4YGDA

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
227
structure length
227
Chain Sequence
PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
total genus 56
structure length 227
sequence length 227
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ygdA00
1DLLA 4YW1A 1SCRA 1N47A 4Y22A 2TEPA 3WHUA 2EIGA 4YG0A 2AYHA 1IKQA 3UL2A 5GALA 5GZFA 1YIFA 1ULCA 1Q8OA 1N3QA 5DUUA 3A0NA 4M3CA 4FPKA 4AVSA 3AXEA 2WSVA 3FUQA 4FPFA 4Y26A 3V0AB 3I4IA 3T2TA 1G9FA 5CAZA 4GALA 4WV8A 4YZ2A 4FQZA 1PZ7A 1QOTA 4XXPA 3WUCA 3ZXFA 4Q1PA 4ZKTB 4K20A 2D6LX 1SLLA 4K1YA 1MS3A 1JYCA 2D6MA 3AYEA 1WCSA 4M01A 5GZDA 1OQ1A 3OBRA 5JOZA 1JYIA 3O0WA 2EAKA 2C9AA 5T55A 3V0BA 4LBKA 1SACA 3WHTA 2JKBA 4PBOA 3W58A 1D2SA 3M3CA 1HLCA 2W39A 4P14A 4Q1RA 2CY6A 1EPWA 2ENRA 1GICA 2VXRA 1W6QA 5T54A 1LEMA 3BTAA 2VH9A 4XJWA 4JC1A 1VIWB 1PZ9A 2VW0A 3LSDA 4FOQA 1MS0A 4ZXKA 1AX0A 5CNAA 2GMPA 1C57A 4Q8KA 2D43A 3V65A 5L73A 2R49A 4R9CA 2P3JA 5T5OA 4XYXA 2FHRA 3UJOA 2DVGA 1H30A 1V6LA 5DUWA 2V73A 3ATGA 3NV1A 1DZQA 5CB7A 1DQ6A 3IKWA 3AK0A 5T5LA 1IS6A 3OYWB 1RIRA 4FPLA 2R1BA 4GKXA 1GZWB 5DUXA 3OGGA 3D6EA 1J1TA 4DPNA 1A3KA 3LSEA 1S0DA 1UKGA 2BQPA 2B7YA 3O5SA 2ZKNA 1Z78A 2R16A 4AGVA 3SISA 2JD4A 5HCAA 2A3YA 3WG1A 1GLHA 3AZXA 4LBJA 3U4XA 2JE7A 2A6VA 2GNDA 4CTEA 1N1SA 2VW2A 1QU0A 1V00A 3M3OA 1QDOA 5T5PA 3B9CA 4XOGA 2ARBA 2ZHNA 5SV8A 2JJ6A 2DU1A 1S0JA 1KQRA 1G9BA 1AJOA 1U0AA 4XJZA 1W0OA 4NO4A 1ENSA 1GYKA 3AYCA 5GM0A 3WNXA 3M1HA 2G4IA 1SBEA 2C5DA 2Q5TA 2VW1A 3N3HA 4P9YA 4FPEA 3BIWE 1CN1A 5T5JA 1MS9A 1LENA 1ULFA 1LHVA 3SH5A 2D6OX 1JOJA 5IT6A 3MPPG 5DG1A 2CTVA 3PJQA 5EXOA 4GXLA 4C1XA 2ZGUA 5H9PA 3ILFA 1UAIA 4LBLA 3AP5A 2CWMA 4XTMA 3R4SA 4DRVA 1KDMA 1WW7A 1CPNA 2ZGLA 5FRAA 5GLVA 5JLVA 1UZYA 3MW3A 4PBPA 3IPVB 4CZSA 5KXEA 1CJPA 1FAYA 1JXNA 1RITA 1QDCA 3WCSA 1SFYA 3OY8A 1KDKA 3AJYA 5T50A 4XJ8A 1N1TA 1DBNA 1N3OA 3SLIA 2YROA 2ZACA 3UK9A 1GSLA 5GLZA 2YV8A 2P34A 1BQPA 1W6OA 3AZVA 4WZFA 1ULEA 3WDYA 2XG3A 4YW2A 1AX1A 2ZMLA 4I30A 2V5YA 4BMEA 1QOOA 2DVFA 4M3CE 4DS0A 2E53A 5DZEA 4GWNA 1IKPA 4YM3A 1HDKA 5IK8A 1AJKA 3JU9A 5EYYA 4FOVA 1O4ZA 1HKDA 3AZYA 5KXDA 1LEDA 1I1EA 1FATA 1LHNA 1MZ6A 4UW6A 4Y1YA 4Y1ZA 2DVDA 2VY0A 2AENA 4C1WA 2YY1A 2D3SA 2WT1A 3CNAA 4JCKA 1WUVA 1LULA 3RMXA 2NP0A 4Y22B 1V6NA 4XMAA 2NYYA 4LBMA 3IM0A 2YZ4A 1VAVA 2WJSA 3ZYRA 2DYCA 1GKBA 4GWMA 4OZXA 3GALA 2A3WA 1JBCA 1MVQA 4YFWA 4AGGA 1IS4A 2A6ZA 2A70A 3DGTA 1SBDA 1BKZA 1GV9A 2WKKA 1YXWA 5GZEA 2D6KA 4HL0A 1SCSA 1V6MA 1HQLA 3KQRA 4WVWA 3R05A 3UJQA 1QGLA 2PHWA 3LCPA 1YYNA 4P9WA 4K1ZA 3AJZA 4YZ5A 1CONA 3MW2A 3V0AA 1H9WA 1N3PA 5DZGA 3VKNA 1SBFA 4DQAA 4FQ4A 2DVBA 2AUYA 5JOYA 3USUB 3H0OA 5E88A 4BMBA 1AZDA 1N1YA 2OVUA 3AXDA 3NV4A 4ASMB 4BPZA 2DTWA 1W6PB 2R1DA 2NZ9A 1LOEA 2ZZJA 5DUVA 1B09A 1WW4A 4Y1XA 4U2AA 2D3RA 5H9QA 5IK5A 1NXD1 4BLIA 3HMYA 4FPCA 4XXAA 2EXIA 1UZZA 1WLDA 4PCRA 3POWA 3ZXJA 5JDBA 2VUAA 3B3QE 3ZSLA 1CR7A 4TZDA 2GN7A 1ULGA 4DFSA 2GN3A 3BODA 5JOWA 1VALA 1UX6A 2ES3A 3R4UA 3VKFC 3PVOA 3VKMA 2D3PA 4YZ1A 3ILNA 1GZCA 2ZAAA 2GMMA 4XJUA 3WUDA 3AZZA 3AP4A 1WBFA 1UN1A 5T52A 3ZXKA 3N7MA 1IOAA 2VU9A 3AP7A 4GKYA 1CPMA 2CL2A 2W68A 1W6NB 4YG3A 2P37A 4FVVA 3POYA 1Y7BA 2E6VA 3D4KA 1WW6A 3I8TA 2WLQA 1MS8A 2OUHA 2D44A 3NV3A 1UPSA 3POSA 3SNMA 3T1LA 1LHUA 1DQ4A 3MW4A 3OYWA 4W65A 4Y24A 3QLQA 4XZPA 5HCFA 1GZWA 1FX5A 3B69A 4CRQA 1LHOA 2HYKA 5E89A 2ZGNA 4AVTA 2I2SA 3FLRA 1QOSA 3RRDA 4ATEA 2AH2A 2E7QA 1X50A 3RQ0A 1WW5A 3WDWA 3WZ1A 4D69A 3MEPA 1LOGA 2EF6A 1OKQA 3WG4A 2WT2A 4UW5A 3HN1A 1RINA 1BXHA 5H9SA 1QNYA 3WG3A 3NWKA 1AF9A 4MYEA 4WVVA 2DTYA 1AXKA 2ZHMA 1NLSA 1QMJA 3O12A 3N36A 1BYHA 4IQPA 2GNTA 5LK5A 5GJ6A 1JHNA 4XBQA 3QCWA 1SLTA 4R9BA 4YW5A 1CVNA 1W6MA 2XB6C 2A6XA 3ZSJA 1DQ0A 1G8WA 1WD4A 4AWDA 3AP6A 1C4RA 2PHTA 5JVVA 2D7FA 1F5FA 1G9AA 2E51A 4L8QA 1LTEA 1JN2P 1AVBA 5GLTA 4ATFA 3OBTA 2PHUA 3AP9A 1LHWA 3ZXLA 4FPJA 4BOWA 2A5ZA 1LOAA 1PZ8A 3RS6A 2EXHA 3OJBA 3ZVXA 3FLPA 2EALA 2ZBJA 1APNA 3WVJA 4Y20B 5F9TA 3PVNA 1SLCA 3M3EA 4UW4A 3W59A 3ZSMA 1W6OB 3IPVA 2ERFA 1LU2A 1V6OA 1HQWA 2DUPA 4R9DA 3WV6A 2WQZC 1AXZA 4LBQD 2DUOA 4LBOA 1A78A 3WDTA 1LECA 2DV9A 1S0GA 3N7LA 1BZWA 1Q8QA 2ZA9A 2UWBA 5IUQA 3HR9A 2GNBA 2KM2A 1Z0HA 3WDVA 5KXBA 2P2KA 2ZHLA 1WLCA 4M3CF 2EXKA 4NOTA 5EYXA 3ZSKA 2P3IA 4LBQA 3VKLA 3M2MA 3PMEA 4PQ9A 3ASIA 4TYSA 3WDXA 4FOYA 2ZGPA 3ZXEA 4ISQA 2A6YA 1LESA 2D6NA 4M3CB 3AZWA 1VLNA 2ZABA 3O0XA 3FUOA 4FP3A 5IK7A 4DRRA 1GNHA 2FMDA 5BYNA 2A6WA 4YGCA 1QKQA 3A0KA 2H0BA 2W52A 1DQ1A 4FPYA 2CNAA 1XQNA 2CWSA 3APBA 2ZMKA 4XIOA 3WCRA 4KBBA 1DIWA 1LODA 2GDFA 4YLZA 4FPGA 3SH3A 1FV3A 1YRZA 5KXCA 4XBLA 2NM1A 3WDUA 1WLWA 1F9KA 4YGBA 5JOXA 2PHXA 1MACA 1I3HA 3V0BB 1LGBA 1LGCA 1MZ5A 5EWSA 5H9RA 1FYUA 2OW4A 3B00A 2E7TA 4JRAA 2AREA 3AYDA 4BM8A 2EXJA 1W6QB 2UWCA 3RMYA 1DQ2A 2UU8A 3M3QA 4AYUA 3V64A 1MS5A 4U36A 2YMZA 3KM5A 1S0FA 1LOFA 1G9CA 1CESA 2DUQA 1V6KA 3USUA 1YO8A 1UMZA 1URXA 1G7YA 5IK4A 4XJAA 2NN8A 2LALA 1KJLA 1QF3A 1LOBA 1W6PA 2DWRA 4Q2FA 4HANA 4BQ1A 1FNZA 2AGSA 2DU0A 4XDQA 5GZGA 4FPHA 4K21A 5GLUA 1C1FA 1LOFC 1S0CA 1Q56A 1ONAA 4YM1A 3D5OA 1DFQA 2A7AA 