4YGDA

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
227
structure length
227
Chain Sequence
PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 56
structure length 227
sequence length 227
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ygdA00
2A6YA 4FPGA 3WZ1A 1R1ZA 4LBOA 4ATFA 4GALA 4Q8KA 2EXIA 3PJQA 4YM3A 1LEMA 4AVVA 1PZ7A 1BKZA 2ZGQA 4UW4A 2NN8A 1CONA 5IK7A 1FX5A 3V0BA 1S1AA 4YM1A 4LBQD 3SH4A 1CPMA 2JE7A 1BZWA 1QKQA 1KDMA 1W6MB 3OYWB 5KXCA 4K1YA 4BMBA 2P3KA 4XJAA 1UPSA 3WUDA 3IM0A 2PHFA 1RIRA 1GZCA 2C5DA 4YGDA 2GNDA 3D6EA 4Q1PA 1WLDA 4TYSA 4YG3A 3FBYA 2JE9A 3QLQA 4OZXA 2LALA 4YW2A 2AYHA 3AXDA 4GWMA 1HLCA 3UK9A 2D6NA 1LHOA 1SBDA 3ZSMA 1FNZA 3AK0A 3RSJA 1YYNA 4NO4A 2DURA 1LHVA 5T54A 3ASIA 1A78A 3RMXA 3N7LA 2EXHA 1DQ1A 1SLAA 5HCAA 3UJQA 4Y1ZA 1D2SA 1H9PA 2AENA 5GJ6A 3H0OA 3M3EA 2EXKA 2WSUA 1GSLA 3VKMA 2G4IA 2W68A 2VW0A 4ISQA 1ONAA 2NMNA 1G8WA 3PMEA 2YV8A 4FOYA 5T5OA 1GZ9A 2CWSA 3O0WA 1LHNA 4FPJA 4IQPA 2SLIA 1GLHA 1QNWA 2W08A 4FPLA 4M3CE 4BLJA 3U4XA 3SLIA 3FLTA 2R49A 2ZABA 1LOFA 5KXDA 1LGCA 1UZZA 1O4YA 4R9DA 1AZDA 1LULA 3IKWA 1MVEA 3ZVXA 3M3CA 1LU2A 1Q8OA 3N7JA 1SLLA 3D5OA 1ULEA 2OUHA 3MW3A 5F5QA 2WLQA 2ZMKA 3HN1A 5CNAA 3OPZA 1YO8A 5DUXA 2GNBA 4Y20A 1A8DA 1LOBA 1H9WA 1AX1A 5DUWA 5LK5A 5JMCA 5AVAA 4YGCA 1CQ9A 5JDBA 1DZQA 1V00A 4AWDA 2R0HA 1LGNA 1WW4A 4FPKA 5EXOA 1WD4A 2WT0A 3O0VA 1KRIA 1U0AA 2GN7A 1SLCA 4DRVA 4P14A 5IUQA 2DVFA 1GV9A 1APNA 2PHWA 3APBA 3WG2A 1AXZA 1UN1A 3WDYA 3NV2A 5H9RA 4XBQA 5HCFA 3AZVA 4XZPA 4YW5A 4I30A 1G9FA 1NLSA 1CJPA 1VLNA 4XTMA 4PQ9A 2H0BA 3OBRA 3ENRA 1MR5A 4XJWA 5DZEA 1W6OB 4Y20B 5DZFA 5E8AA 2ARBA 1S0CA 1YIFA 1N3QA 2HYKA 1QGLA 3I4IA 4P9XA 4Z8BA 1URXA 1LOEA 1S0IA 1ZA4A 2ARXA 2JKBA 2ZGPA 1H30A 2ZHKA 3AXEA 4Q8LA 1ULCA 1ULGA 3T1LA 4GKXA 1WD3A 3MEPA 5GZEA 5DG1A 2VY0A 1GZWA 4LBLA 4YFZA 3B00A 5KXBA 2ZGUA 1W6QA 4GKYA 4AGRA 1I1EA 5H9PA 3M3OA 4FPHA 1HKDA 2FMDA 2PHRA 3WDVA 1XQNA 4PBOA 3Q9OA 4DPNA 4XXAA 2WT2A 3AZYA 3N7KA 1JHNA 4ITCA 1LENA 1QDCA 3R05A 4C1WA 5GM0A 2EXJA 1MS9A 3USUA 1DQ4A 1IOAA 1LOGA 5GZGA 2ZAAA 4BMEA 2JECA 4FQZA 3NV3A 4ZXKA 4AGGA 1W6NA 1DYPA 5JLVA 1FATA 4H55A 3T1MA 1C4RA 1QDOA 1CPNA 4UW3A 2ZGLA 4YGEA 2R0FA 4CZSA 1WCSA 2DUQA 1AXYA 3WDTA 4RL7A 4XDQA 2P3IA 3I8TA 1MS4A 4BOWA 3RMYA 1SCRA 3IMNA 3O12A 1Q8QA 3WVJA 1GZWB 1VAVA 3BTAA 2BQPA 1LU1A 1W6QB 1S0JA 2EAKA 2RHPA 3R4UA 2XB6C 2A3YA 2V73A 2GMPA 2AREA 5IK5A 2D43A 4LBKA 2I2SA 2ZBJA 3FUOA 4ISRA 1W6PA 3O5SA 4FP2A 2A6ZA 3NWKA 2ZACA 4FOWA 4YW3A 3A4UA 1YXWA 1G7YA 4MYEA 1MS1A 1WW5A 4FQ4A 3M3QA 3V65A 4P9WA 1N1TA 2DVDA 2E7QA 1MS5A 1N3OA 4XBLA 1IS5A 1WBLA 2ZGOA 4ATEA 4FPCA 5DUUA 1CR7A 3MW4A 4PF5A 2DVBA 5T55A 2JJ6A 2GDFA 3UJOA 4M00A 1AJKA 3V0BB 2VUAA 1GBGA 2UWCA 5F9TA 5GLTA 3JU9A 2A6XA 4JRAA 1VAMA 1VIWB 1ULDA 3ILFA 3WUCA 1JXNA 5JOYA 2ZGRA 1LOCA 1W6PB 1IKPA 1LJ7A 3AJZA 1YI7A 3DUIA 4XXPA 5T5LA 3WG1A 3W58A 1CN1A 1V6OA 3ZXKA 2ZKNA 1SACA 2D3SA 3FLRA 4Y1VA 2NYYA 5GZCA 4XMIA 1Z78A 4Y22A 4XBNA 2WT1A 3L2YA 4Y1XA 2TEPA 1GICA 1DQ2A 3AFKA 1G9AA 4YZ3A 3JUUA 4WVWA 1V6NA 4YW4A 3ZSJA 3IPVA 2P3JA 4W65A 3KM5A 4FPYA 3SISA 5CAZA 2WSVA 2EALA 2WQZC 5SV8A 1HDKA 2W39A 4LBJA 3RRDA 5T5PA 1LHWA 4R9CA 3OY8A 1DBNA 4YM0A 1OFSA 3AYEA 4GWNA 4LBNA 1JBCA 2GN3A 1KDKA 5GLVA 3ZPYA 1N1VA 1TEIA 3POWA 5GZFA 1QF3A 2AUYA 2D44A 1N1SA 2YXSA 3AP7A 5DG2A 3AYDA 5H9QA 1LEDA 1S0DA 5JVVA 4Q2FA 3V64A 3WG4A 2GALA 4K20A 4M01A 3GNEA 2DYCA 3WCSA 4FOQA 2ES3A 1MZ6A 1V6KA 3LSEA 4Y22B 4XOGA 1JUIA 3PVNA 2ZGKA 2D7FA 2ZGTA 4PCRA 4XJUA 3WDUA 1FNYA 5IK8A 2P34A 5DXDA 1FYUA 2CWMA 3QCWA 1ZM1A 2YROA 4Q27A 1Y7BA 4FPEA 1X50A 2CL2A 2ZGNA 3TB0A 5JOWA 3WHUA 3O0XA 1J1TA 3NV1A 1LECA 2FHRA 1N47A 3BODA 3OY8B 1JW6A 4M3CF 1MS3A 4FVVA 1CIWA 1AX2A 5CBLA 3B69A 1LTEA 3PVEA 1F9KA 2UWAA 4GXLA 3T2TA 4WZFA 1LESA 3ZXFA 1JYIA 2E7TA 2PELA 2ZGSA 2DWRA 2OUJA 3W59A 3VKOA 3N3HA 5GLUA 2NZ9A 4BQ1A 3BOPA 2AR6A 3AZZA 4F83A 4XIKA 1SBFA 3ILRA 5GLZA 2ERFA 2B7YA 1NXD1 2GMMA 1Z0HA 1JN2P 3DGTA 4JC1A 2A70A 3ZXJA 1QNYA 1BYHA 1MZ5A 1Q8SA 2P37A 2LTNA 1WW7A 5E88A 5EYXA 1SLTA 5GALA 5JOZA 3GALA 3BIWE 5DZGA 4DRRA 1DGLA 1WBFA 1MS8A 1OKQA 3WHTA 3ZYPA 1KQRA 4HL0A 3CNAA 1EPWA 1MS0A 5DUVA 1UZYA 4CRQA 1FV3A 4FPOB 1BXHA 4YZ5A 4Y26A 2R1DA 3WCRA 1AX0A 5EWSA 3VV1A 4BM8A 1N1YA 1HQLA 4YFWA 2VW2A 5H9SA 4RA0A 1W6MA 2GMEA 1LGBA 2WJSA 3SH5A 2Z42A 1GKBA 3N7MA 4Q1RA 4DS0A 1UMZA 2WNEA 1DYKA 2DU0A 3SH3A 1RITA 3AYCA 5HCBA 2ZHLA 3ZSLA 1Q8PA 4K1ZA 1BJQA 5CA6A 4XHXA 4WVVA 2EIGA 3USUB 1UKGA 4HANA 4Y1UA 3AJYA 2D6OX 1LHUA 4YZ4A 3SNMA 1UL9A 1W6NB 1IKQA 1JOJA 1PZ9A 3AP4A 2R1BA 3D4KA 1DQ6A 2DVAA 1QMJA 1RINA 3POYA 4XTPA 3VKLA 1G9DA 1A3KA 4NOTA 4UW5A 3VKNA 5FREA 2ZZJA 1YRZA 1S0BA 1CESA 4UW6A 3WG3A 4XYXA 1DFQA 1DIWA 1HQWA 4AYUA 2OW4A 1Q56A 2JD4A 4YGBA 1Q8VA 4TZDA 1KJLA 2A71A 3HMYA 3V0AA 3WDWA 4P9YA 2ZHNA 5CB7A 4SLIA 1ENSA 2SBAA 2AGSA 1WUVA 1SFYA 3FLPA 2CNAA 1D0HA 1QOOA 1WW6A 1C1FA 2KM2A 4AVSA 1AVBA 5T5JA 4BLIA 3B01A 2C9AA 4XE9A 4YG6A 1SLIA 4WV8A 3A0KA 1I3HA 4CTEA 3OGGA 2GNMA 2OVUA 2W52A 5GZDA 4ASMB 2D6LX 2D6KA 4Y1YA 2YMZA 2R16A 2XG3A 4Q26A 3AP5A 2AH2A 4AVTA 3N35A 1LOFC 