4COVA

Crystal structure of epithelial adhesin 6 a domain (epa6a) from candida glabrata in complex with gala1-3gal
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
230
structure length
230
Chain Sequence
GWTDPTEFPLGCSPNVTTPKNGLSMELYSYDYLKSGSNPCWDAAYLDPNYPRTGYKSHRLLAKVENVAGNINFYYHAPMGCTSLFDTLPQAYNYRTPLTMTNFTMLLYGYFKPKVTGYHTFTISADDLLFVNFGAGNAFDCCKRESSADDFGNYQAYAVWGSQTAKDDLTVHLDAGLYYPIRIFFNNRDNDGALSLTLKTESDPNPVIDFSDYFYSFDDTKDGCPGLVSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL ADHESIN 6
publication title Structural Hotspots Determine Functional Diversity of the Candida Glabrata Epithelial Adhesin Family
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 60
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4covA00
4AHXA 4COYA 4D3WA 2XJUA 4LHKA 2XJRA 4ASLA 4AHZA 4AHWA 5A3MA 4AHYA 2XJTA 4AFAA 2XJQA 4AFBA 4AI2A 2XJVA 4GQ7A 4AI0A 4CP0A 2XJSA 4AF9A 4AFCA 4LHNA 4COUA 4A3XA 4LHLA 4COVA 4AI1A 5A3LA 2XJPA 4CP2A 4COZA 4CP1A 4COWA 4AI3A
chains in the Genus database with same CATH superfamily
1X82A 4PDWA 5JWPA 5GLWA 2A3YA 1OKQA 4KGQA 4XCBA 2WNOA 1OH3A 2GALA 5FZOB 1C8NA 3L2HA 4A6OA 3DPRC 2Z42A 5L36A 1Z7S2 4K40A 4Y26A 2GMEA 1KGYA 1KJRA 1UWWA 5JI9A 3HQUA 1XU2A 4WM8A 1F35A 4LBJA 1IKQA 3SKVA 2XHNA 1K5MC 4YZ4A 2WAAA 1IG3A 1OHFA 1YFXA 4IV3B 4PI2A 2UURA 1JZ2A 1PVC2 1VBE1 2X5IA 4BLIA 3WDWA 3DCQA 5FLIA 3DKQA 4GJYA 3RPQA 1DYKA 4ARXA 3MLJA 5LA1A 4I02A 5FBJA 1R64A 1ZZBA 4MX3A 3H1YA 4L0PA 4W6XA 1XPWA 1CONA 2IXCA 3T2OA 1DQ6A 1FMD2 2R042 3EO6A 2RMU3 3CHXA 4Y4RA 3POIA 3NV4A 4AQTA 4CEWC 1E5RA 3AZWA 5FZDA 4MGSA 2E9QA 4LLOA 4BH9A 1F2NA 2RV9A 1WW5A 1LHWA 1QEXA 2MEV1 3NKGA 4MGTA 4CP9B 1U5YA 1DDLA 1RUE1 2CTVA 2XJQA 1HRV2 5BNPB 5JSPA 2E7AA 1VBD2 3K75B 4F3JA 1TE1B 3OUHA 1NXD1 3N9MA 3Q8BA 2IXJA 4K1YA 4B8EA 1CD3G 4R4ZA 3DYOA 1QH7A 1ENQA 1RUH2 2ETEA 3DKWA 2A71A 1AVBA 1V9U1 1AHSA 2DVGA 4AI9A 1REEA 5DAXA 1SPPA 2VMDA 4COZA 2R0HA 3S30A 5JOYA 3LD8A 2VG9A 4ET7A 3E1F1 5A7NA 4JRLA 4XJAA 3O1SA 1COV1 3ZFGA 1TMF1 2C6SA 3Q8FA 5F5QA 1XSRA 3WF2A 1XNDA 3O1OA 1UZVA 5A1AA 1RJ8A 4OQ8A 4NMIA 2YBKA 2ZGTA 3JD71 4CCDA 3VD4A 2B5HA 1W6MB 1IQDC 4HBNA 4R9CA 4C91A 3ZSLA 5CG8A 2MPFA 2OPWA 5FPZA 3OY8A 4C8DA 1ZYBA 1SLTA 5AFEA 5HCAA 3WP5A 1AR92 4LHLA 4QHOA 5M0TA 2P17A 1YQ6A 1VBE3 1HRI2 2GNTA 3BYWA 1W0NA 4CEYC 4AZZA 3IMMA 5JVVA 1B35B 2VR4A 4DEVA 3PTRB 1NA1B 2LROA 2VCCA 2HEYF 2PMWB 2W0XA 1W2NA 2WYSA 5I0UA 4DXTA 1DU3D 1AYN1 2BJSA 2WNVC 1IS5A 1V70A 1Y3TA 3N9PA 5FZGA 1XSQA 2RM21 1LOCA 2CAVA 3VBOB 2MEV3 2V4AA 3M3IA 2PA7A 2W2IA 4OHYA 3V65A 3MPBA 3LB9A 5IWFA 4CDQB 3RDIA 1JYVA 4BM8A 4FVVA 2O1QA 4PCRA 2Y33A 3WX5A 5HCBA 4FOYA 5KHIA 5E89A 1JYNA 4XJZA 2FDGA 4EWEA 2H0BA 2DUPA 3MW3A 4HXCA 3AX4A 4XFIA 1U5IA 1VBA1 5ABJA 1LESA 1V9U3 4BQ4A 2HWF1 4XFGA 1MVEA 2VCBA 1JOPA 2XVKA 4XW3A 4EN7B 1KRIA 5FXWA 2D40A 3E5QA 2DUOA 2AC1A 1HXS3 4AW7A 1REFA 4L92A 1COV3 4AI2A 1DZQA 3MIFA 1Q43A 2ZGKA 2VZVA 3CZJA 2BERA 1RUD2 2DCTA 2PHUA 1H1AA 4K6BA 3T4VA 5JZGA 4Y3OA 2PAEA 3JD73 5KHJA 3LOBA 2YFZA 4QXKA 3ZFFA 1GYKA 3RZKA 4WVWA 2W1QA 1AZDA 1Q8QA 1VAKA 1DLCA 4GULA 5EWSA 3VBFB 4CP2A 3WW4A 4RGAA 4WBBA 3OSDA 2W47A 1AR71 3NO8A 2VBBA 4NJ4A 2D5HA 2XB6C 2VXJA 1S0FA 4XPVA 5F3EA 3T1MA 2E51A 3E5UA 5DAWA 1LKNA 1QOSA 3BB6A 4JDMA 1IHMA 3K4ZA 4XMAA 2BEOA 1VRH2 2QQVA 2NM1A 2J1UA 1AYN3 3O0WA 1KXGA 1O59A 1SLCA 2JDNA 3BTAA 3OUIA 2PYTA 5L7OA 4M4PA 1WBFA 2RM23 2XOMA 5FYUA 2P1BA 1C5HA 2ZZJA 4LORA 2PELA 3A7QA 3KZ4C 5E88A 5F8PA 3A22A 1HN0A 2YZ4A 3B9IA 1W28A 4XQ4A 2YBSA 1QGLA 3I3QA 3SC7X 3UKNA 4YW1A 2X53S 2Q5TA 1V6IA 4WM7C 5T54A 2UWAA 2C4XA 1VBA3 2PAMA 2YC4A 1W8OA 2HWF3 2VQTA 1DLLA 3AP4A 3KGZA 3PJQA 5CKMA 5DDJ3 1CAVA 1MQTB 4EZ4A 2YPJA 2ZBJA 1Q8PA 3CJXA 2FDHA 3CBNA 2BNMA 2JIJA 1PK6B 4QKBA 2XWJB 2ILMA 2ZGQA 1QY4A 2WT2A 2Q1MA 4IERA 4LE3A 4ONUA 3NMBA 4QKNA 5LATA 2Q1ZB 1UY0A 3BVCA 2RR12 5LK5A 2JJ6A 1AYM2 2P3JA 4DRVA 3C3VA 3DPRA 4RS5B 3USUB 2C9KA 4QDSA 5HCFA 3C7GA 3HQRA 4MXVA 4QT6A 2XWBB 4QX3A 1CAWB 1L7RA 3NV3A 2VOVA 5JR2A 1W04A 1RVF2 2IWGB 5C3RA 4XYXA 1JUHA 1PM4A 5FOJB 4Q29A 4WVMA 4RYDA 1AR73 4GKXA 1Q5OA 1HKDA 2JIGA 1W06A 3T2QA 3N3HA 3HD8B 4E27A 1ODMA 2J1VA 2E7TA 3GDBA 1YFUA 4HK9A 1W6OA 4AYUA 4ZU7A 1VBB2 1XXNA 3PUIA 1O5LA 5JXGA 3OOXA 3F2ZA 4NWVA 1C28A 1LJ7A 3C7HA 3PU8A 3AL5A 3KMHA 1S55A 4JC1A 1UY2A 4QPIB 1YHFA 4XQWA 2R49A 1NCRB 3WVJA 2YV8A 1J58A 1UX6A 2VGDA 2R7EB 2Z5WA 2WZ8A 3BCWA 3ZIXA 2QQJA 1B09A 4DXZA 4N9HA 1U12A 1PX4A 1WMEA 2NMNA 1VBC1 4HN1A 5IUQA 1YNAA 5FY5A 3D5OA 1LOFA 1L7QA 3KV4A 5JIAA 2PN5A 4HT1T 1WUVA 1RGSA 1QJY1 2A7AA 2OXBA 5LBFA 1QIQA 2Q4SA 3W5MA 3SH4A 4DOUA 1C1LA 3LZZA 5IHRA 4H2AA 4Z2WA 3KV6A 2BNOA 1SLIA 1D4M2 2D44A 1RHI2 2Q0AA 2XLFA 5DZGA 4OMCA 4CXWA 2QTWB 5T5LA 2DCKA 2KR2A 5FZ8A 1ND3A 3POSA 4FPFA 2RS31 4BQWA 1PHMA 3T09A 1XBFA 5K0UB 3I59A 2VZUA 4BISA 1STMA 2Q8DA 2P6CA 1GSLA 1YIFA 3WUCA 4GWIA 4ZONA 4W6WA 4CU6A 4DUXA 1UQXA 5CKQA 1N3QA 2ENRA 2AYHA 1S2EA 1LECA 3K51A 4OHWA 5A33A 5A3NA 1AR82 5GZFA 4MSVA 5FWEA 3NVCA 3TN91 1QJU2 4IEZA 1XE7A 4ES9A 4QQ2A 1DG6A 4XBLA 3AYCA 5FOBB 4UFJA 4P5YA 4QB2A 2WO1A 4LBKA 1LHUA 5A7WB 2BPA2 3QH7A 5FJHA 4KL1A 2HEVF 3SEPA 4IE5A 4R9DA 2WNVA 1DZTA 2VZTA 