4COVA

Crystal structure of epithelial adhesin 6 a domain (epa6a) from candida glabrata in complex with gala1-3gal
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
230
structure length
230
Chain Sequence
GWTDPTEFPLGCSPNVTTPKNGLSMELYSYDYLKSGSNPCWDAAYLDPNYPRTGYKSHRLLAKVENVAGNINFYYHAPMGCTSLFDTLPQAYNYRTPLTMTNFTMLLYGYFKPKVTGYHTFTISADDLLFVNFGAGNAFDCCKRESSADDFGNYQAYAVWGSQTAKDDLTVHLDAGLYYPIRIFFNNRDNDGALSLTLKTESDPNPVIDFSDYFYSFDDTKDGCPGLVSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords EPITHELIAL ADHESIN 6
publication title Structural Hotspots Determine Functional Diversity of the Candida Glabrata Epithelial Adhesin Family
pubmed doi rcsb
source organism Candida glabrata
total genus 60
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4covA00
4CP0A 4LHLA 4AFBA 4LHNA 4AI1A 4COVA 4AF9A 2XJVA 2XJTA 4AFCA 4COYA 4AHXA 5A3MA 2XJRA 4COWA 2XJQA 4COZA 5A3LA 2XJPA 4A3XA 4AHZA 4AFAA 2XJUA 4AI3A 4AI0A 4AHYA 4COUA 4D3WA 4AI2A 4GQ7A 4CP2A 4LHKA 4AHWA 2XJSA 4ASLA 4CP1A
chains in the Genus database with same CATH superfamily
3ZSEA 1C57A 2OQ6A 3ACFA 3Q8FA 3S0MA 3RYRA 4XJ8A 2R1DA 1PGSA 3WXPA 3WV6A 2RMU3 1ND3A 4QU2A 3POIA 1AX1A 2WBKA 3DF0A 2UWAA 3POBA 2HWC1 4L92A 4MADA 1CAUA 4JQTA 1DYOA 1W6OB 4YPJA 3RWNA 4CYDA 1MS1A 4PI0A 4WM8C 1KDKA 4FPJA 4DIQA 4HVQA 4FFFA 3CMGA 4CUGA 4DB5A 3AP5A 3CBNA 4W65A 4QB6A 3N36A 3G7DA 4CPBD 3T2QA 1W9TA 2NZ9A 3KQRA 4XEZA 2QNKA 4B1LA 5C71A 4CCKA 5E6HA 5FPUA 1EPZA 1F5FA 2J1VA 3ZMNA 3AMNA 3AXEA 2BQPA 3JBG2 4L8QA 2JIGA 4JKKA 2WLQA 4XURA 5LEKA 3I2IA 2W68A 3ME2A 4FPLA 1HN1A 3CQOA 5FZGA 4XUOA 5FZKA 2RR13 1WCQA 4QXBA 1PO22 4LBQA 1V70A 2BVVA 3FLPA 4PT6A 5KHIA 1QXJA 4CEWA 2QQUA 1VBD1 3WG4A 1QJEA 3ACLA 4YSFA 1HKDA 2BWCA 5D8AC 2FD8A 1ULFA 2HBTA 4GH4C 4AFDA 3T09A 2W1WA 4XXAA 5ANNA 5FLHA 1TEIA 4LOSA 1GP6A 1POV1 4RS5C 5JIAA 5KXEA 3BIWE 1O91A 1EV12 3RI9A 1BK1A 3VBHA 1WMEA 2IXKA 4HN1A 3K3OA 4IEZA 2UWCA 3ZXLA 4G4FA 4D3WA 1ENQA 1MQTA 1V6JA 2IVJA 3R4SA 1DQ1A 5FMDA 4FPGA 5D1IA 3TEYA 3WF4A 3PNAA 1D2QA 4CTEA 2YHJA 1XU2A 1DGLA 2RS13 5FXZA 4JC1A 1NE6A 4CCEA 3TEWA 3LIHA 4AF9A 1LEMA 2JDNA 3AMMA 3ETPA 4DXZA 3INAA 4Q4Y2 1W8FA 4CP9B 1QDOA 4Q4V2 1W3XA 5HI0A 5JSPA 2EIDA 2HYKA 3HT2A 1LESA 3WW1A 1ND2C 2HWB2 1W3VA 1ODMA 1JW6A 2WR9A 4QX3A 3WF0A 3I4IA 1D2SA 1VBE2 5E8AA 4YLZA 3AKTA 2LS6A 3LPFA 3N9QA 3JCIA 5F6LB 1J3RA 4IE5A 2ATFA 5FZBA 3VV1A 2HEVF 4JGYB 3TWIA 1VMJA 4FPOB 4HETA 5IT6A 2YFUA 1ZRIA 3BTYA 4O9EA 4LLFA 3RZKA 5JOXA 2KA3A 1JUHA 1QHDA 2FCUA 4BQ5A 1GWLA 1Y9GA 3WT3A 1OKOA 3ZVXA 1W9FA 2YFZA 1YYNA 2AENA 3NL1A 2HEWF 4JCKA 4XQ4A 4Y1ZA 3OBTA 1LOBA 5T54A 3I3QA 1KFUL 2AGSA 2JE7A 4BMBA 2QZ2A 4E27A 2VR4A 2A3YA 2PA7A 2R32A 4OMCA 2PAKA 2QKDA 1NCQB 3OGGA 1CAVB 1RL3A 2C9AA 4ES9A 4IGQA 3BGAA 2JKBA 2W1QA 3N7MA 3POYA 1AR93 1GBGA 3VBFC 3ZSMA 1IPSA 2WWUA 5IK5A 1FPN1 1YEWA 5F5QA 4QDQA 1OF3A 4IUGA 2FMDA 3MI8A 4AQSA 4JGZC 4UW6A 4UFHA 4GB31 3DUIA 1DCSA 3MLJA 3VDCA 1LCLA 4BLJA 4NRMA 3KV4A 2EVXA 2F4LA 1H8TA 3T08A 4DZGA 5KHGA 1GZ9A 4CP9A 3BU0A 5BUVA 2IFWA 5FJKA 3VHRA 1FYUA 1RINA 3S30A 5EJ3A 1QF3A 4CDQC 1F31A 5F5CA 4EV0A 1V6IA 1KITA 2DCYA 2F17A 4W8JA 3A4UA 2ZX2A 5CFCB 2VCMA 3OF1A 4Q27A 4EWAA 1J3PA 2RS33 5LCWL 2VVDA 3WDWA 1ASJ2 3AX4A 4ZONA 5IATA 4JGYA 1UY0A 2NMOA 5ABJB 2CDOA 3H42B 2OT7A 1PK6C 1RVF2 3F95A 5CIRA 3ACGA 2ZKLA 2ORZA 3JUUA 4LMFA 1GQPA 3JBG3 1C28A 3NNFA 1I6XA 2XVKA 4G9SB 1QQP1 4I02A 4XBNA 4AFCA 2I2SA 4K7JA 4CCDA 1SFYA 2W47A 5H9SA 3D0JA 5FUNA 2VW0A 5HCBA 5DABA 2VCCA 1W8NA 4XXPA 4AVCA 4ONUA 3WDUA 1GLHA 4CU8A 4IEQA 3SH5A 2A6VA 1RGSA 5HBAA 3H3LA 3O0VA 2V4VA 4CCJA 3ZR5A 3IMMA 1QXPA 3FWEA 4WZFA 1DQ2A 1EV13 1LENA 2DUOA 2B46X 2LM3A 3AVRA 4BISA 3A22A 4FI9A 4S2HA 4F3JA 2YBPA 4N43C 4YW2A 2Q5TA 4LBOA 2OKXA 3RZGA 1PMHX 4XHXA 3U07A 1NCQC 2TUNA 1OA4A 4LE4A 3R4UA 1V6MA 1ZBE2 4KH9A 2IUWA 2BNNA 5E16A 2WNOA 4N9HA 5TSWA 2J22A 4Q4Y3 2AR6A 2WDBA 4Q4V3 3ZOIA 5FYUA 1OD3A 2RJKA 4Y5Z0 4NIHA 2DVBA 1JZ7A 2HWB3 2BNOA 5FRAA 4QPYA 3ZN5A 2Q0AA 4RHV1 2QQNA 4BA6A 2D93A 5ABJA 1FATA 4YW4A 4V2VA 1AX2A 3ZM8A 4LKFA 5CFCC 3CDZB 3PUQA 1C8M2 3MFCA 3KV5A 5CFDC 1PIV3 3ZFGB 3AP7A 2E6VA 5DQ0A 4QGMA 3RPQA 3WSOA 1K45A 1U0AA 5FV3A 4KU7A 2DV9A 1MZ5A 5EP9A 1H30A 3MYXA 5DAPA 4ES8A 1RUC1 1QIQA 3BB6A 4FT8A 2V5DA 3OPZA 4MGYE 1AZDA 3V56A 3WW3A 1XE8A 1RUOA 3N3HA 2WFPA 5FZOB 3JD71 1PZ9A 2FMYA 2FQPA 1WLCA 2ZZJA 1NOVA 1GICA 1TMF3 2EALA 4XABA 4XW3A 4YW6A 1B09A 2CGOA 2R042 4Q0SA 3KT7A 1XNAA 3OPTA 1COV3 4PQQA 4CXYA 2Z42A 1GOFA 2HYXA 1U12A 4P02B 3U11A 3B9IA 2X10A 1LHOA 2TBVA 2ZAAA 2ZX3A 2E32A 1CQ9A 3SLIA 3ITQA 2ET7A 3UV9A 2HWE3 1RUE1 2CWMA 5FIXA 2WSVA 4KBBA 5HCAA 4HL0A 4V1PA 4EZHA 3DYPA 1NAEA 2VMCA 5F3CA 5A1AA 3PTYA 1ASJ3 4WM7C 4DOUA 2XPJA 1GYKA 4H14A 4OULA 2ZZQA 2QDRA 3VZNA 3O1MA 1RVF3 3FBMA 1DLCA 1UW8A 2A5ZA 2ZACA 5GZGA 1ULDA 3H7YA 2PELA 3TN91 3WNLA 4AK3A 4BH9A 4E4HA 1AUYA 3KCYA 2LRPA 4LEJA 1SBFA 2B5HA 5A80A 2Q30A 4H7MA 1HXS1 1MS9A 1BHGA 4FVVA 3U14A 4KGGA 2E7QA 2WT1A 1VAVA 1FXZA 2VMFA 3D82A 2E53A 3ZFGC 1VPHA 5FZOA 3VZOA 1H1AA 4JV4A 1GWMA 1SEFA 3PL0A 3J8F3 3RI8A 2PHWA 4RR3A 3RYPA 4CP1A 4WVVA 4JHZA 3U75A 1KGYA 1PMIA 1N1TA 1PX3A 4UOJA 2WSUA 2IC1A 2XL7A 3IDEA 1VBC3 