4ZY9A

X-ray crystal structure of selenomethionine-labelled v110m mutant of chitosan-binding module 1 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
b'HHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGGIDDITFTARTAKYVRMHGTVRGTPYGYSLWEFEVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase/chitosanase
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
total genus 32
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zy9A00
3K46A 2VJXA 1XC6A 3WF3A 3GXUA 3I3DA 4PT6A 5DN2A 3CDZB 3T2OA 3K4ZA 4DUWA 3T0AA 2RV9A 1PX4A 4BK4A 1CIYA 4JX0A 2VO5A 1GOHA 4ARYA 3WNOA 4RYDA 3UNPA 4M4RA 3GGLA 2ID4A 1KGYA 2QQIA 1JYVA 3I3BA 3UESA 2E32A 3DYPA 3LE0A 2X09A 2W91A 1ULPA 3A21A 4UAPA 3WSOA 1H6XA 1UZ0A 4A3ZA 3MV11 2QBXA 3NNGA 1W0NA 3SKVA 1CZVA 2VZVA 3WNMA 1US2A 3MO4A 1O59A 2W95A 2J1SA 2E33A 3K4AA 3VD5A 2VZTA 4BDVB 2HYXA 2WDBA 3IDAA 3I3EA 3DYOA 3SKJE 1DYOA 2EIEA 2WZEA 1UY3A 2J1VA 1XNTA 4P00B 1UMHA 2W87A 4A6OA 2EIBA 2WO3A 3PUHA 3IIIA 5J1XA 1K42A 1JZ5A 1W8OA 4TTGA 4XUPA 2VOTA 3MV01 2QQOA 2E31A 4LQRA 1J83A 1UY1A 2RJ2A 4LHSA 2QQJA 1JZ4A 4CU6A 2DCJA 3NRUA 1W9SA 1WKYA 1GOGA 2W94A 4JKKA 2C9KA 2Y6HA 5IHRA 4E8CA 3CIHA 3GM8A 2VR4A 5JXHA 2VMCA 4DXRA 4DEQA 4JKLA 3I97A 4GWIA 2B9VA 1TVGA 4E8DA 4LKSA 3FL7A 4A42A 3NQHA 2QQKA 5JMOA 3OEBA 3CQOA 4XZUG 4CUCA 3HNYM 4QX2A 2WZ8A 1UY2A 4CU9A 1SG3A 3CZJA 3DECA 4XUTA 3MUZ1 3HPNA 2Y6GA 2J1EA 2YG0A 2XQXA 3ACHA 3VDAA 3K4DA 2WAAA 5CZKA 3C7GA 2RVAA 3HN3A 1US3A 2QQMA 1UYXA 5G05L 3T2QA 1L7RA 5B4XA 2W5FA 4MADA 3ZM8A 3FN9A 3A22A 3C7HA 1D7PM 2VC9A 2JD9A 1W8NA 2VZ1A 2LW8A 3I2HA 2VMEA 4OMCA 5DMYA 4Z2AA 2YFZA 3BN6A 2ZEWA 3WNNA 1GMMA 4IUGA 2J1RA 1PMHX 2W1SA 1OF4A 2HLEA 2JE8A 3U37A 2VZSA 4BJ0A 4QX0A 4A4AA 3BGAA 4DXSA 3CMGA 4DXTA 3MBWA 2J7MA 4QB2A 5IJRA 2Z4FA 3CKHA 4FI9A 5LA1A 5IYYA 1XPWA 3OBAA 4PQQA 1UX7A 3LEIA 5LA2A 3K75B 4UI9L 5DQ0A 5EJ1B 5C7GA 3HEIA 2VM9A 1CX1A 5I0DA 3VD9A 2Y6KA 3I2FA 4XVHA 3DYMA 2WBKA 1I5PA 1JYNA 1IQDC 2XOMA 4KWUA 2ORXA 2ZEZA 4GZ9A 1JI6A 3VD4A 3C7FA 2WN2A 3NJXA 4P08A 5IFTA 5C71A 1JHJA 1SHWB 2VQTA 5IFPA 2Y6JA 1JZ8A 2VCCA 2VL4A 3C8XA 2VZRA 3OEAA 3THCA 4P5YA 4ZZ5A 2XONA 4QB1A 1GU3A 4LPLA 1NAEA 3HOBA 5HPOA 1XNAA 2Y6LA 1UYZA 2KD7A 3SEEA 5FUIA 1BHGA 2J1UA 1YQ2A 2VZPA 3A7QA 1EUUA 2WO2A 2LS6A 4M4PA 4A45A 2QQLA 3WF4A 1UMIA 3I2KA 2C4XA 4CVUA 3HNBM 4RN5A 3W5NA 1DP0A 2YB7A 5LA0A 1EUTA 2JDAA 4JHZA 2VMFA 1OT5A 3K77A 3OGRA 2CDPA 5LCWL 2WQ8A 2ZEYA 2JKXA 4QX3A 3SEPA 3WNLA 1MPXA 4GWJA 1GQPA 2WO1A 1UY4A 5G04L 2BBAA 5JUVA 4XUOA 3WNPA 2X05A 2VCAA 2W3JA 2ZEXA 3FHQA 2W46A 3T0DA 4ZZ8A 3MUY1 3CZUA 2VZUA 4MOAA 4QPWA 5B4NA 1T2XA 3T0BA 4ET7A 3C7OA 3ABZA 3OB8A 1PMJX 4QDQA 2VZ3A 4A44A 1F4AA 3LEKA 3F2ZA 4JKMA 4D0QA 1SDDB 2WN3A 3P6BA 4BK5A 3A23A 2ZXQA 3ACGA 1JYWA 4OZOA 1W9TA 3LEGA 2BGPA 3T08A 1NUKA 2L9LA 3I2IA 1OF3A 1NX9A 2YC2A 3IB3A 1OH4A 3P1IA 2WUHA 2VQUA 1JU4A 3I2GA 3HNMA 5JR2A 4XURA 3HJRA 3VDBA 3E1F1 1L7QA 2VCBA 5DPNA 1W9WA 2J1AA 4ZY9A 1TG7A 4ARXA 4D8MA 2V5DA 4ZXEA 2QQNA 1CZTA 1UXXX 4W50A 3VD3A 2W92A 3J7HA 3PUIA 2B4KA 5JXJA 2BERA 1UWWA 1JYXA 4CUBA 2WABA 3AC0A 5JXGA 3OGVA 2YFUA 1ULOA 1CZSA 2VMDA 2C26A 3VDCA 4OUEA 2WYSA 5EIYB 1H6YA 2XHNA 4CUAA 5JXIA 4MO3M 1GOFA 2J1TA 2W1UA 4L0PA 2OKXA 5A1AA 3WF1A 3LPFA 3GDBA 3OG2A 1P8JA 4PF1A 2Y64A 1KEXA 2V4VA 4DUXA 1F4HA 1JU3A 3UETA 4OMDA 2V72A 1JZ2A 2BGOA 4BXSV 1RYYA 3ETPA 2R7EB 5CYYA 2W1WA 4UOJA 3EYPA 2VZOA 2EICA 2PQSA 1LNSA 1O8PA 5F7UA 3C7EA 4XUNA 1O8SA 4W8JA 2DDUA 4QB6A 3I2JA 3FHAA 3T09A 2VZQA 5HXMA 4QAWA 4KI5M 3IAPA 3THDA 2E26A 4XUQA 4W4ZA 3ACFA 3ECQA 1R64A 2DCKA 2CDOA 4AG4A 1W99A 3LPGA 1K3IA 1UYYA 1WCQA 1UY0A 2W47A 2VTFA 1PX3A 1JZ7A 2WAOA 4QX1A 3WQBA 4AAXA 1UXZA 1GUIA 1K45A 3EB7A 4HG6B 3WEZA 4MGSA 2W1QA 3WNKA 3WF0A 4DEVA 1NKGA 4A41A 2Y8KA 2YC4A 3W5MA 4QDSA 3T2PA 3JXSA 3D3AA 3LQCA 1GNYA 1OD3A 3NJVA 4CU8A 1K12A 4DUVA 1JZ6A 1J84A 4KMQA 5EJZB 1JZ3A 4CU7A 4P02B 4YPJA 3IAQA 2ORZA 2BZDA 3WF2A 4MGQA 4OYUA 3VD7A 2J22A 1DLCA 2W9XA 5C70A 4QDRA 2X10A 2EIDA 4TXWA 3ACIA 3OGSA 1HN1A
chains in the Genus database with same CATH superfamily
1ULGA 2Q8CA 1GP4A 5CVRA 3VHOA 3N9MA 1OBNA 1PVXA 1W0PA 1ZA7A 1J1LA 4GMP0 1K5MA 4XFFA 5CBLA 2KR2A 3CO2A 4LO7A 1ENRA 1REEA 1H8TB 2RM22 4LBQA 3PTYA 3VBUA 3BKZA 2ENRA 4YRDA 4YZ3A 2HJIA 5CADA 5GZEA 1WUVA 1RUG3 1COV3 3W20A 4UFIA 1XNKA 2D93A 3ZYGA 1NYWA 5FYYA 3T2TA 3VL8A 1GOHA 4XF1A 4UYBA 3E5QA 4Q27A 4HL0A 2KM2A 4PJYA 5FZCA 3R4UA 2ET7A 3GGLA 4QQOA 1C3HA 1LOFA 4K7JA 1FI2A 3I3BA 3UESA 5F37A 2E32A 1VRH1 1W90A 2PQQA 2WNVB 3RQ0A 5HCAA 2VUCA 5AC93 3M70A 3A21A 1XE0A 4D6SA 1UZ0A 4TWTA 4UFMA 3UKNA 3MV11 5E88A 4Q4V2 1ULEA 4RS5C 5E1RA 3WNMA 1US2A 3GZTB 3MO4A 1O59A 3FC0A 4YVSA 4MGIE 2I74A 2I07B 2ZGSA 5IATA 1UOFA 4MXVA 3GBFA 4I09A 3U78A 3K4AA 2Q5TA 3VD5A 1REFA 1Y9QA 5C4WB 3E5XA 4UFHA 2HYXA 1N3QA 2PAEA 2CWSA 1YFWA 3I3EA 3SLIA 1KFXL 2OVUA 2WZEA 3AYDA 4Z92B 2J1VA 1RINA 3Q8BA 2XMLA 4YW2A 2MEV2 4B1MA 3AXDA 4YM3A 5I8SA 4RHV2 4HFSA 1V6JA 2FMDA 3B69A 4A6OA 2EIBA 3HVDA 4TLGA 3JQXA 3USUA 1K42A 3ZSLA 5LZ6A 2LRPA 3D4KA 3WUCA 4XUPA 3MV01 3HQUA 4B4QA 2CV6A 2R30A 5C5TA 5FRAA 1UN1A 2P1BA 4LHSA 1JZ4A 4QHBA 2HWF1 1CAVA 3UJOA 5FZ1A 2P6HA 1H30A 4Z82A 4QXCA 1ND2C 2XLGA 3AVSA 1FMD2 1W6MB 2WSUA 1RUC3 4YGCA 2XB6C 4QPGC 2R0HA 2W94A 4JKKA 1EYBA 2C9KA 1AL23 2CHHA 4W6YA 3A4UA 1IGOA 4XXAA 1HJFA 5JXHA 4DY5A 2VMCA 1OQDA 1D4M2 4XXPA 3RZZA 1AL0G 2VTXA 2UWAA 4CDUB 2EIGA 2RR11 4WZCA 4BCUA 2WQZC 1PGSA 3D6EA 4IEPA 5A3UA 2X5IC 2B9VA 5FYTA 1TVGA 4BM8A 1KJLA 1VBB1 1RUOA 4LEJA 1RUJ1 1R082 1UIKA 3FWEA 4V1PA 1ZA4A 4CEWB 3I4IA 2DUQA 1WLDA 4M3CF 2OQ7A 4XCAA 2QQKA 3N36A 5IK4A 1JYTA 3JBG3 5JMOA 5FXXA 4Q1PA 2D6PA 5FMOL 3X29B 4BU2A 4NR1A 3WW2A 4U36A 4AFCA 4EV0A 3ZMOA 1IS6A 4XETA 1UY2A 5BNPC 4QPIB 1AYN2 1PIV2 1W8ZA 4I01A 4XHXA 4J1XA 3BODA 3V56A 3POYA 4XUTA 2Y0OA 2R1DA 4CDQA 5DXDA 1QF3A 4QU2A 1V0AA 2O0OA 4WM8A 3N9LA 2Y60A 3PUAA 3DKWA 4HSJA 2YG0A 5FKBA 1NA1B 5ACA1 3ACHA 5JI9A 1B35B 2R063 2R041 4KNCA 4LO5B 4NJ4A 2R0FA 2WAAA 5F5AA 4AHWA 4YZ1A 1H8TC 2D44A 4AFAA 2HWD3 2QQMA 5GZGA 4CCDA 2B45X 2JD4A 4YWAA 1W2AX 3AJYA 2W5FA 1W6QB 5B4XA 3MHZA 2FCVA 5FQ0B 3A22A 3C7HA 2PLV3 1V6OA 4XFHA 4LNVA 2LW8A 3HAGA 3CJIA 5DMYA 5FZIA 3M3EA 4MGKE 1Z7S3 5C6CA 2WJSA 4LE3A 1STMA 2ZEWA 1OA4A 1GZ9A 1GMMA 1J59A 3I3MA 3J8F1 5JZGB 4XTMA 1PMHX 2W1SA 1EY2A 5LA9A 2GNBA 1W0OA 2HLEA 2WNVC 5JOZA 2ZHKA 4IEXA 1Q3EA 2QJVA 1NZIA 1S2BA 4AYUA 1QQP3 3U37A 2VZSA 4BJ0A 2DYCA 2HWB3 1G9FA 2HEVF 2WWJA 4AR2A 3BGAA 5KHHA 4A4AA 1OPMA 2B9UA 4NIAA 2HWE2 4DXTA 3MBWA 4QB2A 5IJRA 1WLCA 3WHUA 4BIFA 1V6IA 3F95A 3NW4A 4F8AA 3MF9A 2D6KA 4GXLA 3AB0A 5LA1A 1WLTA 5IYYA 1XPWA 1PVC3 4PQQA 1UX7A 5LA2A 2VCMA 4M3CE 1M06G 1BYHA 4QM9A 3RRDA 5I0DA 1HRI3 5J98B 1CJPA 1FPN1 2WBKA 1BQPA 2VUJA 5E16A 5IVJA 5A7QA 1ENSA 4GB31 1K5MB 1EV13 5FZFA 4D7YA 5C4WC 2OS2A 5LY1A 1S2KA 2JG8A 4LBQB 3S5QA 2PHTA 3VBUB 1J58A 1IQDC 1YNAA 2XBO1 1POV3 1JYNA 1G9DA 4KWUA 1C8M3 2ORXA 2ZEZA 1TNFA 5ANNA 1SLAA 2BNNA 4GZ9A 5L7OB 5F2SA 1FOD3 3C7FA 3ZFEA 3NJXA 1OURA 1VBA2 5C3SA 1Z78A 2VQTA 4LKDA 4NIHA 1WD3A 4CA9A 2VCCA 4HKOA 4LUMA 5FPUA 2XVKA 2XJUA 3C8XA 2VZRA 3M3OA 1CD3G 1OQEA 2QZ3A 4Q5OA 1UAIA 4C0BA 4IV1A 4LPLA 2OPWA 2D5FA 1NAEA 3HOBA 4BQWA 3AYCA 2DVAA 2FDIA 1FXZA 1XNAA 2Y6LA 3DPRA 2VBPA 4GJYA 4IE5A 2KD7A 5F5CA 4AI9A 3O5SA 1AX1A 3ZN6A 5I0RA 4PIXA 3KB5A 1VBC1 1KQRA 4HKWA 3P3PA 3LD8A 1XYNA 1EUUA 2ARAA 4YZ2A 4XABA 2Q8OA 1JH5A 3I2KA 1ZRIA 4CDUC 2KA3A 1PGW2 3POFA 3SISA 3CBNA 5A6YA 1W05A 4YVSB 1Y43B 4XC9A 3W5NA 4ZHNA 1OLMA 2YB7A 1QIQA 5LA0A 2P6CA 2JDAA 3LFIA 4JHZA 1JN2P 1WA4A 2W68A 2CDPA 1G9CA 1NT0A 2QVSB 2VW2A 4CEWC 2NLRA 1PZ7A 4JDNA 2HBTA 5FV3A 1QJY2 2WQ8A 2ZEYA 4H55A 1U5ZA 4KBBA 4QX3A 3ZYRA 3KLSA 2A3YA 2XJVA 2ZX2A 4PI2A 2LUWA 3JU9A 4GMP1 1I9RA 4PCRA 1O3RA 1POV0 2ET1A 1OUSA 3H1MA 1KD7A 3U1XA 3AKPA 5A33A 4Q0QA 3NJZA 4QPIC 2WSVA 3MFCA 4XYXA 3USUB 2FDGA 4MGTA 2IZWA 3WNPA 4Q4X3 3MFAA 1GYKA 2WZR1 3E5UA 1S0CA 2W46A 5HI0A 1L3JA 4AI1A 3T0DA 1HXS3 4YSFA 5LW9A 2JDNA 3MUY1 1NA1C 1YQ6A 1B35C 2WFF1 5DDJ3 1CAVB 5DUXA 3T0BA 2YROA 1F9KA 5JSOA 1WMDA 2BVVA 4BA6A 4YG6A 2E9QA 2QZ2A 1BEV1 4HK8A 5FZEA 3E6BA 4G4FA 4P9XA 3F2ZA 4JKMA 4BHPA 2RM23 2UURA 2VQAA 4LBJA 1SDDB 4QKNA 1OVSA 3P6BA 5JR7B 3J7LA 1AYM3 2HWC2 2ZXQA 4RFT0 1JYWA 3PU3A 1ODNA 3WCRA 3QACA 3PU8A 5FZOA 1RUNA 3LEGA 4IEZA 1WWYA 1XB9A 4P9GA 2K46A 5FUPA 5JZGC 1ST8A 3PIGA 4ORFA 2FD8A 4UW3A 1TMF2 2UY9A 4BPZA 1RL3A 4PLOA 1TME2 4DZGA 2ZTNA 2QDNA 5FZHA 1OF3A 3AMNA 2H6BA 3OBZA 2Q8DA 4XJAA 3TWIA 1QY4A 3P1IA 2D43A 2VQUA 5I0SA 4YM1A 3SC7X 3TN92 4CDQB 4PIZA 3FBYA 4WM8B 5JR2A 2OXBA 4HONA 3AL6A 1H9WA 3VDBA 1GQGA 1RUG1 3E1F1 1L7QA 1W2UA 1K5MC 1OA3A 4XFCA 3WOGA 3WXPA 1TG7A 3NO8A 4ARXA 2VY0A 4D8MA 5IVFA 1JYVA 4ZXEA 3VBUC 4OUMA 1QJFA 2QQNA 2DF7A 2BUKA 2EVXA 2X8KA 3KCYA 3DUIA 1SFNA 2CNAA 4AE2A 1QDOA 2D6OX 1D2QA 5L7OC 3VD3A 3V0AA 1GBGA 5FYBA 1WCKA 1NQDA 3J7HA 3CJIB 5A7SA 3SQOA 3O1SA 2IXIA 1CVNA 1Q8OA 3UJQA 2VD7A 3IDBB 5LRSA 4AI2A 2YV8A 3AFGA 1XBFA 3SH5A 2AR6A 2OIIA 4ZONA 4W6XA 5AC91 4QD2A 1G8WA 1QJX1 1NG0A 2XVGA 1LOFC 1GQHA 2JE7A 2JIJA 4FOYA 4N7UA 1UQXA 3H0OA 1QDCA 3GCWA 1RUF2 2BP6A 3EQEA 4EN9B 5EIYB 1U0AA 3EHKA 1S0DA 4MO3M 1SCSA 2QKDA 1GOFA 2ZGOA 4LUKA 4S2DA 1JYIA 1DIWA 2ZGUA 3WP5A 5L19A 5L9BA 1Q8VA 1GZTA 4I0AA 1JYCA 3GDBA 4MSVA 1RXGA 5L36A 3V65A 4CP9A 4FPOB 4AQ2A 3OG2A 4IETA 1ODMA 4YVSC 5AFEA 3ILNA 2IFRA 5FY1A 4PF1A 2XVLA 2AZ5A 5IVVA 1KEXA 2V4VA 5FXWA 4CCKA 1U12A 1F4HA 4OMDA 1LODA 2JG8B 5KHKA 1AX0A 4BXSV 4LK6A 1MVEA 3O14A 1R1A2 5LEKA 1JMUB 1GLHA 4UOJA 5C9AA 5GZDA 3ZFEB 2VZOA 4AEMA 1QXJA 4UW6A 4HVQA 3DGTA 3DKQA 3R4SA 2XKOA 4HSLA 2IVIB 3SH4A 4RGAA 4WM7A 5IVEA 1H4GA 1N3OA 4P9LA 2YBKA 5JIAA 4META 5IVYA 3N9PA 3O0XA 4XUNA 1YCIA 1XNDA 4Z1VA 2AH2A 3WDVA 4BQ4A 5CA6A 4XBNA 1RUC1 1O8SA 3NVCA 4W8JA 2D3RA 4QB6A 1G7YA 1IQAA 1AYN3 1AL21 1ND3A 3FHAA 2VZQA 4IV1B 3ST7A 4C90A 5DUWA 5FZ8A 1AJKA 3DPRB 2RS53 1O4YA 2BOJA 2JDKA 1V9U2 2D6LX 4M0HA 4MVTA 3AVRA 3ZN6B 2GP5A 1X33A 3THDA 5FYHA 5A7PA 1UZVA 1Q43A 1X7NA 2XJPA 4K40A 2NP0A 3SNMA 3ECQA 4H2AA 2O8QA 2RR13 3OTFA 2CDOA 3BOWA 1UZWA 4RQPA 4AG4A 5KXBA 1W99A 3L2HA 3PTRB 3JBG1 2XUEA 3HBZA 2Y33A 5EWSA 2PAMA 4ISRA 5A3NA 5K9YA 5TSWA 1UY0A 5F6LB 5JPMB 2BV4A 2W47A 4QPYA 5FMBA 1KXGA 2XHKA 4UXAA 5GZFA 2WAOA 2GH2A 1NY71 4AAXA 1RUH2 3V0BA 1UXZA 1VBE2 3EB7A 1LGBA 1ZZBA 4HG6B 4QX8A 3WNKA 4LBNA 4ES9A 2AGSA 1LAJA 5T5PA 4GALA 4B29A 2EA7A 2K2SA 2BW8A 4P14A 3VKLA 1XRUA 2RS31 1BVP1 2IXLA 2XGXA 2Y8KA 2R061 2YC4A 2IVJA 2JDUA 4DRVA 3WP4A 4CDQC 3ZKUA 4IXLA 3T4VA 1BBT2 1QJU3 2HWD1 5F2WA 2H0VA 1X8EA 4XILA 4CU8A 5KXCA 4GAZA 1Y9GA 3WDTA 4Q1RA 4F3JA 1M4WA 