3PLQA

Crystal structure of pka type i regulatory subunit bound with rp-8-br-camps
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
b'SYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase type I-alpha regulatory subuni
publication title Cyclic AMP analog blocks kinase activation by stabilizing inactive conformation: Conformational selection highlights a new concept in allosteric inhibitor design
rcsb
source organism Bos taurus
molecule tags Transferase inhibitor
total genus 28
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3plqA01
1CAVA 3E5XA 2VQAA 3E6DA 3SMHA 3CLPA 1CX4A 1I6XA 1H1MA 2OZ6A 3BCWA 1EPZA 1CAXB 4XF0A 1ZVFA 3E5QA 2PQQA 4LUMA 2K0GA 4L2NA 4Q0QA 3E6BA 5FPXA 2XLFA 2IXHA 2BYVE 3WW3A 4ZU4A 3ES4A 5KBFA 4XFHA 1UD1A 3OF1A 4I0AA 4ORFA 4UBHA 5J3UA 5LEKA 5JSPA 3MPBA 2GU9A 5LEJA 3JZVA 3QACA 2PHDA 3RDIA 2V09A 4HN1A 4F7ZA 5JSRA 5JCTA 4I3PA 2EAAA 4AVAA 1ZZ8A 4IEWA 3BPZA 3LAGA 2Z69A 3HT1A 1YWKA 3H1YA 5E16A 1LR5A 5I0TA 2N7GA 2GC3A 4DINB 2VECA 4H7LA 3U11A 3RYRA 4TLFA 2OPKA 4QGLA 4LTAA 1UCXA 3L2HA 3KCCA 3SCFA 2XKOA 2GH2A 2HKXA 5CADA 1NYWA 1EY2A 3IDBB 3WW2A 3GYDA 4J1XA 2IXKA 3H7JA 4HZFA 3R6SA 4PIZA 3H1MA 4P9GA 2Q30A 1NE4A 5LRSA 5JAXA 1ZZCA 1X8EA 1O3SA 5FLJA 2GZWA 4E2SA 4AQ6A 1X7NA 2B9UA 2IXIA 4BIFA 4K8FA 4J1WA 2IXCA 3EJKA 4FAHA 5KHJA 1YFWA 3UKNA 1Q3EA 1GQGA 1OFNA 4BH9A 5KHHA 5I8SA 3BB6A 3BU7A 5F1RA 4XFIA 1NE6A 1RGSA 4XFBA 3PVBB 4GULA 5I8YA 2Q4SA 4QMAA 2XHKA 4XEZA 3D0JA 1RL3A 1PM7A 3SHRA 3EO6A 1CAUB 5K8SA 1OI6A 1SFNA 3CO2A 3I59A 3DKWA 1J3RA 4HMZA 4FBFA 4QX5A 5EFUA 3OD0A 4LA3A 4QM8A 5I91A 4EROA 1X8MA 3H3UA 1RC6A 1FXZA 1Q43A 2PA7A 1WLTA 5C8WA 2WFPA 1ZZ6A 3CL1A 4A2UA 3RPQA 4BYYA 4XF1A 5BXXA 1H1IA 4XFFA 2P17A 2BNMA 4META 4PIYA 2Q1ZB 3ACLA 4FT8A 1EP0A 2CV6A 4I02A 4HSJA 4LUKA 3I54A 5FQ0B 3RYPA 5KHKA 2MHFA 5T3NA 3NJZA 1UW8A 1O3RA 1YHFA 1XE7A 3LA7A 4ONUA 2QVSB 4HN0A 1WGPA 1NZCA 3FHIB 1ZNPA 4LULA 2IC1A 1CAXA 2GAUA 1CAWA 4IEPA 4XFGA 2IXJA 1UIKA 3LZZA 3G7DA 3KSCA 4YNIA 4Q29A 3ROUA 3H9AA 4JV4A 1TQ5A 3USSA 3IWZA 2D93A 4XETA 2Y0OA 5I0UA 2XL9A 1RUNA 5JR7B 2B5HA 5BV6A 4ZU7A 4XFCA 2PTMA 4BHPA 4AXOA 4N9IA 2XLAA 5HI0A 3PNAA 1YFYA 1Q5OA 5CVRA 2PHLA 1ZZBA 4E2QA 4EWDA 3H1WA 2BEOA 1G6NA 1DZRA 3LOIA 2XKPA 4IEUA 3S7IA 3ZDSA 4OFGA 2IXLA 1NXMA 4JTNA 1O3QA 3MDPA 4XF4A 4HVRA 1RUOA 2GC2A 1UPIA 4I0BA 1EYBA 2QDRA 2CGPA 1VJ2A 2OZJA 4HLTA 4KU8A 3NW4A 2DCTA 4FAGA 1I5ZA 1DZTA 2F4PA 3ETQA 3S0MA 4I2OA 3U0ZA 1QWRA 2Z2SB 3OGJA 3SCGA 1L3JA 1QY4A 4EWAA 3D82A 2H6CA 3SCHA 3WW4A 4NVPA 5FDBA 2B8MA 4O9GA 1FI2A 3QOPA 3FZ3A 3OTFA 4B29A 4MGYE 1LKNA 2D5HA 5EZWA 4HSLA 3KMHA 3KGZA 4HBNA 1CGPA 2ATFA 1UIJA 3S7EA 3LWCA 5FCCA 1YFXA 5BY5A 4UXAA 1DGWA 4R8HA 1SEFA 2QCSB 2UY9A 3I59B 2HJIA 4YYOA 4IEXA 2EA7A 2ZCWA 1YLLA 3OCPA 2ET7A 2EVXA 2BNOA 4YARA 4IEOA 3WW1A 3RNSA 2C0ZA 2FMYA 4JVAA 4KWKA 4RD7A 4IEQA 2MNGA 3H7YA 4LEJA 3I7DA 1CAVB 4IEYA 4HVOA 1OMIA 4MGIE 4IERA 4MX3A 5KHIA 1ZRFA 4Q0UA 1J3PA 5E1RA 1CAUA 1Y3TA 3RZZA 4LA2A 4QXKA 5BPXA 4EWEA 4AVBA 4D7SA 2GC1A 3ES1A 4MGKE 1U12A 3UKTA 1VP6A 3GBFA 2CAUA 4QM9A 2UYAA 3ST7A 4L11A 3D0SA 3H8UA 4Z07A 1SQ4A 3HT2A 2PYTA 5FPZA 2MPFA 1VR3A 3DN7A 4Q0PA 4MZUA 1J3QA 2H0VA 3CF6E 5CU1A 2ZKLA 3C3VA 3IIAA 2ETEA 2GC0A 3NSTA 1CAWB 2UYBA 4MGZE 5JSOA 2WC2A 4D7TA 2O8QA 2PFWA 2KXLA 3UKVA 1O5LA 5FQ0A 1JUHA 4AVCA 4PJYA 3M3IA 3NL1A 2BNNA 5AVPA 1J58A 2ET1A 3FE5A 3H50A 3EQEA 4WZCA 4XF3A 3LA2A 5I8TA 1O3TA 2D40A 3FFQA 1ZZ9A 4KWJA 5BUVA 3MYXA 3MZHA 1ZREA 3E6CC 4OLLA 1IPJA 1QXRA 4O9EA 3TNQA 4QGNA 3EHKA 4F8AA 2XGXA 3RYKA 2H6BA 1FT9A 1O5UA 3KGLA 5I0SA 1RTVA 2QJVA 4I09A 3NVCA 2OA2A 4KL1A 3U10A 4R52A 5FLIA 3LA3A 3FJSA 4X6QB 5KHGA 4ZU5A 1ZRRA 3SXWA 5D1IA 2QNKA 4MUVA 2K9ZA 1XRUA 4KU7A 4IESA 4HVQA 1ZRCA 4WVZA 3FX3A 2O1QA 4IETA 4XFAA 2I45A 4IEZA 4X6RB 1IPKA 4MH0E 3NKTA 3E5UA 4MV2A 1PMIA 5J7MA 4JTOA 4UBGA 3IBMA 4AQ2A 3FWEA 2PAKA 4Q0SA 2XL7A 3B02A 4CYDA 1ZX5A 1OD5A 4QGMA 4YSFA 4EV0A 3DV8A 2XLGA 1DGRA 1X82A 2BGCA 2OYZA 3HIFA 5I0RA 5LRRA 1XE8A 4XF9A 3HQXA 1ZRDA 5C6CA 2Q0AA 4KWLA 4N9HA 2FQPA 1YFUA 3TNPB 1J59A 2PAEA 3M70A 1HW5A 3DL3A 5FLHA 1O7FA 1O4TA 4YRDA 1GQHA 1LRHA 5I93A 1WA4A 1Y9QA 4Z82A 3CEWA 1V70A 4I01A 3CJXA 4E2GA 2UY8A 3BALA 4LLOA 3O14A 2VPVA 2E9QA 4Q0VA 4PIXA 1LB2A 3ELNA 1J1LA 3VHRA 2PAMA 2CAVA 3N4MA 1YUDA 3PLQA 5J48A 2D5FA 3E97A 1QXJA 1ZZ7A 4WBBA 3EBRA 4IEVA 3IDCB 3H3ZA
chains in the Genus database with same CATH superfamily
