3GZEA

Algal prolyl 4-hydroxylase complexed with zinc and (ser-pro)5 peptide substrate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
WRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKSSVVDNESGKSVDSEIRTSTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYHDGQKYEPHYDYFHDPVNAGPEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGDGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of an Algal Prolyl 4-Hydroxylase Complexed with a Proline-rich Peptide Reveals a Novel Buried Tripeptide Binding Motif
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
molecule keywords Predicted protein
total genus 69
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3gzeA01
3KT1A 5IAVA 4XAAA 4ZONA 3GZEA 5EPAA 4NHYA 5LASA 5C5UA 4Q5OA 3DKQA 5LBBA 3HQRA 3W20A 4JZRA 5EP9A 4NHMA 3HQUA 4UWDA 2RDNA 5IATA 3NNMA 2Y33A 3W21A 4Y5TA 5EQUA 5HV0A 2Y34A 5C5TA 3GJBA 2OPWA 5LATA 5DAXA 3NNJA 4NHXA 3OUJA 5M0TA 4NMIA 4BQXA 5DAVA 5LB6A 5LBFA 4XACA 4Y5SA 2JIGA 2HBTA 3BVCA 3OUIA 3MGUA 4MHUA 4XCBA 5DAQA 5LA9A 2G1MA 5L9RA 4ZPIA 2RDQA 5ERLA 3GJAA 2G19A 3ITQA 4XC9A 2HBUA 2RDRA 5HV4A 4MHRA 3KT7A 5L9BA 2FCVA 3EMRA 4XABA 5IAXA 4NHKA 5LBCA 5DAPA 2A1XA 4XCAA 4J25A 2RDSA 5DAWA 3OBZA 3NNFA 3PL0A 2V4AA 3NNLA 5LBEA 2JIJA 2RG4A 3KT4A 2FCTA 5L9VA 4IW3A 4KBZA 4BQYA 5A3UA 2FCUA 4BQWA 4NAOA 3OUHA 4NHLA
chains in the Genus database with same CATH superfamily
3Q8BA 5AC92 3V0BA 1ZVFA 3ROUA 2GP3A 3BODA 4O61A 3GZEA 4XHBA 2XMLA 1NCRB 3KMHA 4A45A 4V2VA 3VGIA 4RFRB 1C1FA 4AAPA 5C3SA 4XUTA 2PQSA 4GH4C 1VMHA 3HQRA 2ERFA 3T0BA 2HH9A 4OHWA 3B01A 4BXSV 5K0UB 1JI6A 2WL1A 3POIA 1QGLA 2ZGLA 5ABJA 5F2SA 3NJYA 2VUAA 2CV6A 1TG7A 3WP4A 4MUVA 3POFA 4FPYA 1EUTA 1JOPA 1IG0A 4IGQA 4JDNA 1RVF1 3Q9OA 4F83A 3O1MA 5D8AB 1LHUA 4WVZA 1W8HA 2E7QA 1FX5A 3IM0A 1WUVA 3N9NA 3GZUC 4WM8C 1UIJA 4QKDA 3TYJA 4WVWA 4TYSA 3N9PA 3MV01 2R041 5D8AC 1RUI3 3VBRC 3AYCA 2XH6A 4AEDB 2YZ4A 1WCKA 4BQ5A 2ZGRA 2D6LX 3UGGA 2JB8A 4FOVA 3NRUA 2VTFA 4W6YA 1IS4A 1I3HA 3IKWA 3HJRA 5T55A 2Y0OA 1KDKA 3BI3A 5C9AB 3UGFA 1W6OB 2QQMA 3ZFGA 3DEMA 2DVBA 2FZ1A 3RFRA 2DWRA 2IUWA 3BYWA 3VZMA 3PJQA 2RDQA 1TMF2 2EXKA 4XEZA 4EQVA 1XNTA 3I2GA 4IUGA 1UY1A 1O8SA 1UU4A 2D3RA 5H9SA 4FO9A 2TUNA 1LGNA 3H50A 3HIFA 4OQ8A 2WS91 5FZHA 1RB8G 3TBDA 1ZBA3 3ORJA 1Y3TA 1CZVA 4Q0SA 4YFWA 3WNMA 3ZSEA 4B4RA 3C7HA 3WDYA 1F4AA 2XB6C 5DDJ2 2WQZC 3IB3A 4JGZA 1PZ8A 3CIHA 3WDVA 2A70A 1H2NA 1RMU1 2DCJA 3ACHA 2D3PA 1SPPB 4UAPA 3ZIXA 4CEYB 4EN8B 5A1LA 4H55A 3W58A 4YARA 3DUIA 5FIXA 5BNNB 2BEOA 5JR2A 2VZ1A 4RA0A 4QPGC 5DAWA 2WDBA 4LO5B 5FMOS 4Q4Y1 1H8TB 1TNFA 1DDLA 2QE3A 2VMIA 3SNMA 4PIZA 4BDVB 1GSLA 2WNEA 4BIFA 1KQRA 4IXLA 3LDRA 1QQP3 1HRI3 1FPN1 4XMAA 4DXSA 5FLHA 2WZPP 3FFQA 1JZ4A 4BQ4A 4Q4Y2 5JPNB 1H9WA 4BQYA 4NIDA 2VOKA 2WR9A 3CHXA 4XTMA 3U0ZA 2GMEA 2K2SA 4ZU4A 1KFUL 2PELA 1W03A 3FUQA 4I0WB 2VCAA 1RHI3 2H0VA 2R32A 4P9YA 1W0OA 2VZ3A 2JDAA 2CGOA 1R1ZA 5T5PA 3SH4A 1PNFA 2RS53 4CDQC 2XQRA 2OZJA 2W46A 1PX3A 3OEBA 3A7QA 3DECA 4RS5C 2OZ6A 3FE5A 5FXWA 4CTEA 1CGPA 2VC9A 3AMMA 4LKFA 4Z1VA 3H7JA 3LFMA 4NR1A 2WJSA 4BK4A 1WZXA 4GH4B 2JKXA 3GZAA 4Q5OA 2D98A 2HWB1 2Z42A 4I3PA 3CEWA 4FOQA 3GCWA 2Y6JA 5GLUA 4CDWB 3VBOB 4Y22B 3MZHA 4LT5A 4AVAA 5LY2A 1XU1A 2YYOA 5J09A 3O7OA 4IE0A 3EJKA 1TME1 1VAKA 2R6QA 2OXBA 1UYXA 2FDJA 1MQTC 5LATA 3WVJA 1BXHA 1QMJA 2BVBA 4PF5A 3AM2A 3GXUA 1KJLA 1DQ0A 3I2HA 2YBSA 1GKBA 1UOBA 2WO2A 1CIWA 3LEIA 4CA9A 4WM8B 4BQ1A 4YVSC 5FV3A 2E9QA 4DO0A 1A34A 5F39A 4XIOA 4QPIA 3JD73 2CHHA 2MEV1 4P9WA 4CP0A 4DY3A 2PAEA 3BVCA 4LR4A 5C71A 1BEV1 1D4M2 3T4HB 1TVGA 5LA9A 1RITA 2OQ7A 1ENQA 1JOJA 1UMHA 2V09A 3AFKA 3OB8A 4EV0A 5GALA 5DG2A 1W9YA 3J26N 1KD7A 2VZVA 1PMIA 3RYPA 1WGPA 5FBJA 2XUEA 4GMP0 2JICA 1UY4A 2E51A 1V9U2 3FUOA 3OGVA 2A6ZA 4GALA 1LHOA 4FI9A 4M4PA 4CCJA 4X6QB 4D7YA 4GMP3 2W92A 1REDA 5J96B 2J42A 1U5XA 3H3ZA 3CMGA 1Y43B 3K4DA 1RUH3 5TSWA 3B02A 5K0UA 4YM3A 2DUPA 2Q1ZB 4CU7A 3DKWA 2HWE1 4LIUA 1FAYA 5A1AA 2WNOA 3IDEA 3LPGA 4XF4A 2VZUA 3GBWA 4BMEA 4XABA 1L7RA 4BHPA 1U0AA 3O0WA 1BLZA 4MGIE 5DAPA 2AEYA 4P9XA 2BBAA 4LKSA 5A3LA 5BY5A 3H1MA 3RJRA 4EE2A 1NUKA 1VBD1 2GAUA 4Z2AA 3PVEA 1WKYA 1QXRA 1TNRA 2WO7A 3NNLA 4UFJA 5IVFA 2ARBA 4C0HA 4OZXA 1LENA 4CDUA 2E7TA 2BPA2 2QDNA 3DPRB 3IN9A 4ES9A 1OQ1A 4YSFA 1U12A 5BYNA 5C4WC 2XHKA 1I5ZA 3O5SA 1RUJ3 4OI1A 1TMF3 5G05L 2R16A 2BOIA 1DYOA 1DHKB 4IE4A 3RYKA 2HWF2 4QD2A 4AVVA 1OMIA 2PLV2 3HWJA 1LOAA 1AR73 4W4ZA 5T52A 1FI2A 1UPSA 2OVUA 1CAWB 5T54A 4XFBA 3VDCA 1G86A 2YBKA 3CL1A 5F7UA 3AL5A 5HCHA 2WNVA 1ZREA 3RZGA 1V70A 2YU1A 4FTBA 1AVBA 1V6KA 3KT1A 1LEDA 2VUDA 4H3WA 1CR7A 1NYWA 4LKDA 2XJQA 2VO5A 1ZZ9A 1PO22 5FBZA 5FTTC 5FY1A 1OPOA 1OLME 1YFXA 2WNUB 3GF6A 3VBSB 1T6GC 3PVBB 2HWC3 5LBBA 5ACA3 4LKEA 4RGKA 1ND3B 4YVWB 3K3OA 4LA2A 4AGRA 2FDHA 4W8JA 5FZCA 1TEIA 3O0VA 5A7WB 4AR2A 1B09A 1PHMA 1UY0A 4CRQA 3TRSB 4H14A 1PO21 1UY2A 1RUF2 3ILNA 4OHXA 5C3QA 1JYCA 3H0OA 2OPWA 3VV1A 3J8F1 2QFEA 3O0XA 3VBUC 1ZRRA 4OZOA 1GWMA 2HLEA 1XU2A 2HWD1 3NWKA 1GUIA 2E31A 4XOGA 1RUF1 3AP7A 4D94A 1G9DA 3HNYM 1C5IA 1X9TA 2JG8C 5JCTA 3ZYFA 1N47A 2L9LA 4ZZ8A 1F35A 3K46A 1AR91 4GKYA 3THTA 4O65A 4TTGA 3KWVA 5FMBA 1VR3A 4Z8BA 3IZOA 4FAGA 2R49A 4JHZA 1J3RA 1QHDA 3U1XA 3RI8A 4XFIA 3SCGA 3IWZA 4YW6A 2XVLA 3LQCA 2RM21 5FPBA 4XJAA 2GC0A 1UMZA 3B5LB 1HQLA 3O1VA 3PHMA 2YDEA 2YY1A 4IEYA 1OKQA 3PTRB 4AHZA 1ZBA2 4N7IA 5A7PA 3DXTA 3KZ4C 1QIQA 2CU5A 4QM8A 4AFAA 2DVAA 3AKPA 3QCWA 4MGQA 4Y1ZA 4D6QA 3WZ1A 5IVEA 1XSQA 3MV11 4ZS2A 3ACIA 3VBHB 2JD9A 4LE3A 1C8M2 1BMV2 3GNEA 4Q4W1 1PGW2 4Q27A 2CL2A 3UETA 1Z7S1 2VMFA 4H2AA 3C7FA 2VOWA 1RHI2 1JODA 3OPWA 3H3UA 2XBO2 3ZYBA 3HBZA 5A70A 3R4DB 1NY72 3WCRA 1VRH2 5FPLA 4J25A 5F9TA 4M4RA 4ZS3A 4IE5A 2PAKA 4QQ2A 4WM7C 1MS8A 4QHZA 1LNSA 2VCCA 1YFUA 3WP6A 1PVC1 2D5HA 4D69A 2AC1A 2XBO1 3LKJA 2EVXA 2IVIB 2VZRA 2GC1A 4KWLA 1K5JA 1SMVA 1WWYA 3PJYA 4CYDA 2MNGA 1VRH1 4HKOA 4CSWA 3T1MA 3ZFEC 1YNAA 3VUOA 2A75A 2GALA 4AYUA 5JI9A 2A6XA 1PVC3 1NE4A 2UY8A 4IETA 5A3MA 5FQ0A 2WSUA 5JOYA 5E6HA 1IS3A 1NG0A 3RMXA 5CISA 4M3CB 4E4SA 2CDOA 2QQJA 1LULA 4CUCA 5A3UA 2DURA 2ARXA 1HN1A 3WV6A 1QJY1 5DDJ3 5GJ6A 4NAOA 5A3WA 4COWA 3POYA 5F3CA 2W52A 2FMYA 2PHXA 5FPVA 3DPRC 4IERA 3R6SA 1D0GA 5CFCB 1Z7S3 4UW3A 2P3JA 1RUOA 2QUOA 3EHKA 1SLLA 2Q1FA 1H1MA 4INDA 4RR3C 1NCRC 3UESA 4C90A 5EPAA 1YCIA 1QJY2 1SLIA 4K1ZA 5LK7B 3GBFA 2J1VA 3UL2A 1FT9A 4XHXA 3VDAA 2XUMA 4R9BA 4UW6A 2VQTA 4PHZA 2J22A 3BCWA 4JZRA 4NHMA 5FUNA 2PXJA 2KD7A 3GM8A 4LOSA 1V6NA 4AL9A 2OUJA 5FZAA 2Y33A 1FMD2 4Y3OA 4Y5TA 4ASMB 2N7GA 3CJIC 5HV0A 2VVEA 3KVBA 3CNAA 2ZPXA 4AFCA 4KI5M 5F3EA 5EYXA 5T5JA 1UKRA 2XJVA 2XJSA 3SHRA 4NHXA 3B9IA 4YW2A 2YU2A 2GMMA 3WW3A 1ONAA 4QAWA 2ES3A 5L7OC 1O8PA 2XLAA 1STMA 3ZSMA 4MXVA 1EUUA 4TSVA 4ZKTB 4UW5A 4ATFA 3WY6A 2DUQA 3Q8EA 2AYHA 4TWTA 3IBMA 3MIHA 5EJ1B 2QQWA 1MS5A 1D0HA 1UXXX 1MPXA 1X50A 1D4M3 2RS11 1AR63 1C8NA 1RUC1 1UZ0A 3E5XA 2ZGUA 2NM1A 5HXMA 3KGLA 1F8VA 1IPJA 4KGQA 4N90A 3NO8A 1PX4A 5FUIA 4PIYA 1IGOA 1CJPA 1HQWA 2DDUA 3Q8FA 5FY8A 5LRSA 1OI6A 4L2NA 4PQ9A 2JE7A 1RJ8A 4OI4A 3B3QE 5CFDA 3ITQA 5H9PA 4QXBA 4DIQA 1L7LA 5FY9A 3S0MA 4BJ0A 1G9AA 1FXZA 1BZWA 4L9BA 1LHNA 4QDSA 3KT7A 4E8CA 1AZDA 4XDQA 3GZTB 1MQTB 3N9LA 3ZFFB 2AZ5A 4P5YA 4JGZB 1Y4WA 2XHNA 3MYXA 3TEXA 3UK9A 1KGYA 2JECA 4N9IA 2G9GA 4P00B 5JDBA 4A4AA 3H1WA 5GLTA 5FPUA 5A6QA 3O1UA 2LALA 3M3EA 1QOSA 5CFCA 4QPGA 1XSRA 2JDNA 1C57A 2JE9A 2RR13 4GXLA 1GNZA 1QJU2 4YGEA 4XF3A 4LHSA 3OBZA 1AXKA 1CQ9A 1CN1A 3HD8B 1AL21 4M0NA 5AC91 2O14A 1VBB2 4COYA 4IEOA 5CKQA 2P2KA 3ZR5A 2GH8A 2VW2A 4NPMA 3LB9A 2EIBA 3AK0A 1WCUA 4K40A 4YW4A 1K5MA 1LHVA 4XUQA 1W9TA 1OQEA 2BFUL 4FQ4A 4YM0A 4OHZA 1WMEA 4XUPA 4AHYA 4Z82A 4FPFA 1S4CA 4UI9L 2WN2A 1RUF3 5KHJA 3O1SA 1H8VA 2XQXA 2WQ4A 3LEKA 2Q30A 3MF6A 4XPVA 1CAVA 4Q26A 1AR81 4CDUC 2RJLA 4FTSA 1W6QA 2ZGPA 3IAQA 2UU8A 4DXZA 3S57A 3OUHA 2RMU2 4YW1A 3ZO0B 1ENSA 5JVVA 1DZQA 2P34A 1QH6A 3AP9A 3H8OA 1UU6A 4ATEA 3QH6A 3ACLA 1RUH1 4HVQA 3PUQA 2BTVC 5IAVA 4XAAA 3M3OA 5C4WA 3E5UA 2OQ6A 1H30A 3MIGA 4IEQA 1URXA 4LLOA 4PBPA 1UX7A 1WW6A 3GHNA 3VBOA 3FHQA 1H9PA 4Y33A 4QDRA 3W20A 2HEYF 1NXMA 2GN3A 2JENA 2XXZA 3A21A 4CCMA 4V1PA 3HQUA 3MHZA 2HWF3 4DRVA 1AR83 4AEMA 3NJZA 2BW8A 2PAMA 1EAH3 2QQKA 2P17A 4RR3B 4CU9A 4QGMA 5ANNA 1X9PA 1AHSA 4HBNA 3ELNA 1ZYBA 3QD6A 4KG0A 4P14A 2VTXA 3BUCA 2C5DA 5DG1A 5C4WB 1PO12 2DCZA 1ALYA 4AGGA 2VJXA 1F15A 2XOMA 2AH2A 3QLQA 5FCCA 3S30A 5ISLA 2ZGSA 3TN93 1RJ7A 4B3NA 1W8WA 4FFFA 1OD5A 1OQDA 2X5IB 3VZOA 5IFPA 5HCAA 1DQ6A 2PFWA 2YFZA 3LA3A 4WVMA 4MSVA 3ZR6A 4EZ4A 5K9YA 5JPMB 1I6XA 5DUUA 2W91A 3N9QA 5FZEA 1GNHA 4CCNA 4LUKA 5FMCA 2BNMA 1W3VA 2JKBA 4XCBA 3I59B 4OFGA 4DUWA 1R081 3SMHA 3FZ3A 1LESA 4GWJA 2V5YA 3J7LA 5FY0A 4CDQA 4PI2A 3H8RA 4IV3C 4DEVA 1BK0A 2W5FA 2HKXA 5L9RA 4P9GA 4ZPIA 2H6BA 