4NIGA

Crystal structure of alkb d135i/e136h mutant protein with cofactors bound to dsdna containing m6a/a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKIHPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/dna
total genus 49
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nigA00
3BU0A 3I49A 4O7XA 4MGTA 3BTYA 3T4HB 4JHTA 4CXWA 2FDKA 3T4VA 3RZHA 2FDGA 2FD8A 4CXYA 3I3MA 2FDJA 3RZKA 3BI3A 4MG2A 4NIGA 3I3QA 5DABA 3O1SA 4IE4A 3LFMA 2IUWA 4NRQA 4NROA 4IDZA 4ZS2A 3S5AA 3I2OA 2FDFA 4OCTA 3O1UA 4NJ4A 3BTZA 2FDHA 3O1VA 4IE0A 3O1OA 4IE5A 3RZGA 4ZHNA 4QKBA 3RZMA 4NPMA 4NRMA 3BTXA 3T3YA 4IE7A 4NPLA 3H8RA 3RZJA 3KHCA 3O1RA 4QHOA 4IE6A 4ZS3A 2FDIA 4RFRB 4QKNA 4NIHA 3O1MA 3BKZA 4NIDA 4QKFA 4CXXA 3H8OA 3KHBA 3O1TA 3BIEA 3O1PA 4O61A 4QKDA 4NRPA 3BUCA 4NIIA 5F8PA 3S57A 3RZLA 3H8XA
chains in the Genus database with same CATH superfamily
1XSRA 2PXJA 2WABA 1QJX2 2AEZA 1UZYA 4MGTA 4BJ0A 4I2OA 3S30A 2WN3A 1CESA 4BM8A 1UIJA 2JXAA 1RUNA 4LBKA 4RQPA 1OD3A 1CZTA 1FV3A 4OI2A 1C8M3 4Q8LA 5E88A 4YARA 1HQLA 1DG6A 5JAXA 5D8AB 4LITA 3R4UA 5KHHA 1OH3A 2FCVA 4D6SA 1ZZ9A 1RUE3 3RSJA 5T5OA 4A2UA 4Q4X1 1HLCA 4Y1UA 2XWBB 3RZHA 3MLJA 1WUVA 5CA6A 1LESA 2Y8KA 1ZBE1 5M0TA 1CIWA 2RM22 4UOJA 1O59A 1O3RA 4XBLA 4K7JA 4P02B 1UU6A 4ASMB 2DCYA 1VBE3 2XH6A 5L7OB 1OKQA 2GDFA 4UFKA 3ZVXA 3FFQA 1N3OA 2BYVE 2VZ1A 5FQ0B 1AJOA 2RHPA 2WO7A 2BBVA 5ANQA 3GGLA 4HETA 1PZ7A 4LHKA 1HW5A 2WDBA 2MPFA 1BK0A 4OI0A 2JWPA 4AFMA 4QU1A 3SCHA 5FZHA 2UWCA 4MLOA 2DUQA 4GAZA 3O1UA 1CR7A 4N7IA 4LT5A 5FTTC 2QCSB 1D2QA 5FPUA 2JKXA 2WS92 2FDHA 1FI2A 5FLJA 1NXMA 1W6PA 4BB3A 3AYDA 2W91A 4IEOA 4UW6A 2VMDA 4ZHNA 3POSA 3DYMA 2D7FA 4CDUA 3V0AB 3H3LA 4UW5A 1BXHA 3INAA 3AP9A 1UOGA 1H2LA 5F3EA 1U5IA 1UYYA 2G9FA 1XQNA 1W39A 5C9AB 2WINB 2XHKA 4FCAA 2BZDA 1OPOA 3AXDA 4BZ4A 1LOGA 1LODA 3H0OA 3QH6A 3WP4A 4BPZA 4FXGB 1DLLA 4NIAA 3ZXKA 4JKMA 2AACA 1VMJA 2JB8A 2Y64A 3ORJA 4H55A 1EUTA 2IWGB 3F2ZA 2H0BA 4QHOA 5FJKA 3WNOA 1JYNA 4B1MA 3FHAA 3ACGA 1AX0A 2PQSA 3AZVA 4DUWA 5HPOA 5KHJA 1W2TA 3WOGA 4NVPA 1X36A 2J1VA 1WKYA 1WW4A 2ERFA 1GQHA 1L7RA 1NQDA 1O4YA 1UKRA 1LGNA 4CEWC 1NOVA 1EP0A 3WXPA 1RIRA 2O8QA 3IB3A 4PHZA 4BK5A 4W6XA 3W5MA 5IW0A 4NHXA 2GMEA 3PMSA 4OZXA 4ONUA 2YFZA 1ZRRA 3QOPA 5EPAA 2VVFA 2RE9A 2VMCA 5T50A 5FP4A 3LEKA 3PUAA 4MUVA 5JIUA 3K3OA 5CNAA 2D3RA 4DUXA 1VIWB 2ZPXA 3VKFC 1PZ9A 1QKQA 4K9SA 4FVVA 5JR7B 2ZMKA 4YM1A 4FPJA 4YVWA 4H7MA 5FZDA 5I8YA 2ES3A 2ADEA 3RWNA 3V64A 2RJKA 5KXDA 1BBT2 1WCKA 3HR9A 4I01A 5ERLA 4QKBA 2O1QA 3WW3A 1UNBA 2BBAA 2Y0OA 1Y43B 3WX5A 4RGGA 5LA9A 2HYKA 3UJOA 1AJKA 3GJBA 2XUMA 4EWDA 5JUVA 4LK7A 3KWVA 4HZFA 2EAKA 1NAEA 1JU3A 2ZHLA 3S5QA 4OVEA 3EJKA 3VZKA 3WLUA 1ULDA 3NKTA 3ALQA 1CGPA 2HWD2 2YY1A 2YDEA 3QCWA 3AFKA 1J58A 2AZ5A 2E32A 5IFPA 3I3BA 2A73B 2DU0A 2R30A 2VOVA 2DDUA 3KM5A 4NWVA 4FT8A 4Q2FA 4BXSV 5FY5A 1LOEA 1G7YA 1U5YA 2ZGOA 3I3MA 1KEXA 2VUDA 1Q43A 4C91A 4YYOA 4XUTA 5LEJA 2ORXA 5LA2A 2VG9A 3IDAA 4JDOA 5BNPB 4JAAA 1NA1A 1RUJ1 1RHI2 4YPJA 1DU3D 1C4RA 1XNCA 2JEMA 3WINE 3RJRA 4ZXKA 1QGLA 4CDWA 4CYDA 4XIOA 3QLQA 3HD8B 3DGTA 3GDBA 4NROA 3ZX7A 3I3DA 1QDCA 2TNFA 4XDOA 2K0GA 3ZXAC 1ULCA 1YNAA 1NCRC 2PLV1 3NSTA 2OW4A 2IVIB 4IV3C 4EWEA 1KQRA 1RMU1 3RYPA 2FDFA 1W3VA 1O5UA 5HXMA 5SV5A 4DO0A 5BUVA 2XBO2 1ZRFA 5KC5A 1BMV2 1KRIA 1Z78A 4GB32 2WNVB 3UGHA 1UX6A 1H2NA 4YNIA 4P9WA 1LCLA 2MHFA 3AKSA 1YFWA 2WT2A 1H0BA 3TBDA 2CAVA 2OA2A 1HXS3 2QQIA 4AEDB 4LHLA 4QQLA 2FCTA 5C5TA 2RJ2A 3IBMA 4HXCA 5KXEA 3OUJA 2VZSA 1FYUA 1HN0A 3JBG3 2ETEA 3VHOA 2OQ6A 4M3CE 5IUQA 5FAXA 4JDMA 1W2AX 3NJYA 2RDSA 4GWIA 2RS53 4XZUG 1B35C 3BB6A 5FZ0A 4P08A 1H1IA 2WYSA 5JOYA 2CY6A 4W50A 2DBNA 5C3PA 1F4AA 2WRAA 2XMLA 5BNOB 3EB7A 2QUOA 2DV9A 4LBQA 2VM9A 3K48A 2DTYA 3BKZA 3WQBA 2BERA 2ZXQA 2Q1FA 2WNVA 2X09A 4CU9A 1WBFA 1XYNA 1AR83 4G3YC 5JLVA 1HRI2 2JG8C 1JUIA 3NNJA 2BVBA 3MW2A 2NYYA 4KH9A 2ZZJA 4YVSA 1MS4A 3U4XA 4QM8A 3VGIA 2V09A 3N9MA 2PYTA 2WSUA 2BP6A 4XF4A 3OF1A 1RGSA 5FKCA 2NN8A 4XF0A 5EYXA 2EIEA 3USUB 3VD4A 2GNBA 3HAGA 5F37A 3PVNA 1F4HA 4LO8A 3AZXA 4BDVB 2YC0A 4XETA 1AR72 1RUC1 1CAUA 1KS5A 2Q8EA 3CKHA 3NWKA 1BK1A 1COV1 2YC4A 3OD4A 4I3PA 4QDSA 1W8WA 3T1MA 2D93A 1XXNA 3ZDSA 2O0OA 2R7EB 3KGZA 3OGVA 4QB2A 3V0BA 1IS3A 1PO23 2BWAA 1N3PA 1DF0A 1GZCA 1BVVA 1POQA 2XHNA 3SCFA 1G9BA 2VMIA 2E7AA 3IN9A 1VJ2A 3WP5A 2N7GA 1GQPA 1LOCA 3VD9A 5DN2A 4OI1A 2W52A 4JHTA 1W8UA 3E6DA 2NM1A 4YZ3A 4XHBA 2HWC3 5C7GA 2NP0A 2HBUA 3P5BA 5FUNA 4PF5A 4RQPC 5FY9A 5JSOA 1HJGA 4LORA 4KQ7A 4XUPA 4D0QA 2QKDA 4LPLA 2FD8A 3LAGA 2WN2A 4Q1PA 3J4UH 4TLGA 4OQ8A 5FMOS 3POYA 4QXKA 4S2GA 2HH9A 4QHBA 4PI0A 1PIV1 1SHWB 3OBTA 3OJBA 5FZIA 4OHYA 5LWBA 3USSA 4XFCA 4LQRA 4QPYA 3DYOA 4QM9A 3TRSB 4DXZA 2WA3A 5DAWA 5KXCA 5JXIA 2BJSA 2DVBA 1SCSA 4PLMA 3APBA 2VOKA 5A7WB 5GALA 5DZGA 2FZ1A 2ZAAA 4AWDA 5LY1A 1WW6A 1X8EA 1YXWA 2VVDA 1E57A 3SH3A 3VN4A 1VE0A 1PO11 3N9LA 2R0FA 1JW6A 4QWNA 4CTEA 4PBOA 3WCSA 1A8DA 4AI8A 4AE2A 1Z7S1 3PVOA 4ASKA 5H9SA 1SBFA 1V6LA 3T2TA 4K1ZA 3RZMA 5FYUA 1DQ4A 1H8TB 2D44A 1UW8A 1CPNA 2FMDA 3H7JA 1H4HA 3LEGA 4Y22A 1CJDA 3DF0A 3VBSB 1MEC2 1GUIA 3J7LA 4KMQA 2IFRA 1PMIA 2EIDA 4KGGA 3HJRA 3WV6A 5ABJC 1OVSA 4CDUC 3C8XA 4UBHA 3ZN5A 1VRBA 4L92A 1GICA 1VBB2 3B69A 3LB9A 4BQ5A 4PQ9A 2PELA 1S55A 1RB8G 4B4RA 2Y34A 4WVMA 5A7WA 3UKTA 3ZO0B 4DRVA 1RUI3 2GAUA 1WCDJ 2DVGA 1OA3A 2P3IA 4DXSA 1QJU3 1VBA1 3VBUB 3HNYM 2VOWA 1JZ8A 4LBOA 3O1MA 2R32A 3I8TA 5A7SA 2LROA 4QXHA 4IETA 4EN0A 4UFIA 4QGNA 3ETPA 1RUG1 1TNRA 5IAXA 5JPMB 2J22A 1XBFA 3DL3A 3B3QE 3VBSA 1FX5A 3X29B 1V9U1 1W9YA 1XOYA 4GIQA 4ZKTB 4HT1T 2HWB1 4UBGA 3KHBA 1GKBA 3MW4A 2ZEYA 1R081 5FZ8A 1V6NA 3Q8EA 2W46A 1VRH3 3ME2A 4P9XA 4FTEA 5FPAA 4YW2A 4AAPA 1HRV3 4COVA 1EAH2 1DQ2A 1A34A 1C8M2 1BEV1 3CQOA 4UFHA 4W6YA 4URTA 4WM8B 3AYEA 2CDPA 3H8XA 5IK5A 2EIBA 4DUVA 5DG2A 2WAAA 3WNPA 2B8MA 2E51A 2HWF1 4UYBA 4YVWC 2ZHNA 1RUE2 4BA6A 3ZXDA 1VMHA 1BJQA 1LKNA 5FZLA 5FK7A 3ZN6B 4JGZC 5F32A 5IFTA 1ZBA1 1TNFA 3AL5A 2V4AA 2OQ7A 1NLSA 3T4HB 5C6CA 1BMV1 1IS5A 1QQP1 2BUKA 1VBE2 1I1EA 4ZZ8A 2ZX2A 2BQPA 4OULA 1V6JA 1PGW2 3OSDA 5APAA 1OPMA 1I3HA 1YQ8A 5IVVA 2VTFA 5LATA 3LWCA 3ZR5A 3I97A 1NY71 4Q4X3 3ACLA 1DGWX 2QZ2A 2W39A 5F6KA 4QDQA 4IE4A 5KC6A 3WW1A 5FWJA 5JWPA 1ZBE3 1TME2 3BOPA 4P5YA 4Q27A 1LOFA 2K9ZA 3MIDA 1NA1C 4QQOA 4Y20A 1WA4A 2W0XA 1UWWA 3VBFB 1RUH3 1X8MA 1MPXA 4X6RB 3VBOB 4INDA 1JYTA 2KM2A 1SMVA 2WT1A 4XUNA 5FY0A 4CDWC 2MEV1 4DNYA 4QPIB 4AQ2A 4V2WA 4DB5A 2VJXA 3OUHA 4AVVA 4LO7A 1R1A1 2JECA 3OOXA 4OHZA 5FYZA 5JOWA 1LRHA 3RZGA 4UF0B 4EN7B 1QJEA 1RUF1 1FPN1 2TEPA 3A0NA 2XJPA 1SBDA 5FP8A 4BQ3A 2D43A 1OUXA 2Y6HA 1HV0A 3BTXA 4Q26A 3ILNA 3NQHA 3CJIA 1OVPA 1D4M1 3IMNA 4EN6B 1QNYA 4GMP0 1UU5A 1JOJA 4B29A 3D4KA 1JUHA 5LEKA 2W5FA 1GFF2 1JXNA 4QQHA 2D6KA 5T5LA 3N9PA 3ZYBA 3O7OA 1NT0A 2YPDA 2GALA 4IV1B 2Y38A 5FYHA 1LULA 1C57A 1W04A 2BV4A 1Q56A 2Q1ZB 3IIAA 4LNVA 4TN7A 5FUPA 1A3KA 3E5UA 4LIVA 1GLHA 3T08A 2TBVA 5FZ7A 4QHZA 3ZYGA 2B4KA 2K2SA 2VR4A 4BIFA 1ZA4A 3NV3A 3KV4A 4NIHA 3Q8AA 3WUCA 1ND3B 4CU7A 4FAHA 1PGL1 3KVAA 2R071 4PQQA 2JKBA 2YMZA 3PNAA 3TB0A 3LOBA 1YJKA 4WBBA 1CVNA 1CN1A 2B9UA 3ILRA 4YW1A 4A42A 5F39A 2WNVC 2WO3A 4HMZA 3PUHA 2VMFA 4XDQA 5F3IA 3MIEA 3LSDA 1GV9A 1GR3A 1PK6B 4PI2A 4CCLA 2WAOA 1YI9A 2ZGNA 1EV13 1PVC2 4YVSC 4DY5A 1H30A 2ZKLA 3N35A 4CU6A 1SG3A 2VQUA 1CZVA 3CLPA 4XYXA 2OVUA 5CG8A 3GZEA 1JZ5A 5A3LA 5A1LA 2D3SA 4AF9A 1DDLA 4CPBA 4Y5TA 5I0DA 1ND3A 3BTAA 3K75B 5FZOB 3RI8A 1NXD1 4XC9A 3B9CA 2XQRA 3NL1A 1Q8QA 1GU3A 1ULOA 2VPVA 3C7EA 2DVAA 3TYJA 1DYPA 4CUAA 2VCAA 4CXWA 2GN3A 2W47A 1TMF1 5JSRA 2FDJA 1N3QA 2QFEA 2ZGLA 1W2UA 2EF6A 5CKMA 2GC3A 1PK6A 4KWJA 3CZUA 4ASLA 3SLIA 5AC93 2R063 5FY8A 4E27A 5L9VA 4Q0QA 3D5OA 1WCUA 3I2KA 3SITA 3J7MA 3UNPA 3VL9A 3M70A 1AL21 4GZ9A 1SEFA 4Y4YA 4Y1VA 4UXAA 1W9SA 2I07B 1RUJ3 2P1BA 3CIHA 5J98B 3ZFEA 1F5FA 4AI3A 3N7MA 5JOZA 1FOD1 3OTFA 2BTVC 3LE0A 5FZOA 2OKXA 3PVBB 1T6GC 5D2AA 1O4ZA 3H1MA 1HXS2 4WVWA 2A7AA 1CAVA 2PTMA 3POGA 1YFXA 4PCRA 3TNPB 1ASJ1 1O3QA 2YGMA 1FATA 2VQAA 1W6QA 1F8VA 3QD6A 5LB6A 3TEXA 3JBG2 2NMOA 1BKZA 5C4WC 3Q8CA 5DMYA 2PLV3 3AJZA 3N7JA 4XFFA 2QQVA 2RJLA 3O1OA 1XE0A 1HV1A 4YLZA 3ECQA 2RS52 1YEWA 2SLIA 3W5NA 2Y6GA 4E2QA 3MDPA 3Q8FA 3AP4A 3GF6A 1QU0A 1TQ5A 3CHXA 1D7PM 1MS1A 1R1ZA 3FC0A 3NNFA 2D6MA 2RMU1 1H6XA 1JH5A 1DGWA 3WQ0A 1XU2A 3VDDB 5ISLA 2Y0IA 3LDRA 4H3WA 5F7UA 2OPWA 3JUUA 4YG3A 1AR82 1HB4A 2C9AA 4OLLA 5CFCA 4YZ2A 4Z8BA 3B93A 2B46X 4MVTA 3LZZA 1N47A 3HPNA 5FXZA 1PX3A 1F31A 2VQ0A 4CUGA 2F4PA 4DXTA 3OGRA 2CGPA 1QJX1 3AMMA 3TN93 3WY6A 3MYXA 5JSPA 2IFWA 2VTXJ 1C1FA 1TZOA 1UO9A 5K0UA 2YG0A 4M00A 5LBFA 4ZZ5A 3FBYA 3EQEA 4XACA 4AXOA 2UURA 1W6OB 3IPVA 4DEVA 3IAPA 