3K75B

X-ray crystal structure of reduced xrcc1 bound to dna pol beta catalytic domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
151
Chain Sequence
PEIRLRHVVSCSSQDSTHCAENLLKADTRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA repair protein XRCC1
publication title Oxidation state of the XRCC1 N-terminal domain regulates DNA polymerase beta binding affinity.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 151
sequence length 152
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k75B00
4QB1A 3OGRA 4DEQA 1ULPA 3BN6A 1UY4A 3ETPA 1EUTA 1XNAA 2VZOA 1GMMA 4ZXEA 5DQ0A 3K4AA 3FHAA 1UY2A 1XC6A 2QQNA 2VOTA 2C4XA 2E26A 3K4ZA 2V72A 3WNMA 1WCQA 1W9WA 1MPXA 1UXZA 3LEIA 3LE0A 4LPLA 4A41A 4JKKA 3C7GA 3HPNA 4XUQA 2L9LA 1UX7A 4XVHA 2RVAA 3C8XA 4OMDA 3FL7A 4QDRA 3K75B 2WYSA 2ZEZA 2YB7A 2J1VA 3IAQA 3D3AA 3LPGA 4RYDA 1US3A 2DCJA 1L7QA 2VZSA 1PMJX 4CU7A 4UOJA 2C9KA 4DEVA 3SKVA 3LQCA 4D8MA 5JR2A 1O59A 2VTFA 3W5MA 3HJRA 3WNNA 3T08A 2W92A 1JYWA 2Y6LA 3BGAA 3P6BA 3C7FA 4QDSA 3CZJA 2R7EB 2XHNA 2ZEYA 1RYYA 3HEIA 3F2ZA 2WN2A 4M4RA 2WZEA 5F7UA 5HPOA 3I2HA 1P8JA 3WF3A 3WF2A 3OEAA 5JUVA 3HNBM 1K42A 2CDOA 3ABZA 4BJ0A 1GQPA 2W91A 4DUXA 2EIEA 4MOAA 2ORXA 1UY0A 3A23A 4MGQA 1W0NA 3GGLA 2LW8A 3T09A 3P1IA 1US2A 2VC9A 1NX9A 1SDDB 1YQ2A 4OUEA 2VQTA 2B4KA 4XUPA 2Y8KA 2J1AA 5DN2A 5G05L 4TXWA 3OGVA 3WF0A 2J1RA 3LEKA 2WABA 2DDUA 3I3BA 3OBAA 3THCA 3HN3A 4MO3M 2W87A 3SKJE 1ULOA 3T2QA 2W1UA 3T0BA 2WQ8A 2VM9A 3WSOA 1PMHX 4PF1A 5IFPA 3VD4A 5IYYA 2WDBA 2QQIA 2YC2A 1J84A 4HG6B 1O8SA 2J1SA 3HNMA 1W99A 3NJXA 5JXJA 2WUHA 1UYZA 4PQQA 2BZDA 3I2JA 3CZUA 1HN1A 2W1SA 2E33A 3ACFA 4GZ9A 2VZUA 4W8JA 2ORZA 1XNTA 4CU9A 4ZZ5A 2Y6HA 1TG7A 2VZQA 2QQLA 4PT6A 4CUAA 2VL4A 3UNPA 1JZ2A 4DUVA 2QBXA 2Y6GA 3CQOA 2J7MA 2QQJA 4JKMA 1UWWA 3LEGA 3SEPA 2ZEWA 1I5PA 1K3IA 3ECQA 3NRUA 3T2PA 4OZOA 1NUKA 2WAOA 1H6XA 4A42A 1GNYA 1WKYA 1UY1A 1D7PM 2YFZA 2HYXA 2W47A 4P5YA 1F4AA 1J83A 1OF3A 3OG2A 1DP0A 4JHZA 2Y6JA 2W5FA 2W3JA 3UESA 5LCWL 3PUIA 2EIBA 5I0DA 3K4DA 3VD9A 4QX2A 4ARXA 2V4VA 5JXIA 5CYYA 4LHSA 5J1XA 3W5NA 2RV9A 5HXMA 3CIHA 2W46A 1GOFA 4JKLA 4JX0A 2VMDA 4ZY9A 2VCAA 1UYXA 4QX0A 1UMIA 2JKXA 1JU4A 4BK5A 4QB2A 1JZ4A 4MADA 5G04L 2WN3A 4P00B 2Z4FA 3CDZB 3MUZ1 3WQBA 3I2GA 4FI9A 4RN5A 1SG3A 4KMQA 4DXTA 3C7EA 1W8NA 4GWJA 1TVGA 1KEXA 4LKSA 3GM8A 5DPNA 3WNOA 1XPWA 2Y64A 1SHWB 3EYPA 5IFTA 4QX1A 4XUOA 3WF4A 5C71A 2VJXA 2J1UA 3UETA 4XZUG 2VMCA 3I2KA 3CKHA 3LPFA 2OKXA 4KI5M 4CU8A 2VZ3A 2WZ8A 2ID4A 2WO1A 3OEBA 2WO2A 2X05A 3K77A 4IUGA 1R64A 4BK4A 4QDQA 5JXHA 1O8PA 4E8DA 1UYYA 3T0AA 1IQDC 1UXXX 1W9TA 2VO5A 4KWUA 5LA2A 2WO3A 3IDAA 3WNKA 5EJ1B 4DXSA 4L0PA 4M4PA 2VZVA 4OMCA 2XONA 3C7OA 1CZVA 1EUUA 2W95A 1JZ3A 2VCCA 4CVUA 3IIIA 5C70A 3JXSA 5FUIA 2C26A 2VZRA 1JYXA 1H6YA 3T0DA 3A21A 3PUHA 4CUCA 1JZ5A 3VD7A 4QPWA 5CZKA 3GDBA 3T2OA 4MGSA 3HOBA 2VZTA 2QQKA 3ACGA 4XUNA 3I3EA 3K46A 2BBAA 1JYNA 3I97A 2JD9A 3FHQA 5B4NA 1L7RA 3I2FA 2BERA 4DXRA 1JU3A 5A1AA 1CZTA 2VZ1A 1W9SA 3DECA 1DYOA 1UZ0A 1T2XA 2DCKA 3OGSA 2YFUA 3NQHA 4QAWA 4QB6A 1OF4A 1UY3A 3ZM8A 2VMEA 4A45A 4TTGA 4XUTA 1CIYA 3ACHA 2W94A 4P02B 3MV01 2VQUA 3MUY1 1CX1A 1GUIA 3WNLA 1NKGA 3I2IA 3U37A 2E32A 3J7HA 2X10A 4AG4A 2J22A 3ACIA 5DMYA 2W1WA 3GXUA 4LQRA 4YPJA 2BGOA 2XQXA 4W50A 1K12A 2RJ2A 3DYMA 1OT5A 3NNGA 2XOMA 1JZ6A 4Z2AA 5EIYB 2E31A 3MV11 1LNSA 2YC4A 4W4ZA 2ZEXA 3A7QA 1NAEA 3IB3A 5IJRA 2JE8A 3VDBA 2WBKA 4ZZ8A 1DLCA 4OYUA 4QX3A 2W9XA 3E1F1 4ET7A 1OH4A 3VDAA 1JI6A 1JZ7A 2EICA 3WNPA 2CDPA 3I3DA 2VMFA 3NJVA 1KGYA 3CMGA 5B4XA 2J1TA 2WAAA 1BHGA 2VCBA 2X09A 5LA1A 4E8CA 4UI9L 4A4AA 1GOGA 3C7HA 3DYOA 4P08A 5IHRA 4AAXA 3VD3A 3VDCA 2V5DA 3MO4A 2PQSA 5JMOA 3EB7A 4ARYA 2LS6A 1W8OA 1JHJA 1JYVA 4A44A 4CU6A 2BGPA 2KD7A 3WF1A 3DYPA 4XURA 1UMHA 4A3ZA 5LA0A 2W1QA 1PX4A 2QQMA 4BXSV 3AC0A 3WEZA 2EIDA 2YG0A 4CUBA 3IAPA 3HNYM 1GU3A 2HLEA 4UAPA 4GWIA 5JXGA 3A22A 2VR4A 1JZ8A 3VD5A 1OD3A 3OB8A 2QQOA 4A6OA 2Y6KA 1F4HA 3FN9A 3MBWA 2ZXQA 3SEEA 4DUWA 5C7GA 2VZPA 1GOHA 1PX3A 2JDAA 2J1EA 1K45A 1CZSA 2B9VA 4D0QA 3THDA 5EJZB 4BDVB
chains in the Genus database with same CATH superfamily
2XUMA 1W8TA 4IEWA 2AUYA 2VH9A 5FYHA 5CFCC 1SPPB 4UFLA 1NLQA 1ODNA 5FKBA 3HBZA 2Q30A 4DEQA 4LUKA 5EFUA 3ETPA 1JS9A 1F5FA 2CHHA 1DF0A 3AMQA 1XJAA 4JTOA 3J26N 2P1BA 4LA3A 4Q4X3 3OJBA 1YUDA 2EA7A 4BIOA 3QOPA 5DQ0A 1I6XA 4Z82A 3OD4A 3T3YA 2A70A 1W2TA 1YQ8A 1BYHA 1RB8G 1UQXA 1MS8A 3NMBA 1I1EA 1Y9GA 4V1PA 1RXFA 4LNVA 4CEWC 5I93A 1RUE1 4P9XA 4EN9B 2C4XA 2WWJA 4M00A 5C3QA 2V72A 3WNMA 1W9WA 3PJYA 5FPLA 1A8DA 1HRV1 1DLLA 4L9BA 1HLCA 1GKBA 3D5OA 3HQUA 2FZ1A 1TMF1 3K3OA 4KNCA 3C7GA 3HPNA 1FXZA 4QPIA 1IS5A 4GH4C 4XW3A 1YFXA 4XVHA 3IZOA 3T4HB 2R0FA 4NVPA 3C8XA 1GP5A 4Q0UA 3FL7A 3AJYA 4QDRA 1O5UA 3OGJA 2ZGNA 1QKQA 3K75B 2IWGB 4EJRA 2WYSA 4YM3A 2OIIA 2D3PA 3ZSKA 4COVA 4DY3A 5A32A 1VBA1 2J1VA 4UW3A 3VKLA 1VBE1 1QH7A 1VMJA 1W90A 1AYM1 2HKXA 2QUOA 3LPGA 1RUH1 3PMEA 4Q4Y1 4YW1A 1LULA 3RZJA 2WINB 4QPGB 3UL2A 1GSLA 1XB9A 2DYCA 1PMJX 2DCJA 1VBC2 2VZSA 3H7YA 2C9KA 1YRZA 3O0WA 2X29A 3LQCA 2ZGKA 1F9KA 5AFEA 1QJZA 2A3XA 4LA2A 4FAGA 4RR3C 2UURA 5JR2A 5F39A 1G86A 3HJRA 4QT6A 1AVBA 4G9SB 3SMHA 4AAPA 1VE0A 4IETA 1U5ZA 3H8RA 4WM8B 1C8NA 5DAWA 4HT1T 2YXSA 2W92A 1PO23 3BGAA 2BDRA 3I59A 1D4M2 2DVBA 3AK0A 4G3YC 1XSRA 1W3XA 1D2SA 4LEJA 5FZCA 2XHNA 5K0UA 1O5LA 1V00A 2HWE1 3FBMA 4M4RA 5IK7A 2P3KA 4DS0A 1KJRA 3I2HA 4ES9A 3WF3A 4IEVA 3QCWA 4JHTA 4V2VA 4Q8KA 5JUVA 3DGTA 4XYXA 1RTVA 1G9CA 3MW2A 4DUXA 3WDTA 4MOAA 2QKDA 1V6JA 4NAMA 1VRH2 2LW8A 4AI8A 5IK4A 1NX9A 4S2FA 3JU9A 4J1WA 2AR6A 2JG8A 5T54A 1N1TA 4Q0QA 4XUPA 2JD4A 1VBD1 3Q8EA 4RSUA 1VPHA 4GKYA 5G05L 1T6BX 2JDUA 2ERFA 3WF0A 1W05A 2ZA9A 4OVEA 1GFF2 3AMMA 3KV9A 4R8HA 4XF1A 4BA6A 4LBJA 3I3BA 3LFMA 3OBAA 3ILNA 3V64A 3OY8A 1KD7A 4LBQD 3EHKA 3HN3A 1ZZ7A 2HWC2 4QX7A 4DRRA 1NCRA 4K40A 5A33B 3SKJE 2OW4A 3ME2A 3KLSA 3NNJA 4Y5Z0 5F6LB 1PVXA 3D6EA 3SH4A 2WLQA 3T2QA 4IE6A 3J7LA 4HKWA 4LJHA 3VBUC 4KG8A 1LOGA 2A7AA 5JVVA 1T6GC 5FY5A 4RHV1 5JZGC 3KQ4B 4XACA 1PMHX 2ZACA 5H9PA 1QOTA 4YG6A 3SC7X 5IFPA 4YW7A 1TQ5A 3UK9A 5F5IA 3GHMA 5IYYA 5HBAA 1QJU1 1HQLA 2TEPA 4BLJA 3MW3A 1FOD2 2QQIA 1RUF1 2PXJA 1MZ6A 3BPSA 5FMOL 1AR81 2BFUL 2YHJA 3VBSB 1DQ2A 1O8SA 1TE1B 1H9PA 1VALA 5ISLA 3HNMA 1Z7S1 4P9YA 4JDOA 5CKQA 3NJXA 4C0BA 3POEA 2Q8DA 3FLTA 1NG0A 5C33A 1YI7A 2FDHA 1O91A 2BZDA 4NPMA 3EQEA 3ZVXA 3UKVA 3ACFA 1RUG3 3DKWA 2PLV1 3J8F3 2QJVA 2ORZA 4CEYA 1TG7A 2VZQA 2DVGA 1APNA 3TRSB 1UKGA 5LEKA 3O1MA 4JQRA 1CESA 1ZZ6A 3RNSA 4OQ9A 3MLLA 5HXVA 3UGGA 5CFDB 1AX0A 4CUAA 1GZWA 2Z42A 1JZ2A 1ZM1A 1PM7A 3ZFFA 2A5ZA 1PMIA 4CXWA 4CP1A 3AZWA 2JDPA 4AFDA 1EV11 4R9CA 5JDBA 4BQ5A 4XHBA 2OUHA 4PIZA 1VLNA 2R1BA 2JIJA 3NRUA 4QPGC 3V0AA 5FCCA 4OZOA 3KCCA 1NUKA 2R043 4PJYA 2Y0IA 4QU1A 1MEC2 2O0OA 3FUQA 5F1RA 3B02A 2FMYA 1LR5A 2HYXA 2GH8A 2MEV2 1GP6A 1YQCA 2ETEA 4P5YA 1RC6A 3GZTB 3WQ0A 2R16A 3RYRA 4ATFA 2DFBA 2IFWA 1EAH3 1ZNPA 3IN9A 4FPLA 4WM8C 3RS6A 5JAXA 1J83A 5HV0A 4JHZA 4AFMA 2HWD3 2QE3A 3PIGA 1YFYA 4RQPB 3UESA 4MH0E 4M3CB 1Z78A 2XLGA 5SV5A 5IVEA 1ZBA2 1W6NB 4QX2A 1BMV1 2LROA 1XBFA 2RS52 1YJKA 5DZEA 3GBFA 3R0RA 2XBO2 1SFNA 2NN8A 3VKMA 2RV9A 4R52A 5J7MA 1XU1A 3CIHA 1AR83 2W46A 4GA9A 4IV3B 1MVQA 2ZMLA 5T5JA 2WNVA 2R30A 1UZWA 3IM0A 3WDVA 4BIFA 3RMXA 4JKLA 4JX0A 4XE9A 4ZY9A 2YU2A 2DUOA 1IKPA 3PUSA 3VHRA 5LW9A 2CAUA 4CDWA 3JD71 4E27A 1H0BA 2GMEA 5J3UA 4P00B 2Z4FA 2X8KA 5AC93 2B5HA 5C9AA 5F5AA 4Q4X2 2BOIA 2NZ9A 3MUZ1 5FWEA 1OOPB 1VBB3 2OQ6A 4RN5A 1N1SA 3NAPA 4JDMA 1C8M1 1O3QA 4Q1RA 3AYAA 5FY1A 1TVGA 2RHPA 2LALA 4LKSA 3LDRA 3MPPG 3ZO0B 3UJOA 3HR9A 3K2OA 1UZZA 5FO8B 1XE8A 2VCMA 1K5MA 3OPTA 2VTXA 4P9LA 3RDIA 3WY6A 5IFTA 3ES1A 5FY0A 2QCSB 4QX1A 3VL8A 1UN1A 2VECA 4HVRA 4PLMA 1OQDA 4LIUA 5ERLA 5FREA 2HEVF 2DURA 4FPKA 2VMCA 2WNOA 3B93A 5A80A 4NIHA 2VAUA 2JE9A 1PVC3 2O8QA 4LBKA 4ASKA 4FTBA 5CU1A 5L7OA 1RINA 4FOVA 1SLCA 2FCVA 4WVMA 4BQYA 4FAHA 2VUJA 3KZ4C 4JV4A 3VDDA 5BYNA 1B35A 4HVOA 1DYKA 2JG9B 1SZBA 3D0JA 1NA1C 1ND3A 4Z8BA 3V0BA 5K9YA 1RUD3 1YQ5A 1MR5A 2GNDA 5FK7A 4IUGA 3KF5A 4WBBA 5JXHA 4NHMA 4D7YA 2BP6A 3AP6A 4NHYA 2X53S 3VBSC 1A34A 4LLOA 2K46A 1UXXX 2R071 4MX3A 3TOJA 5BNNB 2IC1A 3BTYA 2XJPA 5LA2A 3B9CA 4QXCA 5FR3A 3VBHB 2B8MA 2E6VA 1BK0A 5A70A 2EXKA 1BEV1 1DGWA 4XEZA 2Q1FA 3WCSA 4DXSA 2YGLA 4L0PA 4M4PA 1UOBA 2XLFA 4OMCA 5FBJA 3WP5A 2WS92 3C7OA 1EUUA 1PO22 3AKQA 3LZZA 2Z79A 2FDJA 3MFAA 4XFHA 4Y22A 4RD7A 2PMWB 1VAMA 4DRVA 3NWKA 3M70A 4F8AA 1S2KA 3J7MA 4FO9A 1SQ4A 2VZRA 3ZFEA 3AKPA 5CFDC 2NMOA 5HI0A 1CVNA 3PUHA 5L73A 4B1LA 2VOVA 3UJQA 1CPNA 3SH5A 3WV6A 1RVF3 2OT7A 4QU2A 3WX5A 2ZGMA 5M0TA 2IFRA 5FYVA 1AR62 5A7SA 3Q8FA 5B4NA 1RMU3 3RPQA 3EXUA 1MQTA 1U5XA 2QDNA 3NW4A 4DXRA 4N43B 4QQOA 4PDWA 4LK7A 1ZZ8A 1V6KA 1XNBA 1KFXL 1YFWA 1DYOA 3WG2A 3AXDA 4LBMA 1WLTA 4D7TA 1CJPA 2YFUA 3NQHA 1CIWA 4AK3A 1J59A 4MGIE 1UY3A 4GB31 1AR93 4RQPC 3WW4A 4CUGA 4S2GA 5DAQA 5JOZA 2GNTA 3FLRA 3WINE 4TTGA 1CIYA 2AEYA 4LHKA 3DF0A 1HW5A 1ULFA 4HK8A 4OQ8A 1NLRA 1HXS3 1OA4A 3I2IA 1XOYA 5EV7A 3U37A 2KXLA 4IV3C 2E32A 3ZN6A 2X10A 4NRMA 4K7JA 2J22A 3ACIA 4FFIA 5F8PA 5IT6A 3O1PA 2G9GA 5KHKA 1X9PA 4O65A 5A6ZA 2VNOA 4TWTA 3CJIA 3GXUA 5LWBA 5CB7A 4LQRA 3MIBA 4OHZA 4O61A 5GZEA 3T30A 5FY9A 2EIGA 1CPMA 3M3IA 3C3VA 4C90A 2RJ2A 2XLAA 4YG3A 4PIXA 4HPKB 4UFIA 1I5ZA 1RHI3 4QX5A 5EIYB 1OOPC 3CNAA 2E31A 1FPN2 4CCEA 2VE1A 4JDNA 5F3EA 4EE2A 5TSWA 3FFZA 1OUXA 3O0VA 3JB4C 1AR72 4AEDB 5JPMB 4R4ZA 2PAKA 4JVAA 5FY4A 2ZEXA 3A7QA 4JC1A 3RZGA 1NCQC 2B9UA 2RDQA 3GCXA 1W6OB 5C3OA 2VVEA 3GZAA 5IUQA 2MHFA 1QOSA 3J8F2 3L2YA 4FPCA 4QHOA 5K7PA 3S5AA 4AFBA 1W6QA 1DLCA 2UY9A 1ZBE2 3ACLA 4CDUB 4NUBA 4HETA 5F2SA 4ET7A 3TB0A 1JODA 1JZ7A 4C1WA 1OMIA 1LRHA 3KHCA 5LK7B 3D82A 3I3DA 4RS5B 4LLFA 1AYN2 2HYKA 5BNPA 1KGYA 3CMGA 3KB5A 1VIWB 4BQ2A 5KHJA 2GMMA 3EBRA 4UWDA 1SLBA 2DBIA 2WAAA 4L11A 5LBFA 2JG9C 5F5CA 2DV9A 4YZ3A 5LA1A 4E8CA 4K6BA 3LAGA 4UI9L 4UFHA 4A4AA 2OUJA 4QX8A 5K4LA 4QM8A 3H7JA 4CDQA 3VKFC 2HWF3 2Q5TA 4AAXA 4AVTA 1XU2A 3AYEA 2JIGA 3PTRB 2PQSA 1F31A 4LXLA 3HMYA 5JMOA 4I2OA 5FYUA 1YEWA 3WZ1A 1G9AA 1KRIA 3VBHC 1QQP3 4BU2A 2J42A 2H0BA 1JYVA 3ALQA 1O3TA 1HIXA 4S2HA 3H1WA 2Q8CA 4XCBA 4LBLA 2GH2A 1CWPA 2HWD2 2CWMA 2RR11 3POFA 2PHRA 4Y26A 4Y3OA 5IVFA 4FPOB 4PBPA 4TZDA 3X29B 1H1IA 1VB4A 1PX4A 1VAVA 1FX5A 2VMGA 4LIVA 3ZDVA 4YSFA 2JB4A 4Q27A 1POV3 2YG0A 3VL9A 4XFAA 3ORJA 1WMDA 2B39A 4GWIA 2C5DA 3KV5A 2P6CA 5LY2A 3B5LB 2WA3A 3BI3A 4N90A 5F3IA 3FN9A 2BNMA 2RG4A 1CAXB 1W8HA 2CAVA 3MBWA 5A3OA 4CDXA 3SEEA 1RUI2 2HWC1 2VZPA 4CZSA 1GOHA 3ZIXA 3NKTA 4Y1ZA 3B69A 5C3PA 