3GGLA

X-ray structure of the c-terminal domain (277-440) of putative chitobiase from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr324a.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
DTYTGFCIIKEGTKISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPIGRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Northeast Structural Genomics Consortium Target BtR324A
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Putative chitobiase
total genus 30
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3gglA00
2WABA 2VZ1A 1T2XA 4A3ZA 3HPNA 3JXSA 3NRUA 1US2A 2V72A 2W87A 2ZEYA 1GMMA 4KMQA 2VZ3A 2VZOA 3K4AA 5JXJA 3ECQA 1GU3A 1PMJX 3I2KA 2WAAA 3VD9A 2WBKA 3THCA 2YFUA 4JKMA 3MO4A 2JDAA 2ZEXA 4DUVA 3HNBM 1SHWB 5DMYA 1DYOA 2VJXA 5DPNA 2VZQA 4MO3M 4CUCA 2BGOA 4TXWA 1NKGA 1JU4A 1K12A 4DEVA 2W92A 4UAPA 1UY0A 2Y6KA 1YQ2A 4A41A 2WO3A 4LPLA 4D0QA 4M4RA 2W1UA 1KEXA 2VQTA 3NJVA 3CIHA 3FHQA 1OF4A 3FL7A 4CU6A 3THDA 3W5NA 3CZUA 2YC2A 5J1XA 2QQLA 2VMFA 2VZPA 2X05A 4BJ0A 3CQOA 4QX2A 3WNKA 2W94A 1EUTA 3EB7A 2WZEA 3C7OA 4AAXA 3DYOA 4QPWA 3IDAA 2W5FA 3J7HA 5C70A 1HN1A 2B4KA 4CVUA 1R64A 3FHAA 4ARYA 1XC6A 2WQ8A 3ETPA 1O8PA 2VM9A 4LQRA 3K4DA 2VTFA 4A4AA 1L7RA 1PMHX 1IQDC 2E32A 4DXSA 2C4XA 4P00B 3UNPA 1J84A 4W8JA 3UESA 3IB3A 4A45A 3LEKA 3NNGA 1GNYA 2QQOA 2KD7A 3WNLA 2Y6JA 4ZXEA 1GOGA 4ZZ8A 1L7QA 3LEIA 3LEGA 1CZTA 2BGPA 2OKXA 3A7QA 2YG0A 3ACFA 2WO2A 4ARXA 5LA1A 4ET7A 2VO5A 3K46A 3T0AA 2EIEA 3GXUA 5CYYA 4M4PA 1W9TA 1JZ6A 3VD5A 2YB7A 3VD7A 2J7MA 1TVGA 3WNNA 1H6XA 5F7UA 3HOBA 3VD4A 2WDBA 1GOFA 4LHSA 2EIDA 3HEIA 4QB2A 2WUHA 2J1SA 2W3JA 3SEPA 3HNYM 4AG4A 1ULOA 1KGYA 1UYXA 3W5MA 3I97A 3I2FA 1JZ4A 3NJXA 3WNOA 2CDOA 5LA0A 4GZ9A 1UWWA 3WNMA 2WAOA 4BK4A 3LPFA 3LE0A 2J1TA 3CZJA 1GUIA 3OGRA 3I2JA 1RYYA 2DDUA 4LKSA 4XUOA 4QAWA 3MV11 3DYPA 2VZUA 4CU9A 3ACIA 3UETA 2W91A 3OBAA 3T0BA 4OMCA 3LPGA 5IHRA 3VDCA 1W9WA 2QQIA 2WYSA 1W8NA 3FN9A 5EIYB 2RJ2A 3DYMA 1UX7A 1UZ0A 4E8CA 5DN2A 2DCJA 1JYVA 2J1EA 3WSOA 3A23A 1JZ2A 2L9LA 4PT6A 2XHNA 1UY3A 1D7PM 2LS6A 5B4XA 4QB6A 3OEAA 2CDPA 2VCCA 1NAEA 2QBXA 4QDQA 3C7HA 4UI9L 4IUGA 3F2ZA 5DQ0A 2W1QA 4P08A 4QX0A 5CZKA 5IFTA 3VDBA 4GWJA 1O8SA 3CKHA 4KWUA 4DEQA 1P8JA 4BK5A 5I0DA 4CUAA 3WF4A 4JKLA 3AC0A 3LQCA 4MOAA 2EICA 4QX1A 3MUZ1 3SKJE 2E33A 3HJRA 2J22A 4BXSV 2VCAA 5LCWL 5G04L 2Y8KA 4XUQA 1J83A 3NQHA 3WF1A 3I3DA 5HPOA 1F4AA 1DP0A 3OGSA 3P1IA 5FUIA 3VD3A 1UYYA 3GM8A 2XONA 3U37A 5EJ1B 2JE8A 2JD9A 4DXRA 3MV01 4CUBA 3WF0A 1W9SA 4QX3A 3BN6A 2V5DA 3OEBA 5A1AA 1XPWA 1K45A 1GOHA 3C7EA 3OG2A 2VL4A 1JYXA 3ABZA 1MPXA 1XNTA 4P02B 2QQMA 4QB1A 3SEEA 3T2OA 2RV9A 2Y6LA 3ACGA 5LA2A 2J1RA 2QQNA 2VMDA 5JXIA 1W99A 2WO1A 2HLEA 3VDAA 4DUWA 5JUVA 2Y64A 1LNSA 4JHZA 2C9KA 1JZ8A 2B9VA 2J1VA 4A42A 3IIIA 2J1AA 2C26A 5JMOA 4MGQA 2X10A 2Z4FA 3P6BA 4L0PA 4PF1A 2ZEZA 2ORXA 4OYUA 3IAPA 4GWIA 4UOJA 4XVHA 4E8DA 5C71A 4RYDA 4D8MA 2XQXA 1UMHA 1UXZA 1NX9A 3C7GA 4QDSA 1F4HA 