4YGDA

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
227
structure length
227
Chain Sequence
b'PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 56
structure length 227
sequence length 227
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ygdA00
3RQ0A 4Y22B 1CPMA 4FPOB 4M3CE 5JVVA 2BQPA 4XXPA 4BPZA 2XB6C 1ZM1A 2AYHA 3AP9A 1LOFC 1W6PB 1HDKA 1BQPA 1MVEA 3MEPA 2ZKNA 4YFWA 1LHVA 2DU1A 2WKKA 3AZWA 2A3WA 3OPZA 3WG4A 3INAA 3JU9A 4R9DA 1AJOA 1AXYA 3IMNA 2A71A 5H9PA 1V00A 3M1HA 1LEMA 1W6NA 2R0FA 1SCSA 1VIWB 1CR7A 2W68A 5DG1A 3WHUA 4M3CA 5GLVA 2D6PA 5H9SA 3BIWE 5T55A 1H9PA 1YXWA 4K1YA 1S0EA 2P3JA 1DHKB 1LOCA 1S0JA 1J1TA 2B7YA 3WDTA 4ATEA 3V0AB 4P9YA 3I8TA 1WW4A 2ZGNA 1G9CA 1GV9A 2ZMLA 5LK5A 1MR5A 2EAKA 2NYYA 2WT1A 1CIWA 4Q27A 3MW2A 1Q56A 2DU0A 1OFSA 1A78A 5IK7A 2RHPA 5E89A 1G9BA 3ILNA 1CVNA 4FPYA 3AYEA 4I30A 3WCSA 1LENA 1X50A 1G7YA 5T5PA 1QGLA 4YW4A 4Q8LA 1I3HA 1Q8SA 4PQ9A 3WHTA 1LOAA 1MACA 2CL2A 3ZXKA 1KDKA 2EIGA 4Y20A 3M3QA 1SBEA 1YRZA 1IS6A 2A70A 2DVDA 4Y1ZA 3SISA 1GLHA 5T5LA 4YG0A 2DUPA 4UW3A 3AZZA 1Q8VA 3WDVA 1W0PA 5DZGA 1S0BA 3WDYA 2GMMA 2ZBJA 4XZPA 2PHXA 4YW5A 3N7JA 4H55A 1GZWA 1G9FA 1LOEA 1MS4A 2DYCA 2HYKA 2WT0A 1RITA 2WSUA 4FPCA 4GWMA 4Y22A 2UURA 1UKGA 5GLWA 1ULCA 2ZHNA 5CA6A 3WUCA 1JN2P 3FLTA 1ENQA 1W6PA 1DZQA 3FBYA 3DUIA 4U36A 4DFSA 1FV3A 3WVJA 1N3OA 1LU2A 3VKMA 3ZXEA 1XQNA 3AJYA 2G4IA 3V0BB 1IKPA 1F9KA 5GZCA 1SCRA 4YM2A 1FAYA 3PVEA 1Y7BA 2ARBA 1S1AA 2ZHKA 1SBDA 3VKFC 1WW6A 4C1XA 2E6VA 1G9DA 1AF9A 4ISQA 1LHUA 3ZSJA 3OYWB 1VALA 1WLWA 1C1LA 3WUDA 3V0AA 1JXNA 1LOFA 2DTYA 3B69A 2ZMKA 1V6OA 4BM8A 1VLNA 3RS6A 1UL9A 4Z8BA 1JHNA 4FOYA 4CZSA 4Y1VA 3OGGA 2D3RA 1V6IA 4K1ZA 4R9BA 1GNHA 5JDBA 2ZGLA 3T1MA 4XHXA 3VUOA 3BOPA 1JOJA 4P14A 4LBLA 5DUXA 5IT6A 4FPHA 1KRIA 1DBNA 1BZWA 1AX2A 1DQ1A 4DPNA 2SLIA 1QF3A 2YXSA 1JYIA 4BLJA 4XBLA 3O0XA 4DRRA 1AXKA 2CNAA 1CJPA 3USUA 2ES3A 3ZXFA 2OUJA 5DUUA 3SH3A 3VKNA 3OJBA 4YGDA 5E8AA 3ZXJA 1Z0HA 2D6KA 5KXBA 3M3CA 1APNA 2GALA 3AZVA 3AZXA 1F31A 3WDUA 1I1EA 4GXLA 1LHNA 2SBAA 1ZA4A 1ULGA 1LHOA 3UL2A 4YZ1A 3RMYA 5KXEA 2OUHA 3A0NA 3PJQA 2AR6A 2V73A 1SLCA 3NV2A 1C57A 2GMEA 2A6VA 2VU9A 2D43A 2P2KA 4BQ1A 5JOWA 3UJOA 5IK8A 1MVQA 2R16A 3KQRA 1WD4A 4FVVA 4R9AA 3ZXLA 3V0BA 2ZAAA 3OY8B 4RA0A 1A3KA 4XJ8A 5EXOA 3N35A 3IPVB 4LBQD 1MS1A 3AFKA 3D6EA 3RRDA 2PHRA 3OYWA 3BTAA 5T54A 2DVFA 2YV8A 4JC1A 5DUVA 3A4UA 2FHRA 3KM5A 2ZZJA 1CONA 2A6YA 2NM1A 1YYNA 2A7AA 3IM0A 1GICA 3R4SA 4WZFA 2GDFA 2EXJA 1SLTA 2ZGUA 3B01A 4FP3A 1GZCA 1BXHA 5EYYA 3MPPG 2DWRA 1AXZA 2DVGA 3NV4A 1O4YA 5EWSA 3O0VA 5DG2A 2NZ9A 2WSVA 2VW0A 3FUQA 3HN1A 4JCKA 1UZYA 3N36A 3RG0A 3MW3A 4SLIA 4AGVA 4LBMA 1NXD1 4ZKTB 3O12A 5GJ6A 4GALA 4AGGA 3AYDA 4YZ4A 1N1VA 5H9QA 3N7MA 4TZDA 1V6MA 2UWCA 3R05A 3B00A 1HLCA 1FV2A 1W0OA 1LGCA 1W6QB 4KBBA 5JOZA 5SV8A 2W52A 4YZ3A 4AVTA 1G8WA 1DQ5A 2CY6A 4UW5A 5T52A 1WW7A 4ATFA 3IN9A 1PZ7A 2CWSA 1PZ8A 1MS9A 1V6NA 1KQRA 1LODA 1GYKA 2JD4A 1LOGA 5GLZA 3W58A 3AP4A 4ITCA 3WG1A 1LECA 2UU8A 4YW2A 2JECA 5HCAA 1N47A 3ATGA 4UW6A 2ZGMA 2ZGPA 3O5SA 2KM2A 1BKZA 1DQ6A 1GSLA 1UAIA 4XJZA 1CESA 2ZGSA 2P3KA 3ZYPA 4MYEA 3NWKA 4YM0A 1SACA 4LBOA 1KJRA 1IOAA 3BODA 2ZHMA 3IPVA 2EXKA 4HL0A 1V6KA 3IKWA 2D6MA 3B3QE 3APBA 2UWBA 1DFQA 1ENSA 4FPFA 2R0HA 3WLUA 4F83A 2GMPA 1JUIA 1IS5A 3ASIA 1N1SA 4M01A 3V64A 3LSDA 5FRAA 1AX0A 2H0BA 4YG6A 3WG3A 4C1WA 4NOTA 1DQ4A 1SLLA 3VV1A 2ZACA 2PHTA 2GNDA 4YZ2A 1FNYA 2ENRA 4AVSA 3RMXA 1KJLA 1LGBA 3OBTA 4XBQA 2ZGOA 2D6NA 2PELA 1W6OB 4LBQB 1B09A 1TEIA 1UN1A 3A0KA 1O4ZA 4AYUA 4AGRA 1GKBA 2C9AA 1WD3A 2YMZA 5KXCA 1NLSA 4XILA 2V5YA 2ZGRA 1QNWA 2D7FA 3O0WA 1S0CA 4Y1UA 1ENRA 5T5JA 2LALA 3Q9OA 2A6ZA 3M3OA 2DVAA 2P3IA 3M3EA 1W6QA 4YG3A 4DQAA 1QDCA 5T50A 1LCLA 4FOWA 5GZDA 2AREA 3ILRA 2A75A 2VUAA 4OZXA 2R1BA 4PBPA 5HCBA 1UMZA 2E7TA 3SITA 3OBRA 4FPEA 1RIRA 4YM1A 4YFZA 1LHWA 2R49A 3WNXA 1GNZA 4BLIA 1S0DA 4XE9A 4LBKA 5IK5A 1SFYA 2DVBA 2A6WA 2ZMNA 2GNBA 3WDWA 3ZVXA 5BYNA 1LOBA 1D2SA 2YROA 3CNAA 4XHBA 4XIKA 3FLRA 4XYXA 4M3CB 2E53A 2VW1A 3POWA 1WW5A 5GZGA 1DYKA 1QNYA 1LULA 4BOWA 1CPNA 2D3SA 5GLUA 1N3PA 1H9WA 3ENRA 4RL7A 4XOGA 3ZSKA 2GNTA 5EYXA 1LEDA 1EPWA 1ULDA 2E51A 4Y1YA 2DURA 1QDOA 2CWMA 1C4RA 2AUYA 1MS3A 4GA9A 5DZFA 1IS4A 1FNZA 3AP6A 3VKLA 4ASMB 2D6LX 4PCRA 2W39A 2R1DA 3POSA 2AH2A 3AYAA 5L73A 2ERFA 5CAZA 5JOYA 1WBFA 1KDMA 3L2YA 3QCWA 1N3QA 2VW2A 5E88A 1JYCA 1W6MB 1W6OA 4LBQA 4YW1A 3TAYA 2JKBA 3UJQA 3POYA 4FOVA 3M2MA 1RINA 4YZ5A 2WLQA 2AGSA 2VH9A 1URXA 3TB0A 5FREA 1V6JA 3H0OA 4XIOA 1BJQA 3VKOA 4XBNA 2NMOA 4DS0A 2DV9A 3WG2A 1AX1A 1DLLA 3AJZA 1DGLA 4K20A 1IS3A 3ILFA 1G9AA 3SH4A 3D5OA 2GN7A 3W59A 4Q1RA 3C2UA 4LBJA 1V6LA 1DIWA 1BYHA 3WCRA 1S0GA 4YLZA 2ZGTA 5IK4A 1QKQA 1YO8A 2A3XA 1C1FA 1QOSA 2OW4A 2P37A 3PVOA 3LCPA 4WV8A 4FPGA 3DGTA 2NMNA 4Q1PA 5DZEA 3WV6A 4AWDA 1DQ2A 1UPSA 2AENA 2A5ZA 4K21A 1AJKA 4P9XA 1N1TA 3AZYA 1JBCA 3AXDA 3AX4A 1R1ZA 1N1YA 1LU1A 3I4IA 3N7KA 4Y1XA 1GZ9A 5GALA 3T2TA 1WLCA 5JLVA 4IQPA 2NN8A 1Q8PA 1SLIA 1MS8A 2XG3A 2YZ4A 4W65A 2C5DA 1HKDA 2FMDA 2A3YA 2OVUA 4XJWA 3HMYA 2D3PA 1WUVA 2EALA 3OY8A 4BMBA 