1E5RA 1CZSA 4BLIA 4BQ4A 5AC92 5FQ0A 1HKDA 3D4KA 4AFAA 2FDGA 4ZONA 1SACA 3VBFA 1OVSA 1UMZA 1VBB2 4MUVA 1HRI3 4QB1A 3LCPA 3OPWA 1IPJA 3S0MA 1UY4A 4KG0A 1EUTA 1ZYBA 2D40A 4TN7A 4AF9A 2WNUB 2WQ4A 1XNAA 2ILMA 2QFEA 2VZOA 4W6XA 5JIAA 1FOD1 5CFCB 2CL2A 3K4AA 3FHAA 4Y20A 1D2QA 4I3PA 3WP4A 1CD3G 1XC6A 3BU0A 3H8OA 4JGZB 2YYOA 5FP9A 3WG1A 3R4UA 3RMYA 2C6SA 1V9U3 2XJTA 4NWWA 2VG9A 4CCCA 5A3UA 4AGGA 5L9BA 1S2BA 4XQWA 3TN93 3S57A 2GALA 2XPJA 4LPLA 5C8CA 4A41A 1N1VA 3ZFGA 1RUC2 2DCZA 4JKKA 5L9VA 1RUOA 2I74A 4XUQA 1LOAA 4AZZA 1UX7A 2BPA2 2R062 1ASJ1 2RVAA 1RUD2 2Z69A 2ATFA 2A6ZA 4LBOA 1W6MA 3DXUA 2LUWA 1YWKA 4KBZA 5C8WA 3NV1A 1BCXA 4MSVA 5FZ9A 1GICA 3VZJA 4GH4B 1SLIA 2VBPA 1VB2A 2QTWB 1US3A 4D94A 2XXZA 1QOOA 5FJKA 5A7WA 4AI2A 3ITQA 1L7QA 1LCLA 1V0AA 2OYZA 1QXRA 2E7AA 4LMFA 3VHNA 1UNBA 1QJEA 1ULGA 3VBOB 2ZBJA 4DEVA 2WZR3 1C3HA 3WW3A 1GP4A 4CPBA 2WR9A 3O1TA 1O59A 4GKXA 4E2SA 2BOJA 3W5MA 1YCIA 5FZHA 3WNNA 3BIEA 3T08A 3VB9A 5FYIA 2ET7A 2Y6LA 2VMIA 4OLLA 1UZYA 2GP5A 2TNFA 3P6BA 4RS5C 2XJUA 3BTAA 3C7FA 4WM7B 4AR2A 4AYUA 2AC1A 5JR7B 4MXWA 4XTMA 3Q8CA 1STMA 3CZJA 2D97A 2XUEA 3LGRA 4CEYB 2RDNA 5BNQA 5FV3A 1RYYA 2GC1A 5FZIA 1ZBA1 4A7KA 1RVF2 5I8YA 1P8JA 3FC0A 1RUJ3 1BBT2 5ABJB 3AFGA 4YW2A 2XBO1 3OEAA 1V6MA 2XWJB 4Q4W3 1QJX1 1K42A 5J98B 1H1AA 3H42B 4BJ0A 1GQPA 2BV4A 2W91A 4IDZA 2EIEA 2UY8A 2ORXA 1UY0A 4MGZE 3VV1A 3A23A 2WFF2 4CCNA 3GGLA 2YBKA 2X5IA 5EJ3A 2RMU3 1YQ2A 3WHUA 2VW0A 5FZLA 3W20A 2CU5A 4KQ7A 4DMIA 1W9YA 1WGPA 5FPAA 2GC3A 4JQTA 5F5QA 3IWZA 4YNIA 4WZCA 2RM23 1AR92 2YMZA 4CP2A 2VGDA 4ONUA 1PK6A 5F6KA 4NIIA 1GR3A 2J1RA 3LEKA 1S0DA 2DDUA 2VMHA 1GZ9A 1OH3A 4ISRA 3H8XA 3A0NA 1R1ZA 2RJKA 2EXIA 3LF7A 4LO5B 5LRRA 3THCA 4UFMA 4IV1A 3CL1A 2ZAAA 4IERA 2R1DA 2Y38A 1LHWA 1KS4A 2W87A 3LWCA 3DXTA 4FOWA 5FZOB 2Y33A 4UW5A 3OSDA 4F7ZA 2W1UA 5AVPA 1YI9A 4IEOA 2A6WA 5BNOB 4JRAA 1SLAA 1OLQA 1R092 1H2KA 2O1QA 4R9DA 1TME2 3QH6A 3B00A 5JOYA 2YY1A 1IS6A 2UWAA 3EMRA 1GQHA 1WW7A 3H1YA 1YNAA 4NHKA 3WSOA 5J36A 4FBFA 4CP9A 2EAAA 1ND2A 1CAWB 1FMD1 4Y1VA 4XPVA 1SLTA 5BUVA 3V65A 3VBUB 4DQAA 4XFFA 2WDBA 5EPAA 2YC2A 1J84A 1BVVA 2WNUC 4Q26A 5JZGB 2XMLA 1S0EA 4AQTA 1LECA 4NR1A 4OUMA 3ZXFA 1C57A 1AXYA 1N3QA 4P9WA 5DUVA 5FMDA 2D98A 4AI9A 1W99A 2YUEA 3TAYA 3USUB 2RS33 4KGGA 3ZYBA 1ACCA 5ACA3 1X50A 3KGZA 1L7LA 2ZHNA 3KGLA 3U10A 4JGZC 2PHFA 1A8MA 1DDLA 2WO7A 1W8UA 1Y7BA 1ZZCA 1W8WA 2WWUA 4GZ9A 5EYYA 4Q29A 1UW8A 4FFHA 2VZUA 3IBMA 4W8JA 1SLLA 3HQRA 2WS91 3JB8A 4COYA 2D6OX 1NCRC 4BE3A 3IMNA 1KDKA 1TNFA 2D6KA 3MLKA 3N9QA 1QEXA 1WBLA 1OQEA 2HEYF 2QQLA 1X33A 4YFWA 5EQUA 2VL4A 2QBXA 5F3GA 2YZ4A 4XBNA 3ZXKA 3RZMA 2HWF2 2QQJA 1AJOA 2LRPA 4YW4A 1UWWA 2E9QA 2VOKA 3VDDB 3AJZA 3APBA 3SEPA 1I5PA 1K3IA 5FMOS 1XNDA 2BFUS 4EYUA 1AHSA 1UPSA 1JYCA 4OUSA 1QQP2 3T2PA 5GZGA 3VBRA 1Q8PA 2E51A 1IS4A 3GBWA 3H8UA 1GNYA 1VMHA 1WKYA 3INAA 5LB6A 3VBOC 4F83A 3PVEA 3WW2A 1D7PM 2YFZA 1AX1A 2FD8A 1AR61 2QQUA 3N7LA 1GWKA 4N9IA 1Y3TA 4AWDA 4CCLA 1H9WA 2H6CA 2ET1A 5D8AA 3O5SA 2W08A 5FLJA 1UOGA 5FXXA 4CA9A 3JBG2 1OF3A 5FP4A 3AZYA 1EYBA 5DDJ3 1DP0A 3RYPA 3M7AA 5T5PA 1OVPA 4AGVA 5LCWL 3IPVB 5FZ0A 2EIBA 3POSA 4WM7C 3K4DA 5FXZA 4HVQA 1FNYA 3RJRA 3PTYA 1UOJA 4AE2A 4ARXA 2ZS6B 5AFBA 4CEYC 1W6PB 3K48A 1PIV3 1UX6A 1IHMA 1X8EA 4I0WB 4X6QB 3OD0A 1IGOA 4UW4A 2KR2A 4LHNA 4YGDA 5IWFA 3QD6A 4LHSA 2O8OA 2QQPA 1KFUL 2P3JA 4XJ9A 2HWB3 4Y4RA 1PGL2 2B45X 3RJ2X 4BISA 5ABJC 1G7YA 1XRUA 4A3XA 2HBTA 4H3WA 1R1A2 1GOFA 2RJLA 3CJXA 3E97A 1KXGA 4AVVA 4E4HA 4XF4A 1HRI2 2ARBA 1JZ4A 4XOGA 5FBZA 2WIIB 2OS2A 3AL5A 2JEMA 1BZWA 5IVJA 3H3UA 2JDMA 1JYIA 3MFCA 1DCSA 1V6NA 3POJA 2BWAA 1EPZA 1GNHA 3M3QA 1RUE3 4KMQA 4ZHNA 3OPZA 3OOXA 4GWJA 4BCUA 1FPN1 3DV8A 4D7SA 4L97A 4QD2A 1DZQA 1W9FA 3GM8A 1HRV3 5DPNA 3B01A 2E63A 4K8RB 1AR71 4XMIA 3VZMA 4FTEA 1V9U2 5IAVA 1TMF3 5C71A 2D5FA 3OCPA 2GU9A 2J1UA 1Q8SA 2A3WA 4YW5A 2G4IA 3N4MA 4XZUG 1C1FA 1DGRA 3I2KA 3VUOA 4AVCA 4K3UA 3WDXA 1PGW1 4WVWA 4BWOA 5BNOC 2PFWA 3LDKA 1ZBE1 4J25A 3FJSA 2DUQA 2JKBA 1PNGA 1YYNA 1VBA3 2K9ZA 2PHXA 3POGA 1UKRA 1VBE3 2WNVC 2WZ8A 1W2OA 1AYM3 3DKQA 2VBBA 1DQ1A 1RUH3 4Q4Y3 4R4XA 4AW7A 2XL7A 4C1XA 1AYN1 2ZJCA 4RFRB 3UV9A 5DZGA 4I02A 1H8TB 3FX3A 2WO2A 5GLVA 3M8LA 2QDRA 1O4ZA 4NHLA 2X05A 4BK4A 4CDWC 1NXMA 1IZ3A 2BNNA 5C9AC 3S5QA 4GULA 3O1UA 1XQNA 1NA1B 4O7XA 2WZR2 1ENQA 4KWUA 3RZKA 4EN6B 4IEZA 4AVBA 2WO3A 2JDYA 4OHXA 5GLZA 4AI1A 4NE9A 1DQ6A 5IW0A 3WNKA 5DG1A 4CEWA 1QMJA 2HH9A 3PDQA 1ZRCA 2IXLA 2VZVA 2G9FA 3AFKA 2W95A 1K5MC 1CX4A 3RWKX 1OA3A 2VCCA 4U36A 1JZ3A 1COV2 1O6UA 1UU6A 1M06G 3D8CA 1WZXA 3VKNA 2HWE3 2Y34A 2W0XA 1W6QB 2RS11 3IIIA 1WCUA 4BQ3A 1NYWA 4TLGA 5FUIA 1Q43A 1PO11 4M0HA 2F4PA 4YVSB 1ODMA 4R9AA 5JOWA 1RUJ2 4FPYA 4QQ2A 3I2OA 1NXD1 2A71A 2CWSA 4Q4W2 4QPWA 1H2LA 3MIHA 4ASMB 5T3NA 3LOBA 5CZKA 1KQRA 2GAUA 2JICA 3VDDC 3T2OA 1B35C 5JI9A 5LBEA 1LENA 3HOBA 4YM1A 3KSCA 4DNYA 4DXZA 2HBUA 2VZTA 2QQKA 3DCQA 2ZHLA 4J6GA 4UBGA 4XUNA 2G1MA 2VD7A 3RI9A 1RUI1 2AEZA 2RMU2 1VBD3 3BB6A 4Y5TA 5CAZA 2JD9A 4GJYA 1UU4A 4CE8A 1L7RA 3CLPA 2BERA 3IDCB 2NQYA 3MIEA 1LEMA 4RR3A 3E6CC 3A4UA 1JU3A 1UAIA 1CZTA 3ZLIA 4IEQA 4IL7A 4M3CF 5BY5A 2WZPP 1OLRA 2DCKA 3OGSA 5J37A 5JMCA 1IQAA 1QJY1 1F35A 1RXGA 1AL22 4QB6A 1OF4A 5IATA 2C1FA 1CAUA 4EZ4A 3ZSLA 2W68A 2E7QA 1SDWA 2JENA 3ROUA 5A1LA 3ACHA 1W2AX 3ILFA 5FZEA 1YLLA 2D6PA 2R0HA 2XGXA 3MV01 3MZHA 3OYWB 3MUY1 4HBNA 1LU2A 4MG2A 4COWA 3MIGA 3WT3A 3ZFEC 1NKGA 4RHV3 2BQPA 4NMIA 1MS4A 2WT1A 1HB2A 2RDSA 4M01A 4AG4A 2ZTNA 3HN1A 4RGGA 4XCAA 5DMYA 1PZ7A 2W1WA 3TNPB 2P5BA 3QACA 3T1MA 5JPNB 4B29A 4GAZA 1QJU3 3KVAA 4CCOA 2VVDA 2A6VA 2WLPA 1RUF3 1K5JA 3M3EA 2A6YA 4FCAA 4QKDA 4URTA 4QGMA 4B4QA 4CDXB 1RUC1 1XSQA 4MGKE 4BQXA 1R081 1MZFA 5FZMA 1Z7S3 4W50A 1K12A 4XDOA 2R061 3DYMA 4DPNA 3JQXA 3NNGA 2XOMA 5FQ0B 4N7IA 5FP3A 1LNSA 2YC4A 2ZGUA 3LA3A 3CEWA 4PDWC 4W4ZA 1E57A 1X8MA 2AACA 1J1TA 5ACA2 5FO9B 5FYTA 2CNAA 1JN2P 2PLV3 5LBBA 4JGYB 1NE6A 5FPZA 3R4SA 5ANNA 3URFA 1S4CA 2XKPA 2JE8A 5E1RA 3ZYHA 4R9BA 1S2EA 4HSJA 4LO8A 4UF0B 3ZYJB 5JOXA 3M2MA 1GNZA 3NL1A 2ZKNA 2VVFA 4QX3A 4PQ9A 5BPXA 5FZ8A 3E1F1 3PHMA 5A6XA 1NCQB 1OH4A 2W52A 2XL9A 3NVCA 4A6SA 3WNPA 2CDPA 3O14A 3NJVA 1EV13 1WCSA 3N9NA 2AH2A 5I0RA 4FPEA 3QH7A 3ZFGB 1DGWX 5A3PA 2VCBA 2X09A 3CJIC 5D21A 1H8TC 3ZXJA 5FZ4A 2WNEA 3AYDA 1OUSA 5FY8A 2WKKA 5HCHA 2YBSA 1JYTA 2PAMA 4W6YA 3RFRA 3WQ1A 5IHRA 2SLIA 1LGNA 5FZ3A 3HWJA 1LHOA 1QJFA 3KCYA 4META 4ZU5A 2GDFA 2H6BA 4XJAA 3WP3A 1BBT1 4LULA 1HQWA 3WQ7A 2WWSA 4NPLA 3EB7A 2I45A 3UKNA 4KU8A 2Q0AA 2ZGQA 4HN0A 4A44A 2WFF1 5A3NA 4RGAA 4RGKA 4KWKA 5DDJ2 3AMHA 5FPUA 2D6NA 3EO6A 1JOBA 1UMHA 1OBNA 1PZ9A 3DEMA 3AVRA 4N8MA 4XFBA 5LA0A 3GHNA 4Y24A 1HJFA 2ARXA 2QQMA 4Q4V1 3WEZA 1GANA 1R083 1UU5A 3AZVA 3HNYM 5DAXA 4GMP0 4YVSC 4DB5A 2HWB2 5L19A 3ZR6A 4FFFA 1GLHA 1OD3A 3OTFA 3U07A 4WV8A 3OB8A 4A6OA 2Y6KA 4G4FA 3JD73 3UYJA 3S7IA 3KT1A 3SITA 5C7GA 1GV9A 3HAGA 2YGMA 4QXKA 1HN0A 4XQ4A 4QPGA 2PELA 1GZTA 4XHXA 4BYYA 4DINB 4XF9A 2VXJA 4H7LA 4D3WA 4AHWA 1MS9A 1C8M3 4DFSA 3SCFA 1R091 1IPSA 1QGLA 3BTXA 4BDVB 1TME1 4YZ4A 2OXBA 1LOCA 3AZZA 3OGRA 1RUE2 5FZ6A 4FXKB 1ULPA 2UU8A 3BN6A 2PAEA 4ES8A 4XJZA 4ZXEA 3O1SA 3N9OA 5FLIA 3RG0A 3PUAA 4ZXKA 1TMF2 5FUNA 5H9RA 5FY7A 4MZUA 1UY2A 5T5LA 3AXEA 3EJKA 1JOPA 5FZKA 4YVWA 1F15A 3KQRA 4LO6B 4N53B 3K4ZA 2OX0A 4Y4YA 2I07B 1MPXA 1UXZA 3WD5A 4JRLA 1REFA 1FAYA 3I8TA 4Q0VA 4SLIA 2VW2A 1AL0G 1QHDA 1VBE2 5KWRA 4DO0A 1AYM2 5I0TA 1FYUA 1RUH2 4Q4Y2 3RQ0A 2VOWA 4IEXA 5B2GB 3R05A 2L9LA 3LSEA 1NY72 2PHLA 2VNRA 4GIQA 4OHVA 4CDXC 3H3LA 3HT1A 2XG3A 5C4WB 5IK5A 3LIHA 1Y9MA 4EROA 2CSGA 3BTZA 2FBEA 3S30A 2R073 2ZZQA 2ZEZA 2YB7A 5HCFA 3VBFC 4QKFA 4CP9B 4P9JA 1BEV3 1JW6A 2WSUA 1S1AA 2V09A 1WA6X 1BJQA 4UOJA 1J3PA 3KVBA 3A0KA 4PLNA 5FYZA 4JGYC 4C8DA 4GQ7A 4D6RA 3GCWA 4ZPIA 3OF1A 1KDMA 3CU7A 1H1MA 5E6HA 4B4PA 1LOEA 1QIQA 2ENRA 4B4RA 1DHKB 1IS3A 2HWE2 1AZDA 1GYKA 4LKEA 4NAOA 5A33A 5J48A 1KS5A 5EXOA 4CXXA 4OHWA 1RUG2 1JYWA 1VBC1 2VNVA 5FIXA 3M3OA 2C0ZA 3B9IA 4QDSA 1KJLA 3JBG1 2ZAHA 4LUMA 3N35A 2PTMA 2HEWF 1A3KA 1JUIA 2OZJA 3VLBB 3HVDA 4EN8B 2FDKA 3N7KA 4CXYA 5F37A 3ZFGC 5F9TA 2OQ7A 3HEIA 4E2GA 5F7UA 2DVAA 2WZEA 3I49A 3MF9A 4A7ZA 4IXLA 4AFCA 4P14A 5CADA 4IE7A 3POBA 3WF2A 2IXHA 3HNBM 3VBSA 1D4M1 1AXZA 4W6WA 1U0AA 3B94A 4QPIB 1R1A1 1ULEA 3KF3A 2RE9A 2XDVA 3E5QA 4MGQA 1W0NA 1B09A 3ZXDA 3N9PA 2D7FA 3T09A 1US2A 2FMDA 2R042 4GB33 4ZU7A 3DN7A 4OUEA 5A32B 1WLDA 3DL3A 1LAJA 4GMP1 2B4KA 4IE4A 1AX2A 5FWJA 2Y8KA 4NHXA 4YGCA 5FOJB 4TXWA 2I2SA 1AUYA 2W39A 4OZXA 1YXWA 1EAH2 2B42B 4C91A 1VRH1 2WABA 3ZPYA 5A3TA 3IT8A 2A1XA 5CFDA 1QWRA 4RHV2 1YO8A 3RVHA 1LB2A 4MV2A 3S7EA 5KHGA 3DPRA 1PZ8A 3MYXA 4MO3M 3DUIA 1QXJA 4GD4A 4AEJA 1DQ0A 1W06A 1W0OA 1X82A 4RFT0 2YC0A 5GLUA 4FPFA 1RUF2 1CJDA 5FZDA 2FDFA 4MHUA 1AR82 2BBVA 2EXJA 2BVVA 1OA2A 1OI6A 2VM9A 3I59B 3WVJA 5KXDA 1N3PA 2UYAA 4XTPA 1VR3A 4HFSA 2Q4SA 2F6BA 2JWPA 2PHWA 4YG0A 5CEHA 1WWYA 2BW8A 2V4AA 4PF1A 3W59A 2BTVC 2P6HA 1IG3A 5K0UB 3NKGA 4MLOA 3TYJA 1XE7A 5A7PA 1WBFA 4A2UA 5JSRA 2XR4A 1UD1A 5KHHA 1OFSA 3BOPA 3O7OA 1J3RA 4ORFA 2ZGRA 2WSVA 1SBFA 2AENA 3CF6E 2O14A 4RQPA 4IGQA 4FTSA 4M3CA 1WLCA 5A1FA 1LHVA 5JXJA 1LOFC 1C28A 1UCXA 1W6NA 2WUHA 4JZRA 3MGUA 1V6LA 2UWCA 5DUUA 3LA7A 1UYZA 3I2JA 4N53C 3CZUA 2BU9A 1HN1A 2AZ5A 1WLWA 1TEIA 2E33A 2JG8B 3THPA 2DUPA 1SCRA 3BYWA 4LOSA 4HSLA 1ZRDA 4IV3A 3PU3A 1D4M3 3CO2A 3TEYA 3VKOA 1WW6A 2A73B 2Y6HA 2OA2A 4LE3A 1COV1 3ON7A 1PVC2 4AXOA 1OKOA 3MIFA 5C4WC 3UNPA 4DUVA 2QNKA 5KBFA 2Y6GA 3OY8B 3CQOA 3SXWA 2J7MA 4JCKA 3ZXLA 1F2NA 4JKMA 4X6RB 5FAXA 1NCRB 3B3QE 4UBHA 3WP6A 3H1MA 4EN7B 2ZEWA 4HKLA 4GALA 4AEKA 1VAKA 3ECQA 2YPJA 1JTZX 5T50A 5FMCA 2A6XA 3GBGA 1OSGA 3BVCA 3WHTA 3KV6A 3ZYFA 4QM9A 3U78A 1C5IA 3TWIA 2RR13 2PA7A 1DBNA 1V70A 5ANQA 5FP7A 3ZN6B 1Q8OA 1UY1A 3VHOA 2D6LX 1S0CA 4O9GA 2LTNA 2W47A 4HONA 4LKDA 3BIWE 3ST7A 4GWNA 4Q8LA 2XWBB 3LDBA 1HJGA 3KT7A 1G8WA 3FHIB 1FT9A 1NE4A 3OG2A 1H4HA 3GZEA 4XAEA 5JSOA 5KC5A 2Y6JA 3ZYRA 1UOFA 4AEMA 1EPWA 3PURA 3PUIA 1MEC1 2WRAA 1AL21 2HWC3 3KWVA 2V4VA 1L3JA 4S2DA 2MEV1 5FXVA 4JTNA 3JD72 5CYYA 4L2NA 3W5NA 1UIJA 5HXMA 2C9AA 3U11A 5DG2A 4YARA 4CPBD 2VBDA 5GM0A 4B7EA 2VMDA 1KITA 2A75A 2VCAA 1UYXA 3N7JA 4QPIC 2JKXA 3MLJA 5BNNA 1REDA 3WCRA 2RS51 3N7MA 5G04L 1VJ2A 1GZWB 2XVGA 3VBHA 2WN3A 4F3JA 1JMUB 5T5OA 1FOD3 3ZFFB 4XIOA 5GZCA 2NMNA 2G19A 2NYYA 4Q1PA 2OPKA 3VBRC 3CDZB 1F5JA 3WQBA 1OKQA 1RMU2 2IVIB 1RL3A 1J58A 1S55A 1SG3A 5I8TA 1Y43B 2BNOA 4LBNA 3C7EA 4FPHA 2XKOA 5J09A 3V0AB 3M1HA 3NV2A 1OD5A 4XZPA 4IE0A 4I01A 1I3HA 5DZFA 3J9SA 5FMBA 5D1IA 5FP8A 3TEXA 2ZX0A 1SHWB 3WNOA 