4ZY9A

X-ray crystal structure of selenomethionine-labelled v110m mutant of chitosan-binding module 1 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
HHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGGIDDITFTARTAKYVRMHGTVRGTPYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase/chitosanase
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
total genus 32
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zy9A00
1I5PA 3IAPA 2VMEA 2X05A 2C9KA 5JUVA 2W94A 1SG3A 2CDPA 4BJ0A 2Z4FA 4JKMA 1K12A 3VD9A 1XC6A 4A41A 3K4AA 3T0DA 1J83A 1GNYA 2WAOA 2W1QA 3WNKA 1J84A 4OMDA 1NAEA 1CZVA 2DCKA 2DDUA 2EIBA 4ZZ5A 2J7MA 3LEIA 3C7OA 2VMCA 2WUHA 2W5FA 1RYYA 4QDSA 1PMJX 3WF2A 3T2PA 2RVAA 2ORZA 2J1VA 3I3EA 3LPGA 2QBXA 4D8MA 1NUKA 1W99A 2QQJA 3P6BA 1JYNA 3NJXA 4UI9L 3VDBA 3K46A 1UYXA 1JU3A 4ET7A 4ZZ8A 3VD7A 5LA1A 3HJRA 3IAQA 3MUY1 3WF0A 1NX9A 2VMDA 3ETPA 2W91A 1WCQA 2RV9A 2QQLA 2VZTA 2X09A 2ID4A 3HPNA 4JKLA 1W0NA 4DXRA 3ACFA 3HEIA 3VDCA 3OEBA 1UWWA 1F4HA 1PX4A 1JHJA 3T2QA 5DQ0A 1SHWB 3GM8A 4A6OA 3THDA 2Y6LA 1TG7A 3WNMA 3I2JA 3NRUA 3UNPA 4P00B 3DYMA 3VD3A 2VOTA 1JZ8A 3D3AA 5A1AA 4W50A 1K42A 3WNOA 2VQUA 4M4PA 2J1TA 4GWIA 5DN2A 4IUGA 3DECA 2E31A 3MO4A 3WF3A 3SKVA 3FHAA 2OKXA 1UY4A 1GUIA 4DUXA 1H6XA 3SKJE 3DYOA 2Y8KA 3UETA 3K77A 3U37A 1JZ4A 3OBAA 5CZKA 4GWJA 3E1F1 2J1SA 2L9LA 2WO2A 3BN6A 2W1UA 3HOBA 4UAPA 1GOHA 2YFUA 2YFZA 3W5NA 5JXGA 2E32A 3EYPA 4QX0A 3MV01 1T2XA 3WF1A 4E8CA 1F4AA 3IB3A 4L0PA 1K3IA 4OYUA 4QB1A 4XUQA 4Z2AA 2W47A 1JYVA 3C7HA 2VCAA 2Y6KA 2QQOA 2Y64A 3HN3A 3CZUA 2QQIA 2VZOA 1HN1A 1XNAA 4MOAA 2ZEXA 2VM9A 4XURA 3THCA 3VD4A 4BK4A 2HLEA 3NJVA 3I2FA 3EB7A 4OMCA 3WNPA 3IIIA 3T2OA 5IFTA 4XVHA 2RJ2A 1OF3A 4PT6A 5DMYA 5G04L 1IQDC 4OZOA 4E8DA 3C8XA 1K45A 1UMIA 3DYPA 1JU4A 2JDAA 1JZ7A 2VJXA 1EUUA 2CDOA 1DYOA 2W9XA 3ACIA 2Y6JA 1US3A 3LPFA 1W8OA 3AC0A 5CYYA 1GOFA 4LQRA 1JYXA 5JXHA 4XZUG 2QQNA 1CZSA 1UY3A 4LHSA 3MBWA 2BGOA 1BHGA 1MPXA 3I97A 4D0QA 3A22A 1UY2A 5LA0A 3GXUA 5B4NA 4M4RA 1O8PA 1JZ5A 2ZEZA 2J1UA 2YC2A 3FHQA 4QX2A 1H6YA 2YB7A 5EJZB 4PF1A 2V72A 2YG0A 3NQHA 5LA2A 1KGYA 1UY0A 3LQCA 4QDRA 4W4ZA 2VZPA 2Y6HA 3LE0A 3OGSA 2VCCA 3ZM8A 1GU3A 4QAWA 3K4ZA 2J1RA 4P5YA 3J7HA 5C71A 5IHRA 1P8JA 4KMQA 1ULOA 1W9TA 1UYZA 4DXSA 2JKXA 2X10A 2EIDA 2WO1A 5J1XA 2BBAA 3WQBA 1R64A 2J1EA 3A23A 2EICA 1L7QA 2VZSA 5LCWL 1UXXX 2YC4A 4GZ9A 3T08A 2BZDA 4CU6A 4PQQA 2VMFA 1JI6A 4FI9A 5G05L 1UYYA 2LS6A 3ABZA 2XONA 3PUIA 4QDQA 4CUCA 2LW8A 4MO3M 1ULPA 4DUVA 4DXTA 1OD3A 2ZEYA 3MUZ1 2VC9A 3HNBM 5C70A 2C4XA 2WBKA 2VZQA 3K75B 4CU7A 4A42A 2XHNA 4CU8A 1CX1A 3HNYM 3C7FA 3WEZA 5JR2A 1EUTA 3WNNA 4XUNA 3T0BA 2ZXQA 2WN3A 3WNLA 4AG4A 5IYYA 1YQ2A 4BDVB 2QQMA 3PUHA 1KEXA 4XUTA 3LEKA 3C7EA 3OGRA 3CIHA 1UMHA 3CZJA 4ARYA 1JZ2A 3CQOA 2R7EB 5I0DA 2W1WA 2VQTA 3A21A 3UESA 1O8SA 1UX7A 2BERA 2JE8A 4BK5A 4XUOA 5EIYB 2W87A 2XOMA 4KI5M 3I2HA 1JZ6A 2W1SA 1GQPA 2WQ8A 4CUAA 3GDBA 2BGPA 3I3BA 1US2A 5IJRA 4MADA 2KD7A 1JYWA 3MV11 1D7PM 2VO5A 2B9VA 3SEEA 3WSOA 1PX3A 3WF4A 2VR4A 4CUBA 4DEQA 1OH4A 4CVUA 4LKSA 4QB6A 3I2KA 3ECQA 2VZVA 4JX0A 4JKKA 4RYDA 1NKGA 2Y6GA 2W92A 2V4VA 3FL7A 4ARXA 3A7QA 4DUWA 1XPWA 2J1AA 3I2IA 3CDZB 3F2ZA 2VCBA 2WZEA 3OB8A 2HYXA 5JXJA 4A3ZA 2WO3A 3CMGA 4LPLA 2VTFA 4AAXA 1OT5A 2DCJA 4MGSA 3C7GA 1XNTA 3ACGA 1WKYA 1UY1A 5F7UA 2JD9A 2XQXA 3K4DA 4JHZA 2E33A 3T0AA 1TVGA 4QPWA 5JMOA 3JXSA 4YPJA 2E26A 3VD5A 3SEPA 3T09A 1JZ3A 2VZ3A 3HNMA 2WZ8A 4A4AA 5C7GA 4TTGA 1OF4A 3ACHA 3NNGA 3BGAA 2C26A 3LEGA 4XUPA 3OG2A 3VDAA 3P1IA 1UXZA 2VZUA 1W9WA 4MGQA 1DLCA 1GOGA 4P02B 4OUEA 4BXSV 2W95A 2WAAA 4QX1A 4ZY9A 2W3JA 1DP0A 1W9SA 4P08A 2J22A 2W46A 2ZEWA 1LNSA 4DEVA 2VL4A 5HPOA 4W8JA 1L7RA 2PQSA 2QQKA 2WYSA 2B4KA 5JXIA 2V5DA 4CU9A 4A44A 1CIYA 3I3DA 4UOJA 5DPNA 4RN5A 2VZRA 1CZTA 2WDBA 5IFPA 3GGLA 3OGVA 5B4XA 1SDDB 1PMHX 1O59A 2ORXA 4QX3A 4A45A 2VZ1A 3IDAA 5EJ1B 2WN2A 4HG6B 2WABA 5HXMA 1UZ0A 4TXWA 3OEAA 3FN9A 3CKHA 1GMMA 2EIEA 3W5MA 1W8NA 5FUIA 4KWUA 4QB2A 4ZXEA 3I2GA
chains in the Genus database with same CATH superfamily
3ZLIA 1I5PA 3IAPA 1PM7A 1SLBA 4N7IA 4KBZA 2D3PA 2EXIA 4N43C 5DDJ2 2X05A 1FV2A 1SG3A 1X7NA 4BJ0A 5BNPA 3AMQA 2Z4FA 4N90A 3UV9A 3VD9A 3M1HA 4IGQA 3K4AA 1D4M2 1V6MA 1GNYA 1Q8SA 4PQ9A 1OLRA 5JSRA 1TNRA 1V9U2 2YROA 3E5XA 4FPYA 1AL21 4JRLA 1BLZA 2WINB 5L7OA 4IEPA 4QQOA 5GLZA 2GNTA 5A33A 1UOBA 3NW4A 3C7OA 3AKQA 2ATFA 3ME2A 4AI3A 1VBA1 1TMF1 3N9MA 1RYYA 4QDSA 1EYBA 5A3PA 5AC93 2CSGA 3VB9A 3WF2A 4A7ZA 3T2PA 5EPAA 4Y26A 4LUMA 2ORZA 3BU0A 4Q5OA 1CWPA 2ZHLA 4RS5B 1A8MA 4Z92B 1AX2A 4ZKTB 2XBO3 3POBA 1RMU2 1VRH2 1QHDA 1JYNA 2GSYA 3NJXA 4YGBA 4J1XA 1GNZA 5FZBA 3OJBA 2Z79A 1JU3A 3D82A 4XE9A 1NE6A 3W9AA 3WT3A 5H9QA 5A3NA 2FCVA 5AFBA 1WZXA 4LO8A 3G6JB 2QQWA 2VMDA 4GULA 1NZCA 4Y5TA 2W91A 3MIHA 4NWVA 5CG9A 2DVAA 4G4FA 4YGEA 4E4ZA 2X09A 4YZ4A 3RMXA 4DXRA 1RUE2 3PIGA 1VAMA 3LSEA 5GZDA 1IKPA 5A6XA 1S0EA 5KHGA 3POFA 2R6QA 3HT1A 4HKLA 1LGCA 2PHUA 5EXOA 3FE5A 2UY8A 1TME3 3FUOA 1RUJ2 4TLFA 4MH0E 4AI2A 2GN7A 1QJY1 2UWBA 2ZGTA 3EMRA 3FBMA 4M01A 5DG2A 5LATA 1YRZA 5DQ0A 2QQUA 1DZQA 3GM8A 4AK3A 2CHHA 2D98A 4KG8A 1ULFA 4JGZC 3THDA 1Z0HA 2GMEA 1H8VA 1VBB3 2E7QA 1RUD2 3I2JA 4BM8A 5FP3A 3KMHA 4LO7A 3FLRA 3UNPA 2XKPA 2ZGKA 3DYMA 2AEYA 2CU5A 3QH6A 2VOTA 4IV1B 3ZDVA 5JZGA 2CGPA 2XUEA 2PXJA 5BYNA 3N7LA 2XLFA 1AL0G 1O5LA 4YNIA 3W59A 3ZFFC 3VBHA 1MZ5A 4H14A 4K8FA 1PO21 5A3MA 3O1OA 2ZMLA 2W0XA 1W8UA 1PNGA 1TQ5A 3MO4A 3THPA 2UWCA 5A3UA 5FREA 2JDZA 1YJLA 1HB3A 2QQVA 4PLNA 4S2DA 4YLZA 2VQ0A 4CCEA 2CWMA 3FHAA 3E6DA 2YPDA 4LJHA 3J7LA 2A6YA 3RNSA 3BKZA 5CADA 3OBAA 4FSJA 1UF2C 5CZKA 1LGNA 3HBZA 4WVZA 4LT5A 4YARA 2J1SA 4EROA 2W1UA 3HOBA 1B35A 1LEDA 2A6WA 1H8TB 4ISQA 4O7XA 5T5LA 4E27A 5IAXA 1QNYA 1Q8PA 1S2BA 2VVFA 1HB4A 4A2UA 4EQVA 1PK6C 3PL0A 2R072 4XYXA 3HD8B 4BQXA 4PDWC 1H30A 2NN8A 2X5IC 1T2XA 3WF1A 2ZMKA 1F4AA 5CVRA 3IB3A 4XBQA 4AAPA 1JN2P 1QMJA 4Z82A 1AXYA 1SBEA 3WNXA 3TN93 3AKPA 4OYUA 5ACA3 1COV1 5CKMA 1HRI2 1UPSA 4AFCA 4AGRA 5A70A 2PHLA 1CPNA 2XXZA 2W47A 4M0NA 4IV3B 3N7MA 5KXDA 3NAPB 4KGQA 2R041 4D69A 4BYYA 1AYN2 1UQXA 2JJ6A 2Y64A 4IERA 4MV2A 1R091 2DCYA 1C5IA 1HRV2 1ZBA1 2FHRA 1B09A 3J26N 3ZO0B 2WKKA 2XB6C 2VM9A 4XURA 4Z1VA 3KQRA 2PTMA 4QQ2A 5FFOC 1Z7S3 2OX0A 1GZWA 4E4DX 3WXPA 1VR3A 3S5AA 5F1RA 2FDGA 3I2OA 3CU7A 5IFTA 1OF3A 3NKTA 4XC9A 4BMEA 3IBMA 2UYBA 3AVSA 3PVEA 2FZ2A 2YHJA 3M3OA 1K45A 4JDMA 1UMIA 3KM5A 1DQ2A 4E8DA 3VDDB 3DYPA 3VBSC 3ZN4A 1W6NA 2DBIA 5T5JA 2HWE2 2Y6JA 5FPLA 1OPMA 3LPFA 1O3TA 4AI1A 2DF7A 2HYKA 3H42B 5D8AC 4C8DA 1GOFA 4CCCA 3PU3A 4WM8A 5FUPA 5LA9A 5AC92 5JXHA 3NNLA 3H8OA 3VLBB 1CZSA 1UY3A 3DXTA 3MBWA 4YM0A 1C28A 2BGOA 3N7KA 1MPXA 2E6VA 5FZ9A 5FZIA 4FO9A 3A22A 1UY2A 3OD4A 3S7EA 3V64A 2EIGA 1ND2A 2HWB3 5B4NA 3S30A 1GQGA 1LHVA 4M4RA 1A78A 3O1SA 4ASLA 3AX4A 2QJVA 2CAUA 2OS2A 2FMDA 3G7DA 3GJAA 2G9FA 4I02A 3B94A 3FHQA 3VBUB 4QX2A 1OOPA 3D5OA 1EY2A 2YB7A 1IS3A 1R081 3WDTA 3USSA 4C91A 3BVCA 1LEMA 1S0CA 3LDRA 5EYYA 5JI9A 5A7WB 4HXCA 1V6IA 1VRBA 4LBKA 1QH7A 3POYA 4WM7B 1LHUA 4CDUA 1TME2 2VBDA 3CJIC 3OGSA 1OQDA 4UBGA 1KDMA 4N53C 4B7KA 2Y38A 2V4AA 4KWKA 5D21A 2JG8C 1OFSA 2YDEA 4NPRA 3ZFEA 1XBFA 4QAWA 2WT0A 3LDKA 5C71A 1XJAA 5IHRA 3RI9A 1P8JA 4KMQA 4F3JA 1ULOA 4LBNA 1VBB2 1W9TA 4LK7A 4R4XA 2WZR1 1AR93 2EVXA 4KU7A 5CKNA 1HV1A 2LTNA 2ARXA 2X10A 5FWJA 3ZVXA 4CCKA 1BKZA 2BNNA 4MGYE 4PBOA 4QPGB 4ZONA 3WDUA 2ZGLA 3RZHA 1XQNA 3V65A 5F2SA 1SFYA 4LBMA 3B3QE 4G9SB 5FXXA 3RPQA 3A23A 5IK7A 4HFSA 3AP9A 1L7QA 1N1YA 4AGVA 4NPLA 2D43A 3B01A 3NNFA 4HETA 4Y20B 1BEV2 3DV8A 1OMIA 2BOJA 2YC4A 4GZ9A 2OA2A 3MIFA 5A6YA 3JQXA 2OPKA 4PQQA 3WDVA 1VBD1 4YZ5A 4I0BA 4QX8A 1JI6A 4HLTA 4LO5B 5FOBB 1RHI1 2VOVA 5EFUA 2Q30A 1UYYA 1QJU2 4OUSA 4XMAA 1XB9A 3RGBA 4MLOA 3ZPOA 1QJX2 4HANA 4IEYA 4YW5A 3ABZA 2XONA 1DYKA 4AVCA 4CP9A 4EE2A 1HIXA 5E89A 5LASA 4COYA 4E4SA 2V09A 2SLIA 4BXFA 4CDXC 1HXS3 1KQRA 3BOPA 3SITA 2P3YA 2QZ2A 3AMPA 1V70A 2AC1A 3HNBM 2A70A 5E88A 5C70A 3J7NA 1AYM2 1CAVA 5ISLA 3JBG3 1X8EA 1QJFA 2IC1A 1C57A 3OPWA 2WT2A 4CU8A 1CX1A 1N47A 2ZGSA 3GZTB 5DUXA 3R4DB 5FKBA 1Y43B 1W2AX 4KU8A 1VLNA 3TN92 2WSVA 5ACA2 5C33A 3JCIA 3OOXA 5DAXA 4XUNA 3WNNA 1MS4A 4AQ6A 4XUTA 2FDFA 3C3VA 1N1TA 4AI0A 2IZWA 1X82A 1LODA 1XE8A 3C7EA 1UMHA 1ZM1A 1PVC2 1GSLA 3CIHA 3CZJA 4NR1A 2CV6A 4QGNA 3DF0A 1NXMA 2WC2A 5EP9A 3A21A 1UX7A 2GNDA 4D7SA 1DQ6A 3W58A 4BLIA 5LEKA 4WVVA 4XUOA 5T5PA 5EIYB 1OKOA 3ZYBA 1Z7S2 1Q8VA 2GNBA 2W1SA 2WQ8A 3GDBA 2FDJA 5FZFA 4DNYA 4F8AA 4DRVA 1UNBA 4Y22A 5L9BA 5IJRA 3VBOC 2KD7A 4BB3A 3V56A 5JDBA 3AP5A 4CZSA 1PZ7A 1Y9GA 4FVVA 3ZFFB 4QQLA 3U1XA 3AZYA 1RL3A 2JDPA 5F5QA 2P6CA 3WF4A 1GANA 5J48A 1OQ1A 3U11A 1MS8A 1OH4A 1QQP1 3MI8A 1ENSA 4MXWA 3CBNA 3H50A 3ZSJA 4IETA 4RQPA 4QB6A 3I2KA 1ZYBA 3PU8A 4UFMA 4Z8BA 4LHNA 2C1FA 3ZYGA 3H1MA 4JX0A 4W6WA 1C3HA 4A7YA 1N1VA 2RMU3 4HSLA 4BLJA 1YI9A 3WG1A 3CJXA 3MZHA 3H8XA 3H8RA 5LBCA 2P3IA 3CF6E 3QBQA 2HWB2 1WWYA 3HQUA 3A7QA 1IG3A 2RS33 2BBVA 3U4SA 3CDZB 4NO4A 1YYNA 1UU5A 3VBFC 2HWC2 3F2ZA 4URTA 4QM9A 3SISA 2P17A 3BUCA 3FUQA 1ZBE3 4A3ZA 1E5HA 3NKGA 1PK6B 4ES8A 4LPLA 4XBNA 2A7AA 1KD7A 4PDWB 2X5IB 1OT5A 2DCJA 4HPKA 1TMF3 4YVWC 2WWUA 5FDBA 3ACGA 1UY1A 4UF0A 4A6SA 1EAH3 4CRQA 5FBZA 2PLV3 4QPYA 2B42B 1RUH2 4DFSA 2WFF3 4ZU4A 2ET7A 5M0TA 5DG1A 4NHXA 3UKNA 4NVPA 1RUC2 2VPVA 1RB8G 2E26A 5LK7B 3IZOA 1MZFA 2LRPA 3N7JA 4JTNA 1JOPA 2YMZA 4TTGA 2CNAA 1M06G 4PIYA 4WV8A 2HWF1 4OVEA 4H2AA 4XAAA 4LKDA 2QDNA 3AZWA 4QMAA 3WW1A 2A1XA 4TWTA 4XUPA 4XDQA 4EV0A 3OG2A 4BA6A 3NL1A 3AJZA 4GH4C 2VZUA 3BU7A 2JKBA 2RG4A 1DLCA 1RUG1 4P02B 4LR4A 4M3CF 2HWD1 2WAAA 4QX1A 5L9VA 1PO11 4Q4Y2 2PELA 4RS5A 5FLHA 5A1LA 4J1WA 3ZYFA 1F5FA 3ZYPA 2VUCA 4P08A 4XJAA 2W52A 3D0SA 2OZ6A 2RM22 3QH7A 1RUI1 1GBGA 4XFGA 5FR3A 4V2VA 1LGBA 3NO8A 2JICA 2VL4A 3AZZA 4W8JA 3RS6A 5DAWA 4EN6B 1SPPB 4P9IA 4LITA 1IS4A 3E5QA 2RS53 2HBTA 5FP4A 4C0BA 3Q8CA 3OBRA 4LEJA 4R9DA 1GWLA 1SLAA 4I01A 2BGCA 2V5DA 4IE6A 3KF5A 4CU9A 4XMIA 5DZFA 1RGSA 4ISRA 4Q1PA 4IE4A 5HCAA 3D6EA 1WLTA 2WQ4A 2EXJA 4UOJA 5FZ7A 3PUAA 5F3CA 4I0WB 1NCQC 2A6VA 4DRRA 3DGTA 4EYUA 4MHRA 5FV3A 1FXZA 5LY1A 4YFWA 5FRAA 4L8QA 5E6HA 1LRHA 2VZ1A 5EJ1B 1MVEA 5JR7B 5C3PA 3SXWA 3KD4A 2IXHA 5A80A 4CCJA 1UZ0A 3KCYA 1G9DA 3J8F1 1JYTA 2JDUA 2VUDA 1YCIA 4LO6B 4UYBA 1OVPA 4BQ4A 1GMMA 4IV1A 1ENXA 2JG8B 3M3IA 2VW2A 3M7AA 4Y1YA 5FUIA 5DDJ3 3RZZA 1XNKA 5K4LA 3ATGA 4ZXEA 4FPFA 1RUF1 2QCSB 4JQTA 4Q4X2 5A3TA 3AKSA 2XWBB 1WMDA 3FHIB 1TEIA 2C9KA 5JUVA 1OQEA 2XWJB 2PHFA 2CDPA 1D4M3 4UW5A 2G1MA 2ZGQA 5T50A 3UT0A 3VV1A 4ASMB 4UW3A 1K12A 5JVVA 3VHOA 1DBNA 4N8MA 3ROUA 