3POGA

Crystal structure of the masp-1 cub2 domain bound to ca2+
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
112
structure length
112
Chain Sequence
b'CSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mannan-binding lectin serine protease 1
publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 16
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3pogA00
1NT0A 3POBA 1NZIA 1SZBA 5CKMA 2QQLA 3POGA 5CKNA 4LOTA 1SPPA 5CISA 3POEA 1SFPA 5CKQA 4GZ9A 3POIA 2WNOA 3POFA 1SPPB 2QQKA 3POJA 3KQ4B 4LOSA 4LORA 2QQMA 2QQOA 3DEMA 4LMFA
chains in the Genus database with same CATH superfamily
5DAWA 5EV7A 2JKXA 4UW3A 3T2TA 4IE6A 5LB6A 2E51A 1LCLA 3WEZA 1GFF2 1XNDA 2HWE1 4LITA 1VBB2 2QQLA 2VOWA 5GZEA 3ZFFB 4BZ4A 5IK7A 3I2OA 1AR71 2VZ3A 3RZHA 2AENA 5CG8A 4IGOA 3WP3A 1H2NA 3ZLIA 2TUNA 1NCRA 3RI9A 1IS4A 1WMDA 5ANNA 3MW4A 1V6NA 4DINB 4AGRA 2WQ4A 5FLIA 5BNPA 2ZZQA 5EP9A 1PGL1 3CJIA 5FKBA 2A73B 3ZFEC 4Q4W1 4M3CF 5FWJA 2HWF1 1IHMA 4O65A 4YVWA 1UKGA 1KFXL 1ASJ2 4I0AA 4A7ZA 5D8AC 3ZIXA 1OPMA 5FZAA 1J83A 2BZDA 3PDQA 5IJRA 5C5TA 2E6VA 1PX4A 3NV1A 4CCKA 2ORXA 1OF3A 1HW5A 2WA4A 4YW7A 5FY9A 2RE9A 3AVSA 3CBNA 3HT1A 4XUQA 1ZBE3 1M4WA 4CP9B 1VRH3 3ZFEB 5CFCB 1RUI2 1NAEA 5K9YA 5A7OA 3ACGA 4XJ9A 2VW1A 3WUDA 3WNKA 4IV3C 4P02B 2RDQA 4R4ZA 3IDAA 5D8AB 1CPNA 2UWBA 1ZZ8A 2I74A 4XBQA 4GZ9A 5J7MA 4KG0A 3DXTA 3WXPA 3KMHA 3TEYA 2LUWA 1RXFA 1QY4A 1KJRA 5LA9A 4D3WA 5JOXA 4CCLA 4GD4A 3CLPA 2MEV2 3S57A 3CNAA 2PELA 5FZ0A 3ZSEA 1A34A 2P2KA 4BLJA 4FTSA 4IV3B 2K9ZA 4AVBA 2DFBA 4FP3A 1ZZ9A 4XTPA 2ERFA 5DZEA 2RS11 4YW6A 1LULA 2Z2SB 3OPWA 2J1UA 4YM0A 2NMNA 4QXCA 2VVFA 5C4WA 3SEEA 3GHMA 4LO5B 2ZX4A 4BJ0A 2JIJA 1JODA 1FMD3 2JDHA 3ZYGA 1R1A3 3J7MA 3C7EA 5I8TA 2WSVA 1OVPA 4NWVA 1R093 4AVCA 3I97A 2W95A 2YU2A 2VMCA 5JMOA 2V73A 2DU0A 5EJ1B 4ZXEA 2D5FA 2XLFA 2ZMNA 4KBZA 1GQHA 2YZ4A 4LKDA 4I3PA 2OQ6A 5BNQA 4LO6B 4XDPA 1I9RA 2H6CA 4RGAA 5FYZA 3UT0A 2R49A 4BB3A 5C5UA 5JVVA 4AFBA 4A4AA 1CJDA 2X8KA 3AZWA 2Z5WA 2WT1A 5FXWA 2OUJA 1I6XA 2XOMA 5CKMA 4AHZA 2IUWA 2Y64A 1OLMA 1VBC3 1FI2A 4I30A 1V9U1 2XWBB 2YHJA 5JCTA 3BN6A 4XCAA 5FKCA 4BU2A 2E7TA 4XXAA 1PK6C 4OUMA 1DHKB 2ZEXA 4LBQA 3AKQA 3V65A 4WVVA 1ND2B 5E89A 4I0WB 4BQ4A 1C8M3 4Q5OA 1QDCA 1DP0A 1JW6A 5FYUA 2BUKA 5JXJA 4L2NA 1ND3B 4LKEA 5C9AC 5HI0A 2ZMLA 4WVMA 2QQMA 3PUIA 5LBEA 1SBFA 4CYDA 1NYWA 1PK6B 2KM2A 4Z82A 4MYEA 4AAXA 4XEZA 2ZS6B 1PVC3 2P5BA 1YFXA 4EQVA 5JWPA 2HWC3 3NNJA 1QEXA 3D3AA 4HLTA 5JZGA 4OI0A 1JYXA 3PJYA 2ET7A 5FY0A 4PLOA 1UOGA 2PFWA 2WNUB 4IEYA 3MIEA 1CWPA 1BMV1 4ASLA 5F2WA 1AUYA 5BNOC 5JR7B 1O4ZA 3I8TA 1H8TC 5FR3A 4GB32 3UJOA 3NVCA 2VG9A 1RUE3 1Z0HA 1AR63 3S7EA 3GYDA 4XIKA 5KHHA 1ZNPA 4MGKE 3QH6A 1SDDB 2UURA 3D4KA 1CZSA 2P37A 4V1PA 1YQ6A 5FP9A 5BNOB 3FLRA 2JE9A 2Y33A 5K7PA 1YYNA 2GNBA 3ZXLA 5JDBA 1H8TB 1LU2A 1G9FA 2GU9A 5CYYA 4KNCA 2Z42A 3WG2A 2Y6JA 2ADEA 2DVBA 4B7EA 1YQ2A 5JXIA 1W8WA 3O1RA 2JKBA 4LBMA 2X5IB 3OD0A 3VBSA 5AVPA 4DEVA 4RSUA 1Q8QA 1Q8VA 3O1PA 2ZTNA 5LATA 1JUIA 4L11A 3VBOC 1WMXA 2FDJA 2JWPA 4FTEA 1W2AX 4CDUA 1S0FA 2XL9A 5D1IA 3AX4A 3RG0A 4RHV1 1UU5A 3AYCA 3ZN5A 1W8HA 1I3HA 4QKDA 3QOPA 1MZFA 1C4RA 4XFCA 4YM3A 1UOJA 1AYM2 4IEZA 3MO4A 4CDQC 3BGAA 4ZZ8A 1UKRA 4L8QA 2QVSB 1QJEA 3H7YA 1TZOA 4AVSA 5K0UB 1NA1B 2HWB2 4LBNA 1AXYA 1QF3A 3VBOB 2W92A 2FD8A 1F5FA 4MH0E 2LALA 1OQDA 3PU3A 4HMZA 2A70A 4IGPA 2GP3A 1SEFA 3ILRA 3AKTA 5F3GA 4C0BA 2CL2A 1RYYA 1YHFA 4CDQB 3MDPA 1C8NA 2HH9A 3M3QA 1LGBA 3LB9A 2JEMA 4OMCA 2ZGNA 2PAKA 3T1LA 2NLRA 1QJU3 5C3QA 3IMMA 5FWEA 2EIGA 4RFT0 4XJWA 1QOSA 4A7YA 3MF6A 2TNFA 1H0BA 3DEMA 2WINB 3KCCA 5FZ4A 3T2QA 4HBNA 3V64A 3WNNA 4CDWA 3OTFA 5T5LA 3GALA 1NZIA 1COV1 4H3WA 4XABA 1HRI1 5A3NA 1AR93 3JBG3 3VBHC 4QXBA 1VBD3 1FV3A 2WFPA 4BPZA 1FT9A 1POV0 1W99A 4LR4A 5FYTA 4D6RA 4FT8A 5I0RA 4TLFA 5CKNA 2D6PA 4IGQA 5GALA 2VBPA 4BMBA 2VECA 1UOFA 1RUOA 5A32B 1HQWA 4Q4Y1 3UV9A 1OBNA 3O0XA 1VPHA 1GOGA 3ZYIB 4K6BA 2ZX1A 4QXHA 2D6OX 5KHJA 2GNMA 2FDHA 4CVUA 1GP4A 4D8MA 3VBHB 4E8CA 1OUXA 3RDIA 4ISRA 4N43C 4QHZA 4LKSA 2W94A 1OD3A 1UAIA 1Z7S3 3ZN4A 3PMEA 1UIKA 1V6JA 5FXXA 4B4RA 3VDCA 3W21A 5TSWA 4XTMA 3CO2A 2J1RA 3ZX7A 3PJQA 2OKXA 1O8SA 1QDOA 3WDVA 2OXBA 3ETPA 4JZRA 4R9AA 4RL7A 2BGOA 4Y5SA 3POGA 4HN0A 4NUBA 5CEHA 4C1WA 1R081 1FV2A 2CY6A 2D3RA 5GJ6A 1G9DA 1W8FA 3KVBA 1XNAA 5FYYA 1DQ2A 2VTXA 4MOAA 4AW7A 4C1XA 2V09A 3AFGA 2AH2A 1EPZA 1ZRRA 2FHRA 3D82A 1H2KA 2ZHNA 3RS6A 2NYYA 3NRUA 1OOPC 4AHYA 2Q4SA 4LIVA 5I8YA 2W9XA 4H7LA 4JX0A 3TBDA 3K3NA 1JN2P 3OPZA 1QWRA 2VXRA 1MPXA 4NROA 4UFLA 1PNGA 1QHDA 3SCGA 4E9KA 1HV1A 4RS5C 4RFRB 1UD1A 2B46X 3T3YA 1EAH3 2C0ZA 2DUQA 2GNTA 2VVEA 2RS31 2XBO2 3HN1A 2HWE2 3WQ7A 4JGYB 2VCMA 3TN91 1D0HA 3ZMNA 4PCRA 3KGZA 4PDWA 4CUCA 2HKXA 1D4M2 3PVOA 3EHKA 2XQXA 4FPHA 1K3IA 2Y6KA 4O9GA 4UFIA 3AYEA 5A7NA 5IYYA 2BBVA 3IBMA 3M4FA 4LQRA 2XH6A 1ZA7A 2B9UA 3POJA 4RS5B 2YXSA 4P9JA 3THDA 4ARYA 1RUG1 1S4CA 5IVFA 3APBA 1AL21 1YUDA 4Q4W2 2XUEA 3M2MA 4R4XA 4UW5A 5FZ6A 3VBRA 3ZN6A 5ACA1 3EXUA 3WUCA 4W6WA 3J4UH 4L9BA 2DCKA 2WAOA 2IVJA 1QH7A 1KXGA 2WZR1 5A1AA 4ZS2A 4BQ2A 2R1BA 5FQ0A 2WABA 1XRUA 2Q0AA 2HJIA 2W5FA 1CAUA 3WQBA 3IWZA 5LEJA 1VRH1 3GJBA 2ZGKA 3KSCA 3P3PA 1JZ2A 5EJ3A 3N9QA 4Y20A 2XDVA 3UKVA 3ZXEA 4Q0PA 4WM7B 3VZKA 4EV0A 2O8OA 3IM0A 3I2DA 4BQ3A 1QXRA 3H42B 2L9LA 4DY3A 1H4GA 2FCUA 1ULOA 3FE5A 4Y5Z0 5DDJ3 5FV3A 3NQHA 1GZ9A 4GJZA 2GNDA 4DPNA 1TNFA 5L9RA 3JD72 5LBFA 4AZZA 4YGCA 5BNNC 1JYVA 2GC2A 4AEDA 2VQTA 2W1SA 1S1AA 3SEPA 3ETQA 5CNAA 1LOCA 1WLWA 3QACA 3DECA 1OKQA 2RS12 3UETA 2EXIA 1GOHA 2OIIA 5FYHA 3WDUA 3PIJA 4HN1A 1E5SA 1NLSA 1ZBA2 2RHPA 3LSEA 5F2SA 3OGJA 1KGYA 2XVLA 3VZLA 2IXHA 1OUSA 3AL5A 4D6QA 2DV9A 4XBLA 3POIA 1RVF3 1JI6A 3DYOA 4XBNA 2IWGB 2QNKA 2YC4A 3ZKUA 4UFHA 4RQPC 5F5AA 2AZ5A 3EQEA 4LA2A 1RUJ3 3OYWA 1CGPA 4YSFA 3NKTA 1QJFA 3LD8A 1FNZA 3DF0A 3HQRA 5B2GB 3LPFA 1GQPA 4V2VA 2PLV2 4MV2A 1FYUA 2XMLA 3JZVA 2W52A 3UL2A 1EP0A 2RS52 5FZ9A 1BVVA 2NMOA 3MF9A 4X6RB 4B8EA 2PN5A 4JV4A 5JSOA 4OI1A 4R9DA 2BEOA 3CJIC 3PUHA 3THPA 3FC0A 1FOD2 1V9U2 3LF7A 4RQPB 1H8VA 2LW8A 2XQRA 5FLHA 1W9WA 4NIAA 3MEPA 4YGDA 3TOJA 1VB4A 3ELNA 1BYHA 4LA3A 4RN5A 1XXNA 1WLDA 2A75A 2A3XA 4TLGA 5EWSA 3KHBA 3N9LA 1TQ5A 4AG4A 4DS0A 3N3HA 4DQAA 1YI7A 1Y9MA 2JECA 5FZOB 4MGQA 4HKLA 1ASJ1 1QJX3 2GH2A 3LEMA 3HAGA 3BPSA 3USUA 4JGZA 2D43A 4Q27A 1H6XA 1WBFA 4DUVA 4QX3A 3T0DA 3BTXA 2DWRA 2RM22 3HR9A 1LHNA 1PVC1 3BODA 3S6PA 3TEZA 1H30A 4YZ5A 4GWIA 2JDKA 5FZMA 1W05A 2YGLA 2XLAA 3P5BA 2Q30A 4NN0A 2K46A 2RJLA 1QMJA 1VMHA 4L97A 4YZ2A 1V6LA 1QIQA 3GZAA 3HN3A 4IE7A 5FFOC 5A33A 1HN1A 3SKJE 3K51A 3WVJA 2QQNA 4XFAA 4EN0A 5J36A 5CA6A 2BPA2 3WP5A 2YU1A 1NXMA 3FZ3A 3PIGA 3KV4A 4YFZA 1CJPA 3VDBA 1Y43B 4K9SA 2PYTA 2XVGA 2A6WA 5FREA 2V5DA 1SG3A 2ZGOA 2P6HA 3EJKA 3WX5A 1W6QA 2YY1A 4P14A 1YNAA 1GZTA 1AJOA 4EZHA 1BZWA 1YFWA 2W1WA 4Q8LA 4YZ3A 4JKMA 1IQDC 5GM0A 1IPKA 3MICA 2DTYA 1VAMA 1HN0A 3S5AA 2ILMA 2VOKA 1CVNA 1TMF2 4QHBA 4K8FA 3MUZ1 4XF3A 1OT5A 2VBBA 4JKLA 4P5HA 3ZYFA 4S2HA 4BQ1A 4FPJA 1GOFA 4MZUA 1BKZA 3QLQA 3ZSJA 4CU7A 3C8XA 2ZEYA 3A4UA 5FZEA 4RHV2 1LENA 1LESA 3WF0A 1LJ7A 5HV0A 5HV4A 3QD6A 2VMIA 1VJ2A 4S2DA 5F37A 3CL1A 2YPJA 5D2AA 1GZWB 5FMDA 1LAJA 3TB0A 2YBPA 1J1LA 3ACLA 3EMRA 5L7OC 3AZZA 3FL7A 3LEKA 1VAVA 4HK8A 4FVVA 1NQDA 4CCOA 4Q0QA 1HXS2 1UYXA 3L2YA 1W6NB 3NSTA 4MADA 3HT2A 1MS8A 4BYYA 1POV3 3AMNA 4FQ4A 3E5XA 1A3KA 4A3ZA 5J96B 2BRTA 4ZHNA 3K4AA 2QQVA 1J59A 1RMU2 1QJU1 2VW2A 4HKOA 1MS5A 5F9TA 4LOSA 3DKQA 3UESA 5L7OB 1XE7A 4DY5A 5JZGC 2VUDA 2YYOA 5FPUA 4Y4YA 2ZGRA 2QQUA 3LA3A 2XONA 4L92A 2X09A 2EAAA 5FYVA 1W9YA 3OGRA 5FY7A 2C5DA 3AMPA 2E9QA 3NV3A 4MXWB 5I0TA 3JBG1 3O0VA 1JBCA 4NPLA 4BWOA 1RXGA 1MEC3 1KJLA 2VM9A 2CAVA 2X53S 3VV1A 4LIUA 4NPRA 4CP2A 4GKXA 1V00A 4GB31 1N47A 2BOJA 4P08A 5K8SA 4HPKB 2WNOA 4Q4Y2 1MR5A 5I0UA 5J48A 1IPSA 3F95A 3I2GA 2JIGA 2VU9A 2ZPXA 1AX0A 1R64A 3O1TA 2HEWF 2EICA 1G9CA 3NV2A 5F3CA 2ETEA 3MIHA 3NW4A 1WA4A 3LFIA 5AVAA 3VB9A 1Z7S1 4Y1XA 1MZEA 4WVZA 1R1ZA 4OYUA 1LOBA 3U11A 3W5NA 4YG0A 5GZFA 1UYYA 1KFUL 1C28A 1TME3 3BPZA 4MVTA 5EYXA 3IT8A 2WYFA 3UGGA 4MSVA 3U4XA 4I2OA 5C70A 4NMIA 4UAPA 2Y6GA 4IV1C 2IVIB 2XJPA 3M8LA 3VL9A 5FMOS 4YWAA 2ZGTA 3VD3A 4D7SA 2PHWA 3PVEA 1YJKA 5F5QA 2VULA 3JCIA 3JQWA 3U75A 3I7DA 1AYM1 2WJSA 1ZZ7A 5A3MA 1BEV2 4GWJA 4HKWA 5HBAA 1MS3A 1W6PA 5CFDC 5HXMA 3A22A 1CESA 2HWB1 3CMGA 5DMYA 4QD2A 3E6CC 4IV1B 4RA0A 1GNYA 4W8JA 3KLSA 1OA4A 1AXZA 3B5LB 2JJ6A 3WG4A 5DUWA 1JYIA 3PLQA 4ISQA 1X8EA 3OOXA 