3AJYA

Crystal structure of ancestral congerin con-anc
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
GGLEVKNFDFKVGKFLTVGGVINNYAKRFSINVGESTNSLSLHLDHRFNYGADQNTIVLNSMVNSGWETEQRSKNFPFSAGEYFEITITFDTNKFYIELLDGHKLEFPNRYKKEALNFLSLAGDARLTFVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Ancestral congerin Con-anc
publication title Tracing protein evolution through ancestral structures of fish galectin
pubmed doi rcsb
total genus 30
structure length 133
sequence length 133
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ajyA00
2W52A 4DPNA 4XHBA 3VKFC 4YG6A 3SH4A 1W6MA 2ZGKA 1MS4A 2FHRA 4FQ4A 4MYEA 4PBOA 3JU9A 1ULDA 1WW6A 1LULA 1SLAA 1Q8PA 4FP3A 1V00A 2VUAA 4LBLA 2CYFA 2DVGA 2A75A 5DZFA 3AZYA 1G9DA 3AZWA 4YGDA 2PHUA 1S0GA 1DFQA 2GNMA 2ZHNA 3UL2A 5BYNA 3MW2A 2E6VA 1SACA 3POWA 4XBNA 4K20A 4LBJA 3UK9A 3V0AB 3D5OA 1HLCA 2JECA 2P2KA 3A0NA 1S0BA 4FPKA 3ZPYA 4PQ9A 2A5ZA 2DV9A 4AGRA 3VUOA 2EALA 1F5FA 5E8AA 4K21A 3WVJA 3BTAA 2DU1A 3FBYA 4BPZA 1ULCA 5CNAA 2NMOA 2ZGMA 4LBOA 4WV8A 1CR7A 2R0FA 1LHNA 4M00A 1ENSA 2JE7A 1MS5A 4TYSA 2P3IA 1O4ZA 5DUVA 2PHWA 3ZXFA 1JXNA 2WT0A 4Q26A 2RHPA 5DG1A 5FRAA 3WDXA 2A70A 5GLZA 1TEIA 3N7LA 1KJRA 3OJBA 1MZ5A 2P34A 1ONAA 1WBFA 2UWBA 1CN1A 1WW4A 2D44A 1N1YA 1JBCA 1JN2P 4Y22A 3IPVB 3WG3A 5T54A 1AX2A 4D69A 2A6VA 2YMZA 5GZGA 1F31A 2C9AA 2G4IA 5LK5A 5T5JA 1WUVA 1RITA 1S0CA 1RINA 3M3OA 1AX0A 2E7TA 2XB6C 1Q8SA 1MS8A 2YROA 3POYA 1JHNA 2VU9A 5GM0A 3V65A 4BMBA 1DGLA 4FOWA 2DTWA 1UN1A 1V6MA 3I4IA 5T50A 2V5YA 2A6YA 4UW4A 3WV6A 1G86A 5CB7A 2ES3A 3V64A 3TAYA 1AXYA 4HANA 4YZ4A 1GNZA 4NO4A 3OY8A 4M3CF 4YGCA 1GKBA 2E53A 2ZACA 2ERFA 3VKNA 5F9TA 1VAVA 1WD4A 4XJ8A 1A8DA 1JW6A 3QLQA 1LOAA 2ZGUA 3M3QA 1C4RA 1WW5A 4XZPA 2R1DA 2ARBA 1GZWB 1GZCA 1UMZA 1UZYA 3PMEA 4FOVA 1G8WA 4FPFA 4Y1YA 5FREA 3RG0A 2LTNA 3BIWE 1SLLA 1YIFA 2OW4A 1G9AA 1LENA 5GZDA 4K1YA 4XIOA 1MR5A 2D43A 4YZ2A 3V0AA 4AVVA 2W39A 1UKGA 2WQZC 3LSDA 2E51A 3ILNA 2JDZA 2A6XA 4R9AA 1CESA 1MS0A 2AENA 2ZGLA 3IM0A 4JC1A 2LALA 1S0JA 3A4UA 3RQ0A 3VKOA 5T5OA 1QNYA 3BODA 4LBMA 4CTEA 2EAKA 2JJ6A 4AGVA 2VW2A 1VLNA 3SITA 1VIWB 2WSUA 3W58A 1Q56A 3WCSA 1BXHA 4Y1UA 4RL7A 1JYIA 3OBTA 4BQ1A 4YFWA 3CNAA 4YG3A 3FLPA 5KXDA 3ZYPA 1UAIA 3FFZA 1UX6A 4P9XA 5GLUA 3HN1A 3M2MA 1FAYA 1HQWA 1LU2A 2D6MA 3B00A 1CPMA 1IKPA 3PVOA 2GN7A 3MPPG 1U0AA 3IPVA 4Q1RA 1SLIA 4AGGA 2Q5TA 2W68A 1WW7A 1H30A 3B69A 4YW5A 2EXJA 4YFZA 4XJUA 5JOZA 1NLSA 1LOBA 5DZEA 4Y1ZA 3AZVA 1APNA 3AFKA 3N7MA 4GKXA 4R9BA 1JYCA 1PZ8A 1QDOA 1FYUA 4WZFA 4FPEA 1S1AA 4FPHA 2CWSA 1GNHA 4FPJA 1V6KA 2EXKA 3ATGA 3GALA 4I30A 4P9YA 1S0DA 4Q8LA 4GWNA 4ZXKA 3WG1A 3M3CA 3AP6A 1BZWA 2GMEA 1FX5A 2NMNA 1LTEA 1W6QB 1GV9A 4ZKTB 1S0EA 1KQRA 1LECA 1GLHA 4M3CA 3WDYA 5JDBA 5JMCA 1QU0A 1DZQA 3H0OA 2KM2A 2YV8A 1BYHA 2ZGTA 3IN9A 3SLIA 3NV2A 1CPNA 2DTYA 1NXD1 1CJPA 2A3XA 4LBKA 4W65A 2CY6A 3RSJA 5JOXA 4PF5A 5IK5A 1Q8OA 2GDFA 2ZA9A 1SBDA 1AXKA 1V6IA 3B9CA 1H9WA 4XJAA 1SLBA 4BOWA 3FLRA 1KITA 1MS1A 2CTVA 3HMYA 1SLCA 5EWSA 3AXDA 3OGGA 1VALA 2D3PA 2JE9A 3ILFA 4P9WA 4Q27A 5H9QA 3ZSLA 4XOGA 2HYKA 5H9SA 3NWKA 3BOPA 3WOGA 4GKYA 1N3PA 2A6ZA 4LBQA 1AJOA 3AP7A 1UL9A 1D0HA 4Y1VA 5IK4A 1QNWA 3PJQA 5T55A 1LGBA 3RS6A 2WT1A 2P3JA 4C1XA 2GMPA 1W0PA 1DQ0A 2ZHMA 1O4YA 4XBLA 4XE9A 1QOSA 2UU8A 3OBRA 4YGBA 1ULEA 5CAZA 1LODA 4ASMB 1Y7BA 1CVNA 4BLJA 1RIRA 3INAA 3L2YA 1N47A 1V6JA 4UW6A 5DG2A 3USUB 1N1TA 1SCSA 1FNYA 2DVBA 2EIGA 2DVAA 4XJZA 3ZSMA 1MS3A 4F83A 2JD4A 2A3YA 3B3QE 1DQ4A 1W6OB 3SISA 1C57A 4LBQD 1QMJA 5DUWA 1Q8QA 1LHVA 4PCRA 2WJSA 2NM1A 1Z78A 2ZABA 1LGNA 3T1LA 1AZDA 1FV2A 1S0FA 2ZGRA 1IS4A 1LOGA 3R05A 3UJOA 1DYKA 1JOJA 1QKQA 1W6QA 2TEPA 4RA0A 3N7JA 4YZ1A 1URXA 1GBGA 2OUHA 3C2UA 5GLWA 5T5LA 1LOCA 4YZ5A 1MVEA 1WLWA 4XHXA 2D6OX 2YY1A 3KM5A 4DRVA 4SLIA 3I8TA 2VW0A 1AX1A 1A78A 4XMAA 1N1SA 3VKMA 3QCWA 2VY0A 3JUUA 3V0BB 2SLIA 2PHTA 1MACA 4FPCA 5GJ6A 1IS6A 2D7FA 5EYXA 1KJLA 4Z8BA 1J1TA 1IS5A 4LBNA 3TB0A 5CA6A 2ZAAA 3AK0A 5CBLA 1W0OA 1Q8VA 1IKQA 2DWRA 1N3QA 3PVEA 4GA9A 3WDVA 2GMMA 2CL2A 2ZMNA 4XXAA 1CQ9A 1CONA 1OQ1A 1DQ2A 4ATFA 2E7QA 1OKQA 4XILA 4P14A 3AXEA 2ENRA 1GSLA 4GALA 4ITCA 2ZGOA 4YW1A 1MVQA 1AVBA 4Y24A 4YW2A 1ULFA 1VAMA 3DUIA 2P3KA 4CZSA 4XMIA 2AUYA 5T52A 1DIWA 3NV4A 1IOAA 3A0KA 3SH3A 2EXHA 3AYDA 4H55A 4XXPA 2ZZJA 3VV1A 5L73A 1ULGA 3RMXA 1W6NB 3LSEA 2NN8A 1DQ6A 2ZBJA 4FP2A 4ISQA 3NV1A 3USUA 2V73A 4ISRA 1ZA4A 2ZGPA 4DFSA 1HQLA 2AH2A 4WVVA 4FQZA 2R0HA 3O0WA 4FVVA 1DLLA 2R1BA 1W6OA 2DUOA 3VKLA 2C5DA 4ATEA 3MW3A 2AR6A 4PBPA 4NOTA 4L8QA 2DVFA 4Q1PA 3NV3A 1JUIA 4YM0A 5JOWA 5IK7A 3FUQA 3OPZA 3FUOA 4XTPA 3AYAA 1DYPA 2NZ9A 3OYWB 5GZCA 4JRAA 4BLIA 1LHOA 2DYCA 4XJ9A 4CRQA 1H9PA 3WHTA 2ZHLA 4Y20B 3AZZA 3O0VA 1QOTA 4GXLA 2DUPA 1XQNA 1S0IA 1LHWA 3N36A 3R4SA 1GZWA 4XIKA 1YYNA 3OY8B 1D2SA 3ZXKA 1F9KA 3O0XA 5JOYA 4M01A 2EF6A 3ENRA 2AGSA 2ZGQA 3SH5A 3ZXLA 1LOEA 4YG0A 1GYKA 2OUJA 2WKKA 2P37A 2B7YA 1KRIA 3AJZA 2YZ4A 1N3OA 2ZGNA 2GN3A 2SBAA 4DQAA 3V0BA 3N3HA 3ZYRA 2PHFA 4U36A 4AWDA 5IK8A 3D6EA 3MW4A 1A3KA 1IS3A 2EXIA 5GLVA 4U2AA 1YRZA 5KXEA 2I2SA 2BQPA 3WG2A 2OVUA 4YM3A 2WLQA 1WCSA 1YO8A 2FMDA 5IUQA 1LJ7A 2WSVA 3T2TA 4Y26A 2A7AA 3Q9OA 1WLCA 4KBBA 3O12A 1HDKA 3ASIA 3ZSJA 1MS9A 5DXDA 4FOYA 2AYHA 1YXWA 3B01A 3IMNA 3R4UA 1QDCA 2PHRA 1SLTA 4GWMA 5HCAA 2UWAA 1R1ZA 5H9PA 1V6LA 1WLDA 1LEDA 1LGCA 3IKWA 2D6NA 1GICA 4JCKA 5DZGA 3RMYA 1W6NA 4DS0A 3AP5A 3LCPA 2H0BA 3UJQA 3W59A 4AVTA 1QOOA 3HR9A 2A71A 4FPGA 1LU1A 3APBA 1AXZA 3N7KA 3WDUA 3N35A 3ZSKA 3AP9A 2ZKNA 2UURA 2DVDA 4YZ3A 1DQ1A 5SV8A 1BJQA 1G7YA 3RRDA 1B09A 3WUDA 2GALA 4M3CE 1V6OA 1I1EA 1PZ9A 1FNZA 4YM1A 1ENQA 4HL0A 2XG3A 1OFSA 2PHXA 2YXSA 4YGEA 1W6PB 2JKBA 3KQRA 1LOFA 1SBFA 3OYWA 5DUXA 2DURA 3POSA 4BMEA 2D6LX 1LEMA 4UW5A 3WDTA 2ZHKA 2WT2A 2VW1A 3WCRA 1AF9A 4Y20A 4IQPA 1WD3A 5HCBA 1W6MB 3M1HA 1UPSA 3WZ1A 1BQPA 5GZEA 4Q2FA 1GANA 1C1FA 4M3CB 1I3HA 2D6PA 1KDMA 1KDKA 2ZMKA 4XJWA 2A6WA 5EYYA 2AREA 4R9CA 3PVNA 5E88A 5E89A 2D6KA 4AYUA 3WUCA 5KXBA 4XBQA 3SNMA 2VH9A 5F5QA 4Q8KA 1LCLA 3AZXA 1EPWA 3U4XA 3ILRA 2CNAA 2D3SA 4OZXA 4YW3A 4YLZA 1BKZA 1DHKB 3O5SA 3WNXA 3GNEA 3ZXEA 3AJYA 1QF3A 2R16A 2WNEA 4TZDA 1ENRA 4UW3A 5AVAA 3WDWA 5H9RA 1MZ6A 3ZVXA 3DGTA 1QGLA 4XTMA 1ZM1A 1G9FA 4LBQB 3WHUA 2PELA 3MEPA 4BM8A 3D4KA 2NYYA 4R9DA 2ZGSA 4XDQA 2R49A 1LHUA 1DQ5A 4FPOB 1FATA 4K1ZA 4C1WA 1V6NA 2GNDA 4Y22B 4YW4A 1G9BA 1UZZA 4FPYA 1SCRA 4Y1XA 1FV3A 5T5PA 1N1VA 2ZMLA 2ARXA 1DBNA 4DRRA 5DUUA 1GZ9A 1HKDA 4FPLA 1AJKA 2A3WA 1SBEA 1Z0HA 3AP4A 4WVWA 4YM2A 1LESA 1SFYA 1PZ7A 4XYXA 2DU0A 1X50A 2GNTA 3WLUA 2NP0A 5GLTA 3WG4A 5GALA 1LOFC 5KXCA 3AX4A 3FLTA 4FOQA 2Z42A 5JLVA 2D3RA 1C1LA 1WBLA 2CWMA 2DUQA 3AYEA 5JVVA 5HCFA 2W08A 1CIWA 1W6PA 3T1MA 2UWCA 1G9CA 5EXOA 1YI7A 3M3EA 5IT6A 2GNBA 3AYCA 3ZXJA 4AVSA 5GZFA 2VXRA
chains in the Genus database with same CATH superfamily
4RHV2 3T4HB 4QPWA 1W6MA 2BU9A 4AZZA 4AFBA 2FHRA 3CBNA 2JIJA 1NCQC 3JU9A 1ULDA 1LULA 3JBG3 1Q8PA 3N9PA 2VUAA 2W1WA 2ZEWA 1VJ2A 2WQ8A 3SCGA 3BB6A 3CMGA 4KQ7A 5DZFA 4B29A 4GIQA 4GZ9A 1WLTA 4H7LA 4GB33 3WD5A 5BYNA 5JAXA 5ACA2 2RMU2 1WA6X 1BCXA 4OHYA 3H3LA 4FPKA 1S0BA 2Y26A 3ACLA 5CKQA 2YPJA 3ZPYA 2K9ZA 3BALA 5FY8A 3VZLA 4P9IA 1TMF3 2A5ZA 3VBHC 2EALA 1F5FA 2QQVA 2VNOA 3OOXA 4K21A 4N7UA 5E8AA 2RVAA 3MYXA 5J7MA 2VTFA 3F95A 4BPZA 1ULCA 2WS93 2QTWB 2ZOEB 1Z7S3 2NMOA 5CNAA 1PMIA 1EP0A 2BNOA 1LHNA 4Y3OA 2JE7A 2XBO3 2XH6A 4FCAA 1MS5A 2P3IA 4DUWA 5C33A 5ABJB 1UY3A 1W8OA 3ORJA 1F2NA 1FOD1 2A70A 1RUJ3 1AYN2 3K77A 4LO5B 5FMBA 1ZRIA 5FYZA 4AFAA 4AI9A 1ZRCA 4X8PA 2UWBA 4Y5SA 3M70A 1UXXX 2YBKA 1JBCA 5AVPA 2QZ3A 4NR1A 1XNBA 3DN7A 4AVAA 4NHXA 2A6VA 2VVFA 1QJY1 2BERA 3RZKA 1CZVA 5GZGA 1F31A 5J1XA 4EE2A 5FYIA 5FY4A 3K51A 3EJKA 3BTXA 2IFWA 2XB6C 3AKRA 4O7XA 4CEWC 3O1TA 5F8PA 5GM0A 2RJLA 2QQIA 4UFHA 1U5XA 1AYM3 1F8VA 4BQ3A 4W4ZA 1G86A 5DAPA 1O3RA 3LEMA 1CAXB 3ZFEA 4XCAA 4HANA 2RS33 1XOYA 3I49A 1GNZA 2ZEXA 2VCAA 3RYKA 1R1A1 2E53A 3U10A 1KEXA 3VKNA 2Y6LA 4YW6A 5F9TA 4XJ8A 3ROUA 2VD7A 4LHNA 1ZBA3 2BYVE 1A8DA 3C7OA 3QLQA 4AFCA 2ZGUA 3M3QA 3U14A 4I02A 1JYNA 2FDHA 4BA6A 2JDPA 2X5IA 3A23A 1I9RA 1UZYA 1RUC2 3PMEA 1G8WA 4Y1YA 5FREA 1SDDB 2QQMA 1QJX1 2YFUA 3CO2A 3A22A 5GZDA 1R082 2D43A 2WAAA 5K0UB 5JR2A 2JWPA 3LSDA 4TLFA 2FDGA 2RJKA 2RMU3 3ILNA 3KB5A 2BJSA 3ZN4A 1K5MC 1PM4A 4R9AA 4JC1A 3LAGA 3RZZA 5K8SA 5CEHA 1S0JA 3CEWA 3A4UA 5JXJA 1RJ7A 2HBUA 4PDWC 4D0QA 3VDDB 1BBT2 1B35B 4EN6B 2XLAA 4OI1A 1UYPA 4LKEA 3VHOA 3NW4A 4ZZ8A 2JJ6A 2IXIA 5A3MA 1VLNA 3O1OA 4OYUA 2WSUA 2GC1A 3GZUC 4URTA 4BQ2A 5JXHA 2VTXJ 4QQLA 1O3QA 4GULA 4BQ1A 4YG3A 3FLPA 5ABJA 2D97A 1YEWA 5J96B 4LO7A 2O14A 3M2MA 1JI6A 1HQWA 1JYXA 2GN7A 1BVP1 3MPPG 1ZBE1 1OA2A 4UOJA 1DGWA 5C7GA 4UXAA 4XC9A 3H8XA 1XYOA 4XJUA 2QZ2A 1NLSA 4RYDA 3I97A 5K7PA 2YU2A 1APNA 3AZVA 1W05A 3N7MA 5FZ8A 3TOJA 2CWSA 1NCRB 5K9YA 2D40A 4LO4B 4QQOA 3GALA 1FI2A 2WWSA 1S0DA 3NNFA 3WG1A 1TME2 2QKDA 4ZXKA 3S30A 1UXZA 1J1LA 1JU4A 1FX5A 2R062 3CJIB 3N9OA 4LITA 1IPSA 2BFUL 3CZJA 5FZIA 3P5BA 1PO11 1VRH1 1LECA 1CAXA 2VPVA 4NIIA 4JKMA 4OZXA 1QU0A 3MICA 4DOUA 1BYHA 5FY9A 3SLIA 2JX9A 2PHDA 2XWBB 1CPNA 2YYOA 1ZREA 4E2SA 2A3XA 5J36A 4ES9A 1Q3EA 4YARA 3KT7A 3HNMA 4OQ8A 1I6XA 5FPUA 1SBDA 5FZMA 4QAWA 4RQPC 1RUC3 1RUF1 3K46A 2XWJB 4FFIA 5FK8A 3ZM8A 1VPHA 4QQPA 2HEVF 3FLRA 4FFHA 1KITA 1MS1A 4CEYC 5K0UA 5BNQA 1UD1A 1OVPA 3OGGA 4HZFA 1O5LA 4P9WA 1GQPA 4N9IA 3IT8A 1VMHA 4QXKA 3NWKA 4MO3M 3BOPA 4Z2WA 3O1PA 3IB3A 1N3PA 5EJZB 3J7NA 1B35A 3VDDA 3HIFA 1AJOA 4ES8A 1D0HA 4COZA 1BBT3 1W99A 2HWF3 3GCWA 4L2NA 1DF0A 4Y1VA 2VQTA 5T55A 1LGBA 3VBHB 4CP0A 3PUHA 4JV4A 3KV6A 5HXVA 1YCIA 3RNSA 4MLOA 5SV5A 2ZHMA 2WNVC 4YVWC 4HKLA 4OUSA 4MVTA 1FPN1 5FYUA 3CQOA 1YIPA 2Y33A 1NX9A 3VL9A 4E4DX 5CAZA 2RE9A 3K4AA 3TYJA 1W8ZA 5I0SA 2C6SA 1JYIA 2YGLA 3BTYA 3DKWA 3FE5A 3USUB 1H1AA 1FXZA 5FQ0B 4CCJA 1O3TA 1JYTA 2DVAA 1NA1C 4HVOA 1JZ7A 2W2IA 2ATFA 2EICA 3I3EA 3POEA 4HETA 1W6OB 3ACHA 2GC3A 2MEV2 2IXHA 4AL9A 5IHRA 1LHVA 3ZIWA 2D98A 2NM1A 4AEDC 3PJYA 3ZXDA 1NCRA 1W8NA 2QFEA 1XYPA 4GJZA 5JCTA 5L7OC 5BNNC 2H0VA 3CJIA 4XF0A 3ZYIB 2F17A 3I2GA 1WMXA 2OIIA 1WLWA 4MOAA 4XHXA 3VD3A 4L92A 4MXWB 4R8HA 2E31A 4QDSA 3VZMA 4HSLA 2QE3A 4D7SA 2W5FA 2WUHA 4KWKA 3GHNA 2DBIA 4LA2A 2BTVC 3JUUA 3NNMA 4BK5A 1LB2A 1GQHA 1OLQA 2PHTA 2OKXA 3NNGA 4FPCA 4YSFA 1RUH3 