2QQJA 1JU3A 4XUTA 5G05L 3ACHA 3CDZB 1SDDB 2LW8A 5HXMA 3C7FA 4XZUG 4OZOA 1UY2A 3WF2A 4DXTA 2ID4A 3WNPA 3MUY1 1PX4A 2W95A 3T08A 4W50A 2PQSA 2VZTA 1BHGA 3BGAA 4CU7A 3A22A 2BERA 1UYZA 2JKXA 2ORZA 4FI9A 1JZ7A 1PX3A 2ZXQA 5EJZB 1W0NA 1O59A 3T2QA 2YC4A 4OUEA 2W1WA 4P5YA 1OT5A 1JYWA 3I2IA 3SKVA 1CIYA 3MBWA 1JZ3A 2W46A 3WEZA 1OD3A 4YPJA 1UXXX 3HNMA 1SG3A 3PUHA 1CX1A 2XOMA 1ULPA 2VCBA 5B4NA 2J1UA 2E26A 3T2PA 1W8OA 4XUNA 4W4ZA 1UY1A 2E31A 4HG6B 2HYXA 4ZY9A 4MADA 1DLCA 2WZ8A 1K3IA 4RN5A 1TG7A 3CMGA 2VOTA 3I3EA 1I5PA 2EIBA 2W1SA 3I3BA 3GDBA 2WN3A 2RVAA 1GQPA 1UY4A 2DCKA 2YFZA 1NUKA 4XUPA 5C7GA 2R7EB 5JR2A 2VZRA 3D3AA 1OF3A 5IFPA 2VR4A 3C8XA 3K4ZA 2VC9A 3I2HA 3EYPA 3I2GA 2QQKA 3WQBA 2X09A 2WN2A 2VMCA 1JYNA 2VZSA 3E1F1 3K77A 2VZVA 1K42A 1H6YA 3T0DA 4JX0A 4QDRA 4BDVB 1CZSA 3ZM8A 4CU8A 4JKKA 2BZDA 1WCQA 4PQQA 2Y6GA 2V4VA 2VQUA 3WF3A 3A21A 3GGLA 1CZVA 3DECA 2BBAA 1JI6A 4OMDA 1JHJA 2W9XA 4A6OA 4DUXA 1US3A 4A44A 5JXGA 1JZ5A 3T09A 1WKYA 4ZZ5A 3HN3A 1EUUA 4TTGA 4XURA 3IAQA 1OH4A 3OB8A 2VMEA 2Y6HA 5IYYA 4MGSA 4Z2AA 5JXHA 3OGVA 4KI5M 2ZEWA 3K75B 3PUIA 5IJRA 1XNAA 2W47A 1UMIA
chains in the Genus database with same CATH superfamily
2WABA 4NHLA 4A2UA 4R9DA 4A3ZA 4BIFA 2C24A 3HPNA 3HBKA 4CP2A 4FFGA 1US2A 2GC0A 2WSVA 3WINE 2VBDA 2VZ3A 2VZOA 1UKRA 3K4AA 1RVF1 1GU3A 2WWJA 3HQRA 3POGA 1PMJX 1H8TC 1WMDA 3ZN5A 5C5UA 1HIXA 3VD9A 3VBSC 2DF7A 2NM1A 3OPTA 2JXAA 3SH3A 3PMEA 5IATA 4ORFA 5FYTA 1ULEA 1BEV2 1FPN1 5FMOL 4A7YA 3FMGA 4ASLA 2Q4SA 3ZFGC 2D44A 1ASJ1 2IFWA 1B09A 3VL8A 5FZEA 4MO3M 1QJY2 4TXWA 1PMIA 2RM21 1W2NA 3SNMA 5A7QA 4TZDA 4C1WA 4PLMA 1APNA 2VOVA 3R4SA 5D21A 2X5IA 5CFCC 2W92A 5FZ6A 1UY0A 5BNNB 2WNVB 3E6CC 3TNPB 1YQ2A 3IKWA 3MIGA 3OPZA 3RNSA 3SCFA 3WLUA 1UL9A 2WO3A 2OUHA 4LPLA 1NY71 3WDYA 2W1UA 3AP6A 5LB6A 4NAOA 3NJVA 2A6WA 3RGBA 5HXVA 3R05A 2FQPA 4GWMA 2Y38A 5C4WC 4P9LA 1VRH3 1UQXA 4CU6A 4LEJA 4XCAA 4NAMA 4BQ4A 3ZFEB 4Q4X2 1DFQA 5IVCA 2NP0A 2D6OX 1HN0A 2SBAA 3UKVA 4BCUA 5J1XA 1SLCA 4H7MA 3ZN6B 3ZSJA 1HRI1 1KXGA 4YWAA 2ZMLA 4BB3A 3CQOA 1S2KA 4Q0VA 5C9AA 3NJYA 4K9SA 3O1VA 3ELNA 4LORA 5KXDA 2WZEA 3NKTA 4FXKB 3WDVA 3DYOA 1LEMA 1QMJA 2XVKA 2VUDA 1IPSA 1J3RA 5C3SA 2RS12 3K48A 2ENRA 1DBNA 1R64A 5FY8A 1PIV3 1FOD3 4ARYA 1OQ1A 4N43A 2WT2A 3L2HA 1S55A 1UW8A 5K4LA 1O8PA 3VDDB 4LQRA 3THTA 5LEKA 4MVTA 4FT8A 1C57A 4WM7A 4UF0A 3B69A 1HLCA 3AFKA 3S0MA 1PMHX 2EVXA 1R1A2 1DGWX 5D1IA 3Q9OA 4RR3A 1XE0A 2XJQA 4XOGA 1C5HA 1DG6A 2BOIA 2MEV1 4YNIA 4CDXA 1UU6A 2CTVA 3SHRA 3VKMA 4C0HA 4DXSA 3OD4A 4YM3A 1WA6X 1J84A 3UESA 3KCXA 1POV1 3P3PA 3MIFA 2YXSA 4MYEA 2RJKA 1H2NA 3HD8B 1H8TB 2NN8A 4K8FA 1ALYA 2UWBA 1QEXA 1YC61 2PTMA 3AYDA 5ACA1 2CGOA 3AX4A 3H8RA 2EAKA 1ONAA 2VNGA 5BY5A 5ACA3 3AKRA 2KXLA 3FX3A 4LHLA 5FXWA 2NMOA 2WZPP 4AHWA 3IIAA 1CZTA 4YG3A 1SPPB 2ATFA 4GKYA 2IXIA 4OUSA 4ARXA 2WO2A 5LA1A 1W9FA 1GWKA 2PAMA 1NCQB 1UPSA 4GXLA 4JDMA 3K46A 4GD4A 1EYBA 3H0OA 3KV5A 1XE8A 3CL1A 4RHV2 4EN0A 