2XDVA 2FMYA 3RYRA 1AR82 4BH9A 1F8VA 2DURA 4S2HA 4BE3A 1W6MB 2FQPA 3GCXA 3OUIA 5LY2A 1J84A 1NT0A 4WBBA 5J3UA 4OMDA 2SBAA 1FT9A 1JTZX 1YEWA 4WZCA 5FYSA 4RGGA 1OA3A 1X8MA 2J42A 1LHNA 4TLGA 4AHXA 2VMCA 2WS91 1H8TA 4QPIC 4AXOA 2XVLA 2CTVA 2Z5WA 1OSGA 4LULA 2RMU2 2EAAA 4XIOA 2GN3A 2JD4A 4MZUA 1RMU3 2RVAA 4QGLA 3ZXLA 2R063 3LPGA 4FAHA 5HV0A 4CXWA 2I45A 1NUKA 1W99A 2I2SA 5GZFA 2RDSA 4L99A 4UI9L 1AL22 1URXA 1CAXB 4MVTA 5I91A 1DGRA 2G9ZA 4F83A 4GMP1 5FCCA 4DPNA 4IV3A 4ZHNA 1ZBE2 3NAPA 3KVAA 3MF9A 4IEUA 5EV7A 3R6SA 4AYUA 5LA1A 2Z42A 5BNQA 3ON7A 2OVUA 3SH5A 1TMF2 2D3SA 5T5OA 1VP6A 3ETPA 4UBHA 4AEMA 3UL2A 1D2SA 2JDYA 2OIIA 1QU0A 4PIZA 2RV9A 3ZXEA 1EAH2 3FMGA 2ID4A 4JKLA 2PLV2 1IPSA 2WFF2 2MEV1 2XVKA 1XU2A 1IQAA 3IT8A 3RYPA 4TZDA 1RUJ3 2G4IA 1MEC3 3WQ7A 1W6PB 2E53A 2ZGNA 3OEBA 2X53S 1UWWA 4V1PA 3HWJA 1BZWA 3RJ2X 1WW4A 5C9AC 2BWAA 1W8HA 1PX4A 4DY5A 3ILFA 3T2QA 4OI4A 1SHWB 2B39A 4MUVA 3P5BA 1XE7A 1RUD3 3VDDA 4A6OA 1BK0A 1JUIA 2JB8A 3AJYA 1YXWA 4Y1ZA 5FZ1A 5FK7A 1LOAA 4EWDA 2XKOA 1FOD1 1W03A 4P00B 3WW3A 3RJRA 5C3SA 3J4UH 3Q8BA 1VMFA 3VD3A 4MXVA 1PGL1 2VBPA 2JDHA 3VBOB 3D3AA 1XNCA 3GJBA 4OQ9A 1J3PA 1K42A 1CVNA 3MIDA 4HKWA 5FZMA 4UW6A 4C0HA 5FLIA 1DLLA 1POV0 2H0BA 5HXVA 5FY1A 2ADEA 4FXGB 4XF0A 2CAVA 4IUGA 3DECA 3OY8B 1U5YA 4R9BA 4CPBD 2FBEA 3ZN5A 4LBOA 1O5UA 4JQRA 3S57A 4W6XA 3A4UA 2PHDA 3VBUA 4P9WA 3LF7A 1H6XA 3SKJE 3DYOA 3OGJA 5FP7A 2QQPA 1GZ9A 3KCXA 1RJ7A 2JX9A 3JUUA 1PO22 5A7WA 3E1F1 3BN6A 2WO2A 1GOHA 2YFUA 2YFZA 4GB31 4WM7A 2XJVA 2P37A 5ABJC 4LA3A 3EYPA 2I74A 2JB4A 3LEMA 1HLCA 3MV01 4YVSC 3H3LA 4YW4A 2ENRA 4EWAA 1HW5A 2D97A 1U5XA 1E5RA 1KJLA 4KL1A 1A8DA 2ZHKA 1I3HA 1DCSA 3K3NA 3MGUA 4QB1A 1DG6A 1GWKA 5FXVA 1AVBA 4XUQA 4Z2AA 5I93A 3S5QA 1AYN3 4HPKB 5EZWA 3C7HA 4XQWA 2VCAA 5L36A 1Q8QA 3SNMA 1HRV3 4XF4A 2QQOA 4XETA 2CWSA 4YM3A 1MQTC 1A3KA 4N9IA 1ZRRA 1SCSA 4NRQA 3T1LA 4YZ1A 3CZUA 3KV6A 4EN7B 1FYUA 3NMBA 2AH2A 4P9XA 3IN9A 4LXLA 5BXXA 1HX6A 1XNAA 2ZEXA 3HAGA 3S6PA 1W9YA 2YV8A 4Y20A 1RUNA 5IW0A 1RTVA 3THCA 1CGPA 4BK4A 1W6QA 2GNMA 4DUWA 4R8HA 1K5MC 1KS4A 1O4YA 3IIIA 1NG0A 4PT6A 5DMYA 5FPVA 1OLMA 3PTYA 4OZOA 2FCTA 3OTFA 3I2DA 4JZRA 1R092 1XXNA 3AFGA 2DFBA 2EALA 2HWE3 2JDAA 2XVGA 3DEMA 2ZJCA 1JZ7A 2D93A 1EUUA 1H4HA 2AZ5A 4K40A 5FMOL 3SCFA 3ZPYA 2W9XA 4MX3A 1ODMA 4Q0QA 1K5JA 5FZ8A 2HJIA 1W8OA 1AR61 3B00A 4QXHA 3JQWA 4CP2A 3PDQA 1FMD1 4RGAA 5DAVA 3WV6A 4QHBA 2OQ6A 2JENA 4FPJA 2R062 4LHSA 4HL0A 3K2OA 4HT1T 3I97A 3AYDA 2NQYA 2XJSA 5LA0A 2GU9A 1ND3C 3ZKYA 2XPJA 2RDQA 1VJ2A 3GXUA 1QGLA 4AQ2A 4X8NA 4LUKA 3LGRA 1O8PA 1ASJ1 2J1UA 1NQJA 5APAA 1XSRA 1SFNA 3ITQA 3MW2A 4YM1A 1F35A 4R9AA 4XJZA 1ULCA 3PMEA 1S0IA 1XE0A 1ZA4A 5GJ6A 2BRTA 3TNPB 2OQ7A 3NWKA 4JAAA 5EJ3A 4AGGA 3ES4A 2CGNA 1MR5A 3LIGA 1YIFA 1ZZ8A 3IKWA 1UY0A 4KH9A 4IQPA 1MEC2 4QKFA 4XACA 2BDRA 2ZGRA 3LQCA 5FYHA 1MS0A 2PHTA 2WNVC 4Q4W1 5FPXA 2VZPA 2FCUA 2Y6HA 3LE0A 2VCCA 4M00A 4QXKA 4W6YA 3M3CA 2DTYA 4WVWA 4I30A 3WDXA 3SH4A 4QXCA 1LR5A 2Q8OA 3ZFFA 2DBNA 1NCRC 3HVDA 4Q0SA 5TSWA 1R082 2YGMA 1ZZ7A 3WLUA 2OT7A 2W68A 4UW4A 2QFEA 2NMNA 5K9YA 3MW3A 3WX5A 1O91A 5J1XA 4F7ZA 2QZ3A 4AWDA 4XF1A 1PIV1 1WD3A 2J1EA 1BEV3 1SZBA 2EICA 3JB8A 1CONA 5A7SA 2GC1A 2VZSA 3TEXA 1WMEA 3OUHA 2ZX1A 4LO4B 5SV8A 3VBRC 3T08A 3NNMA 4Q4V1 4QU2A 3VHNA 2ZZQA 3QLQA 4CU6A 2VXJA 3MYXA 3N9LA 4ASKA 5IVYA 3ZFGC 1QJU3 2ZMNA 2WZR2 4XJUA 3ZN6B 2A73B 3WDWA 1S0FA 3IDCB 2X8KA 4RHV1 1QJX3 2WNUC 3KCCA 4BZ4A 1EV13 1AR73 1JYIA 5LRRA 1PK6A 1SQ4A 3NVCA 4PDWA 2LS6A 2VTXJ 2X5IA 4EN9B 1W9FA 5IFPA 3PUIA 4QDQA 3O1PA 3AYCA 4BOWA 4LBQB 2LW8A 2HWD3 1Q5OA 1ULPA 3POSA 2H6BA 4PI0A 3RYKA 4DUVA 2BUKA 1LAJA 1AYM3 3USUB 4LMFA 1KJRA 2YBKA 4YG0A 1BBT1 1SCRA 2A5ZA 2MHFA 1VBD2 1CX4A 2BV4A 5CEHA 1X50A 2VNOA 3BPZA 2AENA 1RHI2 2D6PA 3DPRC 3K75B 4CU7A 1YJKA 3H7JA 3HNYM 4QWNA 3GYDA 3X29B 4YW1A 3ZXGA 4DMIA 2ET1A 2WR9A 3U75A 2BWCA 4CP1A 5K0UC 3T0BA 1ZRDA 2ZXQA 1C5HA 3AVRA 3MLKA 1JBCA 1YQ2A 4AG4A 1PVC3 2HEYF 3PUHA 1KEXA 5LWBA 2DWRA 4NROA 5AVAA 3ZR5A 3LEKA 1BQPA 1M4WA 2ZABA 4LBJA 2CGOA 4GA9A 2IXCA 1BJQA 3T1MA 3T4HB 4XHXA 4ARYA 5KXEA 4RGKA 1JZ2A 4BU2A 5I0DA 3LWCA 3WQ0A 5BY5A 3WW2A 2JE8A 2BERA 1J1LA 1STMA 5I8TA 1LB2A 3O5SA 4PLMA 3VBSA 1V9U1 3A0KA 3AZXA 5C5TA 3LA2A 1BMV1 2W87A 1JYCA 2XOMA 3B9IA 3I2HA 1JZ6A 2B7YA 3N3HA 1GQPA 1IZ3A 5D8AA 1H0BA 3TBDA 2D6LX 3GHNA 1Q8OA 2BGPA 2V73A 1LESA 4IEQA 5DUUA 4CDQC 2ZTNA 5JLVA 1SPPA 3SQOA 4P14A 4DY3A 2JE7A 2YU2A 4MADA 1OLME 5FWEA 4Y33A 4AOCA 3MV11 1C8M3 2PHRA 1FAYA 4OULA 4CEYC 2WLPA 4E9KA 1YO8A 2Y33A 2B9VA 4HK8A 2WZPP 3WSOA 4E2GA 1PX3A 3B93A 2VOXA 1POV3 1OKQA 2IFWA 3H0OA 4AEKA 4DEQA 1VRH1 4CEWC 1QDCA 3WINE 4N9HA 2XH6A 4HKOA 4W65A 1QH6A 1UZZA 2JG9B 4CSWA 5JOZA 4Z2WA 2BU9A 3JD71 4KWJA 4DQAA 1UX6A 1WLDA 1ZRIA 1BXHA 2R0HA 4JKKA 1ULGA 1NKGA 4GWNA 1WCSA 2HEWF 5KXCA 3FL7A 1VB4A 1SDWA 2HWC3 5FKCA 1RVF3 2GMPA 2AYHA 2R0FA 3I2IA 4DZGA 3ELNA 4FFIA 2D5FA 2ZKLA 2XHKA 3WR0A 3POEA 1Y7BA 2F4LA 4XTPA 1QQP2 1PGW1 2Y0OA 3CJIA 1NLRA 2WO3A 2VMIA 3R4UA 1NOVA 3CMGA 4N53A 2VTFA 4YVSB 3WP6A 4QQPA 4AAXA 2Y60A 5BNNC 5CFDC 2D6OX 4IE0A 1S0JA 2JG8A 1S2KA 1YHFA 4C1WA 1RUH3 2VOKA 5L19A 2JD9A 4XILA 4O9EA 3WCSA 1RUC3 5IK4A 3GBWA 4GKYA 3L2YA 1TVGA 4N7UA 1AHSA 3KS7A 3OBZA 1DGRN 4KG0A 4KGGA 4QPWA 3NV3A 4BIOA 3BTZA 5AVPA 2CL2A 3HN1A 2DUPA 1LU1A 3SEPA 1I6XA 4A4AA 2VMGA 1OA2A 1JUHA 1W6MA 2ZS6B 4N43B 5FO9B 2BOIA 3AP4A 4H7LA 1OF4A 1F5JA 4HN1A 4L9BA 3RRDA 4NIAA 3ZKUA 4AE2A 1O4ZA 1LCLA 2ZGPA 2GAUA 5LRSA 2RDRA 1DIWA 3NNGA 3ZYJB 2C26A 3ACLA 1D0GA 3GCWA 1U0AA 3I59A 3ZR6A 1K5MB 2PAEA 4XXPA 3P1IA 1UXZA 1SLTA 3RWNA 3VDAA 4KBBA 2LM3A 1QWRA 5F5CA 4Q4Y3 2Z2SB 5C8WA 5HBAA 4MGQA 3WP5A 4RSUA 4YG6A 2IWGB 1GOGA 3D4KA 3DKQA 3VKNA 4BXSV 1W6QB 2W95A 4PLOA 5A6QA 3JU9A 1N3QA 2W3JA 1NY72 1HB1A 1UMZA 2RM23 1W9SA 2B46X 2UWAA 2A71A 2H6CA 2RHPA 4ORFA 2R49A 3NJYA 5DZGA 1YI7A 2HWF2 2W46A 2BJSA 1LNSA 2XQRA 4P9LA 1CAXA 2VCMA 4JTOA 4I2OA 4JV4A 1IG0A 1CPMA 3OPTA 2LROA 4TN7A 1EV12 4ZXKA 3Q8EA 1AR72 4YW2A 5FY8A 2Q1ZB 3IDEA 1IGOA 1FPN3 5DABA 1L7RA 1S0GA 4AFMA 3E6CC 2WYSA 3OSDA 1YIPA 4DXZA 2WNOA 2HWD2 2R071 3ORJA 3POIA 1PO12 1ND3B 3PTRB 4YZ2A 1VBE3 1TNFA 4I09A 5I8SA 1XNDA 5FQ0B 4HONA 1WUVA 1ZA7A 1N1SA 4CYDA 1W6PA 4RN5A 2YBPA 2JIJA 3PURA 4JVAA 4K3UA 1G9AA 1CZTA 1VB2A 3FZ3A 4GJYA 3B5LB 3VN4A 4JRAA 4CCNA 4COZA 3O1RA 5FY0A 4NOTA 1SDDB 1I5ZA 1PMHX 4QX3A 3IDAA 1APNA 4GD4A 5C6CA 2VNGA 4HG6B 5FOJB 4FQ4A 3PLQA 3A0NA 1PZ9A 3O7OA 3ES1A 2RS13 2GDFA 1DHKB 4JGYA 3RZKA 4K9SA 2OW4A 4NIGA 1XYPA 3FN9A 1GV9A 4JGZB 2O8QA 3KGLA 2HH9A 4Q4X3 3VBOA 1W8NA 1X36A 4RA0A 1OURA 2XJPA 1FV3A 2Q8DA 4FPCA 4QKBA 4QB2A 2B9UA 1NCRB 4FTEA 2VMEA 3K3OA 4FXKB 1AR83 3OY8A 3BCWA 4JKMA 2JDNA 1DYPA 4D94A 3T0DA 3J8F2 5C4WC 3GZUC 5KWRA 2WAOA 3PUSA 5AC91 1C8M2 2IXLA 1CJPA 5I0RA 4DO0A 4FFHA 1CZVA 3VBRB 2XBO1 2DDUA 5F3EA 5FYUA 1F15A 1MS5A 1NLQA 3ZFGB 2J7MA 3LEIA 5FY4A 3V0AB 5IVCA 4K1ZA 2WUHA 1WCDJ 4U36A 4XZPA 5T54A 1QXPA 2C5DA 3ZYHA 2WNUB 5I8YA 5CG8A 5HCHA 1PMJX 5DZEA 3UYJA 5FZKA 3WG3A 1RUOA 4YVWA 5FYMA 1AL23 1AZDA 2RE9A 1C1LA 1O6UA 1HB2A 2VVDA 3BOWA 1RITA 1LOFA 4LLFA 1RVF2 4NHYA 3WG2A 4D8MA 2QQJA 4XJ8A 1UL9A 2IVIB 3TEWA 3VDBA 2WT1A 3K46A 1UYXA 2GZWA 3QCWA 4S2GA 1FNZA 4RFT0 1VBA3 2BQPA 5EQUA 1DGWX 3IPVA 3VD7A 3K51A 4AVSA 2PAMA 2GH2A 5CA6A 4LORA 3MDPA 4Q26A 4AF9A 5LBBA 2WS92 3DPRB 4I0AA 1HDKA 1IOAA 1NX9A 1TME1 3AMMA 5KHKA 2PA7A 4AVAA 4LTAA 3BTAA 3MLLA 4GKXA 5KHJA 2P34A 1W2OA 2WIIB 4RQPC 3FJSA 4IEOA 4INDA 1QOSA 2CY6A 3I4IA 5FPAA 2VZTA 2ETEA 4M3CB 2D6MA 1PNFA 1W0NA 2ARBA 1ZZ9A 3ACFA 5A1FA 2ZACA 3HEIA 3VDCA 1GICA 1SBDA 4MHUA 2YBSA 1VALA 4RR3C 1VBB1 5DUVA 1RC6A 4QT6A 1NA1C 3LKJA 1W0OA 2OUHA 1F4HA 1W28A 3DUIA 1JHNA 1QKQA 4XFAA 1H2LA 4P9GA 3TEZA 3UJOA 3WP4A 4BQ3A 4QHZA 1VPHA 1S2EA 4YGDA 3RI8A 3UGFA 1UZWA 1PMIA 3NRUA 3TYJA 2NPIA 3WUDA 5CAZA 4ZS2A 4UFIA 1NE4A 1WD4A 3VBSB 1QJY3 4CDQB 2AGSA 4FTBA 1W6OA 2W08A 3RZJA 3BODA 4HN0A 3D0JA 4CEYB 4FAGA 4URAA 4W50A 2XLAA 5D8AB 1W0PA 4TSVA 2J1TA 5FP8A 3ZIXA 4AEJA 1ONAA 3PVOA 4CDWC 4PJYA 1YFYA 1VMJA 1KDKA 5DAPA 5F5AA 4CEWB 5DN2A 3TB0A 3ZSLA 4B4PA 4YWAA 5J09A 3KVBA 1NYWA 2E31A 3POWA 1Z78A 4QXBA 1CAUB 4K20A 1JH5A 1MACA 3NNJA 1FPN2 1UU4A 1NCQA 2UURA 2VY0A 1F9KA 4NWWA 4Q0UA 3ZSKA 3B9CA 1ZRFA 1LHWA 2EXKA 1OLQA 3MFAA 5E1RA 3WD5A 1PGL2 2Q0AA 1GUIA 3UKTA 4DUXA 1PIV3 1PO23 1OVSA 1VBE2 2Y8KA 3UETA 4NIDA 1JZ4A 4XBLA 2D5HA 4FPEA 3TN91 4LE4A 4GWJA 5FZHA 3CNAA 4UAPA 2OZJA 1OBNA 4MSVA 4UFLA 3W5NA 2VU9A 2ZOEB 4CCDA 3LDBA 1ZZBA 4H55A 5FY5A 4AEDC 4QX0A 2FDHA 3O12A 1WLWA 5BNNB 5CFDB 5J37A 5FYCA 1WBLA 4RHV3 1CQ9A 4X8PA 1U5ZA 3KT7A 4FP2A 1K3IA 2WJSA 4GWMA 3CJIB 4AW7A 4N53B 2RS12 1DFQA 4FT8A 1QXRA 4NMIA 2DUQA 1SLCA 3M3QA 4LKEA 2Y6KA 2VUAA 1Z7S1 3L9JT 1QXJA 1U5IA 5FO7B 2PMWB 3EXUA 4GB32 3THTA 1DQ1A 4Y1VA 2QQIA 2VZOA 5CFCC 5JWPA 1HN1A 4MOAA 3LA3A 3AL5A 1COV3 1KFXL 3P3NA 4AVTA 2R30A 2XR4A 3HIFA 4LOTA 4ATEA 2HLEA 3PJQA 4PBPA 5I0SA 3VD4A 3I2FA 2ES3A 2R043 4OMCA 3OGGA 1BVP1 1GZTA 3VKFC 3ZN6A 4G3YC 1R093 4Q27A 4UFJA 1ZZCA 1WMFA 5G04L 1ZBA3 3S7IA 2TBVA 2ZHMA 3I59B 4HVOA 4ATFA 5GALA 1G9BA 1PHMA 4ZPIA 4AHYA 3H8UA 4YRDA 2VJXA 1YQCA 1VAVA 4FOWA 4LBQA 5IVVA 3I49A 4IV1C 1CJDA 3R4SA 3CO2A 4IE7A 4IW3A 3S0MA 4XIKA 5IUQA 5FZ0A 1US3A 3SC7X 1V6NA 2HWB1 1YQ5A 3AC0A 3USUA 1JYXA 5DXDA 1JXNA 4XZUG 1H2MA 4XJ9A 2QQNA 4XJWA 4CDXB 3SHRA 4YG3A 2VE1A 4YFZA 4BQYA 3LOBA 4NJ4A 3HBKA 5FMDA 5FZAA 3MHZA 3DKWA 1CIWA 4NPMA 5C5UA 2OYZA 2YXSA 4LE3A 1DQ4A 1VBA2 3U07A 4Q8LA 4AQTA 5FP9A 3ZXKA 2YZ4A 1UZYA 1JZ5A 2ARAA 4KWLA 4JCKA 4A7KA 1AR62 2PFWA 2GMMA 1FMD2 1VBC1 1H2KA 3H9AA 5I0UA 5C9AA 2RDNA 1RINA 5JIUA 1HKDA 1OUXA 2E9QA 2V72A 4B1MA 3ZDSA 4AQSA 3NQHA 4YYOA 2IUWA 4NRPA 5LA2A 3BYWA 5FZEA 4B4RA 4FFGA 4GQ7A 1AR91 4AVBA 4QDRA 1G9FA 3UGGA 4DS0A 2OUJA 5L9RA 3U10A 3KWVA 5EYXA 4ZU5A 1R083 1GU3A 4XDPA 3K4ZA 1RXGA 5I0TA 1YUDA 3N9QA 3H7YA 1X9TA 5A7OA 4LHKA 4BISA 3T4VA 1JMUB 2GC2A 2JKXA 4AL9A 2EIDA 4C1XA 2WO1A 1QJY2 2WYFA 4XTMA 2JG9A 2VQAA 3UKVA 2Q5TA 4QKDA 2BBAA 5C4WB 4QX7A 3FFZA 5FY7A 3MICA 3AYAA 2BEOA 2BVBA 2DCTA 3H3UA 5LCWL 2WZR3 1LENA 2ZGOA 2BZDA 4MGZE 4XF9A 1HXS1 4J6GA 4HVQA 1ENQA 4YW6A 2AREA 5FZ3A 4CP0A 3GBGA 3WG4A 5G05L 5FUNA 4PF5A 4FQZA 3TEYA 5GLTA 2P3JA 2A3WA 3ZSEA 3APBA 5LZ6A 3JBG1 3BALA 5FYVA 4YVSA 1PIV2 1PZ8A 3H1YA 3VBFB 1W06A 1IS5A 4OCTA 3CEWA 4RL7A 5T52A 4GIQA 1S55A 2YU1A 4QHOA 4MG2A 5J7MA 1VBD3 1KITA 4LK6A 3KV9A 5BNOC 1UW8A 1KXGA 1W04A 1N3PA 1OD3A 2H0VA 4Q4V2 1RHI3 4YVWB 3MUZ1 4LA2A 4YSFA 1UD1A 3I8TA 3EBRA 4PIXA 5FJHA 5C8CC 3DL3A 4WZFA 1O4TA 2G19A 4RHV2 2Y6FA 4A42A 2XHNA 1WA4A 3LCPA 4V2WA 4N43A 4BCUA 3IPVB 5JR2A 5A3LA 