1G6NA 1NE6A 5BPXA 4Z8BA 1BMV1 2JDYA 3NSTA 4LO8A 2TNFA 2Y0OA 2ZAAA 4DXRA 4IGQA 3HQUA 5ANQA 1W0OA 4JHZA 1N3QA 3PVEA 3AM2A 2RS11 4A3ZA 2ZMNA 1JOBA 1CQ9A 4D6RA 1OQ1A 4J1XA 4UFKA 5AFBA 5IVBA 4ATFA 2E7QA 2GH8A 4IE7A 1K5MB 4P14A 4CCMA 2ENRA 2PTMA 3I3QA 4ITCA 2HWC2 4QX8A 4PDWB 2DDUA 1C8M3 2WFF1 4GMP0 3HJRA 3BUCA 4A6SA 4CZSA 5IAVA 1HRI3 3BOWA 5T52A 3NV4A 1W8WA 5FWEA 2BFUS 5FZBA 5A6YA 5JIUA 4H55A 2Y8KA 2QQOA 3J8F1 3LSEA 2VUJA 1PNFA 1VBE1 5FO7B 4BZ4A 2NN8A 3O1RA 2QDNA 1SZBA 3FHQA 1DG6A 5F5AA 4CCNA 3USUA 5A33B 2V73A 1HQLA 1NQJA 2AH2A 4Q4Y1 3MLLA 4V1PA 1YFXA 3LIGA 2R0HA 2WA3A 3RZGA 1K3IA 1PO22 2XONA 5EHDA 1W6OA 4X8NA 1EPZA 4NWWA 5FY1A 3BU7A 3LGRA 1E5RA 3IDEA 2AR6A 3LEIA 4ATEA 4URAA 1HJFA 4A6OA 2QNKA 4EWAA 1PGW2 3QOPA 5EP9A 4XTPA 4A44A 3OBZA 3SC7X 3GBWA 3MUY1 4LIUA 5EZWA 2BWAA 5IWFA 3TN91 2ZX3A 5C71A 5ANNA 1OC1A 4BLIA 1H9PA 1DP0A 2W47A 1V0AA 2WLPA 1JYWA 2E63A 3AZZA 3ZYFA 2DUPA 3R4SA 3LEKA 1EUTA 1GZWA 3FX3A 3GZTB 3T0AA 5LEJA 1YYNA 3OY8B 3VZNA 1RXFA 4OHXA 3O0XA 4HN0A 1US2A 3ZN5A 4CPBD 4MXWA 3KQ4B 2EF6A 2VZVA 2ZGQA 2XQXA 3ZXLA 2OUJA 1H2KA 5FXWA 1UU4A 3OD0A 2P37A 2B7YA 3HPNA 4NIGA 4K3UA 1RVF2 2P6CA 1V9U3 1VB2A 2PFWA 4KWLA 3H9AA 2V09A 3OF1A 2PHFA 4N43B 1REDA 4AWDA 1UU5A 5IK8A 2FMYA 3D6EA 5JUVA 2IXCA 5GLVA 2QBXA 4CDUC 4GMP1 2Y0IA 4P00B 5KXEA 4RQPB 3LDBA 3O1SA 3PU8A 4IEPA 4RS5C 5I8SA 4YM3A 2VUDA 1WCSA 5I0TA 2FMDA 5LBBA 1PMJX 1A6CA 5IUQA 4BCUA 4Y26A 2WWJA 1ENXA 2HYXA 4KBBA 5C5UA 1TZOA 4C0HA 5BNOC 1YXWA 4ORFA 4IV3C 1AL0G 1W9WA 1SLTA 2HWC3 4GWMA 4AFMA 3ZSEA 3LOIA 2UWAA 1NY72 2C0ZA 5DMYA 5FYTA 3VD5A 1QXPA 1D4M3 1GICA 4LNVA 3W59A 4L97A 4JQTA 2RM22 1IHMA 4PLNA 1RUI2 5BUVA 2A71A 3N9QA 1O5UA 5A33A 3N7KA 5IVYA 4AI1A 2WZR2 3N35A 2W94A 3AP9A 5FPBA 5HPOA 2JDMA 5HBAA 3D82A 5JPMB 1NA1B 1PO23 2GALA 2K0GA 2VMCA 1PZ9A 3L2HA 4GQ7A 1LAJA 1ENQA 4WM8B 2YXSA 4YGEA 1W6PB 4ZU7A 1LOFA 1SBFA 1VBC1 4XUPA 3KT1A 4Q4V2 3ZYJB 2VW1A 1WD3A 4JGZC 5A6ZA 2VMEA 3M1HA 2B8MA 5FJKA 4IERA 5L7OB 5BNNB 3I3DA 5FZHA 2AREA 2R041 2BOJA 1AL22 2PYTA 3K2OA 5KXBA 1WZXA 4KNCA 4XBQA 4QM8A 1AUYA 2VZSA 5F32A 5F5QA 3URFA 4Q8KA 4OCTA 1RB8G 3LB9A 1ZZ8A 3U4XA 2PAMA 3JBG1 4YW3A 4YLZA 2G9GA 1BKZA 3WNXA 1RVF3 4HK8A 4DXSA 4N43A 1VBD1 4AQSA 4GB31 4BQWA 3WXPA 5IVJA 4COUA 1EYBA 3AJYA 4JHTA 3FMGA 5JSOA 2W95A 1ENRA 5AVAA 3WDWA 5H9RA 2JG8C 3SHRA 3ZMOA 5EJ3A 3MLKA 3KV9A 5A7PA 4CU6A 4XTMA 1ZM1A 1OXCA 4AR2A 3WSOA 1I5PA 4LBQB 3N9LA 5LBEA 1FT9A 3SCHA 4HSJA 3NRUA 2FBEA 4NN0A 1CZSA 3S6PA 4JAAA 4R9DA 3VBOC 2WS91 1LHUA 3H7JA 4FPOB 1Z7S1 5FZGA 1LRHA 2PHLA 1FATA 2XBO1 4C1WA 2GNDA 4FTSA 1VMJA 1GOGA 4KGQA 5LA0A 1UZZA 2ZCWA 1W9TA 5T5PA 1G9BA 2ZMLA 1ULOA 1DBNA 2ARXA 4FO9A 1GZ9A 1PM7A 1RUJ1 4F7ZA 5B4XA 4E4SA 3ELNA 5LA2A 5A70A 1D2QA 1LESA 5FBJA 3IBMA 1QJU2 1PHMA 2RM23 3NQHA 1RUI3 1VBB2 2DU0A 5FZ9A 1X50A 2GNTA 2JKXA 2XJPA 3NJXA 3WLUA 2VZ1A 3JCIA 2WA4A 3KZ4C 5I0UA 4BQYA 4K8RB 5F2SA 2XHNA 3R6SA 4QPGC 1QXRA 3WG4A 1TQ5A 1UIJA 3DCQA 1NA1A 3FLTA 1GP4A 2Z42A 4QX7A 2D3RA 5KXCA 2CWMA 2DUQA 2WINB 1COV2 4LULA 3AVSA 4WM8A 5FBZA 2UYBA 5HCFA 5JVVA 4QKFA 3VBRB 1XE8A 1L7QA 1OOPC 1QQP2 1W6PA 5EXOA 2LUWA 3AYCA 2DCTA 5GZFA 2VXRA 1PK6C 3AZWA 4DPNA 3B93A 4XHBA 3VKFC 3E5XA 1AYM1 3NJVA 1F5JA 1JMUB 3SH4A 1HB3A 3U11A 2ZGKA 1MS4A 2LRPA 5L7OA 2E7AA 4PBOA 4FQ4A 4UAPA 3VBFC 3V56A 5A1AA 2RS31 5BNNA 1SLAA 1JZ8A 4P5HA 1V00A 2BW8A 2CYFA 2DVGA 4LLOA 3VKLA 1G9DA 2XL7A 1ZBA1 1S0GA 4UBGA 4FXGB 2NQYA 3UL2A 1SACA 2BNMA 2YG0A 3NKGA 3POWA 4K20A 5LWBA 1W8UA 4WM7C 3V0AB 2JECA 2EVXA 2P2KA 5FR3A 2O1QA 4M4RA 1PGL2 4ONUA 3WF3A 2BVBA 2DV9A 1UWWA 2IXLA 3I2IA 4FBFA 2WC2A 1OLMA 2VZQA 4HFSA 1JYVA 3WVJA 2XDVA 4HBNA 2Z5WA 5BXXA 2DU1A 1K42A 1RTVA 2RMU1 2XR4A 1QY4A 4G4FA 1CR7A 2BWCA 2R0FA 2TUNA 2H6CA 4FXKB 3H1WA 3MIBA 5DUVA 2E9QA 2PAKA 4QD2A 1EAH2 2WT0A 5FJHA 3ZXFA 2RHPA 5FRAA 3FBMA 1TEIA 3N7LA 5DN2A 4Z07A 3PTRB 1RUE1 1NYWA 2HWE3 3H3ZA 3OBAA 4LEJA 1H8TC 1RHI2 3IPVB 3WG3A 1AX2A 4OHVA 4D69A 4IV3B 4O61A 1R092 2YMZA 2G4IA 5LK5A 1CJDA 3TRSB 1RINA 1ZRFA 5EIYB 4LUMA 3QACA 4QHBA 3WX5A 5FK7A 1Q8SA 2RS53 1MS8A 4LKFA 2VQ0A 1RXGA 4XDPA 1JHNA 1EV11 2O8QA 4LPLA 3OEBA 5FZ6A 2Y64A 1MPXA 1CGPA 1DGLA 1VBB3 2DTWA 5DPNA 3H50A 4ASLA 5AC92 2Q8EA 1HB1A 2A6YA 2Q8CA 2WIIB 3WV6A 5CB7A 2ES3A 3B94A 2WFPA 1XU1A 1V70A 3VBRA 4NO4A 3C3VA 1COV3 1GKBA 2FDFA 3I3BA 4X6QB 1E5IA 2EIDA 2Z69A 5M0TA 5FPXA 3W5MA 1C4RA 5FXZA 4AK3A 1WW5A 4BDVB 1BVVA 4GD4A 2ARBA 1UMZA 4JGZB 1ODNA 2DFCA 4C90A 2LTNA 5A3OA 3BIEA 1OURA 4QMAA 2OW4A 4PJYA 1LENA 4K1YA 1MR5A 3BI3A 3V0AA 4AVVA 4KG0A 3KCXA 5DDJ1 3THPA 2JDZA 4NE9A 1O59A 2VZRA 1MS0A 3TEZA 3GCXA 5KHGA 1RUC1 4BXFA 3VKOA 2QJVA 2VE1A 1ZX5A 1YJLA 2WAOA 5FYYA 3SKVA 3BODA 1ASJ3 3EO6A 4LBMA 4DO0A 3H1MA 4CTEA 2EAKA 1GR3A 4MHRA 2XJVA 1X82A 3UKVA 4XDOA 1VIWB 3BYWA 5A3WA 1BXHA 4YFWA 2YGMA 2BGCA 2JG8B 2OPWA 2R30A 5KXDA 1LNSA 1XU2A 2VQAA 3U07A 3ZYPA 3FFZA 4KU8A 4KGGA 1UX6A 4PIZA 4P9XA 2CGNA 5LBCA 1BBT1 1S2KA 2HWF1 5C3RA 3CIHA 2D6MA 3B00A 3M8LA 5LA9A 1BLZA 1CPMA 1Y9GA 4LHLA 4AQ6A 4L99A 1GFF2 2P1BA 1U0AA 3IPVA 1RHI3 4Q1RA 5FUIA 2IXKA 4AGGA 4IV3A 5BNPB 4XZUG 5CFDC 3MFAA 5HI0A 2W68A 1WW7A 3LDRA 4IEQA 4YFZA 5JOZA 1LOBA 4N8MA 