4ZY9A

X-ray crystal structure of selenomethionine-labelled v110m mutant of chitosan-binding module 1 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
HHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGGIDDITFTARTAKYVRMHGTVRGTPYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
molecule keywords Glucanase/chitosanase
total genus 32
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zy9A00
4P00B 3WF4A 2VMFA 3THCA 5LA1A 2VZ3A 3WNNA 1PMJX 3OGVA 2VQUA 5IYYA 1CZSA 1UY3A 4A45A 3A7QA 5J1XA 1JZ8A 3ECQA 4ZXEA 5A1AA 2XOMA 2VCBA 4W50A 2VMDA 2WBKA 1OF4A 5EIYB 3HN3A 2CDOA 2XONA 4RN5A 4LKSA 1F4AA 3IDAA 1W9SA 2VQTA 2B9VA 2VCAA 1IQDC 1K42A 1UY4A 2YFZA 2J1RA 2WZEA 3DECA 1GU3A 1JZ6A 2W5FA 2ZEWA 3E1F1 2R7EB 3CDZB 2J1AA 3ETPA 2QQJA 4L0PA 2EICA 3C8XA 1GOHA 1JZ7A 5CZKA 2J1SA 1O8PA 3MUZ1 2WO2A 1K12A 3ACIA 1GNYA 3IAPA 5FUIA 1US2A 1MPXA 2J1TA 1WKYA 2RV9A 1ULPA 3UESA 3C7EA 1XNTA 1K45A 1GQPA 3WF0A 3I2JA 1GOFA 2VZOA 4Z2AA 2VC9A 3T2OA 4OZOA 1UYZA 2W1UA 4ZY9A 3PUIA 4DUXA 5HPOA 2VOTA 4A4AA 4CU8A 2E31A 1JHJA 1L7QA 1JU3A 4LHSA 1UY1A 3I2FA 2C26A 1JZ5A 4KMQA 1H6YA 3HJRA 2Y6KA 3HNMA 4LPLA 2J1VA 3HNBM 3CMGA 3DYPA 4DXTA 2W1SA 3MV11 1GUIA 1NAEA 3I3EA 2WAOA 2ZEYA 5JXIA 1W8NA 4CU7A 5LA0A 1JZ4A 5I0DA 1UY0A 3BN6A 1W9TA 2EIEA 4XURA 2Y64A 4MADA 3SKJE 3C7GA 3SEPA 1JU4A 2CDPA 4M4RA 3SEEA 3LPGA 2V72A 3LEGA 4ET7A 2E26A 1UZ0A 4DXRA 1W0NA 1H6XA 2ORZA 4XUNA 3K46A 1OD3A 2VZVA 1P8JA 3VD9A 4JKLA 4PT6A 4LQRA 1O59A 3WNOA 2DDUA 3VD7A 3I97A 3UNPA 3CKHA 1O8SA 2EIDA 3I2KA 4P5YA 1J84A 3GDBA 3P1IA 3WQBA 4CUCA 4DUVA 1D7PM 5C71A 1UXZA 2Y6GA 2L9LA 3ACHA 4FI9A 4OUEA 4A44A 2W95A 3DYMA 5DPNA 3A22A 1TVGA 2WO3A 2JDAA 3FN9A 2QQNA 4DEVA 2WUHA 2QQOA 2W91A 1KEXA 3W5MA 1RYYA 2E33A 3I2HA 2BZDA 2C9KA 2JD9A 3OEAA 1GMMA 3I3DA 1DLCA 3K4DA 3WF2A 2W3JA 2VZQA 2W1WA 3JXSA 4A41A 3T2PA 2BBAA 3SKVA 3NRUA 4MGSA 3FL7A 4QB1A 1K3IA 1OH4A 3NQHA 3WF1A 2VO5A 3OGRA 4CU6A 2WDBA 3LE0A 4XUQA 5EJZB 4CUAA 4QX2A 2W47A 2J1UA 2JE8A 3HOBA 5IFPA 3K4AA 3HEIA 3I2GA 4AG4A 1JYNA 3ACGA 2W46A 1GOGA 3VDBA 2J1EA 2WZ8A 5G05L 1SDDB 2Y6HA 3IB3A 1NUKA 4OMCA 4BDVB 2DCKA 4HG6B 1JYWA 1UWWA 3D3AA 4XVHA 3OB8A 1TG7A 3ACFA 3IIIA 3HPNA 3WNKA 3T0DA 4JHZA 4AAXA 1WCQA 4A6OA 4JKMA 3C7HA 5DN2A 1UMHA 4A42A 3CQOA 4ZZ5A 1UYXA 4ZZ8A 1BHGA 2VL4A 5HXMA 2VMEA 4DUWA 3WNLA 1XNAA 4MOAA 3I2IA 4QDRA 1CZVA 2BGPA 2ID4A 4OMDA 1L7RA 5IHRA 2YC2A 2YB7A 2W87A 4M4PA 4A3ZA 2LS6A 3MBWA 4QX0A 4XUPA 1UYYA 4JKKA 1JI6A 2VR4A 2VZ1A 3I3BA 5JXHA 1UXXX 3C7OA 4QB6A 5JMOA 2YG0A 1W8OA 1US3A 3K4ZA 4QX1A 1UY2A 5JXGA 2RVAA 2DCJA 2J22A 2Y6LA 5IJRA 4GZ9A 3F2ZA 2J7MA 4PQQA 3VDCA 4E8CA 2RJ2A 2VM9A 3A23A 4E8DA 3W5NA 2YC4A 1LNSA 1SG3A 1EUTA 3CIHA 2VZPA 2QQMA 2JKXA 2LW8A 1DP0A 3VD5A 3MUY1 4OYUA 4GWJA 4MGQA 3OG2A 2ORXA 2VMCA 2W1QA 5F7UA 3LEKA 3LPFA 4KWUA 5JR2A 2QQKA 4W4ZA 3U37A 3PUHA 4BK5A 1PMHX 3CZJA 4QB2A 1R64A 3GGLA 2VTFA 3GM8A 3J7HA 4XUOA 1EUUA 2QQLA 2QBXA 2HLEA 2W92A 4QDQA 4IUGA 3EB7A 1W9WA 2EIBA 4QX3A 4TXWA 3WNPA 2W94A 2X10A 4ARYA 3K75B 3P6BA 3NNGA 3EYPA 3OEBA 4BXSV 1JYVA 2WAAA 3T0AA 3LQCA 2OKXA 3A21A 2KD7A 4DXSA 4QPWA 5DMYA 2Y8KA 3AC0A 2VCCA 3MO4A 4PF1A 2VJXA 2QQIA 1XC6A 4W8JA 2PQSA 2E32A 3DYOA 3OGSA 1JZ2A 3OBAA 4P02B 3T09A 2WQ8A 3C7FA 4CVUA 2X09A 1W99A 2V4VA 3FHAA 5JXJA 4XZUG 3VDAA 1DYOA 1T2XA 1CIYA 4MO3M 4ARXA 3NJXA 4YPJA 4RYDA 3GXUA 3HNYM 3VD3A 1HN1A 4JX0A 4D8MA 4BJ0A 5B4NA 3CZUA 5LA2A 4DEQA 1UMIA 1ULOA 2WN3A 3IAQA 1NX9A 2VZUA 1PX4A 3T0BA 1XPWA 2WABA 2ZEZA 3ZM8A 1JYXA 1CZTA 2Y6JA 2YFUA 1I5PA 5DQ0A 4D0QA 3WNMA 3FHQA 4QDSA 5CYYA 1KGYA 4KI5M 2V5DA 3MV01 3WF3A 2VZTA 4UI9L 4BK4A 1UX7A 2XQXA 5G04L 2VZRA 2BGOA 1JZ3A 3WEZA 5C7GA 4CU9A 3NJVA 2Z4FA 5IFTA 2C4XA 2WO1A 3BGAA 1OT5A 2HYXA 4QAWA 2B4KA 2X05A 1NKGA 1PX3A 2ZXQA 5EJ1B 5B4XA 5LCWL 3VD4A 2WN2A 1SHWB 2ZEXA 3UETA 2BERA 3T2QA 4CUBA 4UAPA 4GWIA 4P08A 3LEIA 5C70A 3T08A 5JUVA 1CX1A 4UOJA 3THDA 2WYSA 2VZSA 4TTGA 1OF3A 3ABZA 1J83A 3WSOA 3K77A 4XUTA 1F4HA 1YQ2A 2W9XA 2XHNA
chains in the Genus database with same CATH superfamily
4JV4A 4P00B 4QXBA 3SH3A 5JPNB 4JQTA 4NR1A 2WJSA 1REEA 2HKXA 3KV9A 1QJZA 4Y1VA 4P9XA 1ZBA2 4COWA 2GNBA 1AUYA 1VAVA 3NNMA 4OHXA 5J1XA 3ECQA 1BCXA 2RM22 3E97A 4ZXEA 5KXCA 3VZNA 2E53A 1FXZA 1OF4A 2D3RA 3HN3A 4CDUB 2ARXA 3U4SA 2JB8A 2WWJA 3IDAA 4AFDA 2D5HA 4LBKA 2P2KA 2VCAA 3D6EA 1IQDC 1ZBA3 3ACLA 4ZXKA 3JB4C 3VB9A 4Z92B 3JQWA 3FMGA 5I8SA 3ST7A 1O4TA 3EO6A 4GALA 4JGYC 3RYKA 2J1RA 2WZEA 4XQWA 2RE9A 1GU3A 1QQP2 4IEXA 1JOPA 5CFDC 1S2EA 3L9JT 4HKOA 3AK0A 3W9AA 1L7LA 4CZSA 3E1F1 1RMU1 4YSFA 1S0IA 1LESA 4PLNA 4FPGA 3BALA 4LO5B 5BV6A 1FOD2 3RZGA 1BBT3 1BXHA 4LHKA 1LGBA 1FNYA 1RUI3 2X5IB 3B3QE 4NOTA 2EICA 5BNPA 1C8NA 1ZBE1 3DXUA 3F95A 5LEJA 3AZXA 1JMUB 3KHBA 4HK9A 5HI0A 4PCRA 4JDOA 1O8PA 3FHIB 4IL7A 1MS8A 4KWJA 4UBHA 4JQRA 1W3XA 1CN1A 1KDMA 1SBFA 3MW2A 3ACIA 5LATA 5FUIA 1US2A 3WDVA 4LKFA 3IBMA 5FMBA 4B29A 1W28A 1WKYA 1PO13 2WWSA 2PLV2 1ZZ7A 4I3PA 1YFUA 3IPVB 4HVQA 1REDA 2BJSA 2R041 1GOFA 1SPPB 2R49A 1AR63 2JE9A 1R1A1 2GMPA 3SNMA 3TN91 3T2OA 4OZOA 1E5IA 4AVSA 4C0BA 4Z2AA 1Y9QA 4CDWC 3WX5A 5D8AA 1AR83 1CJDA 2CU5A 3ZYBA 1RUD2 4OUMA 4BPZA 5I0RA 4XF3A 1UOFA 4CU8A 2ET7A 1W6QA 3SXWA 4BQXA 1H4GA 1JU3A 5A7SA 3AYEA 3PUAA 2IZWA 4YM2A 5ERLA 1H6YA 3AYDA 2ES3A 2WT1A 2DVAA 3ALQA 4LEJA 3USUA 1MQTB 4HVRA 1SLBA 3ZIXA 3B9IA 3CMGA 2XDVA 3DYPA 3HNBM 4O65A 5FXZA 2ZGSA 2XVGA 4WVMA 5FYZA 4DXTA 5K8SA 2JG8B 2R063 3MI8A 1FMD1 2LM3A 3RYPA 4YGDA 2XLFA 3LSDA 2ZS6B 3LCPA 5FREA 5LA0A 1CIWA 5EP9A 2OUJA 4LTAA 3GNEA 2WS91 2ZMKA 4KNCA 5FFOC 2BNMA 4C91A 4MADA 2UY8A 1W8FA 3MLLA 1HQNA 4RQPC 2P3JA 2CDPA 1RUJ1 3N7LA 3ROUA 4M4RA 3SEEA 3LPGA 4Z2WA 4XFAA 4NHKA 1RUNA 3HQXA 4QQOA 4URAA 5DAVA 1R081 3MLJA 4YFWA 1FX5A 4M3CE 4HPKB 4R9AA 3P5BA 5FZOA 4YW2A 1AR73 4N7IA 3K46A 1OD3A 3T4VA 1POV1 3PVEA 1WLTA 4YVWC 2XJQA 4LJHA 3VD9A 1MS3A 1AJKA 1XNCA 1H0BA 2ZX2A 2WFF2 5JSOA 3POFA 4XACA 1DGLA 1QKQA 5EJ3A 5C3SA 2WL1A 4B7EA 3KT4A 1OLME 1UZYA 4EN6B 3WXPA 3O1MA 4Q4W3 1LEDA 3GDBA 3WQBA 3P1IA 4NAMA 3UJOA 4LBJA 3B02A 2HWF2 5A1FA 1RJ7A 4AEMA 2G9ZA 3KT1A 1FYUA 4RFT0 3CO2A 3UT0A 2OA2A 2VULA 2W95A 3ATGA 4OFGA 4LO6B 4RS5C 5DPNA 1SCRA 3FX3A 2YPJA 2B46X 4AYUA 5JIAA 3IMNA 1GZ9A 4K1ZA 4RQPA 3I49A 2VBBA 4IDZA 3UGGA 1TEIA 2W91A 1W6OB 2WINB 4K8RB 2MEV2 1BVP1 2VQ0A 3E5QA 4I3GA 2VOVA 4LA3A 1AHSA 3B94A 4UBGA 3LIGA 5TSWA 5CG8A 4XJ9A 1GMMA 3I3DA 4HXCA 4BH9A 2GC1A 1RB8G 1IKQA 2WFPA 3WP4A 1TZOA 4WVMB 2RS53 5EWSA 3U78A 2FMYA 4ZKTB 3VBUB 1KD7A 2HWC2 3T2PA 2G4IA 3RZKA 4AZZA 1ACCA 3EQEA 2VW2A 2BBAA 3FZ3A 1PIV2 4S2GA 4ES8A 3BIWE 4Q1PA 1U0AA 3FFZA 1N3OA 3MF9A 1UD1A 3K2OA 4XXAA 1VBE1 1BKZA 2CGOA 3O0WA 3KCCA 2VO5A 2W2IA 3W59A 2F4LA 1YJKA 5BNNC 4IESA 3I2OA 4KWLA 1COV1 3IKWA 2E6VA 2J1UA 2W47A 3NV2A 5IFPA 5K0UA 3USUB 2LTNA 5F6KA 3VBSA 5CFDB 1V6IA 2FD8A 1W6MA 2K9ZA 5CG9A 3I3QA 1W9FA 3O14A 2F4PA 2R071 4D6SA 5IATA 2QCSB 1GOGA 3B7MA 4DB5A 2Y6FA 3H7JA 1D2SA 2J1EA 1N3QA 1OURA 2WZ8A 3ZYRA 1HRV1 5E6HA 2WNOA 1SDDB 3ON7A 2ZHMA 4DINB 4CEYA 2ZX0A 1QOSA 1RUC1 4AEJA 3VHPA 5IK8A 4BDVB 1PGL1 3J8F2 3ETQA 3AP4A 2PFWA 3LZZA 5HBAA 3HQUA 1ENSA 2JE7A 3PUSA 1QGLA 3D5OA 3OB8A 3O12A 4GWMA 3GCXA 1RGSA 3ACFA 1HIXA 3GHMA 2A6WA 3OGJA 1GWMA 4OCTA 1WLWA 4QPGC 5FZ9A 4LUKA 4YW7A 5FDBA 4BQWA 1BBT2 3H0OA 2BU9A 1WCQA 2R073 3G6JB 3PMSA 4M3CF 4TWTA 3WG3A 3ZVXA 5A70A 2ZBJA 1YHFA 2AC1A 2XUEA 2DTYA 3RG0A 4CDXB 1QIQA 1UYXA 4LORA 1RTVA 4Y1UA 3KT7A 3BYWA 1DZQA 1NQDA 2IXJA 4RA0A 4DUWA 4K9SA 2BWAA 3GBWA 3I2IA 4QDRA 4N43A 1ZM1A 4QKBA 1W6NA 4XBQA 2C9AA 2ID4A 4LIUA 5EQUA 2YC2A 2CAVA 3P3NA 4WVZA 3U0ZA 4L9BA 3PVBB 1UZZA 4CUGA 4CPBD 5BNNB 3ZFGC 2XR4A 4S2DA 3H3UA 3D0JA 1OLMA 1SFPA 2W39A 2NMOA 1WMXA 2ADDA 2WZR3 1UYYA 2YDEA 5DUVA 3LD8A 4RS5A 1TMF3 3SCFA 2EXIA 2KM2A 3PIGA 3KV6A 4GAZA 3QCWA 1ZA7A 5GJ6A 3ZR5A 2GC0A 1UXXX 3C7OA 5LASA 1V9U3 3HT2A 4FP3A 5JMOA 4FAGA 5I8TA 2WLPA 1IGOA 2JG9A 2RS31 4QX1A 2CWMA 1GZWB 1BMV2 1K5MB 5C9AB 1RUC2 2G9FA 5D1IA 5FZFA 2R1DA 2Y6LA 5IJRA 3VZLA 3DEMA 4COZA 1LU1A 3FUOA 1TMF2 5IAVA 5DDJ1 1OHFA 5A3OA 4E8CA 2B7YA 3O5SA 3MFAA 2P4EA 1MVEA 5BNOC 3O1SA 4L92A 4E8DA 5LA9A 2P6CA 2VNOA 1POV0 5KC6A 3W5NA 3FE5A 3WCRA 5CA6A 3OJBA 3MW4A 5ANNA 3U07A 4JDMA 1O6UA 1WMEA 2JKXA 5L73A 2ZMLA 4QQ2A 1XE0A 4AFBA 1DP0A 1OPMA 3M70A 5E88A 2ZGRA 5F5CA 3ZFFA 1AR61 2MPFA 1VMHA 4OYUA 4BQYA 4MGQA 3QOPA 2ORXA 1RITA 4B4PA 4XJUA 5I8YA 4XIOA 2ENRA 4AEDC 4BE3A 4BQ3A 2BVVA 3KLSA 1PO11 4XAAA 4YARA 1QF3A 4W4ZA 4F8AA 2W08A 3ASIA 3PUHA 5JI7A 1VB2A 3T4HB 5A7OA 3VBFC 4AI9A 3CZJA 5CKNA 1GWLA 2LROA 5FP8A 3ZX7A 2ZX3A 3VDDB 5A6XA 2H0BA 1X9PA 4QDQA 4IQPA 5LEKA 2B5HA 3EB7A 4OHYA 1W9WA 2EIBA 3IDEA 4QX3A 4EZ4A 2W68A 5KC5A 4M0HA 2V4AA 1N47A 4TXWA 1BZWA 2YHJA 3ITQA 2VXJA 5A6QA 1AL23 2WNUB 2PAMA 2ZAAA 5KHKA 3WG2A 5KHHA 1KFXL 2IUWA 2A6VA 5FQ0B 3H8RA 1DZRA 4OULA 5L9VA 1HV0A 2WAAA 3T0AA 3LQCA 4D6QA 5FKCA 1XYNA 3RJRA 1G9DA 1W2AX 1K5MC 2E9QA 4DXSA 4QPWA 2Y8KA 2R061 4N7UA 3KQRA 4BISA 3NL1A 1YWKA 2XUMA 1B35B 1WZXA 2VJXA 1R091 4PF1A 3WP3A 4A2UA 5C8CA 3ENRA 2HYKA 3MFCA 3VZJA 1GP5A 2JX9A 2PQSA 4IE5A 1W6PA 3L2YA 1Q3EA 3HD8B 4LE4A 4PDWA 3S5QA 3OGSA 1W05A 3M8LA 4N90A 1D4M3 5I0TA 4I30A 4NPLA 5FYMA 2VY0A 3CHXA 5A7WB 3N9QA 4BA6A 5I91A 1PO22 4YFZA 1AXZA 3SISA 1H8TB 3V64A 3LA2A 4XHBA 5SV5A 5T50A 4CXXA 4MO3M 1CIYA 1A3KA 1JUHA 2EXJA 4BIOA 4DPNA 2D5FA 3O1TA 3VKLA 5BNPC 2PXJA 4PF5A 1G9AA 1ZRCA 1ULCA 1ENXA 4NWVA 3GXUA 1LOGA 2HH9A 2D6OX 1D4M2 1VBA3 2VUAA 4JZRA 3CEWA 1UF2C 1WCSA 2A75A 2XWBB 3GF6A 4L99A 4NRPA 4D8MA 2DFCA 2GP3A 1ALYA 3MIBA 3N9MA 1SQ4A 1VMFA 4XDOA 3J7MA 5A80A 1OA2A 4XIKA 1LECA 5FAXA 1ULOA 4ZS2A 4AI8A 2WN3A 3OF1A 1PX4A 1Q8SA 1XPWA 1RIRA 2R0HA 2VBDA 3M3QA 4FFHA 1W2OA 4AEKA 1PGW2 4XC9A 2HEWF 1PNGA 2ZCWA 2BV4A 1ZBE3 1XBFA 2ZGUA 5DQ0A 4BLJA 4XF9A 1NY72 3PU3A 5IUQA 5K9YA 3WNMA 4F3JA 5JAXA 2OZJA 3G7DA 2GSYA 5BNOA 1AL21 5CYYA 5KR7A 4KI5M 2V5DA 4YGCA 1AX0A 2UURA 4XQ4A 5KXDA 4EJRA 4UI9L 4BK4A 5J37A 5FPVA 1V6OA 5FMCA 5BYNA 4FFIA 2NQYA 3GJBA 5AC91 2B39A 2IWGB 2IXLA 5FPUA 2DUOA 1CD3G 1OFSA 4AE2A 3KCYA 1TE1B 1PVC2 3B00A 3NJVA 1W9YA 2Z4FA 1GWKA 4HKLA 3UL2A 3RS6A 2BRTA 1ZA4A 2AREA 2E63A 4XFCA 5A7QA 5CBLA 3V0AA 4N53A 3BI3A 1QJFA 3SLIA 4AGVA 2CL2A 3HT1A 1WD3A 2C1FA 3ORJA 1OT5A 4QAWA 4FTEA 4COUA 4LO8A 2ZXQA 2CWSA 3WCSA 1S2BA 2WYFA 1NT0A 2H6BA 4YYOA 2Q8OA 2VTXJ 4IW3A 1Q8PA 1JOJA 4K1YA 5FY0A 4EN0A 1MS4A 5FPBA 5F5AA 5FP7A 1CX1A 4UOJA 1F31A 5I0SA 2ZA9A 1XSQA 1CQ9A 2E51A 5GLZA 3H8XA 1ZRFA 1ZYBA 1N1VA 3K77A 2VECA 2VUCA 1CAVB 1J58A 4XUTA 3VV1A 5A7PA 1F4HA 1RL3A 2W0XA 2BVBA 1S0DA 2XHNA 1OOPC 1Q43A 2RDRA 3O0XA 1V9U1 3WF4A 3IN9A 3MICA 2VZ3A 4UFMA 