3GGLA

X-ray structure of the c-terminal domain (277-440) of putative chitobiase from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr324a.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
b'DTYTGFCIIKEGTKISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPIGRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative chitobiase
molecule tags Structural genomics, unknown function
source organism Bacteroides thetaiotaomicron
publication title Northeast Structural Genomics Consortium Target BtR324A
rcsb
total genus 30
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3gglA00
1WKYA 3OEBA 3WF2A 1NUKA 3HN3A 2RVAA 1GQPA 2C9KA 4JX0A 4QDRA 1UYZA 4QX0A 1UX7A 3A22A 4MGQA 3MUY1 2EIEA 5IFTA 1UZ0A 1H6YA 5LA0A 4AAXA 2XQXA 5DPNA 1XPWA 3K75B 4TXWA 1W9SA 4A42A 1US3A 4CUAA 3ACHA 2BBAA 2ZEYA 3MV01 4FI9A 1DP0A 1JU3A 2WQ8A 4A3ZA 4PT6A 3HNYM 2BGOA 4PF1A 3VDBA 2YB7A 3W5NA 4YPJA 3P6BA 1JZ7A 2W47A 3I97A 2W1QA 2VJXA 4CU9A 3ACGA 2J1UA 4TTGA 2Y6JA 5LCWL 5LA1A 3K4ZA 3LPFA 4QB2A 2CDOA 3CZUA 3NJXA 1TG7A 1W99A 3C7HA 3K4AA 3HEIA 1O59A 3IB3A 4QB1A 2VO5A 1K3IA 1L7RA 2W95A 3FHQA 4KI5M 4W4ZA 3UNPA 2VQUA 3I2KA 4QX2A 3WNLA 1NAEA 4QDSA 3C7GA 3C7OA 1UY0A 2WAAA 3GGLA 3HNBM 5A1AA 4UAPA 5DQ0A 3WSOA 2ORXA 3HJRA 3OG2A 5JXGA 2ORZA 2RJ2A 4XURA 3NJVA 2PQSA 4UI9L 2VM9A 3A21A 2VCBA 2VMCA 4DEVA 1SDDB 1W9WA 5IHRA 2Z4FA 5C70A 4KMQA 1T2XA 4OYUA 4M4PA 4E8CA 2YFUA 4XUOA 2WUHA 3LE0A 3SEEA 1BHGA 3D3AA 3AC0A 1JZ3A 3FN9A 1SG3A 1JYXA 3J7HA 2QQIA 1O8PA 1UYYA 3I2FA 4MO3M 3K77A 4GWIA 4XUQA 4QB6A 1CX1A 2ZEXA 3MUZ1 2WN2A 1H6XA 1GOGA 4P02B 3WNMA 2QQMA 3ABZA 4BJ0A 1XNAA 4JKMA 2Y6GA 1CZTA 2WN3A 2C26A 2JDAA 2VTFA 2VCAA 2JE8A 2J7MA 2WABA 2WZ8A 2XONA 5IFPA 4JKKA 1XNTA 5HPOA 4HG6B 2WO1A 4M4RA 2Y6KA 5G04L 3DYMA 3MBWA 5JR2A 2C4XA 1GOHA 1JZ6A 1JYWA 2XHNA 4DXSA 4P5YA 4ET7A 2VOTA 1W9TA 1UY4A 1UY1A 2E31A 3IAQA 1KGYA 1GNYA 2W1UA 5FUIA 2E26A 4OUEA 3DYOA 2DCKA 2J1EA 3CZJA 2WO3A 2EIBA 3PUIA 4CU6A 1HN1A 5B4NA 4A41A 1JZ2A 1YQ2A 1J83A 2J1RA 1CIYA 1XC6A 2QBXA 3CKHA 2X09A 2B4KA 1OF3A 1SHWB 1ULOA 3VDAA 1UMIA 2KD7A 4RYDA 3VD3A 3OB8A 4PQQA 1UMHA 4LQRA 3E1F1 3IAPA 1IQDC 3K46A 4A4AA 3DECA 3T0BA 2W1WA 3IIIA 1JZ4A 3GDBA 2VZTA 2HLEA 4ZXEA 3IDAA 4QX3A 4P00B 2BZDA 4A44A 3LQCA 3T2PA 3EYPA 3LEGA 4P08A 3WNNA 3I2HA 4BK4A 3OGRA 2QQOA 4DXTA 1CZSA 1JZ8A 3T0DA 2J1VA 1F4HA 1JHJA 2E32A 2VZSA 2OKXA 3SEPA 5HXMA 5I0DA 2W5FA 2QQLA 1RYYA 3PUHA 4CU7A 4LPLA 3HOBA 3I3EA 4AG4A 1J84A 4MOAA 3THDA 5G05L 2W3JA 4UOJA 4XZUG 2Y6HA 2JD9A 4CVUA 5IYYA 2W46A 4ZY9A 2LS6A 4XUPA 4ARYA 2XOMA 2VZPA 2J1TA 4DXRA 3SKVA 4DEQA 4Z2AA 4ZZ8A 5JXJA 3WNKA 4RN5A 2E33A 3I2GA 4XUNA 3ZM8A 3P1IA 1O8SA 5F7UA 2VZ3A 2WZEA 1KEXA 2W94A 3WNPA 3FL7A 1LNSA 2ZEZA 4ARXA 1GU3A 1PMHX 1ULPA 3ETPA 3K4DA 1I5PA 1W8OA 5EIYB 1OT5A 4QPWA 3W5MA 5CYYA 3DYPA 2W91A 1OH4A 3LEKA 5DN2A 3T08A 3OGVA 1W8NA 2BERA 3BN6A 2ID4A 3CQOA 2DDUA 2WO2A 3CMGA 5IJRA 3WF0A 3NNGA 4BK5A 2V5DA 2VR4A 2V72A 2EIDA 2BGPA 1CZVA 1PX4A 3ACIA 2J1SA 2W92A 1K42A 2X10A 2VZUA 3CDZB 4DUWA 1US2A 5JMOA 3T09A 3UESA 2DCJA 2VZVA 4CUBA 2J1AA 3A7QA 3T2QA 3OEAA 3VD7A 3EB7A 5LA2A 1NX9A 3ACFA 3WNOA 4DUVA 3VD9A 1K12A 1DLCA 4LHSA 3C7FA 4XVHA 3HNMA 3ECQA 2J22A 4JHZA 3T2OA 2VMEA 4OMCA 1JU4A 1JYVA 2YC2A 1JYNA 4DUXA 2VL4A 1PX3A 1L7QA 3MV11 3C8XA 2CDPA 2ZXQA 4QDQA 2YFZA 1UXZA 2VMFA 2QQKA 1OF4A 4W50A 4CU8A 3NRUA 3THCA 5JXIA 1MPXA 4E8DA 2R7EB 3C7EA 1JZ5A 1UWWA 4LKSA 3I2IA 4L0PA 4QAWA 1R64A 2Y6LA 4D0QA 5C7GA 3MO4A 2WYSA 4ZZ5A 1P8JA 1W0NA 2WDBA 3GXUA 3I2JA 5JXHA 3I3DA 3WF3A 1EUUA 2QQNA 1GMMA 2W87A 3WF4A 3JXSA 4CUCA 2VZOA 2X05A 2VZQA 4BXSV 4A6OA 2QQJA 2VC9A 2VMDA 3LEIA 4A45A 1NKGA 2ZEWA 1EUTA 1UY2A 2VZ1A 3F2ZA 1TVGA 2WBKA 1WCQA 3VD4A 2RV9A 3HPNA 2L9LA 3FHAA 2VCCA 3UETA 2LW8A 5JUVA 3OGSA 2EICA 2V4VA 1UY3A 3WQBA 5EJZB 3VD5A 3T0AA 4BDVB 3WEZA 5CZKA 3NQHA 4GZ9A 2HYXA 4W8JA 2YG0A 3VDCA 2Y8KA 2JKXA 3A23A 2W9XA 3LPGA 4KWUA 1DYOA 4IUGA 2Y64A 4XUTA 4OMDA 3SKJE 1K45A 4D8MA 4JKLA 4QX1A 2W1SA 2B9VA 1OD3A 3GM8A 2YC4A 3WF1A 1UYXA 1D7PM 1PMJX 5C71A 3CIHA 5EJ1B 4MGSA 4OZOA 4MADA 5J1XA 1F4AA 2VZRA 3OBAA 3I3BA 5DMYA 1GUIA 2VQTA 1UXXX 3U37A 4GWJA 1JI6A 2WAOA 1GOFA 5B4XA 3BGAA
chains in the Genus database with same CATH superfamily
1GZCA 4HVRA 2ZHMA 4N53A 4Q5OA 4HBNA 2OW4A 4LIVA 1CJPA 2RMU2 2HWE3 2HH9A 2C9KA 5CFDB 4JX0A 5KXEA 1X8MA 4AOCA 4QDRA 1UYZA 2DU1A 4BQYA 2B39A 2VPVA 4FO9A 4GJYA 2LM3A 2PXJA 3A22A 1JOBA 1JS9A 1TNFA 4I30A 1WW5A 4AAXA 2GSYA 2IZWA 3FFQA 3GNEA 2A75A 2W68A 1DYKA 1DF0A 1W9SA 2QQVA 3MDPA 1HV1A 2XL7A 3DPRA 4TXWA 4A42A 1PGW1 4FTSA 4Q0PA 1NCRB 4YG6A 2RM21 3OTFA 2XJRA 3MV01 4IV1B 3TEYA 2ZACA 2X5IB 1DP0A 1OD5A 1HX6A 3B69A 3VBUA 4XJ8A 4H7MA 4NJ4A 4W6WA 2WNUC 5LATA 3RFRA 5J09A 1QMJA 4C91A 4PF1A 3VDBA 5IAVA 2YB7A 3W5NA 5A7WB 3WP6A 3P6BA 3M3IA 4XQWA 1JZ7A 2ZOEB 5T52A 4JAAA 1HXS1 1S0JA 2VJXA 3O5SA 5EV7A 4W6YA 1UO9A 1WBLA 3WQ0A 1ZZ6A 2WS91 3PJQA 5LA1A 3MI8A 3K4ZA 4EN6B 1LEDA 1UD1A 2AYHA 4QB2A 4LNVA 4CDWB 3FBMA 5JZGC 4AQ6A 2PHTA 1OKQA 1W99A 1S0BA 1ZYBA 1J3PA 5FO9B 1RUH3 1QJEA 4QB1A 2HEYF 2VO5A 2YPDA 4YVWB 5FZOA 1N1VA 1PNGA 1KD7A 1AHSA 1ULDA 4Q8LA 4W4ZA 2VW2A 1OBNA 4R4XA 2WFPA 1UOFA 4ZU4A 1RMU2 3ZVXA 2NQYA 4EJRA 4Y5SA 1IG0A 2C9AA 4DMIA 2XQRA 4CP9B 2R0HA 3C7GA 4MXWB 3RWNA 5BV6A 4K8RB 1RUH1 5DAXA 4PI0A 1SBDA 2ORXA 4XACA 1W04A 1PM4A 4BOWA 5FZ7A 1VB4A 2OQ6A 3I59A 4QPIC 1O7FA 4JGZC 1RVF3 2R043 5A6XA 1F2NA 1HB1A 1W39A 4QKNA 1AYN3 4D6SA 1NG0A 2ORZA 2Z79A 4XURA 2VM9A 3KGLA 2WKKA 3WNXA 3J7NA 2VMCA 1Y7BA 1KITA 5C70A 1I1EA 1NLRA 1VBC1 3WG4A 3ZIXA 3ORJA 2QQWA 5I8YA 1VBD3 3KCCA 1T2XA 4XFAA 2X5IC 4HT1T 2R073 2VUCA 1HIXA 3PTYA 1WMXA 4YW7A 2WUHA 3LDBA 3SEEA 4YVWC 1BHGA 3CJIC 3DXUA 3N9QA 5K7PA 5A3MA 1SG3A 2HWC3 5FDBA 4BPZA 1OMIA 1AX0A 3J7HA 2LRPA 1ENQA 1GWLA 1L7LA 3DV8A 2A1XA 1NQDA 5A7PA 5CG8A 3K77A 2DBIA 3NNMA 1AF9A 4H3WA 2MEV2 3MUZ1 3B5LB 4W65A 2GN7A 2WN2A 4HKWA 1UU4A 2QQMA 2OPWA 3ST7A 1XNAA 3MIEA 4XJAA 5FYMA 4AGVA 4Q4Y1 3M3EA 1W2AX 1GZ9A 2JDAA 3CU7A 2JE8A 2HWC1 3ZN6B 4AR2A 2FCVA 2WZ8A 4JKKA 1BBT3 2YBSA 3AKTA 3VZMA 4V2VA 5AFEA 2XJUA 4RHV2 5A3UA 4Q29A 1ASJ2 3HVDA 2V4AA 3HN1A 1W90A 3MBWA 4XF1A 2A70A 3WW2A 1Z78A 3ZN5A 4NPMA 5ISLA 2C4XA 1GOHA 1JYWA 1FNZA 4QX7A 5D8AA 4DXSA 5FTTC 2JDNA 3LDKA 3POBA 4EWAA 2BWCA 2P4EA 1COV2 3N7KA 1S2BA 1UOGA 1W9TA 4YGEA 2JE9A 1FYUA 2TUNA 1SLAA 3IAQA 1DQ4A 1LU2A 3GZTB 5ERLA 3KV4A 4NOTA 1YEWA 1ZA4A 3D82A 4UW6A 1ODNA 1NOVA 4A7ZA 4YVWA 1OQ1A 5FYCA 3NV2A 1FOD3 2HWB1 1GNYA 2W1UA 4IE4A 2XUEA 1DZTA 4XILA 5FUIA 5KHHA 4K6BA 4EN8B 2JDKA 3VBFC 2D40A 2JECA 4Y20B 3CZJA 2EIBA 2GNMA 1W6OB 4J1XA 2BEOA 5B4NA 1JZ2A 1F9KA 2WL1A 1YQ2A 2YROA 3RZKA 1J83A 5LBBA 4M01A 4JRLA 2Y38A 2CGPA 2B4KA 1OH3A 4Q0VA 4AI2A 3VDAA 4RYDA 1V70A 3IMMA 5C3PA 1W28A 2K0GA 3NNFA 5ACA2 3BPZA 4RSUA 3HT1A 3U75A 1QDOA 2D98A 2XLFA 3KGZA 2FZ1A 3QD6A 2BOJA 1AR63 1S0GA 2GNBA 2DF7A 4J1WA 5BY5A 4A4AA 3PVEA 3JBG3 3DECA 1YIFA 5B2GB 5IVJA 2CL2A 4FPOB 5L19A 1C5IA 3IIIA 2QQUA 1QJX3 1IKPA 4GALA 1QOSA 3DPRB 4YGDA 3ZLIA 3GZUC 4CCNA 4DIQA 2VOKA 1QJX2 4M0HA 4PDWB 5CIRA 5LZ6A 5JVVA 3IDAA 3POFA 4IERA 2OUHA 3WW1A 2NMOA 4LULA 4NHKA 3JD72 4P9IA 1O4TA 4DY5A 2XR4A 1NXMA 2BP6A 3LEGA 5FPAA 3WNNA 3ZXFA 2LTNA 3HAGA 3U4XA 2JXAA 3ZKYA 2ZCWA 3ZXAC 3T0DA 1F31A 4XW3A 2WO7A 3VBRC 1YFWA 4AYUA 4E4ZA 4WM8B 3PUSA 2E7AA 3J7LA 4DRRA 1JHJA 5JMCA 5APAA 5IAXA 5J3UA 1W0PA 2RS11 4LO5B 2OYZA 2DFBA 3HOBA 3I3EA 3OY8B 1YXWA 4HKOA 3ZYIB 4MOAA 1DDLA 3THDA 4AEJA 1C5HA 4AVBA 3MW2A 3D8CA 2UWAA 3RI9A 4XZUG 1RUJ2 3UKTA 3JQWA 1W6QA 4QGMA 1ND3C 4CVUA 4FOWA 1RUOA 4HMZA 1C1LA 4CSWA 4EZ4A 1F5FA 3POEA 1TME2 3QBQA 4YM1A 2E51A 3AZVA 5A32B 3NV1A 1WZXA 2HWD1 1TQ5A 5L7OB 1HQWA 2DCZA 3KCYA 4PHZA 4QXKA 2GP5A 4GAZA 3BYWA 4HLTA 4AFAA 1X36A 5F5AA 1HRV3 5JXJA 4RN5A 4BWOA 3O1RA 5IUQA 4META 4HKLA 4RQPA 4KWLA 3T1LA 2DCYA 2CAUA 5FZGA 3SHRA 1G9DA 2O1QA 1MS1A 2IXHA 2K9ZA 3OUIA 1N47A 4YZ5A 4GMP1 4GH4C 5DAPA 3WNPA 5FBJA 1H1AA 2FBEA 1PO12 2ZEZA 4KNCA 4QHOA 1GU3A 1PMHX 3OGGA 3K4DA 1FATA 1I5PA 2HWF2 4NUBA 5FZ6A 3VHOA 4ONUA 2WC2A 4XTPA 4JGYB 2HWD3 2Q30A 1OT5A 2KXLA 4QPWA 3WP4A 2VMHA 5I93A 2LROA 5CEHA 3R4UA 3DYPA 5CYYA 2W91A 1LEMA 3W5MA 5GZEA 2HWD2 4CDXC 4KBZA 4HVQA 1VBC3 3WX5A 4S2HA 3OGVA 3NL1A 4XF3A 2RG4A 1R081 2UURA 4M0NA 4EN0A 1OHFA 2BERA 3CBNA 3HBZA 1O4ZA 1W6MB 4NPRA 1SLBA 1RHI2 3H42B 2ZTNA 3CQOA 4YVSB 3F95A 4COWA 2WO2A 3JBG1 4TLFA 1YFUA 3WF0A 1RUH2 3ALQA 1LOAA 2R041 3H8XA 1AR61 2VR4A 2ZMKA 1YO8A 3AL6A 1PZ8A 2EIDA 4QXCA 1SLLA 2PAEA 3ACLA 3ROUA 4CPBD 1CZVA 1IPSA 5DZGA 1K42A 4UFJA 1IPJA 2JIJA 1DGRN 2VZUA 1REEA 2X10A 4LBOA 4XFHA 5CNAA 3ZYBA 4BQ4A 3RG0A 3DKQA 3JUUA 1YIPA 1BMV2 2XJQA 3OBRA 5C33A 5JMOA 3T09A 5CFDC 3AMNA 2D7FA 4YZ4A 5FUPA 1VPHA 2A6XA 5K0UA 3VZOA 3POIA 2G9FA 2J1AA 3QACA 1OVPA 1NCQA 4Q27A 1G86A 3OEAA 2JICA 5FY5A 4D7TA 2Y26A 3VBOA 4YLZA 4MH0E 5FZLA 3RSJA 3EO6A 3WZ1A 5EXOA 2YHJA 1OVSA 1U0AA 3ZSJA 4LT5A 3PU8A 3KV5A 4IE6A 2ZGNA 3O1UA 2OS2A 1U5IA 2ZX0A 4WM7A 1K12A 3AYEA 3WR0A 1JUIA 1RITA 4JTOA 3M7AA 1UOBA 4W6XA 2BFUS 1XYPA 1QJX1 5ABJC 1HV0A 4HPKA 1UX6A 3MLKA 1SFYA 4PF5A 2WLPA 4FXGB 4JHZA 1Y9MA 1C8M3 1K5JA 3AYDA 2BFUL 4KU8A 4BMBA 2YC2A 1YQ6A 4UFLA 4CUGA 3KWVA 1S0IA 3I3QA 1PX3A 3UK9A 4MYEA 3J7MA 3J4UH 5T54A 2WR9A 2VW0A 1RMU3 1ZZ7A 3T1MA 5GZFA 1OC1A 5FP3A 1Y3TA 4OQ9A 4EN9B 2VULA 4LBKA 4QDQA 2B7YA 4B29A 1Q3EA 1PK6C 2VH9A 2OUJA 2VCMA 4FOYA 1VBB2 4Z1VA 5C8CB 2W08A 3PUQA 2QZ3A 4CTEA 4XJUA 5JXIA 3NAPB 3ZPOA 2P3IA 2WJSA 4RA0A 3N4MA 4BIOA 1QJFA 3C7EA 1JBCA 1JZ5A 5DAVA 4LKSA 4PDWC 3NJZA 5K0UC 3RNSA 3AXEA 3OPTA 1YNAA 1V6IA 3LA3A 4D0QA 2GN3A 5C7GA 3GJAA 4OI1A 3MO4A 1JOJA 2R6QA 2V5YA 5LEJA 1H9WA 5JXHA 1D0GA 1LB2A 1EUUA 3S0MA 2QQNA 1GMMA 3TB0A 3H9AA 4FFHA 1M4WA 3RJ2X 2JG9A 1D4M1 1UNBA 2X05A 4FAGA 4YG3A 1POV3 3OSDA 4QD2A 4CDUB 1H2MA 2PA7A 3I2OA 1IZ3A 1LOCA 1VBD1 3LF7A 4A6OA 2WQZC 2QQJA 4P9GA 2VMDA 4GMP3 3LEIA 2Q8DA 1G6NA 4XBQA 1VMHA 2AEYA 2RDRA 1EUTA 3V56A 3PMSA 3PLQA 5CFCB 1AR92 1N3QA 3AZWA 2G9ZA 3BIWE 2ARXA 4BQXA 4FFIA 5HCFA 4Q4W3 1W0OA 1W8ZA 5BNNA 3VZJA 3VD4A 4AI9A 4XZPA 2WNUA 5F5QA 3ON7A 4YM2A 1CIWA 1W8FA 2E53A 3S6PA 2RV9A 5BNQA 4FAHA 4MGZE 3PIGA 2L9LA 3ZIWA 2BBVA 4DZGA 1QNWA 5CKMA 3S5QA 3UETA 1QH6A 2XJPA 1RUF1 4IEXA 1ACCA 5F3GA 5K0UB 3PNAA 3WQBA 1LULA 4RS5C 2Y60A 2ZX1A 3JB4C 1TEIA 2XL9A 2MNGA 5GZDA 2XHKA 4GULA 2A71A 3H7YA 5CZKA 3UV9A 2YUEA 3WW4A 4FP3A 4W8JA 2YG0A 3VDCA 2B45X 4GKYA 2JDYA 3T2TA 1LHNA 4Q8KA 4KL1A 5C5TA 3HQRA 3FUQA 4FT8A 4WZCA 4G3YC 1CGPA 3D0JA 4AI1A 5JSPA 1XXNA 3AZYA 2DU0A 2QDRA 2ZMNA 5KC5A 1H8VA 2W1SA 5H9RA 3I3MA 3WVJA 2JG9C 5FO7B 4A7YA 4X6QB 1ZRFA 4NIIA 2D3SA 2K2SA 3AMMA 3TN92 5FAXA 4KG0A 2A5ZA 