2YY1A 4U2AA 2TEPA 1OKQA 1JW6A 1VAMA 3AYCA 3LSEA 4YGEA 4TYSA 3USUB 4LBNA 4AVVA 2Z42A 5JMCA 1W6MA 1FYUA 2D44A 4BMEA 4FOQA 4UW4A 4XJUA 4NO4A 4FPJA 1QOTA 1U0AA 2CTVA 4XXAA 5GM0A 3ZYRA 3NV3A 2WQZC 4CRQA 3AP7A 2ZGKA 3QLQA 3AP5A 2WT2A 1H30A 2UWAA 4FPLA 3SLIA 4GKXA 1CQ9A 2ARXA 1WCSA 4WVWA 3V65A 3MW4A 1FATA 2EXIA 5T5OA 1GANA 2ZABA 1Q8OA 4XMIA 1ULFA 2P34A 3FFZA 3WDXA 2PHFA 4R9CA 1DQ0A 1HQWA 5IUQA 3RSJA 2JJ6A 1GBGA 1YIFA 2EF6A 3HR9A 1IKQA 1ONAA 3GALA 5AVAA 1AVBA 1Q8QA 5GZEA 4FPKA 5CB7A 1DYPA 1VAVA 2DTWA 4WVVA 5CBLA 3U4XA 1LTEA 1MZ5A 2WJSA 2ZHLA 1SBFA 4YGBA 3B9CA 2EXHA 5F9TA 2I2SA 1QMJA 2JE9A 4DRVA 2CYFA 1WBLA 1QU0A 2E7QA 5H9RA 3SNMA 3ZSLA 3FLPA 3FUOA 3ZSMA 4XTPA 5GZFA 4YM3A 4Q8KA 2GN3A 2ZA9A 2PHUA 4YW3A 2VY0A 1SLBA 1FX5A 1W6NB 4XTMA 4CTEA 1D0HA 1AZDA 1S0IA 1UZZA 1ULEA 1Z78A 2JDZA 3WZ1A 1MS5A 1CN1A 3N7LA 5DUWA 2D6OX 2W08A 4XJAA 3AK0A 1A8DA 4M00A 4XDQA 3PVNA 2JE7A 4GWNA 4FP2A 1QOOA 4YGCA 1SLAA 2A6XA 4M3CF 4PBOA 1UX6A 1LESA 2LTNA 4HANA 3WOGA 4D69A 1OQ1A 5DXDA 1WLDA 4ISRA 4Q26A 4L8QA 3ZPYA 4ZXKA 1MZ6A 1YI7A 2GNMA 1KITA 3N3HA 4FQZA 4XJ9A 4Q2FA 3SH5A 3D4KA 2PHWA 3R4UA 2WNEA 1G86A 1LJ7A 4FQ4A 5F5QA 2VXRA 4Y20B 4Y24A 3PMEA 5CNAA 4JRAA 1MS0A 4PF5A 2DUOA 5JOXA 1S0FA 1PZ9A 4Y26A 3NV1A 3T1LA 4P9WA 2Q5TA 5HCFA 3JUUA 3UK9A 2DUQA 2ZGQA 5GLTA 2NP0A 3GNEA 4GKYA 1HQLA 5KXDA 4XMAA 1F5FA 1GZWB 3AXEA 1LGNA
chains in the Genus database with same CATH superfamily
5FZ7A 2YHJA 4BU2A 4DOUA 4XUQA 2WN3A 1GMMA 2PHLA 2AYHA 2VBBA 3I2IA 3W20A 2DBNA 3LA2A 3TWIA 4IEPA 4XFIA 1PVXA 1XC6A 4IETA 3VBRB 2K46A 2QFEA 2WNUC 1LHVA 2ZKNA 2LROA 2Y26A 5FWEA 1VRH2 1ASJ2 4KGQA 1KEXA 1XNKA 3MF6A 3JU9A 4QPIB 3WG4A 5K0UC 3BTZA 2TUNA 1YI9A 4C91A 3OG2A 5L7OA 3TYJA 1LEMA 4AI0A 2XJTA 4JGZC 4K6BA 1VIWB 1RJ7A 3QD6A 3WHUA 4DEVA 5KHIA 3MIEA 2D6PA 2YBPA 1GQPA 1NCRC 3BIWE 1YXWA 1ASJ1 3POJA 1MEC1 3H9AA 2JG8A 2WZEA 1GQGA 5A3MA 3K3NA 2FBEA 5LK5A 1EV12 2YFUA 4OYUA 4RR3C 3FFQA 1LR5A 2X8KA 2Q8DA 3MW2A 3AKRA 1M4WA 2DU0A 1OFSA 1Y4WA 4JGZB 1CVNA 4FPYA 3AYEA 1LENA 1G7YA 1F2NA 1NCQC 1ZNPA 4RFRB 3SMHA 3SXWA 4YW4A 2WZ8A 1NCRB 4Q8LA 1I3HA 1IPJA 1UY2A 3GZTB 4NWVA 4ZY9A 5FYCA 2XONA 5CFDB 2GP3A 4C90A 3KT7A 2D40A 2VOXA 1OQDA 3M3QA 4AVCA 2DVDA 1IS6A 2WR9A 3SISA 2XJUA 3WF0A 1X36A 3P6BA 1Y43B 1PNGA 1Q8VA 1J84A 2HWB1 3WINE 2VVFA 3JQWA 3CIHA 1S0BA 5DABA 2GMMA 1AL23 4PI2A 4YW5A 3N7JA 4H55A 2WT0A 1MS4A 2WSUA 4FPCA 4BHPA 5I8TA 5IVBA 4Y22A 5FAXA 4NN0A 2W1QA 3CO2A 4LORA 3DF0A 4LPLA 5CA6A 5FYYA 1VJ2A 1I9RA 4ZHNA 1EYBA 3FLTA 1W6PA 4COUA 1AUYA 5C6CA 1VPHA 4MGIE 4B7EA 5KC5A 3KV6A 5A6QA 4XPVA 1VP6A 2FD8A 4QKFA 2BP6A 4NVPA 1WWYA 3GBFA 3UNPA 2VZPA 3E6DA 4LR4A 1S1AA 4Q29A 1QJZA 4IGPA 3LFIA 3M3IA 3ES1A 2G9FA 2FMYA 4GMP0 4NHKA 4CP9A 3A23A 4D6QA 5F7UA 3WUDA 1F4AA 2VD7A 4BM8A 2ZMKA 5E16A 1VLNA 2XQRA 1BBT1 1NKGA 2Y0IA 4Z8BA 5K8SA 3FHQA 4FOYA 2UYBA 4K1ZA 4R9BA 1GNHA 3BB6A 3N9PA 4KNCA 1JOJA 4A45A 4CUCA 5DUXA 5C3RA 5IT6A 1DBNA 2VCCA 2YUEA 5HPOA 1OXCA 2HWF1 2YXSA 2RM22 1PVC3 1AXKA 2Z5WA 3K4AA 2ES3A 2RS52 3ZXFA 5FZOA 2W1UA 4UFLA 4LHLA 1OVSA 2FDJA 2WO1A 4YGDA 4IV1A 5CKNA 2XL7A 3TNQA 4BIOA 3DN7A 2RM21 5K9YA 2VZRA 1ZA4A 4V1PA 3AVRA 4LXLA 3T09A 2RS51 5FO7B 1LHOA 5FZLA 4WM7B 5I0TA 2OUHA 4QDRA 4BQ3A 2Y6GA 4CCKA 3ETQA 2BERA 1C57A 2GMEA 2VU9A 2D43A 3W5MA 2P2KA 4NUBA 5LBCA 1POQA 4Y4YA 4X6RB 2BJSA 2OS2A 3I2DA 4OMCA 5FPZA 4AFMA 3KWVA 5FPVA 4A6OA 3BALA 4YVWB 1WD4A 1RXGA 2Y8KA 5FO8B 4HSLA 3VZNA 2FCUA 4EWAA 3OY8B 4RA0A 5JR7B 4Y4RA 3POFA 4NE9A 4XQDA 3E5QA 5FK7A 1I6XA 4XUOA 4NIAA 3MFAA 3BTAA 1F8VA 2WFF2 3P1IA 1OFNA 4UXAA 1CZVA 5DUVA 4ORFA 2IVJA 3KM5A 2ZZJA 1CONA 2A6YA 4WZFA 2A7AA 2KD7A 5LA2A 1GICA 2Z2SB 1TE1B 1JZ6A 2EXJA 3B93A 1OI6A 1SLTA 4IXLA 3B01A 4FP3A 2BBAA 3THCA 1WCQA 4KQ7A 2B42B 1NE6A 4HONA 3S30A 5FZAA 1O4TA 4IE0A 1XPWA 5DG2A 5SV5A 1HRV2 4AI9A 4CXYA 2FDIA 2VW0A 4JCKA 4IV1C 1NA1A 4QGLA 1VMJA 2QZ3A 2PN5A 3IBMA 3IIIA 3MIGA 3VN4A 4AGVA 3O12A 4INDA 5JZGC 4GALA 1RUI3 2YDEA 4YZ4A 5AVPA 1DDLA 4PLMA 1YHFA 2D97A 5H9QA 1V6MA 1WZXA 3RZGA 1JHJA 4AL9A 2XWBB 4QU2A 5D2AA 1W6QB 5BNOB 5FY4A 5CFCA 1AL22 5JOZA 1BVVA 3KF3A 4CSWA 2QKDA 3HVDA 4A42A 5JIUA 4CDUA 3OBZA 4UFHA 1KXGA 4UFKA 1IQAA 1WW7A 2ZAHA 2AACA 2CWSA 2EVXA 1D2QA 1KQRA 1GYKA 2HYXA 2R063 3KHBA 2YGMA 4JRLA 4PIXA 3AP4A 4UOJA 4CDQC 1AL21 1OBNA 2XXZA 3I2JA 5ERLA 4FBFA 1N47A 5FYHA 1GSLA 1UAIA 2MEV2 2XOMA 4XJZA 2ZGSA 2K9ZA 3P3PA 2P3KA 2WINB 2ZX3A 5DAXA 3CJXA 3NL1A 2X05A 3ZYPA 4N43B 4A6SA 2BDRA 5FZ0A 4JDMA 5LEKA 1QJFA 1IOAA 3BODA 4HZFA 3LIHA 1UWWA 4LHKA 4XFGA 4N53A 4XQWA 5JXIA 4BCUA 3EHKA 3APBA 4QXHA 4F83A 2UYAA 3LFMA 5G04L 3I3BA 4CDQB 1BMV2 4MGKE 1X8MA 1N1SA 3ASIA 1ZRDA 1ZZ8A 3V64A 2H0BA 3I59A 4YG6A 4BQ5A 4QQOA 4C1WA 2WAAA 5FZIA 3WD5A 4YZ2A 2VOVA 2Q8CA 3T0BA 3HNMA 2VZ3A 1KJLA 2X5IA 2ZGOA 1W6OB 3MIDA 2WNVA 4AHXA 1O4ZA 4ET7A 4AYUA 4NR1A 1GKBA 4AGRA 4CVUA 3AFGA 4LITA 5KXCA 4OUSA 5EQUA 1QNWA 3O0WA 1S0CA 3ZX7A 2F6BA 4UI9L 4CCDA 3ALQA 3I3MA 4IEYA 4L2NA 2HBUA 2YBSA 4ES9A 2QQPA 5F37A 1PVC1 4RHV3 4WBBA 4CDUC 4S2GA 3GCWA 5LCWL 5T50A 4AEJA 3DKQA 1XE7A 2DF7A 1G6NA 1LCLA 1WCDJ 3NQHA 3ILRA 1TZOA 2H6CA 2IUWA 