5FZLA

Crystal structure of the catalytic domain of human jarid1b in complex with 3d fragment 3-methyl-n-pyridin-4-yl-1,2-oxazole-5-carboxamide (n09954a) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
462
structure length
452
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with 3D Fragment 3-Methyl-N-Pyridin-4-Yl-1,2-Oxazole-5-Carboxamide (N09954A) (Ligand Modelled Based on Pandda Event Map, Sgc - Diamond I04-1 Fragment Screening)
rcsb
source organism Homo sapiens
total genus 137
structure length 452
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzlA01
4GJYA 3KV4A 4D6SA 5ISLA 2Q8DA 2YBKA 5F39A 4E4HA 5FZ6A 5CEHA 5F3EA 5F3CA 3K2OA 5FYYA 5A3PA 2YPDA 4UF0A 5FYZA 5A7PA 5A3TA 5FXWA 2OS2A 5F3IA 5FYTA 5FP3A 4D6QA 3UYJA 5FYHA 5A7WA 1VRBA 2Q8EA 4V2VA 3DXUA 2XDVA 5FP8A 5FZ4A 5IVFA 5K4LA 5A80A 5FZOA 5F5AA 4V2WA 5A1LA 3ZPOA 4DIQA 4CCLA 4HOOA 5FPAA 4DO0A 3AVRA 3AL5A 3U4SA 5FXZA 4CCNA 5FPLA 5A1FA 5FXVA 5ANQA 5F2WA 5FPUA 4XDOA 2XXZA 5FUNA 4CSWA 3N9OA 5LWBA 3N9NA 3DXTA 5FJKA 5FP9A 3PDQA 5A3WA 5F5IA 5FY0A 2YBPA 3KV6A 3K3OA 3NJYA 5FP4A 5FZGA 4XDPA 4LITA 4QXHA 3U78A 3PUSA 4EZ4A 4QX7A 2W2IA 4CCMA 5FY5A 5IVVA 5IVCA 3AL6A 5IVJA 4UF0B 4BXFA 4D6RA 2VD7A 2P5BA 2OX0A 4AI9A 3N9LA 3AVSA 2XUEA 4AAPA 5FWEA 3PURA 2PXJA 4QU1A 4CCOA 5FZ1A 4Y33A 5F3GA 3PTRB 4IGPA 5FP7A 5FZMA 5IVEA 3K3NA 4IGQA 5IWFA 5FZIA 4QWNA 5FZDA 2OT7A 5F5CA 2WWJA 5FZOB 5A3NA 5IW0A 2GP3A 5FZ7A 5KR7A 3N9QA 2OQ6A 5FZKA 5FY1A 5F37A 3KVAA 5FZEA 2YBSA 4QXBA 5FY7A 5FWJA 3N9PA 4GJZA 5FXXA 5FUPA 2GP5A 4LIVA 5FZ9A 4URAA 2YU1A 3OPWA 5FZBA 5A7SA 5FYIA 5F32A 5FYCA 4GD4A 5FZ8A 2WWUA 4EYUA 2YU2A 5FPVA 3OPTA 3ZLIA 4Y4RA 5FY8A 4ASKA 4LXLA 5IVYA 3PU3A 5FZHA 4LIUA 5A7NA 5LY1A 4TN7A 4CUGA 5FBJA 5FYMA 5A7WB 3LDBA 4C8DA 5A7QA 4BU2A 2OQ7A 3KV5A 3N9MA 5FY9A 5FZ0A 5FZLA 5FZAA 5LY2A 4CCJA 5F2SA 4EZHA 3KV9A 2XMLA 5FYUA 3PU8A 5FY4A 5FZFA 3PUQA 5LW9A 4CCKA 4GAZA 2Q8CA 4NUBA 3RVHA 3KVBA 5IVBA 3LD8A 5FV3A 5FYBA 4QXCA 5FJHA 5A7OA 4BISA 3PUAA 5FYVA 5FYSA 5E6HA 5FZCA 4Y3OA 5FZ3A 5FPBA 4HONA 4QX8A 4IGOA
chains in the Genus database with same CATH superfamily
3MYXA 2JG9B 2EICA 1QNWA 1GOFA 4B4QA 1F8VA 1W8UA 3K46A 5JUVA 2ZA9A 3WDTA 1A8MA 3N7LA 4YGEA 2D6PA 1G9FA 4UW5A 4X8PA 3W5MA 4LK6A 4MXVA 2VTXJ 5FMOL 2D44A 1UOGA 4XFIA 4RS5B 3K51A 5A3LA 4Q1PA 5A3TA 2GC3A 4LBKA 2RJLA 1UYPA 1O4ZA 1REFA 1UOBA 1UY4A 5J96B 3EMRA 2XVGA 1FPN3 1ZBE1 3ATGA 1S0CA 2Y6GA 4ZZ5A 1OSGA 4QD2A 2R1DA 3OD4A 5FYHA 3RI8A 3BI3A 4JTNA 3KT1A 2GN7A 5DXDA 2D6OX 4K9SA 3S6PA 4LKDA 4BQ2A 5T50A 4CCLA 1O4YA 4Y1ZA 3KMHA 4MSVA 4U2AA 3R05A 1CVNA 1Y9GA 3A23A 1DYOA 1QJFA 2CY6A 4KWLA 4RN5A 3VDCA 4UFMA 5L7OB 3OJBA 4WM7B 1RUNA 2GMPA 2K9ZA 4GIQA 4COYA 3BALA 4Q0VA 1LOFC 1SLIA 3ITQA 4XUTA 3ZKUA 1RUD2 5LK5A 5JPMB 1LULA 4X6RB 4ZS2A 5C9AB 1VB2A 2D98A 4PI0A 3NMBA 1GZWB 4IETA 4LE3A 1BEV3 3WT3A 2E32A 2OUHA 3I3MA 5IT6A 3O1SA 3RYRA 2PHUA 5DAQA 4SBVA 1HRI3 2PTMA 2BWCA 4I09A 1NXD1 3LKJA 4RHV2 4LK7A 4GMP3 4N90A 1OQ1A 1LESA 3ZR6A 4YZ5A 1HJGA 5FWEA 5L9VA 3E6BA 4IV3B 3LDKA 1QQP1 1NOVA 5FP7A 3W5NA 2Y6JA 5CBLA 4XTPA 3FWEA 3BKZA 2ZGNA 3ROUA 3ZN5A 3GYDA 1DCSA 2DFBA 3PTYA 4XF1A 5HXMA 2JDAA 3GHNA 1UY0A 2XLAA 1VBD2 2YBSA 4YW4A 3D5OA 3MZHA 4GB31 2VVDA 1TE1B 4RL7A 2ZAAA 3D3AA 3J8F2 3O0WA 2V4VA 5DG2A 4ZXKA 5KHKA 1OH4A 2VW0A 4HBNA 2FMYA 5ACA2 5CB7A 5DMYA 2XWJB 1W6NA 2XLGA 4QQOA 3ZXLA 5K0UB 4MVTA 3OPTA 2QVSB 5C9AC 1US2A 1MVQA 2VZ3A 2ZEWA 3Q8EA 4Y4RA 3LEMA 1EV12 3CBNA 3JBG2 5D1IA 3WP3A 5FO9B 3OYWB 1XYPA 4N8MA 1F5FA 2V09A 1HQLA 1BBT3 1VBC1 4YWAA 1JYXA 1S55A 3WV6A 3DN7A 1JN2P 2CV6A 5GLZA 3U37A 4FOQA 3UT0A 4BU2A 1VIWB 3HPNA 2XQRA 3ASIA 2LS6A 3POGA 1Z0HA 1CWPA 4QDRA 1EP0A 1QMJA 3PIGA 4IV3C 5EHDA 1KEXA 2B42B 3DPRA 3NAPC 3S7EA 4XJUA 5FZFA 3PUQA 1F35A 4F83A 1WW6A 1YJLA 3OBAA 5CFCA 1CX4A 1ASJ1 2YMZA 2E7QA 3R4UA 3B7MA 1KQRA 1XB9A 1QF3A 2RDQA 1AR81 3HN1A 4QX5A 3I59A 5FPBA 1VBE3 2OPKA 1M06G 3MUZ1 1W90A 2WYFA 4NMIA 4L9BA 4XJ8A 5LASA 5IK8A 5A3OA 3I54A 2VBPA 4NPRA 1AUYA 3PLQA 1OVSA 3VD5A 4RSUA 4ES8A 5FZ6A 1HW5A 3FL7A 1B35A 4UF0A 5K0UC 1OUSA 1WCQA 1LJ7A 1R64A 1TME3 3AMNA 3I4IA 5H9RA 3N4MA 1NCQA 5DABA 2VZRA 2XJRA 4UWDA 1CN1A 1LODA 3ZSJA 4BK4A 4WVMA 2FDJA 2VU9A 1LKNA 2NZ9A 5LA0A 3S30A 4Z1VA 4IV1B 2IXLA 3AP9A 4FOWA 5C8CC 4EE2A 3THCA 3WQBA 5CKQA 1L3JA 4AAXA 5EIYB 4JGZB 4MGZE 4BA6A 3Q8FA 5GJ6A 1GU3A 1YFXA 3D0JA 2R6QA 3WUDA 4DEQA 1OQDA 3KT4A 2R072 3ZYJB 4CDXA 1QJX2 3ZO0B 4N43B 1L7LA 1SCSA 4P9GA 2WS93 4LLFA 1O7FA 2ADDA 3NJYA 1XJAA 4Q4W3 5DAPA 4DNYA 4NRMA 1F5JA 1PMJX 1ULDA 4AFAA 5EZWA 3JD72 4BLJA 3T1LA 2P3YA 5IVJA 2HWC3 1EAH2 3U1XA 2BEOA 1PVC3 2IWGB 4J1XA 5L9RA 2W47A 1KXGA 4CDQB 3SQOA 2BOJA 5DN2A 2VMGA 3KCCA 3BYWA 1QOOA 2XBO1 3VBSC 3W58A 3ZFFC 2EA7A 3TEXA 2VCBA 4YZ2A 5IWFA 4JQTA 1PMIA 1O4TA 5LB6A 4M3CB 2NM1A 2Y0OA 2OUJA 2ORZA 4LKSA 4GH4B 3W59A 1H6YA 3IIAA 2KXLA 3HOBA 2IXCA 3KCYA 1WCSA 3VB9A 3N9PA 1EPWA 2W1SA 5C33A 5JOYA 4FSJA 1BKZA 3I8TA 5HCHA 3DYOA 5FYIA 4BM8A 3VBOB 3T2TA 1SLAA 3LIHA 4OUMA 3IDCB 4WZFA 1R092 3WEZA 1CZSA 2JJ6A 4XYXA 4N43C 3RZZA 1LHVA 1HN0A 4XHXA 2R32A 3WY6A 1SMVA 3UETA 5FYMA 2VW1A 4OZXA 3RRDA 2V5YA 2AENA 1AR63 3R4SA 4PDWB 5GLWA 3UESA 3PVOA 1H6XA 3MICA 2RS52 1E5HA 2NYYA 1IQAA 4CDQC 2J1UA 4QDQA 2QJVA 1PMHX 3KGZA 4BYYA 5KHIA 3CHXA 1PM7A 2A6ZA 1U0AA 4HSLA 1W05A 4NUBA 5A6ZA 3BU0A 5FYBA 2X8KA 1ZRIA 3WHUA 4LMFA 3H3ZA 4FP2A 1TMF1 1RUI1 3RMXA 4KWUA 2ZEYA 2W1QA 2ZMLA 2Q4SA 4XCBA 3LE0A 2Z4FA 5FMOS 3WW2A 2JG8B 2WZPP 1CAUA 4E4HA 4QKFA 3HT2A 1WD4A 1OA3A 2J1TA 1AXYA 3KSCA 2W94A 3OGGA 4YSFA 2J1SA 2DCTA 1LOBA 1CX1A 3VDDB 4NIIA 4BQXA 2RHPA 3IDEA 4IEVA 1AYM3 2D6NA 2AREA 2PYTA 1ND2A 2GMMA 1FAYA 1MEC3 1YQ5A 2HLEA 3AX4A 3DXUA 3MF6A 4FPCA 3I97A 5C70A 1REDA 1SCRA 2Y60A 3D82A 5F5AA 4DIQA 2WNEA 3LFIA 4P9YA 1G86A 4HKLA 1Q8OA 4UW6A 4M4RA 4XQDA 1VAKA 2J1RA 5LBFA 3U11A 3ZDVA 4PLMA 1JU4A 1RUF2 1H1IA 4NAMA 4LHLA 5FLJA 4WVWA 2DCZA 1VBB3 3VLBB 1W6MA 2AACA 1HDKA 4YM2A 2VUAA 5K8SA 1K3IA 4LITA 5JXHA 5G05L 3ZYGA 4IEYA 1H8TA 1EY2A 3I2IA 3PVEA 4YGDA 5E1RA 4FOYA 4ZU4A 3B69A 4K40A 4LOSA 3KHBA 5JMCA 1DU3D 3J9SA 4DINB 3AMMA 1FOD2 1HIXA 1WWYA 2P5BA 3CJXA 5A1AA 3PNAA 2XUEA 3PMEA 1C1LA 2WSVA 2QE3A 3JUUA 3MW2A 2VNGA 2BOIA 2JKXA 3UV9A 2YV8A 1AL22 2FMDA 5IVEA 3DV8A 4NVPA 2JE8A 4BLIA 1SFPA 4NIHA 4K8FA 3E1F1 3USUB 4QGLA 2GP3A 2PHFA 3VD4A 3TEYA 2VCAA 2DFCA 4XJWA 2VZUA 5FMDA 3GHMA 2TBVA 3BU7A 1U12A 2RM21 3PJQA 1V0AA 4J6GA 4XDQA 4OI1A 3SXWA 5IAXA 3GGLA 1R083 3VBHC 4QPYA 3BTAA 3HQUA 4AI2A 4WM8B 1XE7A 1LOAA 1GP6A 3MLKA 2AR6A 2NLRA 1N1YA 3UJQA 5CYYA 1EUTA 1XBFA 2W87A 3WW4A 2WFPA 3GXUA 2C5DA 4UFIA 4XTMA 3FFQA 3HJRA 4LIUA 3AFKA 1XNKA 2UY9A 3A4UA 4RS5A 4XJAA 1CPNA 4Y1YA 4HL0A 2HBTA 4CXYA 4FPFA 3KM5A 5A7QA 3H50A 2B46X 4P9IA 5AC91 1LOCA 1HKDA 1E57A 4JAAA 2H6CA 4YFWA 5J09A 1YO8A 3NJZA 1RITA 1W9WA 3I3DA 3KF5A 3RI9A 2F4PA 3ZXKA 5FV3A 4XQWA 5L7OA 2HKXA 3CJIB 1LHNA 4WM7A 3V56A 5EQUA 3ZYPA 2G9GA 4BJ0A 3MW4A 2BBVA 2WINB 1G9BA 4JVAA 5EP9A 1NE6A 1MS3A 2WT0A 3ACGA 4EROA 3T3YA 1K5MB 2QDNA 1GZWA 4XHBA 1D4VB 1TG7A 2F17A 1V9U3 4FOVA 5FO7B 4OHXA 4CCDA 4QAWA 4XAAA 4FPYA 5HV0A 3EO6A 1RUH3 5E88A 5JZGB 2D97A 3I2JA 4BQWA 4LBQB 2OS2A 2HWE2 2TEPA 3H8RA 1ENQA 1XC6A 5C3PA 2ZGPA 3OY8B 2ILMA 1ZA7A 3IZOA 4Q4Y3 4AEDB 2FBEA 2RS32 3I2GA 3MI8A 3H0OA 2ARCA 4AEMA 4LQRA 2R7EB 5FP8A 1CAWB 3BUCA 1WW4A 4ITCA 1ZM1A 2BERA 1NY71 4NIAA 2GH8A 4GZ9A 4GKXA 1PM4A 5F2WA 3AFGA 4INDA 4MHRA 5FBZA 2XKPA 5JXIA 3OUJA 4CA9A 3IWZA 1AYN1 3DGTA 3TN93 5A3WA 1DP0A 2EF6A 5CNAA 1Q8VA 2QCSB 2WL1A 3JCIA 2CWSA 5T5LA 1ST8A 3KT7A 3RPQA 1BMV2 2X53S 4A6SA 2D6LX 1HRV1 4D6RA 3OYWA 2P6CA 3VBRB 2VMIA 4QPWA 1OLQA 3N9LA 4FT8A 3VHPA 4YZ3A 1AR92 3AK0A 1O3QA 4EWAA 5JWPA 3SEPA 3A21A 3A7QA 2V72A 4IGPA 3ZX7A 1PIV3 1W04A 4Y1VA 2WO7A 4NHYA 4URTA 4XEZA 4CPBD 5A6XA 1YQ2A 4XF3A 1P8JA 5IW0A 2VUCA 5FZ7A 4NIGA 2IC1A 2YHJA 2IUWA 2R062 4N53A 1YRZA 4L99A 3RS6A 4O9EA 4UAPA 4Q0PA 5KC5A 4AVCA 4AVSA 1V6LA 3S0MA 2A1XA 4UOJA 1N1TA 1S0EA 2DTWA 3POJA 4M3CF 4WV8A 3M3QA 5FZ9A 5H9QA 4ATFA 4IW3A 4RGKA 4E2QA 3JU9A 4A2UA 2WA3A 2ETEA 4L2NA 3VKOA 5FMCA 1YQ6A 4LO8A 3WNXA 3O1PA 1NCQB 2BGPA 2EXJA 1Y3TA 3ILRA 4OMCA 4DEVA 3VL9A 2MEV2 2W5FA 3FBMA 1LEDA 4WVMB 2WO2A 1GWLA 5HI0A 2VO5A 1W8OA 1OQEA 1X8MA 4KG8A 3O5SA 1JUHA 2WFF2 1RJ7A 3AKTA 3GM8A 4MGQA 1ZBA1 4P9JA 3KV5A 3FLRA 5FZ0A 1BVP1 3SEEA 3ZXAC 4BK5A 2HWD2 5BNNC 2QZ2A 4CCJA 2W95A 3GJAA 3DPRC 3T0BA 1K42A 4S2FA 1JYCA 2HJIA 2UU8A 4IV1A 2ZMNA 4YPJA 1QH7A 4CEYB 5CFCC 4DUXA 4PI2A 5A70A 2BGCA 4CDXB 2W1UA 4IE5A 1BXHA 2ZGRA 4CUCA 4XW3A 1UXZA 2ES3A 1CGPA 1HB2A 1WMFA 4JGZA 2J1AA 1COV3 1WMDA 5JSOA 1VALA 2H0BA 1DGWX 2HWB3 2ZX0A 3GNEA 5A3UA 2WAOA 1Y4WA 1FPN1 1ZX5A 5CG8A 1QJY2 1BJQA 2W46A 5GLVA 2HEVF 1HX6A 3AJZA 5BUVA 4GJYA 1YXWA 3KV4A 4UFHA 4EN8B 5FR3A 4YM0A 1Z7S3 2RMU3 2FQPA 4MLOA 3WF4A 4KGQA 2CGNA 5JXJA 5CEHA 1B35C 1AX1A 4UI9L 5AFEA 1SLCA 1NCQC 1RJ8A 1S4CA 3C7OA 3RSJA 3SITA 4QKBA 4YVSA 5FYTA 2VMDA 1GP5A 5KC6A 1D4M3 2RV9A 4CTEA 4MGTA 3AKQA 1J3PA 1MS0A 1W0NA 4BQ3A 4X8NA 5IVFA 1BEV1 3H8UA 1S2KA 2PFWA 4GH4A 2EAAA 2YC2A 3AMPA 1GNZA 3C8XA 4PIXA 1HRI1 3MPBA 4MGIE 1OD5A 5IHRA 4YYOA 3BN6A 5LEJA 2DURA 4GMP1 4YW2A 2WBKA 3KGLA 3VZLA 3K4ZA 3NQHA 5FOJB 1PZ7A 1TEIA 1X82A 3AZXA 3JXSA 4CDXC 2Y6FA 2ZHNA 3HNYM 2VZPA 4FPLA 4PF1A 3MPPG 4Z07A 4BQ1A 2IXKA 3PDQA 1SFNA 4MXWA 2UURA 1J1LA 3NNMA 