4Y1ZA 5L19A 5LK7B 5CG8A 1RUG3 3AB0A 3THCA 1FYUA 5EJ1B 4DUXA 5KWRA 1HRV2 1AR72 1GNHA 4CCEA 4BIOA 3HT2A 2VO5A 1V6KA 4I30A 4YRDA 1D7PM 4Q8LA 3VHNA 3VD4A 1NZIA 2VJXA 4D7TA 2ZX2A 1CIYA 2RR12 3QH6A 4PQQA 4ZKTB 5AC93 3VBSC 1GLHA 1IZ3A 1O8PA 4M3CA 5JDBA 1X9PA 2J1AA 3IAQA 4QPGB 4XF3A 4YVSB 5JMCA 3H0OA 1O3SA 3G6JB 3CZUA 1UY2A 4MGYE 2PLV2 3GJBA 1OOPB 3FN9A 1PGSA 1CJPA 3D0JA 3Q8FA 4L11A 5FZFA 3BPSA 4BIFA 2VGDA 2RDRA 4PF5A 3RVHA 1Q8OA 1PVC3 2ZA9A 4JGZA 4QGNA 1C28A 3DF0A 3G7DA 3SMHA 2RDQA 1H9WA 1SHWB 3VBFB 4XJAA 1SLBA 4BOWA 4ZS3A 1BHGA 3LD8A 4BU2A 1RUD2 1W9FA 2CTVA 3HMYA 1SLCA 4LE4A 2IVJA 3AXDA 3UV9A 1S2BA 2J1VA 3I7DA 3KCYA 4IV1B 4EN0A 4Q27A 5H9QA 3KF3A 4XOGA 4PI0A 1RUH1 4CDXC 3VB9A 5FYBA 4WM7B 1AR83 4Z92B 3VGIA 1I5ZA 2VZ3A 4S2FA 2A6ZA 4J6GA 1XNTA 4KG8A 5LBFA 2YFZA 2ZKLA 3KMHA 1A8MA 3W20A 5IK4A 1QNWA 3T2OA 3HBKA 3MIEA 4ZONA 3T4VA 2VMDA 4C1XA 4LHKA 1J59A 4R4XA 1DQ0A 1OQDA 1QOSA 2UU8A 4OI2A 5FP9A 1LODA 2GAUA 2XLFA 4XAAA 4EQVA 1C8M1 3A21A 3HVDA 2VCMA 3NNJA 1N1TA 2EIGA 2V4VA 3BU0A 1HXS3 1HRI1 3S0MA 1MS3A 5FLIA 4D6QA 3UKNA 2JD4A 1C5HA 4BXSV 2BV4A 3B3QE 3WW3A 4F83A 1DQ4A 2E26A 1OLRA 3GGLA 4BB3A 1C57A 5G05L 2VNVA 4QQ2A 4O9EA 4QPIC 4AI8A 3JD72 1PNGA 2WJSA 1MEC2 3ZKUA 1WA4A 1Z78A 1IPKA 5ERLA 3WINE 2BEOA 3ZFFB 3KHCA 1HRV3 1AR73 1RJ8A 1S0FA 2ZGRA 1IS4A 3R05A 2YPDA 1QKQA 3J7HA 4RA0A 3LFIA 4QQHA 1H0BA 4YZ1A 4RHV3 4Q4W2 4HLTA 4YZ5A 1LOCA 4DXTA 3UKTA 3LA2A 4JGYC 4QPGA 4XETA 4YVSA 3KM5A 1ZZCA 3WNNA 5JZGA 3J26N 4DRVA 4XF1A 1A78A 3UT0A 4H7MA 1OOPA 5HCHA 1YFYA 2PLV3 1UOGA 1H2NA 1ZZ9A 1HB4A 1N1SA 1U12A 3NKTA 1YFWA 3C7EA 2VY0A 2VG9A 3HN3A 3QCWA 4J25A 4GH4C 5E16A 2SLIA 5ACA3 5C4WC 1PIV2 1OFNA 4NIDA 5EYXA 3VBFA 1KJLA 4PLOA 1VBA2 1IS5A 2W92A 4LBNA 3C7FA 3TB0A 4B4RA 3AK0A 4I0WB 3KCCA 1Q8VA 1XNKA 2I45A 4GA9A 2QQNA 1OQEA 1OMIA 3N9MA 4IV1A 4S2DA 2QQLA 5FFOC 1V9U1 3I54A 3B9IA 4CDWC 4CU8A 1CONA 2JB8A 1TNFA 4FAHA 3S7EA 1O7FA 3AMNA 3AXEA 4QDRA 1ALYA 1HW5A 1REEA 1GSLA 2HKXA 5FZDA 4JTNA 1HJGA 1AYN3 4P5YA 1VAMA 1MZEA 3DUIA 4QXCA 4WVMB 2B39A 2VMIA 3C8XA 4JKLA 1HN1A 3KLSA 1DIWA 4IXLA 3S57A 4CA9A 4OMCA 3A0KA 1H4HA 2EXHA 3SH3A 4AW7A 4IEZA 4XXPA 2XL9A 2ZZJA 5L73A 2ORZA 2VZUA 4QHOA 3THDA 3HBZA 4NJ4A 4NRQA 3JXSA 4FP2A 4ISQA 2HWC1 1YQCA 2K2SA 4ISRA 1NG0A 4IESA 4DFSA 4NAMA 2YHJA 5EQUA 1GP5A 4LK7A 2ZX4A 1IGOA 2R071 4UBHA 4P08A 3KSCA 3MIGA 4IEYA 2A73B 4ARYA 1ZRDA 1D4M1 5T5OA 5A1LA 4PBPA 4NOTA 5FPVA 5HV0A 5JOWA 1VP6A 1JUIA 1IG3A 1XE0A 3POBA 5CFDB 1L3JA 2QQKA 3FUQA 3MV01 4KU7A 3FUOA 3ZFFA 4XF9A 2OZ6A 3AYAA 3JD73 4B1LA 1QEXA 5GZCA 5JWPA 2P17A 4OVEA 5C9AB 2YBSA 1LHOA 4XJ9A 5F39A 5FV3A 4AXOA 3WHTA 1W3VA 2VUCA 1XJAA 2ZHLA 3DYOA 3PUIA 4W6YA 3K48A 1PO21 3O0VA 1QOTA 4GXLA 5FYSA 1XQNA 1LHWA 4K9SA 1ULPA 4Q4W3 3T3YA 1F9KA 4MGTA 3VBSB 4Q5OA 1NCQB 2AGSA 4K8FA 4YG0A 1DZTA 4Y4YA 3WQ1A 1Y4WA 4DXZA 4JDOA 4F3JA 5I0RA 2J22A 1DGRA 4MUVA 5APAA 1R083 4QU2A 3AC0A 3FWEA 1UW8A 2GN3A 3LDKA 3RYPA 3N3HA 3AL5A 4DQAA 4HOOA 3W5NA 2J42A 3MIFA 1PIV3 5D8AC 4HT1T 1QH6A 1A3KA 3N9NA 4O9GA 5FZ1A 5F1RA 2B9UA 1CX4A 1YQ6A 2I2SA 2BQPA 1OD5A 4RFRB 3WG2A 1X7NA 3O1VA 1RMU1 2OVUA 2WBKA 5KHIA 2YU1A 4TN7A 4I2OA 5F3EA 2DCYA 3ES1A 1LJ7A 1FOD2 4CUAA 1C5IA 4BJ0A 4X6RB 2ID4A 4WZCA 2W3JA 3T2TA 3RDIA 1OA3A 3Q9OA 1WLCA 3CLPA 2CHHA 3E6CC 3NNLA 2J1EA 3ASIA 1MS9A 3QBQA 5DXDA 5FO9B 2KXLA 1QJY2 1XSRA 1PX3A 5HCAA 1T2XA 3EXUA 1C8NA 4LUKA 4CCDA 5H9PA 4A41A 4JRLA 1XPWA 1U5YA 3IKWA 4I0BA 1ODMA 3AP5A 4IE6A 2H0BA 1ZYBA 2VOTA 2WO3A 4AVTA 5JZGC 1JZ3A 1LU1A 1P8JA 2LM3A 3APBA 3DYMA 4DEQA 3OPWA 1PMHX 2CDOA 3ZXGA 4IGPA 2ZKNA 1JS9A 2UURA 2DVDA 3PL0A 4YZ3A 1DQ1A 2Q8DA 4MGQA 5IJRA 4CEWB 4MG2A 3VBUC 1QJFA 3H1YA 2DBNA 1BJQA 5SV8A 1TME3 1B09A 2HJIA 2VCBA 3M7AA 1V6OA 3VL8A 5I0DA 2R063 1R1A2 4YM1A 5FP4A 2XG3A 1OD3A 1OFSA 4Q4X2 4UWDA 4CCOA 5A3TA 4OUEA 2RM21 1H1IA 1RUI1 5C9AA 4BMEA 4UW5A 5LY2A 3VLBB 3R4DB 2WT2A 3VHRA 3MZHA 3WCRA 4COVA 1K45A 2PAEA 3ZN6B 1UPSA 5GZEA 5A6XA 2OS2A 2ZPXA 2Q0AA 1I3HA 2D6PA 1KDMA 2JG9C 3THTA 3X29B 4E2GA 2A6WA 1SDWA 3EBRA 4LMFA 3PVNA 2D6KA 3VBSA 1CAVB 4D94A 5FAXA 1NCQA 3WUCA 1RL3A 3ZFGC 4DINB 3DKQA 4JGYB 4EYUA 1UCXA 3FC0A 2VH9A 1UZVA 4UI9L 4QM9A 1FMD2 3K4DA 5FXVA 1DU3D 3OUJA 5FY7A 3HAGA 1QH7A 4HMZA 3DXTA 3A7QA 5C4WB 4YWAA 2R16A 4B4QA 1BEV1 3HNYM 1OVSA 3OCPA 5EV7A 3VDBA 1OKOA 2W1QA 3VBHA 1J58A 3OPTA 1OA4A 3DPRC 3SEEA 1QGLA 3ZVXA 1SMVA 4K7JA 3CU7A 3RI9A 4AFDA 1OF3A 4CDWB 2PELA 5KC5A 2NYYA 2ZGSA 4XDQA 3POGA 4DY3A 3BVCA 5FLJA 3WP3A 4AQTA 4QDQA 2J1RA 1NOVA 5FUPA 3WW2A 1V6NA 1F15A 5FQ0A 3H3UA 5KC6A 4FPYA 5HV4A 5JR7B 1FV3A 2VNRA 5CIRA 4DRRA 3BTZA 3H42B 4FPLA 2RG4A 3OUIA 2A3WA 3LA3A 2X8KA 4AF9A 4AHWA 1J3QA 2HWE1 4WVWA 1ZA7A 3WNPA 4YM2A 4BE3A 2MEV3 1CAWB 3SQOA 2LS6A 5C70A 4NVPA 1WGPA 2P6HA 3ZKYA 3S5QA 1YC61 4JKKA 4W50A 5F37A 1XC6A 2OQ7A 4CEWA 1PO12 1VRH2 1H8VA 3WP5A 3MPBA 2D5HA 3POIA 5JLVA 4I09A 4S2HA 1C1LA 4MADA 3Q8EA 5F5IA 1W39A 2RS51 2W08A 2UWCA 3M3EA 4Q4X3 5CFCC 2GNBA 1DDLA 4IDZA 3FHAA 2EIBA 4YG6A 3ZN6A 2XJRA 3ZDSA 2Y6JA 1AHSA 1GOFA 1HQNA 3KGLA 4FP3A 3IWZA 3P1IA 4NIAA 4JQRA 2NLRA 2A75A 4RR3C 1IPJA 5F5CA 3P3PA 2BPA2 2BBVA 1CAVA 1GP6A 1OT5A 4YGDA 1W2UA 1HV1A 2PHUA 