4ZY9A

X-ray crystal structure of selenomethionine-labelled v110m mutant of chitosan-binding module 1 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
HHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGGIDDITFTARTAKYVRMHGTVRGTPYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glucanase/chitosanase
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
total genus 32
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zy9A00
4BXSV 4OMDA 2WBKA 4A44A 1PMJX 4ET7A 3IAPA 1GUIA 1H6YA 4CUCA 4PF1A 5JUVA 2WN3A 3K4AA 4QX2A 2V72A 2E32A 3LEKA 4Z2AA 2ORZA 2EICA 2XQXA 2QQKA 3PUIA 1K42A 3I3EA 4UOJA 3CDZB 3P1IA 2Y64A 3J7HA 5B4XA 4CU9A 3VDBA 1UMHA 3HEIA 3WQBA 4ARXA 1I5PA 2X10A 1D7PM 2JKXA 2HLEA 3C7EA 2W1QA 5C7GA 4ARYA 1JZ8A 4E8DA 2WAAA 3IB3A 3E1F1 2RV9A 2VJXA 3I3BA 4MADA 4DUXA 3WNOA 1JHJA 3CIHA 4DXRA 4ZZ5A 2J1TA 1TG7A 5JR2A 2W91A 3T08A 2VMFA 5DN2A 3K4ZA 5G05L 1GOHA 1J84A 2ID4A 2C26A 2ZXQA 4LQRA 2CDPA 2W46A 1GOFA 3C8XA 5EIYB 3T2PA 4LKSA 2BZDA 2C9KA 5DMYA 5JXGA 3I2FA 1SHWB 1K3IA 4QDQA 3I2HA 5EJZB 2Y8KA 1F4HA 3T09A 2W95A 1UY1A 4QX0A 2WAOA 3WF3A 1CX1A 1H6XA 1NAEA 2Y6KA 3ETPA 3WF0A 5EJ1B 1SG3A 1OD3A 5A1AA 2VO5A 1UZ0A 4D8MA 2VZSA 4UAPA 1TVGA 4CU8A 1OF3A 2VZ3A 3I3DA 4TXWA 2DCJA 3FN9A 1UWWA 1JYXA 3K77A 1XNTA 3T0DA 4RYDA 1JZ7A 4QDSA 3WEZA 2VC9A 4PQQA 2WO3A 2VOTA 4P02B 3K75B 3FL7A 2PQSA 3I2IA 3OGSA 1PX4A 3WNKA 4QAWA 1SDDB 5IFTA 5HPOA 2CDOA 1IQDC 3HPNA 1GMMA 2WUHA 2W9XA 3WSOA 2WN2A 2YC4A 2W1WA 5DPNA 3HNBM 5JXIA 2B4KA 3T0BA 3T0AA 3ZM8A 1K12A 2OKXA 3JXSA 4LPLA 1UXXX 2J7MA 3NRUA 2B9VA 4M4PA 4IUGA 3VD3A 3VD4A 2LS6A 1UXZA 4QDRA 4XUTA 3PUHA 4MO3M 4KMQA 4JKMA 4RN5A 4OMCA 5HXMA 2LW8A 3ACIA 1J83A 5J1XA 2Z4FA 1O8PA 2R7EB 1W8NA 1JZ5A 2VMCA 1F4AA 1JYNA 1US2A 2J22A 3WNPA 1UMIA 2BBAA 2VTFA 4JX0A 4DUWA 1R64A 2RVAA 1MPXA 3GDBA 2Y6JA 3GGLA 3CZJA 3ACGA 3WNNA 1JYWA 2VR4A 2W5FA 4YPJA 2Y6GA 1L7RA 2ORXA 3SEPA 2ZEXA 4W50A 2VZOA 4DEVA 4E8CA 1CZSA 2W92A 4CUBA 1W0NA 5C70A 3GXUA 3VDAA 1GQPA 4CVUA 4JHZA 4UI9L 2QQMA 2QQJA 2W3JA 3HJRA 2ZEZA 5IFPA 3FHAA 3UNPA 1KGYA 3ECQA 2L9LA 1T2XA 4CU6A 3SKJE 3NJXA 1GU3A 2V4VA 1DP0A 4ZXEA 3EYPA 3I97A 3SEEA 4GWJA 3VDCA 5B4NA 3K4DA 3OGVA 1JYVA 3C7OA 2VZRA 4MOAA 3DYMA 4P5YA 3THDA 5I0DA 3BGAA 3K46A 3WF2A 2QQNA 3MO4A 1P8JA 3MV01 1UYZA 4LHSA 4XUNA 1HN1A 3OEAA 4L0PA 3FHQA 4A4AA 2VMEA 2VZ1A 1JZ4A 3C7FA 4DXTA 5JXHA 2EIDA 5IYYA 1W9WA 3VD9A 5C71A 3WNMA 4XUOA 1PMHX 3HNYM 2HYXA 1UY2A 3I2KA 3LQCA 3CZUA 2VCCA 4PT6A 3UETA 1KEXA 3OG2A 2X05A 1NX9A 2WO2A 2WQ8A 2YG0A 4HG6B 3SKVA 1W8OA 3CQOA 4OUEA 1UY4A 2ZEYA 1NUKA 3F2ZA 2BGOA 3WF1A 3UESA 3WNLA 3MBWA 3C7HA 4A6OA 1XPWA 2VZTA 2VMDA 3ACHA 4XZUG 2J1AA 5F7UA 2W87A 3I2JA 3IAQA 2EIBA 1UX7A 3ACFA 4XVHA 4GWIA 2J1EA 1OH4A 3NQHA 5JMOA 1JZ2A 1O59A 2QQOA 2VM9A 5LA2A 1UY3A 2E26A 4QB2A 1JI6A 1XNAA 3HOBA 2QQLA 2YB7A 2BERA 3BN6A 4DUVA 3LEGA 3VD7A 1CIYA 1UY0A 3THCA 1DYOA 5JXJA 4BK5A 3NJVA 3MUY1 2J1RA 2E31A 3IDAA 3LPFA 4D0QA 5FUIA 5LCWL 3AC0A 2C4XA 1W9TA 4XURA 4TTGA 4XUPA 4FI9A 4QB1A 3LE0A 3GM8A 2JDAA 4MGQA 3MUZ1 4GZ9A 2J1VA 1CZTA 3HNMA 2E33A 2VZVA 4A42A 2KD7A 3CKHA 4DXSA 2VL4A 4W4ZA 3WF4A 1US3A 3EB7A 1JU3A 4BK4A 3MV11 3P6BA 2RJ2A 3U37A 1ULPA 2WZEA 4QB6A 3D3AA 4A41A 4W8JA 2QBXA 4QX1A 2W1UA 5CZKA 3W5MA 2Y6LA 3I2GA 4QX3A 2WO1A 1L7QA 3A7QA 3OBAA 4CU7A 1K45A 3NNGA 5DQ0A 2WYSA 4ZZ8A 4OYUA 4CUAA 2QQIA 4A45A 1W9SA 3LPGA 4XUQA 3T2QA 3CMGA 4BDVB 4MGSA 2VQTA 4DEQA 1YQ2A 1NKGA 5LA0A 2W1SA 4P00B 3ABZA 3VD5A 2XHNA 3IIIA 1LNSA 3HN3A 2J1SA 2Y6HA 4OZOA 1GOGA 1WCQA 3OB8A 4JKKA 2WZ8A 2J1UA 2VCBA 3A21A 2YFZA 2ZEWA 1OT5A 2JE8A 2W94A 2BGPA 1BHGA 1RYYA 1EUUA 5LA1A 1GNYA 2XONA 2XOMA 1UYXA 2EIEA 4BJ0A 2WABA 1CZVA 3LEIA 1UYYA 2JD9A 1EUTA 1PX3A 5IJRA 1O8SA 2VZUA 3DYOA 1JZ3A 2YC2A 3T2OA 4JKLA 2VZPA 4KI5M 4KWUA 3W5NA 2DDUA 4AG4A 2VCAA 5CYYA 3A23A 3DECA 3DYPA 4A3ZA 4M4RA 2VZQA 1W99A 3OGRA 1WKYA 1JU4A 1XC6A 4P08A 5G04L 4QPWA 1JZ6A 3OEBA 1ULOA 2DCKA 2YFUA 2V5DA 1DLCA 4ZY9A 2WDBA 5IHRA 2W47A 3C7GA 1OF4A 4AAXA 3A22A 2X09A 2VQUA
chains in the Genus database with same CATH superfamily
2PELA 3QH7A 4N43A 1STMA 4I30A 4RA0A 2XJRA 1VMFA 1AR83 4QPGC 2G1MA 5E89A 1FOD3 1HRV1 4IERA 1OBNA 4QX5A 4LKEA 2WN3A 5L19A 1YQ5A 2XVGA 2ZS6B 3DN7A 1RVF1 1OI6A 2JKBA 2XQXA 2EXIA 2QQKA 3PUIA 4H7MA 4FPCA 1LOAA 5FIXA 5GZFA 4IDZA 2PYTA 4MUVA 2AACA 3TB0A 3WDTA 4MGYE 1SLAA 3AJZA 2CWSA 1OQ1A 1ZA7A 1QJY2 3N9OA 2RM23 4IL7A 3ZVXA 4Q4W3 4YVWB 5JSOA 2Y64A 3NMBA 1SQ4A 2ZKNA 5HCHA 1FX5A 2R061 2JKXA 1BBT2 2PXJA 3N9QA 2W1QA 4TWTA 5C7GA 4ARYA 1NCQC 4OHXA 3IB3A 3PUAA 2LROA 1AR72 1VBB1 2WZPP 2FDGA 4JTNA 3T30A 4JV4A 3H7JA 1JHJA 1OLQA 4Y5SA 5FYVA 2R30A 4DXRA 1HIXA 4ZZ5A 1RUH3 4Y20A 4D94A 2J1TA 4NHKA 5KXEA 2WNOA 4LT5A 1WBFA 4CPBD 3TEXA 3T08A 2WT1A 4HSJA 4W6WA 5G05L 1HB1A 4NIGA 2FZ1A 5FZ1A 4UBHA 3OSDA 1MZ5A 3RWKX 1R092 3K2OA 1H1AA 4N53B 3HT1A 5FZEA 2ZMKA 1H8TC 5EZWA 3I3MA 1GKBA 2HKXA 3MW2A 5F6KA 1DLLA 1MR5A 4HN0A 2CDPA 5LEKA 1O5LA 1R1A3 1W6PA 5K7PA 4QD2A 3ZSLA 4CDWB 4FOWA 2HWD1 2Z79A 3ETQA 4Z82A 4HANA 4QQPA 4H7LA 4HKLA 1CX4A 2IXHA 1PO11 5DMYA 1Z0HA 2BVVA 2UY9A 3V64A 2I2SA 5APAA 5I0UA 4NAOA 4ATEA 5JOYA 1MQTA 3IT8A 5KHGA 4MGTA 1K3IA 4QDQA 4AYUA 3S30A 3FHIB 4AFMA 3AYDA 1LOCA 5EJZB 1FPN1 1Y9GA 2BW8A 3E97A 5EFUA 3T2TA 1WA4A 1CJDA 1DQ5A 1S0FA 5T3NA 4Z8BA 4XF4A 5FPLA 4QX0A 3WQ0A 2VY0A 4R4ZA 3EJKA 5FZFA 1ST8A 2VXJA 2JDNA 1AYM2 2R071 2VOKA 2K9ZA 1H9WA 5DUVA 3WF0A 5IAXA 4AQSA 1OD3A 4M00A 4HOOA 2AGSA 2VAUA 1ENRA 3V56A 1UOGA 1VR3A 4OVEA 2BWAA 4R4XA 3RFRA 3H42B 3KLSA 3MIEA 5FMDA 2PFWA 2VZ3A 2WA3A 1UW8A 1D4M3 4TXWA 1W0PA 1BMV2 2DCJA 3O1MA 2ZA9A 5FPZA 3ZXDA 1ULCA 1S1AA 3FN9A 5JZGC 1UWWA 3IMNA 3J8F1 4JGZC 2PAKA 4NPRA 4CXXA 5FY8A 3IMMA 4BMBA 4ZKTB 1JYXA 4XFAA 3ZFGB 1XNTA 1S55A 3T0DA 4OI4A 4HK9A 4JRAA 1APNA 2LALA 2QCSB 3WEZA 2P3KA 5C3QA 2VC9A 4Y22B 3KGLA 4YM3A 2Q30A 4ZHNA 3KVAA 4RGGA 1F9KA 1CAWB 1A8MA 3B01A 3EQEA 1QIQA 3PTRB 4NHYA 1LHNA 1GR3A 1OFSA 2D97A 1Y43B 4IE5A 5LBBA 4PIYA 3APBA 4QAWA 4I0WB 2UWBA 3NKGA 1GMMA 1I1EA 1RUF1 1RGSA 2RS51 3WSOA 3EHKA 5D1IA 1J3PA 3AKPA 2W1WA 5DPNA 5F5QA 4FFIA 3G7DA 3UJOA 4H3WA 1UO9A 3MDPA 5JXIA 1SPPA 3P5BA 3T0AA 1F8VA 1S0JA 4P9XA 5F3GA 4LUKA 1W8UA 5FXZA 3VBFB 5CEHA 2GAUA 4LPLA 3O1SA 5FQ0B 5FKCA 1H9PA 1LEMA 2Y0IA 3UKNA 4KWJA 3NRUA 5DDJ1 2AENA 2MPFA 3BYWA 1WMDA 4XFIA 5JCTA 4UFKA 4DNYA 3OTFA 4BU2A 2I07B 2XQRA 1OC1A 4XACA 2YDEA 5J37A 3ZFFB 1Y9MA 4M0NA 2X5IB 2A3XA 2DFCA 3MF9A 4Q0UA 4B1MA 4AI1A 4YW4A 3ZX7A 1WUVA 3FBMA 5FYIA 1XNBA 2ZAHA 1CWPA 1JHNA 1B35C 1ZBA3 4Q2FA 1FNYA 4QQLA 4CSWA 2H0VA 1QJX2 1UQXA 4EWDA 2WIIB 2C1FA 1W8NA 3E5XA 1OPOA 2ETEA 3TBDA 1UPSA 4D7SA 1UMIA 3MPPG 5LB6A 1RUE3 3DCQA 1BQPA 2NN8A 3RJRA 1YFUA 5C4WC 1Z7S3 2VUAA 5FDBA 3PTYA 3ES1A 2Y6JA 3RMXA 4HK8A 3CZJA 4L92A 1VIWB 4RL7A 4N43C 3HIFA 3OYWA 1HQWA 2EXHA 3O7OA 3S0MA 3OY8A 4XQWA 4WVZA 1POQA 1KXGA 4FOVA 4Q27A 2JDMA 4ORFA 3GZUC 2WZR2 4DEVA 4XIKA 4FAGA 3TOJA 1CZSA 2B7YA 2NMOA 1ZBE3 2PHWA 3GJBA 4V2WA 4GJYA 2BQPA 1AR62 2CAUA 1ENSA 4QU1A 1ACCA 1NLSA 1AJKA 5H9SA 1QH6A 3A0NA 3RZLA 1PK6C 1YIFA 1COV3 4JHZA 4COWA 4GA9A 4L2NA 5CNAA 5LATA 3WCRA 2QQJA 2PMWB 3TRSB 4E2QA 3M8LA 4XILA 1MEC2 4FQ4A 2JECA 1PHMA 3ECQA 1BBT1 1T2XA 2L9LA 4XJUA 1JUHA 2WYFA 3ZXGA 2O1QA 1MS5A 1AR71 1LECA 2YU2A 3IZOA 4Q4Y2 4WV8A 3ZYRA 2QZ2A 3AFGA 3I97A 4L11A 4XC9A 5FK8A 5C3OA 4IEYA 2WFF2 4H2AA 1VMJA 1WLWA 5FZGA 2G9GA 5B4NA 1N3PA 1Q8PA 2HEVF 2VGDA 4AI8A 2EA7A 1LENA 1FXZA 4XXAA 4QGLA 4ZS2A 1SFPA 4Q8LA 2VZRA 4V1PA 1ODNA 1LOBA 3DYMA 5IK7A 3U1XA 4FPYA 3ZPOA 1HB3A 4IEPA 3VBRB 1AF9A 1R091 3NNFA 4KU8A 5I0DA 2IXIA 4DO0A 2AH2A 2BEOA 2CL2A 2PHXA 2RHPA 4YW6A 5IVBA 2VNRA 1VBC3 4P9JA 5L36A 3KSCA 4LHSA 4MYEA 3WG4A 1CR7A 3OEAA 1QNYA 3D0JA 4LBQB 2QJVA 4L0PA 1OOPB 1SLIA 3BVCA 4QKFA 5FP3A 1ZREA 1RUJ3 4JDOA 1A3KA 1ZX5A 5DABA 3VHNA 3WR0A 3MLKA 5FZAA 1RIRA 1MQTC 2DFBA 2UU8A 4OI2A 3AX4A 5JWPA 2A75A 4QXKA 4LHLA 3SCFA 2VXRA 4R52A 4YRDA 4QKBA 1VAMA 3N7KA 4NVPA 3ZSKA 4B4RA 2EIDA 2WKKA 3HBKA 1GQGA 4W6YA 1VBD3 3FLRA 5IYYA 3NJZA 3OBTA 4N7IA 2LTNA 1VB4A 1YJLA 1UY2A 3H8RA 3CZUA 3KZ4C 4FAHA 1C8M2 4F8AA 1L7LA 2NMNA 1V6KA 2JE7A 4N90A 4Q4X2 4RFT0 5EYXA 1J1TA 4EN7B 4X6QB 4HN1A 1NX9A 3VLBB 1BMV1 4BQ4A 5AFEA 1QJU3 3POFA 5FY4A 1QOOA 2V73A 4XAEA 2WQ8A 1PNFA 1OLRA 4HG6B 5H9RA 1W8OA 3RZZA 3H8XA 2E7AA 1LCLA 1ASJ3 3BODA 4XHBA 2GZWA 4FTSA 3HQUA 4YGBA 5ERLA 1ND2C 2BGOA 1POV0 5A32B 5D8AB 5KBFA 4HL0A 3WNLA 4K8FA 3MBWA 3QCWA 4YM0A 3B94A 3ILRA 1F5JA 3WG2A 2GH2A 5JI7A 4KQ7A 4AVBA 4CP9A 1XPWA 2F17A 2VZTA 4GKYA 5ABJB 4Q1RA 2WNEA 1DQ6A 1NT0A 4YZ3A 1AR93 5F7UA 2W87A 3I2JA 1SACA 3ACFA 3O5SA 1CAXA 2WNVB 4IGPA 1WD4A 1JZ2A 3AZXA 5FYYA 4CRQA 1VBE2 5LA2A 4QPIA 4GB33 3ZDVA 1XNAA 1EV13 4CCEA 4K40A 5C8CB 1O91A 3INAA 2H6BA 2XGXA 2YB7A 3GHNA 2QNKA 4R9BA 1BEV3 2WT0A 3VN4A 2MNGA 3CJIB 4O9EA 4BK5A 3PMEA 4JAAA 3AKSA 3IDAA 1JW6A 5A3WA 1WD3A 2ZOEB 4ONUA 4EN9B 1S0GA 2WS92 3Q8EA 5EXOA 2P6HA 4N7UA 2WQZC 1W9TA 4FPJA 4PI0A 5KXCA 4KG0A 2CGNA 3RZHA 4D7YA 3R4DB 3LE0A 1D2QA 3GM8A 4Y33A 5ANNA 1HKDA 3BTAA 1OVPA 3PU8A 2VW1A 4AEJA 4M3CF 3B00A 3ATGA 2VZVA 4Q0SA 3ZYFA 3ZXJA 5FO9B 1YQCA 2BPA2 3J4UH 4AL9A 1XE8A 1H1MA 2VW0A 2WO7A 3W59A 3MV11 4XTPA 3P6BA 4X8PA 1DGRN 1QJX1 1XRUA 2ZGOA 4YG3A 3ROUA 2FCVA 1W06A 2VE1A 2XG3A 4LMFA 3RZGA 4AEDC 3V0BB 1GSLA 1OQEA 2LRPA 1AZDA 3WW3A 4NRPA 3W5MA 3AJYA 1OA3A 2N7GA 2QQPA 1Q8SA 2Y6LA 4JRLA 3BCWA 2OQ6A 4CCDA 3JQXA 2Z2SB 3NV2A 3HN1A 4XCBA 1FMD3 3PUSA 2ZGQA 3A7QA 5BNOA 4LBLA 5A3LA 1D0GA 3ZSEA 1MZEA 2IXKA 3IBMA 3L2YA 4V2VA 2GNDA 4JGYB 1B09A 2WZR1 4RFRB 5H9QA 1AR61 2W0XA 2ZGUA 4A45A 4AVTA 1W9SA 1HRI3 4CUAA 5JVVA 5BYNA 2Y33A 3PJYA 4FTEA 3NKTA 2P6CA 2VQAA 4LBKA 3UGHA 4XUQA 3T2QA 1GZTA 4IV3C 4BDVB 4EV0A 4MGSA 1LHOA 3H7YA 3TWIA 1YQ2A 1YJKA 4DEQA 3USUB 1NKGA 5LA0A 4KH9A 2C9AA 4P00B 1MEC1 5F5IA 3IIAA 1LNSA 5FMCA 5DZGA 5A7NA 3MPBA 1W6MB 1SCSA 1FI2A 3D82A 2J1SA 2YGLA 3HN3A 2RMU2 5I8SA 1KD7A 4EROA 3I3QA 3NAPB 4CDUB 2WZ8A 4Q4Y1 5IAVA 3DL3A 1I5ZA 1SBEA 2J1UA 2VCBA 4IESA 4LK7A 4OI0A 1W6OA 3E6DA 2WFF1 2CY6A 3VBOA 1DGWA 4DIQA 5C3RA 4A7ZA 1WLDA 2OVUA 2GC3A 2JE8A 2W94A 4K9SA 4ZPIA 4AWDA 5KHJA 3AVRA 4TYSA 1BHGA 1DBNA 4MHRA 5FPXA 2D93A 3M3EA 1GNYA 4MG2A 2GNBA 2XOMA 3NVCA 5K9YA 4NMIA 2OYZA 1J1LA 1OKQA 2HWC2 1PX3A 1LB2A 2VZUA 3DYOA 4OULA 4QQOA 2YC2A 4XDPA 3U10A 4F83A 3J26N 2NYYA 2H6CA 1V6IA 2VUCA 5LK5A 3UK9A 4U36A 2B45X 4KI5M 2G9ZA 1RUG2 4FVVA 4GALA 2SBAA 1V9U2 3BOPA 4AG4A 1W8ZA 3H3LA 5CYYA 2R16A 3A23A 3BPSA 3DYPA 4Q29A 5E88A 4YW7A 3VBUB 1QY4A 2GALA 4I0BA 4QPGB 4GMP1 3OGRA 2JG8C 5LEJA 2ZAAA 1JOPA 1JU4A 1WKYA 4FP2A 1GZ9A 4CPBA 4LBJA 4LITA 3LKJA 3OEBA 3GZTB 4NIAA 3ILFA 