5FZLA

Crystal structure of the catalytic domain of human jarid1b in complex with 3d fragment 3-methyl-n-pyridin-4-yl-1,2-oxazole-5-carboxamide (n09954a) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
462
structure length
452
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with 3D Fragment 3-Methyl-N-Pyridin-4-Yl-1,2-Oxazole-5-Carboxamide (N09954A) (Ligand Modelled Based on Pandda Event Map, Sgc - Diamond I04-1 Fragment Screening)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 137
structure length 452
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzlA01
5A80A 3OPTA 5IVFA 4LITA 5FZOB 5FY5A 3PUSA 4HONA 5A1FA 2YBKA 5IVBA 5FXZA 4LIUA 3KV9A 5FPBA 5A7QA 4QXBA 2XDVA 5FV3A 5IWFA 3U78A 4AAPA 4CSWA 5ANQA 5FXVA 2XXZA 4XDOA 3N9PA 5FYUA 3PU8A 4EZHA 5FYTA 4QX7A 5A3TA 4CCNA 4EZ4A 4QX8A 5FJHA 4LIVA 4DO0A 5FZ7A 5F2WA 5FYBA 4IGQA 5FP3A 5FZIA 5FZDA 2VD7A 3ZPOA 5FXWA 5FJKA 4URAA 5FZFA 4GD4A 3AL5A 5FZHA 5FZAA 4UF0A 5FZ0A 3N9OA 3AVRA 3KV4A 3K3NA 5FP7A 5FYSA 4BISA 3LDBA 2OX0A 4LXLA 1VRBA 3PUQA 4BXFA 5FYZA 3LD8A 5FYCA 3N9NA 4CCLA 5LWBA 3PDQA 5F3EA 2XMLA 2YU1A 5IW0A 4Y4RA 5LY2A 5F2SA 3KV5A 4IGPA 5FZEA 5FUPA 5A7WA 4CCJA 5IVCA 4BU2A 5FZ4A 4GJYA 5FYYA 4QXHA 3PUAA 2P5BA 5FY7A 4NUBA 5FP8A 5F3CA 2WWUA 5FYVA 5FPAA 4TN7A 4Y3OA 5F3GA 2OQ7A 3N9LA 5FPUA 5FYHA 3DXUA 5A1LA 5FZ9A 3UYJA 5KR7A 5A7WB 4IGOA 2YBSA 3NJYA 3OPWA 3PTRB 3KVAA 5FZ8A 5A7NA 4D6SA 5A3NA 5IVJA 3K2OA 4AI9A 4C8DA 5FZCA 3AVSA 5LY1A 4Y33A 4D6QA 5CEHA 4CCMA 5FZOA 5FY1A 5FY8A 2OQ6A 5FY9A 4UF0B 5FZKA 4EYUA 2PXJA 5F3IA 5FZMA 2WWJA 5A7SA 5FP9A 5FY4A 5IVVA 3DXTA 5F32A 5A3WA 5IVEA 5F5IA 3PURA 5A7PA 4QWNA 5FP4A 5LW9A 4QU1A 5FZ1A 2GP5A 5FBJA 2YU2A 3AL6A 4QXCA 2W2IA 5ISLA 4GAZA 5FPVA 3RVHA 5FUNA 4V2VA 5FZLA 5F37A 2OS2A 5FY0A 2YPDA 3U4SA 3N9MA 3KV6A 4DIQA 5K4LA 3N9QA 5FYMA 5F39A 4ASKA 4CUGA 4E4HA 2Q8DA 2OT7A 4GJZA 4XDPA 5FZ6A 3PU3A 4D6RA 4HOOA 5FWEA 5A3PA 5E6HA 3ZLIA 2YBPA 3KVBA 5IVYA 5FYIA 5FZGA 5FZBA 2Q8CA 5FWJA 4CCKA 4CCOA 5F5CA 2XUEA 2Q8EA 5FXXA 5FPLA 2GP3A 4V2WA 3K3OA 5FZ3A 5A7OA 5F5AA
chains in the Genus database with same CATH superfamily
2KR2A 2O8QA 3F95A 2ZAHA 4QX5A 5IVBA 3RZLA 3GDBA 2DBNA 1XPWA 3F2ZA 3WCRA 4PI2A 5DAQA 2DFBA 1AR63 2VCAA 5IWFA 3HQUA 5DG1A 3ZFFA 4W50A 4GKYA 3V0BA 1H1IA 4EV0A 1OOPB 5AFBA 1W8OA 4QX7A 2E63A 5GM0A 1CQ9A 3CKHA 4AVVA 1J83A 2C5DA 1OF4A 3I59A 2WLQA 1DGRA 5JCTA 1QOSA 1YWKA 1NOVA 1NUKA 4IQPA 4OHXA 1TMF2 2ID4A 1AUYA 2PHLA 4QB2A 3SEEA 1LHOA 2GNBA 3HQRA 1MQTB 5JR2A 4TTGA 1YI7A 4UF0A 2VVFA 4LKDA 4QX1A 1E57A 3LF7A 3B5LB 3WP6A 1YLLA 5FYSA 3THDA 4CDUC 2RDNA 5T5JA 3T2PA 5CFDC 3ZN6B 2UWAA 2WNUA 2ZACA 4OHZA 3TB0A 4RQPB 4FVVA 3AZVA 2O1QA 1UX6A 3WF1A 2CTVA 1SCSA 2NMOA 2WZ8A 3PHMA 1L7RA 5FYZA 5C33A 1HRV1 1UF2C 3N9NA 4XQDA 4PIXA 4EWEA 1NYWA 2ZHLA 2XMLA 3HVDA 1UN1A 2VMCA 4Y20B 1RC6A 3A21A 5HCFA 2VZSA 4CCJA 4W8JA 3KV5A 4IGPA 5IJRA 1VBD1 3NV4A 4BQ4A 1W8WA 4HETA 3NJXA 5A1FA 3IDEA 3CLPA 4Z82A 2P5BA 3IDBB 3PIGA 4Y5SA 1WMEA 2JG8A 3U75A 1TMF3 1NE4A 3GZAA 4EN6B 1JZ7A 4MGZE 4J1WA 3VBHA 4CZSA 1KXGA 2DCTA 2R0HA 3U1XA 2OPWA 2VMGA 5GKAC 1ZBE3 1YYNA 1PM4A 3BYWA 3C7FA 3H1MA 1RIRA 1JS9A 3MV01 4GMP0 4L99A 4QQ2A 3OGJA 3I2KA 4FAHA 2HWD2 3AVSA 3N3HA 1QJX2 2A3WA 4XURA 3ACFA 3T2TA 2VOKA 4IE7A 4INDA 4G4FA 3E5UA 2C26A 1JBCA 3V64A 4PDWB 4YPJA 1SLBA 1ALYA 3VBSA 4HN0A 1XNKA 2TNFA 3NNFA 2XBO1 4UAPA 1G7YA 3BTXA 4FQ4A 2G1MA 3HNBM 1ONAA 1OOPA 2NN8A 4LUKA 4AI1A 1OD5A 2JD4A 2QJVA 2ZAAA 3E5XA 2B8MA 4L97A 4CXWA 5KC6A 4Z1VA 5C4WC 4K9SA 4QXCA 4XW3A 1PIV3 3KM5A 1KS4A 1XYPA 3VDDB 4D7TA 4ZKTB 1F31A 3LFIA 3MEPA 1AYN2 2XQXA 1MQTA 2W47A 2ZGRA 5BNOC 5CG9A 3FHIB 4GMP1 5FKBA 4QT6A 5I0RA 1VBA2 2C9AA 3ZN6A 4AYUA 4RQPA 3BU0A 2P3IA 2HYXA 4C0BA 3ACLA 4UFHA 1EV13 1V6OA 4AEDB 4Z2AA 1RUJ1 3VBOC 3ABZA 4QX0A 3VL9A 4EE2A 4LQRA 4YVSB 4Y20A 2Q1MA 4PHZA 2JDHA 3LSDA 3WQ7A 3WDYA 4BMEA 1FI2A 4CTEA 2GP3A 3BU7A 2RS31 5A7OA 3PIJA 1RUD3 3NVCA 5FZOB 2NLRA 1LJ7A 5FXZA 5KHGA 4JV4A 1MS9A 2NZ9A 2NQYA 5I93A 4UW5A 2YC4A 3OF1A 4QM8A 3RSJA 5JDBA 4OLLA 4P9IA 1RUC2 4H2AA 2XXZA 1LKNA 1HQNA 1AR81 1Y9MA 1MEC1 1VBA3 4H7MA 3O1TA 4DO0A 4NIHA 2E7AA 3IMNA 4ISQA 5K8SA 1MPXA 2F4PA 2RS13 4C0HA 5T3NA 1QQP2 1RXFA 2O0OA 3NNJA 3IBMA 1K12A 3IAQA 4KWJA 1PGW1 5A3MA 4V1PA 3ROUA 1YUDA 4D7YA 1RUH2 3K4AA 2JDZA 3N9OA 4JGYB 4DFSA 3KB5A 1B35A 4YM2A 4ZPIA 1W8HA 4Y1VA 3C7HA 3WDXA 5DQ0A 2VM9A 5JI9A 5HCAA 4Y1UA 2OZJA 2XWBB 2HLEA 4UBGA 2WNVC 4AHYA 2DUPA 4CU9A 5FO9B 3LD8A 2JIGA 2JKXA 3ZXLA 2QDNA 4GB32 2PN5A 1PVC2 4P02B 1AR72 3HD8B 3UGGA 4Y4RA 2KXLA 3SNMA 1HN1A 1XJAA 4XJ9A 4HK8A 1RUC3 3VDDA 3WNKA 5FUPA 1RB8G 2VQAA 4XE9A 4LEJA 4A7YA 4BU2A 4AOCA 2GMEA 5ABJA 3GJAA 1G6NA 5FPAA 5T55A 4I02A 2OQ7A 3BOWA 2ZX1A 3N9LA 4FPLA 4BHPA 3H3ZA 1S0BA 2G9ZA 4WVZA 1XQNA 4IEQA 5FPUA 1BBT1 1B09A 1PK6A 2XG3A 4P9XA 1RUH3 3LFMA 1VAKA 2JX9A 2XKOA 4MG2A 3OPWA 1RUF3 3HOBA 4K3UA 2QQLA 2HEVF 1FV3A 1JN2P 2ZHNA 4AFCA 1UOFA 3MW3A 2Y60A 3AMHA 1NKGA 3FZ3A 4YG6A 3ST7A 3VL8A 5FZOA 1ND3B 4EN0A 4Q4V3 4XCBA 1MVQA 2RR13 4LBMA 2YMZA 4CDWA 1GU3A 4YG0A 2R1DA 3M7AA 3POEA 1GZ9A 2Y0IA 2BFUL 5FY4A 3WG1A 5I8TA 1OPMA 2MPFA 2FMYA 5F5IA 3OBRA 3NW4A 3WNMA 4RGGA 3VD4A 3RYPA 4XFCA 4B8EA 2JENA 3CDZB 4Q1PA 1XE0A 4YGCA 2ET7A 3IT8A 1OQDA 3C7OA 5CVRA 2FZ1A 4JHTA 5FKCA 3ZVXA 2H0VA 3WDUA 4MGTA 2Z2SB 2JXAA 4N43C 3OGRA 2D98A 4JGYA 1MZ5A 4ASKA 1WLWA 2ZZQA 3WW4A 2VOVA 4YM3A 1RUI2 4LT5A 2UYAA 3O1PA 2WLPA 3UK9A 3ZN5A 1YFWA 5GLZA 2X05A 4AW7A 4CCCA 3C2UA 1F15A 1AXKA 4HKWA 4AVSA 1IPKA 1RJ8A 2IVJA 2D6MA 3J8F1 3MPPG 4UFJA 1JYTA 3R4UA 2PHXA 4QHZA 4BLIA 4CXXA 1NLSA 4WM8A 5GLWA 1MVEA 5A80A 5C8CA 2VQ0A 5TSWA 2A6WA 1SBEA 2QTWB 4LMFA 4J6GA 4P14A 1QJY1 2W68A 1EAH2 1HXS2 4XETA 1ZNPA 4YGEA 1H4GA 2ADEA 1ULCA 1QY4A 1RXGA 1W04A 1ZM1A 1Y43B 2VNGA 2WBKA 4N7IA 3SKVA 3TBDA 1RUOA 4DINB 3HJRA 4ATEA 2X5IB 2VZOA 4YZ4A 5FYTA 4IEOA 2WSVA 4UBHA 1OC1A 1I3HA 4QX8A 3AB0A 4Q4Y2 5ANNA 3LA7A 4MO3M 4EWAA 4IGQA 5CU1A 2XONA 2HJIA 2CYFA 2DBIA 1UYYA 3ZPOA 4YFZA 5C7GA 4B3NA 4Z07A 1T6BX 1ND3A 2DVFA 3MW2A 5FLIA 4B4QA 3N35A 4EJRA 2A71A 1JMUB 3CJIC 3WSOA 5CB7A 2BPA2 1Z7S2 1MS3A 1UYZA 1ASJ1 3AXEA 5FTTC 3SKJE 4XIKA 2LALA 2GALA 1ZBA2 1I9RA 2QDRA 2FQPA 2GNMA 1D2QA 1WLTA 1VBB2 5FK7A 1TE1B 2V09A 1HXS3 4MUVA 5C3QA 1CJDA 5IW0A 1D0HA 4QQPA 2Q0AA 1QDOA 5L19A 4Q26A 3AP6A 2BTVC 4IE0A 3QH6A 2UY8A 2WFF3 1IZ3A 4GA9A 1YIFA 1XNBA 4YGDA 1ODNA 1V6NA 4TN7A 4YG3A 3OUHA 3JD71 4Y22B 2OW4A 2IXHA 3V0AA 4CPBA 4META 3E5QA 4A6SA 2C0ZA 2FMDA 2OYZA 1VAMA 2P3YA 5JXIA 1PVXA 1VB4A 3LAGA 1NQJA 4QM9A 1C1LA 4CRQA 2VQUA 4AFBA 5C4WB 2EIGA 5LEJA 3GM8A 4ASLA 2DCZA 5FZCA 1R64A 4N90A 1G9FA 5ACA1 1W06A 1VBB3 5EWSA 3I2FA 3OY8B 1UCXA 2VUAA 3KT1A 3JBG2 2LS6A 1ZZ8A 5HV0A 1NCRC 5FCCA 2R063 3ZFEB 4CDUA 1O3TA 4GIQA 1ZRDA 4B4RA 5CFDA 1GZWA 3B94A 4LE3A 2W91A 5A7PA 3D8CA 4NHMA 4AG4A 2X5IA 3ZYPA 4G9SB 4OI0A 5GALA 2GH8A 4YSFA 3NKTA 3LEIA 3JCIA 3IZOA 4UW4A 5F7UA 1GBGA 1QJU3 1ENQA 1O4YA 3ZYHA 1R1A1 4XILA 1CX4A 4P5HA 2YPDA 5L9RA 1EP0A 2XJTA 1XB9A 1ZBE1 5K4LA 4AE2A 3PMSA 2QNKA 4AEKA 3N7LA 2Z69A 4QB6A 2R1BA 2BWCA 2QBXA 3O14A 4NPRA 2VR4A 5L36A 3FFQA 4NAMA 5FWEA 1BYHA 4XHBA 5GZFA 2R043 4NR1A 4U2AA 3MUY1 2JJ6A 2DUOA 2VPVA 4IEZA 4MV2A 2JE8A 1QJEA 4CP0A 2Q8CA 1HRI1 2IC1A 2LW8A 1UAIA 4EN8B 4ZS2A 3M3IA 3ILFA 5EJ1B 1S1AA 4KWLA 1KITA 3FLRA 1DZQA 4D7SA 1DCSA 1O59A 1DFQA 1Y4WA 1RUE1 1UMZA 2YY1A 2CWMA 4RHV1 4XJUA 1A34A 1VMFA 1C8M2 3H9AA 1PIV1 1S0EA 2KA3A 3CZUA 4M0NA 4DUVA 4KI5M 1BJQA 4QXBA 1S0IA 4W6XA 4AGRA 4CXYA 5BNQA 4Y4YA 1O3QA 2ZGSA 4P9JA 2AUYA 5FRAA 5FXVA 4HG6B 3N9PA 3DEMA 4I0WB 2WNVB 4XUOA 1FMD2 5A33B 3L2YA 2YUEA 3MW4A 1DQ4A 1V70A 1XYOA 2JE9A 5C4WA 3TN93 4NIIA 3VBUC 3WF4A 3RZMA 5FZIA 4XACA 1W9SA 5FZDA 3L2HA 1SBFA 1W6QA 2WINB 1JW6A 3WDVA 1HN0A 5FZAA 3AFGA 4I0BA 2R071 1JYWA 2AR6A 2JG9C 1J3QA 2Q1FA 1O3RA 5I8YA 4R9DA 1RUD1 1HRV3 3U14A 2AZ5A 3TNPB 1UWWA 1L3JA 3ZN4A 3VDAA 3W58A 5JPNB 2I07B 4ES8A 3AYDA 1HIXA 3ES1A 1EPWA 5FMCA 1L7LA 5F6LB 2ZX4A 4MXVA 3VBHC 3MDPA 1HV1A 3DYPA 1VBD3 4BYYA 4MZUA 3I3MA 3D6EA 1WBFA 2WC2A 4FPYA 4LUMA 3ZX7A 1IQDC 1NG0A 2RS51 4CDXB 4QXHA 2OVUA 1WCDJ 1YFYA 2W3JA 3OYWB 5FP8A 5EJZB 5T52A 2VMDA 3VKLA 4DRVA 3A23A 2NMNA 3RFRA 2BU9A 1FXZA 1NCQB 3LB9A 3POYA 5FYHA 4XBLA 3LPGA 3WXPA 4E4ZA 1DHKB 2KD7A 3P1IA 1OBNA 3PVOA 5T5OA 2V73A 3SMHA 1WCKA 1XNCA 1RMU1 2QFEA 1PX3A 3MIGA 5A7WB 4EWDA 1QGLA 3RWKX 2B4KA 3T30A 4AFAA 5FPZA 4D6SA 2Z42A 1S0FA 2BEOA 4FOVA 1NXMA 3LA3A 5C9AC 5JSRA 3ZXGA 5J7MA 4YM0A 4DUXA 1G9AA 2XJUA 2DCYA 1RUJ2 1YJLA 3AYAA 2YFZA 5FIXA 4TLGA 2F17A 1ACCA 2VW0A 1J1TA 2QQNA 2D97A 4N43B 5KXEA 3S5AA 1SMVA 4WZFA 2DTWA 4OQ8A 2D7FA 2VE1A 2XBO3 5FP9A 2MEV2 1O6UA 3DXTA 5I8SA 2RS32 2IXJA 2WZR1 2WNVA 2Z5WA 5A33A 4RQPC 3QD6A 1E5IA 2GP5A 4WM7B 5KBFA 2YU2A 5C71A 3KF3A 1REEA 3ZYBA 2P34A 1TZOA 2DFCA 4OQ9A 3FC0A 5FPVA 1CAXB 4IERA 5E88A 4PBPA 1GWMA 4CU6A 1UY2A 2BGPA 3MF9A 4GMP3 5HCBA 1AR82 2DV9A 1UQXA 3CO2A 3KV6A 4JVAA 5DAXA 1C5HA 1DYKA 1RUF1 2A6XA 2WWSA 4FAGA 5LA9A 3VD3A 3OGSA 2PAEA 5M0TA 3H42B 3WDWA 1W2OA 3M3CA 5E6HA 4XDQA 4DRRA 2WNEA 3VD5A 2WO3A 1PGW2 2Q8OA 3GF6A 5L9BA 3UGHA 5FMDA 4AF9A 2XL7A 5FYIA 5GZDA 4IE4A 5FZBA 5F5QA 1ZRFA 2BP6A 2JWPA 2B5HA 2BERA 3OD4A 4Z92B 2RS33 4WV8A 4M3CB 1WD4A 1W8TA 3GZUC 3JQWA 3LIHA 4EZHA 4CDXA 2VUDA 2J1TA 4LO6B 4AFMA 2JDNA 3AK0A 3EYPA 3ZYGA 4CDQA 3A7QA 3IN9A 5T5LA 