4YZ2A 2NP0A 2V5YA 4C1XA 3ATGA 4XJ9A 1S0FA 1IS3A 2CY6A 1W0OA 3V0AB 3AP9A 2E6VA 2P2KA 2A3WA 4XJ8A 5KXEA 1QOTA 5FRAA 1N3PA 3AX4A 1MVQA 2A75A 4FPFA 4KBBA 3WLUA 3A0NA 3OJBA 1PZ8A 3R4SA 5IT6A 1KJRA 3IN9A 1WLCA 2DUOA 1G86A 1SLBA 3PVOA 2DVGA 2PHTA 3WOGA 1DHKB 1WLWA 1W0PA 2A6WA 2ZA9A 2CTVA 1V6MA 2EF6A 1LOAA 5JOXA 4YG0A 1ENQA 1IS4A 1MACA 4JCKA 3LSDA 4FP3A 4FOVA 4L8QA 3IPVB 5T52A 1GYKA 2ZMLA 1AF9A 2DU1A 1QOSA 2D6MA 1LODA 2VH9A 1DLLA 4ZKTB 2DUPA 4M3CA 1W6OA 3INAA 2D6PA 3HR9A 4DQAA 2VXRA 1KITA 2PHXA 5BYNA 1GNZA 4XJZA 4LBMA 1JYCA 1BQPA 4K21A 3N36A 2E51A 3ZXLA 3LCPA 3MPPG 4XIOA 3ZSKA 4YZ1A 4GA9A 3TAYA 4XILA 3WNXA 3POSA 4LBQA 1SCSA 2A6VA 2DTYA 2ENRA 3M1HA 5E89A 1UAIA 2VW1A 2A5ZA 4XHBA 1C1LA 4YLZA 2D3RA 4R9BA 3SITA 1V6LA 1ULFA 1F5FA 1AJOA 2PHUA 2JDZA 2GNTA 2UURA 2D3PA 3RS6A 2DV9A 5EYYA 3KQRA 1SBEA 1GANA 3AP6A 1ENRA 1FAYA 1DQ5A 4M3CB 3RG0A 3ZYRA 4R9AA 1IS6A 1S0GA 2ZGMA 2NMOA 1AXKA 3MW2A 4DFSA 4YW1A 3FUQA 4U36A 1V6JA 1DQ0A 3NV4A 3AZXA 1G9CA 1UX6A 1GNHA 3B9CA 4XMAA 4Y24A 1CVNA 1G9BA 2UWBA 2ZHMA 4YM2A 2A3XA 2DTWA 1VALA 3B3QE 4PBPA 5GLWA 4LBQB 1FV2A 2A7AA 3WDXA 2E53A 1C57A 2UU8A 2ZMNA 2YY1A 1OQ1A 3AYAA 4U2AA 1F31A 3RQ0A 3ILNA 1O4ZA 3UL2A 3VUOA 3C2UA 3AZWA 5L73A 4BPZA 3OYWA 3FFZA 3WV6A 2NM1A 1S0EA 1LCLA 2CYFA 3ZXEA 2Q5TA 3M2MA 1QU0A 2VU9A 1V6IA 4AGVA 3VKFC 1B09A 5IK4A 3OBTA 5T50A 2WKKA 2YZ4A 4D69A
chains in the Genus database with same CATH superfamily
4HKOA 1F8VA 2R071 1R1ZA 4ATFA 1C8M2 1KXGA 3CBNA 4EZHA 1C8M1 3WP5A 4AVVA 4E4SA 3RWNA 2X53S 4UW4A 2HEYF 4CCLA 3PVBB 1S1AA 2HWB2 1CPMA 2HWB1 2JE7A 4BXSV 1QKQA 1KDMA 4KI5M 3R0RA 2J1RA 2Z69A 4KL1A 3WQ0A 4ARYA 1OA4A 4MZUA 4XJAA 3WUDA 4AHYA 2LUWA 4BMBA 3EJKA 1YUDA 3ACHA 2C5DA 2PMWB 4Q1PA 4TYSA 3FBYA 2F4LA 3CZJA 1NQJA 4OZXA 2AYHA 3DCQA 3VZJA 5HV0A 2R062 3ZKYA 2R061 4Y3OA 1V70A 4COYA 1XSQA 1YYNA 1P8JA 2WO1A 3KF3A 4CA9A 4DUVA 5T54A 1NZIA 1WKYA 3N7LA 2EXHA 4WVZA 5HCAA 4QPIC 2IWGB 2BWCA 1NUKA 1H9PA 2AENA 1FMD2 4K7JA 3PURA 3H0OA 5FMBA 5GJ6A 1FMD1 1GWMA 3M3EA 2VMHA 1W9YA 4BA6A 1SG3A 1XYNA 2WAOA 2HJIA 1TMF2 1XXNA 3KT7A 1Z7S3 2VW0A 3GCWA 1DYOA 1TMF1 1O5LA 3QH7A 4L11A 4O65A 4XQ4A 5KC6A 3PMEA 3HBKA 2BERA 2YV8A 2UY9A 5T5OA 3KV9A 1BK1A 2VMIA 1MQTB 2Z2SB 2VZUA 2W46A 3IAQA 3O0WA 4IQPA 2SLIA 4IUGA 4AVCA 5A1FA 1FPN2 2W08A 1FPN1 3MGUA 3KV4A 4OI0A 3U4XA 3SLIA 1QJU3 3O7OA 4B8EA 5L36A 4YW6A 2WBKA 4A7YA 3IT8A 5A1AA 3T30A 3DYMA 3EO6A 1LGCA 2N7GA 2ET7A 1F4AA 1O4YA 3RI9A 4LIUA 5B4XA 5ACA2 2XONA 2FDIA 2X5IA 3N7JA 5ACA1 2VAUA 3D5OA 4RR3A 4AEJA 4B1LA 4DUXA 2OUHA 1U5YA 1YIPA 3WF4A 2NQYA 3UGGA 4IW3A 5JR2A 4Y20A 5F5AA 1AX1A 4G9SB 1DGWA 5AVAA 2JG9A 3FC0A 1CQ9A 4MGYE 1DZQA 4KGQA 1WW4A 3EMRA 4AG4A 3OEBA 2DFBA 1T6GC 5FMCA 4AE2A 4QHBA 2HWD3 4CDUA 4DRVA 1TG7A 2DVFA 3Q8BA 4GMP3 1ND3C 3ZN4A 3ACIA 3U78A 3IDAA 1JHJA 3GJBA 1UN1A 3B94A 4YVSB 3NV2A 2HH9A 4XBQA 5H9RA 3AZVA 2Y60A 1CAWA 4I30A 2MEV2 1RMU3 3ZYJB 2MEV1 2QQIA 4OLLA 3VHOA 4BQ2A 1U5ZA 2VOKA 2HWF2 1MR5A 2BRTA 2ZEZA 2HWF1 3KB5A 1W6OB 5ABJC 5BV6A 1QXRA 2F17A 1SPPB 3T2PA 4DY3A 5FTTC 1H2KA 4EJRA 3R6SA 2GSYA 4P9GA 4P9XA 2ARXA 1LOEA 2JKBA 4NIIA 1JU4A 3KWVA 5FZ1A 1WD3A 2B4KA 2WO7A 2J1VA 1OLRA 5DG1A 4COWA 4QWNA 4YFZA 2ZGUA 5FZAA 5A7WA 2EICA 4RD7A 1ST8A 3CO2A 4N9IA 1QQP3 1QJX2 5LASA 4IEWA 5CEHA 1QJX1 1LNSA 2X10A 3AZYA 4XXAA 5FY7A 5GM0A 2EXJA 3RVHA 4OI4A 1O6UA 5FPUA 4CUAA 4QB6A 4MH0E 2RDRA 1HRI2 2Q8OA 2ZAAA 1HRI1 1NG0A 2XUEA 2OQ7A 4FQZA 4AGGA 4ZXKA 1J1LA 4BMEA 3PTRB 1DYPA 3BGAA 3KT1A 3VD9A 5FY8A 2VBBA 3T1MA 4N9HA 4Q4W3 4YGEA 5IAXA 3VBHB 4GQ7A 2DUQA 1AXYA 2R073 4IE4A 3WDTA 1W90A 2WO2A 1QJY2 2P3IA 3I8TA 2RS32 1C8M3 1JS9A 1QJY1 2VTFA 2RS31 4ZZ5A 4Q4V2 2FQPA 1WA6X 2WAAA 4Q4V1 5F6LB 1T2XA 2K46A 1W6QB 2XH6A 4P9LA 1W9WA 4X6RB 3ZYIB 1GQHA 2A3YA 2GMPA 2AREA 5D21A 2HWB3 2I2SA 4Q0PA 4CDXC 2RDNA 1SMVA 3C7OA 5D8AA 3GHMA 3TN93 3LA3A 3J7HA 3ZR6A 4M4PA 1HV1A 2HBTA 3NWKA 1RYYA 2ILMA 2WN3A 1ZX5A 1YWKA 2CGPA 1MS1A 1WW5A 4JQTA 3V65A 4P9WA 4MGTA 2Q4SA 3ZFGC 4D7SA 3C7FA 4O61A 3AVRA 2ZX0A 2R063 3D0JA 4D0QA 1ULOA 1YCIA 1CR7A 3DPRA 3PJYA 4M00A 4AEDA 5LA2A 2VUAA 3K77A 1UU6A 5FP3A 1RHI2 3FBMA 1VIWB 3HAGA 1RHI1 3X29B 5CFDC 1ULDA 3WUCA 1DZRA 1FMD3 1JXNA 3PUQA 4OHVA 1X33A 1OLME 4I0AA 4QT6A 5L7OB 3VD7A 2VVFA 1IKPA 1JU3A 4W50A 1YI7A 4XXPA 4ONUA 3WG1A 4HK9A 4QPGC 3CLPA 1CN1A 1TMF3 2OYZA 3ZXKA 4A41A 3FLRA 5C8CA 3RJRA 4AI3A 1Z78A 3UNPA 1WMEA 2C9KA 3IIIA 1DQ2A 1NAEA 2VC9A 5EP9A 1G9AA 4META 3ZSJA 1PMIA 1O3SA 3IPVA 3Q8FA 4W65A 4FPYA 1J3QA 4GWJA 3SISA 3E6CC 2EALA 5DAVA 1OT5A 1CGPA 5CIRA 2JB8A 4LBJA 4XQWA 1W2NA 4NRPA 4XZUG 3OY8A 3NJZA 1GP4A 1W9TA 4GWNA 4LBNA 4EWAA 1JBCA 5A1LA 5ACA3 3ACGA 4XQDA 5GZFA 3QH6A 4KG0A 1ZNPA 2D44A 1YQ6A 3AYDA 5H9QA 3K4ZA 5I93A 2WZ8A 1S0DA 4Q2FA 3K3NA 4R8HA 3RYRA 4K20A 1MZFA 1X8EA 1W8HA 3WCSA 2ES3A 1MZ6A 3MV11 5ANNA 3C7EA 3W20A 3NL1A 1UX7A 4XJUA 4GZ9A 1TQ5A 4LKEA 1FYUA 1ZZBA 3QCWA 4Z2WA 4B7KA 1Y9GA 4PDWC 2YROA 4EN7B 5C6CA 1MPXA 1REDA 2CL2A 2WQ4A 4LHKA 5D1IA 3TB0A 4RYDA 1J1TA 5JOWA 3NV1A 1K5MB 3I2KA 4JTNA 5IVVA 4D7TA 3OGRA 2MEV3 1JZ7A 2XUMA 5KBFA 5JAXA 2LS6A 3RZGA 3RZKA 4EN9B 3MPBA 4M3CF 4FSJA 