  4DFS A;  2FDI A;  2CY6 A;  1RUI 2;  4QM8 A;  3U1X A;  3ZMO A;  4AF9 A;  1AR7 3;  4GWM A;  1BVP 1;  1RJ7 A;  1G9C A;  5FIX A;  5KBF A;  4OZX A;  4UW5 A;  5AC9 2;  1J1L A;  3H8U A;  4OUM A;  1ENS A;  2QZ2 A;  2WC2 A;  5GZC A;  2ZGK A;  1NCQ A;  5T5P A;  5JOZ A;  1RIT A;  4EWD A;  2R0H A;  5BUV A;  3NNF A;  1QMJ A;  5A32 B;  4MH0 E;  2UYA A;  2GNB A;  3ACL A;  5A7S A;  3SLI A;  3IDA A;  2ET1 A;  5D2A A;  3T09 A;  3VDD B;  3BTZ A;  5DG1 A;  1HX6 A;  1NYW A;  1VBC 2;  1NQD A;  2ZEX A;  2Y0I A;  1NA1 B;  2UY8 A;  4LE3 A;  1SZB A;  2LUW A;  1NZC A;  3AYC A;  4RR3 C;  2VW2 A;  2VZ3 A;  3T2T A;  5IHR A;  4Q4X 3;  5FP3 A;  4BXF A;  2X10 A;  2RM2 2;  2YRO A;  1JYX A;  4CDX C;  3MI8 A;  1W6Q B;  1HB3 A;  3WHU A;  5ANN A;  1EV1 3;  5G04 L;  1W8T A;  4PCR A;  3NV1 A;  4N7U A;  2RDN A;  2Z5W A;  4GIQ A;  4HN1 A;  2Y6J A;  1ZZ9 A;  1WMF A;  4MO3 M;  2QVS B;  1BHG A;  5LK7 B;  4MV2 A;  3VDA A;  5CG8 A;  5H9S A;  4B7E A;  4WM7 C;  4XHX A;  2RS3 2;  4DPN A;  3AKT A;  2R07 3;  3IMN A;  3HNY M;  3U07 A;  2PLV 1;  1XU2 A;  4XTP A;  3OYW B;  4R9D A;  4OHY A;  2F4L A;  2WSU A;  4EV0 A;  1Q43 A;  1VBE 2;  1PMJ X;  2R06 2;  5E16 A;  3WQ7 A;  2J1R A;  1O6U A;  4HZF A;  3MUY 1;  3NNJ A;  1R08 1;  2PHL A;  2C1F A;  2DU1 A;  1DQ1 A;  2WO3 A;  3RZM A;  4XEZ A;  2YV8 A;  4OFG A;  3O1R A;  3I3E A;  3H8O A;  1XNA A;  1Q8Q A;  2XKO A;  1MQT A;  2ZHK A;  3IDC B;  4Q26 A;  4CU6 A;  3WXP A;  1KFX L;  3CHX A;  3L2H A;  3LQC A;  4IDZ A;  5LRS A;  5A3U A;  4TWT A;  1GNY A;  3UGF A;  1SMV A;  3FL7 A;  1G7Y A;  2BOI A;  5L9R A;  4QPY A;  1C5I A;  1W8W A;  1FNY A;  3JXS A;  3QLQ A;  1BEV 1;  5DUX A;  1KDM A;  1SLI A;  5A7W B;  2WT1 A;  4Q4V 2;  4QQH A;  4XFH A;  1PO1 3;  1VAK A;  3BOD A;  4YVW A;  3TEZ A;  4YM1 A;  4Z92 B;  5DN2 A;  3IMM A;  3VZK A;  4Z2W A;  5T54 A;  4IV1 B;  3S7I A;  4MAD A;  3WP6 A;  4Q0Q A;  1K5M C;  2ZX1 A;  2ZGM A;  3VHR A;  1AYM 3;  5JAX A;  1VRH 2;  1WME A;  3ALQ A;  3N7L A;  2C5D A;  1OA2 A;  3I2G A;  5IAV A;  2AAC A;  1I3H A;  1N1S A;  4M00 A;  3AZV A;  5FYS A;  4YYO A;  1RYY A;  1WCU A;  5FYU A;  3SQO A;  4C90 A;  2YHJ A;  3KGL A;  3P6B A;  3JB8 A;  4XIO A;  4C0B A;  4OHW A;  1QOT A;  4OUL A;  2DF7 A;  3POY A;  1YQ6 A;  4JRL A;  1UY1 A;  5F5I A;  1Y4W A;  2VY0 A;  1JW6 A;  2PQS A;  4RHV 2;  5IJR A;  4OHZ A;  3VBO C;  3RSJ A;  2W9X A;  1BXH A;  1BVV A;  1NCR C;  2R0F A;  2B7Y A;  2R49 A;  4O9G A;  3SKJ E;  1DYO A;  4QWN A;  3RMX A;  2CAU A;  1OMI A;  1PIV 1;  2LM3 A;  2FDH A;  4Q8K A;  1CZV A;  4A3X A;  1GWK A;  4XF4 A;  1N3O A;  2FCU A;  4Q2F A;  3WG1 A;  4DXS A;  1AR9 2;  3I8T A;  2WBK A;  4LT5 A;  3BIE A;  1POV 0;  3MIB A;  4XFB A;  3K51 A;  3Q8B A;  3NV2 A;  3DCQ A;  4JX0 A;  1JZ3 A;  3K4D A;  4FAH A;  2BGP A;  1HRI 3;  2ZHM A;  3OY8 A;  4DXR A;  1NQJ A;  5CB7 A;  3BN6 A;  4LHL A;  1H9W A;  2WNU B;  1C8M 3;  3FLT A;  1O91 A;  3ETP A;  4KL1 A;  1UU5 A;  4FP3 A;  5A6Y A;  5ACA 1;  3USS A;  1W6N A;  5K0U B;  1OUX A;  4WVZ A;  5FY8 A;  2IXK A;  2HBT A;  2CL2 A;  2P3K A;  2RR1 1;  2F17 A;  2VU9 A;  3QH6 A;  2PAK A;  2WIN B;  4XAA A;  3WF0 A;  3ZSE A;  3NVC A;  3I2O A;  4YG0 A;  4YW7 A;  1LCL A;  3GF6 A;  3DF0 A;  2VC9 A;  3ECQ A;  4O65 A;  3ZFE B;  1V6J A;  4QXB A;  4N90 A;  1DF0 A;  3APB A;  1RUF 2;  3WSO A;  5K8S A;  1ENX A;  1OOP B;  3I2F A;  3C7O A;  3K75 B;  1AHS A;  3PIJ A;  4PLN A;  1DBN A;  2A71 A;  1G6N A;  1A6C A;  4XFA A;  4I3G A;  3POW A;  2GMP A;  3OBT A;  4HN0 A;  1H2L A;  1HJF A;  4XC9 A;  4LHK A;  3WNN A;  4XZU G;  4ASK A;  5A3L A;  2NYY A;  2CYF A;  4N53 C;  2JDH A;  2ZX4 A;  3LSE A;  5DAW A;  5JLV A;  2IVJ A;  4ATE A;  1JTZ X;  2VCA A;  1QU0 A;  1T6G C;  3ZSL A;  3BYW A;  4FXG B;  1VPH A;  1DZR A;  3TYJ A;  1WCQ A;  2PN5 A;  3BTA A;  5CKM A;  3SHR A;  3UET A;  4MUV A;  2PLV 2;  4EWA A;  5BNQ A;  3D8C A;  4QPI A;  4OVE A;  4RL7 A;  4PT6 A;  4UWD A;  2E26 A;  2OZ6 A;  2VNG A;  1HIX A;  5FZH