3GZEA

Algal prolyl 4-hydroxylase complexed with zinc and (ser-pro)5 peptide substrate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
WRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKSSVVDNESGKSVDSEIRTSTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYHDGQKYEPHYDYFHDPVNAGPEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGDGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Predicted protein
publication title The Crystal Structure of an Algal Prolyl 4-Hydroxylase Complexed with a Proline-rich Peptide Reveals a Novel Buried Tripeptide Binding Motif
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 69
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3gzeA01
4MHRA 2FCUA 3NNFA 4NHYA 2V4AA 2JIGA 3ITQA 3PL0A 2RDQA 4Q5OA 4NAOA 3OUHA 5LASA 3GJBA 5EP9A 5DAWA 4NHXA 3KT7A 4Y5TA 5C5UA 2FCTA 4NMIA 3OBZA 5L9VA 4UWDA 3NNLA 5DAVA 4ZPIA 3OUJA 5EPAA 3BVCA 3GZEA 3HQRA 5LB6A 4JZRA 2RG4A 4NHKA 3DKQA 5DAPA 2HBTA 3EMRA 2G19A 2Y34A 5M0TA 5LATA 5IAXA 5IAVA 5HV4A 2Y33A 3NNMA 5IATA 3KT1A 2RDRA 5ERLA 5A3UA 5L9BA 4XCAA 4ZONA 5DAXA 5LBBA 5LA9A 2JIJA 2A1XA 4NHMA 4XACA 4BQXA 2OPWA 4MHUA 3OUIA 2G1MA 3HQUA 2HBUA 5LBCA 5C5TA 5LBEA 4NHLA 3W21A 5DAQA 4XAAA 4J25A 4XCBA 4Y5SA 2RDNA 4BQYA 5LBFA 4XABA 3MGUA 3KT4A 5EQUA 4KBZA 5HV0A 4IW3A 4BQWA 2FCVA 5L9RA 3NNJA 4XC9A 3GJAA 2RDSA 3W20A
chains in the Genus database with same CATH superfamily
2VM9A 4GB31 5J7MA 4LOSA 4K1ZA 3WW4A 1VAVA 1UYYA 1UOGA 4NHYA 3KSCA 5F2WA 4QPGA 3WF3A 3OBTA 4WM8A 3PHMA 1OBNA 1AR63 1HIXA 1QQP2 1AR92 1RUC1 4RSUA 3E1F1 4G3YC 1RITA 4Y4YA 3ZYJB 1GQGA 5FXVA 2W08A 4B1MA 4B4PA 2Q1ZB 1O3QA 2PAMA 4RD7A 3OGSA 4Z8BA 2XGXA 3OPWA 5FP7A 3M7AA 2WIIB 1PVXA 2W68A 2WS92 3MIBA 3TEZA 1EAH1 4DINB 1W8ZA 2ERFA 4L97A 3JUUA 1RUF3 4V2WA 3DGTA 3M3CA 3GF6A 2VMGA 4QPIB 1W3VA 2YMZA 4NO4A 3ILRA 3J8F3 5FP9A 3VDAA 5J48A 4IEUA 1GV9A 4COYA 1YRZA 1ZRIA 4OZXA 4OFGA 5FYIA 3USUA 3BVCA 3WUDA 3WW3A 3H42B 3HQRA 4LXLA 5F5AA 4OHYA 1NCQA 2D93A 4QU2A 3ZYIB 2RG4A 5DUUA 3VZMA 1NLQA 4LHNA 5FTTC 5CKNA 2AENA 2P3YA 2WLPA 3BALA 1CONA 4IV3A 4XUQA 2DTYA 5FZKA 4P02B 4PLOA 4R9CA 4X8PA 3RZLA 3J26N 1PK6B 2P3JA 4QPYA 2AYHA 3POGA 1WLDA 2JDAA 2EALA 2JDUA 3LKJA 4K8FA 5IAXA 3T2TA 2NMOA 3THCA 4DZGA 2WNUB 5CFDA 4WZCA 3MV01 2PLV1 3WG3A 3A0NA 3VZJA 1Q3EA 1ZRDA 2HWC3 5GZGA 3CZUA 1FT9A 3IPVB 5F39A 4XCAA 2C1FA 2ZOEB 1JYCA 1ODNA 1LECA 5BNNC 2WQ8A 1IZ3A 4HBNA 3O1UA 2LRPA 3S6PA 2SBAA 1BBT1 4YG6A 1W8OA 5C6CA 3WQ1A 1LB2A 3FBYA 1G9FA 5CU1A 1NOVA 2WQZC 3IT8A 1H1MA 4NWWA 3E5XA 2C9KA 3H8UA 3PUQA 1VALA 4Q4W1 1OOPB 4K8RB 5FP3A 3RRDA 3WDYA 1RUNA 2Q1FA 2ZZQA 4IETA 1YQCA 3KV5A 3LPGA 2IXJA 2JX9A 2ZPXA 3ON7A 1JN2P 5LRSA 5LBCA 5FZLA 3QD6A 4LIVA 2IUWA 1UYXA 4BU2A 5FLJA 1AX1A 5F32A 3DYOA 2QQVA 2HKXA 2Y64A 5FZFA 1GZWB 4YW2A 4QKNA 2BRTA 3TNQA 2FDGA 4N43C 3ECQA 1H9PA 3JBG3 1IHMA 1STMA 4QM9A 5KHJA 3ZMOA 5JCTA 4YVSB 4YW1A 4LBQA 1DCSA 1CAVB 4B3NA 1LAJA 4G9SB 2D5FA 1OMIA 1HDKA 2GN3A 4Y3OA 4JKLA 1DFQA 4W6YA 1JXNA 1ZBE1 3S7IA 5FO8B 5FZ3A 1CAWB 4XF9A 3SEPA 3ES4A 3AKSA 5FZMA 4ISQA 1FPN1 2EXJA 3MICA 2EIEA 3WNKA 5KC5A 1O7FA 2H0BA 4IDZA 4UAPA 3K46A 4Q0UA 1H8VA 3ZFGB 5E88A 3TWIA 3LIHA 1YNAA 1VP6A 2BNOA 1AUYA 5IWFA 2XWBB 2PTMA 2ZGTA 1UU4A 3AFKA 3R6SA 3U11A 5CG8A 3VBOC 3R4DB 1US2A 2UY8A 3IMMA 5A32B 3RJRA 3USSA 1URXA 3OD4A 2X53S 2ENRA 4I01A 4Q4Y2 4Q5OA 5GJ6A 3HVDA 1EPWA 5KHKA 1FMD2 3VHRA 2ZGQA 3VD5A 2MEV3 3APBA 1GP6A 4FFIA 1VBD2 3DPRC 4HZFA 1Z0HA 1AZDA 2ZJCA 5FZDA 1CGPA 1NCRA 1W8TA 3VKOA 3AYEA 4Q0SA 4W6XA 4M0NA 1GP4A 1RJ8A 2HWE1 2ZMKA 3KZ4C 3NO8A 3O1TA 5CFCB 1RUE1 1S0EA 2HJIA 4XDPA 4QGMA 5DAVA 1JYWA 4QPWA 4Q2FA 3OUJA 3ZR5A 1HRV2 1Z78A 3RS6A 1G9DA 5C3OA 4BA6A 1HB3A 3P6BA 5F6LB 1E5IA 1QF3A 4XBQA 1NQDA 1IQAA 2AEYA 2QQPA 2GNTA 4TXWA 2WO7A 3BN6A 4AEDB 5JI7A 1PX3A 2XL7A 3OG2A 5FY9A 2OVUA 4I3PA 4EWEA 1O4ZA 1ZRFA 4SBVA 1C3HA 2JDHA 3O1RA 1C5IA 4A2UA 2Y34A 2JDNA 2R071 4J1WA 4N9HA 2WUHA 5JMOA 4EN9B 3H3ZA 4CVUA 1VBC1 2EIGA 5CG9A 1KJLA 3AKTA 4IE7A 1PO11 4NPRA 4HN0A 4DMIA 1N47A 1V9U3 5FYHA 2JICA 4DNYA 2JEMA 4E4SA 2VY0A 3WXPA 3WNLA 2R041 3D0JA 4FAHA 4CXYA 1YYNA 1S0DA 3ATGA 3J7MA 5D8AA 1PO22 3POWA 1XNAA 4WM7A 4XILA 4D7SA 3CJIB 2RS12 1RUJ2 2JIJA 1ULDA 2WN3A 3WNNA 2KA3A 3OPZA 3ZFFC 1Q5OA 3I2DA 1UOBA 3QCWA 4QQPA 1W90A 3CO2A 5EXOA 3LQCA 1OD5A 4RHV2 2JD4A 3FUQA 3TAYA 2Q0AA 3OUIA 4PF5A 2HBUA 3MUZ1 4QMAA 1Q56A 5F3GA 5LBEA 1XNBA 5BY5A 1HQNA 4QXKA 1DQ2A 5FPLA 3JZVA 3RFRA 1OLME 2OZJA 3VL9A 4BQ1A 1AL21 1OA4A 1DQ0A 2X10A 4XCBA 1UU5A 1WW4A 2AEZA 2PQSA 3AP5A 3N7MA 2W92A 4L99A 1D4M2 1ZBA2 3WG4A 2EICA 1H6YA 1REDA 1W99A 5ABJB 2RJKA 3ZYGA 1JOBA 1DZRA 2YBKA 3MW3A 4N53A 4NUBA 5D21A 3TN93 1V6IA 2ORXA 4QXCA 5FY1A 2Q1MA 3ZIXA 1B35C 3BPZA 1WA4A 4E4DX 1FNZA 2PHFA 2ZGSA 2D6LX 1DZTA 3V0BA 2P5BA 2GN7A 5HCFA 1J3RA 1ZZ6A 2B46X 3ES1A 2WABA 5FMCA 4BYYA 5DUWA 1TMF2 1TNFA 1ND2A 1WBFA 4UFIA 2BWAA 4ZZ5A 5I91A 2VZTA 4CDWC 4LKDA 2Y6JA 1N3QA 1CAXB 1O91A 2JKBA 1AYM2 2V4AA 3ITQA 4ATEA 3MDPA 4JRAA 4YPJA 2HYKA 2WO1A 4DEQA 5KHIA 3ZN6B 3KCXA 4UW4A 1K5MB 1PVC2 1FX5A 4CYDA 1WZXA 2YG0A 3DF0A 4IEWA 4ZHNA 5BNOB 1GOGA 2IVJA 4OULA 2RM22 4YZ5A 1W39A 3ZLIA 4EROA 1FNYA 2TEPA 4FOWA 2QQNA 2WFF3 3WNMA 4IEYA 3N7LA 2WRAA 3OSDA 5J3UA 5C5UA 2A3WA 3OY8A 3FLTA 2W1SA 2HYXA 3NNLA 2W9XA 4AHZA 1R64A 3L2HA 4URTA 4CUAA 2CWSA 2ZHLA 4RQPB 1X8MA 3AP9A 3I97A 5F5IA 1ACCA 2K9ZA 2AREA 2P34A 1IPKA 2YBPA 4YM3A 3NRUA 4BQ5A 4XVHA 3VD9A 1HXS3 3ACIA 3S5QA 1Q8QA 2IXKA 1C8NA 3SQOA 3N9PA 3NMBA 1AR81 4LA2A 4CCEA 2ZTNA 1F4HA 3RSJA 1XNDA 3JD72 2NZ9A 5A80A 1A34A 1RIRA 2RV9A 4GQ7A 4KWKA 3HT1A 4DXSA 2D3PA 5AC91 4CDUB 3CDZB 3DV8A 4IV1B 1GOHA 2W95A 1BK0A 1VBE3 3JQWA 4YZ3A 1JZ6A 1FAYA 1NA1C 2P6CA 1V70A 2X09A 1LOFC 4FOYA 1YHFA 3AK0A 2XJSA 1AR71 2L9LA 4P5HA 2WZR3 5C4WA 3N4MA 1PNFA 4HXCA 1MQTA 4Q1PA 4Y4RA 1F2NA 1HRI3 1RHI1 1RUG2 1L7LA 4D0QA 1G6NA 1QQP1 4D8MA 1R1A3 1JHNA 1YQ8A 3AFGA 4E2GA 3PVBB 1SBDA 2XONA 2BBVA 3A22A 2QQUA 3HAGA 3N7JA 3UYJA 3AYAA 2HWB3 1SPPA 4CP9A 3UGHA 1SCSA 3RPQA 1UX7A 1WLCA 3NJYA 1UW8A 4QKDA 4YYOA 4AW7A 2F6BA 5E16A 4HVRA 5F3CA 4ZY9A 1LU2A 1BVP1 5JI9A 3RWNA 1DLLA 1DF0A 4R4XA 5F8PA 3GBGA 3BTYA 2FDFA 1X9PA 5FZ0A 3G6JB 5L73A 1GNZA 3BB6A 3KVAA 3RZMA 4D94A 1C8M3 1HQLA 4JKKA 4NJ4A 1RUC2 3ZDSA 5B2GB 1UOFA 2ARAA 4MXVA 4NAMA 3MGUA 3ZXFA 2OX0A 3NNGA 1MZEA 1CX1A 4Q8LA 4AG4A 4PBPA 1EAH2 1ULOA 4LITA 3DXUA 3A23A 1J84A 3P1IA 3NV1A 1QY4A 5FXZA 5FYBA 3NNJA 5GZDA 3SISA 4QDRA 5C9AB 2PMWB 1I3HA 3CQOA 1LHUA 3PIJA 4QPIC 1PMHX 3T08A 2H6CA 2PHUA 2VECA 1LEMA 2E7QA 3GM8A 4C1WA 3I3EA 3UGGA 1W2AX 1MZ6A 2AC1A 4KG8A 1XYNA 2IFWA 5BNPB 1X9TA 2CU5A 1DZQA 4MXWA 2RS51 2A6VA 1AVBA 1BEV2 4BLIA 1WCKA 2JB8A 3V0AA 1N3PA 3VBRB 3VBUA 2A6WA 1FOD3 1HX6A 4DQAA 1JYIA 5DXDA 5IK8A 3LDRA 4XZPA 2VW0A 1LU1A 5LASA 4LA3A 5CZKA 5IK5A 3B02A 1PK6C 3LEMA 3POEA 4C1XA 3HBKA 3WCRA 1J3QA 3VDDA 4LBQD 1RC6A 1JU3A 5E89A 2DFBA 2VQAA 2ARXA 3KCCA 4YM2A 5JIAA 1C28A 1RUF1 5A3NA 4E4ZA 1SACA 4AHXA 3LCPA 1XOYA 2VNVA 1S2BA 3S30A 3B9CA 2C4XA 1IPSA 5H9RA 1OA2A 1BBT2 1UIKA 1OVPA 1ULEA 2D6PA 4XTPA 4MSVA 3WQBA 1KFXL 3PUSA 4TZDA 5GALA 2DURA 3I2JA 5I0UA 4CA9A 4KMQA 1H9WA 1RVF2 4GD4A 4Y1UA 1RINA 2VXJA 5A1LA 1OOPC 2DVAA 2I07B 4PF1A 5LA2A 1CWPA 1GU3A 1OFSA 1QXPA 3ZPYA 1AL0G 1ULFA 5M0TA 1W05A 1Y4WA 2I2SA 5FLIA 5A7NA 4XF4A 5C7GA 4IEXA 4QQ2A 3RYRA 1EP0A 3VBSA 1HB1A 4YZ1A 1GNYA 4TWTA 4E2SA 2W91A 4K21A 1CR7A 3AMHA 1B09A 5ANNA 3TEXA 2R32A 3PMEA 3NV4A 5I93A 4FVVA 2ZEZA 1SDDB 2WJSA 1UZ0A 2W39A 1DGWX 3PDQA 2DCKA 4NPLA 2YPJA 1X33A 4YVSC 1W8HA 1OD3A 1GLHA 3KWVA 1YIPA 4QD2A 1DU3D 2CDPA 4A6OA 3ZFEC 1LOBA 2PFWA 3P5BA 4OCTA 1ZBE2 5JSOA 5DQ0A 4W50A 4BOWA 2CAVA 5FXWA 2UURA 3R0RA 3FFQA 4I2OA 5JIUA 3ZYPA 1XC6A 2XXZA 4FCAA 2G1MA 1FPN2 2JD9A 4XIOA 5I8TA 1VBD1 3T2QA 4L8QA 1QGLA 5CIRA 3ZM8A 3M3EA 2XOMA 1BVVA 1N1TA 5EYXA 3AZXA 4WM8B 3ZFGC 3T4VA 1EUTA 1GR3A 3J7HA 5F7UA 4PCRA 2D6KA 1O8SA 4Y5SA 2HWD1 2JG9A 1ALYA 5T5PA 4AEMA 5LBFA 5L7OA 4S2GA 3S7EA 2RMU3 5C3RA 1GBGA 1MEC3 1W2TA 2ZKNA 4CUBA 4DS0A 4JRLA 3AMPA 4KBZA 1YIFA 4Z82A 2FHRA 4AGRA 5H9QA 2XPJA 1P8JA 3T0BA 5KXBA 4QHOA 4XHBA 5GZEA 1RL3A 4AAXA 1YWKA 2YY1A 2VOWA 2HWE2 1XSQA 1H1AA 3JCIA 1YFWA 1CPNA 2HWF2 4HFSA 1D0HA 3RI8A 4DUVA 3EBRA 4FO9A 1WD4A 2GALA 3USUB 4FP2A 2V4VA 3A0KA 5FDBA 2XJUA 1ND3A 3AL5A 3DKWA 2PXJA 2RJ2A 4Q4V3 5A7PA 1NCQB 3UK9A 3WDUA 1RUOA 4UBGA 3VKLA 1GZCA 4ZXKA 5K8SA 4UFMA 3HT2A 4QXHA 4R9DA 4F83A 1QJX2 4IV3B 4CDXA 1RMU1 2JDZA 2RS11 3WG2A 4AEDC 1MS8A 2WT0A 1R1ZA 3WP3A 1RUJ1 4WV8A 1QJU3 2VUCA 4P9WA 3GBFA 1AX2A 1FI2A 1VBC2 4G4FA 5FZAA 5LRRA 5CFDB 4KQ7A 4RHV1 2BU9A 1FV3A 4DEVA 5JPMB 1Q43A 4J1XA 2OW4A 2R042 2WZEA 4D7YA 1XE7A 2WA3A 3I2GA 1H4HA 1VMFA 2EF6A 2PHDA 4MGSA 5DDJ3 2GDFA 2VZPA 2BBAA 3J9SA 2WN2A 1GSLA 4XJZA 4AI8A 1VBA3 1GP5A 3S57A 1AJKA 5A7SA 3CJIC 4B8EA 1ENQA 1YEWA 1OLQA 2BOJA 