3E6DA 1LR5A 2JIJA 2VXJA 2YC0A 1Q8VA 1W6QB 4IERA 2BOIA 2JG9B 5FYVA 1JZ4A 1ZBE3 1H6XA 5I93A 3HIFA 2DU1A 2HKXA 1IG3A 2RS52 1YFWA 1UX7A 1CESA 3M3QA 3V0BA 5IHRA 4GMP1 2JDKA 3GXUA 4R9DA 4COUA 3ZXEA 3FHIB 4UBHA 4XVHA 3SKJE 4GA9A 1HRV3 4BWOA 1P8JA 4DS0A 5IAXA 3KZ4C 3FFQA 5IK7A 3SCHA 1CWPA 2K2SA 1GZWB 1MS8A 3AL6A 1GU3A 1UOGA 4C1XA 3B69A 3MFAA 2G19A 2P3KA 4DEVA 1JXNA 1QJX2 3BVCA 4GWIA 3OGVA 1C8M3 5ACA1 1MZEA 1UU5A 5GLTA 2C26A 1JBCA 2VZTA 2QUOA 2WUHA 3ZFEA 4HK8A 3BUCA 2V4AA 5FY5A 5L7OB 3SH4A 1MS3A 4D7SA 4PDWA 1PVC2 4UFMA 2GC3A 5FZAA 4JDOA 4IV1C 4QHZA 3MDPA 2Z79A 3EQEA 1KJLA 3K3NA 1PX4A 4LHLA 4R4ZA 2ADDA 2UY9A 1B35B 2GMPA 3KVAA 3UKTA 1R092 3I54A 4P00B 2RMU1 4K1YA 2EXIA 4EWDA 2QVSB 3ZPOA 3U0ZA 3BKZA 2E7AA 3ZIWA 5KHHA 5I8SA 3FBYA 3WF3A 3VZJA 3E5UA 5A3LA 4XJAA 5A32A 4NVPA 3AC0A 4QQPA 4CXXA 2DYCA 3J26N 4LA3A 2ZGTA 3PMEA 5IYYA 2W3JA 3NAPB 2AC1A 1RUG3 2ARBA 3CKHA 4NN0A 1LAJA 4YYOA 3WR0A 4CP2A 3RRDA 1JHNA 3DYOA 4MGIE 3J7MA 5FXXA 2RR11 2VNOA 2GU9A 1CAXB 1GZWA 2JG9C 1LGNA 1HIXA 5JOWA 2FDIA 5FPAA 4F83A 1ST8A 3PUHA 2HWD2 2GN3A 2FDKA 4XUPA 4FFGA 5ISLA 3Q9OA 2BP6A 2HBUA 1Z7S2 3MW4A 4HVRA 4KG0A 1JYNA 3USUB 1DP0A 2BTVC 2VNGA 1AL0G 3OY8A 2EXKA 2WFF3 3PUAA 1D4M2 5M0TA 4IEXA 1GANA 4LHSA 3OTFA 5L7OA 4R9AA 3M2MA 1WLWA 3H3UA 4XMIA 4YFWA 1YQ5A 2OVUA 4NHLA 2ORXA 3THDA 4DEQA 4AEJA 3QBQA 2X29A 4N9IA 2VUCA 5KHJA 2PLV2 2DURA 2D5HA 3N9OA 3NNLA 2OYZA 2DTWA 4CSWA 2RS11 4FCAA 1JYCA 1J84A 1B35A 2ZHNA 4DY5A 1L3JA 1JHJA 3S7EA 1HQLA 3ZIXA 4ASMB 1XYPA 4EZ4A 3ACIA 3KGZA 2X53S 2ZEXA 4CDUC 5L7OC 1ZA4A 2C0ZA 2Y6HA 2ZTNA 2R16A 3N9MA 3NKGA 1IKQA 4DUVA 3I2DA 1J1LA 4XCBA 3N9PA 1SMVA 1V0AA 4FXGB 1ZBA2 5I91A 5IAVA 1L7QA 4LTAA 2CU5A 3MUY1 3H8OA 5L9BA 1R64A 1LU1A 1TVGA 1B35C 4CCMA 3TOJA 2R1BA 2C24A 4UFJA 1AYM2 5FWEA 2RS53 2D6NA 2VUAA 1DGWA 3MEPA 4BQYA 1YFXA 3D0SA 4AHWA 3HEIA 3K75B 5L19A 2D6PA 3I2JA 5BNPB 1MEC2 4LA2A 3NW4A 2RJLA 3I3BA 1RUH2 4DINB 4NIGA 1IPJA 1YQ6A 1U5XA 2P3YA 2WC2A 3LGRA 1BCXA 5FO8B 3EXUA 3NAPC 5FZEA 3USUA 3BOPA 2VUJA 3DCQA 5CAZA 1QJX3 1V6LA 1OA3A 3BCWA 4M4RA 4NHMA 4XAEA 4HBNA 5APAA 4E8DA 1AR91 3IIAA 5JVVA 5KR7A 2PHTA 2AEZA 1DFQA 4P5HA 4AR2A 3BIEA 4OLLA 1RTVA 5DDJ3 1G9BA 3I59A 2MPFA 2B42B 3OGSA 4IETA 3KHBA 3IN9A 3MIGA 4OHZA 1OA2A 3ZYPA 4GD4A 2I07B 3RWKX 1LODA 1NLRA 4AEMA 3S5QA 2JDMA 1UY3A 4CU9A 2HWF2 3ZFFB 3OBAA 1DZTA 3JXSA 2JDPA 4XDOA 1YFYA 5FZ4A 4I30A 2QQJA 1HB3A 1Y3TA 1NQDA 1XOYA 4CDWB 2NM1A 2QJVA 4UXAA 3LA7A 2J1EA 2XWBB 3ZKYA 1H4HA 5HXVA 3JB4C 3H1MA 4OFGA 5BNNB 2RS31 3DEMA 3HN1A 2B8MA 2ZGRA 1PGL2 1YUDA 4N7UA 2BRTA 5FYCA 1CAWB 1DQ4A 1SPPB 1LGBA 1G7YA 2RE9A 3DPRB 3LFMA 4E8CA 1HV1A 5IVVA 3BTXA 4P08A 3WQBA 2JXAA 1GNYA 1OUXA 4HKWA 5BNPA 1SLLA 3C7GA 3JBG1 5DMYA 4LXLA 3PHMA 3WP5A 3EHKA 3R4DB 1H9PA 1OSGA 3E6CC 5DG2A 4H55A 2XR4A 1AR82 4L9BA 4QXCA 4UWDA 4YW5A 2PTMA 4K9SA 1OOPB 2ZMKA 3RJ2X 2HWD3 1QJU3 2ZGSA 4MHUA 1RHI3 2XJPA 2O0OA 1JOPA 1KJRA 1XSQA 4FPKA 4FO9A 4S2GA 2XLFA 5C5UA 1APNA 1UZ0A 4NAMA 3EMRA 4Y22A 3LB9A 3U4SA 1EV11 3WHTA 4PF5A 4SBVA 2VCBA 3LEKA 2ERFA 4B1MA 5DUWA 1O3QA 2G1MA 1UO9A 4AQ6A 2UWBA 3IAPA 3T4HB 3FJSA 3UK9A 2WKKA 2PLV3 4AVBA 3THPA 4GAZA 4LE3A 3ZFFA 3JQXA 5I0TA 5JPNB 2UY8A 3TAYA 3B01A 3O1UA 3KMHA 2DCTA 1LECA 2ZS6B 5SV8A 4C0HA 1MVEA 4Q4Y1 3WHUA 4CDWA 4Q4V1 4K8RB 4HVOA 4XFAA 1QMJA 4W50A 3LOIA 4B8EA 4PI2A 4XCAA 2HWB1 2XUMA 3AP4A 3J4UH 5B4NA 1VRBA 2FZ2A 4FFHA 4AZZA 3B94A 3GALA 1AJKA 1SPPA 3CO2A 1OKQA 4A6SA 1S0JA 2GZWA 4QGLA 3DPRA 4YZ5A 4RGAA 1LHWA 3AFKA 3WOGA 4YGCA 1FV3A 4IEUA 5A7SA 5FOBB 4GIQA 3TB0A 2A6XA 4CDWC 2ZBJA 3GYDA 3L9JT 2P3JA 3HJRA 5BNNC 1WBLA 1PIV1 3D8CA 5DAXA 1US2A 2RVAA 5LBFA 3WCRA 2NYYA 1MEC3 3MW2A 4HPKA 2YC2A 5K0UC 2BBVA 4MUVA 4C0BA 1AL22 3KF3A 3MO4A 4IGOA 1OOPA 4LNVA 5CKNA 4CEYB 4RN5A 3NJXA 3N7KA 3WQ7A 4M3CF 2G9GA 3SXWA 2D44A 4KMQA 1UMZA 3C8XA 3R6SA 2LW8A 3AKQA 5HV4A 4RSUA 5FBJA 4P9JA 1MS5A 1WW6A 5A7OA 1W2TA 2Q8DA 1E5RA 2BZDA 2ZAHA 2VMIA 3I2KA 3MZHA 2IWGB 1RUNA 1SG3A 1OOPC 1TMF1 4OHYA 1KXGA 1WBFA 4Y33A 2MEV2 2O8OA 2CAUA 1COV1 3OGJA 5G04L 1IPKA 1XYNA 4CCNA 1QXRA 3GZUC 3AJZA 4XUNA 2HWF3 2Y6FA 3RGBA 4XZPA 1UXZA 3GHNA 1AXZA 4OMDA 4AEDC 3ILFA 3HNMA 3WD5A 2HWE1 3IPVA 1DQ6A 4FPCA 2VBPA 3AYCA 5DG1A 4JVAA 2K0GA 3PVNA 4CPBA 3T1LA 2NQYA 3ECQA 5FYBA 1ZZ6A 3PLQA 2ZKNA 3ZYFA 3S5AA 3VBHB 1RUI2 5HXMA 3ZXAC 1ASJ1 3ZN4A 1MQTB 1AX0A 1ENXA 2JWPA 3A0NA 1C5HA 1W6NA 1W9YA 1RVF1 3RFRA 2WLPA 3UKVA 4XMAA 5BNOA 3SCGA 1VJ2A 4U2AA 2H0BA 2XJTA 2Y64A 4I09A 2V73A 5DUXA 1W90A 2Y6LA 4YM2A 3POWA 4BOWA 4OYUA 5DPNA 3ALQA 2OW4A 1DYPA 3HQUA 1W0PA 3A7QA 3FX3A 4RFT0 4CEYA 3H1YA 1AR83 5FZ0A 3IDBB 3NRUA 2W46A 3I97A 1ZZCA 3IAQA 3VDAA 4QQLA 4GJYA 4AI3A 5JAXA 2ZGQA 4QX8A 4R4XA 3WP6A 1UY2A 3WNNA 1KD7A 2X5IB 4AGGA 1Q56A 2WZPP 3J8F1 2ZEZA 5EHDA 1MS0A 1ND3C 4D6QA 2B39A 1JH5A 2VZQA 2D6KA 4CEYC 4E9KA 4OQ8A 1BMV1 1OH3A 3CU7A 1UMIA 1I3HA 2VOKA 1VBC1 4QWNA 4YZ3A 3NNGA 5FK8A 2JB8A 4HOOA 3U37A 2IXLA 2GNDA 1X9TA 2V72A 4Y1YA 3ZXJA 1XC6A 5IVJA 1EAH3 1ZBE1 5C3PA 2BERA 4FP3A 3TRSB 5JXHA 1UY1A 2A6ZA 2IFRA 3W58A 4BQ4A 1C5IA 3DGTA 4AGRA 3ZXFA 2C5DA 3PVOA 5JXIA 4NIDA 5FR3A 4E4SA 5BY5A 3S6PA 5JI7A 1HRV1 1M4WA 4AE2A 2XGXA 4IEOA 2PHLA 1NXD1 1F4AA 1QJY2 