1DFQA 2ZHNA 4JGYA 4QB6A 2X53S 2E6VA 4LO6B 5IAXA 1HLCA 1NE4A 4P9GA 4EJRA 2VOVA 4KMQA 4CEYB 3S7IA 1DGWX 1FMD3 2CU5A 1WCQA 4LOTA 2RJ2A 4META 3CJXA 4PQ9A 2BVVA 5FCCA 4OMDA 2QCSB 2DCZA 2LROA 4IE5A 5FYCA 1K5MA 1JU3A 3HQRA 4N53C 5C4WA 3ZPOA 4DUVA 5J09A 3BTAA 1YHFA 2W1UA 4JZRA 3O1MA 4FI9A 3U37A 2ZGMA 1TE1B 4PDWA 4EN9B 4WV8A 4Z2AA 4WBBA 3RWNA 2OYZA 1ENSA 1FPN2 2JD9A 4ZHNA 2PHWA 3POJA 1JXNA 1ZZ6A 3MF6A 1ASJ1 1E5SA 1W90A 4CDWA 3WDXA 1PGL1 5GLZA 2G9FA 3PU3A 5D2AA 1KJRA 5LRRA 3RGBA 3TEXA 2WNVB 1W8FA 2I74A 4YVWB 4AI2A 1ONAA 3LQCA 4CXWA 2D44A 1N1YA 1JN2P 5FZOB 1Q5OA 5T54A 2J1TA 5IVCA 1J84A 1WUVA 1S0CA 4KL1A 4MGKE 2E7TA 2TBVA 4ZY9A 4QWNA 3VHPA 1CAWA 2YROA 3POYA 2Q4SA 3V65A 4BMBA 1X36A 3HOBA 3WQ7A 4DZGA 5JZGB 4FOWA 1UN1A 1V6MA 3GF6A 3I4IA 4AEDB 4XQDA 5LY1A 4UW4A 5J3UA 4FT8A 5C3SA 4ZXEA 3V64A 1RUG1 1DYOA 4Q0UA 1AXYA 4NWVA 3TAYA 3VBUB 3OGRA 3OY8A 4IEOA 3I2DA 4HVRA 2XVLA 4OHWA 2ZACA 3DL3A 1O8SA 2D93A 4YGCA 4AVBA 1VAVA 1HX6A 2VBPA 1SFPA 1NLQA 4CUGA 4E9KA 4DMIA 5IATA 2GC2A 2JDAA 3KD4A 3J4UH 3LPFA 3H8OA 3K4ZA 5EPAA 4Q0VA 1GZCA 4COWA 5D1IA 3T0DA 3PTYA 1BMV2 3RG0A 2VMHA 3JQXA 5LZ6A 4QGLA 5C3QA 1SLLA 1ACCA 2JG9B 1G9AA 3T2QA 2F6BA 4XIOA 1NUKA 2HWD2 2W39A 1UKGA 3P6BA 4RQPA 4OHZA 2E51A 3ZFGB 4XQWA 4ZPIA 1PVC1 3UGGA 1CESA 2ZGLA 2AENA 4CEYA 2CGOA 3WNLA 1AR62 3UYJA 2Q1MA 3RQ0A 1TMF1 1UIKA 4CDQC 3KVBA 3ZOIA 3IMMA 1S2EA 5A7SA 4LIVA 1D4VB 2VW2A 3SITA 3FFQA 1Q56A 3I59B 4RL7A 4Y1UA 3OBTA 2EAAA 5E1RA 1AR81 5FUNA 3NJZA 5FDBA 1VBE2 2GP3A 4ARXA 3DPRB 3MIDA 2VULA 2WNVA 4YVWA 3ZMNA 4AHYA 4Q4Y2 3Q8AA 1IKPA 5FZOA 5I8YA 4W6XA 1QJEA 4EV0A 2Q5TA 5LRSA 4QXHA 3BN6A 2WZR3 1H30A 1U5ZA 3B69A 3MGUA 2EXJA 3I2FA 1VE0A 4QKDA 4YW5A 5KHHA 1UQXA 2PXJA 1JYCA 5A7NA 1QDOA 3TN92 4WZFA 4FPEA 1S1AA 4FPHA 3EB7A 1W2NA 4FPJA 3KV4A 1HXS1 2EXKA 3AMMA 3M3CA 3ZFEC 1F4HA 1UO9A 1BZWA 4KI5M 4XFIA 4AEDA 2GMEA 2NMNA 2WO2A 1W6QB 2YC4A 1S0EA 5DABA 1T6GC 3OEAA 4Q4V3 3LF7A 1JOPA 1KQRA 3WNMA 4IEUA 2OX0A 2VAUA 3WDYA 4NRPA 2CAVA 2KM2A 1HRV1 1AR71 2ILMA 5JI9A 3IN9A 5A3PA 2V5DA 4BYYA 5F6KA 2X5IC 4E8CA 3RZMA 4Z1VA 2VOWA 3QH7A 5JSRA 5CFCB 1AL23 5FY0A 4RHV1 2N7GA 5JOXA 4M4PA 4XURA 1KXGA 2BUKA 2HBTA 3B9CA 5DAQA 3QD6A 5B4NA 2A1XA 1ZZBA 2JG9A 4DIQA 2H6BA 2B5HA 1WCKA 4RR3B 3GZEA 5EWSA 5A32B 3ZFGA 2D3PA 2HWD3 3GXUA 4L9BA 1XNCA 5ACA1 4CDUB 4CU7A 2UY9A 3NAPC 5H9SA 2QVSB 3WOGA 3VZOA 2VVEA 4LBQA 1AR63 4RS5B 3HNBM 5TSWA 4UFMA 2QQJA 3RZHA 4AHXA 2DCJA 2WT1A 2P3JA 3UGHA 2GMPA 4N53B 5AFEA 3PURA 1AR92 3EHKA 3I59A 1UMHA 4UT5A 4XE9A 2FZ1A 4QGMA 5BNOB 2QDRA 1J3PA 4MGZE 3OBRA 3GZAA 1E5HA 4YGBA 3DPRA 4HKWA 3TEYA 3OGJA 5CKMA 1ST8A 1Y7BA 5F3CA 3INAA 4CCLA 1AYN1 1UYXA 2CSGA 2DVBA 1SCSA 1FNYA 2BBAA 2ARAA 1QJU3 2A3YA 4SBVA 1POV3 2G9ZA 4HONA 2AEZA 1O91A 4GJYA 4RD7A 3PHMA 1QMJA 1OUXA 4LBQD 2ZXQA 5DUWA 4PCRA 1S55A 1VBC2 4RGKA 3AMPA 2ETEA 5F2WA 4IL7A 4UFIA 4QPYA 1FV2A 4XFCA 4ZS2A 1QQP3 1LOGA 1QIQA 2KR2A 3K3NA 3UJOA 2TEPA 1W6QA 3PUSA 1URXA 1UKRA 2CAUA 3MLJA 5T5LA 3ZR6A 1ZNPA 1REFA 2PQSA 1K5JA 2D6OX 2YY1A 3JD71 4A4AA 4KWJA 1UF2C 5E6HA 1ND2C 5FO8B 4SLIA 4JX0A 5FMDA 4XQ4A 2YUEA 4E2QA 3UNPA 2XUEA 4XMAA 4B7KA 3JBG2 3VKMA 3IZOA 2IXJA 3K75B 5FZ7A 1VBD2 3WT3A 2EA7A 3V0BB 2XKPA 4Q4W1 5C8WA 1NQDA 3JQWA 2VTXA 2ARCA 4GB32 4LORA 5FKCA 3RZJA 2D7FA 4TTGA 1OLME 3ZR5A 2VMGA 1J1TA 2B45X 4NPRA 4XVHA 4HK9A 4OZOA 4RR3A 2OZJA 2DWRA 1IKQA 2AC1A 4EZHA 5A32A 1XYNA 1R081 3VDDC 3O1UA 1DLCA 4AVCA 2GMMA 2CL2A 2HWB2 4XXAA 4CDUA 4ASKA 1DQ2A 1PIV1 3FJSA 5D21A 3WF4A 3IDBB 4XILA 2FD8A 2WS92 1Y43B 3OSDA 1T6BX 4RS5A 4XW3A 2ZX0A 4GWIA 4H2AA 4GALA 1EAH3 3D0SA 4QKBA 4YW1A 2XBO2 1AVBA 3UGFA 3OGSA 2XJSA 1R64A 2OA2A 4IUGA 4CDQB 1OPOA 1Y9QA 2P3KA 1EY2A 3DYPA 1M06G 3HQXA 3VBOB 4BHPA 5BNOA 1IOAA 1AR93 1RC6A 3AKSA 2B9VA 1W0NA 4LKSA 5FPZA 3RJRA 3GHMA 3RMXA 2Y60A 1R093 1W6NB 4C0BA 1Y9MA 3T09A 2ZBJA 3NV1A 1ZA4A 3JB4C 3ACFA 4NUBA 1YJKA 3W9AA 2V4AA 2ZS6B 2ZJCA 2G1MA 3PNAA 4FVVA 5FYMA 4BK4A 4K40A 2DUOA 4UYBA 2XHKA 4XACA 4XEZA 4FTEA 4Q1PA 1W8HA 4L8QA 1PX4A 2DVFA 1LKNA 5IK7A 3IDCB 3OPZA 3JB8A 3CJIC 2IWGB 4CE8A 1JTZX 1NLRA 3NL1A 1VBC3 2J7MA 4J1WA 4FFFA 4PHZA 1TME1 2RS32 2EIEA 3ZFEB 4DY5A 1S0IA 2R061 3FL7A 1PK6B 1D2SA 3GYDA 5LB6A 4EN7B 5JOYA 4M01A 1HV0A 3AMHA 4EZ4A 4XAEA 1GYKA 2WKKA 1DZRA 2WL1A 3TNPB 1X9TA 4NHKA 1KRIA 2BDRA 2X5IB 3AJZA 4E4ZA 1N3OA 1QXJA 2SBAA 2ZGNA 3AVRA 4LHSA 5A1FA 3V0BA 3ZYRA 2VZPA 3VZJA 1VBD3 1UX7A 4M0NA 2Z4FA 3VUOA 3MW4A 1W9SA 1IS3A 1DGRN 2EXIA 4CP2A 4I0AA 5L9BA 3ECQA 5DQ0A 3WQ0A 2FCTA 5I8TA 2Y34A 2VM9A 1CZTA 4FFGA 2WLQA 3NO8A 3I2OA 2HWB3 1POQA 1W3XA 1YNAA 2WSVA 2JG8A 2A7AA 3OGVA 1RUE2 2IUWA 3GDBA 5FZAA 3NAPB 5A6QA 2VZTA 3N4MA 3ZSJA 4FOYA 5FZKA 1Q43A 1NXMA 2AYHA 2JDKA 2X29A 2BNNA 4OUMA 1QDCA 4XFFA 4B8EA 4CDQA 2PHRA 2WR9A 3MF9A 4A7KA 3I3MA 3VBOA 4IETA 1STMA 1V6LA 3T2PA 2GZWA 1H8TB 1Y3TA 1LGCA 4XFBA 2ZEZA 3CKHA 2C4XA 4IW3A 3RMYA 1W6NA 3MI8A 3LCPA 3RWKX 2Y38A 3UJQA 2W46A 3WNKA 1EV12 4DS0A 4AHZA 5FKBA 3HR9A 4FPGA 5C8CC 1WWYA 1GQGA 3AKQA 1AXZA 1RYYA 4NIHA 1UY4A 3WDUA 4OFGA 1U5IA 3RI8A 1ND3C 5FPLA 4RGAA 4Y4RA 3RRDA 1I1EA 3ES4A 2JE8A 4M3CE 1UOFA 3CDZB 2P3YA 1FNZA 2RR13 2MEV1 4HL0A 2WDBA 2PHXA 4OI4A 