4HPKB 1U5ZA 1ZBE3 4HKWA 4ONUA 4RYDA 1YQ8A 2DBIA 4I3PA 2E7TA 3SITA 3H1YA 5JPMB 4FI9A 4CDWA 1LHWA 2WDBA 4QX7A 1GNZA 4R4ZA 1PGL2 4HSJA 2XDVA 4LBKA 5FJHA 1R083 2DVBA 4RQPA 4BA6A 3ON7A 1PK6B 1UW8A 1CD3G 1LOBA 1W8OA 4OUEA 4Q0PA 4XHBA 4CP1A 3UT0A 4M3CB 2E53A 1PMIA 1J59A 1DYKA 1QNYA 3T2PA 2J7MA 4N53C 3MBWA 1C8M3 1H9WA 4RL7A 4XOGA 4EN0A 3ZMOA 1EP0A 1OLMA 2DURA 4EE2A 4MH0E 3RNSA 1RUF2 2AUYA 3VDAA 4GA9A 5FMOS 3PUQA 2VQUA 4LQRA 1XRUA 4PCRA 1OOPA 1K5JA 1RUH3 2Y6FA 4BQYA 3O1TA 4S2FA 1IG3A 3AYAA 4N9HA 4QXBA 3VHPA 3WF2A 1J58A 4QPYA 3NJXA 4AQ2A 1N3QA 2VW2A 4KWKA 4BJ0A 4YW1A 2JX9A 4GIQA 3M2MA 4MO3M 5ABJC 2WLQA 4AF9A 1QY4A 4CU6A 4TSVA 1V6JA 1POV3 1XE8A 2J1TA 3GZUC 3PUAA 2ZEZA 4ZS2A 1SDDB 4XBNA 1STMA 5AFBA 3O1OA 1RUI2 1UQXA 1BLZA 4I09A 3OEAA 4BISA 4Y5TA 2AZ5A 3D0JA 3U1XA 4TWTA 1O5UA 4BZ4A 5C3SA 5F3CA 4JDOA 5FP7A 5ACA2 1JOPA 1V6LA 1DIWA 3AL6A 4S2DA 4D7SA 3LDRA 2ZGTA 1RUI1 1CAXB 1QKQA 1OF4A 4CDWC 1NT0A 4IEVA 2ORXA 2P37A 3BIEA 4FPGA 2AEYA 4RQPC 3QBQA 4Q4X3 1BCXA 1YFUA 3WV6A 4AWDA 4E27A 4E8DA 1UPSA 2H6BA 2XVGA 3W5NA 3GZEA 3ZMNA 3RVHA 1R1A3 3ZLIA 1V70A 3CU7A 1C5IA 1JBCA 1JI6A 2CDPA 2R061 1XNCA 3N7KA 3N9QA 5GALA 3ZYHA 1WLCA 4QX3A 4URAA 1SLIA 5BV6A 3ZO0B 5F8PA 4Q4V2 3GXUA 1UOBA 1AR73 1OOPC 3RZKA 1OA2A 1AR82 4RSUA 4XJWA 5CKQA 3E5XA 5IFPA 2PTMA 3NVCA 2YB7A 3L9JT 2YY1A 1PNFA 4JGYC 2ET7A 1VAMA 4RD7A 4LBNA 5C8CC 1US3A 3OEBA 4P08A 4W6YA 3AMMA 4JQRA 4XDOA 4BMEA 1RUG3 3KT1A 5FPBA 4B4PA 2G9GA 1QOTA 2OZ6A 4FPJA 3ROUA 5BNPA 4GD4A 2LW8A 1HX6A 2B39A 2WQZC 4I2OA 1YFXA 1EUTA 4M0NA 2GU9A 3SLIA 1ZBA3 1H30A 2WT2A 4R8HA 4RHV2 2ARXA 1WCSA 1OPMA 3J9SA 1H8VA 4A7ZA 3H1MA 3MW4A 4JGYB 3RPQA 1JYXA 1AL0G 4YPJA 5C8CB 3K3OA 3M7AA 1ULFA 3IAQA 5E1RA 4DXSA 5A7WA 1O3TA 2PHFA 4R9CA 4IE6A 1HQWA 5IUQA 1GBGA 1MQTA 2YC4A 4P9LA 4RHV1 2VOKA 2VVDA 1ONAA 1PO23 1LAJA 2CV6A 4GH4C 2GH2A 4HK8A 4P5HA 5F1RA 5CB7A 1XB9A 2WRAA 4MOAA 3VBFA 2RS13 1LTEA 1W9WA 1XNBA 3C7EA 1WCUA 1ZBE1 4Y33A 3SKVA 5LY1A 1HXS3 1S2KA 3B9CA 2EXHA 5M0TA 3LZZA 3FZ3A 1CGPA 4PQQA 1QU0A 2E7QA 1VMHA 3ZSLA 5ISLA 5FZHA 3FUOA 1FMD3 5FJKA 3D0SA 2GN3A 4O9GA 2ZA9A 4AR2A 2V5DA 5JXHA 1SLBA 1FX5A 5FK8A 3E6BA 3ZFEA 5DAWA 1RUH2 1CX4A 1S0IA 1C8M1 1ULEA 1W8FA 5EPAA 1QEXA 5J3UA 1CN1A 3N7LA 5A70A 3UESA 4COWA 3KCXA 4MXWA 2OXBA 3VD3A 1KFXL 4RGKA 1NZIA 4XFHA 1YJKA 5EIYB 1L7LA 1SEFA 4DZGA 5FIXA 2B9UA 4ES8A 2CGPA 3TN93 1QOOA 1RUH1 1YUDA 2E63A 2EA7A 1W03A 3CJIC 4AEKA 4HANA 2LTNA 5FYBA 5JI9A 1H6XA 1OQ1A 4HMZA 5DXDA 3SC7X 4JHZA 3VZJA 5BXXA 4L8QA 4AQSA 2NLRA 3AVSA 1CAWB 4UFJA 4YVSA 2PHWA 3DPRB 2OKXA 3R4UA 1U5XA 4I0AA 1LJ7A 4FFIA 4WVZA 5EZWA 4M4RA 1POV1 1IZ3A 3GHNA 4Y20B 4Y24A 4QU1A 3W21A 1MS0A 1Y9GA 2ATFA 2X53S 4XDPA 4NHXA 5FWJA 3I2OA 4Y26A 2HWD3 2VZVA 4CEYA 3CJIB 5HCFA 3JUUA 2DUQA 3OUIA 2NP0A 1QJX3 3OF1A 4GKYA 1HQLA 5KXDA 4GZ9A 4XFBA 4XMAA 2FCVA 1F5FA 2J1AA 2QNKA 5F3EA 3RMYA 1LGNA 1J3RA 3RQ0A 2C0ZA 4K8RB 1CPMA 4FPOB 4DY3A 1SDWA 4XXPA 4AAPA 4Q4W2 1ZM1A 4COVA 1LOFC 3JB4C 1HDKA 2RDRA 4W50A 1BQPA 4Q4X1 3MEPA 2W87A 2XLGA 4CCNA 5A3PA 5JIAA 2B45X 5ANNA 1OMIA 3H7JA 3ZFEC 5A7OA 3I2HA 5APAA 3IMNA 4JQTA 4CCEA 3E97A 4E4DX 3M1HA 4K3UA 4Q4W1 1K5MC 4JKKA 5DG1A 1X82A 1CR7A 2EAAA 2HLEA 1DLCA 4P9JA 4DY5A 3ME2A 4YYOA 2VMFA 2BPA2 3CZUA 4K1YA 1W2UA 4NIIA 1X8EA 3T0DA 3LOBA 1HJFA 5FPAA 2B7YA 2XUEA 3V0AB 3BTYA 4K7JA 3ACIA 1AR71 4CYDA 3SEPA 3ZFGB 1MR5A 1RUG2 1W8HA 2EAKA 1YJLA 2WZPP 2R30A 2VGDA 4HETA 5FZFA 3V56A 2QQKA 4F3JA 5IK7A 2P5BA 2RHPA 1PGW1 5E89A 2ORZA 4CP0A 1G9BA 1K5MB 4YVSC 1ZBA2 1AYN2 5T5PA 2GSYA 4HLTA 2A1XA 3OBAA 2OA2A 3BOWA 4IE5A 5FP3A 1RUG1 1ZREA 4ZU5A 5A1AA 5FY1A 1LOAA 1MACA 4Z2WA 2ZX0A 3ZXKA 4CCOA 3O1SA 2CSGA 4WZCA 4LULA 2VZOA 4Y1ZA 4CEYC 1KS5A 1R092 4YG0A 2DUPA 5L9VA 5I93A 1ZBA1 4UW3A 1IQDC 1YQCA 3B9IA 3LEIA 5FXXA 3S7EA 3TEYA 3VBUA 4LKEA 2HWC2 4NHLA 3VL8A 4JDNA 1RTVA 1QH7A 1YIPA 2UY9A 3HQRA 2DYCA 3Q8BA 2W0XA 4HL0A 3ZXGA 3EYPA 2PMWB 3HNYM 3OPTA 5GLWA 1M06G 1ULCA 1HXS2 2HH9A 3G7DA 5CEHA 1JN2P 5D1IA 4MV2A 4QDSA 3FBYA 2YC2A 3N4MA 2YYOA 5A3OA 3WVJA 1FMD2 4L97A 1LU2A 4QPIA 4FTBA 1XQNA 3AJYA 3JD73 3ZN5A 1LNSA 4XAAA 3V0BB 3WNOA 3C7GA 1HXS1 1CIYA 3UV9A 4KG8A 5IFTA 1Y7BA 2HKXA 1W8ZA 3LDKA 2EIEA 1WW6A 3M8LA 2E6VA 4MX3A 4C1XA 4QPGB 4QX5A 1LHUA 2L9LA 1FMD1 5I8YA 1NUKA 3DCQA 4E2SA 1WLWA 1IPSA 1VBC3 2IXKA 4JHTA 4MGZE 4CU9A 2VCBA 4FXGB 2O8OA 1X7NA 5C4WC 3TN92 4Y1VA 1US2A 5F2WA 5JDBA 5K0UA 4P5YA 3J8F3 3VUOA 2C24A 4FAGA 1GP6A 4LBLA 1ODNA 4FPHA 2Y6HA 1AX2A 1DQ1A 3WNMA 4JGZA 4DPNA 1QF3A 3O1MA 4IV3B 4HK9A 4CXWA 2ZCWA 4BLJA 1JYIA 1ZRFA 3O0XA 2ID4A 1U12A 4DRRA 2CNAA 1CJPA 4XACA 1NCRA 2O8QA 2VZQA 3USUA 5CFDA 2WNOA 2I74A 3TN91 4J1XA 1JYNA 2LRPA 4OMDA 3OJBA 3VKNA 2XVLA 4CA9A 3RZHA 1GWLA 1REFA 1VBD2 4LE4A 1QHDA 2RMU2 5C5TA 5KXBA 2QUOA 4RR3A 4AEDB 3AZXA 3WDUA 5C4WB 1H2NA 1I1EA 4RGAA 2DCKA 2Y38A 3VGIA 5FUPA 1W9FA 2BNMA 2DFBA 5KXEA 1HW5A 3A0NA 3PJQA 2AR6A 1D7PM 3EO6A 2RMU1 3NV2A 4QKNA 1O3SA 3KT4A 3VBRC 4XF9A 2HWD1 4BQ1A 4D7YA 3OB8A 4QPIC 1QJX1 1VR3A 1C28A 4R52A 1SFPA 5FP4A 3UJOA 3P5BA 5IK8A 2JDHA 5JSOA 2CAVA 4LO8A 5A80A 5KHKA 4QAWA 3HQUA 3K46A 2ZAAA 3K4DA 4D7TA 3H3LA 