1W9TA 3PJQA 5FMOS 1XSQA 3LOIA 2I07B 2ZZJA 4AZZA 4CSWA 1PVC3 2J7MA 3PIGA 4N43B 4COYA 3BOWA 3OUIA 1BEV3 4N53A 5F7UA 1RTVA 2P34A 2YY1A 3IN9A 4GALA 5EFUA 5C4WB 2WDBA 5IWFA 3ILRA 4YFWA 3MYXA 2PAEA 1VBB2 3WHUA 5GM0A 5DUWA 4XXAA 5C9AB 5AVAA 3RG0A 4QGMA 4B3NA 3IZOA 4LKFA 2FDFA 4FAGA 5FO8B 1PZ9A 3OOXA 1WGPA 5E6HA 4UFKA 1KD7A 4AEJA 4MHRA 1WBLA 5F3GA 4QM8A 1ODMA 3VBFA 4QPYA 3UT0A 4QGNA 2K2SA 4FPCA 4OQ9A 4Q4X1 5I0RA 3NV1A 1UWWA 3AKQA 1ZZCA 2WAOA 3VKNA 3WNMA 1K5MA 4AVBA 4JHTA 4YW7A 4BK4A 4ISRA 2UYBA 3ZYIB 3I2JA 5A7WB 3RJ2X 4OULA 4LULA 2IXCA 3MV11 1VBA1 3TAYA 3M3QA 1C8M3 3MPBA 4Q8LA 4NIAA 2MNGA 4IGQA 2P6HA 2ET7A 1AYM3 2A75A 2PHTA 2XLGA 1IHMA 1XSRA 2JG9B 2EF6A 3LPGA 1FXZA 2XJSA 2Y34A 4BLIA 5L36A 1VBE3 3B93A 2H0BA 3VDCA 4WM8B 4TN7A 2WYSA 2BBVA 3U07A 3DGTA 2BJSA 3FFZA 3IWZA 2DCJA 1RUE2 3J26N 5EYYA 4ITCA 2BV4A 4P9XA 4M0NA 4RHV1 1Q8OA 3HAGA 2XLAA 3GNEA 4FPKA 2F6BA 3M3CA 4AVTA 4BZ4A 4JC1A 2L9LA 2RR11 2Z69A 5D8AC 2XHNA 1UY3A 4XF9A 3KT1A 2XGXA 4LIUA 4R9AA 2HWE2 4C91A 5K0UA 4QB6A 4K1ZA 1DCSA 3IDCB 1GZTA 2G4IA 1NCQC 2K46A 4RL7A 2VCCA 2WJSA 3LF7A 2AENA 1ULDA 1HB3A 1D2SA 3JBG1 4XMIA 1RUJ2 5DQ0A 2VQAA 5IVFA 1D4M1 2VH9A 3PIJA 4LA3A 4AEDB 4QPIB 2D5HA 1D4VB 1MQTA 4QXHA 3FLTA 2P4EA 2VUJA 5A3TA 3ALQA 3CKHA 1DIWA 1F9KA 4HN0A 2VMGA 1DHKB 1P8JA 4BK5A 1S0JA 1IS6A 1GV9A 4CUAA 2V5YA 4H7LA 3LQCA 3VBFB 4CPBA 1GBGA 2EICA 2VNVA 3SLIA 3MUZ1 4RS5B 1SLLA 1YFXA 2CAVA 4N9IA 4OLLA 1RUI3 2D6MA 5HI0A 3RI9A 2HKXA 4FOYA 5IT6A 2FZ2A 4LOTA 2R30A 5G04L 4ZU7A 1YHFA 2Y60A 3VBUA 3AP5A 1U5XA 3GBGA 3I3DA 4EN8B 1Q8VA 3B9CA 3NNMA 3AKTA 3ZXDA 1OMIA 2UYAA 3I2OA 4YRDA 3U37A 2XKPA 1LOFA 3MV01 4CUBA 3WF0A 2B8MA 4OI1A 5KXBA 2RS33 3J8F3 4NPRA 5GLTA 4S2GA 3AMHA 4E27A 4NOTA 4OZXA 4PIXA 2ARBA 1XPWA 4YVWC 5BNPC 5T54A 5DZGA 2R6QA 4QXKA 3OG2A 2VL4A 4S2DA 1GANA 3GCXA 4XAEA 5FLJA 1MPXA 4XIOA 1XNTA 2PFWA 1VMFA 2UY9A 4YW3A 5A6XA 2Q1FA 4AEMA 1CIWA 2JG9C 2Y6LA 2F17A 1V70A 1OVSA 5LA2A 1G9CA 2VMDA 1XXNA 1ENXA 2HWE1 1AHSA 4NRMA 5CNAA 3VB9A 5A3MA 1RIRA 4Y4RA 5AVPA 4EN7B 4LIVA 4XACA 3JB4C 1QOTA 3WOGA 1NCRB 2J1VA 4PI2A 4CCMA 3BU7A 3AZYA 3IIIA 4EROA 1XRUA 5DAQA 5LBFA 3VBRC 1PGL2 1CJPA 2X10A 5JOZA 2Q8DA 3O1PA 3U75A 1PNFA 4AI3A 3O0XA 5SV5A 4UOJA 1RUE1 2Y26A 4UF0B 3EQEA 1DQ6A 1RJ7A 1Y43B 4PDWC 3CF6E 2BDRA 2XWJB 2X29A 2DVDA 1NX9A 2WRAA 3GZUC 2E7QA 2QQJA 4I09A 5APAA 1O7FA 2E63A 4QPIC 4XF0A 5G05L 2DUPA 3S57A 1TMF3 2HWD3 3ME2A 4FQ4A 1C8M1 2CHHA 4CEYC 4RD7A 3NAPA 3ENRA 2ETEA 1VRBA 2ZCWA 3C7FA 3J9SA 3NSTA 4XZUG 4OZOA 1VR3A 1SQ4A 5EZWA 1OXCA 4QQHA 4X8PA 1XNDA 4JGYC 4RS5C 1VBE1 3POEA 4D6QA 3WNPA 1YWKA 5IAVA 1MZ6A 3D82A 4QWNA 1QJX2 4HVOA 2OPWA 3Q8EA 1R083 4NIGA 1RUJ3 4JV4A 1W3XA 4Q1PA 2VZTA 1BHGA 2RS53 3BGAA 3ACLA 3CJIB 4CU7A 1LHUA 5C3PA 4AGGA 1YI9A 3GHMA 5A6QA 2E7TA 2ORZA 5FOJB 4OHYA 2RR13 3ZIWA 2D40A 2VTXJ 4XFHA 5E89A 4COVA 5FZBA 4LE3A 4EV0A 4Z8BA 2DFCA 3PLQA 5BNOC 1CGPA 5FPZA 2ET1A 2W52A 3M4FA 5I8TA 3QH6A 2D6NA 2IXHA 3LFIA 3FLRA 