2JDNA 2OS2A 4MOAA 4NHYA 4XAEA 2VAUA 1QJY1 4YZ1A 1JYWA 2XJTA 3M3QA 1HIXA 1PO22 2XONA 3HNBM 3MV01 4LHSA 5DUVA 3VHRA 4CP9B 3UETA 1DGRA 3VB9A 3E5QA 4RHV3 1VBD1 3N9QA 2WA4A 5JZGB 2PHRA 3HBZA 2GNDA 1SFPA 4XW3A 3E6CC 1DBNA 2JDHA 1SLIA 2HWC2 2XVKA 1SBEA 1YJLA 3LF7A 5IK8A 2RS33 3S0MA 1GNYA 3Q9OA 4FOWA 2QJVA 4XF1A 1NCQB 1UOJA 1O5LA 3FN9A 3KMHA 4NPRA 2J42A 4QX3A 4JGYA 2FCUA 1QF3A 2PAKA 3U78A 2KR2A 1AXKA 2W94A 1FAYA 2R6QA 4UW4A 1XNTA 4B4PA 5A6YA 1AR61 1AX2A 4CCCA 2FQPA 5IJRA 1JHNA 2D3PA 4LBJA 3B9IA 5FBZA 4R9DA 4CCDA 2BFUL 2WO1A 3ZFFB 4AFAA 3KT4A 5JPNB 5FO8B 2EXIA 3NV2A 1Q5OA 3VBHC 1IS6A 2WS91 3I3QA 4KU8A 2BWCA 3CMGA 5FPZA 5FWEA 2XJRA 4H7LA 1ZZCA 1LAJA 3M7AA 4COYA 2IUWA 2O8OA 3ZKUA 5E89A 4I0AA 4MYEA 1WMEA 3MLKA 2X5IA 1PIV3 1VB4A 5DQ0A 3ZFGB 3NVCA 3ZYJB 4AFBA 5AVAA 2Q8CA 4LLFA 5JOXA 1UY2A 2ZEXA 2A3YA 3K77A 4LR4A 4LKEA 4P9JA 4LBMA 3B00A 3ZDVA 3I2OA 1LOFC 3JU9A 3WG4A 1W6MB 1OFNA 1WMDA 1JZ4A 5B4NA 5IVEA 4QMAA 1M4WA 4Q0UA 1LEDA 4Y1ZA 1G9CA 2DWRA 3OPZA 4IE0A 5FOBB 2OT7A 2Y26A 3MIFA 2AH2A 4G9SB 1PO13 1KXGA 1PM7A 1PM4A 3WF0A 5L19A 1RUI2 1Z7S3 3POIA 4D7TA 3KHCA 5IWFA 1YO8A 1QJU2 3P6BA 1STMA 3HWJA 3KQRA 4QX7A 3H7YA 1C5HA 4AOCA 5J1XA 2BGPA 5CFDC 1PHMA 1GWKA 2VCMA 1YFYA 4BWOA 3CJIC 4OZOA 3I54A 2Z5WA 1L7QA 1GP6A 1MZ5A 1VR3A 3GCWA 3HN3A 4FPKA 4NHKA 5D8AA 5J36A 4XBNA 3T1LA 2FBEA 3M3OA 3R4DB 3PUIA 3TOJA 1S1AA 5I91A 3DXUA 4WM7B 2QQLA 2B5HA 4MGQA 1W6MA 2J1UA 3PDQA 1AYN3 1BBT1 1RTVA 1VRH2 3RVHA 1MZ6A 5CEHA 5IK7A 1HRV2 3WF4A 3WQ1A 2WZPP 3GZAA 4QKFA 1QDOA 4S2HA 1VBA3 3K46A 2WC2A 2VOTA 3GZUC 3OGJA 4LKFA 3W58A 4OHVA 4LE3A 1KJLA 1JS9A 4RS5B 4L2NA 5L7OA 2Y6JA 5EIYB 5JIAA 4ES8A 4K21A 2OUJA 4R9AA 4PT6A 3OBRA 3VBRB 5FQ0A 4FPGA 4YW6A 1S0JA 2HWD1 5A3MA 1V9U3 4AAXA 4Q4W3 3PIJA 4NRPA 2MNGA 2YYOA 3VD3A 3AKPA 1ND2B 2QQKA 2XR4A 5FO7B 1MACA 4E4HA 3O5SA 1YFUA 2Y6FA 4AEMA 4LEJA 3OBAA 3CJXA 1JU4A 1A78A 1BYHA 2WR9A 1BEV3 1IGOA 1UXZA 2YXSA 3GALA 4GD4A 4QU2A 5IAVA 5FP9A 3LD8A 4C1XA 4CDQB 2CTVA 5FZ3A 4CCJA 3OD0A 3C7HA 3J9SA 1W9TA 4FPOB 2HWF3 5FLIA 4D69A 3V0AA 4IEZA 1K12A 2WUHA 3MGUA 1I5PA 3WDUA 4Q4X2 4QX8A 1O4TA 3VZJA 1JMUB 2CHHA 4B7EA 4K40A 3LPFA 4BE3A 1AX1A 2W1WA 1OQEA 1ND3C 1O8PA 2XQXA 4RS5A 3T4VA 5C9AA 1ZBE2 5A32B 5CBLA 4N43B 3VKLA 4FTSA 1BZWA 4HBNA 4IL7A 3HOBA 4CCEA 1RUH2 2P4EA 4MADA 4DPNA 1W2NA 5K7PA 3KSCA 4FPFA 5DAVA 1N1VA 1F35A 1XSQA 3WNLA 5C3OA 1MS5A 3L2YA 5CKQA 3I2JA 1WMFA 2E9QA 3MUY1 2A6WA 3RS6A 1MQTB 5FREA 4AVAA 1SPPB 2VY0A 2XLGA 4Z2WA 1KGYA 3NKGA 2Z2SB 3ZSKA 1QH6A 3WF1A 2JD9A 3ZYFA 5ACA3 3MUZ1 2R1BA 3AX4A 4CEYB 1YQ5A 3BN6A 4XMIA 2JDAA 1S2KA 3WQ7A 4AGRA 3ZFEC 1DP0A 1RVF1 4LIUA 2CWSA 4GJYA 1OC1A 2XJUA 4N9IA 3GBFA 3ES4A 3SISA 4FPEA 1KFXL 4GWMA 3WDXA 1MS0A 1REFA 3WW4A 5A32A 5C8CB 2ZGKA 3O1VA 2IXJA 4FOVA 1F15A 2WZR3 1DFQA 1R093 4CCKA 1JYIA 3AMHA 3FMGA 5IVCA 1WMXA 2AR6A 4LXLA 1MVQA 1S0FA 2R16A 4L0PA 2GZWA 3DPRB 5LBEA 4URAA 4PJYA 1FPN3 5DDJ1 4K6BA 3THTA 4PIZA 1MS3A 2RV9A 2G1MA 2RVAA 2XLAA 3AXEA 2ZHKA 3POEA 1HRI1 5AVPA 3E5XA 1MQTA 1SPPA 1W06A 2VC9A 1D4M3 3B02A 3I2HA 1LECA 1OT5A 1HB2A 4HKWA 3SQOA 1BVP1 5DXDA 3RWKX 3N7KA 1W6NB 3PU8A 1DIWA 1UXXX 2Q8OA 3RQ0A 4ATEA 5K9YA 3NW4A 3PUSA 5A80A 5K8SA 4XIKA 1LHWA 2D5FA 2HBTA 3CF6E 4Q4Y3 5FPXA 4KWUA 4RR3B 1ALYA 1CAWB 2WT0A 3IMMA 4PIXA 2XWJB 4YM2A 5C8CA 3PUQA 3FL7A 4Q1RA 1Q8VA 4LBLA 4XTPA 3ZXFA 5CFCC 4OI4A 2WO2A 1HDKA 1EV12 5BNPA 4LBNA 1O3TA 1LNSA 4NAMA 2VZOA 2GH8A 4MHUA 3WP3A 3H50A 3IIIA 3VKOA 4P00B 2R073 5CVRA 5FYMA 3JQWA 3PIGA 3U14A 4BXFA 3HT1A 1VAVA 1U0AA 4QPGB 3FUOA 1IPJA 1OLMA 4C0HA 3OYWB 3ATGA 5K0UC 4AGGA 3A0KA 1CJPA 4MXWB 2X29A 4GALA 2GNMA 2VO5A 4JRAA 1PGSA 3AC0A 2J1TA 5HCBA 1SZBA 4BQWA 3DCQA 2BPA2 1E5SA 3T09A 2ZTNA 1UOBA 4K1YA 4FPYA 4RA0A 1JOPA 2JIGA 3POBA 1JZ7A 3OUIA 2JX9A 4UW3A 5G04L 3UYJA 3C3VA 2P6HA 3AZZA 4L99A 2PHFA 4RR3A 5C71A 1L3JA 2QVSB 4R4XA 3IDEA 1E5RA 2HWE1 3OY8B 1S0DA 2W1SA 2WBKA 3ZPYA 4AEDA 2B42B 5AC92 2R062 3MW3A 4LBQD 1W03A 2ARBA 2WQ8A 4N8MA 2AUYA 2P34A 2Z69A 4KNCA 3ZMOA 2B39A 2E53A 2W1UA 4V1PA 3V65A 4M4RA 2JB4A 1RUJ2 2PHDA 4JGYC 2Y6LA 3PURA 3JD71 3JQXA 3OYWA 5A7OA 5FYBA 1OUSA 5I0UA 1H8VA 4YG0A 1TMF3 2W1QA 1LHUA 1MR5A 2TUNA 2VGDA 1D2SA 4LA2A 5BNOA 5A70A 5GLTA 2EA7A 3MEPA 3OGGA 5KHGA 1W3XA 2HEVF 1DYKA 4P9LA 5A1AA 2XB6C 1YQCA 3VHPA 3WDVA 4N53B 1PVXA 4HSLA 4YZ5A 1VALA 2R041 4E8DA 3M8LA 4LK6A 1DCSA 4PLNA 3MHZA 4XQWA 4CRQA 4AI0A 1VBB1 1C3HA 3HQUA 1VBC3 4M0HA 2X5IC 1FOD3 1ULFA 2QQMA 4LE4A 1GYKA 2WJSA 1ZA7A 3R05A 1KJRA 3ZIXA 2PMWB 3K3NA 5EHDA 3USUA 4AVTA 5FMDA 2E7TA 2J1EA 2J7MA 3O12A 2NQYA 4EJRA 4KI5M 5JI7A 4FTBA 3AM2A 3CDZB 2BDRA 5CB7A 1J83A 3T3YA 2EIGA 1R64A 3I2IA 1UYZA 4NPLA 1FMD1 1WLWA 2UY9A 3RFRA 4LUMA 5A33B 4Y33A 1XPWA 3BCWA 3TAYA 1UZWA 4RGAA 3FX3A 1H4GA 1WBLA 2ZKNA 4AHXA 1OFSA 5BYNA 2P17A 2RS13 4Y5Z0 3O1RA 1I6XA 1AR91 3KF5A 2YZ4A 1TVGA 3TN92 3VHNA 3UJQA 1GZWB 3RI9A 3DKWA 1IS4A 3M4FA 1EAH1 2LM3A 4EV0A 3AVSA 2L9LA 4FQZA 5L9RA 1UF2C 2CGOA 3MICA 2JDPA 2CNAA 3I4IA 3PLQA 2GN7A 5D8AC 3N4MA 5JMCA 4ISQA 5JR2A 1RUE1 2WZEA 4OHWA 4RHV2 3QBQA 4GMP3 3ZFFA 5LCWL 5E6HA 5A6QA 1ZX5A 2D40A 2PN5A 3MF6A 1W90A 2H6BA 4A6SA 2ZOEB 4J1WA 3SMHA 1GP5A 1YIPA 2RS32 3LSEA 5A33A 3NAPB 2VXRA 2ZGRA 4SLIA 4C90A 1CD3G 3D3AA 2UWBA 1KDKA 4XILA 2Y6KA 2VBBA 3WNXA 2WLQA 1BHGA 2ZGUA 2JE8A 3LA7A 5L7OC 4M01A 4WVVA 1XYOA 1QJY3 3WNNA 2WFF3 3ASIA 2ZS6B 3H8UA 2C5DA 3DXTA 1XYPA 4O7XA 5CU1A 2AGSA 2ARCA 1RXGA 1ZVFA 1P8JA 1VBD3 4ZU4A 3VKNA 3KV9A 1K3IA 3C2UA 4N9HA 1IQAA 1J1TA 2HKXA 1H8TA 4IEPA 1Q8OA 3WCRA 2HYXA 1OLQA 1UAIA 2YU2A 3VDCA 1TME1 4Z2AA 3VDBA 3FHQA 2R0HA 3BODA 1W8ZA 3U75A 1XNDA 1DQ0A 2EXJA 4MGKE 1B09A 1W28A 1OHFA 3U1XA 2FDKA 2WQZC 3T2PA 3ZXGA 2FDGA 3E97A 1HKDA 2VBPA 4CXYA 2GMMA 1E5IA 3OPWA 1PIV2 1LHVA 5B4XA 3SH5A 3SHRA 1O6UA 1D4VB 1AR63 4XTMA 5FPLA 3ACFA 4XURA 2Q8DA 1JYCA 5FJHA 1AYM1 5C9AC 2RG4A 3FFZA 5FYCA 1YRZA 1ZRIA 2E26A 2O14A 4A7ZA 5G05L 4FSJA 5FYIA 4JTNA 4PDWB 3V56A 3VBUA 3HEIA 2ZGSA 2G4IA 4HLTA 4ISRA 4AEKA 4YZ4A 3FUQA 3GXUA 1POV1 1SLTA 1QOOA 1X7NA 2BOIA 3ILFA 2EXKA 5GZGA 3ETQA 1PO12 2LUWA 4EQVA 3MBWA 5KR7A 4EN8B 3URFA 1Z7S2 1GZ9A 3OG2A 2UY8A 4FBFA 4NJ4A 5FBJA 1LB2A 1YI7A 2YB7A 4META 2IVJA 1H1AA 4KL1A 1JYVA 1SDDB 1TE1B 3WSOA 2BNMA 4E4ZA 3HMYA 2Q30A 1DHKB 3PMEA 4WM8A 4AK3A 2DCKA 5HCFA 3UT0A 3CO2A 4OFGA 4OUMA 1I9RA 3VZLA 5FR3A 1OD5A 4LTAA 3FLRA 5GLWA 3VV1A 1AVBA 4Z1VA 1US3A 2D97A 5C70A 4EZHA 2JDZA 2D6OX 4PDWA 4KBBA 4JKLA 1AYN2 3KCYA 5DAQA 2D98A 5EP9A 4Y1XA 2BGOA 3ZN6A 1GBGA 4OQ9A 3RMXA 3GBGA 4HPKB 4IXLA 1VBA2 2GU9A 4BCUA 2BNNA 5EZWA 3HNMA 1W8OA 1XU1A 4L8QA 4AVBA 4NHLA 4NO4A 4HVQA 2WWUA 4E2SA 1CX4A 1DGRN 4ZS3A 1DGLA 2BRTA 5FOJB 2C4XA 4BU2A 2VUCA 1PVC1 5J09A 4LMFA 2VOXA 3AP6A 2NLRA 5GLVA 2A70A 1V9U2 4XFGA 2K46A 4Q4W2 4UAPA 1OA2A 4M0NA 5FZ4A 5FZBA 1LOBA 2HJIA 3A22A 1QHDA 4J1XA 4NN0A 2ZEZA 4IERA 1FNYA 3CL1A 5FZFA 3RYKA 5A3PA 1V0AA 5KWRA 3FHIB 5BNNB 2NZ9A 3I2FA 5ANNA 3RMYA 1BEV2 3I59B 3BALA 4UFJA 1UN1A 4M3CF 5BNPC 3I2GA 1X9TA 4LA3A 3D0JA 1WCQA 3CNAA 3VBFA 3AFGA 3BUCA 4Q5OA 3VBOA 2HWF2 3SC7X 3H3ZA 2YUEA 4DFSA 3G6JB 3GNEA 3JZVA 5C5UA 3E6BA 1TG7A 1EY2A 3H42B 4QAWA 2DCZA 1CAXB 4QPIA 5BXXA 4BLJA 3NNMA 4QXBA 1YIFA 3U37A 4BK4A 3N9NA 3SKVA 3CBNA 3ROUA 5EJZB 4MX3A 4UF0A 1Y3TA 4NUBA 4BMBA 3VDAA 2XPJA 2ZABA 3PJYA 5GKAC 5DG1A 2PHUA 1JBCA 4CEWB 4CP1A 5EFUA 2XLFA 2GP5A 4HK9A 4EROA 1LHNA 4CCOA 1Y7BA 3R0RA 2YBKA 5BNNA 1WD3A 4I02A 3IM0A 1NY72 4IESA 4HSJA 4JQRA 2AENA 2ZGMA 4XFIA 4GXLA 2G9ZA 4XF9A 2E63A 3LA2A 1DQ5A 4IV1A 4AEDC 2PAEA 4LO5B 4Q29A 5FP3A 5ACA2 4AZZA 4BQ2A 5FYYA 2Z4FA 1PZ8A 3KQ4B 4YGEA 4M4PA 3LPGA 2VL4A 4Q4V1 1CAXA 1RUD1 4QGLA 2Z79A 3ZYHA 1DQ1A 1OOPB 3EYPA 3K2OA 4BH9A 5FV3A 3KZ4C 2V5YA 5LA1A 2ENRA 1CIYA 2WZR2 1R092 5BNOC 3S5AA 1UYXA 5FZCA 1WLTA 2QDRA 1OXCA 4CEWA 3J8F1 1XC6A 4CPBD 2JDUA 2W3JA 4HOOA 3AMNA 1FPN2 3ZLIA 5FYTA 2RR11 4GH4B 4RN5A 4YGDA 1GMMA 1OKOA 1S0CA 1W05A 2ZX3A 4LUKA 3WNMA 5FUIA 4CUCA 2JE9A 1D4M2 1RVF3 4NRMA 4EWAA 3P1IA 5FZEA 3U07A 2WNEA 3SH4A 2B45X 2A3WA 2AC1A 2WNUB 4LLOA 2VCCA 2QQUA 2WWSA 2EICA 2WNOA 4COWA 5FK8A 5CIRA 3TEZA 4LO6B 2A75A 4Q4Y2 4CP0A 2Y60A 4WZCA 1OQDA 3FLTA 1OOPA 5H9PA 2EAAA 1GP4A 5DDJ3 3GZTB 3SXWA 3OCPA 4UT5A 2ZX0A 1SLBA 1G9AA 1OLME 4XPVA 1Q3EA 3B7MA 4YSFA 1WWYA 4JZRA 5FO9B 3GBWA 1QWRA 1PGL2 2R072 1MVEA 4TSVA 3S7IA 3AVRA 1REEA 1RMU3 5F6LB 4GH4A 5FRAA 3TEWA 2V73A 4AHYA 2DUOA 4F3JA 3GYDA 4BOWA 1HJFA 4ZXEA 4FFGA 1ZZ6A 1A6CA 3GM8A 3LKJA 4O65A 4FFIA 4YFWA 3PJQA 3T2OA 2IZWA 2H6CA 3ACHA 3HT2A 2WNUA 3WG2A 2ZZQA 4RD7A 5FXVA 5FIXA 1SFYA 5A3NA 2PAMA 4O61A 5D21A 1Q8SA 4FFFA 4JX0A 5L73A 4CE8A 5IYYA 1K5JA 4N90A 4XXAA 3UKNA 1UZZA 5FY4A 1B35B 4YW3A 4QX1A 1SDWA 1VAKA 1H9PA 2A71A 1F5JA 4LKDA 1OH4A 1O7FA 1SLCA 