5FOBB 1ALYA 3ZYBA 5F2WA 3I2JA 3ZXDA 1GZTA 4GXLA 5ISLA 4DXTA 2DTWA 5FYCA 2OZ6A 4Z2AA 5FYSA 4QHBA 5F9TA 1CN1A 4XF0A 1C28A 3DEMA 3HBZA 1VBE3 2P6HA 5F5IA 4H3WA 1ACCA 4IV1B 2K0GA 4D3WA 2XLFA 4OYUA 1AYM3 2IXHA 3WW3A 4ZU4A 4ASKA 4GH4A 4D6SA 5DPNA 2TBVA 1VAVA 4OI0A 3OF1A 1BVVA 1QNYA 1QU0A 1W8FA 2VVDA 3NNMA 5EWSA 3VBHA 3V0BB 3N9NA 4XJWA 4SBVA 5J3UA 4DIQA 1BMV2 4FPYA 3IB3A 5JSPA 1JZ7A 1W9SA 3ILFA 4UAPA 4Z8BA 3MPBA 2GU9A 5LEJA 3QACA 3SLIA 4CDWB 2B4KA 4E4HA 2BZDA 5JSRA 2B45X 4P14A 1HRV3 1OUXA 3MW2A 5DG2A 1ZZ8A 2JG9B 3BPZA 3ZDVA 3ZN6A 1XQNA 2VMFA 2Z69A 3HT1A 3ABZA 3MUY1 1YWKA 2UWBA 3CKHA 4LK7A 3ZYPA 1JZ5A 5E16A 3K3OA 2HYXA 3MLKA 3DPRB 3J9SA 3KB5A 4XCBA 2WNVC 3M3EA 1ASJ2 1MQTA 2DCKA 4MXWA 4AVVA 3VKNA 4PDWB 4HK9A 3H8RA 2DFBA 1YIPA 4L8QA 1TMF3 2ZX3A 4LTAA 1JBCA 5F2SA 1L7RA 2MEV2 5FYUA 1KEXA 2XOMA 4COZA 4QHOA 1LOCA 3O0XA 3ZYGA 2FCUA 1COV1 2QE3A 4NHXA 1NYWA 2ORZA 2WO2A 4B1LA 1WUVA 1EY2A 5A1LA 4AF9A 5B4NA 3PIGA 3MZHA 2ZEXA 1QOOA 3N36A 1UX6A 2BVBA 2QTWB 4J1XA 4UF0B 2BBAA 1W6MB 2IXKA 5FMCA 1JMUB 2W08A 1NA1C 2HWB1 3DGTA 3HN3A 3B94A 3ZKUA 1YQ8A 5A7WA 5FMDA 2OUJA 3HWJA 1TG7A 3B93A 4KNCA 4ZPIA 5FY4A 4XE9A 1D7PM 1GOGA 1Z7S2 2YYOA 1ODNA 3RZKA 1DF0A 3VHOA 1AX0A 4FXGB 4YM3A 5FLJA 4CCEA 1DFQA 3CIHA 3FHQA 3I2GA 4QX7A 1X7NA 2C1FA 2B9UA 1OF4A 3ZFEC 3POYA 5BNPC 5IWFA 1VBC1 4GMP3 5C4WA 4BQ4A 2BOJA 2BERA 4K8FA 1M4WA 4J1WA 1JZ4A 1W6PB 3B01A 4HANA 3J8F2 2PHRA 1LNSA 4XIOA 4XIKA 3UKNA 5KWRA 3RS6A 3CHXA 1W3VA 3IMMA 2VUCA 1WWYA 4ATFA 5K9YA 5DQ0A 3B69A 1SBEA 4NRPA 1U5ZA 1HB4A 1FMD1 4XFIA 1TNFA 3VKLA 1R1A3 3PVBB 1RMU2 2CWMA 2ZX0A 4ZKTB 5FP4A 1W6QB 1JI6A 2GN7A 2R072 4OI4A 4XEZA 4M3CB 4P00B 3VBOB 1GWMA 2KA3A 3WF1A 2Y60A 1RL3A 5DZFA 2BVVA 3EYPA 4JX0A 4OHVA 3VL8A 3M2MA 5FP8A 1HRI2 1IKQA 3ZFGB 4C1XA 3QCWA 3ILRA 4HMZA 4FBFA 5BNNA 4A44A 4GIQA 3OD0A 4LA3A 4QM8A 4YVSA 5CKNA 3PVNA 1XB9A 5I91A 2AUYA 3URFA 1POV1 1RUJ3 4C0BA 3HQRA 1LHUA 3H3UA 1RC6A 2J42A 3N7MA 1Q43A 4QX1A 1O8PA 2P3KA 1GP5A 5C7GA 5AC91 2FMDA 2WIIB 1H9PA 3JQWA 3CL1A 4FO9A 2ZX4A 3GZEA 4A2UA 1EV11 3K4AA 3RPQA 2RHPA 3GHMA 4EN9B 5CFCB 2VZ1A 3K48A 3KHCA 2P17A 3LGRA 2FD8A 2X53S 1G8WA 3A0NA 3WP4A 3VZMA 1GNYA 2Q1ZB 5A7OA 4IGOA 3ZFFA 3BN6A 1KDKA 3QBQA 3RYPA 5KHKA 5FQ0B 5CYYA 1QQP1 3PDQA 2W1QA 3HAGA 3KCYA 4OZXA 4COWA 4JGZB 4WM8B 4Q4Y3 2EXKA 4HPKA 4Z2WA 1UOFA 3LOBA 5GLTA 4YZ1A 1DZQA 1NY71 1NZCA 3FHIB 3ILNA 2OX0A 4IGPA 1CAXA 2GAUA 4FTBA 2JENA 1CAWA 4IEPA 4XFGA 2GDFA 3IM0A 3RZHA 2I07B 3ROUA 1ENXA 1BZWA 5F3CA 4GWMA 4BQWA 2ARXA 5DDJ3 2J22A 4XETA 2VTXA 2DU1A 1V9U1 1XJAA 2BWAA 4JDNA 1HQLA 1PMHX 2JG9C 2WL1A 1NKGA 4FVVA 3TEZA 1LGNA 2JDAA 2ZEWA 4ZU7A 4EE2A 5DAQA 2ZGOA 4SLIA 3JBG3 3SQOA 4HKLA 5KC6A 1SCSA 4HXCA 1H2LA 4XOGA 4BHPA 1WCKA 2HWD1 5EJ3A 4AGRA 2RS12 1F15A 1A8DA 4QPWA 3JQXA 1DGWX 1US3A 1H6YA 1PIV2 4BWOA 4A7YA 3H42B 3S5AA 5GJ6A 2RR12 1DQ6A 5IUQA 1YFYA 3BI3A 1Q5OA 5CVRA 5FIXA 3ZN5A 5FP7A 1PO22 3VHNA 3H1WA 2BEOA 1W3XA 1DZRA 4FPEA 2XKPA 3WX5A 3D5OA 3JD71 2TUNA 2R062 2WNVA 4ZY9A 2YC0A 4NAOA 1NXMA 4QQOA 3ZYFA 1NLSA 4XBQA 5APAA 5BYNA 1AYN3 3PJQA 3WNOA 4HVRA 4XQ4A 1RUOA 3WUDA 4JQTA 1EYBA 1K45A 4P9IA 3VDDB 2CGPA 1PGL2 1VJ2A 2ARBA 2W39A 1Q8QA 1C3HA 5FREA 2Q8CA 1GYKA 3VZOA 3ZXFA 2OZJA 3O7OA 4KU8A 1YJKA 1LAJA 3POBA 4MXVA 2DCTA 5FZIA 2VMDA 4AHWA 1DYKA 3S0MA 1W2AX 2PELA 3G6JB 1HX6A 4W6YA 4YW2A 2VW2A 1UY1A 4M3CE 2NMNA 2E33A 1OHFA 2Y38A 1QWRA 2ZACA 2J1EA 3SCGA 3AYAA 1RUE1 1OPOA 2AGSA 3TBDA 5DZGA 3D82A 3H0OA 1WCQA 1WW7A 3SCHA 3SH4A 3WW4A 5A3NA 1JH5A 1QGLA 2WN3A 4N43B 2EIBA 2W0XA 5FDBA 3WR0A 1RUI2 1FI2A 4N53B 3QOPA 4Y1YA 3FZ3A 4AEJA 3OUJA 4CXWA 4A4AA 3OTFA 3ZSKA 2HWC3 2LS6A 4ZXEA 4WZFA 3ZFEA 1R64A 2XONA 5BNPA 1OVPA 2V72A 4HSLA 3KMHA 3OPWA 5ACA2 1HQNA 4HBNA 1C1LA 2EXJA 5DN2A 2PHWA 5GALA 2Q8DA 5JWPA 5FCCA 2A75A 4JZRA 4NIIA 1XNBA 3ENRA 1W8NA 1DYOA 1GBGA 4ZXKA 1W99A 1XSQA 2WINB 3AZVA 3I59B 1PVXA 3X29B 2P34A 2VTFA 3WF0A 1GZ9A 1OLMA 1WMXA 2Q5TA 2XXZA 4B3NA 2DBIA 3BTXA 1GMMA 4YARA 3FLRA 2PLV1 3MLJA 3MW4A 4JVAA 4MYEA 4RD7A 2YB7A 1FPN1 2MNGA 3H7YA 1XU2A 3RQ0A 4ET7A 1QJU2 3OBZA 2VBPA 2QQOA 3GF6A 2HEYF 3KZ4C 1CAUA 2V5YA 1YRZA 1Y9MA 5CB7A 2W3JA 2B9VA 2D6KA 4OUMA 1QJFA 1S2BA 1OBNA 2D43A 3MIEA 3BU0A 5HCFA 3AMPA 3WDYA 3THDA 4ASLA 1S4CA 1LESA 3UJOA 3GBGA 2WS93 3SKVA 3UKTA 2XUMA 2VY0A 3EMRA 1NG0A 2YGLA 4IL7A 4KQ7A 2UYAA 2DVBA 3T0AA 3NV1A 3Q8EA 1JOPA 4Z07A 1OKQA 4Q26A 2A6YA 2PYTA 5FPZA 4B4PA 1VR3A 4Q0PA 3WG2A 4Q4V1 4Y26A 4MZUA 2H0VA 4AHZA 2EAKA 3OD4A 3C3VA 3SEEA 5EXOA 3T2OA 4JGZC 2YPDA 3EB7A 2R041 4PF1A 1DBNA 1ZBE1 4XJ9A 3VD5A 4RGAA 5JUVA 3HVDA 2WAAA 4FTSA 3K4ZA 2O8QA 2PFWA 3NV3A 3UKVA 3UNPA 1NUKA 2A6VA 1B09A 3AP4A 3FBYA 1AR83 4Y20B 1PK6B 3H8XA 3WNNA 3ZN6B 3OGRA 1HV0A 1NXD1 4FXKB 3UGFA 3M3IA 3RZMA 3ZYRA 4RQPC 1J58A 3V56A 2ET1A 5DAXA 3FE5A 1RUF1 3H50A 4AI0A 4I30A 4KGQA 4Z1VA 4XVHA 5I8TA 1N3QA 3PU8A 1ZZ9A 3WF4A 3NJXA 3NNGA 3TOJA 4YFWA 1MQTB 3VBFB 5IJRA 3TNQA 4NR1A 5C3QA 4F8AA 2YY1A 3MICA 2A73B 1W90A 4J25A 4OULA 3RYKA 5LA0A 2PHUA 2RDNA 3SNMA 1O5UA 1CX1A 3KGLA 4FOYA 2QJVA 5D21A 1RJ8A 2D6PA 2JG9A 2GSYA 4I09A 5FZAA 2OA2A 3NKGA 3VN4A 2NN8A 4FPHA 4AFAA 4XZUG 4FSJA 2A3YA 3BUCA 3AL6A 5CISA 2RS51 4INDA 1S2EA 2NPIA 5CIRA 3BGAA 5T54A 1FX5A 1XNTA 1JYNA 4KU7A 1PGW1 4IESA 1IOAA 4JKLA 3KQRA 5A3UA 4D8MA 5BNOB 1Y9GA 4XAEA 4QXBA 1ZRCA 3N35A 4WVZA 3KD4A 5A7WB 3VDDC 2YHJA 4FPOB 4BISA 3P1IA 2RM22 3RGBA 2CWSA 4AFDA 1TME2 3DECA 4IXLA 4OZOA 5IK5A 1AYM2 3INAA 2B39A 3K77A 1AL0G 4UYBA 4GA9A 1LHNA 1GZCA 1EAH1 2XVLA 2BGOA 3DKQA 1BLZA 3A7QA 3NKTA 5C4WB 4DNYA 5HCHA 3CNAA 4UF0A 1PMIA 1W6MA 1FATA 3KHBA 3NJVA 1SLLA 3P3NA 1W0PA 4JTOA 1WW5A 2BU9A 4Q4W1 4ISRA 1UZZA 3LKJA 5I0DA 4OQ8A 1AX1A 2D98A 3F2ZA 4RA0A 5T5OA 2FDGA 5J36A 3O5SA 4GALA 5ERLA 4NIDA 1ULPA 1COV3 2AC1A 2DCZA 1YQCA 4TXWA 3PUSA 3DV8A 2ZMNA 1OSGA 2VZRA 3MF6A 5FZLA 3ZYJB 1VMJA 1X82A 1WCUA 2BGCA 3UETA 3AJYA 4NIGA 4Q4X1 