4ONUA 4AAPA 4EYUA 4PDWC 1MEC3 2VUCA 4IE6A 4MGIE 4LNVA 2VECA 4NN0A 4CUAA 1ST8A 3MIFA 1RHI1 3NJVA 4I3PA 1AJKA 2A3XA 2NM1A 4PI0A 4XAAA 3SITA 5FJHA 4Q4W1 4AK3A 1LHUA 2IFWA 4QKFA 1BBT2 4AVCA 3AM2A 4RN5A 1GNYA 2VOXA 2YPJA 4GD4A 5FUIA 2RVAA 2VCBA 4N43A 4UFMA 3SCFA 1ZZ6A 1PZ9A 3B9CA 2IXCA 1XU1A 4OHYA 3Q8FA 3LEKA 4YZ2A 2RM21 3ILRA 4A42A 1XNAA 3H3LA 5DAPA 3POSA 3DL3A 1TQ5A 3PDQA 1WA6X 1EPZA 4AEDC 4DY5A 1PO11 3TAYA 2DUQA 2WAAA 1XBFA 1O8PA 5FZEA 4YVSC 3DN7A 2V4AA 4CP1A 3GXUA 4K1YA 4MHRA 3HT1A 5F1RA 5IK4A 3H3UA 4RYDA 2V72A 2ZMKA 3LOIA 4Q27A 5K7PA 2BOIA 1DQ2A 4HT1T 1WD3A 1BBT3 1NCRB 1X8MA 3A0NA 3ZKUA 3D3AA 1CPMA 2EXIA 4GKXA 4D69A 1SDWA 3ZSKA 3UYJA 4IUGA 1JI6A 3MICA 1UPSA 4QHBA 1CAUB 5F8PA 2IVIB 2G19A 5JIUA 2YGLA 3KQRA 1AL21 1SCRA 3D0SA 3RDIA 4JAAA 3URFA 5KHIA 2VVEA 4LLFA 1DGLA 1GQHA 3KGLA 3FUOA 1SLTA 3CJIA 3D0JA 3GBGA 1C57A 1IS3A 4NE9A 1G9CA 5A7SA 4AI0A 2YG0A 4EN9B 1AR92 1CONA 1WMXA 1V6LA 2F6BA 4NPMA 4QWNA 1FNYA 4LKSA 4QPGB 2WFF1 3AKRA 4SBVA 1W6PA 4XJ8A 1C8NA 1AX1A 1QU0A 2ARCA 3FX3A 4R4ZA 5JLVA 2HWB2 3TEWA 5B4NA 1QJY2 3VBFB 4Y5Z0 4FXGB 3BPZA 2RE9A 4JGZB 2OS2A 4P08A 2OIIA 3WQ0A 1W90A 1VBC2 5CKMA 1QF3A 1KEXA 4LO7A 1HDKA 1W2NA 1QXJA 1RVF1 4UXAA 1UU5A 3K51A 4HFSA 3N36A 1XNDA 1JOJA 4IESA 4RS5C 3WINE 4COUA 4D6RA 2E31A 2VC9A 1CESA 2CGNA 2W08A 3CF6E 2C9KA 4OHWA 4XFBA 2PHRA 3BB6A 2GNTA 3RYKA 2VOWA 2JDUA 2QQKA 4E27A 3J8F3 1PGL1 3O0XA 3WV6A 1Q3EA 2Y6GA 2J1SA 2R061 2ETEA 3LIGA 1RYYA 1SFNA 5FPLA 3BKZA 2ZJCA 4WZCA 1SEFA 3ENRA 4W65A 5DMYA 3C7EA 4OHVA 3ZFGB 2VJXA 3ITQA 3AKTA 3PL0A 4YW3A 3I54A 1ND3C 1NCRA 2BUKA 1IS6A 2UURA 2WA4A 5A3UA 5ANQA 4GQ7A 2J1RA 4Q8LA 1PGSA 3LEMA 4Q29A 4C90A 2WQZC 1E5HA 2B7YA 3Q8AA 4CP9B 3UKVA 1V6MA 3T0AA 4BIOA 3JD72 2W0XA 3WX5A 3W20A 4FFFA 1CAUA 4JC1A 2D3PA 3M4FA 1SQ4A 1EUTA 2P17A 4MGQA 1R083 3ZXJA 1YFXA 3N7JA 3I49A 1XRUA 1ASJ3 1KJLA 1X7NA 2PLV1 1XE7A 3J9SA 3KT7A 2BVBA 5LATA 5LEKA 1Q56A 3N4MA 2DU0A 2HEWF 2O14A 2RDRA 2WS93 1J3PA 3LDBA 5C5UA 3LQCA 4LTAA 1W99A 4CU7A 5ACA2 2A6VA 4QPGA 1AXZA 1LCLA 2XR4A 5CZKA 3WNLA 4HSJA 3WP3A 5HPOA 1W6MA 1ZRRA 2YZ4A 3VBFA 4GWIA 1BZWA 2Q4SA 4OUEA 2Y26A 3ZR6A 4LOTA 5DZFA 4CUCA 5IVCA 2ZABA 3VUOA 2PMWB 1AYM1 5C9AB 2XJRA 5BYNA 1XYNA 1ULGA 2FDKA 2B45X 3BPSA 3JD73 4FCAA 4COYA 3QCWA 3TN91 1ULDA 5A6YA 2RHPA 1GZCA 4B7KA 1R1A2 2CDOA 1ND2B 4PJYA 4XTMA 4BA6A 4PT6A 1ZBE2 1CAWA 4KU7A 4XUTA 1GOHA 1AVBA 2X5IC 3AMPA 1W2TA 3R6SA 5LB6A 4AGVA 5ACA3 4KGQA 4PBOA 3VBUA 4AI9A 3NNGA 3NSTA 5BXXA 4LORA 4XQWA 4L2NA 3ZFGA 1ZZBA 5LA1A 1HRI2 1OXCA 2JG9A 2ZGKA 2PHWA 3WUCA 2RMU1 3WNNA 4NROA 4K6BA 2WO2A 5H9QA 2QUOA 4X8PA 4CP9A 2XB6C 4ZU4A 3E97A 1PIV2 4LOSA 2FDJA 1UO9A 1R1A3 1WCUA 2ARBA 1OFSA 2K9ZA 2DVGA 2C1FA 3POJA 2WT2A 4OYUA 5DPNA 3FN9A 5FMOS 2GH2A 5FZLA 4NIAA 4AVTA 5A70A 5FY0A 3ZIWA 5F37A 5D8AC 3NV1A 3NQHA 2YXSA 5C70A 3K46A 4CUGA 2Q8DA 3W9AA 5CYYA 4RR3C 4AEJA 2ADDA 5LASA 2HBUA 4AXOA 1X9TA 1EV12 1UXXX 1NZCA 2CGOA 3ACHA 3FWEA 1H6YA 1P8JA 2QQVA 1TVGA 1HRI3 3VKOA 2VY0A 2FZ2A 5FREA 1HQWA 3FLPA 4AI2A 5FXXA 1RUD2 5KHHA 5CIRA 3WNPA 3J4UH 5E89A 4RHV3 5C9AA 1RUE3 3BTYA 5FFOC 3UNPA 2I74A 2O8OA 1QJZA 4HK9A 4TYSA 2YBKA 1IS5A 1CZVA 2P6CA 4XPVA 1JYIA 2GC0A 1UZVA 3T4HB 3LEGA 5FPBA 2IUWA 1UIJA 1LOEA 5LZ6A 1FT9A 1ND2A 1COV1 1X8EA 3ACGA 4YZ1A 3OPZA 4XBNA 3BUCA 3ZFEC 4QDSA 2HYKA 2RS52 1MR5A 3R4SA 1N47A 4D94A 4PIZA 2ZA9A 4K1ZA 3MYXA 4CCEA 1GYKA 5DABA 4FOWA 2CGPA 5F6KA 5LA0A 2RS12 1LULA 3DKWA 3I2JA 3NNLA 4UW6A 5FYBA 5ERLA 1DZTA 5FP3A 3WP5A 4IEYA 1Y7BA 1UYXA 3ZR5A 2R073 1QWRA 5FZHA 2ZEZA 1LHNA 4C91A 4KQ7A 3RZHA 4XFAA 5FAXA 3FE5A 5EYYA 1R091 2PHDA 1Z0HA 1CGPA 2ZGPA 2ZX3A 4JDOA 3H7JA 3VHOA 4Z8BA 1OI6A 5LK5A 3N7KA 1W9TA 3IMMA 4AQ6A 4A7ZA 5F3EA 4C1XA 5IK8A 4QGLA 1H0BA 4ZZ5A 2RS53 1BKZA 3B93A 3SCHA 1W3XA 3ETQA 4BQ1A 3I7DA 4NVPA 2BBAA 4A2UA 2VOTA 2WZPP 2OXBA 1NXD1 2G9FA 5FLHA 2XUMA 4ZHNA 2WJSA 3ZOIA 5CNAA 1VE0A 4ZU7A 1AL0G 2CNAA 2AH2A 5JSOA 1UU6A 2ZGUA 1Z78A 2CL2A 3ZPYA 1RMU3 2W1UA 5EYXA 3UJOA 4PDWA 4NWWA 2VXRA 2A1XA 1FOD1 4CYDA 1F8VA 1RUF2 3EXUA 2EXKA 4Q4X1 2YBSA 1BVP1 2VUJA 1LOGA 1J84A 4YM1A 4E4SA 3PNAA 4XFIA 4XOGA 1GNZA 4Q4V2 3OEAA 4GWMA 1GOGA 4KMQA 2RR12 3J7MA 1CPNA 2OQ6A 4OULA 3CZJA 3IWZA 5FZMA 1IGOA 1UY1A 2WWJA 3THCA 5CBLA 2Y6LA 4LK6A 2WZR3 1N1VA 4RS5B 1UL9A 2VZ1A 3VD7A 2NP0A 4IV1B 5JXGA 3NO8A 4MYEA 3CL1A 4FSJA 5L73A 1FYUA 4DXRA 3WQ1A 2WN3A 1UD1A 1YO8A 1J3RA 2JICA 4AEDA 1GQPA 3CEWA 4BK4A 1S2KA 5F9TA 4KGGA 1F4AA 1J59A 1JUHA 4XZPA 5DAVA 2BZDA 4NHLA 2FBEA 1IKQA 1YXWA 2P2KA 2CAVA 4YVSA 3SC7X 5I91A 3RZJA 2OT7A 3AJYA 1NQDA 1BK1A 4FPOB 4QU2A 1JU4A 4NAOA 4CDXC 2QQUA 3PU3A 4GZ9A 4YYOA 5HI0A 3WG3A 3FJSA 4PCRA 4I09A 1JOBA 1D4M1 4R9AA 3TYJA 1NCQC 4CDQC 4CDUB 4FQZA 4ISRA 5EHDA 1CIWA 3VZNA 5L7OB 2RV9A 2VL4A 1XU2A 4ZS3A 3CHXA 1I5ZA 2ZX0A 4O9GA 3PMEA 2EALA 2A7AA 1WCQA 1V9U1 4R9CA 3T2QA 5BY5A 3KHBA 2PA7A 3WY6A 1JZ6A 2VULA 2RJKA 4HXCA 1NY72 1RJ7A 3GGLA 3MBWA 4HONA 1UOGA 4LO5B 2VNVA 1UYPA 2VXJA 2W9XA 3I3BA 1U0AA 5DDJ3 1S0CA 5FV3A 5A6ZA 3B3QE 3ELNA 4MOAA 2C24A 2TUNA 2P4EA 1RHI3 3E6BA 3CBNA 5FYUA 3THTA 1BCXA 2VQTA 2J1VA 4Q4W3 5A3TA 4HBNA 3T08A 1DQ5A 4WM7C 1QOTA 2CY6A 4GWNA 3ILNA 5CKQA 5IATA 1VAVA 1Y3TA 4L8QA 1W9YA 4BZ4A 4I30A 2ERFA 3KWVA 2QQWA 5L9VA 4ZZ8A 1OA3A 3WZ1A 1ENXA 4HVRA 4BMBA 4MHUA 1CIYA 2A73B 2W87A 2RM23 3HR9A 4RS5A 1OD3A 4GXLA 3OBZA 1C5IA 2IZWA 1OF3A 1AL22 1QDCA 5IT6A 3EQEA 1VP6A 1PO13 1H2NA 1DGWA 1SBDA 3ZXFA 4OI4A 1GQGA 1WGPA 2WNOA 4L11A 1PNGA 5I0SA 2EF6A 2WFF2 3B7MA 3LPFA 1ENSA 2AREA 1HB2A 3IKWA 4HN1A 4OMCA 4OVEA 1GKBA 2WABA 3RGBA 3K77A 5FK8A 2CHHA 1R081 2VNOA 1ZRIA 2DF7A 4P9GA 3A4UA 2I45A 2P1BA 2LRPA 4D3WA 3PVBB 1H9WA 3UKNA 3VKMA 4EQVA 1OUSA 2JDKA 2WS91 1N3QA 2PTMA 3SEPA 1RINA 3KCXA 4MLOA 5E1RA 1AL23 3OG2A 3SH3A 5FQ0B 3ZYJB 3TEZA 1U5IA 1WW7A 3BTAA 3POWA 5D8AB 1PGL2 2VG9A 3HNMA 2R062 3PTYA 3LZZA 2CDPA 4Y5TA 3O12A 2R32A 1ZREA 3VZMA 4RR3B 1JTZX 2ZXQA 2WA3A 1QIQA 4XZUG 4YVWB 4CCDA 1S2BA 3DV8A 5BNPB 3NMBA 1U5ZA 5FBJA 1QJU2 3B9IA 3EO6A 4FTSA 2W2IA 3INAA 3VBRC 2HH9A 1F4HA 1SPPB 2YC0A 4OZXA 3WUDA 5FUNA 5J1XA 4CEWC 3JQXA 4RGAA 3CU7A 4DIQA 1RVF3 5F39A 3MIBA 4XJZA 2EXJA 2GC2A 3H8UA 3HEIA 3LOBA 3WLUA 4XF3A 1YIPA 1GLHA 1YQ6A 2R7EB 2V4VA 3FHAA 2R042 1BMV1 3KQ4B 2BNMA 4BM8A 2WL1A 1O91A 2DVDA 2QZ2A 4IV3B 3BCWA 5JZGB 3I3DA 5FWJA 1PMHX 3UETA 3GZEA 1KS5A 3SISA 5JOWA 3JXSA 4ZXEA 4FTEA 5FZ3A 5HXVA 3EJKA 5F5AA 2ZS6B 2W1SA 3A22A 3DF0A 4Y26A 3ZYRA 2BWAA 3RI8A 4JKMA 3S6PA 1OKOA 3I3EA 1AYM2 2D6PA 4AHWA 4XQ4A 2Z79A 3PU8A 1UU4A 3FFZA 3MUZ1 4AI8A 1Q43A 4CCNA 4QPGC 3TN92 4DNYA 4EZ4A 2A3YA 3KLSA 4OFGA 4XHXA 2UWBA 2G4IA 4UFLA 5IHRA 3IIAA 3VBFC 5FXWA 4URAA 3VLBB 2PLV3 2MNGA 4JGZC 2PAKA 2WYFA 2UWCA 5A1AA 5D8AA 1QNWA 4BJ0A 2ZEYA 1WKYA 1QH6A 2DURA 2XJQA 4QMAA 5D2AA 4RGKA 1K5MC 1A8DA 4FOQA 4A7KA 4RR3A 2WUHA 1HRV2 2QKDA 2QVSB 4DQAA 2VZ3A 3I3QA 3M3EA 4Y22A 2UYBA 3APBA 5FYCA 3WHUA 2YROA 4R4XA 3UL2A 1IPJA 1VBD2 4NHXA 2QQIA 4P00B 2WQ8A 1ODMA 1DG6A 1AYM3 2EIBA 3OBTA 4YWAA 2D5HA 2BYVE 3I4IA 2BFUS 4GJYA 1GMMA 3PUAA 5J36A 1VMJA 4PF1A 3WD5A 1LOCA 2Y33A 3POFA 3S30A 4J25A 3MIEA 1GWKA 3ZFGC 1WMDA 3OY8A 2ARAA 2P6HA 2GU9A 1YC61 5FZ9A 1DIWA 5EQUA 3ZFEA 4IV3A 3HN3A 2DYCA 3D82A 2JB8A 4LKEA 3O0WA 2B46X 3PTRB 4QKNA 3NV2A 3WF0A 5KXCA 2FDIA 1DGWX 3K2OA 2WDBA 4JZRA 1W03A 3ZSEA 3S5QA 4YFWA 1H2LA 2VU9A 5FY9A 1Q5OA 2HKXA 2HWD1 3ZDVA 4G3YC 1UX7A 1AHSA 3LWCA 4OCTA 2XBO2 4BCUA 1XE8A 1H30A 2RMU3 4U36A 5CFCB 5GZEA 1GANA 1W0PA 1YHFA 5IUQA 5B4XA 5IVVA 3PURA 4RD7A 2EAKA 2WQ4A 3CNAA 4LHSA 3NNMA 5SV5A 2JDMA 4B7EA 4DXTA 3VN4A 1REDA 3VKNA 3AL6A 5A6QA 2FCTA 1MZFA 1DF0A 1QHDA 4HVQA 4IW3A 3T09A 2Y6HA 4YW7A 1AF9A 2BW8A 1GSLA 2X09A 2RG4A 3OGVA 3ALQA 1AYN1 4IEXA 1H9PA 1DGRN 5HBAA 4Q0PA 5C3RA 2ZX2A 1W8FA 4QPIB 4WVMB 3QACA 1POV3 4H14A 3H0OA 1LESA 2I2SA 3AX4A 1WWYA 2MHFA 1OVSA 5FR3A 1ND2C 3DKQA 1NE6A 2C4XA 4H55A 3O1RA 3H1YA 1R092 2A75A 2D40A 4EN7B 1QEXA 3R05A 2XUEA 4X8NA 2WIIB 3I2OA 4GALA 1MZ6A 3LDKA 2AYHA 3OPTA 5JPMB 4JQTA 2AEZA 2ZGLA 4QD2A 1WZXA 2SLIA 4BQ2A 2ZHMA 4LLOA 1RUNA 1COV3 4FPJA 2WFPA 1SFPA 2SBAA 1MEC2 2XHKA 2XKPA 2XDVA 3C3VA 4YGBA 2QQOA 1BHGA 4D0QA 1V6IA 4ZU5A 2H0BA 1T6GC 1UY4A 3KSCA 3NAPB 1DU3D 4DUWA 1ULEA 5DXDA 3VB9A 3OCPA 1UXZA 2YC2A 3Q8EA 4NHKA 4B4PA 1W6NB 1K5JA 5DN2A 4DEQA 5C6CA 2WRAA 4CEYC 2EICA 3AL5A 1YQ5A 4IEVA 4M3CF 3HPNA 1QQP1 4Q4X2 1R093 3VD9A 5A32B 4MGYE 4R52A 1D7PM 5CFCA 4YW4A 4BISA 3QOPA 5T50A 3ZIXA 3AP7A 3OYWA 4BXFA 3TRSB 4AVBA 4XAEA 1PMJX 1UPIA 4NHYA 4DOUA 5DDJ1 2JECA 1NCQA 3O7OA 5DUUA 5C5TA 3GYDA 2EIDA 2ENRA 1HB1A 5F2SA 1US3A 3OSDA 1AR71 5A7WA 4IEWA 5JI7A 3J7LA 3OUJA 5FY7A 5DUVA 4XJAA 5FYYA 3BIWE 5IAXA 1JYCA 4IE5A 2QCSB 1V6JA 1NX9A 4J1XA 2XH6A 4QPIA 2OPKA 4WVMA 2VZRA 3WW2A 3MLLA 2XVGA 1LGNA 3DPRB 1FOD3 1URXA 3KT4A 5J3UA 5DUWA 3PLQA 4Q4X3 4XBQA 3DUIA 4IGOA 3VHNA 3ZYIB 3VDBA 4NJ4A 3Q8BA 2D6OX 5A3NA 5C3OA 1OLRA 4FPFA 4AL9A 3VBRB 4CA9A 4WM7A 4DXZA 3S57A 4BE3A 3POGA 4XF9A 3MLKA 2V5YA 1G86A 2BDRA 4KBZA 1LU2A 1N3PA 1OT5A 2GZWA 4JX0A 4LBNA 3C8XA 5FY8A 5I0UA 4CEWB 4E8DA 2D3RA 2ZGOA 1CAXA 2PXJA 4B1LA 3MGUA 3M70A 2XGXA 1LAJA 2ZZJA 3IDCB 3H8RA 5EZWA 1LEMA 1ULFA 3BVCA 4AGGA 3NAPA 3T2OA 5FZ1A 5BUVA 1LOAA 1HJGA 4E4DX 2BRTA 2W1QA 4BH9A 1APNA 3C7GA 1VBE1 1TEIA 3HAGA 1S2EA 4NPLA 2ES3A 1VMHA 1W28A 1F2NA 1TME3 1G8WA 3N9QA 2PHTA 5GJ6A 3ZM8A 4GJZA 4M3CA 2DCJA 4MGKE 2XWJB 3VZOA 