2DU0A 3TOJA 1N3QA 5ERLA 2R1BA 2G9FA 4MH0E 3LDBA 1RUE3 1SPPA 1DGWX 5FJHA 4AFBA 4WV8A 4R4XA 1YWKA 3G6JB 4KQ7A 2XL7A 5D8AA 1KDMA 3VBOC 4ZZ5A 1UYZA 4YZ4A 5GZEA 3WG1A 4QDQA 4WVVA 1ENXA 2LW8A 2P1BA 3BIEA 3OGRA 2VXRA 2RS51 3AB0A 4E9KA 3Q8AA 4RGAA 2CTVA 1NX9A 4J1XA 4UFMA 2Y6GA 5FAXA 3ZN6A 1PVXA 3IIAA 3UKTA 4FCAA 1ZBE2 4XUOA 1S55A 2A1XA 1HB4A 3PU8A 4GJZA 4OLLA 1GR3A 1SLBA 2DV9A 1S0EA 2EALA 4IE6A 2BZDA 1CONA 4NROA 5GZDA 2UWAA 2PA7A 3NKTA 3ZDSA 5FPZA 3AZXA 3ZMOA 4XURA 4QPIB 1IG3A 3MUY1 1IS5A 4DS0A 1XYOA 1O4ZA 2O0OA 2Y0IA 1NA1A 5IK5A 3DF0A 4NAMA 2JDHA 2ZMLA 4QX3A 3WQBA 4YZ5A 3T2TA 2HWB2 3HN1A 1OA4A 4IEVA 2XPJA 1UAIA 2AEZA 1XB9A 3N7KA 2R1DA 5FWEA 3OY8A 4KBZA 2W39A 4XJ8A 4W6WA 1NOVA 4DINB 5JSOA 4RYDA 2O8OA 3I7DA 1YHFA 4NIIA 1MR5A 1NCQA 1PK6B 2J1UA 4HOOA 4Q0UA 4TXWA 2YUEA 2X29A 4Y4YA 3ZFEA 4N8MA 2K0GA 2WN3A 2IXJA 1OOPB 3PDQA 3WF1A 4CVUA 3B94A 2WT0A 2ADEA 4A41A 2K9ZA 5EFUA 2GN7A 4RHV3 1WMDA 2EA7A 1AXZA 1QJFA 2VMCA 3KHCA 3LWCA 3BTAA 1ND2B 1QH7A 1WCQA 2B4KA 3MW2A 3BOWA 3LFIA 3WNOA 5IVJA 1JYIA 1DIWA 5CKMA 3ZOIA 2RMU3 1V9U3 4BZ4A 1OLMA 3V0BB 5B2GB 5EP9A 1BQPA 1EPZA 3KVAA 3HBKA 5BNPC 4Q1RA 1F5FA 4GMP1 2D97A 3JQXA 4QKFA 3T2QA 1W6MA 5EQUA 4PLMA 5C8CA 5FZBA 1UF2C 2OT7A 1RUG3 2PHRA 2XVKA 2Y34A 3H9AA 1LAJA 1C1LA 2CSGA 5F5CA 4MYEA 1U5YA 3THDA 3MDPA 5CFCC 4AFDA 1HRI2 2VE1A 3KCYA 4HN0A 3JD72 3X29B 4KWUA 3BTYA 2JJ6A 2VUJA 3ZKUA 3BALA 5M0TA 1ENRA 5FPAA 4AEKA 3HPNA 4HLTA 3IPVB 5DZFA 1QOTA 4IE7A 4E2QA 2XL9A 2ID4A 2YXSA 2BQPA 3LEGA 4AEJA 3RWNA 1PGL2 1V6OA 1HRI1 1LOEA 1YI9A 2BGOA 1GQPA 4FFGA 3W5MA 4BCUA 2BP6A 2WINB 1WW7A 4XVHA 1JH5A 5FZFA 1K3IA 4LMFA 4YWAA 2ENRA 3NNGA 3VD4A 4E8DA 1SDWA 1MEC2 3O1TA 2XKPA 5FLJA 4KU7A 4Y1VA 2BERA 4IDZA 3MO4A 1V6JA 3KSCA 1J1LA 1QJX1 2FBEA 3DYOA 3AMNA 5F3GA 4FPEA 5B4XA 3EB7A 3B7MA 3M70A 4AHWA 1DU3D 5I0DA 4HVOA 4DOUA 1CWPA 4J6GA 3NVCA 2I2SA 1QDCA 1D4VB 3DCQA 4KWJA 4PI0A 4COVA 4DQAA 1F9KA 1S2BA 1W05A 2WZR2 3D0SA 3R05A 4RR3A 2B7YA 4NIAA 3TNPB 3VZNA 5BNNA 4WBBA 2VW0A 2WT1A 5IW0A 4FPGA 2A71A 3UJOA 4B7EA 4ZU7A 4FXKB 2JG9B 4KWKA 5FP3A 1RMU2 3IDBB 3UKNA 1O3QA 2IXHA 4HANA 2A6WA 4Q1PA 3SKVA 1CESA 2D6NA 4CXYA 2DVDA 5F32A 2ETEA 1KS5A 4XZPA 3T4VA 3U4SA 5F5AA 3RPQA 4CUAA 3E6CC 2W0XA 3ECQA 1K12A 2BDRA 1ASJ2 3OBRA 4OHYA 3VKOA 1QJZA 3L2YA 2JDZA 4PT6A 1N1YA 1OBNA 4HZFA 5FZOA 3VDDC 2OA2A 3WR0A 3THCA 2YFUA 4BQ2A 4HONA 1VBE3 2RG4A 3J8F3 1Q8QA 4OHVA 2JG9A 2ZMNA 3CKHA 4I09A 3RVHA 2BWCA 3D6EA 2ATFA 1BEV3 1VPHA 1REEA 1HXS1 3LDKA 1TE1B 2NMNA 3J8F2 1S2EA 3C2UA 1BJQA 1H2MA 3OYWA 3MIEA 1UKGA 1S0JA 2WFPA 3GYDA 5AC93 2WSVA 3T2PA 5FREA 3P6BA 5LASA 5GZGA 3K48A 2QQUA 4K8RB 5FYHA 1YQ6A 4FTEA 3NV4A 4Y20A 4DRRA 4D6RA 1WLTA 3E1F1 3T0DA 1EYBA 1RXGA 3T2OA 4MGZE 3POJA 4RS5B 1H1IA 1Z78A 2X09A 5GZFA 4BE3A 2R0FA 2VCMA 2RM23 5C5TA 4BH9A 4IV3A 1EV11 1TME2 4N43B 4Q0PA 2ZKLA 2LROA 1W6OA 1CAUA 2DBNA 4YLZA 3LEMA 4EN6B 5KXCA 1RUI2 1OUXA 3FLPA 2RE9A 3E5QA 4JAAA 4GZ9A 1AR61 2FHRA 5FZIA 4NMIA 4PCRA 4GQ7A 3WDUA 3ZFGC 2NN8A 3PMSA 1YRZA 2D6MA 4IEXA 4Q4W2 4UW4A 1W2AX 5FXVA 3BTXA 4NIGA 5GZCA 1NCQB 1PK6A 3KB5A 3F2ZA 4DPNA 2EF6A 5A80A 4EYUA 2GNMA 3KD4A 4XF0A 3U07A 2B9VA 2X05A 4QB2A 4QPIC 1BEV2 1W0PA 2WNVC 3BPZA 1UZVA 4UFKA 2GDFA 1W9SA 4XQDA 3WUDA 4CDWA 1GQGA 2RJKA 5FZ8A 2ZACA 2VG9A 3W9AA 1W0NA 1W6PB 1CX4A 1YJLA 4OMDA 3ZMNA 2XWBB 5D21A 3C7EA 3NSTA 1YC61 2NP0A 1GP4A 1V9U1 1ZRIA 3S5AA 1RUD2 1VLNA 2EXJA 4FFHA 4UFIA 3T0AA 2VNGA 1XE8A 4MHRA 1ZNPA 5DQ0A 3ZSKA 3DYMA 1OH4A 4CDQB 2A6YA 2NZ9A 4XXAA 3RZJA 3POWA 3BOPA 2IXIA 3OGJA 2FCVA 4CUBA 1J3PA 3N7JA 4LBLA 1FV2A 3VHPA 1ZRCA 1POV1 4PBOA 1PIV2 1PM4A 3IDAA 4RQPB 4QHBA 4WZCA 4V2WA 4F7ZA 1VBD2 1YI7A 3S5QA 3DPRA 3ZXLA 2E32A 4LO6B 3S7EA 3IMMA 2VQ0A 3HR9A 3NNFA 5ANQA 3FJSA 5AVAA 5CB7A 2DCYA 4JGYB 2WLQA 1ST8A 2DTWA 2IC1A 1WLWA 2V72A 3NAPC 4XDOA 1CIYA 5FYTA 1HRV2 2R062 5F5QA 1DCSA 4AI9A 4RL7A 1OFSA 2FCTA 4QXCA 3JBG1 1VRH3 2FDIA 5L7OB 3HEIA 1HX6A 1XYNA 4KBBA 1V6MA 4Y5Z0 4ZXKA 1Z0HA 4NWWA 1SCRA 1UU5A 4YRDA 2ZHMA 5E1RA 3UKVA 2WABA 4ISQA 2QNKA 2ZHLA 3ZSLA 4LO7A 5IHRA 3RGBA 4NPLA 4K8FA 3ZXGA 5FP7A 3JBG2 4JHTA 1C8M3 1QEXA 4NHLA 1W8NA 2KM2A 4HPKB 5LEJA 1UD1A 4FBFA 3POGA 2VMDA 1A3KA 3H1YA 1CPMA 4A44A 1W2NA 4E4DX 3RZKA 2YPJA 2J1AA 5BNNC 1MZEA 3I3DA 4AQTA 3AKRA 4RQPC 3PLQA 1SBFA 3RJ2X 4YGCA 2W1WA 5BUVA 3ZVXA 4LK6A 5A32A 1FOD2 2YC0A 3J7NA 4JDOA 4JTOA 2YG0A 3USUA 2KXLA 2X10A 4M3CA 2LM3A 2ET1A 3ZFFC 1Q56A 1JZ5A 2UWBA 4FPKA 2PHDA 2WWJA 4JRAA 5I0SA 1BBT2 4SBVA 1E5RA 1SLAA 1UX6A 2CYFA 2WLPA 3ETPA 2D43A 5EJ3A 5T50A 4E4HA 1ZZBA 5FZGA 3M3QA 4COZA 3VL8A 3WW1A 1POV0 3P3PA 2UYBA 3OTFA 3U10A 4JKMA 4A7ZA 3I8TA 4ES8A 5J36A 3IMNA 3WF3A 1LEMA 1ZA4A 3VZJA 1GZ9A 2WA3A 2OKXA 4MGTA 2HBTA 2WFF2 1NE6A 4M0HA 1DYPA 4TLFA 4YW7A 2IZWA 5GM0A 3HAGA 1YFWA 4YZ1A 3CQOA 5BNOB 1N1SA 2ZBJA 1JYWA 5T3NA 2C1FA 3EYPA 3LGRA 3SISA 3WD5A 5JXJA 3J7MA 3ZFGB 1GICA 3LSDA 3OCPA 2HWC2 1ZBA1 4KH9A 2HWB3 3D82A 2G19A 1GLHA 1WBLA 3I3EA 2JDYA 3PTYA 4NWVA 3WSOA 2VMHA 5KXDA 3LZZA 5JZGB 3MIDA 2J1RA 5I0UA 1JHJA 5JOXA 5LA1A 4P5HA 4QB6A 3WQ1A 4HKWA 4OI0A 1RVF2 1J3QA 3M2MA 5FY7A 5A7OA 4AI8A 3D8CA 2ZGKA 4CPBD 1YQ2A 4R9CA 1AR82 1XRUA 1V0AA 1O3TA 2I45A 4QPYA 5H9QA 5IAXA 3VBFC 5EHDA 5FZMA 5ACA1 3N36A 4A6OA 1NY71 5FZKA 1SFNA 1XJAA 4QX5A 4W50A 1H0BA 2VZTA 5DZGA 2E6VA 5EYYA 3U11A 1LECA 5KHIA 2W2IA 4Q0VA 2A5ZA 4YGDA 5IWFA 3TN92 3VN4A 5KHKA 4GJYA 2Q8EA 2CWSA 5FPXA 2ET7A 1GZTA 5DABA 4FOWA 4B1MA 4XDPA 2G4IA 4QQHA 1H2LA 2DVGA 1W8ZA 3OF1A 2ZAAA 5CKNA 1VAVA 4DUXA 1EP0A 3TN91 1XNAA 4K1YA 5EWSA 3I3MA 2VNRA 2WS92 1VP6A 5EZWA 1QNWA 4N43A 2E33A 3K4AA 4GB31 4OUMA 4JCKA 2D44A 3CU7A 4LO8A 4BQWA 3IIIA 1YIPA 4FP2A 3CO2A 5CVRA 1KXGA 4CCOA 4C0BA 3S7IA 3ETQA 1W28A 1GFF2 3LAGA 4HK9A 3BPSA 2V73A 5JSPA 1M06G 1LR5A 1GNYA 4M3CE 3LA7A 2HJIA 2RHPA 5CEHA 3I2KA 1VBD3 4HKLA 5JIUA 2VQAA 2R7EB 3VBRA 4A6SA 1A8DA 1JXNA 5C3PA 3LD8A 4XUNA 1OA3A 3GGLA 5C5UA 4XJUA 3M4FA 4LTAA 4QT6A 2P3IA 4HETA 3SEPA 1OVPA 1DGLA 1R082 1NKGA 3NNMA 1ULFA 5CBLA 1SQ4A 2SBAA 4XTPA 1KJRA 1W6NB 1CVNA 3AC0A 2BJSA 5FO7B 4X8PA 3I2DA 1C28A 3AYDA 2NYYA 2ZCWA 2B45X 4PLOA 5ABJC 3C8XA 4D8MA 1GP6A 3TNQA 1CZSA 1XQNA 2XLFA 4AQSA 5L36A 4YM2A 1W3XA 2VTXJ 1OT5A 2YROA 1XE0A 3KM5A 4S2DA 1DP0A 4BQXA 1JZ3A 1JW6A 3SLIA 2JG8A 1GOGA 5IYYA 4UFLA 4Q8LA 2FQPA 1NQJA 5L7OA 4YYOA 3R0RA 1H2KA 2WQ8A 3AJYA 4LHKA 4IEUA 3TWIA 4CDXC 1O5LA 2ZEZA 5LW9A 1QXPA 2BGPA 2W95A 5G04L 3TEZA 1GP5A 2V5DA 5IK7A 2VZPA 1LOFC 1ULDA 1W8FA 1IKQA 1PZ9A 1IKPA 3NKGA 1N3OA 3J4UH 3I2OA 1O59A 4JGYA 3INAA 2XONA 2VVDA 2NMOA 2RR11 2VOTA 3KCXA 4LEJA 1QJX3 1JHNA 5C3OA 4OYUA 3SITA 5A3TA 4YZ3A 1WD4A 1VBB3 4YZ2A 1X82A 2NPIA 5A3PA 4N43C 1YUDA 1JN2P 1ULPA 4QM9A 4Y24A 4Y1UA 5LA2A 4RGGA 1CAXB 2Y6FA 3CLPA 3AXEA 3WDXA 1WLDA 2Y64A 4NPRA 2P37A 1JMUB 2DCTA 3EMRA 4JC1A 5FP4A 1FNYA 1DFQA 3SH3A 5F6KA 4H7MA 5GLWA 2GU9A 5C33A 5HXVA 3LOIA 4AF9A 3MIBA 1O3RA 2MEV2 3IPVA 2D40A 5GKAC 3ILRA 1K5MB 2K46A 4W65A 3VBRB 4XE9A 1O7FA 2ZOEB 2V4AA 4XIKA 2RVAA 2ZX1A 1HV1A 4LBQD 1MZ6A 2HWD3 5FXXA 3ZX7A 1DLLA 1UY3A 1BYHA 1Q5OA 3ALQA 3NJVA 3NAPA 3PIJA 5IVBA 2R043 1JUHA 1XOYA 3GALA 4L99A 4C91A 2VR4A 5J37A 4CCCA 5I0RA 1T6BX 4RQPA 4M00A 2J1TA 1LCLA 5FOJB 1X7NA 3U14A 2Q4SA 2B39A 4DEQA 3APBA 3I2JA 2FCUA 4HK8A 5J48A 1XYPA 1NLRA 1AUYA 1X8MA 4LBNA 3TAYA 2R042 4EWAA 1SFYA 4KGGA 1D2SA 4LJHA 4UXAA 4AQ2A 2VMEA 2RMU1 2HWE2 1OKOA 1RC6A 2A3XA 2OUHA 2R073 3MW4A 3OOXA 3ES1A 4Q4W3 4GA9A 2EIDA 3ILFA 1YO8A 1GANA 2ARCA 4QXKA 3JCIA 3V0AB 2BGCA 3VD5A 2BBVA 4CDWC 1PGL1 1VBC2 1Q8VA 2ILMA 2YHJA 3AVSA 3JQWA 3U78A 3SEEA 2BUKA 4BU2A 5C7GA 2RV9A 1O91A 1NLSA 2AR6A 4Z07A 2WA4A 5K0UC 5FMOL 4RSUA 1VBC1 4O9GA 3EO6A 1QF3A 4HSLA 4IEZA 4JX0A 5C8WA 3AZYA 3OD0A 2FDGA 4CE8A 3THPA 2OPKA 4YPJA 4MV2A 5IVCA 4EROA 4LNVA 1LRHA 4FP3A 2VXJA 3MIFA 3POBA 1QJX2 2QVSB 5JZGA 3HT1A 1J58A 3KV6A 1QJY3 4XF9A 5DDJ1 4DXTA 1PK6C 3RZMA 2QQNA 4P9LA 5IK8A 4LBMA 4BLJA 2XVGA 3BU0A 3ZXDA 1ND2A 4HL0A 1VALA 3UV9A 4HG6B 5LB6A 4ARXA 4XACA 4XFHA 3WOGA 3EBRA 1GV9A 4XBNA 2W9XA 3WF4A 4JV4A 4N53C 4XJWA 4XFFA 4LUMA 5DAQA 4AVSA 1ZZ6A 4WVMB 2ZX4A 4HN1A 3AKTA 3VD3A 4MG2A 4EN9B 5FQ0B 2GNTA 3PVOA 1ACCA 1JU3A 3PVNA 3AJZA 5DXDA 5FZ7A 2VECA 3WUCA 1FATA 2MPFA 1DG6A 2C9AA 1ZRDA 4QPWA 1YYNA 1DQ4A 2DTYA 3AKSA 4XJZA 1QQP1 1RINA 3O1OA 2D6PA 2Z69A 4KL1A 1RUNA 4XFAA 2HBUA 3PUAA 1O4TA 1WMXA 1L7QA 3CJIA 4IEWA 4ONUA 4PIXA 2ORXA 4ZU5A 5LZ6A 4AQ6A 1COV2 1W8OA 4QQOA 3DYPA 4LA3A 1QY4A 2ZTNA 1F2NA 3MEPA 3VBHA 1W90A 5FYVA 2BV4A 1W6NA 1W9FA 4GH4A 1M4WA 2NLRA 5LK5A 1OXCA 3CJXA 4LQRA 3O14A 1RGSA 5AFEA 4NHKA 3K4ZA 2IXCA 3MPPG 2PHTA 4LPLA 3K77A 4RHV1 1BVVA 4Y1YA 4BISA 2EAAA 3N7LA 1H4HA 3BIWE 3I59A 1W9WA 4ISRA 1GU3A 5IJRA 4BYYA 1E5IA 1WW5A 3B9CA 3D4KA 3POEA 4GIQA 4COUA 1HRV3 5F5IA 4D7SA 3AP4A 4AEDA 2CY6A 1UYPA 3G7DA 5FK7A 3T3YA 2JDMA 3U4XA 5HBAA 2VY0A 4RHV2 1NLQA 2BNNA 1UNBA 