5LRRA 2IVIB 5FZDA 4CU9A 4XF9A 1V6MA 3MIGA 2HWB3 3WHTA 4YLZA 1ZRDA 3WNMA 4LPLA 1BBT2 5BNNB 1W8UA 1H0BA 2YPJA 1MEC2 4XDOA 3OSDA 1J59A 1TMF2 1LULA 5JR2A 1XSRA 3D8CA 4YM1A 2F17A 1ZBA1 4PLMA 5A33A 3WLUA 1VRH3 2R16A 1AXZA 3CEWA 3CU7A 1Y4WA 3A4UA 3FL7A 3WSOA 3DCQA 3SH5A 4NROA 1H8TB 2VPVA 2E9QA 1HKDA 5T50A 1GFF2 1LB2A 1IS5A 1K5MC 2UWCA 3BKZA 2LW8A 4MLOA 3J4UH 1J1LA 2JDYA 3RZGA 4CCDA 4DUVA 3PVEA 4URAA 1YUDA 4QX3A 1H30A 2JE9A 3VD4A 1ZZ7A 4WBBA 1FMD3 4KBZA 1D4M3 4KH9A 4FTEA 3TN92 4AOCA 4DOUA 3AM2A 3E5XA 2VQAA 5FYTA 4UWDA 3ZFFC 2JICA 4HPKB 5IVBA 1CX4A 1LU1A 1N3OA 2G19A 3ACIA 5JI7A 2VO5A 3MIBA 4XZPA 1G9AA 4LNVA 1POV0 3AFKA 4ITCA 5FZKA 1CAXB 4K1ZA 1RUG2 3BOWA 1ZVFA 5F3EA 2VH9A 4S2GA 4CU6A 1A3KA 4L2NA 1POV3 4Q0QA 3E6BA 5FZ9A 5FPXA 1OF3A 4AWDA 1R1A2 1K42A 3ZSEA 4CRQA 1ULFA 4BA6A 4AEMA 1XNAA 2W9XA 1C57A 2JD9A 5KBFA 4XFHA 5AC93 1C8M1 4JGZA 1PK6C 3HEIA 3ZKYA 2E7AA 4LBOA 1EV13 4G9SB 3BOPA 4ISQA 4HK8A 3ZR6A 3WDVA 4ORFA 4K7JA 2Z5WA 3RJRA 1HXS1 2HBTA 2WYSA 3MLLA 4XTMA 2SLIA 2BGPA 3AZXA 1QJEA 4RS5C 5LEKA 2KD7A 1W06A 3V65A 4ZONA 3WOGA 2PHDA 1NX9A 3MV11 4K40A 3S30A 4HN1A 4CXYA 1RVF1 4HKWA 4M4PA 5FO9B 3IT8A 4KMQA 3VBFC 1AR91 4I3PA 4LOTA 4XBNA 1QQP3 5FMOL 4AK3A 2Y6HA 2VNGA 4AVAA 1ENSA 4RQPA 1KFXL 4NUBA 1VBD1 1H8VA 2W52A 3H1YA 1GR3A 1S0EA 2WNVB 1LR5A 1MS4A 2DCJA 4P02B 1JYIA 5B2GB 3GGLA 1UXXX 2NM1A 1F35A 2GC3A 4A41A 2LM3A 3Q8FA 1D0GA 3AKRA 4H7LA 5G04L 3WEZA 1WMEA 1W2OA 2YFZA 3RVHA 2FZ1A 1BHGA 1D4VB 2J1SA 4UFHA 5FBZA 1AL21 5BNOC 4LOSA 3L2HA 1JYWA 2OQ6A 3KCCA 5FO8B 2ZA9A 4NOTA 1KRIA 4NPMA 4QB2A 5FYVA 4BCUA 2HKXA 4CPBA 3ALQA 1V9U3 2Y0IA 4Q4Y2 3VDDA 4XACA 1GNHA 4DRVA 4FPKA 5FR3A 1YI7A 4BIOA 1W2UA 2HWD3 5JXGA 4P9GA 2J1AA 3TWIA 2Q30A 1FV2A 5LRSA 1MS5A 1PM4A 1ZZCA 3ZFEB 1MVEA 2Z42A 1G9FA 3JD73 2OT7A 5DDJ2 1BEV1 1L7LA 4BIFA 1HIXA 3POJA 1WKYA 4EJRA 2JEMA 4FAHA 4EN8B 1SFPA 5KHJA 5FUIA 2H0BA 4LT5A 1BMV1 3W59A 2ZBJA 2ZKNA 1Q3EA 3MGUA 3N9QA 1GQGA 2VW1A 2PQSA 3WV6A 4BU2A 2BW8A 4BH9A 3LD8A 4OMDA 4B4RA 4WM7C 5F6LB 4F3JA 5LA1A 3BB6A 2QQLA 5GLWA 4LITA 1S0FA 4BMEA 3O1VA 5CA6A 2UURA 4XFBA 5IAVA 1VB4A 4GULA 1ENQA 5CAZA 1F5FA 1CIYA 1Q8PA 1DQ5A 1SZBA 5FP3A 4MGQA 5I8YA 1RUE3 2A5ZA 3FHAA 4TN7A 5LBCA 1A78A 5I0UA 1AYN2 3SHRA 2IVJA 1CAUB 5A3OA 4A7KA 1OI6A 3V64A 1SFNA 4ES9A 5FZMA 3I59A 5J1XA 1WW6A 1J3RA 1H8TC 1LU2A 2Y33A 3ZYHA 3TRSB 2G1MA 1AXYA 1YI9A 3JU9A 2QQJA 4Y24A 4CCMA 5EFUA 5FY5A 2ZGRA 4OI1A 5EYYA 2MEV1 5FWJA 1RUD2 5L9BA 4QB6A 1CESA 4UW6A 1MVQA 3OPTA 4YG3A 1QF3A 3ZIXA 1K5MA 3BYWA 4C8DA 2R1DA 2WFPA 4OHWA 1CJDA 5LBFA 2WR9A 4NPRA 5EIYB 5J37A 1WA6X 1GLHA 4QX2A 4YZ5A 1H9WA 3BPSA 4XF1A 1VBB2 1HB2A 5BXXA 2XJSA 1APNA 3IDAA 4QHZA 5D8AB 1RB8G 2XH6A 4ARXA 2FDIA 1A6CA 1E57A 1E5IA 2GH8A 3B00A 3CBNA 3SC7X 5A6XA 5C70A 2PLV3 4FT8A 4GKYA 4LUKA 3I2FA 3I54A 4C91A 4QKDA 2W95A 1C4RA 1PZ8A 1W2TA 1FPN3 3OOXA 4JQRA 2XBO1 3NJZA 4H7MA 1UW8A 5T3NA 3THCA 5IVVA 5L19A 4GB31 5CEHA 1QKQA 1YHFA 1XE7A 5A3MA 4QT6A 1ENRA 3SKJE 4XDPA 3U75A 2ARCA 3BIEA 5C3SA 4Y4YA 2PHXA 4ONUA 5IK4A 1HN1A 2W91A 3NNLA 2HYKA 4HN0A 2EIDA 3C7HA 2DF7A 2YU1A 4F83A 4LULA 4HFSA 4BQXA 2YBKA 4CP9A 2JE7A 5FZ8A 3AYDA 3VLBB 4MVTA 1UIKA 4S2HA 4Y20A 4JV4A 1J1TA 1PK6A 1TQ5A 2VU9A 5CZKA 4A6OA 1I9RA 1O6UA 2D93A 2HH9A 3J7MA 3Q9OA 5FPLA 1KXGA 2Y0OA 3WY6A 4RS5A 4Q4V3 3TYJA 4XTPA 5JR7B 4UOJA 5BV6A 4GJZA 4QQ2A 3POGA 1HV1A 2OQ7A 4XFCA 1G9DA 1YNAA 3GCWA 2R043 3GJAA 3VKMA 3VBFA 4FQ4A 1VE0A 2DCYA 1PX4A 2VG9A 1VAKA 4NAMA 1ZZBA 2P4EA 2XMLA 1W04A 3RMYA 2BPA2 4E2QA 4EWDA 4JCKA 1JYTA 4RL7A 3AMHA 2GALA 2ZXQA 1W9YA 5H9SA 1QJZA 3IMNA 1N1YA 2RV9A 2Y6KA 3S7IA 2BTVC 2IXLA 2JX9A 5A6YA 2P3IA 4JTNA 3MDPA 1EUTA 1X33A 3P5BA 1LODA 3PTYA 4XF4A 4CEWB 1RUF3 4I0BA 1G86A 5IAXA 1YC61 2R6QA 4O65A 1X50A 4GJYA 4UW5A 5BNOA 5DUUA 2VM9A 2CY6A 5FZOA 3W58A 1AX2A 1V00A 1S2KA 3GZTB 4RGKA 5FPVA 4CXXA 1XYPA 5E6HA 1Q8VA 2RJKA 2F6BA 1UNBA 2VCCA 2YZ4A 2F4PA 1X36A 1JTZX 2QQIA 1AR82 5F6KA 4CDQA 3ACHA 3UESA 3WUCA 3PVOA 1W0NA 4J6GA 4EWAA 4CCNA 3ASIA 3P6BA 2RS53 2H6CA 4AYUA 3AX4A 1JS9A 3O0VA 1W39A 2AENA 4FI9A 2VZUA 3I3QA 4QDRA 5FY9A 3OGVA 2VR4A 2X29A 4B29A 5IFPA 1MS0A 5JMOA 2JDUA 3AKSA 5HV0A 4PHZA 4XUPA 2D5HA 1MS3A 3FBMA 4M4RA 4UFLA 2VXJA 4LJHA 4JHZA 4PLOA 4URTA 5A33B 3KGZA 5L36A 2AH2A 2QQNA 5FXVA 2WZPP 1EAH3 1KJRA 4AGGA 5IK7A 3T2PA 5C33A 1DQ2A 4XUQA 4UXAA 4R8HA 4WM7A 1D2QA 4XAAA 5AFEA 2UY9A 4I3GA 2HJIA 4JC1A 5DUWA 1XNDA 4GQ7A 5DZEA 3OY8B 4Q4W3 4IEXA 2RS11 4AZZA 1CIWA 1IKPA 2ILMA 1PIV1 2ZCWA 3LEIA 4LR4A 3OCPA 2ET7A 2RR11 3WD5A 3NV2A 4NRMA 4DQAA 1PO21 1F4HA 2D6LX 2ZPXA 1IS6A 4KWKA 4BK4A 4H55A 2R061 4G4FA 4IEYA 1DP0A 5J98B 4HVOA 3ZYIB 1H8TA 2J1RA 3RI9A 4A42A 5CBLA 4Q0UA 3O1TA 1ZRIA 1Y3TA 1QJY2 1R081 4Q4X3 4GZ9A 4LA2A 4QD2A 3RZZA 1PGL1 2QQPA 3S6PA 2DUOA 3MBWA 3WNXA 1IGOA 2OUHA 2J1VA 3AMQA 4D7SA 3W21A 4Y5SA 1REFA 2XG3A 3ES1A 3LSDA 1W8HA 4R4XA 5D8AC 4QQLA 3IKWA 4OHYA 1VP6A 3I2DA 4L0PA 5FYIA 3LSEA 2CAUA 1SLBA 2JDMA 1COV2 5J09A 4AVTA 2VQTA 1SQ4A 2RVAA 3P3PA 1RIRA 1UZVA 1VB2A 4RGGA 5T55A 2RG4A 5EHDA 3GHNA 3CF6E 3T0BA 4DY5A 1LENA 3WHUA 4FOWA 4E4SA 2E6VA 1RUI1 2G4IA 4AHYA 4LO6B 2ETEA 2YC4A 3VHPA 2XWBB 3NSTA 5IVFA 1R092 1IS3A 