3BN6A 5K0UB 4HL0A 1RUI1 1D4M3 3TEYA 4HANA 4DEVA 1O4ZA 4IXLA 3GCWA 1WLDA 3J8F2 5IVYA 4F3JA 5FZGA 3GCXA 4ZXKA 4CDQB 4KWUA 4CCOA 3ME2A 3UJQA 4HSLA 1OHFA 3T1MA 1V9U3 3E6CC 3USSA 3MF6A 3K3OA 5K9YA 3O0VA 3PUSA 1W2AX 5FMBA 3WVJA 1XSQA 5IFPA 2YB7A 1BLZA 2W92A 3KZ4C 2YFUA 4FP2A 2Q5TA 1SLCA 1W05A 1K5MB 2A5ZA 1EAH1 1I6XA 2X29A 4B29A 2E6VA 1IS4A 1OQ1A 1W6OB 3AXDA 3M3OA 1YNAA 3IM0A 1FPN1 1VR3A 4IV1C 4LIVA 4UWDA 3VBRA 1LENA 4GH4C 1R082 2E26A 2EAAA 4Q0UA 4Q4Y1 3TEXA 3BI3A 1S0GA 5AC93 4XMAA 1ASJ2 4CEWA 2PFWA 3J26N 3ZFFB 2WS92 1YCIA 1MS1A 4XF0A 5JXJA 1ULOA 3WNOA 2JDPA 3O1SA 3I59B 3CMGA 1H8TC 3E1F1 4IEPA 1C1FA 1BEV1 1STMA 4H3WA 1A8MA 1IHMA 1M4WA 5I0DA 4JTOA 5LWBA 1ZBA1 5GZCA 1UKRA 1LGCA 1UZ0A 4COZA 5JXHA 2YU1A 1U12A 4LR4A 4QGNA 2HBTA 4FFIA 5JSPA 5L7OC 3SLIA 4XFFA 2NPIA 3K75B 2WNUB 2ZOEB 4GULA 5A6XA 4AI3A 4NUBA 2QQPA 3E6DA 2NYYA 5LBEA 2GNDA 1SZBA 2WAOA 4FXKB 1VIWB 4M4RA 5K0UA 3WW1A 3MFCA 3DXUA 4KBBA 2Z4FA 2EVXA 3L9JT 4YZ3A 2FCUA 2W5FA 1GV9A 4PLNA 3VZLA 1CR7A 4LK7A 1XSRA 1XOYA 2ZGMA 1OLMA 4COWA 4KG0A 2PAMA 2B9VA 1HX6A 4N53C 3EHKA 1BMV2 3W59A 5LY1A 4D6QA 2JG8B 3DYOA 4ES9A 3GHMA 2CV6A 4JGZA 2GN7A 5HV4A 5IYYA 4D8MA 2J1EA 3DGTA 1DYPA 3AP4A 2X8KA 1YQ2A 4QKBA 2JE7A 2K0GA 3OOXA 1K5MA 5A3WA 5IVEA 1YI9A 2XLAA 3NJZA 4N7UA 5FBZA 5C8WA 3R4DB 1W6OA 4I2OA 3B02A 1ULPA 2D3SA 4A45A 5JIAA 3WP4A 5FOBB 3U0ZA 4V2VA 4QQHA 3P3NA 3M2MA 3KF5A 4JQRA 3IB3A 3VBSB 4ET7A 4BIFA 1QJFA 1MS8A 2JDAA 5LBFA 4MADA 3WQBA 1N1SA 4JCKA 4MSVA 5LRRA 2OKXA 5EIYB 1QXPA 3VGIA 3ZO0B 1HJFA 3IDAA 1POV0 3M8LA 1RTVA 1DLCA 4IL7A 3EBRA 4F83A 2UY9A 1JXNA 1DBNA 2GMPA 2BBVA 4I3GA 3A0KA 4XXAA 5GLVA 2W52A 1CAVB 4XMIA 5T5PA 4CCKA 5JMCA 3RI9A 3M1HA 4RHV2 4OI1A 1RUE2 2P37A 2L9LA 2ZGNA 4YARA 1NLQA 2ARXA 3Q8CA 3ZXKA 4CEYB 5FDBA 1H2KA 1YRZA 3SHRA 1A3KA 1O5LA 1YQCA 3AZZA 4FPKA 4OUSA 4BLJA 5KC5A 3BIEA 1FNZA 4I0AA 1D2SA 2ZBJA 3U10A 3GNEA 1C8M1 3UESA 3CJXA 1DQ1A 1X82A 2TBVA 3UGFA 4LHKA 4BK5A 1Q8OA 2QQMA 4FPGA 4YVWC 1EY2A 1JZ3A 2Y6KA 2A70A 4Y1YA 1NA1B 4H7LA 3FHQA 1FMD1 3WG4A 5BNPC 2RDQA 1POV1 5F2WA 4LO8A 4LPLA 5FO7B 5J37A 2R072 2W94A 5KWRA 1H4HA 5FJKA 2PQSA 3DCQA 4CP2A 4FP3A 3AC0A 4BPZA 4KG8A 3RMXA 4XUNA 1JZ8A 3RZZA 3BODA 2E51A 3SCGA 3OGGA 2OA2A 4LBKA 4OI2A 1AX0A 3VDCA 3K48A 4TXWA 2IFRA 3FUQA 1I1EA 4IV3C 1LNSA 2XLFA 3SQOA 5JZGC 1H8VA 2YDEA 1B35B 4GWJA 2J22A 2WR9A 5FZ4A 3MLJA 2WN2A 1QNYA 1HB4A 3PUIA 4AHXA 3VHPA 4Q2FA 4Y3OA 4LBQB 4COVA 2XOMA 4MX3A 1RMU2 2RJ2A 4LKFA 2HWE1 2VW2A 4E9KA 3PJYA 3NWKA 1LU1A 1UZZA 1SDDB 1CAVA 3W5NA 3NJYA 1KFUL 3KVAA 4AHZA 2XJSA 2XVLA 5ABJB 1XC6A 2Y0OA 1UMHA 1KGYA 1WBLA 2R0FA 3B01A 4RFT0 2VGDA 3ZMOA 2HWD3 4KU8A 3R0RA 4CCMA 3O1OA 3FMGA 1QJX3 2Y6JA 1T2XA 1ZA7A 4CEYA 5BNNB 3AYEA 4NIGA 1PK6B 1RUG1 4UFKA 4PQQA 3W5MA 4LJHA 5AFEA 3V56A 2WZR2 3WOGA 2ORZA 1GZTA 1S4CA 1W3VA 5LW9A 2HWC1 2E9QA 4Y1ZA 5CG8A 5DZGA 3PVNA 4HMZA 3LSEA 5DZEA 3AJZA 4ARXA 1VRH1 2MEV1 2WO7A 5KXDA 1NA1A 1UOBA 4LBQD 5LBCA 1QXRA 1HB3A 1J58A 1PZ7A 1C3HA 4CU8A 5LCWL 4FT8A 4CDWB 4W6WA 2XHNA 3U4SA 3Q9OA 4JDMA 4B1MA 1O4TA 4XFHA 4ARYA 2VVDA 1AYN3 2VBDA 4L92A 3U4XA 2VW1A 3OJBA 1X50A 3H7YA 4IEUA 4K21A 1OMIA 3T4VA 4PLMA 5HXMA 4LO4B 1DZRA 2R16A 3RG0A 4FOYA 4BQYA 2YBPA 4YW6A 3TWIA 3LGRA 3BOPA 5C3SA 2IXLA 3KGZA 1D4VB 2XJVA 1Y9QA 3JU9A 4M0HA 5DUXA 5EPAA 5LK7B 2OUHA 5CISA 5FO8B 4GH4B 5IVFA 4M01A 1SFYA 3CQOA 5DDJ2 5FY5A 3THPA 4LBQA 1RITA 3RJ2X 4HZFA 5A7QA 3AMMA 1G9DA 4XABA 3U78A 2D6NA 1RHI2 5JOXA 2GC3A 2VZPA 3H50A 1TME1 2AC1A 3KD4A 5CFCC 4Q4W2 1H8TB 2YV8A 3WCSA 2XPJA 3KHCA 2JIJA 4R8HA 1K42A 2AENA 2VTXA 4WM8B 5AVPA 1XNTA 2PELA 4BQ3A 5C8CB 5SV8A 3ECQA 5KHJA 3SH5A 1GFF2 2VBBA 2VZQA 5FZFA 2B9UA 1QQP3 4X6QB 1F9KA 2BGCA 4AVAA 3I2DA 5BNNA 2VTFA 4HKLA 3AVRA 3USUB 3POIA 1H1MA 4DMIA 4MVTA 2RM22 1AXYA 2RJLA 2FDGA 3I97A 4LULA 4UYBA 3O1VA 1LRHA 4XYXA 5LBBA 3IPVB 2PHUA 2QQJA 1LOFC 1PO12 4QPIC 1S0JA 3J7NA 4DB5A 4CCLA 4OUMA 4O61A 4GB33 4PF5A 1PVC3 4A44A 1AR73 1OQEA 2CWSA 1ENRA 5LY2A 1KRIA 1WW6A 4UOJA 1BVVA 4N53B 1ZRCA 2ZHKA 1IG3A 3LA2A 1F35A 5F3CA 1OFNA 2FDHA 2WWUA 1E5RA 1LECA 1UKGA 2DWRA 1VBE2 1GWLA 2J7MA 2WT1A 3HIFA 5AC91 2J1UA 2ZGQA 4KNCA 5JMOA 5CADA 2R30A 1HLCA 3BALA 4NOTA 1JYVA 1WUVA 3U11A 1JYXA 2E32A 2QZ3A 1VPHA 2WKKA 3MO4A 4YZ5A 5IVJA 3NAPC 4KL1A 4IV1A 5KXBA 4RL7A 1OH3A 1A78A 4C8DA 2WSUA 5JUVA 4DZGA 2JDYA 1N1TA 1E5SA 4GH4A 4XCAA 3V0AB 3RWNA 1W0OA 1JZ4A 2DTYA 1H6XA 3UKTA 1ZYBA 2R6QA 3N7MA 2D43A 5F3IA 4AFDA 3JB4C 3D5OA 1LB2A 1Q8PA 1C28A 2FDFA 1TNFA 3ZKYA 3POBA 3RZGA 4IETA 5E16A 1H8TA 1HV0A 1W8UA 1AR91 4CE8A 2CAUA 1LHWA 2OZ6A 3MV11 1OKQA 1KQRA 1VBE3 1FATA 2A6ZA 1C4RA 3PJQA 2CU5A 2VCCA 2HWB1 2AEYA 2D6LX 1GUIA 2RDSA 1SHWB 5CEHA 5L7OA 4FFHA 1RVF2 1UY3A 4QX2A 1VJ2A 3USUA 5CFDB 1GZWB 5BV6A 1SG3A 3W21A 5E8AA 5AVAA 1FPN2 2J1AA 2XQRA 4QX3A 3VKFC 1QMJA 4OZOA 1RUI3 1VBC1 2X10A 3LE0A 5EFUA 2ZTNA 5FZ6A 4CVUA 4HOOA 2Y8KA 3IPVA 1W2UA 5IFTA 1H1AA 2E53A 2CSGA 1PO21 2HWF1 2B42B 4BXSV 4CPBD 3DPRC 3JZVA 1WCSA 2ZEWA 2YYOA 3EB7A 1S55A 4L0PA 4XUQA 2VMIA 1MS4A 3VZKA 1W9WA 1UIKA 1BEV2 3WNXA 3P3PA 4LBJA 4N53A 4BOWA 4A4AA 1OVPA 3WEZA 2ILMA 1DQ6A 2P3KA 2D93A 2HEYF 3MPBA 3T1LA 1POQA 4LIUA 3MZHA 1FV2A 3KV9A 4QB1A 1EAH3 4QQOA 3RRDA 2VZUA 4RA0A 1EYBA 1AR61 1AZDA 1OA4A 1SLIA 2GN3A 2D44A 4Q8KA 2VMHA 4JRAA 1FPN3 1UZWA 3ZXDA 1LGBA 3U37A 4TSVA 4XF1A 3GJBA 5LRSA 4XIOA 4Q4Y3 4LHLA 3ASIA 1SACA 1ZVFA 4Q1RA 5EJ3A 1CN1A 2PLV2 2VBPA 5IK5A 4DPNA 2N7GA 1OLQA 1TNRA 1REFA 3RJRA 1FX5A 3S7IA 1LODA 3I2IA 4XEZA 3OD0A 1F5JA 1Z7S3 1NLRA 4M4PA 2OX0A 4AQ2A 1BEV3 4JRLA 4QDRA 4LE4A 4ZONA 2C6SA 4QKDA 1O5UA 1BK0A 3DYMA 4QAWA 4WBBA 1ZBA3 5K0UC 2H6BA 2VCMA 4URTA 3ZSMA 1W6QB 2BV4A 5JAXA 1O7FA 3OEBA 5BNOB 1S0DA 3KS7A 1V6KA 1MS5A 3HBZA 4FFGA 4FPHA 1PNFA 2BNNA 1LHVA 3P6BA 3VHRA 4FBFA 4L9BA 2D5FA 5F3GA 3KCCA 2Q30A 5FQ0A 3BTZA 2DU1A 1V0AA 3UV9A 3D4KA 3IAPA 3VBOB 1TMF1 5IK7A 3LDRA 1W39A 2AACA 1YQ8A 4AEMA 1GP4A 2H6CA 4HPKB 4YVWA 5A7NA 1KDKA 4BQWA 5DG2A 1EUUA 1K3IA 3IIIA 2LUWA 2VMFA 3LCPA 3PUHA 4RFRB 5BNPA 3NRUA 2B39A 4NRPA 1PHMA 4UT5A 1JZ2A 1SPPA 5FY1A 2ORXA 3JUUA 3AKSA 3ZSLA 4YW1A 3GBWA 1JH5A 2VTXJ 3T0BA 2RMU2 3JBG3 4M00A 1CZSA 1PX4A 3ZFFC 2Y64A 3WDTA 3WW3A 2BJSA 5FOJB 5KHKA 2VO5A 5FP4A 2JD9A 4QU1A 4TZDA 4XXPA 5H9SA 2ZKNA 4AQTA 3B69A 5CAZA 5JOYA 4GAZA 1JHJA 5APAA 3O1UA 3RS6A 4XF4A 1ZZCA 3MHZA 4Y24A 3O1MA 3QBQA 5JZGA 3G7DA 3MIHA 4FO9A 2BQPA 4N8MA 3T3YA 4HLTA 4E4HA 3MIDA 1BQPA 3RMYA 5CKNA 4MGSA 4XDPA 2WNUC 3P5BA 4S2HA 1MS0A 1JYNA 2D6KA 1QJX1 2BNOA 1LR5A 2G9GA 3ZLIA 1AX2A 1U5XA 2VZTA 1EV11 3KVBA 4KH9A 4LA3A 3ETPA 4YW5A 5LA2A 5T54A 1W0NA 5F5CA 2ET1A 4RSUA 2XVKA 5BNOA 1X33A 1KD7A 3NKGA 1OA2A 5D21A 3K4DA 5GLUA 2GAUA 4LA2A 4X6RB 2JEMA 3AFKA 4LITA 3SXWA 3S0MA 4W4ZA 1W8NA 3ZSJA 2JG8C 1COV2 4LBLA 1OSGA 4QGMA 4NIDA 3HN1A 4A6OA 2Y34A 1C8M3 4M3CE 1BXHA 1ZZ9A 3VBOA 1H2MA 2Y38A 2IWGB 1V00A 2PQQA 4CSWA 5FPXA 1DYOA 3T0DA 3AKPA 4WVVA 4YLZA 1Q8SA 3RNSA 3GBFA 3QLQA 1FMD3 3WT3A 4HPKA 1US2A 1GNHA 1DLLA 1VBA1 2ZMNA 4QHOA 4E2QA 1UNBA 5FZ7A 1U5YA 3PVEA 3VV1A 4BQXA 2VD7A 1AJOA 2HWE2 2RS11 4PQ9A 3WF3A 4WVWA 2K46A 4QXKA 4FPCA 4AR2A 2OUJA 3KV4A 3K3NA 5FP7A 3GHNA 3VBSC 1R1ZA 2W39A 1LTEA 2WT0A 1CX1A 1YEWA 4XFGA 1LOBA 4LXLA 1VRBA 3PUQA 2XLGA 4NRMA 1GR3A 1OOPC 3FBMA 1UY0A 4K8FA 1PMIA 1GOFA 2J42A 4C1WA 1RUG2 4UFIA 5J98B 1GP6A 1N1YA 4W6YA 2K2SA 3AKQA 3LKJA 3OUIA 2HWC2 2XL9A 1MQTC 1JHNA 1OPOA 1W9FA 1RUC1 2TEPA 4K7JA 4Q0VA 2PYTA 1UMIA 3WG2A 1VRH2 4O65A 1Q8QA 4MXWB 5EXOA 5FYVA 2LROA 2WZEA 3TNQA 4QDQA 3ATGA 3FBYA 2EXHA 2XJPA 4N9IA 1KDMA 2HWE3 3GALA 1QKQA 2FD8A 4NWVA 1FOD2 3G6JB 3H1WA 5A3OA 1PZ8A 3AMQA 3HWJA 3OBAA 1PM7A 2DDUA 4JTNA 1IOAA 4Q5OA 3AZXA 4AWDA 1RUH1 4CUBA 5GLTA 4JDNA 2PHFA 4A3XA 5B2GB 4Y1XA 3AMNA 1DP0A 3SH4A 3WHTA 1G9BA 1NA1C 1XXNA 4QPWA 4P9WA 1HQLA 1VB2A 1NZIA 1RUG3 4F8AA 4ASMB 1WW4A 4GB31 1RUJ3 1F5FA 2ATFA 1PVC1 2ZGTA 4Q4V1 4SLIA 5FZKA 1ZA4A 4F7ZA 2RR11 5BPXA 2HWC3 4ORFA 1X36A 3J7HA 4XTPA 3FL7A 3DECA 5F32A 4BWOA 3AZWA 1VRH3 2MEV3 2VH9A 2ZPXA 4YRDA 1WA4A 3MFAA 1LOFA 1VALA 2E7QA 2VNRA 5G04L 3S7EA 3H8OA 5JR7B 3B00A 1OLME 1Q8VA 2LTNA 1IPSA 4BDVB 2IXIA 3CJIB 3ON7A 1TME2 3RQ0A 5EP9A 4P9LA 3HNYM 3EMRA 5FYMA 4DY3A 1AR83 1B35C 4ITCA 2P3JA 4R9BA 3ZDSA 1KFXL 4QQLA 2LM3A 3BGAA 5JVVA 2JB4A 1I5PA 1W6PB 1YJKA 1D4M2 1HKDA 2DCKA 1K45A 2BGOA 1JZ5A 1IG0A 1YFUA 2VAUA 3OB8A 1RL3A 4A41A 3RYRA 1OURA 2VMEA 4NO4A 2WO1A 1QOOA 4K8RB 3GZTB 4P9YA 1V9U2 3VDDC 4S2GA 4O9EA 2E33A 2AGSA 1IKPA 4V2WA 5ABJC 3NV3A 3RZKA 1JUIA 4MXWA 2EA7A 5JWPA 1W6NA 5FMOL 3I8TA 5J48A 4TWTA 5BNNC 3WF2A 5J96B 1NY71 3HT2A 3VZJA 1PK6C 4ATFA 1NAEA 5DAWA 1M06G 5IAVA 1SLLA 2IXKA 4E2SA 5A32A 4XDOA 1X9PA 3K4ZA 2WYSA 1CJPA 2GDFA 3KMHA 1O3SA 4NRQA 4HVOA 2FHRA 5CA6A 3ORJA 1JOPA 5I0TA 1WMFA 2JKBA 2W46A 2R49A 3AYCA 4KWKA 1CWPA 1W8ZA 2Y6FA 4Q0QA 4NMIA 3X29B 5AC92 1GP5A 1UOJA 4CDWC 5FZ0A 5J09A 4BQ5A 1A6CA 5JOZA 3ZXEA 2BOJA 1O8SA 2ZCWA 4XC9A 1TG7A 2GC1A 4FTBA 4FI9A 1Y9GA 4Z2WA 3HBKA 1UZYA 1CVNA 1MACA 4IDZA 2VZVA 4MH0E 1LEDA 3DPRA 2E7TA 2W95A 3I2GA 4Q0SA 1HXS1 1DDLA 1OUXA 1VLNA 3AZYA 3ZYFA 1IQAA 4FPEA 4JGYC 3WR0A 1GICA 4XUPA 4JKKA 4I01A 1FAYA 2GMMA 4AAXA 5HCHA 1UW8A 2V5DA 4XVHA 2BVVA 1W6MB 5A1LA 1JU3A 3O5SA 3CIHA 1WW5A 2FCVA 2F4LA 3OTFA 1WLCA 4JHZA 4ZY9A 2Q1ZB 2ZEXA 5KR7A 3V0BB 4DS0A 1SLAA 5FLJA 4AZZA 2A6YA 5FZ8A 1Z7S1 2ZKLA 4UW3A 4BB3A 5G05L 1L7QA 4WM8C 2DVAA 2GSYA 5C8CC 4TLFA 4Y33A 3UT0A 1JODA 2HWF2 1PO22 4K20A 4PLOA 1VBB1 4UF0B 5EV7A 1CD3G 4K40A 1MZEA 1ZX5A 1OH4A 5C3PA 4YW2A 2X53S 1CAWB 5A3LA 4XJWA 1J1LA 2YHJA 4LHNA 4OMDA 1AR93 3HQXA 4HKOA 2KM2A 3AP5A 2QE3A 3VBUB 2YGMA 1D0GA 5H9RA 4UI9L 5ISLA 3FLTA 2HWB3 3ZMNA 2ZMLA 1QJY3 3RVHA 1QJU1 3I2HA 3U07A 1CZTA 1RGSA 1HW5A 3KCYA 3TOJA 3ZXAC 2JG9B 2EIEA 3ACIA 4E2GA 1AR62 3NL1A 3N9MA 4LBOA 4N9HA 4A3ZA 4S2FA 1QH7A 2DVBA 1VBC3 4AQSA 2UU8A 4S2DA 4PIYA 1ZZ7A 4EROA 5A3PA 2HWF3 1PO23 2W1WA 1KJRA 3VBHB 5GZGA 3RPQA 3H8XA 2R041 3JBG1 3QH7A 1DQ0A 3ES4A 5D1IA 4YNIA 4O7XA 4JKLA 3AP9A 3JB8A 2Q8EA 1N3OA 4QPYA 4DXSA 4P5YA 1NT0A 3M3QA 3V65A 3HMYA 4E8CA 3MI8A 5H9PA