3MFAA 5CU1A 3ZVXA 1AR61 2HEWF 1JZ5A 1NCQB 4XFBA 2UY8A 4IEQA 3GHMA 4UFIA 1VB4A 2RS52 3WNOA 5SV5A 1XB9A 3THTA 1WBLA 2X8KA 3WDYA 1EP0A 1X8EA 3S7IA 2RJLA 3KF5A 4XJUA 5KWRA 3RZJA 5FMOL 3AMPA 3KQRA 1QJY3 2JICA 1IQAA 4FFIA 2P2KA 4LO8A 4QQHA 5EXOA 5BNQA 5IVBA 5J3UA 3FBMA 2E32A 3PIJA 1PMHX 1BQPA 3E6BA 1O4ZA 1VJ2A 1DQ1A 3WCSA 4P08A 2DVDA 3ZOIA 1SLAA 5K4LA 1MS5A 5F39A 1RC6A 2WS91 5SV8A 1G9AA 2VZRA 5LA2A 3RSJA 2WQ8A 3MZHA 5H9QA 1XJAA 3MIDA 3PDQA 5GLTA 5I0SA 4LMFA 3CDZB 4ZPIA 3BTXA 2VAUA 4PLNA 4P9LA 4QWNA 3WW1A 3HN1A 1JU4A 4QHZA 5TSWA 5GZGA 2LTNA 5T52A 1WD4A 1ZBE2 1PGL1 2ZX0A 3IDAA 1DBNA 1I6XA 4W6YA 2XL7A 4G4FA 4B4QA 1Z78A 3LEMA 5EIYB 1NQDA 1O7FA 1RUOA 3GYDA 4GJZA 1W39A 3ZSJA 1ASJ2 1AL22 2VCMA 2ZEYA 3T0AA 5DG2A 3VBSA 4GKYA 2JG9B 4KNCA 5GKAC 1ZBA2 1W0PA 2H6BA 3HQXA 4LKSA 1F9KA 4MV2A 4Q8LA 4RL7A 3VLBB 4BWOA 4CCEA 4E2QA 1NLRA 3FL7A 4FBFA 4GIQA 2JG8C 4M3CA 1LAJA 1AR63 1DHKB 5CBLA 4OHXA 4GWJA 1S0GA 3S5AA 1A34A 5F6KA 3DYMA 4V2VA 5C8CC 3NJXA 1GR3A 5A6YA 4V2WA 2AZ5A 4Q4V1 1BEV1 1BBT1 4AOCA 1ENRA 3ON7A 4AGRA 1SFYA 3AFKA 4RQPC 4E2GA 4Z07A 2RDNA 2QVSB 3BODA 3KF3A 5F7UA 1EAH1 3WG3A 1DGWX 5D2AA 4AF9A 2OVUA 3UGHA 3ZO0B 1AX2A 3T1LA 1E5SA 4BQ3A 1OKOA 3IN9A 2WN2A 4JV4A 4XFHA 5CFDC 2C0ZA 5FYBA 1A3KA 4JHZA 4XBQA 2JECA 2R072 4P5HA 3H8XA 3CJIC 3FHAA 3GZTB 1R091 4FQZA 4IW3A 4RSUA 5FMOS 3WINE 2WS93 2D93A 3ZYHA 4PIXA 3LEGA 1PIV1 1O3QA 3O5SA 2WFF2 3DECA 3PVBB 5FFOC 3QH6A 2VECA 1QQP1 2W92A 3LSDA 2VC9A 4OZOA 4OHZA 2XMLA 4LXLA 3V0AA 4Z92B 2BWCA 3ZFEA 4DO0A 2XKPA 2JEMA 5C70A 5F1RA 3H3LA 3FMGA 2R061 3H7JA 5BNOA 1ONAA 3RNSA 1HV0A 3RYPA 3GJBA 5B4NA 1GQHA 1OI6A 1D4VB 1XU1A 2N7GA 4J1XA 1N1VA 5KHGA 4P9JA 1G86A 4NR1A 2QUOA 2VOKA 4RHV1 2O8OA 5AVAA 3ZSMA 4AQSA 3GBFA 5FYSA 3UKTA 2JDHA 5FIXA 4NPRA 3POFA 2LW8A 3CQOA 1LODA 3LSEA 5A1LA 5CISA 2IXIA 2TEPA 4Y20A 4CTEA 1QNYA 2W52A 3IM0A 2ZGOA 4AEDC 4ASKA 1Y9GA 2D6PA 3K4AA 3WHUA 2YPDA 1HJFA 2D6LX 3LA7A 3PLQA 3VD9A 4HSJA 4Q5OA 2ZKNA 4M3CF 1HQNA 1ZZ7A 1DQ0A 4X8PA 2AH2A 3U14A 2OW4A 4NIHA 1EV11 2VTXJ 2GC1A 1EAH3 4YW2A 3WG2A 1CR7A 4Y1YA 4UFLA 4AG4A 1F5JA 3U11A 3UL2A 1WMXA 4Y22B 3O0VA 4CU9A 3U75A 1H2NA 5JOZA 4HVRA 1UPSA 5IATA 2ZKLA 2YB7A 3A4UA 4EWDA 4WVZA 4DPNA 4QXBA 2HWD1 1PO11 1W6PA 3VL9A 3N7KA 3RZLA 1W9YA 3VDAA 1KD7A 3DEMA 4N53A 2HWC1 3MBWA 4GB31 1J1TA 4XJWA 2XH6A 2Y26A 4CEYB 3T0DA 4XUQA 5FLJA 5BYNA 2A6VA 2R063 3NJYA 5F2WA 2TBVA 2IUWA 2AREA 2PLV2 2WR9A 2GC0A 3PMSA 1S2BA 3HNYM 5DAQA 1XE0A 2VZ1A 3S7EA 1PGSA 4RHV3 3ZKUA 2JDUA 4ISRA 1QNWA 3N36A 4N7UA 5KXDA 3KT1A 1LHNA 3JUUA 2LS6A 4UW3A 1TME3 4WZFA 5H9SA 1AJKA 2VNRA 3MIGA 4JTNA 5IK8A 3ZMNA 5A3UA 2BOJA 2CL2A 2XBO1 5DAPA 2F4LA 1F5FA 4R4XA 5D8AB 5FR3A 2Q30A 3D4KA 3GCWA 4Q1RA 1K12A 3VBHB 1YC61 4L8QA 3AXDA 4H7MA 3W9AA 4OFGA 4MGYE 4JRAA 4HOOA 3HOBA 1K42A 1ZA4A 4AVBA 4DXRA 4Y33A 2RJ2A 2ZX1A 1HQWA 1SFNA 4LKFA 4M01A 2W08A 1EV13 1PNFA 1UL9A 3D0SA 3POGA 4KG8A 1OF3A 5FMBA 4E2SA 3QACA 3JBG1 1R1A1 1HJGA 1ZZCA 4QXHA 1OFSA 1HW5A 1XNBA 4K7JA 2FMDA 4WZCA 1UXZA 4K9SA 2PQSA 4XURA 4UYBA 3GJAA 3BGAA 1HN1A 1RUC3 1ND2A 5BNNB 5IVFA 2H6CA 1SHWB 3HT2A 3I97A 3WZ1A 2D43A 2HWD3 2BNNA 4YGBA 1PO13 4META 1XNTA 5FYTA 2HWC3 3R05A 4GB33 4AEKA 1LNSA 2DCJA 2GNBA 5F37A 2NP0A 4AEMA 5HXMA 1VRBA 3E97A 2LUWA 5FO8B 4LBOA 2BBAA 1JTZX 1UU6A 2VZOA 4OULA 1OA3A 3KLSA 3M1HA 5CYYA 3N9NA 2RS12 2VMCA 3W21A 1PO23 1W2AX 4I30A 2ORXA 2VO5A 5FUPA 1QH6A 4CZSA 1O3TA 1NYWA 4I2OA 1ZZ6A 4GH4B 2EAKA 1QJX1 2YUEA 4LTAA 2WNUB 3J7MA 4OCTA 5ABJC 4CDWC 5FMCA 1H2MA 3V64A 4LEJA 2XBO3 4L99A 3MLKA 2XJVA 5IYYA 4CCKA 2GMMA 2Q1FA 5DUWA 1X8MA 1MVQA 4RA0A 2WL1A 1GMMA 4XF1A 3VZLA 3K46A 1JXNA 1O8PA 2WNEA 3HR9A 3WOGA 2WZPP 1QF3A 4UXAA 2JB8A 3O1UA 1S0JA 2JENA 1FPN3 1FAYA 5A70A 3ZIWA 5FTTC 4HSLA 1WMDA 2ZJCA 4A7KA 3MW2A 5JZGC 2UU8A 5IVJA 4ZS2A 4XJ8A 3ILRA 1F31A 4FQ4A 3ZFFC 2OX0A 3MO4A 3S0MA 3JBG3 2A6YA 2J22A 3VBOA 5AC91 1R1A3 3RZMA 3O12A 3UGGA 2V09A 1TEIA 5CZKA 3TYJA 4XUTA 4CUGA 3J8F3 2WC2A 3BPZA 2W5FA 3KSCA 1U5ZA 4LIUA 4QGNA 3BU7A 3UK9A 4C1XA 5AFBA 2QNKA 1UY3A 3PUAA 3PIGA 3IB3A 3RVHA 4Q4Y2 4CP0A 1J1LA 4PBOA 1XE8A 3B93A 4MUVA 5LBEA 4W8JA 4Q26A 4XF4A 3VKFC 3WP3A 1S0DA 1LGBA 1NY72 4MADA 5FZ0A 4A44A 4C90A 4YZ1A 2GC2A 1BCXA 4V1PA 5FP3A 4URAA 5A3LA 1BHGA 2CWSA 2E7QA 4A2UA 1W6NB 3O14A 2CDOA 2XQXA 3K77A 5FO9B 4IGOA 3VKOA 2JWPA 5APAA 4NIGA 4ATFA 1PGW2 2V72A 1KFUL 4E4DX 1FV2A 4X6QB 3IPVB 4EN0A 5ANQA 2DURA 3NWKA 5A3OA 1GOGA 3ORJA 3HWJA 4D6SA 3WEZA 2Z2SB 5A32A 5I8SA 5DUUA 3VV1A 2SLIA 1O6UA 3B00A 1Q56A 2OT7A 4XTMA 4Y24A 4AFCA 1H8TA 4Q1PA 1VMFA 1UX7A 5DQ0A 5HI0A 5HPOA 1SLBA 3C7OA 1RUG2 1HLCA 5CB7A 3ZXDA 2I07B 2YBPA 5IK5A 1ZRDA 1LU2A 2K0GA 2P34A 3H1MA 2G1MA 2OYZA 3NRUA 4UFMA 2VD7A 3EQEA 4HL0A 4KQ7A 4P9GA 1APNA 3WV6A 3CO2A 3BTZA 1G8WA 1FMD1 3KQ4B 2BVVA 5AC93 2WWJA 1O5UA 2B42B 3AMMA 5EPAA 1EY2A 1PMIA 3TBDA 5KC5A 3R4DB 3I49A 4MOAA 1O91A 1AXKA 1QJFA 1CQ9A 1K45A 1Y4WA 1CN1A 2VNVA 2Y8KA 3UGFA 4UF0B 1OFNA 2DUQA 4ZZ5A 4XFFA 2YXSA 3K3OA 1VBD1 4LO5B 4YW3A 4CU8A 1WLTA 3ALQA 5C5TA 3U4XA 3J7LA 3FC0A 1HB4A 4QPYA 3HAGA 3WNKA 1MQTA 1RUH1 4PLOA 3VBRB 1I1EA 1IS3A 4TXWA 1PK6A 3OGSA 1DCSA 1KDMA 2P3KA 4XMIA 3J26N 3PMEA 4AHWA 4QPWA 1LOAA 1OA4A 