3FBMA 3R4SA 5HV0A 3WDWA 5FYVA 5IHRA 4BIOA 3MI8A 5FZGA 3M1HA 3VKMA 5LZ6A 2VZTA 5JMOA 2GSYA 4IEVA 5EJ1B 5EYYA 1TMF2 2ZGQA 4AQ6A 3POFA 4XJUA 3IDCB 4A3ZA 4N7UA 3ES1A 2JG8B 5T52A 1H8TC 3FJSA 2HWE3 3LEMA 4LJHA 2OX0A 1LGCA 3VBSC 4FOYA 4XCAA 3BI3A 4NAOA 4XABA 4B4QA 3VDDA 1ZRDA 1S0GA 4UWDA 2JDKA 2C9KA 5LBCA 1U5XA 3PVEA 4HFSA 3JD73 3J7NA 4XDPA 1VBC2 2RM21 2ZCWA 1FOD2 1H2MA 2PQQA 3HQRA 4JVAA 4Y4RA 2EALA 2VE1A 1NX9A 2B7YA 2WWJA 1U12A 1RUC3 3LQCA 1D0GA 4FQ4A 4F83A 1N1YA 1ENXA 1XNAA 4Q0VA 1COV3 1JI6A 3VUOA 4XHXA 1RUI1 2BGCA 3A23A 4IDZA 1UQXA 2GC0A 2X53S 5BNQA 5LA0A 4YWAA 4Y1YA 3CEWA 2QZ3A 3VBUC 4P9IA 3WG1A 3UV9A 1AF9A 1KITA 3KT1A 2VQTA 2Z42A 1T6BX 4DMIA 1W6OA 2DU1A 4BQYA 2B9VA 4MO3M 4XBQA 3C7GA 4QXCA 2R043 5FY7A 4ET7A 1QMJA 3W59A 2CGNA 3AKRA 4TTGA 4RQPB 1ZM1A 1ZZBA 2GC2A 4CP9A 1NKGA 5T54A 4R9CA 5HXVA 2RS12 1NUKA 2A5ZA 5FKBA 1VRH1 4AVCA 5JZGA 2R1DA 4S2DA 1IG3A 1HRV1 5KHKA 4TYSA 4E2GA 3KD4A 4TWTA 4B3NA 4IEXA 4WM8C 3UGGA 1HB1A 1NCQA 4KWKA 1K5MB 3RDIA 1FMD3 2BFUS 1EPZA 4IGQA 5CKNA 5JI9A 3LCPA 5FXXA 3DEMA 3PTYA 3WNKA 1ULEA 1S2BA 1UL9A 1WA6X 5FZ9A 2Q5TA 3MIGA 1NE6A 4JQTA 1MS9A 3SCGA 5A1FA 1GOHA 4NWWA 1AR93 1SLLA 1HQNA 1Y9GA 2JDYA 2VNVA 2QE3A 2YFUA 2YPJA 1X9PA 2DFCA 1EAH3 3NV1A 4O9EA 2X05A 2ZMLA 4FAGA 1VP6A 4NIDA 3KS7A 3OB8A 4ES9A 2ZX4A 1LHOA 2CV6A 3GHMA 3WZ1A 1QJY2 2V4VA 5FZKA 2LS6A 1X82A 2WFF2 1WLDA 3KB5A 2BU9A 3I3EA 2VZRA 4E9KA 1AUYA 2FHRA 1BLZA 2WZ8A 3KV5A 1AXZA 3LEIA 1W6PB 3OGSA 4F7ZA 1VBD2 4XJWA 3ZFGA 3ZSEA 5ABJB 4JC1A 4CDUB 3WF3A 1K5MA 4ZPIA 5F8PA 1C8NA 4GWJA 4AYUA 4EYUA 2W87A 3LA3A 4AW7A 1W0NA 4XF3A 4Q0SA 3F95A 4YW7A 3T0AA 3N36A 1RUH1 3VBFC 5LY2A 1ENQA 3VBOC 3BGAA 1VMFA 1Y9QA 4EN9B 1LEMA 4D94A 1G6NA 1V6MA 1W8FA 5F3CA 1H1MA 1PNFA 1JTZX 3KLSA 4QPIC 1AR62 4Q8KA 1JOBA 4FPCA 5C3SA 2BVVA 3J26N 1RUG3 2ZJCA 3M2MA 4I30A 2VW2A 4MGYE 3RPQA 3T2QA 3HVDA 5GZEA 1O8SA 1TME3 3ZSJA 4AQSA 1OA4A 2HWB3 1HN1A 4LHNA 4K3UA 1UIKA 1R083 4ARXA 5ABJA 3D0SA 1YQ6A 4RFT0 1ZZ8A 1HQWA 3L9JT 4K8FA 2F4LA 2DUPA 5F5QA 5BNNC 2IXKA 2XG3A 5DABA 1ODNA 1X33A 3MLLA 4HK8A 4WM7A 4D7YA 4Y3OA 2OZJA 3ZSMA 4IV1C 2AREA 1RHI1 4AI2A 1AYM3 2QNKA 5I8SA 4YVWB 1WGPA 4UFLA 3LDBA 1IOAA 5TSWA 3UESA 5A6ZA 4Y26A 4TLFA 3M3EA 3B94A 1ONAA 1FNZA 4Y5SA 5FZ1A 5FDBA 2HLEA 4JGZB 2XGXA 1V70A 2WIIB 1ZBA3 4PBPA 4P14A 1ULGA 1APNA 1POV3 4BHPA 5FCCA 2I2SA 4QPWA 2R49A 3VBRA 4QX5A 2YC2A 2VNRA 3AZYA 3R6SA 3KF3A 1QQP3 3FZ3A 1UY4A 1BCXA 5HBAA 3RGBA 4ITCA 2XBO1 1IKPA 2UYBA 1ND2A 2EVXA 2QQNA 2XOMA 3MV11 4GB31 4GWNA 4JCKA 3ZYPA 3MZHA 2AYHA 2C1FA 2SBAA 4FPHA 1GNZA 2A6ZA 2H0VA 3ZMNA 1PK6C 2ILMA 2QQOA 4L97A 1GQGA 4V2VA 3UKVA 1I5ZA 4Y24A 1EV11 3AYAA 1OMIA 5I0TA 4CDQA 1AXYA 1QEXA 3A7QA 1T2XA 4OMDA 1KFUL 1XNBA 5GM0A 4JHZA 1MS8A 4H2AA 4CU8A 2JIJA 5FZ6A 2KXLA 4CA9A 5FYSA 1NA1B 3RZZA 2HEWF 3BIWE 5DUUA 1XJAA 3AZWA 2A6VA 5GZFA 3SKJE 4JGZA 4AI9A 2YGLA 3WEZA 5IT6A 2G19A 2VZUA 1DQ6A 5F5IA 5FY1A 4RFRB 1OOPC 4QKNA 4CDWB 2OYZA 3BYWA 3M3CA 4N43A 4W8JA 2MEV3 1LGBA 3U4SA 5EV7A 1OF4A 2KD7A 5J3UA 2VUAA 5F3GA 1H9WA 2GMPA 3KVBA 4QDRA 1R1A3 1PVC3 3ZIWA 5KBFA 5CADA 4U36A 4RGKA 4HL0A 1RUF3 2XL7A 4I0WB 4XFBA 4E4SA 3CZJA 4E8CA 1GOGA 3NO8A 4GH4C 4HKLA 1JZ6A 3H8OA 3JB8A 2ZBJA 2RDRA 1ZYBA 3H3UA 5AC91 2CAUA 1NZCA 2R061 3N7LA 1VAMA 1PMJX 4QGMA 1K45A 4AHWA 1UU4A 3EBRA 4MH0E 2WNUC 3M3IA 3WUDA 5E16A 4CEYA 1A8MA 1QJFA 3I49A 4GJZA 1YC61 2Q0AA 3UGFA 2XL9A 4DRRA 2VZVA 1RUOA 2WL1A 3U11A 4HONA 4OYUA 4ZONA 5IK4A 1AR71 4HN0A 1FT9A 4AI1A 1F9KA 2JDMA 2KA3A 3WD5A 3CU7A 4QQ2A 2DBIA 4K20A 3UK9A 1GZTA 3DPRA 4K8RB 2YBSA 5LK5A 5J48A 3J7HA 2DCTA 3VLBB 1BQPA 1PMHX 2VXJA 1S0IA 3POJA 1AZDA 4LBQB 4G4FA 1IHMA 1OF3A 3UL2A 5JDBA 3TNQA 2DVDA 1IKQA 1Y9MA 3GCXA 5GZDA 4W65A 1CX1A 2I74A 4XFAA 3FE5A 4FXKB 4LKSA 2C6SA 4PLOA 4C8DA 1W6NA 2A6YA 2PFWA 4OUSA 4YVSB 2OXBA 2ADDA 4CDXB 4FOQA 3LFMA 1UY3A 4RL7A 2WQ4A 4DS0A 3VDDC 3ZXLA 2A6XA 2VUJA 1CAWA 1GOFA 1WLCA 2HEYF 2DYCA 3EHKA 1UCXA 3RJ2X 1RVF2 5L9BA 1J3QA 3SNMA 1TEIA 1Y4WA 2UWAA 4HANA 1RUD3 4MGIE 4Q4V3 2LW8A 2WKKA 2DCJA 5CISA 1CAUB 3KV6A 4LOSA 2W9XA 4J6GA 1F2NA 4QX2A 1POV0 4H14A 5BV6A 5BY5A 5T55A 3LIHA 5I93A 4QPGA 1OSGA 3TN91 3BPSA 4AL9A 4P5HA 3V0BB 4BMEA 2NPIA 1YLLA 3J8F3 3OEAA 4FO9A 2P3KA 4MXWA 2AEYA 3OBZA 3JXSA 5HV4A 5DDJ2 3ZM8A 4NHMA 1RINA 2RR13 5AFEA 2C24A 3T0BA 2GP3A 4E4DX 4IE7A 2QQPA 3WT3A 3E1F1 5A7NA 3NRUA 2XJVA 4FP2A 3U10A 4C1WA 1MEC1 2PLV2 4CDXA 3ABZA 3N9OA 4QX0A 4RHV1 1NE4A 1RMU2 4Z07A 1QXJA 4A6OA 5IVFA 5JZGC 2VBDA 2LTNA 1AL23 3MO4A 1W99A 2W68A 5DUWA 5E1RA 3VZOA 4D3WA 3AMPA 3OY8A 2RS31 5LBBA 3TEYA 2IXHA 2PHWA 1ST8A 2X8KA 1NCQC 3ON7A 4X6QB 4YG6A 4PF1A 4TXWA 3AJYA 5CAZA 1SCRA 2WYFA 1ASJ3 3IAQA 4JV4A 1G8WA 1MZEA 3N3HA 4IEYA 1CQ9A 5FMOL 4DIQA 4L9BA 3FWEA 5KHIA 5C4WB 3NNGA 3HIFA 2D6PA 5F2SA 1UD1A 4MZUA 2QBXA 4KU7A 2ZGTA 4XJZA 3ZFFC 5C8WA 4ATFA 3D6EA 4ZY9A 5GJ6A 3PHMA 4D7SA 1REDA 2VW0A 4IEQA 2PHLA 5FPBA 1ACCA 3T30A 4QKDA 3ZPOA 4HVRA 2ET1A 1ENRA 4N53A 4YW5A 4MHRA 2RMU3 3ENRA 3EO6A 4IGOA 3RZLA 1EPWA 4Y22B 1URXA 3S57A 1LU1A 4JDNA 2FMYA 5K4LA 1W8NA 2WFPA 4O9GA 4B1LA 1C8M1 3NJZA 3VD5A 3ZFGC 5CYYA 4AVSA 1DZRA 1ODMA 1WCSA 2JG9B 4YGBA 1K5MC 1ZRCA 2HWE2 4A4AA 5HCHA 5A7PA 5IVJA 1YUDA 5AFBA 1CZSA 4DQAA 1AHSA 1LJ7A 2VD7A 5C4WA 3IKWA 3VZMA 2PHXA 4GKYA 4WVMB 2LALA 5DZFA 3ST7A 1QJX3 2UU8A 1RYYA 1M06G 1OQ1A 4SBVA 1J1LA 3JD72 2VU9A 2JE7A 3PTRB 5DZEA 1SFNA 5B2GB 2DFBA 3NJVA 3P3NA 3SEPA 3WF2A 1NLQA 2P3JA 1EUUA 1RUC2 3NJXA 2OPKA 4FFHA 3RZKA 1COV2 1VBE1 2BOJA 3HN1A 1PGW1 1KS4A 1UOFA 4NIGA 3K51A 1GZWA 1CPMA 1RJ8A 5A3TA 4XJ9A 3ZKYA 1MZFA 1NQJA 1W9FA 3MPBA 4XE9A 4HG6B 2PA7A 4WV8A 4XVHA 1GNHA 4GULA 5EWSA 2R042 2VZPA 1NG0A 2JG9A 5HCAA 1AL0G 3LOIA 4P9GA 4QB6A 1WZXA 2IXIA 2RM23 5F5CA 3WW2A 4ZS2A 3W9AA 4WM7C 4ZU5A 4A44A 4YFZA 5JVVA 1AYN1 1QH7A 2W2IA 4KWLA 5DAXA 5FMCA 1WD4A 3A21A 4COUA 4AFCA 2QDNA 4CUBA 2J1SA 2J1AA 5CZKA 2VECA 4JRLA 4BYYA 3RG0A 4F8AA 3NAPA 3LGRA 4AEJA 4FPLA 1JZ2A 2UYAA 1FMD2 4NPMA 1J84A 2IC1A 3MF9A 4IEUA 2VNGA 4OHXA 4RS5C 1JZ3A 3IWZA 1IG0A 4QB1A 2BNOA 3RYRA 2W92A 4XAAA 3THCA 3VBRC 5FFOC 3AKTA 3B5LB 5E8AA 3VL8A 3ZXEA 3RZJA 4Q4W1 2XDVA 3VBHB 5LRRA 2WS93 1NLRA 1IZ3A 1AR92 4JKKA 2ZEWA 1XNKA 4A3XA 3AMQA 2ARXA 4MV2A 1ND2C 2P37A 4CCMA 1QOSA 1V6OA 3C7OA 1VPHA 3THDA 2XKOA 5L36A 4AFDA 4U2AA 5I0RA 4CDQC 3IT8A 3I7DA 5T5JA 1LR5A 3A4UA 2JD4A 1SACA 2DTWA 5EJ3A 1VB2A 2DVFA 4Y20B 4L11A 1IQDC 1S2EA 3MFAA 5FP7A 1QJZA 1LENA 1RXFA 3QH7A 4YM0A 1FV2A 1H2KA 1Q8PA 2A3XA 2ZHMA 4AR2A 5JXHA 4QQPA 1G9FA 2ZACA 3DUIA 4N43C 4C0BA 5FLHA 4I09A 3VZNA 4BQ4A 2XKPA 3AB0A 2ET7A 2NMNA 5FZAA 3O1TA 1ULPA 3VBHA 4FI9A 5KXBA 2YHJA 3BIEA 2E31A 2VMHA 4YGCA 3WP6A 3IZOA 1PX4A 2BEOA 1OI6A 1O91A 1Z0HA 1W8HA 1PNGA 3NMBA 2P2KA 5CFDB 3BU7A 2G9GA 3S7EA 2D6NA 1GANA 3BPZA 1MQTC 3CJIB 4QD2A 4KG8A 2ZX1A 2DURA 1RUG2 2Y33A 3AL6A 5H9RA 3L2HA 2PHTA 3MIHA 5FMBA 3VD7A 5ACA1 3OPTA 1QY4A 2QQJA 1W9WA 4CEYC 1J3PA 5C33A 1UZVA 2HWB2 3MIBA 3LFIA 3W21A 5LK7B 1R082 1UKGA 3Q8BA 2WSVA 1L7LA 3WDTA 1BBT3 3ITQA 1ENSA 5JCTA 2E33A 3PL0A 3ZYIB 2W95A 1QXPA 1S4CA 2XJQA 3JCIA 2F6BA 4XJAA 5C8CC 1E5HA 3ZYRA 2JICA 2WLPA 1R091 2WZR1 2LRPA 4A41A 4BQXA 2P5BA 4RYDA 1US2A 1AYM2 2DF7A 1RJ7A 2VMGA 4GQ7A 5IVYA 1JODA 3DPRC 4PIYA 4IQPA 4AG4A 4ZU7A 1V00A 4QT6A 4HPKA 2Q1MA 2E7QA 2VVEA 5A3WA 4BLIA 1G86A 2HWD3 2XXZA 3WHUA 5EQUA 3NV4A 1GWMA 5CFDA 1OURA 1ZBA2 2BW8A 1W8TA 3G7DA 5T5PA 4Z82A 5SV8A 4HKOA 3IDBB 4EZ4A 1N1TA 2OZ6A 4NRQA 3ZSLA 1UMZA 1UYPA 3AP7A 4JTOA 4LOTA 3H1YA 2ZAHA 3KT7A 4NE9A 3AK0A 1NYWA 1QQP2 2XVLA 4YM3A 4R9BA 4XFHA 1H6YA 1DZQA 1W2OA 1YQ2A 1RHI3 2P6CA 4Q4Y1 5A6XA 1UY1A 4OCTA 4RR3C 1K42A 4HN1A 1UX7A 4A45A 3I59A 4XMAA 1HXS1 1V6IA 5HI0A 1LTEA 4M3CB 5F1RA 5F9TA 3AYCA 3JBG1 4ORFA 3WR0A 1G9DA 1N1SA 3K4ZA 5A3OA 5LW9A 1JN2P 3DKQA 3KCCA 4IUGA 4DOUA 2ZMNA 4QPGC 2RS51 1YYNA 3H8RA 1JYXA 4UI9L 3FLPA 5F5AA 2XBO3 2IXLA 3O14A 4B7KA 4GB33 4HVOA 1GSLA 2YROA 2MEV2 2D6LX 4NOTA 1ZZ7A 1QXRA 1CONA 4XUOA 4X8PA 3POWA 3GHNA 3DV8A 2CSGA 4XQDA 1R1A2 1XB9A 3HBKA 3DN7A 3P3PA 4MGSA 3ZXJA 2Q4SA 4COZA 4XXPA 4CDXC 1RUF2 5CG9A 2D5HA 4D6RA 2CYFA 4S2FA 3LIGA 1AR81 2ZA9A 2VW1A 4TZDA 4X8NA 3OEBA 5GLUA 3ZFEB 4CZSA 1DYOA 5DAPA 4DZGA 4D6QA 2VH9A 2YV8A 1S0BA 2CDOA 3C7FA 3EMRA 4M3CA 4Z92B 2P3YA 4UFMA 4MXVA 1C1LA 3DECA 2ATFA 1CAVB 4DXRA 2OIIA 1RITA 1W0PA 4LO4B 4AQTA 1YWKA 1W6QB 3HQXA 1UMIA 4OUEA 4XUQA 1WW7A 3GJAA 4YRDA 1XE7A 2CWMA 3ACIA 3O1PA 1NZIA 1DLCA 3KGLA 5LRSA 3T0DA 2I45A 2C0ZA 4WZFA 4NIIA 1ZREA 3I2DA 3U0ZA 5DPNA 1HRI3 5IATA 3O0XA 2F17A 3BU0A 1IPSA 1PO21 2IXCA 5I8TA 1OBNA 4W6WA 5JXJA 1NCRB 1O3SA 2ID4A 1UPSA 4IV3B 4OMCA 3DYPA 1LU2A 1V6KA 4Q0PA 3JB4C 3PU3A 4N53C 2VULA 3WHTA 5J96B 3BTYA 1GWLA 1QOTA 2VTXA 2RDNA 1C5IA 2E6VA 2HWC1 3D8CA 