4ZY9A

X-ray crystal structure of selenomethionine-labelled v110m mutant of chitosan-binding module 1 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
HHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGGIDDITFTARTAKYVRMHGTVRGTPYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase/chitosanase
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
total genus 32
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zy9A00
1JYWA 5JXHA 4ZY9A 3W5NA 4HG6B 4JKLA 4MGSA 3CMGA 4D0QA 2XOMA 2WBKA 4QDRA 2BZDA 2J1VA 1T2XA 3FHQA 5G04L 4BXSV 2X09A 1JZ4A 1UWWA 3OB8A 2WZ8A 4UOJA 1TVGA 4D8MA 4KMQA 4E8CA 3JXSA 4P08A 1CZVA 2VZPA 4JX0A 4A6OA 3ACGA 4ZZ8A 4QDQA 3WF4A 3A21A 4IUGA 3DYMA 2HLEA 3C8XA 2W92A 1W9SA 3THCA 3C7FA 3T0AA 3NRUA 3GGLA 2W91A 2VJXA 5LA0A 2B9VA 1UYYA 4CU6A 2VZVA 2J1AA 3CQOA 3LEIA 3F2ZA 2V5DA 2C9KA 3GDBA 3MO4A 2WDBA 2WO1A 1MPXA 3GXUA 2Y6JA 4A44A 2Y6KA 4E8DA 4BK4A 2QQIA 3T2PA 2Y6LA 3OGSA 1UY4A 2C26A 4TXWA 2VOTA 1UYZA 3HNBM 3I3EA 1GOGA 5EJ1B 3A23A 2ID4A 2E32A 1DLCA 1I5PA 3I2JA 2YC2A 1JU3A 2VTFA 2JKXA 2QQJA 4OZOA 4RYDA 1O8SA 4QX1A 3GM8A 2W1WA 2WZEA 3IAPA 3HNMA 2J1EA 1JYNA 5IFTA 1UZ0A 3FL7A 3WF1A 2L9LA 1UMIA 1YQ2A 1L7QA 1H6XA 2VQTA 3OGVA 1GOHA 4LHSA 1JZ5A 4DUWA 2ZEZA 2Y8KA 2QQOA 3WNOA 3WQBA 3CIHA 1O8PA 5A1AA 1DP0A 2V72A 2VMDA 3C7HA 3SEPA 3K75B 2C4XA 3VDBA 5JXJA 4YPJA 3CKHA 5HPOA 5B4XA 3T2QA 2VZOA 3UETA 3OEAA 4DUXA 2ZEYA 2ZEXA 3HOBA 4MOAA 1TG7A 4XUPA 5C71A 1EUTA 2EIBA 3FN9A 2VZ3A 2ZXQA 2CDPA 5JXIA 4CU9A 1GUIA 1P8JA 2B4KA 4BK5A 3HNYM 4M4RA 4UI9L 1J84A 3K4AA 2QBXA 3NJXA 3I2KA 2Z4FA 3J7HA 4UAPA 2JD9A 3ACFA 3AC0A 4PF1A 2BERA 4TTGA 3A22A 4QB2A 5CYYA 4OMCA 1ULOA 2WO3A 2YG0A 5IFPA 4LPLA 2KD7A 1L7RA 4CUAA 2VQUA 4L0PA 4QX3A 1UY1A 2W95A 2YFUA 4A42A 1XC6A 4A41A 1OF4A 4W50A 3D3AA 3ZM8A 3I2HA 5DPNA 3WNNA 1EUUA 5CZKA 2VCAA 1CX1A 1F4AA 2ZEWA 4DEQA 2RJ2A 3SKJE 2X10A 2VZUA 4A4AA 3VD5A 3LEKA 5I0DA 4PT6A 4XUOA 3OG2A 1F4HA 2WQ8A 4W8JA 1OT5A 1UXZA 2J7MA 4RN5A 5FUIA 3WF2A 4MGQA 4QDSA 2ORZA 2XHNA 1JZ2A 3WNPA 4P5YA 1SHWB 4P02B 2DDUA 3NJVA 2VO5A 5IHRA 1OD3A 4MADA 3CDZB 2Y64A 4QPWA 2WAOA 3IDAA 1W99A 4QB1A 3VD9A 3VD3A 2WUHA 3C7OA 3OGRA 4QX2A 3K46A 3CZJA 1NUKA 2E33A 1UXXX 3MBWA 2R7EB 3LEGA 4AG4A 1OH4A 3HN3A 2W47A 2W5FA 2EIEA 3HEIA 3BGAA 5JUVA 1W0NA 1PMHX 5C7GA 5G05L 4XVHA 2XQXA 3NNGA 1W9WA 2BGPA 1W9TA 1DYOA 2JDAA 1UMHA 3I2FA 3SKVA 3C7EA 4QAWA 3LE0A 3MUY1 4DXSA 1US2A 5DQ0A 3I2GA 4LKSA 4KI5M 1UYXA 2W1QA 3ETPA 3FHAA 1NAEA 3C7GA 3LPGA 2RVAA 1J83A 2VC9A 2BGOA 4BJ0A 4CU7A 3EYPA 1NKGA 2Y6HA 4XUNA 3WSOA 3VD4A 3I3DA 4GWJA 3WNMA 2VCBA 5JXGA 4ARYA 1WCQA 1JZ8A 2WN3A 5JMOA 3BN6A 1JZ3A 1PMJX 1GQPA 3WF3A 4Z2AA 5IYYA 2J1RA 5JR2A 3VD7A 1GOFA 4BDVB 1D7PM 1JYXA 3WNKA 3PUIA 5EIYB 4XUQA 5EJZB 4OYUA 4LQRA 1BHGA 2RV9A 2QQMA 1LNSA 3IB3A 4GZ9A 4JKMA 1US3A 3DYOA 1JYVA 5LCWL 1SG3A 2PQSA 2QQKA 1PX4A 2V4VA 1GNYA 1JHJA 4XUTA 3IIIA 1RYYA 3MV01 3A7QA 2DCKA 3K4ZA 4DXRA 4P00B 2W94A 5HXMA 3LQCA 3ABZA 4OUEA 2VCCA 2YFZA 2BBAA 3I2IA 4CUBA 3I3BA 3K4DA 3UESA 1IQDC 1XNTA 1NX9A 3IAQA 1JZ6A 4XZUG 2VZRA 1R64A 4KWUA 2DCJA 4M4PA 2X05A 4DXTA 1JZ7A 1SDDB 2W9XA 3OBAA 2VMEA 4ZXEA 3THDA 1K42A 4GWIA 3VDCA 3WF0A 3DECA 3WNLA 3PUHA 2LS6A 2Y6GA 4JKKA 2W1SA 4W4ZA 4JHZA 2J1UA 4OMDA 2ORXA 4A45A 3ACHA 1CZSA 2W46A 5F7UA 2VR4A 3HJRA 1K12A 1UY3A 1OF3A 2J1SA 2WN2A 5LA1A 2YC4A 2WO2A 4MO3M 1UX7A 2WAAA 3E1F1 1K3IA 2VMFA 2YB7A 3ACIA 3I97A 4CUCA 1WKYA 2HYXA 1CZTA 2VZQA 1XNAA 1KGYA 2EICA 1PX3A 1ULPA 4ET7A 1XPWA 2JE8A 4ARXA 3T0BA 3EB7A 1W8OA 1HN1A 3T08A 3P1IA 3DYPA 3P6BA 2VL4A 3T0DA 2EIDA 2WYSA 4CVUA 3OEBA 3K77A 2QQNA 2W1UA 3CZUA 1H6YA 3MV11 5B4NA 4PQQA 2E26A 2CDOA 2VZTA 4DUVA 3NQHA 3VDAA 1GMMA 2J1TA 4AAXA 4FI9A 4XURA 2XONA 3SEEA 2E31A 5DMYA 3WEZA 2W87A 3T2OA 2LW8A 2OKXA 2VM9A 1W8NA 2WABA 4CU8A 3LPFA 3ECQA 3MUZ1 2J22A 1UY0A 5IJRA 3W5MA 2VZSA 1JI6A 1KEXA 1O59A 3UNPA 2VMCA 4QB6A 2QQLA 1UY2A 2VZ1A 4QX0A 3T09A 1GU3A 4DEVA 1JU4A 5DN2A 5LA2A 4A3ZA 5J1XA 4ZZ5A 1K45A 2W3JA 3HPNA 1CIYA 3U37A 5C70A
chains in the Genus database with same CATH superfamily
2NQYA 2VUAA 4Z8BA 3NAPA 1AF9A 5FMOS 2B39A 3ATGA 3JU9A 5BYNA 5JXHA 2YV8A 1DCSA 3H3LA 1UOJA 1RUG2 2XJRA 4KG0A 3MEPA 4DY3A 4MGSA 3ZXDA 1Q8QA 2DTYA 2I2SA 3CMGA 1RUI1 1RJ7A 2WBKA 1N1YA 4QDRA 2BZDA 3WDUA 3FHQA 3O1SA 2X09A 1R081 4NR1A 1UWWA 4Q0SA 3PVOA 3V0BA 2PHWA 3BU7A 1BLZA 1JUIA 1MEC1 1LKNA 1WWYA 1TVGA 3AXDA 3MI8A 5KBFA 1LAJA 3AX4A 4KMQA 1PO21 4Q29A 5IWFA 3WP5A 4PBOA 1QJY2 4H55A 4A6SA 3LSDA 4P08A 1H4HA 3TEZA 4JX0A 1W6OA 3NSTA 3FLTA 1N1VA 4FXGB 3PIGA 2IUWA 4GJYA 1D2QA 4LLOA 4Q4V2 1POV0 4FP2A 2JDZA 3UK9A 2IXKA 1QGLA 2NM1A 3C8XA 2YBKA 3PUAA 3VKLA 1K5MA 1WCKA 2W92A 3D4KA 2JJ6A 3IPVB 3GZEA 4BMEA 4MX3A 3ZVXA 5FPVA 1H2NA 2VJXA 1LEDA 4JGZA 2B9VA 3WDVA 4CU6A 1EV13 2VZVA 5LRRA 5FZ6A 1ULEA 3UL2A 2GC0A 1WBLA 1ND3B 2UU8A 4QKDA 4DINB 1HV1A 2FDKA 1IGOA 2WINB 1XQNA 5KC5A 2C9KA 3ITQA 3DGTA 1ENRA 1TQ5A 1AR91 3H50A 4LO4B 3IKWA 4A44A 5IATA 2Y6KA 4ES9A 3E6BA 4U2AA 1CR7A 2C26A 1WGPA 2YPJA 2VOTA 4LK6A 4YW5A 4AHXA 3MLLA 1PVC1 2K0GA 3SCFA 5IAVA 5DDJ3 4FCAA 5BNNB 2VOWA 5J98B 3ZXAC 4FAGA 4I01A 1IS6A 1ZRIA 5I0RA 1UZVA 2E32A 3BPSA 1RUG3 1DQ4A 2AEZA 4V2WA 1DLCA 1I5PA 4JDMA 5H9SA 1IPKA 5KHHA 2YC2A 5JOYA 5KXDA 1DQ5A 2QQJA 1R092 3NNJA 1O8SA 1OUSA 2BP6A 4WBBA 5FZKA 2B8MA 2J1EA 1CX4A 1ULCA 4ZPIA 1K5JA 4P9LA 5CKQA 1YQ2A 1L7QA 1O3SA 2VQTA 4O9GA 5FRAA 1ALYA 2BFUL 3O0WA 4XJ9A 4NIIA 3CNAA 3VBFB 1GOHA 4CCDA 5LK7B 1QH7A 2DURA 2GU9A 3EO6A 2RS31 4Z82A 1LB2A 1S0FA 4XZPA 2LM3A 1JTZX 2HWC2 1Y9MA 4Q4V3 4D6QA 1R1A1 5A1AA 5HCAA 2QJVA 3OPWA 4CP1A 5J36A 2WA3A 2B5HA 5L9BA 4I2OA 3H9AA 4CCLA 2C6SA 5JXJA 4AGRA 1PHMA 2GMMA 5FXWA 1ST8A 4HVRA 4XJ8A 4PDWA 1QMJA 1NY72 4D7SA 5HPOA 2XKPA 3T2QA 1W0OA 1Q3EA 3AVSA 3KB5A 2ZHMA 1DGRA 2DYCA 2ZEXA 2BTVC 3OBZA 5JIUA 1IS5A 5T5LA 4J1XA 1FV2A 3B9IA 3CJXA 1UD1A 5LBBA 4ZHNA 2GH8A 5FPLA 3ZFEC 4XFFA 5JXIA 2B46X 1HB3A 1D0GA 1IHMA 1E5RA 1V0AA 2B4KA 4YVWA 3RMXA 4BK5A 4XIOA 3Q8AA 2YU1A 4LNVA 2VW1A 3VBHC 2WQ4A 1XE7A 1QHDA 4UI9L 3G6JB 3ZXGA 1LODA 1RUF1 1CPMA 3LWCA 3NJXA 4TLGA 3I2KA 1R093 1HB2A 2CY6A 2D6PA 3I2DA 4ES8A 2Z79A 4YM3A 2HWF2 4FPEA 5C8CC 4FPKA 3ACFA 1D4M1 3AC0A 4BM8A 1CGPA 1D2SA 4HL0A 1H9PA 2ZGNA 3A22A 2FDHA 2GP5A 2YU2A 4H14A 1ULOA 5CBLA 2D6OX 4IGOA 4LPLA 1L7RA 5L9RA 4GB32 4WZCA 3WVJA 3ZN4A 3LDKA 2ZHKA 1TNRA 4IEUA 5FXVA 5DZEA 5GZCA 5C9AA 3AKPA 4DMIA 4P5HA 1QKQA 2W95A 4OI1A 3OUIA 4PJYA 5I0DA 2HWC3 5GJ6A 2AREA 3SMHA 3HQUA 1ODMA 2SLIA 2FCVA 1Z7S2 3LDRA 1G6NA 2JG8B 4ISQA 5CZKA 3WW3A 3LZZA 5FY4A 1F4AA 1RHI2 2ET1A 3KVBA 2UWBA 3KLSA 4CCJA 2DVGA 2X10A 5FMBA 4AQ2A 3MPBA 3LEKA 5DAWA 1NA1B 2RMU1 4PT6A 1FPN2 3O0XA 1HXS1 3VD5A 1LHUA 1VBD1 4X6QB 4XUOA 4CCKA 1CD3G 2ZBJA 2PTMA 1QEXA 2PHRA 2AR6A 2VNRA 4M3CB 4XPVA 1BMV2 2H6BA 2IXLA 2WQ8A 2OT7A 3T2TA 1OT5A 4QHOA 2VTXJ 1UXZA 2J7MA 3WF2A 1ND2A 4QDSA 5EZWA 1UN1A 4AEDA 3HN1A 4Y20B 4KBBA 1M06G 2OIIA 3NL1A 4P9WA 1C8M2 5EXOA 1REFA 2YXSA 3ZFGC 1JZ2A 1EY2A 4RGKA 2DDUA 4AL9A 4LA3A 2JB8A 5C4WC 4HFSA 3KM5A 2VO5A 5IHRA 1OD3A 4MADA 4C8DA 1ZNPA 3RYRA 3ST7A 1PNGA 2D40A 1AJKA 5C33A 4NIGA 1X36A 3PJQA 3AKQA 3PMSA 4QPWA 5EJ3A 1TME2 4E9KA 4GD4A 2JKBA 3V64A 5F37A 2HWF3 2YZ4A 1CPNA 2BBVA 2AUYA 2P34A 2TUNA 1W99A 5E88A 5A3NA 1J58A 4BLIA 1PVC3 3VD9A 2ZX3A 3AXEA 3ZDVA 5BV6A 3CJIB 2D6MA 1DLLA 4GB33 4COUA 1W03A 2E33A 2ILMA 3AL5A 4PHZA 5E89A 1UXXX 4YZ5A 2ZMNA 5FYMA 3W58A 5AFEA 3LEGA 3VBUA 3AZWA 4AG4A 4R9AA 1ZBA1 1RVF2 3ETQA 3HN3A 2AENA 5L19A 1SFPA 4K7JA 1OUXA 2RS12 1WA6X 1QY4A 1Z7S3 4HONA 3TRSB 3IBMA 4JRLA 4DRRA 5JOZA 4YG3A 1HQLA 1LR5A 5FYZA 2XXZA 4QX7A 4XVHA 3ZFEB 4I0AA 1FPN3 3BOPA 1SCRA 3EXUA 4CDXC 1PVXA 1ZZ7A 4M3CE 3VBHB 2BGPA 2LALA 1W9TA 3RFRA 3RZMA 1XOYA 4H7MA 1UMHA 3SKVA 2QQUA 1W2AX 2BGCA 3AM2A 3HQXA 4LR4A 5IT6A 4DXSA 1V6KA 3M3IA 4YM2A 3TOJA 2FMYA 1US2A 1C8M3 3THPA 4LKSA 2YPDA 3KHBA 4Y26A 4Q4Y2 5C8CB 1AR61 1QDCA 1UYXA 1AX1A 2JG9A 2BQPA 2VH9A 3ETPA 4MHUA 5KHJA 1W3XA 3OPZA 1AX2A 1Q56A 3QCWA 3T30A 5FPUA 4OI0A 4XMAA 4JRAA 3AMQA 1AVBA 2WT2A 3OY8A 4CCNA 2JDUA 4RA0A 5F32A 4KL1A 2Y26A 1YJKA 1GP5A 1TME3 4BISA 1SEFA 2D6NA 2V09A 2Y6HA 4XUNA 1FOD2 3U07A 3WNMA 2HEYF 3AFGA 2YGMA 1W2TA 2ZX2A 1N3PA 2ADEA 3J8F1 3TNQA 4G9SB 5CAZA 4Q1RA 5CFCC 1JZ3A 1OVPA 1PMJX 2PQQA 3KT7A 1GQPA 5FXXA 3WF3A 4I0BA 5FREA 2O14A 5BUVA 1RUF3 4FPGA 1UPIA 1ZYBA 4XDQA 4CP0A 4B4QA 1REEA 4EJRA 2N7GA 2P3JA 3VD7A 1RVF3 3UKVA 1YQCA 2RS13 1S0EA 4UT5A 4WM7A 4X8PA 1TEIA 3T4VA 2P1BA 4Q8KA 4IXLA 3IM0A 3BB6A 4JQRA 1VBB2 1YIFA 2RM21 4LO5B 3R4UA 4KWLA 3ZFGB 1CESA 5E8AA 3NV2A 4AR2A 1H2LA 4K9SA 4LTAA 4GMP3 5IK7A 5C4WB 4A2UA 3IB3A 4WM8A 4IQPA 3KQRA 1US3A 1RUE1 3DYOA 1V6JA 2G1MA 2Q0AA 3M1HA 5FMOL 3ACLA 4AVVA 4C90A 1JXNA 1LHWA 5FZMA 3WG4A 1SPPA 2QQKA 2X5IC 2ET7A 4QGMA 4QPIC 2JDPA 3P3NA 1PX4A 1CAXB 1QJU2 3OCPA 4PI2A 2I45A 4Q4Y3 4NPLA 5FJHA 1WZXA 2JENA 2TEPA 4WVVA 2WFF2 2Y0OA 4XUTA 2RMU3 4MZUA 3IIIA 1LHOA 2CTVA 4FQZA 2R16A 2A6YA 2ZS6B 4D69A 3HR9A 4XFBA 5FP8A 1ZBE1 2BNOA 4R52A 1VMHA 4DXRA 2EVXA 3KQ4B 5K0UA 3VL9A 3LFMA 2WL1A 2IXHA 3LQCA 4OUEA 1J1TA 2VCCA 4K3UA 3J7MA 2XMLA 1FOD3 3EQEA 3IZOA 5FZOB 1AXYA 1OLRA 1QF3A 2ZGKA 4FOYA 3LCPA 4G4FA 4M3CF 3WCRA 1O3QA 2TBVA 4YGDA 1QQP2 2VZRA 4CCEA 3X29B 3ZYBA 4M4PA 3AYAA 5GLVA 4JV4A 2X05A 5A6YA 2BVBA 4XJAA 4CDXB 4IW3A 5D8AA 1JZ7A 1SLBA 1GZWA 3OBAA 1UIJA 2CGNA 3O7OA 3THDA 5J7MA 3RZLA 4R4ZA 4IERA 1K42A 5CIRA 3S57A 5FO8B 3RS6A 5FZBA 4V1PA 1AUYA 1L3JA 1VBB3 5I8SA 1HRV1 1UKRA 2XHKA 1E5HA 4P9YA 4YM0A 1G9DA 1K5MC 3D8CA 4AWDA 5K8SA 3MIFA 5FP7A 5FP4A 2VBPA 4Y1UA 4JGZC 5DXDA 4ASKA 1CJDA 1DU3D 4YZ1A 1OXCA 4OMDA 2ES3A 3RGBA 3TN92 3KHCA 4XAAA 2QZ2A 3NV3A 5ACA2 5F7UA 3GALA 5FPZA 3ZSMA 1QOTA 1W6QB 2HWD2 4ZS3A 1C3HA 1QJU3 4UW4A 5LBFA 5F1RA 2WFF3 2A71A 2WO2A 5CKNA 2OZ6A 4E4ZA 3KV4A 3LF7A 3T1MA 1UX7A 2GAUA 1G9CA 2W08A 2WAAA 3AK0A 3TB0A 1K3IA 2VMFA 3ACIA 3RQ0A 2BNMA 5CFCB 5JDBA 5FY5A 1KJLA 2HYXA 2VZQA 2ZX4A 1XNAA 4IEWA 1FMD1 4N53C 3H7YA 4IEZA 4O9EA 3OD0A 5IK5A 4ET7A 4DIQA 4MUVA 2K46A 1HJFA 3PURA 3CLPA 2JE8A 2F17A 2WNUC 2BFUS 1QQP3 1YLLA 3ZN6A 4LBMA 5LW9A 3EB7A 1HN1A 2WLPA 3T08A 4MXWB 1AR82 3CHXA 1PGW1 5H9QA 4OI4A 1COV2 2GMEA 5I91A 3T0DA 2GZWA 1AR72 2EIDA 4AI1A 1F2NA 1FATA 4BA6A 4S2GA 1L7LA 1NE4A 2W1UA 3CZUA 1H6YA 3NJZA 1WLCA 3MV11 2VNVA 4HXCA 3TWIA 3O1RA 1H8TC 4Q4X1 5DAXA 1RUC2 1GICA 1HRI1 2CDOA 2GP3A 2X5IB 3POSA 4JGYA 3VGIA 4QPIB 1S0JA 4DUVA 1NOVA 4HPKB 3VDAA 2D93A 2J1TA 4LMFA 1BZWA 3SEEA 4LUMA 3MF9A 3EJKA 1LULA 3MLKA 2GMPA 2MNGA 2CGOA 3PUSA 4PDWC 3OYWB 2A6WA 5HBAA 1JS9A 4AE2A 3TN93 3NAPB 1XYNA 3I59A 2A3XA 3POGA 4N7UA 4Q0PA 5CISA 4Q0UA 3B69A 2GC2A 1W3VA 2A70A 