3PLQA

Crystal structure of pka type i regulatory subunit bound with rp-8-br-camps
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
126
Chain Sequence
SYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase inhibitor
molecule keywords cAMP-dependent protein kinase type I-alpha regulatory subuni
publication title Cyclic AMP analog blocks kinase activation by stabilizing inactive conformation: Conformational selection highlights a new concept in allosteric inhibitor design
rcsb
source organism Bos taurus
total genus 28
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3plqA01
3E97A 4DINB 1VP6A 4I09A 2ET1A 4CYDA 3GBFA 2CV6A 2OPKA 3SCGA 2F4PA 4IEVA 1CGPA 5BY5A 4P9GA 1J3PA 4BH9A 4F7ZA 1H1IA 2GC3A 2HJIA 4Q29A 4OFGA 4KWJA 4QMAA 1J3RA 2PHLA 5JSRA 4QXKA 5EZWA 1CAWA 2D5FA 4LTAA 5LEJA 3CO2A 4FAGA 3E6DA 2PQQA 4XFGA 2OA2A 3WW4A 4JTOA 3UKTA 4EWAA 2MNGA 4HN1A 1Q43A 4X6QB 3MPBA 1O5LA 4FT8A 4XETA 3ROUA 3H7YA 4ZU4A 3H1WA 1YFYA 3RDIA 3S7EA 4MGYE 3LAGA 2B8MA 4XFFA 3BB6A 1X8MA 1L3JA 2IXIA 3HIFA 1DZTA 2Z2SB 2XGXA 4IEPA 1UIKA 1EYBA 4I0AA 3RYRA 3SMHA 4PIYA 1RUOA 3H3ZA 5FLIA 1WGPA 2N7GA 4D7TA 4EWDA 4Q0VA 1GQHA 1O3QA 1ZZCA 4IETA 1RGSA 4E2GA 3EBRA 2B9UA 4L2NA 4XFHA 1OMIA 3LWCA 5FQ0A 3H1YA 4MGKE 4QGNA 1EY2A 2WC2A 3ST7A 1NZCA 2H6CA 3PNAA 4O9EA 4XFCA 3LA7A 5D1IA 4PJYA 4LEJA 1ZNPA 3SXWA 3DN7A 3OF1A 3ZDSA 2XKPA 4XF0A 1SEFA 2D40A 3D0JA 1CAVA 3CLPA 3JZVA 2BNNA 3SCFA 1RTVA 3D82A 1CAUB 4JV4A 5FLJA 3GYDA 3LA2A 4HVQA 5LEKA 2VPVA 1CAWB 4Q0PA 1LB2A 4FBFA 3I54A 5JSPA 3DV8A 5KHIA 5LRSA 4I2OA 2XL7A 2Q4SA 1CAXA 2O1QA 2FQPA 3CEWA 2OZJA 5FCCA 3FE5A 3KCCA 4I02A 2WFPA 5FDBA 2DCTA 2CGPA 2ETEA 1O5UA 4J1WA 5I91A 3E5QA 3I7DA 1YWKA 5CU1A 4AVAA 4YRDA 1SQ4A 4IEXA 4B29A 2GH2A 2IC1A 2XLAA 4QX5A 3H50A 2UYBA 2PA7A 5FLHA 3H7JA 1HW5A 3CJXA 4HVRA 2I45A 4MX3A 4I0BA 4LULA 4XFAA 4D7SA 5LRRA 4WZCA 3R6SA 4J1XA 3IWZA 1Q5OA 4KU8A 5CVRA 2IXHA 1RUNA 1Q3EA 2ZCWA 1EPZA 1XE7A 3I59A 3ACLA 3G7DA 4Q0UA 4META 4N9IA 1J3QA 4UBGA 2O8QA 1ZZ7A 1FI2A 1Y9QA 2XKOA 1ZRDA 4HVOA 3NW4A 1ZREA 2XHKA 1IPJA 2Q1ZB 4MGIE 2C0ZA 1PM7A 2UYAA 3IBMA 1O3SA 3MZHA 2PTMA 3MDPA 1NXMA 1CAXB 4IEZA 1UD1A 2EVXA 4I01A 3IDBB 2D5HA 5J48A 4MGZE 4YYOA 1QY4A 4Z07A 2QVSB 1O3RA 1WLTA 3ELNA 4H7LA 4Q0QA 4N9HA 3ES4A 2QJVA 1O7FA 1ZRFA 4MV2A 4QGMA 1ZZ8A 4AVBA 1PMIA 4BIFA 3BU7A 1OFNA 4XFBA 3HQXA 5BXXA 4I3PA 4KL1A 2XL9A 3U11A 4HZFA 3KGZA 3OD0A 5BUVA 1TQ5A 3FZ3A 3N4MA 3RYKA 3E5UA 3BPZA 3RZZA 1VJ2A 1I6XA 4MUVA 4YNIA 1ZX5A 3NJZA 3EHKA 2CAVA 5JR7B 1ZZ6A 4AXOA 4BHPA 2GC2A 3OCPA 5KHKA 1CX4A 3FX3A 3CF6E 3KMHA 2ATFA 2QCSB 3U0ZA 2OZ6A 4HSLA 1YHFA 4IESA 3NVCA 1UPIA 1GQGA 4ZU5A 4MH0E 2PAMA 1UW8A 4E2SA 5T3NA 5I93A 2Q30A 1EP0A 5BPXA 1QXJA 2H6BA 2PYTA 3H8UA 2BGCA 1YLLA 1V70A 1O4TA 3D0SA 4IEYA 1NE4A 1UIJA 5JCTA 1LR5A 4IEOA 4Q0SA 4BYYA 3WW1A 1OI6A 2EAAA 3HT1A 1RL3A 1UCXA 4XF9A 2OYZA 2V09A 2EA7A 4ONUA 3CL1A 2GC0A 1NYWA 3KGLA 1YFUA 3HT2A 5I0TA 3MYXA 1X8EA 2K0GA 1DGWA 3FWEA 4LLOA 4F8AA 2MPFA 4HN0A 1ZRRA 2KXLA 2IXJA 5KHJA 1X7NA 3FFQA 4R52A 3NKTA 4MZUA 4QM8A 1ZVFA 5HI0A 2PAKA 1ZZBA 5FQ0B 3H9AA 2VECA 1LKNA 1H1MA 4EROA 4Z82A 5KHHA 4O9GA 4LA2A 5JSOA 5J7MA 3IDCB 4WBBA 1ZZ9A 1CAVB 1YFXA 5E1RA 1YFWA 3S7IA 4WVZA 4K8FA 4IEQA 4GULA 4KWKA 3C3VA 3S0MA 2PHDA 3EQEA 2Z69A 5CADA 3E6CC 3E6BA 4UXAA 2FMYA 4LUMA 4XF4A 3EJKA 3RNSA 4A2UA 2Y0OA 3NL1A 4LA3A 1ZRCA 1J1LA 5I8TA 2GU9A 2K9ZA 1NE6A 5KBFA 3U10A 5KHGA 4LUKA 1CAUA 1FXZA 1DZRA 5J3UA 2IXCA 4KU7A 3UKVA 4ORFA 4XFIA 3SHRA 4JTNA 3E5XA 3LZZA 4AQ6A 5AVPA 4FAHA 5I8YA 5K8SA 2B5HA 2ET7A 5C6CA 3OTFA 3SCHA 3UKNA 5F1RA 5I0RA 4HBNA 2MHFA 2Q0AA 4YARA 3M70A 4IEWA 3NSTA 4AQ2A 1U12A 2H0VA 3H1MA 4OLLA 1IPKA 3KSCA 4UBHA 3DKWA 4YSFA 2IXLA 3WW2A 5E16A 3B02A 3ETQA 1OD5A 3TNPB 2GAUA 1WA4A 2XLGA 1YUDA 4X6RB 3EO6A 1QXRA 4R8HA 1XE8A 3BALA 2BEOA 3LOIA 1QWRA 3USSA 2BYVE 3QACA 4EWEA 4NVPA 3VHRA 2IXKA 3OGJA 3I59B 4HMZA 4ZU7A 4AVCA 2ZKLA 5I0SA 3DL3A 4XF1A 2QDRA 5C8WA 2VQAA 4PIZA 2UY8A 4KWLA 1J58A 2BNMA 1SFNA 1J59A 3FJSA 4XEZA 1XRUA 4QM9A 2BNOA 3RPQA 5FPZA 3FHIB 2UY9A 3BCWA 3L2HA 2HKXA 1I5ZA 3H3UA 5JAXA 5I0UA 1FT9A 1G6NA 5I8SA 2P17A 3IIAA 3LA3A 3WW3A 2GC1A 4EV0A 2E9QA 4JVAA 1VR3A 4RD7A 5BV6A 1JUHA 2PAEA 4L11A 1DGRA 4IERA 2QNKA 3M3IA 3ES1A 2PFWA 3O14A 1X82A 4QGLA 3TNQA 5FPXA 3QOPA 5EFUA 4XF3A 3PLQA 1O3TA 4PIXA 2XLFA 1Y3TA 3PVBB 4TLFA 2CAUA 2D93A 1RC6A 4E2QA 4HLTA 4IEUA 1LRHA 3RYPA 4HSJA 2GZWA
chains in the Genus database with same CATH superfamily
