4NIGA

Crystal structure of alkb d135i/e136h mutant protein with cofactors bound to dsdna containing m6a/a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKIHPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nigA00
3BTYA 4CXYA 3KHCA 3H8XA 3I2OA 4ZS3A 4IE0A 4NIIA 3LFMA 4QKNA 4NIGA 2FDHA 3O1OA 3O1UA 2FDFA 2FD8A 3RZMA 3H8RA 3T4VA 2FDJA 4NRMA 3BTXA 4ZS2A 3O1PA 3I3QA 2FDIA 4NPMA 2FDKA 3S57A 4IE4A 4ZHNA 3I49A 4O7XA 4NRQA 3BIEA 4NROA 4IE6A 3T3YA 3BU0A 3S5AA 4QKDA 3BKZA 3I3MA 4IE5A 3O1RA 4IE7A 4MG2A 4O61A 4MGTA 4NPLA 4QKBA 3RZJA 4RFRB 5DABA 3O1TA 2FDGA 4NRPA 3RZKA 3T4HB 4QKFA 3RZHA 3RZGA 4NJ4A 3KHBA 4CXXA 4NIHA 3O1MA 3BUCA 4NIDA 3O1VA 2IUWA 3BI3A 3RZLA 4IDZA 4CXWA 3O1SA 4OCTA 3BTZA 4QHOA 3H8OA 5F8PA 4JHTA
chains in the Genus database with same CATH superfamily
3GZAA 4NHKA 4UF0A 2OYZA 4E8CA 3LOIA 2YGLA 3ZMNA 5KHGA 3OBRA 2XPJA 4BDVB 2PAEA 1VBE3 3OB8A 4LLOA 1O3QA 1LGNA 4J25A 3JU9A 1QJZA 1UF2C 1QDOA 5GLVA 3E6CC 1YFUA 2KM2A 1V6JA 2AZ5A 1KDMA 3WW4A 5FPXA 5I8YA 1D0GA 4Q29A 5I0UA 3ZFGB 5JPNB 2NP0A 1FMD1 1GMMA 2BU9A 3O1OA 1JI6A 2QZ3A 2XJPA 3LZZA 1ALYA 4TWTA 1FOD1 4Y4RA 1AZDA 2VCMA 1HJGA 1UNBA 4XJ9A 4FP2A 3VZOA 4XF0A 1XQNA 1DCSA 2VOWA 1QMJA 2W94A 3BALA 4NHXA 2RJLA 3VKNA 4X8PA 2DDUA 3PIJA 1GOFA 1LOFA 1NLQA 1W6QB 5F2WA 5T54A 3IDAA 4F8AA 4COZA 5A7WB 1F31A 2QFEA 4Q4W1 1QKQA 2ZX4A 2F4LA 3UETA 5FYYA 4XZUG 1PNGA 2OVUA 2JDNA 5F5IA 3LFIA 3VN4A 4NRQA 5H9QA 2A71A 5C3SA 2W9XA 2YV8A 3LA2A 3B94A 1C8M3 4MXWB 3AFGA 2E63A 3ZXKA 1U5ZA 4D7YA 1MZ5A 3OUJA 1BBT2 2WO3A 1YIFA 4JHZA 3J8F1 1E5IA 2Q8DA 1YQ2A 1OLMA 1S55A 3RZJA 1X33A 3PMSA 1KJLA 2DU0A 2RS52 2O8QA 1HW5A 1W3XA 1KFXL 2OW4A 5GLUA 4Y5Z0 3U78A 1J84A 1JH5A 4BZ4A 2WABA 4DY5A 3ZYBA 3LPGA 4QX0A 5DZEA 4RN5A 3SCHA 3J7LA 1QJU1 3MIGA 1FX5A 1GYKA 1SLCA 3ZXAC 1H6XA 2VNOA 1SFPA 2WO1A 3SLIA 3S7IA 3OEAA 4ET7A 5LA0A 4EZHA 1BEV1 3UGHA 3LOBA 3O0WA 1G9BA 5B4NA 4JQTA 3NAPC 2OQ6A 5FQ0B 1W8HA 2BNOA 3IM0A 3ZDSA 3RNSA 1ZREA 2MEV1 2QQVA 3ZN5A 2HWE3 3R4UA 3GXUA 1PO13 1B35B 1VBB1 3GBGA 3PJQA 4CU8A 1DGLA 3CO2A 1J3PA 4Q0QA 4ZY9A 1ZNPA 4CCJA 5FPVA 5A7SA 1NCRB 5BYNA 1HQNA 3RZLA 1RUD3 2W95A 5FZ0A 2XJUA 1HQLA 2P6CA 2VTXJ 3B9IA 2C4XA 3M2MA 3VDAA 4ISRA 3WV6A 2WSUA 4AEJA 4Y1XA 5A3PA 5BNPA 2YB7A 1R1A1 4MGQA 5FMCA 2WFF2 1ASJ1 3NKGA 4QPGB 4RA0A 3TB0A 1F9KA 4AVTA 4JDOA 3K46A 1G86A 2PN5A 4P02B 1QXRA 1FV2A 4A3ZA 5CFDB 1I6XA 5KHIA 3W5NA 2AREA 4B4QA 5JIUA 1GP5A 2G19A 3MYXA 3ECQA 2YROA 3RWKX 1VMJA 2IZWA 3JB8A 1DDLA 1XNCA 2RM22 3I2JA 4HG6B 1GZWA 4UFHA 4B7EA 4XMAA 1N3OA 1UYYA 1N1VA 2XKOA 5DXDA 1WW7A 1X82A 3O1UA 4IV1B 3NV2A 2XMLA 2JB8A 5B4XA 3ZSKA 1UAIA 3POGA 2BGOA 3EJKA 3GYDA 3INAA 1W2NA 2R073 3FWEA 3IDBB 2R32A 3D3AA 1S0FA 5FWEA 3T4VA 4INDA 5FZ9A 4IGQA 2CV6A 2XJRA 4AXOA 3I97A 2ZZJA 2CDPA 3BGAA 1VRH3 4QX8A 1T6BX 2RS13 2WNUC 2R063 4W6WA 4CDQA 3PMEA 4Y1VA 1C1FA 2XQRA 2VXRA 3LIHA 3N35A 1X9TA 3M7AA 1ULFA 3N7LA 1Q8OA 3WQBA 2A3WA 2CGOA 3WW3A 3U07A 2ZGKA 2N7GA 2QQWA 4D3WA 4SLIA 4QDRA 1KFUL 5L7OC 3LEKA 1OSGA 3HPNA 3S7EA 1AR61 2VZPA 3WDXA 5A33B 1XNKA 3POSA 3IB3A 1SDDB 1H4GA 1XNTA 5BY5A 2ZZQA 3WDTA 5FO9B 3HVDA 2FD8A 5IAVA 2W68A 1V6LA 3MI8A 3C7HA 1DLCA 4JGZB 4CCCA 2VMIA 1C4RA 4AL9A 3VHOA 4CP1A 1VBE2 1MS4A 1SG3A 1YQ6A 2J1SA 4HKLA 2BDRA 3V0BA 4RD7A 4Q8LA 4K3UA 1PK6A 4LE4A 2CWSA 2NYYA 4XF9A 3U11A 1TME3 2O1QA 1Q8SA 3WG1A 5CNAA 2C6SA 3IN9A 1UY2A 1JZ6A 4OHXA 4IV3B 4S2FA 1K3IA 2JG9C 2IVIB 4FCAA 2QQNA 3ABZA 4CP0A 3DGTA 1W8NA 4LTAA 3PIGA 4CU6A 5HV4A 2WNUA 1ZBA1 1D7PM 3VL9A 4YZ4A 1SLIA 1PNFA 1UU4A 3J4UH 4KGQA 3THTA 4GAZA 4YW1A 5K9YA 3G7DA 3E97A 3ILFA 5JR7B 5FP7A 5LA1A 3BI3A 4UOJA 1XSRA 2X53S 3PUHA 1GU3A 5FOJB 1SLTA 4LPLA 3SQOA 3SCFA 2IC1A 2RHPA 1YHFA 3VBRC 5J3UA 4CDUB 5F3GA 5F5QA 5IJRA 3LF7A 2ADEA 4JHTA 1QHDA 2VMFA 2RS51 5K7PA 1AR91 4BLJA 4TSVA 4Y22B 1AX1A 1GUIA 3RSJA 3ZYHA 3AKRA 3RG0A 3ELNA 1QNYA 2HYXA 4E9KA 2C1FA 1CPMA 3WP4A 1C8M2 2PQQA 4NVPA 4BYYA 1RIRA 3SITA 4BQ5A 4GD4A 2WS91 3ACHA 3MW2A 2R041 5GALA 3Q8CA 2JEMA 5LATA 2AR6A 2RDNA 2PHDA 5ACA1 2ET1A 4FPYA 1CX1A 1POV0 2YU2A 3PU3A 1EV13 1HB1A 1L7QA 1VBC3 3O5SA 4MUVA 3GNEA 2XJTA 2GH2A 3LE0A 1G9AA 2YU1A 1C3HA 5DAXA 2Y38A 1D4M3 1YRZA 2OIIA 3A21A 2R0FA 4TLGA 2DVFA 2P37A 2ZX1A 4MGSA 5LY1A 4FTSA 1H2LA 1NOVA 3OGJA 2GNMA 3WNMA 2VAUA 1LGCA 3QACA 4OMCA 1S2BA 4U2AA 4P5YA 3LSEA 2I07B 5KXBA 5DAWA 4FOWA 4MXWA 1CAUA 2TBVA 1TMF1 1Z0HA 1OPMA 4OUSA 3WEZA 2WZR1 4HN0A 1JODA 5JLVA 3NQHA 1FATA 4D7TA 1AYN3 5JPMB 4JV4A 2A6YA 1UO9A 1ULEA 2HEVF 3AJZA 3RFRA 1UOFA 3MIFA 1LEMA 2VR4A 1UL9A 2ZGSA 3ZIXA 2DUOA 3M3IA 1LR5A 1RGSA 2HWE2 2V09A 4QT6A 2VXJA 1GWKA 4XC9A 1DG6A 4AI8A 4IERA 4PJYA 3WDYA 1JZ7A 3PURA 2E33A 4I01A 2YBPA 1FPN2 5FZLA 3ZFEB 4XJWA 1AVBA 1NZCA 4CCKA 3RZMA 2VQ0A 3ZFFC 2VQAA 3WF3A 1NY72 1P8JA 1RUJ3 1RUD2 4I0BA 3VBHC 3S5AA 2Z2SB 4FFFA 3O1RA 2GMEA 5EJZB 2VM9A 1VBA2 3R0RA 1G9FA 2JDHA 4XDPA 3J7HA 5DDJ2 1Z78A 1E5HA 3T2TA 5BNOC 4Y4YA 2Y26A 4PI0A 5FQ0A 4XJUA 5A3LA 2RR11 3AMPA 3LQCA 2WDBA 2A73B 5HCHA 1W6OB 1MZ6A 4BB3A 4A42A 4BWOA 1TEIA 5C8CB 2HH9A 1NCRA 4QGLA 4AFBA 2WQZC 5LA9A 2VBDA 5J1XA 1X9PA 1AXZA 4RQPB 4OZOA 4J6GA 2ZGRA 5DMYA 1IS4A 2NLRA 1UZVA 5CIRA 2EAAA 4H2AA 4AF9A 1JZ4A 4B4RA 4FT8A 4UFKA 4R9DA 1RVF3 2PMWB 2R072 1Y3TA 3AKQA 2XXZA 1AXKA 3EYPA 1KXGA 1WD4A 2HWF3 3NVCA 1MQTC 4N43B 4XVHA 3O1SA 3OBZA 2JE7A 3K3OA 2RS12 4QHOA 3WT3A 1R64A 2LTNA 4BIFA 4QPIC 4YM1A 3TYJA 1HJFA 4ASKA 2JDYA 1AYM1 3KSCA 4COVA 3NV3A 1EP0A 1OF4A 4LBQB 5A7PA 4A3XA 1SACA 5KXDA 4IV1A 4TXWA 4XW3A 2C5DA 3VZKA 3I2OA 4XFBA 2VW1A 1CIYA 1XSQA 1RHI3 1BMV2 2RJ2A 4QX1A 1REDA 3WQ7A 5EWSA 2JD4A 2B7YA 5FP3A 1GZ9A 2WWJA 1REEA 3L2HA 2WZEA 5FYBA 1SCSA 4QM8A 1PVXA 3MFCA 1RUF2 1WLCA 4Q4Y3 4A7ZA 1U12A 4BA6A 1XYNA 1NUKA 3JD72 2RV9A 5IVBA 2OX0A 2JKBA 3UYJA 1OI6A 3D0SA 5CISA 1D4VB 1WCUA 1OT5A 3DV8A 3PNAA 5GLZA 1WBFA 3CLPA 1H6YA 2PA7A 2XKPA 1PMHX 2KXLA 4V2WA 2E32A 3VHNA 4D7SA 5HV0A 1RUOA 1A3KA 1YQCA 2X5IB 3VDDC 2WINB 1UN1A 1HRV3 4N53C 4XJ8A 5FIXA 3WNLA 3LEIA 3WG4A 4FPFA 2W47A 4GJYA 3VDBA 5EFUA 2FDKA 1SHWB 4DIQA 1K42A 2DURA 3GBFA 4AQTA 2VGDA 2E51A 2VOXA 3DPRB 4YVSC 4OYUA 3O12A 3U37A 2WJSA 3GALA 2NPIA 3V64A 1QJEA 1MPXA 4XF1A 1O6UA 3IMMA 2WYFA 1DIWA 2YDEA 3WUDA 1ODMA 2ZEXA 2BV4A 3BU0A 3OD0A 1DGRN 1IPKA 4GH4B 4KU8A 5A3OA 3UL2A 3VD7A 1WMFA 4V1PA 4LHSA 1WCSA 1WMXA 3AL5A 3A7QA 4DRRA 4O61A 4W65A 3KCXA 4IV3A 4TYSA 2WO7A 3PTYA 2OKXA 3MF6A 3RJRA 2AENA 1W04A 4KI5M 3VBUB 1EPWA 4PDWC 4COUA 3BYWA 3R4SA 1QJX2 5ANNA 5FZKA 4AVCA 5C4WB 1JYIA 1LHOA 1ND3B 4QB2A 4M01A 3R05A 4XUPA 4P14A 1EUTA 5FYCA 2ZA9A 5A3NA 3AMNA 3O0XA 4H7LA 3U4SA 1J58A 4AI9A 3HBZA 2E7AA 5JZGB 1UZZA 1VB4A 1XNBA 2ZEWA 3M3QA 3UKNA 1RTVA 4A6SA 1PZ7A 2XONA 4AI1A 1W06A 2UWBA 3H8UA 1QJY1 4NIHA 1RL3A 3WQ1A 3LDKA 4CDUA 2GC0A 1Q8QA 4EYUA 2V5YA 2ZEYA 1BZWA 4IGPA 3SXWA 1YJKA 2ERFA 5DZFA 4YVWC 3BTAA 3VBSB 4MGZE 2Q1ZB 2J42A 2B5HA 3N9MA 1FPN1 4YVSA 1CAXB 4LIUA 2YC2A 4OZXA 5FAXA 4META 4XACA 1NY71 4MH0E 2BWCA 1HB3A 4CEYB 2XDVA 5ABJC 4E2SA 1LOCA 1UYZA 5FZ7A 5BPXA 1KS4A 3FHIB 4MGIE 1NXMA 3Q8AA 4L97A 1PZ8A 1VBA1 1A8MA 1V6MA 3KB5A 5DDJ1 5AVPA 3WP3A 5EYYA 1XU1A 2CAVA 2QUOA 3R4DB 1ULPA 3OTFA 3RYKA 3P1IA 1MS9A 1HQWA 1QEXA 2K9ZA 4DB5A 4EE2A 3GGLA 5CEHA 1G9DA 4IE0A 1F8VA 2ZAHA 1IQDC 4LR4A 2UY9A 5F32A 2CWMA 2YG0A 3FLRA 1RUJ2 2D98A 1W99A 2K0GA 2ZKLA 4AI2A 4C1WA 2KR2A 1Q56A 5CKNA 3I54A 2XGXA 3DXTA 4QXKA 2FDHA 1NCQC 3APBA 5FYHA 3T2PA 1DQ4A 4RS5B 1L7RA 4XFAA 5T50A 4FFHA 1MVEA 1NAEA 3RS6A 2BBAA 4N7UA 1ENRA 4C90A 2WLQA 4YRDA 4Z1VA 1W0NA 2Y6LA 3TN93 3M8LA 4OHWA 4XBLA 5IVYA 4JKKA 3H8RA 2R16A 4NHYA 5LK5A 2DFBA 1HXS3 4GWJA 4OLLA 2C9AA 5KR7A 1X36A 4P08A 3HJRA 1S0BA 4J1WA 1X50A 4YWAA 5EP9A 1OA2A 2VECA 4GJZA 1JUIA 5CFCB 1OQDA 3RYPA 4NPMA 1UZ0A 2JXAA 2VW2A 3LKJA 3WF4A 4HPKB 5ABJA 4MLOA 1QU0A 4QDSA 3FLTA 2A7AA 1ACCA 5LBFA 1SCRA 3DKWA 4IE4A 3N9NA 1IKQA 3OY8A 4P9LA 3KT4A 4QQPA 1OXCA 4FAGA 1A6CA 1PVC3 3ZR6A 1JYVA 2A75A 2DV9A 4JQRA 2HYKA 3VKMA 2UWAA 1QF3A 2DUQA 1TNRA 2HWF2 1KJRA 3MFAA 1NQJA 1UXZA 4DEVA 5IVVA 4IETA 1W6OA 2WA4A 4CTEA 4D6SA 5JI9A 3MZHA 1AL23 3ETQA 3VHRA 5IK5A 3AMHA 4MG2A 4I2OA 1RJ8A 1RUC3 1RUF1 5C8CA 5FRAA 4NPLA 4IEUA 3HR9A 2BWAA 5T55A 1SLAA 1OPOA 1V9U3 1Y9QA 1UD1A 2RMU3 2PHTA 3JD71 3T1MA 2ZHNA 4KMQA 4AI0A 2OZ6A 2VVEA 1CZSA 1POV3 2GH8A 4P9GA 2UURA 2V4VA 2VUAA 1PGSA 2DU1A 2D6PA 5ANQA 2Q8CA 4AGRA 4BU2A 1J3RA 3RQ0A 4Q26A 5CBLA 3HQXA 3I3DA 4CZSA 2UYBA 2EXKA 2VC9A 5GZDA 4AFMA 5HXMA 3VGIA 5DUUA 3DEMA 4XJZA 5CU1A 4Q27A 3U4XA 1XE7A 4JGYB 4N43A 1JBCA 3ZKUA 4CXXA 2Q0AA 1QH7A 4RL7A 3OUIA 3MPBA 1CAVA 5EZWA 1VBD1 3LPFA 1V6OA 4M3CF 5L9BA 3KV9A 3MLLA 3EBRA 4LBQA 1TVGA 2VNRA 4CCEA 1ULOA 1NT0A 1RUI2 2GZWA 3NAPB 2IUWA 2VOTA 3I8TA 2ZGPA 1HRV2 4QQHA 