4M3CB 4QU1A 1KFUL 3WNNA 3ZMOA 3OGVA 1UL9A 2XJPA 1I1EA 2BGCA 2VQUA 1PK6A 1J3PA 1RUI1 1HJFA 1H2LA 1UY3A 4Q4V3 1QJY3 2QQWA 3ZKYA 3R4SA 1QJX3 2EXKA 5A1AA 4MYEA 5HV4A 4HBNA 4AHWA 2O8QA 5JSPA 4MGZE 1E5SA 2WA3A 1DG6A 2XBO1 4F7ZA 1UYPA 5ACA3 3JBG3 2GP5A 2RDNA 1MS5A 3AZVA 2XONA 4LKSA 1DGRN 5DAXA 4NIAA 4AF9A 5LRSA 1K42A 1NOVA 3JU9A 3PHMA 1YJLA 5FPLA 3FLRA 1RUG3 2JG8A 1QJX2 2VVFA 1NQJA 1QH6A 3LSEA 1JS9A 2JD4A 2MNGA 5GLVA 2ZZQA 1H1MA 4MVTA 4YGBA 4KG8A 5J7MA 1CGPA 2WNUC 1UPSA 1NCQA 1VRBA 2ZEWA 3M3CA 3BTAA 3VKNA 4Y5SA 2WRAA 1AR92 2J1AA 4CRQA 3ETPA 2QQJA 1FMD2 5SV8A 4HLTA 3AXEA 5FO8B 3IWZA 2YU1A 4H2AA 4FFFA 1WCDJ 3ZSJA 4Q4W1 4UW4A 1SDWA 4H14A 5JOZA 1RHI2 4Q5OA 3CJIB 2ARCA 2LUWA 1AYN3 3BVCA 3UESA 5GZGA 2O0OA 3TRSB 4RR3B 2GN7A 2ADEA 5FXXA 2HWD1 5CB7A 1K45A 1GQPA 1SFYA 1Q8QA 5DAWA 2VZOA 3U11A 4JGYB 3H8UA 4YW3A 2D6PA 2VC9A 1ASJ3 1H9WA 3PNAA 5CFCC 3GBFA 4AXOA 4IEUA 1UYZA 4IEQA 4A3XA 3POIA 4LBNA 4NHLA 2DCTA 4ZY9A 2R042 4DQAA 1XYOA 1YUDA 1AYN2 3OSDA 4A4AA 1R092 1S0BA 1LJ7A 1QEXA 4OLLA 5AVPA 1ENQA 2NN8A 2AH2A 3WG4A 1AZDA 2WZPP 1UY1A 2SBAA 4HONA 4AHZA 4KMQA 1S0GA 2AYHA 2CYFA 3HJRA 2PHTA 5FO7B 4AOCA 4GWNA 1I3HA 2WKKA 4D7YA 4XOGA 5LZ6A 2ZGQA 4AQTA 1GUIA 4JRAA 1NAEA 4OI1A 4CEYC 2XJRA 3I3EA 5FJKA 4CU7A 1UW8A 3PIJA 1JZ4A 1FOD1 1UY0A 1UPIA 5I0DA 1LGNA 4KBZA 2EIEA 1KJLA 4AI0A 4DNYA 2JIGA 1NA1B 5JZGB 3C7GA 5LBCA 2J42A 1Y4WA 2RMU1 1ONAA 1WGPA 4Y1XA 1D0HA 1OH3A 1VR3A 5IVJA 1S0EA 2VNRA 4NPMA 3WDYA 1RXGA 3DUIA 3JZVA 2GN3A 4XAEA 3TBDA 2Y60A 4AI2A 3O0VA 1W0NA 2ORZA 1G9CA 4F83A 1DZTA 1JYCA 3D82A 4NHYA 3V0AB 3WQ7A 1KRIA 4WVVA 4W6WA 1VBE2 4JKLA 5BUVA 2VQAA 5FTTC 1WMFA 1ZZBA 4LQRA 4R9BA 4A7ZA 1PM7A 1QNYA 2CHHA 1VAKA 5GM0A 5FYBA 3VD7A 2JDYA 3RWNA 3I97A 1LOBA 5F5QA 2EIDA 2DU0A 3I2KA 3NNJA 4LLOA 1LOFA 4P5YA 1J84A 4CUCA 4DUVA 1IPKA 4QGMA 1Q8OA 1N1SA 5EYXA 4BU2A 3I3MA 1D7PM 5C71A 1DU3D 2RS11 1POQA 3VBFB 3ZYJB 1EV11 1VBE3 5ACA1 2Y6GA 3RPQA 5C3QA 2PHDA 5DUWA 4OQ9A 3ACHA 4FI9A 4MXWB 2GMEA 2GZWA 2QJVA 1ZZCA 2MEV1 3N9LA 1QJX1 3DYMA 1DCSA 4YWAA 5F37A 1V0AA 3A22A 4XILA 1OUXA 4ZHNA 2QQNA 3M1HA 2A1XA 2YZ4A 2WUHA 4Q4X1 4NVPA 1RYYA 2EF6A 2E33A 1O4YA 2C9KA 1V6MA 3CNAA 1LHNA 1BVVA 3OEAA 5ISLA 1DLCA 1W6PB 4X8NA 2W3JA 3V56A 1MZEA 4K7JA 5FZ8A 4DY3A 3JXSA 4IGQA 5A3WA 4S2HA 1CPNA 4XJ8A 1W2TA 4CDXC 5M0TA 2UWCA 1VP6A 1IQAA 1TME2 2Y26A 2KA3A 3H9AA 2QDNA 5H9RA 1LODA 1DYKA 2PHUA 3VBOB 1MZ5A 4KGGA 3FL7A 3IMMA 4QB1A 1K3IA 1OH4A 3NQHA 2D40A 3PDQA 4YG3A 3WNXA 5LBFA 4QPGB 2SLIA 3U10A 1JHNA 1V6NA 4CU6A 3LE0A 5FXWA 4XUQA 5C4WC 3BU7A 1Z78A 1RJ8A 3I4IA 5L9RA 3HBZA 4IV1B 4QX2A 2JE8A 1FATA 4PI2A 5LK5A 5FY1A 1BQPA 4O61A 4OQ8A 1H2KA 1DDLA 3HEIA 1QU0A 2ZGOA 4MH0E 2RS33 3FFQA 1JYNA 4RFRB 3ACGA 1AJOA 4P5HA 2W46A 2YGMA 3RRDA 1JBCA 5ACA2 1UOJA 1PGL2 2AENA 3AP5A 5F3CA 4XYXA 1AYM2 5F1RA 1EY2A 4NPRA 4R9DA 1RC6A 1E5RA 3AMHA 3ZYHA 4CDWA 5DABA 4KG0A 3IB3A 4M0NA 3HBKA 2NP0A 3ZSLA 4WVWA 4CCEA 4KQ7A 4HG6B 2JKBA 4QX8A 1JYWA 1UWWA 1NXD1 1MS9A 1UX6A 3D3AA 4B4RA 4MXWA 4P9LA 4X6QB 2FDGA 2A3XA 2YBSA 4NO4A 3HPNA 1LCLA 4CDUA 3WNKA 2VXRA 2DF7A 4AAXA 3T30A 4UW5A 1HN0A 4B7KA 2X5IC 4IGPA 2VMGA 4NE9A 4B8EA 4LE3A 5BY5A 5DN2A 1OVSA 1UMHA 3D4KA 4A42A 1B35A 2BDRA 1OKQA 5FZ1A 4ZZ8A 4W6YA 1CAWA 3ZXGA 1BHGA 1PIV1 3ILRA 1F9KA 3RSJA 5HXMA 3NAPC 5FP3A 5FZKA 4MOAA 1H1AA 4M3CA 5JZGA 3OBTA 4FXKB 1RHI3 1YQ8A 1QJU3 2BGPA 4OMDA 1GSLA 2BOIA 3WG1A 1CR7A 2W87A 5F3IA 1SACA 4C8DA 2VGDA 5IK4A 1FAYA 2HJIA 3ZXFA 1XE8A 3ZIWA 4QX0A 4FTBA 4QU2A 4Q4X2 3WHTA 4XUPA 3VKMA 4GJZA 5FWEA 2OVUA 3HIFA 1ASJ2 1VE0A 2BPA2 4PI0A 1IG0A 3I3BA 4UW6A 3UJQA 3WINE 4AHYA 1OOPB 2ZGLA 1V6LA 2R043 2ETEA 1D4M1 2FCTA 1EAH3 2NZ9A 3H3LA 4N53B 1RUG1 2JXAA 3TEXA 2YG0A 3WW1A 1LAJA 1R093 3KVAA 1W8OA 2QQUA 3S0MA 2XL7A 1O4ZA 3K4ZA 3QACA 1W06A 1C57A 5FP9A 4AVCA 3WV6A 2RVAA 4CXWA 1CONA 2J22A 3M3EA 2W52A 4ASKA 4GZ9A 2C24A 3BCWA 3F2ZA 4FPHA 5FYHA 1POV3 1X8MA 4PQQA 3VDCA 4U36A 2FHRA 4GMP1 1VBB1 3EHKA 4JGYA 3ZO0B 3U1XA 2ARBA 4UWDA 5FMOS 3A23A 2XBO3 1R083 2YC4A 4AW7A 3NWKA 5K4LA 1OC1A 1EUTA 1YEWA 2EXHA 1ND2A 1IS4A 3CIHA 4LKEA 5APAA 2B45X 1OFNA 3ME2A 3WT3A 2VZPA 2WFF1 1XE7A 3AB0A 4XHXA 5FWJA 1QJEA 1WUVA 1ULFA 3POGA 3AMQA 1KQRA 2RS51 2GH8A 3IIAA 1M4WA 5AC92 1NE6A 2QFEA 3KGZA 5GLWA 3KD4A 2QZ2A 2VMCA 2W1QA 1RUOA 2E7QA 4MGKE 3LPFA 3VZMA 1NCRC 1F35A 3R05A 3GCWA 4YM0A 5FMOL 5JR2A 2IVJA 4BK5A 4QGNA 4RR3A 1PMHX 2PELA 1XSRA 4NRQA 5DZEA 1IHMA 1Z7S3 2WNVB 3J7HA 4XUOA 2GALA 1EUUA 4ZU5A 4A7YA 1W0OA 2GU9A 3UV9A 4EQVA 4CP1A 3NNFA 1UKRA 3O7OA 4IV3A 4O9EA 4I0WB 1H8TA 2VMIA 3VKFC 1PK6C 4ARYA 2XKOA 4NROA 3EYPA 5A7WA 1JYVA 1CAXA 5A33B 3V0BA 1W8ZA 1Z7S2 4FOYA 1X33A 5JOYA 1AVBA 3WOGA 5LK7B 1W90A 1MR5A 5FYTA 3KVBA 1DHKB 3A21A 3AL6A 2DU1A 2QVSB 4GKYA 1HRV3 1O91A 4AVVA 1AR62 5LWBA 4PQ9A 3VHNA 1IG3A 2X53S 4QPYA 5K0UB 2YY1A 1GZCA 3A0NA 1RUD1 1UZWA 4C1WA 4I2OA 3ES1A 4N8MA 2YROA 2E32A 1YQCA 3S30A 1RVF1 1AR71 3MW3A 4P02B 5F5IA 3TN92 2WQ8A 1R1A2 1ZREA 3C7FA 4LR4A 3AYCA 2QZ3A 2DCYA 1QH7A 4YNIA 1NLQA 1VBC3 2P5BA 4W65A 3SH4A 3Q9OA 1UCXA 4GD4A 1ND3C 3ZYFA 3VDAA 1N1YA 1O3SA 1SZBA 1YXWA 3I54A 5C3PA 2VUJA 4FBFA 4UYBA 1CWPA 2D93A 4XABA 4ARXA 2P3IA 3AVRA 4Q4Y3 1TME3 2JG9C 5FKBA 3TEYA 2BFUL 5AVAA 1BEV3 3J9SA 3HNYM 5EFUA 1KS4A 4XBNA 4JX0A 2CGPA 4KU8A 1DQ5A 3OD0A 1AX2A 5DZGA 4BB3A 4BJ0A 1AR91 3DGTA 2I45A 1MZFA 3BTYA 3FLPA 2BQPA 1UMIA 3ZPYA 1I5ZA 2XH6A 5HCBA 5CKQA 1ND3A 2ILMA 3ZXKA 2JDNA 3MPBA 3TEZA 2PAKA 4L97A 4MX3A 2I2SA 1CZTA 3J7NA 4XEZA 2YFUA 1JYXA 4Z8BA 1AR72 2QNKA 3N7JA 4P14A 1HRI2 1I5PA 3B01A 1DQ6A 3AKSA 3W21A 1NG0A 1A34A 5GZCA 3NV1A 5HCHA 1JH5A 5L9BA 2HWE2 1URXA 2XJUA 3LA3A 3MV01 3MEPA 1C5HA 1RUF3 2EAAA 4HKWA 1AX1A 1YIFA 2XQXA 4RQPB 4C0HA 5A3MA 1N1TA 3M4FA 1SMVA 1CAUB 2VZRA 4AFMA 5JPMB 3S7EA 3WEZA 4Q4W2 5KHIA 4TN7A 3X29B 4CU9A 1W8HA 5F2SA 1LOEA 2YMZA 3N3HA 3Q8FA 2R32A 2HWF3 2C4XA 5FY4A 3ZYPA 2C5DA 2I07B 4Q0PA 5B2GB 2Q0AA 2A5ZA 2HYXA 5FOBB 1NKGA 2A7AA 2VAUA 2A3WA 4GH4C 3GZUC 2OYZA 5LCWL 3Q8EA 5LW9A 3USSA 3URFA 1RUE2 4AAPA 4FOVA 4URTA 2ZKLA 4NMIA 4XE9A 5DUXA 1WWYA 2R30A 3T2QA 2I74A 2GDFA 5A3TA 4CUBA 3PTYA 4GWIA 1Y9MA 1HB4A 1LHOA 2ZGTA 2RHPA 4E2QA 1KS5A 1W6QB 1FI2A 2JECA 3IDCB 4QX5A 2Y0IA 4Y20B 2OUHA 3FLTA 1Y3TA 1F5JA 3THDA 3VBHA 1OBNA 4Y1YA 1LR5A 4UFHA 3ABZA 1J83A 3NV4A 2FDJA 4ISRA 3U4XA 3WW3A 5F32A 2PYTA 4B1MA 4CCOA 4DRVA 2ERFA 4ZONA 4BZ4A 4IV3C 3E5UA 4E4SA 3GZAA 3K3NA 4FPCA 1YQ2A 1UU6A 3D8CA 3BOPA 2HWF1 1PO21 3IDBB 4YZ3A 3CF6E 2VMFA 1UO9A 1A8MA 2HEVF 3THCA 4N43B 4OHZA 1WD4A 2PHRA 1F15A 4LBQD 4RR3C 1PMJX 1NZIA 3ZFEC 4AL9A 2LRPA 2ZGNA 5C4WB 1GP4A 2AEYA 2XVLA 3DCQA 3RWKX 5JMCA 4QX7A 4E4DX 3UKVA 3DN7A 1U5XA 5EYYA 4IE0A 1PVC1 4EYUA 2XOMA 2VCBA 1O5UA 4W50A 2VVEA 1QQP3 2WBKA 5EIYB 3C2UA 4UF0A 5GKAC 2A3YA 4MHRA 4DO0A 1KDKA 5FY5A 2GNDA 3GHNA 2A6YA 1W9SA 1R082 3CJIA 3B93A 4M00A 1UY4A 4XCBA 3OCPA 4RHV3 3ZLIA 2G9GA 2ZHKA 4PDWB 3RFRA 3VBSB 1YFXA 4RL7A 3J8F1 1D2QA 3DPRC 5FV3A 5FUNA 3DECA 1JZ6A 5C8CB 2W5FA 3A0KA 4DMIA 5AC93 2WC2A 5C4WA 3OTFA 3WQ1A 4U2AA 3VDDA 1U5ZA 2R7EB 3N7MA 3AKTA 2JDHA 3CDZB 1OSGA 1VIWB 2JIJA 1J1TA 4XFFA 3UKTA 3O1VA 2WZR1 4E2GA 3OBRA 1PO12 3N9NA 2PLV3 4K8FA 4L0PA 3KGLA 2GC2A 3AKQA 2ZACA 5LY1A 5LBEA 1DIWA 2JDMA 2WO7A 3OGGA 5H9PA 4YW4A 1G6NA 2J1SA 3MUZ1 1YRZA 3DXTA 3VBHB 3Q8CA 2BTVC 4HL0A 4CDUC 5K7PA 3BU0A 1DFQA 3IAPA 2VCMA 1RUD3 2R16A 1AXYA 1SLTA 1C5IA 1STMA 1UIJA 4YVWB 1J59A 1REFA 1HLCA 3I59B 2PAEA 1FPN3 4J1XA 4CCKA 3PUQA 3I2JA 2CAUA 2FQPA 3K51A 4COYA 3OD4A 4I09A 2ZKNA 5C8CC 1B35C 1C4RA 2VMHA 5FMDA 5FZLA 3OUIA 3ZFGA 3OBZA 1J3QA 2W1UA 3PUIA 2P3KA 4GA9A 4R8HA 2X5IA 3E6BA 3N4MA 2GNMA 1OXCA 2R062 1U12A 2VOTA 1VAMA 2JDUA 2EAKA 4Y22A 1RUH1 2D6KA 1DQ0A 3ILFA 4LHNA 4FOWA 1JHJA 4TLGA 4KBBA 3TN93 1R1A3 5T55A 3DV8A 5BNQA 1LOFC 2C26A 1JZ5A 1RUC3 1GNZA 3ILNA 4XMIA 5D2AA 5FLIA 4RS5B 4OI2A 1ULGA 3J4UH 1GKBA 4LPLA 5DG1A 1MEC2 3U14A 3QLQA 4DXZA 3OOXA 5J98B 3VN4A 2OT7A 5J36A 5T5OA 2WAOA 1Z0HA 5F39A 1W8NA 2XJTA 1OD5A 1QWRA 3L2HA 5EXOA 3BN6A 5A1LA 4GXLA 1H2NA 3WY6A 2FZ2A 2OIIA 2Y64A 3SKJE 3AP9A 3SEPA 2WQ4A 1JU4A 4GULA 2IXCA 2OS2A 2BFUS 2WFF3 4Y3OA 4Z07A 4CCJA 1ZX5A 4A7KA 4OI0A 2GMMA 3TWIA 1UN1A 2V72A 2PLV1 2ZX4A 2CNAA 4IEZA 2ZAHA 3ZFFC 3LEGA 2KR2A 3POJA 1NCRB 1UZ0A 2E26A 5FR3A 4DXRA 1H6XA 3LDBA 1IS3A 5L7OC 1UOBA 4QQPA 1HXS1 1Y43B 2UWBA 1RMU3 5FZ3A 4COVA 2ZZJA 3RQ0A 1IZ3A 4IERA 2JENA 4BHPA 1VB4A 2DWRA 4QKDA 5A3UA 3NAPA 2IXHA 3LDRA 2HWB1 2O14A 1V6KA 4GJYA 1O59A 1RUF2 5T5LA 5J48A 1CESA 2XKPA 5C5UA 1C1LA 3T2TA 2DDUA 2DYCA 4UFLA 5DDJ2 2D6NA 5JI9A 3CBNA 4AGRA 5FJHA 2GC3A 4CEYB 2H6CA 1L3JA 2OPWA 4H55A 1RMU2 4FSJA 2RDSA 4HK8A 4MLOA 3WVJA 1BMV1 1UXZA 1W8TA 2OPKA 3MDPA 4LK7A 4MHUA 4Q0VA 2AUYA 2YBPA 4BQ2A 1JYIA 2XLAA 1ULDA 4A44A 3OUHA 4NHMA 5A3NA 2Z69A 2D97A 2FDFA 3EMRA 1HJGA 1YQ5A 3ZN5A 5DDJ3 5J96B 2RS52 4NUBA 4YM1A 2WO3A 1HXS2 2VPVA 1UOGA 2Y33A 3UK9A 4DEVA 4LA2A 1GQGA 4AFAA 1D4VB 2QQOA 1O3TA 3W5MA 4H3WA 1A8DA 1XJAA 2BZDA 3MIHA 4Y5Z0 4XF4A 4QMAA 2JD9A 1PO23 1WCKA 3K4DA 4FPEA 1IKPA 1XNDA 2VOXA 4RD7A 4KU7A 2HBUA 2HWB3 3NJZA 3WF2A 1HKDA 1HRI1 3AKRA 5A3PA 3NO8A 2W1WA 1YI9A 5F6LB 1GNHA 4L2NA 5DAPA 1TMF1 3IT8A 3P3PA 1OPOA 1SFNA 4D94A 3SKVA 3NRUA 2MEV3 1VBA2 4HN0A 4WM7A 4MGSA 1OLRA 1UMZA 4WM8A 5E8AA 4OHVA 2ZMNA 5T5PA 4RGGA 1DQ4A 3MIGA 1OQ1A 2OQ6A 3FWEA 5FK8A 3TAYA 3OGRA 4NHXA 1FNZA 4Y5TA 1GP6A 2HWB2 5GLTA 2HWC3 3N9OA 3LAGA 1PM4A 2YC0A 4CE8A 1SEFA 3BODA 4ZS3A 4TLFA 2JICA 3AKPA 1CPMA 3GBGA 4BIFA 2WSVA 3AZYA 3J8F3 4P9YA 4LO7A 3NAPB 4CTEA 1AYN1 4YVWA 4CCLA 2JEMA 1X36A 1LU2A 1YQ6A 3VLBB 3MZHA 5C6CA 3VDBA 3LOIA 3AFGA 2D3PA 4XMAA 1VRH2 4XJZA 2Q8DA 2K0GA 3Q8BA 5ABJB 4RHV2 1XQNA 3ZFGB 5C9AC 1JTZX 1KJRA 3RZJA 2R072 3AXDA 3B69A 5F2WA 3RI9A 3VBRB 4AI1A 4R4XA 4IE4A 2HWD2 5C3RA 3N36A 4LHLA 4YW5A 1ENRA 2PQQA 3WDTA 4EWAA 5IVCA 1U5IA 3BIEA 2BUKA 1YLLA 4AI3A 1ZNPA 4FPKA 4Z1VA 3T0DA 1R1ZA 1HB3A 1ODMA 2DFBA 4JHZA 4IE7A 1B09A 1FOD3 4YVSB 2B9UA 4MXVA 2UU8A 2DVBA 2A70A 2QDRA 2HEYF 1HQWA 2LALA 1S0JA 1VBD3 3PL0A 4A6OA 4SLIA 1PZ9A 4JCKA 1FPN1 3TYJA 3JD73 3CQOA 5I93A 5JIUA 1XRUA 5CU1A 1GZWA 1JN2P 1PGW1 1YYNA 2YUEA 3THPA 1ZVFA 2QUOA 3EJKA 1BK1A 3LA7A 1AYM1 3CJIC 1VALA 1CZVA 1COV3 1W8WA 1IPJA 4EN8B 5FPAA 1UZVA 4B1LA 4Y22B 2CV6A 4Y4RA 1WCUA 3AP6A 1FPN2 4M4PA 4YLZA 2LS6A 1VBC1 3JD72 4YZ4A 2FBEA 2MHFA 5FY7A 4EN9B 3K48A 2VR4A 2ZPXA 1DQ1A 2XGXA 2VZ1A 4FPLA 4Y33A 4NIGA 1LHVA 1UKGA 1O3RA 4V2WA 1MZ6A 1RINA 4IXLA 3KF5A 1AR82 3NKGA 1NXMA 2D6LX 4FTSA 4QB6A 3ZYIB 3J7LA 2Q5TA 4GB33 2DBIA 3MYXA 1US3A 1DBNA 4MSVA 1GFF2 2XMLA 1UQXA 2YU2A 5FYSA 3LGRA 3OPTA 1W6MB 4Q4V2 1DLLA 3QH6A 4MUVA 2RJKA 3WUCA 3ZN6B 2ARAA 2DCJA 3FBYA 