4ZY9A

X-ray crystal structure of selenomethionine-labelled v110m mutant of chitosan-binding module 1 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
HHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGGIDDITFTARTAKYVRMHGTVRGTPYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
molecule keywords Glucanase/chitosanase
total genus 32
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zy9A00
1GQPA 2XOMA 1W99A 2ZEZA 4QDQA 3T0BA 1R64A 1JZ8A 3AC0A 1XNAA 3I2HA 4OMDA 4XUNA 2ORZA 2KD7A 1NX9A 1GU3A 3GM8A 1UY4A 2XHNA 3T0DA 2Y6HA 3C7EA 1UXZA 1T2XA 2J1RA 2QQOA 2VC9A 3ACHA 4XZUG 4D8MA 1HN1A 1DYOA 4A45A 3VDAA 2W1WA 1PX3A 2W1SA 2J7MA 1OF4A 3HEIA 5LA1A 4IUGA 4W8JA 2VZOA 3NJVA 1UYZA 4MO3M 3NQHA 4ARYA 3THDA 3K4AA 3HN3A 2XQXA 3WF2A 5IJRA 2ZXQA 1OD3A 2CDOA 3PUIA 2VZTA 1PMHX 1CZSA 2J1UA 2BGPA 1O59A 4XUOA 2Y6GA 5JUVA 4BK5A 2Y64A 4QX2A 2ZEYA 4JHZA 1PX4A 3SKJE 2VTFA 1TVGA 1SHWB 4JKLA 4D0QA 1KGYA 2VQTA 3OB8A 2C26A 2VMCA 5LA2A 3VDBA 5B4NA 1K12A 2J22A 4ET7A 4GWJA 3THCA 2X05A 4DUWA 2EIDA 1UZ0A 2W87A 2L9LA 4PT6A 1UX7A 2JE8A 4CUBA 3ETPA 2R7EB 5C70A 2DCJA 3K46A 2VZSA 2C4XA 2WAOA 1US3A 2WZEA 2WN2A 3WEZA 2WQ8A 5IHRA 3OBAA 3WNPA 3DECA 3OGSA 2LS6A 2JDAA 2VO5A 2WO2A 4QX3A 3T09A 1JZ7A 4DXTA 1O8PA 1OT5A 2Y6KA 4ZY9A 2PQSA 1JU4A 3LEKA 3ZM8A 3EB7A 4JKKA 1CIYA 2E33A 2VCCA 3HNBM 1H6XA 3DYPA 2W3JA 3I3BA 3T08A 3NRUA 5JXGA 2VZVA 4ZZ8A 4CU6A 5J1XA 4L0PA 4DEVA 1XPWA 2BZDA 2W1QA 1J84A 4BDVB 4BK4A 4RYDA 3I3EA 1XNTA 2HLEA 1W9WA 3A21A 5IFTA 2YB7A 1DP0A 4QPWA 3C7FA 2QQLA 1JU3A 2WUHA 4MADA 4CU7A 3E1F1 2WO3A 3K77A 4E8DA 1L7RA 5C71A 2J1VA 1NUKA 4CU8A 4A3ZA 4YPJA 3C8XA 2W1UA 3FN9A 1UMHA 5F7UA 4QAWA 5IFPA 3I97A 1XC6A 1ULPA 4PF1A 2C9KA 3K75B 3MBWA 4DEQA 2VZQA 2W46A 4UOJA 2HYXA 2Y6JA 3UNPA 4A4AA 1RYYA 2WDBA 4OZOA 4QB6A 3VD7A 1ULOA 1UYXA 4P08A 5LA0A 3UESA 3F2ZA 1CZTA 4QDRA 3VD9A 1GNYA 3IIIA 4QDSA 5DPNA 1F4AA 4JKMA 3JXSA 2WBKA 3WNKA 5IYYA 2W9XA 3T2OA 4ZZ5A 3ACIA 3ECQA 4M4RA 2WN3A 1H6YA 3LEIA 3J7HA 5HPOA 1KEXA 3DYOA 4FI9A 2B4KA 3FHQA 2CDPA 2V5DA 2VMEA 1MPXA 3C7GA 1K45A 2ORXA 3MV11 2J1SA 2V72A 4AAXA 3VD4A 5DMYA 1JZ6A 2V4VA 2VOTA 5JXJA 2VZ1A 3BGAA 1JHJA 1TG7A 5G04L 2RJ2A 3WF1A 4OUEA 3I2KA 4XUTA 3W5MA 4LQRA 1EUTA 3ACGA 1K42A 1WKYA 2QQNA 2W95A 2VR4A 4UAPA 3I2GA 3T2QA 2WAAA 2BERA 2E26A 2Y8KA 2DDUA 3WNOA 1P8JA 1GOFA 4XURA 2BGOA 4PQQA 1UY1A 3HOBA 3MUY1 2J1TA 3EYPA 3FL7A 2VM9A 3WNMA 1W0NA 4A44A 3GXUA 2YC4A 2VQUA 4W4ZA 5EIYB 3WF0A 3D3AA 3P6BA 2QQJA 3MUZ1 1K3IA 1W8NA 4QB2A 2VZPA 3IB3A 3WF4A 2QQMA 4Z2AA 2YFZA 1D7PM 2EICA 1NKGA 2YC2A 1JYWA 4OYUA 4LHSA 5JR2A 3LPGA 4AG4A 3CQOA 1W8OA 2VMDA 1GMMA 4QX1A 1JYVA 1L7QA 1UWWA 3T0AA 1JI6A 3CKHA 2W47A 4E8CA 3LQCA 3OGVA 2X10A 5EJZB 1YQ2A 3IAQA 1WCQA 3VDCA 5EJ1B 4DUVA 1JZ5A 5FUIA 3ACFA 1F4HA 1OH4A 3OGRA 4LPLA 4UI9L 5A1AA 4M4PA 3P1IA 4MGSA 3K4DA 1W9TA 3WNLA 3T2PA 4JX0A 4CUCA 3A7QA 4MGQA 2E31A 4CVUA 5C7GA 4OMCA 4TXWA 3GGLA 4QX0A 5CZKA 3OG2A 3WF3A 2DCKA 4BJ0A 2WABA 2W92A 3FHAA 3CDZB 1UY0A 5CYYA 2EIEA 2QQIA 2BBAA 2QQKA 3ABZA 3HJRA 1O8SA 4KMQA 5HXMA 2ZEXA 4GWIA 1UY2A 4BXSV 2VZRA 2VZ3A 5JMOA 4RN5A 1W9SA 3SEEA 3DYMA 4ZXEA 5JXIA 2EIBA 2Y6LA 1GOGA 2VMFA 3HPNA 3VD3A 2VCBA 4HG6B 1PMJX 3A23A 2E32A 3I3DA 3VD5A 2RVAA 5G05L 3I2JA 2YFUA 2JKXA 1IQDC 1CX1A 1US2A 1JZ3A 1UY3A 3IAPA 4P5YA 2VL4A 2JD9A 4CUAA 1UMIA 1OF3A 2RV9A 3UETA 3CMGA 3HNMA 4A6OA 5I0DA 3U37A 3IDAA 2XONA 3NJXA 3A22A 2ZEWA 4XUQA 2VJXA 5LCWL 4DXSA 4W50A 3CZUA 3NNGA 2VZUA 3WNNA 3I2IA 3MO4A 3CIHA 2QBXA 5DQ0A 1UXXX 2YG0A 1J83A 3LPFA 3W5NA 5DN2A 2Z4FA 3OEBA 1JYNA 1NAEA 2W91A 3CZJA 4KI5M 1JZ4A 4MOAA 4A42A 1DLCA 1I5PA 2WO1A 2WZ8A 3GDBA 1JZ2A 4GZ9A 1SDDB 2OKXA 2J1AA 3LE0A 4XUPA 3SKVA 1GUIA 1SG3A 3BN6A 5JXHA 4P02B 3K4ZA 4CU9A 4A41A 3WSOA 4P00B 3I2FA 3C7OA 5B4XA 4ARXA 4TTGA 3OEAA 3HNYM 3C7HA 4XVHA 2LW8A 2X09A 4DUXA 2W5FA 1LNSA 3LEGA 3PUHA 1CZVA 4KWUA 2J1EA 3MV01 2B9VA 1EUUA 2W94A 1GOHA 3SEPA 1JYXA 4QB1A 2ID4A 4DXRA 3WQBA 1BHGA 1UYYA 2VCAA 2WYSA 4LKSA
chains in the Genus database with same CATH superfamily
2ET7A 3POBA 1KS5A 2Q8CA 2X5IA 2Q1MA 3AXDA 5HCHA 1RHI1 1QF3A 2XOMA 2VPVA 5T50A 1O3TA 2MEV1 4YZ4A 4PI2A 1V9U1 4AVAA 5IK4A 1HDKA 5EYYA 3CHXA 5E16A 4W65A 1RUD2 3HQUA 2QTWB 1CX4A 4XIOA 5HI0A 2BEOA 2KM2A 1ULEA 3J8F1 2DCZA 2FHRA 2VMIA 2Y6HA 1K5JA 1R092 2XDVA 2VC9A 3ACHA 4BMEA 1J3QA 4YGEA 4N8MA 4JGYA 4AFBA 5HV0A 2P4EA 2GMEA 1AYM2 2OX0A 2EIGA 4LBQD 2VXRA 1SCRA 4LO4B 2W1WA 3I8TA 1MS5A 2J7MA 1OF4A 3HEIA 5LA1A 5BNOB 4W8JA 2VZOA 1PO13 3ZR6A 1SLIA 1H8VA 5IATA 3THDA 2A70A 3RZLA 1ZRCA 4YW1A 5JVVA 3KM5A 4KNCA 4NHKA 4UWDA 5FZCA 5FZ4A 2QE3A 5A3WA 1DLLA 4CCMA 2D43A 2JG9C 3C3VA 1JTZX 4I02A 5DDJ2 1QJX1 2ZXQA 2KXLA 5IAVA 1OD3A 2WNVB 4E2GA 4LHKA 3ZVXA 4RR3A 2J1UA 2Y26A 3V0BB 1O59A 3M7AA 3SISA 1C8M2 3T1MA 2VOKA 5L7OC 2VTXA 4FXGB 2WFF1 3E5XA 3IT8A 5FZOA 4JHZA 3CU7A 5D1IA 1Y3TA 1AR63 2A3WA 3MFCA 3ILRA 3T1LA 5HBAA 4AFCA 3IPVB 1AR92 5A6QA 2JXAA 2WWUA 4OI0A 2MEV3 5KHJA 1TZOA 1W6NB 3MW2A 1QJZA 3HQRA 5FZBA 1KGYA 4D0QA 5L7OB 2VECA 3VZLA 4TYSA 3M3QA 3KVBA 4AZZA 1OLQA 1H0BA 3D0JA 4DINB 1H1MA 4UW4A 2J22A 4ET7A 1H1AA 5J48A 1PM7A 3THCA 1MZEA 3AVSA 4Z92B 5LBBA 3R0RA 1VBC3 4XYXA 1AL21 1QWRA 2PHDA 1CAWB 1PM4A 1LHOA 2VBBA 3ZFGA 4QMAA 4KG8A 1RUOA 4FOYA 1O7FA 1NCRB 4IEYA 5JWPA 2IXCA 4Q1RA 4Y5TA 3GZUC 4O9EA 1JS9A 3N9LA 5C70A 2NYYA 2CGNA 3MIFA 4TLGA 5DABA 1QJEA 3K46A 3KT7A 3NAPC 2P3YA 5T5LA 4GA9A 1VBD1 4P9LA 4LMFA 1B35B 4GIQA 4QT6A 2E7AA 2WN2A 2D97A 3B9CA 2WC2A 2GN7A 4ZONA 3AKRA 2Q8OA 4XF9A 3KHBA 4XDPA 5L73A 4F7ZA 3IDCB 1RUD1 2VO5A 4BQ3A 4NE9A 3T09A 1BKZA 2KA3A 4DXTA 1O8PA 1S2BA 2D44A 2PELA 3EO6A 1QJY2 3M3IA 5FZFA 5IUQA 3SXWA 3FWEA 4LR4A 5HCBA 1JU4A 2HWF1 2JDUA 1HJFA 4MV2A 3MLKA 1CAVB 3ATGA 4S2DA 5A7SA 4LITA 3EB7A 4Q0UA 4YVSA 3KS7A 1AR93 4B1LA 1CIYA 4Y4RA 1COV2 2E33A 3DXUA 5F9TA 2VCCA 3BVCA 2XJTA 2WA4A 1S0FA 2C5DA 3NV4A 4X8NA 3J7NA 5T5PA 4ATEA 4IEVA 1APNA 2F6BA 1J59A 3KF3A 4R9BA 4QX8A 5BNQA 5JXGA 4FFHA 5JPMB 3ETQA 4XFGA 3TN92 5J1XA 1OA2A 4L0PA 5FMCA 3IDEA 2UYBA 1DDLA 4WV8A 3ZYFA 2OZJA 2CY6A 3ZMOA 1N1SA 5ACA1 1J84A 4BDVB 2VE1A 1WZXA 5JOZA 1XNTA 4PDWB 3T4HB 2IVIB 2V4AA 3HT1A 4QGLA 4QHBA 4Y1XA 1HXS2 3MIHA 2ZACA 2IC1A 1Z7S3 2D93A 5IFTA 4Q8KA 4B29A 1WD3A 2D6LX 3RI8A 2YPDA 1RL3A 2DCYA 1EV13 1W3VA 3VZMA 1BEV3 2XR4A 5A7WB 5BY5A 4E8DA 2VMHA 1UU4A 1YLLA 4PDWC 2J1VA 4FXKB 5C71A 1NUKA 2PFWA 4CDXC 4RS5B 4N53A 4OVEA 3PNAA 5AVPA 2CGOA 4QGNA 4NRPA 5D8AC 3FFQA 5F7UA 5IFPA 1O3QA 3I97A 5FYSA 2A6WA 1E5RA 2D5HA 3NKTA 5FY4A 4CDUC 1ULPA 1G9DA 1AYN3 5CFCA 1H9PA 3MBWA 1KS4A 2ERFA 2VZQA 3H8UA 4JGZA 4DEQA 4XCAA 2VOWA 4FOQA 5IWFA 1NA1A 4A4AA 4XTMA 1LR5A 4KQ7A 1RJ8A 1W04A 3SCGA 3V64A 3RZMA 4GB33 4CEWA 5FKCA 4H55A 1PK6A 4QKDA 2VNVA 4LE3A 3MGUA 4AHZA 3BPSA 4OHXA 1CZTA 4EN8B 1VIWB 5DUVA 2JENA 5F5CA 1QJY1 3IIIA 2HKXA 5I8SA 2Y38A 4COWA 2W9XA 2YYOA 1OKQA 1J3PA 1TME2 1W9YA 2QQUA 1Y9MA 2RJLA 3ACIA 4MVTA 5EWSA 3ECQA 3WQ1A 4CP2A 5ABJC 5CADA 1SBDA 3OD4A 1DG6A 3POGA 3LEIA 4H14A 5FLIA 3LZZA 2NN8A 3MLLA 1DF0A 2HWE1 2XB6C 4FI9A 1RUJ2 1YCIA 1AUYA 1UZYA 3BU7A 2IFWA 5FZMA 4X6RB 5AC92 4CP9A 3VBSC 2XG3A 3K51A 3VBFA 2YDEA 1CN1A 5C5TA 5JSRA 3VBHA 5FQ0A 1ZBE2 1JZ6A 3IN9A 1ENXA 2AH2A 2BVVA 2QFEA 2WQZC 1OLRA 2AEYA 3AP7A 1UZVA 1SACA 3PJYA 4C0BA 3TN93 4CXYA 2XJRA 1DCSA 2IXJA 1ZA4A 1T6BX 3RVHA 1YQ6A 2F4PA 4Y26A 1B35A 1ND2B 5LY1A 5FZEA 2OUHA 4Y1UA 3TYJA 5LA9A 1QEXA 4CPBA 4Q4X2 3O1MA 3R05A 5J37A 1FATA 4BOWA 2W95A 2ADEA 1HXS3 1ZA7A 5I0SA 5GKAC 1XU2A 2VR4A 1VAVA 1AJOA 2A7AA 2VBPA 4GH4B 4XW3A 4GB32 4R9CA 5GLVA 1LGBA 1C4RA 1POQA 2BERA 2E26A 1LU2A 2I07B 3ZXFA 2A3YA 5LWBA 4IEUA 1XBFA 2DDUA 2QNKA 2LTNA 2PLV3 3A4UA 3CJIC 4XURA 2QQWA 4YGBA 5FPUA 3L2HA 1YO8A 4CTEA 1UY1A 4CDWB 2IXKA 1ZYBA 5C9AC 2B9UA 1KDKA 1Q43A 5K4LA 2VULA 3EYPA 3VZNA 3WINE 1G86A 1V6JA 3B94A 4EROA 4K3UA 3U4XA 2H6BA 1XE0A 1W0NA 4AE2A 1MZ5A 4A44A 2ZZJA 1YFXA 1ZBA3 2VQUA 4W4ZA 2BUKA 1AR73 5BNNA 5E8AA 3WF0A 2WZR1 2AREA 1IS4A 2DURA 3AX4A 5LBFA 4GAZA 1TE1B 3LSEA 3POYA 2ENRA 3MUZ1 2R0FA 2WO7A 2Z5WA 4WM7A 4QB2A 4RGAA 3WF4A 4BQXA 4TZDA 2WIIB 4LULA 3KV9A 1AF9A 4A3XA 1IPJA 2XBO1 4IDZA 3VKOA 2YC2A 4FT8A 3QH6A 4BB3A 2ZAHA 2DWRA 4YNIA 4YZ5A 2XQRA 3PLQA 2SLIA 2BRTA 3ILFA 4LHSA 3WUDA 4OI1A 5FZKA 4Q4V3 1EYBA 1OH3A 1X50A 3J8F3 4MH0E 3VBOA 1N1TA 5FK8A 5GLWA 1C57A 3ZXGA 4L92A 3MDPA 1RUJ3 2WNUC 3ZO0B 1ULGA 4QQLA 4ZU7A 3AK0A 2XLAA 2AYHA 5J7MA 4CEYB 2A6VA 4WVZA 4NHYA 5DG1A 3N7LA 3VKNA 4J6GA 4HFSA 4E4SA 1COV3 4AF9A 2YC0A 1PHMA 4A6SA 4Q26A 1RUG2 5FUIA 4FAGA 1F4HA 1OH4A 1C8M3 2XL7A 3OGRA 4YW3A 3VKMA 2PLV2 5AVAA 4BISA 1ND2C 3OOXA 4ASKA 1X36A 4GMP3 3P1IA 2OZ6A 4J25A 3HWJA 3QH7A 4EYUA 2BU9A 1RUC3 4XIKA 2GN3A 1H30A 4KL1A 3OY8B 1F2NA 5F32A 2VVDA 1G8WA 4TXWA 1SEFA 3VHOA 1RUE2 2JB4A 2DTYA 3NVCA 2G19A 4FPCA 4QX0A 5ERLA 5FYHA 5C9AB 5KHHA 2DCTA 3WG3A 1N3OA 2I74A 3GBGA 3PIGA 4ORFA 5EV7A 4QXBA 2DCKA 3WT3A 3VBRC 2BNOA 2XJSA 2JDYA 3I59A 3BKZA 1DQ0A 2EIEA 2ZX1A 2FCUA 2N7GA 1CR7A 1JBCA 3B3QE 3FX3A 1NCQA 1CQ9A 2PMWB 4N43B 2JG8B 5A7OA 1OD5A 4CP9B 2UU8A 2XBO3 2AZ5A 3KMHA 4GWIA 2ZAAA 3ZSKA 3R4DB 1VALA 2VZRA 1R1ZA 3GF6A 4U2AA 3AP5A 4IE6A 3QOPA 5FQ0B 4DZGA 5JMOA 1GNZA 3NNLA 4Q4V2 1HRV2 3ZDSA 5K0UB 3M2MA 1FV2A 2WNVA 2JE7A 5APAA 1FMD3 4WVMA 2XUMA 4UW3A 4HN0A 2Y6LA 1PGSA 5FZ6A 5K9YA 3HPNA 1S4CA 1GQHA 1UOGA 2YPJA 1LULA 3CJIA 1PMJX 3WP4A 4BQ5A 4I3PA 2JDZA 3A23A 4RQPC 1XE7A 2G1MA 2YROA 4PI0A 2BDRA 3PUAA 4FQZA 1I3HA 2OXBA 2PHLA 5HV4A 1WMDA 2JKXA 1IQDC 3WW4A 1JOPA 3U4SA 4UW6A 4D6SA 4P5YA 5CAZA 3NNFA 2VL4A 3AMQA 3ME2A 2ZX3A 3FLPA 3VGIA 1SLLA 4R9DA 2P3IA 1OF3A 2X29A 2RV9A 4EJRA 4YW5A 2PN5A 1QMJA 2NMNA 1DGRN 4LA2A 4SLIA 3DV8A 5I0DA 2CAVA 2CL2A 2GMPA 3ENRA 3GJBA 1UPIA 3IDAA 3SCFA 5A33A 3M70A 1OI6A 3NJXA 3A22A 5EP9A 2ZEWA 2W0XA 4XUQA 4FPJA 3ZN5A 4MHRA 3IMMA 2JECA 3V65A 2CTVA 1QJU2 4W50A 1YYNA 5IT6A 4OUSA 3TEYA 4PHZA 1M4WA 1NQDA 1X9TA 1S0DA 2VZUA 3MW4A 3WNNA 5L19A 2SBAA 5FJHA 2EXJA 3WHTA 2ZGOA 1HV1A 3FFZA 3VBSA 4DRRA 1AR81 2Z2SB 1J83A 2E9QA 4YG0A 2UWAA 4XF4A 4NIDA 4QPIA 2XPJA 2JIJA 3W5NA 1EP0A 2XJUA 4LBQA 3OEBA 3PIJA 2GAUA 2RR12 2W91A 3CZJA 1VRH1 3WV6A 1JYNA 1GZTA 1DLCA 2XHKA 2WO1A 1E57A 4M0HA 5D8AB 5JSOA 2UYAA 2RS53 4YVWA 2P5BA 4W6YA 4B8EA 1J58A 5F5IA 4AI8A 1KQRA 5KXBA 4OQ8A 3ES4A 3VBOB 5I0UA 1VRH2 3JB8A 3O7OA 1LHVA 1GUIA 2FZ1A 1IOAA 1SG3A 2QCSB 5L9VA 1BXHA 3ORJA 3R4SA 4IXLA 4GJYA 3O14A 2Y33A 2QZ2A 1SLCA 4CEWC 4P00B 3MYXA 3B00A 3DN7A 3UT0A 5I93A 2GNBA 2WFF2 1BBT1 2E7QA 4QU1A 2XJVA 5FP9A 3OGGA 3ZFFB 1RUF1 4C90A 1VPHA 1XNCA 4NPMA 4NUBA 4CDQA 5C3PA 4S2FA 3DCQA 4LIUA 5FYCA 4BQ4A 4KWUA 3SLIA 1D4M2 4KBBA 3WDVA 2R1BA 5C8CC 2R042 