2D40A 2QVSB 5M0TA 5C3PA 4P00B 3SEEA 1LOEA 4FFGA 4UFIA 1GKBA 3E6BA 2B4KA 4Q4X2 4Z82A 1HIXA 2JG8B 2GNTA 2YUEA 5F3EA 5FZEA 3NSTA 2GNDA 1H2KA 1OLME 2J22A 1YI9A 2PLV3 3HN1A 3NJYA 3DN7A 5E16A 1BHGA 4P9WA 2P2KA 1QJX1 3FUOA 3AVSA 3K75B 2PAMA 2ZAAA 4LBLA 2V5DA 2P34A 4B7KA 3LIGA 4QX5A 3B02A 4CDXB 3DKQA 4WVMA 1SEFA 4HMZA 2A6VA 2DBNA 4EV0A 3FL7A 3AK0A 3ZX7A 1CJPA 4YGEA 4BMEA 4FP3A 2DVGA 1GSLA 1LOFC 4Y33A 2LS6A 2VE1A 3H50A 4KG8A 4Y5SA 3WD5A 5AFBA 1S2KA 3ZSEA 4HL0A 2QQKA 4NPRA 4C1XA 1GANA 1O5UA 1ENXA 1GP4A 2VOKA 1MS8A 3WF1A 5FO8B 1LOBA 2BW8A 1KD7A 4FPEA 1LOAA 4RHV2 3DPRA 4Q0PA 4BH9A 5A1AA 2Y0IA 2ARXA 2OPKA 3NKTA 4GB33 1UOGA 1KRIA 5AC91 1GICA 3WHTA 2BQPA 1S0EA 3H3UA 3N9QA 2PTMA 3FC0A 4HKWA 4ZU7A 1DF0A 3MW4A 3DYMA 3USUB 4AGGA 5FMBA 1C1LA 2D3PA 1H0BA 2D6NA 4C8DA 4CYDA 4CPBA 1AL0G 1FNYA 1H9PA 2QQLA 3GF6A 4P9IA 2W0XA 1OFNA 3BPSA 1N1YA 3FMGA 4ZHNA 4HOOA 3VBUA 1UZWA 4SBVA 1KGYA 5C4WA 4DY3A 4HXCA 1BVP1 5LWBA 5FKCA 3LSDA 1ZBE3 1IGOA 4UYBA 5GLWA 5FK8A 5D8AC 1XRUA 4FXKB 4CDWA 1ZX5A 3HNMA 1C5IA 4BQWA 1A8DA 4RSUA 3MDPA 2IVJA 2D7FA 1F2NA 2WRAA 2XOMA 4HN1A 5LASA 4CPBD 4W8JA 4AZZA 1VAVA 1ZM1A 5F1RA 3SHRA 1AR83 1S0IA 3HNYM 3P3NA 5FTTC 3T1LA 1C57A 5DABA 1HN0A 2P3IA 4AAPA 3AB0A 3KF5A 5GJ6A 1QDCA 1QH6A 2HBUA 4L0PA 4F7ZA 3WVJA 4KWJA 1Y43B 2ZX2A 1RMU3 1NE6A 3RZHA 2LUWA 1CAXA 1N47A 5FYZA 4XQDA 1VMHA 5G05L 5KC5A 4NMIA 4R4XA 1RUH1 1ZZ9A 4CEYA 2D97A 5BNPC 3NRUA 2IXJA 3J26N 4FPCA 4RR3C 3VB9A 5FZ1A 3W59A 1PGW2 4OI0A 2RDQA 1OKQA 2D93A 2B39A 3AZVA 5T5OA 2BOJA 3TN92 4A4AA 2ZHMA 1AUYA 2QDRA 4PF5A 1QNWA 5DG2A 1GQHA 5IWFA 1A34A 1XPWA 2ZHLA 3O7OA 3TEWA 1PIV1 3DYOA 4IDZA 3RI8A 3UK9A 2OUJA 3VUOA 3Q8BA 4Y1UA 5D8AA 2QQMA 2K2SA 4WM8B 3ZPYA 1YI7A 1YC61 4WM7A 1HKDA 4FFIA 3ZYFA 1VR3A 1SBFA 3S0MA 2QZ2A 2JWPA 2DFCA 5C5TA 4RS5A 3KHCA 4LA3A 1OQ1A 4WVWA 3PUIA 2P3KA 1PVC2 4ZXEA 2FHRA 3ZDVA 1QQP3 4J1XA 1W9WA 4E2GA 3IWZA 3JBG3 1TQ5A 5FWJA 4NWWA 1HV0A 3CJIC 1RUE1 2RS33 1AL22 3GHNA 4NIGA 1IS6A 1DZRA 2TUNA 1DGRA 2JX9A 4BQXA 4CDQC 4KGGA 1PO23 4LO7A 1U5IA 1AX2A 5A3WA 5CFCA 4OULA 4XIKA 4XXPA 5K8SA 3J9SA 5KBFA 2VNVA 2ORXA 1YIPA 2NZ9A 1EYBA 1GP6A 1Z7S3 4RR3A 1DLLA 3S30A 1OLQA 4B4PA 2P5BA 1YYNA 1RUI1 1JU3A 3FLPA 5A3TA 1JYXA 2WSVA 2X29A 3D8CA 3SKVA 2WNVB 1FXZA 2AGSA 1CX4A 4CCDA 5E88A 1APNA 4O9EA 1MZFA 1VIWB 4KL1A 4PIZA 3QCWA 1W6MB 4Q4X1 1M06G 1EPZA 1NA1C 4M4RA 5J36A 1DQ2A 4XFHA 2VMHA 4JDMA 1KQRA 5I0RA 2EXHA 2A3YA 2HWD3 2SLIA 4K40A 4BQ4A 4LXLA 2QBXA 4K8RB 1AX0A 3I4IA 3EMRA 1JW6A 1CGPA 5FY1A 5FREA 1FV3A 1Q43A 2I74A 4O7XA 4YGCA 3ATGA 4YZ2A 3LDRA 1XJAA 1LAJA 1PK6C 3MIHA 4EZ4A 3ETPA 3A0KA 4NAMA 4XFFA 4PLOA 4YLZA 4AFCA 5FPUA 4LBMA 2JDUA 4TZDA 2XVLA 4EN9B 3FFZA 3CJIA 3WR0A 2FBEA 3Q9OA 3ES1A 4NR1A 3VBHB 4CCNA 3TEXA 5KC6A 2B9UA 4XZPA 1MEC3 2J1AA 4ES9A 3OBTA 4XF3A 3TEZA 3VBFB 3N3HA 1YFWA 5C3QA 3KVAA 1UKRA 4RHV1 4NRPA 2WBKA 3AM2A 3RZKA 3C2UA 4LJHA 2XL7A 1WGPA 5LB6A 1UX6A 3IPVA 1E57A 1I5PA 1N1SA 3GZEA 3WF0A 4I0WB 1W8OA 2XVKA 2HEYF 2NMOA 2ZBJA 3CZUA 3J7NA 4A6OA 2H0BA 3FHAA 4PBPA 1WMDA 2YHJA 4L99A 5JR2A 2QQPA 4HONA 2BNNA 1U0AA 1COV3 2JG8A 4S2GA 1LTEA 4LKSA 1D2SA 1NA1A 3OYWB 5FYVA 4I09A 3ILNA 5I0DA 1O3TA 1UY3A 3ORJA 2B46X 1RXFA 1ZA4A 2LROA 1J59A 4XETA 5A7OA 3JXSA 1MS5A 1GV9A 3WHUA 4XQWA 1CWPA 4CXWA 1RUG3 1YCIA 4MYEA 3NWKA 4QHBA 4AR2A 1UMHA 1W3VA 3V0AB 4KBZA 2A6WA 5FPLA 4FQZA 2X09A 4LITA 2VW0A 2AEZA 1EAH3 3AMQA 1AJOA 3SH4A 1H2NA 3WQ0A 3D0JA 1RXGA 1S2EA 3N7JA 5JMCA 1F5FA 1UZYA 1X7NA 2Y6GA 1LESA 4QPIB 2ZX3A 4XXAA 3T09A 3GHMA 4CEWB 5FMOS 4DNYA 3H0OA 3H8XA 2WYSA 4GMP1 1ZBE2 4XABA 3D82A 3BIWE 4JDNA 4EWAA 5FY9A 1LB2A 2LW8A 3LB9A 1AJKA 1ZRRA 4QB1A 1W6PB 4OQ8A 4KNCA 4HVQA 5J98B 1AR82 1JXNA 3B69A 3VD3A 1BBT1 1DP0A 1LECA 1S0GA 4KBBA 1JYTA 1JYCA 2BTVC 2PHRA 1PGW1 2UY8A 3PVEA 4M3CB 3ZFGA 2E7TA 2XUEA 1VLNA 2QQIA 3FBYA 5JAXA 1XBFA 1R083 2AUYA 5FY8A 1W9TA 2JD9A 2DWRA 4FPHA 1FI2A 4XHBA 4N9HA 1RMU2 2ETEA 4OI4A 4QX2A 1UW8A 3POFA 3I3QA 4H3WA 3HOBA 5JOWA 4XUQA 3VBOB 4EWDA 1R093 3MLJA 5JSOA 4BE3A 5K4LA 4CE8A 5FZMA 5FZIA 1XE0A 5E6HA 2YYOA 4N53B 3S57A 5EV7A 4ZU5A 1CZVA 4P9JA 5FUIA 1NX9A 3MV01 3LA7A 1W6QA 1GQPA 2YPJA 3MLKA 5I8TA 5A7WA 4MSVA 3HWJA 5JUVA 1IPSA 2Y34A 4LHLA 1B35C 3PVOA 5T5JA 5LCWL 3MV11 4LO4B 4PLNA 1TNFA 1NCRC 5T5LA 2HWB3 4AVSA 5IHRA 3EHKA 4IEVA 1VALA 3T2OA 1IKPA 3WP5A 3BIEA 4I0AA 1PZ9A 3GJBA 1K5MB 3P3PA 5FY0A 2G9ZA 3WSOA 1NLSA 1ZZBA 4QPGC 4UAPA 4Y1YA 1TG7A 5DN2A 5K0UB 2WFF1 2VU9A 3QOPA 1W8UA 4AEDB 2VCAA 3AYDA 5IK7A 3W5MA 2PHUA 5CFDC 1AR73 2BFUL 4A45A 1PO12 2JECA 3TBDA 3NNLA 4W6XA 2IXHA 2D3SA 1WKYA 3W58A 5IT6A 3SCGA 1J1LA 5GM0A 2WZ8A 3RZZA 2BFUS 3HD8B 2EAKA 2Z4FA 4QX7A 1CONA 1PO22 3SISA 2W91A 2QTWB 2RM21 3IAPA 4K8FA 4WM8A 1ULDA 2P3JA 4AHWA 1H1AA 2PQSA 2YGMA 4IV1C 2W5FA 4Y26A 3OG2A 1DBNA 3ACIA 1Z7S2 3KVBA 3NW4A 4HT1T 3KV5A 5KHKA 2VQUA 3AXDA 4W4ZA 4Z92B 1H8VA 1FMD3 1CVNA 4GKXA 4YGBA 2DTYA 1J1TA 3JUUA 4R52A 1OOPB 4Y20B 1WUVA 1FOD3 4YVWB 3NNGA 4YW4A 1BK1A 1A78A 1B35A 2F4PA 2JE8A 3IMNA 3IZOA 2ZXQA 1MS1A 2E6VA 3POJA 4A2UA 3UESA 4AHZA 4FPKA 5JXJA 5H9SA 4AK3A 4QMAA 3CKHA 2D5FA 1W9YA 1SPPB 3H1YA 1QOSA 3HQUA 4FPGA 3BTYA 1M4WA 1KS5A 2JDZA 4IEOA 2VBBA 2VY0A 1UU5A 4KG0A 4LK6A 4COWA 5FV3A 4X6QB 1ZRDA 2XJSA 4IEWA 4ARXA 2GP3A 3E5XA 2WC2A 1ZVFA 2IXKA 4QPGA 1VAMA 1DFQA 3BPZA 3WP6A 2RDRA 5LEJA 1T2XA 3CF6E 3KCYA 4FOQA 4Q4W3 4PCRA 5CZKA 5F2SA 3T0AA 5C8WA 2VZ3A 4TTGA 5CFDA 2WNVA 3IKWA 4NAOA 1W2AX 2RJKA 4L8QA 5SV8A 2K46A 4N7IA 1RYYA 2G4IA 3B93A 3G6JB 4XEZA 4AWDA 4MV2A 3WF2A 1VRH2 1YXWA 2JE9A 5LZ6A 2LRPA 3I2DA 2YXSA 1MEC2 2R062 4L11A 3SEPA 2ZGQA 3Q8FA 3Q8EA 4DZGA 3OGSA 4M4PA 1H8TB 1VJ2A 4JGZC 3WW1A 3J8F3 2YC4A 2QQJA 4MX3A 4XILA 5FLHA 1QXJA 5LRSA 3A0NA 1VBE1 3E1F1 3WNPA 2A70A 5A7NA 4C0HA 1NKGA 4HSJA 2HWC3 3ZSJA 1VPHA 3KM5A 4KQ7A 1SMVA 2WO2A 3QH7A 4IV3C 1NXD1 2IXCA 3LAGA 1COV2 3JQXA 4QQLA 3AVRA 1E5SA 2ARBA 5JMOA 5C9AB 1JZ2A 3FN9A 1QJU3 2ZKNA 3AKTA 2DCTA 1LOGA 3IIAA 3SC7X 1N3PA 4HZFA 5CADA 4LUMA 3ILRA 3VZMA 4NN0A 2WZPP 3I3MA 1BEV3 2OA2A 2RVAA 3ZN4A 2Q1MA 4Q5OA 5A32B 1TME2 1CIWA 2MEV3 1O4YA 4ATFA 1LJ7A 3CHXA 4QKBA 4DQAA 1QXPA 2EICA 4EN7B 1EAH2 5JSPA 1VBB3 1XNDA 2W87A 5A33A 3WW2A 3ZYIB 4H55A 4E4ZA 2XWJB 1W03A 4CDUC 2EXIA 1SFYA 5J48A 2D3RA 2GALA 1SBEA 5CA6A 2FZ2A 3OYWA 3NMBA 2YBSA 3AZWA 2C0ZA 1BXHA 3I59B 2FQPA 4HVRA 1GQGA 1R1A3 4F3JA 1RMU1 2B8MA 4JGZA 4LULA 1ASJ3 3C7FA 2VZRA 4LKDA 4NOTA 2DCJA 5LEKA 1C8M1 1IOAA 1GZTA 4NJ4A 5L73A 3GM8A 1QY4A 3AZXA 2VMGA 1SDWA 5D2AA 4EROA 5BNNB 2J1RA 4RYDA 3P5BA 5AVAA 4CCOA 4CP2A 2C26A 2A6ZA 4DXRA 2WNEA 4ISQA 4Q4V3 1GNHA 2O14A 3ME2A 1R082 3EXUA 4GZ9A 3ZXJA 4WBBA 3LA3A 4NIDA 1JYNA 4CEWA 2BEOA 1ND2B 1UWWA 3ZYRA 5EJ3A 4BCUA 5F3CA 3MW3A 4JTNA 3W21A 4FAHA 5JVVA 2VOVA 1LRHA 5CB7A 3T2QA 4XF4A 1X8MA 2JJ6A 3T0BA 5JSRA 2A3XA 3LEGA 4BK5A 2IXIA 1LODA 4E27A 2ORZA 4QX3A 2ZGTA 4G3YC 2JICA 3AX4A 3FUQA 3OOXA 4JKLA 4YGDA 3WDUA 2NN8A 4D69A 3TEYA 4XBNA 3MUY1 1O7FA 1EV12 1L7LA 3K4DA 1VBC2 2GMMA 4KH9A 4A7YA 2WFPA 2C24A 3E6DA 5CKMA 4XUOA 4CRQA 1D4M2 4M3CA 2HWE1 4GWIA 3MEPA 3OPWA 1PO11 1YJLA 3NL1A 2CGPA 4L2NA 2JDPA 4Y22A 3DXUA 4YW2A 2OZJA 2HWB2 2ZACA 1WW4A 3B5LB 1UKGA 2WQ8A 2D6KA 5FYUA 3URFA 1WCKA 1RUD1 5FZOB 5B2GB 2VNGA 1OH4A 2J1TA 4JKMA 1JYWA 4UXAA 1AYN2 4UW3A 2ZGLA 1AR63 1GLHA 1ONAA 2BNMA 1Y9MA 1LU1A 2ES3A 2ZCWA 3OBAA 1Z7S1 1V00A 2VTXA 1LHNA 3WY6A 3MIBA 4AGVA 4XFGA 3RDIA 4XJAA 1JZ8A 1AR72 2DVBA 2PFWA 3KWVA 1AXYA 3ENRA 2YY1A 1LKNA 3RI9A 3PLQA 4Y3OA 2D6OX 3AYCA 1SBDA 2FDIA 3KGLA 4QQ2A 2PHXA 5C8CC 1UIJA 2BGPA 3ZXDA 1XYOA 1WBLA 2FZ1A 4RQPC 3WG3A 5EHDA 1DYKA 4CA9A 1UY4A 3KZ4C 4IEXA 1K5MA 4FBFA 3MUZ1 1UOBA 4NHLA 1W2OA 3DCQA 3N36A 5E89A 1LCLA 1FMD2 5K0UA 4QXCA 1OF3A 4IEYA 5BXXA 2XLFA 2R7EB 5DAPA 1FOD2 3H3LA 4IE5A 2R071 1ZBA3 4UT5A 3PUQA 2W46A 4N43C 3OGRA 1HV1A 4ATEA 3ZFEA 1YUDA 2QJVA 1VRH1 3VD5A 1UPSA 1YQ8A 5APAA 2RS11 5FYMA 2R061 1OBNA 2RDSA 3H3ZA 4IUGA 5KHJA 3THCA 1K5JA 5IUQA 2Y6HA 1MZEA 3W20A 2JDKA 3BOWA 4K7JA 5FCCA 1PM4A 5C71A 2XUMA 2XJQA 1H1MA 4QU1A 4Q4W2 1RVF2 4XBQA 2RS53 4OHVA 1AR93 5IFPA 1BMV1 4Y1ZA 2BBVA 2GC2A 4AHYA 1IZ3A 1OOPA 2D5HA 2OUHA 2IXLA 3K2OA 4Y20A 2VJXA 1J83A 2CGNA 2WAOA 3WNXA 1Q3EA 3RGBA 3K3NA 2BRTA 3NV4A 2A5ZA 1XE8A 2WS93 2R043 2CNAA 5FY5A 1STMA 1JN2P 5BNPB 5ACA3 5IFTA 1O8SA 3DECA 4RQPA 1WLTA 1N3QA 2A1XA 1H9WA 1XB9A 3I3BA 4MHRA 4YW5A 2WT2A 2UU8A 3H7JA 4Q2FA 5F39A 1CQ9A 1RHI2 1TME1 2HWC2 2XR4A 1FNZA 3OGGA 4HK8A 5JXIA 4CU9A 4OUEA 4XOGA 2ZGNA 3CNAA 4OMDA 1G8WA 2CTVA 4CXYA 4Q4Y2 2BP6A 1MVQA 1QJU2 2BJSA 1JUHA 2Q4SA 4RGKA 5DAQA 1PMJX 1W9FA 4P9XA 1RJ7A 4QHZA 1UYPA 5FZGA 5LY2A 1TMF3 3DPRC 1H30A 2WZR3 2WIIB 4YSFA 1H8TA 3ZOIA 3C7OA 1ZZCA 2W52A 5FP8A 4CUGA 2QQOA 3ALQA 5F37A 2BPA2 4COYA 1IS3A 