3POGA

Crystal structure of the masp-1 cub2 domain bound to ca2+
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
112
structure length
112
Chain Sequence
CSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mannan-binding lectin serine protease 1
publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 16
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3pogA00
2WNOA 5CKQA 1SPPB 3POGA 3POJA 4LOTA 4LORA 1NZIA 2QQOA 1SFPA 4LMFA 2QQKA 4LOSA 1SZBA 3POEA 2QQLA 3KQ4B 1SPPA 3POFA 3POBA 4GZ9A 5CKMA 3DEMA 2QQMA 5CKNA 3POIA 5CISA 1NT0A
chains in the Genus database with same CATH superfamily
3USUB 3N9PA 5FYVA 1NOVA 1NXD1 2VZ1A 3EB7A 2UY8A 3KV5A 1VBA2 4RYDA 4AQTA 1HRI1 4LORA 3WINE 4KU8A 4AVAA 4D0QA 4Q0SA 2NLRA 4UFMA 4FTBA 1UMZA 1HW5A 1OXCA 1PGW2 3UK9A 2YBKA 1WCDJ 5FY8A 3JU9A 4BZ4A 1O91A 2Z42A 1RUH2 3B02A 2EA7A 3VDDA 2OPKA 4KG0A 4UYBA 4W6WA 3WD5A 2JG9C 3N7KA 1YQ2A 3OY8A 4I30A 1VBA1 4FPHA 1OPOA 3T1MA 1W9WA 4IERA 4FCAA 1J1TA 2XJQA 2VECA 4JAAA 4UXAA 5C6CA 2C9AA 1FMD1 4XE9A 4MGSA 1HXS2 4QDSA 5IJRA 4NIAA 4E2QA 2ZGPA 1UZVA 5AC91 5HXMA 1RUH1 2Q30A 2A7AA 1QOTA 1UW8A 1EV12 2O1QA 4IEQA 4YVWC 1ND3B 2X29A 2LW8A 2PAKA 1W04A 3A4UA 4EN8B 4OI2A 4DEQA 3H8UA 4DFSA 4XF9A 5FZKA 2J7MA 3S7EA 4UW4A 1LAJA 4NN0A 3JB8A 1RMU2 3H9AA 4AK3A 4BK4A 3K75B 4QX8A 4PDWB 3CMGA 1HXS1 1SG3A 4COVA 3FN9A 1CX1A 4GD4A 4QGNA 3NRUA 4XBQA 2R063 4BXFA 3EBRA 1WMFA 1F2NA 2ZACA 1RIRA 3P3PA 4QXKA 4UWDA 1RUD2 2RS12 1OUSA 4O9GA 4C0BA 2ZGKA 2R1DA 1UOBA 4ASMB 1FOD2 2Q1MA 5J37A 2GNTA 4RR3C 2E51A 2ENRA 1RMU1 2WNUC 4MUVA 4TN7A 2W95A 5I0RA 1MS1A 3I8TA 1JODA 3TOJA 5ACA3 5A33A 4M3CA 4CU8A 4TLGA 3ACIA 5ANNA 3ACFA 5IYYA 4ZS2A 1RUD1 2RS11 3O14A 2W0XA 2NPIA 2GP5A 1UOGA 4MADA 1V6LA 1QQP2 1FOD1 3U78A 4YW4A 1W03A 5ISLA 2D6NA 3INAA 1NLRA 5LK5A 2OZ6A 3VZKA 2ZX0A 4LIVA 1V0AA 1ZBA3 4LA3A 4RS5C 3TEYA 1UL9A 5CNAA 5FZLA 4JKLA 5BYNA 4V2WA 2E7QA 1AL22 5A7WB 1Q8OA 4L9BA 2RS32 2B9UA 2QUOA 3B69A 1CGPA 1F15A 1FYUA 1QQP1 1SCSA 2RDSA 3I2IA 1WD3A 5FZ8A 1QDOA 4AAPA 4COZA 1UYYA 1W2UA 3MEPA 4WVWA 4QX7A 3ZFGB 1TE1B 4B7KA 1DLCA 4R9DA 1V6KA 1IQAA 1N1TA 1UQXA 1R64A 1SEFA 2C4XA 2JDNA 5EYXA 3MHZA 1D2SA 2WT0A 3VBFB 5C3QA 1S0FA 3DGTA 1AL21 1YJKA 4XAAA 3MW2A 4QM9A 5T54A 1QJX2 2RS31 4XQ4A 2YMZA 2WSVA 5IAXA 3ZSEA 5CEHA 4N7UA 4ORFA 5BNPC 2Q8CA 4B1MA 1GOFA 2VNOA 1S0JA 3HQRA 3TN92 2R042 1T6BX 3WP4A 2CU5A 1QIQA 2ZS6B 3HT1A 1PGSA 1UF2C 1QJU2 4ASKA 5F2SA 3V65A 5JVVA 1V70A 3OBZA 4CU9A 1D4M2 5KHIA 3RWKX 1U5YA 2VM9A 1HJFA 4AVTA 1TEIA 3ORJA 1QJX1 4K1ZA 1R081 4Q0QA 2ZEYA 4GULA 4IW3A 5CU1A 4EWDA 4YZ3A 1PVC2 3C7EA 4I01A 5FYCA 3TN91 3ZXLA 1X8MA 2R041 3UL2A 5F1RA 1NCQB 3IDEA 1OSGA 1UPSA 2BQPA 3AMNA 2PHUA 4P14A 1QJU1 3HR9A 4AFDA 4AQSA 2XPJA 4LT5A 5KR7A 3HMYA 1LHNA 1QF3A 3MIDA 3HIFA 4M4PA 4QKDA 1WMXA 1D4M1 3TNQA 3DN7A 4YVSA 1UZYA 1W6OB 2Z2SB 4P9GA 4UOJA 2LROA 2ZGRA 1C3HA 5HPOA 1OA2A 3K4AA 3FUOA 5K7PA 1PVC1 4IEVA 4MOAA 5LBEA 3O1OA 4DO0A 1YCIA 3JUUA 1PK6A 1VIWB 4FPGA 3IAQA 1F9KA 2LS6A 5FZCA 4D6RA 4A7ZA 5FZMA 2UURA 3AMPA 5J96B 3T0DA 1X36A 3I2HA 2JG9B 3VDCA 1JUHA 3ACLA 4QPGA 1AR82 5B4XA 4WZFA 4W65A 1C28A 3BOPA 1AXZA 3MF6A 2IXIA 5CKQA 1QXRA 1JZ5A 4PT6A 1JYXA 5BXXA 1DZRA 1FAYA 1SLAA 2VO5A 3IB3A 2W46A 4UFLA 1H8TB 1MQTA 4HVRA 1O6UA 1WW4A 2HWD2 2GDFA 1OQ1A 1Y9MA 3IIAA 5FUIA 4AEKA 1UIKA 3RMYA 1DCSA 1EP0A 4LIUA 3NJZA 1KQRA 1OT5A 3WNXA 3TBDA 3H3LA 4AWDA 1FV2A 4IEXA 4YVWB 1CAUB 2C6SA 3OF1A 2IUWA 4FO9A 4Q1RA 3UETA 3A22A 2FCUA 2VMEA 1CZVA 2X5IA 3MDPA 4D3WA 1AF9A 2HWD1 3T4VA 5L9BA 2OXBA 1ULDA 1GMMA 5I0SA 5FMDA 4OQ9A 1LECA 3A0KA 4CP1A 3FMGA 2CDOA 1QKQA 4XJZA 2Y38A 4K6BA 1GNZA 1OLMA 3SCFA 3E6BA 4GAZA 5HXVA 3C7HA 1GOHA 1RVF2 1ZBE2 4GKYA 4RR3B 3JB4C 4TSVA 1OUXA 2DVBA 3ZSJA 3J4UH 1W8UA 2WYFA 1OF3A 2JE8A 3VD4A 4Y26A 3Q9OA 2HWB1 4XAEA 2J1TA 3J8F3 2VCBA 5C8CA 2CAVA 3LA2A 2D6PA 4QPYA 5BPXA 3VL8A 5J3UA 3SITA 5FYBA 1RVF1 1ZBE1 4CSWA 3WT3A 1O8SA 2EAAA 5FZOA 2QQOA 3WLUA 3WP5A 1DGLA 4OI0A 4RS5B 1H4GA 3THTA 4CPBD 5IFPA 4MG2A 2F6BA 4PLNA 3KF5A 5K8SA 3UKTA 2AREA 1NA1C 5FP8A 1WZXA 1SPPA 2JKXA 4IE0A 4PI2A 3H8OA 1KD7A 2ZX2A 5LWBA 5A3OA 2E33A 2J42A 4QM8A 1JYTA 2XLAA 3K46A 3ZYPA 3JD72 5JXHA 1XPWA 1YFWA 2VZTA 3H0OA 2IZWA 2QFEA 4CCJA 3PTRB 1NCRA 2WN3A 2Z79A 5FY7A 5CFDB 2A73B 1VBA3 3HWJA 3OYWA 4HKOA 5F6KA 4CDUA 5I8YA 3M3IA 4L92A 1DF0A 1IKQA 3PMEA 4M3CF 2YC4A 4XF1A 3ZN6B 5BNPB 5LY1A 1YHFA 4NIIA 1UU5A 3SKJE 2YXSA 4AEDA 5HCBA 1FMD3 3IZOA 3RZKA 5J7MA 3J26N 3JD71 3AKTA 2J1UA 4IEUA 3WNNA 3S0MA 4IDZA 5AC93 3WNMA 1MR5A 1RUH3 3VLBB 1H9WA 4QHOA 2XJPA 3LWCA 4AGRA 2QQIA 4M0HA 4H55A 2E63A 1H30A 3BB6A 3BU0A 2DFCA 4YG0A 5C9AC 2PHLA 4XBNA 1WCQA 3LB9A 3MI8A 5JMOA 3CO2A 1OURA 2FD8A 4IE4A 4IEWA 1JHNA 1GU3A 5FLJA 5A70A 1CAVB 1GYKA 1OVPA 1ONAA 2CV6A 2G9ZA 4X8NA 3SCHA 3VBHA 4AF9A 2BBVA 3LIGA 1XSQA 5IW0A 3ROUA 4I0BA 3KVAA 1YUDA 5F32A 5FO7B 1LOGA 2DCZA 2FMDA 3SISA 2EXJA 3HT2A 4Q0UA 3NMBA 3I7DA 1HB4A 1YQCA 3WUDA 2X53S 3ZDSA 4GQ7A 5LCWL 1PZ8A 1RMU3 2A70A 2DUOA 3K4ZA 1DIWA 1UXXX 3B9CA 5EWSA 4N9IA 1COV2 3M3EA 2JDHA 2R6QA 2P34A 2YC0A 1GV9A 3NAPA 1EUUA 3C3VA 5E16A 3VUOA 1NAEA 2ZEXA 2Z5WA 3OPWA 4BH9A 3N35A 4M3CE 1YFXA 4UT5A 4FPEA 1BQPA 2PA7A 1G6NA 4YM2A 5CISA 3ZXDA 4Z92B 4Z82A 4Q26A 5JSOA 5JZGA 2CNAA 2JB4A 2VMIA 2XVGA 1O7FA 2PAEA 1W2AX 4AHWA 4CA9A 1XU1A 2VQTA 4QX2A 4N53A 3ABZA 4NUBA 5IK4A 5FRAA 4KBBA 1COV1 3I3QA 3WG1A 3PURA 1JS9A 3AL5A 3AL6A 3KV9A 2QZ2A 4J1WA 4AFAA 4META 3AMQA 5D8AA 4SBVA 1LHWA 4O65A 4CP2A 5FYIA 2TUNA 4YZ4A 4RFRB 1F4AA 2PQQA 1ZNPA 2W1QA 1JHJA 1GFF2 2Z4FA 1QQP3 2WZR2 2Y6HA 1ZRFA 1TVGA 1NKGA 4IV1A 3UESA 2EIBA 5I8SA 3ZSMA 2MNGA 2RM22 3DL3A 5FYTA 3CZUA 2HWC2 3VDAA 4BLIA 2R16A 2P6HA 2YROA 4L97A 3VKFC 4B8EA 3IDBB 4ONUA 5L7OC 4QX1A 2RS33 4R8HA 3VD3A 4XJUA 2E32A 4W6XA 4J6GA 2RVAA 3CL1A 5KC5A 1UU4A 1AHSA 4RGAA 5T5PA 4DZGA 3MV01 4O61A 3POFA 5K9YA 5KWRA 5DUWA 1OD3A 3U4XA 1IS6A 1KXGA 2JIJA 2RM21 3BTAA 5K0UA 3UGFA 1WCUA 1WBFA 4PI0A 4CCEA 4F7ZA 3HQXA 4EN7B 1K5MC 2WWUA 4YM3A 4GA9A 5D1IA 5E89A 1XU2A 4LO8A 4NHLA 1R083 4DEVA 3LOIA 4GWIA 2OPWA 2K2SA 3VZLA 2V5DA 2JDAA 2WQZC 4KL1A 3DPRC 2YPDA 3AJZA 1UY3A 5EXOA 4LK7A 4CP9B 1PGL2 2XJUA 3I3MA 1AX0A 4FFHA 5A3NA 1D4M3 4COWA 1RUNA 4BA6A 3LZZA 2J1VA 4MSVA 1W28A 4UW5A 1SLTA 4OCTA 3PUIA 4BQ2A 3JQWA 1NA1B 1C8NA 4UBGA 2NN8A 2D97A 3J7HA 3FBMA 1HLCA 4UI9L 4RD7A 2QE3A 3KD4A 1AX2A 4DUVA 1W8FA 3JZVA 4BB3A 3FZ3A 2W1SA 5C3RA 4XIOA 4A3XA 4JGZC 1OHFA 1PGL1 2DCTA 1QHDA 3OCPA 2D6MA 5H9PA 3FC0A 4Y20B 4QGMA 3CIHA 4JRLA 3E97A 4P9WA 1J1LA 5CADA 1ULOA 4ATEA 4OMDA 1LHUA 2Y6LA 3VBOC 5DAQA 4Q8KA 4PJYA 1Y9GA 3ZR5A 4DIQA 5F3GA 3IMNA 4U36A 2XDVA 3N9NA 4ZZ5A 3AP4A 4FPLA 1AX1A 1AR63 1U5ZA 2WR9A 5ABJA 5D21A 1X9PA 2WSUA 3GZUC 2GC3A 5FO9B 3U1XA 4BWOA 4RGGA 2OT7A 2JG8C 1OH3A 2CHHA 2ZABA 5FMCA 3F95A 5C9AB 2OQ7A 5HV0A 3JCIA 1AXKA 4W8JA 1X9TA 3GXUA 4NPRA 1PIV3 1IS4A 1H0BA 1UY1A 2ARBA 2OX0A 4LO5B 3FWEA 2XUMA 1CZTA 4KG8A 1DQ1A 4QDQA 5FZEA 4E27A 5FV3A 3MIHA 3KV6A 3NJYA 4DB5A 2YC2A 4O7XA 2QZ3A 3MLJA 1OLME 3I2DA 3LF7A 2YPJA 2Q4SA 1R1A3 4J25A 1D2QA 4CXYA 4ASLA 4QKBA 4CPBA 2BNOA 3O0XA 4LUMA 1LHOA 1RUJ3 1OMIA 1QU0A 2V5YA 2AYHA 4XFIA 3W21A 1GZTA 4LKSA 5FUNA 5A7PA 4Q4W3 2BV4A 1N3OA 5DZEA 3H7YA 3FHIB 2HWB3 3IAPA 2PELA 2QBXA 3NQHA 3NL1A 1WW6A 2LM3A 1JUIA 1OLRA 2Q5TA 4JDNA 1FXZA 4XZUG 4C1WA 2V4VA 2VR4A 1RUG3 1YQ6A 2WBKA 2VZPA 3K3NA 3OEAA 1LOFC 4ES9A 1VBD2 5FBJA 2Y6FA 3EQEA 3I54A 1PM7A 1W6MA 1S0DA 3MF9A 1H2LA 1CWPA 3IIIA 4JVAA 1LU2A 1HKDA 4JHZA 4QKFA 4Y4YA 2VZRA 2VH9A 3WDWA 4B4QA 4LBLA 3HQUA 2CYFA 3ALQA 1LB2A 1LGNA 4HETA 4D94A 4ISQA 1GWMA 3WCRA 2PYTA 1VBE2 1WMEA 4AI1A 1QJFA 1PX4A 3WDYA 1VBD1 4YW3A 1AL0G 1Z7S2 5FPBA 2ZX3A 3BUCA 3DUIA 1KS4A 1RUF3 4HANA 2IXKA 2VUJA 5FDBA 5KXCA 4C8DA 3POEA 4CCOA 5L7OB 2WL1A 1NQJA 2YFZA 5CKMA 3KS7A 1N3PA 5KC6A 1MS3A 1KRIA 1XSRA 4XHXA 1HRV1 1US3A 2VD7A 3PVBB 3AK0A 1VBE1 4MV2A 3BTYA 2AH2A 1HV1A 4PLMA 5IUQA 4MX3A 1O4ZA 1WLCA 3VHPA 4A7KA 3M3QA 1Z7S1 2ES3A 3ETPA 4AVVA 3LFIA 4YM0A 2XOMA 2E26A 1K5MB 4J1XA 4XHBA 3SH3A 3VV1A 1JYWA 1W90A 1G9DA 1OOPC 3MW3A 1UMIA 2E31A 4WM7A 1GZWA 1WA6X 3MLKA 3AYDA 2GMMA 5APAA 1B35A 5FPUA 2P3KA 3UYJA 2D6LX 3USUA 1V00A 2DTWA 1BEV2 3AYAA 1MS9A 1PZ9A 3DPRB 2Q8OA 4Y4RA 5FYHA 5IVYA 2E9QA 1XNCA 2NMOA 2W3JA 5EHDA 1RXFA 1YC61 2WNEA 1FPN3 3IPVB 4N7IA 2WC2A 2TNFA 2DCYA 1OA4A 4IL7A 2BOJA 3PUAA 5FUPA 3U37A 1MS8A 4W4ZA 3GM8A 1NX9A 1ZA4A 4H14A 3VZMA 4Z2WA 1NUKA 3O0WA 4JDMA 1QJY2 4BMBA 2VULA 4CDXC 1M4WA 1EAH3 4ZXEA 1WWYA 1BEV1 4AE2A 4CCCA 1OD5A 4L11A 