1UQXA 4FOYA 2D7FA 1BKZA 3KF5A 1NA1B 3ACGA 4EWEA 2J1EA 5EJZB 2WYFA 4E2GA 4I01A 2WKKA 3VBFB 2X5IC 1E5HA 3OG2A 4AAXA 1TZOA 2SLIA 5JI7A 4F8AA 2QZ2A 1BMV1 1POQA 4JGZC 4W6XA 5I8TA 2RS32 3RS6A 4AOCA 2DFCA 3A0NA 1AL0G 4AXOA 1COV3 3RSJA 2UYAA 1S0DA 5SV5A 1H1AA 4QU2A 4ZONA 2J7MA 5F37A 1RUD3 4EN0A 5FOBB 4R9DA 3E6DA 4NHYA 3ME2A 3WCSA 3VHNA 1UZWA 3ON7A 5JOZA 3LF7A 3VKLA 5DMYA 4UOJA 3WNXA 3ASIA 3T30A 3W21A 4IV1B 2EIGA 4NE9A 5C9AC 3W59A 2DUOA 4BM8A 2DF7A 4JTNA 4F3JA 4IL7A 1R083 5AFBA 5F8PA 1CPNA 1RYYA 4PQQA 4QMAA 2LTNA 5FYIA 3BN6A 1RUD1 1MS0A 4I3GA 2WC2A 3ZN4A 1AJOA 1VBA3 2JB4A 1AL23 3VLBB 4NUBA 3ZLIA 4E27A 2MEV3 1EPWA 2E7AA 4Q4X2 3V56A 1X8EA 3DV8A 4FPOB 3FLTA 4Y1XA 4LOTA 4YW3A 5FXZA 5BNOA 1VBA1 2HYXA 4MHUA 1PIV1 5J98B 4MADA 1KEXA 4FPJA 2JDKA 4Y26A 3MUZ1 1AYN2 1F4HA 1X36A 5IVYA 1I9RA 1IQAA 2ZABA 3AXDA 5CU1A 4LBQB 1Y9GA 3POSA 3SKJE 1W6MB 1CD3G 1VBA2 1NAEA 2B8MA 2QQVA 5FFOC 5C8CB 2EIEA 3FLRA 4SLIA 5JSRA 5BNPA 3ZXEA 3LIGA 4CP2A 2R0HA 3LCPA 1O3SA 4JVAA 1JTZX 2HWF1 2RDRA 1RXFA 5FUPA 1S0BA 5CYYA 3VL9A 4G4FA 3ZN5A 1QXJA 1GZWB 1QWRA 1L3JA 3K3NA 3USUB 1YQ8A 2HWE3 2R072 3GDBA 4K7JA 4LIVA 3KQ4B 4YNIA 4X8NA 4AFMA 5FZ4A 1ZZ8A 2E53A 3WG3A 3N9MA 5A3OA 3DL3A 1QJEA 3CZJA 1WCDJ 1ND2C 1O4YA 3NL1A 3I2FA 4B8EA 1LTEA 2F4PA 1CZTA 3AMHA 4CEWB 2ZGQA 5LBCA 3N9OA 1DLCA 4QX0A 3SQOA 3N4MA 1MVQA 2VZQA 1ZZ7A 3ZDVA 5FZ3A 2R071 1RUE1 5KR7A 4QX2A 1LODA 3ZYIB 1UOJA 1HLCA 1V6LA 1WBFA 3T09A 1HB2A 4MGYE 1AX1A 1C5HA 4CDUB 4E2SA 4I0BA 3PL0A 1HXS3 2JD4A 3MLLA 4MX3A 4PDWC 4XW3A 4CPBA 5I8YA 3GCXA 1X33A 3JBG3 1CJDA 1QNYA 2FZ2A 1ASJ3 5LBEA 4N7UA 3NV3A 1RUE2 2QDRA 4I30A 3OPZA 1JBCA 5B4NA 2LS6A 1FOD1 2GC3A 2ZAHA 2FD8A 3P3NA 1YIFA 2B46X 2BNOA 5F3IA 5IT6A 2PHFA 2O1QA 2VM9A 3FFZA 1RUJ1 4WM7A 3WP3A 4META 2VBBA 1I5PA 3J9SA 5A32B 4PDWA 3N7MA 4ASKA 2ZX3A 3LPFA 2XWJB 4DZGA 2VNVA 4IGPA 1HJGA 1BBT1 2Y26A 4JGYC 2XJPA 4R52A 3BB6A 4M01A 1POV3 1BHGA 4R4ZA 3JZVA 3QACA 3T08A 4P9JA 1HIXA 3NQHA 2W1SA 4XILA 1EAH1 5CG9A 4YVWA 2BFUS 5BPXA 3L2HA 4MVTA 1DQ2A 2PN5A 2X53S 4B29A 4GAZA 1Y9MA 1UIKA 3NV1A 1OPMA 5FO9B 1SBEA 2EXIA 1IQDC 2VCBA 3RZZA 3IDCB 1VBB1 2AUYA 4FT8A 3E6BA 1XNKA 2P6CA 1N3PA 1LOCA 3MW3A 3WQ7A 1GWLA 1MACA 1EAH2 2TEPA 3MF9A 1RUC3 4LORA 3C7OA 2DVFA 1R1A2 4UBHA 1HKDA 4HMZA 4WZFA 5DPNA 3V0AA 1C8M1 3DXUA 2HWC1 3NNJA 2CAVA 1OD3A 3M7AA 3SXWA 1YEWA 2YBPA 3I4IA 3KHBA 4LE4A 4BXFA 5FRAA 2IVJA 4PF1A 4IV3B 5JXIA 5IFTA 1RUI1 2CGNA 3VB9A 1RHI1 4K3UA 2WZEA 2JG8B 4CCLA 1IPKA 4HFSA 1F5JA 2EAKA 1S0GA 4OVEA 4LBKA 4A3ZA 4AVCA 1H8TC 5I93A 3VDBA 1AYM3 1H6YA 3N3HA 4CDXA 4BQ3A 1H6XA 2W94A 4CEWA 1J1TA 5CZKA 2UWCA 3LSEA 3WHUA 5LWBA 2ZX0A 3WXPA 4CCKA 3ZSJA 1HJFA 2WO3A 1WLCA 2WT2A 1XXNA 2W3JA 1RUG2 2W87A 3RI9A 1K42A 2F17A 4CP1A 3AMPA 2P4EA 2W47A 4A3XA 4ET7A 5EXOA 3TEYA 1JZ7A 1SLTA 4GULA 3M8LA 1NZIA 4BWOA 2WYSA 4DNYA 5BV6A 3GJAA 4NO4A 4XFCA 1RUG1 5BXXA 2CGPA 1U5ZA 2WRAA 3I54A 2QQOA 5F6LB 4YW5A 3WNKA 1DBNA 1H4GA 2QTWB 5LCWL 1CAXA 3PMEA 2AREA 1VB4A 4BPZA 2C24A 1DGWA 2AGSA 1UCXA 1SFPA 3MPBA 4A7YA 2DYCA 3WQ0A 3C7GA 4S2FA 1I1EA 4XMIA 2H6CA 4GKXA 1MS4A 5A7NA 3B69A 5SV8A 5IK4A 4NIHA 1IHMA 4LK7A 1N1TA 2Q8DA 3ATGA 1UZYA 2WS93 5L19A 3QH7A 4XJ9A 1S0IA 3GHMA 3P5BA 2YGMA 4Q4X3 5FLIA 5FKCA 5DUWA 3K2OA 3A4UA 3HMYA 3VHRA 2W08A 4QX8A 3ST7A 3EXUA 4ORFA 3OGGA 3HN3A 4HSJA 1OFNA 2QCSB 2ZZQA 3ENRA 1FMD1 1FPN2 3AZVA 4EWDA 1IOAA 5CA6A 5FZ6A 2F4LA 1CX1A 3JB4C 3ZYGA 3ZKYA 2JIJA 1OVSA 4G9SB 3WW4A 5A6YA 2PHUA 3FHIB 4IQPA 1G9CA 1VIWB 1OSGA 3H8XA 2OX0A 1YQCA 4Y20B 4TZDA 2VD7A 4Q0QA 3I2IA 3ZM8A 4Q4V3 4PJYA 4RS5A 4AEDC 4XXPA 1OURA 1W8UA 2Y8KA 4AK3A 5CG8A 3ZFEB 1IS6A 3O1RA 2XR4A 3A0KA 4CXXA 2VZOA 3WEZA 4MGKE 2OS2A 4CEYC 3LE0A 4NVPA 3MI8A 4MO3M 1DZTA 3GBGA 4PLNA 1VB2A 2P3KA 4NRPA 4B4QA 1R091 4NJ4A 4Y22A 5FDBA 1OH3A 2VU9A 2VOVA 5KXEA 3WHTA 3UJQA 1AR71 3D5OA 1TME3 1CAWA 3WDTA 2VAUA 3MFCA 4KU8A 4C1XA 3FBYA 4FPCA 4QGNA 1R092 4CP9A 1JYNA 1JUIA 1ZX5A 2R063 4K21A 1ZRFA 3IAPA 5FY4A 5I91A 2VL4A 2A3WA 2BVVA 2GNDA 3M3CA 2LRPA 3H7YA 3H42B 3OUJA 3RQ0A 3NAPB 1YJKA 4UT5A 3WP5A 4P9IA 1W6PA 3OEAA 1JYVA 1MZFA 1QKQA 2WAAA 5CIRA 4A2UA 4N53A 5C70A 2LUWA 2RJ2A 1PO13 2ZKNA 3J7HA 5LBFA 1UPIA 4WM7B 4LBOA 1FNZA 1SBDA 3A23A 2JIGA 2W1QA 3FMGA 3JB8A 5HPOA 3OUIA 1VBE1 2WFF1 4CEYA 4DY5A 4JQRA 5GLZA 2WIIB 1MVEA 4PDWB 5J3UA 1W2TA 5JXGA 3MLKA 5T5LA 3WINE 3D3AA 2XJRA 1FOD3 1OC1A 4ARYA 2Q8OA 2GH2A 3WG2A 1VBE2 1HW5A 1KS4A 3ZXKA 1DYKA 4ZHNA 3SCFA 4XC9A 3WT3A 4LLFA 1LJ7A 4BB3A 5FY5A 1JYTA 2ZEWA 1ZZCA 2TBVA 4QGLA 4DUVA 4L92A 5FP8A 1V00A 1C4RA 5JR7B 2RS33 4S2HA 3WNLA 2ZEXA 1GOFA 1W04A 2C9KA 4IESA 5IUQA 4EJRA 4HVRA 4URAA 1B35A 2WNVB 1ULCA 1YQ5A 1XNBA 5C3RA 3FX3A 5GLVA 2P3YA 2TNFA 4YVWC 4E4ZA 2C6SA 3V64A 5ACA2 4QQPA 4UF0B 5C8CC 5F1RA 1NCQC 1SCSA 2YV8A 2DBIA 5KC6A 1TMF1 1UW8A 3AX4A 1ULOA 3WDWA 1PMJX 2JDUA 4P02B 5J1XA 2JX9A 4I02A 5FK8A 3T1LA 3OBTA 1UOFA 5A6ZA 5LY1A 1W2UA 3WF2A 3USSA 2VGDA 1HDKA 4NRQA 2BRTA 2HEWF 5BNQA 2YC4A 3WNNA 1HB3A 4L8QA 4BOWA 2VQUA 2O8QA 1NA1C 4GWMA 2OYZA 1UOGA 3KT4A 2Y6LA 1N1VA 1NQDA 5L9VA 5A7QA 1PO11 1US3A 4K6BA 4OMCA 1LU2A 3ZPYA 2PLV1 4N9HA 3RMYA 2QQIA 4I2OA 2XKOA 5FJKA 1Q8SA 4GB32 2D6KA 5K4LA 5LRRA 3WNPA 5JOWA 1FYUA 2VPVA 2ZGMA 1UXZA 1W39A 4X6RB 1RIRA 3A22A 3HQXA 4BIOA 5E8AA 3UYJA 1G9FA 3ZYPA 1GOHA 1J59A 1YFYA 2PHWA 4XETA 5I8SA 2JWPA 2WZ8A 3WF0A 3KS7A 4AG4A 2WO1A 4YG3A 4AVBA 2B9UA 4QHOA 4QXHA 5FZ1A 5JWPA 1LU1A 1YLLA 3VBUB 2OIIA 2ZGNA 3K75B 3RNSA 2XGXA 3AMQA 4QQLA 4IV1A 1GWKA 4UWDA 2RDNA 2A3YA 3PIGA 2HYKA 4AI0A 4QX1A 2FDFA 5DZEA 5FYMA 2YB7A 1R093 3ES4A 3K51A 1JYXA 5HCFA 1LOBA 5J7MA 1ND3A 3GJBA 1UZZA 3CBNA 5DAXA 2GC2A 1AF9A 2VULA 3TEWA 2HWD2 5FYZA 1DGRN 2XLGA 4XQ4A 1R64A 1PMHX 4YG6A 5APAA 4A42A 4AHXA 1JZ2A 1G9BA 4G3YC 2W1UA 3VBUA 2KA3A 5KHHA 2VMGA 1VMJA 2ZHNA 1COV1 1RTVA 1ZBE1 1AR92 1ODMA 2FMDA 2QJVA 3F95A 1H8TA 1S1AA 5H9RA 4EN7B 1P8JA 3HVDA 4AZZA 4GD4A 5JIAA 5EIYB 1DQ1A 2A6VA 2ZGTA 4QX7A 4UF0A 2JEMA 1US2A 3MGUA 2WAOA 3DGTA 2RM22 1HN0A 3OYWB 2UURA 4R9AA 2YGLA 1EY2A 2G1MA 2PLV3 2WZR3 2Y38A 3DN7A 2XJUA 3Q8CA 4OI2A 1SEFA 4NN0A 5E89A 2FDKA 2OW4A 4CXWA 3PUIA 4UBGA 3OJBA 2UY9A 5CFDC 3VD9A 4DMIA 3LOBA 5FZLA 1EV13 1D2QA 2Y6HA 4QKBA 4YM1A 4YVSB 5EV7A 2R30A 2VH9A 3MICA 3I49A 1XE7A 3H8UA 3ZYJB 1VBC3 3VHOA 4CEWC 1A78A 3BGAA 3D0JA 4CU6A 4O7XA 1KITA 1ND3C 1S0FA 2ZJCA 1G7YA 1MEC3 4D0QA 1PGW1 1Z7S2 4AI2A 2JG9C 2YC2A 2VBPA 4R8HA 3PU3A 4Q4V2 4D3WA 4MLOA 2ZMKA 3SC7X 4XF1A 1D4M1 2RS13 4CU8A 1W2OA 3ZPOA 1CAUB 1YXWA 4UFHA 3S6PA 4ITCA 5JLVA 3U75A 4MZUA 2RDSA 4IGOA 2RS31 5A3NA 2GNBA 3VBFA 4MXWB 1NT0A 3IT8A 5HCBA 3RG0A 1PVC2 4BK5A 4Q4V1 1OOPC 5FZ9A 2C26A 2VBDA 1AX0A 4N53B 1IPSA 3B00A 1FPN3 5FZ0A 2PQQA 1SZBA 3LA2A 4OCTA 2IXLA 1REFA 3RRDA 1R1A3 2WBKA 4LBJA 2C0ZA 3VKMA 3ZIWA 5JMOA 4AVTA 2PHLA 3I97A 2J1SA 1W8TA 3JD71 3KV5A 4IW3A 5FMDA 3VDDB 3WLUA 3KV4A 1E57A 2XG3A 5E88A 3BU7A 2YMZA 2WWUA 3UGHA 3OPTA 4L0PA 1FV3A 2XBO3 4MXWA 2ZZJA 2E26A 3AZZA 5BNPB 3L9JT 2GSYA 5E16A 1G8WA 1UYYA 2VVFA 1B35C 4XQWA 1KRIA 5LEKA 4XBLA 4B4PA 3RWKX 2I07B 2D3SA 4LITA 3AP6A 1C3HA 4B1LA 1GQHA 5K7PA 1SHWB 2VUCA 1AJKA 5CAZA 4O9EA 4IEPA 3ZYRA 1VRBA 4K9SA 2MHFA 4KMQA 5L73A 3VKNA 3ZN6B 3RZHA 5F2WA 5FYBA 1JZ8A 4BA6A 4H7LA 4QU1A 4JRLA 4Z2WA 4LO4B 1MEC1 1AX2A 3I3QA 4XBQA 3O1PA 2BOJA 2Z79A 1LGCA 4DXRA 2GMPA 5IATA 1MS9A 1W6QB 2IFWA 5JXHA 2DCKA 1PGSA 5DN2A 1J84A 4JKKA 2GZWA 1AYN1 1WA4A 1U5IA 4FPLA 4OUEA 3MFAA 5FYYA 4D7TA 1VMFA 2IXKA 1OLRA 3FC0A 1NZCA 4ZXEA 1ULEA 5FR3A 2BU9A 1VJ2A 3PUSA 2PMWB 2JDPA 5C9AA 1AYM2 3LIHA 1UO9A 2WZR1 3FL7A 5BNOC 1LOFA 1Y9QA 1E5SA 3PUHA 3AVRA 3BTZA 4LHNA 1A6CA 5A7WA 1BK1A 2NQYA 5DAVA 4WM8A 1O5UA 4QPGB 5FYCA 1QDOA 1XBFA 1AYM1 5FZOB 1ZBE3 1F31A 1JU4A 2RS12 3B93A 4OULA 2Q5TA 4RN5A 1DZRA 1RUC2 1PNGA 4UYBA 3ZXAC 4FAHA 4JQTA 1HV0A 1ASJ1 2CDPA 1RVF3 2ADDA 4CZSA 1SLCA 4HPKA 4FSJA 3HT2A 4AE2A 4Q4Y3 4CCEA 5ABJB 5CNAA 2PYTA 5I0TA 1WD3A 1RL3A 3ZFFA 4JDMA 1QQP2 1PO23 2E63A 2ZS6B 2ZXQA 3KF3A 1OF3A 3CF6E 4RD7A 4IV1C 3MLJA 4AI3A 2GP5A 3EQEA 3QOPA 3AKQA 3O12A 1Y7BA 4KNCA 1HXS2 3WW2A 4U36A 4B7KA 1T2XA 1G6NA 1OUSA 1MZ5A 1NCRA 2ZA9A 1QJU3 2ARAA 3FN9A 5KHGA 3CJIB 4QWNA 1OA2A 1SACA 2Z4FA 1XPWA 3PURA 3RDIA 2WFF3 4BMBA 4A7KA 2Q0AA 4NRMA 3NJXA 1DQ5A 1QJU1 1ZA7A 4FXGB 4D6SA 4YFZA 3RZLA 1J83A 2EICA 1AR93 1APNA 3JUUA 2IWGB 5DUVA 1AL22 1AXYA 1QU0A 1XC6A 2IFRA 2I74A 2VOXA 2W68A 2YPDA 1WCSA 3NV2A 4L97A 4CDXB 3ZYHA 1KFXL 3HNBM 1BBT3 4MGSA 3SH5A 2Q1MA 2Y60A 5FO8B 5KXBA 3KV9A 4YG0A 2VNOA 2VZSA 2AENA 1O6UA 1CAVB 1EV12 1BVP1 1VAMA 1W06A 3FHAA 1Q8PA 3ABZA 3AYAA 4GB33 2A7AA 5A6XA 2QQPA 3HOBA 1GZWA 4RFT0 3FWEA 3ACFA 3NMBA 4I0AA 3H3LA 3W5NA 1AR62 1R1A1 2EXHA 4OQ9A 4Q29A 2X5IA 5JUVA 2Z2SB 1SDDB 3QBQA 4P08A 4NOTA 1LGBA 1RUH2 5KBFA 3SCHA 3OSDA 1S0CA 2XDVA 1ODNA 3OD4A 4Q8KA 1NXD1 1UMIA 4FPHA 3AZWA 3E97A 3AFGA 2KR2A 2ZEYA 1OF4A 3ZXFA 