1JU4A 3J8F3 5FZCA 3C7HA 4FO9A 4XF0A 4ZU5A 3WDYA 4M00A 4LO4B 4Q8KA 1APNA 1VBE3 1SBDA 1XSQA 2HYKA 4B29A 3BTYA 2RS32 2WAAA 1N1VA 4BQYA 5CFDB 1UY4A 3AZXA 2LRPA 2Y6FA 5KHKA 5JR2A 4MUVA 4QB6A 4QPWA 1ULCA 1SLIA 1TEIA 2VTFA 4C0HA 2JXAA 5IAVA 4PIXA 4RGGA 4GULA 4YM1A 1UW8A 2BERA 1RUH1 1QU0A 4F83A 5C7GA 2PAMA 5IK4A 1C5IA 4FOVA 3ZPYA 4XYXA 5E6HA 1UMIA 2HWD3 3GHNA 1EV13 4YNIA 1SQ4A 4W65A 1NCQC 2Z69A 3AMMA 4NHLA 4E8DA 4AEMA 1AJKA 1MS1A 3E5UA 4CEYA 4HONA 5IUQA 4TZDA 3U07A 1S55A 1ZBE2 2JDNA 1SFPA 1RC6A 1VRH2 4COVA 4Y22B 1OI6A 3K3OA 3OBRA 5CIRA 5A3OA 4CXWA 2YUEA 4DUWA 2LM3A 2RR13 5E16A 3ZR5A 5FP3A 3B69A 1ENSA 1LOFC 1MQTB 1NE4A 1URXA 4ES8A 3KHCA 2WYSA 3HEIA 5A6QA 1GV9A 4Y1UA 3ZSLA 5AC93 1NCQB 2ZGPA 4CXYA 4NIGA 2G1MA 3HWJA 5I0DA 5DDJ1 4C90A 3PU8A 4DMIA 3MFCA 4YW2A 2ZBJA 1AF9A 2VMDA 4YYOA 2JX9A 2OA2A 1XU1A 3ZDVA 2DTWA 3H8OA 4CCDA 4XXPA 1RIRA 2BWAA 1ZA4A 4HOOA 3TRSB 3HQUA 2ZJCA 4UF0A 3AKRA 2VUAA 3THCA 4HT1T 3AK0A 3GM8A 3T2OA 3X29B 2D6KA 2PXJA 4XZPA 2VCBA 4I01A 4Z92B 1BQPA 1X7NA 5GLUA 1XYNA 3KT4A 1R1A2 2BU9A 4CA9A 3WF2A 3WLUA 2O8QA 1DYOA 1LODA 4UYBA 2Q1FA 4LHLA 1LB2A 1ZVFA 3I2JA 2FZ2A 1NX9A 5JSRA 4X8NA 1RHI3 1DZRA 1VBA3 4A45A 4CDXA 4PDWC 1UZYA 4J6GA 3UGFA 3ZFGA 4RR3C 5C3SA 2QFEA 3OB8A 2XBO1 5EQUA 1WMEA 1DBNA 2ORZA 5HXVA 3N7KA 2DCYA 3K2OA 4DNYA 3IAQA 1QXPA 4QQ2A 2YBKA 1BHGA 1D4M1 1VBC2 5CISA 5CU1A 3OEAA 2DUOA 3HNBM 1A6CA 2DVFA 5JPNB 1AZDA 1L7RA 3F2ZA 4AHWA 1MZ5A 4MX3A 4YRDA 1LGNA 3E1F1 1FAYA 5GZDA 3U1XA 2HYXA 3WF4A 4RR3B 2B42B 1OLME 4V2WA 1C8M2 4CCEA 4CTEA 3RWNA 3T09A 1A78A 1OC1A 1CAXA 1Q8PA 5LY2A 1ENQA 2GALA 4MGYE 1NE6A 3DXUA 5GKAC 4QX5A 5C71A 3MZHA 2JG8C 4GH4C 1U5ZA 3OF1A 1NKGA 4JHTA 4QDRA 5DXDA 1PVC2 5LK7B 3OY8B 1UL9A 3PTRB 4MHUA 1DCSA 1LHOA 4CPBD 1D2QA 1QQP3 1OURA 1J3QA 3H7JA 4AQ6A 2FDFA 3IMNA 2DVAA 2PQQA 2D44A 3NAPC 1K5MC 3RNSA 2EXKA 2Q8OA 2RMU3 4Q4X3 5KXBA 4M4PA 3BU7A 3DYMA 3MV11 1CAWA 4Y20B 4AI0A 4ATEA 5GLVA 1YC61 3KGLA 2JG8B 4GH4B 4GMP1 1RUC1 4M3CA 4AFAA 1IG3A 1RUE2 3WCRA 5IVBA 1JS9A 2HEYF 3O0WA 2BYVE 3JD71 4I09A 3LFMA 2Y0IA 3WSOA 1AR62 2VZUA 3BB6A 1UYPA 2VZSA 3VHOA 1SCSA 1S2EA 3K4DA 3NAPB 4HZFA 1OQEA 1K5MB 1LRHA 4AEKA 1RUD3 2OYZA 3AC0A 5JI7A 3RGBA 2E32A 5ABJA 5A6XA 1ZBA1 1JZ3A 3DCQA 4AOCA 3L9JT 1GANA 5E88A 1DQ1A 4U2AA 1AXKA 3M3EA 4ZU7A 5KC6A 3ZXGA 1GP5A 2Q8DA 2R073 2A6XA 2FZ1A 3MLLA 4Q0UA 3MPPG 1YIPA 4O9EA 3NJXA 1POQA 4QPIA 2VQAA 1BBT3 4XUNA 4FFGA 3CU7A 3I3DA 2PLV1 2VMEA 4XOGA 2RS51 3MV01 1KITA 4M0HA 3U37A 4P5YA 3WT3A 3ACFA 3L2HA 3VZOA 5T54A 3D6EA 1FOD1 1OPOA 1W6OA 3WDXA 2XGXA 1UXZA 4QKFA 3HBZA 2CYFA 3EBRA 4BK4A 4DRRA 2B4KA 1H9WA 1N1YA 2WL1A 3AP6A 2H0BA 1VE0A 4LE3A 5C33A 5FBZA 2VY0A 2WN3A 1QJU2 3LQCA 4TYSA 2ZEZA 5FBJA 4FPEA 3ZYHA 2ARCA 3SH3A 4QX1A 3V0AB 2RM21 4XQ4A 2I07B 2W68A 3LKJA 1QXJA 3CIHA 5LA2A 3FBYA 5FXVA 3NJYA 4Q4V3 3GZTB 3W58A 2QZ3A 5FO8B 2P17A 2A3YA 5H9QA 4DXRA 2I2SA 1OD5A 1AR92 3GZUC 1QOOA 3B00A 1VBD2 1XSRA 2D3SA 3JBG2 1JHJA 2W91A 3AXEA 5C9AB 2VZQA 1C57A 1EUUA 5GZGA 3NMBA 5C8CA 5DG1A 1XBFA 4COWA 1AR81 3RYRA 5FY8A 1H1MA 2UU8A 3WP4A 2B7YA 4FAGA 2PHTA 3RFRA 2XXZA 4AGVA 1HX6A 2LROA 2VQUA 3ST7A 4LXLA 1IKPA 1S2BA 3T0BA 1RUF3 3KZ4C 2VVDA 4HL0A 2JDPA 1YWKA 2BNOA 4OI4A 4QPGC 2WO1A 4R8HA 5EZWA 2VW0A 1I5ZA 1JZ6A 1B35A 2K0GA 1ULGA 3AP7A 4FOWA 3FLTA 4IXLA 1Z7S2 1LOEA 3U0ZA 4W4ZA 4AAPA 3IPVB 3R05A 1CAVA 1W6QB 3AZYA 4TXWA 5FO7B 1TME1 4QXKA 3VDDA 1ULDA 4UW4A 4ET7A 3PUQA 1CN1A 1TMF1 2VZRA 4NAOA 4AFDA 3KM5A 4QPGB 1ZX5A 3CKHA 1X82A 3KQRA 2MEV3 2FDIA 1DQ4A 2D6LX 2QQKA 2O0OA 1K12A 1CIYA 3FBMA 1YFUA 4BXFA 1IS5A 1JXNA 4WM8A 5A70A 2ARAA 1W39A 2AREA 2WO7A 5I93A 2WNVC 5FMOL 3JB8A 2CAUA 1WZXA 4PBPA 1OFNA 1OF4A 2FMYA 1HXS1 4KG8A 5LZ6A 1OA3A 4A7KA 2O1QA 5FJKA 1W0OA 3HOBA 4YFWA 1EAH2 3RZMA 3CDZB 3KV6A 5FZLA 1EUTA 4MLOA 3RZLA 2GC3A 3C7OA 1MS0A 3VBUC 2R1DA 3CZUA 2WNVB 1RMU1 4AXOA 4ONUA 5J3UA 2VBDA 3BTAA 4COZA 2AACA 3WV6A 5LCWL 2PHLA 1C3HA 1O4TA 1GMMA 2XUMA 4IUGA 5SV5A 1KEXA 4LTAA 1LTEA 3WW1A 4CUBA 1RUH2 1W6MB 3V0BB 1J1TA 4HFSA 4XF1A 4P9LA 4CSWA 3VBUB 5ERLA 3WW3A 3OPTA 2HWD1 3ZM8A 5G05L 1REEA 3KD4A 5AFBA 4FTBA 5L36A 3J7HA 1US3A 3N7MA 4IE5A 4E4SA 2VNGA 3N35A 5IVJA 2ZABA 2QTWB 4PF1A 2YC0A 4META 5FXZA 3LEGA 4Y26A 3R6SA 1K5JA 4B4PA 1O91A 2CDOA 2XHNA 1VB2A 5FIXA 3H0OA 4KQ7A 4OMDA 3S0MA 1OLQA 1FPN1 2GMEA 4XFIA 5FZ1A 3LIGA 2WFF3 2BP6A 2QQIA 1XNCA 2O14A 2ZGSA 5DDJ2 1PO21 3DPRA 5KHGA 5LRSA 4YM2A 2P34A 2JE8A 4TN7A 2WQ8A 3RYKA 4XMAA 2FDGA 3RPQA 1GSLA 3M3OA 3MW2A 4JRAA 3RMXA 1DQ0A 2XJVA 1ONAA 4QX2A 3AXDA 1ODMA 4LKFA 1LHUA 1E5RA 3I59B 1LNSA 4N43B 1LHWA 1G8WA 5A7WA 2VE1A 2R0FA 3N4MA 1SPPB 1WLCA 4CEWA 1BEV1 2JDUA 2PHUA 4QKBA 1Q3EA 1RVF2 1IKQA 3NNMA 2BNMA 4YG3A 4DZGA 2GP5A 4R9BA 3E5QA 2B9VA 2IXIA 3EYPA 1QJY3 1RUJ2 3VKMA 4BE3A 3NO8A 4CXXA 1KS5A 3O5SA 4FQZA 1RL3A 5CZKA 1PZ8A 1IGOA 2E7QA 4OHZA 3DYPA 2X10A 1G86A 2JG9A 5FP8A 1OOPB 4WZCA 5LBCA 1DZTA 4N9IA 4OHWA 5JAXA 4EN8B 3HJRA 1JZ5A 1MS4A 1J3PA 1JOBA 2RJ2A 3GZEA 5C3PA 5JOWA 1L7QA 1F4HA 2VD7A 3E97A 5C6CA 5FZ7A 4Y1YA 3ZFFA 4CCCA 4YLZA 2BW8A 3D0SA 3LWCA 3UKNA 4TTGA 1JUHA 2YROA 2R30A 1QJX2 2NN8A 3GXUA 4KL1A 1WGPA 4N53C 4DEQA 2J22A 5KR7A 3WW4A 3T1MA 2R063 1PZ7A 1RGSA 4QU2A 3BUCA 4FI9A 1CR7A 1ZBE1 4LBJA 3NV4A 2WSUA 3C2UA 3PNAA 3MPBA 3T2PA 1O4YA 2D93A 3NL1A 4TWTA 2CHHA 3MUY1 1J84A 4N9HA 4K8RB 4NRMA 4N53B 1UYZA 4GAZA 2Q8CA 5GLZA 4XACA 3J7LA 3VL8A 2VJXA 5A3UA 5C8WA 3WY6A 2XJUA 1PIV3 2DCTA 1XB9A 4XF9A 4N7IA 1RUC2 3M1HA 4H14A 3ZFEA 4NR1A 2C24A 2YFZA 3T0AA 4CP9A 5CFCA 1KDKA 3PTYA 4A6OA 1W0PA 2TBVA 1WCUA 3LDKA 1H2LA 3KF5A 5D8AA 3N9NA 5L9BA 1RUD1 5JUVA 4XCBA 5T50A 3T4HB 4LK7A 1CX1A 3KF3A 4CCMA 1AYN3 1WCQA 5AFEA 4ORFA 3FMGA 4UBHA 1FMD1 1WLTA 1QKQA 2GMMA 1R1A1 2VNOA 4UFMA 2EIEA 3LGRA 1R091 2CV6A 4IEVA 4LBOA 4KH9A 2XJTA 5BNNB 4ZPIA 3ATGA 4CDXC 1GZCA 1WCSA 1DYPA 2R043 2WA3A 5APAA 3CF6E 4HSJA 4GA9A 4HANA 5F6LB 3BOWA 3GDBA 4XE9A 4XJZA 3KWVA 4URTA 3BYWA 3GBFA 3K48A 1AHSA 2VUCA 1NCRC 1G9AA 5EIYB 5EYYA 2K2SA 5DUUA 2ZHKA 5FZ3A 1XU2A 4AWDA 1ULEA 5E8AA 3M3IA 4PLNA 5BNPC 1AL0G 2P3IA 1ACCA 2PMWB 1VBC1 3N36A 1RJ7A 4IEQA 4D0QA 1YFYA 4HVOA 4KWKA 4P9YA 1NG0A 3A23A 5F5CA 5L73A 1QH6A 1U12A 5BPXA 4YVWC 4JDOA 4DRVA 1W9SA 2D3PA 1NCRB 4JC1A 2F4LA 5JMCA 4BQXA 1C8M1 3SXWA 1J58A 3MIFA 4NE9A 5BNPB 3IIAA 2XG3A 1W90A 1WCKA 2EXJA 3RZJA 3CJIB 1NY72 4XDOA 2HWE3 1P8JA 1O3SA 2WRAA 4PQQA 1AR73 2JB4A 5DQ0A 4YVWB 3UYJA 1CAXB 1ND2A 4LT5A 3C3VA 5T5PA 1H9PA 4Q4V1 2HWC1 2W87A 3DKWA 1M06G 3UKTA 3J9SA 4P9XA 3WNPA 1ND3A 3OSDA 4AGGA 4H55A 4IEOA 1D4VB 1MEC2 5ANQA 1ZZ6A 1F8VA 1XE8A 5D21A 4XPVA 2ES3A 2HWF3 3B9CA 4QKNA 1PK6A 2F17A 3S7IA 3LZZA 4GALA 3WINE 1AR82 2ZAHA 1RUE1 5IWFA 5FOJB 2JICA 4A44A 1ZRDA 1AR61 2WR9A 4M0NA 2WZPP 5C4WC 3ES1A 3EO6A 4KMQA 1B09A 3GJAA 5ABJC 2DF7A 4L99A 4MXVA 3IAPA 1US2A 2WNUA 1QNYA 2Y8KA 2YC2A 3FUQA 1JYCA 2X05A 4A42A 1UWWA 4DXSA 1E5HA 5FPXA 1YEWA 3SMHA 1O5LA 4XHBA 1BK1A 1FXZA 4LBQD 5JIAA 3N7LA 3LE0A 2CNAA 1J3RA 2BVBA 1BK0A 1TME2 2F4PA 4QPYA 2ET1A 1DFQA 3K77A 5C4WB 1WWYA 1ENXA 1RTVA 4OZXA 1W3VA 2HBUA 1H4HA 1Q43A 5KXEA 1U5YA 1YQ8A 2V4VA 2ZEWA 2ZGMA 3ZXKA 5BNOA 2JE7A 2YV8A 1H8TA 2BFUS 2G9ZA 3J26N 2DVDA 4LBKA 4QGNA 4ZXKA 5JOZA 4YVSA 1QOTA 3K75B 3AM2A 1F35A 5HCFA 4F8AA 4SBVA 2X5IA 5K4LA 2XWJB 1W04A 3MLJA 3VGIA 3O1VA 4MG2A 1CD3G 1JZ8A 4LK6A 3C7GA 2B39A 2ZXQA 4HK9A 4I02A 1VMJA 3J8F2 5A3PA 1LHVA 1GKBA 1VBE2 1UY3A 4FXKB 2QQJA 3LDRA 3WW2A 5I8SA 2JDAA 1UZVA 2WKKA 3PUAA 1OH4A 4N90A 3JU9A 4OHVA 4W6XA 3VD4A 4LBQB 4M4RA 5JPMB 5K0UA 1W9TA 1NA1A 3R4SA 4IEXA 2E33A 3VBOA 5KHIA 4ZONA 3WZ1A 5EJZB 5LW9A 2R32A 4XFBA 3FFZA 3KV9A 5J98B 4WVMB 3D8CA 4FPYA 4CDQA 3AZVA 4IDZA 3T30A 4GJYA 4X8PA 1UO9A 1GU3A 1AR91 1VBD1 1AVBA 2HWD2 1PGW2 4LOTA 4BISA 1EV12 1LGCA 2DU1A 4LHSA 5FPAA 4KWJA 5JZGB 3HMYA 1HB4A 3KCXA 4OUSA 5CKQA 4HG6B 2G9GA 5HCBA 1O3RA 3B93A 3D0JA 3POYA 3KCYA 3QH7A 2WS93 3U78A 3KVAA 5HCHA 2OPWA 3OBZA 2RR12 5FY5A 3IN9A 3GGLA 2XHKA 2VZPA 3IDCB 1FPN2 2ADDA 3A7QA 4C8DA 3WG1A 4XJUA 3VBSC 1V6KA 2OPKA 1W06A 5A32A 1PO22 4FPCA 2QBXA 3I3EA 4IEWA 3WF3A 1W8UA 1XQNA 3OUJA 4A3XA 1CZVA 4AVTA 4CDUC 4PHZA 3GCXA 3MHZA 3UNPA 3O1UA 4MGTA 3GBGA 2DYCA 2PTMA 3VBHA 4FCAA 3SKVA 3O1SA 5F8PA 4YZ4A 2J7MA 4DXZA 5F1RA 3V56A 1TE1B 3VBSB 3OBAA 2B5HA 1SDWA 1DZQA 4CDUB 4K20A 1XNBA 5CVRA 4J1XA 1CX4A 3P3NA 3LA7A 3AYAA 2GN3A 1O59A 1UMZA 4RGKA 3H1YA 1QJY1 3BCWA 2WO2A 5HPOA 4P9WA 5A7SA 1RHI2 1VBA2 1EAH1 2VUJA 3VKFC 3RMYA 4XJAA 3ZSMA 4IETA 2QQWA 3WD5A 2FBEA 2DFCA 5LWBA 2ARXA 1XJAA 5FYIA 3NKGA 4JDNA 