4NIGA

Crystal structure of alkb d135i/e136h mutant protein with cofactors bound to dsdna containing m6a/a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKIHPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 49
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nigA00
4CXWA 2FDJA 4NIIA 3I49A 4QKNA 4QHOA 4IE0A 3O1MA 3H8XA 3BU0A 4ZS2A 3H8OA 4NROA 2FDHA 3RZMA 4O61A 3T3YA 3RZLA 3LFMA 4CXXA 4ZHNA 4NIDA 3O1RA 3BUCA 4IE4A 3H8RA 4NPMA 3BI3A 3S57A 3O1VA 4IE6A 3BTYA 3I3MA 4ZS3A 3BTXA 4RFRB 3KHBA 2FDFA 4IDZA 3BTZA 4IE5A 3I2OA 4NRMA 4JHTA 4QKBA 3BIEA 4NRPA 4NJ4A 3RZHA 4IE7A 4MGTA 5F8PA 3BKZA 4NPLA 4NIGA 3T4HB 5DABA 3O1SA 3RZGA 3RZKA 4NRQA 4O7XA 3O1UA 2FDIA 4OCTA 4QKDA 3O1OA 3KHCA 2IUWA 3S5AA 2FD8A 3RZJA 4MG2A 4QKFA 3I3QA 4CXYA 2FDKA 2FDGA 3T4VA 3O1TA 4NIHA 3O1PA
chains in the Genus database with same CATH superfamily
1B35C 2FDJA 2JDZA 2BNOA 2WT2A 1MQTC 3D5OA 2VZQA 5FZBA 4XIOA 5FOJB 2G9GA 2YFZA 1A3KA 3E97A 3NKTA 4Q4V2 4CXXA 5C8CA 2WZR1 2OZJA 4NWVA 2WNUC 3ES1A 3I8TA 1ZRDA 3ZN5A 4TN7A 4NMIA 3KHBA 5HCHA 2WZR2 2Y33A 3BPZA 4H55A 4N53B 1US2A 2RS52 2QQNA 5LK7B 2H6BA 1O4ZA 2DCTA 3M7AA 3O1UA 1V6MA 4KU8A 2RS51 4IGOA 2YXSA 5J96B 4KI5M 2QQUA 1YFWA 2J1UA 1UOBA 1BBT2 2RS31 2CHHA 3ZXAC 4COWA 4LTAA 3ROUA 3UK9A 3I2DA 3VHNA 1ZX5A 4LBOA 5I0TA 4B8EA 4CCDA 5DN2A 3VD3A 4YZ4A 4YW3A 3WP5A 1SPPA 4PBPA 2K46A 3MW2A 4ATFA 3PNAA 4D3WA 4XHXA 1CR7A 4B7KA 4G9SB 3GALA 2P17A 4PLNA 3CJIC 4HVRA 3NV3A 4IDZA 1NCRB 5JXGA 3ZXKA 2WO7A 3WY6A 1AJOA 2R063 2EIBA 4JKLA 2BJSA 2WJSA 3NRUA 5APAA 3A0KA 2PHTA 3NNFA 3B93A 2EAKA 3UJQA 3R4UA 4UW5A 2VZOA 4FOVA 2VW2A 2CAVA 1C4RA 2OXBA 2C9KA 5JOYA 1G9BA 1RC6A 3LSEA 3ZM8A 5FJHA 5C3SA 1Q8QA 2IXKA 4UBGA 2TUNA 5LY1A 1OUXA 4IV3B 2YG0A 2OPWA 4QB2A 3W20A 1VMFA 1WD3A 2VH9A 1OLRA 3IIAA 4MH0E 5AVAA 5FLJA 3S7IA 4XYXA 2GNDA 3G7DA 2ADEA 2HEWF 1LGNA 5FPUA 4B3NA 3WP3A 3TEZA 4YWAA 2R1DA 3AP7A 3AZXA 4XFGA 3LOBA 3SCGA 1ZM1A 4XUPA 3AXDA 2P3YA 4CP2A 1LOCA 1CIWA 4EZHA 4AQTA 1ZREA 3LEIA 3AP5A 3BVCA 2JENA 2VQ0A 3CBNA 4IEQA 4W4ZA 4XQWA 3MFAA 1V70A 5IWFA 4FAGA 5FZFA 5BNOC 1LHNA 3HBZA 4KGQA 1GLHA 4Y20A 2VY0A 2YV8A 4YW6A 3VD4A 1OUSA 2NP0A 5BNPA 1GQPA 1C57A 2JWPA 5K0UB 1JTZX 2PFWA 2FZ2A 1ND2A 1YNAA 2EXKA 4OQ9A 4N7IA 2G19A 4OI4A 3THCA 1UD1A 2ZGSA 5CNAA 5J36A 3HD8B 2HEYF 2PQSA 3HWJA 2X5IC 4CUCA 1F15A 4Y33A 3K46A 5IHRA 1W6NA 4J1WA 4Q26A 2PAEA 4HK9A 5FZLA 2XHNA 2WZPP 5FPZA 3UGFA 1VBA3 4BMBA 2ZX3A 2QUOA 5F2SA 1K5MB 5FYZA 1YCIA 1D0GA 1S0CA 3ACGA 4JRAA 5EHDA 3VZOA 1O3RA 1OA2A 3KVAA 4MZUA 2BNMA 1GWMA 1K42A 2BVBA 2B8MA 1UAIA 3ZFFA 5CU1A 3ZFGC 5GZEA 1W6OB 1DQ4A 4XF9A 1UX6A 3HJRA 3VBRC 4HK8A 2WQ8A 4ASLA 2UWBA 4XF4A 3WW1A 4A3ZA 2XJTA 1BMV1 2D40A 4Z82A 4IESA 2V09A 1M4WA 2X53S 3NQHA 1TG7A 1HXS3 5FYYA 3DGTA 2X8KA 3JU9A 4UI9L 5L36A 3KLSA 3T1MA 1DP0A 1PO13 1PO12 2YPDA 3IB3A 2Z5WA 3IN9A 4SBVA 5EV7A 5FZOB 3SH3A 2CWMA 3B69A 1JZ2A 3H1WA 1YJKA 5FPBA 3ZMNA 4GA9A 1CZTA 1MPXA 1ULDA 3NAPA 2QTWB 1VJ2A 4UFLA 2GALA 2VOTA 1IS3A 1JYTA 2CYFA 4I3PA 4YZ5A 3TYJA 5FYBA 4WVWA 3HT1A 4P02B 3NJVA 1IG0A 1ALYA 1WW7A 2YMZA 1LENA 1WCQA 1UYZA 2ZKNA 4GMP3 4N9IA 4XFAA 2ZEYA 1OH4A 2RS53 5FZIA 4QGNA 1O3TA 3GCXA 3Q9OA 4KBZA 2ZA9A 4UW4A 4Q0PA 4WV8A 4OULA 2D6NA 4F83A 1NA1A 3K3OA 4FPGA 1C1FA 1IZ3A 4NHXA 4P9JA 4QPGC 4MG2A 3MUY1 1YC61 5F3IA 4OMDA 4BQ4A 3B02A 3BCWA 2JICA 4XF0A 2ZAAA 3NKGA 3ZYIB 5ABJA 4JAAA 5FY4A 4IGQA 1W8UA 2BFUL 2R49A 4MHRA 2ZHMA 3VBUC 1UWWA 1N3OA 4YFWA 2IVJA 1TZOA 4YM1A 2QQMA 2A70A 4F7ZA 4GH4C 5G05L 2IWGB 4AG4A 2VVEA 1U12A 3WOGA 3KT1A 5ACA3 2CGPA 2ZCWA 3LIHA 4IE5A 3J8F2 4P08A 3UV9A 1IPKA 1RJ8A 5DUXA 1GSLA 2WN2A 1LB2A 5F5QA 1C5IA 1OF4A 1L7QA 1KFUL 3AX4A 4LBMA 2P3JA 2LALA 2Z2SB 3OF1A 4HETA 2WRAA 2R0HA 4C91A 3AL5A 1D2SA 2D3PA 3HQXA 4BQ5A 4YGCA 2ZKLA 1NZCA 4FPCA 4AEMA 1RUF1 1HV0A 1VRH2 1Q8SA 3LB9A 3OPWA 3OY8B 3UKTA 4LKEA 2VCBA 2ILMA 4RQPA 1WBLA 2BU9A 1MEC3 3C7GA 1RUI1 3MLLA 3N7LA 5J98B 3T3YA 3WG1A 4DPNA 4BM8A 5KHKA 4PDWB 5A7WB 1ZNPA 4ASMB 3OGRA 1U0AA 3T0BA 3ZSKA 2W94A 3JXSA 4C0BA 5ERLA 3J26N 4CEYA 1I5ZA 3MW4A 2HYKA 1XSQA 2HWD1 1HJFA 2JG8C 2Q4SA 4QB1A 5FWEA 3PHMA 5BV6A 4LOSA 5KWRA 1CWPA 4ET7A 4W6WA 1OQ1A 2HYXA 1MZFA 2HWD2 4HMZA 2YU1A 3J9SA 3SMHA 4I01A 2D97A 5FZEA 5C70A 1X8MA 3U4XA 4UFHA 3QACA 1CIYA 3DXUA 1W8HA 2DCYA 4DO0A 3FJSA 4YW5A 1UO9A 5FPXA 3J7LA 3GXUA 3AP9A 5BNNA 3MUZ1 5JIUA 1BVVA 1LU1A 1IKQA 1AX0A 1W8WA 2JDMA 2XR4A 5FUPA 3EBRA 4XUQA 3Q8CA 3B00A 5HCFA 5LK5A 3AKSA 4TLGA 5GALA 5SV5A 1S0FA 2WNOA 2Q8EA 5FR3A 1YFUA 4XACA 3FMGA 3VDBA 2XLGA 4FSJA 4A4AA 3FLPA 4AEDC 1EUUA 4NRMA 2GH8A 3GZUC 3D3AA 3U75A 2V72A 1PNFA 3MIDA 4META 4CTEA 3OGGA 1FPN1 4MXWA 3NVCA 5CFDC 5AC93 1CGPA 1WA6X 2ZOEB 5FYCA 2ENRA 4AI3A 1OI6A 1R1A1 1U5XA 4FCAA 5FP9A 3WF1A 1FPN2 4XCAA 4M0HA 1SDWA 4XFBA 3AMQA 1WW5A 3ZKYA 5ANNA 3JUUA 1APNA 3FBMA 1IHMA 5EFUA 2WQ4A 3ATGA 1RYYA 5CVRA 1NE4A 4FPLA 3WDXA 3CDZB 1R093 3USUB 5FYVA 2PHFA 1XU2A 1RITA 2G9FA 5FP8A 1LKNA 4MVTA 5DG1A 4BQXA 3ORJA 2W47A 5IJRA 4N43A 4Z1VA 1RUF3 4Q4Y2 4XTPA 4I0WB 4UF0B 2WINB 3AYAA 1QOOA 1QH6A 3W5MA 4WM7B 4K8FA 5T54A 3VD7A 4D8MA 4XMAA 2D5FA 3O0WA 3R05A 2WL1A 4FPKA 5DZFA 4A7YA 2B9VA 1RUH2 1ND2B 2V5DA 3GJAA 2XWBB 5ACA2 5EJZB 1HB4A 2A6ZA 2OVUA 3RZMA 3AK0A 5ACA1 1CZSA 1T6BX 3AJZA 5EPAA 4I02A 1W99A 3PLQA 3NSTA 1BK1A 1HXS1 1WA4A 2LW8A 1HRV2 4RQPB 3U14A 2E7QA 3WP4A 2GH2A 3VB9A 4XUOA 1HRV1 1YUDA 3GCWA 4PDWA 5A7WA 1QJX2 1QJX3 4HG6B 5H9SA 2Q8OA 2VO5A 3M70A 1QMJA 1Y9QA 1QOTA 3ZYBA 1JXNA 4FPFA 4Q4V3 4XBQA 3BN6A 1IPSA 4MXWB 4COVA 2IXIA 2X10A 3KV4A 5FZ9A 1AR81 5KR7A 3A22A 1WCKA 5LA1A 3POIA 2EIGA 2ZGKA 5H9PA 2ZEZA 3P3PA 5C4WB 2OT7A 4Y1VA 1FV3A 1H8VA 2WNEA 3UGHA 4AEDA 1CX1A 5HPOA 2QJVA 5A3LA 3NJXA 4NPMA 2W39A 1JZ6A 4Y1YA 3V65A 5CB7A 1EAH2 2KD7A 1WCUA 2ARBA 3ZYJB 2CGOA 1ENSA 1ZZ9A 5ANQA 4N8MA 4NAOA 3LE0A 4GB31 1Y43B 2YGMA 3M3QA 1OQEA 2ZGRA 5HV4A 1DZTA 1D4M1 1TME3 2RHPA 4Q1RA 3RNSA 3THPA 3IM0A 4OI1A 4Y5Z0 2IVIB 1DGRA 2VECA 2XVLA 4UF0A 1QQP2 1QQP3 4NHLA 1VBD3 4ORFA 4AQSA 2W95A 4P9YA 2WLQA 1BEV3 4MGZE 5J48A 3H3ZA 1MS1A 2ARXA 4N9HA 5FCCA 3AC0A 5IT6A 1OKOA 3AKRA 4J1XA 4Y22B 3ZDSA 2QFEA 1DG6A 4BISA 5FPVA 1VB4A 1GP4A 2VQUA 4NOTA 3NO8A 2ZMLA 4AHXA 4ZKTB 5AFEA 4DUWA 1E57A 2ERFA 2VCCA 5KHHA 1XQNA 3U78A 5LWBA 2VZPA 1GOGA 4MADA 1DCSA 3POJA 4IE7A 4LUKA 3GYDA 4QWNA 3AVRA 1UZVA 2VXRA 4P5YA 1PK6B 1CN1A 1D7PM 2HWF2 2UY9A 4OCTA 5EYYA 4DXTA 4CCKA 3GZTB 1HQWA 3N9LA 5BUVA 3F2ZA 2HWF1 1I5PA 4WM8B 4CPBD 1SCRA 2PTMA 1C8M2 4BK5A 1XOYA 4AFMA 2XL7A 5A7PA 4UT5A 2RS32 1BBT1 4WZFA 5EWSA 3GDBA 4GIQA 1GUIA 4K7JA 3ME2A 3S5QA 1G9FA 1A6CA 2BDRA 1FATA 1ZZ6A 3FFZA 1DGRN 4FFHA 4CEYC 1KS4A 1VBB1 1VIWB 3AB0A 4DXSA 3AL6A 5A80A 5IK8A 3E5XA 1E5HA 5FPAA 3VZJA 4DEVA 2RS11 1LU2A 1UIJA 1QJFA 4R9AA 2RMU1 2R32A 4Q4W2 5IVEA 3J4UH 1RUH3 1ZZBA 2RJKA 5E8AA 5JXHA 2P5BA 4Q4W1 5L9BA 5GZFA 4X6RB 5FZ0A 1FT9A 5FP7A 1FMD1 2W1WA 3ZXEA 5C5TA 2C1FA 4YW1A 3VBUA 1TQ5A 1XXNA 1XNBA 1YRZA 2CV6A 5ABJC 4K1YA 3HNYM 4DOUA 1JOBA 1COV1 2OPKA 5ABJB 4HPKB 4LLOA 4XUNA 5T50A 2JJ6A 3NNMA 4BHPA 2GP5A 3A7QA 5DAPA 3VDAA 4H2AA 4M00A 5LBEA 3DL3A 1PIV1 3FHIB 3TRSB 3T2QA 2DVGA 1W2OA 1I6XA 2JB8A 4GALA 4UBHA 2K0GA 3T09A 5AC92 1VBA2 3FHAA 1VMHA 2JG9B 5CFDB 4Z2AA 1NA1C 3RQ0A 5FY8A 1AR83 1XYPA 3WF0A 5FWJA 4YPJA 1COV3 3IDCB 2QDNA 3URFA 3AKQA 5J09A 1EV12 2E7TA 3S7EA 4LHKA 4AK3A 1EV11 3AMHA 4JHTA 1C28A 1CESA 3GHMA 4YZ3A 3ZN6A 2ZX1A 3ZSEA 1LHVA 2OUHA 3O5SA 4YG6A 5FMOS 3ZSLA 2VZSA 2MNGA 2HWC1 5L7OB 3K75B 3V0BA 1SLTA 2R7EB 1S0JA 4C8DA 1KRIA 1EPZA 4IETA 4BQ2A 3C2UA 2A71A 1W2UA 2JECA 1VR3A 1HRI1 4N7UA 5T5JA 1CJDA 1X36A 3RDIA 1L3JA 1W28A 3ZPYA 5LBFA 3VKOA 4NN0A 1O6UA 2EXHA 2QE3A 1V9U2 3H50A 5FREA 4CDQB 4ZU5A 4XJ8A 5T3NA 3MI8A 3VBRA 5DXDA 1HQNA 1V9U1 1S0EA 2RG4A 3JQXA 3N9NA 2VNGA 3OPZA 3OBTA 1ODMA 2K2SA 5GLTA 1VRBA 3RPQA 3ZFFC 2O8QA 3WUDA 2AGSA 3AMPA 5CYYA 1OFNA 4FAHA 4I3GA 4PHZA 5D2AA 1AR62 4QXCA 1VBE2 1RUC2 2D43A 5FTTC 2VMFA 1EY2A 5LA2A 4FT8A 5C5UA 3WDWA 1GWKA 2HWE3 3ETQA 4YM2A 2VULA 2IXHA 2P4EA 3LKJA 2A6WA 2XONA 2D6PA 2ZHNA 4A7ZA 2HWB3 1IS5A 1PMIA 1H2MA 3ABZA 5I0DA 5A3PA 4Y4RA 4AR2A 4BA6A 2BP6A 5FXXA 2GP3A 3OD0A 1NLSA 4GAZA 3OG2A 3HPNA 5C3RA 2Y38A 5E1RA 1OXCA 5GZDA 3CMGA 2KXLA 3PDQA 1W6MA 1OOPA 1UU5A 4RR3C 1UF2C 3ZFEC 3POGA 2WFF3 4D7TA 1GZTA 5A3NA 1O8PA 4IEPA 4HN0A 1GZWB 3DF0A 4RL7A 1R082 5HCBA 3FLRA 2FDKA 4LBKA 4TSVA 1R092 1CJPA 1UXZA 3I3EA 2VNRA 3MEPA 4K3UA 2JDYA 4V1PA 1JBCA 3HIFA 4LE3A 2W87A 3WEZA 4JHZA 4AZZA 2FDHA 2HWF3 4WM7A 1ND3A 5FZ6A 3VBFA 5GLWA 3BI3A 4CP1A 4E4HA 4XEZA 1UYPA 1AR72 2PMWB 4WVMB 1UQXA 3I3MA 2RDSA 1KJLA 1UY3A 4ITCA 4NAMA 4U36A 2ZGLA 3N9QA 1A34A 4URAA 1XC6A 1R64A 1UX7A 1GICA 2G1MA 2DFBA 4MGIE 1Y3TA 3V0AA 2XDVA 3N7MA 3WDTA 2EXIA 