4P5HA 4B8EA 1GWKA 1AR93 3S30A 1XOYA 5DG2A 4RR3B 1LGNA 1J59A 1UQXA 1RUI2 3ILFA 1PZ7A 4FXKB 5J1XA 1W9FA 4QPGA 3ZXEA 1BZWA 5T55A 2RDSA 4WVWA 3VBHC 4FPYA 1PGW2 2YC0A 1GUIA 3U10A 1Y9GA 1VMJA 4LBQA 1R1ZA 1JI6A 3VBUC 1KDMA 3I7DA 4CCKA 2A6WA 3BGAA 4IEVA 5L9BA 1WMFA 4I01A 3AMHA 4ISQA 4ORFA 2HWE2 1WKYA 5I8SA 2ZGLA 3OEBA 3WF2A 5KHJA 2F4PA 1VE0A 4I09A 4X8PA 5T5OA 4RHV1 5FMOS 4V1PA 3WG1A 2PLV2 3HN3A 2RVAA 3P5BA 3PIJA 4OHYA 4IE5A 5DDJ1 4QX0A 4XQ4A 2KR2A 2KA3A 5DUUA 3WT3A 1QKQA 4N53C 1UX7A 4CEWA 1DQ6A 1Q56A 1LHUA 5FOJB 4IV1A 1D2SA 4NPLA 2EIEA 1UPSA 2XPJA 3AKPA 3KD4A 5IFTA 4BHPA 3DF0A 5DPNA 1MS3A 3K75B 3MW3A 3ZX7A 4CEYC 1YLLA 1SFPA 5FZHA 4OZXA 4GJZA 1X7NA 1WCSA 4A6SA 4CUAA 5AVPA 2BBAA 3WDXA 4FI9A 2YGMA 5FP4A 2DTYA 1TE1B 3GZEA 4LBNA 4LHNA 1A3KA 5FO8B 5FZAA 1PIV2 4PT6A 2YY1A 4Q26A 3HNYM 1YQCA 2RM23 1DBNA 1GP5A 1YJLA 1OOPB 3VBHA 1WMDA 1FPN2 3I97A 4MVTA 4RD7A 1PHMA 2ARBA 2BDRA 3UGHA 3WQ1A 3IKWA 3H3UA 4TTGA 2UWCA 2Y6JA 5IATA 5GALA 3EJKA 2VQ0A 4OI4A 2PHFA 4XPVA 2YU1A 3I2DA 5CAZA 4CDQC 4E2GA 3AKQA 3ITQA 3CZUA 5JPMB 1S55A 4NO4A 1O59A 4XF0A 2IXCA 4I2OA 1K3IA 3PVBB 4LLOA 5GM0A 1VB2A 3CO2A 3FHQA 4KI5M 1W8HA 5KHGA 1QJY1 4OUMA 3UNPA 1C8NA 2QVSB 4XHXA 4CEWC 5EZWA 1G7YA 3WNLA 1RUD1 3ES1A 4QDSA 4Y3OA 1OLQA 1AR71 2BU9A 3Q8CA 5A1AA 1W9YA 1DGWX 2UYBA 2XVLA 5DQ0A 4UW5A 4NIHA 1R092 1POQA 5BUVA 2D6MA 3O7OA 1ZRCA 4NRMA 2PHUA 2FDHA 3NAPC 3LA2A 4GB31 5TSWA 2HWE1 1AJKA 5JOZA 5JXGA 5A7QA 1ZVFA 3DUIA 4HFSA 1QXPA 1R082 4CA9A 3NJVA 2PQSA 3J8F3 1DGRA 4DY3A 3A21A 1MS8A 4RQPC 4MX3A 1BEV2 1PVC2 4I02A 5FY1A 3GCWA 5IWFA 4DEVA 4Z82A 4JGYC 1W9WA 2ZAAA 4JGZA 1V0AA 2WZR3 1QH7A 2WT1A 4KMQA 3KVAA 4QQHA 3OY8A 4AFMA 5C5UA 1QXJA 1T6GC 2IUWA 2HWF1 3OF1A 2WZR1 3ZDVA 1H4GA 1COV3 4E8CA 5FYSA 1XNBA 4QGNA 4XUOA 2VAUA 1EP0A 1SBFA 3B7MA 2D44A 2ADEA 4E4SA 3LOBA 2D6PA 3QH7A 1NA1C 4GWNA 4LTAA 1JZ3A 4N43B 1O3RA 1EAH2 4L97A 4Q4X3 1X82A 3I2FA 3CL1A 4CCEA 1FOD2 2OX0A 4GWIA 4QGLA 4QB6A 3ZYFA 1CX1A 4AWDA 2ETEA 3T30A 4OCTA 5ACA1 2GC2A 4BJ0A 3KQRA 1VALA 3JCIA 3H3ZA 1E5SA 2VNGA 2Y6GA 4H14A 3LFMA 2C26A 2VTFA 4FOQA 2DYCA 2RR11 2J7MA 4Y1YA 2Q5TA 4FTBA 2XONA 3LB9A 3THTA 2XWJB 4LE4A 4BIFA 3I8TA 4HG6B 5IFPA 3V0AB 2ILMA 2VNVA 4QXBA 2Z69A 5KWRA 2RHPA 5IK4A 3I59B 3E5UA 4CDWA 1UIKA 5JR2A 3CJXA 4FQ4A 4O9EA 5JSRA 3AP9A 1AL0G 1WLCA 1W6MA 1GYKA 2WS93 2ZGKA 3GALA 1NE6A 2VOTA 4IE7A 2IFRA 4KWJA 3AB0A 4U36A 4AFBA 1SPPA 1UY4A 1UY1A 4RL7A 4PI2A 3FFZA 3EXUA 3MHZA 5IW0A 5C6CA 1WUVA 1ALYA 2SLIA 2TNFA 1W8WA 4OHZA 1S2EA 3POWA 2E26A 2H0BA 4AHZA 3MICA 5FIXA 2Y0OA 4IQPA 5FXVA 3QH6A 5K8SA 4OHXA 2TBVA 1HB3A 1V9U1 4CU6A 5BNPA 2VOXA 4LKEA 1KQRA 4EZHA 3QCWA 4N43C 1SHWB 1ULOA 5C3RA 1B35B 1NZIA 1UMIA 1AVBA 3CLPA 2R1BA 3VBUB 3VD3A 3KZ4C 3A0KA 4FP2A 3LCPA 5FXXA 3R4DB 1GFF2 1UMHA 2JDHA 1SEFA 3E1F1 4HZFA 5F3IA 3VDDB 1Z7S2 3IAPA 4AVTA 1PGSA 2P2KA 4BMEA 2XGXA 2E9QA 2ES3A 4L2NA 1S0EA 3T0BA 5J48A 4O9GA 3VZKA 1H2NA 4BA6A 1JZ4A 5FYHA 4AVSA 2DFCA 5A3NA 5IVYA 1LHOA 4XHBA 4BLJA 3EMRA 2UY8A 1XNDA 4ZXEA 1UW8A 4QX3A 2RS12 2QE3A 2ZZJA 2LALA 2BZDA 4OUSA 4YVSA 2O0OA 5GLTA 1OOPC 1AR83 4A44A 3LQCA 3T2PA 3WCSA 3ZOIA 2EXHA 3FLPA 4P08A 2G9GA 3LA7A 4ASKA 1CZSA 1JN2P 4IEUA 4LIUA 1JZ8A 3KQ4B 1NCQC 4PBPA 5FBZA 5FQ0A 3SXWA 5KXCA 3B94A 1E5RA 1MEC1 4MGKE 1F4HA 2A3WA 4LA2A 3WDUA 1NY71 1S0FA 5HXMA 4QM8A 1AZDA 1UU5A 2WFF2 5JOYA 2W5FA 5DABA 5CBLA 4CU7A 2W0XA 1OQDA 2ZX4A 5A3PA 4OVEA 1JOPA 3N7MA 2PHRA 3VBSA 3WQ7A 5D21A 1RUJ3 4D6QA 3BIEA 1HRI3 2VVFA 4UOJA 3RQ0A 1LCLA 3HBKA 2GNTA 4AQTA 2V09A 3AYCA 4UF0A 3UKNA 3PURA 3SQOA 5JZGB 2QFEA 1ZBE2 3QOPA 3E6BA 1Y9QA 1VAVA 1REFA 1ND2B 1YCIA 4LUMA 3R05A 4RGGA 4ZY9A 2ZGOA 2LS6A 4XUPA 2P3KA 5JIAA 2XOMA 3D5OA 2CGOA 2VZPA 3M4FA 2O14A 4NWWA 4XEZA 2ZZQA 3W20A 4D7YA 1OA4A 3H50A 4DEQA 5FZ0A 3R4SA 4ZZ8A 3WNKA 4UW3A 5I91A 2NP0A 4YG0A 1XE7A 2FDGA 5FRAA 5H9SA 2BNOA 4JGYA 1WBFA 3AKRA 3N7LA 4IEPA 5F7UA 3EQEA 2VZ3A 4JGZB 4AQ2A 2W94A 3WOGA 2VMGA 3H3LA 4DXZA 1PO21 5T3NA 4AI0A 2YU2A 4ARXA 1ULPA 1RB8G 5FZ4A 2CU5A 4GIQA 4HPKB 4UWDA 2JEMA 4YW4A 5EIYB 2K46A 4AVVA 1E5HA 1N1TA 1QJZA 1FMD2 2ZGPA 5FKBA 5A1LA 2FDIA 1LHVA 2P1BA 4YARA 1W6PB 5C9AA 1PK6B 2GMPA 2PTMA 2C24A 5GZCA 2XBO3 3VHRA 1GZTA 1W8NA 1ZBE3 2D6KA 3BN6A 3N36A 1N3OA 3B93A 3NVCA 2ID4A 4XDQA 5D8AB 1ND2C 5A80A 3NNLA 2DDUA 2XJVA 5IJRA 2GMEA 4NE9A 2RMU1 5D1IA 5LWBA 5F6LB 4PQ9A 2EVXA 2V72A 3V64A 1W6PA 3I54A 2BGPA 2MHFA 4UFHA 3UYJA 3ZR6A 5BNPB 1PX4A 2W92A 1UL9A 2F6BA 3KM5A 4XAEA 4KQ7A 3O12A 1TME1 3TWIA 3MPPG 3ME2A 4DUWA 1US2A 5FYBA 2JB8A 2Q1ZB 4NVPA 1POV0 2DCJA 1RUG2 2LUWA 2RS51 4K1YA 4NROA 5FPVA 4HN0A 3O0VA 4PLMA 4Z07A 2CYFA 5F37A 1RUG3 2WNUB 1WCKA 2HBTA 4QX5A 4FPLA 3ZFEB 1X50A 1RVF2 4MXWA 3PJYA 1UOJA 4IEZA 2HWF3 2IC1A 2YBKA 1O5UA 1NLQA 1Z0HA 1DIWA 1LESA 3ZMNA 5I0RA 3RYRA 5A33B 1A6CA 1UKRA 1ODMA 2C6SA 1JMUB 2BUKA 1H4HA 3BOWA 4XVHA 4XIKA 5FYUA 2FZ2A 1UIJA 2PHXA 3ECQA 3KF3A 4JC1A 3AP7A 3H1MA 2J22A 4OMCA 5E8AA 1JU4A 1F5JA 4H2AA 4HN1A 3O1VA 3RZHA 2Q8OA 1XB9A 2VL4A 4R9DA 4XMIA 3VL8A 1G9BA 2HWC2 1S2KA 1DQ2A 3PHMA 3MV11 4PIZA 1SACA 2VOVA 3O1TA 2B9UA 1LOFC 2R32A 1CWPA 4ATFA 3BU7A 1BBT1 3M3QA 4XIOA 4FPJA 2NLRA 3BKZA 4F3JA 4C0BA 1QJY3 1OA2A 2XWBB 4W50A 4ZHNA 4LBMA 3WG2A 4YW6A 3UGFA 3TYJA 1RUC1 3THCA 5EQUA 1MS4A 1ZRIA 2IXLA 1EAH1 2XB6C 4R8HA 4F8AA 3AFKA 2P17A 4ZZ5A 4MG2A 1W0NA 3I2JA 2JDZA 1PM7A 4S2FA 3I3DA 4BCUA 3FLTA 5FZMA 3B01A 3N3HA 3WF4A 1OUXA 5C3SA 1S4CA 1HXS2 4OULA 4S2DA 3MF9A 5C4WA 3WDWA 3V0AA 2VZOA 3GBFA 5FZ3A 2R071 3IMNA 2HWB2 4CEYA 5KR7A 3SH4A 2ZX2A 3K48A 3ZFEC 2QTWB 4FFGA 1R1A1 1RUE2 1RC6A 2E7QA 5F3CA 4RQPB 3M3CA 4AL9A 5GLUA 2OIIA 1HW5A 1LENA 2D3RA 2BOIA 1TMF3 3M2MA 2ZEWA 1NQJA 3VKOA 3HIFA 3NNJA 3KVBA 1ZBA2 4GB32 1OPMA 3H1YA 1GANA 2QNKA 1OSGA 1NCQB 1ZBA3 2MPFA 1Q43A 4E27A 4E2SA 1ZX5A 3L2YA 4C8DA 1AL23 3I4IA 1NCRA 2AUYA 5LASA 2GZWA 4CP9A 2BNNA 2GU9A 5FZEA 1JTZX 2AZ5A 3ZFGC 5KHIA 3S57A 3TOJA 2OA2A 1CN1A 1ASJ1 3KV9A 1NZCA 3EBRA 2LW8A 3OGSA 2O8QA 3FLRA 5BNNC 1LECA 4QXHA 4LLFA 1BVP1 4QQPA 2GH8A 1QOTA 3VD5A 4XOGA 4RHV3 3N9PA 2ERFA 4GZ9A 3NKTA 4BB3A 3ZSLA 4TYSA 2I2SA 4XYXA 1LU1A 2JKXA 2VTXJ 3LPGA 5F39A 1OLME 4AEMA 3RMYA 1DYOA 3GHNA 4BYYA 4JDNA 3K3OA 4GD4A 5A33A 2XKOA 3WP3A 4IUGA 4XE9A 4ZONA 5I8TA 4UFKA 1K45A 5J98B 3S7IA 4WM8A 5A1FA 1EY2A 1NY72 1RTVA 1V9U2 1SFNA 2SBAA 2B9VA 3K51A 4UFIA 4Y1XA 5FZKA 2BTVC 5FYZA 2YC4A 3SCFA 4MZUA 2ZA9A 3P3NA 5DXDA 1ENRA 1JYTA 5HBAA 5EJ1B 4CDUA 1VIWB 2ZBJA 3GCXA 4XFBA 2OXBA 1GR3A 1FNYA 3WDTA 2JWPA 4MADA 2BVVA 4LR4A 4Q4W2 4Q4V1 4NR1A 4PDWA 4CDQB 4LK6A 2A6VA 2YV8A 2Y6FA 1EYBA 1X9PA 4WM7C 3B02A 1U5YA 4IEYA 3I3BA 2BRTA 4BQ5A 5GLZA 3HWJA 4URAA 5DMYA 4AI8A 5LEKA 4NIDA 1UXXX 3U37A 2WNOA 1N3PA 2FHRA 4D7SA 4CP0A 5AC91 1OFNA 3AMPA 4LMFA 2DV9A 1VRH1 3WUCA 5L9RA 5B4XA 4AE2A 1W03A 2RJLA 5BNPC 2AR6A 1FMD3 3VHNA 1WW7A 4AEDA 3MIGA 3PVOA 1NUKA 5L7OA 1DQ0A 3Q8EA 4AZZA 3BTZA 2VXJA 3USUA 1O3TA 5CU1A 4A7KA 5FYIA 4ZXKA 2QQPA 1L3JA 4XFFA 3DN7A 4MGQA 3MUY1 3HQUA 2C5DA 3X29B 3Q8BA 1UZ0A 1H6YA 4YRDA 3SLIA 1VBE2 4UYBA 1AL21 4XDOA 1BK1A 2P34A 2WFF1 2X8KA 4N9HA 2D5HA 4B3NA 3IWZA 5T50A 4JQTA 3AKSA 2JENA 2Q8CA 1G9FA 5L36A 1AYM1 3AXDA 3HQXA 4IE0A 3IDBB 1ENXA 1QQP2 1PO22 2E6VA 2ZEYA 3H8OA 5JIUA 2IXJA 2P3YA 2GNDA 2R061 4OHVA 4CPBA 4RFT0 5A3LA 1K5MA 2P3JA 2CHHA 1OKOA 4A3ZA 1VAMA 4A2UA 1CR7A 3TNPB 4AVAA 1U5XA 2ZHKA 2I07B 4P9JA 5LA9A 1DQ1A 1C28A 4WVZA 1CAXB 1PIV3 4NHMA 1FV3A 3R0RA 3VKLA 4LOTA 4YPJA 4BU2A 1UZZA 3SCHA 5HCHA 4R9CA 2VVDA 3D4KA 3LIGA 3IPVA 4CU9A 2VBDA 3ZKUA 3ACGA 2J1UA 4CCDA 3BI3A 5LCWL 3Q8AA 1HRI2 4WVMB 1FPN3 5KHKA 1C57A 3IM0A 1SDWA 1YYNA 3CF6E 3CNAA 3LPFA 4XTMA 4QKBA 3W59A 3M1HA 3NJXA 1YHFA 3ENRA 1TG7A 3IB3A 4NHLA 3LFIA 5ANNA 2D5FA 1AYM2 2R063 2E63A 2WNVC 2XBO2 3WG3A 4HSJA 1L7RA 4M3CA 1AR73 1W8TA 1RUC3 1RUG1 2RS52 2W95A 1IOAA 1RHI3 2WWSA 2XLAA 4NIAA 5A6YA 5EHDA 2JKBA 4XABA 1HB4A 1DFQA 1ZZBA 1QIQA 3I2KA 4RR3A 5F8PA 5IVCA 4XJ9A 4EYUA 1V6JA 2CY6A 4E4DX 1DZQA 5FMCA 3SH5A 5FP9A 3HNBM 1CAUA 2ZGRA 3IZOA 5FPBA 3O1MA 4UAPA 5H9PA 5CFCA 4RS5A 3WSOA 2EXIA 1M06G 4AFCA 1R093 2FQPA 2NMNA 3LSDA 2ZGTA 5T5JA 2XH6A 4YZ2A 1QXRA 4YW3A 3NJYA 3FHIB 4INDA 5LBCA 5I0SA 4HONA 2WZR2 2OZJA 1SBEA 1SDDB 2QZ2A 5IHRA 2D6OX 5CFDA 5FR3A 4WZFA 3ZMOA 4YGCA 5AC93 1NE4A 2ZGUA 1XYNA 4IEQA 3D6EA 1VBC2 2D93A 2JG8A 1RJ7A 2YFUA 3K3NA 1DZRA 1V6OA 4JV4A 3LE0A 2EAAA 1XSRA 2Z2SB 4L99A 2BNMA 4OI0A 5JLVA 1X9TA 1AYM3 2R062 3AC0A 1XRUA 3D3AA 3FN9A 3IN9A 1V6NA 1VP6A 4YVSC 1QQP1 4CXXA 3ZSKA 1C8M2 4YNIA 5LRSA 2QQIA 2RS53 1O8PA 3AM2A 1UYYA 4MO3M 1QGLA 2JDMA 2ZGQA 3OPZA 4ITCA 3AMQA 1CD3G 3BOPA 4XUQA 1I9RA 5A32A 2ZEXA 4CCMA 4IGPA 1KDKA 3U78A 3DGTA 1H6XA 1GOGA 5T5PA 3ZFGA 2A73B 5FK7A 1IPKA 2YZ4A 3O14A 4LBQB 4YW5A 4ZS2A 2WN3A 3H1WA 3MYXA 1LOEA 4HOOA 1VBA2 3MIFA 1MS9A 3FMGA 1GQGA 4MHUA 3RWKX 1PGL2 4COUA 2WO1A 1C4RA 1WWYA 2XBO1 1H1IA 2VD7A 1YJKA 3GJBA 4M4RA 2WZPP 5G04L 5L9VA 1GWMA 1PK6A 5JWPA 4IETA 1REDA 5FCCA 4HSLA 1EV13 1MVQA 1UZYA 2XHNA 3ZN4A 4CCCA 2C1FA 5FOBB 4QPYA 2H6CA 2DVDA 5FP8A 3VN4A 3MPBA 2DTWA 3DKWA 4P5YA 4DOUA 3LDRA 4WM8C 5FYVA 1ULGA 2NN8A 2P6HA 3KLSA 4PIYA 2IVIB 1FAYA 1LGBA 1CPMA 1ZBA1 4BQ3A 2A3YA 3KMHA 1PNFA 4JVAA 1AR82 5HCBA 2B8MA 4LUKA 1APNA 2ZHLA 2B46X 5GLWA 1CVNA 2BYVE 4G9SB 1O3SA 1KGYA 1DU3D 1OLRA 4OUEA 4N7UA 3DYOA 4MUVA 1ZM1A 3P3PA 3NW4A 4L9BA 2J1EA 5FREA 1ZA7A 5ABJB 1O91A 2BWAA 3PUIA 3JQXA 1H8TB 2VNRA 1QY4A 2IXIA 1BMV1 2ET7A 1HQLA 1URXA 2QBXA 4QKDA 3ZO0B 4DNYA 5JOXA 3ETQA 3FJSA 5EFUA 1PZ9A 1S0DA 2Q1MA 1AJOA 3BALA 2BJSA 4X8NA 5FLIA 4YM3A 3HT2A 3S7EA 3TBDA 2XG3A 5JI7A 3BU0A 1XYOA 1B09A 1MZ5A 1GBGA 2F4LA 2GC3A 5F2WA 1IQDC 1NLSA 4LBQD 4QQ2A 1C1FA 1NA1A 1OUSA 1Z7S3 4YW2A 3RGBA 4MGTA 2R0FA 4ASMB 2W1WA 3NSTA 4E2QA 2RS33 3GDBA 1HJGA 3ZXKA 5IK8A 2RS32 5F3EA 1MZ6A 2Y33A 4WBBA 2PFWA 3OUHA 4XC9A 5LK5A 1Q8QA 4QM9A 2C0ZA 4LHLA 5A70A 1V9U3 4N7IA 4AAPA 4B4QA 2RJKA 3UGGA 3EYPA 2BGCA 4TWTA 4QQOA 3G7DA 1RUI3 1ULCA 2QQOA 3OBZA 4BQ1A 4Y33A 1A34A 3TN93 3DXTA 3ZFEA 3AX4A 3H8RA 2J1VA 2UU8A 2OKXA 2VZSA 2XVKA 4UXAA 3RDIA 2FCUA 3SEPA 3JU9A 4N8MA 5I0DA 1OURA 2AEZA 1RYYA 1U5ZA 1B35C 5FY4A 4LPLA 5H9QA 3TAYA 3WLUA 1PVXA 3Q9OA 2P37A 5J7MA 4R9AA 4K3UA 2Y34A 3JB8A 3AL5A 4LO6B 5G05L 5FMOL 1HN0A 3LZZA 2Y6HA 3N9OA 4JZRA 5DZFA 3SNMA 4TN7A 2B5HA 2JD9A 3LKJA 1IKQA 1VRH3 4BZ4A 2DVBA 2PLV3 3T4HB 5IYYA 2I45A 4I0WB 1XSQA 2WNVB 4H55A 1IQAA 3E6DA 2EXKA 2GC1A 4IL7A 3IIAA 1TME3 4I0AA 5D2AA 1XU1A 4UFMA 4AI3A 2FCTA 2J1TA 4DINB 4EV0A 5JCTA 4CDXA 5E89A 5LBFA 3SKVA 2VBPA 1LGCA 1A8DA 4FFFA 2BW8A 4CE8A 4ZU5A 4Z2AA 5A7WA 1W2UA 1W6OA 2D6NA 1C8M1 3G6JB 3L9JT 4KU7A 1PO11 3EHKA 3MLLA 5JSOA 3I2GA 4CXYA 1JH5A 4XUNA 5CG9A 4PLNA 3ZM8A 4C0HA 