1V6OA 4Y4YA 1EUTA 4OHXA 5JAXA 4GMP0 1SEFA 1YNAA 1AF9A 3KSCA 3O0XA 4HK9A 1RIRA 4RR3B 1UKGA 1UN1A 1V6KA 4Y5Z0 1K5MA 1LOCA 2ZZJA 1NA1B 2FZ1A 4D6SA 1BBT2 1C4RA 4SBVA 3QACA 5DAQA 5IVFA 5ERLA 2R7EB 3L2HA 2O1QA 3HQRA 2W1WA 1BYHA 2VQTA 4QU1A 4YGCA 2YPJA 3UESA 1O8SA 1QF3A 1SACA 2WWSA 1COV2 4HBNA 4R4ZA 4OHZA 4GH4B 4COUA 4DIQA 2AACA 1UOJA 1ENRA 2R042 3KLSA 3N35A 4CUAA 1MS1A 5IWFA 4C90A 2BYVE 1ZBA2 2HEVF 2JDKA 3I3BA 2UU8A 2QTWB 3AXEA 3U4XA 4FBFA 4AHZA 5C8CB 1REFA 2RMU1 3OD0A 2C9AA 4QPGC 4B7EA 5FJKA 2RR11 3I3QA 4FCAA 1REDA 5FXZA 1J3RA 4CDWB 5FXWA 1ND3A 3N36A 1W6OB 3ZIWA 2ZX3A 4OHWA 5BNPC 1OFNA 5FQ0A 1ZX5A 2RS31 1BMV2 3KZ4C 4LKSA 3MPPG 5CU1A 2VG9A 3ECQA 2DCZA 5BUVA 5FMBA 2TNFA 2NLRA 1ZBE1 1F31A 4D3WA 1DU3D 4AR2A 3I7DA 2NZ9A 2XJRA 1C8NA 1HQWA 3RSJA 5FZDA 3ILRA 3ZXFA 5L7OC 4UXAA 2D40A 4QM8A 4ARXA 1ZREA 1NCQB 3VZOA 2ZBJA 1HV0A 1XPWA 1GWMA 1R1A1 2DVDA 2P6HA 1QJEA 1EAH1 1QQP3 3PNAA 3RQ0A 2VGDA 1ULEA 2QNKA 2PLV1 1MS3A 2WNVA 2WFF1 2WZEA 3OB8A 5FMOS 2GALA 3IMNA 3AKTA 3GF6A 2F4PA 4AEDB 3MIGA 5IT6A 1GYKA 4JGZA 2E63A 3UJQA 5GZCA 5T55A 3JD72 4MGSA 1H1IA 5GLWA 2VMHA 2Z69A 2NP0A 1YFUA 1ZVFA 3KB5A 2A6XA 5JCTA 5F7UA 1NCRA 1H4GA 3K4DA 3MEPA 3MIBA 2E33A 4JHZA 2DYCA 5A7QA 3PMSA 3T0AA 3PHMA 2EAKA 3WCRA 5JMOA 1MZ6A 4NHKA 3JXSA 1S0DA 3NV4A 3AB0A 5FZ4A 2PYTA 3VD5A 3T09A 1UKRA 1A34A 1PGW2 2VZ3A 5A7NA 5J36A 1UOGA 2IXKA 2XJQA 3SCGA 4XW3A 5CFCB 5FBJA 4BMBA 4IXLA 1CN1A 1YQ6A 2YC0A 5LBFA 4B4QA 2XUMA 3BB6A 3BGAA 1WCKA 5FZGA 2JXAA 3VBRA 2DFCA 3LEGA 4ONUA 4QGMA 5DUWA 3ZFGA 2FDKA 4NHLA 1IKQA 4FFFA 4XOGA 3Q8AA 3V0AA 5FZOA 3HMYA 2XG3A 3ZXJA 2IVJA 1W9WA 2WNUA 4MGIE 2VXRA 4PHZA 4XEZA 3ZMNA 5LW9A 1GKBA 2R16A 2RS51 1CD3G 1MZEA 2HWF3 2ZAHA 1L3JA 4CUGA 1N3OA 2LALA 1KFUL 4HZFA 4QPIB 1DGLA 1YC61 3BIWE 5A3OA 4LNVA 2ZEWA 2YY1A 3O14A 2DVBA 1ST8A 4BHPA 3MLJA 2QE3A 4LBLA 4UFHA 5HPOA 4I3PA 4FPGA 1RUG3 2QDRA 4J25A 5JZGC 5FIXA 3IDBB 1IPKA 1TE1B 1PO13 1Y9MA 2PQSA 3AM2A 2QQKA 3DPRA 2PAKA 4Y3OA 2B4KA 3SMHA 3VKMA 3VBHC 1XRUA 5JXIA 1YQ8A 2P1BA 1Q56A 5K0UA 4M3CA 1BCXA 1DF0A 1RUI3 2VTXA 4IE5A 4A44A 2Y0IA 1CIYA 1QJZA 1Q3EA 1WW6A 2GP3A 2PHXA 5DPNA 1SLLA 4HOOA 4OHVA 5IVEA 1UZVA 2AEZA 3WP3A 1FNYA 2P2KA 1W05A 5JI7A 2ORXA 3LIHA 4OI0A 4SLIA 5DDJ1 1D0HA 2WN2A 4XQDA 1T6BX 4L92A 5HCFA 2GC0A 5C9AB 1YLLA 4BQ5A 2W39A 5IVBA 1B35C 4FTSA 4S2FA 1LECA 1D4M1 5FLJA 5FYTA 4HMZA 2WQZC 3OEAA 1OH3A 1QY4A 4CDQA 1ALYA 3CKHA 4OI1A 2EF6A 4B29A 1LOGA 2EIEA 3ZXAC 5IK8A 4IGOA 4FPLA 4CEYA 1CAWB 2VH9A 2QUOA 4JHTA 2LUWA 3I2GA 1LHOA 5L73A 5J96B 5JPMB 3AYEA 4Y1UA 5FY9A 4FOQA 3AK0A 1W39A 2W94A 3J8F3 4CEWA 3VZKA 5F32A 5A7PA 5JSPA 2DU0A 3NV1A 3V0BB 4QQHA 1CAUA 1XC6A 4A41A 4K21A 3JZVA 1AX0A 3H3ZA 1J83A 1W2UA 2W1QA 4CCMA 3VL8A 3T30A 3WNKA 3VL9A 1RMU1 2OPWA 4Q0PA 1A6CA 2XLGA 1RUF3 2R061 5HI0A 1NAEA 1XSQA 2DCKA 3AMHA 5A32A 3EJKA 2BVVA 1DQ0A 2EIBA 4ZZ5A 3WUCA 4R52A 3Q9OA 3EHKA 5IVJA 1S0BA 2W5FA 3LA7A 4EN0A 4YZ3A 3O0VA 1XYOA 1IS6A 4K6BA 5FO8B 5LB6A 5FPBA 5CFDA 5CNAA 2VD7A 2J1VA 3I3EA 5BNNA 2QBXA 5JOXA 4BPZA 5CB7A 1LJ7A 1RUE1 2GC3A 1W2TA 3P6BA 2X29A 4RFRB 4BIFA 1OPOA 5ABJB 3RZGA 5BNOB 4NAOA 2JEMA 3KV4A 2XBO2 5E8AA 2WS93 5FTTC 5H9SA 2F17A 3K48A 1RUJ1 4WM8C 1WCUA 4ET7A 1MEC1 4ZZ8A 4P9YA 4E2QA 3O1VA 5BPXA 3HJRA 3WHTA 3IAQA 3MUY1 1VIWB 3WF0A 2A6ZA 3FC0A 1ACCA 3ZYRA 1RXFA 4OZXA 3N9PA 1JODA 2VW0A 3URFA 2QKDA 1WCQA 4MGKE 3UGHA 2QQLA 3HPNA 3FX3A 1RUD1 1ND2C 1LOBA 1MQTB 1H9WA 1Y9QA 2VUJA 3LAGA 5F5IA 4GMP3 3WW4A 4DOUA 1DDLA 2ZA9A 3I3MA 1DGWA 4EJRA 1EPZA 4YW7A 4EN8B 1W2NA 5A6ZA 3INAA 3O0WA 1JOBA 1JW6A 1U12A 2VBBA 2DU1A 4FOVA 5CKQA 1O3RA 1JHJA 3MIEA 1OOPC 1UU6A 1WGPA 1FX5A 3J7MA 3MFCA 2Q4SA 2E7AA 4XFBA 1UIJA 4RD7A 2Q8CA 1VBC3 5F9TA 2WO7A 3AKRA 1SMVA 2MEV3 4AFBA 2Y6LA 4R9CA 1TG7A 3WNMA 2EXHA 1OD5A 1WA6X 4HSJA 4CDUC 2AUYA 1I9RA 2YGLA 3E97A 3PVBB 1UO9A 3RDIA 4WVMB 1ULDA 3VZMA 1JZ8A 1VE0A 4CDXA 1Y4WA 3ZFEC 5A1AA 2XGXA 3M4FA 3NSTA 3WNOA 1J3QA 4IEXA 2VQUA 1BVVA 1QDOA 4M4PA 1O3QA 3ILNA 4GWIA 3VKLA 2ILMA 5LK5A 5BNPB 4IDZA 5KC6A 1FOD3 3LSDA 1OC1A 3FFQA 1RUG2 2DUOA 3WF3A 1IHMA 1UPIA 5JSOA 4D6RA 4B1LA 3SKVA 2TUNA 2IFRA 4IESA 3VGIA 4CXYA 2OKXA 2ERFA 1UCXA 3O1MA 3VHPA 3BIEA 1ZZ6A 2Q1MA 4IEZA 1UY4A 2PHWA 1ZNPA 1IPJA 5L7OB 2BNMA 4UT5A 1HRI1 5FPZA 2WSUA 3K77A 4AHWA 3GBFA 1RUI2 4QX5A 3U37A 1REEA 3O1TA 1AUYA 4M3CE 4Q29A 1V6LA 4YM2A 4D7YA 5A33B 4K8RB 3WY6A 1I1EA 3OUJA 2L9LA 4X6QB 4AFDA 1AYN1 2D7FA 1E57A 5E16A 1G86A 5JXGA 1HRV1 2ZGMA 2E32A 4ITCA 5AFEA 4FOYA 4QD2A 4JC1A 4XFCA 3WHUA 2BP6A 2B8MA 4E8CA 3CLPA 2WNVB 1LOEA 3W21A 1F2NA 4YW3A 4L0PA 4XCBA 4Z07A 4ZS3A 4DINB 2P3KA 1GQHA 1Q43A 1JYVA 4GB33 4L11A 2UY9A 2UYAA 2VNRA 1MVQA 3KT4A 4BQ2A 4LIUA 4EZHA 3HN3A 3OYWA 1W8WA 5C4WA 1H1MA 2MPFA 4XDOA 5JOYA 2R32A 1SLIA 3AZVA 1PGSA 2O0OA 3PIJA 2HWE1 3KQ4B 1S4CA 3TNQA 5KXBA 2TEPA 2WNEA 3NJVA 1VMHA 4IL7A 2PN5A 4L97A 2C6SA 1FATA 3HQXA 4XAEA 4IEVA 3EB7A 5C3RA 1O7FA 4JGYC 1QEXA 1WLCA 3B7MA 3LFMA 4META 3TOJA 3OCPA 3QOPA 3T2OA 4XVHA 3WNPA 2RJ2A 1GNHA 3ZX7A 1T6GC 2YUEA 2KXLA 3JB4C 3VKOA 1IQDC 1HJFA 4Y1XA 2BPA2 3C8XA 3BI3A 1RUF2 3AP6A 4NE9A 1POQA 4Y24A 1PM4A 1JU4A 5FZOB 3VBFA 3P3PA 3KHCA 1OXCA 2NMOA 4Y4RA 1SBFA 2CDOA 3GNEA 1DYOA 3ACIA 2K9ZA 3M70A 5CYYA 1W3XA 4HVRA 4LQRA 2ZX2A 5LBEA 1J59A 5KBFA 1AJOA 5JZGB 4GJZA 5FYYA 1EP0A 4X6RB 4LOSA 5F3GA 4NIHA 4UFKA 4OLLA 1QOTA 3VBHB 4PI2A 1BHGA 4D0QA 2ZHNA 2C24A 1QOOA 2WA4A 3ETQA 2Y34A 4CA9A 1AR63 4K1YA 2RR13 1FMD3 2O14A 5ANNA 4RR3A 3MPBA 4BQWA 2ZEZA 5GLVA 3IM0A 4UWDA 3I54A 1NA1A 5K0UB 3FLPA 4LLOA 3AXDA 5JIAA 2VW1A 2C0ZA 2YC2A 4EZ4A 1C1FA 3EQEA 1AXZA 1H6YA 5EJZB 4PF1A 4KQ7A 5F6LB 2YG0A 3SCHA 4GH4A 4GXLA 5C3QA 4B3NA 1KGYA 3MF6A 1B35B 5LEJA 1LOFC 1ASJ3 4W4ZA 2VNVA 5KHHA 1R1A3 2ZGUA 1W8FA 1GP6A 3AMNA 4XPVA 5GZEA 3SLIA 4MYEA 2RJKA 3R05A 5F3IA 3W20A 1TZOA 1SFPA 5EHDA 1BEV1 1VBC2 4XCAA 3ZM8A 1KRIA 2J1RA 4XHBA 2MEV2 3J7HA 4P5YA 1V0AA 2ZPXA 3N9NA 1KS5A 3PUQA 5H9RA 1UYZA 1NY71 4CDWA 2QVSB 4DXSA 4CE8A 4Q4W3 2GP5A 2ZAAA 4GALA 1LTEA 2ARCA 5GKAC 4MGTA 3KF3A 4Q0VA 1QJU1 4FPHA 2A75A 1AR92 3U14A 4O9GA 3M8LA 3WQBA 1QJX1 1R64A 4I3GA 3UK9A 1EV11 3RZMA 3IMMA 1AR71 2DVGA 1H9PA 3FWEA 4Q1RA 1R1ZA 4OQ8A 5C3OA 1WW7A 3GALA 4P9JA 1UXXX 3CHXA 1FOD2 3NJZA 3MW4A 2R1BA 2D6NA 2XL7A 3B02A 3M3EA 1LULA 2BFUL 2VMFA 1DQ5A 4M0HA 4QKNA 3WZ1A 1AYM1 2Q1FA 1GZWB 1DZTA 1G7YA 4FI9A 4NN0A 5T3NA 2O8OA 5A32B 2ZX0A 4AEDA 3LD8A 5ACA1 4OFGA 1D2QA 4RS5C 4CUCA 1BK1A 4FPKA 3F95A 1W8ZA 4Q4V3 2WA3A 1W6NB 3KHBA 3GHMA 3M2MA 1OA4A 2K2SA 4MO3M 3ZXDA 1JS9A 2VAUA 2MNGA 4D6QA 4DXTA 1G8WA 1NZIA 1X9PA 2ZEYA 1PVC1 3LB9A 4WM8B 1G9CA 1GR3A 1HXS2 2VC9A 3DCQA 2ZKNA 3RVHA 5KC5A 2YYOA 4D7TA 2C4XA 1G6NA 2JE9A 2VZQA 2WBKA 4IEWA 5FYBA 1LKNA 1NQDA 4COVA 2XJUA 3C7FA 3JBG2 1E5IA 2RJLA 3OF1A 2B5HA 2BFUS 3WEZA 2AR6A 3D8CA 5CFCA 4H3WA 4LBQD 3ZYIB 1ND2B 2JDMA 5GZGA 2WN3A 3VZLA 3GZEA 3WNLA 1XOYA 5IYYA 1W3VA 4BDVB 2QQMA 1YFWA 1BBT3 4XABA 1GFF2 1WMXA 2D6KA 1LU2A 3OGRA 3Q8FA 5F2WA 2E7TA 3GZAA 2NM1A 4OHYA 4P5HA 3KGZA 4NAMA 3CQOA 1D4VB 3WQ1A 4K7JA 2EA7A 3U78A 1OOPB 2ZX4A 3HR9A 5KR7A 2D3RA 4IGPA 5FMCA 2D44A 1J58A 3POJA 4H7MA 1C8M1 3N9OA 1NXD1 4BK5A 2N7GA 5FK8A 2BTVC 4TYSA 5FYIA 4QPIA 2I07B 4XFHA 4AVVA 1GP5A 4KI5M 2G9GA 2VECA 1POV1 1V00A 3VZNA 4GAZA 4CDUB 1JOJA 1H2NA 3PVNA 2JIGA 1X33A 3TAYA 1UYPA 4EWEA 2GH8A 2WLQA 1US2A 3J9SA 1JYWA 3ZFEB 5J98B 3BTXA 4B8EA 2V5YA 4DB5A 4COWA 1D7PM 2VO5A 1V9U3 5F8PA 5HCBA 4XQ4A 3SEEA 4LHLA 2IXIA 3CL1A 3T2TA 4BWOA 2HWC1 2VR4A 4CUBA 1RVF1 2BW8A 3EO6A 3VZJA 3ZOIA 1RJ8A 2K46A 4CVUA 3AL6A 5B2GB 4PCRA 2VZVA 3ALQA 1CESA 3FLTA 3U0ZA 5D1IA 4AI9A 1EPWA 4RYDA 3ZSMA 3WOGA 3DN7A 4AZZA 5CISA 2Y6GA 2W92A 4XXAA 3VUOA 2V4VA 2KR2A 2WWJA 5ANQA 1RUH1 4AI8A 3NV2A 5K7PA 1VRH3 5JPNB 2J1AA 2RR12 5CIRA 1GZCA 1RUC1 1AJKA 4NHMA 4OUMA 2KM2A 2VCBA 4FPOB 3T3YA 4LIVA 1H8TC 2RS32 3JD73 4NRMA 3PJYA 2HYXA 3KV5A 5F6KA 5JXJA 4BQ1A 5K8SA 3OBTA 4CP9B 5IATA 3POGA 1NLSA 3E5UA 3C7GA 1XNTA 1CAWA 1WKYA 1AX1A 1S1AA 2WL1A 4U2AA 5JOWA 3FBYA 3LFIA 2XQXA 1GLHA 1AXKA 3HT2A 1HQLA 4JDNA 1RUE3 4O61A 1ASJ2 2ZCWA 1Y3TA 2WFPA 4IV3C 1VAKA 1PVXA 1R1A2 4KNCA 1E5SA 2XL9A 3NAPC 2Q8EA 3RWKX 1CAVB 4YPJA 2JECA 3SH3A 3V0BA 2CYFA 2P5BA 5FZLA 2DV9A 2W2IA 1WW5A 3RFRA 4Q4Y1 1JZ3A 3HNMA 2WZ8A 5C7GA 1HQNA 2P4EA 3ACHA 2NYYA 5FAXA 1MS9A 1ZRCA 3LOIA 2RM21 2JWPA 4Q4W2 3OYWB 2KA3A 5GM0A 1O3SA 4JGYB 2IXJA 5FZCA 5EWSA 1OI6A 3O1UA 3ASIA 5IAVA 5SV5A 3RG0A 4AFAA 4OUEA 1FPN1 4ZY9A 4XF3A 1GP4A 3TWIA 1YFXA 2A3XA 3QD6A 4L2NA 3VDDC 3LZZA 1DP0A 2DTWA 3TRSB 3E6BA 3WDYA 1FI2A 2J22A 1UAIA 1VBE1 3R0RA 1V6JA 2R1DA 5ABJA 4DEVA 1W90A 5BNOA 5FPUA 1UOFA 4JDOA 3AFKA 5HV4A 5IK5A 2OXBA 3IWZA 5H9PA 1HJGA 1HN0A 4NIIA 5C8CA 1UIKA 4ES9A 4OI2A 4Y22B 4E4HA 3ST7A 5BV6A 3C2UA 4A3XA 1XNBA 2XMLA 2VVEA 3N4MA 2JG9C 2RS52 2XJTA 3KT1A 5F37A 1YWKA 2Y26A 2ADDA 4XFFA 4CTEA 1QNWA 2A3YA 3BPSA 3DXUA 1CR7A 1MQTA 4CCOA 3OPZA 4O65A 4MXWB 3B69A 3I3DA 3VHRA 2RS11 4RQPB 4CCLA 3RZLA 2VZRA 2WRAA 5FYZA 2E51A 2WDBA 5CBLA 4E2SA 1DZRA 3GGLA 3OGVA 1WBFA 4FP3A 5FZ6A 3ZMOA 3IIAA 5B4XA 1XU1A 2R073 3VBUC 4Q4X1 1O59A 4XFIA 3RMYA 2PQQA 4A45A 4CXXA 3WVJA 1OUSA 5KHIA 4NUBA 2HBUA 2WABA 2BNOA 1W8TA 3H1WA 2DVFA 1OHFA 5HXMA 1HRI3 5JMCA 3BTYA 5A3WA 2FDIA 4Y5SA 2B45X 4WM7C 1AR81 4CPBA 4ZU7A 4TXWA 2VOWA 1J1TA 3ENRA 2F6BA 2K0GA 2VULA 3AP7A 3W5MA 1H1AA 4WVMA 5GLUA 5F39A 4Q2FA 5D2AA 4UF0B 1L7LA 1QIQA 1XYNA 4KWUA 4QPGA 4Q8KA 1ODNA 2HKXA 2FD8A 4LKFA
chains in the Genus database with same CATH topology