1WA4A 2YGLA 1W2UA 3MIEA 1YIPA 1FT9A 2AGSA 2J7MA 4IV3B 4NIDA 4DZGA 2RJ2A 1XYPA 3JBG2 2VM9A 2VNVA 3NNLA 1QY4A 1WW7A 3AL5A 4LUMA 3RMXA 1V9U2 1HDKA 2A71A 1LB2A 1LNSA 1GBGA 2AR6A 1W6NB 2QQVA 1SG3A 2DVGA 2Q1ZB 5H9QA 4HSLA 3MGUA 5IT6A 5CFDA 2BOJA 2LW8A 3POWA 2D44A 1OKOA 5C8WA 2DTWA 3MUY1 5CFCA 3RZLA 1OVPA 5T3NA 1ULEA 3UYJA 1UNBA 1YI7A 3OG2A 5ANQA 3WDXA 3AX4A 5F7UA 2UWAA 1H30A 5IWFA 5IAXA 3T3YA 2YPDA 1G9BA 4KWUA 1GQHA 4HN1A 2ZGMA 4PLOA 4E27A 1F8VA 4XJWA 4QKNA 3WW2A 4FAHA 5CEHA 2RS12 4GKXA 4GB31 1R64A 2WT2A 2DUPA 5EV7A 4KL1A 3CLPA 3PTRB 3PU8A 1J1LA 3JBG1 3PVNA 2QBXA 1H8VA 2DBNA 2HLEA 2W92A 4N9IA 3HQRA 3POEA 3WNPA 2W94A 1HX6A 2WR9A 3HN1A 5JDBA 3K75B 3P6BA 3NNGA 4ISQA 4V2VA 3OEBA 4BXSV 2AEZA 4E4HA 4BMEA 2RS13 3INAA 2P37A 5JSRA 3NKTA 3LKJA 1LGCA 1NCRA 4TSVA 1W6OA 3KWVA 2OW4A 4JGZC 4I02A 1QDCA 2KD7A 1IOAA 2V09A 4XW3A 2VUDA 3MO4A 1C28A 2GAUA 5FP4A 3RZHA 5FYYA 4FQ4A 2QQIA 1AL22 4MGYE 4W8JA 2P3YA 4K21A 2P17A 4D7SA 1NA1A 1SLAA 2RG4A 1A78A 1LRHA 4KWKA 3O1RA 1ND2C 1VBD1 3U75A 4RGKA 2XQRA 1JZ2A 4XDQA 3OBAA 5F3EA 2WIIB 1H2MA 4BQ1A 3PJQA 4CVUA 5BPXA 4ASMB 3GZEA 4YRDA 3M2MA 4OI4A 4CP2A 3KHCA 1BK0A 2V4VA 3APBA 3FHAA 5A6YA 5JXJA 4IV1C 2Q30A 5T5JA 1T2XA 1PHMA 4HSJA 4FVVA 4HT1T 4MGIE 1IS5A 2TEPA 3NJXA 5DZFA 3T1LA 4LBMA 4YPJA 3LF7A 3BPSA 3JUUA 5FLJA 1O3QA 1XU2A 1DF0A 1PIV3 5F3GA 5FZ4A 1HN1A 3OUJA 5JOXA 2D7FA 5FRAA 5A7NA 4PIYA 1LHUA 5F8PA 2WNVC 4GIQA 4IEOA 3NV3A 5B4NA 3CZUA 5LA2A 4QWNA 3VDDC 4DEQA 5C5TA 2HWE1 4K40A 2Q8EA 3LFMA 3ZSMA 1MQTC 3K3OA 4KH9A 1MVQA 1X50A 4SBVA 3IAQA 2VZUA 1CAVA 3PLQA 4QXKA 3T0BA 4P9WA 2WABA 5DAQA 3DPRA 3HMYA 5I0UA 3NW4A 3I59A 1C3HA 5FYUA 2VVDA 2E7AA 3WD5A 3OYWB 1QNWA 4CCNA 4L11A 3BPZA 4LO4B 1GLHA 2PMWB 5L36A 3E6DA 4D0QA 5DXDA 3AMMA 4YVSC 5FZEA 4QDSA 3ZFEB 3B5LB 1VRH3 4WM7B 3RJ2X 2VZTA 4TYSA 4CXYA 1BBT1 5ABJC 1VJ2A 1UX7A 2VU9A 2ZGPA 1SLLA 4YW1A 1Q5OA 1H4HA 3KM5A 4WZFA 3ELNA 4CP9B 3ZSEA 2HWD3 3ZR6A 1RVF3 3H1WA 4XF1A 2WNEA 5FY8A 1QXJA 1ZBE2 2ATFA 3SITA 4BQ5A 5IFTA 3I2DA 4H7MA 5GLUA 3O1PA 1AL0G 2IFRA 3KF3A 3BGAA 1HW5A 3VZKA 2ZHLA 1CX4A 1PVXA 3ES4A 1ST8A 3I8TA 5EJ1B 4PDWC 5B4XA 3VD4A 2C0ZA 3NVCA 4RSUA 2WN2A 3GZTB 3VBOA 4AGGA 4Q27A 3TNPB 1VBD2 1SHWB 2ZEXA 1PVC3 4BMBA 2BERA 1RVF2 2BP6A 4FXGB 1WW4A 1WW6A 4UAPA 2WQZC 4HVOA 5E1RA 1DGWA 1QQP1 4WZCA 4P08A 4BYYA 3SH5A 3EBRA 2XXZA 1ZZ9A 2WWUA 4DFSA 5F9TA 1NYWA 1G86A 4INDA 4EV0A 3NMBA 4UF0B 4FOQA 3KSCA 2Y0OA 2RMU3 2VG9A 3VL9A 1COV2 2BW8A 2WYSA 4Q0QA 1M06G 3GALA 3PMEA 1JUIA 1T6GC 4Q8LA 5FCCA 3VHOA 2QTWB 3N9PA 4PHZA 4FCAA 1Y7BA 1YFYA 3ZN6A 2C6SA 1MQTA 2WZR2 3BUCA 4IEWA 2BNNA 2RM21 2QQPA 4QXHA 2K2SA 5FIXA 4D69A 2VTXA 4DS0A 4M01A 4XCAA 2ZABA 3S6PA 4CPBA 4ES9A 1FV2A 3JQXA 1BEV1 1LHWA 4UXAA 5GZDA 4RGAA 5LA1A 4ATFA 2XJSA 4X6RB 3VBFA 4GB32 1NCQB 5IYYA 1NE4A 5D8AB 3AYAA 1CZSA 3MIDA 4A45A 3A7QA 2K46A 3ZXLA 2KXLA 4JC1A 1LOCA 3MPPG 1GYKA 1RUG2 3WUDA 4CSWA 1JZ8A 2RS32 1IS6A 4GMP3 2VMDA 2QKDA 4B3NA 5A3LA 4AWDA 4WBBA 5A6ZA 2CDOA 4RN5A 4I0BA 1AYM3 4MZUA 1F4AA 2VQTA 3LB9A 3LEMA 3Q8AA 4QQLA 4DY5A 1HV1A 2B9VA 4O7XA 4QT6A 2JJ6A 2OXBA 4DOUA 1QJY2 4GH4B 5CISA 4CA9A 1ZRRA 1FMD3 2YFZA 4FFGA 2DCZA 2X29A 2RR12 2Q8CA 4XFBA 3QBQA 1K5MA 4XTPA 5HXVA 3ZKUA 1X7NA 4JGZA 4Q1RA 3ZXEA 2F17A 1YNAA 4WV8A 5H9SA 1X82A 4N43C 5GZFA 2FDIA 3O1OA 4NJ4A 4WM8C 5LBBA 1C8M3 5FQ0A 2R0FA 4UT5A 5FYVA 5A32A 4UFIA 1RHI1 2RR13 1AR81 3C8XA 4GMP0 1V70A 2RJLA 5FLHA 4BLIA 5J3UA 4ONUA 1GOHA 3FUQA 3JB8A 1JZ7A 5CZKA 2HBTA 1QXPA 4OHWA 3ZFFB 2WO2A 3KCXA 3POYA 3CJXA 1QMJA 1K12A 1GNYA 1QJU2 1NLRA 1GZTA 4KGQA 5FZHA 1AR93 1MPXA 3VUOA 1C8M2 2J1TA 5IVYA 3THTA 2RV9A 1ULPA 4PLMA 3LOBA 1BLZA 3C7EA 2EIGA 1X8EA 1XNTA 4JGZB 4HOOA 4G9SB 4J6GA 2Z79A 3WF0A 2BNOA 1RUE1 3TEWA 3AMNA 4LOSA 5KWRA 1HB2A 3KS7A 3TNQA 2O1QA 4S2FA 3VBRA 3MHZA 4LBQA 1Q8VA 2IFWA 3HAGA 4DUXA 2EVXA 3ZXJA 1ZZ8A 4LULA 4PIZA 4P9GA 3M3OA 5D21A 2TNFA 5A32B 4EN7B 5HPOA 4QQHA 1OLQA 3WZ1A 4BCUA 1LULA 2E31A 4WM8B 1L7QA 3VGIA 2EA7A 1S4CA 4LHSA 3POSA 1PNFA 2BWCA 3I2FA 1AXKA 1WA6X 4IEYA 4BQ4A 4E9KA 1S1AA 4XTMA 5CIRA 2A6ZA 3VBSC 3BKZA 2FDKA 2Y6KA 2WLQA 4BM8A 4CDXA 3HNMA 2J1VA 4LIVA 1W2NA 5KXEA 1QXRA 4Y26A 4Z82A 4ASLA 2VW1A 2W1SA 1DGRA 3MV11 2EALA 3KZ4C 1UAIA 5C9AA 2JWPA 2NMNA 3H50A 2ZEYA 4PJYA 5JXIA 2GH2A 3LFIA 5DG2A 1W9TA 4XURA 3H42B 4LKDA 1CJPA 5FYCA 3RZZA 3AMPA 4HETA 1GANA 1LTEA 3AZWA 4LK6A 2BBVA 3LDKA 4J1WA 3VHRA 3NJYA 4NN0A 5FBZA 4I01A 3ZPOA 2DUQA 2G19A 4XPVA 4ET7A 3R6SA 2VNGA 1QJU1 5BNNA 4ITCA 5JR7B 1TNFA 2O8OA 4XUNA 4CCDA 2DVDA 4Y20A 2VZVA 3HWJA 2YXSA 3GJAA 3S7IA 1VPHA 3SHRA 1P8JA 1FV3A 1PZ8A 2Y34A 1ZRIA 2ET1A 3AZZA 5JLVA 1DYPA 4PT6A 4R52A 4WM7C 4YGEA 4CCCA 5C33A 3WNOA 3O1UA 1WBLA 3PURA 4HANA 4CP9A 2B42B 2CSGA 3VBUC 3WDWA 2BYVE 5FZDA 4FPYA 3VBUA 3UNPA 3QH7A 2XLGA 3CKHA 1O8SA 1G8WA 4CYDA 3E5XA 4HZFA 2P1BA 2R6QA 4ZPIA 1TME1 4EE2A 1T6BX 1VLNA 3H1MA 3RVHA 4DIQA 2DV9A 4QPGA 4YG6A 5T54A 4XFGA 1F2NA 2L9LA 5FY9A 1C1FA 2WNUA 3OYWA 4Q4V1 4OUEA 4LBQB 4LLFA 2GNTA 5E89A 1JXNA 4Y24A 1RUJ3 1TVGA 2FZ1A 1CAUA 2JDAA 1WW5A 1EV13 4QHOA 3FN9A 2OZ6A 4J25A 3RMYA 1YC61 2WS93 1KEXA 2FCUA 3AM2A 3R0RA 2AACA 3I2HA 5C3OA 1MS0A 5L7OA 1JODA 3J26N 4N9HA 4O9GA 5JZGC 1EAH1 4JAAA 2RMU2 2OX0A 5LB6A 2Q1FA 1RUJ2 3LWCA 5IVEA 2VZQA 1W04A 1XNKA 2WSUA 2UYBA 3QD6A 3SMHA 4MGTA 4A41A 5K0UC 1EV12 2R1BA 4QPIB 1OQDA 5EZWA 4QPIA 5HCAA 4EWEA 4QKFA 3R4DB 3W20A 5FPZA 1EYBA 1AF9A 5FZCA 2XVKA 1W8UA 1RUF1 4DRRA 5FPXA 4UFJA 1ZZ6A 5FZGA 1C8M1 2X8KA 2F6BA 3KMHA 3WF1A 4XETA 1OOPA 5T52A 3WQ0A 3MF6A 5FZOB 2WDBA 2VH9A 4HPKA 4W6XA 1RXFA 3ZYGA 1TNRA 5CKMA 4A6SA 5LY2A 2UY9A 2H0VA 5EJZB 5J09A 3E6CC 4CUAA 1KITA 3UKNA 4HFSA 1S55A 3HOBA 1EPWA 3K4AA 5L7OB 3WP6A 4B4QA 4UFKA 2IVIB 3I2GA 2JB4A 4QGLA 2JG9B 4AG4A 2D3SA 2PA7A 3ZOIA 3OPWA 2FCVA 2CY6A 4LNVA 2BEOA 4G4FA 2ZX1A 1MS1A 2E7TA 5G05L 3RZMA 2Y6HA 2NPIA 1CAWB 5E16A 1O5LA 5L19A 1NLSA 1NUKA 4NIIA 5FZ7A 4OMCA 1IPSA 2DCKA 2IC1A 1Q56A 1MEC1 4JTNA 5CADA 1QJY1 4Q2FA 5DUUA 4XVHA 1XU1A 1SLIA 4E2SA 1TG7A 3IIIA 4Y1ZA 4N53C 1S0FA 1I6XA 1ASJ1 1S0CA 2ZHNA 4XF0A 1RUH2 1SBEA 1Y9GA 4JKMA 4Q0UA 4OUSA 4LOTA 1X9TA 1XB9A 3C7HA 5FK7A 4EROA 5AFBA 1LKNA 2Q4SA 4QHZA 4V1PA 3D0SA 4QPIC 4AK3A 4ZZ5A 3ZSKA 3H3ZA 5KXBA 2DURA 1I9RA 2VBPA 3ZDVA 4CDWB 4CP0A 1VBA1 2VL4A 4YG0A 1DQ2A 2VMEA 2A6XA 4XQDA 1XNAA 2JDPA 3DKQA 3CU7A 5FZAA 3VBHC 3VL8A 3WNLA 5AFEA 3AJZA 4K6BA 2FMDA 3T1MA 1EAH2 1L7RA 1OQEA 5IHRA 4Q26A 1APNA 3ZDSA 1QHDA 1RUH3 2YB7A 5A33A 3AP7A 1CAXB 3WR0A 4A3ZA 1HB1A 1OMIA 3MBWA 3RI8A 2Y38A 1TQ5A 4FPJA 1YO8A 3RDIA 3VBRC 5IK5A 1JOBA 4JKKA 5CFCB 2QE3A 1JI6A 4G3YC 2PHLA 1PZ7A 3VZOA 3LIHA 2D6MA 5HV0A 3SQOA 4C1XA 5JXHA 4GQ7A 5FBJA 3KB5A 4QM8A 3H8OA 4NAOA 1Z7S1 5FOJB 1O7FA 4D6RA 3ZN4A 1UY2A 2CGNA 5JXGA 4Q4X3 3WDUA 2Z2SB 3FJSA 2HWC1 3SCGA 2XWJB 2WA4A 4IE6A 4MV2A 1XOYA 4OZXA 1GV9A 1PK6B 3SCHA 3WHUA 3ZFEA 1GICA 3W58A 4QD2A 3WLUA 5FZIA 1S2KA 4LBLA 4NWWA 3EXUA 2UYAA 2V73A 4K3UA 1OA4A 1NA1C 1NCQC 4P9JA 2PN5A 5JVVA 2ZOEB 1LEMA 4NIHA 2QQMA 5D8AC 4BWOA 1UU4A 5FZMA 4BOWA 3VD5A 5HCFA 1VBB3 2XL9A 1WMDA 3AVSA 2AZ5A 3KV4A 4GWJA 4H7LA 4XZPA 5EHDA 4AVTA 3B9CA 1GR3A 5BNPB 2WT0A 2PHWA 2YV8A 2FDHA 2XBO2 5JWPA 3LEKA 3MLKA 1QOTA 4JTOA 4FQZA 3TB0A 3H1YA 2Q1MA 4Q0SA 2QQKA 1OUSA 3IPVA 3U37A 4HMZA 4R9CA 4IEPA 4QB2A 4Q8KA 1WLDA 3GGLA 1F5FA 2VTFA 3GM8A 1WLCA 3IZOA 1RUI2 2QQLA 1BYHA 4JRLA 1VBB2 2NLRA 3GYDA 3A4UA 5CNAA 1LOAA 1ND3B 3N7KA 4IUGA 4EWDA 2RR11 3CL1A 1V6JA 4IETA 4QHBA 1EPZA 3POBA 4MG2A 4LXLA 1YFWA 2JDZA 3UGHA 2VD7A 2X10A 5ABJA 1LENA 4CDQC 3AJYA 4Q29A 4X8PA 5GZEA 5BNOB 4D7TA 1UU5A 4XDPA 4YVSA 4C90A 4FPFA 3WP5A 1NZCA 3V65A 4LITA 1SCSA 3RGBA 1ODNA 1SLCA 4I0AA 2OKXA 3FBMA 3HR9A 5DMYA 1VBC2 3PVOA 4IGOA 4Y4YA 3AC0A 2VCCA 2PTMA 4JHTA 5IW0A 1H9PA 1XC6A 1MACA 5FXVA 3DL3A 3H7YA 3OY8A 3BTZA 3S5AA 4AQ2A 2B8MA 2D43A 4AEDB 4AFCA 1A6CA 3DYOA 4LBOA 4GH4A 2WS92 3T09A 1BEV2 2VE1A 3MIFA 4Q4Y1 5LRRA 1HRV2 4PBPA 2X09A 5KHJA 2VW0A 1W99A 1K5JA 4XZUG 3ZXDA 1MEC3 2IXIA 1DYOA 1QOOA 2D98A 4K20A 4CEWC 5FZ0A 4IV1A 2ZGKA 2A73B 2PHFA 4CDQB 4RYDA 5BXXA 3BB6A 3M7AA 1OA3A 2NYYA 2VOKA 3VD3A 2Z42A 4R4ZA 3ZXAC 1HRI3 3V0BB 1E57A 2YBKA 4FO9A 3S57A 1D0GA 4ZU7A 2HWE3 1PGSA 2OQ7A 3ZMNA 4AQ6A 3JD71 1V00A 5KBFA 1G9FA 3UGFA 2ZTNA 4RHV1 1EP0A 1H1IA 1NY71 1XNBA 1NX9A 4IEVA 4META 4PBOA 3SC7X 3PJYA 2ZEZA 4Q4Y2 4FP2A 4XBLA 3ZM8A 2JG8C 5FO9B 2Y6JA 1ND2B 5IVBA 5JOWA 4ZU4A 1W0PA 3I7DA 1W03A 3IM0A 1W3VA 1N3PA 4AVBA 3FHQA 3DKWA 1KGYA 2YYOA 2XHKA 3WF3A 2TUNA 1JW6A 2N7GA 3RNSA 4BXFA 1WBFA 2RDQA 5G04L 4YZ1A 5FUPA 3BTXA 3KV5A 4OVEA 4JVAA 2BGOA 4CEWA 1JZ3A 4CEWB 5KHGA 5C7GA 1UIKA 4YW6A 5FYIA 1KXGA 4NRMA 4AHXA 2Z5WA 4ATEA 3VKOA 3TOJA 2WNVA 2WO1A 4ORFA 5JCTA 2NM1A 1J3RA 1G7YA 4P9IA 4D3WA 1U5YA 1DGWX 1XXNA 2B4KA 2JDKA 2PHXA 5FZBA 2X05A 1PX3A 2XJVA 2P34A 3KQ4B 4AVAA 5IVFA 2P6HA 4AEDA 3OY8B 1H8TC 2G1MA 1E5HA 3BOWA 5GALA 4XFHA 1HXS3 3OPZA 3DPRB 4LMFA 4YZ5A 1ZRDA 1VMJA 3UETA 4UW3A 4QM9A 4XFIA 2XB6C 3RYRA 4PIXA 1SPPA 1VRH1 4QXCA 1HQLA 3HVDA 2V5YA 3JCIA 3LEIA 5EPAA 1QDOA 3R4UA 4E4ZA 5C70A 2VOWA 3NSTA 1BJQA 1PMIA 3T08A 3WW4A 1CVNA 5JUVA 4FT8A 5IK7A 2TBVA 2CTVA 4FPOB 1YCIA 2DVFA 2VZSA 4JDNA 3FC0A 5IVVA 1RUE3 3M3IA 1OF3A 4XXPA 1W39A 4TTGA 4CDQA 4TZDA 4EZHA 4LT5A 3DF0A 1JYTA 2IXKA 3WSOA 5FZ6A 4L8QA 4XJAA 2XPJA 4YM3A 3N35A 2ZJCA 4AR2A 2RM23 3VBOC 4YZ2A 3AFKA 1ZBA1 2W9XA 3C3VA 1OI6A 4CCMA 1SBDA 2XG3A 5CVRA 4AQSA 5CAZA
chains in the Genus database with same CATH topology