4RS5C 3KF3A 1M4WA 5DAPA 4CEYB 3O1OA 1NT0A 2DV9A 3VDCA 5JDBA 2HBTA 2G19A 2Q4SA 4TN7A 3T2OA 2P3KA 5JR7B 3V65A 5HV4A 1ASJ2 2LROA 5E8AA 4QX8A 5IATA 1J1TA 1QJY1 3WQ0A 4LTAA 3PNAA 3VB9A 2RDRA 4XW3A 1X7NA 2XUMA 1IKPA 5DUXA 1XU2A 2K0GA 4AFAA 1TMF1 1MS3A 2DU1A 4GMP0 4N7IA 5FV3A 2D6OX 2YC0A 4B29A 4LBQB 1V9U1 2VW1A 4OHWA 1GYKA 3UJQA 1QJZA 4BCUA 5ABJC 2QZ3A 1F15A 4P9LA 5KWRA 3WP6A 4IEQA 2FD8A 1NQJA 3QLQA 2RS33 1ST8A 3K75B 2WWUA 2RE9A 3MLKA 5FPVA 3SMHA 4SLIA 5CKQA 4LBLA 2BYVE 4AQ2A 1TME1 3ZSJA 3ZXDA 1CN1A 1I5PA 2A6ZA 3B93A 4QGNA 5C5TA 4ARXA 5LA1A 3W21A 4BHPA 1OF4A 4OI2A 1LNSA 2WT1A 2NPIA 2WNEA 5ACA2 4JCKA 2GSYA 4QAWA 4JHTA 5A7WA 4C90A 3IDCB 4AZZA 4OVEA 3BIEA 3RVHA 1W6QA 4PIZA 1VRH2 2KM2A 3HMYA 3U78A 2KR2A 1APNA 1OLRA 1W6OA 1K5MC 1W06A 1U5ZA 3WT3A 5IUQA 4GWMA 2B4KA 4LUKA 1JZ2A 4IW3A 4ASLA 3AMNA 4XZUG 3P3PA 1NCRB 1YI9A 5DUVA 1COV3 5A7QA 2J1RA 1QJFA 4OZOA 3JD71 3KM5A 5FZ9A 1ZA7A 1R083 2DVGA 2VCAA 2YZ4A 1VBB1 2WO3A 3Q8BA 1UL9A 1REFA 1DBNA 1UXXX 3GJAA 1SFPA 4AXOA 3VBHB 4GH4A 3FHAA 4C8DA 5JUVA 2JE9A 4AGGA 4HANA 4MOAA 3W20A 5J96B 4LQRA 1S0FA 1ZZ9A 3MZHA 1AR93 4XF1A 5FZ8A 3OF1A 3BI3A 3NJZA 4EYUA 2BTVC 3WY6A 2XUEA 2BDRA 3I8TA 2VUDA 2FDIA 1WCDJ 4QHZA 3D0SA 4IEOA 1QNWA 1QOTA 3WCSA 4WBBA 2I74A 3WLUA 2ID4A 1RUG1 2BW8A 4Q4X3 2D98A 2EA7A 3MPPG 3MF9A 4AI3A 2VE1A 4MG2A 3GJBA 5AC92 1Z7S1 2WA4A 3WNOA 2QQKA 4HK9A 4Y5TA 5IVBA 4CPBA 1S4CA 2R1BA 2ORZA 2FCTA 3LA2A 1A8DA 4CDUC 1XNCA 3KCYA 2WFF1 4IV1C 1A6CA 1G7YA 1SCRA 3Q8FA 2G9GA 5D8AB 3H1WA 4WM7B 1AR72 5JOZA 3GZEA 4YNIA 5FPUA 1QNYA 1JZ5A 1GWKA 2VCMA 4IGOA 5F3IA 3VBOA 2PQQA 1RHI2 1FXZA 3OBRA 4GMP3 1LGNA 2QQLA 3LSDA 1OI6A 1XQNA 5K0UC 4A7KA 1BYHA 4FPKA 1RTVA 1UY3A 2B9UA 3QH6A 3OGJA 1PM4A 2GH8A 4HKWA 2BNMA 3T1LA 3B9IA 4K9SA 4E4HA 1UNBA 5FZOA 3O0WA 1UKGA 1Q8SA 2ZGNA 2XVLA 4BIOA 1RUD3 5JAXA 2V73A 1HJFA 3U14A 3O1VA 1N1VA 1WW5A 1F5JA 2D7FA 3BTAA 3VZLA 2JDYA 2QE3A 3PIGA 4BM8A 3WDVA 1LHWA 3BGAA 2GMMA 1NLRA 2ZAAA 2O14A 4PDWC 4XUPA 2DUOA 3MF6A 1SG3A 5GZCA 5KXCA 4PQ9A 5DAXA 2E7TA 4N53B 3U4SA 4PT6A 1XRUA 3HWJA 1HB2A 4FPYA 3MUY1 5A6XA 1PM7A 4Q0VA 3M3OA 3WDTA 1BEV1 3N9QA 5F1RA 4BQ3A 3MHZA 4AOCA 4C0BA 3V0BB 1RUI1 1HN1A 5HI0A 3SCHA 2ET1A 1F8VA 3O1PA 1OKQA 2ZAHA 3HQUA 3ZYBA 4BISA 1ND2B 4AFMA 5AFEA 5C9AC 1W28A 1PGSA 1D2QA 1U0AA 2CGOA 2E26A 2VL4A 1WMFA 3I59A 2XH6A 2YYOA 3LE0A 4LULA 4NN0A 4WVVA 3RDIA 4FOQA 1X8EA 1PMJX 2WNVA 2TBVA 3UL2A 4AK3A 1WMDA 3NJXA 2CL2A 3CLPA 4OMCA 1MR5A 1XYPA 3NKTA 3PTRB 3THTA 4BZ4A 4A45A 3DYMA 5BNPC 1N1SA 2Z5WA 3W59A 2RS52 2RDNA 1SZBA 4N7UA 3WR0A 4AFBA 5HCHA 1V0AA 3D4KA 5IVFA 1AR62 4QXBA 1UWWA 1D7PM 1TEIA 1Y9GA 4PHZA 5EQUA 2XLGA 3LB9A 1RVF1 1OQEA 4Q0QA 2I45A 4AHYA 5I0SA 1WA6X 4BMEA 1REEA 2V5DA 1MVEA 2K2SA 2W3JA 3MO4A 3OY8B 1IOAA 2EVXA 1KJRA 1RUF2 2D44A 1R093 3H0OA 3I4IA 3HNMA 4GJYA 1OHFA 3HOBA 3ELNA 4OQ9A 3WW1A 4MGZE 3K4DA 4XQDA 5FZIA 4Q27A 2R063 1C1LA 1ZZCA 1H8TC 3SCGA 2ETEA 4P9GA 1JYNA 5IK7A 1UY2A 1S0CA 3THDA 3H1MA 1LOGA 4EJRA 4O9GA 1B35A 3B69A 4CCKA 4LLOA 2BVVA 4LKFA 1K12A 1JBCA 1UMIA 2LS6A 2W87A 4XFIA 5EP9A 2BFUL 4YM1A 2W47A 5FLHA 1AXKA 4E27A 2PHXA 2VVEA 2BZDA 4JDOA 1JMUB 4GULA 4P14A 3DECA 3AP6A 1O5LA 3VBFA 3WSOA 2CV6A 1RJ7A 1ZZ8A 1DGRA 2GC0A 2GZWA 4YVWC 3BOPA 1ODMA 2HWC2 5FY7A 4A3XA 4JDMA 3N36A 2R49A 4E8DA 3HNYM 3WOGA 3RGBA 3IAQA 1J1LA 1HKDA 1ONAA 2XWJB 1LHVA 3A21A 2O8OA 4P9IA 3FJSA 2OKXA 5C33A 5C8CA 2B45X 4PI0A 2H0VA 4RFT0 4A7YA 2V5YA 2OZ6A 5C3PA 1WCUA 4CP9B 1SPPB 1ZX5A 2ARCA 2BV4A 3SH3A 5A3TA 3AP4A 4YGCA 3AM2A 1K5JA 4UBHA 4O65A 3NL1A 3SEEA 4HVOA 4YRDA 5CB7A 3CHXA 4XJWA 5CADA 2HWF1 3ILNA 4KWJA 4CEWB 2GP3A 2VQUA 1TVGA 1LULA 3POIA 2HWD2 4WM8C 4I02A 3WEZA 4OI0A 4XIKA 1CAUA 4BWOA 2EAAA 4RL7A 5JSRA 5HCBA 2AR6A 3C2UA 4XMAA 1US3A 1H2KA 2NM1A 2O0OA 2ZX2A 2ZX4A 1QJX1 2P17A 4ISRA 1HW5A 2DCZA 1D0GA 1OPOA 3O14A 4CTEA 3WHTA 3UV9A 3U10A 1ULGA 4E2QA 1W6PA 4Y22A 4AQ6A 1WLTA 2VMFA 1YJLA 1U5YA 1BHGA 1AJOA 3M3IA 2EXHA 4XEZA 3OGVA 2UWAA 4HK8A 1EY2A 2VNGA 1ZBA3 5EWSA 4Z2WA 1NA1A 5F5CA 5LEKA 1PGL1 3ZXKA 4MXWB 4ES8A 1ENXA 1LOFA 3WQ7A 4U36A 4NVPA 3MW2A 4XJAA 2WLQA 3V0AB 2J1AA 2HH9A 2VD7A 1W6MA 3K77A 3WDWA 1AYN3 4AQTA 1RMU2 3VBUB 3PUAA 4XFHA 2N7GA 4YGEA 5JZGC 2JDMA 4IV3C 5FY0A 3ZSKA 4BJ0A 2W5FA 2ARBA 2WDBA 1NXD1 2BQPA 2RR13 3ZYFA 4FBFA 2CAUA 4UFJA 3VDDB 2FQPA 3FHIB 4QGLA 2MEV2 4NIDA 3D5OA 5CFDC 1ASJ1 4ES9A 4M3CE 2HEYF 5KR7A 3FLPA 1W03A 1DLCA 4JQRA 1AYM3 1OF3A 4AI0A 1EV13 3ZPOA 2FCUA 1V00A 3HN3A 1LGCA 1CZVA 1RUH3 1JUHA 1PHMA 1KQRA 3LAGA 2GH2A 4Q4V1 2BGCA 4KL1A 1G8WA 3N9LA 2G4IA 4FPJA 5C8WA 1W9TA 5FPBA 3I2HA 2HLEA 1W0NA 1IG3A 4DFSA 4FQ4A 1QXJA 2X5IA 4I09A 4XXAA 4CEYC 2ZX0A 3VBSB 3SH4A 3MIGA 1QJY2 4HSLA 5GLTA 1QJU1 4GKXA 4QKFA 3KT7A 2Y0OA 4QU1A 2ZMNA 1CIWA 4NMIA 4JTOA 3AJYA 4LLFA 1LEDA 3MI8A 4LNVA 2TNFA 1V6KA 5DMYA 2VNOA 2FBEA 1GUIA 2XJQA 2XLFA 3JXSA 1G9CA 5FMOL 1XE0A 5FKBA 4AQSA 1V9U2 2IFRA 3OGGA 4QB6A 5LB6A 5ACA1 4CZSA 3AKRA 3K4AA 3AKQA 3C7EA 4JZRA 4IEVA 4N8MA 3T0AA 3V56A 5A70A 3VUOA 1QKQA 4LEJA 4NHKA 1DIWA 5DDJ1 1OC1A 1W6NA 2VNRA 1VRH1 4PLNA 4RA0A 3VN4A 2YGMA 4YFWA 2E63A 3SH5A 4EZ4A 1TME2 4XUOA 1O8PA 2Y33A 1OH3A 1DGLA 2BWCA 4CU7A 3KT1A 4KGGA 2XG3A 2ZGKA 3RZGA 1OT5A 5D2AA 4XFAA 1NUKA 2RJLA 1C5HA 5L9BA 1M06G 4MVTA 3NV2A 2JG9B 1AX0A 4MGQA 2DUQA 5H9SA 4FFFA 4ONUA 5L7OB 1LCLA 1WCQA 4P5YA 4AHWA 4FQZA 2DBIA 4P9XA 4CPBD 1DYPA 2CGNA 2LM3A 4M4RA 2QQOA 3MYXA 2JB4A 3TN92 2J7MA 4P9JA 4COVA 4QQLA 1W9WA 1ZREA 2OPWA 1GMMA 1XU1A 1VBB2 1NCRC 2E7AA 2UYAA 4ZU7A 2JXAA 2PN5A 2RS31 2YB7A 1O59A 1VB2A 3JU9A 4GB33 4UOJA 2V72A 4YGDA 4LBMA 1HN0A 1S1AA 1SMVA 2XDVA 2QKDA 1ND3B 2CTVA 4S2DA 3VBHC 3I3MA 2XVGA 5KXDA 1XNKA 3RZKA 3H3LA 4XAAA 1RUC3 3ACHA 4LBKA 2H6BA 5K7PA 1H6XA 2YU2A 1W8WA 3S0MA 4QX2A 4EWDA 2XJRA 1IS3A 1Y7BA 2VG9A 2DWRA 5A3WA 5K9YA 4CDXB 2BUKA 1UY1A 2A6XA 2LW8A 4XABA 5FUPA 5IFTA 5IVYA 3ZYRA 1W0OA 1Y43B 4IE5A 2WQ4A 3ZFEA 1XNTA 1LKNA 1UZYA 1NAEA 4MLOA 4XXPA 5EFUA 5JOYA 4IEZA 4LKEA 2VZ3A 4NROA 4XJ8A 1H30A 1DDLA 1Z7S2 1IQDC 2XHKA 1N1YA 4IE4A 1W9SA 5CAZA 1NG0A 2WFF2 4UF0A 3Q9OA 2QQIA 4ZU5A 4CXXA 3WF0A 4QX5A 2XMLA 1ENRA 4UFHA 4QX1A 1Q8VA 1W2UA 4Q0PA 4WM7C 5APAA 3NQHA 4XJ9A 4I30A 1JOJA 3UJOA 3HIFA 5FZCA 2B5HA 3RZZA 3GXUA 5LA0A 5J37A 5A32A 5HBAA 1VB4A 2OQ7A 1HLCA 2XBO1 3CMGA 1WUVA 1HXS2 2VR4A 3EB7A 4WVMA 1H2NA 5F6KA 4M3CF 2Y6HA 4QWNA 3OGRA 5CNAA 3U07A 5FWJA 2PLV3 3T09A 3IKWA 2V09A 1SLLA 2VZQA 3IB3A 4Q4X1 2Z2SB 4FFGA 2UWCA 2JENA 3I2OA 2EIDA 3OTFA 4QB2A 4OYUA 3DXTA 2VC9A 3N9NA 4QDSA 2A70A 4KH9A 3ACGA 4RR3A 3FMGA 1VBE2 3H7JA 1ZA4A 3PUIA 5FBJA 3SC7X 4XQ4A 3FC0A 4Q4W3 4HN1A 1OUXA 1LESA 1VAMA 2A5ZA 2BP6A 2C6SA 3HD8B 4N53C 2WWJA 4XFGA 5FP8A 2WZR2 4DIQA 3H8RA 2ET7A 3C8XA 1HRI2 2D97A 4UYBA 1AR61 4BLJA 3NAPA 1IKQA 1RUI2 5I0TA 2X05A 5CBLA 1R1A2 5LATA 1X82A 1JYXA 1JS9A 3AP7A 1IS4A 2ZCWA 4FPHA 3QACA 1UZZA 2HWB2 2ZX1A 4MGIE 1WW7A 2VZUA 4B4RA 3AZZA 3AB0A 1RUD1 3BIWE 2WNUC 3RI9A 4URAA 2QQMA 1LR5A 2ES3A 2UWBA 4QKBA 1W2NA 4MH0E 5A7WB 1QOOA 3AC0A 5T54A 1W6QB 3J8F1 1JZ4A 1XBFA 4AVAA 1LHNA 2YFZA 2J1VA 4LO7A 5JXHA 1ZBE3 4ASKA 3SNMA 1W6OB 2O8QA 1C8M2 1UYZA 2PYTA 1AXYA 1MS5A 3ILFA 4WVZA 2VJXA 1K42A 4RS5A 2JDPA 2VUAA 4XACA 2A7AA 3GHNA 1FPN3 3VKNA 1DQ1A 4UFKA 3GZUC 2OIIA 3JB4C 2J1EA 2LUWA 4PQQA 4TLGA 1KDMA 3LPFA 1IS5A 4GH4B 1YQ2A 2R1DA 3K3NA 3V64A 4CCOA 4FXKB 4Q1RA 4XURA 2R0HA 2XKOA 3O1SA 5FYCA 3WVJA 3D3AA 1UU6A 3VD4A 2W1QA 5JOXA 1SDWA 3R05A 2ZGRA 3FLRA 4H14A 4CDQA 2HWC1 5LEJA 4JV4A 4O61A 4RN5A 5FZHA 5ABJA 4FSJA 5G05L 1PNGA 2VBPA 2DFCA 2AZ5A 4XDQA 2YXSA 1ENSA 3ZXEA 5IT6A 2D5HA 2IVIB 1A3KA 4R9BA 4D3WA 1G9AA 1EUUA 1F4AA 2F4PA 3SXWA 1RUE3 1FOD2 1S0BA 4P9YA 4XC9A 3VHOA 1FV2A 2IWGB 4PBOA 3UKVA 2CDOA 3VZNA 1UMHA 2FMDA 1IS6A 1H2MA 2JG8A 3LEIA 5BNQA 1I5ZA 2DBNA 4RFRB 3NV3A 1R091 4JHZA 4QPGB 3HEIA 5FBZA 5SV5A 3VBOB 4AAPA 3FHQA 3POJA 1VLNA 4NOTA 5JVVA 1CVNA 1S0GA 3ENRA 3K51A 5ANQA 4COZA 2Y6KA 2JE7A 4W6WA 4LMFA 4E9KA 1UX6A 1MACA 3NW4A 4JGZA 1CJDA 2OXBA 2R073 4EN0A 5JOWA 2VOKA 4JGYA 3JBG1 1SLTA 4PIXA 2B9VA 3IWZA 3N9OA 4YWAA 5FZOB 3SHRA 1PO13 2YUEA 1ULCA 3RZJA 1W8NA 5DAWA 3UKNA 3LIGA 1OH4A 1W8FA 3O0VA 1SEFA 3VDBA 1SBFA 3TRSB 5L9VA 4JQTA 3BYWA 5FXXA 3LA7A 5CFCC 5EV7A 2OYZA 1PIV3 4CEWC 3SLIA 5HPOA 1TG7A 1T2XA 1PGW1 3QOPA 3HQXA 3Q8AA 4GXLA 3MIHA 5JMCA 1K3IA 3OBAA 4M3CA 4CU9A 5C3SA 4H55A 2Y60A 1L3JA 3OB8A 2PHLA 5AVAA 2VBBA 1SLIA 1OLMA 2P1BA 5C70A 2VZVA 3GGLA 2Z79A 4CRQA 3NNMA 3I59B 3ZVXA 2VOTA 3A4UA 1AL23 4YSFA 1QXRA 4O7XA 2YV8A 1XSRA 4B4QA 2MEV1 3NJVA 1OQ1A 4RYDA 2WNVB 2XJPA 5FY4A 3RWKX 1PGL2 4UI9L 3MIEA 3WF2A 2XB6C 1KDKA 2BOIA 1FATA 3KQ4B 4AI9A 2WFPA 3CJXA 4MADA 2Q8OA 4BQ4A 4Y24A 2QDNA 5K0UA 3QH7A 5LA9A 1WD3A 3VBUC 5FYTA 4DOUA 1BCXA 1I6XA 2RMU2 3FE5A 4OUSA 1MZ5A 1UXZA 5FQ0A 1MEC2 4R52A 3LZZA 2VCBA 1POV0 2GAUA 1JODA 2P2KA 5EHDA 1DQ5A 2VMCA 2EXKA 3VDDC 3DL3A 3GCWA 3A7QA 