2J1TA 3AYDA 5CG9A 4PIYA 5BPXA 1ZBA1 3HOBA 4UW6A 1HW5A 2VOWA 3PIGA 5IFTA 5LW9A 2ZGQA 2HWB1 4XJ9A 4FP3A 5IUQA 1X50A 1OMIA 2RVAA 1ZBA2 4NIIA 1HLCA 1R083 1SG3A 1F5FA 1UN1A 3PUAA 5C7GA 5FYTA 4M4RA 3SC7X 3NV2A 5A70A 5GZCA 2DBIA 5F6LB 4JGYC 2ZHLA 4JDMA 1AL0G 1VAKA 4GJYA 2EA7A 5FZ8A 1SPPB 3MYXA 5K9YA 2TBVA 2VZUA 2WABA 3ETPA 3ZXGA 4HSJA 2E51A 3ZXJA 2H0BA 2YB7A 1PVC3 5JXJA 5JR7B 1IPJA 4Y20B 4CDUA 3RG0A 1UZWA 2JDUA 2XJPA 2WSVA 1PM7A 4I30A 3D6EA 5IW0A 1LOAA 1JI6A 1W9FA 4Q29A 2WWUA 5DUVA 4D0QA 1POQA 2FBEA 5FYHA 1RJ7A 3I2IA 1QXJA 4Q4Y3 2O1QA 1G7YA 2I74A 4NHMA 4AYUA 4Q8KA 1IGOA 4YVSB 1NCRC 2AR6A 2BW8A 2WLPA 4AI1A 1HX6A 3KGLA 3KWVA 4QDSA 2ZEWA 2R6QA 1Z78A 4FTBA 3OYWB 4JKKA 5DG2A 3VKFC 4JVAA 4AVSA 4JRLA 4UXAA 4IV3A 5JZGC 2PAMA 1V9U3 2Q8DA 2W1QA 3WV6A 1VALA 3MO4A 1US3A 1Z7S3 4LLFA 3I2GA 4HN1A 4PCRA 1B35A 1NE6A 1H2LA 2JE9A 2FD8A 2GZWA 1H6XA 2GMMA 4A3XA 1MS5A 2VCAA 1W2NA 3VBFC 2DTWA 3J7HA 3SNMA 4DQAA 3IDAA 1GZWA 4XDOA 1X9PA 3C7FA 3LA7A 3SKVA 4W50A 3O0XA 2Y60A 3AM2A 1Q3EA 1TE1B 4CA9A 4HLTA 4EN8B 3M4FA 1LOFC 2GNMA 3HT2A 3WW3A 1RUJ3 2OA2A 1UU4A 5CKQA 1F31A 4NJ4A 1RUI3 1N1YA 2HEVF 1YQ6A 2WT1A 5JLVA 3PJQA 5JSRA 1QU0A 4E4ZA 3ES4A 2D7FA 4RSUA 3WNPA 1NXD1 2YBKA 4QQLA 1A78A 2GNBA 4AI8A 1W04A 3K77A 5GM0A 5DMYA 2HWD3 4R8HA 1Y9MA 3BB6A 4IV1B 4QX0A 1W9WA 4M3CE 4Y24A 1FMD3 3VGIA 3PTYA 3S57A 3M3IA 2DVFA 2AC1A 2MEV2 2QQLA 2XQXA 1SBFA 1WWYA 1YIFA 2VD7A 4B1LA 4E2QA 4M0NA 4DXZA 5HXVA 2MEV1 1ST8A 1W6OA 3BKZA 4NPLA 1LODA 4XIKA 1QJY3 3OSDA 1RUJ2 4QU1A 5I8YA 3PL0A 1DF0A 3WF2A 4GJZA 1W8FA 2RS13 3CHXA 4YW7A 1AYM2 3MICA 4BQ3A 2J42A 5EIYB 5CG8A 2B7YA 1QXPA 5C4WA 1YJLA 3HAGA 4QPIC 3BOPA 1OBNA 2XGXA 1N47A 5FZ7A 3PU3A 4HSLA 3MBWA 5JOWA 1J58A 2BGOA 4GZ9A 1POV0 2NYYA 3MPPG 3VZMA 5E89A 4COUA 1JYCA 2W5FA 4AGGA 4EJRA 4FOYA 4Q4W3 2DV9A 3PVNA 2Q5TA 1RXFA 3B01A 3DECA 3ZYGA 4YG0A 3T2PA 4AAXA 5CAZA 3KVBA 3M3OA 4COZA 4Y1XA 2E7AA 5FY0A 3AVSA 1Y9GA 1UZ0A 4JTOA 1OLMA 3T4HB 2IXCA 2FCVA 2CWSA 1W6PA 4JQRA 4D7YA 3BGAA 2PLV1 2VC9A 4FFIA 3ZX7A 3KCYA 2CDOA 1C8M3 1WMDA 2FMDA 5FKCA 3O1TA 1JUIA 3KS7A 4QKNA 2ATFA 1A8MA 1OC1A 4AFBA 4BE3A 3UKVA 2D3RA 5IVJA 1D2QA 4CCMA 1DLLA 5F1RA 1YYNA 3O0VA 4AL9A 3UNPA 1JMUB 3WT3A 3Q8EA 2DURA 2WNVA 1UZYA 2VTXA 3FZ3A 3RWKX 2P6CA 5C33A 5IVVA 2E31A 2QQIA 2PHXA 1PO11 1MEC1 3CZJA 4QKFA 2VCMA 3G6JB 2OYZA 5HI0A 1LAJA 1UIKA 1XJAA 4A7KA 1PMHX 3P6BA 1HB2A 3T0DA 5B4NA 1LHUA 2J1VA 1C1LA 2WR9A 4PQQA 5LB6A 5E6HA 4WZCA 4CUAA 1H2NA 3O1RA 1MZ6A 1RUG2 3LGRA 4DUVA 3WG2A 1LHWA 1ASJ2 4XC9A 2KA3A 1PZ7A 1VBB2 4FO9A 4M3CF 4CCCA 3U37A 2Y0IA 2V4AA 3TNPB 4GKYA 1EAH3 5A3WA 2QBXA 4XMIA 2W46A 2WZR3 1MZEA 2UYBA 1QJU2 4R9CA 1PK6A 1UPIA 3DPRB 2A3WA 4JQTA 4IEWA 1IQDC 3UETA 2BNNA 4EN7B 2AEZA 4XFCA 3VDDA 3I3QA 4QM9A 1LEMA 5FY1A 4AGVA 4CEWC 1FNZA 4DEQA 4Y1ZA 2CY6A 4Y1UA 4DY3A 1XNKA 5L9VA 4O9EA 5DDJ2 5I8TA 2ZMNA 3ZVXA 4LEJA 5FQ0B 2P2KA 3K3NA 3S0MA 3PUIA 2LROA 1AYN3 5GZGA 5H9QA 2QQVA 2G4IA 3J8F1 5JDBA 4IE6A 3ON7A 1C8NA 2JX9A 3N36A 2YZ4A 3POBA 3SEEA 1JN2P 5A32B 4KH9A 3N7KA 2HKXA 3H8UA 4Q4X3 4TXWA 1ENQA 3UL2A 4AQ6A 4RGKA 4CP9B 3L2YA 4ZU4A 2VR4A 5GJ6A 4Y3OA 1F8VA 2MEV3 1GNYA 4NE9A 3C7HA 3WHTA 5IK7A 3H1MA 2D44A 4MGYE 3ITQA 4BYYA 1T2XA 4W65A 5EYXA 1RUI2 1O7FA 2Q1MA 4RS5A 4QHOA 2W08A 3MIFA 3ACHA 4QHBA 4CDWC 2JD4A 1CQ9A 2CL2A 1VBA1 2GSYA 4NROA 4P00B 3ZYFA 4BXFA 2ZS6B 3KQRA 1W2AX 4XFFA 3TN93 4N43C 5DDJ3 4E2GA 1NQJA 4YFZA 3BODA 3K48A 4OI0A 1NX9A 2ETEA 4K40A 4P9WA 4S2FA 1G9CA 3B7MA 4NPRA 2D3SA 4B4QA 4NR1A 3DN7A 1W9TA 2TNFA 2VUCA 4R9DA 3KD4A 1SCSA 4OZXA 3L9JT 4C0HA 5A3TA 5IVYA 2NM1A 4BZ4A 1Q5OA 3RJ2X 1QEXA 3NNGA 5FZAA 4PIXA 1AXKA 2WYSA 1DQ2A 1JU4A 2VBBA 1GNHA 1ACCA 1K5JA 2OX0A 3W58A 5FXWA 1HRI2 1AR91 1VP6A 3U1XA 1BK0A 3AP4A 2W1SA 3EHKA 2XBO3 3QH6A 2VQAA 4CCEA 1X33A 2IFRA 2YBPA 2XLAA 4JCKA 1SQ4A 1WBFA 3HMYA 3QH7A 4AFDA 1IKPA 3VHRA 1BHGA 3OUHA 3TN92 2VQTA 3DYPA 4LNVA 4RQPC 4N53A 4CU8A 3ZYRA 3TN91 3LF7A 2BV4A 1W90A 1FI2A 2JEMA 2E53A 3A21A 3LCPA 3LIGA 3GNEA 4YVSA 5FY9A 4ZY9A 5JPNB 2X09A 3WR0A 1MS8A 5L7OA 2JD9A 1SBDA 3CJIA 3HVDA 4RR3B 3ZFEB 2VTFA 4BH9A 2VGDA 4XF3A 3GGLA 3IMNA 3SCFA 2R071 5F39A 3BALA 3FL7A 3KV9A 1G86A 2QQWA 1MVQA 1BJQA 4LBNA 5C9AB 1JZ7A 1GU3A 2FQPA 2OS2A 3MV01 3T0AA 4AVCA 2BWAA 5F32A 3UKNA 1GZ9A 2D5HA 4UAPA 5K0UC 1FV2A 4J6GA 4AGRA 3PURA 3VDDC 2VU9A 4FPOB 4FP2A 3I97A 1REDA 2WN3A 2R061 4MOAA 5IATA 5BNOB 4F3JA 1NCRA 2RM21 2PXJA 1UZZA 1PVXA 3JQWA 2EF6A 1GV9A 1E5SA 3JZVA 4ES9A 3FBYA 2J22A 1JYNA 1U5YA 2C0ZA 5FO7B 3D8CA 2FZ1A 1MS3A 5I0RA 4XABA 4AWDA 1J84A 1MQTA 1AF9A 4ZS2A 4BQ1A 1TME2 5FUIA 3GHNA 4O61A 4YW4A 3WXPA 1NY71 3E6DA 1MS4A 4QGMA 1GOHA 3JBG2 4JGZC 1OPMA 1ASJ3 3NNJA 2PHDA 5FO8B 3C3VA 5FO9B 3JD73 3USSA 3HQUA 5GLUA 4Q27A 2DCJA 2FDIA 3UESA 3N4MA 5CBLA 1FAYA 2WFPA 3EXUA 2C9AA 1OOPB 3K4ZA 2WUHA 2JG8B 4H14A 5L9RA 5CEHA 1I1EA 1OOPC 4QPGA 3SKJE 3OD4A 1UMIA 2QCSB 2WNVB 2LUWA 5DQ0A 3USUA 1FXZA 2AUYA 4X8NA 2NQYA 2A6VA 1S1AA 1O5UA 4PIZA 3H3UA 2XVGA 1V6JA 4IE4A 1I9RA 3JD71 2ARAA 4GWNA 3P1IA 2VVFA 3AZVA 1Y4WA 3SH4A 5IVBA 1D4VB 2EAAA 2AREA 1JH5A 1ULOA 3OEBA 4QB6A 3E5UA 3POEA 2ZGTA 1DYPA 4UFJA 2IXLA 1KDKA 2F4PA 1PNGA 1ONAA 2PHWA 1VBE3 2UY8A 2ZGUA 3KV6A 4L11A 4OUSA 5C3QA 2VNOA 3RYPA 4FTEA 5JPMB 2OKXA 5AVPA 4AOCA 1GP6A 3QLQA 2FDGA 4HFSA 2F4LA 1G6NA 3WW2A 4D6RA 5IK5A 2TEPA 1IS6A 4B4RA 4P9IA 3GZEA 4QQHA 3POFA 3MLJA 4GH4B 1RHI2 4M3CA 4K1ZA 4QPIA 1OHFA 2YYOA 4RHV3 3RZZA 3PIJA 4UOJA 2NZ9A 2RR11 3I7DA 4XJAA 3VBUB 4PI2A 4RFRB 4Q4V1 2JG9A 1DLCA 1UYYA 3D82A 1EP0A 2GC2A 1NA1B 5A33B 3MF6A 4XTMA 2AENA 4AI9A 1C8M1 4GWJA 3M3CA 1GQHA 3VBSA 4ES8A 1AR63 5KHGA 1M06G 2NMOA 3LQCA 2ZPXA 1N3PA 3BYWA 2DVAA 4PF1A 4QPGB 4J25A 5GKAC 1H8TB 1W2TA 1UPSA 5IAVA 1J3QA 2BVVA 3IAPA 4NIDA 4KWLA 1GFF2 1CD3G 1NLQA 1CAXB 3P3NA 4XURA 3ZN4A 4A42A 3IT8A 4YSFA 5A7OA 4XAAA 2ZACA 3DYOA 4FPEA 4XUTA 1FPN3 1YIPA 1PGW2 2DTYA 2VNVA 3WCSA 5CFCC 2XBO1 1W6QA 1V6OA 5FP4A 2Y34A 1FOD2 5TSWA 4JZRA 3ZYPA 1PGW1 1PVC2 1GNZA 2O14A 4YZ2A 1NCQB 4IEVA 1PO22 1PO23 2GAUA 4KWJA 1PVC1 3DEMA 5D1IA 4BXSV 1RUG3 1UYXA 5DAQA 5FJKA 5JWPA 1T6GC 1F9KA 1PO21 3VBOA 5A7SA 1Z0HA 3R0RA 1AXYA 1IG3A 4KL1A 3GJBA 2VUJA 2ZGNA 2B46X 3W21A 4X8PA 3OY8A 1H30A 3N35A 5LATA 2DYCA 3MV11 1FNYA 2ARCA 3VHOA 4CDXB 4SLIA 2R1BA 2CDPA 4FQ4A 4DB5A 3H0OA 1ZZ7A 2EALA 3TOJA 5KXEA 4FPHA 4EN0A 2Y6GA 4QD2A 3WINE 1SFYA 1CPNA 3HNBM 1XE7A 3I2JA 3OGVA 3MFCA 1Z7S2 2RJLA 3HEIA 2EVXA 4G3YC 4XCBA 2JDKA 1Z7S1 4V2WA 5A1AA 4NWWA 5CISA 3CKHA 1GANA 4BCUA 1SHWB 1HB3A 3GF6A 4Q0VA 3H8RA 1PGL2 1S2KA 4LJHA 2YPJA 4CDWB 1J3PA 3OB8A 1PHMA 4L0PA 2FDFA 1UCXA 2XUMA 4IL7A 4XDPA 3VL9A 4CDUC 1W0OA 1RB8G 4ARXA 3MW3A 4HL0A 1POV3 1S2EA 2CU5A 4LO6B 2RJ2A 3LZZA 5FMBA 3VBFB 3VHPA 3VBHB 4OUEA 1LNSA 4PI0A 5LASA 5KXDA 2VMDA 5EJ1B 4LA2A 3VBHC 3LFIA 2WIIB 3KF5A 3VZLA 3SH5A 4YM3A 5BNOA 4BOWA 4UW3A 4MGKE 2AEYA 1SDDB 4BDVB 3N9PA 4YW2A 4L97A 3LFMA 5C8CB 3VV1A 4YVWC 2JDAA 5HV0A 1JHJA 2OQ6A 3LEGA 5FZDA 5KHJA 2ZAHA 3O1VA 4K20A 3ILNA 1W06A 5L73A 4DUXA 1UY2A 5F2WA 3ZIWA 2V73A 3A23A 3LA3A 4NIGA 1W39A 1V6NA 4QM8A 2R0FA 1G9DA 4BIFA 4GMP1 4KG0A 1S0DA 3AZYA 1GR3A 5LZ6A 3GBGA 1UY1A 1X82A 5T5OA 1DBNA 1H1MA 2RDRA 1RVF2 1SLBA 1VMJA 1TEIA 1ND3C 2CTVA 3MIHA 4BLIA 3IDBB 1PX4A 4OHZA 4DRRA 5FY5A 1SLIA 1ULEA 4RN5A 1G8WA 3T08A 1S4CA 1YWKA 1GYKA 1H4HA 1LR5A 2J1SA 2VBPA 4KQ7A 2A75A 4N53C 4O9GA 5E88A 5F5IA 2Y8KA 4YARA 4ASKA 3PUQA 3BTXA 5FZCA 5FAXA 3VBOB 2Q1FA 4FBFA 4AHYA 5F3CA 3DYMA 2VZTA 4XQDA 4JTNA 3SHRA 4CDWA 1ASJ1 5D21A 3WD5A 2WZEA 1R081 1PGL1 1LOGA 5D8AA 4GWMA 3IZOA 4OQ8A 2Q1ZB 2JIGA 3CQOA 2SBAA 3OJBA 2VZ3A 4LO8A 4XJZA 3DPRC 3T2TA 4CDXA 5I93A 3M8LA 1W8NA 5GLZA 4A6SA 1XE0A 2C4XA 2GDFA 5I0UA 3I2FA 3IKWA 4A45A 4OLLA 2QQPA 3WNKA 3KZ4C 4L92A 3MHZA 5F37A 1VLNA 1F5JA 5T55A 4FFFA 4Y5TA 4TTGA 1CAVB 3HN3A 1H0BA 4FOQA 2BERA 1UMZA 3I2OA 3OCPA 2MHFA 2JG8A 2SLIA 1N1SA 4D7SA 1NOVA 1G9AA 2R043 3ACLA 4I09A 4CCNA 2JDHA 3OUJA 1NG0A 1ZRRA 5LEJA 3E6CC 4LR4A 4FQZA 4JKMA 2PQQA 1AYM3 2W1UA 3RI8A 1C5HA 1LRHA 2BFUS 3IBMA 1YHFA 1W3VA 4LQRA 5FLHA 3UT0A 2B4KA 2BGCA 2XWJB 4RS5B 3W9AA 1NUKA 3QD6A 3NW4A 1K45A 5FYIA 5FZ4A 3ZOIA 1JOJA 2GN3A 4PDWC 1O3SA 2DCKA 3BPSA 2XJQA 5DPNA 4AEDB 5F3EA 2O8OA 4QX8A 2BOJA 3VDCA 3M1HA 1X7NA 1EPWA 1J1LA 1Y7BA 3RMXA 4Z2WA 1YEWA 4MUVA 1SFPA 2WQZC 5DAVA 5EP9A 3ALQA 3WHUA 4E8DA 1RUNA 1KD7A 4DFSA 1XNDA 5EJ3A 1VBC3 1DIWA 4I0BA 3IAQA 2RDQA 2YC4A 3A0NA 1W05A 1YFXA 1MZ5A 5HBAA 1DZQA 1K5MA 1P8JA 1O4YA 1OPOA 1U5ZA 1OVPA 1ZBE2 4KMQA 4K21A 4RYDA 5LRRA 5DZGA 1YQCA 3ZFFB 1W0NA 2EXJA 4PLOA 3CJXA 3OBRA 2X05A 4D69A 2PHUA 1W9YA 2VE1A 3CL1A 3HQRA 5A33A 1RUE2 5KXBA 3I59B 4N90A 2WZ8A 2WDBA 3BTAA 1VB2A 3OBAA 3N3HA 1NYWA 2V5YA 1CX4A 4URTA 4AVVA 2P3KA 2ZEXA 3POWA 3PMEA 