A;  1VAL A;  5FPZ A;  1WLC A;  3MHZ A;  4BLJ A;  1KQR A;  4JGZ B;  1R08 2;  5EYX A;  1H2K A;  1RJ8 A;  4MET A;  1CPM A;  4Y5Z 0;  4A44 A;  2PFW A;  3ACH A;  3WQB A;  5FLJ A;  3FFZ A;  3VZJ A;  3M8L A;  3I97 A;  2I45 A;  5FYI A;  1VBB 3;  5G05 L;  1O7F A;  2Z4F A;  4BQ3 A;  3M1H A;  1FOD 2;  5I8Y A;  5FO9 B;  2WO1 A;  2ERF A;  1V00 A;  2AEY A;  1CX1 A;  1VAM A;  2VGD A;  4LA2 A;  1DLC A;  1SHW B;  1GZW B;  1VBC 3;  1YHF A;  2Q0A A;  3III A;  4QU1 A;  3IKW A;  3MIF A;  5EWS A;  5EP9 A;  1LGN A;  3VZO A;  4AVS A;  2YBS A;  3BOP A;  3DXU A;  1JZ5 A;  1CES A;  1W3V A;  2RDQ A;  3KS7 A;  1UF2 C;  3FHQ A;  2YU1 A;  4P9X A;  1PO2 3;  2JDM A;  1CZT A;  1GOG A;  2WFF 1;  4ZHN A;  1PGW 2;  3E6D A;  1UAI A;  1PM4 A;  4RFT 0;  5A7O A;  3CJI A;  3PTY A;  4BK4 A;  4XHB A;  2VCC A;  1AL2 3;  2QTW B;  4Q0V A;  4SBV A;  4AVV A;  4YM3 A;  1YRZ A;  1ZZ7 A;  3TN9 3;  1VMJ A;  2W95 A;  2JE7 A;  3WF1 A;  5C8W A;  1MZF A;  1KGY A;  1LOF A;  3J7L A;  4YW5 A;  3HIF A;  3JD7 3;  4IGQ A;  2XH6 A;  5H9Q A;  2WNV B;  3H9A A;  4QMA A;  4E8D A;  5CKN A;  5JSP A;  2WNO A;  4JHZ A;  1OI6 A;  4M3C A;  2D6O X;  5FZO B;  2W1S A;  1ASJ 1;  3LFM A;  5FPA A;  2UWA A;  1PIV 2;  4PLM A;  5F7U A;  1POQ A;  2HWF 1;  1ND2 C;  4AHW A;  4E4D X;  1OFS A;  4W8J A;  3AKR A;  4AVB A;  1GWM A;  5BNO C;  2ZHN A;  4NHM A;  3FX3 A;  4Y4R A;  2YY1 A;  1J3Q A;  3ELN A;  5FPB A;  4AED C;  4CP9 B;  5BY5 A;  3ZFF A;  2BER A;  3SKV A;  3UJO A;  4BLI A;  4XET A;  4ISR A;  4D8M A;  2BVV A;  3LKJ A;  4K20 A;  4WVM A;  4A41 A;  3QH7 A;  4XCA A;  3WV6 A;  2VNV A;  3J7H A;  3LIH A;  4RR3 B;  4Q4V 3;  3ZSK A;  3VBR C;  5BNP C;  4CTE A;  4K40 A;  4LUL A;  1K45 A;  5A7P A;  2RR1 2;  4KWL A;  4Y22 A;  4D3W A;  3WX5 A;  4OZO A;  4CDX B;  3V0B A;  4EN9 B;  4CCE A;  2DU0 A;  3VKL A;  4BU2 A;  2Y6L A;  4Q0S A;  4BQ2 A;  4COZ A;  1ZZB A;  5A6Q A;  3THC A;  4ISQ A;  1OVS A;  2DWR A;  2ZGQ A;  3AL6 A;  4Z1V A;  1QDO A;  3WG2 