3T2QA 3FLPA 1O5LA 2DVDA 3MIHA 2ZGMA 5JZGC 5ACA1 5HV4A 1S0IA 4RQPB 1VRH2 2AR6A 5LATA 2HWF2 2XJRA 2G9ZA 1UYPA 1IG0A 2BNNA 3LDKA 5AVPA 1UWWA 2QZ2A 3PUHA 5H9QA 3JXSA 1O3QA 2LUWA 3KQ4B 4A7ZA 4XF3A 1FNZA 3EQEA 4LMFA 3KT1A 2X09A 3ACFA 1LOGA 3FFQA 4KWJA 2K46A 2WFF2 3TB0A 3FN9A 4D69A 3E6CC 1ZREA 4O9EA 1C8NA 4RN5A 2VMGA 3HNBM 2WNUC 2XGXA 2EALA 3MUZ1 3ZIWA 2JWPA 3MFAA 5AVAA 4BQYA 5A32A 4P5HA 1D4M2 2DVAA 1UYXA 5FYZA 5I0SA 4QXCA 1UMIA 1JHNA 3A23A 4AAPA 5L9VA 1LOFC 3BIWE 4LO5B 1QJU1 5FLIA 4PCRA 4BZ4A 1C8M3 2PN5A 3LA3A 3MHZA 4K8RB 4X6QB 5ANQA 3USUB 1WLDA 3BTYA 5FV3A 1RINA 1ZRRA 4KI5M 4LKEA 5D1IA 1WMFA 2VZQA 2K9ZA 1HXS3 1LHOA 3NO8A 4WVMA 3WG3A 4Q8LA 1TEIA 2OKXA 4QX0A 4B7EA 1REDA 4CEWC 1N1TA 1DDLA 2JKXA 1WCSA 3S5QA 1GSLA 2GNBA 5K4LA 4AVSA 1RVF3 4IETA 1AR93 1OQEA 2BRTA 4OCTA 1VBD3 2VCMA 2DBNA 3DYOA 2PXJA 5C3RA 2CDOA 2RMU1 1H2KA 3F95A 1LECA 1SBFA 3HOBA 3VBRB 1UKRA 1EUUA 2RDQA 1W6OA 3M4FA 4HETA 4AFBA 5IVJA 1GANA 1PO12 2YBSA 4QQHA 5A1FA 4Q0SA 2WO3A 4LBQB 2VQUA 4DEQA 1AL23 2GNMA 3B02A 3T09A 4W6WA 1DG6A 4A3ZA 4QKNA 3ZOIA 2WT0A 4COUA 2A1XA 3M3CA 1ULGA 4YSFA 1CD3G 1IZ3A 3IAPA 5GZDA 5K0UC 2XLGA 2ZGUA 1B35C 1WD4A 3RFRA 1XPWA 4XMIA 4YZ3A 1LGCA 1XE8A 1O91A 2JDNA 4E4DX 1L7QA 3MPPG 4Q27A 2ENRA 2JDZA 3HJRA 4Y33A 1RUH1 4BK5A 4M0NA 1AF9A 1YFUA 4QXHA 5IHRA 4QAWA 3TNPB 2WAOA 2R1BA 5A3LA 1V6OA 3M70A 2VMEA 1REEA 2XJTA 1OA3A 3DL3A 1NT0A 1O7FA 1LOEA 4GWIA 4EZHA 4BQ5A 2V4AA 2VBBA 4M0HA 4YRDA 1XNCA 2B46X 1SCRA 5KR7A 1NLQA 1BEV3 4Z92B 1Y43B 3BODA 1UY3A 1K5MB 2WQ4A 4Q1PA 4E2GA 2TEPA 1DIWA 4LLOA 3O14A 3VKFC 1KD7A 3PURA 3VZLA 4Y3OA 4W4ZA 3ELNA 1W9FA 3OUIA 1V6KA 3VHRA 2HWD2 2RS32 3JCIA 4IQPA 3PLQA 4UT5A 4E9KA 2ZJCA 3WZ1A 1UOJA 1UXZA 2RM21 1ST8A 1QH6A 2DVFA 4C1WA 1VALA 1GOHA 5C3OA 1TME1 2IWGB 1AYM1 3ZFFB 3IDCB 3U4XA 4EN7B 1ZYBA 1KJLA 3O1PA 4YGCA 3U37A 2CTVA 4XUTA 1QDCA 1QJX2 3I2HA 1YEWA 2JJ6A 3LIHA 3KV4A 1CR7A 5JXHA 2E63A 1NCRC 3TEYA 5D8AA 2GMEA 1W8TA 4NHLA 3BCWA 4MO3M 4CP9B 3K3NA 4UI9L 4YM2A 3VDBA 2MEV3 4LUMA 3GM8A 4TSVA 2XJPA 1DHKB 2WZR2 3AXEA 5FBJA 2BYVE 4D6RA 4DS0A 1W9WA 5IVCA 1T6BX 1UD1A 5FZ6A 4RS5B 5FK8A 3B7MA 3DYMA 2RJLA 4I0AA 4IUGA 4L99A 1G9CA 3S57A 4UBHA 4QPYA 1GOFA 5K7PA 2WKKA 4AE2A 1BBT1 4B7KA 5JZGA 2Q8OA 3RDIA 1IQAA 1MEC1 2Z79A 4F7ZA 1TMF1 3M3QA 4OQ9A 2EAAA 1OH3A 1FOD2 2VOTA 3ZSMA 4CCLA 2XBO3 5FYMA 1JZ3A 3LDRA 3NNFA 4FPGA 4GB33 4XUOA 3AVSA 4FQZA 3ETPA 4RR3A 3J26N 5FPAA 3WCRA 2JIGA 4YW6A 2N7GA 4IW3A 2VJXA 2VECA 4LIUA 4GKXA 4XILA 2WNUA 2FDKA 2X8KA 3LFIA 4RHV1 1SACA 1QXPA 1X9TA 2P6CA 5FZOB 3V0AA 1PGSA 1G7YA 4TLFA 2OPKA 2OXBA 2WSUA 4YM0A 4QGLA 3SITA 1VBE2 3I3BA 1LOFA 1UCXA 3KV9A 4XQDA 3SCFA 1WLCA 3L9JT 1NCQC 4IV3C 3O1SA 3TN91 1ONAA 5L73A 2R0HA 4CDQB 5F7UA 4LBNA 3RSJA 1SPPA 2C24A 1KFUL 4C90A 4MGSA 4NRQA 3WW2A 3GYDA 4CEWA 3LEGA 4BDVB 3KLSA 4EN0A 1CONA 1VBA1 4ARYA 3VGIA 1GNZA 4CUBA 3VBRC 3R6SA 4PIZA 3H1MA 1F2NA 2QFEA 5SV5A 1BQPA 3U07A 3ZPYA 3NV4A 4P5YA 3WQ0A 1NE4A 1VMFA 3GZAA 1RUG1 2VUDA 1AR71 2FDFA 2BOIA 3R4UA 5EYXA 5JAXA 3NNJA 1X8EA 2DWRA 3B5LB 5L7OC 2QUOA 1HRV2 1O3SA 4MGTA 1RUC1 3FUQA 4OMCA 3ZLIA 3IDEA 2IXIA 2ZABA 3QH6A 4YW4A 5LBBA 2W47A 4UFJA 2ZMLA 5AFBA 1UY4A 1KS5A 3N9MA 3HQUA 2IXCA 3POFA 3W5MA 4WM7B 1UX7A 2ZGQA 4YW1A 1YFWA 1N1SA 2WUHA 2Y26A 2R042 1OFNA 1XXNA 4YPJA 5A6QA 4YG0A 5I8SA 3R0RA 1UAIA 1RHI1 2JB4A 3BU7A 5F1RA 3O1OA 1PVC1 2D6OX 2AYHA 5K0UA 2ZGKA 5JXJA 1B35A 1DQ0A 1FAYA 3CDZB 2DUPA 2PMWB 1BYHA 1BXHA 2Q4SA 4QMAA 3LCPA 4EN6B 1MZEA 5FMOS 1VBC3 3WF2A 2EXHA 3M1HA 4YVWC 2C9KA 3RI8A 3D0JA 2BV4A 5K8SA 3EO6A 4MG2A 1NQDA 3SEPA 4LXLA 3CO2A 3DKWA 3ITQA 4KBBA 1M06G 4AR2A 3OY8A 1OA4A 1OPMA 4QX5A 5FZFA 3HBKA 4V2WA 2JD4A 4LORA 3HNYM 3O0WA 1IS4A 5A3WA 4AW7A 2XQRA 2PHTA 2EF6A 2BUKA 2FHRA 2VGDA 4XABA 1OOPC 1V6LA 1MZFA 3CJIC 4BLJA 3H8OA 4JKKA 1XC6A 3PMSA 4DFSA 1SDWA 1U0AA 1OD3A 1Q8OA 5F37A 1AR61 3Q8AA 3WCSA 5LCWL 4ZZ8A 4Q4Y1 4BYYA 2VW0A 1S0GA 1QHDA 3KVBA 3LE0A 4XJZA 4XMAA 5DABA 4XURA 2VBDA 2EIEA 1MACA 5FY1A 3RJ2X 4AGVA 2VMHA 3PJYA 1PIV3 1VPHA 2E51A 4JRLA 2RE9A 2RR13 4ATEA 5KC5A 1UU5A 4W6XA 3ACLA 1PO23 2CV6A 4HSJA 5B4XA 1DGRN 2A71A 2MHFA 4BQ3A 2O0OA 2R063 4AI1A 5DDJ1 1EAH2 2WLPA 1NCRA 2DUQA 3LA7A 1DCSA 1AJOA 5FKBA 4CCCA 3VZKA 1YXWA 2XJUA 1UU6A 3K2OA 5F5QA 1R083 2V73A 4Y22A 1RYYA 3TEWA 2VUAA 2XVKA 2J7MA 1ULCA 4QX8A 2IC1A 3Q8CA 1NOVA 4QKBA 3UT0A 4YNIA 2HWE1 3G7DA 3KSCA 3VL9A 2XVGA 1UMHA 3D3AA 1ZM1A 2B42B 2JKBA 2P3JA 1W03A 3AMNA 1RUJ2 3H9AA 3OG2A 2JDKA 2Y6JA 4WVVA 3K51A 5A32B 3ZXEA 5JI9A 3GDBA 2ZGPA 2A3WA 5FZCA 3USSA 4DZGA 2NLRA 3FFZA 2WN2A 4KG8A 2VTXJ 2VZOA 4YW3A 2XQXA 3MFCA 1CZTA 1JU4A 1AYN1 4LHSA 5HCBA 2EXIA 5FZBA 1OC1A 3OYWA 3NRUA 4Q4X2 1RUI3 5F32A 1FYUA 5GZGA 3D4KA 1ODMA 4WVMB 5FZEA 1JUIA 3JUUA 2ZHLA 3APBA 5LK7B 2SBAA 1MZ6A 2Y64A 1E5SA 2XLAA 3RRDA 5DMYA 3ECQA 5HI0A 2WSVA 5FUPA 1I3HA 4HT1T 3VDAA 1MR5A 2LRPA 3I2IA 5C5TA 4DPNA 1RUD1 2O8OA 3UYJA 2NMOA 5ACA3 3LOIA 1S55A 2FBEA 2QZ3A 3I8TA 3J7HA 4IEUA 4MSVA 4OFGA 5C8CC 4UW3A 4BMBA 5F5AA 3U4SA 2VOVA 3AXDA 5DG1A 3USUA 5CG8A 3VZNA 4CDQC 4D94A 2GC2A 2QDRA 1VBB1 1W6OB 4QDSA 4AEDA 3W9AA 3IIIA 2ADEA 2O14A 5C9AB 4NWVA 1OLQA 2CDPA 4PT6A 2JG8B 1DLLA 4IV3A 