4XAEA 2YDEA 4W8JA 4BK4A 3U0ZA 2GC1A 2Y6FA 2ZX0A 3B9IA 3ST7A 3H9AA 4QGLA 4YG3A 4AI0A 3K4AA 5HCAA 2PHRA 4L2NA 4IV1C 2QZ2A 2ID4A 2VXJA 4IUGA 3B3QE 3EO6A 2PN5A 4IQPA 2HWE2 4COYA 5T5LA 1RMU3 3LDKA 3K2OA 3U10A 2XKPA 1RUOA 1RUD3 3MGUA 2CAUA 1WD4A 1ULFA 4Q4X2 1GP5A 3ZR5A 1OD3A 4EN9B 1BEV2 5G04L 2YC2A 3KB5A 3WZ1A 1QH7A 4RA0A 4EN6B 2AZ5A 2PAKA 3BU7A 1XNTA 1VRH3 1BEV1 1ZA7A 3LEMA 1AYN2 3VL8A 2HBUA 3LAGA 5K4LA 4Q8LA 3RS6A 1WLWA 1XU1A 1SEFA 4HZFA 1LGCA 3U11A 2JE7A 3NAPB 1UOFA 2NLRA 3FWEA 2P3IA 4XQ4A 2XJSA 3ZXDA 1PIV3 4YM0A 5HXMA 2E26A 4PQ9A 3IPVA 4LKDA 4F8AA 2HLEA 4Q1PA 1BVP1 2WWJA 1KQRA 5FBZA 5JI9A 2XXZA 4MXVA 4KNCA 1HN1A 1QIQA 4R9BA 1SBEA 5A6YA 2VAUA 4LHNA 1NY72 2VOKA 4XOGA 3WNOA 2ZXQA 5J7MA 2XH6A 1WUVA 3VBRB 4HPKA 5FYMA 3KGZA 2QNKA 4LO4B 3RGBA 3WQ0A 1AYM1 4AF9A 1QDCA 1QJZA 2WSUA 2ES3A 5JOXA 4MYEA 3QBQA 2JDPA 3WF4A 4DXRA 4XDQA 5BNPC 2R041 4CCLA 1QJX1 4R52A 4A6OA 2J1EA 3EJKA 2ZABA 3LA2A 1WLDA 3GBWA 2PELA 2ZX4A 3IDEA 1LTEA 2R042 2ZJCA 1CONA 4IEZA 5EZWA 4QXBA 2W91A 5FZHA 1UY4A 1ZRFA 3W5NA 3BU0A 5F5CA 3I3DA 4DZGA 4IGPA 2YGLA 3THDA 1XSRA 1DQ0A 3AP6A 1EAH1 3F95A 4Q0UA 4RD7A 4IEOA 3WCRA 3THTA 5FZ3A 1J1TA 4M01A 1ENXA 4YYOA 1DQ5A 4GB32 4P9XA 2H0VA 2D6LX 5JMCA 1MACA 2YUEA 3BTZA 4W6XA 2X29A 3Q8FA 3PVEA 3EB7A 3SITA 3FE5A 4QU2A 3ACFA 4OZOA 3VKMA 4BQYA 4E8CA 5C3PA 4HT1T 1NAEA 3EQEA 4K9SA 1J83A 4CCJA 2QDRA 5JUVA 2YY1A 4L8QA 2B39A 1WCDJ 1QJEA 4LPLA 2IUWA 1W6MB 3Q8BA 5LBBA 4RGAA 5FZKA 3RI9A 4S2GA 1YQ5A 5A32A 3VZNA 1AL22 1QQP1 1V6LA 3AKTA 2BQPA 2MPFA 1QF3A 1RXGA 1ZZ8A 4LO5B 3VDDB 5JR2A 3RMYA 1AL21 3NL1A 4AEKA 4DRVA 5D8AB 5JCTA 4E27A 3T2OA 2XKOA 4QX7A 4MGSA 4OHWA 3OGJA 5BXXA 1RIRA 1TVGA 2Q30A 5F9TA 1FYUA 2F6BA 4ONUA 5AFBA 1H1AA 1U5IA 4QQPA 4AFCA 4DIQA 1RGSA 2BUKA 4LO7A 2ZTNA 4YRDA 1R1A3 2DVBA 1X9TA 2Y6JA 2ET1A 3VBSB 2VOXA 4UFMA 4GXLA 4EE2A 3V0AB 2XJVA 5K8SA 5E16A 2XOMA 1JU3A 2A6XA 3VKNA 3P5BA 3WQBA 3X29B 1UL9A 1AVBA 1GKBA 4MX3A 3TBDA 2WT0A 3R4DB 3TAYA 4Y26A 1O4TA 3H8OA 1KJRA 3KCCA 1RUG1 2WKKA 3H7YA 1GWLA 2GNTA 5FPLA 4HKOA 3AXEA 3MLKA 5FMCA 1Q43A 1BKZA 1OURA 1JW6A 2DDUA 4WVVA 3H42B 2BGPA 4QKBA 2VUDA 4EROA 3AMNA 4QT6A 4R4XA 4G4FA 2RS12 1WW6A 2ORZA 2P6HA 1DYOA 4WVMA 2QVSB 1PZ8A 3POSA 4NRQA 4O7XA 2RMU2 1JZ8A 3ENRA 4D6QA 3O1OA 1LULA 1AR93 4QX5A 5FZGA 3JB4C 3ZR6A 1YQ8A 4XJUA 3I3BA 5DDJ1 5EXOA 3RYRA 2BOIA 1EYBA 3EMRA 1JODA 1ZZCA 2WAAA 3RSJA 3BTYA 4BMEA 3QCWA 3H8XA 1W8TA 3N9MA 4NHKA 2D98A 3BIWE 1FMD2 3PUHA 5EQUA 4X6QB 5A6QA 4KWKA 1V6KA 2HH9A 3NJZA 1IOAA 1HIXA 4LBQD 2W52A 4QHZA 1J59A 1BBT3 1RMU1 4U2AA 4JGYA 2WA3A 2VG9A 5CFDA 1LEDA 3OYWA 1COV2 3EYPA 3INAA 2YU2A 4LOTA 4OHVA 1HKDA 1RMU2 4CUBA 3WNNA 2WC2A 4CEWB 3MDPA 1ULPA 1YI7A 4FXGB 3I2HA 2BTVC 1PIV2 1OFSA 1RL3A 3I2KA 4WM7C 4NO4A 5CADA 1KDMA 4Y4YA 5IAXA 4C90A 4DY5A 5AC91 4OVEA 5A3UA 2QKDA 1S0GA 3ZSMA 4BWOA 5A6XA 1F4AA 5A7NA 3BUCA 2DVDA 2QQKA 4EYUA 2R073 4YVWA 4YGEA 1JYIA 1H9PA 2RS33 3B94A 3S30A 3V64A 2UWCA 4GULA 4HVQA 1SFNA 4LHSA 2WA4A 2UWAA 3VBHA 3K4DA 3AYEA 5B4XA 3I54A 3ZYHA 3FFQA 4CU6A 3CZUA 5T52A 1DQ1A 4K6BA 3S5AA 4RFT0 1DQ6A 1VBC1 3B9CA 5ISLA 2ADDA 3QOPA 3I59A 2Z69A 4IE0A 4W6YA 4NHYA 5I91A 2XPJA 3PUSA 3SISA 1S0BA 2JB4A 1MS9A 4E2SA 1BQPA 1RHI3 2DU1A 4LMFA 2WNUA 2VUAA 3LEKA 5FMDA 4BPZA 4DMIA 4AEJA 1WCSA 3WNLA 3ZFGB 5KHIA 4JDNA 3PMSA 5M0TA 1W8OA 1WKYA 4AHWA 1A8DA 4AXOA 3MIBA 1PGSA 3CEWA 4QAWA 1VE0A 1E5RA 4TWTA 1AR61 3RZKA 2XG3A 2A3YA 3O7OA 4QX3A 1BMV2 4WBBA 1WMEA 1UU6A 2W2IA 4L9BA 3U07A 3NV4A 4QX2A 1VAMA 1E5IA 4ZPIA 3RZLA 1R1ZA 2VPVA 2EIDA 5C3OA 4UFIA 2G9ZA 1SLLA 1Q8OA 4OYUA 4RHV1 3WDVA 5BNPB 3WQ7A 4YGDA 1O5LA 5FFOC 1CPMA 3NNLA 4XJWA 4ZXEA 1AUYA 1PZ9A 2RMU3 3ELNA 3C7EA 4P14A 2ZMKA 2IFWA 4GWIA 3E1F1 5C8CC 3VBOC 4LBLA 1YXWA 5DAWA 4MGTA 1K12A 1W3XA 4FPJA 4WM8A 4Y5SA 1DGWX 1LECA 2YROA 4LULA 1C3HA 2KM2A 2JXAA 3FX3A 4QPIB 5FK8A 4CRQA 4YZ1A 4XE9A 1B09A 4I2OA 1SLCA 2WS93 3K51A 3Q8AA 3M3EA 2DUQA 4OHXA 3ZSJA 1H2KA 5JI7A 3JBG3 4ISRA 4S2HA 1OA3A 2BZDA 3LOIA 4V2VA 1R091 5A1LA 2PLV3 3JBG1 4Z07A 5CZKA 5IYYA 4QPYA 2ZHKA 2GMEA 1O59A 2IC1A 3T1LA 3AKPA 4S2DA 4UFKA 1WLTA 1NXMA 4BB3A 4ZS3A 3PVBB 1QJY1 1AR71 1OH3A 5KXCA 5KBFA 1GOFA 3CJIB 4RR3A 3ZFEA 1JZ5A 2VMEA 4YVWB 4ZZ8A 1ND3B 3WG3A 1HV1A 3SLIA 3CLPA 2YBSA 1LOBA 1N3QA 2EICA 4IEYA 1BYHA 1POV1 4PBOA 4XFHA 1JHNA 2VZRA 4GQ7A 4LBQA 2JIJA 4FVVA 1VBD1 2WS92 1AZDA 4AE2A 1UKGA 4LK6A 1DFQA 4EQVA 5IK4A 1QXRA 2HWB2 2WFF1 2BWCA 1VRH1 2VZVA 2GC3A 1VBD2 4ZXKA 2WS91 4B7EA 4INDA 5CFCA 4LITA 1GQGA 4XILA 3MZHA 1PM4A 4DNYA 1H8TA 2A6YA 1DHKB 3ZIXA 2HJIA 3ZN6B 5FKBA 5FOBB 4JX0A 4CU9A 1CAXA 5F8PA 1ULCA 2JKBA 2WNUB 1D0HA 2B5HA 4MLOA 2A3XA 4KU7A 4P9LA 2DBNA 1PX3A 2IXJA 1MQTB 2JDNA 4NIAA 1X8EA 1ZRCA 2RM23 1OD5A 2VBDA 2XLFA 4XVHA 1RHI1 3VBSC 5FDBA 2P1BA 2DUOA 2JKXA 1KITA 2RR12 2AH2A 5FZ1A 2B9UA 2I07B 2ORXA 2D93A 1H1IA 3RYKA 4CDQA 4EWEA 3AFGA 3TEWA 4LORA 1ZBE1 2VJXA 3WF3A 4QQ2A 4JDOA 5LCWL 2A73B 4LUMA 4QDRA 1CAUB 1GMMA 3FC0A 3LSDA 4YVSC 4TZDA 1OQDA 3OUIA 1VAVA 1OF3A 1QNWA 1W0PA 1NCQC 4NVPA 5FZMA 3WLUA 4CPBA 4CP0A 4ZU7A 1UNBA 3KF3A 1H9WA 4HONA 1J3RA 1ZYBA 2Y6LA 5BYNA 4Z92B 4FTSA 5C71A 5JZGB 1KFXL 1YQ2A 4MHUA 1SMVA 2X5IB 2W3JA 4IW3A 5JMOA 3O1PA 1GZCA 1BXHA 1AX2A 5JXIA 5DUWA 4HANA 2Z4FA 2Y26A 4XBNA 3DKQA 3RWNA 1VPHA 2HWE1 3KT4A 1DDLA 3ZPOA 5L19A 2AYHA 5J3UA 1DYKA 5JSPA 2OIIA 2XBO2 4CP9A 1FOD1 2ZGPA 4ZZ5A 1AX1A 1EUTA 2NMNA 3ACIA 5LY2A 4E4SA 2YHJA 3JCIA 5DAXA 5LA0A 3LDBA 3AZWA 1REFA 4YNIA 5FYUA 3T30A 1LESA 2RDNA 1XB9A 1KXGA 2HBTA 1O3QA 4Q4Y1 5FRAA 1IQAA 4JGZA 4BQWA 1ODNA 2WO3A 1DZRA 4AHZA 2JE8A 1LCLA 5A3OA 3N9OA 1JYWA 2VW1A 4LBJA 1F35A 2Y64A 3SQOA 3KCXA 1N1TA 1LOEA 4XF1A 2W9XA 2WO1A 3MF9A 3PTRB 4XPVA 1SACA 5IFPA 4B29A 1UMHA 5FMOL 3ZO0B 3TNQA 5FIXA 1NT0A 2XL9A 1CAWA 3KM5A 3R4SA 4B4PA 1RUE3 4O65A 1AL23 1HXS2 4AFAA 2Q8CA 1Q56A 3DV8A 1KGYA 4M4PA 4QDQA 4WVZA 5DABA 5FYSA 1CAVA 1H6YA 1YI9A 2BBVA 1W6NB 4Q0QA 5DZEA 1GBGA 1HDKA 3O12A 1RUJ1 4OFGA 3H3LA 4A2UA 2ZX2A 2XJRA 1ZBE3 1RINA 2B45X 3DCQA 3BOWA 4I0AA 2PA7A 1ENRA 4XXAA 3MPBA 5JVVA 4EV0A 5I0SA 1AR82 2Y0OA 3J8F3 2I45A 2XQRA 4CE8A 1DU3D 4BLJA 4CEWA 1JZ4A 1UXXX 4PF5A 1XNAA 1QJU3 2GN7A 4K8RB 2BYVE 4HBNA 3ZXLA 1O91A 2LRPA 2R16A 5FBJA 4LT5A 4LHLA 3LPFA 3AZZA 3TEYA 5K0UA 4Q0SA 3RRDA 4NRPA 3KT7A 4QQOA 4LKSA 1DGLA 1VBB3 2PLV2 4LIVA 2E63A 3H7JA 1HQLA 4MGQA 4OHYA 4HVOA 1SLAA 1PMJX 2CNAA 1IS4A 3IWZA 3ZLIA 1BCXA 5FV3A 2A1XA 3SXWA 5JSOA 1L7LA 4CXYA 3SEPA 1SZBA 5L7OC 4HKLA 1YFYA 3CNAA 2RE9A 5FXVA 5I8SA 5CKNA 2WWSA 2XJUA 4ZHNA 5LEKA 1MR5A 3LWCA 4QPWA 4CYDA 4XETA 4Z8BA 5C9AA 2QQJA 3M2MA 1JZ3A 2A7AA 5D8AC 3ASIA 4EZ4A 2Z42A 1W9SA 4IEXA 4UWDA 3E6BA 4AVTA 1S0IA 3JB8A 2WNVC 3TWIA 3U4SA 2OQ7A 4QX1A 1QKQA 1B35B 1F4HA 1S55A 2GC0A 2I2SA 1RVF1 3CIHA 3VN4A 1XYNA 3W59A 4BJ0A 2VMHA 2KR2A 1BLZA 2XVKA 1QHDA 3OBZA 2BPA2 1MEC2 3J7NA 3WVJA 2Y6HA 4GMP0 3DKWA 5FP3A 1HJGA 3POYA 3RJRA 3UYJA 3WG4A 2H6CA 1NLRA 1NQDA 4OUMA 3VUOA 4KGGA 3WSOA 1QDOA 4QMAA 3OGSA 2ZBJA 1L7RA 5C9AC 2UU8A 4LBQB 2OUJA 4JC1A 4MSVA 5GLVA 4AI2A 4CCOA 4E4DX 4H3WA 4PT6A 3SCHA 1XRUA 2VW0A 4KG8A 3DUIA 2QQOA 3LDRA 1V6IA 5BNNC 1FX5A 4RS5C 2J7MA 2P37A 3DXTA 4KBBA 4ATEA 3KHCA 1NKGA 4ARYA 3ECQA 1QJU1 3NV1A 3N7JA 4XZPA 4QXKA 2OZ6A 5JAXA 3O1MA 1ZVFA 3TB0A 4AVBA 5FK7A 4Q2FA 2B42B 3WQ1A 5IVFA 4XHBA 4CZSA 4C1XA 4GH4A 4M3CB 1O8SA 2QZ3A 4AQ2A 4FOWA 3OOXA 4CEYB 4JGYB 3FUQA 1NZIA 3KMHA 1WLCA 2GMPA 4GKXA 5JIAA 5J37A 4P5HA 1QWRA 3S6PA 4EWDA 3TEXA 3VLBB 4GB33 2E6VA 4BU2A 1RUF2 2W68A 1H8TC 3UJOA 2DF7A 1UKRA 4E9KA 5A7QA 1FOD3 1LHOA 3RZJA 4BIOA 1AXZA 2Z79A 3FN9A 5BNNB 1CAUA 2BBAA 1OA4A 1XYOA 2ZZJA 1JYVA 1PK6C 2F17A 4TYSA 2VZ1A 3LD8A 5LBCA 3RVHA 3MIGA 2VM9A 4YLZA 1YO8A 1UW8A 3PU8A 4PLMA 2V4VA 1ZRIA 3AJYA 5F6KA 5A1FA 1XPWA 2FCUA 3FHQA 1JS9A 2O0OA 3J7MA 3NJYA 4JV4A 3ZMOA 4DINB 4D6SA 4MV2A 1JYXA 1WMXA 1W03A 1OVSA 1S2BA 2D6KA 2D6MA 3HR9A 3PJYA 4D94A 5J1XA 3HBKA 1MS0A 4MO3M 4ZONA 2FHRA 2WBKA 4H7MA 1K5MC 3VZKA 1RUD2 3O1SA 4XXPA 2AACA 5F3GA 1V0AA 5DUUA 4IXLA 3RFRA 4Y22A 5CA6A 1I3HA 2HWC2 1RUD1 1XBFA 2C24A 2ZGMA 3VKLA 4XZUG 4C1WA 2VMGA 3WNMA 3ZKUA 4IV1A 4HXCA 3CO2A 1AR92 1RTVA 2D6OX 4FPYA 1V00A 4FFGA 3IMMA 4XBLA 2DWRA 4P9GA 4CXWA 1AJKA 1UY0A 1VBC2 3UGGA 1K3IA 1XNCA 4Q5OA 1RUE1 2R30A 3WNXA 1W8ZA 4PJYA 2L9LA 2BEOA 3D4KA 3C7OA 5SV8A 4CSWA 3IPVB 5FLIA 3OPTA 3C8XA 2N7GA 3FUOA 1AHSA 3WX5A 4CDQC 3VD9A 3GM8A 1F2NA 4N43B 4LIUA 2ET7A 3GBFA 5KC5A 2PHLA 2VOVA 4TLFA 1JOPA 4IV3C 1OSGA 3I4IA 5JZGA 1QNYA 1R1A2 1WZXA 3KV5A 3NAPC 5C4WC 5IVCA 2WAOA 1KEXA 4XW3A 4QKDA 2R072 3E5QA 4HKWA 1N1VA 1W6PB 1Q8PA 1EV13 1YLLA 3HN1A 3LPGA 4OI2A 1Q8VA 1W6QB 1CZVA 2VL4A 3PVOA 5A6ZA 3ZXFA 2C5DA 3HNMA 4H7LA 4L99A 2DU0A 3I49A 1REEA 1RUC1 1VBE1 4R4ZA 3AMMA 2J1AA 3NMBA 