4XJ8A 3LA7A 5F6LB 3IPVB 1UOJA 1MS1A 3RRDA 3BU7A 4QMAA 4XUNA 1JZ2A 2BFUS 2W47A 4XF0A 5T54A 4JC1A 2Y34A 1MEC2 3A4UA 2VAUA 4QGNA 3IM0A 1SQ4A 4Q4Y3 3ZOIA 4E4ZA 3WT3A 4I01A 3I3QA 3OCPA 4Y5SA 2XQXA 2RDQA 2ZGUA 1GZCA 1BXHA 3DV8A 1UPIA 4EZHA 5J1XA 2QE3A 5CFDC 3RI9A 5EWSA 4AE2A 2NZ9A 4YW6A 2OPWA 2WSVA 3WW2A 3HD8B 2QTWB 1XNTA 3I2GA 1UMIA 1IPKA 5FYTA 3RG0A 2Q1ZB 1PO12 2E26A 4LBMA 4AGGA 2WABA 5A3NA 2H0VA 3AYDA 3MUZ1 1TQ5A 3WP4A 1QJY3 5FYUA 5FDBA 1HLCA 1OA3A 1UZWA 5G05L 2HWB2 1CJDA 4IEZA 4KU7A 4PLNA 4YARA 2WA3A 5CYYA 5AC92 4WM7A 1UNBA 4HVOA 1DQ5A 3L2HA 1PO11 3WP5A 4LJHA 2ETEA 1RB8G 3IN9A 1XU1A 5A7SA 1DG6A 1WMDA 1LOGA 2I07B 3MLKA 5EFUA 5A7PA 3W58A 1C8NA 3WG1A 4CUAA 1LECA 2UU8A 1SFNA 1OUSA 5BPXA 5HCAA 2EIBA 4AFDA 5AC91 2K2SA 3ATGA 4UW6A 2XWJB 4CUGA 1DQ6A 4IE4A 3O14A 1JYTA 4AW7A 3PUHA 4MYEA 4ZXEA 4NHMA 3B7MA 4MHRA 1HRI3 3S5AA 2G1MA 3TEXA 5CVRA 2IWGB 1D4M3 1RUD3 3B3QE 1RUE3 1YFWA 2UWBA 1DFQA 2ZX4A 3JD71 4CU8A 4FPFA 2R0HA 3WLUA 4V2VA 1OT5A 2Y6KA 4NRPA 3USSA 3WW3A 4A7KA 5IATA 5LZ6A 3LSDA 4J25A 2P17A 5FRAA 3I49A 4IW3A 1BBT2 4NOTA 1SLLA 1GWMA 4XVHA 1W9SA 2GNDA 1FNYA 4AVSA 4AVAA 5FPXA 3DYPA 1VBC1 1LGBA 4XBQA 4OI2A 3VDCA 2D6NA 4NIHA 4I3GA 2HWF2 3A0KA 3H8XA 3VBOA 5LA0A 3Q8CA 4SBVA 2C9AA 2DDUA 1WD3A 3O7OA 2YMZA 3J8F1 4NRQA 4XC9A 3ZYBA 2ZEXA 3C8XA 1MZEA 1PM7A 2IFWA 2XKPA 2ZGRA 4XILA 5FR3A 3T4HB 5KHGA 2LALA 2A6ZA 2DVAA 2P3IA 2PAEA 4WM7C 2W1SA 3HAGA 1W6QA 5IW0A 5BNOA 3ABZA 1GOGA 4DQAA 5FXVA 2R073 1DGRN 5FYZA 3C7OA 4IEWA 3FE5A 3VBSB 1XSQA 5FMOL 5HCBA 3VB9A 2F4PA 3D8CA 2JB4A 1VBA2 2MNGA 4YM1A 1NG0A 4YFZA 5L9RA 3WNXA 4YVWC 5JZGA 1REDA 2VUCA 5FZMA 2A6WA 2HEWF 2VMHA 2JIJA 2ZMNA 5CU1A 1YEWA 3ZN4A 3ZVXA 4XIKA 1D2SA 2J42A 4XYXA 3THDA 3FLRA 4MVTA 1QJEA 1UY1A 3LPGA 3POWA 1WW5A 1L7RA 4N43A 1LULA 1REEA 4IESA 2D3SA 5GLUA 1N3PA 1VBA1 3ITQA 2JG8B 2IC1A 2Q1MA 2E51A 1ULDA 3K75B 4BB3A 3T08A 5BNQA 2QZ2A 2B8MA 1MS3A 4CDQA 2FZ1A 3IZOA 1IS4A 1GWKA 3AP6A 3G6JB 2D98A 4NPRA 2QQLA 3VKLA 3ZM8A 4AI2A 2R1DA 2YFZA 3FX3A 3H1WA 1O3RA 3ZXDA 5A32B 4TLGA 4QPWA 4IERA 5JOYA 3VHRA 1KDMA 4IEOA 5A1FA 1VBB3 1CZTA 5E88A 1W6OA 2IFRA 1WMEA 1NZCA 4Q4Y1 1J3QA 3UJQA 5DN2A 3MIFA 4FOVA 2GZWA 4CPBD 2VH9A 4OQ9A 1URXA 1L3JA 4XIOA 3U78A 5FOBB 2QQIA 2WS93 5FMCA 4A2UA 2DV9A 2Y60A 1AR63 3WG2A 5BNOC 1QJY2 2ZX1A 5DAQA 1JU3A 1DLLA 4UF0B 3IAPA 1DGLA 2J22A 4JX0A 1IS3A 1W2NA 3DXTA 3FHAA 3IT8A 2IXJA 3RJ2X 1ZZBA 4AHZA 3W59A 4Q1RA 3NAPB 3K48A 2WLPA 5KHHA 1YC61 4HPKA 3HJRA 4QB6A 2VUDA 2OW4A 1QJY1 3PVOA 3DGTA 3HWJA 5KWRA 5DZEA 1ZZCA 1W2TA 5F3GA 2A5ZA 1J3PA 2ZTNA 4N43C 3RYRA 3CKHA 3NJVA 3PU3A 5T3NA 2G19A 5IVYA 1HB2A 3F95A 1OH4A 4ASLA 1N1YA 5HXMA 3IIAA 5LEJA 3T2TA 1X33A 3C7FA 3MV11 5IVJA 5JLVA 1D4M2 2NN8A 2PHDA 1RUE2 4L92A 4O61A 2X10A 5DPNA 2XG3A 1X9PA 2YZ4A 4W65A 1XJAA 5D21A 2A3YA 5FLHA 2KXLA 2ARAA 4QQ2A 1GP4A 5C9AC 1CAUB 2O0OA 4OLLA 1KFUL 1HRI1 2JDKA 1RUJ3 1W04A 4BMBA 3SCGA 4U2AA 1D4M1 1RUD1 4UT5A 1RUE1 4QQPA 1JW6A 3AYCA 4YGEA 4B3NA 3M70A 2Z42A 2JWPA 4LKFA 1F4HA 1FYUA 5FZOB 2XJQA 3VZMA 2VZTA 3NKGA 4XETA 1D0GA 4FOQA 4HG6B 3MIHA 4UW4A 4HVRA 1U0AA 3PJYA 1UXXX 2CTVA 5FZKA 5GM0A 3ZYRA 3DYOA 1ZYBA 3NV3A 4CRQA 2W1WA 1DGRA 3AP7A 3NKTA 3PMSA 5C9AB 2VCMA 4FPLA 4ZONA 2UWAA 3MPBA 1JH5A 4MGQA 4B4RA 4L9BA 1PVC2 2Q0AA 5T5OA 3VL9A 5A3UA 5I0RA 2P34A 1ZA7A 3PIJA 5IVFA 1CAXA 4HN1A 2E32A 2JJ6A 2ZKLA 5ABJA 4DUVA 1YIFA 4OUMA 1NAEA 3HR9A 1E5IA 1IKQA 3GALA 3E1F1 3TNPB 1PK6C 2VR4A 3U10A 3MYXA 2R071 4EYUA 3ACFA 5IJRA 4WVVA 5CBLA 3UKNA 3H8UA 1QWRA 2W9XA 4EWDA 4AHYA 3WY6A 5F5AA 1IHMA 3GF6A 4YGBA 3PURA 5F9TA 2I2SA 2JE9A 4YW7A 3WNKA 2CYFA 1WBLA 4OZOA 3BPSA 5GZFA 2XVKA 2B9VA 4MZUA 2VY0A 2RS33 3U0ZA 2ZXQA 3GJBA 1W6NB 5B4XA 3CQOA 1AZDA 1Z78A 4QHZA 1FXZA 1XNDA 4YWAA 2WQ8A 2D6OX 2VTFA 3AK0A 1A8DA 4MUVA 1O8SA 1RUNA 2JE7A 4GQ7A 1ZZ6A 1ENXA 2A6XA 3POEA 5JMOA 3T0AA 4PBOA 4D69A 2W94A 3CBNA 5FZBA 2O1QA 2PQQA 4ZXKA 1VBB1 2W5FA 1MZ6A 2EICA 4FQZA 3WW4A 3KV9A 5BY5A 2PQSA 1JMUB 1UO9A 1VB2A 2VZSA 4JGYA 2WNEA 1G86A 3MHZA 3Q8FA 1TG7A 3WSOA 4QKBA 1W3XA 5C8CA 3DL3A 1XU2A 2VXRA 2WS91 4JRAA 1VAKA 2C6SA 1UZ0A 4PF5A 1AR61 3WQBA 4CPBA 1PZ9A 3NV1A 2Q5TA 2YU2A 2C1FA 2VOWA 1ULOA 5GLTA 2QVSB 1Y9MA 2VUJA 3GNEA 3VBOB 1NQJA 1GZWB 4P9IA 2FDFA 1PX3A 4M3CE 2ZJCA 1ULPA 2ZOEB 2BQPA 5L9BA 4A4AA 3O1PA 1HQNA 2XB6C 3AP9A 2PAMA 3AL5A 3UKTA 3ECQA 4ARYA 2DU1A 2JB8A 2R062 3OPZA 4PDWB 4X8PA 4P00B 5B2GB 5D8AB 3FMGA 1AJOA 4R9DA 1AXYA 5H9PA 3EQEA 2TNFA 5A3LA 4GH4A 2OZJA 2R0FA 1SCSA 3OGRA 5LB6A 3JBG3 1TMF3 1UZVA 1RUJ2 3OUJA 3PL0A 1FPN3 5H9SA 3ZR5A 1H9PA 3KCCA 2BGPA 2P3JA 1S0JA 3WDTA 5BNNC 2ZGNA 1KGYA 3T2QA 2ZMLA 4XEZA 1NE4A 1RVF3 2WT1A 1F5JA 1CIWA 3KCYA 2WA4A 4Q27A 4ZU4A 5FZ3A 1Q56A 4LIVA 1RUJ1 1OURA 3H7YA 3GBGA 4A44A 4V2WA 4K40A 3J7LA 4I30A 3H42B 5EJ3A 3WCSA 5A1LA 5CG9A 1X50A 1TVGA 1CAWA 4AI8A 1YQ5A 5FFOC 3T4VA 5EP9A 3KS7A 2V4VA 2QQUA 5BNNB 1KDKA 3QH6A 1ALYA 4QM8A 4Y20A 1YRZA 2WO3A 2XHNA 4UFMA 1GLHA 3ZDSA 3VD4A 4AFAA 3WDVA 1W0PA 5DZGA 3CJIA 4HKLA 2WO7A 2ZBJA 2IXCA 2E31A 2PHXA 2XGXA 4N9IA 4META 2ZEYA 1LOEA 1W2AX 2BRTA 4GWMA 2FDGA 1UKGA 5AFEA 2OQ6A 3LGRA 4E2GA 4HOOA 1ZBE2 