4P00B 3WF4A 2VMFA 3THCA 5LA1A 2VZ3A 3WNNA 1PMJX 3OGVA 2VQUA 5IYYA 1CZSA 1UY3A 4A45A 3A7QA 5J1XA 1JZ8A 3ECQA 4ZXEA 5A1AA 2XOMA 2VCBA 4W50A 2VMDA 2WBKA 1OF4A 5EIYB 3HN3A 2CDOA 2XONA 4RN5A 4LKSA 1F4AA 3IDAA 1W9SA 2VQTA 2B9VA 2VCAA 1IQDC 1K42A 1UY4A 2YFZA 2J1RA 2WZEA 3DECA 1GU3A 1JZ6A 2W5FA 2ZEWA 3E1F1 2R7EB 3CDZB 2J1AA 3ETPA 2QQJA 4L0PA 2EICA 3C8XA 1GOHA 1JZ7A 5CZKA 2J1SA 1O8PA 3MUZ1 2WO2A 1K12A 3ACIA 1GNYA 3IAPA 5FUIA 1US2A 1MPXA 2J1TA 1WKYA 2RV9A 1ULPA 3UESA 3C7EA 1XNTA 1K45A 1GQPA 3WF0A 3I2JA 1GOFA 2VZOA 4Z2AA 2VC9A 3T2OA 4OZOA 1UYZA 2W1UA 4ZY9A 3PUIA 4DUXA 5HPOA 2VOTA 4A4AA 4CU8A 2E31A 1JHJA 1L7QA 1JU3A 4LHSA 1UY1A 3I2FA 2C26A 1JZ5A 4KMQA 1H6YA 3HJRA 2Y6KA 3HNMA 4LPLA 2J1VA 3HNBM 3CMGA 3DYPA 4DXTA 2W1SA 3MV11 1GUIA 1NAEA 3I3EA 2WAOA 2ZEYA 5JXIA 1W8NA 4CU7A 5LA0A 1JZ4A 5I0DA 1UY0A 3BN6A 1W9TA 2EIEA 4XURA 2Y64A 4MADA 3SKJE 3C7GA 3SEPA 1JU4A 2CDPA 4M4RA 3SEEA 3LPGA 2V72A 3LEGA 4ET7A 2E26A 1UZ0A 4DXRA 1W0NA 1H6XA 2ORZA 4XUNA 3K46A 1OD3A 2VZVA 1P8JA 3VD9A 4JKLA 4PT6A 4LQRA 1O59A 3WNOA 2DDUA 3VD7A 3I97A 3UNPA 3CKHA 1O8SA 2EIDA 3I2KA 4P5YA 1J84A 3GDBA 3P1IA 3WQBA 4CUCA 4DUVA 1D7PM 5C71A 1UXZA 2Y6GA 2L9LA 3ACHA 4FI9A 4OUEA 4A44A 2W95A 3DYMA 5DPNA 3A22A 1TVGA 2WO3A 2JDAA 3FN9A 2QQNA 4DEVA 2WUHA 2QQOA 2W91A 1KEXA 3W5MA 1RYYA 2E33A 3I2HA 2BZDA 2C9KA 2JD9A 3OEAA 1GMMA 3I3DA 1DLCA 3K4DA 3WF2A 2W3JA 2VZQA 2W1WA 3JXSA 4A41A 3T2PA 2BBAA 3SKVA 3NRUA 4MGSA 3FL7A 4QB1A 1K3IA 1OH4A 3NQHA 3WF1A 2VO5A 3OGRA 4CU6A 2WDBA 3LE0A 4XUQA 5EJZB 4CUAA 4QX2A 2W47A 2J1UA 2JE8A 3HOBA 5IFPA 3K4AA 3HEIA 3I2GA 4AG4A 1JYNA 3ACGA 2W46A 1GOGA 3VDBA 2J1EA 2WZ8A 5G05L 1SDDB 2Y6HA 3IB3A 1NUKA 4OMCA 4BDVB 2DCKA 4HG6B 1JYWA 1UWWA 3D3AA 4XVHA 3OB8A 1TG7A 3ACFA 3IIIA 3HPNA 3WNKA 3T0DA 4JHZA 4AAXA 1WCQA 4A6OA 4JKMA 3C7HA 5DN2A 1UMHA 4A42A 3CQOA 4ZZ5A 1UYXA 4ZZ8A 1BHGA 2VL4A 5HXMA 2VMEA 4DUWA 3WNLA 1XNAA 4MOAA 3I2IA 4QDRA 1CZVA 2BGPA 2ID4A 4OMDA 1L7RA 5IHRA 2YC2A 2YB7A 2W87A 4M4PA 4A3ZA 2LS6A 3MBWA 4QX0A 4XUPA 1UYYA 4JKKA 1JI6A 2VR4A 2VZ1A 3I3BA 5JXHA 1UXXX 3C7OA 4QB6A 5JMOA 2YG0A 1W8OA 1US3A 3K4ZA 4QX1A 1UY2A 5JXGA 2RVAA 2DCJA 2J22A 2Y6LA 5IJRA 4GZ9A 3F2ZA 2J7MA 4PQQA 3VDCA 4E8CA 2RJ2A 2VM9A 3A23A 4E8DA 3W5NA 2YC4A 1LNSA 1SG3A 1EUTA 3CIHA 2VZPA 2QQMA 2JKXA 2LW8A 1DP0A 3VD5A 3MUY1 4OYUA 4GWJA 4MGQA 3OG2A 2ORXA 2VMCA 2W1QA 5F7UA 3LEKA 3LPFA 4KWUA 5JR2A 2QQKA 4W4ZA 3U37A 3PUHA 4BK5A 1PMHX 3CZJA 4QB2A 1R64A 3GGLA 2VTFA 3GM8A 3J7HA 4XUOA 1EUUA 2QQLA 2QBXA 2HLEA 2W92A 4QDQA 4IUGA 3EB7A 1W9WA 2EIBA 4QX3A 4TXWA 3WNPA 2W94A 2X10A 4ARYA 3K75B 3P6BA 3NNGA 3EYPA 3OEBA 4BXSV 1JYVA 2WAAA 3T0AA 3LQCA 2OKXA 3A21A 2KD7A 4DXSA 4QPWA 5DMYA 2Y8KA 3AC0A 2VCCA 3MO4A 4PF1A 2VJXA 2QQIA 1XC6A 4W8JA 2PQSA 2E32A 3DYOA 3OGSA 1JZ2A 3OBAA 4P02B 3T09A 2WQ8A 3C7FA 4CVUA 2X09A 1W99A 2V4VA 3FHAA 5JXJA 4XZUG 3VDAA 1DYOA 1T2XA 1CIYA 4MO3M 4ARXA 3NJXA 4YPJA 4RYDA 3GXUA 3HNYM 3VD3A 1HN1A 4JX0A 4D8MA 4BJ0A 5B4NA 3CZUA 5LA2A 4DEQA 1UMIA 1ULOA 2WN3A 3IAQA 1NX9A 2VZUA 1PX4A 3T0BA 1XPWA 2WABA 2ZEZA 3ZM8A 1JYXA 1CZTA 2Y6JA 2YFUA 1I5PA 5DQ0A 4D0QA 3WNMA 3FHQA 4QDSA 5CYYA 1KGYA 4KI5M 2V5DA 3MV01 3WF3A 2VZTA 4UI9L 4BK4A 1UX7A 2XQXA 5G04L 2VZRA 2BGOA 1JZ3A 3WEZA 5C7GA 4CU9A 3NJVA 2Z4FA 5IFTA 2C4XA 2WO1A 3BGAA 1OT5A 2HYXA 4QAWA 2B4KA 2X05A 1NKGA 1PX3A 2ZXQA 5EJ1B 5B4XA 5LCWL 3VD4A 2WN2A 1SHWB 2ZEXA 3UETA 2BERA 3T2QA 4CUBA 4UAPA 4GWIA 4P08A 3LEIA 5C70A 3T08A 5JUVA 1CX1A 4UOJA 3THDA 2WYSA 2VZSA 4TTGA 1OF3A 3ABZA 1J83A 3WSOA 3K77A 4XUTA 1F4HA 1YQ2A 2W9XA 2XHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P00 B;  3WF4 A;  2VMF A;  3THC A;  5LA1 A;  2VZ3 A;  3WNN A;  1PMJ X;  3OGV A;  2VQU A;  5IYY A;  1CZS A;  1UY3 A;  4A45 A;  3A7Q A;  5J1X A;  1JZ8 A;  3ECQ A;  4ZXE A;  5A1A A;  2XOM A;  2VCB A;  4W50 A;  2VMD A;  2WBK A;  1OF4 A;  5EIY B;  3HN3 A;  2CDO A;  2XON A;  4RN5 A;  4LKS A;  1F4A A;  3IDA A;  1W9S A;  2VQT A;  2B9V A;  2VCA A;  1IQD C;  1K42 A;  1UY4 A;  2YFZ A;  2J1R A;  2WZE A;  3DEC A;  1GU3 A;  1JZ6 A;  2W5F A;  2ZEW A;  3E1F 1;  2R7E B;  3CDZ B;  2J1A A;  3ETP A;  2QQJ A;  4L0P A;  2EIC A;  3C8X A;  1GOH A;  1JZ7 A;  5CZK A;  2J1S A;  1O8P A;  3MUZ 1;  2WO2 A;  1K12 A;  3ACI A;  1GNY A;  3IAP A;  5FUI A;  1US2 A;  1MPX A;  2J1T A;  1WKY A;  2RV9 A;  1ULP A;  3UES A;  3C7E A;  1XNT A;  1K45 A;  1GQP A;  3WF0 A;  3I2J A;  1GOF A;  2VZO A;  4Z2A A;  2VC9 A;  3T2O A;  4OZO A;  1UYZ A;  2W1U A;  4ZY9 A;  3PUI A;  4DUX A;  5HPO A;  2VOT A;  4A4A A;  4CU8 A;  2E31 A;  1JHJ A;  1L7Q A;  1JU3 A;  4LHS A;  1UY1 A;  3I2F A;  2C26 A;  1JZ5 A;  4KMQ A;  1H6Y A;  3HJR A;  2Y6K A;  3HNM A;  4LPL A;  2J1V A;  3HNB M;  3CMG A;  3DYP A;  4DXT A;  2W1S A;  3MV1 1;  1GUI A;  1NAE A;  3I3E A;  2WAO A;  2ZEY A;  5JXI A;  1W8N A;  4CU7 A;  5LA0 A;  1JZ4 A;  5I0D A;  1UY0 A;  3BN6 A;  1W9T A;  2EIE A;  4XUR A;  2Y64 A;  4MAD A;  3SKJ E;  3C7G A;  3SEP A;  1JU4 A;  2CDP A;  4M4R A;  3SEE A;  3LPG A;  2V72 A;  3LEG A;  4ET7 A;  2E26 A;  1UZ0 A;  4DXR A;  1W0N A;  1H6X A;  2ORZ A;  4XUN A;  3K46 A;  1OD3 A;  2VZV A;  1P8J A;  3VD9 A;  4JKL A;  4PT6 A;  4LQR A;  1O59 A;  3WNO A;  2DDU A;  3VD7 A;  3I97 A;  3UNP A;  3CKH A;  1O8S A;  2EID A;  3I2K A;  4P5Y A;  1J84 A;  3GDB A;  3P1I A;  3WQB A;  4CUC A;  4DUV A;  1D7P M;  5C71 A;  1UXZ A;  2Y6G A;  2L9L A;  3ACH A;  4FI9 A;  4OUE A;  4A44 A;  2W95 A;  3DYM A;  5DPN A;  3A22 A;  1TVG A;  2WO3 A;  2JDA A;  3FN9 A;  2QQN A;  4DEV A;  2WUH A;  2QQO A;  2W91 A;  1KEX A;  3W5M A;  1RYY A;  2E33 A;  3I2H A;  2BZD A;  2C9K A;  2JD9 A;  3OEA A;  1GMM A;  3I3D A;  1DLC A;  3K4D A;  3WF2 A;  2W3J A;  2VZQ A;  2W1W A;  3JXS A;  4A41 A;  3T2P A;  2BBA A;  3SKV A;  3NRU A;  4MGS A;  3FL7 A;  4QB1 A;  1K3I A;  1OH4 A;  3NQH A;  3WF1 A;  2VO5 A;  3OGR A;  4CU6 A;  2WDB A;  3LE0 A;  4XUQ A;  5EJZ B;  4CUA A;  4QX2 A;  2W47 A;  2J1U A;  2JE8 A;  3HOB A;  5IFP A;  3K4A A;  3HEI A;  3I2G A;  4AG4 A;  1JYN A;  3ACG A;  2W46 A;  1GOG A;  3VDB A;  2J1E A;  2WZ8 A;  5G05 L;  1SDD B;  2Y6H A;  3IB3 A;  1NUK A;  4OMC A;  4BDV B;  2DCK A;  4HG6 B;  1JYW A;  1UWW A;  3D3A A;  4XVH A;  3OB8 A;  1TG7 A;  3ACF A;  3III A;  3HPN A;  3WNK A;  3T0D A;  4JHZ A;  4AAX A;  1WCQ A;  4A6O A;  4JKM A;  3C7H A;  5DN2 A;  1UMH A;  4A42 A;  3CQO A;  4ZZ5 A;  1UYX A;  4ZZ8 A;  1BHG A;  2VL4 A;  5HXM A;  2VME A;  4DUW A;  3WNL A;  1XNA A;  4MOA A;  3I2I A;  4QDR A;  1CZV A;  2BGP A;  2ID4 A;  4OMD A;  1L7R A;  5IHR A;  2YC2 A;  2YB7 A;  2W87 A;  4M4P A;  4A3Z A;  2LS6 A;  3MBW A;  4QX0 A;  4XUP A;  1UYY A;  4JKK A;  1JI6 A;  2VR4 A;  2VZ1 A;  3I3B A;  5JXH A;  1UXX X;  3C7O A;  4QB6 A;  5JMO A;  2YG0 A;  1W8O A;  1US3 A;  3K4Z A;  4QX1 A;  1UY2 A;  5JXG A;  2RVA A;  2DCJ A;  2J22 A;  2Y6L A;  5IJR A;  4GZ9 A;  3F2Z A;  2J7M A;  4PQQ A;  3VDC A;  4E8C A;  2RJ2 A;  2VM9 A;  3A23 A;  4E8D A;  3W5N A;  2YC4 A;  1LNS A;  1SG3 A;  1EUT A;  3CIH A;  2VZP A;  2QQM A;  2JKX A;  2LW8 A;  1DP0 A;  3VD5 A;  3MUY 1;  4OYU A;  4GWJ A;  4MGQ A;  3OG2 A;  2ORX A;  2VMC A;  2W1Q A;  5F7U A;  3LEK A;  3LPF A;  4KWU A;  5JR2 A;  2QQK A;  4W4Z A;  3U37 A;  3PUH A;  4BK5 A;  1PMH X;  3CZJ A;  4QB2 A;  1R64 A;  3GGL A;  2VTF A;  3GM8 A;  3J7H A;  4XUO A;  1EUU A;  2QQL A;  2QBX A;  2HLE A;  2W92 A;  4QDQ A;  4IUG A;  3EB7 A;  1W9W A;  2EIB A;  4QX3 A;  4TXW A;  3WNP A;  2W94 A;  2X10 A;  4ARY A;  3K75 B;  3P6B A;  3NNG A;  3EYP A;  3OEB A;  4BXS V;  1JYV A;  2WAA A;  3T0A A;  3LQC A;  2OKX A;  3A21 A;  2KD7 A;  4DXS A;  4QPW A;  5DMY A;  2Y8K A;  3AC0 A;  2VCC A;  3MO4 A;  4PF1 A;  2VJX A;  2QQI A;  1XC6 A;  4W8J A;  2PQS A;  2E32 A;  3DYO A;  3OGS A;  1JZ2 A;  3OBA A;  4P02 B;  3T09 A;  2WQ8 A;  3C7F A;  4CVU A;  2X09 A;  1W99 A;  2V4V A;  3FHA A;  5JXJ A;  4XZU G;  3VDA A;  1DYO A;  1T2X A;  1CIY A;  4MO3 M;  4ARX A;  3NJX A;  4YPJ A;  4RYD A;  3GXU A;  3HNY M;  3VD3 A;  1HN1 A;  4JX0 A;  4D8M A;  4BJ0 A;  5B4N A;  3CZU A;  5LA2 A;  4DEQ A;  1UMI A;  1ULO A;  2WN3 A;  3IAQ A;  1NX9 A;  2VZU A;  1PX4 A;  3T0B A;  1XPW A;  2WAB A;  2ZEZ A;  3ZM8 A;  1JYX A;  1CZT A;  2Y6J A;  2YFU A;  1I5P A;  5DQ0 A;  4D0Q A;  3WNM A;  3FHQ A;  4QDS A;  5CYY A;  1KGY A;  4KI5 M;  2V5D A;  3MV0 1;  3WF3 A;  2VZT A;  4UI9 L;  4BK4 A;  1UX7 A;  2XQX A;  5G04 L;  2VZR A;  2BGO A;  1JZ3 A;  3WEZ A;  5C7G A;  4CU9 A;  3NJV A;  2Z4F A;  5IFT A;  2C4X A;  2WO1 A;  3BGA A;  1OT5 A;  2HYX A;  4QAW A;  2B4K A;  2X05 A;  1NKG A;  1PX3 A;  2ZXQ A;  5EJ1 B;  5B4X A;  5LCW L;  3VD4 A;  2WN2 A;  1SHW B;  2ZEX A;  3UET A;  2BER A;  3T2Q A;  4CUB A;  4UAP A;  4GWI A;  4P08 A;  3LEI A;  5C70 A;  3T08 A;  5JUV A;  1CX1 A;  4UOJ A;  3THD A;  2WYS A;  2VZS A;  4TTG A;  1OF3 A;  3ABZ A;  1J83 A;  3WSO A;  3K77 A;  4XUT A;  1F4H A;  1YQ2 A;  2W9X A;  2XHN A; 
#chains in the Genus database with same CATH topology
 4JV4 A;  4P00 B;  4QXB A;  3SH3 A;  5JPN B;  4JQT A;  4NR1 A;  2WJS A;  1REE A;  2HKX A;  3KV9 A;  1QJZ A;  4Y1V A;  4P9X A;  1ZBA 2;  4COW A;  2GNB A;  1AUY A;  1VAV A;  3NNM A;  4OHX A;  5J1X A;  3ECQ A;  1BCX A;  2RM2 2;  3E97 A;  4ZXE A;  5KXC A;  3VZN A;  2E53 A;  1FXZ A;  1OF4 A;  2D3R A;  3HN3 A;  4CDU B;  2ARX A;  3U4S A;  2JB8 A;  2WWJ A;  3IDA A;  4AFD A;  2D5H A;  4LBK A;  2P2K A;  2VCA A;  3D6E A;  1IQD C;  1ZBA 3;  3ACL A;  4ZXK A;  3JB4 C;  3VB9 A;  4Z92 B;  3JQW A;  3FMG A;  5I8S A;  3ST7 A;  1O4T A;  3EO6 A;  4GAL A;  4JGY C;  3RYK A;  2J1R A;  2WZE A;  4XQW A;  2RE9 A;  1GU3 A;  1QQP 2;  4IEX A;  1JOP A;  5CFD C;  1S2E A;  3L9J T;  4HKO A;  3AK0 A;  3W9A A;  1L7L A;  4CZS A;  3E1F 1;  1RMU 1;  4YSF A;  1S0I A;  1LES A;  4PLN A;  4FPG A;  3BAL A;  4LO5 B;  5BV6 A;  1FOD 2;  3RZG A;  1BBT 3;  1BXH A;  4LHK A;  1LGB A;  1FNY A;  1RUI 3;  2X5I B;  3B3Q E;  4NOT A;  2EIC A;  5BNP A;  1C8N A;  1ZBE 1;  3DXU A;  3F95 A;  5LEJ A;  3AZX A;  1JMU B;  3KHB A;  4HK9 A;  5HI0 A;  4PCR A;  4JDO A;  1O8P A;  3FHI B;  4IL7 A;  1MS8 A;  4KWJ A;  4UBH A;  4JQR A;  1W3X A;  1CN1 A;  1KDM A;  1SBF A;  3MW2 A;  3ACI A;  5LAT A;  5FUI A;  1US2 A;  3WDV A;  4LKF A;  3IBM A;  5FMB A;  4B29 A;  1W28 A;  1WKY A;  1PO1 3;  2WWS A;  2PLV 2;  1ZZ7 A;  4I3P A;  1YFU A;  3IPV B;  4HVQ A;  1RED A;  2BJS A;  2R04 1;  1GOF A;  1SPP B;  2R49 A;  1AR6 3;  2JE9 A;  1R1A 1;  2GMP A;  3SNM A;  3TN9 1;  3T2O A;  4OZO A;  1E5I A;  4AVS A;  4C0B A;  4Z2A A;  1Y9Q A;  4CDW C;  3WX5 A;  5D8A A;  1AR8 3;  1CJD A;  2CU5 A;  3ZYB A;  1RUD 2;  4OUM A;  4BPZ A;  5I0R A;  4XF3 A;  1UOF A;  4CU8 A;  2ET7 A;  1W6Q A;  3SXW A;  4BQX A;  1H4G A;  1JU3 A;  5A7S A;  3AYE A;  3PUA A;  2IZW A;  4YM2 A;  5ERL A;  1H6Y A;  3AYD A;  2ES3 A;  2WT1 A;  2DVA A;  3ALQ A;  4LEJ A;  3USU A;  1MQT B;  4HVR A;  1SLB A;  3ZIX A;  3B9I A;  3CMG A;  2XDV A;  3DYP A;  3HNB M;  4O65 A;  5FXZ A;  2ZGS A;  2XVG A;  4WVM A;  5FYZ A;  4DXT A;  5K8S A;  2JG8 B;  2R06 3;  3MI8 A;  1FMD 1;  2LM3 A;  3RYP A;  4YGD A;  2XLF A;  3LSD A;  2ZS6 B;  3LCP A;  5FRE A;  5LA0 A;  1CIW A;  5EP9 A;  2OUJ A;  4LTA A;  3GNE A;  2WS9 1;  2ZMK A;  4KNC A;  5FFO C;  2BNM A;  4C91 A;  4MAD A;  2UY8 A;  1W8F A;  3MLL A;  1HQN A;  4RQP C;  2P3J A;  2CDP A;  1RUJ 1;  3N7L A;  3ROU A;  4M4R A;  3SEE A;  3LPG A;  4Z2W A;  4XFA A;  4NHK A;  1RUN A;  3HQX A;  4QQO A;  4URA A;  5DAV A;  1R08 1;  3MLJ A;  4YFW A;  1FX5 A;  4M3C E;  4HPK B;  4R9A A;  3P5B A;  5FZO A;  4YW2 A;  1AR7 3;  4N7I A;  3K46 A;  1OD3 A;  3T4V A;  1POV 1;  3PVE A;  1WLT A;  4YVW C;  2XJQ A;  4LJH A;  3VD9 A;  1MS3 A;  1AJK A;  1XNC A;  1H0B A;  2ZX2 A;  2WFF 2;  5JSO A;  3POF A;  4XAC A;  