4Q4X1 5LRSA 1NCQA 2XMLA 2YFUA 5C6CA 1LGBA 2NN8A 1TNRA 2R062 5BNQA 1WGPA 1BZWA 4RHV2 2PYTA 1ZA4A 1AYN1 2XHKA 2ZGOA 1H4GA 1WMFA 2BRTA 2GU9A 2CGNA 2E32A 2X5IA 3APBA 3KSCA 3RZHA 3ZFGA 5C8WA 4CVUA 2A5ZA 4JGZB 1CVNA 1RVF3 5T5PA 1JUHA 2ZZQA 3H1YA 3AYCA 1ND2C 3CU7A 5FUNA 2JG9C 2RM22 3DPRA 3KQ4B 4XFIA 3NWKA 1XE8A 2UYAA 1RUH1 2FCTA 5A3MA 1ULGA 1QY4A 1QGLA 4CDUB 1TNFA 3D0JA 4AVAA 4NIHA 2NPIA 1HB1A 2W92A 2XUEA 2C26A 2UURA 2DFCA 3AFKA 3WUCA 1LOFA 1UOJA 4NUBA 3V0BB 5LA9A 4A44A 5KC6A 4LE4A 1D4M3 1TME1 3A4UA 1HN0A 4CUGA 4IERA 5FY7A 1RUC3 5CKMA 4UYBA 3WDYA 5FZOA 4A41A 3BIEA 2WO2A 1UOGA 1QOSA 1URXA 2OW4A 4LA3A 4IEUA 1ZBA3 2C6SA 1QJY2 4FXKB 4B1MA 4EWAA 1AR73 2YC0A 2RR13 2FMYA 2E33A 4KWUA 5B2GB 2W0XA 3OTFA 4AW7A 2P34A 5F7UA 1CAWB 3FLTA 4CDXC 3T4VA 4CU7A 2LS6A 1KS5A 1LJ7A 1OLQA 1OLME 2VTXJ 2WYFA 4RGGA 4WM8C 3IIIA 4FI9A 3JD72 1HRI3 2RV9A 2XB6C 4LKFA 2IZWA 5F5AA 5BY5A 1OKQA 3MIEA 3O14A 5CFCB 5H9RA 4YGBA 5FQ0A 3R6SA 1WW4A 2WFF2 3ZDVA 3CF6E 1STMA 1TMF1 5K7PA 1MVEA 2EIEA 3WP6A 1HRV3 3OEAA 5FXZA 3V56A 3GZAA 4LXLA 2CSGA 2HWC3 2LM3A 2VMIA 1D4M2 2VVDA 1TMF3 1TMF2 2K9ZA 2LTNA 4OMCA 4GD4A 4DS0A 5CIRA 2Y6KA 1DGWA 3B5LB 3D0SA 3ILFA 2J1RA 4ISQA 4LK7A 3RZGA 3VD5A 4AAPA 4HOOA 5JOZA 2VMCA 2DCZA 3WDUA 3WW4A 1OT5A 2DUPA 2E9QA 3ILRA 2Q0AA 3L2HA 4QXHA
chains in the Genus database with same CATH topology
4CXWA 2FDJA 4NIIA 3I49A 4QKNA 4QHOA 4IE0A 3O1MA 3H8XA 3BU0A 4ZS2A 3H8OA 4NROA 2FDHA 3RZMA 4O61A 3T3YA 3RZLA 3LFMA 4CXXA 4ZHNA 4NIDA 3O1RA 3BUCA 4IE4A 3H8RA 4NPMA 3BI3A 3S57A 3O1VA 4IE6A 3BTYA 3I3MA 4ZS3A 3BTXA 4RFRB 3KHBA 2FDFA 4IDZA 3BTZA 4IE5A 3I2OA 4NRMA 4JHTA 4QKBA 3BIEA 4NRPA 4NJ4A 3RZHA 4IE7A 4MGTA 5F8PA 3BKZA 4NPLA 4NIGA 3T4HB 5DABA 3O1SA 3RZGA 3RZKA 4NRQA 4O7XA 3O1UA 2FDIA 4OCTA 4QKDA 3O1OA 3KHCA 2IUWA 3S5AA 2FD8A 3RZJA 4MG2A 4QKFA 3I3QA 4CXYA 2FDKA 2FDGA 3T4VA 3O1TA 4NIHA 3O1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXW A;  2FDJ A;  4NII A;  3I49 A;  4QKN A;  4QHO A;  4IE0 A;  3O1M A;  3H8X A;  3BU0 A;  4ZS2 A;  3H8O A;  4NRO A;  2FDH A;  3RZM A;  4O61 A;  3T3Y A;  3RZL A;  3LFM A;  4CXX A;  4ZHN A;  4NID A;  3O1R A;  3BUC A;  4IE4 A;  3H8R A;  4NPM A;  3BI3 A;  3S57 A;  3O1V A;  4IE6 A;  3BTY A;  3I3M A;  4ZS3 A;  3BTX A;  4RFR B;  3KHB A;  2FDF A;  4IDZ A;  3BTZ A;  4IE5 A;  3I2O A;  4NRM A;  4JHT A;  4QKB A;  3BIE A;  4NRP A;  4NJ4 A;  3RZH A;  4IE7 A;  4MGT A;  5F8P A;  3BKZ A;  4NPL A;  4NIG A;  3T4H B;  5DAB A;  3O1S A;  3RZG A;  3RZK A;  4NRQ A;  4O7X A;  3O1U A;  2FDI A;  4OCT A;  4QKD A;  3O1O A;  3KHC A;  2IUW A;  3S5A A;  2FD8 A;  3RZJ A;  4MG2 A;  4QKF A;  3I3Q A;  4CXY A;  2FDK A;  2FDG A;  3T4V A;  3O1T A;  4NIH A;  3O1P A; 
#chains in the Genus database with same CATH topology
 1B35 C;  2FDJ A;  2JDZ A;  2BNO A;  2WT2 A;  1MQT C;  3D5O A;  2VZQ A;  5FZB A;  4XIO A;  5FOJ B;  2G9G A;  2YFZ A;  1A3K A;  3E97 A;  3NKT A;  4Q4V 2;  4CXX A;  5C8C A;  2WZR 1;  2OZJ A;  4NWV A;  2WNU C;  3ES1 A;  3I8T A;  1ZRD A;  3ZN5 A;  4TN7 A;  4NMI A;  3KHB A;  5HCH A;  2WZR 2;  2Y33 A;  3BPZ A;  4H55 A;  4N53 B;  1US2 A;  2RS5 2;  2QQN A;  5LK7 B;  2H6B A;  1O4Z A;  2DCT A;  3M7A A;  3O1U A;  1V6M A;  4KU8 A;  2RS5 1;  4IGO A;  2YXS A;  5J96 B;  4KI5 M;  2QQU A;  1YFW A;  2J1U A;  1UOB A;  1BBT 2;  2RS3 1;  2CHH A;  3ZXA C;  4COW A;  4LTA A;  3ROU A;  3UK9 A;  3I2D A;  3VHN A;  1ZX5 A;  4LBO A;  5I0T A;  4B8E A;  4CCD A;  5DN2 A;  3VD3 A;  4YZ4 A;  4YW3 A;  3WP5 A;  1SPP A;  4PBP A;  2K46 A;  3MW2 A;  4ATF A;  3PNA A;  4D3W A;  4XHX A;  1CR7 A;  4B7K A;  4G9S B;  3GAL A;  2P17 A;  4PLN A;  3CJI C;  4HVR A;  3NV3 A;  4IDZ A;  1NCR B;  5JXG A;  3ZXK A;  2WO7 A;  3WY6 A;  1AJO A;  2R06 3;  2EIB A;  4JKL A;  2BJS A;  2WJS A;  3NRU A;  5APA A;  3A0K A;  2PHT A;  3NNF A;  3B93 A;  2EAK A;  3UJQ A;  3R4U A;  4UW5 A;  2VZO A;  4FOV A;  2VW2 A;  2CAV A;  1C4R A;  2OXB A;  2C9K A;  5JOY A;  1G9B A;  1RC6 A;  3LSE A;  3ZM8 A;  5FJH A;  5C3S A;  1Q8Q A;  2IXK A;  4UBG A;  2TUN A;  5LY1 A;  1OUX A;  4IV3 B;  2YG0 A;  2OPW A;  4QB2 A;  3W20 A;  1VMF A;  1WD3 A;  2VH9 A;  1OLR A;  3IIA A;  4MH0 E;  5AVA A;  5FLJ A;  3S7I A;  4XYX A;  2GND A;  3G7D A;  2ADE A;  2HEW F;  1LGN A;  5FPU A;  4B3N A;  3WP3 A;  3TEZ A;  4YWA A;  2R1D A;  3AP7 A;  3AZX A;  4XFG A;  3LOB A;  3SCG A;  1ZM1 A;  4XUP A;  3AXD A;  2P3Y A;  4CP2 A;  1LOC A;  1CIW A;  4EZH A;  4AQT A;  1ZRE A;  3LEI A;  3AP5 A;  3BVC A;  2JEN A;  2VQ0 A;  3CBN A;  4IEQ A;  4W4Z A;  4XQW A;  3MFA A;  1V70 A;  5IWF A;  4FAG A;  5FZF A;  5BNO C;  1LHN A;  3HBZ A;  4KGQ A;  1GLH A;  4Y20 A;  2VY0 A;  2YV8 A;  4YW6 A;  3VD4 A;  1OUS A;  2NP0 A;  5BNP A;  1GQP A;  1C57 A;  2JWP A;  5K0U B;  1JTZ X;  2PFW A;  2FZ2 A;  1ND2 A;  1YNA A;  2EXK A;  4OQ9 A;  4N7I A;  2G19 A;  4OI4 A;  3THC A;  1UD1 A;  2ZGS A;  5CNA A;  5J36 A;  3HD8 B;  2HEY F;  2PQS A;  3HWJ A;  2X5I C;  4CUC A;  1F15 A;  4Y33 A;  3K46 A;  5IHR A;  1W6N A;  4J1W A;  4Q26 A;  2PAE A;  4HK9 A;  5FZL A;  2XHN A;  2WZP P;  5FPZ A;  3UGF A;  1VBA 3;  4BMB A;  2ZX3 A;  2QUO A;  5F2S A;  1K5M B;  5FYZ A;  1YCI A;  1D0G A;  1S0C A;  3ACG A;  4JRA A;  5EHD A;  3VZO A;  1O3R A;  1OA2 A;  3KVA A;  4MZU A;  2BNM A;  1GWM A;  1K42 A;  2BVB A;  2B8M A;  1UAI A;  3ZFF A;  5CU1 A;  3ZFG C;  5GZE A;  1W6O B;  1DQ4 A;  4XF9 A;  1UX6 A;  3HJR A;  3VBR C;  4HK8 A;  2WQ8 A;  4ASL A;  2UWB A;  4XF4 A;  3WW1 A;  4A3Z A;  2XJT A;  1BMV 1;  2D40 A;  4Z82 A;  4IES A;  2V09 A;  1M4W A;  2X53 S;  3NQH A;  1TG7 A;  1HXS 3;  5FYY A;  3DGT A;  2X8K A;  3JU9 A;  4UI9 L;  5L36 A;  3KLS A;  3T1M A;  1DP0 A;  1PO1 3;  1PO1 2;  2YPD A;  3IB3 A;  2Z5W A;  3IN9 A;  4SBV A;  5EV7 A;  5FZO B;  3SH3 A;  2CWM A;  3B69 A;  1JZ2 A;  3H1W A;  1YJK A;  5FPB A;  3ZMN A;  4GA9 A;  1CZT A;  1MPX A;  1ULD A;  3NAP A;  2QTW B;  1VJ2 A;  4UFL A;  2GAL A;  2VOT A;  1IS3 A;  1JYT A;  2CYF A;  4I3P A;  4YZ5 A;  3TYJ A;  5FYB A;  4WVW A;  3HT1 A;  4P02 B;  3NJV A;  1IG0 A;  1ALY A;  1WW7 A;  2YMZ A;  1LEN A;  1WCQ A;  1UYZ A;  2ZKN A;  4GMP 3;  4N9I A;  4XFA A;  2ZEY A;  1OH4 A;  2RS5 3;  5FZI A;  4QGN A;  1O3T A;  3GCX A;  3Q9O A;  4KBZ A;  2ZA9 A;  4UW4 A;  4Q0P A;  4WV8 A;  4OUL A;  2D6N A;  4F83 A;  1NA1 A;  3K3O A;  4FPG A;  1C1F A;  1IZ3 A;  4NHX A;  4P9J A;  4QPG C;  4MG2 A;  3MUY 1;  1YC6 1;  5F3I A;  4OMD A;  4BQ4 A;  3B02 A;  3BCW A;  2JIC A;  4XF0 A;  2ZAA A;  3NKG A;  3ZYI B;  5ABJ A;  4JAA A;  5FY4 A;  4IGQ A;  1W8U A;  2BFU L;  2R49 A;  4MHR A;  2ZHM A;  3VBU C;  1UWW A;  1N3O A;  4YFW A;  2IVJ A;  1TZO A;  4YM1 A;  2QQM A;  2A70 A;  4F7Z A;  4GH4 C;  5G05 L;  2IWG B;  4AG4 A;  2VVE A;  1U12 A;  3WOG A;  3KT1 A;  5ACA 3;  2CGP A;  2ZCW A;  3LIH A;  4IE5 A;  3J8F 2;  4P08 A;  3UV9 A;  1IPK A;  1RJ8 A;  5DUX A;  1GSL A;  2WN2 A;  1LB2 A;  5F5Q A;  1C5I A;  1OF4 A;  1L7Q A;  1KFU L;  3AX4 A;  4LBM A;  2P3J A;  2LAL A;  2Z2S B;  3OF1 A;  4HET A;  2WRA A;  2R0H A;  4C91 A;  3AL5 A;  1D2S A;  2D3P A;  3HQX A;  4BQ5 A;  4YGC A;  2ZKL A;  1NZC A;  4FPC A;  4AEM A;  1RUF 1;  1HV0 A;  1VRH 2;  1Q8S A;  3LB9 A;  3OPW A;  3OY8 B;  3UKT A;  4LKE A;  2VCB A;  2ILM A;  4RQP A;  1WBL A;  2BU9 A;  1MEC 3;  3C7G A;  1RUI 1;  3MLL A;  3N7L A;  5J98 B;  3T3Y A;  3WG1 A;  4DPN A;  4BM8 A;  5KHK A;  4PDW B;  5A7W B;  1ZNP A;  4ASM B;  3OGR A;  1U0A A;  3T0B A;  3ZSK A;  2W94 A;  3JXS A;  4C0B A;  5ERL A;  3J26 N;  4CEY A;  1I5Z A;  3MW4 A;  2HYK A;  1XSQ A;  2HWD 1;  1HJF A;  2JG8 C;  2Q4S A;  4QB1 A;  5FWE A;  3PHM A;  5BV6 A;  4LOS A;  5KWR A;  1CWP A;  4ET7 A;  4W6W A;  1OQ1 A;  2HYX A;  1MZF A;  2HWD 2;  4HMZ A;  2YU1 A;  3J9S A;  3SMH A;  4I01 A;  2D97 A;  5FZE A;  5C70 A;  1X8M A;  3U4X A;  4UFH A;  3QAC A;  1CIY A;  3DXU A;  1W8H A;  2DCY A;  4DO0 A;  3FJS A;  4YW5 A;  1UO9 A;  5FPX A;  3J7L A;  3GXU A;  3AP9 A;  5BNN A;  3MUZ 1;  5JIU A;  1BVV A;  1LU1 A;  1IKQ A;  1AX0 A;  1W8W A;  2JDM A;  2XR4 A;  5FUP A;  3EBR A;  4XUQ A;  3Q8C A;  3B00 A;  5HCF A;  5LK5 A;  3AKS A;  4TLG A;  5GAL A;  5SV5 A;  1S0F A;  2WNO A;  2Q8E A;  5FR3 A;  1YFU A;  4XAC A;  3FMG A;  3VDB A;  2XLG A;  4FSJ A;  4A4A A;  3FLP A;  4AED C;  1EUU A;  4NRM A;  2GH8 A;  3GZU C;  3D3A A;  3U75 A;  2V72 A;  1PNF A;  3MID A;  4MET A;  4CTE A;  3OGG A;  1FPN 1;  4MXW A;  3NVC A;  5CFD C;  5AC9 3;  1CGP A;  1WA6 X;  2ZOE B;  5FYC A;  2ENR A;  4AI3 A;  1OI6 A;  1R1A 1;  1U5X A;  4FCA A;  5FP9 A;  3WF1 A;  1FPN 2;  4XCA A;  4M0H A;  1SDW A;  4XFB A;  3AMQ A;  1WW5 A;  3ZKY A;  5ANN A;  3JUU A;  1APN A;  