3OJBA 4BB3A 2KD7A 2UYBA 2ADDA 1JZ7A 1TZOA 2F17A 5C71A 1JZ8A 1UMZA 2JKXA 1F5FA 5FK7A 2Q5TA 2E53A 3CIHA 4PDWA 4FFHA 3CBNA 1CIYA 4AVCA 4F8AA 2GMPA 2ZGUA 4HMZA 4PI2A 4Q4V2 2E51A 2JWPA 5HXMA 1B35B 4X6RB 5KXEA 3URFA 1OUSA 3EXUA 4UXAA 3PJQA 5GZFA 2E31A 5J09A 2WSVA 3ZN4A 1I1EA 5K4LA 1I9RA 2ZHMA 5FAXA 1O3TA 1QDOA 1QJU2 3F2ZA 4ZS2A 4TSVA 3VBSC 4AEKA 1POQA 4PIYA 1KEXA 2CY6A 3T30A 4CCMA 4LUMA 3VBFB 1S0IA 3ZDVA 2OT7A 4HPKA 4XFBA 2W2IA 1GWMA 5FYMA 2VU9A 5IJRA 3KF5A 2XL9A 3B01A 4MHRA 5FOJB 2P37A 2D3RA 3AYDA 4ZU4A 2ADEA 2Z4FA 2ZMLA 2XHNA 1O3RA 5FIXA 2B7YA 1W04A 1AR83 3TYJA 4AGVA 1EV11 5BNNA 5C8CB 2PELA 2CWMA 5DDJ2 5CEHA 5IFPA 2IXLA 3B7MA 5FZEA 3RMYA 5A1FA 2YROA 2VOVA 3O5SA 2VZRA 2J42A 1W0PA 5FP4A 4NAOA 3OUHA 2VAUA 4K7JA 1MZFA 1HJGA 3N9MA 5FYZA 3SCFA 5BNOC 3TN91 2LALA 1AF9A 4NHXA 2ZGOA 2Y0IA 3WP5A 1WBLA 2MNGA 2WSUA 4UFLA 5FKCA 1AR73 1UO9A 4K20A 3UGFA 2ZKLA 2ZEXA 3GNEA 2NN8A 5LW9A 3EJKA 1CAUB 1QQP3 4LK6A 4OI1A 4N43A 4CCJA 4RQPC 5D1IA 4B1LA 4OHZA 1H8TA 3ST7A 2EXIA 5L7OC 1NZIA 2IZWA 1RXGA 3BCWA 4XETA 1YFUA 2XVKA 4BPZA 5FY5A 1OSGA 3J7NA 1LOEA 4FT8A 4XBLA 3VGIA 2Y26A 3DKQA 2WS93 1H1IA 5F9TA 2ZZJA 1JHJA 3KGZA 1W6PB 4Y22B 2XQXA 3U0ZA 2RS32 3W9AA 4Y1ZA 1OXCA 2QVSB 1BMV2 4MUVA 1POV3 5H9PA 3CKHA 3ETPA 2CNAA 4QHBA 1NA1B 1ND3C 4ZKTB 2VOXA 4YVWA 4QM8A 3I49A 1MVQA 1W6MB 2A73B 4H2AA 4LT5A 2E32A 4FPCA 3GYDA 4FP3A 1UPIA 3DYPA 4MO3M 2CSGA 1W9FA 4LJHA 3WUCA 4CSWA 2VBDA 5CVRA 4CDXC 1GICA 1VMJA 5T52A 1QIQA 1E57A 1PZ8A 3I3BA 3TB0A 3SKVA 3HBZA 2OS2A 5C3QA 2ZBJA 3LEKA 2A3XA 4DUXA 1W3XA 4CCCA 3LWCA 1HXS1 1U5IA 1YFYA 3J4UH 3THPA 1IG0A 3O12A 4HLTA 5B4XA 4BK4A 3DPRA 3I2FA 4AWDA 1LHOA 5GLUA 1R082 4JDNA 4HVQA 5IHRA 5DAQA 3IIIA 5A33A 1DHKB 1DYOA 4DXZA 3MFAA 4YW7A 5FWEA 1DG6A 1IGOA 2DCYA 2RS53 3P3NA 2WKKA 3AXDA 4V1PA 1OVSA 1ULPA 4CP0A 3B94A 1VBE1 1C4RA 5BYNA 5A3PA 5SV8A 2XBO2 3F95A 2X5IB 3T1MA 4AI1A 4B7KA 3ZXJA 4BXSV 2WZR1 5EJZB 1BKZA 2X8KA 1Q8OA 3PTYA 1HRI1 3K48A 1QDCA 2VZOA 4Q4X2 2FCVA 2PAEA 4FXGB 4NE9A 2UU8A 3H50A 1NKGA 4Y5Z0 1R1A1 3IM0A 3I3DA 1J83A 3AX4A 3WF1A 3LGRA 3ZMNA 3ZXGA 1HB4A 4COUA 2Q30A 5AVPA 3TEWA 4KU7A 4NIHA 5JXGA 3H9AA 2HWB1 3C7HA 3RG0A 3OYWA 2FMYA 4DO0A 3KV4A 1SBEA 3C7OA 3OPTA 1A78A 4D7TA 1YQ5A 1DQ4A 3U37A 4ATFA 2C0ZA 4K1YA 1W6NB 4YG3A 1QJEA 3O7OA 2W94A 3CL1A 5FYUA 3PVOA 1V6OA 5FPZA 5DZFA 5JZGA 4XUNA 1JOPA 1C8M1 1VPHA 1ZNPA 1MS0A 2AGSA 3OEAA 3GZAA 4LBNA 1CJPA 4K3UA 2E33A 4JAAA 5DG2A 3VBRC 5T50A 3ASIA 3ZFFA 5EIYB 4YZ2A 3FUOA 3M1HA 2FDKA 1NYWA 1X50A 1OPMA 1DGWA 4QT6A 3AVSA 1BLZA 5T55A 1WKYA 3IIAA 1TQ5A 5FJHA 1RUD2 4W4ZA 4UWDA 4IUGA 4FPOB 3WDXA 1RXFA 3WNPA 1W9YA 3N35A 4DY3A 4GAZA 3J8F2 5A6ZA 2WC2A 4FTEA 1C1FA 5A3OA 4LORA 1ZRRA 1O4YA 3VHPA 4Q4Y3 1VR3A 5A6QA 5CA6A 3CZJA 2GP5A 4CP1A 5F2SA 3IDBB 1FMD3 3HJRA 4TTGA 1CPMA 4A42A 3WX5A 2WAOA 1VBD3 4IESA 4YW6A 3KB5A 2QJVA 3EMRA 4UT5A 4XTMA 4CEYA 4Y20A 5T5JA 2WZPP 2ILMA 1KXGA 4M01A 4YFZA 1FOD1 4RGKA 1E5SA 2BGOA 5GLZA 3PVNA 3T0DA 4GH4C 2VZ1A 4OI4A 5ERLA 1SQ4A 4IQPA 1OQDA 1WWYA 1GOFA 3D6EA 4NIAA 4S2FA 1WCSA 1HRV3 2HWD3 1Q8PA 3IBMA 5JSPA 3O1MA 5A7OA 5FREA 1KRIA 1U5XA 1YLLA 5C4WB 4AE2A 2YHJA 4CDWA 4ET7A 3IMNA 2YBSA 4J6GA 4EZHA 1MQTB 4R8HA 4ZONA 5LY2A 3ZIWA 1UY4A 4W8JA 2BGPA 2MHFA 3ZFEB 1A8MA 1XYOA 3JB8A 1HV0A 1T6GC 4OMDA 1VJ2A 2YPDA 4KI5M 3UETA 3PMSA 2ZHKA 4MHUA 1V6JA 3AXEA 3C7FA 1S2KA 2VMEA 4S2HA 4BH9A 4UF0B 2IXHA 3VZKA 2QNKA 2QZ2A 4LR4A 4IERA 4DXRA 2BFUS 5A3LA 3GDBA 2QDRA 3TEYA 4FPEA 1LJ7A 1R092 2JDKA 2BPA2 1PO23 2VGDA 3M3QA 1XXNA 3AKPA 1RMU3 2RS13 4MGKE 2Y6LA 4XF3A 4CCNA 4QPGC 4D69A 3OOXA 3POBA 3R4SA 5GLVA 4DRVA 5BV6A 1RUJ3 2DU0A 4KBBA 2R062 5J1XA 4NR1A 4WVMB 3JBG2 1JTZX 4W65A 4RHV3 1H2LA 3KHBA 1EPZA 3B5LB 1RB8G 5IVVA 4LOTA 2GNMA 4GWJA 2IXIA 3H8XA 3IDAA 3VBHA 3GZTB 1GQPA 3C3VA 1CX4A 4KNCA 1W2OA 2RDSA 4RR3B 1UPSA 1QH7A 5BPXA 4EN6B 1UOJA 4DRRA 1D4M3 1RGSA 3NNFA 5FZ6A 2D43A 4R9AA 3ZSMA 4YARA 1PGW2 3ABZA 1NCQC 3RNSA 5F37A 5I8SA 4ZXEA 1NY71 1MPXA 5LK7B 2DUPA 2RDQA 3NAPB 3WNXA 1F35A 2WO2A 4F3JA 2QTWB 4LBOA 1PZ7A 1QJY3 4Q8KA 3POYA 4CUGA 2RMU1 4AVBA 1CZTA 1MEC1 2XQRA 1H0BA 1TMF3 3MEPA 3KVBA 2VUJA 3LDKA 4QB1A 1CD3G 2YGLA 3LEGA 3N3HA 1O6UA 2VQ0A 4H7MA 4XDOA 4O9EA 5CYYA 3VV1A 2WNVC 1LENA 3D82A 1WGPA 1PMIA 1SHWB 4CXWA 5HCAA 1JU4A 1CESA 2AUYA 5FFOC 3LD8A 1PVC3 4C0HA 1PIV1 2F4LA 2DVBA 1ZVFA 2ZX3A 3BU7A 4YW3A 2RM23 4RS5B 5FZ7A 4I0AA 1GANA 1GNHA 1TME3 4AVSA 3LOIA 2J1TA 3KQRA 4COWA 3AZVA 4I0BA 1DGRN 1YCIA 2AH2A 3BPSA 5GKAC 2WZ8A 5IVEA 3POFA 4A4AA 2LTNA 3TOJA 4XQWA 4QPIA 4A44A 5JR2A 1HQWA 4AFCA 3IN9A 4XYXA 4P08A 2DTWA 4AVVA 3VD7A 4FPGA 2VVFA 2WYSA 4CDQB 4MGYE 2QCSB 4AL9A 4X6QB 5J36A 5DABA 4WZFA 3EHKA 4KWLA 4DB5A 3W5NA 2Q8CA 4XHXA 4D6RA 4ORFA 1SLBA 1NLSA 3JD73 4LO6B 4NHMA 1AYN2 2WAAA 1VBB3 2PHWA 3IZOA 3I3QA 5AFBA 2PA7A 1YC61 1VBA1 2W52A 2J22A 2GU9A 2YDEA 3CEWA 3EO6A 3OD0A 2K46A 3ZOIA 4XF0A 1PK6A 3WW2A 2RR12 3LFMA 5T5OA 4OUEA 3VBFC 2JG8B 3GALA 3S5AA 1W8UA 2FZ1A 4KGQA 3IDEA 1YJKA 3QBQA 2WNUA 4HOOA 2VO5A 4Y1YA 2DF7A 5A1AA 2XJVA 2VMHA 3NWKA 4Y1VA 1KGYA 4J25A 4KWUA 4FPLA 2XLAA 1EV12 1VIWB 1RUG3 5A6YA 3IPVA 1UZWA 4IE6A 4JGZB 5FMOS 2IXCA 1QOSA 2ZA9A 4M4PA 5C8CC 2Y38A 1RUH2 2A3YA 2OUJA 4JGYB 2C9AA 3ACLA 3ETQA 1Z7S3 3WV6A 2RHPA 1PZ9A 4U2AA 2EIBA 1NE6A 1LOAA 3BTXA 3NSTA 4JKMA 5JLVA 3CNAA 3VLBB 1OOPA 4KU8A 4L11A 5LZ6A 3NKGA 5EYYA 3E5QA 3MIDA 4A6SA 3ZO0B 2DDUA 5A3MA 3FBMA 3H8OA 4N9IA 1BMV1 5FR3A 4XE9A 4KG0A 5LY1A 4HKOA 3MBWA 1GZWA 4RGAA 2QQWA 4M0HA 3MLLA 1G86A 4M3CB 4GWIA 1JUIA 3LFIA 3ORJA 2WR9A 4OUMA 4OLLA 4WVWA 1EAH3 4YVSA 5FMBA 3RJ2X 2BEOA 2NQYA 4HKLA 1CAVA 3KHCA 1KS5A 5J98B 1OFNA 3H1YA 4BIFA 2A71A 3AVRA 2ZGMA 2D40A 1O3SA 1S2EA 5FUNA 2C26A 3ZXAC 1CAWA 1OURA 1WMXA 4HETA 2ZGPA 4P00B 1JYVA 2PHRA 5BXXA 1RYYA 3OBZA 1COV1 2YFUA 1R081 2BVBA 3LA3A 4YW4A 4CCDA 2W1UA 2PAKA 4LKSA 5FPAA 4GA9A 5FZGA 2Y6FA 5D8AC 2QFEA 1BEV3 2NMNA 3ZFGA 2ZEYA 3KV6A 2X29A 3MW4A 3HNBM 4NWVA 5EJ3A 3WHUA 4NRPA 5K0UB 2CGPA 1WW6A 1C57A 1RUI3 1AR91 5FQ0B 3FWEA 1GWLA 3MLJA 5GLWA 2Z42A 2B8MA 5L36A 3H3UA 5TSWA 4D6SA 2WS91 3B00A 5IAVA 4CUCA 1WMEA 2AACA 4XUTA 1TNRA 4GB32 5LWBA 3AMQA 2NYYA 4PDWB 1XJAA 1YXWA 5T5LA 1POV1 4LE4A 4BQ2A 5CFCA 4CEWA 1BBT3 2XJTA 2P3IA 4EV0A 1NXMA 3UESA 3BODA 4QX0A 1J3PA 1NX9A 1J59A 1RVF3 2A75A 1XPWA 5FUIA 3SKJE 3W5MA 4GKYA 2A1XA 3LDBA 4AEJA 1UZVA 1D4VB 1QHDA 2VZSA 2QBXA 4PLMA 1YUDA 2X5IC 1CZSA 4AEDA 5FZBA 4QX7A 4LPLA 4L9BA 4GMP1 3VKMA 2R30A 3Q8EA 3N7KA 4A7ZA 4EN7B 3HN1A 1BZWA 5KHGA 2GC1A 4BDVB 3J7LA 4HPKB 5LCWL 2HEWF 2WWSA 3JQXA 1O5UA 4ITCA 1ND2C 2R16A 3M4FA 2MPFA 3O0XA 2DCTA 3K3OA 5DPNA 2WINB 4DUWA 1UAIA 3VHNA 5BNNB 1JI6A 3TBDA 1V6LA 1ZZBA 1X36A 5B4NA 4BQYA 4MGTA 4GALA 3CJIA 2WNOA 3AMMA 4META 1SLCA 5GM0A 4IGQA 1F31A 4FOVA 2BERA 1U12A 5HV0A 4YGBA 2OQ6A 4BQWA 4LO5B 3WINE 3BOWA 1NZCA 3KGLA 3MFCA 3R4UA 3E6CC 2VCCA 3RZHA 2GC3A 2PLV2 3ZSEA 2ZABA 5DN2A 2VH9A 2OUHA 5IVJA 1KS4A 2OA2A 4XMIA 3H7YA 4F7ZA 1UIJA 2VTXA 5FRAA 2KXLA 4Z2AA 4YG0A 4N43B 4AI2A 3GHMA 1H8TB 3C7GA 2ZXQA 2W46A 1UQXA 2VULA 2JIGA 3KD4A 4NRMA 2ATFA 1BQPA 2DVFA 2CHHA 3AZWA 3PL0A 2W0XA 5KC6A 4Q4W2 1N3OA 5IK4A 2GC2A 3POSA 4EE2A 3LOBA 2EAKA 2WT2A 3DN7A 1QMJA 2R0FA 1YFXA 2HWE3 1ZYBA 2HWF3 1UYPA 3M70A 3WF4A 5DZGA 4A3ZA 4LBJA 5T3NA 4FPFA 1LGBA 3NVCA 3VL8A 4IEPA 1AXZA 2NP0A 4CE8A 4YVWB 1LODA 3MPBA 4IE0A 1L7RA 1BK1A 4OHVA 4EN8B 5EPAA 3PVEA 1E5RA 3KLSA 4OHXA 4A41A 4BXFA 5C4WC 1QJX3 3PU8A 1MQTC 1CAXA 1SFYA 2VQTA 4LK7A 5IYYA 3MIFA 3T2PA 3UKTA 2VTXJ 3VZOA 4JVAA 2YC2A 3ZN6A 2R061 4Q4Y1 3E5UA 1K5MA 2GNBA 1Y9MA 1UN1A 1K45A 1VBC3 3PU3A 5IW0A 4GIQA 1FMD1 1Y9QA 3DPRB 3WP4A 5BNOA 1FYUA 3EQEA 2JE8A 1GFF2 3AL6A 3HPNA 2G9ZA 1OA3A 4LE3A 3U4XA 2ZEWA 3K2OA 5A33B 3HR9A 1DP0A 2E9QA 5A3UA 2R043 3DUIA 4Q29A 2Y6GA 5LK5A 4AYUA 2Z69A 3UNPA 3E6BA 3FX3A 5IVCA 4FI9A 3WZ1A 3DEMA 1HRV1 1QU0A 4HL0A 4RQPA 4E8CA 2YC4A 2DVDA 2VMDA 2NLRA 4V2VA 4TLFA 3X29B 3ZN5A 3ZX7A 1LRHA 2PHTA 3T3YA 2E6VA 5E6HA 2J1SA 4BMBA 3ALQA 2IC1A 5FYSA 3WD5A 4OQ8A 2R7EB 4ASMB 1ASJ3 4BQXA 2VTFA 3AZYA 4Z1VA 5FOBB 1BXHA 2J1UA 1JH5A 4N90A 3E6DA 1MS9A 4C91A 3I2IA 1GZ9A 1F9KA 3T4HB 1RUE2 3OCPA 3BTZA 1JYTA 5DG1A 3OYWB 2DYCA 3RYKA 1L7QA 4NHLA 3B3QE 4CDUA 4DXTA 5FMDA 4HT1T 1GZTA 3I7DA 4RR3C 3PJYA 4IV1A 3L9JT 1AHSA 3M2MA 5FK8A 3VKFC 1EYBA 2VVDA 2UY9A 3UT0A 2A6YA 4Y1XA 1UF2C 2HEVF 1NY72 2VPVA 1PO21 1SLAA 1XB9A 1H4GA 1QEXA 5JZGB 4GWNA 1XE8A 3ZXLA 4XJUA 1PX4A 2ZGLA 5F5QA 3ZFFB 3MV11 4H7LA 4R4ZA 3NAPC 3KT4A 3BUCA 5JWPA 2R072 3ME2A 2QUOA 1VAKA 4DPNA 5EJ1B 2VMIA 4AFDA 4B7EA 1PO12 1UCXA 1QWRA 4RGGA 5FY8A 1TE1B 2Q8DA 2JECA 4L0PA 3E97A 4XPVA 1VMHA 5FO9B 2ZHNA 5ACA3 2D3SA 3DCQA 1DYKA 1S0JA 3ACFA 3FFZA 4UW3A 4YW5A 5JXIA 4Y33A 5BUVA 2B42B 3BKZA 1VRH3 4YZ4A 4L2NA 1V6MA 1YQ6A 1ZM1A 1PIV2 5FO7B 1IPJA 2OPKA 1OKOA 2QQJA 4INDA 4IXLA 4MX3A 4YLZA 4AR2A 1D4M1 1ZBA1 5FCCA 4AF9A 1WLWA 