4HKOA 3RZLA 4LORA 4Q4X1 4XUOA 3WF4A 5A6YA 4Q2FA 1CAUB 2IZWA 4U2AA 5A3LA 4NO4A 1ASJ3 1QY4A 4E4DX 1O3SA 1OLMA 1DIWA 1POQA 3BCWA 4Y1UA 2D3RA 1HXS2 4ISQA 5FYCA 5T52A 3CKHA 5KHIA 2OKXA 4KI5M 4PF5A 4CU8A 3BU7A 4Y1XA 4I3GA 3OBTA 3Q9OA 2ID4A 4HK9A 1UL9A 2R072 2WO1A 3SH3A 5CKNA 5JWPA 3O12A 3OBZA 4XXPA 4TLFA 5K0UC 1OPMA 2V73A 5FUPA 1BEV2 3GYDA 4N43A 1ZRRA 3K77A 4HMZA 2H0VA 2Q1MA 3LSDA 2JDHA 4QDQA 1W03A 2WNVB 5FJHA 5EZWA 5I0SA 5FXWA 1O8PA 2QZ2A 1RHI2 1UYYA 3T0AA 1FV2A 1IQDC 2VO5A 4XJWA 3WR0A 4AQSA 4CDWB 4Z1VA 3LOIA 3FWEA 3IDAA 4FT8A 4PBOA 4FQ4A 1IPKA 3OUIA 5C9AB 3GF6A 2VTXJ 1WCDJ 1SBEA 2JG8C 1NLSA 2XONA 3PVBB 3U75A 3TBDA 3NAPB 4B3NA 1GWMA 3AX4A 1ZBA3 3SQOA 1Q8VA 4AVAA 4OHYA 4TYSA 2C26A 2XJRA 4Y1YA 4AI3A 1ST8A 5FPBA 1VMFA 1ZZBA 1H6YA 1K5MB 1OURA 2XBO3 4LKFA 1QJX3 3NNFA 3I7DA 3IDBB 1UIKA 4CUCA 2Y60A 5H9SA 2ES3A 2P4EA 1PO21 3PVOA 4AHXA 1JZ5A 4OI0A 3MW4A 2QVSB 3GDBA 2IUWA 3Q8BA 5FFOC 1W39A 2CV6A 1WUVA 3RWNA 4MGSA 2WC2A 4YM0A 4AEDA 5L7OB 1C4RA 3K46A 2BBAA 3MDPA 3I97A 3PIJA 4GB32 4K20A 4WVMB 1A78A 4XDQA 5E8AA 2BEOA 2IXCA 5KXCA 3JUUA 1B35B 4YYOA 1W6OA 4EN0A 2GC0A 1ND3B 2JDNA 5GLWA 3ZMNA 3V0BB 5A1AA 2N7GA 2VUCA 3AZXA 1HB3A 4X8NA 5GZDA 2ZABA 4CDUA 2D93A 3AKSA 1T2XA 3FUOA 5CNAA 3ZN5A 3O1VA 3POYA 3NNLA 4H14A 4RS5A 2DU0A 3ZM8A 2VMEA 3KM5A 2YROA 3TEZA 2K2SA 4X8PA 4A45A 4XUTA 2W94A 3LB9A 4P02B 4CCKA 2CY6A 1Y4WA 2VQUA 1CX1A 1OLME 3BODA 4QHBA 4UYBA 3WNLA 4KU7A 2XJQA 3RGBA 4Y22B 5KXBA 3VGIA 4CRQA 4QWNA 3PLQA 1FMD3 1FI2A 2PHUA 4FP3A 2ZX2A 4Y5SA 1GWLA 1H30A 4NIGA 2VY0A 4H55A 4QKNA 4ITCA 1IOAA 2B46X 3ZFEB 2WJSA 4PI0A 2XQXA 3V56A 4YFZA 2E7TA 3H9AA 3ZFFC 4WVVA 1NY71 4NRPA 1LGBA 4OI2A 2FQPA 4PI2A 2GN3A 4MGYE 1JZ6A 3L2HA 3PU8A 3MV11 2WT0A 2D3SA 1U5IA 5EHDA 5C3RA 3M4FA 3VZLA 3C2UA 3HIFA 4BOWA 3R4DB 5IJRA 1HB4A 1E5HA 1JUHA 2WS93 3VZNA 1MQTB 2ZX1A 4MXVA 3T1LA 1NOVA 4WZFA 4PDWB 4OFGA 1X7NA 4OYUA 5JLVA 1YIPA 3RZZA 2W9XA 1CAXA 4YVWB 1FV3A 4LO7A 1JI6A 3VDAA 2EICA 1XYPA 4COUA 4Q0SA 4P9IA 2VMFA 4CP0A 3TN92 3G6JB 4XETA 1RUG1 2DU1A 5CG9A 1ENSA 2ADEA 1XXNA 3RYKA 3J8F1 4IQPA 5C3SA 2ZX3A 2IXIA 1MZ5A 2VUAA 1GOGA 4NROA 3C7HA 2WYFA 3DYOA 4HXCA 2WNUA 4IW3A 3VD3A 2RR12 3VDCA 5T55A 3MO4A 1AR63 1ZX5A 2AYHA 3AYCA 4QQHA 3LFIA 1ZZ9A 4XBLA 5CFCA 4XF0A 5IVBA 3CJIB 4LBQA 3P5BA 5IVVA 3SNMA 3AB0A 2LS6A 1W8OA 2RDRA 4ARYA 1S0GA 4I09A 1JHJA 1J3QA 2E53A 2YU1A 4JGZA 5L36A 5E89A 1C5HA 4ZS2A 4ZU4A 2JDZA 2KD7A 4EV0A 4RL7A 4IEUA 2R041 1HV1A 1QF3A 3I54A 3NAPC 3WF1A 4H7MA 4XURA 4A3ZA 3KCXA 4IEYA 2UWBA 1HQNA 4AGRA 3BALA 3AC0A 1NQDA 2C24A 3FFQA 4QHZA 2DTWA 5C5TA 2R49A 4CUBA 2IXKA 1W04A 3IAPA 4FSJA 1GU3A 3MPBA 4UAPA 1HB1A 1ZA4A 1EAH1 2IVJA 3BUCA 1EY2A 4NN0A 5FPVA 5JXGA 1JZ8A 2VR4A 5BXXA 1WMXA 2D5HA 2HWD1 1MVEA 5E88A 2QQOA 4FXGB 4OI4A 4GH4A 2BYVE 1O7FA 2ZXQA 4Q5OA 2GP3A 4FVVA 4AQ6A 4BPZA 4DUWA 2F17A 4RA0A 4XFGA 4XXAA 1GQGA 1RUNA 1PNFA 2CGOA 1V6OA 1MACA 2ZMNA 4MHRA 5BNPB 3UGFA 5HV4A 2B9VA 5KXEA 2NPIA 5LEJA 4D0QA 2CGPA 3VBOA 5EJZB 3ZOIA 2YBPA 4O9EA 1QNWA 4UFKA 5A3MA 1FPN3 1ND3C 2XB6C 3ZKUA 2OPWA 4URAA 5JIUA 1AR73 3H3ZA 2EF6A 4CDQB 1NQJA 2Y26A 2ZGLA 4HZFA 5DAPA 4LTAA 4HL0A 2D43A 4L92A 1GMMA 4D6SA 2FZ2A 3ZIWA 5AC91 2RM22 5L7OC 2P37A 4B8EA 4N9HA 4WM7A 3J7NA 3O1RA 1VBB1 1ASJ2 2QQNA 2VOXA 2IXJA 2VOTA 1QNYA 1YQ6A 1ZBE3 4QXHA 2E26A 3H50A 1E5IA 2EXHA 1O4TA 1WCQA 5IVYA 2ZHMA 4E4SA 1F8VA 3LEIA 4NWVA 5ABJA 1AYN3 3FLPA 3JQWA 2AGSA 3LE0A 1BK1A 3HBKA 3OUJA 3ZXAC 4XBQA 2JE7A 1G9DA 3DPRB 5A7OA 3NV3A 4I0BA 3WG3A 1CR7A 1HX6A 4IE5A 2F4LA 4YW6A 4FFGA 4OMDA 3F95A 2CTVA 4CSWA 4KGQA 1D4VB 1PVC1 4D69A 4IEPA 1PGSA 1LGCA 3IAQA 4M0NA 1YFUA 2YDEA 3D3AA 4RYDA 1JOJA 2BUKA 1UO9A 2WA4A 5DABA 3E6DA 3JCIA 4OI1A 4AOCA 4EWAA 5GKAC 4AL9A 4CU7A 4BB3A 1RUD1 2SBAA 3MICA 4CCDA 4HLTA 1SBDA 3SKVA 3VBFB 4D8MA 4YZ5A 1MQTC 2RS13 5FZ1A 3WDWA 2RS32 4NOTA 5CA6A 4Z07A 2VTFA 1PO13 2D6MA 3PMSA 2OZ6A 3Q8AA 4H2AA 3ZR5A 4XQDA 5FZOA 4XJUA 1DQ4A 4YM2A 1FNZA 4YVWC 1CAVA 1JH5A 4LITA 5DAVA 5APAA 1QU0A 2ZCWA 5BNOA 3ATGA 1QJX2 1OQ1A 1RIRA 3O0XA 2DVDA 3I2DA 5FYMA 3ILRA 4Y20B 1SCSA 5FDBA 2R7EB 3WXPA 4LK6A 2ZEYA 2FCUA 1CAWA 4BQWA 3F2ZA 4FP2A 2WN2A 2FHRA 5HPOA 1RUI3 2DCTA 2ZGTA 5LATA 3VBUA 4FOYA 1QDOA 5DUXA 4QPYA 2JB8A 5FTTC 4BMEA 5JZGA 3VZOA 2NP0A 2CDOA 4AI0A 5C8CB 2ADDA 5LBCA 4BQ1A 3ABZA 1D0HA 3GJAA 1DGRN 1SPPA 1AXKA 4B1MA 3HD8B 4GWMA 3USUA 1GZCA 5CBLA 1G9BA 4QGNA 3IIAA 3RI8A 4K1YA 1TZOA 1POV0 2QQVA 1QJY3 3VZKA 1RVF1 3P1IA 1W6MB 2VC9A 2EAKA 4LOTA 1SDDB 1XE0A 2MPFA 1URXA 2ZMKA 3WDYA 4BZ4A 1Q8QA 1S0IA 1ONAA 1PM4A 1BXHA 1CN1A 3AP9A 2VQTA 3KV4A 2BRTA 2ZKLA 4Z2WA 4GJZA 3N9LA 5D2AA 2J1AA 5DN2A 5FKCA 3OGVA 1RMU1 4UFJA 5A7WB 2XH6A 1WW5A 4CCJA 5H9QA 5A7NA 3ZSMA 4NRQA 3THTA 1MS1A 1N47A 2VXRA 3D0SA 2P3YA 1ENRA 3L9JT 5I91A 3K3NA 2DCYA 2VUDA 2XQRA 2GZWA 1VRBA 4FPJA 5FPXA 1QDCA 2XJSA 1FMD2 1PHMA 2GMPA 3UKTA 3U0ZA 1PIV2 1AR91 2ARAA 4OULA 3USSA 1ULOA 1RUC3 2MNGA 3ZXEA 1W3VA 3MF6A 3LEMA 4QKBA 3T0BA 4CYDA 1WMFA 2R063 2JX9A 3N9MA 5IVCA 1IKQA 3NV4A 2JDKA 2WQ8A 4BMBA 4UT5A 5BNPC 1WW4A 4MXWB 1EP0A 1OC1A 1HXS1 4K9SA 4ATEA 2WQZC 3U4SA 3GNEA 3VD4A 3P3NA 3AMNA 4TSVA 4BM8A 3E5UA 3H0OA 4HG6B 5I8SA 4CDQC 5E16A 4QMAA 3U1XA 1UZVA 2DTYA 1MS5A 4N7UA 2J1SA 4W65A 1CONA 1WCKA 3PJQA 3IPVA 3P3PA 2FCTA 3SISA 1RHI1 2PHTA 3MEPA 1W6PA 2X5IB 4WM8A 2Z2SB 4PQQA 1QH6A 1HRV2 3POWA 3WLUA 2W1SA 4COZA 2Y6FA 2ZGSA 2Q1ZB 3OUHA 1MS0A 1LESA 5EWSA 4LO4B 4KL1A 1XNTA 2XVKA 3AL6A 4CU9A 4ZZ5A 1PK6B 3DPRC 3M3CA 1A6CA 2NLRA 4NJ4A 4FPGA 4MGTA 2D44A 4PT6A 3UT0A 3WNXA 4XILA 1ZREA 4XJ8A 4NIDA 3NSTA 1YHFA 4IV1B 1Q56A 1VBA2 3ZN4A 1BBT3 2KM2A 4ZS3A 3AKRA 2DBNA 3LEGA 5GJ6A 3UGHA 3AM2A 1Y9QA 1M4WA 4Y33A 2WFF3 4XIKA 2YPDA 3ZPOA 4ASLA 3JZVA 2PQQA 4E4ZA 1ENXA 5BV6A 1NZIA 2BVBA 3NJYA 2WAOA 3NO8A 1H6XA 4A42A 2XHKA 1LTEA 4SBVA 4E2QA 2HWF1 1ND2B 4YZ2A 1DG6A 2VNGA 2G9ZA 4Q4V3 1LKNA 3ZDSA 2ZPXA 3ETQA 2JXAA 1XYOA 2FDIA 3W21A 2PN5A 4K8FA 4K1ZA 4XC9A 1F4AA 1QQP1 1RGSA 5LY1A 4WVZA 2W5FA 2W3JA 2GNBA 1BQPA 3E5XA 5FZAA 5I0DA 5AVAA 2P3IA 3VD9A 3ASIA 2ZZJA 4XFIA 4LR4A 5JXIA 3HT2A 1H8TA 5J1XA 3GJBA 3LD8A 3CHXA 3FBYA 3GALA 1POV1 1R093 1XYNA 1TME3 4IGOA 5I0UA 2R6QA 4A7YA 5C8CC 3N36A 4ZKTB 3IDEA 1NA1A 2OVUA 2TUNA 4QX0A 1UMIA 1OXCA 1AF9A 3G7DA 1JU4A 3E6BA 4BK5A 4QB2A 4MADA 1JXNA 2NM1A 2EVXA 5A6QA 2R32A 1VBD2 3GZUC 3LKJA 1PGL1 5GALA 3FMGA 3PNAA 1DFQA 1WD3A 4NPRA 3I2GA 4FI9A 1WA4A 3AVSA 1ULCA 4YWAA 4PHZA 3VN4A 4DXTA 3KHBA 4YGEA 2Z5WA 1W8NA 2AREA 2W2IA 2VPVA 1KEXA 1PGW2 1HRI1 5FZFA 4Z92B 4HOOA 3TNQA 2WL1A 3VBRB 4Q0PA 4C0HA 3HQXA 2LM3A 2GN7A 2XJVA 1SEFA 1XPWA 2Y64A 4YVSA 2VW1A 3EYPA 5LA9A 2VJXA 1I9RA 1JBCA 2VU9A 1H2MA 2BWCA 2Q8OA 3ZKYA 4AHYA 5D8AB 3UETA 1BVP1 1UF2C 2HJIA 4I0AA 1QXPA 5CIRA 3MHZA 5A7QA 3I3QA 2TBVA 4HANA 5FRAA 5KR7A 3NNMA 3RZHA 3LPFA 2DWRA 1MZEA 2VQ0A 1D0GA 3OGGA 2VZ3A 2P34A 2K0GA 5HCBA 4BHPA 1V9U1 2VULA 1YC61 3AP5A 3WUCA 5FYYA 1QJU2 3OEBA 3TN91 1BKZA 1ZVFA 5IAXA 3NJZA 5BNNC 5LZ6A 1U12A 4AQ2A 1R64A 5EP9A 1Z7S2 1IG0A 4L8QA 3T2TA 4E8DA 1Z0HA 2ZGOA 1FATA 4XF3A 1W9TA 2RS12 3SHRA 1RITA 2DF7A 1G6NA 1H4GA 1N3OA 3BOWA 3WUDA 3O1OA 5HCAA 4PCRA 1PO12 1SFPA 4DY5A 1VBC3 2X5IC 2PLV2 3KT4A 5EJ1B 1J1LA 4LE4A 3OYWA 1C1LA 5GZFA 1LOBA 3JBG3 1W8FA 2P2KA 1CZVA 3PL0A 1XNKA 1WMEA 5GLTA 3LIGA 3W58A 2ARCA 4CVUA 5CISA 4LHLA 5A3WA 2WZR1 4AVSA 5C5UA 1PK6C 1NT0A 2ZOEB 3JXSA 5C70A 1DZRA 1Q5OA 1DU3D 1JYXA 1LU1A 1H2NA 4KWLA 3T0DA 4MYEA 3QBQA 3ZMOA 3A21A 4IV1C 1EV12 2JECA 3MIDA 4E9KA 3VD7A 1R1A3 1X36A 1SMVA 1MS3A 3ZSJA 1JHNA 3FE5A 4HN1A 2GC2A 1Q3EA 1DQ5A 3WOGA 4N43C 1H8VA 3I4IA 3ACGA 2CGNA 1QJY2 4GMP3 3I3EA 1JYNA 4YZ1A 3FHQA 4JGYA 4AHZA 1OOPA 1RUJ1 3I2FA 3BKZA 1ND2C 4Q4W1 3N3HA 1S0BA 4CTEA 4UF0A 3AP4A 4LBQB 1VRH3 2VZ1A 1W9SA 3TEWA 2BJSA 3DECA 3PVNA 4D6QA 1NCQA 1UZ0A 2EALA 4FOQA 4K21A 5FZ7A 1S0FA 1DYPA 4QGLA 3I3MA 3IKWA 2Y0OA 4QAWA 2RMU1 3VHPA 4PIYA 2GNMA 2UYBA 1BMV2 1DGLA 4EQVA 3AMPA 4CCMA 5IK8A 2RM21 4CEWB 2P17A 3WW1A 5FZGA 4MVTA 3KD4A 1R082 4XFCA 1GUIA 4JAAA 4XABA 5L9RA 4UW6A 3J7HA 2QQWA 4OCTA 4QQLA 4B7KA 2KA3A 5EYXA 5FLHA 3SCGA 1LHUA 1OPOA 5LASA 3U14A 2JG9A 2ZGPA 5FK8A 3AKTA 3K51A 1BLZA 4YPJA 4KWJA 1WD4A 4YW3A 1SFYA 1UPIA 2DVFA 4BXFA 1VP6A 2BGOA 5C6CA 1HDKA 3IMMA 2YV8A 2ZHKA 3RSJA 1W2NA 1CGPA 4AEDC 3B7MA 3T4VA 1C8M2 1OT5A 4Z2AA 1ZRFA 5CVRA 1U5YA 3R6SA 1ZA7A 1W8ZA 5CKMA 3BPZA 1RJ7A 3KMHA 5KC6A 3PUQA 2GSYA 5LK5A 1NAEA 3IB3A 4YLZA 4CDUC 3MI8A 3ES4A 3ZXGA 4IGPA 1V6IA 3KS7A 3S6PA 1W28A 1YIFA 3VDBA 2WBKA 1COV3 4RR3B 4M3CE 4QXBA 2Q8EA 2BGCA 3SLIA 4ZZ8A 2JJ6A 2B7YA 2XVLA 4NIAA 5JCTA 3W9AA 2V5YA 3FZ3A 2WFPA 5D8AC 1TNRA 1LODA 4FQZA 2RS31 3OBRA 5FOBB 4P9GA 1S0JA 5ACA1 4INDA 4XAAA 3RRDA 2DFCA 4LT5A 1REEA 4I30A 1AJKA 5FYSA 5FYBA 2ZX4A 5B4XA 4KBBA 3ZYPA 3ZX7A 1ULDA 5K8SA 2WT2A 4YRDA 2J1TA 1OFNA 1BHGA 4DZGA 4DIQA 3WG4A 2A3YA 1E5SA 3AP7A 4P08A 1N1YA 5F3CA 5FO7B 5DXDA 1NZCA 2V5DA 4P5HA 1G9FA 1W0PA 3POIA 4BH9A 3WDUA 4Q4V2 3U4XA 1LOFA 1HV0A 3CBNA 1LHNA 4N53A 4EWDA 4CU6A 5JI7A 1MEC3 2BGPA 5FZBA 4L99A 5JSPA 1AL23 4GXLA 4XMAA 4KH9A 4EWEA 5LRSA 3DYPA 2MEV3 2VQAA 3ZYIB 1O4YA 2PYTA 2W1QA 4BXSV 1UYPA 2EIDA 1W2UA 5F32A 5F2WA 1CAVB 5SV8A 4PLOA 2CYFA 5CG8A 1LJ7A 2HLEA 1ZRIA 1GBGA 5C4WA 3ENRA 4EZHA 1XNCA 1OHFA 3A22A 3VD5A 4UXAA 5DDJ1 3ZYGA 5J96B 2QZ3A 5DUWA 4DOUA 2RS53 1F4HA 1O3RA 3ELNA 1DZTA 4XDPA 1PIV1 4YGBA 1PX3A 2JDAA 3SCHA 3ZSEA 1X9TA 4QQPA 1ALYA 3J4UH 4IESA 4J1XA 2J1EA 1YJLA 3QLQA 1K45A 1RJ8A 3LA2A 4V2WA 2PHDA 2HWB1 4HPKA 3THDA 1CQ9A 1LEDA
chains in the Genus database with same CATH topology