1O8SA 2YGLA 4JDMA 1PO13 4AFDA 2IVJA 1FI2A 1KEXA 1ST8A 2H0VA 4JCKA 1N1YA 4Y1UA 3NKGA 1AYN2 3WW3A 1YWKA 4YZ1A 1LNSA 2R1DA 4QX8A 3VGIA 5KBFA 2Q4SA 1JHNA 2AC1A 2NYYA 1BEV3 1PVC3 3CEWA 1WLTA 1ONAA 5FPLA 1WLDA 2WYFA 1OH4A 5F5IA 4COYA 5FJKA 3LEKA 3NMBA 1WW6A 2B42B 2UY9A 5DN2A 3T08A 3VBRB 3RZGA 1IS6A 1AXZA 4LJHA 3AP4A 4OFGA 4JHTA 1WA4A 3ILRA 4Y5Z0 3ZFFA 5F6KA 4YYOA 1OOPA 1YFYA 3CMGA 3R6SA 3WINE 5LBEA 1VBB1 1RUJ1 2JJ6A 2V5DA 4Q4Y3 1R091 1LOBA 3VKNA 4ES8A 1RUC2 2GMMA 3GBWA 5A7OA 1KFXL 3ACIA 2J1SA 4AGRA 1QJU2 5DG1A 4CDQA 5CVRA 1JUHA 1BLZA 4DFSA 1NCRC 1VLNA 2CWMA 3WP5A 4YFZA 4YW1A 1Q8VA 1RJ8A 2WSVA 3H8UA 5GKAC 3UESA 1V6LA 2VZVA 1UU6A 4Q4X1 4LO7A 1R1A3 3OD4A 4Y5TA 3TEWA 1BXHA 3A7QA 1RUI1 1H2KA 1C3HA 3FBYA 1VMFA 4QHZA 5LA2A 1HRI1 2CAVA 2W52A 2VY0A 1GP4A 3ZPYA 1O4YA 1NX9A 3WNOA 4Z92B 4DUVA 3RI8A 2XXZA 4XAAA 3KCXA 4ZS3A 4IGOA 1DLCA 2HEVF 4IEOA 2GDFA 4LOSA 2RS31 4FPEA 4NRPA 4AEKA 3BUCA 3HNMA 1WW4A 3POJA 1H1MA 2RDNA 2DVFA 5GLVA 4LXLA 2DVGA 3RRDA 1MQTA 3AZXA 4Q2FA 5C8WA 5FLHA 1JYVA 3ZFGB 4XETA 1HRV1 1F35A 2VXRA 4R4ZA 3B9CA 4C1XA 2BQPA 4CEWB 3U0ZA 1PGL1 4HL0A 3C8XA 1YC61 4QU1A 1GV9A 4P9WA 4B1LA 4CCLA 2ZXQA 1W2OA 4D69A 1GNZA 1RUF2 3VV1A 1RUD3 5EJ3A 4FPHA 4AQSA 2IFWA 2VMFA 3SH3A 1OF4A 1RUD2 1WD3A 4FPCA 3U14A 4CU8A 5FFOC 1DGWA 2XJTA 1LOFA 3NRUA 1MPXA 2R7EB 1GZWB 2MEV1 4XF9A 5FZBA 3KS7A 5I0UA 1KJLA 5GZGA 1KRIA 1UWWA 1CAUB 3I2IA 4YGBA 2ZKNA 4QAWA 2UWBA 1GNHA 2Y6LA 3J8F2 1HLCA 4RGKA 5CA6A 1X8EA 4NAMA 3VBRA 3D0SA 2VECA 1J3RA 1D2QA 3RVHA 2WDBA 3GXUA 3WD5A 2WRAA 1VBD2 3WF3A 2WWUA 2NPIA 3A4UA 2W87A 4LBLA 3JXSA 3BB6A 3S5AA 2FDFA 1QNYA 4Q0SA 2VTXA 4UF0B 1BEV1 1PVC1 1YRZA 2VZQA 4PBOA 3USSA 5JOWA 5KC6A 4BXSV 5IVFA 4CXWA 4Y24A 2PYTA 1CX4A 5FZFA 3I49A 1JXNA 2BV4A 4K7JA 2I74A 3BODA 1MQTC 3RMXA 3NV4A 5IVVA 1RUE3 1ULEA 5JDBA 1HB2A 1B35A 1UY2A 2VUDA 5FLJA 3ZYJB 3RYPA 2HYKA 1H0BA 1HDKA 5FYTA 4QT6A 2JB4A 1CAXA 3BPSA 4M3CF 4ATEA 1VBE1 4OQ8A 2CWSA 3OCPA 1F15A 4BLIA 3GBGA 2X29A 2VCCA 4JRAA 1W6QB 4XJZA 4LO4B 3TEXA 4QMAA 5C9AC 5JUVA 1E57A 2EICA 5DDJ3 2R30A 2V4VA 1QU0A 1W2NA 5FXZA 3SC7X 5HI0A 5IK5A 2D6LX 4YZ3A 1AX1A 1UF2C 3T0AA 2RE9A 2W39A 4MGYE 3WEZA 4COVA 4NIGA 1WCDJ 1OI6A 3NQHA 4QPGC 3SCGA 4QHBA 5FK8A 2HYXA 4GH4A 5C4WB 5DUVA 1VRH2 2W9XA 4N43A 4KWUA 1CAVA 4P14A 4FPFA 1IS3A 2F17A 2PHDA 4YWAA 1OPOA 1Q8OA 2HWB3 5FV3A 3OUJA 4HVOA 4JKLA 4CP1A 4AK3A 5CB7A 1OD3A 3AZZA 5HV4A 3MFCA 3OGJA 3KT7A 1UYXA 2DBNA 1PMJX 5EP9A 3J9SA 4LKFA 1WGPA 1KS4A 5CKQA 5C71A 1QQP3 1CAWB 1W6NB 3CIHA 3ELNA 4MGSA 4EE2A 1H9PA 4IV1C 1JYCA 1FT9A 1U12A 4CDWC 1XE8A 3O0XA 3H7JA 1D4VB 1F4AA 3J26N 1GQHA 5E16A 3RJRA 3E5XA 3ZYRA 5IVBA 2RM22 3OBAA 4NMIA 1ND3A 4LK7A 4UT5A 2VQTA 5IT6A 2GP3A 3APBA 3ZYGA 4A3XA 1POV1 2XVGA 4V2WA 2CSGA 2WAOA 1S1AA 1GOFA 1PMIA 5AVAA 3FC0A 3WF1A 3UL2A 3NAPA 3VUOA 1OQEA 3WY6A 3N7JA 1MACA 3WHTA 1I6XA 3AVRA 4S2GA 5J96B 1AR62 5FY8A 1LHWA 4CDXB 1ZREA 3OD0A 2VNOA 1GQPA 2EAKA 2PAMA 2VGDA 4GQ7A 5EYYA 4DQAA 4DPNA 3IT8A 1J1TA 3KSCA 5A3OA 3DPRC 5K4LA 4GA9A 4HK9A 4QQLA 1X33A 4Q0UA 1V00A 5GJ6A 4Z8BA 4X6RB 5LA0A 2WA3A 1A8MA 2XQXA 5FZCA 2BPA2 1XPWA 3DEMA 4O61A 2IXKA 1UN1A 2AACA 2JG9B 4MLOA 5FJHA 3GYDA 3RZZA 4QKFA 4HXCA 5ABJA 5FPUA 1ZZ8A 4L92A 5FPXA 3UJQA 1US3A 3POYA 5FYYA 3ACHA 1Y4WA 2FMYA 1JODA 1AR81 3BCWA 4Y4RA 2GC0A 1LOGA 1JU3A 2V73A 1FX5A 1XE0A 2WQ8A 3NO8A 4WVMA 3MEPA 1FV2A 1G8WA 1LKNA 1UZWA 4NAOA 4Q4V3 4WM7B 2Q0AA 3OOXA 2BGOA 1FPN1 3C3VA 1RGSA 2R49A 2DUPA 4BQ2A 3IBMA 1QF3A 2W47A 4IW3A 2W1QA 1OLMA 1SQ4A 3N9MA 1V6KA 1CAVB 2A7AA 5CISA 4CRQA 3OYWA 3RPQA 1AX2A 2CDOA 3FZ3A 1CONA 2R16A 3MF6A 1SMVA 3VL9A 4AXOA 5DUWA 4K9SA 1AXKA 1DG6A 5F9TA 3C7HA 2GAUA 2AREA 3HEIA 3JZVA 3K4AA 5C3QA 4HK8A 2QKDA 1J58A 4IV3B 4Q4X2 4MGIE 3VZNA 1UYPA 1DCSA 1AR72 1QJU3 2RR12 3ZXJA 3KT1A 2YPJA 4Q0QA 3MIBA 5C8CA 2VQUA 3AJYA 3ES4A 4IDZA 3RZLA 4QX2A 1CESA 5I0TA 1NAEA 2JE7A 3ZXGA 3RS6A 3C7OA 1UY0A 1RMU1 1ZNPA 2WAAA 1RIRA 1KFUL 3GGLA 5F2SA 3VBSC 4ASLA 4BISA 4D3WA 2JDUA 2QCSB 4ZU7A 1TZOA 3HJRA 3ZXDA 2R042 4JDOA 3IDEA 1BK0A 4B4RA 1ZZCA 3OG2A 1MS5A 5FZ1A 5A6QA 1JW6A 1H8TA 3LD8A 2RJ2A 2ZPXA 1FMD1 2GALA 2JDPA 4UI9L 2PHWA 5DUXA 2VCBA 2PHLA 1R083 4J25A 4CCOA 2Z4FA 4Y22A 3LSEA 2WA4A 3PL0A 4RGAA 2R072 4O7XA 4OYUA 3VB9A 4FPKA 4M4PA 5E1RA 3ZXLA 4EQVA 3A0NA 3IPVB 2OT7A 4CDUC 5CADA 3FUOA 1JYXA 3AP6A 1XNCA 2OVUA 3AJZA 1J1LA 4K21A 4FSJA 2JG8C 5FQ0B 2Q8EA 1GZWA 1RUF3 2HJIA 1DHKB 3VKMA 1I3HA 5FPZA 3MLJA 2WT2A 3VDDC 1K5MB 3ZFFC 4XCAA 1FXZA 1GP6A 1F8VA 4P02B 3WNMA 2MEV3 4AHXA 3ABZA 1AL22 4JKMA 1SLTA 1G9AA 4I3PA 1CZTA 4LBJA 5A3WA 2VCAA 1QJY2 2OPKA 5LK7B 4BQWA 1NXD1 1CQ9A 1NT0A 2WABA 3K2OA 3WCRA 4ES9A 1RXFA 1HQNA 3V0BB 1XNTA 4XMAA 5HPOA 2VE1A 4FTEA 3H0OA 4AVCA 1SPPB 4RS5B 1EV12 2Y6KA 2WQ4A 3WV6A 3DYMA 2AGSA 3SMHA 1JZ6A 4XBLA 3VBSB 1ASJ3 2XJSA 4B1MA 5CKNA 1D4M3 3THPA 3PU3A 5FZ8A 4AEDB 4ET7A 5K9YA 4QPIB 2HEWF 2J42A 2Y0IA 4JQRA 5JPNB 2UYAA 3N35A 1JYIA 1AR91 1LTEA 3URFA 5JZGA 2YYOA 2E31A 3AP5A 2RS13 2DURA 1HJFA 3SISA 5IK7A 1EAH3 1OA3A 1LODA 2CV6A 2JG8B 2WWJA 1WCUA 3U4SA 5KXDA 2VBBA 4XFCA 1YQ8A 4LA3A 4EWDA 3NWKA 4JTNA 2DCKA 5EPAA 1W05A 4LE3A 2NZ9A 4YFWA 2G4IA 2WO3A 3ZSMA 5M0TA 2VMIA 1ULFA 1HN1A 4A41A 3LOIA 1MZEA 2J1RA 3VBHB 1CIYA 1XC6A 3POSA 2X09A 1NA1B 3CKHA 3ILNA 4CZSA 3KHCA 4P9LA 1OF3A 1I5ZA 2ENRA 3MZHA 2KD7A 3HR9A 4GKXA 2D43A 5SV5A 3U1XA 4E9KA 3OB8A 4PQQA 1GICA 4YM0A 1VBA1 5DDJ2 2WNVA 2WIIB 2G1MA 4LQRA 4NHXA 3OJBA 4RFRB 1UCXA 2NM1A 3ZFFB 5BYNA 1J3QA 1QEXA 3FX3A 3VHPA 1SLCA 3K46A 5HV0A 4FVVA 2ET1A 2A3XA 4IV3A 5FWJA 1XNKA 2VQAA 5C8CC 2CTVA 4K20A 1VJ2A 4O65A 4XJWA 4C90A 3ZDSA 4L11A 1A78A 2VZTA 2HLEA 3VKFC 3CHXA 1N1SA 2YMZA 4NN0A 2A6YA 5EWSA 4LHKA 4PCRA 3VLBB 3C2UA 2EALA 2G19A 4P00B 3TRSB 4AGGA 1MQTB 3MGUA 1HRV2 3ATGA 4Y1VA 4UW4A 1Y43B 2VUAA 4BK4A 3I2HA 2ZMLA 3OGRA 4DXTA 4E4HA 2PN5A 2WFF3 2ZGMA 2XLGA 2AENA 3MIDA 1YI7A 2E32A 4XCBA 2XDVA 3M8LA 1IS4A 4SBVA 2HKXA 1H2LA 3ZR5A 4EWEA 2Z5WA 2QQLA 4KG8A 3PUHA 3M3OA 5C9AB 3IDCB 1DYPA 1YQ5A 4XXAA 2O8OA 5E6HA 4GMP0 1UMZA 4KWKA 4HANA 1J84A 3Q8FA 5HXVA 4AG4A 4AHYA 5JAXA 3W9AA 3WXPA 1QHDA 1WA6X 3LAGA 4I0BA 4K1ZA 3ZN6A 5LW9A 5FZOB 2RMU3 2FMDA 2H6BA 2W3JA 3VBOC 3V0BA 1LR5A 1Q5OA 4DB5A 4QPGB 4WV8A 3VBFB 4LEJA 3DL3A 3KV6A 3RZMA 1KS5A 1BJQA 4PLOA 5D8AC 5EYXA 1LRHA 2DVAA 1BKZA 1SCSA 2W46A 5BPXA 1NYWA 4IV3C 4R9BA 4ARYA 2RR13 5LY1A 4DXRA 3KT4A 2VVEA 1VBE3 3GHMA 3USUB 5C3OA 4Y20A 4FCAA 1PO23 1O5LA 3JD73 5AFBA 1RL3A 2E33A 1ND2A 3POGA 4KGGA 3AFGA 4GXLA 5L73A 2PMWB 3P1IA 1IG3A 5FY9A 1R1A2 1RUE1 4ISRA 1EPWA 2VG9A 4AF9A 2WZEA 4Y22B 3OYWB 4UBHA 2E7TA 4G4FA 3TN91 3FL7A 5A7SA 1CAWA 2P6CA 3N9NA 4LITA 2XUMA 4Z2WA 5BNOA 3BTYA 1LAJA 1OXCA 2EXJA 3ETPA 3LGRA 5FUNA 2EIGA 1CPNA 3FWEA 4J6GA 1UKGA 1OFSA 1W8OA 2Q1FA 3LEMA 1COV1 1W2TA 3E6CC 2ARCA 3DCQA 4NWVA 1Q8SA 1W3XA 5DAQA 2WINB 1K5MC 4OI2A 4M00A 5FXWA 2ATFA 3B00A 1AXYA 1W8UA 4MXVA 2W2IA 5LB6A 1XJAA 4XBNA 3HMYA 4LKDA 5JI9A 2VW1A 4DO0A 1IS5A 3J8F1 4N53B 3QLQA 1Z7S1 2N7GA 3ZSEA 4ZKTB 2FD8A 1MZFA 3NNGA 1RINA 1UPIA 4BK5A 3OBTA 4CEYB 2WT0A 2VOWA 5E88A 3AVSA 3MIHA 1RUNA 3TNQA 4Q4Y2 1QWRA 3ZYPA 3VBOB 4CP2A 3CDZB 1QOOA 4XFIA 3KB5A 2ZGSA 4TSVA 2FDKA 4TZDA 3B3QE 3UT0A 4R52A 4C1WA 1ND3B 4HETA 4NRQA 1TMF1 4KGQA 4YSFA 4AEDC 5F32A 2ZABA 3BTAA 4CUBA 4F7ZA 3T2QA 3FE5A 4DRVA 4Q4V2 5JR7B 3VD7A 3EB7A 4XF4A 3WUDA 3BVCA 1BCXA 3ACFA 5AC92 1XU2A 3VD9A 1XQNA 1DGLA 1MR5A 1UZVA 5CFCC 2XKPA 3PMEA 5FWEA 3RZJA 1BQPA 1BVVA 1D4M2 4LHSA 2HBUA 4GWMA 4QU2A 5J36A 3O1OA 5BNOB 3C7FA 1GLHA 5LY2A 4D6RA 1HXS3 5DAWA 4L8QA 1VRBA 1MVEA 5FY7A 3T2OA 2CNAA 4P9XA 2VMEA 4GH4B 4MV2A 4FBFA 3KF5A 3JD71 4EN7B 5DZEA 1JYNA 4DUXA 5HCAA 1EV11 3E5QA 1ZRDA 1WD4A 2WSUA 3MFAA 1L7QA 4FPGA 2OQ7A 2WNEA 3UKVA 4OHWA 5C4WC 5SV8A 2CDPA 5F1RA 3AK0A 4UBGA 1LJ7A 3GZAA 2YFZA 1T6BX 1UXZA 4IGQA 4PJYA 4PIXA 2QQKA 3WDYA 1QJU1 1O6UA 3M70A 2EA7A 3PDQA 4P9YA 4Q1RA 4B7KA 3VDDA 4AW7A 1H30A 3WDVA 4E8DA 1SZBA 1VBB3 3B9IA 2ZX3A 2JIGA 5FP7A 1FOD1 5A3TA 5ACA3 4QPIA 1STMA 4L0PA 1R64A 3T4VA 3PTRB 2ZS6B 5ANQA 2FDJA 3W21A 4LORA 2DUOA 2WYSA 2ZJCA 2JX9A 1P8JA 1E5IA 3U11A 3HD8B 4BM8A 1AUYA 5FZDA 1QDCA 1EPZA 4RR3C 3MW4A 2CGNA 4U2AA 4CUCA 3NV3A 5FMDA 1KJRA 1ZRRA 3SITA 1IGOA 4MSVA 1WLWA 2JD4A 1RXGA 1W6NA 3LIHA 1W06A 1UAIA 2RDQA 4TLGA 3PUAA 1YUDA 2VC9A 4XQDA 1ZZ9A 2TEPA 2QDNA 1HKDA 3ASIA 1GSLA 3CJIA 1MS0A 3LWCA 4OLLA 1NKGA 4FQZA 4Y26A 4A45A 2DCTA 1G9CA 2VZ1A 2GH2A 3F2ZA 2QJVA 5F5CA 5KXBA 1TMF2 1DLLA 1YFXA 2YBPA 1TVGA 4QWNA 5FKCA 4BXFA 5BNOC 2BVBA 2WBKA 3N9LA 5FZIA 4ZPIA 3BTXA 1WCQA 4GB33 4N9IA 1O3QA 2QUOA 3AYAA 1TNRA 2KM2A 5FMBA 4F83A 3E97A 2VUJA 3CJIB 3HPNA 4Q1PA 4N90A 3FHAA 4KBBA 2IWGB 4B4PA 1VBA3 2PELA 2PAKA 1BBT2 4BE3A 1ZBE1 4AHWA 4EROA 2ZAHA 1UY3A 5FZ9A 1DQ5A 1Q8PA 5EJZB 3RYKA 2PLV1 5A7NA 2D3PA 4BDVB 3JBG2 4Y1ZA 3KHBA 1RHI1 4IEWA 4CYDA 4IESA 1SLIA 3UJOA 4H7LA 3W58A 2Y8KA 4D94A 1IHMA 2WS92 2YXSA 2AH2A 4I3GA 1S0CA 3A23A 3VZLA 5IVEA 2OZ6A 2P5BA 4K8FA 4BH9A 3O1PA 1GKBA 1D0HA 3O0WA 5BXXA 3TEZA 4Y4YA 5J37A 2Y64A 4XUTA 1W3VA 4LO8A 4OMDA 1KXGA 5T5LA 3SKJE 2EF6A 3INAA 4WVVA 4CCJA 4D8MA 2D97A 4QX1A 3T3YA 5A6ZA 3OPWA 2ADDA 2X5IA 5L7OC 1MEC2 3PVNA 3WHUA 3GM8A 4M3CB 1SCRA 5FY0A 1D7PM 3ZYHA 1MEC3 4K40A 4M3CE 3V65A 1AYN1 4MHRA 4Q4W1 4DS0A 1RVF1 2VU9A 1PIV1 4OZOA 5LRRA 1VAKA 1VR3A 2YDEA 4COZA 3O1SA 2A6ZA 2PQQA 1H8TC 4URTA 2DWRA 2ZHNA 1WMEA 2VZRA 3VBFA 2XMLA 2Z42A 2ZKLA 4FOVA 1XBFA 4KH9A 2DUQA 4XXPA 4XDPA 1V6MA 4B7EA 4IXLA 3GF6A 4GWJA 3L2HA 3U07A 2ARAA 2WLQA 1BYHA 1YI9A 4XFGA 5BNNB 4NHYA 1CJDA 2X53S 1ENSA 4SLIA
chains in the Genus database with same CATH topology