3TAYA 1AXYA 2GNMA 1F31A 1VAMA 3INAA 3TB0A 1ULDA 2ARXA 4Q27A 4XBNA 1DGLA 2ZGMA 1QNWA 2SBAA 4AVVA 2WNEA 4XHBA 1IS3A 2ZGTA 1SLIA 2JDZA 5DZFA 4M00A 4P9XA 4Y1UA 1BJQA 1S0EA 5HCBA 1G86A 4UW3A 3FLTA 1WBLA 2R0FA 1Q8VA 2DVAA 2PHRA 1C1LA 2R0HA 3ENRA 4R9AA 4YM2A 1W6NA 3VKOA 3B01A 1JW6A 2ZGSA 2A75A 3FBYA 3SITA 3WLUA 1KRIA 4Q26A 4YZ4A 5CBLA 3O0VA 3T1MA 4YGEA 4Y1VA 4GA9A 3ILRA 1LJ7A 2PHFA 2UWAA 3N35A 2SLIA 3IMNA 3A4UA 4YM0A 1TEIA 1N1VA 1DHKB 1LGNA 1GZ9A 1H9PA 2YXSA 2DURA 2JE9A 3JUUA 5GZCA 2JECA 2PELA 5GLWA 2ZGKA 5AVAA 3AFKA 2A71A 2ZGQA 2NMOA 4RL7A 1FNYA 1WD3A 2ZGRA 1DQ5A 4F83A 1ENRA 1W6MB 2ZHKA 5JMCA 1FV2A 1CQ9A 2WT0A 3C2UA 3Q9OA 3AYAA 3N7KA 5CA6A 2GMEA 2W08A 4RA0A 1D0HA 4PF5A 3WOGA 3VUOA 2D6PA 1IS5A 1SLAA 1DYPA 1V6JA 4FOWA 1GNZA 1ENQA 1V6IA 2A3XA 4XIKA 3BOPA 1S0IA 4YW3A 1JUIA 4YG6A 1ZA4A 3OY8B 1DYKA 2NMNA 2RHPA 4YGDA 4XMIA 1ZM1A 2GALA 1KITA 4XILA 5F5QA 5FREA 1W0PA 1LCLA 4H55A 5DG2A 4LBNA 1OFSA 1CIWA 1GANA 2AR6A 2ZMNA 2UURA 4ISRA 2OUJA 4ITCA 1AX2A 3WG2A 4YFZA 2P3KA 3SH4A 1Q8PA 1Q8SA 3IN9A 3GNEA 2CYFA 4XJ9A 1LOCA 4SLIA 2Z42A 1A8DA 3DUIA 1SLBA 4BLJA 1S0BA 3ZPYA 4Y20A 4FP2A 3VV1A 1MS1A 3N7JA 3PVEA 1KJRA 4XE9A 1S1AA 1MVEA 1LU1A 4YW4A 5DXDA 1O4YA 2WSUA 3AX4A 4LBQB 3RG0A 1UL9A 4Z8BA 3OPZA 2ZGOA 1YI7A 1MR5A 3FFZA 3NV2A 4Q8LA 4XHXA 3ZYPA 1G9DA 1R1ZA 5E8AA 1MS4A 4AGRA 2LTNA 4FPOB 3RSJA 4XTPA 1GBGA 4YZ3A 3L2YA
chains in the Genus database with same CATH superfamily
1JI6A 4KQ7A 1SCRA 3CF6E 2WYFA 1OC1A 4X6RB 4Y22A 1ND3B 2TEPA 5FYBA 1HRV2 1QJZA 2V09A 1IHMA 2EIGA 3N9PA 1D4M3 1WWYA 4SBVA 4Y33A 3UL2A 1YFYA 1OPMA 3NNMA 5GZFA 1DZTA 1Q8OA 2ZCWA 1O3RA 1KFXL 1E5SA 3E6DA 4AEJA 2G9ZA 2H6CA 1H8TB 3S30A 4UWDA 3FE5A 3I4IA 1G9FA 2IVIB 2K2SA 4XF0A 4QQOA 4QMAA 4XXPA 5CZKA 5FMBA 2OYZA 3ZXFA 2UY9A 5A7QA 4K20A 4JQTA 1ZZ8A 4O65A 1CGPA 1FOD3 1UU6A 2VZUA 2WR9A 1NKGA 3ACFA 4Y5Z0 1I5PA 1H2KA 1OQ1A 3OBRA 1JYIA 2B5HA 3O0WA 5DAXA 2WS93 4MV2A 4A7KA 4BK5A 3V0BA 5DAQA 3WHTA 4CDUB 2CV6A 1F2NA 1GP6A 4PBOA 2ZX3A 3H8OA 3MGUA 1HLCA 5FY8A 4YVWB 3U11A 4CXXA 2VXRA 1CAUB 3IDCB 4AE2A 3BTAA 3MFCA 2F4LA 1PZ9A 1XE0A 5B4NA 5F37A 4LHKA 5FPBA 4QPIB 1B35A 5FYIA 3ON7A 5HBAA 1XE8A 5CNAA 3IAQA 3JCIA 3V65A 4GULA 1JZ4A 2GAUA 3VBUB 3UJOA 1HRV1 4D0QA 1W2UA 4QKBA 2GP3A 4LUMA 2C1FA 3AMQA 2FDIA 3IKWA 5T5LA 1UZ0A 1WMDA 1RIRA 3NNLA 1BEV2 2VO5A 1GZWB 2BYVE 2J42A 1F4AA 3CHXA 5FYCA 5C8CC 2WZR3 1A3KA 2AACA 5L7OB 1UKGA 3VBFB 2VNGA 3O5SA 4B4RA 2GC1A 2KR2A 5JXGA 1X8MA 5A3WA 1Z78A 1SFNA 4AGVA 3PUIA 5HCAA 2A3YA 5CFDC 4AQ6A 2YC2A 3DEMA 3AZXA 3HPNA 5F5CA 5DPNA 1AR82 2A6VA 1CD3G 2RM22 1L3JA 3TWIA 5F2WA 3IBMA 2VMHA 2VW2A 3M3OA 1O8SA 3DV8A 3NMBA 5F3CA 5T5PA 5JWPA 3KZ4C 4IE0A 3JD72 1T6BX 4XF1A 4ZY9A 2EA7A 2VQUA 1WGPA 2XJTA 3PVBB 1AR71 2IXHA 4D8MA 2Y33A 3J7NA 1GYKA 5GM0A 3AYCA 1K5JA 4RS5B 3ZX7A 2RS32 4E4HA 3GZUC 1VBD3 3W21A 4WVMB 4QB2A 2QQKA 2JDAA 1CN1A 3AC0A 1NA1A 4IEOA 3SH5A 4IEUA 2D6OX 3J9SA 1O5LA 3TYJA 4QGLA 3LPGA 1JHJA 3PJQA 1R64A 1VB4A 1WCUA 2WO2A 2Y6GA 4NWWA 2ZGUA 5F3EA 4CDXC 3AP5A 3PTYA 3SC7X 4NHYA 2YGLA 1KDMA 4WM8B 3QD6A 1JTZX 1BEV1 2DCZA 2ORZA 5FBJA 4CUGA 1TMF2 1UZYA 5EPAA 4CZSA 5KXEA 2JIJA 2ATFA 1O3TA 3SXWA 3WCSA 1SFYA 3OY8A 1WMXA 5FO8B 3VLBB 4B1LA 1KDKA 2QUOA 4AFMA 4I01A 4DEQA 1DBNA 3S5AA 2RMU3 5J37A 1ND2C 1VBC2 3UK9A 3KVBA 2P34A 2RM21 1W8OA 2HYXA 3VD9A 3MBWA 1RVF2 2G1MA 4WZFA 4CSWA 4IEWA 4AQSA 1QOOA 2VUCA 5C8WA 5FJKA 1WMFA 3G7DA 3JD71 5IK8A 3JU9A 1YQCA 1C5IA 3OGRA 1UW8A 2UY8A 1HKDA 3AZYA 3O1TA 5DDJ2 5BNOA 1FATA 1QXPA 1R082 4UW6A 1R092 4S2HA 4Y1ZA 4QPWA 2VY0A 2AENA 1ZBE2 4AEDA 4C1WA 3GZAA 1AR61 2JG9C 3DYOA 5LA0A 3GGLA 2PAMA 2QTWB 4JCKA 1WUVA 3RMXA 3DN7A 3O1SA 1UZWA 2BU9A 1WA4A 4YWAA 1W28A 3W20A 2GC0A 5A32B 1GKBA 4MSVA 1UMHA 3VBHC 2OQ7A 5FWJA 2Q8OA 3LA7A 4QKNA 4W6XA 1FPN3 1CAXB 1SBDA 3I3DA 1ND3A 1RUD3 1FI2A 2W94A 1BVVA 1PVXA 4ES8A 1I6XA 4HVOA 5C5TA 3CDZB 1V6MA 1HQLA 2Y8KA 3NRUA 2PHWA 3LCPA 2O8QA 1H8TA 1VBC1 1ZYBA 3F2ZA 4R52A 1L7QA 2ZPXA 3LF7A 1H9WA 2P17A 5F5AA 4BHPA 1RVF1 2B46X 2AUYA 2DVBA 4QPGA 3H0OA 3ETPA 2UYAA 4AFDA 1O5UA 4IE7A 4I09A 4BMBA 1AZDA 4ASMB 2VZSA 5FY5A 4W6WA 4BK4A 4YARA 1COV3 4QM8A 1OVSA 3WR0A 1BMV2 4PI2A 2ZOEB 1U5IA 3B94A 5DUVA 1B09A 3MV01 4LNVA 1IGOA 1RYYA 1R081 2TUNA 2VCCA 4BLIA 4CYDA 4BQ2A 5FYUA 3MDPA 4XF9A 4LO8A 1ZBE1 4OQ9A 2L9LA 3A23A 3EJKA 3WW3A 2JENA 1CR7A 4XEZA 1ULGA 1KEXA 2BTVC 2ET7A 4DFSA 4LIVA 5FTTC 3LOBA 4XUPA 1CAUA 3SMHA 4AK3A 4JDOA 4ZU7A 2D3PA 4RQPB 1QJU1 2WWUA 2ETEA 4Q4W3 4P9JA 3HNMA 3DL3A 3PJYA 2F6BA 5FZDA 1W99A 3ZN4A 5FMOL 2WWSA 3N7MA 5AC91 4GKYA 3THDA 4COUA 5F7UA 2Y64A 2K9ZA 1GUIA 1QJX1 5L9VA 1F15A 3D4KA 3NV3A 4NWVA 2C4XA 2OUHA 3LDBA 2D44A 1Z7S2 3OUIA 5KWRA 5BUVA 2CU5A 1C8M2 1LHUA 2HWB2 3MW4A 3T1LA 4AHWA 1GZWA 2PYTA 1YFXA 2XWJB 4R4XA 5FK8A 2WZPP 2X5IB 4D94A 5E89A 5A7OA 4E8CA 3AL5A 5J48A 1CX1A 5CFCB 4ATEA 2AH2A 3RQ0A 1AL21 1WW5A 2R061 4Y5SA 1ZRCA 2ZAHA 3N9NA 2YGMA 1V70A 5CADA 1HV1A 3AMHA 2WT2A 4UW5A 5D8AC 4D6RA 1BXHA 2BPA2 1QNYA 2JICA 5CIRA 5JSOA 3WQ0A 4AVBA 2DTYA 1AXKA 2EIDA 3DPRC 1NLSA 5LRRA 1J3QA 1JYXA 1NCQC 1QMJA 1YCIA 4Z1VA 5LK5A 2ZJCA 4QX5A 1SLTA 3P5BA 