1IS4A 1XYPA 2RS32 3ZSKA 4BMEA 3N7KA 3PUAA 4IV1A 1AX0A 3HR9A 5IWFA 3WVJA 2AC1A 4DINB 5FK8A 4I09A 3HQUA 5IVCA 3KV6A 1IKPA 2G4IA 5FMOS 3FUQA 2CV6A 1NCRC 4EN6B 1AXYA 2F4PA 4WV8A 4JAAA 3J4UH 4P9GA 4QPIA 5DAXA 1OSGA 3I2JA 4RS5A 4BH9A 3NWKA 4BLIA 5A6ZA 1RXFA 4MO3M 2R071 4OHWA 1R093 4S2GA 5FUPA 3T2QA 2R063 4I3GA 2XDVA 3LDBA 3S30A 1SMVA 2F4LA 5LB6A 4A6SA 2W92A 5FZAA 3SKJE 3B93A 3WXPA 4BLJA 2J1AA 5FWEA 4CSWA 2D5FA 2HWD1 2A6XA 3N9QA 2DTYA 3FFZA 4CCCA 1LEDA 5HCFA 2JD9A 4FPJA 4XUPA 1JODA 2VJXA 2XR4A 3HBZA 1TZOA 4MOAA 3WW4A 3VGIA 4IGPA 2GSYA 2MNGA 4G3YC 1Q43A 3JXSA 4HN1A 4N53A 5EP9A 1AHSA 3B9IA 1POV0 1AL21 3S57A 5F7UA 2JDNA 1LOFA 1KFUL 1W6MB 2VVFA 4IE0A 4IV3C 4MGYE 1QOTA 4QPYA 4D6SA 5KXDA 3LAGA 3I3DA 4RQPB 1LTEA 1MS3A 1AYM1 5D2AA 2IXIA 2W1WA 4AAPA 2EICA 3VZMA 3R4UA 2XGXA 3ME2A 2ZHKA 2BERA 2CGOA 4KNCA 4PIYA 4YGDA 1CJDA 4LOTA 1HN0A 4ATFA 3O0XA 3OBAA 2B39A 4D7TA 1ULDA 5LBEA 3HEIA 1QJX1 1O3QA 1LHNA 2ZGTA 2P3KA 4IV1B 1REFA 2QQOA 4E8CA 2RM21 2ZABA 5BNPA 2VD7A 5J09A 3EBRA 4BDVB 5KXEA 2FCVA 1NY72 4R9BA 1PK6C 1SLIA 3B7MA 4MGKE 4LO8A 3RZMA 1EY2A 4JCKA 4Y5Z0 5FJHA 2HEYF 2R0HA 1PO21 4QPIB 2RS53 2W0XA 1OQEA 1ZNPA 2JENA 3BPSA 1HDKA 3DN7A 4RS5B 4UF0B 3SXWA 3ZDSA 4CP1A 1BXHA 5LA2A 3WF3A 5A70A 5DDJ1 3D0JA 2HYKA 4R9CA 3ZXEA 2BNNA 3MW2A 2YHJA 1CAUB 3MUZ1 4JV4A 5A33B 1ULOA 3LA2A 3R4SA 5ABJB 4HVQA 3BI3A 5DMYA 2W2IA 5G04L 1YJKA 2VMGA 2PN5A 3OSDA 4HKOA 4Q0PA 4FBFA 1HKDA 1GZCA 1W2TA 3J7MA 1BMV1 1EUTA 1GP5A 2RDNA 1WKYA 5GZFA 1HRI3 1R091 4GMP3 2R061 3VBSA 3AMMA 5T50A 5FKBA 1HV0A 2XL7A 3RSJA 1JZ6A 4N53B 2R043 3DPRB 5GZGA 3BTZA 2W94A 2JXAA 3R4DB 3W58A 2Q4SA 1CAXA 2QQJA 4FOQA 2O1QA 5EWSA 1D0GA 2JDAA 4CUAA 4OZOA 5BNOB 4MADA 2JB4A 1IKQA 4BQ5A 4K1ZA 5FCCA 2CY6A 2D3SA 5T52A 2DV9A 4LITA 5G05L 2WFPA 1MVEA 5LBCA 4B4PA 5HCHA 3D5OA 5DAPA 1S0BA 4J1WA 3G6JB 1COV3 1RUG2 3E5QA 1WMFA 3WNOA 3ZXAC 1A8MA 4BQYA 3VD9A 5CU1A 1MS9A 1KXGA 1D2QA 2VZQA 1REDA 4QPGC 3TRSB 1LU1A 2GH2A 4XHBA 2IC1A 2ARXA 2XLAA 2RR13 1DHKB 3GCXA 5FZ4A 3AFGA 2ZGMA 3T3YA 3MIEA 5JOXA 1W6QA 2AUYA 2UYBA 4XQDA 5FZLA 1RITA 3O0VA 4AEDA 4CEYC 4KGGA 3H7JA 5FLHA 2DCYA 2I45A 4EN0A 4WVWA 2WR9A 4J6GA 3VZNA 4I0BA 4XURA 4YLZA 4ZY9A 1NXD1 1SACA 2E7QA 3POFA 4RL7A 4XFAA 4BK5A 1YYNA 4WM8C 3SISA 4D7SA 3R6SA 3V64A 1OT5A 2WYFA 3HJRA 2A7AA 3EYPA 4FQZA 4RGGA 1W6PB 5FZFA 3RMYA 3MW4A 5DPNA 2D6OX 3IDAA 4E4DX 3AYCA 5EJ3A 4EJRA 2I2SA 2WDBA 5C33A 1UZ0A 3HNBM 4Q5OA 2KR2A 2D6KA 1UMZA 3POJA 1PZ8A 3ACLA 5CIRA 4META 5FZOB 1AYN2 2B46X 4LORA 1QOOA 4GB32 1U5YA 1RHI2 1WBLA 4RA0A 2ES3A 1FPN2 1UNBA 1UN1A 2RS51 2VW0A 2XKOA 1G8WA 1DQ4A 4FPCA 4JRLA 3W20A 4AFCA 4C0BA 4QDRA 1YQ8A 5AC92 4NHLA 2NMOA 3VBSB 5E8AA 4COYA 1VRH3 2C0ZA 4MGIE 2UYAA 5A3LA 3OOXA 4R4ZA 3OBTA 1O3SA 1GR3A 1UXXX 4AG4A 1AYM2 2PTMA 1NXMA 1CAXB 3J8F2 4IEZA 4YW1A 1UD1A 4PI2A 4RGAA 2X8KA 5CKQA 3O1TA 5FYSA 2WINB 4W6XA 2ADDA 1WCQA 3PVOA 4MGZE 1QY4A 5J48A 2HWE3 2WYSA 3ZFEA 3MLJA 2QVSB 3V56A 1HRI1 4M01A 4GMP1 2QJVA 2QQWA 3A4UA 4MV2A 1BMV2 4BMBA 3WQ7A 3RI9A 2WUHA 2R041 3WHUA 4CDQA 1LGNA 1IQAA 4XUNA 4AVBA 4C90A 1PMIA 2VQTA 1N47A 1OFNA 2J1SA 4GH4C 5FWJA 1ACCA 3JBG2 2FDKA 1OXCA 2P5BA 4ZHNA 4AI2A 4ZZ5A 1SPPA 4HZFA 3VD4A 4BA6A 1GLHA 1EV12 1QJZA 3ZVXA 1ZRIA 3GALA 1W6QB 1R1A3 2RMU3 3RYKA 3AYEA 3E5UA 3PDQA 1JZ7A 2A3WA 5CFDA 1AX2A 5JMOA 1VJ2A 3IMNA 3NJZA 2BFUL 3IAQA 1COV1 1DGRN 1A78A 2CAVA 4JGYC 3A22A 4TN7A 3WNMA 4KG0A 1Y43B 5GLUA 2VZPA 2C9KA 4XABA 4P14A 2VQUA 2ZPXA 4KGQA 4C1WA 2GC2A 4Y22A 2RR11 2ERFA 4NRPA 4CXWA 3ZFGA 1QNYA 1H8TB 1S55A 3JQWA 5KHKA 3CF6E 5EJZB 2D6NA 2JDYA 2W46A 3UNPA 4LO4B 2E26A 1WD4A 1KFXL 1R092 4L8QA 4P02B 4Y20A 4BE3A 1TG7A 5A3UA 2NZ9A 1Q56A 4YM2A 2WN3A 3T1MA 1J83A 2VW1A 1X33A 2DVAA 3ACGA 2IZWA 5JWPA 1UW8A 2E33A 5T3NA 5IW0A 2Q30A 3WF1A 4AVVA 5I93A 2BPA2 5C8CA 5BPXA 3WDXA 2DCJA 4KH9A 4QU2A 4C8DA 3ZYJB 5F3EA 2BGCA 1F2NA 4Y3OA 1GUIA 1I9RA 1O4TA 4YFWA 1VALA 2XWBB 3FLRA 1OUSA 4LKFA 4XCBA 4Q4V2 2FDHA 2JDPA 5A7WA 2WWJA 4Q0SA 3RS6A 2J1UA 4N8MA 2EAAA 4Y4RA 1RL3A 1VAKA 2WN2A 4W6WA 4QWNA 1W8WA 4XF9A 4HG6B 2ZGKA 4NRQA 4YW3A 3ZKYA 1X36A 4BQWA 1W2AX 4ONUA 1YQ2A 1QIQA 1VRH1 2VXJA 2FZ2A 4SBVA 4CDQB 1VIWB 5JXHA 4FXGB 1YFUA 3VKNA 3ZSEA 4JRAA 3W59A 1SPPB 1E57A 1ULCA 1S0EA 1S0DA 2HWE1 5HPOA 3HWJA 4HN0A 5M0TA 1ZRRA 4GWNA 1PNGA 3DUIA 4IE6A 4LK6A 1MR5A 3NKTA 4MZUA 4QM8A 1ZVFA 5FZ1A 4A4AA 1RVF3 1W8OA 2QKDA 2VMFA 3UYJA 5A3OA 1DGWX 4F3JA 1CR7A 1LKNA 4QX7A 3KT4A 5F2SA 3AJYA 3FHAA 4Z82A 3OBRA 5FYHA 3WSOA 1BEV3 1DZQA 2HLEA 4XILA 2H0BA 2Y34A 2P2KA 4WBBA 1JYWA 4LNVA 3HNMA 1R1A1 1YFXA 2VCAA 2RMU1 1FNYA 3C8XA 5JXIA 2TEPA 4YW7A 4RGKA 4Y20B 2Y38A 4YGCA 4EE2A 2EIDA 3MIFA 1VBE2 3B69A 3SEEA 3S0MA 2JE8A 3UT0A 1WW7A 4CU6A 4YM0A 4BWOA 2PHDA 4P9IA 2QFEA 5FYYA 3E6BA 1V6LA 1KEXA 4PBOA 3J7NA 5FFOC 4EN8B 5C4WC 5C8CB 3EJKA 4ZS2A 3RNSA 1FX5A 4B1MA 5E89A 3VKMA 4A2UA 1PVC3 3NL1A 3HVDA 5LY2A 4AVTA 3Q8FA 5FZMA 4QKNA 5T5JA 1G9CA 2CHHA 1JZ2A 5FOBB 4FOYA 5IAXA 2DFCA 1H2MA 2D44A 5FY9A 5KHGA 5T5PA 3FBMA 2ZGLA 1W9FA 5J3UA 1BQPA 2FD8A 2DCZA 4ORFA 2C4XA 1S0IA 1W2OA 1CWPA 3FMGA 3FHQA 3IZOA 4RFT0 4S2FA 4FAHA 4UAPA 2ZAAA 4CCJA 5A7OA 5K8SA 2ET7A 3FC0A 5IJRA 4P00B 4LKSA 5C6CA 1DG6A 4YZ5A 1ONAA 1QNWA 5I0RA 2VZVA 2DBIA 4YARA 1XNBA 3PJYA 1B35A 5FMBA 1SBEA 3WP5A 2LROA 4AQ2A 4RQPC 1IS5A 3MICA 1UYXA 3H1MA 4OLLA 4XIKA 4NMIA 4YSFA 4B3NA 1H1AA 1W39A 3M2MA 2RDQA 3HBKA 2A70A 3ETQA 4W6YA 3WNNA 1OD5A 5A32A 3TNPB 5FMDA 1RUH3 5FY5A 1YUDA 5KXCA 3AVRA 1D7PM 4R8HA 1XBFA 1QWRA 2Z42A 3VBHC 1XXNA 2BYVE 4MVTA 1GYKA 2FBEA 4ZXKA 2QBXA 3M8LA 2IXKA 1RVF1 3PMEA 5AFEA 1VBB3 4ASMB 2YU1A 4DPNA 2ZKLA 2YY1A 4URAA 5C8WA 2RS33 2VQAA 4N90A 2VMCA 3MIBA 3QBQA 1BEV1 3UJQA 3WQ1A 2HEVF 1SFNA 4P9JA 3ZXGA 4AI1A 1J59A 3MBWA 1AUYA 2WRAA 4QPGA 1SDDB 3NNGA 5DUXA 1E5IA 1US2A 3PU3A 5FZ7A 4D69A 3I2DA 4OZXA 2YZ4A 3V0AB 4YM1A 1BVP1 3LFIA 3JD73 4CEYA 