1WKYA 3OEBA 3WF2A 1NUKA 3HN3A 2RVAA 1GQPA 2C9KA 4JX0A 4QDRA 1UYZA 4QX0A 1UX7A 3A22A 4MGQA 3MUY1 2EIEA 5IFTA 1UZ0A 1H6YA 5LA0A 4AAXA 2XQXA 5DPNA 1XPWA 3K75B 4TXWA 1W9SA 4A42A 1US3A 4CUAA 3ACHA 2BBAA 2ZEYA 3MV01 4FI9A 1DP0A 1JU3A 2WQ8A 4A3ZA 4PT6A 3HNYM 2BGOA 4PF1A 3VDBA 2YB7A 3W5NA 4YPJA 3P6BA 1JZ7A 2W47A 3I97A 2W1QA 2VJXA 4CU9A 3ACGA 2J1UA 4TTGA 2Y6JA 5LCWL 5LA1A 3K4ZA 3LPFA 4QB2A 2CDOA 3CZUA 3NJXA 1TG7A 1W99A 3C7HA 3K4AA 3HEIA 1O59A 3IB3A 4QB1A 2VO5A 1K3IA 1L7RA 2W95A 3FHQA 4KI5M 4W4ZA 3UNPA 2VQUA 3I2KA 4QX2A 3WNLA 1NAEA 4QDSA 3C7GA 3C7OA 1UY0A 2WAAA 3GGLA 3HNBM 5A1AA 4UAPA 5DQ0A 3WSOA 2ORXA 3HJRA 3OG2A 5JXGA 2ORZA 2RJ2A 4XURA 3NJVA 2PQSA 4UI9L 2VM9A 3A21A 2VCBA 2VMCA 4DEVA 1SDDB 1W9WA 5IHRA 2Z4FA 5C70A 4KMQA 1T2XA 4OYUA 4M4PA 4E8CA 2YFUA 4XUOA 2WUHA 3LE0A 3SEEA 1BHGA 3D3AA 3AC0A 1JZ3A 3FN9A 1SG3A 1JYXA 3J7HA 2QQIA 1O8PA 1UYYA 3I2FA 4MO3M 3K77A 4GWIA 4XUQA 4QB6A 1CX1A 2ZEXA 3MUZ1 2WN2A 1H6XA 1GOGA 4P02B 3WNMA 2QQMA 3ABZA 4BJ0A 1XNAA 4JKMA 2Y6GA 1CZTA 2WN3A 2C26A 2JDAA 2VTFA 2VCAA 2JE8A 2J7MA 2WABA 2WZ8A 2XONA 5IFPA 4JKKA 1XNTA 5HPOA 4HG6B 2WO1A 4M4RA 2Y6KA 5G04L 3DYMA 3MBWA 5JR2A 2C4XA 1GOHA 1JZ6A 1JYWA 2XHNA 4DXSA 4P5YA 4ET7A 2VOTA 1W9TA 1UY4A 1UY1A 2E31A 3IAQA 1KGYA 1GNYA 2W1UA 5FUIA 2E26A 4OUEA 3DYOA 2DCKA 2J1EA 3CZJA 2WO3A 2EIBA 3PUIA 4CU6A 1HN1A 5B4NA 4A41A 1JZ2A 1YQ2A 1J83A 2J1RA 1CIYA 1XC6A 2QBXA 3CKHA 2X09A 2B4KA 1OF3A 1SHWB 1ULOA 3VDAA 1UMIA 2KD7A 4RYDA 3VD3A 3OB8A 4PQQA 1UMHA 4LQRA 3E1F1 3IAPA 1IQDC 3K46A 4A4AA 3DECA 3T0BA 2W1WA 3IIIA 1JZ4A 3GDBA 2VZTA 2HLEA 4ZXEA 3IDAA 4QX3A 4P00B 2BZDA 4A44A 3LQCA 3T2PA 3EYPA 3LEGA 4P08A 3WNNA 3I2HA 4BK4A 3OGRA 2QQOA 4DXTA 1CZSA 1JZ8A 3T0DA 2J1VA 1F4HA 1JHJA 2E32A 2VZSA 2OKXA 3SEPA 5HXMA 5I0DA 2W5FA 2QQLA 1RYYA 3PUHA 4CU7A 4LPLA 3HOBA 3I3EA 4AG4A 1J84A 4MOAA 3THDA 5G05L 2W3JA 4UOJA 4XZUG 2Y6HA 2JD9A 4CVUA 5IYYA 2W46A 4ZY9A 2LS6A 4XUPA 4ARYA 2XOMA 2VZPA 2J1TA 4DXRA 3SKVA 4DEQA 4Z2AA 4ZZ8A 5JXJA 3WNKA 4RN5A 2E33A 3I2GA 4XUNA 3ZM8A 3P1IA 1O8SA 5F7UA 2VZ3A 2WZEA 1KEXA 2W94A 3WNPA 3FL7A 1LNSA 2ZEZA 4ARXA 1GU3A 1PMHX 1ULPA 3ETPA 3K4DA 1I5PA 1W8OA 5EIYB 1OT5A 4QPWA 3W5MA 5CYYA 3DYPA 2W91A 1OH4A 3LEKA 5DN2A 3T08A 3OGVA 1W8NA 2BERA 3BN6A 2ID4A 3CQOA 2DDUA 2WO2A 3CMGA 5IJRA 3WF0A 3NNGA 4BK5A 2V5DA 2VR4A 2V72A 2EIDA 2BGPA 1CZVA 1PX4A 3ACIA 2J1SA 2W92A 1K42A 2X10A 2VZUA 3CDZB 4DUWA 1US2A 5JMOA 3T09A 3UESA 2DCJA 2VZVA 4CUBA 2J1AA 3A7QA 3T2QA 3OEAA 3VD7A 3EB7A 5LA2A 1NX9A 3ACFA 3WNOA 4DUVA 3VD9A 1K12A 1DLCA 4LHSA 3C7FA 4XVHA 3HNMA 3ECQA 2J22A 4JHZA 3T2OA 2VMEA 4OMCA 1JU4A 1JYVA 2YC2A 1JYNA 4DUXA 2VL4A 1PX3A 1L7QA 3MV11 3C8XA 2CDPA 2ZXQA 4QDQA 2YFZA 1UXZA 2VMFA 2QQKA 1OF4A 4W50A 4CU8A 3NRUA 3THCA 5JXIA 1MPXA 4E8DA 2R7EB 3C7EA 1JZ5A 1UWWA 4LKSA 3I2IA 4L0PA 4QAWA 1R64A 2Y6LA 4D0QA 5C7GA 3MO4A 2WYSA 4ZZ5A 1P8JA 1W0NA 2WDBA 3GXUA 3I2JA 5JXHA 3I3DA 3WF3A 1EUUA 2QQNA 1GMMA 2W87A 3WF4A 3JXSA 4CUCA 2VZOA 2X05A 2VZQA 4BXSV 4A6OA 2QQJA 2VC9A 2VMDA 3LEIA 4A45A 1NKGA 2ZEWA 1EUTA 1UY2A 2VZ1A 3F2ZA 1TVGA 2WBKA 1WCQA 3VD4A 2RV9A 3HPNA 2L9LA 3FHAA 2VCCA 3UETA 2LW8A 5JUVA 3OGSA 2EICA 2V4VA 1UY3A 3WQBA 5EJZB 3VD5A 3T0AA 4BDVB 3WEZA 5CZKA 3NQHA 4GZ9A 2HYXA 4W8JA 2YG0A 3VDCA 2Y8KA 2JKXA 3A23A 2W9XA 3LPGA 4KWUA 1DYOA 4IUGA 2Y64A 4XUTA 4OMDA 3SKJE 1K45A 4D8MA 4JKLA 4QX1A 2W1SA 2B9VA 1OD3A 3GM8A 2YC4A 3WF1A 1UYXA 1D7PM 1PMJX 5C71A 3CIHA 5EJ1B 4MGSA 4OZOA 4MADA 5J1XA 1F4AA 2VZRA 3OBAA 3I3BA 5DMYA 1GUIA 2VQTA 1UXXX 3U37A 4GWJA 1JI6A 2WAOA 1GOFA 5B4XA 3BGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKY A;  3OEB A;  3WF2 A;  1NUK A;  3HN3 A;  2RVA A;  1GQP A;  2C9K A;  4JX0 A;  4QDR A;  1UYZ A;  4QX0 A;  1UX7 A;  3A22 A;  4MGQ A;  3MUY 1;  2EIE A;  5IFT A;  1UZ0 A;  1H6Y A;  5LA0 A;  4AAX A;  2XQX A;  5DPN A;  1XPW A;  3K75 B;  4TXW A;  1W9S A;  4A42 A;  1US3 A;  4CUA A;  3ACH A;  2BBA A;  2ZEY A;  3MV0 1;  4FI9 A;  1DP0 A;  1JU3 A;  2WQ8 A;  4A3Z A;  4PT6 A;  3HNY M;  2BGO A;  4PF1 A;  3VDB A;  2YB7 A;  3W5N A;  4YPJ A;  3P6B A;  1JZ7 A;  2W47 A;  3I97 A;  2W1Q A;  2VJX A;  4CU9 A;  3ACG A;  2J1U A;  4TTG A;  2Y6J A;  5LCW L;  5LA1 A;  3K4Z A;  3LPF A;  4QB2 A;  2CDO A;  3CZU A;  3NJX A;  1TG7 A;  1W99 A;  3C7H A;  3K4A A;  3HEI A;  1O59 A;  3IB3 A;  4QB1 A;  2VO5 A;  1K3I A;  1L7R A;  2W95 A;  3FHQ A;  4KI5 M;  4W4Z A;  3UNP A;  2VQU A;  3I2K A;  4QX2 A;  3WNL A;  1NAE A;  4QDS A;  3C7G A;  3C7O A;  1UY0 A;  2WAA A;  3GGL A;  3HNB M;  5A1A A;  4UAP A;  5DQ0 A;  3WSO A;  2ORX A;  3HJR A;  3OG2 A;  5JXG A;  2ORZ A;  2RJ2 A;  4XUR A;  3NJV A;  2PQS A;  4UI9 L;  2VM9 A;  3A21 A;  2VCB A;  2VMC A;  4DEV A;  1SDD B;  1W9W A;  5IHR A;  2Z4F A;  5C70 A;  4KMQ A;  1T2X A;  4OYU A;  4M4P A;  4E8C A;  2YFU A;  4XUO A;  2WUH A;  3LE0 A;  3SEE A;  1BHG A;  3D3A A;  3AC0 A;  1JZ3 A;  3FN9 A;  1SG3 A;  1JYX A;  3J7H A;  2QQI A;  1O8P A;  1UYY A;  3I2F A;  4MO3 M;  3K77 A;  4GWI A;  4XUQ A;  4QB6 A;  1CX1 A;  2ZEX A;  3MUZ 1;  2WN2 A;  1H6X A;  1GOG A;  4P02 B;  3WNM A;  2QQM A;  3ABZ A;  4BJ0 A;  1XNA A;  4JKM A;  2Y6G A;  1CZT A;  2WN3 A;  2C26 A;  2JDA A;  2VTF A;  2VCA A;  2JE8 A;  2J7M A;  2WAB A;  2WZ8 A;  2XON A;  5IFP A;  4JKK A;  1XNT A;  5HPO A;  4HG6 B;  2WO1 A;  4M4R A;  2Y6K A;  5G04 L;  3DYM A;  3MBW A;  5JR2 A;  2C4X A;  1GOH A;  1JZ6 A;  1JYW A;  2XHN A;  4DXS A;  4P5Y A;  4ET7 A;  2VOT A;  1W9T A;  1UY4 A;  1UY1 A;  2E31 A;  3IAQ A;  1KGY A;  1GNY A;  2W1U A;  5FUI A;  2E26 A;  4OUE A;  3DYO A;  2DCK A;  2J1E A;  3CZJ A;  2WO3 A;  2EIB A;  3PUI A;  4CU6 A;  1HN1 A;  5B4N A;  4A41 A;  1JZ2 A;  1YQ2 A;  1J83 A;  2J1R A;  1CIY A;  1XC6 A;  2QBX A;  3CKH A;  2X09 A;  2B4K A;  1OF3 A;  1SHW B;  1ULO A;  3VDA A;  1UMI A;  2KD7 A;  4RYD A;  3VD3 A;  3OB8 A;  4PQQ A;  1UMH A;  4LQR A;  3E1F 1;  3IAP A;  1IQD C;  3K46 A;  4A4A A;  3DEC A;  3T0B A;  2W1W A;  3III A;  1JZ4 A;  3GDB A;  2VZT A;  2HLE A;  4ZXE A;  3IDA A;  4QX3 A;  4P00 B;  2BZD A;  4A44 A;  3LQC A;  3T2P A;  3EYP A;  3LEG A;  4P08 A;  3WNN A;  3I2H A;  4BK4 A;  3OGR A;  2QQO A;  4DXT A;  1CZS A;  1JZ8 A;  3T0D A;  2J1V A;  1F4H A;  1JHJ A;  2E32 A;  2VZS A;  2OKX A;  3SEP A;  5HXM A;  5I0D A;  2W5F A;  2QQL A;  1RYY A;  3PUH A;  4CU7 A;  4LPL A;  3HOB A;  3I3E A;  4AG4 A;  1J84 A;  4MOA A;  3THD A;  5G05 L;  2W3J A;  4UOJ A;  4XZU G;  2Y6H A;  2JD9 A;  4CVU A;  5IYY A;  2W46 A;  4ZY9 A;  2LS6 A;  4XUP A;  4ARY A;  2XOM A;  2VZP A;  2J1T A;  4DXR A;  3SKV A;  4DEQ A;  4Z2A A;  4ZZ8 A;  5JXJ A;  3WNK A;  4RN5 A;  2E33 A;  3I2G A;  4XUN A;  3ZM8 A;  3P1I A;  1O8S A;  5F7U A;  2VZ3 A;  2WZE A;  1KEX A;  2W94 A;  3WNP A;  3FL7 A;  1LNS A;  2ZEZ A;  4ARX A;  1GU3 A;  1PMH X;  1ULP A;  3ETP A;  3K4D A;  1I5P A;  1W8O A;  5EIY B;  1OT5 A;  4QPW A;  3W5M A;  5CYY A;  3DYP A;  2W91 A;  1OH4 A;  3LEK A;  5DN2 A;  3T08 A;  3OGV A;  1W8N A;  2BER A;  3BN6 A;  2ID4 A;  3CQO A;  2DDU A;  2WO2 A;  3CMG A;  5IJR A;  3WF0 A;  3NNG A;  4BK5 A;  2V5D A;  2VR4 A;  2V72 A;  2EID A;  2BGP A;  1CZV A;  1PX4 A;  3ACI A;  2J1S A;  2W92 A;  1K42 A;  2X10 A;  2VZU A;  3CDZ B;  4DUW A;  1US2 A;  5JMO A;  3T09 A;  3UES A;  2DCJ A;  2VZV A;  4CUB A;  2J1A A;  3A7Q A;  3T2Q A;  3OEA A;  3VD7 A;  3EB7 A;  5LA2 A;  1NX9 A;  3ACF A;  3WNO A;  4DUV A;  3VD9 A;  1K12 A;  1DLC A;  4LHS A;  3C7F A;  4XVH A;  3HNM A;  3ECQ A;  2J22 A;  4JHZ A;  3T2O A;  2VME A;  4OMC A;  1JU4 A;  1JYV A;  2YC2 A;  1JYN A;  4DUX A;  2VL4 A;  1PX3 A;  1L7Q A;  3MV1 1;  3C8X A;  2CDP A;  2ZXQ A;  4QDQ A;  2YFZ A;  1UXZ A;  2VMF A;  2QQK A;  1OF4 A;  4W50 A;  4CU8 A;  3NRU A;  3THC A;  5JXI A;  1MPX A;  4E8D A;  2R7E B;  3C7E A;  1JZ5 A;  1UWW A;  4LKS A;  3I2I A;  4L0P A;  4QAW A;  1R64 A;  2Y6L A;  4D0Q A;  5C7G A;  3MO4 A;  2WYS A;  4ZZ5 A;  1P8J A;  1W0N A;  2WDB A;  3GXU A;  3I2J A;  5JXH A;  3I3D A;  3WF3 A;  1EUU A;  2QQN A;  1GMM A;  2W87 A;  3WF4 A;  3JXS A;  4CUC A;  2VZO A;  2X05 A;  2VZQ A;  4BXS V;  4A6O A;  2QQJ A;  2VC9 A;  2VMD A;  3LEI A;  4A45 A;  1NKG A;  2ZEW A;  1EUT A;  1UY2 A;  2VZ1 A;  3F2Z A;  1TVG A;  2WBK A;  1WCQ A;  3VD4 A;  2RV9 A;  3HPN A;  2L9L A;  3FHA A;  2VCC A;  3UET A;  2LW8 A;  5JUV A;  3OGS A;  2EIC A;  2V4V A;  1UY3 A;  3WQB A;  5EJZ B;  3VD5 A;  3T0A A;  4BDV B;  3WEZ A;  5CZK A;  3NQH A;  4GZ9 A;  2HYX A;  4W8J A;  2YG0 A;  3VDC A;  2Y8K A;  2JKX A;  3A23 A;  2W9X A;  3LPG A;  4KWU A;  1DYO A;  4IUG A;  2Y64 A;  4XUT A;  4OMD A;  3SKJ E;  1K45 A;  4D8M A;  4JKL A;  4QX1 A;  2W1S A;  2B9V A;  1OD3 A;  3GM8 A;  2YC4 A;  3WF1 A;  1UYX A;  1D7P M;  1PMJ X;  5C71 A;  3CIH A;  5EJ1 B;  4MGS A;  4OZO A;  4MAD A;  5J1X A;  1F4A A;  2VZR A;  3OBA A;  3I3B A;  5DMY A;  1GUI A;  2VQT A;  1UXX X;  3U37 A;  4GWJ A;  1JI6 A;  2WAO A;  1GOF A;  5B4X A;  3BGA A; 
#chains in the Genus database with same CATH topology
 1GZC A;  4HVR A;  2ZHM A;  4N53 A;  4Q5O A;  4HBN A;  2OW4 A;  4LIV A;  1CJP A;  2RMU 2;  2HWE 3;  2HH9 A;  2C9K A;  5CFD B;  4JX0 A;  5KXE A;  1X8M A;  4AOC A;  4QDR A;  1UYZ A;  2DU1 A;  4BQY A;  2B39 A;  2VPV A;  4FO9 A;  4GJY A;  2LM3 A;  2PXJ A;  3A22 A;  1JOB A;  1JS9 A;  1TNF A;  4I30 A;  1WW5 A;  4AAX A;  2GSY A;  2IZW A;  3FFQ A;  3GNE A;  2A75 A;  2W68 A;  1DYK A;  1DF0 A;  1W9S A;  2QQV A;  3MDP A;  1HV1 A;  2XL7 A;  3DPR A;  4TXW A;  4A42 A;  1PGW 1;  4FTS A;  4Q0P A;  1NCR B;  4YG6 A;  2RM2 1;  3OTF A;  2XJR A;  3MV0 1;  4IV1 B;  3TEY A;  2ZAC A;  2X5I B;  1DP0 A;  1OD5 A;  1HX6 A;  3B69 A;  3VBU A;  4XJ8 A;  4H7M A;  4NJ4 A;  4W6W A;  2WNU C;  5LAT A;  3RFR A;  5J09 A;  1QMJ A;  4C91 A;  4PF1 A;  3VDB A;  5IAV A;  2YB7 A;  3W5N A;  5A7W B;  3WP6 A;  3P6B A;  3M3I A;  4XQW A;  1JZ7 A;  2ZOE B;  5T52 A;  4JAA A;  1HXS 1;  1S0J A;  2VJX A;  3O5S A;  5EV7 A;  4W6Y A;  1UO9 A;  1WBL A;  3WQ0 A;  1ZZ6 A;  2WS9 1;  3PJQ A;  5LA1 A;  3MI8 A;  3K4Z A;  4EN6 B;  1LED A;  1UD1 A;  2AYH A;  4QB2 A;  4LNV A;  4CDW B;  3FBM A;  5JZG C;  4AQ6 A;  2PHT A;  1OKQ A;  1W99 A;  1S0B A;  1ZYB A;  1J3P A;  5FO9 B;  1RUH 3;  1QJE A;  4QB1 A;  2HEY F;  2VO5 A;  2YPD A;  4YVW B;  5FZO A;  1N1V A;  1PNG A;  1KD7 A;  1AHS A;  1ULD A;  4Q8L A;  4W4Z A;  2VW2 A;  1OBN A;  4R4X A;  2WFP A;  1UOF A;  4ZU4 A;  1RMU 2;  3ZVX A;  2NQY A;  4EJR A;  4Y5S A;  1IG0 A;  2C9A A;  4DMI A;  2XQR A;  4CP9 B;  2R0H A;  3C7G A;  4MXW B;  3RWN A;  5BV6 A;  4K8R B;  1RUH 1;  5DAX A;  4PI0 A;  1SBD A;  2ORX A;  4XAC A;  1W04 A;  1PM4 A;  4BOW A;  5FZ7 A;  1VB4 A;  2OQ6 A;  3I59 A;  4QPI C;  1O7F A;  4JGZ C;  1RVF 3;  2R04 3;  5A6X A;  1F2N A;  1HB1 A;  1W39 A;  4QKN A;  1AYN 3;  4D6S A;  1NG0 A;  2ORZ A;  2Z79 A;  4XUR A;  2VM9 A;  3KGL A;  2WKK A;  3WNX A;  3J7N A;  2VMC A;  1Y7B A;  1KIT A;  5C70 A;  1I1E A;  1NLR A;  1VBC 1;  3WG4 A;  3ZIX A;  3ORJ A;  2QQW A;  5I8Y A;  1VBD 3;  3KCC A;  1T2X A;  4XFA A;  2X5I C;  4HT1 T;  2R07 3;  2VUC A;  1HIX A;  3PTY A;  1WMX A;  4YW7 A;  2WUH A;  3LDB A;  3SEE A;  4YVW C;  1BHG A;  3CJI C;  3DXU A;  3N9Q A;  5K7P A;  5A3M A;  1SG3 A;  2HWC 3;  5FDB A;  4BPZ A;  1OMI A;  1AX0 A;  3J7H A;  2LRP A;  1ENQ A;  1GWL A;  1L7L A;  3DV8 A;  2A1X A;  1NQD A;  5A7P A;  5CG8 A;  3K77 A;  2DBI A;  3NNM A;  1AF9 A;  4H3W A;  2MEV 2;  3MUZ 1;  3B5L B;  4W65 A;  2GN7 A;  2WN2 A;  4HKW A;  1UU4 A;  2QQM A;  2OPW A;  3ST7 A;  1XNA A;  3MIE A;  4XJA A;  5FYM A;  4AGV A;  4Q4Y 1;  3M3E A;  1W2A X;  1GZ9 A;  2JDA A;  3CU7 A;  2JE8 A;  2HWC 1;  3ZN6 B;  4AR2 A;  2FCV A;  2WZ8 A;  4JKK A;  1BBT 3;  