1XNAA 5FZ6A 5F39A 3DUIA 4B4QA 4DFSA 1FV3A 2JE8A 2VMEA 3VKMA 3ZXEA 1R082 2G4IA 3Q8EA 3R0RA 4HKOA 4J6GA 4NAMA 5GZCA 1FAYA 3PVEA 2ARBA 4PI0A 5FMDA 4ZU7A 1G9DA 4ISQA 4MGTA 3ZSJA 3OYWB 1C8M2 4C0BA 3THTA 4Z1VA 3V0AA 3DXUA 1JXNA 1LOFA 1R081 2DTYA 2RS31 1V6OA 4LO7A 4X6QB 4YNIA 3RS6A 2XPJA 3ZFGA 4MGSA 2BGCA 1WMFA 4CZSA 1COV3 3OGGA 2D3RA 1V6IA 4P02B 2ZGLA 1UX7A 3T1MA 4XHXA 4P14A 4B1MA 2XL9A 4CXXA 1ZRIA 3U4SA 5C71A 5JR2A 2DFCA 2SLIA 1K5MA 5C70A 1EAH3 4LUKA 3DPRC 4OCTA 3MGUA 2F17A 1DZTA 3RZLA 5DDJ3 2VMDA 2W91A 4LKSA 1XYOA 3H50A 4OHWA 5DUUA 2P4EA 2VNRA 3IDCB 3VHNA 4E8CA 5KHJA 1SZBA 1HV1A 1V9U3 1H0BA 2DCTA 5DMYA 3RWKX 4DXZA 3ZXJA 1Z0HA 5JAXA 3M3CA 4NPMA 4LOSA 3A22A 3ZYGA 1NX9A 4OI4A 2XR4A 5JSPA 4AQTA 3KHCA 1VB4A 2BFUL 3D3AA 3DYMA 5IHRA 2VPVA 2V73A 1SLCA 1VRBA 1H2LA 1NY71 5K4LA 4Q0SA 5FZCA 2WZR3 1H4GA 1Z7S3 5JOWA 3RFRA 1TNRA 4Q4X2 2R16A 5IVVA 3KQRA 3LA3A 4FVVA 1U5YA 3WNLA 3DECA 3V0BA 3MI8A 1C3HA 1OC1A 3T3YA 1R1A2 1A3KA 4KH9A 2XUMA 5EXOA 3JBG2 1TMF2 4O7XA 4WVMB 1FPN2 3AFKA 2D5FA 5EV7A 2PHRA 3CMGA 4OHXA 1ACCA 4LOTA 1XYPA 2DVFA 3ZFGC 5HI0A 1GFF2 2JENA 2RDNA 4QX1A 2FHRA 4DO0A 5J48A 5BNPB 2NM1A 1SHWB 1R1A1 4GWJA 1AR72 2GDFA 3PTYA 3SCFA 2QQOA 3JBG1 1TMF1 5I91A 4OULA 2XLFA 5I0UA 1FPN1 4XURA 1UIJA 3JXSA 1BK1A 2N7GA 3VZKA 3MPPG 2DWRA 4IV3A 1AXZA 2DVGA 1PGW2 2Q1FA 2PXJA 4QXCA 1O4YA 4FFFA 4IL7A 5FQ0B 3FC0A 3FN9A 1RVF1 3OUHA 3NNGA 3WF4A 3EMRA 3KGLA 2FZ2A 1DZRA 3N36A 5J96B 3HQXA 3MW3A 4SLIA 4ZKTB 1NXD1 1K12A 1CX1A 3KV5A 1MQTB 4AEDA 2RE9A 5C4WA 1N1VA 3KVBA 4UBHA 4TZDA 2GC2A 3R05A 3B00A 3OD4A 1FV2A 1S4CA 1W0OA 2VQ0A 1GR3A 3GBWA 4QGMA 1LRHA 5FBZA 5DAVA 1T2XA 4LTAA 5C33A 2P6CA 4YZ3A 4XF4A 1W9YA 2CY6A 5FLJA 5T52A 4ATFA 5HV4A 2Y6LA 1Y9QA 4GMP3 4NRMA 1PZ8A 1MS9A 2JIGA 3UKVA 1LODA 1VRH3 4ITCA 1U5IA 1JZ3A 1JYVA 2CDOA 4YW2A 2JECA 4MHUA 4MLOA 1PO22 4D6SA 5FKCA 4MXVA 2BYVE 2ZGMA 2KM2A 4BK5A 4H14A 2VOTA 4QDQA 3FL7A 4QX2A 4C0HA 3NWKA 2RS12 2BW8A 5A33B 3GCXA 1SACA 3IMMA 3PU8A 4QPGC 1F35A 3RYKA 2D93A 1GUIA 2ZHMA 3IPVA 4GULA 2EXKA 1V6KA 3VZLA 3IKWA 1UU5A 2GC1A 3ZPOA 2VXJA 1HB4A 1PO21 1P8JA 3VBRA 1EV13 2K0GA 1JUIA 2OPKA 2RS11 4QX0A 2VQAA 1COV2 1W0NA 3WG3A 1UYYA 4EJRA 1GZTA 2MHFA 3VV1A 2ZACA 2P1BA 4IV3C 5FPUA 4FSJA 5FZ1A 3THPA 1EAH2 3RMXA 3OBTA 3OGVA 4D6RA 3KQ4B 1QXPA 2PELA 4UFIA 3RZJA 4LBQB 5E6HA 1A6CA 3ACGA 1UN1A 5FYIA 4G3YC 4XF1A 5A6ZA 1COV1 2Q4SA 2XMLA 4AEDC 2V5YA 4KMQA 3LD8A 4XQ4A 2I45A 4JKLA 5CADA 1DU3D 1EAH1 4DXRA 1ENRA 5DDJ1 3ZR6A 1UY0A 4Y5Z0 3LKJA 3LF7A 1NOVA 1H6YA 1QDCA 2X29A 1W90A 2AREA 2A75A 2LM3A 2VUAA 3S5QA 1K3IA 1W99A 1S55A 4QB1A 5J37A 2WZR2 4AZZA 1QJU3 2ADEA 3OBRA 1Z7S2 2BOIA 3BPZA 3IWZA 4FPEA 4CDXC 3VD9A 4RS5B 3GM8A 4QXKA 1SPPB 4H7LA 5EHDA 2HWD2 1S0DA 1T6GC 4COZA 5J36A 5IK5A 2B4KA 1QJX2 4LMFA 2EIDA 4JKMA 5BYNA 2GC0A 3CNAA 1PMJX 3B94A 1ND2B 3GJAA 4PJYA 2VW1A 4DIQA 5GZGA 2WZR1 3KD4A 3VDDC 1Z7S1 1FI2A 1CPNA 2BWCA 3QACA 4BYYA 5I0SA 4B7KA 3ENRA 4WM8B 3KB5A 3PNAA 1QDOA 1C4RA 4RN5A 2F4LA 2VBPA 3LIGA 4AAXA 2J1UA 4CDXB 4LO4B 3X29B 5DZFA 4CCMA 3BCWA 4XFAA 2ZZQA 3NNFA 4QQHA 2RR13 5C3PA 2IXHA 4IEXA 4ASMB 3WF1A 1PGSA 1W3VA 5A3TA 2PA7A 3POSA 5HXVA 1CAVB 1ND3B 2AH2A 3VD5A 3VBHB 1PMHX 2ERFA 3MICA 3WXPA 5CAZA 3L2YA 4KG0A 3S0MA 3VDDB 1JYCA 1W6MB 3TAYA 4QB2A 2JKBA 1UMHA 4AFCA 4YZ5A 1RINA 1H1IA 4FO9A 2AGSA 2TBVA 4LLOA 2OYZA 3TB0A 5FREA 2J1EA 3H0OA 4OI1A 1BJQA 3VKOA 1J83A 4NWWA 2NMOA 4XW3A 4OQ8A 4CEWB 2KR2A 4O9EA 4CCCA 5LBFA 1H2MA 5FOJB 1H8TC 3EXUA 2VQTA 3UETA 1HN1A 3SH4A 1WLTA 4C8DA 2ADDA 1FOD3 2GN7A 3D5OA 3C2UA 2VNOA 4LBJA 4NMIA 3GGLA 3RGBA 3VBSA 2DCZA 1S0GA 3WCRA 4YLZA 2JG9C 5IK4A 1QOSA 1GOHA 4WV8A 1XSRA 1E5RA 3LCPA 4DUWA 2VZUA 4Q1PA 5KC6A 3P3NA 4EN8B 1WA4A 1H4HA 1YNAA 4K21A 1B35B 2JEMA 4I0WB 4QD2A 1O7FA 4IE7A 3UGHA 1N1TA 5C7GA 2PAKA 2CU5A 3LB9A 1H8TB 1O6UA 3AXDA 2QDNA 3AX4A 4GMP1 3WQ7A 3RZMA 2W95A 4Z07A 5FY8A 1VRH1 3I4IA 2RVAA 4DXTA 4XABA 2WFF3 3POGA 2JG9B 4TXWA 1Q8PA 4NIDA 3URFA 1AYM3 3W9AA 1OVPA 5IYYA 2WNUB 2YPJA 3WEZA 3PTRB 2FMDA 3JD72 4YVWA 1BEV3 5K0UB 2IXLA 3AMNA 1WGPA 3HMYA 2D3PA 1UY3A 1WUVA 2EALA 3OY8A 3J4UH 2TEPA 5A32A 4AOCA 4FT8A 2FDHA 1OKQA 1EV11 3IDBB 3USUB 3WP3A 1HRV3 2ZS6B 5L19A 1ZRCA 2D44A 4ZPIA 3MLJA 4G9SB 1VBC2 3UGFA 4F7ZA 1YWKA 1UOGA 4TN7A 1X9TA 2PYTA 3HPNA 3MV01 4JZRA 4NO4A 4NROA 4RR3B 2VZ1A 3EB7A 2B46X 3S57A 1K42A 5FZ8A 3J8F2 5TSWA 1O91A 1S2EA 2W2IA 4MGYE 3QLQA 4TLFA 4KI5M 5FZGA 4LHNA 1W8TA 1CQ9A 2C26A 4UF0A 2P3YA 2G9ZA 2LUWA 3V65A 4PIYA 5C8WA 1FATA 1NCQB 2EXIA 5FZDA 3VBSC 4EROA 1GANA 4LKDA 4W6XA 1Q8OA 4XMIA 3NAPA 2BEOA 1H1AA 1XOYA 2AEZA 2BV4A 1DQ0A 3NNMA 1VBE3 5ANQA 1QJU2 1Q5OA 3ZN6B 1O3QA 2WYSA 5L7OC 4BIFA 4FTSA 3R6SA 3GYDA 2MEV3 2R32A 5GZEA 5I8SA 3KSCA 4FPKA 1DYPA 1VAVA 2DTWA 2WWJA 1RJ8A 2ZHLA 1GP5A 2BUKA 3I3DA 3OD0A 1OA4A 5DAPA 5FCCA 2VMGA 1QJU1 2JG8C 2HEYF 4BXFA 4DRVA 4W8JA 5IAXA 1YCIA 2IVIB 1I5PA 1YFYA 3FLPA 2WC2A 3CZJA 3ZSMA 3NNJA 4W6WA 2WAOA 3M4FA 2PHUA 3PVBB 5F6KA 4A41A 4A3XA 1QXRA 3ZDVA 5L7OB 2RR12 3LPFA 2J1SA 4IUGA 1DGWX 1A8MA 4EZ4A 2R6QA 4MG2A 1CAUA 3NNLA 1RYYA 2GAUA 4B1LA 4EN7B 4EN9B 5HBAA 3ZYFA 1HIXA 3RDIA 4XJAA 1QXJA 