1I5PA 3IAPA 2VMEA 2X05A 2C9KA 5JUVA 2W94A 1SG3A 2CDPA 4BJ0A 2Z4FA 4JKMA 1K12A 3VD9A 1XC6A 4A41A 3K4AA 3T0DA 1J83A 1GNYA 2WAOA 2W1QA 3WNKA 1J84A 4OMDA 1NAEA 1CZVA 2DCKA 2DDUA 2EIBA 4ZZ5A 2J7MA 3LEIA 3C7OA 2VMCA 2WUHA 2W5FA 1RYYA 4QDSA 1PMJX 3WF2A 3T2PA 2RVAA 2ORZA 2J1VA 3I3EA 3LPGA 2QBXA 4D8MA 1NUKA 1W99A 2QQJA 3P6BA 1JYNA 3NJXA 4UI9L 3VDBA 3K46A 1UYXA 1JU3A 4ET7A 4ZZ8A 3VD7A 5LA1A 3HJRA 3IAQA 3MUY1 3WF0A 1NX9A 2VMDA 3ETPA 2W91A 1WCQA 2RV9A 2QQLA 2VZTA 2X09A 2ID4A 3HPNA 4JKLA 1W0NA 4DXRA 3ACFA 3HEIA 3VDCA 3OEBA 1UWWA 1F4HA 1PX4A 1JHJA 3T2QA 5DQ0A 1SHWB 3GM8A 4A6OA 3THDA 2Y6LA 1TG7A 3WNMA 3I2JA 3NRUA 3UNPA 4P00B 3DYMA 3VD3A 2VOTA 1JZ8A 3D3AA 5A1AA 4W50A 1K42A 3WNOA 2VQUA 4M4PA 2J1TA 4GWIA 5DN2A 4IUGA 3DECA 2E31A 3MO4A 3WF3A 3SKVA 3FHAA 2OKXA 1UY4A 1GUIA 4DUXA 1H6XA 3SKJE 3DYOA 2Y8KA 3UETA 3K77A 3U37A 1JZ4A 3OBAA 5CZKA 4GWJA 3E1F1 2J1SA 2L9LA 2WO2A 3BN6A 2W1UA 3HOBA 4UAPA 1GOHA 2YFUA 2YFZA 3W5NA 5JXGA 2E32A 3EYPA 4QX0A 3MV01 1T2XA 3WF1A 4E8CA 1F4AA 3IB3A 4L0PA 1K3IA 4OYUA 4QB1A 4XUQA 4Z2AA 2W47A 1JYVA 3C7HA 2VCAA 2Y6KA 2QQOA 2Y64A 3HN3A 3CZUA 2QQIA 2VZOA 1HN1A 1XNAA 4MOAA 2ZEXA 2VM9A 4XURA 3THCA 3VD4A 4BK4A 2HLEA 3NJVA 3I2FA 3EB7A 4OMCA 3WNPA 3IIIA 3T2OA 5IFTA 4XVHA 2RJ2A 1OF3A 4PT6A 5DMYA 5G04L 1IQDC 4OZOA 4E8DA 3C8XA 1K45A 1UMIA 3DYPA 1JU4A 2JDAA 1JZ7A 2VJXA 1EUUA 2CDOA 1DYOA 2W9XA 3ACIA 2Y6JA 1US3A 3LPFA 1W8OA 3AC0A 5CYYA 1GOFA 4LQRA 1JYXA 5JXHA 4XZUG 2QQNA 1CZSA 1UY3A 4LHSA 3MBWA 2BGOA 1BHGA 1MPXA 3I97A 4D0QA 3A22A 1UY2A 5LA0A 3GXUA 5B4NA 4M4RA 1O8PA 1JZ5A 2ZEZA 2J1UA 2YC2A 3FHQA 4QX2A 1H6YA 2YB7A 5EJZB 4PF1A 2V72A 2YG0A 3NQHA 5LA2A 1KGYA 1UY0A 3LQCA 4QDRA 4W4ZA 2VZPA 2Y6HA 3LE0A 3OGSA 2VCCA 3ZM8A 1GU3A 4QAWA 3K4ZA 2J1RA 4P5YA 3J7HA 5C71A 5IHRA 1P8JA 4KMQA 1ULOA 1W9TA 1UYZA 4DXSA 2JKXA 2X10A 2EIDA 2WO1A 5J1XA 2BBAA 3WQBA 1R64A 2J1EA 3A23A 2EICA 1L7QA 2VZSA 5LCWL 1UXXX 2YC4A 4GZ9A 3T08A 2BZDA 4CU6A 4PQQA 2VMFA 1JI6A 4FI9A 5G05L 1UYYA 2LS6A 3ABZA 2XONA 3PUIA 4QDQA 4CUCA 2LW8A 4MO3M 1ULPA 4DUVA 4DXTA 1OD3A 2ZEYA 3MUZ1 2VC9A 3HNBM 5C70A 2C4XA 2WBKA 2VZQA 3K75B 4CU7A 4A42A 2XHNA 4CU8A 1CX1A 3HNYM 3C7FA 3WEZA 5JR2A 1EUTA 3WNNA 4XUNA 3T0BA 2ZXQA 2WN3A 3WNLA 4AG4A 5IYYA 1YQ2A 4BDVB 2QQMA 3PUHA 1KEXA 4XUTA 3LEKA 3C7EA 3OGRA 3CIHA 1UMHA 3CZJA 4ARYA 1JZ2A 3CQOA 2R7EB 5I0DA 2W1WA 2VQTA 3A21A 3UESA 1O8SA 1UX7A 2BERA 2JE8A 4BK5A 4XUOA 5EIYB 2W87A 2XOMA 4KI5M 3I2HA 1JZ6A 2W1SA 1GQPA 2WQ8A 4CUAA 3GDBA 2BGPA 3I3BA 1US2A 5IJRA 4MADA 2KD7A 1JYWA 3MV11 1D7PM 2VO5A 2B9VA 3SEEA 3WSOA 1PX3A 3WF4A 2VR4A 4CUBA 4DEQA 1OH4A 4CVUA 4LKSA 4QB6A 3I2KA 3ECQA 2VZVA 4JX0A 4JKKA 4RYDA 1NKGA 2Y6GA 2W92A 2V4VA 3FL7A 4ARXA 3A7QA 4DUWA 1XPWA 2J1AA 3I2IA 3CDZB 3F2ZA 2VCBA 2WZEA 3OB8A 2HYXA 5JXJA 4A3ZA 2WO3A 3CMGA 4LPLA 2VTFA 4AAXA 1OT5A 2DCJA 4MGSA 3C7GA 1XNTA 3ACGA 1WKYA 1UY1A 5F7UA 2JD9A 2XQXA 3K4DA 4JHZA 2E33A 3T0AA 1TVGA 4QPWA 5JMOA 3JXSA 4YPJA 2E26A 3VD5A 3SEPA 3T09A 1JZ3A 2VZ3A 3HNMA 2WZ8A 4A4AA 5C7GA 4TTGA 1OF4A 3ACHA 3NNGA 3BGAA 2C26A 3LEGA 4XUPA 3OG2A 3VDAA 3P1IA 1UXZA 2VZUA 1W9WA 4MGQA 1DLCA 1GOGA 4P02B 4OUEA 4BXSV 2W95A 2WAAA 4QX1A 4ZY9A 2W3JA 1DP0A 1W9SA 4P08A 2J22A 2W46A 2ZEWA 1LNSA 4DEVA 2VL4A 5HPOA 4W8JA 1L7RA 2PQSA 2QQKA 2WYSA 2B4KA 5JXIA 2V5DA 4CU9A 4A44A 1CIYA 3I3DA 4UOJA 5DPNA 4RN5A 2VZRA 1CZTA 2WDBA 5IFPA 3GGLA 3OGVA 5B4XA 1SDDB 1PMHX 1O59A 2ORXA 4QX3A 4A45A 2VZ1A 3IDAA 5EJ1B 2WN2A 4HG6B 2WABA 5HXMA 1UZ0A 4TXWA 3OEAA 3FN9A 3CKHA 1GMMA 2EIEA 3W5MA 1W8NA 5FUIA 4KWUA 4QB2A 4ZXEA 3I2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5P A;  3IAP A;  2VME A;  2X05 A;  2C9K A;  5JUV A;  2W94 A;  1SG3 A;  2CDP A;  4BJ0 A;  2Z4F A;  4JKM A;  1K12 A;  3VD9 A;  1XC6 A;  4A41 A;  3K4A A;  3T0D A;  1J83 A;  1GNY A;  2WAO A;  2W1Q A;  3WNK A;  1J84 A;  4OMD A;  1NAE A;  1CZV A;  2DCK A;  2DDU A;  2EIB A;  4ZZ5 A;  2J7M A;  3LEI A;  3C7O A;  2VMC A;  2WUH A;  2W5F A;  1RYY A;  4QDS A;  1PMJ X;  3WF2 A;  3T2P A;  2RVA A;  2ORZ A;  2J1V A;  3I3E A;  3LPG A;  2QBX A;  4D8M A;  1NUK A;  1W99 A;  2QQJ A;  3P6B A;  1JYN A;  3NJX A;  4UI9 L;  3VDB A;  3K46 A;  1UYX A;  1JU3 A;  4ET7 A;  4ZZ8 A;  3VD7 A;  5LA1 A;  3HJR A;  3IAQ A;  3MUY 1;  3WF0 A;  1NX9 A;  2VMD A;  3ETP A;  2W91 A;  1WCQ A;  2RV9 A;  2QQL A;  2VZT A;  2X09 A;  2ID4 A;  3HPN A;  4JKL A;  1W0N A;  4DXR A;  3ACF A;  3HEI A;  3VDC A;  3OEB A;  1UWW A;  1F4H A;  1PX4 A;  1JHJ A;  3T2Q A;  5DQ0 A;  1SHW B;  3GM8 A;  4A6O A;  3THD A;  2Y6L A;  1TG7 A;  3WNM A;  3I2J A;  3NRU A;  3UNP A;  4P00 B;  3DYM A;  3VD3 A;  2VOT A;  1JZ8 A;  3D3A A;  5A1A A;  4W50 A;  1K42 A;  3WNO A;  2VQU A;  4M4P A;  2J1T A;  4GWI A;  5DN2 A;  4IUG A;  3DEC A;  2E31 A;  3MO4 A;  3WF3 A;  3SKV A;  3FHA A;  2OKX A;  1UY4 A;  1GUI A;  4DUX A;  1H6X A;  3SKJ E;  3DYO A;  2Y8K A;  3UET A;  3K77 A;  3U37 A;  1JZ4 A;  3OBA A;  5CZK A;  4GWJ A;  3E1F 1;  2J1S A;  2L9L A;  2WO2 A;  3BN6 A;  2W1U A;  3HOB A;  4UAP A;  1GOH A;  2YFU A;  2YFZ A;  3W5N A;  5JXG A;  2E32 A;  3EYP A;  4QX0 A;  3MV0 1;  1T2X A;  3WF1 A;  4E8C A;  1F4A A;  3IB3 A;  4L0P A;  1K3I A;  4OYU A;  4QB1 A;  4XUQ A;  4Z2A A;  2W47 A;  1JYV A;  3C7H A;  2VCA A;  2Y6K A;  2QQO A;  2Y64 A;  3HN3 A;  3CZU A;  2QQI A;  2VZO A;  1HN1 A;  1XNA A;  4MOA A;  2ZEX A;  2VM9 A;  4XUR A;  3THC A;  3VD4 A;  4BK4 A;  2HLE A;  3NJV A;  3I2F A;  3EB7 A;  4OMC A;  3WNP A;  3III A;  3T2O A;  5IFT A;  4XVH A;  2RJ2 A;  1OF3 A;  4PT6 A;  5DMY A;  5G04 L;  1IQD C;  4OZO A;  4E8D A;  3C8X A;  1K45 A;  1UMI A;  3DYP A;  1JU4 A;  2JDA A;  1JZ7 A;  2VJX A;  1EUU A;  2CDO A;  1DYO A;  2W9X A;  3ACI A;  2Y6J A;  1US3 A;  3LPF A;  1W8O A;  3AC0 A;  5CYY A;  1GOF A;  4LQR A;  1JYX A;  5JXH A;  4XZU G;  2QQN A;  1CZS A;  1UY3 A;  4LHS A;  3MBW A;  2BGO A;  1BHG A;  1MPX A;  3I97 A;  4D0Q A;  3A22 A;  1UY2 A;  5LA0 A;  3GXU A;  5B4N A;  4M4R A;  1O8P A;  1JZ5 A;  2ZEZ A;  2J1U A;  2YC2 A;  3FHQ A;  4QX2 A;  1H6Y A;  2YB7 A;  5EJZ B;  4PF1 A;  2V72 A;  2YG0 A;  3NQH A;  5LA2 A;  1KGY A;  1UY0 A;  3LQC A;  4QDR A;  4W4Z A;  2VZP A;  2Y6H A;  3LE0 A;  3OGS A;  2VCC A;  3ZM8 A;  1GU3 A;  4QAW A;  3K4Z A;  2J1R A;  4P5Y A;  3J7H A;  5C71 A;  5IHR A;  1P8J A;  4KMQ A;  1ULO A;  1W9T A;  1UYZ A;  4DXS A;  2JKX A;  2X10 A;  2EID A;  2WO1 A;  5J1X A;  2BBA A;  3WQB A;  1R64 A;  2J1E A;  3A23 A;  2EIC A;  1L7Q A;  2VZS A;  5LCW L;  1UXX X;  2YC4 A;  4GZ9 A;  3T08 A;  2BZD A;  4CU6 A;  4PQQ A;  2VMF A;  1JI6 A;  4FI9 A;  5G05 L;  1UYY A;  2LS6 A;  3ABZ A;  2XON A;  3PUI A;  4QDQ A;  4CUC A;  2LW8 A;  4MO3 M;  1ULP A;  4DUV A;  4DXT A;  1OD3 A;  2ZEY A;  3MUZ 1;  2VC9 A;  3HNB M;  5C70 A;  2C4X A;  2WBK A;  2VZQ A;  3K75 B;  4CU7 A;  4A42 A;  2XHN A;  4CU8 A;  1CX1 A;  3HNY M;  3C7F A;  3WEZ A;  5JR2 A;  1EUT A;  3WNN A;  4XUN A;  3T0B A;  2ZXQ A;  2WN3 A;  3WNL A;  4AG4 A;  5IYY A;  1YQ2 A;  4BDV B;  2QQM A;  3PUH A;  1KEX A;  4XUT A;  3LEK A;  3C7E A;  3OGR A;  3CIH A;  1UMH A;  3CZJ A;  4ARY A;  1JZ2 A;  3CQO A;  2R7E B;  5I0D A;  2W1W A;  2VQT A;  3A21 A;  3UES A;  1O8S A;  1UX7 A;  2BER A;  2JE8 A;  4BK5 A;  4XUO A;  5EIY B;  2W87 A;  2XOM A;  4KI5 M;  3I2H A;  1JZ6 A;  2W1S A;  1GQP A;  2WQ8 A;  4CUA A;  3GDB A;  2BGP A;  3I3B A;  1US2 A;  5IJR A;  4MAD A;  2KD7 A;  1JYW A;  3MV1 1;  1D7P M;  2VO5 A;  2B9V A;  3SEE A;  3WSO A;  1PX3 A;  3WF4 A;  2VR4 A;  4CUB A;  4DEQ A;  1OH4 A;  4CVU A;  4LKS A;  4QB6 A;  3I2K A;  3ECQ A;  2VZV A;  4JX0 A;  4JKK A;  4RYD A;  1NKG A;  2Y6G A;  2W92 A;  2V4V A;  3FL7 A;  4ARX A;  3A7Q A;  4DUW A;  1XPW A;  2J1A A;  3I2I A;  3CDZ B;  3F2Z A;  2VCB A;  2WZE A;  3OB8 A;  2HYX A;  5JXJ A;  4A3Z A;  2WO3 A;  3CMG A;  4LPL A;  2VTF A;  4AAX A;  1OT5 A;  2DCJ A;  4MGS A;  3C7G A;  1XNT A;  3ACG A;  1WKY A;  1UY1 A;  5F7U A;  2JD9 A;  2XQX A;  3K4D A;  4JHZ A;  2E33 A;  3T0A A;  1TVG A;  4QPW A;  5JMO A;  3JXS A;  4YPJ A;  2E26 A;  3VD5 A;  3SEP A;  3T09 A;  1JZ3 A;  2VZ3 A;  3HNM A;  2WZ8 A;  4A4A A;  5C7G A;  4TTG A;  1OF4 A;  3ACH A;  3NNG A;  3BGA A;  2C26 A;  3LEG A;  4XUP A;  3OG2 A;  3VDA A;  3P1I A;  1UXZ A;  2VZU A;  1W9W A;  4MGQ A;  1DLC A;  1GOG A;  4P02 B;  4OUE A;  4BXS V;  2W95 A;  2WAA A;  4QX1 A;  4ZY9 A;  2W3J A;  1DP0 A;  1W9S A;  4P08 A;  2J22 A;  2W46 A;  2ZEW A;  1LNS A;  4DEV A;  2VL4 A;  5HPO A;  4W8J A;  1L7R A;  2PQS A;  2QQK A;  2WYS A;  2B4K A;  5JXI A;  2V5D A;  4CU9 A;  4A44 A;  1CIY A;  3I3D A;  4UOJ A;  5DPN A;  4RN5 A;  2VZR A;  1CZT A;  2WDB A;  5IFP A;  3GGL A;  3OGV A;  5B4X A;  1SDD B;  1PMH X;  1O59 A;  2ORX A;  4QX3 A;  4A45 A;  2VZ1 A;  3IDA A;  5EJ1 B;  2WN2 A;  4HG6 B;  2WAB A;  5HXM A;  1UZ0 A;  4TXW A;  3OEA A;  3FN9 A;  3CKH A;  1GMM A;  2EIE A;  3W5M A;  1W8N A;  5FUI A;  4KWU A;  4QB2 A;  4ZXE A;  3I2G A; 
#chains in the Genus database with same CATH topology
 3ZLI A;  1I5P A;  3IAP A;  1PM7 A;  1SLB A;  4N7I A;  4KBZ A;  2D3P A;  2EXI A;  4N43 C;  5DDJ 2;  2X05 A;  1FV2 A;  1SG3 A;  1X7N A;  4BJ0 A;  5BNP A;  3AMQ A;  2Z4F A;  4N90 A;  3UV9 A;  3VD9 A;  3M1H A;  4IGQ A;  3K4A A;  1D4M 2;  1V6M A;  1GNY A;  1Q8S A;  4PQ9 A;  1OLR A;  5JSR A;  1TNR A;  1V9U 2;  2YRO A;  3E5X A;  4FPY A;  1AL2 1;  4JRL A;  1BLZ A;  2WIN B;  5L7O A;  4IEP A;  4QQO A;  5GLZ A;  2GNT A;  5A33 A;  1UOB A;  3NW4 A;  3C7O A;  3AKQ A;  2ATF A;  3ME2 A;  4AI3 A;  1VBA 1;  1TMF 1;  3N9M A;  1RYY A;  4QDS A;  1EYB A;  5A3P A;  5AC9 3;  2CSG A;  3VB9 A;  3WF2 A;  4A7Z A;  3T2P A;  5EPA A;  4Y26 A;  4LUM A;  2ORZ A;  3BU0 A;  4Q5O A;  1CWP A;  2ZHL A;  4RS5 B;  1A8M A;  4Z92 B;  1AX2 A;  4ZKT B;  2XBO 3;  3POB A;  1RMU 2;  1VRH 2;  1QHD A;  1JYN A;  2GSY A;  3NJX A;  4YGB A;  4J1X A;  1GNZ A;  5FZB A;  3OJB A;  2Z79 A;  1JU3 A;  3D82 A;  4XE9 A;  1NE6 A;  3W9A A;  3WT3 A;  5H9Q A;  5A3N A;  2FCV A;  5AFB A;  1WZX A;  4LO8 A;  3G6J B;  2QQW A;  2VMD A;  4GUL A;  1NZC A;  4Y5T A;  2W91 A;  3MIH A;  4NWV A;  5CG9 A;  2DVA A;  4G4F A;  4YGE A;  4E4Z A;  2X09 A;  4YZ4 A;  3RMX A;  4DXR A;  1RUE 2;  3PIG A;  1VAM A;  3LSE A;  5GZD A;  1IKP A;  5A6X A;  1S0E A;  5KHG A;  3POF A;  2R6Q A;  3HT1 A;  4HKL A;  1LGC A;  2PHU A;  5EXO A;  3FE5 A;  2UY8 A;  1TME 3;  3FUO A;  1RUJ 2;  4TLF A;  4MH0 E;  4AI2 A;  2GN7 A;  1QJY 1;  2UWB A;  2ZGT A;  3EMR A;  3FBM A;  4M01 A;  5DG2 A;  5LAT A;  1YRZ A;  5DQ0 A;  2QQU A;  1DZQ A;  3GM8 A;  4AK3 A;  2CHH A;  2D98 A;  4KG8 A;  1ULF A;  4JGZ C;  3THD A;  1Z0H A;  2GME A;  1H8V A;  1VBB 3;  2E7Q A;  1RUD 2;  3I2J A;  4BM8 A;  5FP3 A;  3KMH A;  4LO7 A;  3FLR A;  3UNP A;  2XKP A;  2ZGK A;  3DYM A;  2AEY A;  2CU5 A;  3QH6 A;  2VOT A;  4IV1 B;  3ZDV A;  5JZG A;  2CGP A;  2XUE A;  2PXJ A;  5BYN A;  3N7L A;  2XLF A;  1AL0 G;  1O5L A;  4YNI A;  3W59 A;  3ZFF C;  3VBH A;  1MZ5 A;  4H14 A;  4K8F A;  1PO2 1;  5A3M A;  3O1O A;  2ZML A;  2W0X A;  1W8U A;  1PNG A;  1TQ5 A;  3MO4 A;  3THP A;  2UWC A;  5A3U A;  5FRE A;  2JDZ A;  1YJL A;  1HB3 A;  2QQV A;  4PLN A;  4S2D A;  4YLZ A;  2VQ0 A;  4CCE A;  2CWM A;  3FHA A;  3E6D A;  2YPD A;  4LJH A;  3J7L A;  2A6Y A;  3RNS A;  3BKZ A;  5CAD A;  3OBA A;  4FSJ A;  1UF2 C;  5CZK A;  1LGN A;  3HBZ A;  4WVZ A;  4LT5 A;  4YAR A;  2J1S A;  4ERO A;  2W1U A;  3HOB A;  1B35 A;  1LED A;  2A6W A;  1H8T B;  4ISQ A;  4O7X A;  5T5L A;  4E27 A;  5IAX A;  1QNY A;  1Q8P A;  1S2B A;  2VVF A;  1HB4 A;  4A2U A;  4EQV A;  1PK6 C;  3PL0 A;  2R07 2;  4XYX A;  3HD8 B;  4BQX A;  4PDW C;  1H30 A;  2NN8 A;  2X5I C;  1T2X A;  3WF1 A;  2ZMK A;  1F4A A;  5CVR A;  3IB3 A;  4XBQ A;  4AAP A;  1JN2 P;  1QMJ A;  4Z82 A;  1AXY