1V6IA 1HQNA 5A33A 5CADA 3DKQA 1WW4A 1GZCA 1JOBA 1RMU3 2JE8A 3AL6A 5T5OA 4XFGA 5LA0A 3KGZA 3VBHC 2P6HA 2WWSA 4CP9B 2WNUA 1BCXA 3VBSA 1UN1A 4AWDA 4DFSA 2QZ3A 5FZDA 5JZGC 1AYN3 4GWIA 2ZX2A 1S2KA 1A8MA 2G9ZA 2ZHKA 3AP5A 1MS1A 4JKLA 4HXCA 5C6CA 4XYXA 5HI0A 2QBXA 1UWWA 3CDZB 2C4XA 1DGRA 5CFDB 3C3VA 2VW1A 2D5FA 3U37A 2XJTA 3N35A 4L11A 4EZHA 1JS9A 3TB0A 4FVVA 4MOAA 5A7SA 1GBGA 1Q8OA 5A1FA 5A33B 2DFBA 1OLQA 2D93A 4FQZA 3URFA 3VD7A 3VZKA 4Q2FA 4HT1T 4ASLA 1WMFA 2PTMA 4K20A 4Z92B 4Q4X1 5FKBA 2DU1A 3P1IA 4QB1A 4Y5SA 1PIV3 1HB1A 4TLGA 4DB5A 2JXAA 5FP9A 3RYRA 2V4VA 3CZUA 3KLSA 5K8SA 2CWMA 5KC5A 4QKNA 3UT0A 3R4SA 3I3BA 2D6OX 3NW4A 3PNAA 4J1WA 2ORZA 1K45A 1ULGA 1SG3A 2WUHA 3M3IA 1HRV1 4S2GA 2R061 4LULA 2WNUC 2H0BA 3VBSC 4CCDA 5IVVA 1XNDA 4M3CF 2ZGOA 5FYSA 2P5BA 4C1WA 1GYKA 4LBQA 1TQ5A 5HV4A 3VZLA 3KQRA 5KWRA 3UNPA 5DUXA 3VDDA 3FBMA 2Q8CA 1D7PM 2RS52 5L9BA 1B35B 4XCAA 5FYUA 3M1HA 2B5HA 3BKZA 1Q3EA 1W99A 3OGSA 3JU9A 3OBAA 4AW7A 4XZUG 4URTA 2F6BA 4TN7A 4AI1A 3AYEA 4YVSA 2HEVF 5JAXA 2BYVE 1ZM1A 4C8DA 4LHLA 4OUSA 1LHWA 1WA6X 4ZY9A 1IZ3A 1GMMA 1VE0A 4YGBA 5D1IA 5AVPA 2A73B 3KCCA 5D2AA 1MQTA 2QKDA 2QQLA 3ZXJA 1OHFA 1MS3A 4Y4RA 1LKNA 2CAUA 4GWNA 1JZ6A 4AGVA 3JXSA 5FWJA 1LOGA 1PM7A 2B42B 3WX5A 2BWAA 4KG8A 1QOOA 2X8KA 4FFIA 1AR72 1OOPA 4U2AA 1FMD3 2RR12 1DF0A 1PZ7A 2Y6KA 2Z5WA 3WG4A 3R4UA 1Q43A 3V65A 1RUJ2 1K5MC 4BLIA 1XNCA 4CUGA 3VKFC 3OY8B 2AACA 3MBWA 5JMCA 1LB2A 1UL9A 2CNAA 3HNMA 4XAEA 4LXLA
chains in the Genus database with same CATH topology
3KT1A 5IAVA 4XAAA 4ZONA 3GZEA 5EPAA 4NHYA 5LASA 5C5UA 4Q5OA 3DKQA 5LBBA 3HQRA 3W20A 4JZRA 5EP9A 4NHMA 3HQUA 4UWDA 2RDNA 5IATA 3NNMA 2Y33A 3W21A 4Y5TA 5EQUA 5HV0A 2Y34A 5C5TA 3GJBA 2OPWA 5LATA 5DAXA 3NNJA 4NHXA 3OUJA 5M0TA 4NMIA 4BQXA 5DAVA 5LB6A 5LBFA 4XACA 4Y5SA 2JIGA 2HBTA 3BVCA 3OUIA 3MGUA 4MHUA 4XCBA 5DAQA 5LA9A 2G1MA 5L9RA 4ZPIA 2RDQA 5ERLA 3GJAA 2G19A 3ITQA 4XC9A 2HBUA 2RDRA 5HV4A 4MHRA 3KT7A 5L9BA 2FCVA 3EMRA 4XABA 5IAXA 4NHKA 5LBCA 5DAPA 2A1XA 4XCAA 4J25A 2RDSA 5DAWA 3OBZA 3NNFA 3PL0A 2V4AA 3NNLA 5LBEA 2JIJA 2RG4A 3KT4A 2FCTA 5L9VA 4IW3A 4KBZA 4BQYA 5A3UA 2FCUA 4BQWA 4NAOA 3OUHA 4NHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KT1 A;  5IAV A;  4XAA A;  4ZON A;  3GZE A;  5EPA A;  4NHY A;  5LAS A;  5C5U A;  4Q5O A;  3DKQ A;  5LBB A;  3HQR A;  3W20 A;  4JZR A;  5EP9 A;  4NHM A;  3HQU A;  4UWD A;  2RDN A;  5IAT A;  3NNM A;  2Y33 A;  3W21 A;  4Y5T A;  5EQU A;  5HV0 A;  2Y34 A;  5C5T A;  3GJB A;  2OPW A;  5LAT A;  5DAX A;  3NNJ A;  4NHX A;  3OUJ A;  5M0T A;  4NMI A;  4BQX A;  5DAV A;  5LB6 A;  5LBF A;  4XAC A;  4Y5S A;  2JIG A;  2HBT A;  3BVC A;  3OUI A;  3MGU A;  4MHU A;  4XCB A;  5DAQ A;  5LA9 A;  2G1M A;  5L9R A;  4ZPI A;  2RDQ A;  5ERL A;  3GJA A;  2G19 A;  3ITQ A;  4XC9 A;  2HBU A;  2RDR A;  5HV4 A;  4MHR A;  3KT7 A;  5L9B A;  2FCV A;  3EMR A;  4XAB A;  5IAX A;  4NHK A;  5LBC A;  5DAP A;  2A1X A;  4XCA A;  4J25 A;  2RDS A;  5DAW A;  3OBZ A;  3NNF A;  3PL0 A;  2V4A A;  3NNL A;  5LBE A;  2JIJ A;  2RG4 A;  3KT4 A;  2FCT A;  5L9V A;  4IW3 A;  4KBZ A;  4BQY A;  5A3U A;  2FCU A;  4BQW A;  4NAO A;  3OUH A;  4NHL A; 
#chains in the Genus database with same CATH topology
 3Q8B A;  5AC9 2;  3V0B A;  1ZVF A;  3ROU A;  2GP3 A;  3BOD A;  4O61 A;  3GZE A;  4XHB A;  2XML A;  1NCR B;  3KMH A;  4A45 A;  4V2V A;  3VGI A;  4RFR B;  1C1F A;  4AAP A;  5C3S A;  4XUT A;  2PQS A;  4GH4 C;  1VMH A;  3HQR A;  2ERF A;  3T0B A;  2HH9 A;  4OHW A;  3B01 A;  4BXS V;  5K0U B;  1JI6 A;  2WL1 A;  3POI A;  1QGL A;  2ZGL A;  5ABJ A;  5F2S A;  3NJY A;  2VUA A;  2CV6 A;  1TG7 A;  3WP4 A;  4MUV A;  3POF A;  4FPY A;  1EUT A;  1JOP A;  1IG0 A;  4IGQ A;  4JDN A;  1RVF 1;  3Q9O A;  4F83 A;  3O1M A;  5D8A B;  1LHU A;  4WVZ A;  1W8H A;  2E7Q A;  1FX5 A;  3IM0 A;  1WUV A;  3N9N A;  3GZU C;  4WM8 C;  1UIJ A;  4QKD A;  3TYJ A;  4WVW A;  4TYS A;  3N9P A;  3MV0 1;  2R04 1;  5D8A C;  1RUI 3;  3VBR C;  3AYC A;  2XH6 A;  4AED B;  2YZ4 A;  1WCK A;  4BQ5 A;  2ZGR A;  2D6L X;  3UGG A;  2JB8 A;  4FOV A;  3NRU A;  2VTF A;  4W6Y A;  1IS4 A;  1I3H A;  3IKW A;  3HJR A;  5T55 A;  2Y0O A;  1KDK A;  3BI3 A;  5C9A B;  3UGF A;  1W6O B;  2QQM A;  3ZFG A;  3DEM A;  2DVB A;  2FZ1 A;  3RFR A;  2DWR A;  2IUW A;  3BYW A;  3VZM A;  3PJQ A;  2RDQ A;  1TMF 2;  2EXK A;  4XEZ A;  4EQV A;  1XNT A;  3I2G A;  4IUG A;  1UY1 A;  1O8S A;  1UU4 A;  2D3R A;  5H9S A;  4FO9 A;  2TUN A;  1LGN A;  3H50 A;  3HIF A;  4OQ8 A;  2WS9 1;  5FZH A;  1RB8 G;  3TBD A;  1ZBA 3;  3ORJ A;  1Y3T A;  1CZV A;  4Q0S A;  4YFW A;  3WNM A;  3ZSE A;  4B4R A;  3C7H A;  3WDY A;  1F4A A;  2XB6 C;  5DDJ 2;  2WQZ C;  3IB3 A;  4JGZ A;  1PZ8 A;  3CIH A;  3WDV A;  2A70 A;  1H2N A;  1RMU 1;  2DCJ A;  3ACH A;  2D3P A;  1SPP B;  4UAP A;  3ZIX A;  4CEY B;  4EN8 B;  5A1L A;  4H55 A;  3W58 A;  4YAR A;  3DUI A;  5FIX A;  5BNN B;  2BEO A;  5JR2 A;  2VZ1 A;  4RA0 A;  4QPG C;  5DAW A;  2WDB A;  4LO5 B;  5FMO S;  4Q4Y 1;  1H8T B;  1TNF A;  1DDL A;  2QE3 A;  2VMI A;  3SNM A;  4PIZ A;  4BDV B;  1GSL A;  2WNE A;  4BIF A;  1KQR A;  4IXL A;  3LDR A;  1QQP 3;  1HRI 3;  1FPN 1;  4XMA A;  4DXS A;  5FLH A;  2WZP P;  3FFQ A;  1JZ4 A;  4BQ4 A;  4Q4Y 2;  5JPN B;  1H9W A;  4BQY A;  4NID A;  2VOK A;  2WR9 A;  3CHX A;  4XTM A;  3U0Z A;  2GME A;  2K2S A;  4ZU4 A;  1KFU L;  2PEL A;  1W03 A;  3FUQ A;  4I0W B;  2VCA A;  1RHI 3;  2H0V A;  2R32 A;  4P9Y A;  1W0O A;  2VZ3 A;  2JDA A;  2CGO A;  1R1Z A;  5T5P A;  3SH4 A;  1PNF A;  2RS5 3;  4CDQ C;  2XQR A;  2OZJ A;  2W46 A;  1PX3 A;  3OEB A;  3A7Q A;  3DEC A;  4RS5 C;  2OZ6 A;  3FE5 A;  5FXW A;  4CTE A;  1CGP A;  2VC9 A;  3AMM A;  4LKF A;  4Z1V A;  3H7J A;  3LFM A;  4NR1 A;  2WJS A;  4BK4 A;  1WZX A;  4GH4 B;  2JKX A;  3GZA A;  4Q5O A;  2D98 A;  2HWB 1;  2Z42 A;  4I3P A;  3CEW A;  4FOQ A;  3GCW A;  2Y6J A;  5GLU A;  4CDW B;  3VBO B;  4Y22 B;  3MZH A;  4LT5 A;  4AVA A;  5LY2 A;  1XU1 A;  2YYO A;  5J09 A;  3O7O A;  4IE0 A;  3EJK A;  1TME 1;  1VAK A;  2R6Q A;  2OXB A;  1UYX A;  2FDJ A;  1MQT C;  5LAT A;  3WVJ A;  1BXH A;  1QMJ A;  2BVB A;  4PF5 A;  3AM2 A;  3GXU A;  1KJL A;  1DQ0 A;  3I2H A;  2YBS A;  1GKB A;  1UOB A;  2WO2 A;  1CIW A;  3LEI A;  4CA9 A;  4WM8 B;  4BQ1 A;  4YVS C;  5FV3 A;  2E9Q A;  4DO0 A;  1A34 A;  5F39 A;  4XIO A;  4QPI A;  3JD7 3;  2CHH A;  2MEV 1;  4P9W A;  4CP0 A;  4DY3 A;  2PAE A;  3BVC A;  4LR4 A;  5C71 A;  1BEV 1;  1D4M 2;  3T4H B;  1TVG A;  5LA9 A;  1RIT A;  2OQ7 A;  1ENQ A;  1JOJ A;  1UMH A;  2V09 A;  3AFK A;  3OB8 A;  4EV0 A;  5GAL A;  5DG2 A;  1W9Y A;  3J26 N;  1KD7 A;  2VZV A;  1PMI A;  3RYP A;  1WGP A;  5FBJ A;  2XUE A;  4GMP 0;  2JIC A;  1UY4 A;  2E51 A;  1V9U 2;  3FUO A;  3OGV A;  2A6Z A;  4GAL A;  1LHO A;  4FI9 A;  4M4P A;  4CCJ A;  4X6Q B;  4D7Y A;  4GMP 3;  2W92 A;  1RED A;  5J96 B;  2J42 A;  1U5X A;  3H3Z A;  3CMG A;  1Y43 B;  3K4D A;  1RUH 3;  5TSW A;  3B02 A;  5K0U A;  4YM3 A;  2DUP A;  2Q1Z B;  4CU7 A;  3DKW A;  2HWE 1;  4LIU A;  1FAY A;  5A1A A;  2WNO A;  3IDE A;  3LPG A;  4XF4 A;  2VZU A;  3GBW A;  4BME A;  4XAB A;  1L7R A;  4BHP A;  1U0A A;  3O0W A;  1BLZ A;  4MGI E;  5DAP A;  2AEY A;  4P9X A;  2BBA A;  4LKS A;  5A3L A;  5BY5 A;  3H1M A;  3RJR A;  4EE2 A;  1NUK A;  1VBD 1;  2GAU A;  4Z2A A;  3PVE A;  1WKY A;  1QXR A;  1TNR A;  2WO7 A;  3NNL A;  4UFJ A;  5IVF A;  2ARB A;  4C0H A;  4OZX A;  1LEN A;  4CDU A;  2E7T A;  2BPA 2;  2QDN A;  3DPR B;  3IN9 A;  4ES9 A;  1OQ1 A;  4YSF A;  1U12 A;  5BYN A;  5C4W C;  2XHK A;  1I5Z A;  3O5S A;  1RUJ 3;  4OI1 A;  1TMF 3;  5G05 L;  2R16 A;  2BOI A;  1DYO A;  1DHK B;  4IE4 A;  3RYK A;  2HWF 2;  4QD2 A;  4AVV A;  1OMI A;  2PLV 2;  3HWJ A;  1LOA A;  1AR7 3;  4W4Z A;  5T52 A;  1FI2 A;  1UPS A;  2OVU A;  1CAW B;  5T54 A;  4XFB A;  3VDC A;  1G86 A;  2YBK A;  3CL1 A;  5F7U A;  3AL5 A;  5HCH A;  2WNV A;  1ZRE A;  3RZG A;  1V70 A;  2YU1 A;  4FTB A;  1AVB A;  1V6K A;  3KT1 A;  1LED A;  2VUD A;  4H3W A;  1CR7 A;  1NYW A;  4LKD A;  2XJQ A;  2VO5 A;  1ZZ9 A;  1PO2 2;  5FBZ A;  5FTT C;  5FY1 A;  1OPO A;  1OLM E;  1YFX A;  2WNU B;  3GF6 A;  3VBS B;  1T6G C;  3PVB B;  2HWC 3;  5LBB A;  5ACA 3;  4LKE A;  4RGK A;  1ND3 B;  4YVW B;  3K3O A;  4LA2 A;  4AGR A;  2FDH A;  4W8J A;  5FZC A;  1TEI A;  3O0V A;  5A7W B;  4AR2 A;  1B09 A;  1PHM A;  1UY0 A;  4CRQ A;  3TRS B;  4H14 A;  1PO2 1;  1UY2 A;  1RUF 2;  3ILN A;  4OHX A;  5C3Q A;  1JYC A;  3H0O A;  2OPW A;  3VV1 A;  3J8F 1;  2QFE A;  3O0X A;  3VBU C;  1ZRR A;  4OZO A;  1GWM A;  2HLE A;  1XU2 A;  2HWD 1;  3NWK A;  1GUI A;  2E31 A;  4XOG A;  1RUF 1;  3AP7 A;  4D94 A;  1G9D A;  3HNY M;  1C5I A;  1X9T A;  2JG8 C;  5JCT A;  3ZYF A;  1N47 A;  2L9L A;  4ZZ8 A;  1F35 A;  3K46 