4QB1A 3OGRA 4DEQA 1ULPA 3BN6A 1UY4A 3ETPA 1EUTA 1XNAA 2VZOA 1GMMA 4ZXEA 5DQ0A 3K4AA 3FHAA 1UY2A 1XC6A 2QQNA 2VOTA 2C4XA 2E26A 3K4ZA 2V72A 3WNMA 1WCQA 1W9WA 1MPXA 1UXZA 3LEIA 3LE0A 4LPLA 4A41A 4JKKA 3C7GA 3HPNA 4XUQA 2L9LA 1UX7A 4XVHA 2RVAA 3C8XA 4OMDA 3FL7A 4QDRA 3K75B 2WYSA 2ZEZA 2YB7A 2J1VA 3IAQA 3D3AA 3LPGA 4RYDA 1US3A 2DCJA 1L7QA 2VZSA 1PMJX 4CU7A 4UOJA 2C9KA 4DEVA 3SKVA 3LQCA 4D8MA 5JR2A 1O59A 2VTFA 3W5MA 3HJRA 3WNNA 3T08A 2W92A 1JYWA 2Y6LA 3BGAA 3P6BA 3C7FA 4QDSA 3CZJA 2R7EB 2XHNA 2ZEYA 1RYYA 3HEIA 3F2ZA 2WN2A 4M4RA 2WZEA 5F7UA 5HPOA 3I2HA 1P8JA 3WF3A 3WF2A 3OEAA 5JUVA 3HNBM 1K42A 2CDOA 3ABZA 4BJ0A 1GQPA 2W91A 4DUXA 2EIEA 4MOAA 2ORXA 1UY0A 3A23A 4MGQA 1W0NA 3GGLA 2LW8A 3T09A 3P1IA 1US2A 2VC9A 1NX9A 1SDDB 1YQ2A 4OUEA 2VQTA 2B4KA 4XUPA 2Y8KA 2J1AA 5DN2A 5G05L 4TXWA 3OGVA 3WF0A 2J1RA 3LEKA 2WABA 2DDUA 3I3BA 3OBAA 3THCA 3HN3A 4MO3M 2W87A 3SKJE 1ULOA 3T2QA 2W1UA 3T0BA 2WQ8A 2VM9A 3WSOA 1PMHX 4PF1A 5IFPA 3VD4A 5IYYA 2WDBA 2QQIA 2YC2A 1J84A 4HG6B 1O8SA 2J1SA 3HNMA 1W99A 3NJXA 5JXJA 2WUHA 1UYZA 4PQQA 2BZDA 3I2JA 3CZUA 1HN1A 2W1SA 2E33A 3ACFA 4GZ9A 2VZUA 4W8JA 2ORZA 1XNTA 4CU9A 4ZZ5A 2Y6HA 1TG7A 2VZQA 2QQLA 4PT6A 4CUAA 2VL4A 3UNPA 1JZ2A 4DUVA 2QBXA 2Y6GA 3CQOA 2J7MA 2QQJA 4JKMA 1UWWA 3LEGA 3SEPA 2ZEWA 1I5PA 1K3IA 3ECQA 3NRUA 3T2PA 4OZOA 1NUKA 2WAOA 1H6XA 4A42A 1GNYA 1WKYA 1UY1A 1D7PM 2YFZA 2HYXA 2W47A 4P5YA 1F4AA 1J83A 1OF3A 3OG2A 1DP0A 4JHZA 2Y6JA 2W5FA 2W3JA 3UESA 5LCWL 3PUIA 2EIBA 5I0DA 3K4DA 3VD9A 4QX2A 4ARXA 2V4VA 5JXIA 5CYYA 4LHSA 5J1XA 3W5NA 2RV9A 5HXMA 3CIHA 2W46A 1GOFA 4JKLA 4JX0A 2VMDA 4ZY9A 2VCAA 1UYXA 4QX0A 1UMIA 2JKXA 1JU4A 4BK5A 4QB2A 1JZ4A 4MADA 5G04L 2WN3A 4P00B 2Z4FA 3CDZB 3MUZ1 3WQBA 3I2GA 4FI9A 4RN5A 1SG3A 4KMQA 4DXTA 3C7EA 1W8NA 4GWJA 1TVGA 1KEXA 4LKSA 3GM8A 5DPNA 3WNOA 1XPWA 2Y64A 1SHWB 3EYPA 5IFTA 4QX1A 4XUOA 3WF4A 5C71A 2VJXA 2J1UA 3UETA 4XZUG 2VMCA 3I2KA 3CKHA 3LPFA 2OKXA 4KI5M 4CU8A 2VZ3A 2WZ8A 2ID4A 2WO1A 3OEBA 2WO2A 2X05A 3K77A 4IUGA 1R64A 4BK4A 4QDQA 5JXHA 1O8PA 4E8DA 1UYYA 3T0AA 1IQDC 1UXXX 1W9TA 2VO5A 4KWUA 5LA2A 2WO3A 3IDAA 3WNKA 5EJ1B 4DXSA 4L0PA 4M4PA 2VZVA 4OMCA 2XONA 3C7OA 1CZVA 1EUUA 2W95A 1JZ3A 2VCCA 4CVUA 3IIIA 5C70A 3JXSA 5FUIA 2C26A 2VZRA 1JYXA 1H6YA 3T0DA 3A21A 3PUHA 4CUCA 1JZ5A 3VD7A 4QPWA 5CZKA 3GDBA 3T2OA 4MGSA 3HOBA 2VZTA 2QQKA 3ACGA 4XUNA 3I3EA 3K46A 2BBAA 1JYNA 3I97A 2JD9A 3FHQA 5B4NA 1L7RA 3I2FA 2BERA 4DXRA 1JU3A 5A1AA 1CZTA 2VZ1A 1W9SA 3DECA 1DYOA 1UZ0A 1T2XA 2DCKA 3OGSA 2YFUA 3NQHA 4QAWA 4QB6A 1OF4A 1UY3A 3ZM8A 2VMEA 4A45A 4TTGA 4XUTA 1CIYA 3ACHA 2W94A 4P02B 3MV01 2VQUA 3MUY1 1CX1A 1GUIA 3WNLA 1NKGA 3I2IA 3U37A 2E32A 3J7HA 2X10A 4AG4A 2J22A 3ACIA 5DMYA 2W1WA 3GXUA 4LQRA 4YPJA 2BGOA 2XQXA 4W50A 1K12A 2RJ2A 3DYMA 1OT5A 3NNGA 2XOMA 1JZ6A 4Z2AA 5EIYB 2E31A 3MV11 1LNSA 2YC4A 4W4ZA 2ZEXA 3A7QA 1NAEA 3IB3A 5IJRA 2JE8A 3VDBA 2WBKA 4ZZ8A 1DLCA 4OYUA 4QX3A 2W9XA 3E1F1 4ET7A 1OH4A 3VDAA 1JI6A 1JZ7A 2EICA 3WNPA 2CDPA 3I3DA 2VMFA 3NJVA 1KGYA 3CMGA 5B4XA 2J1TA 2WAAA 1BHGA 2VCBA 2X09A 5LA1A 4E8CA 4UI9L 4A4AA 1GOGA 3C7HA 3DYOA 4P08A 5IHRA 4AAXA 3VD3A 3VDCA 2V5DA 3MO4A 2PQSA 5JMOA 3EB7A 4ARYA 2LS6A 1W8OA 1JHJA 1JYVA 4A44A 4CU6A 2BGPA 2KD7A 3WF1A 3DYPA 4XURA 1UMHA 4A3ZA 5LA0A 2W1QA 1PX4A 2QQMA 4BXSV 3AC0A 3WEZA 2EIDA 2YG0A 4CUBA 3IAPA 3HNYM 1GU3A 2HLEA 4UAPA 4GWIA 5JXGA 3A22A 2VR4A 1JZ8A 3VD5A 1OD3A 3OB8A 2QQOA 4A6OA 2Y6KA 1F4HA 3FN9A 3MBWA 2ZXQA 3SEEA 4DUWA 5C7GA 2VZPA 1GOHA 1PX3A 2JDAA 2J1EA 1K45A 1CZSA 2B9VA 4D0QA 3THDA 5EJZB 4BDVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QB1 A;  3OGR A;  4DEQ A;  1ULP A;  3BN6 A;  1UY4 A;  3ETP A;  1EUT A;  1XNA A;  2VZO A;  1GMM A;  4ZXE A;  5DQ0 A;  3K4A A;  3FHA A;  1UY2 A;  1XC6 A;  2QQN A;  2VOT A;  2C4X A;  2E26 A;  3K4Z A;  2V72 A;  3WNM A;  1WCQ A;  1W9W A;  1MPX A;  1UXZ A;  3LEI A;  3LE0 A;  4LPL A;  4A41 A;  4JKK A;  3C7G A;  3HPN A;  4XUQ A;  2L9L A;  1UX7 A;  4XVH A;  2RVA A;  3C8X A;  4OMD A;  3FL7 A;  4QDR A;  3K75 B;  2WYS A;  2ZEZ A;  2YB7 A;  2J1V A;  3IAQ A;  3D3A A;  3LPG A;  4RYD A;  1US3 A;  2DCJ A;  1L7Q A;  2VZS A;  1PMJ X;  4CU7 A;  4UOJ A;  2C9K A;  4DEV A;  3SKV A;  3LQC A;  4D8M A;  5JR2 A;  1O59 A;  2VTF A;  3W5M A;  3HJR A;  3WNN A;  3T08 A;  2W92 A;  1JYW A;  2Y6L A;  3BGA A;  3P6B A;  3C7F A;  4QDS A;  3CZJ A;  2R7E B;  2XHN A;  2ZEY A;  1RYY A;  3HEI A;  3F2Z A;  2WN2 A;  4M4R A;  2WZE A;  5F7U A;  5HPO A;  3I2H A;  1P8J A;  3WF3 A;  3WF2 A;  3OEA A;  5JUV A;  3HNB M;  1K42 A;  2CDO A;  3ABZ A;  4BJ0 A;  1GQP A;  2W91 A;  4DUX A;  2EIE A;  4MOA A;  2ORX A;  1UY0 A;  3A23 A;  4MGQ A;  1W0N A;  3GGL A;  2LW8 A;  3T09 A;  3P1I A;  1US2 A;  2VC9 A;  1NX9 A;  1SDD B;  1YQ2 A;  4OUE A;  2VQT A;  2B4K A;  4XUP A;  2Y8K A;  2J1A A;  5DN2 A;  5G05 L;  4TXW A;  3OGV A;  3WF0 A;  2J1R A;  3LEK A;  2WAB A;  2DDU A;  3I3B A;  3OBA A;  3THC A;  3HN3 A;  4MO3 M;  2W87 A;  3SKJ E;  1ULO A;  3T2Q A;  2W1U A;  3T0B A;  2WQ8 A;  2VM9 A;  3WSO A;  1PMH X;  4PF1 A;  5IFP A;  3VD4 A;  5IYY A;  2WDB A;  2QQI A;  2YC2 A;  1J84 A;  4HG6 B;  1O8S A;  2J1S A;  3HNM A;  1W99 A;  3NJX A;  5JXJ A;  2WUH A;  1UYZ A;  4PQQ A;  2BZD A;  3I2J A;  3CZU A;  1HN1 A;  2W1S A;  2E33 A;  3ACF A;  4GZ9 A;  2VZU A;  4W8J A;  2ORZ A;  1XNT A;  4CU9 A;  4ZZ5 A;  2Y6H A;  1TG7 A;  2VZQ A;  2QQL A;  4PT6 A;  4CUA A;  2VL4 A;  3UNP A;  1JZ2 A;  4DUV A;  2QBX A;  2Y6G A;  3CQO A;  2J7M A;  2QQJ A;  4JKM A;  1UWW A;  3LEG A;  3SEP A;  2ZEW A;  1I5P A;  1K3I A;  3ECQ A;  3NRU A;  3T2P A;  4OZO A;  1NUK A;  2WAO A;  1H6X A;  4A42 A;  1GNY A;  1WKY A;  1UY1 A;  1D7P M;  2YFZ A;  2HYX A;  2W47 A;  4P5Y A;  1F4A A;  1J83 A;  1OF3 A;  3OG2 A;  1DP0 A;  4JHZ A;  2Y6J A;  2W5F A;  2W3J A;  3UES A;  5LCW L;  3PUI A;  2EIB A;  5I0D A;  3K4D A;  3VD9 A;  4QX2 A;  4ARX A;  2V4V A;  5JXI A;  5CYY A;  4LHS A;  5J1X A;  3W5N A;  2RV9 A;  5HXM A;  3CIH A;  2W46 A;  1GOF A;  4JKL A;  4JX0 A;  2VMD A;  4ZY9 A;  2VCA A;  1UYX A;  4QX0 A;  1UMI A;  2JKX A;  1JU4 A;  4BK5 A;  4QB2 A;  1JZ4 A;  4MAD A;  5G04 L;  2WN3 A;  4P00 B;  2Z4F A;  3CDZ B;  3MUZ 1;  3WQB A;  3I2G A;  4FI9 A;  4RN5 A;  1SG3 A;  4KMQ A;  4DXT A;  3C7E A;  1W8N A;  4GWJ A;  1TVG A;  1KEX A;  4LKS A;  3GM8 A;  5DPN A;  3WNO A;  1XPW A;  2Y64 A;  1SHW B;  3EYP A;  5IFT A;  4QX1 A;  4XUO A;  3WF4 A;  5C71 A;  2VJX A;  2J1U A;  3UET A;  4XZU G;  2VMC A;  3I2K A;  3CKH A;  3LPF A;  2OKX A;  4KI5 M;  4CU8 A;  2VZ3 A;  2WZ8 A;  2ID4 A;  2WO1 A;  3OEB A;  2WO2 A;  2X05 A;  3K77 A;  4IUG A;  1R64 A;  4BK4 A;  4QDQ A;  5JXH A;  1O8P A;  4E8D A;  1UYY A;  3T0A A;  1IQD C;  1UXX X;  1W9T A;  2VO5 A;  4KWU A;  5LA2 A;  2WO3 A;  3IDA A;  3WNK A;  5EJ1 B;  4DXS A;  4L0P A;  4M4P A;  2VZV A;  4OMC A;  2XON A;  3C7O A;  1CZV A;  1EUU A;  2W95 A;  1JZ3 A;  2VCC A;  4CVU A;  3III A;  5C70 A;  3JXS A;  5FUI A;  2C26 A;  2VZR A;  1JYX A;  1H6Y A;  3T0D A;  3A21 A;  3PUH A;  4CUC A;  1JZ5 A;  3VD7 A;  4QPW A;  5CZK A;  3GDB A;  3T2O A;  4MGS A;  3HOB A;  2VZT A;  2QQK A;  3ACG A;  4XUN A;  3I3E A;  3K46 A;  2BBA A;  1JYN A;  3I97 A;  2JD9 A;  3FHQ A;  5B4N A;  1L7R A;  3I2F A;  2BER A;  4DXR A;  1JU3 A;  5A1A A;  1CZT A;  2VZ1 A;  1W9S A;  3DEC A;  1DYO A;  1UZ0 A;  1T2X A;  2DCK A;  3OGS A;  2YFU A;  3NQH A;  4QAW A;  4QB6 A;  1OF4 A;  1UY3 A;  3ZM8 A;  2VME A;  4A45 A;  4TTG A;  4XUT A;  1CIY A;  3ACH A;  2W94 A;  4P02 B;  3MV0 1;  2VQU A;  3MUY 1;  1CX1 A;  1GUI A;  3WNL A;  1NKG A;  3I2I A;  3U37 A;  2E32 A;  3J7H A;  2X10 A;  4AG4 A;  2J22 A;  3ACI A;  5DMY A;  2W1W A;  3GXU A;  4LQR A;  4YPJ A;  2BGO A;  2XQX A;  4W50 A;  1K12 A;  2RJ2 A;  3DYM A;  1OT5 A;  3NNG A;  2XOM A;  1JZ6 A;  4Z2A A;  5EIY B;  2E31 A;  3MV1 1;  1LNS A;  2YC4 A;  4W4Z A;  2ZEX A;  3A7Q A;  1NAE A;  3IB3 A;  5IJR A;  2JE8 A;  3VDB A;  2WBK A;  4ZZ8 A;  1DLC A;  4OYU A;  4QX3 A;  2W9X A;  3E1F 1;  4ET7 A;  1OH4 A;  3VDA A;  1JI6 A;  1JZ7 A;  2EIC A;  3WNP A;  2CDP A;  3I3D A;  2VMF A;  3NJV A;  1KGY A;  3CMG A;  5B4X A;  2J1T A;  2WAA A;  1BHG A;  2VCB A;  2X09 A;  5LA1 A;  4E8C A;  4UI9 L;  4A4A A;  1GOG A;  3C7H A;  3DYO A;  4P08 A;  5IHR A;  4AAX A;  3VD3 A;  3VDC A;  2V5D A;  3MO4 A;  2PQS A;  5JMO A;  3EB7 A;  4ARY A;  2LS6 A;  1W8O A;  1JHJ A;  1JYV A;  4A44 A;  4CU6 A;  2BGP A;  2KD7 A;  3WF1 A;  3DYP A;  4XUR A;  1UMH A;  4A3Z A;  5LA0 A;  2W1Q A;  1PX4 A;  2QQM A;  4BXS V;  3AC0 A;  3WEZ A;  2EID A;  2YG0 A;  4CUB A;  3IAP A;  3HNY M;  1GU3 A;  2HLE A;  4UAP A;  4GWI A;  5JXG A;  3A22 A;  2VR4 A;  1JZ8 A;  3VD5 A;  1OD3 A;  3OB8 A;  2QQO A;  4A6O A;  2Y6K A;  1F4H A;  3FN9 A;  3MBW A;  2ZXQ A;  3SEE A;  4DUW A;  5C7G A;  2VZP A;  1GOH A;  1PX3 A;  2JDA A;  2J1E A;  1K45 A;  1CZS A;  2B9V A;  4D0Q A;  3THD A;  5EJZ B;  4BDV B; 
#chains in the Genus database with same CATH topology
 2XUM A;  1W8T A;  4IEW A;  2AUY A;  2VH9 A;  5FYH A;  5CFC C;  1SPP B;  4UFL A;  1NLQ A;  1ODN A;  5FKB A;  3HBZ A;  2Q30 A;  4DEQ A;  4LUK A;  5EFU A;  3ETP A;  1JS9 A;  1F5F A;  2CHH A;  1DF0 A;  3AMQ A;  1XJA A;  4JTO A;  3J26 N;  2P1B A;  4LA3 A;  4Q4X 3;  3OJB A;  1YUD A;  2EA7 A;  4BIO A;  3QOP A;  5DQ0 A;  1I6X A;  4Z82 A;  3OD4 A;  3T3Y A;  2A70 A;  1W2T A;  1YQ8 A;  1BYH A;  1RB8 G;  1UQX A;  1MS8 A;  3NMB A;  1I1E A;  1Y9G A;  4V1P A;  1RXF A;  4LNV A;  4CEW C;  5I93 A;  1RUE 1;  4P9X A;  4EN9 B;  2C4X A;  2WWJ A;  4M00 A;  5C3Q A;  2V72 A;  3WNM A;  1W9W A;  3PJY A;  5FPL A;  1A8D A;  1HRV 1;  1DLL A;  4L9B A;  1HLC A;  1GKB A;  3D5O A;  3HQU A;  2FZ1 A;  1TMF 1;  3K3O A;  4KNC A;  3C7G A;  3HPN A;  1FXZ A;  4QPI A;  1IS5 A;  4GH4 C;  4XW3 A;  1YFX A;  4XVH A;  3IZO A;  3T4H B;  2R0F A;  4NVP A;  3C8X A;  1GP5 A;  4Q0U A;  3FL7 A;  3AJY A;  4QDR A;  1O5U A;  3OGJ A;  2ZGN A;  1QKQ A;  3K75 B;  2IWG B;  4EJR A;  2WYS A;  4YM3 A;  2OII A;  2D3P A;  3ZSK A;  4COV A;  4DY3 A;  5A32 A;  1VBA 1;  2J1V A;  4UW3 A;  3VKL A;  1VBE 1;  1QH7 A;  1VMJ A;  1W90 A;  1AYM 1;  2HKX A;  2QUO A;  3LPG A;  1RUH 1;  3PME A;  4Q4Y 1;  4YW1 A;  1LUL A;  3RZJ A;  2WIN B;  4QPG B;  3UL2 A;  1GSL A;  1XB9 A;  2DYC A;  1PMJ X;  2DCJ A;  1VBC 2;  2VZS A;  3H7Y A;  2C9K A;  1YRZ A;  3O0W A;  2X29 A;  3LQC A;  2ZGK A;  1F9K A;  5AFE A;  1QJZ A;  2A3X A;  4LA2 A;  4FAG A;  4RR3 C;  2UUR A;  5JR2 A;  5F39 A;  1G86 A;  3HJR A;  4QT6 A;  1AVB A;  4G9S B;  3SMH A;  4AAP A;  1VE0 A;  4IET A;  1U5Z A;  3H8R A;  4WM8 B;  1C8N A;  5DAW A;  4HT1 T;  2YXS A;  2W92 A;  1PO2 3;  3BGA A;  2BDR A;  3I59 A;  1D4M 2;  2DVB A;  3AK0 A;  4G3Y C;  1XSR A;  1W3X A;  1D2S A;  4LEJ A;  5FZC A;  2XHN A;  5K0U A;  1O5L A;  1V00 A;  2HWE 1;  3FBM A;  4M4R A;  5IK7 A;  2P3K A;  4DS0 A;  1KJR A;  3I2H A;  4ES9 A;  3WF3 A;  4IEV A;  3QCW A;  4JHT A;  4V2V A;  4Q8K A;  5JUV A;  3DGT A;  4XYX A;  1RTV A;  1G9C A;  3MW2 A;  4DUX A;  3WDT A;  4MOA A;  2QKD A;  1V6J A;  4NAM A;  1VRH 2;  2LW8 A;  4AI8 A;  5IK4 A;  1NX9 A;  4S2F A;  3JU9 A;  4J1W A;  2AR6 A;  2JG8 A;  5T54 A;  1N1T A;  4Q0Q A;  4XUP A;  2JD4 A;  1VBD 1;  3Q8E A;  4RSU A;  1VPH A;  4GKY A;  5G05 L;  1T6B X;  2JDU A;  2ERF A;  3WF0 A;  1W05 A;  2ZA9 A;  4OVE A;  1GFF 2;  3AMM A;  3KV9 A;  4R8H A;  4XF1 A;  4BA6 A;  4LBJ A;  3I3B A;  3LFM A;  3OBA A;  3ILN A;  3V64 A;  3OY8 A;  1KD7 A;  4LBQ D;  3EHK A;  3HN3 A;  1ZZ7 A;  2HWC 2;  4QX7 A;  4DRR A;  1NCR A;  4K40 A;  5A33 B;  3SKJ E;  2OW4 A;  3ME2 A;  3KLS A;  3NNJ A;  4Y5Z 0;  5F6L B;  1PVX A;  3D6E A;  3SH4 A;  2WLQ A;  3T2Q A;  4IE6 A;  3J7L A;  4HKW A;  4LJH