A;  1SBE A;  3WNX A;  3TN9 3;  3AKP A;  4OYU A;  5ACA 3;  1COV 1;  5CKM A;  1HRI 2;  1UPS A;  4AFC A;  4AGR A;  5A70 A;  2PHL A;  1CPN A;  2XXZ A;  2W47 A;  4M0N A;  4IV3 B;  3N7M A;  5KXD A;  3NAP B;  4KGQ A;  2R04 1;  4D69 A;  4BYY A;  1AYN 2;  1UQX A;  2JJ6 A;  2Y64 A;  4IER A;  4MV2 A;  1R09 1;  2DCY A;  1C5I A;  1HRV 2;  1ZBA 1;  2FHR A;  1B09 A;  3J26 N;  3ZO0 B;  2WKK A;  2XB6 C;  2VM9 A;  4XUR A;  4Z1V A;  3KQR A;  2PTM A;  4QQ2 A;  5FFO C;  1Z7S 3;  2OX0 A;  1GZW A;  4E4D X;  3WXP A;  1VR3 A;  3S5A A;  5F1R A;  2FDG A;  3I2O A;  3CU7 A;  5IFT A;  1OF3 A;  3NKT A;  4XC9 A;  4BME A;  3IBM A;  2UYB A;  3AVS A;  3PVE A;  2FZ2 A;  2YHJ A;  3M3O A;  1K45 A;  4JDM A;  1UMI A;  3KM5 A;  1DQ2 A;  4E8D A;  3VDD B;  3DYP A;  3VBS C;  3ZN4 A;  1W6N A;  2DBI A;  5T5J A;  2HWE 2;  2Y6J A;  5FPL A;  1OPM A;  3LPF A;  1O3T A;  4AI1 A;  2DF7 A;  2HYK A;  3H42 B;  5D8A C;  4C8D A;  1GOF A;  4CCC A;  3PU3 A;  4WM8 A;  5FUP A;  5LA9 A;  5AC9 2;  5JXH A;  3NNL A;  3H8O A;  3VLB B;  1CZS A;  1UY3 A;  3DXT A;  3MBW A;  4YM0 A;  1C28 A;  2BGO A;  3N7K A;  1MPX A;  2E6V A;  5FZ9 A;  5FZI A;  4FO9 A;  3A22 A;  1UY2 A;  3OD4 A;  3S7E A;  3V64 A;  2EIG A;  1ND2 A;  2HWB 3;  5B4N A;  3S30 A;  1GQG A;  1LHV A;  4M4R A;  1A78 A;  3O1S A;  4ASL A;  3AX4 A;  2QJV A;  2CAU A;  2OS2 A;  2FMD A;  3G7D A;  3GJA A;  2G9F A;  4I02 A;  3B94 A;  3FHQ A;  3VBU B;  4QX2 A;  1OOP A;  3D5O A;  1EY2 A;  2YB7 A;  1IS3 A;  1R08 1;  3WDT A;  3USS A;  4C91 A;  3BVC A;  1LEM A;  1S0C A;  3LDR A;  5EYY A;  5JI9 A;  5A7W B;  4HXC A;  1V6I A;  1VRB A;  4LBK A;  1QH7 A;  3POY A;  4WM7 B;  1LHU A;  4CDU A;  1TME 2;  2VBD A;  3CJI C;  3OGS A;  1OQD A;  4UBG A;  1KDM A;  4N53 C;  4B7K A;  2Y38 A;  2V4A A;  4KWK A;  5D21 A;  2JG8 C;  1OFS A;  2YDE A;  4NPR A;  3ZFE A;  1XBF A;  4QAW A;  2WT0 A;  3LDK A;  5C71 A;  1XJA A;  5IHR A;  3RI9 A;  1P8J A;  4KMQ A;  4F3J A;  1ULO A;  4LBN A;  1VBB 2;  1W9T A;  4LK7 A;  4R4X A;  2WZR 1;  1AR9 3;  2EVX A;  4KU7 A;  5CKN A;  1HV1 A;  2LTN A;  2ARX A;  2X10 A;  5FWJ A;  3ZVX A;  4CCK A;  1BKZ A;  2BNN A;  4MGY E;  4PBO A;  4QPG B;  4ZON A;  3WDU A;  2ZGL A;  3RZH A;  1XQN A;  3V65 A;  5F2S A;  1SFY A;  4LBM A;  3B3Q E;  4G9S B;  5FXX A;  3RPQ A;  3A23 A;  5IK7 A;  4HFS A;  3AP9 A;  1L7Q A;  1N1Y A;  4AGV A;  4NPL A;  2D43 A;  3B01 A;  3NNF A;  4HET A;  4Y20 B;  1BEV 2;  3DV8 A;  1OMI A;  2BOJ A;  2YC4 A;  4GZ9 A;  2OA2 A;  3MIF A;  5A6Y A;  3JQX A;  2OPK A;  4PQQ A;  3WDV A;  1VBD 1;  4YZ5 A;  4I0B A;  4QX8 A;  1JI6 A;  4HLT A;  4LO5 B;  5FOB B;  1RHI 1;  2VOV A;  5EFU A;  2Q30 A;  1UYY A;  1QJU 2;  4OUS A;  4XMA A;  1XB9 A;  3RGB A;  4MLO A;  3ZPO A;  1QJX 2;  4HAN A;  4IEY A;  4YW5 A;  3ABZ A;  2XON A;  1DYK A;  4AVC A;  4CP9 A;  4EE2 A;  1HIX A;  5E89 A;  5LAS A;  4COY A;  4E4S A;  2V09 A;  2SLI A;  4BXF A;  4CDX C;  1HXS 3;  1KQR A;  3BOP A;  3SIT A;  2P3Y A;  2QZ2 A;  3AMP A;  1V70 A;  2AC1 A;  3HNB M;  2A70 A;  5E88 A;  5C70 A;  3J7N A;  1AYM 2;  1CAV A;  5ISL A;  3JBG 3;  1X8E A;  1QJF A;  2IC1 A;  1C57 A;  3OPW A;  2WT2 A;  4CU8 A;  1CX1 A;  1N47 A;  2ZGS A;  3GZT B;  5DUX A;  3R4D B;  5FKB A;  1Y43 B;  1W2A X;  4KU8 A;  1VLN A;  3TN9 2;  2WSV A;  5ACA 2;  5C33 A;  3JCI A;  3OOX A;  5DAX A;  4XUN A;  3WNN A;  1MS4 A;  4AQ6 A;  4XUT A;  2FDF A;  3C3V A;  1N1T A;  4AI0 A;  2IZW A;  1X82 A;  1LOD A;  1XE8 A;  3C7E A;  1UMH A;  1ZM1 A;  1PVC 2;  1GSL A;  3CIH A;  3CZJ A;  4NR1 A;  2CV6 A;  4QGN A;  3DF0 A;  1NXM A;  2WC2 A;  5EP9 A;  3A21 A;  1UX7 A;  2GND A;  4D7S A;  1DQ6 A;  3W58 A;  4BLI A;  5LEK A;  4WVV A;  4XUO A;  5T5P A;  5EIY B;  1OKO A;  3ZYB A;  1Z7S 2;  1Q8V A;  2GNB A;  2W1S A;  2WQ8 A;  3GDB A;  2FDJ A;  5FZF A;  4DNY A;  4F8A A;  4DRV A;  1UNB A;  4Y22 A;  5L9B A;  5IJR A;  3VBO C;  2KD7 A;  4BB3 A;  3V56 A;  5JDB A;  3AP5 A;  4CZS A;  1PZ7 A;  1Y9G A;  4FVV A;  3ZFF B;  4QQL A;  3U1X A;  3AZY A;  1RL3 A;  2JDP A;  5F5Q A;  2P6C A;  3WF4 A;  1GAN A;  5J48 A;  1OQ1 A;  3U11 A;  1MS8 A;  1OH4 A;  1QQP 1;  3MI8 A;  1ENS A;  4MXW A;  3CBN A;  3H50 A;  3ZSJ A;  4IET A;  4RQP A;  4QB6 A;  3I2K A;  1ZYB A;  3PU8 A;  4UFM A;  4Z8B A;  4LHN A;  2C1F A;  3ZYG A;  3H1M A;  4JX0 A;  4W6W A;  1C3H A;  4A7Y A;  1N1V A;  2RMU 3;  4HSL A;  4BLJ A;  1YI9 A;  3WG1 A;  3CJX A;  3MZH A;  3H8X A;  3H8R A;  5LBC A;  2P3I A;  3CF6 E;  3QBQ A;  2HWB 2;  1WWY A;  3HQU A;  3A7Q A;  1IG3 A;  2RS3 3;  2BBV A;  3U4S A;  3CDZ B;  4NO4 A;  1YYN A;  1UU5 A;  3VBF C;  2HWC 2;  3F2Z A;  4URT A;  4QM9 A;  3SIS A;  2P17 A;  3BUC A;  3FUQ A;  1ZBE 3;  4A3Z A;  1E5H A;  3NKG A;  1PK6 B;  4ES8 A;  4LPL A;  4XBN A;  2A7A A;  1KD7 A;  4PDW B;  2X5I B;  1OT5 A;  2DCJ A;  4HPK A;  1TMF 3;  4YVW C;  2WWU A;  5FDB A;  3ACG A;  1UY1 A;  4UF0 A;  4A6S A;  1EAH 3;  4CRQ A;  5FBZ A;  2PLV 3;  4QPY A;  2B42 B;  1RUH 2;  4DFS A;  2WFF 3;  4ZU4 A;  2ET7 A;  5M0T A;  5DG1 A;  4NHX A;  3UKN A;  4NVP A;  1RUC 2;  2VPV A;  1RB8 G;  2E26 A;  5LK7 B;  3IZO A;  1MZF A;  2LRP A;  3N7J A;  4JTN A;  1JOP A;  2YMZ A;  4TTG A;  2CNA A;  1M06 G;  4PIY A;  4WV8 A;  2HWF 1;  4OVE A;  4H2A A;  4XAA A;  4LKD A;  2QDN A;  3AZW A;  4QMA A;  3WW1 A;  2A1X A;  4TWT A;  4XUP A;  4XDQ A;  4EV0 A;  3OG2 A;  4BA6 A;  3NL1 A;  3AJZ A;  4GH4 C;  2VZU A;  3BU7 A;  2JKB A;  2RG4 A;  1DLC A;  1RUG 1;  4P02 B;  4LR4 A;  4M3C F;  2HWD 1;  2WAA A;  4QX1 A;  5L9V A;  1PO1 1;  4Q4Y 2;  2PEL A;  4RS5 A;  5FLH A;  5A1L A;  4J1W A;  3ZYF A;  1F5F A;  3ZYP A;  2VUC A;  4P08 A;  4XJA A;  2W52 A;  3D0S A;  2OZ6 A;  2RM2 2;  3QH7 A;  1RUI 1;  1GBG A;  4XFG A;  5FR3 A;  4V2V A;  1LGB A;  3NO8 A;  2JIC A;  2VL4 A;  3AZZ A;  4W8J A;  3RS6 A;  5DAW A;  4EN6 B;  1SPP B;  4P9I A;  4LIT A;  1IS4 A;  3E5Q A;  2RS5 3;  2HBT A;  5FP4 A;  4C0B A;  3Q8C A;  3OBR A;  4LEJ A;  4R9D A;  1GWL A;  1SLA A;  4I01 A;  2BGC A;  2V5D A;  4IE6 A;  3KF5 A;  4CU9 A;  4XMI A;  5DZF A;  1RGS A;  4ISR A;  4Q1P A;  4IE4 A;  5HCA A;  3D6E A;  1WLT A;  2WQ4 A;  2EXJ A;  4UOJ A;  5FZ7 A;  3PUA A;  5F3C A;  4I0W B;  1NCQ C;  2A6V A;  4DRR A;  3DGT A;  4EYU A;  4MHR A;  5FV3 A;  1FXZ A;  5LY1 A;  4YFW A;  5FRA A;  4L8Q A;  5E6H A;  1LRH A;  2VZ1 A;  5EJ1 B;  1MVE A;  5JR7 B;  5C3P A;  3SXW A;  3KD4 A;  2IXH A;  5A80 A;  4CCJ A;  1UZ0 A;  3KCY A;  1G9D A;  3J8F 1;  1JYT A;  2JDU A;  2VUD A;  1YCI A;  4LO6 B;  4UYB A;  1OVP A;  4BQ4 A;  1GMM A;  4IV1 A;  1ENX A;  2JG8 B;  3M3I A;  2VW2 A;  3M7A A;  4Y1Y A;  5FUI A;  5DDJ 3;  3RZZ A;  1XNK A;  5K4L A;  3ATG A;  4ZXE A;  4FPF A;  1RUF 1;  2QCS B;  4JQT A;  4Q4X 2;  5A3T A;  3AKS A;  2XWB B;  1WMD A;  3FHI B;  1TEI A;  2C9K A;  5JUV A;  1OQE A;  2XWJ B;  2PHF A;  2CDP A;  1D4M 3;  4UW5 A;  2G1M A;  2ZGQ A;  5T50 A;  3UT0 A;  3VV1 A;  4ASM B;  4UW3 A;  1K12 A;  5JVV A;  3VHO A;  1DBN A;  4N8M A;  3ROU A;  2XDV A;  2FMY A;  3RYR A;  1AR8 2;  4BH9 A;  1F8V A;  2DUR A;  4S2H A;  4BE3 A;  1W6M B;  2FQP A;  3GCX A;  3OUI A;  5LY2 A;  1J84 A;  1NT0 A;  4WBB A;  5J3U A;  4OMD A;  2SBA A;  1FT9 A;  1JTZ X;  1YEW A;  4WZC A;  5FYS A;  4RGG A;  1OA3 A;  1X8M A;  2J42 A;  1LHN A;  4TLG A;  4AHX A;  2VMC A;  2WS9 1;  1H8T A;  4QPI C;  4AXO A;  2XVL A;  2CTV A;  2Z5W A;  1OSG A;  4LUL A;  2RMU 2;  2EAA A;  4XIO A;  2GN3 A;  2JD4 A;  4MZU A;  1RMU 3;  2RVA A;  4QGL A;  3ZXL A;  2R06 3;  3LPG A;  4FAH A;  5HV0 A;  4CXW A;  2I45 A;  1NUK A;  1W99 A;  2I2S A;  5GZF A;  2RDS A;  4L99 A;  4UI9 L;  1AL2 2;  1URX A;  1CAX B;  4MVT A;  5I91 A;  1DGR A;  2G9Z A;  4F83 A;  4GMP 1;  5FCC A;  4DPN A;  4IV3 A;  4ZHN A;  1ZBE 2;  3NAP A;  3KVA A;  3MF9 A;  4IEU A;  5EV7 A;  3R6S A;  4AYU A;  5LA1 A;  2Z42 A;  5BNQ A;  3ON7 A;  2OVU A;  3SH5 A;  1TMF 2;  2D3S A;  5T5O A;  1VP6 A;  3ETP A;  4UBH A;  4AEM A;  3UL2 A;  1D2S A;  2JDY A;  2OII A;  1QU0 A;  4PIZ A;  2RV9 A;  3ZXE A;  1EAH 2;  3FMG A;  2ID4 A;  4JKL A;  2PLV 2;  1IPS A;  2WFF 2;  2MEV 1;  2XVK A;  1XU2 A;  1IQA A;  3IT8 A;  3RYP A;  4TZD A;  1RUJ 3;  2G4I A;  1MEC 3;  3WQ7 A;  1W6P B;  2E53 A;  2ZGN A;  3OEB A;  2X53 S;  1UWW A;  4V1P A;  3HWJ A;  1BZW A;  3RJ2 X;  1WW4 A;  5C9A C;  2BWA A;  1W8H A;  1PX4 A;  4DY5 A;  3ILF A;  3T2Q A;  4OI4 A;  1SHW B;  2B39 A;  4MUV A;  3P5B A;  1XE7 A;  1RUD 3;  3VDD A;  4A6O A;  1BK0 A;  1JUI A;  2JB8 A;  3AJY A;  1YXW A;  4Y1Z A;  5FZ1 A;  5FK7 A;  1LOA A;  4EWD A;  2XKO A;  1FOD 1;  1W03 A;  4P00 B;  3WW3 A;  3RJR A;  5C3S A;  3J4U H;  3Q8B A;  1VMF A;  3VD3 A;  4MXV A;  1PGL 1;  2VBP A;  2JDH A;  3VBO B;  3D3A A;  1XNC A;  3GJB A;  4OQ9 A;  1J3P A;  1K42 A;  1CVN A;  3MID A;  4HKW A;  5FZM A;  4UW6 A;  4C0H A;  5FLI A;  1DLL A;  1POV 0;  2H0B A;  5HXV A;  5FY1 A;  2ADE A;  4FXG B;  4XF0 A;  2CAV A;  4IUG A;  3DEC A;  3OY8 B;  1U5Y A;  4R9B A;  4CPB D;  2FBE A;  3ZN5 A;  4LBO A;  1O5U A;  4JQR A;  3S57 A;  4W6X A;  3A4U A;  2PHD A;  3VBU A;  4P9W A;  3LF7 A;  1H6X A;  3SKJ E;  3DYO A;  3OGJ A;  5FP7 A;  2QQP A;  1GZ9 A;  3KCX A;  1RJ7 A;  2JX9 A;  3JUU A;  1PO2 2;  5A7W A;  3E1F 1;  3BN6 A;  2WO2 A;  1GOH A;  2YFU A;  2YFZ A;  4GB3 1;  4WM7 A;  2XJV A;  2P37 A;  5ABJ C;  4LA3 A;  3EYP A;  2I74 A;  2JB4 A;  3LEM A;  1HLC A;  3MV0 1;  4YVS C;  3H3L A;  4YW4 A;  2ENR A;  4EWA A;  1HW5 A;  2D97 A;  1U5X A;  1E5R A;  1KJL A;  4KL1 A;  1A8D A;  2ZHK A;  1I3H A;  1DCS A;  3K3N A;  3MGU A;  4QB1 A;  1DG6 A;  1GWK A;  5FXV A;  1AVB A;  4XUQ A;  4Z2A A;  5I93 A;  3S5Q A;  1AYN 3;  4HPK B;  5EZW A;  3C7H A;  4XQW A;  2VCA A;  5L36 A;  1Q8Q A;  3SNM A;  1HRV 3;  4XF4 A;  2QQO A;  4XET A;  2CWS A;  4YM3 A;  1MQT C;  1A3K A;  4N9I A;  1ZRR A;  1SCS A;  4NRQ A;  3T1L A;  4YZ1 A;  3CZU A;  3KV6 A;  4EN7 B;  1FYU A;  3NMB A;  2AH2 A;  4P9X A;  3IN9 A;  4LXL A;  5BXX A;  1HX6 A;  1XNA A;  2ZEX A;  3HAG A;  3S6P A;  1W9Y A;  2YV8 A;  4Y20 A;  1RUN A;  5IW0 A;  1RTV A;  3THC A;  1CGP A;  4BK4 A;  1W6Q A;  2GNM A;  4DUW A;  4R8H A;  1K5M C;  1KS4 A;  1O4Y A;  3III A;  1NG0 A;  4PT6 A;  5DMY A;  5FPV A;  1OLM A;  3PTY A;  4OZO A;  2FCT A;  3OTF A;  3I2D A;  4JZR A;  1R09 2;  1XXN A;  3AFG A;  2DFB A;  2EAL A;  2HWE 3;  2JDA A;  2XVG A;  3DEM A;  2ZJC A;  1JZ7 A;  2D93 A;  1EUU A;  1H4H A;  2AZ5 A;  4K40 A;  5FMO L;  3SCF A;  3ZPY A;  2W9X A;  4MX3 A;  1ODM A;  4Q0Q A;  1K5J A;  5FZ8 A;  2HJI A;  1W8O A;  1AR6 1;  3B00 A;  4QXH A;  3JQW A;  4CP2 A;  3PDQ A;  1FMD 