2WWSA 5C3OA 3LQCA 2HWF3 2WYFA 4MOAA 1W8FA 3HN3A 3T2TA 4EN8B 2E7TA 2PELA 4AVBA 2DWRA 5IVCA 4LKDA 4ZS2A 1NY72 3W59A 3N3HA 1NY71 3DV8A 5GLUA 4NPLA 4BQ1A 2WWUA 3AZZA 3O1RA 2J1SA 3HPNA 2RV9A 1SBFA 4A7KA 1LB2A 2NPIA 5LY1A 2WS92 2AEYA 1ENXA 2WS91 2GMMA 4JC1A 1XBFA 1GP5A 3DGTA 4JVAA 1BVVA 3IDCB 4NVPA 2D98A 1HV0A 2P37A 5JR7B 2LTNA 5IFPA 1RUJ2 3S5AA 3MLKA 3VLBB 1RUJ1 1ND2A 2MNGA 4LPLA 4MGSA 4A3XA 1QJX3 2FDGA 1DGLA 4RS5B 1AUYA 3WHTA 4LE3A 2OKXA 3K4AA 5IVEA 2XR4A 4WM7B 4QXCA 1KQRA 4HL0A 1WCQA 1O8SA 5DUVA 2O1QA 5FYZA 1HRI3 1FV3A 3GZEA 5KHKA 1BXHA 3BTXA 2Y64A 4Y26A 1AX0A 3IDEA 5EWSA 5AFBA 5JWPA 2WA3A 1E5RA 2CGNA 1UPIA 2GC0A 4E8DA 4RA0A 4XPVA 4YARA 4KGGA 4OQ9A 5EV7A 1AYM2 2CAUA 1QJY3 2GMEA 4HPKA 3TEXA 2RS33 1AYM1 1GOGA 2Z42A 1GKBA 4LHLA 1UMZA 4XABA 1GNYA 1UMIA 1BEV2 1PM4A 3SH3A 4AQ2A 3ZSLA 1BEV1 1Q8PA 3DF0A 4IETA 1BJQA 4WVMB 1IQDC 1UKGA 2VMEA 5IVJA 3FN9A 1YQCA 4RHV2 4RHV1 5A6ZA 2R1BA 3D4KA 3OPTA 1UY2A 3ZFEB 4DO0A 1RINA 1XE8A 1EUUA 4IV1B 3ZFFB 1JZ8A 5FREA 1UQXA 3UKVA 3BVCA 4CCKA 4DMIA 3IIAA 4O9EA 1X8MA 2EAAA 3SKVA 1S4CA 1KJLA 3IZOA 1O59A 3WR0A 2ZX1A 4SLIA 5IWFA 5FPBA 5KC5A 1WUVA 2W94A 1MQTA 4J6GA 3SHRA 4P5HA 2VCCA 3P3NA 3WF0A 1AVBA 5T5JA 4AZZA 1EPZA 1K42A 4N7IA 3NO8A 2WZR2 4WV8A 1ACCA 2WZR1 4JHTA 1OD5A 3QACA 4OI2A 5K0UB 2MPFA 4K6BA 2OVUA 2W52A 1M06G 1PIV2 1W3XA 2Y8KA 1PIV1 3J26N 4Y1YA 2XGXA 2XG3A 5A7SA 3T4VA 2BFUS 4SBVA 4AVTA 3MF6A 4HT1T 3LB9A 2R6QA 3SQOA 3KD4A 3OD0A 3KGLA 2V5YA 4DXTA 3RYPA 3CU7A 4XJ9A 4YPJA 4A45A 1SQ4A 4LHNA 3V0AB 4P9IA 4HSJA 2OPWA 2QQNA 2E6VA 2X5IC 2HWC2 2P2KA 2QQLA 3MUZ1 4RR3C 4URTA 4XJ8A 2HWC1 3S7IA 3E5UA 2RJ2A 4N90A 4COZA 4NWVA 2B9UA 4BQ5A 2Q8DA 3WLUA 2JG9C 3A0NA 3OJBA 1PZ8A 1KJRA 4AQSA 3IN9A 3PVOA 2DVGA 1H8TB 1OF3A 2ZA9A 5IHRA 2VQUA 4YVSA 4CDUC 3PMSA 1ENQA 1MACA 3M8LA 4FP3A 4FOVA 1D2QA 1RL3A 2BJSA 1OKOA 2ZMLA 5FV3A 3WW2A 4AFCA 1BK0A 1EAH2 3NNGA 1EAH1 1W6OA 2I07B 3INAA 1IG0A 3CEWA 4EYUA 1SPPA 5BYNA 3BPZA 3VN4A 5JUVA 3DKQA 4LBMA 4MVTA 3ZXLA 2RG4A 3N36A 4IGOA 3LCPA 3ZSKA 4YZ1A 1CZTA 4P00B 4CCEA 3GZAA 4RGAA 3POSA 2ORXA 2QQKA 5FBZA 3QBQA 2VMFA 4XF0A 1SCSA 2A6VA 3LOBA 1JZ6A 1OI6A 2H0VA 2PAEA 4BIOA 2EA7A 5A7OA 4BQ3A 4YLZA 2D3RA 2ET1A 2ZEXA 1F5FA 4N8MA 5C9AB 1R082 2VOWA 4NHKA 2PHUA 1DDLA 4I09A 1R081 2UURA 2D3PA 5IAVA 5IVYA 4QU2A 1QJZA 2DV9A 3K3OA 4GMP0 1CAXA 1TE1B 1JZ2A 1ENRA 5FP7A 2WS93 2RJKA 2C1FA 4XFHA 5FFOC 1UW8A 2RS52 4D6QA 4KBZA 3Q8CA 2W0XA 2RS51 2ZGMA 3TOJA 1AXKA 3ZSEA 4HKLA 3FUQA 4Q0UA 1W3VA 3WP3A 1RUJ3 1UYYA 3AZXA 1UX6A 3B9CA 2W95A 4XMAA 3VBHA 1CVNA 1G9BA 3TEWA 2UWBA 1Y43B 2ZHMA 1B35A 1CD3G 3K48A 4XF9A 2VNOA 1O8PA 2P17A 2QFEA 1G6NA 1FV2A 3BCWA 2VZQA 4LBQB 2PLV2 5JXIA 2UU8A 5HV4A 5KHJA 2YY1A 2PLV1 1OQ1A 5LWBA 3RZMA 3BUCA 4U2AA 4MXVA 2P3YA 1F31A 2PAKA 4I2OA 3GF6A 4TN7A 3UL2A 1VRH2 2JB4A 4BPZA 4L92A 5DAXA 1VRH1 2OZ6A 4P08A 3OYWA 3FFZA 3NJXA 1BLZA 4QX2A 3VBUB 3VDCA 1DGRA 5A32A 2AACA 2YFZA 1HJFA 3WSOA 1W8ZA 1AYM3 3IDBB 4NHMA 3RWKX 3I7DA 2BEOA 4CDWB 1VBB2 4AGVA 4E9KA 1VBB1 5IK4A 3OBTA 2FDJA 5D8AC 2YZ4A 3H3LA 2JDHA 3K75B 4IXLA 1BEV3 1OBNA 2BW8A 3AFGA 4FPGA 5CFCA 4INDA 4LBOA 3WW3A 4GALA 2WC2A 4BJ0A 1L7QA 4BZ4A 1LEMA 4YM3A 1RGSA 1PZ7A 1RJ7A 5F5IA 1BKZA 3GZTB 5CYYA 4Q4Y2 4AF9A 5IK7A 4RHV3 4Q4Y1 3I3QA 4YM1A 3SH4A 2XLAA 2Y6GA 4N53C 2VPVA 3DPRC 5J1XA 3U37A 3FHAA 1VRBA 3NW4A 3VDDC 2XJQA 2P3KA 5I0DA 3O1VA 1ZBE2 4AFAA 3IM0A 1ZBE1 1RIRA 2ZPXA 2JG8B 3D6EA 3WQBA 2VVDA 1OOPA 3PDQA 2W2IA 1UXXX 5FR3A 3MIBA 3WNPA 4YW2A 1PX3A 4MADA 5A7PA 2CGOA 4C90A 2G19A 2C0ZA 4IL7A 4CEYB 5F3IA 2CAVA 3NVCA 5BNNB 3VL9A 2D6NA 3ZSMA 2QQUA 3PU3A 3AK0A 3RSJA 4NO4A 5JIUA 5C8CC 2YPDA 1H2LA 4YSFA 5FZDA 1VP6A 2WZR3 3RMXA 1RUOA 4RQPB 3I3EA 3OCPA 2VXJA 4CXYA 1H4GA 1PK6A 4PIZA 1SLAA 3UJQA 4BQXA 1D2SA 2KXLA 1UIKA 1PIV3 3J8F2 2DCYA 2WN2A 1C3HA 3J8F1 3FX3A 3HNBM 3VKMA 3VL8A 5ANQA 2BOJA 3H8RA 5SV5A 1JZ3A 3L2HA 3AKTA 2CWSA 2JENA 5LEKA 3JQXA 5JPMB 4FPJA 1GLHA 2HWC3 2WZEA 3I3DA 4IV3C 3NRUA 3U4SA 4JKLA 4LHSA 1EV12 1ZZ8A 1EV11 2BGCA 2BGPA 2R49A 3E5QA 5I91A 3F2ZA 3H8OA 2J1AA 4R9DA 3B93A 2YC4A 1BVP1 3LEKA 3ZVXA 3M3CA 1K5MA 1NYWA 3VBRB 5FWEA 5FXVA 5F5QA 2WLQA 5DUXA 3I54A 4BQWA 2JX9A 4LUMA 2R042 5DUWA 3LE0A 1H9WA 3LFIA 5LK5A 4CCOA 2R041 2YHJA 1EAH3 1U5IA 1UCXA 2WFPA 4PT6A 4GWIA 3U14A 1QH6A 1V00A 2JDMA 1L3JA 2R0HA 2OPKA 4D6SA 4NHXA 4Y33A 2RS12 3ECQA 4UBHA 5JMOA 1WD4A 4CXWA 1SHWB 2RS11 2WT0A 3O0VA 5BNQA 2GN7A 1SLCA 5IUQA 2YGLA 1NCQB 1GV9A 1W9SA 4OUMA 1EYBA 3TNPB 2PHWA 2Y6KA 4L9BA 4XF4A 4XW3A 3PU8A 5FYSA 4L2NA 2K0GA 3WDYA 1G9FA 3KCCA 1OQDA 4XTMA 2IXLA 1R083 3OBRA 2IXKA 1IZ3A 3ENRA 4RS5A 5DABA 1ZZ7A 2OT7A 1S2EA 3CJIB 4WM7A 4YNIA 5DZFA 1ND2C 1RUD2 3UGHA 2FZ1A 1S0CA 1RUD1 1SDWA 3AMNA 2RS53 3C8XA 3KMHA 3N9OA 2X8KA 1N3QA 2HYKA 2J7MA 3I4IA 3VB9A 3USSA 4H14A 1S0IA 1ZA4A 1HB2A 4Q8LA 1H30A 5DQ0A 2QE3A 3T1LA 3T0DA 5HI0A 3MZHA 4GKXA 3MEPA 5GZEA 4A2UA 3IMMA 3BPSA 3B00A 3LEMA 5M0TA 1I1EA 1NA1A 3ROUA 2PLV3 3LFMA 4FPHA 1GUIA 1HKDA 4CDQB 1F35A 3WDVA 5AC92 5C3RA 5AC91 3BTZA 5BNPA 4E4ZA 2WT2A 1XU2A 1VRH3 3O1PA 3R05A 4C1WA 3ZIWA 1RUE2 3JQWA 4LITA 1RUE1 3LIGA 2JECA 3NV3A 3MI8A 3B7MA 