3LOBA 2VAUA 3ZR6A 5JSRA 3AZZA 2YU1A 1HDKA 4CEWC 5FQ0B 4XJUA 1OHFA 1NCRA 1STMA 1RXFA 4FTEA 1GP4A 2WNVB 2BVBA 2XLGA 4AAPA 3EYPA 5LK5A 2WQ4A 2P37A 2P1BA 2PHUA 4XF0A 1WMFA 4NMIA 3LIGA 1V9U3 2P2KA 4JKLA 5I0UA 5FYIA 1OPMA 3T4VA 4BYYA 1C8M1 2TEPA 3B5LB 1H6YA 1H8TB 1S55A 2EAKA 4WVZA 2WO2A 2QCSB 4QM8A 4BIFA 1R1A2 3KV6A 4LLOA 3LWCA 3VBHC 2W1SA 3Q8BA 2WJSA 2Q8CA 1WW4A 2D6OX 1AL23 4LO4B 4BCUA 1MQTC 2GMEA 4XFFA 4XFCA 3J7LA 1LKNA 3LFIA 3TBDA 2YZ4A 2D6LX 3ZLIA 1I1EA 4NPMA 1M06G 2D5FA 3DKWA 2X5IA 5LEJA 4Z92B 3S7IA 3H9AA 3VBUB 2VGDA 1S1AA 2VJXA 5IW0A 2J7MA 1TNRA 3LF7A 1PNFA 1J58A 2YY1A 1JZ8A 5FYYA 1GMMA 1KQRA 4LBQD 4AI1A 3ORJA 3VN4A 2VOXA 4I0WB 4A41A 2MEV3 5A3WA 2JD9A 5J3UA 1H2MA 3WNKA 4BQWA 2OZJA 5HCFA 4OHXA 3CHXA 4IEVA 1W28A 3OEBA 1QOTA 4ZKTB 5CB7A 3ON7A 1LHNA 2XH6A 2DVAA 1LRHA 1RUG1 4YVWB 2DTYA 5EXOA 3TEXA 1FNYA 1AYN2 4LBMA 3E5QA 4V2WA 3C7FA 2XOMA 4AL9A 4ZPIA 1S0GA 5FQ0A 1PO12 3W5NA 2GC1A 3MV11 4OVEA 5EQUA 4LUKA 1RUJ3 1O4ZA 1OI6A 2BEOA 2W0XA 1JTZX 2WNVA 2KD7A 2OX0A 1N3OA 3KD4A 4RA0A 4UF0A 4FAGA 4Y1UA 5GZCA 2VZOA 4A44A 3RG0A 5A3UA 1BEV2 4UW4A 3EBRA 4HONA 1QGLA 4M0NA 5F3IA 2O8QA 2XQXA 3SITA 3I49A 2WFF1 1IKPA 2E31A 4MV2A 3ZXKA 2JDUA 2GNMA 4Y24A 1UIKA 1PGW2 3FZ3A 2IZWA 5FPZA 3WCSA 3SC7X 3OUJA 3DECA 2P17A 2WNVC 1JZ3A 4QPIA 4FPYA 4Q0QA 1TME2 1Q3EA 2JB4A 1H0BA 3PIJA 3VBUA 3I7DA 1HQWA 2BGOA 1H8TC 2W95A 3PMSA 4QKDA 5D21A 4NO4A 3ROUA 1WCDJ 4K6BA 3Q8EA 4XZUG 2IXCA 3OJBA 4BQ1A 5FZ1A 4WVWA 4BK4A 4ZZ8A 2A7AA 4DPNA 3O1SA 1A8MA 2F4PA 1XYOA 3UKNA 1JN2P 1PO23 2QQMA 4QDRA 1UWWA 3ETQA 4E2GA 4HN0A 2ZPXA 4D69A 4O9GA 4JGYC 4N90A 5AC92 2EXJA 4O7XA 1HB1A 3D5OA 2P6HA 2DVGA 3OB8A 4YVWA 2QDNA 5J37A 2RS51 3D3AA 3Q8AA 4NRPA 4QQHA 4XJZA 3P3NA 1NKGA 1ZA7A 3N35A 5FMOS 2W39A 1UU6A 1DLLA 5FWJA 2VY0A 1UZZA 3QH6A 4QMAA 3URFA 1ZRFA 3BTZA 4LO6B 3WNMA 4BE3A 1VBB2 3WZ1A 3OEAA 4XQWA 4ARYA 5F9TA 2DFBA 1S2EA 2AUYA 3RQ0A 1FMD2 2JE8A 4ZU4A 1QJX1 4AVTA 1N3PA 3N7LA 1SCSA 2OQ7A 4MGKE 3HT1A 4AHZA 4IL7A 1R1A3 3T2PA 5FYZA 4Q1PA 4YG6A 1O6UA 2H6BA 4GJZA 5DDJ1 5FY9A 4OI1A 5AVPA 1OLRA 3OGRA 4MLOA 4C91A 4CUCA 5T5LA 2WNUB 5FPVA 1JU4A 1VBE3 4MHRA 1DG6A 3O14A 3GJBA 4HMZA 4Z2AA 1QNWA 4TSVA 2Q1FA 2Z5WA 4XUQA 1Y43B 5LW9A 1JYTA 2VH9A 2VZPA 5FUPA 1NY71 4XAAA 2WO1A 3BU7A 1W6PB 4HT1T 1IHMA 3VKFC 5FPLA 3WDTA 2AEYA 4NR1A 3A0KA 4UBGA 4OZOA 5ABJC 3LEGA 2WN2A 5DZFA 1NT0A 5IJRA 3GHMA 3O0WA 4QX1A 4XC9A 5BV6A 2ZX0A 4QX5A 2CY6A 4BZ4A 5C8WA 2OXBA 1LEDA 4ZS2A 3O7OA 1R082 3LDKA 2B4KA 1SLIA 3ASIA 4XETA 2D3PA 2D3RA 1AYN3 3NV3A 4R9BA 4UFKA 4XBQA 5GLZA 4EN0A 3ZYRA 3WDXA 5J09A 4RR3B 1PO13 3JB8A 3O1OA 4C8DA 5HCHA 2DBIA 4GXLA 3FHQA 4Q8KA 2YV8A 1J83A 1NYWA 1O7FA 4FQ4A 2HWD1 3WUDA 5EV7A 1QJU1 2A71A 5AFBA 1EPWA 1RHI1 2VTFA 1OQEA 2CAVA 2Y34A 1BEV3 2X05A 3MBWA 5T5PA 2H6CA 2YDEA 2YGMA 4JHTA 5A7WB 2XKOA 3HR9A 4LIUA 3WG2A 4QX0A 3NMBA 5LY2A 4MZUA 5D2AA 1XNCA 3AZXA 3OPWA 3V0BB 1W2AX 3AP6A 4J1XA 2YPJA 4GWJA 2ZGUA 1SZBA 2WNUA 2BJSA 3EJKA 4LBKA 5B4XA 1JU3A 4LO8A 2XMLA 1UYPA 1VB2A 2ZHKA 5EWSA 2PLV1 2D7FA 5FP3A 2A75A 4P9IA 1HLCA 2R6QA 4FOWA 1DU3D 4DO0A 4RQPB 3OUIA 3WNOA 2PHDA 1W6PA 1VAKA 4XJ9A 5DZGA 5F5IA 3C2UA 2ZX1A 2WNUC 4LBLA 1UY4A 2EF6A 4K1ZA 4P9WA 4A3ZA 3BPSA 4BHPA 2PYTA 5KHKA 3K46A 5A6ZA 4IW3A 3AKSA 4LPLA 3UYJA 4XYXA 5GM0A 3ZFEB 1BVVA 5CVRA 1LGCA 4IEPA 3V64A 4PDWB 3HNBM 4Z07A 4YGEA 2CDPA 4GB32 5C3OA 4XACA 5KXCA 1DDLA 3RVHA 2ZGNA 4CP0A 1T6BX 1YI7A 1V6OA 3HQXA 4OHVA 4P9LA 1MEC1 2K9ZA 4J1WA 5LRSA 3POEA 3VKMA 3ST7A 4NPRA 1EUTA 3VD9A 2W87A 1LB2A 1VBB3 2D6MA 3NVCA 3UGGA 3H7JA 5ANQA 3J7NA 3A23A 1PVXA 5A7WA 1FMD3 1NZCA 4UW5A 5LRRA 2XJUA 5I0DA 2VZ1A 4EN6B 5A32B 5JXGA 4LKSA 3VD4A 4I3PA 3ZXGA 4RR3C 5GJ6A 2GP5A 3CNAA 5IVBA 4MGTA 3UESA 2ZX4A 3T0BA 5FZHA 2OZ6A 5FZ6A 1PZ7A 5F1RA 4N53B 5C3RA 1JYVA 3EB7A 1KDMA 2PQSA 3M7AA 2XG3A 2GSYA 3AMPA 4L97A 1CVNA 1HJGA 4B4RA 5CG9A 3NQHA 4RQPA 4HFSA 3FLRA 3DXTA 2HWF1 2W08A 4YRDA 3WQ0A 3T0DA 3MPPG 4BM8A 1CD3G 2WWSA 1SLAA 1GQHA 1HJFA 1O4TA 3W5MA 2ZJCA 4A3XA 2Y6GA 4YW7A 2FDJA 3B00A 3OY8B 1OVPA 1N1SA 5A6XA 1XXNA 1Q43A 2VECA 4IV3A 4M3CB 3NV1A 3DXUA 2VPVA 4IE0A 4XQDA 3SEPA 5KWRA 4IE4A 1R1ZA 4D0QA 3ZKUA 4A7YA 2KXLA 4WVMB 4I0AA 1TE1B 4PQ9A 1WLDA 4QXHA 3RZZA 5JOYA 1R083 4LITA 1NQJA 2VMHA 3MV01 2D98A 2CV6A 2WA4A 4O65A 3RYKA 4LO7A 5FLJA 3ZFEC 2Y8KA 3USSA 2XHKA 3OOXA 4H3WA 3T30A 3QD6A 5F7UA 1JZ5A 1VLNA 3I3MA 1AR81 4AW7A 2R043 1O4YA 2Q1MA 4PDWC 5JZGB 2HH9A 4M00A 2OPKA 4XF1A 1AF9A 3K4ZA 1O3SA 2BOJA 3HQRA 4FTSA 1LNSA 1UXXX 4QU1A 4AQ2A 3R05A 1CJDA 5HPOA 1XE0A 1KRIA 4META 3KF5A 1CPMA 4N53A 2WYFA 2VG9A 4HG6B 1YRZA 2WS92 2ETEA 1U5IA 1UN1A 2VZVA 2XVGA 2ZXQA 3P3PA 1EAH1 4FAHA 5KC6A 1DBNA 1QKQA 3BYWA 5A3PA 5L36A 5A3MA 1VRH2 3B9CA 3ATGA 4OHWA 4KQ7A 4XF4A 3KCCA 1RMU2 5FMCA 2B9UA 3MW3A 3A21A 4N53C 5IVEA 3DL3A 3ZSJA 4Y1VA 2YG0A 5FZCA 3N4MA 1UKRA 5IWFA 1GSLA 5FAXA 4TZDA 4M3CA 4D7YA 4FOVA 3LDBA 2RDQA 4NWVA 3I2FA 3GZAA 5BNQA 1OLMA 2P6CA 3JD72 1F9KA 1WCKA 3UJQA 3SH3A 4FPEA 4WVMA 1G9DA 1VB4A 3VGIA 2FDGA 3I59B 1E5HA 1QJFA 2EICA 4B7EA 1UZVA 3WP4A 3VL9A 4W6WA 4R8HA 5I0RA 1V9U1 1ZNPA 5EFUA 1W6MA 4QB1A 5IFPA 2G9ZA 2W2IA 1ZRCA 3RNSA 1AL21 3B7MA 3FUQA 5JZGA 3AB0A 2J1AA 5LK7B 1CX4A 