chains in the Genus database with same CATH topology
5A80A 3OPTA 5IVFA 4LITA 5FZOB 5FY5A 3PUSA 4HONA 5A1FA 2YBKA 5IVBA 5FXZA 4LIUA 3KV9A 5FPBA 5A7QA 4QXBA 2XDVA 5FV3A 5IWFA 3U78A 4AAPA 4CSWA 5ANQA 5FXVA 2XXZA 4XDOA 3N9PA 5FYUA 3PU8A 4EZHA 5FYTA 4QX7A 5A3TA 4CCNA 4EZ4A 4QX8A 5FJHA 4LIVA 4DO0A 5FZ7A 5F2WA 5FYBA 4IGQA 5FP3A 5FZIA 5FZDA 2VD7A 3ZPOA 5FXWA 5FJKA 4URAA 5FZFA 4GD4A 3AL5A 5FZHA 5FZAA 4UF0A 5FZ0A 3N9OA 3AVRA 3KV4A 3K3NA 5FP7A 5FYSA 4BISA 3LDBA 2OX0A 4LXLA 1VRBA 3PUQA 4BXFA 5FYZA 3LD8A 5FYCA 3N9NA 4CCLA 5LWBA 3PDQA 5F3EA 2XMLA 2YU1A 5IW0A 4Y4RA 5LY2A 5F2SA 3KV5A 4IGPA 5FZEA 5FUPA 5A7WA 4CCJA 5IVCA 4BU2A 5FZ4A 4GJYA 5FYYA 4QXHA 3PUAA 2P5BA 5FY7A 4NUBA 5FP8A 5F3CA 2WWUA 5FYVA 5FPAA 4TN7A 4Y3OA 5F3GA 2OQ7A 3N9LA 5FPUA 5FYHA 3DXUA 5A1LA 5FZ9A 3UYJA 5KR7A 5A7WB 4IGOA 2YBSA 3NJYA 3OPWA 3PTRB 3KVAA 5FZ8A 5A7NA 4D6SA 5A3NA 5IVJA 3K2OA 4AI9A 4C8DA 5FZCA 3AVSA 5LY1A 4Y33A 4D6QA 5CEHA 4CCMA 5FZOA 5FY1A 5FY8A 2OQ6A 5FY9A 4UF0B 5FZKA 4EYUA 2PXJA 5F3IA 5FZMA 2WWJA 5A7SA 5FP9A 5FY4A 5IVVA 3DXTA 5F32A 5A3WA 5IVEA 5F5IA 3PURA 5A7PA 4QWNA 5FP4A 5LW9A 4QU1A 5FZ1A 2GP5A 5FBJA 2YU2A 3AL6A 4QXCA 2W2IA 5ISLA 4GAZA 5FPVA 3RVHA 5FUNA 4V2VA 5FZLA 5F37A 2OS2A 5FY0A 2YPDA 3U4SA 3N9MA 3KV6A 4DIQA 5K4LA 3N9QA 5FYMA 5F39A 4ASKA 4CUGA 4E4HA 2Q8DA 2OT7A 4GJZA 4XDPA 5FZ6A 3PU3A 4D6RA 4HOOA 5FWEA 5A3PA 5E6HA 3ZLIA 2YBPA 3KVBA 5IVYA 5FYIA 5FZGA 5FZBA 2Q8CA 5FWJA 4CCKA 4CCOA 5F5CA 2XUEA 2Q8EA 5FXXA 5FPLA 2GP3A 4V2WA 3K3OA 5FZ3A 5A7OA 5F5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A80 A;  3OPT A;  5IVF A;  4LIT A;  5FZO B;  5FY5 A;  3PUS A;  4HON A;  5A1F A;  2YBK A;  5IVB A;  5FXZ A;  4LIU A;  3KV9 A;  5FPB A;  5A7Q A;  4QXB A;  2XDV A;  5FV3 A;  5IWF A;  3U78 A;  4AAP A;  4CSW A;  5ANQ A;  5FXV A;  2XXZ A;  4XDO A;  3N9P A;  5FYU A;  3PU8 A;  4EZH A;  5FYT A;  4QX7 A;  5A3T A;  4CCN A;  4EZ4 A;  4QX8 A;  5FJH A;  4LIV A;  4DO0 A;  5FZ7 A;  5F2W A;  5FYB A;  4IGQ A;  5FP3 A;  5FZI A;  5FZD A;  2VD7 A;  3ZPO A;  5FXW A;  5FJK A;  4URA A;  5FZF A;  4GD4 A;  3AL5 A;  5FZH A;  5FZA A;  4UF0 A;  5FZ0 A;  3N9O A;  3AVR A;  3KV4 A;  3K3N A;  5FP7 A;  5FYS A;  4BIS A;  3LDB A;  2OX0 A;  4LXL A;  1VRB A;  3PUQ A;  4BXF A;  5FYZ A;  3LD8 A;  5FYC A;  3N9N A;  4CCL A;  5LWB A;  3PDQ A;  5F3E A;  2XML A;  2YU1 A;  5IW0 A;  4Y4R A;  5LY2 A;  5F2S A;  3KV5 A;  4IGP A;  5FZE A;  5FUP A;  5A7W A;  4CCJ A;  5IVC A;  4BU2 A;  5FZ4 A;  4GJY A;  5FYY A;  4QXH A;  3PUA A;  2P5B A;  5FY7 A;  4NUB A;  5FP8 A;  5F3C A;  2WWU A;  5FYV A;  5FPA A;  4TN7 A;  4Y3O A;  5F3G A;  2OQ7 A;  3N9L A;  5FPU A;  5FYH A;  3DXU A;  5A1L A;  5FZ9 A;  3UYJ A;  5KR7 A;  5A7W B;  4IGO A;  2YBS A;  3NJY A;  3OPW A;  3PTR B;  3KVA A;  5FZ8 A;  5A7N A;  4D6S A;  5A3N A;  5IVJ A;  3K2O A;  4AI9 A;  4C8D A;  5FZC A;  3AVS A;  5LY1 A;  4Y33 A;  4D6Q A;  5CEH A;  4CCM A;  5FZO A;  5FY1 A;  5FY8 A;  2OQ6 A;  5FY9 A;  4UF0 B;  5FZK A;  4EYU A;  2PXJ A;  5F3I A;  5FZM A;  2WWJ A;  5A7S A;  5FP9 A;  5FY4 A;  5IVV A;  3DXT A;  5F32 A;  5A3W A;  5IVE A;  5F5I A;  3PUR A;  5A7P A;  4QWN A;  5FP4 A;  5LW9 A;  4QU1 A;  5FZ1 A;  2GP5 A;  5FBJ A;  2YU2 A;  3AL6 A;  4QXC A;  2W2I A;  5ISL A;  4GAZ A;  5FPV A;  3RVH A;  5FUN A;  4V2V A;  5FZL A;  5F37 A;  2OS2 A;  5FY0 A;  2YPD A;  3U4S A;  3N9M A;  3KV6 A;  4DIQ A;  5K4L A;  3N9Q A;  5FYM A;  5F39 A;  4ASK A;  4CUG A;  4E4H A;  2Q8D A;  2OT7 A;  4GJZ A;  4XDP A;  5FZ6 A;  3PU3 A;  4D6R A;  4HOO A;  5FWE A;  5A3P A;  5E6H A;  3ZLI A;  2YBP A;  3KVB A;  5IVY A;  5FYI A;  5FZG A;  5FZB A;  2Q8C A;  5FWJ A;  4CCK A;  4CCO A;  5F5C A;  2XUE A;  2Q8E A;  5FXX A;  5FPL A;  2GP3 A;  4V2W A;  3K3O A;  5FZ3 A;  5A7O A;  5F5A A; 
#chains in the Genus database with same CATH topology
 2KR2 A;  2O8Q A;  3F95 A;  2ZAH A;  4QX5 A;  5IVB A;  3RZL A;  3GDB A;  2DBN A;  1XPW A;  3F2Z A;  3WCR A;  4PI2 A;  5DAQ A;  2DFB A;  1AR6 3;  2VCA A;  5IWF A;  3HQU A;  5DG1 A;  3ZFF A;  4W50 A;  4GKY A;  3V0B A;  1H1I A;  4EV0 A;  1OOP B;  5AFB A;  1W8O A;  4QX7 A;  2E63 A;  5GM0 A;  1CQ9 A;  3CKH A;  4AVV A;  1J83 A;  2C5D A;  1OF4 A;  3I59 A;  2WLQ A;  1DGR A;  5JCT A;  1QOS A;  1YWK A;  1NOV A;  1NUK A;  4IQP A;  4OHX A;  1TMF 2;  2ID4 A;  1AUY A;  2PHL A;  4QB2 A;  3SEE A;  1LHO A;  2GNB A;  3HQR A;  1MQT B;  5JR2 A;  4TTG A;  1YI7 A;  4UF0 A;  2VVF A;  4LKD A;  4QX1 A;  1E57 A;  3LF7 A;  3B5L B;  3WP6 A;  1YLL A;  5FYS A;  3THD A;  4CDU C;  2RDN A;  5T5J A;  3T2P A;  5CFD C;  3ZN6 B;  2UWA A;  2WNU A;  2ZAC A;  4OHZ A;  3TB0 A;  4RQP B;  4FVV A;  3AZV A;  2O1Q A;  1UX6 A;  3WF1 A;  2CTV A;  1SCS A;  2NMO A;  2WZ8 A;  3PHM A;  1L7R A;  5FYZ A;  5C33 A;  1HRV 1;  1UF2 C;  3N9N A;  4XQD A;  4PIX A;  4EWE A;  1NYW A;  2ZHL A;  2XML A;  3HVD A;  1UN1 A;  2VMC A;  4Y20 B;  1RC6 A;  3A21 A;  5HCF A;  2VZS A;  4CCJ A;  4W8J A;  3KV5 A;  4IGP A;  5IJR A;  1VBD 1;  3NV4 A;  4BQ4 A;  1W8W A;  4HET A;  3NJX A;  5A1F A;  3IDE A;  3CLP A;  4Z82 A;  2P5B A;  3IDB B;  3PIG A;  4Y5S A;  1WME A;  2JG8 A;  3U75 A;  1TMF 3;  1NE4 A;  3GZA A;  4EN6 B;  1JZ7 A;  4MGZ E;  4J1W A;  3VBH A;  4CZS A;  1KXG A;  2DCT A;  2R0H A;  3U1X A;  2OPW A;  2VMG A;  5GKA C;  1ZBE 3;  1YYN A;  1PM4 A;  3BYW A;  3C7F A;  3H1M A;  1RIR A;  1JS9 A;  3MV0 1;  4GMP 0;  4L99 A;  4QQ2 A;  3OGJ A;  3I2K A;  4FAH A;  2HWD 2;  3AVS A;  3N3H A;  1QJX 2;  2A3W A;  4XUR A;  3ACF A;  3T2T A;  2VOK A;  4IE7 A;  4IND A;  4G4F A;  3E5U A;  2C26 A;  1JBC A;  3V64 A;  4PDW B;  4YPJ A;  1SLB A;  1ALY A;  3VBS A;  4HN0 A;  1XNK A;  2TNF A;  3NNF A;  2XBO 1;  4UAP A;  1G7Y A;  3BTX A;  4FQ4 A;  2G1M A;  3HNB M;  1ONA A;  1OOP A;  2NN8 A;  4LUK A;  4AI1 A;  1OD5 A;  2JD4 A;  2QJV A;  2ZAA A;  3E5X A;  2B8M A;  4L97 A;  4CXW A;  5KC6 A;  4Z1V A;  5C4W C;  4K9S A;  4QXC A;  4XW3 A;  1PIV 3;  3KM5 A;  1KS4 A;  1XYP A;  3VDD B;  4D7T A;  4ZKT B;  1F31 A;  3LFI A;  3MEP A;  1AYN 2;  2XQX A;  1MQT A;  2W47 A;  2ZGR A;  5BNO C;  5CG9 A;  3FHI B;  4GMP 1;  5FKB A;  4QT6 A;  5I0R A;  1VBA 2;  2C9A A;  3ZN6 A;  4AYU A;  4RQP A;  3BU0 A;  2P3I A;  2HYX A;  4C0B A;  3ACL A;  4UFH A;  1EV1 3;  1V6O A;  4AED B;  4Z2A A;  1RUJ 1;  3VBO C;  3ABZ A;  4QX0 A;  3VL9 A;  4EE2 A;  4LQR A;  4YVS B;  4Y20 A;  2Q1M A;  4PHZ A;  2JDH A;  3LSD A;  3WQ7 A;  3WDY A;  4BME A;  1FI2 A;  4CTE A;  2GP3 A;  3BU7 A;  2RS3 1;  5A7O A;  3PIJ A;  1RUD 3;  3NVC A;  5FZO B;  2NLR A;  1LJ7 A;  5FXZ A;  5KHG A;  4JV4 A;  1MS9 A;  2NZ9 A;  2NQY A;  5I93 A;  4UW5 A;  2YC4 A;  3OF1 A;  4QM8 A;  3RSJ A;  5JDB A;  4OLL A;  4P9I A;  1RUC 2;  4H2A A;  2XXZ A;  1LKN A;  1HQN A;  1AR8 1;  1Y9M A;  1MEC 1;  1VBA 3;  4H7M A;  3O1T A;  4DO0 A;  4NIH A;  2E7A A;  3IMN A;  4ISQ A;  5K8S A;  1MPX A;  2F4P A;  2RS1 3;  4C0H A;  5T3N A;  1QQP 2;  1RXF A;  2O0O A;  3NNJ A;  3IBM A;  1K12 A;  3IAQ A;  4KWJ A;  1PGW 1;  5A3M A;  4V1P A;  3ROU A;  1YUD A;  4D7Y A;  1RUH 2;  3K4A A;  2JDZ A;  3N9O A;  4JGY B;  4DFS A;  3KB5 A;  1B35 A;  4YM2 A;  4ZPI A;  1W8H A;  4Y1V A;  3C7H A;  3WDX A;  5DQ0 A;  2VM9 A;  5JI9 A;  5HCA A;  4Y1U A;  2OZJ A;  2XWB B;  2HLE A;  4UBG A;  2WNV C;  4AHY A;  2DUP A;  4CU9 A;  5FO9 B;  3LD8 A;  2JIG A;  2JKX A;  3ZXL A;  2QDN A;  4GB3 2;  2PN5 A;  1PVC 2;  4P02 B;  1AR7 2;  3HD8 B;  3UGG A;  4Y4R A;  2KXL A;  3SNM A;  1HN1 A;  1XJA A;  4XJ9 A;  4HK8 A;  1RUC 3;  3VDD A;  3WNK A;  5FUP A;  1RB8 G;  2VQA A;  4XE9 A;  4LEJ A;  4A7Y A;  4BU2 A;  4AOC A;  2GME A;  5ABJ A;  3GJA A;  1G6N A;  5FPA A;  5T55 A;  4I02 A;  2OQ7 A;  3BOW A;  2ZX1 A;  3N9L A;  4FPL A;  4BHP A;  3H3Z A;  1S0B A;  2G9Z A;  4WVZ A;  1XQN A;  4IEQ A;  5FPU A;  1BBT 1;  1B09 A;  1PK6 A;  2XG3 A;  4P9X A;  1RUH 3;  3LFM A;  1VAK A;  2JX9 A;  2XKO A;  4MG2 A;  3OPW A;  1RUF 3;  3HOB A;  4K3U A;  2QQL A;  2HEV F;  1FV3 A;  1JN2 P;  2ZHN A;  4AFC A;  1UOF A;  3MW3 A;  2Y60 A;  3AMH A;  1NKG A;  3FZ3 A;  4YG6 A;  3ST7 A;  3VL8 A;  5FZO A;  1ND3 B;  4EN0 A;  4Q4V 3;  4XCB A;  1MVQ A;  2RR1 3;  4LBM A;  2YMZ A;  4CDW A;  1GU3 A;  4YG0 A;  2R1D A;  3M7A A;  3POE A;  1GZ9 A;  2Y0I A;  2BFU L;  5FY4 A;  3WG1 A;  5I8T A;  1OPM A;  2MPF A;  2FMY A;  5F5I A;  3OBR A;  3NW4 A;  3WNM A;  4RGG A;  3VD4 A;  3RYP A;  4XFC A;  4B8E A;  2JEN A;  3CDZ B;  4Q1P A;  1XE0 A;  4YGC A;  2ET7 A;  3IT8 A;  1OQD A;  3C7O A;  5CVR A;  2FZ1 A;  4JHT A;  5FKC A;  3ZVX A;  2H0V A;  3WDU A;  4MGT A;  2Z2S B;  2JXA A;  4N43 C;  3OGR A;  2D98 A;  4JGY