1J1LA 5CKMA 4M00A 2BZDA 1PHMA 1JYWA 2RR11 2JDNA 3PVNA 4FP2A 4AI3A 4YGCA 1SLAA 3J7HA 4Q4Y2 4Y3OA 5EJ1B 2Q8EA 1JOBA 1UX6A 1LESA 5FP9A 3WOGA 2VC9A 3J7NA 5CG8A 4IDZA 2ZX2A 5FZEA 2JDMA 3GZAA 5C9AA 1YI7A 2GNMA 1KITA 3N3HA 3PHMA 4XJ9A 4Q2FA 5FZ4A 1UCXA 3D4KA 1IGOA 3NAPC 4GAZA 1FOD2 3VHOA 3U14A 2HWE3 3HIFA 4FFGA 5FTTC 4N90A 3MUY1 2VULA 3QH7A 3PMEA 5CNAA 3FHIB 4QX8A 4ZS3A 1ZX5A 4AFBA 4LEJA 1S0FA 2E33A 3C7HA 2Y6JA 2JDYA 3SKJE 2BOJA 2ZGQA 3WW1A 2BU9A 3UGGA 1FOD1 3TBDA 1H2KA 3I2KA 4Y22B 1UU6A 1MPXA 5JVVA 4GB33 5FP8A 4KWLA 4BPZA 2QQVA 2OQ7A 4UYBA 1W6PB 3DEMA 3FJSA 1MVEA 4YFWA 1RUF3 2WKKA 4UBGA 3AZWA 2A3WA 4A7YA 2JD9A 1AYM2 3INAA 4XCBA 2A71A 3BVCA 5FYMA 3TRSB 1V00A 1BEV2 1TNFA 1RC6A 1PK6A 1W6NA 1XYNA 5F3IA 1WMXA 2W68A 5CIRA 2WUHA 4M3CA 5FLIA 5GLVA 4FAHA 5CISA 3BI3A 1DYOA 3ES4A 2WFF1 3HT2A 2ARCA 5LATA 5T55A 1RUC3 4XUTA 1HRI2 4CP9B 5I0DA 1S0EA 1DHKB 1AYM1 1LOCA 1J1TA 1W8NA 3CF6E 3MO4A 5FKBA 4ATEA 1RUD2 3IB3A 3I8TA 1WW4A 4P9YA 5A7QA 4BQXA 1G9CA 1GV9A 1W8WA 2WN2A 4UWDA 1BEV1 3LDBA 1JTZX 5LBEA 2NYYA 2PFWA 3BGAA 4X8NA 2Q30A 4I0BA 4NJ4A 1A78A 3PDQA 3EBRA 4QWNA 4KGGA 3ILNA 3HNBM 1UKRA 1HRV1 1ZZ9A 1TME3 1ST8A 3PUSA 4QKDA 3J26N 1RL3A 1QGLA 4AK3A 5B4NA 3BKZA 5ACA3 5BUVA 4IEUA 1Q8SA 4PQ9A 3NW4A 3WHTA 2CL2A 3K2OA 4XFCA 5LASA 2EIGA 3MF9A 2CGNA 4HFSA 1SBEA 2A70A 4IV1B 5FYSA 2BNOA 5T5LA 5LK7B 1VBE2 2VMIA 1JUHA 5GKAC 3SCHA 3N9OA 4RFT0 3AZZA 3CLPA 4S2HA 3U07A 4OHVA 4E2QA 5JZGB 2XBO3 3WDYA 4XZPA 3GHMA 3ACLA 3FBMA 1ZRRA 4IGOA 1GZWA 1G9FA 2HYKA 1HB3A 1L7QA 1VMFA 1RITA 5FXZA 2R072 2Y0OA 2CHHA 2UURA 1VBE1 4BDVB 2XH6A 2ZHNA 3T30A 5FUIA 3WUCA 1UYZA 1ENQA 4U36A 1DZQA 3RYPA 2E9QA 1EY2A 2HEVF 1N3OA 4Q4V3 2MEV1 4COYA 1XE0A 2OT7A 4PDWA 3TOJA 2VNGA 4DMIA 4NIGA 2BGOA 2YPDA 3KMHA 5D8AA 4HT1T 5FY7A 3HEIA 4FFHA 1AR83 2JXAA 1IKPA 1AR93 1F9KA 1SCRA 3NMBA 4Z92B 4YM2A 2KA3A 2ZHKA 4LA2A 1SBDA 3VKFC 4LK6A 5J7MA 1AF9A 5JPNB 1UD1A 4EQVA 4XCAA 1NA1C 1VALA 1BMV1 1C1LA 5KR7A 2Y33A 3AB0A 3B69A 1LKNA 1KD7A 4Q0VA 3WQ1A 2J1RA 3HOBA 1KS4A 1UL9A 4K8FA 4CUBA 1JHNA 4BXSV 2IZWA 3T2OA 1O5LA 4OI0A 2Z79A 3BOPA 3CL1A 5CFCC 3NJYA 3WNPA 4JAAA 1KRIA 1BZWA 4JVAA 3KGZA 4XBLA 2V09A 2NQYA 4J1WA 4HXCA 5LWBA 1VBB2 5CZKA 1W05A 1OHFA 2OUJA 2QCSB 1NA1B 2WFPA 2IXIA 3SH3A 2HWE2 5A6XA 4D0QA 5BNNA 3J7MA 4MSVA 5E8AA 4AI1A 2D6KA 1PM4A 4XFFA 1JZ5A 4E4HA 4DB5A 1CZSA 2YG0A 1APNA 2GALA 3AZVA 4XAEA 1F31A 1RHI3 2W46A 2WS92 5JUVA 2VTXA 4GXLA 1LHNA 2SBAA 3VBOC 1AR62 5CFCB 5FZ9A 1ULGA 3UL2A 4YZ1A 4N8MA 2HWE1 4Q0QA 4CDUB 4FTEA 3H8RA 2BVBA 2X09A 3K51A 4GB32 3OOXA 4FCAA 1OKOA 2A6VA 2YC0A 1PGL1 2VVEA 4PDWC 1OQEA 2C4XA 2R043 4B29A 1HB1A 5D8AC 4PT6A 4JTNA 1MVQA 2JDPA 3ETPA 5F32A 1Q43A 3FWEA 4R9AA 3ZXLA 4GB31 4EWEA 2X5IC 3N35A 3OPWA 3RWNA 1WCKA 2WL1A 3HT1A 2WNVC 4LBQD 4OHZA 3D6EA 4ARXA 5LA1A 1RUF1 1RUC2 1K45A 1NYWA 3OYWA 4N53B 3ZFFA 5AC93 2WQ4A 2Z69A 4N7UA 3I97A 2YV8A 4D8MA 1BHGA 4JV4A 3RJRA 4BQ4A 2VMCA 1YYNA 3MIBA 4M0HA 3R4SA 3I59B 3MLLA 1VE0A 5LRRA 4AXOA 5EYYA 1RUC1 3ACHA 4OHYA 1W2OA 2XJVA 4G4FA 2X5IB 2XJSA 3ELNA 3NV4A 1TME2 3CHXA 2QQJA 2WNVB 3O0VA 1XBFA 4E9KA 4KU8A 4LA3A 2FDKA 3FUQA 2A73B 3HN1A 4O65A 4BK4A 3ZKYA 1UZYA 5C5UA 5ABJB 1UYPA 5GJ6A 2BTVC 1DF0A 2C9KA 2VG9A 3N7MA 1NQDA 4DEQA 1TME1 2UWCA 4Z82A 2YU1A 4CCJA 1LGCA 2XBO2 4KBBA 5ACA1 2BNNA 5SV8A 5L36A 2W52A 1DGWA 1JS9A 1OPOA 4PIZA 1QQP3 4AVTA 3WX5A 3DPRA 1G8WA 2VJXA 3GDBA 4Q4W3 4UW5A 2WWSA 4P9GA 4LK7A 4QM9A 4ASKA 2GC3A 4GJZA 4LUMA 3S7IA 1PZ7A 1V6NA 2VM9A 4B8EA 2JD4A 5GLZA 4EV0A 4CDWB 2JDUA 2XBO1 2RDSA 4RQPB 2ZGPA 3O5SA 1UOFA 4DNYA 2VTXJ 1BKZA 3SHRA 1CESA 1AR92 3BUCA 4YM0A 3U75A 2BVVA 4LIUA 3CEWA 4LBOA 1KJRA 3BYWA 4WVMA 3I54A 4XUPA 3AC0A 1ZVFA 2GH8A 2D6MA 4Q4V1 1OH3A 3IDEA 5JI7A 3I2FA 1DCSA 1ENSA 3JB8A 3ZFFC 1AR81 1ODMA 2GMPA 1IS5A 1NLRA 1AR91 4URTA 4M01A 1BK0A 3NJZA 2XJPA 2RS32 1EUUA 1AX0A 2XKOA 1HN0A 1OOPB 3I7DA 1DQ4A 2VBDA 5FBJA 2PHTA 3AM2A 2ENRA 1AYN3 1RMU3 1OF3A 3KZ4C 1NLQA 1JU4A 3AKQA 3HN3A 3OTFA 4AHWA 1E5SA 4DUXA 3ZXAC 1B09A 1TEIA 5FQ0A 5HCHA 2WBKA 2Q8OA 3O1VA 3LWCA 4AQ6A 1I5ZA 5LW9A 1UYXA 2NPIA 3VD7A 1NLSA 4QHBA 3ZFFB 1R093 5FY0A 2D7FA 2QQNA 3B02A 3K4ZA 1RGSA 1D4VB 1RHI2 3POIA 1PIV3 4Y1UA 2Z4FA 4PF1A 5T5JA 3Q9OA 3M3OA 2BBVA 4N7IA 2ET1A 2HWC3 3M3EA 3NO8A 5C3OA 3LOIA 2CAUA 1PX4A 4YG3A 3B5LB 5A6YA 5FYVA 2ZPXA 4LNVA 3ZYJB 5GZDA 4FOWA 2WO2A 4OZXA 4PBPA 2R1BA 1T6BX 5F5CA 4YSFA 1RHI1 1UMZA 4NHYA 5EJZB 4Z2AA 3JZVA 1OLME 1NY72 1RIRA 2R042 2R49A 2RJLA 3BU0A 4BLIA 3R4DB 4XE9A 5HV0A 1SFYA 4LE3A 2GNBA 4YRDA 1SMVA 3WDWA 3KF5A 4GH4B 2YROA 4W4ZA 2DCJA 4IGQA 2WWUA 3HBKA 5A33A 3AMQA 2PLV3 3E6CC 5FY9A 4BOWA 5LBBA 2R041 4AG4A 3ZSKA 1UF2C 3AMHA 2GNTA 5EYXA 1LEDA 1EPWA 3D82A 4Y1YA 2CWMA 5JXJA 3WNNA 3ORJA 5BNPC 3KLSA 5KBFA 3VZOA 3ZYIB 1FNZA 1BVP1 4HBNA 3AKPA 2D6LX 5JCTA 2W39A 3LEMA 5FXWA 3WF3A 1W8UA 3TEWA 3H3ZA 1W9TA 3PIGA 3H8OA 1F15A 2O14A 4OVEA 5L73A 4BWOA 1WBFA 3E5UA 3NSTA 3SQOA 3NRUA 3QCWA 4QPGA 3K77A 3IDAA 3POBA 1OLQA 4LBQA 4HVQA 2YGLA 3HBZA 2DCYA 1WA6X 3POYA 3WP6A 5FMBA 1VBD3 1JODA 1MQTC 2RMU3 1RVF2 2UY8A 4D94A 1R64A 4XF3A 1QH6A 1C5HA 1W28A 4DS0A 1XXNA 2VNVA 