3IMMA 1G7YA 4C90A 3LCPA 2EF6A 3E5QA 1S1AA 4QAWA 1C5HA 2XH6A 1MEC2 4QGLA 3WDTA 5JXJA 3GZAA 3FX3A 3AVSA 3VBOB 2ERFA 2JD4A 2ILMA 1QH7A 5ANQA 1QJY1 4KH9A 4YGEA 5IVVA 4E2SA 4LBNA 2NM1A 3WG2A 3KHBA 3OPZA 2ZX1A 4CU7A 4IGOA 2YBSA 2KA3A 1ND3A 1LGBA 2QQUA 3IKWA 4L0PA 4A2UA 3F2ZA 3RS6A 1MZ6A 3OOXA 2AR6A 3P3NA 5GZFA 4P9IA 2XLGA 1BCXA 4I3GA 5IFTA 2HWE3 3ES1A 2JG8B 3VDDC 4PLOA 4GB32 2DUQA 2I07B 4R4XA 2P5BA 4CXWA 1XE0A 4QU1A 1N3QA 4Y22A 5C7GA 1PMIA 3H3UA 2FQPA 2QQVA 2BVVA 4FXKB 4U2AA 2BYVE 2CTVA 4K21A 1YO8A 5FXVA 3O1TA 1G8WA 1W0NA 5CB7A 2QJVA 5A3TA 2GH2A 4R9BA 3JBG2 3PUHA 1CONA 2HYXA 4CEYA 1LU1A 1POV1 3HNBM 1GWLA 3AP9A 3H7JA 2NYYA 4JTNA 1CN1A 3L9JT 4GB31 5FZBA 5L73A 2I74A 4MO3M 5F39A 2YG0A 2W68A 5G05L 4RA0A 5BNQA 4MGZE 2A75A 4X8PA 1W06A 4HK8A 3M3OA 2P3YA 3ZM8A 1JZ3A 2OUHA 3GHNA 1KS5A 3JBG1 4JKKA 5CFCC 5GJ6A 3SH4A 2RJLA 3U14A 1W99A 3MIBA 2W9XA 5KXEA 1LGCA 3U11A 1AR92 4UW6A 5HCHA 3SXWA 3ZYIB 3ACGA 4F83A 1UKGA 4O9EA 2ADEA 3AFKA 4QPIC 4CUCA 2W91A 1IZ3A 1TME2 3CJIC 4I2OA 4DXTA 3U0ZA 4B7EA 2XJSA 4CDQA 2VZUA 2UWBA 1V9U2 1ASJ2 3MW4A 3O1VA 1GKBA 4S2FA 4AL9A 2F4LA 2B39A 4AW7A 2MPFA 5A7OA 3ZFGA 1GUIA 4LO7A 3WNKA 5JOYA 1DQ5A 2FCTA 4GWMA 4H7MA 1AR91 1RJ7A 2NMNA 4XILA 1ZZ8A 1PGW1 1W39A 2YZ4A 3MLLA 2R0HA 2Q8EA 5KHHA 2QTWB 1BZWA 1TME1 3S6PA 2VMFA 2Y33A 2RS53 3PVNA 5FJHA 4NIHA 1V9U1 4TYSA 1ASJ1 4XW3A 1Y7BA 2DDUA 2D3PA 4P9LA 2TEPA 3GYDA 3BOWA 3D0SA 3WY6A 5BNNC 4Y1UA 3GCXA 3O1SA 4P9YA 1LCLA 1VBC2 1JZ7A 4SLIA 4A3ZA 4XJWA 2BWCA 2OVUA 4QXBA 3KSCA 5EFUA 5IVEA 4Y1ZA 5IVBA 4XF0A 3W5MA 2HH9A 1EV11 4NWWA 5DDJ3 4CEWA 3B93A 5JOZA 3POJA 3RPQA 4IGQA 1JOPA 2ETEA 2GAUA 3WX5A 5F5QA 3WHTA 5DXDA 2DU1A 2MEV2 2WFPA 5A6QA 4MHRA 3PL0A 1VBC1 3V56A 5CVRA 3BN6A 5IT6A 2QQNA 2ZGTA 2J1AA 3UNPA 4XXPA 4DXSA 1XNDA 3WSOA 4NWVA 2E7TA 5A32B 1NE4A 4Q4V2 5JWPA 4CYDA 2GU9A 1O5LA 2VBBA 3MPPG 3I59B 3T2OA 2JX9A 1X8EA 2O8QA 3QLQA 3T09A 2MEV1 1C1LA 4YYOA 3SKVA 2BERA 1KFXL 3T0AA 3IN9A 2X09A 1SBFA 3APBA 3CZJA 3WW4A 5CBLA 4NAOA 1DG6A 2NP0A 1C4RA 2FHRA 4C0HA 1US2A 4Q4V1 4WVMA 4AI8A 2G4IA 2FDIA 4E4ZA 1W6PB 2VZQA 3HAGA 5ERLA 3I2OA 1W6QB 4YFWA 5FAXA 3ZIXA 1R093 1XB9A 1O4YA 4NRQA 1H8TA 1H2NA 2EXHA 2H0VA 2HLEA 2WA4A 4QD2A 5DN2A 4YVSC 3CQOA 1J83A 3P5BA 2YFUA 3VKMA 2VNGA 5C33A 2IXCA 2VBPA 5EPAA 3H8XA 1BBT3 2VW1A 2WRAA 4YFZA 4FPKA 1NLSA 2OIIA 2H6BA 2WIIB 3HN1A 2GNDA 3CDZB 4CU6A 1LULA 1PK6C 4I3PA 4FPYA 4Y5Z0 5JR2A 2A6XA 4JRAA 3WNLA 2IC1A 5C70A 2A6WA 5FO8B 1CZSA 2XHKA 2WJSA 3M70A 1VBB2 3KB5A 3NNGA 3D8CA 5LASA 3VDDB 3GDBA 3VGIA 1RUOA 2FMYA 3OY8B 2YV8A 3WP6A 2ORXA 3LD8A 3WDXA 2QQLA 1OH4A 5JPMB 3EYPA 1HQWA 1RUC3 1CJPA 2JDYA 2XR4A 1D7PM 1DGWX 4H7LA 4LO4B 1FNZA 4OHVA 3K4DA 4Q4X2 4FXGB 3ZXKA 5C71A 1H2KA 3T4HB 4DUXA 1JZ8A 2YGLA 4RR3A 1VR3A 1VBB1 3TYJA 2F4PA 1RHI3 4MGQA 3ZKYA 1HRV3 4L99A 4LBQB 2WT2A 4LQRA 2ORZA 4X6RB 5IAVA 1CIYA 1TMF3 3HEIA 3WQBA 1O3QA 5CZKA 3KWVA 5J48A 1Z7S3 4XEZA 4GJZA 5GZDA 5HI0A 2V72A 1XE7A 2X5IC 2VXJA 3KT1A 4GIQA 5FREA 3O1MA 3ZLIA 4Q4X1 1HX6A 1V6MA 5J98B 2X10A 2K9ZA 2VTXJ 1JW6A 5CFCB 2WFF3 3PJYA 3O12A 1F4HA 1VJ2A 4P5HA 2WO2A 1E5SA 1S0EA 4QQLA 2B8MA 5EIYB 2HKXA 2GZWA 1UX7A 4P9JA 4RS5A 4AYUA 1JYNA 3ZXGA 3NV2A 2D6KA 1X7NA 2VC9A 4EV0A 1RUI3 5J1XA 2GC1A 4JQRA 4QPIB 3FHAA 3OTFA 4BXSV 1OF4A 1SLBA 2XLFA 3CJIB 5LRSA 1MZ5A 4ET7A 5EP9A 1GLHA 1IS3A 2DV9A 1G9FA 4QXHA 1W8OA 1GR3A 3GGLA 1TNRA 4YGDA 4A42A 2XMLA 2D98A 5A33B 4M3CB 1HB2A 2E6VA 2RR13 4AFMA 4OLLA 3RZMA 2YY1A 4LKEA 3AJYA 3FBYA 4I02A 4N8MA 5CFDA 2VOKA 3SNMA 1RINA 4ARYA 5A6ZA 5C8CC 2FDHA 3PHMA 3ON7A 1H1AA 4Q29A 3ZR6A 1DLLA 1W9YA 1NYWA 3ZN6A 1ENSA 2R32A 1FI2A 4BQWA 3GALA 1VRH3 3AKPA 3M7AA 2JDUA 1AR81 5FP3A 3RNSA 4OQ8A 1OFNA 2KD7A 2ZZJA 4R9CA 3SCGA 2CY6A 1A6CA 3KVBA 4H2AA 4HKWA 5A80A 3IWZA 3I3EA 5BNNB 3BIEA 3MYXA 1XNTA 1ZREA 1YQ5A 2PHWA 2AC1A 2R072 3B94A 4OZXA 4E8DA 3B9IA 4Q0VA 4BM8A 4NAMA 4YNIA 4AQ2A 2FDJA 1QXJA 1PMJX 2RJKA 3I2FA 1DFQA 2VMGA 2A3WA 1IGOA 4UFHA 5I0TA 1HB1A 3PVOA 4XUPA 4HZFA 1G9CA 4YZ2A 4DMIA 1X82A 3I4IA 2BVBA 1XJAA 2K46A 2DTYA 2WS92 1FV3A 3M3CA 2VZ3A 2WNUB 4I09A 2R071 4Q8LA 1EPWA 1RB8G 2IFWA 5IATA 2CGOA 4DOUA 5GLUA 4CDWA 1BK1A 5FY5A 2W92A 4OFGA 4EQVA 1O3TA 2B46X 2VQAA 4GWNA 5CYYA 2B4KA 4LR4A 4UF0B 3PMSA 4DPNA 2WNVC 4LITA 1B09A 1TNFA 1GNHA 2D93A 2ZGUA 2WS91 2ZMKA 2EVXA 1WUVA 4N43A 4D7TA 5KXDA 4Q0PA 4E8CA 1IG3A 2BWAA 4BMEA 2VXRA 3K3OA 4LHNA 4QMAA 3DV8A 5FZHA 4QHZA 2DUPA 1HRI3 2EALA 2XBO2 4B4PA 3VBHC 1W3XA 1S4CA 5LBBA 2VMCA 3MFCA 4LPLA 4YW2A 2CSGA 3VBSC 5T5LA 1U0AA 3V0BA 1CPNA 5F3IA 5A7NA 1VRBA 4GH4C 3B7MA 2DVAA 1NT0A 4IQPA 4MHUA 3ZFEA 4WM8A 3AM2A 3JQXA 3VB9A 5ACA2 3O5SA 3RMXA 4JGYA 2WO3A 3OUIA 4WV8A 5IVFA 1XRUA 2XBO1 1PK6B 2ZKNA 1JZ4A 1L3JA 2ZMNA 3OEBA 1CVNA 2H6CA 1AR93 3C7FA 3NV3A 2DCJA 3FFQA 2IXJA 4HG6B 4M4RA 2HJIA 5CG8A 3WQ1A 2FZ1A 3KCCA 5JZGC 2GALA 1BJQA 3AZVA 2CWMA 4Y5TA 3NO8A 2PFWA 3PTYA 4XUQA 4YGCA 3OJBA 4OVEA 2VNVA 4N53C 4CE8A 1V9U3 3Q8BA 4EJRA 2KM2A 5JXGA 1UD1A 2HWF2 1K3IA 2AENA 1UU6A 3AC0A 1U12A 3RI9A 5HV4A 3FFZA 2YDEA 5D8AC 2BUKA 3WDVA 4Z8BA 4XCAA 5F37A 2CWSA 4K20A 2RMU2 1HXS3 2WZEA 4UFIA 1AR72 1JYIA 5C4WA 3KM5A 1HIXA 3WW1A 4XCBA 4A7YA 1EV13 2KXLA 2Y6GA 5KHJA 3VBRA 3CKHA 2FDGA 1OFSA 2WN2A 2OA2A 2WQ4A 4AEMA 2X5IB 2HWF1 3BALA 1W0OA 2QQPA 2D43A 4QPWA 2PQSA 1SFNA 1T6GC 2D40A 2QVSB 3PLQA 4LK6A 4CXXA 4IXLA 4KBZA 4RQPC 2BGCA 1I5PA 1AJOA 1CAXA 1XOYA 1FX5A 1OQDA 2CDPA 1AR71 2RMU1 2EIEA 4DY3A 2NZ9A 1BLZA 3OGGA 4AG4A 1FNYA 1G9BA 4YZ1A 3AP5A 2P3JA 2GSYA 2VY0A 5DAVA 1GP6A 1NQDA 3A7QA 1REFA 3LPGA 4S2DA 1RUD3 2RS13 5JR7B 2I2SA 4QB1A 5K0UC 3CHXA 2MEV3 3AZZA 1FOD3 1JMUB 2CGNA 1UPIA 2BP6A 3LKJA 1IPKA 2IVIB 3VHNA 1YIFA 3ETQA 3NSTA 4MVTA 4AZZA 3S5AA 5HCAA 1UOJA 1UAIA 4Y20A 4ZONA 1LOCA 4QQOA 3GJBA 4D8MA 2GH8A 1XC6A 5C8CB 2W1WA 4KWKA 1REDA 1XNKA 1ZM1A 3R4UA 3N36A 4URAA 1MPXA 1I3HA 1S2KA 4BK5A 1OBNA 5FZOB 4IV3A 1UY0A 3FLRA 3QACA 3WW2A 3VN4A 4HOOA 2DWRA 5CA6A 2XUEA 1CAWB 1L7RA 3ILNA 1AYN2 4IGPA 3WW3A 3ZFFA 1KDKA 4KNCA 3ZPOA 3O1PA 1ZZ9A 2PHRA 2RV9A 3ZYRA 2WLPA 4LE4A 1OPMA 1SPPB 2VMDA 3P6BA 2KR2A 4ZU7A 3H50A 1LESA 3K77A 1AL23 4KMQA 4E4HA 3USSA 5LA0A 4RN5A 4NOTA 3KQRA 3POSA 2WZR1 2R1BA 2RDRA 2ZKLA 4Y1VA 5FMBA 2YHJA 2PLV2 1AYN1 4BQ1A 1BYHA 3MIFA 1WW7A 3M1HA 1SHWB 3NWKA 4DXZA 4LLOA 2N7GA 3AYCA 3OYWB 4FPCA 4MXVA 4XIKA 1E5HA 4FOVA 2HWC1 1VAMA 4GKXA 2P3IA 2C9KA 4FOWA 4S2GA 2YYOA 4HVOA 5FQ0A 4PCRA 5FZ3A 5FPAA 1QJX3 1XBFA 4PF1A 5ABJC 4V1PA 3AKRA 5J36A 4FP2A 3N3HA 5JMCA 3TN93 2PLV1 1WCKA 2R043 1F5FA 2WNVB 5AFEA 4XDQA 2VZOA 1QJU3 1ACCA 1KEXA 1CJDA 3MUZ1 3LIHA 4NE9A 4NPMA 1KDMA 4COUA 3POYA 1YEWA 4XFCA 1DZQA 3LOBA 3HOBA 2ZOEB 2J1EA 3H1WA 2CL2A 2VVEA 1GBGA 4HPKB 4Q4X3 2ARAA 2DU0A 2V09A 5FZIA 3MIEA 2A6YA 2GP3A 1PVC3 4UBHA 4XC9A 2PMWB 3VBHB 1W2OA 1EYBA 1K45A 4FTEA 4NHYA 3DECA 3D0JA 3VBSB 1D0HA 4D7SA 1IPSA 5FTTC 4GH4B 2V4AA 1OVSA 1URXA 3GBWA 2FDFA 5DPNA 4CRQA 4DQAA 1QGLA 3MBWA 4XFHA 4ZHNA 4PQQA 3BI3A 3MZHA 2VTFA 3UJOA 2Q0AA 1A78A 1UN1A 3OUJA 2B9VA 5FJKA 4MXWA 1OQEA 3MICA 5C3PA 4INDA 4Z07A 3EHKA 5H9RA 2QQMA 5FK7A 2EICA 2VBDA 3T0BA 5JZGB 4YM1A 2VCAA 2J1SA 2WT1A 3L2YA 3WF4A 4AI0A 1ZRRA 5E88A 5FZGA 4BDVB 5L7OA 1GQHA 5CG9A 3WEZA 1J84A 4N53B 3E1F1 3RDIA 5JXIA 1AR83 1DHKB 1C8M2 4LKFA 4AVCA 1VP6A 1H1MA 4TXWA 5D8AB 1NXMA 4DNYA 1ULCA 4NROA 5FZ6A 3IT8A 4AI9A 3LDKA 2ID4A 2HWD3 2DVDA 3FL7A 1X33A 4HLTA 4JZRA 5FXXA 1K5MA 5A7SA 4YZ5A 5L36A 3VD7A 3CBNA 3GBFA 4AFBA 4PHZA 3VL9A 1BHGA 5JIUA 2VE1A 2WQ8A 2VOXA 2E53A 2Y60A 2J1RA 3GZTB 1SACA 3PDQA 3OGSA 3WUCA 1REEA 3T2TA 1C8M1 2XJRA 4HFSA 5CKNA 5FZ0A 1V6NA 2UWCA 3DPRA 4XTPA 4YW5A 5FLHA 5LY2A 4AI3A 4EE2A 4ISRA 1WLDA 1K5JA 2P4EA 2WAAA 4RQPB 4D7YA 1ZRDA 4JQTA 2BGOA 5FP7A 3THCA 3KGLA 1CD3G 4PIZA 1E5IA 2HEYF 4GALA 3KCYA 1UZZA 3LPFA 3WVJA 5A1LA 2W52A 3C7OA 3BODA 4PF5A 3VHOA 1ZBA2 4XMIA 2RE9A 5ACA1 3W20A 3KV4A 5K0UB 4A45A 3IM0A 2WA3A 4ES8A 3ZKUA 1RVF3 1ZBE3 3THDA 4HSLA 4YARA 4FTSA 2JB8A 4WM7C 2YU2A 5LZ6A 1B35C 3GF6A 1SLIA 2EIGA 3PU3A 3AXDA 2C5DA 1ZBA1 5EQUA 2ZAAA 3VD5A 2D3SA 4CUAA 3KHCA 1S0CA 2ZGOA 5BNOC 5GALA 1QMJA 3OGJA 2C0ZA 1QH6A 4NMIA 4XDPA 2VW2A 4BQYA 2W47A 5FZFA 3AXEA 2WAOA 4EN6B 1D0GA 2UU8A 3DKQA 3GJAA 4YRDA 2BNNA 2XWBB 4OHWA 5F3EA 2Y0IA 3LA7A 2VL4A 5I91A 3BU7A 1F35A 4IEYA 3N7LA 2XBO3 3WF0A 4COYA 4XFBA 1O8PA 3ZPYA 1SFYA 2BW8A 5E8AA 2XKOA 1YYNA 1ZZ6A 1GP5A 4AGVA 5F2WA 1S0GA 3JD73 1PX3A 1WLTA 2P2KA 4JKMA 3ZYGA 5T5JA 5JPNB 3VBUA 4EN0A 3RZGA 2Q1FA 3A0NA 4Y1XA 3FJSA 3BCWA 3UT0A 4FPJA 4M00A 3GNEA 4MZUA 5EJ1B 1GP4A 4CCMA 