2JG8B 5F39A 1WZXA 4UFLA 4G3YC 2PHFA 2K46A 5FUIA 4M0HA 3NV2A 1S0EA 1OD5A 4HKOA 2BBAA 2UU8A 4MGQA 1W03A 1ZVFA 3I3DA 4TLGA 4YGBA 3VD7A 1LJ7A 2NP0A 3RSJA 5CA6A 4XFIA 2QFEA 4AI8A 1XPWA 4UFIA 2P5BA 2ZGOA 4HLTA 3CJIB 4A42A 4AYUA 1YQCA 2WZR2 2Q8OA 4ARXA 1WA4A 5FY0A 2MEV1 1UOFA 4GKYA 3LD8A 2PN5A 2CGNA 1QNYA 1RUF2 4GULA 3VZMA 5JLVA 2W94A 2XJRA 3ZYGA 5IVFA 1IQDC 2J42A 3KCXA 5LBEA 1C4RA 3RZJA 2VZ3A 1JI6A 5A3OA 1D7PM 1YIPA 5A33B 4I2OA 1S0DA 4AGVA 3CZUA 4BU2A 3ZYIB 4OI2A 1W8WA 1YC61 2PAEA 1QWRA 4Y22B 1I5PA 1F5JA 3MICA 3MUZ1 4ISRA 4R52A 3HBZA 5GKAC 3K51A 4TWTA 5DXDA 1FI2A 1RUJ1 2VBDA 5FZDA 1Y9QA 1UAIA 1YCIA 3P5BA 4HK9A 1PVC3 4JAAA 4QKBA 4A6OA 4LKEA 2QZ3A 2SLIA 4PCRA 1DGRA 2RV9A 4YG0A 4BXFA 3E97A 1WMDA 1RB8G 2XJVA 1VAMA 1QOSA 1ZZ8A 1NUKA 4FOQA 2P34A 5FTTC 4KWKA 2W52A 2Q8EA 1D4VB 1R093 1L7RA 2RJ2A 1XSRA 5E89A 3RS6A 5LWBA 2B7YA 1DYKA 1XBFA 2QQVA 4LK7A 2JG8A 2ARCA 1PNGA 1UYZA 2BV4A 3T0AA 2YXSA 3GM8A 3HBKA 1CONA 4FOYA 4XJWA 3KV9A 3O0XA 3BPZA 1YHFA 4YM0A 2DU0A 1YQ2A 4QDSA 4XIOA 3TNQA 1VIWB 1YQ8A 1UPSA 3CJXA 1CZTA 1PZ8A 1GV9A 4XFGA 3CJIA 4Q0UA 5GZEA 3S57A 2VMEA 5CADA 2WT0A 2BW8A 2W5FA 2VZSA 2VVEA 4Y4YA 2VO5A 3AP9A 4OUMA 4NIIA 4NHYA 2BGCA 2WS93 4A45A 5ACA2 2VXRA 4PBOA 3M3OA 1PO21 2DFCA 2HJIA 4HPKB 1SFPA 3O1RA 4Y5SA 3O1VA 2WA3A 1VMFA 2BYVE 2QQKA 1K5MB 1VRH3 5A33A 2ARXA 1O3RA 1Z7S3 1F4HA 3CJIC 5BNPC 1US3A 3PURA 1NA1B 4HSLA 5JMOA 1BBT2 1SBEA 3JZVA 5K9YA 4YZ2A 4OUSA 3I8TA 1BK0A 1D4M3 3IM0A 4L0PA 5FO9B 2BUKA 5EYXA 3WEZA 4D94A 4DXSA 2ZGMA 4QX2A 2XJSA 3GGLA 2GC0A 2WT2A 4M3CE 2AREA 2RMU2 2ZHMA 3AK0A 4TTGA 3K77A 4LIVA 4MVTA 2ZABA 2GDFA 4CXWA 4LR4A 3OG2A 3MF9A 3PU8A 4CDXB 3WW2A 2YB7A 1O8PA 4AHXA 4ET7A 1ENSA 1HRI2 3OYWB 1ZX5A 4AVSA 2UYAA 1Y9MA 2VUDA 1YLLA 5AVAA 1BKZA 1TNFA 4K40A 1R1A1 2E7TA 3W9AA 2Y33A 2XDVA 5FZ9A 2VW2A 2CNAA 1KS5A 4YWAA 3ZO0B 4YARA 3M3EA 3IPVB 1UL9A 1AVBA 1SACA 3WG3A 1ZBA3 3HAGA 1VBE1 1YI9A 5DN2A 4LBJA 1X36A 3T2TA 3VL8A 3ZFFC 3Q8CA 2RDSA 3N7JA 2CHHA 4EROA 1I9RA 3AKRA 3CEWA 5A6QA 5IK8A 1WLTA 3OSDA 3ZMOA 1AYM3 3NJYA 5SV5A 3V0AB 1W0NA 4NRQA 1S0IA 1W6NB 1UCXA 2A3XA 3SCFA 4YGDA 1JZ6A 5BNOB 2BWAA 1NE4A 3VHOA 1S0CA 1A78A 3CIHA 1IG0A 1RUH3 2J1UA 2GH8A 3DPRC 1K5MA 2Y38A 1ENRA 1RUF3 3LKJA 2ZMNA 1MVQA 5E88A 5FY8A 4LO5B 1DHKB 3JQWA 1NA1A 2XBO2 4PIXA 4CU6A 2WYSA 4OCTA 1CPNA 1VBA2 2WN3A 5FPXA 1J59A 2W92A 2BDRA 2EA7A 1AYN1 4DNYA 5JCTA 4WM8B 1XJAA 2QTWB 1POQA 5JR2A 1PO11 2IXJA 4ISQA 1K5MC 4YVSB 2JJ6A 2RM22 2LROA 3LPGA 2R072 4MXWB 4FQZA 5FFOC 5LASA 4ATEA 5J48A 2FHRA 3AKPA 3IDAA 1HW5A 2NPIA 3MIDA 4N7IA 2AH2A 4CDXA 4LKDA 2G4IA 5C9AB 2DWRA 1OQDA 4OI0A 1BEV1 3OYWA 4INDA 1E57A 3ILRA 3X29B 4D7TA 4KL1A 4AWDA 3HVDA 4WV8A 1ZREA 4E4ZA 2WO7A 3D4KA 4B4QA 2FCVA 1PGW1 2XB6C 1W2UA 3AYEA 3GCWA 3KVBA 5FZ8A 5K4LA 4DY3A 3O12A 2VE1A 1BJQA 4MGZE 2P3IA 2IVIB 3GJAA 1G9FA 4MH0E 4GH4B 1W04A 1TME1 5C8CA 3GF6A 2Y26A 2J1SA 4CUBA 3E5XA 3J9SA 1G6NA 5FKBA 1WKYA 4A7ZA 5IUQA 3VZKA 5KXBA 1E5IA 3V0AA 1NCRB 2ZGKA 2J1TA 2ZEWA 5FJHA 4ZHNA 3L2HA 5JIUA 2OUJA 3K4DA 5FZIA 1OT5A 1W8ZA 4Q26A 3VUOA 4NOTA 4ZZ5A 2R0FA 4QPWA 3UL2A 1AJOA 1GOGA 4COZA 4QX7A 1DQ0A 2VBBA 4IDZA 5FK7A 2BFUL 2V5YA 1H4GA 2XONA 4AHYA 3IB3A 3IZOA 1SQ4A 5EPAA 4YW3A 1H1MA 1Y4WA 5BPXA 2EIGA 3GCXA 3KHCA 4FPHA 4EE2A 1X33A 5BNOC 2EIBA 4WM8A 5A7QA 1BBT3 1WCSA 3LE0A 1T2XA 1GKBA 3GBWA 4YVSA 3ES4A 4MXWA 1W9SA 2LALA 1UQXA 1H2KA 4GWNA 3M4FA 5C9AA 1KFXL 3VBOB 1VBB1 4Y5TA 1GZCA 3POSA 4S2DA 2YPDA 3AYDA 1FMD1 4PLMA 5G05L 2RS32 3QOPA 4YM3A 4XBLA 1RUD2 4YW1A 2WWJA 3TEZA 1HRI3 4JRAA 1SLCA 4DUXA 4JTNA 2GNBA 1D0HA 2VCAA 2XUEA 4H7LA 4QAWA 4YVSC 1OMIA 2XVLA 5HV0A 3M70A 5D8AA 1PMJX 1K12A 2A6YA 4GH4A 1GWKA 5C9AC 3SQOA 2CWSA 4RS5A 1PHMA 4Q29A 2AACA 2ZHLA 3FFZA 4A4AA 3ENRA 3NJZA 1CJPA 2ET1A 2VD7A 2ZGLA 3BOWA 4I0BA 2GP3A 3THTA 4COYA 1BVP1 2JDHA 2VNRA 3VBFB 2R062 4UF0B 3KLSA 4DXRA 5FOJB 4FSJA 3U4XA 1IQAA 4COVA 5I8TA 1HV0A 3DYMA 2FZ1A 4Q0PA 1N1VA 3PIGA 4Q0VA 5JSOA 3UJOA 1XNTA 4J25A 4JGZB 3LEIA 4P9YA 3IKWA 4BIOA 3HNYM 4L99A 5FYSA 5IVCA 1GNZA 2QE3A 3RZHA 1NCRC 2QQWA 3E1F1 4CRQA 5T52A 4QPIB 5DUUA 1ND2A 2D3SA 2XBO3 4CDQB 3NV4A 3LA2A 1R081 1VBA3 1FOD2 4KG8A 1N3QA 1FAYA 2PFWA 2ZGPA 3IBMA 4IE7A 1JYWA 1W0OA 3MIBA 3GZTB 3ZSLA 4AFMA 3M3CA 5C3SA 3VD5A 4PJYA 3AMQA 2JECA 2A70A 5LA9A 5JWPA 2A3WA 3VBOA 1OLQA 1YXWA 2RM23 2VNVA 2ILMA 4CZSA 2R073 1H1IA 3PJYA 2R041 4LT5A 2D40A 1W6OA 3FL7A 1PK6B 2VOTA 2FDFA 1PM7A 2X5IC 2OA2A 3UGHA 3N9LA 3NO8A 1DGRN 1Z0HA 2R0HA 2YUEA 1UYXA 2DF7A 2ZA9A 4QKFA 2VC9A 4Y1XA 4K8FA 1W39A 1WD4A 2EAAA 1O8SA 4LORA 5J1XA 3FE5A 4GMP0 4UAPA 4DRRA 3VBOC 1LHVA 2OUHA 4HSJA 1LOCA 1WUVA 3AL5A 1N47A 4GKXA 3NJVA 2EIEA 1KEXA 1PIV2 2MNGA 1XB9A 4Q8LA 5FREA 4DRVA 3R0RA 4Q5OA 5F5AA 1DZQA 3VBFA 4S2FA 5JDBA 1RUI3 1UOBA 4TN7A 4PLOA 2Q4SA 3UNPA 4CCLA 1IS3A 1Y7BA 4TXWA 4JGZA 1ZZBA 1H2NA 1HB2A 3J7HA 4GALA 5DUVA 5GZDA 4N43B 4QB2A 4CVUA 1NX9A 1VALA 4E4DX 2HLEA 1A3KA 2ES3A 5F6KA 3MHZA 5KXDA 2ZMLA 1AR62 3OD4A 1JZ2A 4Q4W2 4ZU7A 4AI0A 4IEWA 4B7KA 2VULA 4EQVA 1DF0A 5L73A 1CN1A 2VQUA 2IXIA 3WG1A 2Z2SB 4CDQA 3ZYJB 1K42A 1TMF2 4Q1RA 5FLIA 3WLUA 4DUWA 4MYEA 3RZLA 2Q1ZB 1COV2 3IWZA 3WUCA 3NSTA 1AR72 1EYBA 1IOAA 1RIRA 1XQNA 4PIYA 