A;  1MZ5 A;  4ASK A;  1WLW A;  2ZZQ A;  3WW4 A;  2VOV A;  4YM3 A;  1RUI 2;  4LT5 A;  2UYA A;  3O1P A;  2WLP A;  3UK9 A;  3ZN5 A;  1YFW A;  5GLZ A;  2X05 A;  4AW7 A;  4CCC A;  3C2U A;  1F15 A;  1AXK A;  4HKW A;  4AVS A;  1IPK A;  1RJ8 A;  2IVJ A;  2D6M A;  3J8F 1;  3MPP G;  4UFJ A;  1JYT A;  3R4U A;  2PHX A;  4QHZ A;  4BLI A;  4CXX A;  1NLS A;  4WM8 A;  5GLW A;  1MVE A;  5A80 A;  5C8C A;  2VQ0 A;  5TSW A;  2A6W A;  1SBE A;  2QTW B;  4LMF A;  4J6G A;  4P14 A;  1QJY 1;  2W68 A;  1EAH 2;  1HXS 2;  4XET A;  1ZNP A;  4YGE A;  1H4G A;  2ADE A;  1ULC A;  1QY4 A;  1RXG A;  1W04 A;  1ZM1 A;  1Y43 B;  2VNG A;  2WBK A;  4N7I A;  3SKV A;  3TBD A;  1RUO A;  4DIN B;  3HJR A;  4ATE A;  2X5I B;  2VZO A;  4YZ4 A;  5FYT A;  4IEO A;  2WSV A;  4UBH A;  1OC1 A;  1I3H A;  4QX8 A;  3AB0 A;  4Q4Y 2;  5ANN A;  3LA7 A;  4MO3 M;  4EWA A;  4IGQ A;  5CU1 A;  2XON A;  2HJI A;  2CYF A;  2DBI A;  1UYY A;  3ZPO A;  4YFZ A;  5C7G A;  4B3N A;  4Z07 A;  1T6B X;  1ND3 A;  2DVF A;  3MW2 A;  5FLI A;  4B4Q A;  3N35 A;  4EJR A;  2A71 A;  1JMU B;  3CJI C;  3WSO A;  5CB7 A;  2BPA 2;  1Z7S 2;  1MS3 A;  1UYZ A;  1ASJ 1;  3AXE A;  5FTT C;  3SKJ E;  4XIK A;  2LAL A;  2GAL A;  1ZBA 2;  1I9R A;  2QDR A;  2FQP A;  2GNM A;  1D2Q A;  1WLT A;  1VBB 2;  5FK7 A;  1TE1 B;  2V09 A;  1HXS 3;  4MUV A;  5C3Q A;  1CJD A;  5IW0 A;  1D0H A;  4QQP A;  2Q0A A;  1QDO A;  5L19 A;  4Q26 A;  3AP6 A;  2BTV C;  4IE0 A;  3QH6 A;  2UY8 A;  2WFF 3;  1IZ3 A;  4GA9 A;  1YIF A;  1XNB A;  4YGD A;  1ODN A;  1V6N A;  4TN7 A;  4YG3 A;  3OUH A;  3JD7 1;  4Y22 B;  2OW4 A;  2IXH A;  3V0A A;  4CPB A;  4MET A;  3E5Q A;  4A6S A;  2C0Z A;  2FMD A;  2OYZ A;  1VAM A;  2P3Y A;  5JXI A;  1PVX A;  1VB4 A;  3LAG A;  1NQJ A;  4QM9 A;  1C1L A;  4CRQ A;  2VQU A;  4AFB A;  5C4W B;  2EIG A;  5LEJ A;  3GM8 A;  4ASL A;  2DCZ A;  5FZC A;  1R64 A;  4N90 A;  1G9F A;  5ACA 1;  1W06 A;  1VBB 3;  5EWS A;  3I2F A;  3OY8 B;  1UCX A;  2VUA A;  3KT1 A;  3JBG 2;  2LS6 A;  1ZZ8 A;  5HV0 A;  1NCR C;  5FCC A;  2R06 3;  3ZFE B;  4CDU A;  1O3T A;  4GIQ A;  1ZRD A;  4B4R A;  5CFD A;  1GZW A;  3B94 A;  4LE3 A;  2W91 A;  5A7P A;  3D8C A;  4NHM A;  4AG4 A;  2X5I A;  3ZYP A;  4G9S B;  4OI0 A;  5GAL A;  2GH8 A;  4YSF A;  3NKT A;  3LEI A;  3JCI A;  3IZO A;  4UW4 A;  5F7U A;  1GBG A;  1QJU 3;  1ENQ A;  1O4Y A;  3ZYH A;  1R1A 1;  4XIL A;  1CX4 A;  4P5H A;  2YPD A;  5L9R A;  1EP0 A;  2XJT A;  1XB9 A;  1ZBE 1;  5K4L A;  4AE2 A;  3PMS A;  2QNK A;  4AEK A;  3N7L A;  2Z69 A;  4QB6 A;  2R1B A;  2BWC A;  2QBX A;  3O14 A;  4NPR A;  2VR4 A;  5L36 A;  3FFQ A;  4NAM A;  5FWE A;  1BYH A;  4XHB A;  5GZF A;  2R04 3;  4NR1 A;  4U2A A;  3MUY 1;  2JJ6 A;  2DUO A;  2VPV A;  4IEZ A;  4MV2 A;  2JE8 A;  1QJE A;  4CP0 A;  2Q8C A;  1HRI 1;  2IC1 A;  2LW8 A;  1UAI A;  4EN8 B;  4ZS2 A;  3M3I A;  3ILF A;  5EJ1 B;  1S1A A;  4KWL A;  1KIT A;  3FLR A;  1DZQ A;  4D7S A;  1DCS A;  1O59 A;  1DFQ A;  1Y4W A;  1RUE 1;  1UMZ A;  2YY1 A;  2CWM A;  4RHV 1;  4XJU A;  1A34 A;  1VMF A;  1C8M 2;  3H9A A;  1PIV 1;  1S0E A;  2KA3 A;  3CZU A;  4M0N A;  4DUV A;  4KI5 M;  1BJQ A;  4QXB A;  1S0I A;  4W6X A;  4AGR A;  4CXY A;  5BNQ A;  4Y4Y A;  1O3Q A;  2ZGS A;  4P9J A;  2AUY A;  5FRA A;  5FXV A;  4HG6 B;  3N9P A;  3DEM A;  4I0W B;  2WNV B;  4XUO A;  1FMD 2;  5A33 B;  3L2Y A;  2YUE A;  3MW4 A;  1DQ4 A;  1V70 A;  1XYO A;  2JE9 A;  5C4W A;  3TN9 3;  4NII A;  3VBU C;  3WF4 A;  3RZM A;  5FZI A;  4XAC A;  1W9S A;  5FZD A;  3L2H A;  1SBF A;  1W6Q A;  2WIN B;  1JW6 A;  3WDV A;  1HN0 A;  5FZA A;  3AFG A;  4I0B A;  2R07 1;  1JYW A;  2AR6 A;  2JG9 C;  1J3Q A;  2Q1F A;  1O3R A;  5I8Y A;  4R9D A;  1RUD 1;  1HRV 3;  3U14 A;  2AZ5 A;  3TNP B;  1UWW A;  1L3J A;  3ZN4 A;  3VDA A;  3W58 A;  5JPN B;  2I07 B;  4ES8 A;  3AYD A;  1HIX A;  3ES1 A;  1EPW A;  5FMC A;  1L7L A;  5F6L B;  2ZX4 A;  4MXV A;  3VBH C;  3MDP A;  1HV1 A;  3DYP A;  1VBD 3;  4BYY A;  4MZU A;  3I3M A;  3D6E A;  1WBF A;  2WC2 A;  4FPY A;  4LUM A;  3ZX7 A;  1IQD C;  1NG0 A;  2RS5 1;  4CDX B;  4QXH A;  2OVU A;  1WCD J;  1YFY A;  2W3J A;  3OYW B;  5FP8 A;  5EJZ B;  5T52 A;  2VMD A;  3VKL A;  4DRV A;  3A23 A;  2NMN A;  3RFR A;  2BU9 A;  1FXZ A;  1NCQ B;  3LB9 A;  3POY A;  5FYH A;  4XBL A;  3LPG A;  3WXP A;  4E4Z A;  1DHK B;  2KD7 A;  3P1I A;  1OBN A;  3PVO A;  5T5O A;  2V73 A;  3SMH A;  1WCK A;  1XNC A;  1RMU 1;  2QFE A;  1PX3 A;  3MIG A;  5A7W B;  4EWD A;  1QGL A;  3RWK X;  2B4K A;  3T30 A;  4AFA A;  5FPZ A;  4D6S A;  2Z42 A;  1S0F A;  2BEO A;  4FOV A;  1NXM A;  3LA3 A;  5C9A C;  5JSR A;  3ZXG A;  5J7M A;  4YM0 A;  4DUX A;  1G9A A;  2XJU A;  2DCY A;  1RUJ 2;  1YJL A;  3AYA A;  2YFZ A;  5FIX A;  4TLG A;  2F17 A;  1ACC A;  2VW0 A;  1J1T A;  2QQN A;  2D97 A;  4N43 B;  5KXE A;  3S5A A;  1SMV A;  4WZF A;  2DTW A;  4OQ8 A;  2D7F A;  2VE1 A;  2XBO 3;  5FP9 A;  2MEV 2;  1O6U A;  3DXT A;  5I8S A;  2RS3 2;  2IXJ A;  2WZR 1;  2WNV A;  2Z5W A;  5A33 A;  4RQP C;  3QD6 A;  1E5I A;  2GP5 A;  4WM7 B;  5KBF A;  2YU2 A;  5C71 A;  3KF3 A;  1REE A;  3ZYB A;  2P34 A;  1TZO A;  2DFC A;  4OQ9 A;  3FC0 A;  5FPV A;  1CAX B;  4IER A;  5E88 A;  4PBP A;  1GWM A;  4CU6 A;  1UY2 A;  2BGP A;  3MF9 A;  4GMP 3;  5HCB A;  1AR8 2;  2DV9 A;  1UQX A;  3CO2 A;  3KV6 A;  4JVA A;  5DAX A;  1C5H A;  1DYK A;  1RUF 1;  2A6X A;  2WWS A;  4FAG A;  5LA9 A;  3VD3 A;  3OGS A;  2PAE A;  5M0T A;  3H42 B;  3WDW A;  1W2O A;  3M3C A;  5E6H A;  4XDQ A;  4DRR A;  2WNE A;  3VD5 A;  2WO3 A;  1PGW 2;  2Q8O A;  3GF6 A;  5L9B A;  3UGH A;  5FMD A;  4AF9 A;  2XL7 A;  5FYI A;  5GZD A;  4IE4 A;  5FZB A;  5F5Q A;  1ZRF A;  2BP6 A;  2JWP A;  2B5H A;  2BER A;  3OD4 A;  4Z92 B;  2RS3 3;  4WV8 A;  4M3C B;  1WD4 A;  1W8T A;  3GZU C;  3JQW A;  3LIH A;  4EZH A;  4CDX A;  2VUD A;  2J1T A;  4LO6 B;  4AFM A;  2JDN A;  3AK0 A;  3EYP A;  3ZYG A;  4CDQ A;  3A7Q A;  3IN9 A;  5T5L A;  4ONU A;  4AAP A;  4EYU A;  4PDW C;  1MEC 3;  2VUC A;  4IE6 A;  4MGI E;  4LNV A;  2VEC A;  4NN0 A;  4CUA A;  1ST8 A;  3MIF A;  1RHI 1;  3NJV A;  4I3P A;  1AJK A;  2A3X A;  2NM1 A;  4PI0 A;  4XAA A;  3SIT A;  5FJH A;  4Q4W 1;  4AK3 A;  1LHU A;  2IFW A;  4QKF A;  1BBT 2;  4AVC A;  3AM2 A;  4RN5 A;  1GNY A;  2VOX A;  2YPJ A;  4GD4 A;  5FUI A;  2RVA A;  2VCB A;  4N43 A;  4UFM A;  3SCF A;  1ZZ6 A;  1PZ9 A;  3B9C A;  2IXC A;  1XU1 A;  4OHY A;  3Q8F A;  3LEK A;  4YZ2 A;  2RM2 1;  3ILR A;  4A42 A;  1XNA A;  3H3L A;  5DAP A;  3POS A;  3DL3 A;  1TQ5 A;  3PDQ A;  1WA6 X;  1EPZ A;  4AED C;  4DY5 A;  1PO1 1;  3TAY A;  2DUQ A;  2WAA A;  1XBF A;  1O8P A;  5FZE A;  4YVS C;  3DN7 A;  2V4A A;  4CP1 A;  3GXU A;  4K1Y A;  4MHR A;  3HT1 A;  5F1R A;  5IK4 A;  3H3U A;  4RYD A;  2V72 A;  2ZMK A;  3LOI A;  4Q27 A;  5K7P A;  2BOI A;  1DQ2 A;  4HT1 T;  1WD3 A;  1BBT 3;  1NCR B;  1X8M A;  3A0N A;  3ZKU A;  3D3A A;  1CPM A;  2EXI A;  4GKX A;  4D69 A;  1SDW A;  3ZSK A;  3UYJ A;  4IUG A;  1JI6 A;  3MIC A;  1UPS A;  4QHB A;  1CAU B;  5F8P A;  2IVI B;  2G19 A;  5JIU A;  2YGL A;  3KQR A;  1AL2 1;  1SCR A;  3D0S A;  3RDI A;  4JAA A;  3URF A;  5KHI A;  2VVE A;  4LLF A;  1DGL A;  1GQH A;  3KGL A;  3FUO A;  1SLT A;  3CJI A;  3D0J A;  3GBG A;  1C57 A;  1IS3 A;  4NE9 A;  1G9C A;  5A7S A;  4AI0 A;  2YG0 A;  4EN9 B;  1AR9 2;  1CON A;  1WMX A;  1V6L A;  2F6B A;  4NPM A;  4QWN A;  1FNY A;  4LKS A;  4QPG B;  2WFF 1;  3AKR A;  4SBV A;  1W6P A;  4XJ8 A;  1C8N A;  1AX1 A;  1QU0 A;  2ARC A;  3FX3 A;  4R4Z A;  5JLV A;  2HWB 2;  3TEW A;  5B4N A;  1QJY 2;  3VBF B;  4Y5Z 0;  4FXG B;  3BPZ A;  2RE9 A;  4JGZ B;  2OS2 A;  4P08 A;  2OII A;  3WQ0 A;  1W90 A;  1VBC 2;  5CKM A;  1QF3 A;  1KEX A;  4LO7 A;  1HDK A;  1W2N A;  1QXJ A;  1RVF 1;  4UXA A;  1UU5 A;  3K51 A;  4HFS A;  3N36 A;  1XND A;  1JOJ A;  4IES A;  4RS5 C;  3WIN E;  4COU A;  4D6R A;  2E31 A;  2VC9 A;  1CES A;  2CGN A;  2W08 A;  3CF6 E;  2C9K A;  4OHW A;  4XFB A;  2PHR A;  3BB6 A;  2GNT A;  3RYK A;  2VOW A;  2JDU A;  2QQK A;  4E27 A;  3J8F 3;  1PGL 1;  3O0X A;  3WV6 A;  1Q3E A;  2Y6G A;  2J1S A;  2R06 1;  2ETE A;  3LIG A;  1RYY A;  1SFN A;  5FPL A;  3BKZ A;  2ZJC A;  4WZC A;  1SEF A;  3ENR A;  4W65 A;  5DMY A;  3C7E A;  4OHV A;  3ZFG B;  2VJX A;  3ITQ A;  3AKT A;  3PL0 A;  4YW3 A;  3I54 A;  1ND3 C;  1NCR A;  2BUK A;  1IS6 A;  2UUR A;  2WA4 A;  5A3U A;  5ANQ A;  4GQ7 A;  2J1R A;  4Q8L A;  1PGS A;  3LEM A;  4Q29 A;  4C90 A;  2WQZ C;  1E5H A;  2B7Y A;  3Q8A A;  4CP9 B;  3UKV A;  1V6M A;  3T0A A;  4BIO A;  3JD7 2;  2W0X A;  3WX5 A;  3W20 A;  4FFF A;  1CAU A;  4JC1 A;  2D3P A;  3M4F A;  1SQ4 A;  1EUT A;  2P17 A;  4MGQ A;  1R08 3;  3ZXJ A;  1YFX A;  3N7J A;  3I49 A;  1XRU A;  1ASJ 3;  1KJL A;  1X7N A;  2PLV 1;  1XE7 A;  3J9S A;  3KT7 A;  2BVB A;  5LAT A;  5LEK A;  1Q56 A;  3N4M A;  2DU0 A;  2HEW F;  2O14 A;  2RDR A;  2WS9 3;  1J3P A;  3LDB A;  5C5U A;  3LQC A;  4LTA A;  1W99 A;  4CU7 A;  5ACA 2;  2A6V A;  4QPG A;  1AXZ A;  1LCL A;  2XR4 A;  5CZK A;  3WNL A;  4HSJ A;  3WP3 A;  5HPO A;  1W6M A;  1ZRR A;  2YZ4 A;  3VBF A;  4GWI A;  1BZW A;  2Q4S A;  4OUE A;  2Y26 A;  3ZR6 A;  4LOT A;  5DZF A;  4CUC A;  5IVC A;  2ZAB A;  3VUO A;  2PMW B;  1AYM 1;  5C9A B;  2XJR A;  5BYN A;  1XYN A;  1ULG A;  