1QOSA 4RL7A 2PLV1 3ZX7A 3ZXJA 2WLPA 1C28A 5KXDA 1JZ3A 3VBOA 1GWKA 4CU7A 4YPJA 3WF2A 3B02A 1Z7S1 3IKWA 4MGQA 5EXOA 5FPLA 2F4LA 1ASJ2 4PLMA 3K51A 1JXNA 4P9WA 4YVWC 2VXJA 4D6RA 3ZSJA 5IK5A 3HN1A 1YI9A 2EIDA 4TXWA 3NV4A 4HN0A 5FZ9A 3VL9A 3CJIC 4DS0A 1GNHA 4FPFA 2VVDA 4YYOA 4QGLA 3OD4A 5JDBA 3OGSA 2W39A 4X6RB 2RS12 2VUAA 2VJXA 1LECA 2HWB1 4FSJA 1HB4A 1XC6A 5FZOB 4FFGA 3WF3A 2V09A 1BMV1 3H9AA 3LIGA 2H6CA 5E89A 3ZO0B 2A75A 3T2OA 1VB2A 4FXGB 4CCOA 3K4ZA 4CXWA 5HCHA 5BV6A 1D4VB 1PVC1 2ZMKA 5H9QA 5LBFA 1QOOA 3IBMA 3UGFA 5T5LA 2ZOEB 1CIYA 3HIFA 4BK4A 5FO8B 1UYPA 4LO6B 1HRI1 3C2UA 1IS4A 1MS9A 1DHKB 3GZUC 1OKQA 4JX0A 2FZ1A 1EV11 2ILMA 1OMIA 4LJHA 4ARYA 5BNNA 1H0BA 4S2FA 3UNPA 3BIWE 5IVCA 1N47A 1POV1 2CU5A 1E5SA 3WQ7A 2W0XA 1C8M1 1NQJA 4GD4A 4JRAA 4AI8A 2G4IA 2ZMNA 1Q56A 1ULDA 1FOD1 5EYYA 4AEJA 3IMNA 5C8WA 1OQ1A 2W91A 4E2GA 1ULPA 1OKOA 2JG8C 2PFWA 2XBO3 4QGNA 1F31A 3GZEA 4O9GA 4UAPA 4NPRA 1AR62 1H6XA 1WA6X 1C5HA 1VMFA 2QBXA 3QH7A 3V0AB 1GSLA 4YM0A 3ZFEC 4N7IA 4B4PA 2VZVA 2AENA 2W95A 3AP5A 2PELA 5FCCA 3RWNA 1YFYA 2GAUA 1JUHA 2J1SA 4DNYA 2NN8A 1FV3A 3NNJA 2D7FA 3H3ZA 2XJTA 1WMEA 5KC6A 3JD73 4CDWB 2JJ6A 2WNEA 3ELNA 3R05A 4UFJA 1OPOA 4LHKA 4AVVA 2PHDA 1GZWA 3K3OA 3SKJE 3DPRC 1DYOA 2EXKA 1W8WA 2EIEA 4L2NA 4R4ZA 1AHSA 1LOEA 4OVEA 4OI1A 1UY3A 2DVBA 1PO23 3CLPA 4NUBA 3GBWA 3WNXA 4E4ZA 5I93A 4AGRA 2G9ZA 2NZ9A 2FCTA 3U4SA 3FUOA 2QNKA 3OF1A 3QOPA 3O1TA 1RUE3 2XG3A 2OT7A 1JZ5A 2VXRA 4CP9B 3KV5A 3JB8A 1LRHA 1R092 3ZYFA 5DAXA 4B1LA 4OHYA 2JIGA 2QQOA 4JQTA 4PF5A 5T3NA 1UY1A 5HCFA 2B42B 4I3GA 1OA2A 4K1ZA 4LORA 2V5YA 1IOAA 1F8VA 1GICA 5KXEA 4IGOA 5JOYA 1WKYA 1ZBA2 4BLJA 4AVTA 5A7OA 4Q4X1 5C9AB 4H3WA 3GM8A 4WVMA 4XBQA 3LOBA 1A34A 1NCQA 1HXS1 1G6NA 4WM7B 4MZUA 3OJBA 4AOCA 1TME3 5DDJ1 2GNTA 5FYSA 1VBD2 2Z2SB 2YBPA 4KWKA 2UY8A 1IPSA 1ND3B 1W6QA 1QGLA 2R072 5ERLA 3NQHA 1CJDA 2GALA 3SCGA 4FTSA 4JRLA 1C8NA 2RM21 3RDIA 2ARBA 5FOJB 3AJZA 2QQVA 5T55A 4EWDA 2WNOA 1AYM1 1AR82 4M01A 2WZ8A 3KF3A 4OI2A 3H8XA 4GJZA 3KV9A 3WCSA 5CFDA 3DECA 2WO7A 1IS3A 1JOPA 4ES8A 2WS92 1WD4A 3HPNA 4RQPB 4RR3A 4XF3A 3POGA 3RZHA 3NMBA 2HKXA 2XJSA 5FAXA 1NCRA 2ZABA 1DQ4A 3EJKA 1IKQA 5DAPA 3VUOA 1DQ0A 1W6OA 4XMIA 4COYA 3WG1A 1I1EA 4CTEA 3V0BB 1US3A 4XPVA 3I49A 4PQ9A 5F3GA 3OUJA 3AYAA 3ORJA 1ZYBA 4M3CA 4GWMA 4YLZA 4MADA 1D7PM 4IGPA 5BYNA 2VC9A 4PIYA 3AZYA 1W8NA 2JEMA 1N3PA 3M7AA 3I2HA 4IW3A 4COUA 2AEYA 4UWDA 2YFZA 3OCPA 5FUNA 4CCEA 4N43A 4NHLA 2RDSA 2JB4A 2ZGNA 4NRPA 4YW4A 3WNNA 3THPA 1DGWA 3AKTA 4KH9A 3MEPA 4IUGA 2J1RA 1H9PA 3NV2A 1VRBA 5L7OA 1OF4A 1S0BA 1EAH3 3L9JT 4KU8A 4OFGA 2JE8A 5JMCA 4LITA 1HN1A 5FY5A 3VBOB 1LENA 4HMZA 2KXLA 3POJA 3BTXA 2J7MA 1VJ2A 4RD7A 5JVVA 1XNCA 4XIOA 5I8YA 1NLRA 3VBRC 5A3TA 3E6CC 3VLBB 5BXXA 2JG9A 3K3NA 1DYPA 3OOXA 5DUVA 3HEIA 3AFKA 3VD9A 4Z2WA 3U10A 3O1RA 1QJX3 2G19A 1C1FA 3G7DA 1A3KA 3O0VA 4A7YA 4CDWC 4B8EA 1I5PA 5J3UA 3VZOA 3IZOA 3N7JA 3M8LA 1NXD1 2BGCA 3LWCA 4LT5A 1PM4A 4XFGA 4ZKTB 3T1LA 2EAAA 5FP4A 1JI6A 3B3QE 2ADEA 3CHXA 3JCIA 3PLQA 4LIVA 4G9SB 4NHKA 2A1XA 3I7DA 3UV9A 3CL1A 2AUYA 1N1SA 1RVF2 2A6XA 1ONAA 1SHWB 2GU9A 3ZDVA 1LESA 3J7MA 4UFKA 1C57A 4LBMA 5B2GB 4QKBA 3ZIWA 5BNNB 1VR3A 4UW5A 3N7KA 5GLWA 5CEHA 5J09A 4Q8KA 2CL2A 3THCA 5CU1A 1PO13 2Z69A 4QB1A 4CDXA 3ZYJB 2WWUA 3FJSA 3OYWA 4Q0PA 1R081 3SMHA 2GNMA 5FUIA 5JCTA 3AZZA 1BHGA 2P3IA 3URFA 2VZPA 4CPBD 4WZFA 3A7QA 5C9AC 2WO2A 3ITQA 4M4PA 2CGOA 2B8MA 3BIEA 4A45A 4F7ZA 2EAKA 2QQLA 2R1BA 1UMIA 3AZWA 4IGQA 2UWCA 4BE3A 1AYN1 1PIV1 1VALA 4WM7C 1RUH3 4GULA 2XKPA 2EXJA 2WRAA 1YUDA 2RS51 2YUEA 3LDKA 4LLFA 4RN5A 4AFMA 4UW4A 5GM0A 1OT5A 1GZWB 1ND3C 4QXHA 4XEZA 4COVA 4OI0A 4I02A 1VRH2 1W8FA 5C3OA 3WNLA 2Y26A 2DVGA 1MPXA 3OPWA 2UU8A 3E6DA 1GQPA 3H7YA 4Q0SA 1KJRA 2ZCWA 3MW2A 5G04L 2YXSA 3GALA 3WDYA 3LIHA 3BYWA 4IEUA 5CNAA 2GN7A 2BYVE 4ONUA 3RNSA 2JDMA 4FVVA 3NJYA 3Q8CA 1RUD3 2Y6FA 3PMSA 2X05A 2VCAA 4QKDA 1WBLA 4RQPC 3MIHA 2ZEXA 5HV4A 3T1MA 1SLCA 5A3WA 1QOTA 4Q4Y3 3AKQA 4Y5TA 4ZZ8A 1TNRA 4MH0E 5FZ4A 4MYEA 5FZGA 3T4HB 1LHOA 1W8HA 4JQRA 4ET7A 3C7OA 5C3PA 2VQ0A 4QX7A 2WL1A 1EPWA 3ABZA 4YFWA 3BU0A 1UCXA 4QDQA 1J3PA 2WINB 2YC0A 3LGRA 4A44A 1F4AA 4YARA 5DG1A 1QJU1 1AR73 4WVMB 4EQVA 2DCYA 4DB5A 3HR9A 3WW3A 1NCQB 4KQ7A 4D0QA 3LA7A 3ZXGA 2RS33 2WN3A 2NPIA 1UNBA 2GH8A 4FTBA 4ZU7A 4R4XA 1RHI3 2BBVA 3VB9A 1UOGA 5FXZA 2WC2A 1AX2A 4JAAA 4HBNA 5IUQA 1QJEA 4YVWA 4NVPA 4YG0A 3I2IA 2L9LA 3PVBB 3VZJA 5FZ7A 3VBOC 4D7SA 4NHXA 4DMIA 1BVVA 2XWJB 2GC0A 2OPKA 2QQUA 2XXZA 3IB3A 2ARXA 2VU9A 3UKTA 1OH4A 3KMHA 2WUHA 3PJQA 3UK9A 5CFDB 4I30A 1PZ9A 4PDWA 2FQPA 3HQRA 1W9FA 4RR3B 3KV4A 1ENXA 1O4TA 4FAHA 1NCRB 1TZOA 2E7AA 4JTOA 2K0GA 1MZ5A 1W9WA 2J1AA 4ZY9A 4XCBA 1W6OB 1VBB2 3BTZA 1VAKA 1WW4A 1FX5A 3M4FA 1ZRDA 1F15A 2JDPA 2Q30A 1CZTA 4M3CB 2ZGPA 3K48A 4CCMA 5KR7A 4W50A 4IE4A 4NN0A 5CKMA 2WZPP 2YU1A 1RMU3 2B46X 5FYZA 1HRV3 5C3QA 2ZX1A 1D2SA 4YW3A 4LHLA 2D3PA 4N43B 3IM0A 1W8TA 4ZS3A 5SV8A 3WUDA 1YRZA 5BNNC 1JYXA 1RXFA 2WABA 2G9GA 5FTTC 4DINB 3ZN5A 3OGVA 5LB6A 2YFUA 1ULOA 4N9IA 3DN7A 1H4HA 2VMDA 3PDQA 1MEC3 5CAZA 5FYUA 3LA3A 2C26A 2D98A 2R042 1ZZ9A 3AMPA 3VDCA 5ACA2 5FWJA 3FX3A 3EO6A 2VOWA 4ISQA 4KBZA 3LA2A 2GMEA 2XHNA 3LCPA 5BPXA 3SXWA 1WZXA 4AVCA 5JXIA 2J1TA 3B9IA 4I3PA 1RIRA 5K4LA 2C6SA 2PXJA 1SLLA 1RUI2 2ATFA 2I45A 1Y9MA 3P3NA 4IEOA 3JD71 5FMCA 3RGBA 4URAA 2MPFA 2A6YA 2JG9B 3IMMA 4NWVA 3N9OA 3USSA 1LOAA 1SQ4A 2P2KA 1UU4A 1GR3A 2WWSA 3FE5A 1PO21 4GH4A 4YZ4A 1SEFA 4DUXA 3RZLA 5IWFA 1V6LA 3BOPA 1S0GA 5L9VA 1RYYA 1RUE1 2R7EB 4AXOA 2W1WA 2YY1A 3KT4A 5KWRA 2R6QA 1AXYA 3BB6A 5FJKA 4AW7A 5KC5A 2MNGA 3WR0A 1JOJA 1YFXA 4JGZA 2PQSA 3VKNA 3DV8A 3S57A 2A7AA 4R9DA 2A3XA 5FREA 2Q8EA 4Y26A 5F7UA 3V64A 4AHZA 1W39A 3HT2A 1TE1B 3MLKA 3HBKA 4N90A 3WW4A 5AVAA 3C7EA 3WQ0A 2JDHA 4WBBA 1S0EA 3B9CA 3IDEA 1S0IA 3I2JA 4ATFA 4CDXB 3H50A 3T09A 1W04A 4Y4YA 3OYWB 4LR4A 1FPN2 3PVOA 1CAXA 5HXMA 5KHIA 4QAWA 2DFCA 4GB32 5K0UA 3OGJA 4BOWA 2JWPA 2CWMA 1X8MA 2JENA 2RDRA 1TME1 1MZEA 3WG3A 3KF5A 4TSVA 3CU7A 4YFZA 3B7MA 4UFLA 4W4ZA 4IEYA 1C1LA 4LMFA 1WCSA 5FJHA 1ZRRA 1NCQC 2XR4A 1S0FA 5ISLA 1J3QA 1QNYA 1O3QA 1GKBA 4NO4A 1UYYA 1HV1A 1W2OA 1UPSA 1WCQA 2GP3A 4AFDA 3RSJA 3S7IA 1PX3A 3ZXDA 2HEWF 1Q5OA 4XW3A 3WT3A 3ZSMA 2TEPA 1GUIA 3FZ3A 1VP6A 1H1MA 3GHMA 3E97A 2DTYA 2W1QA 5BNOA 4DRRA 2VH9A 1AZDA 3ZFGB 1HKDA 3KT1A 3LZZA 5F39A 1WBFA 4BQ5A 1MS3A 1V6KA 2Z5WA 5CFDC 4BMEA 3T2PA 5A6ZA 2VG9A 3EBRA 3LQCA 5FMDA 3I3QA 4LIUA 4LTAA 4RR3C 1GNYA 3TNQA 4XFBA 4FQ4A 3HMYA 1W8UA 1MQTA 3MIDA 1POQA 4NRMA 1NCRC 4EWEA 1OSGA 3DCQA 1QWRA 4EJRA 5IK7A 4LLOA 1QU0A 2IXKA 3HWJA 4NPLA 4KMQA 1DDLA 1LTEA 4AL9A 4LBLA 4P02B 3BI3A 2ORZA 1LOBA 3POIA 3TEZA 4AQ6A 2VNGA 4OYUA 3WD5A 2J22A 2DVDA 4P5HA 2YGLA 2ZX0A 2X10A 4H7LA 4AF9A 2D40A 3G6JB 4LBKA 4MGYE 3ACIA 5FZMA 2P3JA 4INDA 5J37A 4Q4V3 4QXKA 5JIUA 1F35A 1EAH1 4N43C 2ZPXA 1YLLA 4Q2FA 5FKCA 2EALA 4BQYA 1DLLA 3K46A 3I3DA 2DV9A 1RVF3 2WZR2 1SLIA 4K3UA 5JPNB 4XDOA 4YVWB 5DN2A 4IESA 2GNDA 3CDZB 3VBRA 2SLIA 3O1OA 4DUWA 2BDRA 2UYBA 2VW0A 5FYVA 4FPGA 2JDZA 1PX4A 5EYXA 5IT6A 4D6QA 1NE4A 1ZBE2 2MEV3 3TRSB 3JZVA 2VMHA 4BQ2A 1JS9A 1VPHA 1BEV2 4CDWA 5A3LA 4PDWB 5GZCA 4RHV3 2JG9C 2QFEA 3O0WA 3Q8EA 2BRTA 2ZJCA 4NAMA 2DVFA 1CAWB 1MS1A 2D5HA 3ALQA 3ZSEA 2ID4A 3ZKYA 5I8TA 2QQIA 1X82A 1X50A 3ES1A 3D0SA 3DYPA 3LE0A 1LGNA 3MPPG 2X09A 3LEMA 4URTA 2WQ4A 4XJUA 5FXVA 1T6BX 2Q4SA 3VBSA 1YXWA 4MUVA 4K8FA 1J1TA 4KU7A 3U11A 5FFOC 3UKVA 4BLIA 2VBBA 4HPKA 1YJLA 5A80A 1FMD3 2JB8A 4A7KA 2E6VA 2AEZA 2ZS6B 4UT5A 3TEXA 3SKVA 1LB2A 1IS5A 1CZVA 1PO11 3FHIB 1LR5A 2ZKNA 3M3IA 3MF6A 5EHDA 1D4M3 2GC2A 4QM8A 1DQ1A 1OH3A 3I54A 3FFQA 3ZYHA 4XF4A 1DF0A 1ALYA 2UWBA 1W2NA 3POBA 4V2VA 1YQCA 3VBHA 4P9IA 2DU1A 4LBQD 4CDXC 4IEWA 2W08A 4K8RB 4W6WA 1COV2 1R083 1HIXA 4UBHA 1MS4A 2OA2A 1RUH1 1XNTA 5HXVA 4KL1A 2ZX3A 4M0NA 1UMHA 5K7PA 1VMJA 1MS5A 4AVAA 4OI4A 2WO3A 3KT7A 1XYOA 4YGBA 3MYXA 5GLUA 1W8OA 3UL2A 4TTGA 1PIV3 5D21A 2JDYA 3LAGA 5JOXA 3AZVA 4YG3A 2E31A 2E7TA 4LQRA 1J83A 4LKFA 5AC92 1BBT1 2QQJA 4GH4B 1VB4A 3AZXA 3ZVXA 4HETA 4FP2A 4CU6A 5F3IA 2A5ZA 3ZXKA 5HV0A 2B7YA 3NRUA 1ACCA 1UD1A 1W9SA 4X8NA 1GOGA 1WMXA 3PL0A 4PHZA 1RUD1 4DY3A 2HH9A 3ZFGC 2VR4A 4BIOA 1H2KA 2Q0AA 4JGZB 3VKMA 4XJ8A 1OLQA 3AMQA 4Q4Y1 1UKGA 2OQ6A 3HT1A 3ASIA 4JZRA 4JKLA 4FAGA 4OQ8A 1W03A 1CPNA 4EYUA 2BWAA 3SITA 2YHJA 2A71A 3MIGA 4IEVA 3PHMA 5F9TA 1AR71 1CAXB 3MW4A 4FQZA 4GA9A 4LK7A 5FIXA 3AYEA 3FUQA 4Y1UA 5K0UB 5C8CA 4Q4W2 1H2MA 3CQOA 3MI8A 4XZUG 3GNEA 4CUCA 1H1AA 1XOYA 3HNYM 4P9JA 1FNYA 4QX2A 2FCUA 4JTNA 2ZGRA 3NNFA 1RHI1 4EN6B 1XSRA 2HWE3 2Q1MA 4AK3A 4LBOA 1CAUA 1FAYA 4QU1A 3I2DA 3ATGA 3RS6A 1W6NA 2CTVA 4XJWA 4OHWA 2Y6GA 1W2TA 2IXCA 2Y34A 2B5HA 2J1EA 1HV0A 3VDAA 1OFSA 5CFCA 1YI7A 3BPZA 1SBFA 4H7MA 4QQLA 1LJ7A 2RVAA 4GKYA 1AL22 1UYXA 5G05L 4QQ2A 2ZA9A 3ZM8A 3QBQA 5BNOB 3N35A 4NAOA 5A6QA 1KITA 5F8PA 2VZ1A 1O3SA 1BXHA 1B09A 3IWZA 4OMCA 1W28A 2PTMA 4NMIA 2OYZA 3K2OA 1HQNA 4XJZA 4PDWC 5SV5A 4C1WA 3KD4A 1KS5A 3UT0A 1OLRA 1VBA3 2JX9A 1LGCA 5JWPA 4ITCA 3KQRA 4NROA 4H14A 1AUYA 2PHUA 1MQTB 5F5QA 1RUI3 1HQWA 1RMU1 4NRQA 1S55A 4YW1A 2VNOA 4FPCA 1HRV1 3OSDA 5APAA 3KZ4C 4QX0A 2DTWA 2WNUA 2PA7A 5EPAA 1NY72 3CMGA 3WVJA 2A73B 4CP0A 1N1TA 2SBAA 3H1YA 3ZIXA 5A1FA 2CY6A 3RJ2X 4NE9A 4TLFA 1QEXA 5DQ0A 1E5RA 5EJ1B 1MEC1 2NMOA 1YIFA 2VM9A 4FCAA 5BY5A 3ZXEA 5C7GA 1REDA 4D3WA 5LY2A 2Y6KA 3I2FA 4JDOA 3WLUA 3H1WA 2BOIA 4DQAA 4E27A 4MV2A 3TEWA 1DZRA 4EROA 5IW0A 4RGGA 2HWD2 2K9ZA 4IE7A 2BFUS 2E53A 2WT1A 4QKFA 5FR3A 1DQ5A 5DZFA 1ZZ8A 2YDEA 3VBRB 2ZX4A 2XOMA 2O8OA 2VECA 3KCCA 1O4ZA 2PLV2 1WCUA 1SLBA 1QJY3 2P4EA 3KM5A 1SFYA 2VPVA 1DQ2A 4EE2A 3WG2A 1PZ8A 5FP3A 5C71A 1JHJA 1F2NA 3Q8FA 4AEKA 1Z0HA 1GV9A 4L9BA 1XSQA 1IG3A 2P34A 2Y6JA 2QQWA 4HK9A 5T54A 1PGL1 1LOCA 3FLTA 2BJSA 2NMNA 2VL4A 4TYSA 2EXIA 3J9SA 4P5YA 4ZZ5A 2XONA 1OOPB 5CISA 1GU3A 1UPIA 2YPJA 4Y5SA 4GH4C 1QQP2 5HPOA 1O3TA 1X9TA 3VBSB 1C4RA 1DGRA 1BMV2 2BEOA 3O12A 1OVPA 2RHPA 4IEQA 2BNMA 2J1UA 4HPKB 1FNZA 3VBFA 1DGWX 2VNRA 4Q29A 4XOGA 1PVC2 3APBA 2Z42A 3MDPA 4KGQA 1AR81 4JGZC 3IN9A 3O7OA 3AKRA 2C4XA 4JGYA 3O1UA 1HRI2 3HNBM 4EN7B 1SCRA 1DP0A 1EV12 4A3XA 5FYMA 3VBHB 2HWC3 4EZHA 1D0GA 3AL5A 3IPVA 4HKLA 5F1RA 1UZZA 2VMFA 5JSPA 1YEWA 4B3NA 1KFUL 4J25A 1W3XA 2RMU2 1C8M2 3O1PA 2ZAHA 4ZXKA 3U75A 4FTEA 3GZAA 1AR92 1FOD2 2JKXA 2BWCA 3NNMA 3SEPA 1TMF3 3H42B 4BYYA 5K0UC 3PJYA 4GWJA 4BH9A 4TN7A 4Y1XA 5ANQA 4CP1A 2R16A 4KWJA 2BBAA 2ARCA 4QGMA 5T5JA 1MACA 4XUOA 3H8RA 1GNZA 3ON7A 5A6XA 3GJAA 4FXKB 5FYIA 2W3JA 2V73A 2ZHNA 3TN93 4HVOA 3VHRA 4Y1VA 4JVAA 3CZUA 1APNA 4MOAA 4QPWA 2JE9A 