3O0VA 4XZPA 1IPKA 2X10A 1JHJA 1VBC1 1YHFA 1UY0A 4R4ZA 2YU1A 4MGZE 4XJ8A 1AR73 5CFCB 4D8MA 5JXGA 1QIQA 3O0WA 3ZN4A 4I0BA 4CCNA 1J3RA 1EYBA 1OLRA 1QNWA 2JENA 2VZQA 5EXOA 5F2WA 4A7YA 4CP2A 3RNSA 5FXWA 1FXZA 3WDYA 4ARYA 4R8HA 2J1RA 4XQ4A 4BISA 4MG2A 4XCBA 5K0UB 4XOGA 4Q4V2 1RUD2 5D1IA 1ZNPA 3WVJA 2OUHA 3ELNA 5GZCA 2QQWA 2CU5A 3AP5A 1X50A 3MFCA 3O1SA 1NCRA 3IPVB 1UPIA 4IGPA 4XEZA 4AGVA 4IV3A 2RS11 1U5ZA 2VMEA 3D82A 5IVBA 4R52A 1S0EA 3BVCA 2ORZA 3J8F2 2XVGA 4J25A 2CL2A 4W4ZA 5DUXA 4AHZA 4KG0A 2XJSA 4DEQA 1WW5A 2RR12 2QTWB 3QACA 1C28A 5J37A 2W08A 1UMHA 2JG9C 4BQ1A 5J7MA 3BTZA 4MSVA 3ZOIA 5I0SA 3AKQA 4B8EA 1XE8A 3SEEA 4DINB 4DY3A 5A3UA 5C3RA 1J59A 4GMP1 4IE5A 3ZR6A 3BOWA 2XUEA 4P9YA 1HB3A 1AL22 5H9QA 3KCXA 3K4DA 3WG3A 2A1XA 2VCBA 4JGYB 2GNTA 2V72A 3TWIA 4CVUA 1B35A 3H9AA 3NAPC 2C26A 5C3QA 4KGQA 2GH2A 3RRDA 4NMIA 1ASJ2 2ZGPA 4KBZA 1QJU1 1D0HA 2WFF1 2YBPA 1YCIA 4IW3A 5T3NA 1SLAA 4GKXA 1MEC3 5A7QA 4CSWA 3B01A 3K4AA 4IE6A 1VLNA 2V5DA 4IEWA 3LDKA 1W0OA 2VZ3A 2FDIA 2JG8A 5BPXA 4WVZA 3THPA 2GC1A 1VBB3 1XRUA 2JJ6A 2X5IB 2FZ2A 2ARAA 5GLZA 4NR1A 3W20A 1RC6A 4I3GA 2RMU2 3NNLA 4CXXA 4LULA 1LOAA 3H1WA 1DZTA 4EE2A 5FPVA 4RSUA 1SQ4A 1HX6A 2VNOA 5LASA 2RDQA 3EXUA 2EXHA 4A7KA 1KDMA 1UZ0A 1KD7A 1RL3A 1CWPA 3S6PA 4YW4A 3MPPG 4GA9A 5FZMA 4PDWC 4FP3A
chains in the Genus database with same CATH topology
3BU0A 3I49A 4O7XA 4MGTA 3BTYA 3T4HB 4JHTA 4CXWA 2FDKA 3T4VA 3RZHA 2FDGA 2FD8A 4CXYA 3I3MA 2FDJA 3RZKA 3BI3A 4MG2A 4NIGA 3I3QA 5DABA 3O1SA 4IE4A 3LFMA 2IUWA 4NRQA 4NROA 4IDZA 4ZS2A 3S5AA 3I2OA 2FDFA 4OCTA 3O1UA 4NJ4A 3BTZA 2FDHA 3O1VA 4IE0A 3O1OA 4IE5A 3RZGA 4ZHNA 4QKBA 3RZMA 4NPMA 4NRMA 3BTXA 3T3YA 4IE7A 4NPLA 3H8RA 3RZJA 3KHCA 3O1RA 4QHOA 4IE6A 4ZS3A 2FDIA 4RFRB 4QKNA 4NIHA 3O1MA 3BKZA 4NIDA 4QKFA 4CXXA 3H8OA 3KHBA 3O1TA 3BIEA 3O1PA 4O61A 4QKDA 4NRPA 3BUCA 4NIIA 5F8PA 3S57A 3RZLA 3H8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU0 A;  3I49 A;  4O7X A;  4MGT A;  3BTY A;  3T4H B;  4JHT A;  4CXW A;  2FDK A;  3T4V A;  3RZH A;  2FDG A;  2FD8 A;  4CXY A;  3I3M A;  2FDJ A;  3RZK A;  3BI3 A;  4MG2 A;  4NIG A;  3I3Q A;  5DAB A;  3O1S A;  4IE4 A;  3LFM A;  2IUW A;  4NRQ A;  4NRO A;  4IDZ A;  4ZS2 A;  3S5A A;  3I2O A;  2FDF A;  4OCT A;  3O1U A;  4NJ4 A;  3BTZ A;  2FDH A;  3O1V A;  4IE0 A;  3O1O A;  4IE5 A;  3RZG A;  4ZHN A;  4QKB A;  3RZM A;  4NPM A;  4NRM A;  3BTX A;  3T3Y A;  4IE7 A;  4NPL A;  3H8R A;  3RZJ A;  3KHC A;  3O1R A;  4QHO A;  4IE6 A;  4ZS3 A;  2FDI A;  4RFR B;  4QKN A;  4NIH A;  3O1M A;  3BKZ A;  4NID A;  4QKF A;  4CXX A;  3H8O A;  3KHB A;  3O1T A;  3BIE A;  3O1P A;  4O61 A;  4QKD A;  4NRP A;  3BUC A;  4NII A;  5F8P A;  3S57 A;  3RZL A;  3H8X A; 
#chains in the Genus database with same CATH topology
 1XSR A;  2PXJ A;  2WAB A;  1QJX 2;  2AEZ A;  1UZY A;  4MGT A;  4BJ0 A;  4I2O A;  3S30 A;  2WN3 A;  1CES A;  4BM8 A;  1UIJ A;  2JXA A;  1RUN A;  4LBK A;  4RQP A;  1OD3 A;  1CZT A;  1FV3 A;  4OI2 A;  1C8M 3;  4Q8L A;  5E88 A;  4YAR A;  1HQL A;  1DG6 A;  5JAX A;  5D8A B;  4LIT A;  3R4U A;  5KHH A;  1OH3 A;  2FCV A;  4D6S A;  1ZZ9 A;  1RUE 3;  3RSJ A;  5T5O A;  4A2U A;  4Q4X 1;  1HLC A;  4Y1U A;  2XWB B;  3RZH A;  3MLJ A;  1WUV A;  5CA6 A;  1LES A;  2Y8K A;  1ZBE 1;  5M0T A;  1CIW A;  2RM2 2;  4UOJ A;  1O59 A;  1O3R A;  4XBL A;  4K7J A;  4P02 B;  1UU6 A;  4ASM B;  2DCY A;  1VBE 3;  2XH6 A;  5L7O B;  1OKQ A;  2GDF A;  4UFK A;  3ZVX A;  3FFQ A;  1N3O A;  2BYV E;  2VZ1 A;  5FQ0 B;  1AJO A;  2RHP A;  2WO7 A;  2BBV A;  5ANQ A;  3GGL A;  4HET A;  1PZ7 A;  4LHK A;  1HW5 A;  2WDB A;  2MPF A;  1BK0 A;  4OI0 A;  2JWP A;  4AFM A;  4QU1 A;  3SCH A;  5FZH A;  2UWC A;  4MLO A;  2DUQ A;  4GAZ A;  3O1U A;  1CR7 A;  4N7I A;  4LT5 A;  5FTT C;  2QCS B;  1D2Q A;  5FPU A;  2JKX A;  2WS9 2;  2FDH A;  1FI2 A;  5FLJ A;  1NXM A;  1W6P A;  4BB3 A;  3AYD A;  2W91 A;  4IEO A;  4UW6 A;  2VMD A;  4ZHN A;  3POS A;  3DYM A;  2D7F A;  4CDU A;  3V0A B;  3H3L A;  4UW5 A;  1BXH A;  3INA A;  3AP9 A;  1UOG A;  1H2L A;  5F3E A;  1U5I A;  1UYY A;  2G9F A;  1XQN A;  1W39 A;  5C9A B;  2WIN B;  2XHK A;  4FCA A;  2BZD A;  1OPO A;  3AXD A;  4BZ4 A;  1LOG A;  1LOD A;  3H0O A;  3QH6 A;  3WP4 A;  4BPZ A;  4FXG B;  1DLL A;  4NIA A;  3ZXK A;  4JKM A;  2AAC A;  1VMJ A;  2JB8 A;  2Y64 A;  3ORJ A;  4H55 A;  1EUT A;  2IWG B;  3F2Z A;  2H0B A;  4QHO A;  5FJK A;  3WNO A;  1JYN A;  4B1M A;  3FHA A;  3ACG A;  1AX0 A;  2PQS A;  3AZV A;  4DUW A;  5HPO A;  5KHJ A;  1W2T A;  3WOG A;  4NVP A;  1X36 A;  2J1V A;  1WKY A;  1WW4 A;  2ERF A;  1GQH A;  1L7R A;  1NQD A;  1O4Y A;  1UKR A;  1LGN A;  4CEW C;  1NOV A;  1EP0 A;  3WXP A;  1RIR A;  2O8Q A;  3IB3 A;  4PHZ A;  4BK5 A;  4W6X A;  3W5M A;  5IW0 A;  4NHX A;  2GME A;  3PMS A;  4OZX A;  4ONU A;  2YFZ A;  1ZRR A;  3QOP A;  5EPA A;  2VVF A;  2RE9 A;  2VMC A;  5T50 A;  5FP4 A;  3LEK A;  3PUA A;  4MUV A;  5JIU A;  3K3O A;  5CNA A;  2D3R A;  4DUX A;  1VIW B;  2ZPX A;  3VKF C;  1PZ9 A;  1QKQ A;  4K9S A;  4FVV A;  5JR7 B;  2ZMK A;  4YM1 A;  4FPJ A;  4YVW A;  4H7M A;  5FZD A;  5I8Y A;  2ES3 A;  2ADE A;  3RWN A;  3V64 A;  2RJK A;  5KXD A;  1BBT 2;  1WCK A;  3HR9 A;  4I01 A;  5ERL A;  4QKB A;  2O1Q A;  3WW3 A;  1UNB A;  2BBA A;  2Y0O A;  1Y43 B;  3WX5 A;  4RGG A;  5LA9 A;  2HYK A;  3UJO A;  1AJK A;  3GJB A;  2XUM A;  4EWD A;  5JUV A;  4LK7 A;  3KWV A;  4HZF A;  2EAK A;  1NAE A;  1JU3 A;  2ZHL A;  3S5Q A;  4OVE A;  3EJK A;  3VZK A;  3WLU A;  1ULD A;  3NKT A;  3ALQ A;  1CGP A;  2HWD 2;  2YY1 A;  2YDE A;  3QCW A;  3AFK A;  1J58 A;  2AZ5 A;  2E32 A;  5IFP A;  3I3B A;  2A73 B;  2DU0 A;  2R30 A;  2VOV A;  2DDU A;  3KM5 A;  4NWV A;  4FT8 A;  4Q2F A;  4BXS V;  5FY5 A;  1LOE A;  1G7Y A;  1U5Y A;  2ZGO A;  3I3M A;  1KEX A;  2VUD A;  1Q43 A;  4C91 A;  4YYO A;  4XUT A;  5LEJ A;  2ORX A;  5LA2 A;  2VG9 A;  3IDA A;  4JDO A;  5BNP B;  4JAA A;  1NA1 A;  1RUJ 1;  1RHI 2;  4YPJ A;  1DU3 D;  1C4R A;  1XNC A;  2JEM A;  3WIN E;  3RJR A;  4ZXK A;  1QGL A;  4CDW A;  4CYD A;  4XIO A;  3QLQ A;  3HD8 B;  3DGT A;  3GDB A;  4NRO A;  3ZX7 A;  3I3D A;  1QDC A;  2TNF A;  4XDO A;  2K0G A;  3ZXA C;  1ULC A;  1YNA A;  1NCR C;  2PLV 1;  3NST A;  2OW4 A;  2IVI B;  4IV3 C;  4EWE A;  1KQR A;  1RMU 1;  3RYP A;  2FDF A;  1W3V A;  1O5U A;  5HXM A;  5SV5 A;  4DO0 A;  5BUV A;  2XBO 2;  1ZRF A;  5KC5 A;  1BMV 2;  1KRI A;  1Z78 A;  4GB3 2;  2WNV B;  3UGH A;  1UX6 A;  1H2N A;  4YNI A;  4P9W A;  1LCL A;  2MHF A;  3AKS A;  1YFW A;  2WT2 A;  1H0B A;  3TBD A;  2CAV A;  2OA2 A;  1HXS 3;  2QQI A;  4AED B;  4LHL A;  4QQL A;  2FCT A;  5C5T A;  2RJ2 A;  3IBM A;  4HXC A;  5KXE A;  3OUJ A;  2VZS A;  1FYU A;  1HN0 A;  3JBG 3;  2ETE A;  3VHO A;  2OQ6 A;  4M3C E;  5IUQ A;  5FAX A;  4JDM A;  1W2A X;  3NJY A;  2RDS A;  4GWI A;  2RS5 3;  4XZU G;  1B35 C;  3BB6 A;  5FZ0 A;  4P08 A;  1H1I A;  2WYS A;  5JOY A;  2CY6 A;  4W50 A;  2DBN A;  5C3P A;  1F4A A;  2WRA A;  2XML A;  5BNO B;  3EB7 A;  2QUO A;  2DV9 A;  4LBQ A;  2VM9 A;  3K48 A;  2DTY A;  3BKZ A;  3WQB A;  2BER A;  2ZXQ A;  2Q1F A;  2WNV A;  2X09 A;  4CU9 A;  1WBF A;  1XYN A;  1AR8 3;  4G3Y C;  5JLV A;  1HRI 2;  2JG8 C;  1JUI A;  3NNJ A;  2BVB A;  3MW2 A;  2NYY A;  4KH9 A;  2ZZJ A;  4YVS A;  1MS4 A;  3U4X A;  4QM8 A;  3VGI A;  2V09 A;  3N9M A;  2PYT A;  2WSU A;  2BP6 A;  4XF4 A;  3OF1 A;  1RGS A;  5FKC A;  2NN8 A;  4XF0 A;  5EYX A;  2EIE A;  3USU B;  3VD4 A;  2GNB A;  3HAG A;  5F37 A;  3PVN A;  1F4H A;  4LO8 A;  3AZX A;  4BDV B;  2YC0 A;  4XET A;  1AR7 2;  1RUC 1;  1CAU A;  1KS5 A;  2Q8E A;  3CKH A;  3NWK A;  1BK1 A;  1COV 1;  2YC4 A;  3OD4 A;  4I3P A;  4QDS A;  1W8W A;  3T1M A;  2D93 A;  1XXN A;  3ZDS A;  2O0O A;  2R7E B;  3KGZ A;  3OGV A;  4QB2 A;  3V0B A;  1IS3 A;  1PO2 3;  2BWA A;  1N3P A;  1DF0 A;  1GZC A;  1BVV A;  1POQ A;  2XHN A;  3SCF A;  1G9B A;  2VMI A;  2E7A A;  3IN9 A;  1VJ2 A;  3WP5 A;  2N7G A;  1GQP A;  1LOC A;  3VD9 A;  5DN2 A;  4OI1 A;  2W52 A;  4JHT A;  1W8U A;  3E6D A;  2NM1 A;  4YZ3 A;  4XHB A;  2HWC 3;  5C7G A;  2NP0 A;  2HBU A;  3P5B A;  5FUN A;  4PF5 A;  4RQP C;  5FY9 A;  5JSO A;  1HJG A;  4LOR A;  4KQ7 A;  4XUP A;  4D0Q A;  2QKD A;  4LPL A;  2FD8 A;  3LAG A;  2WN2 A;  4Q1P A;  3J4U H;  4TLG A;  4OQ8 A;  5FMO S;  3POY A;  4QXK A;  4S2G A;  2HH9 A;  4QHB A;  4PI0 A;  1PIV 1;  1SHW B;  3OBT A;  3OJB A;  5FZI A;  4OHY A;  5LWB A;  3USS A;  4XFC A;  4LQR A;  4QPY A;  3DYO A;  4QM9 A;  3TRS B;  4DXZ A;  2WA3 A;  5DAW A;  5KXC A;  5JXI A;  2BJS A;  2DVB A;  1SCS A;  4PLM A;  3APB A;  2VOK A;  5A7W B;  5GAL A;  5DZG A;  2FZ1 A;  