1DGL A;  1QKQ A;  5EJ3 A;  5C3S A;  2WL1 A;  4B7E A;  3KT4 A;  1OLM E;  1UZY A;  4EN6 B;  3WXP A;  3O1M A;  4Q4W 3;  1LED A;  3GDB A;  3WQB A;  3P1I A;  4NAM A;  3UJO A;  4LBJ A;  3B02 A;  2HWF 2;  5A1F A;  1RJ7 A;  4AEM A;  2G9Z A;  3KT1 A;  1FYU A;  4RFT 0;  3CO2 A;  3UT0 A;  2OA2 A;  2VUL A;  2W95 A;  3ATG A;  4OFG A;  4LO6 B;  4RS5 C;  5DPN A;  1SCR A;  3FX3 A;  2YPJ A;  2B46 X;  4AYU A;  5JIA A;  3IMN A;  1GZ9 A;  4K1Z A;  4RQP A;  3I49 A;  2VBB A;  4IDZ A;  3UGG A;  1TEI A;  2W91 A;  1W6O B;  2WIN B;  4K8R B;  2MEV 2;  1BVP 1;  2VQ0 A;  3E5Q A;  4I3G A;  2VOV A;  4LA3 A;  1AHS A;  3B94 A;  4UBG A;  3LIG A;  5TSW A;  5CG8 A;  4XJ9 A;  1GMM A;  3I3D A;  4HXC A;  4BH9 A;  2GC1 A;  1RB8 G;  1IKQ A;  2WFP A;  3WP4 A;  1TZO A;  4WVM B;  2RS5 3;  5EWS A;  3U78 A;  2FMY A;  4ZKT B;  3VBU B;  1KD7 A;  2HWC 2;  3T2P A;  2G4I A;  3RZK A;  4AZZ A;  1ACC A;  3EQE A;  2VW2 A;  2BBA A;  3FZ3 A;  1PIV 2;  4S2G A;  4ES8 A;  3BIW E;  4Q1P A;  1U0A A;  3FFZ A;  1N3O A;  3MF9 A;  1UD1 A;  3K2O A;  4XXA A;  1VBE 1;  1BKZ A;  2CGO A;  3O0W A;  3KCC A;  2VO5 A;  2W2I A;  3W59 A;  2F4L A;  1YJK A;  5BNN C;  4IES A;  3I2O A;  4KWL A;  1COV 1;  3IKW A;  2E6V A;  2J1U A;  2W47 A;  3NV2 A;  5IFP A;  5K0U A;  3USU B;  2LTN A;  5F6K A;  3VBS A;  5CFD B;  1V6I A;  2FD8 A;  1W6M A;  2K9Z A;  5CG9 A;  3I3Q A;  1W9F A;  3O14 A;  2F4P A;  2R07 1;  4D6S A;  5IAT A;  2QCS B;  1GOG A;  3B7M A;  4DB5 A;  2Y6F A;  3H7J A;  1D2S A;  2J1E A;  1N3Q A;  1OUR A;  2WZ8 A;  3ZYR A;  1HRV 1;  5E6H A;  2WNO A;  1SDD B;  3ON7 A;  2ZHM A;  4DIN B;  4CEY A;  2ZX0 A;  1QOS A;  1RUC 1;  4AEJ A;  3VHP A;  5IK8 A;  4BDV B;  1PGL 1;  3J8F 2;  3ETQ A;  3AP4 A;  2PFW A;  3LZZ A;  5HBA A;  3HQU A;  1ENS A;  2JE7 A;  3PUS A;  1QGL A;  3D5O A;  3OB8 A;  3O12 A;  4GWM A;  3GCX A;  1RGS A;  3ACF A;  1HIX A;  3GHM A;  2A6W A;  3OGJ A;  1GWM A;  4OCT A;  1WLW A;  4QPG C;  5FZ9 A;  4LUK A;  4YW7 A;  5FDB A;  4BQW A;  1BBT 2;  3H0O A;  2BU9 A;  1WCQ A;  2R07 3;  3G6J B;  3PMS A;  4M3C F;  4TWT A;  3WG3 A;  3ZVX A;  5A70 A;  2ZBJ A;  1YHF A;  2AC1 A;  2XUE A;  2DTY A;  3RG0 A;  4CDX B;  1QIQ A;  1UYX A;  4LOR A;  1RTV A;  4Y1U A;  3KT7 A;  3BYW A;  1DZQ A;  1NQD A;  2IXJ A;  4RA0 A;  4DUW A;  4K9S A;  2BWA A;  3GBW A;  3I2I A;  4QDR A;  4N43 A;  1ZM1 A;  4QKB A;  1W6N A;  4XBQ A;  2C9A A;  2ID4 A;  4LIU A;  5EQU A;  2YC2 A;  2CAV A;  3P3N A;  4WVZ A;  3U0Z A;  4L9B A;  3PVB B;  1UZZ A;  4CUG A;  4CPB D;  5BNN B;  3ZFG C;  2XR4 A;  4S2D A;  3H3U A;  3D0J A;  1OLM A;  1SFP A;  2W39 A;  2NMO A;  1WMX A;  2ADD A;  2WZR 3;  1UYY A;  2YDE A;  5DUV A;  3LD8 A;  4RS5 A;  1TMF 3;  3SCF A;  2EXI A;  2KM2 A;  3PIG A;  3KV6 A;  4GAZ A;  3QCW A;  1ZA7 A;  5GJ6 A;  3ZR5 A;  2GC0 A;  1UXX X;  3C7O A;  5LAS A;  1V9U 3;  3HT2 A;  4FP3 A;  5JMO A;  4FAG A;  5I8T A;  2WLP A;  1IGO A;  2JG9 A;  2RS3 1;  4QX1 A;  2CWM A;  1GZW B;  1BMV 2;  1K5M B;  5C9A B;  1RUC 2;  2G9F A;  5D1I A;  5FZF A;  2R1D A;  2Y6L A;  5IJR A;  3VZL A;  3DEM A;  4COZ A;  1LU1 A;  3FUO A;  1TMF 2;  5IAV A;  5DDJ 1;  1OHF A;  5A3O A;  4E8C A;  2B7Y A;  3O5S A;  3MFA A;  2P4E A;  1MVE A;  5BNO C;  3O1S A;  4L92 A;  4E8D A;  5LA9 A;  2P6C A;  2VNO A;  1POV 0;  5KC6 A;  3W5N A;  3FE5 A;  3WCR A;  5CA6 A;  3OJB A;  3MW4 A;  5ANN A;  3U07 A;  4JDM A;  1O6U A;  1WME A;  2JKX A;  5L73 A;  2ZML A;  4QQ2 A;  1XE0 A;  4AFB A;  1DP0 A;  1OPM A;  3M70 A;  5E88 A;  2ZGR A;  5F5C A;  3ZFF A;  1AR6 1;  2MPF A;  1VMH A;  4OYU A;  4BQY A;  4MGQ A;  3QOP A;  2ORX A;  1RIT A;  4B4P A;  4XJU A;  5I8Y A;  4XIO A;  2ENR A;  4AED C;  4BE3 A;  4BQ3 A;  2BVV A;  3KLS A;  1PO1 1;  4XAA A;  4YAR A;  1QF3 A;  4W4Z A;  4F8A A;  2W08 A;  3ASI A;  3PUH A;  5JI7 A;  1VB2 A;  3T4H B;  5A7O A;  3VBF C;  4AI9 A;  3CZJ A;  5CKN A;  1GWL A;  2LRO A;  5FP8 A;  3ZX7 A;  2ZX3 A;  3VDD B;  5A6X A;  2H0B A;  1X9P A;  4QDQ A;  4IQP A;  5LEK A;  2B5H A;  3EB7 A;  4OHY A;  1W9W A;  2EIB A;  3IDE A;  4QX3 A;  4EZ4 A;  2W68 A;  5KC5 A;  4M0H A;  2V4A A;  1N47 A;  4TXW A;  1BZW A;  2YHJ A;  3ITQ A;  2VXJ A;  5A6Q A;  1AL2 3;  2WNU B;  2PAM A;  2ZAA A;  5KHK A;  3WG2 A;  5KHH A;  1KFX L;  2IUW A;  2A6V A;  5FQ0 B;  3H8R A;  1DZR A;  4OUL A;  5L9V A;  1HV0 A;  2WAA A;  3T0A A;  3LQC A;  4D6Q A;  5FKC A;  1XYN A;  3RJR A;  1G9D A;  1W2A X;  1K5M C;  2E9Q A;  4DXS A;  4QPW A;  2Y8K A;  2R06 1;  4N7U A;  3KQR A;  4BIS A;  3NL1 A;  1YWK A;  2XUM A;  1B35 B;  1WZX A;  2VJX A;  1R09 1;  4PF1 A;  3WP3 A;  4A2U A;  5C8C A;  3ENR A;  2HYK A;  3MFC A;  3VZJ A;  1GP5 A;  2JX9 A;  2PQS A;  4IE5 A;  1W6P A;  3L2Y A;  1Q3E A;  3HD8 B;  4LE4 A;  4PDW A;  3S5Q A;  3OGS A;  1W05 A;  3M8L A;  4N90 A;  1D4M 3;  5I0T A;  4I30 A;  4NPL A;  5FYM A;  2VY0 A;  3CHX A;  5A7W B;  3N9Q A;  4BA6 A;  5I91 A;  1PO2 2;  4YFZ A;  1AXZ A;  3SIS A;  1H8T B;  3V64 A;  3LA2 A;  4XHB A;  5SV5 A;  5T50 A;  4CXX A;  4MO3 M;  1CIY A;  1A3K A;  1JUH A;  2EXJ A;  4BIO A;  4DPN A;  2D5F A;  3O1T A;  3VKL A;  5BNP C;  2PXJ A;  4PF5 A;  1G9A A;  1ZRC A;  1ULC A;  1ENX A;  4NWV A;  3GXU A;  1LOG A;  2HH9 A;  2D6O X;  1D4M 2;  1VBA 3;  2VUA A;  4JZR A;  3CEW A;  1UF2 C;  1WCS A;  2A75 A;  2XWB B;  3GF6 A;  4L99 A;  4NRP A;  4D8M A;  2DFC A;  2GP3 A;  1ALY A;  3MIB A;  3N9M A;  1SQ4 A;  1VMF A;  4XDO A;  3J7M A;  5A80 A;  1OA2 A;  4XIK A;  1LEC A;  5FAX A;  1ULO A;  4ZS2 A;  4AI8 A;  2WN3 A;  3OF1 A;  1PX4 A;  1Q8S A;  1XPW A;  1RIR A;  2R0H A;  2VBD A;  3M3Q A;  4FFH A;  1W2O A;  4AEK A;  1PGW 2;  4XC9 A;  2HEW F;  1PNG A;  2ZCW A;  2BV4 A;  1ZBE 3;  1XBF A;  2ZGU A;  5DQ0 A;  4BLJ A;  4XF9 A;  1NY7 2;  3PU3 A;  5IUQ A;  5K9Y A;  3WNM A;  4F3J A;  5JAX A;  2OZJ A;  3G7D A;  2GSY A;  5BNO A;  1AL2 1;  5CYY A;  5KR7 A;  4KI5 M;  2V5D A;  4YGC A;  1AX0 A;  2UUR A;  4XQ4 A;  5KXD A;  4EJR A;  4UI9 L;  4BK4 A;  5J37 A;  5FPV A;  1V6O A;  5FMC A;  5BYN A;  4FFI A;  2NQY A;  3GJB A;  5AC9 1;  2B39 A;  2IWG B;  2IXL A;  5FPU A;  2DUO A;  1CD3 G;  1OFS A;  4AE2 A;  3KCY A;  1TE1 B;  1PVC 2;  3B00 A;  3NJV A;  1W9Y A;  2Z4F A;  1GWK A;  4HKL A;  3UL2 A;  3RS6 A;  2BRT A;  1ZA4 A;  2ARE A;  2E63 A;  4XFC A;  5A7Q A;  5CBL A;  3V0A A;  4N53 A;  3BI3 A;  1QJF A;  3SLI A;  4AGV A;  2CL2 A;  3HT1 A;  1WD3 A;  2C1F A;  3ORJ A;  1OT5 A;  4QAW A;  4FTE A;  4COU A;  4LO8 A;  2ZXQ A;  2CWS A;  3WCS A;  1S2B A;  2WYF A;  1NT0 A;  2H6B A;  4YYO A;  2Q8O A;  2VTX J;  4IW3 A;  1Q8P A;  1JOJ A;  4K1Y A;  5FY0 A;  4EN0 A;  1MS4 A;  5FPB A;  5F5A A;  5FP7 A;  1CX1 A;  4UOJ A;  1F31 A;  5I0S A;  2ZA9 A;  1XSQ A;  1CQ9 A;  2E51 A;  5GLZ A;  3H8X A;  1ZRF A;  1ZYB A;  1N1V A;  3K77 A;  2VEC A;  2VUC A;  1CAV B;  1J58 A;  4XUT A;  3VV1 A;  5A7P A;  1F4H A;  1RL3 A;  2W0X A;  2BVB A;  1S0D A;  2XHN A;  1OOP C;  1Q43 A;  2RDR A;  3O0X A;  1V9U 1;  3WF4 A;  3IN9 A;  3MIC A;  2VZ3 A;  4UFM A;  4M3C B;  4QU1 A;  1KFU L;  3WNN A;  3ZMO A;  3OGV A;  1UL9 A;  2XJP A;  1I1E A;  2BGC A;  2VQU A;  1PK6 A;  1J3P A;  1RUI 1;  1HJF A;  1H2L A;  1UY3 A;  4Q4V 3;  1QJY 3;  2QQW A;  3ZKY A;  3R4S A;  1QJX 3;  2EXK A;  5A1A A;  4MYE A;  5HV4 A;  4HBN A;  4AHW A;  2O8Q A;  5JSP A;  4MGZ E;  1E5S A;  2WA3 A;  1DG6 A;  2XBO 1;  4F7Z A;  1UYP A;  5ACA 3;  3JBG 3;  2GP5 A;  2RDN A;  1MS5 A;  3AZV A;  2XON A;  4LKS A;  1DGR N;  5DAX A;  4NIA A;  4AF9 A;  5LRS A;  1K42 A;  1NOV A;  3JU9 A;  3PHM A;  1YJL A;  5FPL A;  3FLR A;  1RUG 3;  2JG8 A;  1QJX 2;  2VVF A;  1NQJ A;  1QH6 A;  3LSE A;  1JS9 A;  2JD4 A;  2MNG A;  5GLV A;  2ZZQ A;  1H1M A;  4MVT A;  4YGB A;  4KG8 A;  5J7M A;  1CGP A;  2WNU C;  1UPS A;  1NCQ A;  1VRB A;  2ZEW A;  3M3C A;  3BTA A;  3VKN A;  4Y5S A;  2WRA A;  1AR9 2;  2J1A A;  4CRQ A;  3ETP A;  2QQJ A;  1FMD 2;  5SV8 A;  4HLT A;  3AXE A;  5FO8 B;  3IWZ A;  2YU1 A;  4H2A A;  4FFF A;  1WCD J;  3ZSJ A;  4Q4W 1;  4UW4 A;  1SDW A;  4H14 A;  5JOZ A;  1RHI 2;  4Q5O A;  3CJI B;  2ARC A;  2LUW A;  1AYN 3;  3BVC A;  3UES A;  5GZG A;  2O0O A;  3TRS B;  4RR3 B;  2GN7 A;  2ADE A;  5FXX A;  2HWD 1;  5CB7 A;  1K45 A;  1GQP A;  1SFY A;  1Q8Q A;  5DAW A;  2VZO A;  3U11 A;  4JGY B;  3H8U A;  4YW3 A;  2D6P A;  2VC9 A;  1ASJ 3;  1H9W A;  3PNA A;  5CFC C;  3GBF A;  4AXO A;  4IEU A;  1UYZ A;  4IEQ A;  4A3X A;  3POI A;  4LBN A;  4NHL A;  2DCT A;  4ZY9 A;  2R04 2;  4DQA A;  1XYO A;  1YUD A;  1AYN 2;  3OSD A;  4A4A A;  1R09 2;  1S0B A;  1LJ7 A;  1QEX A;  4OLL A;  5AVP A;  1ENQ A;  2NN8 A;  2AH2 A;  3WG4 A;  1AZD A;  2WZP P;  1UY1 A;  2SBA A;  4HON A;  4AHZ A;  4KMQ A;  1S0G A;  2AYH A;  2CYF A;  3HJR A;  2PHT A;  5FO7 B;  4AOC A;  4GWN A;  1I3H A;  2WKK A;  4D7Y A;  4XOG A;  5LZ6 A;  2ZGQ A;  4AQT A;  1GUI A;  4JRA A;  1NAE A;  4OI1 A;  4CEY C;  2XJR A;  3I3E A;  5FJK A;  4CU7 A;  1UW8 A;  3PIJ A;  1JZ4 A;  1FOD 1;  1UY0 A;  1UPI A;  5I0D A;  1LGN A;  4KBZ A;  2EIE A;  1KJL A;  4AI0 A;  4DNY A;  2JIG A;  1NA1 B;  5JZG B;  3C7G A;  5LBC A;  2J42 A;  1Y4W A;  2RMU 1;  1ONA A;  1WGP A;  4Y1X A;  1D0H A;  1OH3 A;  1VR3 A;  5IVJ A;  1S0E A;  2VNR A;  4NPM A;  3WDY A;  1RXG A;  3DUI A;  3JZV A;  2GN3 A;  4XAE A;  3TBD A;  2Y60 A;  4AI2 A;  3O0V A;  1W0N A;  2ORZ A;  1G9C A;  4F83 A;  1DZT A;  1JYC A;  3D82 A;  4NHY A;  3V0A B;  3WQ7 A;  1KRI A;  4WVV A;  4W6W A;  1VBE 2;  4JKL A;  5BUV A;  2VQA A;  5FTT C;  1WMF A;  1ZZB A;  4LQR A;  4R9B A;  4A7Z A;  1PM7 A;  1QNY A;  2CHH A;  1VAK A;  5GM0 A;  5FYB A;  3VD7 A;  2JDY A;  3RWN A;  3I97 A;  1LOB A;  5F5Q A;  2EID A;  2DU0 A;  3I2K A;  3NNJ A;  4LLO A;  1LOF A;  4P5Y A;  1J84 A;  4CUC A;  4DUV A;  1IPK A;  4QGM A;  1Q8O A;  1N1S A;  5EYX A;  4BU2 A;  3I3M A;  1D7P M;  5C71 A;  1DU3 D;  2RS1 1;  1POQ A;  3VBF B;  3ZYJ B;  1EV1 1;  1VBE 3;  5ACA 1;  2Y6G A;  3RPQ A;  5C3Q A;  2PHD A;  5DUW A;  4OQ9 A;  3ACH A;  4FI9 A;  4MXW B;  2GME A;  2GZW A;  2QJV A;  1ZZC A;  2MEV 1;  3N9L A;  1QJX 1;  3DYM A;  1DCS A;  4YWA A;  5F37 A;  1V0A A;  3A22 A;  4XIL A;  1OUX A;  4ZHN A;  2QQN A;  3M1H A;  2A1X A;  2YZ4 A;  2WUH A;  4Q4X 1;  4NVP A;  1RYY A;  2EF6 A;  2E33 A;  1O4Y A;  2C9K A;  1V6M A;  3CNA A;  1LHN A;  1BVV A;  3OEA A;  5ISL A;  1DLC A;  1W6P B;  4X8N A;  2W3J A;  3V56 A;  1MZE A;  4K7J A;  5FZ8 A;  4DY3 A;  3JXS A;  4IGQ A;  5A3W A;  4S2H A;  1CPN A;  4XJ8 A;  1W2T A;  4CDX C;  5M0T A;  2UWC A;  1VP6 A;  1IQA A;  1TME 2;  2Y26 A;  2KA3 A;  3H9A A;  2QDN A;  5H9R