1W2UA 4GH4C 5I93A 2Z5WA 1YLLA 3KF3A 3LGRA 1W28A 2L9LA 3VV1A 1IHMA 2XVGA 3FJSA 3KV6A 1DZTA 4AEMA 4YG0A 1WZXA 1VBB2 1ZRIA 3ES4A 4FI9A 2RG4A 3TAYA 1W8TA 4IW3A 4CUCA 3DYPA 5GLTA 3R6SA 4UFMA 2VUJA 1O59A 1UY1A 2ZGMA 3VBUC 2D6MA 5KWRA 5LBEA 3ZLIA 5C4WC 2TEPA 3HMYA 1ND3C 1JOPA 3GCXA 4HETA 5IATA 3PVBB 2QDNA 1R1A2 2AC1A 3HNBM 4LBQD 3UJQA 1LGBA 3JB4C 3D5OA 3UT0A 4CDWC 1QOTA 4YM3A 1S1AA 3M3CA 1VE0A 4E4HA 1PGL2 2G9GA 2ILMA 4XPVA 4Z8BA 4QDQA 2X5IA 2RR13 2WWUA 2W08A 3M70A 1EV11 4YZ3A 1DQ0A 1VBC1 3UV9A 4Q1RA 1S0JA 2W92A 1WW6A 2ZMKA 3OPZA 4Q4V2 4B3NA 5FLJA 1D4M1 4MVTA 5F5CA 4QQOA 1G9CA 3CIHA 2Q8OA 5FP9A 2DF7A 3VLBB 3VKFC 3OPTA 4AAXA 4AW7A 4MZUA 2HWB1 4HLTA 4MGYE 3POIA 3SH5A 4CEYC 3BN6A 5EPAA 5DG1A 4K6BA 1JS9A 4GH4A 2E26A 4TN7A 1AYN1 2X10A 4FPLA 4E8DA 1UX7A 2ZMNA 2VZUA 2VMDA 5BNNA 2FDGA 4UBGA 4LLFA 4DS0A 4IESA 5DUXA 4YARA 2WNUB 3GBWA 1F4HA 4QGMA 4B8EA 2GNBA 1AYM3 1QJFA 4R4ZA 5LRRA 2VMEA 1ND2A 4PF1A 1ND3A 4KWKA 4U36A 4GA9A 4PBOA 1RUJ1 3KHBA 5C7GA 2ZPXA 2H6BA 3U0ZA 4WM7C 1U5XA 1GBGA 5EQUA 4L92A 1WWYA 2Z79A 4YG6A 5DUVA 2GAUA 1F5JA 5JZGA 3IIIA 3CMGA 3DUIA 3K51A 2O8OA 4IXLA 4RS5C 5L7OB 1AR62 1GWMA 3HQRA 3NNJA 2Y6FA 2VBPA 3FHQA 1W9SA 3WDVA 3ZYJB 4MADA 2ZHKA 3TNQA 3PVNA 3HIFA 5ERLA 4EN8B 5FO7B 5IK8A 1YQ5A 1NE4A 1C5HA 2PHLA 3K4AA 3M3EA 2PYTA 1QWRA 2XJVA 1XU2A 4XCAA 3UKTA 5FMDA 3VBSA 4AOCA 1NLRA 4UW6A 2Y64A 2YPDA 4XAAA 2ID4A 4AE2A 5L19A 1JOBA 1W0PA 4ONUA 4LOTA 2UWCA 4YFZA 1ULCA 2VUDA 5FR3A 3KS7A 1ULGA 2W39A 4IGOA 5T52A 5A6ZA 5CFCC 2JIGA 1I5ZA 2J7MA 3AL6A 4IEQA 5FZOA 1WMEA 1OFSA 2E31A 3H1WA 1RB8G 4CP9B 1US3A 5FPAA 5JDBA 1BCXA 3CEWA 3UJOA 1O5LA 2V72A 1IQAA 1JOJA 1DQ6A 5KHHA 3OF1A 2WNOA 2WR9A 1SZBA 2JG9B 4DFSA 4H7MA 5FKBA 3LFMA 2V73A 1RVF1 2R30A 2YC0A 1HXS2 5LA2A 3VZJA 1ZBA2 2WAAA 1E5RA 4XTPA 1CD3G 1HB4A 2HWF1 4XUNA 1V6NA 5FYIA 2MNGA 4WZCA 3I2IA 3M4FA 5IVCA 5L36A 2IFWA 1CAUB 3I3EA 3RYRA 2ZX0A 3ACLA 2OXBA 2WKKA 2CDOA 4MOAA 1K45A 3SNMA 4DOUA 3MGUA 1OD3A 3UKVA 4JTOA 1IS5A 3JZVA 3ZXFA 4ORFA 4PI2A 4ZXKA 2EF6A 4PLMA 2TNFA 2FDJA 4P5HA 3BTXA 3B00A 4D6RA 4ZS2A 1PHMA 4IEZA 2QCSB 5FXXA 3VBRB 5FP4A 1VRBA 5F6LB 5FUNA 1AR92 1H4HA 1RHI1 3FX3A 4FO9A 3HAGA 4JCKA 2HWC1 3ACGA 3CQOA 4DUVA 3DF0A 5A1LA 1I1EA 1DYPA 4UW4A 4XFIA 3ST7A 4JGYC 2XHNA 4Q4Y1 2XWBB 1RUC2 3ACFA 1BYHA 4D8MA 5JWPA 2NMNA 2WS92 3EO6A 2WL1A 4WZFA 4ZONA 3W9AA 2R042 1V9U2 2BZDA 1D2QA 2ZEZA 2RMU2 3BB6A 3POWA 4NROA 2EALA 2B42B 1X8EA 4XUTA 5FFOC 5FY4A 4BLIA 5ACA2 2CYFA 5J37A 4OHZA 3MO4A 4AQSA 3POBA 3DL3A 4HPKA 4W6YA 1BQPA 3VKLA 5H9PA 5BUVA 3CZJA 2HLEA 1QJY3 4XDQA 3FE5A 5D21A 1HDKA 2VD7A 1BLZA 4HANA 1HRV1 1LNSA 2VO5A 3VL8A 3WNNA 3KT7A 3ON7A 2JG8C 2VZQA 1FPN3 3AP9A 3HT2A 4O9GA 4DXTA 3CBNA 2AH2A 3N7KA 1WCDJ 2VL4A 2Y0OA 4Y5TA 1XOYA 4YM2A 3ZO0B 3NNFA 1SLBA 1TMF2 1V70A 2WZR2 1OLRA 2BOIA 5JIAA 1SLLA 1Y9GA 4G4FA 4QKFA 2JIJA 4LOSA 1VBA3 2NM1A 1YFXA 2JENA 4W50A 5DDJ3 4CDXC 2WN3A 5BV6A 4IEPA 1S0DA 1PGL1 2FCTA 5EJ1B 1JZ3A 2F17A 3M3OA 5JOZA 1XYPA 4QXHA 5EYXA 2KD7A 1D0HA 2ZGOA 1F4AA 1OVSA 4GQ7A 4FTEA 3CL1A 3H1MA 4ASLA 4TLFA 4XIOA 2IFRA 3LWCA 2PLV2 2D6LX 3ZFFB 1NQDA 4JGYA 4Q4V1 5C3OA 4FTBA 1REFA 1HLCA 1LULA 2P3YA 1WA6X 2KA3A 4CU7A 3KMHA 5HPOA 2A6XA 1RC6A 1OURA 2WT0A 3HEIA 5BNOB 3MF9A 3ZSLA 2Q5TA 5D1IA 3NAPA 4JVAA 4S2DA 2RR12 3B01A 3L2YA 5CG8A 4XCBA 4B29A 5FY7A 4C91A 4AFDA 1SQ4A 5ISLA 3LCPA 4BHPA 2ZABA 1GNZA 3BVCA 4JRLA 3ZFGC 1OUXA 2PXJA 5FDBA 3PUSA 4QGNA 3S5QA 1Q5OA 2GDFA 4UFLA 4GIQA 4XURA 4LUKA 2ENRA 3TWIA 4GB32 3H7YA 3ITQA 3PUAA 3POYA 1ZZ8A 1YO8A 3KT1A 2E53A 5CKQA 5KXEA 5IVJA 2BGCA 2PHFA 3HBKA 3KQ4B 3A23A 2DVAA 4WVVA 4CDXA 1O4ZA 3K77A 1NZIA 3UGGA 1EUUA 1UMIA 4R9CA 2CU5A 4NWVA 3OJBA 5FMOL 3A4UA 1O91A 2GN3A 2JDAA 1MQTB 3I2FA 1IG0A 3VHPA 1WA4A 1RUF3 4NRMA 3AP5A 3C7EA 1AYM2 4NUBA 2XH6A 1UYXA 4EQVA 3JD73 4LBJA 5A6XA 3O1PA 4GMP0 4GWNA 1MS3A 3CDZB 3U75A 4UFJA 3SKJE 4ASMB 4CCLA 2WQ4A 3FZ3A 3I2KA 5GKAC 1YWKA 2FMYA 4DINB 4FOVA 2P6HA 3NJVA 3QBQA 4QPYA 1OH3A 3USUA 1I9RA 4DUXA 3WG2A 4D0QA 2FCVA 4PT6A 4XHXA 1W6NB 4IE6A 2PAKA 1JU4A 3T3YA 4AVBA 1C8NA 1GOGA 5JXGA 3ZN6B 1O3RA 3TN91 5CG9A 1UIKA 1N1TA 4GULA 2QKDA 3TRSB 1HXS1 2CHHA 3JQWA 4YW3A 5DUWA 1VBD3 1WD3A 1VB2A 4CVUA 5LK7B 4YYOA 4BK4A 5A3MA 4EN6B 4MGTA 4XFCA 5JOYA 3K48A 2XG3A 1GOHA 2CL2A 4LKEA 1O8PA 2ZGUA 1S0CA 2WLPA 5C70A 4PQ9A 1NG0A 1VMFA 2IWGB 2XBO3 4HKOA 4I30A 4WM8C 5HXVA 3VDDB 3USSA 1ZRCA 2H0VA 2ZS6B 1Y7BA 4EJRA 4LHNA 2GSYA 5I91A 4XE9A 5L7OA 3AYEA 5C5UA 3MPPG 3IDCB 4IQPA 2D43A 2EIGA 2GN7A 3D6EA 1PVC1 1MACA 4Z2AA 1HB2A 3OGVA 4AHXA 4I3GA 4I3PA 5FXZA 4YVSB 4LBOA 1QJX3 1Y4WA 5FYSA 1G6NA 1OMIA 2YMZA 5L9VA 5DQ0A 2D44A 1QOOA 3ZYPA 1AL21 2QNKA 3HN3A 3X29B 3RVHA 2BVVA 1RUC1 1BKZA 2G9FA 4K21A 4BQ1A 4DXZA 1W8FA 2XHKA 3KGZA 4LKFA 4EN0A 3KCCA 2Z69A 1V9U1 1ZA7A 2RMU1 1RUNA 1V6IA 4K1YA 2BYVE 2ADDA 4CP9A 2VG9A 1POV1 2Y60A 2HJIA 2AYHA 4BIOA 4N8MA 5EXOA 1ODNA 2JG9A 3BTZA 2G1MA 1QQP2 3K4ZA 3TOJA 5F3IA 2WNVC 4PDWB 3JBG2 2GU9A 3LD8A 3ZSMA 1HRI3 2RS32 2GC3A 5AC93 3E5QA 4RFT0 2Q8EA 2YFUA 2SBAA 1Q8VA 4GWMA 4JRAA 4XYXA 2OT7A 2ZMLA 4ZS3A 1B09A 4DXSA 5SV5A 5FBZA 3WINE 4R9BA 1GNYA 1MS0A 4B1MA 5A6YA 3C3VA 1QJY2 4QKNA 2VCCA 2I45A 3VBRA 3KV4A 5FZ4A 4Q8KA 3UGFA 2WT1A 4BPZA 3EQEA 2AACA 1JMUB 3B3QE 5GZFA 2OS2A 4K1ZA 3NNMA 4ZZ8A 2R1DA 2PLV1 2JDMA 2YZ4A 4FVVA 3VDCA 2EVXA 2HWD2 3VBFC 2R1BA 1TZOA 2R6QA 4HVOA 4JZRA 3WOGA 5ABJB 5HI0A 3N7MA 2VZOA 3ZXEA 3UNPA 4KU7A 1F35A 5CYYA 5A80A 3RMXA 4YFWA 4LA2A 3RPQA 4CSWA 5IYYA 2B45X 5FLIA 3N9PA 3BCWA 3OY8B 1OA4A 5FZHA 1VAKA 5FZ6A 3VZNA 1KEXA 2DUPA 2P17A 2LM3A 1URXA 1KDKA 2VZSA 2Y8KA 4OQ9A 4YPJA 1ST8A 3JCIA 3AZYA 4QAWA 1W6MA 4WVZA 1DQ5A 2Y33A 1GZCA 4M3CE 1RUH3 5IW0A 2WUHA 1W2TA 2J1EA 4K20A 3BKZA 3KD4A 5H9RA 1NCQB 2VUCA 4GB31 3OUHA 5GZCA 2J1VA 5FZFA 1XNAA 2YFZA 1SFNA 4BXFA 4B1LA 3PTRB 5FK7A 4E4SA 4OFGA 5IK4A 1TE1B 1VP6A 3V56A 5F7UA 3IAQA 3MIEA 5JXHA 3AXEA 4ZKTB 1FT9A 1FAYA 2VZVA 4UWDA 3U1XA 4RFRB 3B9CA 3AKPA 2ET7A 4M0HA 4OI1A 4FPJA 1PIV3 3P6BA 4HFSA 1OHFA 5E8AA 3BU7A 4M0NA 4M00A 4BQ2A 4OHYA 3U14A 4FQ4A 1DYOA 3ZFFA 4L9BA 1PX3A 3T4HB 1OD5A 5T3NA 1CAVB 3VBHA 4CEWC 5A6QA 3RJ2X 4XAEA 5IVEA 3VBFA 1WLWA 1ENQA 5A3UA 2XLAA 1ZBE1 4OVEA 4MO3M 4JAAA 3THDA 1RUG2 1L3JA 5HCFA 3MHZA 3J7MA 5BNOA 2Q1FA 2W1WA 5E1RA 3WCSA 2ZJCA 1AR81 1BK0A 1ZZ7A 4RGGA 2BVBA 4UBHA 1RUE3 5GZEA 2J1UA 3O1VA 4Z2WA 2AEYA 3ZXGA 1T6GC 3D4KA 4UW5A 4FOYA 2ARAA 1WLDA 5FYTA 4BISA 5FZ3A 5A1FA 5IAXA 4HSLA 4N90A 3RMYA 3SMHA 4DPNA 3WCRA 4WVMB 5FZBA 1HN1A 3NV1A 1YNAA 3VBOC 5LW9A 3A22A 5AFEA 5FXVA 4C0BA 1RUI3 2GMPA 2Q30A 2P1BA 1CAWB 5FBJA 5FPBA 4NHMA 5J96B 2W3JA 3V0AA 3AFKA 4JX0A 4LBNA 2W1UA 5FZAA 3OSDA 5C6CA 4Q4X3 3F2ZA 4QD2A 2W2IA 3S6PA 4G9SB 4YZ5A 2VZ1A 1CN1A 1MQTA 3POEA 3ROUA 2E7QA 4D6QA 3T30A 1LEDA 5FXWA 2VTFA 1VBD2 2PHWA 4BMBA 5I0SA 2B9VA 4Q0UA 4QPIA 2EXJA 3H9AA 4UI9L 4UF0B 2DCYA 2EIDA 1W39A 2XBO2 1R092 3PJYA 1PX4A 4JC1A 1UMZA 1JZ5A 3QLQA 1JHJA 3VKOA 2DVDA 3BODA 4E4DX 1W6PA 3GJAA 1K5MC 4LBKA 1GWLA 2VVDA 5K0UC 3AKSA 1W6NA 2X8KA 4AEDC 1W8WA 3ZYGA 1OA3A 3ZN6A 1W8ZA 2O0OA 1QQP1 4LE3A 4V2VA 5DPNA 4LNVA 3RWNA 5A7QA 3JBG1 3SH3A 1AF9A 1S4CA 1OC1A 1DGWX 4DUWA 4URAA 3ZFEC 2W1SA 4RHV3 2RS31 4QPWA 4KWUA 3N9OA 4CDWB 4ZZ5A 4Q0SA 4LT5A 3V65A 3I2GA 4LO6B 4BM8A 1PO21 3EB7A 3O0VA 3WZ1A 3VBOA 4DO0A 5I8SA 3VDDA 2OQ7A 2Z42A 4YG3A 3ZXLA 2ZTNA 2LALA 4I02A 4N53A 3BOPA 4QKDA 4AVVA 4N9IA 1JTZX 1ZYBA 2JKXA 2YBKA 3PDQA 5I0TA 5L9RA 4XDOA 3ZPOA 4R9AA 3HT1A 4IE7A 1O3SA 4PHZA 2EIBA 1CJDA 1OOPC 4MXVA 1HRI2 3GCWA 1GR3A 4QB6A 1RINA 1US2A 2XL9A 5IVFA 1WCQA 2EIEA 5AC92 2DCKA 3E5UA 1CR7A 1NYWA 2MHFA 5GZGA 3O1TA 1LU2A 3ASIA 1EY2A 1OUSA 2HWD1 2WN2A 1O4TA 2HKXA 4AQ6A 4BOWA 3AP4A 5FZDA 3AYAA 3AMMA 1WW5A 3CJXA 3WXPA 1W05A 1UQXA 4FSJA 3LEMA 3CU7A 4IL7A 5HCAA 4XQ4A 5J09A 2VH9A 4AEDA 5LBBA 5HBAA 2VZTA 4PDWA 4PIXA 1F15A 1UU6A 2RE9A 1G7YA 4GMP3 4AFAA 4Z07A 4NIAA 3U10A 4AEKA 2X05A 4GALA 3O1MA 3KLSA 2CSGA 2VMCA 5CVRA 4A44A 2R49A 1GFF2 3O14A 5D8AB 4YW6A 1DHKB 2XQXA 3IDEA 4QU2A 1MEC1 5T5PA 1Q8PA 4Q1PA 4WM7B 4QWNA 1H8TC 2Y6JA 3FBMA 3WDWA 2WWSA 4A7KA 4DMIA 4CUAA 5BNQA 5FOBB 4OCTA 2DCZA 4A41A 1BBT3 4DEQA 2HBTA 1LHVA 4XMIA 4FXGB 4X6RB 5FZCA 1AHSA 5FJKA 3ZMOA 4XTMA 5F8PA 2VQTA 4LEJA 2FCUA 3GZTB 3T0DA 1XXNA 4FPOB 1MR5A 1FYUA 1XC6A 4S2HA 4X8NA 4OUMA 4YVWA 2PELA 4EWEA 5G04L 1COV1 1W0OA 5C9AC 1V0AA 1CESA 1ZRFA 4NIIA 2BERA 1RUH2 3L9JT 1SPPA 2R0HA 4ITCA 4ARYA 3MICA 3VD9A 1UPIA 1PMIA 4YZ1A 5A70A 4KWLA 4LIVA 3J8F2 4RR3B 3PU8A 1CZTA 3KQRA 1OQEA 3I7DA 3I2HA 4GKYA 1W90A 4YNIA 2EA7A 1RUG1 4HK9A 2ATFA 2I2SA 1BJQA 2X5IC 3C7GA 4OI2A 4PIYA 2FDFA 2DBIA 5CAZA 5F9TA 5DZGA 5LBCA 4BXSV 1UY0A 4ZU4A 3FFQA 1RITA 4D94A 1PIV2 4PQQA 4F83A 1EAH1 2GC1A 2ZOEB 3H42B 4NO4A 4CCMA 3IT8A 4WV8A 3VZLA 2W1QA 1GZWB 2E9QA 2FMDA 5HCBA 1LHUA 1I3HA 1YEWA 3ZIWA 3ZR5A 4R8HA 3THPA 1LHWA 3WX5A 1NCQA 3MIDA 4Y24A 3AJYA 4NE9A 2QE3A 1BEV2 3OD4A 2WFF3 3OCPA 3QD6A 5FJHA 1IG3A 2HEWF 4Q0VA 5DAVA 3WLUA 2V4AA 5C33A 2MEV2 4DRVA 5EIYB 3M1HA 3PHMA 4QM9A 3I49A 1J3QA 4LQRA 1UOJA 3MBWA 4LORA 1BVVA 5BNNC 3ZVXA 4K9SA 2WA3A 4BQYA 1RUE2 5TSWA 3CJIB 4H14A 1DGWA 5C3RA 3F95A 1POQA 2MPFA 3LDBA 3GZUC 3NJZA 5F5AA 2F6BA 4CDQB 1DU3D 3B7MA 3C8XA 5C9AA 1YFYA 4LHKA 2RM23 1R081 2XLGA 1ND2C 4BQ3A 3N9LA 5F6KA 1DZQA 1U5YA 1ENSA 2VULA 2NQYA 5JI7A 1ASJ2 4LO5B 4P9YA 2C9KA 3AP6A 4URTA 5FZ8A 3IPVB 1C28A 2CY6A 2BUKA 3RRDA 3IBMA 2UYAA 3WUCA 2XBO1 3PL0A 4LO8A 4CUBA 4E2QA 1R091 3NJXA 5FPZA 4AYUA 2VPVA 4BJ0A 5JZGC 1DQ1A 3ZM8A 5A32A 1OVPA 1CPNA 5J7MA 2DYCA 3AZZA 3ZKYA 3WNOA 4YM0A 4GXLA 3N4MA 1IPJA 4LK7A 4ZPIA 1NA1B 2VCBA 2Y6KA 5JCTA 3QH6A 3RZGA 1H1IA 1V6KA 1JHNA 3NO8A 2JB4A 3VBSC 3I59A 2ARCA 1UCXA 2H6CA 2OPWA 3AC0A 3TNPB 5FUPA 4AQ2A 2DTWA 4ES8A 2VVFA 4AI3A 3V0BB 1KITA 1R1ZA 1UXXX 1PK6B 4MGKE 5KXCA 1LENA 1PM7A 2CAUA 4QXBA 3BUCA 1QIQA 4MHUA 4O65A 2XB6C 4RGAA 1CAWA 3GDBA 2QQUA 3T08A 1QGLA 5JOXA 2GP5A 3AP7A 4AG4A 4YW7A 1AR71 4LMFA 1HX6A 4AVAA 3H8OA 1H2MA 4HBNA 1K12A 1OKOA 1HRI1 3WNKA 3VD4A 3OEBA 1ZZ6A 2P4EA