A;  3VBU C;  4KG8 A;  1LOG A;  2A7A A;  5JVV A;  1T6G C;  5FY5 A;  4RHV 1;  5JZG C;  3KQ4 B;  4XAC A;  1PMH X;  2ZAC A;  5H9P A;  1QOT A;  4YG6 A;  3SC7 X;  5IFP A;  4YW7 A;  1TQ5 A;  3UK9 A;  5F5I A;  3GHM A;  5IYY A;  5HBA A;  1QJU 1;  1HQL A;  2TEP A;  4BLJ A;  3MW3 A;  1FOD 2;  2QQI A;  1RUF 1;  2PXJ A;  1MZ6 A;  3BPS A;  5FMO L;  1AR8 1;  2BFU L;  2YHJ A;  3VBS B;  1DQ2 A;  1O8S A;  1TE1 B;  1H9P A;  1VAL A;  5ISL A;  3HNM A;  1Z7S 1;  4P9Y A;  4JDO A;  5CKQ A;  3NJX A;  4C0B A;  3POE A;  2Q8D A;  3FLT A;  1NG0 A;  5C33 A;  1YI7 A;  2FDH A;  1O91 A;  2BZD A;  4NPM A;  3EQE A;  3ZVX A;  3UKV A;  3ACF A;  1RUG 3;  3DKW A;  2PLV 1;  3J8F 3;  2QJV A;  2ORZ A;  4CEY A;  1TG7 A;  2VZQ A;  2DVG A;  1APN A;  3TRS B;  1UKG A;  5LEK A;  3O1M A;  4JQR A;  1CES A;  1ZZ6 A;  3RNS A;  4OQ9 A;  3MLL A;  5HXV A;  3UGG A;  5CFD B;  1AX0 A;  4CUA A;  1GZW A;  2Z42 A;  1JZ2 A;  1ZM1 A;  1PM7 A;  3ZFF A;  2A5Z A;  1PMI A;  4CXW A;  4CP1 A;  3AZW A;  2JDP A;  4AFD A;  1EV1 1;  4R9C A;  5JDB A;  4BQ5 A;  4XHB A;  2OUH A;  4PIZ A;  1VLN A;  2R1B A;  2JIJ A;  3NRU A;  4QPG C;  3V0A A;  5FCC A;  4OZO A;  3KCC A;  1NUK A;  2R04 3;  4PJY A;  2Y0I A;  4QU1 A;  1MEC 2;  2O0O A;  3FUQ A;  5F1R A;  3B02 A;  2FMY A;  1LR5 A;  2HYX A;  2GH8 A;  2MEV 2;  1GP6 A;  1YQC A;  2ETE A;  4P5Y A;  1RC6 A;  3GZT B;  3WQ0 A;  2R16 A;  3RYR A;  4ATF A;  2DFB A;  2IFW A;  1EAH 3;  1ZNP A;  3IN9 A;  4FPL A;  4WM8 C;  3RS6 A;  5JAX A;  1J83 A;  5HV0 A;  4JHZ A;  4AFM A;  2HWD 3;  2QE3 A;  3PIG A;  1YFY A;  4RQP B;  3UES A;  4MH0 E;  4M3C B;  1Z78 A;  2XLG A;  5SV5 A;  5IVE A;  1ZBA 2;  1W6N B;  4QX2 A;  1BMV 1;  2LRO A;  1XBF A;  2RS5 2;  1YJK A;  5DZE A;  3GBF A;  3R0R A;  2XBO 2;  1SFN A;  2NN8 A;  3VKM A;  2RV9 A;  4R52 A;  5J7M A;  1XU1 A;  3CIH A;  1AR8 3;  2W46 A;  4GA9 A;  4IV3 B;  1MVQ A;  2ZML A;  5T5J A;  2WNV A;  2R30 A;  1UZW A;  3IM0 A;  3WDV A;  4BIF A;  3RMX A;  4JKL A;  4JX0 A;  4XE9 A;  4ZY9 A;  2YU2 A;  2DUO A;  1IKP A;  3PUS A;  3VHR A;  5LW9 A;  2CAU A;  4CDW A;  3JD7 1;  4E27 A;  1H0B A;  2GME A;  5J3U A;  4P00 B;  2Z4F A;  2X8K A;  5AC9 3;  2B5H A;  5C9A A;  5F5A A;  4Q4X 2;  2BOI A;  2NZ9 A;  3MUZ 1;  5FWE A;  1OOP B;  1VBB 3;  2OQ6 A;  4RN5 A;  1N1S A;  3NAP A;  4JDM A;  1C8M 1;  1O3Q A;  4Q1R A;  3AYA A;  5FY1 A;  1TVG A;  2RHP A;  2LAL A;  4LKS A;  3LDR A;  3MPP G;  3ZO0 B;  3UJO A;  3HR9 A;  3K2O A;  1UZZ A;  5FO8 B;  1XE8 A;  2VCM A;  1K5M A;  3OPT A;  2VTX A;  4P9L A;  3RDI A;  3WY6 A;  5IFT A;  3ES1 A;  5FY0 A;  2QCS B;  4QX1 A;  3VL8 A;  1UN1 A;  2VEC A;  4HVR A;  4PLM A;  1OQD A;  4LIU A;  5ERL A;  5FRE A;  2HEV F;  2DUR A;  4FPK A;  2VMC A;  2WNO A;  3B93 A;  5A80 A;  4NIH A;  2VAU A;  2JE9 A;  1PVC 3;  2O8Q A;  4LBK A;  4ASK A;  4FTB A;  5CU1 A;  5L7O A;  1RIN A;  4FOV A;  1SLC A;  2FCV A;  4WVM A;  4BQY A;  4FAH A;  2VUJ A;  3KZ4 C;  4JV4 A;  3VDD A;  5BYN A;  1B35 A;  4HVO A;  1DYK A;  2JG9 B;  1SZB A;  3D0J A;  1NA1 C;  1ND3 A;  4Z8B A;  3V0B A;  5K9Y A;  1RUD 3;  1YQ5 A;  1MR5 A;  2GND A;  5FK7 A;  4IUG A;  3KF5 A;  4WBB A;  5JXH A;  4NHM A;  4D7Y A;  2BP6 A;  3AP6 A;  4NHY A;  2X53 S;  3VBS C;  1A34 A;  4LLO A;  2K46 A;  1UXX X;  2R07 1;  4MX3 A;  3TOJ A;  5BNN B;  2IC1 A;  3BTY A;  2XJP A;  5LA2 A;  3B9C A;  4QXC A;  5FR3 A;  3VBH B;  2B8M A;  2E6V A;  1BK0 A;  5A70 A;  2EXK A;  1BEV 1;  1DGW A;  4XEZ A;  2Q1F A;  3WCS A;  4DXS A;  2YGL A;  4L0P A;  4M4P A;  1UOB A;  2XLF A;  4OMC A;  5FBJ A;  3WP5 A;  2WS9 2;  3C7O A;  1EUU A;  1PO2 2;  3AKQ A;  3LZZ A;  2Z79 A;  2FDJ A;  3MFA A;  4XFH A;  4Y22 A;  4RD7 A;  2PMW B;  1VAM A;  4DRV A;  3NWK A;  3M70 A;  4F8A A;  1S2K A;  3J7M A;  4FO9 A;  1SQ4 A;  2VZR A;  3ZFE A;  3AKP A;  5CFD C;  2NMO A;  5HI0 A;  1CVN A;  3PUH A;  5L73 A;  4B1L A;  2VOV A;  3UJQ A;  1CPN A;  3SH5 A;  3WV6 A;  1RVF 3;  2OT7 A;  4QU2 A;  3WX5 A;  2ZGM A;  5M0T A;  2IFR A;  5FYV A;  1AR6 2;  5A7S A;  3Q8F A;  5B4N A;  1RMU 3;  3RPQ A;  3EXU A;  1MQT A;  1U5X A;  2QDN A;  3NW4 A;  4DXR A;  4N43 B;  4QQO A;  4PDW A;  4LK7 A;  1ZZ8 A;  1V6K A;  1XNB A;  1KFX L;  1YFW A;  1DYO A;  3WG2 A;  3AXD A;  4LBM A;  1WLT A;  4D7T A;  1CJP A;  2YFU A;  3NQH A;  1CIW A;  4AK3 A;  1J59 A;  4MGI E;  1UY3 A;  4GB3 1;  1AR9 3;  4RQP C;  3WW4 A;  4CUG A;  4S2G A;  5DAQ A;  5JOZ A;  2GNT A;  3FLR A;  3WIN E;  4TTG A;  1CIY A;  2AEY A;  4LHK A;  3DF0 A;  1HW5 A;  1ULF A;  4HK8 A;  4OQ8 A;  1NLR A;  1HXS 3;  1OA4 A;  3I2I A;  1XOY A;  5EV7 A;  3U37 A;  2KXL A;  4IV3 C;  2E32 A;  3ZN6 A;  2X10 A;  4NRM A;  4K7J A;  2J22 A;  3ACI A;  4FFI A;  5F8P A;  5IT6 A;  3O1P A;  2G9G A;  5KHK A;  1X9P A;  4O65 A;  5A6Z A;  2VNO A;  4TWT A;  3CJI A;  3GXU A;  5LWB A;  5CB7 A;  4LQR A;  3MIB A;  4OHZ A;  4O61 A;  5GZE A;  3T30 A;  5FY9 A;  2EIG A;  1CPM A;  3M3I A;  3C3V A;  4C90 A;  2RJ2 A;  2XLA A;  4YG3 A;  4PIX A;  4HPK B;  4UFI A;  1I5Z A;  1RHI 3;  4QX5 A;  5EIY B;  1OOP C;  3CNA A;  2E31 A;  1FPN 2;  4CCE A;  2VE1 A;  4JDN A;  5F3E A;  4EE2 A;  5TSW A;  3FFZ A;  1OUX A;  3O0V A;  3JB4 C;  1AR7 2;  4AED B;  5JPM B;  4R4Z A;  2PAK A;  4JVA A;  5FY4 A;  2ZEX A;  3A7Q A;  4JC1 A;  3RZG A;  1NCQ C;  2B9U A;  2RDQ A;  3GCX A;  1W6O B;  5C3O A;  2VVE A;  3GZA A;  5IUQ A;  2MHF A;  1QOS A;  3J8F 2;  3L2Y A;  4FPC A;  4QHO A;  5K7P A;  3S5A A;  4AFB A;  1W6Q A;  1DLC A;  2UY9 A;  1ZBE 2;  3ACL A;  4CDU B;  4NUB A;  4HET A;  5F2S A;  4ET7 A;  3TB0 A;  1JOD A;  1JZ7 A;  4C1W A;  1OMI A;  1LRH A;  3KHC A;  5LK7 B;  3D82 A;  3I3D A;  4RS5 B;  4LLF A;  1AYN 2;  2HYK A;  5BNP A;  1KGY A;  3CMG A;  3KB5 A;  1VIW B;  4BQ2 A;  5KHJ A;  2GMM A;  3EBR A;  4UWD A;  1SLB A;  2DBI A;  2WAA A;  4L11 A;  5LBF A;  2JG9 C;  5F5C A;  2DV9 A;  4YZ3 A;  5LA1 A;  4E8C A;  4K6B A;  3LAG A;  4UI9 L;  4UFH A;  4A4A A;  2OUJ A;  4QX8 A;  5K4L A;  4QM8 A;  3H7J A;  4CDQ A;  3VKF C;  2HWF 3;  2Q5T A;  4AAX A;  4AVT A;  1XU2 A;  3AYE A;  2JIG A;  3PTR B;  2PQS A;  1F31 A;  4LXL A;  3HMY A;  5JMO A;  4I2O A;  5FYU A;  1YEW A;  3WZ1 A;  1G9A A;  1KRI A;  3VBH C;  1QQP 3;  4BU2 A;  2J42 A;  2H0B A;  1JYV A;  3ALQ A;  1O3T A;  1HIX A;  4S2H A;  3H1W A;  2Q8C A;  4XCB A;  4LBL A;  2GH2 A;  1CWP A;  2HWD 2;  2CWM A;  2RR1 1;  3POF A;  2PHR A;  4Y26 A;  4Y3O A;  5IVF A;  4FPO B;  4PBP A;  4TZD A;  3X29 B;  1H1I A;  1VB4 A;  1PX4 A;  1VAV A;  1FX5 A;  2VMG A;  4LIV A;  3ZDV A;  4YSF A;  2JB4 A;  4Q27 A;  1POV 3;  2YG0 A;  3VL9 A;  4XFA A;  3ORJ A;  1WMD A;  2B39 A;  4GWI A;  2C5D A;  3KV5 A;  2P6C A;  5LY2 A;  3B5L B;  2WA3 A;  3BI3 A;  4N90 A;  5F3I A;  3FN9 A;  2BNM A;  2RG4 A;  1CAX B;  1W8H A;  2CAV A;  3MBW A;  5A3O A;  4CDX A;  3SEE A;  1RUI 2;  2HWC 1;  2VZP A;  4CZS A;  1GOH A;  3ZIX A;  3NKT A;  4Y1Z A;  3B69 A;  5C3P A;  1E5R A;  1CZS A;  4BLI A;  4BQ4 A;  5AC9 2;  5FQ0 A;  1HKD A;  3D4K A;  4AFA A;  2FDG A;  4ZON A;  1SAC A;  3VBF A;  1OVS A;  1UMZ A;  1VBB 2;  4MUV A;  1HRI 3;  4QB1 A;  3LCP A;  3OPW A;  1IPJ A;  3S0M A;  1UY4 A;  4KG0 A;  1EUT A;  1ZYB A;  2D40 A;  4TN7 A;  4AF9 A;  2WNU B;  2WQ4 A;  1XNA A;  2ILM A;  2QFE A;  2VZO A;  4W6X A;  5JIA A;  1FOD 1;  5CFC B;  2CL2 A;  3K4A A;  3FHA A;  4Y20 A;  1D2Q A;  4I3P A;  3WP4 A;  1CD3 G;  1XC6 A;  3BU0 A;  3H8O A;  4JGZ B;  2YYO A;  5FP9 A;  3WG1 A;  3R4U A;  3RMY A;  2C6S A;  1V9U 3;  2XJT A;  4NWW A;  2VG9 A;  4CCC A;  5A3U A;  4AGG A;  5L9B A;  1S2B A;  4XQW A;  3TN9 3;  3S57 A;  2GAL A;  2XPJ A;  4LPL A;  5C8C A;  4A41 A;  1N1V A;  3ZFG A;  1RUC 2;  2DCZ A;  4JKK A;  5L9V A;  1RUO A;  2I74 A;  4XUQ A;  1LOA A;  4AZZ A;  1UX7 A;  2BPA 2;  2R06 2;  1ASJ 1;  2RVA A;  1RUD 2;  2Z69 A;  2ATF A;  2A6Z A;  4LBO A;  1W6M A;  3DXU A;  2LUW A;  1YWK A;  4KBZ A;  5C8W A;  3NV1 A;  1BCX A;  4MSV A;  5FZ9 A;  1GIC A;  3VZJ A;  4GH4 B;  1SLI A;  2VBP A;  1VB2 A;  2QTW B;  1US3 A;  4D94 A;  2XXZ A;  1QOO A;  5FJK A;  5A7W A;  4AI2 A;  3ITQ A;  1L7Q A;  1LCL A;  1V0A A;  2OYZ A;  1QXR A;  2E7A A;  4LMF A;  3VHN A;  1UNB A;  1QJE A;  1ULG A;  3VBO B;  2ZBJ A;  4DEV A;  2WZR 3;  1C3H A;  3WW3 A;  1GP4 A;  4CPB A;  2WR9 A;  3O1T A;  1O59 A;  4GKX A;  4E2S A;  2BOJ A;  3W5M A;  1YCI A;  5FZH A;  3WNN A;  3BIE A;  3T08 A;  3VB9 A;  5FYI A;  2ET7 A;  2Y6L A;  2VMI A;  4OLL A;  1UZY A;  2GP5 A;  2TNF A;  3P6B A;  4RS5 C;  2XJU A;  3BTA A;  3C7F A;  4WM7 B;  4AR2 A;  4AYU A;  2AC1 A;  5JR7 B;  4MXW A;  4XTM A;  3Q8C A;  1STM A;  3CZJ A;  2D97 A;  2XUE A;  3LGR A;  4CEY B;  2RDN A;  5BNQ A;  5FV3 A;  1RYY A;  2GC1 A;  5FZI A;  1ZBA 1;  4A7K A;  1RVF 2;  5I8Y A;  1P8J A;  3FC0 A;  1RUJ 3;  1BBT 2;  5ABJ B;  3AFG A;  4YW2 A;  2XBO 1;  3OEA A;  1V6M A;  2XWJ B;  4Q4W 3;  1QJX 1;  1K42 A;  5J98 B;  1H1A A;  3H42 B;  4BJ0 A;  1GQP A;  2BV4 A;  2W91 A;  4IDZ A;  2EIE A;  2UY8 A;  2ORX A;  1UY0 A;  4MGZ E;  3VV1 A;  3A23 A;  2WFF 2;  4CCN A;  3GGL A;  2YBK A;  2X5I A;  5EJ3 A;  2RMU 3;  1YQ2 A;  3WHU A;  2VW0 A;  5FZL A;  3W20 A;  2CU5 A;  4KQ7 A;  4DMI A;  1W9Y A;  1WGP A;  5FPA A;  2GC3 A;  4JQT A;  5F5Q A;  3IWZ A;  4YNI A;  4WZC A;  2RM2 3;  1AR9 2;  2YMZ A;  4CP2 A;  2VGD A;  4ONU A;  1PK6 A;  5F6K A;  4NII A;  1GR3 A;  2J1R A;  3LEK A;  1S0D A;  2DDU A;  2VMH A;  1GZ9 A;  1OH3 A;  4ISR A;  3H8X A;  3A0N A;  1R1Z A;  2RJK A;  2EXI A;  3LF7 A;  4LO5 B;  5LRR A;  3THC A;  4UFM A;  4IV1 A;  3CL1 A;  2ZAA A;  4IER A;  2R1D A;  2Y38 A;  1LHW A;  1KS4 A;  2W87 A;  3LWC A;  3DXT A;  4FOW A;  5FZO B;  2Y33 A;  4UW5 A;  3OSD A;  4F7Z A;  2W1U A;  5AVP A;  1YI9 A;  4IEO A;  2A6W A;  5BNO B;  4JRA A;  1SLA A;  1OLQ A;  1R09 2;  1H2K A;  2O1Q A;  4R9D A;  1TME 2;  3QH6 A;  3B00 A;  5JOY A;  2YY1 A;  1IS6 A;  2UWA A;  3EMR A;  1GQH A;  1WW7 A;  3H1Y A;  1YNA A;  4NHK A;  3WSO A;  5J36 A;  4FBF A;  4CP9 A;  2EAA A;  1ND2 A;  1CAW B;  1FMD 1;  4Y1V A;  4XPV A;  1SLT A;  5BUV A;  3V65 A;  3VBU B;  4DQA A;  4XFF A;  2WDB A;  5EPA A;  2YC2 A;  1J84 A;  1BVV A;  2WNU C;  4Q26 A;  5JZG B;  2XML A;  1S0E A;  4AQT A;  1LEC A;  4NR1 A;  4OUM A;  3ZXF A;  1C57 A;  1AXY A;  1N3Q A;  4P9W A;  5DUV A;  5FMD A;  2D98 A;  4AI9 A;  1W99 A;  2YUE A;  3TAY A;  3USU B;  2RS3 3;  4KGG A;  3ZYB A;  1ACC A;  5ACA 3;  1X50 A;  3KGZ A;  1L7L A;  2ZHN A;  3KGL A;  3U10 A;  4JGZ C;  2PHF A;  1A8M A;  1DDL A;  2WO7 A;  1W8U A;  1Y7B A;  1ZZC A;  1W8W A;  2WWU A;  4GZ9 A;  5EYY A;  4Q29 A;  1UW8 A;  