1VE0A 5I0RA 5FYVA 3CU7A 5E1RA 4CU6A 3INAA 4L92A 4Y20B 2B39A 4LO8A 2ZS6B 1KITA 1AYN1 1YO8A 1G9BA 5FJKA 2XR4A 1V6NA 3ZKUA 3G7DA 1HV1A 5KBFA 3CF6E 1GKBA 2BJSA 1MS1A 5FYYA 3RQ0A 3W58A 4JTNA 4FAGA 2RR11 4IGPA 4HSJA 4NPMA 5C9AA 2RVAA 2WBKA 1UKRA 4LHKA 1AL22 4BE3A 4CDWB 2TUNA 4ZPIA 1E5HA 2Q8EA 4XAEA 5FZ1A 4ARYA 2ZACA 4IL7A 4EQVA 5JPNB 4Z92B 3K4ZA 1ZRCA 3KMHA 4CDQC 1O4TA 3GBWA 1AYM1 5FZ4A 1KFUL 3GCXA 5BNPA 1KD7A 2BNNA 4ZS3A 2WL1A 4GZ9A 4Q26A 1DQ6A 4K40A 1RUH1 1J58A 1PVC1 3FZ3A 1VBA2 4K6BA 4LO4B 1BJQA 2P4EA 4NIIA 3VBRA 3ZR6A 5AC93 1Y3TA 2RM21 3PURA 4M00A 4XBNA 2W1WA 1LOCA 4AVTA 1QH6A 4NRQA 4MZUA 4LHSA 4LIUA 1NE4A 2GMEA 1SFNA 3KS7A 1D2SA 2VXRA 2WYFA 3D8CA 4HONA 4MYEA 4TYSA 4QQHA 3ZYHA 1MS4A 4PJYA 2DCJA 2R6QA 2JG8C 3TNPB 1LTEA 3WG1A 2CYFA 2YU1A 4UW5A 4NIGA 1GQHA 3LF7A 4QQOA 4Z07A 1RHI3 3ZKYA 5HXVA 2JG9C 5G04L 5LBBA 1T6BX 4JGZC 3VD3A 3LSEA 1JW6A 5I8YA 4GJZA 1YI7A 4JGYC 3Q8CA 4HG6B 5CKMA 3U1XA 4MV2A 5L19A 3SITA 1ZZ7A 2XKPA 1UY0A 5DZEA 5FPXA 4FTSA 3IAPA 3I54A 2O1QA 5F3EA 1VRBA 3RYPA 4BK5A 1JZ3A 3I2KA 2D6NA 2GNDA 3ROUA 3BU0A 1CQ9A 3RMXA 1S55A 3AJZA 3AYCA 4I0WB 4D6QA 2SLIA 2D6MA 4YM0A 2P6HA 4LHLA 5I0DA 4JC1A 3EYPA 2VW2A 4QX3A 4Y26A 2XBO3 5KHHA 4X8NA 5EZWA 1UD1A 3PLQA 3U75A 4UW6A 1AR82 3OEBA 4XFFA 4CU8A 2FDHA 4EWAA 4DY5A 2JJ6A 2Y8KA 4I3GA 4ZZ8A 2FZ2A 2C5DA 3L2YA 4CP2A 5CISA 4FTBA 3KV9A 3PUHA 5L9RA 3M8LA 3FN9A 4CCLA 4JX0A 2G9FA 1COV2 4QDQA 3FL7A 2FDJA 5ISLA 5JXJA 4XFCA 4XOGA 3ZSLA 4H3WA 2C24A
chains in the Genus database with same CATH topology
4MHRA 2FCUA 3NNFA 4NHYA 2V4AA 2JIGA 3ITQA 3PL0A 2RDQA 4Q5OA 4NAOA 3OUHA 5LASA 3GJBA 5EP9A 5DAWA 4NHXA 3KT7A 4Y5TA 5C5UA 2FCTA 4NMIA 3OBZA 5L9VA 4UWDA 3NNLA 5DAVA 4ZPIA 3OUJA 5EPAA 3BVCA 3GZEA 3HQRA 5LB6A 4JZRA 2RG4A 4NHKA 3DKQA 5DAPA 2HBTA 3EMRA 2G19A 2Y34A 5M0TA 5LATA 5IAXA 5IAVA 5HV4A 2Y33A 3NNMA 5IATA 3KT1A 2RDRA 5ERLA 5A3UA 5L9BA 4XCAA 4ZONA 5DAXA 5LBBA 5LA9A 2JIJA 2A1XA 4NHMA 4XACA 4BQXA 2OPWA 4MHUA 3OUIA 2G1MA 3HQUA 2HBUA 5LBCA 5C5TA 5LBEA 4NHLA 3W21A 5DAQA 4XAAA 4J25A 4XCBA 4Y5SA 2RDNA 4BQYA 5LBFA 4XABA 3MGUA 3KT4A 5EQUA 4KBZA 5HV0A 4IW3A 4BQWA 2FCVA 5L9RA 3NNJA 4XC9A 3GJAA 2RDSA 3W20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHR A;  2FCU A;  3NNF A;  4NHY A;  2V4A A;  2JIG A;  3ITQ A;  3PL0 A;  2RDQ A;  4Q5O A;  4NAO A;  3OUH A;  5LAS A;  3GJB A;  5EP9 A;  5DAW A;  4NHX A;  3KT7 A;  4Y5T A;  5C5U A;  2FCT A;  4NMI A;  3OBZ A;  5L9V A;  4UWD A;  3NNL A;  5DAV A;  4ZPI A;  3OUJ A;  5EPA A;  3BVC A;  3GZE A;  3HQR A;  5LB6 A;  4JZR A;  2RG4 A;  4NHK A;  3DKQ A;  5DAP A;  2HBT A;  3EMR A;  2G19 A;  2Y34 A;  5M0T A;  5LAT A;  5IAX A;  5IAV A;  5HV4 A;  2Y33 A;  3NNM A;  5IAT A;  3KT1 A;  2RDR A;  5ERL A;  5A3U A;  5L9B A;  4XCA A;  4ZON A;  5DAX A;  5LBB A;  5LA9 A;  2JIJ A;  2A1X A;  4NHM A;  4XAC A;  4BQX A;  2OPW A;  4MHU A;  3OUI A;  2G1M A;  3HQU A;  2HBU A;  5LBC A;  5C5T A;  5LBE A;  4NHL A;  3W21 A;  5DAQ A;  4XAA A;  4J25 A;  4XCB A;  4Y5S A;  2RDN A;  4BQY A;  5LBF A;  4XAB A;  3MGU A;  3KT4 A;  5EQU A;  4KBZ A;  5HV0 A;  4IW3 A;  4BQW A;  2FCV A;  5L9R A;  3NNJ A;  4XC9 A;  3GJA A;  2RDS A;  3W20 A; 
#chains in the Genus database with same CATH topology
 2VM9 A;  4GB3 1;  5J7M A;  4LOS A;  4K1Z A;  3WW4 A;  1VAV A;  1UYY A;  1UOG A;  4NHY A;  3KSC A;  5F2W A;  4QPG A;  3WF3 A;  3OBT A;  4WM8 A;  3PHM A;  1OBN A;  1AR6 3;  1HIX A;  1QQP 2;  1AR9 2;  1RUC 1;  4RSU A;  3E1F 1;  4G3Y C;  1RIT A;  4Y4Y A;  3ZYJ B;  1GQG A;  5FXV A;  2W08 A;  4B1M A;  4B4P A;  2Q1Z B;  1O3Q A;  2PAM A;  4RD7 A;  3OGS A;  4Z8B A;  2XGX A;  3OPW A;  5FP7 A;  3M7A A;  2WII B;  1PVX A;  2W68 A;  2WS9 2;  3MIB A;  3TEZ A;  1EAH 1;  4DIN B;  1W8Z A;  2ERF A;  4L97 A;  3JUU A;  1RUF 3;  4V2W A;  3DGT A;  3M3C A;  3GF6 A;  2VMG A;  4QPI B;  1W3V A;  2YMZ A;  4NO4 A;  3ILR A;  3J8F 3;  5FP9 A;  3VDA A;  5J48 A;  4IEU A;  1GV9 A;  4COY A;  1YRZ A;  1ZRI A;  4OZX A;  4OFG A;  5FYI A;  3USU A;  3BVC A;  3WUD A;  3WW3 A;  3H42 B;  3HQR A;  4LXL A;  5F5A A;  4OHY A;  1NCQ A;  2D93 A;  4QU2 A;  3ZYI B;  2RG4 A;  5DUU A;  3VZM A;  1NLQ A;  4LHN A;  5FTT C;  5CKN A;  2AEN A;  2P3Y A;  2WLP A;  3BAL A;  1CON A;  4IV3 A;  4XUQ A;  2DTY A;  5FZK A;  4P02 B;  4PLO A;  4R9C A;  4X8P A;  3RZL A;  3J26 N;  1PK6 B;  2P3J A;  4QPY A;  2AYH A;  3POG A;  1WLD A;  2JDA A;  2EAL A;  2JDU A;  3LKJ A;  4K8F A;  5IAX A;  3T2T A;  2NMO A;  3THC A;  4DZG A;  2WNU B;  5CFD A;  4WZC A;  3MV0 1;  2PLV 1;  3WG3 A;  3A0N A;  3VZJ A;  1Q3E A;  1ZRD A;  2HWC 3;  5GZG A;  3CZU A;  1FT9 A;  3IPV B;  5F39 A;  4XCA A;  2C1F A;  2ZOE B;  1JYC A;  1ODN A;  1LEC A;  5BNN C;  2WQ8 A;  1IZ3 A;  4HBN A;  3O1U A;  2LRP A;  3S6P A;  2SBA A;  1BBT 1;  4YG6 A;  1W8O A;  5C6C A;  3WQ1 A;  1LB2 A;  3FBY A;  1G9F A;  5CU1 A;  1NOV A;  2WQZ C;  3IT8 A;  1H1M A;  4NWW A;  3E5X A;  2C9K A;  3H8U A;  3PUQ A;  1VAL A;  4Q4W 1;  1OOP B;  4K8R B;  5FP3 A;  3RRD A;  3WDY A;  1RUN A;  2Q1F A;  2ZZQ A;  4IET A;  1YQC A;  3KV5 A;  3LPG A;  2IXJ A;  2JX9 A;  2ZPX A;  3ON7 A;  1JN2 P;  5LRS A;  5LBC A;  5FZL A;  3QD6 A;  4LIV A;  2IUW A;  1UYX A;  4BU2 A;  5FLJ A;  1AX1 A;  5F32 A;  3DYO A;  2QQV A;  2HKX A;  2Y64 A;  5FZF A;  1GZW B;  4YW2 A;  4QKN A;  2BRT A;  3TNQ A;  2FDG A;  4N43 C;  3ECQ A;  1H9P A;  3JBG 3;  1IHM A;  1STM A;  4QM9 A;  5KHJ A;  3ZMO A;  5JCT A;  4YVS B;  4YW1 A;  4LBQ A;  1DCS A;  1CAV B;  4B3N A;  1LAJ A;  4G9S B;  2D5F A;  1OMI A;  1HDK A;  2GN3 A;  4Y3O A;  4JKL A;  1DFQ A;  4W6Y A;  1JXN A;  1ZBE 1;  3S7I A;  5FO8 B;  5FZ3 A;  1CAW B;  4XF9 A;  3SEP A;  3ES4 A;  3AKS A;  5FZM A;  4ISQ A;  1FPN 1;  2EXJ A;  3MIC A;  2EIE A;  3WNK A;  5KC5 A;  1O7F A;  2H0B A;  4IDZ A;  4UAP A;  3K46 A;  4Q0U A;  1H8V A;  3ZFG B;  5E88 A;  3TWI A;  3LIH A;  1YNA A;  1VP6 A;  2BNO A;  1AUY A;  5IWF A;  2XWB B;  2PTM A;  2ZGT A;  1UU4 A;  3AFK A;  3R6S A;  3U11 A;  5CG8 A;  3VBO C;  3R4D B;  1US2 A;  2UY8 A;  3IMM A;  5A32 B;  3RJR A;  3USS A;  1URX A;  3OD4 A;  2X53 S;  2ENR A;  4I01 A;  4Q4Y 2;  4Q5O A;  5GJ6 A;  3HVD A;  1EPW A;  5KHK A;  1FMD 2;  3VHR A;  2ZGQ A;  3VD5 A;  2MEV 3;  3APB A;  1GP6 A;  4FFI A;  1VBD 2;  3DPR C;  4HZF A;  1Z0H A;  1AZD A;  2ZJC A;  5FZD A;  1CGP A;  1NCR A;  1W8T A;  3VKO A;  3AYE A;  4Q0S A;  4W6X A;  4M0N A;  1GP4 A;  1RJ8 A;  2HWE 1;  2ZMK A;  3KZ4 C;  3NO8 A;  3O1T A;  5CFC B;  1RUE 1;  1S0E A;  2HJI A;  4XDP A;  4QGM A;  5DAV A;  1JYW A;  4QPW A;  4Q2F A;  3OUJ A;  3ZR5 A;  1HRV 2;  1Z78 A;  3RS6 A;  1G9D A;  5C3O A;  4BA6 A;  1HB3 A;  3P6B A;  5F6L B;  1E5I A;  1QF3 A;  4XBQ A;  1NQD A;  1IQA A;  2AEY A;  2QQP A;  2GNT A;  4TXW A;  2WO7 A;  3BN6 A;  4AED B;  5JI7 A;  1PX3 A;  2XL7 A;  3OG2 A;  5FY9 A;  2OVU A;  4I3P A;  4EWE A;  1O4Z A;  1ZRF A;  4SBV A;  1C3H A;  2JDH A;  3O1R A;  1C5I A;  4A2U A;  2Y34 A;  2JDN A;  2R07 1;  4J1W A;  4N9H A;  2WUH A;  5JMO A;  4EN9 B;  3H3Z A;  4CVU A;  1VBC 1;  2EIG A;  5CG9 A;  1KJL A;  3AKT A;  4IE7 A;  1PO1 1;  4NPR A;  4HN0 A;  4DMI A;  1N47 A;  1V9U 3;  5FYH A;  2JIC A;  4DNY A;  2JEM A;  4E4S A;  2VY0 A;  3WXP A;  3WNL A;  2R04 1;  3D0J A;  4FAH A;  4CXY A;  1YYN A;  1S0D A;  3ATG A;  3J7M A;  5D8A A;  1PO2 2;  3POW A;  1XNA A;  4WM7 A;  4XIL A;  4D7S A;  3CJI B;  2RS1 2;  1RUJ 2;  2JIJ A;  1ULD A;  2WN3 A;  3WNN A;  2KA3 A;  3OPZ A;  3ZFF C;  1Q5O A;  3I2D A;  1UOB A;  3QCW A;  4QQP A;  1W90 A;  3CO2 A;  5EXO A;  3LQC A;  1OD5 A;  4RHV 2;  2JD4 A;  3FUQ A;  3TAY A;  2Q0A A;  3OUI A;  4PF5 A;  2HBU A;  3MUZ 1;  4QMA A;  1Q56 A;  5F3G A;  5LBE A;  1XNB A;  5BY5 A;  1HQN A;  4QXK A;  1DQ2 A;  5FPL A;  3JZV A;  3RFR A;  1OLM E;  2OZJ A;  3VL9 A;  4BQ1 A;  1AL2 1;  1OA4 A;  1DQ0 A;  2X10 A;  4XCB A;  1UU5 A;  1WW4 A;  2AEZ A;  2PQS A;  3AP5 A;  3N7M A;  2W92 A;  4L99 A;  1D4M 2;  1ZBA 2;  3WG4 A;  2EIC A;  1H6Y A;  1RED A;  1W99 A;  5ABJ B;  2RJK A;  3ZYG A;  1JOB A;  1DZR A;  2YBK A;  3MW3 A;  4N53 A;  4NUB A;  5D21 A;  3TN9 3;  1V6I A;  2ORX A;  4QXC A;  5FY1 A;  2Q1M A;  3ZIX A;  1B35 C;  3BPZ A;  1WA4 A;  4E4D X;  1FNZ A;  2PHF A;  2ZGS A;  2D6L X;  1DZT A;  3V0B A;  2P5B A;  2GN7 A;  5HCF A;  1J3R A;  1ZZ6 A;  2B46 X;  3ES1 A;  2WAB A;  5FMC A;  4BYY A;  5DUW A;  1TMF 2;  1TNF A;  1ND2 A;  1WBF A;  4UFI A;  2BWA A;  4ZZ5 A;  5I91 A;  2VZT A;  4CDW C;  4LKD A;  2Y6J A;  1N3Q A;  1CAX B;  1O91 A;  2JKB A;  1AYM 2;  2V4A A;  3ITQ A;  4ATE A;  3MDP A;  4JRA A;  4YPJ A;  2HYK A;  2WO1 A;  4DEQ A;  5KHI A;  3ZN6 B;  3KCX A;  4UW4 A;  1K5M B;  1PVC 2;  1FX5 A;  4CYD A;  1WZX A;  2YG0 A;  3DF0 A;  4IEW A;  4ZHN A;  5BNO B;  1GOG A;  2IVJ A;  4OUL A;  2RM2 2;  4YZ5 A;  