4NN0A 2W1WA 2ZMNA 1JYWA 4DIQA 1LGCA 3HQXA 5L9RA 2FDJA 5FBJA 1RUF2 2BEOA 2R0HA 3BB6A 4TWTA 3AZWA 1V9U3 3S7IA 1PK6A 5FZ9A 5AC91 1N47A 1ZRFA 4A7ZA 1FATA 1G8WA 3U0ZA 2Q8CA 1VBC3 4FPHA 1WBFA 1FOD1 3LA3A 1SG3A 5JCTA 1CAXA 5CU1A 2ZGQA 1FYUA 5DAVA 5B4NA 2J1UA 2E26A 3AMPA 4JQRA 5GZCA 1ZNPA 2EA7A 1NCRC 1UNBA 2XDVA 4XABA 1URXA 1UY1A 4LO4B 2E31A 3KT7A 4HG6B 2XUMA 4ZY9A 3NNJA 4Q27A 2AUYA 5JI9A 5LEJA 3OYWA 4EZHA 3RRDA 3VBRB 1W04A 4Y20B 2PA7A 1C8NA 3I3EA 2W1SA 2BTVC 1W6MB 1QF3A 2WLPA 2BRTA 5KHKA 4QXCA 3VL9A 4EN9B 5T5OA 1AR82 5JZGC 2ZS6B 4KWJA 2VNOA 1BVP1 3PVBB 4ATFA 4CA9A 2DCKA 5C33A 2K9ZA 2C1FA 1O3RA 4BQ1A 1NUKA 4CDUA 2GNBA 3WY6A 4AQSA 4DY5A 3T30A 4AHXA 2ZX3A 2R7EB 4CEYB 1Y3TA 1GZWA 4AEKA 4LR4A 2D93A 5DDJ1 4BM8A 5JSRA 5FZFA 2WNUC 1JOJA 1CAWB 5C5TA 5C8CB 1W39A 2VC9A 3I2HA 3I2GA 1AUYA 1RUH1 2QQKA 4QHBA 4JGYB 4TYSA 3BUCA 2WN2A 1ND3C 1AVBA 1RVF2 1JHNA 3LWCA 3EBRA 3E1F1 4Z2WA 4LUKA 5FYYA 2VZVA 1K42A 3H3UA 4XBQA 3FFQA 4GKXA 2ARCA 1JOPA 4AI8A 4NHXA 1XNBA 2PLV2 2RHPA 3ZM8A 4COWA 2YHJA 1KRIA 1W6NB 2CYFA 1AXZA 1K5JA 4JKKA 4ES8A 5A1LA 2BZDA 3KMHA 5JI7A 1TNFA 2WZR1 2ZGLA 3NV2A 3POJA 4RSUA 1ULCA 2XL9A 2A3WA 3CHXA 3EO6A 5E8AA 3A21A 5C3OA 4XDPA 3PU3A 1H2MA 2WS91 4FTEA 1PK6B 3DECA 4ZS3A 5FKBA 1ZZ9A 1RUC3 1OPOA 1W6PB 2VMIA 2I45A 3BKZA 2ZMKA 4Q26A 2P1BA 5FV3A 1BCXA 1O4ZA 1UZZA 2QNKA 2B7YA 4L11A 4N9HA 4EQVA 1CAVA 4A44A 5JXGA 1JZ5A 3T09A 4YM2A 1PM7A 3H1MA 1WW7A 4TTGA 3VKLA 2AYHA 1XYNA 4B1LA 1DGRN 1V6LA 3KS7A 1XU1A 3N9NA 1IS4A 2DUQA 4H3WA 2JENA 3H9AA 2VMEA 5DAWA 3ZYBA 2A6XA 3QH7A 2AC1A 2LM3A 2RG4A 2VBBA 3VBOA 4DMIA 4DPNA 4Z2AA 3WT3A 4AF9A 2BW8A 3OGVA 1R081 3UJOA 4AI2A 2PHDA 3OUHA 4IV3A 5IJRA 1YQ6A 3K3NA 1XNAA 1BK0A 4D6RA 1UMIA 3BPZA 4JRAA 4LBQD 4OHVA 4Q4V1 1OURA 2XJUA 4FOVA 2RS13 3ZFGB 1H30A 3E5UA 3NRUA 3DN7A 4ZU4A 3VBHB 1C3HA 4R8HA 3VHNA 4HPKB 3BALA 1ND2A 1AYN2 3TN91 1LKNA 3ON7A 3TEXA 3I2KA 3USUB 3EHKA 1DQ1A 1U12A 2WBKA 3G7DA 4JGZB 4LUMA 5EPAA 2YFUA 4ATEA 1RGSA 2HWF3 1R1A3 2JDAA 2ZEXA 1YQ8A 5FCCA 5DMYA 2R0FA 1SBDA 4L2NA 5FK7A 5FPLA 1AR81 4BLJA 3NAPC 1GZWB 2ZOEB 5JZGB 5KXEA 1N1YA 3PVEA 4LLFA 1K12A 4FCAA 4E9KA 4C90A 1MS9A 2JE7A 3HWJA 4PCRA 4QPIA 5FRAA 1PO21 1S0BA 1SEFA 1NQDA 2A70A 2VAUA 3O5SA 5DDJ2 3DCQA 4PF5A 2JG8B 2JDMA 4XFIA 2XKOA 3X29B 3AK0A 3VZNA 3CIHA 1OF4A 3ZYJB 2WL1A 1LB2A 2VOKA 3FL7A 4AFDA 4XW3A 4IETA 5FP8A 4RQPB 3TWIA 5FMBA 1W8HA 5FMCA 4DQAA 5FY0A 5IK4A 2K0GA 2ZX2A 1LU1A 5FP4A 2QQLA 1REDA 5CADA 1SFYA 4YGBA 2VZPA 1J1LA 3MI8A 1PVC2 2XUEA 2YV8A 1A6CA 4LK7A 1S0CA 2HEYF 1QY4A 5KXCA 2ZX0A 2CGNA 3EB7A 1UPIA 3C7OA 4CXXA 1B35C 4QPWA 1VAMA 1FX5A 2W5FA 1I9RA 1AX1A 3MDPA 1ULFA 5C70A 1HN1A 2XG3A 3EJKA 4XF3A 5C3RA 2WQ8A 3D8CA 1X9TA 1WUVA 1TE1B 2CL2A 5J48A 2YGMA 2MPFA 5JAXA 1V6IA 4E4ZA 2AZ5A 1UU4A 5T3NA 4BIOA 2VTFA 3H50A 1L7RA 1NOVA 1W8WA 4HT1T 4XDQA 1S2BA 1IQDC 2ERFA 3MPPG 4UW4A 1JW6A 4WVMB 4YVSA 3ZX7A 2JDYA 4I2OA 2D3PA 3KZ4C 5DXDA 3UYJA 4CDQC 1L7LA 5LBBA 4LKDA 3ZSMA 