3FBM A;  1IHM A;  5EFU A;  2WQ4 A;  3ATG A;  1RYY A;  5CVR A;  1NE4 A;  4FPL A;  3WDX A;  3CDZ B;  1R09 3;  3USU B;  5FYV A;  2PHF A;  1XU2 A;  1RIT A;  2G9F A;  5FP8 A;  1LKN A;  4MVT A;  5DG1 A;  4BQX A;  3ORJ A;  2W47 A;  5IJR A;  4N43 A;  4Z1V A;  1RUF 3;  4Q4Y 2;  4XTP A;  4I0W B;  4UF0 B;  2WIN B;  3AYA A;  1QOO A;  1QH6 A;  3W5M A;  4WM7 B;  4K8F A;  5T54 A;  3VD7 A;  4D8M A;  4XMA A;  2D5F A;  3O0W A;  3R05 A;  2WL1 A;  4FPK A;  5DZF A;  4A7Y A;  2B9V A;  1RUH 2;  1ND2 B;  2V5D A;  3GJA A;  2XWB B;  5ACA 2;  5EJZ B;  1HB4 A;  2A6Z A;  2OVU A;  3RZM A;  3AK0 A;  5ACA 1;  1CZS A;  1T6B X;  3AJZ A;  5EPA A;  4I02 A;  1W99 A;  3PLQ A;  3NST A;  1BK1 A;  1HXS 1;  1WA4 A;  2LW8 A;  1HRV 2;  4RQP B;  3U14 A;  2E7Q A;  3WP4 A;  2GH2 A;  3VB9 A;  4XUO A;  1HRV 1;  1YUD A;  3GCW A;  4PDW A;  5A7W A;  1QJX 2;  1QJX 3;  4HG6 B;  5H9S A;  2Q8O A;  2VO5 A;  3M70 A;  1QMJ A;  1Y9Q A;  1QOT A;  3ZYB A;  1JXN A;  4FPF A;  4Q4V 3;  4XBQ A;  3BN6 A;  1IPS A;  4MXW B;  4COV A;  2IXI A;  2X10 A;  3KV4 A;  5FZ9 A;  1AR8 1;  5KR7 A;  3A22 A;  1WCK A;  5LA1 A;  3POI A;  2EIG A;  2ZGK A;  5H9P A;  2ZEZ A;  3P3P A;  5C4W B;  2OT7 A;  4Y1V A;  1FV3 A;  1H8V A;  2WNE A;  3UGH A;  4AED A;  1CX1 A;  5HPO A;  2QJV A;  5A3L A;  3NJX A;  4NPM A;  2W39 A;  1JZ6 A;  4Y1Y A;  3V65 A;  5CB7 A;  1EAH 2;  2KD7 A;  1WCU A;  2ARB A;  3ZYJ B;  2CGO A;  1ENS A;  1ZZ9 A;  5ANQ A;  4N8M A;  4NAO A;  3LE0 A;  4GB3 1;  1Y43 B;  2YGM A;  3M3Q A;  1OQE A;  2ZGR A;  5HV4 A;  1DZT A;  1D4M 1;  1TME 3;  2RHP A;  4Q1R A;  3RNS A;  3THP A;  3IM0 A;  4OI1 A;  4Y5Z 0;  2IVI B;  1DGR A;  2VEC A;  2XVL A;  4UF0 A;  1QQP 2;  1QQP 3;  4NHL A;  1VBD 3;  4ORF A;  4AQS A;  2W95 A;  4P9Y A;  2WLQ A;  1BEV 3;  4MGZ E;  5J48 A;  3H3Z A;  1MS1 A;  2ARX A;  4N9H A;  5FCC A;  3AC0 A;  5IT6 A;  1OKO A;  3AKR A;  4J1X A;  4Y22 B;  3ZDS A;  2QFE A;  1DG6 A;  4BIS A;  5FPV A;  1VB4 A;  1GP4 A;  2VQU A;  4NOT A;  3NO8 A;  2ZML A;  4AHX A;  4ZKT B;  5AFE A;  4DUW A;  1E57 A;  2ERF A;  2VCC A;  5KHH A;  1XQN A;  3U78 A;  5LWB A;  2VZP A;  1GOG A;  4MAD A;  1DCS A;  3POJ A;  4IE7 A;  4LUK A;  3GYD A;  4QWN A;  3AVR A;  1UZV A;  2VXR A;  4P5Y A;  1PK6 B;  1CN1 A;  1D7P M;  2HWF 2;  2UY9 A;  4OCT A;  5EYY A;  4DXT A;  4CCK A;  3GZT B;  1HQW A;  3N9L A;  5BUV A;  3F2Z A;  2HWF 1;  1I5P A;  4WM8 B;  4CPB D;  1SCR A;  2PTM A;  1C8M 2;  4BK5 A;  1XOY A;  4AFM A;  2XL7 A;  5A7P A;  4UT5 A;  2RS3 2;  1BBT 1;  4WZF A;  5EWS A;  3GDB A;  4GIQ A;  1GUI A;  4K7J A;  3ME2 A;  3S5Q A;  1G9F A;  1A6C A;  2BDR A;  1FAT A;  1ZZ6 A;  3FFZ A;  1DGR N;  4FFH A;  4CEY C;  1KS4 A;  1VBB 1;  1VIW B;  3AB0 A;  4DXS A;  3AL6 A;  5A80 A;  5IK8 A;  3E5X A;  1E5H A;  5FPA A;  3VZJ A;  4DEV A;  2RS1 1;  1LU2 A;  1UIJ A;  1QJF A;  4R9A A;  2RMU 1;  2R32 A;  4Q4W 2;  5IVE A;  3J4U H;  1RUH 3;  1ZZB A;  2RJK A;  5E8A A;  5JXH A;  2P5B A;  4Q4W 1;  5L9B A;  5GZF A;  4X6R B;  5FZ0 A;  1FT9 A;  5FP7 A;  1FMD 1;  2W1W A;  3ZXE A;  5C5T A;  2C1F A;  4YW1 A;  3VBU A;  1TQ5 A;  1XXN A;  1XNB A;  1YRZ A;  2CV6 A;  5ABJ C;  4K1Y A;  3HNY M;  4DOU A;  1JOB A;  1COV 1;  2OPK A;  5ABJ B;  4HPK B;  4LLO A;  4XUN A;  5T50 A;  2JJ6 A;  3NNM A;  4BHP A;  2GP5 A;  3A7Q A;  5DAP A;  3VDA A;  4H2A A;  4M00 A;  5LBE A;  3DL3 A;  1PIV 1;  3FHI B;  3TRS B;  3T2Q A;  2DVG A;  1W2O A;  1I6X A;  2JB8 A;  4GAL A;  4UBH A;  2K0G A;  3T09 A;  5AC9 2;  1VBA 2;  3FHA A;  1VMH A;  2JG9 B;  5CFD B;  4Z2A A;  1NA1 C;  3RQ0 A;  5FY8 A;  1AR8 3;  1XYP A;  3WF0 A;  5FWJ A;  4YPJ A;  1COV 3;  3IDC B;  2QDN A;  3URF A;  3AKQ A;  5J09 A;  1EV1 2;  2E7T A;  3S7E A;  4LHK A;  4AK3 A;  1EV1 1;  3AMH A;  4JHT A;  1C28 A;  1CES A;  3GHM A;  4YZ3 A;  3ZN6 A;  2ZX1 A;  3ZSE A;  1LHV A;  2OUH A;  3O5S A;  4YG6 A;  5FMO S;  3ZSL A;  2VZS A;  2MNG A;  2HWC 1;  5L7O B;  3K75 B;  3V0B A;  1SLT A;  2R7E B;  1S0J A;  4C8D A;  1KRI A;  1EPZ A;  4IET A;  4BQ2 A;  3C2U A;  2A71 A;  1W2U A;  2JEC A;  1VR3 A;  1HRI 1;  4N7U A;  5T5J A;  1CJD A;  1X36 A;  3RDI A;  1L3J A;  1W28 A;  3ZPY A;  5LBF A;  3VKO A;  4NN0 A;  1O6U A;  2EXH A;  2QE3 A;  1V9U 2;  3H50 A;  5FRE A;  4CDQ B;  4ZU5 A;  4XJ8 A;  5T3N A;  3MI8 A;  3VBR A;  5DXD A;  1HQN A;  1V9U 1;  1S0E A;  2RG4 A;  3JQX A;  3N9N A;  2VNG A;  3OPZ A;  3OBT A;  1ODM A;  2K2S A;  5GLT A;  1VRB A;  3RPQ A;  3ZFF C;  2O8Q A;  3WUD A;  2AGS A;  3AMP A;  5CYY A;  1OFN A;  4FAH A;  4I3G A;  4PHZ A;  5D2A A;  1AR6 2;  4QXC A;  1VBE 2;  1RUC 2;  2D43 A;  5FTT C;  2VMF A;  1EY2 A;  5LA2 A;  4FT8 A;  5C5U A;  3WDW A;  1GWK A;  2HWE 3;  3ETQ A;  4YM2 A;  2VUL A;  2IXH A;  2P4E A;  3LKJ A;  2A6W A;  2XON A;  2D6P A;  2ZHN A;  4A7Z A;  2HWB 3;  1IS5 A;  1PMI A;  1H2M A;  3ABZ A;  5I0D A;  5A3P A;  4Y4R A;  4AR2 A;  4BA6 A;  2BP6 A;  5FXX A;  2GP3 A;  3OD0 A;  1NLS A;  4GAZ A;  3OG2 A;  3HPN A;  5C3R A;  2Y38 A;  5E1R A;  1OXC A;  5GZD A;  3CMG A;  2KXL A;  3PDQ A;  1W6M A;  1OOP A;  1UU5 A;  4RR3 C;  1UF2 C;  3ZFE C;  3POG A;  2WFF 3;  4D7T A;  1GZT A;  5A3N A;  1O8P A;  4IEP A;  4HN0 A;  1GZW B;  3DF0 A;  4RL7 A;  1R08 2;  5HCB A;  3FLR A;  2FDK A;  4LBK A;  4TSV A;  1R09 2;  1CJP A;  1UXZ A;  3I3E A;  2VNR A;  3MEP A;  4K3U A;  2JDY A;  4V1P A;  1JBC A;  3HIF A;  4LE3 A;  2W87 A;  3WEZ A;  4JHZ A;  4AZZ A;  2FDH A;  2HWF 3;  4WM7 A;  1ND3 A;  5FZ6 A;  3VBF A;  5GLW A;  3BI3 A;  4CP1 A;  4E4H A;  4XEZ A;  1UYP A;  1AR7 2;  2PMW B;  4WVM B;  1UQX A;  3I3M A;  2RDS A;  1KJL A;  1UY3 A;  4ITC A;  4NAM A;  4U36 A;  2ZGL A;  3N9Q A;  1A34 A;  4URA A;  1XC6 A;  1R64 A;  1UX7 A;  1GIC A;  2G1M A;  2DFB A;  4MGI E;  1Y3T A;  3V0A A;  2XDV A;  3N7M A;  3WDT A;  2EXI A;  2J1T A;  3AYD A;  5CG9 A;  4PIY A;  5BPX A;  1ZBA 1;  3HOB A;  4UW6 A;  1HW5 A;  2VOW A;  3PIG A;  5IFT A;  5LW9 A;  2ZGQ A;  2HWB 1;  4XJ9 A;  4FP3 A;  5IUQ A;  1X50 A;  1OMI A;  2RVA A;  1ZBA 2;  4NII A;  1HLC A;  1R08 3;  1SG3 A;  1F5F A;  1UN1 A;  3PUA A;  5C7G A;  5FYT A;  4M4R A;  3SC7 X;  3NV2 A;  5A70 A;  5GZC A;  2DBI A;  5F6L B;  4JGY C;  2ZHL A;  4JDM A;  1AL0 G;  1VAK A;  4GJY A;  2EA7 A;  5FZ8 A;  1SPP B;  3MYX A;  5K9Y A;  2TBV A;  2VZU A;  2WAB A;  3ETP A;  3ZXG A;  4HSJ A;  2E51 A;  3ZXJ A;  2H0B A;  2YB7 A;  1PVC 3;  5JXJ A;  5JR7 B;  1IPJ A;  4Y20 B;  4CDU A;  3RG0 A;  1UZW A;  2JDU A;  2XJP A;  2WSV A;  1PM7 A;  4I30 A;  3D6E A;  5IW0 A;  1LOA A;  1JI6 A;  1W9F A;  4Q29 A;  2WWU A;  5DUV A;  4D0Q A;  1POQ A;  2FBE A;  5FYH A;  1RJ7 A;  3I2I A;  1QXJ A;  4Q4Y 3;  2O1Q A;  1G7Y A;  2I74 A;  4NHM A;  4AYU A;  4Q8K A;  1IGO A;  4YVS B;  1NCR C;  2AR6 A;  2BW8 A;  2WLP A;  4AI1 A;  1HX6 A;  3KGL A;  3KWV A;  4QDS A;  2ZEW A;  2R6Q A;  1Z78 A;  4FTB A;  3OYW B;  4JKK A;  5DG2 A;  3VKF C;  4JVA A;  4AVS A;  4JRL A;  4UXA A;  4IV3 A;  5JZG C;  2PAM A;  1V9U 3;  2Q8D A;  2W1Q A;  3WV6 A;  1VAL A;  3MO4 A;  1US3 A;  1Z7S 3;  4LLF A;  3I2G A;  4HN1 A;  4PCR A;  1B35 A;  1NE6 A;  1H2L A;  2JE9 A;  2FD8 A;  2GZW A;  1H6X A;  2GMM A;  4A3X A;  1MS5 A;  2VCA A;  1W2N A;  3VBF C;  2DTW A;  3J7H A;  3SNM A;  4DQA A;  3IDA A;  1GZW A;  4XDO A;  1X9P A;  3C7F A;  3LA7 A;  3SKV A;  4W50 A;  3O0X A;  2Y60 A;  3AM2 A;  1Q3E A;  1TE1 B;  4CA9 A;  4HLT A;  4EN8 B;  3M4F A;  1LOF C;  2GNM A;  3HT2 A;  3WW3 A;  1RUJ 3;  2OA2 A;  1UU4 A;  5CKQ A;  1F31 A;  4NJ4 A;  1RUI 3;  1N1Y A;  2HEV F;  1YQ6 A;  2WT1 A;  5JLV A;  3PJQ A;  5JSR A;  1QU0 A;  4E4Z A;  3ES4 A;  2D7F A;  4RSU A;  3WNP A;  1NXD 1;  2YBK A;  4QQL A;  1A78 A;  2GNB A;  4AI8 A;  1W04 A;  3K77 A;  5GM0 A;  5DMY A;  2HWD 3;  4R8H A;  1Y9M A;  3BB6 A;  4IV1 B;  4QX0 A;  1W9W A;  4M3C E;  4Y24 A;  1FMD 3;  3VGI A;  3PTY A;  3S57 A;  3M3I A;  2DVF A;  2AC1 A;  2MEV 2;  2QQL A;  2XQX A;  1SBF A;  1WWY A;  1YIF A;  2VD7 A;  4B1L A;  4E2Q A;  4M0N A;  4DXZ A;  5HXV A;  2MEV 1;  1ST8 A;  1W6O A;  3BKZ A;  4NPL A;  1LOD A;  4XIK A;  1QJY 3;  3OSD A;  1RUJ 2;  4QU1 A;  5I8Y A;  3PL0 A;  1DF0 A;  3WF2 A;  4GJZ A;  1W8F A;  2RS1 3;  3CHX A;  4YW7 A;  1AYM 2;  3MIC A;  4BQ3 A;  2J42 A;  5EIY B;  5CG8 A;  2B7Y A;  1QXP A;  5C4W A;  1YJL A;  3HAG A;  4QPI C;  3BOP A;  1OBN A;  2XGX A;  1N47 A;  5FZ7 A;  3PU3 A;  4HSL A;  3MBW A;  5JOW A;  1J58 A;  2BGO A;  4GZ9 A;  1POV 0;  2NYY A;  3MPP G;  3VZM A;  5E89 A;  4COU A;  1JYC A;  2W5F A;  4AGG A;  4EJR A;  4FOY A;  4Q4W 3;  2DV9 A;  3PVN A;  2Q5T A;  1RXF A;  3B01 A;  3DEC A;  3ZYG A;  4YG0 A;  3T2P A;  4AAX A;  5CAZ A;  3KVB A;  3M3O A;  4COZ A;  4Y1X A;  