2YBS A;  3AKT A;  3VZM A;  4V2V A;  5AFE A;  2XJU A;  4RHV 2;  5A3U A;  4Q29 A;  1ASJ 2;  3HVD A;  2V4A A;  3HN1 A;  1W90 A;  3MBW A;  4XF1 A;  2A70 A;  3WW2 A;  1Z78 A;  3ZN5 A;  4NPM A;  5ISL A;  2C4X A;  1GOH A;  1JYW A;  1FNZ A;  4QX7 A;  5D8A A;  4DXS A;  5FTT C;  2JDN A;  3LDK A;  3POB A;  4EWA A;  2BWC A;  2P4E A;  1COV 2;  3N7K A;  1S2B A;  1UOG A;  1W9T A;  4YGE A;  2JE9 A;  1FYU A;  2TUN A;  1SLA A;  3IAQ A;  1DQ4 A;  1LU2 A;  3GZT B;  5ERL A;  3KV4 A;  4NOT A;  1YEW A;  1ZA4 A;  3D82 A;  4UW6 A;  1ODN A;  1NOV A;  4A7Z A;  4YVW A;  1OQ1 A;  5FYC A;  3NV2 A;  1FOD 3;  2HWB 1;  1GNY A;  2W1U A;  4IE4 A;  2XUE A;  1DZT A;  4XIL A;  5FUI A;  5KHH A;  4K6B A;  4EN8 B;  2JDK A;  3VBF C;  2D40 A;  2JEC A;  4Y20 B;  3CZJ A;  2EIB A;  2GNM A;  1W6O B;  4J1X A;  2BEO A;  5B4N A;  1JZ2 A;  1F9K A;  2WL1 A;  1YQ2 A;  2YRO A;  3RZK A;  1J83 A;  5LBB A;  4M01 A;  4JRL A;  2Y38 A;  2CGP A;  2B4K A;  1OH3 A;  4Q0V A;  4AI2 A;  3VDA A;  4RYD A;  1V70 A;  3IMM A;  5C3P A;  1W28 A;  2K0G A;  3NNF A;  5ACA 2;  3BPZ A;  4RSU A;  3HT1 A;  3U75 A;  1QDO A;  2D98 A;  2XLF A;  3KGZ A;  2FZ1 A;  3QD6 A;  2BOJ A;  1AR6 3;  1S0G A;  2GNB A;  2DF7 A;  4J1W A;  5BY5 A;  4A4A A;  3PVE A;  3JBG 3;  3DEC A;  1YIF A;  5B2G B;  5IVJ A;  2CL2 A;  4FPO B;  5L19 A;  1C5I A;  3III A;  2QQU A;  1QJX 3;  1IKP A;  4GAL A;  1QOS A;  3DPR B;  4YGD A;  3ZLI A;  3GZU C;  4CCN A;  4DIQ A;  2VOK A;  1QJX 2;  4M0H A;  4PDW B;  5CIR A;  5LZ6 A;  5JVV A;  3IDA A;  3POF A;  4IER A;  2OUH A;  3WW1 A;  2NMO A;  4LUL A;  4NHK A;  3JD7 2;  4P9I A;  1O4T A;  4DY5 A;  2XR4 A;  1NXM A;  2BP6 A;  3LEG A;  5FPA A;  3WNN A;  3ZXF A;  2LTN A;  3HAG A;  3U4X A;  2JXA A;  3ZKY A;  2ZCW A;  3ZXA C;  3T0D A;  1F31 A;  4XW3 A;  2WO7 A;  3VBR C;  1YFW A;  4AYU A;  4E4Z A;  4WM8 B;  3PUS A;  2E7A A;  3J7L A;  4DRR A;  1JHJ A;  5JMC A;  5APA A;  5IAX A;  5J3U A;  1W0P A;  2RS1 1;  4LO5 B;  2OYZ A;  2DFB A;  3HOB A;  3I3E A;  3OY8 B;  1YXW A;  4HKO A;  3ZYI B;  4MOA A;  1DDL A;  3THD A;  4AEJ A;  1C5H A;  4AVB A;  3MW2 A;  3D8C A;  2UWA A;  3RI9 A;  4XZU G;  1RUJ 2;  3UKT A;  3JQW A;  1W6Q A;  4QGM A;  1ND3 C;  4CVU A;  4FOW A;  1RUO A;  4HMZ A;  1C1L A;  4CSW A;  4EZ4 A;  1F5F A;  3POE A;  1TME 2;  3QBQ A;  4YM1 A;  2E51 A;  3AZV A;  5A32 B;  3NV1 A;  1WZX A;  2HWD 1;  1TQ5 A;  5L7O B;  1HQW A;  2DCZ A;  3KCY A;  4PHZ A;  4QXK A;  2GP5 A;  4GAZ A;  3BYW A;  4HLT A;  4AFA A;  1X36 A;  5F5A A;  1HRV 3;  5JXJ A;  4RN5 A;  4BWO A;  3O1R A;  5IUQ A;  4MET A;  4HKL A;  4RQP A;  4KWL A;  3T1L A;  2DCY A;  2CAU A;  5FZG A;  3SHR A;  1G9D A;  2O1Q A;  1MS1 A;  2IXH A;  2K9Z A;  3OUI A;  1N47 A;  4YZ5 A;  4GMP 1;  4GH4 C;  5DAP A;  3WNP A;  5FBJ A;  1H1A A;  2FBE A;  1PO1 2;  2ZEZ A;  4KNC A;  4QHO A;  1GU3 A;  1PMH X;  3OGG A;  3K4D A;  1FAT A;  1I5P A;  2HWF 2;  4NUB A;  5FZ6 A;  3VHO A;  4ONU A;  2WC2 A;  4XTP A;  4JGY B;  2HWD 3;  2Q30 A;  1OT5 A;  2KXL A;  4QPW A;  3WP4 A;  2VMH A;  5I93 A;  2LRO A;  5CEH A;  3R4U A;  3DYP A;  5CYY A;  2W91 A;  1LEM A;  3W5M A;  5GZE A;  2HWD 2;  4CDX C;  4KBZ A;  4HVQ A;  1VBC 3;  3WX5 A;  4S2H A;  3OGV A;  3NL1 A;  4XF3 A;  2RG4 A;  1R08 1;  2UUR A;  4M0N A;  4EN0 A;  1OHF A;  2BER A;  3CBN A;  3HBZ A;  1O4Z A;  1W6M B;  4NPR A;  1SLB A;  1RHI 2;  3H42 B;  2ZTN A;  3CQO A;  4YVS B;  3F95 A;  4COW A;  2WO2 A;  3JBG 1;  4TLF A;  1YFU A;  3WF0 A;  1RUH 2;  3ALQ A;  1LOA A;  2R04 1;  3H8X A;  1AR6 1;  2VR4 A;  2ZMK A;  1YO8 A;  3AL6 A;  1PZ8 A;  2EID A;  4QXC A;  1SLL A;  2PAE A;  3ACL A;  3ROU A;  4CPB D;  1CZV A;  1IPS A;  5DZG A;  1K42 A;  4UFJ A;  1IPJ A;  2JIJ A;  1DGR N;  2VZU A;  1REE A;  2X10 A;  4LBO A;  4XFH A;  5CNA A;  3ZYB A;  4BQ4 A;  3RG0 A;  3DKQ A;  3JUU A;  1YIP A;  1BMV 2;  2XJQ A;  3OBR A;  5C33 A;  5JMO A;  3T09 A;  5CFD C;  3AMN A;  2D7F A;  4YZ4 A;  5FUP A;  1VPH A;  2A6X A;  5K0U A;  3VZO A;  3POI A;  2G9F A;  2J1A A;  3QAC A;  1OVP A;  1NCQ A;  4Q27 A;  1G86 A;  3OEA A;  2JIC A;  5FY5 A;  4D7T A;  2Y26 A;  3VBO A;  4YLZ A;  4MH0 E;  5FZL A;  3RSJ A;  3EO6 A;  3WZ1 A;  5EXO A;  2YHJ A;  1OVS A;  1U0A A;  3ZSJ A;  4LT5 A;  3PU8 A;  3KV5 A;  4IE6 A;  2ZGN A;  3O1U A;  2OS2 A;  1U5I A;  2ZX0 A;  4WM7 A;  1K12 A;  3AYE A;  3WR0 A;  1JUI A;  1RIT A;  4JTO A;  3M7A A;  1UOB A;  4W6X A;  2BFU S;  1XYP A;  1QJX 1;  5ABJ C;  1HV0 A;  4HPK A;  1UX6 A;  3MLK A;  1SFY A;  4PF5 A;  2WLP A;  4FXG B;  4JHZ A;  1Y9M A;  1C8M 3;  1K5J A;  3AYD A;  2BFU L;  4KU8 A;  4BMB A;  2YC2 A;  1YQ6 A;  4UFL A;  4CUG A;  3KWV A;  1S0I A;  3I3Q A;  1PX3 A;  3UK9 A;  4MYE A;  3J7M A;  3J4U H;  5T54 A;  2WR9 A;  2VW0 A;  1RMU 3;  1ZZ7 A;  3T1M A;  5GZF A;  1OC1 A;  5FP3 A;  1Y3T A;  4OQ9 A;  4EN9 B;  2VUL A;  4LBK A;  4QDQ A;  2B7Y A;  4B29 A;  1Q3E A;  1PK6 C;  2VH9 A;  2OUJ A;  2VCM A;  4FOY A;  1VBB 2;  4Z1V A;  5C8C B;  2W08 A;  3PUQ A;  2QZ3 A;  4CTE A;  4XJU A;  5JXI A;  3NAP B;  3ZPO A;  2P3I A;  2WJS A;  4RA0 A;  3N4M A;  4BIO A;  1QJF A;  3C7E A;  1JBC A;  1JZ5 A;  5DAV A;  4LKS A;  4PDW C;  3NJZ A;  5K0U C;  3RNS A;  3AXE A;  3OPT A;  1YNA A;  1V6I A;  3LA3 A;  4D0Q A;  2GN3 A;  5C7G A;  3GJA A;  4OI1 A;  3MO4 A;  1JOJ A;  2R6Q A;  2V5Y A;  5LEJ A;  1H9W A;  5JXH A;  1D0G A;  1LB2 A;  1EUU A;  3S0M A;  2QQN A;  1GMM A;  3TB0 A;  3H9A A;  4FFH A;  1M4W A;  3RJ2 X;  2JG9 A;  1D4M 1;  1UNB A;  2X05 A;  4FAG A;  4YG3 A;  1POV 3;  3OSD A;  4QD2 A;  4CDU B;  1H2M A;  2PA7 A;  3I2O A;  1IZ3 A;  1LOC A;  1VBD 1;  3LF7 A;  4A6O A;  2WQZ C;  2QQJ A;  4P9G A;  2VMD A;  4GMP 3;  3LEI A;  2Q8D A;  1G6N A;  4XBQ A;  1VMH A;  2AEY A;  2RDR A;  1EUT A;  3V56 A;  3PMS A;  3PLQ A;  5CFC B;  1AR9 2;  1N3Q A;  3AZW A;  2G9Z A;  3BIW E;  2ARX A;  4BQX A;  4FFI A;  5HCF A;  4Q4W 3;  1W0O A;  1W8Z A;  5BNN A;  3VZJ A;  3VD4 A;  4AI9 A;  4XZP A;  2WNU A;  5F5Q A;  3ON7 A;  4YM2 A;  1CIW A;  1W8F A;  2E53 A;  3S6P A;  2RV9 A;  5BNQ A;  4FAH A;  4MGZ E;  3PIG A;  2L9L A;  3ZIW A;  2BBV A;  4DZG A;  1QNW A;  5CKM A;  3S5Q A;  3UET A;  1QH6 A;  2XJP A;  1RUF 1;  4IEX A;  1ACC A;  5F3G A;  5K0U B;  3PNA A;  3WQB A;  1LUL A;  4RS5 C;  2Y60 A;  2ZX1 A;  3JB4 C;  1TEI A;  2XL9 A;  2MNG A;  5GZD A;  2XHK A;  4GUL A;  2A71 A;  3H7Y A;  5CZK A;  3UV9 A;  2YUE A;  3WW4 A;  4FP3 A;  4W8J A;  2YG0 A;  3VDC A;  2B45 X;  4GKY A;  2JDY A;  3T2T A;  1LHN A;  4Q8K A;  4KL1 A;  5C5T A;  3HQR A;  3FUQ A;  4FT8 A;  4WZC A;  4G3Y C;  1CGP A;  3D0J A;  4AI1 A;  5JSP A;  1XXN A;  3AZY A;  2DU0 A;  2QDR A;  2ZMN A;  5KC5 A;  1H8V A;  2W1S A;  5H9R A;  3I3M A;  3WVJ A;  2JG9 C;  5FO7 B;  4A7Y A;  4X6Q B;  1ZRF A;  4NII A;  2D3S A;  2K2S A;  3AMM A;  3TN9 2;  5FAX A;  4KG0 A;  2A5Z A;  4P5H A;  4B8E A;  1GWK A;  1AR9 3;  3S30 A;  1XOY A;  5DG2 A;  4RR3 B;  1LGN A;  1J59 A;  1UQX A;  1RUI 2;  3ILF A;  1PZ7 A;  4FXK B;  5J1X A;  1W9F A;  4QPG A;  3ZXE A;  1BZW A;  5T55 A;  2RDS A;  4WVW A;  3VBH C;  4FPY A;  1PGW 2;  2YC0 A;  1GUI A;  3U10 A;  1Y9G A;  1VMJ A;  4LBQ A;  1R1Z A;  1JI6 A;  3VBU C;  1KDM A;  3I7D A;  4CCK A;  2A6W A;  3BGA A;  4IEV A;  5L9B A;  1WMF A;  4I01 A;  3AMH A;  4ISQ A;  4ORF A;  2HWE 2;  1WKY A;  5I8S A;  2ZGL A;  3OEB A;  3WF2 A;  5KHJ A;  2F4P A;  1VE0 A;  4I09 A;  4X8P A;  5T5O A;  4RHV 1;  5FMO S;  4V1P A;  3WG1 A;  2PLV 2;  3HN3 A;  2RVA A;  3P5B A;  3PIJ A;  4OHY A;  4IE5 A;  5DDJ 1;  4QX0 A;  4XQ4 A;  2KR2 A;  2KA3 A;  5DUU A;  3WT3 A;  1QKQ A;  4N53 C;  1UX7 A;  4CEW A;  1DQ6 A;  1Q56 A;  1LHU A;  5FOJ B;  4IV1 A;  1D2S A;  4NPL A;  2EIE A;  1UPS A;  2XPJ A;  3AKP A;  3KD4 A;  5IFT A;  4BHP A;  3DF0 A;  5DPN A;  1MS3 A;  3K75 B;  3MW3 A;  3ZX7 A;  4CEY C;  1YLL A;  1SFP A;  5FZH A;  4OZX A;  4GJZ A;  1X7N A;  1WCS A;  4A6S A;  4CUA A;  5AVP A;  2BBA A;  3WDX A;  4FI9 A;  2YGM A;  5FP4 A;  2DTY A;  1TE1 B;  3GZE A;  4LBN A;  4LHN A;  1A3K A;  5FO8 B;  5FZA A;  1PIV 2;  4PT6 A;  2YY1 A;  4Q26 A;  3HNY M;  1YQC A;  2RM2 3;  1DBN A;  1GP5 A;  1YJL A;  1OOP B;  3VBH A;  1WMD A;  1FPN 2;  3I97 A;  4MVT A;  4RD7 A;  1PHM A;  2ARB A;  2BDR A;  3UGH A;  3WQ1 A;  3IKW A;  3H3U A;  4TTG A;  2UWC A;  2Y6J A;  5IAT A;  5GAL A;  3EJK A;  2VQ0 A;  4OI4 A;  2PHF A;  4XPV A;  2YU1 A;  3I2D A;  5CAZ A;  4CDQ C;  4E2G A;  3AKQ A;  3ITQ A;  3CZU A;  5JPM B;  1S55 A;  4NO4 A;  1O59 A;  4XF0 A;  2IXC A;  4I2O A;  1K3I A;  3PVB B;  4LLO A;  5GM0 A;  1VB2 A;  3CO2 A;  3FHQ A;  4KI5 M;  1W8H A;  5KHG A;  1QJY 1;  4OUM A;  3UNP A;  1C8N A;  2QVS B;  4XHX A;  4CEW C;  5EZW A;  1G7Y A;  3WNL A;  1RUD 1;  3ES1 A;  4QDS A;  4Y3O A;  1OLQ A;  1AR7 1;  2BU9 A;  3Q8C A;  5A1A A;  1W9Y A;  1DGW X;  2UYB A;  2XVL A;  5DQ0 A;  4UW5 A;  4NIH A;  1R09 2;  1POQ A;  5BUV A;  2D6M A;  3O7O A;  1ZRC A;  4NRM A;  2PHU A;  2FDH A;  3NAP C;  3LA2 A;  4GB3 1;  5TSW A;  2HWE 1;  1AJK A;  5JOZ A;  5JXG A;  5A7Q A;  1ZVF A;  3DUI A;  4HFS A;  1QXP A;  1R08 2;  4CA9 A;  3NJV A;  2PQS A;  3J8F 3;  1DGR A;  4DY3 A;  3A21 A;  1MS8 A;  4RQP C;  4MX3 A;  1BEV 2;  1PVC 2;  4I02 A;  5FY1 A;  3GCW A;  5IWF A;  4DEV A;  4Z82 A;  4JGY C;  1W9W A;  2ZAA A;  4JGZ A;  1V0A A;  2WZR 3;  1QH7 A;  2WT1 A;  4KMQ A;  3KVA A;  4QQH A;  3OY8 A;  4AFM A;  5C5U A;  1QXJ A;  1T6G C;  2IUW A;  2HWF 1;  3OF1 A;  2WZR 1;  3ZDV A;  1H4G A;  1COV 3;  4E8C A;  5FYS A;  1XNB A;  4QGN A;  4XUO A;  2VAU A;  1EP0 A;  1SBF A;  3B7M A;  2D44 A;  2ADE A;  4E4S A;  3LOB A;  2D6P A;  3QH7 A;  1NA1 C;  4GWN A;  4LTA A;  1JZ3 A;  4N43 B;  1O3R A;  1EAH 2;  4L97 A;  4Q4X 3;  1X82 A;  3I2F A;  3CL1 A;  4CCE A;  1FOD 2;  2OX0 A;  4GWI A;  4QGL A;  4QB6 A;  3ZYF A;  1CX1 A;  4AWD A;  2ETE A;  3T30 A;  4OCT A;  5ACA 1;  2GC2 A;  4BJ0 A;  3KQR A;  1VAL A;  3JCI A;  3H3Z A;  1E5S A;  2VNG A;  2Y6G A;  4H14 A;  3LFM A;  2C26 A;  2VTF A;  4FOQ A;  2DYC A;  2RR1 1;  2J7M A;  4Y1Y A;  2Q5T A;  4FTB A;  2XON A;  3LB9 A;  3THT A;  2XWJ B;  4LE4 A;  4BIF A;  3I8T A;  4HG6 B;  5IFP A;  3V0A B;  2ILM A;  2VNV A;  4QXB A;  2Z69 A;  5KWR A;  2RHP A;  5IK4 A;  3I59 B;  3E5U A;  4CDW A;  1UIK A;  5JR2 A;  3CJX A;  4FQ4 A;  4O9E A;  5JSR A;  3AP9 A;  1AL0 G;  1WLC A;  1W6M A;  1GYK A;  2WS9 3;  2ZGK A;  3GAL A;  1NE6 A;  2VOT A;  4IE7 A;  2IFR A;  4KWJ A;  3AB0 A;  4U36 A;  4AFB A;  1SPP A;  1UY4 A;  1UY1 A;  4RL7 A;  4PI2 A;  3FFZ A;  3EXU A;  3MHZ A;  5IW0 A;  5C6C A;  1WUV A;  1ALY A;  2SLI A;  2TNF A;  1W8W A;  