4IE4A 1AX0A 2DU0A 4P00B 3UNPA 3V65A 2EXHA 4PJYA 4Q5OA 4XFAA 2HEVF 3IB3A 3URFA 5FJKA 3M7AA 1E5RA 2CY6A 3WX5A 3LDRA 4XFFA 3ZYGA 4N8MA 3E97A 2V4AA 3JCIA 3POBA 2DWRA 1BKZA 1CN1A 1QDCA 5H9QA 4XHBA 1LECA 1GOGA 4AW7A 1YI7A 5DG2A 4XILA 4AOCA 4YG6A 2YPJA 2WC2A 3DUIA 4QU2A 2YG0A 2FZ1A 1MQTC 2P3IA 4M01A 4ET7A 4Q1RA 2XR4A 1G7YA 2YBSA 2EIEA 3AVRA 3T0AA 1GZ9A 4LHKA 4AFBA 1SACA 3H3LA 1KITA 2R32A 1QHDA 3T3YA 5LBCA 3VD7A 3WW4A 4GJYA 4F83A 2VVEA 2BFUL 1QGLA 1A8MA 1WCUA 3VD4A 2OA2A 3O1UA 1IS3A 1XNKA 3KM5A 1OC1A 5I8SA 3VZKA 3HEIA 4V1PA 3USSA 2WUHA 3OCPA 3KD4A 2JE9A 2DUOA 2VMHA 3U1XA 3VBUB 4QKFA 3AYCA 2G19A 5F2WA 1ZBA2 1COV3 3I54A 5FZ7A 1S1AA 5A3NA 4N7IA 4XJZA 4KG0A 3GJAA 3HNYM 1WLDA 1ULOA 1UYXA 4P9GA 1UO9A 4AHZA 5GLVA 5JVVA 1W0OA 3ETQA 4J1XA 3KWVA 3NJXA 1ZVFA 1VALA 5FYHA 4WVMA 4YVSB 1SPPA 2CAUA 4IERA 4A7KA 4FQZA 3AP9A 2J1TA 5A6YA 3OGRA 1HQWA 2A3YA 1DQ4A 1RYYA 5A3PA 1O5LA 1DZTA 5EJ3A 4QAWA 4X8NA 1OUXA 2WA4A 1HXS1 4FPLA 4I3PA 3DYPA 3H3ZA 1GFF2 3FLPA 5GZEA 2IXKA 4OI0A 4C8DA 3ACIA 4CTEA 5J37A 2ADEA 1V6JA 4BWOA 2NPIA 1LHWA 1JODA 5F2SA 3KGLA 5FY1A 5BPXA 1W2OA 1FMD2 4CDQB 4OMCA 1UX6A 1W9WA 3AMMA 3HMYA 2QQIA 3LA2A 4MSVA 4NO4A 1ENQA 1W8NA 3FN9A 5KR7A 1ZRDA 2RJ2A 2WNEA 3DYMA 1UZ0A 3BU0A 4LHNA 4GJZA 3BVCA 2H0VA 2OPKA 2BGCA 2XBO2 2QTWB 4ZS2A 4CP0A 4ES9A 3JD73 2OIIA 2W2IA 1Y9QA 3A23A 3WSOA 1JZ2A 5ABJA 2Z79A 5K8SA 5L19A 3HR9A 4M00A 2TUNA 2LS6A 4X6QB 5FZKA 4MG2A 1G9DA 5B4XA 3WDTA 1YYNA 1ULGA 4F7ZA 2CDPA 3QCWA 3ZXKA 2WWUA 3PMSA 1QXRA 5GLZA 4DZGA 1DQ2A 4XCBA 3KV6A 4QU1A 3C7HA 5FUNA 4XBLA 2H6BA 2IZWA 4CCDA 2YU2A 1UN1A 2JIGA 5FY4A 5IFTA 3VDBA 1RMU1 4GWJA 3ZN6A 5GZFA 4C1XA 2Q1MA 2ZGRA 4RR3B 4UXAA 4K20A 3DPRA 4Y1YA 3M2MA 4HOOA 5ANQA 4ZXKA 1B35A 2CNAA 4JKLA 3AC0A 3TOJA 3I3MA 3BODA 4LO5B 4WV8A 4LO7A 2MEV3 5FR3A 4GH4A 2ZHMA 5C8WA 1PGW2 4AVAA 3HJRA 2J22A 4MXWB 3VV1A 2Q30A 4CXYA 5GZGA 4ZONA 1AXYA 3ZVXA 1UIJA 5LCWL 1IZ3A 3AKSA 1ASJ2 2VUCA 3A0NA 3PUQA 4IXLA 2Y8KA 1LENA 4XUQA 1AR72 1IPJA 1H9WA 1PO12 4O9GA 1SLIA 2XVGA 4UW6A 4AFMA 5HPOA 1DP0A 2C5DA 1KS5A 2RM22 2WZR3 3L2YA 1V00A 4CDQA 3IPVB 5FUIA 2VY0A 3BOPA 2ZTNA 4BA6A 2XONA 1O5UA 4YVSC 2GH8A 1AR62 1IOAA 3NNFA 5C6CA 1ODNA 2AREA 1LULA 2VG9A 3RZMA 3VN4A 1ZBA3 2DVFA 3P3NA 2V5DA 5A1AA 5IVJA 1K45A 3DXTA 1YIPA 2DVAA 5F3EA 4BH9A 2I74A 4CCEA 5JPMB 4JGZA 1EP0A 5TSWA 3MZHA 1MS1A 4XEZA 1JYXA 1HW5A 1NZCA 5BUVA 3LFMA 4FFHA 5I0TA 1JYTA 2HWC3 1AL23 3ES1A 3SEEA 3T2TA 5M0TA 3ACGA 5A7NA 5LY1A 1S0FA 4WM7B 2XL7A 1OH3A 4Y4YA 1EPZA 4Q4W3 3IMMA 4FPYA 4YVWB 3VBOB 4IDZA 4PLNA 4UW3A 2PHWA 3VKOA 1N3PA 4B4RA 5IVBA 2Y64A 3HT2A 2C9KA 3RI8A 1NA1B 4A42A 1COV1 2YZ4A 4PI0A 2OXBA 2D5FA 3MFCA 1V9U2 5J36A 4QQOA 1LAJA 1GP6A 2J1AA 4A6SA 1ZRCA 1BJQA 5JMOA 1T6BX 1AXKA 1RMU2 1TZOA 2VXJA 1A78A 1LGNA 5C4WA 3S6PA 1JYIA 2YYOA 3N7KA 3IDEA 4IE6A 3VHPA 1S0IA 5FZDA 1FV3A 2HWB2 4I01A 2NLRA 1YJKA 4XVHA 5CB7A 1V6MA 3RQ0A 4UFHA 4NHKA 3C3VA 4D8MA 1QXJA 5FY9A 1IG0A 3UGHA 4H55A 5CIRA 1UMHA 