4P9YA 4MXWA 3MEPA 2D40A 3AM2A 4QKDA 4ZY9A 4C90A 4IEOA 3I2OA 1C8M1 1NG0A 2W47A 4Q4X1 5GM0A 1E5IA 4AAXA 2Y34A 3A22A 3AXEA 4OUMA 2ZHMA 3WF2A 2VQUA 5J3UA 1EAH1 1XYNA 2GDFA 2NQYA 4BXSV 1LHUA 5EYYA 5FREA 3WDUA 4A44A 5FPUA 3IAPA 2BNMA 1OA4A 3M7AA 4P9LA 1H6YA 3AZVA 1NCQB 4CUCA 1O3SA 2ZACA 4CEYB 4HSLA 4XFBA 3MIBA 1OPMA 4QX2A 4CXWA 3BU0A 1AXZA 4Z2AA 4DY3A 5DXDA 4H14A 4H55A 5A7WA 4ASMB 1IPKA 1DIWA 1H8TA 1NCRA 1UOBA 1RUNA 4PHZA 1W05A 4ISQA 3OUIA 4NJ4A 5GLZA 4XBNA 1RUI2 4K1YA 1DQ2A 4UOJA 5KWRA 2ZX1A 2BRTA 4FFGA 4FFHA 1HRV3 3CDZB 3H8UA 2OPWA 3E5UA 1WW5A 1LULA 3J7HA 4QHZA 4CU9A 1ZZBA 5DAXA 4OI1A 1WCUA 2D44A 3LA7A 3C7EA 2DVGA 3I7DA 1VBE1 3E1F1 1SFNA 1ULGA 2RV9A 2OA2A 2WWSA 2DUOA 2G19A 5AC92 3POJA 2XWJB 3SH3A 1XB9A 1LAJA 4FPHA 2A6YA 5GZGA 4CXYA 4YW1A 3CIHA 3ZN5A 1K5MA 2ZHKA 3D8CA 1U5ZA 4GULA 1MZFA 2R063 2ZBJA 5DG2A 4CEWB 1NA1A 5JR2A 3NW4A 2W91A 3DGTA 5FY0A 2D3SA 3H3UA 3LF7A 2VMFA 2PHRA 5DN2A 1AXYA 2CU5A 4ZU5A 1GICA 5GZCA 4DZGA 1VBB3 2ZJCA 2R49A 1J84A 3KT7A 1D4VB 1GFF2 4MZUA 2WS91 4FXGB 4GH4C 4BIOA 4LE4A 3ILNA 3POGA 1NE6A 3DPRC 3C8XA 5JIUA 3AP9A 5FTTC 3RI9A 3Q8AA 1DU3D 1PZ9A 2RS32 5SV5A 4LKSA 2IVJA 2HBUA 3T2PA 4E9KA 5A1LA 2P3JA 3U11A 5JXGA 4AGGA 2EAKA 4BCUA 1C57A 1VE0A 2HJIA 4GWMA 4ZU4A 5HI0A 4BQ5A 2A1XA 3MI8A 3CBNA 2HWD3 4LOTA 3QLQA 4XEZA 1HDKA 5JZGB 2ET1A 4IEVA 1JS9A 2D6PA 1BYHA 4E4SA 1L3JA 1PO13 3WF3A 5FP8A 1H6XA 1CX1A 2VD7A 2Y6KA 1E5HA 2WWUA 2YY1A 5GKAC 3CEWA 2ZMNA 3NNMA 1CAVA 3ZLIA 1V6MA 2VW2A 3ZN4A 5A1AA 3L9JT 1FPN3 3ACLA 3SC7X 1MS3A 5FOBB 1TVGA 1JH5A 5FK7A 1CJPA 3URFA 4E2GA 1UAIA 4IE0A 1JOBA 4BLJA 2JIJA 2R073 4BE3A 3AP7A 4WM8A 4CA9A 2Y38A 1V6LA 2CWMA 1QXRA 3IPVB 1AX2A 4AQTA 4Q5OA 3VGIA 2D5FA 2RJLA 3AP5A 3JB8A 3LB9A 4QDSA 4YGDA 2XJTA 4PQQA 3VZNA 4ISRA 2VOTA 2WO3A 3J8F3 4B1LA 1PO21 2MEV2 1XBFA 5M0TA 3MICA 3W9AA 2VUJA 3N36A 3VBHA 2RMU1 2ZX0A 3OGSA 5T55A 1QJZA 2G9FA 1W2AX 1SDDB 1GWKA 4Q0QA 2Q8DA 3UV9A 4CCJA 3J7LA 3PVNA 1B35A 3BU7A 2WUHA 2W9XA 2A6WA 2DWRA 5L7OB 3CO2A 3VBOC 2KA3A 1H2KA 3O0XA 4CDXA 3T0BA 3AVSA 3EO6A 4LBNA 4NAMA 1N3OA 2RM22 5C4WA 2BDRA 1W3VA 3JXSA 3N9PA 5FY7A 4QQHA 4JVAA 1UCXA 3KHBA 4KU7A 1RUF3 2RS53 2HWC1 3ME2A 4Y26A 2D3PA 2W08A 2WC2A 3LOBA 5CFDA 4O9GA 5B2GB 4QHBA 1EYBA 4GKXA 5KHIA 2D6LX 1X8MA 3UL2A 5K8SA 1PVXA 5C9AB 4CCKA 1DFQA 3LSEA 1MS1A 2C0ZA 3VD4A 3KM5A 1QWRA 2LS6A 3O0WA 4LTAA 4QDRA 5FY5A 4XUTA 1RUG1 4RN5A 1TQ5A 1V9U1 4LHKA 3DUIA 4NO4A 3WHUA 4PQ9A 1O3QA 1DCSA 2XVLA 4IE4A 4EN8B 4N43B 1WCKA 3ACIA 1PK6A 5DDJ3 4QX7A 3B93A 3H9AA 1GWMA 2ERFA 2F4PA 3OCPA 4IGOA 3R6SA 3ZSJA 4CCLA 1WW6A 2QQWA 1HN0A 5FY9A 4BWOA 4I3GA 4YGEA 3O14A 4GMP0 1OLMA 2QTWB 1JZ5A 1F4AA 1PZ7A 5IK5A 1S0CA 2WSVA 3VZMA 2VVEA 4FCAA 2A6ZA 2BYVE 4WVVA 1YO8A 4XFGA 1G8WA 4LO7A 1H2LA 2BV4A 1MPXA 1SLCA 2AREA 3GDBA 1Y9QA 4MGIE 3WNNA 2YYOA 1W9FA 2VR4A 4UW6A 1CAUA 2W5FA 3I59A 4XABA 1DHKB 1HJFA 1TME2 5EPAA 3EMRA 2ORXA 3ZN6A 3SH5A 2JD4A 3LZZA 3AMPA 4W50A 1EPWA 4AI0A 4FT8A 1CQ9A 3HT2A 1UD1A 4CUBA 1XJAA 3MHZA 2QDNA 4XF0A 2VH9A 1W0NA 4MV2A 1NCRC 5CG9A 1QJFA 4OHZA 2FMYA 4LNVA 1RUI1 4Y20B 4WM7A 5IUQA 4RHV1 2UYBA 3IDEA 2W3JA 1H1IA 1C3HA 5LASA 1G86A 2ZEZA 3POYA 3FHAA 5IFPA 1GANA 4YFWA 1D4M2 1IS4A 2FQPA 4NWVA 3NJXA 5F5CA 4OLLA 4DRVA 3R4UA 4QXCA 1W6PB 3GZEA 5AC91 2FMDA 2Q8EA 2B9UA 1PVC2 4NRMA 4EYUA 5IVEA 1Q8VA 2ZCWA 3B69A 4GWJA 4MHUA 3TEZA 1K5MC 3ZXKA 1XOYA 2PLV2 1BBT3 3OGVA 3ZYPA 1ZRCA 1NA1C 2ATFA 1JYVA 3WDWA 2ZGTA 3OBZA 2OX0A 4F3JA 1AR73 1UOFA 2O8QA 4P5YA 3N7MA 4S2HA 1UZVA 2V5YA 4XFCA 2QQNA 2ZPXA 3OGGA 1KS4A 4IEZA 2Y6FA 2ZX4A 4R8HA 1P8JA 1F31A 2DURA 1N47A 2YUEA 4XHXA 4AGRA 3FUOA 4FPFA 5FZLA 1H4HA 1IKPA 5FZCA 4EN0A 1PIV2 1ZA4A 1POV1 2ZHLA 2GN3A 3U0ZA 1R093 2RS31 3KWVA 3FHQA 4A4AA 1ND2A 3IWZA 2VZ1A 3K3OA 5FLHA 5FYBA 1UN1A 3C2UA 3PDQA 4XBLA 2Q5TA 1GZWA 1NXD1 2D7FA 5BNNC 1V6NA 1BK0A 4NUBA 4AHZA 4IW3A 4XYXA 5J48A 5K4LA 2HWE2 5LBFA 1W9WA 3VD9A 3W58A 3WHTA 2RR12 2PHTA 1H30A 3HNYM 2HYXA 3LDRA 4KWKA 5GZDA 1TNRA 1GP6A 1CAWA 1JMUB 3I2KA 4AFDA 5KXDA 2VCCA 3VKOA 2XPJA 1J59A 5T54A 1NLQA 3M70A 1KEXA 2P3YA 4N8MA 2VOVA 4CDQA 2UYAA 5FPBA 4K6BA 3SQOA 4WM8C 5K0UA 4ITCA 3NO8A 4DINB 2A6VA 1UY4A 2RS12 2HWB1 2ZEYA 1NLRA 5FMOS 3F2ZA 3UESA 4ATFA 3ES4A 4XF9A 2WLPA 4A2UA 3KF3A 3WDXA 4FBFA 4G4FA 1IOAA 3H3ZA 5FLJA 5CFCA 4OQ8A 4GQ7A 2JX9A 4AE2A 3B3QE 1RUE2 4B8EA 1SPPB 2HWF2 3POBA 4FFFA 3KB5A 4D7TA 1UOJA 1Z7S2 4WBBA 5FYZA 2DCTA 3ACHA 4XZUG 2ZGNA 1ZZ7A 4IEQA 4NOTA 4XBQA 3ZYGA 1G9AA 5JPNB 3VBHC 3ON7A 1AUYA 1LU2A 3OD0A 5J09A 4G3YC 5JMOA 1O59A 3MW4A 2E26A 1S2KA 2QQLA 3GZAA 3VHPA 2CGPA 3BN6A 3S6PA 3FE5A 2TNFA 4CDXC 4DFSA 5F3IA 4CUGA 2JIGA 4AEDA 3UT0A 5GLVA 1Q3EA 3LEGA 1COV2 5IVYA 1UY0A 1MVQA 1DYOA 3RG0A 5C5TA 3GJAA 5JXJA 3LA2A 5FLIA 1U5YA 1V70A 4BH9A 3DF0A 1LR5A 1T6GC 5CFDC 2VU9A 3AC0A 5LCWL 5H9PA 1BLZA 2C4XA 4TTGA 1HW5A 1OUXA 4XUPA 3M3OA 4FI9A 3T4HB 3PUQA 5BNPA 4E2SA 3MUZ1 5IK4A 2J1VA 1CZTA 2PTMA 3HNMA 2E33A 2ZX3A 4A42A 3LDBA 5CADA 1U0AA 4DXSA 5FWJA 4W4ZA 4DB5A 3OYWB 4IV3A 2ADDA 5F5AA 3AP4A 1QJY1 2XKOA 3OY8B 1JU3A 5FPAA 5HCFA 1OSGA 3CJXA 4BK4A 3HMYA 1JODA 4R9DA 2P17A 2RDRA 1KJLA 1ULPA 4UWDA 2WZEA 3QACA 4A41A 3RNSA 2QBXA 2DV9A 5EQUA 5IATA 1VBC2 4J25A 5DUWA 2YXSA 3PLQA 1ZRDA 1YYNA 3K3NA 5FZKA 4Z07A 2YROA 2ZGPA 3J7MA 3I2GA 2QQVA 3GHMA 4LHNA 3AKRA 4C1XA 1QJX3 1JBCA 1UIKA 1YUDA 4QXBA 2A6XA 5EV7A 1RUJ2 3FLTA 1L7QA 3NNJA 1NXMA 5CB7A 2YBPA 1REEA 4URAA 3MW3A 5IW0A 1TME1 3TN92 4YLZA 3CNAA 4HVQA 1ZRIA 4OZXA 2XJVA 3VZOA 3QD6A 1VBA2 1VBD2 4Q0PA 2G4IA 2QQIA 3WUCA 2EIGA 3PIGA 3WP4A 1JXNA 5JPMB 2DUPA 1I3HA 3OF1A 1CONA 4XJAA 4WM7C 3CU7A 2H0BA 2B46X 1HXS2 4EZHA 5A3PA 4K21A 4AI3A 2DU0A 2WZR3 1YI9A 4TLGA 1Q56A 2Y0OA 1AR63 2W1SA 2XJPA 4N9IA 1YFXA 2XHNA 5LK7B 5FZOA 3KCCA 2FDHA 4PDWA 4L99A 5FP7A 1QJU2 4OZOA 4CDWC 1WCQA 2JDPA 3M1HA 4JKKA 4FP3A 5FXWA 2Q4SA 3ZIWA 3B02A 1PVC1 3AYEA 1YIPA 3A21A 2YFZA 2JG8A 5DAWA 1MEC3 1Y3TA 1XSQA 2PLV1 3V0AA 1NY72 2IXCA 1AYM1 4LA3A 1F15A 3KHCA 3B7MA 3X29B 2SLIA 4LBOA 2XONA 4HVOA 5F2WA 3Q9OA 1Q5OA 2JDHA 4Q4Y3 3TYJA 4EE2A 1QEXA 2EIEA 4BJ0A 2GP5A 3LEIA 4XJZA 1UYYA 4L97A 5E1RA 4RQPA 1W2UA 2WFF3 1EUTA 4UBGA 3W20A 5KC6A 2Q1MA 1H2MA 1SFYA 1O8SA 1VAKA 4ZXKA 5L9BA 4LUMA 5A6YA 4YW2A 1PIV1 1EV12 1UYPA 4QWNA 5C6CA 4AQ2A 1BK1A 1H2NA 2BP6A 4ES9A 1XNKA 1AL0G 4LKDA 2VZPA 1BEV2 3KV9A 2QVSB 2E6VA 4KWUA 4Y4YA 4YWAA 4CCCA 1IQAA 5FZDA 2EAAA 4YM1A 2WR9A 4LKFA 1ZM1A 4XFHA 5BUVA 1DGRA 4LR4A 4XPVA 3AL5A 2FBEA 3U14A 1ZRFA 1VRH2 2EF6A 3S7EA 2WRAA 2ZKLA 3RPQA 4CTEA 1CESA 3R05A 5A3MA 2VZQA 1W99A 3PURA 1UU4A 2HWE1 4UXAA 4TZDA 3CF6E 1XC6A 4QGMA 5JOWA 1HJGA 1N1YA 2RR11 3UGFA 3LCPA 3GBFA 2R6QA 1H8VA 2YFUA 3JD73 1O4ZA 4CP9B 2V5DA 4FSJA 2ZMLA 1W2NA 1DLCA 1VP6A 4TSVA 2DF7A 5IHRA 5FWEA 1DDLA 5DAQA 1DQ0A 4B4PA 1RMU2 4YW5A 4I01A 2PHDA 2WNVA 4CDQC 1MS8A 1D2SA 1ODMA 4OQ9A 1PMJX 1XXNA 5K0UC 5LY2A 3P3NA 1DZQA 3VDDA 4PF1A 1AL23 4NR1A 2RS11 4QPIB 4UT5A 1RUD2 3E5QA 2XXZA 1DQ1A 4Q4X3 2D6OX 5E6HA 2DUQA 2V72A 2E32A 1BZWA 4LO5B 1MVEA 2ORZA 5LRSA 1XNDA 2JG9B 5FMBA 1EAH3 3N7JA 1G9CA 1K42A 1OUSA 1UF2C 5FZBA 4GH4A 5CFCC 3ZYJB 1W6NA 1PGSA 2HWF1 5KXBA 2JE9A 1NE4A 1FYUA 1Z7S1 3DPRA 3P1IA 3WVJA 4YZ1A 1TNFA 2I74A 5I0RA 2GNMA 3OUJA 4I0AA 5F3EA 5B4XA 4AI2A 1FMD2 3VDBA 1UMHA 3HEIA 1U5IA 1C5IA 2DVAA 1I5PA 3HD8B 5IWFA 1W39A 4KBZA 4ARXA 2A3WA 4BA6A 4YZ5A 5JAXA 3R4SA 4QXHA 2CV6A 4NPMA 2CAVA 1CD3G 4E8DA 2WAAA 5A6XA 3ZR5A 3LWCA 4Q0VA 4O61A 2IZWA 1DZTA 4MADA 2V4AA 4DUXA 1W90A 1HRI2 4E27A 2BNOA 1QQP2 2J42A 1TMF2 5TSWA 2BJSA 4EQVA 1COV1 2R32A 1HV0A 2KR2A 5JMCA 1Z78A 2A71A 2IFRA 3LAGA 5I8TA 5FZ8A 5CU1A 1W6QA 2X29A 3HR9A 2ZGSA 5I8YA 4AVAA 2P37A 5F32A 1YC61 3O1VA 5HV4A 3T4VA 2DBNA 5CAZA 2P4EA 2UY8A 1ZZ6A 1EP0A 1PM4A 1QJEA 4LIVA 4IEUA 5EIYB 1R082 3NV1A 5GLUA 4HPKA 4XJ8A 4NE9A 5FZ3A 5BNPC 4FPGA 5ANQA 3AMHA 4XW3A 1DF0A 3N7LA 5DAPA 4FQZA 2WS93 5BNOB 1SHWB 2YPJA 1UZWA 5JIAA 3IKWA 4K20A 4NIHA 4EWAA 3KGZA 4LLFA 2Y8KA 3ENRA 3ZYIB 4LE3A 4C91A 2VCMA 1O5UA 3PNAA 4Z2WA 5A3UA 3S5QA 4JDNA 1UY1A 1RL3A 3ZMOA 3OPZA 4PIXA 1VBC1 3ETPA 2AR6A 2CGOA 3WDVA 3ZXEA 1OHFA 1PM7A 2VO5A 2XH6A 4FPLA 4NRQA 3SITA 4OHWA 5FZIA 3USUA 4D8MA 4ES8A 2DBIA 3JBG2 5A33B 4UAPA 2JDKA 5LBEA 1G6NA 3MYXA 3OBRA 1W6MA 1WLCA 3SHRA 5HCBA 4AZZA 2RE9A 2ZGLA 1W9YA 3I3DA 4BYYA 4HLTA 3FC0A 4YSFA 1RITA 3TN91 2PHUA 3TEYA 1VBA1 1VBD1 4COVA 3K77A 1SEFA 1ZRRA 1W28A 4IV1A 4M3CA 4LO6B 1W2TA 4ZONA 1QGLA 1W6OB 4YARA 4XF1A 3VBOB 3VKNA 4RYDA 1ONAA 1KS5A 2HBTA 2OQ7A 4AR2A 4AF9A 3RS6A 5KHKA 1HXS1 1AXKA 1JYCA 4YM2A 3VBRC 3WW4A 3ZFEA 4DMIA 1LEDA 1FV2A 4S2DA 1PGL2 4PI2A 3H1WA 4AFBA 4P02B 3J9SA 1MZ6A 2ZGKA 3PU3A 4RGKA 2P5BA 4PDWC 3FL7A 3I2IA 1JTZX 3WXPA 3WNKA 4NIDA 3SH4A 1D0HA 4Y24A 2CDOA 1VMHA 3AXDA 2JDZA 3EBRA 1O7FA 1OOPC 1W03A 1X7NA 3T3YA 1PO23 2XJQA 3HQXA 5ACA2 1NOVA 2WN2A 5FYMA 1NY71 2JXAA 1GQHA 5FAXA 3HNBM 1DG6A 2JDUA 2RMU3 3POEA 3VBUA 2B4KA 5A7PA 3WD5A 3AK0A 5FYTA 3WQ1A 2DVBA 3KV6A 2OZ6A 5LBCA 2BFUL 4D6SA 2WA4A 1BKZA 2WLQA 3VB9A 3O1UA 1VAVA 1UXXX 2KM2A 3IDCB 4RQPC 4BMEA 3PL0A 2J7MA 5CA6A 4LBQD 2VULA 4LK6A 3ZYHA 2B9VA 4MXWB 5E16A 1EV11 2GH8A 2IFWA 2BBVA 1W8TA 2XLGA 3KT4A 1KQRA 1UXZA 3PVBB 5DZEA 1XE7A 1ZNPA 1BEV1 1C5HA 4B4QA 2F4LA 2HWC3 4N9HA 4JKMA 5HXMA 1K5JA 3RZMA 3JUUA 3A0KA 3AP6A 1YEWA 3FZ3A 4BXFA 1J83A 1VRH1 3FWEA 4LLOA 4CEYA 2BFUS 1YCIA 4J6GA 4FOQA 1VBB2 2R7EB 4O7XA 4S2GA 5D8AC 5GJ6A 3SMHA 4BQWA 4YZ2A 1RHI2 1RVF3 2UWAA 1UKRA 1V9U3 4OHVA 2VMCA 5A7WB 4BQXA 1AVBA 1H8TB 1NCRB 5ABJC 3O1OA 1US2A 3WNPA 4YNIA 5T5LA 1WLTA 2VTFA 4DUWA 4SLIA 1RMU1 2VECA 1QDCA 3KMHA 2WNVC 3GGLA 4FPEA 3USSA 5A7QA 4RR3A 4LOSA 3KCYA 2VMGA 3ZR6A 4YPJA 4INDA 3AL6A 4QHOA 1TZOA 3FX3A 5D21A 3VDDC 2XJSA 1W04A 2ZEXA 1RUD1 3OGJA 2OW4A 5J98B 4RS5A 3ITQA 1RUC2 5I93A 4META 5DUXA 1K5MB 4HFSA 3RYRA 4XIOA 3UKVA 2GC0A 1NA1B 2DVDA 1PGW2 3FUQA 3ZMNA 1X82A 2CTVA 2QQMA 3M2MA 4GJZA 4Q4V2 4XFFA 3WDYA 1U12A 4YVSA 5LW9A 1KGYA 3FLPA 3LSDA 1ND3A 2P2KA 3P3PA 1RUI3 1SCRA 1V0AA 1DP0A 4Q1PA 3VUOA 4RHV3 3Q8CA 3ORJA 4ZXEA 5BNNA 1AYN2 3EYPA 4LORA 2NLRA 1HRI1 4D3WA 1QQP1 1W2OA 1TMF1 4JGZB 5GZEA 4HKWA 2AEYA 3K4DA 4HONA 3FBYA 4MXVA 1S0EA 1YXWA 4D6QA 3GBWA 1MS9A 1QU0A 2GMMA 2VBBA 4P5HA 1W3XA 1YI7A 2JEMA 5AC93 2NZ9A 5FO7B 3BGAA 5FZ0A 4OCTA 1RXGA 4B29A 2C6SA 1MACA 3MO4A 2XBO2 5A7SA 4EZ4A 4XJWA 1IPSA 2VVFA 1UYZA 1CAVB 1R081 1PNGA 4XUNA 3WV6A 3RZKA 1KRIA 3VBSA 2R042 4O65A 2OZJA 1ZZ9A 1MS4A 3VKLA 2VMEA 1R1ZA 5A3NA 3IN9A 4JGYC 3Q8BA 1OLME 3WW2A 4AW7A 3C7FA 4WM8B 4DXTA 2WNUA 1REFA 4PBPA 5LRRA 3POWA 4Y1UA 5I91A 1POV3 2VNGA 1OKOA 2RS52 4YG6A 1QMJA 2PQQA 3H8OA 4CP2A 1YHFA 1J58A 3PJQA 4XUOA 3O1PA 1PMHX 3UKTA 3MF6A 5FKBA 4AQ6A 3LDKA 