1;  4RGA A;  5DAV A;  3WV6 A;  4QHB A;  2OQ6 A;  2JEN A;  4FPJ A;  2R06 2;  4LHS A;  4HL0 A;  3K2O A;  4HT1 T;  3I97 A;  3AYD A;  2NQY A;  2XJS A;  5LA0 A;  2GU9 A;  1ND3 C;  3ZKY A;  2XPJ A;  2RDQ A;  1VJ2 A;  3GXU A;  1QGL A;  4AQ2 A;  4X8N A;  4LUK A;  3LGR A;  1O8P A;  1ASJ 1;  2J1U A;  1NQJ A;  5APA A;  1XSR A;  1SFN A;  3ITQ A;  3MW2 A;  4YM1 A;  1F35 A;  4R9A A;  4XJZ A;  1ULC A;  3PME A;  1S0I A;  1XE0 A;  1ZA4 A;  5GJ6 A;  2BRT A;  3TNP B;  2OQ7 A;  3NWK A;  4JAA A;  5EJ3 A;  4AGG A;  3ES4 A;  2CGN A;  1MR5 A;  3LIG A;  1YIF A;  1ZZ8 A;  3IKW A;  1UY0 A;  4KH9 A;  4IQP A;  1MEC 2;  4QKF A;  4XAC A;  2BDR A;  2ZGR A;  3LQC A;  5FYH A;  1MS0 A;  2PHT A;  2WNV C;  4Q4W 1;  5FPX A;  2VZP A;  2FCU A;  2Y6H A;  3LE0 A;  2VCC A;  4M00 A;  4QXK A;  4W6Y A;  3M3C A;  2DTY A;  4WVW A;  4I30 A;  3WDX A;  3SH4 A;  4QXC A;  1LR5 A;  2Q8O A;  3ZFF A;  2DBN A;  1NCR C;  3HVD A;  4Q0S A;  5TSW A;  1R08 2;  2YGM A;  1ZZ7 A;  3WLU A;  2OT7 A;  2W68 A;  4UW4 A;  2QFE A;  2NMN A;  5K9Y A;  3MW3 A;  3WX5 A;  1O91 A;  5J1X A;  4F7Z A;  2QZ3 A;  4AWD A;  4XF1 A;  1PIV 1;  1WD3 A;  2J1E A;  1BEV 3;  1SZB A;  2EIC A;  3JB8 A;  1CON A;  5A7S A;  2GC1 A;  2VZS A;  3TEX A;  1WME A;  3OUH A;  2ZX1 A;  4LO4 B;  5SV8 A;  3VBR C;  3T08 A;  3NNM A;  4Q4V 1;  4QU2 A;  3VHN A;  2ZZQ A;  3QLQ A;  4CU6 A;  2VXJ A;  3MYX A;  3N9L A;  4ASK A;  5IVY A;  3ZFG C;  1QJU 3;  2ZMN A;  2WZR 2;  4XJU A;  3ZN6 B;  2A73 B;  3WDW A;  1S0F A;  3IDC B;  2X8K A;  4RHV 1;  1QJX 3;  2WNU C;  3KCC A;  4BZ4 A;  1EV1 3;  1AR7 3;  1JYI A;  5LRR A;  1PK6 A;  1SQ4 A;  3NVC A;  4PDW A;  2LS6 A;  2VTX J;  2X5I A;  4EN9 B;  1W9F A;  5IFP A;  3PUI A;  4QDQ A;  3O1P A;  3AYC A;  4BOW A;  4LBQ B;  2LW8 A;  2HWD 3;  1Q5O A;  1ULP A;  3POS A;  2H6B A;  4PI0 A;  3RYK A;  4DUV A;  2BUK A;  1LAJ A;  1AYM 3;  3USU B;  4LMF A;  1KJR A;  2YBK A;  4YG0 A;  1BBT 1;  1SCR A;  2A5Z A;  2MHF A;  1VBD 2;  1CX4 A;  2BV4 A;  5CEH A;  1X50 A;  2VNO A;  3BPZ A;  2AEN A;  1RHI 2;  2D6P A;  3DPR C;  3K75 B;  4CU7 A;  1YJK A;  3H7J A;  3HNY M;  4QWN A;  3GYD A;  3X29 B;  4YW1 A;  3ZXG A;  4DMI A;  2ET1 A;  2WR9 A;  3U75 A;  2BWC A;  4CP1 A;  5K0U C;  3T0B A;  1ZRD A;  2ZXQ A;  1C5H A;  3AVR A;  3MLK A;  1JBC A;  1YQ2 A;  4AG4 A;  1PVC 3;  2HEY F;  3PUH A;  1KEX A;  5LWB A;  2DWR A;  4NRO A;  5AVA A;  3ZR5 A;  3LEK A;  1BQP A;  1M4W A;  2ZAB A;  4LBJ A;  2CGO A;  4GA9 A;  2IXC A;  1BJQ A;  3T1M A;  3T4H B;  4XHX A;  4ARY A;  5KXE A;  4RGK A;  1JZ2 A;  4BU2 A;  5I0D A;  3LWC A;  3WQ0 A;  5BY5 A;  3WW2 A;  2JE8 A;  2BER A;  1J1L A;  1STM A;  5I8T A;  1LB2 A;  3O5S A;  4PLM A;  3VBS A;  1V9U 1;  3A0K A;  3AZX A;  5C5T A;  3LA2 A;  1BMV 1;  2W87 A;  1JYC A;  2XOM A;  3B9I A;  3I2H A;  1JZ6 A;  2B7Y A;  3N3H A;  1GQP A;  1IZ3 A;  5D8A A;  1H0B A;  3TBD A;  2D6L X;  3GHN A;  1Q8O A;  2BGP A;  2V73 A;  1LES A;  4IEQ A;  5DUU A;  4CDQ C;  2ZTN A;  5JLV A;  1SPP A;  3SQO A;  4P14 A;  4DY3 A;  2JE7 A;  2YU2 A;  4MAD A;  1OLM E;  5FWE A;  4Y33 A;  4AOC A;  3MV1 1;  1C8M 3;  2PHR A;  1FAY A;  4OUL A;  4CEY C;  2WLP A;  4E9K A;  1YO8 A;  2Y33 A;  2B9V A;  4HK8 A;  2WZP P;  3WSO A;  4E2G A;  1PX3 A;  3B93 A;  2VOX A;  1POV 3;  1OKQ A;  2IFW A;  3H0O A;  4AEK A;  4DEQ A;  1VRH 1;  4CEW C;  1QDC A;  3WIN E;  4N9H A;  2XH6 A;  4HKO A;  4W65 A;  1QH6 A;  1UZZ A;  2JG9 B;  4CSW A;  5JOZ A;  4Z2W A;  2BU9 A;  3JD7 1;  4KWJ A;  4DQA A;  1UX6 A;  1WLD A;  1ZRI A;  1BXH A;  2R0H A;  4JKK A;  1ULG A;  1NKG A;  4GWN A;  1WCS A;  2HEW F;  5KXC A;  3FL7 A;  1VB4 A;  1SDW A;  2HWC 3;  5FKC A;  1RVF 3;  2GMP A;  2AYH A;  2R0F A;  3I2I A;  4DZG A;  3ELN A;  4FFI A;  2D5F A;  2ZKL A;  2XHK A;  3WR0 A;  3POE A;  1Y7B A;  2F4L A;  4XTP A;  1QQP 2;  1PGW 1;  2Y0O A;  3CJI A;  1NLR A;  2WO3 A;  2VMI A;  3R4U A;  1NOV A;  3CMG A;  4N53 A;  2VTF A;  4YVS B;  3WP6 A;  4QQP A;  4AAX A;  2Y60 A;  5BNN C;  5CFD C;  2D6O X;  4IE0 A;  1S0J A;  2JG8 A;  1S2K A;  1YHF A;  4C1W A;  1RUH 3;  2VOK A;  5L19 A;  2JD9 A;  4XIL A;  4O9E A;  3WCS A;  1RUC 3;  5IK4 A;  3GBW A;  4GKY A;  3L2Y A;  1TVG A;  4N7U A;  1AHS A;  3KS7 A;  3OBZ A;  1DGR N;  4KG0 A;  4KGG A;  4QPW A;  3NV3 A;  4BIO A;  3BTZ A;  5AVP A;  2CL2 A;  3HN1 A;  2DUP A;  1LU1 A;  3SEP A;  1I6X A;  4A4A A;  2VMG A;  1OA2 A;  1JUH A;  1W6M A;  2ZS6 B;  4N43 B;  5FO9 B;  2BOI A;  3AP4 A;  4H7L A;  1OF4 A;  1F5J A;  4HN1 A;  4L9B A;  3RRD A;  4NIA A;  3ZKU A;  4AE2 A;  1O4Z A;  1LCL A;  2ZGP A;  2GAU A;  5LRS A;  2RDR A;  1DIW A;  3NNG A;  3ZYJ B;  2C26 A;  3ACL A;  1D0G A;  3GCW A;  1U0A A;  3I59 A;  3ZR6 A;  1K5M B;  2PAE A;  4XXP A;  3P1I A;  1UXZ A;  1SLT A;  3RWN A;  3VDA A;  4KBB A;  2LM3 A;  1QWR A;  5F5C A;  4Q4Y 3;  2Z2S B;  5C8W A;  5HBA A;  4MGQ A;  3WP5 A;  4RSU A;  4YG6 A;  2IWG B;  1GOG A;  3D4K A;  3DKQ A;  3VKN A;  4BXS V;  1W6Q B;  2W95 A;  4PLO A;  5A6Q A;  3JU9 A;  1N3Q A;  2W3J A;  1NY7 2;  1HB1 A;  1UMZ A;  2RM2 3;  1W9S A;  2B46 X;  2UWA A;  2A71 A;  2H6C A;  2RHP A;  4ORF A;  2R49 A;  3NJY A;  5DZG A;  1YI7 A;  2HWF 2;  2W46 A;  2BJS A;  1LNS A;  2XQR A;  4P9L A;  1CAX A;  2VCM A;  4JTO A;  4I2O A;  4JV4 A;  1IG0 A;  1CPM A;  3OPT A;  2LRO A;  4TN7 A;  1EV1 2;  4ZXK A;  3Q8E A;  1AR7 2;  4YW2 A;  5FY8 A;  2Q1Z B;  3IDE A;  1IGO A;  1FPN 3;  5DAB A;  1L7R A;  1S0G A;  4AFM A;  3E6C C;  2WYS A;  3OSD A;  1YIP A;  4DXZ A;  2WNO A;  2HWD 2;  2R07 1;  3ORJ A;  3POI A;  1PO1 2;  1ND3 B;  3PTR B;  4YZ2 A;  1VBE 3;  1TNF A;  4I09 A;  5I8S A;  1XND A;  5FQ0 B;  4HON A;  1WUV A;  1ZA7 A;  1N1S A;  4CYD A;  1W6P A;  4RN5 A;  2YBP A;  2JIJ A;  3PUR A;  4JVA A;  4K3U A;  1G9A A;  1CZT A;  1VB2 A;  3FZ3 A;  4GJY A;  3B5L B;  3VN4 A;  4JRA A;  4CCN A;  4COZ A;  3O1R A;  5FY0 A;  4NOT A;  1SDD B;  1I5Z A;  1PMH X;  4QX3 A;  3IDA A;  1APN A;  4GD4 A;  5C6C A;  2VNG A;  4HG6 B;  5FOJ B;  4FQ4 A;  3PLQ A;  3A0N A;  1PZ9 A;  3O7O A;  3ES1 A;  2RS1 3;  2GDF A;  1DHK B;  4JGY A;  3RZK A;  4K9S A;  2OW4 A;  4NIG A;  1XYP A;  3FN9 A;  1GV9 A;  4JGZ B;  2O8Q A;  3KGL A;  2HH9 A;  4Q4X 3;  3VBO A;  1W8N A;  1X36 A;  4RA0 A;  1OUR A;  2XJP A;  1FV3 A;  2Q8D A;  4FPC A;  4QKB A;  4QB2 A;  2B9U A;  1NCR B;  4FTE A;  2VME A;  3K3O A;  4FXK B;  1AR8 3;  3OY8 A;  3BCW A;  4JKM A;  2JDN A;  1DYP A;  4D94 A;  3T0D A;  3J8F 2;  5C4W C;  3GZU C;  5KWR A;  2WAO A;  3PUS A;  5AC9 1;  1C8M 2;  2IXL A;  1CJP A;  5I0R A;  4DO0 A;  4FFH A;  1CZV A;  3VBR B;  2XBO 1;  2DDU A;  5F3E A;  5FYU A;  1F15 A;  1MS5 A;  1NLQ A;  3ZFG B;  2J7M A;  3LEI A;  5FY4 A;  3V0A B;  5IVC A;  4K1Z A;  2WUH A;  1WCD J;  4U36 A;  4XZP A;  5T54 A;  1QXP A;  2C5D A;  3ZYH A;  2WNU B;  5I8Y A;  5CG8 A;  5HCH A;  1PMJ X;  5DZE A;  3UYJ A;  5FZK A;  3WG3 A;  1RUO A;  4YVW A;  5FYM A;  1AL2 3;  1AZD A;  2RE9 A;  1C1L A;  1O6U A;  1HB2 A;  2VVD A;  3BOW A;  1RIT A;  1LOF A;  4LLF A;  1RVF 2;  4NHY A;  3WG2 A;  4D8M A;  2QQJ A;  4XJ8 A;  1UL9 A;  2IVI B;  3TEW A;  3VDB A;  2WT1 A;  3K46 A;  1UYX A;  2GZW A;  3QCW A;  4S2G A;  1FNZ A;  4RFT 0;  1VBA 3;  2BQP A;  5EQU A;  1DGW X;  3IPV A;  3VD7 A;  3K51 A;  4AVS A;  2PAM A;  2GH2 A;  5CA6 A;  4LOR A;  3MDP A;  4Q26 A;  4AF9 A;  5LBB A;  2WS9 2;  3DPR B;  4I0A A;  1HDK A;  1IOA A;  1NX9 A;  1TME 1;  3AMM A;  5KHK A;  2PA7 A;  4AVA A;  4LTA A;  3BTA A;  3MLL A;  4GKX A;  5KHJ A;  2P34 A;  1W2O A;  2WII B;  4RQP C;  3FJS A;  4IEO A;  4IND A;  1QOS A;  2CY6 A;  3I4I A;  5FPA A;  2VZT A;  2ETE A;  4M3C B;  2D6M A;  1PNF A;  1W0N A;  2ARB A;  1ZZ9 A;  3ACF A;  5A1F A;  2ZAC A;  3HEI A;  3VDC A;  1GIC A;  1SBD A;  4MHU A;  2YBS A;  1VAL A;  4RR3 C;  1VBB 1;  5DUV A;  1RC6 A;  4QT6 A;  1NA1 C;  3LKJ A;  1W0O A;  2OUH A;  1F4H A;  1W28 A;  3DUI A;  1JHN A;  1QKQ A;  4XFA A;  1H2L A;  4P9G A;  3TEZ A;  3UJO A;  3WP4 A;  4BQ3 A;  4QHZ A;  1VPH A;  1S2E A;  4YGD A;  3RI8 A;  3UGF A;  1UZW A;  1PMI A;  3NRU A;  3TYJ A;  2NPI A;  3WUD A;  5CAZ A;  4ZS2 A;  4UFI A;  1NE4 A;  1WD4 A;  3VBS B;  1QJY 3;  4CDQ B;  2AGS A;  4FTB A;  1W6O A;  2W08 A;  3RZJ A;  3BOD A;  4HN0 A;  3D0J A;  4CEY B;  4FAG A;  4URA A;  4W50 A;  2XLA A;  5D8A B;  1W0P A;  4TSV A;  2J1T A;  5FP8 A;  3ZIX A;  4AEJ A;  1ONA A;  3PVO A;  4CDW C;  4PJY A;  1YFY A;  1VMJ A;  1KDK A;  5DAP A;  5F5A A;  4CEW B;  5DN2 A;  3TB0 A;  3ZSL A;  4B4P A;  4YWA A;  5J09 A;  3KVB A;  1NYW A;  2E31 A;  3POW A;  1Z78 A;  4QXB A;  1CAU B;  4K20 A;  1JH5 A;  1MAC A;  3NNJ A;  1FPN 2;  1UU4 A;  1NCQ A;  2UUR A;  2VY0 A;  1F9K A;  4NWW A;  4Q0U A;  3ZSK A;  3B9C A;  1ZRF A;  1LHW A;  2EXK A;  1OLQ A;  3MFA A;  5E1R A;  3WD5 A;  1PGL 2;  2Q0A A;  1GUI A;  3UKT A;  4DUX A;  1PIV 3;  1PO2 3;  1OVS A;  1VBE 2;  2Y8K A;  3UET A;  4NID A;  1JZ4 A;  4XBL A;  2D5H A;  4FPE A;  3TN9 1;  4LE4 A;  4GWJ A;  5FZH A;  3CNA A;  4UAP A;  2OZJ A;  1OBN A;  4MSV A;  4UFL A;  3W5N A;  2VU9 A;  2ZOE B;  4CCD A;  3LDB A;  1ZZB A;  4H55 A;  5FY5 A;  4AED C;  4QX0 A;  2FDH A;  3O12 A;  1WLW A;  5BNN B;  5CFD B;  5J37 A;  5FYC A;  1WBL A;  4RHV 3;  1CQ9 A;  4X8P A;  1U5Z A;  3KT7 A;  4FP2 A;  1K3I A;  2WJS A;  4GWM A;  3CJI B;  4AW7 A;  4N53 B;  2RS1 2;  1DFQ A;  4FT8 A;  1QXR A;  4NMI A;  2DUQ A;  1SLC A;  3M3Q A;  4LKE A;  2Y6K A;  2VUA A;  1Z7S 1;  3L9J T;  1QXJ A;  1U5I A;  5FO7 B;  2PMW B;  3EXU A;  4GB3 2;  3THT A;  1DQ1 A;  4Y1V A;  2QQI A;  2VZO A;  5CFC C;  5JWP A;  1HN1 A;  4MOA A;  3LA3 A;  3AL5 A;  1COV 3;  1KFX L;  3P3N A;  4AVT A;  2R30 A;  2XR4 A;  3HIF A;  4LOT A;  4ATE A;  2HLE A;  3PJQ A;  4PBP A;  5I0S A;  3VD4 A;  3I2F A;  2ES3 A;  2R04 3;  4OMC A;  3OGG A;  1BVP 1;  1GZT A;  3VKF C;  3ZN6 A;  4G3Y C;  1R09 3;  4Q27 A;  4UFJ A;  1ZZC A;  1WMF A;  5G04 L;  1ZBA 3;  3S7I A;  2TBV A;  2ZHM A;  3I59 B;  4HVO A;  4ATF A;  5GAL A;  1G9B A;  1PHM A;  4ZPI A;  4AHY A;  3H8U A;  4YRD A;  2VJX A;  1YQC A;  1VAV A;  4FOW A;  4LBQ A;  5IVV A;  3I49 A;  4IV1 C;  1CJD A;  3R4S A;  3CO2 A;  4IE7 A;  4IW3 A;  3S0M A;  4XIK A;  5IUQ A;  5FZ0 A;  1US3 A;  3SC7 X;  1V6N A;  2HWB 1;  1YQ5 A;  3AC0 A;  3USU A;  1JYX A;  5DXD A;  1JXN A;  4XZU G;  1H2M A;  4XJ9 A;  2QQN A;  4XJW A;  4CDX B;  3SHR A;  4YG3 A;  2VE1 A;  4YFZ A;  4BQY A;  3LOB A;  4NJ4 A;  3HBK A;  5FMD A;  5FZA A;  3MHZ A;  3DKW A;  1CIW A;  4NPM A;  5C5U A;  2OYZ A;  2YXS A;  4LE3 A;  1DQ4 A;  1VBA 2;  3U07 A;  4Q8L A;  4AQT A;  