5LBEA 5B4NA 4F83A 3PNAA 3NV3A 4PLNA 3OB8A 5DUUA 3WX5A 1MVQA 1PMJX 2VZ3A 1NLQA 2QTWB 5A7WA 4XF0A 3RI9A 2VUDA 3AP9A 5BNOC 5JOWA 1WCDJ 3LEKA 1XU1A 4FPHA 4E4DX 1UX6A 5LBCA 1CESA 1DZTA 2HYKA 3INAA 4QMAA 2DCZA 4BK5A 1YYNA 2P3KA 3A23A 3MIBA 3ACGA 2G9FA 4OZOA 4COWA 1W9TA 1BK1A 1NZCA 3PVNA 3TB0A 1MQTC 1G9AA 1YO8A 1CR7A 1ZBE3 1TQ5A 3H3UA 2VOVA 4NHMA 5FY0A 1LHNA 3BU7A 4YGEA 2X29A 2YYOA 3D0JA 1KS4A 3UGGA 4Q4V1 5C8CB 2XQRA 3TEYA 4UF0B 4GIQA 2PMWB 3ZSKA 1W06A 3AXEA 4AGVA 2XWBB 1RUF3 2YC2A 4IDZA 5A32A 5CB7A 1UKRA 1SBEA 3H8UA 4IQPA 4Q4X2 1JU4A 1CAUB 1CIWA 1IHMA 1RVF1 3I2GA 4XIKA 1W6NB 3CJXA 1HXS2 3VKFC 4DFSA 3T30A 1N1VA 2XL7A 2XLFA 4RSUA 3PUSA 1HW5A 5DDJ2 3HJRA 1Y7BA 2VCBA 5CFCB 5DPNA 4FPKA 5GLTA 3NNLA 2IWGB 4O9EA 1JHNA 3LSDA 2MEV1 2WKKA 2RJLA 5FZ3A 2IUWA 2PHWA 4CEYA 4RHV1 5FO9B 1NE6A 2PYTA 1UXXX 5FO7B 3TNPB 3U4XA 1XYPA 1WW6A 5L73A 1AJOA 4E4HA 1PNGA 5J48A 2E51A 1R1A3 3AP6A 3OUHA 4ATEA 1AYM2 4LO8A 1E5HA 3U14A 2VOXA 4JCKA 2BERA 1UWWA 2R32A 3WDWA 4J1WA 3WV6A 4AFBA 4C1XA 1WW7A 4GWNA 4CUBA 1H8VA 5F6KA 5JXGA 4AAPA 1BLZA 4FT8A 1CZSA 1FMD1 1LU2A 1OOPC 1LHWA 2O1QA 2XUMA 3NV1A 3R0RA 4AQSA 1KDMA 4MGZE 3VBSC 3AK0A 4OUEA 1PK6A 2WYSA 3BTYA 4OQ9A 4FO9A 2TNFA 4CZSA 5C33A 2JKBA 1D4M1 4CUAA 2WNUB 3O1MA 2Z79A 2UYAA 1VMHA 3Q9OA 5BUVA 2VTXJ 1V9U3 3TAYA 5A1AA 3LFMA 5FZDA 5FZLA 4FOQA 5T5OA 4ZPIA 4OHZA 1IPKA 2YMZA 2OUHA 5EJ3A 4COZA 2TBVA 2ES3A 2XH6A 4E9KA 5FPVA 1LEMA 1P8JA 4YNIA 4Y22A 2Y64A 4PBPA 3VBHC 3HD8B 4L97A 5LASA 3RZMA 1JU3A 4SBVA 4XQ4A 1JZ2A 1O91A 2BGOA 4PBOA 5FY8A 3U0ZA 1C5IA 2RG4A 3ETPA 2X53S 3DF0A 4FPEA 3RG0A 3W58A 1MZFA 1QHDA 3VZKA 4BXFA 4Y20A 1UMZA 1VBE3 3EYPA 2EICA 1LNSA 4HXCA 2A3WA 1SPPA 2VE1A 4RA0A 1O8PA 1UU5A 2G1MA 4XDQA 5FZBA 4L11A 4ASMB 2QE3A 1RJ8A 4Q4W3 3VDDA 2NYYA 2LALA 2DU0A 4Q26A 2DDUA 3QCWA 4M00A 4MX3A 1BBT3 5FPZA 3RYRA 3SCHA 4E2QA 3ZFGA 5LK7B 1ZRFA 2WIIB 1YFUA 4YGDA 1XQNA 4NHYA 3VBFB 4AI3A 3M1HA 4YM2A 4XUQA 1CONA 3ACFA 2XL9A 4CCNA 4D69A 1ASJ3 2HBUA 2XJQA 3ZN4A 4JGYB 1UOBA 5HCBA 3ZXFA 1FV2A 4XACA 5DZEA 3LPGA 2CAUA 3S5AA 3IDCB 1VAMA 1HB1A 1I6XA 1K3IA 5CIRA 1PM7A 3GCXA 3IPVB 2RS13 1ZZ6A 1E5IA 4I0BA 1CGPA 3AP7A 4MXWA 1JZ7A 3ZPOA 1DZQA 2HWE1 1ZVFA 1XE8A 3AM2A 4MGSA 2WT2A 5AFBA 5C8CC 2ETEA 5FY9A 1H2LA 3BVCA 1VE0A 1LU1A 3NL1A 4SLIA 4XAAA 4ZU4A 1L7LA 5H9SA 3RWKX 4UBGA 3THTA 4BZ4A 1NKGA 4DEVA 1ZREA 2ZZQA 1UW8A 4OCTA 1LKNA 1MR5A 4L99A 3W5MA 2PN5A 2O14A 4PI0A 1AF9A 3D3AA 1MZ6A 1NOVA 3O1VA 3H8OA 3S30A 1OD3A 4ZS2A 5T50A 2HWF2 2QCSB 3PURA 4WV8A 1K12A 1OC1A 2RS52 5GKAC 4BB3A 3D82A 5H9RA 5CFCC 1J84A 2YU2A 5A3MA 1RC6A 5F5IA 1QJZA 3LDRA 2GN3A 2BZDA 2YBSA 1O5LA 3A0NA 3ZYIB 5A7WB 4FPYA 1VBA1 3NAPA 5IAVA 5C70A 2FDFA 4X6QB 4QDRA 4XBLA 1AR63 1CAWA 2RR12 2OW4A 5JAXA 4XFAA 4A2UA 4YW6A 1LOGA 2ZAAA 1RUI1 1JTZX 2DWRA 5FLHA 1FATA 3KCXA 1RUJ2 5FP9A 2IXHA 2JXAA 1OXCA 3ZFFA 3GXUA 4LHNA 2GMPA 2WA3A 3LF7A 4PT6A 5L9RA 4LE4A 1O7FA 1BJQA 3RPQA 4OHVA 5DZGA 4DOUA 1X9PA 5FWEA 1RB8G 3JB4C 2Y0IA 3AX4A 3Q8AA 3T0AA 2VW1A 2ADDA 3OUIA 3ZYPA 2RV9A 3I8TA 2WNUC 4AEDA 4LOTA 1AXZA 1YWKA 5A32B 1PGW1 1JW6A 2A70A 3MIFA 2NQYA 2P3YA 2VO5A 3N7MA 3SHRA 1DQ6A 3BCWA 4B7KA 3VV1A 1QJU2 2RDQA 3WNOA 4V2WA 1UF2C 4Q8LA 1CQ9A 1QKQA 4RYDA 1D0HA 4XJ9A 1EPZA 4M4RA 1KGYA 5FK7A 1R093 3ZR6A 4K20A 1QJY1 2PHLA 2PHXA 3EXUA 1WMFA 4BISA 2BNOA 3WSOA 4CEYB 4A3ZA 4W65A 5I0UA 1ZBA3 3NNGA 3MLJA 5D8AA 3ETQA 1W0NA 3KWVA 3U07A 2VVFA 3CNAA 4FOWA 2RMU3 4DO0A 1CX4A 1I5ZA 3N7LA 2IFWA 1GP5A 2W52A 1YIPA 1AR93 1Q8SA 3FLPA 3GBGA 3ENRA 1URXA 2E33A 3J8F2 4DXZA 3POEA 1OHFA 2WA4A 2WR9A 2VZTA 4BDVB 2CAVA 1O5UA 1VBD3 1ZZ7A 3KGLA 4QX5A 4Y24A 4HLTA 2WDBA 2CGNA 3IDAA 1QH6A 2AC1A 3B5LB 3DYOA 5FY7A 1K5JA 3AP4A 3NWKA 2R073 5FMOS 1PK6B 4LA2A 4NPMA 3RVHA 3VHPA 4OZXA 2BPA2 4QQHA 3HQXA 3VBFC 4P00B 3OD0A 2W87A 1XE7A 2HWC1 1AR83 5KBFA 3PUHA 3IIIA 1F5FA 5F3EA 5J1XA 1UZYA 3LOIA 4JGYC 2F6BA 4YW7A 5F3CA 1FT9A 1SFPA 2VOTA 3T3YA 1Y3TA 4IV3A 4Y4RA 2N7GA 2WS93 1TMF1 2RJ2A 3NKGA 4Y22B 3ILFA 3LSEA 2XBO2 4R52A 3PIJA 3KV6A 2MHFA 4C8DA 3KSCA 3WDXA 1MS0A 1BK0A 1T6GC 2DCJA 2OZJA 3J4UH 4QHOA 4RFRB 3RZGA 3WINE 1WGPA 5FY4A 2ZACA 2Y6HA 5IHRA 3PUQA 4E8CA 4Y20B 3CIHA 4OULA 2E63A 3SH3A 3TN91 1H2NA 5LWBA 2VMGA 1SPPB 3QLQA 4MLOA 5EFUA 4WVWA 3JD72 4DXRA 4DEQA 2ZKLA 3I97A 4GWIA 3VDDB 2YPDA 2VULA 2LROA 4FFFA 4FPLA 4E8DA 4LKSA 4N53A 3TYJA 1W6PA 3FL7A 2DFBA 4A42A 1A8MA 1PO22 4BQ1A 4NWWA 1VBC2 1V70A 1BKZA 5FBZA 1IG0A 4BMBA 1YJKA 3OEBA 4KG0A 4MHRA 3KVAA 1GWLA 3N3HA 5F32A 3RFRA 2ZMLA 4AWDA 3RYKA 1RUE2 4E2SA 2P5BA 4N8MA 1UO9A 3B93A 3ZPYA 3ME2A 4CU9A 1SG3A 3CZJA 3WDUA 1ZBE1 2AYHA 3MUZ1 4A7ZA 4D94A 1LULA 2ZBJA 2C0ZA 2VVEA 5LEJA 5ABJA 4RGKA 1E57A 1O6UA 2XQXA 1S0JA 2GSYA 4GKXA 5IVBA 3W21A 3K4DA 1RUF1 3MICA 5CZKA 1F5JA 5FZ0A 5K8SA 4MXWB 3C7GA 2EXHA 3HN3A 5DG2A 2OX0A 3T2QA 4BQ3A 1L7RA 4CXXA 3VZLA 1KRIA 1IPJA 2GZWA 4QT6A 2BQPA 3FN9A 2V4AA 4R8HA 5FBJA 5A70A 2PAKA 4B7EA 2JD9A 3WY6A 5FZKA 4AI0A 4AQTA 2RJKA 2LM3A 1Q8QA 1V6NA 2VMEA 2VMIA 3W9AA 2W2IA 3NKTA 4Z2AA 1QXPA 4IE0A 5A7NA 4O65A 1QNWA 5FLJA 1LEDA 3BN6A 4CYDA 1JUIA 1NXMA 1Q8PA 4JDMA 3OY8A 2WFF2 3VN4A 1PNFA 1QH7A 2QDRA 4KG8A 1JOBA 5FZ6A 4NOTA 2FDKA 5E6HA 3KHBA 1R1A1 3DXUA 4R9CA 1OUXA 1XNBA 1DU3D 4BQXA 4CXYA 1COV1 4DXSA 4CEYC 4MG2A 4K21A 3NAPB 4WVZA 4CPBA 2Z4FA 1SLTA 3CKHA 4FI9A 5EQUA 1U5YA 1NLSA 2DBIA 3OBAA 1OOPA 3LEIA 1S2EA 5FPAA 3H3LA 1RJ7A 3K75B 4UI9L 1CX1A 4FP3A 4U2AA 1LHVA 3D5OA 3N9NA 3VZMA 1UU6A 4XVHA 3ZYBA 3DYMA 3KVBA 2ZGKA 4OLLA 3WP3A 3ZFFB 4Y33A 3ZOIA 1XU2A 4FBFA 3AMHA 1V9U1 2ZZJA 3ZXAC 1CPMA 1VIWB 5IK8A 3QD6A 2DURA 4CP2A 4G3YC 1DGRN 1PK6C 2GC3A 3A0KA 3TBDA 1VRH3 3VD4A 1EP0A 4AEDB 2F4PA 4RS5A 2WN2A 4P08A 5IFTA 3WHTA 3I2OA 3VKOA 2QQPA 4P9YA 4LKEA 4HZFA 5IFPA 4I0WB 1JZ8A 3BUCA 4QQPA 2BTVC 4Q0VA 1RUG2 3ZXLA 4Z07A 1EAH2 3OEAA 5JI7A 2XJRA 5A1LA 4QXBA 1CN1A 1UIJA 1VBE1 3R6SA 5CG8A 1UYZA 1HB2A 3KQ4B 2QUOA 1WLWA 3SEEA 2FHRA 3PVEA 4Q0UA 2RE9A 1G9BA 1DBNA 1GFF2 1YQ2A 4JHTA 3EMRA 2D97A 3FFZA 4Q4W1 2WYFA 2LS6A 3IT8A 5D8AB 1S1AA 1OI6A 3BALA 3WF4A 3JQWA 1N1YA 3WZ1A 4CVUA 4MHUA 2BU9A 3OPZA 1QJX2 4FFIA 5CG9A 3S7EA 1JBCA 3W59A 5IAXA 3VDDC 4K1YA 1EUTA 3RYPA 1V6MA 4XZPA 5JSRA 3K77A 3OGRA 4AZZA 4QHZA 1ND2A 5LCWL 1DCSA 2BFUL 4HANA 5GLVA 2DUPA 4JC1A 4QPGA 1ASJ1 1W3VA 2C9AA 4LA3A 1DYKA 4S2GA 5FPXA 5KHGA 2WO1A 1ZNPA 3M2MA 1VLNA 1FYUA 2HWF3 4YZ5A 2ZGTA 5GALA 1UY4A 4LXLA 2JICA 1BCXA 1S4CA 4LULA 3J26N 4XDPA 2RS11 1GZCA 5JUVA 4IE6A 3OGGA 2X5IA 1PO12 3I59A 4IV3B 4EWAA 2Y38A 1YC61 4EZ4A 2C1FA 3FHQA 2OUJA 4Y1YA 3DL3A 3WQ1A 3ROUA 4WVVA 2VZUA 4UF0A 1V00A 4AVBA 4GQ7A 3DXTA 5GJ6A 1T2XA 4CCJA 4EN0A 3MZHA 4ZU5A 1VBB3 1OLME 1RUJ3 4DIQA 2C24A 4Z8BA 5I91A 5D1IA 5BNPA 5LATA 3FMGA 5FPBA 4HOOA 4L92A 1QXRA 4CE8A 4CCLA 1ZZCA 1G86A 1DG6A 1RUC2 2GC1A 3BPSA 5CKNA 3OBRA 1KDKA 5A33B 5DAVA 3LKJA 2A6ZA 4FOVA 2BGPA 2ERFA 4N53B 3R4DB 3N9QA 1W6PB 4XQWA 4KWLA 1H8TA 4WM8C 1RITA 2RDNA 1AR61 3OBTA 3IIAA 5FLIA 1NUKA 3T08A 4Y3OA 4I2OA 4N9HA 2IC1A 3MIEA 2P37A 5ACA3 1YQ5A 2R043 4EN8B 1SMVA 1NX9A 1A78A 3GYDA 3KS7A 3NAPC 5FDBA 2DUOA 2CSGA 2TUNA 2VNVA 4OHXA 5LRRA 1RUD2 1IKPA 3RZJA 3MLLA 2H0BA 3KHCA 3FBMA 2XLAA 3HNMA 3JBG2 3UGHA 4Q4Y2 4XURA 3RJRA 2PHRA 5ABJB 4BWOA 4C91A 1XXNA 5FOBB 1ZM1A 3ZFFC 1W9YA 2WNVA 3B94A 2GMMA 2OZ6A 2A6VA 2V5DA 3M3CA 1QQP1 4K6BA 3ZLIA 2HEYF 3QH6A 3J8F3 1AR72 3TOJA 1H1IA 2W92A 4AEDC 2RS32 3C3VA 5LBBA 4NIIA 2R062 1QMJA 5EV7A 1R091 3PUIA 2B4KA 4B4RA 4QWNA 4D7TA 1HX6A 1U5IA 5AVPA 1SBDA 2Q1FA 1HDKA 1RHI2 3ACLA 5HBAA 5JXJA 4LO4B 2A6WA 4AGGA 5LK5A 5EZWA 4XF9A 2IXJA 3AC0A 4XHBA 3OY8B 4IERA 4OUSA 2YGMA 5C4WA 2D3SA 2ZGMA 3S6PA 1ZBA1 5FP7A 1GANA 2WLQA 3JUUA 1HN0A 3POWA 3VHNA 1Z7S2 2ZHMA 1HQLA 2P17A 2RMU1 4HT1T 1LHUA 1H6YA 1FPN3 3H7JA 5H9PA 3WP6A 1AR91 4GB33 5D2AA 2W1UA 3P5BA 4L0PA 2OKXA 1R1ZA 3WF1A 4J6GA 3LPFA 4XAEA 1HB3A 3GJBA 5D8AC 1ZX5A 3VGIA 1OD5A 4O61A 5A3OA 1VBD1 2ZGLA 1RGSA 1MS8A 4CRQA 4HN1A 4CUGA 4AHXA 3MGUA 1DGLA 2HWB2 1IZ3A 3NSTA 5FYCA 2R071 2JECA 5DAWA 3ZMNA 4CSWA 3ILRA 2BVBA 1LCLA 2I2SA 5J96B 1GWMA 3UETA 3WG4A 2V72A 1BZWA 3RMYA 4S2HA 4XQDA 2CYFA 1W6MA 3PMEA 5J7MA 5CYYA 5C5UA 1RMU2 3POSA 3CEWA 4IV1C 1Y4WA 2AACA 2R49A 1HRV2 1TEIA 2FMYA 4RS5B 3ZDSA 3RZKA 2WS91 3RMXA 1PMIA 4NIDA 4CDUA 4O7XA 1AVBA 1PHMA 3LDBA 1VBC3 1ENQA 1RTVA 2NM1A 3GHNA 2VBDA 1SDWA 4IV3C 3MPBA 2F17A 5M0TA 4XFIA 1MEC2 3MW3A 1HJGA 1XJAA 5DABA 4CEWA 1JODA 3CF6E 3LB9A 1VAVA 1YQ8A 1SACA 4KI5M 4K9SA 4R9AA 3BTAA 2J42A 3IAPA 4JV4A 5C3RA 3S0MA 4CCCA 1I3HA 2DBNA 2E26A 4QPIA 3B01A 2ZGQA 3RI8A 5T52A 1GP6A 1ZRCA 3B00A 1R64A 4XE9A 1ULCA 2DCKA 2B39A 4GMP3 2FDJA 3ES4A 5J36A 4YW5A 2WT0A 2PHFA 3SCFA 1X36A 5EP9A 1NA1A 1PGL2 2Q1ZB 1B35A 3FLRA 4XTPA 2XPJA 2VTFA 4N53C 2WFPA 4DPNA 1ND2B 4FFHA 4HVRA 4X8PA 3WQBA 4QX1A 4LOSA 2WZR3 2YZ4A 4QPGB 3KGZA 4AHYA 1K45A 2C5DA 3WW1A 1UL9A 3M3QA 3WEZA 3L2YA 5FQ0A 2VOKA 3GF6A 2WFF3 1UOJA 4KGGA 5BNQA 5FK8A 2D6NA 1OFNA 1SZBA 2LTNA 3WF0A 3D8CA 2DCTA 1YHFA 3ZR5A 2VGDA 4NIGA 1A6CA 1A8DA 4A41A 4Y1ZA 4QDSA 3UYJA 3JXSA 2X5IB 1BEV3 2GDFA 3I59B 4R9BA 3NJVA 4IL7A 4Y5Z0 5ABJC 2FZ2A 3N4MA 5JZGA 2VAUA 4E4SA 1CWPA 5FZAA 4C0HA 3J7NA 4DUVA 1WW5A 5DAQA 1JZ6A 2CGPA 4FPJA 5EJZB 4TZDA 4XMAA 1AXKA 3IAQA 1U5XA 2AREA 2D6MA 2E7QA 3AKSA 3VD7A 5A3PA 5KHJA 1DLCA 2W9XA 5CKQA 3OPTA 5FP8A 5I0TA 3VZNA 5BNPB 2FDHA 4A6SA 4AVSA 3AMMA 2XDVA 2ZHLA 4L8QA 4ASKA 1ULFA 2EF6A 1HLCA 5JLVA 3DEMA 1J3RA 5E8AA 4ASLA 5GLZA 2FBEA 1DFQA
chains in the Genus database with same CATH topology