3ELNA 1AR82 5EWSA 4DRRA 5I0SA 1FOD2 4GXLA 1Y7BA 3JBG1 1V6JA 1S2EA 2X05A 1S4CA 2YGMA 4LA2A 4NPLA 3U4SA 3VZKA 4I3PA 3VBHB 1QKQA 2A73B 4CDUC 5IT6A 2YG0A 4YYOA 4OUEA 2XR4A 3LFMA 1X9PA 5F39A 3A4UA 3D0SA 1O3RA 4Q4W2 4Y3OA 1B35B 1N1SA 4R9CA 2FDJA 3Q8FA 1VJ2A 4IV1C 4URTA 3R0RA 1WMEA 3C7HA 2BNNA 2QFEA 4PJYA 1CN1A 4CDXB 4UF0B 4A6OA 3GCWA 3ZFEC 4WVMA 3LGRA 1LHWA 2GP3A 1PGL1 5C4WB 2VMDA 1KJRA 2HWB3 4JHTA 4F7ZA 1C1FA 2EIBA 1UX7A 3N9LA 5FOJB 2XJUA 2WJSA 4GWIA 2J1EA 1OH4A 1RUH2 1T6BX 4DXZA 5C9AA 5CFDB 4HKOA 2RDSA 3QOPA 2QQOA 4Q26A 5FRAA 5KR7A 2D98A 1UY3A 4QB2A 4BPZA 4DQAA 1JI6A 4FTBA 4KWLA 4M0HA 1O4TA 3HOBA 1G9FA 2BERA 5ACA1 3N35A 5KC5A 1GBGA 3NWKA 2ZGRA 4GIQA 3WW1A 2RJKA 2XMLA 4HXCA 1HLCA 3NSTA 2ES3A 1O4YA 3VBUC 4XDOA 1X50A 4DUVA 4C0HA 1R1A2 2B39A 1CIYA 4OFGA 5FZHA 1UU6A 4YVWA 1ZZCA 1PK6B 2QZ3A 3ZXLA 4YFZA 4LO8A 3LPFA 5FUIA 4NHLA 1VLNA 2B42B 3OD4A 3SNMA 3RGBA 5FJKA 4YG0A 3NV3A 1UU5A 4GZ9A 3OPWA 2GNTA 5ISLA 4AVSA 1VB2A 4GWNA 2VL4A 4MGZE 3N3HA 1XYPA 3WF4A 3KF5A 1LOFA 1CAUB 3I59B 2XL7A 1US3A 1NQDA 1IZ3A 4CEYC 5JI9A 3ZN6B 2B8MA 1ULEA 4HT1T 4D69A 2RJ2A 4N53A 4YGCA 3U37A 3VZJA 3ZOIA 1ENQA 1RHI1 1V6OA 2VOWA 3D3AA 2CHHA 4IEWA 4KBBA 4JQTA 3G6JB 4NIIA 4CCOA 2W1UA 4CDWA 2JJ6A 1XQNA 5CZKA 2K2SA 1TEIA 1UMZA 5FV3A 5FUNA 3TNQA 4WM7B 5A7OA 1QJY3 4HMZA 3BTZA 4QX3A 1XSRA 1Q8QA 2HEWF 2ARCA 3D6EA 4IE6A 3VZLA 1DQ4A 4C0BA 5J96B 3GALA 3I8TA 3LOIA 3OBAA 4RR3C 2OS2A 5FYUA 4CU7A 2CYFA 3V65A 1K45A 4QM9A 4KGGA 3NNGA 2EVXA 5DQ0A 1MQTB 4OYUA 2IXJA 2BOIA 1BCXA 4NHXA 1REDA 3AMQA 2DCZA 4RS5C 2PN5A 2XL9A 1RUC1 3LPGA 1W0OA 4CEWC 4ZU7A 4DPNA 4BLIA 1LU1A 1W8HA 3B9CA 1TME3 2ILMA 1PGW1 2PAMA 1S2BA 2VQTA 4Q4V1 2IC1A 4YVSC 1S0DA 2ZGMA 1SLLA 2VVDA 3VD5A 3POSA 4BM8A 1AJOA 4X6RB 1ND3C 2WFPA 2Y6HA 3FFQA 4DOUA 3M3QA 4XJ9A 3GF6A 3NL1A 1AYN1 1QOSA 5FY1A 3SLIA 1VRBA 1SMVA 3ZFGA 5FMOL 5JLVA 2WQ4A 2ZEWA 1DYKA 1OA2A 1QOTA 3C3VA 4RD7A 4XDQA 1OT5A 1UZZA 1ND2B 2ARBA 3MIDA 5F6LB 1YFWA 3ZIXA 3BTXA 4Y22A 1RYYA 4I02A 1EUUA 5I0TA 3RYKA 4UW4A 1QNWA 1GZWB 1UYXA 1ENXA 1PVC3 3SCGA 2WABA 4MH0E 4HETA 5C5UA 2PLV3 2XBO1 4AOCA 4CE8A 1AYM3 3WINE 3MLLA 1JUIA 4AI9A 1JZ3A 5FFOC 1KDKA 4QM8A 3T2OA 1XU2A 1ZBA2 2R041 4MLOA 4RSUA 3VBSC 2Q1ZB 2V09A 2BTVC 3MIHA 3D4KA 1C8NA 4YZ4A 4A3XA 3DXTA 4Q8KA 1GYKA 1WW4A 2VCAA 2P3IA 4UYBA 4CDQB 3MIFA 4A3ZA 2DVFA 2WNUC 5K0UB 3VBFA 1PIV3 2VTXA 1A6CA 3SISA 5FQ0A 2R0HA 4NN0A 3GCXA 4W65A 2MEV1 1OVSA 3HQRA 4P08A 1OURA 1OMIA 5G04L 4ASKA 1DGWX 1QDOA 1HB2A 1JZ6A 1ULOA 4HZFA 2DCKA 4PLMA 3S57A 4XTMA 5FBZA 3JU9A 1AR81 4IGQA 3WX5A 5CFCB 2W39A 2WDBA 1FOD1 4S2FA 3RI8A 4NHMA 1LGNA 1OF4A 2QKDA 2HWE3 3B9IA 2BGCA 1ZBE2 2WINB 1IS5A 4KG8A 5T5JA 1GP5A 2X5IA 2YPDA 3ZFFA 1UZYA 3M3IA 2RR13 2WBKA 1RJ8A 4OMDA 5DZFA 4ET7A 1IG3A 2EALA 1G9DA 1GUIA 1YNAA 5T5OA 1WMFA 2RM21 2NM1A 5JOXA 5L7OC 4Q4W1 5JUVA 1BVVA 4FXKB 3H0OA 1HV1A 2LM3A 3K4AA 1NZIA 2AUYA 2GSYA 3LEKA 4TLFA 3MFAA 2DCYA 2EICA 1UPIA 2Z69A 1M06G 4NWWA 4TN7A 1TE1B 4FOYA 4NROA 4AEDB 3I3EA 4QU2A 2FD8A 2MHFA 2RS13 3ZPYA 3SCHA 2ADEA 4Z1VA 4XOGA 4DY5A 5F3CA 3WQBA 5A1FA 5C33A 2OXBA 5FP4A 5BV6A 1RUH1 1D7PM 2X10A 2BVBA 2HLEA 4AGVA 1AX1A 5C9AC 1CPMA 4AFAA 1JZ8A 1PMIA 4BHPA 2E9QA 4LIUA 2HWF3 3VHRA 2VJXA 3I3BA 1SLBA 3SXWA 4PF5A 3WG1A 3KT1A 4G9SB 1JN2P 2BWCA 1YQ6A 3NNLA 1VALA 4Y1YA 3WNOA 5BNPB 5D2AA 3QH6A 2XHKA 1TG7A 1R1A1 4AEMA 1GV9A 1NYWA 2OT7A 4K1ZA 2FCTA 5FCCA 4IV3B 3K4ZA 4Y1VA 1GOHA 1C1LA 1H4GA 3PIJA 4YVWC 3BIWE 5BNQA 3KV5A 5FZ4A 2E51A 3KS7A 2ID4A 2C26A 3KQRA 2ZXQA 2W52A 1GNHA 3OJBA 4LQRA 4UFHA 3KCXA 4R9AA 1O3TA 3U07A 2VNVA 1EY2A 2W46A 4KL1A 1GOFA 3U75A 1ZZ8A 3ASIA 2VUDA 2HH9A 1RTVA 2BZDA 2C9KA 3S7IA 2QDRA 1SZBA 4KGQA 1LOEA 3I2FA 1I9RA 1N1TA 3HAGA 1LOFC 1QXJA 2R1DA 3I2HA 3WP5A 4AHXA 3VBRA 2ARXA 1F4HA 3T09A 2W95A 4J1XA 4N53C 2RDNA 3O1RA 1DYPA 2WAOA 2Y26A 3T1MA 5FZ9A 1D4M1 5T52A 1NAEA 4J1WA 5LY1A 5EJ1B 3FMGA 4MGKE 3N9MA 2ZHNA 1SG3A 2ZABA 1UZ0A 2JB4A 4LBQA 1ASJ2 2VZSA 1OOPA 1XE0A 4CU8A 1OF3A 3CHXA 2O8OA 1LJ7A 2ZX2A 2ARAA 4BOWA 5FZOB 3MLJA 4COYA 4AHYA 4PDWB 2XLAA 3RDIA 1GZCA 4Z92B 1NQJA 2XLFA 4XCAA 3WT3A 5J7MA 4WVWA 3WQ7A 1LODA 1ULFA 2OUJA 4AXOA 3CL1A 2IWGB 4COZA 1UX6A 1AR92 4JQRA 1LRHA 5FBJA 3RWNA 2JG8B 3KD4A 3AZYA 3THPA 4AAPA 3FFZA 1JZ7A 3V0AB 2VPVA 3JD72 3RSJA 3TN93 2D6KA 1OQDA 3KV4A 4I2OA 4GB32 4EWEA 1W8WA 1VBA3 2XDVA 2WWJA 4X8NA 3K48A 1GP4A 3WLUA 1XU1A 5AVAA 4P9WA 3K75B 1A34A 2JICA 2HYKA 1V00A 3AMMA 1X36A 2PQSA 1QH7A 1Y4WA 4RQPB 3RMYA 1PX4A 2AC1A 3HBZA 5IVCA 1IS6A 4EJRA 5L9RA 3TEWA 5IFTA 5CVRA 1UIJA 5HPOA 2UWCA 1HXS3 4A7KA 1IQDC 1AL22 1F5FA 3AB0A 3HPNA 3KVBA 4WZCA 2VMIA 3U78A 3VKFC 5HV0A 2GN7A 3ZFGC 5A32A 4XXPA 5D8AA 3ZYBA 1IS3A 2YC4A 1EAH2 5JOZA 3AMNA 5FUPA 5ABJA 5FXXA 1HB4A 4CCMA 5LWBA 1DGLA 1WA6X 1K12A 2OKXA 3ZM8A 3THTA 4B3NA 5F9TA 2GC1A 3MGUA 4GMP3 4BQYA 1WWYA 2YBSA 4XF3A 5FR3A 3OPTA 1LOGA 2A7AA 3ZDSA 5BPXA 3H50A 2NP0A 1CAXB 5IVJA 4M4PA 2C24A 1YFYA 4IUGA 3VD3A 4UFMA 1ZBA1 3GNEA 3AZWA 2VOXA 3WCSA 5C8CA 5HXVA 3H1MA 4LJHA 1C8M3 4U2AA 3PUHA 2Q1FA 3NJYA 4IE7A 4LO4B 4MO3M 4KMQA 4K7JA 5A80A 4E4HA 5BY5A 4OMCA 2YV8A 2YZ4A 3VL9A 3CJIA 1KFXL 2JENA 2LW8A 2BUKA 2QQUA 1RUE1 4L9BA 5J1XA 3VBFC 2Z4FA 4QQ2A 4K8RB 3ZO0B 3LD8A 3VDDB 1O8PA 4UFIA 5EJ3A 3WOGA 3W21A 2PA7A 2JG9A 5JSPA 1CPNA 3IDBB 4PLNA 4JDMA 4IETA 3UYJA 1M4WA 1JYNA 2J22A 2IVIB 4GH4B 2BBAA 5E8AA 1W6NB 1GWLA 1VRH3 4JC1A 3JB4C 1R64A 4JX0A 5EHDA 4CP0A 2RVAA 2TEPA 4M01A 3DPRB 1BVP1 4GAZA 1ZBE1 1H0BA 1LTEA 4KNCA 3AZZA 2JDYA 4XQDA 3ZFFC 1UNBA 2X5IC 4M3CE 3ACGA 3DKWA 2WT2A 2XB6C 1JYWA 2F6BA 4LEJA 3WG3A 5FXVA 4AVVA 3BI3A 2Y6GA 2X53S 1L7RA 1VBE3 2VG9A 4Y1XA 4XZPA 3SEPA 2Z42A 5AVPA 4UFJA 2VZOA 2BU9A 3VHOA 1IHMA 1RMU3 4E8CA 3RZJA 1URXA 2W92A 1PZ8A 1FT9A 1IG0A 1QXPA 3LFIA 5C70A 3V0BA 2ZTNA 1S0IA 3GXUA 1GQPA 3VDAA 4CVUA 4Y4RA 1MS0A 2BOJA 4UI9L 5FPVA 1AX0A 3WZ1A 1RUD3 1FV3A 1LGCA 5FYHA 1W6QB 3HJRA 3UNPA 1CGPA 2O0OA 4CU6A 2WL1A 1WBLA 4QT6A 3SKJE 3ST7A 4AVCA 4JGYA 3UJQA 5KHHA 1GU3A 2V4VA 2Y60A 3LIGA 4C1WA 5IVFA 3M3CA 2GMPA 2JWPA 4HPKB 3SEEA 3VDCA 1ZYBA 3OUHA 3WNXA 1KFUL 2A70A 4A7YA 2DU1A 5F1RA 1JYIA 1HX6A 2EXJA 2I45A 3O12A 4BISA 1SBFA 3T1LA 5LZ6A 3C7OA 2VQ0A 4MOAA 2DTWA 3KQ4B 2WSUA 4K3UA 2YC0A 3THDA 2E53A 5CKMA 2P34A 1QQP3 4HVRA 1RUJ1 1TMF3 3K46A 2DYCA 2GC2A 2JB8A 2CNAA 3LIHA 3MV01 5T50A 3QBQA 4B7EA 3N4MA 3MFCA 3NAPA 4CDUA 3BTYA 3LEMA 5CIRA 5A33A 3ZKUA 1IGOA 5J36A 4AHWA 3E6CC 3RVHA 3AYAA 3E6BA 1HN1A 3GYDA 3HWJA 5JR7B 4E4ZA 3BKZA 3DKQA 4Y1ZA 1PO22 3MIGA 2Q8OA 1RC6A 3PHMA 1JZ4A 2YHJA 2ZZJA 1RINA 2QUOA 5JXHA 5CBLA 4ASLA 2FDIA 1FNZA 3BALA 1EPZA 1R083 4QX8A 4P14A 4CCNA 4E4DX 1E57A 5L9VA 3UGGA 3GBGA 1F2NA 1GLHA 4IV1B 4M3CB 5DUUA 5C71A 4OUSA 3WNMA 5HCAA 3MZHA 1LGBA 4CZSA 1QJU1 1CIWA 3PMSA 3LQCA 4COUA 5JDBA 3VL8A 4JTOA 1S0BA 1ASJ1 4PT6A 4QMAA 3ZFEB 2AEZA 4FPOB 2W68A 2AZ5A 3WP3A 4GD4A 3UETA 1A8DA 3OG2A 4XMAA 2CSGA 3CLPA 2WO2A 4PLOA 3HVDA 2NPIA 3SKVA 1YQ8A 3CQOA 3N9NA 4QPGA 2B5HA 1HRV2 3AFKA 3JBG3 4MX3A 4EN6B 1ZVFA 1NUKA 2IUWA 1AR91 5C3SA 1WCDJ 5IK8A 2XVKA 5FYCA 3WF1A 1YRZA 1RVF2 5T5PA 2VBPA 1RUOA 1G7YA 3JD71 2QE3A 3DV8A 5GLWA 2FDKA 4GB31 4DS0A 4BIFA 4W6XA 5A6ZA 2J1AA 2GMEA 2E7QA 2KXLA 1XNCA 2UURA 3IAQA 1X9TA 4XVHA 4YW3A 3RQ0A 4B7KA 1UL9A 2R062 5A3OA 4LXLA 3NQHA 3TNPB 1NCQA 1OH3A 2VM9A 1WZXA 3BUCA 1AL21 1Q43A 5BXXA 1LESA 2K0GA 3H1YA 5FZ7A 1C4RA 1LHVA 5FJHA 5A6QA 4I09A 1SLTA 4LBMA 3ZXAC 3DXUA 1RUG3 1OD5A 3U4XA 4OHYA 2FHRA 3FJSA 4UW3A 1QF3A 2O14A 3VD7A 1U5XA 3AKTA 3WY6A 3THCA 5FP9A 1JOJA 4CYDA 3I2DA 1C28A 1YLLA 3BOWA 3NJVA 3MUY1 2J1RA 3POIA 3BIEA 2E31A 3I4IA 2R1BA 2OUHA 2VMHA 4Y5TA 4D0QA 5ACA3 5IVVA 1X33A 4AEKA 5CKQA 2VNOA 3AYCA 4IQPA 4RGAA 1DZRA 4A6SA 3IM0A 5JSRA 2PHLA 1A78A 2ZZQA 4WZFA 4XURA 4XAAA 4JZRA 2W2IA 4RHV2 5C8CC 4QB1A 2FDFA 2HWD2 4FO9A 1G9BA 2P1BA 1WGPA 2D6MA 2GU9A 1WMXA 2JDAA 4QGNA 1HQNA 3F95A 4MSVA 4MGQA 1YWKA 4FPKA 1PO12 1ULDA 5GALA 2KD7A 4P9GA 1Q8OA 3CKHA 3JZVA 3RYPA 3WUDA 3CJIC 3WP6A 4BB3A 4CEWA 2YU1A 2HEYF 4RR3B 2TBVA 5FZMA 4P9IA 4QPIC 4LULA 2D6NA 5F2SA 3EB7A 3RRDA 2E7TA 1J3RA 1FPN2 2YMZA 3O1TA 4UFLA 2JG9C 5CISA 4L8QA 1NZCA 1JYTA 1FMD1 4QB6A 4RS5B 1HQLA 2K46A 3BPZA 4PIZA 4W8JA 1IPJA 1N1VA 4MVTA 4QX1A 4Y5Z0 5F8PA 3TAYA 1SBDA 2R072 4QPYA 5L73A 1ALYA 4XQ4A 1KDMA 4BQ2A 1FAYA 2Q0AA 2XUMA 2IXLA 4BQ1A 2WO1A 1RHI3 4YVSB 2Q8CA 5FO8B 1RXFA 1F35A 1ND3B 4IEXA 1N3QA 1SDWA 2E63A 5SV8A 3LA3A 1E5RA 2WYSA 5FZ6A 4ZZ8A 5JZGA 2OIIA 3NV4A 4JGZA 3J8F2 2FCUA 4AK3A 5BNNB 3ZSMA 3O0VA 1RB8G 4UW5A 5EP9A 4PCRA 3CMGA 1W8FA 2D43A 3OOXA 3VKMA 4C8DA 2C5DA 1WW7A 2VTXJ 5A70A 4IXLA 1VPHA 2VBDA 2XUEA 2ET7A 3ABZA 3D5OA 3IIIA 1RUC3 4ZS3A 1OFNA 2Z5WA 4D6RA 1X8EA 3ALQA 5LA9A 1WCSA 1GOGA 4AFCA 1XYOA 3M4FA 2A5ZA 3OB8A 4HBNA 4BZ4A 3VV1A 2D5HA 1CVNA 4Q4V3 3J7NA 3I49A 3IPVA 1RUF2 1RJ7A 3VBSB 2YBKA 2FZ2A 1QHDA 5BNOC 2RS33 4XE9A 5DG1A 4BQ3A 2R0FA 5A3TA 2A3YA 2D3RA 3AKQA 5C8WA 2BGPA 1BJQA 5F37A 5LA1A 2LUWA 2EXKA 2WNUB 2X8KA 1AYN3 2HWB2 5GLTA 4JCKA 1CZVA 2JD9A 5CKNA 4CP1A 1OXCA 3RJ2X 1O6UA 5IJRA 2TUNA 2PHFA 3NAPC 4PBOA 5DDJ2 5CG8A 5HBAA 5L7OA 4JKLA 5DAVA 5AFBA 1GNZA 3W5NA 1J3QA 2DDUA 3PVOA 2RG4A 1I6XA 4SBVA 2XBO3 3JQWA 3DEMA 3EXUA 3DECA 1BXHA 1LKNA 4M4RA 1IKQA 2XWBB 1KITA 1FATA 2PAEA 2R043 3ZXFA 3L2HA 1AHSA 2RDQA 3I54A 4QPWA 1E5SA 2AYHA 4UF0A 4XETA 4XMIA 1UKGA 2ENRA 3K51A 3ZKYA 3JCIA 3S5AA 2XKPA 3PVEA 3BB6A 2OPKA 3C7GA 4WVMB 5FYSA 5C3PA 3B5LB 2DTYA 4QKNA 2MEV3 2X09A
chains in the Genus database with same CATH topology