5D8AC 1I5ZA 1WLWA 4XUTA 5I0UA 1OA3A 3ZPOA 4LR4A 4CP2A 4Y5SA 4WM8A 5FTTC 4D6RA 5C3QA 1OQDA 1PVC1 3ZX7A 3SH5A 1AR93 1H6XA 4HPKB 5C9AA 1JU4A 4EV0A 3T2PA 4HT1T 2LTNA 2JEMA 1UMIA 2YROA 3P6BA 1VR3A 2AEZA 2L9LA 4M4PA 4OHVA 1VE0A 4AI8A 5A7PA 4Y1UA 2Q5TA 5BV6A 1YQ6A 4I30A 4NPLA 1FOD2 2VCCA 3DCQA 3LSDA 4AEKA 1VPHA 5K4LA 3O1RA 1B35B 5C5TA 3M3EA 3ZDVA 1V0AA 4RHV3 1DGRA 3POBA 4NIHA 3BIWE 3MUY1 4QHBA 3ZR6A 1HN1A 3TEXA 3ZM8A 1LHWA 2VE1A 2X10A 3WP6A 4K9SA 4M0HA 5FPXA 5JXGA 4BU2A 3PUIA 4XF3A 3VV1A 5KWRA 5FYMA 1UU4A 1SG3A 2C5DA 5ERLA 3ILFA 2XJVA 4YG0A 4QB1A 4HETA 3X29B 5FZHA 4YG6A 4LBMA 4DFSA 4GALA 1PVXA 3RJ2X 2ZMLA 1N3OA 4UFJA 1UPSA 5L9BA 3PVBB 5ACA2 3ZYGA 4CDXC 3OB8A 4LE3A 3AC0A 4IEUA 5DAWA 4CCDA 1OUXA 3H0OA 1RUH1 4LA2A 1UXZA 1OLME 4HL0A 4E4HA 4GH4A 3ZOIA 1BJQA 3MIDA 4ZZ8A 1UQXA 1XNCA 3BVCA 4MXWB 5F6KA 5FO9B 3SCGA 2FCTA 4UFIA 1VBB1 4IEVA 1CGPA 1AJOA 1YIFA 3ABZA 5E88A 2R6QA 3HAGA 5BY5A 5C7GA 1C5IA 2RS31 1TVGA 2QQKA 4Q29A 4X8NA 2BWAA 4OFGA 3URFA 1V6OA 1YJLA 4KWJA 4NN0A 5F5QA 3TEYA 3B00A 4W65A 3RRDA 5EV7A 1G9AA 3K46A 4GKYA 2ZEWA 3WF4A 1J3RA 2PHLA 5GALA 4ES9A 2YPDA 4DUVA 5C9AB 5JSRA 2W47A 4WM7B 2YPJA 3KVAA 1K3IA 3VBFB 3ZKUA 3GXUA 5LEJA 3JD71 3AL6A 3TAYA 4FI9A 3CO2A 2CNAA 4FAGA 3DYOA 1W9SA 3ZO0B 1NG0A 2R49A 4JZRA 4XFGA 5LASA 3I8TA 2ZEZA 2RHPA 2VZTA 5CFCC 4AF9A 3VD3A 1AR91 1T6BX 4QQHA 3H7YA 3NNFA 4ZU4A 1HLCA 3H1WA 4A45A 3PL0A 1OKOA 1T2XA 1R64A 4Y1YA 3RDIA 2NLRA 5DUUA 3ZMOA 2EAKA 1AL0G 1MQTB 3LEKA 2XJTA 5H9RA 4CP0A 2K46A 5J36A 2B8MA 2VMDA 2GDFA 1JYXA 4HXCA 1HB1A 1X8MA 4RHV1 1MZ6A 1RUG3 1BEV2 2Z2SB 1HJFA 1UIKA 4CDUC 1V6IA 1IS3A 1OH4A 3K3OA 4H7MA 4I0AA 5A3WA 1UZYA 4LPLA 3SMHA 3WCSA 1XE0A 1AXKA 1OD3A 2FDFA 4JHTA 2VNGA 3SITA 4CPBD 4RR3B 2N7GA 4NIIA 1YIPA 1CN1A 4CCEA 4A7KA 4Q0VA 3W5MA 4IGOA 1GQHA 4OQ8A 1ZZCA 3GZTB 3CKHA 2VUCA 4IETA 4E2GA 1WCSA 1VMFA 1UZVA 2OQ7A 2XG3A 5F3GA 3C7EA 5FXZA 3OY8B 3WEZA 3IM0A 4L2NA 4XFHA 2FZ1A 3LWCA 2VAUA 5IK7A 5LK5A 2WC2A 2JE9A 3I2GA 1NZCA 4XFCA 5D1IA 1W2NA 4IE5A 4PJYA 4LEJA 4DOUA 1W8FA 2VBBA 4CP9A 3EB7A 1W6NB 4XF0A 1SEFA 3N9PA 3OBZA 3DKQA 3KZ4C 3VZOA 4CDWA 3ZLIA 3ALQA 3SCFA 2JG9A 2JG8B 3OGGA 3D82A 3ILNA 1NY71 3GYDA 4XQ4A 1AYN3 3AKPA 3N9NA 4MGSA 5LEKA 2Y60A 1JYVA 4GB33 3LKJA 4UI9L 1RHI3 5FPAA 2GNBA 3P3NA 3T08A 4EZ4A 1A34A 4CXXA 1W0PA 1FPN3 4HFSA 4WVMA 3KWVA 4M3CE 3J7LA 4NO4A 1APNA 5AC93 1ZBA2 3AKQA 4JDNA 4MHRA 3O7OA 5FP3A 5GJ6A 2OQ6A 2W3JA 5DABA 5DXDA 2YYOA 3ITQA 5J98B 5JPMB 4KBBA 1BKZA 2P3JA 2W95A 5CZKA 3J8F3 1HB3A 3POGA 3PIGA 4PI0A 3AKTA 4AHXA 1K42A 3LE0A 2DBNA 3WY6A 1UKRA 1ZYBA 3VZKA 1J1TA 2LALA 3FBYA 3FL7A 3ZSJA 4D6QA 3CEWA 4AHYA 1S1AA 4JHZA 4SLIA 2HYXA 4GWJA 4I0WB 5FMOL 5FREA 3VDCA 2VUJA 1DQ1A 2WZR2 2YC2A 4I02A 1I1EA 2KA3A 1PO13 4NHXA 3T09A 1O5UA 4COZA 4FO9A 3WUCA 2VR4A 1HRV2 1GMMA 3K77A 5I91A 3I7DA 3JBG3 5LA1A 2LRPA 2BOIA 1WMXA 1K5MC 2VH9A 4XZPA 3S5QA 1LEMA 1YC61 4YRDA 3DEMA 4AVAA 4B29A 1EV13 1ND2C 1PM4A 1UYZA 1NAEA 3NV4A 1VBB2 3VKLA 4E9KA 3CJIC 3H50A 4QXHA 4A41A 1HW5A 3J26N 1RUG1 2A73B 2GMPA 3RZGA 4A3ZA 3KD4A 1DFQA 4LULA 2BBVA 1DYPA 2DCKA 1MS8A 2HBUA 5LRRA 1CJPA 5DN2A 1IZ3A 1Q5OA 4FXKB 3BUCA 4CDWB 2QE3A 2QZ2A 4RSUA 1UYYA 2IXHA 2BQPA 2JG9B 2VOKA 1S2KA 3VBOA 3JD72 1D4VB 2IVIB 2XHNA 1Q3EA 3SEPA 1RUNA 1C1FA 2ZCWA 3BKZA 2BGOA 5FZDA 1EPZA 1XE7A 4FOWA 3B5LB 4N9IA 1DU3D 1PGL2 1YI7A 4WVMB 2RV9A 1ZZ7A 3C2UA 3VBHA 2A6WA 3WG2A 1FI2A 2VXRA 1WZXA 4LBQD 1AR92 3ZFFB 3SC7X 2VQ0A 4Y5TA 3OD4A 5F32A 3NW4A 4OMDA 5LW9A 1IPJA 2D97A 1ND3B 5FYTA 4B4RA 1CESA 1V9U2 3IBMA 4QB6A 4V1PA 1WD3A 1V6MA 1AYN1 1YEWA 2XUMA 2Y6HA 1AR82 4GB31 1RHI1 4RHV2 2Y6LA 5APAA 4Q4V3 2EVXA 1FPN1 2Y6FA 3RGBA 3OUJA 1OVPA 2P1BA 1JBCA 3V0BB 3I3MA 5A80A 4Z07A 1Z7S2 2WWSA 5AC91 2F17A 4TLGA 4Y1XA 3VBUA 2G9FA 4H14A 4YVWB 1E5HA 3OGVA 1G7YA 4IUGA 3KCYA 5JIUA 5D8AA 1O7FA 5ANQA 3UETA 4CCLA 5A6QA 3VZLA 1O59A 4GKXA 4QB2A 5J37A 4LO7A 4Q4X2 3J8F1 1UY1A 2I74A 2VW2A 4XJWA 1YCIA 4DMIA 4ZPIA 4BIFA 1L7LA 3BU7A 4FFHA 2C24A 2ARBA 2CL2A 4XFBA 5BXXA 2XPJA 1WCDJ 3MIGA 4I3PA 3U11A 4LHSA 3KGZA 4JX0A 4V2WA 2ZS6B 2VNRA 2VTFA 4MXVA 4CEWC 3N4MA 3NAPB 4LIVA 2PLV2 3TYJA 3JCIA 1C3HA 1PO11 5C3OA 4LHKA 1IPSA 5IUQA 1FATA 4NOTA 3I4IA 4G9SB 1CPNA 4XPVA 3NMBA 1NUKA 5FZCA 2FDGA 3JBG1 4RYDA 1QEXA 4PLOA 3OJBA 1EV11 4BHPA 1GSLA 3MEPA 1KRIA 3VKOA 3VBOB 5C3SA 3EXUA 3BIEA 4NAOA 3FX3A 3U14A 2A6VA 3PUQA 4PLNA 5IVJA 1VBE3 3Q8EA 5HCAA 5IYYA 1QJY2 2XVLA 1G9FA 5JZGC 4IESA 1WMDA 3WNLA 1H4HA 3FUOA 1MS1A 4XBNA 5ISLA 2FHRA 4QU1A 2PAMA 4DXZA 1TMF2 2YC0A 1GWLA 2P6CA 4E2SA 3JU9A 1PMHX 3V65A 4XCAA 1QXJA 5HXMA 2PYTA 3H8UA 2VZSA 1YLLA 1HX6A 2ARCA 2WLPA 2WT2A 4LBNA 3O1MA 5A3PA 5LA0A 2I07B 3SKVA 2VCBA 3U75A 1LR5A 4IEOA 5FXVA 4BYYA 2VZ1A 3VBUB 1OPMA 3SLIA 1UCXA 2AREA 2YGMA 2J1RA 3KF5A 2O0OA 2DYCA 2PHWA 1W2UA 4ES8A 5FIXA 4YVSC 3QLQA 2JE7A 3JQXA 2GC0A 4XIOA 2DU0A 5F3CA 3NV3A 4Q4V1 3N3HA 1WWYA 3A21A 5I0TA 4B7EA 3AKSA 2R7EB 3P5BA 4XAAA 1JN2P 1X8EA 1XB9A 3FWEA 3ACFA 4UWDA 5L36A 5LY1A 4BPZA 5FZ9A 2W9XA 4QAWA 4DQAA 1X7NA 3MW3A 3DYMA 5BNPB 1JYNA 1JZ8A 5I0DA 3PU8A 1LOEA 4PDWA 4E4SA 2FMDA 4LHLA 3ZXFA 1XU2A 3ZXKA 2EF6A 2W91A 4XJ8A 1W9YA 2VECA 1H1MA 3LGRA 1LHUA 1S0GA 