2ZAA A;  4AWD A;  5LY1 A;  1WW6 A;  1X8E A;  1YXW A;  2VVD A;  1E57 A;  3SH3 A;  3VN4 A;  1VE0 A;  1PO1 1;  3N9L A;  2R0F A;  1JW6 A;  4QWN A;  4CTE A;  4PBO A;  3WCS A;  1A8D A;  4AI8 A;  4AE2 A;  1Z7S 1;  3PVO A;  4ASK A;  5H9S A;  1SBF A;  1V6L A;  3T2T A;  4K1Z A;  3RZM A;  5FYU A;  1DQ4 A;  1H8T B;  2D44 A;  1UW8 A;  1CPN A;  2FMD A;  3H7J A;  1H4H A;  3LEG A;  4Y22 A;  1CJD A;  3DF0 A;  3VBS B;  1MEC 2;  1GUI A;  3J7L A;  4KMQ A;  2IFR A;  1PMI A;  2EID A;  4KGG A;  3HJR A;  3WV6 A;  5ABJ C;  1OVS A;  4CDU C;  3C8X A;  4UBH A;  3ZN5 A;  1VRB A;  4L92 A;  1GIC A;  1VBB 2;  3B69 A;  3LB9 A;  4BQ5 A;  4PQ9 A;  2PEL A;  1S55 A;  1RB8 G;  4B4R A;  2Y34 A;  4WVM A;  5A7W A;  3UKT A;  3ZO0 B;  4DRV A;  1RUI 3;  2GAU A;  1WCD J;  2DVG A;  1OA3 A;  2P3I A;  4DXS A;  1QJU 3;  1VBA 1;  3VBU B;  3HNY M;  2VOW A;  1JZ8 A;  4LBO A;  3O1M A;  2R32 A;  3I8T A;  5A7S A;  2LRO A;  4QXH A;  4IET A;  4EN0 A;  4UFI A;  4QGN A;  3ETP A;  1RUG 1;  1TNR A;  5IAX A;  5JPM B;  2J22 A;  1XBF A;  3DL3 A;  3B3Q E;  3VBS A;  1FX5 A;  3X29 B;  1V9U 1;  1W9Y A;  1XOY A;  4GIQ A;  4ZKT B;  4HT1 T;  2HWB 1;  4UBG A;  3KHB A;  1GKB A;  3MW4 A;  2ZEY A;  1R08 1;  5FZ8 A;  1V6N A;  3Q8E A;  2W46 A;  1VRH 3;  3ME2 A;  4P9X A;  4FTE A;  5FPA A;  4YW2 A;  4AAP A;  1HRV 3;  4COV A;  1EAH 2;  1DQ2 A;  1A34 A;  1C8M 2;  1BEV 1;  3CQO A;  4UFH A;  4W6Y A;  4URT A;  4WM8 B;  3AYE A;  2CDP A;  3H8X A;  5IK5 A;  2EIB A;  4DUV A;  5DG2 A;  2WAA A;  3WNP A;  2B8M A;  2E51 A;  2HWF 1;  4UYB A;  4YVW C;  2ZHN A;  1RUE 2;  4BA6 A;  3ZXD A;  1VMH A;  1BJQ A;  1LKN A;  5FZL A;  5FK7 A;  3ZN6 B;  4JGZ C;  5F32 A;  5IFT A;  1ZBA 1;  1TNF A;  3AL5 A;  2V4A A;  2OQ7 A;  1NLS A;  3T4H B;  5C6C A;  1BMV 1;  1IS5 A;  1QQP 1;  2BUK A;  1VBE 2;  1I1E A;  4ZZ8 A;  2ZX2 A;  2BQP A;  4OUL A;  1V6J A;  1PGW 2;  3OSD A;  5APA A;  1OPM A;  1I3H A;  1YQ8 A;  5IVV A;  2VTF A;  5LAT A;  3LWC A;  3ZR5 A;  3I97 A;  1NY7 1;  4Q4X 3;  3ACL A;  1DGW X;  2QZ2 A;  2W39 A;  5F6K A;  4QDQ A;  4IE4 A;  5KC6 A;  3WW1 A;  5FWJ A;  5JWP A;  1ZBE 3;  1TME 2;  3BOP A;  4P5Y A;  4Q27 A;  1LOF A;  2K9Z A;  3MID A;  1NA1 C;  4QQO A;  4Y20 A;  1WA4 A;  2W0X A;  1UWW A;  3VBF B;  1RUH 3;  1X8M A;  1MPX A;  4X6R B;  3VBO B;  4IND A;  1JYT A;  2KM2 A;  1SMV A;  2WT1 A;  4XUN A;  5FY0 A;  4CDW C;  2MEV 1;  4DNY A;  4QPI B;  4AQ2 A;  4V2W A;  4DB5 A;  2VJX A;  3OUH A;  4AVV A;  4LO7 A;  1R1A 1;  2JEC A;  3OOX A;  4OHZ A;  5FYZ A;  5JOW A;  1LRH A;  3RZG A;  4UF0 B;  4EN7 B;  1QJE A;  1RUF 1;  1FPN 1;  2TEP A;  3A0N A;  2XJP A;  1SBD A;  5FP8 A;  4BQ3 A;  2D43 A;  1OUX A;  2Y6H A;  1HV0 A;  3BTX A;  4Q26 A;  3ILN A;  3NQH A;  3CJI A;  1OVP A;  1D4M 1;  3IMN A;  4EN6 B;  1QNY A;  4GMP 0;  1UU5 A;  1JOJ A;  4B29 A;  3D4K A;  1JUH A;  5LEK A;  2W5F A;  1GFF 2;  1JXN A;  4QQH A;  2D6K A;  5T5L A;  3N9P A;  3ZYB A;  3O7O A;  1NT0 A;  2YPD A;  2GAL A;  4IV1 B;  2Y38 A;  5FYH A;  1LUL A;  1C57 A;  1W04 A;  2BV4 A;  1Q56 A;  2Q1Z B;  3IIA A;  4LNV A;  4TN7 A;  5FUP A;  1A3K A;  3E5U A;  4LIV A;  1GLH A;  3T08 A;  2TBV A;  5FZ7 A;  4QHZ A;  3ZYG A;  2B4K A;  2K2S A;  2VR4 A;  4BIF A;  1ZA4 A;  3NV3 A;  3KV4 A;  4NIH A;  3Q8A A;  3WUC A;  1ND3 B;  4CU7 A;  4FAH A;  1PGL 1;  3KVA A;  2R07 1;  4PQQ A;  2JKB A;  2YMZ A;  3PNA A;  3TB0 A;  3LOB A;  1YJK A;  4WBB A;  1CVN A;  1CN1 A;  2B9U A;  3ILR A;  4YW1 A;  4A42 A;  5F39 A;  2WNV C;  2WO3 A;  4HMZ A;  3PUH A;  2VMF A;  4XDQ A;  5F3I A;  3MIE A;  3LSD A;  1GV9 A;  1GR3 A;  1PK6 B;  4PI2 A;  4CCL A;  2WAO A;  1YI9 A;  2ZGN A;  1EV1 3;  1PVC 2;  4YVS C;  4DY5 A;  1H30 A;  2ZKL A;  3N35 A;  4CU6 A;  1SG3 A;  2VQU A;  1CZV A;  3CLP A;  4XYX A;  2OVU A;  5CG8 A;  3GZE A;  1JZ5 A;  5A3L A;  5A1L A;  2D3S A;  4AF9 A;  1DDL A;  4CPB A;  4Y5T A;  5I0D A;  1ND3 A;  3BTA A;  3K75 B;  5FZO B;  3RI8 A;  1NXD 1;  4XC9 A;  3B9C A;  2XQR A;  3NL1 A;  1Q8Q A;  1GU3 A;  1ULO A;  2VPV A;  3C7E A;  2DVA A;  3TYJ A;  1DYP A;  4CUA A;  2VCA A;  4CXW A;  2GN3 A;  2W47 A;  1TMF 1;  5JSR A;  2FDJ A;  1N3Q A;  2QFE A;  2ZGL A;  1W2U A;  2EF6 A;  5CKM A;  2GC3 A;  1PK6 A;  4KWJ A;  3CZU A;  4ASL A;  3SLI A;  5AC9 3;  2R06 3;  5FY8 A;  4E27 A;  5L9V A;  4Q0Q A;  3D5O A;  1WCU A;  3I2K A;  3SIT A;  3J7M A;  3UNP A;  3VL9 A;  3M70 A;  1AL2 1;  4GZ9 A;  1SEF A;  4Y4Y A;  4Y1V A;  4UXA A;  1W9S A;  2I07 B;  1RUJ 3;  2P1B A;  3CIH A;  5J98 B;  3ZFE A;  1F5F A;  4AI3 A;  3N7M A;  5JOZ A;  1FOD 1;  3OTF A;  2BTV C;  3LE0 A;  5FZO A;  2OKX A;  3PVB B;  1T6G C;  5D2A A;  1O4Z A;  3H1M A;  1HXS 2;  4WVW A;  2A7A A;  1CAV A;  2PTM A;  3POG A;  1YFX A;  4PCR A;  3TNP B;  1ASJ 1;  1O3Q A;  2YGM A;  1FAT A;  2VQA A;  1W6Q A;  1F8V A;  3QD6 A;  5LB6 A;  3TEX A;  3JBG 2;  2NMO A;  1BKZ A;  5C4W C;  3Q8C A;  5DMY A;  2PLV 3;  3AJZ A;  3N7J A;  4XFF A;  2QQV A;  2RJL A;  3O1O A;  1XE0 A;  1HV1 A;  4YLZ A;  3ECQ A;  2RS5 2;  1YEW A;  2SLI A;  3W5N A;  2Y6G A;  4E2Q A;  3MDP A;  3Q8F A;  3AP4 A;  3GF6 A;  1QU0 A;  1TQ5 A;  3CHX A;  1D7P M;  1MS1 A;  1R1Z A;  3FC0 A;  3NNF A;  2D6M A;  2RMU 1;  1H6X A;  1JH5 A;  1DGW A;  3WQ0 A;  1XU2 A;  3VDD B;  5ISL A;  2Y0I A;  3LDR A;  4H3W A;  5F7U A;  2OPW A;  3JUU A;  4YG3 A;  1AR8 2;  1HB4 A;  2C9A A;  4OLL A;  5CFC A;  4YZ2 A;  4Z8B A;  3B93 A;  2B46 X;  4MVT A;  3LZZ A;  1N47 A;  3HPN A;  5FXZ A;  1PX3 A;  1F31 A;  2VQ0 A;  4CUG A;  2F4P A;  4DXT A;  3OGR A;  2CGP A;  1QJX 1;  3AMM A;  3TN9 3;  3WY6 A;  3MYX A;  5JSP A;  2IFW A;  2VTX J;  1C1F A;  1TZO A;  1UO9 A;  5K0U A;  2YG0 A;  4M00 A;  5LBF A;  4ZZ5 A;  3FBY A;  3EQE A;  4XAC A;  4AXO A;  2UUR A;  1W6O B;  3IPV A;  4DEV A;  3IAP A;  2JDN A;  2OS2 A;  4MOA A;  4NHY A;  4XAE A;  2VAU A;  1QJY 1;  4YZ1 A;  1JYW A;  2XJT A;  3M3Q A;  1HIX A;  1PO2 2;  2XON A;  3HNB M;  3MV0 1;  4LHS A;  5DUV A;  3VHR A;  4CP9 B;  3UET A;  1DGR A;  3VB9 A;  3E5Q A;  4RHV 3;  1VBD 1;  3N9Q A;  2WA4 A;  5JZG B;  2PHR A;  3HBZ A;  2GND A;  1SFP A;  4XW3 A;  3E6C C;  1DBN A;  2JDH A;  1SLI A;  2HWC 2;  2XVK A;  1SBE A;  1YJL A;  3LF7 A;  5IK8 A;  2RS3 3;  3S0M A;  1GNY A;  3Q9O A;  4FOW A;  2QJV A;  4XF1 A;  1NCQ B;  1UOJ A;  1O5L A;  3FN9 A;  3KMH A;  4NPR A;  2J42 A;  4QX3 A;  4JGY A;  2FCU A;  1QF3 A;  2PAK A;  3U78 A;  2KR2 A;  1AXK A;  2W94 A;  1FAY A;  2R6Q A;  4UW4 A;  1XNT A;  4B4P A;  5A6Y A;  1AR6 1;  1AX2 A;  4CCC A;  2FQP A;  5IJR A;  1JHN A;  2D3P A;  4LBJ A;  3B9I A;  5FBZ A;  4R9D A;  4CCD A;  2BFU L;  2WO1 A;  3ZFF B;  4AFA A;  3KT4 A;  5JPN B;  5FO8 B;  2EXI A;  3NV2 A;  1Q5O A;  3VBH C;  1IS6 A;  2WS9 1;  3I3Q A;  4KU8 A;  2BWC A;  3CMG A;  5FPZ A;  5FWE A;  2XJR A;  4H7L A;  1ZZC A;  1LAJ A;  3M7A A;  4COY A;  2IUW A;  2O8O A;  3ZKU A;  5E89 A;  4I0A A;  4MYE A;  1WME A;  3MLK A;  2X5I A;  1PIV 3;  1VB4 A;  5DQ0 A;  3ZFG B;  3NVC A;  3ZYJ B;  4AFB A;  5AVA A;  2Q8C A;  4LLF A;  5JOX A;  1UY2 A;  2ZEX A;  2A3Y A;  3K77 A;  4LR4 A;  4LKE A;  4P9J A;  4LBM A;  3B00 A;  3ZDV A;  3I2O A;  1LOF C;  3JU9 A;  3WG4 A;  1W6M B;  1OFN A;  1WMD A;  1JZ4 A;  5B4N A;  5IVE A;  4QMA A;  1M4W A;  4Q0U A;  1LED A;  4Y1Z A;  1G9C A;  2DWR A;  3OPZ A;  4IE0 A;  5FOB B;  2OT7 A;  2Y26 A;  3MIF A;  2AH2 A;  4G9S B;  1PO1 3;  1KXG A;  1PM7 A;  1PM4 A;  3WF0 A;  5L19 A;  1RUI 2;  1Z7S 3;  3POI A;  4D7T A;  3KHC A;  5IWF A;  1YO8 A;  1QJU 2;  3P6B A;  1STM A;  3HWJ A;  3KQR A;  4QX7 A;  3H7Y A;  1C5H A;  4AOC A;  5J1X A;  2BGP A;  5CFD C;  1PHM A;  1GWK A;  2VCM A;  1YFY A;  4BWO A;  3CJI C;  4OZO A;  3I54 A;  2Z5W A;  1L7Q A;  1GP6 A;  1MZ5 A;  1VR3 A;  3GCW A;  3HN3 A;  4FPK A;  4NHK A;  5D8A A;  5J36 A;  4XBN A;  3T1L A;  2FBE A;  3M3O A;  3R4D B;  3PUI A;  3TOJ A;  1S1A A;  5I91 A;  3DXU A;  4WM7 B;  2QQL A;  2B5H A;  4MGQ A;  1W6M A;  2J1U A;  3PDQ A;  1AYN 3;  1BBT 1;  1RTV A;  1VRH 2;  3RVH A;  1MZ6 A;  5CEH A;  5IK7 A;  1HRV 2;  3WF4 A;  3WQ1 A;  2WZP P;  3GZA A;  4QKF A;  1QDO A;  4S2H A;  1VBA 3;  3K46 A;  2WC2 A;  2VOT A;  3GZU C;  3OGJ A;  4LKF A;  3W58 A;  4OHV A;  4LE3 A;  1KJL A;  1JS9 A;  4RS5 B;  4L2N A;  5L7O A;  2Y6J A;  5EIY B;  5JIA A;  4ES8 A;  4K21 A;  2OUJ A;  4R9A A;  4PT6 A;  3OBR A;  3VBR B;  5FQ0 A;  4FPG A;  4YW6 A;  1S0J A;  2HWD 1;  5A3M A;  1V9U 3;  4AAX A;  4Q4W 3;  3PIJ A;  4NRP A;  2MNG A;  2YYO A;  3VD3 A;  3AKP A;  1ND2 B;  2QQK A;  2XR4 A;  5FO7 B;  1MAC A;  4E4H A;  3O5S A;  1YFU A;  2Y6F A;  4AEM A;  4LEJ A;  3OBA A;  3CJX A;  1JU4 A;  1A78 A;  1BYH A;  2WR9 A;  1BEV 3;  