4BXSV 4OMDA 2WBKA 4A44A 1PMJX 4ET7A 3IAPA 1GUIA 1H6YA 4CUCA 4PF1A 5JUVA 2WN3A 3K4AA 4QX2A 2V72A 2E32A 3LEKA 4Z2AA 2ORZA 2EICA 2XQXA 2QQKA 3PUIA 1K42A 3I3EA 4UOJA 3CDZB 3P1IA 2Y64A 3J7HA 5B4XA 4CU9A 3VDBA 1UMHA 3HEIA 3WQBA 4ARXA 1I5PA 2X10A 1D7PM 2JKXA 2HLEA 3C7EA 2W1QA 5C7GA 4ARYA 1JZ8A 4E8DA 2WAAA 3IB3A 3E1F1 2RV9A 2VJXA 3I3BA 4MADA 4DUXA 3WNOA 1JHJA 3CIHA 4DXRA 4ZZ5A 2J1TA 1TG7A 5JR2A 2W91A 3T08A 2VMFA 5DN2A 3K4ZA 5G05L 1GOHA 1J84A 2ID4A 2C26A 2ZXQA 4LQRA 2CDPA 2W46A 1GOFA 3C8XA 5EIYB 3T2PA 4LKSA 2BZDA 2C9KA 5DMYA 5JXGA 3I2FA 1SHWB 1K3IA 4QDQA 3I2HA 5EJZB 2Y8KA 1F4HA 3T09A 2W95A 1UY1A 4QX0A 2WAOA 3WF3A 1CX1A 1H6XA 1NAEA 2Y6KA 3ETPA 3WF0A 5EJ1B 1SG3A 1OD3A 5A1AA 2VO5A 1UZ0A 4D8MA 2VZSA 4UAPA 1TVGA 4CU8A 1OF3A 2VZ3A 3I3DA 4TXWA 2DCJA 3FN9A 1UWWA 1JYXA 3K77A 1XNTA 3T0DA 4RYDA 1JZ7A 4QDSA 3WEZA 2VC9A 4PQQA 2WO3A 2VOTA 4P02B 3K75B 3FL7A 2PQSA 3I2IA 3OGSA 1PX4A 3WNKA 4QAWA 1SDDB 5IFTA 5HPOA 2CDOA 1IQDC 3HPNA 1GMMA 2WUHA 2W9XA 3WSOA 2WN2A 2YC4A 2W1WA 5DPNA 3HNBM 5JXIA 2B4KA 3T0BA 3T0AA 3ZM8A 1K12A 2OKXA 3JXSA 4LPLA 1UXXX 2J7MA 3NRUA 2B9VA 4M4PA 4IUGA 3VD3A 3VD4A 2LS6A 1UXZA 4QDRA 4XUTA 3PUHA 4MO3M 4KMQA 4JKMA 4RN5A 4OMCA 5HXMA 2LW8A 3ACIA 1J83A 5J1XA 2Z4FA 1O8PA 2R7EB 1W8NA 1JZ5A 2VMCA 1F4AA 1JYNA 1US2A 2J22A 3WNPA 1UMIA 2BBAA 2VTFA 4JX0A 4DUWA 1R64A 2RVAA 1MPXA 3GDBA 2Y6JA 3GGLA 3CZJA 3ACGA 3WNNA 1JYWA 2VR4A 2W5FA 4YPJA 2Y6GA 1L7RA 2ORXA 3SEPA 2ZEXA 4W50A 2VZOA 4DEVA 4E8CA 1CZSA 2W92A 4CUBA 1W0NA 5C70A 3GXUA 3VDAA 1GQPA 4CVUA 4JHZA 4UI9L 2QQMA 2QQJA 2W3JA 3HJRA 2ZEZA 5IFPA 3FHAA 3UNPA 1KGYA 3ECQA 2L9LA 1T2XA 4CU6A 3SKJE 3NJXA 1GU3A 2V4VA 1DP0A 4ZXEA 3EYPA 3I97A 3SEEA 4GWJA 3VDCA 5B4NA 3K4DA 3OGVA 1JYVA 3C7OA 2VZRA 4MOAA 3DYMA 4P5YA 3THDA 5I0DA 3BGAA 3K46A 3WF2A 2QQNA 3MO4A 1P8JA 3MV01 1UYZA 4LHSA 4XUNA 1HN1A 3OEAA 4L0PA 3FHQA 4A4AA 2VMEA 2VZ1A 1JZ4A 3C7FA 4DXTA 5JXHA 2EIDA 5IYYA 1W9WA 3VD9A 5C71A 3WNMA 4XUOA 1PMHX 3HNYM 2HYXA 1UY2A 3I2KA 3LQCA 3CZUA 2VCCA 4PT6A 3UETA 1KEXA 3OG2A 2X05A 1NX9A 2WO2A 2WQ8A 2YG0A 4HG6B 3SKVA 1W8OA 3CQOA 4OUEA 1UY4A 2ZEYA 1NUKA 3F2ZA 2BGOA 3WF1A 3UESA 3WNLA 3MBWA 3C7HA 4A6OA 1XPWA 2VZTA 2VMDA 3ACHA 4XZUG 2J1AA 5F7UA 2W87A 3I2JA 3IAQA 2EIBA 1UX7A 3ACFA 4XVHA 4GWIA 2J1EA 1OH4A 3NQHA 5JMOA 1JZ2A 1O59A 2QQOA 2VM9A 5LA2A 1UY3A 2E26A 4QB2A 1JI6A 1XNAA 3HOBA 2QQLA 2YB7A 2BERA 3BN6A 4DUVA 3LEGA 3VD7A 1CIYA 1UY0A 3THCA 1DYOA 5JXJA 4BK5A 3NJVA 3MUY1 2J1RA 2E31A 3IDAA 3LPFA 4D0QA 5FUIA 5LCWL 3AC0A 2C4XA 1W9TA 4XURA 4TTGA 4XUPA 4FI9A 4QB1A 3LE0A 3GM8A 2JDAA 4MGQA 3MUZ1 4GZ9A 2J1VA 1CZTA 3HNMA 2E33A 2VZVA 4A42A 2KD7A 3CKHA 4DXSA 2VL4A 4W4ZA 3WF4A 1US3A 3EB7A 1JU3A 4BK4A 3MV11 3P6BA 2RJ2A 3U37A 1ULPA 2WZEA 4QB6A 3D3AA 4A41A 4W8JA 2QBXA 4QX1A 2W1UA 5CZKA 3W5MA 2Y6LA 3I2GA 4QX3A 2WO1A 1L7QA 3A7QA 3OBAA 4CU7A 1K45A 3NNGA 5DQ0A 2WYSA 4ZZ8A 4OYUA 4CUAA 2QQIA 4A45A 1W9SA 3LPGA 4XUQA 3T2QA 3CMGA 4BDVB 4MGSA 2VQTA 4DEQA 1YQ2A 1NKGA 5LA0A 2W1SA 4P00B 3ABZA 3VD5A 2XHNA 3IIIA 1LNSA 3HN3A 2J1SA 2Y6HA 4OZOA 1GOGA 1WCQA 3OB8A 4JKKA 2WZ8A 2J1UA 2VCBA 3A21A 2YFZA 2ZEWA 1OT5A 2JE8A 2W94A 2BGPA 1BHGA 1RYYA 1EUUA 5LA1A 1GNYA 2XONA 2XOMA 1UYXA 2EIEA 4BJ0A 2WABA 1CZVA 3LEIA 1UYYA 2JD9A 1EUTA 1PX3A 5IJRA 1O8SA 2VZUA 3DYOA 1JZ3A 2YC2A 3T2OA 4JKLA 2VZPA 4KI5M 4KWUA 3W5NA 2DDUA 4AG4A 2VCAA 5CYYA 3A23A 3DECA 3DYPA 4A3ZA 4M4RA 2VZQA 1W99A 3OGRA 1WKYA 1JU4A 1XC6A 4P08A 5G04L 4QPWA 1JZ6A 3OEBA 1ULOA 2DCKA 2YFUA 2V5DA 1DLCA 4ZY9A 2WDBA 5IHRA 2W47A 3C7GA 1OF4A 4AAXA 3A22A 2X09A 2VQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXS V;  4OMD A;  2WBK A;  4A44 A;  1PMJ X;  4ET7 A;  3IAP A;  1GUI A;  1H6Y A;  4CUC A;  4PF1 A;  5JUV A;  2WN3 A;  3K4A A;  4QX2 A;  2V72 A;  2E32 A;  3LEK A;  4Z2A A;  2ORZ A;  2EIC A;  2XQX A;  2QQK A;  3PUI A;  1K42 A;  3I3E A;  4UOJ A;  3CDZ B;  3P1I A;  2Y64 A;  3J7H A;  5B4X A;  4CU9 A;  3VDB A;  1UMH A;  3HEI A;  3WQB A;  4ARX A;  1I5P A;  2X10 A;  1D7P M;  2JKX A;  2HLE A;  3C7E A;  2W1Q A;  5C7G A;  4ARY A;  1JZ8 A;  4E8D A;  2WAA A;  3IB3 A;  3E1F 1;  2RV9 A;  2VJX A;  3I3B A;  4MAD A;  4DUX A;  3WNO A;  1JHJ A;  3CIH A;  4DXR A;  4ZZ5 A;  2J1T A;  1TG7 A;  5JR2 A;  2W91 A;  3T08 A;  2VMF A;  5DN2 A;  3K4Z A;  5G05 L;  1GOH A;  1J84 A;  2ID4 A;  2C26 A;  2ZXQ A;  4LQR A;  2CDP A;  2W46 A;  1GOF A;  3C8X A;  5EIY B;  3T2P A;  4LKS A;  2BZD A;  2C9K A;  5DMY A;  5JXG A;  3I2F A;  1SHW B;  1K3I A;  4QDQ A;  3I2H A;  5EJZ B;  2Y8K A;  1F4H A;  3T09 A;  2W95 A;  1UY1 A;  4QX0 A;  2WAO A;  3WF3 A;  1CX1 A;  1H6X A;  1NAE A;  2Y6K A;  3ETP A;  3WF0 A;  5EJ1 B;  1SG3 A;  1OD3 A;  5A1A A;  2VO5 A;  1UZ0 A;  4D8M A;  2VZS A;  4UAP A;  1TVG A;  4CU8 A;  1OF3 A;  2VZ3 A;  3I3D A;  4TXW A;  2DCJ A;  3FN9 A;  1UWW A;  1JYX A;  3K77 A;  1XNT A;  3T0D A;  4RYD A;  1JZ7 A;  4QDS A;  3WEZ A;  2VC9 A;  4PQQ A;  2WO3 A;  2VOT A;  4P02 B;  3K75 B;  3FL7 A;  2PQS A;  3I2I A;  3OGS A;  1PX4 A;  3WNK A;  4QAW A;  1SDD B;  5IFT A;  5HPO A;  2CDO A;  1IQD C;  3HPN A;  1GMM A;  2WUH A;  2W9X A;  3WSO A;  2WN2 A;  2YC4 A;  2W1W A;  5DPN A;  3HNB M;  5JXI A;  2B4K A;  3T0B A;  3T0A A;  3ZM8 A;  1K12 A;  2OKX A;  3JXS A;  4LPL A;  1UXX X;  2J7M A;  3NRU A;  2B9V A;  4M4P A;  4IUG A;  3VD3 A;  3VD4 A;  2LS6 A;  1UXZ A;  4QDR A;  4XUT A;  3PUH A;  4MO3 M;  4KMQ A;  4JKM A;  4RN5 A;  4OMC A;  5HXM A;  2LW8 A;  3ACI A;  1J83 A;  5J1X A;  2Z4F A;  1O8P A;  2R7E B;  1W8N A;  1JZ5 A;  2VMC A;  1F4A A;  1JYN A;  1US2 A;  2J22 A;  3WNP A;  1UMI A;  2BBA A;  2VTF A;  4JX0 A;  4DUW A;  1R64 A;  2RVA A;  1MPX A;  3GDB A;  2Y6J A;  3GGL A;  3CZJ A;  3ACG A;  3WNN A;  1JYW A;  2VR4 A;  2W5F A;  4YPJ A;  2Y6G A;  1L7R A;  2ORX A;  3SEP A;  2ZEX A;  4W50 A;  2VZO A;  4DEV A;  4E8C A;  1CZS A;  2W92 A;  4CUB A;  1W0N A;  5C70 A;  3GXU A;  3VDA A;  1GQP A;  4CVU A;  4JHZ A;  4UI9 L;  2QQM A;  2QQJ A;  2W3J A;  3HJR A;  2ZEZ A;  5IFP A;  3FHA A;  3UNP A;  1KGY A;  3ECQ A;  2L9L A;  1T2X A;  4CU6 A;  3SKJ E;  3NJX A;  1GU3 A;  2V4V A;  1DP0 A;  4ZXE A;  3EYP A;  3I97 A;  3SEE A;  4GWJ A;  3VDC A;  5B4N A;  3K4D A;  3OGV A;  1JYV A;  3C7O A;  2VZR A;  4MOA A;  3DYM A;  4P5Y A;  3THD A;  5I0D A;  3BGA A;  3K46 A;  3WF2 A;  2QQN A;  3MO4 A;  1P8J A;  3MV0 1;  1UYZ A;  4LHS A;  4XUN A;  1HN1 A;  3OEA A;  4L0P A;  3FHQ A;  4A4A A;  2VME A;  2VZ1 A;  1JZ4 A;  3C7F A;  4DXT A;  5JXH A;  2EID A;  5IYY A;  1W9W A;  3VD9 A;  5C71 A;  3WNM A;  4XUO A;  1PMH X;  3HNY M;  2HYX A;  1UY2 A;  3I2K A;  3LQC A;  3CZU A;  2VCC A;  4PT6 A;  3UET A;  1KEX A;  3OG2 A;  2X05 A;  1NX9 A;  2WO2 A;  2WQ8 A;  2YG0 A;  4HG6 B;  3SKV A;  1W8O A;  3CQO A;  4OUE A;  1UY4 A;  2ZEY A;  1NUK A;  3F2Z A;  2BGO A;  3WF1 A;  3UES A;  3WNL A;  3MBW A;  3C7H A;  4A6O A;  1XPW A;  2VZT A;  2VMD A;  3ACH A;  4XZU G;  2J1A A;  5F7U A;  2W87 A;  3I2J A;  3IAQ A;  2EIB A;  1UX7 A;  3ACF A;  4XVH A;  4GWI A;  2J1E A;  1OH4 A;  3NQH A;  5JMO A;  1JZ2 A;  1O59 A;  2QQO A;  2VM9 A;  5LA2 A;  1UY3 A;  2E26 A;  4QB2 A;  1JI6 A;  1XNA A;  3HOB A;  2QQL A;  2YB7 A;  2BER A;  3BN6 A;  4DUV A;  3LEG A;  3VD7 A;  1CIY A;  1UY0 A;  3THC A;  1DYO A;  5JXJ A;  4BK5 A;  3NJV A;  3MUY 1;  2J1R A;  2E31 A;  3IDA A;  3LPF A;  4D0Q A;  5FUI A;  5LCW L;  3AC0 A;  2C4X A;  1W9T A;  4XUR A;  4TTG A;  4XUP A;  4FI9 A;  4QB1 A;  3LE0 A;  3GM8 A;  2JDA A;  4MGQ A;  3MUZ 1;  4GZ9 A;  2J1V A;  1CZT A;  3HNM A;  2E33 A;  2VZV A;  4A42 A;  2KD7 A;  3CKH A;  4DXS A;  2VL4 A;  4W4Z A;  3WF4 A;  1US3 A;  3EB7 A;  1JU3 A;  4BK4 A;  3MV1 1;  3P6B A;  2RJ2 A;  3U37 A;  1ULP A;  2WZE A;  4QB6 A;  3D3A A;  4A41 A;  4W8J A;  2QBX A;  4QX1 A;  2W1U A;  5CZK A;  3W5M A;  2Y6L A;  3I2G A;  4QX3 A;  2WO1 A;  1L7Q A;  3A7Q A;  3OBA A;  4CU7 A;  1K45 A;  3NNG A;  5DQ0 A;  2WYS A;  4ZZ8 A;  4OYU A;  4CUA A;  2QQI A;  4A45 A;  1W9S A;  3LPG A;  4XUQ A;  3T2Q A;  3CMG A;  4BDV B;  4MGS A;  2VQT A;  4DEQ A;  1YQ2 A;  1NKG A;  5LA0 A;  2W1S A;  4P00 B;  3ABZ A;  3VD5 A;  2XHN A;  3III A;  1LNS A;  3HN3 A;  2J1S A;  2Y6H A;  4OZO A;  1GOG A;  1WCQ A;  3OB8 A;  4JKK A;  2WZ8 A;  2J1U A;  2VCB A;  3A21 A;  2YFZ A;  2ZEW A;  1OT5 A;  2JE8 A;  2W94 A;  2BGP A;  1BHG A;  1RYY A;  1EUU A;  5LA1 A;  1GNY A;  2XON A;  2XOM A;  1UYX A;  2EIE A;  4BJ0 A;  2WAB A;  1CZV A;  3LEI A;  1UYY A;  2JD9 A;  1EUT A;  1PX3 A;  5IJR A;  1O8S A;  2VZU A;  3DYO A;  1JZ3 A;  2YC2 A;  3T2O A;  4JKL A;  2VZP A;  4KI5 M;  4KWU A;  3W5N A;  2DDU A;  4AG4 A;  2VCA A;  5CYY A;  3A23 A;  3DEC A;  3DYP A;  4A3Z A;  4M4R A;  2VZQ A;  1W99 A;  3OGR A;  1WKY A;  1JU4 A;  1XC6 A;  4P08 A;  5G04 L;  4QPW A;  1JZ6 A;  3OEB A;  1ULO A;  2DCK A;  2YFU A;  2V5D A;  1DLC A;  4ZY9 A;  2WDB A;  5IHR A;  2W47 A;  3C7G A;  1OF4 A;  4AAX A;  3A22 A;  2X09 A;  2VQU A; 
#chains in the Genus database with same CATH topology
 2PEL A;  3QH7 A;  4N43 A;  1STM A;  4I30 A;  4RA0 A;  2XJR A;  1VMF A;  1AR8 3;  4QPG C;  2G1M A;  5E89 A;  1FOD 3;  1HRV 1;  4IER A;  1OBN A;  4QX5 A;  4LKE A;  2WN3 A;  5L19 A;  1YQ5 A;  2XVG A;  2ZS6 B;  3DN7 A;  1RVF 1;  1OI6 A;  2JKB A;  2XQX A;  2EXI A;  2QQK A;  3PUI A;  4H7M A;  4FPC A;  1LOA A;  5FIX A;  5GZF A;  4IDZ A;  2PYT A;  4MUV A;  2AAC A;  3TB0 A;  3WDT A;  4MGY E;  1SLA A;  3AJZ A;  2CWS A;  1OQ1 A;  1ZA7 A;  1QJY 2;  3N9O A;  2RM2 3;  4IL7 A;  3ZVX A;  4Q4W 3;  4YVW B;  5JSO A;  2Y64 A;  3NMB A;  1SQ4 A;  2ZKN A;  5HCH A;  1FX5 A;  2R06 1;  2JKX A;  1BBT 2;  2PXJ A;  3N9Q A;  2W1Q A;  4TWT A;  5C7G A;  4ARY A;  1NCQ C;  4OHX A;  3IB3 A;  3PUA A;  2LRO A;  1AR7 2;  1VBB 1;  2WZP P;  2FDG A;  4JTN A;  3T30 A;  4JV4 A;  3H7J A;  1JHJ A;  1OLQ A;  4Y5S A;  5FYV A;  2R30 A;  4DXR A;  1HIX A;  4ZZ5 A;  1RUH 3;  4Y20 A;  4D94 A;  2J1T A;  4NHK A;  5KXE A;  2WNO A;  4LT5 A;  1WBF A;  4CPB D;  3TEX A;  3T08 A;  2WT1 A;  4HSJ A;  4W6W A;  5G05 L;  1HB1 A;  4NIG A;  2FZ1 A;  5FZ1 A;  4UBH A;  3OSD A;  1MZ5 A;  3RWK X;  1R09 2;  3K2O A;  1H1A A;  4N53 B;  3HT1 A;  5FZE A;  2ZMK A;  1H8T C;  5EZW A;  3I3M A;  1GKB A;  2HKX A;  3MW2 A;  5F6K A;  1DLL A;  1MR5 A;  4HN0 A;  2CDP A;  5LEK A;  1O5L A;  1R1A 3;  1W6P A;  5K7P A;  4QD2 A;  3ZSL A;  4CDW B;  4FOW A;  2HWD 1;  2Z79 A;  3ETQ A;  4Z82 A;  4HAN A;  4QQP A;  4H7L A;  4HKL A;  1CX4 A;  2IXH A;  1PO1 1;  5DMY A;  1Z0H A;  2BVV A;  2UY9 A;  3V64 A;  2I2S A;  5APA A;  5I0U A;  4NAO A;  4ATE A;  5JOY A;  1MQT A;  3IT8 A;  5KHG A;  4MGT A;  1K3I A;  4QDQ A;  4AYU A;  3S30 A;  3FHI B;  4AFM A;  3AYD A;  1LOC A;  5EJZ B;  1FPN 1;  1Y9G A;  2BW8 A;  3E97 A;  5EFU A;  3T2T A;  1WA4 A;  1CJD A;  1DQ5 A;  1S0F A;  5T3N A;  4Z8B A;  4XF4 A;  5FPL A;  4QX0 A;  3WQ0 A;  2VY0 A;  4R4Z A;  3EJK A;  5FZF A;  1ST8 A;  2VXJ A;  2JDN A;  1AYM 2;  2R07 1;  2VOK A;  2K9Z A;  1H9W A;  5DUV A;  3WF0 A;  5IAX A;  4AQS A;  1OD3 A;  4M00 A;  4HOO A;  2AGS A;  2VAU A;  1ENR A;  3V56 A;  1UOG A;  1VR3 A;  4OVE A;  2BWA A;  4R4X A;  3RFR A;  3H42 B;  3KLS A;  3MIE A;  5FMD A;  2PFW A;  2VZ3 A;  2WA3 A;  1UW8 A;  1D4M 3;  4TXW A;  1W0P A;  1BMV 2;  2DCJ A;  3O1M A;  2ZA9 A;  5FPZ A;  3ZXD A;  1ULC A;  1S1A A;  3FN9 A;  5JZG C;  1UWW A;  3IMN A;  3J8F 1;  4JGZ C;  2PAK A;  4NPR A;  4CXX A;  5FY8 A;  3IMM A;  4BMB A;  4ZKT B;  1JYX A;  4XFA A;  3ZFG B;  1XNT A;  1S55 A;  3T0D A;  4OI4 A;  4HK9 A;  4JRA A;  1APN A;  2LAL A;  2QCS B;  3WEZ A;  2P3K A;  5C3Q A;  2VC9 A;  4Y22 B;  3KGL A;  4YM3 A;  2Q30 A;  4ZHN A;  3KVA A;  4RGG A;  1F9K A;  1CAW B;  1A8M A;  3B01 A;  3EQE A;  1QIQ A;  3PTR B;  4NHY A;  1LHN A;  1GR3 A;  1OFS A;  2D97 