1W39 A;  3ZLI A;  4ERO A;  1FNY A;  2TEP A;  4FOW A;  2QQN A;  2WFF 3;  3WNM A;  4IEY A;  3N7L A;  2WRA A;  3OSD A;  5J3U A;  5C5U A;  2A3W A;  3OY8 A;  3FLT A;  2W1S A;  2HYX A;  3NNL A;  2W9X A;  4AHZ A;  1R64 A;  3L2H A;  4URT A;  4CUA A;  2CWS A;  2ZHL A;  4RQP B;  1X8M A;  3AP9 A;  3I97 A;  5F5I A;  1ACC A;  2K9Z A;  2ARE A;  2P34 A;  1IPK A;  2YBP A;  4YM3 A;  3NRU A;  4BQ5 A;  4XVH A;  3VD9 A;  1HXS 3;  3ACI A;  3S5Q A;  1Q8Q A;  2IXK A;  1C8N A;  3SQO A;  3N9P A;  3NMB A;  1AR8 1;  4LA2 A;  4CCE A;  2ZTN A;  1F4H A;  3RSJ A;  1XND A;  3JD7 2;  2NZ9 A;  5A80 A;  1A34 A;  1RIR A;  2RV9 A;  4GQ7 A;  4KWK A;  3HT1 A;  4DXS A;  2D3P A;  5AC9 1;  4CDU B;  3CDZ B;  3DV8 A;  4IV1 B;  1GOH A;  2W95 A;  1BK0 A;  1VBE 3;  3JQW A;  4YZ3 A;  1JZ6 A;  1FAY A;  1NA1 C;  2P6C A;  1V70 A;  2X09 A;  1LOF C;  4FOY A;  1YHF A;  3AK0 A;  2XJS A;  1AR7 1;  2L9L A;  4P5H A;  2WZR 3;  5C4W A;  3N4M A;  1PNF A;  4HXC A;  1MQT A;  4Q1P A;  4Y4R A;  1F2N A;  1HRI 3;  1RHI 1;  1RUG 2;  1L7L A;  4D0Q A;  1G6N A;  1QQP 1;  4D8M A;  1R1A 3;  1JHN A;  1YQ8 A;  3AFG A;  4E2G A;  3PVB B;  1SBD A;  2XON A;  2BBV A;  3A22 A;  2QQU A;  3HAG A;  3N7J A;  3UYJ A;  3AYA A;  2HWB 3;  1SPP A;  4CP9 A;  3UGH A;  1SCS A;  3RPQ A;  1UX7 A;  1WLC A;  3NJY A;  1UW8 A;  4QKD A;  4YYO A;  4AW7 A;  2F6B A;  5E16 A;  4HVR A;  5F3C A;  4ZY9 A;  1LU2 A;  1BVP 1;  5JI9 A;  3RWN A;  1DLL A;  1DF0 A;  4R4X A;  5F8P A;  3GBG A;  3BTY A;  2FDF A;  1X9P A;  5FZ0 A;  3G6J B;  5L73 A;  1GNZ A;  3BB6 A;  3KVA A;  3RZM A;  4D94 A;  1C8M 3;  1HQL A;  4JKK A;  4NJ4 A;  1RUC 2;  3ZDS A;  5B2G B;  1UOF A;  2ARA A;  4MXV A;  4NAM A;  3MGU A;  3ZXF A;  2OX0 A;  3NNG A;  1MZE A;  1CX1 A;  4Q8L A;  4AG4 A;  4PBP A;  1EAH 2;  1ULO A;  4LIT A;  3DXU A;  3A23 A;  1J84 A;  3P1I A;  3NV1 A;  1QY4 A;  5FXZ A;  5FYB A;  3NNJ A;  5GZD A;  3SIS A;  4QDR A;  5C9A B;  2PMW B;  1I3H A;  3CQO A;  1LHU A;  3PIJ A;  4QPI C;  1PMH X;  3T08 A;  2H6C A;  2PHU A;  2VEC A;  1LEM A;  2E7Q A;  3GM8 A;  4C1W A;  3I3E A;  3UGG A;  1W2A X;  1MZ6 A;  2AC1 A;  4KG8 A;  1XYN A;  2IFW A;  5BNP B;  1X9T A;  2CU5 A;  1DZQ A;  4MXW A;  2RS5 1;  2A6V A;  1AVB A;  1BEV 2;  4BLI A;  1WCK A;  2JB8 A;  3V0A A;  1N3P A;  3VBR B;  3VBU A;  2A6W A;  1FOD 3;  1HX6 A;  4DQA A;  1JYI A;  5DXD A;  5IK8 A;  3LDR A;  4XZP A;  2VW0 A;  1LU1 A;  5LAS A;  4LA3 A;  5CZK A;  5IK5 A;  3B02 A;  1PK6 C;  3LEM A;  3POE A;  4C1X A;  3HBK A;  3WCR A;  1J3Q A;  3VDD A;  4LBQ D;  1RC6 A;  1JU3 A;  5E89 A;  2DFB A;  2VQA A;  2ARX A;  3KCC A;  4YM2 A;  5JIA A;  1C28 A;  1RUF 1;  5A3N A;  4E4Z A;  1SAC A;  4AHX A;  3LCP A;  1XOY A;  2VNV A;  1S2B A;  3S30 A;  3B9C A;  2C4X A;  1IPS A;  5H9R A;  1OA2 A;  1BBT 2;  1UIK A;  1OVP A;  1ULE A;  2D6P A;  4XTP A;  4MSV A;  3WQB A;  1KFX L;  3PUS A;  4TZD A;  5GAL A;  2DUR A;  3I2J A;  5I0U A;  4CA9 A;  4KMQ A;  1H9W A;  1RVF 2;  4GD4 A;  4Y1U A;  1RIN A;  2VXJ A;  5A1L A;  1OOP C;  2DVA A;  2I07 B;  4PF1 A;  5LA2 A;  1CWP A;  1GU3 A;  1OFS A;  1QXP A;  3ZPY A;  1AL0 G;  1ULF A;  5M0T A;  1W05 A;  1Y4W A;  2I2S A;  5FLI A;  5A7N A;  4XF4 A;  5C7G A;  4IEX A;  4QQ2 A;  3RYR A;  1EP0 A;  3VBS A;  1HB1 A;  4YZ1 A;  1GNY A;  4TWT A;  4E2S A;  2W91 A;  4K21 A;  1CR7 A;  3AMH A;  1B09 A;  5ANN A;  3TEX A;  2R32 A;  3PME A;  3NV4 A;  5I93 A;  4FVV A;  2ZEZ A;  1SDD B;  2WJS A;  1UZ0 A;  2W39 A;  1DGW X;  3PDQ A;  2DCK A;  4NPL A;  2YPJ A;  1X33 A;  4YVS C;  1W8H A;  1OD3 A;  1GLH A;  3KWV A;  1YIP A;  4QD2 A;  1DU3 D;  2CDP A;  4A6O A;  3ZFE C;  1LOB A;  2PFW A;  3P5B A;  4OCT A;  1ZBE 2;  5JSO A;  5DQ0 A;  4W50 A;  4BOW A;  2CAV A;  5FXW A;  2UUR A;  3R0R A;  3FFQ A;  4I2O A;  5JIU A;  3ZYP A;  1XC6 A;  2XXZ A;  4FCA A;  2G1M A;  1FPN 2;  2JD9 A;  4XIO A;  5I8T A;  1VBD 1;  3T2Q A;  4L8Q A;  1QGL A;  5CIR A;  3ZM8 A;  3M3E A;  2XOM A;  1BVV A;  1N1T A;  5EYX A;  3AZX A;  4WM8 B;  3ZFG C;  3T4V A;  1EUT A;  1GR3 A;  3J7H A;  5F7U A;  4PCR A;  2D6K A;  1O8S A;  4Y5S A;  2HWD 1;  2JG9 A;  1ALY A;  5T5P A;  4AEM A;  5LBF A;  5L7O A;  4S2G A;  3S7E A;  2RMU 3;  5C3R A;  1GBG A;  1MEC 3;  1W2T A;  2ZKN A;  4CUB A;  4DS0 A;  4JRL A;  3AMP A;  4KBZ A;  1YIF A;  4Z82 A;  2FHR A;  4AGR A;  5H9Q A;  2XPJ A;  1P8J A;  3T0B A;  5KXB A;  4QHO A;  4XHB A;  5GZE A;  1RL3 A;  4AAX A;  1YWK A;  2YY1 A;  2VOW A;  2HWE 2;  1XSQ A;  1H1A A;  3JCI A;  1YFW A;  1CPN A;  2HWF 2;  4HFS A;  1D0H A;  3RI8 A;  4DUV A;  3EBR A;  4FO9 A;  1WD4 A;  2GAL A;  3USU B;  4FP2 A;  2V4V A;  3A0K A;  5FDB A;  2XJU A;  1ND3 A;  3AL5 A;  3DKW A;  2PXJ A;  2RJ2 A;  4Q4V 3;  5A7P A;  1NCQ B;  3UK9 A;  3WDU A;  1RUO A;  4UBG A;  3VKL A;  1GZC A;  4ZXK A;  5K8S A;  4UFM A;  3HT2 A;  4QXH A;  4R9D A;  4F83 A;  1QJX 2;  4IV3 B;  4CDX A;  1RMU 1;  2JDZ A;  2RS1 1;  3WG2 A;  4AED C;  1MS8 A;  2WT0 A;  1R1Z A;  3WP3 A;  1RUJ 1;  4WV8 A;  1QJU 3;  2VUC A;  4P9W A;  3GBF A;  1AX2 A;  1FI2 A;  1VBC 2;  4G4F A;  5FZA A;  5LRR A;  5CFD B;  4KQ7 A;  4RHV 1;  2BU9 A;  1FV3 A;  4DEV A;  5JPM B;  1Q43 A;  4J1X A;  2OW4 A;  2R04 2;  2WZE A;  4D7Y A;  1XE7 A;  2WA3 A;  3I2G A;  1H4H A;  1VMF A;  2EF6 A;  2PHD A;  4MGS A;  5DDJ 3;  2GDF A;  2VZP A;  2BBA A;  3J9S A;  2WN2 A;  1GSL A;  4XJZ A;  4AI8 A;  1VBA 3;  1GP5 A;  3S57 A;  1AJK A;  5A7S A;  3CJI C;  4B8E A;  1ENQ A;  1YEW A;  1OLQ A;  2BOJ A;  4RS5 C;  3KF3 A;  1M4W A;  5DAP A;  4CEY B;  3O1O A;  1NT0 A;  2DV9 A;  3VDC A;  5JDB A;  2HBT A;  2G19 A;  2Q4S A;  4TN7 A;  3T2O A;  2P3K A;  5JR7 B;  3V65 A;  5HV4 A;  1ASJ 2;  2LRO A;  5E8A A;  4QX8 A;  5IAT A;  1J1T A;  1QJY 1;  3WQ0 A;  4LTA A;  3PNA A;  3VB9 A;  2RDR A;  4XW3 A;  1X7N A;  2XUM A;  1IKP A;  5DUX A;  1XU2 A;  2K0G A;  4AFA A;  1TMF 1;  1MS3 A;  2DU1 A;  4GMP 0;  4N7I A;  5FV3 A;  2D6O X;  2YC0 A;  4B29 A;  4LBQ B;  1V9U 1;  2VW1 A;  4OHW A;  1GYK A;  3UJQ A;  1QJZ A;  4BCU A;  5ABJ C;  2QZ3 A;  1F15 A;  4P9L A;  5KWR A;  3WP6 A;  4IEQ A;  2FD8 A;  1NQJ A;  3QLQ A;  2RS3 3;  1ST8 A;  3K75 B;  2WWU A;  2RE9 A;  3MLK A;  5FPV A;  3SMH A;  4SLI A;  5CKQ A;  4LBL A;  2BYV E;  4AQ2 A;  1TME 1;  3ZSJ A;  3ZXD A;  1CN1 A;  1I5P A;  2A6Z A;  3B93 A;  4QGN A;  5C5T A;  4ARX A;  5LA1 A;  3W21 A;  4BHP A;  1OF4 A;  4OI2 A;  1LNS A;  2WT1 A;  2NPI A;  2WNE A;  5ACA 2;  4JCK A;  2GSY A;  4QAW A;  4JHT A;  5A7W A;  4C90 A;  3IDC B;  4AZZ A;  4OVE A;  3BIE A;  3RVH A;  1W6Q A;  4PIZ A;  1VRH 2;  2KM2 A;  3HMY A;  3U78 A;  2KR2 A;  1APN A;  1OLR A;  1W6O A;  1K5M C;  1W06 A;  1U5Z A;  3WT3 A;  5IUQ A;  4GWM A;  2B4K A;  4LUK A;  1JZ2 A;  4IW3 A;  4ASL A;  3AMN A;  4XZU G;  3P3P A;  1NCR B;  1YI9 A;  5DUV A;  1COV 3;  5A7Q A;  2J1R A;  1QJF A;  4OZO A;  3JD7 1;  3KM5 A;  5FZ9 A;  1ZA7 A;  1R08 3;  2DVG A;  2VCA A;  2YZ4 A;  1VBB 1;  2WO3 A;  3Q8B A;  1UL9 A;  1REF A;  1DBN A;  1UXX X;  3GJA A;  1SFP A;  4AXO A;  3VBH B;  4GH4 A;  3FHA A;  4C8D A;  5JUV A;  2JE9 A;  4AGG A;  4HAN A;  4MOA A;  3W20 A;  5J96 B;  4LQR A;  1S0F A;  1ZZ9 A;  3MZH A;  1AR9 3;  4XF1 A;  5FZ8 A;  3OF1 A;  3BI3 A;  3NJZ A;  4EYU A;  2BTV C;  3WY6 A;  2XUE A;  2BDR A;  3I8T A;  2VUD A;  2FDI A;  1WCD J;  4QHZ A;  3D0S A;  4IEO A;  1QNW A;  1QOT A;  3WCS A;  4WBB A;  2I74 A;  3WLU A;  2ID4 A;  1RUG 1;  2BW8 A;  4Q4X 3;  2D98 A;  2EA7 A;  3MPP G;  3MF9 A;  4AI3 A;  2VE1 A;  4MG2 A;  3GJB A;  5AC9 2;  1Z7S 1;  2WA4 A;  3WNO A;  2QQK A;  4HK9 A;  4Y5T A;  5IVB A;  4CPB A;  1S4C A;  2R1B A;  2ORZ A;  2FCT A;  3LA2 A;  1A8D A;  4CDU C;  1XNC A;  3KCY A;  2WFF 1;  4IV1 C;  1A6C A;  1G7Y A;  1SCR A;  3Q8F A;  2G9G A;  5D8A B;  3H1W A;  4WM7 B;  1AR7 2;  5JOZ A;  3GZE A;  4YNI A;  5FPU A;  1QNY A;  1JZ5 A;  1GWK A;  2VCM A;  4IGO A;  5F3I A;  3VBO A;  2PQQ A;  1RHI 2;  1FXZ A;  3OBR A;  4GMP 3;  1LGN A;  2QQL A;  3LSD A;  1OI6 A;  1XQN A;  5K0U C;  4A7K A;  1BYH A;  4FPK A;  1RTV A;  1UY3 A;  2B9U A;  3QH6 A;  3OGJ A;  1PM4 A;  2GH8 A;  4HKW A;  2BNM A;  3T1L A;  3B9I A;  4K9S A;  4E4H A;  1UNB A;  5FZO A;  3O0W A;  1UKG A;  1Q8S A;  2ZGN A;  2XVL A;  4BIO A;  1RUD 3;  5JAX A;  2V73 A;  1HJF A;  3U14 A;  3O1V A;  1N1V A;  1WW5 A;  1F5J A;  2D7F A;  3BTA A;  3VZL A;  2JDY A;  2QE3 A;  3PIG A;  4BM8 A;  3WDV A;  1LHW A;  3BGA A;  2GMM A;  1NLR A;  2ZAA A;  2O14 A;  4PDW C;  4XUP A;  2DUO A;  3MF6 A;  1SG3 A;  5GZC A;  5KXC A;  4PQ9 A;  5DAX A;  2E7T A;  4N53 B;  3U4S A;  4PT6 A;  1XRU A;  3HWJ A;  1HB2 A;  4FPY A;  3MUY 1;  5A6X A;  1PM7 A;  4Q0V A;  3M3O A;  3WDT A;  1BEV 1;  3N9Q A;  5F1R A;  4BQ3 A;  3MHZ A;  4AOC A;  4C0B A;  3V0B B;  1RUI 1;  1HN1 A;  5HI0 A;  3SCH A;  2ET1 A;  