1NCQA 5DUXA 3PUQA 1GQPA 1U5IA 3HR9A 2NYYA 3HD8B 4BQ2A 1DZTA 1LOBA 4CU8A 1PZ9A 1F31A 4NHMA 2VZVA 3OGJA 1QJU3 1L3JA 1QY4A 3ZXAC 1S0JA 3VBRA 4W65A 2E26A 3VBSC 4HONA 1ND3C 1OLRA 3AKPA 5H9PA 3C7FA 1JOBA 3AVRA 3JBG2 2Y6GA 3WDXA 3WP6A 2ZHKA 5L7OA 2DDUA 4MGYE 1LKNA 2AZ5A 4LBQA 1IG3A 4LO8A 2DYCA 1YQ5A 2OIIA 3POSA 2ZGLA 4K9SA 4CUGA 4OI2A 2YFUA 2C5DA 1N3PA 4NIAA 2ATFA 3S7EA 2RMU3 1DGLA 4R9CA 4YG6A 3UL2A 3LWCA 1UU4A 1K12A 5HXVA 4NJ4A 1UOBA 3GALA 3NMBA 4Q8KA 4U36A 1HXS2 2QCSB 2VOXA 3FUOA 4W50A 1TVGA 3UV9A 4XW3A 1GP6A 1ASJ1 2WA4A 4XC9A 4LBLA 2EA7A 5FFOC 3O12A 1IPSA 2EVXA 2RDSA 1W0OA 2B7YA 4IEOA 3WW1A 3RNSA 1HDKA 2FMYA 3AJZA 3AZZA 3PIJA 4YVWA 5DAWA 5A3TA 4NHYA 1JXNA 4IEQA 4AI9A 4LLFA 1SLAA 5JXIA 1UZYA 3C7GA 1HLCA 2D97A 4IERA 4CCKA 2D44A 4CCOA 5FOJB 1MPXA 2VCBA 1J3PA 5E1RA 1QMJA 2W68A 5FY7A 4LO4B 1F4AA 4QXKA 1ULOA 2RJ2A 5GKAC 3BTZA 2W1UA 4YGBA 1WCDJ 1JU3A 1RUH3 3NAPB 4YW5A 1OOPA 2Y6FA 4FCAA 4Y4RA 2KM2A 2XWJB 3B3QE 3CJIA 4AI2A 4CDXC 2HWC2 5FK7A 5FY8A 1AL22 4MGKE 1Z7S1 1VAMA 5EV7A 4YGEA 4IE7A 1IHMA 3GBFA 3I49A 5ABJC 1YIFA 3KT7A 4L11A 2VNVA 4MADA 3OBRA 3H8UA 5F39A 3UK9A 3Q8BA 5CFDC 4QPGC 4Y5Z0 4XJAA 2MPFA 3DN7A 3DUIA 3T08A 5HPOA 5E88A 2D6MA 4K20A 3J8F1 1QDOA 5GLUA 2G9FA 4COVA 5J96B 3D6EA 5JPNB 3AK0A 1SLCA 1UL9A 3A0KA 4FP2A 4S2FA 2GC0A 3UGGA 2UYBA 4MGZE 4BPZA 1DLCA 5JSOA 5JZGB 2OVUA 4IE6A 4DY3A 1CPMA 2RM23 3PU3A 1UZWA 4LE3A 5FUNA 2KXLA 4KWUA 2XHNA 1TME3 1QNWA 2CNAA 4N90A 3ZMNA 1I1EA 1RMU1 3AMMA 2EICA 4UFIA 4AVCA 2P5BA 1W8WA 1BEV2 3OGSA 2P1BA 1ZA4A 2R071 4RR3B 5DUVA 4CVUA 2NP0A 2QDNA 3KV6A 1OKOA 1GWLA 1MS8A 4JDOA 4WZCA 3LA2A 5A7SA 1O3TA 4H14A 1H6XA 1NQJA 2D40A 1HRI1 4L97A 2WNUB 2QQMA 4OLLA 3V0AB 4FPCA 2GP3A 1ZBE3 4IDZA 3EHKA 5FPBA 2CGNA 3T4VA 4ZZ5A 5EJZB 5C5UA 1U5YA 2WS92 3ZVXA 5JVVA 3AYCA 3WQBA 3NVCA 3PHMA 2VZ3A 3ACGA 4EZ4A 4PF5A 1SPPB 4KL1A 1JODA 3U10A 1KITA 3FMGA 3T0DA 5LA9A 2QKDA 3WQ7A 3K75B 5LBEA 3WNPA 5LY2A 3SXWA 1OLME 1QJY1 2E32A 2QNKA 3HN1A 4MUVA 1XRUA 1SHWB 2R7EB 4FPLA 3ZSJA 2JXAA 4OHZA 4DXSA 3LIGA 5FZ3A 4DXZA 2XDVA 2ZZQA 1BBT3 2A70A 1MEC3 2BBVA 5C9AC 5C8CA 3C2UA 2JG8C 2LTNA 4JDMA 4XFAA 1ULEA 5IW0A 1SDDB 4PQ9A 3SISA 3N7LA 1TE1B 4MH0E 3O1MA 2CU5A 4YWAA 4BLIA 2R49A 2GMMA 4KG0A 4AQSA 3VD9A 4MV2A 3WP5A 4X8PA 4HL0A 5J7MA 1S1AA 4LHNA 3WG4A 4RHV3 4PI2A 4Y1UA 1LEMA 1UF2C 4A45A 4BQ1A 3OUHA 4XCAA 2PAKA 1R091 5JMCA 1OFSA 2RDRA 1K3IA 4HKOA 3VB9A 4GMP0 2WT1A 4CYDA 1AVBA 5K0UB 5CNAA 1B35B 2F4LA 3TN93 1ND3A 2XBO2 1VRH1 4L9BA 3J7NA 2HWF1 5GZEA 4QGMA 3ZXLA 4GB32 4BJ0A 4NPLA 2QQVA 1UQXA 4QPIA 1SMVA 1XBFA 1AZDA 5BNQA 3PL0A 2OYZA 3HIFA 1VBA3 2LROA 1LOAA 1GWKA 4NWWA 3N9PA 4GD4A 2WFF1 3WNLA 3AKQA 3MV01 5JLVA 4KWLA 2C9AA 2YGMA 4N9HA 4Q2FA 1RUG3 5FYHA 1AR73 3MEPA 4XBLA 5A1AA 1NLRA 2XB6C 4ZHNA 4XHXA 1HW5A 3VD7A 1D4M1 1KQRA 1YJLA 2VZTA 5FLHA 1O4TA 1RUC3 2P37A 5I93A 1LRHA 4KGGA 1WA4A 1Y9QA 2G9GA 2VVEA 3CMGA 4Z82A 3T1MA 1UMZA 4I01A 3CJXA 4JGYC 2UY8A 1GICA 2WWJA 4B8EA 3QLQA 2A7AA 1JHJA 1QH7A 2Q8EA 3GCXA 3U1XA 3MIDA 2OW4A 5FZ7A 1QOTA 2PAMA 2FDJA 1NAEA 4ASMB 4CDUA 2FDHA 3N4MA 5E89A 2D5FA 2WQZC 1QXJA 1S0BA 3C7EA 1RHI3 3E97A 3WINE 5IT6A 3KS7A 1PVC3 4LBMA 2WQ8A 3NAPC 2DURA 1ZBA3 1CQ9A 2VE1A 3W20A 3ZR5A 1OXCA 2OS2A 3H3ZA 5FXZA 1CAVA 1JYCA 3E6DA 3UJQA 4ZS3A 1N1VA 1NCRB 3LPFA 3SMHA 2ES3A 3CLPA 3VBUB 2W46A 3R4SA 1LTEA 2I74A 1I6XA 3JB8A 5C71A 4CDXA 3R05A 2ZX2A 2WABA 1H1MA 4Y22B 2HWB2 1BCXA 2VUJA 3AP6A 1PO11 1EPZA 2X10A 5LY1A 5A6ZA 5LASA 2DV9A 1JZ2A 1WLWA 5ABJA 4GAZA 1WD3A 3CQOA 2XUEA 3E5QA 4TZDA 2PQQA 3T3YA 1JZ6A 5CFDA 1TNRA 2EIGA 2Y8KA 4QPGA 2GN3A 1CVNA 1BJQA 2ID4A 4DUXA 3HPNA 4IV1C 3ES4A 4M00A 1AR63 1VBC2 4Y1VA 3OEBA 4S2DA 1XYNA 2JE8A 4XDQA 2R30A 5SV8A 3OYWB 3MO4A 5D2AA 1TZOA 4RR3C 2JECA 2VAUA 2KR2A 2W92A 3LEMA 4QWNA 3U78A 4R9DA 3GJBA 3JZVA 2V09A 2WWUA 1OVSA 2WT2A 1FMD2 5JCTA 1XU1A 4IEWA 3QH7A 1Z0HA 3LAGA 4CDWC 4R9BA 1QOSA 5E8AA 4CCJA 1H2NA 1O4YA 2ERFA 5ANNA 4FP3A 4ZS2A 5I0TA 4AQTA 1ND2B 4CEYC 4AFMA 3VZJA 1UO9A 4DINB 2VNRA 5FWEA 4AEDB 4CUCA 2Y6LA 2BWCA 3U11A 2HEVF 4BOWA 4M01A 3DPRC 4B1MA 4P9JA 5LK5A 2ZHNA 2RS31 2VULA 4IV3B 3RYRA 1NCQB 1WZXA 3VD3A 4HG6B 4TWTA 2HWE3 3KF3A 1UY0A 4NN0A 1UN1A 3A21A 3T30A 4NE9A 4PDWC 1JOJA 2WDBA 3I2OA 3A22A 3LQCA 2XKOA 2GH2A 1OQ1A 5CADA 2AREA 4FPFA 1QJX1 1SFYA 2QBXA 2E7QA 1GZWA 3IDBB 5AC92 1UPSA 2QQWA 3O1RA 1EV12 4LK6A 1LCLA 1R082 3H7JA 5FRAA 4HZFA 1CJPA 1QIQA 2I2SA 3DXTA 5A7PA 4CE8A 3SH3A 4GWNA 5C9AA 3POWA 4DMIA 1I5PA 4BB3A 2JG8A 2XJVA 5L7OB 2D7FA 2GP5A 1NZIA 3CZUA 2GNTA 2WNEA 3HNMA 1W6NA 1XOYA 1YCIA 4XJ8A 2ZEYA 1RUD3 3PUAA 4QKFA 1O8SA 1QQP2 3AP9A 2X5IB 2GZWA 2D3RA 2WZR1 4O61A 5LA2A 3N9OA 4QDQA 3PTRB 3WP3A 4AQ6A 4E2SA 5A3PA 5HBAA 5JIUA 1ULDA 3RWKX 5JIAA 4E8CA 2D6NA 1NA1A 1A8MA 5DAPA 2IUWA 3KF5A 5A80A 1RXFA 4XJUA 1LEDA 2ADDA 1UYZA 3EJKA 1VBB3 3ZSLA 1NY72 3PUIA 1HB1A 4PBOA 5T5LA 5T5PA 3OBAA 2VQ0A 1RITA 2ZGTA 4LKFA 4Q1RA 4WVWA 5KHHA 1JYVA 1W05A 5EJ1B 3M7AA 3ZXGA 3NJYA 3I3MA 5JPMB 1NE6A 1RGSA 4P08A 5FP9A 1FOD1 1DYPA 4YVWB 3AC0A 3DF0A 4DXRA 5TSWA 2XHKA 5LWBA 3I4IA 1WW4A 1V9U2 4BE3A 4EQVA 5IK8A 4N8MA 1PM7A 4XUNA 1HJGA 5JOXA 3VBOC 1U5XA 2ZX1A 4CSWA 3I2KA 1OOPB 