2WNEA 2JKBA 2RS13 1EY2A 3HVDA 1EUUA 1SFNA 2P3KA 3URFA 1PGW2 4K7JA 1ZRFA 3Q8EA 2FD8A 4CDXA 3SEPA 1JYXA 3KZ4C 1A8MA 2RDRA 5LK5A 4NIHA 3OY8A 1AHSA 1V6NA 1LOFC 4DXRA 1NCRC 2RS31 1BHGA 2XXZA 5DUWA 4AI0A 2WYFA 3O12A 2QQPA 1URXA 4PQ9A 2Y34A 2NLRA 4CDWC 4LLFA 3W20A 3JBG1 1BEV1 2PA7A 2PHUA 1W99A 1OUXA 2ZEZA 3T0BA 1JZ8A 3BCWA 1H2NA 4CCJA 4JCKA 3FMGA 2B46X 2YBSA 1IG0A 3I2HA 3RG0A 2ORZA 2MEV2 1GR3A 1V9U2 4DXZA 1VBB1 1POV0 2KD7A 4Q0PA 1NX9A 5JMCA 1ZRIA 1VP6A 2Q1FA 1CONA 2OQ6A 4YZ3A 1DZTA 1GU3A 1ZVFA 4CCLA 5I8TA 4EE2A 3GM8A 3AZZA 1UY4A 2XHNA 1AXZA 4IEXA 1RHI3 3B01A 3B02A 1UXZA 2B8MA 3APBA 4HKWA 2J1RA 2E7TA 1QNWA 3UGFA 4NVPA 2XVKA 5A3LA 3R4UA 5DAQA 1O5LA 3VV1A 5IVYA 2Q30A 2VMGA 2VUAA 1QJFA 3V0AA 1PX3A 5GM0A 4P9JA 4IGOA 5FTTC 4IV1B 1L7LA 4I2OA 4IUGA 5DAWA 4EZHA 3FLTA 4JQTA 4LA3A 4KH9A 1QJY3 4MO3M 2V73A 1V6LA 1ENQA 2V5YA 4Q4Y2 4HK8A 2ZMLA 3ZYPA 5IK7A 1VR3A 1DFQA 3BTAA 2Q8DA 5FOJB 4FOVA 2D6PA 2HWB3 3AJYA 5EJ3A 2DYCA 3W21A 1I1EA 3J7LA 2W52A 3LA7A 5LK7B 4QGMA 2FQPA 2VZTA 2GZWA 1CZSA 3CL1A 2BGPA 4XUOA 5ABJB 1CIWA 1Q56A 4BK5A 5FPZA 5A33B 2Y64A 5T5OA 2ZEYA 4MG2A 2O8QA 4ZU5A 4FTSA 2RMU1 1GZWB 1PX4A 2GALA 3T3YA 1F8VA 1D4VB 4P9GA 3SKJE 2YU2A 4AEJA 3H50A 4C0HA 3P3NA 4NPRA 1SHWB 1UKGA 1COV1 3H8XA 4JKLA 3VDDA 4IESA 4Q4V1 5E88A 3GALA 2NPIA 3ZFGC 3IBMA 2ZCWA 3PHMA 5LA2A 1GANA 2C9AA 3JU9A 3EQEA 5B4NA 5GLZA 5A3MA 1RTVA 1NE6A 3VZKA 2G9FA 2VW2A 2GNDA 3M3OA 5C3QA 5FUNA 1OQDA 5EXOA 4MXWA 1MS3A 4TN7A 1BEV2 1GWMA 1UZ0A 5BUVA 4RHV2 3KCCA 2X5IB 2JE8A 4RGGA 2A1XA 5J3UA 3AXEA 3WOGA 1NZCA 4ONUA 4CUBA 4W6WA 4Q4W2 3HAGA 5GALA 1H4HA 4XHXA 3AFKA 3ZXDA 2PAMA 4IETA 1PO22 3S7IA 5FP7A 1DGRA 4Y4YA 5J09A 3E5QA 5CIRA 1Z78A 1DGLA 5FBJA 3LFIA 3HBKA 3WEZA 4XILA 4DNYA 3ZSLA 5IHRA 2GC1A 1HN0A 1PMIA 3PL0A 3PVOA 1RMU1 3H7YA 4RFT0 2EXIA 5T52A 2JDAA 2RS11 2JICA 4JHTA 2ZS6B 4D7SA 4GKXA 1JZ7A 1CJPA 4PIXA 3ZMNA 1XNDA 4E4DX 4IEQA 3KV4A 4LBKA 3NL1A 4IV3A 1S0IA 2VH9A 2RS51 4NPLA 1IHMA 4M01A 5T3NA 4I0BA 4JC1A 4COVA 3ZM8A 3RDIA 1X8MA 3VBUB 2ETEA 4PLNA 4YRDA 4EN7B 5DAVA 4OCTA 1RXGA 5LEJA 3O0XA 3H8OA 3T4VA 4QX5A 1MQTB 4FBFA 3DYPA 3LA2A 5J98B 5BNPB 2J42A 2CWSA 3NRUA 4FP3A 3W59A 2VZVA 2ZGRA 2F4LA 4QPGB 1AL0G 2ZJCA 5FZAA 4D7YA 2ZABA 2D3SA 4ZZ8A 5KWRA 3VBUC 4KWKA 5LEKA 1H2KA 4FCAA 4CCKA 1WWYA 3E97A 2W1QA 5F2SA 3ZOIA 5BPXA 4AI2A 1BYHA 3CF6E 4Z2WA 1ALYA 4RYDA 4YZ2A 2CHHA 1F5FA 1HQWA 2AR6A 4M3CE 2BWAA 1IKPA 1FMD2 4B1MA 1W9WA 2D5FA 2HWE3 3NV2A 1VRBA 5EYXA 1RUF2 4O9GA 1S0EA 4I01A 4ISRA 3WNXA 1C5IA 1RUG3 4NJ4A 1Y9GA 3NAPB 3DXTA 1J3RA 3E1F1 3K77A 2LM3A 2VUDA 2ZGUA 1L7RA 3S7EA 2QDNA 4BZ4A 2BPA2 1H4GA 1RUH1 4CU8A 3DPRC 3NNJA 4XJWA 4YPJA 3LB9A 1MEC1 4I09A 2PHXA 3WP6A 3TWIA 1UMHA 1PVC2 3D5OA 4BWOA 2A6XA 1UCXA 3EHKA 4I0AA 2VQAA 2ZKLA 2GP3A 4DQAA 3I59B 4TSVA 1ZBA1 2AGSA 2XH6A 1LESA 2Y6JA 4V2WA 3GNEA 3ZKYA 2WDBA 3EBRA 2FZ2A 3NV3A 4OHZA 3WG2A 4OZOA 5D2AA 4QB6A 3JD71 5FY0A 1UYXA 4D69A 4P08A 2IXLA 3E6BA 1YC61 1ZM1A 2CAUA 1GZWA 3I49A 5K0UC 3H3LA 3UGGA 1ZRRA 3AJZA 1RUI3 2UURA 2WBKA 3JXSA 2C0ZA 2HH9A 1RC6A 4ZZ5A 1Q8OA 3N36A 4P9WA 4M4RA 2ATFA 1AL23 5EHDA 3J7HA 3KWVA 3S30A 4ES8A 2JG9B 4IERA 1LODA 2CDPA 2P6CA 3U78A 4LUKA 4AXOA 4RL7A 2HWE2 1RB8G 1XOYA 2ARBA 4NN0A 1VJ2A 3MV11 1R091 1JODA 2V72A 2BJSA 2DVBA 1Y43B 5FZ9A 3VD4A 4P9XA 2V4VA 4J1WA 1QXPA 2PHTA 3AZYA 2CU5A 5A6YA 4ISQA 5JXJA 3AYAA 3O5SA 1GV9A 1C1LA 2R6QA 4P9IA 4YW7A 3WCSA 1EV12 1TG7A 1YI7A 4V1PA 2TEPA 3RZZA 4CP0A 1VMFA 3IIAA 5G04L 2YU1A 2GDFA 4QD2A 2O14A 2ZHLA 1OKOA 2IXHA 1LOFA 4GQ7A 4L11A 4YFZA 1FPN2 1XB9A 1A34A 1L3JA 1R1A2 2FDGA 5C8WA 4XUTA 1YUDA 4XF1A 5A7PA 3ACGA 2K0GA 3AKTA 3G7DA 4IE7A 2QQNA 3ROUA 5A3UA 2ZHNA 5ACA3 1X33A 3U14A 2XWJB 1IQAA 4UAPA 3OYWB 3T2QA 2WAAA 2JD4A 4XFCA 2W39A 4LHLA 1UIKA 3N9PA 2G9ZA 5LB6A 4YM2A 1HB2A 4LBQB 4R52A 5FYYA 2D6NA 2IXIA 1V6IA 2Q1ZB 2R16A 2VGDA 2WZPP 1LAJA 3GCWA 4BQYA 5FP4A 3WDTA 4IGQA 5FLHA 3LCPA 4AVVA 2YZ4A 4P5HA 1OA4A 1UZZA 2QJVA 4XQDA 1W6MB 3U10A 1LOAA 1S0CA 2P6HA 3NJZA 4FFGA 1J1LA 1HIXA 2VM9A 5CFCB 5FO8B 1QOSA 2XBO2 5CKMA 5HCFA 2DF7A 1A6CA 4XETA 2X8KA 5CKQA 4YVWC 3USUA 4YARA 3D3AA 3P6BA 5ISLA 5JOWA 4Q27A 1TMF3 2QQJA 4A7YA 5LRSA 4Q4W3 2PAEA 1JN2P 1K3IA 4CCDA 2JJ6A 4PLOA 1HB3A 4Z2AA 2YFZA 4Y24A 4CDQB 3GZAA 1D7PM 1K5MC 1RUI1 4JGYB 1LRHA 1AR71 1JYWA 3HIFA 4YM1A 1ODMA 3M8LA 4Y1VA 4UXAA 1BJQA 3F95A 3ZSJA 4AAPA 4XQWA 5FAXA 1W8OA 2VMDA 2ARCA 4XDOA 4XFAA 4BQ1A 1OVPA 3AFGA 3RS6A 1N3QA 3N9OA 4NHXA 1GMMA 3ALQA 3WUCA 4HSJA 1JYVA 3T0AA 3WD5A 1GWLA 1OA3A 2DTWA 1OOPA 4N90A 3VBFB 1C3HA 4E8CA 1RUD3 1FOD1 1IGOA 4WZFA 2Y6FA 4UBHA 3MZHA 3N7MA 4YG6A 1PZ8A 5EJ1B 4DUVA 1PVC1 4RGKA 5FYIA 3BI3A 2BFUL 3B7MA 4N7IA 3ACFA 3VL9A 4UFHA 1LOEA 4LHNA 3WR0A 2K46A 3C2UA 1D2QA 1QQP1 1XRUA 3KHCA 1G9FA 1KDMA 5DXDA 2WS93 1W9TA 3WNLA 2E6VA 2VOXA 4JX0A 2R062 3E6CC 2NM1A 3A7QA 4KWJA 5EPAA 3AL6A 4CE8A 4RQPA 5FJKA 4GULA 2QDRA 1RUH2 4XACA 1SPPB 2GNTA 1QIQA 1ULDA 3BYWA 3NWKA 5F2WA 4CUGA 3SCHA 3ZXLA 2ZX4A 2OQ7A 4K20A 4QXKA 4GXLA 1WW5A 1U5IA 2W92A 3FHAA 2B45X 2VW1A 2ZOEB 3CDZB 5CYYA 3PU3A 4HOOA 1YFYA 2QQIA 2BBAA 1U5XA 2QQKA 4YW2A 3HJRA 3ZXKA 2OPKA 5C3SA 1NLSA 5HXMA 2ZEXA 3CJXA 3KVAA 1NCQC 1WMXA 1X7NA 4HXCA 4L99A 5IK5A 1H8TB 4P9YA 3K3OA 1W9SA 4UBGA 5IW0A 3SEEA 3RNSA 3LSDA 2HWB2 3QCWA 4HONA 3DYMA 3VBRA 5IVVA 5L36A 3WW2A 4ZXEA 1HRI3 1LOGA 4I30A 3ZPOA 5J96B 3NO8A 2EIBA 3EMRA 5FFOC 2Q0AA 1D2SA 3DF0A 1CESA 1PIV1 2WSUA 4B7KA 2Q8EA 1YIPA 1BK1A 3CO2A 3KGLA 2YUEA 2ZMNA 4GMP0 5FWEA 3WDUA 4C1XA 2RS12 2RVAA 3FHIB 5F3EA 2YFUA 1SZBA 1W6NA 2XGXA 4MXVA 4XMIA 1ZZ7A 5FXVA 2YGMA 1OSGA 1DQ4A 1ZBE1 3AZVA 3AYEA 1BCXA 1UMIA 1POV3 1LGNA 1OQ1A 3AKSA 1LCLA 3HNMA 4BIOA 5AC91 1IS5A 2A6ZA 3VKFC 1HV0A 1V00A 4LBLA 2P1BA 3LGRA 4QQOA 1BK0A 1BVVA 4CDWA 4M3CF 3ZYGA 1GNHA 4JTNA 4XBQA 1W8HA 1GP4A 4HSLA 4DXSA 4AI9A 3BIEA 3VBOC 1YQ5A 4WM8A 1Q5OA 1TME1 1YIFA 1FI2A 4SBVA 2LUWA 1CVNA 1JXNA 4GJZA 3I2IA 3KV6A 1ZRDA 2A71A 1S2KA 4Q4X3 1MQTC 2QBXA 5FPLA 1UXXX 5C8CA 3N9MA 4XPVA 2O8OA 3B93A 4Q2FA 3ZFEC 1GP5A 5EFUA 5GZGA 2JX9A 3RWKX 1MACA 1KRIA 1YJKA 3UKNA 2GC0A 2MPFA 4KI5M 4AVTA 1AR72 2ARAA 3W9AA 4Q0VA 4GWNA 1I5PA 1E5SA 1LKNA 2WZ8A 4OI4A 2TUNA 2HWF3 4IV3B 3JZVA 4QQ2A 2WNUB 2YBKA 1SDDB 1YFWA 4XOGA 4MLOA 4LKEA 4PBOA 2X53S 5A7WA 1A78A 3WLUA 4ZKTB 2Y0IA 1WD4A 4BLJA 4M0NA 4HETA 2D6OX 4N53B 3K4ZA 1TNRA 3PMEA 2XMLA 4W6XA 1E5IA 4A41A 3I2FA 4BPZA 1RXFA 3C7OA 3MIEA 5B4XA 2CNAA 1QH7A 3H1MA 5F6KA 5FZLA 4DO0A 4WVVA 1CAUB 1NOVA 2JEMA 3C7HA 3HNYM 1NY71 2LW8A 3OEAA 4JRAA 4XVHA 5I0RA 4DUXA 3OD0A 1W8UA 1UPSA 4QPIC 2HWC1 1BMV2 1CZVA 1GBGA 2DU1A 4XJ8A 3WXPA 2NQYA 3BUCA 1TQ5A 3LF7A 3Q8AA 3LOBA 2W94A 2I45A 4FPHA 4HL0A 1UNBA 4QM9A 1TEIA 1VBD2 1Q8PA 3D4KA 2JDHA 4LO6B 4QB1A 4RQPB 2WT2A 3B69A 2QUOA 5LBCA 5JZGC 1SPPA 1CAWA 3D0SA 1UYYA 1V6OA 1XNBA 2VCAA 1VLNA 1QKQA 3J9SA 5J36A 1OMIA 1HQLA 5JZGA 4PF5A 4QM8A 3MEPA 4CSWA 1IS3A 3WDWA 2PHWA 3QACA 4QDQA 1WLCA 3AC0A 1XNAA 4N9IA 4D7TA 1BLZA 4OMDA 3GHMA 1NCQB 1WBFA 3VBFC 1IPKA 1LOCA 2DUQA 4K1YA 4LO8A 3CEWA 3POJA 4OHWA 5F5QA 4YGCA 1PNFA 3MI8A 2DVGA 1BBT3 1DBNA 1UAIA 2QKDA 3OCPA 3WHUA 4F83A 3H0OA 3I2DA 1QDCA 1Y7BA 1T2XA 3ZYJB 1Z0HA 1RVF2 3AMMA 3OPZA 1HN1A 3VBRB 4D8MA 5A1LA 4AI1A 3RZKA 1DYOA 3ZDVA 1QXJA 3BTZA 4RHV3 2DBNA 3IM0A 2W1SA 3ZPYA 2WNVC 3TB0A 2DVAA 2BOJA 2PQQA 1I9RA 3KGZA 3NJVA 2R041 3NQHA 4BMBA 4ARYA 4QHOA 2VVFA 2WZR3 3MPPG 1PK6C 2JB8A 1N1YA 4PIYA 5DDJ1 4F8AA 5A70A 3K4AA 2AEZA 2ZGPA 3NV1A 5H9RA 4D6QA 5AFBA 1XXNA 3N9QA 4XABA 1G9AA 2XQXA 4AQTA 3GZEA 2PHRA 1PIV2 5IJRA 3O1RA 1W2AX 4F3JA 2BBVA 2G9GA 2CDOA 1VBB2 4CDUA 3PUIA 5FO9B 1PMHX 4GALA 1UKRA 1AL22 2BGCA 3ZFEA 5JUVA 3RZHA 3I7DA 3LIHA 4Y20A 1BBT2 2BP6A 4AGRA 1GSLA 4KGQA 4QX2A 4Q0SA 4N53C 4DB5A 4L8QA 4PDWA 1UQXA 2RDSA 4WM8C 3ZFFA 3POIA 4HPKB 3WY6A 1TVGA 3MIGA 4QPYA 1RINA 4EQVA 5JSPA 2P37A 5FYTA 4AEKA 4MGZE 2VOVA 2VQTA 3OB8A 3EJKA 2Z42A 2C26A 2VMCA 3SQOA 3KCXA 3VDBA 3S5AA 1OURA 4XBLA 5FPBA 1K12A 2HBUA 3M1HA 1LECA 1WCKA 1O4TA 3ZYRA 4LNVA 5FRAA 3D6EA 3KLSA 1R1A3 1PO12 1DYKA 4NHLA 4DUWA 5JLVA 2EIDA 2W87A 5FXXA 4QQPA 1RHI2 3RJRA 2P34A 1UX7A 5JOYA 2WNUA 4S2GA 3TRSB 3BTXA 4IQPA 2R7EB 4A7ZA 2DCJA 4CCEA 1LHUA 1OPMA 3TAYA 1GQGA 4ATFA 1HX6A 4BLIA 1KJLA 2VZSA 4IEOA 5LZ6A 3W58A 3NJYA 3O0VA 3NMBA 1M06G 2BW8A 1KFUL 2WZEA 4COYA 3N7KA 2ZGKA 4JDMA 2PHFA 2WSVA 3QD6A 5FMBA 3U0ZA 1U5ZA 4LIVA 4FVVA 3OBAA 1BMV1 1QU0A 3WNPA 5FXZA 4FO9A 3DECA 3OGSA 3ZN4A 2WO2A 1UOBA 4GWMA 1YRZA 4WM7C 3S5QA 4DPNA 5FZGA 2NP0A 1G6NA 2XVGA 4KU8A 4BU2A 1PGL1 1YNAA 4ZY9A 4JV4A 1VMHA 3BOPA 5BNNC 2HEWF 1ND3B 1YQCA 1U12A 1SFPA 2VY0A 3RJ2X 5BNOA 2RS52 5CNAA 2HWD1 4DFSA 1WUVA 3OUJA 2DUPA 1EAH1 1SQ4A 5FPAA 3RZGA 3ZIXA 4AFAA 3HNBM 1H6XA 4PBPA 4E9KA 4CDUB 5C5UA 3T08A 5JZGB 1V6KA 1CJDA 1N3PA 1ONAA 3DKWA 3AP9A 4CU6A 3A0NA 3FBYA 4AVSA 3POSA 1F35A 1XPWA 4FPLA 3SHRA 4E2SA 2BZDA 2UY9A 1JYCA 1D0HA 1W0OA 4IW3A 1UL9A 2VVEA 3CLPA 4BK4A 4QPIB 1ZZ8A 2OS2A 1RUC2 2A73B 3DPRB 1CWPA 2YHJA 5FZ8A 4E2QA 2R49A 1W2TA 2R30A 2XL9A 1XJAA 2AACA 3ILNA 4Y5Z0 2HWC2 5K8SA 3MIDA 2WA3A 4ZPIA 4EWAA 2VNOA 1W8TA 5A3OA 3Q8BA 1B35C 4OI2A 2YB7A 5FR3A 3KT1A 3C7FA 2FDIA 3MF9A 2QQLA 2XWBB 1JU3A 2WUHA 4OFGA 2FDHA 1RUC1 4COZA 4CU7A 4HN1A 3BU0A 3DGTA 3JBG3 4FPGA 2ZA9A 3AMPA 3NKGA 5DUUA 1JUIA 2OYZA 3I4IA 1REEA 4A3ZA 4LKSA 1LB2A 1Y9QA 4ZU4A 2CSGA 3VBHC 3Q8CA 2W1UA 1VBE1 1ZZ9A 1H1IA 1KD7A 3FN9A 4QAWA 4CPBD 1LEDA 2MNGA 1K5MA 3B5LB 1XC6A 4PF1A 2XJQA 5HCAA 1X9PA 4UOJA 2HYXA 4GD4A 3UNPA 4UW5A 5ABJA 1CAXB 1VE0A 1W6OA 4M3CB 4FPKA 1EAH3 1U5YA 2HBTA 3IWZA 5LA0A 4LBMA 3UESA 3F2ZA 4WM7B 4Y5SA 4URAA 2WWSA 4QDRA 4XF3A 4AYUA 1GNYA 4QDSA 2C6SA 1F4AA 1OC1A 1BZWA 1STMA 1YWKA 3LWCA 5A1FA 4BH9A 1AYM3 1NZIA 3ES1A 3WNKA 2ZGTA 2WN3A 4YW4A 1H6YA 2ZX2A 1PGW1 1WLWA 1NA1C 4R4XA 1NG0A 1MEC2 4JGZC 4XFFA 2BWCA 2VQ0A 3UV9A 5HPOA 1KEXA 1VB2A 5JIUA 5M0TA 3FHQA 5HXVA 1VAKA 4XJZA 4META 5DZFA 3K48A 4MXWB 1MPXA 3C7GA 5D8AA 1K45A 4BCUA 2ORXA 3O1TA 4AAXA 1YI9A 2D98A 5DMYA 1MZFA 2FMYA 2WZR2 3VUOA 4PIZA 2VOTA 4UFIA 5FP8A 4R9AA 4FP2A 4NIAA 3UK9A 1H2LA 4BHPA 2X5IC 3GBFA 1ENRA 4URTA 4B3NA 4INDA 3PMSA 1W6PB 1GZ9A 5E6HA 2RJ2A 3WF1A 1SLBA 2BNMA 1PZ7A 4OUEA 1CPMA 3U07A 5C4WB 5L9RA 3V56A 3W5MA 2W68A 1EUTA 3O0WA 4JDNA 2EALA 4LQRA 4CCCA 1ZBA2 4ES9A 1GWKA 3LEMA 1WW6A 2RDNA 4Q4X1 4WZCA 3VHPA 2VUJA 1OHFA 3K2OA 4OQ9A 3SH3A 3PVNA 5H9SA 3N7JA 4IGPA 5C3OA 4XQ4A 3RWNA 5JI7A 2G4IA 3WP3A 4BM8A 1AX1A 1VRH3 2Y8KA 2B7YA 1WCSA 2H0BA 4LOTA 4A2UA 1P8JA 4A7KA 1GOFA 4D3WA 1E5HA 4PQQA 3JB4C 3WDXA 3HOBA 1FMD1 5SV8A 5BNPA 3ELNA 2J1TA 3H1WA 3MUY1 4N9HA 5FP3A 3AYCA 1POV1 3FL7A 1HB1A 3PJQA 3TNQA 1WCDJ 3ZKUA 4AHYA 4YVSC 4FAHA 5IVFA 3IPVA 3WNMA 