4QU1A 4RHV3 5EHDA 4QAWA 5JI9A 3POFA 4JCKA 1RITA 2EXHA 2CGOA 2GMPA 4CDWC 4N7UA 2B45X 3KB5A 5FOBB 2EA7A 2SBAA 2OVUA 2R16A 2JDYA 2PHXA 5LASA 4CU6A 3AYDA 1W2OA 3OEBA 3POBA 1UIJA 2XVKA 4JGYA 1A8DA 1DG6A 1Y3TA 2UY9A 4JTNA 4TSVA 2W2IA 3LAGA 2W08A 2VC9A 4XHXA 2Y6LA 5DAPA 3GBWA 1W8NA 3PL0A 4QX7A 4CDWB 1DQ6A 3LDBA 3NNLA 4R52A 1G6NA 2XB6C 3HNYM 4RS5A 1DF0A 3BOPA 1W3XA 3ME2A 1PM4A 4XFFA 4GWNA 5FDBA 3D5OA 1QQP2 4J1WA 4QT6A 4CU9A 3DPRC 2F6BA 1DGWX 2JENA 3VHNA 4O61A 2RMU2 5ISLA 1D7PM 2VL4A 2XLGA 3O1OA 5FYCA 1COV3 1HRI3 3ENRA 1PM7A 2IXCA 1SFNA 4S2GA 2OX0A 5FZBA 3R4UA 5F7UA 3AP5A 1XE0A 1V6IA 2JDMA 2WUHA 3DPRB 4CP0A 4WM7A 3VUOA 1Q5OA 1EPWA 1RUD2 4I3GA 4GKYA 1OH3A 4ASKA 5L9VA 3O12A 5CB7A 3VD9A 2PHFA 4DXTA 1FMD2 4LNVA 4Y1VA 5LRRA 1RVF1 2GH8A 3N7JA 1R092 2R072 5FZHA 4H2AA 3I3MA 4CE8A 1JOPA 2C9AA 3W20A 2BBAA 2A7AA 1RUJ1 2IXKA 1Y9QA 3FLPA 5IVCA 1BBT2 1Y7BA 2AEYA 3OJBA 4YW3A 2Z79A 3DL3A 5DG2A 3I2FA 1OXCA 3AFKA 4QQOA 1R083 1RJ8A 4AI9A 5C3RA 3LOBA 4QGLA 4LLOA 4EWAA 1SLTA 4AI3A 3B94A 3ILNA 4Y33A 4F3JA 2RG4A 2VAUA 4ZY9A 4NHXA 1UZZA 3VBRC 1IPJA 2W46A 2VZTA 1I5PA 4BA6A 4BH9A 1LOAA 2XJQA 3HIFA 4XJ8A 2C9KA 4PDWB 4COYA 2VZVA 1ZYBA 1HRV3 2OT7A 1TG7A 3MLKA 2QKDA 1U0AA 2RV9A 2PAEA 2VXJA 3MFAA 1T6GC 3A0KA 1UNBA 3TWIA 2ZHMA 1Z78A 3INAA 4FFFA 4NIHA 1QJX1 4KGGA 4BLIA 5A6ZA 1GBGA 4XMIA 1LEDA 3ES4A 4RQPA 1CZTA 4YPJA 2RS33 3VBRB 3ZN6B 2WLQA 5FZIA 3JQXA 3IDBB 5FP7A 3TN93 3ZR6A 5EPAA 1ZZCA 3SLIA 4BMEA 4Q4V2 1W2UA 5H9PA 3IIIA 2HWC2 1CQ9A 1KDMA 3W5MA 1W2TA 2XPJA 1YIFA 5FZOA 4BIOA 4INDA 5FQ0B 2VR4A 1LOGA 1MS9A 1QGLA 3W59A 1NXD1 1CAUB 2UWCA 4OI2A 1JYTA 4PIZA 5CFCC 3ZDSA 5T52A 1RUG3 4Z2WA 3BIWE 1YO8A 2RDNA 1AL23 1Q8SA 1IS3A 2FCTA 5FK7A 4AEDC 4X6QB 5ACA3 1V70A 3OGSA 4JVAA 3DN7A 4A41A 2WQZC 4YW4A 2BQPA 2WZR3 1OLRA 1HJGA 1XNKA 2R7EB 4D69A 1RUF2 5IFTA 4Q1PA 3SISA 3RZZA 1JOJA 2E63A 5JSPA 1S0IA 2GZWA 3FUOA 2I45A 2G9FA 4AEDB 1GWLA 4MGSA 3USSA 1KQRA 1X33A 2JD4A 4XUTA 5IHRA 2PQSA 2VOVA 1UY1A 1OVSA 3RJ2X 2QDRA 3E6DA 5FZGA 2J1EA 1UN1A 3VHPA 3VBFA 3OG2A 2X29A 3SHRA 1QJZA 1D0GA 4PI0A 4EWEA 1W2NA 1PO13 2E7AA 3AJZA 4FP2A 5FK8A 4C91A 1NLRA 4W50A 4IW3A 4DOUA 3UGHA 4JQRA 1JTZX 2SLIA 4FPFA 4WBBA 3FN9A 2WZEA 3OYWB 4QWNA 1SLLA 2P3YA 4JHZA 4FXGB 3VN4A 1IQAA 3CJXA 2XKOA 3ZXFA 2BFUL 3VHRA 4QM8A 1DU3D 1YCIA 3AP9A 5F6KA 3I2KA 4EN6B 1LECA 1Q56A 5BY5A 2BJSA 3KV5A 4FAHA 4EYUA 1POV1 1QNWA 4JGZC 5DN2A 4H7MA 5HCAA 4XAAA 5IAXA 2E53A 1ND2C 3E6BA 2QQOA 1GZWA 1HDKA 2EAKA 1NY71 2N7GA 2W1UA 4HETA 4KBBA 4WZFA 2QE3A 4CCJA 4NO4A 1VBB3 2P3JA 2ZKNA 3B3QE 5CADA 1DQ5A 1VMFA 2P3KA 3Q8BA 3ZYBA 1ND3C 1W6NA 4OZOA 1O8PA 1L7LA 3LSDA 2AYHA 4NHMA 1N3QA 4JGZB 3USUB 4IL7A 4UFJA 3SNMA 4AYUA 3DUIA 3RVHA 3BKZA 1MEC1 1BJQA 2Y60A 2Y6HA 1S0JA 3LOIA 4LUMA 1YQ5A 2WC2A 4LE4A 4QGMA 5L7OA 1MZ6A 3WHUA 2W0XA 4NIIA 3N9PA 1SCRA 4FFHA 1O5UA 4RD7A 2KA3A 2WNUC 1ASJ3 2VOTA 1ZRIA 2WS91 5A33B 1S0GA 1FATA 4EN9B 2A5ZA 5J09A 4MXWA 1W03A 4Y4RA 2Q8EA 1WCDJ 1G7YA 5T5JA 4PLMA 2VMHA 1RUI3 5FRAA 1DDLA 4JAAA 4NIDA 1IZ3A 3DV8A 4K1YA 2WFF2 4GXLA 5BV6A 4U36A 1C1LA 1S0EA 3H8UA 2WWJA 1H1AA 2WWUA 3GCWA 5IATA 4HPKA 2PHRA 1JZ7A 2GDFA 1GWMA 4Q2FA 1JZ4A 2VGDA 3AP4A 2GC0A 1X50A 4YVSC 4XDQA 2YB7A 3KT1A 2C26A 1HB2A 3KQ4B 4QQHA 2X5IC 5FUPA 4K3UA 1DIWA 1S0DA 2LTNA 4ZS3A 2J42A 2D6NA 5LK5A 3Q8AA 3R0RA 4B1MA 3WNOA 1DLLA 1HQNA 3ACHA 4YVSB 4B7KA 2AUYA 4E4ZA 1S2KA 4OCTA 4FPKA 1GNZA 4XQDA 3RJRA 1QJY2 4ATFA 4D6SA 3AL6A 3J8F1 2NZ9A 2WBKA 1WA6X 4CCNA 4DUXA 5FPBA 2VZ1A 4AR2A 3K46A 1NA1C 1VBE1 2ID4A 4GMP0 5K0UC 1UZ0A 5CAZA 1L3JA 4HSLA 2NPIA 5FCCA 1LEMA 2J1VA 2VOXA 1V0AA 4YARA 1SLAA 2EF6A 4P9IA 2E31A 5LY1A 5T55A 4Q1RA 4IV1A 2C4XA 1LR5A 3GF6A 3PURA 3RZGA 3U4SA 2ZA9A 1WKYA 2C1FA 3MBWA 4UOJA 2LS6A 1HV0A 3AB0A 3AKPA 4LHNA 3I4IA 2QDNA 2D7FA 2BTVC 3OBTA 4XETA 1DLCA 1H2MA 1OFSA 1VRBA 4PT6A 1N3OA 5CFDA 3SH5A 1PGW1 2AC1A 3NJVA 4JRLA 5FZKA 1EV11 4PIYA 2ZHLA 2RDSA 1S0BA 2ZZJA 3IB3A 4LO8A 3OD4A 2R062 4EE2A 5E1RA 2YBSA 3P6BA 3Q9OA 2VCCA 2J1AA 2P6CA 5GLWA 1OKOA 2HEVF 2W39A 3H8RA 1VLNA 3HBKA 5FAXA 3BI3A 2TEPA 2NM1A 2RR11 3AVRA 3TEWA 5BUVA 3EB7A 2J1TA 1UZWA 1IS6A 4AFCA 2KD7A 5AC91 3DGTA 1Y9GA 2EALA 1D2SA 3TNQA 1ALYA 3G6JB 1PIV2 5LEKA 2YGMA 3BTZA 5F39A 4YG6A 5A1FA 2IC1A 4Y22A 3WOGA 3ZSKA 4B4QA 1NQJA 1K45A 4GB33 4NPMA 1F31A 1ENRA 1MQTA 1BVP1 4LO7A 2D5HA 4E2GA 5DUVA 1N1TA 1NCQA 4Q0SA 3FX3A 1UPIA 1AYN2 3G7DA 1O3QA 1IG0A 3MGUA 1UU4A 4BIFA 5A3WA 2Z4FA 3FHQA 2EIBA 1UXXX 1PX3A 2R042 4QX0A 3ACIA 1LOFA 1NT0A 3PUSA 3R4DB 5C3OA 1FX5A 3OGVA 1PMHX 5F5IA 1PHMA 1UY2A 1Q8OA 1W6PB 2W1QA 1RHI1 4FFIA 1C1FA 1VBA1 1W8TA 1UF2C 5FY1A 1UQXA 1SLBA 3PVBB 1KS4A 4AK3A 4QB2A 3A0NA 4XZUG 5JXHA 2DBIA 2B8MA 3BALA 5F3IA 4BQWA 4K7JA 4HVQA 3O7OA 2PHDA 4QX8A 1WD4A 1AYM3 4KU8A 3NNFA 4PJYA 4Z8BA 4WV8A 4OLLA 3Q8CA 3ECQA 4Y3OA 4JGYC 4ASMB 5FMBA 4ZKTB 2WZ8A 3HPNA 3QCWA 2CGPA 4AQTA 3IZOA 2WN2A 1MVQA 3T08A 1HRV1 2HWB3 1ST8A 3SH4A 4CUAA 4J25A 1ZRCA 2JB8A 4NHKA 3VD5A 1YJLA 3QBQA 2FMDA 5FTTC 4CEYC 1F5JA 3N9OA 1SZBA 3LIHA 3NNGA 2GAUA 1ULFA 2DVGA 3JB4C 4IE0A 3WDWA 1LU1A 1OA2A 2WWSA 1W8ZA 2RDRA 1AR72 5FLJA 2BNNA 3ZYJB 2RJKA 3I49A 1SLCA 4RR3A 5FPLA 4FOYA 5M0TA 2OUHA 4OFGA 4AEJA 1QQP1 5GZCA 2WT2A 4JKKA 2ZMKA 2JD9A 1XYOA 3I2HA 4Q29A 4CEYB 3O1MA 1RUH3 1PGL2 1YRZA 2RMU1 1Y4WA 3CZJA 4Q4X1 1WMFA 4AQ2A 2HWF2 4IEPA 4NOTA 2H0VA 1T6BX 2ARBA 4WM7C 1UU6A 2BWCA 3O14A 2BGPA 2E26A 4W6YA 3OY8A 2D40A 4PF5A 4XC9A 4Y24A 5IVVA 5KXCA 5F32A 4AI8A 1I1EA 2ENRA 4I0BA 4AF9A 5JIUA 1G9BA 2GN7A 2ZOEB 2P1BA 4FOQA 4COUA 4KI5M 3FFQA 5LA0A 5FPZA 4OVEA 3VZJA 4BQ5A 4AL9A 1BXHA 5LBBA 2A6YA 3B01A 4MGIE 4XW3A 3C7FA 4AFMA 4E2QA 2PA7A 1VP6A 1U5XA 2RVAA 2WNEA 2JG8A 1WW6A 3NJZA 4GH4A 3ZKYA 1RUNA 5LA1A 4EWDA 4UF0B 3KT7A 2R071 3VKOA 1V6OA 4YW5A 1NZCA 3AJYA 4QQPA 1VIWB 3ABZA 4IV3A 5FY4A 3NAPA 3ZFGC 2Y26A 3HVDA 5FZ8A 1K5MA 1JYWA 4OQ9A 1BBT1 1HB3A 1PO11 3KS7A 4R9CA 3ZMOA 5H9RA 2VMGA 1FNYA 5A6YA 1XC6A 1HLCA 4QQLA 4G9SB 5CBLA 3ZXJA 2MNGA 2V4AA 2D98A 1ODNA 2Q1MA 3WCSA 1GNHA 1H1IA 2QZ2A 4CDXB 1UOBA 5DZFA 1JYNA 3BIEA 3ZFGB 3WG3A 3POEA 3ILFA 4G3YC 2ZGUA 3T4VA 2VH9A 4AE2A 1ULPA 2VPVA 4CPBA 1W9FA 2W47A 4YGEA 4D7TA 5IK8A 2VTXJ 3ALQA 1F2NA 4NVPA 5A7QA 4KWUA 1N1SA 4S2FA 4AHXA 4AI1A 1YI9A 3LPGA 1WD3A 4Z07A 1O3TA 3LCPA 2DBNA 2IFWA 4IE4A 3U10A 3ZPOA 3AKSA 4LMFA 3OUHA 4OHXA 2KR2A 4LUKA 2CSGA 1MACA 4CU8A 5J37A 1NLQA 5FUIA 2A71A 2DURA 4PI2A 1VBB1 2FQPA 2XBO3 4HVRA 3JUUA 3WNLA 2UY8A 1SACA 2A3WA 3HQXA 1E57A 4NJ4A 4PQ9A 1D4M3 4XVHA 4ZZ5A 4OQ8A 3FHIB 3VZMA 3ZYRA 1ZREA 5FYMA 5J1XA 3URFA 1SFYA 1PVXA 1H6YA 1HQLA 4GIQA 3U14A 1KRIA 2DUPA 2XR4A 1GICA 3MIGA 3RWKX 4Q4W3 3UJQA 4QHOA 2AGSA 2Y0OA 4DFSA 2CWMA 3WQ0A 5DABA 5A3TA 3V0AA 4LORA 2VNRA 2Q1ZB 1GR3A 1REDA 1UX7A 3SITA 2WS92 4Z1VA 3RQ0A 5CG9A 1CAWB 1RUF1 2IXJA 4M3CB 4BXSV 3ORJA 5C9AA 1PNFA 3CHXA 1RUI1 2DCZA 4M01A 3Q8FA 1N3PA 3MI8A 2VQ0A 4LHKA 4AI2A 1ZZBA 3VBFC 4N8MA 1EY2A 1V6MA 3TNPB 5FO9B 5G04L 1BMV2 4QPIC 1F9KA 1GUIA 2H6BA 3M7AA 3CQOA 4XUOA 2OQ7A 2C6SA 3SCFA 5DZGA 2DDUA 1TVGA 4LPLA 5ABJB 2ZX3A 3SC7X 2FDKA 5DAQA 2XL7A 4GMP3 1RUC3 4MO3M 5IFPA 1WW5A 2MEV1 4ZU4A 3I3BA 3JD73 3ASIA 5F3EA 4QDSA 4KGQA 3VBFB 3H1MA 4LEJA 3IPVA 5GLTA 3B02A 2VNVA 1SMVA 4NHYA 4QPIB 3S30A 5I91A 1VALA 5JLVA 1TNRA 2RS13 2XKPA 1WUVA 2AR6A 3POSA 3WNMA 1EYBA 1AX1A 1ZBA3 2IFRA 5B4NA 4QPGA 4EJRA 1NOVA 4YGBA 3H50A 4PBOA 5FYBA 4CRQA 1VAKA 4XUPA 2MHFA 1OSGA 3BVCA 3I2IA 4O7XA 3ZO0B 2OZJA 4XFHA 2R6QA 3IKWA 2ZACA 2ZX0A 3VZNA 3BU0A 2G19A 3VKNA 1W6OB 1W8OA 5IVEA 3OUIA 1OHFA 2YFUA 3MIDA 3W9AA 1PGSA 3IDEA 4AQSA 2PLV3 5IW0A 4E4DX 3MIBA 2RS53 2W3JA 1HIXA 1S0CA 2A6VA 3I54A 1RINA 1XYPA 5A7PA 2Y38A 4MGZE 4GWMA 2BVVA 4EROA 1WW4A 1FOD3 5BYNA 1V9U3 2UWAA 3AMQA 3GNEA 4Q26A 4BM8A 3RSJA 3TYJA 5H9SA 5C8CC 1LKNA 2XJSA 1STMA 2XJRA 3H1WA 2WNVA 3K4ZA 3WR0A 5FUNA 5DUXA 2UYBA 4ARXA 2OZ6A 1C5HA 1W0NA 2WDBA 5BXXA 1AX2A 2ZCWA 1X9TA 3ZXAC 5IK5A 2EVXA 2VCAA 1CIWA 3H8XA 4K1ZA 1W6MA 1DGRN 1B35C 1E5IA 1SHWB 1DYKA 1YQCA 4XAEA 3THTA 4NRPA 3ZIWA 3ZOIA 3V0BA 4LLFA 4XURA 3RRDA 3VBUA 2OW4A 2ZX2A 5C8CB 5DAVA 2EIDA 5KBFA 1SBEA 2RM23 4IESA 3H3LA 4OHYA 2QQPA 3VDDC 4K40A 2ZGLA 4UWDA 3S5QA 3RYPA 2WFF1 5AC92 1PZ9A 3M3CA 1COV2 4HXCA 2AEZA 4UFKA 4YZ1A 1HRI2 2UYAA 2VO5A 4UT5A 1CPMA 1B35B 4GQ7A 2WLPA 1IOAA 1F15A 3Q8EA 4JTOA 3ZYPA 1UY0A 1BLZA 5JOYA 5FP4A 1AR83 2HBTA 1O6UA 3LEIA 1CAVB 4WM8C 5A80A 1CONA 3VDDB 1UPSA 5T3NA 4IEUA 4B3NA 3N9MA 2WIIB 1GLHA 2IZWA 2IXLA 2QUOA 5FYSA 4FPLA 2JDZA 2YG0A 4CZSA 5A1LA 2WO3A 3ITQA 4ITCA 2CDPA 1XOYA 