4MHUA 3CJIB 1GU3A 3I3EA 2WRAA 3L2YA 3DXUA 3RWNA 4V2VA 1VBE1 3ZFGC 3NQHA 3KVAA 1JYXA 1D2SA 4EROA 3O1UA 1X8MA 4JGYA 4K21A 2Q1MA 4Y1XA 1VLNA 1YYNA 2E31A 3ME2A 3WDWA 3JD72 1O4ZA 2QQUA 1FXZA 2BDRA 2D3PA 2PA7A 3IPVA 1WLTA 2ZOEB 5C8WA 5KXEA 1CZSA 3GBWA 1JW6A 1ZZ6A 2K2SA 3TAYA 1P8JA 1CPNA 2JDPA 3MF9A 5LZ6A 2V4VA 1E5HA 2DVGA 3THTA 4AAXA 3VKOA 4E4ZA 3GXUA 1H1IA 4XFFA 2BNMA 1ASJ3 2UU8A 3VBUC 3HMYA 3NAPA 3I97A 4META 4PQQA 4PIYA 3AP7A 5FXXA 3WDTA 5CFCC 4R4ZA 2ORXA 2VCAA 4H2AA 1RXGA 1EP0A 4I02A 4O7XA 1HRV1 1EPWA 1C1FA 1KDMA 2AEYA 4AEKA 2OPWA 5KXDA 1W9TA 4LE4A 4BXFA 4GH4B 4K3UA 1O3RA 4AG4A 1RUE2 2WBKA 2RMU2 1DQ4A 1QEXA 5FZ1A 1OURA 5H9RA 4DB5A 5GM0A 2VOKA 3VBHB 2QVSB 4PBPA 1S0CA 1WGPA 3AP5A 2FZ2A 1ZNPA 4WM8C 1D0HA 5IVYA 4JAAA 4U2AA 4IGQA 4UFMA 5FZ4A 2WZ8A 3IAQA 1LJ7A 2IXJA 3LZZA 4IE4A 4WV8A 1Z7S3 3M3OA 4Q29A 4IV1A 3FC0A 4GWJA 4DEVA 1H4HA 3BTAA 2WLQA 5GLZA 3AFGA 3IWZA 3LPGA 1J83A 2Z4FA 2ZMKA 3OEAA 4FFFA 4MXWB 3M8LA 3ZO0B 3AL5A 2IZWA 5FZGA 2L9LA 5KXBA 2XL9A 4JKMA 1RUNA 2B5HA 4M3CF 1PNGA 3V0BA 1DU3D 4Q5OA 4C0HA 3J8F3 3WQ1A 2IFRA 2W87A 1Y7BA 2PTMA 2W5FA 4QB1A 5LW9A 1ND2C 3FLTA 4XQWA 4AXOA 1RUH2 2C6SA 4MOAA 4N9IA 2VC9A 5DXDA 4AEDC 3PNAA 2HBUA 2E7TA 4CDWA 3RZJA 3CZJA 2PHLA 2YMZA 4LBKA 5C8CB 2AACA 2PLV2 5IFTA 5JOZA 3ZX7A 1G6NA 1RMU3 4CEYA 1FPN2 4JRAA 3ZDSA 5JOWA 1UKGA 2ZAHA 3OB8A 4OUSA 4XYXA 5JOYA 1V0AA 2FCVA 2R073 2VOWA 4GMP1 4B4QA 4DRRA 1F8VA 3DPRA 2NZ9A 1UPIA 3VV1A 1STMA 1WBFA 5T5JA 4ES8A 5EQUA 1HRI3 2IFWA 1C5IA 1US2A 2C4XA 4YGDA 1PX3A 3T1LA 3VUOA 2ZEZA 1JN2P 2WJSA 4HLTA 1GKBA 4PDWA 2P3YA 3N9LA 2DU0A 3NW4A 1CZVA 1G9BA 2PHFA 2P2KA 4FAGA 1I5ZA 1OT5A 1X9PA 2R0FA 1KS4A 3ETQA 1R1A1 4I2OA 3IZOA 3WG1A 3VBSB 3U0ZA 1ND3B 2Z2SB 1XE0A 3K46A 1W8OA 3LFMA 4QPIB 3VDCA 4XPVA 4Q4V2 2X5IC 1JZ8A 4N7UA 4NVPA 5FYYA 1QJY3 2B8MA 4O9GA 1R1ZA 4AL9A 5A7NA 4IE5A 1V6NA 3AZWA 5FKCA 5FZ0A 5CKMA 1OQDA 1HQWA 1POQA 4N43C 4YW7A 5IYYA 4DO0A 4CP2A 1ZBE2 4CZSA 4OUEA 1MZ5A 5L9RA 4BXSV 4N53C 5GZFA 2VXRA 1C5HA 1F5JA 5F8PA 1UYYA 1RUJ1 1V6IA 5EZWA 4OVEA 5T52A 4E27A 3NWKA 5M0TA 5FO7B 2DTYA 1SG3A 4CP1A 3JB4C 1CGPA 1BVP1 2YUEA 1UIJA 1W28A 1E5RA 4XXPA 4LO7A 4OHXA 3ZMOA 4LBJA 3EXUA 1YFXA 2VD7A 3MI8A 5BY5A 4FOQA 5F3IA 1RUF2 4TTGA 1W6PA 4RFT0 1DGWA 1SEFA 1AXKA 3I3DA 2DFCA 4YYOA 4CDUB 3WNKA 2YXSA 2X05A 1H2MA 1R093 1YLLA 1W8ZA 2BNOA 4Y1ZA 2WZEA 2VZSA 4YVSB 3RG0A 3ZXJA 2WO1A 1BK1A 3WVJA 4CEYB 2C0ZA 4Y5TA 1PZ7A 2TNFA 1VIWB 2HWF3 4LKDA 4LEJA 3I7DA 1CAVB 1W6QA 4R9AA 4MGIE 1OMIA 3VBOA 1VMHA 2W2IA 4MX3A 2A6ZA 4M3CA 1UY2A 2J1UA 2RS52 5KHIA 5C3PA 1ZRFA 3OJBA 1BKZA 2XPJA 4CU7A 3W5NA 1LGBA 4CDXB 1PGW2 3IN9A 3ZFGA 2WFF3 2CYFA 5CG9A 1HN0A 4RHV2 1UOGA 2RS13 4LKSA 2Y34A 5BPXA 3OGGA 2A6XA 3WT3A 4EWEA 4AVBA 5ABJB 2GC1A 4V1PA 2ZGNA 2WNOA 1U12A 2YV8A 5GLVA 2BJSA 2ZAAA 3BVCA 5CFDB 1SBDA 4QPGB 1DQ1A 1URXA 4RFRB 4QM9A 3ST7A 4D7YA 4FFGA 4COYA 3KCXA 3D0SA 3ON7A 4A3XA 1PNFA 3HT2A 2WA3A 3DYPA 2ZHMA 2XJQA 3PMEA 1J3QA 4FFIA 5CU1A 3VBUA 5HCAA 4GH4C 1VBA2 2ZKLA 4FFHA 5LB6A 1OA2A 3U14A 3ZPOA 5CFCA 3ATGA 2HLEA 5FXWA 3JBG1 2VL4A 3IIAA 2BQPA 4E8DA 4Q4W2 2R32A 2W1WA 3VBHC 1CAWB 1J84A 1FV3A 1T2XA 1AR72 2WC2A 5FAXA 2QQKA 4D7TA 3LF7A 3GZUC 2A6WA 1F9KA 3H3LA 2FCTA 5FQ0A 3AZYA 4P9YA 4CTEA 4W8JA 1JUHA 1RUC2 3N7JA 2A3XA 2ZS6B 4LQRA 3ORJA 4PJYA 3NL1A 1AUYA 1XYOA 5FPUA 3KWVA 5DAVA 2GNDA 1O59A 4WM8A 5CKQA 4CPBD 1S0DA 5F5CA 1W2NA 3KM5A 1PMJX 4AI3A 1MS9A 1XNKA 4P9XA 5BUVA 3MYXA 5FJHA 2YC2A 1PO13 4EYUA 1IPJA 1QXRA 3OPZA 4LHLA 5FTTC 4QGNA 2LALA 3MIFA 1OH4A 2BFUS 1RHI2 4NMIA 2H6BA 3B9CA 4CUAA 1FT9A 1MQTC 1PVC2 1RJ7A 2WYFA 3J7LA 4N7IA 5FMBA 1RTVA 5G05L 1ZBA2 5HXMA 2E53A 4K1YA 2WWSA 2YROA 3MW3A 4QU1A 4R52A 1Q56A 3C7OA 2VNOA 3FJSA 1GZWB 1ND2A 4P9LA 2YU2A 5A70A 5IATA 5KHGA 1HJFA 1ZA7A 4ZU5A 4NHKA 3WF3A 4HVQA 4L92A 1T6GC 5GZCA 5EP9A 2JDHA 5FYBA 4LHKA 1V6JA 1WMDA 2HWC1 4FOVA 3ZN4A 2J1TA 4XHBA 1W6NB 3FX3A 2O1QA 4LBQD 5FY0A 3KV5A 2CL2A 2I45A 3LEKA 1Z78A 4IEZA 4X6RB 4X8NA 2WO7A 1IPKA 4D6QA 2YBPA 1HB3A 4G3YC 4CA9A 3R4DB 3N7KA 1BK0A 4XXAA 5JDBA 1AR62 1GP4A 3E5UA 4NO4A 1LHWA 1NA1B 3POIA 4FPJA 2ZTNA 3C8XA 1LHVA 4QQPA 4YZ2A 1N47A 4AFCA 4QPIC 2JIJA 5C4WC 4UBGA 4BM8A 3IBMA 4AQ2A 4I0WB 3E1F1 3FWEA 4MHRA 4LIVA 1VRBA 2RS33 3KT4A 1A34A 4AHXA 2XL7A 2ZZJA 1GUIA 5F3GA 5FZHA 5BNPB 4A6SA 1YO8A 1YQ2A 2AEZA 1ZX5A 2X5IA 1SLIA 4TLGA 3AKTA 4TYSA 3LB9A 1OD5A 3T2TA 2Q1FA 1MS1A 4UFKA 4DUWA 4EV0A 1QJX3 5FJKA 3RZLA 2YDEA 1C8M2 2C26A 2ARAA 5IVEA 3OBTA 1DGRA 3RMXA 2VVFA 3N3HA 4N43A 3UGHA 3VBSA 5I0RA 1PHMA 1GV9A 2JB8A 3T4HB 2VMCA 1Q8SA 2V5DA 4N53A 2BFUL 3HQXA 2D3SA 4UW4A 1K5JA 4P9WA 5C6CA 2YG0A 3WXPA 2Q0AA 3QD6A 2FQPA 5EPAA 4QU2A 2HWE2 2WS91 4HOOA 4PI0A 3TEXA 1YQ6A 1RVF2 2PAEA 4CDUC 4YFZA 4JHTA 1AR92 3K4DA 5BNNC 4JGYB 1AHSA 2WZR3 1GQHA 3WDUA 1CWPA 1VBD2 3B9IA 4YVSC 4RSUA 1OUSA 3ZM8A 1V70A 3IPVB 3ZXKA 2NQYA 5KXCA 1SLTA 2W1SA 3BALA 4CP0A 2CHHA 3LDBA 3GNEA 2ZGSA 3POEA 4Q0VA 4D0QA 4PIXA 4NIHA 2CGOA 1FNYA 4RYDA 1IQDC 1AJKA 3THPA 2CAVA 1WBLA 4AI8A 2GMPA 1H4GA 2HEWF 2BP6A 2CSGA 5J48A 1UZ0A 2W94A 4PLNA 4IE0A 3EBRA 4IEVA 2VMIA 1FOD3 3AYEA 1AR81 1KGYA 2UWAA 3AB0A 4YZ4A 5A7QA 2XR4A 2VZPA 1H1AA 4K6BA