4DUXA 2XJQA 5FY1A 1POV3 2DFBA 5A7QA 3VZJA 3O1UA 4FPLA 1ZZ9A 2DUQA 2X5IA 4UW4A 5E1RA 3IMMA 5JI7A 3S7IA 5FY8A 3GJAA 3ZYIB 4IGQA 4KWKA 4BISA 4B7KA 3B94A 2WQ8A 4LBKA 5DAVA 1VBA2 5GKAC 3ZSMA 4MLOA 4PF1A 5CADA 1NKGA 3E6CC 3O1SA 2B9VA 1K45A 2FMYA 4XF4A 4FPHA 4AWDA 1K5JA 3GHNA 1SCSA 5L7OA 4P9XA 2Y0OA 1QH6A 4DY5A 5CB7A 2PMWB 3VDDC 3WNPA 1KQRA 3IKWA 4NJ4A 1VBE1 5KHJA 2Y6JA 2JICA 1GICA 2NMNA 3U1XA 5I8TA 4WVVA 2VU9A 1C8M2 2AZ5A 3N35A 3TN93 4KG8A 4Z8BA 5KBFA 4LUKA 3LEGA 4HKWA 2XJSA 5CBLA 1JXNA 5GLVA 1UMHA 1FXZA 1ULEA 1DYOA 1DZRA 3AMPA 1X50A 3DYPA 3KV9A 2TNFA 1N3PA 5BNNB 2B45X 3AZWA 1DYKA 4O7XA 5GM0A 2YB7A 4CCNA 4X8PA 2XJRA 1LESA 5T5OA 4Q1PA 4AGVA 4C1XA 1PO12 4COVA 3PUSA 5DZEA 4ET7A 3THTA 1OOPC 2A75A 2WJSA 1FOD3 3SCHA 3AL5A 2MHFA 2Q0AA 3IDEA 4Q8LA 1QDOA 3GZUC 2E63A 4KMQA 3RWKX 4CXYA 1RUE2 4EQVA 2WT0A 2PXJA 1H30A 4AYUA 1QMJA 2H0VA 2WFF3 4H55A 4AEDB 1S2EA 4PDWB 5EIYB 4COUA 1NOVA 3KSCA 2ILMA 3AB0A 1NA1A 1UY2A 5FK7A 3POIA 4IQPA 1Y9MA 4N7UA 3L2YA 1WA4A 1C28A 3PVEA 4QD2A 5JOYA 1D4M3 1XE8A 2X5IB 3BALA 4LIUA 2TUNA 3LFMA 3ZYHA 1M06G 4JKMA 2E6VA 4GQ7A 4RFRB 5ACA3 2JD4A 5FP8A 1VBD2 4NVPA 2A5ZA 1NCQA 2AH2A 3VHRA 4Q26A 3LPGA 4HMZA 1YO8A 2WO3A 2RG4A 4AVCA 3RZKA 4AFDA 3KQRA 5KC6A 5F2WA 4DUWA 2ZGNA 2QDRA 4IDZA 4XF1A 2NP0A 4F83A 4QKBA 3SH3A 2WNVC 4OMCA 4NIDA 2WNUC 1POV1 3KVBA 5FOJB 2BNMA 2B42B 1VB2A 4E8DA 4N43A 4Q4Y2 2E51A 2JG8C 3I97A 1MVQA 1UOFA 4AI0A 1XSRA 4XEZA 1XRUA 4QX0A 1WA6X 4YZ1A 1RJ7A 2JKBA 3MPPG 1UZZA 2NM1A 3RPQA 3FHIB 4FFFA 3AZZA 4LOSA 1IGOA 3LOBA 3BCWA 3H3UA 5JAXA 1GFF2 5CG8A 1H6YA 2XXZA 2QQLA 3ZFEB 5K0UC 5HV4A 5I8SA 1NCRA 3RZHA 3IIAA 1U5ZA 3LA3A 2ZMKA 2AGSA 2ZJCA 2YBSA 3MO4A 1JMUB 3HOBA 4RD7A 5FV3A 3ZMNA 1JUHA 3TN91 3SQOA 2LW8A 4YM3A 3MGUA 2ZHLA 3T1LA 2WNOA 5F5IA 1JU3A 1WW6A 3VL9A 3WHTA 2VMHA 1JYCA 2AENA 4UW3A 5FPVA 3VBRC 4DO0A 5HV0A 2QNKA 2ZHMA 4JGZC 5CFDB 3O14A 1NA1B 1X82A 4XC9A 4LMFA 1TE1B 2BUKA 4QGLA 2GP5A 3QOPA 5EFUA 1S4CA 1JS9A 1FOD1 2YFUA 4ARYA 2D3RA 5IK5A 1W8NA 5GLWA 1MPXA 1IS6A 1F5JA 1OH3A 3ZYFA 4ATEA 3VKFC 1CZSA 3DXUA 4Y22B 1OC1A 3OUIA 3ZFGB 5BNNC 5FPLA 1U5XA 1Z78A 2WFF1 3D3AA 4R9AA 1NCQB 4AAXA 1PZ7A 2W1UA 4CU9A 1FV3A 4IV3A 1RC6A 2JDKA 4HLTA 1JOJA 1LRHA 3KQ4B 4GJYA 3ACHA 3O1PA 3RYPA 4HSJA 2GZWA 1XU1A 2WA4A 3WOGA 3BU0A 1ULFA 3W9AA 1FNZA 4GWMA 1D4M1 3MF6A 4XUOA 1VP6A 4DEVA 1S0JA 3N9LA 2ET1A 4CCKA 5ACA1 1PX4A 3WF2A 1JZ3A 3GBFA 5FYBA 4EZHA 4LBJA 2OPKA 1RYYA 2DTWA 2BDRA 1KJRA 3I3BA 3MV11 3N9MA 4XHXA 3NQHA 4XJ9A 4F7ZA 1LOCA 1F4AA 1H1IA 1KS5A 2YDEA 3E1F1 2VMIA 4L92A 2ZX4A 4NHMA 4XYXA 2VNVA 5A7WB 1NQJA 4E27A 1PK6A 2ZGPA 1WCUA 5JXJA 4QMAA 2WSUA 1NCRB 5JIAA 2JIJA 3WDWA 2F6BA 3LDKA 4XQWA 5LA9A 2VVEA 4QXKA 4ZS3A 4W8JA 5EZWA 2Y6GA 1UY4A 4XTMA 3AZXA 1ZBA3 1OLQA 3JB4C 2VOVA 3PTYA 3MLKA 2OVUA 3E6DA 5JZGA 1OQ1A 1ST8A 5LZ6A 1UZWA 4LT5A 4EWAA 1ULGA 3D6EA 4XACA 3WNXA 3KM5A 4X6QB 3T0BA 2JWPA 2RJ2A 4FTBA 1TME2 2HWC2 4XETA 4EYUA 3POSA 3I2IA 5EYXA 3U4SA 4OI4A 2YUEA 4ITCA 1YFYA 4L99A 4P08A 2WZR3 5FZ6A 5AFBA 4YGBA 2G1MA 3RWNA 3WG4A 1BVVA 4LO6B 1MS4A 3IN9A 4XFFA 3BB6A 1HRV3 1W9TA 3LIGA 4HK9A 3TBDA 5EJ1B 3TWIA 1JUIA 2J22A 5FZBA 4FTSA 1DZTA 4CPBA 2MEV3 1BK0A 3DGTA 4IEPA 2XB6C 4IV1C 2D6LX 4QX3A 4IV3B 5CYYA 3UGHA 2CYFA 3RYRA 2DVGA 1QJEA 3H3ZA 4K20A 4DXTA 3I3QA 1PGSA 1T6GC 4NHKA 3Q9OA 4YVSA 4EWDA 2WS92 2Z5WA 2D6PA 2WZPP 2WT1A 3VHOA 3M3OA 1ZBE2 4OHXA 1GZWA 4QPIC 3A7QA 4RS5C 5FZEA 1RUC2 3NJXA 2JIGA 3AP4A 5IVBA 2IFWA 2B9UA 3FLPA 5A6YA 4YZ3A 1UY3A 3CHXA 3H1YA 2OKXA 4B8EA 5FQ0A 4QGNA 2Q1MA 3ST7A 2W68A 4QKDA 5ABJC 3LA7A 1F35A 3MLLA 3WR0A 3OF1A 3FLTA 2E53A 3W21A 3UJOA 1CAVA 5JOWA 4KWUA 3TN92 1SLBA 4XBQA 3I3EA 1PHMA 5FYIA 3UL2A 1UU6A 1CZTA 3IB3A 1O4ZA 1CZVA 3NRUA 1GZ9A 1LB2A 4N53C 1SLLA 3DPRC 2ZGSA 2ADEA 5F37A 4W50A 4E4ZA 4U36A 3I54A 4ZXEA 5JR2A 5JSPA 5FAXA 1V00A 1LOFC 1V9U3 3PVNA 4CZSA 5BNOC 5KC5A 1UX6A 2JKXA 1RUF2 1PIV2 4BQ4A 4QXBA 1AR83 4OQ9A 3BN6A 1KDMA 2JDMA 3HNYM 4GWIA 2BTVC 2E7AA 3ZYBA 1JYTA 3WX5A 2WFF2 4Q27A 4QX1A 2KM2A 1Z7S3 3ZIXA 1ZBA1 2FQPA 2VY0A 3I2FA 4LLFA 3CDZB 4D8MA 1AVBA 3KCCA 5A32B 1NZIA 5CISA 1DF0A 4CUGA 2BBAA 5FDBA 2DCTA 2VBPA 3KS7A 2CGPA 2ETEA 3ZN4A 1QQP2 4Q4X3 5C5UA 1MS0A 1JOPA 2RDSA 3Q8CA 4FP3A 2LM3A 1D4M2 5JVVA 2JDZA 3VD5A 3PUHA 4MGQA 4NPMA 1SLAA 4Z1VA 2XMLA 1SQ4A 1OKQA 2ZBJA 5LK7B 2ZXQA 4AGGA 2WZR1 2PLV3 1GZWB 3U78A 2BRTA 1OOPA 2DVFA 2RE9A 4QX5A 1PGW2 2Z4FA 1HRV1 2PA7A 4MX3A 4HKLA 2IWGB 4AI3A 2MEV1 4QPGB 3AP6A 4A7ZA 5JI9A 3B3QE 1BK1A 3KV5A 1NLSA 1B09A 1JZ5A 2Y64A 5FJKA 2R1BA 3NNJA 4J1XA 4CEYB 3CZUA 4KU8A 4UFMA 4Q8KA 5H9SA 5CVRA 3K75B 2P3YA 1CPMA 2FCUA 3BTXA 3UV9A 1W8HA 2J1TA 1UOGA 1POQA 4S2HA 4JGYA 1QJY3 4WM8B 4YPJA 1DQ2A 3I59A 1US3A 3G7DA 4LBQA 2ZGRA 4Q0UA 2OS2A 3VBSC 1J3QA 4UBGA 3USUA 2O8QA 2DURA 2R0FA 2WO1A 1Y9QA 1TMF3 1N1VA 2XBO2 1ODMA 3LIHA 1ZRDA 2R16A 1UOBA 4AQSA 1W6OA 4HVOA 5F8PA 5IVFA 1AJKA 1QU0A 4YGEA 2XHKA 4LBLA 1LENA 1VB4A 3K48A 3ACIA 5D21A 1UAIA 4AHZA 5H9QA 1PGL1 4QPWA 2WNVA 4O61A 4YW4A 3M7AA 5SV5A 3KHBA 3MZHA 1NLQA 3DF0A 3I2OA 4Y1VA 1NLRA 1RINA 2RS12 2W1QA 1YI9A 3J7HA 3L9JT 3ON7A 4I01A 1RUI3 2D5HA 4QHZA 1W28A 1PZ9A 4DB5A 4FPKA 1RUJ2 5F3IA 2WABA 1OF4A 