2DCJA 4FSJA 4WM8B 4XF4A 4XILA 2D97A 5DPNA 5L19A 1MVEA 1UX6A 4EZ4A 4N43A 1WW7A 3I59A 2CWSA 3OCPA 2QJVA 5KWRA 2R0HA 1TMF3 2VZOA 3H3UA 3POWA 1SPPA 4P9GA 4URAA 4G4FA 1GP6A 1X36A 1R082 2NQYA 3B7MA 5EXOA 3ZXDA 3WHTA 2ZKLA 4QMAA 1HKDA 4LULA 2NP0A 2Q5TA 3A21A 5I0SA 2GC1A 4LBLA 3LA2A 4UBGA 2P4EA 1K42A 1DGWA 4D94A 4BK5A 3WP6A 4LJHA 3SCHA 4NWWA 4EN7B 3B9IA 5FZFA 5A3LA 1W28A 4IERA 4Y5TA 1GWKA 3NWKA 3FWEA 1HRV2 3UK9A 2QCSB 4QM9A 3ON7A 3H9AA 1DGLA 1X8MA 4MHRA 1HXS3 4K21A 1OOPA 5T5OA 4QDQA 3SQOA 5JXGA 4D7YA 1A8MA 4A6SA 4WVWA 3J7NA 3VKLA 3ZVXA 1T2XA 4JDMA 2GSYA 4E27A 2VMFA 4JQTA 3TAYA 2R061 2YMZA 1KD7A 1RMU3 1GYKA 3TN92 4A2UA 4OUEA 5FMCA 1YXWA 4P00B 5DAXA 5EFUA 3WF1A 4OULA 2Y34A 2MPFA 3CEWA 2BGCA 3PHMA 4IQPA 3VDAA 4DB5A 2V72A 4UXAA 4CUGA 1PMJX 1RUG2 2D6MA 4Q4X2 4YW1A 1OQ1A 3ROUA 4CP1A 1AL22 4NRQA 4AVVA 1RB8G 1WBLA 2CTVA 1PIV1 4L0PA 1MQTC 1PMIA 3AMHA 4FPOB 5ACA2 1HJFA 4FPGA 1JH5A 2WZR2 4KU7A 2ZGQA 4UI9L 4BHPA 4CEWC 3OGGA 1JHNA 4Q4Y3 4N53A 4Y1ZA 2HLEA 1DGRA 1X9PA 1JMUB 4M3CE 1F4AA 2CU5A 3HD8B 3VLBB 3WQ1A 4FBFA 3TEXA 1AYN1 3VD7A 2YDEA 4BDVB 4RYDA 1O7FA 1REFA 4KWLA 4UW6A 1ZRFA 3PMSA 5B4XA 1FPN3 4ES9A 2FCVA 2ATFA 3M70A 5A7WB 5IT6A 2R041 4QB1A 3HNMA 4DIQA 1PO23 3PVNA 5FPVA 4CEWB 1GQGA 4BCUA 3P1IA 4B1LA 2KXLA 3MW3A 2JG9C 1PO12 1NUKA 2OS2A 4F7ZA 1XPWA 2CGNA 4Z2AA 5KXDA 3RZKA 5KC5A 2G4IA 1ZM1A 1UCXA 3FHAA 3WNXA 5IVYA 1VR3A 2ZAAA 5FZDA 2YPDA 4XQWA 4SLIA 2J1SA 2BV4A 4BOWA 5BNNA 1BCXA 4Q0VA 1JU3A 2A6ZA 5SV8A 1YLLA 4XFGA 1U5IA 2WT0A 1BEV3 4XIOA 3RI8A 3ZFFC 4E2SA 1HB1A 3H3ZA 2JG9B 4E4HA 2BOIA 4NAMA 1UMHA 3I3QA 4AVAA 2V5YA 4DO0A 3FJSA 2BDRA 2A1XA 1XNTA 5FJHA 3WDTA 1OMIA 3MYXA 3JXSA
chains in the Genus database with same CATH topology
1NT0A 3POBA 1NZIA 1SZBA 5CKMA 2QQLA 3POGA 5CKNA 4LOTA 1SPPA 5CISA 3POEA 1SFPA 5CKQA 4GZ9A 3POIA 2WNOA 3POFA 1SPPB 2QQKA 3POJA 3KQ4B 4LOSA 4LORA 2QQMA 2QQOA 3DEMA 4LMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NT0 A;  3POB A;  1NZI A;  1SZB A;  5CKM A;  2QQL A;  3POG A;  5CKN A;  4LOT A;  1SPP A;  5CIS A;  3POE A;  1SFP A;  5CKQ A;  4GZ9 A;  3POI A;  2WNO A;  3POF A;  1SPP B;  2QQK A;  3POJ A;  3KQ4 B;  4LOS A;  4LOR A;  2QQM A;  2QQO A;  3DEM A;  4LMF A; 
#chains in the Genus database with same CATH topology
 5DAW A;  5EV7 A;  2JKX A;  4UW3 A;  3T2T A;  4IE6 A;  5LB6 A;  2E51 A;  1LCL A;  3WEZ A;  1GFF 2;  1XND A;  2HWE 1;  4LIT A;  1VBB 2;  2QQL A;  2VOW A;  5GZE A;  3ZFF B;  4BZ4 A;  5IK7 A;  3I2O A;  1AR7 1;  2VZ3 A;  3RZH A;  2AEN A;  5CG8 A;  4IGO A;  3WP3 A;  1H2N A;  3ZLI A;  2TUN A;  1NCR A;  3RI9 A;  1IS4 A;  1WMD A;  5ANN A;  3MW4 A;  1V6N A;  4DIN B;  4AGR A;  2WQ4 A;  5FLI A;  5BNP A;  2ZZQ A;  5EP9 A;  1PGL 1;  3CJI A;  5FKB A;  2A73 B;  3ZFE C;  4Q4W 1;  4M3C F;  5FWJ A;  2HWF 1;  1IHM A;  4O65 A;  4YVW A;  1UKG A;  1KFX L;  1ASJ 2;  4I0A A;  4A7Z A;  5D8A C;  3ZIX A;  1OPM A;  5FZA A;  1J83 A;  2BZD A;  3PDQ A;  5IJR A;  5C5T A;  2E6V A;  1PX4 A;  3NV1 A;  4CCK A;  2ORX A;  1OF3 A;  1HW5 A;  2WA4 A;  4YW7 A;  5FY9 A;  2RE9 A;  3AVS A;  3CBN A;  3HT1 A;  4XUQ A;  1ZBE 3;  1M4W A;  4CP9 B;  1VRH 3;  3ZFE B;  5CFC B;  1RUI 2;  1NAE A;  5K9Y A;  5A7O A;  3ACG A;  4XJ9 A;  2VW1 A;  3WUD A;  3WNK A;  4IV3 C;  4P02 B;  2RDQ A;  4R4Z A;  3IDA A;  5D8A B;  1CPN A;  2UWB A;  1ZZ8 A;  2I74 A;  4XBQ A;  4GZ9 A;  5J7M A;  4KG0 A;  3DXT A;  3WXP A;  3KMH A;  3TEY A;  2LUW A;  1RXF A;  1QY4 A;  1KJR A;  5LA9 A;  4D3W A;  5JOX A;  4CCL A;  4GD4 A;  3CLP A;  2MEV 2;  3S57 A;  3CNA A;  2PEL A;  5FZ0 A;  3ZSE A;  1A34 A;  2P2K A;  4BLJ A;  4FTS A;  4IV3 B;  2K9Z A;  4AVB A;  2DFB A;  4FP3 A;  1ZZ9 A;  4XTP A;  2ERF A;  5DZE A;  2RS1 1;  4YW6 A;  1LUL A;  2Z2S B;  3OPW A;  2J1U A;  4YM0 A;  2NMN A;  4QXC A;  2VVF A;  5C4W A;  3SEE A;  3GHM A;  4LO5 B;  2ZX4 A;  4BJ0 A;  2JIJ A;  1JOD A;  1FMD 3;  2JDH A;  3ZYG A;  1R1A 3;  3J7M A;  3C7E A;  5I8T A;  2WSV A;  1OVP A;  4NWV A;  1R09 3;  4AVC A;  3I97 A;  2W95 A;  2YU2 A;  2VMC A;  5JMO A;  2V73 A;  2DU0 A;  5EJ1 B;  4ZXE A;  2D5F A;  2XLF A;  2ZMN A;  4KBZ A;  1GQH A;  2YZ4 A;  4LKD A;  4I3P A;  2OQ6 A;  5BNQ A;  4LO6 B;  4XDP A;  1I9R A;  2H6C A;  4RGA A;  5FYZ A;  3UT0 A;  2R49 A;  4BB3 A;  5C5U A;  5JVV A;  4AFB A;  4A4A A;  1CJD A;  2X8K A;  3AZW A;  2Z5W A;  2WT1 A;  5FXW A;  2OUJ A;  1I6X A;  2XOM A;  5CKM A;  4AHZ A;  2IUW A;  2Y64 A;  1OLM A;  1VBC 3;  1FI2 A;  4I30 A;  1V9U 1;  2XWB B;  2YHJ A;  5JCT A;  3BN6 A;  4XCA A;  5FKC A;  4BU2 A;  2E7T A;  4XXA A;  1PK6 C;  4OUM A;  1DHK B;  2ZEX A;  4LBQ A;  3AKQ A;  3V65 A;  4WVV A;  1ND2 B;  5E89 A;  4I0W B;  4BQ4 A;  1C8M 3;  4Q5O A;  1QDC A;  1DP0 A;  1JW6 A;  5FYU A;  2BUK A;  5JXJ A;  4L2N A;  1ND3 B;  4LKE A;  5C9A C;  5HI0 A;  2ZML A;  4WVM A;  2QQM A;  3PUI A;  5LBE A;  1SBF A;  4CYD A;  1NYW A;  1PK6 B;  2KM2 A;  4Z82 A;  4MYE A;  4AAX A;  4XEZ A;  2ZS6 B;  1PVC 3;  2P5B A;  1YFX A;  4EQV A;  5JWP A;  2HWC 3;  3NNJ A;  1QEX A;  3D3A A;  4HLT A;  5JZG A;  4OI0 A;  1JYX A;  3PJY A;  2ET7 A;  5FY0 A;  4PLO A;  1UOG A;  2PFW A;  2WNU B;  4IEY A;  3MIE A;  1CWP A;  1BMV 1;  4ASL A;  5F2W A;  1AUY A;  5BNO C;  5JR7 B;  1O4Z A;  3I8T A;  1H8T C;  5FR3 A;  4GB3 2;  3UJO A;  3NVC A;  2VG9 A;  1RUE 3;  1Z0H A;  1AR6 3;  3S7E A;  3GYD A;  4XIK A;  5KHH A;  1ZNP A;  4MGK E;  3QH6 A;  1SDD B;  2UUR A;  3D4K A;  1CZS A;  2P37 A;  4V1P A;  1YQ6 A;  5FP9 A;  5BNO B;  3FLR A;  2JE9 A;  2Y33 A;  5K7P A;  1YYN A;  2GNB A;  3ZXL A;  5JDB A;  1H8T B;  1LU2 A;  1G9F A;  2GU9 A;  5CYY A;  4KNC A;  2Z42 A;  3WG2 A;  2Y6J A;  2ADE A;  2DVB A;  4B7E A;  1YQ2 A;  5JXI A;  1W8W A;  3O1R A;  2JKB A;  4LBM A;  2X5I B;  3OD0 A;  3VBS A;  5AVP A;  4DEV A;  4RSU A;  1Q8Q A;  1Q8V A;  3O1P A;  2ZTN A;  5LAT A;  1JUI A;  4L11 A;  3VBO C;  1WMX A;  2FDJ A;  2JWP A;  4FTE A;  1W2A X;  4CDU A;  1S0F A;  2XL9 A;  5D1I A;  3AX4 A;  3RG0 A;  4RHV 1;  1UU5 A;  3AYC A;  3ZN5 A;  1W8H A;  1I3H A;  4QKD A;  3QOP A;  1MZF A;  1C4R A;  4XFC A;  4YM3 A;  1UOJ A;  1AYM 2;  4IEZ A;  3MO4 A;  4CDQ C;  3BGA A;  4ZZ8 A;  1UKR A;  4L8Q A;  2QVS B;  1QJE A;  3H7Y A;  1TZO A;  4AVS A;  5K0U B;  1NA1 B;  2HWB 2;  4LBN A;  1AXY A;  1QF3 A;  3VBO B;  2W92 A;  2FD8 A;  1F5F A;  4MH0 E;  2LAL A;  1OQD A;  3PU3 A;  4HMZ A;  2A70 A;  4IGP A;  2GP3 A;  1SEF A;  3ILR A;  3AKT A;  5F3G A;  4C0B A;  2CL2 A;  1RYY A;  1YHF A;  4CDQ B;  3MDP A;  1C8N A;  2HH9 A;  3M3Q A;  1LGB A;  3LB9 A;  2JEM A;  4OMC A;  2ZGN A;  2PAK A;  3T1L A;  2NLR A;  1QJU 3;  5C3Q A;  3IMM A;  5FWE A;  2EIG A;  4RFT 0;  4XJW A;  1QOS A;  4A7Y A;  3MF6 A;  2TNF A;  1H0B A;  3DEM A;  2WIN B;  3KCC A;  5FZ4 A;  3T2Q A;  4HBN A;  3V64 A;  3WNN A;  4CDW A;  3OTF A;  5T5L A;  3GAL A;  1NZI A;  1COV 1;  4H3W A;  4XAB A;  1HRI 1;  5A3N A;  1AR9 3;  3JBG 3;  3VBH C;  4QXB A;  1VBD 3;  1FV3 A;  2WFP A;  4BPZ A;  1FT9 A;  1POV 0;  1W99 A;  4LR4 A;  5FYT A;  4D6R A;  4FT8 A;  5I0R A;  4TLF A;  5CKN A;  2D6P A;  4IGQ A;  5GAL A;  2VBP A;  4BMB A;  2VEC A;  1UOF A;  1RUO A;  5A32 B;  1HQW A;  4Q4Y 1;  3UV9 A;  1OBN A;  3O0X A;  1VPH A;  1GOG A;  3ZYI B;  4K6B A;  2ZX1 A;  4QXH A;  2D6O X;  5KHJ A;  2GNM A;  2FDH A;  4CVU A;  1GP4 A;  4D8M A;  3VBH B;  4E8C A;  1OUX A;  3RDI A;  4ISR A;  4N43 C;  4QHZ A;  4LKS A;  2W94 A;  1OD3 A;  1UAI A;  1Z7S 3;  3ZN4 A;  3PME A;  1UIK A;  1V6J A;  5FXX A;  4B4R A;  3VDC A;  3W21 A;  5TSW A;  4XTM A;  3CO2 A;  2J1R A;  3ZX7 A;  3PJQ A;  2OKX A;  1O8S A;  1QDO A;  3WDV A;  2OXB A;  3ETP A;  4JZR A;  4R9A A;  4RL7 A;  2BGO A;  4Y5S A;  3POG A;  4HN0 A;  4NUB A;  5CEH A;  4C1W A;  1R08 1;  1FV2 A;  2CY6 A;  2D3R A;  5GJ6 A;  1G9D A;  1W8F A;  3KVB A;  1XNA A;  5FYY A;  1DQ2 A;  2VTX A;  4MOA A;  4AW7 A;  4C1X A;  2V09 A;  3AFG A;  2AH2 A;  1EPZ A;  1ZRR A;  2FHR A;  3D82 A;  1H2K A;  2ZHN A;  3RS6 A;  2NYY A;  3NRU A;  1OOP C;  4AHY A;  2Q4S A;  4LIV A;  5I8Y A;  2W9X A;  4H7L A;  4JX0 A;  3TBD A;  3K3N A;  1JN2 P;  3OPZ A;  1QWR A;  2VXR A;  1MPX A;  4NRO A;  4UFL A;  1PNG A;  1QHD A;  3SCG A;  4E9K A;  1HV1 A;  4RS5 C;  4RFR B;  1UD1 A;  2B46 X;  3T3Y A;  1EAH 3;  2C0Z A;  2DUQ A;  2GNT A;  2VVE A;  2RS3 1;  2XBO 2;  3HN1 A;  2HWE 2;  3WQ7 A;  4JGY B;  2VCM A;  3TN9 1;  1D0H A;  3ZMN A;  4PCR A;  3KGZ A;  4PDW A;  4CUC A;  2HKX A;  1D4M 2;  3PVO A;  3EHK