A;  1AR9 1;  4GKY A;  3THT A;  4O65 A;  4TTG A;  3KWV A;  5FMB A;  1VR3 A;  4Z8B A;  3IZO A;  4FAG A;  2R49 A;  4JHZ A;  1J3R A;  1QHD A;  3U1X A;  3RI8 A;  4XFI A;  3SCG A;  3IWZ A;  4YW6 A;  2XVL A;  3LQC A;  2RM2 1;  5FPB A;  4XJA A;  2GC0 A;  1UMZ A;  3B5L B;  1HQL A;  3O1V A;  3PHM A;  2YDE A;  2YY1 A;  4IEY A;  1OKQ A;  3PTR B;  4AHZ A;  1ZBA 2;  4N7I A;  5A7P A;  3DXT A;  3KZ4 C;  1QIQ A;  2CU5 A;  4QM8 A;  4AFA A;  2DVA A;  3AKP A;  3QCW A;  4MGQ A;  4Y1Z A;  4D6Q A;  3WZ1 A;  5IVE A;  1XSQ A;  3MV1 1;  4ZS2 A;  3ACI A;  3VBH B;  2JD9 A;  4LE3 A;  1C8M 2;  1BMV 2;  3GNE A;  4Q4W 1;  1PGW 2;  4Q27 A;  2CL2 A;  3UET A;  1Z7S 1;  2VMF A;  4H2A A;  3C7F A;  2VOW A;  1RHI 2;  1JOD A;  3OPW A;  3H3U A;  2XBO 2;  3ZYB A;  3HBZ A;  5A70 A;  3R4D B;  1NY7 2;  3WCR A;  1VRH 2;  5FPL A;  4J25 A;  5F9T A;  4M4R A;  4ZS3 A;  4IE5 A;  2PAK A;  4QQ2 A;  4WM7 C;  1MS8 A;  4QHZ A;  1LNS A;  2VCC A;  1YFU A;  3WP6 A;  1PVC 1;  2D5H A;  4D69 A;  2AC1 A;  2XBO 1;  3LKJ A;  2EVX A;  2IVI B;  2VZR A;  2GC1 A;  4KWL A;  1K5J A;  1SMV A;  1WWY A;  3PJY A;  4CYD A;  2MNG A;  1VRH 1;  4HKO A;  4CSW A;  3T1M A;  3ZFE C;  1YNA A;  3VUO A;  2A75 A;  2GAL A;  4AYU A;  5JI9 A;  2A6X A;  1PVC 3;  1NE4 A;  2UY8 A;  4IET A;  5A3M A;  5FQ0 A;  2WSU A;  5JOY A;  5E6H A;  1IS3 A;  1NG0 A;  3RMX A;  5CIS A;  4M3C B;  4E4S A;  2CDO A;  2QQJ A;  1LUL A;  4CUC A;  5A3U A;  2DUR A;  2ARX A;  1HN1 A;  3WV6 A;  1QJY 1;  5DDJ 3;  5GJ6 A;  4NAO A;  5A3W A;  4COW A;  3POY A;  5F3C A;  2W52 A;  2FMY A;  2PHX A;  5FPV A;  3DPR C;  4IER A;  3R6S A;  1D0G A;  5CFC B;  1Z7S 3;  4UW3 A;  2P3J A;  1RUO A;  2QUO A;  3EHK A;  1SLL A;  2Q1F A;  1H1M A;  4IND A;  4RR3 C;  1NCR C;  3UES A;  4C90 A;  5EPA A;  1YCI A;  1QJY 2;  1SLI A;  4K1Z A;  5LK7 B;  3GBF A;  2J1V A;  3UL2 A;  1FT9 A;  4XHX A;  3VDA A;  2XUM A;  4R9B A;  4UW6 A;  2VQT A;  4PHZ A;  2J22 A;  3BCW A;  4JZR A;  4NHM A;  5FUN A;  2PXJ A;  2KD7 A;  3GM8 A;  4LOS A;  1V6N A;  4AL9 A;  2OUJ A;  5FZA A;  2Y33 A;  1FMD 2;  4Y3O A;  4Y5T A;  4ASM B;  2N7G A;  3CJI C;  5HV0 A;  2VVE A;  3KVB A;  3CNA A;  2ZPX A;  4AFC A;  4KI5 M;  5F3E A;  5EYX A;  5T5J A;  1UKR A;  2XJV A;  2XJS A;  3SHR A;  4NHX A;  3B9I A;  4YW2 A;  2YU2 A;  2GMM A;  3WW3 A;  1ONA A;  4QAW A;  2ES3 A;  5L7O C;  1O8P A;  2XLA A;  1STM A;  3ZSM A;  4MXV A;  1EUU A;  4TSV A;  4ZKT B;  4UW5 A;  4ATF A;  3WY6 A;  2DUQ A;  3Q8E A;  2AYH A;  4TWT A;  3IBM A;  3MIH A;  5EJ1 B;  2QQW A;  1MS5 A;  1D0H A;  1UXX X;  1MPX A;  1X50 A;  1D4M 3;  2RS1 1;  1AR6 3;  1C8N A;  1RUC 1;  1UZ0 A;  3E5X A;  2ZGU A;  2NM1 A;  5HXM A;  3KGL A;  1F8V A;  1IPJ A;  4KGQ A;  4N90 A;  3NO8 A;  1PX4 A;  5FUI A;  4PIY A;  1IGO A;  1CJP A;  1HQW A;  2DDU A;  3Q8F A;  5FY8 A;  5LRS A;  1OI6 A;  4L2N A;  4PQ9 A;  2JE7 A;  1RJ8 A;  4OI4 A;  3B3Q E;  5CFD A;  3ITQ A;  5H9P A;  4QXB A;  4DIQ A;  1L7L A;  5FY9 A;  3S0M A;  4BJ0 A;  1G9A A;  1FXZ A;  1BZW A;  4L9B A;  1LHN A;  4QDS A;  3KT7 A;  4E8C A;  1AZD A;  4XDQ A;  3GZT B;  1MQT B;  3N9L A;  3ZFF B;  2AZ5 A;  4P5Y A;  4JGZ B;  1Y4W A;  2XHN A;  3MYX A;  3TEX A;  3UK9 A;  1KGY A;  2JEC A;  4N9I A;  2G9G A;  4P00 B;  5JDB A;  4A4A A;  3H1W A;  5GLT A;  5FPU A;  5A6Q A;  3O1U A;  2LAL A;  3M3E A;  1QOS A;  5CFC A;  4QPG A;  1XSR A;  2JDN A;  1C57 A;  2JE9 A;  2RR1 3;  4GXL A;  1GNZ A;  1QJU 2;  4YGE A;  4XF3 A;  4LHS A;  3OBZ A;  1AXK A;  1CQ9 A;  1CN1 A;  3HD8 B;  1AL2 1;  4M0N A;  5AC9 1;  2O14 A;  1VBB 2;  4COY A;  4IEO A;  5CKQ A;  2P2K A;  3ZR5 A;  2GH8 A;  2VW2 A;  4NPM A;  3LB9 A;  2EIB A;  3AK0 A;  1WCU A;  4K40 A;  4YW4 A;  1K5M A;  1LHV A;  4XUQ A;  1W9T A;  1OQE A;  2BFU L;  4FQ4 A;  4YM0 A;  4OHZ A;  1WME A;  4XUP A;  4AHY A;  4Z82 A;  4FPF A;  1S4C A;  4UI9 L;  2WN2 A;  1RUF 3;  5KHJ A;  3O1S A;  1H8V A;  2XQX A;  2WQ4 A;  3LEK A;  2Q30 A;  3MF6 A;  4XPV A;  1CAV A;  4Q26 A;  1AR8 1;  4CDU C;  2RJL A;  4FTS A;  1W6Q A;  2ZGP A;  3IAQ A;  2UU8 A;  4DXZ A;  3S57 A;  3OUH A;  2RMU 2;  4YW1 A;  3ZO0 B;  1ENS A;  5JVV A;  1DZQ A;  2P34 A;  1QH6 A;  3AP9 A;  3H8O A;  1UU6 A;  4ATE A;  3QH6 A;  3ACL A;  1RUH 1;  4HVQ A;  3PUQ A;  2BTV C;  5IAV A;  4XAA A;  3M3O A;  5C4W A;  3E5U A;  2OQ6 A;  1H30 A;  3MIG A;  4IEQ A;  1URX A;  4LLO A;  4PBP A;  1UX7 A;  1WW6 A;  3GHN A;  3VBO A;  3FHQ A;  1H9P A;  4Y33 A;  4QDR A;  3W20 A;  2HEY F;  1NXM A;  2GN3 A;  2JEN A;  2XXZ A;  3A21 A;  4CCM A;  4V1P A;  3HQU A;  3MHZ A;  2HWF 3;  4DRV A;  1AR8 3;  4AEM A;  3NJZ A;  2BW8 A;  2PAM A;  1EAH 3;  2QQK A;  2P17 A;  4RR3 B;  4CU9 A;  4QGM A;  5ANN A;  1X9P A;  1AHS A;  4HBN A;  3ELN A;  1ZYB A;  3QD6 A;  4KG0 A;  4P14 A;  2VTX A;  3BUC A;  2C5D A;  5DG1 A;  5C4W B;  1PO1 2;  2DCZ A;  1ALY A;  4AGG A;  2VJX A;  1F15 A;  2XOM A;  2AH2 A;  3QLQ A;  5FCC A;  3S30 A;  5ISL A;  2ZGS A;  3TN9 3;  1RJ7 A;  4B3N A;  1W8W A;  4FFF A;  1OD5 A;  1OQD A;  2X5I B;  3VZO A;  5IFP A;  5HCA A;  1DQ6 A;  2PFW A;  2YFZ A;  3LA3 A;  4WVM A;  4MSV A;  3ZR6 A;  4EZ4 A;  5K9Y A;  5JPM B;  1I6X A;  5DUU A;  2W91 A;  3N9Q A;  5FZE A;  1GNH A;  4CCN A;  4LUK A;  5FMC A;  2BNM A;  1W3V A;  2JKB A;  4XCB A;  3I59 B;  4OFG A;  4DUW A;  1R08 1;  3SMH A;  3FZ3 A;  1LES A;  4GWJ A;  2V5Y A;  3J7L A;  5FY0 A;  4CDQ A;  4PI2 A;  3H8R A;  4IV3 C;  4DEV A;  1BK0 A;  2W5F A;  2HKX A;  5L9R A;  4P9G A;  4ZPI A;  2H6B A;  2DU0 A;  3TOJ A;  1N3Q A;  5ERL A;  2R1B A;  2G9F A;  4MH0 E;  3LDB A;  1RUE 3;  1SPP A;  1DGW X;  5FJH A;  4AFB A;  4WV8 A;  4R4X A;  1YWK A;  3G6J B;  4KQ7 A;  2XL7 A;  5D8A A;  1KDM A;  3VBO C;  4ZZ5 A;  1UYZ A;  4YZ4 A;  5GZE A;  3WG1 A;  4QDQ A;  4WVV A;  1ENX A;  2LW8 A;  2P1B A;  3BIE A;  3OGR A;  2VXR A;  2RS5 1;  3AB0 A;  4E9K A;  3Q8A A;  4RGA A;  2CTV A;  1NX9 A;  4J1X A;  4UFM A;  2Y6G A;  5FAX A;  3ZN6 A;  1PVX A;  3IIA A;  3UKT A;  4FCA A;  1ZBE 2;  4XUO A;  1S55 A;  2A1X A;  1HB4 A;  3PU8 A;  4GJZ A;  4OLL A;  1GR3 A;  1SLB A;  2DV9 A;  1S0E A;  2EAL A;  4IE6 A;  2BZD A;  1CON A;  4NRO A;  5GZD A;  2UWA A;  2PA7 A;  3NKT A;  3ZDS A;  5FPZ A;  3AZX A;  3ZMO A;  4XUR A;  4QPI B;  1IG3 A;  3MUY 1;  1IS5 A;  4DS0 A;  1XYO A;  1O4Z A;  2O0O A;  2Y0I A;  1NA1 A;  5IK5 A;  3DF0 A;  4NAM A;  2JDH A;  2ZML A;  4QX3 A;  3WQB A;  4YZ5 A;  3T2T A;  2HWB 2;  3HN1 A;  1OA4 A;  4IEV A;  2XPJ A;  1UAI A;  2AEZ A;  1XB9 A;  3N7K A;  2R1D A;  5FWE A;  3OY8 A;  4KBZ A;  2W39 A;  4XJ8 A;  4W6W A;  1NOV A;  4DIN B;  5JSO A;  4RYD A;  2O8O A;  3I7D A;  1YHF A;  4NII A;  1MR5 A;  1NCQ A;  1PK6 B;  2J1U A;  4HOO A;  4Q0U A;  4TXW A;  2YUE A;  2X29 A;  4Y4Y A;  3ZFE A;  4N8M A;  2K0G A;  2WN3 A;  2IXJ A;  1OOP B;  3PDQ A;  3WF1 A;  4CVU A;  3B94 A;  2WT0 A;  2ADE A;  4A41 A;  2K9Z A;  5EFU A;  2GN7 A;  4RHV 3;  1WMD A;  2EA7 A;  1AXZ A;  1QJF A;  2VMC A;  3KHC A;  3LWC A;  3BTA A;  1ND2 B;  1QH7 A;  1WCQ A;  2B4K A;  3MW2 A;  3BOW A;  3LFI A;  3WNO A;  5IVJ A;  1JYI A;  1DIW A;  5CKM A;  3ZOI A;  2RMU 3;  1V9U 3;  4BZ4 A;  1OLM A;  3V0B B;  5B2G B;  5EP9 A;  1BQP A;  1EPZ A;  3KVA A;  3HBK A;  5BNP C;  4Q1R A;  1F5F A;  4GMP 1;  2D97 A;  3JQX A;  4QKF A;  3T2Q A;  1W6M A;  5EQU A;  4PLM A;  5C8C A;  5FZB A;  1UF2 C;  2OT7 A;  1RUG 3;  2PHR A;  2XVK A;  2Y34 A;  3H9A A;  1LAJ A;  1C1L A;  2CSG A;  5F5C A;  4MYE A;  1U5Y A;  3THD A;  3MDP A;  5CFC C;  4AFD A;  1HRI 2;  2VE1 A;  3KCY A;  4HN0 A;  3JD7 2;  3X29 B;  4KWU A;  3BTY A;  2JJ6 A;  2VUJ A;  3ZKU A;  3BAL A;  5M0T A;  1ENR A;  5FPA A;  4AEK A;  3HPN A;  4HLT A;  3IPV B;  5DZF A;  1QOT A;  4IE7 A;  4E2Q A;  2XL9 A;  2ID4 A;  2YXS A;  2BQP A;  3LEG A;  4AEJ A;  3RWN A;  1PGL 2;  1V6O A;  1HRI 1;  1LOE A;  1YI9 A;  2BGO A;  1GQP A;  4FFG A;  3W5M A;  4BCU A;  2BP6 A;  2WIN B;  1WW7 A;  4XVH A;  1JH5 A;  5FZF A;  1K3I A;  4LMF A;  4YWA A;  2ENR A;  3NNG A;  3VD4 A;  4E8D A;  1SDW A;  1MEC 2;  3O1T A;  2XKP A;  5FLJ A;  4KU7 A;  4Y1V A;  2BER A;  4IDZ A;  3MO4 A;  1V6J A;  3KSC A;  1J1L A;  1QJX 1;  2FBE A;  3DYO A;  3AMN A;  5F3G A;  4FPE A;  5B4X A;  3EB7 A;  3B7M A;  3M70 A;  4AHW A;  1DU3 D;  5I0D A;  4HVO A;  4DOU A;  1CWP A;  4J6G A;  3NVC A;  2I2S A;  1QDC A;  1D4V B;  3DCQ A;  4KWJ A;  4PI0 A;  4COV A;  4DQA A;  1F9K A;  1S2B A;  1W05 A;  2WZR 2;  3D0S A;  3R05 A;  4RR3 A;  2B7Y A;  4NIA A;  3TNP B;  3VZN A;  5BNN A;  4WBB A;  2VW0 A;  2WT1 A;  5IW0 A;  4FPG A;  2A71 A;  3UJO A;  4B7E A;  4ZU7 A;  4FXK B;  2JG9 B;  4KWK A;  5FP3 A;  1RMU 2;  3IDB B;  3UKN A;  1O3Q A;  2IXH A;  4HAN A;  2A6W A;  4Q1P A;  3SKV A;  1CES A;  2D6N A;  4CXY A;  2DVD A;  5F32 A;  2ETE A;  1KS5 A;  4XZP A;  3T4V