A;  5HV0 A;  2JDU A;  3TB0 A;  1RUH 1;  2CAV A;  1YI9 A;  2WFP A;  4NMI A;  2VMI A;  1HXS 3;  5T52 A;  1BK0 A;  2HWE 3;  4WM7 B;  3CU7 A;  5FZC A;  4EN7 B;  4BZ4 A;  4CCL A;  5FPX A;  2KD7 A;  5JZG A;  1RL3 A;  2VL4 A;  4DRV A;  2Z42 A;  1CAX A;  1JXN A;  2OUH A;  2W47 A;  2AR6 A;  3DKQ A;  4FT8 A;  3KCY A;  4HOO A;  4Q0P A;  3H3U A;  1PGS A;  1STM A;  5KXD A;  4OI2 A;  1W8Z A;  2RHP A;  1YFX A;  4Q4Y 3;  3AMM A;  3BIW E;  1YQ8 A;  3M4F A;  4XBQ A;  3A4U A;  3VDB A;  2BQP A;  1YFW A;  2P6C A;  3MV1 1;  2ZGL A;  3ZN5 A;  1I5P A;  4EZ4 A;  5D8A A;  3WHT A;  4NVP A;  3M7A A;  4AEM A;  2ADE A;  4QHZ A;  1WW7 A;  1IKP A;  2HEW F;  3HOB A;  2DUO A;  3WDV A;  2JG9 C;  1JZ8 A;  2PAM A;  2X5I A;  3PUR A;  4CP2 A;  1L7L A;  4HSJ A;  1ODN A;  5IVV A;  3PME A;  3N9M A;  1JHN A;  1JU3 A;  3OD0 A;  5F8P A;  4AI3 A;  5K9Y A;  4XDO A;  3FLR A;  3NKT A;  1B09 A;  3RYK A;  3HMY A;  3TRS B;  1K5M B;  3ZO0 B;  3V56 A;  3IT8 A;  1QJF A;  4OMD A;  1CIW A;  1MZE A;  2XVL A;  3GBF A;  4YZ4 A;  4EYU A;  1LRH A;  1A8M A;  3ES1 A;  5FMD A;  4BWO A;  2JDA A;  1KDK A;  2W94 A;  2WQZ C;  2BWA A;  1Z7S 1;  2UYB A;  2OXB A;  3ZXE A;  2WLQ A;  1MEC 3;  3J7N A;  1RXG A;  1WLD A;  4LBK A;  3UGG A;  1QJY 3;  1GLH A;  3CIH A;  1ULP A;  4IEQ A;  4Y1U A;  3TOJ A;  4Y20 A;  5FXV A;  3X29 B;  3N7J A;  3VUO A;  1L7Q A;  2FHR A;  2IXL A;  2WFF 2;  2XL7 A;  2YBK A;  4IE5 A;  4MXW A;  1RUG 2;  2ENR A;  3UKT A;  2IFR A;  1AYN 3;  2VME A;  4KWU A;  4XMA A;  3VBO B;  3ZYG A;  1E57 A;  1EAH 3;  3ZXF A;  3LD8 A;  1RVF 1;  1TME 2;  1WKY A;  1HB4 A;  4LUM A;  5CFD C;  1UX6 A;  1LEC A;  2HYX A;  3PVB B;  5HCH A;  3RI9 A;  5FZE A;  2VM9 A;  3ZOI A;  4DO0 A;  5JVV A;  5C4W A;  4AHX A;  4ZY9 A;  1HQW A;  1SEF A;  4Z8B A;  3FE5 A;  1PMH X;  3S6P A;  2V73 A;  3NST A;  4S2D A;  3GZT B;  3TAY A;  3PUI A;  2HWF 2;  2VXJ A;  1JH5 A;  1VJ2 A;  2Q1M A;  4J25 A;  2I07 B;  4XF9 A;  4CCK A;  3VN4 A;  4XZP A;  