1F8V A;  3O1P A;  1OKQ A;  2ZAH A;  3HQU A;  3ZYB A;  4BIS A;  1ND2 B;  4AFM A;  5AFE A;  5C9A C;  1W28 A;  1PGS A;  1D2Q A;  1U0A A;  2CGO A;  2E26 A;  2VL4 A;  1WMF A;  3I59 A;  2XH6 A;  2YYO A;  3LE0 A;  4LUL A;  4NN0 A;  4WVV A;  3RDI A;  4FOQ A;  1X8E A;  1PMJ X;  2WNV A;  2TBV A;  3UL2 A;  4AK3 A;  1WMD A;  3NJX A;  2CL2 A;  3CLP A;  4OMC A;  1MR5 A;  1XYP A;  3NKT A;  3PTR B;  3THT A;  4BZ4 A;  4A45 A;  3DYM A;  5BNP C;  1N1S A;  2Z5W A;  3W59 A;  2RS5 2;  2RDN A;  1SZB A;  4N7U A;  3WR0 A;  4AFB A;  5HCH A;  1V0A A;  3D4K A;  5IVF A;  1AR6 2;  4QXB A;  1UWW A;  1D7P M;  1TEI A;  1Y9G A;  4PHZ A;  5EQU A;  2XLG A;  3LB9 A;  1RVF 1;  1OQE A;  4Q0Q A;  2I45 A;  4AHY A;  5I0S A;  1WA6 X;  4BME A;  1REE A;  2V5D A;  1MVE A;  2K2S A;  2W3J A;  3MO4 A;  3OY8 B;  1IOA A;  2EVX A;  1KJR A;  1RUF 2;  2D44 A;  1R09 3;  3H0O A;  3I4I A;  3HNM A;  4GJY A;  1OHF A;  3HOB A;  3ELN A;  4OQ9 A;  3WW1 A;  4MGZ E;  3K4D A;  4XQD A;  5FZI A;  4Q27 A;  2R06 3;  1C1L A;  1ZZC A;  1H8T C;  3SCG A;  2ETE A;  4P9G A;  1JYN A;  5IK7 A;  1UY2 A;  1S0C A;  3THD A;  3H1M A;  1LOG A;  4EJR A;  4O9G A;  1B35 A;  3B69 A;  4CCK A;  4LLO A;  2BVV A;  4LKF A;  1K12 A;  1JBC A;  1UMI A;  2LS6 A;  2W87 A;  4XFI A;  5EP9 A;  2BFU L;  4YM1 A;  2W47 A;  5FLH A;  1AXK A;  4E27 A;  2PHX A;  2VVE A;  2BZD A;  4JDO A;  1JMU B;  4GUL A;  4P14 A;  3DEC A;  3AP6 A;  1O5L A;  3VBF A;  3WSO A;  2CV6 A;  1RJ7 A;  1ZZ8 A;  1DGR A;  2GC0 A;  2GZW A;  4YVW C;  3BOP A;  1ODM A;  2HWC 2;  5FY7 A;  4A3X A;  4JDM A;  3N36 A;  2R49 A;  4E8D A;  3HNY M;  3WOG A;  3RGB A;  3IAQ A;  1J1L A;  1HKD A;  1ONA A;  2XWJ B;  1LHV A;  3A21 A;  2O8O A;  4P9I A;  3FJS A;  2OKX A;  5C33 A;  5C8C A;  2B45 X;  4PI0 A;  2H0V A;  4RFT 0;  4A7Y A;  2V5Y A;  2OZ6 A;  5C3P A;  1WCU A;  4CP9 B;  1SPP B;  1ZX5 A;  2ARC A;  2BV4 A;  3SH3 A;  5A3T A;  3AP4 A;  4YGC A;  3AM2 A;  1K5J A;  4UBH A;  4O65 A;  3NL1 A;  3SEE A;  4HVO A;  4YRD A;  5CB7 A;  3CHX A;  4XJW A;  5CAD A;  2HWF 1;  3ILN A;  4KWJ A;  4CEW B;  2GP3 A;  2VQU A;  1TVG A;  1LUL A;  3POI A;  2HWD 2;  4WM8 C;  4I02 A;  3WEZ A;  4OI0 A;  4XIK A;  1CAU A;  4BWO A;  2EAA A;  4RL7 A;  5JSR A;  5HCB A;  2AR6 A;  3C2U A;  4XMA A;  1US3 A;  1H2K A;  2NM1 A;  2O0O A;  2ZX2 A;  2ZX4 A;  1QJX 1;  2P17 A;  4ISR A;  1HW5 A;  2DCZ A;  1D0G A;  1OPO A;  3O14 A;  4CTE A;  3WHT A;  3UV9 A;  3U10 A;  1ULG A;  4E2Q A;  1W6P A;  4Y22 A;  4AQ6 A;  1WLT A;  2VMF A;  1YJL A;  1U5Y A;  1BHG A;  1AJO A;  3M3I A;  2EXH A;  4XEZ A;  3OGV A;  2UWA A;  4HK8 A;  1EY2 A;  2VNG A;  1ZBA 3;  5EWS A;  4Z2W A;  1NA1 A;  5F5C A;  5LEK A;  1PGL 1;  3ZXK A;  4MXW B;  4ES8 A;  1ENX A;  1LOF A;  3WQ7 A;  4U36 A;  4NVP A;  3MW2 A;  4XJA A;  2WLQ A;  3V0A B;  2J1A A;  2HH9 A;  2VD7 A;  1W6M A;  3K77 A;  3WDW A;  1AYN 3;  4AQT A;  1RMU 2;  3VBU B;  3PUA A;  4XFH A;  2N7G A;  4YGE A;  5JZG C;  2JDM A;  4IV3 C;  5FY0 A;  3ZSK A;  4BJ0 A;  2W5F A;  2ARB A;  2WDB A;  1NXD 1;  2BQP A;  2RR1 3;  3ZYF A;  4FBF A;  2CAU A;  4UFJ A;  3VDD B;  2FQP A;  3FHI B;  4QGL A;  2MEV 2;  4NID A;  3D5O A;  5CFD C;  1ASJ 1;  4ES9 A;  4M3C E;  2HEY F;  5KR7 A;  3FLP A;  1W03 A;  1DLC A;  4JQR A;  1AYM 3;  1OF3 A;  4AI0 A;  1EV1 3;  3ZPO A;  2FCU A;  1V00 A;  3HN3 A;  1LGC A;  1CZV A;  1RUH 3;  1JUH A;  1PHM A;  1KQR A;  3LAG A;  2GH2 A;  4Q4V 1;  2BGC A;  4KL1 A;  1G8W A;  3N9L A;  2G4I A;  4FPJ A;  5C8W A;  1W9T A;  5FPB A;  3I2H A;  2HLE A;  1W0N A;  1IG3 A;  4DFS A;  4FQ4 A;  1QXJ A;  2X5I A;  4I09 A;  4XXA A;  4CEY C;  2ZX0 A;  3VBS B;  3SH4 A;  3MIG A;  1QJY 2;  4HSL A;  5GLT A;  1QJU 1;  4GKX A;  4QKF A;  3KT7 A;  2Y0O A;  4QU1 A;  2ZMN A;  1CIW A;  4NMI A;  4JTO A;  3AJY A;  4LLF A;  1LED A;  3MI8 A;  4LNV A;  2TNF A;  1V6K A;  5DMY A;  2VNO A;  2FBE A;  1GUI A;  2XJQ A;  2XLF A;  3JXS A;  1G9C A;  5FMO L;  1XE0 A;  5FKB A;  4AQS A;  1V9U 2;  2IFR A;  3OGG A;  4QB6 A;  5LB6 A;  5ACA 1;  4CZS A;  3AKR A;  3K4A A;  3AKQ A;  3C7E A;  4JZR A;  4IEV A;  4N8M A;  3T0A A;  3V56 A;  5A70 A;  3VUO A;  1QKQ A;  4LEJ A;  4NHK A;  1DIW A;  5DDJ 1;  1OC1 A;  1W6N A;  2VNR A;  1VRH 1;  4PLN A;  4RA0 A;  3VN4 A;  2YGM A;  4YFW A;  2E63 A;  3SH5 A;  4EZ4 A;  1TME 2;  4XUO A;  1O8P A;  2Y33 A;  1OH3 A;  1DGL A;  2BWC A;  4CU7 A;  3KT1 A;  4KGG A;  2XG3 A;  2ZGK A;  3RZG A;  1OT5 A;  5D2A A;  4XFA A;  1NUK A;  2RJL A;  1C5H A;  5L9B A;  1M06 G;  4MVT A;  3NV2 A;  2JG9 B;  1AX0 A;  4MGQ A;  2DUQ A;  5H9S A;  4FFF A;  4ONU A;  5L7O B;  1LCL A;  1WCQ A;  4P5Y A;  4AHW A;  4FQZ A;  2DBI A;  4P9X A;  4CPB D;  1DYP A;  2CGN A;  2LM3 A;  4M4R A;  2QQO A;  3MYX A;  2JB4 A;  3TN9 2;  2J7M A;  4P9J A;  4COV A;  4QQL A;  1W9W A;  1ZRE A;  2OPW A;  1GMM A;  1XU1 A;  1VBB 2;  1NCR C;  2E7A A;  2UYA A;  4ZU7 A;  2JXA A;  2PN5 A;  2RS3 1;  2YB7 A;  1O59 A;  1VB2 A;  3JU9 A;  4GB3 3;  4UOJ A;  2V72 A;  4YGD A;  4LBM A;  1HN0 A;  1S1A A;  1SMV A;  2XDV A;  2QKD A;  1ND3 B;  2CTV A;  4S2D A;  3VBH C;  3I3M A;  2XVG A;  5KXD A;  1XNK A;  3RZK A;  3H3L A;  4XAA A;  1RUC 3;  3ACH A;  4LBK A;  2H6B A;  5K7P A;  1H6X A;  2YU2 A;  1W8W A;  3S0M A;  4QX2 A;  4EWD A;  2XJR A;  1IS3 A;  1Y7B A;  2VG9 A;  2DWR A;  5A3W A;  5K9Y A;  4CDX B;  2BUK A;  1UY1 A;  2A6X A;  2LW8 A;  4XAB A;  5FUP A;  5IFT A;  5IVY A;  3ZYR A;  1W0O A;  1Y43 B;  4IE5 A;  2WQ4 A;  3ZFE A;  1XNT A;  1LKN A;  1UZY A;  1NAE A;  4MLO A;  4XXP A;  5EFU A;  5JOY A;  4IEZ A;  4LKE A;  2VZ3 A;  4NRO A;  4XJ8 A;  1H30 A;  1DDL A;  1Z7S 2;  1IQD C;  2XHK A;  1N1Y A;  4IE4 A;  1W9S A;  5CAZ A;  1NG0 A;  2WFF 2;  4UF0 A;  3Q9O A;  2QQI A;  4ZU5 A;  4CXX A;  3WF0 A;  4QX5 A;  2XML A;  1ENR A;  4UFH A;  4QX1 A;  1Q8V A;  1W2U A;  4Q0P A;  4WM7 C;  5APA A;  3NQH A;  4XJ9 A;  4I30 A;  1JOJ A;  3UJO A;  3HIF A;  5FZC A;  2B5H A;  3RZZ A;  3GXU A;  5LA0 A;  5J37 A;  5A32 A;  5HBA A;  1VB4 A;  2OQ7 A;  1HLC A;  2XBO 1;  3CMG A;  1WUV A;  1HXS 2;  2VR4 A;  3EB7 A;  4WVM A;  1H2N A;  5F6K A;  4M3C F;  2Y6H A;  4QWN A;  3OGR A;  5CNA A;  3U07 A;  5FWJ A;  2PLV 3;  3T09 A;  3IKW A;  2V09 A;  1SLL A;  2VZQ A;  3IB3 A;  4Q4X 1;  2Z2S B;  4FFG A;  2UWC A;  2JEN A;  3I2O A;  2EID A;  3OTF A;  4QB2 A;  4OYU A;  3DXT A;  2VC9 A;  3N9N A;  4QDS A;  2A70 A;  4KH9 A;  3ACG A;  4RR3 A;  3FMG A;  1VBE 2;  3H7J A;  1ZA4 A;  3PUI A;  5FBJ A;  3SC7 X;  4XQ4 A;  3FC0 A;  4Q4W 3;  4HN1 A;  1OUX A;  1LES A;  1VAM A;  2A5Z A;  2BP6 A;  2C6S A;  3HD8 B;  4N53 C;  2WWJ A;  4XFG A;  5FP8 A;  2WZR 2;  4DIQ A;  3H8R A;  2ET7 A;  3C8X A;  1HRI 2;  2D97 A;  4UYB A;  1AR6 1;  4BLJ A;  3NAP A;  1IKQ A;  1RUI 2;  5I0T A;  2X05 A;  5CBL A;  1R1A 2;  5LAT A;  1X82 A;  1JYX A;  1JS9 A;  3AP7 A;  1IS4 A;  2ZCW A;  4FPH A;  3QAC A;  1UZZ A;  2HWB 2;  2ZX1 A;  4MGI E;  1WW7 A;  2VZU A;  4B4R A;  3AZZ A;  3AB0 A;  1RUD 1;  3BIW E;  2WNU C;  3RI9 A;  4URA A;  2QQM A;  1LR5 A;  2ES3 A;  2UWB A;  4QKB A;  1W2N A;  4MH0 E;  5A7W B;  1QOO A;  3AC0 A;  5T54 A;  1W6Q B;  3J8F 1;  1JZ4 A;  1XBF A;  4AVA A;  1LHN A;  2YFZ A;  2J1V A;  4LO7 A;  5JXH A;  1ZBE 3;  4ASK A;  3SNM A;  1W6O B;  2O8Q A;  1C8M 2;  1UYZ A;  2PYT A;  1AXY A;  1MS5 A;  3ILF A;  4WVZ A;  2VJX A;  1K42 A;  4RS5 A;  2JDP A;  2VUA A;  4XAC A;  2A7A A;  3GHN A;  1FPN 3;  3VKN A;  1DQ1 A;  4UFK A;  3GZU C;  2OII A;  3JB4 C;  2J1E A;  2LUW A;  4PQQ A;  4TLG A;  1KDM A;  3LPF A;  1IS5 A;  4GH4 B;  1YQ2 A;  2R1D A;  3K3N A;  3V64 A;  4CCO A;  4FXK B;  4Q1R A;  4XUR A;  2R0H A;  2XKO A;  3O1S A;  5FYC A;  3WVJ A;  3D3A A;  1UU6 A;  3VD4 A;  2W1Q A;  5JOX A;  1SDW A;  3R05 A;  2ZGR A;  3FLR A;  4H14 A;  4CDQ A;  2HWC 1;  5LEJ A;  4JV4 A;  4O61 A;  4RN5 A;  5FZH A;  5ABJ A;  4FSJ A;  5G05 L;  1PNG A;  2VBP A;  2DFC A;  2AZ5 A;  4XDQ A;  2YXS A;  1ENS A;  3ZXE A;  5IT6 A;  2D5H A;  2IVI B;  1A3K A;  4R9B A;  4D3W A;  1G9A A;  1EUU A;  1F4A A;  2F4P A;  3SXW A;  1RUE 3;  1FOD 2;  1S0B A;  4P9Y A;  4XC9 A;  3VHO A;  1FV2 A;  2IWG B;  4PBO A;  3UKV A;  2CDO A;  3VZN A;  1UMH A;  2FMD A;  1IS6 A;  1H2M A;  2JG8 A;  3LEI A;  5BNQ A;  1I5Z A;  2DBN A;  4RFR B;  3NV3 A;  1R09 1;  4JHZ A;  4QPG B;  3HEI A;  5FBZ A;  5SV5 A;  3VBO B;  4AAP A;  3FHQ A;  3POJ A;  1VLN A;  4NOT A;  5JVV A;  1CVN A;  1S0G A;  3ENR A;  3K51 A;  5ANQ A;  4COZ A;  2Y6K A;  2JE7 A;  4W6W A;  4LMF A;  4E9K A;  1UX6 A;  1MAC A;  3NW4 A;  4JGZ A;  1CJD A;  2OXB A;  2R07 3;  4EN0 A;  5JOW A;  2VOK A;  4JGY A;  3JBG 1;  1SLT A;  4PIX A;  2B9V A;  3IWZ A;  3N9O A;  4YWA A;  5FZO B;  3SHR A;  1PO1 3;  2YUE A;  1ULC A;  3RZJ A;  1W8N A;  5DAW A;  3UKN A;  3LIG A;  1OH4 A;  1W8F A;  3O0V