4OHZ A;  1S2E A;  3POW A;  2E26 A;  2H0B A;  4AHZ A;  3MIC A;  5FIX A;  2Y0O A;  4IQP A;  5FXV A;  3QH6 A;  5K8S A;  4OHX A;  2TBV A;  1HB3 A;  1V9U 1;  4CU6 A;  5BNP A;  2VOX A;  4LKE A;  1KQR A;  4EZH A;  3QCW A;  4N43 C;  1SHW B;  1ULO A;  5C3R A;  1B35 B;  1NZI A;  1UMI A;  1AVB A;  3CLP A;  2R1B A;  3VBU B;  3VD3 A;  3KZ4 C;  3A0K A;  4FP2 A;  3LCP A;  5FXX A;  3R4D B;  1GFF 2;  1UMH A;  2JDH A;  1SEF A;  3E1F 1;  4HZF A;  5F3I A;  3VDD B;  1Z7S 2;  3IAP A;  4AVT A;  1PGS A;  2P2K A;  4BME A;  2XGX A;  2E9Q A;  2ES3 A;  4L2N A;  1S0E A;  3T0B A;  5J48 A;  4O9G A;  3VZK A;  1H2N A;  4BA6 A;  1JZ4 A;  5FYH A;  4AVS A;  2DFC A;  5A3N A;  5IVY A;  1LHO A;  4XHB A;  4BLJ A;  3EMR A;  2UY8 A;  1XND A;  4ZXE A;  1UW8 A;  4QX3 A;  2RS1 2;  2QE3 A;  2ZZJ A;  2LAL A;  2BZD A;  4OUS A;  4YVS A;  2O0O A;  5GLT A;  1OOP C;  1AR8 3;  4A44 A;  3LQC A;  3T2P A;  3WCS A;  3ZOI A;  2EXH A;  3FLP A;  4P08 A;  2G9G A;  3LA7 A;  4ASK A;  1CZS A;  1JN2 P;  4IEU A;  4LIU A;  1JZ8 A;  3KQ4 B;  1NCQ C;  4PBP A;  5FBZ A;  5FQ0 A;  3SXW A;  5KXC A;  3B94 A;  1E5R A;  1MEC 1;  4MGK E;  1F4H A;  2A3W A;  4LA2 A;  3WDU A;  1NY7 1;  1S0F A;  5HXM A;  4QM8 A;  1AZD A;  1UU5 A;  2WFF 2;  5JOY A;  2W5F A;  5DAB A;  5CBL A;  4CU7 A;  2W0X A;  1OQD A;  2ZX4 A;  5A3P A;  4OVE A;  1JOP A;  3N7M A;  2PHR A;  3VBS A;  3WQ7 A;  5D21 A;  1RUJ 3;  4D6Q A;  3BIE A;  1HRI 3;  2VVF A;  4UOJ A;  3RQ0 A;  1LCL A;  3HBK A;  2GNT A;  4AQT A;  2V09 A;  3AYC A;  4UF0 A;  3UKN A;  3PUR A;  3SQO A;  5JZG B;  2QFE A;  1ZBE 2;  3QOP A;  3E6B A;  1Y9Q A;  1VAV A;  1REF A;  1ND2 B;  1YCI A;  4LUM A;  3R05 A;  4RGG A;  4ZY9 A;  2ZGO A;  2LS6 A;  4XUP A;  2P3K A;  5JIA A;  2XOM A;  3D5O A;  2CGO A;  2VZP A;  3M4F A;  2O14 A;  4NWW A;  4XEZ A;  2ZZQ A;  3W20 A;  4D7Y A;  1OA4 A;  3H50 A;  4DEQ A;  5FZ0 A;  3R4S A;  4ZZ8 A;  3WNK A;  4UW3 A;  5I91 A;  2NP0 A;  4YG0 A;  1XE7 A;  2FDG A;  5FRA A;  5H9S A;  2BNO A;  4JGY A;  1WBF A;  3AKR A;  3N7L A;  4IEP A;  5F7U A;  3EQE A;  2VZ3 A;  4JGZ B;  4AQ2 A;  2W94 A;  3WOG A;  2VMG A;  3H3L A;  4DXZ A;  1PO2 1;  5T3N A;  4AI0 A;  2YU2 A;  4ARX A;  1ULP A;  1RB8 G;  5FZ4 A;  2CU5 A;  4GIQ A;  4HPK B;  4UWD A;  2JEM A;  4YW4 A;  5EIY B;  2K46 A;  4AVV A;  1E5H A;  1N1T A;  1QJZ A;  1FMD 2;  2ZGP A;  5FKB A;  5A1L A;  2FDI A;  1LHV A;  2P1B A;  4YAR A;  1W6P B;  5C9A A;  1PK6 B;  2GMP A;  2PTM A;  2C24 A;  5GZC A;  2XBO 3;  3VHR A;  1GZT A;  1W8N A;  1ZBE 3;  2D6K A;  3BN6 A;  3N36 A;  1N3O A;  3B93 A;  3NVC A;  2ID4 A;  4XDQ A;  5D8A B;  1ND2 C;  5A80 A;  3NNL A;  2DDU A;  2XJV A;  5IJR A;  2GME A;  4NE9 A;  2RMU 1;  5D1I A;  5LWB A;  5F6L B;  4PQ9 A;  2EVX A;  2V72 A;  3V64 A;  1W6P A;  3I54 A;  2BGP A;  2MHF A;  4UFH A;  3UYJ A;  3ZR6 A;  5BNP B;  1PX4 A;  2W92 A;  1UL9 A;  2F6B A;  3KM5 A;  4XAE A;  4KQ7 A;  3O12 A;  1TME 1;  3TWI A;  3MPP G;  3ME2 A;  4DUW A;  1US2 A;  5FYB A;  2JB8 A;  2Q1Z B;  4NVP A;  1POV 0;  2DCJ A;  1RUG 2;  2LUW A;  2RS5 1;  4K1Y A;  4NRO A;  5FPV A;  4HN0 A;  3O0V A;  4PLM A;  4Z07 A;  2CYF A;  5F37 A;  1RUG 3;  2WNU B;  1WCK A;  2HBT A;  4QX5 A;  4FPL A;  3ZFE B;  1X50 A;  1RVF 2;  4MXW A;  3PJY A;  1UOJ A;  4IEZ A;  2HWF 3;  2IC1 A;  2YBK A;  1O5U A;  1NLQ A;  1Z0H A;  1DIW A;  1LES A;  3ZMN A;  5I0R A;  3RYR A;  5A33 B;  1A6C A;  1UKR A;  1ODM A;  2C6S A;  1JMU B;  2BUK A;  1H4H A;  3BOW A;  4XVH A;  4XIK A;  5FYU A;  2FZ2 A;  1UIJ A;  2PHX A;  3ECQ A;  3KF3 A;  4JC1 A;  3AP7 A;  3H1M A;  2J22 A;  4OMC A;  5E8A A;  1JU4 A;  1F5J A;  4H2A A;  4HN1 A;  3O1V A;  3RZH A;  2Q8O A;  1XB9 A;  2VL4 A;  4R9D A;  4XMI A;  3VL8 A;  1G9B A;  2HWC 2;  1S2K A;  1DQ2 A;  3PHM A;  3MV1 1;  4PIZ A;  1SAC A;  2VOV A;  3O1T A;  2B9U A;  1LOF C;  2R32 A;  1CWP A;  4ATF A;  3BU7 A;  1BBT 1;  3M3Q A;  4XIO A;  4FPJ A;  2NLR A;  3BKZ A;  4F3J A;  4C0B A;  1QJY 3;  1OA2 A;  2XWB B;  4W50 A;  4ZHN A;  4LBM A;  3WG2 A;  4YW6 A;  3UGF A;  3TYJ A;  1RUC 1;  3THC A;  5EQU A;  1MS4 A;  1ZRI A;  2IXL A;  1EAH 1;  2XB6 C;  4R8H A;  4F8A A;  3AFK A;  2P17 A;  4ZZ5 A;  4MG2 A;  1W0N A;  3I2J A;  2JDZ A;  1PM7 A;  4S2F A;  3I3D A;  4BCU A;  3FLT A;  5FZM A;  3B01 A;  3N3H A;  3WF4 A;  1OUX A;  5C3S A;  1S4C A;  1HXS 2;  4OUL A;  4S2D A;  3MF9 A;  5C4W A;  3WDW A;  3V0A A;  2VZO A;  3GBF A;  5FZ3 A;  2R07 1;  3IMN A;  2HWB 2;  4CEY A;  5KR7 A;  3SH4 A;  2ZX2 A;  3K48 A;  3ZFE C;  2QTW B;  4FFG A;  1R1A 1;  1RUE 2;  1RC6 A;  2E7Q A;  5F3C A;  4RQP B;  3M3C A;  4AL9 A;  5GLU A;  2OII A;  1HW5 A;  1LEN A;  2D3R A;  2BOI A;  1TMF 3;  3M2M A;  2ZEW A;  1NQJ A;  3VKO A;  3HIF A;  3NNJ A;  3KVB A;  1ZBA 2;  4GB3 2;  1OPM A;  3H1Y A;  1GAN A;  2QNK A;  1OSG A;  1NCQ B;  1ZBA 3;  2MPF A;  1Q43 A;  4E27 A;  4E2S A;  1ZX5 A;  3L2Y A;  4C8D A;  1AL2 3;  3I4I A;  1NCR A;  2AUY A;  5LAS A;  2GZW A;  4CP9 A;  2BNN A;  2GU9 A;  5FZE A;  1JTZ X;  2AZ5 A;  3ZFG C;  5KHI A;  3S57 A;  3TOJ A;  2OA2 A;  1CN1 A;  1ASJ 1;  3KV9 A;  1NZC A;  3EBR A;  2LW8 A;  3OGS A;  2O8Q A;  3FLR A;  5BNN C;  1LEC A;  4QXH A;  4LLF A;  1BVP 1;  4QQP A;  2GH8 A;  1QOT A;  3VD5 A;  4XOG A;  4RHV 3;  3N9P A;  2ERF A;  4GZ9 A;  3NKT A;  4BB3 A;  3ZSL A;  4TYS A;  2I2S A;  4XYX A;  1LU1 A;  2JKX A;  2VTX J;  3LPG A;  5F39 A;  1OLM E;  4AEM A;  3RMY A;  1DYO A;  3GHN A;  4BYY A;  4JDN A;  3K3O A;  4GD4 A;  5A33 A;  2XKO A;  3WP3 A;  4IUG A;  4XE9 A;  4ZON A;  5I8T A;  4UFK A;  1K45 A;  5J98 B;  3S7I A;  4WM8 A;  5A1F A;  1EY2 A;  1NY7 2;  1RTV A;  1V9U 2;  1SFN A;  2SBA A;  2B9V A;  3K51 A;  4UFI A;  4Y1X A;  5FZK A;  2BTV C;  5FYZ A;  2YC4 A;  3SCF A;  4MZU A;  2ZA9 A;  3P3N A;  5DXD A;  1ENR A;  1JYT A;  5HBA A;  5EJ1 B;  4CDU A;  1VIW B;  2ZBJ A;  3GCX A;  4XFB A;  2OXB A;  1GR3 A;  1FNY A;  3WDT A;  2JWP A;  4MAD A;  2BVV A;  4LR4 A;  4Q4W 2;  4Q4V 1;  4NR1 A;  4PDW A;  4CDQ B;  4LK6 A;  2A6V A;  2YV8 A;  2Y6F A;  1EYB A;  1X9P A;  4WM7 C;  3B02 A;  1U5Y A;  4IEY A;  3I3B A;  2BRT A;  4BQ5 A;  5GLZ A;  3HWJ A;  4URA A;  5DMY A;  4AI8 A;  5LEK A;  4NID A;  1UXX X;  3U37 A;  2WNO A;  1N3P A;  2FHR A;  4D7S A;  4CP0 A;  5AC9 1;  1OFN A;  3AMP A;  4LMF A;  2DV9 A;  1VRH 1;  3WUC A;  5L9R A;  5B4X A;  4AE2 A;  1W03 A;  2RJL A;  5BNP C;  2AR6 A;  1FMD 3;  3VHN A;  1WW7 A;  4AED A;  3MIG A;  3PVO A;  1NUK A;  5L7O A;  1DQ0 A;  3Q8E A;  4AZZ A;  3BTZ A;  2VXJ A;  3USU A;  1O3T A;  5CU1 A;  4A7K A;  5FYI A;  4ZXK A;  2QQP A;  1L3J A;  4XFF A;  3DN7 A;  4MGQ A;  3MUY 1;  3HQU A;  2C5D A;  3X29 B;  3Q8B A;  1UZ0 A;  1H6Y A;  4YRD A;  3SLI A;  1VBE 2;  4UYB A;  1AL2 1;  4XDO A;  1BK1 A;  2P34 A;  2WFF 1;  2X8K A;  4N9H A;  2D5H A;  4B3N A;  3IWZ A;  5T50 A;  4JQT A;  3AKS A;  2JEN A;  2Q8C A;  1G9F A;  5L36 A;  1AYM 1;  3AXD A;  3HQX A;  4IE0 A;  3IDB B;  1ENX A;  1QQP 2;  1PO2 2;  2E6V A;  2ZEY A;  3H8O A;  5JIU A;  2IXJ A;  2P3Y A;  2GND A;  2R06 1;  4OHV A;  4CPB A;  4RFT 0;  5A3L A;  1K5M A;  2P3J A;  2CHH A;  1OKO A;  4A3Z A;  1VAM A;  4A2U A;  1CR7 A;  3TNP B;  4AVA A;  1U5X A;  2ZHK A;  2I07 B;  4P9J A;  5LA9 A;  1DQ1 A;  1C28 A;  4WVZ A;  1CAX B;  1PIV 3;  4NHM A;  1FV3 A;  3R0R A;  3VKL A;  4LOT A;  4YPJ A;  4BU2 A;  1UZZ A;  3SCH A;  5HCH A;  4R9C A;  2VVD A;  3D4K A;  3LIG A;  3IPV A;  4CU9 A;  2VBD A;  3ZKU A;  3ACG A;  2J1U A;  4CCD A;  3BI3 A;  5LCW L;  3Q8A A;  1HRI 2;  4WVM B;  1FPN 3;  5KHK A;  1C57 A;  3IM0 A;  1SDW A;  1YYN A;  3CF6 E;  3CNA A;  3LPF A;  4XTM A;  4QKB A;  3W59 A;  3M1H A;  3NJX A;  1YHF A;  3ENR A;  1TG7 A;  3IB3 A;  4NHL A;  3LFI A;  5ANN A;  2D5F A;  1AYM 2;  2R06 3;  2E63 A;  2WNV C;  2XBO 2;  3WG3 A;  4HSJ A;  1L7R A;  4M3C A;  1AR7 3;  1W8T A;  1RUC 3;  1RUG 1;  2RS5 2;  2W95 A;  1IOA A;  1RHI 3;  2WWS A;  2XLA A;  4NIA A;  5A6Y A;  5EHD A;  2JKB A;  4XAB A;  1HB4 A;  1DFQ A;  1ZZB A;  1QIQ A;  3I2K A;  4RR3 A;  5F8P A;  5IVC A;  4XJ9 A;  4EYU A;  1V6J A;  2CY6 A;  4E4D X;  1DZQ A;  5FMC A;  3SH5 A;  5FP9 A;  3HNB M;  1CAU A;  2ZGR A;  3IZO A;  5FPB A;  3O1M A;  4UAP A;  5H9P A;  5CFC A;  4RS5 A;  3WSO A;  2EXI A;  1M06 G;  4AFC A;  1R09 3;  2FQP A;  2NMN A;  3LSD A;  2ZGT A;  5T5J A;  2XH6 A;  4YZ2 A;  1QXR A;  4YW3 A;  3NJY A;  3FHI B;  4IND A;  5LBC A;  5I0S A;  4HON A;  2WZR 2;  2OZJ A;  1SBE A;  1SDD B;  2QZ2 A;  5IHR A;  2D6O X;  5CFD A;  5FR3 A;  4WZF A;  3ZMO A;  4YGC A;  5AC9 3;  1NE4 A;  2ZGU A;  1XYN A;  4IEQ A;  3D6E A;  1VBC 2;  2D93 A;  2JG8 A;  1RJ7 A;  2YFU A;  3K3N A;  1DZR A;  1V6O A;  4JV4 A;  3LE0 A;  2EAA A;  1XSR A;  2Z2S B;  4L99 A;  2BNM A;  4OI0 A;  5JLV A;  1X9T A;  1AYM 3;  2R06 2;  3AC0 A;  1XRU A;  3D3A A;  3FN9 A;  3IN9 A;  1V6N A;  1VP6 A;  4YVS C;  1QQP 1;  4CXX A;  3ZSK A;  1C8M 2;  4YNI A;  5LRS A;  2QQI A;  2RS5 3;  1O8P A;  3AM2 A;  1UYY A;  4MO3 M;  1QGL A;  2JDM A;  2ZGQ A;  3OPZ A;  4ITC A;  3AMQ A;  1CD3 G;  3BOP A;  4XUQ A;  1I9R A;  5A32 A;  2ZEX A;  4CCM A;  4IGP A;  1KDK A;  3U78 A;  3DGT A;  1H6X A;  1GOG A;  5T5P A;  3ZFG A;  2A73 B;  5FK7 A;  1IPK A;  2YZ4 A;  3O14 A;  4LBQ B;  4YW5 A;  4ZS2 A;  2WN3 A;  3H1W A;  3MYX A;  1LOE A;  4HOO A;  1VBA 2;  3MIF A;  1MS9 A;  3FMG A;  1GQG A;  4MHU A;  3RWK X;  1PGL 2;  4COU A;  2WO1 A;  1C4R A;  1WWY A;  2XBO 1;  1H1I A;  2VD7 A;  1YJK A;  3GJB A;  4M4R A;  2WZP P;  5G04 L;  5L9V A;  1GWM A;  1PK6 A;  5JWP A;  4IET A;  1RED A;  5FCC A;  4HSL A;  1EV1 3;  1MVQ A;  1UZY A;  2XHN A;  3ZN4 A;  4CCC A;  2C1F A;  5FOB B;  4QPY A;  2H6C A;  2DVD A;  5FP8 A;  3VN4 A;  3MPB A;  2DTW A;  3DKW A;  4P5Y A;  4DOU A;  3LDR A;  4WM8 C;  5FYV A;  1ULG A;  2NN8 A;  2P6H A;  3KLS A;  4PIY A;  2IVI B;  1FAY A;  1LGB A;  1CPM A;  1ZBA 1;  4BQ3 A;  2A3Y A;  3KMH A;  1PNF A;  4JVA A;  1AR8 2;  5HCB A;  2B8M A;  4LUK A;  1APN A;  2ZHL A;  2B46 X;  5GLW A;  1CVN A;  2BYV E;  4G9S B;  1O3S A;  1KGY A;  1DU3 D;  1OLR A;  4OUE A;  4N7U A;  3DYO A;  4MUV A;  1ZM1 A;  3P3P A;  3NW4 A;  4L9B A;  2J1E A;  5FRE A;  1ZA7 A;  5ABJ B;  1O91 A;  2BWA A;  3PUI A;  3JQX A;  1H8T B;  2VNR A;  1QY4 A;  2IXI A;  1BMV 1;  2ET7 A;  1HQL A;  1URX A;  2QBX A;  4QKD A;  3ZO0 B;  4DNY A;  5JOX A;  3ETQ A;  3FJS A;  5EFU A;  1PZ9 A;  1S0D A;  2Q1M A;  1AJO A;  3BAL A;  2BJS A;  4X8N A;  5FLI A;  4YM3 A;  3HT2 A;  3S7E A;  3TBD A;  2XG3 A;  5JI7 A;  3BU0 A;  1XYO A;  1B09 A;  1MZ5 A;  1GBG A;  2F4L A;  2GC3 A;  5F2W A;  1IQD C;  1NLS A;  4LBQ D;  4QQ2 A;  1C1F A;  1NA1 A;  1OUS A;  1Z7S 3;  4YW2 A;  3RGB A;  4MGT A;  2R0F A;  4ASM B;  2W1W A;  3NST A;  4E2Q A;  2RS3 3;  3GDB A;  1HJG A;  3ZXK A;  5IK8 A;  2RS3 2;  5F3E A;  1MZ6 A;  2Y33 A;  4WBB A;  2PFW A;  3OUH A;  4XC9 A;  5LK5 A;  1Q8Q A;  4QM9 A;  2C0Z A;  4LHL A;  5A70 A;  1V9U 3;  4N7I A;  4AAP A;  4B4Q A;  2RJK A;  3UGG A;  3EYP A;  2BGC A;  4TWT A;  4QQO A;  3G7D A;  1RUI 3;  1ULC A;  2QQO A;  3OBZ A;  4BQ1 A;  4Y33 A;  1A34 A;  3TN9 3;  3DXT A;  3ZFE A;  3AX4 A;  3H8R A;  2J1V A;  2UU8 A;  2OKX A;  2VZS A;  2XVK A;  4UXA A;  3RDI A;  2FCU A;  3SEP A;  3JU9 A;  4N8M A;  5I0D A;  1OUR A;  2AEZ A;  1RYY A;  1U5Z A;  1B35 C;  5FY4 A;  4LPL A;  5H9Q A;  3TAY A;  3WLU A;  1PVX A;  3Q9O A;  2P37 A;  5J7M A;  4R9A A;  4K3U A;  2Y34 A;  3JB8 A;  3AL5 A;  4LO6 B;  5G05 L;  5FMO L;  1HN0 A;  3LZZ A;  2Y6H A;  3N9O A;  4JZR A;  5DZF A;  3SNM A;  4TN7 A;  2B5H A;  2JD9 A;  3LKJ A;  1IKQ A;  1VRH 3;  4BZ4 A;  2DVB A;  2PLV 3;  3T4H B;  5IYY A;  2I45 A;  4I0W B;  1XSQ A;  2WNV B;  4H55 A;  1IQA A;  3E6D A;  2EXK A;  2GC1 A;  4IL7 A;  3IIA A;  1TME 3;  4I0A A;  5D2A A;  1XU1 A;  4UFM A;  4AI3 A;  2FCT A;  2J1T A;  4DIN B;  4EV0 A;  5JCT A;  4CDX A;  5E89 A;  5LBF A;  3SKV A;  2VBP A;  1LGC A;  1A8D A;  4FFF A;  2BW8 A;  4CE8 A;  4ZU5 A;  4Z2A A;  5A7W A;  1W2U A;  1W6O A;  2D6N A;  1C8M 1;  3G6J B;  3L9J T;  4KU7 A;  1PO1 1;  3EHK A;  3MLL A;  5JSO A;  3I2G A;  4CXY A;  1JH5 A;  4XUN A;  5CG9 A;  4PLN A;  3ZM8 A;  4C0H A;  1O8S A;  2YGL A;  4JDM A;  1PO1 3;  4AFD A;  2IVJ A;  1FI2 A;  1KEX A;  1ST8 A;  2H0V A;  4JCK A;  1N1Y A;  4Y1U A;  3NKG A;  1AYN 2;  3WW3 A;  1YWK A;  4YZ1 A;  1LNS A;  2R1D A;  4QX8 A;  3VGI A;  5KBF A;  2Q4S A;  1JHN A;  2AC1 A;  2NYY A;  1BEV 3;  1PVC 3;  3CEW A;  1WLT A;  1ONA A;  5FPL A;  1WLD A;  2WYF A;  1OH4 A;  5F5I A;  4COY A;  5FJK A;  3LEK A;  3NMB A;  1WW6 A;  2B42 B;  2UY9 A;  5DN2 A;  3T08 A;  3VBR B;  3RZG A;  1IS6 A;  1AXZ A;  4LJH A;  3AP4 A;  4OFG A;  4JHT A;  1WA4 A;  3ILR A;  4Y5Z 0;  3ZFF A;  5F6K A;  4YYO A;  1OOP A;  1YFY A;  3CMG A;  3R6S A;  3WIN E;  5LBE A;  1VBB 1;  1RUJ 1;  2JJ6 A;  2V5D A;  4Q4Y 3;  1R09 1;  1LOB A;  3VKN A;  4ES8 A;  1RUC 2;  2GMM A;  3GBW A;  5A7O A;  1KFX L;  3ACI A;  2J1S A;  4AGR A;  1QJU 2;  5DG1 A;  4CDQ A;  5CVR A;  1JUH A;  1BLZ A;  4DFS A;  1NCR C;  1VLN A;  2CWM A;  3WP5 A;  4YFZ A;  4YW1 A;  1Q8V A;  1RJ8 A;  2WSV A;  3H8U A;  5GKA C;  3UES A;  1V6L A;  2VZV A;  1UU6 A;  4Q4X 1;  4LO7 A;  1R1A 3;  3OD4 A;  4Y5T A;  3TEW A;  1BXH A;  3A7Q A;  1RUI 1;  1H2K A;  1C3H A;  3FBY A;  1VMF A;  4QHZ A;  5LA2 A;  1HRI 1;  2CAV A;  2W52 A;  2VY0 A;  1GP4 A;  3ZPY A;  1O4Y A;  1NX9 A;  3WNO A;  4Z92 B;  4DUV A;  3RI8 A;  2XXZ A;  4XAA A;  3KCX A;  4ZS3 A;  4IGO A;  1DLC A;  2HEV F;  4IEO A;  2GDF A;  4LOS A;  2RS3 1;  4FPE A;  4NRP A;  4AEK A;  3BUC A;  3HNM A;  1WW4 A;  3POJ A;  1H1M A;  2RDN A;  2DVF A;  5GLV A;  4LXL A;  2DVG A;  3RRD A;  1MQT A;  3AZX A;  4Q2F A;  5C8W A;  5FLH A;  1JYV A;  3ZFG B;  4XET A;  1HRV 1;  1F35 A;  2VXR A;  4R4Z A;  3B9C A;  4C1X A;  2BQP A;  4CEW B;  3U0Z A;  1PGL 1;  4HL0 A;  3C8X A;  1YC6 1;  4QU1 A;  1GV9 A;  4P9W A;  4B1L A;  4CCL A;  2ZXQ A;  1W2O A;  4D69 A;  1GNZ A;  1RUF 2;  3VV1 A;  1RUD 3;  5EJ3 A;  4FPH A;  4AQS A;  2IFW A;  2VMF A;  3SH3 A;  1OF4 A;  1RUD 2;  1WD3 A;  4FPC A;  3U14 A;  4CU8 A;  5FFO C;  1DGW A;  2XJT A;  1LOF A;  3NRU A;  1MPX A;  2R7E B;  1GZW B;  2MEV 1;  4XF9 A;  5FZB A;  3KS7 A;  5I0U A;  1KJL A;  5GZG A;  1KRI A;  1UWW A;  1CAU B;  3I2I A;  4YGB A;  2ZKN A;  4QAW A;  2UWB A;  1GNH A;  2Y6L A;  3J8F 2;  1HLC A;  4RGK A;  5CA6 A;  1X8E A;  4NAM A;  3VBR A;  3D0S A;  2VEC A;  1J3R A;  1D2Q A;  3RVH A;  2WDB A;  3GXU A;  3WD5 A;  2WRA A;  1VBD 2;  3WF3 A;  2WWU A;  2NPI A;  3A4U A;  2W87 A;  4LBL A;  3JXS A;  3BB6 A;  3S5A A;  2FDF A;  1QNY A;  4Q0S A;  2VTX A;  4UF0 B;  1BEV 1;  1PVC 1;  1YRZ A;  2VZQ A;  4PBO A;  3USS A;  5JOW A;  5KC6 A;  4BXS V;  5IVF A;  4CXW A;  4Y24 A;  2PYT A;  1CX4 A;  5FZF A;  3I49 A;  1JXN A;  2BV4 A;  4K7J A;  2I74 A;  3BOD A;  1MQT C;  3RMX A;  3NV4 A;  5IVV A;  1RUE 3;  1ULE A;  5JDB A;  1HB2 A;  1B35 A;  1UY2 A;  2VUD A;  5FLJ A;  3ZYJ B;  3RYP A;  2HYK A;  1H0B A;  1HDK A;  5FYT A;  4QT6 A;  2JB4 A;  1CAX A;  3BPS A;  4M3C F;  4ATE A;  1VBE 1;  4OQ8 A;  2CWS A;  3OCP A;  1F15 A;  4BLI A;  3GBG A;  2X29 A;  2VCC A;  4JRA A;  1W6Q B;  4XJZ A;  4LO4 B;  3TEX A;  4QMA A;  5C9A C;  5JUV A;  1E57 A;  2EIC A;  5DDJ 3;  2R30 A;  2V4V A;  1QU0 A;  1W2N A;  5FXZ A;  3SC7 X;  5HI0 A;  5IK5 A;  2D6L X;  4YZ3 A;  1AX1 A;  1UF2 C;  3T0A A;  2RE9 A;  2W39 A;  4MGY E;  3WEZ A;  4COV A;  4NIG A;  1WCD J;  1OI6 A;  3NQH A;  4QPG C;  3SCG A;  4QHB A;  5FK8 A;  2HYX A;  4GH4 A;  5C4W B;  5DUV A;  1VRH 2;  2W9X A;  4N43 A;  4KWU A;  1CAV A;  4P14 A;  4FPF A;  1IS3 A;  2F17 A;  2PHD A;  4YWA A;  1OPO A;  1Q8O A;  2HWB 3;  5FV3 A;  3OUJ A;  4HVO A;  4JKL A;  4CP1 A;  4AK3 A;  5CB7 A;  1OD3 A;  3AZZ A;  5HV4 A;  3MFC A;  3OGJ A;  3KT7 A;  1UYX A;  2DBN A;  1PMJ X;  5EP9 A;  3J9S A;  4LKF A;  1WGP A;  1KS4 A;  5CKQ A;  5C71 A;  1QQP 3;  1CAW B;  1W6N B;  3CIH A;  3ELN A;  4MGS A;  4EE2 A;  1H9P A;  4IV1 C;  1JYC A;  1FT9 A;  1U12 A;  4CDW C;  1XE8 A;  3O0X A;  3H7J A;  1D4V B;  1F4A A;  3J26 N;  1GQH A;  5E16 A;  3RJR A;  3E5X A;  3ZYR A;  5IVB A;  2RM2 2;  3OBA A;  4NMI A;  1ND3 A;  4LK7 A;  4UT5 A;  2VQT A;  5IT6 A;  2GP3 A;  3APB A;  3ZYG A;  4A3X A;  1POV 1;  2XVG A;  4V2W A;  2CSG A;  2WAO A;  1S1A A;  1GOF A;  1PMI A;  5AVA A;  3FC0 A;  3WF1 A;  3UL2 A;  3NAP A;  3VUO A;  1OQE A;  3WY6 A;  3N7J A;  1MAC A;  3WHT A;  1I6X A;  3AVR A;  4S2G A;  5J96 B;  1AR6 2;  5FY8 A;  1LHW A;  4CDX B;  1ZRE A;  3OD0 A;  2VNO A;  1GQP A;  2EAK A;  2PAM A;  2VGD A;  4GQ7 A;  5EYY A;  4DQA A;  4DPN A;  3IT8 A;  1J1T A;  3KSC A;  5A3O A;  3DPR C;  5K4L A;  4GA9 A;  4HK9 A;  4QQL A;  1X33 A;  4Q0U A;  1V00 A;  5GJ6 A;  4Z8B A;  4X6R B;  5LA0 A;  2WA3 A;  1A8M A;  2XQX A;  5FZC A;  2BPA 2;  1XPW A;  3DEM A;  4O61 A;  2IXK A;  1UN1 A;  2AAC A;  2JG9 B;  4MLO A;  5FJH A;  3GYD A;  3RZZ A;  4QKF A;  4HXC A;  5ABJ A;  5FPU A;  1ZZ8 A;  4L92 A;  5FPX A;  3UJQ A;  1US3 A;  3POY A;  5FYY A;  3ACH A;  1Y4W A;  2FMY A;  1JOD A;  1AR8 1;  3BCW A;  4Y4R A;  2GC0 A;  1LOG A;  1JU3 A;  2V73 A;  1FX5 A;  1XE0 A;  2WQ8 A;  3NO8 A;  4WVM A;  3MEP A;  1FV2 A;  1G8W A;  1LKN A;  1UZW A;  4NAO A;  4Q4V 3;  4WM7 B;  2Q0A A;  3OOX A;  2BGO A;  1FPN 1;  3C3V A;  1RGS A;  2R49 A;  2DUP A;  4BQ2 A;  3IBM A;  1QF3 A;  2W47 A;  4IW3 A;  2W1Q A;  1OLM A;  1SQ4 A;  3N9M A;  1V6K A;  1CAV B;  2A7A A;  5CIS A;  4CRQ A;  3OYW A;  3RPQ A;  1AX2 A;  2CDO A;  3FZ3 A;  1CON A;  2R16 A;  3MF6 A;  1SMV A;  3VL9 A;  4AXO A;  5DUW A;  4K9S A;  1AXK A;  1DG6 A;  5F9T A;  3C7H A;  2GAU A;  2ARE A;  3HEI A;  3JZV A;  3K4A A;  5C3Q A;  4HK8 A;  2QKD A;  1J58 A;  4IV3 B;  4Q4X 2;  4MGI E;  3VZN A;  1UYP A;  1DCS A;  1AR7 2;  1QJU 3;  2RR1 2;  3ZXJ A;  3KT1 A;  2YPJ A;  4Q0Q A;  3MIB A;  5C8C A;  2VQU A;  3AJY A;  3ES4 A;  4IDZ A;  3RZL A;  4QX2 A;  1CES A;  5I0T A;  1NAE A;  2JE7 A;  3ZXG A;  3RS6 A;  3C7O A;  1UY0 A;  1RMU 1;  1ZNP A;  2WAA A;  1RIR A;  1KFU L;  3GGL A;  5F2S A;  3VBS C;  4ASL A;  4BIS A;  4D3W A;  2JDU A;  2QCS B;  4ZU7 A;  1TZO A;  3HJR A;  3ZXD A;  2R04 2;  4JDO A;  3IDE A;  1BK0 A;  4B4R A;  1ZZC A;  3OG2 A;  1MS5 A;  5FZ1 A;  5A6Q A;  1JW6 A;  1H8T A;  3LD8 A;  2RJ2 A;  2ZPX A;  1FMD 1;  2GAL A;  2JDP A;  4UI9 L;  2PHW A;  5DUX A;  2VCB A;  2PHL A;  1R08 3;  4J25 A;  4CCO A;  2Z4F A;  4Y22 A;  3LSE A;  2WA4 A;  3PL0 A;  4RGA A;  2R07 2;  4O7X A;  4OYU A;  3VB9 A;  4FPK A;  4M4P A;  5E1R A;  3ZXL A;  4EQV A;  3A0N A;  3IPV B;  2OT7 A;  4CDU C;  5CAD A;  3FUO A;  1JYX A;  3AP6 A;  1XNC A;  2OVU A;  3AJZ A;  1J1L A;  4K21 A;  4FSJ A;  2JG8 C;  5FQ0 B;  2Q8E A;  1GZW A;  1RUF 3;  2HJI A;  1DHK B;  3VKM A;  1I3H A;  5FPZ A;  3MLJ A;  2WT2 A;  3VDD C;  1K5M B;  3ZFF C;  4XCA A;  1FXZ A;  1GP6 A;  1F8V A;  4P02 B;  3WNM A;  2MEV 3;  4AHX A;  3ABZ A;  1AL2 2;  4JKM A;  1SLT A;  1G9A A;  4I3P A;  1CZT A;  4LBJ A;  5A3W A;  2VCA A;  1QJY 2;  2OPK A;  5LK7 B;  4BQW A;  1NXD 1;  1CQ9 A;  1NT0 A;  2WAB A;  3K2O A;  3WCR A;  4ES9 A;  1RXF A;  1HQN A;  3V0B B;  1XNT A;  4XMA A;  5HPO A;  2VE1 A;  4FTE A;  3H0O A;  4AVC A;  1SPP B;  4RS5 B;  1EV1 2;  2Y6K A;  2WQ4 A;  3WV6 A;  3DYM A;  2AGS A;  3SMH A;  1JZ6 A;  4XBL A;  3VBS B;  1ASJ 3;  2XJS A;  4B1M A;  5CKN A;  1D4M 3;  3THP A;  3PU3 A;  5FZ8 A;  4AED B;  4ET7 A;  5K9Y A;  4QPI B;  2HEW F;  2J42 A;  2Y0I A;  4JQR A;  5JPN B;  2UYA A;  3N35 A;  1JYI A;  1AR9 1;  1LTE A;  3URF A;  5JZG A;  2YYO A;  2E31 A;  3AP5 A;  2RS1 3;  2DUR A;  1HJF A;  3SIS A;  5IK7 A;  1EAH 3;  1OA3 A;  1LOD A;  2CV6 A;  2JG8 B;  2WWJ A;  1WCU A;  3U4S A;  5KXD A;  2VBB A;  4XFC A;  1YQ8 A;  4LA3 A;  4EWD A;  3NWK A;  4JTN A;  2DCK A;  5EPA A;  1W05 A;  4LE3 A;  2NZ9 A;  4YFW A;  2G4I A;  2WO3 A;  3ZSM A;  5M0T A;  2VMI A;  1ULF A;  1HN1 A;  4A41 A;  3LOI A;  1MZE A;  2J1R A;  3VBH B;  1CIY A;  1XC6 A;  3POS A;  2X09 A;  1NA1 B;  3CKH A;  3ILN A;  4CZS A;  3KHC A;  4P9L A;  1OF3 A;  1I5Z A;  2ENR A;  3MZH A;  2KD7 A;  3HR9 A;  4GKX A;  2D43 A;  5SV5 A;  3U1X A;  4E9K A;  3OB8 A;  4PQQ A;  1GIC A;  4YM0 A;  1VBA 1;  5DDJ 2;  2WNV A;  2WII B;  2G1M A;  4LQR A;  4NHX A;  3OJB A;  4RFR B;  1UCX A;  2NM1 A;  3ZFF B;  5BYN A;  1J3Q A;  1QEX A;  3FX3 A;  3VHP A;  1SLC A;  3K46 A;  5HV0 A;  4FVV A;  2ET1 A;  2A3X A;  4IV3 A;  5FWJ A;  1XNK A;  2VQA A;  5C8C C;  2CTV A;  4K20 A;  1VJ2 A;  4O65 A;  4XJW A;  4C90 A;  3ZDS A;  4L11 A;  1A78 A;  2VZT A;  2HLE A;  3VKF C;  3CHX A;  1N1S A;  2YMZ A;  4NN0 A;  2A6Y A;  5EWS A;  4LHK A;  4PCR A;  3VLB B;  3C2U A;  2EAL A;  2G19 A;  4P00 B;  3TRS B;  4AGG A;  1MQT B;  3MGU A;  1HRV 2;  3ATG A;  4Y1V A;  4UW4 A;  1Y43 B;  2VUA A;  4BK4 A;  3I2H A;  2ZML A;  3OGR A;  4DXT A;  4E4H A;  2PN5 A;  2WFF 3;  2ZGM A;  2XLG A;  2AEN A;  3MID A;  1YI7 A;  2E32 A;  4XCB A;  2XDV A;  3M8L A;  1IS4 A;  4SBV A;  2HKX A;  1H2L A;  3ZR5 A;  4EWE A;  2Z5W A;  2QQL A;  4KG8 A;  3PUH A;  3M3O A;  5C9A B;  3IDC B;  1DYP A;  1YQ5 A;  4XXA A;  2O8O A;  5E6H A;  4GMP 0;  1UMZ A;  4KWK A;  4HAN A;  1J84 A;  3Q8F A;  5HXV A;  4AG4 