chains in the Genus database with same CATH topology
3BTYA 4CXYA 3KHCA 3H8XA 3I2OA 4ZS3A 4IE0A 4NIIA 3LFMA 4QKNA 4NIGA 2FDHA 3O1OA 3O1UA 2FDFA 2FD8A 3RZMA 3H8RA 3T4VA 2FDJA 4NRMA 3BTXA 4ZS2A 3O1PA 3I3QA 2FDIA 4NPMA 2FDKA 3S57A 4IE4A 4ZHNA 3I49A 4O7XA 4NRQA 3BIEA 4NROA 4IE6A 3T3YA 3BU0A 3S5AA 4QKDA 3BKZA 3I3MA 4IE5A 3O1RA 4IE7A 4MG2A 4O61A 4MGTA 4NPLA 4QKBA 3RZJA 4RFRB 5DABA 3O1TA 2FDGA 4NRPA 3RZKA 3T4HB 4QKFA 3RZHA 3RZGA 4NJ4A 3KHBA 4CXXA 4NIHA 3O1MA 3BUCA 4NIDA 3O1VA 2IUWA 3BI3A 3RZLA 4IDZA 4CXWA 3O1SA 4OCTA 3BTZA 4QHOA 3H8OA 5F8PA 4JHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTY A;  4CXY A;  3KHC A;  3H8X A;  3I2O A;  4ZS3 A;  4IE0 A;  4NII A;  3LFM A;  4QKN A;  4NIG A;  2FDH A;  3O1O A;  3O1U A;  2FDF A;  2FD8 A;  3RZM A;  3H8R A;  3T4V A;  2FDJ A;  4NRM A;  3BTX A;  4ZS2 A;  3O1P A;  3I3Q A;  2FDI A;  4NPM A;  2FDK A;  3S57 A;  4IE4 A;  4ZHN A;  3I49 A;  4O7X A;  4NRQ A;  3BIE A;  4NRO A;  4IE6 A;  3T3Y A;  3BU0 A;  3S5A A;  4QKD A;  3BKZ A;  3I3M A;  4IE5 A;  3O1R A;  4IE7 A;  4MG2 A;  4O61 A;  4MGT A;  4NPL A;  4QKB A;  3RZJ A;  4RFR B;  5DAB A;  3O1T A;  2FDG A;  4NRP A;  3RZK A;  3T4H B;  4QKF A;  3RZH A;  3RZG A;  4NJ4 A;  3KHB A;  4CXX A;  4NIH A;  3O1M A;  3BUC A;  4NID A;  3O1V A;  2IUW A;  3BI3 A;  3RZL A;  4IDZ A;  4CXW A;  3O1S A;  4OCT A;  3BTZ A;  4QHO A;  3H8O A;  5F8P A;  4JHT A; 
#chains in the Genus database with same CATH topology
 3GZA A;  4NHK A;  4UF0 A;  2OYZ A;  4E8C A;  3LOI A;  2YGL A;  3ZMN A;  5KHG A;  3OBR A;  2XPJ A;  4BDV B;  2PAE A;  1VBE 3;  3OB8 A;  4LLO A;  1O3Q A;  1LGN A;  4J25 A;  3JU9 A;  1QJZ A;  1UF2 C;  1QDO A;  5GLV A;  3E6C C;  1YFU A;  2KM2 A;  1V6J A;  2AZ5 A;  1KDM A;  3WW4 A;  5FPX A;  5I8Y A;  1D0G A;  4Q29 A;  5I0U A;  3ZFG B;  5JPN B;  2NP0 A;  1FMD 1;  1GMM A;  2BU9 A;  3O1O A;  1JI6 A;  2QZ3 A;  2XJP A;  3LZZ A;  1ALY A;  4TWT A;  1FOD 1;  4Y4R A;  1AZD A;  2VCM A;  1HJG A;  1UNB A;  4XJ9 A;  4FP2 A;  3VZO A;  4XF0 A;  1XQN A;  1DCS A;  2VOW A;  1QMJ A;  2W94 A;  3BAL A;  4NHX A;  2RJL A;  3VKN A;  4X8P A;  2DDU A;  3PIJ A;  1GOF A;  1LOF A;  1NLQ A;  1W6Q B;  5F2W A;  5T54 A;  3IDA A;  4F8A A;  4COZ A;  5A7W B;  1F31 A;  2QFE A;  4Q4W 1;  1QKQ A;  2ZX4 A;  2F4L A;  3UET A;  5FYY A;  4XZU G;  1PNG A;  2OVU A;  2JDN A;  5F5I A;  3LFI A;  3VN4 A;  4NRQ A;  5H9Q A;  2A71 A;  5C3S A;  2W9X A;  2YV8 A;  3LA2 A;  3B94 A;  1C8M 3;  4MXW B;  3AFG A;  2E63 A;  3ZXK A;  1U5Z A;  4D7Y A;  1MZ5 A;  3OUJ A;  1BBT 2;  2WO3 A;  1YIF A;  4JHZ A;  3J8F 1;  1E5I A;  2Q8D A;  1YQ2 A;  1OLM A;  1S55 A;  3RZJ A;  1X33 A;  3PMS A;  1KJL A;  2DU0 A;  2RS5 2;  2O8Q A;  1HW5 A;  1W3X A;  1KFX L;  2OW4 A;  5GLU A;  4Y5Z 0;  3U78 A;  1J84 A;  1JH5 A;  4BZ4 A;  2WAB A;  4DY5 A;  3ZYB A;  3LPG A;  4QX0 A;  5DZE A;  4RN5 A;  3SCH A;  3J7L A;  1QJU 1;  3MIG A;  1FX5 A;  1GYK A;  1SLC A;  3ZXA C;  1H6X A;  2VNO A;  1SFP A;  2WO1 A;  3SLI A;  3S7I A;  3OEA A;  4ET7 A;  5LA0 A;  4EZH A;  1BEV 1;  3UGH A;  3LOB A;  3O0W A;  1G9B A;  5B4N A;  4JQT A;  3NAP C;  2OQ6 A;  5FQ0 B;  1W8H A;  2BNO A;  3IM0 A;  3ZDS A;  3RNS A;  1ZRE A;  2MEV 1;  2QQV A;  3ZN5 A;  2HWE 3;  3R4U A;  3GXU A;  1PO1 3;  1B35 B;  1VBB 1;  3GBG A;  3PJQ A;  4CU8 A;  1DGL A;  3CO2 A;  1J3P A;  4Q0Q A;  4ZY9 A;  1ZNP A;  4CCJ A;  5FPV A;  5A7S A;  1NCR B;  5BYN A;  1HQN A;  3RZL A;  1RUD 3;  2W95 A;  5FZ0 A;  2XJU A;  1HQL A;  2P6C A;  2VTX J;  3B9I A;  2C4X A;  3M2M A;  3VDA A;  4ISR A;  3WV6 A;  2WSU A;  4AEJ A;  4Y1X A;  5A3P A;  5BNP A;  2YB7 A;  1R1A 1;  4MGQ A;  5FMC A;  2WFF 2;  1ASJ 1;  3NKG A;  4QPG B;  4RA0 A;  3TB0 A;  1F9K A;  4AVT A;  4JDO A;  3K46 A;  1G86 A;  2PN5 A;  4P02 B;  1QXR A;  1FV2 A;  4A3Z A;  5CFD B;  1I6X A;  5KHI A;  3W5N A;  2ARE A;  4B4Q A;  5JIU A;  1GP5 A;  2G19 A;  3MYX A;  3ECQ A;  2YRO A;  3RWK X;  1VMJ A;  2IZW A;  3JB8 A;  1DDL A;  1XNC A;  2RM2 2;  3I2J A;  4HG6 B;  1GZW A;  4UFH A;  4B7E A;  4XMA A;  1N3O A;  1UYY A;  1N1V A;  2XKO A;  5DXD A;  1WW7 A;  1X82 A;  3O1U A;  4IV1 B;  3NV2 A;  2XML A;  2JB8 A;  5B4X A;  3ZSK A;  1UAI A;  3POG A;  2BGO A;  3EJK A;  3GYD A;  3INA A;  1W2N A;  2R07 3;  3FWE A;  3IDB B;  2R32 A;  3D3A A;  1S0F A;  5FWE A;  3T4V A;  4IND A;  5FZ9 A;  4IGQ A;  2CV6 A;  2XJR A;  4AXO A;  3I97 A;  2ZZJ A;  2CDP A;  3BGA A;  1VRH 3;  4QX8 A;  1T6B X;  2RS1 3;  2WNU C;  2R06 3;  4W6W A;  4CDQ A;  3PME A;  4Y1V A;  1C1F A;  2XQR A;  2VXR A;  3LIH A;  3N35 A;  1X9T A;  3M7A A;  1ULF A;  3N7L A;  1Q8O A;  3WQB A;  2A3W A;  2CGO A;  3WW3 A;  3U07 A;  2ZGK A;  2N7G A;  2QQW A;  4D3W A;  4SLI A;  4QDR A;  1KFU L;  5L7O C;  3LEK A;  1OSG A;  3HPN A;  3S7E A;  1AR6 1;  2VZP A;  3WDX A;  5A33 B;  1XNK A;  3POS A;  3IB3 A;  1SDD B;  1H4G A;  1XNT A;  5BY5 A;  2ZZQ A;  3WDT A;  5FO9 B;  3HVD A;  2FD8 A;  5IAV A;  2W68 A;  1V6L A;  3MI8 A;  3C7H A;  1DLC A;  4JGZ B;  4CCC A;  2VMI A;  1C4R A;  4AL9 A;  3VHO A;  4CP1 A;  1VBE 2;  1MS4 A;  1SG3 A;  1YQ6 A;  2J1S A;  4HKL A;  2BDR A;  3V0B A;  4RD7 A;  4Q8L A;  4K3U A;  1PK6 A;  4LE4 A;  2CWS A;  2NYY A;  4XF9 A;  3U11 A;  1TME 3;  2O1Q A;  1Q8S A;  3WG1 A;  5CNA A;  2C6S A;  3IN9 A;  1UY2 A;  1JZ6 A;  4OHX A;  4IV3 B;  4S2F A;  1K3I A;  2JG9 C;  2IVI B;  4FCA A;  2QQN A;  3ABZ A;  4CP0 A;  3DGT A;  1W8N A;  4LTA A;  3PIG A;  4CU6 A;  5HV4 A;  2WNU A;  1ZBA 1;  1D7P M;  3VL9 A;  4YZ4 A;  1SLI A;  1PNF A;  1UU4 A;  3J4U H;  4KGQ A;  3THT A;  4GAZ A;  4YW1 A;  5K9Y A;  3G7D A;  3E97 A;  3ILF A;  5JR7 B;  5FP7 A;  5LA1 A;  3BI3 A;  4UOJ A;  1XSR A;  2X53 S;  3PUH A;  1GU3 A;  5FOJ B;  1SLT A;  4LPL A;  3SQO A;  3SCF A;  2IC1 A;  2RHP A;  1YHF A;  3VBR C;  5J3U A;  4CDU B;  5F3G A;  5F5Q A;  5IJR A;  3LF7 A;  2ADE A;  4JHT A;  1QHD A;  2VMF A;  2RS5 1;  5K7P A;  1AR9 1;  4BLJ A;  4TSV A;  4Y22 B;  1AX1 A;  1GUI A;  3RSJ A;  3ZYH A;  3AKR A;  3RG0 A;  3ELN A;  1QNY A;  2HYX A;  4E9K A;  2C1F A;  1CPM A;  3WP4 A;  1C8M 2;  2PQQ A;  4NVP A;  4BYY A;  1RIR A;  3SIT A;  4BQ5 A;  4GD4 A;  2WS9 1;  3ACH A;  3MW2 A;  2R04 1;  5GAL A;  3Q8C A;  2JEM A;  5LAT A;  2AR6 A;  2RDN A;  2PHD A;  5ACA 1;  2ET1 A;  4FPY A;  1CX1 A;  1POV 0;  2YU2 A;  3PU3 A;  1EV1 3;  1HB1 A;  1L7Q A;  1VBC 3;  3O5S A;  4MUV A;  3GNE A;  2XJT A;  2GH2 A;  3LE0 A;  1G9A A;  2YU1 A;  1C3H A;  5DAX A;  2Y38 A;  1D4M 3;  1YRZ A;  2OII A;  3A21 A;  2R0F A;  4TLG A;  2DVF A;  2P37 A;  2ZX1 A;  4MGS A;  5LY1 A;  4FTS A;  1H2L A;  1NOV A;  3OGJ A;  2GNM A;  3WNM A;  2VAU A;  1LGC A;  3QAC A;  4OMC A;  1S2B A;  4U2A A;  4P5Y A;  3LSE A;  2I07 B;  5KXB A;  5DAW A;  4FOW A;  4MXW A;  1CAU A;  2TBV A;  1TMF 1;  1Z0H A;  1OPM A;  4OUS A;  3WEZ A;  2WZR 1;  4HN0 A;  1JOD A;  5JLV A;  3NQH A;  1FAT A;  4D7T A;  1AYN 3;  5JPM B;  4JV4 A;  2A6Y A;  1UO9 A;  1ULE A;  2HEV F;  3AJZ A;  3RFR A;  1UOF A;  3MIF A;  1LEM A;  2VR4 A;  1UL9 A;  2ZGS A;  3ZIX A;  2DUO A;  3M3I A;  1LR5 A;  1RGS A;  2HWE 2;  2V09 A;  4QT6 A;  2VXJ A;  1GWK A;  4XC9 A;  1DG6 A;  4AI8 A;  4IER A;  4PJY A;  3WDY A;  1JZ7 A;  3PUR A;  2E33 A;  4I01 A;  2YBP A;  1FPN 2;  5FZL A;  3ZFE B;  4XJW A;  1AVB A;  1NZC A;  4CCK A;  3RZM A;  2VQ0 A;  3ZFF C;  2VQA A;  3WF3 A;  1NY7 2;  1P8J A;  1RUJ 3;  