4XQD A;  4IEY A;  5KXC A;  2WN2 A;  3EJK A;  2XUE A;  1YEW A;  2RVA A;  2BYV E;  3RS6 A;  2A6W A;  3SC7 X;  2GP3 A;  3PIG A;  2EF6 A;  1M06 G;  1QXR A;  1GQG A;  4UF0 A;  3VBH C;  2W46 A;  3NAP A;  2CWS A;  4CCM A;  1COV 2;  1YCI A;  1PO1 1;  5C9A C;  1EPW A;  1D4V B;  1HKD A;  2JG8 A;  2W39 A;  3PHM A;  4BK5 A;  1RHI 3;  2YU2 A;  2Y60 A;  3GAL A;  4IQP A;  3OBA A;  4IE4 A;  1CN1 A;  1PK6 C;  3DXT A;  1IGO A;  1Y9M A;  1W2A X;  3ZN6 B;  1VBA 2;  5C8C A;  1UPI A;  3S0M A;  4ITC A;  5KWR A;  2YYO A;  2YC0 A;  2Y6G A;  5ERL A;  1MZ5 A;  3D5O A;  4XDQ A;  5B4X A;  2R04 2;  3LA3 A;  3KV5 A;  4N53 B;  3UES A;  2VMC A;  3J8F 2;  1XC6 A;  1GP4 A;  1OA4 A;  2GAL A;  4HK8 A;  1ZNP A;  2AZ5 A;  3VBU C;  5FZ0 A;  1FX5 A;  3T08 A;  2ZML A;  1ENR A;  3DGT A;  3I2K A;  3SXW A;  5HCA A;  1LES A;  5IAX A;  1I1E A;  3H7J A;  1TMF 2;  2E53 A;  1Q3E A;  4A7Z A;  4CEW A;  5FWE A;  3NMB A;  2FZ2 A;  3H42 B;  4C1W A;  4KGG A;  2DBN A;  1OD5 A;  2W1W A;  2WAB A;  4NRO A;  4PJY A;  3BB6 A;  4K7J A;  4LLO A;  4RSU A;  3VD4 A;  4Q0U A;  5ISL A;  2LW8 A;  4GXL A;  4MGQ A;  1FMD 3;  4EQV A;  1OSG A;  3ILF A;  2D6P A;  2NMO A;  3ACF A;  3OEA A;  4NIG A;  1AR7 2;  3U10 A;  2A3X A;  1PVC 3;  1ZM1 A;  4QD2 A;  5I0U A;  2K46 A;  1BK1 A;  1H8T C;  1POV 3;  1C8M 1;  1G9F A;  5JPN B;  1UY0 A;  1CQ9 A;  5FCC A;  4QPG C;  5J37 A;  3GYD A;  2WYF A;  3OUJ A;  4ZS3 A;  2WII B;  5FFO C;  3MID A;  2DVA A;  2HWD 3;  3C3V A;  3IM0 A;  1UU6 A;  4AGV A;  4AVT A;  2HBU A;  3VL8 A;  4M4R A;  1H30 A;  4NHX A;  4JGY A;  1V0A A;  1RC6 A;  4BOW A;  4COV A;  4BA6 A;  4CEY C;  2WRA A;  2EID A;  1P8J A;  3ZVX A;  2LTN A;  5A3N A;  3AM2 A;  4Q4X 2;  1LED A;  2D5H A;  4G4F A;  1FPN 3;  2ORX A;  2I74 A;  4UW6 A;  4Y1Z A;  3S30 A;  4EWE A;  2ZA9 A;  3DYP A;  1EV1 2;  1GR3 A;  3USU A;  1DQ6 A;  5FYC A;  1W2N A;  3LPG A;  4R9A A;  1IS5 A;  5T5J A;  2QQP A;  2GME A;  4XAC A;  5FXX A;  2BEO A;  1HW5 A;  1S0C A;  