3VBOA 1HQNA 1I1EA 5LRSA 1KRIA 2VOXA 4R52A 1YJKA 2YZ4A 1GZTA 1RUC2 2J7MA 3M7AA 2JE7A 4QXHA 5LATA 3TB0A 4A41A 1JYTA 1D0HA 1NCRB 3OD0A 1JHJA 2XL7A 3CO2A 1J3QA 1WA6X 4NJ4A 4BXFA 5EV7A 5A33B 3OPZA 1H0BA 1S1AA 2G9FA 1SDWA 1QDOA 5JI7A 5BNPB 1LGBA 4PDWA 2PA7A 1Q8QA 2CWMA 1XNTA 4B4RA 1PHMA 3WOGA 2PHRA 1OKOA 1IG3A 5T5OA 1X36A 1PVXA 1PX3A 4YW5A 1ZBE2 5FY1A 3VZMA 5FZEA 1UL9A 3MEPA 2J1VA 1GZ9A 4GJZA 3UKVA 1BBT1 3JQXA 3WZ1A 2VH9A 3JB4C 3N7JA 4FFHA 4YM1A 2GP5A 3ZYIB 1CAUB 4BPZA 3WF3A 4GQ7A 2DVFA 2B9UA 2E6VA 3THPA 4AI8A 5EYYA 2GNTA 2VOWA 4Y24A 1OPOA 1V70A 2RR13 4L0PA 2EIEA 4CCCA 4M00A 3JZVA 5DUUA 1JHNA 2JG8A 1SZBA 3IM0A 4LPLA 5C4WB 4QKNA 5B2GB 3SKJE 2UY8A 2ZOEB 2QQKA 2RDSA 3C7HA 3FHAA 4Y1XA 4CE8A 5BNOB 4CUGA 4MGKE 2VBDA 4QU2A 5GLTA 4PHZA 1LU1A 1ND3A 3KLSA 4AQTA 4IQPA 1VBE1 3OCPA 3VDDA 4KU8A 3P5BA 3HQRA 2DYCA 5F2SA 3UK9A 4QT6A 4CUBA 4BB3A 1ULCA 2C26A 4OHWA 2JICA 1Y43B 1QQP2 3BPSA 5I0TA 1OOPA 3C7GA 3WP5A 1AR73 2Q8CA 4LHSA 4AFBA 2JD9A 3T0DA 1ZA4A 2UWBA 1L7RA 3NJVA 4KL1A 3WDUA 3O14A 1TME1 1W6MB 1H1AA 5CU1A 4BISA 3QH6A 2ZPXA 4H55A 3T08A 5ERLA 3O1VA 2P37A 1YFWA 3DECA 4GA9A 4GB32 4N7IA 4K7JA 4CXXA 5FDBA 3FUQA 3O0VA 4AHYA 4LOTA 3QLQA 3LZZA 4JTOA 2VUJA 2CTVA 3KQRA 2QQUA 3E5UA 1OBNA 5L73A 4K6BA 4XIKA 4AFCA 3ZYFA 3GJBA 2W9XA 1K5JA 5I0RA 3ORJA 5FUIA 2X09A 3GBGA 3UGGA 4ZS3A 2QQWA 3ZSEA 3H1MA 2W3JA 3TRSB 3ZOIA 1CR7A 1TQ5A 5BXXA 1PO23 5APAA 1ND2C 1OVPA 2Q5TA 2AYHA 5DZEA 5F6KA 4DB5A 3KHCA 1VBC2 2WS91 3K48A 4G9SB 2R49A 4QX1A 4Q4W1 4Z92B 3AYEA 4HKWA 4K21A 4I02A 4F7ZA 4Q8KA 4XMIA 1Q8PA 3ZXJA 4QM8A 4BMEA 1BCXA 2HWC1 4IUGA 4XFHA 1OLRA 1BVVA 4NHMA 5J48A 1PVC1 2WQZC 1RL3A 1LCLA 2FDGA 1RMU3 3MF9A 3N9OA 4D7SA 3MFCA 5HCBA 2R0FA 1ZZ9A 2VECA 2EIDA 5D8AB 4G3YC 4CU9A 1ASJ2 5C7GA 2VXJA 4WM8A 5EYXA 2WZR3 1MS8A 3H3LA 4QB2A 4XUOA 1AR82 5JR2A 5HCFA 1H8TC 2DVBA 3U78A 5FLIA 2IXJA 1ZZBA 2BNNA 4YVWA 1ENSA 3M3OA 3WF2A 4CCMA 1W2TA 4LBMA 1HXS3 5GLUA 2NPIA 1FYUA 4AI3A 1FMD3 4S2GA 4CDWA 3OTFA 5I0SA 2OX0A 5FLHA 1RVF3 2RE9A 3PURA 4HSJA 4QU1A 1ZVFA 1YUDA 3BIWE 1VP6A 4FFGA 4SLIA 4E8CA 1JZ3A 4FTBA 4R4XA 1NA1A 1ODMA 5C71A 2D5FA 2ZXQA 1Y9QA 1W6PB 5CVRA 5FZOB 2VAUA 3H42B 2PQQA 3VHOA 2PLV3 2WT1A 2DTYA 4NIDA 2E26A 2Q1ZB 5JVVA 1PK6B 3CF6E 1MS4A 3TWIA 1CAXA 1GR3A 2DF7A 1AR61 3CJIA 1UZVA 2ZEZA 1AX2A 1X33A 2OKXA 2JG9C 5H9PA 1O8PA 5F1RA 1K5MA 1QNYA 2AEYA 4NRQA 4FFIA 3VKLA 4ASKA 1A8DA 2YGMA 1UU6A 3LEKA 4RS5C 1CIYA 5FZHA 3UGHA 4AF9A 5JZGA 3LDBA 1SBDA 4KI5M 4LBQA 1W9SA 1W28A 2BVBA 2WC2A 3S5QA 1HB1A 2DCJA 5LA1A 1PO13 1AX0A 1QHDA 3OY8A 2D3PA 4ZHNA 4AEDA 2SLIA 4IERA 5KBFA 2DCKA 1C5IA 2JDHA 4YZ1A 1MS5A 1Q3EA 4C0HA 1CAWA 2XBO2 4BE3A 3NV1A 3TEWA 2W39A 3M70A 4CCKA 2IZWA 5L7OC 3NKTA 2C6SA 5CAZA 2JIJA 3LD8A 2RVAA 2NMNA 1DQ4A 1UYZA 4IE7A 4JRLA 4QXCA 4WM7C 4AR2A 5A6QA 3VZNA 2ATFA 2BNMA 1X9TA 2P4EA 1J1TA 4LBLA 4QMAA 1AYM1 1JI6A 4RQPB 4W50A 2BDRA 1MEC1 1POV0 1IS6A 2BU9A 2YFUA 3ZDSA 1VRH3 2CYFA 5E16A 3PIJA 2FCUA 2OYZA 5F3CA 4LR4A 1RUE3 3QH7A 3HEIA 1UQXA 2NN8A 3K75B 2XB6C 1NZIA 3VBRA 4ZONA 3L2YA 5D21A 5A32A 1A34A 4MYEA 4N53B 1VBB1 4FAHA 3A0KA 4B7KA 2ZGOA 2O14A 3DCQA 2BV4A 3UGFA 1NYWA 2A70A 5C6CA 4OFGA 4E4DX 3FUOA 2D6MA 1LTEA 3E6CC 4RFT0 4MUVA 1JYIA 2DV9A 2DUPA 3NSTA 1Q8SA 3ZXEA 4C0BA 1OF4A 2VQAA 5ANQA 1AZDA 4RGAA 5SV5A 2AH2A 4CSWA 4P08A 2QQJA 1JOPA 2VVFA 2WYSA 4UFLA 3K77A 2DVAA 5I91A 4Y5Z0 1TMF2 1RUI2 5FZGA 5C8WA 5JI9A 1QXRA 5T5PA 4DRVA 2W92A 4IEZA 2QQLA 4CEWA 1NUKA 5AVPA 1VBA3 3N7MA 3ST7A 3I2FA 4CDUA 1WBLA 1WW7A 1G9AA 3AVSA 3J7LA 1R081 4HN0A 4LEJA 1CZVA 3C7EA 4E27A 1JU3A 2BW8A 3DEMA 1C3HA 2H6BA 1C8NA 5CG9A 4MG2A 2ZZJA 4ZZ8A 2UYAA 2ZGLA 5F5CA 2YROA 1MPXA 1QEXA 3ZN6B 4N53C 3WW1A 4D3WA 1D2QA 1BZWA 2AZ5A 1DQ0A 4CEYA 2KR2A 2WWSA 4XFBA 2EIGA 1T2XA 5DUWA 5DUXA 4DOUA 2YB7A 1KFUL 4P5HA 5HPOA 2A3YA 2HWF3 3NJXA 4PQQA 1GMMA 2BFUL 5F32A 1NZCA 1DF0A 2WAAA 3HAGA 3FN9A 1MS9A 4CVUA 1RUG3 4TLFA 4EYUA 3OGJA 5FPVA 5T5JA 4YVSB 5J3UA 1WLWA 4QB1A 4FXKB 5EJZB 1UKGA 1XQNA 4GWMA 3QACA 3AYAA 4LXLA 5IVYA 1F15A 2Z69A 5LY1A 1ZRCA 4OYUA 3BIEA 2QDRA 1RUJ3 4PF5A 4Q4V3 1C8M3 2WDBA 4XVHA 3ZYRA 4BIOA 5BYNA 4W6XA 4R9CA 1O59A 4IEQA 4OZOA 3RDIA 4A7ZA 4FAGA 4TXWA 5JAXA 3CL1A 4XF4A 3EQEA 2GC0A 3NV3A 4FXGB 4IV1C 1R1A3 2BP6A 3E5XA 1OA2A 2BGOA 1S0BA 2R043 4YW3A 1V9U1 5IK4A 3BTYA 3NV2A 3RVHA 4JGZC 2VW2A 1RUH1 1T6GC 3H1WA 4KGGA 4MXWB 1C5HA 2VCCA 1SPPB 3K4DA 5FYVA 5IUQA 2ZGSA 2KA3A 3GBWA 3OBRA 4Q4Y1 1UOFA 2A3XA 2RM22 1LHWA 2WIIB 3FE5A 3M4FA 3LGRA 3SH3A 4ORFA 4D0QA 4D6SA 2JDMA 2K2SA 2YBKA 1U5IA 4LHNA 1DGWA 4A3ZA 5E8AA 2N7GA 1NCRA 3ZSLA 2OIIA 5A33A 1G7YA 3RG0A 1SHWB 3R4DB 2VTXA 4YVSC 2MNGA 3I7DA 4AFDA 5J36A 1W3XA 5HXVA 1UWWA 4GWNA 5BNPA 3BCWA 4MX3A 4D6QA 1ULPA 3TN91 2A6XA 5KXEA 3MIBA 4EWEA 3JB8A 4MOAA 2Q8EA 4V2VA 1NT0A 1HN1A 2ERFA 1QY4A 4GH4C 3I49A 5AC92 5DDJ3 3AVRA 1W9TA 4I30A 1GKBA 5FXVA 4E2SA 3OB8A 2XLFA 4XDOA 3SNMA 3HMYA 3X29B 5LWBA 3N9NA 4XE9A 3BOPA 3SC7X 3VBOC 3WP4A 1PIV1 2HEYF 3QOPA 5FY0A 1DQ6A 2YBPA 1H4GA 3R6SA 3VL8A 3ZYHA 5IATA 3K3OA 4IXLA 2QQOA 2WNVA 4OCTA 3S7IA 1AF9A 1ND3B 4HVRA 4M0HA 1VR3A 5C4WA 2W2IA 5DAXA 1S0IA 3TNQA 4I3GA 2ZHLA 5FY5A 1IPJA 5BNOA 1C4RA 2PHDA 2CAVA 3RMYA 4PDWC 4AAPA 5B4XA 4KH9A 3ZKYA 1OOPB 3AZWA 5FQ0B 2R0HA 2VOKA 3PTRB 4A6OA 2LRPA 3MHZA 3T09A 2JWPA 5FZDA 5JOXA 1Y9MA 2XJTA 1QJU3 2RS13 1RHI3 4MZUA 3O1TA 1KDMA 3O7OA 5KXBA 2ZGKA 1WLDA 4MGSA 4RR3B 4LBOA 4W6WA 5FY7A 4PBPA 2VY0A 1SACA 1NY72 5F5QA 2ENRA 3OPWA 4XPVA 5JIAA 2JG8C 1OI6A 4QB6A 4TWTA 5CFDB 5FZ8A 5LCWL 3WQ7A 1YI7A 4LA2A 4ONUA 1AYN2 5CKMA 3POFA 3ZFGA 4HANA 1SLTA 4GWJA 4BOWA 1J84A 1S0GA 3VZKA 4Q4X3 1COV1 2HWB1 1XU2A 4I2OA 3I2HA 3VN4A 2ARAA 2ZGUA 5EJ3A 3VDDC 3VDAA 1CJPA 2XJQA 3HQXA 1DIWA 4C8DA 1RB8G 5FY9A 1S2EA 1HRV2 2JD4A 5FPXA 1U5YA 3VBUB 1DDLA 4ISQA 2ZX4A 3KV9A 1DZQA 1Z7S1 2RMU1 3ZVXA 1OOPC 1CAVB 5FYUA 2JKBA 2W91A 1GQHA 4LUKA 2C24A 4GAZA 5KXCA 2EAKA 2NQYA 2PHTA 4FBFA 5JXGA 2VBBA 3HN3A 4IE0A 3BOWA 4XABA 5A7OA 4OQ8A 3IMMA 1KJRA 1CONA 5GM0A 3IDBB 3POSA 1O5UA 4UW4A 1D4M1 5BY5A 1W6OB 2WQ4A 4YVWB 3WHTA 1LEMA 5D8AA 2VNOA 4YG3A 5DAWA 5E89A 1UMIA 1GNHA 1UOJA 2ZEXA 4O7XA 3WF1A 4CDWB 1RINA 1W8WA 3I3BA 3N3HA 3C7FA 4HVQA 1O5LA 5F39A 3R0RA 4QDSA 3J7HA 4MH0E 3NO8A 1W2OA 5T3NA 2RG4A 3CZUA 5FYYA 1NA1B 1AJOA 1RUD3 2YFZA 3WW3A 3POIA 5FYZA 3GZTB 4PCRA 5FXWA 3J26N 4QQPA 1W9YA 1W8FA 4GALA 3WG1A 4BQ4A 1LNSA 2E31A 4F3JA 3TYJA 1ZBA2 1WUVA 2YC0A 2V5DA 1CAXB 1AJKA 1LOEA 1W6PA 2BUKA 3LEIA 4Y5TA 4RHV3 4V2WA 5FZOA 4CP9B 1QWRA 1GZCA 4DO0A 2QQVA 3WD5A 1DYKA 3AL5A 4Q5OA 3A0NA 4AEKA 4Z8BA 5A1FA 3IAPA 3WSOA 1PK6A 4AVBA 1N1SA 3ZYBA 4OLLA 3O1UA 3SH4A 3DXTA 4JGYA 2XJVA 2I74A 4AL9A 4WM8C 1KDKA 3VD3A 1OD3A 1SBFA 1RYYA 1S0DA 2XKOA 5LK7B 1VBD3 1FPN2 3UKTA 4YVWC 2BQPA 3ECQA 3PUSA 4K20A 4LKFA 4CDWC 1UU5A 3J8F3 5K7PA 2NMOA 4QX0A 2LM3A 4V1PA 3T30A 2VMFA 1GOHA 3H7YA 4AI9A 1QOTA 4O9GA 4LUMA 3MW3A 5ACA3 1C28A 1NA1C 1WKYA 1S0JA 4M3CE 1Q43A 2I2SA 3WXPA 2X10A 2E51A 2QZ3A 2HYKA 2XHKA 2RR11 4QWNA 4MHUA 3LOIA 4HPKA 3IB3A 4IE4A 1VMFA 5FZIA 1EV13 2XONA 3JBG3 2G1MA 4DUWA 2ZHKA 1DQ1A 1XPWA 4QPGB 1RXFA 2GNMA 1AL0G 4Q1RA 5F37A 1FT9A 1XOYA 1BEV2 2VE1A 3CJIC 4XFFA 1ZZCA 1XU1A 2BFUS 2RJKA 2XGXA 3LFMA 1HRI2 3D4KA 1IS4A 4LIVA 4JKLA 4WBBA 2YU1A 3V65A 3NV4A 4EN6B 5IFTA 2Q30A 2WZ8A 4RQPA 1W8TA 1AXZA 1HJFA 1K5MC 5I8YA 2C9KA 4GD4A 5EJ1B 3RNSA 2YU2A 1OPMA 1H1MA 2VULA 3B00A 5A32B 3ZLIA 1AR71 1UN1A 3LF7A 4M01A 3WNKA 1WLCA 3U10A 1W6QA 4C1XA 4LBQD 1DZRA 1NKGA 4JQRA 5JZGC 1GBGA 3VDBA 5BPXA 4CU8A 4AQ2A 4OHYA 2OQ7A 5EFUA 4AEDC 4YGCA 4NRPA 3POEA 5LBEA 3ZXGA 2AEZA 5JIUA 2D5HA 4QPIA 1JS9A 5C3QA 1N47A 3M8LA 5IFPA 4QHZA 1MZ6A 1W8NA 3LA2A 3WVJA 1DLLA 1IKQA 2Y0IA 1CZTA 1XNBA 3PL0A 1PGL2 1UYYA 1AXKA 5FZCA 1BQPA 1XNAA 1A6CA 4Y3OA 1PO21 4CEWB 1GOGA 1HV1A 1IGOA 4Y22B 1UF2C 1BBT2 3P6BA 4IGOA 5FPAA 3TNPB 4A42A 2PAKA 1DBNA 1W0PA 2JEMA 4CDUB 1QKQA 3KZ4C 4XFGA 2Q8DA 3WDYA 2K46A 4MADA 1UX6A 3I2OA 3THTA 1GUIA 2P3IA 1OHFA 1Q56A 3FX3A 3VBRC 2JB8A 1UAIA 2CGOA 2R073 1MACA 2Z79A 1RMU1 2ZS6B 4ARXA 1QJX3 2ZX2A 2P34A 1WW5A 2GALA 3UYJA 2Y64A 4DXZA 2K0GA 2WZR1 2Y38A 4DMIA 2DVDA 1JZ2A 2JDYA 1UY1A 2R1BA 3JD73 1VBE2 2XVKA 5K4LA 3ZSKA 3ZN6A 4I0BA 1EAH3 2QUOA 2WZEA 1OUXA 2LTNA 3U07A 1WBFA 1HXS1 4P5YA 4KU7A 5FXZA 3PMSA 1FMD1 4PT6A 3VBSA 4AFMA 2JDKA 5T55A 5FAXA 3ETQA 1QOSA 1RVF1 1Y7BA 2ARBA 2XXZA 3LPFA 3EYPA 4Y26A 4ARYA 1GQPA 4X6QB 1YIPA 1TME2 2B45X 5F5IA 4K1ZA 3KV6A 2WUHA 3H7JA 2Z5WA 3NWKA 4XZPA 4CEWC 1JYVA 2PLV1 3AYCA 3RYPA 1H8VA 4YG0A 5FKBA 4CDUC 3U14A 2X05A 2AGSA 4UW3A 5F9TA 1G6NA 2XR4A 4N9IA 4NWVA 3VKFC 3IPVB 5J98B 1UY2A 3WNPA 1PGW1 2FZ1A 3WQ0A 1R093 2ID4A 3CIHA 3T4VA 1U5ZA 1YLLA 1CD3G 1DGRN 1OLME 2C0ZA 3SKVA 1CJDA 2OZ6A 3MFAA 5GKAC 2IXHA 4ZKTB 4FPHA 2YUEA 4CEYC 2QQPA 5FO8B 5KR7A 5D2AA 3RZHA 4QHOA 4Y5SA 2WS92 5JMOA 5FZKA 5FOBB 1OC1A 3BVCA 3CNAA 4Q4W2 5A3MA 3AB0A 4COWA 3WP6A 4JZRA 1KS5A 3W20A 4E2GA 1POQA 1SPPA 2RS53 2V73A 3ES1A 4U36A 5FUPA 5ABJB 2HWC2 1PO11 1VE0A 1B09A 1J59A 1V6IA 1PVC2 4J1WA 4LTAA 4A7YA 4COUA 1PNGA 2GNBA 3PVNA 4AVVA 1OKQA 1G8WA 1OA4A 2BNOA 1IZ3A 2WJSA 2VGDA 3U0ZA 3C2UA 4BIFA 2A75A 2PELA 4LHKA 4TN7A 2YXSA 3UL2A 2ZACA 3MIFA 1XRUA 1RUOA 1F31A 2JDNA 3VBFA 2B7YA 2FDHA 3LA3A 3AM2A 4A7KA 2X5IB 3SCFA 4XUPA 1PGL1 5AVAA 4IEPA 1SLLA 3THDA 4CU6A 1WZXA 3MGUA 2EIBA 3HVDA 1VRH1 4LNVA 3POWA 4H7MA 3F95A 3I2DA 3I3EA 1W9FA 5F8PA 