2QDRA 2VZSA 5ABJB 1FATA 1ND3C 5F6LB 1ENRA 2AZ5A 1W6NB 3RWNA 4CP0A 2SLIA 1UZWA 3ZMNA 4OUEA 5IK5A 1W2NA 3WF3A 3ACHA 4XF3A 2JJ6A 5C3OA 4BIFA 4NRMA 5KXBA 4R4ZA 3GZEA 5FZ7A 2OKXA 1JYCA 4JDOA 3UKNA 3DF0A 3O0VA 2JEMA 4XFGA 1APNA 2B42B 2HBTA 1ND2C 1S55A 1AVBA 3LEGA 2WNOA 3SEEA 4Q4Y2 1JU3A 4CEYC 4JGZB 4FVVA 4NIDA 1HN0A 1QDCA 1UY2A 2WWSA 2XVKA 2OS2A 5LBCA 3VKNA 2DVGA 3FLTA 3HD8B 4FPFA 4FT8A 2ET1A 5F5CA 5EYYA 1JN2P 3LE0A 4A4AA 2JD9A 1LJ7A 1ZRIA 3E5XA 2HEWF 1OA3A 3AZWA 3NKTA 4HMZA 4P08A 4Z2AA 4MGTA 3R0RA 1COV3 4K8RB 5GZGA 2ZCWA 1BK0A 4Q27A 4Q4Y1 5LA9A 4DY5A 3T08A 2A3YA 3POIA 4K1YA 5JDBA 2B45X 2JDPA 2BDRA 1ZX5A 4XDOA 1W0PA 2JE9A 1CX4A 1MEC1 4A6SA 2F17A 2VMHA 4ARXA 4IEZA 3IDAA 3LDBA 3MGUA 3E5UA 4PDWA 2DVFA 2VVDA 4CDQC 1DQ0A 1W8NA 5SV5A 1MZFA 3RJ2X 1UY4A 1VMJA 4Q2FA 2GNMA 3NV4A 4OUMA 2PHFA 4BHPA 2GC2A 1HB3A 3O1RA 2ZTNA 1Q43A 3VKOA 5FYYA 2VJXA 3POBA 4FFIA 3K2OA 2XXZA 3BGAA 2ARCA 1OLQA 5JCTA 1UCXA 1UO9A 2O8OA 4AHZA 4HBNA 1CR7A 2VUCA 5HBAA 2P6CA 2WO7A 2WZR3 5FZ9A 4UFJA 1BMV2 4B3NA 5JLVA 1I9RA 1I6XA 5F7UA 1LRHA 3J8F2 1N1YA 2PHTA 2WINB 2ZHMA 3OD0A 4IEOA 1F5JA 1L7QA 2RM23 4FAHA 5F3CA 4CCNA 5A32A 2HWC3 1CESA 5I8TA 4Y3OA 1YWKA 3UKVA 3ZXFA 1BKZA 3I59A 5FCCA 4HKLA 1DYKA 2A3XA 1PO12 4EZHA 5FZDA 3Q8EA 1YI7A 4AR2A 1VAVA 1G86A 4NR1A 3RSJA 2LRPA 3DXUA 4FFGA 2PLV3 4OI1A 2D5FA 4WZCA 3J8F1 4CEWC 2Q8DA 4QX5A 1RYYA 1LTEA 1ULFA 2PHXA 3WF2A 3PJQA 4FBFA 4MGKE 1W6PA 5A7WA 4WM7B 1W8ZA 1W6QA 5DG1A 1B35B 5KHGA 2AGSA 1IG0A 1PO11 3C8XA 4XFAA 1CQ9A 1G9AA 5B2GB 3P1IA 1Q5OA 1TZOA 3RI8A 3ZYHA 5EJZB 3KCXA 5BNOB 3PUQA 4XURA 3VBFA 4IEPA 3V0AB 4DS0A 4RL7A 3EMRA 2DBNA 1P8JA 1Y43B 4YLZA 1FMD2 2A6ZA 4B4RA 5AC92 3NV1A 3UGHA 2AACA 1W9FA 3KT7A 1V6IA 1ZZBA 4FI9A 1Q8VA 4ZKTB 1H6XA 1F31A 1YI9A 2BTVC 5BY5A 1YFYA 4FFFA 2VUAA 5F8PA 4AAXA 4LHLA 1YLLA 4AFCA 1H8TC 2XJVA 4KI5M 1OI6A 4OHZA 5JI7A 1PO22 5A1FA 1LENA 1ULPA 2R0FA 5K4LA 2ZEWA 2VTXA 2FDKA 3OGRA 4Z1VA 5A3UA 1WW5A 5GM0A 1YNAA 3POWA 2QDNA 1NCQA 4LBQA 5FY0A 4BQ3A 1OOPB 4B29A 5C8WA 2J22A 4PBPA 2BNMA 2R30A 3I3BA 3ZOIA 2JECA 3E6CC 3TAYA 4BJ0A 1S2BA 3BPSA 4QKNA 3DEMA 1W6OA 3AZXA 3QH7A 5F9TA 1PO21 1W05A 2GNBA 3DXTA 3LQCA 4PIXA 2G19A 4YPJA 5CFCA 4ZZ8A 1VLNA 2D7FA 4Y22B 2JDMA 2BFUL 3HBZA 4E4SA 1C8M3 1EY2A 1UIJA 4XOGA 2ZGQA 2D5HA 4YWAA 4AXOA 1ULEA 5FZ4A 3KT4A 4HN1A 1A8DA 2JXAA 5A7QA 4CDXB 1ND2B 1GANA 5FLIA 3ZXEA 4QPIA 4BQ5A 4C1XA 4NJ4A 3ASIA 2VUDA 3CJIA 3TNPB 2V73A 1JYVA 4G3YC 1OC1A 4CEYB 5FMOL 2JG9A 4LE3A 1NZCA 4XQDA 1NE6A 4GMP1 1Q3EA 2VNRA 2WKKA 1NG0A 3Q8FA 1D4VB 2BJSA 1L7LA 5FP9A 2VOTA 1PNFA 4CCKA 4XJ8A 5TSWA 1UYPA 2LTNA 3SQOA 5A3WA 3RZLA 3PIJA 1H4HA 5AVAA 2ZGMA 3VZJA 3T2PA 3RJRA 4FP3A 3CJXA 4YVWA 1QOOA 1CAUA 4XXAA 5DZGA 1V6JA 3A23A 4EZ4A 4HL0A 1KITA 2XL9A 4XMAA 3VDBA 2BOIA 1GSLA 3ELNA 4XF4A 5BNNA 5FY9A 2QKDA 5JSRA 1MACA 2GMPA 4DRVA 3N4MA 4FQZA 3G6JB 1GOGA 1WMDA 3DCQA 3KMHA 4PIYA 4XVHA 4A41A 3SHRA 4CDQB 2WZ8A 2JWPA 4QPGC 4RFT0 1Q8QA 2O0OA 1UYZA 1J3RA 3BIWE 1PZ7A 1VBD3 4XUOA 3UJQA 1LOBA 1QOSA 1ZA7A 2WABA 4XABA 5E1RA 5DAPA 1UMHA 4YW1A 4BQXA 1SMVA 4MLOA 4BIOA 4CVUA 5CFDC 1GZCA 1MQTC 1UX6A 3MIGA 3ZN4A 3QCWA 1JOJA 1W9TA 3PVEA 4LEJA 2HBUA 5L9RA 3BKZA 1LHVA 1YXWA 2ZBJA 2WNUA 1DP0A 4XUNA 1R082 1NLQA 4W50A 3NNLA 1Q8SA 2O14A 1VBE3 2MHFA 2A6VA 4K40A 4LXLA 5DZFA 5GLVA 4A44A 3ZSLA 4EROA 2UYBA 5B4NA 5E6HA 5A3MA 4UF0A 1SBDA 4NIGA 4D6SA 4E9KA 1KJLA 5T3NA 3RG0A 4L2NA 4UW3A 3ME2A 1T2XA 4NPLA 4LBMA 5L19A 3LSEA 2VVFA 2WUHA 5DQ0A 5FKCA 4WVZA 4CEWB 4DXRA 2WO1A 2JENA 4Y1YA 4GJYA 5FWEA 5FZ1A 2VPVA 3ZXAC 4G9SB 4XZPA 2ZXQA 4QT6A 3C7GA 3H42B 1QWRA 1DYPA 2GN3A 3U07A 1H9PA 1W8HA 1WKYA 3LSDA 2IXLA 3AKSA 2ATFA 1IHMA 1RUE2 3WNPA 3B3QE 3LEMA 5G04L 1LODA 2A5ZA 4CDWC 3LEKA 4IE5A 1SBEA 1A34A 1RXGA 1GWKA 1DGRN 1BEV3 3RYPA 4ATFA 3BTXA 4G4FA 4OMCA 3TEXA 2PTMA 3S5QA 2SBAA 4FOYA 2IWGB 1VPHA 4IESA 4JCKA 1S2EA 4LULA 5GLWA 1AR62 5FY4A 4DINB 1OKOA 4N43C 4IUGA 2JE7A 4AEJA 5BNPA 1E5RA 4KU7A 4UAPA 4Y24A 1IS5A 1N1SA 3AFGA 3ZYBA 2C24A 1I1EA 1STMA 1UYXA 5JIAA 4OULA 1RUE1 1QJY3 5DMYA 2YBPA 2ZX4A 2Z69A 3OUHA 1YRZA 3J7NA 1IOAA 4GXLA 4WVMB 5F5AA 3WR0A 1DGWA 4HSJA 4Q4Y3 3WHUA 2G1MA 4C91A 1AYM2 4R9AA 3ENRA 4JV4A 1UOFA 3ES4A 2OQ6A 1N1VA 1UWWA 2ZHKA 2D6OX 4HT1T 1AR61 3H1MA 3RQ0A 1NZIA 1PIV2 2PXJA 4FPOB 1MEC3 3ZSKA 4F3JA 3ZFEC 2DURA 1NCRC 4WM8C 1TQ5A 1CAVA 1KGYA 4JGYC 1AUYA 3OBTA 5FXWA 3WQ7A 1PM4A 4CDUC 1EPZA 4KWLA 3LAGA 4W6YA 3E6DA 3ECQA 1R1A2 3W5NA 1AYM1 5I0DA 4FOQA 2VOWA 5FPVA 5FOJB 2RJ2A 2K0GA 1RUJ2 2IXHA 1PIV1 5D2AA 5T50A 4AEDC 3I97A 4CCLA 2XJTA 2XQXA 4BLJA 3KLSA 1POV3 4Q4W2 4GB33 2OZJA 2HWB2 1LOEA 2H0BA 5CIRA 3QBQA 1YIPA 4QU2A 3VKLA 5FR3A 4WBBA 1JU4A 2FBEA 5LK7B 1RC6A 3D6EA 5LBFA 2XB6C 1R1A1 2BGPA 3B00A 2OW4A 4L8QA 1Z0HA 4N9HA 2ADDA 3VZNA 1CIWA 3T3YA 5H9QA 1H1IA 1RUG2 1GQGA 3A21A 5KBFA 1RUJ1 2XKPA 3JBG3 3ITQA 4E2GA 1Z78A 4MGIE 5C4WC 2ZJCA 4QQ2A 4P5YA 2UYAA 4Q4W1 2ZZQA 3HPNA 2C26A 1JOBA 3I2JA 4KWUA 5LB6A 1RITA 2ZAHA 4YVSB 3VBRC 4OI4A 4P02B 3NJVA 4QQPA 3MPBA 2GMEA 3N9MA 1ULGA 3M4FA 2X05A 3IBMA 3RRDA 2Q1ZB 1RUG1 4CUGA 5I0UA 1DQ4A 4ZPIA 1BVP1 1JH5A 1PO13 1ZZ7A 3U10A 5CAZA 3WZ1A 5IVJA 3HNMA 4E4DX 1CAWA 3NAPC 3TEWA 1YFUA 1RUF2 3EJKA 3DYMA 3AP7A 4Q1PA 3O1UA 3OBRA 2VU9A 5I93A 3FE5A 4JHTA 1FT9A 4K7JA 2RG4A 1TME3 4QPGB 2OUJA 4YG3A 4EN9B 5J09A 4GWJA 3H1YA 3U75A 1ASJ3 5DUXA 1WLWA 2QNKA 1XXNA 1MQTB 2EXKA 4KWJA 3SEPA 1RUF1 3NKGA 3J7LA 4NHKA 3T1LA 1J3PA 5LA1A 5LW9A 1LEDA 1I5ZA 4AI2A 5A6XA 3LFMA 3RZHA 2ZGNA 4IV3C 3UGGA 5JSPA 1SQ4A 3ATGA 2W87A 2YGMA 1C57A 4IV1C 3D4KA 3AMHA 3ZFFC 3J7MA 1S0IA 2AEYA 3NNFA 3WG4A 1O4TA 1U5IA 2WNVA 3SMHA 1FPN2 3N7MA 4H3WA 1R1ZA 2W39A 3AP6A 1MS0A 1VMHA 2D44A 4XTMA 1LEMA 1GNYA 4CP9A 4JX0A 1VBC3 3N9LA 4P00B 3I3DA 4LBKA 4D69A 4LBJA 5GZEA 5DG2A 3AKQA 4HPKA 1XYNA 1EAH2 1PO23 4RGKA 1NA1A 1ENQA 3GBGA 3R05A 5SV8A 4PBOA 4QXCA 1K12A 1ALYA 3WCSA 2VGDA 1BVVA 3RYRA 4BPZA 1OKQA 1A8MA 1FPN1 2DF7A 3VBSA 2BEOA 4IE7A 1VAKA 1MS5A 2P17A 3KGZA 1WCSA 2HEVF 5EV7A 2VW0A 1QJEA 2ZGSA 5IWFA 3R4DB 4AVSA 3BTZA 2IVJA 4CDWB 3ILRA 1ZYBA 4GH4A 5DUVA 1GICA 3H8RA 4GZ9A 4HK9A 1DYOA 1AXYA 5DABA 4XYXA 5A3PA 5JAXA 3DKWA 3MO4A 1EAH1 3OG2A 4URTA 1SCRA 1Y3TA 3GCWA 4EWEA 4Q4V3 1QXPA 3ZYJB 3I49A 1KFUL 2B7YA 2DCKA 4GMP3 4NHXA 1DBNA 4N43B 1WD4A 5JI9A 2ZEZA 1SDDB 2VOVA 3LDRA 3PIGA 4BE3A 3ST7A 2HWE2 2WYSA 5A6YA 1H6YA 1YJLA 2RHPA 4LOTA 2XGXA 3UV9A 2PAMA 1E57A 4BYYA 4V2VA 5C5TA 2XWJB 1SFPA 4QQHA 4PQ9A 1IKPA 3HVDA 5LA2A 1UKRA 1O3RA 2WLQA 2AEZA 2GN7A 5C9AA 1WA4A 3V0BB 4YW6A 4RHV2 5LATA 4QB2A 3KQ4B 4FQ4A 5DUUA 3ILFA 3ZFEB 1O3SA 2EIDA 4CZSA 4A6OA 1NCRB 1Y9QA 4CTEA 2EAKA 1PVXA 4WM8B 3N9OA 4JC1A 1JTZX 2JIGA 2HWE1 4JGYB 4TWTA 4HXCA 2FZ2A 2C1FA 2Y64A 4CDUB 3EXUA 5DAXA 3KZ4C 4QHBA 1LR5A 3N9QA 1GQPA 5L9VA 4LKDA 4AEDB 4N90A 4RHV1 3RGBA 2JKBA 4IETA 4M01A 1NY72 1VBB3 4RQPA 5FKBA 1POQA 4CUBA 5GZCA 1H2MA 2XQRA 2Y0OA 1ZRCA 2W08A 4KGQA 4LHKA 2DYCA 4FAGA 3T30A 1QEXA 4Y33A 1YQ8A 4QB6A 1DQ2A 2R7EB 1K42A 1MZEA 2JDZA 3S7IA 2PHDA 5LEJA 5C4WB 3R4SA 1NY71 1CPMA 3Q8CA 5FYZA 1XQNA 4BISA 4DUWA 5FPXA 2JDKA 2TBVA 4AVBA 1QNYA 3K48A 3C2UA 3HNYM 5HCFA 3VBRB 3K51A 3AB0A 3WNOA 1O59A 2ZA9A 4F8AA 1HN1A 4NRPA 1W3VA 3OD4A 4WVVA 1UXZA 3CNAA 3D5OA 1W8WA 1UZ0A 3FLPA 1CAXB 3RVHA 2RS52 3U4SA 3NAPB 3TRSB 3WXPA 1VALA 4MYEA 4XUTA 4BU2A 2DFBA 5T52A 4RSUA 4OHYA 3HN3A 2YB7A 5C5UA 1XYPA 2NQYA 1J59A 5FOBB 2RDQA 2HYKA 4ZXKA 5FYSA 3G7DA 4ITCA 1ST8A 5FXZA 3B5LB 2W5FA 1SLCA 3NVCA 5FPZA 2R062 2RS51 2W2IA 3KF3A 4XQWA 2B5HA 1RUE3 5DDJ2 4BOWA 4I0AA 1XNAA 4XETA 5M0TA 1S0BA 3SLIA 4NHMA 1F8VA 4LNVA 2W1UA 4YG6A 3OPTA 3CF6E 4IV3B 4OZOA 3WP3A 1HDKA 2XL7A 2VCMA 4ZU4A 4IV1B 2VQ0A 4AHYA 1HQLA 3S30A 3ZFFB 1W6NA 2R061 1HJGA 4ZU5A 1ZVFA 5DDJ1 1VE0A 5F5IA 5FPLA 3M2MA 4K9SA 2YU1A 3AZYA 5C3SA 3IPVA 4LBQD 1AYM3 2R073 3WOGA 3DYOA 4MGYE 1MS4A 2CAUA 2DBIA 3WF1A 2VCCA 1J3QA 1MVQA 4QX0A 3OB8A 1QJZA 3VBUC 1ODNA 3R6SA 3CLPA 2A1XA 3RFRA 2ZHLA 2XVLA 3H3ZA 2BZDA 3W9AA 5IVCA 2XONA 4JGZA 2BFUS 2ZMLA 1W8TA 4Y5SA 1DQ6A 2WS93 1W9SA 3OBAA 2IFRA 2ARXA 4LJHA 4XBLA 5FQ0B 3T2QA 1R092 1DGRA 2EXIA 3VD9A 4LHSA 4S2HA 4LO6B 3AYEA 3W59A 1J58A 1PHMA 4XFFA 1O5UA 2RDNA 2VQUA 1BBT2 5DAWA 3VBOA 5AVPA 3URFA 3LGRA 1MVEA 5FMOS 2CGPA 4KQ7A 3D82A 4I0WB 1RJ8A 2WDBA 2ZHNA 1KJRA 2XG3A 3ZDVA 1R091 5LEKA 3FUQA 3D3AA 2GC0A 3EO6A 3IDCB 2ET7A 3VZOA 2R49A 3QOPA 1Y4WA 1BBT1 1LOAA 1Q8PA 1VMFA 2JG8A 2VZVA 4XJAA 1A3KA 1JBCA 3I2KA 2Y26A 1RUC2 4UFKA 3SH5A 3TEZA 4XJ9A 3BVCA 3GHMA 1AJKA 1IPJA 5JOXA 4LLFA 3J9SA 5T5OA 4D6QA 4YGBA 