5FPBA 2A70A 3MPPG 2W1WA 1SDWA 3KCYA 3PTYA 5FCCA 4LIVA 1LOFC 2E33A 5EZWA 2WZEA 4OYUA 3JQXA 1GANA 3KB5A 4GA9A 3E5XA 1BKZA 2Q8EA 4K3UA 1VP6A 1Y9MA 4FOVA 4RN5A 3VDDB 4UFKA 4TZDA 2W68A 2FZ2A 2EALA 1HXS1 4WV8A 1AR91 2ARAA 2AR6A 3T2PA 4CVUA 1NLQA 1ND3C 1VBE2 3ZPOA 1HRI1 1PMJX 4G9SB 1SDDB 4L2NA 4YVWB 5FUIA 3DN7A 1ZRCA 1WZXA 4AHYA 4XETA 1GOFA 4L9BA 3JB8A 1C8M2 2GP5A 1FMD3 1T6GC 2ADDA 4HANA 4QPIA 4XC9A 1NCRA 2KD7A 1GZWB 3ENRA 3NQHA 3ETPA 3DXUA 1OBNA 3GM8A 4JGYC 5FZCA 4CDUB 3B3QE 2MEV2 4URTA 4DIQA 2JKBA 1POV1 2YFUA 5FXVA 3RYKA 3WNPA 1RUE2 4HPKB 2QDRA 1VBD3 5FYYA 4KBBA 4MO3M 2GSYA 5CFCA 1LCLA 1RUH3 1RMU1 4UW4A 1WCKA 1V9U2 4AHZA 4QD2A 3WT3A 1K5JA 1Q8SA 2WA4A 4N43B 2ZXQA 1BZWA 2W1UA 4RR3A 4NIIA 2DFCA 3VL8A 4NRQA 4L97A 3VBUB 3CL1A 5KXCA 2VQAA 1UZYA 1ULEA 5KHKA 1NZIA 3D6EA 1COV2 1LGCA 2QQKA 2JDZA 1TMF2 2PTMA 3AP7A 3LKJA 3RRDA 4XDOA 5ISLA 2WINB 4CPBD 3MYXA 4BQYA 1JU3A 4DUWA 2WWUA 1U0AA 2CDPA 2QQNA 1W8ZA 1WLCA 2B4KA 4QX8A 5CNAA 5DDJ1 5I0TA 1G9FA 4YFWA 3SLIA 4HVQA 5IVEA 3JD72 4IEPA 2IC1A 2GAUA 2WBKA 4Q0UA 4YVSC 4QPGB 2VW0A 2HJIA 1DQ2A 2PQQA 5DN2A 1AR93 4UT5A 4QHBA 3VDBA 3A21A 4Y5Z0 1HRI3 1H6YA 4IEOA 3M7AA 4FXKB 1ZX5A 1MZ5A 1WCDJ 4GQ7A 4P9WA 2WYFA 5ACA1 3LF7A 3B9CA 1WCQA 1VR3A 5C4WC 4IXLA 4QGMA 1RUI1 3T3YA 1UXXX 3NAPB 4AFMA 4BPZA 2RM22 4CDXB 1JS9A 4MGIE 3I2IA 2CU5A 3K48A 2FMYA 2EAAA 4JAAA 4OZXA 1JODA 1POV3 3WQ7A 1SZBA 2A73B 4IE7A 4D3WA 3OB8A 2W95A 4JKLA 2XJUA 4KWLA 5JMOA 4AAPA 4I01A 3AZVA 4NRPA 3VBSC 3KGLA 3HBKA 3L9JT 5CFCC 1OLRA 1KS4A 2DWRA 1RMU3 2D97A 2DBIA 2J1AA 4XILA 1OUXA 2AENA 2HWF2 1V0AA 4Z1VA 2D6NA 4E9KA 5IVVA 1Q8OA 4QDRA 5CG9A 5A7OA 2PHDA 3P3PA 4XXAA 3KHBA 2HYKA 3PVEA 4P9YA 3ACIA 2ZMLA 4N7IA 3NNLA 2Y6FA 1DQ4A 4UW6A 5A3WA 2BGPA 3JQWA 5KC6A 1WLDA 4CP1A 5KR7A 2XLAA 2W91A 5FPVA 1YJLA 4PDWB 1X33A 4YNIA 1M4WA 2YG0A 5BXXA 4DNYA 1CAXB 4EN9B 3IAQA 4O7XA 5G05L 2HKXA 1H4HA 4DS0A 5FZ1A 4CUBA 4WM8B 4Q4X1 5FY0A 1DF0A 1AR72 2VNOA 1LOGA 5KHHA 3GBWA 2GN3A 4NVPA 1J3QA 4W50A 5KBFA 2WDBA 1LEMA 1UKGA 3H8UA 3M3QA 4AI3A 5FZ9A 3G7DA 4LPLA 1A8MA 5IVYA 2XHKA 1F4AA 1C4RA 2FDJA 2X5IB 2YDEA 3H1WA 4LO6B 3WHTA 5FLHA 3ZFEC 5ACA3 1JYIA 1ZREA 3IBMA 4D7TA 3FWEA 5LBCA 1BYHA 2NLRA 4X6RB 2QDNA 3S5QA 3WLUA 5BNOC 1RUI3 5I93A 5FXZA 1IKPA 2VTXA 4FPYA 2FHRA 4HETA 5HV0A 4B29A 3ILNA 2FDKA 4BIOA 3FLRA 4OI1A 4YZ3A 3AK0A 3U07A 2YC0A 1EPZA 4FTEA 3JU9A 3I3DA 4LBNA 1N47A 1QXRA 5H9PA 1DYOA 2QQPA 1DGWA 2VZQA 5DAVA 2PHFA 4TYSA 5K8SA 5C9AC 2R1BA 4YM3A 5JPNB 1BK1A 3KS7A 1JH5A 2WSVA 1V6MA 4FPGA 1VAVA 4E4SA 4NE9A 2ZX4A 3N9OA 1UAIA 1WW6A 2E6VA 2J7MA 1SPPB 4IV1B 4COYA 5CKNA 5FZEA 3CKHA 2ERFA 4EYUA 1ZZ8A 2AEYA 1CX4A 4J25A 1AYM3 1FATA 1W99A 4LO7A 3ZFGB 4AQ6A 3PUHA 5C3SA 1G7YA 3ZYBA 2PHXA 4S2FA 2PHLA 3FUQA 3OTFA 1QHDA 2UYAA 1AJOA 4A3ZA 4JQTA 4Q4X3 3RWNA 3LCPA 4EZHA 5JOXA 4XHXA 4GWNA 1O8SA 3AYDA 4C0BA 4ZZ8A 3OY8B 4COVA 4N53C 4CUAA 4Q8KA 5KXEA 1OLME 2VVEA 1JYTA 3WF3A 2A3WA 1VBB3 3WDXA 4F7ZA 2YY1A 1POV0 3BOPA 1VE0A 1C57A 2BW8A 4IEUA 3V0BA 1W8NA 3INAA 1OOPC 5FPAA 1IPSA 3T4HB 4KWUA 2WKKA 2AEZA 1TQ5A 1YYNA 2OS2A 3H8OA 4LK6A 3Q8EA 3IMNA 4JGYA 1RUJ1 5G04L 5FZLA 3ZM8A 3UNPA 2EIBA 1FNYA 5IJRA 5A1FA 4JGZB 2A6ZA 4LHSA 1ZRRA 5EV7A 4CUCA 5FPXA 4IEXA 4ATEA 4BB3A 1VBC2 5FP7A 4QX1A 2E26A 1SG3A 4YPJA 4FOWA 5J1XA 2WT0A 3Q8AA 1QJY2 4LJHA 1HIXA 4ES8A 2VBPA 1A6CA 5C6CA 1WGPA 1I5ZA 2JE8A 4UI9L 4TLGA 1A78A 5ABJB 5JDBA 2Z69A 3O1PA 3OUJA 4UWDA 5GLUA 2XUMA 3ZXAC 2Q8OA 4OLLA 1LEDA 1VB2A 3WDVA 3S57A 3LPFA 2RS32 2C5DA 2VU9A 3AYAA 3K2OA 3X29B 5D21A 1YI9A 3LA3A 2ADEA 2BU9A 2WO2A 5BNPC 2VBDA 1MS0A 2K9ZA 3M8LA 3IIAA 1GUIA 1ND2C 1JOJA 2W3JA 2UYBA 3NNFA 1OD3A 1XOYA 4YVSA 3ZFFB 1E57A 1NQJA 2YU2A 3LA2A 5IAVA 4PLMA 4UOJA 2BP6A 1EUUA 4HKWA 3P1IA 3TN92 1SBDA 4EN8B 1RL3A 3I3MA 2FCUA 2JDKA 1QJU3 1AL21 2X10A 3VBHA 3GHNA 4I3PA 4RD7A 3HJRA 1W6QB 3KV5A 5I0DA 2CYFA 1ZBA1 3NW4A 1OUSA 1N3PA 4P9IA 1LHVA 5LRSA 4BZ4A 5C4WA 4E4ZA 5DZFA 1VIWB 3RYRA 3RG0A 4W65A 1TVGA 3I2OA 1HB2A 1RUJ3 5L7OB 1IS4A 1SCSA 2UWCA 2Z4FA 5FY1A 4A3XA 2P37A 1W8UA 3FHQA 4EV0A 2IXHA 3AJYA 4QKDA 4M00A 2HWB1 4FPEA 1D0GA 3OBTA 4KU7A 1MEC2 1REDA 3BN6A 2HWE1 1J84A 2DTYA 3PUQA 3RMYA 1FI2A 5BNNA 1B35C 5LRRA 3OYWB 3ZN4A 1NA1C 3TAYA 5GLZA 3ZLIA 4XACA 3RI8A 4O9EA 1XYPA 3DYPA 5FMDA 1MS9A 4MHUA 4LT5A 2OQ6A 4W4ZA 4GXLA 3DUIA 1XQNA 4IE4A 2P6HA 1UD1A 3EJKA 3BU0A 1LENA 3VBOC 5JSOA 4XAAA 1FOD1 3IIIA 1IZ3A 5LY1A 1JUIA 4LK7A 5FUNA 3GXUA 4CDQC 3MIBA 2UY9A 3KCXA 4M0HA 2EXIA 3I3EA 3CZUA 3DPRB 5FYVA 3POYA 4D94A 4GZ9A 1D2QA 1R082 2D7FA 1K5MB 1CZVA 4YW5A 4WVMB 4XCAA 2DTWA 4RGGA 4BDVB 3T0BA 1ASJ3 3SHRA 1AL23 4FTSA 4NHLA 2WN3A 4NO4A 3B7MA 3OG2A 1RXFA 1CX1A 4CYDA 1FNZA 1ZBA3 1W6OB 2ZZQA 3NV2A 3MDPA 1JZ7A 4NPMA 3NKTA 2P3YA 4XAEA 2QFEA 1J3RA 1OH4A 2D98A 2O14A 1UN1A 1NE4A 1ULDA 1W8WA 1G6NA 2EIDA 3KVBA 4CEWB 1YQ2A 3EHKA 4Q4V2 1BEV2 1BBT2 3M3CA 1TME1 2GMPA 4A41A 1WD3A 2HWB3 1H6XA 2AGSA 1WA4A 2EXKA 1H8TC 3URFA 3AMNA 1MS8A 1W9WA 3OGGA 1MS3A 4BQ1A 2HWE3 4Q27A 1UNBA 4A45A 1TNFA 4AVTA 3T2TA 3ZN6B 5C9AA 1XNCA 1NXMA 2GH2A 2WT1A 2G9FA 2BGOA 2R073 3DL3A 1R092 1EPWA 3GZUC 5FP8A 2J42A 1YQCA 1ST8A 2WQ4A 2YU1A 2ZEXA 3OF1A 4Z82A 5F6LB 3ETQA 3RGBA 5EHDA 3B5LB 4DEQA 