3OCPA 1CIYA 4XFIA 1SFPA 4IEQA 3ZSJA 1DQ0A 1G8WA 4AWDA 4RS5A 1W04A 2JG8C 2P4EA 1V9U3 2VCMA 3VL8A 1XE7A 2D7FA 5FZ0A 1GZTA 2CDPA 2E51A 4HSLA 3RWKX 4L8QA 3NSTA 4DZGA 3VL9A 1LTEA 1PVC2 1AVBA 4D6QA 5FPXA 3W5NA 1XYPA 3CLPA 4HBNA 4GJZA 4JHTA 4RGKA 3H1YA 3I2OA 4N53C 4HZFA 1RHI2 4I3PA 3VN4A 3FLPA 1QH7A 2ZBJA 1PO13 2HLEA 2A1XA 1T6GC 2HWB1 2JIGA 4Y20B 4WM8A 3T4HB 2XJPA 5C3PA 2HEWF 3O1VA 3N9MA 1V6OA 2ZS6B 3KVAA 2DUPA 1VB2A 2HEVF 2DUOA 2YHJA 3WDTA 4BWOA 1LECA 2DV9A 4HN1A 4QB6A 1VE0A 2ZA9A 1EV13 3M3IA 5FY7A 1NUKA 1Z0HA 1BHGA 4CE8A 2P2KA 4M3CF 1NAEA 3EBRA 1T2XA 5GKAC 5CKQA 1A6CA 3ZSKA 5A1LA 1XJAA 1YJLA 4BIFA 1O8PA 4GJYA 3WDXA 4HVRA 1DDLA 3NNFA 1SQ4A 4YW6A 1FT9A 5ACA1 4M0NA 2B9VA 2I45A 2E9QA 4ISQA 4QQHA 2WNUC 4EJRA 1M4WA 5JUVA 1AL0G 4L92A 3LKJA 2BFUS 3LAGA 4NR1A 3PUHA 1IG0A 4M3CB 2ZABA 2V72A 3FUOA 5I8SA 5IK7A 1GNHA 2FMDA 4OQ8A 3HIFA 1KGYA 3KLSA 1QKQA 3A0KA 4HN0A 4JKKA 2H0BA 5C5UA 4DUXA 1DQ1A 4HKWA 4LPLA 2C0ZA 2HH9A 3APBA 4D7TA 4CA9A 3KF3A 4KBBA 2GDFA 2IWGB 1GU3A 4EN6B 5A32A 5JR2A 1RHI1 1YRZA 4RHV1 4NVPA 2NM1A 4XBLA 2PHXA 1VBA3 4LO6B 5JPMB 5C7GA 5A80A 4MADA 1CAXA 5H9RA 2DCJA 2JDHA 3S5QA 4KWJA 3S0MA 2OW4A 5IHRA 3JQXA 2E7TA 4JRAA 5BNNC 1XNDA 5FP8A 2AREA 5FPZA 5FUIA 2EXJA 3E5XA 3KD4A 3IZOA 4IE5A 4AYUA 2CAVA 1WKYA 3J8F3 1VBB2 2ZEXA 1Y43B 3PUAA 3K46A 3EXUA 2XBO2 1RUH3 3D82A 4LLOA 1G6NA 1W2AX 2NN8A 4CP1A 2LALA 2CGPA 4BIOA 1QF3A 4PLNA 2DWRA 3PHMA 5A33A 2X05A 4CCDA 2JDMA 3U0ZA 4HANA 4BQ1A 1D7PM 4XDQA 1HXS1 1OVPA 3MIBA 4A2UA 3OPTA 3RZHA 4K21A 5A3NA 1AYM3 5FUPA 4IERA 4V1PA 4GH4C 1PK6B 4P9GA 4PHZA 1TNFA 4ZU5A 4DXRA 4DUWA 3RZKA 2HWC1 4XBNA 5CG9A 1RUJ3 1TME2 1C3HA 1QNWA 2SBAA 3HVDA 4QM9A 4WBBA 5D8AA 4YVSB 1ZBA3 5FXVA 3WQBA 1YFUA 4BZ4A 3VBRB 4OHZA 4COWA 5EHDA 4A4AA 2XLAA 3MUZ1 4IESA 1ZZ6A 4D6SA 1CAVB 4Y1UA 3VBOB 4URAA 4OLLA 1NOVA 4X8NA 5FOJB 1UWWA 1ST8A 3ENRA 4IW3A 4NRMA 4R9AA 3MV11 2VQAA 1OUXA 4AVAA 1CZTA 1YUDA 3POBA 2VECA 1E5RA 3QH6A 5FKBA 3O0VA 3RNSA 3T1MA 1JUHA 4YGEA 4GA9A 4ZU4A 5A70A 4ZS3A 1LJ7A 4G9SB 3VZJA 5EJ3A 4GIQA 4KNCA 3IMNA 4KL1A 1VBB1 4G4FA 2X5IA 1NX9A 5CEHA 5CFCA 2DF7A 1H9PA 2YXSA 2XBO1 1XBFA 3UNPA 2E63A 4N9HA 4NHXA 1YLLA 4E8DA 5C9AC 4UT5A 1J1LA 2NMOA 2ZX0A 2JDYA 4HFSA 2BERA 2ZGRA 3MLJA 4F83A 2ZHKA 1W6MB 5JMCA 2XXZA 3C2UA 2ZX4A 4AI1A 4XCBA 4RA0A 2D6PA 1BBT1 4S2FA 1IS5A 5BXXA 5JPNB 1V6JA 4FOWA 1V6IA 5LB6A 5FP4A 3BGAA 1S0IA 4D3WA 4YG6A 3MIGA 1ZA4A 4XZUG 3QOPA 1KS4A 2VE1A 1TME1 2NQYA 2RHPA 4CDQB 1RUE1 1US3A 3C7OA 2GH2A 5F32A 2MEV3 4TLFA 5J7MA 1KITA 3Q8EA 3ETQA 1W0PA 3J7LA 4ASLA 2FZ2A 4IE4A 4H55A 1ZREA 1EP0A 1KS5A 2AR6A 3PU3A 1OH4A 2UURA 4ISRA 5EJZB 3THTA 3U4SA 3WW1A 5JZGA 5LCWL 1YQ8A 4QX0A 1D4M2 5I0UA 3AFGA 1SDWA 4IEXA 4S2DA 4UFHA 2CYFA 4K6BA 1LOCA 1W8HA 2VVEA 3DUIA 4KU7A 1SLBA 3DF0A 2QQNA 4Q0UA 1O7FA 1UYYA 2TBVA 4Y20A 4B4QA 1MS1A 3PVEA 4FFIA 2EIBA 4IGQA 3GZTB 1DF0A 5A3OA 4IV3C 1MVEA 1H1AA 3URFA 1S55A 4IEVA 4YW4A 4NIDA 1O4YA 3ZSEA 4LBQB 3U07A 4Z8BA 2VL4A 5HPOA 3GHNA 2ZGOA 5FYHA 2WIIB 3VZMA 2E7AA 2IVJA 2P6CA 3E5UA 1YI7A 2AC1A 2ZKLA 1RUI1 3FFZA 2MPFA 3OPWA 4MGQA 4XPVA 4XHXA 1V0AA 5FMCA 1GP4A 4FPOB 1GBGA 2VUDA 3L2YA 3WNMA 1RJ8A 2VPVA 2WS92 4YW1A 1XNBA 1JYNA 5A6YA 1H6YA 4YG0A 3VZOA 5JSPA 2AYHA 1IKQA 5GALA 1SHWB 5DUUA 3A0NA 5FZKA 3JBG3 1PO21 4M3CA 5FZ7A 3HT1A 4AVSA 3AXEA 4FPFA 5KHGA 1ZZCA 2PN5A 1XSRA 4GALA 3ZFGB 3RFRA 4YZ2A 3NJXA 4FQZA 1PZ7A 1X7NA 5JR7B 2FZ1A 4OHVA 4CUBA 1AR93 2RS13 1D4M1 1RUC3 3AKSA 4LKFA 4LR4A 3BYWA 4K1YA 1MS3A 1JYCA 2D6MA 3AYEA 2WNVA 4H7LA 2FBEA 3N9QA 5I8YA 3FC0A 1SACA 2E31A 3WNNA 5BY5A 5IVCA 4LKEA 3W58A 3M3CA 2VC9A 1EPWA 1GICA 4O9GA 5L9BA 1HJGA 1XOYA 5K7PA 1FOD1 1OBNA 3HQUA 3LSDA 4FOQA 4QQ2A 2VZRA 4AHYA 4ZXKA 1NCRC 2GMPA 4LXLA 2WO3A 2WS91 3MUY1 2D43A 5C3SA 2R49A 4QAWA 3H8XA 2RDNA 4IV1B 2DCTA 4RR3B 2DVGA 1QXJA 1V6LA 5FZOB 5J3UA 2XHKA 4QKFA 5BNQA 1DZQA 1NY72 4EZ4A 3AK0A 5EIYB 4ARXA 1OF4A 1W06A 4KU8A 1B35C 1VBD2 1VRH3 4AI0A 1J59A 2R1BA 4Q5OA 3GHMA 5DUXA 3OGGA 2OIIA 4DPNA 2QBXA 1W8UA 5FZ8A 2BQPA 2B7YA 5B4XA 1CX4A 2X53S 2ZKNA 4I0BA 2BNOA 4LUKA 4ZONA 2JD4A 1ENXA 3IWZA 4JAAA 4YVSA 5FLJA 1QXRA 3U4XA 2W9XA 2JE7A 3CZJA 2GNDA 3CKHA 4N7IA 1I9RA 1N1SA 1CAVA 1LKNA 3VBOA 3PMSA 2WZR1 2YUEA 2OXBA 2OKXA 4BU2A 3K4DA 4F3JA 2ZHNA 3SEPA 2GU9A 5SV8A 2DU1A 3GBFA 4QPYA 2XGXA 5F6KA 1AJOA 2GH8A 3K3NA 3ZN6A 3J7HA 4XJZA 1PGL1 2HWF3 2CAUA 4RFT0 2G4IA 3VDDB 1SBEA 3CBNA 1TQ5A 2VW1A 4Q4X3 1IQDC 3IDBB 3K51A 4FFHA 5T5JA 1S2EA 1MS9A 4NHMA 3WQ1A 2YC0A 1LENA 4CUAA 5KR7A 1LHVA 4BQYA 2FCUA 4AZZA 4DY5A 3MHZA 5IT6A 3PNAA 4CCKA 3MPPG 5FZ9A 5M0TA 3C8XA 4EWEA 5EXOA 1GR3A 1W8NA 2Y0OA 4C1XA 1NY71 1UAIA 2PHDA 2CWMA 1XPWA 3R4SA 2C9KA 3BIEA 4FO9A 3ACLA 1VBD1 1GOGA 2ZGLA 1W8FA 4RSUA 4DNYA 5GLVA 2VGDA 2XJQA 5JLVA 2W46A 4PBPA 4BB3A 3P3PA 3J7MA 1FAYA 1NA1C 3UGHA 2O14A 3ES4A 1RUI3 3PDQA 2BJSA 4O9EA 4XC9A 1MQTA 3EMRA 4AFAA 2QQWA 3THPA 3CU7A 4CDQA 4XJ8A 1N1TA 1POV3 3T3YA 4A3XA 2YROA 5IVYA 4UFMA 2D98A 3GXUA 4GMP0 4OHYA 3ALQA 2WFF3 2YV8A 4CEWB 5A7PA 1BQPA 1W6OA 5A6ZA 5DMYA 1FPN2 1DU3D 2RR11 4YW2A 4YSFA 4I30A 4BMEA 2DVFA 3AKTA 2ET1A 2E53A 5DZEA 1IKPA 1HV0A 4NIHA 3THCA 