5FP9 A;  3ZXK A;  2YZ4 A;  1UZY A;  1JZ5 A;  2ARA A;  4KWL A;  4JCK A;  4A7K A;  1AR6 2;  2PFW A;  2GMM A;  1FMD 2;  1VBC 1;  1H2K A;  3H9A A;  5I0U A;  5C9A A;  2RDN A;  1RIN A;  5JIU A;  1HKD A;  1OUX A;  2E9Q A;  2V72 A;  4B1M A;  3ZDS A;  4AQS A;  3NQH A;  4YYO A;  2IUW A;  4NRP A;  5LA2 A;  3BYW A;  5FZE A;  4B4R A;  4FFG A;  4GQ7 A;  1AR9 1;  4AVB A;  4QDR A;  1G9F A;  3UGG A;  4DS0 A;  2OUJ A;  5L9R A;  3U10 A;  3KWV A;  5EYX A;  4ZU5 A;  1R08 3;  1GU3 A;  4XDP A;  3K4Z A;  1RXG A;  5I0T A;  1YUD A;  3N9Q A;  3H7Y A;  1X9T A;  5A7O A;  4LHK A;  4BIS A;  3T4V A;  1JMU B;  2GC2 A;  2JKX A;  4AL9 A;  2EID A;  4C1X A;  2WO1 A;  1QJY 2;  2WYF A;  4XTM A;  2JG9 A;  2VQA A;  3UKV A;  2Q5T A;  4QKD A;  2BBA A;  5C4W B;  4QX7 A;  3FFZ A;  5FY7 A;  3MIC A;  3AYA A;  2BEO A;  2BVB A;  2DCT A;  3H3U A;  5LCW L;  2WZR 3;  1LEN A;  2ZGO A;  2BZD A;  4MGZ E;  4XF9 A;  1HXS 1;  4J6G A;  4HVQ A;  1ENQ A;  4YW6 A;  2ARE A;  5FZ3 A;  4CP0 A;  3GBG A;  3WG4 A;  5G05 L;  5FUN A;  4PF5 A;  4FQZ A;  3TEY A;  5GLT A;  2P3J A;  2A3W A;  3ZSE A;  3APB A;  5LZ6 A;  3JBG 1;  3BAL A;  5FYV A;  4YVS A;  1PIV 2;  1PZ8 A;  3H1Y A;  3VBF B;  1W06 A;  1IS5 A;  4OCT A;  3CEW A;  4RL7 A;  5T52 A;  4GIQ A;  1S55 A;  2YU1 A;  4QHO A;  4MG2 A;  5J7M A;  1VBD 3;  1KIT A;  4LK6 A;  3KV9 A;  5BNO C;  1UW8 A;  1KXG A;  1W04 A;  1N3P A;  1OD3 A;  2H0V A;  4Q4V 2;  1RHI 3;  4YVW B;  3MUZ 1;  4LA2 A;  4YSF A;  1UD1 A;  3I8T A;  3EBR A;  4PIX A;  5FJH A;  5C8C C;  3DL3 A;  4WZF A;  1O4T A;  2G19 A;  4RHV 2;  2Y6F A;  4A42 A;  2XHN A;  1WA4 A;  3LCP A;  4V2W A;  4N43 A;  4BCU A;  3IPV B;  5JR2 A;  5A3L A;  1V6O A;  4Y4Y A;  1EUT A;  4OHX A;  5JAX A;  4GMP 0;  1SEF A;  1YNA A;  1AF9 A;  3KSC A;  3O0X A;  4HK9 A;  1RIR A;  4RR3 B;  1UKG A;  1UN1 A;  1V6K A;  4Y5Z 0;  1K5M A;  1LOC A;  2ZZJ A;  1NA1 B;  2FZ1 A;  4D6S A;  1BBT 2;  1C4R A;  4SBV A;  3QAC A;  5DAQ A;  5IVF A;  5ERL A;  2R7E B;  3L2H A;  2O1Q A;  3HQR A;  2W1W A;  1BYH A;  2VQT A;  4QU1 A;  4YGC A;  2YPJ A;  3UES A;  1O8S A;  1QF3 A;  1SAC A;  2WWS A;  1COV 2;  4HBN A;  4R4Z A;  4OHZ A;  4GH4 B;  4COU A;  4DIQ A;  2AAC A;  1UOJ A;  1ENR A;  2R04 2;  3KLS A;  3N35 A;  4CUA A;  1MS1 A;  5IWF A;  4C90 A;  2BYV E;  1ZBA 2;  2HEV F;  2JDK A;  3I3B A;  2UU8 A;  2QTW B;  3AXE A;  3U4X A;  4FBF A;  4AHZ A;  5C8C B;  1REF A;  2RMU 1;  3OD0 A;  2C9A A;  4QPG C;  4B7E A;  5FJK A;  2RR1 1;  3I3Q A;  4FCA A;  1RED A;  5FXZ A;  1J3R A;  4CDW B;  5FXW A;  1ND3 A;  3N36 A;  1W6O B;  3ZIW A;  2ZX3 A;  4OHW A;  5BNP C;  1OFN A;  5FQ0 A;  1ZX5 A;  2RS3 1;  1BMV 2;  3KZ4 C;  4LKS A;  3MPP G;  5CU1 A;  2VG9 A;  3ECQ A;  2DCZ A;  5BUV A;  5FMB A;  2TNF A;  2NLR A;  1ZBE 1;  1F31 A;  4D3W A;  1DU3 D;  4AR2 A;  3I7D A;  2NZ9 A;  2XJR A;  1C8N A;  1HQW A;  3RSJ A;  5FZD A;  3ILR A;  3ZXF A;  5L7O C;  4UXA A;  2D40 A;  4QM8 A;  4ARX A;  1ZRE A;  1NCQ B;  3VZO A;  2ZBJ A;  1HV0 A;  1XPW A;  1GWM A;  1R1A 1;  2DVD A;  2P6H A;  1QJE A;  1EAH 1;  1QQP 3;  3PNA A;  3RQ0 A;  2VGD A;  1ULE A;  2QNK A;  2PLV 1;  1MS3 A;  2WNV A;  2WFF 1;  2WZE A;  3OB8 A;  5FMO S;  2GAL A;  3IMN A;  3AKT A;  3GF6 A;  2F4P A;  4AED B;  3MIG A;  5IT6 A;  1GYK A;  4JGZ A;  2E63 A;  3UJQ A;  5GZC A;  5T55 A;  3JD7 2;  4MGS A;  1H1I A;  5GLW A;  2VMH A;  2Z69 A;  2NP0 A;  1YFU A;  1ZVF A;  3KB5 A;  2A6X A;  5JCT A;  5F7U A;  1NCR A;  1H4G A;  3K4D A;  3MEP A;  3MIB A;  2E33 A;  4JHZ A;  2DYC A;  5A7Q A;  3PMS A;  3T0A A;  3PHM A;  2EAK A;  3WCR A;  5JMO A;  1MZ6 A;  4NHK A;  3JXS A;  1S0D A;  3NV4 A;  3AB0 A;  5FZ4 A;  2PYT A;  3VD5 A;  3T09 A;  1UKR A;  1A34 A;  1PGW 2;  2VZ3 A;  5A7N A;  5J36 A;  1UOG A;  2IXK A;  2XJQ A;  3SCG A;  4XW3 A;  5CFC B;  5FBJ A;  4BMB A;  4IXL A;  1CN1 A;  1YQ6 A;  2YC0 A;  5LBF A;  4B4Q A;  2XUM A;  3BB6 A;  3BGA A;  1WCK A;  5FZG A;  2JXA A;  3VBR A;  2DFC A;  3LEG A;  4ONU A;  4QGM A;  5DUW A;  3ZFG A;  2FDK A;  4NHL A;  1IKQ A;  4FFF A;  4XOG A;  3Q8A A;  3V0A A;  5FZO A;  3HMY A;  2XG3 A;  3ZXJ A;  2IVJ A;  1W9W A;  2WNU A;  4MGI E;  2VXR A;  4PHZ A;  4XEZ A;  3ZMN A;  5LW9 A;  1GKB A;  2R16 A;  2RS5 1;  1CD3 G;  1MZE A;  2HWF 3;  2ZAH A;  1L3J A;  4CUG A;  1N3O A;  2LAL A;  1KFU L;  4HZF A;  4QPI B;  1DGL A;  1YC6 1;  3BIW E;  5A3O A;  4LNV A;  2ZEW A;  2YY1 A;  3O14 A;  2DVB A;  1ST8 A;  4BHP A;  3MLJ A;  2QE3 A;  4LBL A;  4UFH A;  5HPO A;  4I3P A;  4FPG A;  1RUG 3;  2QDR A;  4J25 A;  5JZG C;  5FIX A;  3IDB B;  1IPK A;  1TE1 B;  1PO1 3;  1Y9M A;  2PQS A;  3AM2 A;  2QQK A;  3DPR A;  2PAK A;  4Y3O A;  2B4K A;  3SMH A;  3VKM A;  3VBH C;  1XRU A;  5JXI A;  1YQ8 A;  2P1B A;  1Q56 A;  5K0U A;  4M3C A;  1BCX A;  1DF0 A;  1RUI 3;  2VTX A;  4IE5 A;  4A44 A;  2Y0I A;  1CIY A;  1QJZ A;  1Q3E A;  1WW6 A;  2GP3 A;  2PHX A;  5DPN A;  1SLL A;  4HOO A;  4OHV A;  5IVE A;  1UZV A;  2AEZ A;  3WP3 A;  1FNY A;  2P2K A;  1W05 A;  5JI7 A;  2ORX A;  3LIH A;  4OI0 A;  4SLI A;  5DDJ 1;  1D0H A;  2WN2 A;  4XQD A;  1T6B X;  4L92 A;  5HCF A;  2GC0 A;  5C9A B;  1YLL A;  4BQ5 A;  2W39 A;  5IVB A;  1B35 C;  4FTS A;  4S2F A;  1LEC A;  1D4M 1;  5FLJ A;  5FYT A;  4HMZ A;  2WQZ C;  3OEA A;  1OH3 A;  1QY4 A;  4CDQ A;  1ALY A;  3CKH A;  4OI1 A;  2EF6 A;  4B29 A;  1LOG A;  2EIE A;  3ZXA C;  5IK8 A;  4IGO A;  4FPL A;  4CEY A;  1CAW B;  2VH9 A;  2QUO A;  4JHT A;  2LUW A;  3I2G A;  1LHO A;  5L73 A;  5J96 B;  5JPM B;  3AYE A;  4Y1U A;  5FY9 A;  4FOQ A;  3AK0 A;  1W39 A;  2W94 A;  3J8F 3;  4CEW A;  3VZK A;  5F32 A;  5A7P A;  5JSP A;  2DU0 A;  3NV1 A;  3V0B B;  4QQH A;  1CAU A;  1XC6 A;  4A41 A;  4K21 A;  3JZV A;  1AX0 A;  3H3Z A;  1J83 A;  1W2U A;  2W1Q A;  4CCM A;  3VL8 A;  3T30 A;  3WNK A;  3VL9 A;  1RMU 1;  2OPW A;  4Q0P A;  1A6C A;  2XLG A;  1RUF 3;  2R06 1;  5HI0 A;  1NAE A;  1XSQ A;  2DCK A;  3AMH A;  5A32 A;  3EJK A;  2BVV A;  1DQ0 A;  2EIB A;  4ZZ5 A;  3WUC A;  4R52 A;  3Q9O A;  3EHK A;  5IVJ A;  1S0B A;  2W5F A;  3LA7 A;  4EN0 A;  4YZ3 A;  3O0V A;  1XYO A;  1IS6 A;  4K6B A;  5FO8 B;  5LB6 A;  5FPB A;  5CFD A;  5CNA A;  2VD7 A;  2J1V A;  3I3E A;  5BNN A;  2QBX A;  5JOX A;  4BPZ A;  5CB7 A;  1LJ7 A;  1RUE 1;  2GC3 A;  1W2T A;  3P6B A;  2X29 A;  4RFR B;  4BIF A;  1OPO A;  5ABJ B;  3RZG A;  5BNO B;  4NAO A;  2JEM A;  3KV4 A;  2XBO 2;  5E8A A;  2WS9 3;  5FTT C;  5H9S A;  2F17 A;  3K48 A;  1RUJ 1;  4WM8 C;  1WCU A;  4ET7 A;  1MEC 1;  4ZZ8 A;  4P9Y A;  4E2Q A;  3O1V A;  5BPX A;  3HJR A;  3WHT A;  3IAQ A;  3MUY 1;  1VIW B;  3WF0 A;  2A6Z A;  3FC0 A;  1ACC A;  3ZYR A;  1RXF A;  4OZX A;  3N9P A;  1JOD A;  2VW0 A;  3URF A;  2QKD A;  1WCQ A;  4MGK E;  3UGH A;  2QQL A;  3HPN A;  3FX3 A;  1RUD 1;  1ND2 C;  1LOB A;  1MQT B;  1H9W A;  1Y9Q A;  2VUJ A;  3LAG A;  5F5I A;  4GMP 3;  3WW4 A;  4DOU A;  1DDL A;  2ZA9 A;  3I3M A;  1DGW A;  4EJR A;  1EPZ A;  4YW7 A;  4EN8 B;  1W2N A;  5A6Z A;  3INA A;  3O0W A;  1JOB A;  1JW6 A;  1U12 A;  2VBB A;  2DU1 A;  4FOV A;  5CKQ A;  1O3R A;  1JHJ A;  3MIE A;  1OOP C;  1UU6 A;  1WGP A;  1FX5 A;  3J7M A;  3MFC A;  2Q4S A;  2E7A A;  4XFB A;  1UIJ A;  4RD7 A;  2Q8C A;  1VBC 3;  5F9T A;  2WO7 A;  3AKR A;  1SMV A;  2MEV 3;  4AFB A;  2Y6L A;  4R9C A;  1TG7 A;  3WNM A;  2EXH A;  1OD5 A;  1WA6 X;  4HSJ A;  4CDU C;  2AUY A;  1I9R A;  2YGL A;  3E97 A;  3PVB B;  1UO9 A;  3RDI A;  4WVM B;  1ULD A;  3VZM A;  1JZ8 A;  1VE0 A;  4CDX A;  1Y4W A;  3ZFE C;  5A1A A;  2XGX A;  3M4F A;  3NST A;  3WNO A;  1J3Q A;  4IEX A;  2VQU A;  1BVV A;  1QDO A;  4M4P A;  1O3Q A;  3ILN A;  4GWI A;  3VKL A;  2ILM A;  5LK5 A;  5BNP B;  4IDZ A;  5KC6 A;  1FOD 3;  3LSD A;  1OC1 A;  3FFQ A;  1RUG 2;  2DUO A;  3WF3 A;  1IHM A;  1UPI A;  5JSO A;  4D6R A;  4B1L A;  3SKV A;  2TUN A;  2IFR A;  4IES A;  3VGI A;  4CXY A;  2OKX A;  2ERF A;  1UCX A;  3O1M A;  3VHP A;  3BIE A;  1ZZ6 A;  2Q1M A;  4IEZ A;  1UY4 A;  2PHW A;  1ZNP A;  1IPJ A;  5L7O B;  2BNM A;  4UT5 A;  1HRI 1;  5FPZ A;  2WSU A;  3K77 A;  4AHW A;  3GBF A;  1RUI 2;  4QX5 A;  3U37 A;  1REE A;  3O1T A;  1AUY A;  4M3C E;  4Q29 A;  1V6L A;  4YM2 A;  4D7Y A;  5A33 B;  4K8R B;  3WY6 A;  1I1E A;  3OUJ A;  2L9L A;  4X6Q B;  4AFD A;  1AYN 1;  2D7F A;  1E57 A;  5E16 A;  1G86 A;  5JXG A;  1HRV 1;  2ZGM A;  2E32 A;  4ITC A;  5AFE A;  4FOY A;  4QD2 A;  4JC1 A;  4XFC A;  3WHU A;  2BP6 A;  2B8M A;  4E8C A;  3CLP A;  2WNV B;  1LOE A;  3W21 A;  1F2N A;  4YW3 A;  4L0P A;  4XCB A;  4Z07 A;  4ZS3 A;  4DIN B;  2P3K A;  1GQH A;  1Q43 A;  1JYV A;  4GB3 3;  4L11 A;  2UY9 A;  2UYA A;  2VNR A;  1MVQ A;  3KT4 A;  4BQ2 A;  4LIU A;  4EZH A;  3HN3 A;  3OYW A;  1W8W A;  5C4W A;  1H1M A;  2MPF A;  4XDO A;  5JOY A;  2R32 A;  1SLI A;  3AZV A;  1PGS A;  2O0O A;  3PIJ A;  2HWE 1;  3KQ4 B;  1S4C A;  3TNQ A;  5KXB A;  2TEP A;  2WNE A;  3NJV A;  1VMH A;  4IL7 A;  2PN5 A;  4L97 A;  2C6S A;  1FAT A;  3HQX A;  4XAE A;  4IEV A;  3EB7 A;  5C3R A;  1O7F A;  4JGY C;  1QEX A;  1WLC A;  3B7M A;  3LFM A;  4MET A;  3TOJ A;  3OCP A;  3QOP A;  3T2O A;  4XVH A;  3WNP A;  2RJ2 A;  1GNH A;  3ZX7 A;  1T6G C;  2YUE A;  2KXL A;  3JB4 C;  3VKO A;  1IQD C;  1HJF A;  4Y1X A;  2BPA 2;  3C8X A;  3BI3 A;  1RUF 2;  3AP6 A;  4NE9 A;  1POQ A;  4Y24 A;  1PM4 A;  1JU4 A;  5FZO B;  3VBF A;  3P3P A;  3KHC A;  1OXC A;  2NMO A;  4Y4R A;  1SBF A;  2CDO A;  3GNE A;  1DYO A;  3ACI A;  2K9Z A;  3M70 A;  5CYY A;  1W3X A;  4HVR A;  4LQR A;  2ZX2 A;  5LBE A;  1J59 A;  5KBF A;  1AJO A;  5JZG B;  4GJZ A;  5FYY A;  1EP0 A;  4X6R B;  4LOS A;  5F3G A;  4NIH A;  4UFK A;  4OLL A;  1QOT A;  3VBH B;  4PI2 A;  1BHG A;  4D0Q A;  2ZHN A;  2C24 A;  1QOO A;  2WA4 A;  3ETQ A;  2Y34 A;  4CA9 A;  1AR6 3;  4K1Y A;  2RR1 3;  1FMD 3;  2O14 A;  5ANN A;  4RR3 A;  3MPB A;  4BQW A;  2ZEZ A;  5GLV A;  3IM0 A;  4UWD A;  3I54 A;  1NA1 A;  5K0U B;  3FLP A;  4LLO A;  3AXD A;  5JIA A;  2VW1 A;  2C0Z A;  2YC2 A;  4EZ4 A;  1C1F A;  3EQE A;  1AXZ A;  1H6Y A;  5EJZ B;  4PF1 A;  4KQ7 A;  5F6L B;  2YG0 A;  3SCH A;  4GH4 A;  4GXL A;  5C3Q A;  4B3N A;  1KGY A;  3MF6 A;  1B35 B;  5LEJ A;  1LOF C;  1ASJ 3;  4W4Z A;  2VNV A;  5KHH A;  1R1A 3;  2ZGU A;  1W8F A;  1GP6 A;  3AMN A;  4XPV A;  5GZE A;  3SLI A;  4MYE A;  2RJK A;  3R05 A;  5F3I A;  3W20 A;  1TZO A;  1SFP A;  5EHD A;  1BEV 1;  1VBC 2;  4XCA A;  3ZM8 A;  1KRI A;  2J1R A;  4XHB A;  2MEV 2;  3J7H A;  4P5Y A;  1V0A A;  2ZPX A;  3N9N A;  1KS5 A;  3PUQ A;  5H9R A;  1UYZ A;  1NY7 1;  4CDW A;  2QVS B;  4DXS A;  