3C7GA 2IUWA 4IEZA 4QDSA 3ZOIA 3NV3A 1W6PA 2X5IC 5CFCA 1JU3A 2P6CA 3ACHA 1Q8PA 1UCXA 2BWAA 4LO6B 1XQNA 1W6QB 3U4SA 5HXMA 4Q4W1 1VB2A 3TYJA 3M8LA 1UY2A 3Q8CA 1SLAA 4Y22A 3WF2A 4QX8A 3AZVA 4XFGA 4QGLA 5GKAC 4W65A 4WVVA 3LEMA 1WD3A 2D3RA 2Q0AA 2RS32 2W95A 3J8F2 1ZZ8A 3MLKA 2PQSA 5L9BA 5BNOB 2O8OA 1AZDA 2SLIA 4FPOB 3ZFEA 2AACA 2ZX1A 2ZGSA 5EV7A 1W06A 1NZIA 1VE0A 3MLLA 5LW9A 3FUQA 2R043 5KHHA 3AM2A 1S0DA 2ZXQA 3H1YA 1UOFA 4LE4A 4CZSA 4Z1VA 1RVF3 5EJZB 1QDOA 4ASKA 1DLLA 2KM2A 2R041 2R1DA 3IMNA 2QDRA 4R52A 3UGGA 4HPKA 3D0JA 4GWNA 4M3CE 1GZCA 1BMV2 1W9YA 5L7OC 4CDUB 3SKVA 4QKBA 1VBA3 2P37A 2ZHLA 1ND3A 4Q0QA 3BTZA 2W46A 2AR6A 4Y22B 2ZGMA 5LBEA 1NG0A 1WCSA 2RM23 2WZR2 4Y5Z0 2WNUA 5FY7A 1OD3A 3RSJA 3WEZA 3WW1A 3ZMOA 1UXXX 3A0KA 2GN7A 2IXJA 3WP6A 4XZPA 2HWB1 4CCCA 1RUG1 1WW5A 2GN3A 3WUDA 4LBQA 2A6VA 3PUHA 3LGRA 1CX1A 3RWKX 2UU8A 5FYUA 2R061 2DCTA 3PJYA 5FZ0A 4XAAA 1OI6A 2WKKA 4LOSA 3V64A 5DZFA 3KGZA 1DQ0A 5IVVA 3OBRA 1VPHA 4MADA 3VHRA 5IK7A 5E1RA 1N1TA 1TMF2 2HWD2 4RN5A 1I1EA 2GP5A 4E4SA 1S0GA 2XJTA 4PBPA 4BQ3A 2EIBA 2QJVA 1OQEA 2LUWA 2O1QA 3I3BA 4LT5A 4BQXA 1AR93 3GDBA 3B02A 1YXWA 2JB8A 1OSGA 3RYRA 1UY4A 3ZKYA 4KU7A 5IW0A 5FYBA 1OQDA 4J6GA 1ND3B 1JMUB 5AFBA 3AZZA 1R082 3JBG3 4Y3OA 4S2HA 2E7AA 2GMEA 1OF3A 5I93A 1W6NA 1RMU3 1YCIA 4OFGA 3ROUA 5FPVA 5F1RA 1RUG3 4AI0A 3QOPA 5IFPA 5GZDA 2P2KA 4AAPA 4IW3A 1Z7S1 3DXUA 3RZKA 4BQ2A 1UMZA 1ZA4A 2YMZA 4FXGB 4LTAA 5FLHA 3SCHA 2X09A 3IDBB 1NYWA 3N9QA 5LK7B 3Q8FA 4YW2A 2VMCA 1JYNA 1OKQA 3ZDSA 2FCTA 1MZFA 3GF6A 3ZSLA 2P3YA 3K77A 1H6YA 3T0DA 2HBTA 1RUI1 3WDUA 4HFSA 5JZGA 1GNHA 1CZSA 1Q5OA 1QJY1 4K3UA 5DUUA 5E88A 3WHTA 1O3SA 1UOBA 5EHDA 1WCKA 2IWGB 4URTA 1WCQA 1CONA 3OY8A 1ST8A 2D7FA 2OW4A 2Y6GA 1GLHA 2ZABA 4AQ6A 2IC1A 1MS5A 1UZWA 2QKDA 5IVYA 2V4VA 3J7LA 4WZFA 4QKNA 3ZFEC 1HQNA 3E5XA 3K2OA 5F8PA 4EWAA 5BYNA 4Q4Y2 2IXLA 1NCRA 1SFNA 2JJ6A 2PELA 4NHMA 3LDKA 3OBTA 4YARA 4NR1A 2YUEA 1SDWA 3LCPA 2QZ2A 2WS93 1JHJA 1V6OA 4PQ9A 4HXCA 1VLNA 1RUC1 4M3CB 5JSOA 1WKYA 1PVXA 2P3JA 3MW3A 3PL0A 2R042 5FO7B 5FY5A 4NWWA 4CDWB 4QKDA 4V2VA 4HK9A 1PK6C 1YQ5A 4FVVA 4XURA 3IBMA 4UW5A 3BTAA 3OB8A 2DVGA 4LLOA 4OI2A 4B7EA 1X50A 4HKWA 1IG3A 3S5AA 1PVC1 4QQLA 2R073 4MGSA 4Q0UA 2BVBA 4PDWA 2WSUA 1F5FA 4XHXA 2WFF2 2TEPA 1LHNA 1OLMA 5F5QA 2W47A 2QFEA 4LBKA 2VCMA 1T2XA 2ZGKA 5J3UA 5FYIA 3JXSA 3VBRA 1LJ7A 1VP6A 2V72A 1W6QA 2VOXA 2JDNA 1GMMA 3NAPB 1DYKA 3ECQA 4RHV3 1H1IA 4ZHNA 4XTMA 2WAAA 4LJHA 3SC7X 2DBNA 5FXXA 5H9PA 1W8FA 2ZGTA 3TN93 4GA9A 2ES3A 2WT1A 3N3HA 3OUJA 4LBLA 3JU9A 4DUVA 5A3UA 2PLV3 1HRI3 2G9GA 4MZUA 4Q29A 1QJFA 1VMJA 4KH9A 5DPNA 5FZGA 4CUCA 2BGOA 2F4LA 3CJIA 3ZFFB 4CEYA 1VBB3 1GP5A 4FP3A 4XQ4A 1NKGA 1JU4A 4R4ZA 5FKCA 4DEVA 1O3TA 2WQZC 1QJEA 4JGZC 1GICA 5F6LB 2EAAA 4UAPA 5BNPA 1HJFA 1WW4A 3AJYA 2Y6KA 4FBFA 1CAUA 3E5QA 1HB1A 3E6DA 3NV4A 4J1WA 5EWSA 4N7UA 4A41A 5CFDC 4NJ4A 5A7WA 2JDZA 4D0QA 1PGL1 4FPFA 2DURA 1KEXA 1LOFC 1BXHA 4P5HA 4XE9A 