A;  1SEF A;  3VDB A;  1SBF A;  3TRS B;  5L9V A;  4JQT A;  3BYW A;  5FXX A;  3LA7 A;  5CFC C;  5EV7 A;  2OYZ A;  1PIV 3;  4CEW C;  3SLI A;  5HPO A;  1TG7 A;  1T2X A;  1PGW 1;  3QOP A;  3HQX A;  3Q8A A;  4GXL A;  3MIH A;  5JMC A;  1K3I A;  3OBA A;  4M3C A;  4CU9 A;  5C3S A;  4H55 A;  2Y60 A;  1L3J A;  3OB8 A;  2PHL A;  5AVA A;  2VBB A;  1SLI A;  1OLM A;  2P1B A;  5C70 A;  2VZV A;  3GGL A;  2Z79 A;  4CRQ A;  3NNM A;  3I59 B;  3ZVX A;  2VOT A;  3A4U A;  1AL2 3;  4YSF A;  1QXR A;  4O7X A;  2YV8 A;  1XSR A;  4B4Q A;  2MEV 1;  3NJV A;  1OQ1 A;  4RYD A;  2WNV B;  2XJP A;  5FY4 A;  3RWK X;  1PGL 2;  4UI9 L;  3MIE A;  3WF2 A;  2XB6 C;  1KDK A;  2BOI A;  1FAT A;  3KQ4 B;  4AI9 A;  2WFP A;  3CJX A;  4MAD A;  2Q8O A;  4BQ4 A;  4Y24 A;  2QDN A;  5K0U A;  3QH7 A;  5LA9 A;  1WD3 A;  3VBU C;  5FYT A;  4DOU A;  1BCX A;  1I6X A;  2RMU 2;  3FE5 A;  4OUS A;  1MZ5 A;  1UXZ A;  5FQ0 A;  1MEC 2;  4R52 A;  3LZZ A;  2VCB A;  1POV 0;  2GAU A;  1JOD A;  2P2K A;  5EHD A;  1DQ5 A;  2VMC A;  2EXK A;  3VDD C;  3DL3 A;  3GCW A;  3A7Q A;  3OJB A;  4BB3 A;  2KD7 A;  2UYB A;  2ADD A;  1JZ7 A;  1TZO A;  2F17 A;  5C71 A;  1JZ8 A;  1UMZ A;  2JKX A;  1F5F A;  5FK7 A;  2Q5T A;  2E53 A;  3CIH A;  4PDW A;  4FFH A;  3CBN A;  1CIY A;  4AVC A;  4F8A A;  2GMP A;  2ZGU A;  4HMZ A;  4PI2 A;  4Q4V 2;  2E51 A;  2JWP A;  5HXM A;  1B35 B;  4X6R B;  5KXE A;  3URF A;  1OUS A;  3EXU A;  4UXA A;  3PJQ A;  5GZF A;  2E31 A;  5J09 A;  2WSV A;  3ZN4 A;  1I1E A;  5K4L A;  1I9R A;  2ZHM A;  5FAX A;  1O3T A;  1QDO A;  1QJU 2;  3F2Z A;  4ZS2 A;  4TSV A;  3VBS C;  4AEK A;  1POQ A;  4PIY A;  1KEX A;  2CY6 A;  3T30 A;  4CCM A;  4LUM A;  3VBF B;  1S0I A;  3ZDV A;  2OT7 A;  4HPK A;  4XFB A;  2W2I A;  1GWM A;  5FYM A;  2VU9 A;  5IJR A;  3KF5 A;  2XL9 A;  3B01 A;  4MHR A;  5FOJ B;  2P37 A;  2D3R A;  3AYD A;  4ZU4 A;  2ADE A;  2Z4F A;  2ZML A;  2XHN A;  1O3R A;  5FIX A;  2B7Y A;  1W04 A;  1AR8 3;  3TYJ A;  4AGV A;  1EV1 1;  5BNN A;  5C8C B;  2PEL A;  2CWM A;  5DDJ 2;  5CEH A;  5IFP A;  2IXL A;  3B7M A;  5FZE A;  3RMY A;  5A1F A;  2YRO A;  2VOV A;  3O5S A;  2VZR A;  2J42 A;  1W0P A;  5FP4 A;  4NAO A;  3OUH A;  2VAU A;  4K7J A;  1MZF A;  1HJG A;  3N9M A;  5FYZ A;  3SCF A;  5BNO C;  3TN9 1;  2LAL A;  1AF9 A;  4NHX A;  2ZGO A;  2Y0I A;  3WP5 A;  1WBL A;  2MNG A;  2WSU A;  4UFL A;  5FKC A;  1AR7 3;  1UO9 A;  4K20 A;  3UGF A;  2ZKL A;  2ZEX A;  3GNE A;  2NN8 A;  5LW9 A;  3EJK A;  1CAU B;  1QQP 3;  4LK6 A;  4OI1 A;  4N43 A;  4CCJ A;  4RQP C;  5D1I A;  4B1L A;  4OHZ A;  1H8T A;  3ST7 A;  2EXI A;  5L7O C;  1NZI A;  2IZW A;  1RXG A;  3BCW A;  4XET A;  1YFU A;  2XVK A;  4BPZ A;  5FY5 A;  1OSG A;  3J7N A;  1LOE A;  4FT8 A;  4XBL A;  3VGI A;  2Y26 A;  3DKQ A;  2WS9 3;  1H1I A;  5F9T A;  2ZZJ A;  1JHJ A;  3KGZ A;  1W6P B;  4Y22 B;  2XQX A;  3U0Z A;  2RS3 2;  3W9A A;  4Y1Z A;  1OXC A;  2QVS B;  1BMV 2;  4MUV A;  1POV 3;  5H9P A;  3CKH A;  3ETP A;  2CNA A;  4QHB A;  1NA1 B;  1ND3 C;  4ZKT B;  2VOX A;  4YVW A;  4QM8 A;  3I49 A;  1MVQ A;  1W6M B;  2A73 B;  4H2A A;  4LT5 A;  2E32 A;  4FPC A;  3GYD A;  4FP3 A;  1UPI A;  3DYP A;  4MO3 M;  2CSG A;  1W9F A;  4LJH A;  3WUC A;  4CSW A;  2VBD A;  5CVR A;  4CDX C;  1GIC A;  1VMJ A;  5T52 A;  1QIQ A;  1E57 A;  1PZ8 A;  3I3B A;  3TB0 A;  3SKV A;  3HBZ A;  2OS2 A;  5C3Q A;  2ZBJ A;  3LEK A;  2A3X A;  4DUX A;  1W3X A;  4CCC A;  3LWC A;  1HXS 1;  1U5I A;  1YFY A;  3J4U H;  3THP A;  1IG0 A;  3O12 A;  4HLT A;  5B4X A;  4BK4 A;  3DPR A;  3I2F A;  4AWD A;  1LHO A;  5GLU A;  1R08 2;  4JDN A;  4HVQ A;  5IHR A;  5DAQ A;  3III A;  5A33 A;  1DHK B;  1DYO A;  4DXZ A;  3MFA A;  4YW7 A;  5FWE A;  1DG6 A;  1IGO A;  2DCY A;  2RS5 3;  3P3N A;  2WKK A;  3AXD A;  4V1P A;  1OVS A;  1ULP A;  4CP0 A;  3B94 A;  1VBE 1;  1C4R A;  5BYN A;  5A3P A;  5SV8 A;  2XBO 2;  3F95 A;  2X5I B;  3T1M A;  4AI1 A;  4B7K A;  3ZXJ A;  4BXS V;  2WZR 1;  5EJZ B;  1BKZ A;  2X8K A;  1Q8O A;  3PTY A;  1HRI 1;  3K48 A;  1QDC A;  2VZO A;  4Q4X 2;  2FCV A;  2PAE A;  4FXG B;  4NE9 A;  2UU8 A;  3H50 A;  1NKG A;  4Y5Z 0;  1R1A 1;  3IM0 A;  3I3D A;  1J83 A;  3AX4 A;  3WF1 A;  3LGR A;  3ZMN A;  3ZXG A;  1HB4 A;  4COU A;  2Q30 A;  5AVP A;  3TEW A;  4KU7 A;  4NIH A;  5JXG A;  3H9A A;  2HWB 1;  3C7H A;  3RG0 A;  3OYW A;  2FMY A;  4DO0 A;  3KV4 A;  1SBE A;  3C7O A;  3OPT A;  1A78 A;  4D7T A;  1YQ5 A;  1DQ4 A;  3U37 A;  4ATF A;  2C0Z A;  4K1Y A;  1W6N B;  4YG3 A;  1QJE A;  3O7O A;  2W94 A;  3CL1 A;  5FYU A;  3PVO A;  1V6O A;  5FPZ A;  5DZF A;  5JZG A;  4XUN A;  1JOP A;  1C8M 1;  1VPH A;  1ZNP A;  1MS0 A;  2AGS A;  3OEA A;  3GZA A;  4LBN A;  1CJP A;  4K3U A;  2E33 A;  4JAA A;  5DG2 A;  3VBR C;  5T50 A;  3ASI A;  3ZFF A;  5EIY B;  4YZ2 A;  3FUO A;  3M1H A;  2FDK A;  1NYW A;  1X50 A;  1OPM A;  1DGW A;  4QT6 A;  3AVS A;  1BLZ A;  5T55 A;  1WKY A;  3IIA A;  1TQ5 A;  5FJH A;  1RUD 2;  4W4Z A;  4UWD A;  4IUG A;  4FPO B;  3WDX A;  1RXF A;  3WNP A;  1W9Y A;  3N35 A;  4DY3 A;  4GAZ A;  3J8F 2;  5A6Z A;  2WC2 A;  4FTE A;  1C1F A;  5A3O A;  4LOR A;  1ZRR A;  1O4Y A;  3VHP A;  4Q4Y 3;  1VR3 A;  5A6Q A;  5CA6 A;  3CZJ A;  2GP5 A;  4CP1 A;  5F2S A;  3IDB B;  1FMD 3;  3HJR A;  4TTG A;  1CPM A;  4A42 A;  3WX5 A;  2WAO A;  1VBD 3;  4IES A;  4YW6 A;  3KB5 A;  2QJV A;  3EMR A;  4UT5 A;  4XTM A;  4CEY A;  4Y20 A;  5T5J A;  2WZP P;  2ILM A;  1KXG A;  4M01 A;  4YFZ A;  1FOD 1;  4RGK A;  1E5S A;  2BGO A;  5GLZ A;  3PVN A;  3T0D A;  4GH4 C;  2VZ1 A;  4OI4 A;  5ERL A;  1SQ4 A;  4IQP A;  1OQD A;  1WWY A;  1GOF A;  3D6E A;  4NIA A;  4S2F A;  1WCS A;  1HRV 3;  2HWD 3;  1Q8P A;  3IBM A;  5JSP A;  3O1M A;  5A7O A;  5FRE A;  1KRI A;  1U5X A;  1YLL A;  5C4W B;  4AE2 A;  2YHJ A;  4CDW A;  4ET7 A;  3IMN A;  2YBS A;  4J6G A;  4EZH A;  1MQT B;  4R8H A;  4ZON A;  5LY2 A;  3ZIW A;  1UY4 A;  4W8J A;  2BGP A;  2MHF A;  3ZFE B;  1A8M A;  1XYO A;  3JB8 A;  1HV0 A;  1T6G C;  4OMD A;  1VJ2 A;  2YPD A;  4KI5 M;  3UET A;  3PMS A;  2ZHK A;  4MHU A;  1V6J A;  3AXE A;  3C7F A;  1S2K A;  2VME A;  4S2H A;  4BH9 A;  4UF0 B;  2IXH A;  3VZK A;  2QNK A;  2QZ2 A;  4LR4 A;  4IER A;  4DXR A;  2BFU S;  5A3L A;  3GDB A;  2QDR A;  3TEY A;  4FPE A;  1LJ7 A;  1R09 2;  2JDK A;  2BPA 2;  1PO2 3;  2VGD A;  3M3Q A;  1XXN A;  3AKP A;  1RMU 3;  2RS1 3;  4MGK E;  2Y6L A;  4XF3 A;  4CCN A;  4QPG C;  4D69 A;  3OOX A;  3POB A;  3R4S A;  5GLV A;  4DRV A;  5BV6 A;  1RUJ 3;  2DU0 A;  4KBB A;  2R06 2;  5J1X A;  4NR1 A;  4WVM B;  3JBG 2;  1JTZ X;  4W65 A;  4RHV 3;  1H2L A;  3KHB A;  1EPZ A;  3B5L B;  1RB8 G;  5IVV A;  4LOT A;  2GNM A;  4GWJ A;  2IXI A;  3H8X A;  3IDA A;  3VBH A;  3GZT B;  1GQP A;  3C3V A;  1CX4 A;  4KNC A;  1W2O A;  2RDS A;  4RR3 B;  1UPS A;  1QH7 A;  5BPX A;  4EN6 B;  1UOJ A;  4DRR A;  1D4M 3;  1RGS A;  3NNF A;  5FZ6 A;  2D43 A;  4R9A A;  3ZSM A;  4YAR A;  1PGW 2;  3ABZ A;  1NCQ C;  3RNS A;  5F37 A;  5I8S A;  4ZXE A;  1NY7 1;  1MPX A;  5LK7 B;  2DUP A;  2RDQ A;  3NAP B;  3WNX A;  1F35 A;  2WO2 A;  4F3J A;  2QTW B;  4LBO A;  1PZ7 A;  1QJY 3;  4Q8K A;  3POY A;  4CUG A;  2RMU 1;  4AVB A;  1CZT A;  1MEC 1;  2XQR A;  1H0B A;  1TMF 3;  3MEP A;  3KVB A;  2VUJ A;  3LDK A;  4QB1 A;  1CD3 G;  2YGL A;  3LEG A;  3N3H A;  1O6U A;  2VQ0 A;  4H7M A;  4XDO A;  4O9E A;  5CYY A;  3VV1 A;  2WNV C;  1LEN A;  3D82 A;  1WGP A;  1PMI A;  1SHW B;  4CXW A;  5HCA A;  1JU4 A;  1CES A;  2AUY A;  5FFO C;  3LD8 A;  1PVC 3;  4C0H A;  1PIV 1;  2F4L A;  2DVB A;  1ZVF A;  2ZX3 A;  3BU7 A;  4YW3 A;  2RM2 3;  4RS5 B;  5FZ7 A;  4I0A A;  1GAN A;  1GNH A;  1TME 3;  4AVS A;  3LOI A;  2J1T A;  3KQR A;  4COW A;  3AZV A;  4I0B A;  1DGR N;  1YCI A;  2AH2 A;  3BPS A;  5GKA C;  2WZ8 A;  5IVE A;  3POF A;  4A4A A;  2LTN A;  3TOJ A;  4XQW A;  4QPI A;  4A44 A;  5JR2 A;  1HQW A;  4AFC A;  3IN9 A;  4XYX A;  4P08 A;  2DTW A;  4AVV A;  3VD7 A;  4FPG A;  2VVF A;  2WYS A;  4CDQ B;  4MGY E;  2QCS B;  4AL9 A;  4X6Q B;  5J36 A;  5DAB A;  4WZF A;  3EHK A;  4KWL A;  4DB5 A;  3W5N A;  2Q8C A;  4XHX A;  4D6R A;  4ORF A;  1SLB A;  1NLS A;  3JD7 3;  4LO6 B;  4NHM A;  1AYN 2;  2WAA A;  1VBB 3;  2PHW A;  3IZO A;  3I3Q A;  5AFB A;  2PA7 A;  1YC6 1;  1VBA 1;  2W52 A;  2J22 A;  2GU9 A;  2YDE A;  3CEW A;  3EO6 A;  3OD0 A;  2K46 A;  3ZOI A;  4XF0 A;  1PK6 A;  3WW2 A;  2RR1 2;  3LFM A;  5T5O A;  4OUE A;  3VBF C;  2JG8 B;  3GAL A;  3S5A A;  1W8U A;  2FZ1 A;  4KGQ A;  3IDE A;  1YJK A;  3QBQ A;  2WNU A;  4HOO A;  2VO5 A;  4Y1Y A;  2DF7 A;  5A1A A;  2XJV A;  2VMH A;  3NWK A;  4Y1V A;  1KGY A;  4J25 A;  4KWU A;  4FPL A;  2XLA A;  1EV1 2;  1VIW B;  1RUG 3;  5A6Y A;  3IPV A;  1UZW A;  4IE6 A;  4JGZ B;  5FMO S;  2IXC A;  1QOS A;  2ZA9 A;  4M4P