1RUD 2;  4I0B A;  3VBH C;  3S5A A;  2Z2S B;  4FFF A;  3O1R A;  2GME A;  5EJZ B;  2VM9 A;  1VBA 2;  3R0R A;  1G9F A;  2JDH A;  4XDP A;  3J7H A;  5DDJ 2;  1Z78 A;  1E5H A;  3T2T A;  5BNO C;  4Y4Y A;  2Y26 A;  4PI0 A;  5FQ0 A;  4XJU A;  5A3L A;  2RR1 1;  3AMP A;  3LQC A;  2WDB A;  2A73 B;  5HCH A;  1W6O B;  1MZ6 A;  4BB3 A;  4A42 A;  4BWO A;  1TEI A;  5C8C B;  2HH9 A;  1NCR A;  4QGL A;  4AFB A;  2WQZ C;  5LA9 A;  2VBD A;  5J1X A;  1X9P A;  1AXZ A;  4RQP B;  4OZO A;  4J6G A;  2ZGR A;  5DMY A;  1IS4 A;  2NLR A;  1UZV A;  5CIR A;  2EAA A;  4H2A A;  4AF9 A;  1JZ4 A;  4B4R A;  4FT8 A;  4UFK A;  4R9D A;  1RVF 3;  2PMW B;  2R07 2;  1Y3T A;  3AKQ A;  2XXZ A;  1AXK A;  3EYP A;  1KXG A;  1WD4 A;  2HWF 3;  3NVC A;  1MQT C;  4N43 B;  4XVH A;  3O1S A;  3OBZ A;  2JE7 A;  3K3O A;  2RS1 2;  4QHO A;  3WT3 A;  1R64 A;  2LTN A;  4BIF A;  4QPI C;  4YM1 A;  3TYJ A;  1HJF A;  4ASK A;  2JDY A;  1AYM 1;  3KSC A;  4COV A;  3NV3 A;  1EP0 A;  1OF4 A;  4LBQ B;  5A7P A;  4A3X A;  1SAC A;  5KXD A;  4IV1 A;  4TXW A;  4XW3 A;  2C5D A;  3VZK A;  3I2O A;  4XFB A;  2VW1 A;  1CIY A;  1XSQ A;  1RHI 3;  1BMV 2;  2RJ2 A;  4QX1 A;  1RED A;  3WQ7 A;  5EWS A;  2JD4 A;  2B7Y A;  5FP3 A;  1GZ9 A;  2WWJ A;  1REE A;  3L2H A;  2WZE A;  5FYB A;  1SCS A;  4QM8 A;  1PVX A;  3MFC A;  1RUF 2;  1WLC A;  4Q4Y 3;  4A7Z A;  1U12 A;  4BA6 A;  1XYN A;  1NUK A;  3JD7 2;  2RV9 A;  5IVB A;  2OX0 A;  2JKB A;  3UYJ A;  1OI6 A;  3D0S A;  5CIS A;  1D4V B;  1WCU A;  1OT5 A;  3DV8 A;  3PNA A;  5GLZ A;  1WBF A;  3CLP A;  1H6Y A;  2PA7 A;  2XKP A;  1PMH X;  2KXL A;  4V2W A;  2E32 A;  3VHN A;  4D7S A;  5HV0 A;  1RUO A;  1A3K A;  1YQC A;  2X5I B;  3VDD C;  2WIN B;  1UN1 A;  1HRV 3;  4N53 C;  4XJ8 A;  5FIX A;  3WNL A;  3LEI A;  3WG4 A;  4FPF A;  2W47 A;  4GJY A;  3VDB A;  5EFU A;  2FDK A;  1SHW B;  4DIQ A;  1K42 A;  2DUR A;  3GBF A;  4AQT A;  2VGD A;  2E51 A;  2VOX A;  3DPR B;  4YVS C;  4OYU A;  3O12 A;  3U37 A;  2WJS A;  3GAL A;  2NPI A;  3V64 A;  1QJE A;  1MPX A;  4XF1 A;  1O6U A;  3IMM A;  2WYF A;  1DIW A;  2YDE A;  3WUD A;  1ODM A;  2ZEX A;  2BV4 A;  3BU0 A;  3OD0 A;  1DGR N;  1IPK A;  4GH4 B;  4KU8 A;  5A3O A;  3UL2 A;  3VD7 A;  1WMF A;  4V1P A;  4LHS A;  1WCS A;  1WMX A;  3AL5 A;  3A7Q A;  4DRR A;  4O61 A;  4W65 A;  3KCX A;  4IV3 A;  4TYS A;  2WO7 A;  3PTY A;  2OKX A;  3MF6 A;  3RJR A;  2AEN A;  1W04 A;  4KI5 M;  3VBU B;  1EPW A;  4PDW C;  4COU A;  3BYW A;  3R4S A;  1QJX 2;  5ANN A;  5FZK A;  4AVC A;  5C4W B;  1JYI A;  1LHO A;  1ND3 B;  4QB2 A;  4M01 A;  3R05 A;  4XUP A;  4P14 A;  1EUT A;  5FYC A;  2ZA9 A;  5A3N A;  3AMN A;  3O0X A;  4H7L A;  3U4S A;  1J58 A;  4AI9 A;  3HBZ A;  2E7A A;  5JZG B;  1UZZ A;  1VB4 A;  1XNB A;  2ZEW A;  3M3Q A;  3UKN A;  1RTV A;  4A6S A;  1PZ7 A;  2XON A;  4AI1 A;  1W06 A;  2UWB A;  3H8U A;  1QJY 1;  4NIH A;  1RL3 A;  3WQ1 A;  3LDK A;  4CDU A;  2GC0 A;  1Q8Q A;  4EYU A;  2V5Y A;  2ZEY A;  1BZW A;  4IGP A;  3SXW A;  1YJK A;  2ERF A;  5DZF A;  4YVW C;  3BTA A;  3VBS B;  4MGZ E;  2Q1Z B;  2J42 A;  2B5H A;  3N9M A;  1FPN 1;  4YVS A;  1CAX B;  4LIU A;  2YC2 A;  4OZX A;  5FAX A;  4MET A;  4XAC A;  1NY7 1;  4MH0 E;  2BWC A;  1HB3 A;  4CEY B;  2XDV A;  5ABJ C;  4E2S A;  1LOC A;  1UYZ A;  5FZ7 A;  5BPX A;  1KS4 A;  3FHI B;  4MGI E;  1NXM A;  3Q8A A;  4L97 A;  1PZ8 A;  1VBA 1;  1A8M A;  1V6M A;  3KB5 A;  5DDJ 1;  5AVP A;  3WP3 A;  5EYY A;  1XU1 A;  2CAV A;  2QUO A;  3R4D B;  1ULP A;  3OTF A;  3RYK A;  3P1I A;  1MS9 A;  1HQW A;  1QEX A;  2K9Z A;  4DB5 A;  4EE2 A;  3GGL A;  5CEH A;  1G9D A;  4IE0 A;  1F8V A;  2ZAH A;  1IQD C;  4LR4 A;  2UY9 A;  5F32 A;  2CWM A;  2YG0 A;  3FLR A;  1RUJ 2;  2D98 A;  1W99 A;  2K0G A;  2ZKL A;  4AI2 A;  4C1W A;  2KR2 A;  1Q56 A;  5CKN A;  3I54 A;  2XGX A;  3DXT A;  4QXK A;  2FDH A;  1NCQ C;  3APB A;  5FYH A;  3T2P A;  1DQ4 A;  4RS5 B;  1L7R A;  4XFA A;  5T50 A;  4FFH A;  1MVE A;  1NAE A;  3RS6 A;  2BBA A;  4N7U A;  1ENR A;  4C90 A;  2WLQ A;  4YRD A;  4Z1V A;  1W0N A;  2Y6L A;  3TN9 3;  3M8L A;  4OHW A;  4XBL A;  5IVY A;  4JKK A;  3H8R A;  2R16 A;  4NHY A;  5LK5 A;  2DFB A;  1HXS 3;  4GWJ A;  4OLL A;  2C9A A;  5KR7 A;  1X36 A;  4P08 A;  3HJR A;  1S0B A;  4J1W A;  1X50 A;  4YWA A;  5EP9 A;  1OA2 A;  2VEC A;  4GJZ A;  1JUI A;  5CFC B;  1OQD A;  3RYP A;  4NPM A;  1UZ0 A;  2JXA A;  2VW2 A;  3LKJ A;  3WF4 A;  4HPK B;  5ABJ A;  4MLO A;  1QU0 A;  4QDS A;  3FLT A;  2A7A A;  1ACC A;  5LBF A;  1SCR A;  3DKW A;  4IE4 A;  3N9N A;  1IKQ A;  3OY8 A;  4P9L A;  3KT4 A;  4QQP A;  1OXC A;  4FAG A;  1A6C A;  1PVC 3;  3ZR6 A;  1JYV A;  2A75 A;  2DV9 A;  4JQR A;  2HYK A;  3VKM A;  2UWA A;  1QF3 A;  2DUQ A;  1TNR A;  2HWF 2;  1KJR A;  3MFA A;  1NQJ A;  1UXZ A;  4DEV A;  5IVV A;  4IET A;  1W6O A;  2WA4 A;  4CTE A;  4D6S A;  5JI9 A;  3MZH A;  1AL2 3;  3ETQ A;  3VHR A;  5IK5 A;  3AMH A;  4MG2 A;  4I2O A;  1RJ8 A;  1RUC 3;  1RUF 1;  5C8C A;  5FRA A;  4NPL A;  4IEU A;  3HR9 A;  2BWA A;  5T55 A;  1SLA A;  1OPO A;  1V9U 3;  1Y9Q A;  1UD1 A;  2RMU 3;  2PHT A;  3JD7 1;  3T1M A;  2ZHN A;  4KMQ A;  4AI0 A;  2OZ6 A;  2VVE A;  1CZS A;  1POV 3;  2GH8 A;  4P9G A;  2UUR A;  2V4V A;  2VUA A;  1PGS A;  2DU1 A;  2D6P A;  5ANQ A;  2Q8C A;  4AGR A;  4BU2 A;  1J3R A;  3RQ0 A;  4Q26 A;  5CBL A;  3HQX A;  3I3D A;  4CZS A;  2UYB A;  2EXK A;  2VC9 A;  5GZD A;  4AFM A;  5HXM A;  3VGI A;  5DUU A;  3DEM A;  4XJZ A;  5CU1 A;  4Q27 A;  3U4X A;  1XE7 A;  4JGY B;  4N43 A;  1JBC A;  3ZKU A;  4CXX A;  2Q0A A;  1QH7 A;  4RL7 A;  3OUI A;  3MPB A;  1CAV A;  5EZW A;  1VBD 1;  3LPF A;  1V6O A;  4M3C F;  5L9B A;  3KV9 A;  3MLL A;  3EBR A;  4LBQ A;  1TVG A;  2VNR A;  4CCE A;  1ULO A;  1NT0 A;  1RUI 2;  2GZW A;  3NAP B;  2IUW A;  2VOT A;  3I8T A;  2ZGP A;  1HRV 2;  4QQH A;  2D40 A;  2QVS B;  5M0T A;  5C3P A;  4P00 B;  3SEE A;  1LOE A;  4FFG A;  4UFI A;  1GKB A;  3E6B A;  2B4K A;  4Q4X 2;  4Z82 A;  1HIX A;  2JG8 B;  2GNT A;  2YUE A;  5F3E A;  5FZE A;  3NST A;  2GND A;  1H2K A;  1OLM E;  2J22 A;  1YI9 A;  2PLV 3;  3HN1 A;  3NJY A;  3DN7 A;  5E16 A;  1BHG A;  4P9W A;  2P2K A;  1QJX 1;  3FUO A;  3AVS A;  3K75 B;  2PAM A;  2ZAA A;  4LBL A;  2V5D A;  2P34 A;  4B7K A;  3LIG A;  4QX5 A;  3B02 A;  4CDX B;  3DKQ A;  4WVM A;  1SEF A;  4HMZ A;  2A6V A;  2DBN A;  4EV0 A;  3FL7 A;  3AK0 A;  3ZX7 A;  1CJP A;  4YGE A;  4BME A;  4FP3 A;  2DVG A;  1GSL A;  1LOF C;  4Y33 A;  2LS6 A;  2VE1 A;  3H50 A;  4KG8 A;  4Y5S A;  3WD5 A;  5AFB A;  1S2K A;  3ZSE A;  4HL0 A;  2QQK A;  4NPR A;  4C1X A;  1GAN A;  1O5U A;  1ENX A;  1GP4 A;  2VOK A;  1MS8 A;  3WF1 A;  5FO8 B;  1LOB A;  2BW8 A;  1KD7 A;  4FPE A;  1LOA A;  4RHV 2;  3DPR A;  4Q0P A;  4BH9 A;  5A1A A;  2Y0I A;  2ARX A;  2OPK A;  3NKT A;  4GB3 3;  1UOG A;  1KRI A;  5AC9 1;  1GIC A;  3WHT A;  2BQP A;  1S0E A;  3H3U A;  3N9Q A;  2PTM A;  3FC0 A;  4HKW A;  4ZU7 A;  1DF0 A;  3MW4 A;  3DYM A;  3USU B;  4AGG A;  5FMB A;  1C1L A;  2D3P A;  1H0B A;  2D6N A;  4C8D A;  4CYD A;  4CPB A;  1AL0 G;  1FNY A;  1H9P A;  2QQL A;  3GF6 A;  4P9I A;  2W0X A;  1OFN A;  3BPS A;  1N1Y A;  3FMG A;  4ZHN A;  4HOO A;  3VBU A;  1UZW A;  4SBV A;  1KGY A;  5C4W A;  4DY3 A;  4HXC A;  1BVP 1;  5LWB A;  5FKC A;  3LSD A;  1ZBE 3;  1IGO A;  4UYB A;  5GLW A;  5FK8 A;  5D8A C;  1XRU A;  4FXK B;  4CDW A;  1ZX5 A;  3HNM A;  1C5I A;  4BQW A;  1A8D A;  4RSU A;  3MDP A;  2IVJ A;  2D7F A;  1F2N A;  2WRA A;  2XOM A;  4HN1 A;  5LAS A;  4CPB D;  4W8J A;  4AZZ A;  1VAV A;  1ZM1 A;  5F1R A;  3SHR A;  1AR8 3;  1S0I A;  3HNY M;  3P3N A;  5FTT C;  3T1L A;  1C57 A;  5DAB A;  1HN0 A;  2P3I A;  4AAP A;  3AB0 A;  3KF5 A;  5GJ6 A;  1QDC A;  1QH6 A;  2HBU A;  4L0P A;  4F7Z A;  3WVJ A;  4KWJ A;  1Y43 B;  2ZX2 A;  1RMU 3;  1NE6 A;  3RZH A;  2LUW A;  1CAX A;  1N47 A;  5FYZ A;  4XQD A;  1VMH A;  5G05 L;  5KC5 A;  4NMI A;  4R4X A;  1RUH 1;  1ZZ9 A;  4CEY A;  2D97 A;  5BNP C;  3NRU A;  2IXJ A;  3J26 N;  4FPC A;  4RR3 C;  3VB9 A;  5FZ1 A;  3W59 A;  1PGW 2;  4OI0 A;  2RDQ A;  1OKQ A;  2D93 A;  2B39 A;  3AZV A;  5T5O A;  2BOJ A;  3TN9 2;  4A4A A;  2ZHM A;  1AUY A;  2QDR A;  4PF5 A;  1QNW A;  5DG2 A;  1GQH A;  5IWF A;  1A34 A;  1XPW A;  2ZHL A;  3O7O A;  3TEW A;  1PIV 1;  3DYO A;  4IDZ A;  3RI8 A;  3UK9 A;  2OUJ A;  3VUO A;  3Q8B A;  4Y1U A;  5D8A A;  2QQM A;  2K2S A;  4WM8 B;  3ZPY A;  1YI7 A;  1YC6 1;  4WM7 A;  1HKD A;  4FFI A;  3ZYF A;  1VR3 A;  1SBF A;  3S0M A;  2QZ2 A;  2JWP A;  2DFC A;  5C5T A;  4RS5 A;  3KHC A;  4LA3 A;  1OQ1 A;  4WVW A;  3PUI A;  2P3K A;  1PVC 2;  4ZXE A;  2FHR A;  3ZDV A;  1QQP 