A;  1Y43 B;  4IE5 A;  5LBB A;  4PIY A;  3APB A;  4QAW A;  4I0W B;  2UWB A;  3NKG A;  1GMM A;  1I1E A;  1RUF 1;  1RGS A;  2RS5 1;  3WSO A;  3EHK A;  5D1I A;  1J3P A;  3AKP A;  2W1W A;  5DPN A;  5F5Q A;  4FFI A;  3G7D A;  3UJO A;  4H3W A;  1UO9 A;  3MDP A;  5JXI A;  1SPP A;  3P5B A;  3T0A A;  1F8V A;  1S0J A;  4P9X A;  5F3G A;  4LUK A;  1W8U A;  5FXZ A;  3VBF B;  5CEH A;  2GAU A;  4LPL A;  3O1S A;  5FQ0 B;  5FKC A;  1H9P A;  1LEM A;  2Y0I A;  3UKN A;  4KWJ A;  3NRU A;  5DDJ 1;  2AEN A;  2MPF A;  3BYW A;  1WMD A;  4XFI A;  5JCT A;  4UFK A;  4DNY A;  3OTF A;  4BU2 A;  2I07 B;  2XQR A;  1OC1 A;  4XAC A;  2YDE A;  5J37 A;  3ZFF B;  1Y9M A;  4M0N A;  2X5I B;  2A3X A;  2DFC A;  3MF9 A;  4Q0U A;  4B1M A;  4AI1 A;  4YW4 A;  3ZX7 A;  1WUV A;  3FBM A;  5FYI A;  1XNB A;  2ZAH A;  1CWP A;  1JHN A;  1B35 C;  1ZBA 3;  4Q2F A;  1FNY A;  4QQL A;  4CSW A;  2H0V A;  1QJX 2;  1UQX A;  4EWD A;  2WII B;  2C1F A;  1W8N A;  3E5X A;  1OPO A;  2ETE A;  3TBD A;  1UPS A;  4D7S A;  1UMI A;  3MPP G;  5LB6 A;  1RUE 3;  3DCQ A;  1BQP A;  2NN8 A;  3RJR A;  1YFU A;  5C4W C;  1Z7S 3;  2VUA A;  5FDB A;  3PTY A;  3ES1 A;  2Y6J A;  3RMX A;  4HK8 A;  3CZJ A;  4L92 A;  1VIW B;  4RL7 A;  4N43 C;  3HIF A;  3OYW A;  1HQW A;  2EXH A;  3O7O A;  3S0M A;  3OY8 A;  4XQW A;  4WVZ A;  1POQ A;  1KXG A;  4FOV A;  4Q27 A;  2JDM A;  4ORF A;  3GZU C;  2WZR 2;  4DEV A;  4XIK A;  4FAG A;  3TOJ A;  1CZS A;  2B7Y A;  2NMO A;  1ZBE 3;  2PHW A;  3GJB A;  4V2W A;  4GJY A;  2BQP A;  1AR6 2;  2CAU A;  1ENS A;  4QU1 A;  1ACC A;  1NLS A;  1AJK A;  5H9S A;  1QH6 A;  3A0N A;  3RZL A;  1PK6 C;  1YIF A;  1COV 3;  4JHZ A;  4COW A;  4GA9 A;  4L2N A;  5CNA A;  5LAT A;  3WCR A;  2QQJ A;  2PMW B;  3TRS B;  4E2Q A;  3M8L A;  4XIL A;  1MEC 2;  4FQ4 A;  2JEC A;  1PHM A;  3ECQ A;  1BBT 1;  1T2X A;  2L9L A;  4XJU A;  1JUH A;  2WYF A;  3ZXG A;  2O1Q A;  1MS5 A;  1AR7 1;  1LEC A;  2YU2 A;  3IZO A;  4Q4Y 2;  4WV8 A;  3ZYR A;  2QZ2 A;  3AFG A;  3I97 A;  4L11 A;  4XC9 A;  5FK8 A;  5C3O A;  4IEY A;  2WFF 2;  4H2A A;  1VMJ A;  1WLW A;  5FZG A;  2G9G A;  5B4N A;  1N3P A;  1Q8P A;  2HEV F;  2VGD A;  4AI8 A;  2EA7 A;  1LEN A;  1FXZ A;  4XXA A;  4QGL A;  4ZS2 A;  1SFP A;  4Q8L A;  2VZR A;  4V1P A;  1ODN A;  1LOB A;  3DYM A;  5IK7 A;  3U1X A;  4FPY A;  3ZPO A;  1HB3 A;  4IEP A;  3VBR B;  1AF9 A;  1R09 1;  3NNF A;  4KU8 A;  5I0D A;  2IXI A;  4DO0 A;  2AH2 A;  2BEO A;  2CL2 A;  2PHX A;  2RHP A;  4YW6 A;  5IVB A;  2VNR A;  1VBC 3;  4P9J A;  5L36 A;  3KSC A;  4LHS A;  4MYE A;  3WG4 A;  1CR7 A;  3OEA A;  1QNY A;  3D0J A;  4LBQ B;  2QJV A;  4L0P A;  1OOP B;  1SLI A;  3BVC A;  4QKF A;  5FP3 A;  1ZRE A;  1RUJ 3;  4JDO A;  1A3K A;  1ZX5 A;  5DAB A;  3VHN A;  3WR0 A;  3MLK A;  5FZA A;  1RIR A;  1MQT C;  2DFB A;  2UU8 A;  4OI2 A;  3AX4 A;  5JWP A;  2A75 A;  4QXK A;  4LHL A;  3SCF A;  2VXR A;  4R52 A;  4YRD A;  4QKB A;  1VAM A;  3N7K A;  4NVP A;  3ZSK A;  4B4R A;  2EID A;  2WKK A;  3HBK A;  1GQG A;  4W6Y A;  1VBD 3;  3FLR A;  5IYY A;  3NJZ A;  3OBT A;  4N7I A;  2LTN A;  1VB4 A;  1YJL A;  1UY2 A;  3H8R A;  3CZU A;  3KZ4 C;  4FAH A;  1C8M 2;  4F8A A;  1L7L A;  2NMN A;  1V6K A;  2JE7 A;  4N90 A;  4Q4X 2;  4RFT 0;  5EYX A;  1J1T A;  4EN7 B;  4X6Q B;  4HN1 A;  1NX9 A;  3VLB B;  1BMV 1;  4BQ4 A;  5AFE A;  1QJU 3;  3POF A;  5FY4 A;  1QOO A;  2V73 A;  4XAE A;  2WQ8 A;  1PNF A;  1OLR A;  4HG6 B;  5H9R A;  1W8O A;  3RZZ A;  3H8X A;  2E7A A;  1LCL A;  1ASJ 3;  3BOD A;  4XHB A;  2GZW A;  4FTS A;  3HQU A;  4YGB A;  5ERL A;  1ND2 C;  2BGO A;  1POV 0;  5A32 B;  5D8A B;  5KBF A;  4HL0 A;  3WNL A;  4K8F A;  3MBW A;  3QCW A;  4YM0 A;  3B94 A;  3ILR A;  1F5J A;  3WG2 A;  2GH2 A;  5JI7 A;  4KQ7 A;  4AVB A;  4CP9 A;  1XPW A;  2F17 A;  2VZT A;  4GKY A;  5ABJ B;  4Q1R A;  2WNE A;  1DQ6 A;  1NT0 A;  4YZ3 A;  1AR9 3;  5F7U A;  2W87 A;  3I2J A;  1SAC A;  3ACF A;  3O5S A;  1CAX A;  2WNV B;  4IGP A;  1WD4 A;  1JZ2 A;  3AZX A;  5FYY A;  4CRQ A;  1VBE 2;  5LA2 A;  4QPI A;  4GB3 3;  3ZDV A;  1XNA A;  1EV1 3;  4CCE A;  4K40 A;  5C8C B;  1O91 A;  3INA A;  2H6B A;  2XGX A;  2YB7 A;  3GHN A;  2QNK A;  4R9B A;  1BEV 3;  2WT0 A;  3VN4 A;  2MNG A;  3CJI B;  4O9E A;  4BK5 A;  3PME A;  4JAA A;  3AKS A;  3IDA A;  1JW6 A;  5A3W A;  1WD3 A;  2ZOE B;  4ONU A;  4EN9 B;  1S0G A;  2WS9 2;  3Q8E A;  5EXO A;  2P6H A;  4N7U A;  2WQZ C;  1W9T A;  4FPJ A;  4PI0 A;  5KXC A;  4KG0 A;  2CGN A;  3RZH A;  4D7Y A;  3R4D B;  3LE0 A;  1D2Q A;  3GM8 A;  4Y33 A;  5ANN A;  1HKD A;  3BTA A;  1OVP A;  3PU8 A;  2VW1 A;  4AEJ A;  4M3C F;  3B00 A;  3ATG A;  2VZV A;  4Q0S A;  3ZYF A;  3ZXJ A;  5FO9 B;  1YQC A;  2BPA 2;  3J4U H;  4AL9 A;  1XE8 A;  1H1M A;  2VW0 A;  2WO7 A;  3W59 A;  3MV1 1;  4XTP A;  3P6B A;  4X8P A;  1DGR N;  1QJX 1;  1XRU A;  2ZGO A;  4YG3 A;  3ROU A;  2FCV A;  1W06 A;  2VE1 A;  2XG3 A;  4LMF A;  3RZG A;  4AED C;  3V0B B;  1GSL A;  1OQE A;  2LRP A;  1AZD A;  3WW3 A;  4NRP A;  3W5M A;  3AJY A;  1OA3 A;  2N7G A;  2QQP A;  1Q8S A;  2Y6L A;  4JRL A;  3BCW A;  2OQ6 A;  4CCD A;  3JQX A;  2Z2S B;  3NV2 A;  3HN1 A;  4XCB A;  1FMD 3;  3PUS A;  2ZGQ A;  3A7Q A;  5BNO A;  4LBL A;  5A3L A;  1D0G A;  3ZSE A;  1MZE A;  2IXK A;  3IBM A;  3L2Y A;  4V2V A;  2GND A;  4JGY B;  1B09 A;  2WZR 1;  4RFR B;  5H9Q A;  1AR6 1;  2W0X A;  2ZGU A;  4A45 A;  4AVT A;  1W9S A;  1HRI 3;  4CUA A;  5JVV A;  5BYN A;  2Y33 A;  3PJY A;  4FTE A;  3NKT A;  2P6C A;  2VQA A;  4LBK A;  3UGH A;  4XUQ A;  3T2Q A;  1GZT A;  4IV3 C;  4BDV B;  4EV0 A;  4MGS A;  1LHO A;  3H7Y A;  3TWI A;  1YQ2 A;  1YJK A;  4DEQ A;  3USU B;  1NKG A;  5LA0 A;  4KH9 A;  2C9A A;  4P00 B;  1MEC 1;  5F5I A;  3IIA A;  1LNS A;  5FMC A;  5DZG A;  5A7N A;  3MPB A;  1W6M B;  1SCS A;  1FI2 A;  3D82 A;  2J1S A;  2YGL A;  3HN3 A;  2RMU 2;  5I8S A;  1KD7 A;  4ERO A;  3I3Q A;  3NAP B;  4CDU B;  2WZ8 A;  4Q4Y 1;  5IAV A;  3DL3 A;  1I5Z A;  1SBE A;  2J1U A;  2VCB A;  4IES A;  4LK7 A;  4OI0 A;  1W6O A;  3E6D A;  2WFF 1;  2CY6 A;  3VBO A;  1DGW A;  4DIQ A;  5C3R A;  4A7Z A;  1WLD A;  2OVU A;  2GC3 A;  2JE8 A;  2W94 A;  4K9S A;  4ZPI A;  4AWD A;  5KHJ A;  3AVR A;  4TYS A;  1BHG A;  1DBN A;  4MHR A;  5FPX A;  2D93 A;  3M3E A;  1GNY A;  4MG2 A;  2GNB A;  2XOM A;  3NVC A;  5K9Y A;  4NMI A;  2OYZ A;  1J1L A;  1OKQ A;  2HWC 2;  1PX3 A;  1LB2 A;  2VZU A;  3DYO A;  4OUL A;  4QQO A;  2YC2 A;  4XDP A;  3U10 A;  4F83 A;  3J26 N;  2NYY A;  2H6C A;  1V6I A;  2VUC A;  5LK5 A;  3UK9 A;  4U36 A;  2B45 X;  4KI5 M;  2G9Z A;  1RUG 2;  4FVV A;  4GAL A;  2SBA A;  1V9U 2;  3BOP A;  4AG4 A;  1W8Z A;  3H3L A;  5CYY A;  2R16 A;  3A23 A;  3BPS A;  3DYP A;  4Q29 A;  5E88 A;  4YW7 A;  3VBU B;  1QY4 A;  2GAL A;  4I0B A;  4QPG B;  4GMP 1;  3OGR A;  2JG8 C;  5LEJ A;  2ZAA A;  1JOP A;  1JU4 A;  1WKY A;  4FP2 A;  1GZ9 A;  4CPB A;  4LBJ A;  4LIT A;  3LKJ A;  3OEB A;  3GZT B;  4NIA A;  3ILF A;  4P9Y A;  4MXW A;  3MEP A;  2D40 A;  3AM2 A;  4QKD A;  4ZY9 A;  4C90 A;  4IEO A;  3I2O A;  1C8M 1;  1NG0 A;  2W47 A;  4Q4X 1;  5GM0 A;  1E5I A;  4AAX A;  2Y34 A;  3A22 A;  3AXE A;  4OUM A;  2ZHM A;  3WF2 A;  2VQU A;  5J3U A;  1EAH 1;  1XYN A;  2GDF A;  2NQY A;  4BXS V;  1LHU A;  5EYY A;  5FRE A;  3WDU A;  4A44 A;  5FPU A;  3IAP A;  2BNM A;  1OA4 A;  3M7A A;  4P9L A;  1H6Y A;  3AZV A;  1NCQ B;  4CUC A;  1O3S A;  2ZAC A;  4CEY B;  4HSL A;  4XFB A;  3MIB A;  1OPM A;  4QX2 A;  4CXW A;  3BU0 A;  1AXZ A;  4Z2A A;  4DY3 A;  5DXD A;  4H14 A;  4H55 A;  5A7W A;  4ASM B;  1IPK A;  1DIW A;  1H8T A;  1NCR A;  1UOB A;  1RUN A;  4PHZ A;  1W05 A;  4ISQ A;  3OUI A;  4NJ4 A;  5GLZ A;  4XBN A;  1RUI 2;  4K1Y A;  1DQ2 A;  4UOJ A;  5KWR A;  2ZX1 A;  2BRT A;  4FFG A;  4FFH A;  1HRV 3;  3CDZ B;  3H8U A;  2OPW A;  3E5U A;  1WW5 A;  1LUL A;  3J7H A;  4QHZ A;  4CU9 A;  1ZZB A;  5DAX A;  4OI1 A;  1WCU A;  2D44 A;  3LA7 A;  3C7E A;  2DVG A;  3I7D A;  1VBE 1;  3E1F 1;  1SFN A;  1ULG A;  2RV9 A;  2OA2 A;  2WWS A;  2DUO A;  2G19 A;  5AC9 2;  3POJ A;  2XWJ B;  3SH3 A;  1XB9 A;  1LAJ A;  4FPH A;  2A6Y A;  5GZG A;  4CXY A;  4YW1 A;  3CIH A;  3ZN5 A;  1K5M A;  2ZHK A;  3D8C A;  1U5Z A;  4GUL A;  1MZF A;  2R06 3;  2ZBJ A;  5DG2 A;  4CEW B;  1NA1 A;  5JR2 A;  3NW4 A;  2W91 A;  3DGT A;  5FY0 A;  2D3S A;  3H3U A;  3LF7 A;  2VMF A;  2PHR A;  5DN2 A;  1AXY A;  2CU5 A;  4ZU5 A;  1GIC A;  5GZC A;  4DZG A;  1VBB 3;  2ZJC A;  2R49 A;  1J84 A;  3KT7 A;  1D4V B;  1GFF 2;  4MZU A;  2WS9 1;  4FXG B;  4GH4 C;  4BIO A;  4LE4 A;  3ILN A;  3POG A;  1NE6 A;  3DPR C;  3C8X A;  5JIU A;  3AP9 A;  5FTT C;  3RI9 A;  3Q8A A;  1DU3 D;  1PZ9 A;  2RS3 2;  5SV5 A;  4LKS A;  2IVJ A;  2HBU A;  3T2P A;  4E9K A;  5A1L A;  2P3J A;  3U11 A;  5JXG A;  4AGG A;  2EAK A;  4BCU A;  1C57 A;  1VE0 A;  2HJI A;  4GWM A;  4ZU4 A;  5HI0 A;  4BQ5 A;  2A1X A;  3MI8 A;  3CBN A;  2HWD 3;  4LOT A;  3QLQ A;  4XEZ A;  1HDK A;  5JZG B;  2ET1 A;  4IEV A;  1JS9 A;  2D6P A;  1BYH A;  4E4S A;  1L3J A;  1PO1 3;  3WF3 A;  5FP8 A;  1H6X A;  1CX1 A;  2VD7 A;  2Y6K A;  1E5H A;  2WWU A;  2YY1 A;  5GKA C;  3CEW A;  2ZMN A;  3NNM A;  1CAV A;  3ZLI A;  1V6M A;  2VW2 A;  3ZN4 A;  5A1A A;  3L9J T;  1FPN 3;  3ACL A;  3SC7 X;  1MS3 A;  5FOB B;  1TVG A;  1JH5 A;  5FK7 A;  1CJP A;  3URF A;  4E2G A;  1UAI A;  4IE0 A;  1JOB A;  4BLJ A;  2JIJ A;  2R07 3;  4BE3 A;  3AP7 A;  4WM8 A;  4CA9 A;  2Y38 A;  1V6L A;  2CWM A;  1QXR A;  3IPV B;  1AX2 A;  4AQT A;  4Q5O A;  3VGI A;  2D5F A;  2RJL A;  3AP5 A;  3JB8 A;  3LB9 A;  4QDS A;  4YGD A;  2XJT A;  4PQQ A;  3VZN A;  4ISR A;  2VOT A;  2WO3 A;  3J8F 3;  4B1L A;  1PO2 1;  2MEV 2;  1XBF A;  5M0T A;  3MIC A;  3W9A A;  2VUJ A;  3N36 A;  3VBH A;  2RMU 1;  2ZX0 A;  3OGS A;  5T55 A;  1QJZ A;  2G9F A;  1W2A X;  1SDD B;  1GWK A;  4Q0Q A;  2Q8D A;  3UV9 A;  4CCJ A;  3J7L A;  3PVN A;  1B35 A;  3BU7 A;  2WUH A;  2W9X A;  2A6W A;  2DWR A;  5L7O B;  3CO2 A;  3VBO C;  2KA3 A;  1H2K A;  3O0X A;  4CDX A;  3T0B A;  3AVS A;  3EO6 A;  4LBN A;  4NAM A;  1N3O A;  2RM2 2;  5C4W A;  2BDR A;  1W3V A;  3JXS A;  3N9P A;  5FY7 A;  4QQH A;  4JVA A;  1UCX A;  3KHB A;  4KU7 A;  1RUF 3;  2RS5 3;  2HWC 1;  3ME2 A;  4Y26 A;  2D3P A;  2W08 A;  2WC2 A;  3LOB A;  5CFD A;  4O9G A;  5B2G B;  4QHB A;  1EYB A;  4GKX A;  5KHI A;  2D6L X;  1X8M A;  3UL2 A;  5K8S A;  1PVX A;  5C9A B;  4CCK A;  1DFQ A;  3LSE A;  1MS1 A;  2C0Z A;  3VD4 A;  3KM5 A;  1QWR A;  2LS6 A;  3O0W A;  4LTA A;  4QDR A;  5FY5 A;  4XUT A;  1RUG 1;  4RN5 A;  