A;  2XQX A;  4FPH A;  1K3I A;  2Y6K A;  4O9G A;  4UFI A;  3AYE A;  5A7N A;  5IYY A;  2BBV A;  3IBM A;  3M4F A;  4LQR A;  2XH6 A;  1ZA7 A;  2B9U A;  3POJ A;  4RS5 B;  2YXS A;  4P9J A;  3THD A;  4ARY A;  1RUG 1;  1S4C A;  5IVF A;  3APB A;  1AL2 1;  1YUD A;  4Q4W 2;  2XUE A;  3M2M A;  4R4X A;  4UW5 A;  5FZ6 A;  3VBR A;  3ZN6 A;  5ACA 1;  3EXU A;  3WUC A;  4W6W A;  3J4U H;  4L9B A;  2DCK A;  2WAO A;  2IVJ A;  1QH7 A;  1KXG A;  2WZR 1;  5A1A A;  4ZS2 A;  4BQ2 A;  2R1B A;  5FQ0 A;  2WAB A;  1XRU A;  2Q0A A;  2HJI A;  2W5F A;  1CAU A;  3WQB A;  3IWZ A;  5LEJ A;  1VRH 1;  3GJB A;  2ZGK A;  3KSC A;  3P3P A;  1JZ2 A;  5EJ3 A;  3N9Q A;  4Y20 A;  2XDV A;  3UKV A;  3ZXE A;  4Q0P A;  4WM7 B;  3VZK A;  4EV0 A;  2O8O A;  3IM0 A;  3I2D A;  4BQ3 A;  1QXR A;  3H42 B;  2L9L A;  4DY3 A;  1H4G A;  2FCU A;  1ULO A;  3FE5 A;  4Y5Z 0;  5DDJ 3;  5FV3 A;  3NQH A;  1GZ9 A;  4GJZ A;  2GND A;  4DPN A;  1TNF A;  5L9R A;  3JD7 2;  5LBF A;  4AZZ A;  4YGC A;  5BNN C;  1JYV A;  2GC2 A;  4AED A;  2VQT A;  2W1S A;  1S1A A;  3SEP A;  3ETQ A;  5CNA A;  1LOC A;  1WLW A;  3QAC A;  3DEC A;  1OKQ A;  2RS1 2;  3UET A;  2EXI A;  1GOH A;  2OII A;  5FYH A;  3WDU A;  3PIJ A;  4HN1 A;  1E5S A;  1NLS A;  1ZBA 2;  2RHP A;  3LSE A;  5F2S A;  3OGJ A;  1KGY A;  2XVL A;  3VZL A;  2IXH A;  1OUS A;  3AL5 A;  4D6Q A;  2DV9 A;  4XBL A;  3POI A;  1RVF 3;  1JI6 A;  3DYO A;  4XBN A;  2IWG B;  2QNK A;  2YC4 A;  3ZKU A;  4UFH A;  4RQP C;  5F5A A;  2AZ5 A;  3EQE A;  4LA2 A;  1RUJ 3;  3OYW A;  1CGP A;  4YSF A;  3NKT A;  1QJF A;  3LD8 A;  1FNZ A;  3DF0 A;  3HQR A;  5B2G B;  3LPF A;  1GQP A;  4V2V A;  2PLV 2;  4MV2 A;  1FYU A;  2XML A;  3JZV A;  2W52 A;  3UL2 A;  1EP0 A;  2RS5 2;  5FZ9 A;  1BVV A;  2NMO A;  3MF9 A;  4X6R B;  4B8E A;  2PN5 A;  4JV4 A;  5JSO A;  4OI1 A;  4R9D A;  2BEO A;  3CJI C;  3PUH A;  3THP A;  3FC0 A;  1FOD 2;  1V9U 2;  3LF7 A;  4RQP B;  1H8V A;  2LW8 A;  2XQR A;  5FLH A;  1W9W A;  4NIA A;  3MEP A;  4YGD A;  3TOJ A;  1VB4 A;  3ELN A;  1BYH A;  4LA3 A;  4RN5 A;  1XXN A;  1WLD A;  2A75 A;  2A3X A;  4TLG A;  5EWS A;  3KHB A;  3N9L A;  1TQ5 A;  4AG4 A;  4DS0 A;  3N3H A;  4DQA A;  1YI7 A;  1Y9M A;  2JEC A;  5FZO B;  4MGQ A;  4HKL A;  1ASJ 1;  1QJX 3;  2GH2 A;  3LEM A;  3HAG A;  3BPS A;  3USU A;  4JGZ A;  2D43 A;  4Q27 A;  1H6X A;  1WBF A;  4DUV A;  4QX3 A;  3T0D A;  3BTX A;  2DWR A;  2RM2 2;  3HR9 A;  1LHN A;  1PVC 1;  3BOD A;  3S6P A;  3TEZ A;  1H30 A;  4YZ5 A;  4GWI A;  2JDK A;  5FZM A;  1W05 A;  2YGL A;  2XLA A;  3P5B A;  2Q30 A;  4NN0 A;  2K46 A;  2RJL A;  1QMJ A;  1VMH A;  4L97 A;  4YZ2 A;  1V6L A;  1QIQ A;  3GZA A;  3HN3 A;  4IE7 A;  5FFO C;  5A33 A;  1HN1 A;  3SKJ E;  3K51 A;  3WVJ A;  2QQN A;  4XFA A;  4EN0 A;  5J36 A;  5CA6 A;  2BPA 2;  3WP5 A;  2YU1 A;  1NXM A;  3FZ3 A;  3PIG A;  3KV4 A;  4YFZ A;  1CJP A;  3VDB A;  1Y43 B;  4K9S A;  2PYT A;  2XVG A;  2A6W A;  5FRE A;  2V5D A;  1SG3 A;  2ZGO A;  2P6H A;  3EJK A;  3WX5 A;  1W6Q A;  2YY1 A;  4P14 A;  1YNA A;  1GZT A;  1AJO A;  4EZH A;  1BZW A;  1YFW A;  2W1W A;  4Q8L A;  4YZ3 A;  4JKM A;  1IQD C;  5GM0 A;  1IPK A;  3MIC A;  2DTY A;  1VAM A;  1HN0 A;  3S5A A;  2ILM A;  2VOK A;  1CVN A;  1TMF 2;  4QHB A;  4K8F A;  3MUZ 1;  4XF3 A;  1OT5 A;  2VBB A;  4JKL A;  4P5H A;  3ZYF A;  4S2H A;  4BQ1 A;  4FPJ A;  1GOF A;  4MZU A;  1BKZ A;  3QLQ A;  3ZSJ A;  4CU7 A;  3C8X A;  2ZEY A;  3A4U A;  5FZE A;  4RHV 2;  1LEN A;  1LES A;  3WF0 A;  1LJ7 A;  5HV0 A;  5HV4 A;  3QD6 A;  2VMI A;  1VJ2 A;  4S2D A;  5F37 A;  3CL1 A;  2YPJ A;  5D2A A;  1GZW B;  5FMD A;  1LAJ A;  3TB0 A;  2YBP A;  1J1L A;  3ACL A;  3EMR A;  5L7O C;  3AZZ A;  3FL7 A;  3LEK A;  1VAV A;  4HK8 A;  4FVV A;  1NQD A;  4CCO A;  4Q0Q A;  1HXS 2;  1UYX A;  3L2Y A;  1W6N B;  3NST A;  4MAD A;  3HT2 A;  1MS8 A;  4BYY A;  1POV 3;  3AMN A;  4FQ4 A;  3E5X A;  1A3K A;  4A3Z A;  5J96 B;  2BRT A;  4ZHN A;  3K4A A;  2QQV A;  1J59 A;  1RMU 2;  1QJU 1;  2VW2 A;  4HKO A;  1MS5 A;  5F9T A;  4LOS A;  3DKQ A;  3UES A;  5L7O B;  1XE7 A;  4DY5 A;  5JZG C;  2VUD A;  2YYO A;  5FPU A;  4Y4Y A;  2ZGR A;  2QQU A;  3LA3 A;  2XON A;  4L92 A;  2X09 A;  2EAA A;  5FYV A;  1W9Y A;  3OGR A;  5FY7 A;  2C5D A;  3AMP A;  2E9Q A;  3NV3 A;  4MXW B;  5I0T A;  3JBG 1;  3O0V A;  1JBC A;  4NPL A;  4BWO A;  1RXG A;  1MEC 3;  1KJL A;  2VM9 A;  2CAV A;  2X53 S;  3VV1 A;  4LIU A;  4NPR A;  4CP2 A;  4GKX A;  1V00 A;  4GB3 1;  1N47 A;  2BOJ A;  4P08 A;  5K8S A;  4HPK B;  2WNO A;  4Q4Y 2;  1MR5 A;  5I0U A;  5J48 A;  1IPS A;  3F95 A;  3I2G A;  2JIG A;  2VU9 A;  2ZPX A;  1AX0 A;  1R64 A;  3O1T A;  2HEW F;  2EIC A;  1G9C A;  3NV2 A;  5F3C A;  2ETE A;  3MIH A;  3NW4 A;  1WA4 A;  3LFI A;  5AVA A;  3VB9 A;  1Z7S 1;  4Y1X A;  1MZE A;  4WVZ A;  1R1Z A;  4OYU A;  1LOB A;  3U11 A;  3W5N A;  4YG0 A;  5GZF A;  1UYY A;  1KFU L;  1C28 A;  1TME 3;  3BPZ A;  4MVT A;  5EYX A;  3IT8 A;  2WYF A;  3UGG A;  4MSV A;  3U4X A;  4I2O A;  5C70 A;  4NMI A;  4UAP A;  2Y6G A;  4IV1 C;  2IVI B;  2XJP A;  3M8L A;  3VL9 A;  5FMO S;  4YWA A;  2ZGT A;  3VD3 A;  4D7S A;  2PHW A;  3PVE A;  1YJK A;  5F5Q A;  2VUL A;  3JCI A;  3JQW A;  3U75 A;  3I7D A;  1AYM 1;  2WJS A;  1ZZ7 A;  5A3M A;  1BEV 2;  4GWJ A;  4HKW A;  5HBA A;  1MS3 A;  1W6P A;  5CFD C;  5HXM A;  3A22 A;  1CES A;  2HWB 1;  3CMG A;  5DMY A;  4QD2 A;  3E6C C;  4IV1 B;  4RA0 A;  1GNY A;  4W8J A;  3KLS A;  1OA4 A;  1AXZ A;  3B5L B;  2JJ6 A;  3WG4 A;  5DUW A;  1JYI A;  3PLQ A;  4ISQ A;  1X8E A;  3OOX A;  1JU4 A;  3J8F 3;  5FZC A;  3C7H A;  4FO9 A;  4XF0 A;  4ZU5 A;  3WDY A;  4M00 A;  4LO4 B;  4Q8K A;  1APN A;  1VBE 3;  1SBD A;  1XSQ A;  2HYK A;  4B29 A;  3BTY A;  2RS3 2;  2WAA A;  1N1V A;  4BQY A;  5CFD B;  1UY4 A;  3AZX A;  2LRP A;  2Y6F A;  5KHK A;  5JR2 A;  4MUV A;  4QB6 A;  4QPW A;  1ULC A;  1SLI A;  1TEI A;  2VTF A;  4C0H A;  2JXA A;  5IAV A;  4PIX A;  4RGG A;  4GUL A;  4YM1 A;  1UW8 A;  2BER A;  1RUH 1;  1QU0 A;  4F83 A;  5C7G A;  2PAM A;  5IK4 A;  1C5I A;  4FOV A;  3ZPY A;  4XYX A;  5E6H A;  1UMI A;  2HWD 3;  3GHN A;  1EV1 3;  4YNI A;  1SQ4 A;  4W65 A;  1NCQ C;  2Z69 A;  3AMM A;  4NHL A;  4E8D A;  4AEM A;  1AJK A;  1MS1 A;  3E5U A;  4CEY A;  4HON A;  5IUQ A;  4TZD A;  3U07 A;  1S55 A;  1ZBE 2;  2JDN A;  1SFP A;  1RC6 A;  1VRH 2;  4COV A;  4Y22 B;  1OI6 A;  3K3O A;  3OBR A;  5CIR A;  5A3O A;  4CXW A;  2YUE A;  4DUW A;  2LM3 A;  2RR1 3;  5E16 A;  3ZR5 A;  5FP3 A;  3B69 A;  1ENS A;  1LOF C;  1MQT B;  1NE4 A;  1URX A;  4ES8 A;  3KHC A;  2WYS A;  3HEI A;  5A6Q A;  1GV9 A;  4Y1U A;  3ZSL A;  5AC9 3;  1NCQ B;  2ZGP A;  4CXY A;  4NIG A;  2G1M A;  3HWJ A;  5I0D A;  5DDJ 1;  4C90 A;  3PU8 A;  4DMI A;  3MFC A;  4YW2 A;  2ZBJ A;  1AF9 A;  2VMD A;  4YYO A;  2JX9 A;  2OA2 A;  1XU1 A;  3ZDV A;  2DTW A;  3H8O A;  4CCD A;  4XXP A;  1RIR A;  2BWA A;  1ZA4 A;  4HOO A;  3TRS B;  3HQU A;  2ZJC A;  4UF0 A;  3AKR A;  2VUA A;  3THC A;  4HT1 T;  3AK0 A;  3GM8 A;  3T2O A;  3X29 B;  2D6K A;  2PXJ A;  4XZP A;  2VCB A;  4I01 A;  4Z92 B;  1BQP A;  1X7N A;  5GLU A;  1XYN A;  3KT4 A;  1R1A 2;  2BU9 A;  4CA9 A;  3WF2 A;  3WLU A;  2O8Q A;  1DYO A;  1LOD A;  4UYB A;  2Q1F A;  4LHL A;  1LB2 A;  1ZVF A;  3I2J A;  2FZ2 A;  1NX9 A;  5JSR A;  4X8N A;  1RHI 3;  1DZR A;  1VBA 3;  4A45 A;  4CDX A;  4PDW C;  1UZY A;  4J6G A;  3UGF A;  3ZFG A;  4RR3 C;  5C3S A;  2QFE A;  3OB8 A;  2XBO 1;  5EQU A;  1WME A;  1DBN A;  2ORZ A;  5HXV A;  3N7K A;  2DCY A;  3K2O A;  4DNY A;  3IAQ A;  1QXP A;  4QQ2 A;  2YBK A;  1BHG A;  1D4M 1;  1VBC 2;  5CIS A;  5CU1 A;  3OEA A;  2DUO A;  3HNB M;  1A6C A;  2DVF A;  5JPN B;  1AZD A;  1L7R A;  3F2Z A;  4AHW A;  1MZ5 A;  4MX3 A;  4YRD A;  1LGN A;  3E1F 1;  1FAY A;  5GZD A;  3U1X A;  2HYX A;  3WF4 A;  4RR3 B;  2B42 B;  1OLM E;  4V2W A;  1C8M 2;  4CCE A;  4CTE A;  3RWN A;  3T09 A;  1A78 A;  1OC1 A;  1CAX A;  1Q8P A;  5LY2 A;  1ENQ A;  2GAL A;  4MGY E;  1NE6 A;  3DXU A;  5GKA C;  4QX5 A;  5C71 A;  3MZH A;  2JG8 C;  4GH4 C;  1U5Z A;  3OF1 A;  1NKG A;  4JHT A;  4QDR A;  5DXD A;  1PVC 2;  5LK7 B;  3OY8 B;  1UL9 A;  3PTR B;  4MHU A;  1DCS A;  1LHO A;  4CPB D;  1D2Q A;  1QQP 3;  1OUR A;  1J3Q A;  3H7J A;  4AQ6 A;  2FDF A;  3IMN A;  2DVA A;  2PQQ A;  2D44 A;  3NAP C;  1K5M C;  3RNS A;  2EXK A;  2Q8O A;  2RMU 3;  4Q4X 3;  5KXB A;  4M4P A;  3BU7 A;  3DYM A;  3MV1 1;  1CAW A;  4Y20 B;  4AI0 A;  4ATE