1IGO A;  1UXZ A;  2YXS A;  3GAL A;  4GD4 A;  4QU2 A;  5IAV A;  5FP9 A;  3LD8 A;  4C1X A;  4CDQ B;  2CTV A;  5FZ3 A;  4CCJ A;  3OD0 A;  3C7H A;  3J9S A;  1W9T A;  4FPO B;  2HWF 3;  5FLI A;  4D69 A;  3V0A A;  4IEZ A;  1K12 A;  2WUH A;  3MGU A;  1I5P A;  3WDU A;  4Q4X 2;  4QX8 A;  1O4T A;  3VZJ A;  1JMU B;  2CHH A;  4B7E A;  4K40 A;  3LPF A;  4BE3 A;  1AX1 A;  2W1W A;  1OQE A;  1ND3 C;  1O8P A;  2XQX A;  4RS5 A;  3T4V A;  5C9A A;  1ZBE 2;  5A32 B;  5CBL A;  4N43 B;  3VKL A;  4FTS A;  1BZW A;  4HBN A;  4IL7 A;  3HOB A;  4CCE A;  1RUH 2;  2P4E A;  4MAD A;  4DPN A;  1W2N A;  5K7P A;  3KSC A;  4FPF A;  5DAV A;  1N1V A;  1F35 A;  1XSQ A;  3WNL A;  5C3O A;  1MS5 A;  3L2Y A;  5CKQ A;  3I2J A;  1WMF A;  2E9Q A;  3MUY 1;  2A6W A;  3RS6 A;  1MQT B;  5FRE A;  4AVA A;  1SPP B;  2VY0 A;  2XLG A;  4Z2W A;  1KGY A;  3NKG A;  2Z2S B;  3ZSK A;  1QH6 A;  3WF1 A;  2JD9 A;  3ZYF A;  5ACA 3;  3MUZ 1;  2R1B A;  3AX4 A;  4CEY B;  1YQ5 A;  3BN6 A;  4XMI A;  2JDA A;  1S2K A;  3WQ7 A;  4AGR A;  3ZFE C;  1DP0 A;  1RVF 1;  4LIU A;  2CWS A;  4GJY A;  1OC1 A;  2XJU A;  4N9I A;  3GBF A;  3ES4 A;  3SIS A;  4FPE A;  1KFX L;  4GWM A;  3WDX A;  1MS0 A;  1REF A;  3WW4 A;  5A32 A;  5C8C B;  2ZGK A;  3O1V A;  2IXJ A;  4FOV A;  1F15 A;  2WZR 3;  1DFQ A;  1R09 3;  4CCK A;  1JYI A;  3AMH A;  3FMG A;  5IVC A;  1WMX A;  2AR6 A;  4LXL A;  1MVQ A;  1S0F A;  2R16 A;  4L0P A;  2GZW A;  3DPR B;  5LBE A;  4URA A;  4PJY A;  1FPN 3;  5DDJ 1;  4K6B A;  3THT A;  4PIZ A;  1MS3 A;  2RV9 A;  2G1M A;  2RVA A;  2XLA A;  3AXE A;  2ZHK A;  3POE A;  1HRI 1;  5AVP A;  3E5X A;  1MQT A;  1SPP A;  1W06 A;  2VC9 A;  1D4M 3;  3B02 A;  3I2H A;  1LEC A;  1OT5 A;  1HB2 A;  4HKW A;  3SQO A;  1BVP 1;  5DXD A;  3RWK X;  3N7K A;  1W6N B;  3PU8 A;  1DIW A;  1UXX X;  2Q8O A;  3RQ0 A;  4ATE A;  5K9Y A;  3NW4 A;  3PUS A;  5A80 A;  5K8S A;  4XIK A;  1LHW A;  2D5F A;  2HBT A;  3CF6 E;  4Q4Y 3;  5FPX A;  4KWU A;  4RR3 B;  1ALY A;  1CAW B;  2WT0 A;  3IMM A;  4PIX A;  2XWJ B;  4YM2 A;  5C8C A;  3PUQ A;  3FL7 A;  4Q1R A;  1Q8V A;  4LBL A;  4XTP A;  3ZXF A;  5CFC C;  4OI4 A;  2WO2 A;  1HDK A;  1EV1 2;  5BNP A;  4LBN A;  1O3T A;  1LNS A;  4NAM A;  2VZO A;  2GH8 A;  4MHU A;  3WP3 A;  3H50 A;  3III A;  3VKO A;  4P00 B;  2R07 3;  5CVR A;  5FYM A;  3JQW A;  3PIG A;  3U14 A;  4BXF A;  3HT1 A;  1VAV A;  1U0A A;  4QPG B;  3FUO A;  1IPJ A;  1OLM A;  4C0H A;  3OYW B;  3ATG A;  5K0U C;  4AGG A;  3A0K A;  1CJP A;  4MXW B;  2X29 A;  4GAL A;  2GNM A;  2VO5 A;  4JRA A;  1PGS A;  3AC0 A;  2J1T A;  5HCB A;  1SZB A;  4BQW A;  3DCQ A;  2BPA 2;  1E5S A;  3T09 A;  2ZTN A;  1UOB A;  4K1Y A;  4FPY A;  4RA0 A;  1JOP A;  2JIG A;  3POB A;  1JZ7 A;  3OUI A;  2JX9 A;  4UW3 A;  5G04 L;  3UYJ A;  3C3V A;  2P6H A;  3AZZ A;  4L99 A;  2PHF A;  4RR3 A;  5C71 A;  1L3J A;  2QVS B;  4R4X A;  3IDE A;  1E5R A;  2HWE 1;  3OY8 B;  1S0D A;  2W1S A;  2WBK A;  3ZPY A;  4AED A;  2B42 B;  5AC9 2;  2R06 2;  3MW3 A;  4LBQ D;  1W03 A;  2ARB A;  2WQ8 A;  4N8M A;  2AUY A;  2P34 A;  2Z69 A;  4KNC A;  3ZMO A;  2B39 A;  2E53 A;  2W1U A;  4V1P A;  3V65 A;  4M4R A;  2JB4 A;  1RUJ 2;  2PHD A;  4JGY C;  2Y6L A;  3PUR A;  3JD7 1;  3JQX A;  3OYW A;  5A7O A;  5FYB A;  1OUS A;  5I0U A;  1H8V A;  4YG0 A;  1TMF 3;  2W1Q A;  1LHU A;  1MR5 A;  2TUN A;  2VGD A;  1D2S A;  4LA2 A;  5BNO A;  5A70 A;  5GLT A;  2EA7 A;  3MEP A;  3OGG A;  5KHG A;  1W3X A;  2HEV F;  1DYK A;  4P9L A;  5A1A A;  2XB6 C;  1YQC A;  3VHP A;  3WDV A;  4N53 B;  1PVX A;  4HSL A;  4YZ5 A;  1VAL A;  2R04 1;  4E8D A;  3M8L A;  4LK6 A;  1DCS A;  4PLN A;  3MHZ A;  4XQW A;  4CRQ A;  4AI0 A;  1VBB 1;  1C3H A;  3HQU A;  1VBC 3;  4M0H A;  2X5I C;  1FOD 3;  1ULF A;  2QQM A;  4LE4 A;  1GYK A;  2WJS A;  1ZA7 A;  3R05 A;  1KJR A;  3ZIX A;  2PMW B;  3K3N A;  5EHD A;  3USU A;  4AVT A;  5FMD A;  2E7T A;  2J1E A;  2J7M A;  3O12 A;  2NQY A;  4EJR A;  4KI5 M;  5JI7 A;  4FTB A;  3AM2 A;  3CDZ B;  2BDR A;  5CB7 A;  1J83 A;  3T3Y A;  2EIG A;  1R64 A;  3I2I A;  1UYZ A;  4NPL A;  1FMD 1;  1WLW A;  2UY9 A;  3RFR A;  4LUM A;  5A33 B;  4Y33 A;  1XPW A;  3BCW A;  3TAY A;  1UZW A;  4RGA A;  3FX3 A;  1H4G A;  1WBL A;  2ZKN A;  4AHX A;  1OFS A;  5BYN A;  2P17 A;  2RS1 3;  4Y5Z 0;  3O1R A;  1I6X A;  1AR9 1;  3KF5 A;  2YZ4 A;  1TVG A;  3TN9 2;  3VHN A;  3UJQ A;  1GZW B;  3RI9 A;  3DKW A;  1IS4 A;  3M4F A;  1EAH 1;  2LM3 A;  4EV0 A;  3AVS A;  2L9L A;  4FQZ A;  5L9R A;  1UF2 C;  2CGO A;  3MIC A;  2JDP A;  2CNA A;  3I4I A;  3PLQ A;  2GN7 A;  5D8A C;  3N4M A;  5JMC A;  4ISQ A;  5JR2 A;  1RUE 1;  2WZE A;  4OHW A;  4RHV 2;  3QBQ A;  4GMP 3;  3ZFF A;  5LCW L;  5E6H A;  5A6Q A;  1ZX5 A;  2D40 A;  2PN5 A;  3MF6 A;  1W90 A;  2H6B A;  4A6S A;  2ZOE B;  4J1W A;  3SMH A;  1GP5 A;  1YIP A;  2RS3 2;  3LSE A;  5A33 A;  3NAP B;  2VXR A;  2ZGR A;  4SLI A;  4C90 A;  1CD3 G;  3D3A A;  2UWB A;  1KDK A;  4XIL A;  2Y6K A;  2VBB A;  3WNX A;  2WLQ A;  1BHG A;  2ZGU A;  2JE8 A;  3LA7 A;  5L7O C;  4M01 A;  4WVV A;  1XYO A;  1QJY 3;  3WNN A;  2WFF 3;  3ASI A;  2ZS6 B;  3H8U A;  2C5D A;  3DXT A;  1XYP A;  4O7X A;  5CU1 A;  2AGS A;  2ARC A;  1RXG A;  1ZVF A;  1P8J A;  1VBD 3;  4ZU4 A;  3VKN A;  3KV9 A;  1K3I A;  3C2U A;  4N9H A;  1IQA A;  1J1T A;  2HKX A;  1H8T A;  4IEP A;  1Q8O A;  3WCR A;  2HYX A;  1OLQ A;  1UAI A;  2YU2 A;  3VDC A;  1TME 1;  4Z2A A;  3VDB A;  3FHQ A;  2R0H A;  3BOD A;  1W8Z A;  3U75 A;  1XND A;  1DQ0 A;  2EXJ A;  4MGK E;  1B09 A;  1W28 A;  1OHF A;  3U1X A;  2FDK A;  2WQZ C;  3T2P A;  3ZXG A;  2FDG A;  3E97 A;  1HKD A;  2VBP A;  4CXY A;  2GMM A;  1E5I A;  3OPW A;  1PIV 2;  1LHV A;  5B4X A;  3SH5 A;  3SHR A;  1O6U A;  1D4V B;  1AR6 3;  4XTM A;  5FPL A;  3ACF A;  4XUR A;  2Q8D A;  1JYC A;  5FJH A;  1AYM 1;  5C9A C;  2RG4 A;  3FFZ A;  5FYC A;  1YRZ A;  1ZRI A;  2E26 A;  2O14 A;  4A7Z A;  5G05 L;  4FSJ A;  5FYI A;  4JTN A;  4PDW B;  3V56 A;  3VBU A;  3HEI A;  2ZGS A;  2G4I A;  4HLT A;  4ISR A;  4AEK A;  4YZ4 A;  3FUQ A;  3GXU A;  1POV 1;  1SLT A;  1QOO A;  1X7N A;  2BOI A;  3ILF A;  2EXK A;  5GZG A;  3ETQ A;  1PO1 2;  2LUW A;  4EQV A;  3MBW A;  5KR7 A;  4EN8 B;  3URF A;  1Z7S 2;  1GZ9 A;  3OG2 A;  2UY8 A;  4FBF A;  4NJ4 A;  5FBJ A;  1LB2 A;  1YI7 A;  2YB7 A;  4MET A;  2IVJ A;  1H1A A;  4KL1 A;  1JYV A;  1SDD B;  1TE1 B;  3WSO A;  2BNM A;  4E4Z A;  3HMY A;  2Q30 A;  1DHK B;  3PME A;  4WM8 A;  4AK3 A;  2DCK A;  5HCF A;  3UT0 A;  3CO2 A;  4OFG A;  4OUM A;  1I9R A;  3VZL A;  5FR3 A;  1OD5 A;  4LTA A;  3FLR A;  5GLW A;  3VV1 A;  1AVB A;  4Z1V A;  1US3 A;  2D97 A;  5C70 A;  4EZH A;  2JDZ A;  2D6O X;  4PDW A;  4KBB A;  4JKL A;  1AYN 2;  3KCY A;  5DAQ A;  2D98 A;  5EP9 A;  4Y1X A;  2BGO A;  3ZN6 A;  1GBG A;  4OQ9 A;  3RMX A;  3GBG A;  4HPK B;  4IXL A;  1VBA 2;  2GU9 A;  4BCU A;  2BNN A;  5EZW A;  3HNM A;  1W8O A;  1XU1 A;  4L8Q A;  4AVB A;  4NHL A;  4NO4 A;  4HVQ A;  2WWU A;  4E2S A;  1CX4 A;  1DGR N;  4ZS3 A;  1DGL A;  2BRT A;  5FOJ B;  2C4X A;  4BU2 A;  2VUC A;  1PVC 1;  5J09 A;  4LMF A;  2VOX A;  3AP6 A;  2NLR A;  5GLV A;  2A70 A;  1V9U 2;  4XFG A;  2K46 A;  4Q4W 2;  4UAP A;  1OA2 A;  4M0N A;  5FZ4 A;  5FZB A;  1LOB A;  2HJI A;  3A22 A;  1QHD A;  4J1X A;  4NN0 A;  2ZEZ A;  4IER A;  1FNY A;  3CL1 A;  5FZF A;  3RYK A;  5A3P A;  1V0A A;  5KWR A;  3FHI B;  5BNN B;  2NZ9 A;  3I2F A;  5ANN A;  3RMY A;  1BEV 2;  3I59 B;  3BAL A;  4UFJ A;  1UN1 A;  4M3C F;  5BNP C;  3I2G A;  1X9T A;  4LA3 A;  3D0J A;  1WCQ A;  3CNA A;  3VBF A;  3AFG A;  3BUC A;  4Q5O A;  3VBO A;  2HWF 2;  3SC7 X;  3H3Z A;  2YUE A;  4DFS A;  3G6J B;  3GNE A;  3JZV A;  5C5U A;  3E6B A;  1TG7 A;  1EY2 A;  3H42 B;  4QAW A;  2DCZ A;  1CAX B;  4QPI A;  5BXX A;  4BLJ A;  3NNM A;  4QXB A;  1YIF A;  3U37 A;  4BK4 A;  3N9N A;  3SKV A;  3CBN A;  3ROU A;  5EJZ B;  4MX3 A;  4UF0 A;  1Y3T A;  4NUB A;  4BMB A;  3VDA A;  2XPJ A;  2ZAB A;  3PJY A;  5GKA C;  5DG1 A;  2PHU A;  1JBC A;  4CEW B;  4CP1 A;  5EFU A;  2XLF A;  2GP5 A;  4HK9 A;  4ERO A;  1LHN A;  4CCO A;  1Y7B A;  3R0R A;  2YBK A;  5BNN A;  1WD3 A;  4I02 A;  3IM0 A;  1NY7 2;  4IES A;  4HSJ A;  4JQR A;  2AEN A;  2ZGM A;  4XFI A;  4GXL A;  2G9Z A;  4XF9 A;  2E63 A;  3LA2 A;  1DQ5 A;  4IV1 A;  4AED C;  2PAE A;  4LO5 B;  4Q29 A;  5FP3 A;  5ACA 2;  4AZZ A;  4BQ2 A;  5FYY A;  2Z4F A;  1PZ8 A;  3KQ4 B;  4YGE A;  4M4P A;  3LPG A;  2VL4 A;  4Q4V 1;  1CAX A;  1RUD 1;  4QGL A;  2Z79 A;  3ZYH A;  1DQ1 A;  1OOP B;  3EYP A;  3K2O A;  4BH9 A;  5FV3 A;  3KZ4 C;  2V5Y A;  5LA1 A;  2ENR A;  1CIY A;  2WZR 2;  1R09 2;  5BNO C;  3S5A A;  1UYX