4Q0VA 1J84A 1VBB3 2XLFA 1CPNA 3ZFEA 2ZGLA 2R0FA 5FXZA 5FYHA 1OH3A 3POGA 4RL7A 1V0AA 4XDQA 4BOWA 3KV6A 4QGMA 1F4HA 1SCRA 3IMNA 2TNFA 5CG9A 1GZWB 3BTAA 3HWJA 1LU1A 2P6HA 2ZEYA 1S0JA 2EAKA 2RHPA 3AC0A 3R4UA 4QXBA 3BIEA 4Q4Y3 3TN92 2VZPA 5E6HA 4XFAA 5A33B 3TN91 5C3PA 4QAWA 2WNUB 3PIJA 2JDUA 5L19A 5HBAA 1ZBE3 4FP2A 2FBEA 4JHZA 4YW3A 4FOWA 2JIGA 2PTMA 2Q8CA 5DPNA 2VZVA 4QHOA 2DVDA 3VHNA 2E7QA 5C33A 2E63A 1IS5A 3AMQA 1H6YA 4FPCA 1XRUA 3MW4A 4XUOA 2ARAA 3MO4A 4NR1A 5FK7A 3VDBA 4G3YC 5HXVA 2KR2A 2UWCA 3ACFA 4IEVA 5FYUA 5GLTA 2A6XA 4JRAA 1VAMA 4NE9A 3HD8B 3LD8A 3ILFA 1A8MA 2VCMA 3J8F3 5A3PA 2ZGRA 3N4MA 5FZ6A 1W6PB 3DUIA 5FP9A 4OULA 3ZPOA 3W58A 2ZKNA 3D0SA 2PA7A 3U0ZA 2C6SA 1YC61 2XKOA 3L2YA 4Y1XA 3NSTA 1HX6A 3VBFA 2CHHA 3AFKA 5TSWA 4YW4A 3JUUA 1OXCA 3KM5A 4AI1A 4AQ6A 4RGGA 2VCBA 2VGDA 2WQZC 2WSVA 5A3WA 4M0HA 3VD3A 1EV13 1HDKA 3TEZA 2PXJA 1EUTA 3BOWA 1LHWA 1H1MA 2W1WA 1WCDJ 2JWPA 1QY4A 5C3QA 1TNFA 2JDNA 4OMCA 3JB8A 3Q8EA 1H4HA 5AVPA 1TEIA 2KD7A 2YXSA 3AP7A 1O5UA 4DY5A 4EWDA 2DFCA 2R043 2YYOA 3GNEA 1HB4A 3UGFA 4Y22B 1NCRA 2ADDA 3GDBA 4XOGA 1XNAA 2WR9A 3SCGA 4PLOA 3T0BA 2RS13 2PN5A 1QJFA 2C26A 3I2JA 4LA2A 1FNYA 1KD7A 3WDUA 5IK8A 1F5JA 3WNNA 1W9FA 3EXUA 3I59A 3UYJA 3WQ1A 2VQ0A 1AR92 4JRLA 1U12A 5JXJA 1AR91 3KQ4B 2YBSA 3LIHA 3WHUA 3O0XA 5LW9A 3UKNA 2OA2A 2FHRA 2XHKA 4GD4A 3I2FA 1JW6A 4CP2A 5JZGC 2BTVC 1VBE2 4LEJA 1VBE1 4W6WA 1UY4A 1LTEA 1F9KA 1GFF2 4N43A 1RUD3 5FJHA 4CU7A 1B35C 3MUY1 2GC3A 2ORZA 3BOPA 2Y6JA 4MXWB 1ZBA2 4CUGA 2B8MA 1O3TA 1ZBA1 3OTFA 4F3JA 3HNYM 4DUWA 4JGZB 5GLZA 2ERFA 5FLJA 3T4HB 2B7YA 1K5JA 1NXD1 3NNLA 4Y5Z0 4OYUA 3BTYA 2O0OA 3SC7X 2BBAA 1BYHA 1MZ5A 1Q8SA 2W87A 5EYXA 1SLTA 3ZR5A 5T3NA 2VTXA 1TME2 5AC93 4UBGA 4JZRA 1CIYA 1TME1 1PHMA 1W2AX 2BOIA 2JIJA 3CJXA 4QX7A 1YLLA 5BUVA 4A6OA 5I8TA 1UY0A 1EPWA 1RUE3 1XYOA 1UZYA 2JDKA 4YVWC 4CRQA 5J48A 1CZVA 5CFCC 3RGBA 1UU4A 4HBNA 3WCRA 1ND3B 2Z79A 4OHXA 4ZPIA 4UI9L 2K9ZA 3ST7A 3W5NA 3HQXA 3OUIA 4UT5A 3M7AA 1R092 1N1YA 4NHYA 4PF1A 4PQQA 2VW2A 4YFWA 1R091 4CPBA 5FYMA 1ZRCA 5K4LA 4OZOA 4LKFA 1DGWX 3N7MA 4A42A 1GR3A 1WCKA 2WNEA 2JG8A 2XDVA 4XFBA 2EVXA 1DYKA 5ABJB 2WRAA 1T6BX 4K1ZA 1SFNA 4E4DX 5FMOS 4CEYA 2C4XA 2UYBA 1VR3A 2VUCA 4QQHA 4Y1UA 5DDJ2 1MEC2 5DDJ1 1OOPC 3AJYA 4A6SA 2D6OX 1MEC1 4WZCA 3SNMA 4DINB 1W6NB 2BU9A 3JZVA 3S57A 1JOJA 3F95A 1XU1A 1KGYA 4JGYC 2GZWA 4XTPA 4NPMA 1OLQA 1GWKA 1XNBA 3U10A 4UW5A 3VKNA 3LAGA 2ZZJA 2WNOA 2XWBB 1YRZA 1S0BA 2XJUA 4AI9A 4UFMA 2ZOEB 4UF0B 3H42B 4KWLA 1PK6C 2OW4A 4YGBA 4EV0A 2J22A 3HMYA 3ZIXA 4LMFA 4P9YA 1XNKA 4ORFA 3POEA 4RFT0 3GXUA 2AGSA 1UY3A 1HJGA 4D7YA 2BVBA 4JQRA 2VO5A 2KM2A 2XLGA 2X05A 1C1FA 1J59A 1RVF2 4CUBA 5APAA 4AVSA 1RVF1 4QM8A 4DZGA 4CEWA 4BYYA 2JEMA 4YG6A 3OB8A 3CHXA 1SLIA 5FZEA 1I3HA 5FY9A 3VZMA 2WO3A 3OGGA 3MIGA 3VGIA 2FCUA 5F2WA 2R7EB 3D8CA 2IC1A 2HEVF 2GU9A 3GGLA 4Q26A 3THPA 2ZS6B 1JUHA 1W0NA 2ZX2A 5F5CA 5BNOC 4NUBA 2FZ2A 4BQYA 4FTSA 4XACA 3VBRA 4QXHA 4YZ2A 5FWJA 4UYBA 4CDXB 2BVVA 2V4VA 1D4M2 1IS3A 2CY6A 3JD72 4KQ7A 1D4M1 3GYDA 3JD71 2YC0A 4CPBD 3S7EA 3LPGA 1H2MA 1X36A 4TWTA 1QOTA 5KXEA 1N3PA 4LJHA 1MVQA 5F7UA 5K9YA 5FPLA 3IAPA 1H0BA 3JXSA 5HPOA 4QKDA 5J36A 2BYVE 1OURA 5LA9A 1SLBA 1NCQA 2PHTA 3CF6E 3VHRA 5FY4A 1WLWA 1W0PA 3ETPA 2CTVA 1QEXA 1OMIA 4JCKA 1IS4A 3OBZA 2X09A 5BY5A 2OXBA 4HONA 4UFJA 1AF9A 2DU1A 1QOSA 2D6MA 3IBMA 4S2FA 5IJRA 4KH9A 3P5BA 5CFDB 4M3CA 2VULA 1JOPA 2DCKA 3HR9A 4QDSA 3BU7A 3CJIA 1AYN3 1AR93 1GNZA 3M4FA 1MZEA 1JYCA 1AL22 3J4UH 4QPGB 1WGPA 1W39A 2QQMA 4RS5C 1AL21 2GC1A 4IEQA 4QQPA 4IGQA 3O14A 2PQSA 3S0MA 2B9VA 2UY8A 4GA9A 4QU1A 4WM7C 5FYYA 4COUA 4XILA 2VM9A 3G6JB 5F39A 3WF2A 5F3CA 4CVUA 1PVC2 4FFIA 4L99A 3RNSA 4B4RA 1VBE3 3UV9A 1PVC1 2YFUA 5E89A 2RDSA 1SDDB 2A5ZA 3E5XA 2Y33A 4QMAA 4XHBA 4AK3A 4DNYA 3WEZA 3SITA 5FP8A 1V6LA 3NAPA 3OD4A 1NE4A 1YJLA 1Y3TA 1PNGA 2A1XA 2GNTA 2JDZA 4IE5A 1ZBA3 1C8NA 1NA1C 3OGVA 3KQRA 4ASMB 3AP6A 1FAYA 1DQ5A 4XFGA 5FP4A 2V09A 2VNVA 2XQRA 3DYPA 2WQ8A 4R9AA 5BNPC 4MG2A 1DP0A 1S0GA 4AAPA 1UKRA 2NMOA 4EZ4A 5IFTA 2DCZA 1US2A 4HSLA 1HN0A 4LKSA 3ON7A 3NV4A 3UETA 4AI2A 1UXZA 1TME3 3ZX7A 5IYYA 3B3QE 5GLWA 2BNOA 1R64A 3POBA 3WDXA 1ZVFA 2QNKA 1F2NA 1C57A 2ZMNA 4CP1A 4PLMA 4QKBA 3P3PA 3ZFEC 3LDRA 4KWUA 4A7ZA 2BDRA 1ODNA 2B5HA 3A23A 1O4ZA 1OUSA 1HRV2 4QB1A 3PHMA 1HRV1 4I0WB 4PDWB 5LBCA 5A33A 3WV6A 2NM1A 2OS2A 1S0EA 1LCLA 2WA4A 1R093 2CYFA 4QHZA 4YW7A 2OQ6A 2Q5TA 2VU9A 1V6IA 3E97A 2CDOA 3VKFC 1B09A 3PLQA 2HBUA 5FUNA 3RI8A 1RUI2 3LA2A 1AR62 1AR61 1RUI1 2TBVA 1OD3A 5I8SA 3SEPA 2D5HA 3AMMA 4CSWA 5DMYA 4LNVA 1CAUB 2EXIA 3IWZA 3PJQA 5DDJ3 4B1MA 1MEC3 1OQEA 2YPJA 5JCTA 1HXS2 1HXS1 1FX5A 4RN5A 5DN2A 4A44A 1X7NA 3H8UA 5FQ0B 1YHFA 3ZXAC 4BH9A 1JH5A 1W6MB 5KXCA 1QWRA 4K1YA 3OG2A 3VBOB 1UPSA 1J58A 3THTA 2V72A 2BNMA 2PHFA 3RDIA 1XNDA 2XBO3 3O1TA 2GNDA 2ZJCA 1WLDA 2W92A 5J09A 3VHPA 2LW8A 5FY1A 3D82A 1YI9A 2LALA 4Q4X2 5KHHA 1HQNA 3AXDA 1XE7A 4Q4X1 5A3TA 4MUVA 3MV01 1LHOA 1SBDA 2GP3A 1FNZA 4UFHA 3ZDSA 2PAMA 5A80A 1RVF3 1ZYBA 4Y5SA 2DURA 2I45A 1LHVA 5FZHA 1A78A 1HB1A 5F3GA 3WW4A 5FLHA 2H6CA 3VBFC 