4FFH A;  2VZU A;  3IBM A;  4W8J A;  1SLL A;  3HQR A;  2WS9 1;  3JB8 A;  4COY A;  2D6O X;  1NCR C;  4BE3 A;  3IMN A;  1KDK A;  1TNF A;  2D6K A;  3MLK A;  3N9Q A;  1QEX A;  1WBL A;  1OQE A;  2HEY F;  2QQL A;  1X33 A;  4YFW A;  5EQU A;  2VL4 A;  2QBX A;  5F3G A;  2YZ4 A;  4XBN A;  3ZXK A;  3RZM A;  2HWF 2;  2QQJ A;  1AJO A;  2LRP A;  4YW4 A;  1UWW A;  2E9Q A;  2VOK A;  3VDD B;  3AJZ A;  3APB A;  3SEP A;  1I5P A;  1K3I A;  5FMO S;  1XND A;  2BFU S;  4EYU A;  1AHS A;  1UPS A;  1JYC A;  4OUS A;  1QQP 2;  3T2P A;  5GZG A;  3VBR A;  1Q8P A;  2E51 A;  1IS4 A;  3GBW A;  3H8U A;  1GNY A;  1VMH A;  1WKY A;  3INA A;  5LB6 A;  3VBO C;  4F83 A;  3PVE A;  3WW2 A;  1D7P M;  2YFZ A;  1AX1 A;  2FD8 A;  1AR6 1;  2QQU A;  3N7L A;  1GWK A;  4N9I A;  1Y3T A;  4AWD A;  4CCL A;  1H9W A;  2H6C A;  2ET1 A;  5D8A A;  3O5S A;  2W08 A;  5FLJ A;  1UOG A;  5FXX A;  4CA9 A;  3JBG 2;  1OF3 A;  5FP4 A;  3AZY A;  1EYB A;  5DDJ 3;  1DP0 A;  3RYP A;  3M7A A;  5T5P A;  1OVP A;  4AGV A;  5LCW L;  3IPV B;  5FZ0 A;  2EIB A;  3POS A;  4WM7 C;  3K4D A;  5FXZ A;  4HVQ A;  1FNY A;  3RJR A;  3PTY A;  1UOJ A;  4AE2 A;  4ARX A;  2ZS6 B;  5AFB A;  4CEY C;  1W6P B;  3K48 A;  1PIV 3;  1UX6 A;  1IHM A;  1X8E A;  4I0W B;  4X6Q B;  3OD0 A;  1IGO A;  4UW4 A;  2KR2 A;  4LHN A;  4YGD A;  5IWF A;  3QD6 A;  4LHS A;  2O8O A;  2QQP A;  1KFU L;  2P3J A;  4XJ9 A;  2HWB 3;  4Y4R A;  1PGL 2;  2B45 X;  3RJ2 X;  4BIS A;  5ABJ C;  1G7Y A;  1XRU A;  4A3X A;  2HBT A;  4H3W A;  1R1A 2;  1GOF A;  2RJL A;  3CJX A;  3E97 A;  1KXG A;  4AVV A;  4E4H A;  4XF4 A;  1HRI 2;  2ARB A;  1JZ4 A;  4XOG A;  5FBZ A;  2WII B;  2OS2 A;  3AL5 A;  2JEM A;  1BZW A;  5IVJ A;  3H3U A;  2JDM A;  1JYI A;  3MFC A;  1DCS A;  1V6N A;  3POJ A;  2BWA A;  1EPZ A;  1GNH A;  3M3Q A;  1RUE 3;  4KMQ A;  4ZHN A;  3OPZ A;  3OOX A;  4GWJ A;  4BCU A;  1FPN 1;  3DV8 A;  4D7S A;  4L97 A;  4QD2 A;  1DZQ A;  1W9F A;  3GM8 A;  1HRV 3;  5DPN A;  3B01 A;  2E63 A;  4K8R B;  1AR7 1;  4XMI A;  3VZM A;  4FTE A;  1V9U 2;  5IAV A;  1TMF 3;  5C71 A;  2D5F A;  3OCP A;  2GU9 A;  2J1U A;  1Q8S A;  2A3W A;  4YW5 A;  2G4I A;  3N4M A;  4XZU G;  1C1F A;  1DGR A;  3I2K A;  3VUO A;  4AVC A;  4K3U A;  3WDX A;  1PGW 1;  4WVW A;  4BWO A;  5BNO C;  2PFW A;  3LDK A;  1ZBE 1;  4J25 A;  3FJS A;  2DUQ A;  2JKB A;  1PNG A;  1YYN A;  1VBA 3;  2K9Z A;  2PHX A;  3POG A;  1UKR A;  1VBE 3;  2WNV C;  2WZ8 A;  1W2O A;  1AYM 3;  3DKQ A;  2VBB A;  1DQ1 A;  1RUH 3;  4Q4Y 3;  4R4X A;  4AW7 A;  2XL7 A;  4C1X A;  1AYN 1;  2ZJC A;  4RFR B;  3UV9 A;  5DZG A;  4I02 A;  1H8T B;  3FX3 A;  2WO2 A;  5GLV A;  3M8L A;  2QDR A;  1O4Z A;  4NHL A;  2X05 A;  4BK4 A;  4CDW C;  1NXM A;  1IZ3 A;  2BNN A;  5C9A C;  3S5Q A;  4GUL A;  3O1U A;  1XQN A;  1NA1 B;  4O7X A;  2WZR 2;  1ENQ A;  4KWU A;  3RZK A;  4EN6 B;  4IEZ A;  4AVB A;  2WO3 A;  2JDY A;  4OHX A;  5GLZ A;  4AI1 A;  4NE9 A;  1DQ6 A;  5IW0 A;  3WNK A;  5DG1 A;  4CEW A;  1QMJ A;  2HH9 A;  3PDQ A;  1ZRC A;  2IXL A;  2VZV A;  2G9F A;  3AFK A;  2W95 A;  1K5M C;  1CX4 A;  3RWK X;  1OA3 A;  2VCC A;  4U36 A;  1JZ3 A;  1COV 2;  1O6U A;  1UU6 A;  1M06 G;  3D8C A;  1WZX A;  3VKN A;  2HWE 3;  2Y34 A;  2W0X A;  1W6Q B;  2RS1 1;  3III A;  1WCU A;  4BQ3 A;  1NYW A;  4TLG A;  5FUI A;  1Q43 A;  1PO1 1;  4M0H A;  2F4P A;  4YVS B;  1ODM A;  4R9A A;  5JOW A;  1RUJ 2;  4FPY A;  4QQ2 A;  3I2O A;  1NXD 1;  2A71 A;  2CWS A;  4Q4W 2;  4QPW A;  1H2L A;  3MIH A;  4ASM B;  5T3N A;  3LOB A;  5CZK A;  1KQR A;  2GAU A;  2JIC A;  3VDD C;  3T2O A;  1B35 C;  5JI9 A;  5LBE A;  1LEN A;  3HOB A;  4YM1 A;  3KSC A;  4DNY A;  4DXZ A;  2HBU A;  2VZT A;  2QQK A;  3DCQ A;  2ZHL A;  4J6G A;  4UBG A;  4XUN A;  2G1M A;  2VD7 A;  3RI9 A;  1RUI 1;  2AEZ A;  2RMU 2;  1VBD 3;  3BB6 A;  4Y5T A;  5CAZ A;  2JD9 A;  4GJY A;  1UU4 A;  4CE8 A;  1L7R A;  3CLP A;  2BER A;  3IDC B;  2NQY A;  3MIE A;  1LEM A;  4RR3 A;  3E6C C;  3A4U A;  1JU3 A;  1UAI A;  1CZT A;  3ZLI A;  4IEQ A;  4IL7 A;  4M3C F;  5BY5 A;  2WZP P;  1OLR A;  2DCK A;  3OGS A;  5J37 A;  5JMC A;  1IQA A;  1QJY 1;  1F35 A;  1RXG A;  1AL2 2;  4QB6 A;  1OF4 A;  5IAT A;  2C1F A;  1CAU A;  4EZ4 A;  3ZSL A;  2W68 A;  2E7Q A;  1SDW A;  2JEN A;  3ROU A;  5A1L A;  3ACH A;  1W2A X;  3ILF A;  5FZE A;  1YLL A;  2D6P A;  2R0H A;  2XGX A;  3MV0 1;  3MZH A;  3OYW B;  3MUY 1;  4HBN A;  1LU2 A;  4MG2 A;  4COW A;  3MIG A;  3WT3 A;  3ZFE C;  1NKG A;  4RHV 3;  2BQP A;  4NMI A;  1MS4 A;  2WT1 A;  1HB2 A;  2RDS A;  4M01 A;  4AG4 A;  2ZTN A;  3HN1 A;  4RGG A;  4XCA A;  5DMY A;  1PZ7 A;  2W1W A;  3TNP B;  2P5B A;  3QAC A;  3T1M A;  5JPN B;  4B29 A;  4GAZ A;  1QJU 3;  3KVA A;  4CCO A;  2VVD A;  2A6V A;  2WLP A;  1RUF 3;  1K5J A;  3M3E A;  2A6Y A;  4FCA A;  4QKD A;  4URT A;  4QGM A;  4B4Q A;  4CDX B;  1RUC 1;  1XSQ A;  4MGK E;  4BQX A;  1R08 1;  1MZF A;  5FZM A;  1Z7S 3;  4W50 A;  1K12 A;  4XDO A;  2R06 1;  3DYM A;  4DPN A;  3JQX A;  3NNG A;  2XOM A;  5FQ0 B;  4N7I A;  5FP3 A;  1LNS A;  2YC4 A;  2ZGU A;  3LA3 A;  3CEW A;  4PDW C;  4W4Z A;  1E57 A;  1X8M A;  2AAC A;  1J1T A;  5ACA 2;  5FO9 B;  5FYT A;  2CNA A;  1JN2 P;  2PLV 3;  5LBB A;  4JGY B;  1NE6 A;  5FPZ A;  3R4S A;  5ANN A;  3URF A;  1S4C A;  2XKP A;  2JE8 A;  5E1R A;  3ZYH A;  4R9B A;  1S2E A;  4HSJ A;  4LO8 A;  4UF0 B;  3ZYJ B;  5JOX A;  3M2M A;  1GNZ A;  3NL1 A;  2ZKN A;  2VVF A;  4QX3 A;  4PQ9 A;  5BPX A;  5FZ8 A;  3E1F 1;  3PHM A;  5A6X A;  1NCQ B;  1OH4 A;  2W52 A;  2XL9 A;  3NVC A;  4A6S A;  3WNP A;  2CDP A;  3O14 A;  3NJV A;  1EV1 3;  1WCS A;  3N9N A;  2AH2 A;  5I0R A;  4FPE A;  3QH7 A;  3ZFG B;  1DGW X;  5A3P A;  2VCB A;  2X09 A;  3CJI C;  5D21 A;  1H8T C;  3ZXJ A;  5FZ4 A;  2WNE A;  3AYD A;  1OUS A;  5FY8 A;  2WKK A;  5HCH A;  2YBS A;  1JYT A;  2PAM A;  4W6Y A;  3RFR A;  3WQ1 A;  5IHR A;  2SLI A;  1LGN A;  5FZ3 A;  3HWJ A;  1LHO A;  1QJF A;  3KCY A;  4MET A;  4ZU5 A;  2GDF A;  2H6B A;  4XJA A;  3WP3 A;  1BBT 1;  4LUL A;  1HQW A;  3WQ7 A;  2WWS A;  4NPL A;  3EB7 A;  2I45 A;  3UKN A;  4KU8 A;  2Q0A A;  2ZGQ A;  4HN0 A;  4A44 A;  2WFF 1;  5A3N A;  4RGA A;  4RGK A;  4KWK A;  5DDJ 2;  3AMH A;  5FPU A;  2D6N A;  3EO6 A;  1JOB A;  1UMH A;  1OBN A;  1PZ9 A;  3DEM A;  3AVR A;  4N8M A;  4XFB A;  5LA0 A;  3GHN A;  4Y24 A;  1HJF A;  2ARX A;  2QQM A;  4Q4V 1;  3WEZ A;  1GAN A;  1R08 3;  1UU5 A;  3AZV A;  3HNY M;  5DAX A;  4GMP 0;  4YVS C;  4DB5 A;  2HWB 2;  5L19 A;  3ZR6 A;  4FFF A;  1GLH A;  1OD3 A;  3OTF A;  3U07 A;  4WV8 A;  3OB8 A;  4A6O A;  2Y6K A;  4G4F A;  3JD7 3;  3UYJ A;  3S7I A;  3KT1 A;  3SIT A;  5C7G A;  1GV9 A;  3HAG A;  2YGM A;  4QXK A;  1HN0 A;  4XQ4 A;  4QPG A;  2PEL A;  1GZT A;  4XHX A;  4BYY A;  4DIN B;  4XF9 A;  2VXJ A;  4H7L A;  4D3W A;  4AHW A;  1MS9 A;  1C8M 3;  4DFS A;  3SCF A;  1R09 1;  1IPS A;  1QGL A;  3BTX A;  4BDV B;  1TME 1;  4YZ4 A;  2OXB A;  1LOC A;  3AZZ A;  3OGR A;  1RUE 2;  5FZ6 A;  4FXK B;  1ULP A;  2UU8 A;  3BN6 A;  2PAE A;  4ES8 A;  4XJZ A;  4ZXE A;  3O1S A;  3N9O A;  5FLI A;  3RG0 A;  3PUA A;  4ZXK A;  1TMF 2;  5FUN A;  5H9R A;  5FY7 A;  4MZU A;  1UY2 A;  5T5L A;  3AXE A;  3EJK A;  1JOP A;  5FZK A;  4YVW A;  1F15 A;  3KQR A;  4LO6 B;  4N53 B;  3K4Z A;  2OX0 A;  4Y4Y A;  2I07 B;  1MPX A;  1UXZ A;  3WD5 A;  4JRL A;  1REF A;  1FAY A;  3I8T A;  4Q0V A;  4SLI A;  2VW2 A;  1AL0 G;  1QHD A;  1VBE 2;  5KWR A;  4DO0 A;  1AYM 2;  5I0T A;  1FYU A;  1RUH 2;  4Q4Y 2;  3RQ0 A;  2VOW A;  4IEX A;  5B2G B;  3R05 A;  2L9L A;  3LSE A;  1NY7 2;  2PHL A;  2VNR A;  4GIQ A;  4OHV A;  4CDX C;  3H3L A;  3HT1 A;  2XG3 A;  5C4W B;  5IK5 A;  3LIH A;  1Y9M A;  4ERO A;  2CSG A;  3BTZ A;  2FBE A;  3S30 A;  2R07 3;  2ZZQ A;  2ZEZ A;  2YB7 A;  5HCF A;  3VBF C;  4QKF A;  4CP9 B;  4P9J A;  1BEV 3;  1JW6 A;  2WSU A;  1S1A A;  2V09 A;  1WA6 X;  1BJQ A;  4UOJ A;  1J3P A;  3KVB A;  3A0K A;  4PLN A;  5FYZ A;  4JGY C;  4C8D A;  4GQ7 A;  4D6R A;  3GCW A;  4ZPI A;  3OF1 A;  1KDM A;  3CU7 A;  1H1M A;  5E6H A;  4B4P A;  1LOE A;  1QIQ A;  2ENR A;  4B4R A;  1DHK B;  1IS3 A;  2HWE 2;  1AZD A;  1GYK A;  4LKE A;  4NAO A;  5A33 A;  5J48 A;  1KS5 A;  5EXO A;  4CXX A;  4OHW A;  1RUG 2;  1JYW A;  1VBC 1;  2VNV A;  5FIX A;  3M3O A;  2C0Z A;  3B9I A;  4QDS A;  1KJL A;  3JBG 1;  2ZAH A;  4LUM A;  3N35 A;  2PTM A;  2HEW F;  1A3K A;  1JUI A;  2OZJ A;  3VLB B;  3HVD A;  4EN8 B;  2FDK A;  3N7K A;  4CXY A;  5F37 A;  3ZFG C;  5F9T A;  2OQ7 A;  3HEI A;  4E2G A;  5F7U A;  2DVA A;  2WZE A;  3I49 A;  3MF9 A;  4A7Z A;  4IXL A;  4AFC A;  4P14 A;  5CAD A;  4IE7 A;  3POB A;  3WF2 A;  2IXH A;  3HNB M;  3VBS A;  1D4M 1;  1AXZ A;  4W6W A;  1U0A A;  3B94 A;  4QPI B;  1R1A 1;  1ULE A;  3KF3 A;  2RE9 A;  2XDV A;  3E5Q A;  4MGQ A;  1W0N A;  1B09 A;  3ZXD A;  3N9P A;  2D7F A;  3T09 A;  1US2 A;  2FMD A;  2R04 2;  4GB3 3;  4ZU7 A;  3DN7 A;  4OUE A;  5A32 B;  1WLD A;  3DL3 A;  1LAJ A;  4GMP 1;  2B4K A;  4IE4 A;  1AX2 A;  5FWJ A;  2Y8K A;  4NHX A;  4YGC A;  5FOJ B;  4TXW A;  2I2S A;  1AUY A;  2W39 A;  4OZX A;  1YXW A;  1EAH 2;  2B42 B;  4C91 A;  1VRH 1;  2WAB A;  3ZPY A;  5A3T A;  3IT8 A;  2A1X A;  5CFD A;  1QWR A;  4RHV 2;  1YO8 A;  3RVH A;  1LB2 A;  4MV2 A;  3S7E A;  5KHG A;  3DPR A;  1PZ8 A;  3MYX A;  4MO3 M;  3DUI A;  1QXJ A;  4GD4 A;  4AEJ A;  1DQ0 A;  1W06 A;  1W0O A;  1X82 A;  4RFT 0;  2YC0 A;  5GLU A;  4FPF A;  1RUF 2;  1CJD A;  5FZD A;  2FDF A;  4MHU A;  1AR8 2;  2BBV A;  2EXJ A;  2BVV A;  1OA2 A;  1OI6 A;  2VM9 A;  3I59 B;  3WVJ A;  5KXD A;  1N3P A;  2UYA A;  4XTP A;  1VR3 A;  4HFS A;  2Q4S A;  2F6B A;  2JWP A;  2PHW A;  4YG0 A;  5CEH A;  1WWY A;  2BW8 A;  2V4A A;  4PF1 A;  3W59 A;  2BTV C;  2P6H A;  1IG3 A;  5K0U B;  3NKG A;  4MLO A;  3TYJ A;  1XE7 A;  5A7P A;  1WBF A;  4A2U A;  5JSR A;  2XR4 A;  1UD1 A;  5KHH A;  1OFS A;  3BOP A;  3O7O A;  1J3R A;  4ORF A;  2ZGR A;  2WSV A;  1SBF A;  2AEN A;  3CF6 E;  2O14 A;  4RQP A;  4IGQ A;  4FTS A;  4M3C A;  1WLC A;  5A1F A;  1LHV A;  5JXJ A;  1LOF C;  1C28 A;  1UCX A;  1W6N A;  2WUH A;  4JZR A;  3MGU A;  1V6L A;  2UWC A;  5DUU A;  3LA7 A;  1UYZ A;  3I2J A;  4N53 C;  3CZU A;  2BU9 A;  1HN1 A;  2AZ5 A;  1WLW A;  1TEI A;  2E33 A;  2JG8 B;  3THP A;  2DUP A;  1SCR A;  3BYW A;  4LOS A;  4HSL A;  1ZRD A;  4IV3 A;  3PU3 A;  1D4M 3;  3CO2 A;  3TEY A;  3VKO A;  1WW6 A;  2A73 B;  2Y6H A;  2OA2 A;  4LE3 A;  1COV 1;  3ON7 A;  1PVC 2;  4AXO A;  1OKO A;  3MIF A;  5C4W C;  3UNP A;  4DUV A;  2QNK A;  5KBF A;  2Y6G A;  3OY8 B;  3CQO A;  