4FAGA 3HIFA 1PIV2 2W46A 3JCIA 1SFPA 1W0OA 1JHNA 1YI7A 2ZGPA 5FZ7A 1FOD3 1QQP2 3APBA 4D69A 5JXIA 1IS6A 3EB7A 3M3EA 4BK4A 3AP6A 1ND3B 4COWA 1S2KA 3ATGA 3W59A 1UOJA 3H3ZA 1ZVFA 3IPVA 1OC1A 2R062 5F5CA 4Q0QA 1GICA 1CVNA 4ASLA 1RUC1 5IW0A 3I2HA 1UMZA 2CAUA 1I3HA 3OPTA 5A80A 2QZ3A 2GC3A 1FYUA 1MQTC 1UU5A 5T55A 5DUXA 5GM0A 2I45A 3N35A 4H7LA 2EXJA 3I4IA 3PU3A 1PK6C 5A33B 3TRSB 4Y1VA 3LEIA 2BFUL 3AKRA 1ODNA 2X29A 3LQCA 3AP5A 4YGDA 4D0QA 1M06G 2CWMA 1LULA 2XUEA 3MLLA 2XVLA 5CADA 2IFWA 1OOPA 1QU0A 1X9TA 1PO21 1UZZA 3EBRA 1S4CA 2B46X 2G9ZA 4F83A 1FV3A 1OPMA 5FZOA 2WNVB 4RS5C 3N9LA 1PZ8A 2IXLA 3WF0A 3MV11 4FAHA 3TEZA 2WJSA 3F95A 2Y0OA 2I2SA 1GP4A 3MFCA 1V6NA 1EV12 2ZTNA 3M3OA 1W8TA 2OZ6A 3R4SA 4IV3A 3JZVA 4K1ZA 3B01A 4AI8A 4ZHNA 2GU9A 4HMZA 4XZPA 3VZMA 3NJZA 2CNAA 4NHYA 2BGCA 2R0FA 3U10A 4FPLA 4UF0A 4ZS3A 1RXGA 4EROA 1KDKA 1UMHA 4FI9A 4IL7A 1FPN1 4QDQA 4XUNA 4B4RA 3KV9A 1BK0A 1YIPA 2HWD2 5FK8A 3VHOA 3POWA 4JDOA 4QPIC 1DQ5A 2XVGA 4PF1A 5LW9A 1UIKA 3VN4A 2HWC2 1NCRC 4QX2A 4GB32 2WABA 4RFT0 5J36A 1CGPA 1O4TA 1NOVA 1X7NA 4GWMA 1H30A 1UPIA 3AZYA 4CP9A 1JN2P 1RUNA 5I8TA 3BALA 4TLFA 5BNPA 4LKDA 3J8F1 1RIRA 3WY6A 3VDCA 1BJQA 1W05A 2XJTA 4O61A 4PIYA 2PLV3 2PAKA 4BJ0A 2BRTA 1Y9QA 3LFMA 1WKYA 1YEWA 5CVRA 2VZPA 3OGVA 1W8FA 2VZSA 4BXSV 4JHTA 4QB1A 4LHNA 3FFQA 3SH5A 1BXHA 1UO9A 3ES1A 3VDDA 3NL1A 1QDCA 2EA7A 1UY4A 2XBO2 4ZU4A 2F4PA 3WR0A 2XQRA 1V6OA 2E63A 1H4GA 3I2JA 4K21A 3O1MA 4DY3A 2OKXA 1QKQA 4RGKA 4RFRB 4RR3C 4XABA 1NLSA 2GDFA 2V5YA 4K20A 3SCGA 4BE3A 2WZR1 2IVIB 2W9XA 5K0UC 2V4VA 4OVEA 2DCYA 3DXTA 4J6GA 1H2LA 1RTVA 1RUF2 2BFUS 3PNAA 4HLTA 4M3CB 3ZKYA 3U0ZA 3QCWA 3W5NA 5T5OA 4J1WA 3J7HA 3SISA 3ZSEA 5LCWL 4CXYA 4MGQA 5EP9A 4AFBA 5FDBA 1GZWA 1W6MA 2Y60A 5C8WA 5J98B 3SH3A 3T08A 5J48A 3VKNA 3OGJA 3WUDA 2WA3A 4CDUA 3VKMA 4BQXA 4ISQA 5GZDA 1R1A2 2A75A 4QM9A 2VNGA 5JSRA 2GNMA 2Z79A 4XBNA 4SLIA 1URXA 4HPKA 1ULGA 5C33A 2QQUA 3LDKA 1B35A 1DZRA 4QGLA 3ILFA 2VUDA 4WM7B 1NA1A 2ZMKA 3FN9A 4NHKA 4YLZA 5AVPA 3SITA 4QB6A 1MS4A 1WWYA 1OVPA 2ARXA 2HLEA 3PL0A 4P14A 4BMBA 1YFWA 3AYEA 4N43A 1H9PA 1NCQC 2PFWA 3MIEA 3PURA 2W94A 2R32A 4A4AA 2IFRA 4NHMA 3FUOA 3JB4C 4CDQA 3AL6A 4NN0A 5FBZA 2YC2A 1UOBA 3BOWA 5ERLA 3E6DA 2BTVC 4R8HA 1J83A 1SBEA 5F2SA 2HBTA 3UETA 5J7MA 1ENSA 1LOEA 3D8CA 1QJX2 3EXUA 1UYZA 3GGLA 5CA6A 5B4XA 2D3RA 5EFUA 2ZA9A 4GMP1 3C2UA 4Q0PA 2YROA 3N4MA 2VUAA 2J1SA 4AHXA 4QPGA 5FYHA 3T30A 3AJZA 4Q4W1 4HFSA 4QX7A 3OBZA 4JX0A 3IZOA 4BCUA 1IGOA 2MNGA 4N8MA 1E5HA 4XUOA 3SCFA 3NNGA 2X05A 5IVCA 1PZ7A 2WZR3 4PI0A 1ULFA 3ZR5A 3FLTA 3GCXA 5H9RA 4Y20B 5C3OA 1N3OA 1RUG1 2B39A 2R6QA 4XIOA 2TNFA 3AC0A 3DF0A 4BQ2A 3CF6E 3UKVA 3NJVA 4KH9A 2C26A 1ACCA 4QAWA 5C7GA 3KHCA 5EJ3A 2UWBA 5FZHA 5LZ6A 4ZKTB 4HZFA 5CEHA 1NX9A 2VULA 4JTOA 1W3VA 1Z7S1 3NAPA 1UZWA 4PIZA 2D6MA 1QMJA 3OBRA 3VBFA 4CDXA 5BUVA 2RDQA 1BMV2 5AC92 4XDQA 1J3PA 2Y64A 3GF6A 3LOIA 1YCIA 4JCKA 2A5ZA 1GP6A 1RJ7A 1UOGA 4CCMA 4X8NA 1V6KA 1RYYA 4A6SA 4XXPA 4CRQA 5F3CA 1PVC1 4ARYA 3POJA 2VOXA 1YRZA 1UCXA 2VTFA 1PX3A 2G4IA 3GBGA 4PF5A 3N7LA 1S0CA 4MYEA 1D0HA 1IPKA 2R041 3J7NA 2RMU2 3WD5A 3AM2A 3BI3A 1W6PB 3H3UA 1N1SA 2RVAA 3Q8CA 2DF7A 5K9YA 2C9AA 2VMHA 5HBAA 4XTPA 5FZFA 1JYCA 2W87A 3CNAA 2D5FA 3U4SA 4ASMB 3OBAA 2FDIA 5DG1A 4LBQB 4WVVA 5E8AA 3FZ3A 3THCA 1HRV1 5CAZA 1S0EA 1OSGA 2RHPA 2WQZC 2Y6LA 3LIGA 4LR4A 5T50A 1T6BX 3OJBA 3POEA 4YM2A 1W3XA 2D6KA 1JZ3A 1CAUB 3ACLA 2DU0A 1OXCA 4GMP3 5JI7A 1OLQA 2IVJA 3HEIA 2DFBA 1CAXA 4LHKA 4TTGA 3M4FA 4P02B 4Q4W3 1O3SA 3L2YA 4B4PA 4Q2FA 4KWJA 4YG0A 5GALA 3ZDSA 4DMIA 2ATFA 2BUKA 3NNMA 4S2DA 2VMEA 1JMUB 1GWLA 1RUG3 3VZJA 2CSGA 3ACHA 1GLHA 2FBEA 1LHOA 2I74A 1HB3A 4LA3A 5F5AA 1JYWA 4AAXA 4RS5A 1UYYA 2C1FA 1MZ6A 3USUA 1XYNA 2BVBA 2VCAA 1Z0HA 2WLPA 1HQLA 1CPMA 1Z7S3 1CAWA 2VZ3A 1C8M1 3TWIA 3ABZA 2A6XA 2H0VA 2NZ9A 5L9VA 1H2KA 4MXWB 2VPVA 4OI4A 5JAXA 2Y6HA 2DYCA 4NOTA 3VUOA 2NN8A 2ZAHA 3AZXA 4MH0E 1PVC3 3K4DA 3MUY1 4LLFA 4OI0A 3V56A 3HBZA 3QD6A 3AVRA 4CE8A 1ND2B 2VJXA 4XF0A 1QJEA 2XG3A 1NE6A 3ITQA 3FX3A 5FPLA 2R043 5FXXA 1H1IA 2D3SA 4MGKE 4ZY9A 4NIAA 2ZEZA 5LEKA 4FOQA 2DV9A 3GALA 3UYJA 2G19A 4PT6A 3BPSA 3RZHA 4UBHA 5F5IA 2RJKA 2CGOA 1E5IA 4IV1A 5FV3A 4G3YC 3WQBA 5JUVA 2FDFA 4BLJA 3EMRA 5EYYA 5FZAA 1OPOA 3N7MA 4LKEA 5LEJA 1HRV3 3I54A 1DGRA 3SKJE 4QU2A 5A7QA 3ZXEA 2YMZA 1GZ9A 3WNMA 4P00B 4ITCA 3FJSA 1H0BA 3HMYA 3HN3A 1UYXA 2ZEWA 3IDCB 1VLNA 4AVSA 4CCOA 2WUHA 5D1IA 4UBGA 5C5UA 1GZCA 5FZ3A 2KM2A 1GOHA 3JXSA 1HXS2 5K0UA 1GWKA 1S0IA 2OIIA 2LALA 3I3BA 1BVVA 2ET1A 2ZGSA 1JYXA 2FZ1A 5C3QA 2JG8B 2Y38A 3WW3A 3H0OA 2D3PA 5FYMA 1RUD1 2VM9A 1DP0A 4NROA 1A8DA 1C8M3 1K3IA 4LBMA 4E8CA 5E6HA 3WNNA 5A6QA 5C8CB 4KBZA 4D8MA 4XHBA 3CEWA 3HVDA 5T5PA 2XKOA 1PNGA 3R0RA 4NWWA 4RQPB 4HG6B 4JGZA 2ZPXA 3IDEA 2EICA 2RDSA 3UV9A 2ZGUA 5FRAA 1RUE3 5D8AC 3VHRA 1CWPA 2B45X 1CESA 2GH8A 2K46A 4KWKA 4AI0A 4CPBA 5CFDB 3TEWA 3VBHC 5EJZB 5A7WA 1SACA 5E16A 2VVFA 4DRRA 1VRH1 4H55A 3CJIB 1AYN2 4QX0A 1RMU2 3AVSA 3ZR6A 2AACA 3SCHA 4YRDA 5LA9A 3BTYA 1NCQA 1IOAA 5FZKA 4IQPA 3MICA 4GMP0 3VGIA 1AX0A 2QQMA 3HNBM 3MEPA 3TEYA 1GU3A 4SBVA 1ZZ9A 5DABA 5I91A 3BKZA 2ES3A 3U78A 5FQ0B 3RI9A 