5K0UA 1PNGA 2BNNA 1AX0A 4JQRA 3RRDA 3GXUA 2YC4A 1D4M3 2RDQA 5JIAA 1JHNA 1UU6A 3OBTA 5A3PA 2CGPA 4XF0A 5A32A 3RSJA 2R043 5F5AA 4LT5A 1N1VA 4BQWA 2TNFA 3SH4A 3IB3A 3USSA 3WZ1A 4YVSB 3ZR5A 2QQMA 5F37A 3ASIA 1RVF1 4YG3A 2WKKA 2EICA 2YGLA 2YXSA 2DFBA 3N9NA 2YBPA 3UJOA 4MYEA 3FZ3A 4OYUA 2GNMA 3WCRA 2XLGA 3LPGA 3NAPA 2CV6A 4AG4A 3OUHA 2FMDA 4AHXA 4MHUA 1O4YA 4HBNA 2VAUA 3FLRA 5FY7A 4HVOA 2WFPA 2WWJA 1JOBA 1VBD3 1L7QA 5KR7A 1UWWA 4L97A 2LROA 5JI9A 1ASJ2 1FYUA 3RQ0A 1RMU2 2LALA 2FCVA 1K5MB 3OGVA 5EJZB 1YQ2A 3IAQA 4HZFA 3VDCA 1DGWX 1XYNA 4IE0A 2VG9A 5E89A 2Z69A 3FBMA 3VZOA 1JZ5A 2BFUS 5A1AA 1QH6A 1DHKB 4UI9L 5CBLA 2FDJA 5JPNB 1HRV1 4XJAA 1VBC1 1CPNA 3OF1A 2C1FA 2KR2A 1FPN1 1RUJ1 4M4PA 5FYZA 3VBSB 3X29B 4WBBA 1OLMA 4R4ZA 4Q4W1 4MGSA 3K4DA 4FFFA 3SMHA 5BYNA 5KHKA 5KXCA 4CXWA 1VBE2 3VBUA 1WGPA 2ZX0A 3EXUA 4CUCA 1EV11 1SBFA 3H3ZA 1SCSA 3JUUA 2JIGA 1EPWA 2E31A 4Y3OA 4ZS3A 5GZCA 1OQEA 4OMCA 5JAXA 4RS5A 1IG3A 3Q9OA 3NW4A 2OW4A 4TWTA 1O3RA 3GGLA 4Q4Y3 4K9SA 3AVRA 4HVQA 1NXMA 5FV3A 1BVP1 1W05A 5CA6A 5L7OA 1YQ8A 1WLTA 2EVXA 4NIIA 4RR3C 4FPOB 4BJ0A 2VBDA 2WABA 3ZXAC 4BXFA 4YW6A 4JDOA 1R093 3PU8A 1RMU3 4PCRA 3ABZA 1O8SA 1JW6A 2WR9A 4OHYA 2ZGNA 1JH5A 4IV3C 4L2NA 4AQSA 1GFF2 3DEMA 4OZXA 1LU1A 2HYKA 2DV9A 2JDPA 3KB5A 5FZHA 4BXSV 2VZ3A 1JYIA 2R073 1VBC2 2Y60A 2PLV1 2K2SA 3ZSMA 1RUE3 5JXIA 4DIQA 4YYOA 4QXHA 5BNPC 4P14A 2VMFA 1YJLA 1S0JA 3IMNA 1J1TA 2OUJA 2HWF2 1VMJA 4HG6B 3WG4A 5IVJA 4XFHA 2IVJA 3ZIWA 4FTBA 3ON7A 3VD5A 3BODA 2HWD2 4AHWA 5FZ3A 5FDBA 4B7EA 3ZX7A 4QX7A 3VDDB 4Q4Y1 4NIGA 1S1AA 2ZMKA 1UX6A 2PYTA 1UY3A 1MS9A 3IAPA 3MF6A 3H8RA 1W6QB 1FPN3 1UD1A 2I2SA 2R0HA 4CZSA 4AOCA 3FUQA 2VTXJ 4FPYA 3UETA 1IPSA 4XAEA 2E51A 3CMGA 3IDBB 2JDNA 4Y22A 3KQ4B 5CU1A 3VN4A 5BV6A 1AXYA 4BQ2A 2GSYA 3KF5A 2R063 4UF0B 3VLBB 4H2AA 4D94A 3VDDC 1CGPA 2Q4SA 2VJXA 3LOIA 5LCWL 5FYMA 1W2NA 2VD7A 1D4M1 3CZUA 4Y1ZA 1ZZCA 4DMIA 4KG0A 4TLFA 1PO11 5DAPA 4YFWA 1HRV3 4G3YC 1IZ3A 2QZ3A 3WW3A 2Z79A 5DQ0A 5A32B 2RM21 5KC5A 3LIGA 4AI3A 3THPA 1W0PA 3UKTA 4AQ6A 4LTAA 5F8PA 3CNAA 5CG8A 3POWA 1W8ZA 5DN2A 4LKFA 4NAOA 1DQ6A 2RJKA 5IVEA 1JZ4A 5LW9A 1DQ1A 4BE3A 1LOBA 2DVFA 5DAXA 3ZFGB 1HRI1 1FV3A 3RMXA 4XC9A 4EWEA 2ET1A 4GB31 1LHWA 4GZ9A 5FY5A 1W9FA 2OKXA 3IZOA 2J1AA 1C8NA 4LK6A 1V9U3 1X82A 1DQ5A 4FSJA 4RR3B 2RS32 3SKVA 1WW7A 4X6QB 3V0BA 5GZFA 3U1XA 2JG8A 3BN6A 4NO4A 4MGYE 4CU9A 3H9AA 3WSOA 2RE9A 5FZOB 4L9BA 4N43C 5FZIA 4AFDA 1H8TA 4TTGA 2R071 4QPGA 1DQ2A 1G9CA 4NWWA 2W5FA 1EPZA 2WJSA 3AMHA 4QKBA 1LNSA 3ZYBA 2IFRA 1QJU1 5CFDB 1UN1A 4GH4A 4UFMA 3RI9A 3OPWA 4HMZA 1UU5A 5F3CA 4Y1YA 1PK6B 2CWMA 2VXJA 1V0AA 2R061 4XBNA 2OT7A 3TEXA 1GOHA 1WA4A 3OPTA 4C1WA 1Z7S2 3MPBA 4K8FA 4KBZA 1RIRA 5FYBA 3WW1A 4FFIA 4CYDA 1VBB3 2C24A 3H42B 4AEDA 5FZDA 1ENSA 3ZLIA 5KXDA 3MHZA 2ZZQA 4ASMB 1GQPA 1NCRA 1SDWA 1FT9A 3J8F2 1F15A 4JRLA 3VKLA 4QXCA 1R64A 2IWGB 1X8EA 1ZREA 1QHDA 1ZNPA 5FCCA 4FPFA 1QY4A 3J26N 3BOWA 4XUNA 2JDKA 1A8DA 1DZQA 1HJGA 5FMOL 1AYN2 1S2EA 5GZDA 1FAYA 3ZN6A 4CEYC 5EQUA 2HEYF 4NMIA 2GC2A 2WLPA 5A7NA 4CDQC 2OIIA 3T0DA 3OGJA 2A6YA 1JMUB 4DY5A 4WM8B 3C7EA 2XVLA 5C3RA 3OSDA 1ASJ3 2QQOA 4XZUG 3OUIA 3S0MA 3M3CA 4B4RA 5T55A 1MZ6A 4A45A 2VU9A 5ANQA 3VDAA 3RYRA 3TNPB 4CRQA 1CAVA 2D6KA 4C8DA 5FREA 2BV4A 2XUEA 4RD7A 1UYZA 5BNOC 4NROA 1PO21 1MS1A 1QOTA 2OA2A 1UZWA 2DU0A 4NRMA 4QKFA 1B09A 1UF2C 2NMOA 1OOPB 1YXWA 4XFIA 1T6GC 3POFA 1AX2A 5F6LB 3GZTB 4IEZA 4YVWB 3HN3A 4AGVA 3WF2A 5CEHA 5FY1A 4RHV1 2P17A 3VZJA 2LRPA 2ZGLA 1NA1B 5F1RA 2VNRA 1W8FA 1WA6X 1S0BA 2Y6GA 3HD8B 1GZCA 4GKYA 4D6RA 4UF0A 1TME3 4H3WA 1OFSA 3S6PA 4QU2A 3RFRA 4AL9A 4FTEA 1CAUA 1JUHA 2VTFA 4IEPA 1O3SA 4YGDA 4E27A 1V70A 2WT0A 3AZWA 2VCMA 4K40A 4B4QA 1IKQA 4XXPA 3USUB 2PAKA 3ZSEA 1OPOA 4IL7A 1KXGA 2ZTNA 2ZKNA 2WT1A 1WMEA 5LATA 4ZS2A 1YHFA 2UWCA 2ZBJA 4RA0A 3TEWA 2RMU2 5D21A 5C4WA 1ZBE3 3I3MA 1VAMA 3JQWA 3P3PA 4GWJA 5EZWA 3U11A 4CCOA 1SLAA 4IE4A 2PTMA 1QNYA 1R081 2X05A 1O5UA 4KWLA 4EN6B 3O1OA 3OYWA 2L9LA 1C1FA 4PT6A 5JR7B 4AQ2A 3UGHA 4DY3A 5KC6A 1AJKA 1UO9A 4K1ZA 1VB4A 3ETPA 3OTFA 3ZFFC 4IV1C 1W90A 1MS0A 1Z7S1 4ZXKA 5CKNA 2FDFA 2C4XA 1G7YA 2WAOA 3ZYHA 4KU7A 1US3A 3UJQA 2EAAA 3OBRA 3TN91 5CFDC 2WQ8A 3CJIB 1W3XA 5A3TA 1FNYA 3KT4A 5FPVA 5FY8A 3MICA 2XKOA 2LS6A 1ASJ1 1LTEA 4HLTA 5IK8A 4QX3A 2V09A 4JZRA 2ZHKA 3AP4A 4Y33A 1OT5A 1NE4A 4OUMA 2Y6KA 3P5BA 4G9SB 4UT5A 4DRVA 2PQSA 4XMAA 1VBE3 2EAKA 2EF6A 3LEKA 2IZWA 4YWAA 3ZXJA 4B4PA 3U75A 4ZHNA 5FZ7A 4EV0A 1QDOA 5BXXA 1PO23 1PVC3 1WBLA 4JKKA 2RR13 3MFAA 5JDBA 4E4ZA 5FK7A 4DS0A 5FOBB 5JOXA 4AEDB 4K6BA 5FWJA 2RHPA 2H0VA 2W3JA 3I3BA 3J7MA 3ZXEA 3BTYA 2A3XA 1AVBA 3N3HA 4RFRB 3IKWA 3K3NA 4MGIE 3GCXA 2OVUA 5KHIA 2MHFA 5IAXA 3PUSA 4Q29A 2DBIA 1ND3C 4DEVA 3LFMA 3MLJA 5KXEA 4BA6A 2AC1A 1NT0A 4LEJA 4IEWA 4UFJA 1XNKA 1ND2A 5C8CB 2ILMA 2WFF3 4LKDA 2R072 3I3EA 4FOWA 1DU3D 1UMZA 3CBNA 3JQXA 1DIWA 1XYOA 4LE4A 4PLMA 3T2TA 1RUNA 2BVBA 2HLEA 4XZPA 3M3EA 1NYWA 3WDYA 1SBEA 3A21A 4GMP1 1UW8A 4XFBA 1QOOA 3TEZA 4I3GA 3UYJA 3WVJA 1A3KA 1FNZA 1DP0A 4QPWA 4XAAA 4H7MA 4YLZA 4MADA 4XEZA 2WO3A 2DFCA 4QWNA 5F39A 5F3GA 3RYPA 1RVF3 4JVAA 5KBFA 2HWD3 3HR9A 2K9ZA 4LBJA 2ZGQA 3FJSA 1UYPA 3C8XA 3I54A 3POEA 1RITA 3S57A 3O1VA 2TBVA 5DZEA 4IE5A 1W6MA 4MZUA 3E5UA 2P2KA 1DGWA 2FCTA 1FOD2 3SITA 2C9KA 4WVWA 3K75B 3PTYA 1UOFA 1AR82 4J1XA 4OLLA 2W46A 3THTA 2FDKA 1HRI2 1XSRA 3AMNA 3QLQA 5BNNB 1RYYA 1SMVA 1ULCA 2PXJA 2QVSB 1Y4WA 4Y20B 2RR11 1XU1A 3VD7A 2EXHA 3AL5A 1ULOA 5A6XA 1W39A 1XE8A 4Q0QA 4Z07A 3SH5A 4AVCA 2RM22 2O0OA 3VD9A 4X8PA 4HPKA 1N47A 1ACCA 1Q8VA 5DPNA 3UL2A 3D8CA 5ANNA 4JKMA 5C9AA 4MX3A 5IYYA 4NR1A 3T2OA 1OUSA 3L2YA 4LXLA 5T54A 3JD73 4BYYA 3WQ7A 1RUF3 4V2VA 3ZYIB 2JDMA 3DYOA 1QQP2 5FIXA 1S0GA 2B4KA 5K7PA 1NQJA 4HKLA 3I2OA 3GBWA 2V5DA 2XLFA 1GICA 3NNMA 2VMEA 5GZEA 1WMFA 5IVCA 2XJPA 1MQTA 4YM0A 1LENA 2J1SA 4CEYA 4Z8BA 1W6QA 2ZGSA 4O65A 5JCTA 4N7UA 3ST7A 4LJHA 3WP5A 1OLME 1AZDA 1H2MA 1S55A 3FC0A 2RS33 2VZ1A 1GP6A 2XKPA 2JE9A 2UWBA 4WVMB 4Y22B 5FYVA 1XQNA 1WW4A 1JHJA 3BGAA 1ZZBA 4NWVA 1UIJA 4NRQA 2FBEA 1LJ7A 4AEDC 4DOUA 3V0AB 2R1DA 5TSWA 2Y0OA 3OBZA 3VL8A 2Q5TA 1RGSA 1G9BA 1YFUA 3I2KA 1GLHA 5CG9A 2OPWA 1RUG1 3LD8A 5LASA 1K42A 1WKYA 5CB7A 3UKVA 4O61A 4AEMA 2BTVC 4GH4C 1O91A 1R1A1 3I2GA 4K8RB 2DVDA 2ZGMA 2VW0A 5T5JA 4CCNA 1ND3A 5FXWA 1REDA 1HW5A 3N4MA 2D40A 4HKOA 1EAH2 5KHGA 3WNOA 1QXRA 2ZPXA 4N43A 2BGOA 4HT1T 5FY9A 3AB0A 4HK9A 5A3NA 2HJIA 4S2HA 2HEVF 5A7QA 1F9KA 1RJ7A 1W2UA 1PGL2 4LK7A 1AR61 4CP1A 1OXCA 2B42B 1ODNA 1AXKA 1MVQA 1RUE1 1W2OA 3L9JT 4LBOA 5ACA2 1Q8QA 1C5HA 4EN0A 1CD3G 3KD4A 5EIYB 1D0GA 3DL3A 4OULA 1CAXA 2RG4A 3KSCA 5FBZA 5CISA 2F17A 1LHNA 1VBA2 3HMYA 3RPQA 4JTOA 5FO7B 1W8NA 2VZPA 3WG1A 1I6XA 5B2GB 3SC7X 1PVXA 5CFCC 4XE9A 3KCYA 1O4ZA 2ZHMA 3LDRA 4HVRA 3O1SA 3VB9A 4E4HA 1GYKA 3PUQA 3BIWE 1NKGA 5A6ZA 1MR5A 5CFDA 3H1YA 1HKDA 1Q8SA 4FPEA 4JAAA 3H7JA 3N35A 5JR2A 4MGTA 2YY1A 5L9BA 1HB4A 2WS92 1SFYA 3JD72 4IV1A 1MVEA 3CQOA 5F3IA 4FQ4A 1AYN1 4AWDA 5AFEA 4AGGA 1V6MA 3PURA 1W06A 1QQP3 4QX1A 4YZ1A 2VNGA 2WINB 5FKBA 1BQPA 1JI6A 3CKHA 3RZJA 1O6UA 3GHNA 2W47A 4EZ4A 3LQCA 2X10A 1WCQA 3JBG2 2GH8A 5FMDA 2GMMA 4XJUA 2BQPA 3Q8FA 4AVBA 3PVBB 5C4WC 3M4FA 3B9IA 3A0KA 4LPLA 2D3PA 3ZFEB 1QJX3 4Q8LA 1JOJA 2AENA 1OOPC 3ZN6B 1DZRA 2B5HA 2P3JA 3T2PA 4COUA 3WQ0A 3LKJA 1F5JA 4MGQA 5FZ1A 2E63A 3GYDA 4MGKE 3RMYA 2A75A 3FUOA 4CVUA 5C7GA 1ULFA 5H9PA 4AR2A 2WLQA 2YMZA 1QJU3 2W2IA 3LA3A 2BYVE 1JYTA 1XSQA 2D6MA 3AKQA 3HN1A 3OG2A 2O1QA 3HT2A 5CZKA 5DZGA 1FX5A 3VHRA 3WF3A 1W28A 1YEWA 2GP5A 4ITCA 3KQRA 1MS4A 3AM2A 3H3UA 3TOJA 4JGZB 1ZZ6A 4MSVA 4UFLA 1UY0A 4UYBA 5I0TA 4LUMA 2DUOA 5LY2A 1QGLA 4KMQA 4LO5B 3PTRB 4XCBA 1NXD1 2HWC3 2VUCA 4XDQA 4CEWB 2HWB1 1AR91 2R32A 4NHMA 1UY2A 1OFNA 4LLOA 5DG2A 4C91A 4RN5A 3BB6A 1PZ9A 4UFKA 1RUH3 1ZX5A 5GLUA 3QBQA 5GLTA 5E1RA 4QQHA 3I3QA 1KITA 5FUPA 2IUWA 1FOD3 4AK3A 1GOGA 4LBNA 1KJRA 3LDBA 4YSFA 1AR83 2E53A 2W08A 5FYUA 3VD3A 3T30A 2VCBA 4RS5C 1VBA3 4CDXB 2D7FA 3DUIA 1W8WA 2JWPA 2NZ9A 5AC93 2E32A 1C8M1 3I3DA 4XTPA 1RUI2 1ST8A 3G6JB 1HLCA 5G05L 3I2JA 1MEC3 2A5ZA 3FE5A 4CXXA 1CX1A 1QJX2 2AUYA 1US2A 1XYPA 2WS91 1JZ3A 3PDQA 2YV8A 5LBEA 3VBHB 4MUVA 2JD9A 4PJYA 4QHZA 4AFMA 4CUAA 4AW7A 4G4FA 1H9WA 1Q3EA 5I91A 1OVSA 1W03A 4LOSA 5SV5A 1LEMA 4A6OA 3RYKA 3LAGA 1W6OB 4M3CA 3U37A 4OHVA 5DUXA 3TBDA 2XONA 4R8HA 4U36A 4XJ9A 5H9QA 1WCUA 4YM3A 1TMF1 4ASLA 2GU9A 4BIFA 1REFA 1I5ZA 2EXKA 4H7LA 1AYM1 4O7XA 1NLRA 3MW3A 3O1UA 2GH2A 3NNGA 1R082 5FMOS 5GJ6A 5C33A 2ES3A 3O1PA 1LGCA 1MS8A 3MO4A 3CIHA 1C28A 1NLQA 5FZ0A 5CVRA 2YG0A 4NOTA 3LPFA 1WLDA 1DYPA 1F31A 2UY8A 5IVBA 5C6CA 5I8YA 2Z4FA 4XHBA 5A80A 2JG9A 2B39A 1NAEA 4QPGC 1H8TC 3AYDA 3NSTA 4Q5OA 4MOAA 4A42A 1GKBA 4KGGA 1HQNA 4EWDA 3LDKA 2ARXA 2JG8C 2CYFA 3HQXA 1FXZA 3GDBA 1JZ2A 5DDJ3 3ACLA 2EA7A 3J4UH 1VBA1 3LE0A 4XUPA 3INAA 4I0WB 1IS6A 5JXHA 4P02B 1TNFA 1W6PA 4QKNA 4EN9B 3BPZA 3HBZA 4JGYC 5LRRA 1NY72 2ADDA 1UOJA 4LO7A 3D82A 1AR62 4ARXA 2WNOA 3DKQA 4NAMA 3BALA 4CA9A 3R6SA 1OBNA 3AP6A 3WX5A 2H6CA 3AZXA 2X09A 5FPXA 1U0AA 3JCIA 3VHNA 4HANA 3PVEA 1SLTA 3LEGA 3PUHA 1HXS1 2J1EA 2BOIA 4Q1PA 3RGBA 4Z1VA 2WRAA 3KV5A 3MV01 2QQVA 3OJBA 2B9VA 4Z82A 1KFXL 1TMF2 2RM23 2WQ4A 4M00A 2GC3A 3AKPA 3DPRA 5FLJA 4RSUA 3GJAA 3MIBA 3E6DA 3SNMA 2ID4A 3ITQA 2D3RA 4K21A 3WQBA 4XXAA 1R083 4LORA 2WL1A 2WYSA 2RMU3 1PIV3
chains in the Genus database with same CATH topology