2BRTA 1VB2A 1RHI2 1JXNA 3FHQA 5GLZA 4AOCA 1JZ2A 1X50A 1HRV2 3NJXA 5IK8A 1N47A 1ENXA 3HJRA 5LRRA 1BXHA 1TMF2 2BBAA 3BYWA 1LNSA 3JXSA 4HN0A 4BQ4A 1RGSA 3DYPA 4MXWB 1RUC1 1POV0 4YSFA 3Q8AA 3WG3A 4AHXA 3NNJA 5FZAA 1AZDA 4MH0E 3OSDA 4IE6A 3L2HA 3ZXJA 4TZDA 2WFF2 3BPZA 4KGGA 1JI6A 3TWIA 5GKAC 2FCVA 1RHI1 5BV6A 1C1FA 5FIXA 4PDWC 3ZIWA 3NNMA 5A1AA 1M06G 2XHNA 1PMHX 1TMF1 1RUI2 1H8VA 2HWF3 2BU9A 3AX4A 1RTVA 2BPA2 4DRRA 4QWNA 1Q56A 2YUEA 4BCUA 1XNBA 2D3RA 4HVQA 1DDLA 5EJ3A 1XE8A 3I2GA 5FFOC 5FYUA 1LOFA 2RMU3 4TLFA 5FY1A 2WFF1 1AR73 1UNBA 3PU8A 1ZZCA 4K8FA 4K3UA 3V64A 3ZN5A 1TG7A 1XYOA 4ZY9A 2RR12 3VHRA 1HV0A 1VB4A 4QDRA 2WZPP 2G9FA 2Y6KA 3RZZA 3W58A 1RUI1 3B01A 3RYKA 2P1BA 5BNOA 2WWJA 4XPVA 4B1LA 4OYUA 2ZGLA 1ODMA 2I45A 1RL3A 1VRH2 3V0AA 3ZVXA 5GLTA 2W94A 4OUSA 2UY9A 5JUVA 5A3LA 2LUWA 2AUYA 3N7JA 2G9GA 4X6QB 2PN5A 3THPA 4CCDA 2RR11 1DZTA 3ZYFA 2UWAA 4ZS3A 1SLLA 4Q5OA 1JZ6A 5JOWA 4QX3A 3MV11 2Y34A 4NVPA 3SC7X 3POGA 5T55A 3ZMOA 1SDWA 2L9LA 2Y6JA 2QCSB 3LA3A 4LMFA 1VRH1 3AVRA 3ZO0B 2Y8KA 2E7AA 4M0NA 1W6MB 3WQ0A 4OHXA 1LKNA 5H9SA 1U5XA 3ZFGC 4EWAA 2LALA 1QY4A 5FP4A 5KHKA 3QD6A 1C5IA 1QNWA 4P9XA 2P37A 2VAUA 5BUVA 2X8KA 3PNAA 1OOPA 3CEWA 1EUTA 4R52A 1IQDC 3MUY1 3VBFC 4NO4A 2ZPXA 3PUSA 3ZX7A 5FWJA 3M8LA 1AYN3 3O7OA 5FYMA 1HQNA 4AQ6A 1DU3D 1WBLA 4LA2A 2QQJA 5IK7A 4XACA 4LUKA 1V6OA 2VG9A 4LTAA 5FBZA 2JICA 5EZWA 4HONA 5FK8A 3AMMA 5IHRA 2QQWA 4LBOA 2QQKA 5AFBA 2OYZA 4RHV3 3CU7A 1W2TA 4LOSA 4EYUA 3S57A 3RZJA 1SZBA 4CDXA 1ND2A 3VBUB 3NW4A 1GZ9A 3X29B 4JTOA 1BMV1 1HRI2 3WV6A 3OGVA 4TTGA 3TB0A 3MFAA 1WGPA 1NCQC 1PNGA 3WDUA 4FSJA 3LEIA 2A71A 3HBKA 1GZWB 4AGGA 3QH6A 4GMP0 4YW7A
chains in the Genus database with same CATH topology
2WNOA 5CKQA 1SPPB 3POGA 3POJA 4LOTA 4LORA 1NZIA 2QQOA 1SFPA 4LMFA 2QQKA 4LOSA 1SZBA 3POEA 2QQLA 3KQ4B 1SPPA 3POFA 3POBA 4GZ9A 5CKMA 3DEMA 2QQMA 5CKNA 3POIA 5CISA 1NT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNO A;  5CKQ A;  1SPP B;  3POG A;  3POJ A;  4LOT A;  4LOR A;  1NZI A;  2QQO A;  1SFP A;  4LMF A;  2QQK A;  4LOS A;  1SZB A;  3POE A;  2QQL A;  3KQ4 B;  1SPP A;  3POF A;  3POB A;  4GZ9 A;  5CKM A;  3DEM A;  2QQM A;  5CKN A;  3POI A;  5CIS A;  1NT0 A; 
#chains in the Genus database with same CATH topology
 3USU B;  3N9P A;  5FYV A;  1NOV A;  1NXD 1;  2VZ1 A;  3EB7 A;  2UY8 A;  3KV5 A;  1VBA 2;  4RYD A;  4AQT A;  1HRI 1;  4LOR A;  3WIN E;  4KU8 A;  4AVA A;  4D0Q A;  4Q0S A;  2NLR A;  4UFM A;  4FTB A;  1UMZ A;  1HW5 A;  1OXC A;  1PGW 2;  3UK9 A;  2YBK A;  1WCD J;  5FY8 A;  3JU9 A;  4BZ4 A;  1O91 A;  2Z42 A;  1RUH 2;  3B02 A;  2EA7 A;  3VDD A;  2OPK A;  4KG0 A;  4UYB A;  4W6W A;  3WD5 A;  2JG9 C;  3N7K A;  1YQ2 A;  3OY8 A;  4I30 A;  1VBA 1;  4FPH A;  1OPO A;  3T1M A;  1W9W A;  4IER A;  4FCA A;  1J1T A;  2XJQ A;  2VEC A;  4JAA A;  4UXA A;  5C6C A;  2C9A A;  1FMD 1;  4XE9 A;  4MGS A;  1HXS 2;  4QDS A;  5IJR A;  4NIA A;  4E2Q A;  2ZGP A;  1UZV A;  5AC9 1;  5HXM A;  1RUH 1;  2Q30 A;  2A7A A;  1QOT A;  1UW8 A;  1EV1 2;  2O1Q A;  4IEQ A;  4YVW C;  1ND3 B;  2X29 A;  2LW8 A;  2PAK A;  1W04 A;  3A4U A;  4EN8 B;  4OI2 A;  4DEQ A;  3H8U A;  4DFS A;  4XF9 A;  5FZK A;  2J7M A;  3S7E A;  4UW4 A;  1LAJ A;  4NN0 A;  3JB8 A;  1RMU 2;  3H9A A;  4AK3 A;  4BK4 A;  3K75 B;  4QX8 A;  4PDW B;  3CMG A;  1HXS 1;  1SG3 A;  4COV A;  3FN9 A;  1CX1 A;  4GD4 A;  4QGN A;  3NRU A;  4XBQ A;  2R06 3;  4BXF A;  3EBR A;  1WMF A;  1F2N A;  2ZAC A;  1RIR A;  3P3P A;  4QXK A;  4UWD A;  1RUD 2;  2RS1 2;  1OUS A;  4O9G A;  4C0B A;  2ZGK A;  2R1D A;  1UOB A;  4ASM B;  1FOD 2;  2Q1M A;  5J37 A;  2GNT A;  4RR3 C;  2E51 A;  2ENR A;  1RMU 1;  2WNU C;  4MUV A;  4TN7 A;  2W95 A;  5I0R A;  1MS1 A;  3I8T A;  1JOD A;  3TOJ A;  5ACA 3;  5A33 A;  4M3C A;  4CU8 A;  4TLG A;  3ACI A;  5ANN A;  3ACF A;  5IYY A;  4ZS2 A;  1RUD 1;  2RS1 1;  3O14 A;  2W0X A;  2NPI A;  2GP5 A;  1UOG A;  4MAD A;  1V6L A;  1QQP 2;  1FOD 1;  3U78 A;  4YW4 A;  1W03 A;  5ISL A;  2D6N A;  3INA A;  1NLR A;  5LK5 A;  2OZ6 A;  3VZK A;  2ZX0 A;  4LIV A;  1V0A A;  1ZBA 3;  4LA3 A;  4RS5 C;  3TEY A;  1UL9 A;  5CNA A;  5FZL A;  4JKL A;  5BYN A;  4V2W A;  2E7Q A;  1AL2 2;  5A7W B;  1Q8O A;  4L9B A;  2RS3 2;  2B9U A;  2QUO A;  3B69 A;  1CGP A;  1F15 A;  1FYU A;  1QQP 1;  1SCS A;  2RDS A;  3I2I A;  1WD3 A;  5FZ8 A;  1QDO A;  4AAP A;  4COZ A;  1UYY A;  1W2U A;  3MEP A;  4WVW A;  4QX7 A;  3ZFG B;  1TE1 B;  4B7K A;  1DLC A;  4R9D A;  1V6K A;  1IQA A;  1N1T A;  1UQX A;  1R64 A;  1SEF A;  2C4X A;  2JDN A;  5EYX A;  3MHZ A;  1D2S A;  2WT0 A;  3VBF B;  5C3Q A;  1S0F A;  3DGT A;  1AL2 1;  1YJK A;  4XAA A;  3MW2 A;  4QM9 A;  5T54 A;  1QJX 2;  2RS3 1;  4XQ4 A;  2YMZ A;  2WSV A;  5IAX A;  3ZSE A;  5CEH A;  4N7U A;  4ORF A;  5BNP C;  2Q8C A;  4B1M A;  1GOF A;  2VNO A;  1S0J A;  3HQR A;  3TN9 2;  2R04 2;  1T6B X;  3WP4 A;  2CU5 A;  1QIQ A;  2ZS6 B;  3HT1 A;  1PGS A;  1UF2 C;  1QJU 2;  4ASK A;  5F2S A;  3V65 A;  5JVV A;  1V70 A;  3OBZ A;  4CU9 A;  1D4M 2;  5KHI A;  3RWK X;  1U5Y A;  2VM9 A;  1HJF A;  4AVT A;  1TEI A;  3ORJ A;  1QJX 1;  4K1Z A;  1R08 1;  4Q0Q A;  2ZEY A;  4GUL A;  4IW3 A;  5CU1 A;  4EWD A;  4YZ3 A;  1PVC 2;  3C7E A;  4I01 A;  5FYC A;  3TN9 1;  3ZXL A;  1X8M A;  2R04 1;  3UL2 A;  5F1R A;  1NCQ B;  3IDE A;  1OSG A;  1UPS A;  2BQP A;  3AMN A;  2PHU A;  4P14 A;  1QJU 1;  3HR9 A;  4AFD A;  4AQS A;  2XPJ A;  4LT5 A;  5KR7 A;  3HMY A;  1LHN A;  1QF3 A;  3MID A;  3HIF A;  4M4P A;  4QKD A;  1WMX A;  1D4M 1;  3TNQ A;  3DN7 A;  4YVS A;  1UZY A;  1W6O B;  2Z2S B;  4P9G A;  4UOJ A;  2LRO A;  2ZGR A;  1C3H A;  5HPO A;  1OA2 A;  3K4A A;  3FUO A;  5K7P A;  1PVC 1;  4IEV A;  4MOA A;  5LBE A;  3O1O A;  4DO0 A;  1YCI A;  3JUU A;  1PK6 A;  1VIW B;  4FPG A;  3IAQ A;  1F9K A;  2LS6 A;  5FZC A;  4D6R A;  4A7Z A;  5FZM A;  2UUR A;  3AMP A;  5J96 B;  3T0D A;  1X36 A;  3I2H A;  2JG9 B;  3VDC A;  1JUH A;  3ACL A;  4QPG A;  1AR8 2;  5B4X A;  4WZF A;  4W65 A;  1C28 A;  3BOP A;  1AXZ A;  3MF6 A;  2IXI A;  5CKQ A;  1QXR A;  1JZ5 A;  4PT6 A;  1JYX A;  5BXX A;  1DZR A;  1FAY A;  1SLA A;  2VO5 A;  3IB3 A;  2W46 A;  4UFL A;  1H8T B;  1MQT A;  4HVR A;  1O6U A;  1WW4 A;  2HWD 2;  2GDF A;  1OQ1 A;  1Y9M A;  3IIA A;  5FUI A;  4AEK A;  1UIK A;  3RMY A;  1DCS A;  1EP0 A;  4LIU A;  3NJZ A;  1KQR A;  1OT5 A;  3WNX A;  3TBD A;  3H3L A;  4AWD A;  1FV2 A;  4IEX A;  4YVW B;  1CAU B;  2C6S A;  3OF1 A;  2IUW A;  4FO9 A;  4Q1R A;  3UET A;  3A22 A;  2FCU A;  2VME A;  1CZV A;  2X5I A;  3MDP A;  4D3W A;  1AF9 A;  2HWD 1;  3T4V A;  5L9B A;  2OXB A;  1ULD A;  1GMM A;  5I0S A;  5FMD A;  4OQ9 A;  1LEC A;  3A0K A;  4CP1 A;  3FMG A;  2CDO A;  1QKQ A;  4XJZ A;  2Y38 A;  4K6B A;  1GNZ A;  1OLM A;  3SCF A;  3E6B A;  4GAZ A;  5HXV A;  3C7H A;  1GOH A;  1RVF 2;  1ZBE 2;  4GKY A;  4RR3 B;  3JB4 C;  4TSV A;  1OUX A;  2DVB A;  3ZSJ A;  3J4U H;  1W8U A;  2WYF A;  1OF3 A;  2JE8 A;  3VD4 A;  4Y26 A;  3Q9O A;  2HWB 1;  4XAE A;  2J1T A;  3J8F 3;  2VCB A;  5C8C A;  2CAV A;  3LA2 A;  2D6P A;  4QPY A;  5BPX A;  3VL8 A;  5J3U A;  3SIT A;  5FYB A;  1RVF 1;  1ZBE 1;  4CSW A;  3WT3 A;  1O8S A;  2EAA A;  5FZO A;  2QQO A;  3WLU A;  3WP5 A;  1DGL A;  4OI0 A;  4RS5 B;  1H4G A;  3THT A;  4CPB D;  5IFP A;  4MG2 A;  2F6B A;  4PLN A;  3KF5 A;  5K8S A;  3UKT A;  2ARE A;  1NA1 C;  5FP8 A;  1WZX A;  1SPP A;  2JKX A;  4IE0 A;  4PI2 A;  3H8O A;  1KD7 A;  2ZX2 A;  5LWB A;  5A3O A;  2E33 A;  2J42 A;  4QM8 A;  1JYT A;  2XLA A;  3K46 A;  3ZYP A;  3JD7 2;  5JXH A;  1XPW A;  1YFW A;  2VZT A;  3H0O A;  2IZW A;  2QFE A;  4CCJ A;  3PTR B;  1NCR A;  2WN3 A;  2Z79 A;  5FY7 A;  5CFD B;  2A73 B;  1VBA 3;  3HWJ A;  3OYW A;  4HKO A;  5F6K A;  4CDU A;  5I8Y A;  3M3I A;  4L92 A;  1DF0 A;  1IKQ A;  3PME A;  4M3C F;  2YC4 A;  4XF1 A;  3ZN6 B;  5BNP B;  5LY1 A;  1YHF A;  4NII A;  1UU5 A;  3SKJ E;  2YXS A;  4AED A;  5HCB A;  1FMD 3;  3IZO A;  3RZK A;  5J7M A;  3J26 N;  3JD7 1;  3AKT A;  2J1U A;  4IEU A;  3WNN A;  3S0M A;  4IDZ A;  5AC9 3;  3WNM A;  1MR5 A;  1RUH 3;  3VLB B;  1H9W A;  4QHO A;  2XJP A;  3LWC A;  4AGR A;  2QQI A;  4M0H A;  4H55 A;  2E63 A;  1H30 A;  3BB6 A;  3BU0 A;  2DFC A;  4YG0 A;  5C9A C;  2PHL A;  4XBN A;  1WCQ A;  3LB9 A;  3MI8 A;  5JMO A;  3CO2 A;  1OUR A;  2FD8 A;  4IE4 A;  4IEW A;  1JHN A;  1GU3 A;  5FLJ A;  5A70 A;  1CAV B;  1GYK A;  1OVP A;  1ONA A;  2CV6 A;  2G9Z