4NUBA 4PBPA 2OPWA 3WVJA 3T1MA 2Z4FA 4QPIC 4Q4X2 1PK6A 4XDQA 3BODA 4QKNA 3RZMA 4COWA 2DCJA 2HWE2 3E6BA 3VBUC 1S2BA 5A70A 4BMEA 1GZTA 5F8PA 2VW1A 1SCRA 5CFDB 1X8EA 5AFEA 4KI5M 4Z8BA 1RUD3 5FP4A 2JDYA 1MZ6A 2ZEYA 4YNIA 3RDIA 5C33A 3C7HA 1LOEA 2A1XA 2PMWB 2PXJA 2GALA 3BTAA 2VZUA 3GZEA 3H8UA 1VE0A 3HMYA 4M01A 3NNJA 1QJY3 3LSEA 2C1FA 4NAOA 1HB4A 5BYNA 5EJ1B 5FP9A 1W9WA 1TG7A 1F15A 5LA2A 1UF2C 1BLZA 3QH7A 2R063 4JX0A 2HWC2 4YVWC 1H2LA 4IXLA 4N43A 4N8MA 4JQRA 5I0SA 1CIWA 2R30A 4F7ZA 4BQXA 1NCQA 1CAVA 1X7NA 3AZYA 2ZCWA 4ORFA 3WINE 4SLIA 1ULGA 3J8F2 1O5LA 5DAVA 1J1TA 3O1PA 1Q5OA 1UIJA 2VQTA 5C4WB 5L9VA 1BMV2 1UX6A 4Z2WA 3T3YA 1PVC1 1QU0A 3CLPA 4X8PA 5LZ6A 5H9PA 4AEKA 1VBC2 1BXHA 1QDCA 1UZWA 3ES1A 3IDCB 2VTXJ 5H9RA 4AG4A 1FOD3 3PJQA 3PU3A 1WGPA 4ZU5A 1VBD2 3SHRA 2A73B 3W59A 1R091 2VMDA 1X82A 4HZFA 4KWJA 5LBBA 2IXHA 3N9NA 4U36A 2WIIB 4WM7B 5CFCA 5CBLA 1C3HA 1JMUB 1ULEA 3KSCA 1KS4A 3VZLA 4DXTA 3APBA 3FLTA 5CFDA 2XKPA 1HRV2 1JS9A 3ZDVA 1ONAA 3OD0A 3KS7A 4Z82A 1WD3A 5F2SA 2MHFA 5JI9A 1OQ1A 5CYYA 4JDNA 4X6QB 5A3TA 2W1UA 1IGOA 2WO3A 4FTBA 5FZ3A 2WZEA 3ILNA 4FPFA 2WZ8A 1V6NA 3VKLA 4BK5A 2WS91 4NE9A 3DV8A 4AXOA 5F3EA 2CTVA 1FT9A 1A34A 1MZFA 2NN8A 4XPVA 3ZSKA 1QOOA 3LSDA 3I2GA 1VRH1 1X9PA 2PQQA 2UYBA 3T2OA 1Z7S1 2J1RA 4HXCA 1OUSA 2XQRA 1RMU1 1ZZ9A 1VP6A 2X09A 2BGPA 4URTA 5T50A 1MACA 4BJ0A 3FC0A 1D4M1 5IVYA 4BQ2A 1AR63 2XHNA 3I3EA 5C4WA 4P14A 4OI4A 4Q4W3 1Q8OA 5FYMA 4EYUA 2Y6JA 1F35A 1NLSA 5FZLA 4EN7B 1TME3 4Z1VA 2PAMA 4XILA 1GFF2 1WW5A 5C3QA 2XWJB 2DVFA 2PHXA 3IT8A 3AVSA 1AR73 3MF6A 3MLLA 4KWUA 5F32A 3KT4A 1QEXA 2KM2A 3VBRB 2VM9A 4WM7A 3H8RA 5KBFA 5C4WC 2HEYF 4ZXEA 1ZZ7A 4ZY9A 4QHBA 4Q4X3 1RUG2 1WA6X 5I8YA 2YBSA 5IFTA 5H9QA 1ZBA1 1V00A 2DCKA 2I45A 2VZRA 5FKCA 3AM2A 2VTXA 1CR7A 1FPN2 4IV3B 3MPBA 3THCA 3C3VA 1GQGA 1UKGA 4L2NA 5AC93 1ZM1A 1F8VA 3CZJA 1AYM1 3AJYA 4QGNA 4K21A 3L2YA 1C8NA 3WQ1A 4BQ3A 3OBRA 1RYYA 4EN8B 2WZR1 3ZFGA 5FPBA 3EO6A 5FO7B 5JMCA 2ADEA 1RUH1 4ITCA 4IV1B 4XUTA 2WFF2 1BYHA 1RUF1 4NJ4A 4XE9A 1FV2A 1W06A 4DQAA 5FXVA 5EZWA 2HWC3 4NIAA 1GP5A 3WW4A 1W05A 3DKQA 3KGLA 4NPLA 4X6RB 1UZYA 5LBCA 1JODA 4B29A 1K5JA 5B2GB 5FZFA 1FX5A 3B3QE 4W4ZA 3AXDA 2RDNA 1UPIA 1ZYBA 2JICA 5FY4A 1RJ8A 3PUSA 2ARAA 4HANA 2NLRA 2E9QA 4P9XA 2YC4A 3GBFA 4UI9L 1UMHA 3ZXDA 4KU8A 3POJA 4AVVA 1Q8SA 4GZ9A 1OFNA 1QQP2 1SBDA 5LATA 2Z69A 3W21A 5FYHA 4K20A 3VBRA 4CA9A 4EN9B 1UD1A 4XFBA 1VBD3 2A6WA 3MIHA 1LOAA 1N1YA 5FBZA 3CF6E 4XDPA 5EYYA 4AI9A 4D6SA 5FP7A 4WBBA 5FMOL 2WABA 3AMHA 4A2UA 4KGQA 1POV3 2C9KA 4O61A 2Y0OA 2CYFA 4TYSA 5FYTA 4B4PA 4IQPA 3ZYBA 2BPA2 3HD8B 1PGL1 3KT1A 4UYBA 4Y20B 1OC1A 3KQ4B 1D0GA 2Y60A 4RQPC 4NHXA 1RITA 1DIWA 3VBRC 3VLBB 3F2ZA 4ASLA 2BNMA 3WNPA 4QHOA 2H0VA 2WL1A 1O5UA 3KWVA 4IV1A 3NKTA 4LOTA 1W6MB 1REFA 2VOVA 4JRLA 3UETA 4IV3C 3WX5A 4HKLA 1AXKA 1W8OA 2SBAA 4DFSA 5FCCA 1W99A 1PM4A 4AFAA 4BB3A 1J3QA 2ZOEB 5DDJ2 4URAA 4CDUB 2FDHA 5FMBA 2X8KA 4RHV2 2JDAA 5E1RA 2C6SA 3ACHA 5GZFA 2B45X 1BBT1 1K3IA 1LOFA 4J6GA 1QH7A 4RFRB 4AI2A 4GQ7A 4IGPA 2WAOA 3I2OA 3WF1A 1HQNA 1ULCA 3VBSB 1NY72 1SFNA 1SLBA 4FBFA 1LOGA 3W20A 5F37A 1S2KA 5A7PA 2Y6KA 4KBZA 2E63A 2LTNA 1W2NA 3BN6A 4AVAA 1XNDA 5GLWA 1G8WA 1W6QA 1EY2A 2JG9A 1OVSA 1OH4A 1HRI1 1LOFC 3SMHA 4MG2A 1ZRDA 2YGLA 1RUC2 2XL9A 2VMGA 3ZX7A 1ULPA 1CZSA 4JTOA 4MSVA 1WCUA 3PVBB 4BXSV 2GH2A 1YJLA 5LB6A 4ASKA 5JUVA 3AFGA 4QQOA 4M4PA 2CL2A 1NXMA 2RG4A 4Y20A 1BZWA 3C7OA 4B3NA 5JPMB 2I74A 4AQTA 1FPN3 2GNTA 3JU9A 2QBXA 3M3IA 4XFHA 3WDYA 5T5JA 3RJRA 2OS2A 1RC6A 4PIZA 4GB33 1QH6A 1XRUA 1GUIA 1QJU2 3ELNA 5C7GA 1RHI2 4XOGA 5EJZB 1CGPA 2P4EA 4CCOA 1W8UA 4AOCA 1UOJA 3VKNA 1U5YA 1HN0A 3BI3A 2JDZA 4CDUA 1RUE2 1VR3A 2GMMA 4K3UA 4YM1A 2AZ5A 2XBO1 3O5SA 4IE6A 1MR5A 4LULA 2WQ8A 4XHBA 4CCCA 1VBA1 2R7EB 3G6JB 4XTPA 4UT5A 1JOJA 2GC2A 3OCPA 1A6CA 2D43A 2F6BA 3SEEA 3VBSA 1GNHA 1JUIA 2FBEA 5JZGC 3TYJA 4I01A 1MS4A 1IS6A 1YO8A 2RM21 2VVFA 4LHNA 2KR2A 2R071 4IESA 4Y26A 1QJZA 3WY6A 3HOBA 4PLNA 4D6RA 2WQZC 3TN92 2VOWA 1FNZA 4QQ2A 5CKQA 1QQP3 5J98B 5BXXA 3P1IA 4QT6A 3B93A 3FHAA 3U10A 1S4CA 3B02A 1Z78A 1HXS2 2FCTA 2UURA 4UW3A 3LCPA 4XIKA 2YU2A 3GBGA 2GAUA 5GLVA 3ZN6B 4P9GA 3VBSC 5J36A 1OFSA 3NAPA 2QQOA 3H3ZA 1POV0 2D97A 1NLQA 3D6EA 2CGPA 5CISA 2XLAA 1E5SA 4OUEA 1YIFA 3MLKA 2JEMA 3LEMA 3VB9A 1CAXA 5A1LA 2JKXA 1RUI1 2O14A 1BQPA 1RJ7A 4E2SA 3O1TA 3TNPB 1EP0A 3POGA 1URXA 2BU9A 3POFA 1U5ZA 1VMHA 3BALA 3CL1A 3FN9A 4FP2A 3M1HA 5GALA 2YMZA 2VU9A 4LBNA 1GOHA 4NHKA 1W8TA 2RDRA 1RXGA 4QM9A 1GR3A 4BLIA 4C90A 5K8SA 2OIIA 4JDMA 3AYAA 2YBKA 3IMNA 4ATFA 5C6CA 3ZDSA 1JYIA 5T55A 3M8LA 1AXYA 1H9WA 2E26A 3UT0A 2QQLA 2BFUS 3C7EA 4YG3A 4F8AA 4LK6A 3VHPA 4LJHA 2Y0IA 4RHV3 3ZPYA 1JOBA 2WINB 2GN7A 2L9LA 1OURA 1SLTA 5FY1A 4A7KA 5JXJA 4AFBA 1REEA 1ULOA 5JOZA 1MPXA 5ERLA 2JG8C 4MO3M 1DZRA 5T3NA 1O3TA 1C1LA 3FUOA 1TZOA 3IIIA 4YZ4A 2E51A 4RGKA 3H50A 4GWMA 2XJQA 3MIFA 3WP3A 2RHPA 4EJRA 3OBZA 5C70A 5LY1A 4JKMA 3H0OA 2G9FA 5DZEA 3AZWA 4ZXKA 3ZN6A 1RUD1 3QLQA 3PDQA 5K0UB 4EWEA 1DGWX 2V09A 1SDWA 4LQRA 4W6YA 4XF9A 1UNBA 3VDDB 5A6YA 5EIYB 1RUC3 1RMU3 5CKMA 4JZRA 5DAQA 3P6BA 1YFUA 4OZXA 5T5OA 5FXWA 1ACCA 1X8MA 2WNEA 4AAXA 4BDVB 