1J1LA 1YRZA 2HWD3 3A4UA 4Y22B 5JVVA 4FSJA 3WW2A 3JQXA 2E7QA 1KEXA 1O59A 4LBNA 5I0UA 2VMCA 3UNPA 5A3OA 4QX0A 3ZIXA 5L73A 1RIRA 3LFIA 5FYTA 1I1EA 1Q8PA 4FOWA 4TYSA 5JR7B 2OYZA 3POBA 1MQTA 3S30A 4BU2A 4OQ8A 3PUQA 4WVZA 4QT6A 3T4HB 3O1TA 5J1XA 2ZGMA 5L7OA 1EYBA 3WY6A 1K45A 2OQ7A 4OHVA 2E63A 1LECA 3JUUA 1HKDA 5LRSA 3ON7A 3U37A 2WFPA 4CDQB 3JBG2 1D0HA 4CVUA 1K5MB 4OQ9A 4X6RB 1DZQA 4AEKA 3ZXJA 4BE3A 1AR83 3AZVA 1COV3 1UZYA 3I4IA 1GV9A 3PLQA 4JZRA 4D7YA 2KXLA 5LBCA 4JGZB 1AR73 2UYBA 4XDPA 4C91A 4LOSA 4DOUA 5BNPC 5KWRA 1ZX5A 4QGLA 5CB7A 2OW4A 1C5IA 2FCUA 5DAQA 3S5AA 2VTXA 1OA2A 1EAH2 3OB8A 2XWBB 4CZSA 2WZ8A 1ZA4A 4LO7A 4A7KA 4L2NA 3DKQA 3S7IA 2XG3A 4IV3C 2UURA 4LHLA 5FLJA 1JYIA 1CZVA 2D5HA 2PHUA 1U5IA 2PLV1 4NRMA 2VZPA 2YC0A 3KF3A 5JSPA 4CDWA 4XOGA 2P3IA 4A6OA 2EALA 3FHIB 4N53B 1MACA 5A1FA 5A33A 4GXLA 4HT1T 3LAGA 4XETA 3BYWA 2R041 2FZ1A 4LKEA 5GKAC 3T0AA 3H8XA 2QVSB 3WHTA 4HLTA 2WNUB 1UYYA 2VMGA 4XE9A 2P5BA 4OHWA 4IEQA 2DUPA 2EAAA 1T6GC 2FHRA 4SLIA 4IEPA 1VBC2 4XBNA 5FFOC 1C1FA 3O1VA 1XNKA 1FXZA 3WUDA 4RQPA 1SQ4A 2ZGOA 1MPXA 1OA4A 2Y6JA 3WNXA 2CAUA 4E8DA 4AI3A 1I9RA 2ARBA 5A3PA 1GSLA 4A7YA 4CEWC 5F6KA 4YW6A 1CVNA 1DIWA 4E27A 4TXWA 1UYZA 2WSVA 5FUNA 1NQJA 1RUH2 2Q8DA 3WG3A 3WP6A 1H8TB 1U5ZA 3F95A 4CTEA 1X9PA 5KHGA 1DZTA 2IZWA 3JBG3 3JD71 4RS5A 2ZABA 2Q1MA 1W2UA 4QMAA 1UNBA 2B45X 5JI9A 5FZEA 1WCUA 3DUIA 4LE3A 4RR3A 3ZYPA 4KQ7A 1GZCA 4PDWB 1PNFA 4K21A 4YM1A 2X53S 4DFSA 3IAPA 3DKWA 5DAVA 3AVRA 1S4CA 1UU4A 4XJWA 5GLTA 1EAH3 2JD4A 3W59A 1CAVA 4OUMA 1KXGA 3N9MA 3WF1A 3LIGA 1UMIA 2WZR1 4CPBD 3BTYA 2IVIB 5T5OA 2B42B 3OGVA 3HMYA 4GH4C 4NVPA 2QUOA 3I3QA 5K4LA 4LHSA 3RWKX 1EPWA 3QH7A 1OQ1A 3Q9OA 1GFF2 1CWPA 5AC92 5FO9B 2JB4A 4HKLA 1RUJ2 1D4VB 3CIHA 4NHYA 5J48A 5DG1A 1DP0A 4AI2A 3C7HA 4OI2A 4QPGC 5GZFA 2MEV2 2P3YA 5FJKA 3K75B 1AZDA 1B35A 2C4XA 2CHHA 2XL7A 3VBRA 2FDIA 3LOIA 4Q0VA 4BOWA 4UFKA 4LIVA 1VJ2A 3UT0A 1CAUB 5JWPA 5FZDA 1O5UA 2P3KA 3HQRA 3OEAA 4N9HA 3FUOA 4DUXA 1VBC3 4NAOA 4JCKA 2YUEA 5IVYA 2ZJCA 1POV1 4DNYA 1AHSA 3GF6A 4IESA 1FT9A 3FN9A 2YGLA 3WP4A 2QNKA 4CP9B 1A8MA 2VZ3A 2ZXQA 1RUH3 1W05A 3AZXA 3KCCA 1HLCA 1GUIA 1RITA 5BNOA 3E97A 3HBKA 3PU8A 5FZ4A 4QQPA 4EZ4A 1VE0A 2WSUA 3HNYM 3THTA 4M4RA 4IV3B 2RHPA 1J84A 1QIQA 5A7OA 3K4AA 1A34A 4L99A 2BYVE 3BUCA 4BLJA 5ISLA 2DV9A 3OGGA 1BQPA 3ORJA 2DUQA 2BERA 1MZ5A 4CCMA 4WM7C 2OPKA 4EN0A 3HT2A 4YSFA 4OMCA 2WO3A 1QJX2 5IFPA 2KD7A 1ASJ2 2VPVA 2VQUA 4OCTA 1BEV1 1SDWA 4Q4W2 1RUD1 3MW3A 4UF0A 4YVSC 4MSVA 5A7WB 1IOAA 4GQ7A 4A42A 4EYUA 3OF1A 5AC93 1WUVA 2XLGA 3AP9A 5DZFA 1RUJ3 4KNCA 4NE9A 4A41A 2ATFA 1I5ZA 4NUBA 4QGNA 4W50A 5FYSA 3D3AA 3W21A 3IDBB 2AACA 3N9QA 4LO8A 3I2HA 3WD5A 4NMIA 3WNNA 2MEV3 3ZM8A 1EUUA 1W6PB 4CEWB 4AQTA 4Q5OA 2VCAA 3T3YA 2ZZJA 2ZEWA 4QX8A 1CX1A 1PM4A 2A3YA 2HJIA 4IEVA 3GHNA 3SKJE 3VV1A 2VZUA 4A4AA 1AX0A 3APBA 1RL3A 1MS0A 2C24A 4XCBA 1WMEA 5FTTC 2HBTA 4ZS2A 2RR11 5CFDA 3VBOA 3USSA 1JOPA 1VLNA 2WRAA 5I93A 1VRH2 2O8QA 1YEWA 1GWMA 3ZSKA 2Q8EA 3K2OA 1S2BA 4RN5A 4UXAA 5AFBA 3AP7A 1NG0A 3QBQA 4LE4A 4UYBA 3SLIA 1S55A 4P5YA 3VDDA 1SHWB 4Y1YA 3VBUB 4OLLA 3RWNA 3NJVA 3FJSA 2ARAA 1PK6A 3GBWA 5K7PA 1HW5A 1YO8A 4GH4B 1NT0A 1EP0A 3OUHA 3POIA 2Y64A 5DG2A 3VHOA 2O8OA 4BQYA 4EN7B 2JG8C 3ZO0B 4W6WA 1NCRA 4ISRA 3RJ2X 3QOPA 1Q43A 2R061 1H8VA 4QPGB 3GJBA 1GP6A 2NMNA 1NA1C 1U5YA 1VAKA 2HWB2 4Y4RA 1QJX3 1XB9A 2WA4A 3J7NA 4NIHA 4QX2A 5JSRA 4XQDA 1LHNA 1ASJ3 4IEXA 1N1SA 4Q4W3 1H9WA 1NUKA 4G3YC 4QX5A 3DN7A 3M3QA 3RYKA 1OH4A 2WR9A 3B94A 2XVGA 1NCQC 2ZKLA 5FY9A 2W47A 1W39A 3OY8B 1SLLA 1LU2A 1RMU1 3GCWA 2EXKA 5F5AA 3UJQA 3KD4A 1PMHX 5C7GA 3AL6A 3KV9A 3RSJA 1F15A 4AVAA 2FBEA 3OSDA 2XKOA 1U5XA 4KU7A 1C1LA 4MHRA 4YZ3A 1W9WA 1CAWA 1RUI2 3DPRC 1VRH3 4K8RB 3WINE 4ZKTB 1B09A 2JDAA 2XWJB 4XDOA 3I2FA 5FYVA 3ZYFA 4QHZA 1MZFA 1OLMA 1R082 3ZYGA 2YHJA 3NMBA 4FPJA 4CEYC 4I02A 3FX3A 1W8FA 5DQ0A 4DS0A 3ZKYA 3CJIC 1MEC2 3NJYA 3H7JA 3MIGA 3FHAA 1OBNA 1PO22 2XVLA 4WM7B 3LPGA 4O65A 3EMRA 1YQ8A 3AMMA 3POWA 3PVEA 2ZPXA 2BGOA 4YVSB 3N9NA 4LBQA 2PHTA 5HV0A 3AP5A 2VGDA 2D97A 4EE2A 5KHIA 2VUJA 1YNAA 3MYXA 3CF6E 2CWMA 2RG4A 3VD4A 4CXWA 1DYKA 3PU3A 2QDNA 5A32B 2QQVA 3OD4A 2YDEA 5EWSA 2W0XA 5FMCA 4BQWA 4E4DX 2HWB3 1JZ8A 1WA4A 4N43A 2AYHA 1OOPA 1STMA 4UFMA 5FZHA 5A80A 1SLAA 2VNOA 1XBFA 4JGYC 5HCFA 2QQPA 4UFHA 4CDUB 4NROA 2C1FA 5FWJA 1YC61 1AR92 1YQ5A 4AYUA 5JPMB 4LLFA 3ZSJA 2Z5WA 4AVTA 1BBT1 2R1BA 2OUJA 1VBE1 5E1RA 4S2FA 4OZXA 2FMDA 2GALA 2LRPA 4D3WA 4XUQA 4D6SA 5EIYB 2AZ5A 5JCTA 1PVC2 5ANNA 4QQOA 3WZ1A 4OYUA 4LQRA 4WVMB 3JB8A 3ZYIB 3CU7A 3S6PA 1LNSA 2ZHLA 3U4SA 3ZDSA 2OA2A 1RUI3 2G9FA 2BWCA 1KJRA 2OXBA 5LCWL 1W6NA 1MQTC 2HH9A 3WDWA 3K48A 1R083 2R49A 1IQAA 1T6BX 5D8AB 3WOGA 2R1DA 1OFNA 3O0VA 1J59A 1GZWB 1NLRA 2CL2A 4FT8A 1MEC3 4Y4YA 2V4VA 1GNYA 3MF6A 3TEYA 1YJLA 5JI7A 1PO23 1POQA 1S2KA 1H0BA 3D5OA 1RYYA 2WS91 5EPAA 2RS32 1YQ6A 2XJSA 1ZM1A 3EHKA 3HT1A 1AYM1 1HV0A 1RC6A 1R1A2 1OPMA 2W94A 1ZRRA 3B00A 4P00B 5F8PA 1AJOA 5HXMA 1WD4A 4OFGA 2BW8A 5CU1A 2CGPA 4XABA 3BI3A 1PGL1 3AJZA 4F83A 2WWUA 3H0OA 1NCQB 1ZZ9A 4CUBA 2XBO1 2JE9A 3DXTA 1VMFA 4TWTA 1LOGA 1JZ6A 4XZUG 3V65A 1R64A 3ZFFA 4EWEA 4QXBA 1JHNA 1G9AA 2Y6FA 2YY1A 3O1MA 1AR93 3H1MA 4HSLA 4DXTA 5FOJB 1IS4A 3DPRB 3PTRB 4XFAA 4J6GA 1GANA 3MFCA 2DVAA 3QACA 3R4SA 1A78A 4GIQA 3WF0A 4CEYB 3DECA 4QPYA 3WNLA 3MGUA 3FBYA 3VZNA 4E2SA 4LHKA 4IV1A 2W2IA 2X8KA 3J26N 1RXGA 3D82A 1NXD1 4JKKA 1LENA 2D3PA 2ZGPA 4YG6A 1MS3A 2VXRA 1RUF2 3ZN6B 1JOBA 1CIWA 4A45A 2GH2A 3ACHA 4RGAA 2W46A 3SQOA 1D4M2 4A3XA 1DGWX 3VL8A 5HXVA 3VHNA 1K12A 1XNBA 1CQ9A 2WN2A 5BPXA 4KGGA 4OHZA 5LA1A 4XHXA 2OVUA 4HKOA 1E5SA 4RGGA 5C3OA 3KT1A 1LTEA 4MO3M 1O5LA 4NPMA 5IUQA 2VOVA 2RS33 3E1F1 1YCIA 2ZA9A 4GMP0 2NYYA 4JGYB 2WWSA 3IIAA 4FOQA 2ZKNA 4O7XA 4CUCA 1FX5A 4HMZA 3IPVA 1R1A3 4P14A 1V6LA 4U36A 4IE5A 3G7DA 1W8TA 1ULPA 4HN0A 1MR5A 1TZOA 1UQXA 3I54A 3ME2A 2JDNA 3O5SA 2EA7A 4JC1A 2KM2A 4J1WA 1IS3A 4S2HA 1ND3A 4AOCA 3K3OA 1W9YA 4EWDA 5EQUA 2RMU2 3FC0A 3T0BA 3R0RA 1HXS2 4BQ3A 1VBD2 2ARXA 3MIBA 2VVDA 1AXKA 3P1IA 2OS2A 2PAEA 4UW6A 4I3PA 3LIHA 3SISA 3DYPA 2ERFA 2O0OA 3ZIWA 4EQVA 3MW4A 3AP6A 5C6CA 3H8OA 1ULDA 2A75A 2Q1ZB 2QQNA 2WNEA 2BWAA 2XH6A 3J7LA 1MQTB 3OEBA 4FP3A 3PJYA 5BNNA 1LOEA 5IVVA 2E26A 4K20A 3PL0A 3N7LA 1OHFA 5L7OB 4JTNA 1GMMA 1VMJA 1B35C 2ZCWA 5EYXA 4AAXA 4OHYA 2JDHA 3VZKA 2VQAA 5HI0A 1JMUB 2BDRA 2R32A 1DG6A 4XBLA 3WQ7A 3WUCA 3S5QA 4MG2A 3T2OA 3ZYRA 3B3QE 4YW4A 4ONUA 1GR3A 2VM9A 3O12A 2VOXA 3VBSA 4CU8A 5LEJA 2E7AA 3WDTA 1GQGA 4AF9A 4AEMA 2V5YA 1D4M3 3MUZ1 5JZGC 5CG9A 1FV3A 2ZTNA 5T50A 3LA7A 5CG8A 1Q8VA 1RUOA 2UY8A 3GBGA 3WCSA 3WR0A 3W5MA 3VBFA 1MS1A 3TNPB 4XJZA 2WNOA 2E51A 1I3HA 1UY2A 2VZ1A 3KGLA 1PO11 4WVWA 5GM0A 3T09A 1PIV1 5E6HA 5F39A 3ALQA 4AHWA 1MVQA 5FQ0B 3HBZA 1ZBA2 3H42B 1W8ZA 4YG0A 1IZ3A 1W0PA 4A3ZA 4ZZ5A 4I0WB 4R8HA 5GLZA 4E4SA 3FE5A 4M0HA 1XU1A 2GN3A 4CDWB 3C2UA 5FZ9A 1W6MA 2ZOEB 5FZ7A 2GC3A 1LEMA 1HXS3 1VBD3 3WW4A 4FO9A 1VRBA 3BALA 2HBUA 2YMZA 3RZJA 4HG6B 3MW2A 4MGZE 1VPHA 3AMPA 3NAPC 5C3SA 3NNFA 5EV7A 3RZHA 2HWE1 2UYAA 4Y33A 3QD6A 2XJPA 2ARCA 2XOMA 4YFZA 2J1VA 4I3GA 1T2XA 4IGPA 5G04L 1ZVFA 1AYN1 5DUXA 5EYYA 2ZGUA 2R071 2K9ZA 2R6QA 3A0KA 1AR62 1JUHA 4UW3A 2RS51 2UWCA 4N8MA 1WLDA 1LHVA 4E8CA 1HN0A 3JXSA 5JSOA 3LB9A 2VE1A 5JPNB 4R4XA 4BB3A 4NHKA 1W90A 4XJUA 5T52A 3RYPA 4KGQA 1Y9GA 1WLTA 3H8RA 4GULA 3I8TA 4QDQA 3DCQA 4LITA 3MLJA 3DYMA 4O61A 1LRHA 5J96B 5C8WA 1VBA1 2MPFA 3M4FA 5IVCA 3J8F2 4L92A 2W91A 4UFIA 4H3WA 2RJLA 2J1AA 3SHRA 2CWSA 2F6BA 3F2ZA 1BKZA 3IMNA 2E9QA 1CAVB 2JXAA 5JAXA 1OQDA 1UIKA 3MO4A 5FY8A 5GALA 1ZBA3 2GN7A 1ENXA 4HKWA 4BK4A 1H1AA 3AMNA 2QQIA 5HCHA 4P9JA 3T2PA 3ILNA 2Y6LA 4AHYA 2RM22 1UY4A 1IKPA 4UWDA 4AQSA 3I3EA 4HETA 5FZ3A 1S0CA 1GOGA 4BQ4A 4M3CA 3A23A 3P5BA 3VZJA 1YWKA 2ID4A 2WC2A 1B35B 2ZAHA 3JB4C 1RUE2 4OVEA 4E4HA 1GNZA 2QTWB 4GKYA 4Y20A 1JU3A 3UGGA 3SITA 4OZOA 1OH3A 1DQ0A 3Q8EA 1TMF1 1V70A 4QX1A 3RI8A 1REDA 3HAGA 2GNDA 1IKQA 4BZ4A 5JZGB 1AR63 2DBIA 5IFTA 5K9YA 1UZ0A 4NOTA 4QHBA 1KS5A 1ZRFA 1SMVA 3FL7A 4JAAA 2L9LA 5C5TA 2E7TA 4PIXA 1X33A 2X29A 1H6XA 5A3WA 1Z0HA 2NN8A 1NE6A 4PQ9A 1ZBE2 1NLQA 2G4IA 3J4UH 1JZ5A 3VKNA 4DUWA 1GQHA 5J3UA 1N47A 3U11A 2XL9A 2RDRA 2WJSA 3WNOA 2XGXA 4META 4AFDA 2RJKA 4LULA 1HX6A 3WLUA 3BPZA 4COVA 2VMDA 4QQ2A 2CYFA 3SEPA 1QOSA 3E5QA 1V6IA 3VDBA 1GWKA 1H1IA 2LROA 3J8F3 3ZLIA 1C4RA 1F8VA 5GZGA 4RHV1 1RINA 4XF9A 5E16A 3RG0A 4FBFA 5B4XA 5FK7A 2VD7A 1LOCA 3R05A 1GNHA 4B4RA 2VZOA 2CSGA 1YI9A 4TN7A 2D3RA 3HOBA 2A3WA 2I07B 2JDKA 3UYJA 3BVCA 3HD8B 2WNVA 3D0JA 3RVHA 1FI2A 2QDRA 5C71A 1EUTA 4NPRA 2EIBA 1ONAA 2RM23 1HRV2 3ZXEA 4CU9A 2D7FA 4LEJA 3VBHA 1PO13 2XVKA 2IWGB 4GALA 3POJA 3OPTA 4DZGA 4K40A 1RUE3 4YVWC 1U12A 1WW7A 3V0BB 2XLFA 1GP4A 4ITCA 2QBXA 1YXWA 2P6HA 2PMWB 3N36A 4BIFA 5C8CA 2Z4FA 2YBSA 2XJQA 3J7HA 5FXZA 4JHTA 2DTWA 1W6OB 2DVBA 1BVVA 1UO9A 1IPSA 2D5FA 3KCXA 1SFYA 2YG0A 4KH9A 3VKOA 4QX3A 1ZBE3 3VDDB 1XNDA 5KXCA 2LTNA 3RJRA 5LEKA 1FMD2 1UY1A 2YFUA 1V9U1 2Q8OA 3N7MA 5C9AC 1NZCA 1E5IA 3B02A 1OF4A 4HN1A 1OVSA 4KWJA 5DPNA 3FFQA 2Q8CA 4XF0A 4L8QA 3TAYA 1XJAA 2RJ2A 5F5IA 1UYPA 4QKBA 4TZDA 4JQTA 1PGW2 1J3QA 3WDXA 3OG2A 1KS4A 1UZZA 1YFXA 2QCSB 1S0IA 4AK3A 5BXXA 2GSYA 2NZ9A 2VUDA 2YYOA 2OQ6A 3H3ZA 4CA9A 5GZDA 3ZFGA 4FOVA 3POEA 4XFIA 5FZGA 4Q4X2 1TNFA 1SCSA 3WG1A 3LD8A 1HRI2 1FAYA 4K1YA 1HRV3 1W9FA 2XHNA 1ND2C 5EP9A 2IFWA 5FV3A 4YGEA 5C4WA 3VZOA 1BXHA 3WNPA 4AEDC 4DPNA 1ENQA 4IETA 4EN8B 1VB2A 1AL21 1LJ7A 1KDKA 2A73B 4CYDA 1O3RA 3FWEA 1GKBA 1UW8A 4AVSA 5L9VA 3L2HA 3CDZB 4FTBA 1LOBA 3M70A 4AGGA 4B1MA 3FMGA 1CAXA 3AYCA 5DAPA 4K6BA 3BKZA 1CAWB 2WAOA 1XE8A 2XUMA 3ASIA 5FP9A 1QNWA 1GZ9A 4NAMA 4PIZA 4QB1A 2GC1A 4DB5A 2AH2A 2LUWA 4NN0A 2PXJA 2ZHNA 3C7OA 3OGRA 4FPOB 2R0HA 3UV9A 5I0SA 3DL3A 2WKKA 1H30A 4HVQA 3CZJA 1EV11 1X8MA 2VOKA 3CO2A 4XBQA 4NIAA 1Y43B 4LT5A 2EAKA 4CDQC 1FMD3 5FZOA 3VZLA 1FYUA 2P6CA 1N3QA 2R7EB 4MVTA 1TMF3 3OBTA 1RUNA 3PIJA 3VBUC 2VCMA 1XXNA 4C1WA 1O4YA 2EIEA 3HEIA 3BGAA 4LHNA 5DDJ2 1OKOA 4V2VA 4BWOA 5FAXA 5A6ZA 4D6RA 2SBAA 1VALA 5DDJ1 1LESA 2XQXA 1O91A 4Q1PA 5FZFA 3OJBA 4AAPA 1RUG1 4YVWB 1S2EA 1QWRA 3BTAA 4QXKA 1OI6A 1DYOA 2XR4A 3ZSLA 1MS9A 4YZ2A 3S0MA 3AZZA 3C7EA 4LK7A 4QAWA 3WT3A 3LE0A 3NV4A 4MH0E 4HSJA 4PLOA 4Q4X3 2XLAA 1HRI3 5FP3A 3I2GA 4Q0QA 4KI5M 4L97A 3PDQA 2ETEA 1ULGA 3JCIA 4YWAA 5FPBA 1O4ZA 2W1QA 4OULA 3BTXA 1CN1A 3LDBA 4FXKB 1NAEA 1RB8G 3ZR5A 3I49A 2UWAA 2JG9C 1W04A 2PLV2 2RVAA 3U1XA 4CXYA 2VC9A 4LOTA 1QJY1 3EYPA 4FPFA 2YBPA 5LY2A 4NRPA 2D6LX 4QD2A 1Y3TA 3WSOA 2H0VA 2Q1FA 3PTYA 4Q4V1 4YARA 2R042 