A;  3U4S A;  5F5A A;  3RPQ A;  4CUA A;  3E6C C;  2W0X A;  3ECQ A;  1K12 A;  2BDR A;  1ASJ 2;  3OBR A;  4OHY A;  3VKO A;  1QJZ A;  3L2Y A;  2JDZ A;  4PT6 A;  1N1Y A;  1OBN A;  4HZF A;  5FZO A;  3VDD C;  2OA2 A;  3WR0 A;  3THC A;  2YFU A;  4BQ2 A;  4HON A;  1VBE 3;  2RG4 A;  3J8F 3;  1Q8Q A;  4OHV A;  2JG9 A;  2ZMN A;  3CKH A;  4I09 A;  3RVH A;  2BWC A;  3D6E A;  2ATF A;  1BEV 3;  1VPH A;  1REE A;  1HXS 1;  3LDK A;  1TE1 B;  2NMN A;  3J8F 2;  1S2E A;  3C2U A;  1BJQ A;  1H2M A;  3OYW A;  3MIE A;  1UKG A;  1S0J A;  2WFP A;  3GYD A;  5AC9 3;  2WSV A;  3T2P A;  5FRE A;  3P6B A;  5LAS A;  5GZG A;  3K48 A;  2QQU A;  4K8R B;  5FYH A;  1YQ6 A;  4FTE A;  3NV4 A;  4Y20 A;  4DRR A;  4D6R A;  1WLT A;  3E1F 1;  3T0D A;  1EYB A;  1RXG A;  3T2O A;  4MGZ E;  3POJ A;  4RS5 B;  1H1I A;  1Z78 A;  2X09 A;  5GZF A;  4BE3 A;  2R0F A;  2VCM A;  2RM2 3;  5C5T A;  4BH9 A;  4IV3 A;  1EV1 1;  1TME 2;  4N43 B;  4Q0P A;  2ZKL A;  2LRO A;  1W6O A;  1CAU A;  2DBN A;  4YLZ A;  3LEM A;  4EN6 B;  5KXC A;  1RUI 2;  1OUX A;  3FLP A;  2RE9 A;  3E5Q A;  4JAA A;  4GZ9 A;  1AR6 1;  2FHR A;  5FZI A;  4NMI A;  4PCR A;  4GQ7 A;  3WDU A;  3ZFG C;  2NN8 A;  3PMS A;  1YRZ A;  2D6M A;  4IEX A;  4Q4W 2;  4UW4 A;  1W2A X;  5FXV A;  3BTX A;  4NIG A;  5GZC A;  1NCQ B;  1PK6 A;  3KB5 A;  3F2Z A;  4DPN A;  2EF6 A;  5A80 A;  4EYU A;  2GNM A;  3KD4 A;  4XF0 A;  3U07 A;  2B9V A;  2X05 A;  4QB2 A;  4QPI C;  1BEV 2;  1W0P A;  2WNV C;  3BPZ A;  1UZV A;  4UFK A;  2GDF A;  1W9S A;  4XQD A;  3WUD A;  4CDW A;  1GQG A;  2RJK A;  5FZ8 A;  2ZAC A;  2VG9 A;  3W9A A;  1W0N A;  1W6P B;  1CX4 A;  1YJL A;  4OMD A;  3ZMN A;  2XWB B;  5D21 A;  3C7E A;  3NST A;  1YC6 1;  2NP0 A;  1GP4 A;  1V9U 1;  1ZRI A;  3S5A A;  1RUD 2;  1VLN A;  2EXJ A;  4FFH A;  4UFI A;  3T0A A;  2VNG A;  1XE8 A;  4MHR A;  1ZNP A;  5DQ0 A;  3ZSK A;  3DYM A;  1OH4 A;  4CDQ B;  2A6Y A;  2NZ9 A;  4XXA A;  3RZJ A;  3POW A;  3BOP A;  2IXI A;  3OGJ A;  2FCV A;  4CUB A;  1J3P A;  3N7J A;  4LBL A;  1FV2 A;  3VHP A;  1ZRC A;  1POV 1;  4PBO A;  1PIV 2;  1PM4 A;  3IDA A;  4RQP B;  4QHB A;  4WZC A;  4V2W A;  4F7Z A;  1VBD 2;  1YI7 A;  3S5Q A;  3DPR A;  3ZXL A;  2E32 A;  4LO6 B;  3S7E A;  3IMM A;  2VQ0 A;  3HR9 A;  3NNF A;  5ANQ A;  3FJS A;  5AVA A;  5CB7 A;  2DCY A;  4JGY B;  2WLQ A;  1ST8 A;  2DTW A;  2IC1 A;  1WLW A;  2V72 A;  3NAP C;  4XDO A;  1CIY A;  5FYT A;  1HRV 2;  2R06 2;  5F5Q A;  1DCS A;  4AI9 A;  4RL7 A;  1OFS A;  2FCT A;  4QXC A;  3JBG 1;  1VRH 3;  2FDI A;  5L7O B;  3HEI A;  1HX6 A;  1XYN A;  4KBB A;  1V6M A;  4Y5Z 0;  4ZXK A;  1Z0H A;  4NWW A;  1SCR A;  1UU5 A;  4YRD A;  2ZHM A;  5E1R A;  3UKV A;  2WAB A;  4ISQ A;  2QNK A;  2ZHL A;  3ZSL A;  4LO7 A;  5IHR A;  3RGB A;  4NPL A;  4K8F A;  3ZXG A;  5FP7 A;  3JBG 2;  4JHT A;  1C8M 3;  1QEX A;  4NHL A;  1W8N A;  2KM2 A;  4HPK B;  5LEJ A;  1UD1 A;  4FBF A;  3POG A;  2VMD A;  1A3K A;  3H1Y A;  1CPM A;  4A44 A;  1W2N A;  4E4D X;  3RZK A;  2YPJ A;  2J1A A;  5BNN C;  1MZE A;  3I3D A;  4AQT A;  3AKR A;  4RQP C;  3PLQ A;  1SBF A;  3RJ2 X;  4YGC A;  2W1W A;  5BUV A;  3ZVX A;  4LK6 A;  5A32 A;  1FOD 2;  2YC0 A;  3J7N A;  4JDO A;  4JTO A;  2YG0 A;  3USU A;  2KXL A;  2X10 A;  4M3C A;  2LM3 A;  2ET1 A;  3ZFF C;  1Q56 A;  1JZ5 A;  2UWB A;  4FPK A;  2PHD A;  2WWJ A;  4JRA A;  5I0S A;  1BBT 2;  4SBV A;  1E5R A;  1SLA A;  1UX6 A;  2CYF A;  2WLP A;  3ETP A;  2D43 A;  5EJ3 A;  5T50 A;  4E4H A;  1ZZB A;  5FZG A;  3M3Q A;  4COZ A;  3VL8 A;  3WW1 A;  1POV 0;  3P3P A;  2UYB A;  3OTF A;  3U10 A;  4JKM A;  4A7Z A;  3I8T A;  4ES8 A;  5J36 A;  3IMN A;  3WF3 A;  1LEM A;  1ZA4 A;  3VZJ A;  1GZ9 A;  2WA3 A;  2OKX A;  4MGT A;  2HBT A;  2WFF 2;  1NE6 A;  4M0H A;  1DYP A;  4TLF A;  4YW7 A;  2IZW A;  5GM0 A;  3HAG A;  1YFW A;  4YZ1 A;  3CQO A;  5BNO B;  1N1S A;  2ZBJ A;  1JYW A;  5T3N A;  2C1F A;  3EYP A;  3LGR A;  3SIS A;  3WD5 A;  5JXJ A;  3J7M A;  3ZFG B;  1GIC A;  3LSD A;  3OCP A;  2HWC 2;  1ZBA 1;  4KH9 A;  2HWB 3;  3D82 A;  2G19 A;  1GLH A;  1WBL A;  3I3E A;  2JDY A;  3PTY A;  4NWV A;  3WSO A;  2VMH A;  5KXD A;  3LZZ A;  5JZG B;  3MID A;  2J1R A;  5I0U A;  1JHJ A;  5JOX A;  5LA1 A;  4P5H A;  4QB6 A;  3WQ1 A;  4HKW A;  4OI0 A;  1RVF 2;  1J3Q A;  3M2M A;  5FY7 A;  5A7O A;  4AI8 A;  3D8C A;  2ZGK A;  4CPB D;  1YQ2 A;  4R9C A;  1AR8 2;  1XRU A;  1V0A A;  1O3T A;  2I45 A;  4QPY A;  5H9Q A;  5IAX A;  3VBF C;  5EHD A;  5FZM A;  5ACA 1;  3N36 A;  4A6O A;  1NY7 1;  5FZK A;  1SFN A;  1XJA A;  4QX5 A;  4W50 A;  1H0B A;  2VZT A;  5DZG A;  2E6V A;  5EYY A;  3U11 A;  1LEC A;  5KHI A;  2W2I A;  4Q0V A;  2A5Z A;  4YGD A;  5IWF A;  3TN9 2;  3VN4 A;  5KHK A;  4GJY A;  2Q8E A;  2CWS A;  5FPX A;  2ET7 A;  1GZT A;  5DAB A;  4FOW A;  4B1M A;  4XDP A;  2G4I A;  4QQH A;  1H2L A;  2DVG A;  1W8Z A;  3OF1 A;  2ZAA A;  5CKN A;  1VAV A;  4DUX A;  1EP0 A;  3TN9 1;  1XNA A;  4K1Y A;  5EWS A;  3I3M A;  2VNR A;  2WS9 2;  1VP6 A;  5EZW A;  1QNW A;  4N43 A;  2E33 A;  3K4A A;  4GB3 1;  4OUM A;  4JCK A;  2D44 A;  3CU7 A;  4LO8 A;  4BQW A;  3III A;  1YIP A;  4FP2 A;  3CO2 A;  5CVR A;  1KXG A;  4CCO A;  4C0B A;  3S7I A;  3ETQ A;  1W28 A;  1GFF 2;  3LAG A;  4HK9 A;  3BPS A;  2V73 A;  5JSP A;  1M06 G;  1LR5 A;  1GNY A;  4M3C E;  3LA7 A;  2HJI A;  2RHP A;  5CEH A;  3I2K A;  1VBD 3;  4HKL A;  5JIU A;  2VQA A;  2R7E B;  3VBR A;  4A6S A;  1A8D A;  1JXN A;  5C3P A;  3LD8 A;  4XUN A;  1OA3 A;  3GGL A;  5C5U A;  4XJU A;  3M4F A;  4LTA A;  4QT6 A;  2P3I A;  4HET A;  3SEP A;  1OVP A;  1DGL A;  1R08 2;  1NKG A;  3NNM A;  1ULF A;  5CBL A;  1SQ4 A;  2SBA A;  4XTP A;  1KJR A;  1W6N B;  1CVN A;  3AC0 A;  2BJS A;  5FO7 B;  4X8P A;  3I2D A;  1C28 A;  3AYD A;  2NYY A;  2ZCW A;  2B45 X;  4PLO A;  5ABJ C;  3C8X A;  4D8M A;  1GP6 A;  3TNQ A;  1CZS A;  1XQN A;  2XLF A;  4AQS A;  5L36 A;  4YM2 A;  1W3X A;  2VTX J;  1OT5 A;  2YRO A;  1XE0 A;  3KM5 A;  4S2D A;  1DP0 A;  4BQX A;  1JZ3 A;  1JW6 A;  3SLI A;  2JG8 A;  1GOG A;  5IYY A;  4UFL A;  4Q8L A;  2FQP A;  1NQJ A;  5L7O A;  4YYO A;  3R0R A;  1H2K A;  2WQ8 A;  3AJY A;  4LHK A;  4IEU A;  3TWI A;  4CDX C;  1O5L A;  2ZEZ A;  5LW9 A;  1QXP A;  2BGP A;  2W95 A;  5G04 L;  3TEZ A;  1GP5 A;  2V5D A;  5IK7 A;  2VZP A;  1LOF C;  1ULD A;  1W8F A;  1IKQ A;  1PZ9 A;  1IKP A;  3NKG A;  1N3O A;  3J4U H;  3I2O A;  1O59 A;  4JGY A;  3INA A;  2XON A;  2VVD A;  2NMO A;  2RR1 1;  2VOT A;  3KCX A;  4LEJ A;  1QJX 3;  1JHN A;  5C3O A;  4OYU A;  3SIT A;  5A3T A;  4YZ3 A;  1WD4 A;  1VBB 3;  4YZ2 A;  1X82 A;  2NPI A;  5A3P A;  4N43 C;  1YUD A;  1JN2 P;  1ULP A;  4QM9 A;  4Y24 A;  4Y1U A;  5LA2 A;  4RGG A;  1CAX B;  2Y6F A;  3CLP A;  3AXE A;  3WDX A;  1WLD A;  2Y64 A;  4NPR A;  2P37 A;  1JMU B;  2DCT A;  3EMR A;  4JC1 A;  5FP4 A;  1FNY A;  1DFQ A;  3SH3 A;  5F6K A;  4H7M A;  5GLW A;  2GU9 A;  5C33 A;  5HXV A;  3LOI A;  4AF9 A;  3MIB A;  1O3R A;  2MEV 2;  3IPV A;  2D40 A;  5GKA C;  3ILR A;  1K5M B;  2K46 A;  4W65 A;  3VBR B;  4XE9 A;  1O7F A;  2ZOE B;  2V4A A;  4XIK A;  2RVA A;  2ZX1 A;  1HV1 A;  4LBQ D;  1MZ6 A;  2HWD 3;  5FXX A;  3ZX7 A;  1DLL A;  1UY3 A;  1BYH A;  1Q5O A;  3ALQ A;  3NJV A;  3NAP A;  3PIJ A;  5IVB A;  2R04 3;  1JUH A;  1XOY A;  3GAL A;  4L99 A;  4C91 A;  2VR4 A;  5J37 A;  4CCC A;  5I0R A;  1T6B X;  4RQP A;  4M00 A;  2J1T A;  1LCL A;  5FOJ B;  1X7N A;  3U14 A;  2Q4S A;  2B39 A;  4DEQ A;  3APB A;  3I2J A;  2FCU A;  4HK8 A;  5J48 A;  1XYP A;  1NLR A;  1AUY A;  1X8M A;  4LBN A;  3TAY A;  2R04 2;  4EWA A;  1SFY A;  4KGG A;  1D2S A;  4LJH A;  4UXA A;  4AQ2 A;  2VME A;  2RMU 1;  2HWE 2;  1OKO A;  1RC6 A;  2A3X A;  2OUH A;  2R07 3;  3MW4 A;  3OOX A;  3ES1 A;  4Q4W 3;  4GA9 A;  2EID A;  3ILF A;  1YO8 A;  1GAN A;  2ARC A;  4QXK A;  3JCI A;  3V0A B;  2BGC A;  3VD5 A;  2BBV A;  4CDW C;  1PGL 1;  1VBC 2;  1Q8V A;  2ILM A;  2YHJ A;  3AVS A;  3JQW A;  3U78 A;  3SEE A;  2BUK A;  4BU2 A;  5C7G A;  2RV9 A;  1O91 A;  1NLS A;  2AR6 A;  4Z07 A;  2WA4 A;  5K0U C;  5FMO L;  4RSU A;  1VBC 1;  4O9G A;  3EO6 A;  1QF3 A;  4HSL A;  4IEZ A;  4JX0 A;  5C8W A;  3AZY A;  3OD0 A;  2FDG A;  4CE8 A;  3THP A;  2OPK A;  4YPJ A;  4MV2 A;  5IVC A;  4ERO A;  4LNV A;  1LRH A;  4FP3 A;  2VXJ A;  3MIF A;  3POB A;  1QJX 2;  2QVS B;  5JZG A;  3HT1 A;  1J58 A;  3KV6 A;  1QJY 3;  4XF9 A;  5DDJ 1;  4DXT A;  1PK6 C;  3RZM A;  2QQN A;  4P9L A;  5IK8 A;  4LBM A;  4BLJ A;  2XVG A;  3BU0 A;  3ZXD A;  1ND2 A;  4HL0 A;  1VAL A;  3UV9 A;  4HG6 B;  5LB6 A;  4ARX A;  4XAC A;  4XFH A;  3WOG A;  3EBR A;  1GV9 A;  4XBN A;  2W9X A;  3WF4 A;  4JV4 A;  4N53 C;  4XJW A;  4XFF A;  4LUM A;  5DAQ A;  4AVS A;  1ZZ6 A;  4WVM B;  2ZX4 A;  4HN1 A;  3AKT A;  3VD3 A;  4MG2 