1TQ5 A;  1V9U 1;  4LHK A;  3DUI A;  4NO4 A;  3WHU A;  4PQ9 A;  1O3Q A;  1DCS A;  2XVL A;  4IE4 A;  4EN8 B;  4N43 B;  1WCK A;  3ACI A;  1PK6 A;  5DDJ 3;  4QX7 A;  3B93 A;  3H9A A;  1GWM A;  2ERF A;  2F4P A;  3OCP A;  4IGO A;  3R6S A;  3ZSJ A;  4CCL A;  1WW6 A;  2QQW A;  1HN0 A;  5FY9 A;  4BWO A;  4I3G A;  4YGE A;  3O14 A;  4GMP 0;  1OLM A;  2QTW B;  1JZ5 A;  1F4A A;  1PZ7 A;  5IK5 A;  1S0C A;  2WSV A;  3VZM A;  2VVE A;  4FCA A;  2A6Z A;  2BYV E;  4WVV A;  1YO8 A;  4XFG A;  1G8W A;  4LO7 A;  1H2L A;  2BV4 A;  1MPX A;  1SLC A;  2ARE A;  3GDB A;  1Y9Q A;  4MGI E;  3WNN A;  2YYO A;  1W9F A;  2VR4 A;  4UW6 A;  1CAU A;  2W5F A;  3I59 A;  4XAB A;  1DHK B;  1HJF A;  1TME 2;  5EPA A;  3EMR A;  2ORX A;  3ZN6 A;  3SH5 A;  2JD4 A;  3LZZ A;  3AMP A;  4W50 A;  1EPW A;  4AI0 A;  4FT8 A;  1CQ9 A;  3HT2 A;  1UD1 A;  4CUB A;  1XJA A;  3MHZ A;  2QDN A;  4XF0 A;  2VH9 A;  1W0N A;  4MV2 A;  1NCR C;  5CG9 A;  1QJF A;  4OHZ A;  2FMY A;  4LNV A;  1RUI 1;  4Y20 B;  4WM7 A;  5IUQ A;  4RHV 1;  2UYB A;  3IDE A;  2W3J A;  1H1I A;  1C3H A;  5LAS A;  1G86 A;  2ZEZ A;  3POY A;  3FHA A;  5IFP A;  1GAN A;  4YFW A;  1D4M 2;  1IS4 A;  2FQP A;  4NWV A;  3NJX A;  5F5C A;  4OLL A;  4DRV A;  3R4U A;  4QXC A;  1W6P B;  3GZE A;  5AC9 1;  2FMD A;  2Q8E A;  2B9U A;  1PVC 2;  4NRM A;  4EYU A;  5IVE A;  1Q8V A;  2ZCW A;  3B69 A;  4GWJ A;  4MHU A;  3TEZ A;  1K5M C;  3ZXK A;  1XOY A;  2PLV 2;  1BBT 3;  3OGV A;  3ZYP A;  1ZRC A;  1NA1 C;  2ATF A;  1JYV A;  3WDW A;  2ZGT A;  3OBZ A;  2OX0 A;  4F3J A;  1AR7 3;  1UOF A;  2O8Q A;  4P5Y A;  3N7M A;  4S2H A;  1UZV A;  2V5Y A;  4XFC A;  2QQN A;  2ZPX A;  3OGG A;  1KS4 A;  4IEZ A;  2Y6F A;  2ZX4 A;  4R8H A;  1P8J A;  1F31 A;  2DUR A;  1N47 A;  2YUE A;  4XHX A;  4AGR A;  3FUO A;  4FPF A;  5FZL A;  1H4H A;  1IKP A;  5FZC A;  4EN0 A;  1PIV 2;  1ZA4 A;  1POV 1;  2ZHL A;  2GN3 A;  3U0Z A;  1R09 3;  2RS3 1;  3KWV A;  3FHQ A;  4A4A A;  1ND2 A;  3IWZ A;  2VZ1 A;  3K3O A;  5FLH A;  5FYB A;  1UN1 A;  3C2U A;  3PDQ A;  4XBL A;  2Q5T A;  1GZW A;  1NXD 1;  2D7F A;  5BNN C;  1V6N A;  1BK0 A;  4NUB A;  4AHZ A;  4IW3 A;  4XYX A;  5J48 A;  5K4L A;  2HWE 2;  5LBF A;  1W9W A;  3VD9 A;  3W58 A;  3WHT A;  2RR1 2;  2PHT A;  1H30 A;  3HNY M;  2HYX A;  3LDR A;  4KWK A;  5GZD A;  1TNR A;  1GP6 A;  1CAW A;  1JMU B;  3I2K A;  4AFD A;  5KXD A;  2VCC A;  3VKO A;  2XPJ A;  1J59 A;  5T54 A;  1NLQ A;  3M70 A;  1KEX A;  2P3Y A;  4N8M A;  2VOV A;  4CDQ A;  2UYA A;  5FPB A;  4K6B A;  3SQO A;  4WM8 C;  5K0U A;  4ITC A;  3NO8 A;  4DIN B;  2A6V A;  1UY4 A;  2RS1 2;  2HWB 1;  2ZEY A;  1NLR A;  5FMO S;  3F2Z A;  3UES A;  4ATF A;  3ES4 A;  4XF9 A;  2WLP A;  4A2U A;  3KF3 A;  3WDX A;  4FBF A;  4G4F A;  1IOA A;  3H3Z A;  5FLJ A;  5CFC A;  4OQ8 A;  4GQ7 A;  2JX9 A;  4AE2 A;  3B3Q E;  1RUE 2;  4B8E A;  1SPP B;  2HWF 2;  3POB A;  4FFF A;  3KB5 A;  4D7T A;  1UOJ A;  1Z7S 2;  4WBB A;  5FYZ A;  2DCT A;  3ACH A;  4XZU G;  2ZGN A;  1ZZ7 A;  4IEQ A;  4NOT A;  4XBQ A;  3ZYG A;  1G9A A;  5JPN B;  3VBH C;  3ON7 A;  1AUY A;  1LU2 A;  3OD0 A;  5J09 A;  4G3Y C;  5JMO A;  1O59 A;  3MW4 A;  2E26 A;  1S2K A;  2QQL A;  3GZA A;  3VHP A;  2CGP A;  3BN6 A;  3S6P A;  3FE5 A;  2TNF A;  4CDX C;  4DFS A;  5F3I A;  4CUG A;  2JIG A;  4AED A;  3UT0 A;  5GLV A;  1Q3E A;  3LEG A;  1COV 2;  5IVY A;  1UY0 A;  1MVQ A;  1DYO A;  3RG0 A;  5C5T A;  3GJA A;  5JXJ A;  3LA2 A;  5FLI A;  1U5Y A;  1V70 A;  4BH9 A;  3DF0 A;  1LR5 A;  1T6G C;  5CFD C;  2VU9 A;  3AC0 A;  5LCW L;  5H9P A;  1BLZ A;  2C4X A;  4TTG A;  1HW5 A;  1OUX A;  4XUP A;  3M3O A;  4FI9 A;  3T4H B;  3PUQ A;  5BNP A;  4E2S A;  3MUZ 1;  5IK4 A;  2J1V A;  1CZT A;  2PTM A;  3HNM A;  2E33 A;  2ZX3 A;  4A42 A;  3LDB A;  5CAD A;  1U0A A;  4DXS A;  5FWJ A;  4W4Z A;  4DB5 A;  3OYW B;  4IV3 A;  2ADD A;  5F5A A;  3AP4 A;  1QJY 1;  2XKO A;  3OY8 B;  1JU3 A;  5FPA A;  5HCF A;  1OSG A;  3CJX A;  4BK4 A;  3HMY A;  1JOD A;  4R9D A;  2P17 A;  2RDR A;  1KJL A;  1ULP A;  4UWD A;  2WZE A;  3QAC A;  4A41 A;  3RNS A;  2QBX A;  2DV9 A;  5EQU A;  5IAT A;  1VBC 2;  4J25 A;  5DUW A;  2YXS A;  3PLQ A;  1ZRD A;  1YYN A;  3K3N A;  5FZK A;  4Z07 A;  2YRO A;  2ZGP A;  3J7M A;  3I2G A;  2QQV A;  3GHM A;  4LHN A;  3AKR A;  4C1X A;  1QJX 3;  1JBC A;  1UIK A;  1YUD A;  4QXB A;  2A6X A;  5EV7 A;  1RUJ 2;  3FLT A;  1L7Q A;  3NNJ A;  1NXM A;  5CB7 A;  2YBP A;  1REE A;  4URA A;  3MW3 A;  5IW0 A;  1TME 1;  3TN9 2;  4YLZ A;  3CNA A;  4HVQ A;  1ZRI A;  4OZX A;  2XJV A;  3VZO A;  3QD6 A;  1VBA 2;  1VBD 2;  4Q0P A;  2G4I A;  2QQI A;  3WUC A;  2EIG A;  3PIG A;  3WP4 A;  1JXN A;  5JPM B;  2DUP A;  1I3H A;  3OF1 A;  1CON A;  4XJA A;  4WM7 C;  3CU7 A;  2H0B A;  2B46 X;  1HXS 2;  4EZH A;  5A3P A;  4K21 A;  4AI3 A;  2DU0 A;  2WZR 3;  1YI9 A;  4TLG A;  1Q56 A;  2Y0O A;  1AR6 3;  2W1S A;  2XJP A;  4N9I A;  1YFX A;  2XHN A;  5LK7 B;  5FZO A;  3KCC A;  2FDH A;  4PDW A;  4L99 A;  5FP7 A;  1QJU 2;  4OZO A;  4CDW C;  1WCQ A;  2JDP A;  3M1H A;  4JKK A;  4FP3 A;  5FXW A;  2Q4S A;  3ZIW A;  3B02 A;  1PVC 1;  3AYE A;  1YIP A;  3A21 A;  2YFZ A;  2JG8 A;  5DAW A;  1MEC 3;  1Y3T A;  1XSQ A;  2PLV 1;  3V0A A;  1NY7 2;  2IXC A;  1AYM 1;  4LA3 A;  1F15 A;  3KHC A;  3B7M A;  3X29 B;  2SLI A;  4LBO A;  2XON A;  4HVO A;  5F2W A;  3Q9O A;  1Q5O A;  2JDH A;  4Q4Y 3;  3TYJ A;  4EE2 A;  1QEX A;  2EIE A;  4BJ0 A;  2GP5 A;  3LEI A;  4XJZ A;  1UYY A;  4L97 A;  5E1R A;  4RQP A;  1W2U A;  2WFF 3;  1EUT A;  4UBG A;  3W20 A;  5KC6 A;  2Q1M A;  1H2M A;  1SFY A;  1O8S A;  1VAK A;  4ZXK A;  5L9B A;  4LUM A;  5A6Y A;  4YW2 A;  1PIV 1;  1EV1 2;  1UYP A;  4QWN A;  5C6C A;  4AQ2 A;  1BK1 A;  1H2N A;  2BP6 A;  4ES9 A;  1XNK A;  1AL0 G;  4LKD A;  2VZP A;  1BEV 2;  3KV9 A;  2QVS B;  2E6V A;  4KWU A;  4Y4Y A;  4YWA A;  4CCC A;  1IQA A;  5FZD A;  2EAA A;  4YM1 A;  2WR9 A;  4LKF A;  1ZM1 A;  4XFH A;  5BUV A;  1DGR A;  4LR4 A;  4XPV A;  3AL5 A;  2FBE A;  3U14 A;  1ZRF A;  1VRH 2;  2EF6 A;  3S7E A;  2WRA A;  2ZKL A;  3RPQ A;  4CTE A;  1CES A;  3R05 A;  5A3M A;  2VZQ A;  1W99 A;  3PUR A;  1UU4 A;  2HWE 1;  4UXA A;  4TZD A;  3CF6 E;  1XC6 A;  4QGM A;  5JOW A;  1HJG A;  1N1Y A;  2RR1 1;  3UGF A;  3LCP A;  3GBF A;  2R6Q A;  1H8V A;  2YFU A;  3JD7 3;  1O4Z A;  4CP9 B;  2V5D A;  4FSJ A;  2ZML A;  1W2N A;  1DLC A;  1VP6 A;  4TSV A;  2DF7 A;  5IHR A;  5FWE A;  1DDL A;  5DAQ A;  1DQ0 A;  4B4P A;  1RMU 2;  4YW5 A;  4I01 A;  2PHD A;  2WNV A;  4CDQ C;  1MS8 A;  1D2S A;  1ODM A;  4OQ9 A;  1PMJ X;  1XXN A;  5K0U C;  5LY2 A;  3P3N A;  1DZQ A;  3VDD A;  4PF1 A;  1AL2 3;  4NR1 A;  2RS1 1;  4QPI B;  4UT5 A;  1RUD 2;  3E5Q A;  2XXZ A;  1DQ1 A;  4Q4X 3;  2D6O X;  5E6H A;  2DUQ A;  2V72 A;  2E32 A;  1BZW A;  4LO5 B;  1MVE A;  2ORZ A;  5LRS A;  1XND A;  2JG9 B;  5FMB A;  1EAH 3;  3N7J A;  1G9C A;  1K42 A;  1OUS A;  1UF2 C;  5FZB A;  4GH4 A;  5CFC C;  3ZYJ B;  1W6N A;  1PGS A;  2HWF 1;  5KXB A;  2JE9 A;  1NE4 A;  1FYU A;  1Z7S 1;  3DPR A;  3P1I A;  3WVJ A;  4YZ1 A;  1TNF A;  2I74 A;  5I0R A;  2GNM A;  3OUJ A;  4I0A A;  5F3E A;  5B4X A;  4AI2 A;  1FMD 2;  3VDB A;  1UMH A;  3HEI A;  1U5I A;  1C5I A;  2DVA A;  1I5P A;  3HD8 B;  5IWF A;  1W39 A;  4KBZ A;  4ARX A;  2A3W A;  4BA6 A;  4YZ5 A;  5JAX A;  3R4S A;  4QXH A;  2CV6 A;  4NPM A;  2CAV A;  1CD3 G;  4E8D A;  2WAA A;  5A6X A;  3ZR5 A;  3LWC A;  4Q0V A;  4O61 A;  2IZW A;  1DZT A;  4MAD A;  2V4A A;  4DUX A;  1W90 A;  1HRI 2;  4E27 A;  2BNO A;  1QQP 2;  2J42 A;  1TMF 2;  5TSW A;  2BJS A;  4EQV A;  1COV 1;  2R32 A;  1HV0 A;  2KR2 A;  5JMC A;  1Z78 A;  2A71 A;  2IFR A;  3LAG A;  5I8T A;  5FZ8 A;  5CU1 A;  1W6Q A;  2X29 A;  3HR9 A;  2ZGS A;  5I8Y A;  4AVA A;  2P37 A;  5F32 A;  1YC6 1;  3O1V A;  5HV4 A;  3T4V A;  2DBN A;  5CAZ A;  2P4E A;  2UY8 A;  1ZZ6 A;  1EP0 A;  1PM4 A;  1QJE A;  4LIV A;  4IEU A;  5EIY B;  1R08 2;  3NV1 A;  5GLU A;  4HPK A;  4XJ8 A;  4NE9 A;  5FZ3 A;  5BNP C;  4FPG A;  5ANQ A;  3AMH A;  4XW3 A;  1DF0 A;  3N7L A;  5DAP A;  4FQZ A;  2WS9 3;  5BNO B;  1SHW B;  2YPJ A;  1UZW A;  5JIA A;  3IKW A;  4K20 A;  4NIH A;  4EWA A;  3KGZ A;  4LLF A;  2Y8K A;  3ENR A;  3ZYI B;  4LE3 A;  4C91 A;  2VCM A;  1O5U A;  3PNA A;  4Z2W A;  5A3U A;  3S5Q A;  4JDN A;  1UY1 A;  1RL3 A;  3ZMO A;  3OPZ A;  4PIX A;  1VBC 1;  3ETP A;  2AR6 A;  2CGO A;  3WDV A;  3ZXE A;  1OHF A;  1PM7 A;  2VO5 A;  2XH6 A;  4FPL A;  4NRQ A;  3SIT A;  4OHW A;  5FZI A;  3USU A;  4D8M A;  4ES8 A;  2DBI A;  3JBG 2;  5A33 B;  4UAP A;  2JDK A;  5LBE A;  1G6N A;  3MYX A;  3OBR A;  1W6M A;  1WLC A;  3SHR A;  5HCB A;  4AZZ A;  2RE9 A;  2ZGL A;  1W9Y A;  3I3D A;  4BYY A;  4HLT A;  3FC0 A;  4YSF A;  1RIT A;  3TN9 1;  2PHU A;  3TEY A;  1VBA 1;  1VBD 1;  4COV A;  3K77 A;  1SEF A;  1ZRR A;  1W28 A;  4IV1 A;  4M3C A;  4LO6 B;  1W2T A;  4ZON A;  1QGL A;  1W6O B;  4YAR A;  4XF1 A;  3VBO B;  3VKN A;  4RYD A;  1ONA A;  1KS5 A;  2HBT A;  2OQ7 A;  4AR2 A;  4AF9 A;  3RS6 A;  5KHK A;  1HXS 1;  1AXK A;  1JYC A;  4YM2 A;  3VBR C;  3WW4 A;  3ZFE A;  4DMI A;  1LED A;  1FV2 A;  4S2D A;  1PGL 2;  4PI2 A;  3H1W A;  4AFB A;  4P02 B;  3J9S A;  1MZ6 A;  2ZGK A;  3PU3 A;  4RGK A;  2P5B A;  4PDW C;  3FL7 A;  3I2I A;  1JTZ X;  3WXP A;  3WNK A;  4NID A;  3SH4 A;  1D0H A;  4Y24 A;  2CDO A;  1VMH A;  3AXD A;  2JDZ A;  3EBR A;  1O7F A;  1OOP C;  1W03 A;  1X7N A;  3T3Y A;  1PO2 3;  2XJQ A;  3HQX A;  5ACA 2;  1NOV A;  2WN2 A;  5FYM A;  1NY7 1;  2JXA A;  1GQH A;  5FAX A;  3HNB M;  1DG6 A;  2JDU A;  2RMU 3;  3POE A;  3VBU A;  2B4K A;  5A7P A;  3WD5 A;  3AK0 A;  5FYT A;  3WQ1 A;  2DVB A;  3KV6 A;  2OZ6 A;  5LBC A;  2BFU L;  4D6S A;  2WA4 A;  1BKZ A;  2WLQ A;  3VB9 A;  3O1U A;  1VAV A;  1UXX X;  2KM2 A;  3IDC B;  4RQP C;  4BME A;  3PL0 A;  2J7M A;  5CA6 A;  4LBQ D;  2VUL A;  4LK6 A;  3ZYH A;  2B9V A;  4MXW B;  5E16 A;  1EV1 1;  2GH8 A;  2IFW A;  2BBV A;  1W8T A;  2XLG A;  3KT4 A;  1KQR A;  1UXZ A;  3PVB B;  5DZE A;  1XE7 A;  1ZNP A;  1BEV 1;  1C5H A;  4B4Q A;  2F4L A;  2HWC 3;  4N9H A;  4JKM A;  5HXM A;  1K5J A;  3RZM A;  3JUU A;  3A0K A;  3AP6 A;  1YEW A;  3FZ3 A;  4BXF A;  1J83 A;  1VRH 1;  3FWE A;  4LLO A;  4CEY A;  2BFU S;  1YCI A;  4J6G A;  4FOQ A;  1VBB 2;  2R7E B;  4O7X A;  4S2G A;  5D8A C;  5GJ6 A;  3SMH A;  4BQW A;  4YZ2 A;  1RHI 2;  1RVF 3;  2UWA A;  1UKR A;  1V9U 3;  4OHV A;  2VMC A;  5A7W B;  4BQX A;  1AVB A;  1H8T B;  1NCR B;  5ABJ C;  3O1O A;  1US2 A;  3WNP A;  4YNI A;  5T5L A;  1WLT A;  2VTF A;  