A;  1LOD A;  1DYK A;  2PHU A;  3VBO B;  1MZ5 A;  4KGG A;  3FL7 A;  3IMM A;  4QB1 A;  1K3I A;  1OH4 A;  3NQH A;  2D40 A;  3PDQ A;  4YG3 A;  3WNX A;  5LBF A;  4QPG B;  2SLI A;  3U10 A;  1JHN A;  1V6N A;  4CU6 A;  3LE0 A;  5FXW A;  4XUQ A;  5C4W C;  3BU7 A;  1Z78 A;  1RJ8 A;  3I4I A;  5L9R A;  3HBZ A;  4IV1 B;  4QX2 A;  2JE8 A;  1FAT A;  4PI2 A;  5LK5 A;  5FY1 A;  1BQP A;  4O61 A;  4OQ8 A;  1H2K A;  1DDL A;  3HEI A;  1QU0 A;  2ZGO A;  4MH0 E;  2RS3 3;  3FFQ A;  1JYN A;  4RFR B;  3ACG A;  1AJO A;  4P5H A;  2W46 A;  2YGM A;  3RRD A;  1JBC A;  5ACA 2;  1UOJ A;  1PGL 2;  2AEN A;  3AP5 A;  5F3C A;  4XYX A;  1AYM 2;  5F1R A;  1EY2 A;  4NPR A;  4R9D A;  1RC6 A;  1E5R A;  3AMH A;  3ZYH A;  4CDW A;  5DAB A;  4KG0 A;  3IB3 A;  4M0N A;  3HBK A;  2NP0 A;  3ZSL A;  4WVW A;  4CCE A;  4KQ7 A;  4HG6 B;  2JKB A;  4QX8 A;  1JYW A;  1UWW A;  1NXD 1;  1MS9 A;  1UX6 A;  3D3A A;  4B4R A;  4MXW A;  4P9L A;  4X6Q B;  2FDG A;  2A3X A;  2YBS A;  4NO4 A;  3HPN A;  1LCL A;  4CDU A;  3WNK A;  2VXR A;  2DF7 A;  4AAX A;  3T30 A;  4UW5 A;  1HN0 A;  4B7K A;  2X5I C;  4IGP A;  2VMG A;  4NE9 A;  4B8E A;  4LE3 A;  5BY5 A;  5DN2 A;  1OVS A;  1UMH A;  3D4K A;  4A42 A;  1B35 A;  2BDR A;  1OKQ A;  5FZ1 A;  4ZZ8 A;  4W6Y A;  1CAW A;  3ZXG A;  1BHG A;  1PIV 1;  3ILR A;  1F9K A;  3RSJ A;  5HXM A;  3NAP C;  5FP3 A;  5FZK A;  4MOA A;  1H1A A;  4M3C A;  5JZG A;  3OBT A;  4FXK B;  1RHI 3;  1YQ8 A;  1QJU 3;  2BGP A;  4OMD A;  1GSL A;  2BOI A;  3WG1 A;  1CR7 A;  2W87 A;  5F3I A;  1SAC A;  4C8D A;  2VGD A;  5IK4 A;  1FAY A;  2HJI A;  3ZXF A;  1XE8 A;  3ZIW A;  4QX0 A;  4FTB A;  4QU2 A;  4Q4X 2;  3WHT A;  4XUP A;  3VKM A;  4GJZ A;  5FWE A;  2OVU A;  3HIF A;  1ASJ 2;  1VE0 A;  2BPA 2;  4PI0 A;  1IG0 A;  3I3B A;  4UW6 A;  3UJQ A;  3WIN E;  4AHY A;  1OOP B;  2ZGL A;  1V6L A;  2R04 3;  2ETE A;  1D4M 1;  2FCT A;  1EAH 3;  2NZ9 A;  3H3L A;  4N53 B;  1RUG 1;  2JXA A;  3TEX A;  2YG0 A;  3WW1 A;  1LAJ A;  1R09 3;  3KVA A;  1W8O A;  2QQU A;  3S0M A;  2XL7 A;  1O4Z A;  3K4Z A;  3QAC A;  1W06 A;  1C57 A;  5FP9 A;  4AVC A;  3WV6 A;  2RVA A;  4CXW A;  1CON A;  2J22 A;  3M3E A;  2W52 A;  4ASK A;  4GZ9 A;  2C24 A;  3BCW A;  3F2Z A;  4FPH A;  5FYH A;  1POV 3;  1X8M A;  4PQQ A;  3VDC A;  4U36 A;  2FHR A;  4GMP 1;  1VBB 1;  3EHK A;  4JGY A;  3ZO0 B;  3U1X A;  2ARB A;  4UWD A;  5FMO S;  3A23 A;  2XBO 3;  1R08 3;  2YC4 A;  4AW7 A;  3NWK A;  5K4L A;  1OC1 A;  1EUT A;  1YEW A;  2EXH A;  1ND2 A;  1IS4 A;  3CIH A;  4LKE A;  5APA A;  2B45 X;  1OFN A;  3ME2 A;  3WT3 A;  2VZP A;  2WFF 1;  1XE7 A;  3AB0 A;  4XHX A;  5FWJ A;  1QJE A;  1WUV A;  1ULF A;  3POG A;  3AMQ A;  1KQR A;  2RS5 1;  2GH8 A;  3IIA A;  1M4W A;  5AC9 2;  1NE6 A;  2QFE A;  3KGZ A;  5GLW A;  3KD4 A;  2QZ2 A;  2VMC A;  2W1Q A;  1RUO A;  2E7Q A;  4MGK E;  3LPF A;  3VZM A;  1NCR C;  1F35 A;  3R05 A;  3GCW A;  4YM0 A;  5FMO L;  5JR2 A;  2IVJ A;  4BK5 A;  4QGN A;  4RR3 A;  1PMH X;  2PEL A;  1XSR A;  4NRQ A;  5DZE A;  1IHM A;  1Z7S 3;  2WNV B;  3J7H A;  4XUO A;  2GAL A;  1EUU A;  4ZU5 A;  4A7Y A;  1W0O A;  2GU9 A;  3UV9 A;  4EQV A;  4CP1 A;  3NNF A;  1UKR A;  3O7O A;  4IV3 A;  4O9E A;  4I0W B;  1H8T A;  2VMI A;  3VKF C;  1PK6 C;  4ARY A;  2XKO A;  4NRO A;  3EYP A;  5A7W A;  1JYV A;  1CAX A;  5A33 B;  3V0B A;  1W8Z A;  1Z7S 2;  4FOY A;  1X33 A;  5JOY A;  1AVB A;  3WOG A;  5LK7 B;  1W90 A;  1MR5 A;  5FYT A;  3KVB A;  1DHK B;  3A21 A;  3AL6 A;  2DU1 A;  2QVS B;  4GKY A;  1HRV 3;  1O91 A;  4AVV A;  1AR6 2;  5LWB A;  4PQ9 A;  3VHN A;  1IG3 A;  2X53 S;  4QPY A;  5K0U B;  2YY1 A;  1GZC A;  3A0N A;  1RUD 1;  1UZW A;  4C1W A;  4I2O A;  3ES1 A;  4N8M A;  2YRO A;  2E32 A;  1YQC A;  3S30 A;  1RVF 1;  1AR7 1;  3MW3 A;  4P02 B;  5F5I A;  3TN9 2;  2WQ8 A;  1R1A 2;  1ZRE A;  3C7F A;  4LR4 A;  3AYC A;  2QZ3 A;  2DCY A;  1QH7 A;  4YNI A;  1NLQ A;  1VBC 3;  2P5B A;  4W65 A;  3SH4 A;  3Q9O A;  1UCX A;  4GD4 A;  1ND3 C;  3ZYF A;  3VDA A;  1N1Y A;  1O3S A;  1SZB A;  1YXW A;  3I54 A;  5C3P A;  2VUJ A;  4FBF A;  4UYB A;  1CWP A;  2D93 A;  4XAB A;  4ARX A;  2P3I A;  3AVR A;  4Q4Y 3;  1TME 3;  2JG9 C;  5FKB A;  3TEY A;  2BFU L;  5AVA A;  1BEV 3;  3J9S A;  3HNY M;  5EFU A;  1KS4 A;  4XBN A;  4JX0 A;  2CGP A;  4KU8 A;  1DQ5 A;  3OD0 A;  1AX2 A;  5DZG A;  4BB3 A;  4BJ0 A;  1AR9 1;  3DGT A;  2I45 A;  1MZF A;  3BTY A;  3FLP A;  2BQP A;  1UMI A;  3ZPY A;  1I5Z A;  2XH6 A;  5HCB A;  5CKQ A;  1ND3 A;  2ILM A;  3ZXK A;  2JDN A;  3MPB A;  3TEZ A;  2PAK A;  4L97 A;  4MX3 A;  2I2S A;  1CZT A;  3J7N A;  4XEZ A;  2YFU A;  1JYX A;  4Z8B A;  1AR7 2;  2QNK A;  3N7J A;  4P14 A;  1HRI 2;  1I5P A;  3B01 A;  1DQ6 A;  3AKS A;  3W21 A;  1NG0 A;  1A34 A;  5GZC A;  3NV1 A;  5HCH A;  1JH5 A;  5L9B A;  2HWE 2;  1URX A;  2XJU A;  3LA3 A;  3MV0 1;  3MEP A;  1C5H A;  1RUF 3;  2EAA A;  4HKW A;  1AX1 A;  1YIF A;  2XQX A;  4RQP B;  4C0H A;  5A3M A;  1N1T A;  3M4F A;  1SMV A;  1CAU B;  2VZR A;  4AFM A;  5JPM B;  3S7E A;  3WEZ A;  4Q4W 2;  5KHI A;  4TN7 A;  3X29 B;  4CU9 A;  1W8H A;  5F2S A;  1LOE A;  2YMZ A;  3N3H A;  3Q8F A;  2R32 A;  2HWF 3;  2C4X A;  5FY4 A;  3ZYP A;  2C5D A;  2I07 B;  4Q0P A;  5B2G B;  2Q0A A;  2A5Z A;  2HYX A;  5FOB B;  1NKG A;  2A7A A;  2VAU A;  2A3W A;  4GH4 C;  3GZU C;  2OYZ A;  5LCW L;  3Q8E A;  5LW9 A;  3USS A;  3URF A;  1RUE 2;  4AAP A;  4FOV A;  4URT A;  2ZKL A;  4NMI A;  4XE9 A;  5DUX A;  1WWY A;  2R30 A;  3T2Q A;  2I74 A;  2GDF A;  5A3T A;  4CUB A;  3PTY A;  4GWI A;  1Y9M A;  1HB4 A;  1LHO A;  2ZGT A;  2RHP A;  4E2Q A;  1KS5 A;  1W6Q B;  1FI2 A;  2JEC A;  3IDC B;  4QX5 A;  2Y0I A;  4Y20 B;  2OUH A;  3FLT A;  1Y3T A;  1F5J A;  3THD A;  3VBH A;  1OBN A;  4Y1Y A;  1LR5 A;  4UFH A;  3ABZ A;  1J83 A;  3NV4 A;  2FDJ A;  4ISR A;  3U4X A;  3WW3 A;  5F32 A;  2PYT A;  4B1M A;  4CCO A;  4DRV A;  2ERF A;  4ZON A;  4BZ4 A;  4IV3 C;  3E5U A;  4E4S A;  3GZA A;  3K3N A;  4FPC A;  1YQ2 A;  1UU6 A;  3D8C A;  3BOP A;  2HWF 1;  1PO2 1;  3IDB B;  4YZ3 A;  3CF6 E;  2VMF A;  1UO9 A;  1A8M A;  2HEV F;  3THC A;  4N43 B;  4OHZ A;  1WD4 A;  2PHR A;  1F15 A;  4LBQ D;  4RR3 C;  1PMJ X;  1NZI A;  3ZFE C;  4AL9 A;  2LRP A;  2ZGN A;  5C4W B;  1GP4 A;  2AEY A;  2XVL A;  3DCQ A;  3RWK X;  5JMC A;  4QX7 A;  4E4D X;  3UKV A;  3DN7 A;  1U5X A;  5EYY A;  4IE0 A;  1PVC 1;  4EYU A;  2XOM A;  2VCB A;  1O5U A;  4W50 A;  2VVE A;  1QQP 3;  2WBK A;  5EIY B;  3C2U A;  4UF0 A;  5GKA C;  2A3Y A;  4MHR A;  4DO0 A;  1KDK A;  5FY5 A;  2GND A;  3GHN A;  2A6Y A;  1W9S A;  1R08 2;  3CJI A;  3B93 A;  4M00 A;  1UY4 A;  4XCB A;  3OCP A;  4RHV 3;  3ZLI A;  2G9G A;  2ZHK A;  4PDW B;  3RFR A;  3VBS B;  1YFX A;  4RL7 A;  3J8F 1;  1D2Q A;  3DPR C;  5FV3 A;  5FUN A;  3DEC A;  1JZ6 A;  5C8C B;  2W5F A;  3A0K A;  4DMI A;  5AC9 3;  2WC2 A;  5C4W A;  3OTF A;  3WQ1 A;  4U2A A;  3VDD A;  1U5Z A;  2R7E B;  3N7M A;  3AKT A;  2JDH A;  3CDZ B;  1OSG A;  1VIW B;  2JIJ A;  1J1T A;  4XFF A;  3UKT A;  3O1V A;  2WZR 1;  4E2G A;  3OBR A;  1PO1 2;  3N9N A;  2PLV 3;  4K8F A;  4L0P A;  3KGL A;  2GC2 A;  3AKQ A;  2ZAC A;  5LY1 A;  5LBE A;  1DIW A;  2JDM A;  2WO7 A;  3OGG A;  5H9P A;  4YW4 A;  1G6N A;  2J1S A;  3MUZ 1;  1YRZ A;  3DXT A;  3VBH B;  3Q8C A;  2BTV C;  4HL0 A;  4CDU C;  5K7P A;  3BU0 A;  1DFQ A;  3IAP A;  2VCM A;  1RUD 3;  2R16 A;  1AXY A;  1SLT A;  1C5I A;  1STM A;  1UIJ A;  4YVW B;  1J59 A;  1REF A;  1HLC A;  3I59 B;  2PAE A;  1FPN 3;  4J1X A;  4CCK A;  3PUQ A;  3I2J A;  2CAU A;  2FQP A;  3K51 A;  4COY A;  3OD4 A;  4I09 A;  2ZKN A;  5C8C C;  1B35 C;  1C4R A;  2VMH A;  5FMD A;  5FZL A;  3OUI A;  3ZFG A;  3OBZ A;  1J3Q A;  2W1U A;  3PUI A;  2P3K A;  4GA9 A;  4R8H A;  2X5I A;  3E6B A;  3N4M A;  2GNM A;  1OXC A;  2R06 2;  1U12 A;  2VOT A;  1VAM A;  2JDU A;  2EAK A;  4Y22 A;  1RUH 1;  2D6K A;  1DQ0 A;  3ILF A;  4LHN A;  4FOW A;  1JHJ A;  4TLG A;  4KBB A;  3TN9 3;  1R1A 3;  5T55 A;  3DV8 A;  5BNQ A;  1LOF C;  2C26 A;  1JZ5 A;  1RUC 3;  1GNZ A;  3ILN A;  4XMI A;  5D2A A;  5FLI A;  4RS5 B;  4OI2 A;  1ULG A;  3J4U H;  1GKB A;  4LPL A;  5DG1 A;  1MEC 2;  3U14 A;  3QLQ A;  4DXZ A;  3OOX A;  5J98 B;  3VN4 A;  2OT7 A;  5J36 A;  5T5O A;  2WAO A;  1Z0H A;  5F39 A;  1W8N A;  2XJT A;  1OD5 A;  1QWR A;  3L2H A;  5EXO A;  3BN6 A;  5A1L A;  4GXL A;  1H2N A;  3WY6 A;  2FZ2 A;  2OII A;  2Y64 A;  3SKJ E;  3AP9 A;  3SEP A;  2WQ4 A;  1JU4 A;  4GUL A;  2IXC A;  2OS2 A;  2BFU S;  2WFF 3;  4Y3O A;  4Z07 A;  4CCJ A;  1ZX5 A;  4A7K A;  4OI0 A;  2GMM A;  3TWI A;  1UN1 A;  2V72 A;  2PLV 1;  2ZX4 A;  2CNA A;  4IEZ A;  2ZAH A;  3ZFF C;  3LEG A;  2KR2 A;  3POJ A;  1NCR B;  1UZ0 A;  2E26 A;  5FR3 A;  4DXR A;  1H6X A;  3LDB A;  1IS3 A;  5L7O C;  1UOB A;  4QQP A;  1HXS 1;  1Y43 B;  2UWB A;  1RMU 3;  5FZ3 A;  4COV A;  2ZZJ A;  3RQ0 A;  1IZ3 A;  4IER A;  2JEN A;  4BHP A;  1VB4 A;  2DWR A;  4QKD A;  5A3U A;  3NAP A;  2IXH A;  3LDR A;  2HWB 1;  2O14 A;  1V6K A;  4GJY A;  1O59 A;  1RUF 2;  5T5L A;  5J48 A;  1CES A;  2XKP A;  5C5U A;  1C1L A;  3T2T A;  2DDU A;  2DYC A;  4UFL A;  5DDJ 2;  2D6N A;  5JI9 A;  3CBN A;  4AGR A;  5FJH A;  2GC3 A;  4CEY B;  2H6C A;  1L3J A;  2OPW A;  4H55 A;  1RMU 2;  4FSJ A;  2RDS A;  4HK8 A;  4MLO A;  3WVJ A;  1BMV 1;  1UXZ A;  1W8T A;  2OPK A;  3MDP A;  4LK7 A;  4MHU A;  4Q0V A;  2AUY A;  2YBP A;  4BQ2 A;  1JYI A;  2XLA A;  1ULD A;  4A44 A;  3OUH A;  4NHM A;  5A3N A;  2Z69 A;  2D97 A;  2FDF A;  3EMR A;  1HJG A;  1YQ5 A;  3ZN5 A;  5DDJ 3;  5J96 B;  2RS5 2;  4NUB A;  4YM1 A;  2WO3 A;  1HXS 2;  2VPV A;  1UOG A;  2Y33 A;  3UK9 A;  4DEV A;  4LA2 A;  1GQG A;  4AFA A;  1D4V B;  2QQO A;  1O3T A;  3W5M A;  4H3W A;  1A8D A;  1XJA A;  2BZD A;  3MIH A;  4Y5Z 0;  4XF4 A;  4QMA A;  2JD9 A;  1PO2 3;  1WCK A;  3K4D A;  4FPE A;  1IKP A;  1XND A;  2VOX A;  4RD7 A;  4KU7 A;  2HBU A;  2HWB 3;  3NJZ A;  3WF2 A;  1HKD A;  1HRI 1;  3AKR A;  5A3P A;  3NO8 A;  2W1W A;  1YI9 A;  5F6L B;  1GNH A;  4L2N A;  5DAP A;  1TMF 1;  3IT8 A;  3P3P A;  1OPO A;  1SFN A;  4D94 A;  3SKV A;  3NRU A;  2MEV 3;  1VBA 2;  4HN0 A;  4WM7 A;  4MGS A;  1OLR A;  1UMZ A;  4WM8 A;  5E8A A;  4OHV A;  2ZMN A;  5T5P A;  4RGG A;  1DQ4 A;  3MIG A;  1OQ1 A;  2OQ6 A;  3FWE A;  5FK8 A;  3TAY A;  3OGR A;  4NHX A;  1FNZ A;  4Y5T A;  1GP6 A;  2HWB 2;  5GLT A;  2HWC 3;  3N9O A;  3LAG A;  1PM4 A;  2YC0 A;  4CE8 A;  1SEF A;  3BOD A;  4ZS3 A;  4TLF A;  2JIC A;  3AKP A;  1CPM A;  3GBG A;  4BIF A;  2WSV A;  3AZY A;  3J8F 3;  4P9Y A;  