1W2OA 3AZVA 5FDBA 1XE7A 1ALYA 1QJY1 3HN3A 3SNMA 1OPOA 2WRAA 4WZCA 5F2WA 2AYHA 3JD73 1LTEA 3KM5A 1IZ3A 1REDA 3WDVA 4BPZA 5FZ7A 1OLME 4L11A 4QXKA 1O59A 2R061 5JR7B 2B9VA 3PTRB 4NWWA 5CG8A 2R49A 3PUIA 3VKOA 3LDRA 2O1QA 5CU1A 1C1FA 4IEYA 4CE8A 1WWYA 4PF1A 1OBNA 1YNAA 4KNCA 4X8NA 3H8XA 4MOAA 1DQ5A 1X50A 2W9XA 4YFZA 3QCWA 2C4XA 4D8MA 1JYXA 1S0FA 2XXZA 1RUE3 1CZVA 3U1XA 3WNXA 4AEDB 5C8CB 4LHKA 1XNKA 2RR12 1OXCA 3SISA 3GNEA 4RL7A 5L9RA 1FOD1 3LAGA 5F3GA 3U78A 4XTMA 2DCZA 4RD7A 4MGSA 1EAH2 1AHSA 3KB5A 1XNBA 1IS5A 1WW7A 3V65A 2DUQA 4RYDA 4OQ9A 5J96B 1WMXA 5A1FA 1S0BA 1CX1A 2WZR3 4QPGB 2W91A 1V6KA 3TN93 1HX6A 5BNNA 5FZMA 3FMGA 5FY7A 4R9CA 1ODNA 3K2OA 5K0UA 1CAWA 4PHZA 1Q8PA 2JX9A 1HXS3 5A7NA 3VDDA 1G9CA 5J7MA 3LA3A 2CSGA 3I2HA 4C1WA 4Y3OA 4E2QA 5FP8A 2QQPA 5GLUA 4MXVA 4P5YA 2RS12 1V9U2 4TLFA 1W8HA 1F2NA 2ID4A 5LA1A 2DVDA 3NWKA 2PHRA 3UGFA 1G86A 1TQ5A 4CUAA 4Q2FA 1EUUA 1OF4A 5IK4A 2TNFA 3VHNA 4FXKB 3WF2A 1LULA 3VDDC 2VQAA 1XU1A 1NA1C 5CEHA 4KWLA 1ND3B 2LUWA 3OUHA 1CAUB 1LU2A 2JD4A 3DN7A 1SDDB 3K48A 1YWKA 4LUMA 4MX3A 5C5TA 1ZRRA 2DDUA 3SKVA 1AR61 2YROA 2JE9A 3HWJA 2NMNA 1Q8QA 3HPNA 3MGUA 4I3GA 2DUPA 1NG0A 4Q4W1 4W6XA 2JENA 1H8VA 4GMP3 4RGGA 5D8AB 2VL4A 3QACA 4AEDA 3VD3A 2DBNA 2E33A 1I5ZA 3NNMA 4XF3A 4CDXC 4YZ1A 4RS5B 1IS4A 3RMXA 1AR71 3ABZA 1SHWB 4QD2A 5A3NA 4LBQB 4H2AA 1T6GC 2QQIA 3ZYHA 1LHUA 3LZZA 4CEWB 1G9AA 5CZKA 5KC5A 3H1WA 2N7GA 2VQ0A 3GDBA 4QPGA 1CIYA 3LQCA 1L7LA 4Q4X1 5ACA3 5C8CC 2EXHA 4FFIA 4Y4RA 1AR92 4CU7A 3RMYA 5LA0A 2WAAA 4QPGC 2ENRA 5AC91 1RUJ2 5DAWA 4ZS3A 5K7PA 3MIEA 5CNAA 3PVEA 3VDBA 1ND2B 4NROA 1A8DA 2YYOA 3K4AA 1YJKA 1UU4A 1UYYA 1NZIA 1QY4A 4DMIA
chains in the Genus database with same CATH topology
3ZSEA 1C57A 3S0MA 3RYRA 4XJ8A 2R1DA 1PGSA 3WXPA 3WV6A 2RMU3 1ND3A 4QU2A 1AX1A 3DF0A 2UWAA 2HWC1 4L92A 1CAUA 1W6OB 3RWNA 4CYDA 1MS1A 4WM8C 1KDKA 4FPJA 4HVQA 4DB5A 3AP5A 4W65A 3N36A 3G7DA 2NZ9A 3KQRA 4XEZA 2QNKA 1EPZA 1F5FA 3ZMNA 3AMNA 3AXEA 2BQPA 3JBG2 4L8QA 2WLQA 5LEKA 3ME2A 2W68A 4FPLA 2RR13 1PO22 4LBQA 1V70A 2BVVA 3FLPA 5KHIA 1QXJA 4CEWA 1VBD1 3WG4A 3ACLA 4YSFA 1HKDA 2BWCA 5D8AC 1ULFA 4GH4C 4AFDA 4XXAA 5FLHA 1TEIA 5JIAA 4RS5C 1POV1 5KXEA 3BIWE 1O91A 1EV12 3RI9A 1BK1A 3VBHA 1WMEA 2IXKA 4HN1A 4IEZA 3ZXLA 2UWCA 4D3WA 4G4FA 1ENQA 1MQTA 1V6JA 3R4SA 1DQ1A 4FPGA 5D1IA 3PNAA 1D2QA 4CTEA 2YHJA 1XU2A 1DGLA 2RS13 4JC1A 1NE6A 4AF9A 1LEMA 3AMMA 4DXZA 3INAA 4Q4Y2 1QDOA 4Q4V2 5HI0A 5JSPA 2HYKA 3HT2A 1LESA 3WW1A 1ND2C 2HWB2 1JW6A 3I4IA 1D2SA 1VBE2 5E8AA 4YLZA 3AKTA 3JCIA 5F6LB 1J3RA 2ATFA 3VV1A 2HEVF 4JGYB 3TWIA 4FPOB 4HETA 5IT6A 4O9EA 4LLFA 5JOXA 2KA3A 1JUHA 1QHDA 3WT3A 3ZVXA 1YYNA 2AENA 3NL1A 2HEWF 4JCKA 4XQ4A 4Y1ZA 3OBTA 1LOBA 5T54A 4BMBA 1KFUL 2AGSA 2JE7A 4E27A 2QZ2A 2A3YA 2PA7A 2R32A 2PAKA 2QKDA 1NCQB 3OGGA 1CAVB 1RL3A 2C9AA 4ES9A 3VBFC 2JKBA 3N7MA 3ZSMA 3POYA 1AR93 1GBGA 5IK5A 1FPN1 5F5QA 2FMDA 3MI8A 4AQSA 4JGZC 4UW6A 4GB31 3DUIA 3MLJA 4BLJA 1LCLA 2EVXA 1H8TA 4DZGA 5KHGA 1GZ9A 5BUVA 2IFWA 3VHRA 1FYUA 1RINA 3S30A 5EJ3A 1QF3A 4CDQC 1F31A 4EV0A 5CFCB 1V6IA 1KITA 2DCYA 3A4UA 2ZX2A 3OF1A 4Q27A 4EWAA 1J3PA 2RS33 2VVDA 3WDWA 1ASJ2 3AX4A 4JGYA 2NMOA 5ABJB 1PK6C 1RVF2 5CIRA 2ZKLA 3JUUA 3JBG3 1C28A 1I6XA 2XVKA 4G9SB 1QQP1 4I02A 4XBNA 4AFCA 2I2SA 4K7JA 1SFYA 5H9SA 3D0JA 2VW0A 5HCBA 4AVCA 4XXPA 4ONUA 3WDUA 1GLHA 4IEQA 3SH5A 2A6VA 1RGSA 5HBAA 3O0VA 1QXPA 3FWEA 4WZFA 1DQ2A 1EV13 1LENA 2DUOA 2B46X 2LM3A 4F3JA 4S2HA 4N43C 4YW2A 2Q5TA 4LBOA 4XHXA 3U07A 1NCQC 2TUNA 1OA4A 4LE4A 3R4UA 1V6MA 1ZBE2 4KH9A 2BNNA 5E16A 4N9HA 5TSWA 4Q4Y3 2AR6A 4Q4V3 2RJKA 4Y5Z0 2DVBA 2HWB3 2BNOA 5FRAA 4QPYA 3ZN5A 2Q0AA 4RHV1 4BA6A 2D93A 5ABJA 1FATA 4YW4A 1AX2A 5CFCC 1C8M2 3MFCA 5CFDC 1PIV3 3ZFGB 3AP7A 2E6VA 4QGMA 3RPQA 1U0AA 4KU7A 2DV9A 1MZ5A 1H30A 3MYXA 4ES8A 1RUC1 3BB6A 4FT8A 3OPZA 4MGYE 1AZDA 3V56A 3WW3A 1XE8A 1RUOA 3N3HA 2WFPA 3JD71 1PZ9A 2FMYA 2FQPA 1WLCA 2ZZJA 1NOVA 1GICA 1TMF3 2EALA 4XW3A 1B09A 2CGOA 2R042 4Q0SA 3KT7A 1COV3 2Z42A 1U12A 3U11A 3B9IA 1LHOA 2TBVA 2ZAAA 2ZX3A 1CQ9A 3SLIA 2ET7A 3UV9A 2HWE3 1RUE1 2CWMA 2WSVA 4KBBA 5HCAA 4HL0A 4V1PA 3PTYA 1ASJ3 4WM7C 4DOUA 2XPJA 1GYKA 4H14A 4OULA 2ZZQA 2QDRA 3VZNA 1RVF3 3FBMA 1UW8A 2A5ZA 2ZACA 5GZGA 1ULDA 3H7YA 2PELA 3TN91 4AK3A 4BH9A 1AUYA 3KCYA 4LEJA 1SBFA 2B5HA 2Q30A 4H7MA 1HXS1 1MS9A 4FVVA 4KGGA 2E7QA 2WT1A 1VAVA 1FXZA 3D82A 2E53A 3ZFGC 3VZOA 1H1AA 4JV4A 1SEFA 3J8F3 3RI8A 2PHWA 4RR3A 3RYPA 4CP1A 4WVVA 1PMIA 1N1TA 2WSUA 2IC1A 2XL7A 3IDEA 1VBC3 3E6DA 1LR5A 2YC0A 1Q8VA 1W6QB 4IERA 2JG9B 1ZBE3 5I93A 3HIFA 2DU1A 2HKXA 2RS52 1YFWA 3M3QA 1CESA 3V0BA 4GMP1 4R9DA 4COUA 3ZXEA 3FHIB 4UBHA 4GA9A 1HRV3 4BWOA 4DS0A 3KZ4C 3FFQA 5IK7A 3SCHA 2K2SA 1GZWB 1MS8A 4C1XA 3B69A 3MFAA 2P3KA 1JXNA 1QJX2 1C8M3 5ACA1 1MZEA 1UU5A 5GLTA 1JBCA 2QUOA 3ZFEA 4HK8A 5L7OB 1MS3A 4D7SA 4PDWA 1PVC2 2GC3A 4JDOA 4IV1C 3MDPA 2Z79A 3EQEA 1KJLA 4LHLA 4R4ZA 2UY9A 1B35B 2GMPA 3UKTA 1R092 3I54A 2RMU1 4K1YA 2EXIA 4EWDA 2QVSB 3U0ZA 2E7AA 3ZIWA 5KHHA 5I8SA 3FBYA 3VZJA 3E5UA 5A3LA 4XJAA 5A32A 4NVPA 4QQPA 2DYCA 3J26N 4LA3A 2ZGTA 3PMEA 3NAPB 1RUG3 2ARBA 4NN0A 4YYOA 3WR0A 4CP2A 3RRDA 1JHNA 4MGIE 2RR11 2VNOA 2GU9A 