4ASLA 1URXA 1MS1A 1YI9A 1RUE1 2ORXA 2YC4A 4FFFA 4M4PA 4UYBA 3WG2A 4AHZA 4XQ4A 3O1RA 3USSA 1X9PA 3KS7A 2VXRA 3W9AA 4AXOA 1I6XA 2PHXA 4LULA 2WNVB 5E6HA 4K3UA 2ZBJA 2PHWA 1BHGA 1Q5OA 1UMHA 3KCXA 3MDPA 3Q8AA 3I3QA 3MLJA 2GMEA 1LR5A 3BODA 2O0OA 3LSEA 4YG6A 1AR62 1N3PA 5DPNA 1VAMA 2FCTA 3FFZA 4B7EA 1NCRC 2QFEA 4JRAA 3QCWA 3QD6A 1QGLA 5LA9A 5IK7A 2WR9A 1RUF3 4YLZA 4DQAA 5BNPC 3O1MA 2Q1MA 4Z82A 4AEJA 4D7TA 3B93A 5C5UA 2WQ8A 2XVLA 4L92A 1IPKA 1MVEA 1SLBA 5FQ0A 1W99A 3PJYA 3NNGA 2PQSA 3GZUC 2ZKNA 4C91A 4OUSA 2EXHA 1FOD3 1ENRA 1ULGA 3APBA 1NQDA 1VBA1 4RR3A 5F6LB 3RGBA 5FPLA 4DXRA 4P14A 1AL23 3M3IA 4LBNA 5C3RA 1POV3 2YGLA 4W65A 3ZFGB 5CA6A 1EUUA 1I5PA 3FHIB 2WNVC 1STMA 4M0NA 3VKNA 2EXIA 4XCAA 3RFRA 1LGNA 5CFDA 5C4WC 1AYM2 1UKRA 4GWIA 4PIZA 1PZ8A 5BNOC 1MEC2 3N7KA 2IXIA 1NXMA 1Z78A 4BDVB 3AL6A 2VD7A 3LWCA 1N3QA 2O1QA 3H3UA 2X29A 1VLNA 2CHHA 2HWF1 3AKSA 3W21A 4AW7A 1BYHA 4B1LA 2HEWF 2EXKA 4LA3A 3VBUA 5GZDA 3NKGA 1RUG1 3NL1A 5HV4A 4JKMA 2MPFA 2YY1A 3DYPA 1CAVA 1VB4A 1VBB2 1YQ8A 5FCCA 2A3WA 3EHKA 3OEAA 4COVA 4XXPA 3ZMOA 5CISA 2P6HA 1KGYA 1RUJ1 2A5ZA 1C8M1 2VMEA 4O61A 4Q4V1 2GZWA 1GICA 2O8OA 3KWVA 4BMBA 1GP4A 1PGSA 3D8CA 2ET1A 4ET7A 4URAA 4XIOA 3ZFEA 4EV0A 1V6MA 1I3HA 2B9VA 3N35A 5DUVA 2BVVA 4AHXA 1W6OA 2JIGA 4ES9A 1J83A 1XXNA 2VNVA 3EBRA 1R1A1 3ZFGC 2R041 1PX4A 3LDRA 4JX0A 1NQJA 4AYUA 5LA2A 2KM2A 1JZ4A 3ZN4A 2WN2A 2VMHA 2XOMA 3TBDA 3MIDA 3TEZA 5FZLA 3M1HA 3DUIA 1UPIA 1W8HA 2VMCA 1MR5A 1R082 2WLPA 4DXTA 1REEA 2XMLA 1YCIA 3AKPA 4I01A 4B4PA 4JGYB 4CP9A 3V0BB 2LUWA 2J22A 1O3TA 3KVBA 2HWE3 3B94A 1MQTA 5C3SA 1S2BA 3LIGA 3IIIA 2RS33 3HNBM 4H7LA 5D8AC 4B8EA 1DGRA 1YWKA 4QX8A 2Y6KA 4XBNA 5FZAA 4A45A 3LCPA 2CDOA 2WO1A 5ISLA 4ATEA 1ULFA 4OUEA 2ZCWA 3CKHA 3DKWA 3IAQA 5DDJ1 2VG9A 1ALYA 4XC9A 5F3EA 3NNFA 4E8DA 4QM9A 5A3PA 1CESA 5DZFA 4LBJA 4LORA 4YGBA 1DQ5A 4E4ZA 4HPKB 4HK9A 1H9PA 3P1IA 3H8XA 2GNDA 3T1MA 2SBAA 3WF0A 4AOCA 1ZRFA 1ODNA 3OGSA 2ZABA 4JHZA 4FO9A 3CZJA 1SDDB 1VRBA 2A71A 3GCXA 2VC9A 4HFSA 3B02A 3U75A 1UIKA 3NVCA 1IS5A 3RJ2X 4HK8A 3WNNA 3ZPOA 1HV0A 3NAPB 4IEOA 4QPGA 2XG3A 5GZEA 3FLTA 1PK6C 2AC1A 4H14A 1AR93 4YZ4A 1DG6A 1W0OA 2WN3A 2OPWA 1V9U2 4JGYC 4LLOA 5FUNA 1H2MA 4XFAA 4CPBA 2EVXA 1JW6A 1RUH2 2C1FA 3J4UH 2Q8OA 4E4SA 1W6QB 3ACIA 1ZNPA 2E9QA 2G9ZA 3AC0A 2A73B 2R063 1V6NA 1QJU1 2J1EA 2RS11 1RHI1 3ME2A 4Q4Y2 3URFA 3S5AA 2LALA 3LA7A 2FDKA 5SV8A 4NO4A 1KITA 3E6DA 4RFRB 5IVCA 2CL2A 1RIRA 3B9IA 3SMHA 2VM9A 4AVAA 2IFRA 3GCWA 4QPIB 3EXUA 1E5SA 4IEXA 1US3A 4R9AA 1J3RA 1FI2A 2JE9A 4IGQA 2HBUA 1X50A 1DLCA 2MEV3 2OT7A 4KNCA 1UY3A 4N9HA 1F9KA 2J42A 4NE9A 4Q8LA 4XUQA 1GFF2 1HQWA 1UYXA 3E97A 3TN92 4AE2A 4YARA 5C8CB 3KVAA 2WFF3 1XNDA 4Q4X1 4KWJA 4KWKA 2WABA 5BNNA 2WNOA 3T4HB 1WLTA 2HWD3 3ELNA 3KD4A 4HETA 4QHBA 3L2HA 1QXJA 4OMDA 4RQPC 1R1ZA 5KHJA 3IDAA 3LB9A 4AK3A 2ZMKA 4NN0A 4Y22A 3LQCA 1JZ8A 4TZDA 3OOXA 4GULA 1MZ5A 3Q9OA 4P9WA 4HG6B 3PUHA 1PIV2 4AVTA 2Q1FA 1AVBA 1FV2A 3AZYA 4LO5B 3AP6A 3GBFA 4C1WA 2BJSA 2JECA 2UWAA 1W2NA 1QJY3 3FC0A 4Y1UA 2BBAA 2XH6A 1IHMA 3INAA 3N9MA 4QPIC 3E5QA 1JYWA 5LY2A 3ZFFB 4XUNA 2QQNA 3VBSB 5FFOC 4QGMA 2R16A 2JXAA 1VPHA 5FY4A 4KMQA 2PAMA 1JZ5A 4Q0UA 2GH2A 1AHSA 2VOTA 2P3JA 1IKPA 1RUD1 4XMAA 5FJHA 1O91A 2QBXA 1UMZA 2VZSA 4ISRA 3ZM8A 2W08A 3WDXA 1WCKA 3DKQA 4S2HA 1XSRA 1JXNA 4HKOA 4S2DA 2FDIA 4Q0SA 1RXGA 2XUMA 1UXXX 2F6BA 4DFSA 2XHNA 1V6JA 3C3VA 2C9AA 2DWRA 1HB4A 4RHV1 4IL7A 4Q0QA 1UZWA 5L9BA 3H8OA 4OI0A 1U5XA 1XNCA 3ZR5A 1NLSA 5KXDA 2VR4A 3HT1A 2DBNA 4NHKA 4WVZA 3IPVA 2YG0A 1JOJA 1LOGA 1H2NA 2WO3A 1CQ9A 4HXCA 4GMP0 3AKRA 5M0TA 1IQDC 1PZ9A 3AZZA 4JC1A 1COV2 1RUC3 2D93A 2HWB2 3I2KA 5A7WA 1VBD1 2XDVA 1A3KA 1N1VA 4R4ZA 1MZEA 3LAGA 5A1LA 3V64A 3WLUA 3J8F1 1Z7S2 2E53A 2RMU2 2YDEA 1DFQA 3HWJA 3OG2A 2VQTA 1BK0A 2DVGA 2GDFA 3MIGA 4QQ2A 1NE4A 2P2KA 1ZRRA 4H3WA 4A4AA 4OULA 5ABJA 3M3EA 1CPMA 2W52A 3WINE 4AHWA 4AGGA 1KD7A 2Y6HA 1ZBE3 1E5RA 4HT1T 4K1YA 1QJZA 2E7TA 2VZ1A 1EV11 3JBG1 3NNJA 1D4M2 2B4KA 3VBFB 1QJEA 2P3KA 2VUDA 4QX7A 4XFCA 3SCHA 3Q8BA 4B29A 5IVVA 1OT5A 2VPVA 1W06A 3B9CA 1OF3A 4FPGA 1LENA 4OQ9A 3HBZA 2LW8A 1ENXA 1WA4A 3FJSA 2X5IA 5FZMA 4CYDA 2E63A 5F7UA 1W03A 1V6OA 3CEWA 2VZTA 1PNFA 3MLLA 1JODA 2TUNA 4DUVA 2WNUA 1QIQA 2ZJCA 1H9WA 4A3XA 4ZU7A 4ZY9A 1QU0A 5FWJA 4LJHA 2GC2A 5I8TA 4G4FA 2CU5A 4ZXEA 4BZ4A 4LT5A 1YHFA 1GWMA 4MGYE 3SISA 5FZBA 1GWKA 4CP2A 3DL3A 1QQP3 3IKWA 3ZXDA 3VD7A 2CNAA 2VL4A 5FYCA 5FPZA 3MO4A 1MZFA 3FBYA 4AQSA 1VAVA 3UKNA 2Y34A 3MIHA 3M3CA 4HLTA 4XF9A 1UO9A 2QNKA 4C90A 2FD8A 2DUOA 1ZYBA 1W39A 3IT8A 3QBQA 3TAYA 1YFUA 4PJYA 4GB33 3VBFC 1W2UA 1GSLA 4RYDA 5I0DA 4XJ9A 4RA0A 4JCKA 4DY5A 2RDNA 3ENRA 1FV3A 2QTWB 1O3RA 2V4AA 3G7DA 4PLNA 1XSQA 4PLOA 3UJOA 4QX2A 4I0WB 4LO6B 4EZHA 4YRDA 1UNBA 3AP7A 1LECA 3OEBA 3PVBB 3BB6A 1LGCA 2JENA 4F8AA 2ZX1A 2PN5A 2RR12 4BQYA 2B8MA 5JSPA 2R071 2PMWB 3DF0A 1G9DA 1QJX1 3RZKA 4HVOA 5FYSA 1LHOA 1VBC3 2ZGMA 5C3OA 5L36A 1NLRA 2OW4A 4AG4A 1K45A 5FIXA 2FZ2A 3VBHB 3JD71 3H9AA 3ZIXA 1ND3C 2W0XA 1EAH1 4R9BA 4Y20A 4OHVA 4XBLA 3T2OA 3V0AA 3VZJA 4I3PA 2YPJA 4YW6A 1APNA 1VMHA 2YPDA 5T52A 1AR72 1IG0A 1ASJ3 1UD1A 4FPOB 4GKYA 3RZMA 2A6VA 4JDMA 4JDNA 4MO3M 1SEFA 5FP3A 1AR83 4FQ4A 5BNQA 5FMBA 4Q26A 1IOAA 5AFBA 4UT5A 2OXBA 1JBCA 1W2AX 3VGIA 4YFZA 5FK7A 3LOBA 4RR3C 4UXAA 2P1BA 5FREA 3ZFEB 4HOOA 2ADEA 4NHXA 2Q0AA 1RGSA 1UCXA 4FI9A 4Q27A 4XETA 4CCNA 1DGLA 2D3RA 5CADA 2TNFA 2BPA2 5FPUA 2O8QA 1I9RA 1TZOA 1R091 2Y6LA 5FJKA 1UPSA 1UX7A 2BRTA 1LOFA 4CUAA 1YNAA 2RJ2A 4B1MA 5CFDC 5JPNB 3NRUA 5EPAA 1LHUA 4KG0A 1OFNA 1PO22 2OA2A 3AZVA 2JB4A 4XDPA 4CP0A 4HMZA 3ETPA 4JKKA 4QQHA 5DAVA 4BWOA 3GZAA 4EZ4A 4Z2WA 3S57A 1YFYA 4XOGA 1TNRA 3OUIA 2JG9A 4R8HA 1T6BX 1OFSA 2JDUA 2QKDA 2RS51 3FMGA 2C4XA 2UYBA 4EN0A 2PXJA 5J37A 1UZYA 5FZ1A 3D0SA 1LU2A 5F3GA 3VBUC 1EPZA 2CGPA 1RTVA 5EXOA 1RMU2 3DYMA 4IDZA 3MIEA 4NHLA 2DUQA 4AQ6A 5CZKA 1MQTB 4XXAA 1ZZ6A 5A3NA 3WG4A 3ALQA 2VZQA 2GU9A 1IS3A 4L11A 1FATA 2BYVE 2ZGQA 2WZR2 2YYOA 3J7NA 3N9QA 5JSRA 3V0BA 1LAJA 3ZMNA 3U4XA 4Q2FA 4EN7B 3K4AA 3ZFEC 4XAEA 5JDBA 4TLGA 2LROA 4BCUA 1HXS2 2ZKLA 2DCYA 3GDBA 4Z2AA 1FMD2 1JTZX 2QQMA 4WZCA 5A7SA 2XBO3 2CAUA 1F2NA 2A6WA 1TNFA 3LSDA 1RVF2 1D7PM 1O6UA 3POBA 2AUYA 2KD7A 1L7QA 1M4WA 3O1OA 4YM3A 3AYDA 4FQZA 4TTGA 2GN3A 4QKDA 4Y4YA 1FNYA 1ULOA 5C9AA 1F4HA 2JDZA 2Y26A 3WCRA 2F4LA 3NNLA 2PLV2 2XL9A 3ES4A 3ZSMA 5ACA1 1KJLA 1LB2A 4LO7A 2D6KA 3B01A 5LBCA 3JQWA 3RZJA 4P00B 2FHRA 4CU7A 1JOBA 1PGW2 3RWKX 4QQLA 3F2ZA 3WQ1A 2VCMA 1ZZ7A 1H2LA 3VHNA 2XJSA 3VV1A 3WDWA 3OGVA 3PU8A 2B5HA 4IV3A 5LW9A 3NAPA 3ZPYA 5EWSA 1MQTC 3AP5A 1XYNA 2XPJA 2B39A 1H2KA 1RUF1 3ZIWA 1EYBA 2FDFA 1CIWA 1S0FA 3ILNA 1QXPA 3HIFA 1WMEA 2R30A 2IFWA 3O0XA 3SHRA 4D94A 2E33A 1ONAA 1YC61 4D8MA 2ET7A 5K9YA 5KHGA 2H0VA 1V6KA 4AZZA 1XE0A 2BTVC 3T0AA 2GSYA 3HD8B 3OUHA 4QGNA 1W6NB 3RQ0A 1PO12 4IE6A 1SG3A 3OBZA 4DY3A 1W3VA 3CU7A 3TOJA 4NPMA 1FOD1 1X7NA 4NWWA 1FNZA 1GV9A 1NLQA 4KBZA 1GLHA 5ANNA 5A6YA 2OVUA 1C57A 1AL21 1YEWA 2Y33A 3CDZB 2VZOA 5K0UA 3VUOA 3MUY1 1TMF3 1POV1 1RUI3 1UZ0A 5F3IA 3WNOA 4COZA 4CXWA 4DXSA 3RZLA 4AGVA 3SH5A 3EJKA 4OVEA 5LRRA 5BNNB 4AGRA 4CCEA 5GALA 1WMXA 4RGGA 3DPRB 4XACA 4NAOA 2E7AA 4QPGC 1UU4A 1NX9A 2VZVA 3ACHA 1WD3A 3PHMA 4FTEA 3AMQA 1JYNA 5CFCB 5C8CA 2P17A 1VRH2 3MV01 3AXDA 4AI0A 1ZRDA 5FKCA 4FTSA 3KQ4B 3EB7A 4D69A 2IVJA 5JOZA 1RUE2 3LEGA 3WNLA 1OXCA 3I59B 2VOVA 1O8SA 3UNPA 2W68A 5FP9A 4O65A 4ZPIA 5I8SA 4A44A 2D43A 3IMNA 5FP4A 4UFKA 5LZ6A 3SLIA 2ZZQA 1GNYA 3P3NA 4IEUA 2QQIA 3B5LB 5J1XA 1DYPA 3NW4A 4TSVA 1B35B 2W1WA 2ARXA 4GXLA 4UF0B 4BXSV 3ACFA 4PIYA 4YW7A 3H1YA 4P9LA 5HBAA 4CCOA 2WKKA 4TYSA 2DDUA 3J7MA 3KF3A 2I07B 4XILA 3ZFFA 5FTTC 1ULEA 1H30A 4EJRA 1YQCA 2CSGA 1BLZA 4FPJA 4H2AA 2PHLA 2OQ6A 3AJYA 3IN9A 3A22A 3POYA 1W8ZA 3WUCA 1OURA 2G4IA 3OBTA 4OHZA 5IYYA 5B4NA 1IPSA 1K12A 3SCGA 1VBA2 1VJ2A 4XZUG 5H9SA 4DPNA 2ZAHA 3G6JB 3ILFA 2L9LA 5IAVA 2WWUA 4L97A 4LKEA 4META 3BTXA 4IEWA 4L8QA 4N7UA 2HWE1 1GQGA 4W4ZA 3L9JT 4N43A 5A7NA 4EWDA 1DZTA 3FHQA 4B3NA 2XWBB 2DBIA 5FBJA 5A7WB 4W6YA 1QH6A 2RS31 1YYNA 2RM23 2D7FA 4EN9B 5LEKA 2A7AA 1JMUB 3MV11 3B3QE 4E9KA 3GZEA 1JZ7A 1O3SA 5IK5A 3VZOA 2HWF2 4PBOA 1D0GA 4CDQA 4W8JA 1QDCA 3AXEA 1RUG2 2MHFA 3CMGA 1JZ6A 2DU1A 5T54A 2IVIB 3GF6A 4FPEA 4M3CA 2UWCA 3D6EA 4YW1A 3VHRA 2HYXA 2HH9A 4UFJA 2Z2SB 5FZ3A 1KS4A 1RUJ2 2VJXA 4Q4V2 1C8M2 1RC6A 1YIFA 3CQOA 4LO4B 5JR7B 4DS0A 5AC93 2D3SA 1BMV1 1F4AA 1HB3A 2XJPA 5GZGA 3RYKA 3OSDA 3AMHA 3T2PA 5JCTA 1ZREA 1X8EA 4NROA 5GZFA 4FP3A 1GANA 3K2OA 1R1A2 1AR91 2VTFA 1DHKB 4FPKA 4XURA 2R042 5A7PA 1VMJA 2Y8KA 2WNUB 3FLPA 2VQUA 4NPLA 5C5TA 4P02B 1V00A 4NR1A 4QXKA 4YNIA 4NOTA 2R061 4ZU5A 3BGAA 5FZ4A 1N3OA 1GYKA 5FK8A 5GZCA 4BH9A 1A78A 5A80A 4CZSA 2A6YA 5HCAA 2I45A 2RDRA 4J25A 4JHTA 1C1FA 3U4SA 1ACCA 2XJUA 4JV4A 1HLCA 4LE4A 5ABJC 5KWRA 4IESA 3P3PA 2D40A 1SQ4A 1LRHA 3Q8CA 3HNMA 4CP1A 3RZGA 2WRAA 2VNRA 5TSWA 2BZDA 3WX5A 2MEV1 5JLVA 1UZZA 3ZXFA 3CLPA 4DZGA 1J58A 2JDPA 1WCUA 2JX9A 4ASMB 1XYOA 2WFF1 1FXZA 2G19A 2EALA 2HWD1 4HZFA 5DDJ2 3OF1A 3AP4A 5CKNA 5DQ0A 4DRRA 1BK1A 4HN1A 5CIRA 2X5IC 3RJRA 3ABZA 4QX3A 4XF0A 2WLQA 4Y33A 1AYN3 1ND2B 2WNUC 3K3NA 3BPZA 3IBMA 2CDPA 4KQ7A 4PQ9A 1WGPA 1SBEA 3MBWA 2WWJA 2Z42A 2WA4A 5G04L 2NP0A 3O12A 1NG0A 4BHPA 5DG1A 2OZJA 4I0AA 4K8RB 4AI1A 5I93A 1DQ2A 2DU0A 2GAUA 2ZGTA 4QXBA 1HRV3 2ZHMA 3WDVA 1QJY1 5FXXA 3VKMA 4P9XA 1I5ZA 1TVGA 3GALA 2ZTNA 3RWNA 3WR0A 4D7YA 4AWDA 4Y20B 3V0AB 3WG3A 4BQ5A 1D2SA 1G9CA 4XJZA 3HR9A 4KBBA 2VQ0A 5LBBA 3VBHA 1UIJA 3T2QA 2VVEA 4FCAA 4EQVA 1UW8A 1H8TB 5JOWA 5FY8A 5KHHA 2WSUA 1QJU2 1SFYA 2RS12 1RHI2 2PAEA 3PU3A 4RD7A 5BV6A 4MV2A 5IJRA 5DZGA 1OMIA 4R9DA 3LPGA 3N36A 3PUIA 4OI2A 4UBHA 4CRQA 3BTZA 4FVVA 3OGRA 3ACLA 5FRAA 3VD9A 4XBQA 3ON7A 1WCDJ 3M2MA 3WNMA 1KFXL 1ZZ8A 4OI4A 3FZ3A 2FCVA 5J7MA 1H4HA 1XE8A 4JDOA 2WT2A 4Q29A 5L19A 3WCSA 5IVBA 1JUIA 2GC1A 2XQXA 3KB5A 1E5IA 2ZX3A 1FX5A 3PUAA 1OLMA 2BWAA 4WVVA 5I0UA 3USUA 4UBGA 4Q4X2 1OH3A 1ZBA3 1JH5A 1RUC1 4HONA 3HBKA 1NAEA