3K46A 2VJXA 1XC6A 3WF3A 3GXUA 3I3DA 4PT6A 5DN2A 3CDZB 3T2OA 3K4ZA 4DUWA 3T0AA 2RV9A 1PX4A 4BK4A 1CIYA 4JX0A 2VO5A 1GOHA 4ARYA 3WNOA 4RYDA 3UNPA 4M4RA 3GGLA 2ID4A 1KGYA 2QQIA 1JYVA 3I3BA 3UESA 2E32A 3DYPA 3LE0A 2X09A 2W91A 1ULPA 3A21A 4UAPA 3WSOA 1H6XA 1UZ0A 4A3ZA 3MV11 2QBXA 3NNGA 1W0NA 3SKVA 1CZVA 2VZVA 3WNMA 1US2A 3MO4A 1O59A 2W95A 2J1SA 2E33A 3K4AA 3VD5A 2VZTA 4BDVB 2HYXA 2WDBA 3IDAA 3I3EA 3DYOA 3SKJE 1DYOA 2EIEA 2WZEA 1UY3A 2J1VA 1XNTA 4P00B 1UMHA 2W87A 4A6OA 2EIBA 2WO3A 3PUHA 3IIIA 5J1XA 1K42A 1JZ5A 1W8OA 4TTGA 4XUPA 2VOTA 3MV01 2QQOA 2E31A 4LQRA 1J83A 1UY1A 2RJ2A 4LHSA 2QQJA 1JZ4A 4CU6A 2DCJA 3NRUA 1W9SA 1WKYA 1GOGA 2W94A 4JKKA 2C9KA 2Y6HA 5IHRA 4E8CA 3CIHA 3GM8A 2VR4A 5JXHA 2VMCA 4DXRA 4DEQA 4JKLA 3I97A 4GWIA 2B9VA 1TVGA 4E8DA 4LKSA 3FL7A 4A42A 3NQHA 2QQKA 5JMOA 3OEBA 3CQOA 4XZUG 4CUCA 3HNYM 4QX2A 2WZ8A 1UY2A 4CU9A 1SG3A 3CZJA 3DECA 4XUTA 3MUZ1 3HPNA 2Y6GA 2J1EA 2YG0A 2XQXA 3ACHA 3VDAA 3K4DA 2WAAA 5CZKA 3C7GA 2RVAA 3HN3A 1US3A 2QQMA 1UYXA 5G05L 3T2QA 1L7RA 5B4XA 2W5FA 4MADA 3ZM8A 3FN9A 3A22A 3C7HA 1D7PM 2VC9A 2JD9A 1W8NA 2VZ1A 2LW8A 3I2HA 2VMEA 4OMCA 5DMYA 4Z2AA 2YFZA 3BN6A 2ZEWA 3WNNA 1GMMA 4IUGA 2J1RA 1PMHX 2W1SA 1OF4A 2HLEA 2JE8A 3U37A 2VZSA 4BJ0A 4QX0A 4A4AA 3BGAA 4DXSA 3CMGA 4DXTA 3MBWA 2J7MA 4QB2A 5IJRA 2Z4FA 3CKHA 4FI9A 5LA1A 5IYYA 1XPWA 3OBAA 4PQQA 1UX7A 3LEIA 5LA2A 3K75B 4UI9L 5DQ0A 5EJ1B 5C7GA 3HEIA 2VM9A 1CX1A 5I0DA 3VD9A 2Y6KA 3I2FA 4XVHA 3DYMA 2WBKA 1I5PA 1JYNA 1IQDC 2XOMA 4KWUA 2ORXA 2ZEZA 4GZ9A 1JI6A 3VD4A 3C7FA 2WN2A 3NJXA 4P08A 5IFTA 5C71A 1JHJA 1SHWB 2VQTA 5IFPA 2Y6JA 1JZ8A 2VCCA 2VL4A 3C8XA 2VZRA 3OEAA 3THCA 4P5YA 4ZZ5A 2XONA 4QB1A 1GU3A 4LPLA 1NAEA 3HOBA 5HPOA 1XNAA 2Y6LA 1UYZA 2KD7A 3SEEA 5FUIA 1BHGA 2J1UA 1YQ2A 2VZPA 3A7QA 1EUUA 2WO2A 2LS6A 4M4PA 4A45A 2QQLA 3WF4A 1UMIA 3I2KA 2C4XA 4CVUA 3HNBM 4RN5A 3W5NA 1DP0A 2YB7A 5LA0A 1EUTA 2JDAA 4JHZA 2VMFA 1OT5A 3K77A 3OGRA 2CDPA 5LCWL 2WQ8A 2ZEYA 2JKXA 4QX3A 3SEPA 3WNLA 1MPXA 4GWJA 1GQPA 2WO1A 1UY4A 5G04L 2BBAA 5JUVA 4XUOA 3WNPA 2X05A 2VCAA 2W3JA 2ZEXA 3FHQA 2W46A 3T0DA 4ZZ8A 3MUY1 3CZUA 2VZUA 4MOAA 4QPWA 5B4NA 1T2XA 3T0BA 4ET7A 3C7OA 3ABZA 3OB8A 1PMJX 4QDQA 2VZ3A 4A44A 1F4AA 3LEKA 3F2ZA 4JKMA 4D0QA 1SDDB 2WN3A 3P6BA 4BK5A 3A23A 2ZXQA 3ACGA 1JYWA 4OZOA 1W9TA 3LEGA 2BGPA 3T08A 1NUKA 2L9LA 3I2IA 1OF3A 1NX9A 2YC2A 3IB3A 1OH4A 3P1IA 2WUHA 2VQUA 1JU4A 3I2GA 3HNMA 5JR2A 4XURA 3HJRA 3VDBA 3E1F1 1L7QA 2VCBA 5DPNA 1W9WA 2J1AA 4ZY9A 1TG7A 4ARXA 4D8MA 2V5DA 4ZXEA 2QQNA 1CZTA 1UXXX 4W50A 3VD3A 2W92A 3J7HA 3PUIA 2B4KA 5JXJA 2BERA 1UWWA 1JYXA 4CUBA 2WABA 3AC0A 5JXGA 3OGVA 2YFUA 1ULOA 1CZSA 2VMDA 2C26A 3VDCA 4OUEA 2WYSA 5EIYB 1H6YA 2XHNA 4CUAA 5JXIA 4MO3M 1GOFA 2J1TA 2W1UA 4L0PA 2OKXA 5A1AA 3WF1A 3LPFA 3GDBA 3OG2A 1P8JA 4PF1A 2Y64A 1KEXA 2V4VA 4DUXA 1F4HA 1JU3A 3UETA 4OMDA 2V72A 1JZ2A 2BGOA 4BXSV 1RYYA 3ETPA 2R7EB 5CYYA 2W1WA 4UOJA 3EYPA 2VZOA 2EICA 2PQSA 1LNSA 1O8PA 5F7UA 3C7EA 4XUNA 1O8SA 4W8JA 2DDUA 4QB6A 3I2JA 3FHAA 3T09A 2VZQA 5HXMA 4QAWA 4KI5M 3IAPA 3THDA 2E26A 4XUQA 4W4ZA 3ACFA 3ECQA 1R64A 2DCKA 2CDOA 4AG4A 1W99A 3LPGA 1K3IA 1UYYA 1WCQA 1UY0A 2W47A 2VTFA 1PX3A 1JZ7A 2WAOA 4QX1A 3WQBA 4AAXA 1UXZA 1GUIA 1K45A 3EB7A 4HG6B 3WEZA 4MGSA 2W1QA 3WNKA 3WF0A 4DEVA 1NKGA 4A41A 2Y8KA 2YC4A 3W5MA 4QDSA 3T2PA 3JXSA 3D3AA 3LQCA 1GNYA 1OD3A 3NJVA 4CU8A 1K12A 4DUVA 1JZ6A 1J84A 4KMQA 5EJZB 1JZ3A 4CU7A 4P02B 4YPJA 3IAQA 2ORZA 2BZDA 3WF2A 4MGQA 4OYUA 3VD7A 2J22A 1DLCA 2W9XA 5C70A 4QDRA 2X10A 2EIDA 4TXWA 3ACIA 3OGSA 1HN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K46 A;  2VJX A;  1XC6 A;  3WF3 A;  3GXU A;  3I3D A;  4PT6 A;  5DN2 A;  3CDZ B;  3T2O A;  3K4Z A;  4DUW A;  3T0A A;  2RV9 A;  1PX4 A;  4BK4 A;  1CIY A;  4JX0 A;  2VO5 A;  1GOH A;  4ARY A;  3WNO A;  4RYD A;  3UNP A;  4M4R A;  3GGL A;  2ID4 A;  1KGY A;  2QQI A;  1JYV A;  3I3B A;  3UES A;  2E32 A;  3DYP A;  3LE0 A;  2X09 A;  2W91 A;  1ULP A;  3A21 A;  4UAP A;  3WSO A;  1H6X A;  1UZ0 A;  4A3Z A;  3MV1 1;  2QBX A;  3NNG A;  1W0N A;  3SKV A;  1CZV A;  2VZV A;  3WNM A;  1US2 A;  3MO4 A;  1O59 A;  2W95 A;  2J1S A;  2E33 A;  3K4A A;  3VD5 A;  2VZT A;  4BDV B;  2HYX A;  2WDB A;  3IDA A;  3I3E A;  3DYO A;  3SKJ E;  1DYO A;  2EIE A;  2WZE A;  1UY3 A;  2J1V A;  1XNT A;  4P00 B;  1UMH A;  2W87 A;  4A6O A;  2EIB A;  2WO3 A;  3PUH A;  3III A;  5J1X A;  1K42 A;  1JZ5 A;  1W8O A;  4TTG A;  4XUP A;  2VOT A;  3MV0 1;  2QQO A;  2E31 A;  4LQR A;  1J83 A;  1UY1 A;  2RJ2 A;  4LHS A;  2QQJ A;  1JZ4 A;  4CU6 A;  2DCJ A;  3NRU A;  1W9S A;  1WKY A;  1GOG A;  2W94 A;  4JKK A;  2C9K A;  2Y6H A;  5IHR A;  4E8C A;  3CIH A;  3GM8 A;  2VR4 A;  5JXH A;  2VMC A;  4DXR A;  4DEQ A;  4JKL A;  3I97 A;  4GWI A;  2B9V A;  1TVG A;  4E8D A;  4LKS A;  3FL7 A;  4A42 A;  3NQH A;  2QQK A;  5JMO A;  3OEB A;  3CQO A;  4XZU G;  4CUC A;  3HNY M;  4QX2 A;  2WZ8 A;  1UY2 A;  4CU9 A;  1SG3 A;  3CZJ A;  3DEC A;  4XUT A;  3MUZ 1;  3HPN A;  2Y6G A;  2J1E A;  2YG0 A;  2XQX A;  3ACH A;  3VDA A;  3K4D A;  2WAA A;  5CZK A;  3C7G A;  2RVA A;  3HN3 A;  1US3 A;  2QQM A;  1UYX A;  5G05 L;  3T2Q A;  1L7R A;  5B4X A;  2W5F A;  4MAD A;  3ZM8 A;  3FN9 A;  3A22 A;  3C7H A;  1D7P M;  2VC9 A;  2JD9 A;  1W8N A;  2VZ1 A;  2LW8 A;  3I2H A;  2VME A;  4OMC A;  5DMY A;  4Z2A A;  2YFZ A;  3BN6 A;  2ZEW A;  3WNN A;  1GMM A;  4IUG A;  2J1R A;  1PMH X;  2W1S A;  1OF4 A;  2HLE A;  2JE8 A;  3U37 A;  2VZS A;  4BJ0 A;  4QX0 A;  4A4A A;  3BGA A;  4DXS A;  3CMG A;  4DXT A;  3MBW A;  2J7M A;  4QB2 A;  5IJR A;  2Z4F A;  3CKH A;  4FI9 A;  5LA1 A;  5IYY A;  1XPW A;  3OBA A;  4PQQ A;  1UX7 A;  3LEI A;  5LA2 A;  3K75 B;  4UI9 L;  5DQ0 A;  5EJ1 B;  5C7G A;  3HEI A;  2VM9 A;  1CX1 A;  5I0D A;  3VD9 A;  2Y6K A;  3I2F A;  4XVH A;  3DYM A;  2WBK A;  1I5P A;  1JYN A;  1IQD C;  2XOM A;  4KWU A;  2ORX A;  2ZEZ A;  4GZ9 A;  1JI6 A;  3VD4 A;  3C7F A;  2WN2 A;  3NJX A;  4P08 A;  5IFT A;  5C71 A;  1JHJ A;  1SHW B;  2VQT A;  5IFP A;  2Y6J A;  1JZ8 A;  2VCC A;  2VL4 A;  3C8X A;  2VZR A;  3OEA A;  3THC A;  4P5Y A;  4ZZ5 A;  2XON A;  4QB1 A;  1GU3 A;  4LPL A;  1NAE A;  3HOB A;  5HPO A;  1XNA A;  2Y6L A;  1UYZ A;  2KD7 A;  3SEE A;  5FUI A;  1BHG A;  2J1U A;  1YQ2 A;  2VZP A;  3A7Q A;  1EUU A;  2WO2 A;  2LS6 A;  4M4P A;  4A45 A;  2QQL A;  3WF4 A;  1UMI A;  3I2K A;  2C4X A;  4CVU A;  3HNB M;  4RN5 A;  3W5N A;  1DP0 A;  2YB7 A;  5LA0 A;  1EUT A;  2JDA A;  4JHZ A;  2VMF A;  1OT5 A;  3K77 A;  3OGR A;  2CDP A;  5LCW L;  2WQ8 A;  2ZEY A;  2JKX A;  4QX3 A;  3SEP A;  3WNL A;  1MPX A;  4GWJ A;  1GQP A;  2WO1 A;  1UY4 A;  5G04 L;  2BBA A;  5JUV A;  4XUO A;  3WNP A;  2X05 A;  2VCA A;  2W3J A;  2ZEX A;  3FHQ A;  2W46 A;  3T0D A;  4ZZ8 A;  3MUY 1;  3CZU A;  2VZU A;  4MOA A;  4QPW A;  5B4N A;  1T2X A;  3T0B A;  4ET7 A;  3C7O A;  3ABZ A;  3OB8 A;  1PMJ X;  4QDQ A;  2VZ3 A;  4A44 A;  1F4A A;  3LEK A;  3F2Z A;  4JKM A;  4D0Q A;  1SDD B;  2WN3 A;  3P6B A;  4BK5 A;  3A23 A;  2ZXQ A;  3ACG A;  1JYW A;  4OZO A;  1W9T A;  3LEG A;  2BGP A;  3T08 A;  1NUK A;  2L9L A;  3I2I A;  1OF3 A;  1NX9 A;  2YC2 A;  3IB3 A;  1OH4 A;  3P1I A;  2WUH A;  2VQU A;  1JU4 A;  3I2G A;  3HNM A;  5JR2 A;  4XUR A;  3HJR A;  3VDB A;  3E1F 1;  1L7Q A;  2VCB A;  5DPN A;  1W9W A;  2J1A A;  4ZY9 A;  1TG7 A;  4ARX A;  4D8M A;  2V5D A;  4ZXE A;  2QQN A;  1CZT A;  1UXX X;  4W50 A;  3VD3 A;  2W92 A;  3J7H A;  3PUI A;  2B4K A;  5JXJ A;  2BER A;  1UWW A;  1JYX A;  4CUB A;  2WAB A;  3AC0 A;  5JXG A;  3OGV A;  2YFU A;  1ULO A;  1CZS A;  2VMD A;  2C26 A;  3VDC A;  4OUE A;  2WYS A;  5EIY B;  1H6Y A;  2XHN A;  4CUA A;  5JXI A;  4MO3 M;  1GOF A;  2J1T A;  2W1U A;  4L0P A;  2OKX A;  5A1A A;  3WF1 A;  3LPF A;  3GDB A;  3OG2 A;  1P8J A;  4PF1 A;  2Y64 A;  1KEX A;  2V4V A;  4DUX A;  1F4H A;  1JU3 A;  3UET A;  4OMD A;  2V72 A;  1JZ2 A;  2BGO A;  4BXS V;  1RYY A;  3ETP A;  2R7E B;  5CYY A;  2W1W A;  4UOJ A;  3EYP A;  2VZO A;  2EIC A;  2PQS A;  1LNS A;  1O8P A;  5F7U A;  3C7E A;  4XUN A;  1O8S A;  4W8J A;  2DDU A;  4QB6 A;  3I2J A;  3FHA A;  3T09 A;  2VZQ A;  5HXM A;  4QAW A;  4KI5 M;  3IAP A;  3THD A;  2E26 A;  4XUQ A;  4W4Z A;  3ACF A;  3ECQ A;  1R64 A;  2DCK A;  2CDO A;  4AG4 A;  1W99 A;  3LPG A;  1K3I A;  1UYY A;  1WCQ A;  1UY0 A;  2W47 A;  2VTF A;  1PX3 A;  1JZ7 A;  2WAO A;  4QX1 A;  3WQB A;  4AAX A;  1UXZ A;  1GUI A;  1K45 A;  3EB7 A;  4HG6 B;  3WEZ A;  4MGS A;  2W1Q A;  3WNK A;  3WF0 A;  4DEV A;  1NKG A;  4A41 A;  2Y8K A;  2YC4 A;  3W5M A;  4QDS A;  3T2P A;  3JXS A;  3D3A A;  3LQC A;  1GNY A;  1OD3 A;  3NJV A;  4CU8 A;  1K12 A;  4DUV A;  1JZ6 A;  1J84 A;  4KMQ A;  5EJZ B;  1JZ3 A;  4CU7 A;  4P02 B;  4YPJ A;  3IAQ A;  2ORZ A;  2BZD A;  3WF2 A;  4MGQ A;  4OYU A;  3VD7 A;  2J22 A;  1DLC A;  2W9X A;  5C70 A;  4QDR A;  2X10 A;  2EID A;  4TXW A;  3ACI A;  3OGS A;  1HN1 A; 
#chains in the Genus database with same CATH topology
 1ULG A;  2Q8C A;  1GP4 A;  5CVR A;  3VHO A;  3N9M A;  1OBN A;  1PVX A;  1W0P A;  1ZA7 A;  1J1L A;  4GMP 0;  1K5M A;  4XFF A;  5CBL A;  2KR2 A;  3CO2 A;  4LO7 A;  1ENR A;  1REE A;  1H8T B;  2RM2 2;  4LBQ A;  3PTY A;  3VBU A;  3BKZ A;  2ENR A;  4YRD A;  4YZ3 A;  2HJI A;  5CAD A;  5GZE A;  1WUV A;  1RUG 3;  1COV 3;  3W20 A;  4UFI A;  1XNK A;  2D93 A;  3ZYG A;  1NYW A;  5FYY A;  3T2T A;  3VL8 A;  1GOH A;  4XF1 A;  4UYB A;  3E5Q A;  4Q27 A;  4HL0 A;  2KM2 A;  4PJY A;  5FZC A;  3R4U A;  2ET7 A;  3GGL A;  4QQO A;  1C3H A;  1LOF A;  4K7J A;  1FI2 A;  3I3B A;  3UES A;  5F37 A;  2E32 A;  1VRH 1;  1W90 A;  2PQQ A;  2WNV B;  3RQ0 A;  5HCA A;  2VUC A;  5AC9 3;  3M70 A;  3A21 A;  1XE0 A;  4D6S A;  1UZ0 A;  4TWT A;  4UFM A;  3UKN A;  3MV1 1;  5E88 A;  4Q4V 2;  1ULE A;  4RS5 C;  5E1R A;  3WNM A;  1US2 A;  3GZT B;  3MO4 A;  1O59 A;  3FC0 A;  4YVS A;  4MGI E;  2I74 A;  2I07 B;  2ZGS A;  5IAT A;  1UOF A;  4MXV A;  3GBF A;  4I09 A;  3U78 A;  3K4A A;  2Q5T A;  3VD5 A;  1REF A;  1Y9Q A;  5C4W B;  3E5X A;  4UFH A;  2HYX A;  1N3Q A;  2PAE A;  2CWS A;  1YFW A;  3I3E A;  3SLI A;  1KFX L;  2OVU A;  2WZE A;  3AYD A;  4Z92 B;  2J1V A;  1RIN A;  3Q8B A;  2XML A;  4YW2 A;  2MEV 2;  4B1M A;  3AXD A;  4YM3 A;  5I8S A;  4RHV 2;  4HFS A;  1V6J A;  2FMD A;  3B69 A;  4A6O A;  2EIB A;  3HVD A;  4TLG A;  3JQX A;  3USU A;  1K42 A;  3ZSL A;  5LZ6 A;  2LRP A;  3D4K A;  3WUC A;  4XUP A;  3MV0 1;  3HQU A;  4B4Q A;  2CV6 A;  2R30 A;  5C5T A;  5FRA A;  1UN1 A;  2P1B A;  4LHS A;  1JZ4 A;  4QHB A;  2HWF 1;  1CAV A;  3UJO A;  5FZ1 A;  2P6H A;  1H30 A;  4Z82 A;  4QXC A;  1ND2 C;  2XLG A;  3AVS A;  1FMD 2;  1W6M B;  2WSU A;  1RUC 3;  4YGC A;  2XB6 C;  4QPG C;  2R0H A;  2W94 A;  4JKK A;  1EYB A;  2C9K A;  1AL2 3;  2CHH A;  4W6Y A;  3A4U A;  1IGO A;  4XXA A;  1HJF A;  5JXH A;  4DY5 A;  2VMC A;  1OQD A;  1D4M 2;  4XXP A;  3RZZ A;  1AL0 G;  2VTX A;  2UWA A;  4CDU B;  2EIG A;  2RR1 1;  4WZC A;  4BCU A;  2WQZ C;  1PGS A;  3D6E A;  4IEP A;  5A3U A;  2X5I C;  2B9V A;  5FYT A;  1TVG A;  4BM8 A;  1KJL A;  1VBB 1;  1RUO A;  4LEJ A;  1RUJ 1;  1R08 2;  1UIK A;  3FWE A;  4V1P A;  1ZA4 A;  4CEW B;  3I4I A;  2DUQ A;  1WLD A;  4M3C F;  2OQ7 A;  4XCA A;  2QQK A;  3N36 A;  5IK4 A;  1JYT A;  3JBG 3;  5JMO A;  5FXX A;  4Q1P A;  2D6P A;  5FMO L;  3X29 B;  4BU2 A;  4NR1 A;  3WW2 A;  4U36 A;  4AFC A;  4EV0 A;  3ZMO A;  1IS6 A;  4XET A;  1UY2 A;  5BNP C;  4QPI B;  1AYN 2;  1PIV 2;  1W8Z A;  4I01 A;  4XHX A;  4J1X A;  3BOD A;  3V56 A;  3POY A;  4XUT A;  2Y0O A;  2R1D A;  4CDQ A;  5DXD A;  1QF3 A;  4QU2 A;  1V0A A;  2O0O A;  4WM8 A;  3N9L A;  2Y60 A;  3PUA A;  3DKW A;  4HSJ A;  2YG0 A;  5FKB A;  1NA1 B;  5ACA 1;  3ACH A;  5JI9 A;  