1DQ1A 4HN0A 2DF7A 4FTEA 3NKGA 1IHMA 1RXGA 3K51A 4GAZA 2WNVB 5CU1A 5FO7B 4TLGA 4EWEA 1VBA2 2WSUA 2ETEA 1VBA1 2G4IA 4M0NA 2BWAA 4ISQA 1ONAA 4V2VA 4B4PA 4MV2A 1G8WA 2E26A 4J25A 3P6BA 1D4M3 3E6DA 3ZXDA 2VR4A 3JD73 3L9JT 4FOYA 5DAWA 5EHDA 4XUQA 3MIDA 1QNWA 3NNJA 2XPJA 4M3CE 4W8JA 2XVLA 2VMDA 4OHYA 2GP5A 4I01A 5LRSA 4TTGA 1S2KA 4QKFA 3FLTA 3MLLA 1NCRC 3I49A 5KXDA 5FKCA 3H50A 3HQUA 4FXGB 4KG8A 1AZDA 4LUKA 3VBSB 2RM23 3QD6A 3VZOA 5JXHA 4MX3A 1ULEA 1YQ8A 1W8NA 2VBDA 3HN1A 2ZMKA 5CNAA 3OPZA 1YO8A 2QQVA 4ZU4A 5FZ3A 1A8DA 1LOBA 4AEKA 2J1TA 2FDHA 2VMCA 2OZJA 4LORA 4ES9A 5JDBA 4FXKB 1IQAA 1LGNA 2BUKA 5EXOA 1AL23 3WP6A 5I0TA 1GQPA 4QM9A 5IW0A 1U0AA 3FHQA 1W06A 4N43C 1GZTA 1UOGA 4JGZA 1E5IA 5C8WA 4XF3A 1PVC3 1VMFA 4ES8A 1AXZA 1WMDA 1H6XA 1H1AA 5HCFA 3SXWA 3CQOA 4YW5A 4NPRA 2QQJA 2ZCWA 1CJPA 1UMHA 1VLNA 4I0BA 4LO8A 2VUDA 3M3IA 4XJWA 4Y20B 3OUHA 4YWAA 5FZGA 5E8AA 1LRHA 1W8TA 4K9SA 1YIFA 1VPHA 3HIFA 2XJVA 4Z8BA 1OFNA 1W2UA 1ND3A 1SEFA 2ZGPA 4KNCA 4NMIA 3TAYA 2DBIA 3AXEA 2ZHKA 3ZDVA 4DS0A 1ULGA 5CADA 1IGOA 4HK8A 4R4ZA 2W1QA 4LBLA 4XURA 4AW7A 1W6QA 4GKYA 3T2QA 3ITQA 4XFCA 4EN6B 5AFEA 2G9ZA 3AKSA 4G4FA 3THDA 1XQNA 2ZEWA 3WW1A 4ET7A 3Q9OA 1NQDA 3I2DA 4DPNA 3OPWA 4N7UA 5A6YA 1HRV3 3N7KA 4XFFA 2F6BA 4ITCA 4QX1A 1LENA 2GC2A 1QDCA 2GH2A 5CZKA 5FZCA 4CCNA 1UOJA 4DXRA 1DQ4A 3AL5A 1IOAA 5B4NA 4JDNA 3ZYFA 2Q1ZB 3WQ7A 1W6NA 2QDNA 4DEVA 4XEZA 4LTAA 4CCJA 1XC6A 4CEYC 5JLVA 4UW3A 1AR63 1RUI3 5DAQA 4NN0A 4NIHA 1D4VB 1OA3A 1MS4A 4DXZA 5E16A 2VOXA 4H3WA 3RMYA 2BGOA 2QVSB 3O12A 1Q8QA 3WVJA 3WP4A 1VAVA 3AB0A 4LOSA 2XXZA 5A7WB 3SMHA 3BKZA 3N9NA 4Q0SA 1HXS3 5FK8A 5E1RA 5A7NA 4QD2A 3AKRA 3AM2A 3VZNA 3A7QA 4AEDC 4D3WA 2QKDA 3H1WA 4XUNA 3FUOA 5L7OA 4Q0QA 2R32A 1NZCA 4RFRB 2AZ5A 3AMPA 1ODMA 4AEMA 1QH7A 2VZTA 3O5SA 1YJKA 1UZWA 4CU6A 1YXWA 4MYEA 5LBEA 3KHBA 5FZKA 4CEWC 2TUNA 2WLPA 4Q4X3 5FAXA 1LR5A 4EN0A 1MS5A 1N3OA 3E1F1 4XBLA 1WBLA 2AC1A 5DUUA 4PF5A 5IVFA 2DVBA 1XSRA 4C91A 4W4ZA 1WZXA 3UJOA 4OQ8A 1H8VA 1AJKA 4QDRA 1X9TA 4CDXA 3V0BB 3OSDA 1JOBA 1GBGA 3ELNA 4IEXA 2WZPP 1WMFA 5F9TA 2D40A 4IEUA 2VVEA 3VBRC 2EIEA 3OF1A 3CDZB 5JOYA 1ZZ9A 2YC2A 4KU7A 1VBA3 3MHZA 3AJZA 1LJ7A 4QQLA 3CL1A 3HQRA 1I5PA 1VJ2A 3NNFA 1D7PM 2IXJA 4XAAA 2D3SA 4HZFA 3POFA 4KU8A 3LEGA 1JYXA 5C5UA 4XBNA 2ZX3A 2VOVA 5DAPA 2TEPA 2E33A 3LPFA 1UYXA 3VZLA 1S2BA 1O7FA 4HG6B 4YZ3A 3RZJA 4WVWA 1V6NA 4MLOA 4N53B 1OA2A 2P3JA 3AVSA 3DPRB 4ZS3A 1V9U2 5CAZA 1NXMA 1V9U1 1DZTA 1VBC2 5CFDA 1NE6A 3VDDB 3FL7A 1VBC1 5T5PA 2VQAA 4AFMA 3ZN6B 4DXSA 4AAXA 1RUF2 4EROA 4GULA 1RUF1 2D97A 4Y4YA 1KDKA 5GLVA 1O91A 3A22A 3CJIC 5C7GA 1QF3A 2W91A 5FZ9A 3KVAA 2W47A 3WF3A 3V64A 2VOTA 5A3UA 1QJEA 2GALA 4M01A 5C8CB 1BBT3 4FAHA 3I2IA 1FOD2 5FXWA 1V6KA 2DCJA 3LSEA 1EP0A 1FOD1 2IXIA 3CIHA 5FXXA 5C4WB 3PVNA 3MIHA 2D7FA 2QTWB 2ZGTA 4PCRA 3UESA 4URAA 3EBRA 3OGJA 2P34A 3VZKA 4D94A 1U5XA 3GM8A 1ZM1A 3NAPC 4GH4B 4BQ4A 4LK7A 5C3SA 4H7MA 5CG8A 1Y7BA 4CP9B 1X50A 2ZXQA 2ZGNA 4K8RB 2Z4FA 5FZ0A 1LECA 1TZOA 3GZUC 2ATFA 3OY8B 2JE8A 3ES1A 2BZDA 4IDZA 3EB7A 4K8FA 1MS3A 4QX3A 4EQVA 3B69A 4XCAA 1ZRIA 2CSGA 1OH4A 2UWAA 3MLJA 1OSGA 4OVEA 1LESA 5FUIA 3ZXFA 4IV3B 3RZZA 1ALYA 2ZGSA 2OUJA 4LR4A 2HKXA 3VKOA 3W21A 5KHGA 1Q5OA 1QXPA 3MICA 2WDBA 1YNAA 2AR6A 3PUIA 4XIKA 3T0AA 3ILRA 3ZMOA 1RXFA 3OBAA 5FYIA 4NIAA 1XJAA 4PI2A 4LK6A 3MFCA 1OUXA 3ZXJA 3U75A 1O3RA 5E88A 2B45X 3EHKA 5GALA 4HVQA 3W5MA 1WW7A 1REEA 3AKQA 4CCMA 5FYVA 4WVMA 4CYDA 3VD5A 1NLQA 1MS8A 1OKQA 3FMGA 3ORJA 3PUHA 1CAUA 1OVPA 2Y38A 2Y6FA 3CNAA 3FZ3A 1MS0A 4MGZE 5LK7B 2RMU3 3FJSA 4HVRA 3DEMA 3KT4A 4NROA 2R1DA 1OVSA 4IV1A 3U07A 2W5FA 3ZFFA 1GOHA 3VV1A 5FQ0A 4BM8A 1HQLA 3B9IA 5FCCA 5H9SA 1W6MA 1IPSA 1WCUA 1US3A 2WJSA 4UWDA 2K2SA 4LO7A 2QQWA 4IE0A 3SH5A 3VBOA 5JSRA 2WWJA 5HCHA 5EZWA 1A34A 4PHZA 3NKTA 5KR7A 1RITA 5LRRA 2ZHLA 2FCVA 2I74A 1ND2B 3LKJA 3N9MA 4COVA 4FI9A 4QGLA 4WVVA 4J1WA 5F6KA 3USUB 3WY6A 4HANA 2ZAHA 1YFXA 1RJ8A 1XNTA 1MQTC 1IPJA 5K0UA 1PZ9A 2DVAA 1TVGA 3KV5A 4JX0A 2IVJA 4CCDA 3VKLA 3POYA 1G9DA 1PGL2 4WM8B 2XVGA 1I5ZA 3PTYA 5F37A 2VNRA 2WNVA 2UYAA 1PGL1 5LB6A 1W2OA 1I6XA 2YU1A 3GHNA 1DFQA 1DIWA 1HQWA 3OOXA 4XETA 4HPKB 1Q56A 2JD4A 2XVKA 1Q8VA 4TZDA 2A71A 4FO9A 2Y26A 3V0AA 1SFPA 1VB2A 1XNCA 5CB7A 1ENSA 2SBAA 3S30A 5ISLA 3C7GA 1JMUB 3ALQA 4BCUA 4BU2A 3FLPA 4CUCA 1D0HA 4ZU5A 4OHZA 4IESA 2X29A 2C9AA 4YYOA 4XE9A 1W05A 3A0KA 3JCIA 1H8TA 2E7AA 2GNMA 5FO9B 5CISA 2D6LX 1UY1A 2WABA 5F8PA 3PUSA 2R16A 2AH2A 1CX4A 3VBSA 4Z07A 4Z1VA 4XAEA 5KHIA 3N35A 4BE3A 2FCTA 4YVSC 3ATGA 2PHDA 1S0FA 5FZFA 1GWLA 3ZOIA 5EIYB 1V9U3 4BB3A 4JKKA 3AP9A 1VBC3 1UOFA 3WF1A 4DOUA 2A3WA 4I3PA 1PX4A 4XFIA 5FJKA 4FCAA 5FRAA 2XHNA 4ZY9A 3U1XA 2HWE2 1RUF3 2HWE1 4FPFA 4KBBA 1WMXA 2FD8A 1RUH3 3LDKA 3T08A 5A3LA 1WLCA 4E8CA 1HB3A 3T3YA 3WOGA 3O1MA 1F15A 1OLMA 2PHLA 4MGQA 3SEEA 2VZ3A 2Z5WA 5C9AA 1FOD3 2XJTA 4K3UA 4YG0A 4QPIB 5JOXA 1ZRFA 1NOVA 4L8QA 5FMDA 3CMGA 4JGZC 2W9XA 1CX1A 1LODA 1DLLA 5GKAC 1AYN2 2DUPA 1K45A 1AYN1 2DBNA 2D6PA 2VXRA 2FDFA 1KITA 2PHXA 5A7QA 1ULPA 3HEIA 4XJZA 1JZ4A 1BQPA 5G04L 4UXAA 2E51A 3KCYA 1J3RA 2IXCA 