1GQPA 2XOMA 1W99A 2ZEZA 4QDQA 3T0BA 1R64A 1JZ8A 3AC0A 1XNAA 3I2HA 4OMDA 4XUNA 2ORZA 2KD7A 1NX9A 1GU3A 3GM8A 1UY4A 2XHNA 3T0DA 2Y6HA 3C7EA 1UXZA 1T2XA 2J1RA 2QQOA 2VC9A 3ACHA 4XZUG 4D8MA 1HN1A 1DYOA 4A45A 3VDAA 2W1WA 1PX3A 2W1SA 2J7MA 1OF4A 3HEIA 5LA1A 4IUGA 4W8JA 2VZOA 3NJVA 1UYZA 4MO3M 3NQHA 4ARYA 3THDA 3K4AA 3HN3A 2XQXA 3WF2A 5IJRA 2ZXQA 1OD3A 2CDOA 3PUIA 2VZTA 1PMHX 1CZSA 2J1UA 2BGPA 1O59A 4XUOA 2Y6GA 5JUVA 4BK5A 2Y64A 4QX2A 2ZEYA 4JHZA 1PX4A 3SKJE 2VTFA 1TVGA 1SHWB 4JKLA 4D0QA 1KGYA 2VQTA 3OB8A 2C26A 2VMCA 5LA2A 3VDBA 5B4NA 1K12A 2J22A 4ET7A 4GWJA 3THCA 2X05A 4DUWA 2EIDA 1UZ0A 2W87A 2L9LA 4PT6A 1UX7A 2JE8A 4CUBA 3ETPA 2R7EB 5C70A 2DCJA 3K46A 2VZSA 2C4XA 2WAOA 1US3A 2WZEA 2WN2A 3WEZA 2WQ8A 5IHRA 3OBAA 3WNPA 3DECA 3OGSA 2LS6A 2JDAA 2VO5A 2WO2A 4QX3A 3T09A 1JZ7A 4DXTA 1O8PA 1OT5A 2Y6KA 4ZY9A 2PQSA 1JU4A 3LEKA 3ZM8A 3EB7A 4JKKA 1CIYA 2E33A 2VCCA 3HNBM 1H6XA 3DYPA 2W3JA 3I3BA 3T08A 3NRUA 5JXGA 2VZVA 4ZZ8A 4CU6A 5J1XA 4L0PA 4DEVA 1XPWA 2BZDA 2W1QA 1J84A 4BDVB 4BK4A 4RYDA 3I3EA 1XNTA 2HLEA 1W9WA 3A21A 5IFTA 2YB7A 1DP0A 4QPWA 3C7FA 2QQLA 1JU3A 2WUHA 4MADA 4CU7A 3E1F1 2WO3A 3K77A 4E8DA 1L7RA 5C71A 2J1VA 1NUKA 4CU8A 4A3ZA 4YPJA 3C8XA 2W1UA 3FN9A 1UMHA 5F7UA 4QAWA 5IFPA 3I97A 1XC6A 1ULPA 4PF1A 2C9KA 3K75B 3MBWA 4DEQA 2VZQA 2W46A 4UOJA 2HYXA 2Y6JA 3UNPA 4A4AA 1RYYA 2WDBA 4OZOA 4QB6A 3VD7A 1ULOA 1UYXA 4P08A 5LA0A 3UESA 3F2ZA 1CZTA 4QDRA 3VD9A 1GNYA 3IIIA 4QDSA 5DPNA 1F4AA 4JKMA 3JXSA 2WBKA 3WNKA 5IYYA 2W9XA 3T2OA 4ZZ5A 3ACIA 3ECQA 4M4RA 2WN3A 1H6YA 3LEIA 3J7HA 5HPOA 1KEXA 3DYOA 4FI9A 2B4KA 3FHQA 2CDPA 2V5DA 2VMEA 1MPXA 3C7GA 1K45A 2ORXA 3MV11 2J1SA 2V72A 4AAXA 3VD4A 5DMYA 1JZ6A 2V4VA 2VOTA 5JXJA 2VZ1A 3BGAA 1JHJA 1TG7A 5G04L 2RJ2A 3WF1A 4OUEA 3I2KA 4XUTA 3W5MA 4LQRA 1EUTA 3ACGA 1K42A 1WKYA 2QQNA 2W95A 2VR4A 4UAPA 3I2GA 3T2QA 2WAAA 2BERA 2E26A 2Y8KA 2DDUA 3WNOA 1P8JA 1GOFA 4XURA 2BGOA 4PQQA 1UY1A 3HOBA 3MUY1 2J1TA 3EYPA 3FL7A 2VM9A 3WNMA 1W0NA 4A44A 3GXUA 2YC4A 2VQUA 4W4ZA 5EIYB 3WF0A 3D3AA 3P6BA 2QQJA 3MUZ1 1K3IA 1W8NA 4QB2A 2VZPA 3IB3A 3WF4A 2QQMA 4Z2AA 2YFZA 1D7PM 2EICA 1NKGA 2YC2A 1JYWA 4OYUA 4LHSA 5JR2A 3LPGA 4AG4A 3CQOA 1W8OA 2VMDA 1GMMA 4QX1A 1JYVA 1L7QA 1UWWA 3T0AA 1JI6A 3CKHA 2W47A 4E8CA 3LQCA 3OGVA 2X10A 5EJZB 1YQ2A 3IAQA 1WCQA 3VDCA 5EJ1B 4DUVA 1JZ5A 5FUIA 3ACFA 1F4HA 1OH4A 3OGRA 4LPLA 4UI9L 5A1AA 4M4PA 3P1IA 4MGSA 3K4DA 1W9TA 3WNLA 3T2PA 4JX0A 4CUCA 3A7QA 4MGQA 2E31A 4CVUA 5C7GA 4OMCA 4TXWA 3GGLA 4QX0A 5CZKA 3OG2A 3WF3A 2DCKA 4BJ0A 2WABA 2W92A 3FHAA 3CDZB 1UY0A 5CYYA 2EIEA 2QQIA 2BBAA 2QQKA 3ABZA 3HJRA 1O8SA 4KMQA 5HXMA 2ZEXA 4GWIA 1UY2A 4BXSV 2VZRA 2VZ3A 5JMOA 4RN5A 1W9SA 3SEEA 3DYMA 4ZXEA 5JXIA 2EIBA 2Y6LA 1GOGA 2VMFA 3HPNA 3VD3A 2VCBA 4HG6B 1PMJX 3A23A 2E32A 3I3DA 3VD5A 2RVAA 5G05L 3I2JA 2YFUA 2JKXA 1IQDC 1CX1A 1US2A 1JZ3A 1UY3A 3IAPA 4P5YA 2VL4A 2JD9A 4CUAA 1UMIA 1OF3A 2RV9A 3UETA 3CMGA 3HNMA 4A6OA 5I0DA 3U37A 3IDAA 2XONA 3NJXA 3A22A 2ZEWA 4XUQA 2VJXA 5LCWL 4DXSA 4W50A 3CZUA 3NNGA 2VZUA 3WNNA 3I2IA 3MO4A 3CIHA 2QBXA 5DQ0A 1UXXX 2YG0A 1J83A 3LPFA 3W5NA 5DN2A 2Z4FA 3OEBA 1JYNA 1NAEA 2W91A 3CZJA 4KI5M 1JZ4A 4MOAA 4A42A 1DLCA 1I5PA 2WO1A 2WZ8A 3GDBA 1JZ2A 4GZ9A 1SDDB 2OKXA 2J1AA 3LE0A 4XUPA 3SKVA 1GUIA 1SG3A 3BN6A 5JXHA 4P02B 3K4ZA 4CU9A 4A41A 3WSOA 4P00B 3I2FA 3C7OA 5B4XA 4ARXA 4TTGA 3OEAA 3HNYM 3C7HA 4XVHA 2LW8A 2X09A 4DUXA 2W5FA 1LNSA 3LEGA 3PUHA 1CZVA 4KWUA 2J1EA 3MV01 2B9VA 1EUUA 2W94A 1GOHA 3SEPA 1JYXA 4QB1A 2ID4A 4DXRA 3WQBA 1BHGA 1UYYA 2VCAA 2WYSA 4LKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQP A;  2XOM A;  1W99 A;  2ZEZ A;  4QDQ A;  3T0B A;  1R64 A;  1JZ8 A;  3AC0 A;  1XNA A;  3I2H A;  4OMD A;  4XUN A;  2ORZ A;  2KD7 A;  1NX9 A;  1GU3 A;  3GM8 A;  1UY4 A;  2XHN A;  3T0D A;  2Y6H A;  3C7E A;  1UXZ A;  1T2X A;  2J1R A;  2QQO A;  2VC9 A;  3ACH A;  4XZU G;  4D8M A;  1HN1 A;  1DYO A;  4A45 A;  3VDA A;  2W1W A;  1PX3 A;  2W1S A;  2J7M A;  1OF4 A;  3HEI A;  5LA1 A;  4IUG A;  4W8J A;  2VZO A;  3NJV A;  1UYZ A;  4MO3 M;  3NQH A;  4ARY A;  3THD A;  3K4A A;  3HN3 A;  2XQX A;  3WF2 A;  5IJR A;  2ZXQ A;  1OD3 A;  2CDO A;  3PUI A;  2VZT A;  1PMH X;  1CZS A;  2J1U A;  2BGP A;  1O59 A;  4XUO A;  2Y6G A;  5JUV A;  4BK5 A;  2Y64 A;  4QX2 A;  2ZEY A;  4JHZ A;  1PX4 A;  3SKJ E;  2VTF A;  1TVG A;  1SHW B;  4JKL A;  4D0Q A;  1KGY A;  2VQT A;  3OB8 A;  2C26 A;  2VMC A;  5LA2 A;  3VDB A;  5B4N A;  1K12 A;  2J22 A;  4ET7 A;  4GWJ A;  3THC A;  2X05 A;  4DUW A;  2EID A;  1UZ0 A;  2W87 A;  2L9L A;  4PT6 A;  1UX7 A;  2JE8 A;  4CUB A;  3ETP A;  2R7E B;  5C70 A;  2DCJ A;  3K46 A;  2VZS A;  2C4X A;  2WAO A;  1US3 A;  2WZE A;  2WN2 A;  3WEZ A;  2WQ8 A;  5IHR A;  3OBA A;  3WNP A;  3DEC A;  3OGS A;  2LS6 A;  2JDA A;  2VO5 A;  2WO2 A;  4QX3 A;  3T09 A;  1JZ7 A;  4DXT A;  1O8P A;  1OT5 A;  2Y6K A;  4ZY9 A;  2PQS A;  1JU4 A;  3LEK A;  3ZM8 A;  3EB7 A;  4JKK A;  1CIY A;  2E33 A;  2VCC A;  3HNB M;  1H6X A;  3DYP A;  2W3J A;  3I3B A;  3T08 A;  3NRU A;  5JXG A;  2VZV A;  4ZZ8 A;  4CU6 A;  5J1X A;  4L0P A;  4DEV A;  1XPW A;  2BZD A;  2W1Q A;  1J84 A;  4BDV B;  4BK4 A;  4RYD A;  3I3E A;  1XNT A;  2HLE A;  1W9W A;  3A21 A;  5IFT A;  2YB7 A;  1DP0 A;  4QPW A;  3C7F A;  2QQL A;  1JU3 A;  2WUH A;  4MAD A;  4CU7 A;  3E1F 1;  2WO3 A;  3K77 A;  4E8D A;  1L7R A;  5C71 A;  2J1V A;  1NUK A;  4CU8 A;  4A3Z A;  4YPJ A;  3C8X A;  2W1U A;  3FN9 A;  1UMH A;  5F7U A;  4QAW A;  5IFP A;  3I97 A;  1XC6 A;  1ULP A;  4PF1 A;  2C9K A;  3K75 B;  3MBW A;  4DEQ A;  2VZQ A;  2W46 A;  4UOJ A;  2HYX A;  2Y6J A;  3UNP A;  4A4A A;  1RYY A;  2WDB A;  4OZO A;  4QB6 A;  3VD7 A;  1ULO A;  1UYX A;  4P08 A;  5LA0 A;  3UES A;  3F2Z A;  1CZT A;  4QDR A;  3VD9 A;  1GNY A;  3III A;  4QDS A;  5DPN A;  1F4A A;  4JKM A;  3JXS A;  2WBK A;  3WNK A;  5IYY A;  2W9X A;  3T2O A;  4ZZ5 A;  3ACI A;  3ECQ A;  4M4R A;  2WN3 A;  1H6Y A;  3LEI A;  3J7H A;  5HPO A;  1KEX A;  3DYO A;  4FI9 A;  2B4K A;  3FHQ A;  2CDP A;  2V5D A;  2VME A;  1MPX A;  3C7G A;  1K45 A;  2ORX A;  3MV1 1;  2J1S A;  2V72 A;  4AAX A;  3VD4 A;  5DMY A;  1JZ6 A;  2V4V A;  2VOT A;  5JXJ A;  2VZ1 A;  3BGA A;  1JHJ A;  1TG7 A;  5G04 L;  2RJ2 A;  3WF1 A;  4OUE A;  3I2K A;  4XUT A;  3W5M A;  4LQR A;  1EUT A;  3ACG A;  1K42 A;  1WKY A;  2QQN A;  2W95 A;  2VR4 A;  4UAP A;  3I2G A;  3T2Q A;  2WAA A;  2BER A;  2E26 A;  2Y8K A;  2DDU A;  3WNO A;  1P8J A;  1GOF A;  4XUR A;  2BGO A;  4PQQ A;  1UY1 A;  3HOB A;  3MUY 1;  2J1T A;  3EYP A;  3FL7 A;  2VM9 A;  3WNM A;  1W0N A;  4A44 A;  3GXU A;  2YC4 A;  2VQU A;  4W4Z A;  5EIY B;  3WF0 A;  3D3A A;  3P6B A;  2QQJ A;  3MUZ 1;  1K3I A;  1W8N A;  4QB2 A;  2VZP A;  3IB3 A;  3WF4 A;  2QQM A;  4Z2A A;  2YFZ A;  1D7P M;  2EIC A;  1NKG A;  2YC2 A;  1JYW A;  4OYU A;  4LHS A;  5JR2 A;  3LPG A;  4AG4 A;  3CQO A;  1W8O A;  2VMD A;  1GMM A;  4QX1 A;  1JYV A;  1L7Q A;  1UWW A;  3T0A A;  1JI6 A;  3CKH A;  2W47 A;  4E8C A;  3LQC A;  3OGV A;  2X10 A;  5EJZ B;  1YQ2 A;  3IAQ A;  1WCQ A;  3VDC A;  5EJ1 B;  4DUV A;  1JZ5 A;  5FUI A;  3ACF A;  1F4H A;  1OH4 A;  3OGR A;  4LPL A;  4UI9 L;  5A1A A;  4M4P A;  3P1I A;  4MGS A;  3K4D A;  1W9T A;  3WNL A;  3T2P A;  4JX0 A;  4CUC A;  3A7Q A;  4MGQ A;  2E31 A;  4CVU A;  5C7G A;  4OMC A;  4TXW A;  3GGL A;  4QX0 A;  5CZK A;  3OG2 A;  3WF3 A;  2DCK A;  4BJ0 A;  2WAB A;  2W92 A;  3FHA A;  3CDZ B;  1UY0 A;  5CYY A;  2EIE A;  2QQI A;  2BBA A;  2QQK A;  3ABZ A;  3HJR A;  1O8S A;  4KMQ A;  5HXM A;  2ZEX A;  4GWI A;  1UY2 A;  4BXS V;  2VZR A;  2VZ3 A;  5JMO A;  4RN5 A;  1W9S A;  3SEE A;  3DYM A;  4ZXE A;  5JXI A;  2EIB A;  2Y6L A;  1GOG A;  2VMF A;  3HPN A;  3VD3 A;  2VCB A;  4HG6 B;  1PMJ X;  3A23 A;  2E32 A;  3I3D A;  3VD5 A;  2RVA A;  5G05 L;  3I2J A;  2YFU A;  2JKX A;  1IQD C;  1CX1 A;  1US2 A;  1JZ3 A;  1UY3 A;  3IAP A;  4P5Y A;  2VL4 A;  2JD9 A;  4CUA A;  1UMI A;  1OF3 A;  2RV9 A;  3UET A;  3CMG A;  3HNM A;  4A6O A;  5I0D A;  3U37 A;  3IDA A;  2XON A;  3NJX A;  3A22 A;  2ZEW A;  4XUQ A;  2VJX A;  5LCW L;  4DXS A;  4W50 A;  3CZU A;  3NNG A;  2VZU A;  3WNN A;  3I2I A;  3MO4 A;  3CIH A;  2QBX A;  5DQ0 A;  1UXX X;  2YG0 A;  1J83 A;  3LPF A;  3W5N A;  5DN2 A;  2Z4F A;  3OEB A;  1JYN A;  1NAE A;  2W91 A;  3CZJ A;  4KI5 M;  1JZ4 A;  4MOA A;  4A42 A;  1DLC A;  1I5P A;  2WO1 A;  2WZ8 A;  3GDB A;  1JZ2 A;  4GZ9 A;  1SDD B;  2OKX A;  2J1A A;  3LE0 A;  4XUP A;  3SKV A;  1GUI A;  1SG3 A;  3BN6 A;  5JXH A;  4P02 B;  3K4Z A;  4CU9 A;  4A41 A;  3WSO A;  4P00 B;  3I2F A;  3C7O A;  5B4X A;  4ARX A;  4TTG A;  3OEA A;  3HNY M;  3C7H A;  4XVH A;  2LW8 A;  2X09 A;  4DUX A;  2W5F A;  1LNS A;  3LEG A;  3PUH A;  1CZV A;  4KWU A;  2J1E A;  3MV0 1;  2B9V A;  1EUU A;  2W94 A;  1GOH A;  3SEP A;  1JYX A;  4QB1 A;  2ID4 A;  4DXR A;  3WQB A;  1BHG A;  1UYY A;  2VCA A;  2WYS A;  4LKS A; 
#chains in the Genus database with same CATH topology
 2ET7 A;  3POB A;  1KS5 A;  2Q8C A;  2X5I A;  2Q1M A;  3AXD A;  5HCH A;  1RHI 1;  1QF3 A;  2XOM A;  2VPV A;  5T50 A;  1O3T A;  2MEV 1;  4YZ4 A;  4PI2 A;  1V9U 1;  4AVA A;  5IK4 A;  1HDK A;  5EYY A;  3CHX A;  5E16 A;  4W65 A;  1RUD 2;  3HQU A;  2QTW B;  1CX4 A;  4XIO A;  5HI0 A;  2BEO A;  2KM2 A;  1ULE A;  3J8F 1;  2DCZ A;  2FHR A;  2VMI A;  2Y6H A;  1K5J A;  1R09 2;  2XDV A;  2VC9 A;  3ACH A;  4BME A;  1J3Q A;  4YGE A;  4N8M A;  4JGY A;  4AFB A;  5HV0 A;  2P4E A;  2GME A;  1AYM 2;  2OX0 A;  2EIG A;  4LBQ D;  2VXR A;  1SCR A;  4LO4 B;  2W1W A;  3I8T A;  1MS5 A;  2J7M A;  1OF4 A;  3HEI A;  5LA1 A;  5BNO B;  4W8J A;  2VZO A;  1PO1 3;  3ZR6 A;  1SLI A;  1H8V A;  5IAT A;  3THD A;  2A70 A;  3RZL A;  1ZRC A;  4YW1 A;  5JVV A;  3KM5 A;  4KNC A;  4NHK A;  4UWD A;  5FZC A;  5FZ4 A;  2QE3 A;  5A3W A;  1DLL A;  4CCM A;  2D43 A;  2JG9 C;  3C3V A;  1JTZ X;  4I02 A;  5DDJ 2;  1QJX 1;  2ZXQ A;  2KXL A;  5IAV A;  1OD3 A;  2WNV B;  4E2G A;  4LHK A;  3ZVX A;  4RR3 A;  2J1U A;  2Y26 A;  3V0B B;  1O59 A;  3M7A A;  3SIS A;  1C8M 2;  3T1M A;  2VOK A;  5L7O C;  2VTX A;  4FXG B;  2WFF 1;  3E5X A;  3IT8 A;  5FZO A;  4JHZ A;  3CU7 A;  5D1I A;  1Y3T A;  1AR6 3;  2A3W A;  3MFC A;  3ILR A;  3T1L A;  5HBA A;  4AFC A;  3IPV B;  1AR9 2;  5A6Q A;  2JXA A;  2WWU A;  4OI0 A;  2MEV 3;  5KHJ A;  1TZO A;  1W6N B;  3MW2 A;  1QJZ A;  3HQR A;  5FZB A;  1KGY A;  4D0Q A;  5L7O B;  2VEC A;  3VZL A;  4TYS A;  3M3Q A;  3KVB A;  4AZZ A;  1OLQ A;  1H0B A;  3D0J A;  4DIN B;  1H1M A;  4UW4 A;  2J22 A;  4ET7 A;  1H1A A;  5J48 A;  1PM7 A;  3THC A;  1MZE A;  3AVS A;  4Z92 B;  5LBB A;  3R0R A;  1VBC 3;  4XYX A;  1AL2 1;  1QWR A;  2PHD A;  1CAW B;  1PM4 A;  1LHO A;  2VBB A;  3ZFG A;  4QMA A;  4KG8 A;  1RUO A;  4FOY A;  1O7F A;  1NCR B;  4IEY A;  5JWP A;  2IXC A;  4Q1R A;  4Y5T A;  3GZU C;  4O9E A;  1JS9 A;  3N9L A;  5C70 A;  2NYY A;  2CGN A;  3MIF A;  4TLG A;  5DAB A;  1QJE A;  3K46 A;  3KT7 A;  3NAP C;  2P3Y A;  5T5L A;  4GA9 A;  1VBD 1;  4P9L A;  4LMF A;  1B35 B;  4GIQ A;  4QT6 A;  2E7A A;  2WN2 A;  2D97 A;  3B9C A;  2WC2 A;  2GN7 A;  4ZON A;  3AKR A;  2Q8O A;  4XF9 A;  3KHB A;  4XDP A;  5L73 A;  4F7Z A;  3IDC B;  1RUD 1;  2VO5 A;  4BQ3 A;  4NE9 A;  3T09 A;  1BKZ A;  2KA3 A;  4DXT A;  1O8P A;  1S2B A;  2D44 A;  2PEL A;  3EO6 A;  1QJY 2;  3M3I A;  5FZF A;  5IUQ A;  3SXW A;  3FWE A;  4LR4 A;  5HCB A;  1JU4 A;  2HWF 1;  2JDU A;  1HJF A;  4MV2 A;  3MLK A;  1CAV B;  3ATG A;  4S2D A;  5A7S A;  4LIT A;  3EB7 A;  4Q0U A;  4YVS A;  3KS7 A;  1AR9 3;  4B1L A;  1CIY A;  4Y4R A;  1COV 2;  2E33 A;  3DXU A;  5F9T A;  2VCC A;  3BVC A;  2XJT A;  2WA4 A;  1S0F A;  2C5D A;  3NV4 A;  4X8N A;  3J7N A;  5T5P A;  4ATE A;  4IEV A;  1APN A;  2F6B A;  