1PMJX 1C28A 1ZRRA 1US2A 2D5FA 5FZEA 4CEYB 5KXDA 1LEDA 1I1EA 1LHNA 2RMU1 4Y1YA 1PX4A 4MZUA 3L2HA 4QHZA 3SKVA 2DVDA 1M06G 1JH5A 3PU8A 4XFFA 3WF4A 2YY1A 3GJBA 5A6QA 3K77A 3FL7A 2VCBA 5K0UB 2Q4SA 3HNYM 3KB5A 2DCKA 1VAVA 2WJSA 2YZ4A 3K4ZA 2DYCA 4PDWB 5I8TA 4EWAA 5BNOC 4OZXA 5FPLA 1OMIA 5FYYA 3HBZA 5KHHA 2XJSA 4WM7B 4YFWA 4AEDC 4AGGA 5BV6A 3MI8A 4XUTA 2B39A 2A70A 3DGTA 3L9JT 5C4WA 1YXWA 4HLTA 4HL0A 3KQRA 4B7EA 4UFLA 3R05A 5FPUA 4KGQA 3X29B 3KV4A 4P9WA 4K1ZA 4LO4B 1NCRA 3WD5A 1N3PA 2XLGA 1P8JA 1SBFA 1G9BA 2W92A 5ERLA 3VZLA 1FPN1 3ZFGA 3ZLIA 1ND3C 5E88A 2IXCA 5FO7B 4KWLA 5EJ1B 4HSJA 5A3UA 1RUD1 1AR72 3K3OA 4F7ZA 1TVGA 2R1DA 2RJKA 3RZLA 2BVBA 3BUCA 5CYYA 4P08A 4JQRA 4BDVB 1WW4A 1MZEA 1H8TC 3WNPA 4FPCA 1RXFA 4XXAA 2QQIA 1Y3TA 1WLDA 2WQ4A 4PCRA 3POWA 3VDAA 3ZXJA 4BH9A 4QPGC 4ET7A 3ZSLA 4TZDA 2GN7A 2CSGA 3POIA 2BZDA 2VOWA 2JDPA 1COV1 3R4UA 2BWCA 1QH6A 3PVOA 1WA6X 3UETA 4YZ1A 5CFDB 4QGMA 2EVXA 1ACCA 2ZAAA 5FP7A 3AZZA 2VVDA 4ZPIA 4QD2A 1WBFA 1UKRA 3J4UH 2D40A 4EQVA 1IOAA 4IV1A 4ASKA 1NT0A 1CPMA 1W6NB 5T3NA 3POGA 3BI3A 4AEKA 1YI9A 3POYA 1Y7BA 1UIJA 2E6VA 2P1BA 3E6BA 3POSA 1JOPA 1MS8A 2WLQA 5FYMA 1J3RA 4Q4Y3 4QPIC 1DQ4A 1V9U2 2HBUA 2J22A 4L2NA 4Q4W1 3QLQA 2VXJA 3O14A 4N43B 2P3YA 1PNGA 3B69A 4YNIA 1UY3A 3PTRB 4A7YA 1H2MA 4CDWB 1XNTA 2ZGNA 5FY4A 2VUJA 1CZVA 3LWCA 1X50A 2E26A 3OSDA 5LZ6A 1LOGA 4FFGA 1OFNA 2QQLA 5K4LA 2R043 1DP0A 1OKQA 3R4DB 5CU1A 3OF1A 3WG4A 1W9SA 3RWNA 3HN1A 1PO12 3T0AA 1RINA 4I0AA 5H9SA 3P3NA 5A3LA 1AR62 1OLME 2J1TA 5F5IA 3POEA 2I74A 2OA2A 5TSWA 5FY0A 1W9WA 3ME2A 5LEJA 2QVSB 2ZHMA 1H8VA 4LHSA 4IQPA 4WVZA 4L97A 4PF1A 3T08A 1JHNA 5C3RA 4R9BA 3ITQA 4YW5A 5C33A 2R071 2WRAA 2GP5A 3C7HA 4OUSA 3VDDA 1K12A 4UFIA 3LPFA 2RR13 1S2KA 5JVVA 1F5FA 5IAVA 3FMGA 4UYBA 4KMQA 4XACA 4QQLA 1OKOA 3KS7A 3MZHA 1LHWA 2XVKA 4KH9A 4BOWA 2A5ZA 4CVUA 1LOAA 1PZ8A 2QQVA 3OOXA 4RS5C 2ADEA 4H3WA 4TLGA 3ZVXA 5JAXA 1APNA 1VMHA 2LROA 1RUG3 3JXSA 1OQEA 1V9U1 4LE3A 4NRPA 2QNKA 3PVNA 4BYYA 3U1XA 4NHKA 3ZSMA 1W03A 5SV5A 2ERFA 5JI9A 1JYTA 3TOJA 1JZ5A 4CCMA 2WQZC 1EUTA 4LBQD 4AXOA 2VOKA 4TSVA 1BZWA 1FMD3 1K5MB 2KM2A 1PO11 1NG0A 1EAH3 3WDVA 4WM8C 3H8RA 3C3VA 1WLCA 3IDAA 2H6BA 2AEYA 2GC3A 3GJAA 4BE3A 3H50A 5F6LB 1YWKA 2D93A 3LDKA 1XYNA 2Y6HA 4LT5A 4PQ9A 3PMEA 1YNAA 3ASIA 3AVSA 3PLQA 2B4KA 1UYPA 2C26A 4MHRA 4AQ2A 1QJU2 2XOMA 3P1IA 5FP9A 2A6YA 1WCDJ 4M0HA 1UYXA 1EV11 3ST7A 2GC2A 3AZWA 1VLNA 2PXJA 2W5FA 3J8F2 3O0XA 5FZHA 4OI1A 2ZEWA 3O1RA 2ARCA 5BYNA 4AG4A 5AC92 1W2NA 2W52A 4KI5M 2W91A 2BBAA 1RUH2 5FZ3A 4ZZ5A 5JMOA 3A22A 2W1WA 1QJX2 1OLQA 2CWSA 4XAEA 2ZMKA 4XIOA 4PDWA 5I0SA 1DIWA 1X9TA 4YLZA 3NAPB 5KXCA 1OH3A 2VMEA 1ZRIA 4EZHA 3KHCA 3U78A 4WM7A 1AYM2 4MGSA 5ANNA 4NIAA 2WL1A 2JDKA 1AL22 1LGBA 1MZ5A 1SG3A 2R062 4OYUA 4XABA 2MNGA 5EWSA 4BQ4A 2BOIA 4JDMA 2ZX1A 3AYDA 3OD4A 4LKSA 3R6SA 4BM8A 1RUJ2 1W6QB 2UWCA 3ZYHA 2F4PA 4LIUA 3RMYA 1DQ2A 1HB3A 1ZBA2 3I59B 4NJ4A 4Q0PA 5A7SA 4TTGA 3FZ3A 3HOBA 2Q8CA 3WNOA 4CDUA 2YMZA 1VBA1 1S0FA 2Z69A 1Q43A 2I07B 1LOFA 3LA3A 1CESA 2DUQA 3T09A 4UFJA 4YVWA 5JSRA 5IK4A 4PIYA 2BUKA 5FMOS 4A42A 3ZR6A 2W1QA 3U14A 4RYDA 3I2JA 1S4CA 3EB7A 4QPIA 2AGSA 4FCAA 4UBGA 3W9AA 3SCHA 2Y0IA 4FPHA 5ABJB 4NIGA 2WDBA 3J8F1 2QCSB 5IW0A 3CEWA 1S0CA 1F5JA 1Q56A 3HEIA 4HT1T 4YM1A 3D5OA 3VBUA 2A7AA 2ZTNA 1RUH1 2W47A 3VZKA 3INAA 4NPMA 5FYVA 1OQDA 2ORXA 1QJFA 2HKXA 2BGPA 4P5YA 2VVFA 1ZVFA 3VD4A 3CJIB 2FDGA 1UQXA 1SLIA 2LRPA 1PX3A 1HX6A 3GZEA 5DZFA 1AYM1 4P9XA 3VBFA 1BJQA 2VMGA 1S0EA 4KBZA 4EYUA 1IQAA 4HMZA 4UW3A 3FLTA 5FZ4A 1WBLA 2R0FA 1JZ8A 1Q8VA 2PHRA 3V56A 2BGOA 1UZVA 2EICA 2R073 1W6NA 3VKOA 3B01A 4MGKE 2ZGSA 1RUJ1 3SITA 5IVJA 4FSJA 5CBLA 4XF3A 1PMIA 5LA2A 4Y1VA 1GOHA 1ZBA1 3ILRA 4QQPA 3N35A 1REFA 3I3MA 2SLIA 4XW3A 2GSYA 4OHXA 4N43A 2FQPA 2HWE3 1RB8G 3DKQA 4RD7A 1TEIA 4ONUA 4CDWA 3LFIA 1DHKB 1LGNA 5J09A 5IFPA 1GZ9A 2YB7A 5A3MA 5ACA2 3DXUA 2JECA 5GLWA 5LATA 4HKLA 4G3YC 3AFKA 2ZGQA 4RL7A 1FNYA 2XKPA 1WD3A 2XONA 2VBBA 4Z2AA 4UF0B 1CQ9A 4WVMA 4N53B 2G9GA 1IPJA 3AYAA 3N4MA 2XUMA 1IPKA 1W90A 3OBZA 3I2HA 3WNLA 2X5IC 4PF5A 4RGGA 3ZXAC 3IAPA 2Z2SB 4YM3A 1SLAA 5CFCC 4XIKA 1GOFA 4OMCA 2A3XA 4YW3A 1DYKA 3FBMA 4RHV2 4YGDA 1ODNA 2ZXQA 4YRDA 1OHFA 3RYKA 5F3GA 5LW9A 4XMIA 1JZ3A 1ZM1A 5FREA 5F5QA 5G04L 3UKVA 1AR83 4I3GA 1LCLA 3UV9A 4HONA 5DG2A 4IEYA 4FTBA 2Y60A 2JX9A 1GANA 4OULA 2ZMNA 2WBKA 4Y5TA 2XJVA 3K4AA 4EN0A 2DFBA 3SCFA 5FLHA 3LOIA 2E32A 2P3KA 4UAPA 3BTYA 1Q8PA 4XVHA 3HNBM 2B8MA 4K8FA 3KF5A 1W8WA 4SLIA 5BNPB 3MYXA 3S57A 1HN1A 2MEV1 2W2IA 4FP2A 3N7JA 3IIIA 1KJRA 2RS33 4XE9A 2Q8DA 2TNFA 1S1AA 1W2OA 2X29A 2YFUA 3KV9A 4LJHA 3TN93 5JZGC 3SHRA 5DXDA 4BXFA 3KMHA 2WSUA 3GBWA 4QX3A 3C7FA 1RUC2 2PLV3 2PQSA 1HXS2 3ZYPA 4FXGB 1K5MA 3WP6A 2BNNA 5E8AA 4CP9B 4AGRA 2LTNA 2MHFA 3FHQA 3RSJA 1EYBA 2WQ8A 2YG0A 4XETA 2DBIA 3KV6A 2WUHA 4LBNA 1DLLA 1RUNA 2KXLA 2WA3A 1X36A 1VRBA 1PM7A 4KWKA 2HWC2 1N47A 1TMF3 3H8UA 3E97A 3VHRA 2JWPA 3WHUA 1TG7A 5FDBA 1UX7A 3RJ2X 5BNNB 3VBSB 2IUWA 1YIFA 2QZ3A 1ULCA 3M7AA 5FZBA 3RYRA 1HW5A 2FMYA 4R8HA 3V0AB 3O1UA 3TNQA 5CAZA 4UXAA 3WSOA 2Y6KA 4WV8A 