A;  4X8N A;  3SCH A;  3VBH A;  4AF9 A;  2BBV A;  3LIG A;  1XSQ A;  5IW0 A;  3ROU A;  4I0B A;  3KVA A;  1YUD A;  5F32 A;  5FO7 B;  1LOG A;  2DCZ A;  2FMD A;  3SIS A;  2EXJ A;  3HT2 A;  4Q0U A;  3NMB A;  3I7D A;  1HB4 A;  1YQC A;  3WUD A;  2X53 S;  3ZDS A;  4GQ7 A;  5LCW L;  1PZ8 A;  1RMU 3;  2A70 A;  2DUO A;  3K4Z A;  1DIW A;  1UXX X;  3B9C A;  5EWS A;  4N9I A;  1COV 2;  3M3E A;  2JDH A;  2R6Q A;  2P34 A;  2YC0 A;  1GV9 A;  3NAP A;  1EUU A;  3C3V A;  5E16 A;  3VUO A;  1NAE A;  2ZEX A;  2Z5W A;  3OPW A;  4BH9 A;  3N35 A;  4M3C E;  1YFX A;  4UT5 A;  4FPE A;  1BQP A;  2PA7 A;  1G6N A;  4YM2 A;  5CIS A;  3ZXD A;  4Z92 B;  4Z82 A;  4Q26 A;  5JSO A;  5JZG A;  2CNA A;  2JB4 A;  2VMI A;  2XVG A;  1O7F A;  2PAE A;  1W2A X;  4AHW A;  4CA9 A;  1XU1 A;  2VQT A;  4QX2 A;  4N53 A;  3ABZ A;  4NUB A;  5IK4 A;  5FRA A;  4KBB A;  1COV 1;  3I3Q A;  3WG1 A;  3PUR A;  1JS9 A;  3AL5 A;  3AL6 A;  3KV9 A;  2QZ2 A;  4J1W A;  4AFA A;  4MET A;  3AMQ A;  5D8A A;  4SBV A;  1LHW A;  4O65 A;  4CP2 A;  5FYI A;  2TUN A;  4YZ4 A;  4RFR B;  1F4A A;  2PQQ A;  1ZNP A;  2W1Q A;  1JHJ A;  1GFF 2;  2Z4F A;  1QQP 3;  2WZR 2;  2Y6H A;  1ZRF A;  1TVG A;  1NKG A;  4IV1 A;  3UES A;  2EIB A;  5I8S A;  3ZSM A;  2MNG A;  2RM2 2;  3DL3 A;  5FYT A;  3CZU A;  2HWC 2;  3VDA A;  4BLI A;  2R16 A;  2P6H A;  2YRO A;  4L97 A;  3VKF C;  4B8E A;  3IDB B;  4ONU A;  5L7O C;  4QX1 A;  2RS3 3;  4R8H A;  3VD3 A;  4XJU A;  2E32 A;  4W6X A;  4J6G A;  2RVA A;  3CL1 A;  5KC5 A;  1UU4 A;  1AHS A;  4RGA A;  5T5P A;  4DZG A;  3MV0 1;  4O61 A;  3POF A;  5K9Y A;  5KWR A;  5DUW A;  1OD3 A;  3U4X A;  1IS6 A;  1KXG A;  2JIJ A;  2RM2 1;  3BTA A;  5K0U A;  3UGF A;  1WCU A;  1WBF A;  4PI0 A;  4CCE A;  4F7Z A;  3HQX A;  4EN7 B;  1K5M C;  2WWU A;  4YM3 A;  4GA9 A;  5D1I A;  5E89 A;  1XU2 A;  4LO8 A;  4NHL A;  1R08 3;  4DEV A;  3LOI A;  4GWI A;  2OPW A;  2K2S A;  3VZL A;  2V5D A;  2JDA A;  2WQZ C;  4KL1 A;  3DPR C;  2YPD A;  3AJZ A;  1UY3 A;  5EXO A;  4LK7 A;  4CP9 B;  1PGL 2;  2XJU A;  3I3M A;  1AX0 A;  4FFH A;  5A3N A;  1D4M 3;  4COW A;  1RUN A;  4BA6 A;  3LZZ A;  2J1V A;  4MSV A;  1W28 A;  4UW5 A;  1SLT A;  4OCT A;  3PUI A;  4BQ2 A;  3JQW A;  1NA1 B;  1C8N A;  4UBG A;  2NN8 A;  2D97 A;  3J7H A;  3FBM A;  1HLC A;  4UI9 L;  4RD7 A;  2QE3 A;  3KD4 A;  1AX2 A;  4DUV A;  1W8F A;  3JZV A;  4BB3 A;  3FZ3 A;  2W1S A;  5C3R A;  4XIO A;  4A3X A;  4JGZ C;  1OHF A;  1PGL 1;  2DCT A;  1QHD A;  3OCP A;  2D6M A;  5H9P A;  3FC0 A;  4Y20 B;  4QGM A;  3CIH A;  4JRL A;  3E97 A;  4P9W A;  1J1L A;  5CAD A;  1ULO A;  4ATE A;  4OMD A;  1LHU A;  2Y6L A;  3VBO C;  5DAQ A;  4Q8K A;  4PJY A;  1Y9G A;  3ZR5 A;  4DIQ A;  5F3G A;  3IMN A;  4U36 A;  2XDV A;  3N9N A;  4ZZ5 A;  3AP4 A;  4FPL A;  1AX1 A;  1AR6 3;  1U5Z A;  2WR9 A;  5ABJ A;  5D21 A;  1X9P A;  2WSU A;  3GZU C;  2GC3 A;  5FO9 B;  3U1X A;  4BWO A;  4RGG A;  2OT7 A;  2JG8 C;  1OH3 A;  2CHH A;  2ZAB A;  5FMC A;  3F95 A;  5C9A B;  2OQ7 A;  5HV0 A;  3JCI A;  1AXK A;  4W8J A;  1X9T A;  3GXU A;  4NPR A;  1PIV 3;  1IS4 A;  1H0B A;  1UY1 A;  2ARB A;  2OX0 A;  4LO5 B;  3FWE A;  2XUM A;  1CZT A;  4KG8 A;  1DQ1 A;  4QDQ A;  5FZE A;  4E27 A;  5FV3 A;  3MIH A;  3KV6 A;  3NJY A;  4DB5 A;  2YC2 A;  4O7X A;  2QZ3 A;  3MLJ A;  1OLM E;  3I2D A;  3LF7 A;  2YPJ A;  2Q4S A;  1R1A 3;  4J25 A;  1D2Q A;  4CXY A;  4ASL A;  4QKB A;  4CPB A;  2BNO A;  3O0X A;  4LUM A;  1LHO A;  1RUJ 3;  1OMI A;  1QU0 A;  2V5Y A;  2AYH A;  4XFI A;  3W21 A;  1GZT A;  4LKS A;  5FUN A;  5A7P A;  4Q4W 3;  2BV4 A;  1N3O A;  5DZE A;  3H7Y A;  3FHI B;  2HWB 3;  3IAP A;  2PEL A;  2QBX A;  3NQH A;  3NL1 A;  1WW6 A;  2LM3 A;  1JUI A;  1OLR A;  2Q5T A;  4JDN A;  1FXZ A;  4XZU G;  4C1W A;  2V4V A;  2VR4 A;  1RUG 3;  1YQ6 A;  2WBK A;  2VZP A;  3K3N A;  3OEA A;  1LOF C;  4ES9 A;  1VBD 2;  5FBJ A;  2Y6F A;  3EQE A;  3I54 A;  1PM7 A;  1W6M A;  1S0D A;  3MF9 A;  1H2L A;  1CWP A;  3III A;  4JVA A;  1LU2 A;  1HKD A;  4JHZ A;  4QKF A;  4Y4Y A;  2VZR A;  2VH9 A;  3WDW A;  4B4Q A;  4LBL A;  3HQU A;  2CYF A;  3ALQ A;  1LB2 A;  1LGN A;  4HET A;  4D94 A;  4ISQ A;  1GWM A;  3WCR A;  2PYT A;  1VBE 2;  1WME A;  4AI1 A;  1QJF A;  1PX4 A;  3WDY A;  1VBD 1;  4YW3 A;  1AL0 G;  1Z7S 2;  5FPB A;  2ZX3 A;  3BUC A;  3DUI A;  1KS4 A;  1RUF 3;  4HAN A;  2IXK A;  2VUJ A;  5FDB A;  5KXC A;  4C8D A;  3POE A;  4CCO A;  5L7O B;  2WL1 A;  1NQJ A;  2YFZ A;  5CKM A;  3KS7 A;  1N3P A;  5KC6 A;  1MS3 A;  1KRI A;  1XSR A;  4XHX A;  1HRV 1;  1US3 A;  2VD7 A;  3PVB B;  3AK0 A;  1VBE 1;  4MV2 A;  3BTY A;  2AH2 A;  1HV1 A;  4PLM A;  5IUQ A;  4MX3 A;  1O4Z A;  1WLC A;  3VHP A;  4A7K A;  3M3Q A;  1Z7S 1;  2ES3 A;  3ETP A;  4AVV A;  3LFI A;  4YM0 A;  2XOM A;  2E26 A;  1K5M B;  4J1X A;  4XHB A;  3SH3 A;  3VV1 A;  1JYW A;  1W90 A;  1G9D A;  1OOP C;  3MW3 A;  1UMI A;  2E31 A;  4WM7 A;  1GZW A;  1WA6 X;  3MLK A;  3AYD A;  2GMM A;  5APA A;  1B35 A;  5FPU A;  2P3K A;  3UYJ A;  2D6L X;  3USU A;  1V00 A;  2DTW A;  1BEV 2;  3AYA A;  1MS9 A;  1PZ9 A;  3DPR B;  2Q8O A;  4Y4R A;  5FYH A;  5IVY A;  2E9Q A;  1XNC A;  2NMO A;  2W3J A;  5EHD A;  1RXF A;  1YC6 1;  2WNE A;  1FPN 3;  3IPV B;  4N7I A;  2WC2 A;  2TNF A;  2DCY A;  1OA4 A;  4IL7 A;  2BOJ A;  3PUA A;  5FUP A;  3U37 A;  1MS8 A;  4W4Z A;  3GM8 A;  1NX9 A;  1ZA4 A;  4H14 A;  3VZM A;  4Z2W A;  1NUK A;  3O0W A;  4JDM A;  1QJY 2;  4BMB A;  2VUL A;  4CDX C;  1M4W A;  1EAH 3;  4ZXE A;  1WWY A;  1BEV 1;  4AE2 A;  4CCC A;  1OD5 A;  4L11 A;  3IMM A;  1G7Y A;  4C90 A;  3LCP A;  2EF6 A;  3E5Q A;  1S1A A;  4QAW A;  1C5H A;  2XH6 A;  1MEC 2;  4QGL A;  3WDT A;  5JXJ A;  3GZA A;  3FX3 A;  3AVS A;  3VBO B;  2ERF A;  2JD4 A;  2ILM A;  1QH7 A;  5ANQ A;  1QJY 1;  4KH9 A;  4YGE A;  5IVV A;  4E2S A;  4LBN A;  2NM1 A;  3WG2 A;  3KHB A;  3OPZ A;  2ZX1 A;  4CU7 A;  4IGO A;  2YBS A;  2KA3 A;  1ND3 A;  1LGB A;  2QQU A;  3IKW A;  4L0P A;  4A2U A;  3F2Z A;  3RS6 A;  1MZ6 A;  3OOX A;  2AR6 A;  3P3N A;  5GZF A;  4P9I A;  2XLG A;  1BCX A;  4I3G A;  5IFT A;  2HWE 3;  3ES1 A;  2JG8 B;  3VDD C;  4PLO A;  4GB3 2;  2DUQ A;  2I07 B;  4R4X A;  2P5B A;  4CXW A;  1XE0 A;  4QU1 A;  1N3Q A;  4Y22 A;  5C7G A;  1PMI A;  3H3U A;  2FQP A;  2QQV A;  2BVV A;  4FXK B;  4U2A A;  2BYV E;  2CTV A;  4K21 A;  1YO8 A;  5FXV A;  3O1T A;  1G8W A;  1W0N A;  5CB7 A;  2QJV A;  5A3T A;  2GH2 A;  4R9B A;  3JBG 2;  3PUH A;  1CON A;  2HYX A;  4CEY A;  1LU1 A;  1POV 1;  3HNB M;  1GWL A;  3AP9 A;  3H7J A;  2NYY A;  4JTN A;  1CN1 A;  3L9J T;  4GB3 1;  5FZB A;  5L73 A;  2I74 A;  4MO3 M;  5F39 A;  2YG0 A;  2W68 A;  5G05 L;  4RA0 A;  5BNQ A;  4MGZ E;  2A75 A;  4X8P A;  1W06 A;  4HK8 A;  3M3O A;  2P3Y A;  3ZM8 A;  1JZ3 A;  2OUH A;  3GHN A;  1KS5 A;  3JBG 1;  4JKK A;  5CFC C;  5GJ6 A;  3SH4 A;  2RJL A;  3U14 A;  1W99 A;  3MIB A;  2W9X A;  5KXE A;  1LGC A;  3U11 A;  1AR9 2;  4UW6 A;  5HCH A;  3SXW A;  3ZYI B;  3ACG A;  4F83 A;  1UKG A;  4O9E A;  2ADE A;  3AFK A;  4QPI C;  4CUC A;  2W91 A;  1IZ3 A;  1TME 2;  3CJI C;  4I2O A;  4DXT A;  3U0Z A;  4B7E A;  2XJS A;  4CDQ A;  2VZU A;  2UWB A;  1V9U 2;  1ASJ 2;  3MW4 A;  3O1V A;  1GKB A;  4S2F A;  4AL9 A;  2F4L A;  2B39 A;  4AW7 A;  2MPF A;  5A7O A;  3ZFG A;  1GUI A;  4LO7 A;  3WNK A;  5JOY A;  1DQ5 A;  2FCT A;  4GWM A;  4H7M A;  1AR9 1;  1RJ7 A;  2NMN A;  4XIL A;  1ZZ8 A;  1PGW 1;  1W39 A;  2YZ4 A;  3MLL A;  2R0H A;  2Q8E A;  5KHH A;  2QTW B;  1BZW A;  1TME 1;  3S6P A;  2VMF A;  2Y33 A;  2RS5 3;  3PVN A;  5FJH A;  4NIH A;  1V9U 1;  4TYS A;  1ASJ 1;  4XW3 A;  1Y7B A;  2DDU A;  2D3P A;  4P9L A;  2TEP A;  3GYD A;  3BOW A;  3D0S A;  3WY6 A;  5BNN C;  4Y1U A;  3GCX A;  3O1S A;  4P9Y A;  1LCL A;  1VBC 2;  1JZ7 A;  4SLI A;  4A3Z A;  4XJW A;  2BWC A;  2OVU A;  4QXB A;  3KSC A;  5EFU A;  5IVE A;  4Y1Z A;  5IVB A;  4XF0 A;  3W5M A;  2HH9 A;  1EV1 1;  4NWW A;  5DDJ 3;  4CEW A;  3B93 A;  5JOZ A;  3POJ A;  3RPQ A;  4IGQ A;  1JOP A;  2ETE A;  2GAU A;  3WX5 A;  5F5Q A;  3WHT A;  5DXD A;  2DU1 A;  2MEV 2;  2WFP A;  5A6Q A;  4MHR A;  3PL0 A;  1VBC 1;  3V56 A;  5CVR A;  3BN6 A;  5IT6 A;  2QQN A;  2ZGT A;  2J1A A;  3UNP A;  4XXP A;  4DXS A;  1XND A;  3WSO A;  4NWV A;  2E7T A;  5A32 B;  1NE4 A;  4Q4V 2;  5JWP A;  4CYD A;  2GU9 A;  1O5L A;  2VBB A;  3MPP G;  3I59 B;  3T2O A;  2JX9 A;  1X8E A;  2O8Q A;  3QLQ A;  3T09 A;  2MEV 1;  1C1L A;  4YYO A;  3SKV