2FDK A;  2B45 X;  3BPS A;  3JD7 3;  4FCA A;  4COY A;  3QCW A;  3TN9 1;  1ULD A;  5A6Y A;  2RHP A;  1GZC A;  4B7K A;  1R1A 2;  2CDO A;  1ND2 B;  4PJY A;  4XTM A;  4BA6 A;  4PT6 A;  1ZBE 2;  1CAW A;  4KU7 A;  4XUT A;  1GOH A;  1AVB A;  2X5I C;  3AMP A;  1W2T A;  3R6S A;  5LB6 A;  4AGV A;  5ACA 3;  4KGQ A;  4PBO A;  3VBU A;  4AI9 A;  3NNG A;  3NST A;  5BXX A;  4LOR A;  4XQW A;  4L2N A;  3ZFG A;  1ZZB A;  5LA1 A;  1HRI 2;  1OXC A;  2JG9 A;  2ZGK A;  2PHW A;  3WUC A;  2RMU 1;  3WNN A;  4NRO A;  4K6B A;  2WO2 A;  5H9Q A;  2QUO A;  4X8P A;  4CP9 A;  2XB6 C;  4ZU4 A;  3E97 A;  1PIV 2;  4LOS A;  2FDJ A;  1UO9 A;  1R1A 3;  1WCU A;  2ARB A;  1OFS A;  2K9Z A;  2DVG A;  2C1F A;  3POJ A;  2WT2 A;  4OYU A;  5DPN A;  3FN9 A;  5FMO S;  2GH2 A;  5FZL A;  4NIA A;  4AVT A;  5A70 A;  5FY0 A;  3ZIW A;  5F37 A;  5D8A C;  3NV1 A;  3NQH A;  2YXS A;  5C70 A;  3K46 A;  4CUG A;  2Q8D A;  3W9A A;  5CYY A;  4RR3 C;  4AEJ A;  2ADD A;  5LAS A;  2HBU A;  4AXO A;  1X9T A;  1EV1 2;  1UXX X;  1NZC A;  2CGO A;  3ACH A;  3FWE A;  1H6Y A;  1P8J A;  2QQV A;  1TVG A;  1HRI 3;  3VKO A;  2VY0 A;  2FZ2 A;  5FRE A;  1HQW A;  3FLP A;  4AI2 A;  5FXX A;  1RUD 2;  5KHH A;  5CIR A;  3WNP A;  3J4U H;  5E89 A;  4RHV 3;  5C9A A;  1RUE 3;  3BTY A;  5FFO C;  3UNP A;  2I74 A;  2O8O A;  1QJZ A;  4HK9 A;  4TYS A;  2YBK A;  1IS5 A;  1CZV A;  2P6C A;  4XPV A;  1JYI A;  2GC0 A;  1UZV A;  3T4H B;  3LEG A;  5FPB A;  2IUW A;  1UIJ A;  1LOE A;  5LZ6 A;  1FT9 A;  1ND2 A;  1COV 1;  1X8E A;  3ACG A;  4YZ1 A;  3OPZ A;  4XBN A;  3BUC A;  3ZFE C;  4QDS A;  2HYK A;  2RS5 2;  1MR5 A;  3R4S A;  1N47 A;  4D94 A;  4PIZ A;  2ZA9 A;  4K1Z A;  3MYX A;  4CCE A;  1GYK A;  5DAB A;  4FOW A;  2CGP A;  5F6K A;  5LA0 A;  2RS1 2;  1LUL A;  3DKW A;  3I2J A;  3NNL A;  4UW6 A;  5FYB A;  5ERL A;  1DZT A;  5FP3 A;  3WP5 A;  4IEY A;  1Y7B A;  1UYX A;  3ZR5 A;  2R07 3;  1QWR A;  5FZH A;  2ZEZ A;  1LHN A;  4C91 A;  4KQ7 A;  3RZH A;  4XFA A;  5FAX A;  3FE5 A;  5EYY A;  1R09 1;  2PHD A;  1Z0H A;  1CGP A;  2ZGP A;  2ZX3 A;  4JDO A;  3H7J A;  3VHO A;  4Z8B A;  1OI6 A;  5LK5 A;  3N7K A;  1W9T A;  3IMM A;  4AQ6 A;  4A7Z A;  5F3E A;  4C1X A;  5IK8 A;  4QGL A;  1H0B A;  4ZZ5 A;  2RS5 3;  1BKZ A;  3B93 A;  3SCH A;  1W3X A;  3ETQ A;  4BQ1 A;  3I7D A;  4NVP A;  2BBA A;  4A2U A;  2VOT A;  2WZP P;  2OXB A;  1NXD 1;  2G9F A;  5FLH A;  2XUM A;  4ZHN A;  2WJS A;  3ZOI A;  5CNA A;  1VE0 A;  4ZU7 A;  1AL0 G;  2CNA A;  2AH2 A;  5JSO A;  1UU6 A;  2ZGU A;  1Z78 A;  2CL2 A;  3ZPY A;  1RMU 3;  2W1U A;  5EYX A;  3UJO A;  4PDW A;  4NWW A;  2VXR A;  2A1X A;  1FOD 1;  4CYD A;  1F8V A;  1RUF 2;  3EXU A;  2EXK A;  4Q4X 1;  2YBS A;  1BVP 1;  2VUJ A;  1LOG A;  1J84 A;  4YM1 A;  4E4S A;  3PNA A;  4XFI A;  4XOG A;  1GNZ A;  4Q4V 2;  3OEA A;  4GWM A;  1GOG A;  4KMQ A;  2RR1 2;  3J7M A;  1CPN A;  2OQ6 A;  4OUL A;  3CZJ A;  3IWZ A;  5FZM A;  1IGO A;  1UY1 A;  2WWJ A;  3THC A;  5CBL A;  2Y6L A;  4LK6 A;  2WZR 3;  1N1V A;  4RS5 B;  1UL9 A;  2VZ1 A;  3VD7 A;  2NP0 A;  4IV1 B;  5JXG A;  3NO8 A;  4MYE A;  3CL1 A;  4FSJ A;  5L73 A;  1FYU A;  4DXR A;  3WQ1 A;  2WN3 A;  1UD1 A;  1YO8 A;  1J3R A;  2JIC A;  4AED A;  1GQP A;  3CEW A;  4BK4 A;  1S2K A;  5F9T A;  4KGG A;  1F4A A;  1J59 A;  1JUH A;  4XZP A;  5DAV A;  2BZD A;  4NHL A;  2FBE A;  1IKQ A;  1YXW A;  2P2K A;  2CAV A;  4YVS A;  3SC7 X;  5I91 A;  3RZJ A;  2OT7 A;  3AJY A;  1NQD A;  1BK1 A;  4FPO B;  4QU2 A;  1JU4 A;  4NAO A;  4CDX C;  2QQU A;  3PU3 A;  4GZ9 A;  4YYO A;  5HI0 A;  3WG3 A;  3FJS A;  4PCR A;  4I09 A;  1JOB A;  1D4M 1;  4R9A A;  3TYJ A;  1NCQ C;  4CDQ C;  4CDU B;  4FQZ A;  4ISR A;  5EHD A;  1CIW A;  3VZN A;  5L7O B;  2RV9 A;  2VL4 A;  1XU2 A;  4ZS3 A;  3CHX A;  1I5Z A;  2ZX0 A;  4O9G A;  3PME A;  2EAL A;  2A7A A;  1WCQ A;  1V9U 1;  4R9C A;  3T2Q A;  5BY5 A;  3KHB A;  2PA7 A;  3WY6 A;  1JZ6 A;  2VUL A;  2RJK A;  4HXC A;  1NY7 2;  1RJ7 A;  3GGL A;  3MBW A;  4HON A;  1UOG A;  4LO5 B;  2VNV A;  1UYP A;  2VXJ A;  2W9X A;  3I3B A;  1U0A A;  5DDJ 3;  1S0C A;  5FV3 A;  5A6Z A;  3B3Q E;  3ELN A;  4MOA A;  2C24 A;  2TUN A;  2P4E A;  1RHI 3;  3E6B A;  3CBN A;  5FYU A;  3THT A;  1BCX A;  2VQT A;  2J1V A;  4Q4W 3;  5A3T A;  4HBN A;  3T08 A;  1DQ5 A;  4WM7 C;  1QOT A;  2CY6 A;  4GWN A;  3ILN A;  5CKQ A;  5IAT A;  1VAV A;  1Y3T A;  4L8Q A;  1W9Y A;  4BZ4 A;  4I30 A;  2ERF A;  3KWV A;  2QQW A;  5L9V A;  4ZZ8 A;  1OA3 A;  3WZ1 A;  1ENX A;  4HVR A;  4BMB A;  4MHU A;  1CIY A;  2A73 B;  2W87 A;  2RM2 3;  3HR9 A;  4RS5 A;  1OD3 A;  4GXL A;  3OBZ A;  1C5I A;  2IZW A;  1OF3 A;  1AL2 2;  1QDC A;  5IT6 A;  3EQE A;  1VP6 A;  1PO1 3;  1H2N A;  1DGW A;  1SBD A;  3ZXF A;  4OI4 A;  1GQG A;  1WGP A;  2WNO A;  4L11 A;  1PNG A;  5I0S A;  2EF6 A;  2WFF 2;  3B7M A;  3LPF A;  1ENS A;  2ARE A;  1HB2 A;  3IKW A;  4HN1 A;  4OMC A;  4OVE A;  1GKB A;  2WAB A;  3RGB A;  3K77 A;  5FK8 A;  2CHH A;  1R08 1;  2VNO A;  1ZRI A;  2DF7 A;  4P9G A;  3A4U A;  2I45 A;  2P1B A;  2LRP A;  4D3W A;  3PVB B;  1H9W A;  3UKN A;  3VKM A;  4EQV A;  1OUS A;  2JDK A;  2WS9 1;  1N3Q A;  2PTM A;  3SEP A;  1RIN A;  3KCX A;  4MLO A;  5E1R A;  1AL2 3;  3OG2 A;  3SH3 A;  5FQ0 B;  3ZYJ B;  3TEZ A;  1U5I A;  1WW7 A;  3BTA A;  3POW A;  5D8A B;  1PGL 2;  2VG9 A;  3HNM A;  2R06 2;  3PTY A;  3LZZ A;  2CDP A;  4Y5T A;  3O12 A;  2R32 A;  1ZRE A;  3VZM A;  4RR3 B;  1JTZ X;  2ZXQ A;  2WA3 A;  1QIQ A;  4XZU G;  4YVW B;  4CCD A;  1S2B A;  3DV8 A;  5BNP B;  3NMB A;  1U5Z A;  5FBJ A;  1QJU 2;  3B9I A;  3EO6 A;  4FTS A;  2W2I A;  3INA A;  3VBR C;  2HH9 A;  1F4H A;  1SPP B;  2YC0 A;  4OZX A;  3WUD A;  5FUN A;  5J1X A;  4CEW C;  3JQX A;  4RGA A;  3CU7 A;  4DIQ A;  1RVF 3;  5F39 A;  3MIB A;  4XJZ A;  2EXJ A;  2GC2 A;  3H8U A;  3HEI A;  3LOB A;  3WLU A;  4XF3 A;  1YIP A;  1GLH A;  1YQ6 A;  2R7E B;  2V4V A;  3FHA A;  2R04 2;  1BMV 1;  3KQ4 B;  2BNM A;  4BM8 A;  2WL1 A;  1O91 A;  2DVD A;  2QZ2 A;  4IV3 B;  3BCW A;  5JZG B;  3I3D A;  5FWJ A;  1PMH X;  3UET A;  3GZE A;  1KS5 A;  3SIS A;  5JOW A;  3JXS A;  4ZXE A;  4FTE A;  5FZ3 A;  5HXV A;  3EJK A;  5F5A A;  2ZS6 B;  2W1S A;  3A22 A;  3DF0 A;  4Y26 A;  3ZYR A;  2BWA A;  3RI8 A;  4JKM A;  3S6P A;  1OKO A;  3I3E A;  1AYM 2;  2D6P A;  4AHW A;  4XQ4 A;  2Z79 A;  3PU8 A;  1UU4 A;  3FFZ A;  3MUZ 1;  4AI8 A;  1Q43 A;  4CCN A;  4QPG C;  3TN9 2;  4DNY A;  4EZ4 A;  2A3Y A;  3KLS A;  4OFG A;  4XHX A;  2UWB A;  2G4I A;  4UFL A;  5IHR A;  3IIA A;  3VBF C;  5FXW A;  4URA A;  3VLB B;  2PLV 3;  2MNG A;  4JGZ C;  2PAK A;  2WYF A;  2UWC A;  5A1A A;  5D8A A;  1QNW A;  4BJ0 A;  2ZEY A;  1WKY A;  1QH6 A;  2DUR A;  2XJQ A;  4QMA A;  5D2A A;  4RGK A;  1K5M C;  1A8D A;  4FOQ A;  4A7K A;  4RR3 A;  2WUH A;  1HRV 2;  2QKD A;  2QVS B;  4DQA A;  2VZ3 A;  3I3Q A;  3M3E A;  4Y22 A;  2UYB A;  3APB A;  5FYC A;  3WHU A;  2YRO A;  4R4X A;  3UL2 A;  1IPJ A;  1VBD 2;  4NHX A;  2QQI A;  4P00 B;  2WQ8 A;  1ODM A;  1DG6 A;  1AYM 3;  2EIB A;  3OBT A;  4YWA A;  2D5H A;  2BYV E;  3I4I A;  2BFU S;  4GJY A;  1GMM A;  3PUA A;  5J36 A;  1VMJ A;  4PF1 A;  3WD5 A;  1LOC A;  2Y33 A;  3POF A;  3S30 A;  4J25 A;  3MIE A;  1GWK A;  3ZFG C;  1WMD A;  3OY8 A;  2ARA A;  2P6H A;  2GU9 A;  1YC6 1;  5FZ9 A;  1DIW A;  5EQU A;  3ZFE A;  4IV3 A;  3HN3 A;  2DYC A;  3D82 A;  2JB8 A;  4LKE A;  3O0W A;  2B46 X;  3PTR B;  4QKN A;  3NV2 A;  3WF0 A;  5KXC A;  2FDI A;  1DGW X;  3K2O A;  2WDB A;  4JZR A;  1W03 A;  3ZSE A;  3S5Q A;  4YFW A;  1H2L A;  2VU9 A;  5FY9 A;  1Q5O A;  2HKX A;  2HWD 1;  3ZDV A;  4G3Y C;  1UX7 A;  1AHS A;  3LWC A;  4OCT A;  2XBO 2;  4BCU A;  1XE8 A;  1H30 A;  2RMU 3;  4U36 A;  5CFC B;  5GZE A;  1GAN A;  1W0P A;  1YHF A;  5IUQ A;  5B4X A;  5IVV A;  3PUR A;  4RD7 A;  2EAK A;  2WQ4 A;  3CNA A;  4LHS A;  3NNM A;  5SV5 A;  2JDM A;  4B7E A;  4DXT A;  3VN4 A;  1RED A;  3VKN A;  3AL6 A;  5A6Q A;  2FCT A;  1MZF A;  1DF0 A;  1QHD A;  4HVQ A;  4IW3 A;  3T09 A;  2Y6H A;  4YW7 A;  1AF9 A;  2BW8 A;  1GSL A;  2X09 A;  2RG4 A;  3OGV A;  3ALQ A;  1AYN 1;  4IEX A;  1H9P A;  1DGR N;  5HBA A;  4Q0P A;  5C3R A;  2ZX2 A;  1W8F A;  4QPI B;  4WVM B;  3QAC A;  1POV 3;  4H14 A;  3H0O A;  1LES A;  2I2S A;  3AX4 A;  1WWY A;  2MHF A;  1OVS A;  5FR3 A;  1ND2 C;  3DKQ A;  1NE6 A;  2C4X A;  4H55 A;  3O1R A;  3H1Y A;  1R09 2;  2A75 A;  2D40 A;  4EN7 B;  1QEX A;  3R05 A;  2XUE A;  4X8N A;  2WII B;  3I2O A;  4GAL A;  1MZ6 A;  3LDK A;  2AYH A;  3OPT A;  5JPM B;  4JQT A;  2AEZ A;  2ZGL A;  4QD2 A;  1WZX A;  2SLI A;  4BQ2 A;  2ZHM A;  4LLO A;  1RUN A;  1COV 3;  4FPJ A;  2WFP A;  1SFP A;  2SBA A;  1MEC 2;  2XHK A;  2XKP A;  2XDV A;  3C3V A;  4YGB A;  2QQO A;  1BHG A;  4D0Q A;  1V6I A;  4ZU5 A;  2H0B A;  1T6G C;  1UY4 A;  3KSC A;  3NAP B;  1DU3 D;  4DUW A;  1ULE A;  5DXD A;  3VB9 A;  3OCP A;  1UXZ A;  2YC2 A;  3Q8E A;  4NHK A;  4B4P A;  1W6N B;  1K5J A;  5DN2 A;  4DEQ A;  5C6C A;  2WRA A;  4CEY C;  2EIC A;  3AL5 A;  1YQ5 A;  4IEV A;  4M3C F;  3HPN A;  1QQP 1;  4Q4X 2;  1R09 3;  3VD9 A;  5A32 B;  4MGY E;  4R52 A;  1D7P M;  5CFC A;  4YW4 A;  4BIS A;  3QOP A;  5T50 A;  3ZIX A;  3AP7 A;  3OYW A;  4BXF A;  3TRS B;  4AVB A;  4XAE A;  1PMJ X;  1UPI A;  4NHY A;  4DOU A;  