chains in the Genus database with same CATH topology
5FOBB 1ALYA 3ZXDA 4GXLA 2DTWA 2OZ6A 4QHBA 5F9TA 1CN1A 4XF0A 1C28A 3HBZA 1VBE3 4H3WA 4IV1B 2K0GA 4D3WA 2XLFA 1AYM3 2IXHA 3WW3A 4ZU4A 4GH4A 2TBVA 1VAVA 4OI0A 3OF1A 1BVVA 1QNYA 1QU0A 2VVDA 5EWSA 3VBHA 3V0BB 4XJWA 4SBVA 5J3UA 1BMV2 4FPYA 5JSPA 3ILFA 4Z8BA 3MPBA 2GU9A 5LEJA 3QACA 3SLIA 4CDWB 5JSRA 2B45X 4P14A 1HRV3 3MW2A 5DG2A 1ZZ8A 2JG9B 3BPZA 3ZN6A 4CEYB 1XQNA 2Z69A 3HT1A 4MXWA 1YWKA 2UWBA 3ZYPA 5E16A 3MLKA 3DPRB 3J9SA 3KB5A 2WNVC 3M3EA 1ASJ2 1MQTA 2DCKA 4AVVA 3VKNA 4PDWB 4HK9A 2DFBA 1YIPA 4L8QA 1TMF3 2ZX3A 4LTAA 1JBCA 2MEV2 4COZA 1LOCA 3O0XA 3ZYGA 1COV1 2QE3A 1NYWA 1WUVA 1EY2A 4AF9A 3N36A 1QOOA 4J1XA 1UX6A 2BVBA 1W6MB 2IXKA 2W08A 1NA1C 2HWB1 3DGTA 3B94A 2OUJA 3HWJA 3B93A 4KNCA 4XE9A 1Z7S2 2YYOA 1DF0A 3VHOA 1AX0A 4FXGB 4YM3A 5FLJA 1DFQA 1X7NA 2C1FA 2B9UA 3ZFEC 3POYA 5BNPC 1VBC1 4GMP3 5C4WA 4K8FA 1M4WA 4J1WA 1W6PB 3B01A 4HANA 3J8F2 2PHRA 4XIOA 4XIKA 3UKNA 5KWRA 3RS6A 4ATFA 5K9YA 3B69A 1SBEA 1U5ZA 1FMD1 4XFIA 1TNFA 3VKLA 1R1A3 3PVBB 1RMU2 2CWMA 2ZX0A 4ZKTB 1W6QB 2R072 2GN7A 4OI4A 4XEZA 3VBOB 4M3CB 3WUDA 2KA3A 1RL3A 5DZFA 2BVVA 3VL8A 4OHVA 3M2MA 1HRI2 1IKQA 3ZFGB 4C1XA 3QCWA 3ILRA 4HMZA 4FBFA 5BNNA 4GIQA 3OD0A 4LA3A 4QM8A 4YVSA 3PVNA 5I91A 2AUYA 3URFA 1POV1 1RUJ3 4C0BA 1LHUA 3H3UA 1RC6A 3N7MA 1Q43A 2P3KA 5AC91 2FMDA 2WIIB 1H9PA 3JQWA 3CL1A 4FO9A 2ZX4A 4A2UA 1EV11 3RPQA 2RHPA 3GHMA 4EN9B 5CFCB 3K48A 2P17A 3LGRA 2X53S 1G8WA 3A0NA 3WP4A 3VZMA 2Q1ZB 3QBQA 1KDKA 3RYPA 5KHKA 5FQ0B 1QQP1 3HAGA 3KCYA 4OZXA 4COWA 4JGZB 4WM8B 4Q4Y3 2EXKA 4HPKA 4Z2WA 3LOBA 5GLTA 4YZ1A 1DZQA 1NY71 1NZCA 3FHIB 3ILNA 1CAXA 2GAUA 4FTBA 2JENA 1CAWA 4IEPA 4XFGA 2GDFA 3IM0A 2I07B 3ROUA 1ENXA 1BZWA 4GWMA 2ARXA 5DDJ3 4XETA 2DU1A 1V9U1 2BWAA 4JDNA 5I0UA 1HQLA 2JG9C 2WL1A 4FVVA 1LGNA 4ZU7A 2ZGOA 4SLIA 3JBG3 4HKLA 5KC6A 1SCSA 4XOGA 1H2LA 4BHPA 1WCKA 2HWD1 5EJ3A 4AGRA 2RS12 1A8DA 3JQXA 1DGWX 4BWOA 1PIV2 4A7YA 5GJ6A 2RR12 1DQ6A 5IUQA 1YFYA 1Q5OA 5CVRA 3ZN5A 1PO22 3VHNA 3H1WA 2BEOA 1DZRA 4FPEA 2XKPA 3WX5A 3D5OA 3JD71 2TUNA 2R062 2WNVA 2YC0A 1NXMA 4QQOA 1NLSA 4XBQA 5BYNA 1AYN3 3PJQA 4HVRA 4XQ4A 1RUOA 1EYBA 4P9IA 3VDDB 2CGPA 1PGL2 1VJ2A 2ARBA 2W39A 1Q8QA 1C3HA 5FREA 1GYKA 3VZOA 3ZXFA 2OZJA 3O7OA 4KU8A 1YJKA 4MXVA 2DCTA 4AHWA 1DYKA 3S0MA 4W6YA 2PELA 3G6JB 1HX6A 4YW2A 2VW2A 4M3CE 2NMNA 2Y38A 1OHFA 1QWRA 2ZACA 3SCGA 3AYAA 1RUE1 1OPOA 2AGSA 3TBDA 5DZGA 3D82A 3H0OA 1WW7A 3SCHA 3SH4A 3WW4A 1JH5A 1QGLA 4N43B 2W0XA 5FDBA 3WR0A 1RUI2 1FI2A 4N53B 3QOPA 4Y1YA 3FZ3A 4AEJA 3OTFA 3ZSKA 2HWC3 4WZFA 3ZFEA 5BNPA 4HSLA 3KMHA 5ACA2 1HQNA 4HBNA 1C1LA 2EXJA 5JWPA 2PHWA 5GALA 5FCCA 2A75A 1XNBA 3ENRA 1GBGA 4ZXKA 2WINB 3AZVA 3I59B 1PVXA 3X29B 2P34A 1GZ9A 2Q5TA 4B3NA 4YARA 3FLRA 2PLV1 3MLJA 3MW4A 4JVAA 4MYEA 4RD7A 1FPN1 2MNGA 3H7YA 1XU2A 3RQ0A 1QJU2 3GF6A 2HEYF 3KZ4C 1CAUA 2V5YA 1YRZA 5CB7A 2D6KA 4OUMA 1S2BA 2D43A 3MIEA 5HCFA 3AMPA 3WDYA 4ASLA 1LESA 3UJOA 3GBGA 2WS93 3UKTA 2XUMA 2VY0A 1NG0A 2YGLA 4IL7A 4KQ7A 2UYAA 2DVBA 3NV1A 4Z07A 1OKQA 4Q26A 2A6YA 2PYTA 5FPZA 4B4PA 1VR3A 4Q0PA 3WG2A 4Q4V1 4Y26A 4MZUA 2H0VA 4AHZA 2EAKA 3OD4A 3C3VA 5EXOA 4JGZC 2R041 1DBNA 1ZBE1 4XJ9A 4RGAA 4FTSA 2O8QA 2PFWA 3NV3A 3UKVA 2A6VA 3AP4A 1B09A 3FBYA 4Y20B 1AR83 1PK6B 3ZN6B 1HV0A 1NXD1 4FXKB 3M3IA 3ZYRA 4RQPC 1J58A 3V56A 2ET1A 3FE5A 1RUF1 3H50A 4AI0A 4I30A 4KGQA 4Z1VA 5I8TA 1N3QA 1ZZ9A 3TOJA 4YFWA 1MQTB 3VBFB 3TNQA 4NR1A 4F8AA 2YY1A 3MICA 2A73B 4OULA 3RYKA 2PHUA 3SNMA 1O5UA 3KGLA 4FOYA 2QJVA 4CZSA 1RJ8A 2D6PA 2JG9A 2GSYA 4I09A 3VN4A 2OA2A 3NKGA 2NN8A 4FPHA 4AFAA 4FSJA 2A3YA 2RS51 4INDA 2NPIA 5CIRA 5T54A 1FX5A 4KU7A 1PGW1 4IESA 1IOAA 3KQRA 5BNOB 1ZRCA 3N35A 4WVZA 3KD4A 3VDDC 2YHJA 4FPOB 2RM22 2CWSA 4AFDA 1TME2 4IXLA 5IK5A 1AYM2 3INAA 2B39A 1AL0G 4GA9A 1LHNA 1GZCA 1EAH1 2XVLA 3NKTA 5C4WB 4DNYA 3CNAA 1PMIA 1W6MA 1FATA 1SLLA 3P3NA 1W0PA 4JTOA 1WW5A 4Q4W1 4ISRA 1UZZA 3LKJA 1AX1A 2D98A 4RA0A 5T5OA 5J36A 3O5SA 4GALA 1COV3 2DCZA 3DV8A 2ZMNA 1OSGA 3MF6A 3ZYJB 1X82A 2BGCA 3AJYA 4Q4X1 5LRRA 4XF9A 1V6MA 3MIGA 2HWB3 3WHTA 4YLZA 1ZRDA 1BBT2 5BNNB 1H0BA 2YPJA 1MEC2 1J59A 1TMF2 1LULA 3D8CA 4YM1A 3WLUA 1ZBA1 4PLMA 5A33A 1VRH3 2R16A 1AXZA 3CEWA 3CU7A 3A4UA 3SH5A 1H8TB 2VPVA 2E9QA 1HKDA 5T50A 1GFF2 1LB2A 1K5MC 1IS5A 2UWCA 4MLOA 3J4UH 1J1LA 3PVEA 1YUDA 1H30A 2JE9A 1ZZ7A 4WBBA 1FMD3 1D4M3 4KH9A 4FTEA 3TN92 4DOUA 3AM2A 3E5XA 2VQAA 3ZFFC 2JICA 4HPKB 1CX4A 1LU1A 1N3OA 5JI7A 4XZPA 3MIBA 1G9AA 4LNVA 1POV0 3AFKA 4ITCA 1CAXB 4K1ZA 1RUG2 3BOWA 1ZVFA 2VH9A 4S2GA 1A3KA 4L2NA 1POV3 4Q0QA 3E6BA 5FPXA 4AWDA 1R1A2 3ZSEA 4CRQA 1ULFA 4BA6A 4AEMA 1C57A 5KBFA 4XFHA 5AC93 1C8M1 4JGZA 1PK6C 2E7AA 4LBOA 1EV13 4G9SB 3BOPA 4ISQA 4HK8A 3WDVA 4ORFA 4K7JA 2Z5WA 3RJRA 1HXS1 4XTMA 3MLLA 2SLIA 4RS5C 3AZXA 5LEKA 3V65A 3WOGA 2PHDA 3S30A 4K40A 4HN1A 1RVF1 4HKWA 5FO9B 3IT8A 3VBFC 1AR91 4I3PA 4XBNA 1QQP3 5FMOL 4AK3A 4AVAA 2VNGA 1ENSA 4RQPA 1KFXL 1VBD1 1H8VA 2W52A 3H1YA 1GR3A 1S0EA 2WNVB 1LR5A 1MS4A 2DCJA 1JYIA 5B2GB 2NM1A 2GC3A 2LM3A 1D0GA 3AKRA 4H7LA 1WMEA 2FZ1A 1D4VB 5FBZA 1AL21 5BNOC 3L2HA 3KCCA 5FO8B 2ZA9A 4NOTA 1KRIA 4BCUA 2HKXA 3ALQA 1V9U3 