1CWPA 4A41A 1OOPB 3AL6A 4Q1PA 1UY4A 3LEGA 1W9FA 1SLLA 3E6CC 4IE6A 4PI0A 2AEZA 3BVCA 3RZGA 4M4PA 1W2TA 4LA2A 4M01A 1JS9A 1GWLA 1ODMA 1VRH2 2RJLA 3JBG1 5DDJ3 2KA3A 1J83A 2EAKA 2C9AA 2IXJA 4ZS2A 2BNMA 5T55A 1R093 4XF4A 3B9IA 4Q4V3 2G9FA 4TN7A 2VMIA 2JKBA 4LA3A 4AHXA 2W39A 5IJRA 3HQXA 3JB8A 2ENRA 1AR91 2RS11 1RUC1 1W6QA 5KC6A 1LB2A 4NIIA 2VH9A 3OEBA 3I59A 2VW0A 3HD8B 1MEC3 3CQOA 1QQP3 5A3PA 2WNVC 1NZIA 2BP6A 2OPWA 1BBT2 4PIZA 4Q8KA 3O7OA 1K3IA 5L73A 3I7DA 2O8OA 5FJHA 3QH7A 4XYXA 2FHRA 2J1RA 5T5OA 1UU4A 4EROA 1OSGA 1RUE2 5DUWA 4RQPA 5CB7A 4Z92B 1DQ6A 1RJ7A 4JGZB 3BN6A 5FXZA 3ZYJB 3OYWB 1ZNPA 5ABJA 4GKXA 4Q4X2 4CUCA 3D6EA 1QHDA 1S0DA 3TNPB 4AFBA 3D8CA 2J1UA 4E9KA 3SISA 1QWRA 2XUEA 1AYN3 3MLLA 3WG1A 1GLHA 2O1QA 1NLQA 4LBJA 5C9AB 2WO7A 3NQHA 2W87A 2XJUA 3CJIA 4BJ0A 1VRH1 1W05A 3WF2A 4CTEA 4K3UA 2WLPA 4MUVA 1QU0A 1ULPA 1QDOA 1ZZBA 4FTEA 2HBTA 4HVQA 3H9AA 1RMU3 3B9CA 4XOGA 2ARBA 4XFBA 3KV5A 1RUI2 2JJ6A 3VDBA 1S0JA 1KQRA 4BQXA 2WWJA 2LW8A 5HI0A 4YVSC 4NO4A 4QXBA 3BKZA 2W3JA 3HBKA 3VBRC 4DXSA 2VOXA 4AI8A 4DXZA 2C5DA 2WFF2 3LEIA 4URTA 3N3HA 4P9YA 5FPAA 4FPEA 3ZM8A 1QIQA 1O6UA 3VBOC 3LQCA 2Q8EA 3K75B 4CPBD 1JOBA 1HB4A 4CU9A 1C5HA 4Z82A 1ULFA 1QEXA 3ZYGA 2HJIA 2X10A 2BW8A 4BCUA 1K42A 1PO22 5DABA 4GXLA 4ORFA 4UF0A 3NVCA 2HWF1 3D0SA 4XTMA 3EYPA 4NE9A 3ACHA 1UYZA 1W9YA 1Z7S3 1CJDA 4L11A 4DRVA 1C8M3 1ULOA 1TNRA 4Q4X1 3MW3A 3IPVB 2VBPA 1ASJ3 2K0GA 2RV9A 1JXNA 5GZDA 3NO8A 2VCAA 3H3ZA 4JV4A 5T50A 1N3OA 2ZACA 4KWUA 5GLZA 4IDZA 2ZZQA 2FDKA 3AZVA 1STMA 1HRI1 3OB8A 2ZMLA 2W95A 2V5YA 3LGRA 4PQQA 2JDNA 4GWNA 1I5ZA 1HDKA 2ADDA 1AJKA 3Q8FA 1MQTC 3WT3A 2Q30A 1FOD2 3I3BA 4CDQC 1RC6A 3WXPA 2WAOA 1POV1 5BNPA 4AW7A 4NPRA 1DGWX 3OEAA 3ZN5A 2WFF1 1YQ5A 2ZEYA 3ZMNA 2WA4A 3RZJA 4GWIA 1X33A 2RVAA 3ES1A 1PVC3 5JIUA 2XPJA 4Y22B 4XMAA 2J1VA 2NYYA 4LBMA 3IM0A 4Q0VA 1YIPA 5F2SA 3ZYRA 4RGAA 4CP9A 1WLTA 4GWMA 2IFRA 3GALA 5CG8A 5IFTA 1JBCA 1MVQA 2RS53 4DIQA 3WF0A 4Q0SA 1BKZA 2EIEA 1IG3A 1WMEA 5GZEA 2QJVA 4CCLA 3N9OA 3RJRA 3DKWA 1PIV3 3VBSA 2NLRA 1U5XA 1Y4WA 3I2KA 1HIXA 1O91A 5FKCA 3UJQA 2QZ2A 4OI4A 2FCVA 3AJZA 4LOSA 1NQJA 2WZR2 5JCTA 3V0AA 3VD7A 2N7GA 3MFAA 3MF6A 1JU3A 2OQ6A 5C4WC 3OUHA 1H1IA 3NJYA 1N1YA 2OVUA 1OOPA 3AXDA 3NV4A 4J1XA 4BPZA 1PGL2 3AKPA 3M4FA 4QDRA 2NZ9A 2ZZJA 4H14A 4Y1XA 3E1F1 1NXD1 2EXIA 4BQ3A 2VZVA 5FZLA 1UZZA 4A6OA 2VTXJ 4MO3M 1B35B 3MIHA 3MF9A 5DAVA 5JDBA 3ZFGC 4META 5A1FA 2PA7A 3O1OA 2XWBB 2BRTA 3KHBA 2Q1FA 4KG0A 2GN3A 2RDQA 3BODA 4QX1A 4CP0A 5JOWA 2ES3A 1RUF3 5FV3A 3ZXGA 2V4AA 4XUNA 3BTZA 4OUEA 2KD7A 2GMMA 4XJUA 3WUDA 1UMIA 4L99A 2DFCA 1XB9A 1DYOA 1PK6A 2R7EB 4QHOA 4Z2WA 2WN2A 3Q8CA 5T52A 3CZUA 3ZXKA 4C0HA 5AVPA 2VU9A 3AP7A 2QE3A 2WZ8A 2B42B 1ZRFA 1NYWA 1R1A3 3S6PA 2CL2A 2VNVA 2W68A 3LD8A 4I2OA 4FVVA 4I0WB 3VDCA 1OA4A 2VMCA 3KGZA 1OUSA 3VBRA 3I8TA 4K8RB 1VBE3 1UPSA 4JGZA 5CVRA 2VZQA 5FWEA 1Y9MA 3OYWA 3ZFFB 4AEMA 2RR12 3AB0A 4W65A 4XZPA 2VM9A 5FZFA 1DGRA 4DOUA 4L9BA 4CRQA 1LHOA 3T2OA 3RRDA 4IV1C 4OI2A 3WDWA 3AM2A 3MEPA 3M70A 4RR3C 4D69A 4JGYB 2VTFA 2EF6A 3LEMA 4J1WA 4TXWA 2RMU2 2Y34A 5L36A 3IIAA 1FXZA 1RUG2 2IFWA 4Q4Y1 2DCYA 3NWKA 5HXVA 3WG3A 4ARYA 3NNGA 2QQPA 1AF9A 3H7YA 2BWAA 4LHLA 4P9LA 3WX5A 3O12A 1KFUL 3N36A 2GNTA 3BU7A 3POJA 3QCWA 3ZFEB 3H7JA 1GNYA 1CVNA 1UY1A 1W6MA 2R041 1FMD2 1WD4A 1ALYA 2IXLA 1U12A 3H1MA 3T0BA 2PHTA 2VTXA 1HRI3 4JDNA 1TZOA 3KSCA 1G9AA 1YQ6A 1ZA7A 1GQHA 4CP2A 4BXSV 4AQTA 5GLTA 4XDPA 2DDUA 4ATFA 3OBTA 1E57A 2PHUA 5LY1A 1HB2A 2OZJA 3AP9A 3ZXLA 3AKQA 4FPJA 3ECQA 3LE0A 3MPBA 1UCXA 4J25A 5EQUA 3TEXA 4PLMA 3OJBA 3VDDC 2EALA 3H1WA 5F3IA 1A34A 4AOCA 4HXCA 1JU4A 5EV7A 3UT0A 3H3UA 4QT6A 3DYPA 3ZYIB 5LRSA 3M3EA 4UW4A 2XQXA 4EN9B 2BGCA 3IPVA 1RUD2 2YBKA 1LU2A 3B02A 1HQWA 3ZKUA 4R9DA 4XUQA 3I54A 4TWTA 1BLZA 2CGOA 1S0GA 3N7LA 4E27A 1YHFA 3VHPA 4XFAA 2UWBA 3OBAA 3MO4A 2BEOA 4COVA 1RUG1 2GZWA 5KXBA 3RYPA 5IATA 3I2GA 5LA1A 2P3IA 1U5ZA 2IXIA 4LBQA 1O4TA 2F17A 4QX2A 3HQRA 2OT7A 3RZZA 3M2MA 1COV2 1OD3A 3AMPA 4TYSA 3VKLA 3ELNA 4FOYA 4QXCA 5E1RA 2ZGPA 4XFHA 3WNKA 4EN7B 3BU0A 2VNOA 5E16A 4GB33 4V2WA 3I97A 1FMD1 3HN3A 1LESA 4UI9L 2D6NA 5IVVA 2JKXA 3O1PA 1EAH1 1S2BA 2A6WA 5FZ6A 4HK8A 5J96B 1U5YA 4Q29A 3LFMA 5FCCA 4B3NA 2VOTA 4CEYC 4O61A 3FJSA 2QFEA 1LODA 4FTSA 2ILMA 1DZRA 4FPGA 4Q4W2 4FFFA 4Y4YA 2OS2A 3CO2A 4GMP3 3WDUA 4HOOA 1XRUA 2XJRA 3ZO0B 3T0DA 1LGCA 1LRHA 5K0UC 1OI6A 4QPGB 3ZYFA 2Y6LA 4M4RA 3ZOIA 2HWD3 2YDEA 4PDWC 3VGIA 4XAAA 1QJY3 2QDNA 3IMMA 2UU8A 1E5IA 4MGYE 5FXWA 4WM7C 5FYTA 4U36A 3FX3A 3KM5A 4AI3A 3B93A 3BPSA 5C8CB 1PGW1 2G19A 3NL1A 1V6KA 5I0RA 1UXXX 1YO8A 1UMZA 3SCGA 3KT7A 4BQWA 1HJFA 2R072 5KHJA 1KJLA 1LOBA 4LHNA 4Q2FA 5FZMA 5FFOC 2VNRA 3KT1A 4PT6A 2VZ1A 5KHKA 3DCQA 5IVBA 2HWE2 4CDUC 5GLUA 1PNFA 1W3XA 1F4HA 1LOFC 3I2IA 1ONAA 1DFQA 1RGSA 4YVWC 3USSA 3VB9A 5FQ0B 4RR3A 1AXYA 2GNMA 4RN5A 5FZOA 1ULDA 2ARXA 4Q27A 4QX8A 5FIXA 1DGLA 1XU2A 2ZGMA 3U75A 3U10A 1IPSA 2BV4A 1OA3A 1TE1B 2BBVA 4XHBA 1IS3A 1BK0A 1H1MA 1NE4A 4C8DA 4OZOA 3UKNA 2PHLA 3I2DA 3VBUC 4AF9A 2BDRA 5HCBA 4YYOA 5FOBB 2PQQA 1X8EA 4XFCA 3UESA 3T2QA 1JW6A 2PAKA 2A75A 