5DDJ 1;  2JEC A;  1NCQ A;  3O7O A;  5DUU A;  5C5T A;  3GYD A;  2EID A;  2ENR A;  1HB1 A;  5F2S A;  1US3 A;  3OSD A;  1AR7 1;  5A7W A;  4IEW A;  5JI7 A;  3J7L A;  3OUJ A;  5FY7 A;  5DUV A;  4XJA A;  5FYY A;  3BIW E;  5IAX A;  1JYC A;  4IE5 A;  2QCS B;  1V6J A;  1NX9 A;  4J1X A;  2XH6 A;  4QPI A;  2OPK A;  4WVM A;  2VZR A;  3WW2 A;  3MLL A;  2XVG A;  1LGN A;  3DPR B;  1FOD 3;  1URX A;  3KT4 A;  5J3U A;  5DUW A;  3PLQ A;  4Q4X 3;  4XBQ A;  3DUI A;  4IGO A;  3VHN A;  3ZYI B;  3VDB A;  4NJ4 A;  3Q8B A;  2D6O X;  5A3N A;  5C3O A;  1OLR A;  4FPF A;  4AL9 A;  3VBR B;  4CA9 A;  4WM7 A;  4DXZ A;  3S57 A;  4BE3 A;  3POG A;  4XF9 A;  3MLK A;  2V5Y A;  1G86 A;  2BDR A;  4KBZ A;  1LU2 A;  1N3P A;  1OT5 A;  2GZW A;  4JX0 A;  4LBN A;  3C8X A;  5FY8 A;  5I0U A;  4CEW B;  4E8D A;  2D3R A;  2ZGO A;  1CAX A;  2PXJ A;  4B1L A;  3MGU A;  3M70 A;  2XGX A;  1LAJ A;  2ZZJ A;  3IDC B;  3H8R A;  5EZW A;  1LEM A;  1ULF A;  3BVC A;  4AGG A;  3NAP A;  3T2O A;  5FZ1 A;  5BUV A;  1LOA A;  1HJG A;  4E4D X;  2BRT A;  2W1Q A;  4BH9 A;  1APN A;  3C7G A;  1VBE 1;  1TEI A;  3HAG A;  1S2E A;  4NPL A;  2ES3 A;  1VMH A;  1W28 A;  1F2N A;  1TME 3;  1G8W A;  3N9Q A;  2PHT A;  5GJ6 A;  3ZM8 A;  4GJZ A;  4M3C A;  2DCJ A;  4MGK E;  2XWJ B;  3VZO A;  3BN6 A;  5K0U B;  4HL0 A;  1RUI 1;  1D4M 3;  3TEY A;  4HAN A;  4DEV A;  1O4Z A;  4IXL A;  3GCW A;  1WLD A;  3J8F 2;  5IVY A;  4F3J A;  5FZG A;  3GCX A;  4ZXK A;  4CDQ B;  4KWU A;  4CCO A;  3ME2 A;  3UJQ A;  4HSL A;  1OHF A;  3T1M A;  1V9U 3;  3E6C C;  3USS A;  3MF6 A;  3K3O A;  5K9Y A;  3O0V A;  3PUS A;  1W2A X;  5FMB A;  3WVJ A;  1XSQ A;  5IFP A;  2YB7 A;  1BLZ A;  2W92 A;  3KZ4 C;  2YFU A;  4FP2 A;  2Q5T A;  1SLC A;  1W05 A;  1K5M B;  2A5Z A;  1EAH 1;  1I6X A;  2X29 A;  4B29 A;  2E6V A;  1IS4 A;  1OQ1 A;  1W6O B;  3AXD A;  3M3O A;  1YNA A;  3IM0 A;  1FPN 1;  1VR3 A;  4IV1 C;  4LIV A;  4UWD A;  3VBR A;  1LEN A;  4GH4 C;  1R08 2;  2E26 A;  2EAA A;  4Q0U A;  4Q4Y 1;  3TEX A;  3BI3 A;  1S0G A;  5AC9 3;  4XMA A;  1ASJ 2;  4CEW A;  2PFW A;  3J26 N;  3ZFF B;  2WS9 2;  1YCI A;  1MS1 A;  4XF0 A;  5JXJ A;  1ULO A;  3WNO A;  2JDP A;  3O1S A;  3I59 B;  3CMG A;  1H8T C;  3E1F 1;  4IEP A;  1C1F A;  1BEV 1;  1STM A;  4H3W A;  1A8M A;  1IHM A;  1M4W A;  5I0D A;  4JTO A;  5LWB A;  1ZBA 1;  5GZC A;  1UKR A;  1LGC A;  1UZ0 A;  4COZ A;  5JXH A;  2YU1 A;  1U12 A;  4LR4 A;  4QGN A;  2HBT A;  4FFI A;  5JSP A;  5L7O C;  3SLI A;  4XFF A;  2NPI A;  3K75 B;  2WNU B;  2ZOE B;  4GUL A;  5A6X A;  4AI3 A;  4NUB A;  2QQP A;  3E6D A;  2NYY A;  5LBE A;  2GND A;  1SZB A;  2WAO A;  4FXK B;  1VIW B;  4M4R A;  5K0U A;  3WW1 A;  3MFC A;  3DXU A;  4KBB A;  2Z4F A;  2EVX A;  3L9J T;  4YZ3 A;  2FCU A;  2W5F A;  1GV9 A;  4PLN A;  3VZL A;  1CR7 A;  4LK7 A;  1XSR A;  1XOY A;  2ZGM A;  1OLM A;  4COW A;  4KG0 A;  2PAM A;  2B9V A;  1HX6 A;  4N53 C;  3EHK A;  1BMV 2;  3W59 A;  5LY1 A;  4D6Q A;  2JG8 B;  3DYO A;  4ES9 A;  3GHM A;  2CV6 A;  4JGZ A;  2GN7 A;  5HV4 A;  5IYY A;  4D8M A;  2J1E A;  3DGT A;  1DYP A;  3AP4 A;  2X8K A;  1YQ2 A;  4QKB A;  2JE7 A;  2K0G A;  3OOX A;  1K5M A;  5A3W A;  5IVE A;  1YI9 A;  2XLA A;  3NJZ A;  4N7U A;  5FBZ A;  5C8W A;  3R4D B;  1W6O A;  4I2O A;  3B02 A;  1ULP A;  2D3S A;  4A45 A;  5JIA A;  3WP4 A;  5FOB B;  3U0Z A;  4V2V A;  4QQH A;  3P3N A;  3M2M A;  3KF5 A;  4JQR A;  3IB3 A;  3VBS B;  4ET7 A;  4BIF A;  1QJF A;  1MS8 A;  2JDA A;  5LBF A;  4MAD A;  3WQB A;  1N1S A;  4JCK A;  4MSV A;  5LRR A;  2OKX A;  5EIY B;  1QXP A;  3VGI A;  3ZO0 B;  1HJF A;  3IDA A;  1POV 0;  3M8L A;  1RTV A;  1DLC A;  4IL7 A;  3EBR A;  4F83 A;  2UY9 A;  1JXN A;  1DBN A;  2GMP A;  2BBV A;  4I3G A;  3A0K A;  4XXA A;  5GLV A;  2W52 A;  1CAV B;  4XMI A;  5T5P A;  4CCK A;  5JMC A;  3RI9 A;  3M1H A;  4RHV 2;  4OI1 A;  1RUE 2;  2P37 A;  2L9L A;  2ZGN A;  4YAR A;  1NLQ A;  2ARX A;  3Q8C A;  3ZXK A;  4CEY B;  5FDB A;  1H2K A;  1YRZ A;  3SHR A;  1A3K A;  1O5L A;  1YQC A;  3AZZ A;  4FPK A;  4OUS A;  4BLJ A;  5KC5 A;  3BIE A;  1FNZ A;  4I0A A;  1D2S A;  2ZBJ A;  3U10 A;  3GNE A;  1C8M 1;  3UES A;  3CJX A;  1DQ1 A;  1X82 A;  2TBV A;  3UGF A;  4LHK A;  4BK5 A;  1Q8O A;  2QQM A;  4FPG A;  4YVW C;  1EY2 A;  1JZ3 A;  2Y6K A;  2A70 A;  4Y1Y A;  1NA1 B;  4H7L A;  3FHQ A;  1FMD 1;  3WG4 A;  5BNP C;  2RDQ A;  1POV 1;  5F2W A;  4LO8 A;  4LPL A;  5FO7 B;  5J37 A;  2R07 2;  2W94 A;  5KWR A;  1H4H A;  5FJK A;  2PQS A;  3DCQ A;  4CP2 A;  4FP3 A;  3AC0 A;  4BPZ A;  4KG8 A;  3RMX A;  4XUN A;  1JZ8 A;  3RZZ A;  3BOD A;  2E51 A;  3SCG A;  3OGG A;  2OA2 A;  4LBK A;  4OI2 A;  1AX0 A;  3VDC A;  3K48 A;  4TXW A;  2IFR A;  3FUQ A;  1I1E A;  4IV3 C;  1LNS A;  2XLF A;  3SQO A;  5JZG C;  1H8V A;  2YDE A;  1B35 B;  4GWJ A;  2J22 A;  2WR9 A;  5FZ4 A;  3MLJ A;  2WN2 A;  1QNY A;  1HB4 A;  3PUI A;  4AHX A;  3VHP A;  4Q2F A;  4Y3O A;  4LBQ B;  4COV A;  2XOM A;  4MX3 A;  1RMU 2;  2RJ2 A;  4LKF A;  2HWE 1;  2VW2 A;  4E9K A;  3PJY A;  3NWK A;  1LU1 A;  1UZZ A;  1SDD B;  1CAV A;  3W5N A;  3NJY A;  1KFU L;  3KVA A;  4AHZ A;  2XJS A;  2XVL A;  5ABJ B;  1XC6 A;  2Y0O A;  1UMH A;  1KGY A;  1WBL A;  2R0F A;  3B01 A;  4RFT 0;  2VGD A;  3ZMO A;  2HWD 3;  4KU8 A;  3R0R A;  4CCM A;  3O1O A;  3FMG A;  1QJX 3;  2Y6J A;  1T2X A;  1ZA7 A;  4CEY A;  5BNN B;  3AYE A;  4NIG A;  1PK6 B;  1RUG 1;  4UFK A;  4PQQ A;  3W5M A;  4LJH A;  5AFE A;  3V56 A;  2WZR 2;  3WOG A;  2ORZ A;  1GZT A;  1S4C A;  1W3V A;  5LW9 A;  2HWC 1;  2E9Q A;  4Y1Z A;  5CG8 A;  5DZG A;  3PVN A;  4HMZ A;  3LSE A;  5DZE A;  3AJZ A;  4ARX A;  1VRH 1;  2MEV 1;  2WO7 A;  5KXD A;  1NA1 A;  1UOB A;  4LBQ D;  5LBC A;  1QXR A;  1HB3 A;  1J58 A;  1PZ7 A;  1C3H A;  4CU8 A;  5LCW L;  4FT8 A;  4CDW B;  4W6W A;  2XHN A;  3U4S A;  3Q9O A;  4JDM A;  4B1M A;  1O4T A;  4XFH A;  4ARY A;  2VVD A;  1AYN 3;  2VBD A;  4L92 A;  3U4X A;  2VW1 A;  3OJB A;  1X50 A;  3H7Y A;  4IEU A;  4K21 A;  1OMI A;  3T4V A;  4PLM A;  5HXM A;  4LO4 B;  1DZR A;  2R16 A;  3RG0 A;  4FOY A;  4BQY A;  2YBP A;  4YW6 A;  3TWI A;  3LGR A;  3BOP A;  5C3S A;  2IXL A;  3KGZ A;  1D4V B;  2XJV A;  1Y9Q A;  3JU9 A;  4M0H A;  5DUX A;  5EPA A;  5LK7 B;  2OUH A;  5CIS A;  5FO8 B;  4GH4 B;  5IVF A;  4M01 A;  1SFY A;  3CQO A;  5DDJ 2;  5FY5 A;  3THP A;  4LBQ A;  1RIT A;  3RJ2 X;  4HZF A;  5A7Q A;  3AMM A;  1G9D A;  4XAB A;  3U78 A;  2D6N A;  1RHI 2;  5JOX A;  2GC3 A;  2VZP A;  3H50 A;  1TME 1;  2AC1 A;  3KD4 A;  5CFC C;  4Q4W 2;  1H8T B;  2YV8 A;  3WCS A;  2XPJ A;  3KHC A;  2JIJ A;  4R8H A;  1K42 A;  2AEN A;  2VTX A;  4WM8 B;  5AVP A;  1XNT A;  2PEL A;  4BQ3 A;  5C8C B;  5SV8 A;  3ECQ A;  5KHJ A;  3SH5 A;  1GFF 2;  2VBB A;  2VZQ A;  5FZF A;  2B9U A;  1QQP 3;  4X6Q B;  1F9K A;  2BGC A;  4AVA A;  3I2D A;  5BNN A;  2VTF A;  4HKL A;  3AVR A;  3USU B;  3POI A;  1H1M A;  4DMI A;  4MVT A;  2RM2 2;  1AXY A;  2RJL A;  2FDG A;  3I97 A;  4LUL A;  4UYB A;  3O1V A;  1LRH A;  4XYX A;  5LBB A;  3IPV B;  2PHU A;  2QQJ A;  1LOF C;  1PO1 2;  4QPI C;  1S0J A;  3J7N A;  4DB5 A;  4CCL A;  4OUM A;  4O61 A;  4GB3 3;  4PF5 A;  1PVC 3;  4A44 A;  1AR7 3;  1OQE A;  2CWS A;  1ENR A;  5LY2 A;  1KRI A;  1WW6 A;  4UOJ A;  1BVV A;  4N53 B;  1ZRC A;  2ZHK A;  1IG3 A;  3LA2 A;  1F35 A;  5F3C A;  1OFN A;  2FDH A;  2WWU A;  1E5R A;  1LEC A;  1UKG A;  2DWR A;  1VBE 2;  1GWL A;  2J7M A;  2WT1 A;  3HIF A;  5AC9 1;  2J1U A;  2ZGQ A;  4KNC A;  5JMO A;  5CAD A;  2R30 A;  1HLC A;  3BAL A;  4NOT A;  1JYV A;  1WUV A;  3U11 A;  1JYX A;  2E32 A;  2QZ3 A;  1VPH A;  2WKK A;  3MO4 A;  4YZ5 A;  5IVJ A;  3NAP C;  4KL1 A;  4IV1 A;  5KXB A;  4RL7 A;  1OH3 A;  1A78 A;  4C8D A;  2WSU A;  5JUV A;  4DZG A;  2JDY A;  1N1T A;  1E5S A;  4GH4 A;  4XCA A;  3V0A B;  3RWN A;  1W0O A;  1JZ4 A;  2DTY A;  1H6X A;  3UKT A;  1ZYB A;  2R6Q A;  3N7M A;  2D43 A;  5F3I A;  4AFD A;  3JB4 C;  3D5O A;  1LB2 A;  1Q8P A;  1C28 A;  2FDF A;  1TNF A;  3ZKY A;  3POB A;  3RZG A;  4IET A;  5E16 A;  1H8T A;  1HV0 A;  1W8U A;  1AR9 1;  4CE8 A;  2CAU A;  1LHW A;  2OZ6 A;  3MV1 1;  1OKQ A;  1KQR A;  1VBE 3;  1FAT A;  2A6Z A;  1C4R A;  3PJQ A;  2CU5 A;  2VCC A;  2HWB 1;  2AEY A;  2D6L X;  1GUI A;  2RDS A;  1SHW B;  5CEH A;  5L7O A;  4FFH A;  1RVF 2;  1UY3 A;  4QX2 A;  1VJ2 A;  3USU A;  5CFD B;  1GZW B;  5BV6 A;  1SG3 A;  3W21 A;  5E8A A;  5AVA A;  1FPN 2;  2J1A A;  2XQR A;  4QX3 A;  3VKF C;  1QMJ A;  4OZO A;  1RUI 3;  1VBC 1;  2X10 A;  3LE0 A;  5EFU A;  2ZTN A;  5FZ6 A;  4CVU A;  4HOO A;  2Y8K A;  3IPV A;  1W2U A;  5IFT A;  1H1A A;  2E53 A;  2CSG A;  1PO2 1;  2HWF 1;  2B42 B;  4BXS V;  4CPB D;  3DPR C;  3JZV A;  1WCS A;  2ZEW A;  2YYO A;  3EB7 A;  1S55 A;  4L0P A;  4XUQ A;  2VMI A;  1MS4 A;  3VZK A;  1W9W A;  1UIK A;  1BEV 2;  3WNX A;  3P3P A;  4LBJ A;  4N53 A;  4BOW A;  4A4A A;  1OVP A;  3WEZ A;  2ILM A;  1DQ6 A;  2P3K A;  2D93 A;  2HEY F;  3MPB A;  3T1L A;  1POQ A;  4LIU A;  3MZH A;  1FV2 A;  3KV9 A;  4QB1 A;  1EAH 3;  4QQO A;  3RRD A;  2VZU A;  4RA0 A;  1EYB A;  1AR6 1;  1AZD A;  1OA4 A;  1SLI A;  2GN3 A;  2D44 A;  4Q8K A;  2VMH A;  4JRA A;  1FPN 3;  1UZW A;  3ZXD A;  1LGB A;  3U37 A;  4TSV A;  4XF1 A;  3GJB A;  5LRS A;  4XIO A;  4Q4Y 3;  4LHL A;  