1J59 A;  3KF3 A;  4R9B A;  4QX8 A;  5BNQ A;  5JXG A;  4FFH A;  5JPM B;  3ETQ A;  4XFG A;  3TN9 2;  5J1X A;  1OA2 A;  4L0P A;  5FMC A;  3IDE A;  2UYB A;  1DDL A;  4WV8 A;  3ZYF A;  2OZJ A;  2CY6 A;  3ZMO A;  1N1S A;  5ACA 1;  1J84 A;  4BDV B;  2VE1 A;  1WZX A;  5JOZ A;  1XNT A;  4PDW B;  3T4H B;  2IVI B;  2V4A A;  3HT1 A;  4QGL A;  4QHB A;  4Y1X A;  1HXS 2;  3MIH A;  2ZAC A;  2IC1 A;  1Z7S 3;  2D93 A;  5IFT A;  4Q8K A;  4B29 A;  1WD3 A;  2D6L X;  3RI8 A;  2YPD A;  1RL3 A;  2DCY A;  1EV1 3;  1W3V A;  3VZM A;  1BEV 3;  2XR4 A;  5A7W B;  5BY5 A;  4E8D A;  2VMH A;  1UU4 A;  1YLL A;  4PDW C;  2J1V A;  4FXK B;  5C71 A;  1NUK A;  2PFW A;  4CDX C;  4RS5 B;  4N53 A;  4OVE A;  3PNA A;  5AVP A;  2CGO A;  4QGN A;  4NRP A;  5D8A C;  3FFQ A;  5F7U A;  5IFP A;  1O3Q A;  3I97 A;  5FYS A;  2A6W A;  1E5R A;  2D5H A;  3NKT A;  5FY4 A;  4CDU C;  1ULP A;  1G9D A;  1AYN 3;  5CFC A;  1H9P A;  3MBW A;  1KS4 A;  2ERF A;  2VZQ A;  3H8U A;  4JGZ A;  4DEQ A;  4XCA A;  2VOW A;  4FOQ A;  5IWF A;  1NA1 A;  4A4A A;  4XTM A;  1LR5 A;  4KQ7 A;  1RJ8 A;  1W04 A;  3SCG A;  3V64 A;  3RZM A;  4GB3 3;  4CEW A;  5FKC A;  4H55 A;  1PK6 A;  4QKD A;  2VNV A;  4LE3 A;  3MGU A;  4AHZ A;  3BPS A;  4OHX A;  1CZT A;  4EN8 B;  1VIW B;  5DUV A;  2JEN A;  5F5C A;  1QJY 1;  3III A;  2HKX A;  5I8S A;  2Y38 A;  4COW A;  2W9X A;  2YYO A;  1OKQ A;  1J3P A;  1TME 2;  1W9Y A;  2QQU A;  1Y9M A;  2RJL A;  3ACI A;  4MVT A;  5EWS A;  3ECQ A;  3WQ1 A;  4CP2 A;  5ABJ C;  5CAD A;  1SBD A;  3OD4 A;  1DG6 A;  3POG A;  3LEI A;  4H14 A;  5FLI A;  3LZZ A;  2NN8 A;  3MLL A;  1DF0 A;  2HWE 1;  2XB6 C;  4FI9 A;  1RUJ 2;  1YCI A;  1AUY A;  1UZY A;  3BU7 A;  2IFW A;  5FZM A;  4X6R B;  5AC9 2;  4CP9 A;  3VBS C;  2XG3 A;  3K51 A;  3VBF A;  2YDE A;  1CN1 A;  5C5T A;  5JSR A;  3VBH A;  5FQ0 A;  1ZBE 2;  1JZ6 A;  3IN9 A;  1ENX A;  2AH2 A;  2BVV A;  2QFE A;  2WQZ C;  1OLR A;  2AEY A;  3AP7 A;  1UZV A;  1SAC A;  3PJY A;  4C0B A;  3TN9 3;  4CXY A;  2XJR A;  1DCS A;  2IXJ A;  1ZA4 A;  1T6B X;  3RVH A;  1YQ6 A;  2F4P A;  4Y26 A;  1B35 A;  1ND2 B;  5LY1 A;  5FZE A;  2OUH A;  4Y1U A;  3TYJ A;  5LA9 A;  1QEX A;  4CPB A;  4Q4X 2;  3O1M A;  3R05 A;  5J37 A;  1FAT A;  4BOW A;  2W95 A;  2ADE A;  1HXS 3;  1ZA7 A;  5I0S A;  5GKA C;  1XU2 A;  2VR4 A;  1VAV A;  1AJO A;  2A7A A;  2VBP A;  4GH4 B;  4XW3 A;  4GB3 2;  4R9C A;  5GLV A;  1LGB A;  1C4R A;  1POQ A;  2BER A;  2E26 A;  1LU2 A;  2I07 B;  3ZXF A;  2A3Y A;  5LWB A;  4IEU A;  1XBF A;  2DDU A;  2QNK A;  2LTN A;  2PLV 3;  3A4U A;  3CJI C;  4XUR A;  2QQW A;  4YGB A;  5FPU A;  3L2H A;  1YO8 A;  4CTE A;  1UY1 A;  4CDW B;  2IXK A;  1ZYB A;  5C9A C;  2B9U A;  1KDK A;  1Q43 A;  5K4L A;  2VUL A;  3EYP A;  3VZN A;  3WIN E;  1G86 A;  1V6J A;  3B94 A;  4ERO A;  4K3U A;  3U4X A;  2H6B A;  1XE0 A;  1W0N A;  4AE2 A;  1MZ5 A;  4A44 A;  2ZZJ A;  1YFX A;  1ZBA 3;  2VQU A;  4W4Z A;  2BUK A;  1AR7 3;  5BNN A;  5E8A A;  3WF0 A;  2WZR 1;  2ARE A;  1IS4 A;  2DUR A;  3AX4 A;  5LBF A;  4GAZ A;  1TE1 B;  3LSE A;  3POY A;  2ENR A;  3MUZ 1;  2R0F A;  2WO7 A;  2Z5W A;  4WM7 A;  4QB2 A;  4RGA A;  3WF4 A;  4BQX A;  4TZD A;  2WII B;  4LUL A;  3KV9 A;  1AF9 A;  4A3X A;  1IPJ A;  2XBO 1;  4IDZ A;  3VKO A;  2YC2 A;  4FT8 A;  3QH6 A;  4BB3 A;  2ZAH A;  2DWR A;  4YNI A;  4YZ5 A;  2XQR A;  3PLQ A;  2SLI A;  2BRT A;  3ILF A;  4LHS A;  3WUD A;  4OI1 A;  5FZK A;  4Q4V 3;  1EYB A;  1OH3 A;  1X50 A;  3J8F 3;  4MH0 E;  3VBO A;  1N1T A;  5FK8 A;  5GLW A;  1C57 A;  3ZXG A;  4L92 A;  3MDP A;  1RUJ 3;  2WNU C;  3ZO0 B;  1ULG A;  4QQL A;  4ZU7 A;  3AK0 A;  2XLA A;  2AYH A;  5J7M A;  4CEY B;  2A6V A;  4WVZ A;  4NHY A;  5DG1 A;  3N7L A;  3VKN A;  4J6G A;  4HFS A;  4E4S A;  1COV 3;  4AF9 A;  2YC0 A;  1PHM A;  4A6S A;  4Q26 A;  1RUG 2;  5FUI A;  4FAG A;  1F4H A;  1OH4 A;  1C8M 3;  2XL7 A;  3OGR A;  4YW3 A;  3VKM A;  2PLV 2;  5AVA A;  4BIS A;  1ND2 C;  3OOX A;  4ASK A;  1X36 A;  4GMP 3;  3P1I A;  2OZ6 A;  4J25 A;  3HWJ A;  3QH7 A;  4EYU A;  2BU9 A;  1RUC 3;  4XIK A;  2GN3 A;  1H30 A;  4KL1 A;  3OY8 B;  1F2N A;  5F32 A;  2VVD A;  1G8W A;  4TXW A;  1SEF A;  3VHO A;  1RUE 2;  2JB4 A;  2DTY A;  3NVC A;  2G19 A;  4FPC A;  4QX0 A;  5ERL A;  5FYH A;  5C9A B;  5KHH A;  2DCT A;  3WG3 A;  1N3O A;  2I74 A;  3GBG A;  3PIG A;  4ORF A;  5EV7 A;  4QXB A;  2DCK A;  3WT3 A;  3VBR C;  2BNO A;  2XJS A;  2JDY A;  3I59 A;  3BKZ A;  1DQ0 A;  2EIE A;  2ZX1 A;  2FCU A;  2N7G A;  1CR7 A;  1JBC A;  3B3Q E;  3FX3 A;  1NCQ A;  1CQ9 A;  2PMW B;  4N43 B;  2JG8 B;  5A7O A;  1OD5 A;  4CP9 B;  2UU8 A;  2XBO 3;  2AZ5 A;  3KMH A;  4GWI A;  2ZAA A;  3ZSK A;  3R4D B;  1VAL A;  2VZR A;  1R1Z A;  3GF6 A;  4U2A A;  3AP5 A;  4IE6 A;  3QOP A;  5FQ0 B;  4DZG A;  5JMO A;  1GNZ A;  3NNL A;  4Q4V 2;  1HRV 2;  3ZDS A;  5K0U B;  3M2M A;  1FV2 A;  2WNV A;  2JE7 A;  5APA A;  1FMD 3;  4WVM A;  2XUM A;  4UW3 A;  4HN0 A;  2Y6L A;  1PGS A;  5FZ6 A;  5K9Y A;  3HPN A;  1S4C A;  1GQH A;  1UOG A;  2YPJ A;  1LUL A;  3CJI A;  1PMJ X;  3WP4 A;  4BQ5 A;  4I3P A;  2JDZ A;  3A23 A;  4RQP C;  1XE7 A;  2G1M A;  2YRO A;  4PI0 A;  2BDR A;  3PUA A;  4FQZ A;  1I3H A;  2OXB A;  2PHL A;  5HV4 A;  1WMD A;  2JKX A;  1IQD C;  3WW4 A;  1JOP A;  3U4S A;  4UW6 A;  4D6S A;  4P5Y A;  5CAZ A;  3NNF A;  2VL4 A;  3AMQ A;  3ME2 A;  2ZX3 A;  3FLP A;  3VGI A;  1SLL A;  4R9D A;  2P3I A;  1OF3 A;  2X29 A;  2RV9 A;  4EJR A;  4YW5 A;  2PN5 A;  1QMJ A;  2NMN A;  1DGR N;  4LA2 A;  4SLI A;  3DV8 A;  5I0D A;  2CAV A;  2CL2 A;  2GMP A;  3ENR A;  3GJB A;  1UPI A;  3IDA A;  3SCF A;  5A33 A;  3M70 A;  1OI6 A;  3NJX A;  3A22 A;  5EP9 A;  2ZEW A;  2W0X A;  4XUQ A;  4FPJ A;  3ZN5 A;  4MHR A;  3IMM A;  2JEC A;  3V65 A;  2CTV A;  1QJU 2;  4W50 A;  1YYN A;  5IT6 A;  4OUS A;  3TEY A;  4PHZ A;  1M4W A;  1NQD A;  1X9T A;  1S0D A;  2VZU A;  3MW4 A;  3WNN A;  5L19 A;  2SBA A;  5FJH A;  2EXJ A;  3WHT A;  2ZGO A;  1HV1 A;  3FFZ A;  3VBS A;  4DRR A;  1AR8 1;  2Z2S B;  1J83 A;  2E9Q A;  4YG0 A;  2UWA A;  4XF4 A;  4NID A;  4QPI A;  2XPJ A;  2JIJ A;  3W5N A;  1EP0 A;  2XJU A;  4LBQ A;  3OEB A;  3PIJ A;  2GAU A;  2RR1 2;  2W91 A;  3CZJ A;  1VRH 1;  3WV6 A;  1JYN A;  1GZT A;  1DLC A;  2XHK A;  2WO1 A;  1E57 A;  4M0H A;  5D8A B;  5JSO A;  2UYA A;  2RS5 3;  4YVW A;  2P5B A;  4W6Y A;  4B8E A;  1J58 A;  5F5I A;  4AI8 A;  1KQR A;  5KXB A;  4OQ8 A;  3ES4 A;  3VBO B;  5I0U A;  1VRH 2;  3JB8 A;  3O7O A;  1LHV A;  1GUI A;  2FZ1 A;  1IOA A;  1SG3 A;  2QCS B;  5L9V A;  1BXH A;  3ORJ A;  3R4S A;  4IXL A;  4GJY A;  3O14 A;  2Y33 A;  2QZ2 A;  1SLC A;  4CEW C;  4P00 B;  3MYX A;  3B00 A;  3DN7 A;  3UT0 A;  5I93 A;  2GNB A;  2WFF 2;  1BBT 1;  2E7Q A;  4QU1 A;  2XJV A;  5FP9 A;  3OGG A;  3ZFF B;  1RUF 1;  4C90 A;  1VPH A;  1XNC A;  4NPM A;  4NUB A;  4CDQ A;  5C3P A;  4S2F A;  3DCQ A;  4LIU A;  5FYC A;  4BQ4 A;  4KWU A;  3SLI A;  1D4M 2;  4KBB A;  3WDV A;  2R1B A;  5C8C C;  2R04 2;  2WNE A;  2JKB A;  2RS1 3;  1EY2 A;  3HVD A;  1EUU A;  1SFN A;  2P3K A;  3URF A;  1PGW 2;  4K7J A;  1ZRF A;  3Q8E A;  2FD8 A;  4CDX A;  3SEP A;  1JYX A;  3KZ4 C;  1A8M A;  2RDR A;  5LK5 A;  4NIH A;  3OY8 A;  1AHS A;  1V6N A;  1LOF C;  4DXR A;  1NCR C;  2RS3 1;  1BHG A;  2XXZ A;  5DUW A;  4AI0 A;  2WYF A;  3O12 A;  2QQP A;  1URX A;  4PQ9 A;  2Y34 A;  2NLR A;  4CDW C;  4LLF A;  3W20 A;  3JBG 1;  1BEV 1;  2PA7 A;  2PHU A;  1W99 A;  1OUX A;  2ZEZ A;  3T0B A;  1JZ8 A;  3BCW A;  1H2N A;  4CCJ A;  4JCK A;  3FMG A;  2B46 X;  2YBS A;  1IG0 A;  3I2H A;  3RG0 A;  2ORZ A;  2MEV 2;  1GR3 A;  1V9U 2;  4DXZ A;  1VBB 1;  1POV 0;  2KD7 A;  4Q0P A;  1NX9 A;  5JMC A;  1ZRI A;  1VP6 A;  2Q1F A;  1CON A;  2OQ6 A;  4YZ3 A;  1DZT A;  1GU3 A;  1ZVF A;  4CCL A;  5I8T A;  4EE2 A;  3GM8 A;  3AZZ A;  1UY4 A;  2XHN A;  1AXZ A;  4IEX A;  1RHI 3;  3B01 A;  3B02 A;  1UXZ A;  2B8M A;  3APB A;  4HKW A;  2J1R A;  2E7T A;  1QNW A;  3UGF A;  4NVP A;  2XVK A;  5A3L A;  3R4U A;  5DAQ A;  1O5L A;  3VV1 A;  5IVY A;  2Q30 A;  2VMG A;  2VUA A;  1QJF A;  3V0A A;  1PX3 A;  5GM0 A;  4P9J A;  4IGO A;  5FTT C;  4IV1 B;  1L7L A;  4I2O A;  4IUG A;  5DAW A;  4EZH A;  3FLT A;  4JQT A;  4LA3 A;  4KH9 A;  1QJY 3;  4MO3 M;  2V73 A;  1V6L A;  1ENQ A;  2V5Y A;  4Q4Y 2;  4HK8 A;  2ZML A;  3ZYP A;  5IK7 A;  1VR3 A;  1DFQ A;  3BTA A;  2Q8D A;  5FOJ B;  4FOV A;  2D6P A;  2HWB 3;  3AJY A;  5EJ3 A;  2DYC A;  3W21 A;  1I1E A;  3J7L A;  2W52 A;  3LA7 A;  5LK7 B;  4QGM A;  2FQP A;  2VZT A;  2GZW A;  1CZS A;  3CL1 A;  2BGP A;  4XUO A;  5ABJ B;  1CIW A;  1Q56 A;  4BK5 A;  5FPZ A;  5A33 B;  2Y64 A;  5T5O A;  2ZEY A;  4MG2 A;  2O8Q A;  4ZU5 A;  4FTS A;  2RMU 1;  1GZW B;  1PX4 A;  2GAL A;  3T3Y A;  1F8V A;  1D4V B;  4P9G A;  3SKJ E;  2YU2 A;  4AEJ A;  3H50 A;  4C0H A;  3P3N A;  4NPR A;  1SHW B;  1UKG A;  1COV 1;  3H8X A;  4JKL A;  3VDD A;  4IES A;  4Q4V 1;  5E88 A;  3GAL A;  2NPI A;  3ZFG C;  3IBM A;  2ZCW A;  3PHM A;  5LA2 A;  1GAN A;  2C9A A;  3JU9 A;  3EQE A;  5B4N A;  5GLZ A;  5A3M A;  1RTV A;  1NE6 A;  3VZK A;  2G9F A;  2VW2 A;  2GND A;  3M3O A;  5C3Q A;  5FUN A;  1OQD A;  5EXO A;  4MXW A;  1MS3 A;  4TN7 A;  1BEV 2;  1GWM A;  1UZ0 A;  5BUV A;  4RHV 2;  3KCC A;  2X5I B;  2JE8 A;  4RGG A;  2A1X A;  5J3U A;  3AXE A;  3WOG A;  1NZC A;  4ONU A;  4CUB A;  4W6W A;  4Q4W 2;  3HAG A;  5GAL A;  1H4H A;  4XHX A;  3AFK A;  3ZXD A;  2PAM A;  4IET A;  1PO2 2;  3S7I A;  5FP7 A;  1DGR A;  4Y4Y A;  5J09 A;  3E5Q A;  5CIR A;  1Z78 A;  1DGL A;  5FBJ A;  3LFI A;  3HBK A;  3WEZ A;  4XIL A;  4DNY A;  3ZSL A;  5IHR A;  2GC1 A;  1HN0 A;  1PMI A;  3PL0 A;  3PVO A;  1RMU 1;  3H7Y A;  4RFT 0;  2EXI A;  5T52 A;  2JDA A;  2RS1 1;  2JIC A;  4JHT A;  2ZS6 B;  4D7S A;  4GKX A;  1JZ7 A;  1CJP A;  4PIX A;  3ZMN A;  1XND A;  4E4D X;  4IEQ A;  3KV4 A;  4LBK A;  3NL1 A;  4IV3 A;  1S0I A;  2VH9 A;  2RS5 1;  4NPL A;  1IHM A;  4M01 A;  5T3N A;  4I0B A;  4JC1 A;  4COV A;  3ZM8 A;  3RDI A;  1X8M A;  3VBU B;  2ETE A;  4PLN A;  4YRD A;  4EN7 B;  5DAV A;  4OCT A;  1RXG A;  5LEJ A;  3O0X A;  3H8O A;  3T4V A;  4QX5 A;  1MQT B;  4FBF A;  3DYP A;  3LA2 A;  5J98 B;  5BNP B;  2J42 A;  2CWS A;  3NRU A;  4FP3 A;  3W59 A;  2VZV A;  2ZGR A;  2F4L A;  4QPG B;  1AL0 G;  2ZJC A;  5FZA A;  4D7Y A;  2ZAB A;  2D3S A;  4ZZ8 A;  5KWR A;  3VBU C;  4KWK A;  5LEK A;  1H2K A;  4FCA A;  4CCK A;  1WWY A;  3E97 A;  2W1Q A;  5F2S A;  3ZOI A;  5BPX A;  4AI2 A;  1BYH A;  3CF6 E;  4Z2W A;  1ALY A;  4RYD A;  4YZ2 A;  2CHH