2ZEY A;  1NY7 2;  3B01 A;  3WCS A;  4BJ0 A;  4AHY A;  2EAA A;  3POE A;  3AZW A;  4AQ6 A;  4LBQ B;  3ZYI B;  2TNF A;  4M3C E;  3RJR A;  5CAD A;  2R07 2;  1B35 A;  4NWW A;  1W2O A;  4QX8 A;  4LK7 A;  3E5Q A;  5CFC C;  1DIW A;  1ZZ8 A;  1UCX A;  5CIS A;  1E5S A;  4L97 A;  1XBF A;  1YFU A;  1ND2 B;  3F95 A;  3KV4 A;  4ZON A;  3T2P A;  4QKD A;  3DPR A;  5BNO B;  2P2K A;  4KBZ A;  5C3Q A;  2DCT A;  1RUI 1;  1NA1 A;  1ULF A;  2QE3 A;  2Y8K A;  4AED B;  4YZ5 A;  1G9A A;  2AYH A;  5AC9 1;  5I0R A;  2DVD A;  5T5L A;  1ZRC A;  2WDB A;  3WP5 A;  1UW8 A;  3E5X A;  2Q5T A;  3O5S A;  3IBM A;  4NIA A;  1VBB 1;  4AI8 A;  5DPN A;  3PJQ A;  4ERO A;  2W08 A;  4TLF A;  5DQ0 A;  1YQC A;  1W6Q A;  4COU A;  5LA9 A;  3Q8A A;  4V2W A;  2FDJ A;  3MIE A;  1V6M A;  4AFD A;  5BNP B;  3VBR B;  2VTX A;  3OPZ A;  5HV4 A;  1DGR N;  4YPJ A;  5F3G A;  2XJP A;  1VBC 1;  3ON7 A;  1PO1 2;  2PHX A;  4FO9 A;  1PX4 A;  3CEW A;  3TEY A;  2VZO A;  3RDI A;  1OLQ A;  1J3P A;  1QF3 A;  2ZZQ A;  2YC4 A;  1F4H A;  4H55 A;  1SPP B;  2JE8 A;  4L92 A;  4ZXE A;  2RM2 1;  2J42 A;  3NWK A;  2XUM A;  3SEP A;  1AYM 2;  3ZFG C;  3PTR B;  4ZKT B;  1JU4 A;  2VZV A;  2XPJ A;  3DUI A;  3NO8 A;  3OYW A;  2QQJ A;  2Q8C A;  4QAW A;  3RJ2 X;  3WNL A;  4IV3 A;  3BI3 A;  1RUJ 3;  1GP5 A;  1V6O A;  4BMB A;  1OOP C;  2XL9 A;  2GND A;  1HV0 A;  1SFP A;  4P08 A;  4DUW A;  1IG0 A;  3PU3 A;  5FZI A;  1QXJ A;  3JBG 3;  1SDW A;  2RS3 1;  3C7E A;  3JQW A;  5I91 A;  3WDW A;  2QQL A;  4P14 A;  1VBE 1;  3HBK A;  2J1U A;  4LE4 A;  2R06 1;  2ADD A;  1D4M 3;  2WYS A;  5A7W A;  2RMU 3;  1WMX A;  4I02 A;  4CPB A;  1VLN A;  3KVB A;  4YGE A;  4UAP A;  5T55 A;  3VD3 A;  1IS6 A;  3UNP A;  4E4H A;  4F3J A;  2JG9 B;  4IV1 A;  4MGY E;  1UN1 A;  1C8N A;  5FY5 A;  1CD3 G;  3B94 A;  2FBE A;  4BQY A;  4DUV A;  5FO7 B;  3OUH A;  1HRI 2;  4UFH A;  3MO4 A;  3L9J T;  1C8M 2;  4IW3 A;  1NT0 A;  4CCD A;  4FSJ A;  3IZO A;  3ZDV A;  1X8E A;  3POG A;  