A;  2BER A;  1KFX L;  3T0A A;  3IN9 A;  2X09 A;  1SBF A;  3APB A;  3CZJ A;  3WW4 A;  5CBL A;  4NAO A;  1DG6 A;  2NP0 A;  1C4R A;  2FHR A;  4C0H A;  1US2 A;  4Q4V 1;  4WVM A;  4AI8 A;  2G4I A;  2FDI A;  4E4Z A;  1W6P B;  2VZQ A;  3HAG A;  5ERL A;  3I2O A;  1W6Q B;  4YFW A;  5FAX A;  3ZIX A;  1R09 3;  1XB9 A;  1O4Y A;  4NRQ A;  1H8T A;  1H2N A;  2EXH A;  2H0V A;  2HLE A;  2WA4 A;  4QD2 A;  5DN2 A;  4YVS C;  3CQO A;  1J83 A;  3P5B A;  2YFU A;  3VKM A;  2VNG A;  5C33 A;  2IXC A;  2VBP A;  5EPA A;  3H8X A;  1BBT 3;  2VW1 A;  2WRA A;  4YFZ A;  4FPK A;  1NLS A;  2OII A;  2H6B A;  2WII B;  3HN1 A;  2GND A;  3CDZ B;  4CU6 A;  1LUL A;  1PK6 C;  4I3P A;  4FPY A;  4Y5Z 0;  5JR2 A;  2A6X A;  4JRA A;  3WNL A;  2IC1 A;  5C70 A;  2A6W A;  5FO8 B;  1CZS A;  2XHK A;  2WJS A;  3M70 A;  1VBB 2;  3KB5 A;  3NNG A;  3D8C A;  5LAS A;  3VDD B;  3GDB A;  3VGI A;  1RUO A;  2FMY A;  3OY8 B;  2YV8 A;  3WP6 A;  2ORX A;  3LD8 A;  3WDX A;  2QQL A;  1OH4 A;  5JPM B;  3EYP A;  1HQW A;  1RUC 3;  1CJP A;  2JDY A;  2XR4 A;  1D7P M;  1DGW X;  4H7L A;  4LO4 B;  1FNZ A;  4OHV A;  3K4D A;  4Q4X 2;  4FXG B;  3ZXK A;  5C71 A;  1H2K A;  3T4H B;  4DUX A;  1JZ8 A;  2YGL A;  4RR3 A;  1VR3 A;  1VBB 1;  3TYJ A;  2F4P A;  1RHI 3;  4MGQ A;  3ZKY A;  1HRV 3;  4L99 A;  4LBQ B;  2WT2 A;  4LQR A;  2ORZ A;  4X6R B;  5IAV A;  1CIY A;  1TMF 3;  3HEI A;  3WQB A;  1O3Q A;  5CZK A;  3KWV A;  5J48 A;  1Z7S 3;  4XEZ A;  4GJZ A;  5GZD A;  5HI0 A;  2V72 A;  1XE7 A;  2X5I C;  2VXJ A;  3KT1 A;  4GIQ A;  5FRE A;  3O1M A;  3ZLI A;  4Q4X 1;  1HX6 A;  1V6M A;  5J98 B;  2X10 A;  2K9Z A;  2VTX J;  1JW6 A;  5CFC B;  2WFF 3;  3PJY A;  3O12 A;  1F4H A;  1VJ2 A;  4P5H A;  2WO2 A;  1E5S A;  1S0E A;  4QQL A;  2B8M A;  5EIY B;  2HKX A;  2GZW A;  1UX7 A;  4P9J A;  4RS5 A;  4AYU A;  1JYN A;  3ZXG A;  3NV2 A;  2D6K A;  1X7N A;  2VC9 A;  4EV0 A;  1RUI 3;  5J1X A;  2GC1 A;  4JQR A;  4QPI B;  3FHA A;  3OTF A;  4BXS V;  1OF4 A;  1SLB A;  2XLF A;  3CJI B;  5LRS A;  1MZ5 A;  4ET7 A;  5EP9 A;  1GLH A;  1IS3 A;  2DV9 A;  1G9F A;  4QXH A;  1W8O A;  1GR3 A;  3GGL A;  1TNR A;  4YGD A;  4A42 A;  2XML A;  2D98 A;  5A33 B;  4M3C B;  1HB2 A;  2E6V A;  2RR1 3;  4AFM A;  4OLL A;  3RZM A;  2YY1 A;  4LKE A;  3AJY A;  3FBY A;  4I02 A;  4N8M A;  5CFD A;  2VOK A;  3SNM A;  1RIN A;  4ARY A;  5A6Z A;  5C8C C;  2FDH A;  3PHM A;  3ON7 A;  1H1A A;  4Q29 A;  3ZR6 A;  1DLL A;  1W9Y A;  1NYW A;  3ZN6 A;  1ENS A;  2R32 A;  1FI2 A;  4BQW A;  3GAL A;  1VRH 3;  3AKP A;  3M7A A;  2JDU A;  1AR8 1;  5FP3 A;  3RNS A;  4OQ8 A;  1OFN A;  2KD7 A;  2ZZJ A;  4R9C A;  3SCG A;  2CY6 A;  1A6C A;  3KVB A;  4H2A A;  4HKW A;  5A80 A;  3IWZ A;  3I3E A;  5BNN B;  3BIE A;  3MYX A;  1XNT A;  1ZRE A;  1YQ5 A;  2PHW A;  2AC1 A;  2R07 2;  3B94 A;  4OZX A;  4E8D A;  3B9I A;  4Q0V A;  4BM8 A;  4NAM A;  4YNI A;  4AQ2 A;  2FDJ A;  1QXJ A;  1PMJ X;  2RJK A;  3I2F A;  1DFQ A;  2VMG A;  2A3W A;  1IGO A;  4UFH A;  5I0T A;  1HB1 A;  3PVO A;  4XUP A;  4HZF A;  1G9C A;  4YZ2 A;  4DMI A;  1X82 A;  3I4I A;  2BVB A;  1XJA A;  2K46 A;  2DTY A;  2WS9 2;  1FV3 A;  3M3C A;  2VZ3 A;  2WNU B;  4I09 A;  2R07 1;  4Q8L A;  1EPW A;  1RB8 G;  2IFW A;  5IAT A;  2CGO A;  4DOU A;  5GLU A;  4CDW A;  1BK1 A;  5FY5 A;  2W92 A;  4OFG A;  4EQV A;  1O3T A;  2B46 X;  2VQA A;  4GWN A;  5CYY A;  2B4K A;  4LR4 A;  4UF0 B;  3PMS A;  4DPN A;  2WNV C;  4LIT A;  1B09 A;  1TNF A;  1GNH A;  2D93 A;  2ZGU A;  2WS9 1;  2ZMK A;  2EVX A;  1WUV A;  4N43 A;  4D7T A;  5KXD A;  4Q0P A;  4E8C A;  1IG3 A;  2BWA A;  4BME A;  2VXR A;  3K3O A;  4LHN A;  4QMA A;  3DV8 A;  5FZH A;  4QHZ A;  2DUP A;  1HRI 3;  2EAL A;  2XBO 2;  4B4P A;  3VBH C;  1W3X A;  1S4C A;  5LBB A;  2VMC A;  3MFC A;  4LPL A;  4YW2 A;  2CSG A;  3VBS C;  5T5L A;  1U0A A;  3V0B A;  1CPN A;  5F3I A;  5A7N A;  1VRB A;  4GH4 C;  3B7M A;  2DVA A;  1NT0 A;  4IQP A;  4MHU A;  3ZFE A;  4WM8 A;  3AM2 A;  3JQX A;  3VB9 A;  5ACA 2;  3O5S A;  3RMX A;  4JGY A;  2WO3 A;  3OUI A;  4WV8 A;  5IVF A;  1XRU A;  2XBO 1;  1PK6 B;  2ZKN A;  1JZ4 A;  1L3J A;  2ZMN A;  3OEB A;  1CVN A;  2H6C A;  1AR9 3;  3C7F A;  3NV3 A;  2DCJ A;  3FFQ A;  2IXJ A;  4HG6 B;  4M4R A;  2HJI A;  5CG8 A;  3WQ1 A;  2FZ1 A;  3KCC A;  5JZG C;  2GAL A;  1BJQ A;  3AZV A;  2CWM A;  4Y5T A;  3NO8 A;  2PFW A;  3PTY A;  4XUQ A;  4YGC A;  3OJB A;  4OVE A;  2VNV A;  4N53 C;  4CE8 A;  1V9U 3;  3Q8B A;  4EJR A;  2KM2 A;  5JXG A;  1UD1 A;  2HWF 2;  1K3I A;  2AEN A;  1UU6 A;  3AC0 A;  1U12 A;  3RI9 A;  5HV4 A;  3FFZ A;  2YDE A;  5D8A C;  2BUK A;  3WDV A;  4Z8B A;  4XCA A;  5F37 A;  2CWS A;  4K20 A;  2RMU 2;  1HXS 3;  2WZE A;  4UFI A;  1AR7 2;  1JYI A;  5C4W A;  3KM5 A;  1HIX A;  3WW1 A;  4XCB A;  4A7Y A;  1EV1 3;  2KXL A;  2Y6G A;  5KHJ A;  3VBR A;  3CKH A;  2FDG A;  1OFS A;  2WN2 A;  2OA2 A;  2WQ4 A;  4AEM A;  2X5I B;  2HWF 1;  3BAL A;  1W0O A;  2QQP A;  2D43 A;  4QPW A;  2PQS A;  1SFN A;  1T6G C;  2D40 A;  2QVS B;  3PLQ A;  4LK6 A;  4CXX A;  4IXL A;  4KBZ A;  4RQP C;  2BGC A;  1I5P A;  1AJO A;  1CAX A;  1XOY A;  1FX5 A;  1OQD A;  2CDP A;  1AR7 1;  2RMU 1;  2EIE A;  4DY3 A;  2NZ9 A;  1BLZ A;  3OGG A;  4AG4 A;  1FNY A;  1G9B A;  4YZ1 A;  3AP5 A;  2P3J A;  2GSY A;  2VY0 A;  5DAV A;  1GP6 A;  1NQD A;  3A7Q A;  1REF A;  3LPG A;  4S2D A;  1RUD 3;  2RS1 3;  5JR7 B;  2I2S A;  4QB1 A;  5K0U C;  3CHX A;  2MEV 3;  3AZZ A;  1FOD 3;  1JMU B;  2CGN A;  1UPI A;  2BP6 A;  3LKJ A;  1IPK A;  2IVI B;  3VHN A;  1YIF A;  3ETQ A;  3NST A;  4MVT A;  4AZZ A;  3S5A A;  5HCA A;  1UOJ A;  1UAI A;  4Y20 A;  4ZON A;  1LOC A;  4QQO A;  3GJB A;  4D8M A;  2GH8 A;  1XC6 A;  5C8C B;  2W1W A;  4KWK A;  1RED A;  1XNK A;  1ZM1 A;  3R4U A;  3N36 A;  4URA A;  1MPX A;  1I3H A;  1S2K A;  4BK5 A;  1OBN A;  5FZO B;  4IV3 A;  1UY0 A;  3FLR A;  3QAC A;  3WW2 A;  3VN4 A;  4HOO A;  2DWR A;  5CA6 A;  2XUE A;  1CAW B;  1L7R A;  3ILN A;  1AYN 2;  4IGP A;  3WW3 A;  3ZFF A;  1KDK A;  4KNC A;  3ZPO A;  3O1P A;  1ZZ9 A;  2PHR A;  2RV9 A;  3ZYR A;  2WLP A;  4LE4 A;  1OPM A;  1SPP B;  2VMD A;  3P6B A;  2KR2 A;  4ZU7 A;  3H50 A;  1LES A;  3K77 A;  1AL2 3;  4KMQ A;  4E4H A;  3USS A;  5LA0 A;  4RN5 A;  4NOT A;  3KQR A;  3POS A;  2WZR 1;  2R1B A;  2RDR A;  2ZKL A;  4Y1V A;  5FMB A;  2YHJ A;  2PLV 2;  1AYN 1;  4BQ1 A;  1BYH A;  3MIF A;  1WW7 A;  3M1H A;  1SHW B;  3NWK A;  4DXZ A;  4LLO A;  2N7G A;  3AYC A;  3OYW B;  4FPC A;  4MXV A;  4XIK A;  1E5H A;  4FOV A;  2HWC 1;  1VAM A;  4GKX A;  2P3I A;  2C9K A;  4FOW A;  4S2G A;  2YYO A;  4HVO A;  5FQ0 A;  4PCR A;  5FZ3 A;  5FPA A;  1QJX 3;  1XBF A;  4PF1 A;  5ABJ C;  4V1P A;  3AKR A;  5J36 A;  4FP2 A;  3N3H A;  5JMC A;  3TN9 3;  2PLV 1;  1WCK A;  2R04 3;  1F5F A;  2WNV B;  5AFE A;  4XDQ A;  2VZO A;  1QJU 3;  1ACC A;  1KEX A;  1CJD A;  3MUZ 1;  3LIH A;  4NE9 A;  4NPM A;  1KDM A;  4COU A;  3POY A;  1YEW A;  4XFC A;  1DZQ A;  3LOB A;  3HOB A;  2ZOE B;  2J1E A;  3H1W A;  2CL2 A;  2VVE A;  1GBG A;  4HPK B;  4Q4X 3;  2ARA A;  2DU0 A;  2V09 A;  5FZI A;  3MIE A;  2A6Y A;  2GP3 A;  1PVC 3;  4UBH A;  4XC9 A;  2PMW B;  3VBH B;  1W2O A;  1EYB A;  1K45 A;  4FTE A;  4NHY A;  3DEC A;  3D0J A;  3VBS B;  1D0H A;  4D7S A;  1IPS A;  5FTT C;  4GH4 B;  2V4A A;  1OVS A;  1URX A;  3GBW A;  2FDF A;  5DPN A;  4CRQ A;  4DQA A;  1QGL A;  3MBW A;  4XFH A;  4ZHN A;  4PQQ A;  3BI3 A;  3MZH A;  2VTF A;  3UJO A;  2Q0A A;  1A78 A;  1UN1 A;  3OUJ A;  2B9V A;  5FJK A;  4MXW A;  1OQE A;  3MIC A;  5C3P A;  4IND A;  4Z07 A;  3EHK A;  5H9R A;  2QQM A;  5FK7 A;  2EIC A;  2VBD A;  3T0B A;  5JZG B;  4YM1 A;  2VCA A;  2J1S A;  2WT1 A;  3L2Y A;  3WF4 A;  4AI0 A;  1ZRR A;  5E88 A;  5FZG A;  4BDV B;  5L7O A;  1GQH A;  5CG9 A;  3WEZ A;  1J84 A;  4N53 B;  3E1F 1;  3RDI A;  5JXI A;  1AR8 3;  1DHK B;  1C8M 2;  4LKF A;  4AVC A;  1VP6 A;  1H1M A;  4TXW A;  5D8A B;  1NXM A;  4DNY A;  1ULC A;  4NRO A;  5FZ6 A;  3IT8 A;  4AI9 A;  3LDK A;  2ID4 A;  2HWD 3;  2DVD A;  3FL7 A;  1X33 A;  4HLT A;  4JZR A;  5FXX A;  1K5M A;  5A7S A;  4YZ5 A;  5L36 A;  3VD7 A;  3CBN A;  3GBF A;  4AFB A;  4PHZ A;  3VL9 A;  1BHG A;  5JIU A;  2VE1 A;  2WQ8 A;  2VOX A;  2E53 A;  2Y60 A;  2J1R A;  3GZT B;  1SAC A;  3PDQ A;  3OGS A;  3WUC A;  1REE A;  3T2T A;  1C8M 1;  2XJR A;  4HFS A;  5CKN A;  5FZ0 A;  1V6N A;  2UWC A;  3DPR A;  4XTP A;  4YW5 A;  5FLH A;  5LY2 A;  4AI3 A;  