2E7A A;  5FY0 A;  3AVS A;  1Y9G A;  1UZ0 A;  4JTO A;  1OLM A;  3T4H B;  2IXC A;  2FCV A;  2CWS A;  1W6P A;  4JQR A;  4D7Y A;  3BGA A;  2PLV 1;  2VC9 A;  4FFI A;  3ZX7 A;  3KCY A;  2CDO A;  1C8M 3;  1WMD A;  2FMD A;  5FKC A;  3O1T A;  1JUI A;  3KS7 A;  4QKN A;  2ATF A;  1A8M A;  1OC1 A;  4AFB A;  4BE3 A;  3UKV A;  2D3R A;  5IVJ A;  1D2Q A;  4CCM A;  1DLL A;  5F1R A;  1YYN A;  3O0V A;  4AL9 A;  3UNP A;  1JMU B;  3WT3 A;  3Q8E A;  2DUR A;  2WNV A;  1UZY A;  2VTX A;  3FZ3 A;  3RWK X;  2P6C A;  5C33 A;  5IVV A;  2E31 A;  2QQI A;  2PHX A;  1PO1 1;  1MEC 1;  3CZJ A;  4QKF A;  2VCM A;  3G6J B;  2OYZ A;  5HI0 A;  1LAJ A;  1UIK A;  1XJA A;  4A7K A;  1PMH X;  3P6B A;  1HB2 A;  3T0D A;  5B4N A;  1LHU A;  2J1V A;  1C1L A;  2WR9 A;  4PQQ A;  5LB6 A;  5E6H A;  4WZC A;  4CUA A;  1H2N A;  3O1R A;  1MZ6 A;  1RUG 2;  3LGR A;  4DUV A;  3WG2 A;  1LHW A;  1ASJ 2;  4XC9 A;  2KA3 A;  1PZ7 A;  1VBB 2;  4FO9 A;  4M3C F;  4CCC A;  3U37 A;  2Y0I A;  2V4A A;  3TNP B;  4GKY A;  1EAH 3;  5A3W A;  2QBX A;  4XMI A;  2W46 A;  2WZR 3;  1MZE A;  2UYB A;  1QJU 2;  4R9C A;  1PK6 A;  1UPI A;  3DPR B;  2A3W A;  4JQT A;  4IEW A;  1IQD C;  3UET A;  2BNN A;  4EN7 B;  2AEZ A;  4XFC A;  3VDD A;  3I3Q A;  4QM9 A;  1LEM A;  5FY1 A;  4AGV A;  4CEW C;  1FNZ A;  4DEQ A;  4Y1Z A;  2CY6 A;  4Y1U A;  4DY3 A;  1XNK A;  5L9V A;  4O9E A;  5DDJ 2;  5I8T A;  2ZMN A;  3ZVX A;  4LEJ A;  5FQ0 B;  2P2K A;  3K3N A;  3S0M A;  3PUI A;  2LRO A;  1AYN 3;  5GZG A;  5H9Q A;  2QQV A;  2G4I A;  3J8F 1;  5JDB A;  4IE6 A;  3ON7 A;  1C8N A;  2JX9 A;  3N36 A;  2YZ4 A;  3POB A;  3SEE A;  1JN2 P;  5A32 B;  4KH9 A;  3N7K A;  2HKX A;  3H8U A;  4Q4X 3;  4TXW A;  1ENQ A;  3UL2 A;  4AQ6 A;  4RGK A;  4CP9 B;  3L2Y A;  4ZU4 A;  2VR4 A;  5GJ6 A;  4Y3O A;  1F8V A;  2MEV 3;  1GNY A;  4NE9 A;  3C7H A;  3WHT A;  5IK7 A;  3H1M A;  2D44 A;  4MGY E;  3ITQ A;  4BYY A;  1T2X A;  4W65 A;  5EYX A;  1RUI 2;  1O7F A;  2Q1M A;  4RS5 A;  4QHO A;  2W08 A;  3MIF A;  3ACH A;  4QHB A;  4CDW C;  2JD4 A;  1CQ9 A;  2CL2 A;  1VBA 1;  2GSY A;  4NRO A;  4P00 B;  3ZYF A;  4BXF A;  2ZS6 B;  3KQR A;  1W2A X;  4XFF A;  3TN9 3;  4N43 C;  5DDJ 3;  4E2G A;  1NQJ A;  4YFZ A;  3BOD A;  3K48 A;  4OI0 A;  1NX9 A;  2ETE A;  4K40 A;  4P9W A;  4S2F A;  1G9C A;  3B7M A;  4NPR A;  2D3S A;  4B4Q A;  4NR1 A;  3DN7 A;  1W9T A;  2TNF A;  2VUC A;  4R9D A;  3KD4 A;  1SCS A;  4OZX A;  3L9J T;  4C0H A;  5A3T A;  5IVY A;  2NM1 A;  4BZ4 A;  1Q5O A;  3RJ2 X;  1QEX A;  3NNG A;  5FZA A;  4PIX A;  1AXK A;  2WYS A;  1DQ2 A;  1JU4 A;  2VBB A;  1GNH A;  1ACC A;  1K5J A;  2OX0 A;  3W58 A;  5FXW A;  1HRI 2;  1AR9 1;  1VP6 A;  3U1X A;  1BK0 A;  3AP4 A;  2W1S A;  3EHK A;  2XBO 3;  3QH6 A;  2VQA A;  4CCE A;  1X33 A;  2IFR A;  2YBP A;  2XLA A;  4JCK A;  1SQ4 A;  1WBF A;  3HMY A;  3QH7 A;  4AFD A;  1IKP A;  3VHR A;  1BHG A;  3OUH A;  3TN9 2;  2VQT A;  3DYP A;  4LNV A;  4RQP C;  4N53 A;  4CU8 A;  3ZYR A;  3TN9 1;  3LF7 A;  2BV4 A;  1W90 A;  1FI2 A;  2JEM A;  2E53 A;  3A21 A;  3LCP A;  3LIG A;  3GNE A;  4YVS A;  5FY9 A;  4ZY9 A;  5JPN B;  2X09 A;  3WR0 A;  1MS8 A;  5L7O A;  2JD9 A;  1SBD A;  3CJI A;  3HVD A;  4RR3 B;  3ZFE B;  2VTF A;  4BH9 A;  2VGD A;  4XF3 A;  3GGL A;  3IMN A;  3SCF A;  2R07 1;  5F39 A;  3BAL A;  3FL7 A;  3KV9 A;  1G86 A;  2QQW A;  1MVQ A;  1BJQ A;  4LBN A;  5C9A B;  1JZ7 A;  1GU3 A;  2FQP A;  2OS2 A;  3MV0 1;  3T0A A;  4AVC A;  2BWA A;  5F32 A;  3UKN A;  1GZ9 A;  2D5H A;  4UAP A;  5K0U C;  1FV2 A;  4J6G A;  4AGR A;  3PUR A;  3VDD C;  2VU9 A;  4FPO B;  4FP2 A;  3I97 A;  1RED A;  2WN3 A;  2R06 1;  4MOA A;  5IAT A;  5BNO B;  4F3J A;  1NCR A;  2RM2 1;  2PXJ A;  1UZZ A;  1PVX A;  3JQW A;  2EF6 A;  1GV9 A;  1E5S A;  3JZV A;  4ES9 A;  3FBY A;  2J22 A;  1JYN A;  1U5Y A;  2C0Z A;  5FO7 B;  3D8C A;  2FZ1 A;  1MS3 A;  5I0R A;  4XAB A;  4AWD A;  1J84 A;  1MQT A;  1AF9 A;  4ZS2 A;  4BQ1 A;  1TME 2;  5FUI A;  3GHN A;  4O61 A;  4YW4 A;  3WXP A;  1NY7 1;  3E6D A;  1MS4 A;  4QGM A;  1GOH A;  3JBG 2;  4JGZ C;  1OPM A;  1ASJ 3;  3NNJ A;  2PHD A;  5FO8 B;  3C3V A;  5FO9 B;  3JD7 3;  3USS A;  3HQU A;  5GLU A;  4Q27 A;  2DCJ A;  2FDI A;  3UES A;  3N4M A;  5CBL A;  1FAY A;  2WFP A;  3EXU A;  2C9A A;  1OOP B;  3K4Z A;  2WUH A;  2JG8 B;  4H14 A;  5L9R A;  5CEH A;  1I1E A;  1OOP C;  4QPG A;  3SKJ E;  3OD4 A;  1UMI A;  2QCS B;  2WNV B;  2LUW A;  5DQ0 A;  3USU A;  1FXZ A;  2AUY A;  4X8N A;  2NQY A;  2A6V A;  1S1A A;  1O5U A;  4PIZ A;  3H3U A;  2XVG A;  1V6J A;  4IE4 A;  1I9R A;  3JD7 1;  2ARA A;  4GWN A;  3P1I A;  2VVF A;  3AZV A;  1Y4W A;  3SH4 A;  5IVB A;  1D4V B;  2EAA A;  2ARE A;  1JH5 A;  1ULO A;  3OEB A;  4QB6 A;  3E5U A;  3POE A;  2ZGT A;  1DYP A;  4UFJ A;  2IXL A;  1KDK A;  2F4P A;  1PNG A;  1ONA A;  2PHW A;  1VBE 3;  2UY8 A;  2ZGU A;  3KV6 A;  4L11 A;  4OUS A;  5C3Q A;  2VNO A;  3RYP A;  4FTE A;  5JPM B;  2OKX A;  5AVP A;  4AOC A;  1GP6 A;  3QLQ A;  2FDG A;  4HFS A;  2F4L A;  1G6N A;  3WW2 A;  4D6R A;  5IK5 A;  2TEP A;  1IS6 A;  4B4R A;  4P9I A;  3GZE A;  4QQH A;  3POF A;  3MLJ A;  4GH4 B;  1RHI 2;  4M3C A;  4K1Z A;  4QPI A;  1OHF A;  2YYO A;  4RHV 3;  3RZZ A;  3PIJ A;  4UOJ A;  2NZ9 A;  2RR1 1;  3I7D A;  4XJA A;  3VBU B;  4PI2 A;  4RFR B;  4Q4V 1;  2JG9 A;  1DLC A;  1UYY A;  3D82 A;  1EP0 A;  2GC2 A;  1NA1 B;  5A33 B;  3MF6 A;  4XTM A;  2AEN A;  4AI9 A;  1C8M 1;  4GWJ A;  3M3C A;  1GQH A;  3VBS A;  4ES8 A;  1AR6 3;  5KHG A;  1M06 G;  2NMO A;  3LQC A;  2ZPX A;  1N3P A;  3BYW A;  2DVA A;  4PF1 A;  4QPG B;  4J25 A;  5GKA C;  1H8T B;  1W2T A;  1UPS A;  5IAV A;  1J3Q A;  2BVV A;  3IAP A;  4NID A;  4KWL A;  1GFF 2;  1CD3 G;  1NLQ A;  1CAX B;  3P3N A;  4XUR A;  3ZN4 A;  4A42 A;  3IT8 A;  4YSF A;  5A7O A;  4XAA A;  2ZAC A;  3DYO A;  4FPE A;  4XUT A;  1FPN 3;  1YIP A;  1PGW 2;  2DTY A;  2VNV A;  3WCS A;  5CFC C;  2XBO 1;  1W6Q A;  1V6O A;  5FP4 A;  2Y34 A;  1FOD 2;  5TSW A;  4JZR A;  3ZYP A;  1PGW 1;  1PVC 2;  1GNZ A;  2O14 A;  4YZ2 A;  1NCQ B;  4IEV A;  1PO2 2;  1PO2 3;  2GAU A;  4KWJ A;  1PVC 1;  3DEM A;  5D1I A;  4BXS V;  1RUG 3;  1UYX A;  5DAQ A;  5FJK A;  5JWP A;  1T6G C;  1F9K A;  1PO2 1;  3VBO A;  5A7S A;  1Z0H A;  3R0R A;  1AXY A;  1IG3 A;  4KL1 A;  3GJB A;  2VUJ A;  2ZGN A;  2B46 X;  3W21 A;  4X8P A;  3OY8 A;  1H30 A;  3N35 A;  5LAT A;  2DYC A;  3MV1 1;  1FNY A;  2ARC A;  3VHO A;  4CDX B;  4SLI A;  2R1B A;  2CDP A;  4FQ4 A;  4DB5 A;  3H0O A;  1ZZ7 A;  2EAL A;  3TOJ A;  5KXE A;  4FPH A;  4EN0 A;  2Y6G A;  4QD2 A;  3WIN E;  1SFY A;  1CPN A;  3HNB M;  1XE7 A;  3I2J A;  3OGV A;  3MFC A;  1Z7S 2;  2RJL A;  3HEI A;  2EVX A;  4G3Y C;  4XCB A;  2JDK A;  1Z7S 1;  4V2W A;  5A1A A;  4NWW A;  5CIS A;  3CKH A;  1GAN A;  4BCU A;  1SHW B;  1HB3 A;  3GF6 A;  4Q0V A;  3H8R A;  1PGL 2;  1S2K A;  4LJH A;  2YPJ A;  4CDW B;  1J3P A;  3OB8 A;  1PHM A;  4L0P A;  2FDF A;  1UCX A;  2XUM A;  4IL7 A;  4XDP A;  3VL9 A;  4CDU C;  1W0O A;  1RB8 G;  4ARX A;  3MW3 A;  4HL0 A;  1POV 3;  1S2E A;  2CU5 A;  4LO6 B;  2RJ2 A;  3LZZ A;  5FMB A;  3VBF B;  3VHP A;  3VBH B;  4OUE A;  1LNS A;  4PI0 A;  5LAS A;  5KXD A;  2VMD A;  5EJ1 B;  4LA2 A;  3VBH C;  3LFI A;  2WII B;  3KF5 A;  3VZL A;  3SH5 A;  4YM3 A;  5BNO A;  4BOW A;  4UW3 A;  4MGK E;  2AEY A;  1SDD B;  4BDV B;  3N9P A;  4YW2 A;  4L97 A;  3LFM A;  5C8C B;  3VV1 A;  4YVW C;  2JDA A;  5HV0 A;  1JHJ A;  2OQ6 A;  3LEG A;  5FZD A;  5KHJ A;  2ZAH A;  3O1V A;  4K20 A;  3ILN A;  1W06 A;  5L73 A;  4DUX A;  1UY2 A;  5F2W A;  3ZIW A;  2V73 A;  3A23 A;  3LA3 A;  4NIG A;  1W39 A;  1V6N A;  4QM8 A;  2R0F A;  1G9D A;  4BIF A;  4GMP 1;  4KG0 A;  1S0D A;  3AZY A;  1GR3 A;  5LZ6 A;  3GBG A;  1UY1 A;  1X82 A;  5T5O A;  1DBN A;  1H1M A;  2RDR A;  1RVF 2;  1SLB A;  1VMJ A;  1TEI A;  1ND3 C;  2CTV A;  3MIH A;  4BLI A;  3IDB B;  1PX4 A;  4OHZ A;  4DRR A;  5FY5 A;  1SLI A;  1ULE A;  4RN5 A;  1G8W A;  3T08 A;  1S4C A;  1YWK A;  1GYK A;  1H4H A;  1LR5 A;  2J1S A;  2VBP A;  4KQ7 A;  2A75 A;  4N53 C;  4O9G A;  5E88 A;  5F5I A;  2Y8K A;  4YAR A;  4ASK A;  3PUQ A;  3BTX A;  5FZC A;  5FAX A;  3VBO B;  2Q1F A;  4FBF A;  4AHY A;  5F3C A;  3DYM A;  2VZT A;  4XQD A;  4JTN A;  3SHR A;  4CDW A;  1ASJ 1;  5D21 A;  3WD5 A;  2WZE A;  1R08 1;  1PGL 1;  1LOG A;  5D8A A;  4GWM A;  3IZO A;  4OQ8 A;  2Q1Z B;  2JIG A;  3CQO A;  2SBA A;  3OJB A;  2VZ3 A;  4LO8 A;  4XJZ A;  3DPR C;  3T2T A;  4CDX A;  5I93 A;  3M8L A;  1W8N A;  5GLZ A;  4A6S A;  1XE0 A;  2C4X A;  2GDF A;  5I0U A;  3I2F A;  3IKW A;  4A45 A;  4OLL A;  2QQP A;  3WNK A;  3KZ4 C;  4L92 A;  3MHZ A;  