1CAXB 1GZWA 2JG9C 1LGNA 1HIXA 5JOWA 4F83A 2HWD2 2GN3A 3Q9OA 1Z7S2 3MW4A 4HVRA 4KG0A 3USUB 2BTVC 2VNGA 1AL0G 3OY8A 2EXKA 2WFF3 1D4M2 4IEXA 1GANA 3OTFA 5L7OA 4R9AA 3M2MA 1WLWA 3H3UA 4XMIA 4YFWA 2OVUA 4NHLA 4AEJA 3QBQA 2X29A 4N9IA 5KHJA 2PLV2 2DURA 2D5HA 2OYZA 2DTWA 2RS11 4FCAA 1JYCA 1B35A 2ZHNA 4DY5A 1L3JA 3S7EA 1HQLA 3ZIXA 4ASMB 1XYPA 3KGZA 4CDUC 2X53S 5L7OC 1ZA4A 2C0ZA 2ZTNA 3NKGA 2R16A 1IKQA 3I2DA 1J1LA 1SMVA 4FXGB 1ZBA2 5I91A 4LTAA 1LU1A 1B35C 3TOJA 2R1BA 1AYM2 2RS53 2D6NA 2VUAA 1DGWA 3MEPA 1YFXA 3D0SA 4AHWA 5L19A 2D6PA 5BNPB 1MEC2 4LA2A 3NW4A 2RJLA 4DINB 1RUH2 1IPJA 1U5XA 2WC2A 3LGRA 1BCXA 5FO8B 3EXUA 3NAPC 3USUA 3BOPA 2VUJA 5CAZA 1QJX3 1V6LA 1OA3A 3BCWA 4NHMA 4HBNA 1AR91 3IIAA 5JVVA 2PHTA 4P5HA 1DFQA 4OLLA 1RTVA 5DDJ3 1G9BA 3I59A 2MPFA 2B42B 4IETA 3IN9A 3MIGA 4OHZA 1OA2A 3ZYPA 2I07B 4AEMA 1LODA 1NLRA 2HWF2 3ZFFB 1DZTA 1YFYA 4I30A 1Y3TA 1NQDA 4CDWB 2NM1A 2QJVA 4UXAA 3LA7A 2XWBB 5BNNB 1H4HA 5HXVA 3JB4C 3H1MA 4OFGA 2RS31 3HN1A 2B8MA 2ZGRA 1PGL2 1YUDA 4N7UA 1CAWB 1DQ4A 1LGBA 1G7YA 2RE9A 3DPRB 1HV1A 2JXAA 4HKWA 5BNPA 1SLLA 3JBG1 3PHMA 3WP5A 3EHKA 3R4DB 1H9PA 1OSGA 3E6CC 5DG2A 4H55A 1AR82 4L9BA 4YW5A 2PTMA 4K9SA 1OOPB 2ZMKA 3RJ2X 2HWD3 1QJU3 2ZGSA 1RHI3 2XJPA 2O0OA 1KJRA 4FPKA 4FO9A 4S2GA 2XLFA 1APNA 4Y22A 3LB9A 1EV11 3WHTA 4PF5A 4SBVA 2ERFA 5DUWA 1O3QA 4AQ6A 2UWBA 3UK9A 3FJSA 2WKKA 2PLV3 4AVBA 3THPA 5JPNB 4LE3A 3ZFFA 3JQXA 5I0TA 2UY8A 3TAYA 3B01A 3KMHA 2DCTA 1LECA 2ZS6B 5SV8A 4C0HA 1MVEA 4Q4Y1 3WHUA 4CDWA 4Q4V1 4HVOA 4XFAA 1QMJA 4B8EA 3LOIA 2HWB1 2XUMA 3AP4A 3J4UH 2FZ2A 3B94A 3GALA 1AJKA 3CO2A 1OKQA 1S0JA 2GZWA 4QGLA 3DPRA 4YZ5A 4RGAA 1LHWA 3AFKA 3WOGA 4YGCA 1FV3A 4IEUA 5FOBB 4GIQA 3TB0A 2A6XA 4CDWC 2ZBJA 3GYDA 3L9JT 2P3JA 5BNNC 1WBLA 1PIV1 3D8CA 3WCRA 2BBVA 2NYYA 1MEC3 3MW2A 4HPKA 5K0UC 4MUVA 4C0BA 1AL22 1OOPA 4LNVA 4CEYB 3WQ7A 3N7KA 4M3CF 2G9GA 3SXWA 2D44A 1UMZA 3R6SA 3AKQA 4RSUA 4P9JA 1MS5A 1WW6A 2ZAHA 3MZHA 2VMIA 2IWGB 1RUNA 1OOPC 1TMF1 4OHYA 1KXGA 1WBFA 2MEV2 2O8OA 2CAUA 1COV1 3OGJA 1IPKA 1XYNA 1QXRA 3GZUC 3AJZA 2HWF3 4XZPA 3GHNA 1AXZA 4AEDC 3ILFA 3WD5A 2HWE1 3IPVA 1DQ6A 4FPCA 3AYCA 5DG1A 4JVAA 2K0GA 3PVNA 3T1LA 2NQYA 3ECQA 1ZZ6A 3PLQA 2ZKNA 3VBHB 1RUI2 3ZXAC 1ASJ1 3ZN4A 1MQTB 1AX0A 1ENXA 3A0NA 1C5HA 1W6NA 1RVF1 2WLPA 3UKVA 4XMAA 5BNOA 3SCGA 1VJ2A 4U2AA 2H0BA 2XJTA 4I09A 2V73A 5DUXA 4YM2A 3POWA 4BOWA 3ALQA 2OW4A 1DYPA 4CEYA 1W0PA 3FX3A 4RFT0 3H1YA 1AR83 3IDBB 1ZZCA 4QQLA 4AI3A 5JAXA 2ZGQA 4R4XA 3WP6A 1KD7A 2X5IB 4AGGA 1Q56A 2WZPP 3J8F1 1MS0A 1ND3C 1BMV1 2B39A 1JH5A 4CEYC 2D6KA 4E9KA 3CU7A 2VOKA 1I3HA 4YZ3A 1VBC1 2IXLA 2GNDA 4Y1YA 3ZXJA 1EAH3 1ZBE1 4FP3A 3TRSB 2A6ZA 2IFRA 3W58A 1C5IA 3DGTA 4AGRA 3ZXFA 2C5DA 3PVOA 4E4SA 5BY5A 3S6PA 5JI7A 1HRV1 1M4WA 4AE2A 2XGXA 4IEOA 2PHLA 1NXD1 1QJY2 3LOBA 5JSRA 3AZZA 1HDKA 4CEWC 5FQ0B 4XJUA 1OHFA 1NCRA 4FTEA 2WNVB 2BVBA 2XLGA 5LK5A 2WQ4A 2P37A 2PHUA 4XF0A 1WMFA 1V9U3 2P2KA 5I0UA 4BYYA 1OPMA 1C8M1 2TEPA 3B5LB 1S55A 1H8TB 4WVZA 2EAKA 4QM8A 2QCSB 4BIFA 1R1A2 4LLOA 3LWCA 3VBHC 2WJSA 4BCUA 1WW4A 2D6OX 1AL23 4LO4B 1MQTC 2GMEA 4XFFA 4XFCA 1LKNA 3TBDA 2YZ4A 2D6LX 1I1EA 1M06G 2D5FA 3DKWA 2X5IA 5LEJA 4Z92B 3S7IA 3H9AA 3VBUB 2VGDA 1S1AA 1TNRA 1PNFA 1J58A 2YY1A 1KQRA 4LBQD 4AI1A 3VN4A 2VOXA 4I0WB 2MEV3 5J3UA 1H2MA 2OZJA 5HCFA 4OHXA 4IEVA 1QOTA 4ZKTB 5CB7A 1LHNA 2XH6A 2DVAA 1LRHA 1RUG1 4YVWB 2DTYA 5EXOA 1FNYA 1AYN2 4LBMA 3E5QA 1S0GA 5FQ0A 1PO12 2GC1A 4OVEA 4LUKA 2WNVA 1RUJ3 1O4ZA 1OI6A 2BEOA 1JTZX 2W0XA 3AP6A 3KD4A 1N3OA 4RA0A 4FAGA 5GZCA 4Y1UA 3RG0A 1BEV2 4UW4A 3EBRA 1QGLA 4M0NA 2O8QA 3SITA 2WFF1 1IKPA 4MV2A 3ZXKA 2GNMA 4Y24A 1UIKA 1PGW2 3FZ3A 2IZWA 5FPZA 3WCSA 2P17A 2WNVC 4QPIA 4FPYA 4Q0QA 1TME2 1Q3EA 1H0BA 3VBUA 3I7DA 1HQWA 1H8TC 3PMSA 4NO4A 3ROUA 1WCDJ 4K6BA 2IXCA 3OJBA 4BQ1A 4WVWA 2A7AA 4DPNA 1A8MA 2F4PA 1XYOA 3UKNA 1JN2P 1PO23 3ETQA 4E2GA 4HN0A 2ZPXA 4D69A 4O9GA 4JGYC 4N90A 5AC92 2EXJA 3D5OA 4YVWA 2DVGA 2QDNA 5J37A 2RS51 4QQHA 4XJZA 3P3NA 3N35A 5FMOS 2W39A 1UU6A 1DLLA 2VY0A 1UZZA 3QH6A 4QMAA 3URFA 1ZRFA 4LO6B 4BE3A 1VBB2 3WZ1A 5F9TA 4XQWA 2DFBA 2AUYA 3RQ0A 1FMD2 4ZU4A 1QJX1 4AVTA 1N3PA 3N7LA 1SCSA 4MGKE 3HT1A 4AHZA 4IL7A 1R1A3 4Q1PA 4YG6A 2H6BA 5DDJ1 4OI1A 5AVPA 1OLRA 4MLOA 4C91A 5T5LA 2WNUB 1VBE3 1DG6A 3O14A 4HMZA 1QNWA 4TSVA 2Z5WA 1Y43B 2VH9A 1NY71 3BU7A 1W6PB 4HT1T 1IHMA 3VKFC 3WDTA 4NR1A 3A0KA 4UBGA 5ABJC 5DZFA 3GHMA 3O0WA 5BV6A 2ZX0A 4QX5A 2CY6A 4BZ4A 5C8WA 1LEDA 3O7OA 1R082 1SLIA 3ASIA 4XETA 2D3PA 2D3RA 1AYN3 3NV3A 4R9BA 4XBQA 5GLZA 4EN0A 3ZYRA 3WDXA 5J09A 4RR3B 1PO13 3JB8A 4GXLA 4Q8KA 2YV8A 1NYWA 1O7FA 4FQ4A 2HWD1 3WUDA 5EV7A 1QJU1 2A71A 5AFBA 1EPWA 1RHI1 1OQEA 2CAVA 1BEV3 5T5PA 2H6CA 2YDEA 2YGMA 2XKOA 3HR9A 3WG2A 4MZUA 1XNCA 3AZXA 3V0BB 4J1XA 4M0HA 2YPJA 4LBKA 2ZGUA 2WNUA 3EJKA 4LO8A 1VB2A 2ZHKA 5EWSA 2PLV1 2D7FA 2A75A 4P9IA 1HLCA 2R6QA 4FOWA 1DU3D 4RQPB 2PHDA 1W6PA 1VAKA 4XJ9A 5DZGA 3C2UA 2ZX1A 2WNUC 4LBLA 2EF6A 4K1ZA 4P9WA 4BHPA 2PYTA 5KHKA 3AKSA 4XYXA 5GM0A 3ZFEB 1BVVA 5CVRA 1LGCA 4IEPA 3V64A 4PDWB 4Z07A 4YGEA 4GB32 1DDLA 5KXCA 2ZGNA 4CP0A 1YI7A 1V6OA 3HQXA 4OHVA 4P9LA 1MEC1 2K9ZA 4J1WA 5LRSA 3VKMA 3ST7A 4NPRA 1LB2A 1VBB3 