3QBQ A;  1COV 3;  2QFE A;  2WZE A;  4LR4 A;  2G9Z A;  4JKM A;  4Q1P A;  4Q4V 1;  5DG2 A;  3VB9 A;  2XJT A;  3ZPY A;  4BXS V;  5LY1 A;  1MS0 A;  3LZZ A;  4J1X A;  2X09 A;  4P9W A;  5LEJ A;  1VRH 1;  3K4A A;  1QQP 3;  4K9S A;  3VGI A;  2XXZ A;  1V6I A;  1IG3 A;  3WIN E;  3GBW A;  3WNO A;  1PZ8 A;  5KXB A;  2V72 A;  3RYR A;  2A73 B;  2I2S A;  3MIG A;  1YJL A;  2QUO A;  3A7Q A;  2OQ6 A;  4QKB A;  2JDP A;  5HCF A;  5A80 A;  2VNR A;  1HXS 1;  3ABZ A;  1ENQ A;  2HWE 1;  3A21 A;  3N7K A;  3AP9 A;  3B02 A;  4MVT A;  4C0H A;  1DQ4 A;  1S0G A;  2LAL A;  4IND A;  4WM8 A;  4CUB A;  5F9T A;  4HT1 T;  5A7Q A;  2ARA A;  4KBB A;  3FHI B;  1MPX A;  1OBN A;  2HWB 3;  4RHV 1;  5CFD B;  1OA3 A;  2B9V A;  2PMW B;  3EO6 A;  5CVR A;  1TQ5 A;  4XDP A;  1GAN A;  4DOU A;  2WNU A;  2HH9 A;  3JU9 A;  3MF9 A;  5FYH A;  4JVA A;  1D2S A;  1NUK A;  4LK6 A;  4Q4Y 1;  2QDN A;  5K0U A;  3ZYJ B;  1EPZ A;  2OZJ A;  3A0K A;  3G7D A;  4L99 A;  4BDV B;  5FYM A;  3IB3 A;  2OS2 A;  3R4S A;  4QU2 A;  3OOX A;  1MQT C;  3K48 A;  3PNA A;  4PHZ A;  1PMI A;  5DXD A;  2IVI B;  5JPM B;  3S7E A;  2W3J A;  4L11 A;  4GAL A;  3ZFE A;  3T1L A;  4QDS A;  5A6X A;  5L36 A;  3O1O A;  2OT7 A;  3VBH B;  1L3J A;  1DGW X;  1F15 A;  2GNM A;  2J7M A;  2D40 A;  2XGX A;  5C9A B;  4Q4W 3;  1VBB 2;  1DQ5 A;  2KA3 A;  4E2Q A;  3H1W A;  3Q8C A;  5FP8 A;  2DTW A;  3QCW A;  4HFS A;  1FAY A;  1MS9 A;  3O1S A;  3RWN A;  1O59 A;  1ZA7 A;  3POI A;  5GM0 A;  1EYB A;  4GUL A;  1PK6 B;  4F83 A;  1LHO A;  2BUK A;  1FI2 A;  2YB7 A;  5C3S A;  4XXA A;  3RMY A;  3CZU A;  5F3C A;  1RUF 1;  1O8S A;  1ULG A;  4LO8 A;  1AX1 A;  4B7K A;  1MEC 1; 
#chains in the Genus database with same CATH homology