1UOFA 3LEKA 1XNAA 2NYYA 1W03A 3I2FA 2QQIA 1TMF3 2ORZA 3LE0A 4B1LA 2Y0IA 3EYPA 1QJZA 2EXHA 2ZCWA 3BIEA 1X50A 4Q0VA 1H1MA 4MGZE 1OQEA 1VBA2 2XONA 3OD4A 3IWZA 5BNNC 1VMJA 5DDJ2 3ZXFA 1N1YA 4LE4A 5FK7A 5A32B 3QLQA 4B1MA 3C7EA 3MF6A 3AMQA 5B2GB 2ZGMA 1H8TB 4NUBA 2WSUA 1C5IA 1LGNA 2OZJA 1OQ1A 1V00A 2V5DA 5E1RA 1KITA 4JKMA 4OI2A 4AGVA 2CGPA 4AEDB 1UZ0A 4FP3A 4TSVA 1W6QA 3NV1A 1O3RA 3PVNA 2DCZA 2RR11 4FTBA 1RUD3 1AYM1 4HN0A 4BU2A 5ACA2 3CLPA 4M0NA 2A6WA 3H9AA 1WA6X 1UW8A 1WCUA 2QBXA 3I8TA 4GH4C 1RUI2 5T3NA 1SEFA 2CY6A 4HK8A 3TEXA 1ZM1A 3OPZA 1RVF1 2LM3A 4M4RA 2ARCA 2WNUC 3H7YA 4UW5A 1TNRA 4FPHA 5FY8A 3TNPB 5J09A 4YG3A 1EUTA 3I2DA 4LQRA 2JDYA 1UY1A 5DUVA 1HDKA 2RE9A 4DQAA 4R9AA 2F6BA 1XRUA 2JG9A 3AKPA 1P8JA 4IGPA 4AVCA 5JMCA 3PJYA 1VBB1 3HPNA 3HT1A 1LOBA 3VD5A 3ZMOA 1VRH3 4YW4A 5HCHA 1JZ4A 3OCPA 2FCVA 2EIEA 3OYWA 4AL9A 4DUVA 4QMAA 4EWAA 3MHZA 4N9IA 3LIHA 3O0XA 4XIKA 3UJOA 1YUDA 3POBA 3IT8A 5GLVA 3ZXJA 3ZXLA 2DVAA 5FYIA 1QOTA 1DIWA 3RWKX 4YFZA 2RDRA 3TOJA 5IK7A 2P3IA 5FKCA 2CV6A 3WNXA 4I0BA 4JKKA 4FO9A 3P5BA 1R1ZA 4LA2A 3CIHA 2GNDA 2PHTA 3ES4A 1HB1A 5FY4A 2VUJA 3ACFA 4YARA 1WW7A 4AR2A 4DXSA 1OD5A 1D4M1 1K5MA 4Q4X2 2DBNA 4I0WB 3LPGA 1RHI1 5FO7B 4GD4A 1NUKA 3LDBA 5FAXA 2AUYA 2QJVA 3N7JA 1ULCA 2JDPA 1OQDA 2RR13 1I9RA 4DFSA 2FD8A 4XF9A 3PHMA 4R9BA 2Y6KA 2JD4A 4PJYA 1W2UA 2O8QA 2Y6GA 2ET7A 1EYBA 3WF1A 1JI6A 3VZOA 1AXYA 1VAMA 1KS5A 1RVF3 5FP9A 4EE2A 3D0JA 5IFPA 5J96B 1U5XA 3AXEA 4CEWA 2VOTA 3OD0A 1W90A 4NAMA 4QX5A 1LU1A 3A23A 1YLLA 4IESA 4OMDA 5A7SA 1MZEA 3LAGA 3U37A 3W20A 1AR81 1W9SA 2KA3A 3C7FA 2LRPA 1QJU1 2ID4A 2ZOEB 3WSOA 1AF9A 4I0AA 4KMQA 3ZN6A 3SNMA 4XE9A 2VH9A 2FQPA 2QCSB 1N1TA 2SBAA 1YQ5A 3IKWA 3VD3A 5LWBA 4MG2A 2ZGRA 5ANNA 5FZBA 3VZNA 5GZEA 3K3NA 3WG1A 4LO4B 1D7PM 1LTEA 4FCAA 2RS51 1UYPA 2GN7A 4A7ZA 1TG7A 4RR3B 3TNQA 1ZRIA 4CDWA 4QQPA 3UT0A 3WP6A 4BIFA 1C3HA 5EJ1B 4IV3C 5C71A 1FX5A 2XJPA 4Y22A 4NAOA 2F17A 2VY0A 3DGTA 4Y1XA 2B8MA 4BXFA 5IT6A 5A3PA 4Y1ZA 3KM5A 1GQPA 2JB4A 3THPA 4MLOA 1L3JA 2DVBA 4CDWB 1YWKA 1YFYA 3OEBA 4Q0SA 1OLMA 2A1XA 1D4M3 2NPIA 1W2TA 1RHI3 1XC6A 3ST7A 3VBRC 3ELNA 1DFQA 5A3MA 2JDMA 1YQ8A 4CCNA 3ZN5A 2QQWA 5I0RA 1GWMA 4H14A 4IE6A 1MZFA 4CEYA 5HXVA 1F8VA 4BOWA 5IFTA 1W9FA 4XEZA 2DDUA 5FZMA 4BA6A 4IUGA 3SQOA 2V73A 3GZAA 5JZGB 1S1AA 5JPMB 1ZBE1 2PXJA 4OUEA 4UFHA 1RUJ2 3OGRA 5FWJA 5GJ6A 3D3AA 1MS1A 2CHHA 1AR83 5FY9A 1KQRA 3VDDC 3RJ2X 4YM1A 5JLVA 1WCSA 3ECQA 5D8AA 3BIWE 4OQ9A 4BQ5A 1ASJ1 1FT9A 1VBC3 3WP4A 3HNMA 1UIJA 3R4UA 3IAPA 1FXZA 1MEC1 1XNKA 1X9PA 2WFPA 2WIIB 4YVWC 1GP5A 5FJKA 1G9DA 2QQOA 4LOSA 2WLQA 3O1RA 5JXHA 1AR62 1ZNPA 3UESA 4FSJA 1HV1A 4XFAA 1F15A 5L73A 4KI5M 5A3TA 2RS53 4LUKA 4M3CE 4NPLA 5FZ6A 4YWAA 2BWAA 2RS33 2ZX2A 4CDUC 4D6RA 3MIHA 4F8AA 2IZWA 4TN7A 1CIYA 3P3NA 1MPXA 4QM8A 4IGQA 5C3PA 2OUHA 3RS6A 1CAVB 2R071 2W39A 3A0NA 4IE0A 4Y5TA 1ZRFA 5A7PA 2WS92 1J59A 1US3A 2WO3A 3THDA 3AFGA 1R081 1Y43B 3GZEA 2B9UA 4N43C 1G9CA 1VALA 3TN93 2WFF1 2OA2A 1Q8VA 3KD4A 4INDA 3WNLA 5L19A 4YM0A 4CU7A 5LK7B 3VBUC 1X36A 4IEVA 3O1TA 3I2GA 4NHXA 4GH4A 1ZBE3 4AVVA 1PGL2 2YGMA 2XGXA 3RJRA 2WO7A 4QQOA 4XJ9A 2WNUA 1IPJA 3D82A 4LNVA 5LASA 3VKLA 3SMHA 4R52A 3ASIA 2ZHKA 3ZYGA 2QE3A 1LR5A 1POQA 4UAPA 3SXWA 4E4HA 2YYOA 4AFAA 2JE7A 1SCRA 4LULA 4QPGC 3WW2A 4A7YA 2HWB2 1L7LA 4GALA 1MEC3 2JD9A 2EIGA 2HWE2 1ULPA 3MI8A 3MW4A 1W2OA 4PQ9A 4WM7A 3ZXKA 4FPCA 1RB8G 3C8XA 4YW7A 5FREA 3AZZA 2VW2A 1AL0G 2VL4A 1CPNA 4FFGA 1SQ4A 2P5BA 2VVDA 2W1SA 3VHPA 4AWDA 2BYVE 3A0KA 3RFRA 2YHJA 5LB6A 1NT0A 2HH9A 4YZ5A 3WF4A 4CDXC 3NAPC 3VBFC 3KCCA 3ZYIB 1LB2A 2BV4A 3G6JB 3J4UH 2ZMNA 3GNEA 4XDPA 3ZYRA 4FXGB 1JZ8A 2ARBA 1EAH2 1FOD2 2EF6A 1OA2A 1JW6A 1YO8A 2EVXA 3I7DA 3IDBB 5FYZA 4YZ2A 1JZ6A 2JE9A 3FE5A 5T5JA 2ZAAA 4JZRA 4LOTA 5DPNA 4L11A 1SBFA 2VMFA 1WW4A 4NRMA 3RZZA 3H50A 1GV9A 5F3IA 3KWVA 3VHNA 4Y4YA 2QZ2A 4COUA 4CA9A 3M2MA 3UJQA 1R083 3ZPYA 2PHRA 2ZX3A 5A6ZA 1CZSA 1RINA 1W6NA 2WFF3 4AI1A 3H42B 3WCRA 4FP2A 5LY2A 1CIWA 4HKLA 2CGNA 4TWTA 4H3WA 4BYYA 3U1XA 2GZWA 3I59B 2ZGLA 3LFIA 1RITA 4FT8A 4B7EA 2ZS6B 1DGLA 1V6LA 2K2SA 4CCCA 3V0BB 4BMEA 2PLV1 2WAOA 2ZHNA 4KGGA 5FPUA 1KEXA 1PM7A 4PDWC 3KT7A 1GKBA 4PHZA 5JIUA 4RHV2 2VW1A 4QU1A 3DV8A 5J37A 1DGRN 4Q4V3 1BEV3 1BBT3 1GFF2 1TME2 3KT4A 4JGYB 4AGGA 1H8VA 2NQYA 2XJSA 4D7SA 2E53A 2R16A 2DU1A 3MF9A 4WM8C 1JOBA 1GQGA 2O0OA 4LUMA 4LBQD 2J1EA 4O9GA 1GNZA 2OQ7A 2X5IC 4IDZA 1QXPA 5EYXA 3E6CC 1WMFA 3FBYA 3MGUA 3Q9OA 4D6QA 3B02A 1R093 3MV01 3QBQA 1V6JA 2JX9A 2QKDA 2XJRA 4DZGA 2HBUA 4ZXEA 2E31A 3ZX7A 4XF3A 1PIV3 4OHVA 4AEJA 1UKRA 5LA0A 1QQP3 3VB9A 3ZSKA 5DXDA 4Y5SA 4I3GA 1YJKA 3LGRA 1OVSA 2VMIA 4DY5A 1MACA 1OMIA 4LBQA 1CJDA 1KJLA 1PZ9A 4I09A 5FKBA 5JOWA 4C1WA 1JHJA 4P9XA 4Y1UA 5BY5A 4U36A 5FY7A 4EQVA 1CZTA 4GAZA 1RUC2 1NKGA 1HX6A 1CAUA 2JXAA 4AVAA 1H9WA 2G9GA 4O65A 1O4YA 3AP9A 4OUSA 3WDTA 1IG0A 1PO12 3VBRA 4YVSB 2XXZA 1C1FA 4AFDA 4NIDA 1YXWA 2D6OX 1TZOA 2VMGA 1ZA7A 3CU7A 4IV1C 5BPXA 1AXZA 3AKQA 5JR7B 2IXKA 4XZUG 2VOWA 5A6XA 2YGLA 1CJPA 3ACGA 3O7OA 1BVP1 2RS11 4YW6A 3PUSA 4ZXKA 5IAXA 1PO22 1GZTA 3M70A 3OEAA 4DINB 3ZXGA 5LBBA 3AB0A 4Z2AA 1DYPA 2PHWA 1RUF1 3MUZ1 3VZKA 3ZFGC 