3SXW A;  2J7M A;  4JCK A;  3ZXL A;  1F2N A;  4JKM A;  4X6R B;  5FAX A;  1NCR B;  3B3Q E;  4UBH A;  3WP6 A;  3H1M A;  4EN7 B;  2ZEW A;  4HKL A;  4GAL A;  4AEK A;  1VAK A;  3ECQ A;  2YPJ A;  1JTZ X;  5T50 A;  5FMC A;  2A6X A;  3GBG A;  1OSG A;  3BVC A;  3WHT A;  3KV6 A;  3ZYF A;  4QM9 A;  3U78 A;  1C5I A;  3TWI A;  2RR1 3;  2PA7 A;  1DBN A;  1V70 A;  5ANQ A;  5FP7 A;  3ZN6 B;  1Q8O A;  1UY1 A;  3VHO A;  2D6L X;  1S0C A;  4O9G A;  2LTN A;  2W47 A;  4HON A;  4LKD A;  3BIW E;  3ST7 A;  4GWN A;  4Q8L A;  2XWB B;  3LDB A;  1HJG A;  3KT7 A;  1G8W A;  3FHI B;  1FT9 A;  1NE4 A;  3OG2 A;  1H4H A;  3GZE A;  4XAE A;  5JSO A;  5KC5 A;  2Y6J A;  3ZYR A;  1UOF A;  4AEM A;  1EPW A;  3PUR A;  3PUI A;  1MEC 1;  2WRA A;  1AL2 1;  2HWC 3;  3KWV A;  2V4V A;  1L3J A;  4S2D A;  2MEV 1;  5FXV A;  4JTN A;  3JD7 2;  5CYY A;  4L2N A;  3W5N A;  1UIJ A;  5HXM A;  2C9A A;  3U11 A;  5DG2 A;  4YAR A;  4CPB D;  2VBD A;  5GM0 A;  4B7E A;  2VMD A;  1KIT A;  2A75 A;  2VCA A;  1UYX A;  3N7J A;  4QPI C;  2JKX A;  3MLJ A;  5BNN A;  1RED A;  3WCR A;  2RS5 1;  3N7M A;  5G04 L;  1VJ2 A;  1GZW B;  2XVG A;  3VBH A;  2WN3 A;  4F3J A;  1JMU B;  5T5O A;  1FOD 3;  3ZFF B;  4XIO A;  5GZC A;  2NMN A;  2G19 A;  2NYY A;  4Q1P A;  2OPK A;  3VBR C;  3CDZ B;  1F5J A;  3WQB A;  1OKQ A;  1RMU 2;  2IVI B;  1RL3 A;  1J58 A;  1S55 A;  1SG3 A;  5I8T A;  1Y43 B;  2BNO A;  4LBN A;  3C7E A;  4FPH A;  2XKO A;  5J09 A;  3V0A B;  3M1H A;  3NV2 A;  1OD5 A;  4XZP A;  4IE0 A;  4I01 A;  1I3H A;  5DZF A;  3J9S A;  5FMB A;  5D1I A;  5FP8 A;  3TEX A;  2ZX0 A;  1SHW B;  3WNO A;  4HKO A;  3RZL A;  4LOR A;  4Q4X 1;  4XUO A;  3WF4 A;  5A6Y A;  4Q2F A;  1CAU B;  2IZW A;  4U2A A;  5A3L A;  4NO4 A;  1ASJ 3;  1QY4 A;  4E4D X;  1O3S A;  1OLM A;  1DIW A;  1POQ A;  3BCW A;  4Y1U A;  2D3R A;  1HXS 2;  4ISQ A;  5FYC A;  5T52 A;  3CKH A;  5KHI A;  2OKX A;  4KI5 M;  4PF5 A;  4CU8 A;  3BU7 A;  4Y1X A;  4I3G A;  3OBT A;  3Q9O A;  2ID4 A;  4HK9 A;  1UL9 A;  2R07 2;  2WO1 A;  3SH3 A;  5CKN A;  5JWP A;  3O12 A;  3OBZ A;  4XXP A;  4TLF A;  5K0U C;  1OPM A;  2V73 A;  5FUP A;  1BEV 2;  3GYD A;  4N43 A;  1ZRR A;  3K77 A;  4HMZ A;  2H0V A;  2Q1M A;  3LSD A;  2JDH A;  4QDQ A;  1W03 A;  2WNV B;  5FJH A;  5EZW A;  5I0S A;  5FXW A;  1O8P A;  2QZ2 A;  1RHI 2;  1UYY A;  3T0A A;  1FV2 A;  1IQD C;  2VO5 A;  4XJW A;  3WR0 A;  4AQS A;  4CDW B;  4Z1V A;  3LOI A;  3FWE A;  3IDA A;  4FT8 A;  4PBO A;  4FQ4 A;  1IPK A;  3OUI A;  5C9A B;  3GF6 A;  2VTX J;  1WCD J;  1SBE A;  2JG8 C;  1NLS A;  2XON A;  3PVB B;  3U75 A;  3TBD A;  3NAP B;  4B3N A;  1GWM A;  3AX4 A;  1ZBA 3;  3SQO A;  1Q8V A;  4AVA A;  4OHY A;  4TYS A;  2C26 A;  2XJR A;  4Y1Y A;  4AI3 A;  1ST8 A;  5FPB A;  1VMF A;  1ZZB A;  1H6Y A;  1K5M B;  1OUR A;  2XBO 3;  4LKF A;  1QJX 3;  3NNF A;  3I7D A;  3IDB B;  1UIK A;  4CUC A;  2Y60 A;  5H9S A;  2ES3 A;  2P4E A;  1PO2 1;  3PVO A;  4AHX A;  1JZ5 A;  4OI0 A;  3MW4 A;  2QVS B;  3GDB A;  2IUW A;  3Q8B A;  5FFO C;  1W39 A;  2CV6 A;  1WUV A;  3RWN A;  4MGS A;  2WC2 A;  4YM0 A;  4AED A;  5L7O B;  1C4R A;  3K46 A;  2BBA A;  3MDP A;  3I97 A;  3PIJ A;  4GB3 2;  4K20 A;  4WVM B;  1A78 A;  4XDQ A;  5E8A A;  2BEO A;  2IXC A;  5KXC A;  3JUU A;  1B35 B;  4YYO A;  1W6O A;  4EN0 A;  2GC0 A;  1ND3 B;  2JDN A;  5GLW A;  3ZMN A;  3V0B B;  5A1A A;  2N7G A;  2VUC A;  3AZX A;  1HB3 A;  4X8N A;  5GZD A;  2ZAB A;  4CDU A;  2D93 A;  3AKS A;  1T2X A;  3FUO A;  5CNA A;  3ZN5 A;  3O1V A;  3POY A;  3NNL A;  4H14 A;  4RS5 A;  2DU0 A;  3ZM8 A;  2VME A;  3KM5 A;  2YRO A;  3TEZ A;  2K2S A;  4X8P A;  4A45 A;  4XUT A;  2W94 A;  3LB9 A;  4P02 B;  4CCK A;  2CY6 A;  1Y4W A;  2VQU A;  1CX1 A;  1OLM E;  3BOD A;  4QHB A;  4UYB A;  3WNL A;  4KU7 A;  2XJQ A;  3RGB A;  4Y22 B;  5KXB A;  3VGI A;  4CRQ A;  4QWN A;  3PLQ A;  1FMD 3;  1FI2 A;  2PHU A;  4FP3 A;  2ZX2 A;  4Y5S A;  1GWL A;  1H30 A;  4NIG A;  2VY0 A;  4H55 A;  4QKN A;  4ITC A;  1IOA A;  2B46 X;  3ZFE B;  2WJS A;  4PI0 A;  2XQX A;  3V56 A;  4YFZ A;  2E7T A;  3H9A A;  3ZFF C;  4WVV A;  1NY7 1;  4NRP A;  1LGB A;  4OI2 A;  2FQP A;  4PI2 A;  2GN3 A;  4MGY E;  1JZ6 A;  3L2H A;  3PU8 A;  3MV1 1;  2WT0 A;  2D3S A;  1U5I A;  5EHD A;  5C3R A;  3M4F A;  3VZL A;  3C2U A;  3HIF A;  4BOW A;  3R4D B;  5IJR A;  1HB4 A;  1E5H A;  1JUH A;  2WS9 3;  3VZN A;  1MQT B;  2ZX1 A;  4MXV A;  3T1L A;  1NOV A;  4WZF A;  4PDW B;  4OFG A;  1X7N A;  4OYU A;  5JLV A;  1YIP A;  3RZZ A;  2W9X A;  1CAX A;  4YVW B;  1FV3 A;  4LO7 A;  1JI6 A;  3VDA A;  2EIC A;  1XYP A;  4COU A;  4Q0S A;  4P9I A;  2VMF A;  4CP0 A;  3TN9 2;  3G6J B;  4XET A;  1RUG 1;  2DU1 A;  5CG9 A;  1ENS A;  2ADE A;  1XXN A;  3RYK A;  3J8F 1;  4IQP A;  5C3S A;  2ZX3 A;  2IXI A;  1MZ5 A;  2VUA A;  1GOG A;  4NRO A;  3C7H A;  2WYF A;  3DYO A;  4HXC A;  2WNU A;  4IW3 A;  3VD3 A;  2RR1 2;  3VDC A;  5T55 A;  3MO4 A;  1AR6 3;  1ZX5 A;  2AYH A;  3AYC A;  4QQH A;  3LFI A;  1ZZ9 A;  4XBL A;  5CFC A;  4XF0 A;  5IVB A;  3CJI B;  4LBQ A;  3P5B A;  5IVV A;  3SNM A;  3AB0 A;  2LS6 A;  1W8O A;  2RDR A;  4ARY A;  1S0G A;  4I09 A;  1JHJ A;  1J3Q A;  2E53 A;  2YU1 A;  4JGZ A;  5L36 A;  5E89 A;  1C5H A;  4ZS2 A;  4ZU4 A;  2JDZ A;  2KD7 A;  4EV0 A;  4RL7 A;  4IEU A;  2R04 1;  1HV1 A;  1QF3 A;  3I54 A;  3NAP C;  3WF1 A;  4H7M A;  4XUR A;  4A3Z A;  3KCX A;  4IEY A;  2UWB A;  1HQN A;  4AGR A;  3BAL A;  3AC0 A;  1NQD A;  2C24 A;  3FFQ A;  4QHZ A;  2DTW A;  5C5T A;  2R49 A;  4CUB A;  2IXK A;  1W04 A;  3IAP A;  4FSJ A;  1GU3 A;  3MPB A;  4UAP A;  1HB1 A;  1ZA4 A;  1EAH 1;  2IVJ A;  3BUC A;  1EY2 A;  4NN0 A;  5FPV A;  5JXG A;  1JZ8 A;  2VR4 A;  5BXX A;  1WMX A;  2D5H A;  2HWD 1;  1MVE A;  5E88 A;  2QQO A;  4FXG B;  4OI4 A;  4GH4 A;  2BYV E;  1O7F A;  2ZXQ A;  4Q5O A;  2GP3 A;  4FVV A;  4AQ6 A;  4BPZ A;  4DUW A;  2F17 A;  4RA0 A;  4XFG A;  4XXA A;  1GQG A;  1RUN A;  1PNF A;  2CGO A;  1V6O A;  1MAC A;  2ZMN A;  4MHR A;  5BNP B;  3UGF A;  5HV4 A;  2B9V A;  5KXE A;  2NPI A;  5LEJ A;  4D0Q A;  2CGP A;  3VBO A;  5EJZ B;  3ZOI A;  2YBP A;  4O9E A;  1QNW A;  4UFK A;  5A3M A;  1FPN 3;  1ND3 C;  2XB6 C;  3ZKU A;  2OPW A;  4URA A;  5JIU A;  1AR7 3;  3H3Z A;  2EF6 A;  4CDQ B;  1NQJ A;  2Y26 A;  2ZGL A;  4HZF A;  5DAP A;  4LTA A;  4HL0 A;  2D43 A;  4L92 A;  1GMM A;  4D6S A;  2FZ2 A;  3ZIW A;  5AC9 1;  2RM2 2;  5L7O C;  2P37 A;  4B8E A;  4N9H A;  4WM7 A;  3J7N A;  3O1R A;  1VBB 1;  1ASJ 2;  2QQN A;  2VOX A;  2IXJ A;  2VOT A;  1QNY A;  1YQ6 A;  1ZBE 3;  4QXH A;  2E26 A;  3H50 A;  1E5I A;  2EXH A;  1O4T A;  1WCQ A;  5IVY A;  2ZHM A;  4E4S A;  1F8V A;  3LEI A;  4NWV A;  5ABJ A;  1AYN 3;  3FLP A;  3JQW A;  2AGS A;  3LE0 A;  1BK1 A;  3HBK A;  3OUJ A;  3ZXA C;  4XBQ A;  2JE7 A;  1G9D A;  3DPR B;  5A7O A;  3NV3 A;  4I0B A;  3WG3 A;  1CR7 A;  1HX6 A;  4IE5 A;  2F4L A;  4YW6 A;  4FFG A;  4OMD A;  3F95 A;  2CTV A;  4CSW A;  4KGQ A;  1D4V B;  1PVC 1;  4D69 A;  4IEP A;  1PGS A;  1LGC A;  3IAQ A;  4M0N A;  1YFU A;  2YDE A;  3D3A A;  4RYD A;  1JOJ A;  2BUK A;  1UO9 A;  2WA4 A;  5DAB A;  3E6D A;  3JCI A;  4OI1 A;  4AOC A;  4EWA A;  5GKA C;  4AL9 A;  4CU7 A;  4BB3 A;  1RUD 1;  2SBA A;  3MIC A;  4CCD A;  4HLT A;  1SBD A;  3SKV A;  3VBF B;  4D8M A;  4YZ5 A;  1MQT C;  2RS1 3;  5FZ1 A;  3WDW A;  2RS3 2;  4NOT A;  5CA6 A;  4Z07 A;  2VTF A;  1PO1 3;  2D6M A;  3PMS A;  2OZ6 A;  3Q8A A;  4H2A A;  3ZR5 A;  4XQD A;  5FZO A;  4XJU A;  1DQ4 A;  4YM2 A;  1FNZ A;  4YVW C;  1CAV A;  1JH5 A;  4LIT A;  5DAV A;  5APA A;  1QU0 A;  2ZCW A;  5BNO A;  3ATG A;  1QJX 2;  1OQ1 A;  1RIR A;  3O0X A;  2DVD A;  3I2D A;  5FYM A;  3ILR A;  4Y20 B;  1SCS A;  5FDB A;  2R7E B;  3WXP A;  4LK6 A;  2ZEY A;  2FCU A;  1CAW A;  4BQW A;  3F2Z A;  4FP2 A;  2WN2 A;  2FHR A;  5HPO A;  1RUI 3;  2DCT A;  2ZGT A;  5LAT A;  3VBU A;  4FOY A;  1QDO A;  5DUX A;  4QPY A;  2JB8 A;  5FTT C;  4BME A;  5JZG A;  3VZO A;  2NP0 A;  2CDO A;  4AI0 A;  5C8C B;  2ADD A;  5LBC A;  4BQ1 A;  3ABZ A;  1D0H A;  3GJA A;  1DGR N;  1SPP A;  1AXK A;  4B1M A;  3HD8 B;  4GWM A;  3USU A;  1GZC A;  5CBL A;  1G9B A;  4QGN A;  3IIA A;  3RI8 A;  4K1Y A;  1TZO A;  1POV 0;  2QQV A;  1QJY 3;  3VZK A;  1RVF 1;  3P1I A;  1W6M B;  2VC9 A;  2EAK A;  4LOT A;  1SDD B;  1XE0 A;  2MPF A;  1URX A;  2ZMK A;  3WDY A;  4BZ4 A;  1Q8Q A;  1S0I A;  1ONA A;  1PM4 A;  1BXH A;  1CN1 A;  3AP9 A;  2VQT A;  3KV4 A;  2BRT A;  2ZKL A;  4Z2W A;  4GJZ A;  3N9L A;  5D2A A;  2J1A A;  5DN2 A;  5FKC A;  3OGV A;  1RMU 1;  4UFJ A;  5A7W B;  2XH6 A;  1WW5 A;  4CCJ A;  5H9Q A;  5A7N A;  3ZSM A;  4NRQ A;  3THT A;  1MS1 A;  1N47 A;  2VXR A;  3D0S A;  2P3Y A;  1ENR A;  3L9J T;  5I91 A;  3K3N A;  2DCY A;  2VUD A;  2XQR A;  2GZW A;  1VRB A;  4FPJ A;  5FPX A;  1QDC A;  2XJS A;  1FMD 2;  1PHM A;  2GMP A;  3UKT A;  3U0Z A;  1PIV 2;  1AR9 1;  2ARA A;  4OUL A;  3USS A;  1ULO A;  1RUC 3;  2MNG A;  3ZXE A;  1W3V A;  3MF6 A;  3LEM A;  4QKB A;  3T0B A;  4CYD A;  1WMF A;  2R06 3;  2JX9 A;  3N9M A;  5IVC A;  1IKQ A;  3NV4 A;  2JDK A;  2WQ8 A;  4BMB A;  4UT5 A;  5BNP C;  1WW4 A;  4MXW B;  1EP0 A;  1OC1 A;  1HXS 1;  4K9S A;  4ATE A;  2WQZ C;  3U4S A;  3GNE A;  3VD4 A;  3P3N A;  3AMN A;  4TSV A;  4BM8 A;  3E5U A;  3H0O A;  4HG6 B;  5I8S A;  4CDQ C;  5E16 A;  4QMA A;  3U1X A;  1UZV A;  2DTY A;  1MS5 A;  4N7U A;  2J1S A;  4W65 A;  1CON A;  1WCK A;  3PJQ A;  3IPV A;  3P3P A;  2FCT A;  3SIS A;  1RHI 1;  2PHT A;  3MEP A;  1W6P A;  2X5I B;  4WM8 A;  2Z2S B;  4PQQ A;  1QH6 A;  1HRV 2;  3POW A;  3WLU A;  2W1S A;  4COZ A;  2Y6F A;  2ZGS A;  2Q1Z B;  3OUH A;  1MS0 A;  1LES A;  5EWS A;  4LO4 B;  4KL1 A;  1XNT A;  2XVK A;  3AL6 A;  4CU9 A;  4ZZ5 A;  1PK6 B;  3DPR C;  3M3C A;  1A6C A;  2NLR A;  4NJ4 A;  4FPG A;  4MGT A;  2D44 A;  4PT6 A;  3UT0 A;  3WNX A;  4XIL A;  1ZRE A;  4XJ8 A;  4NID A;  3NST A;  1YHF A;  4IV1 B;  1Q56 A;  1VBA 2;  3ZN4 A;  1BBT 3;  2KM2 A;  4ZS3 A;  3AKR A;  2DBN A;  3LEG A;  5GJ6 A;  3UGH A;  3AM2 A;  1Y9Q A;  1M4W A;  4Y33 A;  2WFF 3;  4XIK A;  2YPD A;  3ZPO A;  4ASL A;  3JZV A;  2PQQ A;  4E4Z A;  1ENX A;  5BV6 A;  1NZI A;  2BVB A;  3NJY A;  2WAO A;  3NO8 A;  1H6X A;  4A42 A;  2XHK A;  1LTE A;  4SBV A;  4E2Q A;  2HWF 1;  1ND2 B;  4YZ2 A;  1DG6 A;  2VNG A;  2G9Z A;  4Q4V 3;  1LKN A;  3ZDS A;  2ZPX A;  3ETQ A;  2JXA A;  1XYO A;  2FDI A;  3W21 A;  2PN5 A;  4K8F A;  4K1Z A;  4XC9 A;  1F4A A;  1QQP 1;  1RGS A;  5LY1 A;  4WVZ A;  2W5F A;  2W3J A;  2GNB A;  1BQP A;  3E5X A;  5FZA A;  5I0D A;  