2Y0IA 4Q4Y2 3VDDA 1GNHA 4DRVA 4FPKA 1YI7A 4BIOA 1W2UA 2HWD3 4P9GA 3TWIA 2Q30A 1FV2A 5LRSA 1MS5A 1ZZCA 3ZFEB 1MVEA 2Z42A 1G9FA 3JD73 5DDJ2 1BEV1 4BIFA 1HIXA 4EJRA 2JEMA 4FAHA 4EN8B 5KHJA 2H0BA 4LT5A 1BMV1 3W59A 2ZBJA 2ZKNA 1Q3EA 3MGUA 3WV6A 1GQGA 2VW1A 2BW8A 4BH9A 4B4RA 4WM7C 5F6LB 4F3JA 3BB6A 5GLWA 1S0FA 4BMEA 5CA6A 2UURA 4XFBA 1VB4A 4GULA 1ENQA 5CAZA 1F5FA 1Q8PA 5I8YA 1DQ5A 1RUE3 2A5ZA 1A78A 1AYN2 3SHRA 1CAUB 4A7KA 1OI6A 3V64A 1SFNA 4ES9A 3I59A 1WW6A 1J3RA 1H8TC 1LU2A 3TRSB 1AXYA 1YI9A 3JU9A 4Y24A 5EFUA 4OI1A 2ZGRA 5EYYA 2MEV1 1RUD2 1CESA 4UW6A 1MVQA 4YG3A 1QF3A 3ZIXA 1K5MA 2R1DA 2WFPA 4OHWA 1CJDA 5J37A 4NPRA 1GLHA 4YZ5A 1H9WA 4XF1A 1VBB2 5BXXA 2XJSA 1APNA 5D8AB 1RB8G 2XH6A 1A6CA 1E57A 3B00A 2GH8A 2PLV3 4FT8A 4GKYA 4LUKA 3I54A 4C91A 1C4RA 1PZ8A 3ZFFA 1FPN3 4JQRA 3ZMNA 2XBO1 3NJZA 4H7MA 1UW8A 5T3NA 5L19A 4GB31 1QKQA 1YHFA 1XE7A 5A3MA 4QT6A 1ENRA 4Y4YA 2PHXA 4ONUA 5IK4A 2HYKA 4HN0A 2DF7A 4F83A 4LULA 4HFSA 2JE7A 3VLBB 3AYDA 4MVTA 1UIKA 4S2HA 4Y20A 4JV4A 1J1TA 1PK6A 1TQ5A 2VU9A 1I9RA 2D93A 3Q9OA 1KXGA 2Y0OA 3WY6A 4RS5A 4Q4V3 3TYJA 4XTPA 5JR7B 5BV6A 4QQ2A 1HV1A 4XFCA 1G9DA 1YNAA 2R043 3VKMA 3VBFA 4FQ4A 2DCYA 2VG9A 1VAKA 1ZZBA 2BPA2 3RMYA 4E2QA 4EWDA 4JCKA 4RL7A 3AMHA 2GALA 5H9SA 1QJZA 3IMNA 1N1YA 3S7IA 2BTVC 2IXLA 2JX9A 2P3IA 4JTNA 3MDPA 1X33A 1LODA 3PTYA 4XF4A 4CEWB 1RUF3 4I0BA 1G86A 2R6QA 1X50A 4UW5A 5BNOA 5DUUA 2CY6A 3W58A 1AX2A 1V00A 1S2KA 3GZTB 1XYPA 1Q8VA 2RJKA 2F6BA 2YZ4A 2F4PA 1X36A 1JTZX 1AR82 5F6KA 4CDQA 3WUCA 3PVOA 4J6GA 4EWAA 3ASIA 2RS53 2H6CA 4AYUA 3AX4A 3O0VA 1W39A 2AENA 2X29A 4B29A 1MS0A 3AKSA 2D5HA 1MS3A 3FBMA 4PLOA 4URTA 5A33B 3KGZA 5L36A 2AH2A 2WZPP 1EAH3 1KJRA 4AGGA 5IK7A 5C33A 1DQ2A 4UXAA 4R8HA 4WM7A 1D2QA 5AFEA 2UY9A 4I3GA 2HJIA 4JC1A 5DUWA 1XNDA 4GQ7A 5DZEA 3OY8B 4Q4W3 4IEXA 2RS11 1CIWA 1IKPA 2ILMA 1PIV1 2ZCWA 4LR4A 3OCPA 2ET7A 2RR11 3WD5A 3NV2A 4DQAA 1PO21 2D6LX 2ZPXA 1IS6A 4KWKA 4H55A 2R061 4G4FA 4IEYA 5J98B 4HVOA 3ZYIB 1H8TA 3RI9A 5CBLA 4Q0UA 1Y3TA 1QJY2 1R081 4Q4X3 4LA2A 4QD2A 3RZZA 1PGL1 2QQPA 3S6PA 2DUOA 3WNXA 1IGOA 2OUHA 3AMQA 4D7SA 1REFA 2XG3A 3ES1A 3LSDA 4R4XA 5D8AC 4QQLA 3IKWA 4OHYA 1VP6A 3I2DA 3LSEA 2CAUA 1SLBA 1COV2 5J09A 4AVTA 1SQ4A 3P3PA 1RIRA 1VB2A 4RGGA 5T55A 3GHNA 3CF6E 4DY5A 1LENA 3WHUA 4FOWA 4E4SA 2E6VA 1RUI1 2G4IA 4AHYA 4LO6B 2ETEA 3VHPA 2XWBB 3NSTA 1R092 1IS3A 3FLPA 1O5LA 2DVDA 3MIHA 2ZGMA 5JZGC 5ACA1 1S0IA 4RQPB 1VRH2 2AR6A 2HWF2 2XJRA 2BNNA 5AVPA 2QZ2A 2LUWA 4A7ZA 4XF3A 1FNZA 3EQEA 3KT1A 3TB0A 3FFQA 1LOGA 4KWJA 2WFF2 4D69A 1ZREA 3E6CC 4O9EA 1C8NA 2VMGA 2WNUC 2XGXA 2EALA 3ZIWA 3MFAA 5AVAA 5A32A 4P5HA 1D4M2 2DVAA 5I0SA 1JHNA 1LOFC 3BIWE 4LO5B 1QJU1 5FLIA 4PCRA 4BZ4A 1C8M3 2PN5A 3LA3A 4X6QB 3USUB 1WLDA 1RINA 1ZRRA 5D1IA 1WMFA 2K9ZA 1HXS3 1LHOA 3NO8A 4WVMA 3WG3A 4Q8LA 1TEIA 4B7EA 4CEWC 1REDA 1N1TA 1DDLA 1WCSA 1GSLA 2GNBA 4AVSA 1RVF3 4IETA 1AR93 1OQEA 1VBD3 2RMU1 1H2KA 3VBRB 1LECA 1SBFA 1UKRA 1W6OA 3M4FA 4HETA 4AFBA 1GANA 1PO12 4QQHA 4Q0SA 4LBQB 1AL23 2GNMA 3B02A 4W6WA 1DG6A 2WT0A 4COUA 3M3CA 1ULGA 4YSFA 1CD3G 1IZ3A 5GZDA 5K0UC 2XLGA 2ZGUA 1B35C 1WD4A 4XMIA 4YZ3A 1LGCA 1XE8A 1O91A 4E4DX 3MPPG 4Q27A 2ENRA 2JDZA 1RUH1 4M0NA 1AF9A 1YFUA 3TNPB 2R1BA 5A3LA 1V6OA 3M70A 2XJTA 1REEA 1OA3A 3DL3A 1O7FA 1LOEA 4M0HA 4YRDA 1XNCA 2B46X 1SCRA 1BEV3 4Z92B 1Y43B 3BODA 1K5MB 2WQ4A 4Q1PA 4E2GA 2TEPA 1DIWA 4LLOA 3O14A 3VKFC 1KD7A 3VZLA 3ELNA 1V6KA 3VHRA 2HWD2 2RS32 3JCIA 4IQPA 3PLQA 4E9KA 2ZJCA 3WZ1A 2RM21 1QH6A 2DVFA 4C1WA 1VALA 1TME1 2IWGB 1AYM1 3ZFFB 3IDCB 3U4XA 4EN7B 1ZYBA 1KJLA 4YGCA 2CTVA 1QDCA 1QJX2 2JJ6A 1CR7A 2E63A 1NCRC 5D8AA 2GMEA 4NHLA 3BCWA 4YM2A 2MEV3 4LUMA 4TSVA 2XJPA 1DHKB 2WZR2 3AXEA 2BYVE 4DS0A 1UD1A 4RS5B 3B7MA 2RJLA 4I0AA 4L99A 1G9CA 4UBHA 4QPYA 5K7PA 2WKKA 4AE2A 1BBT1 4B7KA 5JZGA 2Q8OA 3RDIA 1IQAA 1MEC1 2Z79A 4F7ZA 1TMF1 3M3QA 2EAAA 1FOD2 3ZSMA 2XBO3 4FPGA 4GB33 4FQZA 4RR3A 3J26N 3WCRA 2N7GA 2VECA 4GKXA 4XILA 2WNUA 2X8KA 4RHV1 3V0AA 1SACA 1QXPA 1PGSA 1G7YA 4TLFA 2OPKA 2WSUA 4YM0A 4QGLA 3SITA 1VBE2 1LOFA 1UCXA 4XQDA 3SCFA 1WLCA 3L9JT 1NCQC 4IV3C 3TN91 1ONAA 5L73A 2R0HA 4CDQB 4LBNA 3RSJA 4C90A 1KFUL 3WW2A 3GYDA 4CEWA 3KLSA 4EN0A 1CONA 1VBA1 3VGIA 1GNZA 3VBRC 3R6SA 4PIZA 3H1MA 1F2NA 2QFEA 5SV5A 1BQPA 3U07A 3ZPYA 3NV4A 3WQ0A 1NE4A 3GZAA 1RUG1 1AR71 5EYXA 3R4UA 5JAXA 1X8EA 2DWRA 3B5LB 5L7OC 2QUOA 1HRV2 1O3SA 1RUC1 3FUQA 3IDEA 2IXIA 2ZABA 3QH6A 4YW4A 2ZMLA 5AFBA 1KS5A 2IXCA 4WM7B 2ZGQA 4YW1A 1YFWA 1N1SA 2Y26A 2R042 1OFNA 1XXNA 4YG0A 5I8SA 3R0RA 1UAIA 1RHI1 3BU7A 5F1RA 1PVC1 2D6OX 2AYHA 5K0UA 2ZGKA 1B35A 1DQ0A 1FAYA 2DUPA 1BYHA 1BXHA 2Q4SA 4QMAA 3LCPA 4EN6B 1MZEA 5FMOS 1VBC3 2EXHA 3M1HA 4YVWC 3RI8A 3D0JA 5K8SA 3EO6A 1NQDA 3CO2A 3DKWA 4KBBA 1M06G 3OY8A 1OA4A 1OPMA 4QX5A 2JD4A 3O0WA 1IS4A 4AW7A 2PHTA 2EF6A 2BUKA 2FHRA 2VGDA 1OOPC 1V6LA 1MZFA 3CJIC 4BLJA 3PMSA 4DFSA 1SDWA 1U0AA 1Q8OA 1AR61 3WCSA 4Q4Y1 4BYYA 2VW0A 1S0GA 1QHDA 4XJZA 4XMAA 1MACA 3RJ2X 4AGVA 2VMHA 3PJYA 1PIV3 2E51A 4JRLA 2RE9A 2RR13 4ATEA 5KC5A 1UU5A 4W6XA 3ACLA 1PO23 2CV6A 4HSJA 1DGRN 2A71A 2MHFA 2O0OA 2R063 4AI1A 5DDJ1 1EAH2 2WLPA 1NCRA 2DUQA 3LA7A