2OT7A 3GHMA 4Q0QA 1V9U1 4N9HA 4BIOA 3ES4A 4NPRA 2QQMA 2D43A 5J96B 5KXBA 4JQTA 2Y33A 1AR81 2UWAA 3GBWA 2XJUA 4AEDC 1N1TA 5FKCA 5F6LB 2UWBA 5K0UA 1RMU2 3HQXA 1RUD2 1BLZA 4KBZA 4BQ1A 1Z7S1 1UO9A 1KDKA 1AF9A 2WWUA 4D3WA 3FZ3A 3UK9A 3OPWA 4HOOA 1ASJ2 3RZJA 1VLNA 4Q4X1 4XXAA 4GH4B 4BQ3A 2ZX3A 5FUIA 4MUVA 3AZYA 1H8TC 4OULA 5LWBA 4M3CF 1CVNA 1WLDA 1UF2C 5JR7B 4CRQA 2YFZA 1ENSA 2O8OA 1OA2A 1OVSA 3IT8A 3VBRA 4JGZA 4AXOA 4CVUA 5C70A 4QHOA 2BV4A 1GNYA 4JDMA 2PLV1 2JB8A 1LNSA 2EXIA 3LB9A 1W8UA 2AACA 3KMHA 1QJFA 1JHNA 4JGYB 2XJPA 2ATFA 1BCXA 2QCSB 4LBQB 4BK4A 3U0ZA 4HSLA 1VBA3 4A6OA 3NVCA 4IL7A 2KD7A 1GQGA 2BU9A 4NIGA 3TEZA 2G9ZA 4ZU5A 5IVYA 2OXBA 4NWVA 1AR62 2HWF2 1Y4WA 2X05A 3NKGA 2H6BA 5FYZA 3INAA 4QQOA 1QJY1 1V70A 3KV4A 2P34A 4D94A 1C8M3 5FYUA 1CD3G 4GA9A 4QQ2A 5JCTA 5C4WA 1GWMA 4CDQC 1TMF1 4QQLA 1XNKA 4AE2A 4FSJA 1OI6A 1L7QA 1NQDA 2BZDA 3IIIA 1DQ6A 1VAMA 5A7SA 3WP3A 4A3XA 2QDNA 1SCRA 2OYZA 1L7RA 2EA7A 1SHWB 2Q8CA 1R082 3CL1A 2V5YA 1NYWA 4AZZA 4DZGA 3KGLA 1GBGA 2BJSA 5FP9A 2MEV2 1E5RA 1EAH2 1RUI1 1LCLA 3JB8A 3T0AA 1RUE3 4LLOA 1W9WA 2PELA 4F8AA 2MPFA 1UKGA 3GZEA 3N7JA 1DIWA 4HK8A 1W04A 4ASKA 2ORXA 2PHFA 2VZUA 4KQ7A 3GBGA 4G4FA 4NROA 3P1IA 1LHVA 3WG1A 3ENRA 1YQCA 4DEQA 2GNTA 3DECA 3LEIA 2WZ8A 3HN3A 1STMA 3NV1A 1QOSA 3KLSA 4LKEA 1VAVA 2PAKA 1ALYA 1A8DA 1ZZBA 1C57A 1IG0A 2VTXJ 1LGBA 3PTRB 3ZIWA 1JYIA 2W52A 4O9GA 4RQPA 3OGSA 5JSOA 4CP9B 4UFLA 4BZ4A 3GDBA 3LF7A 1VBD3 3APBA 4WVZA 3RVHA 5C8CC 4K8FA 5FMCA 3C3VA 3N9OA 1VBC2 2E32A 1WUVA 2ZGOA 4GMP0 4GJZA 4M4RA 5EPAA 1XJAA 2CDPA 2Z69A 4LKDA 1HXS2 4HANA 2Q8OA 1OFSA 1W06A 4Q4Y3 4H3WA 1YXWA 2X09A 2P37A 2DU1A 3T2TA 4S2DA 2ZEYA 3LD8A 1F15A 2D98A 3NJVA 4JQRA 1SLTA 4P5HA 3UGFA 1WW4A 1LECA 5CA6A 1VBA1 4UF0A 3EMRA 4YG3A 5C4WB 2K9ZA 4LXLA 1IOAA 3LEMA 4JDOA 1Q8OA 4XTPA 4AHWA 4DY3A 2JECA 1S0FA 2VC9A 2X29A 1UX7A 3OGRA 4FP2A 4JKLA 5A33A 1CAUA 1JOBA 5GLTA 2NYYA 3D8CA 5ABJA 5IK4A 3UKVA 4XFIA 1AXZA 3WV6A 1XSQA 4JTNA 4Q4W2 3E5XA 3LZZA 2GP3A 5AVPA 4XOGA 4XE9A 3K3NA 4FPEA 1C8M1 1O8SA 3CZJA 5L19A 2ZKNA 3QD6A 4FFIA 5EHDA 5FBJA 3UKNA 2AYHA 2LUWA 5F1RA 5B2GB 2Q1FA 2YMZA 4HBNA 5FZKA 1UWWA 2ZA9A 1TEIA 5L73A 3M70A 1HQNA 3RMXA 2EIEA 2GALA 2ZX1A 3NSTA 1HIXA 1O4YA 4K3UA 2XWJB 3DPRA 4XZUG 2IFRA 3UGGA 1DP0A 4Y1ZA 1O6UA 1OLRA 1OBNA 3NO8A 1V6NA 1IPKA 3KT7A 3DKWA 2V5DA 3M3CA 3OYWA 5BNOA 2IXLA 3WW2A 4K40A 1JHJA 3O1OA 5BYNA 1JI6A 3BOWA 3B02A 2WSVA 3WINE 3AK0A 2GAUA 3WF0A 5FPUA 2TBVA 2OPWA 3EO6A 1PMJX 1QXRA 1RUE1 2NN8A 4IXLA 3GZAA 5DG1A 2BEOA 4XJAA 3LOIA 3USSA 3VLBB 3ZXDA 3QACA 4EWEA 3C7GA 5TSWA 2WL1A 3MIHA 3OGJA 1XYNA 4BQ2A 1AR72 1LULA 5DAQA 5IFTA 4CUBA 5GZCA 1H2NA 3VBHB 4FPOB 1QJU2 1JZ4A 5FZIA 3AYDA 4PIZA 3ZXLA 3KF3A 5JLVA 4KWLA 3UESA 1EPWA 4DRVA 2ZTNA 2PHTA 4CDXA 1VBD1 2E31A 4MG2A 2PQSA 3M4FA 4QM9A 4K6BA 2BP6A 3Q8BA 4OI0A 2BWCA 2J42A 3POEA 3CBNA 5FPZA 5K9YA 3H8OA 2QQPA 1LAJA 1HV1A 3AFKA 1MEC2 1W6PA 5LBFA 2HKXA 1Y9GA 1G9DA 2FDJA 3GGLA 1V6JA 3AP9A 1FT9A 2GNMA 2A3XA 2WO7A 2DWRA 1OA4A 1RUI2 4Q4Y1 1DBNA 1GV9A 1O8PA 1CX1A 2ZGUA 5FZOA 2P17A 3K2OA 1B35C 2ORZA 5D8AB 4K7JA 2DF7A 4OI1A 3ZN5A 3WW3A 2GC1A 4BJ0A 2VG9A 2E9QA 2WIIB 2P3IA 4JVAA 2Q8EA 2QQVA 2YGLA 1IHMA 4AFMA 2YG0A 1LHOA 5IT6A 3POYA 1GNHA 2A1XA 4GXLA 3THDA 4AL9A 1N1SA 2PAEA 3K4AA 4MSVA 5EXOA 4L11A 5JDBA 5DZFA 2ZZQA 3PMSA 4IERA 3K51A 1TME3 1Q8QA 2HWC3 5CG9A 2BW8A 5F5AA 3M3IA 3AMHA 4XJZA 2PFWA 1H2LA 2HWB3 2W39A 3OYWB 1CIYA 2GNDA 4YWAA 3WDYA 1XQNA 2HBTA 2W87A 3AX4A 3U07A 3ZR5A 1SBDA 1TNRA 3AVSA 4PIXA 4DNYA 4Z2WA 5CFCA 5FO8B 2XLFA 1IQDC 3THPA 4Z2AA 4GD4A 3D4KA 3T2OA 3VHNA 1Y3TA 1F4HA 3AXDA 2BVVA 1C4RA 4TLFA 2D93A 3VDBA 3LSEA 3BTAA 4E2QA 2WS93 2CGNA 3WG3A 1PNFA 4DXSA 3RQ0A 1ZBE3 4Q1RA 4UT5A 4WZFA 3SNMA 1RUC3 2R072 3E97A 3CMGA 4XDOA 4AK3A 1ULPA 4CDUA 5A1AA 4YZ2A 4CDXB 3SH4A 2EXJA 3O5SA 4CYDA 4FPYA 3MFAA 5IHRA 2W5FA 3ZSLA 2WA3A 4RN5A 1J3PA 5C9AC 2NQYA 4DIQA 4WM7C 2HWD2 2GC3A 3P3PA 1H8TA 2HJIA 3CNAA 1BYHA 4FPFA 4H2AA 4PBPA 4XMIA 2EXHA 3VBFC 4Y26A 1FMD3 1URXA 5CKNA 3WLUA 1DQ0A 1GP4A 4ASLA 4U2AA 5C3PA 4C0HA 4BXSV 1UU5A 2D3PA 1I5PA 5GLZA 1AL22 1CAWA 1GNZA 1REEA 4LTAA 1LOBA 3ZYPA 2VNOA 3W5NA 1DDLA 4XDPA 1RUF3 2PQQA 3F95A 1PIV3 5FPBA 2OA2A 4JTOA 4OVEA 3UKTA 1BHGA 2CU5A 3N36A 1MQTC 3KB5A 2PHXA 4AR2A 1HQWA 1O5LA 2SLIA 2CTVA 1W3VA 3IPVA 3MPBA 3MHZA 3R05A 4FT8A 4XUQA 2SBAA 5DZGA 3ROUA 2WO2A 2OW4A 3FN9A 3HQRA 1KJLA 3LQCA 4NRMA 3S7EA 4M0NA 1HQLA 3LCPA 5F9TA 1Q8SA 4DRRA 5CFCB 4PCRA 4Y33A 1W0NA 2NPIA 2ZHNA 1QQP3 1QJX2 3O1VA 4Z92B 4ZONA 4RR3C 5T5LA 4NE9A 1L3JA 2RM22 1GOGA 3HIFA 1LODA 1MZFA 1TME1 2HWC1 1EYBA 2VZOA 2HWB1 1OHFA 2RJKA 2UURA 3TEWA 1RUOA 5FLIA 1LOGA 1PO22 1SFYA 4OI2A 2VCMA 2YU2A 4XXPA 1WGPA 3U37A 2J1VA 4CE8A 5DDJ2 4CDUB 2OX0A 1RGSA 2R30A 3GM8A 2VL4A 2GMMA 2HH9A 1OMIA 1K5MA 2BGPA 5L7OB 2B4KA 3ECQA 4OHYA 4GIQA 4ARXA 3ATGA 5ANNA 1ND2A 3ORJA 2YV8A 4O9EA 2H6CA 3PNAA 3B9CA 3A0KA 4CUCA 5IK8A 2WQ4A 4L97A 3CJIA 3ZXJA 2WS91 2XKPA 2QTWB 2VGDA 1VMHA 2CDOA 1RIRA 1ZBE1 2D40A 4GZ9A 5E6HA 4YW2A 2B7YA 3CLPA 1RUC1 2XQRA 3JZVA 2GN3A 2J7MA 4ISRA 4L0PA 4QXCA 1RTVA 4OHZA 2R062 5FLJA 2EIGA 3WQBA 2QQNA 2W1SA 1WCKA 2VPVA 3NNMA 4CTEA 2ZGQA 