1B35 B;  2R06 3;  2R04 1;  4KNC A;  4LO5 B;  4NJ4 A;  2R0F A;  2WAA A;  5F5A A;  4AHW A;  4YZ1 A;  1H8T C;  2D44 A;  4AFA A;  2HWD 3;  2QQM A;  5GZG A;  4CCD A;  2B45 X;  2JD4 A;  4YWA A;  1W2A X;  3AJY A;  2W5F A;  1W6Q B;  5B4X A;  3MHZ A;  2FCV A;  5FQ0 B;  3A22 A;  3C7H A;  2PLV 3;  1V6O A;  4XFH A;  4LNV A;  2LW8 A;  3HAG A;  3CJI A;  5DMY A;  5FZI A;  3M3E A;  4MGK E;  1Z7S 3;  5C6C A;  2WJS A;  4LE3 A;  1STM A;  2ZEW A;  1OA4 A;  1GZ9 A;  1GMM A;  1J59 A;  3I3M A;  3J8F 1;  5JZG B;  4XTM A;  1PMH X;  2W1S A;  1EY2 A;  5LA9 A;  2GNB A;  1W0O A;  2HLE A;  2WNV C;  5JOZ A;  2ZHK A;  4IEX A;  1Q3E A;  2QJV A;  1NZI A;  1S2B A;  4AYU A;  1QQP 3;  3U37 A;  2VZS A;  4BJ0 A;  2DYC A;  2HWB 3;  1G9F A;  2HEV F;  2WWJ A;  4AR2 A;  3BGA A;  5KHH A;  4A4A A;  1OPM A;  2B9U A;  4NIA A;  2HWE 2;  4DXT A;  3MBW A;  4QB2 A;  5IJR A;  1WLC A;  3WHU A;  4BIF A;  1V6I A;  3F95 A;  3NW4 A;  4F8A A;  3MF9 A;  2D6K A;  4GXL A;  3AB0 A;  5LA1 A;  1WLT A;  5IYY A;  1XPW A;  1PVC 3;  4PQQ A;  1UX7 A;  5LA2 A;  2VCM A;  4M3C E;  1M06 G;  1BYH A;  4QM9 A;  3RRD A;  5I0D A;  1HRI 3;  5J98 B;  1CJP A;  1FPN 1;  2WBK A;  1BQP A;  2VUJ A;  5E16 A;  5IVJ A;  5A7Q A;  1ENS A;  4GB3 1;  1K5M B;  1EV1 3;  5FZF A;  4D7Y A;  5C4W C;  2OS2 A;  5LY1 A;  1S2K A;  2JG8 A;  4LBQ B;  3S5Q A;  2PHT A;  3VBU B;  1J58 A;  1IQD C;  1YNA A;  2XBO 1;  1POV 3;  1JYN A;  1G9D A;  4KWU A;  1C8M 3;  2ORX A;  2ZEZ A;  1TNF A;  5ANN A;  1SLA A;  2BNN A;  4GZ9 A;  5L7O B;  5F2S A;  1FOD 3;  3C7F A;  3ZFE A;  3NJX A;  1OUR A;  1VBA 2;  5C3S A;  1Z78 A;  2VQT A;  4LKD A;  4NIH A;  1WD3 A;  4CA9 A;  2VCC A;  4HKO A;  4LUM A;  5FPU A;  2XVK A;  2XJU A;  3C8X A;  2VZR A;  3M3O A;  1CD3 G;  1OQE A;  2QZ3 A;  4Q5O A;  1UAI A;  4C0B A;  4IV1 A;  4LPL A;  2OPW A;  2D5F A;  1NAE A;  3HOB A;  4BQW A;  3AYC A;  2DVA A;  2FDI A;  1FXZ A;  1XNA A;  2Y6L A;  3DPR A;  2VBP A;  4GJY A;  4IE5 A;  2KD7 A;  5F5C A;  4AI9 A;  3O5S A;  1AX1 A;  3ZN6 A;  5I0R A;  4PIX A;  3KB5 A;  1VBC 1;  1KQR A;  4HKW A;  3P3P A;  3LD8 A;  1XYN A;  1EUU A;  2ARA A;  4YZ2 A;  4XAB A;  2Q8O A;  1JH5 A;  3I2K A;  1ZRI A;  4CDU C;  2KA3 A;  1PGW 2;  3POF A;  3SIS A;  3CBN A;  5A6Y A;  1W05 A;  4YVS B;  1Y43 B;  4XC9 A;  3W5N A;  4ZHN A;  1OLM A;  2YB7 A;  1QIQ A;  5LA0 A;  2P6C A;  2JDA A;  3LFI A;  4JHZ A;  1JN2 P;  1WA4 A;  2W68 A;  2CDP A;  1G9C A;  1NT0 A;  2QVS B;  2VW2 A;  4CEW C;  2NLR A;  1PZ7 A;  4JDN A;  2HBT A;  5FV3 A;  1QJY 2;  2WQ8 A;  2ZEY A;  4H55 A;  1U5Z A;  4KBB A;  4QX3 A;  3ZYR A;  3KLS A;  2A3Y A;  2XJV A;  2ZX2 A;  4PI2 A;  2LUW A;  3JU9 A;  4GMP 1;  1I9R A;  4PCR A;  1O3R A;  1POV 0;  2ET1 A;  1OUS A;  3H1M A;  1KD7 A;  3U1X A;  3AKP A;  5A33 A;  4Q0Q A;  3NJZ A;  4QPI C;  2WSV A;  3MFC A;  4XYX A;  3USU B;  2FDG A;  4MGT A;  2IZW A;  3WNP A;  4Q4X 3;  3MFA A;  1GYK A;  2WZR 1;  3E5U A;  1S0C A;  2W46 A;  5HI0 A;  1L3J A;  4AI1 A;  3T0D A;  1HXS 3;  4YSF A;  5LW9 A;  2JDN A;  3MUY 1;  1NA1 C;  1YQ6 A;  1B35 C;  2WFF 1;  5DDJ 3;  1CAV B;  5DUX A;  3T0B A;  2YRO A;  1F9K A;  5JSO A;  1WMD A;  2BVV A;  4BA6 A;  4YG6 A;  2E9Q A;  2QZ2 A;  1BEV 1;  4HK8 A;  5FZE A;  3E6B A;  4G4F A;  4P9X A;  3F2Z A;  4JKM A;  4BHP A;  2RM2 3;  2UUR A;  2VQA A;  4LBJ A;  1SDD B;  4QKN A;  1OVS A;  3P6B A;  5JR7 B;  3J7L A;  1AYM 3;  2HWC 2;  2ZXQ A;  4RFT 0;  1JYW A;  3PU3 A;  1ODN A;  3WCR A;  3QAC A;  3PU8 A;  5FZO A;  1RUN A;  3LEG A;  4IEZ A;  1WWY A;  1XB9 A;  4P9G A;  2K46 A;  5FUP A;  5JZG C;  1ST8 A;  3PIG A;  4ORF A;  2FD8 A;  4UW3 A;  1TMF 2;  2UY9 A;  4BPZ A;  1RL3 A;  4PLO A;  1TME 2;  4DZG A;  2ZTN A;  2QDN A;  5FZH A;  1OF3 A;  3AMN A;  2H6B A;  3OBZ A;  2Q8D A;  4XJA A;  3TWI A;  1QY4 A;  3P1I A;  2D43 A;  2VQU A;  5I0S A;  4YM1 A;  3SC7 X;  3TN9 2;  4CDQ B;  4PIZ A;  3FBY A;  4WM8 B;  5JR2 A;  2OXB A;  4HON A;  3AL6 A;  1H9W A;  3VDB A;  1GQG A;  1RUG 1;  3E1F 1;  1L7Q A;  1W2U A;  1K5M C;  1OA3 A;  4XFC A;  3WOG A;  3WXP A;  1TG7 A;  3NO8 A;  4ARX A;  2VY0 A;  4D8M A;  5IVF A;  1JYV A;  4ZXE A;  3VBU C;  4OUM A;  1QJF A;  2QQN A;  2DF7 A;  2BUK A;  2EVX A;  2X8K A;  3KCY A;  3DUI A;  1SFN A;  2CNA A;  4AE2 A;  1QDO A;  2D6O X;  1D2Q A;  5L7O C;  3VD3 A;  3V0A A;  1GBG A;  5FYB A;  1WCK A;  1NQD A;  3J7H A;  3CJI B;  5A7S A;  3SQO A;  3O1S A;  2IXI A;  1CVN A;  1Q8O A;  3UJQ A;  2VD7 A;  3IDB B;  5LRS A;  4AI2 A;  2YV8 A;  3AFG A;  1XBF A;  3SH5 A;  2AR6 A;  2OII A;  4ZON A;  4W6X A;  5AC9 1;  4QD2 A;  1G8W A;  1QJX 1;  1NG0 A;  2XVG A;  1LOF C;  1GQH A;  2JE7 A;  2JIJ A;  4FOY A;  4N7U A;  1UQX A;  3H0O A;  1QDC A;  3GCW A;  1RUF 2;  2BP6 A;  3EQE A;  4EN9 B;  5EIY B;  1U0A A;  3EHK A;  1S0D A;  4MO3 M;  1SCS A;  2QKD A;  1GOF A;  2ZGO A;  4LUK A;  4S2D A;  1JYI A;  1DIW A;  2ZGU A;  3WP5 A;  5L19 A;  5L9B A;  1Q8V A;  1GZT A;  4I0A A;  1JYC A;  3GDB A;  4MSV A;  1RXG A;  5L36 A;  3V65 A;  4CP9 A;  4FPO B;  4AQ2 A;  3OG2 A;  4IET A;  1ODM A;  4YVS C;  5AFE A;  3ILN A;  2IFR A;  5FY1 A;  4PF1 A;  2XVL A;  2AZ5 A;  5IVV A;  1KEX A;  2V4V A;  5FXW A;  4CCK A;  1U12 A;  1F4H A;  4OMD A;  1LOD A;  2JG8 B;  5KHK A;  1AX0 A;  4BXS V;  4LK6 A;  1MVE A;  3O14 A;  1R1A 2;  5LEK A;  1JMU B;  1GLH A;  4UOJ A;  5C9A A;  5GZD A;  3ZFE B;  2VZO A;  4AEM A;  1QXJ A;  4UW6 A;  4HVQ A;  3DGT A;  3DKQ A;  3R4S A;  2XKO A;  4HSL A;  2IVI B;  3SH4 A;  4RGA A;  4WM7 A;  5IVE A;  1H4G A;  1N3O A;  4P9L A;  2YBK A;  5JIA A;  4MET A;  5IVY A;  3N9P A;  3O0X A;  4XUN A;  1YCI A;  1XND A;  4Z1V A;  2AH2 A;  3WDV A;  4BQ4 A;  5CA6 A;  4XBN A;  1RUC 1;  1O8S A;  3NVC A;  4W8J A;  2D3R A;  4QB6 A;  1G7Y A;  1IQA A;  1AYN 3;  1AL2 1;  1ND3 A;  3FHA A;  2VZQ A;  4IV1 B;  3ST7 A;  4C90 A;  5DUW A;  5FZ8 A;  1AJK A;  3DPR B;  2RS5 3;  1O4Y A;  2BOJ A;  2JDK A;  1V9U 2;  2D6L X;  4M0H A;  4MVT A;  3AVR A;  3ZN6 B;  2GP5 A;  1X33 A;  3THD A;  5FYH A;  5A7P A;  1UZV A;  1Q43 A;  1X7N A;  2XJP A;  4K40 A;  2NP0 A;  3SNM A;  3ECQ A;  4H2A A;  2O8Q A;  2RR1 3;  3OTF A;  2CDO A;  3BOW A;  1UZW A;  4RQP A;  4AG4 A;  5KXB A;  1W99 A;  3L2H A;  3PTR B;  3JBG 1;  2XUE A;  3HBZ A;  2Y33 A;  5EWS A;  2PAM A;  4ISR A;  5A3N A;  5K9Y A;  5TSW A;  1UY0 A;  5F6L B;  5JPM B;  2BV4 A;  2W47 A;  4QPY A;  5FMB A;  1KXG A;  2XHK A;  4UXA A;  5GZF A;  2WAO A;  2GH2 A;  1NY7 1;  4AAX A;  1RUH 2;  3V0B A;  1UXZ A;  1VBE 2;  3EB7 A;  1LGB A;  1ZZB A;  4HG6 B;  4QX8 A;  3WNK A;  4LBN A;  4ES9 A;  2AGS A;  1LAJ A;  5T5P A;  4GAL A;  4B29 A;  2EA7 A;  2K2S A;  2BW8 A;  4P14 A;  3VKL A;  1XRU A;  2RS3 1;  1BVP 1;  2IXL A;  2XGX A;  2Y8K A;  2R06 1;  2YC4 A;  2IVJ A;  2JDU A;  4DRV A;  3WP4 A;  4CDQ C;  3ZKU A;  4IXL A;  3T4V A;  1BBT 2;  1QJU 3;  2HWD 1;  5F2W A;  2H0V A;  1X8E A;  4XIL A;  4CU8 A;  5KXC A;  4GAZ A;  1Y9G A;  3WDT A;  4Q1R A;  4F3J A;  1M4W A;  1QOS A;  4RL7 A;  2PLV 1;  3ZX7 A;  3ZXJ A;  2WLP A;  1C28 A;  5KXD A;  1JZ3 A;  3VBO A;  1GWK A;  4CU7 A;  4YPJ A;  3WF2 A;  3B02 A;  1Z7S 1;  3IKW A;  4MGQ A;  5EXO A;  5FPL A;  2F4L A;  1ASJ 2;  4PLM A;  3K51 A;  1JXN A;  4P9W A;  4YVW C;  2VXJ A;  4D6R A;  3ZSJ A;  5IK5 A;  3HN1 A;  1YI9 A;  2EID A;  4TXW A;  3NV4 A;  4HN0 A;  5FZ9 A;  3VL9 A;  3CJI C;  4DS0 A;  1GNH A;  4FPF A;  2VVD A;  4YYO A;  4QGL A;  3OD4 A;  5JDB A;  3OGS A;  2W39 A;  4X6R B;  2RS1 2;  2VUA A;  2VJX A;  1LEC A;  2HWB 1;  4FSJ A;  1HB4 A;  1XC6 A;  5FZO B;  4FFG A;  3WF3 A;  2V09 A;  1BMV 1;  3H9A A;  3LIG A;  2H6C A;  5E89 A;  3ZO0 B;  2A75 A;  3T2O A;  1VB2 A;  4FXG B;  4CCO A;  3K4Z A;  4CXW A;  5HCH A;  5BV6 A;  1D4V B;  1PVC 1;  2ZMK A;  5H9Q A;  5LBF A;  1QOO A;  3IBM A;  3UGF A;  5T5L A;  2ZOE B;  1CIY A;  3HIF A;  4BK4 A;  5FO8 B;  1UYP A;  4LO6 B;  1HRI 1;  3C2U A;  1IS4 A;  1MS9 A;  1DHK B;  3GZU C;  1OKQ A;  4JX0 A;  2FZ1 A;  1EV1 1;  2ILM A;  1OMI A;  4LJH A;  4ARY A;  5BNN A;  1H0B A;  4S2F A;  3UNP A;  3BIW E;  5IVC A;  1N47 A;  1POV 1;  2CU5 A;  1E5S A;  3WQ7 A;  2W0X A;  1C8M 1;  1NQJ A;  4GD4 A;  4JRA A;  4AI8 A;  2G4I A;  2ZMN A;  1Q56 A;  1ULD A;  1FOD 1;  5EYY A;  4AEJ A;  3IMN A;  5C8W A;  1OQ1 A;  2W91 A;  4E2G A;  1ULP A;  1OKO A;  2JG8 C;  2PFW A;  2XBO 3;  4QGN A;  1F31 A;  3GZE A;  4O9G A;  4UAP A;  4NPR A;  1AR6 2;  1H6X A;  1WA6 X;  1C5H A;  1VMF A;  2QBX A;  3QH7 A;  3V0A B;  1GSL A;  4YM0 A;  3ZFE C;  4N7I A;  4B4P A;  2VZV A;  2AEN A;  2W95 A;  3AP5 A;  2PEL A;  5FCC A;  3RWN A;  1YFY A;  2GAU A;  1JUH A;  2J1S A;  4DNY A;  2NN8 A;  1FV3 A;  3NNJ A;  2D7F A;  3H3Z A;  2XJT A;  1WME A;  5KC6 A;  3JD7 3;  4CDW B;  2JJ6 A;  2WNE A;  3ELN A;  3R05 A;  4UFJ A;  1OPO A;  4LHK A;  4AVV A;  2PHD A;  1GZW A;  3K3O A;  3SKJ E;  3DPR C;  1DYO A;  2EXK A;  1W8W A;  2EIE A;  4L2N A;  4R4Z A;  1AHS A;  1LOE A;  4OVE A;  4OI1 A;  1UY3 A;  2DVB A;  1PO2 3;  3CLP A;  4NUB A;  3GBW A;  3WNX A;  4E4Z A;  5I93 A;  4AGR A;  2G9Z A;  2NZ9 A;  2FCT A;  3U4S A;  3FUO A;  2QNK A;  3OF1 A;  3QOP A;  3O1T A;  1RUE 3;  2XG3 A;  2OT7 A;  1JZ5 A;  2VXR A;  4CP9 B;  3KV5 A;  3JB8 A;  1LRH A;  1R09 2;  3ZYF A;  5DAX A;  4B1L A;  4OHY A;  2JIG A;  2QQO A;  4JQT A;  4PF5 A;  5T3N A;  1UY1 A;  5HCF A;  2B42 B;  4I3G A;  1OA2 A;  4K1Z A;  4LOR A;  2V5Y A;  1IOA A;  1F8V A;  1GIC A;  5KXE A;  4IGO A;  5JOY A;  1WKY A;  1ZBA 2;  4BLJ A;  4AVT A;  5A7O A;  4Q4X 1;  5C9A B;  4H3W A;  3GM8 A;  4WVM A;  4XBQ A;  3LOB A;  1A34 A;  1NCQ A;  1HXS 1;  1G6N A;  4WM7 B;  4MZU A;  3OJB A;  4AOC A;  1TME 3;  5DDJ 1;  2GNT A;  5FYS A;  1VBD 2;  2Z2S B;  2YBP A;  4KWK A;  2UY8 A;  1IPS A;  1ND3 B;  1W6Q A;  1QGL A;  2R07 2;  5ERL A;  3NQH A;  1CJD A;  2GAL A;  3SCG A;  4FTS A;  4JRL A;  1C8N A;  2RM2 1;  3RDI A;  2ARB A;  5FOJ B;  3AJZ A;  2QQV A;  5T55 A;  4EWD A;  2WNO A;  1AYM 1;  1AR8 2;  4M01 A;  2WZ8 A;  3KF3 A;  4OI2 A;  3H8X A;  4GJZ A;  3KV9 A;  3WCS A;  5CFD A;  3DEC A;  2WO7 A;  1IS3 A;  1JOP A;  4ES8 A;  2WS9 2;  1WD4 A;  3HPN A;  4RQP B;  4RR3 A;  4XF3 A;  3POG A;  3RZH A;  3NMB A;  2HKX A;  2XJS A;  5FAX A;  1NCR A;  2ZAB A;  1DQ4 A;  3EJK A;  1IKQ A;  5DAP A;  3VUO A;  1DQ0 A;  1W6O A;  4XMI A;  4COY A;  3WG1 A;  1I1E A;  4CTE A;  3V0B B;  1US3 A;  4XPV A;  3I49 A;  4PQ9 A;  5F3G A;  3OUJ A;  3AYA A;  3ORJ A;  1ZYB A;  4M3C A;  4GWM A;  4YLZ A;  4MAD A;  1D7P M;  4IGP A;  5BYN A;  2VC9 A;  4PIY A;  3AZY A;  1W8N A;  2JEM A;  1N3P A;  3M7A A;  