4LO7 A;  3NAP B;  4CTE A;  1AYN 1;  4YVW A;  4CCL A;  2JEM A;  1X36 A;  1LU2 A;  1YQ6 A;  3VLB B;  3MZH A;  5C6C A;  3VDB A;  3LOI A;  3AFG A;  2D3P A;  4XMA A;  1VRH 2;  4XJZ A;  2Q8D A;  2K0G A;  3Q8B A;  5ABJ B;  4RHV 2;  1XQN A;  3ZFG B;  5C9A C;  1JTZ X;  1KJR A;  3RZJ A;  2R07 2;  3AXD A;  3B69 A;  5F2W A;  3RI9 A;  3VBR B;  4AI1 A;  4R4X A;  4IE4 A;  2HWD 2;  5C3R A;  3N36 A;  4LHL A;  4YW5 A;  1ENR A;  2PQQ A;  3WDT A;  4EWA A;  5IVC A;  1U5I A;  3BIE A;  2BUK A;  1YLL A;  4AI3 A;  1ZNP A;  4FPK A;  4Z1V A;  3T0D A;  1R1Z A;  1HB3 A;  1ODM A;  2DFB A;  4JHZ A;  4IE7 A;  1B09 A;  1FOD 3;  4YVS B;  2B9U A;  4MXV A;  2UU8 A;  2DVB A;  2A70 A;  2QDR A;  2HEY F;  1HQW A;  2LAL A;  1S0J A;  1VBD 3;  3PL0 A;  4A6O A;  4SLI A;  1PZ9 A;  4JCK A;  1FPN 1;  3TYJ A;  3JD7 3;  3CQO A;  5I93 A;  5JIU A;  1XRU A;  5CU1 A;  1GZW A;  1JN2 P;  1PGW 1;  1YYN A;  2YUE A;  3THP A;  1ZVF A;  2QUO A;  3EJK A;  1BK1 A;  3LA7 A;  1AYM 1;  3CJI C;  1VAL A;  1CZV A;  1COV 3;  1W8W A;  1IPJ A;  4EN8 B;  5FPA A;  1UZV A;  4B1L A;  4Y22 B;  2CV6 A;  4Y4R A;  1WCU A;  3AP6 A;  1FPN 2;  4M4P A;  4YLZ A;  2LS6 A;  1VBC 1;  3JD7 2;  4YZ4 A;  2FBE A;  2MHF A;  5FY7 A;  4EN9 B;  3K48 A;  2VR4 A;  2ZPX A;  1DQ1 A;  2XGX A;  2VZ1 A;  4FPL A;  4Y33 A;  4NIG A;  1LHV A;  1UKG A;  1O3R A;  4V2W A;  1MZ6 A;  1RIN A;  4IXL A;  3KF5 A;  1AR8 2;  3NKG A;  1NXM A;  2D6L X;  4FTS A;  4QB6 A;  3ZYI B;  3J7L A;  2Q5T A;  4GB3 3;  2DBI A;  3MYX A;  1US3 A;  1DBN A;  4MSV A;  1GFF 2;  2XML A;  1UQX A;  2YU2 A;  5FYS A;  3LGR A;  3OPT A;  1W6M B;  4Q4V 2;  1DLL A;  3QH6 A;  4MUV A;  2RJK A;  3WUC A;  3ZN6 B;  2ARA A;  2DCJ A;  3FBY A;  1WA4 A;  2YGL A;  1W2U A;  3MIE A;  1YIP A;  1FT9 A;  2AGS A;  2J7M A;  4IV3 B;  4NID A;  4DZG A;  2RJ2 A;  1XYP A;  3JBG 2;  2VM9 A;  2VNV A;  3NNL A;  1QY4 A;  1WW7 A;  3AL5 A;  4LUM A;  3RMX A;  1V9U 2;  1HDK A;  2A71 A;  1LB2 A;  1LNS A;  1GBG A;  2AR6 A;  1W6N B;  2QQV A;  1SG3 A;  2DVG A;  2Q1Z B;  5H9Q A;  4HSL A;  3MGU A;  5IT6 A;  5CFD A;  2BOJ A;  2LW8 A;  3POW A;  2D44 A;  1OKO A;  5C8W A;  2DTW A;  3MUY 1;  5CFC A;  3RZL A;  1OVP A;  5T3N A;  1ULE A;  3UYJ A;  1UNB A;  1YI7 A;  3OG2 A;  5ANQ A;  3WDX A;  3AX4 A;  5F7U A;  2UWA A;  1H30 A;  5IWF A;  5IAX A;  3T3Y A;  2YPD A;  1G9B A;  4KWU A;  1GQH A;  4HN1 A;  2ZGM A;  4PLO A;  4E27 A;  1F8V A;  4XJW A;  4QKN A;  3WW2 A;  4FAH A;  5CEH A;  2RS1 2;  4GKX A;  4GB3 1;  1R64 A;  2WT2 A;  2DUP A;  5EV7 A;  4KL1 A;  3CLP A;  3PTR B;  3PU8 A;  1J1L A;  3JBG 1;  3PVN A;  2QBX A;  1H8V A;  2DBN A;  2HLE A;  2W92 A;  4N9I A;  3HQR A;  3POE A;  3WNP A;  2W94 A;  1HX6 A;  2WR9 A;  3HN1 A;  5JDB A;  3K75 B;  3P6B A;  3NNG A;  4ISQ A;  4V2V A;  3OEB A;  4BXS V;  2AEZ A;  4E4H A;  4BME A;  2RS1 3;  3INA A;  2P37 A;  5JSR A;  3NKT A;  3LKJ A;  1LGC A;  1NCR A;  4TSV A;  1W6O A;  3KWV A;  2OW4 A;  4JGZ C;  4I02 A;  1QDC A;  2KD7 A;  1IOA A;  2V09 A;  4XW3 A;  2VUD A;  3MO4 A;  1C28 A;  2GAU A;  5FP4 A;  3RZH A;  5FYY A;  4FQ4 A;  2QQI A;  1AL2 2;  4MGY E;  4W8J A;  2P3Y A;  4K21 A;  2P17 A;  4D7S A;  1NA1 A;  1SLA A;  2RG4 A;  1A78 A;  1LRH A;  4KWK A;  3O1R A;  1ND2 C;  1VBD 1;  3U75 A;  4RGK A;  2XQR A;  1JZ2 A;  4XDQ A;  3OBA A;  5F3E A;  2WII B;  1H2M A;  4BQ1 A;  3PJQ A;  4CVU A;  5BPX A;  4ASM B;  3GZE A;  4YRD A;  3M2M A;  4OI4 A;  4CP2 A;  3KHC A;  1BK0 A;  2V4V A;  3APB A;  3FHA A;  5A6Y A;  5JXJ A;  4IV1 C;  2Q30 A;  5T5J A;  1T2X A;  1PHM A;  4HSJ A;  4FVV A;  4HT1 T;  4MGI E;  1IS5 A;  2TEP A;  3NJX A;  5DZF A;  3T1L A;  4LBM A;  4YPJ A;  3LF7 A;  3BPS A;  3JUU A;  5FLJ A;  1O3Q A;  1XU2 A;  1DF0 A;  1PIV 3;  5F3G A;  5FZ4 A;  1HN1 A;  3OUJ A;  5JOX A;  2D7F A;  5FRA A;  5A7N A;  4PIY A;  1LHU A;  5F8P A;  2WNV C;  4GIQ A;  4IEO A;  3NV3 A;  5B4N A;  3CZU A;  5LA2 A;  4QWN A;  3VDD C;  4DEQ A;  5C5T A;  2HWE 1;  4K40 A;  2Q8E A;  3LFM A;  3ZSM A;  1MQT C;  3K3O A;  4KH9 A;  1MVQ A;  1X50 A;  4SBV A;  3IAQ A;  2VZU A;  1CAV A;  3PLQ A;  4QXK A;  3T0B A;  4P9W A;  2WAB A;  5DAQ A;  3DPR A;  3HMY A;  5I0U A;  3NW4 A;  3I59 A;  1C3H A;  5FYU A;  2VVD A;  2E7A A;  3WD5 A;  3OYW B;  1QNW A;  4CCN A;  4L11 A;  3BPZ A;  4LO4 B;  1GLH A;  2PMW B;  5L36 A;  3E6D A;  4D0Q A;  5DXD A;  3AMM A;  4YVS C;  5FZE A;  4QDS A;  3ZFE B;  3B5L B;  1VRH 3;  4WM7 B;  3RJ2 X;  2VZT A;  4TYS A;  4CXY A;  1BBT 1;  5ABJ C;  1VJ2 A;  1UX7 A;  2VU9 A;  2ZGP A;  1SLL A;  4YW1 A;  1Q5O A;  1H4H A;  3KM5 A;  4WZF A;  3ELN A;  4CP9 B;  3ZSE A;  2HWD 3;  3ZR6 A;  1RVF 3;  3H1W A;  4XF1 A;  2WNE A;  5FY8 A;  1QXJ A;  1ZBE 2;  2ATF A;  3SIT A;  4BQ5 A;  5IFT A;  3I2D A;  4H7M A;  5GLU A;  3O1P A;  1AL0 G;  2IFR A;  3KF3 A;  3BGA A;  1HW5 A;  3VZK A;  2ZHL A;  1CX4 A;  1PVX A;  3ES4 A;  1ST8 A;  3I8T A;  5EJ1 B;  4PDW C;  5B4X A;  3VD4 A;  2C0Z A;  3NVC A;  4RSU A;  2WN2 A;  3GZT B;  3VBO A;  4AGG A;  4Q27 A;  3TNP B;  1VBD 2;  1SHW B;  2ZEX A;  1PVC 3;  4BMB A;  2BER A;  1RVF 2;  2BP6 A;  4FXG B;  1WW4 A;  1WW6 A;  4UAP A;  2WQZ C;  4HVO A;  5E1R A;  1DGW A;  1QQP 1;  4WZC A;  4P08 A;  4BYY A;  3SH5 A;  3EBR A;  2XXZ A;  1ZZ9 A;  2WWU A;  4DFS A;  5F9T A;  1NYW A;  1G86 A;  4IND A;  4EV0 A;  3NMB A;  4UF0 B;  4FOQ A;  3KSC A;  2Y0O A;  2RMU 3;  2VG9 A;  3VL9 A;  1COV 2;  2BW8 A;  2WYS A;  4Q0Q A;  1M06 G;  3GAL A;  3PME A;  1JUI A;  1T6G C;  4Q8L A;  5FCC A;  3VHO A;  2QTW B;  3N9P A;  4PHZ A;  4FCA A;  1Y7B A;  1YFY A;  3ZN6 A;  2C6S A;  1MQT A;  2WZR 2;  3BUC A;  4IEW A;  2BNN A;  2RM2 1;  2QQP A;  4QXH A;  2K2S A;  5FIX A;  4D69 A;  2VTX A;  4DS0 A;  4M01 A;  4XCA A;  2ZAB A;  3S6P A;  4CPB A;  4ES9 A;  1FV2 A;  3JQX A;  1BEV 1;  1LHW A;  4UXA A;  5GZD A;  4RGA A;  5LA1 A;  4ATF A;  2XJS A;  4X6R B;  3VBF A;  4GB3 2;  1NCQ B;  5IYY A;  1NE4 A;  5D8A B;  3AYA A;  1CZS A;  3MID A;  4A45 A;  3A7Q A;  2K46 A;  3ZXL A;  2KXL A;  4JC1 A;  1LOC A;  3MPP G;  1GYK A;  1RUG 2;  3WUD A;  4CSW A;  1JZ8 A;  2RS3 2;  1IS6 A;  4GMP 3;  2VMD A;  2QKD A;  4B3N A;  5A3L A;  4AWD A;  4WBB A;  5A6Z A;  2CDO A;  4RN5 A;  4I0B A;  1AYM 3;  4MZU A;  1F4A A;  2VQT A;  3LB9 A;  3LEM A;  3Q8A A;  4QQL A;  4DY5 A;  1HV1 A;  2B9V A;  4O7X A;  4QT6 A;  2JJ6 A;  2OXB A;  4DOU A;  1QJY 2;  4GH4 B;  5CIS A;  4CA9 A;  1ZRR A;  1FMD 3;  2YFZ A;  4FFG A;  2DCZ A;  2X29 A;  2RR1 2;  2Q8C A;  4XFB A;  3QBQ A;  1K5M A;  4XTP A;  5HXV A;  3ZKU A;  1X7N A;  4JGZ A;  4Q1R A;  3ZXE A;  2F17 A;  1YNA A;  4WV8 A;  5H9S A;  1X82 A;  4N43 C;  5GZF A;  2FDI A;  3O1O A;  4NJ4 A;  4WM8 C;  5LBB A;  1C8M 3;  5FQ0 A;  2R0F A;  4UT5 A;  5FYV A;  5A32 A;  4UFI A;  1RHI 1;  2RR1 3;  1AR8 1;  3C8X A;  4GMP 0;  1V70 A;  2RJL A;  5FLH A;  4BLI A;  5J3U A;  4ONU A;  1GOH A;  3FUQ A;  3JB8 A;  1JZ7 A;  5CZK A;  2HBT A;  1QXP A;  4OHW A;  3ZFF B;  2WO2 A;  3KCX A;  3POY A;  3CJX A;  1QMJ A;  1K12 A;  1GNY A;  1QJU 2;  1NLR A;  1GZT A;  4KGQ A;  5FZH A;  1AR9 3;  1MPX A;  3VUO A;  1C8M 2;  2J1T A;  5IVY A;  3THT A;  2RV9 A;  1ULP A;  4PLM A;  3LOB A;  1BLZ A;  3C7E A;  2EIG A;  1X8E A;  1XNT A;  4JGZ B;  4HOO A;  4G9S B;  4J6G A;  2Z79 A;  3WF0 A;  2BNO A;  1RUE 1;  3TEW A;  3AMN A;  4LOS A;  5KWR A;  1HB2 A;  3KS7 A;  3TNQ A;  2O1Q A;  4S2F A;  3VBR A;  3MHZ A;  4LBQ A;  1Q8V A;  2IFW A;  3HAG A;  4DUX A;  2EVX A;  3ZXJ A;  1ZZ8 A;  4LUL A;  4PIZ A;  4P9G A;  3M3O A;  5D21 A;  2TNF A;  5A32 B;  4EN7 B;  5HPO A;  4QQH A;  1OLQ A;  3WZ1 A;  4BCU A;  1LUL A;  2E31 A;  4WM8 B;  1L7Q A;  3VGI A;  2EA7 A;  1S4C A;  4LHS A;  3POS A;  1PNF A;  2BWC A;  3I2F A;  1AXK A;  1WA6 X;  4IEY A;  4BQ4 A;  4E9K A;  1S1A A;  4XTM A;  5CIR A;  2A6Z A;  3VBS C;  3BKZ A;  2FDK A;  2Y6K A;  2WLQ A;  4BM8 A;  4CDX A;  3HNM A;  2J1V A;  4LIV A;  1W2N A;  5KXE A;  1QXR A;  4Y26 A;  4Z82 A;  4ASL A;  2VW1 A;  2W1S A;  1DGR A;  3MV1 1;  2EAL A;  3KZ4 C;  1UAI A;  5C9A A;  2JWP A;  2NMN A;  3H50 A;  2ZEY A;  4PJY A;  5JXI A;  2GH2 A;  3LFI A;  5DG2 A;  1W9T A;  4XUR A;  3H42 B;  4LKD A;  1CJP A;  5FYC A;  3RZZ A;  3AMP A;  4HET A;  1GAN A;  1LTE A;  3AZW A;  4LK6 A;  2BBV A;  3LDK A;  4J1W A;  3VHR A;  3NJY A;  4NN0 A;  5FBZ A;  4I01 A;  3ZPO A;  2DUQ A;  2G19 A;  4XPV A;  4ET7 A;  3R6S A;  2VNG A;  1QJU 1;  5BNN A;  4ITC A;  5JR7 B;  1TNF A;  2O8O A;  4XUN A;  4CCD A;  2DVD A;  4Y20 A;  2VZV A;  3HWJ A;  2YXS A;  3GJA A;  3S7I A;  1VPH A;  3SHR A;  1P8J A;  1FV3 A;  1PZ8 A;  2Y34 A;  1ZRI A;  2ET1 A;  3AZZ A;  5JLV A;  1DYP A;  4PT6 A;  4R52 A;  4WM7 C;  4YGE A;  4CCC A;  5C33 A;  3WNO A;  3O1U A;  1WBL A;  3PUR A;  4HAN A;  4CP9 A;  2B42 B;  2CSG A;  3VBU C;  3WDW A;  2BYV E;  5FZD A;  4FPY A;  3VBU A;  3UNP A;  3QH7 A;  2XLG A;  3CKH A;  1O8S A;  1G8W A;  4CYD A;  3E5X A;  4HZF A;  2P1B A;  2R6Q A;  4ZPI A;  1TME 1;  4EE2 A;  1T6B X;  1VLN A;  3H1M A;  3RVH A;  4DIQ A;  2DV9 A;  4QPG A;  4YG6 A;  5T54 A;  4XFG A;  1F2N A;  2L9L A;  5FY9 A;  1C1F A;  2WNU A;  3OYW A;  4Q4V 1;  4OUE A;  4LBQ B;  4LLF A;  2GNT A;  5E89 A;  1JXN A;  4Y24 A;  1RUJ 3;  1TVG A;  2FZ1 A;  1CAU A;  2JDA A;  1WW5 A;  1EV1 3;  4QHO A;  3FN9 A;  2OZ6 A;  4J25 A;  3RMY A;  1YC6 1;  2WS9 3;  1KEX A;  2FCU A;  3AM2 A;  3R0R A;  2AAC A;  3I2H A;  5C3O A;  1MS0 A;  5L7O A;  1JOD A;  3J26 N;  4N9H A;  4O9G A;  5JZG C;  1EAH 1;  4JAA A;  2RMU 2;  2OX0 A;  5LB6 A;  2Q1F A;  1RUJ 2;  3LWC A;  5IVE A;  2VZQ A;  1W04 A;  1XNK A;  2WSU A;  2UYB A;  3QD6 A;  3SMH A;  4MGT A;  4A41 A;  5K0U C;  1EV1 2;  2R1B A;  4QPI B;  1OQD A;  5EZW A;  4QPI A;  5HCA A;  4EWE A;  4QKF A;  3R4D B;  3W20 A;  5FPZ A;  1EYB A;  1AF9 A;  5FZC A;  2XVK A;  1W8U A;  1RUF 1;  4DRR A;  5FPX A;  4UFJ A;  1ZZ6 A;  5FZG A;  1C8M 1;  2X8K A;  2F6B A;  3KMH A;  3WF1 A;  4XET A;  1OOP A;  5T52 A;  3WQ0 A;  3MF6 A;  5FZO B;  2WDB A;  2VH9 A;  4HPK A;  4W6X A;  1RXF A;  3ZYG A;  1TNR A;  5CKM A;  4A6S A;  5LY2 A;  2UY9 A;  2H0V A;  5EJZ B;  5J09 A;  3E6C C;  4CUA A;  1KIT A;  3UKN A;  4HFS A;  1S55 A;  3HOB A;  1EPW A;  3K4A A;  5L7O B;  3WP6 A;  4B4Q A;  4UFK A;  2IVI B;  3I2G A;  2JB4 A;  4QGL A;  2JG9 B;  4AG4 A;  2D3S A;  2PA7 A;  3ZOI A;  3OPW A;  2FCV A;  2CY6 A;  4LNV A;  2BEO A;  4G4F A;  2ZX1 A;  1MS1 A;  2E7T A;  5G05 L;  3RZM A;  2Y6H A;  2NPI A;  1CAW B;  5E16 A;  1O5L A;  5L19 A;  1NLS A;  1NUK A;  4NII A;  5FZ7 A;  4OMC A;  1IPS A;  2DCK A;  2IC1 A;  1Q56 A;  1MEC 