4GWJA 2ZX0A 1YIPA 5C9AB 4S2DA 5GZEA 1MZEA 5JXGA 5CFCA 4ARYA 1XYOA 1WCQA 4XIKA 2WN3A 4XF3A 2D44A 2XJUA 2VNGA 5FYIA 2VULA 4LORA 1YYNA 2Y60A 1V6OA 2GNTA 1HJGA 1LU1A 4NHLA 2J1RA 5FR3A 5JR2A 4F3JA 5FZIA 1O7FA 2BNNA 2JIJA 2YROA 4BDVB 4F8AA 1DQ6A 5T55A 3HVDA 1SBEA 3PUIA 4F7ZA 1RJ8A 2WQZC 2XUEA 5IVBA 2AEYA 2QQWA 4MXWA 3SNMA 5ABJA 1ND2B 3EBRA 1WMXA 3JD72 4FTSA 1X9TA 2NMOA 4LXLA 4UBGA 4AEDB 2RV9A 2QQMA 4LA2A 2OPWA 3KV5A 3RZZA 4LBLA 4YW7A 1JYVA 4ORFA 1SBFA 4MGTA 4L9BA 4WM8C 2HYKA 2PQSA 3GZAA 5LATA 4DXZA 2X5IA 2C0ZA 1R091 2P17A 4QPIA 3E6CC 4HPKA 1NZIA 4IE0A 4NWVA 3I3MA 5T54A 1NLSA 1S1AA 2Z69A 4Y1XA 5FK8A 1WMFA 2WZR2 3WG2A 3AKTA 4FPHA 1JHJA 1V00A 4KG8A 4CDUC 2IXJA 2PLV3 2ENRA 5A6QA 4YNIA 1Q5OA 3A7QA 3MFAA 4YW2A 3GHMA 4IV1B 4LBQD 4LJHA 5FZCA 4Y22A 3ABZA 3ZX7A 2HWC1 2I74A 2Q30A 5K0UC 3MIDA 4SBVA 1QNYA 2R043 5AVAA 3I2IA 5BY5A 1UU6A 5JMCA 1NYWA 1ZZBA 4R9CA 3K4DA 3UESA 1XNTA 5D2AA 1AL23 3SH5A 4HANA 4UBHA 5C3PA 1NX9A 4XXPA 4CPBA 4AI8A 4Y24A 2W68A 4FPYA 2VUCA 4RFT0 1QXJA 3N7JA 2VXJA 3M3CA 5A1LA 5A7SA 1NY71 4AGVA 3TEWA 3GCXA 3A0NA 3OUJA 5A7PA 4B7KA 3KV6A 4ASMB 4Z2WA 1QXRA 2WZPP 4L11A 3KSCA 4PI0A 4GWIA 2CNAA 3FBMA 5D8AC 5IVJA 4QQLA 3V0AA 4CDQA 5J37A 1ULFA 3VHPA 2BU9A 2QKDA 3INAA 3PUHA 4X8NA 4CRQA 2LS6A 3JD73 2Y6GA 4FQ4A 4NJ4A 1UAIA 2B7YA 3BODA 1QDOA 2DVFA 2W1SA 3GYDA 3RI9A 3ZMNA 1IG0A 4W4ZA 4R9BA 1AXZA 2J1UA 4JHZA 4PBPA 2VW0A 2JG9B 3ILFA 3ZOIA 1PZ8A 3KZ4C 4JTOA 4FVVA 3UGHA 4MGIE 3SCHA 2NP0A 3U10A 4QKNA 4Z1VA 3U0ZA 2A7AA 2VR4A 2FDJA 3N9LA 3PVNA 1LGBA 2ZACA 2RDNA 4XACA 5A3TA 2HWF1 1OF3A 1RGSA 3M2MA 2WZR3 1O6UA 1KITA 4LBJA 2Y0IA 1BEV2 4KBZA 2A1XA 1RUD2 4AI0A 1XRUA 1NXMA 4N53A 3I97A 4GB31 1KQRA 2VVFA 4UFLA 3IDEA 1CZTA 1WW6A 3NWKA 5T3NA 1KGYA 3M8LA 2UY9A 4ZXKA 3ZXFA 5F3EA 3M3EA 2WNUA 4YGCA 4YW3A 1VB4A 1XPWA 4GKXA 3BIEA 1PGSA 2C5DA 3DV8A 4XTMA 4ZONA 3VBSB 2D3SA 1Z7S1 5DABA 4ATFA 4ARXA 5CADA 1RHI1 3GBFA 5D21A 1F9KA 2RR12 1BVP1 3PNAA 1HQWA 2PAMA 3H8UA 4DQAA 1FPN1 1QJY3 1MS5A 3GNEA 4B8EA 2VL4A 1ZZCA 1POV3 1QJZA 1BMV1 3WXPA 1QOOA 4AI9A 2WLQA 5CVRA 5FYCA 1H8TA 4WM8B 1GYKA 3K77A 3ZR6A 1U0AA 5A7NA 4BQ2A 4AEJA 4PQQA 3KGZA 4COWA 1LOFA 2VZTA 1C8M1 4I30A 2PELA 2W52A 4RSUA 5FY7A 1F5JA 1SLCA 4FI9A 1SPPB 4XURA 2XONA 2E31A 5DMYA 3J9SA 2W87A 4AW7A 5FMDA 3W20A 1UOBA 1W6MB 2BEOA 4MLOA 5ERLA 3WX5A 1EPZA 2WT1A 5FZLA 3VB9A 3LEMA 1OMIA 3N4MA 2LW8A 1SZBA 4EWAA 3ZPYA 4FFGA 5ANQA 1JYCA 3WDYA 3LPFA 5IK4A 1XYPA 2Y38A 3ECQA 1TME1 4B3NA 2MHFA 2R062 4LKDA 1YFYA 2WNVC 5K0UB 3BIWE 5IJRA 4LIUA 3ZYHA 2VG9A 3TEXA 1JI6A 3AFKA 1KFXL 1BEV3 3MDPA 1RUD3 2QQLA 3OGJA 3PVBB 1F31A 3AJYA 2VW2A 1GWLA 1WCSA 2VBBA 4I09A 3UJOA 4XEZA 3WHUA 4DEVA 5KC6A 2PA7A 5DN2A 1DQ2A 1ENSA 2O1QA 1RMU2 2W3JA 4RD7A 3USUA 2BPA2 1OQEA 1RVF1 3ZMOA 4CP2A 4JDNA 5L7OC 3KF5A 1CAUA 4IGQA 2RS11 5IAXA 5GLUA 5DUVA 5C3QA 2KA3A 2A5ZA 2F4PA 2VBDA 5KXBA 3DF0A 5TSWA 4BYYA 2VAUA 4YLZA 5C70A 2C9AA 2RR13 4PLNA 4B29A 4COZA 1JYWA 3O1OA 3D6EA 4ZY9A 4GMP1 3W5NA 5BNPA 1DQ1A 4K1ZA 3PHMA 4JKLA 4CP9A 2JDMA 4D0QA 4E2GA 1C28A 1J3PA 2IXIA 4XFCA 3P3PA 3GZTB 1C57A 2OUHA 3Q8FA 4LBOA 4BXSV 1YI7A 1VIWB 4Y1VA 2GDFA 1JZ4A 2JX9A 4Y5Z0 5F3IA 3CEWA 3IN9A 3B9CA 2ZGTA 2XJVA 4Q4Y1 4IV3A 1WD3A 4UOJA 3B01A 1S0DA 4EV0A 5LB6A 4D8MA 5LZ6A 4XXAA 3BTZA 1UKGA 5FBZA 4XHBA 3NVCA 2H0BA 1W06A 3U14A 5I8YA 5HCBA 2RDSA 5EFUA 3O14A 3IT8A 2R0FA 3FFZA 4WV8A 2JIGA 4ZZ8A 3ACGA 2DF7A 2VMHA 3A21A 3WF4A 4QQHA 4CDWC 4IUGA 2HLEA 4IL7A 2R063 1FOD1 1W9SA 3H1WA 3THCA 4AHZA 3C7FA 1WBFA 2HEVF 2P37A 3GGLA 3NRUA 5LASA 5A7WA 3AP4A 5LA0A 3LOBA 5SV8A 3NNMA 3CQOA 3LEIA 5H9PA 2EIGA 2V5DA 2TNFA 4QWNA 1FNYA 1ZA7A 2A6ZA 5I0TA 3GDBA 2WDBA 1Z78A 2D98A 2WO1A 1BBT2 2ZZQA 3QH6A 4PIYA 1W6PA 5F6LB 4CEWA 1VBE2 3GXUA 2PHXA 1RMU3 4Q27A 1IG3A 2E6VA 4RQPC 4UW5A 4XAEA 5FYBA 3VLBB 4Q26A 3RMYA 4IEYA 3OGSA 5EHDA 5KHKA 3UKNA 3ES1A 3HNBM 2ADDA 5FYYA 2A6XA 3KT4A 5B2GB 1VBB1 3L9JT 3T1LA 2EXHA 2JE7A 3B5LB 5EJ1B 2VVEA 2DU1A 1KD7A 4RS5C 2H6CA 3FLPA 3I2JA 3Q8BA 3JZVA 1A6CA 4Y3OA 2VTFA 1W2OA 2B9UA 2JKXA 3H3UA 4RL7A 4RYDA 1I6XA 1ZZ8A 4RR3C 3GM8A 2W1WA 3CBNA 2WZEA 5FIXA 3HNMA 1H2KA 2XB6C 3M7AA 1JYNA 5CNAA 4BHPA 3I59B 2WNVB 1RHI3 2PYTA 1QJU1 4GH4A 4URAA 2WS92 2ZX1A 2CAVA 2WFF1 1RTVA 2JDYA 1AYM2 3N9OA 5FWEA 3TYJA 2ZEZA 4KWKA 1OFSA 1Q8OA 1W2NA 2Y8KA 2QQOA 4QPGA 3WQBA 1PGL2 1O8PA 4XF4A 1OLQA 3C3VA 2V72A 2XBO2 2WT0A 1HB4A 4IEOA 3ZSEA 2FDGA 3V56A 4FTEA 1C8NA 4GAZA 4YPJA 2QFEA 3VBRC 4R9DA 3CKHA 4XFGA 1QQP1 1LGCA 1DGWA 1JBCA 3MZHA 1N1TA 3SCGA 3MPPG 3Q8CA 4XMIA 3UETA 2BVVA 3ZXLA 1PM7A 3HIFA 2ZEYA 3BU0A 3AKSA 1BBT3 4BMBA 4MOAA 4TLFA 1VBE3 1XNCA 1TG7A 4XUPA 1ZRDA 4OHXA 3RZGA 3ROUA 1WCDJ 3SC7X 3WW1A 4Z07A 1F35A 2BOJA 2CDPA 4AZZA 1NQDA 1TE1B 4XQWA 4B4PA 4NIDA 5LA9A 3UKTA 1P8JA 5APAA 2ZMLA 4AFCA 1HQNA 5BNOC 5HV4A 3AB0A 3WV6A 1OPOA 1XSQA 2BUKA 2DCYA 4C0HA 4DRVA 1DGLA 1G9BA 1UL9A 1O3TA 2HKXA 5FO7B 3TN91 4UAPA 1G86A 2JD9A 4ZU7A 2DU0A 5FOBB 5ACA1 3L2YA 3E5UA 4PF1A 2FDFA 1VR3A 1X7NA 3BOWA 4FAHA 4XCAA 1OSGA 1SFNA 5C3RA 4TTGA 4QB2A 2HWD1 5CYYA 4YVSA 5A33B 2WS93 4M0NA 4BPZA 4MGYE 4NRQA 4CUAA 5ABJC 4CSWA 3KCYA 4L0PA 1AYM3 1SLTA 1LOAA 2WIIB 1W8WA 3N7KA 3S7EA 5A32A 3WQ0A 1XC6A 5A3UA 2PHDA 1S0GA 3PMEA 5AVPA 5FZ8A 4D7TA 5T5PA 2Z2SB 3O1UA 2XBO3 4RQPB 3FLRA 1FNZA 1UF2C 2DVDA 3N3HA 3ZPOA 4LUKA 3B7MA 4D94A 2FQPA 5FY1A 4DEQA 5FKCA 4DY5A 3I7DA 2GNMA 2K2SA 1A3KA 2ZAAA 4QXCA 4JVAA 3VN4A 3ES4A 3W9AA 2Q4SA 4RFRB 1AR81 1F4HA 1XE0A 2D43A 5CFDC 4RS5B 1COV1 3VBOC 1PZ9A 4W8JA 3BCWA 2BRTA 1AR71 4QXHA 5FUIA 5LBEA 5F5CA 4MGQA 3ZKUA 4E2QA 4EN9B 2ORZA 4WVMA 3H1YA 4RR3B 5FCCA 1UCXA 1DHKB 2P2KA 1LCLA 5A6XA 4P02B 1OA3A 1RUC1 4HOOA 5IVEA 4HK8A 3VDDC 5A7QA 1Y9QA 2EF6A 4A7ZA 3MIEA 4NO4A 1A8DA 1SBDA 4NHMA 3WP3A 1PK6C 4GJZA 2V4AA 2JG8A 4LBKA 1GZTA 1KDMA 5SV5A 3NW4A 4PF5A 5FYHA 1W28A 1N3OA 5JOXA 1G9FA 3KWVA 3IDAA 4ASLA 1NA1A 4W6YA 1X50A 4Q8LA 1NCRC 4QU2A 3LGRA 3VD3A 2WUHA 2Q5TA 4GWNA 3RZKA 3SH4A 1PO12 4CCOA 4P9IA 1PIV2 3K46A 3NKGA 3VBRB 4MV2A 3D0SA 1DYPA 4PLMA 3KVAA 3VHRA 5FBJA 3MBWA 1NCQA 4Y5TA 3RDIA 2IC1A 2VU9A 1Q8SA 3LSEA 1O4TA 3ZYJB 4HZFA 2W5FA 4CUGA 4IDZA 3B93A 4Y1ZA 5JUVA 1W0NA 4BIOA 3N9PA 5G05L 3RNSA 1BK0A 4YW1A 3RPQA 3DPRA 3JBG1 3NNGA 2RDQA 1BCXA 2PHFA 4AQ6A 2HWE2 1XSRA 2IXCA 3AYDA 5H9RA 5BNOB 2A6VA 1YHFA 1H2MA 4CEYA 1Y4WA 5CA6A 5FLHA 2G19A 2XJTA 1QU0A 3I2OA 2PFWA 1AYN2 3R6SA 4AFBA 2R072 3MUY1 3CJIA 4B7EA 2FD8A 2GNBA 4YFWA 2RS52 3OOXA 4FPLA 4LO6B 5LK5A 5C5UA 4URTA 3KMHA 4MXVA 1EAH1 1F5FA 2DFBA 1VP6A 5LWBA 1CJPA 4C0BA 3C7GA 1JH5A 4QM8A 1J83A 1OURA 2EXJA 4OUSA 4MGKE 4BJ0A 3MHZA 4AXOA 4CCCA 4CU7A 5ABJB 3FUQA 4ZU4A 1NKGA 3ZXKA 4UF0B 5FYUA 4BH9A 2F4LA 1G7YA 4JDOA 3DEMA 1VBA2 3I3DA 3ZFEA 4XYXA 1IPJA 4LKFA 1GLHA 2VCBA 4EZHA 3E6DA 1VAVA 3KS7A 1ZZ6A 2WYFA 4DO0A 1UOGA 5IVFA 5JMOA 3BN6A 2Y33A 1ACCA 1LOFC 1SLIA 4XC9A 1PIV3 5A3MA 4N43C 1OOPC 3LKJA 4ZU5A 1UU5A 1H1MA 3IMMA 4Z2AA 3MICA 1DBNA 5DZGA 5IYYA 2JEMA 5FUPA 3IDCB 1HIXA 1VBC1 5CFDB 1GOFA 2ZGQA 3VBOB 4AFAA 3ZN5A 5CKMA 1D7PM 5ACA3 1JYXA 4PCRA 3AMHA 3WNKA 5EJZB 1URXA 5F2WA 5FDBA 2BJSA 1JN2P 5GLWA 3SH3A 3ELNA 1OKQA 2OX0A 1MS4A 1BHGA 1RUH1 3GZUC 3LA2A 5F3GA 1M4WA 2WO7A 4BQ5A 1YFWA 4YGBA 2QZ3A 2P4EA 4GZ9A 4JKMA 2HWE3 4IE4A 1TMF2 3TBDA 1V6MA 4QU1A 1PK6B 1SG3A 1JW6A 4BXFA 1AYN3 3K51A 2R073 3DXUA 1VAMA 1X8EA 2DWRA 2RS53 4GA9A 1DZRA 3M3OA 2IVJA 2VMIA 1NCRB 1BJQA 3V0AB 4HK9A 5J09A 5KR7A 4XQ4A 5CEHA 1YFUA 3MV01 4TSVA 1BYHA 1Y7BA 1J3RA 4FFIA 4XW3A 1WW5A 4C1XA 5DUWA 2DCKA 3K4ZA 3QLQA 4FFFA 5FPXA 1V6NA 3AZYA 5FZ0A 5AC91 2YFZA 1JODA 1OD5A 1SACA 1RUJ1 1VBA3 2BBAA 4FFHA 5F2SA 4INDA 3I3BA 3N35A 5F5QA 2VY0A 3VZMA 1RUC3 1IQDC 2MEV1 2R30A 3CL1A 1JOJA 2J42A 4RHV2 2DCZA 1R1ZA 1WW4A 3IAQA 1ZRCA 5FQ0A 5JIAA 5F9TA 2AC1A 4KWUA 2DCJA 4N9IA 3K3NA 5IW0A 3ZFFC 5FLIA 4UFJA 3GJAA 1SDDB 2W9XA 1MVEA 2VMEA 4QM9A 5D1IA 4ZXEA 4XILA 4AVCA 2QE3A 3VDCA 1G8WA 1HDKA 3URFA 3OTFA 2Y34A 1KRIA 2ZGLA 5LY1A 3IWZA 1WLWA 1X82A 4CDUA 2BOIA 3U78A 1QH6A 4NWWA 5A3LA 1ODNA 3NKTA 2G9ZA 2DUOA 4IE6A 3E5XA 4N90A 4W65A 2DBNA 2OZJA 2WWJA 3ILRA 4IV1C 3VKMA 2PAKA 2ORXA 3NNLA 3OBRA 1UPSA 5FZ1A 1S0BA 4XFHA 1W8HA 1CZSA 2VQ0A 1UX6A 5BNQA 4LBQB 3MIHA 3HJRA 4XTPA 4K8FA 1UY3A 2IFRA 2E53A 2ZMKA 2J1SA 4M01A 1AL0G 4CDXA 1APNA 1LGNA 1RXFA 2JECA 2YC4A 2NPIA 1JYTA 1QJX1 1ASJ1 2YB7A 4Q4W1 4N43B 1V9U2 1OOPB 1WKYA 4EN6B 3ENRA 2EICA 4Q2FA 3JQWA 3NO8A 1QXPA 1PX3A 1ZREA 5F3CA 4YRDA 4HVOA 2JWPA 2BV4A 3SXWA 4FPCA 4N7IA 5FKBA 4RHV3 3O1PA 4M00A 4AVBA 2XDVA 4P9GA 1ND3C 2ZGSA 1QJFA 1W8OA 1HB1A 1QJEA 4HBNA 2FZ2A 4NHXA 3AKRA 1KFUL 5KXEA 2XQRA 4BQXA 1XU2A 3HWJA 5IK8A 3P6BA 1W6QA 3FZ3A 1VRH1 5A70A 4KU8A 2PN5A 2WYSA 4W6XA 1WMDA 1UMZA 3VKFC 3U75A 4EROA 5B4NA 1PMIA 2JICA 1W6NB 1AL22 5BNNC 1OLME 2VECA 4WZFA 3NQHA 5T5JA 2V73A 1GBGA 4Z92B 3USUB 5JOWA 1BK1A 4BQ1A 4ATEA 3WEZA 1UOFA 2CV6A 4COYA 1OC1A 1DGRN 4AFMA 4B1LA 5FY0A 2OKXA 5JZGA 1W8NA 2WABA 4Y5SA 4BCUA 4XF1A 5DUUA 2KR2A 5JLVA 1W8UA 3VBSC 4CXXA 2RE9A 4CE8A 1PZ7A 3R4DB 4IE7A 1YUDA 5BNPB 4H2AA 2W39A 2J22A 3AYEA 3POFA 1UY0A 3UGFA 5I8TA 4H7LA 1CONA 1C5HA 2DCTA 1DDLA 2VZSA 4YYOA 2FCTA 2HWB1 2DFCA 1EV12 4QB6A 3VBFC 3WQ1A 2AGSA 2XPJA 5FZAA 4YZ4A 3RRDA 5L36A 3NV1A 1GU3A 2ZGRA 1V9U3 1DFQA 1MZ6A 3VUOA 2PHLA 3LA3A 3ZFFB 1JU4A 2CU5A 5LA2A 4GWMA 2Z42A 1DF0A 5M0TA 4J25A 1H4GA 1UZWA 5FPAA 3HPNA 2HEWF 1E57A 2D6KA 4P9XA 1CIYA 2G9GA 4QKFA 3POYA 2NLRA 3OYWA 3U4XA 4MYEA 1MS8A 2EXIA
chains in the Genus database with same CATH topology