1BLZA 2OPKA 5C4WB 1VMHA 4D7YA 5KXBA 3ZYJB 5GZCA 5F3GA 4FPKA 2FCTA 3ME2A 4MXWA 2B9VA 1ENXA 4FPJA 3CMGA 4XFCA 4CCLA 1I5PA 4KG0A 4XOGA 4BK5A 3VBSB 3FFZA 2BDRA 4YVWA 3P6BA 5CFCB 1F4HA 4EJRA 3AMHA 4YGEA 2GP3A 1FPN2 4B7KA 1D2SA 5L9BA 5F9TA 1Y7BA 4XUPA 4KU8A 3KVAA 4YYOA 2KXLA 4AQ2A 3BUCA 3JBG2 2L9LA 4QKFA 1JBCA 4JGZC 3VD7A 4LITA 4AE2A 4IEYA 1LRHA 4BHPA 1SLLA 2ZABA 3J8F2 1BMV1 5CIRA 2RG4A 3R6SA 5JXJA 2QQLA 1QDOA 4XVHA 2Q8CA 5HV4A 1US2A 3N9QA 5DMYA 4Q4Y1 4AK3A 1WLWA 5EQUA 4FFFA 5FYCA 2WRAA 4PBPA 5I8YA 2VE1A 1NY71 2R30A 2XR4A 4JDNA 4QQLA 5FP4A 3ROUA 4FFHA 2VUCA 2B7YA 3USSA 2J1RA 4AXOA 1XYOA 1GNHA 3VBUA 3V0AB 3FLPA 4LBLA 4MZUA 1KFXL 1PGW1 1W9TA 2RS13 3ZFEB 5K7PA 2WZR2 3WQ1A 4PQQA 2VXRA 2P4EA 5L9RA 1UF2C 2JG8A 4S2GA 4HONA 3SEEA 2X09A 1RUF3 1OF4A 5BNOB 4K8RB 2MHFA 4C0HA 1VPHA 3H8RA 5C8CA 2ZACA 2A3XA 4YG6A 2ZHMA 5IK4A 1MR5A 1NG0A 3B69A 1NAEA 2Y6JA 4RQPA 1W8HA 1AUYA 4DB5A 1OT5A 5FZ4A 4U2AA 3RMXA 3LWCA 1OURA 1S0BA 4XQDA 2J1TA 4CXXA 4JVAA 4MVTA 3WDUA 5BV6A 2JDAA 4HVOA 5CFDA 1QXJA 1GNYA 2C24A 3I2KA 2XL9A 3TB0A 1ULOA 2TUNA 5C9AB 3WG4A 3ZDVA 3NNJA 3CJIA 2NMOA 2BBVA 2XPJA 2VQ0A 3O1VA 4B3NA 1QOOA 4QXCA 2WWSA 2Y34A 2VQUA 4ORFA 4E8DA 3WQ0A 1T2XA 5FZIA 2RMU1 5L7OC 3ZYPA 3ZYFA 1ALYA 4FPOB 4Z8BA 2JKXA 1SMVA 4YGCA 3S6PA 2R1DA 3B94A 4N90A 3RQ0A 5FQ0A 1UMIA 4IEWA 1UU4A 3OPWA 2JG9C 4MHRA 1AX1A 1PVXA 2XLGA 4S2HA 1QWRA 2DVFA 2BZDA 4Q4Y3 4A42A 4ZU5A 4CCJA 2BQPA 4OUMA 3LDRA 1NZCA 1QJX3 1GBGA 2OUJA 3QOPA 2HYXA 3AKTA 2ZGNA 5JCTA 3PVOA 3J9SA 2ZHLA 5DZEA 4Q4W2 4N53B 2BOIA 1Q3EA 3WXPA 4K8FA 4JQRA 3NSTA 1G9BA 4HKOA 3AKSA 4EN6B 2XDVA 4YSFA 4IETA 4AEDA 3W58A 3RZGA 4CSWA 5F32A 1OOPB 3FHIB
chains in the Genus database with same CATH topology
1X82A 4PDWA 5JWPA 5GLWA 2A3YA 1OKQA 4KGQA 2GALA 1C8NA 3L2HA 3DPRC 2Z42A 5L36A 1Z7S2 4K40A 4Y26A 2GMEA 1KJRA 5JI9A 1XU2A 4WM8A 4LBJA 1IKQA 1K5MC 4YZ4A 1OHFA 1YFXA 4IV3B 2UURA 1PVC2 1VBE1 2X5IA 4BLIA 3WDWA 5FLIA 3RPQA 1DYKA 3MLJA 4I02A 4MX3A 1ZZBA 3H1YA 4W6XA 1CONA 2IXCA 1DQ6A 1FMD2 2R042 3EO6A 2RMU3 3NV4A 4AQTA 4CEWC 3AZWA 2E9QA 4LLOA 4BH9A 1F2NA 1WW5A 1LHWA 2MEV1 3NKGA 1U5YA 1DDLA 1RUE1 2CTVA 2XJQA 1HRV2 5BNPB 5JSPA 2E7AA 1VBD2 4F3JA 1TE1B 1NXD1 4K1YA 4B8EA 2IXJA 1CD3G 4R4ZA 1QH7A 1ENQA 1RUH2 2ETEA 3DKWA 2A71A 1AVBA 1V9U1 1AHSA 2DVGA 1REEA 4COZA 2R0HA 3S30A 5JOYA 2VG9A 4JRLA 4XJAA 1COV1 3ZFGA 1TMF1 5F5QA 1XNDA 1RJ8A 2ZGTA 3JD71 2B5HA 1W6MB 4HBNA 5CG8A 4R9CA 4C91A 3ZSLA 2MPFA 5FPZA 3OY8A 1ZYBA 1SLTA 5AFEA 5HCAA 3WP5A 1AR92 4LHLA 2P17A 1VBE3 1HRI2 2GNTA 4CEYC 5JVVA 1B35B 1NA1B 2HEYF 2W0XA 5I0UA 1DU3D 1AYN1 2WNVC 1IS5A 1V70A 1Y3TA 2RM21 1LOCA 2CAVA 3VBOB 2MEV3 3M3IA 2PA7A 4OHYA 3V65A 3MPBA 3LB9A 4CDQB 3RDIA 4BM8A 4FVVA 2O1QA 4PCRA 3WX5A 5HCBA 4FOYA 5KHIA 5E89A 4XJZA 4EWEA 2H0BA 2DUPA 3MW3A 3AX4A 4XFIA 1U5IA 1VBA1 5ABJA 1LESA 1V9U3 2HWF1 4XFGA 1MVEA 2XVKA 4XW3A 4EN7B 1KRIA 2D40A 3E5QA 2DUOA 1HXS3 4AW7A 1REFA 4L92A 1COV3 4AI2A 1DZQA 3MIFA 1Q43A 2ZGKA 2DCTA 1RUD2 2PHUA 1H1AA 4K6BA 5JZGA 2PAEA 3JD73 5KHJA 3LOBA 4QXKA 3ZFFA 1GYKA 4WVWA 1AZDA 1Q8QA 1VAKA 4GULA 5EWSA 3VBFB 4CP2A 3WW4A 4RGAA 4WBBA 1AR71 3NO8A 2D5HA 2XB6C 4XPVA 1S0FA 3T1MA 2E51A 3E5UA 1LKNA 1QOSA 3BB6A 4JDMA 1IHMA 4XMAA 2BEOA 1VRH2 2NM1A 1AYN3 3O0WA 1KXGA 3BTAA 1SLCA 2PYTA 5L7OA 1WBFA 2RM23 1C5HA 2ZZJA 2PELA 3KZ4C 5E88A 2YZ4A 3B9IA 4XQ4A 1QGLA 3UKNA 4YW1A 2X53S 2Q5TA 1V6IA 4WM7C 5T54A 2UWAA 1VBA3 2PAMA 2HWF3 3KGZA 3PJQA 1DLLA 3AP4A 5DDJ3 1CAVA 1MQTB 2YPJA 2ZBJA 1Q8PA 3CJXA 2BNMA 1PK6B 2XWJB 2ILMA 2ZGQA 1QY4A 2WT2A 2Q1MA 4IERA 4LE3A 4ONUA 2Q1ZB 2RR12 5LK5A 2JJ6A 1AYM2 2P3JA 4DRVA 3C3VA 3DPRA 4RS5B 3USUB 5HCFA 4MXVA 4QT6A 2XWBB 1CAWB 3NV3A 2VOVA 2IWGB 1RVF2 4XYXA 1JUHA 5FOJB 4Q29A 4WVMA 1AR73 4GKXA 1Q5OA 1HKDA 3N3HA 3HD8B 4E27A 2E7TA 1YFUA 4HK9A 1W6OA 4AYUA 4ZU7A 1VBB2 1XXNA 1O5LA 4NWVA 1C28A 1LJ7A 4JC1A 3KMHA 1S55A 4QPIB 4XQWA 1YHFA 2R49A 1NCRB 3WVJA 2YV8A 1J58A 1UX6A 2VGDA 2Z5WA 3BCWA 3ZIXA 1B09A 4DXZA 4N9HA 1U12A 1WMEA 2NMNA 1VBC1 4HN1A 5IUQA 1YNAA 3D5OA 1LOFA 5JIAA 2PN5A 4HT1T 1WUVA 1RGSA 1QJY1 2A7AA 2Q4SA 3SH4A 4DOUA 1C1LA 3LZZA 4Z2WA 2BNOA 1SLIA 1D4M2 2D44A 1RHI2 2Q0AA 2XLFA 5DZGA 5T5LA 2DCKA 1ND3A 3POSA 4FPFA 2RS31 1PHMA 5K0UB 3I59A 1GSLA 1YIFA 3WUCA 4W6WA 1N3QA 2ENRA 2AYHA 3K51A 1LECA 4OHWA 5A33A 1AR82 5GZFA 4MSVA 3TN91 3NVCA 1QJU2 4IEZA 1XE7A 4ES9A 4QQ2A 1DG6A 4XBLA 3AYCA 5FOBB 2BPA2 4LBKA 1LHUA 3QH7A 4KL1A 2HEVF 4R9DA 2WNVA 1DZTA 3MFAA 5CU1A 3ZVXA 1AR61 2HEWF 1NCQB 4XFBA 2UY8A 4IEQA 3GHMA 1VB4A 2RS52 5SV5A 3THTA 1WBLA 2X8KA 3WDYA 1EP0A 1X8EA 3S7IA 2RJLA 4XJUA 5KWRA 5FMOL 3AMPA 3KQRA 1QJY3 2JICA 1IQAA 4LO8A 2P2KA 5BNQA 4QQHA 5EXOA 5J3UA 3FBMA 3E6BA 1BQPA 1O4ZA 1VJ2A 1DQ1A 3WCSA 2DVDA 1SLAA 1MS5A 1RC6A 2WS91 5SV8A 1G9AA 3RSJA 3MZHA 5H9QA 5GLTA 3MIDA 5I0SA 4PLNA 4P9LA 3WW1A 3HN1A 5TSWA 5GZGA 2LTNA 5T52A 1WD4A 1ZBE2 1PGL1 2ZX0A 1DBNA 1I6XA 4W6YA 2XL7A 4G4FA 4B4QA 1Z78A 1NQDA 1O7FA 1RUOA 3GYDA 1W39A 3ZSJA 1ASJ2 1AL22 3VBSA 5DG2A 4GKYA 2JG9B 4KNCA 5GKAC 1ZBA2 1W0PA 2H6BA 3HQXA 4MV2A 1F9KA 4Q8LA 4RL7A 3VLBB 4BWOA 4E2QA 5CFCA 1NLRA 4FBFA 4GIQA 2JG8C 4M3CA 1AR63 1DHKB 5CBLA 4OHXA 1S0GA 5F6KA 5C8CC 1GR3A 2AZ5A 4Q4V1 