1DGWA 3WLUA 5FR3A 4Q26A 1C8NA 2C6SA 3BB6A 5FMDA 1JODA 2PHFA 2UWAA 4CDXB 2WFPA 3ZFFA 5CISA 1O3SA 4YM0A 2EAAA 5A7NA 5L7OC 3VBFC 1A8MA 5F39A 3SQOA 4B29A 1GFF2 1Q3EA 1XSQA 2RDSA 4LQRA 2PTMA 2ZGKA 4JGYA 5AVAA 5IVFA 1EV12 1OLRA 1YQ2A 2WC2A 4KGGA 1DQ5A 2XMLA 1ENRA 3NNJA 5FZ1A 3ROUA 5J1XA 4JRLA 3T2PA 1ND2B 4N43C 1PHMA 4K40A 4NMIA 2HWE1 2W08A 4JKLA 1D0HA 4CDWC 3VUOA 3TN92 5FY9A 3FHAA 1ENQA 3JZVA 4H2AA 5D21A 4AAXA 3ZFEA 4K7JA 4X8PA 4XURA 3FN9A 1J3PA 4MHUA 4N8MA 2PLV2 4FXKB 4N7UA 5FLIA 3UYJA 5LWBA 5L19A 2AZ5A 3BOWA 1OD5A 1CIWA 2FCTA 2JG9B 2RE9A 3PIGA 4ITCA 1AX2A 3POFA 3CL1A 3SH4A 1Q8SA 2QQMA 4LTAA 4NHLA 4IXLA 3NW4A 3DECA 4XJ9A 4CEWA 3PUSA 4AVCA 1VBA2 5G05L 4UFKA 3HJRA 3VBHB 1UOJA 4OMDA 5IVEA 1AR81 2JDUA 4B8EA 5C71A 2QQUA 5ANQA 3I2FA 3JQWA 4XFGA 5FZAA 4COYA 1YEWA 3EHKA 4DEVA 4CEYA 3AX4A 5LK7B 4ZHNA 1X9PA 3OPZA 3RGBA 4AR2A 4MGIE 1HQNA 2Q1ZB 3BPZA 2RDRA 4Q8LA 1G9DA 1MZFA 1VP6A 2P6HA 3CMGA 4GWJA 1O3QA 4GZ9A 1MS4A 4NN0A 4XTPA 3B7MA 5JOXA 2RS31 1Q5OA 2A73B 4Q4V2 5K0UA 1W8TA 5L9RA 3TN91 4B1MA 4ZXEA 2QKDA 5JIAA 3BTXA 4CU6A 2W1UA 2VAUA 2VOVA 5I0TA 4DY3A 2PLV1 4CCNA 1RL3A 1K5MC 1N3QA 1MEC2 1NLRA 1QQP2 3HWJA 4AL9A 5AFBA 4W50A 4FPKA 1OPOA 2WSVA 3FUQA 4Y26A 3RZMA 2C24A 3T2TA 2R30A 3D3AA 2WYSA 3Q8BA 1TMF1 1DCSA 1QOTA 3WUCA 3KCXA 4ZKTB 2PAEA 2XVGA 2D6LX 5DN2A 1WCSA 3ABZA 2VMDA 5JOZA 3OD0A 4MXVA 1QJEA 1J84A 4OFGA 4LBKA 1W0NA 4LE4A 5LY2A 5B2GB 2J1AA 4CU7A 1D2SA 2V5DA 4Q1RA 4P14A 1HRV3 2CY6A 1GP5A 5KC5A 1UOFA 3VZNA 5T54A 1AYN2 1LEMA 4XJWA 4Y3OA 4JC1A 4NUBA 1VIWB 3NAPC 5A33B 3ACGA 5LA9A 4XUOA 5DDJ1 1MS0A 3TEWA 1AX0A 5HXMA 4HPKB 1C57A 1R091 4K9SA 3SKJE 5C8CA 1PM4A 5I91A 4Q4V1 4R9CA 1RMU2 2P3JA 3AMMA 1MPXA 2X09A 1H30A 4MLOA 1SMVA 1W39A 2V73A 3ATGA 2WABA 4LMFA 4A44A 5CFDA 3G6JB 3NV1A 3I3EA 3KGLA 2WINB 1MEC1 5D8AB 1IS6A 1QQP1 1REEA 3EQEA 3NKGA 4FPLA 1GWKA 3PL0A 1UD1A 3GCWA 5FZIA 3DPRB 1J1TA 1D0GA 1NE6A 2JB4A 1BK1A 3ACIA 3FWEA 1NCQB 3LSEA 3OGJA 2W1SA 4UOJA 3WP5A 2WZEA 5FQ0A 1XXNA 2R16A 2J1SA 4RQPC 1AR73 2MEV2 2Z79A 1XNAA 3LDRA 5LBBA 3T4VA 1PMHX 2JG8B 5ABJC 2ZEZA 1V00A 3TEZA 1BCXA 1ASJ2 3F95A 3NJVA 4LKDA 1ZZ7A 1QY4A 4LO5B 2WO1A 1W3VA 1U0AA 1AYN1 3KCCA 1W0OA 1ENSA 2YU1A 3A7QA 3VHOA 3WNXA 3M1HA 4CDXA 1BMV1 3CJIC 5K8SA 5JXIA 4DO0A 2Q5TA 2Y38A 1BEV3 4LLFA 2VJXA 3BIWE 4DINB 1W9TA 3GBGA 1VMFA 2WAAA 3T30A 3UGFA 3ZXDA 1RMU1 4N9IA 1JOJA 4E4SA 4S2GA 1VMJA 5I0DA 5DG1A 2D97A 2CTVA 4E2GA 2OPKA 5H9PA 3ILFA 4LBLA 4JKMA 3LZZA 1ND2A 2X8KA 2RM23 4HK9A 4X6QB 1WW7A 2Y6JA 1CPNA 2Z4FA 5FRAA 3K48A 1D2QA 3IT8A 5EFUA 4BQ5A 4CPBA 4E4DX 1ZRDA 4FAHA 4V2VA 4IETA 1CJPA 3M8LA 1RITA 2OX0A 1QDCA 3AMNA 1H6XA 3JD73 3D0JA 1OLMA 4Q0QA 5HV0A 5JZGB 3LB9A 1CZSA 3AJYA 3OGVA 2WNUB 3JBG2 3W5MA 2VG9A 5A7WB 3SLIA 3RPQA 3C7GA 5A1AA 4OI0A 4JHZA 1GSLA 4EWDA 1REDA 4AAPA 1Z7S1 2CHHA 2RS52 1AR63 1C8M1 1ULEA 2XG3A 3WDYA 5C70A 5FAXA 1AX1A 2JG9A 1ASJ1 1AR92 4M3CE 2RS12 4DS0A 5A6XA 5I93A 1RXGA 5EYYA 1PIV2 1ZX5A 2J1EA 2Q1MA 3IDEA 1O4ZA 4FOVA 4JVAA 4QB1A 3PUQA 1UOBA 1MZ6A 1UIKA 4QU1A 1O59A 3VBHA 4DXTA 1YFWA 4P5HA 4D7YA 2D3SA 2YC4A 2WT1A 4C91A 1BVP1 3OG2A 4XCAA 4MH0E 3CNAA 2XH6A 1LULA 5FUNA 2NP0A 4IGOA 1V6NA 2VMFA 1LAJA 4COZA 3N9LA 4W8JA 5BNPC 3EO6A 3QACA 4OVEA 1HB1A 3WW4A 1KD7A 1UOGA 2A3WA 4JX0A 1VBC3 1UY0A 2VBDA 1IS4A 4C90A 1H0BA 1RVF3 2A6ZA 2FDFA 1UPIA 4YPJA 4FI9A 2WKKA 1GV9A 1PVC1 4QHBA 1SPPB 4MOAA 2XQRA 5JXHA 4LK6A 1RUF2 2JD9A 4KG8A 2D6KA 2BFUL 3NAPA 1SCSA 1EUUA 1RTVA 3SEEA 4WVWA 1UO9A 1QGLA 3CJXA 1YYNA 1R083 4WZCA 5K9YA 2XR4A 4QXKA 5DAPA 5AFEA 4YZ5A 3I49A 1CONA 3MW2A 4MGTA 1ZBE3 5DZGA 2WNVB 3VKNA 2RS51 3ZYBA 4FQ4A 4DQAA 5JOYA 1VR3A 3USUB 3R0RA 4GH4B 3IB3A 4IGPA 3ZDSA 1R1A2 4GD4A 2DTWA 3VBSC 4CCOA 1W6PB 1J58A 1PIV1 2VZOA 1LOEA 4QU2A 3VHNA 1SDDB 5EZWA 4AHZA 3ZKYA 2R32A 5HV4A 1VBE2 1QJU3 2HEYF 3TRSB 5L7OA 4U2AA 2D3RA 4QWNA 5H9QA 2P5BA 4QX7A 5KHIA 3HMYA 5IK5A 4AI2A 3VD5A 4HETA 2VUAA 4DB5A 3B3QE 3WW2A 3NKTA 5AC93 2LM3A 2O0OA 2VULA 1OOPC 3CIHA 1H4HA 2JXAA 4JTNA 1VALA 2VZTA 1UX6A 3AKRA 4Z07A 1QJX3 2HWF2 5J98B 5JI7A 3VKFC 3A21A 3VKMA 3KT4A 4FT8A 4MXWB 4D7SA 4LORA 3ILNA 5FYZA 4E4ZA 4XDOA 1GZCA 4PIXA 4HPKA 4A7ZA 3AP4A 1UN1A 1AL23 1E5HA 1EPZA 5APAA 2R063 3WP4A 2PFWA 4LEJA 5IYYA 4CU8A 1OURA 4YG3A 2P37A 1RUF1 1WW6A 3HT2A 3SNMA 1HRI2 5A3TA 4Y24A 5HCFA 1NXMA 3B5LB 1RUOA 2BOJA 1FX5A 1PK6C 2HYKA 3DPRA 5FP3A 5C6CA 2BVVA 4AVTA 1NCQA 2I2SA 2Z5WA 1QOSA 3FLRA 4NAOA 2E7QA 3DXTA 5D2AA 3WZ1A 4E2QA 1CAWB 1R1A1 3MIDA 4HKOA 3KCYA 3ZN6B 3DYMA 4JGZC 1H2NA 1VBE1 3H3LA 2JG8A 1JZ2A 2D5HA 4MYEA 4WVVA 4XQ4A 2UYBA 2YBPA 5FK7A 4EV0A 1BYHA 4RFRB 2IC1A 3I3QA 4EN8B 1PGSA 2QQOA 5GJ6A 4XBQA 3WF1A 4N90A 3WF3A 5FYSA 5J36A 4LK7A 4A45A 4A6SA 1VAKA 2RJ2A 2XB6C 1X82A 2A6XA 3PURA 4MVTA 4N53A 3AP6A 1C4RA 4XQDA 2HWB3 4IUGA 2PMWB 4LO7A 2YU2A 3AVRA 2YYOA 3FFQA 1JN2P 2ARAA 3LEKA 4IV3B 4BISA 2IXKA 2XVLA 5CKMA 1JMUB 1Y9QA 3BCWA 5FZGA 4FAGA 1JZ6A 3ZIXA 4IEPA 4ZZ8A 4YW7A 4GB32 5C3OA 2K46A 3GM8A 3RS6A 1MQTB 2EXHA 3OTFA 3WY6A 4CXYA 4LITA 3PIJA 3WVJA 3LIHA 2VR4A 3OUJA 2H0VA 5F9TA 3K2OA 3ORJA 4Y4RA 4C0BA 1POQA 1SLCA 3W59A 1HN0A 1W6OB 2XDVA 3RVHA 3WV6A 