1OVPA 3VZJA 3O1RA 4MH0E 3MEPA 1DU3D 3FHQA 2D97A 1LOGA 3HT1A 1CWPA 3J7MA 3RMXA 4DS0A 1JS9A 2QCSB 2ARAA 2BP6A 2OT7A 3KF5A 4RGKA 3THDA 1GP4A 3WQ7A 4JAAA 4MGTA 3W5NA 1AR91 2YC2A 4HETA 4KU8A 1EPWA 1VRH1 2VGDA 2GMMA 3B3QE 4DB5A 1C8M2 4NUBA 2OVUA 3ASIA 3NW4A 3WNKA 1CPNA 4BMEA 4GH4C 1EUTA 4XYXA 1NLQA 2CU5A 4DXZA 4ASMB 1VBB1 4AAXA 5FTTC 2YC0A 3AXDA 2RDSA 3DPRC 1VBE2 3J7HA 4META 4YZ4A 3ZR6A 2B4KA 2RS31 3J8F1 1BVVA 5L9VA 5A32A 1ZBA1 2RDQA 3FHAA 2GNTA 3M3OA 1XC6A 4Q0PA 4R9CA 4Z07A 3KHCA 2ADDA 4YVWA 1ACCA 4XXPA 1QJZA 1VAVA 4BHPA 2RDNA 3K4DA 1NCQA 4A4AA 4BOWA 4HVQA 1REEA 2E6VA 2RMU1 1K5MB 4X6RB 5FZLA 5FXZA 2E32A 1BLZA 1BYHA 1QOOA 2YPDA 4KNCA 1QQP2 5K0UC 4QQ2A 4ZPIA 2HWE3 2BNMA 1DGLA 3ZIXA 1OLRA 4G4FA 1X8MA 1BEV1 1FPN2 2C9AA 3KSCA 2C4XA 4WZCA 4GIQA 2D98A 1H1MA 2LTNA 1IQAA 4I02A 5ABJC 4XPVA 5F32A 4P9JA 4A45A 3NNGA 4Y1VA 1GNYA 4MGYE 2QQOA 3LIHA 2WFF1 1FMD1 3WNLA 2Y6JA 5A33B 4LMFA 1MEC3 3UL2A 4ZXEA 1ZREA 5KC5A 4NVPA 1XE7A 3FJSA 5FK8A 2WFF3 3VKFC 1HV1A 4AGVA 2A6ZA 3O14A 5BV6A 3KV4A 2Y6FA 3KQ4B 2BGPA 3LEGA 3NMBA 4N53B 1CESA 2R062 1VMHA 4L8QA 3ZO0B 1TNRA 4IE5A 4BYYA 4KWKA 2YBKA 3RYPA 2XBO1 5LATA 3ZXJA 3GXUA 5CYYA 3S5QA 3WUCA 5F37A 3DF0A 1JZ6A 2VXRA 2YB7A 3AP7A 4AQ2A 3OTFA 1BBT2 2GNMA 1PGSA 3WNNA 3FE5A 1N3QA 5FJHA 1X9PA 2Y33A 3MW2A 2WA3A 3OJBA 4AVSA 3B9IA 2EIDA 1QWRA 4QB2A 4QQPA 3VBFC 4CXWA 4JRLA 2CGPA 4FPJA 5FYSA 1UD1A 2HYKA 1MS8A 1L3JA 4IQPA 1W90A 2A7AA 4IE0A 2ZX4A 4AGRA 3MLJA 4XJUA 3WVJA 3NWKA 1IGOA 4QXBA 5DZEA 5GLUA 3WXPA 3B94A 1KGYA 3SH4A 3W5MA 1Z7S2 1X82A 2Z5WA 5FZ4A 3I97A 1RUH2 4TSVA 3I2FA 1JZ4A 1XOYA 2XXZA 4D7SA 2OZJA 5GLWA 2PMWB 4CCLA 2PHUA 4FO9A 1UZYA 1VRH2 2GSYA 3LE0A 1HXS3 3OGGA 2NMNA 4WBBA 1LHVA 4YGDA 1GUIA 4BPZA 1NE6A 1LRHA 4OQ8A 4FOWA 3WP4A 2DDUA 4LKSA 3RYKA 2VQ0A 4XUOA 5FZOA 4B29A 5IVEA 3N4MA 3OBZA 4QMAA 2A5ZA 2QQVA 4NWVA 5T52A 1BQPA 5BNPB 2VZUA 3RZJA 2V09A 1GQHA 3KV9A 3K51A 5LA9A 3APBA 1K5MC 1U5IA 1D4M3 1TME3 2YU1A 4U2AA 2VTXA 5J7MA 2FMDA 2ZHKA 4TLGA 4F8AA 1SLTA 4AVVA 3ORJA 5FZHA 2OS2A 4QX5A 3SH5A 4B7KA 4LA2A 4JDOA 3D0SA 5FAXA 3POSA 5ABJB 1F8VA 5LRRA 1PZ7A 3WR0A 1W3VA 2G9ZA 2VU9A 4PIZA 2JEMA 5FZ8A 4IEOA 4HZFA 1FAYA 3GHNA 4MXWA 1FT9A 5T50A 2J1EA 4N90A 4UFJA 5CVRA 4IEXA 1ND2B 5J98B 5L73A 5FLIA 1OHFA 1E5HA 2DCYA 1DZRA 1LU2A 5KHJA 2TNFA 4RQPA 5HCHA 3KHBA 4ONUA 4YM1A 3AMQA 2VBPA 3LIGA 4RR3C 3RZGA 1OUSA 2BQPA 2XQRA 4N53C 1LCLA 3O7OA 1UOJA 3S7EA 4IEQA 2EXKA 1LOEA 2HEWF 1NAEA 1QJU3 1FI2A 2QBXA 4QDQA 4CCNA 2E53A 1DDLA 4QHOA 1LTEA 2QZ3A 4IEVA 4P08A 4QX0A 4LBOA 4N43C 5FP7A 5A80A 4W6XA 2YBPA 4BMBA 1RC6A 4KWUA 1VAKA 3HN1A 1DF0A 5I0DA 5JOXA 3GZAA 2XJRA 3TEYA 2OUJA 3WF4A 2D3SA 4MOAA 2QUOA 3AMNA 3I3QA 2R063 1JUIA 1AL21 4D3WA 5KHIA 2E33A 5C9AC 2AH2A 4UFIA 2FBEA 2QDNA 4FOQA 5DAPA 2VNRA 4BXSV 1LHOA 2VCAA 4CP1A 1W2TA 4M0HA 1RUF3 4UYBA 4HKLA 4JTNA 5LRSA 3R6SA 3WF1A 3NQHA 2Q1ZB 1RINA 3H7YA 3N9MA 5DG1A 1MEC1 3OGSA 5LWBA 1HQLA 5F3IA 3P1IA 1VBC2 5DUVA 3VD3A 