5F37 A;  1VLN A;  1F5J A;  5T55 A;  4FFF A;  4Y5T A;  4TTG A;  1CAV B;  3HN3 A;  1H0B A;  4FOQ A;  2BER A;  1UMZ A;  3I2O A;  3OCP A;  2MHF A;  2JG8 A;  2SLI A;  1N1S A;  4D7S A;  1NOV A;  1G9A A;  2R04 3;  3ACL A;  4I09 A;  4CCN A;  2JDH A;  3OUJ A;  1NG0 A;  1ZRR A;  5LEJ A;  3E6C C;  4LR4 A;  4FQZ A;  4JKM A;  2PQQ A;  1AYM 3;  2W1U A;  3RI8 A;  1C5H A;  1LRH A;  2BFU S;  3IBM A;  1YHF A;  1W3V A;  4LQR A;  5FLH A;  3UT0 A;  2B4K A;  2BGC A;  2XWJ B;  4RS5 B;  3W9A A;  1NUK A;  3QD6 A;  3NW4 A;  1K45 A;  5FYI A;  5FZ4 A;  3ZOI A;  1JOJ A;  2GN3 A;  4PDW C;  1O3S A;  2DCK A;  3BPS A;  2XJQ A;  5DPN A;  4AED B;  5F3E A;  2O8O A;  4QX8 A;  2BOJ A;  3VDC A;  3M1H A;  1X7N A;  1EPW A;  1J1L A;  1Y7B A;  3RMX A;  4Z2W A;  1YEW A;  4MUV A;  1SFP A;  2WQZ C;  5DAV A;  5EP9 A;  3ALQ A;  3WHU A;  4E8D A;  1RUN A;  1KD7 A;  4DFS A;  1XND A;  5EJ3 A;  1VBC 3;  1DIW A;  4I0B A;  3IAQ A;  2RDQ A;  2YC4 A;  3A0N A;  1W05 A;  1YFX A;  1MZ5 A;  5HBA A;  1DZQ A;  1K5M A;  1P8J A;  1O4Y A;  1OPO A;  1U5Z A;  1OVP A;  1ZBE 2;  4KMQ A;  4K21 A;  4RYD A;  5LRR A;  5DZG A;  1YQC A;  3ZFF B;  1W0N A;  2EXJ A;  4PLO A;  3CJX A;  3OBR A;  2X05 A;  4D69 A;  2PHU A;  1W9Y A;  2VE1 A;  3CL1 A;  3HQR A;  5A33 A;  1RUE 2;  5KXB A;  3I59 B;  4N90 A;  2WZ8 A;  2WDB A;  3BTA A;  1VB2 A;  3OBA A;  3N3H A;  1NYW A;  2V5Y A;  1CX4 A;  4URT A;  4AVV A;  2P3K A;  2ZEX A;  3POW A;  3PME A;  4XAE A;  2YDE A;  4W8J A;  4BK4 A;  3U0Z A;  2GC1 A;  2Y6F A;  2ZX0 A;  3B9I A;  3ST7 A;  3H9A A;  4QGL A;  4YG3 A;  4AI0 A;  3K4A A;  5HCA A;  2PHR A;  4L2N A;  4IV1 C;  2QZ2 A;  2ID4 A;  2VXJ A;  4IUG A;  3B3Q E;  3EO6 A;  2PN5 A;  4IQP A;  2HWE 2;  4COY A;  5T5L A;  1RMU 3;  3LDK A;  3K2O A;  3U10 A;  2XKP A;  1RUO A;  1RUD 3;  3MGU A;  2CAU A;  1WD4 A;  1ULF A;  4Q4X 2;  1GP5 A;  3ZR5 A;  1OD3 A;  4EN9 B;  1BEV 2;  5G04 L;  2YC2 A;  3KB5 A;  3WZ1 A;  1QH7 A;  4RA0 A;  4EN6 B;  2AZ5 A;  2PAK A;  3BU7 A;  1XNT A;  1VRH 3;  1BEV 1;  1ZA7 A;  3LEM A;  1AYN 2;  3VL8 A;  2HBU A;  3LAG A;  5K4L A;  4Q8L A;  3RS6 A;  1WLW A;  1XU1 A;  1SEF A;  4HZF A;  1LGC A;  3U11 A;  2JE7 A;  3NAP B;  1UOF A;  2NLR A;  3FWE A;  2P3I A;  4XQ4 A;  2XJS A;  3ZXD A;  1PIV 3;  4YM0 A;  5HXM A;  2E26 A;  4PQ9 A;  3IPV A;  4LKD A;  4F8A A;  2HLE A;  4Q1P A;  1BVP 1;  2WWJ A;  1KQR A;  5FBZ A;  5JI9 A;  2XXZ A;  4MXV A;  4KNC A;  1HN1 A;  1QIQ A;  4R9B A;  1SBE A;  5A6Y A;  2VAU A;  4LHN A;  1NY7 2;  2VOK A;  4XOG A;  3WNO A;  2ZXQ A;  5J7M A;  2XH6 A;  1WUV A;  3VBR B;  4HPK A;  5FYM A;  3KGZ A;  2QNK A;  4LO4 B;  3RGB A;  3WQ0 A;  1AYM 1;  4AF9 A;  1QDC A;  1QJZ A;  2WSU A;  2ES3 A;  5JOX A;  4MYE A;  3QBQ A;  2JDP A;  3WF4 A;  4DXR A;  4XDQ A;  5BNP C;  2R04 1;  4CCL A;  1QJX 1;  4R52 A;  4A6O A;  2J1E A;  3EJK A;  2ZAB A;  3LA2 A;  1WLD A;  3GBW A;  2PEL A;  2ZX4 A;  3IDE A;  1LTE A;  2R04 2;  2ZJC A;  1CON A;  4IEZ A;  5EZW A;  4QXB A;  2W91 A;  5FZH A;  1UY4 A;  1ZRF A;  3W5N A;  3BU0 A;  5F5C A;  3I3D A;  4DZG A;  4IGP A;  2YGL A;  3THD A;  1XSR A;  1DQ0 A;  3AP6 A;  1EAH 1;  3F95 A;  4Q0U A;  4RD7 A;  4IEO A;  3WCR A;  3THT A;  5FZ3 A;  1J1T A;  4M01 A;  1ENX A;  4YYO A;  1DQ5 A;  4GB3 2;  4P9X A;  2H0V A;  2D6L X;  5JMC A;  1MAC A;  2YUE A;  3BTZ A;  4W6X A;  2X29 A;  3Q8F A;  3PVE A;  3EB7 A;  3SIT A;  3FE5 A;  4QU2 A;  3ACF A;  4OZO A;  3VKM A;  4BQY A;  4E8C A;  5C3P A;  4HT1 T;  1NAE A;  3EQE A;  4K9S A;  1J83 A;  4CCJ A;  2QDR A;  5JUV A;  2YY1 A;  4L8Q A;  2B39 A;  1WCD J;  1QJE A;  4LPL A;  2IUW A;  1W6M B;  3Q8B A;  5LBB A;  4RGA A;  5FZK A;  3RI9 A;  4S2G A;  1YQ5 A;  5A32 A;  3VZN A;  1AL2 2;  1QQP 1;  1V6L A;  3AKT A;  2BQP A;  2MPF A;  1QF3 A;  1RXG A;  1ZZ8 A;  4LO5 B;  3VDD B;  5JR2 A;  3RMY A;  1AL2 1;  3NL1 A;  4AEK A;  4DRV A;  5D8A B;  5JCT A;  4E27 A;  3T2O A;  2XKO A;  4QX7 A;  4MGS A;  4OHW A;  3OGJ A;  5BXX A;  1RIR A;  1TVG A;  2Q30 A;  5F9T A;  1FYU A;  2F6B A;  4ONU A;  5AFB A;  1H1A A;  1U5I A;  4QQP A;  4AFC A;  4DIQ A;  1RGS A;  2BUK A;  4LO7 A;  2ZTN A;  4YRD A;  1R1A 3;  2DVB A;  1X9T A;  2Y6J A;  2ET1 A;  3VBS B;  2VOX A;  4UFM A;  4GXL A;  4EE2 A;  3V0A B;  2XJV A;  5K8S A;  5E16 A;  2XOM A;  1JU3 A;  2A6X A;  3VKN A;  3P5B A;  3WQB A;  3X29 B;  1UL9 A;  1AVB A;  1GKB A;  4MX3 A;  3TBD A;  2WT0 A;  3R4D B;  3TAY A;  4Y26 A;  1O4T A;  3H8O A;  1KJR A;  3KCC A;  1RUG 1;  2WKK A;  3H7Y A;  1GWL A;  2GNT A;  5FPL A;  4HKO A;  3AXE A;  3MLK A;  5FMC A;  1Q43 A;  1BKZ A;  1OUR A;  1JW6 A;  2DDU A;  4WVV A;  3H42 B;  2BGP A;  4QKB A;  2VUD A;  4ERO A;  3AMN A;  4QT6 A;  4R4X A;  4G4F A;  2RS1 2;  1WW6 A;  2ORZ A;  2P6H A;  1DYO A;  4WVM A;  2QVS B;  1PZ8 A;  3POS A;  4NRQ A;  4O7X A;  2RMU 2;  1JZ8 A;  3ENR A;  4D6Q A;  3O1O A;  1LUL A;  1AR9 3;  4QX5 A;  5FZG A;  3JB4 C;  3ZR6 A;  1YQ8 A;  4XJU A;  3I3B A;  5DDJ 1;  5EXO A;  3RYR A;  2BOI A;  1EYB A;  3EMR A;  1JOD A;  1ZZC A;  2WAA A;  3RSJ A;  3BTY A;  4BME A;  3QCW A;  3H8X A;  1W8T A;  3N9M A;  4NHK A;  2D98 A;  3BIW E;  1FMD 2;  3PUH A;  5EQU A;  4X6Q B;  5A6Q A;  4KWK A;  1V6K A;  2HH9 A;  3NJZ A;  1IOA A;  1HIX A;  4LBQ D;  2W52 A;  4QHZ A;  1J59 A;  1BBT 3;  1RMU 1;  4U2A A;  4JGY A;  2WA3 A;  2VG9 A;  5CFD A;  1LED A;  3OYW A;  1COV 2;  3EYP A;  3INA A;  2YU2 A;  4LOT A;  4OHV A;  1HKD A;  1RMU 2;  4CUB A;  3WNN A;  2WC2 A;  4CEW B;  3MDP A;  1ULP A;  1YI7 A;  4FXG B;  3I2H A;  2BTV C;  1PIV 2;  1OFS A;  1RL3 A;  3I2K A;  4WM7 C;  4NO4 A;  5CAD A;  1KDM A;  4Y4Y A;  5IAX A;  4C90 A;  4DY5 A;  5AC9 1;  4OVE A;  5A3U A;  2QKD A;  1S0G A;  3ZSM A;  4BWO A;  5A6X A;  1F4A A;  5A7N A;  3BUC A;  2DVD A;  2QQK A;  4EYU A;  2R07 3;  4YVW A;  4YGE A;  1JYI A;  1H9P A;  2RS3 3;  3B94 A;  3S30 A;  3V64 A;  2UWC A;  4GUL A;  4HVQ A;  1SFN A;  4LHS A;  2WA4 A;  2UWA A;  3VBH A;  3K4D A;  3AYE A;  5B4X A;  3I54 A;  3ZYH A;  3FFQ A;  4CU6 A;  3CZU A;  5T52 A;  1DQ1 A;  4K6B A;  3S5A A;  4RFT 0;  1DQ6 A;  1VBC 1;  3B9C A;  5ISL A;  2ADD A;  3QOP A;  3I59 A;  2Z69 A;  4IE0 A;  4W6Y A;  4NHY A;  5I91 A;  2XPJ A;  3PUS A;  3SIS A;  1S0B A;  2JB4 A;  1MS9 A;  4E2S A;  1BQP A;  1RHI 3;  2DU1 A;  4LMF A;  2WNU A;  2VUA A;  3LEK A;  5FMD A;  4BPZ A;  4DMI A;  4AEJ A;  1WCS A;  3WNL A;  3ZFG B;  5KHI A;  4JDN A;  3PMS A;  5M0T A;  1W8O A;  1WKY A;  4AHW A;  1A8D A;  4AXO A;  3MIB A;  1PGS A;  3CEW A;  4QAW A;  1VE0 A;  1E5R A;  4TWT A;  1AR6 1;  3RZK A;  2XG3 A;  2A3Y A;  3O7O A;  4QX3 A;  1BMV 2;  4WBB A;  1WME A;  1UU6 A;  2W2I A;  4L9B A;  3U07 A;  3NV4 A;  4QX2 A;  1VAM A;  1E5I A;  4ZPI A;  3RZL A;  1R1Z A;  2VPV A;  2EID A;  5C3O A;  4UFI A;  2G9Z A;  1SLL A;  1Q8O A;  4OYU A;  4RHV 1;  3WDV A;  5BNP B;  3WQ7 A;  4YGD A;  1O5L A;  5FFO C;  1CPM A;  3NNL A;  4XJW A;  4ZXE A;  1AUY A;  1PZ9 A;  2RMU 3;  3ELN A;  3C7E A;  4P14 A;  2ZMK A;  2IFW A;  4GWI A;  3E1F 1;  5C8C C;  3VBO C;  4LBL A;  1YXW A;  5DAW A;  4MGT A;  1K12 A;  1W3X A;  4FPJ A;  4WM8 A;  4Y5S A;  1DGW X;  1LEC A;  2YRO A;  4LUL A;  1C3H A;  2KM2 A;  2JXA A;  3FX3 A;  4QPI B;  5FK8 A;  4CRQ A;  4YZ1 A;  4XE9 A;  1B09 A;  4I2O A;  1SLC A;  2WS9 3;  3K51 A;  3Q8A A;  3M3E A;  2DUQ A;  4OHX A;  3ZSJ A;  1H2K A;  5JI7 A;  3JBG 3;  4ISR A;  4S2H A;  1OA3 A;  2BZD A;  3LOI A;  4V2V A;  1R09 1;  5A1L A;  2PLV 3;  3JBG 1;  4Z07 A;  5CZK A;  5IYY A;  4QPY A;  2ZHK A;  2GME A;  1O59 A;  2IC1 A;  3T1L A;  3AKP A;  4S2D A;  4UFK A;  1WLT A;  1NXM A;  4BB3 A;  4ZS3 A;  3PVB B;  1QJY 1;  1AR7 1;  1OH3 A;  5KXC A;  5KBF A;  1GOF A;  3CJI B;  4RR3 A;  3ZFE A;  1JZ5 A;  2VME A;  4YVW B;  4ZZ8 A;  1ND3 B;  3WG3 A;  1HV1 A;  3SLI A;  3CLP A;  2YBS A;  1LOB A;  1N3Q A;  2EIC A;  4IEY A;  1BYH A;  1POV 1;  4PBO A;  4XFH A;  1JHN A;  2VZR A;  4GQ7 A;  4LBQ A;  2JIJ A;  4FVV A;  1VBD 1;  2WS9 2;  1AZD A;  4AE2 A;  1UKG A;  4LK6 A;  1DFQ A;  4EQV A;  5IK4 A;  1QXR A;  2HWB 2;  2WFF 1;  2BWC A;  1VRH 1;  2VZV A;  2GC3 A;  1VBD 2;  4ZXK A;  2WS9 1;  4B7E A;  4IND A;  5CFC A;  4LIT A;  1GQG A;  4XIL A;  3MZH A;  1PM4 A;  4DNY A;  1H8T A;  2A6Y A;  1DHK B;  3ZIX A;  2HJI A;  3ZN6 B;  5FKB A;  5FOB B;  4JX0 A;  4CU9 A;  1CAX A;  5F8P A;  1ULC A;  2JKB A;  2WNU B;  1D0H A;  2B5H A;  4MLO A;  2A3X A;  4KU7 A;  4P9L A;  2DBN A;  1PX3 A;  2IXJ A;  1MQT B;  2JDN A;  4NIA A;  1X8E A;  1ZRC A;  2RM2 3;  1OD5 A;  2VBD A;  2XLF A;  4XVH A;  1RHI 1;  3VBS C;  5FDB A;  2P1B A;  2DUO A;  2JKX A;  1KIT A;  2RR1 2;  2AH2 A;  5FZ1 A;  2B9U A;  2I07 B;  2ORX