2JKBA 5DUXA 3TBDA 3POSA 1GWMA 1LEMA 3GJAA 4Q0QA 1JUHA 4A42A 2YC2A 1OH4A 1VB4A 3WEZA 3WZ1A 5BV6A 1BQPA 4LKDA 2GP5A 4QX1A 1GWKA 1VMFA 4OULA 1C1FA 4RN5A 2XJQA 1PK6A 1KDKA 2ZMKA 4LXLA 4BQ5A 5EYYA 2XVKA 4B3NA 5FMCA 3WY6A 4Q4X1 1M4WA 2XGXA 4R9CA 5E89A 4E27A 2UY8A 2MPFA 2WO1A 4AYUA 4CP9B 4MV2A 5DAWA 4CVUA 5DDJ2 1ND2B 1LCLA 1SPPB 1EPWA 1YI9A 1K12A 2D5FA 3AZXA 3KT4A 5J48A 1KS4A 1RUD3 2CNAA 2D3SA 1OH3A 2PN5A 2W0XA 3CHXA 1HB2A 1DHKB 3O14A 4NHYA 3O5SA 1X33A 3EYPA 3GNEA 3PIJA 5IFPA 1XBFA 4WM7A 4HG6B 4R52A 3KS7A 1QF3A 2WNEA 2ADEA 3HWJA 4N9HA 4TZDA 5FWJA 4UW3A 5I93A 1OF4A 1MZ6A 1UYZA 3DGTA 3MHZA 4QX5A 3WW4A 1FMD1 3KHBA 1G9FA 2HWF2 4NPLA 2QQUA 5I91A 5LEKA 1L7LA 3MEPA 4BM8A 3NAPA 3D4KA 1MZFA 2AZ5A 2XKOA 3NVCA 3BKZA 1RUE3 3USSA 1WCDJ 4JDMA 2VC9A 2JIGA 3PUAA 4K1ZA 4N90A 3J9SA 4Y22B 1VAKA 4Y1XA 1SCRA 1SEFA 2O8OA 1H8TA 2Y6FA 4Y33A 1AJKA 2BRTA 1SBEA 1Z0HA 3AP4A 4DNYA 4DEVA 2WNUC 3K3OA 3MDPA 3LKJA 4A2UA 5K4LA 1EV13 4FTBA 1RUNA 2XMLA 3U75A 3LOBA 2WZEA 2WZ8A 1MEC3 1QWRA 4A7ZA 4XFGA 2NP0A 5GLTA 2P4EA 2FDJA 5GALA 3E6BA 1LOFC 3AX4A 4IGOA 1ZVFA 1SFNA 4OI0A 2GH2A 3LWCA 5LW9A 2HEYF 1CIWA 1G9CA 1PGW1 3ZXJA 4HPKB 4KBZA 4OLLA 4JDNA 4PLMA 2W52A 4V2WA 3VD7A 5LCWL 1WMFA 3I2KA 2ZTNA 2XJTA 3PLQA 4Q0PA 2KD7A 2WABA 4MYEA 2WO7A 1WW6A 3UESA 4LBLA 4YNIA 2YDEA 3Q8CA 3H7YA 5B2GB 4CP9A 3AZYA 3TEWA 2FDKA 2GNMA 2C24A 3MW2A 1JZ6A 2XQRA 3UK9A 4XBNA 1ND2A 3E1F1 1VBA3 4LBJA 3D5OA 1SPPA 1RUH2 4N43C 3A0NA 5DDJ3 4B7EA 4YYOA 4EWDA 4E4HA 4QT6A 2DFBA 1RVF1 2MHFA 4Z82A 4AGRA 4IE4A 3WF0A 3ZDVA 4QX2A 4CP1A 2CGPA 5FP7A 4EWEA 4OQ9A 4QKNA 1QHDA 4CDXB 3FBYA 3DXUA 3LEGA 1MQTC 4LBOA 2VQUA 3E5QA 4NPMA 1W2TA 4WVMA 4M00A 5FLHA 1JZ2A 1JZ4A 2BGOA 4TYSA 1O4ZA 4PIXA 2VBBA 3ZO0B 4EN8B 4NROA 4Q26A 5DG1A 5A80A 1C8M2 4MGSA 4RGGA 3OJBA 1MZ5A 3S5AA 2P34A 1WBFA 1HRI2 1CN1A 2ZX1A 1WW4A 1X8MA 3ZX7A 5CYYA 3EQEA 1UZWA 1WMEA 1YQ8A 4Y22A 2BGPA 5IYYA 2ZAHA 4D8MA 4N7IA 5EFUA 3SKJE 1XRUA 2QUOA 1NY71 2C9AA 2JENA 3FHIB 2W9XA 3LE0A 1RITA 5T5JA 3WF1A 4AE2A 5IVFA 1KFXL 1XNDA 3M3OA 1AX0A 5FPAA 5CFDA 1XXNA 2NPIA 1UYYA 2VU9A 5KBFA 3RJ2X 3ON7A 3ETQA 3AL6A 3EMRA 4QPIB 4WM8C 3NJYA 5C8CB 1TNRA 2WZR1 3BGAA 3KWVA 2V5YA 4KWUA 5T50A 5CZKA 5FZ4A 1UNBA 1KFUL 4LTAA 3RFRA 4M0HA 1ND3B 3PVBB 3ZYHA 4YZ4A 1QJX2 2VMFA 2FZ2A 1PVXA 1VRBA 5A7QA 1CAUB 2VVDA 4M3CF 2XPJA 2ERFA 4LK6A 1WD4A 4HPKA 2ZEYA 4ZU4A 5FZ0A 2MNGA 1JW6A 2IVIB 3E6DA 1JH5A 1LOAA 5FOBB 2J1SA 4AG4A 4XZPA 1YWKA 2R1DA 1POV0 3IAPA 3OTFA 4Q4V1 3WQBA 4MZUA 1GZWB 4FOVA 4MGIE 1KGYA 3AFGA 4FPFA 3NMBA 2Z2SB 4LJHA 3U0ZA 3BIWE 1YIFA 1UY0A 1XE7A 3IIIA 3WNOA 4GH4B 5C3PA 4YZ2A 3L9JT 1V9U2 1AL21 2WQZC 1TVGA 5FZ3A 1GZTA 2A6XA 3I2JA 2F4PA 3D8CA 2DCKA 3IM0A 3OD4A 4B4PA 2LALA 5A3NA 4FSJA 3AKTA 3T0BA 2C9KA 1QNYA 1YLLA 2WYSA 3ACIA 4CCCA 1FOD3 3I2HA 5FMOL 4B1MA 2JEMA 4CDXA 2RDSA 5G04L 4AGVA 2VCCA 2HWD1 1ZBE2 1IG0A 2WQ4A 3VN4A 3WCSA 5L36A 2PMWB 4DB5A 3CNAA 3BPZA 4EROA 1QJY3 1AR61 2VNGA 5FXXA 1H6XA 1UAIA 3ABZA 3GBGA 5GLUA 3HN1A 2KA3A 4QU1A 4V2VA 5A3UA 1HIXA 1FAYA 1J3RA 2CV6A 1LU2A 4P02B 3PVOA 3OG2A 4I3GA 2JICA 4BQXA 2R072 1SLIA 1D4M2 4LE3A 2HLEA 2Z79A 2FQPA 3LFMA 4AQ2A 2W1SA 4QX0A 5DZEA 1DCSA 3TWIA 4GKXA 3AFKA 4R9BA 4IE0A 1PZ8A 4AI3A 5HXMA 4CPBA 1H1MA 1R1A3 2XUMA 3ATGA 1TG7A 4P9YA 4D3WA 2WNUB 1QJU1 4GWNA 4QPIA 3RPQA 3VZKA 3VBRC 1POV1 3AP6A 1VBB1 2I07B 4QB2A 5C8CA 4UF0B 1LTEA 2C26A 4E8DA 1GV9A 4QXBA 4LT5A 4W6WA 2WWUA 1IQDC 4AEJA 1ND3A 2C1FA 1RUF2 1CAUA 1BK1A 1DZQA 2Q8OA 1COV1 1QJX3 3ZYGA 2YV8A 3LZZA 3CF6E 2ZGTA 1QQP1 2VZOA 2K46A 1O4TA 3DEMA 3NV2A 4YW7A 4PI2A 2DTYA 1NXD1 3M3IA 4LBKA 4W65A 5FP8A 2OXBA 1WCUA 2CY6A 1UPIA 4CUCA 3ZLIA 3RSJA 1XB9A 2AEYA 5IK5A 1OHFA 2YC0A 2GDFA 2W91A 1AXKA 1V6IA 2B46X 4RFT0 4AVSA 1W2AX 4R4ZA 4G3YC 3UETA 5IVVA 4GH4A 1RMU2 3U1XA 4BWOA 1VALA 2FCUA 2JE9A 1GNYA 3HT1A 3ILFA 4MXVA 5D8AB 1RGSA 3ZSLA 4LLFA 2HYKA 3LPGA 5JSPA 2X05A 2HH9A 4NMIA 3AMQA 4GKYA 4A3XA 3AP7A 1UL9A 2OPKA 4XPVA 3PJQA 1H2MA 3E97A 3RS6A 3D3AA 1W0PA 3BCWA 1W06A 2JB4A 4QX3A 1ZBE3 4XBLA 1EUUA 1O4YA 5LASA 4XFAA 1MQTB 3ME2A 1KD7A 1YQ5A 2JXAA 5L9VA 1NAEA 1ULEA 5BNPA 5CADA 4H3WA 1EAH1 4ASMB 1CVNA 4BLJA 1RIRA 1UY1A 3L2YA 4TLGA 5F7UA 1N47A 1V6JA 4UW6A 1UU6A 2GU9A 5DG2A 3MIHA 3MV11 4XJZA 3ZSMA 4LQRA 1RHI1 2R073 1AR91 5KHKA 4XFHA 3SISA 5A7WB 3FZ3A 4JVAA 1R091 1Q8QA 1PO13 1VRH3 1RUOA 2VECA 2ZABA 1LGNA 4Y5Z0 3T1LA 1AZDA 4IEXA 3T30A 2WNUA 2R32A 3CL1A 4RSUA 2ET7A 4XUOA 2B4KA 4BH9A 4AAXA 4CXYA 1DYKA 1JOJA 4UF0A 4IEVA 4ET7A 3N7JA 1H2LA 1GBGA 2OUHA 3C2UA 5GLWA 5AC91 3H8RA 2QQPA 1MVEA 5CG9A 5T3NA 5JI7A 5FMOS 1RUF3 3I8TA 4CSWA 2VW0A 1AX1A 4I3PA 4INDA 2Q30A 2RS12 5DAVA 4AEKA 4CCKA 3VD9A 4AI0A 2DF7A 2IZWA 3C7GA 4L0PA 4AEMA 4NRMA 1MACA 4QHZA 5GJ6A 5LA1A 5A3LA 1GUIA 4UFJA 1IS6A 2XLGA 1BEV2 2FDIA 5CA6A 3MUZ1 2G19A 2WFF2 3IIAA 5CBLA 3RZLA 1D0GA 1CWPA 4Q0SA 2PA7A 1RMU3 2OT7A 5D8AA 3WR0A 5ISLA 3WDVA 1YFUA 5JXIA 3LA7A 2GSYA 2XOMA 4XABA 1YQ2A 1A34A 1OKQA 1FPN3 3J8F2 3VDCA 2E33A 2ZZQA 2UYAA 2VBDA 4PIYA 2VOXA 2ZGOA 4BQ4A 1MVQA 1VR3A 1L7RA 4Y24A 4YW2A 3HD8B 1ULFA 4C8DA 5CISA 4TWTA 3HEIA 2AUYA 2AACA 3B7MA 4XMIA 4XCBA 3GM8A 5BY5A 2HWB1 1MQTA 4XUTA 2RV9A 3MO4A 4MHUA 