3I2H A;  4IW3 A;  4COU A;  2AEY A;  4UWD A;  2YFZ A;  3OCP A;  5FUN A;  4CCE A;  4N43 A;  4NHL A;  2RDS A;  2JB4 A;  2ZGN A;  4NRP A;  4YW4 A;  3WNN A;  3THP A;  1DGW A;  3AKT A;  4KH9 A;  3MEP A;  4IUG A;  2J1R A;  1H9P A;  3NV2 A;  1VRB A;  5L7O A;  1OF4 A;  1S0B A;  1EAH 3;  3L9J T;  4KU8 A;  4OFG A;  2JE8 A;  5JMC A;  4LIT A;  1HN1 A;  5FY5 A;  3VBO B;  1LEN A;  4HMZ A;  2KXL A;  3POJ A;  3BTX A;  2J7M A;  1VJ2 A;  4RD7 A;  5JVV A;  1XNC A;  4XIO A;  5I8Y A;  1NLR A;  3VBR C;  5A3T A;  3E6C C;  3VLB B;  5BXX A;  2JG9 A;  3K3N A;  1DYP A;  3OOX A;  5DUV A;  3HEI A;  3AFK A;  3VD9 A;  4Z2W A;  3U10 A;  3O1R A;  1QJX 3;  2G19 A;  1C1F A;  3G7D A;  1A3K A;  3O0V A;  4A7Y A;  4CDW C;  4B8E A;  1I5P A;  5J3U A;  3VZO A;  3IZO A;  3N7J A;  3M8L A;  1NXD 1;  2BGC A;  3LWC A;  4LT5 A;  1PM4 A;  4XFG A;  4ZKT B;  3T1L A;  2EAA A;  5FP4 A;  1JI6 A;  3B3Q E;  2ADE A;  3CHX A;  3JCI A;  3PLQ A;  4LIV A;  4G9S B;  4NHK A;  2A1X A;  3I7D A;  3UV9 A;  3CL1 A;  2AUY A;  1N1S A;  1RVF 2;  2A6X A;  1ONA A;  1SHW B;  2GU9 A;  3ZDV A;  1LES A;  3J7M A;  4UFK A;  1C57 A;  4LBM A;  5B2G B;  4QKB A;  3ZIW A;  5BNN B;  1VR3 A;  4UW5 A;  3N7K A;  5GLW A;  5CEH A;  5J09 A;  4Q8K A;  2CL2 A;  3THC A;  5CU1 A;  1PO1 3;  2Z69 A;  4QB1 A;  4CDX A;  3ZYJ B;  2WWU A;  3FJS A;  3OYW A;  4Q0P A;  1R08 1;  3SMH A;  2GNM A;  5FUI A;  5JCT A;  3AZZ A;  1BHG A;  2P3I A;  3URF A;  2VZP A;  4CPB D;  4WZF A;  3A7Q A;  5C9A C;  2WO2 A;  3ITQ A;  4M4P A;  2CGO A;  2B8M A;  3BIE A;  4A45 A;  4F7Z A;  2EAK A;  2QQL A;  2R1B A;  1UMI A;  3AZW A;  4IGQ A;  2UWC A;  4BE3 A;  1AYN 1;  1PIV 1;  1VAL A;  4WM7 C;  1RUH 3;  4GUL A;  2XKP A;  2EXJ A;  2WRA A;  1YUD A;  2RS5 1;  2YUE A;  3LDK A;  4LLF A;  4RN5 A;  4AFM A;  4UW4 A;  5GM0 A;  1OT5 A;  1GZW B;  1ND3 C;  4QXH A;  4XEZ A;  4COV A;  4OI0 A;  4I02 A;  1VRH 2;  1W8F A;  5C3O A;  3WNL A;  2Y26 A;  2DVG A;  1MPX A;  3OPW A;  2UU8 A;  3E6D A;  1GQP A;  3H7Y A;  4Q0S A;  1KJR A;  2ZCW A;  3MW2 A;  5G04 L;  2YXS A;  3GAL A;  3WDY A;  3LIH A;  3BYW A;  4IEU A;  5CNA A;  2GN7 A;  2BYV E;  4ONU A;  3RNS A;  2JDM A;  4FVV A;  3NJY A;  3Q8C A;  1RUD 3;  2Y6F A;  3PMS A;  2X05 A;  2VCA A;  4QKD A;  1WBL A;  4RQP C;  3MIH A;  2ZEX A;  5HV4 A;  3T1M A;  1SLC A;  5A3W A;  1QOT A;  4Q4Y 3;  3AKQ A;  4Y5T A;  4ZZ8 A;  1TNR A;  4MH0 E;  5FZ4 A;  4MYE A;  5FZG A;  3T4H B;  1LHO A;  1W8H A;  4JQR A;  4ET7 A;  3C7O A;  5C3P A;  2VQ0 A;  4QX7 A;  2WL1 A;  1EPW A;  3ABZ A;  4YFW A;  3BU0 A;  1UCX A;  4QDQ A;  1J3P A;  2WIN B;  2YC0 A;  3LGR A;  4A44 A;  1F4A A;  4YAR A;  5DG1 A;  1QJU 1;  1AR7 3;  4WVM B;  4EQV A;  2DCY A;  4DB5 A;  3HR9 A;  3WW3 A;  1NCQ B;  4KQ7 A;  4D0Q A;  3LA7 A;  3ZXG A;  2RS3 3;  2WN3 A;  2NPI A;  1UNB A;  2GH8 A;  4FTB A;  4ZU7 A;  4R4X A;  1RHI 3;  2BBV A;  3VB9 A;  1UOG A;  5FXZ A;  2WC2 A;  1AX2 A;  4JAA A;  4HBN A;  5IUQ A;  1QJE A;  4YVW A;  4NVP A;  4YG0 A;  3I2I A;  2L9L A;  3PVB B;  3VZJ A;  5FZ7 A;  3VBO C;  4D7S A;  4NHX A;  4DMI A;  1BVV A;  2XWJ B;  2GC0 A;  2OPK A;  2QQU A;  2XXZ A;  3IB3 A;  2ARX A;  2VU9 A;  3UKT A;  1OH4 A;  3KMH A;  2WUH A;  3PJQ A;  3UK9 A;  5CFD B;  4I30 A;  1PZ9 A;  4PDW A;  2FQP A;  3HQR A;  1W9F A;  4RR3 B;  3KV4 A;  1ENX A;  1O4T A;  4FAH A;  1NCR B;  1TZO A;  2E7A A;  4JTO A;  2K0G A;  1MZ5 A;  1W9W A;  2J1A A;  4ZY9 A;  4XCB A;  1W6O B;  1VBB 2;  3BTZ A;  1VAK A;  1WW4 A;  1FX5 A;  3M4F A;  1ZRD A;  1F15 A;  2JDP A;  2Q30 A;  1CZT A;  4M3C B;  2ZGP A;  3K48 A;  4CCM A;  5KR7 A;  4W50 A;  4IE4 A;  4NN0 A;  5CKM A;  2WZP P;  2YU1 A;  1RMU 3;  2B46 X;  5FYZ A;  1HRV 3;  5C3Q A;  2ZX1 A;  1D2S A;  4YW3 A;  4LHL A;  2D3P A;  4N43 B;  3IM0 A;  1W8T A;  4ZS3 A;  5SV8 A;  3WUD A;  1YRZ A;  5BNN C;  1JYX A;  1RXF A;  2WAB A;  2G9G A;  5FTT C;  4DIN B;  3ZN5 A;  3OGV A;  5LB6 A;  2YFU A;  1ULO A;  4N9I A;  3DN7 A;  1H4H A;  2VMD A;  3PDQ A;  1MEC 3;  5CAZ A;  5FYU A;  3LA3 A;  2C26 A;  2D98 A;  2R04 2;  1ZZ9 A;  3AMP A;  3VDC A;  5ACA 2;  5FWJ A;  3FX3 A;  3EO6 A;  2VOW A;  4ISQ A;  4KBZ A;  3LA2 A;  2GME A;  2XHN A;  3LCP A;  5BPX A;  3SXW A;  1WZX A;  4AVC A;  5JXI A;  2J1T A;  3B9I A;  4I3P A;  1RIR A;  5K4L A;  2C6S A;  2PXJ A;  1SLL A;  1RUI 2;  2ATF A;  2I45 A;  1Y9M A;  3P3N A;  4IEO A;  3JD7 1;  5FMC A;  3RGB A;  4URA A;  2MPF A;  2A6Y A;  2JG9 B;  3IMM A;  4NWV A;  3N9O A;  3USS A;  1LOA A;  1SQ4 A;  2P2K A;  1UU4 A;  1GR3 A;  2WWS A;  3FE5 A;  1PO2 1;  4GH4 A;  4YZ4 A;  1SEF A;  4DUX A;  3RZL A;  5IWF A;  1V6L A;  3BOP A;  1S0G A;  5L9V A;  1RYY A;  1RUE 1;  2R7E B;  4AXO A;  2W1W A;  2YY1 A;  3KT4 A;  5KWR A;  2R6Q A;  1AXY A;  3BB6 A;  5FJK A;  4AW7 A;  5KC5 A;  2MNG A;  3WR0 A;  1JOJ A;  1YFX A;  4JGZ A;  2PQS A;  3VKN A;  3DV8 A;  3S57 A;  2A7A A;  4R9D A;  2A3X A;  5FRE A;  2Q8E A;  4Y26 A;  5F7U A;  3V64 A;  4AHZ A;  1W39 A;  3HT2 A;  1TE1 B;  3MLK A;  3HBK A;  4N90 A;  3WW4 A;  5AVA A;  3C7E A;  3WQ0 A;  2JDH A;  4WBB A;  1S0E A;  3B9C A;  3IDE A;  1S0I A;  3I2J A;  4ATF A;  4CDX B;  3H50 A;  3T09 A;  1W04 A;  4Y4Y A;  3OYW B;  4LR4 A;  1FPN 2;  3PVO A;  1CAX A;  5HXM A;  5KHI A;  4QAW A;  2DFC A;  4GB3 2;  5K0U A;  3OGJ A;  4BOW A;  2JWP A;  2CWM A;  1X8M A;  2JEN A;  2RDR A;  1TME 1;  1MZE A;  3WG3 A;  3KF5 A;  4TSV A;  3CU7 A;  4YFZ A;  3B7M A;  4UFL A;  4W4Z A;  4IEY A;  1C1L A;  4LMF A;  1WCS A;  5FJH A;  1ZRR A;  1NCQ C;  2XR4 A;  1S0F A;  5ISL A;  1J3Q A;  1QNY A;  1O3Q A;  1GKB A;  4NO4 A;  1UYY A;  1HV1 A;  1W2O A;  1UPS A;  1WCQ A;  2GP3 A;  4AFD A;  3RSJ A;  3S7I A;  1PX3 A;  3ZXD A;  2HEW F;  1Q5O A;  4XW3 A;  3WT3 A;  3ZSM A;  2TEP A;  1GUI A;  3FZ3 A;  1VP6 A;  1H1M A;  3GHM A;  3E97 A;  2DTY A;  2W1Q A;  5BNO A;  4DRR A;  2VH9 A;  1AZD A;  3ZFG B;  1HKD A;  3KT1 A;  3LZZ A;  5F39 A;  1WBF A;  4BQ5 A;  1MS3 A;  1V6K A;  2Z5W A;  5CFD C;  4BME A;  3T2P A;  5A6Z A;  2VG9 A;  3EBR A;  3LQC A;  5FMD A;  3I3Q A;  4LIU A;  4LTA A;  4RR3 C;  1GNY A;  3TNQ A;  4XFB A;  4FQ4 A;  3HMY A;  1W8U A;  1MQT A;  3MID A;  1POQ A;  4NRM A;  1NCR C;  4EWE A;  1OSG A;  3DCQ A;  1QWR A;  4EJR A;  5IK7 A;  4LLO A;  1QU0 A;  2IXK A;  3HWJ A;  4NPL A;  4KMQ A;  1DDL A;  1LTE A;  4AL9 A;  4LBL A;  4P02 B;  3BI3 A;  2ORZ A;  1LOB A;  3POI A;  3TEZ A;  4AQ6 A;  2VNG A;  4OYU A;  3WD5 A;  2J22 A;  2DVD A;  4P5H A;  2YGL A;  2ZX0 A;  2X10 A;  4H7L A;  4AF9 A;  2D40 A;  3G6J B;  4LBK A;  4MGY E;  3ACI A;  5FZM A;  2P3J A;  4IND A;  5J37 A;  4Q4V 3;  4QXK A;  5JIU A;  1F35 A;  1EAH 1;  4N43 C;  2ZPX A;  1YLL A;  4Q2F A;  5FKC A;  2EAL A;  4BQY A;  1DLL A;  3K46 A;  3I3D A;  2DV9 A;  1RVF 3;  2WZR 2;  1SLI A;  4K3U A;  5JPN B;  4XDO A;  4YVW B;  5DN2 A;  4IES A;  2GND A;  3CDZ B;  3VBR A;  2SLI A;  3O1O A;  4DUW A;  2BDR A;  2UYB A;  2VW0 A;  5FYV A;  4FPG A;  2JDZ A;  1PX4 A;  5EYX A;  5IT6 A;  4D6Q A;  1NE4 A;  1ZBE 2;  2MEV 3;  3TRS B;  3JZV A;  2VMH A;  4BQ2 A;  1JS9 A;  1VPH A;  1BEV 2;  4CDW A;  5A3L A;  4PDW B;  5GZC A;  4RHV 3;  2JG9 C;  2QFE A;  3O0W A;  3Q8E A;  2BRT A;  2ZJC A;  4NAM A;  2DVF A;  1CAW B;  1MS1 A;  2D5H A;  3ALQ A;  3ZSE A;  2ID4 A;  3ZKY A;  5I8T A;  2QQI A;  1X82 A;  1X50 A;  3ES1 A;  3D0S A;  3DYP A;  3LE0 A;  1LGN A;  3MPP G;  2X09 A;  3LEM A;  4URT A;  2WQ4 A;  4XJU A;  5FXV A;  1T6B X;  2Q4S A;  3VBS A;  1YXW A;  4MUV A;  4K8F A;  1J1T A;  4KU7 A;  3U11 A;  5FFO C;  3UKV A;  4BLI A;  2VBB A;  4HPK A;  1YJL A;  5A80 A;  1FMD 3;  2JB8 A;  4A7K A;  2E6V A;  2AEZ A;  2ZS6 B;  4UT5 A;  3TEX A;  3SKV A;  1LB2 A;  1IS5 A;  1CZV A;  1PO1 1;  3FHI B;  1LR5 A;  2ZKN A;  3M3I A;  3MF6 A;  5EHD A;  1D4M 3;  2GC2 A;  4QM8 A;  1DQ1 A;  1OH3 A;  3I54 A;  3FFQ A;  3ZYH A;  4XF4 A;  1DF0 A;  1ALY A;  2UWB A;  1W2N A;  3POB A;  4V2V A;  1YQC A;  3VBH A;  4P9I A;  2DU1 A;  4LBQ D;  4CDX C;  4IEW A;  2W08 A;  4K8R B;  4W6W A;  1COV 2;  1R08 3;  1HIX A;  4UBH A;  1MS4 A;  2OA2 A;  1RUH 1;  1XNT A;  5HXV A;  4KL1 A;  2ZX3 A;  4M0N A;  1UMH A;  5K7P A;  1VMJ A;  1MS5 A;  4AVA A;  4OI4 A;  2WO3 A;  3KT7 A;  1XYO A;  4YGB A;  3MYX A;  5GLU A;  1W8O A;  3UL2 A;  4TTG A;  1PIV 3;  5D21 A;  2JDY A;  3LAG A;  5JOX A;  3AZV A;  4YG3 A;  2E31 A;  2E7T A;  4LQR A;  1J83 A;  4LKF A;  5AC9 2;  1BBT 1;  2QQJ A;  4GH4 B;  1VB4 A;  3AZX A;  3ZVX A;  4HET A;  4FP2 A;  4CU6 A;  5F3I A;  2A5Z A;  3ZXK A;  5HV0 A;  2B7Y A;  3NRU A;  1ACC A;  1UD1 A;  1W9S A;  4X8N A;  1GOG A;  1WMX A;  3PL0 A;  4PHZ A;  1RUD 1;  4DY3 A;  2HH9 A;  3ZFG C;  2VR4 A;  4BIO A;  1H2K A;  2Q0A A;  4JGZ B;  3VKM A;  4XJ8 A;  1OLQ A;  3AMQ A;  4Q4Y 1;  1UKG A;  2OQ6 A;  3HT1 A;  3ASI A;  4JZR A;  4JKL A;  4FAG A;  4OQ8 A;  1W03 A;  1CPN A;  4EYU A;  2BWA A;  3SIT A;  2YHJ A;  2A71 A;  3MIG A;  4IEV A;  3PHM A;  5F9T A;  1AR7 1;  1CAX B;  3MW4 A;  4FQZ A;  4GA9 A;  4LK7 A;  5FIX A;  3AYE A;  3FUQ A;  4Y1U A;  5K0U B;  5C8C A;  4Q4W 2;  1H2M A;  3CQO A;  3MI8 A;  4XZU G;  3GNE A;  4CUC A;  1H1A A;  1XOY A;  3HNY M;  4P9J A;  1FNY A;  4QX2 A;  2FCU A;  4JTN A;  2ZGR A;  3NNF A;  1RHI 1;  4EN6 B;  1XSR A;  2HWE 3;  2Q1M A;  4AK3 A;  4LBO A;  1CAU A;  1FAY A;  4QU1 A;  3I2D A;  3ATG A;  3RS6 A;  1W6N A;  2CTV A;  4XJW A;  4OHW A;  2Y6G A;  1W2T A;  2IXC A;  2Y34 A;  2B5H A;  2J1E A;  1HV0 A;  3VDA A;  1OFS A;  5CFC A;  1YI7 A;  3BPZ A;  1SBF A;  4H7M A;  4QQL A;  1LJ7 A;  2RVA A;  4GKY A;  1AL2 2;  1UYX A;  5G05 L;  4QQ2 A;  2ZA9 A;  3ZM8 A;  3QBQ A;  5BNO B;  3N35 A;  4NAO A;  5A6Q A;  1KIT A;  5F8P A;  2VZ1 A;  1O3S A;  1BXH A;  1B09 A;  3IWZ A;  4OMC A;  1W28 A;  2PTM A;  4NMI A;  2OYZ A;  3K2O A;  1HQN A;  4XJZ A;  4PDW C;  5SV5 A;  4C1W A;  3KD4 A;  1KS5 A;  3UT0 A;  1OLR A;  1VBA 3;  2JX9 A;  1LGC A;  5JWP A;  4ITC A;  3KQR A;  4NRO A;  4H14 A;  1AUY A;  2PHU A;  1MQT B;  5F5Q A;  1RUI 3;  1HQW A;  1RMU 1;  4NRQ A;  1S55 A;  4YW1 A;  2VNO A;  4FPC A;  1HRV 1;  3OSD A;  5APA A;  3KZ4 C;  4QX0 A;  2DTW A;  2WNU A;  2PA7 A;  5EPA A;  1NY7 2;  3CMG A;  3WVJ A;  2A73 B;  4CP0 A;  1N1T A;  2SBA A;  3H1Y A;  3ZIX A;  5A1F A;  2CY6 A;  3RJ2 X;  4NE9 A;  4TLF A;  1QEX A;  5DQ0 A;  1E5R A;  5EJ1 B;  1MEC 1;  2NMO A;  1YIF A;  2VM9 A;  4FCA A;  5BY5 A;  3ZXE A;  5C7G A;  1RED A;  4D3W A;  5LY2 A;  2Y6K A;  3I2F A;  4JDO A;  3WLU A;  3H1W A;  2BOI A;  4DQA A;  4E27 A;  4MV2 A;  3TEW A;  1DZR A;  4ERO A;  5IW0 A;  4RGG A;  2HWD 2;  2K9Z A;  