A;  5GLV A;  1YC6 1;  3KGL A;  2JG8 B;  4GH4 B;  4GMP 1;  1RUC 1;  4M3C A;  4AFA A;  1IG3 A;  1RUE 2;  3WCR A;  5IVB A;  1JS9 A;  2HEY F;  3O0W A;  2BYV E;  3JD7 1;  4I09 A;  3LFM A;  2Y0I A;  3WSO A;  1AR6 2;  2VZU A;  3BB6 A;  1UYP A;  2VZS A;  3VHO A;  1SCS A;  1S2E A;  3K4D A;  3NAP B;  4HZF A;  1OQE A;  1K5M B;  1LRH A;  4AEK A;  1RUD 3;  2OYZ A;  3AC0 A;  5JI7 A;  3RGB A;  2E32 A;  5ABJ A;  5A6X A;  1ZBA 1;  1JZ3 A;  3DCQ A;  4AOC A;  3L9J T;  1GAN A;  5E88 A;  1DQ1 A;  4U2A A;  1AXK A;  3M3E A;  4ZU7 A;  5KC6 A;  3ZXG A;  1GP5 A;  2Q8D A;  2R07 3;  2A6X A;  2FZ1 A;  3MLL A;  4Q0U A;  3MPP G;  1YIP A;  4O9E A;  3NJX A;  1POQ A;  4QPI A;  2VQA A;  1BBT 3;  4XUN A;  4FFG A;  3CU7 A;  3I3D A;  2PLV 1;  2VME A;  4XOG A;  2RS5 1;  3MV0 1;  1KIT A;  4M0H A;  3U37 A;  4P5Y A;  3WT3 A;  3ACF A;  3L2H A;  3VZO A;  5T54 A;  3D6E A;  1FOD 1;  1OPO A;  1W6O A;  3WDX A;  2XGX A;  1UXZ A;  4QKF A;  3HBZ A;  2CYF A;  3EBR A;  4BK4 A;  4DRR A;  2B4K A;  1H9W A;  1N1Y A;  2WL1 A;  3AP6 A;  2H0B A;  1VE0 A;  4LE3 A;  5C33 A;  5FBZ A;  2VY0 A;  2WN3 A;  1QJU 2;  3LQC A;  4TYS A;  2ZEZ A;  5FBJ A;  4FPE A;  3ZYH A;  2ARC A;  3SH3 A;  4QX1 A;  3V0A B;  2RM2 1;  4XQ4 A;  2I07 B;  2W68 A;  3LKJ A;  1QXJ A;  3CIH A;  5LA2 A;  3FBY A;  5FXV A;  3NJY A;  4Q4V 3;  3GZT B;  3W58 A;  2QZ3 A;  5FO8 B;  2P17 A;  2A3Y A;  5H9Q A;  4DXR A;  2I2S A;  1OD5 A;  1AR9 2;  3GZU C;  1QOO A;  3B00 A;  1VBD 2;  1XSR A;  2D3S A;  3JBG 2;  1JHJ A;  2W91 A;  3AXE A;  5C9A B;  2VZQ A;  1C57 A;  1EUU A;  5GZG A;  3NMB A;  5C8C A;  5DG1 A;  1XBF A;  4COW A;  1AR8 1;  3RYR A;  5FY8 A;  1H1M A;  2UU8 A;  3WP4 A;  2B7Y A;  4FAG A;  2PHT A;  3RFR A;  2XXZ A;  4AGV A;  1HX6 A;  2LRO A;  2VQU A;  3ST7 A;  4LXL A;  1IKP A;  1S2B A;  3T0B A;  1RUF 3;  3KZ4 C;  2VVD A;  4HL0 A;  2JDP A;  1YWK A;  2BNO A;  4OI4 A;  4QPG C;  2WO1 A;  4R8H A;  5EZW A;  2VW0 A;  1I5Z A;  1JZ6 A;  1B35 A;  2K0G A;  1ULG A;  3AP7 A;  4FOW A;  3FLT A;  4IXL A;  1Z7S 2;  1LOE A;  3U0Z A;  4W4Z A;  4AAP A;  3IPV B;  3R05 A;  1CAV A;  1W6Q B;  3AZY A;  4TXW A;  5FO7 B;  1TME 1;  4QXK A;  3VDD A;  1ULD A;  4UW4 A;  4ET7 A;  3PUQ A;  1CN1 A;  1TMF 1;  2VZR A;  4NAO A;  4AFD A;  3KM5 A;  4QPG B;  1ZX5 A;  3CKH A;  1X82 A;  3KQR A;  2MEV 3;  2FDI A;  1DQ4 A;  2D6L X;  2QQK A;  2O0O A;  1K12 A;  1CIY A;  3FBM A;  1YFU A;  4BXF A;  1IS5 A;  1JXN A;  4WM8 A;  5A70 A;  2ARA A;  1W39 A;  2ARE A;  2WO7 A;  5I93 A;  2WNV C;  5FMO L;  3JB8 A;  2CAU A;  1WZX A;  4PBP A;  1OFN A;  1OF4 A;  2FMY A;  1HXS 1;  4KG8 A;  5LZ6 A;  1OA3 A;  4A7K A;  2O1Q A;  5FJK A;  1W0O A;  3HOB A;  4YFW A;  1EAH 2;  3RZM A;  3CDZ B;  3KV6 A;  5FZL A;  1EUT A;  4MLO A;  3RZL A;  2GC3 A;  3C7O A;  1MS0 A;  3VBU C;  2R1D A;  3CZU A;  2WNV B;  1RMU 1;  4AXO A;  4ONU A;  5J3U A;  2VBD A;  3BTA A;  4COZ A;  2AAC A;  3WV6 A;  5LCW L;  2PHL A;  1C3H A;  1O4T A;  1GMM A;  2XUM A;  4IUG A;  5SV5 A;  1KEX A;  4LTA A;  1LTE A;  3WW1 A;  4CUB A;  1RUH 2;  1W6M B;  3V0B B;  1J1T A;  4HFS A;  4XF1 A;  4P9L A;  4CSW A;  3VBU B;  5ERL A;  3WW3 A;  3OPT A;  2HWD 1;  3ZM8 A;  5G05 L;  1REE A;  3KD4 A;  5AFB A;  4FTB A;  5L36 A;  3J7H A;  1US3 A;  3N7M A;  4IE5 A;  4E4S A;  2VNG A;  3N35 A;  5IVJ A;  2ZAB A;  2QTW B;  4PF1 A;  2YC0 A;  4MET A;  5FXZ A;  3LEG A;  4Y26 A;  3R6S A;  1K5J A;  4B4P A;  1O91 A;  2CDO A;  2XHN A;  1VB2 A;  5FIX A;  3H0O A;  4KQ7 A;  4OMD A;  3S0M A;  1OLQ A;  1FPN 1;  2GME A;  4XFI A;  5FZ1 A;  3LIG A;  2WFF 3;  2BP6 A;  2QQI A;  1XNC A;  2O14 A;  2ZGS A;  5DDJ 2;  1PO2 1;  3DPR A;  5KHG A;  5LRS A;  4YM2 A;  2P34 A;  2JE8 A;  4TN7 A;  2WQ8 A;  3RYK A;  4XMA A;  2FDG A;  3RPQ A;  1GSL A;  3M3O A;  3MW2 A;  4JRA A;  3RMX A;  1DQ0 A;  2XJV A;  1ONA A;  4QX2 A;  3AXD A;  1ODM A;  4LKF A;  1LHU A;  1E5R A;  3I59 B;  1LNS A;  4N43 B;  1LHW A;  1G8W A;  5A7W A;  2VE1 A;  2R0F A;  3N4M A;  1SPP B;  1WLC A;  4CEW A;  1BEV 1;  2JDU A;  2PHU A;  4QKB A;  1Q3E A;  1RVF 2;  1IKQ A;  3NNM A;  2BNM A;  4YG3 A;  4DZG A;  2GP5 A;  4R9B A;  3E5Q A;  2B9V A;  2IXI A;  3EYP A;  1QJY 3;  1RUJ 2;  3VKM A;  4BE3 A;  3NO8 A;  4CXX A;  1KS5 A;  3O5S A;  4FQZ A;  1RL3 A;  5CZK A;  1PZ8 A;  1IGO A;  2E7Q A;  4OHZ A;  3DYP A;  2X10 A;  1G86 A;  2JG9 A;  5FP8 A;  1OOP B;  4WZC A;  5LBC A;  1DZT A;  4N9I A;  4OHW A;  5JAX A;  4EN8 B;  3HJR A;  1JZ5 A;  1MS4 A;  1J3P A;  1JOB A;  2RJ2 A;  3GZE A;  5C3P A;  5JOW A;  1L7Q A;  1F4H A;  2VD7 A;  3E97 A;  5C6C A;  5FZ7 A;  4Y1Y A;  3ZFF A;  4CCC A;  4YLZ A;  2BW8 A;  3D0S A;  3LWC A;  3UKN A;  4TTG A;  1JUH A;  2YRO A;  2R30 A;  1QJX 2;  2NN8 A;  3GXU A;  4KL1 A;  1WGP A;  4N53 C;  4DEQ A;  2J22 A;  5KR7 A;  3WW4 A;  3T1M A;  2R06 3;  1PZ7 A;  1RGS A;  4QU2 A;  3BUC A;  4FI9 A;  1CR7 A;  1ZBE 1;  4LBJ A;  3NV4 A;  2WSU A;  3C2U A;  3PNA A;  3MPB A;  3T2P A;  1O4Y A;  2D93 A;  3NL1 A;  4TWT A;  2CHH A;  3MUY 1;  1J84 A;  4N9H A;  4K8R B;  4NRM A;  4N53 B;  1UYZ A;  4GAZ A;  2Q8C A;  5GLZ A;  4XAC A;  3J7L A;  3VL8 A;  2VJX A;  5A3U A;  5C8W A;  3WY6 A;  2XJU A;  1PIV 3;  2DCT A;  1XB9 A;  4XF9 A;  4N7I A;  1RUC 2;  3M1H A;  4H14 A;  3ZFE A;  4NR1 A;  2C24 A;  2YFZ A;  3T0A A;  4CP9 A;  5CFC A;  1KDK A;  3PTY A;  4A6O A;  1W0P A;  2TBV A;  1WCU A;  3LDK A;  1H2L A;  3KF5 A;  5D8A A;  3N9N A;  5L9B A;  1RUD 1;  5JUV A;  4XCB A;  5T50 A;  3T4H B;  4LK7 A;  1CX1 A;  3KF3 A;  4CCM A;  1AYN 3;  1WCQ A;  5AFE A;  4ORF A;  3FMG A;  4UBH A;  1FMD 1;  1WLT A;  1QKQ A;  2GMM A;  1R1A 1;  2VNO A;  4UFM A;  2EIE A;  3LGR A;  1R09 1;  2CV6 A;  4IEV A;  4LBO A;  4KH9 A;  2XJT A;  5BNN B;  4ZPI A;  3ATG A;  4CDX C;  1GZC A;  1WCS A;  1DYP A;  2R04 3;  2WA3 A;  5APA A;  3CF6 E;  4HSJ A;  4GA9 A;  4HAN A;  5F6L B;  3BOW A;  3GDB A;  4XE9 A;  4XJZ A;  3KWV A;  4URT A;  3BYW A;  3GBF A;  3K48 A;  1AHS A;  2VUC A;  1NCR C;  1G9A A;  5EIY B;  5EYY A;  2K2S A;  5DUU A;  2ZHK A;  5FZ3 A;  1XU2 A;  4AWD A;  1ULE A;  5E8A A;  3M3I A;  4PLN A;  5BNP C;  1AL0 G;  2P3I A;  1ACC A;  2PMW B;  1VBC 1;  3N36 A;  1RJ7 A;  4IEQ A;  4D0Q A;  1YFY A;  4HVO A;  4KWK A;  4P9Y A;  1NG0 A;  3A23 A;  5F5C A;  5L73 A;  1QH6 A;  1U12 A;  5BPX A;  4YVW C;  4JDO A;  4DRV A;  1W9S A;  2D3P A;  1NCR B;  4JC1 A;  2F4L A;  5JMC A;  4BQX A;  1C8M 1;  3SXW A;  1J58 A;  3MIF A;  4NE9 A;  5BNP B;  3IIA A;  2XG3 A;  1W90 A;  1WCK A;  2EXJ A;  3RZJ A;  3CJI B;  1NY7 2;  4XDO A;  2HWE 3;  1P8J A;  1O3S A;  2WRA A;  4PQQ A;  1AR7 3;  2JB4 A;  5DQ0 A;  4YVW B;  3UYJ A;  1CAX B;  1ND2 A;  4LT5 A;  3C3V A;  5T5P A;  1H9P A;  4Q4V 1;  2HWC 1;  2W87 A;  3DKW A;  1M06 G;  3UKT A;  3J9S A;  4P9X A;  3WNP A;  1ND3 A;  3OSD A;  4AGG A;  4H55 A;  4IEO A;  1D4V B;  1MEC 2;  5ANQ A;  1ZZ6 A;  1F8V A;  1XE8 A;  5D21 A;  4XPV A;  2ES3 A;  2HWF 3;  3B9C A;  4QKN A;  1PK6 A;  2F17 A;  3S7I A;  3LZZ A;  4GAL A;  3WIN E;  1AR8 2;  2ZAH A;  1RUE 1;  5IWF A;  5FOJ B;  2JIC A;  4A44 A;  1ZRD A;  1AR6 1;  2WR9 A;  4M0N A;  2WZP P;  5C4W C;  3ES1 A;  3EO6 A;  4KMQ A;  1B09 A;  3GJA A;  5ABJ C;  2DF7 A;  4L99 A;  4MXV A;  3IAP A;  1US2 A;  2WNU A;  1QNY A;  2Y8K A;  2YC2 A;  3FUQ A;  1JYC A;  2X05 A;  4A42 A;  1UWW A;  4DXS A;  1E5H A;  5FPX A;  1YEW A;  3SMH A;  1O5L A;  4XHB A;  1BK1 A;  1FXZ A;  4LBQ D;  5JIA A;  3N7L A;  3LE0 A;  2CNA A;  1J3R A;  2BVB A;  1BK0 A;  1TME 2;  2F4P A;  4QPY A;  2ET1 A;  1DFQ A;  3K77 A;  5C4W B;  1WWY A;  1ENX A;  1RTV A;  4OZX A;  1W3V A;  2HBU A;  1H4H A;  1Q43 A;  5KXE A;  1U5Y A;  1YQ8 A;  2V4V A;  2ZEW A;  2ZGM A;  3ZXK A;  5BNO A;  2JE7 A;  2YV8 A;  1H8T A;  2BFU S;  2G9Z A;  3J26 N;  2DVD A;  4LBK A;  4QGN A;  4ZXK A;  5JOZ A;  4YVS A;  1QOT A;  3K75 B;  3AM2 A;  1F35 A;  5HCF A;  4F8A A;  4SBV A;  2X5I A;  5K4L A;  2XWJ B;  1W04 A;  3MLJ A;  3VGI A;  3O1V A;  4MG2 A;  1CD3 G;  1JZ8 A;  4LK6 A;  3C7G A;  2B39 A;  2ZXQ A;  4HK9 A;  4I02 A;  1VMJ A;  3J8F 2;  5A3P A;  1LHV A;  1GKB A;  1VBE 2;  1UY3 A;  4FXK B;  2QQJ A;  3LDR A;  3WW2 A;  5I8S A;  2JDA A;  1UZV A;  2WKK A;  3PUA A;  1OH4 A;  4N90 A;  3JU9 A;  4OHV A;  4W6X A;  3VD4 A;  4LBQ B;  4M4R A;  5JPM B;  5K0U A;  1W9T A;  1NA1 A;  3R4S A;  4IEX A;  2E33 A;  3VBO A;  5KHI A;  4ZON A;  3WZ1 A;  5EJZ B;  5LW9 A;  2R32 A;  4XFB A;  3FFZ A;  3KV9 A;  5J98 B;  4WVM B;  