chains in the Genus database with same CATH topology
4GJYA 3KV4A 4D6SA 5ISLA 2Q8DA 2YBKA 5F39A 4E4HA 5FZ6A 5CEHA 5F3EA 5F3CA 3K2OA 5FYYA 5A3PA 2YPDA 4UF0A 5FYZA 5A7PA 5A3TA 5FXWA 2OS2A 5F3IA 5FYTA 5FP3A 4D6QA 3UYJA 5FYHA 5A7WA 1VRBA 2Q8EA 4V2VA 3DXUA 2XDVA 5FP8A 5FZ4A 5IVFA 5K4LA 5A80A 5FZOA 5F5AA 4V2WA 5A1LA 3ZPOA 4DIQA 4CCLA 4HOOA 5FPAA 4DO0A 3AVRA 3AL5A 3U4SA 5FXZA 4CCNA 5FPLA 5A1FA 5FXVA 5ANQA 5F2WA 5FPUA 4XDOA 2XXZA 5FUNA 4CSWA 3N9OA 5LWBA 3N9NA 3DXTA 5FJKA 5FP9A 3PDQA 5A3WA 5F5IA 5FY0A 2YBPA 3KV6A 3K3OA 3NJYA 5FP4A 5FZGA 4XDPA 4LITA 4QXHA 3U78A 3PUSA 4EZ4A 4QX7A 2W2IA 4CCMA 5FY5A 5IVVA 5IVCA 3AL6A 5IVJA 4UF0B 4BXFA 4D6RA 2VD7A 2P5BA 2OX0A 4AI9A 3N9LA 3AVSA 2XUEA 4AAPA 5FWEA 3PURA 2PXJA 4QU1A 4CCOA 5FZ1A 4Y33A 5F3GA 3PTRB 4IGPA 5FP7A 5FZMA 5IVEA 3K3NA 4IGQA 5IWFA 5FZIA 4QWNA 5FZDA 2OT7A 5F5CA 2WWJA 5FZOB 5A3NA 5IW0A 2GP3A 5FZ7A 5KR7A 3N9QA 2OQ6A 5FZKA 5FY1A 5F37A 3KVAA 5FZEA 2YBSA 4QXBA 5FY7A 5FWJA 3N9PA 4GJZA 5FXXA 5FUPA 2GP5A 4LIVA 5FZ9A 4URAA 2YU1A 3OPWA 5FZBA 5A7SA 5FYIA 5F32A 5FYCA 4GD4A 5FZ8A 2WWUA 4EYUA 2YU2A 5FPVA 3OPTA 3ZLIA 4Y4RA 5FY8A 4ASKA 4LXLA 5IVYA 3PU3A 5FZHA 4LIUA 5A7NA 5LY1A 4TN7A 4CUGA 5FBJA 5FYMA 5A7WB 3LDBA 4C8DA 5A7QA 4BU2A 2OQ7A 3KV5A 3N9MA 5FY9A 5FZ0A 5FZLA 5FZAA 5LY2A 4CCJA 5F2SA 4EZHA 3KV9A 2XMLA 5FYUA 3PU8A 5FY4A 5FZFA 3PUQA 5LW9A 4CCKA 4GAZA 2Q8CA 4NUBA 3RVHA 3KVBA 5IVBA 3LD8A 5FV3A 5FYBA 4QXCA 5FJHA 5A7OA 4BISA 3PUAA 5FYVA 5FYSA 5E6HA 5FZCA 4Y3OA 5FZ3A 5FPBA 4HONA 4QX8A 4IGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GJY A;  3KV4 A;  4D6S A;  5ISL A;  2Q8D A;  2YBK A;  5F39 A;  4E4H A;  5FZ6 A;  5CEH A;  5F3E A;  5F3C A;  3K2O A;  5FYY A;  5A3P A;  2YPD A;  4UF0 A;  5FYZ A;  5A7P A;  5A3T A;  5FXW A;  2OS2 A;  5F3I A;  5FYT A;  5FP3 A;  4D6Q A;  3UYJ A;  5FYH A;  5A7W A;  1VRB A;  2Q8E A;  4V2V A;  3DXU A;  2XDV A;  5FP8 A;  5FZ4 A;  5IVF A;  5K4L A;  5A80 A;  5FZO A;  5F5A A;  4V2W A;  5A1L A;  3ZPO A;  4DIQ A;  4CCL A;  4HOO A;  5FPA A;  4DO0 A;  3AVR A;  3AL5 A;  3U4S A;  5FXZ A;  4CCN A;  5FPL A;  5A1F A;  5FXV A;  5ANQ A;  5F2W A;  5FPU A;  4XDO A;  2XXZ A;  5FUN A;  4CSW A;  3N9O A;  5LWB A;  3N9N A;  3DXT A;  5FJK A;  5FP9 A;  3PDQ A;  5A3W A;  5F5I A;  5FY0 A;  2YBP A;  3KV6 A;  3K3O A;  3NJY A;  5FP4 A;  5FZG A;  4XDP A;  4LIT A;  4QXH A;  3U78 A;  3PUS A;  4EZ4 A;  4QX7 A;  2W2I A;  4CCM A;  5FY5 A;  5IVV A;  5IVC A;  3AL6 A;  5IVJ A;  4UF0 B;  4BXF A;  4D6R A;  2VD7 A;  2P5B A;  2OX0 A;  4AI9 A;  3N9L A;  3AVS A;  2XUE A;  4AAP A;  5FWE A;  3PUR A;  2PXJ A;  4QU1 A;  4CCO A;  5FZ1 A;  4Y33 A;  5F3G A;  3PTR B;  4IGP A;  5FP7 A;  5FZM A;  5IVE A;  3K3N A;  4IGQ A;  5IWF A;  5FZI A;  4QWN A;  5FZD A;  2OT7 A;  5F5C A;  2WWJ A;  5FZO B;  5A3N A;  5IW0 A;  2GP3 A;  5FZ7 A;  5KR7 A;  3N9Q A;  2OQ6 A;  5FZK A;  5FY1 A;  5F37 A;  3KVA A;  5FZE A;  2YBS A;  4QXB A;  5FY7 A;  5FWJ A;  3N9P A;  4GJZ A;  5FXX A;  5FUP A;  2GP5 A;  4LIV A;  5FZ9 A;  4URA A;  2YU1 A;  3OPW A;  5FZB A;  5A7S A;  5FYI A;  5F32 A;  5FYC A;  4GD4 A;  5FZ8 A;  2WWU A;  4EYU A;  2YU2 A;  5FPV A;  3OPT A;  3ZLI A;  4Y4R A;  5FY8 A;  4ASK A;  4LXL A;  5IVY A;  3PU3 A;  5FZH A;  4LIU A;  5A7N A;  5LY1 A;  4TN7 A;  4CUG A;  5FBJ A;  5FYM A;  5A7W B;  3LDB A;  4C8D A;  5A7Q A;  4BU2 A;  2OQ7 A;  3KV5 A;  3N9M A;  5FY9 A;  5FZ0 A;  5FZL A;  5FZA A;  5LY2 A;  4CCJ A;  5F2S A;  4EZH A;  3KV9 A;  2XML A;  5FYU A;  3PU8 A;  5FY4 A;  5FZF A;  3PUQ A;  5LW9 A;  4CCK A;  4GAZ A;  2Q8C A;  4NUB A;  3RVH A;  3KVB A;  5IVB A;  3LD8 A;  5FV3 A;  5FYB A;  4QXC A;  5FJH A;  5A7O A;  4BIS A;  3PUA A;  5FYV A;  5FYS A;  5E6H A;  5FZC A;  4Y3O A;  5FZ3 A;  5FPB A;  4HON A;  4QX8 A;  4IGO A; 
#chains in the Genus database with same CATH topology
 3MYX A;  2JG9 B;  2EIC A;  1QNW A;  1GOF A;  4B4Q A;  1F8V A;  1W8U A;  3K46 A;  5JUV A;  2ZA9 A;  3WDT A;  1A8M A;  3N7L A;  4YGE A;  2D6P A;  1G9F A;  4UW5 A;  4X8P A;  3W5M A;  4LK6 A;  4MXV A;  2VTX J;  5FMO L;  2D44 A;  1UOG A;  4XFI A;  4RS5 B;  3K51 A;  5A3L A;  4Q1P A;  5A3T A;  2GC3 A;  4LBK A;  2RJL A;  1UYP A;  1O4Z A;  1REF A;  1UOB A;  1UY4 A;  5J96 B;  3EMR A;  2XVG A;  1FPN 3;  1ZBE 1;  3ATG A;  1S0C A;  2Y6G A;  4ZZ5 A;  1OSG A;  4QD2 A;  2R1D A;  3OD4 A;  5FYH A;  3RI8 A;  3BI3 A;  4JTN A;  3KT1 A;  2GN7 A;  5DXD A;  2D6O X;  4K9S A;  3S6P A;  4LKD A;  4BQ2 A;  5T50 A;  4CCL A;  1O4Y A;  4Y1Z A;  3KMH A;  4MSV A;  4U2A A;  3R05 A;  1CVN A;  1Y9G A;  3A23 A;  1DYO A;  1QJF A;  2CY6 A;  4KWL A;  4RN5 A;  3VDC A;  4UFM A;  5L7O B;  3OJB A;  4WM7 B;  1RUN A;  2GMP A;  2K9Z A;  4GIQ A;  4COY A;  3BAL A;  4Q0V A;  1LOF C;  1SLI A;  3ITQ A;  4XUT A;  3ZKU A;  1RUD 2;  5LK5 A;  5JPM B;  1LUL A;  4X6R B;  4ZS2 A;  5C9A B;  1VB2 A;  2D98 A;  4PI0 A;  3NMB A;  1GZW B;  4IET A;  4LE3 A;  1BEV 3;  3WT3 A;  2E32 A;  2OUH A;  3I3M A;  5IT6 A;  3O1S A;  3RYR A;  2PHU A;  5DAQ A;  4SBV A;  1HRI 3;  2PTM A;  2BWC A;  4I09 A;  1NXD 1;  3LKJ A;  4RHV 2;  4LK7 A;  4GMP 3;  4N90 A;  1OQ1 A;  1LES A;  3ZR6 A;  4YZ5 A;  1HJG A;  5FWE A;  5L9V A;  3E6B A;  4IV3 B;  3LDK A;  1QQP 1;  1NOV A;  5FP7 A;  3W5N A;  2Y6J A;  5CBL A;  4XTP A;  3FWE A;  3BKZ A;  2ZGN A;  3ROU A;  3ZN5 A;  3GYD A;  1DCS A;  2DFB A;  3PTY A;  4XF1 A;  5HXM A;  2JDA A;  3GHN A;  1UY0 A;  2XLA A;  1VBD 2;  2YBS A;  4YW4 A;  3D5O A;  3MZH A;  4GB3 1;  2VVD A;  1TE1 B;  4RL7 A;  2ZAA A;  3D3A A;  3J8F 2;  3O0W A;  2V4V A;  5DG2 A;  4ZXK A;  5KHK A;  1OH4 A;  2VW0 A;  4HBN A;  2FMY A;  5ACA 2;  5CB7 A;  5DMY A;  2XWJ B;  1W6N A;  2XLG A;  4QQO A;  3ZXL A;  5K0U B;  4MVT A;  3OPT A;  2QVS B;  5C9A C;  1US2 A;  1MVQ A;  2VZ3 A;  2ZEW A;  3Q8E A;  4Y4R A;  3LEM A;  1EV1 2;  3CBN A;  3JBG 2;  5D1I A;  3WP3 A;  5FO9 B;  3OYW B;  1XYP A;  4N8M A;  1F5F A;  2V09 A;  1HQL A;  1BBT 3;  1VBC 1;  4YWA A;  1JYX A;  1S55 A;  3WV6 A;  3DN7 A;  1JN2 P;  2CV6 A;  5GLZ A;  3U37 A;  4FOQ A;  3UT0 A;  4BU2 A;  1VIW B;  3HPN A;  2XQR A;  3ASI A;  2LS6 A;  3POG A;  1Z0H A;  1CWP A;  4QDR A;  1EP0 A;  1QMJ A;  3PIG A;  4IV3 C;  5EHD A;  1KEX A;  2B42 B;  3DPR A;  3NAP C;  3S7E A;  4XJU A;  5FZF A;  3PUQ A;  1F35 A;  4F83 A;  1WW6 A;  1YJL A;  3OBA A;  5CFC A;  1CX4 A;  1ASJ 1;  2YMZ A;  2E7Q A;  3R4U A;  3B7M A;  1KQR A;  1XB9 A;  1QF3 A;  2RDQ A;  1AR8 1;  3HN1 A;  4QX5 A;  3I59 A;  5FPB A;  1VBE 3;  2OPK A;  1M06 G;  3MUZ 1;  1W90 A;  2WYF A;  4NMI A;  4L9B A;  4XJ8 A;  5LAS A;  5IK8 A;  5A3O A;  3I54 A;  2VBP A;  4NPR A;  1AUY A;  3PLQ A;  1OVS A;  3VD5 A;  4RSU A;  4ES8 A;  5FZ6 A;  1HW5 A;  3FL7 A;  1B35 A;  4UF0 A;  5K0U C;  1OUS A;  1WCQ A;  1LJ7 A;  1R64 A;  1TME 3;  3AMN A;  3I4I A;  5H9R A;  3N4M A;  1NCQ A;  5DAB A;  2VZR A;  2XJR A;  4UWD A;  1CN1 A;  1LOD A;  3ZSJ A;  4BK4 A;  4WVM A;  2FDJ A;  2VU9 A;  1LKN A;  2NZ9 A;  5LA0 A;  3S30 A;  4Z1V A;  4IV1 B;  2IXL A;  3AP9 A;  4FOW A;  5C8C C;  4EE2 A;  3THC A;  3WQB A;  5CKQ A;  1L3J A;  4AAX A;  5EIY B;  4JGZ B;  4MGZ E;  4BA6 A;  3Q8F A;  5GJ6 A;  1GU3 A;  1YFX A;  3D0J A;  2R6Q A;  3WUD A;  4DEQ A;  1OQD A;  3KT4 A;  2R07 2;  3ZYJ B;  4CDX A;  1QJX 2;  3ZO0 B;  4N43 B;  1L7L A;  1SCS A;  4P9G A;  2WS9 3;  4LLF A;  1O7F A;  2ADD A;  3NJY A;  1XJA A;  4Q4W 3;  5DAP A;  4DNY A;  4NRM A;  1F5J A;  1PMJ X;  1ULD A;  4AFA A;  5EZW A;  3JD7 2;  4BLJ A;  3T1L A;  2P3Y A;  5IVJ A;  2HWC 3;  1EAH 2;  3U1X A;  2BEO A;  1PVC 3;  2IWG B;  4J1X A;  5L9R A;  2W47 A;  1KXG A;  4CDQ B;  3SQO A;  2BOJ A;  5DN2 A;  2VMG A;  3KCC A;  3BYW A;  1QOO A;  2XBO 1;  3VBS C;  3W58 A;  3ZFF C;  2EA7 A;  3TEX A;  2VCB A;  4YZ2 A;  5IWF A;  4JQT A;  1PMI A;  1O4T A;  5LB6 A;  4M3C B;  2NM1 A;  2Y0O A;  2OUJ A;  2ORZ A;  4LKS A;  4GH4 B;  3W59 A;  1H6Y A;  3IIA A;  2KXL A;  3HOB A;  2IXC A;  3KCY A;  1WCS A;  3VB9 A;  3N9P A;  1EPW A;  2W1S A;  5C33 A;  5JOY A;  4FSJ A;  1BKZ A;  3I8T A;  5HCH A;  3DYO A;  5FYI A;  4BM8 A;  3VBO B;  3T2T A;  1SLA A;  3LIH A;  4OUM A;  3IDC B;  4WZF A;  1R09 2;  3WEZ A;  1CZS A;  2JJ6 A;  4XYX A;  4N43 C;  3RZZ A;  1LHV A;  1HN0 A;  4XHX A;  2R32 A;  3WY6 A;  1SMV A;  3UET A;  5FYM A;  2VW1 A;  4OZX A;  3RRD A;  2V5Y A;  2AEN A;  1AR6 3;  3R4S A;  4PDW B;  5GLW A;  3UES A;  3PVO A;  1H6X A;  3MIC A;  2RS5 2;  1E5H A;  2NYY A;  1IQA A;  4CDQ C;  2J1U A;  4QDQ A;  2QJV A;  1PMH X;  3KGZ A;  4BYY A;  5KHI A;  3CHX A;  1PM7 A;  2A6Z A;  1U0A A;  4HSL A;  1W05 A;  4NUB A;  5A6Z A;  3BU0 A;  5FYB A;  