3ASI A;  1SAC A;  1ZVF A;  4Q1R A;  5EJ3 A;  1CN1 A;  2PLV 2;  2VBP A;  5IK5 A;  4DPN A;  2N7G A;  1OLQ A;  1TNR A;  1REF A;  3RJR A;  1FX5 A;  3S7I A;  1LOD A;  3I2I A;  4XEZ A;  3OD0 A;  1F5J A;  1Z7S 3;  1NLR A;  4M4P A;  2OX0 A;  4AQ2 A;  1BEV 3;  4JRL A;  4QDR A;  4LE4 A;  4ZON A;  2C6S A;  4QKD A;  1O5U A;  1BK0 A;  3DYM A;  4QAW A;  4WBB A;  1ZBA 3;  5K0U C;  2H6B A;  2VCM A;  4URT A;  3ZSM A;  1W6Q B;  2BV4 A;  5JAX A;  1O7F A;  3OEB A;  5BNO B;  1S0D A;  3KS7 A;  1V6K A;  1MS5 A;  3HBZ A;  4FFG A;  4FPH A;  1PNF A;  2BNN A;  1LHV A;  3P6B A;  3VHR A;  4FBF A;  4L9B A;  2D5F A;  5F3G A;  3KCC A;  2Q30 A;  5FQ0 A;  3BTZ A;  2DU1 A;  1V0A A;  3UV9 A;  3D4K A;  3IAP A;  3VBO B;  1TMF 1;  5IK7 A;  3LDR A;  1W39 A;  2AAC A;  1YQ8 A;  4AEM A;  1GP4 A;  2H6C A;  4HPK B;  4YVW A;  5A7N A;  1KDK A;  4BQW A;  5DG2 A;  1EUU A;  1K3I A;  3III A;  2LUW A;  2VMF A;  3LCP A;  3PUH A;  4RFR B;  5BNP A;  3NRU A;  2B39 A;  4NRP A;  1PHM A;  4UT5 A;  1JZ2 A;  1SPP A;  5FY1 A;  2ORX A;  3JUU A;  3AKS A;  3ZSL A;  4YW1 A;  3GBW A;  1JH5 A;  2VTX J;  3T0B A;  2RMU 2;  3JBG 3;  4M00 A;  1CZS A;  1PX4 A;  3ZFF C;  2Y64 A;  3WDT A;  3WW3 A;  2BJS A;  5FOJ B;  5KHK A;  2VO5 A;  5FP4 A;  2JD9 A;  4QU1 A;  4TZD A;  4XXP A;  5H9S A;  2ZKN A;  4AQT A;  3B69 A;  5CAZ A;  5JOY A;  4GAZ A;  1JHJ A;  5APA A;  3O1U A;  3RS6 A;  4XF4 A;  1ZZC A;  3MHZ A;  4Y24 A;  3O1M A;  3QBQ A;  5JZG A;  3G7D A;  3MIH A;  4FO9 A;  2BQP A;  4N8M A;  3T3Y A;  4HLT A;  4E4H A;  3MID A;  1BQP A;  3RMY A;  5CKN A;  4MGS A;  4XDP A;  2WNU C;  3P5B A;  4S2H A;  1MS0 A;  1JYN A;  2D6K A;  1QJX 1;  2BNO A;  1LR5 A;  2G9G A;  3ZLI A;  1AX2 A;  1U5X A;  2VZT A;  1EV1 1;  3KVB A;  4KH9 A;  4LA3 A;  3ETP A;  4YW5 A;  5LA2 A;  5T54 A;  1W0N A;  5F5C A;  2ET1 A;  4RSU A;  2XVK A;  5BNO A;  1X33 A;  1KD7 A;  3NKG A;  1OA2 A;  5D21 A;  3K4D A;  5GLU A;  2GAU A;  4LA2 A;  4X6R B;  2JEM A;  3AFK A;  4LIT A;  3SXW A;  3S0M A;  4W4Z A;  1W8N A;  3ZSJ A;  2JG8 C;  1COV 2;  4LBL A;  1OSG A;  4QGM A;  4NID A;  3HN1 A;  4A6O A;  2Y34 A;  1C8M 3;  4M3C E;  1BXH A;  1ZZ9 A;  3VBO A;  1H2M A;  2Y38 A;  2IWG B;  1V00 A;  2PQQ A;  4CSW A;  5FPX A;  1DYO A;  3T0D A;  3AKP A;  4WVV A;  4YLZ A;  1Q8S A;  3RNS A;  3GBF A;  3QLQ A;  1FMD 3;  3WT3 A;  4HPK A;  1US2 A;  1GNH A;  1DLL A;  1VBA 1;  2ZMN A;  4QHO A;  4E2Q A;  1UNB A;  5FZ7 A;  1U5Y A;  3PVE A;  3VV1 A;  4BQX A;  2VD7 A;  1AJO A;  2HWE 2;  2RS1 1;  4PQ9 A;  3WF3 A;  4WVW A;  2K46 A;  4QXK A;  4FPC A;  4AR2 A;  2OUJ A;  3KV4 A;  3K3N A;  5FP7 A;  3GHN A;  3VBS C;  1R1Z A;  2W39 A;  1LTE A;  2WT0 A;  1CX1 A;  1YEW A;  4XFG A;  1LOB A;  4LXL A;  1VRB A;  3PUQ A;  2XLG A;  4NRM A;  1GR3 A;  1OOP C;  3FBM A;  1UY0 A;  4K8F A;  1PMI A;  1GOF A;  2J42 A;  4C1W A;  1RUG 2;  4UFI A;  5J98 B;  1GP6 A;  1N1Y A;  4W6Y A;  2K2S A;  3AKQ A;  3LKJ A;  3OUI A;  2HWC 2;  2XL9 A;  1MQT C;  1JHN A;  1OPO A;  1W9F A;  1RUC 1;  2TEP A;  4K7J A;  4Q0V A;  2PYT A;  1UMI A;  3WG2 A;  1VRH 2;  4O65 A;  1Q8Q A;  4MXW B;  5EXO A;  5FYV A;  2LRO A;  2WZE A;  3TNQ A;  4QDQ A;  3ATG A;  3FBY A;  2EXH A;  2XJP A;  4N9I A;  1KDM A;  2HWE 3;  3GAL A;  1QKQ A;  2FD8 A;  4NWV A;  1FOD 2;  3G6J B;  3H1W A;  5A3O A;  1PZ8 A;  3AMQ A;  3HWJ A;  3OBA A;  1PM7 A;  2DDU A;  4JTN A;  1IOA A;  4Q5O A;  3AZX A;  4AWD A;  1RUH 1;  4CUB A;  5GLT A;  4JDN A;  2PHF A;  4A3X A;  5B2G B;  4Y1X A;  3AMN A;  1DP0 A;  3SH4 A;  3WHT A;  1G9B A;  1NA1 C;  1XXN A;  4QPW A;  4P9W A;  1HQL A;  1VB2 A;  1NZI A;  1RUG 3;  4F8A A;  4ASM B;  1WW4 A;  4GB3 1;  1RUJ 3;  1F5F A;  2ATF A;  1PVC 1;  2ZGT A;  4Q4V 1;  4SLI A;  5FZK A;  1ZA4 A;  4F7Z A;  2RR1 1;  5BPX A;  2HWC 3;  4ORF A;  1X36 A;  3J7H A;  4XTP A;  3FL7 A;  3DEC A;  5F32 A;  4BWO A;  3AZW A;  1VRH 3;  2MEV 3;  2VH9 A;  2ZPX A;  4YRD A;  1WA4 A;  3MFA A;  1LOF A;  1VAL A;  2E7Q A;  2VNR A;  5G04 L;  3S7E A;  3H8O A;  5JR7 B;  3B00 A;  1OLM E;  1Q8V A;  2LTN A;  1IPS A;  4BDV B;  2IXI A;  3CJI B;  3ON7 A;  1TME 2;  3RQ0 A;  5EP9 A;  4P9L A;  3HNY M;  3EMR A;  5FYM A;  4DY3 A;  1AR8 3;  1B35 C;  4ITC A;  2P3J A;  4R9B A;  3ZDS A;  1KFX L;  4QQL A;  2LM3 A;  3BGA A;  5JVV A;  2JB4 A;  1I5P A;  1W6P B;  1YJK A;  1D4M 2;  1HKD A;  2DCK A;  1K45 A;  2BGO A;  1JZ5 A;  1IG0 A;  1YFU A;  2VAU A;  3OB8 A;  1RL3 A;  4A41 A;  3RYR A;  1OUR A;  2VME A;  4NO4 A;  2WO1 A;  1QOO A;  4K8R B;  3GZT B;  4P9Y A;  1V9U 2;  3VDD C;  4S2G A;  4O9E A;  2E33 A;  2AGS A;  1IKP A;  4V2W A;  5ABJ C;  3NV3 A;  3RZK A;  1JUI A;  4MXW A;  2EA7 A;  5JWP A;  1W6N A;  5FMO L;  3I8T A;  5J48 A;  4TWT A;  5BNN C;  3WF2 A;  5J96 B;  1NY7 1;  3HT2 A;  3VZJ A;  1PK6 C;  4ATF A;  1NAE A;  5DAW A;  1M06 G;  5IAV A;  1SLL A;  2IXK A;  4E2S A;  5A32 A;  4XDO A;  1X9P A;  3K4Z A;  2WYS A;  1CJP A;  2GDF A;  3KMH A;  1O3S A;  4NRQ A;  4HVO A;  2FHR A;  5CA6 A;  3ORJ A;  1JOP A;  5I0T A;  1WMF A;  2JKB A;  2W46 A;  2R49 A;  3AYC A;  4KWK A;  1CWP A;  1W8Z A;  2Y6F A;  4Q0Q A;  4NMI A;  3X29 B;  5AC9 2;  1GP5 A;  1UOJ A;  4CDW C;  5FZ0 A;  5J09 A;  4BQ5 A;  1A6C A;  5JOZ A;  3ZXE A;  2BOJ A;  1O8S A;  2ZCW A;  4XC9 A;  1TG7 A;  2GC1 A;  4FTB A;  4FI9 A;  1Y9G A;  4Z2W A;  3HBK A;  1UZY A;  1CVN A;  1MAC A;  4IDZ A;  2VZV A;  4MH0 E;  1LED A;  3DPR A;  2E7T A;  2W95 A;  3I2G A;  4Q0S A;  1HXS 1;  1DDL A;  1OUX A;  1VLN A;  3AZY A;  3ZYF A;  1IQA A;  4FPE A;  4JGY C;  3WR0 A;  1GIC A;  4XUP A;  4JKK A;  4I01 A;  1FAY A;  2GMM A;  4AAX A;  5HCH A;  1UW8 A;  2V5D A;  4XVH A;  2BVV A;  1W6M B;  5A1L A;  1JU3 A;  3O5S A;  3CIH A;  1WW5 A;  2FCV A;  2F4L A;  3OTF A;  1WLC A;  4JHZ A;  4ZY9 A;  2Q1Z B;  2ZEX A;  5KR7 A;  3V0B B;  4DS0 A;  1SLA A;  5FLJ A;  4AZZ A;  2A6Y A;  5FZ8 A;  1Z7S 1;  2ZKL A;  4UW3 A;  4BB3 A;  5G05 L;  1L7Q A;  4WM8 C;  2DVA A;  2GSY A;  5C8C C;  4TLF A;  4Y33 A;  3UT0 A;  1JOD A;  2HWF 2;  1PO2 2;  4K20 A;  4PLO A;  1VBB 1;  4UF0 B;  5EV7 A;  1CD3 G;  4K40 A;  1MZE A;  1ZX5 A;  1OH4 A;  5C3P A;  4YW2 A;  2X53 S;  1CAW B;  5A3L A;  4XJW A;  1J1L A;  2YHJ A;  4LHN A;  4OMD A;  1AR9 3;  3HQX A;  4HKO A;  2KM2 A;  3AP5 A;  2QE3 A;  3VBU B;  2YGM A;  1D0G A;  5H9R A;  4UI9 L;  5ISL A;  3FLT A;  2HWB 3;  3ZMN A;  2ZML A;  1QJY 3;  3RVH A;  1QJU 1;  3I2H A;  3U07 A;  1CZT A;  1RGS A;  1HW5 A;  3KCY A;  3TOJ A;  3ZXA C;  2JG9 B;  2EIE A;  3ACI A;  4E2G A;  1AR6 2;  3NL1 A;  3N9M A;  4LBO A;  4N9H A;  4A3Z A;  4S2F A;  1QH7 A;  2DVB A;  1VBC 3;  4AQS A;  2UU8 A;  4S2D A;  4PIY A;  1ZZ7 A;  4ERO A;  5A3P A;  2HWF 3;  1PO2 3;  2W1W A;  1KJR A;  3VBH B;  5GZG A;  3RPQ A;  3H8X A;  2R04 1;  3JBG 1;  3QH7 A;  1DQ0 A;  3ES4 A;  5D1I A;  4YNI A;  4O7X A;  4JKL A;  3AP9 A;  3JB8 A;  2Q8E A;  1N3O A;  4QPY A;  4DXS A;  4P5Y A;  1NT0 A;  3M3Q A;  3V65 A;  3HMY A;  4E8C A;  3MI8 A;  5H9P A; 
#chains in the Genus database with same CATH homology
 5A80 A;  3OPT A;  5IVF A;  4LIT A;  5FZO B;  5FY5 A;  3PUS A;  4HON A;  5A1F A;  2YBK A;  5IVB A;  5FXZ A;  4LIU A;  3KV9 A;  5FPB A;  5A7Q A;  4QXB A;  2XDV A;  5FV3 A;  5IWF A;  3U78 A;  4AAP A;  4CSW A;  5ANQ A;  5FXV A;  2XXZ A;  4XDO A;  3N9P A;  5FYU A;  3PU8 A;  4EZH A;  5FYT A;  4QX7 A;  5A3T A;  4CCN A;  4EZ4 A;  4QX8 A;  5FJH A;  4LIV A;  4DO0 A;  5FZ7 A;  5F2W A;  5FYB A;  4IGQ A;  5FP3 A;  5FZI A;  5FZD A;  2VD7 A;  3ZPO A;  5FXW A;  5FJK A;  4URA A;  5FZF A;  4GD4 A;  3AL5 A;  5FZH A;  5FZA A;  4UF0 A;  5FZ0 A;  3N9O A;  3AVR A;  3KV4 A;  3K3N A;  5FP7 A;  5FYS A;  4BIS A;  3LDB A;  2OX0 A;  4LXL A;  1VRB A;  3PUQ A;  4BXF A;  5FYZ A;  3LD8 A;  5FYC A;  3N9N A;  4CCL A;  5LWB A;  3PDQ A;  5F3E A;  2XML A;  2YU1 A;  5IW0 A;  4Y4R A;  5LY2 A;  5F2S A;  3KV5 A;  4IGP A;  5FZE A;  5FUP A;  5A7W A;  4CCJ A;  5IVC A;  4BU2 A;  5FZ4 A;  4GJY A;  5FYY A;  4QXH A;  3PUA A;  2P5B A;  5FY7 A;  4NUB A;  5FP8 A;  5F3C A;  2WWU A;  5FYV A;  5FPA A;  4TN7 A;  4Y3O A;  5F3G A;  2OQ7 A;  3N9L A;  5FPU A;  5FYH A;  3DXU A;  5A1L A;  5FZ9 A;  3UYJ A;  5KR7 A;  5A7W B;  4IGO A;  2YBS A;  3NJY A;  3OPW A;  3PTR B;  3KVA A;  5FZ8 A;  5A7N A;  4D6S A;  5A3N A;  5IVJ A;  3K2O A;  4AI9 A;  4C8D A;  5FZC A;  3AVS A;  5LY1 A;  4Y33 A;  4D6Q A;  5CEH A;  4CCM A;  5FZO A;  5FY1 A;  5FY8 A;  2OQ6 A;  5FY9 A;  4UF0 B;  5FZK A;  4EYU A;  2PXJ A;  5F3I A;  5FZM A;  2WWJ A;  5A7S A;  5FP9 A;  5FY4 A;  5IVV A;  3DXT A;  5F32 A;  5A3W A;  5IVE A;  5F5I A;  3PUR A;  5A7P A;  4QWN A;  5FP4 A;  5LW9 A;  4QU1 A;  5FZ1 A;  2GP5 A;  5FBJ A;  2YU2 A;  3AL6 A;  4QXC A;  2W2I A;  5ISL A;  4GAZ A;  5FPV A;  3RVH A;  5FUN A;  4V2V A;  5FZL A;  5F37 A;  2OS2 A;  5FY0 A;  2YPD A;  3U4S A;  3N9M A;  3KV6 A;  4DIQ A;  5K4L A;  3N9Q A;  5FYM A;  5F39 A;  4ASK A;  4CUG A;  4E4H A;  2Q8D A;  2OT7 A;  4GJZ A;  4XDP A;  5FZ6 A;  3PU3 A;  4D6R A;  4HOO A;  5FWE A;  5A3P A;  5E6H A;  3ZLI A;  2YBP A;  3KVB A;  5IVY A;  5FYI A;  5FZG A;  5FZB A;  2Q8C A;  5FWJ A;  4CCK A;  4CCO A;  5F5C A;  2XUE A;  2Q8E A;  5FXX A;  5FPL A;  2GP3 A;  4V2W A;  3K3O A;  5FZ3 A;  5A7O A;  5F5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...