3;  4J1X A;  1W9W A;  4E2G A;  3IWZ A;  3JBG 3;  1TQ5 A;  5FWJ A;  4NWW A;  1HV0 A;  3CJI C;  1RUE 1;  2RS3 3;  1AL2 2;  3GHN A;  4NIG A;  1IS6 A;  1DZR A;  2TUN A;  1DGR A;  2JX9 A;  4BQX A;  4CDQ C;  4KGG A;  1PO2 3;  4LO7 A;  1U5I A;  1AX2 A;  5A3W A;  5CFC A;  4OUL A;  4XIK A;  4XXP A;  5K8S A;  3J9S A;  5KBF A;  2VNV A;  2ORX A;  1YIP A;  2NZ9 A;  1EYB A;  1GP6 A;  1Z7S 3;  4RR3 A;  1DLL A;  3S30 A;  1OLQ A;  4B4P A;  2P5B A;  1YYN A;  1RUI 1;  1JU3 A;  3FLP A;  5A3T A;  1JYX A;  2WSV A;  2X29 A;  3D8C A;  3SKV A;  2WNV B;  1FXZ A;  2AGS A;  1CX4 A;  4CCD A;  5E88 A;  1APN A;  4O9E A;  1MZF A;  1VIW B;  4KL1 A;  4PIZ A;  3QCW A;  1W6M B;  4Q4X 1;  1M06 G;  1EPZ A;  1NA1 C;  4M4R A;  5J36 A;  1DQ2 A;  4XFH A;  2VMH A;  4JDM A;  1KQR A;  5I0R A;  2EXH A;  2A3Y A;  2HWD 3;  2SLI A;  4K40 A;  4BQ4 A;  4LXL A;  2QBX A;  4K8R B;  1AX0 A;  3I4I A;  3EMR A;  1JW6 A;  1CGP A;  5FY1 A;  5FRE A;  1FV3 A;  1Q43 A;  2I74 A;  4O7X A;  4YGC A;  3ATG A;  4YZ2 A;  3LDR A;  1XJA A;  1LAJ A;  1PK6 C;  3MIH A;  4EZ4 A;  3ETP A;  3A0K A;  4NAM A;  4XFF A;  4PLO A;  4YLZ A;  4AFC A;  5FPU A;  4LBM A;  2JDU A;  4TZD A;  2XVL A;  4EN9 B;  3FFZ A;  3CJI A;  3WR0 A;  2FBE A;  3Q9O A;  3ES1 A;  4NR1 A;  3VBH B;  4CCN A;  3TEX A;  5KC6 A;  2B9U A;  4XZP A;  1MEC 3;  2J1A A;  4ES9 A;  3OBT A;  4XF3 A;  3TEZ A;  3VBF B;  3N3H A;  1YFW A;  5C3Q A;  3KVA A;  1UKR A;  4RHV 1;  4NRP A;  2WBK A;  3AM2 A;  3RZK A;  3C2U A;  4LJH A;  2XL7 A;  1WGP A;  5LB6 A;  1UX6 A;  3IPV A;  1E57 A;  1I5P A;  1N1S A;  3GZE A;  3WF0 A;  4I0W B;  1W8O A;  2XVK A;  2HEY F;  2NMO A;  2ZBJ A;  3CZU A;  3J7N A;  4A6O A;  2H0B A;  3FHA A;  4PBP A;  1WMD A;  2YHJ A;  4L99 A;  5JR2 A;  2QQP A;  4HON A;  2BNN A;  1U0A A;  1COV 3;  2JG8 A;  4S2G A;  1LTE A;  4LKS A;  1D2S A;  1NA1 A;  3OYW B;  5FYV A;  4I09 A;  3ILN A;  5I0D A;  1O3T A;  1UY3 A;  3ORJ A;  2B46 X;  1RXF A;  1ZA4 A;  2LRO A;  1J59 A;  4XET A;  5A7O A;  3JXS A;  1MS5 A;  1GV9 A;  3WHU A;  4XQW A;  1CWP A;  4CXW A;  1RUG 3;  1YCI A;  4MYE A;  3NWK A;  4QHB A;  4AR2 A;  1UMH A;  1W3V A;  3V0A B;  4KBZ A;  2A6W A;  5FPL A;  4FQZ A;  2X09 A;  4LIT A;  2VW0 A;  2AEZ A;  1EAH 3;  3AMQ A;  1AJO A;  3SH4 A;  1H2N A;  3WQ0 A;  3D0J A;  1RXG A;  1S2E A;  3N7J A;  5JMC A;  1F5F A;  1UZY A;  1X7N A;  2Y6G A;  1LES A;  4QPI B;  2ZX3 A;  4XXA A;  3T09 A;  3GHM A;  4CEW B;  5FMO S;  4DNY A;  3H0O A;  3H8X A;  2WYS A;  4GMP 1;  1ZBE 2;  4XAB A;  3D82 A;  3BIW E;  4JDN A;  4EWA A;  5FY9 A;  1LB2 A;  2LW8 A;  3LB9 A;  1AJK A;  1ZRR A;  4QB1 A;  1W6P B;  4OQ8 A;  4KNC A;  4HVQ A;  5J98 B;  1AR8 2;  1JXN A;  3B69 A;  3VD3 A;  1BBT 1;  1DP0 A;  1LEC A;  1S0G A;  4KBB A;  1JYT A;  1JYC A;  2BTV C;  2PHR A;  1PGW 1;  2UY8 A;  3PVE A;  4M3C B;  3ZFG A;  2E7T A;  2XUE A;  1VLN A;  2QQI A;  3FBY A;  5JAX A;  1XBF A;  1R08 3;  2AUY A;  5FY8 A;  1W9T A;  2JD9 A;  2DWR A;  4FPH A;  1FI2 A;  4XHB A;  4N9H A;  1RMU 2;  2ETE A;  4OI4 A;  4QX2 A;  1UW8 A;  3POF A;  3I3Q A;  4H3W A;  3HOB A;  5JOW A;  4XUQ A;  3VBO B;  4EWD A;  1R09 3;  3MLJ A;  5JSO A;  4BE3 A;  5K4L A;  4CE8 A;  5FZM A;  5FZI A;  1XE0 A;  5E6H A;  2YYO A;  4N53 B;  3S57 A;  5EV7 A;  4ZU5 A;  1CZV A;  4P9J A;  5FUI A;  1NX9 A;  3MV0 1;  3LA7 A;  1W6Q A;  1GQP A;  2YPJ A;  3MLK A;  5I8T A;  5A7W A;  4MSV A;  3HWJ A;  5JUV A;  1IPS A;  2Y34 A;  4LHL A;  1B35 C;  3PVO A;  5T5J A;  5LCW L;  3MV1 1;  4LO4 B;  4PLN A;  1TNF A;  1NCR C;  5T5L A;  2HWB 3;  4AVS A;  5IHR A;  3EHK A;  4IEV A;  1VAL A;  3T2O A;  1IKP A;  3WP5 A;  3BIE A;  4I0A A;  1PZ9 A;  3GJB A;  1K5M B;  3P3P A;  5FY0 A;  2G9Z A;  3WSO A;  1NLS A;  1ZZB A;  4QPG C;  4UAP A;  4Y1Y A;  1TG7 A;  5DN2 A;  5K0U B;  2WFF 1;  2VU9 A;  3QOP A;  1W8U A;  4AED B;  2VCA A;  3AYD A;  5IK7 A;  3W5M A;  2PHU A;  5CFD C;  1AR7 3;  2BFU L;  4A45 A;  1PO1 2;  2JEC A;  3TBD A;  3NNL A;  4W6X A;  2IXH A;  2D3S A;  1WKY A;  3W58 A;  5IT6 A;  3SCG A;  1J1L A;  5GM0 A;  2WZ8 A;  3RZZ A;  2BFU S;  3HD8 B;  2EAK A;  2Z4F A;  4QX7 A;  1CON A;  1PO2 2;  3SIS A;  2W91 A;  2QTW B;  2RM2 1;  3IAP A;  4K8F A;  4WM8 A;  1ULD A;  2P3J A;  4AHW A;  1H1A A;  2PQS A;  2YGM A;  4IV1 C;  2W5F A;  4Y26 A;  3OG2 A;  1DBN A;  3ACI A;  1Z7S 2;  3KVB A;  3NW4 A;  4HT1 T;  3KV5 A;  5KHK A;  2VQU A;  3AXD A;  4W4Z A;  4Z92 B;  1H8V A;  1FMD 3;  1CVN A;  4GKX A;  4YGB A;  2DTY A;  1J1T A;  3JUU A;  4R52 A;  1OOP B;  4Y20 B;  1WUV A;  1FOD 3;  4YVW B;  3NNG A;  4YW4 A;  1BK1 A;  1A78 A;  1B35 A;  2F4P A;  2JE8 A;  3IMN A;  3IZO A;  2ZXQ A;  1MS1 A;  2E6V A;  3POJ A;  4A2U A;  3UES A;  4AHZ A;  4FPK A;  5JXJ A;  5H9S A;  4AK3 A;  4QMA A;  3CKH A;  2D5F A;  1W9Y A;  1SPP B;  3H1Y A;  1QOS A;  3HQU A;  4FPG A;  3BTY A;  1M4W A;  1KS5 A;  2JDZ A;  4IEO A;  2VBB A;  2VY0 A;  1UU5 A;  4KG0 A;  4LK6 A;  4COW A;  5FV3 A;  4X6Q B;  1ZRD A;  2XJS A;  4IEW A;  4ARX A;  2GP3 A;  3E5X A;  2WC2 A;  1ZVF A;  2IXK A;  4QPG A;  1VAM A;  1DFQ A;  3BPZ A;  3WP6 A;  2RDR A;  5LEJ A;  1T2X A;  3CF6 E;  3KCY A;  4FOQ A;  4Q4W 3;  4PCR A;  5CZK A;  5F2S A;  3T0A A;  5C8W A;  2VZ3 A;  4TTG A;  5CFD A;  2WNV A;  3IKW A;  4NAO A;  1W2A X;  2RJK A;  4L8Q A;  5SV8 A;  2K46 A;  4N7I A;  1RYY A;  2G4I A;  3B93 A;  3G6J B;  4XEZ A;  4AWD A;  4MV2 A;  3WF2 A;  1VRH 2;  1YXW A;  2JE9 A;  5LZ6 A;  2LRP A;  3I2D A;  2YXS A;  1MEC 2;  2R06 2;  4L11 A;  3SEP A;  2ZGQ A;  3Q8F A;  3Q8E A;  4DZG A;  3OGS A;  4M4P A;  1H8T B;  1VJ2 A;  4JGZ C;  3WW1 A;  3J8F 3;  2YC4 A;  2QQJ A;  4MX3 A;  4XIL A;  5FLH A;  1QXJ A;  5LRS A;  3A0N A;  1VBE 1;  3E1F 1;  3WNP A;  2A70 A;  5A7N A;  4C0H A;  1NKG A;  4HSJ A;  2HWC 3;  3ZSJ A;  1VPH A;  3KM5 A;  4KQ7 A;  1SMV A;  2WO2 A;  3QH7 A;  4IV3 C;  1NXD 1;  2IXC A;  3LAG A;  1COV 2;  3JQX A;  4QQL A;  3AVR A;  1E5S A;  2ARB A;  5JMO A;  5C9A B;  1JZ2 A;  3FN9 A;  1QJU 3;  2ZKN A;  3AKT A;  2DCT A;  1LOG A;  3IIA A;  3SC7 X;  1N3P A;  4HZF A;  5CAD A;  4LUM A;  3ILR A;  3VZM A;  4NN0 A;  2WZP P;  3I3M A;  1BEV 3;  2OA2 A;  2RVA A;  3ZN4 A;  2Q1M A;  4Q5O A;  5A32 B;  1TME 2;  1CIW A;  2MEV 3;  1O4Y A;  4ATF A;  1LJ7 A;  3CHX A;  4QKB A;  4DQA A;  1QXP A;  2EIC A;  4EN7 B;  1EAH 2;  5JSP A;  1VBB 3;  1XND A;  2W87 A;  5A33 A;  3WW2 A;  3ZYI B;  4H55 A;  4E4Z A;  2XWJ B;  1W03 A;  4CDU C;  2EXI A;  1SFY A;  5J48 A;  2D3R A;  2GAL A;  1SBE A;  5CA6 A;  2FZ2 A;  3OYW A;  3NMB A;  2YBS A;  3AZW A;  2C0Z A;  1BXH A;  3I59 B;  2FQP A;  4HVR A;  1GQG A;  1R1A 3;  4F3J A;  1RMU 1;  2B8M A;  4JGZ A;  4LUL A;  1ASJ 3;  3C7F A;  2VZR A;  4LKD A;  4NOT A;  2DCJ A;  5LEK A;  1C8M 1;  1IOA A;  1GZT A;  4NJ4 A;  5L73 A;  3GM8 A;  1QY4 A;  3AZX A;  2VMG A;  1SDW A;  5D2A A;  4ERO A;  5BNN B;  2J1R A;  4RYD A;  3P5B A;  5AVA A;  4CCO A;  4CP2 A;  2C26 A;  2A6Z A;  4DXR A;  2WNE A;  4ISQ A;  4Q4V 3;  1GNH A;  2O14 A;  3ME2 A;  1R08 2;  3EXU A;  4GZ9 A;  3ZXJ A;  4WBB A;  3LA3 A;  4NID A;  1JYN A;  4CEW A;  2BEO A;  1ND2 B;  1UWW A;  3ZYR A;  5EJ3 A;  4BCU A;  5F3C A;  3MW3 A;  4JTN A;  3W21 A;  4FAH A;  5JVV A;  2VOV A;  1LRH A;  5CB7 A;  3T2Q A;  4XF4 A;  1X8M A;  2JJ6 A;  3T0B A;  5JSR A;  2A3X A;  3LEG A;  4BK5 A;  2IXI A;  1LOD A;  4E27 A;  2ORZ A;  4QX3 A;  2ZGT A;  4G3Y C;  2JIC A;  3AX4 A;  3FUQ A;  3OOX A;  4JKL A;  4YGD A;  3WDU A;  2NN8 A;  4D69 A;  3TEY A;  4XBN A;  3MUY 1;  1O7F A;  1EV1 2;  1L7L A;  3K4D A;  1VBC 2;  2GMM A;  4KH9 A;  4A7Y A;  2WFP A;  2C24 A;  3E6D A;  5CKM A;  4XUO A;  4CRQ A;  1D4M 2;  4M3C A;  2HWE 1;  4GWI A;  3MEP A;  3OPW A;  1PO1 1;  1YJL A;  3NL1 A;  2CGP A;  4L2N A;  2JDP A;  4Y22 A;  3DXU A;  4YW2 A;  2OZJ A;  2HWB 2;  2ZAC A;  1WW4 A;  3B5L B;  1UKG A;  2WQ8 A;  2D6K A;  5FYU A;  3URF A;  1WCK A;  1RUD 1;  5FZO B;  5B2G B;  2VNG A;  1OH4 A;  2J1T A;  4JKM A;  1JYW A;  4UXA A;  1AYN 2;  4UW3 A;  2ZGL A;  1AR6 3;  1GLH A;  1ONA A;  2BNM A;  1Y9M A;  1LU1 A;  2ES3 A;  2ZCW A;  3OBA A;  1Z7S 1;  1V00 A;  2VTX A;  1LHN A;  3WY6 A;  3MIB A;  4AGV A;  4XFG A;  3RDI A;  4XJA A;  1JZ8 A;  1AR7 2;  2DVB A;  2PFW A;  3KWV A;  1AXY A;  3ENR A;  2YY1 A;  1LKN A;  3RI9 A;  3PLQ A;  4Y3O A;  2D6O X;  3AYC A;  1SBD A;  2FDI A;  3KGL A;  4QQ2 A;  2PHX A;  5C8C C;  1UIJ A;  2BGP A;  3ZXD A;  1XYO A;  1WBL A;  2FZ1 A;  4RQP C;  3WG3 A;  5EHD A;  1DYK A;  4CA9 A;  1UY4 A;  3KZ4 C;  4IEX A;  1K5M A;  4FBF A;  3MUZ 1;  1UOB A;  4NHL A;  1W2O A;  3DCQ A;  3N36 A;  5E89 A;  1LCL A;  1FMD 2;  5K0U A;  4QXC A;  1OF3 A;  4IEY A;  5BXX A;  2XLF A;  2R7E B;  5DAP A;  1FOD 2;  3H3L A;  4IE5 A;  2R07 1;  1ZBA 3;  4UT5 A;  3PUQ A;  2W46 A;  4N43 C;  3OGR A;  1HV1 A;  4ATE A;  3ZFE A;  1YUD A;  2QJV A;  1VRH 1;  3VD5 A;  1UPS A;  1YQ8 A;  5APA A;  2RS1 1;  5FYM A;  2R06 1;  1OBN A;  2RDS A;  3H3Z A;  4IUG A;  5KHJ A;  3THC A;  1K5J A;  5IUQ A;  2Y6H A;  1MZE A;  3W20 A;  2JDK A;  3BOW A;  4K7J A;  5FCC A;  1PM4 A;  5C71 A;  2XUM A;  2XJQ A;  1H1M A;  4QU1 A;  4Q4W 2;  1RVF 2;  4XBQ A;  2RS5 3;  4OHV A;  1AR9 3;  5IFP A;  1BMV 1;  4Y1Z A;  2BBV A;  2GC2 A;  4AHY A;  1IZ3 A;  1OOP A;  2D5H A;  2OUH A;  2IXL A;  3K2O A;  4Y20 A;  2VJX A;  1J83 A;  2CGN A;  2WAO A;  3WNX A;  1Q3E A;  3RGB A;  3K3N A;  2BRT A;  3NV4 A;  2A5Z A;  1XE8 A;  2WS9 3;  2R04 3;  2CNA A;  5FY5 A;  1STM A;  1JN2 P;  5BNP B;  5ACA 3;  5IFT A;  1O8S A;  3DEC A;  4RQP A;  1WLT A;  1N3Q A;  2A1X A;  1H9W A;  1XB9 A;  3I3B A;  4MHR A;  4YW5 A;  2WT2 A;  2UU8 A;  3H7J A;  4Q2F A;  5F39 A;  1CQ9 A;  1RHI 2;  1TME 1;  2HWC 2;  2XR4 A;  1FNZ A;  3OGG A;  4HK8 A;  5JXI A;  4CU9 A;  4OUE A;  4XOG A;  2ZGN A;  3CNA A;  4OMD A;  1G8W A;  2CTV A;  4CXY A;  4Q4Y 2;  2BP6 A;  1MVQ A;  1QJU 2;  2BJS A;  1JUH A;  2Q4S A;  4RGK A;  5DAQ A;  1PMJ X;  1W9F A;  4P9X A;  1RJ7 A;  4QHZ A;  1UYP A;  5FZG A;  5LY2 A;  1TMF 3;  3DPR C;  1H30 A;  2WZR 3;  2WII B;  4YSF A;  1H8T A;  3ZOI A;  3C7O A;  1ZZC A;  2W52 A;  5FP8 A;  4CUG A;  2QQO A;  3ALQ A;  5F37 A;  2BPA 2;  4COY A;  1IS3 A;  1W2U A;  4GH4 C;  5I93 A;  2Z5W A;  1YLL A;  3KF3 A;  3LGR A;  1W28 A;  2L9L A;  3VV1 A;  1IHM A;  2XVG A;  3FJS A;  3KV6 A;  1DZT A;  4AEM A;  4YG0 A;  1WZX A;  1VBB 2;  1ZRI A;  3ES4 A;  4FI9 A;  2RG4 A;  3TAY A;  1W8T A;  4IW3 A;  4CUC A;  3DYP A;  5GLT A;  3R6S A;  4UFM A;  2VUJ A;  1O59 A;  1UY1 A;  2ZGM A;  3VBU C;  2D6M A;  5KWR A;  5LBE A;  3ZLI A;  5C4W C;  2TEP A;  3HMY A;  1ND3 C;  1JOP A;  3GCX A;  4HET A;  5IAT A;  3PVB B;  2QDN A;  1R1A 2;  2AC1 A;  3HNB M;  4LBQ D;  3UJQ A;  1LGB A;  3JB4 C;  3D5O A;  3UT0 A;  4CDW C;  1QOT A;  4YM3 A;  1S1A A;  3M3C A;  1VE0 A;  4E4H A;  1PGL 2;  2G9G A;  2ILM A;  4XPV A;  4Z8B A;  4QDQ A;  2X5I A;  2RR1 3;  2WWU A;  2W08 A;  3M70 A;  1EV1 1;  4YZ3 A;  1DQ0 A;  1VBC 1;  3UV9 A;  4Q1R A;  1S0J A;  2W92 A;  1WW6 A;  2ZMK A;  3OPZ A;  4Q4V 2;  4B3N A;  5FLJ A;  1D4M 1;  4MVT A;  5F5C A;  4QQO A;  1G9C A;  3CIH A;  2Q8O A;  5FP9 A;  2DF7 A;  3VLB B;  3VKF C;  3OPT A;  4AAX A;  4AW7 A;  4MZU A;  2HWB 1;  4HLT A;  4MGY E;  3POI A;  3SH5 A;  4CEY C;  3BN6 A;  5EPA A;  5DG1 A;  4K6B A;  1JS9 A;  4GH4 A;  2E26 A;  4TN7 A;  1AYN 1;  2X10 A;  4FPL A;  4E8D A;  1UX7 A;  2ZMN A;  2VZU A;  2VMD A;  5BNN A;  2FDG A;  4UBG A;  4LLF A;  4DS0 A;  4IES A;  5DUX A;  4YAR A;  2WNU B;  3GBW A;  1F4H A;  4QGM A;  4B8E A;  2GNB A;  1AYM 3;  1QJF A;  4R4Z A;  5LRR A;  2VME A;  1ND2 A;  4PF1 A;  1ND3 A;  4KWK A;  4U36 A;  4GA9 A;  4PBO A;  1RUJ 1;  3KHB A;  5C7G A;  2ZPX A;  2H6B A;  3U0Z A;  4WM7 C;  1U5X A;  1GBG A;  5EQU A;  4L92 A;  1WWY A;  2Z79 A;  4YG6 A;  5DUV A;  2GAU A;  1F5J A;  5JZG A;  3III A;  3CMG A;  3DUI A;  3K51 A;  2O8O A;  4IXL A;  4RS5 C;  5L7O B;  1AR6 2;  1GWM A;  3HQR A;  3NNJ A;  2Y6F A;  2VBP A;  3FHQ A;  1W9S A;  3WDV A;  3ZYJ B;  4MAD A;  2ZHK A;  3TNQ A;  3PVN A;  3HIF A;  5ERL A;  4EN8 B;  5FO7 B;  5IK8 A;  1YQ5 A;  1NE4 A;  1C5H A;  2PHL A;  3K4A A;  3M3E A;  2PYT A;  1QWR A;  2XJV A;  1XU2 A;  4XCA A;  3UKT A;  5FMD A;  3VBS A;  4AOC A;  1NLR A;  4UW6 A;  2Y64 A;  2YPD A;  4XAA A;  2ID4 A;  4AE2 A;  5L19 A;  1JOB A;  1W0P A;  4ONU A;  4LOT A;  2UWC A;  4YFZ A;  1ULC A;  2VUD A;  5FR3 A;  3KS7 A;  1ULG A;  2W39 A;  4IGO A;  5T52 A;  5A6Z A;  5CFC C;  2JIG A;  1I5Z A;  2J7M A;  3AL6 A;  4IEQ A;  5FZO A;  1WME A;  1OFS A;  2E31 A;  3H1W A;  1RB8 G;  4CP9 B;  1US3 A;  5FPA A;  5JDB A;  1BCX A;  3CEW A;  3UJO A;  1O5L A;  2V72 A;  1IQA A;  1JOJ A;  1DQ6 A;  5KHH A;  3OF1 A;  2WNO A;  2WR9 A;  1SZB A;  2JG9 B;  4DFS A;  4H7M A;  5FKB A;  3LFM A;  2V73 A;  1RVF 1;  2R30 A;  2YC0 A;  1HXS 2;  5LA2 A;  3VZJ A;  1ZBA 2;  2WAA A;  1E5R A;  4XTP A;  1CD3 G;  1HB4 A;  2HWF 1;  4XUN A;  1V6N A;  5FYI A;  2MNG A;  4WZC A;  3I2I A;  3M4F A;  5IVC A;  5L36 A;  2IFW A;  1CAU B;  3I3E A;  3RYR A;  2ZX0 A;  3ACL A;  2OXB A;  2WKK A;  2CDO A;  4MOA A;  1K45 A;  3SNM A;  4DOU A;  3MGU A;  1OD3 A;  3UKV A;  4JTO A;  1IS5 A;  3JZV A;  3ZXF A;  4ORF A;  4PI2 A;  4ZXK A;  2EF6 A;  4PLM A;  2TNF A;  2FDJ A;  4P5H A;  3BTX A;  3B00 A;  4D6R A;  4ZS2 A;  1PHM A;  4IEZ A;  2QCS B;  5FXX A;  3VBR B;  5FP4 A;  1VRB A;  5F6L B;  5FUN A;  1AR9 2;  1H4H A;  1RHI 1;  3FX3 A;  4FO9 A;  3HAG A;  4JCK A;  2HWC 1;  3ACG A;  3CQO A;  4DUV A;  3DF0 A;  5A1L A;  1I1E A;  1DYP A;  4UW4 A;  4XFI A;  3ST7 A;  4JGY C;  2XHN A;  4Q4Y 1;  2XWB B;  1RUC 2;  3ACF A;  1BYH A;  4D8M A;  5JWP A;  2NMN A;  2WS9 2;  3EO6 A;  2WL1 A;  4WZF A;  4ZON A;  3W9A A;  2R04 2;  1V9U 2;  2BZD A;  1D2Q A;  2ZEZ A;  2RMU 2;  3BB6 A;  3POW A;  4NRO A;  2EAL A;  2B42 B;  1X8E A;  4XUT A;  5FFO C;  5FY4 A;  4BLI A;  5ACA 2;  2CYF A;  5J37 A;  4OHZ A;  3MO4 A;  4AQS A;  3POB A;  3DL3 A;  4HPK A;  4W6Y A;  1BQP A;  3VKL A;  5H9P A;  5BUV A;  3CZJ A;  2HLE A;  1QJY 3;  4XDQ A;  3FE5 A;  5D21 A;  1HDK A;  2VD7 A;  1BLZ A;  4HAN A;  1HRV 1;  1LNS A;  2VO5 A;  3VL8 A;  3WNN A;  3KT7 A;  3ON7 A;  2JG8 C;  2VZQ A;  1FPN 3;  3AP9 A;  3HT2 A;  4O9G A;  4DXT A;  3CBN A;  2AH2 A;  3N7K A;  1WCD J;  2VL4 A;  2Y0O A;  4Y5T A;  1XOY A;  4YM2 A;  3ZO0 B;  3NNF A;  1SLB A;  1TMF 2;  1V70 A;  2WZR 2;  1OLR A;  2BOI A;  5JIA A;  1SLL A;  1Y9G A;  4G4F A;  4QKF A;  2JIJ A;  4LOS A;  1VBA 3;  2NM1 A;  1YFX A;  2JEN A;  4W50 A;  5DDJ 3;  4CDX C;  2WN3 A;  5BV6 A;  4IEP A;  1S0D A;  1PGL 1;  2FCT A;  5EJ1 B;  1JZ3 A;  2F17 A;  3M3O A;  5JOZ A;  1XYP A;  4QXH A;  5EYX A;  2KD7 A;  1D0H A;  2ZGO A;  1F4A A;  1OVS A;  4GQ7 A;  4FTE A;  3CL1 A;  3H1M A;  4ASL A;  4TLF A;  4XIO A;  2IFR A;  3LWC A;  2PLV 2;  2D6L X;  3ZFF B;  1NQD A;  4JGY A;  4Q4V 1;  5C3O A;  4FTB A;  1REF A;  1HLC A;  1LUL A;  2P3Y A;  1WA6 X;  2KA3 A;  4CU7 A;  3KMH A;  5HPO A;  2A6X A;  1RC6 A;  1OUR A;  2WT0 A;  3HEI A;  5BNO B;  3MF9 A;  3ZSL A;  2Q5T A;  5D1I A;  3NAP A;  4JVA A;  4S2D A;  2RR1 2;  3B01 A;  3L2Y A;  5CG8 A;  4XCB A;  4B29 A;  5FY7 A;  4C91 A;  4AFD A;  1SQ4 A;  5ISL A;  3LCP A;  4BHP A;  2ZAB A;  1GNZ A;  3BVC A;  4JRL A;  3ZFG C;  1OUX A;  2PXJ A;  5FDB A;  3PUS A;  4QGN A;  3S5Q A;  1Q5O A;  2GDF A;  4UFL A;  4GIQ A;  4XUR A;  4LUK A;  2ENR A;  3TWI A;  4GB3 2;  3H7Y A;  3ITQ A;  3PUA A;  3POY A;  1ZZ8 A;  1YO8 A;  3KT1 A;  2E53 A;  5CKQ A;  5KXE A;  5IVJ A;  2BGC A;  2PHF A;  3HBK A;  3KQ4 B;  3A23 A;  2DVA A;  4WVV A;  4CDX A;  1O4Z A;  3K77 A;  1NZI A;  3UGG A;  1EUU A;  1UMI A;  4R9C A;  2CU5 A;  4NWV A;  3OJB A;  5FMO L;  3A4U A;  1O91 A;  2GN3 A;  2JDA A;  1MQT B;  3I2F A;  1IG0 A;  3VHP A;  1WA4 A;  1RUF 3;  4NRM A;  3AP5 A;  3C7E A;  1AYM 2;  4NUB A;  2XH6 A;  1UYX A;  4EQV A;  3JD7 3;  4LBJ A;  5A6X A;  3O1P A;  4GMP 0;  4GWN A;  1MS3 A;  3CDZ B;  3U75 A;  4UFJ A;  3SKJ E;  4ASM B;  4CCL A;  2WQ4 A;  3FZ3 A;  3I2K A;  5GKA C;  1YWK A;  2FMY A;  4DIN B;  4FOV A;  2P6H A;  3NJV A;  3QBQ A;  4QPY A;  1OH3 A;  3USU A;  1I9R A;  4DUX A;  3WG2 A;  4D0Q A;  2FCV A;  4PT6 A;  4XHX A;  1W6N B;  4IE6 A;  2PAK A;  1JU4 A;  3T3Y A;  4AVB A;  1C8N A;  1GOG A;  5JXG A;  3ZN6 B;  1O3R A;  3TN9 1;  5CG9 A;  1UIK A;  1N1T A;  4GUL A;  2QKD A;  3TRS B;  1HXS 1;  2CHH A;  3JQW A;  4YW3 A;  5DUW A;  1VBD 3;  1WD3 A;  1VB2 A;  4CVU A;  5LK7 B;  4YYO A;  4BK4 A;  5A3M A;  4EN6 B;  4MGT A;  4XFC A;  5JOY A;  3K48 A;  2XG3 A;  1GOH A;  2CL2 A;  4LKE A;  1O8P A;  2ZGU A;  1S0C A;  2WLP A;  5C70 A;  4PQ9 A;  1NG0 A;  1VMF A;  2IWG B;  2XBO 3;  4HKO A;  4I30 A;  4WM8 C;  5HXV A;  3VDD B;  3USS A;  1ZRC A;  2H0V A;  2ZS6 B;  1Y7B A;  4EJR A;  4LHN A;  2GSY A;  5I91 A;  4XE9 A;  5L7O A;  3AYE A;  5C5U A;  3MPP G;  3IDC B;  4IQP A;  2D43 A;  2EIG A;  2GN7 A;  3D6E A;  1PVC 1;  1MAC A;  4Z2A A;  1HB2 A;  3OGV A;  4AHX A;  4I3G A;  4I3P A;  5FXZ A;  4YVS B;  4LBO A;  1QJX 3;  1Y4W A;  5FYS A;  1G6N A;  1OMI A;  2YMZ A;  5L9V A;  5DQ0 A;  2D44 A;  1QOO A;  3ZYP A;  1AL2 1;  2QNK A;  3HN3 A;  3X29 B;  3RVH A;  2BVV A;  1RUC 1;  1BKZ A;  2G9F A;  4K21 A;  4BQ1 A;  4DXZ A;  1W8F A;  2XHK A;  3KGZ A;  4LKF A;  4EN0 A;  3KCC A;  2Z69 A;  1V9U 1;  1ZA7 