A;  4AHY A;  5JAX A;  3W9A A;  3WXP A;  1QHD A;  1WA6 X;  3LAG A;  4I0B A;  4K1Z A;  3ZN6 A;  5LW9 A;  5FZO B;  2RMU 3;  2FMD A;  2H6B A;  2W3J A;  3VBO C;  3V0B A;  1LR5 A;  1Q5O A;  4DB5 A;  4QPG B;  4WV8 A;  3VBF B;  4LEJ A;  3DL3 A;  3KV6 A;  3RZM A;  1KS5 A;  1BJQ A;  4PLO A;  5D8A C;  5EYX A;  1LRH A;  2DVA A;  1BKZ A;  1SCS A;  2W46 A;  5BPX A;  1NYW A;  4IV3 C;  4R9B A;  4ARY A;  2RR1 3;  5LY1 A;  4DXR A;  3KT4 A;  2VVE A;  1VBE 3;  3GHM A;  3USU B;  5C3O A;  4Y20 A;  4FCA A;  1PO2 3;  1O5L A;  3JD7 3;  5AFB A;  1RL3 A;  2E33 A;  1ND2 A;  3POG A;  4KGG A;  3AFG A;  4GXL A;  5L73 A;  2PMW B;  3P1I A;  1IG3 A;  5FY9 A;  1R1A 2;  1RUE 1;  4ISR A;  1EPW A;  2VG9 A;  4AF9 A;  2WZE A;  4Y22 B;  3OYW B;  4UBH A;  2E7T A;  4G4F A;  3TN9 1;  3FL7 A;  5A7S A;  1CAW A;  2P6C A;  3N9N A;  4LIT A;  2XUM A;  4Z2W A;  5BNO A;  3BTY A;  1LAJ A;  1OXC A;  2EXJ A;  3ETP A;  3LGR A;  5FUN A;  2EIG A;  1CPN A;  3FWE A;  4J6G A;  1UKG A;  1OFS A;  1W8O A;  2Q1F A;  3LEM A;  1COV 1;  1W2T A;  3E6C C;  2ARC A;  3DCQ A;  4NWV A;  1Q8S A;  1W3X A;  5DAQ A;  2WIN B;  1K5M C;  4OI2 A;  4M00 A;  5FXW A;  2ATF A;  3B00 A;  1AXY A;  1W8U A;  4MXV A;  2W2I A;  5LB6 A;  1XJA A;  4XBN A;  3HMY A;  4LKD A;  5JI9 A;  2VW1 A;  4DO0 A;  1IS5 A;  3J8F 1;  4N53 B;  3QLQ A;  1Z7S 1;  2N7G A;  3ZSE A;  4ZKT B;  2FD8 A;  1MZF A;  3NNG A;  1RIN A;  1UPI A;  4BK5 A;  3OBT A;  4CEY B;  2WT0 A;  2VOW A;  5E88 A;  3AVS A;  3MIH A;  1RUN A;  3TNQ A;  4Q4Y 2;  1QWR A;  3ZYP A;  3VBO B;  4CP2 A;  3CDZ B;  1QOO A;  4XFI A;  3KB5 A;  2ZGS A;  4TSV A;  2FDK A;  4TZD A;  3B3Q E;  3UT0 A;  4R52 A;  4C1W A;  1ND3 B;  4HET A;  4NRQ A;  1TMF 1;  4KGQ A;  4YSF A;  4AED C;  5F32 A;  2ZAB A;  3BTA A;  4CUB A;  4F7Z A;  3T2Q A;  3FE5 A;  4DRV A;  4Q4V 2;  5JR7 B;  3VD7 A;  3EB7 A;  4XF4 A;  3WUD A;  3BVC A;  1BCX A;  3ACF A;  5AC9 2;  1XU2 A;  3VD9 A;  1XQN A;  1DGL A;  1MR5 A;  1UZV A;  5CFC C;  2XKP A;  3PME A;  5FWE A;  3RZJ A;  1BQP A;  1BVV A;  1D4M 2;  4LHS A;  2HBU A;  4GWM A;  4QU2 A;  5J36 A;  3O1O A;  5BNO B;  3C7F A;  1GLH A;  5LY2 A;  4D6R A;  1HXS 3;  5DAW A;  4L8Q A;  1VRB A;  1MVE A;  5FY7 A;  3T2O A;  2CNA A;  4P9X A;  2VME A;  4GH4 B;  4MV2 A;  4FBF A;  3KF5 A;  3JD7 1;  4EN7 B;  5DZE A;  1JYN A;  4DUX A;  5HCA A;  1EV1 1;  3E5Q A;  1ZRD A;  1WD4 A;  2WSU A;  3MFA A;  1L7Q A;  4FPG A;  2OQ7 A;  2WNE A;  3UKV A;  4OHW A;  5C4W C;  5SV8 A;  2CDP A;  5F1R A;  3AK0 A;  4UBG A;  1LJ7 A;  3GZA A;  2YFZ A;  1T6B X;  1UXZ A;  4IGQ A;  4PJY A;  4PIX A;  2QQK A;  3WDY A;  1QJU 1;  1O6U A;  3M70 A;  2EA7 A;  3PDQ A;  4P9Y A;  4Q1R A;  4B7K A;  3VDD A;  4AW7 A;  1H30 A;  3WDV A;  4E8D A;  1SZB A;  1VBB 3;  3B9I A;  2ZX3 A;  2JIG A;  5FP7 A;  1FOD 1;  5A3T A;  5ACA 3;  4QPI A;  1STM A;  4L0P A;  1R64 A;  3T4V A;  3PTR B;  2ZS6 B;  5ANQ A;  2FDJ A;  3W21 A;  4LOR A;  2DUO A;  2WYS A;  2ZJC A;  2JX9 A;  1P8J A;  1E5I A;  3U11 A;  3HD8 B;  4BM8 A;  1AUY A;  5FZD A;  1QDC A;  1EPZ A;  4RR3 C;  3MW4 A;  2CGN A;  4U2A A;  4CUC A;  3NV3 A;  5FMD A;  1KJR A;  1ZRR A;  3SIT A;  1IGO A;  4MSV A;  1WLW A;  2JD4 A;  1RXG A;  1W6N A;  3LIH A;  1W06 A;  1UAI A;  2RDQ A;  4TLG A;  3PUA A;  1YUD A;  2VC9 A;  4XQD A;  1ZZ9 A;  2TEP A;  2QDN A;  1HKD A;  3ASI A;  1GSL A;  3CJI A;  1MS0 A;  3LWC A;  4OLL A;  1NKG A;  4FQZ A;  4Y26 A;  4A45 A;  2DCT A;  1G9C A;  2VZ1 A;  2GH2 A;  3F2Z A;  2QJV A;  5F5C A;  5KXB A;  1TMF 2;  1DLL A;  1YFX A;  2YBP A;  1TVG A;  4QWN A;  5FKC A;  4BXF A;  5BNO C;  2BVB A;  2WBK A;  3N9L A;  5FZI A;  4ZPI A;  3BTX A;  1WCQ A;  4GB3 3;  4N9I A;  1O3Q A;  2QUO A;  3AYA A;  1TNR A;  2KM2 A;  5FMB A;  4F83 A;  3E97 A;  2VUJ A;  3CJI B;  3HPN A;  4Q1P A;  4N90 A;  3FHA A;  4KBB A;  2IWG B;  4B4P A;  1VBA 3;  2PEL A;  2PAK A;  1BBT 2;  4BE3 A;  1ZBE 1;  4AHW A;  4ERO A;  2ZAH A;  1UY3 A;  5FZ9 A;  1DQ5 A;  1Q8P A;  5EJZ B;  3RYK A;  2PLV 1;  5A7N A;  2D3P A;  4BDV B;  3JBG 2;  4Y1Z A;  3KHB A;  1RHI 1;  4IEW A;  4CYD A;  4IES A;  1SLI A;  3UJO A;  4H7L A;  3W58 A;  2Y8K A;  4D94 A;  1IHM A;  2WS9 2;  2YXS A;  2AH2 A;  4I3G A;  1S0C A;  3A23 A;  3VZL A;  5IVE A;  2OZ6 A;  2P5B A;  4K8F A;  4BH9 A;  3O1P A;  1GKB A;  1D0H A;  3O0W A;  5BXX A;  3TEZ A;  4Y4Y A;  5J37 A;  2Y64 A;  4XUT A;  1W3V A;  4LO8 A;  4OMD A;  1KXG A;  5T5L A;  3SKJ E;  2EF6 A;  3INA A;  4WVV A;  4CCJ A;  4D8M A;  2D97 A;  4QX1 A;  3T3Y A;  5A6Z A;  3OPW A;  2ADD A;  2X5I A;  5L7O C;  1MEC 2;  3PVN A;  3WHU A;  3GM8 A;  4M3C B;  1SCR A;  5FY0 A;  1D7P M;  3ZYH A;  1MEC 3;  4K40 A;  4M3C E;  3V65 A;  1AYN 1;  4MHR A;  4Q4W 1;  4DS0 A;  1RVF 1;  2VU9 A;  1PIV 1;  4OZO A;  5LRR A;  1VAK A;  1VR3 A;  2YDE A;  4COZ A;  3O1S A;  2A6Z A;  2PQQ A;  1H8T C;  4URT A;  2DWR A;  2ZHN A;  1WME A;  2VZR A;  3VBF A;  2XML A;  2Z42 A;  2ZKL A;  4FOV A;  1XBF A;  4KH9 A;  2DUQ A;  4XXP A;  4XDP A;  1V6M A;  4B7E A;  4IXL A;  3GF6 A;  4GWJ A;  3L2H A;  3U07 A;  2ARA A;  2WLQ A;  1BYH A;  1YI9 A;  4XFG A;  5BNN B;  4NHY A;  1CJD A;  2X53 S;  1ENS A;  4SLI A; 
#chains in the Genus database with same CATH homology
 1WKY A;  3OEB A;  3WF2 A;  1NUK A;  3HN3 A;  2RVA A;  1GQP A;  2C9K A;  4JX0 A;  4QDR A;  1UYZ A;  4QX0 A;  1UX7 A;  3A22 A;  4MGQ A;  3MUY 1;  2EIE A;  5IFT A;  1UZ0 A;  1H6Y A;  5LA0 A;  4AAX A;  2XQX A;  5DPN A;  1XPW A;  3K75 B;  4TXW A;  1W9S A;  4A42 A;  1US3 A;  4CUA A;  3ACH A;  2BBA A;  2ZEY A;  3MV0 1;  4FI9 A;  1DP0 A;  1JU3 A;  2WQ8 A;  4A3Z A;  4PT6 A;  3HNY M;  2BGO A;  4PF1 A;  3VDB A;  2YB7 A;  3W5N A;  4YPJ A;  3P6B A;  1JZ7 A;  2W47 A;  3I97 A;  2W1Q A;  2VJX A;  4CU9 A;  3ACG A;  2J1U A;  4TTG A;  2Y6J A;  5LCW L;  5LA1 A;  3K4Z A;  3LPF A;  4QB2 A;  2CDO A;  3CZU A;  3NJX A;  1TG7 A;  1W99 A;  3C7H A;  3K4A A;  3HEI A;  1O59 A;  3IB3 A;  4QB1 A;  2VO5 A;  1K3I A;  1L7R A;  2W95 A;  3FHQ A;  4KI5 M;  4W4Z A;  3UNP A;  2VQU A;  3I2K A;  4QX2 A;  3WNL A;  1NAE A;  4QDS A;  3C7G A;  3C7O A;  1UY0 A;  2WAA A;  3GGL A;  3HNB M;  5A1A A;  4UAP A;  5DQ0 A;  3WSO A;  2ORX A;  3HJR A;  3OG2 A;  5JXG A;  2ORZ A;  2RJ2 A;  4XUR A;  3NJV A;  2PQS A;  4UI9 L;  2VM9 A;  3A21 A;  2VCB A;  2VMC A;  4DEV A;  1SDD B;  1W9W A;  5IHR A;  2Z4F A;  5C70 A;  4KMQ A;  1T2X A;  4OYU A;  4M4P A;  4E8C A;  2YFU A;  4XUO A;  2WUH A;  3LE0 A;  3SEE A;  1BHG A;  3D3A A;  3AC0 A;  1JZ3 A;  3FN9 A;  1SG3 A;  1JYX A;  3J7H A;  2QQI A;  1O8P A;  1UYY A;  3I2F A;  4MO3 M;  3K77 A;  4GWI A;  4XUQ A;  4QB6 A;  1CX1 A;  2ZEX A;  3MUZ 1;  2WN2 A;  1H6X A;  1GOG A;  4P02 B;  3WNM A;  2QQM A;  3ABZ A;  4BJ0 A;  1XNA A;  4JKM A;  2Y6G A;  1CZT A;  2WN3 A;  2C26 A;  2JDA A;  2VTF A;  2VCA A;  2JE8 A;  2J7M A;  2WAB A;  2WZ8 A;  2XON A;  5IFP A;  4JKK A;  1XNT A;  5HPO A;  4HG6 B;  2WO1 A;  4M4R A;  2Y6K A;  5G04 L;  3DYM A;  3MBW A;  5JR2 A;  2C4X A;  1GOH A;  1JZ6 A;  1JYW A;  2XHN A;  4DXS A;  4P5Y A;  4ET7 A;  2VOT A;  1W9T A;  1UY4 A;  1UY1 A;  2E31 A;  3IAQ A;  1KGY A;  1GNY A;  2W1U A;  5FUI A;  2E26 A;  4OUE A;  3DYO A;  2DCK A;  2J1E A;  3CZJ A;  2WO3 A;  2EIB A;  3PUI A;  4CU6 A;  1HN1 A;  5B4N A;  4A41 A;  1JZ2 A;  1YQ2 A;  1J83 A;  2J1R A;  1CIY A;  1XC6 A;  2QBX A;  3CKH A;  2X09 A;  2B4K A;  1OF3 A;  1SHW B;  1ULO A;  3VDA A;  1UMI A;  2KD7 A;  4RYD A;  3VD3 A;  3OB8 A;  4PQQ A;  1UMH A;  4LQR A;  3E1F 1;  3IAP A;  1IQD C;  3K46 A;  4A4A A;  3DEC A;  3T0B A;  2W1W A;  3III A;  1JZ4 A;  3GDB A;  2VZT A;  2HLE A;  4ZXE A;  3IDA A;  4QX3 A;  4P00 B;  2BZD A;  4A44 A;  3LQC A;  3T2P A;  3EYP A;  3LEG A;  4P08 A;  3WNN A;  3I2H A;  4BK4 A;  3OGR A;  2QQO A;  4DXT A;  1CZS A;  1JZ8 A;  3T0D A;  2J1V A;  1F4H A;  1JHJ A;  2E32 A;  2VZS A;  2OKX A;  3SEP A;  5HXM A;  5I0D A;  2W5F A;  2QQL A;  1RYY A;  3PUH A;  4CU7 A;  4LPL A;  3HOB A;  3I3E A;  4AG4 A;  1J84 A;  4MOA A;  3THD A;  5G05 L;  2W3J A;  4UOJ A;  4XZU G;  2Y6H A;  2JD9 A;  4CVU A;  5IYY A;  2W46 A;  4ZY9 A;  2LS6 A;  4XUP A;  4ARY A;  2XOM A;  2VZP A;  2J1T A;  4DXR A;  3SKV A;  4DEQ A;  4Z2A A;  4ZZ8 A;  5JXJ A;  3WNK A;  4RN5 A;  2E33 A;  3I2G A;  4XUN A;  3ZM8 A;  3P1I A;  1O8S A;  5F7U A;  2VZ3 A;  2WZE A;  1KEX A;  2W94 A;  3WNP A;  3FL7 A;  1LNS A;  2ZEZ A;  4ARX A;  1GU3 A;  1PMH X;  1ULP A;  3ETP A;  3K4D A;  1I5P A;  1W8O A;  5EIY B;  1OT5 A;  4QPW A;  3W5M A;  5CYY A;  3DYP A;  2W91 A;  1OH4 A;  3LEK A;  5DN2 A;  3T08 A;  3OGV A;  1W8N A;  2BER A;  3BN6 A;  2ID4 A;  3CQO A;  2DDU A;  2WO2 A;  3CMG A;  5IJR A;  3WF0 A;  3NNG A;  4BK5 A;  2V5D A;  2VR4 A;  2V72 A;  2EID A;  2BGP A;  1CZV A;  1PX4 A;  3ACI A;  2J1S A;  2W92 A;  1K42 A;  2X10 A;  2VZU A;  3CDZ B;  4DUW A;  1US2 A;  5JMO A;  3T09 A;  3UES A;  2DCJ A;  2VZV A;  4CUB A;  2J1A A;  3A7Q A;  3T2Q A;  3OEA A;  3VD7 A;  3EB7 A;  5LA2 A;  1NX9 A;  3ACF A;  3WNO A;  4DUV A;  3VD9 A;  1K12 A;  1DLC A;  4LHS A;  3C7F A;  4XVH A;  3HNM A;  3ECQ A;  2J22 A;  4JHZ A;  3T2O A;  2VME A;  4OMC A;  1JU4 A;  1JYV A;  2YC2 A;  1JYN A;  4DUX A;  2VL4 A;  1PX3 A;  1L7Q A;  3MV1 1;  3C8X A;  2CDP A;  2ZXQ A;  4QDQ A;  2YFZ A;  1UXZ A;  2VMF A;  2QQK A;  1OF4 A;  4W50 A;  4CU8 A;  3NRU A;  3THC A;  5JXI A;  1MPX A;  4E8D A;  2R7E B;  3C7E A;  1JZ5 A;  1UWW A;  4LKS A;  3I2I A;  4L0P A;  4QAW A;  1R64 A;  2Y6L A;  4D0Q A;  5C7G A;  3MO4 A;  2WYS A;  4ZZ5 A;  1P8J A;  1W0N A;  2WDB A;  3GXU A;  3I2J A;  5JXH A;  3I3D A;  3WF3 A;  1EUU A;  2QQN A;  1GMM A;  2W87 A;  3WF4 A;  3JXS A;  4CUC A;  2VZO A;  2X05 A;  2VZQ A;  4BXS V;  4A6O A;  2QQJ A;  2VC9 A;  2VMD A;  3LEI A;  4A45 A;  1NKG A;  2ZEW A;  1EUT A;  1UY2 A;  2VZ1 A;  3F2Z A;  1TVG A;  2WBK A;  1WCQ A;  3VD4 A;  2RV9 A;  3HPN A;  2L9L A;  3FHA A;  2VCC A;  3UET A;  2LW8 A;  5JUV A;  3OGS A;  2EIC A;  2V4V A;  1UY3 A;  3WQB A;  5EJZ B;  3VD5 A;  3T0A A;  4BDV B;  3WEZ A;  5CZK A;  3NQH A;  4GZ9 A;  2HYX A;  4W8J A;  2YG0 A;  3VDC A;  2Y8K A;  2JKX A;  3A23 A;  2W9X A;  3LPG A;  4KWU A;  1DYO A;  4IUG A;  2Y64 A;  4XUT A;  4OMD A;  3SKJ E;  1K45 A;  4D8M A;  4JKL A;  4QX1 A;  2W1S A;  2B9V A;  1OD3 A;  3GM8 A;  2YC4 A;  3WF1 A;  1UYX A;  1D7P M;  1PMJ X;  5C71 A;  3CIH A;  5EJ1 B;  4MGS A;  4OZO A;  4MAD A;  5J1X A;  1F4A A;  2VZR A;  3OBA A;  3I3B A;  5DMY A;  1GUI A;  2VQT A;  1UXX X;  3U37 A;  4GWJ A;  1JI6 A;  2WAO A;  1GOF A;  5B4X A;  3BGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...