A;  1F5F A;  1HQW A;  2AR6 A;  4M3C E;  2BWA A;  1IKP A;  1FMD 2;  4B1M A;  1W9W A;  2D5F A;  2HWE 3;  3NV2 A;  1VRB A;  5EYX A;  1RUF 2;  4O9G A;  1S0E A;  4I01 A;  4ISR A;  3WNX A;  1C5I A;  1RUG 3;  4NJ4 A;  1Y9G A;  3NAP B;  3DXT A;  1J3R A;  3E1F 1;  3K77 A;  2LM3 A;  2VUD A;  2ZGU A;  1L7R A;  3S7E A;  2QDN A;  4BZ4 A;  2BPA 2;  1H4G A;  1RUH 1;  4CU8 A;  3DPR C;  3NNJ A;  4XJW A;  4YPJ A;  3LB9 A;  1MEC 1;  4I09 A;  2PHX A;  3WP6 A;  3TWI A;  1UMH A;  1PVC 2;  3D5O A;  4BWO A;  2A6X A;  1UCX A;  3EHK A;  4I0A A;  2VQA A;  2ZKL A;  2GP3 A;  4DQA A;  3I59 B;  4TSV A;  1ZBA 1;  2AGS A;  2XH6 A;  1LES A;  2Y6J A;  4V2W A;  3GNE A;  3ZKY A;  2WDB A;  3EBR A;  2FZ2 A;  3NV3 A;  4OHZ A;  3WG2 A;  4OZO A;  5D2A A;  4QB6 A;  3JD7 1;  5FY0 A;  1UYX A;  4D69 A;  4P08 A;  2IXL A;  3E6B A;  1YC6 1;  1ZM1 A;  2CAU A;  1GZW A;  3I49 A;  5K0U C;  3H3L A;  3UGG A;  1ZRR A;  3AJZ A;  1RUI 3;  2UUR A;  2WBK A;  3JXS A;  2C0Z A;  2HH9 A;  1RC6 A;  4ZZ5 A;  1Q8O A;  3N36 A;  4P9W A;  4M4R A;  2ATF A;  1AL2 3;  5EHD A;  3J7H A;  3KWV A;  3S30 A;  4ES8 A;  2JG9 B;  4IER A;  1LOD A;  2CDP A;  2P6C A;  3U78 A;  4LUK A;  4AXO A;  4RL7 A;  2HWE 2;  1RB8 G;  1XOY A;  2ARB A;  4NN0 A;  1VJ2 A;  3MV1 1;  1R09 1;  1JOD A;  2V72 A;  2BJS A;  2DVB A;  1Y43 B;  5FZ9 A;  3VD4 A;  4P9X A;  2V4V A;  4J1W A;  1QXP A;  2PHT A;  3AZY A;  2CU5 A;  5A6Y A;  4ISQ A;  5JXJ A;  3AYA A;  3O5S A;  1GV9 A;  1C1L A;  2R6Q A;  4P9I A;  4YW7 A;  3WCS A;  1EV1 2;  1TG7 A;  1YI7 A;  4V1P A;  2TEP A;  3RZZ A;  4CP0 A;  1VMF A;  3IIA A;  5G04 L;  2YU1 A;  2GDF A;  4QD2 A;  2O14 A;  2ZHL A;  1OKO A;  2IXH A;  1LOF A;  4GQ7 A;  4L11 A;  4YFZ A;  1FPN 2;  1XB9 A;  1A34 A;  1L3J A;  1R1A 2;  2FDG A;  5C8W A;  4XUT A;  1YUD A;  4XF1 A;  5A7P A;  3ACG A;  2K0G A;  3AKT A;  3G7D A;  4IE7 A;  2QQN A;  3ROU A;  5A3U A;  2ZHN A;  5ACA 3;  1X33 A;  3U14 A;  2XWJ B;  1IQA A;  4UAP A;  3OYW B;  3T2Q A;  2WAA A;  2JD4 A;  4XFC A;  2W39 A;  4LHL A;  1UIK A;  3N9P A;  2G9Z A;  5LB6 A;  4YM2 A;  1HB2 A;  4LBQ B;  4R52 A;  5FYY A;  2D6N A;  2IXI A;  1V6I A;  2Q1Z B;  2R16 A;  2VGD A;  2WZP P;  1LAJ A;  3GCW A;  4BQY A;  5FP4 A;  3WDT A;  4IGQ A;  5FLH A;  3LCP A;  4AVV A;  2YZ4 A;  4P5H A;  1OA4 A;  1UZZ A;  2QJV A;  4XQD A;  1W6M B;  3U10 A;  1LOA A;  1S0C A;  2P6H A;  3NJZ A;  4FFG A;  1J1L A;  1HIX A;  2VM9 A;  5CFC B;  5FO8 B;  1QOS A;  2XBO 2;  5CKM A;  5HCF A;  2DF7 A;  1A6C A;  4XET A;  2X8K A;  5CKQ A;  4YVW C;  3USU A;  4YAR A;  3D3A A;  3P6B A;  5ISL A;  5JOW A;  4Q27 A;  1TMF 3;  2QQJ A;  4A7Y A;  5LRS A;  4Q4W 3;  2PAE A;  1JN2 P;  1K3I A;  4CCD A;  2JJ6 A;  4PLO A;  1HB3 A;  4Z2A A;  2YFZ A;  4Y24 A;  4CDQ B;  3GZA A;  1D7P M;  1K5M C;  1RUI 1;  4JGY B;  1LRH A;  1AR7 1;  1JYW A;  3HIF A;  4YM1 A;  1ODM A;  3M8L A;  4Y1V A;  4UXA A;  1BJQ A;  3F95 A;  3ZSJ A;  4AAP A;  4XQW A;  5FAX A;  1W8O A;  2VMD A;  2ARC A;  4XDO A;  4XFA A;  4BQ1 A;  1OVP A;  3AFG A;  3RS6 A;  1N3Q A;  3N9O A;  4NHX A;  1GMM A;  3ALQ A;  3WUC A;  4HSJ A;  1JYV A;  3T0A A;  3WD5 A;  1GWL A;  1OA3 A;  2DTW A;  1OOP A;  4N90 A;  3VBF B;  1C3H A;  4E8C A;  1RUD 3;  1FOD 1;  1IGO A;  4WZF A;  2Y6F A;  4UBH A;  3MZH A;  3N7M A;  4YG6 A;  1PZ8 A;  5EJ1 B;  4DUV A;  1PVC 1;  4RGK A;  5FYI A;  3BI3 A;  2BFU L;  3B7M A;  4N7I A;  3ACF A;  3VL9 A;  4UFH A;  1LOE A;  4LHN A;  3WR0 A;  2K46 A;  3C2U A;  1D2Q A;  1QQP 1;  1XRU A;  3KHC A;  1G9F A;  1KDM A;  5DXD A;  2WS9 3;  1W9T A;  3WNL A;  2E6V A;  2VOX A;  4JX0 A;  2R06 2;  3E6C C;  2NM1 A;  3A7Q A;  4KWJ A;  5EPA A;  3AL6 A;  4CE8 A;  4RQP A;  5FJK A;  4GUL A;  2QDR A;  1RUH 2;  4XAC A;  1SPP B;  2GNT A;  1QIQ A;  1ULD A;  3BYW A;  3NWK A;  5F2W A;  4CUG A;  3SCH A;  3ZXL A;  2ZX4 A;  2OQ7 A;  4K20 A;  4QXK A;  4GXL A;  1WW5 A;  1U5I A;  2W92 A;  3FHA A;  2B45 X;  2VW1 A;  2ZOE B;  3CDZ B;  5CYY A;  3PU3 A;  4HOO A;  1YFY A;  2QQI A;  2BBA A;  1U5X A;  2QQK A;  4YW2 A;  3HJR A;  3ZXK A;  2OPK A;  5C3S A;  1NLS A;  5HXM A;  2ZEX A;  3CJX A;  3KVA A;  1NCQ C;  1WMX A;  1X7N A;  4HXC A;  4L99 A;  5IK5 A;  1H8T B;  4P9Y A;  3K3O A;  1W9S A;  4UBG A;  5IW0 A;  3SEE A;  3RNS A;  3LSD A;  2HWB 2;  3QCW A;  4HON A;  3DYM A;  3VBR A;  5IVV A;  5L36 A;  3WW2 A;  4ZXE A;  1HRI 3;  1LOG A;  4I30 A;  3ZPO A;  5J96 B;  3NO8 A;  2EIB A;  3EMR A;  5FFO C;  2Q0A A;  1D2S A;  3DF0 A;  1CES A;  1PIV 1;  2WSU A;  4B7K A;  2Q8E A;  1YIP A;  1BK1 A;  3CO2 A;  3KGL A;  2YUE A;  2ZMN A;  4GMP 0;  5FWE A;  3WDU A;  4C1X A;  2RS1 2;  2RVA A;  3FHI B;  5F3E A;  2YFU A;  1SZB A;  1W6N A;  2XGX A;  4MXV A;  4XMI A;  1ZZ7 A;  5FXV A;  2YGM A;  1OSG A;  1DQ4 A;  1ZBE 1;  3AZV A;  3AYE A;  1BCX A;  1UMI A;  1POV 3;  1LGN A;  1OQ1 A;  3AKS A;  1LCL A;  3HNM A;  4BIO A;  5AC9 1;  1IS5 A;  2A6Z A;  3VKF C;  1HV0 A;  1V00 A;  4LBL A;  2P1B A;  3LGR A;  4QQO A;  1BK0 A;  1BVV A;  4CDW A;  4M3C F;  3ZYG A;  1GNH A;  4JTN A;  4XBQ A;  1W8H A;  1GP4 A;  4HSL A;  4DXS A;  4AI9 A;  3BIE A;  3VBO C;  1YQ5 A;  4WM8 A;  1Q5O A;  1TME 1;  1YIF A;  1FI2 A;  4SBV A;  2LUW A;  1CVN A;  1JXN A;  4GJZ A;  3I2I A;  3KV6 A;  1ZRD A;  2A71 A;  1S2K A;  4Q4X 3;  1MQT C;  2QBX A;  5FPL A;  1UXX X;  5C8C A;  3N9M A;  4XPV A;  2O8O A;  3B93 A;  4Q2F A;  3ZFE C;  1GP5 A;  5EFU A;  5GZG A;  2JX9 A;  3RWK X;  1MAC A;  1KRI A;  1YJK A;  3UKN A;  2GC0 A;  2MPF A;  4KI5 M;  4AVT A;  1AR7 2;  2ARA A;  3W9A A;  4Q0V A;  4GWN A;  1I5P A;  1E5S A;  1LKN A;  2WZ8 A;  4OI4 A;  2TUN A;  2HWF 3;  4IV3 B;  3JZV A;  4QQ2 A;  2WNU B;  2YBK A;  1SDD B;  1YFW A;  4XOG A;  4MLO A;  4LKE A;  4PBO A;  2X53 S;  5A7W A;  1A78 A;  3WLU A;  4ZKT B;  2Y0I A;  1WD4 A;  4BLJ A;  4M0N A;  4HET A;  2D6O X;  4N53 B;  3K4Z A;  1TNR A;  3PME A;  2XML A;  4W6X A;  1E5I A;  4A41 A;  3I2F A;  4BPZ A;  1RXF A;  3C7O A;  3MIE A;  5B4X A;  2CNA A;  1QH7 A;  3H1M A;  5F6K A;  5FZL A;  4DO0 A;  4WVV A;  1CAU B;  1NOV A;  2JEM A;  3C7H A;  3HNY M;  1NY7 1;  2LW8 A;  3OEA A;  4JRA A;  4XVH A;  5I0R A;  4DUX A;  3OD0 A;  1W8U A;  1UPS A;  4QPI C;  2HWC 1;  1BMV 2;  1CZV A;  1GBG A;  2DU1 A;  4XJ8 A;  3WXP A;  2NQY A;  3BUC A;  1TQ5 A;  3LF7 A;  3Q8A A;  3LOB A;  2W94 A;  2I45 A;  4FPH A;  4HL0 A;  1UNB A;  4QM9 A;  1TEI A;  1VBD 2;  1Q8P A;  3D4K A;  2JDH A;  4LO6 B;  4QB1 A;  4RQP B;  2WT2 A;  3B69 A;  2QUO A;  5LBC A;  5JZG C;  1SPP A;  1CAW A;  3D0S A;  1UYY A;  1V6O A;  1XNB A;  2VCA A;  1VLN A;  1QKQ A;  3J9S A;  5J36 A;  1OMI A;  1HQL A;  5JZG A;  4PF5 A;  4QM8 A;  3MEP A;  4CSW A;  1IS3 A;  3WDW A;  2PHW A;  3QAC A;  4QDQ A;  1WLC A;  3AC0 A;  1XNA A;  4N9I A;  4D7T A;  1BLZ A;  4OMD A;  3GHM A;  1NCQ B;  1WBF A;  3VBF C;  1IPK A;  1LOC A;  2DUQ A;  4K1Y A;  4LO8 A;  3CEW A;  3POJ A;  4OHW A;  5F5Q A;  4YGC A;  1PNF A;  3MI8 A;  2DVG A;  1BBT 3;  1DBN A;  1UAI A;  2QKD A;  3OCP A;  3WHU A;  4F83 A;  3H0O A;  3I2D A;  1QDC A;  1Y7B A;  1T2X A;  3ZYJ B;  1Z0H A;  1RVF 2;  3AMM A;  3OPZ A;  1HN1 A;  3VBR B;  4D8M A;  5A1L A;  4AI1 A;  3RZK A;  1DYO A;  3ZDV A;  1QXJ A;  3BTZ A;  4RHV 3;  2DBN A;  3IM0 A;  2W1S A;  3ZPY A;  2WNV C;  3TB0 A;  2DVA A;  2BOJ A;  2PQQ A;  1I9R A;  3KGZ A;  3NJV A;  2R04 1;  3NQH A;  4BMB A;  4ARY A;  4QHO A;  2VVF A;  2WZR 3;  3MPP G;  1PK6 C;  2JB8 A;  1N1Y A;  4PIY A;  5DDJ 1;  4F8A A;  5A70 A;  3K4A A;  2AEZ A;  2ZGP A;  3NV1 A;  5H9R A;  4D6Q A;  5AFB A;  1XXN A;  3N9Q A;  4XAB A;  1G9A A;  2XQX A;  4AQT A;  3GZE A;  2PHR A;  1PIV 2;  5IJR A;  3O1R A;  1W2A X;  4F3J A;  2BBV A;  2G9G A;  2CDO A;  1VBB 2;  4CDU A;  3PUI A;  5FO9 B;  1PMH X;  4GAL A;  1UKR A;  1AL2 2;  2BGC A;  3ZFE A;  5JUV A;  3RZH A;  3I7D A;  3LIH A;  4Y20 A;  1BBT 2;  2BP6 A;  4AGR A;  1GSL A;  4KGQ A;  4QX2 A;  4Q0S A;  4N53 C;  4DB5 A;  4L8Q A;  4PDW A;  1UQX A;  2RDS A;  4WM8 C;  3ZFF A;  3POI A;  4HPK B;  3WY6 A;  1TVG A;  3MIG A;  4QPY A;  1RIN A;  4EQV A;  5JSP A;  2P37 A;  5FYT A;  4AEK A;  4MGZ E;  2VOV A;  2VQT A;  3OB8 A;  3EJK A;  2Z42 A;  2C26 A;  2VMC A;  3SQO A;  3KCX A;  3VDB A;  3S5A A;  1OUR A;  4XBL A;  5FPB A;  1K12 A;  2HBU A;  3M1H A;  1LEC A;  1WCK A;  1O4T A;  3ZYR A;  4LNV A;  5FRA A;  3D6E A;  3KLS A;  1R1A 3;  1PO1 2;  1DYK A;  4NHL A;  4DUW A;  5JLV A;  2EID A;  2W87 A;  5FXX A;  4QQP A;  1RHI 2;  3RJR A;  2P34 A;  1UX7 A;  5JOY A;  2WNU A;  4S2G A;  3TRS B;  3BTX A;  4IQP A;  2R7E B;  4A7Z A;  2DCJ A;  4CCE A;  1LHU A;  1OPM A;  3TAY A;  1GQG A;  4ATF A;  1HX6 A;  4BLI A;  1KJL A;  2VZS A;  4IEO A;  5LZ6 A;  3W58 A;  3NJY A;  3O0V A;  3NMB A;  1M06 G;  2BW8 A;  1KFU L;  2WZE A;  4COY A;  3N7K A;  2ZGK A;  4JDM A;  2PHF A;  2WSV A;  3QD6 A;  5FMB A;  3U0Z A;  1U5Z A;  4LIV A;  4FVV A;  3OBA A;  1BMV 1;  1QU0 A;  3WNP A;  5FXZ A;  4FO9 A;  3DEC A;  3OGS A;  3ZN4 A;  2WO2 A;  1UOB A;  4GWM A;  1YRZ A;  4WM7 C;  3S5Q A;  4DPN A;  5FZG A;  2NP0 A;  1G6N A;  2XVG A;  4KU8 A;  4BU2 A;  1PGL 1;  1YNA A;  4ZY9 A;  4JV4 A;  1VMH A;  3BOP A;  5BNN C;  2HEW F;  1ND3 B;  1YQC A;  1U12 A;  1SFP A;  2VY0 A;  3RJ2 X;  5BNO A;  2RS5 2;  5CNA A;  2HWD 1;  4DFS A;  1WUV A;  3OUJ A;  2DUP A;  1EAH 1;  1SQ4 A;  5FPA A;  3RZG A;  3ZIX A;  4AFA A;  3HNB M;  1H6X A;  4PBP A;  4E9K A;  4CDU B;  5C5U A;  3T08 A;  5JZG B;  1V6K A;  1CJD A;  1N3P A;  1ONA A;  3DKW A;  3AP9 A;  4CU6 A;  3A0N A;  3FBY A;  4AVS A;  3POS A;  1F35 A;  1XPW A;  4FPL A;  3SHR A;  4E2S A;  2BZD A;  2UY9 A;  1JYC A;  1D0H A;  1W0O A;  4IW3 A;  1UL9 A;  2VVE A;  3CLP A;  4BK4 A;  4QPI B;  1ZZ8 A;  2OS2 A;  1RUC 2;  2A73 B;  3DPR B;  1CWP A;  2YHJ A;  5FZ8 A;  4E2Q A;  2R49 A;  1W2T A;  2R30 A;  2XL9 A;  1XJA A;  2AAC A;  3ILN A;  4Y5Z 0;  2HWC 2;  5K8S A;  3MID A;  2WA3 A;  4ZPI A;  4EWA A;  2VNO A;  1W8T A;  5A3O A;  3Q8B A;  1B35 C;  4OI2 A;  2YB7 A;  5FR3 A;  3KT1 A;  3C7F A;  2FDI A;  3MF9 A;  2QQL A;  2XWB B;  1JU3 A;  2WUH A;  4OFG A;  2FDH A;  1RUC 1;  4COZ A;  4CU7 A;  4HN1 A;  3BU0 A;  3DGT A;  3JBG 3;  4FPG A;  2ZA9 A;  3AMP A;  3NKG A;  5DUU A;  1JUI A;  2OYZ A;  3I4I A;  1REE A;  4A3Z A;  4LKS A;  1LB2 A;  1Y9Q A;  4ZU4 A;  2CSG A;  3VBH C;  3Q8C A;  2W1U A;  1VBE 1;  1ZZ9 A;  1H1I A;  1KD7 A;  3FN9 A;  4QAW A;  4CPB D;  1LED A;  2MNG A;  1K5M A;  3B5L B;  1XC6 A;  4PF1 A;  2XJQ A;  5HCA A;  1X9P A;  4UOJ A;  2HYX A;  4GD4 A;  3UNP A;  4UW5 A;  5ABJ A;  1CAX B;  1VE0 A;  1W6O A;  