1F8VA 1AXZA 5ACA3 4LBOA 1A78A 2DBNA 3MICA 5E6HA 3WQ7A 2VQ0A 2B9UA 2JB8A 3GF6A 5LBFA 2WNUA 1Q8QA 5A7WA 5IUQA 3HR9A 2GNBA 1OA2A 3NJZA 3RI9A 2J7MA 2YBSA 2ZHLA 4NOTA 2EXKA 1JYWA 5EYXA 1DGRN 1XNKA 4LOTA 1D4VB 4INDA 4PLOA 3RI8A 1IZ3A 1XC6A 4IL7A 2WNOA 1OF3A 2HWD2 3ZXEA 4B7KA 4CXWA 2FDJA 2VZPA 3GYDA 4B4PA 1QJY2 2LUWA 1RHI3 2NPIA 4RHV3 1L7LA 4FP3A 4DUVA 4HG6B 4DRRA 2Q0AA 5FZCA 5LEKA 4YGCA 2ZX2A 4JZRA 3VD3A 5BNNA 4FPYA 2CNAA 1XQNA 3H42B 5C4WB 4E2SA 3WCRA 4GB31 3HAGA 3SH3A 1FV3A 3LIGA 4CCEA 1WLWA 1F9KA 4YGBA 5IWFA 4P9IA 1MACA 3MIEA 2V4VA 2VD7A 1I3HA 1NCRB 3LA2A 4MX3A 3QBQA 4NAMA 4XQWA 5JXJA 3V0BB 1FYUA 3B00A 4QDSA 1SPPA 1H2LA 4DMIA 2YPJA 3GCXA 4CCCA 4Q4Y2 4AFCA 4O7XA 2Y6FA 4GQ7A 1HXS3 3M3QA 5LASA 1EY2A 1KXGA 2ID4A 3Q8AA 4GMP1 5FY1A 3V64A 2LS6A 1OXCA 4JTOA 1MS5A 1DLCA 4PJYA 5LBEA 4CCJA 4MGZE 2XHNA 1G9CA 1VPHA 3USUA 1XU1A 1URXA 4GH4A 3TBDA 1G7YA 2R042 4XJAA 2HWC3 1W6PA 2HWD1 1OT5A 1QJY1 3BALA 3S7EA 1FNZA 1WCKA 2DU0A 4P02B 5GZGA 5DQ0A 2RG4A 1C1FA 5EP9A 3U37A 1YC61 5ISLA 4L0PA 1WZXA 3TAYA 2IZWA 1F31A 1VAMA 5FBZA 3TB0A 4J6GA 3WEZA 2JE8A 2FD8A 3WINE 2WNEA 3P6BA 4MXWA 2ZGTA 4AVVA 2OZ6A 5FPVA 1GQGA 5FO9B 4MG2A 5FXXA 1VBB3 2JDZA 4M00A 3E5QA 4QKDA 4W6YA 2B45X 1G86A 1AHSA 2JEMA 2XBO3 4AI9A 1UY2A 2DVAA 2R0HA 1C1LA 3GDBA 4YM2A 5C3QA 1Y9GA 3FBYA 5C9AA 1KRIA 3ZDVA 4YZ4A 2W0XA 1POV0 3KWVA 1SEFA 3OGSA 4ES9A 3A4UA 1BBT3 1N1VA 2YFZA 4NROA 1GMMA 5IAXA 2YPDA 4OUMA 2DURA 3MIFA 1NA1B 2JE9A 3JUUA 1VJ2A 2PELA 1CAWA 5GZCA 4OHWA 2A71A 1TME3 4EE2A 1RUE3 1EAH2 5F8PA 4BA6A 2FDHA 1FV2A 1GWMA 2WT0A 3Q9OA 4UBHA 3ZFFC 5D1IA 3N7KA 4A3ZA 2WN3A 5CA6A 2GMEA 5F1RA 3WOGA 1ZZ9A 5DAWA 1K45A 2E33A 4NPLA 3C7EA 1DYPA 4R4ZA 4W4ZA 1GNZA 1W8ZA 3KQ4B 3BOPA 1JUIA 1F35A 4H7MA 3J26N 1XYOA 3OY8B 1LR5A 4JGYC 2NMNA 4F8AA 5HCHA 2VQTA 2XL7A 1UNBA 3O1MA 4IEZA 2GALA 4OCTA 4XILA 2VZ3A 2R6QA 1UU5A 1UF2C 4LULA 1OFSA 2QDRA 2CDOA 1GQPA 3FHIB 4IV3A 2OUJA 3ZFEC 1NQDA 1UXZA 2XKOA 3WG2A 4YFZA 3ZPOA 1L7RA 1WCQA 3ZMOA 1JYVA 3IN9A 3JB4C 4I02A 3GNEA 3MLKA 1AUYA 1XNCA 2XL9A 4P00B 5BNOB 2Z42A 1A8DA 1DG6A 4QDQA 4BLJA 1S0BA 4QGNA 3ZPYA 3VV1A 2QQJA 1PGW2 5LBCA 4NRQA 3WP3A 3RDIA 4AEDB 4GAZA 3TEYA 3UKTA 1H4GA 1LU1A 3ZIWA 2Y26A 4FBFA 5KBFA 3RG0A 1UL9A 1SZBA 2XLFA 3UGGA 4QXHA 3S7IA 3NV2A 1MR5A 4CEWC 1JZ7A 1R1ZA 2CGNA 3ZR5A 5CKNA 1PO23 1NZCA 5BPXA 1LNSA 4YZ3A 1YJKA
chains in the Genus database with same CATH topology
4KQ7A 1SCRA 3CF6E 4X6RB 4Y22A 1ND3B 2TEPA 1HRV2 1QJZA 2V09A 1IHMA 2EIGA 1D4M3 4SBVA 3UL2A 1YFYA 1OPMA 5GZFA 1DZTA 1Q8OA 2ZCWA 1O3RA 1KFXL 4AEJA 3E6DA 2H6CA 1H8TB 3S30A 3FE5A 3I4IA 1G9FA 2K2SA 4XF0A 4QQOA 4QMAA 4XXPA 2OYZA 3ZXFA 2UY9A 4K20A 1ZZ8A 1CGPA 1FOD3 1UU6A 4Y5Z0 1H2KA 1OQ1A 3OBRA 1JYIA 2B5HA 3O0WA 2WS93 4MV2A 4A7KA 3V0BA 4CDUB 3WHTA 2CV6A 1F2NA 4PBOA 2ZX3A 3MGUA 1HLCA 4YVWB 3U11A 2VXRA 1CAUB 3IDCB 4AE2A 3BTAA 3MFCA 1PZ9A 4LHKA 4QPIB 1B35A 5HBAA 1XE8A 5CNAA 3JCIA 3V65A 4GULA 2GAUA 3VBUB 3UJOA 1HRV1 1W2UA 4LUMA 2C1FA 3AMQA 3IKWA 5T5LA 1RIRA 1WMDA 1BEV2 1GZWB 2BYVE 5C8CC 2WZR3 1A3KA 5L7OB 1UKGA 3VBFB 2VNGA 3O5SA 4B4RA 2GC1A 1X8MA 1Z78A 1SFNA 4AGVA 5HCAA 2A3YA 5CFDC 4AQ6A 3AZXA 1AR82 2A6VA 1CD3G 2RM22 1L3JA 3TWIA 3IBMA 2VMHA 2VW2A 3M3OA 3DV8A 5T5PA 5JWPA 3KZ4C 3JD72 4XF1A 2EA7A 1WGPA 2XJTA 3PVBB 1AR71 2IXHA 1GYKA 5GM0A 3AYCA 3ZX7A 4RS5B 2RS32 3GZUC 1VBD3 4WVMB 1CN1A 1NA1A 4IEOA 3SH5A 4IEUA 2D6OX 3J9SA 1O5LA 3TYJA 4QGLA 4NWWA 3PJQA 1VB4A 2ZGUA 4CDXC 3AP5A 3PTYA 2YGLA 1KDMA 4WM8B 3QD6A 1JTZX 1BEV1 2DCZA 1TMF2 1UZYA 4CZSA 5KXEA 2ATFA 1O3TA 3SXWA 3WCSA 1SFYA 3OY8A 5FO8B 3VLBB 1KDKA 2QUOA 4AFMA 4I01A 1DBNA 2RMU3 5J37A 1ND2C 1VBC2 3UK9A 2P34A 2RM21 1RVF2 4WZFA 4IEWA 4AQSA 1QOOA 5C8WA 1WMFA 3G7DA 3JD71 5IK8A 3JU9A 1C5IA 1UW8A 2UY8A 1HKDA 3AZYA 5DDJ2 5BNOA 1FATA 1QXPA 1R082 4UW6A 1R092 4S2HA 4Y1ZA 2VY0A 2AENA 1ZBE2 4AEDA 4C1WA 3GZAA 1AR61 2JG9C 2PAMA 4JCKA 1WUVA 3RMXA 3DN7A 1WA4A 2GC0A 5A32B 1GKBA 4MSVA 3VBHC 2Q8OA 3LA7A 4W6XA 1FPN3 1CAXB 1SBDA 1ND3A 1RUD3 1FI2A 1BVVA 1PVXA 4ES8A 1I6XA 4HVOA 1V6MA 1HQLA 2PHWA 3LCPA 2O8QA 1H8TA 1VBC1 1ZYBA 4R52A 2ZPXA 4BHPA 1H9WA 2P17A 1RVF1 2B46X 2AUYA 2DVBA 4QPGA 3H0OA 4A7YA 2UYAA 4AFDA 1O5UA 4BMBA 4I09A 1AZDA 4ASMB 4YARA 4W6WA 1COV3 4QM8A 1BMV2 3WR0A 2ZOEB 1U5IA 3B94A 5DUVA 1B09A 4LNVA 1IGOA 1R081 2TUNA 4BLIA 4CYDA 3MDPA 4XF9A 4LO8A 1ZBE1 3EJKA 3WW3A 2JENA 1CR7A 4XEZA 1ULGA 2BTVC 2ET7A 4DFSA 5FTTC 3LOBA 1CAUA 3SMHA 4AK3A 4JDOA 4ZU7A 2D3PA 4RQPB 1QJU1 2ETEA 4Q4W3 4P9JA 3DL3A 3PJYA 2F6BA 3ZN4A 5FMOL 2WWSA 3N7MA 5AC91 4GKYA 4COUA 2K9ZA 1QJX1 3D4KA 4NWVA 3NV3A 2OUHA 2D44A 1Z7S2 5KWRA 1LB2A 5BUVA 1C8M2 1LHUA 2HWB2 3MW4A 3T1LA 4AHWA 1GZWA 2PYTA 1YFXA 2XWJB 4R4XA 2WZPP 4D94A 2X5IB 5E89A 5J48A 5CFCB 4ATEA 2AH2A 3RQ0A 1AL21 1WW5A 2R061 1ZRCA 2ZAHA 2YGMA 1V70A 5CADA 1HV1A 3AMHA 2WT2A 4UW5A 5D8AC 1BXHA 2BPA2 1QNYA 2JICA 5CIRA 3WQ0A 4AVBA 2DTYA 1AXKA 3DPRC 5LRRA 1NLSA 1J3QA 1NCQC 1QMJA 1YCIA 4Z1VA 5LK5A 2ZJCA 4QX5A 1SLTA 3OCPA 4XFIA 4IEQA 3ZSJA 1DQ0A 1G8WA 4AWDA 4RS5A 2JG8C 1V9U3 3VL8A 1XE7A 2D7FA 4HSLA 2E51A 4DZGA 4L8QA 3NSTA 3VL9A 1LTEA 1PVC2 1AVBA 5FPXA 