2W92A 4NAOA 3VBFC 5FPLA 1AX1A 1FT9A 3AJZA 3AKSA 3AMPA 2GP5A 2E7AA 4K20A 4K9SA 4PHZA 3WQ0A 2XJRA 3N9MA 4Q0UA 3ILFA 1QQP2 1G9AA 5IVEA 1E5HA 3ZIWA 1EPZA 4F8AA 1JZ7A 1BYHA 3A7QA 4QQLA 5A7WB 5C3QA 1YO8A 3OGJA 5K7PA 2A3XA 1C1FA 2FQPA 2OX0A 5LY2A 2WYFA 4RS5A 1SPPA 2B5HA 2NMNA 1ZZ7A 3DKWA 1DQ2A 1QQP1 2AENA 3PUIA 1JZ8A 4LO6B 1AJKA 2ZEWA 4KWUA 5A3WA 3VBFB 4P9XA 3WR0A 1ND2A 1CWPA 3AZYA 4CE8A 1S2BA 3RI8A 3U11A 1R1ZA 1Q3EA 1LU1A 2QQMA 4Y1XA 1GZ9A 4WM8A 1POV0 1SG3A 2JICA 3KVAA 1OD3A 3JCIA 4H2AA 4IQPA 5IVCA 1ASJ3 2V4AA 2R7EB 1MEC3 1MS8A 5JWPA 4CDXA 3ZIXA 2C5DA 3OSDA 1HKDA 4H7MA 3U37A 1W06A 2OVUA 3LE0A 2ILMA 3ZFEB 4ZZ5A 2RG4A 1OD5A 5F5IA 3I3EA 3AKTA 2JKXA 1CAVA 1ND3A 3TEZA 1RMU2 2RJ2A 3VBHA 3LSEA 4MXWB 1NXMA 4TYSA 4AVVA 5JMCA 3VDDA 2MPFA 1W6MA 4XZUG 3O1RA 3OGSA 2J1VA 2W3JA 1PO13 2OIIA 4XJUA 1A34A 2VL4A 4XXAA 1MZFA 1RXFA 2VECA 4GJYA 1AYN1 1RMU1 1UY4A 4HN0A 1GQHA 3UYJA 1AHSA 1QIQA 1PIV2 2RJKA 2ZGKA 2BWAA 3AP5A 4LO5B 4RGGA 2HWB3 4A3ZA 4CEWA 4GKXA 3O1UA 4YVSB 4WVWA 4LT5A 2VCAA 3QOPA 2VE1A 1HV0A 2QQWA 3N9NA 5DDJ2 3S6PA 3BTXA 2ZABA 4FXKB 1IG0A 1R091 1UXZA 3FFZA 5DQ0A 3WDXA 1JZ4A 5FO9B 1V9U2 4RS5C 3RSJA 1PIV1 4MADA 4GWIA 2EF6A 3MFCA 3ST7A 2HWC1 4CEYB 1DP0A 4TTGA 5AVAA 3MZHA 1AVBA 2WIIB 3Q8AA 1Q8QA 3EJKA 4ZZ8A 1ND2C 4EN6B 5FUNA 3ZSEA 1GU3A 4CP2A 3U4XA 1B35A 1E57A 1MZ5A 3LEKA 2WJSA 3LEGA 3KV4A 5J98B 4AVBA 5J09A 1SBFA 4KBZA 5IWFA 1V9U1 4BQWA 1H8TA 4H3WA 2PLV2 4NPLA 1UU4A 4WM8C 2YBKA 2HJIA 3LQCA 4AEMA 1QMJA 4PLOA 1RUOA 5H9RA 3SEEA 4BQ2A 3SNMA 1WKYA 2JG9A 2QBXA 4XTPA 5FY5A 5A7NA 2Y64A 2QDRA 3N9LA 4YM3A 4Q8KA 4R4XA 2WNUA 1O8PA 4YW3A 2XLAA 2QJVA 3VLBB 4QT6A 1BBT3 3C3VA 4M4PA 4XTMA 2PLV1 3F2ZA 1ND3C 4UAPA 1D0HA 4CTEA 1O59A 5LRSA 1V0AA 3VBHC 1UZZA 1Y3TA 5F2SA 2JDZA 3WZ1A 4IEQA 2RV9A 2HBTA 1MS5A 4BE3A 4KWJA 4LHSA 5DUWA 4BH9A 5JXGA 2HWF3 2W08A 2AC1A 3A21A 4L0PA 4XDQA 3RZZA 4KL1A 4QHOA 2CGOA 3JQXA 2VO5A 4GWNA 4L99A 1GNYA 2V72A 4DINB 1UIKA 1YQ6A 2P6HA 4M3CF 3VBUC 3H3UA 3CDZB 4CEWC 4CU7A 1WLDA 3LAGA 4ISRA 4Q26A 1W39A 3ZPYA 5IAVA 2RM23 4L11A 4OFGA 3SH5A 1YLLA 5LA9A 1HJGA 4CCLA 2JDAA 1VBD1 1H1MA 1NCQA 2RS53 3PLQA 4FQ4A 4JTOA 2LS6A 5F5QA 3BN6A 5FV3A 2XHKA 1YQ2A 4D3WA 5JSRA 1OUXA 2DUOA 1VBA3 1LB2A 5JOXA 3VDBA 3ZN6A 4I02A 1GOFA 1OSGA 3T1LA 4P9WA 3UK9A 2D5HA 3VBUB 4LLFA 4Q5OA 1B35C 2FCTA 4E4SA 1OLRA 3ZKUA 3AXEA 3MDPA
chains in the Genus database with same CATH topology
2YHJA 4DOUA 2PHLA 2AYHA 3LA2A 3TWIA 4IEPA 4XFIA 1PVXA 4IETA 3VBRB 2ZKNA 2QFEA 2WNUC 1LHVA 2Y26A 1VRH2 1ASJ2 4KGQA 1XNKA 3WG4A 3MF6A 3JU9A 4QPIB 5K0UC 2TUNA 1YI9A 4C91A 5L7OA 3TYJA 1LEMA 4AI0A 2XJTA 4JGZC 4K6BA 1VIWB 1RJ7A 3QD6A 3WHUA 5KHIA 3MIEA 2D6PA 1NCRC 3BIWE 1YXWA 1ASJ1 1MEC1 3H9AA 2JG8A 1GQGA 5A3MA 2FBEA 5LK5A 1EV12 4RR3C 3FFQA 1LR5A 2X8KA 3MW2A 3AKRA 1M4WA 2DU0A 1OFSA 4JGZB 1CVNA 4FPYA 3AYEA 1LENA 1G7YA 1F2NA 1NCQC 1ZNPA 3SXWA 3SMHA 4YW4A 1NCRB 4Q8LA 1I3HA 1IPJA 3GZTB 4NWVA 5CFDB 5KBFA 4C90A 3KT7A 2D40A 2VOXA 1OQDA 3M3QA 4AVCA 2DVDA 1IS6A 3SISA 2XJUA 1X36A 1Y43B 1PNGA 1Q8VA 2HWB1 3WINE 2VVFA 3JQWA 1S0BA 2GMMA 1AL23 4YW5A 3N7JA 4H55A 2WT0A 1MS4A 2WSUA 4FPCA 4BHPA 5I8TA 4Y22A 5FAXA 4NN0A 3CO2A 3DF0A 5CA6A 1VJ2A 1I9RA 1EYBA 3FLTA 1W6PA 4COUA 1AUYA 5C6CA 4MGIE 4B7EA 5KC5A 4XPVA 1VP6A 4NVPA 3GBFA 4LR4A 3E6DA 1S1AA 4Q29A 1QJZA 3M3IA 3ES1A 2G9FA 2FMYA 4GMP0 4NHKA 3WUDA 4BM8A 2ZMKA 5E16A 1VLNA 2Y0IA 1BBT1 4Z8BA 5K8SA 4FOYA 2UYBA 4K1ZA 4R9BA 1GNHA 3BB6A 4KNCA 1JOJA 5DUXA 5IT6A 1DBNA 2YUEA 2HWF1 2YXSA 2RM22 1PVC3 1AXKA 2Z5WA 2ES3A 2RS52 3ZXFA 4LHLA 4YGDA 4IV1A 2XL7A 3TNQA 4BIOA 3DN7A 2RM21 1ZA4A 4V1PA 2RS51 5FO7B 1LHOA 4WM7B 5I0TA 2OUHA 3ETQA 1C57A 2GMEA 2VU9A 2D43A 2P2KA 4Y4YA 4X6RB 3I2DA 5FPZA 4AFMA 3BALA 4YVWB 1WD4A 5FO8B 4HSLA 3VZNA 4EWAA 3OY8B 4RA0A 5JR7B 4XQDA 3E5QA 1I6XA 1F8VA 3MFAA 3BTAA 2WFF2 1OFNA 4UXAA 5DUVA 4ORFA 3KM5A 2ZZJA 1CONA 2A6YA 4WZFA 2A7AA 1GICA 2Z2SB 1TE1B 2EXJA 3B93A 1OI6A 1SLTA 4IXLA 3B01A 4FP3A 4KQ7A 2B42B 1NE6A 3S30A 1O4TA 5DG2A 5SV5A 1HRV2 2VW0A 4JCKA 4IV1C 1NA1A 4QGLA 2QZ3A 3IBMA 2PN5A 3MIGA 3VN4A 4AGVA 3O12A 4INDA 5JZGC 4GALA 1RUI3 2YDEA 4YZ4A 5AVPA 1DDLA 4PLMA 1YHFA 2D97A 5H9QA 1V6MA 2XWBB 4QU2A 1W6QB 5BNOB 5CFCA 5JOZA 1AL22 1BVVA 2QKDA 5JIUA 4CDUA 1KXGA 1IQAA 1WW7A 2ZAHA 2CWSA 2EVXA 1D2QA 1KQRA 1GYKA 2R063 4PIXA 2YGMA 4JRLA 3AP4A 4CDQC 1AL21 4FBFA 1N47A 1GSLA 1UAIA 2MEV2 4XJZA 2ZGSA 2K9ZA 3P3PA 2P3KA 2WINB 2ZX3A 3VBOA 3CJXA 3NL1A 3ZYPA 4N43B 5LEKA 4JDMA 1IOAA 3BODA 4HZFA 4XFGA 4LHKA 4N53A 4XQWA 4BCUA 3EHKA 3APBA 4F83A 2UYAA 4CDQB 1BMV2 4MGKE 1X8MA 1N1SA 3ASIA 1ZRDA 1ZZ8A 3V64A 2H0BA 3I59A 4YG6A 4QQOA 4C1WA 3WD5A 4YZ2A 2VOVA 1KJLA 2X5IA 2ZGOA 1W6OB 3MIDA 2WNVA 4AHXA 1O4ZA 4AYUA 4NR1A 1GKBA 4AGRA 3AFGA 5KXCA 4OUSA 1QNWA 3O0WA 1S0CA 3ZX7A 2F6BA 3ALQA 4IEYA 4L2NA 4ES9A 2QQPA 1PVC1 4RHV3 4WBBA 4CDUC 4S2GA 5T50A 4AEJA 1XE7A 2DF7A 1G6NA 1LCLA 1WCDJ 3ILRA 2H6CA 4HPKB 1U5ZA 1ZBE3 4HKWA 4ONUA 4I3PA 2E7TA 3SITA 3H1YA 5JPMB 4CDWA 1LHWA 1GNZA 4R4ZA 1PGL2 4HSJA 4LBKA 1R083 2DVBA 4RQPA 4BA6A 1PK6B 1UW8A 1CD3G 1LOBA 4XHBA 4CP1A 4Q0PA 4M3CB 2E53A 1PMIA 1J59A 1DYKA 