A;  2D93 A;  1H1I A;  3RYK A;  4CDQ A;  4EWE A;  3AFG A;  3TEW A;  4LOR A;  1ZBE 1;  2VJX A;  3WF3 A;  4QQ2 A;  4JDO A;  5LCW L;  2A73 B;  4LUM A;  4QDR A;  1CAU B;  1GMM A;  3FC0 A;  3LSD A;  4YVS C;  4TZD A;  1OQD A;  3OUI A;  1VAV A;  1OF3 A;  1QNW A;  1W0P A;  1NCQ C;  4NVP A;  5FZM A;  3WLU A;  4CPB A;  4CP0 A;  4ZU7 A;  1UNB A;  3KF3 A;  1H9W A;  4HON A;  1J3R A;  1ZYB A;  2Y6L A;  5BYN A;  4Z92 B;  4FTS A;  5C71 A;  5JZG B;  1KFX L;  1YQ2 A;  4MHU A;  1SMV A;  2X5I B;  2W3J A;  4IW3 A;  5JMO A;  3O1P A;  1GZC A;  1BXH A;  1AX2 A;  5JXI A;  5DUW A;  4HAN A;  2Z4F A;  2Y26 A;  4XBN A;  3DKQ A;  3RWN A;  1VPH A;  2HWE 1;  3KT4 A;  1DDL A;  3ZPO A;  5L19 A;  2AYH A;  5J3U A;  1DYK A;  5JSP A;  2OII A;  2XBO 2;  4CP9 A;  1FOD 1;  2ZGP A;  4ZZ5 A;  1AX1 A;  1EUT A;  2NMN A;  3ACI A;  5LY2 A;  4E4S A;  2YHJ A;  3JCI A;  5DAX A;  5LA0 A;  3LDB A;  3AZW A;  1REF A;  4YNI A;  5FYU A;  3T30 A;  1LES A;  2RDN A;  1XB9 A;  1KXG A;  2HBT A;  1O3Q A;  4Q4Y 1;  5FRA A;  1IQA A;  4JGZ A;  4BQW A;  1ODN A;  2WO3 A;  1DZR A;  4AHZ A;  2JE8 A;  1LCL A;  5A3O A;  3N9O A;  1JYW A;  2VW1 A;  4LBJ A;  1F35 A;  2Y64 A;  3SQO A;  3KCX A;  1N1T A;  1LOE A;  4XF1 A;  2W9X A;  2WO1 A;  3MF9 A;  3PTR B;  4XPV A;  1SAC A;  5IFP A;  4B29 A;  1UMH A;  5FMO L;  3ZO0 B;  3TNQ A;  5FIX A;  1NT0 A;  2XL9 A;  1CAW A;  3KM5 A;  3R4S A;  4B4P A;  1RUE 3;  4O65 A;  1AL2 3;  1HXS 2;  4AFA A;  2Q8C A;  1Q56 A;  3DV8 A;  1KGY A;  4M4P A;  4QDQ A;  4WVZ A;  5DAB A;  5FYS A;  1CAV A;  1H6Y A;  1YI9 A;  2BBV A;  1W6N B;  4Q0Q A;  5DZE A;  1GBG A;  1HDK A;  3O12 A;  1RUJ 1;  4OFG A;  3H3L A;  4A2U A;  2ZX2 A;  2XJR A;  1ZBE 3;  1RIN A;  2B45 X;  3DCQ A;  3BOW A;  4I0A A;  2PA7 A;  1ENR A;  4XXA A;  3MPB A;  5JVV A;  4EV0 A;  5I0S A;  1AR8 2;  2Y0O A;  3J8F 3;  2I45 A;  2XQR A;  4CE8 A;  1DU3 D;  4BLJ A;  4CEW A;  1JZ4 A;  1UXX X;  4PF5 A;  1XNA A;  1QJU 3;  2GN7 A;  4K8R B;  2BYV E;  4HBN A;  3ZXL A;  1O91 A;  2LRP A;  2R16 A;  5FBJ A;  4LT5 A;  4LHL A;  3LPF A;  3AZZ A;  3TEY A;  5K0U A;  4Q0S A;  3RRD A;  4NRP A;  3KT7 A;  4QQO A;  4LKS A;  1DGL A;  1VBB 3;  2PLV 2;  4LIV A;  2E63 A;  3H7J A;  1HQL A;  4MGQ A;  4OHY A;  4HVO A;  1SLA A;  1PMJ X;  2CNA A;  1IS4 A;  3IWZ A;  3ZLI A;  1BCX A;  5FV3 A;  2A1X A;  3SXW A;  5JSO A;  1L7L A;  4CXY A;  3SEP A;  1SZB A;  5L7O C;  4HKL A;  1YFY A;  3CNA A;  2RE9 A;  5FXV A;  5I8S A;  5CKN A;  2WWS A;  2XJU A;  4ZHN A;  5LEK A;  1MR5 A;  3LWC A;  4QPW A;  4CYD A;  4XET A;  4Z8B A;  5C9A A;  2QQJ A;  3M2M A;  1JZ3 A;  2A7A A;  5D8A C;  3ASI A;  4EZ4 A;  2Z42 A;  1W9S A;  4IEX A;  4UWD A;  3E6B A;  4AVT A;  1S0I A;  3JB8 A;  2WNV C;  3TWI A;  3U4S A;  2OQ7 A;  4QX1 A;  1QKQ A;  1B35 B;  1F4H A;  1S55 A;  2GC0 A;  2I2S A;  1RVF 1;  3CIH A;  3VN4 A;  1XYN A;  3W59 A;  4BJ0 A;  2VMH A;  2KR2 A;  1BLZ A;  2XVK A;  1QHD A;  3OBZ A;  2BPA 2;  1MEC 2;  3J7N A;  3WVJ A;  2Y6H A;  4GMP 0;  3DKW A;  5FP3 A;  1HJG A;  3POY A;  3RJR A;  3UYJ A;  3WG4 A;  2H6C A;  1NLR A;  1NQD A;  4OUM A;  3VUO A;  4KGG A;  3WSO A;  1QDO A;  4QMA A;  3OGS A;  2ZBJ A;  1L7R A;  5C9A C;  2UU8 A;  4LBQ B;  2OUJ A;  4JC1 A;  4MSV A;  5GLV A;  4AI2 A;  4CCO A;  4E4D X;  4H3W A;  4PT6 A;  3SCH A;  1XRU A;  2VW0 A;  4KG8 A;  3DUI A;  2QQO A;  3LDR A;  1V6I A;  5BNN C;  1FX5 A;  4RS5 C;  2J7M A;  2P37 A;  3DXT A;  4KBB A;  4ATE A;  3KHC A;  1NKG A;  4ARY A;  3ECQ A;  1QJU 1;  3NV1 A;  3N7J A;  4XZP A;  4QXK A;  2OZ6 A;  5JAX A;  3O1M A;  1ZVF A;  3TB0 A;  4AVB A;  5FK7 A;  4Q2F A;  2B42 B;  3WQ1 A;  5IVF A;  4XHB A;  4CZS A;  4C1X A;  4GH4 A;  4M3C B;  1O8S A;  2QZ3 A;  4AQ2 A;  4FOW A;  3OOX A;  4CEY B;  4JGY B;  3FUQ A;  1NZI A;  3KMH A;  1WLC A;  2GMP A;  4GKX A;  5JIA A;  5J37 A;  4P5H A;  1QWR A;  3S6P A;  4EWD A;  3TEX A;  3VLB B;  4GB3 3;  2E6V A;  4BU2 A;  1RUF 2;  2W68 A;  1H8T C;  3UJO A;  2DF7 A;  1UKR A;  4E9K A;  5A7Q A;  1FOD 3;  1LHO A;  3RZJ A;  4BIO A;  1AXZ A;  2Z79 A;  3FN9 A;  5BNN B;  1CAU A;  2BBA A;  1OA4 A;  1XYO A;  2ZZJ A;  1JYV A;  1PK6 C;  2F17 A;  4TYS A;  2VZ1 A;  3LD8 A;  5LBC A;  3RVH A;  3MIG A;  2VM9 A;  4YLZ A;  1YO8 A;  1UW8 A;  3PU8 A;  4PLM A;  2V4V A;  1ZRI A;  3AJY A;  5F6K A;  5A1F A;  1XPW A;  2FCU A;  3FHQ A;  1JS9 A;  2O0O A;  3J7M A;  3NJY A;  4JV4 A;  3ZMO A;  4DIN B;  4D6S A;  4MV2 A;  1JYX A;  1WMX A;  1W03 A;  1OVS A;  1S2B A;  2D6K A;  2D6M A;  3HR9 A;  3PJY A;  4D94 A;  5J1X A;  3HBK A;  1MS0 A;  4MO3 M;  4ZON A;  2FHR A;  2WBK A;  4H7M A;  1K5M C;  3VZK A;  1RUD 2;  3O1S A;  4XXP A;  2AAC A;  5F3G A;  1V0A A;  5DUU A;  4IXL A;  3RFR A;  4Y22 A;  5CA6 A;  1I3H A;  2HWC 2;  1RUD 1;  1XBF A;  2C24 A;  2ZGM A;  3VKL A;  4XZU G;  4C1W A;  2VMG A;  3WNM A;  3ZKU A;  4IV1 A;  4HXC A;  3CO2 A;  1AR9 2;  1RTV A;  2D6O X;  4FPY A;  1V00 A;  4FFG A;  3IMM A;  4XBL A;  2DWR A;  4P9G A;  4CXW A;  1AJK A;  1UY0 A;  1VBC 2;  3UGG A;  1K3I A;  1XNC A;  4Q5O A;  1RUE 1;  2R30 A;  3WNX A;  1W8Z A;  4PJY A;  2L9L A;  2BEO A;  3D4K A;  3C7O A;  5SV8 A;  4CSW A;  3IPV B;  5FLI A;  3OPT A;  3C8X A;  2N7G A;  3FUO A;  1AHS A;  3WX5 A;  4CDQ C;  3VD9 A;  3GM8 A;  1F2N A;  4N43 B;  4LIU A;  2ET7 A;  3GBF A;  5KC5 A;  2PHL A;  2VOV A;  4TLF A;  1JOP A;  4IV3 C;  1OSG A;  3I4I A;  5JZG A;  1QNY A;  1R1A 2;  1WZX A;  3KV5 A;  3NAP C;  5C4W C;  5IVC A;  2WAO A;  1KEX A;  4XW3 A;  4QKD A;  2R07 2;  3E5Q A;  4HKW A;  1N1V A;  1W6P B;  1Q8P A;  1EV1 3;  1YLL A;  3HN1 A;  3LPG A;  4OI2 A;  1Q8V A;  1W6Q B;  1CZV A;  2VL4 A;  3PVO A;  5A6Z A;  3ZXF A;  2C5D A;  3HNM A;  4H7L A;  4L99 A;  2DU0 A;  3I49 A;  1REE A;  1RUC 1;  1VBE 1;  4R4Z A;  3AMM A;  2J1A A;  3NMB A;  4Q4X 1;  5LRS A;  1NCQ A;  2XML A;  2YFU A;  5C6C A;  1LGB A;  2NN8 A;  1TNR A;  2R06 2;  5BNQ A;  1WGP A;  1BZW A;  4RHV 2;  2PYT A;  1ZA4 A;  1AYN 1;  2XHK A;  2ZGO A;  1H4G A;  1WMF A;  2BRT A;  2GU9 A;  2CGN A;  2E32 A;  2X5I A;  3APB A;  3KSC A;  3RZH A;  3ZFG A;  5C8W A;  4CVU A;  2A5Z A;  4JGZ B;  1CVN A;  1RVF 3;  5T5P A;  1JUH A;  2ZZQ A;  3H1Y A;  3AYC A;  1ND2 C;  3CU7 A;  5FUN A;  2JG9 C;  2RM2 2;  3DPR A;  3KQ4 B;  4XFI A;  3NWK A;  1XE8 A;  2UYA A;  1RUH 1;  2FCT A;  5A3M A;  1ULG A;  1QY4 A;  1QGL A;  4CDU B;  1TNF A;  3D0J A;  4AVA A;  4NIH A;  2NPI A;  1HB1 A;  2W92 A;  2XUE A;  2C26 A;  2UUR A;  2DFC A;  3AFK A;  3WUC A;  1LOF A;  1UOJ A;  4NUB A;  3V0B B;  5LA9 A;  4A44 A;  5KC6 A;  4LE4 A;  1D4M 3;  1TME 1;  3A4U A;  1HN0 A;  4CUG A;  4IER A;  5FY7 A;  1RUC 3;  5CKM A;  4UYB A;  3WDY A;  5FZO A;  4A41 A;  3BIE A;  2WO2 A;  1UOG A;  1QOS A;  1URX A;  2OW4 A;  4LA3 A;  4IEU A;  1ZBA 3;  2C6S A;  1QJY 2;  4FXK B;  4B1M A;  4EWA A;  1AR7 3;  2YC0 A;  2RR1 3;  2FMY A;  2E33 A;  4KWU A;  5B2G B;  2W0X A;  3OTF A;  4AW7 A;  2P34 A;  5F7U A;  1CAW B;  3FLT A;  4CDX C;  3T4V A;  4CU7 A;  2LS6 A;  1KS5 A;  1LJ7 A;  1OLQ A;  1OLM E;  2VTX J;  2WYF A;  4RGG A;  4WM8 C;  3III A;  4FI9 A;  3JD7 2;  1HRI 3;  2RV9 A;  2XB6 C;  4LKF A;  2IZW A;  5F5A A;  5BY5 A;  1OKQ A;  3MIE A;  3O14 A;  5CFC B;  5H9R A;  4YGB A;  5FQ0 A;  3R6S A;  1WW4 A;  2WFF 2;  3ZDV A;  3CF6 E;  1STM A;  1TMF 1;  5K7P A;  1MVE A;  2EIE A;  3WP6 A;  1HRV 3;  3OEA A;  5FXZ A;  3V56 A;  3GZA A;  4LXL A;  2CSG A;  2HWC 3;  2LM3 A;  2VMI A;  1D4M 2;  2VVD A;  1TMF 3;  1TMF 2;  2K9Z A;  2LTN A;  4OMC A;  4GD4 A;  4DS0 A;  5CIR A;  2Y6K A;  1DGW A;  3B5L B;  3D0S A;  3ILF A;  2J1R A;  4ISQ A;  4LK7 A;  3RZG A;  3VD5 A;  4AAP A;  4HOO A;  5JOZ A;  2VMC A;  2DCZ A;  3WDU A;  3WW4 A;  1OT5 A;  2DUP A;  2E9Q A;  3ILR A;  2Q0A A;  3L2H A;  4QXH A; 
#chains in the Genus database with same CATH homology
 4CXW A;  2FDJ A;  4NII A;  3I49 A;  4QKN A;  4QHO A;  4IE0 A;  3O1M A;  3H8X A;  3BU0 A;  4ZS2 A;  3H8O A;  4NRO A;  2FDH A;  3RZM A;  4O61 A;  3T3Y A;  3RZL A;  3LFM A;  4CXX A;  4ZHN A;  4NID A;  3O1R A;  3BUC A;  4IE4 A;  3H8R A;  4NPM A;  3BI3 A;  3S57 A;  3O1V A;  4IE6 A;  3BTY A;  3I3M A;  4ZS3 A;  3BTX A;  4RFR B;  3KHB A;  2FDF A;  4IDZ A;  3BTZ A;  4IE5 A;  3I2O A;  4NRM A;  4JHT A;  4QKB A;  3BIE A;  4NRP A;  4NJ4 A;  3RZH A;  4IE7 A;  4MGT A;  5F8P A;  3BKZ A;  4NPL A;  4NIG A;  3T4H B;  5DAB A;  3O1S A;  3RZG A;  3RZK A;  4NRQ A;  4O7X A;  3O1U A;  2FDI A;  4OCT A;  4QKD A;  3O1O A;  3KHC A;  2IUW A;  3S5A A;  2FD8 A;  3RZJ A;  4MG2 A;  4QKF A;  3I3Q A;  4CXY A;  2FDK A;  2FDG A;  3T4V A;  3O1T A;  4NIH A;  3O1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...