4IE7 A;  2BFU S;  2E53 A;  2WT1 A;  4QKF A;  5FR3 A;  1DQ5 A;  5DZF A;  1ZZ8 A;  2YDE A;  3VBR B;  2ZX4 A;  2XOM A;  2O8O A;  2VEC A;  3KCC A;  1O4Z A;  2PLV 2;  1WCU A;  1SLB A;  1QJY 3;  2P4E A;  3KM5 A;  1SFY A;  2VPV A;  1DQ2 A;  4EE2 A;  3WG2 A;  1PZ8 A;  5FP3 A;  5C71 A;  1JHJ A;  1F2N A;  3Q8F A;  4AEK A;  1Z0H A;  1GV9 A;  4L9B A;  1XSQ A;  1IG3 A;  2P34 A;  2Y6J A;  2QQW A;  4HK9 A;  5T54 A;  1PGL 1;  1LOC A;  3FLT A;  2BJS A;  2NMN A;  2VL4 A;  4TYS A;  2EXI A;  3J9S A;  4P5Y A;  4ZZ5 A;  2XON A;  1OOP B;  5CIS A;  1GU3 A;  1UPI A;  2YPJ A;  4Y5S A;  4GH4 C;  1QQP 2;  5HPO A;  1O3T A;  1X9T A;  3VBS B;  1C4R A;  1DGR A;  1BMV 2;  2BEO A;  3O12 A;  1OVP A;  2RHP A;  4IEQ A;  2BNM A;  2J1U A;  4HPK B;  1FNZ A;  3VBF A;  1DGW X;  2VNR A;  4Q29 A;  4XOG A;  1PVC 2;  3APB A;  2Z42 A;  3MDP A;  4KGQ A;  1AR8 1;  4JGZ C;  3IN9 A;  3O7O A;  3AKR A;  2C4X A;  4JGY A;  3O1U A;  1HRI 2;  3HNB M;  4EN7 B;  1SCR A;  1DP0 A;  1EV1 2;  4A3X A;  5FYM A;  3VBH B;  2HWC 3;  4EZH A;  1D0G A;  3AL5 A;  3IPV A;  4HKL A;  5F1R A;  1UZZ A;  2VMF A;  5JSP A;  1YEW A;  4B3N A;  1KFU L;  4J25 A;  1W3X A;  2RMU 2;  1C8M 2;  3O1P A;  2ZAH A;  4ZXK A;  3U75 A;  4FTE A;  3GZA A;  1AR9 2;  1FOD 2;  2JKX A;  2BWC A;  3NNM A;  3SEP A;  1TMF 3;  3H42 B;  4BYY A;  5K0U C;  3PJY A;  4GWJ A;  4BH9 A;  4TN7 A;  4Y1X A;  5ANQ A;  4CP1 A;  2R16 A;  4KWJ A;  2BBA A;  2ARC A;  4QGM A;  5T5J A;  1MAC A;  4XUO A;  3H8R A;  1GNZ A;  3ON7 A;  5A6X A;  3GJA A;  4FXK B;  5FYI A;  2W3J A;  2V73 A;  2ZHN A;  3TN9 3;  4HVO A;  3VHR A;  4Y1V A;  4JVA A;  3CZU A;  1APN A;  4MOA A;  4QPW A;  2JE9 A;  5LBE A;  5B4N A;  4F83 A;  3PNA A;  3NV3 A;  4PLN A;  3OB8 A;  5DUU A;  3WX5 A;  1MVQ A;  1PMJ X;  2VZ3 A;  1NLQ A;  2QTW B;  5A7W A;  4XF0 A;  3RI9 A;  2VUD A;  3AP9 A;  5BNO C;  5JOW A;  1WCD J;  3LEK A;  1XU1 A;  4FPH A;  4E4D X;  1UX6 A;  5LBC A;  1CES A;  1DZT A;  2HYK A;  3INA A;  4QMA A;  2DCZ A;  4BK5 A;  1YYN A;  2P3K A;  3A23 A;  3MIB A;  3ACG A;  2G9F A;  4OZO A;  4COW A;  1W9T A;  1BK1 A;  1NZC A;  3PVN A;  3TB0 A;  1MQT C;  1G9A A;  1YO8 A;  1CR7 A;  1ZBE 3;  1TQ5 A;  3H3U A;  2VOV A;  4NHM A;  5FY0 A;  1LHN A;  3BU7 A;  4YGE A;  2X29 A;  2YYO A;  3D0J A;  1KS4 A;  3UGG A;  4Q4V 1;  5C8C B;  2XQR A;  3TEY A;  4UF0 B;  4GIQ A;  2PMW B;  3ZSK A;  1W06 A;  3AXE A;  4AGV A;  2XWB B;  1RUF 3;  2YC2 A;  4IDZ A;  5A32 A;  5CB7 A;  1UKR A;  1SBE A;  3H8U A;  4IQP A;  4Q4X 2;  1JU4 A;  1CAU B;  1CIW A;  1IHM A;  1RVF 1;  3I2G A;  4XIK A;  1W6N B;  3CJX A;  1HXS 2;  3VKF C;  4DFS A;  3T30 A;  1N1V A;  2XL7 A;  2XLF A;  4RSU A;  3PUS A;  1HW5 A;  5DDJ 2;  3HJR A;  1Y7B A;  2VCB A;  5CFC B;  5DPN A;  4FPK A;  5GLT A;  3NNL A;  2IWG B;  4O9E A;  1JHN A;  3LSD A;  2MEV 1;  2WKK A;  2RJL A;  5FZ3 A;  2IUW A;  2PHW A;  4CEY A;  4RHV 1;  5FO9 B;  1NE6 A;  2PYT A;  1UXX X;  5FO7 B;  3TNP B;  3U4X A;  1XYP A;  1WW6 A;  5L73 A;  1AJO A;  4E4H A;  1PNG A;  5J48 A;  2E51 A;  1R1A 3;  3AP6 A;  3OUH A;  4ATE A;  1AYM 2;  4LO8 A;  1E5H A;  3U14 A;  2VOX A;  4JCK A;  2BER A;  1UWW A;  2R32 A;  3WDW A;  4J1W A;  3WV6 A;  4AFB A;  4C1X A;  1WW7 A;  4GWN A;  4CUB A;  1H8V A;  5F6K A;  5JXG A;  4AAP A;  1BLZ A;  4FT8 A;  1CZS A;  1FMD 1;  1LU2 A;  1OOP C;  1LHW A;  2O1Q A;  2XUM A;  3NV1 A;  3R0R A;  4AQS A;  1KDM A;  4MGZ E;  3VBS C;  3AK0 A;  4OUE A;  1PK6 A;  2WYS A;  3BTY A;  4OQ9 A;  4FO9 A;  2TNF A;  4CZS A;  5C33 A;  2JKB A;  1D4M 1;  4CUA A;  2WNU B;  3O1M A;  2Z79 A;  2UYA A;  1VMH A;  3Q9O A;  5BUV A;  2VTX J;  1V9U 3;  3TAY A;  5A1A A;  3LFM A;  5FZD A;  5FZL A;  4FOQ A;  5T5O A;  4ZPI A;  4OHZ A;  1IPK A;  2YMZ A;  2OUH A;  5EJ3 A;  4COZ A;  2TBV A;  2ES3 A;  2XH6 A;  4E9K A;  5FPV A;  1LEM A;  1P8J A;  4YNI A;  4Y22 A;  2Y64 A;  4PBP A;  3VBH C;  3HD8 B;  4L97 A;  5LAS A;  3RZM A;  1JU3 A;  4SBV A;  4XQ4 A;  1JZ2 A;  1O91 A;  2BGO A;  4PBO A;  5FY8 A;  3U0Z A;  1C5I A;  2RG4 A;  3ETP A;  2X53 S;  3DF0 A;  4FPE A;  3RG0 A;  3W58 A;  1MZF A;  1QHD A;  3VZK A;  4BXF A;  4Y20 A;  1UMZ A;  1VBE 3;  3EYP A;  2EIC A;  1LNS A;  4HXC A;  2A3W A;  1SPP A;  2VE1 A;  4RA0 A;  1O8P A;  1UU5 A;  2G1M A;  4XDQ A;  5FZB A;  4L11 A;  4ASM B;  2QE3 A;  1RJ8 A;  4Q4W 3;  3VDD A;  2NYY A;  2LAL A;  2DU0 A;  4Q26 A;  2DDU A;  3QCW A;  4M00 A;  4MX3 A;  1BBT 3;  5FPZ A;  3RYR A;  3SCH A;  4E2Q A;  3ZFG A;  5LK7 B;  1ZRF A;  2WII B;  1YFU A;  4YGD A;  1XQN A;  4NHY A;  3VBF B;  4AI3 A;  3M1H A;  4YM2 A;  4XUQ A;  1CON A;  3ACF A;  2XL9 A;  4CCN A;  4D69 A;  1ASJ 3;  2HBU A;  2XJQ A;  3ZN4 A;  4JGY B;  1UOB A;  5HCB A;  3ZXF A;  1FV2 A;  4XAC A;  5DZE A;  3LPG A;  2CAU A;  3S5A A;  3IDC B;  1VAM A;  1HB1 A;  1I6X A;  1K3I A;  5CIR A;  1PM7 A;  3GCX A;  3IPV B;  2RS1 3;  1ZZ6 A;  1E5I A;  4I0B A;  1CGP A;  3AP7 A;  4MXW A;  1JZ7 A;  3ZPO A;  1DZQ A;  2HWE 1;  1ZVF A;  1XE8 A;  3AM2 A;  4MGS A;  2WT2 A;  5AFB A;  5C8C C;  2ETE A;  5FY9 A;  1H2L A;  3BVC A;  1VE0 A;  1LU1 A;  3NL1 A;  4SLI A;  4XAA A;  4ZU4 A;  1L7L A;  5H9S A;  3RWK X;  4UBG A;  3THT A;  4BZ4 A;  1NKG A;  4DEV A;  1ZRE A;  2ZZQ A;  1UW8 A;  4OCT A;  1LKN A;  1MR5 A;  4L99 A;  3W5M A;  2PN5 A;  2O14 A;  4PI0 A;  1AF9 A;  3D3A A;  1MZ6 A;  1NOV A;  3O1V A;  3H8O A;  3S30 A;  1OD3 A;  4ZS2 A;  5T50 A;  2HWF 2;  2QCS B;  3PUR A;  4WV8 A;  1K12 A;  1OC1 A;  2RS5 2;  5GKA C;  4BB3 A;  3D82 A;  5H9R A;  5CFC C;  1J84 A;  2YU2 A;  5A3M A;  1RC6 A;  5F5I A;  1QJZ A;  3LDR A;  2GN3 A;  2BZD A;  2YBS A;  1O5L A;  3A0N A;  3ZYI B;  5A7W B;  4FPY A;  1VBA 1;  3NAP A;  5IAV A;  5C70 A;  2FDF A;  4X6Q B;  4QDR A;  4XBL A;  1AR6 3;  1CAW A;  2RR1 2;  2OW4 A;  5JAX A;  4XFA A;  4A2U A;  4YW6 A;  1LOG A;  2ZAA A;  1RUI 1;  1JTZ X;  2DWR A;  5FLH A;  1FAT A;  3KCX A;  1RUJ 2;  5FP9 A;  2IXH A;  2JXA A;  1OXC A;  3ZFF A;  3GXU A;  4LHN A;  2GMP A;  2WA3 A;  3LF7 A;  4PT6 A;  5L9R A;  4LE4 A;  1O7F A;  1BJQ A;  3RPQ A;  4OHV A;  5DZG A;  4DOU A;  1X9P A;  5FWE A;  1RB8 G;  3JB4 C;  2Y0I A;  3AX4 A;  3Q8A A;  3T0A A;  2VW1 A;  2ADD A;  3OUI A;  3ZYP A;  2RV9 A;  3I8T A;  2WNU C;  4AED A;  4LOT A;  1AXZ A;  1YWK A;  5A32 B;  1PGW 1;  1JW6 A;  2A70 A;  3MIF A;  2NQY A;  2P3Y A;  2VO5 A;  3N7M A;  3SHR A;  1DQ6 A;  3BCW A;  4B7K A;  3VV1 A;  1QJU 2;  2RDQ A;  3WNO A;  4V2W A;  1UF2 C;  4Q8L A;  1CQ9 A;  1QKQ A;  4RYD A;  1D0H A;  4XJ9 A;  1EPZ A;  4M4R A;  1KGY A;  5FK7 A;  1R09 3;  3ZR6 A;  4K20 A;  1QJY 1;  2PHL A;  2PHX A;  3EXU A;  1WMF A;  4BIS A;  2BNO A;  3WSO A;  4CEY B;  4A3Z A;  4W65 A;  5I0U A;  1ZBA 3;  3NNG A;  3MLJ A;  5D8A A;  3ETQ A;  1W0N A;  3KWV A;  3U07 A;  2VVF A;  3CNA A;  4FOW A;  2RMU 3;  4DO0 A;  1CX4 A;  1I5Z A;  3N7L A;  2IFW A;  1GP5 A;  2W52 A;  1YIP A;  1AR9 3;  1Q8S A;  3FLP A;  3GBG A;  3ENR A;  1URX A;  2E33 A;  3J8F 2;  4DXZ A;  3POE A;  1OHF A;  2WA4 A;  2WR9 A;  2VZT A;  4BDV B;  2CAV A;  1O5U A;  1VBD 3;  1ZZ7 A;  3KGL A;  4QX5 A;  4Y24 A;  4HLT A;  2WDB A;  2CGN A;  3IDA A;  1QH6 A;  2AC1 A;  3B5L B;  3DYO A;  5FY7 A;  1K5J A;  3AP4 A;  3NWK A;  2R07 3;  5FMO S;  1PK6 B;  4LA2 A;  4NPM A;  3RVH A;  3VHP A;  4OZX A;  2BPA 2;  4QQH A;  3HQX A;  3VBF C;  4P00 B;  3OD0 A;  2W87 A;  1XE7 A;  2HWC 1;  1AR8 3;  5KBF A;  3PUH A;  3III A;  1F5F A;  5F3E A;  5J1X A;  1UZY A;  3LOI A;  4JGY C;  2F6B A;  4YW7 A;  5F3C A;  1FT9 A;  1SFP A;  2VOT A;  3T3Y A;  1Y3T A;  4IV3 A;  4Y4R A;  2N7G A;  2WS9 3;  1TMF 1;  2RJ2 A;  3NKG A;  4Y22 B;  3ILF A;  3LSE A;  2XBO 2;  4R52 A;  3PIJ A;  3KV6 A;  2MHF A;  4C8D A;  3KSC A;  3WDX A;  1MS0 A;  1BK0 A;  1T6G C;  2DCJ A;  2OZJ A;  3J4U H;  4QHO A;  4RFR B;  3RZG A;  3WIN E;  1WGP A;  5FY4 A;  2ZAC A;  2Y6H A;  5IHR A;  3PUQ A;  4E8C A;  4Y20 B;  3CIH A;  4OUL A;  2E63 A;  3SH3 A;  3TN9 1;  1H2N A;  5LWB A;  2VMG A;  1SPP B;  3QLQ A;  4MLO A;  5EFU A;  4WVW A;  3JD7 2;  4DXR A;  4DEQ A;  2ZKL A;  3I97 A;  4GWI A;  3VDD B;  2YPD A;  2VUL A;  2LRO A;  4FFF A;  4FPL A;  4E8D A;  4LKS A;  4N53 A;  3TYJ A;  1W6P A;  3FL7 A;  2DFB A;  4A42 A;  1A8M A;  1PO2 2;  4BQ1 A;  4NWW A;  1VBC 2;  1V70 A;  1BKZ A;  5FBZ A;  1IG0 A;  4BMB A;  1YJK A;  3OEB A;  4KG0 A;  4MHR A;  3KVA A;  1GWL A;  3N3H A;  5F32 A;  3RFR A;  2ZML A;  4AWD A;  3RYK A;  1RUE 2;  4E2S A;  2P5B A;  4N8M A;  1UO9 A;  3B93 A;  3ZPY A;  3ME2 A;  4CU9 A;  1SG3 A;  3CZJ A;  3WDU A;  1ZBE 1;  2AYH A;  3MUZ 1;  4A7Z A;  4D94 A;  1LUL A;  2ZBJ A;  2C0Z A;  2VVE A;  5LEJ A;  5ABJ A;  4RGK A;  1E57 A;  1O6U A;  2XQX A;  1S0J A;  2GSY A;  4GKX A;  5IVB A;  3W21 A;  3K4D A;  1RUF 1;  3MIC A;  5CZK A;  1F5J A;  5FZ0 A;  5K8S A;  4MXW B;  3C7G A;  2EXH A;  3HN3 A;  5DG2 A;  2OX0 A;  3T2Q A;  4BQ3 A;  1L7R A;  4CXX A;  3VZL A;  1KRI A;  1IPJ A;  2GZW A;  4QT6 A;  2BQP A;  3FN9 A;  2V4A A;  4R8H A;  5FBJ A;  5A70 A;  2PAK A;  4B7E A;  2JD9 A;  3WY6 A;  5FZK A;  4AI0 A;  4AQT A;  2RJK A;  2LM3 A;  1Q8Q A;  1V6N A;  2VME A;  2VMI A;  3W9A A;  2W2I A;  3NKT A;  4Z2A A;  1QXP A;  4IE0 A;  5A7N A;  4O65 A;  1QNW A;  5FLJ A;  1LED A;  3BN6 A;  4CYD A;  1JUI A;  1NXM A;  1Q8P A;  4JDM A;  3OY8 A;  2WFF 2;  3VN4 A;  1PNF A;  1QH7 A;  2QDR A;  4KG8 A;  1JOB A;  5FZ6 A;  4NOT A;  2FDK A;  5E6H A;  3KHB A;  1R1A 1;  3DXU A;  4R9C A;  1OUX A;  1XNB A;  1DU3 D;  4BQX A;  4CXY A;  1COV 1;  4DXS A;  4CEY C;  4MG2 A;  4K21 A;  3NAP B;  4WVZ A;  4CPB A;  2Z4F A;  1SLT A;  3CKH A;  4FI9 A;  5EQU A;  1U5Y A;  1NLS A;  2DBI A;  3OBA A;  1OOP A;  3LEI A;  1S2E A;  5FPA A;  3H3L A;  1RJ7 A;  3K75 B;  4UI9 L;  1CX1 A;  4FP3 A;  4U2A A;  1LHV A;  3D5O A;  3N9N A;  3VZM A;  1UU6 A;  4XVH A;  3ZYB A;  3DYM A;  3KVB A;  2ZGK A;  4OLL A;  3WP3 A;  3ZFF B;  4Y33 A;  3ZOI A;  1XU2 A;  4FBF A;  3AMH A;  1V9U 1;  2ZZJ A;  3ZXA C;  1CPM A;  1VIW B;  5IK8 A;  3QD6 A;  2DUR A;  4CP2 A;  4G3Y C;  1DGR N;  1PK6 C;  2GC3 A;  3A0K A;  3TBD A;  1VRH 3;  3VD4 A;  1EP0 A;  4AED B;  2F4P A;  4RS5 A;  2WN2 A;  4P08 A;  5IFT A;  3WHT A;  3I2O A;  3VKO A;  2QQP A;  4P9Y A;  4LKE A;  4HZF A;  5IFP A;  4I0W B;  1JZ8 A;  3BUC A;  4QQP A;  2BTV C;  4Q0V A;  1RUG 2;  3ZXL A;  4Z07 A;  1EAH 2;  3OEA A;  5JI7 A;  2XJR A;  5A1L A;  4QXB A;  1CN1 A;  1UIJ A;  1VBE 1;  3R6S A;  5CG8 A;  1UYZ A;  1HB2 A;  3KQ4 B;  2QUO A;  1WLW A;  3SEE A;  2FHR A;  3PVE A;  4Q0U A;  2RE9 A;  1G9B A;  1DBN A;  1GFF 2;  1YQ2 A;  4JHT