4MH0E 5JPNB 1UMIA 2HWE2 3AYDA 3TNQA 1F4AA 1WKYA 3VV1A 1ULGA 2ORXA 5BNPC 3ZYBA 1DQ6A 2CDPA 4UFLA 5CVRA 2ZGPA 4D7YA 4WVVA 4FQZA 4CYDA 1F35A 1LR5A 3O0WA 4JTOA 1DLLA 3F2ZA 2R1BA 1IQAA 2WN3A 3H8UA 2C5DA 1OSGA 2OQ6A 1QJZA 2RS52 3DECA 2BP6A 3LIHA 3MW3A 3PIGA 4YM0A 5A7WA 2VOKA 3NV3A 1NKGA 2WNOA 1BK0A 1CD3G 4S2GA 1H4GA 2YBPA 3VBUA 2JDHA 2RDNA 2Y6GA 1DYPA 2NZ9A 3OYWB 4XF4A 3AKPA 5FZCA 4JRAA 4ZZ5A 1ZRRA 2DYCA 1W9YA 4CRQA 1CX1A 4K6BA 4Y20B 4YVSC 2F4LA 2W87A 5A7OA 2XJUA 3GBFA 3N36A 5FP3A 2RR11 1W03A 2JDUA 4XIKA 5JIAA 5J98B 1XNAA 2XXZA 2R6QA 3ZXKA 2IFRA 5FIXA 1OI6A 3SEPA 3U4SA 3ENRA 3SH5A 1GWLA 1LOEA 2WYFA 3IDAA 2PLV1 1GU3A 2YZ4A 2WRAA 2RS13 4MSVA 5IW0A 3J7MA 4F8AA 1ZZ7A 2B42B 3POFA 1GMMA 1JHJA 3ACGA 2O0OA 4HN1A 4U36A 2V72A 4IV1C 5IVEA 1BEV3 3RYRA 1OBNA 4HKOA 5J37A 4U2AA 1YRZA 3KGZA 5ABJC 2FCVA 2WFF3 3P3NA 1RUD1 3KF5A 4GAZA 3ZXAC 1SQ4A 4C91A 1X8EA 4O65A 4H14A 2HEWF 1YO8A 1ASJ2 5FZLA 3SXWA 4ZU5A 4CUBA 1H6YA 3O12A 1HDKA 3J8F3 4A7YA 1VBE3 5FYVA 5JXGA 3OUHA 1XSQA 2YB7A 3B01A 3IMNA 3R4UA 4CU9A 1SG3A 5C5TA 3WP6A 1KS5A 1R1ZA 4Q29A 4Q4Y3 4TSVA 4TXWA 4KH9A 1WLDA 1LEDA 3PDQA 5KHJA 3PUQA 4XUNA 2D6NA 4JCKA 5FYHA 5DZGA 4AAPA 5C6CA 5FZEA 2Q1FA 1NT0A 1QOOA 4YPJA 3ZIXA 4NAOA 4PT6A 3TN93 5F3IA 3ZSKA 4CXXA 2WN2A 3ALQA 5C3OA 4LR4A 3ZFFC 1RUG2 2WZPP 1G7YA 1W2OA 3WUDA 2L9LA 1UZ0A 2Y6HA 2R042 4WVZA 3KQRA 2PQQA 4G9SB 3OYWA 1MEC1 2DURA 4W8JA 3T08A 1OPMA 2VR4A 4FAGA 2D6LX 5FY5A 3B02A 2ZHKA 3WDTA 4AOCA 1GOHA 1AF9A 1E57A 1S4CA 3ITQA 4IQPA 4Y20A 3R0RA 5HCBA 1C3HA 1W6MB 5FOJB 5CFCA 2P5BA 2GC0A 4Q2FA 1GANA 4M3CB 4MX3A 5F6LB 1W28A 4XJWA 2LW8A 2IC1A 1O6UA 3E5UA 3M4FA 5E88A 5K0UC 3B5LB 3OB8A 1YUDA 5CU1A 2VL4A 2Y6KA 4GMP3 3SNMA 5F3GA 4PF1A 1PVC2 3U78A 3C7HA 1UOBA 3O7OA 3ILRA 1B35C 5DAXA 1TMF2 2Q1ZB 4D6SA 2QQWA 3KVAA 1W8TA 5CKNA 3ZXEA 4COYA 1Z7S2 3KV5A 1VBA1 2VXJA 4LA3A 1AR82 4I01A 1JODA 4N53A 3JZVA 4IEWA 3WW1A 1RUJ2 3WHUA 5L9RA 4GWJA 3ST7A 2BOIA 3DV8A 2BZDA 2ET1A 4A45A 3WP4A 5GKAC 2R49A 4Y5TA 1DQ5A 2J1UA 2E32A 5IFTA 4HXCA 4BISA 1NZCA 4P9JA 4YW4A 3SCFA 3VDAA 2X10A 3W21A 1N1VA 5DUUA 1HKDA 1UOJA 1NCRC 3ETPA 1WMDA 1HXS2 5FTTC 1SFYA 1PZ7A 2X09A 3PMSA 5LATA 4NHLA 1W04A 2R7EB 3Q8BA 4HVQA 1HN0A 5JMOA 4XYXA 1OUSA 1AYM2 3MBWA 2JDNA 4P9LA 4QB1A 4FOQA 4LOSA 1J83A 3WF2A 5C9AC 1WBLA 1JZ5A 3AYEA 3J7LA 4XUQA 5KR7A 1US3A 3MFCA 2ADDA 3T1MA 5IT6A 1YI7A 1ZBA2 2R043 4NHMA 2XVGA 3W58A
chains in the Genus database with same CATH topology
4RHV2 1W6MA 4AFBA 2FHRA 1NCQC 3JU9A 1ULDA 1LULA 3JBG3 1Q8PA 2VUAA 3SCGA 1VJ2A 3BB6A 4KQ7A 5DZFA 4B29A 4GIQA 1WLTA 4H7LA 4GB33 3WD5A 5BYNA 5JAXA 5ACA2 2RMU2 1BCXA 4OHYA 4FPKA 1S0BA 2Y26A 3ACLA 2YPJA 3ZPYA 2K9ZA 3BALA 3VZLA 4P9IA 1TMF3 2A5ZA 3VBHC 2EALA 1F5FA 4N7UA 2VNOA 4K21A 5E8AA 3MYXA 5J7MA 4BPZA 1ULCA 2WS93 2ZOEB 5CNAA 1Z7S3 2NMOA 1PMIA 1EP0A 2BNOA 1LHNA 2JE7A 2XBO3 2XH6A 4FCAA 1MS5A 2P3IA 5C33A 5ABJB 1F2NA 1FOD1 2A70A 1RUJ3 1AYN2 4LO5B 4AFAA 1ZRCA 4X8PA 2UWBA 3M70A 1JBCA 5AVPA 2QZ3A 4NR1A 1XNBA 3DN7A 4AVAA 2A6VA 2VVFA 1QJY1 5GZGA 1F31A 3K51A 3EJKA 2IFWA 2XB6C 3AKRA 4CEWC 5GM0A 2RJLA 1U5XA 1AYM3 1F8VA 1G86A 1O3RA 1CAXB 3ZFEA 4HANA 2RS33 1GNZA 3RYKA 1R1A1 2E53A 3U10A 3VKNA 5F9TA 4XJ8A 3ROUA 4LHNA 1ZBA3 2BYVE 1A8DA 3QLQA 4AFCA 2ZGUA 3M3QA 4I02A 4BA6A 2X5IA 1I9RA 1UZYA 1RUC2 3PMEA 1G8WA 4Y1YA 5FREA 1QJX1 3CO2A 5GZDA 1R082 2D43A 5K0UB 3LSDA 4TLFA 2RJKA 2RMU3 3ILNA 3KB5A 3ZN4A 1K5MC 4R9AA 4JC1A 3LAGA 3RZZA 5K8SA 1S0JA 3CEWA 3A4UA 1RJ7A 4PDWC 3VDDB 1BBT2 1B35B 4EN6B 2XLAA 4OI1A 3VHOA 3NW4A 2JJ6A 2IXIA 5A3MA 1VLNA 2WSUA 2GC1A 3GZUC 4URTA 4QQLA 1O3QA 4GULA 4BQ1A 4YG3A 3FLPA 5ABJA 2D97A 5J96B 4LO7A 3M2MA 1HQWA 2GN7A 1BVP1 3MPPG 1ZBE1 1OA2A 1DGWA 4UXAA 1XYOA 4XJUA 2QZ2A 1NLSA 5K7PA 3AZVA 1APNA 3TOJA 3N7MA 2CWSA 1NCRB 5K9YA 2D40A 4LO4B 4QQOA 3GALA 1FI2A 2WWSA 1S0DA 3WG1A 1TME2 2QKDA 4ZXKA 3S30A 1J1LA 1FX5A 2R062 3CJIB 2BFUL 1PO11 1VRH1 1LECA 1CAXA 2VPVA 1QU0A 3MICA 4DOUA 1BYHA 3SLIA 2JX9A 2PHDA 2XWBB 1CPNA 2YYOA 1ZREA 4E2SA 2A3XA 5J36A 4ES9A 1Q3EA 4YARA 3KT7A 1I6XA 1SBDA 4RQPC 1RUC3 1RUF1 2XWJB 4QQPA 2HEVF 3FLRA 1KITA 1MS1A 4CEYC 5K0UA 5BNQA 1UD1A 3OGGA 4HZFA 1O5LA 4P9WA 4N9IA 3IT8A 4QXKA 3NWKA 3BOPA 4Z2WA 1N3PA 3VDDA 1B35A 3HIFA 1AJOA 4ES8A 1D0HA 4COZA 1BBT3 2HWF3 4L2NA 4Y1VA 1DF0A 5T55A 3VBHB 1LGBA 4CP0A 4JV4A 5HXVA 1YCIA 3RNSA 4MLOA 5SV5A 2ZHMA 2WNVC 4YVWC 4HKLA 4OUSA 4MVTA 1FPN1 1YIPA 5CAZA 3VL9A 4E4DX 2RE9A 3TYJA 5I0SA 2YGLA 3DKWA 3FE5A 3USUB 1H1AA 1FXZA 5FQ0B 1O3TA 2DVAA 1NA1C 4HVOA 2ATFA 4HETA 1W6OB 2GC3A 2MEV2 2IXHA 1LHVA 3ZIWA 2D98A 2NM1A 4AEDC 3PJYA 3ZXDA 1NCRA 2QFEA 1XYPA 5JCTA 5L7OC 5BNNC 2H0VA 3CJIA 4XF0A 3ZYIB 2OIIA 1WLWA 4XHXA 4L92A 4MXWB 4R8HA 3VZMA 4D7SA 4HSLA 2QE3A 4KWKA 3GHNA 4LA2A 2BTVC 3JUUA 1LB2A 1GQHA 1OLQA 2PHTA 4YSFA 4FPCA 1RUH3 1G6NA 1NE6A 5BPXA 4Z8BA 1BMV1 3NSTA 4LO8A 2TNFA 2Y0OA 2ZAAA 1W0OA 1N3QA 3PVEA 3AM2A 2RS11 2ZMNA 1CQ9A 1OQ1A 4J1XA 5AFBA 4ATFA 2E7QA 2GH8A 1K5MB 4P14A 2ENRA 2PTMA 4ITCA 2HWC2 4PDWB 1C8M3 2WFF1 4GMP0 4CZSA 1HRI3 3BOWA 5T52A 3NV4A 2BFUS 5JIUA 4H55A 3J8F1 3LSEA 2VUJA 1PNFA 1VBE1 5FO7B 4BZ4A 2NN8A 2QDNA 1DG6A 5A33B 3USUA 2V73A 1HQLA 1NQJA 