3WNMA 2BPA2 5JPNB 4O9GA 3WNXA 4F7ZA 4LBQA 2XJPA 4W6YA 3M1HA 2ENRA 2VW1A 3BALA 3VBHC 1PMHX 3BI3A 1PGSA 1C1LA 2ZX4A 1UYPA 3LDBA 3SCHA 3MYXA 4R9BA 5A6XA 4AFDA 2IUWA 5J37A 4YRDA 2P6CA 2ZKLA 2WIIB 5L9RA 3VBUA 2CU5A 5FZLA 1RB8G 5EYYA 2QDRA 1S55A 3AKPA 2V5DA 4CDWA 3FE5A 3ZXGA 1VMJA 1GOFA 4DFSA 4U36A 4WBBA 4XDPA 1DQ0A 1AR72 1AR71 4Y24A 3N9PA 4YM2A 2JICA 2A3XA 1DF0A 1M4WA 1VALA 2A7AA 3DN7A 2E53A 2VZRA 3MDPA 4AHXA 3DXTA 5EQUA 3RQ0A 4IEPA 3HT2A 3C3VA 1PM7A 5A3OA 3I2GA 3IB3A 4UFKA 5FPXA 4Y4RA 5CKNA 3FFQA 3ZN5A 5C5TA 4MHRA 3KCXA 4Q4W1 1RUC2 4ARXA 2RJLA 3RZHA 1CAXB 3ZXEA 1RUC1 3TEYA 1QU0A 5JZGB 4BHPA 4IEYA 4MGKE 1CAVB 3FWEA 1PMJX 5FLIA 5FZBA 4B4QA 5T50A 1AL0G 4D69A 5L7OC 1UZVA 3ZO0B 2JXAA 1ASJ3 5BNNA 2A6YA 3WZ1A 3LGRA 3J7MA 3H7JA 5FOBB 4B7EA 4Q8KA 4E2QA 1B35B 3H3ZA 4UAPA 2L9LA 1UOBA 2ZGQA 2NN8A 1CONA 4RQPA 5CKQA 1COV2 2VUJA 1GQGA 3V0BA 3J7LA 1COV1 4LBQD 2W3JA 4MO3M 2RR12 4HKWA 2Q8EA 1BZWA 1DLCA 2BP6A 2RR11 2XBO2 3OYWB 1JYTA 2XBO1 3URFA 2WUHA 5G05L 4XUTA 5A32B 3VD4A 1POV0 3H8XA 1GZCA 1PGW2 3HBZA 4Z82A 4YGDA 4OMDA 4Q29A 1PGW1 4E2GA 3MIFA 4YG3A 2JE9A 3QLQA 5FZ7A 4PIYA 4YVWB 4GWMA 4C8DA 2YUEA 1HLCA 1XB9A 2ARCA 3UK9A 5CFCB 3OEAA 1QIQA 3LOIA 4LXLA 4LIVA 2LM3A 4N53A 4PJYA 5K8SA 3ASIA 3HVDA 2JD9A 1VB4A 1GU3A 2VG9A 3ACLA 3ES4A 3HNMA 3KVBA 3VDDA 4Y1ZA 3A21A 3WXPA 3ZN6A 1HIXA 4CU9A 1H1IA 2EXKA 1OHFA 2E9QA 1ZRRA 3H7YA 5FZOB 1GSLA 3MBWA 3K46A 2W68A 3WINE 2ADEA 3DXUA 2NMNA 4D8MA 3W9AA 1K5MC 2VNGA 4OUSA 3B02A 1OOPB 2FMYA 4LQRA 1I9RA 1GZ9A 3GCXA 4LA3A 4AL9A 1LHNA 5EJZB 1HW5A 2P4EA 4QXKA 1JODA 2LROA 4K40A 1Q43A 4FPLA 4JGYB 2VBPA 3ZFGB 5C4WA 5J7MA 4BLJA 4DIQA 2HWE3 2ZZQA 1FPN3 2XKPA 1JYNA 5J3UA 4XF1A 1O4TA 5FZMA 2RM22 2ZABA 1LOFA 1QXJA 2RM21 4GH4A 1L7LA 1UZZA 1HN1A 2G1MA 1PK6B 2Y6HA 3IKWA 1LULA 4CP9A 1MVEA 2YDEA 1W8OA 3HT1A 3KGZA 3NMBA 5F2SA 5CVRA 4BXFA 1LU2A 1Q8OA 1SLLA 2MHFA 3J7NA 3MW3A 3KZ4C 4GB32 4V1PA 4IGPA 3H9AA 2GNBA 4GB31 4KMQA 2E31A 4B3NA 4IE6A 5EJ3A 4FFFA 4AHWA 5JMCA 4YGCA 2B39A 4IV3A 2RVAA 4AWDA 4CE8A 2Q1FA 4FPKA 4H7LA 4AI8A 4X8NA 4JDOA 4AHZA 1C28A 1KRIA 2J42A 5LBFA 4P14A 1J83A 3V56A 2Q30A 2B46X 4OUEA 4S2GA 1APNA 1KFXL 3APBA 3WG2A 5BNOB 1YQ5A 4CDQA 3DL3A 4GIQA 1ZZ6A 1E57A 4QX5A 5L9BA 4NWWA 4XZPA 1XOYA 3WNKA 3I2HA 3KHCA 1UZ0A 1NLSA 5A6QA 1CWPA 3I3BA 2KA3A 3K4DA 4PQ9A 1E5SA 2H0BA 5DZEA 3G7DA 1JI6A 4NAOA 1UNBA 4BIFA 1H2NA 2NLRA 2JKXA 1UF2C 3U11A 2P1BA 2B42B 4ZU7A 1W99A 2ARBA 4A4AA 5CKMA 4TLFA 1FI2A 1QGLA 4NIGA 1OPOA 1URXA 1W2TA 1AR73 4GJYA 1ULCA 1ZZCA 3GBWA 1RUG2 2VY0A 3PNAA 4X8PA 4BWOA 3H1YA 1RUG1 1GZWA 5LA0A 1YFWA 3LF7A 1A6CA 5KXBA 4IV1C 4AGRA 5H9PA 3ZFFC 3M3OA 1BCXA 2FMDA 4QPYA 2PHRA 2DDUA 4PBOA 1AR82 2R30A 2OIIA 1AR81 2WYSA 3GBGA 3O1OA 1XYPA 1PNFA 1JHNA 2VZOA 2WNUA 5FY5A 3VBOC 5FMOL 2C24A 3TRSB 1MS9A 3USUA 5IVBA 1C5HA 1W03A 1LOGA 2RDQA 1WWYA 1RUC3 5GZGA 4HXCA 4Q5OA 2QQOA 5J96B 1LAJA 5FKBA 1FATA 4H55A 1C4RA 1QDOA 1Y9MA 5C70A 4CZSA 1WCSA 1X9PA 4WM8A 2VJXA 4DEQA 5K0UC 1POV1 2ID4A 1IG3A 1FXZA 4L97A 1K3IA 1UIJA 4JTOA 3KS7A 4NRQA 2BQPA 4E4HA 1OC1A 2YU2A 1NA1B 4ZHNA 1JZ5A 2XB6C 2V73A 2WNVC 2YGMA 4Q4V3 4Y5TA 1COV3 5IK5A 2D43A 2Y6LA 4LBKA 5BNPB 2ZBJA 3T2OA 5FZ8A 2RR13 2XMLA 4ISRA 1ZREA 1W6PA 4L0PA 2J1EA 4AXOA 3EYPA 4RSUA 3D3AA 2A6ZA 5LATA 3LEIA 4I02A 2ZACA 4P9JA 3A4UA 1G7YA 3LWCA 1REFA 3M3QA 4FQ4A 4A3ZA 4E27A 4FTBA 2O8OA 4H2AA 1N1TA 2EIBA 2G9GA 3MIEA 4IEOA 4FT8A 4AFBA 4IERA 2ZGOA 4ATEA 4FFHA 3AMHA 3KSCA 1H8TC 5T55A 2IFRA 2JJ6A 2GDFA 4BK4A 2QZ3A 3T09A 2QJVA 1NX9A 3BB6A 4R52A 4HLTA 3VBSC 5HXMA 4QDQA 1C5IA 3JU9A 2XL7A 3HOBA 5FYCA 4EE2A 4F8AA 4LO4B 2GAUA 4QQOA 1RHI3 1LOCA 3ME2A 5T5LA 2Y0IA 4LO6B 4Z92B 1PO22 3ETQA 1V6OA 4IEZA 4QX0A 1PO21 1SACA 4Y1VA 5GZCA 2NYYA 4XMIA 4Y22A 2WT1A 5B2GB 1GICA 1VAKA 2WINB 2Q0AA 1RC6A 4QKNA 3I97A 3ZYBA 4QPIA 2YBPA 1YEWA 3PUAA 3ZKUA 3S5QA 4W6XA 3NJVA 4HN1A 2ZTNA 5SV8A 4OI1A 1PO12 2J1UA 2W39A 5C9AC 3RRDA 1PO11 2F4PA 5LY2A 2HLEA 4R9CA 2QQPA 1VBD2 1VBD1 5I0RA 3RZLA 1DBNA 4YM0A 1OFSA 3AYEA 1POQA 3O1SA 1TNRA 2GN3A 3ZPYA 1N1VA 3BYWA 1BBT2 3POWA 5DG2A 2AUYA 3J9SA 1N1SA 1BBT1 2XQXA 4GB33 3UKTA 5JI7A 4S2DA 1LEDA 5JVVA 4NAMA 3WG4A 1CZSA 1E5HA 2DYCA 4FOQA 4B29A 2O14A 1GP6A 5BPXA 1W04A 4MXWA 4ZZ8A 4UFIA 1JUIA 4IE7A 2ZGKA 3VBFB 5FDBA 3K2OA 3P1IA 5C71A 1GMMA 3GBFA 1YFYA 3TNQA 2LRPA 1W28A 2P5BA 3NQHA 5DXDA 5A70A 2CWMA 5L9VA 3I2OA 4Q27A 4S2HA 4FAGA 4FPEA 3VBUC 3CZUA 1LKNA 1WA4A 2X5IB 1DU3D 4HETA 4XVHA 4LO5B 4RR3B 1N47A 1ZA7A 3BODA 5FPAA 4CDWC 1STMA 3SCFA 4FVVA 1AX2A 1CIWA 3POJA 5CBLA 3Q8AA 5I0SA 3PVEA 1Q3EA 4GXLA 2JG9B 1PVXA 3DKWA 4WZFA 3ZM8A 4C0BA 1JYIA 2W1UA 4KWKA 3MF9A 5K7PA 4LULA 1NCRB 3HJRA 2NZ9A 4CDUB 2XJSA 4XUPA 4F83A 4CP0A 2H6BA 4O7XA 5JI9A 2EIDA 4RGKA 5FY0A 1RUG3 4LOTA 1Z0HA 1JN2P 4JAAA 4XCBA 3LZZA 2WFF2 3I59B 1UYZA 1NKGA 2A70A 1QNYA 4HVOA 2WFF1 4M4RA 4AR2A 1CAWB 3TWIA 4NJ4A 5ABJA 1CAVA 2PQQA 5JOZA 5JZGA 3GALA 3SKJE 5LZ6A 1D0GA 1AR83 3BIWE 4UFLA 5DZGA 5FIXA 3WNOA 4DRRA 1RTVA 1WBFA 2JG8C 5JSOA 5IATA 3RFRA 5EFUA 2FDKA 2RMU2 4KWJA 5FYTA 3ZYPA 1CJDA 1YQ2A 1EY2A 2RMU1 2QZ2A 3R4DB 4AVAA 2BNNA 3BU0A 1NT0A 1XE0A 3DYOA 5BNNC 