5AVA A;  2P3I A;  3VD9 A;  3ASI A;  2ZZJ A;  4XFI A;  4LR4 A;  5JXI A;  3HT2 A;  1H8T A;  5J1X A;  3GJB A;  3LD8 A;  3CHX A;  3FBY A;  3GAL A;  1POV 1;  1R09 3;  1XYN A;  1TME 3;  4IGO A;  5I0U A;  2R6Q A;  4A7Y A;  5C8C C;  3N36 A;  4ZKT B;  3IDE A;  1NA1 A;  2OVU A;  2TUN A;  4QX0 A;  1UMI A;  1OXC A;  1AF9 A;  3G7D A;  1JU4 A;  3E6B A;  4BK5 A;  4QB2 A;  4MAD A;  1JXN A;  2NM1 A;  2EVX A;  5A6Q A;  2R32 A;  1VBD 2;  3GZU C;  3LKJ A;  1PGL 1;  5GAL A;  3FMG A;  3PNA A;  1DFQ A;  1WD3 A;  4NPR A;  3I2G A;  4FI9 A;  1WA4 A;  3AVS A;  1ULC A;  4YWA A;  4PHZ A;  3VN4 A;  4DXT A;  3KHB A;  4YGE A;  2Z5W A;  1W8N A;  2ARE A;  2W2I A;  2VPV A;  1KEX A;  1PGW 2;  1HRI 1;  5FZF A;  4Z92 B;  4HOO A;  3TNQ A;  2WL1 A;  3VBR B;  4Q0P A;  4C0H A;  3HQX A;  2LM3 A;  2GN7 A;  2XJV A;  1SEF A;  1XPW A;  2Y64 A;  4YVS A;  2VW1 A;  3EYP A;  5LA9 A;  2VJX A;  1I9R A;  1JBC A;  2VU9 A;  1H2M A;  2BWC A;  2Q8O A;  3ZKY A;  4AHY A;  5D8A B;  3UET A;  1BVP 1;  1UF2 C;  2HJI A;  4I0A A;  1QXP A;  5CIR A;  3MHZ A;  5A7Q A;  3I3Q A;  2TBV A;  4HAN A;  5FRA A;  5KR7 A;  3NNM A;  3RZH A;  3LPF A;  2DWR A;  1MZE A;  2VQ0 A;  1D0G A;  3OGG A;  2VZ3 A;  2P34 A;  2K0G A;  5HCB A;  4BHP A;  1V9U 1;  2VUL A;  1YC6 1;  3AP5 A;  3WUC A;  5FYY A;  1QJU 2;  3OEB A;  3TN9 1;  1BKZ A;  1ZVF A;  5IAX A;  3NJZ A;  5BNN C;  5LZ6 A;  1U12 A;  4AQ2 A;  1R64 A;  5EP9 A;  1Z7S 2;  1IG0 A;  4L8Q A;  3T2T A;  4E8D A;  1Z0H A;  2ZGO A;  1FAT A;  4XF3 A;  1W9T A;  2RS1 2;  3SHR A;  1RIT A;  2DF7 A;  1G6N A;  1H4G A;  1N3O A;  3BOW A;  3WUD A;  3O1O A;  5HCA A;  4PCR A;  1PO1 2;  1SFP A;  4DY5 A;  1VBC 3;  2X5I C;  2PLV 2;  3KT4 A;  5EJ1 B;  1J1L A;  4LE4 A;  3OYW A;  1C1L A;  5GZF A;  1LOB A;  3JBG 3;  1W8F A;  2P2K A;  1CZV A;  3PL0 A;  1XNK A;  1WME A;  5GLT A;  3LIG A;  3W58 A;  2ARC A;  4CVU A;  5CIS A;  4LHL A;  5A3W A;  2WZR 1;  4AVS A;  5C5U A;  1PK6 C;  1NT0 A;  2ZOE B;  3JXS A;  5C70 A;  1DZR A;  1Q5O A;  1DU3 D;  1JYX A;  1LU1 A;  1H2N A;  4KWL A;  3T0D A;  4MYE A;  3QBQ A;  3ZMO A;  3A21 A;  4IV1 C;  1EV1 2;  2JEC A;  3MID A;  4E9K A;  3VD7 A;  1R1A 3;  1X36 A;  1SMV A;  1MS3 A;  3ZSJ A;  1JHN A;  3FE5 A;  4HN1 A;  2GC2 A;  1Q3E A;  1DQ5 A;  3WOG A;  4N43 C;  1H8V A;  3I4I A;  3ACG A;  2CGN A;  1QJY 2;  4GMP 3;  3I3E A;  1JYN A;  4YZ1 A;  3FHQ A;  4JGY A;  4AHZ A;  1OOP A;  1RUJ 1;  3I2F A;  3BKZ A;  1ND2 C;  4Q4W 1;  3N3H A;  1S0B A;  4CTE A;  4UF0 A;  3AP4 A;  4LBQ B;  1VRH 3;  2VZ1 A;  1W9S A;  3TEW A;  2BJS A;  3DEC A;  3PVN A;  4D6Q A;  1NCQ A;  1UZ0 A;  2EAL A;  4FOQ A;  4K21 A;  5FZ7 A;  1S0F A;  1DYP A;  4QGL A;  3I3M A;  3IKW A;  2Y0O A;  4QAW A;  2RMU 1;  3VHP A;  4PIY A;  2GNM A;  2UYB A;  1BMV 2;  1DGL A;  4EQV A;  3AMP A;  4CCM A;  5IK8 A;  2RM2 1;  4CEW B;  2P17 A;  3WW1 A;  5FZG A;  4MVT A;  3KD4 A;  1R08 2;  4XFC A;  1GUI A;  4JAA A;  4XAB A;  5L9R A;  4UW6 A;  3J7H A;  2QQW A;  4OCT A;  4QQL A;  4B7K A;  2KA3 A;  5EYX A;  5FLH A;  3SCG A;  1LHU A;  1OPO A;  5LAS A;  3U14 A;  2JG9 A;  2ZGP A;  5FK8 A;  3AKT A;  3K51 A;  1BLZ A;  4YPJ A;  4KWJ A;  1WD4 A;  4YW3 A;  1SFY A;  1UPI A;  2DVF A;  4BXF A;  1VP6 A;  2BGO A;  5C6C A;  1HDK A;  3IMM A;  2YV8 A;  2ZHK A;  3RSJ A;  1W2N A;  1CGP A;  4AED C;  3B7M A;  3T4V A;  1C8M 2;  1OT5 A;  4Z2A A;  1ZRF A;  5CVR A;  1U5Y A;  3R6S A;  1ZA7 A;  1W8Z A;  5CKM A;  3BPZ A;  1RJ7 A;  3KMH A;  5KC6 A;  3PUQ A;  2GSY A;  5LK5 A;  1NAE A;  3IB3 A;  4YLZ A;  4CDU C;  3MI8 A;  3ES4 A;  3ZXG A;  4IGP A;  1V6I A;  3KS7 A;  3S6P A;  1W28 A;  1YIF A;  3VDB A;  2WBK A;  1COV 3;  4RR3 B;  4M3C E;  4QXB A;  2Q8E A;  2BGC A;  3SLI A;  4ZZ8 A;  2JJ6 A;  2B7Y A;  2XVL A;  4NIA A;  5JCT A;  3W9A A;  2V5Y A;  3FZ3 A;  2WFP A;  5D8A C;  1TNR A;  1LOD A;  4FQZ A;  2RS3 1;  3OBR A;  5FOB B;  4P9G A;  1S0J A;  5ACA 1;  4IND A;  4XAA A;  3RRD A;  2DFC A;  4LT5 A;  1REE A;  4I30 A;  1AJK A;  5FYS A;  5FYB A;  2ZX4 A;  5B4X A;  4KBB A;  3ZYP A;  3ZX7 A;  1ULD A;  5K8S A;  2WT2 A;  4YRD A;  2J1T A;  1OFN A;  1BHG A;  4DZG A;  4DIQ A;  3WG4 A;  2A3Y A;  1E5S A;  3AP7 A;  4P08 A;  1N1Y A;  5F3C A;  5FO7 B;  5DXD A;  1NZC A;  2V5D A;  4P5H A;  1G9F A;  1W0P A;  3POI A;  4BH9 A;  3WDU A;  4Q4V 2;  3U4X A;  1LOF A;  1HV0 A;  3CBN A;  1LHN A;  4N53 A;  4EWD A;  4CU6 A;  5JI7 A;  1MEC 3;  2BGP A;  5FZB A;  4L99 A;  5JSP A;  1AL2 3;  4GXL A;  4XMA A;  4KH9 A;  4EWE A;  5LRS A;  3DYP A;  2MEV 3;  2VQA A;  3ZYI B;  1O4Y A;  2PYT A;  2W1Q A;  4BXS V;  1UYP A;  2EID A;  1W2U A;  5F32 A;  5F2W A;  1CAV B;  5SV8 A;  4PLO A;  2CYF A;  5CG8 A;  1LJ7 A;  2HLE A;  1ZRI A;  1GBG A;  5C4W A;  3ENR A;  4EZH A;  1XNC A;  1OHF A;  3A22 A;  3VD5 A;  4UXA A;  5DDJ 1;  3ZYG A;  5J96 B;  2QZ3 A;  5DUW A;  4DOU A;  2RS5 3;  1F4H A;  1O3R A;  3ELN A;  1DZT A;  4XDP A;  1PIV 1;  4YGB A;  1PX3 A;  2JDA A;  3SCH A;  3ZSE A;  1X9T A;  4QQP A;  1ALY A;  3J4U H;  4IES A;  4J1X A;  2J1E A;  1YJL A;  3QLQ A;  1K45 A;  1RJ8 A;  3LA2 A;  4V2W A;  2PHD A;  2HWB 1;  4HPK A;  3THD A;  1CQ9 A;  1LED A; 
#chains in the Genus database with same CATH homology
 4QB1 A;  3OGR A;  4DEQ A;  1ULP A;  3BN6 A;  1UY4 A;  3ETP A;  1EUT A;  1XNA A;  2VZO A;  1GMM A;  4ZXE A;  5DQ0 A;  3K4A A;  3FHA A;  1UY2 A;  1XC6 A;  2QQN A;  2VOT A;  2C4X A;  2E26 A;  3K4Z A;  2V72 A;  3WNM A;  1WCQ A;  1W9W A;  1MPX A;  1UXZ A;  3LEI A;  3LE0 A;  4LPL A;  4A41 A;  4JKK A;  3C7G A;  3HPN A;  4XUQ A;  2L9L A;  1UX7 A;  4XVH A;  2RVA A;  3C8X A;  4OMD A;  3FL7 A;  4QDR A;  3K75 B;  2WYS A;  2ZEZ A;  2YB7 A;  2J1V A;  3IAQ A;  3D3A A;  3LPG A;  4RYD A;  1US3 A;  2DCJ A;  1L7Q A;  2VZS A;  1PMJ X;  4CU7 A;  4UOJ A;  2C9K A;  4DEV A;  3SKV A;  3LQC A;  4D8M A;  5JR2 A;  1O59 A;  2VTF A;  3W5M A;  3HJR A;  3WNN A;  3T08 A;  2W92 A;  1JYW A;  2Y6L A;  3BGA A;  3P6B A;  3C7F A;  4QDS A;  3CZJ A;  2R7E B;  2XHN A;  2ZEY A;  1RYY A;  3HEI A;  3F2Z A;  2WN2 A;  4M4R A;  2WZE A;  5F7U A;  5HPO A;  3I2H A;  1P8J A;  3WF3 A;  3WF2 A;  3OEA A;  5JUV A;  3HNB M;  1K42 A;  2CDO A;  3ABZ A;  4BJ0 A;  1GQP A;  2W91 A;  4DUX A;  2EIE A;  4MOA A;  2ORX A;  1UY0 A;  3A23 A;  4MGQ A;  1W0N A;  3GGL A;  2LW8 A;  3T09 A;  3P1I A;  1US2 A;  2VC9 A;  1NX9 A;  1SDD B;  1YQ2 A;  4OUE A;  2VQT A;  2B4K A;  4XUP A;  2Y8K A;  2J1A A;  5DN2 A;  5G05 L;  4TXW A;  3OGV A;  3WF0 A;  2J1R A;  3LEK A;  2WAB A;  2DDU A;  3I3B A;  3OBA A;  3THC A;  3HN3 A;  4MO3 M;  2W87 A;  3SKJ E;  1ULO A;  3T2Q A;  2W1U A;  3T0B A;  2WQ8 A;  2VM9 A;  3WSO A;  1PMH X;  4PF1 A;  5IFP A;  3VD4 A;  5IYY A;  2WDB A;  2QQI A;  2YC2 A;  1J84 A;  4HG6 B;  1O8S A;  2J1S A;  3HNM A;  1W99 A;  3NJX A;  5JXJ A;  2WUH A;  1UYZ A;  4PQQ A;  2BZD A;  3I2J A;  3CZU A;  1HN1 A;  2W1S A;  2E33 A;  3ACF A;  4GZ9 A;  2VZU A;  4W8J A;  2ORZ A;  1XNT A;  4CU9 A;  4ZZ5 A;  2Y6H A;  1TG7 A;  2VZQ A;  2QQL A;  4PT6 A;  4CUA A;  2VL4 A;  3UNP A;  1JZ2 A;  4DUV A;  2QBX A;  2Y6G A;  3CQO A;  2J7M A;  2QQJ A;  4JKM A;  1UWW A;  3LEG A;  3SEP A;  2ZEW A;  1I5P A;  1K3I A;  3ECQ A;  3NRU A;  3T2P A;  4OZO A;  1NUK A;  2WAO A;  1H6X A;  4A42 A;  1GNY A;  1WKY A;  1UY1 A;  1D7P M;  2YFZ A;  2HYX A;  2W47 A;  4P5Y A;  1F4A A;  1J83 A;  1OF3 A;  3OG2 A;  1DP0 A;  4JHZ A;  2Y6J A;  2W5F A;  2W3J A;  3UES A;  5LCW L;  3PUI A;  2EIB A;  5I0D A;  3K4D A;  3VD9 A;  4QX2 A;  4ARX A;  2V4V A;  5JXI A;  5CYY A;  4LHS A;  5J1X A;  3W5N A;  2RV9 A;  5HXM A;  3CIH A;  2W46 A;  1GOF A;  4JKL A;  4JX0 A;  2VMD A;  4ZY9 A;  2VCA A;  1UYX A;  4QX0 A;  1UMI A;  2JKX A;  1JU4 A;  4BK5 A;  4QB2 A;  1JZ4 A;  4MAD A;  5G04 L;  2WN3 A;  4P00 B;  2Z4F A;  3CDZ B;  3MUZ 1;  3WQB A;  3I2G A;  4FI9 A;  4RN5 A;  1SG3 A;  4KMQ A;  4DXT A;  3C7E A;  1W8N A;  4GWJ A;  1TVG A;  1KEX A;  4LKS A;  3GM8 A;  5DPN A;  3WNO A;  1XPW A;  2Y64 A;  1SHW B;  3EYP A;  5IFT A;  4QX1 A;  4XUO A;  3WF4 A;  5C71 A;  2VJX A;  2J1U A;  3UET A;  4XZU G;  2VMC A;  3I2K A;  3CKH A;  3LPF A;  2OKX A;  4KI5 M;  4CU8 A;  2VZ3 A;  2WZ8 A;  2ID4 A;  2WO1 A;  3OEB A;  2WO2 A;  2X05 A;  3K77 A;  4IUG A;  1R64 A;  4BK4 A;  4QDQ A;  5JXH A;  1O8P A;  4E8D A;  1UYY A;  3T0A A;  1IQD C;  1UXX X;  1W9T A;  2VO5 A;  4KWU A;  5LA2 A;  2WO3 A;  3IDA A;  3WNK A;  5EJ1 B;  4DXS A;  4L0P A;  4M4P A;  2VZV A;  4OMC A;  2XON A;  3C7O A;  1CZV A;  1EUU A;  2W95 A;  1JZ3 A;  2VCC A;  4CVU A;  3III A;  5C70 A;  3JXS A;  5FUI A;  2C26 A;  2VZR A;  1JYX A;  1H6Y A;  3T0D A;  3A21 A;  3PUH A;  4CUC A;  1JZ5 A;  3VD7 A;  4QPW A;  5CZK A;  3GDB A;  3T2O A;  4MGS A;  3HOB A;  2VZT A;  2QQK A;  3ACG A;  4XUN A;  3I3E A;  3K46 A;  2BBA A;  1JYN A;  3I97 A;  2JD9 A;  3FHQ A;  5B4N A;  1L7R A;  3I2F A;  2BER A;  4DXR A;  1JU3 A;  5A1A A;  1CZT A;  2VZ1 A;  1W9S A;  3DEC A;  1DYO A;  1UZ0 A;  1T2X A;  2DCK A;  3OGS A;  2YFU A;  3NQH A;  4QAW A;  4QB6 A;  1OF4 A;  1UY3 A;  3ZM8 A;  2VME A;  4A45 A;  4TTG A;  4XUT A;  1CIY A;  3ACH A;  2W94 A;  4P02 B;  3MV0 1;  2VQU A;  3MUY 1;  1CX1 A;  1GUI A;  3WNL A;  1NKG A;  3I2I A;  3U37 A;  2E32 A;  3J7H A;  2X10 A;  4AG4 A;  2J22 A;  3ACI A;  5DMY A;  2W1W A;  3GXU A;  4LQR A;  4YPJ A;  2BGO A;  2XQX A;  4W50 A;  1K12 A;  2RJ2 A;  3DYM A;  1OT5 A;  3NNG A;  2XOM A;  1JZ6 A;  4Z2A A;  5EIY B;  2E31 A;  3MV1 1;  1LNS A;  2YC4 A;  4W4Z A;  2ZEX A;  3A7Q A;  1NAE A;  3IB3 A;  5IJR A;  2JE8 A;  3VDB A;  2WBK A;  4ZZ8 A;  1DLC A;  4OYU A;  4QX3 A;  2W9X A;  3E1F 1;  4ET7 A;  1OH4 A;  3VDA A;  1JI6 A;  1JZ7 A;  2EIC A;  3WNP A;  2CDP A;  3I3D A;  2VMF A;  3NJV A;  1KGY A;  3CMG A;  5B4X A;  2J1T A;  2WAA A;  1BHG A;  2VCB A;  2X09 A;  5LA1 A;  4E8C A;  4UI9 L;  4A4A A;  1GOG A;  3C7H A;  3DYO A;  4P08 A;  5IHR A;  4AAX A;  3VD3 A;  3VDC A;  2V5D A;  3MO4 A;  2PQS A;  5JMO A;  3EB7 A;  4ARY A;  2LS6 A;  1W8O A;  1JHJ A;  1JYV A;  4A44 A;  4CU6 A;  2BGP A;  2KD7 A;  3WF1 A;  3DYP A;  4XUR A;  1UMH A;  4A3Z A;  5LA0 A;  2W1Q A;  1PX4 A;  2QQM A;  4BXS V;  3AC0 A;  3WEZ A;  2EID A;  2YG0 A;  4CUB A;  3IAP A;  3HNY M;  1GU3 A;  2HLE A;  4UAP A;  4GWI A;  5JXG A;  3A22 A;  2VR4 A;  1JZ8 A;  3VD5 A;  1OD3 A;  3OB8 A;  2QQO A;  4A6O A;  2Y6K A;  1F4H A;  3FN9 A;  3MBW A;  2ZXQ A;  3SEE A;  4DUW A;  5C7G A;  2VZP A;  1GOH A;  1PX3 A;  2JDA A;  2J1E A;  1K45 A;  1CZS A;  2B9V A;  4D0Q A;  3THD A;  5EJZ B;  4BDV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...