2X8K A;  1ZRI A;  3WHU A;  4LMF A;  3H3Z A;  4FP2 A;  1TMF 1;  1RUI 1;  3RMX A;  4KWU A;  2ZEY A;  2W1Q A;  2ZML A;  2Q4S A;  4XCB A;  3LE0 A;  2Z4F A;  5FMO S;  3WW2 A;  2JG8 B;  2WZP P;  1CAU A;  4E4H A;  4QKF A;  3HT2 A;  1WD4 A;  1OA3 A;  2J1T A;  1AXY A;  3KSC A;  2W94 A;  3OGG A;  4YSF A;  2J1S A;  2DCT A;  1LOB A;  1CX1 A;  3VDD B;  4NII A;  4BQX A;  2RHP A;  3IDE A;  4IEV A;  1AYM 3;  2D6N A;  2ARE A;  2PYT A;  1ND2 A;  2GMM A;  1FAY A;  1MEC 3;  1YQ5 A;  2HLE A;  3AX4 A;  3DXU A;  3MF6 A;  4FPC A;  3I97 A;  5C70 A;  1RED A;  1SCR A;  2Y60 A;  3D82 A;  5F5A A;  4DIQ A;  2WNE A;  3LFI A;  4P9Y A;  1G86 A;  4HKL A;  1Q8O A;  4UW6 A;  4M4R A;  4XQD A;  1VAK A;  2J1R A;  5LBF A;  3U11 A;  3ZDV A;  4PLM A;  1JU4 A;  1RUF 2;  1H1I A;  4NAM A;  4LHL A;  5FLJ A;  4WVW A;  2DCZ A;  1VBB 3;  3VLB B;  1W6M A;  2AAC A;  1HDK A;  4YM2 A;  2VUA A;  5K8S A;  1K3I A;  4LIT A;  5JXH A;  5G05 L;  3ZYG A;  4IEY A;  1H8T A;  1EY2 A;  3I2I A;  3PVE A;  4YGD A;  5E1R A;  4FOY A;  4ZU4 A;  3B69 A;  4K40 A;  4LOS A;  3KHB A;  5JMC A;  1DU3 D;  3J9S A;  4DIN B;  3AMM A;  1FOD 2;  1HIX A;  1WWY A;  2P5B A;  3CJX A;  5A1A A;  3PNA A;  2XUE A;  3PME A;  1C1L A;  2WSV A;  2QE3 A;  3JUU A;  3MW2 A;  2VNG A;  2BOI A;  2JKX A;  3UV9 A;  2YV8 A;  1AL2 2;  2FMD A;  5IVE A;  3DV8 A;  4NVP A;  2JE8 A;  4BLI A;  1SFP A;  4NIH A;  4K8F A;  3E1F 1;  3USU B;  4QGL A;  2GP3 A;  2PHF A;  3VD4 A;  3TEY A;  2VCA A;  2DFC A;  4XJW A;  2VZU A;  5FMD A;  3GHM A;  2TBV A;  3BU7 A;  1U12 A;  2RM2 1;  3PJQ A;  1V0A A;  4J6G A;  4XDQ A;  4OI1 A;  3SXW A;  5IAX A;  3GGL A;  1R08 3;  3VBH C;  4QPY A;  3BTA A;  3HQU A;  4AI2 A;  4WM8 B;  1XE7 A;  1LOA A;  1GP6 A;  3MLK A;  2AR6 A;  2NLR A;  1N1Y A;  3UJQ A;  5CYY A;  1EUT A;  1XBF A;  2W87 A;  3WW4 A;  2WFP A;  3GXU A;  2C5D A;  4UFI A;  4XTM A;  3FFQ A;  3HJR A;  4LIU A;  3AFK A;  1XNK A;  2UY9 A;  3A4U A;  4RS5 A;  4XJA A;  1CPN A;  4Y1Y A;  4HL0 A;  2HBT A;  4CXY A;  4FPF A;  3KM5 A;  5A7Q A;  3H50 A;  2B46 X;  4P9I A;  5AC9 1;  1LOC A;  1HKD A;  1E57 A;  4JAA A;  2H6C A;  4YFW A;  5J09 A;  1YO8 A;  3NJZ A;  1RIT A;  1W9W A;  3I3D A;  3KF5 A;  3RI9 A;  2F4P A;  3ZXK A;  5FV3 A;  4XQW A;  5L7O A;  2HKX A;  3CJI B;  1LHN A;  4WM7 A;  3V56 A;  5EQU A;  3ZYP A;  2G9G A;  4BJ0 A;  3MW4 A;  2BBV A;  2WIN B;  1G9B A;  4JVA A;  5EP9 A;  1NE6 A;  1MS3 A;  2WT0 A;  3ACG A;  4ERO A;  3T3Y A;  1K5M B;  2QDN A;  1GZW A;  4XHB A;  1D4V B;  1TG7 A;  2F17 A;  1V9U 3;  4FOV A;  5FO7 B;  4OHX A;  4CCD A;  4QAW A;  4XAA A;  4FPY A;  5HV0 A;  3EO6 A;  1RUH 3;  5E88 A;  5JZG B;  2D97 A;  3I2J A;  4BQW A;  4LBQ B;  2OS2 A;  2HWE 2;  2TEP A;  3H8R A;  1ENQ A;  1XC6 A;  5C3P A;  2ZGP A;  3OY8 B;  2ILM A;  1ZA7 A;  3IZO A;  4Q4Y 3;  4AED B;  2FBE A;  2RS3 2;  3I2G A;  3MI8 A;  3H0O A;  2ARC A;  4AEM A;  4LQR A;  2R7E B;  5FP8 A;  1CAW B;  3BUC A;  1WW4 A;  4ITC A;  1ZM1 A;  2BER A;  1NY7 1;  4NIA A;  2GH8 A;  4GZ9 A;  4GKX A;  1PM4 A;  5F2W A;  3AFG A;  4IND A;  4MHR A;  5FBZ A;  2XKP A;  5JXI A;  3OUJ A;  4CA9 A;  3IWZ A;  1AYN 1;  3DGT A;  3TN9 3;  5A3W A;  1DP0 A;  2EF6 A;  5CNA A;  1Q8V A;  2QCS B;  2WL1 A;  3JCI A;  2CWS A;  5T5L A;  1ST8 A;  3KT7 A;  3RPQ A;  1BMV 2;  2X53 S;  4A6S A;  2D6L X;  1HRV 1;  4D6R A;  3OYW A;  2P6C A;  3VBR B;  2VMI A;  4QPW A;  1OLQ A;  3N9L A;  4FT8 A;  3VHP A;  4YZ3 A;  1AR9 2;  3AK0 A;  1O3Q A;  4EWA A;  5JWP A;  3SEP A;  3A21 A;  3A7Q A;  2V72 A;  4IGP A;  3ZX7 A;  1PIV 3;  1W04 A;  4Y1V A;  2WO7 A;  4NHY A;  4URT A;  4XEZ A;  4CPB D;  5A6X A;  1YQ2 A;  4XF3 A;  1P8J A;  5IW0 A;  2VUC A;  5FZ7 A;  4NIG A;  2IC1 A;  2YHJ A;  2IUW A;  2R06 2;  4N53 A;  1YRZ A;  4L99 A;  3RS6 A;  4O9E A;  4UAP A;  4Q0P A;  5KC5 A;  4AVC A;  4AVS A;  1V6L A;  3S0M A;  2A1X A;  4UOJ A;  1N1T A;  1S0E A;  2DTW A;  3POJ A;  4M3C F;  4WV8 A;  3M3Q A;  5FZ9 A;  5H9Q A;  4ATF A;  4IW3 A;  4RGK A;  4E2Q A;  3JU9 A;  4A2U A;  2WA3 A;  2ETE A;  4L2N A;  3VKO A;  5FMC A;  1YQ6 A;  4LO8 A;  3WNX A;  3O1P A;  1NCQ B;  2BGP A;  2EXJ A;  1Y3T A;  3ILR A;  4OMC A;  4DEV A;  3VL9 A;  2MEV 2;  2W5F A;  3FBM A;  1LED A;  4WVM B;  2WO2 A;  1GWL A;  5HI0 A;  2VO5 A;  1W8O A;  1OQE A;  1X8M A;  4KG8 A;  3O5S A;  1JUH A;  2WFF 2;  1RJ7 A;  3AKT A;  3GM8 A;  4MGQ A;  1ZBA 1;  4P9J A;  3KV5 A;  3FLR A;  5FZ0 A;  1BVP 1;  3SEE A;  3ZXA C;  4BK5 A;  2HWD 2;  5BNN C;  2QZ2 A;  4CCJ A;  2W95 A;  3GJA A;  3DPR C;  3T0B A;  1K42 A;  4S2F A;  1JYC A;  2HJI A;  2UU8 A;  4IV1 A;  2ZMN A;  4YPJ A;  1QH7 A;  4CEY B;  5CFC C;  4DUX A;  4PI2 A;  5A70 A;  2BGC A;  4CDX B;  2W1U A;  4IE5 A;  1BXH A;  2ZGR A;  4CUC A;  4XW3 A;  1UXZ A;  2ES3 A;  1CGP A;  1HB2 A;  1WMF A;  4JGZ A;  2J1A A;  1COV 3;  1WMD A;  5JSO A;  1VAL A;  2H0B A;  1DGW X;  2HWB 3;  2ZX0 A;  3GNE A;  5A3U A;  2WAO A;  1Y4W A;  1FPN 1;  1ZX5 A;  5CG8 A;  1QJY 2;  1BJQ A;  2W46 A;  5GLV A;  2HEV F;  1HX6 A;  3AJZ A;  5BUV A;  4GJY A;  1YXW A;  3KV4 A;  4UFH A;  4EN8 B;  5FR3 A;  4YM0 A;  1Z7S 3;  2RMU 3;  2FQP A;  4MLO A;  3WF4 A;  4KGQ A;  2CGN A;  5JXJ A;  5CEH A;  1B35 C;  1AX1 A;  4UI9 L;  5AFE A;  1SLC A;  1NCQ C;  1RJ8 A;  1S4C A;  3C7O A;  3RSJ A;  3SIT A;  4QKB A;  4YVS A;  5FYT A;  2VMD A;  1GP5 A;  5KC6 A;  1D4M 3;  2RV9 A;  4CTE A;  4MGT A;  3AKQ A;  1J3P A;  1MS0 A;  1W0N A;  4BQ3 A;  4X8N A;  5IVF A;  1BEV 1;  3H8U A;  1S2K A;  2PFW A;  4GH4 A;  2EAA A;  2YC2 A;  3AMP A;  1GNZ A;  3C8X A;  4PIX A;  1HRI 1;  3MPB A;  4MGI E;  1OD5 A;  5IHR A;  4YYO A;  3BN6 A;  5LEJ A;  2DUR A;  4GMP 1;  4YW2 A;  2WBK A;  3KGL A;  3VZL A;  3K4Z A;  3NQH A;  5FOJ B;  1PZ7 A;  1TEI A;  1X82 A;  3AZX A;  3JXS A;  4CDX C;  2Y6F A;  2ZHN A;  3HNY M;  2VZP A;  4FPL A;  4PF1 A;  3MPP G;  4Z07 A;  4BQ1 A;  2IXK A;  3PDQ A;  1SFN A;  4MXW A;  2UUR A;  1J1L A;  3NNM A;  3VBO A;  1HQN A;  1I1E A;  5LRS A;  1KRI A;  2VOX A;  4R52 A;  1YJK A;  2YZ4 A;  1GZT A;  1RUC 2;  2J7M A;  3M7A A;  2JE7 A;  4QXH A;  5LAT A;  3TB0 A;  4A41 A;  1JYT A;  1D0H A;  1NCR B;  3OD0 A;  1JHJ A;  2XL7 A;  3CO2 A;  1J3Q A;  1WA6 X;  4NJ4 A;  4BXF A;  5EV7 A;  5A33 B;  3OPZ A;  1H0B A;  1S1A A;  2G9F A;  1SDW A;  1QDO A;  5JI7 A;  5BNP B;  1LGB A;  4PDW A;  2PA7 A;  1Q8Q A;  2CWM A;  1XNT A;  4B4R A;  1PHM A;  3WOG A;  2PHR A;  1OKO A;  1IG3 A;  5T5O A;  1X36 A;  1PVX A;  1PX3 A;  4YW5 A;  1ZBE 2;  5FY1 A;  3VZM A;  5FZE A;  1UL9 A;  3MEP A;  2J1V A;  1GZ9 A;  4GJZ A;  3UKV A;  1BBT 1;  3JQX A;  3WZ1 A;  2VH9 A;  3JB4 C;  3N7J A;  4FFH A;  4YM1 A;  2GP5 A;  3ZYI B;  1CAU B;  4BPZ A;  3WF3 A;  4GQ7 A;  2DVF A;  2B9U A;  2E6V A;  3THP A;  4AI8 A;  5EYY A;  2GNT A;  2VOW A;  4Y24 A;  1OPO A;  1V70 A;  2RR1 3;  4L0P A;  2EIE A;  4CCC A;  4M00 A;  3JZV A;  5DUU A;  1JHN A;  2JG8 A;  1SZB A;  3IM0 A;  4LPL A;  5C4W B;  4QKN A;  5B2G B;  3SKJ E;  2UY8 A;  2ZOE B;  2QQK A;  2RDS A;  3C7H A;  3FHA A;  4Y1X A;  4CE8 A;  5BNO B;  4CUG A;  4MGK E;  2VBD A;  4QU2 A;  5GLT A;  4PHZ A;  1LU1 A;  1ND3 A;  3KLS A;  4AQT A;  4IQP A;  1VBE 1;  3OCP A;  3VDD A;  4KU8 A;  3P5B A;  3HQR A;  2DYC A;  5F2S A;  3UK9 A;  4QT6 A;  4CUB A;  4BB3 A;  1ULC A;  2C26 A;  4OHW A;  2JIC A;  1Y43 B;  1QQP 2;  3BPS A;  5I0T A;  1OOP A;  3C7G A;  3WP5 A;  1AR7 3;  2Q8C A;  4LHS A;  4AFB A;  2JD9 A;  3T0D A;  1ZA4 A;  2UWB A;  1L7R A;  3NJV A;  4KL1 A;  3WDU A;  3O14 A;  1TME 1;  1W6M B;  1H1A A;  5CU1 A;  4BIS A;  3QH6 A;  2ZPX A;  4H55 A;  3T08 A;  5ERL A;  3O1V A;  2P37 A;  1YFW A;  3DEC A;  4GA9 A;  4GB3 2;  4N7I A;  4K7J A;  4CXX A;  5FDB A;  3FUQ A;  3O0V A;  4AHY A;  4LOT A;  3QLQ A;  3LZZ A;  4JTO A;  2VUJ A;  2CTV A;  3KQR A;  2QQU A;  3E5U A;  1OBN A;  5L73 A;  4K6B A;  4XIK A;  4AFC A;  3ZYF A;  3GJB A;  2W9X A;  1K5J A;  5I0R A;  3ORJ A;  5FUI A;  2X09 A;  3GBG A;  3UGG A;  4ZS3 A;  2QQW A;  3ZSE A;  3H1M A;  2W3J A;  3TRS B;  3ZOI A;  1CR7 A;  1TQ5 A;  5BXX A;  1PO2 3;  5APA A;  1ND2 C;  1OVP A;  2Q5T A;  2AYH A;  5DZE A;  5F6K A;  4DB5 A;  3KHC A;  1VBC 2;  2WS9 1;  3K48 A;  4G9S B;  2R49 A;  4QX1 A;  4Q4W 1;  4Z92 B;  3AYE A;  4HKW A;  4K21 A;  4I02 A;  4F7Z A;  4Q8K A;  4XMI A;  1Q8P A;  3ZXJ A;  4QM8 A;  4BME A;  1BCX A;  2HWC 1;  4IUG A;  4XFH A;  1OLR A;  1BVV A;  4NHM A;  5J48 A;  1PVC 1;  2WQZ C;  1RL3 A;  1LCL A;  2FDG A;  1RMU 3;  3MF9 A;  3N9O A;  4D7S A;  3MFC A;  5HCB A;  2R0F A;  1ZZ9 A;  2VEC A;  2EID A;  5D8A B;  4G3Y C;  4CU9 A;  1ASJ 2;  5C7G A;  2VXJ A;  4WM8 A;  5EYX A;  2WZR 3;  1MS8 A;  3H3L A;  4QB2 A;  4XUO A;  1AR8 2;  5JR2 A;  5HCF A;  1H8T C;  2DVB A;  3U78 A;  5FLI A;  2IXJ A;  1ZZB A;  2BNN A;  4YVW A;  1ENS A;  3M3O A;  3WF2 A;  4CCM A;  1W2T A;  4LBM A;  1HXS 3;  5GLU A;  2NPI A;  1FYU A;  4AI3 A;  1FMD 3;  4S2G A;  4CDW A;  3OTF A;  5I0S A;  2OX0 A;  5FLH A;  1RVF 3;  2RE9 A;  3PUR A;  4HSJ A;  4QU1 A;  1ZVF A;  1YUD A;  3BIW E;  1VP6 A;  4FFG A;  4SLI A;  4E8C A;  1JZ3 A;  4FTB A;  4R4X A;  1NA1 A;  1ODM A;  5C71 A;  2D5F A;  2ZXQ A;  1Y9Q A;  1W6P B;  5CVR A;  5FZO B;  2VAU A;  3H42 B;  2PQQ A;  3VHO A;  2PLV 3;  2WT1 A;  2DTY A;  4NID A;  2E26 A;  2Q1Z B;  5JVV