1BEV1 1BBT1 1ENRA 4AGRA 1SFYA 3AFKA 4RQPC 4E2GA 4Z07A 2QVSB 3BODA 1EAH1 3WG3A 1DGWX 4AF9A 2OVUA 3ZO0B 1AX2A 3T1LA 3IN9A 4JV4A 4XFHA 5CFDC 2C0ZA 1A3KA 4XBQA 2JECA 2R072 4P5HA 3CJIC 5FMOS 3GZTB 1R091 4FQZA 4RSUA 3WINE 2WS93 2D93A 4PIXA 1PIV1 1O3QA 3O5SA 2WFF2 5FFOC 3PVBB 3QH6A 2VECA 1QQP1 3LSDA 4OHZA 3V0AA 4Z92B 2BWCA 3ZFEA 2XKPA 2JEMA 5F1RA 3FMGA 2R061 3H7JA 5BNOA 1ONAA 1HV0A 3RYPA 1GQHA 1OI6A 1D4VB 1XU1A 2N7GA 4J1XA 1N1VA 5KHGA 4P9JA 1G86A 4NR1A 2QUOA 2VOKA 4RHV1 2O8OA 5AVAA 3ZSMA 4AQSA 3GBFA 3UKTA 4NPRA 3LSEA 1LODA 2IXIA 2TEPA 4Y20A 4CTEA 1QNYA 2W52A 3IM0A 2ZGOA 4AEDC 2D6PA 3WHUA 3LA7A 2D6LX 3PLQA 4HSJA 2ZKNA 4M3CF 1HQNA 1ZZ7A 1DQ0A 4X8PA 2AH2A 2OW4A 1EV11 2GC1A 1EAH3 4YW2A 3WG2A 1CR7A 4Y1YA 4AG4A 1F5JA 3U11A 3UL2A 4Y22B 3O0VA 1H2NA 5JOZA 4HVRA 1UPSA 2ZKLA 3A4UA 4EWDA 4WVZA 4DPNA 2HWD1 1PO11 1W6PA 3VL9A 3N7KA 1KD7A 4N53A 2HWC1 4GB31 1J1TA 4XJWA 2XH6A 2Y26A 4CEYB 5FLJA 5BYNA 2A6VA 2R063 2TBVA 2AREA 2PLV2 2GC0A 3PMSA 1S2BA 3S7EA 1PGSA 4RHV3 4ISRA 4N7UA 1QNWA 3N36A 5KXDA 3KT1A 1LHNA 3JUUA 4UW3A 1TME3 4WZFA 5H9SA 1AJKA 2VNRA 3MIGA 4JTNA 5IK8A 3ZMNA 2CL2A 2XBO1 4R4XA 1F5FA 5D8AB 2Q30A 3D4KA 4Q1RA 3VBHB 4L8QA 3AXDA 4H7MA 3W9AA 4OFGA 4MGYE 4JRAA 1ZA4A 4AVBA 2ZX1A 1HQWA 1SFNA 4M01A 2W08A 1EV13 1PNFA 1UL9A 3D0SA 4Z8BA 4KG8A 4E2SA 3QACA 3JBG1 1R1A1 1ZZCA 1OFSA 1HW5A 1XNBA 4K7JA 2FMDA 4WZCA 4K9SA 1RUC3 1ND2A 5BNNB 2H6CA 3HT2A 3WZ1A 2D43A 2HWD3 2BNNA 4YGBA 1PO13 4META 2HWC3 3R05A 4GB33 4AEKA 2DCJA 2GNBA 2NP0A 4AEMA 3E97A 2LUWA 5FO8B 4LBOA 1JTZX 1UU6A 4OULA 1OA3A 3KLSA 3M1HA 2RS12 1PO23 4I30A 4CZSA 1QH6A 1O3TA 1NYWA 4I2OA 1ZZ6A 4GH4B 2EAKA 1QJX1 2YUEA 4LTAA 2WNUB 5ABJC 4CDWC 1H2MA 3V64A 4LEJA 2XBO3 4L99A 3MLKA 2XJVA 2GMMA 5DUWA 1X8MA 1MVQA 4RA0A 2WL1A 3VZLA 4XF1A 1JXNA 2WNEA 3HR9A 3WOGA 2WZPP 1QF3A 4UXAA 1S0JA 2JENA 1FPN3 1FAYA 3ZIWA 5FTTC 4HSLA 1WMDA 2ZJCA 4A7KA 3MW2A 5JZGC 2UU8A 4XJ8A 3ILRA 1F31A 4FQ4A 3ZFFC 3S0MA 3JBG3 2A6YA 3VBOA 5AC91 1R1A3 3O12A 2V09A 1TEIA 3TYJA 3J8F3 2WC2A 3BPZA 3KSCA 4C1XA 1U5ZA 3UK9A 4QGNA 3BU7A 1BMV2 5AFBA 2QNKA 4CP0A 4Q4Y2 1J1LA 4PBOA 1XE8A 3B93A 4MUVA 3VKFC 4Q26A 4XF4A 3WP3A 1S0DA 1LGBA 1NY72 4C90A 4YZ1A 2GC2A 1BCXA 4V1PA 5A3LA 2CWSA 2E7QA 4A2UA 1W6NB 3O14A 5FO9B 3VKOA 4ATFA 1PGW2 1KFUL 4E4DX 1FV2A 4X6QB 3IPVB 4EN0A 2DURA 3NWKA 3HWJA 2Z2SB 5A32A 5I8SA 5DUUA 3VV1A 2SLIA 3B00A 1Q56A 4Y24A 4XTMA 4AFCA 1H8TA 4Q1PA 5HI0A 1SLBA 1RUG2 1HLCA 5CB7A 3ZXDA 2I07B 5IK5A 1ZRDA 1LU2A 2K0GA 2P34A 3H1MA 2OYZA 3EQEA 4HL0A 4KQ7A 4P9GA 1APNA 3WV6A 3CO2A 1G8WA 1FMD1 2BVVA 5AC93 1O5UA 2B42B 3AMMA 5KC5A 1EY2A 1PMIA 3TBDA 3R4DB 1O91A 1AXKA 1CQ9A 1CN1A 1OFNA 2DUQA 4XFFA 2YXSA 4LO5B 1VBD1 4YW3A 1WLTA 3ALQA 3U4XA 3FC0A 4QPYA 3HAGA 1MQTA 1RUH1 4PLOA 3VBRB 1I1EA 1IS3A 1PK6A 1KDMA 2P3KA 4XMIA 3J26N 3PMEA 4AHWA 1LOAA 1OA4A 2A70A 3MPPG 1SDWA 3KCYA 3PTYA 5FCCA 1LOFC 5EZWA 3JQXA 1GANA 3KB5A 4GA9A 3E5XA 1BKZA 4K3UA 1VP6A 4FOVA 3VDDB 4TZDA 2W68A 2FZ2A 2EALA 1HXS1 4WV8A 1AR91 2AR6A 1VBE2 1ND3C 1HRI1 4G9SB 4L2NA 4YVWB 3DN7A 1ZRCA 4AHYA 4XETA 4L9BA 3JB8A 1C8M2 1FMD3 1T6GC 4HANA 4QPIA 1NCRA 1GZWB 3ENRA 4CDUB 4JGYC 3B3QE 2MEV2 4URTA 2JKBA 1POV1 3RYKA 1RUE2 4HPKB 2QDRA 1VBD3 4KBBA 2GSYA 1LCLA 1RUH3 1RMU1 4UW4A 1WCKA 1V9U2 4AHZA 4QD2A 3WT3A 1Q8SA 2WA4A 4N43B 1BZWA 4RR3A 2DFCA 3VL8A 3VBUB 4L97A 3CL1A 5KXCA 2VQAA 1UZYA 1ULEA 5KHKA 3D6EA 1COV2 1LGCA 2JDZA 1TMF2 2PTMA 3AP7A 3LKJA 3RRDA 2WINB 3MYXA 1U0AA 4AI3A 5I0TA 1WLCA 5CNAA 4CDWA 5DDJ1 3SLIA 1G9FA 4YFWA 4HVQA 3JD72 4IEPA 2IC1A 2GAUA 4Q0UA 4YVSC 4QPGB 2VW0A 2HJIA 1DQ2A 2PQQA 1AR93 4QHBA 4Y5Z0 1HRI3 4IEOA 3M7AA 4FXKB 1ZX5A 1MZ5A 1WCDJ 4GQ7A 4P9WA 5ACA1 3B9CA 1VR3A 5C4WC 4IXLA 4QGMA 1RUI1 4AFMA 3NAPB 4CDXB 4BPZA 2RM22 4MGIE 3K48A 2EAAA 2FMYA 4JAAA 4OZXA 1POV3 3WQ7A 2A73B 4D3WA 4KWLA 2XJUA 4I01A 3AZVA 3VBSC 3KGLA 3L9JT 5CFCC 1OLRA 1KS4A 2DWRA 1RMU3 2D97A 4XILA 2AENA 2HWF2 4Z1VA 2D6NA 4E9KA 1Q8OA 5CG9A 2PHDA 3P3PA 4XXAA 4P9YA 2HYKA 3PVEA 2ZMLA 4N7IA 1DQ4A 4UW6A 3JQWA 5KC6A 1WLDA 4CP1A 2XLAA 1YJLA 4PDWB 1X33A 4YNIA 1M4WA 5BXXA 4DNYA 1CAXB 4EN9B 2HKXA 1H4HA 4DS0A 4WM8B 4Q4X1 1DF0A 1AR72 2VNOA 1LOGA 5KHHA 3GBWA 2GN3A 4NVPA 1J3QA 5KBFA 1LEMA 1UKGA 3H8UA 3M3QA 3G7DA 1A8MA 3RNSA 2XHKA 2YDEA 1C4RA 4LO6B 2X5IB 3H1WA 3WHTA 3ZFEC 1JYIA 5FLHA 5ACA3 1ZREA 3IBMA 4D7TA 3FWEA 1BYHA 2NLRA 4X6RB 2QDNA 3WLUA 5BNOC 1RUI3 5I93A 1IKPA 4FPYA 4HETA 2FHRA 4B29A 3ILNA 4BIOA 3FLRA 4OI1A 4YZ3A 3AK0A 3U07A 2YC0A 1EPZA 4FTEA 3JU9A 4LBNA 1N47A 1QXRA 5H9PA 2QQPA 1DGWA 2PHFA 4TYSA 5K8SA 5C9AC 2R1BA 4YM3A 5JPNB 1BK1A 3KS7A 1JH5A 2WSVA 1V6MA 4FPGA 1VAVA 4E4SA 2ZX4A 1UAIA 1WW6A 2E6VA 4IV1B 4COYA 2ERFA 1ZZ8A 1CX4A 1AYM3 1FATA 4LO7A 3ZFGB 4AQ6A 1G7YA 2PHXA 4S2FA 2PHLA 3FUQA 3OTFA 1QHDA 2UYAA 1AJOA 4Q4X3 3RWNA 3LCPA 5JOXA 4XHXA 4GWNA 3AYDA 4C0BA 3OY8B 4COVA 4N53C 4Q8KA 5KXEA 2VVEA 2A3WA 1VBB3 3WDXA 4F7ZA 2YY1A 1POV0 3BOPA 1C57A 2BW8A 4IEUA 3V0BA 3INAA 1OOPC 2WKKA 1TQ5A 1YYNA 3IMNA 4JGYA 1RUJ1 1FNYA 4JGZB 2A6ZA 5EV7A 1ZRRA 5FPXA 4IEXA 4ATEA 1VBC2 4FOWA 2WT0A 4ES8A 1QJY2 1HIXA 1A6CA 5C6CA 1WGPA 1I5ZA 5ABJB 1A78A 5JDBA 2Z69A 5GLUA 2XUMA 3ZXAC 2Q8OA 4OLLA 1LEDA 1VB2A 3WDVA 2RS32 