4DUW A;  4SLI A;  1RMU 1;  2VEC A;  1QDC A;  3KMH A;  2WNV C;  3GGL A;  4FPE A;  3USS A;  5A7Q A;  4RR3 A;  4LOS A;  3KCY A;  2VMG A;  3ZR6 A;  4YPJ A;  4IND A;  3AL6 A;  4QHO A;  1TZO A;  3FX3 A;  5D21 A;  3VDD C;  2XJS A;  1W04 A;  2ZEX A;  1RUD 1;  3OGJ A;  2OW4 A;  5J98 B;  4RS5 A;  3ITQ A;  1RUC 2;  5I93 A;  4MET A;  5DUX A;  1K5M B;  4HFS A;  3RYR A;  4XIO A;  3UKV A;  2GC0 A;  1NA1 B;  2DVD A;  1PGW 2;  3FUQ A;  3ZMN A;  1X82 A;  2CTV A;  2QQM A;  3M2M A;  4GJZ A;  4Q4V 2;  4XFF A;  3WDY A;  1U12 A;  4YVS A;  5LW9 A;  1KGY A;  3FLP A;  3LSD A;  1ND3 A;  2P2K A;  3P3P A;  1RUI 3;  1SCR A;  1V0A A;  1DP0 A;  4Q1P A;  3VUO A;  4RHV 3;  3Q8C A;  3ORJ A;  4ZXE A;  5BNN A;  1AYN 2;  3EYP A;  4LOR A;  2NLR A;  1HRI 1;  4D3W A;  1QQP 1;  1W2O A;  1TMF 1;  4JGZ B;  5GZE A;  4HKW A;  2AEY A;  3K4D A;  4HON A;  3FBY A;  4MXV A;  1S0E A;  1YXW A;  4D6Q A;  3GBW A;  1MS9 A;  1QU0 A;  2GMM A;  2VBB A;  4P5H A;  1W3X A;  1YI7 A;  2JEM A;  5AC9 3;  2NZ9 A;  5FO7 B;  3BGA A;  5FZ0 A;  4OCT A;  1RXG A;  4B29 A;  2C6S A;  1MAC A;  3MO4 A;  2XBO 2;  5A7S A;  4EZ4 A;  4XJW A;  1IPS A;  2VVF A;  1UYZ A;  1CAV B;  1R08 1;  1PNG A;  4XUN A;  3WV6 A;  3RZK A;  1KRI A;  3VBS A;  2R04 2;  4O65 A;  2OZJ A;  1ZZ9 A;  1MS4 A;  3VKL A;  2VME A;  1R1Z A;  5A3N A;  3IN9 A;  4JGY C;  3Q8B A;  1OLM E;  3WW2 A;  4AW7 A;  3C7F A;  4WM8 B;  4DXT A;  2WNU A;  1REF A;  4PBP A;  5LRR A;  3POW A;  4Y1U A;  5I91 A;  1POV 3;  2VNG A;  1OKO A;  2RS5 2;  4YG6 A;  1QMJ A;  2PQQ A;  3H8O A;  4CP2 A;  1YHF A;  1J58 A;  3PJQ A;  4XUO A;  3O1P A;  1PMH X;  3UKT A;  3MF6 A;  5FKB A;  4AQ6 A;  3LDK A;  3ELN A;  1AR8 2;  5EWS A;  4DRR A;  5I0S A;  1FOD 2;  4GXL A;  1Y7B A;  3JBG 1;  1V6J A;  1S2E A;  2X05 A;  1S4C A;  2YGM A;  4LA2 A;  4NPL A;  3U4S A;  3VZK A;  4I3P A;  3VBH B;  1QKQ A;  2A73 B;  4CDU C;  5IT6 A;  2YG0 A;  4YYO A;  4OUE A;  2XR4 A;  3LFM A;  1X9P A;  5F39 A;  3A4U A;  3D0S A;  1O3R A;  4Q4W 2;  4Y3O A;  1B35 B;  1N1S A;  4R9C A;  2FDJ A;  3Q8F A;  1VJ2 A;  4IV1 C;  4URT A;  3R0R A;  1WME A;  3C7H A;  2BNN A;  2QFE A;  4PJY A;  1CN1 A;  4CDX B;  4UF0 B;  4A6O A;  3GCW A;  3ZFE C;  4WVM A;  3LGR A;  1LHW A;  2GP3 A;  1PGL 1;  5C4W B;  2VMD A;  1KJR A;  2HWB 3;  4JHT A;  4F7Z A;  1C1F A;  2EIB A;  1UX7 A;  3N9L A;  5FOJ B;  2XJU A;  2WJS A;  4GWI A;  2J1E A;  1OH4 A;  1RUH 2;  1T6B X;  4DXZ A;  5C9A A;  5CFD B;  4HKO A;  2RDS A;  3QOP A;  2QQO A;  4Q26 A;  5FRA A;  5KR7 A;  2D98 A;  1UY3 A;  4QB2 A;  4BPZ A;  4DQA A;  1JI6 A;  4FTB A;  4KWL A;  4M0H A;  1O4T A;  3HOB A;  1G9F A;  2BER A;  5ACA 1;  3N35 A;  5KC5 A;  1GBG A;  3NWK A;  2ZGR A;  4GIQ A;  3WW1 A;  2RJK A;  2XML A;  4HXC A;  1HLC A;  3NST A;  2ES3 A;  1O4Y A;  3VBU C;  4XDO A;  1X50 A;  4DUV A;  4C0H A;  1R1A 2;  2B39 A;  1CIY A;  4OFG A;  5FZH A;  1UU6 A;  4YVW A;  1ZZC A;  1PK6 B;  2QZ3 A;  3ZXL A;  4YFZ A;  4LO8 A;  3LPF A;  5FUI A;  4NHL A;  1VLN A;  2B42 B;  3OD4 A;  3SNM A;  3RGB A;  5FJK A;  4YG0 A;  3NV3 A;  1UU5 A;  4GZ9 A;  3OPW A;  2GNT A;  5ISL A;  4AVS A;  1VB2 A;  4GWN A;  2VL4 A;  4MGZ E;  3N3H A;  1XYP A;  3WF4 A;  3KF5 A;  1LOF A;  1CAU B;  3I59 B;  2XL7 A;  1US3 A;  1NQD A;  1IZ3 A;  4CEY C;  5JI9 A;  3ZN6 B;  2B8M A;  1ULE A;  4HT1 T;  4D69 A;  2RJ2 A;  4N53 A;  4YGC A;  3U37 A;  3VZJ A;  3ZOI A;  1ENQ A;  1RHI 1;  1V6O A;  2VOW A;  3D3A A;  2CHH A;  4IEW A;  4KBB A;  4JQT A;  3G6J B;  4NII A;  4CCO A;  2W1U A;  4CDW A;  2JJ6 A;  1XQN A;  5CZK A;  2K2S A;  1TEI A;  1UMZ A;  5FV3 A;  5FUN A;  3TNQ A;  4WM7 B;  5A7O A;  1QJY 3;  4HMZ A;  3BTZ A;  4QX3 A;  1XSR A;  1Q8Q A;  2HEW F;  2ARC A;  3D6E A;  4IE6 A;  3VZL A;  1DQ4 A;  4C0B A;  5J96 B;  3GAL A;  3I8T A;  3LOI A;  3OBA A;  4RR3 C;  2OS2 A;  5FYU A;  4CU7 A;  2CYF A;  3V65 A;  1K45 A;  4QM9 A;  4KGG A;  3NNG A;  2EVX A;  5DQ0 A;  1MQT B;  4OYU A;  2IXJ A;  2BOI A;  1BCX A;  4NHX A;  1RED A;  3AMQ A;  2DCZ A;  4RS5 C;  2PN5 A;  2XL9 A;  1RUC 1;  3LPG A;  1W0O A;  4CEW C;  4ZU7 A;  4DPN A;  4BLI A;  1LU1 A;  1W8H A;  3B9C A;  1TME 3;  2ILM A;  1PGW 1;  2PAM A;  1S2B A;  2VQT A;  4Q4V 1;  2IC1 A;  4YVS C;  1S0D A;  2ZGM A;  1SLL A;  2VVD A;  3VD5 A;  3POS A;  4BM8 A;  1AJO A;  4X6R B;  1ND3 C;  2WFP A;  2Y6H A;  3FFQ A;  4DOU A;  3M3Q A;  4XJ9 A;  3GF6 A;  3NL1 A;  1AYN 1;  1QOS A;  5FY1 A;  3SLI A;  1VRB A;  1SMV A;  3ZFG A;  5FMO L;  5JLV A;  2WQ4 A;  2ZEW A;  1DYK A;  1OA2 A;  1QOT A;  3C3V A;  4RD7 A;  4XDQ A;  1OT5 A;  1UZZ A;  1ND2 B;  2ARB A;  3MID A;  5F6L B;  1YFW A;  3ZIX A;  3BTX A;  4Y22 A;  1RYY A;  4I02 A;  1EUU A;  5I0T A;  3RYK A;  4UW4 A;  1QNW A;  1GZW B;  1UYX A;  1ENX A;  1PVC 3;  3SCG A;  2WAB A;  4MH0 E;  4HET A;  5C5U A;  2PLV 3;  2XBO 1;  4AOC A;  4CE8 A;  1AYM 3;  3WIN E;  3MLL A;  1JUI A;  4AI9 A;  1JZ3 A;  5FFO C;  1KDK A;  4QM8 A;  3T2O A;  1XU2 A;  1ZBA 2;  2R04 1;  4MLO A;  4RSU A;  3VBS C;  2Q1Z B;  2V09 A;  2BTV C;  3MIH A;  3D4K A;  1C8N A;  4YZ4 A;  4A3X A;  3DXT A;  4Q8K A;  1GYK A;  1WW4 A;  2VCA A;  2P3I A;  4UYB A;  4CDQ B;  3MIF A;  4A3Z A;  2DVF A;  2WNU C;  5K0U B;  3VBF A;  1PIV 3;  2VTX A;  1A6C A;  3SIS A;  5FQ0 A;  2R0H A;  4NN0 A;  3GCX A;  4W65 A;  2MEV 1;  1OVS A;  3HQR A;  4P08 A;  1OUR A;  1OMI A;  5G04 L;  4ASK A;  1DGW X;  1QDO A;  1HB2 A;  1JZ6 A;  1ULO A;  4HZF A;  2DCK A;  4PLM A;  3S57 A;  4XTM A;  5FBZ A;  3JU9 A;  1AR8 1;  4IGQ A;  3WX5 A;  5CFC B;  2W39 A;  2WDB A;  1FOD 1;  4S2F A;  3RI8 A;  4NHM A;  1LGN A;  1OF4 A;  2QKD A;  2HWE 3;  3B9I A;  2BGC A;  1ZBE 2;  2WIN B;  1IS5 A;  4KG8 A;  5T5J A;  1GP5 A;  2X5I A;  2YPD A;  3ZFF A;  1UZY A;  3M3I A;  2RR1 3;  2WBK A;  1RJ8 A;  4OMD A;  5DZF A;  4ET7 A;  1IG3 A;  2EAL A;  1G9D A;  1GUI A;  1YNA A;  5T5O A;  1WMF A;  2RM2 1;  2NM1 A;  5JOX A;  5L7O C;  4Q4W 1;  5JUV A;  1BVV A;  4FXK B;  3H0O A;  1HV1 A;  2LM3 A;  3K4A A;  1NZI A;  2AUY A;  2GSY A;  3LEK A;  4TLF A;  3MFA A;  2DCY A;  2EIC A;  1UPI A;  2Z69 A;  1M06 G;  4NWW A;  4TN7 A;  1TE1 B;  4FOY A;  4NRO A;  4AED B;  3I3E A;  4QU2 A;  2FD8 A;  2MHF A;  2RS1 3;  3ZPY A;  3SCH A;  2ADE A;  4Z1V A;  4XOG A;  4DY5 A;  5F3C A;  3WQB A;  5A1F A;  5C33 A;  2OXB A;  5FP4 A;  5BV6 A;  1RUH 1;  1D7P M;  2X10 A;  2BVB A;  2HLE A;  4AGV A;  1AX1 A;  5C9A C;  1CPM A;  4AFA A;  1JZ8 A;  1PMI A;  4BHP A;  2E9Q A;  4LIU A;  2HWF 3;  3VHR A;  2VJX A;  3I3B A;  1SLB A;  3SXW A;  4PF5 A;  3WG1 A;  3KT1 A;  4G9S B;  1JN2 P;  2BWC A;  1YQ6 A;  3NNL A;  1VAL A;  4Y1Y A;  3WNO A;  5BNP B;  5D2A A;  3QH6 A;  2XHK A;  1TG7 A;  1R1A 1;  4AEM A;  1GV9 A;  1NYW A;  2OT7 A;  4K1Z A;  2FCT A;  5FCC A;  4IV3 B;  3K4Z A;  4Y1V A;  1GOH A;  1C1L A;  1H4G A;  3PIJ A;  4YVW C;  3BIW E;  5BNQ A;  3KV5 A;  5FZ4 A;  2E51 A;  3KS7 A;  2ID4 A;  2C26 A;  3KQR A;  2ZXQ A;  2W52 A;  1GNH A;  3OJB A;  4LQR A;  4UFH A;  3KCX A;  4R9A A;  1O3T A;  3U07 A;  2VNV A;  1EY2 A;  2W46 A;  4KL1 A;  1GOF A;  3U75 A;  1ZZ8 A;  3ASI A;  2VUD A;  2HH9 A;  1RTV A;  2BZD A;  2C9K A;  3S7I A;  2QDR A;  1SZB A;  4KGQ A;  1LOE A;  3I2F A;  1I9R A;  1N1T A;  3HAG A;  1LOF C;  1QXJ A;  2R1D A;  3I2H A;  3WP5 A;  4AHX A;  3VBR A;  2ARX A;  1F4H A;  3T09 A;  2W95 A;  4J1X A;  4N53 C;  2RDN A;  3O1R A;  1DYP A;  2WAO A;  2Y26 A;  3T1M A;  5FZ9 A;  1D4M 1;  5T52 A;  1NAE A;  4J1W A;  5LY1 A;  5EJ1 B;  3FMG A;  4MGK E;  3N9M A;  2ZHN A;  1SG3 A;  2ZAB A;  1UZ0 A;  2JB4 A;  4LBQ A;  1ASJ 2;  2VZS A;  1OOP A;  1XE0 A;  4CU8 A;  1OF3 A;  3CHX A;  2O8O A;  1LJ7 A;  2ZX2 A;  2ARA A;  4BOW A;  5FZO B;  3MLJ A;  4COY A;  4AHY A;  4PDW B;  2XLA A;  3RDI A;  1GZC A;  4Z92 B;  1NQJ A;  2XLF A;  4XCA A;  3WT3 A;  5J7M A;  4WVW A;  3WQ7 A;  1LOD A;  1ULF A;  2OUJ A;  4AXO A;  3CL1 A;  2IWG B;  4COZ A;  1UX6 A;  1AR9 2;  4JQR A;  1LRH A;  5FBJ A;  3RWN A;  2JG8 B;  3KD4 A;  3AZY A;  3THP A;  4AAP A;  3FFZ A;  1JZ7 A;  3V0A B;  2VPV A;  3JD7 2;  3RSJ A;  3TN9 3;  2D6K A;  1OQD A;  3KV4 A;  4I2O A;  4GB3 2;  4EWE A;  1W8W A;  1VBA 3;  2XDV A;  2WWJ A;  4X8N A;  3K48 A;  1GP4 A;  3WLU A;  1XU1 A;  5AVA A;  4P9W A;  3K75 B;  1A34 A;  2JIC A;  2HYK A;  1V00 A;  3AMM A;  1X36 A;  2PQS A;  1QH7 A;  1Y4W A;  4RQP B;  3RMY A;  1PX4 A;  2AC1 A;  3HBZ A;  5IVC A;  1IS6 A;  4EJR A;  5L9R A;  3TEW A;  5IFT A;  5CVR A;  1UIJ A;  5HPO A;  2UWC A;  1HXS 3;  4A7K A;  1IQD C;  1AL2 2;  1F5F A;  3AB0 A;  3HPN A;  3KVB A;  4WZC A;  2VMI A;  3U78 A;  3VKF C;  5HV0 A;  2GN7 A;  3ZFG C;  5A32 A;  4XXP A;  5D8A A;  3ZYB A;  1IS3 A;  2YC4 A;  1EAH 2;  5JOZ A;  3AMN A;  5FUP A;  5ABJ A;  5FXX A;  1HB4 A;  4CCM A;  5LWB A;  1DGL A;  1WA6 X;  1K12 A;  2OKX A;  3ZM8 A;  3THT A;  4B3N A;  5F9T A;  2GC1 A;  3MGU A;  4GMP 3;  4BQY A;  1WWY A;  2YBS A;  4XF3 A;  5FR3 A;  3OPT A;  1LOG A;  2A7A A;  3ZDS A;  5BPX A;  3H50 A;  2NP0 A;  1CAX B;  5IVJ A;  4M4P A;  2C24 A;  1YFY A;  4IUG A;  3VD3 A;  4UFM A;  1ZBA 1;  3GNE A;  3AZW A;  2VOX A;  3WCS A;  5C8C A;  5HXV A;  3H1M A;  4LJH A;  1C8M 3;  4U2A A;  3PUH A;  2Q1F A;  3NJY A;  4IE7 A;  4LO4 B;  4MO3 M;  4KMQ A;  4K7J A;  5A80 A;  4E4H A;  5BY5 A;  4OMC A;  2YV8 A;  2YZ4 A;  3VL9 A;  3CJI A;  1KFX L;  2JEN A;  2LW8 A;  2BUK A;  2QQU A;  1RUE 1;  4L9B A;  5J1X A;  3VBF C;  2Z4F A;  4QQ2 A;  4K8R B;  3ZO0 B;  3LD8 A;  3VDD B;  1O8P A;  4UFI A;  5EJ3 A;  3WOG A;  3W21 A;  2PA7 A;  2JG9 A;  5JSP A;  1CPN A;  3IDB B;  4PLN A;  4JDM A;  4IET A;  3UYJ A;  1M4W A;  1JYN A;  2J22 A;  2IVI B;  4GH4 B;  2BBA A;  5E8A A;  1W6N B;  1GWL A;  1VRH 3;  4JC1 A;  3JB4 C;  1R64 A;  4JX0 A;  5EHD A;  4CP0 A;  2RVA A;  2TEP A;  4M01 A;  3DPR B;  1BVP 1;  4GAZ A;  1ZBE 1;  1H0B A;  1LTE A;  4KNC A;  3AZZ A;  2JDY A;  4XQD A;  3ZFF C;  1UNB A;  2X5I C;  4M3C E;  3ACG A;  3DKW A;  2WT2 A;  2XB6 C;  1JYW A;  2F6B A;  4LEJ A;  3WG3 A;  5FXV A;  4AVV A;  3BI3 A;  2Y6G A;  2X53 S;  1L7R A;  1VBE 3;  2VG9 A;  4Y1X A;  4XZP A;  3SEP A;  2Z42 A;  5AVP A;  4UFJ A;  2VZO A;  2BU9 A;  3VHO A;  1IHM A;  1RMU 3;  4E8C A;  3RZJ A;  1URX A;  2W92 A;  1PZ8 A;  1FT9 A;  1IG0 A;  1QXP A;  3LFI A;  5C70 A;  3V0B A;  2ZTN A;  1S0I A;  3GXU A;  1GQP A;  3VDA A;  4CVU A;  4Y4R A;  1MS0 A;  2BOJ A;  4UI9 L;  5FPV A;  1AX0 A;  3WZ1 A;  1RUD 3;  1FV3 A;  1LGC A;  5FYH A;  1W6Q B;  3HJR A;  3UNP A;  1CGP A;  2O0O A;  4CU6 A;  2WL1 A;  1WBL A;  4QT6 A;  3SKJ E;  3ST7 A;  4AVC A;  4JGY A;  