A;  1PK6 B;  3CF6 E;  1MS4 A;  3TWI A;  1CAX A;  1GR3 A;  2DF7 A;  1AR6 1;  3CJI A;  1UZV A;  2ZEZ A;  1AX2 A;  1X33 A;  2OKX A;  2JG9 C;  5H9P A;  1O8P A;  5F1R A;  1K5M A;  1QNY A;  2AEY A;  4NRQ A;  4FFI A;  3VKL A;  4ASK A;  1A8D A;  2YGM A;  1UU6 A;  3LEK A;  4RS5 C;  1CIY A;  5FZH A;  3UGH A;  4AF9 A;  5JZG A;  3LDB A;  1SBD A;  4KI5 M;  4LBQ A;  1W9S A;  1W28 A;  2BVB A;  2WC2 A;  3S5Q A;  1HB1 A;  2DCJ A;  5LA1 A;  1PO1 3;  1AX0 A;  1QHD A;  3OY8 A;  2D3P A;  4ZHN A;  4AED A;  2SLI A;  4IER A;  5KBF A;  2DCK A;  1C5I A;  2JDH A;  4YZ1 A;  1MS5 A;  1Q3E A;  4C0H A;  1CAW A;  2XBO 2;  4BE3 A;  3NV1 A;  3TEW A;  2W39 A;  3M70 A;  4CCK A;  2IZW A;  5L7O C;  3NKT A;  2C6S A;  5CAZ A;  2JIJ A;  3LD8 A;  2RVA A;  2NMN A;  1DQ4 A;  1UYZ A;  4IE7 A;  4JRL A;  4QXC A;  4WM7 C;  4AR2 A;  5A6Q A;  3VZN A;  2ATF A;  2BNM A;  1X9T A;  2P4E A;  1J1T A;  4LBL A;  4QMA A;  1AYM 1;  1JI6 A;  4RQP B;  4W50 A;  2BDR A;  1MEC 1;  1POV 0;  1IS6 A;  2BU9 A;  2YFU A;  3ZDS A;  1VRH 3;  2CYF A;  5E16 A;  3PIJ A;  2FCU A;  2OYZ A;  5F3C A;  4LR4 A;  1RUE 3;  3QH7 A;  3HEI A;  1UQX A;  2NN8 A;  3K75 B;  2XB6 C;  1NZI A;  3VBR A;  4ZON A;  3L2Y A;  5D21 A;  5A32 A;  1A34 A;  4MYE A;  4N53 B;  1VBB 1;  4FAH A;  3A0K A;  4B7K A;  2ZGO A;  2O14 A;  3DCQ A;  2BV4 A;  3UGF A;  1NYW A;  2A70 A;  5C6C A;  4OFG A;  4E4D X;  3FUO A;  2D6M A;  1LTE A;  3E6C C;  4RFT 0;  4MUV A;  1JYI A;  2DV9 A;  2DUP A;  3NST A;  1Q8S A;  3ZXE A;  4C0B A;  1OF4 A;  2VQA A;  5ANQ A;  1AZD A;  4RGA A;  5SV5 A;  2AH2 A;  4CSW A;  4P08 A;  2QQJ A;  1JOP A;  2VVF A;  2WYS A;  4UFL A;  3K77 A;  2DVA A;  5I91 A;  4Y5Z 0;  1TMF 2;  1RUI 2;  5FZG A;  5C8W A;  5JI9 A;  1QXR A;  5T5P A;  4DRV A;  2W92 A;  4IEZ A;  2QQL A;  4CEW A;  1NUK A;  5AVP A;  1VBA 3;  3N7M A;  3ST7 A;  3I2F A;  4CDU A;  1WBL A;  1WW7 A;  1G9A A;  3AVS A;  3J7L A;  1R08 1;  4HN0 A;  4LEJ A;  1CZV A;  3C7E A;  4E27 A;  1JU3 A;  2BW8 A;  3DEM A;  1C3H A;  2H6B A;  1C8N A;  5CG9 A;  4MG2 A;  2ZZJ A;  4ZZ8 A;  2UYA A;  2ZGL A;  5F5C A;  2YRO A;  1MPX A;  1QEX A;  3ZN6 B;  4N53 C;  3WW1 A;  4D3W A;  1D2Q A;  1BZW A;  2AZ5 A;  1DQ0 A;  4CEY A;  2KR2 A;  2WWS A;  4XFB A;  2EIG A;  1T2X A;  5DUW A;  5DUX A;  4DOU A;  2YB7 A;  1KFU L;  4P5H A;  5HPO A;  2A3Y A;  2HWF 3;  3NJX A;  4PQQ A;  1GMM A;  2BFU L;  5F32 A;  1NZC A;  1DF0 A;  2WAA A;  3HAG A;  3FN9 A;  1MS9 A;  4CVU A;  1RUG 3;  4TLF A;  4EYU A;  3OGJ A;  5FPV A;  5T5J A;  4YVS B;  5J3U A;  1WLW A;  4QB1 A;  4FXK B;  5EJZ B;  1UKG A;  1XQN A;  4GWM A;  3QAC A;  3AYA A;  4LXL A;  5IVY A;  1F15 A;  2Z69 A;  5LY1 A;  1ZRC A;  4OYU A;  3BIE A;  2QDR A;  1RUJ 3;  4PF5 A;  4Q4V 3;  1C8M 3;  2WDB A;  4XVH A;  3ZYR A;  4BIO A;  5BYN A;  4W6X A;  4R9C A;  1O59 A;  4IEQ A;  4OZO A;  3RDI A;  4A7Z A;  4FAG A;  4TXW A;  5JAX A;  3CL1 A;  4XF4 A;  3EQE A;  2GC0 A;  3NV3 A;  4FXG B;  4IV1 C;  1R1A 3;  2BP6 A;  3E5X A;  1OA2 A;  2BGO A;  1S0B A;  2R04 3;  4YW3 A;  1V9U 1;  5IK4 A;  3BTY A;  3NV2 A;  3RVH A;  4JGZ C;  2VW2 A;  1RUH 1;  1T6G C;  3H1W A;  4KGG A;  4MXW B;  1C5H A;  2VCC A;  1SPP B;  3K4D A;  5FYV A;  5IUQ A;  2ZGS A;  2KA3 A;  3GBW A;  3OBR A;  4Q4Y 1;  1UOF A;  2A3X A;  2RM2 2;  1LHW A;  2WII B;  3FE5 A;  3M4F A;  3LGR A;  3SH3 A;  4ORF A;  4D0Q A;  4D6S A;  2JDM A;  2K2S A;  2YBK A;  1U5I A;  4LHN A;  1DGW A;  4A3Z A;  5E8A A;  2N7G A;  1NCR A;  3ZSL A;  2OII A;  5A33 A;  1G7Y A;  3RG0 A;  1SHW B;  3R4D B;  2VTX A;  4YVS C;  2MNG A;  3I7D A;  4AFD A;  5J36 A;  1W3X A;  5HXV A;  1UWW A;  4GWN A;  5BNP A;  3BCW A;  4MX3 A;  4D6Q A;  1ULP A;  3TN9 1;  2A6X A;  5KXE A;  3MIB A;  4EWE A;  3JB8 A;  4MOA A;  2Q8E A;  4V2V A;  1NT0 A;  1HN1 A;  2ERF A;  1QY4 A;  4GH4 C;  3I49 A;  5AC9 2;  5DDJ 3;  3AVR A;  1W9T A;  4I30 A;  1GKB A;  5FXV A;  4E2S A;  3OB8 A;  2XLF A;  4XDO A;  3SNM A;  3HMY A;  3X29 B;  5LWB A;  3N9N A;  4XE9 A;  3BOP A;  3SC7 X;  3VBO C;  3WP4 A;  1PIV 1;  2HEY F;  3QOP A;  5FY0 A;  1DQ6 A;  2YBP A;  1H4G A;  3R6S A;  3VL8 A;  3ZYH A;  5IAT A;  3K3O A;  4IXL A;  2QQO A;  2WNV A;  4OCT A;  3S7I A;  1AF9 A;  1ND3 B;  4HVR A;  4M0H A;  1VR3 A;  5C4W A;  2W2I A;  5DAX A;  1S0I A;  3TNQ A;  4I3G A;  2ZHL A;  5FY5 A;  1IPJ A;  5BNO A;  1C4R A;  2PHD A;  2CAV A;  3RMY A;  4PDW C;  4AAP A;  5B4X A;  4KH9 A;  3ZKY A;  1OOP B;  3AZW A;  5FQ0 B;  2R0H A;  2VOK A;  3PTR B;  4A6O A;  2LRP A;  3MHZ A;  3T09 A;  2JWP A;  5FZD A;  5JOX A;  1Y9M A;  2XJT A;  1QJU 3;  2RS1 3;  1RHI 3;  4MZU A;  3O1T A;  1KDM A;  3O7O A;  5KXB A;  2ZGK A;  1WLD A;  4MGS A;  4RR3 B;  4LBO A;  4W6W A;  5FY7 A;  4PBP A;  2VY0 A;  1SAC A;  1NY7 2;  5F5Q A;  2ENR A;  3OPW A;  4XPV A;  5JIA A;  2JG8 C;  1OI6 A;  4QB6 A;  4TWT A;  5CFD B;  5FZ8 A;  5LCW L;  3WQ7 A;  1YI7 A;  4LA2 A;  4ONU A;  1AYN 2;  5CKM A;  3POF A;  3ZFG A;  4HAN A;  1SLT A;  4GWJ A;  4BOW A;  1J84 A;  1S0G A;  3VZK A;  4Q4X 3;  1COV 1;  2HWB 1;  1XU2 A;  4I2O A;  3I2H A;  3VN4 A;  2ARA A;  2ZGU A;  5EJ3 A;  3VDD C;  3VDA A;  1CJP A;  2XJQ A;  3HQX A;  1DIW A;  4C8D A;  1RB8 G;  5FY9 A;  1S2E A;  1HRV 2;  2JD4 A;  5FPX A;  1U5Y A;  3VBU B;  1DDL A;  4ISQ A;  2ZX4 A;  3KV9 A;  1DZQ A;  1Z7S 1;  2RMU 1;  3ZVX A;  1OOP C;  1CAV B;  5FYU A;  2JKB A;  2W91 A;  1GQH A;  4LUK A;  2C24 A;  4GAZ A;  5KXC A;  2EAK A;  2NQY A;  2PHT A;  4FBF A;  5JXG A;  2VBB A;  3HN3 A;  4IE0 A;  3BOW A;  4XAB A;  5A7O A;  4OQ8 A;  3IMM A;  1KJR A;  1CON A;  5GM0 A;  3IDB B;  3POS A;  1O5U A;  4UW4 A;  1D4M 1;  5BY5 A;  1W6O B;  2WQ4 A;  4YVW B;  3WHT A;  1LEM A;  5D8A A;  2VNO A;  4YG3 A;  5DAW A;  5E89 A;  1UMI A;  1GNH A;  1UOJ A;  2ZEX A;  4O7X A;  3WF1 A;  4CDW B;  1RIN A;  1W8W A;  3I3B A;  3N3H A;  3C7F A;  4HVQ A;  1O5L A;  5F39 A;  3R0R A;  4QDS A;  3J7H A;  4MH0 E;  3NO8 A;  1W2O A;  5T3N A;  2RG4 A;  3CZU A;  5FYY A;  1NA1 B;  1AJO A;  1RUD 3;  2YFZ A;  3WW3 A;  3POI A;  5FYZ A;  3GZT B;  4PCR A;  5FXW A;  3J26 N;  4QQP A;  1W9Y A;  1W8F A;  4GAL A;  3WG1 A;  4BQ4 A;  1LNS A;  2E31 A;  4F3J A;  3TYJ A;  1ZBA 2;  1WUV A;  2YC0 A;  2V5D A;  1CAX B;  1AJK A;  1LOE A;  1W6P A;  2BUK A;  3LEI A;  4Y5T A;  4RHV 3;  4V2W A;  5FZO A;  4CP9 B;  1QWR A;  1GZC A;  4DO0 A;  2QQV A;  3WD5 A;  1DYK A;  3AL5 A;  4Q5O A;  3A0N A;  4AEK A;  4Z8B A;  5A1F A;  3IAP A;  3WSO A;  1PK6 A;  4AVB A;  1N1S A;  3ZYB A;  4OLL A;  3O1U A;  3SH4 A;  3DXT A;  4JGY A;  2XJV A;  2I74 A;  4AL9 A;  4WM8 C;  1KDK A;  3VD3 A;  1OD3 A;  1SBF A;  1RYY A;  1S0D A;  2XKO A;  5LK7 B;  1VBD 3;  1FPN 2;  3UKT A;  4YVW C;  2BQP A;  3ECQ A;  3PUS A;  4K20 A;  4LKF A;  4CDW C;  1UU5 A;  3J8F 3;  5K7P A;  2NMO A;  4QX0 A;  2LM3 A;  4V1P A;  3T30 A;  2VMF A;  1GOH A;  3H7Y A;  4AI9 A;  1QOT A;  4O9G A;  4LUM A;  3MW3 A;  5ACA 3;  1C28 A;  1NA1 C;  1WKY A;  1S0J A;  4M3C E;  1Q43 A;  2I2S A;  3WXP A;  2X10 A;  2E51 A;  2QZ3 A;  2HYK A;  2XHK A;  2RR1 1;  4QWN A;  4MHU A;  3LOI A;  4HPK A;  3IB3 A;  4IE4 A;  1VMF A;  5FZI A;  1EV1 3;  2XON A;  3JBG 3;  2G1M A;  4DUW A;  2ZHK A;  1DQ1 A;  1XPW A;  4QPG B;  1RXF A;  2GNM A;  1AL0 G;  4Q1R A;  5F37 A;  1FT9 A;  1XOY A;  1BEV 2;  2VE1 A;  3CJI C;  4XFF A;  1ZZC A;  1XU1 A;  2BFU S;  2RJK A;  2XGX A;  3LFM A;  1HRI 2;  3D4K A;  1IS4 A;  4LIV A;  4JKL A;  4WBB A;  2YU1 A;  3V65 A;  3NV4 A;  4EN6 B;  5IFT A;  2Q30 A;  2WZ8 A;  4RQP A;  1W8T A;  1AXZ A;  1HJF A;  1K5M C;  5I8Y A;  2C9K A;  4GD4 A;  5EJ1 B;  3RNS A;  2YU2 A;  1OPM A;  1H1M A;  2VUL A;  3B00 A;  5A32 B;  3ZLI A;  1AR7 1;  1UN1 A;  3LF7 A;  4M01 A;  3WNK A;  1WLC A;  3U10 A;  1W6Q A;  4C1X A;  4LBQ D;  1DZR A;  1NKG A;  4JQR A;  5JZG C;  1GBG A;  3VDB A;  5BPX A;  4CU8 A;  4AQ2 A;  4OHY A;  2OQ7 A;  5EFU A;  4AED C;  4YGC A;  4NRP A;  3POE A;  5LBE A;  3ZXG A;  2AEZ A;  5JIU A;  2D5H A;  4QPI A;  1JS9 A;  5C3Q A;  1N47 A;  3M8L A;  5IFP A;  4QHZ A;  1MZ6 A;  1W8N A;  3LA2 A;  3WVJ A;  1DLL A;  1IKQ A;  2Y0I A;  1CZT A;  1XNB A;  3PL0 A;  1PGL 2;  1UYY A;  1AXK A;  5FZC A;  1BQP A;  1XNA A;  1A6C A;  4Y3O A;  1PO2 1;  4CEW B;  1GOG A;  1HV1 A;  1IGO A;  4Y22 B;  1UF2 C;  1BBT 2;  3P6B A;  4IGO A;  5FPA A;  3TNP B;  4A42 A;  2PAK A;  1DBN A;  1W0P A;  2JEM A;  4CDU B;  1QKQ A;  3KZ4 C;  4XFG A;  2Q8D A;  3WDY A;  2K46 A;  4MAD A;  1UX6 A;  3I2O A;  3THT A;  1GUI A;  2P3I A;  1OHF A;  1Q56 A;  3FX3 A;  3VBR C;  2JB8 A;  1UAI A;  2CGO A;  2R07 3;  1MAC A;  2Z79 A;  1RMU 1;  2ZS6 B;  4ARX A;  1QJX 3;  2ZX2 A;  2P34 A;  1WW5 A;  2GAL A;  3UYJ A;  2Y64 A;  4DXZ A;  2K0G A;  2WZR 1;  2Y38 A;  4DMI A;  2DVD A;  1JZ2 A;  2JDY A;  1UY1 A;  2R1B A;  3JD7 3;  1VBE 2;  2XVK A;  5K4L A;  3ZSK A;  3ZN6 A;  4I0B A;  1EAH 3;  2QUO A;  2WZE A;  1OUX A;  2LTN A;  3U07 A;  1WBF A;  1HXS 1;  4P5Y A;  4KU7 A;  5FXZ A;  3PMS A;  1FMD 1;  4PT6 A;  3VBS A;  4AFM A;  2JDK A;  5T55 A;  5FAX A;  3ETQ A;  1QOS A;  1RVF 1;  1Y7B A;  2ARB A;  2XXZ A;  3LPF A;  3EYP A;  4Y26 A;  4ARY A;  1GQP A;  4X6Q B;  1YIP A;  1TME 2;  2B45 X;  5F5I A;  4K1Z A;  3KV6 A;  2WUH A;  3H7J A;  2Z5W A;  3NWK A;  4XZP A;  4CEW C;  1JYV A;  2PLV 1;  3AYC A;  3RYP A;  