4EE2 A;  4ISR A;  1WLD A;  1K5J A;  2P4E A;  2WAA A;  4RQP B;  4D7Y A;  1ZRD A;  4JQT A;  2BGO A;  5FP7 A;  3THC A;  3KGL A;  1CD3 G;  4PIZ A;  1E5I A;  2HEY F;  4GAL A;  3KCY A;  1UZZ A;  3LPF A;  3WVJ A;  5A1L A;  2W52 A;  3C7O A;  3BOD A;  4PF5 A;  3VHO A;  1ZBA 2;  4XMI A;  2RE9 A;  5ACA 1;  3W20 A;  3KV4 A;  5K0U B;  4A45 A;  3IM0 A;  2WA3 A;  4ES8 A;  3ZKU A;  1RVF 3;  1ZBE 3;  3THD A;  4HSL A;  4YAR A;  4FTS A;  2JB8 A;  4WM7 C;  2YU2 A;  5LZ6 A;  1B35 C;  3GF6 A;  1SLI A;  2EIG A;  3PU3 A;  3AXD A;  2C5D A;  1ZBA 1;  5EQU A;  2ZAA A;  3VD5 A;  2D3S A;  4CUA A;  3KHC A;  1S0C A;  2ZGO A;  5BNO C;  5GAL A;  1QMJ A;  3OGJ A;  2C0Z A;  1QH6 A;  4NMI A;  4XDP A;  2VW2 A;  4BQY A;  2W47 A;  5FZF A;  3AXE A;  2WAO A;  4EN6 B;  1D0G A;  2UU8 A;  3DKQ A;  3GJA A;  4YRD A;  2BNN A;  2XWB B;  4OHW A;  5F3E A;  2Y0I A;  3LA7 A;  2VL4 A;  5I91 A;  3BU7 A;  1F35 A;  4IEY A;  3N7L A;  2XBO 3;  3WF0 A;  4COY A;  4XFB A;  1O8P A;  3ZPY A;  1SFY A;  2BW8 A;  5E8A A;  2XKO A;  1YYN A;  1ZZ6 A;  1GP5 A;  4AGV A;  5F2W A;  1S0G A;  3JD7 3;  1PX3 A;  1WLT A;  2P2K A;  4JKM A;  3ZYG A;  5T5J A;  5JPN B;  3VBU A;  4EN0 A;  3RZG A;  2Q1F A;  3A0N A;  4Y1X A;  3FJS A;  3BCW A;  3UT0 A;  4FPJ A;  4M00 A;  3GNE A;  4MZU A;  5EJ1 B;  1GP4 A;  4CCM A;  2QDR A;  2VZS A;  5ABJ B;  1FAT A;  1ND3 C;  5F6L B;  1ENR A;  2AZ5 A;  1W6N B;  3RWN A;  4CP0 A;  2SLI A;  1UZW A;  3ZMN A;  4OUE A;  5IK5 A;  1W2N A;  3WF3 A;  3ACH A;  4XF3 A;  2JJ6 A;  5C3O A;  4BIF A;  4NRM A;  5KXB A;  4R4Z A;  3GZE A;  5FZ7 A;  2OKX A;  1JYC A;  4JDO A;  3UKN A;  3DF0 A;  3O0V A;  2JEM A;  4XFG A;  1APN A;  2B42 B;  2HBT A;  1ND2 C;  1S55 A;  1AVB A;  3LEG A;  2WNO A;  3SEE A;  4Q4Y 2;  1JU3 A;  4CEY C;  4JGZ B;  4FVV A;  4NID A;  1HN0 A;  1QDC A;  1UY2 A;  2WWS A;  2XVK A;  2OS2 A;  5LBC A;  3VKN A;  2DVG A;  3FLT A;  3HD8 B;  4FPF A;  4FT8 A;  2ET1 A;  5F5C A;  5EYY A;  1JN2 P;  3LE0 A;  4A4A A;  2JD9 A;  1LJ7 A;  1ZRI A;  3E5X A;  2HEW F;  1OA3 A;  3AZW A;  3NKT A;  4HMZ A;  4P08 A;  4Z2A A;  4MGT A;  3R0R A;  1COV 3;  4K8R B;  5GZG A;  2ZCW A;  1BK0 A;  4Q27 A;  4Q4Y 1;  5LA9 A;  4DY5 A;  3T08 A;  2A3Y A;  3POI A;  4K1Y A;  5JDB A;  2B45 X;  2JDP A;  2BDR A;  1ZX5 A;  4XDO A;  1W0P A;  2JE9 A;  1CX4 A;  1MEC 1;  4A6S A;  2F17 A;  2VMH A;  4ARX A;  4IEZ A;  3IDA A;  3LDB A;  3MGU A;  3E5U A;  4PDW A;  2DVF A;  2VVD A;  4CDQ C;  1DQ0 A;  1W8N A;  5SV5 A;  1MZF A;  3RJ2 X;  1UY4 A;  1VMJ A;  4Q2F A;  2GNM A;  3NV4 A;  4OUM A;  2PHF A;  4BHP A;  2GC2 A;  1HB3 A;  3O1R A;  2ZTN A;  1Q43 A;  3VKO A;  5FYY A;  2VJX A;  3POB A;  4FFI A;  3K2O A;  2XXZ A;  3BGA A;  2ARC A;  1OLQ A;  5JCT A;  1UCX A;  1UO9 A;  2O8O A;  4AHZ A;  4HBN A;  1CR7 A;  2VUC A;  5HBA A;  2P6C A;  2WO7 A;  2WZR 3;  5FZ9 A;  4UFJ A;  1BMV 2;  4B3N A;  5JLV A;  1I9R A;  1I6X A;  5F7U A;  1LRH A;  3J8F 2;  1N1Y A;  2PHT A;  2WIN B;  2ZHM A;  3OD0 A;  4IEO A;  1F5J A;  1L7Q A;  2RM2 3;  4FAH A;  5F3C A;  4CCN A;  5A32 A;  2HWC 3;  1CES A;  5I8T A;  4Y3O A;  1YWK A;  3UKV A;  3ZXF A;  1BKZ A;  3I59 A;  5FCC A;  4HKL A;  1DYK A;  2A3X A;  1PO1 2;  4EZH A;  5FZD A;  3Q8E A;  1YI7 A;  4AR2 A;  1VAV A;  1G86 A;  4NR1 A;  3RSJ A;  2LRP A;  3DXU A;  4FFG A;  2PLV 3;  4OI1 A;  2D5F A;  4WZC A;  3J8F 1;  4CEW C;  2Q8D A;  4QX5 A;  1RYY A;  1LTE A;  1ULF A;  2PHX A;  3WF2 A;  3PJQ A;  4FBF A;  4MGK E;  1W6P A;  5A7W A;  4WM7 B;  1W8Z A;  1W6Q A;  5DG1 A;  1B35 B;  5KHG A;  2AGS A;  1IG0 A;  1PO1 1;  3C8X A;  4XFA A;  1CQ9 A;  1G9A A;  5B2G B;  3P1I A;  1Q5O A;  1TZO A;  3RI8 A;  3ZYH A;  5EJZ B;  3KCX A;  5BNO B;  3PUQ A;  4XUR A;  3VBF A;  4IEP A;  3V0A B;  4DS0 A;  4RL7 A;  3EMR A;  2DBN A;  1P8J A;  1Y43 B;  4YLZ A;  1FMD 2;  2A6Z A;  4B4R A;  5AC9 2;  3NV1 A;  3UGH A;  2AAC A;  1W9F A;  3KT7 A;  1V6I A;  1ZZB A;  4FI9 A;  1Q8V A;  4ZKT B;  1H6X A;  1F31 A;  1YI9 A;  2BTV C;  5BY5 A;  1YFY A;  4FFF A;  2VUA A;  5F8P A;  4AAX A;  4LHL A;  1YLL A;  4AFC A;  1H8T C;  2XJV A;  4KI5 M;  1OI6 A;  4OHZ A;  5JI7 A;  1PO2 2;  5A1F A;  1LEN A;  1ULP A;  2R0F A;  5K4L A;  2ZEW A;  2VTX A;  2FDK A;  3OGR A;  4Z1V A;  5A3U A;  1WW5 A;  5GM0 A;  1YNA A;  3POW A;  2QDN A;  1NCQ A;  4LBQ A;  5FY0 A;  4BQ3 A;  1OOP B;  4B29 A;  5C8W A;  2J22 A;  4PBP A;  2BNM A;  2R30 A;  3I3B A;  3ZOI A;  2JEC A;  3E6C C;  3TAY A;  4BJ0 A;  1S2B A;  3BPS A;  4QKN A;  3DEM A;  1W6O A;  3AZX A;  3QH7 A;  5F9T A;  1PO2 1;  1W05 A;  2GNB A;  3DXT A;  3LQC A;  4PIX A;  2G19 A;  4YPJ A;  5CFC A;  4ZZ8 A;  1VLN A;  2D7F A;  4Y22 B;  2JDM A;  2BFU L;  3HBZ A;  4E4S A;  1C8M 3;  1EY2 A;  1UIJ A;  4XOG A;  2ZGQ A;  2D5H A;  4YWA A;  4AXO A;  1ULE A;  5FZ4 A;  3KT4 A;  4HN1 A;  1A8D A;  2JXA A;  5A7Q A;  4CDX B;  1ND2 B;  1GAN A;  5FLI A;  3ZXE A;  4QPI A;  4BQ5 A;  4C1X A;  4NJ4 A;  3ASI A;  2VUD A;  3CJI A;  3TNP B;  2V73 A;  1JYV A;  4G3Y C;  1OC1 A;  4CEY B;  5FMO L;  2JG9 A;  4LE3 A;  1NZC A;  4XQD A;  1NE6 A;  4GMP 1;  1Q3E A;  2VNR A;  2WKK A;  1NG0 A;  3Q8F A;  1D4V B;  2BJS A;  1L7L A;  5FP9 A;  2VOT A;  1PNF A;  4CCK A;  4XJ8 A;  5TSW A;  1UYP A;  2LTN A;  3SQO A;  5A3W A;  3RZL A;  3PIJ A;  1H4H A;  5AVA A;  2ZGM A;  3VZJ A;  3T2P A;  3RJR A;  4FP3 A;  3CJX A;  4YVW A;  1QOO A;  1CAU A;  4XXA A;  5DZG A;  1V6J A;  3A23 A;  4EZ4 A;  4HL0 A;  1KIT A;  2XL9 A;  4XMA A;  3VDB A;  2BOI A;  1GSL A;  3ELN A;  4XF4 A;  5BNN A;  5FY9 A;  2QKD A;  5JSR A;  1MAC A;  2GMP A;  4DRV A;  3N4M A;  4FQZ A;  3G6J B;  1GOG A;  1WMD A;  3DCQ A;  3KMH A;  4PIY A;  4XVH A;  4A41 A;  3SHR A;  4CDQ B;  2WZ8 A;  2JWP A;  4QPG C;  4RFT 0;  1Q8Q A;  2O0O A;  1UYZ A;  1J3R A;  3BIW E;  1PZ7 A;  1VBD 3;  4XUO A;  3UJQ A;  1LOB A;  1QOS A;  1ZA7 A;  2WAB A;  4XAB A;  5E1R A;  5DAP A;  1UMH A;  4YW1 A;  4BQX A;  1SMV A;  4MLO A;  4BIO A;  4CVU A;  5CFD C;  1GZC A;  1MQT C;  1UX6 A;  3MIG A;  3ZN4 A;  3QCW A;  1JOJ A;  1W9T A;  3PVE A;  4LEJ A;  2HBU A;  5L9R A;  3BKZ A;  1LHV A;  1YXW A;  2ZBJ A;  2WNU A;  1DP0 A;  4XUN A;  1R08 2;  1NLQ A;  4W50 A;  3NNL A;  1Q8S A;  2O14 A;  1VBE 3;  2MHF A;  2A6V A;  4K40 A;  4LXL A;  5DZF A;  5GLV A;  4A44 A;  3ZSL A;  4ERO A;  2UYB A;  5B4N A;  5E6H A;  5A3M A;  4UF0 A;  1SBD A;  4NIG A;  4D6S A;  4E9K A;  1KJL A;  5T3N A;  3RG0 A;  4L2N A;  4UW3 A;  3ME2 A;  1T2X A;  4NPL A;  4LBM A;  5L19 A;  3LSE A;  2VVF A;  2WUH A;  5DQ0 A;  5FKC A;  4WVZ A;  4CEW B;  4DXR A;  2WO1 A;  2JEN A;  4Y1Y A;  4GJY A;  5FWE A;  5FZ1 A;  2VPV A;  3ZXA C;  4G9S B;  4XZP A;  2ZXQ A;  4QT6 A;  3C7G A;  3H42 B;  1QWR A;  1DYP A;  2GN3 A;  3U07 A;  1H9P A;  1W8H A;  1WKY A;  3LSD A;  2IXL A;  3AKS A;  2ATF A;  1IHM A;  1RUE 2;  3WNP A;  3B3Q E;  3LEM A;  5G04 L;  1LOD A;  2A5Z A;  4CDW C;  3LEK A;  4IE5 A;  1SBE A;  1A34 A;  1RXG A;  1GWK A;  1DGR N;  1BEV 3;  3RYP A;  4ATF A;  3BTX A;  4G4F A;  4OMC A;  3TEX A;  2PTM A;  3S5Q A;  2SBA A;  4FOY A;  2IWG B;  1VPH A;  4IES A;  4JCK A;  1S2E A;  4LUL A;  5GLW A;  1AR6 2;  5FY4 A;  4DIN B;  1OKO A;  4N43 C;  4IUG A;  2JE7 A;  4AEJ A;  5BNP A;  1E5R A;  4KU7 A;  4UAP A;  4Y24 A;  1IS5 A;  1N1S A;  3AFG A;  3ZYB A;  2C24 A;  1I1E A;  1STM A;  1UYX A;  5JIA A;  4OUL A;  1RUE 1;  1QJY 3;  5DMY A;  2YBP A;  2ZX4 A;  2Z69 A;  3OUH A;  1YRZ A;  3J7N A;  1IOA A;  4GXL A;  4WVM B;  5F5A A;  3WR0 A;  1DGW A;  4HSJ A;  4Q4Y 3;  3WHU A;  2G1M A;  4C91 A;  1AYM 2;  4R9A A;  3ENR A;  4JV4 A;  1UOF A;  3ES4 A;  2OQ6 A;  1N1V A;  1UWW A;  2ZHK A;  2D6O X;  4HT1 T;  1AR6 1;  3H1M A;  3RQ0 A;  1NZI A;  1PIV 2;  2PXJ A;  4FPO B;  1MEC 3;  3ZSK A;  4F3J A;  3ZFE C;  2DUR A;  1NCR C;  4WM8 C;  1TQ5 A;  1CAV A;  1KGY A;  4JGY C;  1AUY A;  3OBT A;  5FXW A;  3WQ7 A;  1PM4 A;  4CDU C;  1EPZ A;  4KWL A;  3LAG A;  4W6Y A;  3E6D A;  3ECQ A;  1R1A 2;  3W5N A;  1AYM 1;  5I0D A;  4FOQ A;  2VOW A;  5FPV A;  5FOJ B;  2RJ2 A;  2K0G A;  1RUJ 2;  2IXH A;  1PIV 1;  5D2A A;  5T50 A;  4AED C;  3I97 A;  4CCL A;  2XJT A;  2XQX A;  4BLJ A;  3KLS A;  1POV 3;  4Q4W 2;  4GB3 3;  2OZJ A;  2HWB 2;  1LOE A;  2H0B A;  5CIR A;  3QBQ A;  1YIP A;  4QU2 A;  3VKL A;  5FR3 A;  4WBB A;  1JU4 A;  2FBE A;  5LK7 B;  1RC6 A;  3D6E A;  5LBF A;  2XB6 C;  1R1A 1;  2BGP A;  3B00 A;  2OW4 A;  4L8Q A;  1Z0H A;  4N9H A;  2ADD A;  3VZN A;  1CIW A;  3T3Y A;  