A;  2RMU 1;  1RUN A;  1V6I A;  4K1Y A;  2BYV E;  2ADD A;  4CP9 A;  2VG9 A;  1POV 1;  2Y60 A;  2HJI A;  2AYH A;  4BIO A;  4N8M A;  5EXO A;  1ODN A;  2JG9 A;  3BTZ A;  2G1M A;  1QQP 2;  3K4Z A;  3TOJ A;  5F3I A;  2WNV C;  4PDW B;  3JBG 2;  2GU9 A;  3LD8 A;  3ZSM A;  1HRI 3;  2RS3 2;  2GC3 A;  5AC9 3;  3E5Q A;  4RFT 0;  2Q8E A;  2YFU A;  2SBA A;  1Q8V A;  4GWM A;  4JRA A;  4XYX A;  2OT7 A;  2ZML A;  4ZS3 A;  1B09 A;  4DXS A;  5SV5 A;  5FBZ A;  3WIN E;  4R9B A;  1GNY A;  1MS0 A;  4B1M A;  5A6Y A;  3C3V A;  1QJY 2;  4QKN A;  2VCC A;  2I45 A;  3VBR A;  3KV4 A;  5FZ4 A;  4Q8K A;  3UGF A;  2WT1 A;  4BPZ A;  3EQE A;  2AAC A;  1JMU B;  3B3Q E;  5GZF A;  2OS2 A;  4K1Z A;  3NNM A;  4ZZ8 A;  2R1D A;  2PLV 1;  2JDM A;  2YZ4 A;  4FVV A;  3VDC A;  2EVX A;  2HWD 2;  3VBF C;  2R1B A;  1TZO A;  2R6Q A;  4HVO A;  4JZR A;  3WOG A;  5ABJ B;  5HI0 A;  3N7M A;  2VZO A;  3ZXE A;  3UNP A;  4KU7 A;  1F35 A;  5CYY A;  5A80 A;  3RMX A;  4YFW A;  4LA2 A;  3RPQ A;  4CSW A;  5IYY A;  2B45 X;  5FLI A;  3N9P A;  3BCW A;  3OY8 B;  1OA4 A;  5FZH A;  1VAK A;  5FZ6 A;  3VZN A;  1KEX A;  2DUP A;  2P17 A;  2LM3 A;  1URX A;  1KDK A;  2VZS A;  2Y8K A;  4OQ9 A;  4YPJ A;  1ST8 A;  3JCI A;  3AZY A;  4QAW A;  1W6M A;  4WVZ A;  1DQ5 A;  2Y33 A;  1GZC A;  4M3C E;  1RUH 3;  5IW0 A;  2WUH A;  1W2T A;  2J1E A;  4K20 A;  3BKZ A;  3KD4 A;  5H9R A;  1NCQ B;  2VUC A;  4GB3 1;  3OUH A;  5GZC A;  2J1V A;  5FZF A;  1XNA A;  2YFZ A;  1SFN A;  4BXF A;  4B1L A;  3PTR B;  5FK7 A;  4E4S A;  4OFG A;  5IK4 A;  1TE1 B;  1VP6 A;  3V56 A;  5F7U A;  3IAQ A;  3MIE A;  5JXH A;  3AXE A;  4ZKT B;  1FT9 A;  1FAY A;  2VZV A;  4UWD A;  3U1X A;  4RFR B;  3B9C A;  3AKP A;  2ET7 A;  4M0H A;  4OI1 A;  4FPJ A;  1PIV 3;  3P6B A;  4HFS A;  1OHF A;  5E8A A;  3BU7 A;  4M0N A;  4M00 A;  4BQ2 A;  4OHY A;  3U14 A;  4FQ4 A;  1DYO A;  3ZFF A;  4L9B A;  1PX3 A;  3T4H B;  1OD5 A;  5T3N A;  1CAV B;  3VBH A;  4CEW C;  5A6Q A;  3RJ2 X;  4XAE A;  5IVE A;  3VBF A;  1WLW A;  1ENQ A;  5A3U A;  2XLA A;  1ZBE 1;  4OVE A;  4MO3 M;  4JAA A;  3THD A;  1RUG 2;  1L3J A;  5HCF A;  3MHZ A;  3J7M A;  5BNO A;  2Q1F A;  2W1W A;  5E1R A;  3WCS A;  2ZJC A;  1AR8 1;  1BK0 A;  1ZZ7 A;  4RGG A;  2BVB A;  4UBH A;  1RUE 3;  5GZE A;  2J1U A;  3O1V A;  4Z2W A;  2AEY A;  3ZXG A;  1T6G C;  3D4K A;  4UW5 A;  4FOY A;  2ARA A;  1WLD A;  5FYT A;  4BIS A;  5FZ3 A;  5A1F A;  5IAX A;  4HSL A;  4N90 A;  3RMY A;  3SMH A;  4DPN A;  3WCR A;  4WVM B;  5FZB A;  1HN1 A;  3NV1 A;  1YNA A;  3VBO C;  5LW9 A;  3A22 A;  5AFE A;  5FXV A;  4C0B A;  1RUI 3;  2GMP A;  2Q30 A;  2P1B A;  1CAW B;  5FBJ A;  5FPB A;  4NHM A;  5J96 B;  2W3J A;  3V0A A;  3AFK A;  4JX0 A;  4LBN A;  2W1U A;  5FZA A;  3OSD A;  5C6C A;  4Q4X 3;  3F2Z A;  4QD2 A;  2W2I A;  3S6P A;  4G9S B;  4YZ5 A;  2VZ1 A;  1CN1 A;  1MQT A;  3POE A;  3ROU A;  2E7Q A;  4D6Q A;  3T30 A;  1LED A;  5FXW A;  2VTF A;  1VBD 2;  2PHW A;  4BMB A;  5I0S A;  2B9V A;  4Q0U A;  4QPI A;  2EXJ A;  3H9A A;  4UI9 L;  4UF0 B;  2DCY A;  2EID A;  1W39 A;  2XBO 2;  1R09 2;  3PJY A;  1PX4 A;  4JC1 A;  1UMZ A;  1JZ5 A;  3QLQ A;  1JHJ A;  3VKO A;  2DVD A;  3BOD A;  4E4D X;  1W6P A;  3GJA A;  1K5M C;  4LBK A;  1GWL A;  2VVD A;  5K0U C;  3AKS A;  1W6N A;  2X8K A;  4AED C;  1W8W A;  3ZYG A;  1OA3 A;  3ZN6 A;  1W8Z A;  2O0O A;  1QQP 1;  4LE3 A;  4V2V A;  5DPN A;  4LNV A;  3RWN A;  5A7Q A;  3JBG 1;  3SH3 A;  1AF9 A;  1S4C A;  1OC1 A;  1DGW X;  4DUW A;  4URA A;  3ZFE C;  2W1S A;  4RHV 3;  2RS3 1;  4QPW A;  4KWU A;  3N9O A;  4CDW B;  4ZZ5 A;  4Q0S A;  4LT5 A;  3V65 A;  3I2G A;  4LO6 B;  4BM8 A;  1PO2 1;  3EB7 A;  3O0V A;  3WZ1 A;  3VBO A;  4DO0 A;  5I8S A;  3VDD A;  2OQ7 A;  2Z42 A;  4YG3 A;  3ZXL A;  2ZTN A;  2LAL A;  4I02 A;  4N53 A;  3BOP A;  4QKD A;  4AVV A;  4N9I A;  1JTZ X;  1ZYB A;  2JKX A;  2YBK A;  3PDQ A;  5I0T A;  5L9R A;  4XDO A;  3ZPO A;  4R9A A;  3HT1 A;  4IE7 A;  1O3S A;  4PHZ A;  2EIB A;  1CJD A;  1OOP C;  4MXV A;  1HRI 2;  3GCW A;  1GR3 A;  4QB6 A;  1RIN A;  1US2 A;  2XL9 A;  5IVF A;  1WCQ A;  2EIE A;  5AC9 2;  2DCK A;  3E5U A;  1CR7 A;  1NYW A;  2MHF A;  5GZG A;  3O1T A;  1LU2 A;  3ASI A;  1EY2 A;  1OUS A;  2HWD 1;  2WN2 A;  1O4T A;  2HKX A;  4AQ6 A;  4BOW A;  3AP4 A;  5FZD A;  3AYA A;  3AMM A;  1WW5 A;  3CJX A;  3WXP A;  1W05 A;  1UQX A;  4FSJ A;  3LEM A;  3CU7 A;  4IL7 A;  5HCA A;  4XQ4 A;  5J09 A;  2VH9 A;  4AED A;  5LBB A;  5HBA A;  2VZT A;  4PDW A;  4PIX A;  1F15 A;  1UU6 A;  2RE9 A;  1G7Y A;  4GMP 3;  4AFA A;  4Z07 A;  4NIA A;  3U10 A;  4AEK A;  2X05 A;  4GAL A;  3O1M A;  3KLS A;  2CSG A;  2VMC A;  5CVR A;  4A44 A;  2R49 A;  1GFF 2;  3O14 A;  5D8A B;  4YW6 A;  1DHK B;  2XQX A;  3IDE A;  4QU2 A;  1MEC 1;  5T5P A;  1Q8P A;  4Q1P A;  4WM7 B;  4QWN A;  1H8T C;  2Y6J A;  3FBM A;  3WDW A;  2WWS A;  4A7K A;  4DMI A;  4CUA A;  5BNQ A;  5FOB B;  4OCT A;  2DCZ A;  4A41 A;  1BBT 3;  4DEQ A;  2HBT A;  1LHV A;  4XMI A;  4FXG B;  4X6R B;  5FZC A;  1AHS A;  5FJK A;  3ZMO A;  4XTM A;  5F8P A;  2VQT A;  4LEJ A;  2FCU A;  3GZT B;  3T0D A;  1XXN A;  4FPO B;  1MR5 A;  1FYU A;  1XC6 A;  4S2H A;  4X8N A;  4OUM A;  4YVW A;  2PEL A;  4EWE A;  5G04 L;  1COV 1;  1W0O A;  5C9A C;  1V0A A;  1CES A;  1ZRF A;  4NII A;  2BER A;  1RUH 2;  3L9J T;  1SPP A;  2R0H A;  4ITC A;  4ARY A;  3MIC A;  3VD9 A;  1UPI A;  1PMI A;  4YZ1 A;  5A70 A;  4KWL A;  4LIV A;  3J8F 2;  4RR3 B;  3PU8 A;  1CZT A;  3KQR A;  1OQE A;  3I7D A;  3I2H A;  4GKY A;  1W90 A;  4YNI A;  2EA7 A;  1RUG 1;  4HK9 A;  2ATF A;  2I2S A;  1BJQ A;  2X5I C;  3C7G A;  4OI2 A;  4PIY A;  2FDF A;  2DBI A;  5CAZ A;  5F9T A;  5DZG A;  5LBC A;  4BXS V;  1UY0 A;  4ZU4 A;  3FFQ A;  1RIT A;  4D94 A;  1PIV 2;  4PQQ A;  4F83 A;  1EAH 1;  2GC1 A;  2ZOE B;  3H42 B;  4NO4 A;  4CCM A;  3IT8 A;  4WV8 A;  3VZL A;  2W1Q A;  1GZW B;  2E9Q A;  2FMD A;  5HCB A;  1LHU A;  1I3H A;  1YEW A;  3ZIW A;  3ZR5 A;  4R8H A;  3THP A;  1LHW A;  3WX5 A;  1NCQ A;  3MID A;  4Y24 A;  3AJY A;  4NE9 A;  2QE3 A;  1BEV 2;  3OD4 A;  2WFF 3;  3OCP A;  3QD6 A;  5FJH A;  1IG3 A;  2HEW F;  4Q0V A;  5DAV A;  3WLU A;  2V4A A;  5C33 A;  2MEV 2;  4DRV A;  5EIY B;  3M1H A;  3PHM A;  4QM9 A;  3I49 A;  1J3Q A;  4LQR A;  1UOJ A;  3MBW A;  4LOR A;  1BVV A;  5BNN C;  3ZVX A;  4K9S A;  2WA3 A;  4BQY A;  1RUE 2;  5TSW A;  3CJI B;  4H14 A;  1DGW A;  5C3R A;  3F95 A;  1POQ A;  2MPF A;  3LDB A;  3GZU C;  3NJZ A;  5F5A A;  2F6B A;  4CDQ B;  1DU3 D;  3B7M A;  3C8X A;  5C9A A;  1YFY A;  4LHK A;  2RM2 3;  1R08 1;  2XLG A;  1ND2 C;  4BQ3 A;  3N9L A;  5F6K A;  1DZQ A;  1U5Y A;  1ENS A;  2VUL A;  2NQY A;  5JI7 A;  1ASJ 2;  4LO5 B;  4P9Y A;  2C9K A;  3AP6 A;  4URT A;  5FZ8 A;  3IPV B;  1C28 A;  2CY6 A;  2BUK A;  3RRD A;  3IBM A;  2UYA A;  3WUC A;  2XBO 1;  3PL0 A;  4LO8 A;  4CUB A;  4E2Q A;  1R09 1;  3NJX A;  5FPZ A;  4AYU A;  2VPV A;  4BJ0 A;  5JZG C;  1DQ1 A;  3ZM8 A;  5A32 A;  1OVP A;  1CPN A;  5J7M A;  2DYC A;  3AZZ A;  3ZKY A;  3WNO A;  4YM0 A;  4GXL A;  3N4M A;  1IPJ A;  4LK7 A;  4ZPI A;  1NA1 B;  2VCB A;  2Y6K A;  5JCT A;  3QH6 A;  3RZG A;  1H1I A;  1V6K A;  1JHN A;  3NO8 A;  2JB4 A;  3VBS C;  3I59 A;  2ARC A;  1UCX A;  2H6C A;  2OPW A;  3AC0 A;  3TNP B;  5FUP A;  4AQ2 A;  2DTW A;  4ES8 A;  2VVF A;  4AI3 A;  3V0B B;  1KIT A;  1R1Z A;  1UXX X;  1PK6 B;  4MGK E;  5KXC A;  1LEN A;  1PM7 A;  2CAU A;  4QXB A;  3BUC A;  1QIQ A;  4MHU A;  4O65 A;  2XB6 C;  4RGA A;  1CAW A;  3GDB A;  2QQU A;  3T08 A;  1QGL A;  5JOX A;  2GP5 A;  3AP7 A;  4AG4 A;  4YW7 A;  1AR7 1;  4LMF A;  1HX6 A;  4AVA A;  3H8O A;  1H2M A;  4HBN A;  1K12 A;  1OKO A;  1HRI 1;  3WNK A;  3VD4 A;  3OEB A;  1ZZ6 A;  2P4E A; 
#chains in the Genus database with same CATH homology
 3BTY A;  4CXY A;  3KHC A;  3H8X A;  3I2O A;  4ZS3 A;  4IE0 A;  4NII A;  3LFM A;  4QKN A;  4NIG A;  2FDH A;  3O1O A;  3O1U A;  2FDF A;  2FD8 A;  3RZM A;  3H8R A;  3T4V A;  2FDJ A;  4NRM A;  3BTX A;  4ZS2 A;  3O1P A;  3I3Q A;  2FDI A;  4NPM A;  2FDK A;  3S57 A;  4IE4 A;  4ZHN A;  3I49 A;  4O7X A;  4NRQ A;  3BIE A;  4NRO A;  4IE6 A;  3T3Y A;  3BU0 A;  3S5A A;  4QKD A;  3BKZ A;  3I3M A;  4IE5 A;  3O1R A;  4IE7 A;  4MG2 A;  4O61 A;  4MGT A;  4NPL A;  4QKB A;  3RZJ A;  4RFR B;  5DAB A;  3O1T A;  2FDG A;  4NRP A;  3RZK A;  3T4H B;  4QKF A;  3RZH A;  3RZG A;  4NJ4 A;  3KHB A;  4CXX A;  4NIH A;  3O1M A;  3BUC A;  4NID A;  3O1V A;  2IUW A;  3BI3 A;  3RZL A;  4IDZ A;  4CXW A;  3O1S A;  4OCT A;  3BTZ A;  4QHO A;  3H8O A;  5F8P A;  4JHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...