1H8V A;  4YG0 A;  5FKB A;  4CDU C;  3U14 A;  2X05 A;  2AGS A;  4UW3 A;  5F9T A;  1G6N A;  2XR4 A;  4N9I A;  4NWV A;  3VKF C;  3IPV B;  5J98 B;  1UY2 A;  3WNP A;  1PGW 1;  2FZ1 A;  3WQ0 A;  1R09 3;  2ID4 A;  3CIH A;  3T4V A;  1U5Z A;  1YLL A;  1CD3 G;  1DGR N;  1OLM E;  2C0Z A;  3SKV A;  1CJD A;  2OZ6 A;  3MFA A;  5GKA C;  2IXH A;  4ZKT B;  4FPH A;  2YUE A;  4CEY C;  2QQP A;  5FO8 B;  5KR7 A;  5D2A A;  3RZH A;  4QHO A;  4Y5S A;  2WS9 2;  5JMO A;  5FZK A;  5FOB B;  1OC1 A;  3BVC A;  3CNA A;  4Q4W 2;  5A3M A;  3AB0 A;  4COW A;  3WP6 A;  4JZR A;  1KS5 A;  3W20 A;  4E2G A;  1POQ A;  1SPP A;  2RS5 3;  2V73 A;  3ES1 A;  4U36 A;  5FUP A;  5ABJ B;  2HWC 2;  1PO1 1;  1VE0 A;  1B09 A;  1J59 A;  1V6I A;  1PVC 2;  4J1W A;  4LTA A;  4A7Y A;  4COU A;  1PNG A;  2GNB A;  3PVN A;  4AVV A;  1OKQ A;  1G8W A;  1OA4 A;  2BNO A;  1IZ3 A;  2WJS A;  2VGD A;  3U0Z A;  3C2U A;  4BIF A;  2A75 A;  2PEL A;  4LHK A;  4TN7 A;  2YXS A;  3UL2 A;  2ZAC A;  3MIF A;  1XRU A;  1RUO A;  1F31 A;  2JDN A;  3VBF A;  2B7Y A;  2FDH A;  3LA3 A;  3AM2 A;  4A7K A;  2X5I B;  3SCF A;  4XUP A;  1PGL 1;  5AVA A;  4IEP A;  1SLL A;  3THD A;  4CU6 A;  1WZX A;  3MGU A;  2EIB A;  3HVD A;  1VRH 1;  4LNV A;  3POW A;  4H7M A;  3F95 A;  3I2D A;  3I3E A;  1W9F A;  5F8P A;  4ASL A;  1URX A;  1MS1 A;  1YI9 A;  1RUE 1;  2ORX A;  2YC4 A;  4FFF A;  4M4P A;  4UYB A;  3WG2 A;  4AHZ A;  4XQ4 A;  3O1R A;  3USS A;  1X9P A;  3KS7 A;  2VXR A;  3W9A A;  4AXO A;  1I6X A;  2PHX A;  4LUL A;  2WNV B;  5E6H A;  4K3U A;  2ZBJ A;  2PHW A;  1BHG A;  1Q5O A;  1UMH A;  3KCX A;  3MDP A;  3Q8A A;  3I3Q A;  3MLJ A;  2GME A;  1LR5 A;  3BOD A;  2O0O A;  3LSE A;  4YG6 A;  1AR6 2;  1N3P A;  5DPN A;  1VAM A;  2FCT A;  3FFZ A;  4B7E A;  1NCR C;  2QFE A;  4JRA A;  3QCW A;  3QD6 A;  1QGL A;  5LA9 A;  5IK7 A;  2WR9 A;  1RUF 3;  4YLZ A;  4DQA A;  5BNP C;  3O1M A;  2Q1M A;  4Z82 A;  4AEJ A;  4D7T A;  3B93 A;  5C5U A;  2WQ8 A;  2XVL A;  4L92 A;  1IPK A;  1MVE A;  1SLB A;  5FQ0 A;  1W99 A;  3PJY A;  3NNG A;  2PQS A;  3GZU C;  2ZKN A;  4C91 A;  4OUS A;  2EXH A;  1FOD 3;  1ENR A;  1ULG A;  3APB A;  1NQD A;  1VBA 1;  4RR3 A;  5F6L B;  3RGB A;  5FPL A;  4DXR A;  4P14 A;  1AL2 3;  3M3I A;  4LBN A;  5C3R A;  1POV 3;  2YGL A;  4W65 A;  3ZFG B;  5CA6 A;  1EUU A;  1I5P A;  3FHI B;  2WNV C;  1STM A;  4M0N A;  3VKN A;  2EXI A;  4XCA A;  3RFR A;  1LGN A;  5CFD A;  5C4W C;  1AYM 2;  1UKR A;  4GWI A;  4PIZ A;  1PZ8 A;  5BNO C;  1MEC 2;  3N7K A;  2IXI A;  1NXM A;  1Z78 A;  4BDV B;  3AL6 A;  2VD7 A;  3LWC A;  1N3Q A;  2O1Q A;  3H3U A;  2X29 A;  1VLN A;  2CHH A;  2HWF 1;  3AKS A;  3W21 A;  4AW7 A;  1BYH A;  4B1L A;  2HEW F;  2EXK A;  4LA3 A;  3VBU A;  5GZD A;  3NKG A;  1RUG 1;  3NL1 A;  5HV4 A;  4JKM A;  2MPF A;  2YY1 A;  3DYP A;  1CAV A;  1VB4 A;  1VBB 2;  1YQ8 A;  5FCC A;  2A3W A;  3EHK A;  3OEA A;  4COV A;  4XXP A;  3ZMO A;  5CIS A;  2P6H A;  1KGY A;  1RUJ 1;  2A5Z A;  1C8M 1;  2VME A;  4O61 A;  4Q4V 1;  2GZW A;  1GIC A;  2O8O A;  3KWV A;  4BMB A;  1GP4 A;  1PGS A;  3D8C A;  2ET1 A;  4ET7 A;  4URA A;  4XIO A;  3ZFE A;  4EV0 A;  1V6M A;  1I3H A;  2B9V A;  3N35 A;  5DUV A;  2BVV A;  4AHX A;  1W6O A;  2JIG A;  4ES9 A;  1J83 A;  1XXN A;  2VNV A;  3EBR A;  1R1A 1;  3ZFG C;  2R04 1;  1PX4 A;  3LDR A;  4JX0 A;  1NQJ A;  4AYU A;  5LA2 A;  2KM2 A;  1JZ4 A;  3ZN4 A;  2WN2 A;  2VMH A;  2XOM A;  3TBD A;  3MID A;  3TEZ A;  5FZL A;  3M1H A;  3DUI A;  1UPI A;  1W8H A;  2VMC A;  1MR5 A;  1R08 2;  2WLP A;  4DXT A;  1REE A;  2XML A;  1YCI A;  3AKP A;  4I01 A;  4B4P A;  4JGY B;  4CP9 A;  3V0B B;  2LUW A;  2J22 A;  1O3T A;  3KVB A;  2HWE 3;  3B94 A;  1MQT A;  5C3S A;  1S2B A;  3LIG A;  3III A;  2RS3 3;  3HNB M;  4H7L A;  5D8A C;  4B8E A;  1DGR A;  1YWK A;  4QX8 A;  2Y6K A;  4XBN A;  5FZA A;  4A45 A;  3LCP A;  2CDO A;  2WO1 A;  5ISL A;  4ATE A;  1ULF A;  4OUE A;  2ZCW A;  3CKH A;  3DKW A;  3IAQ A;  5DDJ 1;  2VG9 A;  1ALY A;  4XC9 A;  5F3E A;  3NNF A;  4E8D A;  4QM9 A;  5A3P A;  1CES A;  5DZF A;  4LBJ A;  4LOR A;  4YGB A;  1DQ5 A;  4E4Z A;  4HPK B;  4HK9 A;  1H9P A;  3P1I A;  3H8X A;  2GND A;  3T1M A;  2SBA A;  3WF0 A;  4AOC A;  1ZRF A;  1ODN A;  3OGS A;  2ZAB A;  4JHZ A;  4FO9 A;  3CZJ A;  1SDD B;  1VRB A;  2A71 A;  3GCX A;  2VC9 A;  4HFS A;  3B02 A;  3U75 A;  1UIK A;  3NVC A;  1IS5 A;  3RJ2 X;  4HK8 A;  3WNN A;  3ZPO A;  1HV0 A;  3NAP B;  4IEO A;  4QPG A;  2XG3 A;  5GZE A;  3FLT A;  1PK6 C;  2AC1 A;  4H14 A;  1AR9 3;  4YZ4 A;  1DG6 A;  1W0O A;  2WN3 A;  2OPW A;  1V9U 2;  4JGY C;  4LLO A;  5FUN A;  1H2M A;  4XFA A;  4CPB A;  2EVX A;  1JW6 A;  1RUH 2;  2C1F A;  3J4U H;  2Q8O A;  4E4S A;  1W6Q B;  3ACI A;  1ZNP A;  2E9Q A;  2G9Z A;  3AC0 A;  2A73 B;  2R06 3;  1V6N A;  1QJU 1;  2J1E A;  2RS1 1;  1RHI 1;  3ME2 A;  4Q4Y 2;  3URF A;  3S5A A;  2LAL A;  3LA7 A;  2FDK A;  5SV8 A;  4NO4 A;  1KIT A;  3E6D A;  4RFR B;  5IVC A;  2CL2 A;  1RIR A;  3B9I A;  3SMH A;  2VM9 A;  4AVA A;  2IFR A;  3GCW A;  4QPI B;  3EXU A;  1E5S A;  4IEX A;  1US3 A;  4R9A A;  1J3R A;  1FI2 A;  2JE9 A;  4IGQ A;  2HBU A;  1X50 A;  1DLC A;  2MEV 3;  2OT7 A;  4KNC A;  1UY3 A;  4N9H A;  1F9K A;  2J42 A;  4NE9 A;  4Q8L A;  4XUQ A;  1GFF 2;  1HQW A;  1UYX A;  3E97 A;  3TN9 2;  4AE2 A;  4YAR A;  5C8C B;  3KVA A;  2WFF 3;  1XND A;  4Q4X 1;  4KWJ A;  4KWK A;  2WAB A;  5BNN A;  2WNO A;  3T4H B;  1WLT A;  2HWD 3;  3ELN A;  3KD4 A;  4HET A;  4QHB A;  3L2H A;  1QXJ A;  4OMD A;  4RQP C;  1R1Z A;  5KHJ A;  3IDA A;  3LB9 A;  4AK3 A;  2ZMK A;  4NN0 A;  4Y22 A;  3LQC A;  1JZ8 A;  4TZD A;  3OOX A;  4GUL A;  1MZ5 A;  3Q9O A;  4P9W A;  4HG6 B;  3PUH A;  1PIV 2;  4AVT A;  2Q1F A;  1AVB A;  1FV2 A;  3AZY A;  4LO5 B;  3AP6 A;  3GBF A;  4C1W A;  2BJS A;  2JEC A;  2UWA A;  1W2N A;  1QJY 3;  3FC0 A;  4Y1U A;  2BBA A;  2XH6 A;  1IHM A;  3INA A;  3N9M A;  4QPI C;  3E5Q A;  1JYW A;  5LY2 A;  3ZFF B;  4XUN A;  2QQN A;  3VBS B;  5FFO C;  4QGM A;  2R16 A;  2JXA A;  1VPH A;  5FY4 A;  4KMQ A;  2PAM A;  1JZ5 A;  4Q0U A;  2GH2 A;  1AHS A;  2VOT A;  2P3J A;  1IKP A;  1RUD 1;  4XMA A;  5FJH A;  1O91 A;  2QBX A;  1UMZ A;  2VZS A;  4ISR A;  3ZM8 A;  2W08 A;  3WDX A;  1WCK A;  3DKQ A;  4S2H A;  1XSR A;  1JXN A;  4HKO A;  4S2D A;  2FDI A;  4Q0S A;  1RXG A;  2XUM A;  1UXX X;  2F6B A;  4DFS A;  2XHN A;  1V6J A;  3C3V A;  2C9A A;  2DWR A;  1HB4 A;  4RHV 1;  4IL7 A;  4Q0Q A;  1UZW A;  5L9B A;  3H8O A;  4OI0 A;  1U5X A;  1XNC A;  3ZR5 A;  1NLS A;  5KXD A;  2VR4 A;  3HT1 A;  2DBN A;  4NHK A;  4WVZ A;  3IPV A;  2YG0 A;  1JOJ A;  1LOG A;  1H2N A;  2WO3 A;  1CQ9 A;  4HXC A;  4GMP 0;  3AKR A;  5M0T A;  1IQD C;  1PZ9 A;  3AZZ A;  4JC1 A;  1COV 2;  1RUC 3;  2D93 A;  2HWB 2;  3I2K A;  5A7W A;  1VBD 1;  2XDV A;  1A3K A;  1N1V A;  4R4Z A;  1MZE A;  3LAG A;  5A1L A;  3V64 A;  3WLU A;  3J8F 1;  1Z7S 2;  2E53 A;  2RMU 2;  2YDE A;  1DFQ A;  3HWJ A;  3OG2 A;  2VQT A;  1BK0 A;  2DVG A;  2GDF A;  3MIG A;  4QQ2 A;  1NE4 A;  2P2K A;  1ZRR A;  4H3W A;  4A4A A;  4OUL A;  5ABJ A;  3M3E A;  1CPM A;  2W52 A;  3WIN E;  4AHW A;  4AGG A;  1KD7 A;  2Y6H A;  1ZBE 3;  1E5R A;  4HT1 T;  4K1Y A;  1QJZ A;  2E7T A;  2VZ1 A;  1EV1 1;  3JBG 1;  3NNJ A;  1D4M 2;  2B4K A;  3VBF B;  1QJE A;  2P3K A;  2VUD A;  4QX7 A;  4XFC A;  3SCH A;  3Q8B A;  4B29 A;  5IVV A;  1OT5 A;  2VPV A;  1W06 A;  3B9C A;  1OF3 A;  4FPG A;  1LEN A;  4OQ9 A;  3HBZ A;  2LW8 A;  1ENX A;  1WA4 A;  3FJS A;  2X5I A;  5FZM A;  4CYD A;  2E63 A;  5F7U A;  1W03 A;  1V6O A;  3CEW A;  2VZT A;  1PNF A;  3MLL A;  1JOD A;  2TUN A;  4DUV A;  2WNU A;  1QIQ A;  2ZJC A;  1H9W A;  4A3X A;  4ZU7 A;  4ZY9 A;  1QU0 A;  5FWJ A;  4LJH A;  2GC2 A;  5I8T A;  4G4F A;  2CU5 A;  4ZXE A;  4BZ4 A;  4LT5 A;  1YHF A;  1GWM A;  4MGY E;  3SIS A;  5FZB A;  1GWK A;  4CP2 A;  3DL3 A;  1QQP 3;  3IKW A;  3ZXD A;  3VD7 A;  2CNA A;  2VL4 A;  5FYC A;  5FPZ A;  3MO4 A;  1MZF A;  3FBY A;  4AQS A;  1VAV A;  3UKN A;  2Y34 A;  3MIH A;  3M3C A;  4HLT A;  4XF9 A;  1UO9 A;  2QNK A;  4C90 A;  2FD8 A;  2DUO A;  1ZYB A;  1W39 A;  3IT8 A;  3QBQ A;  3TAY A;  1YFU A;  4PJY A;  4GB3 3;  3VBF C;  1W2U A;  1GSL A;  4RYD A;  5I0D A;  4XJ9 A;  4RA0 A;  4JCK A;  4DY5 A;  2RDN A;  3ENR A;  1FV3 A;  2QTW B;  1O3R A;  2V4A A;  3G7D A;  4PLN A;  1XSQ A;  4PLO A;  3UJO A;  4QX2 A;  4I0W B;  4LO6 B;  4EZH A;  4YRD A;  1UNB A;  3AP7 A;  1LEC A;  3OEB A;  3PVB B;  3BB6 A;  1LGC A;  2JEN A;  4F8A A;  2ZX1 A;  2PN5 A;  2RR1 2;  4BQY A;  2B8M A;  5JSP A;  2R07 1;  2PMW B;  3DF0 A;  1G9D A;  1QJX 1;  3RZK A;  4HVO A;  5FYS A;  1LHO A;  1VBC 3;  2ZGM A;  5C3O A;  5L36 A;  1NLR A;  2OW4 A;  4AG4 A;  1K45 A;  5FIX A;  2FZ2 A;  3VBH B;  3JD7 1;  3H9A A;  3ZIX A;  1ND3 C;  2W0X A;  1EAH 1;  4R9B A;  4Y20 A;  4OHV A;  4XBL A;  3T2O A;  3V0A A;  3VZJ A;  4I3P A;  2YPJ A;  4YW6 A;  1APN A;  1VMH A;  2YPD A;  5T52 A;  1AR7 2;  1IG0 A;  1ASJ 3;  1UD1 A;  4FPO B;  4GKY A;  3RZM A;  2A6V A;  4JDM A;  4JDN A;  4MO3 M;  1SEF A;  5FP3 A;  1AR8 3;  4FQ4 A;  5BNQ A;  5FMB A;  4Q26 A;  1IOA A;  5AFB A;  4UT5 A;  2OXB A;  1JBC A;  1W2A X;  3VGI A;  4YFZ A;  5FK7 A;  3LOB A;  4RR3 C;  4UXA A;  2P1B A;  5FRE A;  3ZFE B;  4HOO A;  2ADE A;  