1JYWA 5JXHA 4ZY9A 3W5NA 4HG6B 4JKLA 4MGSA 3CMGA 4D0QA 2XOMA 2WBKA 4QDRA 2BZDA 2J1VA 1T2XA 3FHQA 5G04L 4BXSV 2X09A 1JZ4A 1UWWA 3OB8A 2WZ8A 4UOJA 1TVGA 4D8MA 4KMQA 4E8CA 3JXSA 4P08A 1CZVA 2VZPA 4JX0A 4A6OA 3ACGA 4ZZ8A 4QDQA 3WF4A 3A21A 4IUGA 3DYMA 2HLEA 3C8XA 2W92A 1W9SA 3THCA 3C7FA 3T0AA 3NRUA 3GGLA 2W91A 2VJXA 5LA0A 2B9VA 1UYYA 4CU6A 2VZVA 2J1AA 3CQOA 3LEIA 3F2ZA 2V5DA 2C9KA 3GDBA 3MO4A 2WDBA 2WO1A 1MPXA 3GXUA 2Y6JA 4A44A 2Y6KA 4E8DA 4BK4A 2QQIA 3T2PA 2Y6LA 3OGSA 1UY4A 2C26A 4TXWA 2VOTA 1UYZA 3HNBM 3I3EA 1GOGA 5EJ1B 3A23A 2ID4A 2E32A 1DLCA 1I5PA 3I2JA 2YC2A 1JU3A 2VTFA 2JKXA 2QQJA 4OZOA 4RYDA 1O8SA 4QX1A 3GM8A 2W1WA 2WZEA 3IAPA 3HNMA 2J1EA 1JYNA 5IFTA 1UZ0A 3FL7A 3WF1A 2L9LA 1UMIA 1YQ2A 1L7QA 1H6XA 2VQTA 3OGVA 1GOHA 4LHSA 1JZ5A 4DUWA 2ZEZA 2Y8KA 2QQOA 3WNOA 3WQBA 3CIHA 1O8PA 5A1AA 1DP0A 2V72A 2VMDA 3C7HA 3SEPA 3K75B 2C4XA 3VDBA 5JXJA 4YPJA 3CKHA 5HPOA 5B4XA 3T2QA 2VZOA 3UETA 3OEAA 4DUXA 2ZEYA 2ZEXA 3HOBA 4MOAA 1TG7A 4XUPA 5C71A 1EUTA 2EIBA 3FN9A 2VZ3A 2ZXQA 2CDPA 5JXIA 4CU9A 1GUIA 1P8JA 2B4KA 4BK5A 3HNYM 4M4RA 4UI9L 1J84A 3K4AA 2QBXA 3NJXA 3I2KA 2Z4FA 3J7HA 4UAPA 2JD9A 3ACFA 3AC0A 4PF1A 2BERA 4TTGA 3A22A 4QB2A 5CYYA 4OMCA 1ULOA 2WO3A 2YG0A 5IFPA 4LPLA 2KD7A 1L7RA 4CUAA 2VQUA 4L0PA 4QX3A 1UY1A 2W95A 2YFUA 4A42A 1XC6A 4A41A 1OF4A 4W50A 3D3AA 3ZM8A 3I2HA 5DPNA 3WNNA 1EUUA 5CZKA 2VCAA 1CX1A 1F4AA 2ZEWA 4DEQA 2RJ2A 3SKJE 2X10A 2VZUA 4A4AA 3VD5A 3LEKA 5I0DA 4PT6A 4XUOA 3OG2A 1F4HA 2WQ8A 4W8JA 1OT5A 1UXZA 2J7MA 4RN5A 5FUIA 3WF2A 4MGQA 4QDSA 2ORZA 2XHNA 1JZ2A 3WNPA 4P5YA 1SHWB 4P02B 2DDUA 3NJVA 2VO5A 5IHRA 1OD3A 4MADA 3CDZB 2Y64A 4QPWA 2WAOA 3IDAA 1W99A 4QB1A 3VD9A 3VD3A 2WUHA 3C7OA 3OGRA 4QX2A 3K46A 3CZJA 1NUKA 2E33A 1UXXX 3MBWA 2R7EB 3LEGA 4AG4A 1OH4A 3HN3A 2W47A 2W5FA 2EIEA 3HEIA 3BGAA 5JUVA 1W0NA 1PMHX 5C7GA 5G05L 4XVHA 2XQXA 3NNGA 1W9WA 2BGPA 1W9TA 1DYOA 2JDAA 1UMHA 3I2FA 3SKVA 3C7EA 4QAWA 3LE0A 3MUY1 4DXSA 1US2A 5DQ0A 3I2GA 4LKSA 4KI5M 1UYXA 2W1QA 3ETPA 3FHAA 1NAEA 3C7GA 3LPGA 2RVAA 1J83A 2VC9A 2BGOA 4BJ0A 4CU7A 3EYPA 1NKGA 2Y6HA 4XUNA 3WSOA 3VD4A 3I3DA 4GWJA 3WNMA 2VCBA 5JXGA 4ARYA 1WCQA 1JZ8A 2WN3A 5JMOA 3BN6A 1JZ3A 1PMJX 1GQPA 3WF3A 4Z2AA 5IYYA 2J1RA 5JR2A 3VD7A 1GOFA 4BDVB 1D7PM 1JYXA 3WNKA 3PUIA 5EIYB 4XUQA 5EJZB 4OYUA 4LQRA 1BHGA 2RV9A 2QQMA 1LNSA 3IB3A 4GZ9A 4JKMA 1US3A 3DYOA 1JYVA 5LCWL 1SG3A 2PQSA 2QQKA 1PX4A 2V4VA 1GNYA 1JHJA 4XUTA 3IIIA 1RYYA 3MV01 3A7QA 2DCKA 3K4ZA 4DXRA 4P00B 2W94A 5HXMA 3LQCA 3ABZA 4OUEA 2VCCA 2YFZA 2BBAA 3I2IA 4CUBA 3I3BA 3K4DA 3UESA 1IQDC 1XNTA 1NX9A 3IAQA 1JZ6A 4XZUG 2VZRA 1R64A 4KWUA 2DCJA 4M4PA 2X05A 4DXTA 1JZ7A 1SDDB 2W9XA 3OBAA 2VMEA 4ZXEA 3THDA 1K42A 4GWIA 3VDCA 3WF0A 3DECA 3WNLA 3PUHA 2LS6A 2Y6GA 4JKKA 2W1SA 4W4ZA 4JHZA 2J1UA 4OMDA 2ORXA 4A45A 3ACHA 1CZSA 2W46A 5F7UA 2VR4A 3HJRA 1K12A 1UY3A 1OF3A 2J1SA 2WN2A 5LA1A 2YC4A 2WO2A 4MO3M 1UX7A 2WAAA 3E1F1 1K3IA 2VMFA 2YB7A 3ACIA 3I97A 4CUCA 1WKYA 2HYXA 1CZTA 2VZQA 1XNAA 1KGYA 2EICA 1PX3A 1ULPA 4ET7A 1XPWA 2JE8A 4ARXA 3T0BA 3EB7A 1W8OA 1HN1A 3T08A 3P1IA 3DYPA 3P6BA 2VL4A 3T0DA 2EIDA 2WYSA 4CVUA 3OEBA 3K77A 2QQNA 2W1UA 3CZUA 1H6YA 3MV11 5B4NA 4PQQA 2E26A 2CDOA 2VZTA 4DUVA 3NQHA 3VDAA 1GMMA 2J1TA 4AAXA 4FI9A 4XURA 2XONA 3SEEA 2E31A 5DMYA 3WEZA 2W87A 3T2OA 2LW8A 2OKXA 2VM9A 1W8NA 2WABA 4CU8A 3LPFA 3ECQA 3MUZ1 2J22A 1UY0A 5IJRA 3W5MA 2VZSA 1JI6A 1KEXA 1O59A 3UNPA 2VMCA 4QB6A 2QQLA 1UY2A 2VZ1A 4QX0A 3T09A 1GU3A 4DEVA 1JU4A 5DN2A 5LA2A 4A3ZA 5J1XA 4ZZ5A 1K45A 2W3JA 3HPNA 1CIYA 3U37A 5C70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JYW A;  5JXH A;  4ZY9 A;  3W5N A;  4HG6 B;  4JKL A;  4MGS A;  3CMG A;  4D0Q A;  2XOM A;  2WBK A;  4QDR A;  2BZD A;  2J1V A;  1T2X A;  3FHQ A;  5G04 L;  4BXS V;  2X09 A;  1JZ4 A;  1UWW A;  3OB8 A;  2WZ8 A;  4UOJ A;  1TVG A;  4D8M A;  4KMQ A;  4E8C A;  3JXS A;  4P08 A;  1CZV A;  2VZP A;  4JX0 A;  4A6O A;  3ACG A;  4ZZ8 A;  4QDQ A;  3WF4 A;  3A21 A;  4IUG A;  3DYM A;  2HLE A;  3C8X A;  2W92 A;  1W9S A;  3THC A;  3C7F A;  3T0A A;  3NRU A;  3GGL A;  2W91 A;  2VJX A;  5LA0 A;  2B9V A;  1UYY A;  4CU6 A;  2VZV A;  2J1A A;  3CQO A;  3LEI A;  3F2Z A;  2V5D A;  2C9K A;  3GDB A;  3MO4 A;  2WDB A;  2WO1 A;  1MPX A;  3GXU A;  2Y6J A;  4A44 A;  2Y6K A;  4E8D A;  4BK4 A;  2QQI A;  3T2P A;  2Y6L A;  3OGS A;  1UY4 A;  2C26 A;  4TXW A;  2VOT A;  1UYZ A;  3HNB M;  3I3E A;  1GOG A;  5EJ1 B;  3A23 A;  2ID4 A;  2E32 A;  1DLC A;  1I5P A;  3I2J A;  2YC2 A;  1JU3 A;  2VTF A;  2JKX A;  2QQJ A;  4OZO A;  4RYD A;  1O8S A;  4QX1 A;  3GM8 A;  2W1W A;  2WZE A;  3IAP A;  3HNM A;  2J1E A;  1JYN A;  5IFT A;  1UZ0 A;  3FL7 A;  3WF1 A;  2L9L A;  1UMI A;  1YQ2 A;  1L7Q A;  1H6X A;  2VQT A;  3OGV A;  1GOH A;  4LHS A;  1JZ5 A;  4DUW A;  2ZEZ A;  2Y8K A;  2QQO A;  3WNO A;  3WQB A;  3CIH A;  1O8P A;  5A1A A;  1DP0 A;  2V72 A;  2VMD A;  3C7H A;  3SEP A;  3K75 B;  2C4X A;  3VDB A;  5JXJ A;  4YPJ A;  3CKH A;  5HPO A;  5B4X A;  3T2Q A;  2VZO A;  3UET A;  3OEA A;  4DUX A;  2ZEY A;  2ZEX A;  3HOB A;  4MOA A;  1TG7 A;  4XUP A;  5C71 A;  1EUT A;  2EIB A;  3FN9 A;  2VZ3 A;  2ZXQ A;  2CDP A;  5JXI A;  4CU9 A;  1GUI A;  1P8J A;  2B4K A;  4BK5 A;  3HNY M;  4M4R A;  4UI9 L;  1J84 A;  3K4A A;  2QBX A;  3NJX A;  3I2K A;  2Z4F A;  3J7H A;  4UAP A;  2JD9 A;  3ACF A;  3AC0 A;  4PF1 A;  2BER A;  4TTG A;  3A22 A;  4QB2 A;  5CYY A;  4OMC A;  1ULO A;  2WO3 A;  2YG0 A;  5IFP A;  4LPL A;  2KD7 A;  1L7R A;  4CUA A;  2VQU A;  4L0P A;  4QX3 A;  1UY1 A;  2W95 A;  2YFU A;  4A42 A;  1XC6 A;  4A41 A;  1OF4 A;  4W50 A;  3D3A A;  3ZM8 A;  3I2H A;  5DPN A;  3WNN A;  1EUU A;  5CZK A;  2VCA A;  1CX1 A;  1F4A A;  2ZEW A;  4DEQ A;  2RJ2 A;  3SKJ E;  2X10 A;  2VZU A;  4A4A A;  3VD5 A;  3LEK A;  5I0D A;  4PT6 A;  4XUO A;  3OG2 A;  1F4H A;  2WQ8 A;  4W8J A;  1OT5 A;  1UXZ A;  2J7M A;  4RN5 A;  5FUI A;  3WF2 A;  4MGQ A;  4QDS A;  2ORZ A;  2XHN A;  1JZ2 A;  3WNP A;  4P5Y A;  1SHW B;  4P02 B;  2DDU A;  3NJV A;  2VO5 A;  5IHR A;  1OD3 A;  4MAD A;  3CDZ B;  2Y64 A;  4QPW A;  2WAO A;  3IDA A;  1W99 A;  4QB1 A;  3VD9 A;  3VD3 A;  2WUH A;  3C7O A;  3OGR A;  4QX2 A;  3K46 A;  3CZJ A;  1NUK A;  2E33 A;  1UXX X;  3MBW A;  2R7E B;  3LEG A;  4AG4 A;  1OH4 A;  3HN3 A;  2W47 A;  2W5F A;  2EIE A;  3HEI A;  3BGA A;  5JUV A;  1W0N A;  1PMH X;  5C7G A;  5G05 L;  4XVH A;  2XQX A;  3NNG A;  1W9W A;  2BGP A;  1W9T A;  1DYO A;  2JDA A;  1UMH A;  3I2F A;  3SKV A;  3C7E A;  4QAW A;  3LE0 A;  3MUY 1;  4DXS A;  1US2 A;  5DQ0 A;  3I2G A;  4LKS A;  4KI5 M;  1UYX A;  2W1Q A;  3ETP A;  3FHA A;  1NAE A;  3C7G A;  3LPG A;  2RVA A;  1J83 A;  2VC9 A;  2BGO A;  4BJ0 A;  4CU7 A;  3EYP A;  1NKG A;  2Y6H A;  4XUN A;  3WSO A;  3VD4 A;  3I3D A;  4GWJ A;  3WNM A;  2VCB A;  5JXG A;  4ARY A;  1WCQ A;  1JZ8 A;  2WN3 A;  5JMO A;  3BN6 A;  1JZ3 A;  1PMJ X;  1GQP A;  3WF3 A;  4Z2A A;  5IYY A;  2J1R A;  5JR2 A;  3VD7 A;  1GOF A;  4BDV B;  1D7P M;  1JYX A;  3WNK A;  3PUI A;  5EIY B;  4XUQ A;  5EJZ B;  4OYU A;  4LQR A;  1BHG A;  2RV9 A;  2QQM A;  1LNS A;  3IB3 A;  4GZ9 A;  4JKM A;  1US3 A;  3DYO A;  1JYV A;  5LCW L;  1SG3 A;  2PQS A;  2QQK A;  1PX4 A;  2V4V A;  1GNY A;  1JHJ A;  4XUT A;  3III A;  1RYY A;  3MV0 1;  3A7Q A;  2DCK A;  3K4Z A;  4DXR A;  4P00 B;  2W94 A;  5HXM A;  3LQC A;  3ABZ A;  4OUE A;  2VCC A;  2YFZ A;  2BBA A;  3I2I A;  4CUB A;  3I3B A;  3K4D A;  3UES A;  1IQD C;  1XNT A;  1NX9 A;  3IAQ A;  1JZ6 A;  4XZU G;  2VZR A;  1R64 A;  4KWU A;  2DCJ A;  4M4P A;  2X05 A;  4DXT A;  1JZ7 A;  1SDD B;  2W9X A;  3OBA A;  2VME A;  4ZXE A;  3THD A;  1K42 A;  4GWI A;  3VDC A;  3WF0 A;  3DEC A;  3WNL A;  3PUH A;  2LS6 A;  2Y6G A;  4JKK A;  2W1S A;  4W4Z A;  4JHZ A;  2J1U A;  4OMD A;  2ORX A;  4A45 A;  3ACH A;  1CZS A;  2W46 A;  5F7U A;  2VR4 A;  3HJR A;  1K12 A;  1UY3 A;  1OF3 A;  2J1S A;  2WN2 A;  5LA1 A;  2YC4 A;  2WO2 A;  4MO3 M;  1UX7 A;  2WAA A;  3E1F 1;  1K3I A;  2VMF A;  2YB7 A;  3ACI A;  3I97 A;  4CUC A;  1WKY A;  2HYX A;  1CZT A;  2VZQ A;  1XNA A;  1KGY A;  2EIC A;  1PX3 A;  1ULP A;  4ET7 A;  1XPW A;  2JE8 A;  4ARX A;  3T0B A;  3EB7 A;  1W8O A;  1HN1 A;  3T08 A;  3P1I A;  3DYP A;  3P6B A;  2VL4 A;  3T0D A;  2EID A;  2WYS A;  4CVU A;  3OEB A;  3K77 A;  2QQN A;  2W1U A;  3CZU A;  1H6Y A;  3MV1 1;  5B4N A;  4PQQ A;  2E26 A;  2CDO A;  2VZT A;  4DUV A;  3NQH A;  3VDA A;  1GMM A;  2J1T A;  4AAX A;  4FI9 A;  4XUR A;  2XON A;  3SEE A;  2E31 A;  5DMY A;  3WEZ A;  2W87 A;  3T2O A;  2LW8 A;  2OKX A;  2VM9 A;  1W8N A;  2WAB A;  4CU8 A;  3LPF A;  3ECQ A;  3MUZ 1;  2J22 A;  1UY0 A;  5IJR A;  3W5M A;  2VZS A;  1JI6 A;  1KEX A;  1O59 A;  3UNP A;  2VMC A;  4QB6 A;  2QQL A;  1UY2 A;  2VZ1 A;  4QX0 A;  3T09 A;  1GU3 A;  4DEV A;  1JU4 A;  5DN2 A;  5LA2 A;  4A3Z A;  5J1X A;  4ZZ5 A;  1K45 A;  2W3J A;  3HPN A;  1CIY A;  3U37 A;  5C70 A; 
#chains in the Genus database with same CATH topology
 2NQY A;  2VUA A;  4Z8B A;  3NAP A;  1AF9 A;  5FMO S;  2B39 A;  3ATG A;  3JU9 A;  5BYN A;  5JXH A;  2YV8 A;  1DCS A;  3H3L A;  1UOJ A;  1RUG 2;  2XJR A;  4KG0 A;  3MEP A;  4DY3 A;  4MGS A;  3ZXD A;  1Q8Q A;  2DTY A;  2I2S A;  3CMG A;  1RUI 1;  1RJ7 A;  2WBK A;  1N1Y A;  4QDR A;  2BZD A;  3WDU A;  3FHQ A;  3O1S A;  2X09 A;  1R08 1;  4NR1 A;  1UWW A;  4Q0S A;  3PVO A;  3V0B A;  2PHW A;  3BU7 A;  1BLZ A;  1JUI A;  1MEC 1;  1LKN A;  1WWY A;  1TVG A;  3AXD A;  3MI8 A;  5KBF A;  1LAJ A;  3AX4 A;  4KMQ A;  1PO2 1;  4Q29 A;  5IWF A;  3WP5 A;  4PBO A;  1QJY 2;  4H55 A;  4A6S A;  3LSD A;  4P08 A;  1H4H A;  3TEZ A;  4JX0 A;  1W6O A;  3NST A;  3FLT A;  1N1V A;  4FXG B;  3PIG A;  2IUW A;  4GJY A;  1D2Q A;  4LLO A;  4Q4V 2;  1POV 0;  4FP2 A;  2JDZ A;  3UK9 A;  2IXK A;  1QGL A;  2NM1 A;  3C8X A;  2YBK A;  3PUA A;  3VKL A;  1K5M A;  1WCK A;  2W92 A;  3D4K A;  2JJ6 A;  3IPV B;  3GZE A;  4BME A;  4MX3 A;  3ZVX A;  5FPV A;  1H2N A;  2VJX A;  1LED A;  4JGZ A;  2B9V A;  3WDV A;  4CU6 A;  1EV1 3;  2VZV A;  5LRR A;  5FZ6 A;  1ULE A;  3UL2 A;  2GC0 A;  1WBL A;  1ND3 B;  2UU8 A;  4QKD A;  4DIN B;  1HV1 A;  2FDK A;  1IGO A;  2WIN B;  1XQN A;  5KC5 A;  2C9K A;  3ITQ A;  3DGT A;  1ENR A;  1TQ5 A;  1AR9 1;  3H50 A;  4LO4 B;  3IKW A;  4A44 A;  5IAT A;  2Y6K A;  4ES9 A;  3E6B A;  4U2A A;  1CR7 A;  2C26 A;  1WGP A;  2YPJ A;  2VOT A;  4LK6 A;  4YW5 A;  4AHX A;  3MLL A;  1PVC 1;  2K0G A;  3SCF A;  5IAV A;  5DDJ 3;  4FCA A;  5BNN B;  2VOW A;  5J98 B;  3ZXA C;  4FAG A;  4I01 A;  1IS6 A;  1ZRI A;  5I0R A;  1UZV A;  2E32 A;  3BPS A;  1RUG 3;  1DQ4 A;  2AEZ A;  4V2W A;  1DLC A;  1I5P A;  4JDM A;  5H9S A;  1IPK A;  5KHH A;  2YC2 A;  5JOY A;  5KXD A;  1DQ5 A;  2QQJ A;  1R09 2;  3NNJ A;  1O8S A;  1OUS A;  2BP6 A;  4WBB A;  5FZK A;  2B8M A;  2J1E A;  1CX4 A;  1ULC A;  4ZPI A;  1K5J A;  4P9L A;  5CKQ A;  1YQ2 A;  1L7Q A;  1O3S A;  2VQT A;  4O9G A;  5FRA A;  1ALY A;  2BFU L;  3O0W A;  4XJ9 A;  4NII A;  3CNA A;  3VBF B;  1GOH A;  4CCD A;  5LK7 B;  1QH7 A;  2DUR A;  2GU9 A;  3EO6 A;  2RS3 1;  4Z82 A;  1LB2 A;  1S0F A;  4XZP A;  2LM3 A;  1JTZ X;  2HWC 2;  1Y9M A;  4Q4V 3;  4D6Q A;  1R1A 1;  5A1A A;  5HCA A;  2QJV A;  3OPW A;  4CP1 A;  5J36 A;  2WA3 A;  2B5H A;  5L9B A;  4I2O A;  3H9A A;  4CCL A;  2C6S A;  5JXJ A;  4AGR A;  1PHM A;  2GMM A;  5FXW A;  1ST8 A;  4HVR A;  4XJ8 A;  4PDW A;  1QMJ A;  1NY7 2;  4D7S A;  5HPO A;  2XKP A;  3T2Q A;  1W0O A;  1Q3E A;  3AVS A;  3KB5 A;  2ZHM A;  1DGR A;  2DYC A;  2ZEX A;  2BTV C;  3OBZ A;  5JIU A;  1IS5 A;  5T5L A;  4J1X A;  1FV2 A;  3B9I A;  3CJX A;  1UD1 A;  5LBB A;  4ZHN A;  2GH8 A;  5FPL A;  3ZFE C;  4XFF A;  5JXI A;  2B46 X;  1HB3 A;  1D0G A;  1IHM A;  1E5R A;  1V0A