4M3C B;  4FPK A;  1EAH 3;  1U5Y A;  2HBT A;  3IWZ A;  5LA0 A;  4LBM A;  3UES A;  3F2Z A;  4WM7 B;  4Y5S A;  4URA A;  2WWS A;  4QDR A;  4XF3 A;  4AYU A;  1GNY A;  4QDS A;  2C6S A;  1F4A A;  1OC1 A;  1BZW A;  1STM A;  1YWK A;  3LWC A;  5A1F A;  4BH9 A;  1AYM 3;  1NZI A;  3ES1 A;  3WNK A;  2ZGT A;  2WN3 A;  4YW4 A;  1H6Y A;  2ZX2 A;  1PGW 1;  1WLW A;  1NA1 C;  4R4X A;  1NG0 A;  1MEC 2;  4JGZ C;  4XFF A;  2BWC A;  2VQ0 A;  3UV9 A;  5HPO A;  1KEX A;  1VB2 A;  5JIU A;  5M0T A;  3FHQ A;  5HXV A;  1VAK A;  4XJZ A;  4MET A;  5DZF A;  3K48 A;  4MXW B;  1MPX A;  3C7G A;  5D8A A;  1K45 A;  4BCU A;  2ORX A;  3O1T A;  4AAX A;  1YI9 A;  2D98 A;  5DMY A;  1MZF A;  2FMY A;  2WZR 2;  3VUO A;  4PIZ A;  2VOT A;  4UFI A;  5FP8 A;  4R9A A;  4FP2 A;  4NIA A;  3UK9 A;  1H2L A;  4BHP A;  2X5I C;  3GBF A;  1ENR A;  4URT A;  4B3N A;  4IND A;  3PMS A;  1W6P B;  1GZ9 A;  5E6H A;  2RJ2 A;  3WF1 A;  1SLB A;  2BNM A;  1PZ7 A;  4OUE A;  1CPM A;  3U07 A;  5C4W B;  5L9R A;  3V56 A;  3W5M A;  2W68 A;  1EUT A;  3O0W A;  4JDN A;  2EAL A;  4LQR A;  4CCC A;  1ZBA 2;  4ES9 A;  1GWK A;  3LEM A;  1WW6 A;  2RDN A;  4Q4X 1;  4WZC A;  3VHP A;  2VUJ A;  1OHF A;  3K2O A;  4OQ9 A;  3SH3 A;  3PVN A;  5H9S A;  3N7J A;  4IGP A;  5C3O A;  4XQ4 A;  3RWN A;  5JI7 A;  2G4I A;  3WP3 A;  4BM8 A;  1AX1 A;  1VRH 3;  2Y8K A;  2B7Y A;  1WCS A;  2H0B A;  4LOT A;  4A2U A;  1P8J A;  4A7K A;  1GOF A;  4D3W A;  1E5H A;  4PQQ A;  3JB4 C;  3WDX A;  3HOB A;  1FMD 1;  5SV8 A;  5BNP A;  3ELN A;  2J1T A;  3H1W A;  3MUY 1;  4N9H A;  5FP3 A;  3AYC A;  1POV 1;  3FL7 A;  1HB1 A;  3PJQ A;  3TNQ A;  1WCD J;  3ZKU A;  4AHY A;  4YVS C;  4FAH A;  5IVF A;  3IPV A;  3WNM A;  5K0U A;  1PNG A;  2BNN A;  1AX0 A;  4JQR A;  3RRD A;  3GXU A;  2YC4 A;  1D4M 3;  2RDQ A;  5JIA A;  1JHN A;  1UU6 A;  3OBT A;  5A3P A;  2CGP A;  4XF0 A;  5A32 A;  3RSJ A;  2R04 3;  5F5A A;  4LT5 A;  1N1V A;  4BQW A;  2TNF A;  3SH4 A;  3IB3 A;  3USS A;  3WZ1 A;  4YVS B;  3ZR5 A;  2QQM A;  5F37 A;  3ASI A;  1RVF 1;  4YG3 A;  2WKK A;  2EIC A;  2YGL A;  2YXS A;  2DFB A;  3N9N A;  2YBP A;  3UJO A;  4MYE A;  3FZ3 A;  4OYU A;  2GNM A;  3WCR A;  2XLG A;  3LPG A;  3NAP A;  2CV6 A;  4AG4 A;  3OUH A;  2FMD A;  4AHX A;  4MHU A;  1O4Y A;  4HBN A;  2VAU A;  3FLR A;  5FY7 A;  4HVO A;  2WFP A;  2WWJ A;  1JOB A;  1VBD 3;  1L7Q A;  5KR7 A;  1UWW A;  4L97 A;  2LRO A;  5JI9 A;  1ASJ 2;  1FYU A;  3RQ0 A;  1RMU 2;  2LAL A;  2FCV A;  1K5M B;  3OGV A;  5EJZ B;  1YQ2 A;  3IAQ A;  4HZF A;  3VDC A;  1DGW X;  1XYN A;  4IE0 A;  2VG9 A;  5E89 A;  2Z69 A;  3FBM A;  3VZO A;  1JZ5 A;  2BFU S;  5A1A A;  1QH6 A;  1DHK B;  4UI9 L;  5CBL A;  2FDJ A;  5JPN B;  1HRV 1;  4XJA A;  1VBC 1;  1CPN A;  3OF1 A;  2C1F A;  2KR2 A;  1FPN 1;  1RUJ 1;  4M4P A;  5FYZ A;  3VBS B;  3X29 B;  4WBB A;  1OLM A;  4R4Z A;  4Q4W 1;  4MGS A;  3K4D A;  4FFF A;  3SMH A;  5BYN A;  5KHK A;  5KXC A;  4CXW A;  1VBE 2;  3VBU A;  1WGP A;  2ZX0 A;  3EXU A;  4CUC A;  1EV1 1;  1SBF A;  3H3Z A;  1SCS A;  3JUU A;  2JIG A;  1EPW A;  2E31 A;  4Y3O A;  4ZS3 A;  5GZC A;  1OQE A;  4OMC A;  5JAX A;  4RS5 A;  1IG3 A;  3Q9O A;  3NW4 A;  2OW4 A;  4TWT A;  1O3R A;  3GGL A;  4Q4Y 3;  4K9S A;  3AVR A;  4HVQ A;  1NXM A;  5FV3 A;  1BVP 1;  1W05 A;  5CA6 A;  5L7O A;  1YQ8 A;  1WLT A;  2EVX A;  4NII A;  4RR3 C;  4FPO B;  4BJ0 A;  2VBD A;  2WAB A;  3ZXA C;  4BXF A;  4YW6 A;  4JDO A;  1R09 3;  3PU8 A;  1RMU 3;  4PCR A;  3ABZ A;  1O8S A;  1JW6 A;  2WR9 A;  4OHY A;  2ZGN A;  1JH5 A;  4IV3 C;  4L2N A;  4AQS A;  1GFF 2;  3DEM A;  4OZX A;  1LU1 A;  2HYK A;  2DV9 A;  2JDP A;  3KB5 A;  5FZH A;  4BXS V;  2VZ3 A;  1JYI A;  2R07 3;  1VBC 2;  2Y60 A;  2PLV 1;  2K2S A;  3ZSM A;  1RUE 3;  5JXI A;  4DIQ A;  4YYO A;  4QXH A;  5BNP C;  4P14 A;  2VMF A;  1YJL A;  1S0J A;  3IMN A;  1J1T A;  2OUJ A;  2HWF 2;  1VMJ A;  4HG6 B;  3WG4 A;  5IVJ A;  4XFH A;  2IVJ A;  3ZIW A;  4FTB A;  3ON7 A;  3VD5 A;  3BOD A;  2HWD 2;  4AHW A;  5FZ3 A;  5FDB A;  4B7E A;  3ZX7 A;  4QX7 A;  3VDD B;  4Q4Y 1;  4NIG A;  1S1A A;  2ZMK A;  1UX6 A;  2PYT A;  1UY3 A;  1MS9 A;  3IAP A;  3MF6 A;  3H8R A;  1W6Q B;  1FPN 3;  1UD1 A;  2I2S A;  2R0H A;  4CZS A;  4AOC A;  3FUQ A;  2VTX J;  4FPY A;  3UET A;  1IPS A;  4XAE A;  2E51 A;  3CMG A;  3IDB B;  2JDN A;  4Y22 A;  3KQ4 B;  5CU1 A;  3VN4 A;  5BV6 A;  1AXY A;  4BQ2 A;  2GSY A;  3KF5 A;  2R06 3;  4UF0 B;  3VLB B;  4H2A A;  4D94 A;  3VDD C;  1CGP A;  2Q4S A;  2VJX A;  3LOI A;  5LCW L;  5FYM A;  1W2N A;  2VD7 A;  1D4M 1;  3CZU A;  4Y1Z A;  1ZZC A;  4DMI A;  4KG0 A;  4TLF A;  1PO1 1;  5DAP A;  4YFW A;  1HRV 3;  4G3Y C;  1IZ3 A;  2QZ3 A;  3WW3 A;  2Z79 A;  5DQ0 A;  5A32 B;  2RM2 1;  5KC5 A;  3LIG A;  4AI3 A;  3THP A;  1W0P A;  3UKT A;  4AQ6 A;  4LTA A;  5F8P A;  3CNA A;  5CG8 A;  3POW A;  1W8Z A;  5DN2 A;  4LKF A;  4NAO A;  1DQ6 A;  2RJK A;  5IVE A;  1JZ4 A;  5LW9 A;  1DQ1 A;  4BE3 A;  1LOB A;  2DVF A;  5DAX A;  3ZFG B;  1HRI 1;  1FV3 A;  3RMX A;  4XC9 A;  4EWE A;  2ET1 A;  4GB3 1;  1LHW A;  4GZ9 A;  5FY5 A;  1W9F A;  2OKX A;  3IZO A;  2J1A A;  1C8N A;  4LK6 A;  1V9U 3;  1X82 A;  1DQ5 A;  4FSJ A;  4RR3 B;  2RS3 2;  3SKV A;  1WW7 A;  4X6Q B;  3V0B A;  5GZF A;  3U1X A;  2JG8 A;  3BN6 A;  4NO4 A;  4MGY E;  4CU9 A;  3H9A A;  3WSO A;  2RE9 A;  5FZO B;  4L9B A;  4N43 C;  5FZI A;  4AFD A;  1H8T A;  4TTG A;  2R07 1;  4QPG A;  1DQ2 A;  1G9C A;  4NWW A;  2W5F A;  1EPZ A;  2WJS A;  3AMH A;  4QKB A;  1LNS A;  3ZYB A;  2IFR A;  1QJU 1;  5CFD B;  1UN1 A;  4GH4 A;  4UFM A;  3RI9 A;  3OPW A;  4HMZ A;  1UU5 A;  5F3C A;  4Y1Y A;  1PK6 B;  2CWM A;  2VXJ A;  1V0A A;  2R06 1;  4XBN A;  2OT7 A;  3TEX A;  1GOH A;  1WA4 A;  3OPT A;  4C1W A;  1Z7S 2;  3MPB A;  4K8F A;  4KBZ A;  1RIR A;  5FYB A;  3WW1 A;  4FFI A;  4CYD A;  1VBB 3;  2C24 A;  3H42 B;  4AED A;  5FZD A;  1ENS A;  3ZLI A;  5KXD A;  3MHZ A;  2ZZQ A;  4ASM B;  1GQP A;  1NCR A;  1SDW A;  1FT9 A;  3J8F 2;  1F15 A;  4JRL A;  3VKL A;  4QXC A;  1R64 A;  2IWG B;  1X8E A;  1ZRE A;  1QHD A;  1ZNP A;  5FCC A;  4FPF A;  1QY4 A;  3J26 N;  3BOW A;  4XUN A;  2JDK A;  1A8D A;  1DZQ A;  1HJG A;  5FMO L;  1AYN 2;  1S2E A;  5GZD A;  1FAY A;  3ZN6 A;  4CEY C;  5EQU A;  2HEY F;  4NMI A;  2GC2 A;  2WLP A;  5A7N A;  4CDQ C;  2OII A;  3T0D A;  3OGJ A;  2A6Y A;  1JMU B;  4DY5 A;  4WM8 B;  3C7E A;  2XVL A;  5C3R A;  3OSD A;  1ASJ 3;  2QQO A;  4XZU G;  3OUI A;  3S0M A;  3M3C A;  4B4R A;  5T55 A;  1MZ6 A;  4A45 A;  2VU9 A;  5ANQ A;  3VDA A;  3RYR A;  3TNP B;  4CRQ A;  1CAV A;  2D6K A;  4C8D A;  5FRE A;  2BV4 A;  2XUE A;  4RD7 A;  1UYZ A;  5BNO C;  4NRO A;  1PO2 1;  1MS1 A;  1QOT A;  2OA2 A;  1UZW A;  2DU0 A;  4NRM A;  4QKF A;  1B09 A;  1UF2 C;  2NMO A;  1OOP B;  1YXW A;  4XFI A;  1T6G C;  3POF A;  1AX2 A;  5F6L B;  3GZT B;  4IEZ A;  4YVW B;  3HN3 A;  4AGV A;  3WF2 A;  5CEH A;  5FY1 A;  4RHV 1;  2P17 A;  3VZJ A;  2LRP A;  2ZGL A;  1NA1 B;  5F1R A;  2VNR A;  1W8F A;  1WA6 X;  1S0B A;  2Y6G A;  3HD8 B;  1GZC A;  4GKY A;  4D6R A;  4UF0 A;  1TME 3;  4H3W A;  1OFS A;  3S6P A;  4QU2 A;  3RFR A;  4AL9 A;  4FTE A;  1CAU A;  1JUH A;  2VTF A;  4IEP A;  1O3S A;  4YGD A;  4E27 A;  1V70 A;  2WT0 A;  3AZW A;  2VCM A;  4K40 A;  4B4Q A;  1IKQ A;  4XXP A;  3USU B;  2PAK A;  3ZSE A;  1OPO A;  4IL7 A;  1KXG A;  2ZTN A;  2ZKN A;  2WT1 A;  1WME A;  5LAT A;  4ZS2 A;  1YHF A;  2UWC A;  2ZBJ A;  4RA0 A;  3TEW A;  2RMU 2;  5D21 A;  5C4W A;  1ZBE 3;  3I3M A;  1VAM A;  3JQW A;  3P3P A;  4GWJ A;  5EZW A;  3U11 A;  4CCO A;  1SLA A;  4IE4 A;  2PTM A;  1QNY A;  1R08 1;  2X05 A;  1O5U A;  4KWL A;  4EN6 B;  3O1O A;  3OYW A;  2L9L A;  1C1F A;  4PT6 A;  5JR7 B;  4AQ2 A;  3UGH A;  4DY3 A;  5KC6 A;  1AJK A;  1UO9 A;  4K1Z A;  1VB4 A;  3ETP A;  3OTF A;  3ZFF C;  4IV1 C;  1W90 A;  1MS0 A;  1Z7S 1;  4ZXK A;  5CKN A;  2FDF A;  2C4X A;  1G7Y A;  2WAO A;  3ZYH A;  4KU7 A;  1US3 A;  3UJQ A;  2EAA A;  3OBR A;  3TN9 1;  5CFD C;  2WQ8 A;  3CJI B;  1W3X A;  5A3T A;  1FNY A;  3KT4 A;  5FPV A;  5FY8 A;  3MIC A;  2XKO A;  2LS6 A;  1ASJ 1;  1LTE A;  4HLT A;  5IK8 A;  4QX3 A;  2V09 A;  4JZR A;  2ZHK A;  3AP4 A;  4Y33 A;  1OT5 A;  1NE4 A;  4OUM A;  2Y6K A;  3P5B A;  4G9S B;  4UT5 A;  4DRV A;  2PQS A;  4XMA A;  1VBE 3;  2EAK A;  2EF6 A;  3LEK A;  2IZW A;  4YWA A;  3ZXJ A;  4B4P A;  3U75 A;  4ZHN A;  5FZ7 A;  4EV0 A;  1QDO A;  5BXX A;  1PO2 3;  1PVC 3;  1WBL A;  4JKK A;  2RR1 3;  3MFA A;  5JDB A;  4E4Z A;  5FK7 A;  4DS0 A;  5FOB B;  5JOX A;  4AED B;  4K6B A;  5FWJ A;  2RHP A;  2H0V A;  2W3J A;  3I3B A;  3J7M A;  3ZXE A;  3BTY A;  2A3X A;  1AVB A;  3N3H A;  4RFR B;  3IKW A;  3K3N A;  4MGI E;  3GCX A;  2OVU A;  5KHI A;  2MHF A;  5IAX A;  3PUS A;  4Q29 A;  2DBI A;  1ND3 C;  4DEV A;  3LFM A;  3MLJ A;  5KXE A;  4BA6 A;  2AC1 A;  1NT0 A;  4LEJ A;  4IEW A;  4UFJ A;  1XNK A;  1ND2 A;  5C8C B;  2ILM A;  2WFF 3;  4LKD A;  2R07 2;  3I3E A;  4FOW A;  1DU3 D;  1UMZ A;  3CBN A;  3JQX A;  1DIW A;  1XYO A;  4LE4 A;  4PLM A;  3T2T A;  1RUN A;  2BVB A;  2HLE A;  4XZP A;  3M3E A;  1NYW A;  3WDY A;  1SBE A;  3A21 A;  4GMP 1;  1UW8 A;  4XFB A;  1QOO A;  3TEZ A;  4I3G A;  3UYJ A;  3WVJ A;  1A3K A;  1FNZ A;  1DP0 A;  4QPW A;  4XAA A;  4H7M A;  4YLZ A;  4MAD A;  4XEZ A;  2WO3 A;  2DFC A;  4QWN A;  5F39 A;  5F3G A;  3RYP A;  1RVF 3;  4JVA A;  5KBF A;  2HWD 3;  3HR9 A;  2K9Z A;  4LBJ A;  2ZGQ A;  3FJS A;  1UYP A;  3C8X A;  3I54 A;  3POE A;  1RIT A;  3S57 A;  3O1V A;  2TBV A;  5DZE A;  4IE5 A;  1W6M A;  4MZU A;  3E5U A;  2P2K A;  1DGW A;  2FCT A;  1FOD 2;  3SIT A;  2C9K A;  4WVW A;  3K75 B;  3PTY A;  1UOF A;  1AR8 2;  4J1X A;  4OLL A;  2W46 A;  3THT A;  2FDK A;  1HRI 2;  1XSR A;  3AMN A;  3QLQ A;  5BNN B;  1RYY A;  1SMV A;  1ULC A;  2PXJ A;  2QVS B;  1Y4W A;  4Y20 B;  2RR1 1;  1XU1 A;  3VD7 A;  2EXH A;  3AL5 A;  1ULO A;  5A6X A;  1W39 A;  1XE8 A;  4Q0Q A;  4Z07 A;  3SH5 A;  4AVC A;  2RM2 2;  2O0O A;  3VD9 A;  4X8P A;  4HPK A;  1N47 A;  1ACC A;  1Q8V A;  5DPN A;  3UL2 A;  3D8C A;  5ANN A;  4JKM A;  5C9A A;  4MX3 A;  5IYY A;  4NR1 A;  3T2O A;  1OUS A;  3L2Y A;  4LXL A;  5T54 A;  3JD7 3;  4BYY A;  3WQ7 A;  1RUF 3;  4V2V A;  3ZYI B;  2JDM A;  3DYO A;  1QQP 2;  5FIX A;  1S0G A;  2B4K A;  5K7P A;  1NQJ A;  4HKL A;  3I2O A;  3GBW A;  2V5D A;  2XLF A;  1GIC A;  3NNM A;  2VME A;  5GZE A;  1WMF A;  5IVC A;  2XJP A;  1MQT A;  4YM0 A;  1LEN A;  2J1S A;  4CEY A;  4Z8B A;  1W6Q A;  2ZGS A;  4O65 A;  5JCT A;  4N7U A;  3ST7 A;  4LJH