A;  4EN9 B;  5FQ0 B;  2GNT A;  3PVO A;  1ACC A;  1JU3 A;  3PVN A;  3AJZ A;  5DXD A;  5FZ7 A;  2VEC A;  3WUC A;  1FAT A;  2MPF A;  1DG6 A;  2C9A A;  1ZRD A;  4QPW A;  1YYN A;  1DQ4 A;  2DTY A;  3AKS A;  4XJZ A;  1QQP 1;  1RIN A;  3O1O A;  2D6P A;  2Z69 A;  4KL1 A;  1RUN A;  4XFA A;  2HBU A;  3PUA A;  1O4T A;  1WMX A;  1L7Q A;  3CJI A;  4IEW A;  4ONU A;  4PIX A;  2ORX A;  4ZU5 A;  5LZ6 A;  4AQ6 A;  1COV 2;  1W8O A;  4QQO A;  3DYP A;  4LA3 A;  1QY4 A;  2ZTN A;  1F2N A;  3MEP A;  3VBH A;  1W90 A;  5FYV A;  2BV4 A;  1W6N A;  1W9F A;  4GH4 A;  1M4W A;  2NLR A;  5LK5 A;  1OXC A;  3CJX A;  4LQR A;  3O14 A;  1RGS A;  5AFE A;  4NHK A;  3K4Z A;  2IXC A;  3MPP G;  2PHT A;  4LPL A;  3K77 A;  4RHV 1;  1BVV A;  4Y1Y A;  4BIS A;  2EAA A;  3N7L A;  1H4H A;  3BIW E;  3I59 A;  1W9W A;  4ISR A;  1GU3 A;  5IJR A;  4BYY A;  1E5I A;  1WW5 A;  3B9C A;  3D4K A;  3POE A;  4GIQ A;  4COU A;  1HRV 3;  5F5I A;  4D7S A;  3AP4 A;  4AED A;  2CY6 A;  1UYP A;  3G7D A;  5FK7 A;  3T3Y A;  2JDM A;  3U4X A;  5HBA A;  2VY0 A;  4RHV 2;  1NLQ A;  2BNN A;  1UNB A;  1UQX A;  4FOY A;  2D7F A;  1BKZ A;  3KF5 A;  1NA1 B;  3ACG A;  4EWE A;  2J1E A;  5EJZ B;  2WYF A;  4E2G A;  4I01 A;  2WKK A;  3VBF B;  2X5I C;  1E5H A;  3OG2 A;  4AAX A;  1TZO A;  2SLI A;  5JI7 A;  4F8A A;  2QZ2 A;  1BMV 1;  1POQ A;  4JGZ C;  4W6X A;  5I8T A;  2RS3 2;  3RS6 A;  4AOC A;  2DFC A;  3A0N A;  1AL0 G;  4AXO A;  1COV 3;  3RSJ A;  2UYA A;  1S0D A;  5SV5 A;  1H1A A;  4QU2 A;  4ZON A;  2J7M A;  5F37 A;  1RUD 3;  4EN0 A;  5FOB B;  4R9D A;  3E6D A;  4NHY A;  3ME2 A;  3WCS A;  3VHN A;  1UZW A;  3ON7 A;  5JOZ A;  3LF7 A;  3VKL A;  5DMY A;  4UOJ A;  3WNX A;  3ASI A;  3T30 A;  3W21 A;  4IV1 B;  2EIG A;  4NE9 A;  5C9A C;  3W59 A;  2DUO A;  4BM8 A;  2DF7 A;  4JTN A;  4F3J A;  4IL7 A;  1R08 3;  5AFB A;  5F8P A;  1CPN A;  1RYY A;  4PQQ A;  4QMA A;  2LTN A;  5FYI A;  3BN6 A;  1RUD 1;  1MS0 A;  4I3G A;  2WC2 A;  3ZN4 A;  1AJO A;  1VBA 3;  2JB4 A;  1AL2 3;  3VLB B;  4NUB A;  3ZLI A;  4E27 A;  2MEV 3;  1EPW A;  2E7A A;  4Q4X 2;  3V56 A;  1X8E A;  3DV8 A;  4FPO B;  3FLT A;  4Y1X A;  4LOT A;  4YW3 A;  5FXZ A;  5BNO A;  1VBA 1;  2HYX A;  4MHU A;  1PIV 1;  5J98 B;  4MAD A;  1KEX A;  4FPJ A;  2JDK A;  4Y26 A;  3MUZ 1;  1AYN 2;  1F4H A;  1X36 A;  5IVY A;  1I9R A;  1IQA A;  2ZAB A;  3AXD A;  5CU1 A;  4LBQ B;  1Y9G A;  3POS A;  3SKJ E;  1W6M B;  1CD3 G;  1VBA 2;  1NAE A;  2B8M A;  2QQV A;  5FFO C;  5C8C B;  2EIE A;  3FLR A;  4SLI A;  5JSR A;  5BNP A;  3ZXE A;  3LIG A;  4CP2 A;  2R0H A;  3LCP A;  1O3S A;  4JVA A;  1JTZ X;  2HWF 1;  2RDR A;  1RXF A;  5FUP A;  1S0B A;  5CYY A;  3VL9 A;  4G4F A;  3ZN5 A;  1QXJ A;  1GZW B;  1QWR A;  1L3J A;  3K3N A;  3USU B;  1YQ8 A;  2HWE 3;  2R07 2;  3GDB A;  4K7J A;  4LIV A;  3KQ4 B;  4YNI A;  4X8N A;  4AFM A;  5FZ4 A;  1ZZ8 A;  2E53 A;  3WG3 A;  3N9M A;  5A3O A;  3DL3 A;  1QJE A;  3CZJ A;  1WCD J;  1ND2 C;  1O4Y A;  3NL1 A;  3I2F A;  4B8E A;  1LTE A;  2F4P A;  1CZT A;  3AMH A;  4CEW B;  2ZGQ A;  5LBC A;  3N9O A;  1DLC A;  4QX0 A;  3SQO A;  3N4M A;  1MVQ A;  2VZQ A;  1ZZ7 A;  3ZDV A;  5FZ3 A;  2R07 1;  1RUE 1;  5KR7 A;  4QX2 A;  1LOD A;  3ZYI B;  1UOJ A;  1HLC A;  1V6L A;  1WBF A;  3T09 A;  1HB2 A;  4MGY E;  1AX1 A;  1C5H A;  4CDU B;  4E2S A;  4I0B A;  3PL0 A;  1HXS 3;  2JD4 A;  3MLL A;  4MX3 A;  4PDW C;  4XW3 A;  4CPB A;  5I8Y A;  3GCX A;  1X33 A;  3JBG 3;  1CJD A;  1QNY A;  2FZ2 A;  1ASJ 3;  5LBE A;  4N7U A;  3NV3 A;  1RUE 2;  2QDR A;  4I30 A;  3OPZ A;  1JBC A;  5B4N A;  2LS6 A;  1FOD 1;  2GC3 A;  2ZAH A;  2FD8 A;  3P3N A;  1YIF A;  2B46 X;  2BNO A;  5F3I A;  5IT6 A;  2PHF A;  2O1Q A;  2VM9 A;  3FFZ A;  1RUJ 1;  4WM7 A;  3WP3 A;  4MET A;  2VBB A;  1I5P A;  3J9S A;  5A32 B;  4PDW A;  3N7M A;  4ASK A;  2ZX3 A;  3LPF A;  2XWJ B;  4DZG A;  2VNV A;  4IGP A;  1HJG A;  1BBT 1;  2Y26 A;  4JGY C;  2XJP A;  4R52 A;  3BB6 A;  4M01 A;  1POV 3;  1BHG A;  4R4Z A;  3JZV A;  3QAC A;  3T08 A;  4P9J A;  1HIX A;  3NQH A;  2W1S A;  4XIL A;  1EAH 1;  5CG9 A;  4YVW A;  2BFU S;  5BPX A;  3L2H A;  4MVT A;  1DQ2 A;  2PN5 A;  2X53 S;  4B29 A;  4GAZ A;  1Y9M A;  1UIK A;  3NV1 A;  1OPM A;  5FO9 B;  1SBE A;  2EXI A;  1IQD C;  2VCB A;  3RZZ A;  3IDC B;  1VBB 1;  2AUY A;  4FT8 A;  3E6B A;  1XNK A;  2P6C A;  1N3P A;  1LOC A;  3MW3 A;  3WQ7 A;  1GWL A;  1MAC A;  1EAH 2;  2TEP A;  3MF9 A;  1RUC 3;  4LOR A;  3C7O A;  2DVF A;  1R1A 2;  4UBH A;  1HKD A;  4HMZ A;  4WZF A;  5DPN A;  3V0A A;  1C8M 1;  3DXU A;  2HWC 1;  3NNJ A;  2CAV A;  1OD3 A;  3M7A A;  3SXW A;  1YEW A;  2YBP A;  3I4I A;  3KHB A;  4LE4 A;  4BXF A;  5FRA A;  2IVJ A;  4PF1 A;  4IV3 B;  5JXI A;  5IFT A;  1RUI 1;  2CGN A;  3VB9 A;  1RHI 1;  4K3U A;  2WZE A;  2JG8 B;  4CCL A;  1IPK A;  4HFS A;  1F5J A;  2EAK A;  1S0G A;  4OVE A;  4LBK A;  4A3Z A;  4AVC A;  1H8T C;  5I93 A;  3VDB A;  1AYM 3;  1H6Y A;  3N3H A;  4CDX A;  4BQ3 A;  1H6X A;  2W94 A;  4CEW A;  1J1T A;  5CZK A;  2UWC A;  3LSE A;  3WHU A;  5LWB A;  2ZX0 A;  3WXP A;  4CCK A;  3ZSJ A;  1HJF A;  2WO3 A;  1WLC A;  2WT2 A;  1XXN A;  2W3J A;  1RUG 2;  2W87 A;  3RI9 A;  1K42 A;  2F17 A;  4CP1 A;  3AMP A;  2P4E A;  2W47 A;  4A3X A;  4ET7 A;  5EXO A;  3TEY A;  1JZ7 A;  1SLT A;  4GUL A;  3M8L A;  1NZI A;  4BWO A;  2WYS A;  4DNY A;  5BV6 A;  3GJA A;  4NO4 A;  4XFC A;  1RUG 1;  5BXX A;  2CGP A;  1U5Z A;  2WRA A;  3I54 A;  2QQO A;  5F6L B;  4YW5 A;  3WNK A;  1DBN A;  1H4G A;  2QTW B;  5LCW L;  1CAX A;  3PME A;  2ARE A;  1VB4 A;  4BPZ A;  2C24 A;  1DGW A;  2AGS A;  1UCX A;  1SFP A;  3MPB A;  4A7Y A;  2DYC A;  3WQ0 A;  3C7G A;  4S2F A;  1I1E A;  4XMI A;  2H6C A;  4GKX A;  1MS4 A;  5A7N A;  3B69 A;  5SV8 A;  5IK4 A;  4NIH A;  1IHM A;  4LK7 A;  1N1T A;  2Q8D A;  3ATG A;  1UZY A;  2WS9 3;  5L19 A;  3QH7 A;  4XJ9 A;  1S0I A;  3GHM A;  3P5B A;  2YGM A;  4Q4X 3;  5FLI A;  5FKC A;  5DUW A;  3K2O A;  3A4U A;  3HMY A;  3VHR A;  2W08 A;  4QX8 A;  3ST7 A;  3EXU A;  4ORF A;  3OGG A;  3HN3 A;  4HSJ A;  1OFN A;  2QCS B;  2ZZQ A;  3ENR A;  1FMD 1;  1FPN 2;  3AZV A;  4EWD A;  1IOA A;  5CA6 A;  5FZ6 A;  2F4L A;  1CX1 A;  3JB4 C;  3ZYG A;  3ZKY A;  2JIJ A;  1OVS A;  4G9S B;  3WW4 A;  5A6Y A;  2PHU A;  3FHI B;  4IQP A;  1G9C A;  1VIW B;  1OSG A;  3H8X A;  2OX0 A;  1YQC A;  4Y20 B;  4TZD A;  2VD7 A;  4Q0Q A;  3I2I A;  3ZM8 A;  4Q4V 3;  4PJY A;  4RS5 A;  4AED C;  4XXP A;  1OUR A;  1W8U A;  2Y8K A;  4AK3 A;  5CG8 A;  3ZFE B;  1IS6 A;  3O1R A;  2XR4 A;  3A0K A;  4CXX A;  2VZO A;  3WEZ A;  4MGK E;  2OS2 A;  4CEY C;  3LE0 A;  4NVP A;  3MI8 A;  4MO3 M;  1DZT A;  3GBG A;  4PLN A;  1VB2 A;  2P3K A;  4NRP A;  4B4Q A;  1R09 1;  4NJ4 A;  4Y22 A;  5FDB A;  1OH3 A;  2VU9 A;  2VOV A;  5KXE A;  3WHT A;  3UJQ A;  1AR7 1;  3D5O A;  1TME 3;  1CAW A;  3WDT A;  2VAU A;  3MFC A;  4KU8 A;  4C1X A;  3FBY A;  4FPC A;  4QGN A;  1R09 2;  4CP9 A;  1JYN A;  1JUI A;  1ZX5 A;  2R06 3;  4K21 A;  1ZRF A;  3IAP A;  5FY4 A;  5I91 A;  2VL4 A;  2A3W A;  2BVV A;  2GND A;  3M3C A;  2LRP A;  3H7Y A;  3H42 B;  3OUJ A;  3RQ0 A;  3NAP B;  1YJK A;  4UT5 A;  3WP5 A;  4P9I A;  1W6P A;  3OEA A;  1JYV A;  1MZF A;  1QKQ A;  2WAA A;  5CIR A;  4A2U A;  4N53 A;  5C70 A;  2LUW A;  2RJ2 A;  1PO1 3;  2ZKN A;  3J7H A;  5LBF A;  1UPI A;  4WM7 B;  4LBO A;  1FNZ A;  1SBD A;  3A23 A;  2JIG A;  2W1Q A;  3FMG A;  3JB8 A;  5HPO A;  3OUI A;  1VBE 1;  2WFF 1;  4CEY A;  4DY5 A;  4JQR A;  5GLZ A;  2WII B;  1MVE A;  4PDW B;  5J3U A;  1W2T A;  5JXG A;  3MLK A;  5T5L A;  3WIN E;  3D3A A;  2XJR A;  1FOD 3;  1OC1 A;  4ARY A;  2Q8O A;  2GH2 A;  3WG2 A;  1VBE 2;  1HW5 A;  1KS4 A;  3ZXK A;  1DYK A;  4ZHN A;  3SCF A;  4XC9 A;  3WT3 A;  4LLF A;  1LJ7 A;  4BB3 A;  5FY5 A;  1JYT A;  2ZEW A;  1ZZC A;  2TBV A;  4QGL A;  4DUV A;  4L92 A;  5FP8 A;  1V00 A;  1C4R A;  5JR7 B;  2RS3 3;  4S2H A;  3WNL A;  2ZEX A;  1GOF A;  1W04 A;  2C9K A;  4IES A;  5IUQ A;  4EJR A;  4HVR A;  4URA A;  1B35 A;  2WNV B;  1ULC A;  1YQ5 A;  1XNB A;  5C3R A;  3FX3 A;  5GLV A;  2P3Y A;  2TNF A;  4YVW C;  4E4Z A;  2C6S A;  3V64 A;  5ACA 2;  4QQP A;  4UF0 B;  5C8C C;  5F1R A;  1NCQ C;  1SCS A;  2YV8 A;  2DBI A;  5KC6 A;  1TMF 1;  1UW8 A;  3AX4 A;  1ULO A;  3WDW A;  1PMJ X;  2JDU A;  4P02 B;  5J1X A;  2JX9 A;  4I02 A;  5FK8 A;  3T1L A;  3OBT A;  1UOF A;  5A6Z A;  5LY1 A;  1W2U A;  3WF2 A;  3USS A;  2VGD A;  1HDK A;  4NRQ A;  2BRT A;  2HEW F;  5BNQ A;  2YC4 A;  3WNN A;  1HB3 A;  4L8Q A;  4BOW A;  2VQU A;  2O8Q A;  1NA1 C;  4GWM A;  2OYZ A;  1UOG A;  3KT4 A;  2Y6L A;  1N1V A;  1NQD A;  5L9V A;  5A7Q A;  1PO1 1;  1US3 A;  4K6B A;  4OMC A;  1LU2 A;  3ZPY A;  2PLV 1;  4N9H A;  3RMY A;  2QQI A;  4I2O A;  2XKO A;  5FJK A;  1Q8S