A;  2B4K A;  4YVW A;  3RMX A;  4BK5 A;  4XIO A;  3Q8A A;  2YU1 A;  4LNV A;  2VW1 A;  3VBH C;  2WQ4 A;  1XE7 A;  1QHD A;  4UI9 L;  3G6J B;  3ZXG A;  1LOD A;  1RUF 1;  1CPM A;  3LWC A;  3NJX A;  4TLG A;  3I2K A;  1R09 3;  1HB2 A;  2CY6 A;  2D6P A;  3I2D A;  4ES8 A;  2Z79 A;  4YM3 A;  2HWF 2;  4FPE A;  5C8C C;  4FPK A;  3ACF A;  1D4M 1;  3AC0 A;  4BM8 A;  1CGP A;  1D2S A;  4HL0 A;  1H9P A;  2ZGN A;  3A22 A;  2FDH A;  2GP5 A;  2YU2 A;  4H14 A;  1ULO A;  5CBL A;  2D6O X;  4IGO A;  4LPL A;  1L7R A;  5L9R A;  4GB3 2;  4WZC A;  3WVJ A;  3ZN4 A;  3LDK A;  2ZHK A;  1TNR A;  4IEU A;  5FXV A;  5DZE A;  5GZC A;  5C9A A;  3AKP A;  4DMI A;  4P5H A;  1QKQ A;  2W95 A;  4OI1 A;  3OUI A;  4PJY A;  5I0D A;  2HWC 3;  5GJ6 A;  2ARE A;  3SMH A;  3HQU A;  1ODM A;  2SLI A;  2FCV A;  1Z7S 2;  3LDR A;  1G6N A;  2JG8 B;  4ISQ A;  5CZK A;  3WW3 A;  3LZZ A;  5FY4 A;  1F4A A;  1RHI 2;  2ET1 A;  3KVB A;  2UWB A;  3KLS A;  4CCJ A;  2DVG A;  2X10 A;  5FMB A;  4AQ2 A;  3MPB A;  3LEK A;  5DAW A;  1NA1 B;  2RMU 1;  4PT6 A;  1FPN 2;  3O0X A;  1HXS 1;  3VD5 A;  1LHU A;  1VBD 1;  4X6Q B;  4XUO A;  4CCK A;  1CD3 G;  2ZBJ A;  2PTM A;  1QEX A;  2PHR A;  2AR6 A;  2VNR A;  4M3C B;  4XPV A;  1BMV 2;  2H6B A;  2IXL A;  2WQ8 A;  2OT7 A;  3T2T A;  1OT5 A;  4QHO A;  2VTX J;  1UXZ A;  2J7M A;  3WF2 A;  1ND2 A;  4QDS A;  5EZW A;  1UN1 A;  4AED A;  3HN1 A;  4Y20 B;  4KBB A;  1M06 G;  2OII A;  3NL1 A;  4P9W A;  1C8M 2;  5EXO A;  1REF A;  2YXS A;  3ZFG C;  1JZ2 A;  1EY2 A;  4RGK A;  2DDU A;  4AL9 A;  4LA3 A;  2JB8 A;  5C4W C;  4HFS A;  3KM5 A;  2VO5 A;  5IHR A;  1OD3 A;  4MAD A;  4C8D A;  1ZNP A;  3RYR A;  3ST7 A;  1PNG A;  2D40 A;  1AJK A;  5C33 A;  4NIG A;  1X36 A;  3PJQ A;  3AKQ A;  3PMS A;  4QPW A;  5EJ3 A;  1TME 2;  4E9K A;  4GD4 A;  2JKB A;  3V64 A;  5F37 A;  2HWF 3;  2YZ4 A;  1CPN A;  2BBV A;  2AUY A;  2P34 A;  2TUN A;  1W99 A;  5E88 A;  5A3N A;  1J58 A;  4BLI A;  1PVC 3;  3VD9 A;  2ZX3 A;  3AXE A;  3ZDV A;  5BV6 A;  3CJI B;  2D6M A;  1DLL A;  4GB3 3;  4COU A;  1W03 A;  2E33 A;  2ILM A;  3AL5 A;  4PHZ A;  5E89 A;  1UXX X;  4YZ5 A;  2ZMN A;  5FYM A;  3W58 A;  5AFE A;  3LEG A;  3VBU A;  3AZW A;  4AG4 A;  4R9A A;  1ZBA 1;  1RVF 2;  3ETQ A;  3HN3 A;  2AEN A;  5L19 A;  1SFP A;  4K7J A;  1OUX A;  2RS1 2;  1WA6 X;  1QY4 A;  1Z7S 3;  4HON A;  3TRS B;  3IBM A;  4JRL A;  4DRR A;  5JOZ A;  4YG3 A;  1HQL A;  1LR5 A;  5FYZ A;  2XXZ A;  4QX7 A;  4XVH A;  3ZFE B;  4I0A A;  1FPN 3;  3BOP A;  1SCR A;  3EXU A;  4CDX C;  1PVX A;  1ZZ7 A;  4M3C E;  3VBH B;  2BGP A;  2LAL A;  1W9T A;  3RFR A;  3RZM A;  1XOY A;  4H7M A;  1UMH A;  3SKV A;  2QQU A;  1W2A X;  2BGC A;  3AM2 A;  3HQX A;  4LR4 A;  5IT6 A;  4DXS A;  1V6K A;  3M3I A;  4YM2 A;  3TOJ A;  2FMY A;  1US2 A;  1C8M 3;  3THP A;  4LKS A;  2YPD A;  3KHB A;  4Y26 A;  4Q4Y 2;  5C8C B;  1AR6 1;  1QDC A;  1UYX A;  1AX1 A;  2JG9 A;  2BQP A;  2VH9 A;  3ETP A;  4MHU A;  5KHJ A;  1W3X A;  3OPZ A;  1AX2 A;  1Q56 A;  3QCW A;  3T30 A;  5FPU A;  4OI0 A;  4XMA A;  4JRA A;  3AMQ A;  1AVB A;  2WT2 A;  3OY8 A;  4CCN A;  2JDU A;  4RA0 A;  5F32 A;  4KL1 A;  2Y26 A;  1YJK A;  1GP5 A;  1TME 3;  4BIS A;  1SEF A;  2D6N A;  2V09 A;  2Y6H A;  4XUN A;  1FOD 2;  3U07 A;  3WNM A;  2HEY F;  3AFG A;  2YGM A;  1W2T A;  2ZX2 A;  1N3P A;  2ADE A;  3J8F 1;  3TNQ A;  4G9S B;  5CAZ A;  4Q1R A;  5CFC C;  1JZ3 A;  1OVP A;  1PMJ X;  2PQQ A;  3KT7 A;  1GQP A;  5FXX A;  3WF3 A;  4I0B A;  5FRE A;  2O14 A;  5BUV A;  1RUF 3;  4FPG A;  1UPI A;  1ZYB A;  4XDQ A;  4CP0 A;  4B4Q A;  1REE A;  4EJR A;  2N7G A;  2P3J A;  3VD7 A;  1RVF 3;  3UKV A;  1YQC A;  2RS1 3;  1S0E A;  4UT5 A;  4WM7 A;  4X8P A;  1TEI A;  3T4V A;  2P1B A;  4Q8K A;  4IXL A;  3IM0 A;  3BB6 A;  4JQR A;  1VBB 2;  1YIF A;  2RM2 1;  4LO5 B;  3R4U A;  4KWL A;  3ZFG B;  1CES A;  5E8A A;  3NV2 A;  4AR2 A;  1H2L A;  4K9S A;  4LTA A;  4GMP 3;  5IK7 A;  5C4W B;  4A2U A;  3IB3 A;  4WM8 A;  4IQP A;  3KQR A;  1US3 A;  1RUE 1;  3DYO A;  1V6J A;  2G1M A;  2Q0A A;  3M1H A;  5FMO L;  3ACL A;  4AVV A;  4C90 A;  1JXN A;  1LHW A;  5FZM A;  3WG4 A;  1SPP A;  2QQK A;  2X5I C;  2ET7 A;  4QGM A;  4QPI C;  2JDP A;  3P3N A;  1PX4 A;  1CAX B;  1QJU 2;  3OCP A;  4PI2 A;  2I45 A;  4Q4Y 3;  4NPL A;  5FJH A;  1WZX A;  2JEN A;  2TEP A;  4WVV A;  2WFF 2;  2Y0O A;  4XUT A;  2RMU 3;  4MZU A;  3III A;  1LHO A;  2CTV A;  4FQZ A;  2R16 A;  2A6Y A;  2ZS6 B;  4D69 A;  3HR9 A;  4XFB A;  5FP8 A;  1ZBE 1;  2BNO A;  4R52 A;  1VMH A;  4DXR A;  2EVX A;  3KQ4 B;  5K0U A;  3VL9 A;  3LFM A;  2WL1 A;  2IXH A;  3LQC A;  4OUE A;  1J1T A;  2VCC A;  4K3U A;  3J7M A;  2XML A;  1FOD 3;  3EQE A;  3IZO A;  5FZO B;  1AXY A;  1OLR A;  1QF3 A;  2ZGK A;  4FOY A;  3LCP A;  4G4F A;  4M3C F;  3WCR A;  1O3Q A;  2TBV A;  4YGD A;  1QQP 2;  2VZR A;  4CCE A;  3X29 B;  3ZYB A;  4M4P A;  3AYA A;  5GLV A;  4JV4 A;  2X05 A;  5A6Y A;  2BVB A;  4XJA A;  4CDX B;  4IW3 A;  5D8A A;  1JZ7 A;  1SLB A;  1GZW A;  3OBA A;  1UIJ A;  2CGN A;  3O7O A;  3THD A;  5J7M A;  3RZL A;  4R4Z A;  4IER A;  1K42 A;  5CIR A;  3S57 A;  5FO8 B;  3RS6 A;  5FZB A;  4V1P A;  1AUY A;  1L3J A;  1VBB 3;  5I8S A;  1HRV 1;  1UKR A;  2XHK A;  1E5H A;  4P9Y A;  4YM0 A;  1G9D A;  1K5M C;  3D8C A;  4AWD A;  5K8S A;  3MIF A;  5FP7 A;  5FP4 A;  2VBP A;  4Y1U A;  4JGZ C;  5DXD A;  4ASK A;  1CJD A;  1DU3 D;  4YZ1 A;  1OXC A;  4OMD A;  2ES3 A;  3RGB A;  3TN9 2;  3KHC A;  4XAA A;  2QZ2 A;  3NV3 A;  5ACA 2;  5F7U A;  3GAL A;  5FPZ A;  3ZSM A;  1QOT A;  1W6Q B;  2HWD 2;  4ZS3 A;  1C3H A;  1QJU 3;  4UW4 A;  5LBF A;  5F1R A;  2WFF 3;  2A71 A;  2WO2 A;  5CKN A;  2OZ6 A;  4E4Z A;  3KV4 A;  3LF7 A;  3T1M A;  1UX7 A;  2GAU A;  1G9C A;  2W08 A;  2WAA A;  3AK0 A;  3TB0 A;  1K3I A;  2VMF A;  3ACI A;  3RQ0 A;  2BNM A;  5CFC B;  5JDB A;  5FY5 A;  1KJL A;  2HYX A;  2VZQ A;  2ZX4 A;  1XNA A;  4IEW A;  1FMD 1;  4N53 C;  3H7Y A;  4IEZ A;  4O9E A;  3OD0 A;  5IK5 A;  4ET7 A;  4DIQ A;  4MUV A;  2K46 A;  1HJF A;  3PUR A;  3CLP A;  2JE8 A;  2F17 A;  2WNU C;  2BFU S;  1QQP 3;  1YLL A;  3ZN6 A;  4LBM A;  5LW9 A;  3EB7 A;  1HN1 A;  2WLP A;  3T08 A;  4MXW B;  1AR8 2;  3CHX A;  1PGW 1;  5H9Q A;  4OI4 A;  1COV 2;  2GME A;  5I91 A;  3T0D A;  2GZW A;  1AR7 2;  2EID A;  4AI1 A;  1F2N A;  1FAT A;  4BA6 A;  4S2G A;  1L7L A;  1NE4 A;  2W1U A;  3CZU A;  1H6Y A;  3NJZ A;  1WLC A;  3MV1 1;  2VNV A;  4HXC A;  3TWI A;  3O1R A;  1H8T C;  4Q4X 1;  5DAX A;  1RUC 2;  1GIC A;  1HRI 1;  2CDO A;  2GP3 A;  2X5I B;  3POS A;  4JGY A;  3VGI A;  4QPI B;  1S0J A;  4DUV A;  1NOV A;  4HPK B;  3VDA A;  2D93 A;  2J1T A;  4LMF A;  1BZW A;  3SEE A;  4LUM A;  3MF9 A;  3EJK A;  1LUL A;  3MLK A;  2GMP A;  2MNG A;  2CGO A;  3PUS A;  4PDW C;  3OYW B;  2A6W A;  5HBA A;  1JS9 A;  4AE2 A;  3TN9 3;  3NAP B;  1XYN A;  3I59 A;  2A3X A;  3POG A;  4N7U A;  4Q0P A;  5CIS A;  4Q0U A;  3B69 A;  2GC2 A;  1W3V A;  2A70 A;  1J1L A;  1YRZ A;  2HWD 3;  3A4U A;  4Y22 B;  5JVV A;  4FSJ A;  3WW2 A;  3JQX A;  2E7Q A;  1KEX A;  1O59 A;  4LBN A;  5I0U A;  2VMC A;  3UNP A;  5A3O A;  4QX0 A;  3ZIX A;  5L73 A;  1RIR A;  3LFI A;  5FYT A;  1I1E A;  1Q8P A;  4FOW A;  4TYS A;  5JR7 B;  2OYZ A;  3POB A;  1MQT A;  3S30 A;  4BU2 A;  4OQ8 A;  3PUQ A;  4WVZ A;  4QT6 A;  3T4H B;  3O1T A;  5J1X A;  2ZGM A;  5L7O A;  1EYB A;  3WY6 A;  1K45 A;  2OQ7 A;  4OHV A;  2E63 A;  1LEC A;  3JUU A;  1HKD A;  5LRS A;  3ON7 A;  3U37 A;  2WFP A;  4CDQ B;  3JBG 2;  1D0H A;  4CVU A;  1K5M B;  4OQ9 A;  4X6R B;  1DZQ A;  4AEK A;  3ZXJ A;  4BE3 A;  1AR8 3;  3AZV A;  1COV 3;  1UZY A;  3I4I A;  1GV9 A;  3PLQ A;  4JZR A;  4D7Y A;  2KXL A;  5LBC A;  4JGZ B;  1AR7 3;  2UYB A;  4XDP A;  4C91 A;  4LOS A;  4DOU A;  5BNP C;  5KWR A;  1ZX5 A;  4QGL A;  5CB7 A;  2OW4 A;  1C5I A;  2FCU A;  5DAQ A;  3S5A A;  2VTX A;  1OA2 A;  1EAH 2;  3OB8 A;  2XWB B;  4CZS A;  2WZ8 A;  1ZA4 A;  4LO7 A;  4A7K A;  4L2N A;  3DKQ A;  3S7I A;  2XG3 A;  4IV3 C;  2UUR A;  4LHL A;  5FLJ A;  1JYI A;  1CZV A;  2D5H A;  2PHU A;  1U5I A;  2PLV 1;  4NRM A;  2VZP A;  2YC0 A;  3KF3 A;  5JSP A;  4CDW A;  4XOG A;  2P3I A;  4A6O A;  2EAL A;  3FHI B;  4N53 B;  1MAC A;  5A1F A;  5A33 A;  4GXL A;  4HT1 T;  3LAG A;  4XET A;  3BYW A;  2R04 1;  2FZ1 A;  4LKE A;  5GKA C;  3T0A A;  3H8X A;  2QVS B;  3WHT A;  4HLT A;  2WNU B;  1UYY A;  2VMG A;  4XE9 A;  2P5B A;  4OHW A;  4IEQ A;  2DUP A;  2EAA A;  1T6G C;  2FHR A;  4SLI A;  4IEP A;  1VBC 2;  4XBN A;  5FFO C;  1C1F A;  3O1V A;  1XNK A;  1FXZ A;  3WUD A;  4RQP A;  1SQ4 A;  2ZGO A;  1MPX A;  1OA4 A;  2Y6J A;  3WNX A;  2CAU A;  4E8D A;  4AI3 A;  1I9R A;  2ARB A;  5A3P A;  1GSL A;  4A7Y A;  4CEW C;  5F6K A;  4YW6 A;  1CVN A;  1DIW A;  4E27 A;  4TXW A;  1UYZ A;  2WSV A;  5FUN A;  1NQJ A;  1RUH 2;  2Q8D A;  3WG3 A;  3WP6 A;  1H8T B;  1U5Z A;  3F95 A;  4CTE A;  1X9P A;  5KHG A;  1DZT A;  2IZW A;  3JBG 3;  3JD7 1;  4RS5 A;  2ZAB A;  2Q1M A;  1W2U A;  4QMA A;  1UNB A;  2B45 X;  5JI9 A;  5FZE A;  1WCU A;  3DUI A;  4LE3 A;  4RR3 A;  3ZYP A;  4KQ7 A;  1GZC A;  4PDW B;  1PNF A;  4K21 A;  4YM1 A;  2X53 S;  4DFS A;  3IAP A;  3DKW A;  5DAV A;  3AVR A;  1S4C A;  1UU4 A;  4XJW A;  5GLT A;  1EAH 3;  2JD4 A;  3W59 A;  1CAV A;  4OUM A;  1KXG A;  3N9M A;  3WF1 A;  3LIG A;  1UMI A;  2WZR 1;  4CPB D;  3BTY A;  2IVI B;  5T5O A;  2B42 B;  3OGV A;  3HMY A;  4GH4 C;  4NVP A;  2QUO A;  3I3Q A;  5K4L A;  4LHS A;  3RWK X;  1EPW A;  3QH7 A;  1OQ1 A;  3Q9O A;  1GFF 2;  1CWP A;  5AC9 2;  5FO9 B;  2JB4 A;  4HKL A;  1RUJ 2;  1D4V B;  3CIH A;  4NHY A;  5J48 A;  5DG1 A;  1DP0 A;  4AI2 A;  3C7H A;  4OI2 A;  4QPG C;  5GZF A;  2MEV 2;  2P3Y A;  5FJK A;  3K75 B;  1AZD A;  1B35 A;  2C4X A;  2CHH A;  2XL7 A;  3VBR A;  2FDI A;  3LOI A;  4Q0V A;  4BOW A;  4UFK A;  4LIV A;  1VJ2 A;  3UT0 A;  1CAU B;  5JWP A;  5FZD A;  1O5U A;  2P3K A;  3HQR A;  3OEA A;  4N9H A;  3FUO A;  4DUX A;  1VBC 3;  4NAO A;  4JCK A;  2YUE A;  5IVY A;  2ZJC A;  1POV 1;  4DNY A;  1AHS A;  3GF6 A;  4IES A;  1FT9 A;  3FN9 A;  2YGL A;  3WP4 A;  2QNK A;  4CP9 B;  1A8M A;  2VZ3 A;  2ZXQ A;  1RUH 3;  1W05 A;  3AZX A;  3KCC A;  1HLC A;  1GUI A;  1RIT A;  5BNO A;  3E97 A;  3HBK A;  3PU8 A;  5FZ4 A;  4QQP A;  4EZ4 A;  1VE0 A;  2WSU A;  3HNY M;  3THT A;  4M4R A;  4IV3 B;  2RHP A;  1J84 A;  1QIQ A;  5A7O A;  3K4A A;  1A34 A;  4L99 A;  2BYV E;  3BUC A;  4BLJ A;  5ISL A;  2DV9 A;  3OGG A;  1BQP A;  3ORJ A;  2DUQ A;  2BER A;  1MZ5 A;  4CCM A;  4WM7 C;  2OPK A;  4EN0 