2AH2A 4Q4Y1 3MLLA 4V1PA 1YFXA 2R0HA 2WA3A 1PO22 1W6OA 4X8NA 1EPZA 4NWWA 4ATEA 3BU7A 3LGRA 3IDEA 2AR6A 2QNKA 4EWAA 1PGW2 3QOPA 4XTPA 3GBWA 5EZWA 2BWAA 3TN91 2ZX3A 4BLIA 1H9PA 2WLPA 2E63A 3AZZA 2DUPA 3R4SA 1GZWA 3FX3A 3GZTB 5LEJA 1YYNA 3OY8B 3VZNA 4OHXA 3O0XA 4HN0A 3ZN5A 4MXWA 2EF6A 2ZGQA 3ZXLA 2OUJA 1H2KA 1UU4A 3OD0A 2P37A 2B7YA 4K3UA 1RVF2 1V9U3 1VB2A 2PFWA 4KWLA 3H9AA 2V09A 3OF1A 2PHFA 4N43B 1REDA 4AWDA 1UU5A 5IK8A 2FMYA 3D6EA 2IXCA 5GLVA 4CDUC 4GMP1 2Y0IA 5KXEA 4RQPB 4IEPA 4RS5C 5I8SA 4YM3A 1WCSA 5I0TA 2FMDA 5IUQA 1A6CA 4BCUA 4Y26A 1ENXA 4KBBA 4C0HA 5BNOC 1YXWA 4ORFA 4IV3C 1AL0G 1SLTA 2HWC3 4GWMA 4AFMA 3ZSEA 3LOIA 2UWAA 1NY72 2C0ZA 1QXPA 1D4M3 1GICA 4LNVA 3W59A 4L97A 2RM22 1IHMA 4PLNA 1RUI2 5BUVA 2A71A 1O5UA 5A33A 3N7KA 4AI1A 2WZR2 3N35A 3AP9A 5HBAA 3D82A 5JPMB 1NA1B 1PO23 2GALA 2K0GA 3L2HA 1PZ9A 4GQ7A 1ENQA 4WM8B 2YXSA 4YGEA 1W6PB 4ZU7A 1LOFA 1SBFA 1VBC1 3KT1A 4Q4V2 3ZYJB 2VW1A 1WD3A 4JGZC 3M1HA 2B8MA 4IERA 5L7OB 5BNNB 2AREA 2R041 1AL22 2PYTA 5KXBA 4KNCA 4XBQA 4QM8A 1AUYA 5F5QA 3URFA 4Q8KA 1RB8G 3LB9A 1ZZ8A 3U4XA 2PAMA 3JBG1 4YW3A 4YLZA 2G9GA 1BKZA 3WNXA 1RVF3 4HK8A 4N43A 1VBD1 4AQSA 4GB31 3WXPA 4COUA 1EYBA 3AJYA 3FMGA 5JSOA 1ENRA 5AVAA 3WDWA 5H9RA 2JG8C 3SHRA 3ZMOA 5EJ3A 3MLKA 4XTMA 1ZM1A 4LBQB 3SCHA 1FT9A 4HSJA 2FBEA 4NN0A 3S6PA 4JAAA 4R9DA 3VBOC 2WS91 1LHUA 3H7JA 4FPOB 1Z7S1 1LRHA 2PHLA 1FATA 2XBO1 4C1WA 2GNDA 4FTSA 4KGQA 1G9BA 1UZZA 2ZCWA 5T5PA 2ZMLA 2ARXA 1DBNA 4FO9A 1GZ9A 1PM7A 1RUJ1 4F7ZA 4E4SA 3ELNA 1D2QA 1LESA 3IBMA 1QJU2 1PHMA 2RM23 1RUI3 1VBB2 2DU0A 1X50A 2GNTA 2XJPA 3WLUA 3JCIA 2WA4A 3KZ4C 5I0UA 3R6SA 3WG4A 4QPGC 1QXRA 1TQ5A 1UIJA 3FLTA 1NA1A 5KXCA 2Z42A 2D3RA 2WINB 2CWMA 2DUQA 1COV2 4LULA 4WM8A 5FBZA 5JVVA 2UYBA 5HCFA 3VBRB 1XE8A 1QQP2 1OOPC 1W6PA 5EXOA 2LUWA 3AYCA 2DCTA 5GZFA 2VXRA 1PK6C 3AZWA 4DPNA 3B93A 4XHBA 3VKFC 3E5XA 1AYM1 1F5JA 3SH4A 3U11A 2ZGKA 1MS4A 5L7OA 2E7AA 4PBOA 4FQ4A 3VBFC 5BNNA 3V56A 2RS31 1SLAA 4P5HA 1V00A 2BW8A 2CYFA 2DVGA 4LLOA 1G9DA 2XL7A 1ZBA1 1S0GA 4UBGA 4FXGB 2NQYA 3UL2A 1SACA 2BNMA 3POWA 3NKGA 4K20A 3V0AB 4WM7C 2JECA 2EVXA 2P2KA 2O1QA 1PGL2 4ONUA 2BVBA 2DV9A 2IXLA 4FBFA 2WC2A 4HFSA 3WVJA 4HBNA 2Z5WA 5BXXA 2DU1A 1RTVA 2RMU1 1QY4A 4G4FA 1CR7A 2BWCA 2R0FA 2TUNA 2H6CA 4FXKB 3H1WA 3MIBA 5DUVA 2E9QA 2PAKA 4QD2A 1EAH2 2WT0A 3ZXFA 2RHPA 5FRAA 3FBMA 1TEIA 3N7LA 4Z07A 1RUE1 1NYWA 2HWE3 3H3ZA 4LEJA 1H8TC 1RHI2 3IPVB 3WG3A 1AX2A 4OHVA 4D69A 4IV3B 1R092 2YMZA 2G4IA 5LK5A 1CJDA 3TRSB 1RINA 1ZRFA 4LUMA 3QACA 4QHBA 3WX5A 1Q8SA 2RS53 1MS8A 2VQ0A 1JHNA 1EV11 2O8QA 1CGPA 1DGLA 1VBB3 2DTWA 3H50A 4ASLA 5AC92 2A6YA 2WIIB 3WV6A 5CB7A 2ES3A 3B94A 2WFPA 1XU1A 1V70A 3VBRA 4NO4A 3C3VA 1COV3 1GKBA 4X6QB 2Z69A 5FPXA 1C4RA 4AK3A 1WW5A 1BVVA 2ARBA 1UMZA 4JGZB 2DFCA 4C90A 2LTNA 4QMAA 2OW4A 4PJYA 1LENA 4K1YA 1MR5A 3V0AA 4AVVA 4KG0A 3KCXA 5DDJ1 3THPA 2JDZA 1MS0A 5KHGA 1RUC1 3VKOA 2QJVA 1ZX5A 1YJLA 3BODA 1ASJ3 3EO6A 4LBMA 3H1MA 4CTEA 2EAKA 1GR3A 2XJVA 1X82A 3UKVA 1VIWB 1BXHA 4YFWA 2YGMA 2BGCA 2JG8B 2R30A 5KXDA 3U07A 1XU2A 2VQAA 3ZYPA 3FFZA 4KU8A 4KGGA 1UX6A 4PIZA 4P9XA 2CGNA 1BBT1 1S2KA 2HWF1 2D6MA 3B00A 3M8LA 4AQ6A 1CPMA 4LHLA 4L99A 1GFF2 1U0AA 3IPVA 1RHI3 4Q1RA 4AGGA 2IXKA 5BNPB 4IV3A 5CFDC 3MFAA 5HI0A 2W68A 1WW7A 4IEQA 4YFZA 5JOZA 1LOBA 4Y1ZA 5L19A 5LK7B 5CG8A 1RUG3 3AB0A 5KWRA 1FYUA 1HRV2 1AR72 1GNHA 4BIOA 3HT2A 3VHNA 1V6KA 4I30A 4YRDA 4Q8LA 4D7TA 2ZX2A 2RR12 3QH6A 4ZKTB 5AC93 3VBSC 1GLHA 1IZ3A 4M3CA 5JDBA 5JMCA 4QPGB 4XF3A 4YVSB 1O3SA 3H0OA 3G6JB 4MGYE 2PLV2 1OOPB 1PGSA 1CJPA 3D0JA 4L11A 4BIFA 2VGDA 4PF5A 1Q8OA 1PVC3 2ZA9A 4JGZA 4QGNA 1C28A 3DF0A 3G7DA 3SMHA 1H9WA 3VBFB 4XJAA 1SLBA 4BOWA 1RUD2 2CTVA 4LE4A 3HMYA 1SLCA 3UV9A 3AXDA 1S2BA 3I7DA 3KCYA 4IV1B 4EN0A 4Q27A 5H9QA 4XOGA 1RUH1 4CDXC 4WM7B 1AR83 4Z92B 3VGIA 1I5ZA 4S2FA 2A6ZA 4J6GA 4KG8A 2ZKLA 3KMHA 1A8MA 5IK4A 1QNWA 3MIEA 4C1XA 4LHKA 1J59A 4R4XA 1DQ0A 1OQDA 1QOSA 2UU8A 4OI2A 1LODA 2GAUA 2XLFA 1C8M1 1N1TA 2EIGA 1HXS3 1HRI1 3S0MA 1MS3A 5FLIA 4F83A 3UKNA 2JD4A 1C5HA 5BNPA 3B3QE 3WW3A 1DQ4A 1OLRA 1C57A 4QQ2A 4O9EA 4QPIC 4AI8A 3JD72 1PNGA 2WJSA 1MEC2 1WA4A 1Z78A 1IPKA 3WINE 3ZFFB 2BEOA 1HRV3 1AR73 1RJ8A 1S0FA 2ZGRA 1IS4A 3R05A 1QKQA 4RA0A 4QQHA 1H0BA 4YZ1A 4RHV3 4Q4W2 4HLTA 4YZ5A 1LOCA 3UKTA 3LA2A 4JGYC 4QPGA 4XETA 4YVSA 3KM5A 1ZZCA 3J26N 4DRVA 4XF1A 1A78A 4H7MA 1OOPA 1YFYA 2PLV3 1H2NA 1ZZ9A 1N1SA 3NKTA 1U12A 1YFWA 3QCWA 2VY0A 2VG9A 5E16A 5ACA3 4GH4C 2SLIA 5C4WC 1PIV2 1OFNA 5EYXA 3VBFA 1KJLA 4PLOA 1VBA2 1IS5A 4LBNA 3TB0A 4B4RA 3AK0A 4I0WB 3KCCA 1Q8VA 1XNKA 2I45A 4GA9A 5FFOC 1OQEA 1OMIA 4S2DA 4IV1A 1V9U1 3I54A 3B9IA 4CDWC 1CONA 1TNFA 4FAHA 3S7EA 1O7FA 3AMNA 3AXEA 1ALYA 1HW5A 1REEA 1GSLA 2HKXA 4JTNA 1AYN3 4WVMB 1VAMA 1MZEA 3DUIA 2B39A 2VMIA 3KLSA 1DIWA 4IXLA 3A0KA 1H4HA 2EXHA 3SH3A 4AW7A 4IEZA 4XXPA 2XL9A 2ZZJA 5L73A 3HBZA 4FP2A 4ISQA 2HWC1 2K2SA 4ISRA 1NG0A 4IESA 4DFSA 2YHJA 2ZX4A 1IGOA 2R071 4UBHA 3KSCA 3MIGA 4IEYA 2A73B 1ZRDA 1D4M1 5T5OA 4PBPA 4NOTA 5JOWA 1VP6A 1JUIA 5CFDB 1L3JA 3FUQA 4KU7A 3FUOA 3ZFFA 4XF9A 2OZ6A 3AYAA 3JD73 5GZCA 5JWPA 2P17A 4OVEA 5C9AB 1LHOA 4XJ9A 4AXOA 3WHTA