1QNYA 4N53C 1C8M3 1H9WA 4RL7A 4XOGA 4EN0A 3ZMOA 1EP0A 2DURA 4MH0E 3RNSA 1RUF2 2AUYA 4GA9A 5FMOS 1XRUA 4PCRA 1OOPA 1RUH3 4S2FA 3AYAA 4N9HA 3VHPA 1J58A 4QPYA 4AQ2A 1N3QA 2VW2A 4KWKA 4YW1A 2JX9A 4GIQA 3M2MA 5ABJC 2WLQA 4AF9A 1QY4A 4TSVA 1V6JA 1POV3 1XE8A 3GZUC 3ZFFA 4XBNA 5AFBA 1RUI2 4I09A 2AZ5A 3D0JA 4BZ4A 4TWTA 1O5UA 4JDOA 5ACA2 1V6LA 1DIWA 4S2DA 4D7SA 2ZGTA 1RUI1 1CAXB 1QKQA 4CDWC 4IEVA 2P37A 4FPGA 4RQPC 3QBQA 4Q4X3 1BCXA 1YFUA 3WV6A 4AWDA 4E27A 1UPSA 2H6BA 2XVGA 3ZMNA 1R1A3 1V70A 3CU7A 1C5IA 1JBCA 2R061 1XNCA 3N7KA 5GALA 1WLCA 1SLIA 5BV6A 3ZO0B 4Q4V2 1AR73 1OOPC 1OA2A 1AR82 4RSUA 4XJWA 3E5XA 2PTMA 3NVCA 3L9JT 2YY1A 1PNFA 4JGYC 2ET7A 1VAMA 4RD7A 4LBNA 5C8CC 4W6YA 3AMMA 4JQRA 4BMEA 1RUG3 3KT1A 4B4PA 2G9GA 1QOTA 2OZ6A 4FPJA 3ROUA 5BNPA 1HX6A 2B39A 2WQZC 4I2OA 1YFXA 4M0NA 2GU9A 3SLIA 1ZBA3 1H30A 2WT2A 4R8HA 4RHV2 2ARXA 1WCSA 1OPMA 3J9SA 1H8VA 4A7ZA 3H1MA 3MW4A 4JGYB 3RPQA 1AL0G 5C8CB 3M7AA 1ULFA 5E1RA 1O3TA 2PHFA 4R9CA 1HQWA 5IUQA 1GBGA 1MQTA 4P9LA 4RHV1 2VOKA 2VVDA 1ONAA 1PO23 2CV6A 4GH4C 2GH2A 4HK8A 4P5HA 5F1RA 5CB7A 3VBFA 2RS13 1LTEA 1XNBA 1ZBE1 1HXS3 1S2KA 3B9CA 2EXHA 3LZZA 3FZ3A 1CGPA 1QU0A 2E7QA 3ZSLA 3FUOA 1FMD3 3D0SA 2GN3A 4O9GA 2ZA9A 1SLBA 1FX5A 3E6BA 3ZFEA 1RUH2 1CX4A 1S0IA 1C8M1 1ULEA 5J3UA 1CN1A 3N7LA 4COWA 3KCXA 4MXWA 1KFXL 4XFHA 1YJKA 1SEFA 4DZGA 2CGPA 2B9UA 4ES8A 3TN93 1QOOA 1RUH1 1YUDA 2E63A 2EA7A 3CJIC 4AEKA 4HANA 2LTNA 5JI9A 1OQ1A 4HMZA 5DXDA 3VZJA 5BXXA 4L8QA 4AQSA 2NLRA 1CAWB 4YVSA 2PHWA 3DPRB 3R4UA 1U5XA 4I0AA 1LJ7A 4WVZA 5EZWA 1POV1 1IZ3A 3GHNA 4Y20B 4Y24A 1MS0A 2ATFA 2X53S 4Y26A 2HWD3 4CEYA 3CJIB 5HCFA 3JUUA 2DUQA 2NP0A 1QJX3 3OF1A 4GKYA 1HQLA 5KXDA 4XFBA 4XMAA 2QNKA 1F5FA 3RMYA 1LGNA 1J3RA 3RQ0A 2C0ZA 1CPMA 4FPOB 4DY3A 1SDWA 4XXPA 4Q4W2 1ZM1A 4COVA 1LOFC 3JB4C 1HDKA 1BQPA 4Q4X1 3MEPA 2XLGA 5JIAA 2B45X 1OMIA 3H7JA 3ZFEC 3IMNA 3E97A 4E4DX 3M1HA 4K3UA 4Q4W1 1K5MC 5DG1A 1X82A 1CR7A 2EAAA 4DY5A 4P9JA 3ME2A 4YYOA 2BPA2 4K1YA 1W2UA 1X8EA 3LOBA 2B7YA 3V0AB 4K7JA 1AR71 4CYDA 3ZFGB 1MR5A 1RUG2 2EAKA 1YJLA 2WZPP 2R30A 2VGDA 4HETA 3V56A 4F3JA 5IK7A 2RHPA 1PGW1 5E89A 4CP0A 1G9BA 1K5MB 4YVSC 1ZBA2 1AYN2 5T5PA 2GSYA 4HLTA 2OA2A 3BOWA 1ZREA 1RUG1 4ZU5A 1LOAA 1MACA 4Z2WA 2ZX0A 3ZXKA 4WZCA 4LULA 4Y1ZA 4CEYC 1KS5A 1R092 4YG0A 2DUPA 5I93A 1ZBA1 4UW3A 3B9IA 3S7EA 3VBUA 2HWC2 4NHLA 3VL8A 4JDNA 1RTVA 1QH7A 1YIPA 2UY9A 4HL0A 2DYCA 5AC93 2W0XA 3ZXGA 5GLWA 1M06G 1ULCA 1HXS2 3G7DA 1JN2P 5D1IA 4MV2A 3N4MA 3FBYA 2YYOA 3WVJA 1FMD2 4L97A 1LU2A 4QPIA 4FTBA 1XQNA 3AJYA 3JD73 3ZN5A 3V0BB 1HXS1 3UV9A 4KG8A 1Y7BA 2HKXA 4C1XA 1WW6A 3M8LA 2E6VA 4MX3A 5I8YA 4QPGB 4QX5A 1LHUA 1FMD1 4E2SA 1WLWA 1VBC3 2IXKA 4MGZE 4FXGB 2O8OA 1X7NA 5C4WC 3TN92 4Y1VA 5JDBA 5K0UA 3J8F3 3VUOA 4FAGA 4LBLA 4FPHA 1AX2A 1DQ1A 4DPNA 4JGZA 1QF3A 4IV3B 4HK9A 2ZCWA 4BLJA 1JYIA 1ZRFA 3O0XA 4DRRA 1U12A 2CNAA 1CJPA 1NCRA 2O8QA 3USUA 5CFDA 2I74A 3TN91 4J1XA 3VKNA 3OJBA 2XVLA 1REFA 1VBD2 4LE4A 1QHDA 2RMU2 5KXBA 2QUOA 4RR3A 4AEDB 3AZXA 3WDUA 5C4WB 1H2NA 1I1EA 4RGAA 2DCKA 2Y38A 3VGIA 2BNMA 2DFBA 5KXEA 1HW5A 3A0NA 3PJQA 2AR6A 3EO6A 2RMU1 3NV2A 1O3SA 3KT4A 3VBRC 4XF9A 2HWD1 4BQ1A 4D7YA 4QPIC 1QJX1 1VR3A 1C28A 4R52A 3UJOA 5IK8A 5JSOA 2CAVA 4LO8A 5KHKA 2ZAAA 4D7TA 4XJ8A 3LA7A 5F6LB 3IPVB 3RRDA 1MS1A 3BU7A 4QMAA 2BFUS 4XF0A 5T54A 4JC1A 1MEC2 3A4UA 4QGNA 3IM0A 1SQ4A 4Q4Y3 4E4ZA 3WT3A 4I01A 3OCPA 2ZGUA 1GZCA 1BXHA 3DV8A 1UPIA 2QE3A 5CFDC 3RI9A 5EWSA 4AE2A 2NZ9A 2WSVA 3WW2A 3HD8B 1IPKA 3RG0A 2Q1ZB 1PO12 4LBMA 4AGGA 2H0VA 3AYDA 1TQ5A 3WP4A 1QJY3 5FDBA 1HLCA 1OA3A 2HWB2 1CJDA 4IEZA 4KU7A 4PLNA 4YARA 2WA3A 5AC92 4WM7A 4HVOA 1DQ5A 3L2HA 1PO11 3WP5A 2ETEA 1RB8G 3IN9A 1XU1A 1DG6A 1WMDA 1LOGA 2I07B 3MLKA 5EFUA 3W58A 1C8NA 3WG1A 1LECA 2UU8A 1SFNA 5BPXA 5HCAA 4AFDA 5AC91 2K2SA 3ATGA 4UW6A 2XWJB 1DQ6A 3O14A 4AW7A 4MYEA 4NHMA 3B7MA 1HRI3 5CVRA 2IWGB 1D4M3 1RUD3 3B3QE 1RUE3 1YFWA 2UWBA 1DFQA 2ZX4A 3JD71 4FPFA 2R0HA 3WLUA 4A7KA 3USSA 3WW3A 3LSDA 2P17A 5FRAA 1BBT2 4NOTA 1SLLA 2GNDA 1FNYA 4AVSA 4AVAA 5FPXA 1VBC1 1LGBA 4XBQA 4OI2A 2D6NA 4I3GA 2HWF2 3A0KA 4SBVA 2C9AA 1WD3A 3O7OA 2YMZA 3J8F1 4XILA 1MZEA 1PM7A 2IFWA 2XKPA 2ZGRA 5KHGA 2LALA 2A6ZA 2DVAA 2P3IA 2PAEA 4WM7C 3HAGA 1W6QA 5BNOA 4DQAA 2R073 1DGRN 4IEWA 3FE5A 3VBSB 5FMOL 5HCBA 2F4PA 3D8CA 4YM1A 1VBA2 2MNGA 1NG0A 4YFZA 3WNXA 4YVWC 5JZGA 1REDA 2A6WA 2HEWF 2VMHA 2ZMNA 3ZN4A 5CU1A 3ZVXA 4XIKA 1D2SA 4XYXA 3FLRA 4MVTA 3POWA 1WW5A 4N43A 1LULA 1REEA 4IESA 2D3SA 5GLUA 1N3PA 1VBA1 2JG8B 2IC1A 2Q1MA 2E51A 1ULDA 5BNQA 2QZ2A 2B8MA 1MS3A 4CDQA 2FZ1A 1IS4A 3AP6A 3G6JB 4NPRA 2D98A 3VKLA 4AI2A 2R1DA 3FX3A 3H1WA 1O3RA 3ZXDA 5A32B 4IERA 5JOYA 3VHRA 1KDMA 4IEOA 1VBB3 5E88A 1W6OA 2IFRA 1WMEA 1NZCA 4Q4Y1 1J3QA 3UJQA 3MIFA 4FOVA 2GZWA 2VH9A 1URXA 1L3JA 4XIOA 5FOBB 2WS93 4A2UA 2DV9A 1AR63 3WG2A 5BNOC 1QJY2 2ZX1A 1DLLA 1DGLA 1IS3A 3IT8A 2IXJA 3RJ2X 1ZZBA 4AHZA 3W59A 4Q1RA 3NAPB 3K48A 2WLPA 5KHHA 4HPKA 2OW4A 1QJY1 3PVOA 3DGTA 3HWJA 5KWRA 5DZEA 1ZZCA 2A5ZA 1J3PA 2ZTNA 4N43C 3RYRA 5T3NA 4ASLA 1N1YA 3IIAA 5LEJA 3T2TA 1X33A 5JLVA 1D4M2 2NN8A 2PHDA 1RUE2 4L92A