A;  3HT2 A;  4YSF A;  4OMC A;  2WO3 A;  1QJX 2;  5IFP A;  2KD7 A;  1ASJ 2;  2VPV A;  2VQU A;  4OCT A;  1BEV 1;  1SDW A;  4Q4W 2;  1RUD 1;  3MW3 A;  4UF0 A;  4YVS C;  4MSV A;  5A7W B;  1IOA A;  4GQ7 A;  4A42 A;  4EYU A;  3OF1 A;  5AC9 3;  1WUV A;  2XLG A;  3AP9 A;  5DZF A;  1RUJ 3;  4KNC A;  4NE9 A;  4A41 A;  2ATF A;  1I5Z A;  4NUB A;  4QGN A;  4W50 A;  5FYS A;  3D3A A;  3W21 A;  3IDB B;  2AAC A;  3N9Q A;  4LO8 A;  3I2H A;  3WD5 A;  4NMI A;  3WNN A;  2MEV 3;  3ZM8 A;  1EUU A;  1W6P B;  4CEW B;  4AQT A;  4Q5O A;  2VCA A;  3T3Y A;  2ZZJ A;  2ZEW A;  4QX8 A;  1CX1 A;  1PM4 A;  2A3Y A;  2HJI A;  4IEV A;  3GHN A;  3SKJ E;  3VV1 A;  2VZU A;  4A4A A;  1AX0 A;  3APB A;  1RL3 A;  1MS0 A;  2C24 A;  4XCB A;  1WME A;  5FTT C;  2HBT A;  4ZS2 A;  2RR1 1;  5CFD A;  3VBO A;  3USS A;  1JOP A;  1VLN A;  2WRA A;  5I93 A;  1VRH 2;  2O8Q A;  1YEW A;  1GWM A;  3ZSK A;  2Q8E A;  3K2O A;  1S2B A;  4RN5 A;  4UXA A;  5AFB A;  3AP7 A;  1NG0 A;  3QBQ A;  4LE4 A;  4UYB A;  3SLI A;  1S55 A;  4P5Y A;  3VDD A;  1SHW B;  4Y1Y A;  3VBU B;  4OLL A;  3RWN A;  3NJV A;  3FJS A;  2ARA A;  1PK6 A;  3GBW A;  5K7P A;  1HW5 A;  1YO8 A;  4GH4 B;  1NT0 A;  1EP0 A;  3OUH A;  3POI A;  2Y64 A;  5DG2 A;  3VHO A;  2O8O A;  4BQY A;  4EN7 B;  2JG8 C;  3ZO0 B;  4W6W A;  1NCR A;  4ISR A;  3RJ2 X;  3QOP A;  1Q43 A;  2R06 1;  1H8V A;  4QPG B;  3GJB A;  1GP6 A;  2NMN A;  1NA1 C;  1U5Y A;  1VAK A;  2HWB 2;  4Y4R A;  1QJX 3;  1XB9 A;  2WA4 A;  3J7N A;  4NIH A;  4QX2 A;  5JSR A;  4XQD A;  1LHN A;  1ASJ 3;  4IEX A;  1N1S A;  4Q4W 3;  1H9W A;  1NUK A;  4G3Y C;  4QX5 A;  3DN7 A;  3M3Q A;  3RYK A;  1OH4 A;  2WR9 A;  3B94 A;  2XVG A;  1NCQ C;  2ZKL A;  5FY9 A;  2W47 A;  1W39 A;  3OY8 B;  1SLL A;  1LU2 A;  1RMU 1;  3GCW A;  2EXK A;  5F5A A;  3UJQ A;  3KD4 A;  1PMH X;  5C7G A;  3AL6 A;  3KV9 A;  3RSJ A;  1F15 A;  4AVA A;  2FBE A;  3OSD A;  2XKO A;  1U5X A;  4KU7 A;  1C1L A;  4MHR A;  4YZ3 A;  1W9W A;  1CAW A;  1RUI 2;  3DPR C;  1VRH 3;  4K8R B;  3WIN E;  4ZKT B;  1B09 A;  2JDA A;  2XWJ B;  4XDO A;  3I2F A;  5FYV A;  3ZYF A;  4QHZ A;  1MZF A;  1OLM A;  1R08 2;  3ZYG A;  2YHJ A;  3NMB A;  4FPJ A;  4CEY C;  4I02 A;  3FX3 A;  1W8F A;  5DQ0 A;  4DS0 A;  3ZKY A;  3CJI C;  1MEC 2;  3NJY A;  3H7J A;  3MIG A;  3FHA A;  1OBN A;  1PO2 2;  2XVL A;  4WM7 B;  3LPG A;  4O65 A;  3EMR A;  1YQ8 A;  3AMM A;  3POW A;  3PVE A;  2ZPX A;  2BGO A;  4YVS B;  3N9N A;  4LBQ A;  2PHT A;  5HV0 A;  3AP5 A;  2VGD A;  2D97 A;  4EE2 A;  5KHI A;  2VUJ A;  1YNA A;  3MYX A;  3CF6 E;  2CWM A;  2RG4 A;  3VD4 A;  4CXW A;  1DYK A;  3PU3 A;  2QDN A;  5A32 B;  2QQV A;  3OD4 A;  2YDE A;  5EWS A;  2W0X A;  5FMC A;  4BQW A;  4E4D X;  2HWB 3;  1JZ8 A;  1WA4 A;  4N43 A;  2AYH A;  1OOP A;  1STM A;  4UFM A;  5FZH A;  5A80 A;  1SLA A;  2VNO A;  1XBF A;  4JGY C;  5HCF A;  2QQP A;  4UFH A;  4CDU B;  4NRO A;  2C1F A;  5FWJ A;  1YC6 1;  1AR9 2;  1YQ5 A;  4AYU A;  5JPM B;  4LLF A;  3ZSJ A;  2Z5W A;  4AVT A;  1BBT 1;  2R1B A;  2OUJ A;  1VBE 1;  5E1R A;  4S2F A;  4OZX A;  2FMD A;  2GAL A;  2LRP A;  4D3W A;  4XUQ A;  4D6S A;  5EIY B;  2AZ5 A;  5JCT A;  1PVC 2;  5ANN A;  4QQO A;  3WZ1 A;  4OYU A;  4LQR A;  4WVM B;  3JB8 A;  3ZYI B;  3CU7 A;  3S6P A;  1LNS A;  2ZHL A;  3U4S A;  3ZDS A;  2OA2 A;  1RUI 3;  2G9F A;  2BWC A;  1KJR A;  2OXB A;  5LCW L;  1W6N A;  1MQT C;  2HH9 A;  3WDW A;  3K48 A;  1R08 3;  2R49 A;  1IQA A;  1T6B X;  5D8A B;  3WOG A;  2R1D A;  1OFN A;  3O0V A;  1J59 A;  1GZW B;  1NLR A;  2CL2 A;  4FT8 A;  1MEC 3;  4Y4Y A;  2V4V A;  1GNY A;  3MF6 A;  3TEY A;  1YJL A;  5JI7 A;  1PO2 3;  1POQ A;  1S2K A;  1H0B A;  3D5O A;  1RYY A;  2WS9 1;  5EPA A;  2RS3 2;  1YQ6 A;  2XJS A;  1ZM1 A;  3EHK A;  3HT1 A;  1AYM 1;  1HV0 A;  1RC6 A;  1R1A 2;  1OPM A;  2W94 A;  1ZRR A;  3B00 A;  4P00 B;  5F8P A;  1AJO A;  5HXM A;  1WD4 A;  4OFG A;  2BW8 A;  5CU1 A;  2CGP A;  4XAB A;  3BI3 A;  1PGL 1;  3AJZ A;  4F83 A;  2WWU A;  3H0O A;  1NCQ B;  1ZZ9 A;  4CUB A;  2XBO 1;  2JE9 A;  3DXT A;  1VMF A;  4TWT A;  1LOG A;  1JZ6 A;  4XZU G;  3V65 A;  1R64 A;  3ZFF A;  4EWE A;  4QXB A;  1JHN A;  1G9A A;  2Y6F A;  2YY1 A;  3O1M A;  1AR9 3;  3H1M A;  4HSL A;  4DXT A;  5FOJ B;  1IS4 A;  3DPR B;  3PTR B;  4XFA A;  4J6G A;  1GAN A;  3MFC A;  2DVA A;  3QAC A;  3R4S A;  1A78 A;  4GIQ A;  3WF0 A;  4CEY B;  3DEC A;  4QPY A;  3WNL A;  3MGU A;  3FBY A;  3VZN A;  4E2S A;  4LHK A;  4IV1 A;  2W2I A;  2X8K A;  3J26 N;  1RXG A;  3D82 A;  1NXD 1;  4JKK A;  1LEN A;  2D3P A;  2ZGP A;  4YG6 A;  1MS3 A;  2VXR A;  1RUF 2;  3ZN6 B;  1JOB A;  1CIW A;  4A45 A;  2GH2 A;  3ACH A;  4RGA A;  2W46 A;  3SQO A;  1D4M 2;  4A3X A;  1DGW X;  3VL8 A;  5HXV A;  3VHN A;  1K12 A;  1XNB A;  1CQ9 A;  2WN2 A;  5BPX A;  4KGG A;  4OHZ A;  5LA1 A;  4XHX A;  2OVU A;  4HKO A;  1E5S A;  4RGG A;  5C3O A;  3KT1 A;  1LTE A;  4MO3 M;  1O5L A;  4NPM A;  5IUQ A;  2VOV A;  2RS3 3;  3E1F 1;  1YCI A;  2ZA9 A;  4GMP 0;  2NYY A;  4JGY B;  2WWS A;  3IIA A;  4FOQ A;  2ZKN A;  4O7X A;  4CUC A;  1FX5 A;  4HMZ A;  3IPV A;  1R1A 3;  4P14 A;  1V6L A;  4U36 A;  4IE5 A;  3G7D A;  1W8T A;  1ULP A;  4HN0 A;  1MR5 A;  1TZO A;  1UQX A;  3I54 A;  3ME2 A;  2JDN A;  3O5S A;  2EA7 A;  4JC1 A;  2KM2 A;  4J1W A;  1IS3 A;  4S2H A;  1ND3 A;  4AOC A;  3K3O A;  1W9Y A;  4EWD A;  5EQU A;  2RMU 2;  3FC0 A;  3T0B A;  3R0R A;  1HXS 2;  4BQ3 A;  1VBD 2;  2ARX A;  3MIB A;  2VVD A;  1AXK A;  3P1I A;  2OS2 A;  2PAE A;  4UW6 A;  4I3P A;  3LIH A;  3SIS A;  3DYP A;  2ERF A;  2O0O A;  3ZIW A;  4EQV A;  3MW4 A;  3AP6 A;  5C6C A;  3H8O A;  1ULD A;  2A75 A;  2Q1Z B;  2QQN A;  2WNE A;  2BWA A;  2XH6 A;  3J7L A;  1MQT B;  3OEB A;  4FP3 A;  3PJY A;  5BNN A;  1LOE A;  5IVV A;  2E26 A;  4K20 A;  3PL0 A;  3N7L A;  1OHF A;  5L7O B;  4JTN A;  1GMM A;  1VMJ A;  1B35 C;  2ZCW A;  5EYX A;  4AAX A;  4OHY A;  2JDH A;  3VZK A;  2VQA A;  5HI0 A;  1JMU B;  2BDR A;  2R32 A;  1DG6 A;  4XBL A;  3WQ7 A;  3WUC A;  3S5Q A;  4MG2 A;  3T2O A;  3ZYR A;  3B3Q E;  4YW4 A;  4ONU A;  1GR3 A;  2VM9 A;  3O12 A;  2VOX A;  3VBS A;  4CU8 A;  5LEJ A;  2E7A A;  3WDT A;  1GQG A;  4AF9 A;  4AEM A;  2V5Y A;  1D4M 3;  3MUZ 1;  5JZG C;  5CG9 A;  1FV3 A;  2ZTN A;  5T50 A;  3LA7 A;  5CG8 A;  1Q8V A;  1RUO A;  2UY8 A;  3GBG A;  3WCS A;  3WR0 A;  3W5M A;  3VBF A;  1MS1 A;  3TNP B;  4XJZ A;  2WNO A;  2E51 A;  1I3H A;  1UY2 A;  2VZ1 A;  3KGL A;  1PO1 1;  4WVW A;  5GM0 A;  3T09 A;  1PIV 1;  5E6H A;  5F39 A;  3ALQ A;  4AHW A;  1MVQ A;  5FQ0 B;  3HBZ A;  1ZBA 2;  3H42 B;  1W8Z A;  4YG0 A;  1IZ3 A;  1W0P A;  4A3Z A;  4ZZ5 A;  4I0W B;  4R8H A;  5GLZ A;  4E4S A;  3FE5 A;  4M0H A;  1XU1 A;  2GN3 A;  4CDW B;  3C2U A;  5FZ9 A;  1W6M A;  2ZOE B;  5FZ7 A;  2GC3 A;  1LEM A;  1HXS 3;  1VBD 3;  3WW4 A;  4FO9 A;  1VRB A;  3BAL A;  2HBU A;  2YMZ A;  3RZJ A;  4HG6 B;  3MW2 A;  4MGZ E;  1VPH A;  3AMP A;  3NAP C;  5C3S A;  3NNF A;  5EV7 A;  3RZH A;  2HWE 1;  2UYA A;  4Y33 A;  3QD6 A;  2XJP A;  2ARC A;  2XOM A;  4YFZ A;  2J1V A;  4I3G A;  1T2X A;  4IGP A;  5G04 L;  1ZVF A;  1AYN 1;  5DUX A;  5EYY A;  2ZGU A;  2R07 1;  2K9Z A;  2R6Q A;  3A0K A;  1AR6 2;  1JUH A;  4UW3 A;  2RS5 1;  2UWC A;  4N8M A;  1WLD A;  1LHV A;  4E8C A;  1HN0 A;  3JXS A;  5JSO A;  3LB9 A;  2VE1 A;  5JPN B;  4R4X A;  4BB3 A;  4NHK A;  1W90 A;  4XJU A;  5T52 A;  3RYP A;  4KGQ A;  1Y9G A;  1WLT A;  3H8R A;  4GUL A;  3I8T A;  4QDQ A;  3DCQ A;  4LIT A;  3MLJ A;  3DYM A;  4O61 A;  1LRH A;  5J96 B;  5C8W A;  1VBA 1;  2MPF A;  3M4F A;  5IVC A;  3J8F 2;  4L92 A;  2W91 A;  4UFI A;  4H3W A;  2RJL A;  2J1A A;  3SHR A;  2CWS A;  2F6B A;  3F2Z A;  1BKZ A;  3IMN A;  2E9Q A;  1CAV B;  2JXA A;  5JAX A;  1OQD A;  1UIK A;  3MO4 A;  5FY8 A;  5GAL A;  1ZBA 3;  2GN7 A;  1ENX A;  4HKW A;  4BK4 A;  1H1A A;  3AMN A;  2QQI A;  5HCH A;  4P9J A;  3T2P A;  3ILN A;  2Y6L A;  4AHY A;  2RM2 2;  1UY4 A;  1IKP A;  4UWD A;  4AQS A;  3I3E A;  4HET A;  5FZ3 A;  1S0C A;  1GOG A;  4BQ4 A;  4M3C A;  3A23 A;  3P5B A;  3VZJ A;  1YWK A;  2ID4 A;  2WC2 A;  1B35 B;  2ZAH A;  3JB4 C;  1RUE 2;  4OVE A;  4E4H A;  1GNZ A;  2QTW B;  4GKY A;  4Y20 A;  1JU3 A;  3UGG A;  3SIT A;  4OZO A;  1OH3 A;  1DQ0 A;  3Q8E A;  1TMF 1;  1V70 A;  4QX1 A;  3RI8 A;  1RED A;  3HAG A;  2GND A;  1IKQ A;  4BZ4 A;  5JZG B;  1AR6 3;  2DBI A;  5IFT A;  5K9Y A;  1UZ0 A;  4NOT A;  4QHB A;  1KS5 A;  1ZRF A;  1SMV A;  3FL7 A;  4JAA A;  2L9L A;  5C5T A;  2E7T A;  4PIX A;  1X33 A;  2X29 A;  1H6X A;  5A3W A;  1Z0H A;  2NN8 A;  1NE6 A;  4PQ9 A;  1ZBE 2;  1NLQ A;  2G4I A;  3J4U H;  1JZ5 A;  3VKN A;  4DUW A;  1GQH A;  5J3U A;  1N47 A;  3U11 A;  2XL9 A;  2RDR A;  2WJS A;  3WNO A;  2XGX A;  4MET A;  4AFD A;  2RJK A;  4LUL A;  1HX6 A;  3WLU A;  3BPZ A;  4COV A;  2VMD A;  4QQ2 A;  2CYF A;  3SEP A;  1QOS A;  3E5Q A;  1V6I A;  3VDB A;  1GWK A;  1H1I A;  2LRO A;  3J8F 3;  3ZLI A;  1C4R A;  1F8V A;  5GZG A;  4RHV 1;  1RIN A;  4XF9 A;  5E16 A;  3RG0 A;  4FBF A;  5B4X A;  5FK7 A;  2VD7 A;  1LOC A;  3R05 A;  1GNH A;  4B4R A;  2VZO A;  2CSG A;  1YI9 A;  4TN7 A;  2D3R A;  3HOB A;  2A3W A;  2I07 B;  2JDK A;  3UYJ A;  3BVC A;  3HD8 B;  2WNV A;  3D0J A;  3RVH A;  1FI2 A;  2QDR A;  5C71 A;  1EUT A;  4NPR A;  2EIB A;  1ONA A;  2RM2 3;  1HRV 2;  3ZXE A;  4CU9 A;  2D7F A;  4LEJ A;  3VBH A;  1PO1 3;  2XVK A;  2IWG B;  4GAL A;  3POJ A;  3OPT A;  4DZG A;  4K40 A;  1RUE 3;  4YVW C;  1U12 A;  1WW7 A;  3V0B B;  2XLF A;  1GP4 A;  4ITC A;  2QBX A;  1YXW A;  2P6H A;  2PMW B;  3N36 A;  4BIF A;  5C8C A;  2Z4F A;  2YBS A;  2XJQ A;  3J7H A;  5FXZ A;  4JHT A;  2DTW A;  1W6O B;  2DVB A;  1BVV A;  1UO9 A;  1IPS A;  2D5F A;  3KCX A;  1SFY A;  2YG0 A;  4KH9 A;  3VKO A;  4QX3 A;  1ZBE 3;  3VDD B;  1XND A;  5KXC A;  2LTN A;  3RJR A;  5LEK A;  1FMD 2;  1UY1 A;  2YFU A;  1V9U 1;  2Q8O A;  3N7M A;  5C9A C;  1NZC A;  1E5I A;  3B02 A;  1OF4 A;  4HN1 A;  1OVS A;  4KWJ A;  5DPN A;  3FFQ A;  2Q8C A;  4XF0 A;  4L8Q A;  3TAY A;  1XJA A;  2RJ2 A;  5F5I A;  1UYP A;  4QKB A;  4TZD A;  4JQT A;  1PGW 2;  1J3Q A;  3WDX A;  3OG2 A;  1KS4 A;  1UZZ A;  1YFX A;  2QCS B;  1S0I A;  4AK3 A;  5BXX A;  2GSY A;  2NZ9 A;  2VUD A;  2YYO A;  2OQ6 A;  3H3Z A;  4CA9 A;  5GZD A;  3ZFG A;  4FOV A;  3POE A;  4XFI A;  5FZG A;  4Q4X 2;  1TNF A;  1SCS A;  3WG1 A;  3LD8 A;  1HRI 2;  1FAY A;  4K1Y A;  1HRV 3;  1W9F A;  2XHN A;  1ND2 C;  5EP9 A;  2IFW A;  5FV3 A;  4YGE A;  5C4W A;  3VZO A;  1BXH A;  3WNP A;  4AED C;  4DPN A;  1ENQ A;  