A;  5FZC A;  1WLT A;  2QDR A;  1OXC A;  4CEW A;  3J8F 1;  1XC6 A;  4CPB D;  2JDU A;  2W3J A;  4HOO A;  3AMN A;  1FPN 2;  3ZLI A;  5FYT A;  2RR1 1;  4GH4 B;  4RN5 A;  4YGD A;  1GMM A;  1OKO A;  1S0C A;  1W05 A;  2ZX3 A;  4LUK A;  3WNM A;  5FUI A;  4CUC A;  2JE9 A;  1D4M 2;  1RVF 3;  4NRM A;  4EWA A;  3P1I A;  5FZE A;  3U07 A;  2WNE A;  3SH4 A;  2B45 X;  2A3W A;  2AC1 A;  2WNU B;  4LLO A;  2VCC A;  2QQU A;  2WWS A;  2EIC A;  2WNO A;  4COW A;  5FK8 A;  5CIR A;  3TEZ A;  4LO6 B;  2A75 A;  4Q4Y 2;  4CP0 A;  2Y60 A;  4WZC A;  1OQD A;  3FLT A;  1OOP A;  5H9P A;  2EAA A;  1GP4 A;  5DDJ 3;  3GZT B;  3SXW A;  3OCP A;  4UT5 A;  2ZX0 A;  1SLB A;  1G9A A;  1OLM E;  4XPV A;  1Q3E A;  3B7M A;  4YSF A;  1WWY A;  4JZR A;  5FO9 B;  3GBW A;  1QWR A;  1PGL 2;  2R07 2;  1MVE A;  4TSV A;  3S7I A;  3AVR A;  1REE A;  1RMU 3;  5F6L B;  4GH4 A;  5FRA A;  3TEW A;  2V73 A;  4AHY A;  2DUO A;  4F3J A;  3GYD A;  4BOW A;  1HJF A;  4ZXE A;  4FFG A;  1ZZ6 A;  1A6C A;  3GM8 A;  3LKJ A;  4O65 A;  4FFI A;  4YFW A;  3PJQ A;  3T2O A;  2IZW A;  2H6C A;  3ACH A;  3HT2 A;  2WNU A;  3WG2 A;  2ZZQ A;  4RD7 A;  5FXV A;  5FIX A;  1SFY A;  5A3N A;  2PAM A;  4O61 A;  5D21 A;  1Q8S A;  4FFF A;  4JX0 A;  5L73 A;  4CE8 A;  5IYY A;  1K5J A;  4N90 A;  4XXA A;  3UKN A;  1UZZ A;  5FY4 A;  1B35 B;  4YW3 A;  4QX1 A;  1SDW A;  1VAK A;  1H9P A;  2A71 A;  1F5J A;  4LKD A;  1OH4 A;  1O7F A;  1SLC A;  3FBM A;  3R4S A;  5HV0 A;  3WDW A;  5FYV A;  5IHR A;  4BIO A;  3MI8 A;  5FZG A;  3M1H A;  3VKM A;  5LZ6 A;  2VZT A;  5JMO A;  2GSY A;  4IEV A;  5EJ1 B;  5EYY A;  1TMF 2;  2ZGQ A;  4AQ6 A;  3POF A;  4XJU A;  3IDC B;  4A3Z A;  4N7U A;  3ES1 A;  2JG8 B;  5T52 A;  1H8T C;  3FJS A;  2HWE 3;  3LEM A;  4LJH A;  2OX0 A;  1LGC A;  3VBS C;  4FOY A;  4XCA A;  3BI3 A;  4NAO A;  4XAB A;  4B4Q A;  3VDD A;  1ZRD A;  1S0G A;  4UWD A;  2JDK A;  2C9K A;  5LBC A;  1U5X A;  3PVE A;  4HFS A;  3JD7 3;  3J7N A;  4XDP A;  1VBC 2;  2RM2 1;  2ZCW A;  1FOD 2;  1H2M A;  2PQQ A;  3HQR A;  4JVA A;  4Y4R A;  2EAL A;  2VE1 A;  1NX9 A;  2B7Y A;  2WWJ A;  1U12 A;  1RUC 3;  3LQC A;  1D0G A;  4FQ4 A;  4F83 A;  1N1Y A;  1ENX A;  1XNA A;  4Q0V A;  1COV 3;  1JI6 A;  3VUO A;  4XHX A;  1RUI 1;  2BGC A;  3A23 A;  4IDZ A;  1UQX A;  2GC0 A;  2X53 S;  5BNQ A;  5LA0 A;  4YWA A;  4Y1Y A;  3CEW A;  2QZ3 A;  3VBU C;  4P9I A;  3WG1 A;  3UV9 A;  1AF9 A;  1KIT A;  3KT1 A;  2VQT A;  2Z42 A;  1T6B X;  4DMI A;  1W6O A;  2DU1 A;  4BQY A;  2B9V A;  4MO3 M;  4XBQ A;  3C7G A;  4QXC A;  2R04 3;  5FY7 A;  4ET7 A;  1QMJ A;  3W59 A;  2CGN A;  3AKR A;  4TTG A;  4RQP B;  1ZM1 A;  1ZZB A;  2GC2 A;  4CP9 A;  1NKG A;  5T54 A;  4R9C A;  5HXV A;  2RS1 2;  1NUK A;  2A5Z A;  5FKB A;  1VRH 1;  4AVC A;  5JZG A;  2R1D A;  4S2D A;  1IG3 A;  1HRV 1;  5KHK A;  4TYS A;  4E2G A;  3KD4 A;  4TWT A;  4B3N A;  4IEX A;  4WM8 C;  3UGG A;  1HB1 A;  1NCQ A;  4KWK A;  1K5M B;  3RDI A;  1FMD 3;  2BFU S;  1EPZ A;  4IGQ A;  5CKN A;  5JI9 A;  3LCP A;  5FXX A;  3DEM A;  3PTY A;  3WNK A;  1ULE A;  1S2B A;  1UL9 A;  1WA6 X;  5FZ9 A;  2Q5T A;  3MIG A;  1NE6 A;  4JQT A;  1MS9 A;  3SCG A;  5A1F A;  1GOH A;  4NWW A;  1AR9 3;  1SLL A;  1HQN A;  1Y9G A;  2JDY A;  2VNV A;  2QE3 A;  2YFU A;  2YPJ A;  1X9P A;  2DFC A;  1EAH 3;  3NV1 A;  4O9E A;  2X05 A;  2ZML A;  4FAG A;  1VP6 A;  4NID A;  3KS7 A;  3OB8 A;  4ES9 A;  2ZX4 A;  1LHO A;  2CV6 A;  3GHM A;  3WZ1 A;  1QJY 2;  2V4V A;  5FZK A;  2LS6 A;  1X82 A;  2WFF 2;  1WLD A;  3KB5 A;  2BU9 A;  3I3E A;  2VZR A;  4E9K A;  1AUY A;  2FHR A;  1BLZ A;  2WZ8 A;  3KV5 A;  1AXZ A;  3LEI A;  1W6P B;  3OGS A;  4F7Z A;  1VBD 2;  4XJW A;  3ZFG A;  3ZSE A;  5ABJ B;  4JC1 A;  4CDU B;  3WF3 A;  1K5M A;  4ZPI A;  5F8P A;  1C8N A;  4GWJ A;  4AYU A;  4EYU A;  2W87 A;  3LA3 A;  4AW7 A;  1W0N A;  4XF3 A;  4Q0S A;  3F95 A;  4YW7 A;  3T0A A;  3N36 A;  1RUH 1;  3VBF C;  5LY2 A;  1ENQ A;  3VBO C;  3BGA A;  1VMF A;  1Y9Q A;  4EN9 B;  1LEM A;  4D94 A;  1G6N A;  1V6M A;  1W8F A;  5F3C A;  1H1M A;  1PNF A;  1JTZ X;  3KLS A;  4QPI C;  1AR6 2;  4Q8K A;  1JOB A;  4FPC A;  5C3S A;  2BVV A;  3J26 N;  1RUG 3;  2ZJC A;  3M2M A;  4I30 A;  2VW2 A;  4MGY E;  3RPQ A;  3T2Q A;  3HVD A;  5GZE A;  1O8S A;  1TME 3;  3ZSJ A;  4AQS A;  1OA4 A;  2HWB 3;  1HN1 A;  4LHN A;  4K3U A;  1UIK A;  1R08 3;  4ARX A;  5ABJ A;  3D0S A;  1YQ6 A;  4RFT 0;  1ZZ8 A;  1HQW A;  3L9J T;  4K8F A;  2F4L A;  2DUP A;  5F5Q A;  5BNN C;  2IXK A;  2XG3 A;  5DAB A;  1ODN A;  1X33 A;  3MLL A;  4HK8 A;  4WM7 A;  4D7Y A;  4Y3O A;  2OZJ A;  3ZSM A;  4IV1 C;  2ARE A;  1RHI 1;  4AI2 A;  1AYM 3;  2QNK A;  5I8S A;  4YVW B;  1WGP A;  4UFL A;  3LDB A;  1IOA A;  5TSW A;  3UES A;  5A6Z A;  4Y26 A;  4TLF A;  3M3E A;  3B94 A;  1ONA A;  1FNZ A;  4Y5S A;  5FZ1 A;  5FDB A;  2HLE A;  4JGZ B;  2XGX A;  1V70 A;  2WII B;  1ZBA 3;  4PBP A;  4P14 A;  1ULG A;  1APN A;  1POV 3;  4BHP A;  5FCC A;  2I2S A;  4QPW A;  2R49 A;  3VBR A;  4QX5 A;  2YC2 A;  2VNR A;  3AZY A;  3R6S A;  3KF3 A;  1QQP 3;  3FZ3 A;  1UY4 A;  1BCX A;  5HBA A;  3RGB A;  4ITC A;  2XBO 1;  1IKP A;  2UYB A;  1ND2 A;  2EVX A;  2QQN A;  2XOM A;  3MV1 1;  4GB3 1;  4GWN A;  4JCK A;  3ZYP A;  3MZH A;  2AYH A;  2C1F A;  2SBA A;  4FPH A;  1GNZ A;  2A6Z A;  2H0V A;  3ZMN A;  1PK6 C;  2ILM A;  2QQO A;  4L97 A;  1GQG A;  4V2V A;  3UKV A;  1I5Z A;  4Y24 A;  1EV1 1;  3AYA A;  1OMI A;  5I0T A;  4CDQ A;  1AXY A;  1QEX A;  3A7Q A;  1T2X A;  4OMD A;  1KFU L;  1XNB A;  5GM0 A;  4JHZ A;  1MS8 A;  4H2A A;  4CU8 A;  2JIJ A;  5FZ6 A;  2KXL A;  4CA9 A;  5FYS A;  1NA1 B;  3RZZ A;  2HEW F;  3BIW E;  5DUU A;  1XJA A;  3AZW A;  2A6V A;  5GZF A;  3SKJ E;  4JGZ A;  4AI9 A;  2YGL A;  3WEZ A;  5IT6 A;  2G19 A;  2VZU A;  1DQ6 A;  5F5I A;  5FY1 A;  4RFR B;  1OOP C;  4QKN A;  4CDW B;  2OYZ A;  3BYW A;  3M3C A;  4N43 A;  4W8J A;  2MEV 3;  1LGB A;  3U4S A;  5EV7 A;  1OF4 A;  2KD7 A;  5J3U A;  2VUA A;  5F3G A;  1H9W A;  2GMP A;  3KVB A;  4QDR A;  1R1A 3;  1PVC 3;  3ZIW A;  5KBF A;  5CAD A;  4U36 A;  4RGK A;  4HL0 A;  1RUF 3;  2XL7 A;  4I0W B;  4XFB A;  4E4S A;  3CZJ A;  4E8C A;  1GOG A;  3NO8 A;  4GH4 C;  4HKL A;  1JZ6 A;  3H8O A;  3JB8 A;  2ZBJ A;  2RDR A;  1ZYB A;  3H3U A;  5AC9 1;  2CAU A;  1NZC A;  2R06 1;  3N7L A;  1VAM A;  1PMJ X;  4QGM A;  1K45 A;  4AHW A;  1UU4 A;  3EBR A;  4MH0 E;  2WNU C;  3M3I A;  3WUD A;  5E16 A;  4CEY A;  1A8M A;  1QJF A;  3I49 A;  4GJZ A;  1YC6 1;  2Q0A A;  3UGF A;  2XL9 A;  4DRR A;  2VZV A;  1RUO A;  2WL1 A;  3U11 A;  4HON A;  4OYU A;  4ZON A;  5IK4 A;  1AR7 1;  4HN0 A;  1FT9 A;  4AI1 A;  1F9K A;  2JDM A;  2KA3 A;  3WD5 A;  3CU7 A;  4QQ2 A;  2DBI A;  4K20 A;  3UK9 A;  1GZT A;  3DPR A;  4K8R B;  2YBS A;  5LK5 A;  5J48 A;  3J7H A;  2DCT A;  3VLB B;  1BQP A;  1PMH X;  2VXJ A;  1S0I A;  3POJ A;  1AZD A;  4LBQ B;  4G4F A;  1IHM A;  1OF3 A;  3UL2 A;  5JDB A;  3TNQ A;  2DVD A;  1IKQ A;  1Y9M A;  3GCX A;  5GZD A;  4W65 A;  1CX1 A;  2I74 A;  4XFA A;  3FE5 A;  4FXK B;  4LKS A;  2C6S A;  4PLO A;  4C8D A;  1W6N A;  2A6Y A;  2PFW A;  4OUS A;  4YVS B;  2OXB A;  2ADD A;  4CDX B;  4FOQ A;  3LFM A;  1UY3 A;  4RL7 A;  2WQ4 A;  4DS0 A;  3VDD C;  3ZXL A;  2A6X A;  2VUJ A;  1CAW A;  1GOF A;  1WLC A;  2HEY F;  2DYC A;  3EHK A;  1UCX A;  3RJ2 X;  1RVF 2;  5L9B A;  1J3Q A;  3SNM A;  1TEI A;  1Y4W A;  2UWA A;  4HAN A;  1RUD 3;  4MGI E;  4Q4V 3;  2LW8 A;  2WKK A;  2DCJ A;  5CIS A;  1CAU B;  3KV6 A;  4LOS A;  2W9X A;  4J6G A;  1F2N A;  4QX2 A;  1POV 0;  4H14 A;  5BV6 A;  5BY5 A;  5T55 A;  3LIH A;  5I93 A;  4QPG A;  1OSG A;  3TN9 1;  3BPS A;  4AL9 A;  4P5H A;  3V0B B;  4BME A;  2NPI A;  1YLL A;  3J8F 3;  3OEA A;  4FO9 A;  2P3K A;  4MXW A;  2AEY A;  3OBZ A;  3JXS A;  5HV4 A;  5DDJ 2;  3ZM8 A;  4NHM A;  1RIN A;  2RR1 3;  5AFE A;  2C24 A;  3T0B A;  2GP3 A;  4E4D X;  4IE7 A;  2QQP A;  3WT3 A;  3E1F 1;  5A7N A;  3NRU A;  2XJV A;  4FP2 A;  3U10 A;  4C1W A;  1MEC 1;  2PLV 2;  4CDX A;  3ABZ A;  3N9O A;  4QX0 A;  4RHV 1;  1NE4 A;  1RMU 2;  4Z07 A;  1QXJ A;  4A6O A;  5IVF A;  5JZG C;  2VBD A;  2LTN A;  1AL2 3;  3MO4 A;  1W99 A;  2W68 A;  5DUW A;  5E1R A;  3VZO A;  4D3W A;  3AMP A;  3OY8 A;  2RS3 1;  5LBB A;  3TEY A;  2IXH A;  2PHW A;  1ST8 A;  2X8K A;  1NCQ C;  3ON7 A;  4X6Q B;  4YG6 A;  4PF1 A;  4TXW A;  3AJY A;  5CAZ A;  1SCR A;  2WYF A;  1ASJ 3;  3IAQ A;  4JV4 A;  1G8W A;  1MZE A;  3N3H A;  4IEY A;  1CQ9 A;  5FMO L;  4DIQ A;  4L9B A;  3FWE A;  5KHI A;  5C4W B;  3NNG A;  3HIF A;  2D6P A;  5F2S A;  1UD1 A;  4MZU A;  2QBX A;  4KU7 A;  2ZGT A;  4XJZ A;  3ZFF C;  5C8W A;  4ATF