1;  4JTN A;  5CAD A;  1QJY 1;  4Q2F A;  5DUU A;  4XVH A;  1XU1 A;  1SLI A;  4E2S A;  1TG7 A;  3III A;  4Y1Z A;  4N53 C;  1S0F A;  1I6X A;  1ASJ 1;  1S0C A;  2ZHN A;  4XF0 A;  1RUH 2;  1SBE A;  1Y9G A;  4JKM A;  4Q0U A;  4OUS A;  4LOT A;  1X9T A;  1XB9 A;  3C7H A;  5FK7 A;  4ERO A;  5AFB A;  1LKN A;  2Q4S A;  4QHZ A;  4V1P A;  3D0S A;  4QPI C;  4AK3 A;  4ZZ5 A;  3ZSK A;  3H3Z A;  5KXB A;  2DUR A;  1I9R A;  2VBP A;  3ZDV A;  4CDW B;  4CP0 A;  1VBA 1;  2VL4 A;  4YG0 A;  1DQ2 A;  2VME A;  2A6X A;  4XQD A;  1XNA A;  2JDP A;  3DKQ A;  3CU7 A;  5FZA A;  3VBH C;  3VL8 A;  3WNL A;  5AFE A;  3AJZ A;  4K6B A;  2FMD A;  3T1M A;  1EAH 2;  1L7R A;  1OQE A;  5IHR A;  4Q26 A;  1APN A;  3ZDS A;  1QHD A;  1RUH 3;  2YB7 A;  5A33 A;  3AP7 A;  1CAX B;  3WR0 A;  4A3Z A;  1HB1 A;  1OMI A;  3MBW A;  3RI8 A;  2Y38 A;  1TQ5 A;  4FPJ A;  1YO8 A;  3RDI A;  3VBR C;  5IK5 A;  1JOB A;  4JKK A;  5CFC B;  2QE3 A;  1JI6 A;  4G3Y C;  2PHL A;  1PZ7 A;  3VZO A;  3LIH A;  2D6M A;  5HV0 A;  3SQO A;  4C1X A;  5JXH A;  4GQ7 A;  5FBJ A;  3KB5 A;  4QM8 A;  3H8O A;  4NAO A;  1Z7S 1;  5FOJ B;  1O7F A;  4D6R A;  3ZN4 A;  1UY2 A;  2CGN A;  5JXG A;  4Q4X 3;  3WDU A;  2Z2S B;  3FJS A;  2HWC 1;  3SCG A;  2XWJ B;  2WA4 A;  4IE6 A;  4MV2 A;  1XOY A;  4OZX A;  1GV9 A;  1PK6 B;  3SCH A;  3WHU A;  3ZFE A;  1GIC A;  3W58 A;  4QD2 A;  3WLU A;  5FZI A;  1S2K A;  4LBL A;  4NWW A;  3EXU A;  2UYA A;  2V73 A;  4K3U A;  1OA4 A;  1NA1 C;  1NCQ C;  4P9J A;  2PN5 A;  5JVV A;  2ZOE B;  1LEM A;  4NIH A;  2QQM A;  5D8A C;  4BWO A;  1UU4 A;  5FZM A;  4BOW A;  3VD5 A;  5HCF A;  1VBB 3;  2XL9 A;  1WMD A;  3AVS A;  2AZ5 A;  3KV4 A;  4GWJ A;  4H7L A;  4XZP A;  5EHD A;  4AVT A;  3B9C A;  1GR3 A;  5BNP B;  2WT0 A;  2PHW A;  2YV8 A;  2FDH A;  2XBO 2;  5JWP A;  3LEK A;  3MLK A;  1QOT A;  4JTO A;  4FQZ A;  3TB0 A;  3H1Y A;  2Q1M A;  4Q0S A;  2QQK A;  1OUS A;  3IPV A;  3U37 A;  4HMZ A;  4R9C A;  4IEP A;  4QB2 A;  4Q8K A;  1WLD A;  3GGL A;  1F5F A;  2VTF A;  3GM8 A;  1WLC A;  3IZO A;  1RUI 2;  2QQL A;  1BYH A;  4JRL A;  1VBB 2;  2NLR A;  3GYD A;  3A4U A;  5CNA A;  1LOA A;  1ND3 B;  3N7K A;  4IUG A;  4EWD A;  2RR1 1;  3CL1 A;  1V6J A;  4IET A;  4QHB A;  1EPZ A;  3POB A;  4MG2 A;  4LXL A;  1YFW A;  2JDZ A;  3UGH A;  2VD7 A;  2X10 A;  5ABJ A;  1LEN A;  4CDQ C;  3AJY A;  4Q29 A;  4X8P A;  5GZE A;  5BNO B;  4D7T A;  1UU5 A;  4XDP A;  4YVS A;  4C90 A;  4FPF A;  3WP5 A;  1NZC A;  3V65 A;  4LIT A;  1SCS A;  3RGB A;  1ODN A;  1SLC A;  4I0A A;  2OKX A;  3FBM A;  3HR9 A;  5DMY A;  1VBC 2;  3PVO A;  4IGO A;  4Y4Y A;  3AC0 A;  2VCC A;  2PTM A;  4JHT A;  5IW0 A;  1H9P A;  1XC6 A;  1MAC A;  5FXV A;  3DL3 A;  3H7Y A;  3OY8 A;  3BTZ A;  3S5A A;  4AQ2 A;  2B8M A;  2D43 A;  4AED B;  4AFC A;  1A6C A;  3DYO A;  4LBO A;  4GH4 A;  2WS9 2;  3T09 A;  1BEV 2;  2VE1 A;  3MIF A;  4Q4Y 1;  5LRR A;  1HRV 2;  4PBP A;  2X09 A;  5KHJ A;  2VW0 A;  1W99 A;  1K5J A;  4XZU G;  3ZXD A;  1MEC 3;  2IXI A;  1DYO A;  1QOO A;  2D98 A;  4K20 A;  4CEW C;  5FZ0 A;  4IV1 A;  2ZGK A;  2A73 B;  2PHF A;  4CDQ B;  4RYD A;  5BXX A;  3BB6 A;  3M7A A;  1OA3 A;  2NYY A;  2VOK A;  3VD3 A;  2Z42 A;  4R4Z A;  3ZXA C;  1HRI 3;  3V0B B;  1E57 A;  2YBK A;  4FO9 A;  3S57 A;  1D0G A;  4ZU7 A;  2HWE 3;  1PGS A;  2OQ7 A;  3ZMN A;  4AQ6 A;  3JD7 1;  1V00 A;  5KBF A;  1G9F A;  3UGF A;  2ZTN A;  4RHV 1;  1EP0 A;  1H1I A;  1NY7 1;  1XNB A;  1NX9 A;  4IEV A;  4MET A;  4PBO A;  3SC7 X;  3PJY A;  2ZEZ A;  4Q4Y 2;  4FP2 A;  4XBL A;  3ZM8 A;  2JG8 C;  5FO9 B;  2Y6J A;  1ND2 B;  5IVB A;  5JOW A;  4ZU4 A;  1W0P A;  3I7D A;  1W03 A;  3IM0 A;  1W3V A;  1N3P A;  4AVB A;  3FHQ A;  3DKW A;  1KGY A;  2YYO A;  2XHK A;  3WF3 A;  2TUN A;  1JW6 A;  2N7G A;  3RNS A;  4BXF A;  1WBF A;  2RDQ A;  5G04 L;  4YZ1 A;  5FUP A;  3BTX A;  3KV5 A;  4OVE A;  4JVA A;  2BGO A;  4CEW A;  1JZ3 A;  4CEW B;  5KHG A;  5C7G A;  1UIK A;  4YW6 A;  5FYI A;  1KXG A;  4NRM A;  4AHX A;  2Z5W A;  4ATE A;  3VKO A;  3TOJ A;  2WNV A;  2WO1 A;  4ORF A;  5JCT A;  2NM1 A;  1J3R A;  1G7Y A;  4P9I A;  4D3W A;  1U5Y A;  1DGW X;  1XXN A;  2B4K A;  2JDK A;  2PHX A;  5FZB A;  2X05 A;  1PX3 A;  2XJV A;  2P34 A;  3KQ4 B;  4AVA A;  5IVF A;  2P6H A;  4AED A;  3OY8 B;  1H8T C;  2G1M A;  1E5H A;  3BOW A;  5GAL A;  4XFH A;  1HXS 3;  3OPZ A;  3DPR B;  4LMF A;  4YZ5 A;  1ZRD A;  1VMJ A;  3UET A;  4UW3 A;  4QM9 A;  4XFI A;  2XB6 C;  3RYR A;  4PIX A;  1SPP A;  1VRH 1;  4QXC A;  1HQL A;  3HVD A;  2V5Y A;  3JCI A;  3LEI A;  5EPA A;  1QDO A;  3R4U A;  4E4Z A;  5C70 A;  2VOW A;  3NST A;  1BJQ A;  1PMI A;  3T08 A;  3WW4 A;  1CVN A;  5JUV A;  4FT8 A;  5IK7 A;  2TBV A;  2CTV A;  4FPO B;  1YCI A;  2DVF A;  2VZS A;  4JDN A;  3FC0 A;  5IVV A;  1RUE 3;  3M3I A;  1OF3 A;  4XXP A;  1W39 A;  4TTG A;  4CDQ A;  4TZD A;  4EZH A;  4LT5 A;  3DF0 A;  1JYT A;  2IXK A;  3WSO A;  5FZ6 A;  4L8Q A;  4XJA A;  2XPJ A;  4YM3 A;  3N35 A;  2ZJC A;  4AR2 A;  2RM2 3;  3VBO C;  4YZ2 A;  3AFK A;  1ZBA 1;  2W9X A;  3C3V A;  1OI6 A;  4CCM A;  1SBD A;  2XG3 A;  5CVR A;  4AQS A;  5CAZ A; 
#chains in the Genus database with same CATH homology
 4P00 B;  3WF4 A;  2VMF A;  3THC A;  5LA1 A;  2VZ3 A;  3WNN A;  1PMJ X;  3OGV A;  2VQU A;  5IYY A;  1CZS A;  1UY3 A;  4A45 A;  3A7Q A;  5J1X A;  1JZ8 A;  3ECQ A;  4ZXE A;  5A1A A;  2XOM A;  2VCB A;  4W50 A;  2VMD A;  2WBK A;  1OF4 A;  5EIY B;  3HN3 A;  2CDO A;  2XON A;  4RN5 A;  4LKS A;  1F4A A;  3IDA A;  1W9S A;  2VQT A;  2B9V A;  2VCA A;  1IQD C;  1K42 A;  1UY4 A;  2YFZ A;  2J1R A;  2WZE A;  3DEC A;  1GU3 A;  1JZ6 A;  2W5F A;  2ZEW A;  3E1F 1;  2R7E B;  3CDZ B;  2J1A A;  3ETP A;  2QQJ A;  4L0P A;  2EIC A;  3C8X A;  1GOH A;  1JZ7 A;  5CZK A;  2J1S A;  1O8P A;  3MUZ 1;  2WO2 A;  1K12 A;  3ACI A;  1GNY A;  3IAP A;  5FUI A;  1US2 A;  1MPX A;  2J1T A;  1WKY A;  2RV9 A;  1ULP A;  3UES A;  3C7E A;  1XNT A;  1K45 A;  1GQP A;  3WF0 A;  3I2J A;  1GOF A;  2VZO A;  4Z2A A;  2VC9 A;  3T2O A;  4OZO A;  1UYZ A;  2W1U A;  4ZY9 A;  3PUI A;  4DUX A;  5HPO A;  2VOT A;  4A4A A;  4CU8 A;  2E31 A;  1JHJ A;  1L7Q A;  1JU3 A;  4LHS A;  1UY1 A;  3I2F A;  2C26 A;  1JZ5 A;  4KMQ A;  1H6Y A;  3HJR A;  2Y6K A;  3HNM A;  4LPL A;  2J1V A;  3HNB M;  3CMG A;  3DYP A;  4DXT A;  2W1S A;  3MV1 1;  1GUI A;  1NAE A;  3I3E A;  2WAO A;  2ZEY A;  5JXI A;  1W8N A;  4CU7 A;  5LA0 A;  1JZ4 A;  5I0D A;  1UY0 A;  3BN6 A;  1W9T A;  2EIE A;  4XUR A;  2Y64 A;  4MAD A;  3SKJ E;  3C7G A;  3SEP A;  1JU4 A;  2CDP A;  4M4R A;  3SEE A;  3LPG A;  2V72 A;  3LEG A;  4ET7 A;  2E26 A;  1UZ0 A;  4DXR A;  1W0N A;  1H6X A;  2ORZ A;  4XUN A;  3K46 A;  1OD3 A;  2VZV A;  1P8J A;  3VD9 A;  4JKL A;  4PT6 A;  4LQR A;  1O59 A;  3WNO A;  2DDU A;  3VD7 A;  3I97 A;  3UNP A;  3CKH A;  1O8S A;  2EID A;  3I2K A;  4P5Y A;  1J84 A;  3GDB A;  3P1I A;  3WQB A;  4CUC A;  4DUV A;  1D7P M;  5C71 A;  1UXZ A;  2Y6G A;  2L9L A;  3ACH A;  4FI9 A;  4OUE A;  4A44 A;  2W95 A;  3DYM A;  5DPN A;  3A22 A;  1TVG A;  2WO3 A;  2JDA A;  3FN9 A;  2QQN A;  4DEV A;  2WUH A;  2QQO A;  2W91 A;  1KEX A;  3W5M A;  1RYY A;  2E33 A;  3I2H A;  2BZD A;  2C9K A;  2JD9 A;  3OEA A;  1GMM A;  3I3D A;  1DLC A;  3K4D A;  3WF2 A;  2W3J A;  2VZQ A;  2W1W A;  3JXS A;  4A41 A;  3T2P A;  2BBA A;  3SKV A;  3NRU A;  4MGS A;  3FL7 A;  4QB1 A;  1K3I A;  1OH4 A;  3NQH A;  3WF1 A;  2VO5 A;  3OGR A;  4CU6 A;  2WDB A;  3LE0 A;  4XUQ A;  5EJZ B;  4CUA A;  4QX2 A;  2W47 A;  2J1U A;  2JE8 A;  3HOB A;  5IFP A;  3K4A A;  3HEI A;  3I2G A;  4AG4 A;  1JYN A;  3ACG A;  2W46 A;  1GOG A;  3VDB A;  2J1E A;  2WZ8 A;  5G05 L;  1SDD B;  2Y6H A;  3IB3 A;  1NUK A;  4OMC A;  4BDV B;  2DCK A;  4HG6 B;  1JYW A;  1UWW A;  3D3A A;  4XVH A;  3OB8 A;  1TG7 A;  3ACF A;  3III A;  3HPN A;  3WNK A;  3T0D A;  4JHZ A;  4AAX A;  1WCQ A;  4A6O A;  4JKM A;  3C7H A;  5DN2 A;  1UMH A;  4A42 A;  3CQO A;  4ZZ5 A;  1UYX A;  4ZZ8 A;  1BHG A;  2VL4 A;  5HXM A;  2VME A;  4DUW A;  3WNL A;  1XNA A;  4MOA A;  3I2I A;  4QDR A;  1CZV A;  2BGP A;  2ID4 A;  4OMD A;  1L7R A;  5IHR A;  2YC2 A;  2YB7 A;  2W87 A;  4M4P A;  4A3Z A;  2LS6 A;  3MBW A;  4QX0 A;  4XUP A;  1UYY A;  4JKK A;  1JI6 A;  2VR4 A;  2VZ1 A;  3I3B A;  5JXH A;  1UXX X;  3C7O A;  4QB6 A;  5JMO A;  2YG0 A;  1W8O A;  1US3 A;  3K4Z A;  4QX1 A;  1UY2 A;  5JXG A;  2RVA A;  2DCJ A;  2J22 A;  2Y6L A;  5IJR A;  4GZ9 A;  3F2Z A;  2J7M A;  4PQQ A;  3VDC A;  4E8C A;  2RJ2 A;  2VM9 A;  3A23 A;  4E8D A;  3W5N A;  2YC4 A;  1LNS A;  1SG3 A;  1EUT A;  3CIH A;  2VZP A;  2QQM A;  2JKX A;  2LW8 A;  1DP0 A;  3VD5 A;  3MUY 1;  4OYU A;  4GWJ A;  4MGQ A;  3OG2 A;  2ORX A;  2VMC A;  2W1Q A;  5F7U A;  3LEK A;  3LPF A;  4KWU A;  5JR2 A;  2QQK A;  4W4Z A;  3U37 A;  3PUH A;  4BK5 A;  1PMH X;  3CZJ A;  4QB2 A;  1R64 A;  3GGL A;  2VTF A;  3GM8 A;  3J7H A;  4XUO A;  1EUU A;  2QQL A;  2QBX A;  2HLE A;  2W92 A;  4QDQ A;  4IUG A;  3EB7 A;  1W9W A;  2EIB A;  4QX3 A;  4TXW A;  3WNP A;  2W94 A;  2X10 A;  4ARY A;  3K75 B;  3P6B A;  3NNG A;  3EYP A;  3OEB A;  4BXS V;  1JYV A;  2WAA A;  3T0A A;  3LQC A;  2OKX A;  3A21 A;  2KD7 A;  4DXS A;  4QPW A;  5DMY A;  2Y8K A;  3AC0 A;  2VCC A;  3MO4 A;  4PF1 A;  2VJX A;  2QQI A;  1XC6 A;  4W8J A;  2PQS A;  2E32 A;  3DYO A;  3OGS A;  1JZ2 A;  3OBA A;  4P02 B;  3T09 A;  2WQ8 A;  3C7F A;  4CVU A;  2X09 A;  1W99 A;  2V4V A;  3FHA A;  5JXJ A;  4XZU G;  3VDA A;  1DYO A;  1T2X A;  1CIY A;  4MO3 M;  4ARX A;  3NJX A;  4YPJ A;  4RYD A;  3GXU A;  3HNY M;  3VD3 A;  1HN1 A;  4JX0 A;  4D8M A;  4BJ0 A;  5B4N A;  3CZU A;  5LA2 A;  4DEQ A;  1UMI A;  1ULO A;  2WN3 A;  3IAQ A;  1NX9 A;  2VZU A;  1PX4 A;  3T0B A;  1XPW A;  2WAB A;  2ZEZ A;  3ZM8 A;  1JYX A;  1CZT A;  2Y6J A;  2YFU A;  1I5P A;  5DQ0 A;  4D0Q A;  3WNM A;  3FHQ A;  4QDS A;  5CYY A;  1KGY A;  4KI5 M;  2V5D A;  3MV0 1;  3WF3 A;  2VZT A;  4UI9 L;  4BK4 A;  1UX7 A;  2XQX A;  5G04 L;  2VZR A;  2BGO A;  1JZ3 A;  3WEZ A;  5C7G A;  4CU9 A;  3NJV A;  2Z4F A;  5IFT A;  2C4X A;  2WO1 A;  3BGA A;  1OT5 A;  2HYX A;  4QAW A;  2B4K A;  2X05 A;  1NKG A;  1PX3 A;  2ZXQ A;  5EJ1 B;  5B4X A;  5LCW L;  3VD4 A;  2WN2 A;  1SHW B;  2ZEX A;  3UET A;  2BER A;  3T2Q A;  4CUB A;  4UAP A;  4GWI A;  4P08 A;  3LEI A;  5C70 A;  3T08 A;  5JUV A;  1CX1 A;  4UOJ A;  3THD A;  2WYS A;  2VZS A;  4TTG A;  1OF3 A;  3ABZ A;  1J83 A;  3WSO A;  3K77 A;  4XUT A;  1F4H A;  1YQ2 A;  2W9X A;  2XHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...