2C5DA 2VU9A 3AYAA 3X29B 1YI9A 3LA3A 5BNPC 1MS0A 2K9ZA 3M8LA 3IIAA 1ND2C 1JOJA 2UYBA 4YVSA 3ZFFB 1E57A 1NQJA 3LA2A 4PLMA 4HKWA 3TN92 1SBDA 4EN8B 1RL3A 1QJU3 1AL21 3VBHA 3GHNA 4I3PA 4RD7A 1W6QB 2CYFA 1ZBA1 3NW4A 1N3PA 4P9IA 1LHVA 5LRSA 4BZ4A 5C4WA 4E4ZA 5DZFA 1VIWB 3RYRA 3RG0A 4W65A 1RUJ3 5L7OB 1IS4A 1SCSA 2UWCA 4A3XA 2P37A 4EV0A 2IXHA 3AJYA 4M00A 2HWB1 4FPEA 1D0GA 3OBTA 4KU7A 1MEC2 1REDA 2HWE1 2DTYA 3RMYA 1FI2A 5BNNA 1B35C 5LRRA 3OYWB 3ZN4A 1NA1C 3TAYA 5GLZA 3RI8A 4O9EA 1XYPA 1MS9A 4LT5A 4GXLA 3DUIA 1XQNA 1UD1A 3EJKA 1LENA 3VBOC 5JSOA 1FOD1 1IZ3A 1JUIA 4CDQC 3MIBA 2UY9A 3KCXA 4M0HA 2EXIA 3DPRB 3POYA 4D94A 1D2QA 1R082 2D7FA 1K5MB 4YW5A 4WVMB 2DTWA 4RGGA 1ASJ3 3SHRA 1AL23 4FTSA 4NHLA 4NO4A 3B7MA 4CYDA 1FNZA 1ZBA3 1W6OB 2ZZQA 3NV2A 3MDPA 3NKTA 2QFEA 1J3RA 2D98A 1UN1A 1NE4A 1ULDA 1G6NA 4CEWB 3EHKA 4Q4V2 1BEV2 1BBT2 3M3CA 1TME1 2GMPA 1WD3A 2HWB3 2AGSA 1WA4A 2EXKA 1H8TC 3URFA 3AMNA 1MS8A 3OGGA 1MS3A 4BQ1A 2HWE3 4Q27A 1TNFA 4AVTA 3T2TA 3ZN6B 5C9AA 1XNCA 1NXMA 2GH2A 2WT1A 2G9FA 2R073 3DL3A 1R092 1EPWA 3GZUC 4Z82A 2WQ4A 5F6LB 3OF1A 3ETQA 4FAGA 3B5LB 3HIFA 1PIV2 3JCIA 1W0OA 1JHNA 1YI7A 2ZGPA 1FOD3 1QQP2 3APBA 4D69A 1IS6A 3M3EA 3AP6A 1ND3B 4COWA 1S2KA 3ATGA 3W59A 3H3ZA 1ZVFA 3IPVA 2R062 4Q0QA 1GICA 1CVNA 4ASLA 1RUC1 1UMZA 2CAUA 1I3HA 2QZ3A 2GC3A 1FYUA 1MQTC 1UU5A 5T55A 5DUXA 5GM0A 2I45A 3N35A 4H7LA 2EXJA 3I4IA 1PK6C 5A33B 3TRSB 4Y1VA 2BFUL 3AKRA 2X29A 4YGDA 3AP5A 1M06G 2CWMA 1LULA 3MLLA 2XVLA 5CADA 2IFWA 1OOPA 1QU0A 1PO21 1UZZA 3EBRA 2B46X 4F83A 1FV3A 1OPMA 2WNVB 4RS5C 1PZ8A 2IXLA 4FAHA 2WJSA 2Y0OA 2I2SA 3MFCA 1V6NA 1EV12 2ZTNA 3M3OA 2OZ6A 3R4SA 4IV3A 3JZVA 4K1ZA 3B01A 4AI8A 2GU9A 4HMZA 4XZPA 3VZMA 3NJZA 2CNAA 3U10A 2BGCA 2R0FA 4FPLA 4EROA 1KDKA 4IL7A 1FPN1 4B4RA 1YIPA 2HWD2 3VHOA 3POWA 4JDOA 4QPIC 1DQ5A 2XVGA 1UIKA 3VN4A 2HWC2 1NCRC 4GB32 4RFT0 5J36A 1CGPA 1O4TA 1NOVA 1X7NA 4GWMA 1H30A 1UPIA 3AZYA 1RUNA 1JN2P 5I8TA 3BALA 4TLFA 5BNPA 3J8F1 1RIRA 3WY6A 1BJQA 2XJTA 4PIYA 2PLV3 2PAKA 1Y9QA 5CVRA 4LHNA 3FFQA 3SH5A 1BXHA 3ES1A 3VDDA 3NL1A 1QDCA 2EA7A 2XBO2 4ZU4A 2F4PA 3WR0A 1V6OA 2E63A 1H4GA 4K21A 4DY3A 1QKQA 4RR3C 1NLSA 2GDFA 2V5YA 4K20A 3SCGA 4BE3A 2WZR1 5K0UC 4OVEA 2DCYA 4J6GA 1H2LA 1RTVA 1RUF2 2BFUS 3PNAA 4HLTA 4M3CB 3U0ZA 3QCWA 5T5OA 4J1WA 3SISA 3ZSEA 4AFBA 5FDBA 1GZWA 1W6MA 5C8WA 5J98B 3SH3A 5J48A 3VKNA 3OGJA 3WUDA 2WA3A 4CDUA 3VKMA 4ISQA 5GZDA 1R1A2 2A75A 4QM9A 2VNGA 5JSRA 2GNMA 2Z79A 4XBNA 4SLIA 1URXA 4HPKA 1ULGA 5C33A 4QGLA 4WM7B 1B35A 1DZRA 3ILFA 1NA1A 2ZMKA 4NHKA 4YLZA 5AVPA 3SITA 1MS4A 2ARXA 4P14A 4BMBA 1YFWA 3AYEA 4N43A 2PFWA 1H9PA 1NCQC 3MIEA 2R32A 2IFRA 4NHMA 3FUOA 3JB4C 4CDQA 4NN0A 5FBZA 3BOWA 3E6DA 2BTVC 4R8HA 1SBEA 5J7MA 1ENSA 1LOEA 3D8CA 1QJX2 3EXUA 5CA6A 2D3RA 5EFUA 2ZA9A 4GMP1 3C2UA 4Q0PA 2YROA 3N4MA 2VUAA 4AHXA 4QPGA 3AJZA 4Q4W1 4HFSA 4BCUA 1IGOA 2MNGA 3SCFA 1PZ7A 2WZR3 1ULFA 3FLTA 5H9RA 4Y20B 1N3OA 1RUG1 2B39A 2R6QA 4XIOA 2TNFA 3DF0A 3CF6E 3UKVA 4KH9A 5EJ3A 2UWBA 4ZKTB 4HZFA 2VULA 4JTOA 4PIZA 1Z7S1 4CDXA 3NAPA 3VBFA 2D6MA 1QMJA 3OBRA 5BUVA 5AC92 4XDQA 1J3PA 3GF6A 3LOIA 1YCIA 4JCKA 2A5ZA 1RJ7A 4X8NA 1V6KA 4XXPA 4CRQA 1PVC1 2VOXA 1YRZA 1UCXA 2G4IA 3GBGA 4PF5A 3N7LA 1S0CA 4MYEA 1D0HA 1IPKA 2R041 2RMU2 3WD5A 3AM2A 1W6PB 3H3UA 1N1SA 5K9YA 2DF7A 2C9AA 2VMHA 5HBAA 4XTPA 1JYCA 3CNAA 2D5FA 4ASMB 5DG1A 4LBQB 4WVVA 5E8AA 3FZ3A 1HRV1 5CAZA 1S0EA 1OSGA 2RHPA 2WQZC 4LR4A 5T50A 3OJBA 4YM2A 2D6KA 1CAUB 3ACLA 2DU0A 4GMP3 5JI7A 1OLQA 2DFBA 1CAXA 4LHKA 3M4FA 4Q4W3 1O3SA 3L2YA 4B4PA 4Q2FA 4KWJA 4YG0A 5GALA 3ZDSA 4DMIA 2ATFA 2BUKA 4S2DA 1RUG3 3VZJA 1GLHA 2FBEA 1LHOA 2I74A 4LA3A 4RS5A 2C1FA 3USUA 1MZ6A 1XYNA 2BVBA 1Z0HA 2WLPA 1HQLA 1CPMA 1Z7S3 1CAWA 1C8M1 3TWIA 2A6XA 2H0VA 2NZ9A 1H2KA 4MXWB 2VPVA 4OI4A 5JAXA 2DYCA 4NOTA 3VUOA 2NN8A 2ZAHA 3AZXA 4MH0E 1PVC3 4LLFA 4OI0A 3V56A 3HBZA 3QD6A 1ND2B 4XF0A 2XG3A 1NE6A 3FX3A 2R043 1H1IA 2D3SA 4MGKE 5LEKA 4FOQA 2DV9A 3GALA 4UBHA 2RJKA 2CGOA 4IV1A 4G3YC 4BLJA 5EYYA 1OPOA 3N7MA 5LEJA 1HRV3 3I54A 1DGRA 4QU2A 3ZXEA 2YMZA 1GZ9A 4ITCA 3FJSA 1H0BA 3HMYA 3IDCB 1VLNA 4AVSA 5D1IA 4UBGA 1GZCA 2KM2A 1HXS2 5K0UA 1S0IA 2OIIA 2LALA 1BVVA 2ET1A 2ZGSA 2FZ1A 2JG8B 2Y38A 3WW3A 3H0OA 2D3PA 1RUD1 1A8DA 1C8M3 4LBMA 5C8CB 4XHBA 3CEWA 5T5PA 2XKOA 1PNGA 3R0RA 4NWWA 4RQPB 4JGZA 2ZPXA 3IDEA 3UV9A 2ZGUA 5FRAA 1RUE3 5D8AC 3VHRA 2B45X 1CESA 2GH8A 4KWKA 4AI0A 5CFDB 3VBHC 1SACA 5E16A 2VVFA 4DRRA 1VRH1 4H55A 3CJIB 1AYN2 1RMU2 3SCHA 4YRDA 1NCQA 1IOAA 4IQPA 3MICA 4GMP0 3VGIA 1AX0A 3MEPA 5I91A 4SBVA 1ZZ9A 2ES3A 5FQ0B 3RI9A 2NYYA 1TMF3 2Y0IA 1QJZA 2EXHA 2ZCWA 1X50A 4Q0VA 1H1MA 4MGZE 1OQEA 1VBA2 3OD4A 3IWZA 5BNNC 3ZXFA 5DDJ2 1N1YA 4LE4A 5A32B 3QLQA 3MF6A 3AMQA 5B2GB 2ZGMA 1H8TB 2WSUA 1C5IA 1LGNA 2OZJA 1OQ1A 1V00A 4AGVA 5E1RA 1KITA 2CGPA 4OI2A 4AEDB 4FP3A 4TSVA 1W6QA 3NV1A 1O3RA 3PVNA 2DCZA 2RR11 4FTBA 1RUD3 1AYM1 4HN0A 5ACA2 3CLPA 4M0NA 2A6WA 3H9AA 1UW8A 3I8TA 4GH4C 1RUI2 5T3NA 1SEFA 2CY6A 4HK8A 1ZM1A 3OPZA 1RVF1 2LM3A 2WNUC 3H7YA 4UW5A 1TNRA 4FPHA 3TNPB 5J09A 4YG3A 3I2DA 5DUVA 1HDKA 2RE9A 4DQAA 4R9AA 2F6BA 1XRUA 2JG9A 3AKPA 4AVCA 5JMCA 3PJYA 1VBB1 3ZMOA 3HT1A 1LOBA 1VRH3 4YW4A