2XBO3 4R4XA 1CAWB 2ZEXA 5IATA 4COWA 5FP7A 3VUOA 3DXTA 2GMEA 1GZTA 1WLCA 2VZRA 2Y26A 3A0NA 3AZVA 3PURA 4QT6A 1ENQA 4AEJA 2BFUS 1KS4A 3DV8A 2DUPA 4ZKTB 4QX2A 5KHIA 1FMD1 2R1DA 5LRSA 4I2OA 1TNFA 4MHUA 1ODNA 2WLQA 3IPVB 1GOFA 1QKQA 2RS13 4XBLA 4OYUA 3B01A 4LE4A 1JH5A 4XW3A 5L9RA 5FZ3A 2DVDA 4YFZA 2RDRA 4AFAA 1RUJ3 3F2ZA 3PIJA 2OZJA 3R0RA 2VMEA 3FE5A 5FYVA 3ZPYA 5C3RA 2C26A 1H2KA 1RUF1 3MF9A 5A3NA 1PIV1 1MS5A 1W99A 2OUJA 2IUWA 3OUHA 3AP5A 5DUWA 4IE4A 1RMU3 1YWKA 1RUD3 2VVDA 3IAPA 5A6XA 2EXKA 4IEXA 4PF5A 1A3KA 2JDUA 1R1ZA 1ASJ3 1QQP1 2VBDA 2RJLA 4D7YA 1Y7BA 4CDWC 1K5MB 3CJXA 4HVRA 4N43B 4DS0A 2JG9C 5DUVA 1DLCA 4FTEA 1ND2B 2ZOEB 5B4NA 4B4QA 2XQXA 2FDIA 2XOMA 4TSVA 3CJIB 4CEWA 4PT6A 4WZCA 4W4ZA 3IWZA 4HONA 4TYSA 2RS52 4NR1A 3CIHA 5KR7A 3ETPA 1GWKA 1LGCA 4PQ9A 3A23A 1PGW1 5AVAA 5A1LA 3VDAA 3ZFFC 1F5FA 1OLMA 4TTGA 2C1FA 2C9AA 5JOZA 1FV2A 3KHCA 1AZDA 1EUUA 2W08A 1QH7A 1ND3C 1JTZX 4UW6A 5HCBA 2DVBA 1AR63 1N1YA 2HWF3 2UU8A 3I2HA 4CU7A 3WDUA 3TOJA 3AM2A 3QH6A 3GF6A 1ZREA 1LU2A 4IE7A 5A3MA 2Q1ZB 1HRI2 3KT1A 1PM7A 3RFRA 2HEWF 1H0BA 3LPFA 2AEYA 4Q2FA 4YVWC 3V0AA 4J25A 4UFHA 5FY4A 1N3QA 2K2SA 2R042 3MDPA 5T55A 2ZX0A 2IVJA 3C7OA 2XBO1 1WMEA 1WBFA 3IDBB 3JUUA 1HB4A 1XYOA 5SV8A 4YYOA 3AJZA 2HWB2 2Z79A 4NAMA 3NV2A 3T30A 1O3RA 2VM9A 4NWWA 1WLTA 3ELNA 1X9PA 3KCXA 3M1HA 4H7LA 3O12A 2Y6KA 3Q8AA 1R083 3WNKA 1ZRFA 3HMYA 4HPKA 5A7NA 4QGMA 1NX9A 1HB2A 4AVSA 3OEBA 1ZZ8A 3NAPC 3QCWA 2RS11 3CQOA 3HPNA 3M3QA 5CNAA 1QHDA 5IVVA 1COV2 1EAH3 3S6PA 1NT0A 3WT3A 1F9KA 3OEAA 2ZAHA 4KL1A 1XPWA 4XDQA 1BZWA 1RUJ1 2XL9A 4OUEA 3OD0A 5BUVA 1TQ5A 3AXEA 3H42B 3AKRA 2RR12 1AX1A 2YBKA 3WZ1A 3BPZA 4A44A 4QDQA 1SDWA 1KD7A 1RB8G 3RZZA 3OPZA 1I6XA 3VBOC 1HJGA 4YNIA 1ZX5A 1CIWA 5A1FA 1W05A 5JUVA 1S2BA 5FZGA 3EHKA 1LJ7A 1RMU1 1RUD1 2X53S 3RG0A 3C7HA 1W03A 4PLMA 4CEWB 1BBT3 1ZZ6A 3K4DA 2D6MA 5FRAA 2VOXA 4UW5A 3ILRA 2BVBA 5K7PA 3WDTA 3OCPA 1UL9A 1U5IA 1ASJ1 1RXGA 1CX4A 1I3HA 1K12A 1ZM1A 5CKMA 3WCRA 1W90A 1PK6B 5GZDA 5LCWL 1VBC3 4QX8A 3ZYRA 1ENXA 2OZ6A 2ZACA 1FMD2 1YHFA 4XVHA 4BB3A 2PHUA 5C71A 3PJQA 1HXS3 1UPIA 2JJ6A 3NJYA 4MYEA 4GAZA 1XOYA 5L9VA 3PHMA 4MH0E 1A6CA 1JW6A 2ZX2A 3HD8B 1EP0A 2V72A 1UY0A 4OUMA 2ZZJA 5JZGB 5FZ8A 2ZMNA 2A6YA 4FVVA 3VBUC 4KI5M 4MXWA 1VRH2 3D0SA 4IEYA 4FCAA 5BNQA 2XONA 5FP4A 1F31A 1NE4A 4NIAA 4BOWA 1MACA 1UIJA 4D0QA 1AR61 1FAYA 2VTXA 2WNEA 4FOVA 2HWF1 2V73A 5FY0A 3QH7A 4M3CA 5CAZA 1Q8VA 3WW1A 3HT1A 1RJ8A 1VRBA 1QGLA 2HWE2 4YZ4A 5H9PA 4P9LA 2GH8A 4FQ4A 5GZEA 3VDDA 1WW5A 4Q4W3 1DCSA 2V09A 1QDCA 1CONA 1LOAA 5EQUA 5HXVA 4AOCA 4WM7A 5DG2A 3BTYA 2WQZC 1GOHA 3O0WA 3VBFA 5JMCA 3I49A 2C6SA 4ISQA 4CCMA 3N7MA 3HT2A 5BNPC 2A71A 3MYXA 3H8RA 5FZ0A 2K0GA 1DGWA 1OF3A 4YVSB 4QKFA 1M4WA 4O65A 2KXLA 5A3TA 5FUNA 2IXJA 1R1A2 1OURA 1R081 2RMU2 3FFQA 4R52A 4BQXA 4QQPA 4JKKA 5HI0A 2R32A 4K8RB 4AEMA 5LBBA 5FQ0B 2EALA 3H9AA 1EAH1 2VO5A 2XH6A 3NNLA 5IFPA 4LBOA 1QXPA 2DUOA 1MQTA 3AYAA 4FFGA 4XMAA 4EROA 5KHHA 1YNAA 1MZEA 5J7MA 3IDCB 2WBKA 5FY7A 5F39A 3U4XA 1CAVB 2UWCA 1SFPA 1YFWA 2O14A 1W8TA 4FPGA 3VN4A 1AR73 5LATA 4IEQA 3VL8A 4GULA 2E7TA 1FYUA 2A6ZA 1D2SA 4RR3A 3ASIA 4C91A 1QJU3 4EN9B 1KITA 1KGYA 3EQEA 1GANA 2WAAA 1BBT1 1XNDA 3I2KA 4Y4YA 5EYYA 4UXAA 1DQ5A 2Y0IA 1GU3A 2QQUA 1H4GA 1XNAA 2D7FA 2ID4A 2WAOA 2WKKA 1P8JA 3OY8A 3H3LA 1G86A 4LUMA 3TB0A 3ZN6A 2CSGA 4OCTA 1ZA7A 3T0DA 2P6HA 3J9SA 1U0AA 1DLLA 1VBC1 3N7LA 4JC1A 4LA3A 1MEC3 1ZRCA 3WUDA 1J1LA 1DGLA 2GU9A 2YXSA 1W6NA 1HXS1 1NE6A 2WNUA 4PQQA 5HBAA 1V6KA 3U10A 4M3CB 4LHNA 1S0CA 4IW3A 4NUBA 4MGTA 2QQIA 2JG8A 4TZDA 4UYBA 3VDDB 1SBFA 1E5SA 2IXCA 4KU7A 4LK7A 5FXXA 1D0HA 2JDHA 3T4HB 4NHYA 1UYPA 3SHRA 1IG3A 5FR3A 3AMNA 4AQ6A 4CCOA 4XAEA 5I8YA 1C8NA 2B5HA 4B1LA 3OG2A 3OTFA 3BOPA 2RVAA 1YQ5A 1X9TA 2G19A 2EIBA 2J1EA 1GP6A 4PDWC 4CU8A 3MFCA 4K21A 2ENRA 3GNEA 5IAVA 3VD7A 1ZA4A 4IEWA 4P9YA 1U12A 4Q4W1 1OOPB 2QUOA 1CQ9A 2P4EA 4YW5A 2X5IC 4QDSA 4UBHA 3RJRA 1Q8PA 2XVKA 1XNTA 2Q8DA 1ENRA 4CA9A 1RVF2 5E16A 1W8ZA 2YBPA 1PX3A 1GKBA 3VB9A 2G9GA 4L9BA 1SZBA 1W3XA 5FXWA 5J1XA 2XLGA 4X6RB 1SLCA 3LDRA 1W0OA 4M00A 3RI8A 4XJUA 1VMJA 5T54A 4AW7A 2A3YA 2XUEA 3C7FA 1C1LA 1H8VA 4OUSA 3RZLA 2Y8KA 5F5CA 4AQTA 5JPNB 5L7OC 3I59B 3OPTA 2OUHA 2CWMA 4ZU7A 4LJHA 2WZEA 5I0SA 4BXFA 4AGRA 3DL3A 3USUB 3GJBA 4P5YA 1G9BA 3MI8A 1XC6A 2R073 1QF3A 2BOJA 5BNNA 2UY8A 1W6OB 2VZ3A 4PHZA 1J58A 3ZN6B 4DXRA 3FJSA 4UOJA 2VOTA 3BGAA 2YC4A 3BYWA 1PVC2 3ZFEC 1AR71 1YRZA 2BNOA 2WNVB 2V4VA 5FO7B 2WNUB 4BCUA 2UY9A 1QJU1 1C5HA 2HWD3 4YW6A 4BM8A 5CEHA 4INDA 2DDUA 2QZ3A 3THCA 3L2HA 4K1YA 3AMQA 3WDVA 1G6NA 3CU7A 1J84A 1H9PA 2OIIA 2GN7A 3K4ZA 4UFKA 1AL23 5DQ0A 4V2VA 4LO5B 1MEC1 4A7YA 3ZFFA 1O91A 5K0UB 5IVEA 5CFDC 1NA1C 1H9WA 1MZ5A 3WQ0A 1ND3A 2JX9A 3AP7A 4TXWA 1AYM3 1Z0HA 2VULA 5FBZA 2XVGA 1F8VA 2V4AA 4EN7B 2ARAA 4A42A 3ES1A 3HN1A 1GQPA 3TNQA 4LQRA 3ZFGC 2VOWA 4TWTA 3V0BA 3H8XA 3T4VA 1NCQC 3BODA 3PLQA 1W6MA 3WD5A 1QJX3 4YVWA 3VBRB 1O3TA 4JGZB 1RUH2 2LS6A 2RM23 3WP4A 1BBT2 2VUAA 4Y24A 3S5AA 5B4XA 2CWSA 3GCWA 3VHPA 2VUDA 2CAUA 4N43C 1PO23 5FYCA 4URTA 4N7IA 4AFBA 4R9DA 3POWA 1UOJA 4P9WA 4AI9A 2PHRA 5DDJ3 2AR6A 1OPOA 3NAPA 3MV01