A;  3EMR A;  2D97 A;  3FFZ A;  4Q4W 1;  2WYF A;  2LS6 A;  3IT8 A;  5D8A B;  1S1A A;  1OI6 A;  3BAL A;  3WF4 A;  3JQW A;  1N1Y A;  3WZ1 A;  4CVU A;  4MHU A;  2BU9 A;  3OPZ A;  1QJX 2;  4FFI A;  5CG9 A;  3S7E A;  1JBC A;  3W59 A;  5IAX A;  3VDD C;  4K1Y A;  1EUT A;  3RYP A;  1V6M A;  4XZP A;  5JSR A;  3K77 A;  3OGR A;  4AZZ A;  4QHZ A;  1ND2 A;  5LCW L;  1DCS A;  2BFU L;  4HAN A;  5GLV A;  2DUP A;  4JC1 A;  4QPG A;  1ASJ 1;  1W3V A;  2C9A A;  4LA3 A;  1DYK A;  4S2G A;  5FPX A;  5KHG A;  2WO1 A;  1ZNP A;  3M2M A;  1VLN A;  1FYU A;  2HWF 3;  4YZ5 A;  2ZGT A;  5GAL A;  1UY4 A;  4LXL A;  2JIC A;  1BCX A;  1S4C A;  4LUL A;  3J26 N;  4XDP A;  2RS1 1;  1GZC A;  5JUV A;  4IE6 A;  3OGG A;  2X5I A;  1PO1 2;  3I59 A;  4IV3 B;  4EWA A;  2Y38 A;  1YC6 1;  4EZ4 A;  2C1F A;  3FHQ A;  2OUJ A;  4Y1Y A;  3DL3 A;  3WQ1 A;  3ROU A;  4WVV A;  2VZU A;  4UF0 A;  1V00 A;  4AVB A;  4GQ7 A;  3DXT A;  5GJ6 A;  1T2X A;  4CCJ A;  4EN0 A;  3MZH A;  4ZU5 A;  1VBB 3;  1OLM E;  1RUJ 3;  4DIQ A;  2C24 A;  4Z8B A;  5I91 A;  5D1I A;  5BNP A;  5LAT A;  3FMG A;  5FPB A;  4HOO A;  4L92 A;  1QXR A;  4CE8 A;  4CCL A;  1ZZC A;  1G86 A;  1DG6 A;  1RUC 2;  2GC1 A;  3BPS A;  5CKN A;  3OBR A;  1KDK A;  5A33 B;  5DAV A;  3LKJ A;  2A6Z A;  4FOV A;  2BGP A;  2ERF A;  4N53 B;  3R4D B;  3N9Q A;  1W6P B;  4XQW A;  4KWL A;  1H8T A;  4WM8 C;  1RIT A;  2RDN A;  1AR6 1;  3OBT A;  3IIA A;  5FLI A;  1NUK A;  3T08 A;  4Y3O A;  4I2O A;  4N9H A;  2IC1 A;  3MIE A;  2P37 A;  5ACA 3;  1YQ5 A;  2R04 3;  4EN8 B;  1SMV A;  1NX9 A;  1A78 A;  3GYD A;  3KS7 A;  3NAP C;  5FDB A;  2DUO A;  2CSG A;  2TUN A;  2VNV A;  4OHX A;  5LRR A;  1RUD 2;  1IKP A;  3RZJ A;  3MLL A;  2H0B A;  3KHC A;  3FBM A;  2XLA A;  3HNM A;  3JBG 2;  3UGH A;  4Q4Y 2;  4XUR A;  3RJR A;  2PHR A;  5ABJ B;  4BWO A;  4C91 A;  1XXN A;  5FOB B;  1ZM1 A;  3ZFF C;  1W9Y A;  2WNV A;  3B94 A;  2GMM A;  2OZ6 A;  2A6V A;  2V5D A;  3M3C A;  1QQP 1;  4K6B A;  3ZLI A;  2HEY F;  3QH6 A;  3J8F 3;  1AR7 2;  3TOJ A;  1H1I A;  2W92 A;  4AED C;  2RS3 2;  3C3V A;  5LBB A;  4NII A;  2R06 2;  1QMJ A;  5EV7 A;  1R09 1;  3PUI A;  2B4K A;  4B4R A;  4QWN A;  4D7T A;  1HX6 A;  1U5I A;  5AVP A;  1SBD A;  2Q1F A;  1HDK A;  1RHI 2;  3ACL A;  5HBA A;  5JXJ A;  4LO4 B;  2A6W A;  4AGG A;  5LK5 A;  5EZW A;  4XF9 A;  2IXJ A;  3AC0 A;  4XHB A;  3OY8 B;  4IER A;  4OUS A;  2YGM A;  5C4W A;  2D3S A;  2ZGM A;  3S6P A;  1ZBA 1;  5FP7 A;  1GAN A;  2WLQ A;  3JUU A;  1HN0 A;  3POW A;  3VHN A;  1Z7S 2;  2ZHM A;  1HQL A;  2P17 A;  2RMU 1;  4HT1 T;  1LHU A;  1H6Y A;  1FPN 3;  3H7J A;  5H9P A;  3WP6 A;  1AR9 1;  4GB3 3;  5D2A A;  2W1U A;  3P5B A;  4L0P A;  2OKX A;  1R1Z A;  3WF1 A;  4J6G A;  3LPF A;  4XAE A;  1HB3 A;  3GJB A;  5D8A C;  1ZX5 A;  3VGI A;  1OD5 A;  4O61 A;  5A3O A;  1VBD 1;  2ZGL A;  1RGS A;  1MS8 A;  4CRQ A;  4HN1 A;  4CUG A;  4AHX A;  3MGU A;  1DGL A;  2HWB 2;  1IZ3 A;  3NST A;  5FYC A;  2R07 1;  2JEC A;  5DAW A;  3ZMN A;  4CSW A;  3ILR A;  2BVB A;  1LCL A;  2I2S A;  5J96 B;  1GWM A;  3UET A;  3WG4 A;  2V72 A;  1BZW A;  3RMY A;  4S2H A;  4XQD A;  2CYF A;  1W6M A;  3PME A;  5J7M A;  5CYY A;  5C5U A;  1RMU 2;  3POS A;  3CEW A;  4IV1 C;  1Y4W A;  2AAC A;  2R49 A;  1HRV 2;  1TEI A;  2FMY A;  4RS5 B;  3ZDS A;  3RZK A;  2WS9 1;  3RMX A;  1PMI A;  4NID A;  4CDU A;  4O7X A;  1AVB A;  1PHM A;  3LDB A;  1VBC 3;  1ENQ A;  1RTV A;  2NM1 A;  3GHN A;  2VBD A;  1SDW A;  4IV3 C;  3MPB A;  2F17 A;  5M0T A;  4XFI A;  1MEC 2;  3MW3 A;  1HJG A;  1XJA A;  5DAB A;  4CEW A;  1JOD A;  3CF6 E;  3LB9 A;  1VAV A;  1YQ8 A;  1SAC A;  4KI5 M;  4K9S A;  4R9A A;  3BTA A;  2J42 A;  3IAP A;  4JV4 A;  5C3R A;  3S0M A;  4CCC A;  1I3H A;  2DBN A;  2E26 A;  4QPI A;  3B01 A;  2ZGQ A;  3RI8 A;  5T52 A;  1GP6 A;  1ZRC A;  3B00 A;  1R64 A;  4XE9 A;  1ULC A;  2DCK A;  2B39 A;  4GMP 3;  2FDJ A;  3ES4 A;  5J36 A;  4YW5 A;  2WT0 A;  2PHF A;  3SCF A;  1X36 A;  5EP9 A;  1NA1 A;  1PGL 2;  2Q1Z B;  1B35 A;  3FLR A;  4XTP A;  2XPJ A;  2VTF A;  4N53 C;  2WFP A;  4DPN A;  1ND2 B;  4FFH A;  4HVR A;  4X8P A;  3WQB A;  4QX1 A;  4LOS A;  2WZR 3;  2YZ4 A;  4QPG B;  3KGZ A;  4AHY A;  1K45 A;  2C5D A;  3WW1 A;  1UL9 A;  3M3Q A;  3WEZ A;  3L2Y A;  5FQ0 A;  2VOK A;  3GF6 A;  2WFF 3;  1UOJ A;  4KGG A;  5BNQ A;  5FK8 A;  2D6N A;  1OFN A;  1SZB A;  2LTN A;  3WF0 A;  3D8C A;  2DCT A;  1YHF A;  3ZR5 A;  2VGD A;  4NIG A;  1A6C A;  1A8D A;  4A41 A;  4Y1Z A;  4QDS A;  3UYJ A;  3JXS A;  2X5I B;  1BEV 3;  2GDF A;  3I59 B;  4R9B A;  3NJV A;  4IL7 A;  4Y5Z 0;  5ABJ C;  2FZ2 A;  3N4M A;  5JZG A;  2VAU A;  4E4S A;  1CWP A;  5FZA A;  4C0H A;  3J7N A;  4DUV A;  1WW5 A;  5DAQ A;  1JZ6 A;  2CGP A;  4FPJ A;  5EJZ B;  4TZD A;  4XMA A;  1AXK A;  3IAQ A;  1U5X A;  2ARE A;  2D6M A;  2E7Q A;  3AKS A;  3VD7 A;  5A3P A;  5KHJ A;  1DLC A;  2W9X A;  5CKQ A;  3OPT A;  5FP8 A;  5I0T A;  3VZN A;  5BNP B;  2FDH A;  4A6S A;  4AVS A;  3AMM A;  2XDV A;  2ZHL A;  4L8Q A;  4ASK A;  1ULF A;  2EF6 A;  1HLC A;  5JLV A;  3DEM A;  1J3R A;  5E8A A;  4ASL A;  5GLZ A;  2FBE A;  1DFQ A; 
#chains in the Genus database with same CATH homology
 3K46 A;  2VJX A;  1XC6 A;  3WF3 A;  3GXU A;  3I3D A;  4PT6 A;  5DN2 A;  3CDZ B;  3T2O A;  3K4Z A;  4DUW A;  3T0A A;  2RV9 A;  1PX4 A;  4BK4 A;  1CIY A;  4JX0 A;  2VO5 A;  1GOH A;  4ARY A;  3WNO A;  4RYD A;  3UNP A;  4M4R A;  3GGL A;  2ID4 A;  1KGY A;  2QQI A;  1JYV A;  3I3B A;  3UES A;  2E32 A;  3DYP A;  3LE0 A;  2X09 A;  2W91 A;  1ULP A;  3A21 A;  4UAP A;  3WSO A;  1H6X A;  1UZ0 A;  4A3Z A;  3MV1 1;  2QBX A;  3NNG A;  1W0N A;  3SKV A;  1CZV A;  2VZV A;  3WNM A;  1US2 A;  3MO4 A;  1O59 A;  2W95 A;  2J1S A;  2E33 A;  3K4A A;  3VD5 A;  2VZT A;  4BDV B;  2HYX A;  2WDB A;  3IDA A;  3I3E A;  3DYO A;  3SKJ E;  1DYO A;  2EIE A;  2WZE A;  1UY3 A;  2J1V A;  1XNT A;  4P00 B;  1UMH A;  2W87 A;  4A6O A;  2EIB A;  2WO3 A;  3PUH A;  3III A;  5J1X A;  1K42 A;  1JZ5 A;  1W8O A;  4TTG A;  4XUP A;  2VOT A;  3MV0 1;  2QQO A;  2E31 A;  4LQR A;  1J83 A;  1UY1 A;  2RJ2 A;  4LHS A;  2QQJ A;  1JZ4 A;  4CU6 A;  2DCJ A;  3NRU A;  1W9S A;  1WKY A;  1GOG A;  2W94 A;  4JKK A;  2C9K A;  2Y6H A;  5IHR A;  4E8C A;  3CIH A;  3GM8 A;  2VR4 A;  5JXH A;  2VMC A;  4DXR A;  4DEQ A;  4JKL A;  3I97 A;  4GWI A;  2B9V A;  1TVG A;  4E8D A;  4LKS A;  3FL7 A;  4A42 A;  3NQH A;  2QQK A;  5JMO A;  3OEB A;  3CQO A;  4XZU G;  4CUC A;  3HNY M;  4QX2 A;  2WZ8 A;  1UY2 A;  4CU9 A;  1SG3 A;  3CZJ A;  3DEC A;  4XUT A;  3MUZ 1;  3HPN A;  2Y6G A;  2J1E A;  2YG0 A;  2XQX A;  3ACH A;  3VDA A;  3K4D A;  2WAA A;  5CZK A;  3C7G A;  2RVA A;  3HN3 A;  1US3 A;  2QQM A;  1UYX A;  5G05 L;  3T2Q A;  1L7R A;  5B4X A;  2W5F A;  4MAD A;  3ZM8 A;  3FN9 A;  3A22 A;  3C7H A;  1D7P M;  2VC9 A;  2JD9 A;  1W8N A;  2VZ1 A;  2LW8 A;  3I2H A;  2VME A;  4OMC A;  5DMY A;  4Z2A A;  2YFZ A;  3BN6 A;  2ZEW A;  3WNN A;  1GMM A;  4IUG A;  2J1R A;  1PMH X;  2W1S A;  1OF4 A;  2HLE A;  2JE8 A;  3U37 A;  2VZS A;  4BJ0 A;  4QX0 A;  4A4A A;  3BGA A;  4DXS A;  3CMG A;  4DXT A;  3MBW A;  2J7M A;  4QB2 A;  5IJR A;  2Z4F A;  3CKH A;  4FI9 A;  5LA1 A;  5IYY A;  1XPW A;  3OBA A;  4PQQ A;  1UX7 A;  3LEI A;  5LA2 A;  3K75 B;  4UI9 L;  5DQ0 A;  5EJ1 B;  5C7G A;  3HEI A;  2VM9 A;  1CX1 A;  5I0D A;  3VD9 A;  2Y6K A;  3I2F A;  4XVH A;  3DYM A;  2WBK A;  1I5P A;  1JYN A;  1IQD C;  2XOM A;  4KWU A;  2ORX A;  2ZEZ A;  4GZ9 A;  1JI6 A;  3VD4 A;  3C7F A;  2WN2 A;  3NJX A;  4P08 A;  5IFT A;  5C71 A;  1JHJ A;  1SHW B;  2VQT A;  5IFP A;  2Y6J A;  1JZ8 A;  2VCC A;  2VL4 A;  3C8X A;  2VZR A;  3OEA A;  3THC A;  4P5Y A;  4ZZ5 A;  2XON A;  4QB1 A;  1GU3 A;  4LPL A;  1NAE A;  3HOB A;  5HPO A;  1XNA A;  2Y6L A;  1UYZ A;  2KD7 A;  3SEE A;  5FUI A;  1BHG A;  2J1U A;  1YQ2 A;  2VZP A;  3A7Q A;  1EUU A;  2WO2 A;  2LS6 A;  4M4P A;  4A45 A;  2QQL A;  3WF4 A;  1UMI A;  3I2K A;  2C4X A;  4CVU A;  3HNB M;  4RN5 A;  3W5N A;  1DP0 A;  2YB7 A;  5LA0 A;  1EUT A;  2JDA A;  4JHZ A;  2VMF A;  1OT5 A;  3K77 A;  3OGR A;  2CDP A;  5LCW L;  2WQ8 A;  2ZEY A;  2JKX A;  4QX3 A;  3SEP A;  3WNL A;  1MPX A;  4GWJ A;  1GQP A;  2WO1 A;  1UY4 A;  5G04 L;  2BBA A;  5JUV A;  4XUO A;  3WNP A;  2X05 A;  2VCA A;  2W3J A;  2ZEX A;  3FHQ A;  2W46 A;  3T0D A;  4ZZ8 A;  3MUY 1;  3CZU A;  2VZU A;  4MOA A;  4QPW A;  5B4N A;  1T2X A;  3T0B A;  4ET7 A;  3C7O A;  3ABZ A;  3OB8 A;  1PMJ X;  4QDQ A;  2VZ3 A;  4A44 A;  1F4A A;  3LEK A;  3F2Z A;  4JKM A;  4D0Q A;  1SDD B;  2WN3 A;  3P6B A;  4BK5 A;  3A23 A;  2ZXQ A;  3ACG A;  1JYW A;  4OZO A;  1W9T A;  3LEG A;  2BGP A;  3T08 A;  1NUK A;  2L9L A;  3I2I A;  1OF3 A;  1NX9 A;  2YC2 A;  3IB3 A;  1OH4 A;  3P1I A;  2WUH A;  2VQU A;  1JU4 A;  3I2G A;  3HNM A;  5JR2 A;  4XUR A;  3HJR A;  3VDB A;  3E1F 1;  1L7Q A;  2VCB A;  5DPN A;  1W9W A;  2J1A A;  4ZY9 A;  1TG7 A;  4ARX A;  4D8M A;  2V5D A;  4ZXE A;  2QQN A;  1CZT A;  1UXX X;  4W50 A;  3VD3 A;  2W92 A;  3J7H A;  3PUI A;  2B4K A;  5JXJ A;  2BER A;  1UWW A;  1JYX A;  4CUB A;  2WAB A;  3AC0 A;  5JXG A;  3OGV A;  2YFU A;  1ULO A;  1CZS A;  2VMD A;  2C26 A;  3VDC A;  4OUE A;  2WYS A;  5EIY B;  1H6Y A;  2XHN A;  4CUA A;  5JXI A;  4MO3 M;  1GOF A;  2J1T A;  2W1U A;  4L0P A;  2OKX A;  5A1A A;  3WF1 A;  3LPF A;  3GDB A;  3OG2 A;  1P8J A;  4PF1 A;  2Y64 A;  1KEX A;  2V4V A;  4DUX A;  1F4H A;  1JU3 A;  3UET A;  4OMD A;  2V72 A;  1JZ2 A;  2BGO A;  4BXS V;  1RYY A;  3ETP A;  2R7E B;  5CYY A;  2W1W A;  4UOJ A;  3EYP A;  2VZO A;  2EIC A;  2PQS A;  1LNS A;  1O8P A;  5F7U A;  3C7E A;  4XUN A;  1O8S A;  4W8J A;  2DDU A;  4QB6 A;  3I2J A;  3FHA A;  3T09 A;  2VZQ A;  5HXM A;  4QAW A;  4KI5 M;  3IAP A;  3THD A;  2E26 A;  4XUQ A;  4W4Z A;  3ACF A;  3ECQ A;  1R64 A;  2DCK A;  2CDO A;  4AG4 A;  1W99 A;  3LPG A;  1K3I A;  1UYY A;  1WCQ A;  1UY0 A;  2W47 A;  2VTF A;  1PX3 A;  1JZ7 A;  2WAO A;  4QX1 A;  3WQB A;  4AAX A;  1UXZ A;  1GUI A;  1K45 A;  3EB7 A;  4HG6 B;  3WEZ A;  4MGS A;  2W1Q A;  3WNK A;  3WF0 A;  4DEV A;  1NKG A;  4A41 A;  2Y8K A;  2YC4 A;  3W5M A;  4QDS A;  3T2P A;  3JXS A;  3D3A A;  3LQC A;  1GNY A;  1OD3 A;  3NJV A;  4CU8 A;  1K12 A;  4DUV A;  1JZ6 A;  1J84 A;  4KMQ A;  5EJZ B;  1JZ3 A;  4CU7 A;  4P02 B;  4YPJ A;  3IAQ A;  2ORZ A;  2BZD A;  3WF2 A;  4MGQ A;  4OYU A;  3VD7 A;  2J22 A;  1DLC A;  2W9X A;  5C70 A;  4QDR A;  2X10 A;  2EID A;  4TXW A;  3ACI A;  3OGS A;  1HN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...