A;  4GB3 2;  2D6K A;  5K4L A;  5LRR A;  3WNP A;  5JOW A;  1FYU A;  2VPV A;  2ZGM A;  1UXZ A;  1W39 A;  4X6R B;  1RIR A;  3A22 A;  3HQX A;  4BIO A;  5E8A A;  3UYJ A;  1G9F A;  3ZYP A;  1GOH A;  1J59 A;  1YFY A;  2PHW A;  4XET A;  5I8S A;  2JWP A;  2WZ8 A;  3WF0 A;  3KS7 A;  4AG4 A;  2WO1 A;  4YG3 A;  4AVB A;  2B9U A;  4QHO A;  4QXH A;  5FZ1 A;  5JWP A;  1LU1 A;  1YLL A;  3VBU B;  2OII A;  2ZGN A;  3K75 B;  3RNS A;  2XGX A;  3AMQ A;  4QQL A;  4IV1 A;  1GWK A;  4UWD A;  2RDN A;  2A3Y A;  3PIG A;  2HYK A;  4AI0 A;  4QX1 A;  2FDF A;  5DZE A;  5FYM A;  2YB7 A;  1R09 3;  3ES4 A;  3K51 A;  1JYX A;  5HCF A;  1LOB A;  5J7M A;  1ND3 A;  3GJB A;  1UZZ A;  3CBN A;  5DAX A;  2GC2 A;  1AF9 A;  2VUL A;  3TEW A;  2HWD 2;  5FYZ A;  1DGR N;  2XLG A;  4XQ4 A;  1R64 A;  1PMH X;  4YG6 A;  5APA A;  4A42 A;  4AHX A;  1JZ2 A;  1G9B A;  4G3Y C;  2W1U A;  3VBU A;  2KA3 A;  5KHH A;  2VMG A;  1VMJ A;  2ZHN A;  1COV 1;  1RTV A;  1ZBE 1;  1AR9 2;  1ODM A;  2FMD A;  2QJV A;  3F95 A;  1H8T A;  1S1A A;  5H9R A;  4EN7 B;  1P8J A;  3HVD A;  4AZZ A;  4GD4 A;  5JIA A;  5EIY B;  1DQ1 A;  2A6V A;  2ZGT A;  4QX7 A;  4UF0 A;  2JEM A;  1US2 A;  3MGU A;  2WAO A;  3DGT A;  2RM2 2;  1HN0 A;  3OYW B;  2UUR A;  4R9A A;  2YGL A;  1EY2 A;  2G1M A;  2PLV 3;  2WZR 3;  2Y38 A;  3DN7 A;  2XJU A;  3Q8C A;  4OI2 A;  1SEF A;  4NN0 A;  5E89 A;  2FDK A;  2OW4 A;  4CXW A;  3PUI A;  4UBG A;  3OJB A;  2UY9 A;  5CFD C;  3VD9 A;  4DMI A;  3LOB A;  5FZL A;  1EV1 3;  1D2Q A;  2Y6H A;  4QKB A;  4YM1 A;  4YVS B;  5EV7 A;  2R30 A;  2VH9 A;  3MIC A;  3I49 A;  1XE7 A;  3H8U A;  3ZYJ B;  1VBC 3;  3VHO A;  4CEW C;  1A78 A;  3BGA A;  3D0J A;  4CU6 A;  4O7X A;  1KIT A;  1ND3 C;  1S0F A;  2ZJC A;  1G7Y A;  1MEC 3;  4D0Q A;  1PGW 1;  1Z7S 2;  4AI2 A;  2JG9 C;  2YC2 A;  2VBP A;  4R8H A;  3PU3 A;  4Q4V 2;  4D3W A;  4MLO A;  2ZMK A;  3SC7 X;  4XF1 A;  1D4M 1;  2RS1 3;  4CU8 A;  1W2O A;  3ZPO A;  1CAU B;  1YXW A;  4UFH A;  3S6P A;  4ITC A;  5JLV A;  3U75 A;  4MZU A;  2RDS A;  4IGO A;  2RS3 1;  5A3N A;  2GNB A;  3VBF A;  4MXW B;  1NT0 A;  3IT8 A;  5HCB A;  3RG0 A;  1PVC 2;  4BK5 A;  4Q4V 1;  1OOP C;  5FZ9 A;  2C26 A;  2VBD A;  1AX0 A;  4N53 B;  1IPS A;  3B00 A;  1FPN 3;  5FZ0 A;  2PQQ A;  1SZB A;  3LA2 A;  4OCT A;  2IXL A;  1REF A;  3RRD A;  1R1A 3;  2WBK A;  4LBJ A;  2C0Z A;  3VKM A;  3ZIW A;  5JMO A;  4AVT A;  2PHL A;  3I97 A;  2J1S A;  1W8T A;  3JD7 1;  3KV5 A;  4IW3 A;  5FMD A;  3VDD B;  3WLU A;  3KV4 A;  1E57 A;  2XG3 A;  5E88 A;  3BU7 A;  2YMZ A;  2WWU A;  3UGH A;  3OPT A;  4L0P A;  1FV3 A;  2XBO 3;  4MXW A;  2ZZJ A;  2E26 A;  3AZZ A;  5BNP B;  3L9J T;  2GSY A;  5E16 A;  1G8W A;  1UYY A;  2VVF A;  1B35 C;  4XQW A;  1KRI A;  5LEK A;  4XBL A;  4B4P A;  3RWK X;  2I07 B;  2D3S A;  4LIT A;  3AP6 A;  1C3H A;  4B1L A;  1GQH A;  5K7P A;  1SHW B;  2VUC A;  1AJK A;  5CAZ A;  4O9E A;  4IEP A;  3ZYR A;  1VRB A;  4K9S A;  2MHF A;  4KMQ A;  5L73 A;  3VKN A;  3ZN6 B;  3RZH A;  5F2W A;  5FYB A;  1JZ8 A;  4BA6 A;  4H7L A;  4QU1 A;  4JRL A;  4Z2W A;  4LO4 B;  1MEC 1;  1AX2 A;  3I3Q A;  4XBQ A;  3O1P A;  2BOJ A;  2Z79 A;  1LGC A;  4DXR A;  2GMP A;  5IAT A;  1MS9 A;  1W6Q B;  2IFW A;  5JXH A;  2DCK A;  1PGS A;  5DN2 A;  1J84 A;  4JKK A;  2GZW A;  1AYN 1;  1WA4 A;  1U5I A;  4FPL A;  4OUE A;  3MFA A;  5FYY A;  4D7T A;  1VMF A;  2IXK A;  1OLR A;  3FC0 A;  1NZC A;  4ZXE A;  1ULE A;  5FR3 A;  2BU9 A;  1VJ2 A;  3PUS A;  2PMW B;  2JDP A;  5C9A A;  1AYM 2;  3LIH A;  1UO9 A;  2WZR 1;  3FL7 A;  5BNO C;  1LOF A;  1Y9Q A;  1E5S A;  3PUH A;  3AVR A;  3BTZ A;  4LHN A;  1A6C A;  5A7W A;  1BK1 A;  2NQY A;  5DAV A;  4WM8 A;  1O5U A;  4QPG B;  5FYC A;  1QDO A;  1XBF A;  1AYM 1;  5FZO B;  1ZBE 3;  1F31 A;  1JU4 A;  2RS1 2;  3B93 A;  4OUL A;  2Q5T A;  4RN5 A;  1DZR A;  1RUC 2;  1PNG A;  4UYB A;  3ZXA C;  4FAH A;  4JQT A;  1HV0 A;  1ASJ 1;  2CDP A;  1RVF 3;  2ADD A;  4CZS A;  1SLC A;  4HPK A;  4FSJ A;  3HT2 A;  4AE2 A;  4Q4Y 3;  4CCE A;  5ABJ B;  5CNA A;  2PYT A;  5I0T A;  1WD3 A;  1RL3 A;  3ZFF A;  4JDM A;  1QQP 2;  1PO2 3;  2E63 A;  2ZS6 B;  2ZXQ A;  3KF3 A;  1OF3 A;  3CF6 E;  4RD7 A;  4IV1 C;  3MLJ A;  4AI3 A;  2GP5 A;  3EQE A;  3QOP A;  3AKQ A;  3O12 A;  1Y7B A;  4KNC A;  1HXS 2;  3WW2 A;  4U36 A;  4B7K A;  1T2X A;  1G6N A;  1OUS A;  1MZ5 A;  1NCR A;  2ZA9 A;  1QJU 3;  2ARA A;  3FN9 A;  5KHG A;  3CJI B;  4QWN A;  1OA2 A;  1SAC A;  2Z4F A;  1XPW A;  3PUR A;  3RDI A;  2WFF 3;  4BMB A;  4A7K A;  2Q0A A;  4NRM A;  3NJX A;  1DQ5 A;  1QJU 1;  1ZA7 A;  4FXG B;  4D6S A;  4YFZ A;  3RZL A;  1J83 A;  2EIC A;  1AR9 3;  1APN A;  3JUU A;  2IWG B;  5DUV A;  1AL2 2;  1AXY A;  1QU0 A;  1XC6 A;  2IFR A;  2I74 A;  2VOX A;  2W68 A;  2YPD A;  1WCS A;  3NV2 A;  4L97 A;  4CDX B;  3ZYH A;  1KFX L;  3HNB M;  1BBT 3;  4MGS A;  3SH5 A;  2Q1M A;  2Y60 A;  5FO8 B;  5KXB A;  3KV9 A;  4YG0 A;  2VNO A;  2VZS A;  2AEN A;  1O6U A;  1CAV B;  1EV1 2;  1BVP 1;  1VAM A;  1W06 A;  3FHA A;  1Q8P A;  3ABZ A;  3AYA A;  4GB3 3;  2A7A A;  5A6X A;  2QQP A;  3HOB A;  1GZW A;  4RFT 0;  3FWE A;  3ACF A;  3NMB A;  4I0A A;  3H3L A;  3W5N A;  1AR6 2;  1R1A 1;  2EXH A;  4OQ9 A;  4Q29 A;  2X5I A;  5JUV A;  2Z2S B;  1SDD B;  3QBQ A;  4P08 A;  4NOT A;  1LGB A;  1RUH 2;  5KBF A;  3SCH A;  3OSD A;  1S0C A;  2XDV A;  1ODN A;  3OD4 A;  4Q8K A;  1NXD 1;  1UMI A;  4FPH A;  3AZW A;  3E97 A;  3AFG A;  2KR2 A;  2ZEY A;  1OF4 A;  3ZXF A;  1V6I A;  1HQN A;  5A33 A;  5CAD A;  3DKQ A;  1WW4 A;  1GZC A;  1JOB A;  1RMU 3;  2JE8 A;  3AL6 A;  5T5O A;  4XFG A;  5LA0 A;  3KGZ A;  3VBH C;  2P6H A;  2WWS A;  4CP9 B;  2WNU A;  1BCX A;  3VBS A;  1UN1 A;  4AWD A;  4DFS A;  2QZ3 A;  5FZD A;  5JZG C;  1AYN 3;  4GWI A;  2ZX2 A;  1S2K A;  1A8M A;  2G9Z A;  2ZHK A;  3AP5 A;  1MS1 A;  4JKL A;  4HXC A;  5C6C A;  4XYX A;  5HI0 A;  2QBX A;  1UWW A;  3CDZ B;  2C4X A;  1DGR A;  5CFD B;  3C3V A;  2VW1 A;  2D5F A;  3U37 A;  2XJT A;  3N35 A;  4L11 A;  4EZH A;  1JS9 A;  3TB0 A;  4FVV A;  4MOA A;  5A7S A;  1GBG A;  1Q8O A;  5A1F A;  5A33 B;  2DFB A;  1OLQ A;  2D93 A;  4FQZ A;  3URF A;  3VD7 A;  3VZK A;  4Q2F A;  4HT1 T;  4ASL A;  1WMF A;  2PTM A;  4K20 A;  4Z92 B;  4Q4X 1;  5FKB A;  2DU1 A;  3P1I A;  4QB1 A;  4Y5S A;  1PIV 3;  1HB1 A;  4TLG A;  4DB5 A;  2JXA A;  5FP9 A;  3RYR A;  2V4V A;  3CZU A;  3KLS A;  5K8S A;  2CWM A;  5KC5 A;  4QKN A;  3UT0 A;  3R4S A;  3I3B A;  2D6O X;  3NW4 A;  3PNA A;  4J1W A;  2ORZ A;  1K45 A;  1ULG A;  1SG3 A;  2WUH A;  3M3I A;  1HRV 1;  4S2G A;  2R06 1;  4LUL A;  2WNU C;  2H0B A;  3VBS C;  4CCD A;  5IVV A;  1XND A;  4M3C F;  2ZGO A;  5FYS A;  2P5B A;  4C1W A;  1GYK A;  4LBQ A;  1TQ5 A;  5HV4 A;  3VZL A;  3KQR A;  5KWR A;  3UNP A;  5DUX A;  3VDD A;  3FBM A;  2Q8C A;  1D7P M;  2RS5 2;  5L9B A;  1B35 B;  4XCA A;  5FYU A;  3M1H A;  2B5H A;  3BKZ A;  1Q3E A;  1W99 A;  3OGS A;  3JU9 A;  3OBA A;  4AW7 A;  4XZU G;  4URT A;  2F6B A;  4TN7 A;  4AI1 A;  3AYE A;  4YVS A;  2HEV F;  5JAX A;  2BYV E;  1ZM1 A;  4C8D A;  4LHL A;  4OUS A;  1LHW A;  1WA6 X;  4ZY9 A;  1IZ3 A;  1GMM A;  1VE0 A;  4YGB A;  5D1I A;  5AVP A;  2A73 B;  3KCC A;  5D2A A;  1MQT A;  2QKD A;  2QQL A;  3ZXJ A;  1OHF A;  1MS3 A;  4Y4R A;  1LKN A;  2CAU A;  4GWN A;  1JZ6 A;  4AGV A;  3JXS A;  5FWJ A;  1LOG A;  1PM7 A;  2B42 B;  3WX5 A;  2BWA A;  4KG8 A;  1QOO A;  2X8K A;  4FFI A;  1AR7 2;  1OOP A;  4U2A A;  1FMD 3;  2RR1 2;  1DF0 A;  1PZ7 A;  2Y6K A;  2Z5W A;  3WG4 A;  3R4U A;  1Q43 A;  3V65 A;  1RUJ 2;  1K5M C;  4BLI A;  1XNC A;  4CUG A;  3VKF C;  3OY8 B;  2AAC A;  3MBW A;  5JMC A;  1LB2 A;  1UL9 A;  2CNA A;  3HNM A;  4XAE A;  4LXL A; 
#chains in the Genus database with same CATH homology
 3KT1 A;  5IAV A;  4XAA A;  4ZON A;  3GZE A;  5EPA A;  4NHY A;  5LAS A;  5C5U A;  4Q5O A;  3DKQ A;  5LBB A;  3HQR A;  3W20 A;  4JZR A;  5EP9 A;  4NHM A;  3HQU A;  4UWD A;  2RDN A;  5IAT A;  3NNM A;  2Y33 A;  3W21 A;  4Y5T A;  5EQU A;  5HV0 A;  2Y34 A;  5C5T A;  3GJB A;  2OPW A;  5LAT A;  5DAX A;  3NNJ A;  4NHX A;  3OUJ A;  5M0T A;  4NMI A;  4BQX A;  5DAV A;  5LB6 A;  5LBF A;  4XAC A;  4Y5S A;  2JIG A;  2HBT A;  3BVC A;  3OUI A;  3MGU A;  4MHU A;  4XCB A;  5DAQ A;  5LA9 A;  2G1M A;  5L9R A;  4ZPI A;  2RDQ A;  5ERL A;  3GJA A;  2G19 A;  3ITQ A;  4XC9 A;  2HBU A;  2RDR A;  5HV4 A;  4MHR A;  3KT7 A;  5L9B A;  2FCV A;  3EMR A;  4XAB A;  5IAX A;  4NHK A;  5LBC A;  5DAP A;  2A1X A;  4XCA A;  4J25 A;  2RDS A;  5DAW A;  3OBZ A;  3NNF A;  3PL0 A;  2V4A A;  3NNL A;  5LBE A;  2JIJ A;  2RG4 A;  3KT4 A;  2FCT A;  5L9V A;  4IW3 A;  4KBZ A;  4BQY A;  5A3U A;  2FCU A;  4BQW A;  4NAO A;  3OUH A;  4NHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...