A;  5C8C C;  2Y38 A;  1RUH 2;  2A3Y A;  2OUJ A;  4JGY B;  2C9A A;  3ACL A;  3ETQ A;  1Z7S 3;  3WV6 A;  2RHP A;  1PZ9 A;  4U2A A;  2EIB A;  1NE6 A;  1LOA A;  3BTX A;  3NST A;  4JKM A;  5JLV A;  3CNA A;  3VLB B;  1OOP A;  4KU8 A;  4L11 A;  5LZ6 A;  3NKG A;  5EYY A;  3E5Q A;  3MID A;  4A6S A;  3ZO0 B;  2DDU A;  5A3M A;  3FBM A;  3H8O A;  4N9I A;  1BMV 1;  5FR3 A;  4XE9 A;  4KG0 A;  5LY1 A;  4HKO A;  3MBW A;  1GZW A;  4RGA A;  2QQW A;  4M0H A;  3MLL A;  1G86 A;  4M3C B;  4GWI A;  1JUI A;  3LFI A;  3ORJ A;  2WR9 A;  4OUM A;  4OLL A;  4WVW A;  1EAH 3;  4YVS A;  5FMB A;  3RJ2 X;  2BEO A;  2NQY A;  4HKL A;  1CAV A;  3KHC A;  1KS5 A;  5J98 B;  1OFN A;  3H1Y A;  4BIF A;  2A71 A;  3AVR A;  2ZGM A;  2D40 A;  1O3S A;  1S2E A;  5FUN A;  2C26 A;  3ZXA C;  1CAW A;  1OUR A;  1WMX A;  4HET A;  2ZGP A;  4P00 B;  1JYV A;  2PHR A;  5BXX A;  1RYY A;  3OBZ A;  1COV 1;  2YFU A;  1R08 1;  2BVB A;  3LA3 A;  4YW4 A;  4CCD A;  2W1U A;  2PAK A;  4LKS A;  5FPA A;  4GA9 A;  5FZG A;  2Y6F A;  5D8A C;  2QFE A;  1BEV 3;  2NMN A;  3ZFG A;  2ZEY A;  3KV6 A;  2X29 A;  3MW4 A;  3HNB M;  4NWV A;  5EJ3 A;  3WHU A;  4NRP A;  5K0U B;  2CGP A;  1WW6 A;  1C57 A;  1RUI 3;  1AR9 1;  5FQ0 B;  3FWE A;  1GWL A;  3MLJ A;  5GLW A;  2Z42 A;  2B8M A;  5L36 A;  3H3U A;  5TSW A;  4D6S A;  2WS9 1;  3B00 A;  5IAV A;  4CUC A;  1WME A;  2AAC A;  4XUT A;  1TNR A;  4GB3 2;  5LWB A;  3AMQ A;  2NYY A;  4PDW B;  1XJA A;  1YXW A;  5T5L A;  1POV 1;  4LE4 A;  4BQ2 A;  5CFC A;  4CEW A;  1BBT 3;  2XJT A;  2P3I A;  4EV0 A;  1NXM A;  3UES A;  3BOD A;  4QX0 A;  1J3P A;  1NX9 A;  1J59 A;  1RVF 3;  2A75 A;  1XPW A;  5FUI A;  3SKJ E;  3W5M A;  4GKY A;  2A1X A;  3LDB A;  4AEJ A;  1UZV A;  1D4V B;  1QHD A;  2VZS A;  2QBX A;  4PLM A;  1YUD A;  2X5I C;  1CZS A;  4AED A;  5FZB A;  4QX7 A;  4LPL A;  4L9B A;  4GMP 1;  3VKM A;  2R30 A;  3Q8E A;  3N7K A;  4A7Z A;  4EN7 B;  3HN1 A;  1BZW A;  5KHG A;  2GC1 A;  4BDV B;  3J7L A;  4HPK B;  5LCW L;  2HEW F;  2WWS A;  3JQX A;  1O5U A;  4ITC A;  1ND2 C;  2R16 A;  3M4F A;  2MPF A;  3O0X A;  2DCT A;  3K3O A;  5DPN A;  2WIN B;  4DUW A;  1UAI A;  3VHN A;  5BNN B;  1JI6 A;  3TBD A;  1V6L A;  1ZZB A;  1X36 A;  5B4N A;  4BQY A;  4MGT A;  4GAL A;  3CJI A;  2WNO A;  3AMM A;  4MET A;  1SLC A;  5GM0 A;  4IGQ A;  1F31 A;  4FOV A;  2BER A;  1U12 A;  5HV0 A;  4YGB A;  2OQ6 A;  4BQW A;  4LO5 B;  3WIN E;  3BOW A;  1NZC A;  3KGL A;  3MFC A;  3R4U A;  3E6C C;  2VCC A;  3RZH A;  2GC3 A;  2PLV 2;  3ZSE A;  2ZAB A;  5DN2 A;  2VH9 A;  2OUH A;  5IVJ A;  1KS4 A;  2OA2 A;  4XMI A;  3H7Y A;  4F7Z A;  1UIJ A;  2VTX A;  5FRA A;  2KXL A;  4Z2A A;  4YG0 A;  4N43 B;  4AI2 A;  3GHM A;  1H8T B;  3C7G A;  2ZXQ A;  2W46 A;  1UQX A;  2VUL A;  2JIG A;  3KD4 A;  4NRM A;  2ATF A;  1BQP A;  2DVF A;  2CHH A;  3AZW A;  3PL0 A;  2W0X A;  5KC6 A;  4Q4W 2;  1N3O A;  5IK4 A;  2GC2 A;  3POS A;  4EE2 A;  3LOB A;  2EAK A;  2WT2 A;  3DN7 A;  1QMJ A;  2R0F A;  1YFX A;  2HWE 3;  1ZYB A;  2HWF 3;  1UYP A;  3M70 A;  3WF4 A;  5DZG A;  4A3Z A;  4LBJ A;  5T3N A;  4FPF A;  1LGB A;  3NVC A;  3VL8 A;  4IEP A;  1AXZ A;  2NP0 A;  4CE8 A;  4YVW B;  1LOD A;  3MPB A;  4IE0 A;  1L7R A;  1BK1 A;  4OHV A;  4EN8 B;  5EPA A;  3PVE A;  1E5R A;  3KLS A;  4OHX A;  4A41 A;  4BXF A;  5C4W C;  1QJX 3;  3PU8 A;  1MQT C;  1CAX A;  1SFY A;  2VQT A;  4LK7 A;  5IYY A;  3MIF A;  3T2P A;  3UKT A;  2VTX J;  3VZO A;  4JVA A;  2YC2 A;  3ZN6 A;  2R06 1;  4Q4Y 1;  3E5U A;  1K5M A;  2GNB A;  1Y9M A;  1UN1 A;  1K45 A;  1VBC 3;  3PU3 A;  5IW0 A;  4GIQ A;  1FMD 1;  1Y9Q A;  3DPR B;  3WP4 A;  5BNO A;  1FYU A;  3EQE A;  2JE8 A;  1GFF 2;  3AL6 A;  3HPN A;  2G9Z A;  1OA3 A;  4LE3 A;  3U4X A;  2ZEW A;  3K2O A;  5A33 B;  3HR9 A;  1DP0 A;  2E9Q A;  5A3U A;  2R04 3;  3DUI A;  4Q29 A;  2Y6G A;  5LK5 A;  4AYU A;  2Z69 A;  3UNP A;  3E6B A;  3FX3 A;  5IVC A;  4FI9 A;  3WZ1 A;  3DEM A;  1HRV 1;  1QU0 A;  4HL0 A;  4RQP A;  4E8C A;  2YC4 A;  2DVD A;  2VMD A;  2NLR A;  4V2V A;  4TLF A;  3X29 B;  3ZN5 A;  3ZX7 A;  1LRH A;  2PHT A;  3T3Y A;  2E6V A;  5E6H A;  2J1S A;  4BMB A;  3ALQ A;  2IC1 A;  5FYS A;  3WD5 A;  4OQ8 A;  2R7E B;  4ASM B;  1ASJ 3;  4BQX A;  2VTF A;  3AZY A;  4Z1V A;  5FOB B;  1BXH A;  2J1U A;  1JH5 A;  4N90 A;  3E6D A;  1MS9 A;  4C91 A;  3I2I A;  1GZ9 A;  1F9K A;  3T4H B;  1RUE 2;  3OCP A;  3BTZ A;  1JYT A;  5DG1 A;  3OYW B;  2DYC A;  3RYK A;  1L7Q A;  4NHL A;  3B3Q E;  4CDU A;  4DXT A;  5FMD A;  4HT1 T;  1GZT A;  3I7D A;  4RR3 C;  3PJY A;  4IV1 A;  3L9J T;  1AHS A;  3M2M A;  5FK8 A;  3VKF C;  1EYB A;  2VVD A;  2UY9 A;  3UT0 A;  2A6Y A;  4Y1X A;  1UF2 C;  2HEV F;  1NY7 2;  2VPV A;  1PO2 1;  1SLA A;  1XB9 A;  1H4G A;  1QEX A;  5JZG B;  4GWN A;  1XE8 A;  3ZXL A;  4XJU A;  1PX4 A;  2ZGL A;  5F5Q A;  3ZFF B;  3MV1 1;  4H7L A;  4R4Z A;  3NAP C;  3KT4 A;  3BUC A;  5JWP A;  2R07 2;  3ME2 A;  2QUO A;  1VAK A;  4DPN A;  5EJ1 B;  2VMI A;  4AFD A;  4B7E A;  1PO1 2;  1UCX A;  1QWR A;  4RGG A;  5FY8 A;  1TE1 B;  2Q8D A;  2JEC A;  4L0P A;  3E97 A;  4XPV A;  1VMH A;  5FO9 B;  2ZHN A;  5ACA 3;  2D3S A;  3DCQ A;  1DYK A;  1S0J A;  3ACF A;  3FFZ A;  4UW3 A;  4YW5 A;  5JXI A;  4Y33 A;  5BUV A;  2B42 B;  3BKZ A;  1VRH 3;  4YZ4 A;  4L2N A;  1V6M A;  1YQ6 A;  1ZM1 A;  1PIV 2;  5FO7 B;  1IPJ A;  2OPK A;  1OKO A;  2QQJ A;  4IND A;  4IXL A;  4MX3 A;  4YLZ A;  4AR2 A;  1D4M 1;  1ZBA 1;  5FCC A;  4AF9 A;  1WLW A;  1VE0 A;  5I0R A;  5FYV A;  3CU7 A;  5E1R A;  4CU6 A;  3INA A;  4L92 A;  4Y20 B;  2B39 A;  4LO8 A;  2ZS6 B;  1KIT A;  1AYN 1;  1YO8 A;  1G9B A;  5FJK A;  2XR4 A;  1V6N A;  3ZKU A;  3G7D A;  1HV1 A;  5KBF A;  3CF6 E;  1GKB A;  2BJS A;  1MS1 A;  5FYY A;  3RQ0 A;  3W58 A;  4JTN A;  4FAG A;  2RR1 1;  4IGP A;  4HSJ A;  4NPM A;  5C9A A;  2RVA A;  2WBK A;  1UKR A;  4LHK A;  1AL2 2;  4BE3 A;  4CDW B;  2TUN A;  4ZPI A;  1E5H A;  2Q8E A;  4XAE A;  5FZ1 A;  4ARY A;  2ZAC A;  4IL7 A;  4EQV A;  5JPN B;  4Z92 B;  3K4Z A;  1ZRC A;  3KMH A;  4CDQ C;  1O4T A;  3GBW A;  1AYM 1;  5FZ4 A;  1KFU L;  3GCX A;  5BNP A;  1KD7 A;  2BNN A;  4ZS3 A;  2WL1 A;  4GZ9 A;  4Q26 A;  1DQ6 A;  4K40 A;  1RUH 1;  1J58 A;  1PVC 1;  3FZ3 A;  1VBA 2;  4K6B A;  4LO4 B;  1BJQ A;  2P4E A;  4NII A;  3VBR A;  3ZR6 A;  5AC9 3;  1Y3T A;  2RM2 1;  3PUR A;  4M00 A;  4XBN A;  2W1W A;  1LOC A;  4AVT A;  1QH6 A;  4NRQ A;  4MZU A;  4LHS A;  4LIU A;  1NE4 A;  2GME A;  1SFN A;  3KS7 A;  1D2S A;  2VXR A;  2WYF A;  3D8C A;  4HON A;  4MYE A;  4TYS A;  4QQH A;  3ZYH A;  1MS4 A;  4PJY A;  2DCJ A;  2R6Q A;  2JG8 C;  3TNP B;  1LTE A;  3WG1 A;  2CYF A;  2YU1 A;  4UW5 A;  4NIG A;  1GQH A;  3LF7 A;  4QQO A;  4Z07 A;  1RHI 3;  3ZKY A;  5HXV A;  2JG9 C;  5G04 L;  5LBB A;  1T6B X;  4JGZ C;  3VD3 A;  3LSE A;  1JW6 A;  5I8Y A;  4GJZ A;  1YI7 A;  4JGY C;  3Q8C A;  4HG6 B;  5CKM A;  3U1X A;  4MV2 A;  5L19 A;  3SIT A;  1ZZ7 A;  2XKP A;  1UY0 A;  5DZE A;  5FPX A;  4FTS A;  3IAP A;  3I54 A;  2O1Q A;  5F3E A;  1VRB A;  3RYP A;  4BK5 A;  1JZ3 A;  3I2K A;  2D6N A;  2GND A;  3ROU A;  3BU0 A;  1CQ9 A;  3RMX A;  1S55 A;  3AJZ A;  3AYC A;  4I0W B;  4D6Q A;  2SLI A;  2D6M A;  4YM0 A;  2P6H A;  4LHL A;  5I0D A;  4JC1 A;  3EYP A;  2VW2 A;  4QX3 A;  4Y26 A;  2XBO 3;  5KHH A;  4X8N A;  5EZW A;  1UD1 A;  3PLQ A;  3U75 A;  4UW6 A;  1AR8 2;  3OEB A;  4XFF A;  4CU8 A;  2FDH A;  4EWA A;  4DY5 A;  2JJ6 A;  2Y8K A;  4I3G A;  4ZZ8 A;  2FZ2 A;  2C5D A;  3L2Y A;  4CP2 A;  5CIS A;  4FTB A;  3KV9 A;  3PUH A;  5L9R A;  3M8L A;  3FN9 A;  4CCL A;  4JX0 A;  2G9F A;  1COV 2;  4QDQ A;  3FL7 A;  2FDJ A;  5ISL A;  5JXJ A;  4XFC A;  4XOG A;  3ZSL A;  4H3W A;  2C24 A; 
#chains in the Genus database with same CATH homology
 4MHR A;  2FCU A;  3NNF A;  4NHY A;  2V4A A;  2JIG A;  3ITQ A;  3PL0 A;  2RDQ A;  4Q5O A;  4NAO A;  3OUH A;  5LAS A;  3GJB A;  5EP9 A;  5DAW A;  4NHX A;  3KT7 A;  4Y5T A;  5C5U A;  2FCT A;  4NMI A;  3OBZ A;  5L9V A;  4UWD A;  3NNL A;  5DAV A;  4ZPI A;  3OUJ A;  5EPA A;  3BVC A;  3GZE A;  3HQR A;  5LB6 A;  4JZR A;  2RG4 A;  4NHK A;  3DKQ A;  5DAP A;  2HBT A;  3EMR A;  2G19 A;  2Y34 A;  5M0T A;  5LAT A;  5IAX A;  5IAV A;  5HV4 A;  2Y33 A;  3NNM A;  5IAT A;  3KT1 A;  2RDR A;  5ERL A;  5A3U A;  5L9B A;  4XCA A;  4ZON A;  5DAX A;  5LBB A;  5LA9 A;  2JIJ A;  2A1X A;  4NHM A;  4XAC A;  4BQX A;  2OPW A;  4MHU A;  3OUI A;  2G1M A;  3HQU A;  2HBU A;  5LBC A;  5C5T A;  5LBE A;  4NHL A;  3W21 A;  5DAQ A;  4XAA A;  4J25 A;  4XCB A;  4Y5S A;  2RDN A;  4BQY A;  5LBF A;  4XAB A;  3MGU A;  3KT4 A;  5EQU A;  4KBZ A;  5HV0 A;  4IW3 A;  4BQW A;  2FCV A;  5L9R A;  3NNJ A;  4XC9 A;  3GJA A;  2RDS A;  3W20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...