3D8C A;  4FPY A;  4CDQ A;  3AZV A;  4IDZ A;  3T30 A;  4GJY A;  4X8P A;  1UO9 A;  1GU3 A;  1AR9 1;  1VBD 1;  1AVB A;  2HWD 2;  1PGW 2;  4LOT A;  4BIS A;  1EV1 2;  1LGC A;  2DU1 A;  4LHS A;  5FPA A;  4KWJ A;  5JZG B;  3HMY A;  1HB4 A;  3KCX A;  4OUS A;  5CKQ A;  4HG6 B;  2G9G A;  5HCB A;  1O3R A;  3B93 A;  3D0J A;  3POY A;  3KCY A;  3QH7 A;  2WS9 3;  3U78 A;  3KVA A;  5HCH A;  2OPW A;  3OBZ A;  2RR1 2;  5FY5 A;  3IN9 A;  3GGL A;  2XHK A;  2VZP A;  3IDC B;  1FPN 2;  2ADD A;  3A7Q A;  4C8D A;  3WG1 A;  4XJU A;  3VBS C;  1V6K A;  2OPK A;  1W06 A;  5A32 A;  1PO2 2;  4FPC A;  2QBX A;  3I3E A;  4IEW A;  3WF3 A;  1W8U A;  1XQN A;  3OUJ A;  4A3X A;  1CZV A;  4AVT A;  4CDU C;  4PHZ A;  3GCX A;  3MHZ A;  3UNP A;  3O1U A;  4MGT A;  3GBG A;  2DYC A;  2PTM A;  3VBH A;  4FCA A;  3SKV A;  3O1S A;  5F8P A;  4YZ4 A;  2J7M A;  4DXZ A;  5F1R A;  3V56 A;  1TE1 B;  3VBS B;  3OBA A;  2B5H A;  1SDW A;  1DZQ A;  4CDU B;  4K20 A;  1XNB A;  5CVR A;  4J1X A;  1CX4 A;  3P3N A;  3LA7 A;  3AYA A;  2GN3 A;  1O59 A;  1UMZ A;  4RGK A;  3H1Y A;  1QJY 1;  3BCW A;  2WO2 A;  5HPO A;  4P9W A;  5A7S A;  1RHI 2;  1VBA 2;  1EAH 1;  2VUJ A;  3VKF C;  3RMY A;  4XJA A;  3ZSM A;  4IET A;  2QQW A;  3WD5 A;  2FBE A;  2DFC A;  5LWB A;  2ARX A;  1XJA A;  5FYI A;  3NKG A;  4JDN A;  4QU1 A;  4RHV 3;  5EHD A;  4QAW A;  5JI9 A;  3POF A;  4JCK A;  1RIT A;  2EXH A;  2CGO A;  2GMP A;  4CDW C;  4N7U A;  2B45 X;  3KB5 A;  5FOB B;  2EA7 A;  2SBA A;  2OVU A;  2R16 A;  2JDY A;  2PHX A;  5LAS A;  4CU6 A;  3AYD A;  1W2O A;  3OEB A;  3POB A;  1UIJ A;  2XVK A;  4JGY A;  1A8D A;  1DG6 A;  1Y3T A;  2UY9 A;  4JTN A;  4TSV A;  2W2I A;  3LAG A;  2W08 A;  2VC9 A;  4XHX A;  2Y6L A;  5DAP A;  3GBW A;  1W8N A;  3PL0 A;  4QX7 A;  4CDW B;  1DQ6 A;  3LDB A;  3NNL A;  4R52 A;  1G6N A;  2XB6 C;  3HNY M;  4RS5 A;  1DF0 A;  3BOP A;  1W3X A;  3ME2 A;  1PM4 A;  4XFF A;  4GWN A;  5FDB A;  3D5O A;  1QQP 2;  4J1W A;  4QT6 A;  4CU9 A;  3DPR C;  2F6B A;  1DGW X;  2JEN A;  3VHN A;  4O61 A;  2RMU 2;  5ISL A;  1D7P M;  2VL4 A;  2XLG A;  3O1O A;  5FYC A;  1COV 3;  1HRI 3;  3ENR A;  1PM7 A;  2IXC A;  1SFN A;  4S2G A;  2OX0 A;  5FZB A;  3R4U A;  5F7U A;  3AP5 A;  1XE0 A;  1V6I A;  2JDM A;  2WUH A;  3DPR B;  4CP0 A;  4WM7 A;  3VUO A;  1Q5O A;  1EPW A;  1RUD 2;  4I3G A;  4GKY A;  1OH3 A;  4ASK A;  5L9V A;  3O12 A;  5CB7 A;  3VD9 A;  2PHF A;  4DXT A;  1FMD 2;  4LNV A;  4Y1V A;  5LRR A;  1RVF 1;  2GH8 A;  3N7J A;  1R09 2;  2R07 2;  5FZH A;  4H2A A;  3I3M A;  4CE8 A;  1JOP A;  2C9A A;  3W20 A;  2BBA A;  2A7A A;  1RUJ 1;  2IXK A;  1Y9Q A;  3FLP A;  5IVC A;  1BBT 2;  1Y7B A;  2AEY A;  3OJB A;  4YW3 A;  2Z79 A;  3DL3 A;  5DG2 A;  3I2F A;  1OXC A;  3AFK A;  4QQO A;  1R08 3;  1RJ8 A;  4AI9 A;  5C3R A;  3LOB A;  4QGL A;  4LLO A;  4EWA A;  1SLT A;  4AI3 A;  3B94 A;  3ILN A;  4Y33 A;  4F3J A;  2RG4 A;  2VAU A;  4ZY9 A;  4NHX A;  1UZZ A;  3VBR C;  1IPJ A;  2W46 A;  2VZT A;  1I5P A;  4BA6 A;  4BH9 A;  1LOA A;  2XJQ A;  3HIF A;  4XJ8 A;  2C9K A;  4PDW B;  4COY A;  2VZV A;  1ZYB A;  1HRV 3;  2OT7 A;  1TG7 A;  3MLK A;  2QKD A;  1U0A A;  2RV9 A;  2PAE A;  2VXJ A;  3MFA A;  1T6G C;  3A0K A;  1UNB A;  3TWI A;  2ZHM A;  1Z78 A;  3INA A;  4FFF A;  4NIH A;  1QJX 1;  4KGG A;  4BLI A;  5A6Z A;  1GBG A;  4XMI A;  1LED A;  3ES4 A;  4RQP A;  1CZT A;  4YPJ A;  2RS3 3;  3VBR B;  3ZN6 B;  2WLQ A;  5FZI A;  3JQX A;  3IDB B;  5FP7 A;  3TN9 3;  3ZR6 A;  5EPA A;  1ZZC A;  3SLI A;  4BME A;  4Q4V 2;  1W2U A;  5H9P A;  3III A;  2HWC 2;  1CQ9 A;  1KDM A;  3W5M A;  1W2T A;  2XPJ A;  1YIF A;  5FZO A;  4BIO A;  4IND A;  5FQ0 B;  2VR4 A;  1LOG A;  1MS9 A;  1QGL A;  3W59 A;  1NXD 1;  1CAU B;  2UWC A;  4OI2 A;  1JYT A;  4PIZ A;  5CFC C;  3ZDS A;  5T52 A;  1RUG 3;  4Z2W A;  3BIW E;  1YO8 A;  2RDN A;  1AL2 3;  1Q8S A;  1IS3 A;  2FCT A;  5FK7 A;  4AED C;  4X6Q B;  5ACA 3;  1V70 A;  3OGS A;  4JVA A;  3DN7 A;  4A41 A;  2WQZ C;  4YW4 A;  2BQP A;  2WZR 3;  1OLR A;  1HJG A;  1XNK A;  2R7E B;  4D69 A;  1RUF 2;  5IFT A;  4Q1P A;  3SIS A;  3RZZ A;  1JOJ A;  2E63 A;  5JSP A;  1S0I A;  2GZW A;  3FUO A;  2I45 A;  2G9F A;  4AED B;  1GWL A;  4MGS A;  3USS A;  1KQR A;  1X33 A;  2JD4 A;  4XUT A;  5IHR A;  2PQS A;  2VOV A;  1UY1 A;  1OVS A;  3RJ2 X;  2QDR A;  3E6D A;  5FZG A;  2J1E A;  1UN1 A;  3VHP A;  3VBF A;  3OG2 A;  2X29 A;  3SHR A;  1QJZ A;  1D0G A;  4PI0 A;  4EWE A;  1W2N A;  1PO1 3;  2E7A A;  3AJZ A;  4FP2 A;  5FK8 A;  4C91 A;  1NLR A;  4W50 A;  4IW3 A;  4DOU A;  3UGH A;  4JQR A;  1JTZ X;  2SLI A;  4FPF A;  4WBB A;  3FN9 A;  2WZE A;  3OYW B;  4QWN A;  1SLL A;  2P3Y A;  4JHZ A;  4FXG B;  3VN4 A;  1IQA A;  3CJX A;  2XKO A;  3ZXF A;  2BFU L;  3VHR A;  4QM8 A;  1DU3 D;  1YCI A;  3AP9 A;  5F6K A;  3I2K A;  4EN6 B;  1LEC A;  1Q56 A;  5BY5 A;  2BJS A;  3KV5 A;  4FAH A;  4EYU A;  1POV 1;  1QNW A;  4JGZ C;  5DN2 A;  4H7M A;  5HCA A;  4XAA A;  5IAX A;  2E53 A;  1ND2 C;  3E6B A;  2QQO A;  1GZW A;  1HDK A;  2EAK A;  1NY7 1;  2N7G A;  2W1U A;  4HET A;  4KBB A;  4WZF A;  2QE3 A;  4CCJ A;  4NO4 A;  1VBB 3;  2P3J A;  2ZKN A;  3B3Q E;  5CAD A;  1DQ5 A;  1VMF A;  2P3K A;  3Q8B A;  3ZYB A;  1ND3 C;  1W6N A;  4OZO A;  1O8P A;  1L7L A;  3LSD A;  2AYH A;  4NHM A;  1N3Q A;  4JGZ B;  3USU B;  4IL7 A;  4UFJ A;  3SNM A;  4AYU A;  3DUI A;  3RVH A;  3BKZ A;  1MEC 1;  1BJQ A;  2Y60 A;  2Y6H A;  1S0J A;  3LOI A;  4LUM A;  1YQ5 A;  2WC2 A;  4LE4 A;  4QGM A;  5L7O A;  1MZ6 A;  3WHU A;  2W0X A;  4NII A;  3N9P A;  1SCR A;  4FFH A;  1O5U A;  4RD7 A;  2KA3 A;  2WNU C;  1ASJ 3;  2VOT A;  1ZRI A;  2WS9 1;  5A33 B;  1S0G A;  1FAT A;  4EN9 B;  2A5Z A;  5J09 A;  4MXW A;  1W03 A;  4Y4R A;  2Q8E A;  1WCD J;  1G7Y A;  5T5J A;  4PLM A;  2VMH A;  1RUI 3;  5FRA A;  1DDL A;  4JAA A;  4NID A;  1IZ3 A;  3DV8 A;  4K1Y A;  2WFF 2;  4GXL A;  5BV6 A;  4U36 A;  1C1L A;  1S0E A;  3H8U A;  2WWJ A;  1H1A A;  2WWU A;  3GCW A;  5IAT A;  4HPK A;  2PHR A;  1JZ7 A;  2GDF A;  1GWM A;  4Q2F A;  1JZ4 A;  2VGD A;  3AP4 A;  2GC0 A;  1X50 A;  4YVS C;  4XDQ A;  2YB7 A;  3KT1 A;  2C26 A;  1HB2 A;  3KQ4 B;  4QQH A;  2X5I C;  5FUP A;  4K3U A;  1DIW A;  1S0D A;  2LTN A;  4ZS3 A;  2J42 A;  2D6N A;  5LK5 A;  3Q8A A;  3R0R A;  4B1M A;  3WNO A;  1DLL A;  1HQN A;  3ACH A;  4YVS B;  4B7K A;  2AUY A;  4E4Z A;  1S2K A;  4OCT A;  4FPK A;  1GNZ A;  4XQD A;  3RJR A;  1QJY 2;  4ATF A;  4D6S A;  3AL6 A;  3J8F 1;  2NZ9 A;  2WBK A;  1WA6 X;  4CCN A;  4DUX A;  5FPB A;  2VZ1 A;  4AR2 A;  3K46 A;  1NA1 C;  1VBE 1;  2ID4 A;  4GMP 0;  5K0U C;  1UZ0 A;  5CAZ A;  1L3J A;  4HSL A;  2NPI A;  5FCC A;  1LEM A;  2J1V A;  2VOX A;  1V0A A;  4YAR A;  1SLA A;  2EF6 A;  4P9I A;  2E31 A;  5LY1 A;  5T55 A;  4Q1R A;  4IV1 A;  2C4X A;  1LR5 A;  3GF6 A;  3PUR A;  3RZG A;  3U4S A;  2ZA9 A;  1WKY A;  2C1F A;  3MBW A;  4UOJ A;  2LS6 A;  1HV0 A;  3AB0 A;  3AKP A;  4LHN A;  3I4I A;  2QDN A;  2D7F A;  2BTV C;  3OBT A;  4XET A;  1DLC A;  1H2M A;  1OFS A;  1VRB A;  4PT6 A;  1N3O A;  5CFD A;  3SH5 A;  1PGW 1;  2AC1 A;  3NJV A;  4JRL A;  5FZK A;  1EV1 1;  4PIY A;  2ZHL A;  2RDS A;  1S0B A;  2ZZJ A;  3IB3 A;  4LO8 A;  3OD4 A;  2R06 2;  4EE2 A;  5E1R A;  2YBS A;  3P6B A;  3Q9O A;  2VCC A;  2J1A A;  2P6C A;  5GLW A;  1OKO A;  2HEV F;  2W39 A;  3H8R A;  1VLN A;  3HBK A;  5FAX A;  3BI3 A;  2TEP A;  2NM1 A;  2RR1 1;  3AVR A;  3TEW A;  5BUV A;  3EB7 A;  2J1T A;  1UZW A;  1IS6 A;  4AFC A;  2KD7 A;  5AC9 1;  3DGT A;  1Y9G A;  2EAL A;  1D2S A;  3TNQ A;  1ALY A;  3G6J B;  1PIV 2;  5LEK A;  2YGM A;  3BTZ A;  5F39 A;  4YG6 A;  5A1F A;  2IC1 A;  4Y22 A;  3WOG A;  3ZSK A;  4B4Q A;  1NQJ A;  1K45 A;  4GB3 3;  4NPM A;  1F31 A;  1ENR A;  1MQT A;  1BVP 1;  4LO7 A;  2D5H A;  4E2G A;  5DUV A;  1N1T A;  1NCQ A;  4Q0S A;  3FX3 A;  1UPI A;  1AYN 2;  3G7D A;  1O3Q A;  1IG0 A;  3MGU A;  1UU4 A;  4BIF A;  5A3W A;  2Z4F A;  3FHQ A;  2EIB A;  1UXX X;  1PX3 A;  2R04 2;  4QX0 A;  3ACI A;  1LOF A;  1NT0 A;  3PUS A;  3R4D B;  5C3O A;  1FX5 A;  3OGV A;  1PMH X;  5F5I A;  1PHM A;  1UY2 A;  1Q8O A;  1W6P B;  2W1Q A;  1RHI 1;  4FFI A;  1C1F A;  1VBA 1;  1W8T A;  1UF2 C;  5FY1 A;  1UQX A;  1SLB A;  3PVB B;  1KS4 A;  4AK3 A;  4QB2 A;  3A0N A;  4XZU G;  5JXH A;  2DBI A;  2B8M A;  3BAL A;  5F3I A;  4BQW A;  4K7J A;  4HVQ A;  3O7O A;  2PHD A;  4QX8 A;  1WD4 A;  1AYM 3;  4KU8 A;  3NNF A;  4PJY A;  4Z8B A;  