A;  3D6E A;  4ZY9 A;  5GJ6 A;  3PHM A;  4D7S A;  1RED A;  2VW0 A;  4IEQ A;  2PHL A;  5FPB A;  1ACC A;  3T30 A;  4QKD A;  3ZPO A;  4HVR A;  2ET1 A;  1ENR A;  4N53 A;  4YW5 A;  4MHR A;  2RMU 3;  3ENR A;  3EO6 A;  4IGO A;  3RZL A;  1EPW A;  4Y22 B;  1URX A;  3S57 A;  1LU1 A;  4JDN A;  2FMY A;  5K4L A;  1W8N A;  2WFP A;  4O9G A;  4B1L A;  1C8M 1;  3NJZ A;  3VD5 A;  3ZFG C;  5CYY A;  4AVS A;  1DZR A;  1ODM A;  1WCS A;  2JG9 B;  4YGB A;  1K5M C;  1ZRC A;  2HWE 2;  4A4A A;  5HCH A;  5A7P A;  5IVJ A;  1YUD A;  5AFB A;  1CZS A;  4DQA A;  1AHS A;  1LJ7 A;  2VD7 A;  5C4W A;  3IKW A;  3VZM A;  2PHX A;  4GKY A;  4WVM B;  2LAL A;  5DZF A;  3ST7 A;  1QJX 3;  2UU8 A;  1RYY A;  1M06 G;  1OQ1 A;  4SBV A;  1J1L A;  3JD7 2;  2VU9 A;  2JE7 A;  3PTR B;  5DZE A;  1SFN A;  5B2G B;  2DFB A;  3NJV A;  3P3N A;  3SEP A;  3WF2 A;  1NLQ A;  2P3J A;  1EUU A;  1RUC 2;  3NJX A;  2OPK A;  4FFH A;  3RZK A;  1COV 2;  1VBE 1;  2BOJ A;  3HN1 A;  1PGW 1;  1KS4 A;  1UOF A;  4NIG A;  3K51 A;  1GZW A;  1CPM A;  1RJ8 A;  5A3T A;  4XJ9 A;  3ZKY A;  1MZF A;  1NQJ A;  1W9F A;  3MPB A;  4XE9 A;  4HG6 B;  2PA7 A;  4WV8 A;  4XVH A;  1GNH A;  4GUL A;  5EWS A;  2R04 2;  2VZP A;  1NG0 A;  2JG9 A;  5HCA A;  1AL0 G;  3LOI A;  4P9G A;  4QB6 A;  1WZX A;  2IXI A;  2RM2 3;  5F5C A;  3WW2 A;  4ZS2 A;  3W9A A;  4WM7 C;  4ZU5 A;  4A44 A;  4YFZ A;  5JVV A;  1AYN 1;  1QH7 A;  2W2I A;  4KWL A;  5DAX A;  5FMC A;  1WD4 A;  3A21 A;  4COU A;  4AFC A;  2QDN A;  4CUB A;  2J1S A;  2J1A A;  5CZK A;  2VEC A;  4JRL A;  4BYY A;  3RG0 A;  4F8A A;  3NAP A;  3LGR A;  4AEJ A;  4FPL A;  1JZ2 A;  2UYA A;  1FMD 2;  4NPM A;  1J84 A;  2IC1 A;  3MF9 A;  4IEU A;  2VNG A;  4OHX A;  4RS5 C;  1JZ3 A;  3IWZ A;  1IG0 A;  4QB1 A;  2BNO A;  3RYR A;  2W92 A;  4XAA A;  3THC A;  3VBR C;  5FFO C;  3AKT A;  3B5L B;  5E8A A;  3VL8 A;  3ZXE A;  3RZJ A;  4Q4W 1;  2XDV A;  3VBH B;  5LRR A;  2WS9 3;  1NLR A;  1IZ3 A;  1AR9 2;  4JKK A;  2ZEW A;  1XNK A;  4A3X A;  3AMQ A;  2ARX A;  4MV2 A;  1ND2 C;  2P37 A;  4CCM A;  1QOS A;  1V6O A;  3C7O A;  1VPH A;  3THD A;  2XKO A;  5L36 A;  4AFD A;  4U2A A;  5I0R A;  4CDQ C;  3IT8 A;  3I7D A;  5T5J A;  1LR5 A;  3A4U A;  2JD4 A;  1SAC A;  2DTW A;  5EJ3 A;  1VB2 A;  2DVF A;  4Y20 B;  4L11 A;  1IQD C;  1S2E A;  3MFA A;  5FP7 A;  1QJZ A;  1LEN A;  1RXF A;  3QH7 A;  4YM0 A;  1FV2 A;  1H2K A;  1Q8P A;  2A3X A;  2ZHM A;  4AR2 A;  5JXH A;  4QQP A;  1G9F A;  2ZAC A;  3DUI A;  4N43 C;  4C0B A;  5FLH A;  4I09 A;  3VZN A;  4BQ4 A;  2XKP A;  3AB0 A;  2ET7 A;  2NMN A;  5FZA A;  3O1T A;  1ULP A;  3VBH A;  4FI9 A;  5KXB A;  2YHJ A;  3BIE A;  2E31 A;  2VMH A;  4YGC A;  3WP6 A;  3IZO A;  1PX4 A;  2BEO A;  1OI6 A;  1O91 A;  1Z0H A;  1W8H A;  1PNG A;  3NMB A;  2P2K A;  5CFD B;  3BU7 A;  2G9G A;  3S7E A;  2D6N A;  1GAN A;  3BPZ A;  1MQT C;  3CJI B;  4QD2 A;  4KG8 A;  2ZX1 A;  2DUR A;  1RUG 2;  2Y33 A;  3AL6 A;  5H9R A;  3L2H A;  2PHT A;  3MIH A;  5FMB A;  3VD7 A;  5ACA 1;  3OPT A;  1QY4 A;  2QQJ A;  1W9W A;  4CEY C;  1J3P A;  5C33 A;  1UZV A;  2HWB 2;  3MIB A;  3LFI A;  3W21 A;  5LK7 B;  1R08 2;  1UKG A;  3Q8B A;  2WSV A;  1L7L A;  3WDT A;  1BBT 3;  3ITQ A;  1ENS A;  5JCT A;  2E33 A;  3PL0 A;  3ZYI B;  2W95 A;  1QXP A;  1S4C A;  2XJQ A;  3JCI A;  2F6B A;  4XJA A;  5C8C C;  1E5H A;  3ZYR A;  2JIC A;  2WLP A;  1R09 1;  2WZR 1;  2LRP A;  4A41 A;  4BQX A;  2P5B A;  4RYD A;  1US2 A;  1AYM 2;  2DF7 A;  1RJ7 A;  2VMG A;  4GQ7 A;  5IVY A;  1JOD A;  3DPR C;  4PIY A;  4IQP A;  4AG4 A;  4ZU7 A;  1V00 A;  4QT6 A;  4HPK A;  2Q1M A;  2E7Q A;  2VVE A;  5A3W A;  4BLI A;  1G86 A;  2HWD 3;  2XXZ A;  3WHU A;  5EQU A;  3NV4 A;  1GWM A;  5CFD A;  1OUR A;  1ZBA 2;  2BW8 A;  1W8T A;  3G7D A;  5T5P A;  4Z82 A;  5SV8 A;  4HKO A;  3IDB B;  4EZ4 A;  1N1T A;  2OZ6 A;  4NRQ A;  3ZSL A;  1UMZ A;  1UYP A;  3AP7 A;  4JTO A;  4LOT A;  3H1Y A;  2ZAH A;  3KT7 A;  4NE9 A;  3AK0 A;  1NYW A;  1QQP 2;  2XVL A;  4YM3 A;  4R9B A;  4XFH A;  1H6Y A;  1DZQ A;  1W2O A;  1YQ2 A;  1RHI 3;  2P6C A;  4Q4Y 1;  5A6X A;  1UY1 A;  4OCT A;  4RR3 C;  1K42 A;  4HN1 A;  1UX7 A;  4A45 A;  3I59 A;  4XMA A;  1HXS 1;  1V6I A;  5HI0 A;  1LTE A;  4M3C B;  5F1R A;  5F9T A;  3AYC A;  3JBG 1;  4ORF A;  3WR0 A;  1G9D A;  1N1S A;  3K4Z A;  5A3O A;  5LW9 A;  1JN2 P;  3DKQ A;  3KCC A;  4IUG A;  4DOU A;  2ZMN A;  4QPG C;  2RS5 1;  1YYN A;  3H8R A;  1JYX A;  4UI9 L;  3FLP A;  5F5A A;  2XBO 3;  2IXL A;  3O14 A;  4B7K A;  4GB3 3;  4HVO A;  1GSL A;  2YRO A;  2MEV 2;  2D6L X;  4NOT A;  1ZZ7 A;  1QXR A;  1CON A;  4XUO A;  4X8P A;  3POW A;  3GHN A;  3DV8 A;  2CSG A;  4XQD A;  1R1A 2;  1XB9 A;  3HBK A;  3DN7 A;  3P3P A;  4MGS A;  3ZXJ A;  2Q4S A;  4COZ A;  4XXP A;  4CDX C;  1RUF 2;  5CG9 A;  2D5H A;  4D6R A;  2CYF A;  4S2F A;  3LIG A;  1AR8 1;  2ZA9 A;  2VW1 A;  4TZD A;  4X8N A;  3OEB A;  5GLU A;  3ZFE B;  4CZS A;  1DYO A;  5DAP A;  4DZG A;  4D6Q A;  2VH9 A;  2YV8 A;  1S0B A;  2CDO A;  3C7F A;  3EMR A;  4M3C A;  4Z92 B;  2P3Y A;  4UFM A;  4MXV A;  1C1L A;  3DEC A;  2ATF A;  1CAV B;  4DXR A;  2OII A;  1RIT A;  1W0P A;  4LO4 B;  4AQT A;  1YWK A;  1W6Q B;  3HQX A;  1UMI A;  4OUE A;  4XUQ A;  1WW7 A;  3GJA A;  4YRD A;  1XE7 A;  2CWM A;  3ACI A;  3O1P A;  1NZI A;  1DLC A;  3KGL A;  5LRS A;  3T0D A;  2I45 A;  2C0Z A;  4WZF A;  4NII A;  1ZRE A;  3I2D A;  3U0Z A;  5DPN A;  1HRI 3;  5IAT A;  3O0X A;  2F17 A;  3BU0 A;  1IPS A;  1PO2 1;  2IXC A;  5I8T A;  1OBN A;  4W6W A;  5JXJ A;  1NCR B;  1O3S A;  2ID4 A;  1UPS A;  4IV3 B;  4OMC A;  3DYP A;  1LU2 A;  1V6K A;  4Q0P A;  3JB4 C;  3PU3 A;  4N53 C;  2VUL A;  3WHT A;  5J96 B;  3BTY A;  1GWL A;  1QOT A;  2VTX A;  2RDN A;  1C5I A;  2E6V A;  2HWC 1;  3D8C A;  3O0V A;  4XZP A;  1IPK A;  2X10 A;  1JHJ A;  1VBC 1;  1YHF A;  1UY0 A;  4R4Z A;  2YU1 A;  4MGZ E;  4XJ8 A;  1AR7 3;  5CFC B;  4D8M A;  5JXG A;  1QIQ A;  3O0W A;  3ZN4 A;  4I0B A;  4CCN A;  1J3R A;  1EYB A;  1OLR A;  1QNW A;  2JEN A;  2VZQ A;  5EXO A;  5F2W A;  4A7Y A;  4CP2 A;  3RNS A;  5FXW A;  1FXZ A;  3WDY A;  4ARY A;  4R8H A;  2J1R A;  4XQ4 A;  4BIS A;  4MG2 A;  4XCB A;  5K0U B;  4XOG A;  4Q4V 2;  1RUD 2;  5D1I A;  1ZNP A;  3WVJ A;  2OUH A;  3ELN A;  5GZC A;  2QQW A;  2CU5 A;  3AP5 A;  1X50 A;  3MFC A;  3O1S A;  1NCR A;  3IPV B;  1UPI A;  4IGP A;  4XEZ A;  4AGV A;  4IV3 A;  2RS1 1;  1U5Z A;  2VME A;  3D82 A;  5IVB A;  4R52 A;  1S0E A;  3BVC A;  2ORZ A;  3J8F 2;  2XVG A;  4J25 A;  2CL2 A;  4W4Z A;  5DUX A;  4AHZ A;  4KG0 A;  2XJS A;  4DEQ A;  1WW5 A;  2RR1 2;  2QTW B;  3QAC A;  1C28 A;  5J37 A;  2W08 A;  1UMH A;  2JG9 C;  4BQ1 A;  5J7M A;  3BTZ A;  4MSV A;  3ZOI A;  5I0S A;  3AKQ A;  4B8E A;  1XE8 A;  3SEE A;  4DIN B;  4DY3 A;  5A3U A;  5C3R A;  1J59 A;  4GMP 1;  4IE5 A;  3ZR6 A;  3BOW A;  2XUE A;  4P9Y A;  1HB3 A;  1AL2 2;  5H9Q A;  3KCX A;  3K4D A;  3WG3 A;  2A1X A;  2VCB A;  4JGY B;  2GNT A;  2V72 A;  3TWI A;  4CVU A;  1B35 A;  3H9A A;  3NAP C;  2C26 A;  5C3Q A;  4KGQ A;  2GH2 A;  3RRD A;  4NMI A;  1ASJ 2;  2ZGP A;  4KBZ A;  1QJU 1;  1D0H A;  2WFF 1;  2YBP A;  1YCI A;  4IW3 A;  5T3N A;  1SLA A;  4GKX A;  1MEC 3;  5A7Q A;  4CSW A;  3B01 A;  3K4A A;  4IE6 A;  1VLN A;  2V5D A;  4IEW A;  3LDK A;  1W0O A;  2VZ3 A;  2FDI A;  2JG8 A;  5BPX A;  4WVZ A;  3THP A;  2GC1 A;  1VBB 3;  1XRU A;  2JJ6 A;  2X5I B;  2FZ2 A;  2ARA A;  5GLZ A;  4NR1 A;  3W20 A;  1RC6 A;  4I3G A;  2RMU 2;  3NNL A;  4CXX A;  4LUL A;  1LOA A;  3H1W A;  1DZT A;  4EE2 A;  5FPV A;  4RSU A;  1SQ4 A;  1HX6 A;  2VNO A;  5LAS A;  2RDQ A;  3EXU A;  2EXH A;  4A7K A;  1KDM A;  1UZ0 A;  1KD7 A;  1RL3 A;  1CWP A;  3S6P A;  4YW4 A;  3MPP G;  4GA9 A;  5FZM A;  4PDW C;  4FP3 A; 
#chains in the Genus database with same CATH homology
 3BU0 A;  3I49 A;  4O7X A;  4MGT A;  3BTY A;  3T4H B;  4JHT A;  4CXW A;  2FDK A;  3T4V A;  3RZH A;  2FDG A;  2FD8 A;  4CXY A;  3I3M A;  2FDJ A;  3RZK A;  3BI3 A;  4MG2 A;  4NIG A;  3I3Q A;  5DAB A;  3O1S A;  4IE4 A;  3LFM A;  2IUW A;  4NRQ A;  4NRO A;  4IDZ A;  4ZS2 A;  3S5A A;  3I2O A;  2FDF A;  4OCT A;  3O1U A;  4NJ4 A;  3BTZ A;  2FDH A;  3O1V A;  4IE0 A;  3O1O A;  4IE5 A;  3RZG A;  4ZHN A;  4QKB A;  3RZM A;  4NPM A;  4NRM A;  3BTX A;  3T3Y A;  4IE7 A;  4NPL A;  3H8R A;  3RZJ A;  3KHC A;  3O1R A;  4QHO A;  4IE6 A;  4ZS3 A;  2FDI A;  4RFR B;  4QKN A;  4NIH A;  3O1M A;  3BKZ A;  4NID A;  4QKF A;  4CXX A;  3H8O A;  3KHB A;  3O1T A;  3BIE A;  3O1P A;  4O61 A;  4QKD A;  4NRP A;  3BUC A;  4NII A;  5F8P A;  3S57 A;  3RZL A;  3H8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...