4NHX A;  2Q0A A;  1RGS A;  1UCX A;  4FI9 A;  4Q27 A;  4XET A;  4CCN A;  1DGL A;  2D3R A;  5CAD A;  2TNF A;  2BPA 2;  5FPU A;  2O8Q A;  1I9R A;  1TZO A;  1R09 1;  2Y6L A;  5FJK A;  1UPS A;  1UX7 A;  2BRT A;  1LOF A;  4CUA A;  1YNA A;  2RJ2 A;  4B1M A;  5CFD C;  5JPN B;  3NRU A;  5EPA A;  1LHU A;  4KG0 A;  1OFN A;  1PO2 2;  2OA2 A;  3AZV A;  2JB4 A;  4XDP A;  4CP0 A;  4HMZ A;  3ETP A;  4JKK A;  4QQH A;  5DAV A;  4BWO A;  3GZA A;  4EZ4 A;  4Z2W A;  3S57 A;  1YFY A;  4XOG A;  1TNR A;  3OUI A;  2JG9 A;  4R8H A;  1T6B X;  1OFS A;  2JDU A;  2QKD A;  2RS5 1;  3FMG A;  2C4X A;  2UYB A;  4EN0 A;  2PXJ A;  5J37 A;  1UZY A;  5FZ1 A;  3D0S A;  1LU2 A;  5F3G A;  3VBU C;  1EPZ A;  2CGP A;  1RTV A;  5EXO A;  1RMU 2;  3DYM A;  4IDZ A;  3MIE A;  4NHL A;  2DUQ A;  4AQ6 A;  5CZK A;  1MQT B;  4XXA A;  1ZZ6 A;  5A3N A;  3WG4 A;  3ALQ A;  2VZQ A;  2GU9 A;  1IS3 A;  4L11 A;  1FAT A;  2BYV E;  2ZGQ A;  2WZR 2;  2YYO A;  3J7N A;  3N9Q A;  5JSR A;  3V0B A;  1LAJ A;  3ZMN A;  3U4X A;  4Q2F A;  4EN7 B;  3K4A A;  3ZFE C;  4XAE A;  5JDB A;  4TLG A;  2LRO A;  4BCU A;  1HXS 2;  2ZKL A;  2DCY A;  3GDB A;  4Z2A A;  1FMD 2;  1JTZ X;  2QQM A;  4WZC A;  5A7S A;  2XBO 3;  2CAU A;  1F2N A;  2A6W A;  1TNF A;  3LSD A;  1RVF 2;  1D7P M;  1O6U A;  3POB A;  2AUY A;  2KD7 A;  1L7Q A;  1M4W A;  3O1O A;  4YM3 A;  3AYD A;  4FQZ A;  4TTG A;  2GN3 A;  4QKD A;  4Y4Y A;  1FNY A;  1ULO A;  5C9A A;  1F4H A;  2JDZ A;  2Y26 A;  3WCR A;  2F4L A;  3NNL A;  2PLV 2;  2XL9 A;  3ES4 A;  3ZSM A;  5ACA 1;  1KJL A;  1LB2 A;  4LO7 A;  2D6K A;  3B01 A;  5LBC A;  3JQW A;  3RZJ A;  4P00 B;  2FHR A;  4CU7 A;  1JOB A;  1PGW 2;  3RWK X;  4QQL A;  3F2Z A;  3WQ1 A;  2VCM A;  1ZZ7 A;  1H2L A;  3VHN A;  2XJS A;  3VV1 A;  3WDW A;  3OGV A;  3PU8 A;  2B5H A;  4IV3 A;  5LW9 A;  3NAP A;  3ZPY A;  5EWS A;  1MQT C;  3AP5 A;  1XYN A;  2XPJ A;  2B39 A;  1H2K A;  1RUF 1;  3ZIW A;  1EYB A;  2FDF A;  1CIW A;  1S0F A;  3ILN A;  1QXP A;  3HIF A;  1WME A;  2R30 A;  2IFW A;  3O0X A;  3SHR A;  4D94 A;  2E33 A;  1ONA A;  1YC6 1;  4D8M A;  2ET7 A;  5K9Y A;  5KHG A;  2H0V A;  1V6K A;  4AZZ A;  1XE0 A;  2BTV C;  3T0A A;  2GSY A;  3HD8 B;  3OUH A;  4QGN A;  1W6N B;  3RQ0 A;  1PO1 2;  4IE6 A;  1SG3 A;  3OBZ A;  4DY3 A;  1W3V A;  3CU7 A;  3TOJ A;  4NPM A;  1FOD 1;  1X7N A;  4NWW A;  1FNZ A;  1GV9 A;  1NLQ A;  4KBZ A;  1GLH A;  5ANN A;  5A6Y A;  2OVU A;  1C57 A;  1AL2 1;  1YEW A;  2Y33 A;  3CDZ B;  2VZO A;  5K0U A;  3VUO A;  3MUY 1;  1TMF 3;  1POV 1;  1RUI 3;  1UZ0 A;  5F3I A;  3WNO A;  4COZ A;  4CXW A;  4DXS A;  3RZL A;  4AGV A;  3SH5 A;  3EJK A;  4OVE A;  5LRR A;  5BNN B;  4AGR A;  4CCE A;  5GAL A;  1WMX A;  4RGG A;  3DPR B;  4XAC A;  4NAO A;  2E7A A;  4QPG C;  1UU4 A;  1NX9 A;  2VZV A;  3ACH A;  1WD3 A;  3PHM A;  4FTE A;  3AMQ A;  1JYN A;  5CFC B;  5C8C A;  2P17 A;  1VRH 2;  3MV0 1;  3AXD A;  4AI0 A;  1ZRD A;  5FKC A;  4FTS A;  3KQ4 B;  3EB7 A;  4D69 A;  2IVJ A;  5JOZ A;  1RUE 2;  3LEG A;  3WNL A;  1OXC A;  3I59 B;  2VOV A;  1O8S A;  3UNP A;  2W68 A;  5FP9 A;  4O65 A;  4ZPI A;  5I8S A;  4A44 A;  2D43 A;  3IMN A;  5FP4 A;  4UFK A;  5LZ6 A;  3SLI A;  2ZZQ A;  1GNY A;  3P3N A;  4IEU A;  2QQI A;  3B5L B;  5J1X A;  1DYP A;  3NW4 A;  4TSV A;  1B35 B;  2W1W A;  2ARX A;  4GXL A;  4UF0 B;  4BXS V;  3ACF A;  4PIY A;  4YW7 A;  3H1Y A;  4P9L A;  5HBA A;  4CCO A;  2WKK A;  4TYS A;  2DDU A;  3J7M A;  3KF3 A;  2I07 B;  4XIL A;  3ZFF A;  5FTT C;  1ULE A;  1H30 A;  4EJR A;  1YQC A;  2CSG A;  1BLZ A;  4FPJ A;  4H2A A;  2PHL A;  2OQ6 A;  3AJY A;  3IN9 A;  3A22 A;  3POY A;  1W8Z A;  3WUC A;  1OUR A;  2G4I A;  3OBT A;  4OHZ A;  5IYY A;  5B4N A;  1IPS A;  1K12 A;  3SCG A;  1VBA 2;  1VJ2 A;  4XZU G;  5H9S A;  4DPN A;  2ZAH A;  3G6J B;  3ILF A;  2L9L A;  5IAV A;  2WWU A;  4L97 A;  4LKE A;  4MET A;  3BTX A;  4IEW A;  4L8Q A;  4N7U A;  2HWE 1;  1GQG A;  4W4Z A;  3L9J T;  4N43 A;  5A7N A;  4EWD A;  1DZT A;  3FHQ A;  4B3N A;  2XWB B;  2DBI A;  5FBJ A;  5A7W B;  4W6Y A;  1QH6 A;  2RS3 1;  1YYN A;  2RM2 3;  2D7F A;  4EN9 B;  5LEK A;  2A7A A;  1JMU B;  3MV1 1;  3B3Q E;  4E9K A;  3GZE A;  1JZ7 A;  1O3S A;  5IK5 A;  3VZO A;  2HWF 2;  4PBO A;  1D0G A;  4CDQ A;  4W8J A;  1QDC A;  3AXE A;  1RUG 2;  2MHF A;  3CMG A;  1JZ6 A;  2DU1 A;  5T54 A;  2IVI B;  3GF6 A;  4FPE A;  4M3C A;  2UWC A;  3D6E A;  4YW1 A;  3VHR A;  2HYX A;  2HH9 A;  4UFJ A;  2Z2S B;  5FZ3 A;  1KS4 A;  1RUJ 2;  2VJX A;  4Q4V 2;  1C8M 2;  1RC6 A;  1YIF A;  3CQO A;  4LO4 B;  5JR7 B;  4DS0 A;  5AC9 3;  2D3S A;  1BMV 1;  1F4A A;  1HB3 A;  2XJP A;  5GZG A;  3RYK A;  3OSD A;  3AMH A;  3T2P A;  5JCT A;  1ZRE A;  1X8E A;  4NRO A;  5GZF A;  4FP3 A;  1GAN A;  3K2O A;  1R1A 2;  1AR9 1;  2VTF A;  1DHK B;  4FPK A;  4XUR A;  2R04 2;  5A7P A;  1VMJ A;  2Y8K A;  2WNU B;  3FLP A;  2VQU A;  4NPL A;  5C5T A;  4P02 B;  1V00 A;  4NR1 A;  4QXK A;  4YNI A;  4NOT A;  2R06 1;  4ZU5 A;  3BGA A;  5FZ4 A;  1N3O A;  1GYK A;  5FK8 A;  5GZC A;  4BH9 A;  1A78 A;  5A80 A;  4CZS A;  2A6Y A;  5HCA A;  2I45 A;  2RDR A;  4J25 A;  4JHT A;  1C1F A;  3U4S A;  1ACC A;  2XJU A;  4JV4 A;  1HLC A;  4LE4 A;  5ABJ C;  5KWR A;  4IES A;  3P3P A;  2D40 A;  1SQ4 A;  1LRH A;  3Q8C A;  3HNM A;  4CP1 A;  3RZG A;  2WRA A;  2VNR A;  5TSW A;  2BZD A;  3WX5 A;  2MEV 1;  5JLV A;  1UZZ A;  3ZXF A;  3CLP A;  4DZG A;  1J58 A;  2JDP A;  1WCU A;  2JX9 A;  4ASM B;  1XYO A;  2WFF 1;  1FXZ A;  2G19 A;  2EAL A;  2HWD 1;  4HZF A;  5DDJ 2;  3OF1 A;  3AP4 A;  5CKN A;  5DQ0 A;  4DRR A;  1BK1 A;  4HN1 A;  5CIR A;  2X5I C;  3RJR A;  3ABZ A;  4QX3 A;  4XF0 A;  2WLQ A;  4Y33 A;  1AYN 3;  1ND2 B;  2WNU C;  3K3N A;  3BPZ A;  3IBM A;  2CDP A;  4KQ7 A;  4PQ9 A;  1WGP A;  1SBE A;  3MBW A;  2WWJ A;  2Z42 A;  2WA4 A;  5G04 L;  2NP0 A;  3O12 A;  1NG0 A;  4BHP A;  5DG1 A;  2OZJ A;  4I0A A;  4K8R B;  4AI1 A;  5I93 A;  1DQ2 A;  2DU0 A;  2GAU A;  2ZGT A;  4QXB A;  1HRV 3;  2ZHM A;  3WDV A;  1QJY 1;  5FXX A;  3VKM A;  4P9X A;  1I5Z A;  1TVG A;  3GAL A;  2ZTN A;  3RWN A;  3WR0 A;  4D7Y A;  4AWD A;  4Y20 B;  3V0A B;  3WG3 A;  4BQ5 A;  1D2S A;  1G9C A;  4XJZ A;  3HR9 A;  4KBB A;  2VQ0 A;  5LBB A;  3VBH A;  1UIJ A;  3T2Q A;  2VVE A;  4FCA A;  4EQV A;  1UW8 A;  1H8T B;  5JOW A;  5FY8 A;  5KHH A;  2WSU A;  1QJU 2;  1SFY A;  2RS1 2;  1RHI 2;  2PAE A;  3PU3 A;  4RD7 A;  5BV6 A;  4MV2 A;  5IJR A;  5DZG A;  1OMI A;  4R9D A;  3LPG A;  3N36 A;  3PUI A;  4OI2 A;  4UBH A;  4CRQ A;  3BTZ A;  4FVV A;  3OGR A;  3ACL A;  5FRA A;  3VD9 A;  4XBQ A;  3ON7 A;  1WCD J;  3M2M A;  3WNM A;  1KFX L;  1ZZ8 A;  4OI4 A;  3FZ3 A;  2FCV A;  5J7M A;  1H4H A;  1XE8 A;  4JDO A;  2WT2 A;  4Q29 A;  5L19 A;  3WCS A;  5IVB A;  1JUI A;  2GC1 A;  2XQX A;  3KB5 A;  1E5I A;  2ZX3 A;  1FX5 A;  3PUA A;  1OLM A;  2BWA A;  4WVV A;  5I0U A;  3USU A;  4UBG A;  4Q4X 2;  1OH3 A;  1ZBA 3;  1JH5 A;  1RUC 1;  4HON A;  3HBK A;  1NAE A; 
#chains in the Genus database with same CATH homology
 4GJY A;  3KV4 A;  4D6S A;  5ISL A;  2Q8D A;  2YBK A;  5F39 A;  4E4H A;  5FZ6 A;  5CEH A;  5F3E A;  5F3C A;  3K2O A;  5FYY A;  5A3P A;  2YPD A;  4UF0 A;  5FYZ A;  5A7P A;  5A3T A;  5FXW A;  2OS2 A;  5F3I A;  5FYT A;  5FP3 A;  4D6Q A;  3UYJ A;  5FYH A;  5A7W A;  1VRB A;  2Q8E A;  4V2V A;  3DXU A;  2XDV A;  5FP8 A;  5FZ4 A;  5IVF A;  5K4L A;  5A80 A;  5FZO A;  5F5A A;  4V2W A;  5A1L A;  3ZPO A;  4DIQ A;  4CCL A;  4HOO A;  5FPA A;  4DO0 A;  3AVR A;  3AL5 A;  3U4S A;  5FXZ A;  4CCN A;  5FPL A;  5A1F A;  5FXV A;  5ANQ A;  5F2W A;  5FPU A;  4XDO A;  2XXZ A;  5FUN A;  4CSW A;  3N9O A;  5LWB A;  3N9N A;  3DXT A;  5FJK A;  5FP9 A;  3PDQ A;  5A3W A;  5F5I A;  5FY0 A;  2YBP A;  3KV6 A;  3K3O A;  3NJY A;  5FP4 A;  5FZG A;  4XDP A;  4LIT A;  4QXH A;  3U78 A;  3PUS A;  4EZ4 A;  4QX7 A;  2W2I A;  4CCM A;  5FY5 A;  5IVV A;  5IVC A;  3AL6 A;  5IVJ A;  4UF0 B;  4BXF A;  4D6R A;  2VD7 A;  2P5B A;  2OX0 A;  4AI9 A;  3N9L A;  3AVS A;  2XUE A;  4AAP A;  5FWE A;  3PUR A;  2PXJ A;  4QU1 A;  4CCO A;  5FZ1 A;  4Y33 A;  5F3G A;  3PTR B;  4IGP A;  5FP7 A;  5FZM A;  5IVE A;  3K3N A;  4IGQ A;  5IWF A;  5FZI A;  4QWN A;  5FZD A;  2OT7 A;  5F5C A;  2WWJ A;  5FZO B;  5A3N A;  5IW0 A;  2GP3 A;  5FZ7 A;  5KR7 A;  3N9Q A;  2OQ6 A;  5FZK A;  5FY1 A;  5F37 A;  3KVA A;  5FZE A;  2YBS A;  4QXB A;  5FY7 A;  5FWJ A;  3N9P A;  4GJZ A;  5FXX A;  5FUP A;  2GP5 A;  4LIV A;  5FZ9 A;  4URA A;  2YU1 A;  3OPW A;  5FZB A;  5A7S A;  5FYI A;  5F32 A;  5FYC A;  4GD4 A;  5FZ8 A;  2WWU A;  4EYU A;  2YU2 A;  5FPV A;  3OPT A;  3ZLI A;  4Y4R A;  5FY8 A;  4ASK A;  4LXL A;  5IVY A;  3PU3 A;  5FZH A;  4LIU A;  5A7N A;  5LY1 A;  4TN7 A;  4CUG A;  5FBJ A;  5FYM A;  5A7W B;  3LDB A;  4C8D A;  5A7Q A;  4BU2 A;  2OQ7 A;  3KV5 A;  3N9M A;  5FY9 A;  5FZ0 A;  5FZL A;  5FZA A;  5LY2 A;  4CCJ A;  5F2S A;  4EZH A;  3KV9 A;  2XML A;  5FYU A;  3PU8 A;  5FY4 A;  5FZF A;  3PUQ A;  5LW9 A;  4CCK A;  4GAZ A;  2Q8C A;  4NUB A;  3RVH A;  3KVB A;  5IVB A;  3LD8 A;  5FV3 A;  5FYB A;  4QXC A;  5FJH A;  5A7O A;  4BIS A;  3PUA A;  5FYV A;  5FYS A;  5E6H A;  5FZC A;  4Y3O A;  5FZ3 A;  5FPB A;  4HON A;  4QX8 A;  4IGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...