chains in the Genus database with same CATH topology
1IS4A 1XYPA 2RS32 3ZSKA 4BMEA 3N7KA 4IV1A 3WVJA 1AX0A 3HR9A 4DINB 4I09A 1IKPA 2G4IA 5FMOS 3FUQA 2CV6A 1NCRC 4EN6B 1AXYA 2F4PA 4WV8A 4JAAA 3J4UH 4P9GA 4QPIA 1OSGA 4RS5A 4BH9A 3NWKA 4BLIA 2R071 4OHWA 1R093 4S2GA 2R063 4I3GA 3S30A 1SMVA 3B93A 3WXPA 4BLJA 2D5FA 2HWD1 2A6XA 2DTYA 3FFZA 1LEDA 5HCFA 4FPJA 3HBZA 3WW4A 3VGIA 2GSYA 2MNGA 4G3YC 1Q43A 4HN1A 4N53A 1AHSA 3B9IA 1POV0 1AL21 1LOFA 1KFUL 1W6MB 2VVFA 4IV3C 4MGYE 1QOTA 4QPYA 5KXDA 3LAGA 4RQPB 1LTEA 1MS3A 1AYM1 2IXIA 3VZMA 3R4UA 2XGXA 3ME2A 2ZHKA 4KNCA 2CGOA 4PIYA 4YGDA 1CJDA 4ATFA 3O0XA 2B39A 4D7TA 1ULDA 1QJX1 1O3QA 1LHNA 2ZGTA 2P3KA 4IV1B 1REFA 2RM21 2ZABA 5BNPA 5J09A 3EBRA 5KXEA 1NY72 4R9BA 1PK6C 1SLIA 3B7MA 4MGKE 4LO8A 1EY2A 4JCKA 4Y5Z0 2HEYF 2R0HA 1PO21 4QPIB 2RS53 2W0XA 1OQEA 1ZNPA 2JENA 4RS5B 1HDKA 3DN7A 3SXWA 3ZDSA 4C91A 4CP1A 1BXHA 5DDJ1 3D0JA 2HYKA 4R9CA 3ZXEA 2BNNA 3MW2A 2YHJA 1CAUB 4JV4A 5A33B 3LA2A 3R4SA 5ABJB 4HVQA 1YJKA 2VMGA 2PN5A 4Q0PA 4HKOA 4FBFA 1HKDA 1GZCA 1BMV1 5GZFA 1HRI3 1R091 4GMP3 2R061 3VBSA 3AMMA 5T50A 1HV0A 2XL7A 3RSJA 4N53B 2R043 3DPRB 5GZGA 2JXAA 3R4DB 3W58A 2Q4SA 1CAXA 5EWSA 4FOQA 2O1QA 1D0GA 5BNOB 1IKQA 4K1ZA 5FCCA 2CY6A 2D3SA 5T52A 2DV9A 2WFPA 1MVEA 4B4PA 3D5OA 1S0BA 4J1WA 3G6JB 1COV3 1RUG2 3E5QA 1WMFA 3ZXAC 1A8MA 5CU1A 1MS9A 1KXGA 1D2QA 1REDA 4QPGC 3TRSB 1LU1A 2GH2A 4XHBA 2IC1A 2ARXA 2XLAA 2RR13 1DHKB 3AFGA 2ZGMA 3MIEA 5JOXA 1W6QA 2AUYA 2UYBA 4XQDA 4AEDA 1RITA 3O0VA 4CEYC 4KGGA 3H7JA 5FLHA 2DCYA 2I45A 4EN0A 4WVWA 4J6GA 3VZNA 4I0BA 4YLZA 1NXD1 1SACA 2E7QA 4RL7A 4XFAA 1YYNA 4WM8C 3SISA 4D7SA 3R6SA 3V64A 2A7AA 4FQZA 4RGGA 1W6PB 3RMYA 3MW4A 2D6OX 4E4DX 3AYCA 5EJ3A 4EJRA 2I2SA 5C33A 2D6KA 1UMZA 1PZ8A 3ACLA 5CIRA 4META 1AYN2 2B46X 1QOOA 4GB32 1U5YA 1RHI2 1WBLA 4RA0A 2ES3A 2XKOA 1FPN2 1UN1A 2RS51 2VW0A 4JRLA 1G8WA 1DQ4A 4FPCA 5E8AA 4AFCA 4C0BA 5AC92 4NHLA 2NMOA 3VBSB 4COYA 1VRH3 2C0ZA 4MGIE 2UYAA 5A3LA 4R4ZA 3OBTA 1O3SA 1GR3A 4AG4A 1AYM2 2PTMA 1NXMA 1CAXB 3J8F2 4IEZA 4YW1A 1UD1A 4RGAA 2X8KA 2WINB 4W6XA 3PVOA 5J48A 4MGZE 1QY4A 2HWE3 3ZFEA 3MLJA 2QVSB 3V56A 1HRI1 4M01A 4GMP1 2QJVA 3A4UA 4MV2A 4BMBA 3WQ7A 3RI9A 2R041 3WHUA 4CDQA 1LGNA 1IQAA 4AVBA 4C90A 1PMIA 1N47A 1OFNA 4GH4C 3JBG2 4AI2A 4HZFA 4BA6A 1GLHA 1EV12 1QJZA 3ZVXA 3GALA 1W6QB 1R1A3 2RMU3 3RYKA 3AYEA 3E5UA 2A3WA 5CFDA 1AX2A 1VJ2A 3IMNA 3NJZA 2BFUL 1COV1 1DGRN 1A78A 2CAVA 4JGYC 4KG0A 1Y43B 5GLUA 4P14A 2ZPXA 4KGQA 4C1WA 2GC2A 4Y22A 2RR11 2ERFA 3ZFGA 1QNYA 1H8TB 1S55A 3JQWA 5KHKA 3CF6E 2D6NA 4LO4B 1WD4A 1KFXL 1R092 4L8QA 4BE3A 4Y20A 2NZ9A 1Q56A 4YM2A 3T1MA 2VW1A 1X33A 2DVAA 5JWPA 2IZWA 1UW8A 5T3NA 4AVVA 2Q30A 5I93A 2BPA2 5C8CA 5BPXA 3WDXA 2DCJA 4KH9A 4QU2A 3ZYJB 2BGCA 1F2NA 1I9RA 1O4TA 4YFWA 1VALA 2XWBB 3FLRA 4Q4V2 4Q0SA 3RS6A 2EAAA 1RL3A 1VAKA 4W6WA 4XF9A 2ZGKA 4YW3A 1X36A 2FZ2A 4ONUA 1VRH1 4SBVA 4CDQB 1VIWB 4FXGB 1YFUA 3VKNA 3ZSEA 4JRAA 3W59A 1E57A 1ULCA 1S0EA 1S0DA 2HWE1 3HWJA 4HN0A 1ZRRA 4GWNA 1PNGA 3DUIA 1MR5A 3NKTA 4MZUA 4QM8A 1ZVFA 1RVF3 2QKDA 1DGWX 4F3JA 1CR7A 1LKNA 4AHXA 3KT4A 3AJYA 4Z82A 3OBRA 1BEV3 1DZQA 4XILA 2H0BA 2P2KA 4WBBA 4LNVA 1R1A1 1YFXA 2RMU1 1FNYA 2TEPA 4Y20B 2Y38A 4YGCA 3MIFA 1VBE2 3B69A 3S0MA 1WW7A 4YM0A 4BWOA 2PHDA 4P9IA 2QFEA 3E6BA 1V6LA 4PBOA 4EN8B 5FFOC 5C4WC 5C8CB 3EJKA 3RNSA 1FX5A 5E89A 3VKMA 4A2UA 1PVC3 3NL1A 4AVTA 5T5JA 1G9CA 5FOBB 4FOYA 2DFCA 1H2MA 2D44A 5KHGA 5T5PA 3FBMA 2ZGLA 5J3UA 1BQPA 2DCZA 4ORFA 1S0IA 3FMGA 4RFT0 4S2FA 4FAHA 5K8SA 2ZAAA 2ET7A 3FC0A 5C6CA 1DG6A 4YZ5A 1ONAA 1QNWA 5I0RA 4YARA 1XNBA 3PJYA 1B35A 1SBEA 3WP5A 4AQ2A 4RQPC 1IS5A 3MICA 3H1MA 4OLLA 4XIKA 4YSFA 4B3NA 1H1AA 1W39A 3M2MA 2A70A 3ETQA 4W6YA 1OD5A 5A32A 3TNPB 1RUH3 1YUDA 5KXCA 4R8HA 3VBHC 1QWRA 2Z42A 1XXNA 2BYVE 4MVTA 1GYKA 2FBEA 4ZXKA 3M8LA 2IXKA 1RVF1 3PMEA 5AFEA 1VBB3 4ASMB 4DPNA 2ZKLA 2YY1A 5C8WA 2RS33 2VQAA 4N90A 3MIBA 3QBQA 1BEV1 3UJQA 3WQ1A 2HEVF 1SFNA 4P9JA 3ZXGA 4AI1A 1J59A 1AUYA 4QPGA 5DUXA 4D69A 3I2DA 4OZXA 2YZ4A 3V0AB 4YM1A 1BVP1 3JD73 4CEYA 5D8AC 1I5ZA 1WLWA 5I0UA 1OA3A 4LR4A 4CP2A 4WM8A 5FTTC 1OQDA 1PVC1 3ZX7A 3SH5A 1AR93 5C9AA 4HPKB 4EV0A 4HT1T 2LTNA 2JEMA 4OHVA 2YROA 4AI8A 1VR3A 4Y1UA 2Q5TA 5BV6A 4I30A 1FOD2 4AEKA 3LSDA 1B35B 3M3EA 4RHV3 1DGRA 3BIWE 4QHBA 1LHWA 3WP6A 5FPXA 4K9SA 4M0HA 4XF3A 3VV1A 5KWRA 1UU4A 2C5DA 3ILFA 2XJVA 4YG0A 4HETA 3X29B 4YG6A 4LBMA 4DFSA 4GALA 1PVXA 3RJ2X 2ZMLA 1N3OA 1UPSA 3PVBB 5ACA2 3ZYGA 4CDXC 4LE3A 4IEUA 3H0OA 1RUH1 4LA2A 4HL0A 4GH4A 1BJQA 3MIDA 1XNCA 4MXWB 5F6KA 5FO9B 3SCGA 1VBB1 4IEVA 1CGPA 1AJOA 1YIFA 5E88A 5BY5A 2R6QA 3HAGA 1C5IA 2RS31 4Q29A 4X8NA 2BWAA 4OFGA 3URFA 1V6OA 1YJLA 4KWJA 4NN0A 5F5QA 3B00A 4W65A 3RRDA 5EV7A 1G9AA 4GKYA 5C9AB 4ES9A 1J3RA 2PHLA 5GALA 5JSRA 4WM7B 2YPJA 3VBFB 5LEJA 3JD71 3TAYA 3CO2A 2CNAA 4FAGA 3ZO0B 1NG0A 2R49A 4XFGA 3I8TA 2RHPA 5CFCC 4AF9A 1AR91 4QQHA 3H7YA 4ZU4A 1HLCA 3H1WA 4Y1YA 3RDIA 3ZMOA 2NLRA 5DUUA 2EAKA 1AL0G 1MQTB 4CP0A 2XJTA 5H9RA 5J36A 2B8MA 2GDFA 1X8MA 4RHV1 1MZ6A 1RUG3 1BEV2 2Z2SB 1UIKA 4CDUC 1V6IA 1IS3A 4H7MA 3WCSA 4I0AA 3SMHA 1UZYA 1AXKA 3SITA 2VNGA 4RR3B 2N7GA 1YIPA 1CN1A 