5H9Q A;  1H1I A;  1RUG 2;  1GQG A;  3A21 A;  5KBF A;  1RUJ 1;  2XKP A;  3JBG 3;  3ITQ A;  4E2G A;  1Z78 A;  4MGI E;  5C4W C;  2ZJC A;  4QQ2 A;  4P5Y A;  2UYA A;  4Q4W 1;  2ZZQ A;  3HPN A;  2C26 A;  1JOB A;  3I2J A;  4KWU A;  5LB6 A;  1RIT A;  2ZAH A;  4YVS B;  3VBR C;  4OI4 A;  4P02 B;  3NJV A;  4QQP A;  3MPB A;  2GME A;  3N9M A;  1ULG A;  3M4F A;  2X05 A;  3IBM A;  3RRD A;  2Q1Z B;  1RUG 1;  4CUG A;  5I0U A;  1DQ4 A;  4ZPI A;  1BVP 1;  1JH5 A;  1PO1 3;  1ZZ7 A;  3U10 A;  5CAZ A;  3WZ1 A;  5IVJ A;  3HNM A;  4E4D X;  1CAW A;  3NAP C;  3TEW A;  1YFU A;  1RUF 2;  3EJK A;  3DYM A;  3AP7 A;  4Q1P A;  3O1U A;  3OBR A;  2VU9 A;  5I93 A;  3FE5 A;  4JHT A;  1FT9 A;  4K7J A;  2RG4 A;  1TME 3;  4QPG B;  2OUJ A;  4YG3 A;  4EN9 B;  5J09 A;  4GWJ A;  3H1Y A;  3U75 A;  1ASJ 3;  5DUX A;  1WLW A;  2QNK A;  1XXN A;  1MQT B;  2EXK A;  4KWJ A;  3SEP A;  1RUF 1;  3NKG A;  3J7L A;  4NHK A;  3T1L A;  1J3P A;  5LA1 A;  5LW9 A;  1LED A;  1I5Z A;  4AI2 A;  5A6X A;  3LFM A;  3RZH A;  2ZGN A;  4IV3 C;  3UGG A;  5JSP A;  1SQ4 A;  3ATG A;  2W87 A;  2YGM A;  1C57 A;  4IV1 C;  3D4K A;  3AMH A;  3ZFF C;  3J7M A;  1S0I A;  2AEY A;  3NNF A;  3WG4 A;  1O4T A;  1U5I A;  2WNV A;  3SMH A;  1FPN 2;  3N7M A;  4H3W A;  1R1Z A;  2W39 A;  3AP6 A;  1MS0 A;  1VMH A;  2D44 A;  4XTM A;  1LEM A;  1GNY A;  4CP9 A;  4JX0 A;  1VBC 3;  3N9L A;  4P00 B;  3I3D A;  4LBK A;  4D69 A;  4LBJ A;  5GZE A;  5DG2 A;  3AKQ A;  4HPK A;  1XYN A;  1EAH 2;  1PO2 3;  4RGK A;  1NA1 A;  1ENQ A;  3GBG A;  3R05 A;  5SV8 A;  4PBO A;  4QXC A;  1K12 A;  1ALY A;  3WCS A;  2VGD A;  1BVV A;  3RYR A;  4BPZ A;  1OKQ A;  1A8M A;  1FPN 1;  2DF7 A;  3VBS A;  2BEO A;  4IE7 A;  1VAK A;  1MS5 A;  2P17 A;  3KGZ A;  1WCS A;  2HEV F;  5EV7 A;  2VW0 A;  1QJE A;  2ZGS A;  5IWF A;  3R4D B;  4AVS A;  3BTZ A;  2IVJ A;  4CDW B;  3ILR A;  1ZYB A;  4GH4 A;  5DUV A;  1GIC A;  3H8R A;  4GZ9 A;  4HK9 A;  1DYO A;  1AXY A;  5DAB A;  4XYX A;  5A3P A;  5JAX A;  3DKW A;  3MO4 A;  1EAH 1;  3OG2 A;  4URT A;  1SCR A;  1Y3T A;  3GCW A;  4EWE A;  4Q4V 3;  1QXP A;  3ZYJ B;  3I49 A;  1KFU L;  2B7Y A;  2DCK A;  4GMP 3;  4NHX A;  1DBN A;  4N43 B;  1WD4 A;  5JI9 A;  2ZEZ A;  1SDD B;  2VOV A;  3LDR A;  3PIG A;  4BE3 A;  3ST7 A;  2HWE 2;  2WYS A;  5A6Y A;  1H6Y A;  1YJL A;  2RHP A;  4LOT A;  2XGX A;  3UV9 A;  2PAM A;  1E57 A;  4BYY A;  4V2V A;  5C5T A;  2XWJ B;  1SFP A;  4QQH A;  4PQ9 A;  1IKP A;  3HVD A;  5LA2 A;  1UKR A;  1O3R A;  2WLQ A;  2AEZ A;  2GN7 A;  5C9A A;  1WA4 A;  3V0B B;  4YW6 A;  4RHV 2;  5LAT A;  4QB2 A;  3KQ4 B;  4FQ4 A;  5DUU A;  3ILF A;  3ZFE B;  1O3S A;  2EID A;  4CZS A;  4A6O A;  1NCR B;  1Y9Q A;  4CTE A;  2EAK A;  1PVX A;  4WM8 B;  3N9O A;  4JC1 A;  1JTZ X;  2JIG A;  2HWE 1;  4JGY B;  4TWT A;  4HXC A;  2FZ2 A;  2C1F A;  2Y64 A;  4CDU B;  3EXU A;  5DAX A;  3KZ4 C;  4QHB A;  1LR5 A;  3N9Q A;  1GQP A;  5L9V A;  4LKD A;  4AED B;  4N90 A;  4RHV 1;  3RGB A;  2JKB A;  4IET A;  4M01 A;  1NY7 2;  1VBB 3;  4RQP A;  5FKB A;  1POQ A;  4CUB A;  5GZC A;  1H2M A;  2XQR A;  2Y0O A;  1ZRC A;  2W08 A;  4KGQ A;  4LHK A;  2DYC A;  4FAG A;  3T30 A;  1QEX A;  4Y33 A;  1YQ8 A;  4QB6 A;  1DQ2 A;  2R7E B;  1K42 A;  1MZE A;  2JDZ A;  3S7I A;  2PHD A;  5LEJ A;  5C4W B;  3R4S A;  1NY7 1;  1CPM A;  3Q8C A;  5FYZ A;  1XQN A;  4BIS A;  4DUW A;  5FPX A;  2JDK A;  2TBV A;  4AVB A;  1QNY A;  3K48 A;  3C2U A;  3HNY M;  5HCF A;  3VBR B;  3K51 A;  3AB0 A;  3WNO A;  1O59 A;  2ZA9 A;  4F8A A;  1HN1 A;  4NRP A;  1W3V A;  3OD4 A;  4WVV A;  1UXZ A;  3CNA A;  3D5O A;  1W8W A;  1UZ0 A;  3FLP A;  1CAX B;  3RVH A;  2RS5 2;  3U4S A;  3NAP B;  3TRS B;  3WXP A;  1VAL A;  4MYE A;  4XUT A;  4BU2 A;  2DFB A;  5T52 A;  4RSU A;  4OHY A;  3HN3 A;  2YB7 A;  5C5U A;  1XYP A;  2NQY A;  1J59 A;  5FOB B;  2RDQ A;  2HYK A;  4ZXK A;  5FYS A;  3G7D A;  4ITC A;  1ST8 A;  5FXZ A;  3B5L B;  2W5F A;  1SLC A;  3NVC A;  5FPZ A;  2R06 2;  2RS5 1;  2W2I A;  3KF3 A;  4XQW A;  2B5H A;  1RUE 3;  5DDJ 2;  4BOW A;  4I0A A;  1XNA A;  4XET A;  5M0T A;  1S0B A;  3SLI A;  4NHM A;  1F8V A;  4LNV A;  2W1U A;  4YG6 A;  3OPT A;  3CF6 E;  4IV3 B;  4OZO A;  3WP3 A;  1HDK A;  2XL7 A;  2VCM A;  4ZU4 A;  4IV1 B;  2VQ0 A;  4AHY A;  1HQL A;  3S30 A;  3ZFF B;  1W6N A;  2R06 1;  1HJG A;  4ZU5 A;  1ZVF A;  5DDJ 1;  1VE0 A;  5F5I A;  5FPL A;  3M2M A;  4K9S A;  2YU1 A;  3AZY A;  5C3S A;  3IPV A;  4LBQ D;  1AYM 3;  2R07 3;  3WOG A;  3DYO A;  4MGY E;  1MS4 A;  2CAU A;  2DBI A;  3WF1 A;  2VCC A;  1J3Q A;  1MVQ A;  4QX0 A;  3OB8 A;  1QJZ A;  3VBU C;  1ODN A;  3R6S A;  3CLP A;  2A1X A;  3RFR A;  2ZHL A;  2XVL A;  3H3Z A;  2BZD A;  3W9A A;  5IVC A;  2XON A;  4JGZ A;  2BFU S;  2ZML A;  1W8T A;  4Y5S A;  1DQ6 A;  2WS9 3;  1W9S A;  3OBA A;  2IFR A;  2ARX A;  4LJH A;  4XBL A;  5FQ0 B;  3T2Q A;  1R09 2;  1DGR A;  2EXI A;  3VD9 A;  4LHS A;  4S2H A;  4LO6 B;  3AYE A;  3W59 A;  1J58 A;  1PHM A;  4XFF A;  1O5U A;  2RDN A;  2VQU A;  1BBT 2;  5DAW A;  3VBO A;  5AVP A;  3URF A;  3LGR A;  1MVE A;  5FMO S;  2CGP A;  4KQ7 A;  3D82 A;  4I0W B;  1RJ8 A;  2WDB A;  2ZHN A;  1KJR A;  2XG3 A;  3ZDV A;  1R09 1;  5LEK A;  3FUQ A;  3D3A A;  2GC0 A;  3EO6 A;  3IDC B;  2ET7 A;  3VZO A;  2R49 A;  3QOP A;  1Y4W A;  1BBT 1;  1LOA A;  1Q8P A;  1VMF A;  2JG8 A;  2VZV A;  4XJA A;  1A3K A;  1JBC A;  3I2K A;  2Y26 A;  1RUC 2;  4UFK A;  3SH5 A;  3TEZ A;  4XJ9 A;  3BVC A;  3GHM A;  1AJK A;  1IPJ A;  5JOX A;  4LLF A;  3J9S A;  5T5O A;  4D6Q A;  4YGB A;  2BRT A;  1VB2 A;  1RHI 2;  1JXN A;  3FHQ A;  5GLZ A;  4AOC A;  1JZ2 A;  1X50 A;  1HRV 2;  3NJX A;  5IK8 A;  1N47 A;  1ENX A;  3HJR A;  5LRR A;  1BXH A;  1TMF 2;  2BBA A;  3BYW A;  1LNS A;  3JXS A;  4HN0 A;  4BQ4 A;  1RGS A;  3DYP A;  4MXW B;  1RUC 1;  1POV 0;  4YSF A;  3Q8A A;  3WG3 A;  4AHX A;  3NNJ A;  5FZA A;  1AZD A;  4MH0 E;  3OSD A;  4IE6 A;  3L2H A;  3ZXJ A;  4TZD A;  2WFF 2;  3BPZ A;  4KGG A;  1JI6 A;  3TWI A;  5GKA C;  2FCV A;  1RHI 1;  5BV6 A;  1C1F A;  5FIX A;  4PDW C;  3ZIW A;  3NNM A;  5A1A A;  1M06 G;  2XHN A;  1PMH X;  1TMF 1;  1RUI 2;  1H8V A;  2HWF 3;  2BU9 A;  3AX4 A;  1RTV A;  2BPA 2;  4DRR A;  4QWN A;  1Q56 A;  2YUE A;  4BCU A;  1XNB A;  2D3R A;  4HVQ A;  1DDL A;  5EJ3 A;  1XE8 A;  3I2G A;  5FFO C;  5FYU A;  1LOF A;  2RMU 3;  4TLF A;  5FY1 A;  2WFF 1;  1AR7 3;  1UNB A;  3PU8 A;  1ZZC A;  4K8F A;  4K3U A;  3V64 A;  3ZN5 A;  1TG7 A;  1XYO A;  4ZY9 A;  2RR1 2;  3VHR A;  1HV0 A;  1VB4 A;  4QDR A;  2WZP P;  2G9F A;  2Y6K A;  3RZZ A;  3W58 A;  1RUI 1;  3B01 A;  3RYK A;  2P1B A;  5BNO A;  2WWJ A;  4XPV A;  4B1L A;  4OYU A;  2ZGL A;  1ODM A;  2I45 A;  1RL3 A;  1VRH 2;  3V0A A;  3ZVX A;  5GLT A;  2W94 A;  4OUS A;  2UY9 A;  5JUV A;  5A3L A;  2LUW A;  2AUY A;  3N7J A;  2G9G A;  4X6Q B;  2PN5 A;  3THP A;  4CCD A;  2RR1 1;  1DZT A;  3ZYF A;  2UWA A;  4ZS3 A;  1SLL A;  4Q5O A;  1JZ6 A;  5JOW A;  4QX3 A;  3MV1 1;  2Y34 A;  4NVP A;  3SC7 X;  3POG A;  5T55 A;  3ZMO A;  1SDW A;  2L9L A;  2Y6J A;  2QCS B;  3LA3 A;  4LMF A;  1VRH 1;  3AVR A;  3ZO0 B;  2Y8K A;  2E7A A;  4M0N A;  1W6M B;  3WQ0 A;  4OHX A;  1LKN A;  5H9S A;  1U5X A;  3ZFG C;  4EWA A;  2LAL A;  1QY4 A;  5FP4 A;  5KHK A;  3QD6 A;  1C5I A;  1QNW A;  4P9X A;  2P37 A;  2VAU A;  5BUV A;  2X8K A;  3PNA A;  1OOP A;  3CEW A;  1EUT A;  4R52 A;  1IQD C;  3MUY 1;  3VBF C;  4NO4 A;  2ZPX A;  3PUS A;  3ZX7 A;  5FWJ A;  3M8L A;  1AYN 3;  3O7O A;  5FYM A;  1HQN A;  4AQ6 A;  1DU3 D;  1WBL A;  4LA2 A;  2QQJ A;  5IK7 A;  4XAC A;  4LUK A;  1V6O A;  2VG9 A;  4LTA A;  5FBZ A;  2JIC A;  5EZW A;  4HON A;  5FK8 A;  3AMM A;  5IHR A;  2QQW A;  4LBO A;  2QQK A;  5AFB A;  2OYZ A;  4RHV 3;  3CU7 A;  1W2T A;  4LOS A;  4EYU A;  3S57 A;  3RZJ A;  1SZB A;  4CDX A;  1ND2 A;  3VBU B;  3NW4 A;  1GZ9 A;  3X29 B;  4JTO A;  1BMV 1;  1HRI 2;  3WV6 A;  3OGV A;  4TTG A;  3TB0 A;  3MFA A;  1WGP A;  1NCQ C;  1PNG A;  3WDU A;  4FSJ A;  3LEI A;  2A71 A;  3HBK A;  1GZW B;  4AGG A;  3QH6 A;  4GMP 0;  4YW7 A; 
#chains in the Genus database with same CATH homology
 2WNO A;  5CKQ A;  1SPP B;  3POG A;  3POJ A;  4LOT A;  4LOR A;  1NZI A;  2QQO A;  1SFP A;  4LMF A;  2QQK A;  4LOS A;  1SZB A;  3POE A;  2QQL A;  3KQ4 B;  1SPP A;  3POF A;  3POB A;  4GZ9 A;  5CKM A;  3DEM A;  2QQM A;  5CKN A;  3POI A;  5CIS A;  1NT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...