4IET A;  4EN8 B;  1VB2 A;  1AL2 1;  1LJ7 A;  1KDK A;  2A73 B;  4CYD A;  1O3R A;  3FWE A;  1GKB A;  1UW8 A;  4AVS A;  5L9V A;  3L2H A;  3CDZ B;  4FTB A;  1LOB A;  3M70 A;  4AGG A;  4B1M A;  3FMG A;  1CAX A;  3AYC A;  5DAP A;  4K6B A;  3BKZ A;  1CAW B;  2WAO A;  1XE8 A;  2XUM A;  3ASI A;  5FP9 A;  1QNW A;  1GZ9 A;  4NAM A;  4PIZ A;  4QB1 A;  2GC1 A;  4DB5 A;  2AH2 A;  2LUW A;  4NN0 A;  2PXJ A;  2ZHN A;  3C7O A;  3OGR A;  4FPO B;  2R0H A;  3UV9 A;  5I0S A;  3DL3 A;  2WKK A;  1H30 A;  4HVQ A;  3CZJ A;  1EV1 1;  1X8M A;  2VOK A;  3CO2 A;  4XBQ A;  4NIA A;  1Y43 B;  4LT5 A;  2EAK A;  4CDQ C;  1FMD 3;  5FZO A;  3VZL A;  1FYU A;  2P6C A;  1N3Q A;  2R7E B;  4MVT A;  1TMF 3;  3OBT A;  1RUN A;  3PIJ A;  3VBU C;  2VCM A;  1XXN A;  4C1W A;  1O4Y A;  2EIE A;  3HEI A;  3BGA A;  4LHN A;  5DDJ 2;  1OKO A;  4V2V A;  4BWO A;  5FAX A;  5A6Z A;  4D6R A;  2SBA A;  1VAL A;  5DDJ 1;  1LES A;  2XQX A;  1O91 A;  4Q1P A;  5FZF A;  3OJB A;  4AAP A;  1RUG 1;  4YVW B;  1S2E A;  1QWR A;  3BTA A;  4QXK A;  1OI6 A;  1DYO A;  2XR4 A;  3ZSL A;  1MS9 A;  4YZ2 A;  3S0M A;  3AZZ A;  3C7E A;  4LK7 A;  4QAW A;  3WT3 A;  3LE0 A;  3NV4 A;  4MH0 E;  4HSJ A;  4PLO A;  4Q4X 3;  2XLA A;  1HRI 3;  5FP3 A;  3I2G A;  4Q0Q A;  4KI5 M;  4L97 A;  3PDQ A;  2ETE A;  1ULG A;  3JCI A;  4YWA A;  5FPB A;  1O4Z A;  2W1Q A;  4OUL A;  3BTX A;  1CN1 A;  3LDB A;  4FXK B;  1NAE A;  1RB8 G;  3ZR5 A;  3I49 A;  2UWA A;  2JG9 C;  1W04 A;  2PLV 2;  2RVA A;  3U1X A;  4CXY A;  2VC9 A;  4LOT A;  1QJY 1;  3EYP A;  4FPF A;  2YBP A;  5LY2 A;  4NRP A;  2D6L X;  4QD2 A;  1Y3T A;  3WSO A;  2H0V A;  2Q1F A;  3PTY A;  4Q4V 1;  4YAR A;  2R04 2;  4GWJ A;  2ZX0 A;  1YIP A;  5C9A B;  4S2D A;  5GZE A;  1MZE A;  5JXG A;  5CFC A;  4ARY A;  1XYO A;  1WCQ A;  4XIK A;  2WN3 A;  4XF3 A;  2D44 A;  2XJU A;  2VNG A;  5FYI A;  2VUL A;  4LOR A;  1YYN A;  2Y60 A;  1V6O A;  2GNT A;  1HJG A;  1LU1 A;  4NHL A;  2J1R A;  5FR3 A;  5JR2 A;  4F3J A;  5FZI A;  1O7F A;  2BNN A;  2JIJ A;  2YRO A;  4BDV B;  4F8A A;  1DQ6 A;  5T55 A;  3HVD A;  1SBE A;  3PUI A;  4F7Z A;  1RJ8 A;  2WQZ C;  2XUE A;  5IVB A;  2AEY A;  2QQW A;  4MXW A;  3SNM A;  5ABJ A;  1ND2 B;  3EBR A;  1WMX A;  3JD7 2;  4FTS A;  1X9T A;  2NMO A;  4LXL A;  4UBG A;  4AED B;  2RV9 A;  2QQM A;  4LA2 A;  2OPW A;  3KV5 A;  3RZZ A;  4LBL A;  4YW7 A;  1JYV A;  4ORF A;  1SBF A;  4MGT A;  4L9B A;  4WM8 C;  2HYK A;  2PQS A;  3GZA A;  5LAT A;  4DXZ A;  2X5I A;  2C0Z A;  1R09 1;  2P17 A;  4QPI A;  3E6C C;  4HPK A;  1NZI A;  4IE0 A;  4NWV A;  3I3M A;  5T54 A;  1NLS A;  1S1A A;  2Z69 A;  4Y1X A;  5FK8 A;  1WMF A;  2WZR 2;  3WG2 A;  3AKT A;  4FPH A;  1JHJ A;  1V00 A;  4KG8 A;  4CDU C;  2IXJ A;  2PLV 3;  2ENR A;  5A6Q A;  4YNI A;  1Q5O A;  3A7Q A;  3MFA A;  4YW2 A;  3GHM A;  4IV1 B;  4LBQ D;  4LJH A;  5FZC A;  4Y22 A;  3ABZ A;  3ZX7 A;  2HWC 1;  2I74 A;  2Q30 A;  5K0U C;  3MID A;  4SBV A;  1QNY A;  2R04 3;  5AVA A;  3I2I A;  5BY5 A;  1UU6 A;  5JMC A;  1NYW A;  1ZZB A;  4R9C A;  3K4D A;  3UES A;  1XNT A;  5D2A A;  1AL2 3;  3SH5 A;  4HAN A;  4UBH A;  5C3P A;  1NX9 A;  4XXP A;  4CPB A;  4AI8 A;  4Y24 A;  2W68 A;  4FPY A;  2VUC A;  4RFT 0;  1QXJ A;  3N7J A;  2VXJ A;  3M3C A;  5A1L A;  5A7S A;  1NY7 1;  4AGV A;  3TEW A;  3GCX A;  3A0N A;  3OUJ A;  5A7P A;  4B7K A;  3KV6 A;  4ASM B;  4Z2W A;  1QXR A;  2WZP P;  4L11 A;  3KSC A;  4PI0 A;  4GWI A;  2CNA A;  3FBM A;  5D8A C;  5IVJ A;  4QQL A;  3V0A A;  4CDQ A;  5J37 A;  1ULF A;  3VHP A;  2BU9 A;  2QKD A;  3INA A;  3PUH A;  4X8N A;  4CRQ A;  2LS6 A;  3JD7 3;  2Y6G A;  4FQ4 A;  4NJ4 A;  1UAI A;  2B7Y A;  3BOD A;  1QDO A;  2DVF A;  2W1S A;  3GYD A;  3RI9 A;  3ZMN A;  1IG0 A;  4W4Z A;  4R9B A;  1AXZ A;  2J1U A;  4JHZ A;  4PBP A;  2VW0 A;  2JG9 B;  3ILF A;  3ZOI A;  1PZ8 A;  3KZ4 C;  4JTO A;  4FVV A;  3UGH A;  4MGI E;  3SCH A;  2NP0 A;  3U10 A;  4QKN A;  4Z1V A;  3U0Z A;  2A7A A;  2VR4 A;  2FDJ A;  3N9L A;  3PVN A;  1LGB A;  2ZAC A;  2RDN A;  4XAC A;  5A3T A;  2HWF 1;  1OF3 A;  1RGS A;  3M2M A;  2WZR 3;  1O6U A;  1KIT A;  4LBJ A;  2Y0I A;  1BEV 2;  4KBZ A;  2A1X A;  1RUD 2;  4AI0 A;  1XRU A;  1NXM A;  4N53 A;  3I97 A;  4GB3 1;  1KQR A;  2VVF A;  4UFL A;  3IDE A;  1CZT A;  1WW6 A;  3NWK A;  5T3N A;  1KGY A;  3M8L A;  2UY9 A;  4ZXK A;  3ZXF A;  5F3E A;  3M3E A;  2WNU A;  4YGC A;  4YW3 A;  1VB4 A;  1XPW A;  4GKX A;  3BIE A;  1PGS A;  2C5D A;  3DV8 A;  4XTM A;  4ZON A;  3VBS B;  2D3S A;  1Z7S 1;  5DAB A;  4ATF A;  4ARX A;  5CAD A;  1RHI 1;  3GBF A;  5D21 A;  1F9K A;  2RR1 2;  1BVP 1;  3PNA A;  1HQW A;  2PAM A;  3H8U A;  4DQA A;  1FPN 1;  1QJY 3;  1MS5 A;  3GNE A;  4B8E A;  2VL4 A;  1ZZC A;  1POV 3;  1QJZ A;  1BMV 1;  3WXP A;  1QOO A;  4AI9 A;  2WLQ A;  5CVR A;  5FYC A;  1H8T A;  4WM8 B;  1GYK A;  3K77 A;  3ZR6 A;  1U0A A;  5A7N A;  4BQ2 A;  4AEJ A;  4PQQ A;  3KGZ A;  4COW A;  1LOF A;  2VZT A;  1C8M 1;  4I30 A;  2PEL A;  2W52 A;  4RSU A;  5FY7 A;  1F5J A;  1SLC A;  4FI9 A;  1SPP B;  4XUR A;  2XON A;  2E31 A;  5DMY A;  3J9S A;  2W87 A;  4AW7 A;  5FMD A;  3W20 A;  1UOB A;  1W6M B;  2BEO A;  4MLO A;  5ERL A;  3WX5 A;  1EPZ A;  2WT1 A;  5FZL A;  3VB9 A;  3LEM A;  1OMI A;  3N4M A;  2LW8 A;  1SZB A;  4EWA A;  3ZPY A;  4FFG A;  5ANQ A;  1JYC A;  3WDY A;  3LPF A;  5IK4 A;  1XYP A;  2Y38 A;  3ECQ A;  1TME 1;  4B3N A;  2MHF A;  2R06 2;  4LKD A;  1YFY A;  2WNV C;  5K0U B;  3BIW E;  5IJR A;  4LIU A;  3ZYH A;  2VG9 A;  3TEX A;  1JI6 A;  3AFK A;  1KFX L;  1BEV 3;  3MDP A;  1RUD 3;  2QQL A;  3OGJ A;  3PVB B;  1F31 A;  3AJY A;  2VW2 A;  1GWL A;  1WCS A;  2VBB A;  4I09 A;  3UJO A;  4XEZ A;  3WHU A;  4DEV A;  5KC6 A;  2PA7 A;  5DN2 A;  1DQ2 A;  1ENS A;  2O1Q A;  1RMU 2;  2W3J A;  4RD7 A;  3USU A;  2BPA 2;  1OQE A;  1RVF 1;  3ZMO A;  4CP2 A;  4JDN A;  5L7O C;  3KF5 A;  1CAU A;  4IGQ A;  2RS1 1;  5IAX A;  5GLU A;  5DUV A;  5C3Q A;  2KA3 A;  2A5Z A;  2F4P A;  2VBD A;  5KXB A;  3DF0 A;  5TSW A;  4BYY A;  2VAU A;  4YLZ A;  5C70 A;  2C9A A;  2RR1 3;  4PLN A;  4B29 A;  4COZ A;  1JYW A;  3O1O A;  3D6E A;  4ZY9 A;  4GMP 1;  3W5N A;  5BNP A;  1DQ1 A;  4K1Z A;  3PHM A;  4JKL A;  4CP9 A;  2JDM A;  4D0Q A;  4E2G A;  1C28 A;  1J3P A;  2IXI A;  4XFC A;  3P3P A;  3GZT B;  1C57 A;  2OUH A;  3Q8F A;  4LBO A;  4BXS V;  1YI7 A;  1VIW B;  4Y1V A;  2GDF A;  1JZ4 A;  2JX9 A;  4Y5Z 0;  5F3I A;  3CEW A;  3IN9 A;  3B9C A;  2ZGT A;  2XJV A;  4Q4Y 1;  4IV3 A;  1WD3 A;  4UOJ A;  3B01 A;  1S0D A;  4EV0 A;  5LB6 A;  4D8M A;  5LZ6 A;  4XXA A;  3BTZ A;  1UKG A;  5FBZ A;  4XHB A;  3NVC A;  2H0B A;  1W06 A;  3U14 A;  5I8Y A;  5HCB A;  2RDS A;  5EFU A;  3O14 A;  3IT8 A;  2R0F A;  3FFZ A;  4WV8 A;  2JIG A;  4ZZ8 A;  3ACG A;  2DF7 A;  2VMH A;  3A21 A;  3WF4 A;  4QQH A;  4CDW C;  4IUG A;  2HLE A;  4IL7 A;  2R06 3;  1FOD 1;  1W9S A;  3H1W A;  3THC A;  4AHZ A;  3C7F A;  1WBF A;  2HEV F;  2P37 A;  3GGL A;  3NRU A;  5LAS A;  5A7W A;  3AP4 A;  5LA0 A;  3LOB A;  5SV8 A;  3NNM A;  3CQO A;  3LEI A;  5H9P A;  2EIG A;  2V5D A;  2TNF A;  4QWN A;  1FNY A;  1ZA7 A;  2A6Z A;  5I0T A;  3GDB A;  2WDB A;  1Z78 A;  2D98 A;  2WO1 A;  1BBT 2;  2ZZQ A;  3QH6 A;  4PIY A;  1W6P A;  5F6L B;  4CEW A;  1VBE 2;  3GXU A;  2PHX A;  1RMU 3;  4Q27 A;  1IG3 A;  2E6V A;  4RQP C;  4UW5 A;  4XAE A;  5FYB A;  3VLB B;  4Q26 A;  3RMY A;  4IEY A;  3OGS A;  5EHD A;  5KHK A;  3UKN A;  3ES1 A;  3HNB M;  2ADD A;  5FYY A;  2A6X A;  3KT4 A;  5B2G B;  1VBB 1;  3L9J T;  3T1L A;  2EXH A;  2JE7 A;  3B5L B;  5EJ1 B;  2VVE A;  2DU1 A;  1KD7 A;  4RS5 C;  2H6C A;  3FLP A;  3I2J A;  3Q8B A;  3JZV A;  1A6C A;  4Y3O A;  2VTF A;  1W2O A;  2B9U A;  2JKX A;  3H3U A;  4RL7 A;  4RYD A;  1I6X A;  1ZZ8 A;  4RR3 C;  3GM8 A;  2W1W A;  3CBN A;  2WZE A;  5FIX A;  3HNM A;  1H2K A;  2XB6 C;  3M7A A;  1JYN A;  5CNA A;  4BHP A;  3I59 B;  2WNV B;  1RHI 3;  2PYT A;  1QJU 1;  4GH4 A;  4URA A;  2WS9 2;  2ZX1 A;  2CAV A;  2WFF 1;  1RTV A;  2JDY A;  1AYM 2;  3N9O A;  5FWE A;  3TYJ A;  2ZEZ A;  4KWK A;  1OFS A;  1Q8O A;  1W2N A;  2Y8K A;  2QQO A;  4QPG A;  3WQB A;  1PGL 2;  1O8P A;  4XF4 A;  1OLQ A;  3C3V A;  2V72 A;  2XBO 2;  2WT0 A;  1HB4 A;  4IEO A;  3ZSE A;  2FDG A;  3V56 A;  4FTE A;  1C8N A;  4GAZ A;  4YPJ A;  2QFE A;  3VBR C;  4R9D A;  3CKH A;  4XFG A;  1QQP 1;  1LGC A;  1DGW A;  1JBC A;  3MZH A;  1N1T A;  3SCG A;  3MPP G;  3Q8C A;  4XMI A;  3UET A;  2BVV A;  3ZXL A;  1PM7 A;  3HIF A;  2ZEY A;  3BU0 A;  3AKS A;  1BBT 3;  4BMB A;  4MOA A;  4TLF A;  1VBE 3;  1XNC A;  1TG7 A;  4XUP A;  1ZRD A;  4OHX A;  3RZG A;  3ROU A;  1WCD J;  3SC7 X;  3WW1 A;  4Z07 A;  1F35 A;  2BOJ A;  2CDP A;  4AZZ A;  1NQD A;  1TE1 B;  4XQW A;  4B4P A;  4NID A;  5LA9 A;  3UKT A;  1P8J A;  5APA A;  2ZML A;  4AFC A;  1HQN A;  5BNO C;  5HV4 A;  3AB0 A;  3WV6 A;  1OPO A;  1XSQ A;  2BUK A;  2DCY A;  4C0H A;  4DRV A;  1DGL A;  1G9B A;  1UL9 A;  1O3T A;  2HKX A;  5FO7 B;  3TN9 1;  4UAP A;  1G86 A;  2JD9 A;  4ZU7 A;  2DU0 A;  5FOB B;  5ACA 1;  3L2Y A;  3E5U A;  4PF1 A;  2FDF A;  1VR3 A;  1X7N A;  3BOW A;  4FAH A;  4XCA A;  1OSG A;  1SFN A;  5C3R A;  4TTG A;  4QB2 A;  2HWD 1;  5CYY A;  4YVS A;  5A33 B;  2WS9 3;  4M0N A;  4BPZ A;  4MGY E;  4NRQ A;  4CUA A;  5ABJ C;  4CSW A;  3KCY A;  4L0P A;  1AYM 3;  1SLT A;  1LOA A;  2WII B;  1W8W A;  3N7K A;  3S7E A;  5A32 A;  3WQ0 A;  1XC6 A;  5A3U A;  2PHD A;  1S0G A;  3PME A;  5AVP A;  5FZ8 A;  4D7T A;  5T5P A;  2Z2S B;  3O1U A;  2XBO 3;  4RQP B;  3FLR A;  1FNZ A;  1UF2 C;  2DVD A;  3N3H A;  3ZPO A;  4LUK A;  3B7M A;  4D94 A;  2FQP A;  5FY1 A;  4DEQ A;  5FKC A;  4DY5 A;  3I7D A;  2GNM A;  2K2S A;  1A3K A;  2ZAA A;  4QXC A;  4JVA A;  3VN4 A;  3ES4 A;  3W9A A;  2Q4S A;  4RFR B;  1AR8 1;  1F4H A;  1XE0 A;  2D43 A;  5CFD C;  4RS5 B;  1COV 1;  3VBO C;  1PZ9 A;  4W8J A;  3BCW A;  2BRT A;  1AR7 1;  4QXH A;  5FUI A;  5LBE A;  5F5C A;  4MGQ A;  3ZKU A;  4E2Q A;  4EN9 B;  2ORZ A;  4WVM A;  3H1Y A;  4RR3 B;  5FCC A;  1UCX A;  1DHK B;  2P2K A;  1LCL A;  5A6X A;  4P02 B;  1OA3 A;  1RUC 1;  4HOO A;  5IVE A;  4HK8 A;  3VDD C;  5A7Q A;  1Y9Q A;  2EF6 A;  4A7Z A;  3MIE A;  4NO4 A;  1A8D A;  1SBD A;  4NHM A;  3WP3 A;  1PK6 C;  4GJZ A;  2V4A A;  2JG8 A;  4LBK A;  1GZT A;  1KDM A;  5SV5 A;  3NW4 A;  4PF5 A;  5FYH A;  1W28 A;  1N3O A;  5JOX A;  1G9F A;  3KWV A;  3IDA A;  4ASL A;  1NA1 A;  4W6Y A;  1X50 A;  4Q8L A;  1NCR C;  4QU2 A;  3LGR A;  3VD3 A;  2WUH A;  2Q5T A;  4GWN A;  3RZK A;  3SH4 A;  1PO1 2;  4CCO A;  