4FPOB 2QCSB 3WD5A 4N43B 4YZ5A 2E32A 5ERLA 4OFGA 1L7RA 3PIGA 3ZMNA 3E6BA 3JBG2 4FFGA 4ASLA 2XJRA 4UF0A 3JBG1 4RQPC 4AI0A 1POV3 1LGBA 2XL9A 1UO9A 4Q1RA 2GH8A 3OUJA 4QGNA 2YB7A 1R1A2 1KS5A 3AL6A 2DU0A 1R1A1 1KFUL 4UOJA 3AYCA 5HCBA 1DCSA 3WNLA 4NIDA 5LCWL 4YVWA 5CA6A 4XHXA 2EIGA 4PI0A 1LHUA 4YZ4A 1UL9A 1AHSA 4LLFA 1IKQA 5BXXA 3AP4A 1DQ6A 3DECA 3NJYA 5FBJA 1QMJA 2G9FA 4ASKA 5A3MA 1O3QA 1A3KA 1X82A 4NOTA 2BFUL 2IXHA 5I0UA 2A73B 1UU5A 4CU8A 1QHDA 3N9LA 1CESA 1KS4A 4UW6A 4XYXA 3WG3A 3TBDA 2HYXA 1W8UA 5FZOA 4AYUA 3ZYHA 2QBXA 3WDWA 3KLSA 2ZHNA 4DB5A 4OHWA 1W8WA 5F3EA 2CV6A 1SFYA 2D93A 2CNAA 5LA1A 1QOOA 3WT3A 1WW6A 5D8AB 5FZ4A 3NNMA 4JGYA 4BLIA 1DGRN 3B01A 3ZFGA 4ZONA 1JYVA 4AQTA 3C7HA 4R4XA 4CTEA 3FHIB 3THCA 1YFUA 1PO23 4BDVB 1J3PA 5GZDA 1DG6A 5C4WC 1FT9A 2D6KA 4HMZA 2PYTA 2YMZA 3AP5A 1Y9QA 2BV4A 1NCQC 5EJ1B 2D5FA 1SZBA 1Z7S2 1LOFC 2O8QA 5FOJB 1Z7S1 2YBKA 4AEDB 4GH4C 5EPAA 4ZXEA 4C1XA 3KF5A 2NP0A 4XDOA 4BISA 1W0OA 2WL1A 5FPVA 2CDPA 4MSVA 4PLNA 2Y0OA 3UT0A 1PO13 1XPWA 4QPGA 2DCTA 2VTXJ 2VZ1A 5D2AA 4Z2AA 1RUH2 1VBD3 2JDYA 3AX4A 5FO8B 1RUH1 2A75A 1JTZX 1QJU2 4JDMA 1QJU1 4P5YA 4CEWB 2IVIB 3R4SA 5IT6A 2HEWF 2RE9A 4QX8A 2IZWA 2DUOA 1G86A 2OX0A 3B5LB 1DHKB 5BNOA 2A6WA 2IFWA 1V6MA 2VE1A 2EF6A 1KEXA 3OGSA 1LOAA 4JV4A 4X6QB 3MFAA 4QPWA 3LSDA 3IPVB 5T52A 1GYKA 2VZSA 2VH9A 3VDAA 4CDQC 4ZKTB 5JXGA 3POIA 4PIXA 4DQAA 3PL0A 4JKMA 1OPMA 1UD1A 4P02B 5KWRA 3BN6A 1WLTA 5J98B 1OF4A 2VQTA 4K21A 4J1XA 2HWD2 2Y34A 3MPPG 4XIOA 2HWD1 4V2WA 3S6PA 1ZRDA 4GMP1 2DTYA 2XWJB 3LA7A 3EQEA 1UAIA 3GJAA 2Q1MA 2VL4A 2BBVA 1RMU2 2W1SA 4QQ2A 1NLRA 2YG0A 5FPZA 1RMU1 1ULFA 5F1RA 4PDWA 3I3MA 2XOMA 1AJOA 5FUPA 4MHUA 3RS6A 3H3UA 4QB2A 1JYWA 2JDAA 4C0HA 5A3NA 2QUOA 1SBEA 1GANA 3RG0A 3ZYRA 4LLOA 4M3CB 5I8YA 3RYKA 1IS6A 4OCTA 4CXXA 5FYBA 5LBBA 3MW2A 2WFF3 2WNUC 4NRMA 4TXWA 4YW1A 1BMV2 1V6JA 3QOPA 4HOOA 4LE4A 1BMV1 2VD7A 3WX5A 1G9CA 1GNHA 5JIAA 1IPKA 5JSPA 3RPQA 2DTWA 4PBPA 4I3GA 4AOCA 4XC9A 2PFWA 3H1MA 1RUNA 3TYJA 2VMGA 3AYAA 1QQP2 3ZYGA 1K12A 1QQP1 4D6RA 1UWWA 3ILNA 4WM8C 5LEJA 3VUOA 3CKHA 3C2UA 3AZWA 4GJZA 3NAPB 5L73A 4E2SA 4CCCA 5F32A 4LT5A 3ABZA 4FBFA 3O1UA 1BHGA 3JBG3 4NHLA 3ZLIA 3M2MA 4HFSA 5FZIA 4MGIE 3RJ2X 3N9QA 4TSVA 1ASJ2 2VCAA 2JDPA 1ASJ1 3JB4C 4Q4W2 1VE0A 1Y4WA 3M70A 2AEZA 2V4AA 2WKKA 2VECA 1R1A3 4BK5A 2R072 1VMHA
chains in the Genus database with same CATH topology
4HKOA 1F8VA 2R071 1R1ZA 4ATFA 1C8M2 1KXGA 1C8M1 3WP5A 4AVVA 4E4SA 3RWNA 2X53S 4UW4A 2HEYF 3PVBB 1S1AA 2HWB2 1CPMA 2HWB1 2JE7A 1QKQA 1KDMA 3R0RA 4KL1A 2Z69A 3WQ0A 4BMBA 1OA4A 4MZUA 4XJAA 3WUDA 4AHYA 2LUWA 3EJKA 1YUDA 2C5DA 4Q1PA 4TYSA 3FBYA 4OZXA 1NQJA 2AYHA 3VZJA 2R062 2R061 1V70A 4COYA 1YYNA 5T54A 3N7LA 2EXHA 4WVZA 5HCAA 4QPIC 2IWGB 2BWCA 1H9PA 2AENA 1FMD2 4K7JA 5GJ6A 3H0OA 1FMD1 3M3EA 2VMHA 4BA6A 1XYNA 2HJIA 1TMF2 1XXNA 3KT7A 1Z7S3 2VW0A 4L11A 3QH7A 1TMF1 1O5LA 4XQ4A 5KC6A 3PMEA 2YV8A 2UY9A 5T5OA 1BK1A 2VMIA 1MQTB 2Z2SB 3O0WA 4AVCA 4IQPA 2SLIA 1FPN2 2W08A 1FPN1 3MGUA 4OI0A 3U4XA 3SLIA 1QJU3 3O7OA 4B8EA 5L36A 4A7YA 3IT8A 3EO6A 1LGCA 2N7GA 2ET7A 1O4YA 3RI9A 5ACA2 2X5IA 3N7JA 5ACA1 3D5OA 4RR3A 4AEJA 2OUHA 1U5YA 1YIPA 2NQYA 4Y20A 1AX1A 4G9SB 1DGWA 5AVAA 2JG9A 3FC0A 1CQ9A 4MGYE 1DZQA 4KGQA 1WW4A 4AG4A 4AE2A 2DFBA 1T6GC 4QHBA 2HWD3 4CDUA 4DRVA 2DVFA 4GMP3 1ND3C 3ZN4A 1UN1A 3B94A 4YVSB 3NV2A 5H9RA 4XBQA 3AZVA 1CAWA 4I30A 2MEV2 1RMU3 3ZYJB 2MEV1 4OLLA 3VHOA 1U5ZA 2VOKA 2HWF2 1MR5A 2HWF1 3KB5A 1W6OB 5ABJC 5BV6A 1QXRA 4DY3A 5FTTC 1H2KA 4EJRA 3R6SA 2GSYA 4P9GA 4P9XA 2JKBA 1LOEA 2ARXA 1WD3A 4COWA 1OLRA 5DG1A 4YFZA 2ZGUA 4RD7A 3CO2A 4N9IA 1QQP3 1QJX2 4IEWA 1QJX1 4XXAA 3AZYA 5GM0A 2EXJA 4OI4A 4MH0E 1HRI2 2Q8OA 2ZAAA 1HRI1 1NG0A 4BMEA 4FQZA 4AGGA 4ZXKA 1J1LA 1DYPA 3KT1A 3T1MA 4N9HA 4Q4W3 4YGEA 3VBHB 4GQ7A 2DUQA 1AXYA 2R073 3WDTA 1QJY2 2P3IA 3I8TA 2RS32 1C8M3 1QJY1 2RS31 4Q4V2 2FQPA 4Q4V1 5F6LB 1W6QB 2XH6A 4P9LA 4X6RB 3ZYIB 1GQHA 2A3YA 2GMPA 2AREA 2HWB3 2I2SA 4Q0PA 4CDXC 1SMVA 5D8AA 3GHMA 3TN93 3LA3A 1HV1A 3NWKA 2ILMA 1ZX5A 1YWKA 2CGPA 1MS1A 1WW5A 3V65A 4P9WA 2Q4SA 3ZFGC 4D7SA 2ZX0A 2R063 3D0JA 1YCIA 3DPRA 1CR7A 3PJYA 4M00A 4AEDA 2VUAA 1UU6A 1RHI2 3FBMA 1VIWB 3HAGA 1RHI1 3X29B 5CFDC 1ULDA 3WUCA 1DZRA 1FMD3 1JXNA 4OHVA 4QT6A 1X33A 5L7OB 4I0AA 2VVFA 1IKPA 4XXPA 1YI7A 3WG1A 4ONUA 4HK9A 4QPGC 3CLPA 1CN1A 1TMF3 2OYZA 3ZXKA 3FLRA 5C8CA 3RJRA 4AI3A 1Z78A 1WMEA 1DQ2A 1G9AA 4META 3ZSJA 1PMIA 1O3SA 3IPVA 3SISA 4W65A 4FPYA 1J3QA 3E6CC 2EALA 1CGPA 5CIRA 4LBJA 4XQWA 3OY8A 3NJZA 4GWNA 4LBNA 4EWAA 1JBCA 5ACA3 4XQDA 5GZFA 3QH6A 4KG0A 1ZNPA 2D44A 3AYDA 5H9QA 5I93A 1S0DA 4Q2FA 4R8HA 3RYRA 4K20A 1MZFA 1X8EA 3WCSA 2ES3A 1MZ6A 3NL1A 4XJUA 1TQ5A 1FYUA 1ZZBA 3QCWA 4Z2WA 4B7KA 4PDWC 2YROA 4EN7B 5C6CA 1REDA 2CL2A 2WQ4A 4LHKA 5D1IA 3TB0A 5JOWA 1J1TA 3NV1A 1K5MB 4JTNA 4D7TA 2MEV3 2XUMA 5KBFA 5JAXA 4EN9B 3MPBA 4M3CF 4FSJA 2WWSA 2HWF3 3T2TA 4EN8B 2E7TA 2PELA 4AVBA 2DWRA 1NY72 3W59A 3N3HA 1NY71 3DV8A 5GLUA 4BQ1A 3AZZA 4A7KA 1SBFA 1LB2A 2NPIA 2WS92 1ENXA 2WS91 2GMMA 4JC1A 3DGTA 4JVAA 1BVVA 3IDCB 4NVPA 2D98A 2P37A 1HV0A 5JR7B 