3UJQ A;  5KHH A;  1GU3 A;  2V4V A;  2Y60 A;  3LIG A;  4C1W A;  5IVF A;  3M3C A;  2GMP A;  2JWP A;  4HPK B;  3SEE A;  3VDC A;  1ZYB A;  3OUH A;  3WNX A;  1KFU L;  2A70 A;  4A7Y A;  2DU1 A;  5F1R A;  1JYI A;  1HX6 A;  2EXJ A;  2I45 A;  3O12 A;  4BIS A;  1SBF A;  3T1L A;  5LZ6 A;  3C7O A;  2VQ0 A;  4MOA A;  2DTW A;  3KQ4 B;  2WSU A;  4K3U A;  2YC0 A;  3THD A;  2E53 A;  5CKM A;  2P34 A;  1QQP 3;  4HVR A;  1RUJ 1;  1TMF 3;  3K46 A;  2DYC A;  2GC2 A;  2JB8 A;  2CNA A;  3LIH A;  3MV0 1;  5T50 A;  3QBQ A;  4B7E A;  3N4M A;  3MFC A;  3NAP A;  4CDU A;  3BTY A;  3LEM A;  5CIR A;  5A33 A;  3ZKU A;  1IGO A;  5J36 A;  4AHW A;  3E6C C;  3RVH A;  3AYA A;  3E6B A;  1HN1 A;  3GYD A;  3HWJ A;  5JR7 B;  4E4Z A;  3BKZ A;  3DKQ A;  4Y1Z A;  1PO2 2;  3MIG A;  2Q8O A;  1RC6 A;  3PHM A;  1JZ4 A;  2YHJ A;  2ZZJ A;  1RIN A;  2QUO A;  5JXH A;  5CBL A;  4ASL A;  2FDI A;  1FNZ A;  3BAL A;  1EPZ A;  1R08 3;  4QX8 A;  4P14 A;  4CCN A;  4E4D X;  1E57 A;  5L9V A;  3UGG A;  3GBG A;  1F2N A;  1GLH A;  4IV1 B;  4M3C B;  5DUU A;  5C71 A;  4OUS A;  3WNM A;  5HCA A;  3MZH A;  1LGB A;  4CZS A;  1QJU 1;  1CIW A;  3PMS A;  3LQC A;  4COU A;  5JDB A;  3VL8 A;  4JTO A;  1S0B A;  1ASJ 1;  4PT6 A;  4QMA A;  3ZFE B;  2AEZ A;  4FPO B;  2W68 A;  2AZ5 A;  3WP3 A;  4GD4 A;  3UET A;  1A8D A;  3OG2 A;  4XMA A;  2CSG A;  3CLP A;  2WO2 A;  4PLO A;  3HVD A;  2NPI A;  3SKV A;  1YQ8 A;  3CQO A;  3N9N A;  4QPG A;  2B5H A;  1HRV 2;  3AFK A;  3JBG 3;  4MX3 A;  4EN6 B;  1ZVF A;  1NUK A;  2IUW A;  1AR9 1;  5C3S A;  1WCD J;  5IK8 A;  2XVK A;  5FYC A;  3WF1 A;  1YRZ A;  1RVF 2;  5T5P A;  2VBP A;  1RUO A;  1G7Y A;  3JD7 1;  2QE3 A;  3DV8 A;  5GLW A;  2FDK A;  4GB3 1;  4DS0 A;  4BIF A;  4W6X A;  5A6Z A;  2J1A A;  2GME A;  2E7Q A;  2KXL A;  1XNC A;  2UUR A;  3IAQ A;  1X9T A;  4XVH A;  4YW3 A;  3RQ0 A;  4B7K A;  1UL9 A;  2R06 2;  5A3O A;  4LXL A;  3NQH A;  3TNP B;  1NCQ A;  1OH3 A;  2VM9 A;  1WZX A;  3BUC A;  1AL2 1;  1Q43 A;  5BXX A;  1LES A;  2K0G A;  3H1Y A;  5FZ7 A;  1C4R A;  1LHV A;  5FJH A;  5A6Q A;  4I09 A;  1SLT A;  4LBM A;  3ZXA C;  3DXU A;  1RUG 3;  1OD5 A;  3U4X A;  4OHY A;  2FHR A;  3FJS A;  4UW3 A;  1QF3 A;  2O14 A;  3VD7 A;  1U5X A;  3AKT A;  3WY6 A;  3THC A;  5FP9 A;  1JOJ A;  4CYD A;  3I2D A;  1C28 A;  1YLL A;  3BOW A;  3NJV A;  3MUY 1;  2J1R A;  3POI A;  3BIE A;  2E31 A;  3I4I A;  2R1B A;  2OUH A;  2VMH A;  4Y5T A;  4D0Q A;  5ACA 3;  5IVV A;  1X33 A;  4AEK A;  5CKQ A;  2VNO A;  3AYC A;  4IQP A;  4RGA A;  1DZR A;  4A6S A;  3IM0 A;  5JSR A;  2PHL A;  1A78 A;  2ZZQ A;  4WZF A;  4XUR A;  4XAA A;  4JZR A;  2W2I A;  4RHV 2;  5C8C C;  4QB1 A;  2FDF A;  2HWD 2;  4FO9 A;  1G9B A;  2P1B A;  1WGP A;  2D6M A;  2GU9 A;  1WMX A;  2JDA A;  4QGN A;  1HQN A;  3F95 A;  4MSV A;  4MGQ A;  1YWK A;  4FPK A;  1PO1 2;  1ULD A;  5GAL A;  2KD7 A;  4P9G A;  1Q8O A;  3CKH A;  3JZV A;  3RYP A;  3WUD A;  3CJI C;  3WP6 A;  4BB3 A;  4CEW A;  2YU1 A;  2HEY F;  4RR3 B;  2TBV A;  5FZM A;  4P9I A;  4QPI C;  4LUL A;  2D6N A;  5F2S A;  3EB7 A;  3RRD A;  2E7T A;  1J3R A;  1FPN 2;  2YMZ A;  3O1T A;  4UFL A;  2JG9 C;  5CIS A;  4L8Q A;  1NZC A;  1JYT A;  1FMD 1;  4QB6 A;  4RS5 B;  1HQL A;  2K46 A;  3BPZ A;  4PIZ A;  4W8J A;  1IPJ A;  1N1V A;  4MVT A;  4QX1 A;  4Y5Z 0;  5F8P A;  3TAY A;  1SBD A;  2R07 2;  4QPY A;  5L73 A;  1ALY A;  4XQ4 A;  1KDM A;  4BQ2 A;  1FAY A;  2Q0A A;  2XUM A;  2IXL A;  4BQ1 A;  2WO1 A;  1RHI 3;  4YVS B;  2Q8C A;  5FO8 B;  1RXF A;  1F35 A;  1ND3 B;  4IEX A;  1N3Q A;  1SDW A;  2E63 A;  5SV8 A;  3LA3 A;  1E5R A;  2WYS A;  5FZ6 A;  4ZZ8 A;  5JZG A;  2OII A;  3NV4 A;  4JGZ A;  3J8F 2;  2FCU A;  4AK3 A;  5BNN B;  3ZSM A;  3O0V A;  1RB8 G;  4UW5 A;  5EP9 A;  4PCR A;  3CMG A;  1W8F A;  2D43 A;  3OOX A;  3VKM A;  4C8D A;  2C5D A;  1WW7 A;  2VTX J;  5A70 A;  4IXL A;  1VPH A;  2VBD A;  2XUE A;  2ET7 A;  3ABZ A;  3D5O A;  3III A;  1RUC 3;  4ZS3 A;  1OFN A;  2Z5W A;  4D6R A;  1X8E A;  3ALQ A;  5LA9 A;  1WCS A;  1GOG A;  4AFC A;  1XYO A;  3M4F A;  2A5Z A;  3OB8 A;  4HBN A;  4BZ4 A;  3VV1 A;  2D5H A;  1CVN A;  4Q4V 3;  3J7N A;  3I49 A;  3IPV A;  1RUF 2;  1RJ7 A;  3VBS B;  2YBK A;  2FZ2 A;  1QHD A;  5BNO C;  2RS3 3;  4XE9 A;  5DG1 A;  4BQ3 A;  2R0F A;  5A3T A;  2A3Y A;  2D3R A;  3AKQ A;  5C8W A;  2BGP A;  1BJQ A;  5F37 A;  5LA1 A;  2LUW A;  2EXK A;  2WNU B;  2X8K A;  1AYN 3;  2HWB 2;  5GLT A;  4JCK A;  1CZV A;  2JD9 A;  5CKN A;  4CP1 A;  1OXC A;  3RJ2 X;  1O6U A;  5IJR A;  2TUN A;  2PHF A;  3NAP C;  4PBO A;  5DDJ 2;  5CG8 A;  5HBA A;  5L7O A;  4JKL A;  5DAV A;  5AFB A;  1GNZ A;  3W5N A;  1J3Q A;  2DDU A;  3PVO A;  2RG4 A;  1I6X A;  4SBV A;  2XBO 3;  3JQW A;  3DEM A;  3EXU A;  3DEC A;  1BXH A;  1LKN A;  4M4R A;  1IKQ A;  2XWB B;  1KIT A;  1FAT A;  2PAE A;  2R04 3;  3ZXF A;  3L2H A;  1AHS A;  2RDQ A;  3I54 A;  4QPW A;  1E5S A;  2AYH A;  4UF0 A;  4XET A;  4XMI A;  1UKG A;  2ENR A;  3K51 A;  3ZKY A;  3JCI A;  3S5A A;  2XKP A;  3PVE A;  3BB6 A;  2OPK A;  3C7G A;  4WVM B;  5FYS A;  5C3P A;  3B5L B;  2DTY A;  4QKN A;  2MEV 3;  2X09 A; 
#chains in the Genus database with same CATH homology
 4BXS V;  4OMD A;  2WBK A;  4A44 A;  1PMJ X;  4ET7 A;  3IAP A;  1GUI A;  1H6Y A;  4CUC A;  4PF1 A;  5JUV A;  2WN3 A;  3K4A A;  4QX2 A;  2V72 A;  2E32 A;  3LEK A;  4Z2A A;  2ORZ A;  2EIC A;  2XQX A;  2QQK A;  3PUI A;  1K42 A;  3I3E A;  4UOJ A;  3CDZ B;  3P1I A;  2Y64 A;  3J7H A;  5B4X A;  4CU9 A;  3VDB A;  1UMH A;  3HEI A;  3WQB A;  4ARX A;  1I5P A;  2X10 A;  1D7P M;  2JKX A;  2HLE A;  3C7E A;  2W1Q A;  5C7G A;  4ARY A;  1JZ8 A;  4E8D A;  2WAA A;  3IB3 A;  3E1F 1;  2RV9 A;  2VJX A;  3I3B A;  4MAD A;  4DUX A;  3WNO A;  1JHJ A;  3CIH A;  4DXR A;  4ZZ5 A;  2J1T A;  1TG7 A;  5JR2 A;  2W91 A;  3T08 A;  2VMF A;  5DN2 A;  3K4Z A;  5G05 L;  1GOH A;  1J84 A;  2ID4 A;  2C26 A;  2ZXQ A;  4LQR A;  2CDP A;  2W46 A;  1GOF A;  3C8X A;  5EIY B;  3T2P A;  4LKS A;  2BZD A;  2C9K A;  5DMY A;  5JXG A;  3I2F A;  1SHW B;  1K3I A;  4QDQ A;  3I2H A;  5EJZ B;  2Y8K A;  1F4H A;  3T09 A;  2W95 A;  1UY1 A;  4QX0 A;  2WAO A;  3WF3 A;  1CX1 A;  1H6X A;  1NAE A;  2Y6K A;  3ETP A;  3WF0 A;  5EJ1 B;  1SG3 A;  1OD3 A;  5A1A A;  2VO5 A;  1UZ0 A;  4D8M A;  2VZS A;  4UAP A;  1TVG A;  4CU8 A;  1OF3 A;  2VZ3 A;  3I3D A;  4TXW A;  2DCJ A;  3FN9 A;  1UWW A;  1JYX A;  3K77 A;  1XNT A;  3T0D A;  4RYD A;  1JZ7 A;  4QDS A;  3WEZ A;  2VC9 A;  4PQQ A;  2WO3 A;  2VOT A;  4P02 B;  3K75 B;  3FL7 A;  2PQS A;  3I2I A;  3OGS A;  1PX4 A;  3WNK A;  4QAW A;  1SDD B;  5IFT A;  5HPO A;  2CDO A;  1IQD C;  3HPN A;  1GMM A;  2WUH A;  2W9X A;  3WSO A;  2WN2 A;  2YC4 A;  2W1W A;  5DPN A;  3HNB M;  5JXI A;  2B4K A;  3T0B A;  3T0A A;  3ZM8 A;  1K12 A;  2OKX A;  3JXS A;  4LPL A;  1UXX X;  2J7M A;  3NRU A;  2B9V A;  4M4P A;  4IUG A;  3VD3 A;  3VD4 A;  2LS6 A;  1UXZ A;  4QDR A;  4XUT A;  3PUH A;  4MO3 M;  4KMQ A;  4JKM A;  4RN5 A;  4OMC A;  5HXM A;  2LW8 A;  3ACI A;  1J83 A;  5J1X A;  2Z4F A;  1O8P A;  2R7E B;  1W8N A;  1JZ5 A;  2VMC A;  1F4A A;  1JYN A;  1US2 A;  2J22 A;  3WNP A;  1UMI A;  2BBA A;  2VTF A;  4JX0 A;  4DUW A;  1R64 A;  2RVA A;  1MPX A;  3GDB A;  2Y6J A;  3GGL A;  3CZJ A;  3ACG A;  3WNN A;  1JYW A;  2VR4 A;  2W5F A;  4YPJ A;  2Y6G A;  1L7R A;  2ORX A;  3SEP A;  2ZEX A;  4W50 A;  2VZO A;  4DEV A;  4E8C A;  1CZS A;  2W92 A;  4CUB A;  1W0N A;  5C70 A;  3GXU A;  3VDA A;  1GQP A;  4CVU A;  4JHZ A;  4UI9 L;  2QQM A;  2QQJ A;  2W3J A;  3HJR A;  2ZEZ A;  5IFP A;  3FHA A;  3UNP A;  1KGY A;  3ECQ A;  2L9L A;  1T2X A;  4CU6 A;  3SKJ E;  3NJX A;  1GU3 A;  2V4V A;  1DP0 A;  4ZXE A;  3EYP A;  3I97 A;  3SEE A;  4GWJ A;  3VDC A;  5B4N A;  3K4D A;  3OGV A;  1JYV A;  3C7O A;  2VZR A;  4MOA A;  3DYM A;  4P5Y A;  3THD A;  5I0D A;  3BGA A;  3K46 A;  3WF2 A;  2QQN A;  3MO4 A;  1P8J A;  3MV0 1;  1UYZ A;  4LHS A;  4XUN A;  1HN1 A;  3OEA A;  4L0P A;  3FHQ A;  4A4A A;  2VME A;  2VZ1 A;  1JZ4 A;  3C7F A;  4DXT A;  5JXH A;  2EID A;  5IYY A;  1W9W A;  3VD9 A;  5C71 A;  3WNM A;  4XUO A;  1PMH X;  3HNY M;  2HYX A;  1UY2 A;  3I2K A;  3LQC A;  3CZU A;  2VCC A;  4PT6 A;  3UET A;  1KEX A;  3OG2 A;  2X05 A;  1NX9 A;  2WO2 A;  2WQ8 A;  2YG0 A;  4HG6 B;  3SKV A;  1W8O A;  3CQO A;  4OUE A;  1UY4 A;  2ZEY A;  1NUK A;  3F2Z A;  2BGO A;  3WF1 A;  3UES A;  3WNL A;  3MBW A;  3C7H A;  4A6O A;  1XPW A;  2VZT A;  2VMD A;  3ACH A;  4XZU G;  2J1A A;  5F7U A;  2W87 A;  3I2J A;  3IAQ A;  2EIB A;  1UX7 A;  3ACF A;  4XVH A;  4GWI A;  2J1E A;  1OH4 A;  3NQH A;  5JMO A;  1JZ2 A;  1O59 A;  2QQO A;  2VM9 A;  5LA2 A;  1UY3 A;  2E26 A;  4QB2 A;  1JI6 A;  1XNA A;  3HOB A;  2QQL A;  2YB7 A;  2BER A;  3BN6 A;  4DUV A;  3LEG A;  3VD7 A;  1CIY A;  1UY0 A;  3THC A;  1DYO A;  5JXJ A;  4BK5 A;  3NJV A;  3MUY 1;  2J1R A;  2E31 A;  3IDA A;  3LPF A;  4D0Q A;  5FUI A;  5LCW L;  3AC0 A;  2C4X A;  1W9T A;  4XUR A;  4TTG A;  4XUP A;  4FI9 A;  4QB1 A;  3LE0 A;  3GM8 A;  2JDA A;  4MGQ A;  3MUZ 1;  4GZ9 A;  2J1V A;  1CZT A;  3HNM A;  2E33 A;  2VZV A;  4A42 A;  2KD7 A;  3CKH A;  4DXS A;  2VL4 A;  4W4Z A;  3WF4 A;  1US3 A;  3EB7 A;  1JU3 A;  4BK4 A;  3MV1 1;  3P6B A;  2RJ2 A;  3U37 A;  1ULP A;  2WZE A;  4QB6 A;  3D3A A;  4A41 A;  4W8J A;  2QBX A;  4QX1 A;  2W1U A;  5CZK A;  3W5M A;  2Y6L A;  3I2G A;  4QX3 A;  2WO1 A;  1L7Q A;  3A7Q A;  3OBA A;  4CU7 A;  1K45 A;  3NNG A;  5DQ0 A;  2WYS A;  4ZZ8 A;  4OYU A;  4CUA A;  2QQI A;  4A45 A;  1W9S A;  3LPG A;  4XUQ A;  3T2Q A;  3CMG A;  4BDV B;  4MGS A;  2VQT A;  4DEQ A;  1YQ2 A;  1NKG A;  5LA0 A;  2W1S A;  4P00 B;  3ABZ A;  3VD5 A;  2XHN A;  3III A;  1LNS A;  3HN3 A;  2J1S A;  2Y6H A;  4OZO A;  1GOG A;  1WCQ A;  3OB8 A;  4JKK A;  2WZ8 A;  2J1U A;  2VCB A;  3A21 A;  2YFZ A;  2ZEW A;  1OT5 A;  2JE8 A;  2W94 A;  2BGP A;  1BHG A;  1RYY A;  1EUU A;  5LA1 A;  1GNY A;  2XON A;  2XOM A;  1UYX A;  2EIE A;  4BJ0 A;  2WAB A;  1CZV A;  3LEI A;  1UYY A;  2JD9 A;  1EUT A;  1PX3 A;  5IJR A;  1O8S A;  2VZU A;  3DYO A;  1JZ3 A;  2YC2 A;  3T2O A;  4JKL A;  2VZP A;  4KI5 M;  4KWU A;  3W5N A;  2DDU A;  4AG4 A;  2VCA A;  5CYY A;  3A23 A;  3DEC A;  3DYP A;  4A3Z A;  4M4R A;  2VZQ A;  1W99 A;  3OGR A;  1WKY A;  1JU4 A;  1XC6 A;  4P08 A;  5G04 L;  4QPW A;  1JZ6 A;  3OEB A;  1ULO A;  2DCK A;  2YFU A;  2V5D A;  1DLC A;  4ZY9 A;  2WDB A;  5IHR A;  2W47 A;  3C7G A;  1OF4 A;  4AAX A;  3A22 A;  2X09 A;  2VQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...