4WV8 A;  4OLL A;  3Q8C A;  3ECQ A;  4Y3O A;  4JGY C;  4ASM B;  5FMB A;  4ZKT B;  2WZ8 A;  3HPN A;  3QCW A;  2CGP A;  4AQT A;  3IZO A;  2WN2 A;  1MVQ A;  3T08 A;  1HRV 1;  2HWB 3;  1ST8 A;  3SH4 A;  4CUA A;  4J25 A;  1ZRC A;  2JB8 A;  4NHK A;  3VD5 A;  1YJL A;  3QBQ A;  2FMD A;  5FTT C;  4CEY C;  1F5J A;  3N9O A;  1SZB A;  3LIH A;  3NNG A;  2GAU A;  1ULF A;  2DVG A;  3JB4 C;  4IE0 A;  3WDW A;  1LU1 A;  1OA2 A;  2WWS A;  1W8Z A;  2RDR A;  1AR7 2;  5FLJ A;  2BNN A;  3ZYJ B;  2RJK A;  3I49 A;  1SLC A;  4RR3 A;  5FPL A;  4FOY A;  5M0T A;  2OUH A;  4OFG A;  4AEJ A;  1QQP 1;  5GZC A;  2WT2 A;  4JKK A;  2ZMK A;  2JD9 A;  1XYO A;  3I2H A;  4Q29 A;  4CEY B;  3O1M A;  1RUH 3;  1PGL 2;  1YRZ A;  2RMU 1;  1Y4W A;  3CZJ A;  4Q4X 1;  1WMF A;  4AQ2 A;  2HWF 2;  4IEP A;  4NOT A;  2H0V A;  1T6B X;  2ARB A;  4WM7 C;  1UU6 A;  2BWC A;  3O14 A;  2BGP A;  2E26 A;  4W6Y A;  3OY8 A;  2D40 A;  4PF5 A;  4XC9 A;  4Y24 A;  5IVV A;  5KXC A;  5F32 A;  4AI8 A;  1I1E A;  2ENR A;  4I0B A;  4AF9 A;  5JIU A;  1G9B A;  2GN7 A;  2ZOE B;  2P1B A;  4FOQ A;  4COU A;  4KI5 M;  3FFQ A;  5LA0 A;  5FPZ A;  4OVE A;  3VZJ A;  4BQ5 A;  4AL9 A;  1BXH A;  5LBB A;  2A6Y A;  3B01 A;  4MGI E;  4XW3 A;  3C7F A;  4AFM A;  4E2Q A;  2PA7 A;  1VP6 A;  1U5X A;  2RVA A;  2WNE A;  2JG8 A;  1WW6 A;  3NJZ A;  4GH4 A;  3ZKY A;  1RUN A;  5LA1 A;  4EWD A;  4UF0 B;  3KT7 A;  2R07 1;  3VKO A;  1V6O A;  4YW5 A;  1NZC A;  3AJY A;  4QQP A;  1VIW B;  3ABZ A;  4IV3 A;  5FY4 A;  3NAP A;  3ZFG C;  2Y26 A;  3HVD A;  5FZ8 A;  1K5M A;  1JYW A;  4OQ9 A;  1BBT 1;  1HB3 A;  1PO1 1;  3KS7 A;  4R9C A;  3ZMO A;  5H9R A;  2VMG A;  1FNY A;  5A6Y A;  1XC6 A;  1HLC A;  4QQL A;  4G9S B;  5CBL A;  3ZXJ A;  2MNG A;  2V4A A;  2D98 A;  1ODN A;  2Q1M A;  3WCS A;  1GNH A;  1H1I A;  2QZ2 A;  4CDX B;  1UOB A;  5DZF A;  1JYN A;  3BIE A;  3ZFG B;  3WG3 A;  3POE A;  3ILF A;  4G3Y C;  2ZGU A;  3T4V A;  2VH9 A;  4AE2 A;  1ULP A;  2VPV A;  4CPB A;  1W9F A;  2W47 A;  4YGE A;  4D7T A;  5IK8 A;  2VTX J;  3ALQ A;  1F2N A;  4NVP A;  5A7Q A;  4KWU A;  1N1S A;  4S2F A;  4AHX A;  4AI1 A;  1YI9 A;  3LPG A;  1WD3 A;  4Z07 A;  1O3T A;  3LCP A;  2DBN A;  2IFW A;  4IE4 A;  3U10 A;  3ZPO A;  3AKS A;  4LMF A;  3OUH A;  4OHX A;  2KR2 A;  4LUK A;  2CSG A;  1MAC A;  4CU8 A;  5J37 A;  1NLQ A;  5FUI A;  2A71 A;  2DUR A;  4PI2 A;  1VBB 1;  2FQP A;  2XBO 3;  4HVR A;  3JUU A;  3WNL A;  2UY8 A;  1SAC A;  2A3W A;  3HQX A;  1E57 A;  4NJ4 A;  4PQ9 A;  1D4M 3;  4XVH A;  4ZZ5 A;  4OQ8 A;  3FHI B;  3VZM A;  3ZYR A;  1ZRE A;  5FYM A;  5J1X A;  3URF A;  1SFY A;  1PVX A;  1H6Y A;  1HQL A;  4GIQ A;  3U14 A;  1KRI A;  2DUP A;  2XR4 A;  1GIC A;  3MIG A;  3RWK X;  4Q4W 3;  3UJQ A;  4QHO A;  2AGS A;  2Y0O A;  4DFS A;  2CWM A;  3WQ0 A;  5DAB A;  5A3T A;  3V0A A;  4LOR A;  2VNR A;  2Q1Z B;  1GR3 A;  1RED A;  1UX7 A;  3SIT A;  2WS9 2;  4Z1V A;  3RQ0 A;  5CG9 A;  1CAW B;  1RUF 1;  2IXJ A;  4M3C B;  4BXS V;  3ORJ A;  5C9A A;  1PNF A;  3CHX A;  1RUI 1;  2DCZ A;  4M01 A;  3Q8F A;  1N3P A;  3MI8 A;  2VQ0 A;  4LHK A;  4AI2 A;  1ZZB A;  3VBF C;  4N8M A;  1EY2 A;  1V6M A;  3TNP B;  5FO9 B;  5G04 L;  1BMV 2;  4QPI C;  1F9K A;  1GUI A;  2H6B A;  3M7A A;  3CQO A;  4XUO A;  2OQ7 A;  2C6S A;  3SCF A;  5DZG A;  2DDU A;  1TVG A;  4LPL A;  5ABJ B;  2ZX3 A;  3SC7 X;  2FDK A;  5DAQ A;  2XL7 A;  4GMP 3;  1RUC 3;  4MO3 M;  5IFP A;  1WW5 A;  2MEV 1;  4ZU4 A;  3I3B A;  3JD7 3;  3ASI A;  5F3E A;  4QDS A;  4KGQ A;  3VBF B;  3H1M A;  4LEJ A;  3IPV A;  5GLT A;  3B02 A;  2VNV A;  1SMV A;  4NHY A;  4QPI B;  3S30 A;  5I91 A;  1VAL A;  5JLV A;  1TNR A;  2RS1 3;  2XKP A;  1WUV A;  2AR6 A;  3POS A;  3WNM A;  1EYB A;  1AX1 A;  1ZBA 3;  2IFR A;  5B4N A;  4QPG A;  4EJR A;  1NOV A;  4YGB A;  3H50 A;  4PBO A;  5FYB A;  4CRQ A;  1VAK A;  4XUP A;  2MHF A;  1OSG A;  3BVC A;  3I2I A;  4O7X A;  3ZO0 B;  2OZJ A;  4XFH A;  2R6Q A;  3IKW A;  2ZAC A;  2ZX0 A;  3VZN A;  3BU0 A;  2G19 A;  3VKN A;  1W6O B;  1W8O A;  5IVE A;  3OUI A;  1OHF A;  2YFU A;  3MID A;  3W9A A;  1PGS A;  3IDE A;  4AQS A;  2PLV 3;  5IW0 A;  4E4D X;  3MIB A;  2RS5 3;  2W3J A;  1HIX A;  1S0C A;  2A6V A;  3I54 A;  1RIN A;  1XYP A;  5A7P A;  2Y38 A;  4MGZ E;  4GWM A;  2BVV A;  4ERO A;  1WW4 A;  1FOD 3;  5BYN A;  1V9U 3;  2UWA A;  3AMQ A;  3GNE A;  4Q26 A;  4BM8 A;  3RSJ A;  3TYJ A;  5H9S A;  5C8C C;  1LKN A;  2XJS A;  1STM A;  2XJR A;  3H1W A;  2WNV A;  3K4Z A;  3WR0 A;  5FUN A;  5DUX A;  2UYB A;  4ARX A;  2OZ6 A;  1C5H A;  1W0N A;  2WDB A;  5BXX A;  1AX2 A;  2ZCW A;  1X9T A;  3ZXA C;  5IK5 A;  2EVX A;  2VCA A;  1CIW A;  3H8X A;  4K1Z A;  1W6M A;  1DGR N;  1B35 C;  1E5I A;  1SHW B;  1DYK A;  1YQC A;  4XAE A;  3THT A;  4NRP A;  3ZIW A;  3ZOI A;  3V0B A;  4LLF A;  4XUR A;  3RRD A;  3VBU A;  2OW4 A;  2ZX2 A;  5C8C B;  5DAV A;  2EID A;  5KBF A;  1SBE A;  2RM2 3;  4IES A;  3H3L A;  4OHY A;  2QQP A;  3VDD C;  4K40 A;  2ZGL A;  4UWD A;  3S5Q A;  3RYP A;  2WFF 1;  5AC9 2;  1PZ9 A;  3M3C A;  1COV 2;  4HXC A;  2AEZ A;  4UFK A;  4YZ1 A;  1HRI 2;  2UYA A;  2VO5 A;  4UT5 A;  1CPM A;  1B35 B;  4GQ7 A;  2WLP A;  1IOA A;  1F15 A;  3Q8E A;  4JTO A;  3ZYP A;  1UY0 A;  1BLZ A;  5JOY A;  5FP4 A;  1AR8 3;  2HBT A;  1O6U A;  3LEI A;  1CAV B;  4WM8 C;  5A80 A;  1CON A;  3VDD B;  1UPS A;  5T3N A;  4IEU A;  4B3N A;  3N9M A;  2WII B;  1GLH A;  2IZW A;  2IXL A;  2QUO A;  5FYS A;  4FPL A;  2JDZ A;  2YG0 A;  4CZS A;  5A1L A;  2WO3 A;  3ITQ A;  4ITC A;  2CDP A;  1XOY A;  2DCJ A;  4FSJ A;  4WM8 B;  4XF4 A;  4XIL A;  2D97 A;  5DPN A;  5L19 A;  1MVE A;  1UX6 A;  4EZ4 A;  4N43 A;  1WW7 A;  3I59 A;  2CWS A;  3OCP A;  2QJV A;  5KWR A;  2R0H A;  1TMF 3;  2VZO A;  3H3U A;  3POW A;  1SPP A;  4P9G A;  4URA A;  4G4F A;  1GP6 A;  1X36 A;  1R08 2;  2NQY A;  3B7M A;  5EXO A;  3ZXD A;  3WHT A;  2ZKL A;  4QMA A;  1HKD A;  4LUL A;  2NP0 A;  2Q5T A;  3A21 A;  5I0S A;  2GC1 A;  4LBL A;  3LA2 A;  4UBG A;  2P4E A;  1K42 A;  1DGW A;  4D94 A;  4BK5 A;  3WP6 A;  4LJH A;  3SCH A;  4NWW A;  4EN7 B;  3B9I A;  5FZF A;  5A3L A;  1W28 A;  4IER A;  4Y5T A;  1GWK A;  3NWK A;  3FWE A;  1HRV 2;  3UK9 A;  2QCS B;  4QM9 A;  3ON7 A;  3H9A A;  1DGL A;  1X8M A;  4MHR A;  1HXS 3;  4K21 A;  1OOP A;  5T5O A;  4QDQ A;  3SQO A;  5JXG A;  4D7Y A;  1A8M A;  4A6S A;  4WVW A;  3J7N A;  3VKL A;  3ZVX A;  1T2X A;  4JDM A;  2GSY A;  4E27 A;  2VMF A;  4JQT A;  3TAY A;  2R06 1;  2YMZ A;  1KD7 A;  1RMU 3;  1GYK A;  3TN9 2;  4A2U A;  4OUE A;  5FMC A;  1YXW A;  4P00 B;  5DAX A;  5EFU A;  3WF1 A;  4OUL A;  2Y34 A;  2MPF A;  3CEW A;  2BGC A;  3PHM A;  4IQP A;  3VDA A;  4DB5 A;  2V72 A;  4UXA A;  4CUG A;  1PMJ X;  1RUG 2;  2D6M A;  4Q4X 2;  4YW1 A;  1OQ1 A;  3ROU A;  4CP1 A;  1AL2 2;  4NRQ A;  4AVV A;  1RB8 G;  1WBL A;  2CTV A;  1PIV 1;  4L0P A;  1MQT C;  1PMI A;  3AMH A;  4FPO B;  5ACA 2;  1HJF A;  4FPG A;  1JH5 A;  2WZR 2;  4KU7 A;  2ZGQ A;  4UI9 L;  4BHP A;  4CEW C;  3OGG A;  1JHN A;  4Q4Y 3;  4N53 A;  4Y1Z A;  2HLE A;  1DGR A;  1X9P A;  1JMU B;  4M3C E;  1F4A A;  2CU5 A;  3HD8 B;  3VLB B;  3WQ1 A;  4FBF A;  3TEX A;  1AYN 1;  3VD7 A;  2YDE A;  4BDV B;  4RYD A;  1O7F A;  1REF A;  4KWL A;  4UW6 A;  1ZRF A;  3PMS A;  5B4X A;  1FPN 3;  4ES9 A;  2FCV A;  2ATF A;  3M70 A;  5A7W B;  5IT6 A;  2R04 1;  4QB1 A;  3HNM A;  4DIQ A;  1PO2 3;  3PVN A;  5FPV A;  4CEW B;  1GQG A;  4BCU A;  3P1I A;  4B1L A;  2KXL A;  3MW3 A;  2JG9 C;  1PO1 2;  1NUK A;  2OS2 A;  4F7Z A;  1XPW A;  2CGN A;  4Z2A A;  5KXD A;  3RZK A;  5KC5 A;  2G4I A;  1ZM1 A;  1UCX A;  3FHA A;  3WNX A;  5IVY A;  1VR3 A;  2ZAA A;  5FZD A;  2YPD A;  4XQW A;  4SLI A;  2J1S A;  2BV4 A;  4BOW A;  5BNN A;  1BCX A;  4Q0V A;  1JU3 A;  2A6Z A;  5SV8 A;  1YLL A;  4XFG A;  1U5I A;  2WT0 A;  1BEV 3;  4XIO A;  3RI8 A;  3ZFF C;  4E2S A;  1HB1 A;  3H3Z A;  2JG9 B;  4E4H A;  2BOI A;  4NAM A;  1UMH A;  3I3Q A;  4AVA A;  2V5Y A;  4DO0 A;  3FJS A;  2BDR A;  2A1X A;  1XNT A;  5FJH A;  3WDT A;  1OMI A;  3MYX A;  3JXS A; 
#chains in the Genus database with same CATH homology
 1NT0 A;  3POB A;  1NZI A;  1SZB A;  5CKM A;  2QQL A;  3POG A;  5CKN A;  4LOT A;  1SPP A;  5CIS A;  3POE A;  1SFP A;  5CKQ A;  4GZ9 A;  3POI A;  2WNO A;  3POF A;  1SPP B;  2QQK A;  3POJ A;  3KQ4 B;  4LOS A;  4LOR A;  2QQM A;  2QQO A;  3DEM A;  4LMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...