4CE8 A;  4Q4W 3;  2GP5 A;  2ZAA A;  4GAL A;  1LTE A;  2ARC A;  5GKA C;  4MGT A;  3KF3 A;  4Q0V A;  1QJU 1;  4FPH A;  2A75 A;  1AR9 2;  3U14 A;  4O9G A;  3M8L A;  3WQB A;  1QJX 1;  1R64 A;  4I3G A;  3UK9 A;  1EV1 1;  3RZM A;  3IMM A;  1AR7 1;  2DVG A;  1H9P A;  3FWE A;  4Q1R A;  1R1Z A;  4OQ8 A;  5C3O A;  1WW7 A;  3GAL A;  4P9J A;  1UXX X;  3CHX A;  1FOD 2;  3NJZ A;  3MW4 A;  2R1B A;  2D6N A;  2XL7 A;  3B02 A;  3M3E A;  1LUL A;  2BFU L;  2VMF A;  1DQ5 A;  4M0H A;  4QKN A;  3WZ1 A;  1AYM 1;  2Q1F A;  1GZW B;  1DZT A;  1G7Y A;  4FI9 A;  4NN0 A;  5T3N A;  2O8O A;  5A32 B;  2ZX0 A;  4AED A;  3LD8 A;  5ACA 1;  4OFG A;  1D2Q A;  4RS5 C;  4CUC A;  1BK1 A;  4FPK A;  3F95 A;  1W8Z A;  4Q4V 3;  2WA3 A;  1W6N B;  3KHB A;  3GHM A;  3M2M A;  1OA4 A;  2K2S A;  4MO3 M;  3ZXD A;  1JS9 A;  2VAU A;  2MNG A;  4D6Q A;  4DXT A;  1G8W A;  1NZI A;  1X9P A;  2ZEY A;  1PVC 1;  3LB9 A;  4WM8 B;  1G9C A;  1GR3 A;  1HXS 2;  2VC9 A;  3DCQ A;  2ZKN A;  3RVH A;  5KC5 A;  2YYO A;  4D7T A;  2C4X A;  1G6N A;  2JE9 A;  2VZQ A;  2WBK A;  4IEW A;  5FYB A;  1LKN A;  1NQD A;  4COV A;  2XJU A;  3C7F A;  3JBG 2;  1E5I A;  2RJL A;  3OF1 A;  2B5H A;  2BFU S;  3WEZ A;  2AR6 A;  3D8C A;  5CFC A;  4H3W A;  4LBQ D;  3ZYI B;  1ND2 B;  2JDM A;  5GZG A;  2WN3 A;  3VZL A;  3GZE A;  3WNL A;  1XOY A;  5IYY A;  1W3V A;  4BDV B;  2QQM A;  1YFW A;  1BBT 3;  4XAB A;  1GFF 2;  1WMX A;  2D6K A;  1LU2 A;  3OGR A;  3Q8F A;  5F2W A;  2E7T A;  3GZA A;  2NM1 A;  4OHY A;  4P5H A;  3KGZ A;  4NAM A;  3CQO A;  1D4V B;  3WQ1 A;  4K7J A;  2EA7 A;  3U78 A;  1OOP B;  2ZX4 A;  3HR9 A;  5KR7 A;  2D3R A;  4IGP A;  5FMC A;  2D44 A;  1J58 A;  3POJ A;  4H7M A;  1C8M 1;  3N9O A;  1NXD 1;  4BK5 A;  2N7G A;  5FK8 A;  2BTV C;  4TYS A;  5FYI A;  4QPI A;  2I07 B;  4XFH A;  4AVV A;  1GP5 A;  4KI5 M;  2G9G A;  2VEC A;  1POV 1;  1V00 A;  3VZN A;  4GAZ A;  4CDU B;  1JOJ A;  1H2N A;  3PVN A;  2JIG A;  1X33 A;  3TAY A;  1UYP A;  4EWE A;  2GH8 A;  2WLQ A;  1US2 A;  3J9S A;  1JYW A;  3ZFE B;  5J98 B;  3BTX A;  4B8E A;  2V5Y A;  4DB5 A;  4COW A;  1D7P M;  2VO5 A;  1V9U 3;  5F8P A;  5HCB A;  4XQ4 A;  3SEE A;  4LHL A;  2IXI A;  3CL1 A;  3T2T A;  4BWO A;  2HWC 1;  2VR4 A;  4CUB A;  1RVF 1;  2BW8 A;  3EO6 A;  3VZJ A;  3ZOI A;  1RJ8 A;  2K46 A;  4CVU A;  3AL6 A;  5B2G B;  4PCR A;  2VZV A;  3ALQ A;  1CES A;  3FLT A;  3U0Z A;  5D1I A;  4AI9 A;  1EPW A;  4RYD A;  3ZSM A;  3WOG A;  3DN7 A;  4AZZ A;  5CIS A;  2Y6G A;  2W92 A;  4XXA A;  3VUO A;  2V4V A;  2KR2 A;  2WWJ A;  5ANQ A;  1RUH 1;  4AI8 A;  3NV2 A;  5K7P A;  1VRH 3;  5JPN B;  2J1A A;  2RR1 2;  5CIR A;  1GZC A;  1RUC 1;  1AJK A;  4NHM A;  4OUM A;  2KM2 A;  2VCB A;  4FPO B;  3T3Y A;  4LIV A;  1H8T C;  2RS3 2;  3JD7 3;  4NRM A;  3PJY A;  2HYX A;  3KV5 A;  5F6K A;  5JXJ A;  4BQ1 A;  5K8S A;  3OBT A;  4CP9 B;  5IAT A;  3POG A;  1NLS A;  3E5U A;  3C7G A;  1XNT A;  1CAW A;  1WKY A;  1AX1 A;  1S1A A;  2WL1 A;  4U2A A;  5JOW A;  3FBY A;  3LFI A;  2XQX A;  1GLH A;  1AXK A;  3HT2 A;  1HQL A;  4JDN A;  1RUE 3;  4O61 A;  1ASJ 2;  2ZCW A;  1Y3T A;  2WFP A;  4IV3 C;  1VAK A;  1PVX A;  1R1A 2;  4KNC A;  1E5S A;  2XL9 A;  3NAP C;  2Q8E A;  3RWK X;  1CAV B;  4YPJ A;  2JEC A;  3SH3 A;  3V0B A;  2CYF A;  2P5B A;  5FZL A;  2DV9 A;  2W2I A;  1WW5 A;  3RFR A;  4Q4Y 1;  1JZ3 A;  3HNM A;  2WZ8 A;  5C7G A;  1HQN A;  2P4E A;  3ACH A;  2NYY A;  5FAX A;  1MS9 A;  1ZRC A;  3LOI A;  2RM2 1;  2JWP A;  4Q4W 2;  3OYW B;  2KA3 A;  5GM0 A;  1O3S A;  4JGY B;  2IXJ A;  5FZC A;  5EWS A;  1OI6 A;  3O1U A;  3ASI A;  5IAV A;  5SV5 A;  3RG0 A;  4AFA A;  4OUE A;  1FPN 1;  4ZY9 A;  4XF3 A;  1GP4 A;  3TWI A;  1YFX A;  2A3X A;  3QD6 A;  4L2N A;  3VDD C;  3LZZ A;  1DP0 A;  2DTW A;  3TRS B;  3E6B A;  3WDY A;  1FI2 A;  2J22 A;  1UAI A;  1VBE 1;  3R0R A;  1V6J A;  2R1D A;  5ABJ A;  4DEV A;  1W90 A;  5BNO A;  5FPU A;  1UOF A;  4JDO A;  3AFK A;  5HV4 A;  5IK5 A;  2OXB A;  3IWZ A;  5H9P A;  1HJG A;  1HN0 A;  4NII A;  5C8C A;  1UIK A;  4ES9 A;  4OI2 A;  4Y22 B;  4E4H A;  3ST7 A;  5BV6 A;  3C2U A;  4A3X A;  1XNB A;  2XML A;  2VVE A;  3N4M A;  2JG9 C;  2RS5 2;  2XJT A;  3KT1 A;  5F37 A;  1YWK A;  2Y26 A;  2ADD A;  4XFF A;  4CTE A;  1QNW A;  2A3Y A;  3BPS A;  3DXU A;  1CR7 A;  1MQT A;  4CCO A;  3OPZ A;  4O65 A;  4MXW B;  3B69 A;  3I3D A;  3VHR A;  2RS1 1;  4RQP B;  4CCL A;  3RZL A;  2VZR A;  2WRA A;  5FYZ A;  2E51 A;  2WDB A;  5CBL A;  4E2S A;  1DZR A;  3GGL A;  3OGV A;  1WBF A;  4FP3 A;  5FZ6 A;  3ZMO A;  3IIA A;  5B4X A;  1XU1 A;  2R07 3;  3VBU C;  4Q4X 1;  1O59 A;  4XFI A;  3RMY A;  2PQQ A;  4A45 A;  4CXX A;  3WVJ A;  1OUS A;  5KHI A;  4NUB A;  2HBU A;  2WAB A;  2BNO A;  1W8T A;  3H1W A;  2DVF A;  1OHF A;  5HXM A;  1HRI 3;  5JMC A;  3BTY A;  5A3W A;  2FDI A;  4Y5S A;  2B45 X;  4WM7 C;  1AR8 1;  4CPB A;  4ZU7 A;  4TXW A;  2VOW A;  1J1T A;  3ENR A;  2F6B A;  2K0G A;  2VUL A;  3AP7 A;  3W5M A;  1H1A A;  4WVM A;  5GLU A;  5F39 A;  4Q2F A;  5D2A A;  4UF0 B;  1L7L A;  1QIQ A;  1XYN A;  4KWU A;  4QPG A;  4Q8K A;  1ODN A;  2HKX A;  2FD8 A;  4LKF A; 
#chains in the Genus database with same CATH homology
 1I5P A;  3IAP A;  2VME A;  2X05 A;  2C9K A;  5JUV A;  2W94 A;  1SG3 A;  2CDP A;  4BJ0 A;  2Z4F A;  4JKM A;  1K12 A;  3VD9 A;  1XC6 A;  4A41 A;  3K4A A;  3T0D A;  1J83 A;  1GNY A;  2WAO A;  2W1Q A;  3WNK A;  1J84 A;  4OMD A;  1NAE A;  1CZV A;  2DCK A;  2DDU A;  2EIB A;  4ZZ5 A;  2J7M A;  3LEI A;  3C7O A;  2VMC A;  2WUH A;  2W5F A;  1RYY A;  4QDS A;  1PMJ X;  3WF2 A;  3T2P A;  2RVA A;  2ORZ A;  2J1V A;  3I3E A;  3LPG A;  2QBX A;  4D8M A;  1NUK A;  1W99 A;  2QQJ A;  3P6B A;  1JYN A;  3NJX A;  4UI9 L;  3VDB A;  3K46 A;  1UYX A;  1JU3 A;  4ET7 A;  4ZZ8 A;  3VD7 A;  5LA1 A;  3HJR A;  3IAQ A;  3MUY 1;  3WF0 A;  1NX9 A;  2VMD A;  3ETP A;  2W91 A;  1WCQ A;  2RV9 A;  2QQL A;  2VZT A;  2X09 A;  2ID4 A;  3HPN A;  4JKL A;  1W0N A;  4DXR A;  3ACF A;  3HEI A;  3VDC A;  3OEB A;  1UWW A;  1F4H A;  1PX4 A;  1JHJ A;  3T2Q A;  5DQ0 A;  1SHW B;  3GM8 A;  4A6O A;  3THD A;  2Y6L A;  1TG7 A;  3WNM A;  3I2J A;  3NRU A;  3UNP A;  4P00 B;  3DYM A;  3VD3 A;  2VOT A;  1JZ8 A;  3D3A A;  5A1A A;  4W50 A;  1K42 A;  3WNO A;  2VQU A;  4M4P A;  2J1T A;  4GWI A;  5DN2 A;  4IUG A;  3DEC A;  2E31 A;  3MO4 A;  3WF3 A;  3SKV A;  3FHA A;  2OKX A;  1UY4 A;  1GUI A;  4DUX A;  1H6X A;  3SKJ E;  3DYO A;  2Y8K A;  3UET A;  3K77 A;  3U37 A;  1JZ4 A;  3OBA A;  5CZK A;  4GWJ A;  3E1F 1;  2J1S A;  2L9L A;  2WO2 A;  3BN6 A;  2W1U A;  3HOB A;  4UAP A;  1GOH A;  2YFU A;  2YFZ A;  3W5N A;  5JXG A;  2E32 A;  3EYP A;  4QX0 A;  3MV0 1;  1T2X A;  3WF1 A;  4E8C A;  1F4A A;  3IB3 A;  4L0P A;  1K3I A;  4OYU A;  4QB1 A;  4XUQ A;  4Z2A A;  2W47 A;  1JYV A;  3C7H A;  2VCA A;  2Y6K A;  2QQO A;  2Y64 A;  3HN3 A;  3CZU A;  2QQI A;  2VZO A;  1HN1 A;  1XNA A;  4MOA A;  2ZEX A;  2VM9 A;  4XUR A;  3THC A;  3VD4 A;  4BK4 A;  2HLE A;  3NJV A;  3I2F A;  3EB7 A;  4OMC A;  3WNP A;  3III A;  3T2O A;  5IFT A;  4XVH A;  2RJ2 A;  1OF3 A;  4PT6 A;  5DMY A;  5G04 L;  1IQD C;  4OZO A;  4E8D A;  3C8X A;  1K45 A;  1UMI A;  3DYP A;  1JU4 A;  2JDA A;  1JZ7 A;  2VJX A;  1EUU A;  2CDO A;  1DYO A;  2W9X A;  3ACI A;  2Y6J A;  1US3 A;  3LPF A;  1W8O A;  3AC0 A;  5CYY A;  1GOF A;  4LQR A;  1JYX A;  5JXH A;  4XZU G;  2QQN A;  1CZS A;  1UY3 A;  4LHS A;  3MBW A;  2BGO A;  1BHG A;  1MPX A;  3I97 A;  4D0Q A;  3A22 A;  1UY2 A;  5LA0 A;  3GXU A;  5B4N A;  4M4R A;  1O8P A;  1JZ5 A;  2ZEZ A;  2J1U A;  2YC2 A;  3FHQ A;  4QX2 A;  1H6Y A;  2YB7 A;  5EJZ B;  4PF1 A;  2V72 A;  2YG0 A;  3NQH A;  5LA2 A;  1KGY A;  1UY0 A;  3LQC A;  4QDR A;  4W4Z A;  2VZP A;  2Y6H A;  3LE0 A;  3OGS A;  2VCC A;  3ZM8 A;  1GU3 A;  4QAW A;  3K4Z A;  2J1R A;  4P5Y A;  3J7H A;  5C71 A;  5IHR A;  1P8J A;  4KMQ A;  1ULO A;  1W9T A;  1UYZ A;  4DXS A;  2JKX A;  2X10 A;  2EID A;  2WO1 A;  5J1X A;  2BBA A;  3WQB A;  1R64 A;  2J1E A;  3A23 A;  2EIC A;  1L7Q A;  2VZS A;  5LCW L;  1UXX X;  2YC4 A;  4GZ9 A;  3T08 A;  2BZD A;  4CU6 A;  4PQQ A;  2VMF A;  1JI6 A;  4FI9 A;  5G05 L;  1UYY A;  2LS6 A;  3ABZ A;  2XON A;  3PUI A;  4QDQ A;  4CUC A;  2LW8 A;  4MO3 M;  1ULP A;  4DUV A;  4DXT A;  1OD3 A;  2ZEY A;  3MUZ 1;  2VC9 A;  3HNB M;  5C70 A;  2C4X A;  2WBK A;  2VZQ A;  3K75 B;  4CU7 A;  4A42 A;  2XHN A;  4CU8 A;  1CX1 A;  3HNY M;  3C7F A;  3WEZ A;  5JR2 A;  1EUT A;  3WNN A;  4XUN A;  3T0B A;  2ZXQ A;  2WN3 A;  3WNL A;  4AG4 A;  5IYY A;  1YQ2 A;  4BDV B;  2QQM A;  3PUH A;  1KEX A;  4XUT A;  3LEK A;  3C7E A;  3OGR A;  3CIH A;  1UMH A;  3CZJ A;  4ARY A;  1JZ2 A;  3CQO A;  2R7E B;  5I0D A;  2W1W A;  2VQT A;  3A21 A;  3UES A;  1O8S A;  1UX7 A;  2BER A;  2JE8 A;  4BK5 A;  4XUO A;  5EIY B;  2W87 A;  2XOM A;  4KI5 M;  3I2H A;  1JZ6 A;  2W1S A;  1GQP A;  2WQ8 A;  4CUA A;  3GDB A;  2BGP A;  3I3B A;  1US2 A;  5IJR A;  4MAD A;  2KD7 A;  1JYW A;  3MV1 1;  1D7P M;  2VO5 A;  2B9V A;  3SEE A;  3WSO A;  1PX3 A;  3WF4 A;  2VR4 A;  4CUB A;  4DEQ A;  1OH4 A;  4CVU A;  4LKS A;  4QB6 A;  3I2K A;  3ECQ A;  2VZV A;  4JX0 A;  4JKK A;  4RYD A;  1NKG A;  2Y6G A;  2W92 A;  2V4V A;  3FL7 A;  4ARX A;  3A7Q A;  4DUW A;  1XPW A;  2J1A A;  3I2I A;  3CDZ B;  3F2Z A;  2VCB A;  2WZE A;  3OB8 A;  2HYX A;  5JXJ A;  4A3Z A;  2WO3 A;  3CMG A;  4LPL A;  2VTF A;  4AAX A;  1OT5 A;  2DCJ A;  4MGS A;  3C7G A;  1XNT A;  3ACG A;  1WKY A;  1UY1 A;  5F7U A;  2JD9 A;  2XQX A;  3K4D A;  4JHZ A;  2E33 A;  3T0A A;  1TVG A;  4QPW A;  5JMO A;  3JXS A;  4YPJ A;  2E26 A;  3VD5 A;  3SEP A;  3T09 A;  1JZ3 A;  2VZ3 A;  3HNM A;  2WZ8 A;  4A4A A;  5C7G A;  4TTG A;  1OF4 A;  3ACH A;  3NNG A;  3BGA A;  2C26 A;  3LEG A;  4XUP A;  3OG2 A;  3VDA A;  3P1I A;  1UXZ A;  2VZU A;  1W9W A;  4MGQ A;  1DLC A;  1GOG A;  4P02 B;  4OUE A;  4BXS V;  2W95 A;  2WAA A;  4QX1 A;  4ZY9 A;  2W3J A;  1DP0 A;  1W9S A;  4P08 A;  2J22 A;  2W46 A;  2ZEW A;  1LNS A;  4DEV A;  2VL4 A;  5HPO A;  4W8J A;  1L7R A;  2PQS A;  2QQK A;  2WYS A;  2B4K A;  5JXI A;  2V5D A;  4CU9 A;  4A44 A;  1CIY A;  3I3D A;  4UOJ A;  5DPN A;  4RN5 A;  2VZR A;  1CZT A;  2WDB A;  5IFP A;  3GGL A;  3OGV A;  5B4X A;  1SDD B;  1PMH X;  1O59 A;  2ORX A;  4QX3 A;  4A45 A;  2VZ1 A;  3IDA A;  5EJ1 B;  2WN2 A;  4HG6 B;  2WAB A;  5HXM A;  1UZ0 A;  4TXW A;  3OEA A;  3FN9 A;  3CKH A;  1GMM A;  2EIE A;  3W5M A;  1W8N A;  5FUI A;  4KWU A;  4QB2 A;  4ZXE A;  3I2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...