 3N9N A;  5FZ0 A;  3KV6 A;  5FZ4 A;  3PU8 A;  4EZH A;  5F37 A;  5A3T A;  4CCJ A;  5FY1 A;  5A7N A;  3U4S A;  5FZH A;  5LWB A;  3PU3 A;  5FZI A;  5FWE A;  4LXL A;  5FZ6 A;  5ISL A;  4AAP A;  4GD4 A;  5A3W A;  5FZ9 A;  4EZ4 A;  3N9Q A;  3PUA A;  4GAZ A;  3PUS A;  3KVA A;  5FYI A;  5A7W B;  5FP4 A;  4LIV A;  5A7W A;  2Q8D A;  5FWJ A;  5IVC A;  5IW0 A;  3PUR A;  3PUQ A;  4HON A;  3KVB A;  5FZM A;  5IVV A;  3N9M A;  4E4H A;  3LDB A;  4D6S A;  4QXH A;  4XDO A;  5FY5 A;  5FZB A;  5FP7 A;  5FUN A;  4QU1 A;  3K3O A;  5FV3 A;  2YBS A;  2W2I A;  3DXU A;  5F5C A;  1VRB A;  4EYU A;  4V2V A;  5FYS A;  5FZ1 A;  4TN7 A;  5IVB A;  5F5A A;  2YU1 A;  4URA A;  4GJZ A;  5FYU A;  2P5B A;  5FYT A;  5IVY A;  4CCN A;  4IGP A;  5A1L A;  5FZ7 A;  4CUG A;  3RVH A;  5FY9 A;  5A3N A;  5FZL A;  5LY1 A;  5F5I A;  5A7O A;  2OX0 A;  2PXJ A;  5IWF A;  3K3N A;  5FXV A;  4AI9 A;  5KR7 A;  5F39 A;  2XXZ A;  2YBK A;  4QX7 A;  2VD7 A;  5FJK A;  3OPW A;  4UF0 B;  5LW9 A;  4QWN A;  3N9P A;  5FYC A;  5ANQ A;  2YBP A;  3NJY A;  5FZ3 A;  4IGO A;  2XML A;  3U78 A;  4IGQ A;  2OQ6 A;  5A80 A;  5FXX A;  3LD8 A;  5FZO B;  5FBJ A;  5FPA A;  5FZO A;  3AVS A;  5FYY A;  2OQ7 A;  5FZE A;  5A7Q A;  4D6R A;  4QX8 A;  4QXC A;  3K2O A;  4DO0 A;  5IVF A;  5K4L A;  3UYJ A;  5F3E A;  5IVJ A;  5A7S A;  5FPV A;  3KV4 A;  4C8D A;  4Y4R A;  4XDP A;  5FY0 A;  5LY2 A;  5FPB A;  3KV9 A;  5FY4 A;  5FYH A;  3N9O A;  5FP9 A;  4CCK A;  4GJY A;  5FY8 A;  2XUE A;  3PDQ A;  5FJH A;  2WWU A;  5FXW A;  5FYM A;  4DIQ A;  5FYB A;  2OS2 A;  2GP3 A;  5FP3 A;  3ZPO A;  4BXF A;  5A3P A;  2GP5 A;  5FYV A;  5FZD A;  4CSW A;  4UF0 A;  5IVE A;  5E6H A;  5FZG A;  5F3I A;  5A7P A;  4CCM A;  3ZLI A;  4QXB A;  5FPU A;  4NUB A;  4V2W A;  2WWJ A;  2OT7 A;  4LIT A;  5FYZ A;  5FZA A;  5FXZ A;  2YU2 A;  4BU2 A;  3AL5 A;  5F3G A;  5F2W A;  5CEH A;  5FZ8 A;  3DXT A;  4Y3O A;  5FP8 A;  5FUP A;  3AL6 A;  5FZK A;  2YPD A;  4Y33 A;  5F2S A;  4ASK A;  4D6Q A;  4BIS A;  5FZC A;  2XDV A;  3PTR B;  3AVR A;  5F32 A;  5FPL A;  5FY7 A;  3KV5 A;  5FZF A;  4CCL A;  5F3C A;  2Q8C A;  5A1F A;  2Q8E A;  4LIU A;  3N9L A;  4HOO A;  3OPT A;  4CCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...