2D6MA 3NVCA 3H7JA 1PVXA 1FMD3 1NZCA 4UW5A 5LRRA 2XJUA 4EN6B 5A32B 4I3PA 3ZXGA 4RR3C 5GJ6A 3CNAA 2ZX4A 2OZ6A 1PZ7A 5F1RA 4N53B 1KDMA 3M7AA 2XG3A 2GSYA 3AMPA 4L97A 1CVNA 4B4RA 5CG9A 4RQPA 4HFSA 3FLRA 2HWF1 2W08A 4YRDA 3WQ0A 3MPPG 4BM8A 1CD3G 2WWSA 1SLAA 1GQHA 1O4TA 2ZJCA 4A3XA 3OY8B 3B00A 1N1SA 1XXNA 1Q43A 2VECA 4IV3A 4M3CB 3NV1A 2VPVA 4XQDA 5KWRA 1R1ZA 4A7YA 2KXLA 4WVMB 4I0AA 1TE1B 4PQ9A 1WLDA 3RZZA 5JOYA 1R083 1NQJA 2VMHA 2D98A 2CV6A 2WA4A 3RYKA 4LO7A 5FLJA 3ZFEC 3USSA 2XHKA 4H3WA 3QD6A 1VLNA 1AR81 4AW7A 2R043 1O4YA 2Q1MA 4PDWC 5JZGB 4M00A 2OPKA 4XF1A 1AF9A 1O3SA 4FTSA 4AQ2A 3R05A 1CJDA 1KRIA 4META 1CPMA 4N53A 2VG9A 1YRZA 2WS92 2ETEA 1U5IA 1UN1A 2XVGA 3P3PA 1EAH1 4FAHA 5KC6A 1DBNA 1QKQA 5L36A 5A3MA 1VRH2 3B9CA 3ATGA 4OHWA 4KQ7A 4XF4A 3KCCA 1RMU2 2B9UA 3MW3A 4N53C 3DL3A 3ZSJA 4Y1VA 3N4MA 1UKRA 1GSLA 5FAXA 4TZDA 4M3CA 4D7YA 4FOVA 4NWVA 5BNQA 3GZAA 3JD72 1F9KA 1WCKA 3UJQA 3SH3A 4FPEA 4WVMA 1G9DA 1VB4A 3VGIA 3I59B 4B7EA 3WP4A 3VL9A 4W6WA 4R8HA 5I0RA 1V9U1 1ZNPA 5EFUA 1W6MA 1ZRCA 3RNSA 1AL21 3B7MA 3FUQA 5JZGA 3AB0A 5LK7B 1CX4A 2JG8B 4G3YC 2PHFA 3NV2A 1S0EA 1OD5A 4HKOA 2UU8A 4YGBA 1ZVFA 1LJ7A 2NP0A 3RSJA 5CA6A 4XFIA 2QFEA 4AI8A 2ZGOA 4HLTA 3CJIB 4AYUA 2WZR2 2Q8OA 1WA4A 2MEV1 4GKYA 2PN5A 2CGNA 1QNYA 1RUF2 4GULA 3VZMA 5JLVA 2XJRA 3ZYGA 3KCXA 1C4RA 5A33B 1YIPA 4I2OA 1S0DA 4AGVA 3ZYIB 4OI2A 2PAEA 1QWRA 4Y22B 1F5JA 3MICA 4ISRA 4R52A 3HBZA 5GKAC 3K51A 4TWTA 5DXDA 1FI2A 1RUJ1 1Y9QA 1UAIA 1YCIA 4JAAA 4HK9A 1PVC3 2QZ3A 2SLIA 4PCRA 1DGRA 4YG0A 3E97A 1WMDA 1RB8G 2XJVA 1VAMA 1QOSA 1ZZ8A 4FOQA 5FTTC 2P34A 4KWKA 2W52A 1D4VB 1R093 5E89A 3RS6A 2B7YA 1DYKA 2JG8A 1PNGA 2YXSA 1CONA 4FOYA 4XJWA 3O0XA 3BPZA 1YHFA 4YM0A 2DU0A 4XIOA 3TNQA 1VIWB 3CJXA 1UPSA 1PZ8A 1GV9A 4XFGA 3CJIA 4Q0UA 5GZEA 5CADA 2WT0A 2BW8A 4Y4YA 2VVEA 3AP9A 4OUMA 2BGCA 2WS93 5ACA2 2VXRA 4PBOA 3M3OA 1PO21 2DFCA 2HJIA 4HPKB 2WA3A 2BYVE 1K5MB 1VRH3 5A33A 2ARXA 1O3RA 1Z7S3 3CJIC 5BNPC 1NA1B 4HSLA 1BBT2 1SBEA 3JZVA 5K9YA 4YZ2A 4OUSA 3I8TA 1D4M3 3IM0A 5FO9B 2BUKA 5EYXA 4D94A 2ZGMA 2XJSA 2GC0A 2WT2A 4M3CE 2AREA 2RMU2 2ZHMA 3AK0A 4MVTA 2ZABA 2GDFA 4LR4A 3MF9A 4CDXB 3WW2A 4AHXA 1ENSA 1HRI2 3OYWB 1ZX5A 4AVSA 2UYAA 1YLLA 5AVAA 1BKZA 1TNFA 4K40A 1R1A1 2E7TA 3W9AA 2VW2A 2CNAA 1KS5A 4YARA 3ZO0B 3M3EA 3IPVB 1UL9A 1AVBA 1SACA 3WG3A 1ZBA3 3HAGA 1VBE1 1YI9A 3VL8A 4LBJA 1X36A 3T2TA 3ZFFC 3N7JA 4EROA 1I9RA 3AKRA 3CEWA 5IK8A 1WLTA 3ZMOA 1AYM3 5SV5A 3V0AB 1S0IA 1W6NB 1UCXA 2A3XA 3SCFA 4YGDA 5BNOB 2BWAA 1NE4A 3VHOA 1S0CA 1A78A 1RUH3 2GH8A 3DPRC 1K5MA 2Y38A 1ENRA 1RUF3 3LKJA 2ZMNA 1MVQA 5E88A 4LO5B 1DHKB 3JQWA 1NA1A 2XBO2 4PIXA 1CPNA 1VBA2 5FPXA 1J59A 2EA7A 1AYN1 4DNYA 5JCTA 4WM8B 1PO11 2IXJA 4ISQA 1K5MC 4YVSB 2JJ6A 2RM22 4ATEA 2R072 4MXWB 4FQZA 5FFOC 5J48A 2FHRA 3AKPA 4N7IA 1HW5A 2NPIA 3MIDA 2AH2A 4CDXA 5C9AB 2G4IA 2DWRA 1OQDA 4OI0A 1BEV1 3OYWA 4INDA 1E57A 3ILRA 3X29B 4D7TA 4KL1A 4AWDA 1ZREA 4WV8A 4E4ZA 3D4KA 4B4QA 1PGW1 2XB6C 1W2UA 3AYEA 4DY3A 3O12A 4MGZE 1BJQA 2P3IA 1G9FA 4MH0E 4GH4B 5C8CA 1TME1 3GF6A 2Y26A 3E5XA 3J9SA 1G6NA 4A7ZA 5IUQA 3VZKA 5KXBA 3V0AA 1NCRB 2ZGKA 3L2HA 5JIUA 2OUJA 3VUOA 4Q26A 4NOTA 2R0FA 3UL2A 1AJOA 4COZA 1DQ0A 2BFUL 2V5YA 1H4GA 4AHYA 4YW3A 1SQ4A 5BPXA 1H1MA 2EIGA 4FPHA 1X33A 5BNOC 4WM8A 1BBT3 1WCSA 3GBWA 1GKBA 4YVSA 3ES4A 4MXWA 2LALA 1H2KA 4GWNA 3M4FA 5C9AA 1KFXL 3VBOB 1VBB1 1GZCA 3POSA 4S2DA 3AYDA 1FMD1 4PLMA 2RS32 3QOPA 4YM3A 4XBLA 1RUD2 4YW1A 1HRI3 4JRAA 1SLCA 4JTNA 2GNBA 1D0HA 4H7LA 4YVSC 1OMIA 2XVLA 3M70A 5D8AA 2A6YA 4GH4A 5C9AC 2CWSA 4RS5A 1PHMA 4Q29A 3FFZA 2ZHLA 3ENRA 3NJZA 1CJPA 2ET1A 2ZGLA 3BOWA 4I0BA 3THTA 4COYA 1BVP1 3VBFB 2VNRA 5FOJB 2R062 4FSJA 3KLSA 3U4XA 1IQAA 4COVA 5I8TA 1HV0A 2FZ1A 4Q0PA 1N1VA 4Q0VA 5JSOA 3UJOA 4JGZB 4P9YA 3IKWA 4BIOA 4L99A 1GNZA 2QE3A 1NCRC 4CRQA 5T52A 4QPIB 5DUUA 1ND2A 2D3SA 2XBO3 4CDQB 3NV4A 3LA2A 1R081 1VBA3 1FOD2 4KG8A 1N3QA 1FAYA 2PFWA 2ZGPA 3IBMA 1W0OA 3MIBA 3GZTB 3ZSLA 4AFMA 3M3CA 4PJYA 3AMQA 2JECA 2A70A 5JWPA 2A3WA 3VBOA 1OLQA 1YXWA 2RM23 2ILMA 4CZSA 2R073 1H1IA 3PJYA 2R041 4LT5A 2D40A 1W6OA 1PK6B 1PM7A 2X5IC 2OA2A 3NO8A 1DGRN 1Z0HA 2R0HA 2YUEA 2DF7A 2ZA9A 4Y1XA 4K8FA 1W39A 1WD4A 2EAAA 3FE5A 4GMP0 4DRRA 3VBOC 1LHVA 2OUHA 4HSJA 1LOCA 1WUVA 1N47A 4GKXA 4DRVA 1PIV2 2MNGA 5FREA 4Q8LA 3R0RA 3VBFA 5JDBA 1DZQA 4S2FA 1RUI3 4PLOA 2Q4SA 1IS3A 1Y7BA 4JGZA 1ZZBA 1H2NA 5DUVA 4GALA 5GZDA 4N43B 4E4DX 1VALA 1A3KA 2ES3A 5F6KA 5KXDA 2ZMLA 1AR62 3OD4A 4Q4W2 4ZU7A 4AI0A 4IEWA 4B7KA 2VULA 1DF0A 5L73A 1CN1A 2IXIA 3WG1A 2Z2SB 4CDQA 3ZYJB 1TMF2 4Q1RA 5FLIA 3WLUA 4MYEA 2Q1ZB 1COV2 3IWZA 3WUCA 3NSTA 1AR72 1EYBA 1IOAA 1RIRA 1XQNA 4PIYA 4PBPA 3WVJA 3T1MA 4QPIC 4Q4X2 1PK6A 4XDQA 3BODA 4COWA 2DCJA 2HWE2 3E6BA 3VBUC 1S2BA 4BMEA 2VW1A 1SCRA 5CFDB 1X8EA 5AFEA 4Z8BA 1RUD3 1MZ6A 5C33A 4YNIA 3RDIA 1LOEA 2GALA 3BTAA 3H8UA 3HMYA 4M01A 1QJY3 3LSEA 2C1FA 5BYNA 1UF2C 3QH7A 2R063 4YVWC 2HWC2 1H2LA 4IXLA 4N43A 4JQRA 5I0SA 1CIWA 2R30A 4F7ZA 1NCQA 1CAVA 1X7NA 3AZYA 2ZCWA 4ORFA 3WINE 4SLIA 1ULGA 3J8F2 1O5LA 1J1TA 1Q5OA 1UIJA 5C4WB 1BMV2 1UX6A 4Z2WA 1PVC1 1QU0A 3CLPA 4X8PA 5H9PA 4AEKA 1VBC2 1BXHA 1QDCA 3ES1A 3IDCB 5H9RA 4AG4A<