4A7KA 4Q0VA 1GQHA 1ZZCA 3GZTB 4IETA 4E2GA 1WCSA 2XG3A 4AGRA 3OY8B 3IM0A 4L2NA 4XFHA 2FZ1A 3LWCA 5IK7A 5LK5A 2WC2A 2JE9A 1NZCA 4XFCA 5D1IA 4DOUA 4PJYA 4LEJA 1W6NB 4XF0A 1SEFA 3VZOA 3KZ4C 4CDWA 3ALQA 3SCFA 2JG9A 2JG8B 3OGGA 3D82A 3ILNA 1NY71 3GYDA 4XQ4A 1AYN3 3AKPA 5LEKA 4GB33 3LKJA 1RHI3 2GNBA 3P3NA 1W0PA 1FPN3 4HFSA 4WVMA 4M3CE 4NO4A 1APNA 5AC93 1ZBA2 3AKQA 4JDNA 3O7OA 5GJ6A 5DXDA 5JPMB 2YYOA 5J98B 4KBBA 1BKZA 2P3JA 3J8F3 3AKTA 3WY6A 1UKRA 1ZYBA 3VZKA 1J1TA 2LALA 3FBYA 3ZSJA 3CEWA 4AHYA 1S1AA 4SLIA 5FMOL 4I0WB 5FREA 2VUJA 1DQ1A 2WZR2 4I02A 1I1EA 2KA3A 1PO13 1O5UA 4COZA 4FO9A 3WUCA 1HRV2 5I91A 3I7DA 3JBG3 1K5MC 2VH9A 4XZPA 1LEMA 4AVAA 4YRDA 4B29A 1EV13 1ND2C 3NV4A 1VBB2 3VKLA 4E9KA 3CJIC 3H50A 1HW5A 3J26N 1RUG1 2A73B 2GMPA 3KD4A 1DFQA 4LULA 2BBVA 1DYPA 2DCKA 1MS8A 5LRRA 1CJPA 1IZ3A 1Q5OA 4FXKB 4CDWB 2QE3A 2QZ2A 4RSUA 2IXHA 2BQPA 2JG9B 2VOKA 1S2KA 3VBOA 3JD72 1D4VB 1RUNA 1Q3EA 1C1FA 2ZCWA 1EPZA 1XE7A 4FOWA 3B5LB 4N9IA 1DU3D 1PGL2 1YI7A 4WVMB 1ZZ7A 3C2UA 3VBHA 2A6WA 3WG2A 2VXRA 1FI2A 4LBQD 1AR92 3ZFFB 2VQ0A 3OD4A 3NW4A 1IPJA 2D97A 1ND3B 4B4RA 1CESA 1V9U2 3IBMA 4V1PA 1WD3A 1V6MA 1AYN1 2XUMA 1AR82 4GB31 1RHI1 4RHV2 4Q4V3 2EVXA 1FPN1 1JBCA 3V0BB 4Z07A 1Z7S2 2WWSA 5AC91 4Y1XA 3VBUA 2G9FA 4H14A 4YVWB 1G7YA 3KCYA 5JIUA 5D8AA 1O7FA 5J37A 3VZLA 4GKXA 4LO7A 4Q4X2 3J8F1 4XJWA 2I74A 2VW2A 1YCIA 4DMIA 4BIFA 3BU7A 4XFBA 2XPJA 2CL2A 2ARBA 5BXXA 1WCDJ 3MIGA 4I3PA 3U11A 3KGZA 2ZS6B 2VNRA 4MXVA 4CEWC 3N4MA 3NAPB 2PLV2 3TYJA 3JCIA 1C3HA 1PO11 4LHKA 5IUQA 1FATA 4NOTA 3I4IA 4G9SB 1CPNA 4XPVA 3JBG1 4PLOA 3OJBA 1EV11 4BHPA 1GSLA 3MEPA 1KRIA 3VKOA 3VBOB 3EXUA 3FX3A 2A6VA 4PLNA 1VBE3 5HCAA 1QJY2 2XVLA 1G9FA 5JZGC 4IESA 1WMDA 1H4HA 3FUOA 1MS1A 4XBNA 2FHRA 2PAMA 4DXZA 1TMF2 2YC0A 4E2SA 3JU9A 3V65A 1QXJA 2PYTA 3H8UA 1YLLA 1HX6A 2WLPA 2WT2A 4LBNA 2I07B 1LR5A 4IEOA 4BYYA 3VBUB 1OPMA 3SLIA 1UCXA 2AREA 2YGMA 2O0OA 2DYCA 2PHWA 1W2UA 4ES8A 4YVSC 3QLQA 2JE7A 3JQXA 2GC0A 4XIOA 2DU0A 3NV3A 4Q4V1 3N3HA 5I0TA 4B7EA 3AKSA 1JN2P 1X8EA 3FWEA 5L36A 4BPZA 4DQAA 1X7NA 3MW3A 5BNPB 4PDWA 1LOEA 4E4SA 2FMDA 4LHLA 3ZXFA 1XU2A 3ZXKA 2EF6A 4XJ8A 2VECA 1H1MA 3LGRA 1LHUA 1S0GA 2XJQA 1POV3 2DFBA 3VZJA 4FPLA 1ZZ9A 2DUQA 2X5IA 4UW4A 5E1RA 3S7IA 5JI7A 3ZYIB 4KWKA 4B7KA 3B94A 4LBKA 5GKAC 1VBA2 3ZSMA 4MLOA 5CADA 3E6CC 2FMYA 4XF4A 4FPHA 4AWDA 3GHNA 1SCSA 5L7OA 4P9XA 2Y0OA 1QH6A 4DY5A 5CB7A 3VDDC 1KQRA 3IKWA 1VBE1 2JICA 1GICA 2NMNA 5I8TA 4WVVA 2VU9A 1C8M2 2AZ5A 3N35A 3TN93 4KG8A 4Z8BA 5KBFA 4LUKA 4HKWA 2XJSA 5CBLA 1JXNA 5GLVA 1FXZA 1ULEA 1DZRA 3AMPA 1X50A 2TNFA 1N3PA 2B45X 3AZWA 1DYKA 5GM0A 4X8PA 2XJRA 1LESA 5T5OA 4Q1PA 4AGVA 4C1XA 1PO12 4COVA 5DZEA 3THTA 1OOPC 2A75A 2WJSA 1FOD3 3SCHA 2MHFA 2Q0AA 3IDEA 4Q8LA 1QDOA 3GZUC 2E63A 1RUE2 2WT0A 1H30A 4AYUA 1QMJA 2H0VA 2WFF3 4H55A 4AEDB 4PDWB 4COUA 1NOVA 3KSCA 2ILMA 3AB0A 1NA1A 4IQPA 4N7UA 3L2YA 1WA4A 1C28A 3PVEA 4QD2A 5JOYA 1D4M3 1XE8A 2X5IB 3BALA 1M06G 2TUNA 2E6VA 4GQ7A 5ACA3 2JD4A 1VBD2 4NVPA 2A5ZA 1NCQA 2AH2A 3VHRA 4Q26A 4HMZA 1YO8A 4AVCA 4AFDA 3KQRA 5KC6A 2ZGNA 2QDRA 4XF1A 2NP0A 4F83A 3SH3A 2WNVC 2WNUC 1POV1 5FOJB 2BNMA 2B42B 1VB2A 4N43A 4Q4Y2 2E51A 2JG8C 4AI0A 1MVQA 4XEZA 1XRUA 4YZ1A 1RJ7A 2JKBA 3MPPG 1UZZA 2NM1A 3RPQA 3FHIB 3AZZA 1IGOA 3LOBA 3BCWA 3H3UA 5JAXA 1GFF2 5CG8A 3ZFEB 5K0UC 5I8SA 1NCRA 3IIAA 1U5ZA 3LA3A 2ZMKA 2AGSA 2ZJCA 4RD7A 3ZMNA 1JUHA 3TN91 4YM3A 3MGUA 2ZHLA 3T1LA 3WHTA 1WW6A 3VL9A 2VMHA 1JYCA 2AENA 4UW3A 3VBRC 2QNKA 2ZHMA 4JGZC 5CFDB 3O14A 1NA1B 1X82A 4QGLA 1TE1B 2BUKA 3QOPA 5EFUA 1FOD1 2D3RA 5IK5A 5GLWA 1IS6A 1F5JA 4ATEA 3VKFC 4Y22B 3ZFGB 5BNNC 1U5XA 1Z78A 2WFF1 4R9AA 1NCQB 1PZ7A 1FV3A 4IV3A 1RC6A 4HLTA 1JOJA 1LRHA 3RYPA 4HSJA 2WA4A 2GZWA 1XU1A 3WOGA 1ULFA 3W9AA 1FNZA 4GWMA 1D4M1 3MF6A 1VP6A 1S0JA 2ET1A 5ACA1 3GBFA 4LBJA 2OPKA 2DTWA 1KJRA 4XHXA 4XJ9A 4F7ZA 1LOCA 2YDEA 1H1IA 1KS5A 4L92A 4NHMA 2VMIA 4XYXA 2ZX4A 4E27A 1NQJA 1PK6A 2ZGPA 4QMAA 2WSUA 1NCRB 5JIAA 3WDWA 2F6BA 4XQWA 2VVEA 4QXKA 5EZWA 4XTMA 3AZXA 1ZBA3 1OLQA 3JB4C 2VOVA 3PTYA 3MLKA 2OVUA 3E6DA 5JZGA 1OQ1A 4LT5A 4EWAA 1ULGA 3D6EA 3WNXA 3KM5A 4X6QB 4FTBA 1TME2 2HWC2 4XETA 3POSA 5EYXA 4OI4A 2YUEA 4ITCA 1YFYA 4L99A 2WZR3 5AFBA 4YGBA 3RWNA 3WG4A 1BVVA 4LO6B 1MS4A 3IN9A 4XFFA 3BB6A 1HRV3 4HK9A 3TBDA 3TWIA 1JUIA 4FTSA 1DZTA 2MEV3 3DGTA 4IEPA 4IV1C 2XB6C 2D6LX 4IV3B 2CYFA 3RYRA 2DVGA 3H3ZA 4K20A 1PGSA 1T6GC 4NHKA 3Q9OA 4YVSA 4EWDA 2WS92 2Z5WA 2D6PA 2WZPP 2WT1A 3VHOA 3M3OA 1ZBE2 4OHXA 1GZWA 4QPIC 4RS5C 1RUC2 3AP4A 2IFWA 2B9UA 3FLPA 4YZ3A 5FQ0A 4B8EA 3H1YA 4QGNA 2Q1MA 3ST7A 2W68A 5ABJC 3LA7A 3MLLA 3WR0A 3OF1A 3FLTA 2E53A 3UJOA 1CAVA 5JOWA 3TN92 1SLBA 4XBQA 1PHMA 3UL2A 1UU6A 1O4ZA 1GZ9A 1LB2A 4N53C 1SLLA 3DPRC 2ZGSA 4E4ZA 4U36A 3I54A 5JSPA 5FAXA 1V00A 1LOFC 1V9U3 3PVNA 4CZSA 5BNOC 5KC5A 1UX6A 1RUF2 1PIV2 1AR83 1KDMA 2BTVC 2E7AA 3WX5A 2WFF2 4Q27A 2KM2A 1Z7S3 3ZIXA 1ZBA1 2FQPA 2VY0A 4LLFA 1AVBA 3KCCA 5A32B 1DF0A 2CGPA 5FDBA 2DCTA 3KS7A 2ETEA 3ZN4A 1QQP2 4Q4X3 1MS0A 4FP3A 2LM3A 1D4M2 5JVVA 2JDZA 1SLAA 4Z1VA 1SQ4A 1OKQA 2ZBJA 5LK7B 4AGGA 2WZR1 2PLV3 1GZWB 2RE9A 1OOPA 2DVFA 4QX5A 1PGW2 1HRV1 2PA7A 4MX3A