A;  3WP5 A;  1OLM E;  1AZD A;  1H2M A;  1S55 A;  3FC0 A;  2RS3 3;  2VZ1 A;  1GP6 A;  2XKP A;  2JE9 A;  2UWB A;  4WVM B;  4Y22 B;  5FYV A;  1XQN A;  1WW4 A;  1JHJ A;  3BGA A;  1ZZB A;  4NWV A;  1UIJ A;  4NRQ A;  2FBE A;  1LJ7 A;  4AED C;  4DOU A;  3V0A B;  2R1D A;  5TSW A;  2Y0O A;  3OBZ A;  3VL8 A;  2Q5T A;  1RGS A;  1G9B A;  1YFU A;  3I2K A;  1GLH A;  5CG9 A;  2OPW A;  1RUG 1;  3LD8 A;  5LAS A;  1K42 A;  1WKY A;  5CB7 A;  3UKV A;  4O61 A;  4AEM A;  2BTV C;  4GH4 C;  1O91 A;  1R1A 1;  3I2G A;  4K8R B;  2DVD A;  2ZGM A;  2VW0 A;  5T5J A;  4CCN A;  1ND3 A;  5FXW A;  1RED A;  1HW5 A;  3N4M A;  2D40 A;  4HKO A;  1EAH 2;  5KHG A;  3WNO A;  1QXR A;  2ZPX A;  4N43 A;  2BGO A;  4HT1 T;  5FY9 A;  3AB0 A;  4HK9 A;  5A3N A;  2HJI A;  4S2H A;  2HEV F;  5A7Q A;  1F9K A;  1RJ7 A;  1W2U A;  1PGL 2;  4LK7 A;  1AR6 1;  4CP1 A;  1OXC A;  2B42 B;  1ODN A;  1AXK A;  1MVQ A;  1RUE 1;  1W2O A;  3L9J T;  4LBO A;  5ACA 2;  1Q8Q A;  1C5H A;  4EN0 A;  1CD3 G;  3KD4 A;  5EIY B;  1D0G A;  3DL3 A;  4OUL A;  1CAX A;  2RG4 A;  3KSC A;  5FBZ A;  5CIS A;  2F17 A;  1LHN A;  1VBA 2;  3HMY A;  3RPQ A;  4JTO A;  5FO7 B;  1W8N A;  2VZP A;  3WG1 A;  1I6X A;  5B2G B;  3SC7 X;  1PVX A;  5CFC C;  4XE9 A;  3KCY A;  1O4Z A;  2ZHM A;  3LDR A;  4HVR A;  3O1S A;  3VB9 A;  4E4H A;  1GYK A;  3PUQ A;  3BIW E;  1NKG A;  5A6Z A;  1MR5 A;  5CFD A;  3H1Y A;  1HKD A;  1Q8S A;  4FPE A;  4JAA A;  3H7J A;  3N35 A;  5JR2 A;  4MGT A;  2YY1 A;  5L9B A;  1HB4 A;  2WS9 2;  1SFY A;  3JD7 2;  4IV1 A;  1MVE A;  3CQO A;  5F3I A;  4FQ4 A;  1AYN 1;  4AWD A;  5AFE A;  4AGG A;  1V6M A;  3PUR A;  1W06 A;  1QQP 3;  4QX1 A;  4YZ1 A;  2VNG A;  2WIN B;  5FKB A;  1BQP A;  1JI6 A;  3CKH A;  3RZJ A;  1O6U A;  3GHN A;  2W47 A;  4EZ4 A;  3LQC A;  2X10 A;  1WCQ A;  3JBG 2;  2GH8 A;  5FMD A;  2GMM A;  4XJU A;  2BQP A;  3Q8F A;  4AVB A;  3PVB B;  5C4W C;  3M4F A;  3B9I A;  3A0K A;  4LPL A;  2D3P A;  3ZFE B;  1QJX 3;  4Q8L A;  1JOJ A;  2AEN A;  1OOP C;  3ZN6 B;  1DZR A;  2B5H A;  2P3J A;  3T2P A;  4COU A;  3WQ0 A;  3LKJ A;  1F5J A;  4MGQ A;  5FZ1 A;  2E63 A;  3GYD A;  4MGK E;  3RMY A;  2A75 A;  3FUO A;  4CVU A;  5C7G A;  1ULF A;  5H9P A;  4AR2 A;  2WLQ A;  2YMZ A;  1QJU 3;  2W2I A;  3LA3 A;  2BYV E;  1JYT A;  1XSQ A;  2D6M A;  3AKQ A;  3HN1 A;  3OG2 A;  2O1Q A;  3HT2 A;  5CZK A;  5DZG A;  1FX5 A;  3VHR A;  3WF3 A;  1W28 A;  1YEW A;  2GP5 A;  4ITC A;  3KQR A;  1MS4 A;  3AM2 A;  3H3U A;  3TOJ A;  4JGZ B;  1ZZ6 A;  4MSV A;  4UFL A;  1UY0 A;  4UYB A;  5I0T A;  4LUM A;  2DUO A;  5LY2 A;  1QGL A;  4KMQ A;  4LO5 B;  3PTR B;  4XCB A;  1NXD 1;  2HWC 3;  2VUC A;  4XDQ A;  4CEW B;  2HWB 1;  1AR9 1;  2R32 A;  4NHM A;  1UY2 A;  1OFN A;  4LLO A;  5DG2 A;  4C91 A;  4RN5 A;  3BB6 A;  1PZ9 A;  4UFK A;  1RUH 3;  1ZX5 A;  5GLU A;  3QBQ A;  5GLT A;  5E1R A;  4QQH A;  3I3Q A;  1KIT A;  5FUP A;  2IUW A;  1FOD 3;  4AK3 A;  1GOG A;  4LBN A;  1KJR A;  3LDB A;  4YSF A;  1AR8 3;  2E53 A;  2W08 A;  5FYU A;  3VD3 A;  3T30 A;  2VCB A;  4RS5 C;  1VBA 3;  4CDX B;  2D7F A;  3DUI A;  1W8W A;  2JWP A;  2NZ9 A;  5AC9 3;  2E32 A;  1C8M 1;  3I3D A;  4XTP A;  1RUI 2;  1ST8 A;  3G6J B;  1HLC A;  5G05 L;  3I2J A;  1MEC 3;  2A5Z A;  3FE5 A;  4CXX A;  1CX1 A;  1QJX 2;  2AUY A;  1US2 A;  1XYP A;  2WS9 1;  1JZ3 A;  3PDQ A;  2YV8 A;  5LBE A;  3VBH B;  4MUV A;  2JD9 A;  4PJY A;  4QHZ A;  4AFM A;  4CUA A;  4AW7 A;  4G4F A;  1H9W A;  1Q3E A;  5I91 A;  1OVS A;  1W03 A;  4LOS A;  5SV5 A;  1LEM A;  4A6O A;  3RYK A;  3LAG A;  1W6O B;  4M3C A;  3U37 A;  4OHV A;  5DUX A;  3TBD A;  2XON A;  4R8H A;  4U36 A;  4XJ9 A;  5H9Q A;  1WCU A;  4YM3 A;  1TMF 1;  4ASL A;  2GU9 A;  4BIF A;  1REF A;  1I5Z A;  2EXK A;  4H7L A;  1AYM 1;  4O7X A;  1NLR A;  3MW3 A;  3O1U A;  2GH2 A;  3NNG A;  1R08 2;  5FMO S;  5GJ6 A;  5C33 A;  2ES3 A;  3O1P A;  1LGC A;  1MS8 A;  3MO4 A;  3CIH A;  1C28 A;  1NLQ A;  5FZ0 A;  5CVR A;  2YG0 A;  4NOT A;  3LPF A;  1WLD A;  1DYP A;  1F31 A;  2UY8 A;  5IVB A;  5C6C A;  5I8Y A;  2Z4F A;  4XHB A;  5A80 A;  2JG9 A;  2B39 A;  1NAE A;  4QPG C;  1H8T C;  3AYD A;  3NST A;  4Q5O A;  4MOA A;  4A42 A;  1GKB A;  4KGG A;  1HQN A;  4EWD A;  3LDK A;  2ARX A;  2JG8 C;  2CYF A;  3HQX A;  1FXZ A;  3GDB A;  1JZ2 A;  5DDJ 3;  3ACL A;  2EA7 A;  3J4U H;  1VBA 1;  3LE0 A;  4XUP A;  3INA A;  4I0W B;  1IS6 A;  5JXH A;  4P02 B;  1TNF A;  1W6P A;  4QKN A;  4EN9 B;  3BPZ A;  3HBZ A;  4JGY C;  5LRR A;  1NY7 2;  2ADD A;  1UOJ A;  4LO7 A;  3D82 A;  1AR6 2;  4ARX A;  2WNO A;  3DKQ A;  4NAM A;  3BAL A;  4CA9 A;  3R6S A;  1OBN A;  3AP6 A;  3WX5 A;  2H6C A;  3AZX A;  2X09 A;  5FPX A;  1U0A A;  3JCI A;  3VHN A;  4HAN A;  3PVE A;  1SLT A;  3LEG A;  3PUH A;  1HXS 1;  2J1E A;  2BOI A;  4Q1P A;  3RGB A;  4Z1V A;  2WRA A;  3KV5 A;  3MV0 1;  2QQV A;  3OJB A;  2B9V A;  4Z82 A;  1KFX L;  1TMF 2;  2RM2 3;  2WQ4 A;  4M00 A;  2GC3 A;  3AKP A;  3DPR A;  5FLJ A;  4RSU A;  3GJA A;  3MIB A;  3E6D A;  3SNM A;  2ID4 A;  3ITQ A;  2D3R A;  4K21 A;  3WQB A;  4XXA A;  1R08 3;  4LOR A;  2WL1 A;  2WYS A;  2RMU 3;  1PIV 3; 
#chains in the Genus database with same CATH homology
 1GQP A;  2XOM A;  1W99 A;  2ZEZ A;  4QDQ A;  3T0B A;  1R64 A;  1JZ8 A;  3AC0 A;  1XNA A;  3I2H A;  4OMD A;  4XUN A;  2ORZ A;  2KD7 A;  1NX9 A;  1GU3 A;  3GM8 A;  1UY4 A;  2XHN A;  3T0D A;  2Y6H A;  3C7E A;  1UXZ A;  1T2X A;  2J1R A;  2QQO A;  2VC9 A;  3ACH A;  4XZU G;  4D8M A;  1HN1 A;  1DYO A;  4A45 A;  3VDA A;  2W1W A;  1PX3 A;  2W1S A;  2J7M A;  1OF4 A;  3HEI A;  5LA1 A;  4IUG A;  4W8J A;  2VZO A;  3NJV A;  1UYZ A;  4MO3 M;  3NQH A;  4ARY A;  3THD A;  3K4A A;  3HN3 A;  2XQX A;  3WF2 A;  5IJR A;  2ZXQ A;  1OD3 A;  2CDO A;  3PUI A;  2VZT A;  1PMH X;  1CZS A;  2J1U A;  2BGP A;  1O59 A;  4XUO A;  2Y6G A;  5JUV A;  4BK5 A;  2Y64 A;  4QX2 A;  2ZEY A;  4JHZ A;  1PX4 A;  3SKJ E;  2VTF A;  1TVG A;  1SHW B;  4JKL A;  4D0Q A;  1KGY A;  2VQT A;  3OB8 A;  2C26 A;  2VMC A;  5LA2 A;  3VDB A;  5B4N A;  1K12 A;  2J22 A;  4ET7 A;  4GWJ A;  3THC A;  2X05 A;  4DUW A;  2EID A;  1UZ0 A;  2W87 A;  2L9L A;  4PT6 A;  1UX7 A;  2JE8 A;  4CUB A;  3ETP A;  2R7E B;  5C70 A;  2DCJ A;  3K46 A;  2VZS A;  2C4X A;  2WAO A;  1US3 A;  2WZE A;  2WN2 A;  3WEZ A;  2WQ8 A;  5IHR A;  3OBA A;  3WNP A;  3DEC A;  3OGS A;  2LS6 A;  2JDA A;  2VO5 A;  2WO2 A;  4QX3 A;  3T09 A;  1JZ7 A;  4DXT A;  1O8P A;  1OT5 A;  2Y6K A;  4ZY9 A;  2PQS A;  1JU4 A;  3LEK A;  3ZM8 A;  3EB7 A;  4JKK A;  1CIY A;  2E33 A;  2VCC A;  3HNB M;  1H6X A;  3DYP A;  2W3J A;  3I3B A;  3T08 A;  3NRU A;  5JXG A;  2VZV A;  4ZZ8 A;  4CU6 A;  5J1X A;  4L0P A;  4DEV A;  1XPW A;  2BZD A;  2W1Q A;  1J84 A;  4BDV B;  4BK4 A;  4RYD A;  3I3E A;  1XNT A;  2HLE A;  1W9W A;  3A21 A;  5IFT A;  2YB7 A;  1DP0 A;  4QPW A;  3C7F A;  2QQL A;  1JU3 A;  2WUH A;  4MAD A;  4CU7 A;  3E1F 1;  2WO3 A;  3K77 A;  4E8D A;  1L7R A;  5C71 A;  2J1V A;  1NUK A;  4CU8 A;  4A3Z A;  4YPJ A;  3C8X A;  2W1U A;  3FN9 A;  1UMH A;  5F7U A;  4QAW A;  5IFP A;  3I97 A;  1XC6 A;  1ULP A;  4PF1 A;  2C9K A;  3K75 B;  3MBW A;  4DEQ A;  2VZQ A;  2W46 A;  4UOJ A;  2HYX A;  2Y6J A;  3UNP A;  4A4A A;  1RYY A;  2WDB A;  4OZO A;  4QB6 A;  3VD7 A;  1ULO A;  1UYX A;  4P08 A;  5LA0 A;  3UES A;  3F2Z A;  1CZT A;  4QDR A;  3VD9 A;  1GNY A;  3III A;  4QDS A;  5DPN A;  1F4A A;  4JKM A;  3JXS A;  2WBK A;  3WNK A;  5IYY A;  2W9X A;  3T2O A;  4ZZ5 A;  3ACI A;  3ECQ A;  4M4R A;  2WN3 A;  1H6Y A;  3LEI A;  3J7H A;  5HPO A;  1KEX A;  3DYO A;  4FI9 A;  2B4K A;  3FHQ A;  2CDP A;  2V5D A;  2VME A;  1MPX A;  3C7G A;  1K45 A;  2ORX A;  3MV1 1;  2J1S A;  2V72 A;  4AAX A;  3VD4 A;  5DMY A;  1JZ6 A;  2V4V A;  2VOT A;  5JXJ A;  2VZ1 A;  3BGA A;  1JHJ A;  1TG7 A;  5G04 L;  2RJ2 A;  3WF1 A;  4OUE A;  3I2K A;  4XUT A;  3W5M A;  4LQR A;  1EUT A;  3ACG A;  1K42 A;  1WKY A;  2QQN A;  2W95 A;  2VR4 A;  4UAP A;  3I2G A;  3T2Q A;  2WAA A;  2BER A;  2E26 A;  2Y8K A;  2DDU A;  3WNO A;  1P8J A;  1GOF A;  4XUR A;  2BGO A;  4PQQ A;  1UY1 A;  3HOB A;  3MUY 1;  2J1T A;  3EYP A;  3FL7 A;  2VM9 A;  3WNM A;  1W0N A;  4A44 A;  3GXU A;  2YC4 A;  2VQU A;  4W4Z A;  5EIY B;  3WF0 A;  3D3A A;  3P6B A;  2QQJ A;  3MUZ 1;  1K3I A;  1W8N A;  4QB2 A;  2VZP A;  3IB3 A;  3WF4 A;  2QQM A;  4Z2A A;  2YFZ A;  1D7P M;  2EIC A;  1NKG A;  2YC2 A;  1JYW A;  4OYU A;  4LHS A;  5JR2 A;  3LPG A;  4AG4 A;  3CQO A;  1W8O A;  2VMD A;  1GMM A;  4QX1 A;  1JYV A;  1L7Q A;  1UWW A;  3T0A A;  1JI6 A;  3CKH A;  2W47 A;  4E8C A;  3LQC A;  3OGV A;  2X10 A;  5EJZ B;  1YQ2 A;  3IAQ A;  1WCQ A;  3VDC A;  5EJ1 B;  4DUV A;  1JZ5 A;  5FUI A;  3ACF A;  1F4H A;  1OH4 A;  3OGR A;  4LPL A;  4UI9 L;  5A1A A;  4M4P A;  3P1I A;  4MGS A;  3K4D A;  1W9T A;  3WNL A;  3T2P A;  4JX0 A;  4CUC A;  3A7Q A;  4MGQ A;  2E31 A;  4CVU A;  5C7G A;  4OMC A;  4TXW A;  3GGL A;  4QX0 A;  5CZK A;  3OG2 A;  3WF3 A;  2DCK A;  4BJ0 A;  2WAB A;  2W92 A;  3FHA A;  3CDZ B;  1UY0 A;  5CYY A;  2EIE A;  2QQI A;  2BBA A;  2QQK A;  3ABZ A;  3HJR A;  1O8S A;  4KMQ A;  5HXM A;  2ZEX A;  4GWI A;  1UY2 A;  4BXS V;  2VZR A;  2VZ3 A;  5JMO A;  4RN5 A;  1W9S A;  3SEE A;  3DYM A;  4ZXE A;  5JXI A;  2EIB A;  2Y6L A;  1GOG A;  2VMF A;  3HPN A;  3VD3 A;  2VCB A;  4HG6 B;  1PMJ X;  3A23 A;  2E32 A;  3I3D A;  3VD5 A;  2RVA A;  5G05 L;  3I2J A;  2YFU A;  2JKX A;  1IQD C;  1CX1 A;  1US2 A;  1JZ3 A;  1UY3 A;  3IAP A;  4P5Y A;  2VL4 A;  2JD9 A;  4CUA A;  1UMI A;  1OF3 A;  2RV9 A;  3UET A;  3CMG A;  3HNM A;  4A6O A;  5I0D A;  3U37 A;  3IDA A;  2XON A;  3NJX A;  3A22 A;  2ZEW A;  4XUQ A;  2VJX A;  5LCW L;  4DXS A;  4W50 A;  3CZU A;  3NNG A;  2VZU A;  3WNN A;  3I2I A;  3MO4 A;  3CIH A;  2QBX A;  5DQ0 A;  1UXX X;  2YG0 A;  1J83 A;  3LPF A;  3W5N A;  5DN2 A;  2Z4F A;  3OEB A;  1JYN A;  1NAE A;  2W91 A;  3CZJ A;  4KI5 M;  1JZ4 A;  4MOA A;  4A42 A;  1DLC A;  1I5P A;  2WO1 A;  2WZ8 A;  3GDB A;  1JZ2 A;  4GZ9 A;  1SDD B;  2OKX A;  2J1A A;  3LE0 A;  4XUP A;  3SKV A;  1GUI A;  1SG3 A;  3BN6 A;  5JXH A;  4P02 B;  3K4Z A;  4CU9 A;  4A41 A;  3WSO A;  4P00 B;  3I2F A;  3C7O A;  5B4X A;  4ARX A;  4TTG A;  3OEA A;  3HNY M;  3C7H A;  4XVH A;  2LW8 A;  2X09 A;  4DUX A;  2W5F A;  1LNS A;  3LEG A;  3PUH A;  1CZV A;  4KWU A;  2J1E A;  3MV0 1;  2B9V A;  1EUU A;  2W94 A;  1GOH A;  3SEP A;  1JYX A;  4QB1 A;  2ID4 A;  4DXR A;  3WQB A;  1BHG A;  1UYY A;  2VCA A;  2WYS A;  4LKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...