4P9I A;  1PIV 2;  3K46 A;  3NKG A;  3VBR B;  4MV2 A;  3D0S A;  1DYP A;  4PLM A;  3KVA A;  3VHR A;  5FBJ A;  3MBW A;  1NCQ A;  4Y5T A;  3RDI A;  2IC1 A;  2VU9 A;  1Q8S A;  3LSE A;  1O4T A;  3ZYJ B;  4HZF A;  2W5F A;  4CUG A;  4IDZ A;  3B93 A;  4Y1Z A;  5JUV A;  1W0N A;  4BIO A;  3N9P A;  5G05 L;  3RNS A;  1BK0 A;  4YW1 A;  3RPQ A;  3DPR A;  3JBG 1;  3NNG A;  2RDQ A;  1BCX A;  2PHF A;  4AQ6 A;  2HWE 2;  1XSR A;  2IXC A;  3AYD A;  5H9R A;  5BNO B;  2A6V A;  1YHF A;  1H2M A;  4CEY A;  1Y4W A;  5CA6 A;  5FLH A;  2G19 A;  2XJT A;  1QU0 A;  3I2O A;  2PFW A;  1AYN 2;  3R6S A;  4AFB A;  2R07 2;  3MUY 1;  3CJI A;  4B7E A;  2FD8 A;  2GNB A;  4YFW A;  2RS5 2;  3OOX A;  4FPL A;  4LO6 B;  5LK5 A;  5C5U A;  4URT A;  3KMH A;  4MXV A;  1EAH 1;  1F5F A;  2DFB A;  1VP6 A;  5LWB A;  1CJP A;  4C0B A;  3C7G A;  1JH5 A;  4QM8 A;  1J83 A;  1OUR A;  2EXJ A;  4OUS A;  4MGK E;  4BJ0 A;  3MHZ A;  4AXO A;  4CCC A;  4CU7 A;  5ABJ B;  3FUQ A;  4ZU4 A;  1NKG A;  3ZXK A;  4UF0 B;  5FYU A;  4BH9 A;  2F4L A;  1G7Y A;  4JDO A;  3DEM A;  1VBA 2;  3I3D A;  3ZFE A;  4XYX A;  1IPJ A;  4LKF A;  1GLH A;  2VCB A;  4EZH A;  3E6D A;  1VAV A;  3KS7 A;  1ZZ6 A;  2WYF A;  4DO0 A;  1UOG A;  5IVF A;  5JMO A;  3BN6 A;  2Y33 A;  1ACC A;  1LOF C;  1SLI A;  4XC9 A;  1PIV 3;  5A3M A;  4N43 C;  1OOP C;  3LKJ A;  4ZU5 A;  1UU5 A;  1H1M A;  3IMM A;  4Z2A A;  3MIC A;  1DBN A;  5DZG A;  5IYY A;  2JEM A;  5FUP A;  3IDC B;  1HIX A;  1VBC 1;  5CFD B;  1GOF A;  2ZGQ A;  3VBO B;  4AFA A;  3ZN5 A;  5CKM A;  1D7P M;  5ACA 3;  1JYX A;  4PCR A;  3AMH A;  3WNK A;  5EJZ B;  1URX A;  5F2W A;  5FDB A;  2BJS A;  1JN2 P;  5GLW A;  3SH3 A;  3ELN A;  1OKQ A;  2OX0 A;  1MS4 A;  1BHG A;  1RUH 1;  3GZU C;  3LA2 A;  5F3G A;  1M4W A;  2WO7 A;  4BQ5 A;  1YFW A;  4YGB A;  2QZ3 A;  2P4E A;  4GZ9 A;  4JKM A;  2HWE 3;  4IE4 A;  1TMF 2;  3TBD A;  1V6M A;  4QU1 A;  1PK6 B;  1SG3 A;  1JW6 A;  4BXF A;  1AYN 3;  3K51 A;  2R07 3;  3DXU A;  1VAM A;  1X8E A;  2DWR A;  2RS5 3;  4GA9 A;  1DZR A;  3M3O A;  2IVJ A;  2VMI A;  1NCR B;  1BJQ A;  3V0A B;  4HK9 A;  5J09 A;  5KR7 A;  4XQ4 A;  5CEH A;  1YFU A;  3MV0 1;  4TSV A;  1BYH A;  1Y7B A;  1J3R A;  4FFI A;  4XW3 A;  1WW5 A;  4C1X A;  5DUW A;  2DCK A;  3K4Z A;  3QLQ A;  4FFF A;  5FPX A;  1V6N A;  3AZY A;  5FZ0 A;  5AC9 1;  2YFZ A;  1JOD A;  1OD5 A;  1SAC A;  1RUJ 1;  1VBA 3;  2BBA A;  4FFH A;  5F2S A;  4IND A;  3I3B A;  3N35 A;  5F5Q A;  2VY0 A;  3VZM A;  1RUC 3;  1IQD C;  2MEV 1;  2R30 A;  3CL1 A;  1JOJ A;  2J42 A;  4RHV 2;  2DCZ A;  1R1Z A;  1WW4 A;  3IAQ A;  1ZRC A;  5FQ0 A;  5JIA A;  5F9T A;  2AC1 A;  4KWU A;  2DCJ A;  4N9I A;  3K3N A;  5IW0 A;  3ZFF C;  5FLI A;  4UFJ A;  3GJA A;  1SDD B;  2W9X A;  1MVE A;  2VME A;  4QM9 A;  5D1I A;  4ZXE A;  4XIL A;  4AVC A;  2QE3 A;  3VDC A;  1G8W A;  1HDK A;  3URF A;  3OTF A;  2Y34 A;  1KRI A;  2ZGL A;  5LY1 A;  3IWZ A;  1WLW A;  1X82 A;  4CDU A;  2BOI A;  3U78 A;  1QH6 A;  4NWW A;  5A3L A;  1ODN A;  3NKT A;  2G9Z A;  2DUO A;  4IE6 A;  3E5X A;  4N90 A;  4W65 A;  2DBN A;  2OZJ A;  2WWJ A;  3ILR A;  4IV1 C;  3VKM A;  2PAK A;  2ORX A;  3NNL A;  3OBR A;  1UPS A;  5FZ1 A;  1S0B A;  4XFH A;  1W8H A;  1CZS A;  2VQ0 A;  1UX6 A;  5BNQ A;  4LBQ B;  3MIH A;  3HJR A;  4XTP A;  4K8F A;  1UY3 A;  2IFR A;  2E53 A;  2ZMK A;  2J1S A;  4M01 A;  1AL0 G;  4CDX A;  1APN A;  1LGN A;  1RXF A;  2JEC A;  2YC4 A;  2NPI A;  1JYT A;  1QJX 1;  1ASJ 1;  2YB7 A;  4Q4W 1;  4N43 B;  1V9U 2;  1OOP B;  1WKY A;  4EN6 B;  3ENR A;  2EIC A;  4Q2F A;  3JQW A;  3NO8 A;  1QXP A;  1PX3 A;  1ZRE A;  5F3C A;  4YRD A;  4HVO A;  2JWP A;  2BV4 A;  3SXW A;  4FPC A;  4N7I A;  5FKB A;  4RHV 3;  3O1P A;  4M00 A;  4AVB A;  2XDV A;  4P9G A;  1ND3 C;  2ZGS A;  1QJF A;  1W8O A;  1HB1 A;  1QJE A;  4HBN A;  2FZ2 A;  4NHX A;  3AKR A;  1KFU L;  5KXE A;  2XQR A;  4BQX A;  1XU2 A;  3HWJ A;  5IK8 A;  3P6B A;  1W6Q A;  3FZ3 A;  1VRH 1;  5A70 A;  4KU8 A;  2PN5 A;  2WYS A;  4W6X A;  1WMD A;  1UMZ A;  3VKF C;  3U75 A;  4ERO A;  5B4N A;  1PMI A;  2JIC A;  1W6N B;  1AL2 2;  5BNN C;  1OLM E;  2VEC A;  4WZF A;  3NQH A;  5T5J A;  2V73 A;  1GBG A;  4Z92 B;  3USU B;  5JOW A;  1BK1 A;  4BQ1 A;  4ATE A;  3WEZ A;  1UOF A;  2CV6 A;  4COY A;  1OC1 A;  1DGR N;  4AFM A;  4B1L A;  5FY0 A;  2OKX A;  5JZG A;  1W8N A;  2WAB A;  4Y5S A;  4BCU A;  4XF1 A;  5DUU A;  2KR2 A;  5JLV A;  1W8U A;  3VBS C;  4CXX A;  2RE9 A;  4CE8 A;  1PZ7 A;  3R4D B;  4IE7 A;  1YUD A;  5BNP B;  4H2A A;  2W39 A;  2J22 A;  3AYE A;  3POF A;  1UY0 A;  3UGF A;  5I8T A;  4H7L A;  1CON A;  1C5H A;  2DCT A;  1DDL A;  2VZS A;  4YYO A;  2FCT A;  2HWB 1;  2DFC A;  1EV1 2;  4QB6 A;  3VBF C;  3WQ1 A;  2AGS A;  2XPJ A;  5FZA A;  4YZ4 A;  3RRD A;  5L36 A;  3NV1 A;  1GU3 A;  2ZGR A;  1V9U 3;  1DFQ A;  1MZ6 A;  3VUO A;  2PHL A;  3LA3 A;  3ZFF B;  1JU4 A;  2CU5 A;  5LA2 A;  4GWM A;  2Z42 A;  1DF0 A;  5M0T A;  4J25 A;  1H4G A;  1UZW A;  5FPA A;  3HPN A;  2HEW F;  1E57 A;  2D6K A;  4P9X A;  1CIY A;  2G9G A;  4QKF A;  3POY A;  2NLR A;  3OYW A;  3U4X A;  4MYE A;  1MS8 A;  2EXI A; 
#chains in the Genus database with same CATH homology
 1JYW A;  5JXH A;  4ZY9 A;  3W5N A;  4HG6 B;  4JKL A;  4MGS A;  3CMG A;  4D0Q A;  2XOM A;  2WBK A;  4QDR A;  2BZD A;  2J1V A;  1T2X A;  3FHQ A;  5G04 L;  4BXS V;  2X09 A;  1JZ4 A;  1UWW A;  3OB8 A;  2WZ8 A;  4UOJ A;  1TVG A;  4D8M A;  4KMQ A;  4E8C A;  3JXS A;  4P08 A;  1CZV A;  2VZP A;  4JX0 A;  4A6O A;  3ACG A;  4ZZ8 A;  4QDQ A;  3WF4 A;  3A21 A;  4IUG A;  3DYM A;  2HLE A;  3C8X A;  2W92 A;  1W9S A;  3THC A;  3C7F A;  3T0A A;  3NRU A;  3GGL A;  2W91 A;  2VJX A;  5LA0 A;  2B9V A;  1UYY A;  4CU6 A;  2VZV A;  2J1A A;  3CQO A;  3LEI A;  3F2Z A;  2V5D A;  2C9K A;  3GDB A;  3MO4 A;  2WDB A;  2WO1 A;  1MPX A;  3GXU A;  2Y6J A;  4A44 A;  2Y6K A;  4E8D A;  4BK4 A;  2QQI A;  3T2P A;  2Y6L A;  3OGS A;  1UY4 A;  2C26 A;  4TXW A;  2VOT A;  1UYZ A;  3HNB M;  3I3E A;  1GOG A;  5EJ1 B;  3A23 A;  2ID4 A;  2E32 A;  1DLC A;  1I5P A;  3I2J A;  2YC2 A;  1JU3 A;  2VTF A;  2JKX A;  2QQJ A;  4OZO A;  4RYD A;  1O8S A;  4QX1 A;  3GM8 A;  2W1W A;  2WZE A;  3IAP A;  3HNM A;  2J1E A;  1JYN A;  5IFT A;  1UZ0 A;  3FL7 A;  3WF1 A;  2L9L A;  1UMI A;  1YQ2 A;  1L7Q A;  1H6X A;  2VQT A;  3OGV A;  1GOH A;  4LHS A;  1JZ5 A;  4DUW A;  2ZEZ A;  2Y8K A;  2QQO A;  3WNO A;  3WQB A;  3CIH A;  1O8P A;  5A1A A;  1DP0 A;  2V72 A;  2VMD A;  3C7H A;  3SEP A;  3K75 B;  2C4X A;  3VDB A;  5JXJ A;  4YPJ A;  3CKH A;  5HPO A;  5B4X A;  3T2Q A;  2VZO A;  3UET A;  3OEA A;  4DUX A;  2ZEY A;  2ZEX A;  3HOB A;  4MOA A;  1TG7 A;  4XUP A;  5C71 A;  1EUT A;  2EIB A;  3FN9 A;  2VZ3 A;  2ZXQ A;  2CDP A;  5JXI A;  4CU9 A;  1GUI A;  1P8J A;  2B4K A;  4BK5 A;  3HNY M;  4M4R A;  4UI9 L;  1J84 A;  3K4A A;  2QBX A;  3NJX A;  3I2K A;  2Z4F A;  3J7H A;  4UAP A;  2JD9 A;  3ACF A;  3AC0 A;  4PF1 A;  2BER A;  4TTG A;  3A22 A;  4QB2 A;  5CYY A;  4OMC A;  1ULO A;  2WO3 A;  2YG0 A;  5IFP A;  4LPL A;  2KD7 A;  1L7R A;  4CUA A;  2VQU A;  4L0P A;  4QX3 A;  1UY1 A;  2W95 A;  2YFU A;  4A42 A;  1XC6 A;  4A41 A;  1OF4 A;  4W50 A;  3D3A A;  3ZM8 A;  3I2H A;  5DPN A;  3WNN A;  1EUU A;  5CZK A;  2VCA A;  1CX1 A;  1F4A A;  2ZEW A;  4DEQ A;  2RJ2 A;  3SKJ E;  2X10 A;  2VZU A;  4A4A A;  3VD5 A;  3LEK A;  5I0D A;  4PT6 A;  4XUO A;  3OG2 A;  1F4H A;  2WQ8 A;  4W8J A;  1OT5 A;  1UXZ A;  2J7M A;  4RN5 A;  5FUI A;  3WF2 A;  4MGQ A;  4QDS A;  2ORZ A;  2XHN A;  1JZ2 A;  3WNP A;  4P5Y A;  1SHW B;  4P02 B;  2DDU A;  3NJV A;  2VO5 A;  5IHR A;  1OD3 A;  4MAD A;  3CDZ B;  2Y64 A;  4QPW A;  2WAO A;  3IDA A;  1W99 A;  4QB1 A;  3VD9 A;  3VD3 A;  2WUH A;  3C7O A;  3OGR A;  4QX2 A;  3K46 A;  3CZJ A;  1NUK A;  2E33 A;  1UXX X;  3MBW A;  2R7E B;  3LEG A;  4AG4 A;  1OH4 A;  3HN3 A;  2W47 A;  2W5F A;  2EIE A;  3HEI A;  3BGA A;  5JUV A;  1W0N A;  1PMH X;  5C7G A;  5G05 L;  4XVH A;  2XQX A;  3NNG A;  1W9W A;  2BGP A;  1W9T A;  1DYO A;  2JDA A;  1UMH A;  3I2F A;  3SKV A;  3C7E A;  4QAW A;  3LE0 A;  3MUY 1;  4DXS A;  1US2 A;  5DQ0 A;  3I2G A;  4LKS A;  4KI5 M;  1UYX A;  2W1Q A;  3ETP A;  3FHA A;  1NAE A;  3C7G A;  3LPG A;  2RVA A;  1J83 A;  2VC9 A;  2BGO A;  4BJ0 A;  4CU7 A;  3EYP A;  1NKG A;  2Y6H A;  4XUN A;  3WSO A;  3VD4 A;  3I3D A;  4GWJ A;  3WNM A;  2VCB A;  5JXG A;  4ARY A;  1WCQ A;  1JZ8 A;  2WN3 A;  5JMO A;  3BN6 A;  1JZ3 A;  1PMJ X;  1GQP A;  3WF3 A;  4Z2A A;  5IYY A;  2J1R A;  5JR2 A;  3VD7 A;  1GOF A;  4BDV B;  1D7P M;  1JYX A;  3WNK A;  3PUI A;  5EIY B;  4XUQ A;  5EJZ B;  4OYU A;  4LQR A;  1BHG A;  2RV9 A;  2QQM A;  1LNS A;  3IB3 A;  4GZ9 A;  4JKM A;  1US3 A;  3DYO A;  1JYV A;  5LCW L;  1SG3 A;  2PQS A;  2QQK A;  1PX4 A;  2V4V A;  1GNY A;  1JHJ A;  4XUT A;  3III A;  1RYY A;  3MV0 1;  3A7Q A;  2DCK A;  3K4Z A;  4DXR A;  4P00 B;  2W94 A;  5HXM A;  3LQC A;  3ABZ A;  4OUE A;  2VCC A;  2YFZ A;  2BBA A;  3I2I A;  4CUB A;  3I3B A;  3K4D A;  3UES A;  1IQD C;  1XNT A;  1NX9 A;  3IAQ A;  1JZ6 A;  4XZU G;  2VZR A;  1R64 A;  4KWU A;  2DCJ A;  4M4P A;  2X05 A;  4DXT A;  1JZ7 A;  1SDD B;  2W9X A;  3OBA A;  2VME A;  4ZXE A;  3THD A;  1K42 A;  4GWI A;  3VDC A;  3WF0 A;  3DEC A;  3WNL A;  3PUH A;  2LS6 A;  2Y6G A;  4JKK A;  2W1S A;  4W4Z A;  4JHZ A;  2J1U A;  4OMD A;  2ORX A;  4A45 A;  3ACH A;  1CZS A;  2W46 A;  5F7U A;  2VR4 A;  3HJR A;  1K12 A;  1UY3 A;  1OF3 A;  2J1S A;  2WN2 A;  5LA1 A;  2YC4 A;  2WO2 A;  4MO3 M;  1UX7 A;  2WAA A;  3E1F 1;  1K3I A;  2VMF A;  2YB7 A;  3ACI A;  3I97 A;  4CUC A;  1WKY A;  2HYX A;  1CZT A;  2VZQ A;  1XNA A;  1KGY A;  2EIC A;  1PX3 A;  1ULP A;  4ET7 A;  1XPW A;  2JE8 A;  4ARX A;  3T0B A;  3EB7 A;  1W8O A;  1HN1 A;  3T08 A;  3P1I A;  3DYP A;  3P6B A;  2VL4 A;  3T0D A;  2EID A;  2WYS A;  4CVU A;  3OEB A;  3K77 A;  2QQN A;  2W1U A;  3CZU A;  1H6Y A;  3MV1 1;  5B4N A;  4PQQ A;  2E26 A;  2CDO A;  2VZT A;  4DUV A;  3NQH A;  3VDA A;  1GMM A;  2J1T A;  4AAX A;  4FI9 A;  4XUR A;  2XON A;  3SEE A;  2E31 A;  5DMY A;  3WEZ A;  2W87 A;  3T2O A;  2LW8 A;  2OKX A;  2VM9 A;  1W8N A;  2WAB A;  4CU8 A;  3LPF A;  3ECQ A;  3MUZ 1;  2J22 A;  1UY0 A;  5IJR A;  3W5M A;  2VZS A;  1JI6 A;  1KEX A;  1O59 A;  3UNP A;  2VMC A;  4QB6 A;  2QQL A;  1UY2 A;  2VZ1 A;  4QX0 A;  3T09 A;  1GU3 A;  4DEV A;  1JU4 A;  5DN2 A;  5LA2 A;  4A3Z A;  5J1X A;  4ZZ5 A;  1K45 A;  2W3J A;  3HPN A;  1CIY A;  3U37 A;  5C70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...