2LTNA 1RUJ2 3MLKA 3VLBB 1RUJ1 1ND2A 2MNGA 4A3XA 1QJX3 1DGLA 4RS5B 1AUYA 3WHTA 4LE3A 4WM7B 1KQRA 4HL0A 5DUVA 2O1QA 1HRI3 1FV3A 5KHKA 1BXHA 4Y26A 1AX0A 3IDEA 5EWSA 5AFBA 5JWPA 2WA3A 2CGNA 1UPIA 2GC0A 4RA0A 4XPVA 4YARA 4KGGA 5EV7A 1AYM2 2CAUA 1QJY3 2GMEA 4HPKA 2RS33 1AYM1 2Z42A 1GKBA 4LHLA 1UMZA 1BEV2 3SH3A 4AQ2A 3ZSLA 1BEV1 1Q8PA 3DF0A 4IETA 1BJQA 4WVMB 1UKGA 4RHV2 4RHV1 2R1BA 3D4KA 3ZFEB 1RINA 1XE8A 4IV1B 3ZFFB 5FREA 3UKVA 4DMIA 3IIAA 4O9EA 1X8MA 2EAAA 1KJLA 3WR0A 2ZX1A 4SLIA 5KC5A 1WUVA 1MQTA 4J6GA 3SHRA 4P5HA 3P3NA 1AVBA 5T5JA 1EPZA 4N7IA 3NO8A 2WZR2 4WV8A 2WZR1 1OD5A 3QACA 4OI2A 5K0UB 2MPFA 4K6BA 2OVUA 2W52A 1M06G 1PIV2 4Y1YA 1PIV1 3J26N 2XGXA 2XG3A 2BFUS 4SBVA 4AVTA 3MF6A 4HT1T 3LB9A 2R6QA 3KD4A 3OD0A 3KGLA 2V5YA 3RYPA 3CU7A 4XJ9A 1SQ4A 4LHNA 3V0AB 4P9IA 4HSJA 2E6VA 2X5IC 2HWC2 2P2KA 4RR3C 4XJ8A 4URTA 2HWC1 3S7IA 3E5UA 4N90A 4COZA 4NWVA 2B9UA 3WLUA 2JG9C 3A0NA 3OJBA 1PZ8A 1KJRA 4AQSA 3IN9A 3PVOA 2DVGA 1H8TB 2ZA9A 4CDUC 4YVSA 3PMSA 1ENQA 1MACA 3M8LA 4FP3A 4FOVA 1D2QA 1RL3A 2ZMLA 3WW2A 4AFCA 1EAH2 1EAH1 1W6OA 2I07B 3INAA 3CEWA 5BYNA 3BPZA 3VN4A 4LBMA 4MVTA 3ZXLA 3N36A 3LCPA 3ZSKA 4YZ1A 3GZAA 4RGAA 3POSA 5FBZA 3QBQA 4XF0A 1SCSA 2A6VA 3LOBA 1OI6A 2H0VA 2PAEA 4BIOA 2EA7A 4YLZA 2D3RA 2ET1A 1F5FA 5C9AB 1R082 2VOWA 4NHKA 2PHUA 1DDLA 4I09A 1R081 2UURA 2D3PA 4QU2A 1QJZA 2DV9A 4GMP0 1CAXA 1TE1B 1ENRA 2WS93 2RJKA 2C1FA 4XFHA 5FFOC 1UW8A 2RS52 2W0XA 2RS51 2ZGMA 3TOJA 1AXKA 3ZSEA 4HKLA 3FUQA 4Q0UA 3WP3A 1RUJ3 3AZXA 1UX6A 3B9CA 4XMAA 3VBHA 1CVNA 1G9BA 2UWBA 1Y43B 2ZHMA 1B35A 1CD3G 3K48A 4XF9A 2VNOA 2QFEA 2P17A 3BCWA 1G6NA 1FV2A 4LBQB 2PLV2 2UU8A 5KHJA 2YY1A 2PLV1 1OQ1A 4U2AA 4MXVA 2PAKA 1F31A 4I2OA 3GF6A 3UL2A 1VRH2 4BPZA 4L92A 1VRH1 2OZ6A 3OYWA 3FFZA 3VBUB 1DGRA 5A32A 1AYM3 3IDBB 4NHMA 3I7DA 2BEOA 4CDWB 1VBB2 4AGVA 4E9KA 1VBB1 5IK4A 3OBTA 5D8AC 2YZ4A 4IXLA 1BEV3 2BW8A 5CFCA 3AFGA 4FPGA 4INDA 4LBOA 3WW3A 4GALA 2WC2A 4BZ4A 4YM3A 1LEMA 1RGSA 1PZ7A 1RJ7A 1BKZA 3GZTB 4Q4Y2 4AF9A 5IK7A 4RHV3 4Q4Y1 4YM1A 3SH4A 2XLAA 4N53C 2VPVA 3DPRC 3NW4A 3VDDC 2XJQA 2P3KA 1ZBE2 4AFAA 3IM0A 1ZBE1 1RIRA 2ZPXA 2JG8B 3D6EA 2VVDA 1OOPA 3MIBA 4YW2A 4C90A 2CGOA 2C0ZA 4IL7A 4CEYB 5BNNB 2CAVA 3NVCA 3VL9A 2D6NA 3ZSMA 3AK0A 3RSJA 4NO4A 5JIUA 5C8CC 1H2LA 4YSFA 1VP6A 2WZR3 3RMXA 1RUOA 4RQPB 3OCPA 1H4GA 1PK6A 4PIZA 1SLAA 3UJQA 1D2SA 2KXLA 1UIKA 1PIV3 3J8F2 2DCYA 1C3HA 3J8F1 3FX3A 3VKMA 3VL8A 5SV5A 3L2HA 3AKTA 2CWSA 2JENA 5LEKA 3JQXA 5JPMB 4FPJA 1GLHA 2HWC3 4IV3C 1EV12 1ZZ8A 1EV11 2BGCA 2R49A 3E5QA 5I91A 4R9DA 3B93A 1BVP1 3ZVXA 3M3CA 1K5MA 1NYWA 3VBRB 5F5QA 2WLQA 5DUXA 3I54A 2JX9A 4LUMA 2R042 5DUWA 1H9WA 5LK5A 2R041 2YHJA 1EAH3 1U5IA 1UCXA 2WFPA 1QH6A 1V00A 1L3JA 2R0HA 2OPKA 2RS12 3ECQA 4UBHA 1WD4A 2RS11 2WT0A 3O0VA 5BNQA 2GN7A 1SLCA 5IUQA 2YGLA 1NCQB 1GV9A 4OUMA 3TNPB 1EYBA 2PHWA 4L9BA 4XF4A 4XW3A 4L2NA 2K0GA 3WDYA 1G9FA 3KCCA 1OQDA 4XTMA 2IXLA 1R083 3OBRA 2IXKA 1IZ3A 3ENRA 4RS5A 1ZZ7A 4WM7A 5DZFA 3CJIB 4YNIA 1ND2C 1RUD2 2FZ1A 1S0CA 1RUD1 1SDWA 3AMNA 2RS53 3KMHA 2X8KA 1N3QA 2HYKA 3I4IA 3USSA 4H14A 1S0IA 1ZA4A 4Q8LA 1H30A 3MZHA 2QE3A 3T1LA 5HI0A 4GKXA 3MEPA 5GZEA 4A2UA 3B00A 1I1EA 1NA1A 3ROUA 2PLV3 4FPHA 1HKDA 4CDQB 3WDVA 5AC92 5AC91 5BNPA 4E4ZA 2WT2A 1XU2A 1VRH3 3R05A 4C1WA 3ZIWA 1RUE2 3JQWA 1RUE1 2JECA 3NV3A 3MI8A 3B7MA 4Q0VA 1VBB3 2XLFA 1CPNA 3ZFEA 2ZGLA 2R0FA 4RL7A 4XDQA 4BOWA 4QGMA 1SCRA 3IMNA 2TNFA 5CG9A 1GZWB 3BTAA 3HWJA 1LU1A 1S0JA 2EAKA 2RHPA 3R4UA 4Q4Y3 3TN92 4XFAA 5A33B 3TN91 2WNUB 5L19A 5HBAA 1ZBE3 4FP2A 2FBEA 4YW3A 4FOWA 2PTMA 2DVDA 3VHNA 2E7QA 5C33A 2E63A 1IS5A 3AMQA 4FPCA 1XRUA 3MW4A 4NR1A 4G3YC 5HXVA 2UWCA 4IEVA 5GLTA 2A6XA 4JRAA 1VAMA 3HD8B 3ILFA 1A8MA 3J8F3 2ZGRA 3N4MA 1W6PB 3DUIA 4OULA 3W58A 2ZKNA 3D0SA 2PA7A 3U0ZA 2XKOA 3L2YA 4Y1XA 3NSTA 1HX6A 3VBFA 3AFKA 5TSWA 4YW4A 3JUUA 3KM5A 4AI1A 4AQ6A 4RGGA 2WSVA 2VGDA 2WQZC 4M0HA 1EV13 1HDKA 3BOWA 1LHWA 1H1MA 1WCDJ 1QY4A 1TNFA 3JB8A 1H4HA 5AVPA 1TEIA 2YXSA 3AP7A 1O5UA 4DY5A 4EWDA 2DFCA 2R043 2YYOA 3GNEA 4Y22B 1NCRA 4XOGA 3SCGA 4PLOA 2RS13 2PN5A 4LA2A 1FNYA 1KD7A 3WDUA 5IK8A 1F5JA 3EXUA 3I59A 3WQ1A 2VQ0A 1AR92 4JRLA 1U12A 1AR91 3WHUA 3O0XA 3UKNA 2OA2A 2FHRA 2XHKA 4CP2A 1JW6A 5JZGC 2BTVC 1VBE2 4LEJA 1VBE1 4W6WA 1LTEA 1F9KA 1GFF2 4N43A 1RUD3 1B35C 2GC3A 4MXWB 3BOPA 1ZBA2 2B8MA 1O3TA 1ZBA1 3OTFA 4F3JA 4JGZB 5GLZA 2ERFA 5FLJA 2B7YA 1NXD1 4Y5Z0 2O0OA 1BYHA 1MZ5A 1Q8SA 5EYXA 1SLTA 5T3NA 1TME2 5AC93 4UBGA 1TME1 1PHMA 3CJXA 1YLLA 5BUVA 5I8TA 1EPWA 1RUE3 1XYOA 1UZYA 4YVWC 4CRQA 5J48A 5CFCC 1UU4A 4HBNA 3WCRA 1ND3B 2Z79A 4OHXA 2K9ZA 3ST7A 3HQXA 3M7AA 1R092 1N1YA 4YFWA 2VW2A 1R091 1ZRCA 1DGWX 3N7MA 1GR3A 1WCKA 2WNEA 2JG8A 4XFBA 2EVXA 1DYKA 5ABJB 4K1ZA 4E4DX 1SFNA 5FMOS 4CEYA 5DDJ2 2UYBA 1VR3A 4QQHA 4Y1UA 1MEC2 5DDJ1 1OOPC 3AJYA 2D6OX 1MEC1 4WZCA 3SNMA 4DINB 1W6NB 3JZVA 1JOJA 4JGYC 1XU1A 2GZWA 4XTPA 1OLQA 1XNBA 3U10A 4UW5A 3VKNA 3LAGA 2ZZJA 2XWBB 1YRZA 1S0BA 2XJUA 2ZOEB 4KWLA 1PK6C 2OW4A 4YGBA 4EV0A 3HMYA 3ZIXA 4P9YA 1XNKA 4ORFA 4RFT0 2AGSA 4D7YA 2BVBA 4JQRA 2KM2A 2XLGA 1C1FA 1J59A 1RVF2 4AVSA 1RVF1 4QM8