1XYPA 3CLPA 4HBNA 3H1YA 4N53C 4HZFA 1RHI2 4I3PA 3VN4A 3FLPA 1QH7A 2ZBJA 1PO13 1T6GC 2HWB1 4Y20B 4WM8A 2XJPA 2HEWF 1V6OA 2ZS6B 2DUPA 1VB2A 2HEVF 2DUOA 2YHJA 3WDTA 4BWOA 1LECA 2DV9A 4HN1A 2ZA9A 1EV13 3M3IA 1Z0HA 2P2KA 4M3CF 3EBRA 5GKAC 1A6CA 3ZSKA 1YJLA 4BIFA 1DDLA 3WDXA 4HVRA 1SQ4A 1FT9A 5ACA1 4M0NA 4QQHA 2I45A 2E9QA 4ISQA 2WNUC 4EJRA 1M4WA 1AL0G 4L92A 3LKJA 2BFUS 3LAGA 4NR1A 4M3CB 2ZABA 3FUOA 5I8SA 5IK7A 1GNHA 2FMDA 3HIFA 3KLSA 4HN0A 1QKQA 3A0KA 2H0BA 1DQ1A 4HKWA 2C0ZA 3APBA 4D7TA 4KBBA 2GDFA 2IWGB 4EN6B 5A32A 1RHI1 1YRZA 4RHV1 4NVPA 2NM1A 4XBLA 2PHXA 1VBA3 4LO6B 5JPMB 1CAXA 5H9RA 2DCJA 3S0MA 4KWJA 2OW4A 3JQXA 2E7TA 4JRAA 5BNNC 1XNDA 2AREA 5FPZA 2EXJA 3E5XA 3KD4A 4AYUA 2CAVA 3J8F3 1VBB2 1Y43B 3EXUA 2XBO2 1RUH3 3D82A 4LLOA 1G6NA 2NN8A 4CP1A 2LALA 2CGPA 4BIOA 1QF3A 4PLNA 2DWRA 3PHMA 5A33A 3U0ZA 4HANA 4BQ1A 4XDQA 1HXS1 3MIBA 4A2UA 4K21A 1AYM3 4IERA 4V1PA 4GH4C 1PK6B 4P9GA 1TNFA 4ZU5A 2HWC1 4XBNA 5CG9A 1RUJ3 1TME2 1C3HA 1QNWA 2SBAA 4WBBA 4QM9A 5D8AA 4YVSB 4COWA 1ZBA3 4BZ4A 1YFUA 3VBRB 4OHZA 2XLAA 4IESA 1ZZ6A 1CAVB 4Y1UA 3VBOB 4OLLA 1NOVA 4X8NA 5FOJB 3ENRA 4R9AA 2VQAA 4AVAA 1YUDA 3QH6A 2VECA 3RNSA 3O0VA 3T1MA 1JUHA 4YGEA 4GA9A 4ZU4A 1LJ7A 4G9SB 3VZJA 5EJ3A 4GIQA 4KNCA 3IMNA 4KL1A 1VBB1 4G4FA 2X5IA 5CFCA 2DF7A 1H9PA 2YXSA 2XBO1 2E63A 4N9HA 1YLLA 5C9AC 1J1LA 2NMOA 2ZX0A 4HFSA 4F83A 2ZGRA 3MLJA 5JMCA 2ZHKA 1W6MB 3C2UA 2ZX4A 4AI1A 4RA0A 2D6PA 1BBT1 4S2FA 1IS5A 5BXXA 5JPNB 1V6JA 4FOWA 1V6IA 1S0IA 4D3WA 4YG6A 3MIGA 1ZA4A 3QOPA 1KS4A 1TME1 2NQYA 2RHPA 4CDQB 1RUE1 2GH2A 2MEV3 4TLFA 5J7MA 1KITA 3ETQA 1W0PA 4ASLA 2FZ2A 4H55A 1ZREA 1EP0A 1KS5A 2AR6A 4ISRA 2UURA 3THTA 3WW1A 5JZGA 1D4M2 5I0UA 3AFGA 1SDWA 4IEXA 4S2DA 2CYFA 4K6BA 1LOCA 2VVEA 3DUIA 4KU7A 4Q0UA 1SLBA 3DF0A 1O7FA 2TBVA 4Y20A 4B4QA 1MS1A 3PVEA 3GZTB 1DF0A 4IV3C 1MVEA 1H1AA 3URFA 1S55A 4IEVA 4YW4A 1O4YA 3ZSEA 4LBQB 3U07A 4Z8BA 3GHNA 2ZGOA 2WIIB 3VZMA 2E7AA 3E5UA 1YI7A 3FFZA 2ZKLA 1RUI1 4XHXA 2MPFA 4XPVA 4FPOB 1GBGA 3L2YA 1RJ8A 2VPVA 2WS92 4YW1A 1XNBA 4YG0A 3VZOA 5JSPA 2AYHA 1IKQA 5GALA 5DUUA 3A0NA 3JBG3 1PO21 4M3CA 3HT1A 4AVSA 3AXEA 4FPFA 5KHGA 1ZZCA 2PN5A 4GALA 3ZFGB 4YZ2A 4FQZA 1PZ7A 1X7NA 5JR7B 2FZ1A 4OHVA 1AR93 2RS13 1D4M1 1RUC3 3AKSA 4LR4A 4K1YA 1MS3A 1JYCA 2D6MA 3AYEA 2WNVA 4H7LA 2FBEA 5I8YA 3FC0A 1SACA 5BY5A 3W58A 3M3CA 1EPWA 1GICA 4O9GA 5K7PA 1FOD1 3LSDA 4FOQA 4QQ2A 4AHYA 4ZXKA 1NCRC 2GMPA 2WS91 2D43A 2R49A 4IV1B 2DCTA 4RR3B 2DVGA 1QXJA 1V6LA 5J3UA 2XHKA 5BNQA 1DZQA 1NY72 3AK0A 4KU8A 1B35C 1VBD2 1VRH3 1J59A 2R1BA 3GHMA 5DUXA 3OGGA 2OIIA 4DPNA 2BQPA 2B7YA 1CX4A 2X53S 2ZKNA 4I0BA 2BNOA 4LUKA 2JD4A 1ENXA 3IWZA 4JAAA 4YVSA 5FLJA 1QXRA 3U4XA 2JE7A 2GNDA 4N7IA 1I9RA 1N1SA 1CAVA 1LKNA 3VBOA 3PMSA 2WZR1 2YUEA 4F3JA 2ZHNA 2GU9A 5SV8A 2DU1A 3GBFA 4QPYA 2XGXA 5F6KA 1AJOA 2GH8A 3ZN6A 1G9BA 4XJZA 1PGL1 2HWF3 2CAUA 4RFT0 2G4IA 3VDDB 1SBEA 1TQ5A 2VW1A 4Q4X3 3IDBB 3K51A 5T5JA 3WQ1A 1MS9A 4NHMA 2YC0A 1LENA 1LHVA 4DY5A 5IT6A 3PNAA 3MPPG 4EWEA 5EXOA 1GR3A 4C1XA 2Y0OA 1NY71 1UAIA 2PHDA 2CWMA 3R4SA 4FO9A 3ACLA 1VBD1 2ZGLA 4DNYA 4RSUA 5GLVA 2VGDA 2XJQA 5JLVA 4PBPA 3P3PA 1FAYA 1NA1C 3ES4A 1RUI3 4O9EA 4AFAA 1MQTA 3THPA 4CDQA 3CU7A 4XJ8A 1N1TA 1POV3 4A3XA 2YROA 2D98A 4GMP0 4OHYA 3ALQA 2WFF3 2YV8A 4CEWB 1BQPA 1W6OA 1FPN2 1DU3D 2RR11 4YW2A 4YSFA 4I30A 4BMEA 2DVFA 3AKTA 2ET1A 2E53A 5DZEA 1IKPA 1HV0A 1C28A 1ZRRA 2D5FA 4CEYB 5KXDA 1LEDA 1I1EA 1LHNA 2RMU1 4Y1YA 4MZUA 3L2HA 2DVDA 1M06G 1JH5A 4XFFA 2YY1A 5K0UB 2Q4SA 3KB5A 2DCKA 1VAVA 2WJSA 2YZ4A 4PDWB 2DYCA 5I8TA 4EWAA 5BNOC 4OZXA 1OMIA 3HBZA 5KHHA 2XJSA 4WM7B 4YFWA 4AEDC 4AGGA 5BV6A 3MI8A 2B39A 2A70A 3DGTA 3L9JT 5C4WA 1YXWA 4HLTA 4HL0A 3KQRA 4B7EA 3R05A 4KGQA 3X29B 4P9WA 4K1ZA 4LO4B 1NCRA 3WD5A 1N3PA 2XLGA 1SBFA 3VZLA 1FPN1 3ZFGA 1ND3C 5E88A 2IXCA 5FO7B 4KWLA 4HSJA 1RUD1 1AR72 4F7ZA 2R1DA 2RJKA 2BVBA 4JQRA 1WW4A 1MZEA 1H8TC 4FPCA 4XXAA 1Y3TA 1WLDA 2WQ4A 4PCRA 3POWA 3ZXJA 4BH9A 4QPGC 3ZSLA 4TZDA 2GN7A 2VOWA 1COV1 3R4UA 2BWCA 1QH6A 3PVOA 4YZ1A 5CFDB 4QGMA 2EVXA 2ZAAA 3AZZA 2VVDA 4QD2A 1WBFA 1UKRA 3J4UH 2D40A 1IOAA 4IV1A 1CPMA 1W6NB 5T3NA 4AEKA 1YI9A 3POYA 1Y7BA 1UIJA 2E6VA 3E6BA 3POSA 2WLQA 1MS8A 1J3RA 4Q4Y3 4QPIC 1DQ4A 1V9U2 4L2NA 4Q4W1 3QLQA 3O14A 4N43B 1PNGA 3B69A 4YNIA 4CDWB 1H2MA 2ZGNA 2VUJA 3LWCA 1X50A 1LOGA 4BA6A 1OFNA 2R043 1OKQA 3R4DB 5CU1A 3OF1A 3WG4A 3RWNA 3HN1A 1PO12 1RINA 4I0AA 5H9SA 3P3NA 5A3LA 1AR62 5LEJA 5TSWA 2I74A 2OA2A 3ME2A 2QVSB 2ZHMA 1H8VA 4IQPA 4WVZA 4L97A 1JHNA 4R9BA 4YW5A 5C33A 2R071 4OUSA 3VDDA 5JVVA 2RR13 1S2KA 1F5FA 3FMGA 4QQLA 3KS7A 3MZHA 1LHWA 2XVKA 4KH9A 4BOWA 2A5ZA 1LOAA 1PZ8A 3ZVXA 4RS5C 4H3WA 5JAXA 1APNA 1RUG3 1OQEA 1V9U1 4LE3A 2QNKA 3PVNA 4BYYA 4NHKA 3ZSMA 5SV5A 2ERFA 5JI9A 3TOJA 2WQZC 4LBQD 4AXOA 2VOKA 4TSVA 1BZWA 1FMD3 1K5MB 2KM2A 1PO11 1NG0A 1EAH3 3WDVA 4WM8C 3C3VA 1WLCA 2H6BA 2GC3A 4BE3A 3H50A 5F6LB 1YWKA 2D93A 1XYNA 4LT5A 4PQ9A 3PMEA 1YNAA 3ASIA 3PLQA 4AQ2A 1QJU2 2A6YA 1WCDJ 4M0HA 1EV11 3ST7A 2GC2A 3AZWA 1VLNA 3J8F2 3O0XA 4OI1A 5BYNA 4AG4A 5AC92 2W52A 1RUH2 1QJX2 1OLQA 2CWSA 2ZMKA 4XIOA 4PDWA 5I0SA