4D6SA 1UYYA 3GM8A 4P9IA 5H9SA 3PUAA 5EJ1B 1WMEA 1PO22 5SV8A 1YO8A 2JD9A 2JE8A 1EV11 1XB9A 2AGSA 3BIWE 3ZSEA 4DXRA 2FDHA 1NT0A 2YDEA 3PTRB 1R091 4WM7C 3RS6A 2JDUA 4YM0A 5CBLA 3A4UA 4QX3A 3BN6A 1GR3A 4DINB 3OEBA 4V2WA 2HH9A 5JMCA 2XBO3 4LITA 5FO9B 1HV0A 5HCBA 3C7EA 4Q8KA 3AYAA 2WFPA 3ABZA 5E16A 2UURA 3P5BA 4P02B 2QQMA 4YZ1A 1RHI2 3I49A 3O1TA 4LKEA 2RV9A 1FV2A 3WDXA 1Q8QA 4XF1A 2J1RA 3VDDA 3POFA 1W99A 2R49A 4XIKA 1MVEA 1NXD1 2BNOA 2WO1A 1XJAA 1SMVA 3ZDVA 1J58A 1QNWA 3I59A 2B9VA 4AVCA 3ZSKA 4XQWA 2VVFA 1OLME 1ND2C 2NYYA 1X33A 2GU9A 2VW1A 1DGRA 3CJXA 2C26A 1AYM2 3I8TA 4G3YC 5D8AB 1RUJ1 1NY72 2Z4FA 5EXOA 4CEWB 4GQ7A 4PF1A 2C6SA 2ZEZA 4BQ5A 4QX7A 3SITA 3VBOC 2ZGNA 1A8DA 4IV3C 4LK6A 1VJ2A 1CR7A 4EJRA 2TBVA 4Y24A 4K40A 4E8DA 5C71A 2F4PA 1M4WA 4D7TA 4GB32 2BVVA 4QT6A 1RB8G 2DTWA 2XQXA 2RMU2 1S4CA 3ILFA 4AEDC 2BNNA 1RUD1 4XUTA 3S30A 1DQ5A 3WNXA 2QVSB 4XJ8A 5F5IA 4Y26A 4COUA 3V56A 1AR73 1PO13 3JB8A 4Y5SA 1SDDB 2LW8A 5KWRA 5IK8A 1YJLA 2WNUB 3M70A 3ZPOA 3ZFGA 5FMDA 1OKOA 1ZBE3 1AR63 1W2AX 4DXTA 3B01A 2WWSA 4AI1A 5A33A 2ID4A 4ZU5A 1EV12 1UU5A 2R071 3T08A 2X8KA 1F2NA 1F31A 4CE8A 1H8TA 1W8TA 3LKJA 5FZIA 1LEDA 1E57A 1W2UA 3FZ3A 3LD8A 3RPQA 3ZFFA 3T1MA 1YUDA 1W8ZA 3AVSA 3LDBA 2DVBA 4KL1A 1WZXA 2JKXA 1PZ8A 4CCJA 3KVAA 4P9WA 5JDBA 2B46X 4DO0A 1NQJA 4FI9A 3CU7A 1JZ7A 1YEWA 2XJPA 1PX3A 3N7MA 1O91A 4O9EA 5CKNA 3USUA 1X7NA 5JPNB 1O59A 5A3WA 2JIJA 5I91A 1JH5A 1SCSA 1OPMA 2YC4A 3N9LA 4OUEA 1RUI2 4IV1A 1LESA 1QIQA 1BK1A 2H6CA 3JQWA 4P5YA 3VBHA 1AR71 1OA4A 1PO11 3CEWA 2ZBJA 4EYUA 4JTOA 3MBWA 3CBNA 1JZ3A 3KCYA 4E2SA 1VBC1 3F95A 2D43A 1JUHA 3B5LB 3KB5A 4QPGA 1TME1 4Q4Y1 4CUGA 5FXVA 4CP9B 1TEIA 5AC93 1MR5A 3L9JT 1H0BA 4K6BA 1Y4WA 4Q4Y3 1H9PA 4L9BA 3ZMNA 2JECA 2XOMA 1ULPA 4CDUC 5A1FA 1BZWA 2XH6A 1Q8SA 1R1ZA 1E5SA 5H9RA 3T2PA 2MHFA 3KF3A 4W4ZA 4AK3A 5I8YA 4CDWA 5F9TA 1EAH3 5FREA 3VZMA 2HWF2 4DRRA 1VBD3 3JD71 1YRZA 4OUMA 5FZMA 4FAHA 1J59A 1DLCA 2W08A 2YGLA 4S2FA 3WV6A 5A7OA 4BU2A 2D6PA 2WYFA 4CEWC 1TG7A 2GNDA 1CAXB 2LALA 1VBD1 2PN5A 2VOTA 2Y0IA 3CMGA 4HONA 3ZXFA 4KWLA 2XWBB 4NRPA 2ZGUA 2JG8A 3I2DA 3OD0A 1OOPA 1C5IA 2WN3A 1W8UA 1GQPA 3B7MA 2B39A 4PDWB 1G86A 4YLZA 4HKOA 1V9U1 2P17A 2R072 1NA1A 3PVNA 2YFZA 3WCRA 4ZKTB 5BNNA 1QOSA 2YROA 2PXJA 3AZXA 4XUPA 5C7GA 2ZKLA 5IUQA 3ZKUA 1W6MA 4UFMA 4AFAA 5JR2A 4IEPA 1KQRA 2VZRA 3D3AA 4YG0A 1H4HA 5HCAA 3V0BA 2JICA 3C8XA 3K4ZA 4M3CA 2Q5TA 4K8RB 1D0HA 4NPMA 4WVZA 4D69A 4Y1XA 2EXJA 4UBGA 1S2EA 4LXLA 4Z82A 5KBFA 1POQA 2VZSA 1KDKA 4NPLA 1RL3A 1RUD2 3O1MA 3TRSB 5IAXA 1VIWB 1YNAA 5LK5A 4JX0A 2RMU3 4QDRA 4FPEA 1NE4A 4BDVB 5LZ6A 1CAWA 5C8CA 3TB0A 2XPJA 1HRI2 1VBA2 1HX6A 5BNOA 5KHGA 5IK5A 2JG8C 1RUNA 2IVIB 1LOCA 4A3XA 4IESA 4L99A 1ZX5A 4L92A 3U11A 2ARXA 4CEWA 4PQQA 4Q2FA 4OHZA 1N1VA 2WO7A 3QBQA 3U4XA 4PIYA 4BISA 4MX3A 2FMYA 2VQUA 4I0BA 1JXNA 2GC2A 4Q4V3 3WF3A 3ZXLA 4CDWC 5FDBA 2ZAHA 2RS11 2JDPA 2PQQA 2KA3A 5FYMA 1EY2A 5BNQA 3HBZA 1OOPB 1QJX3 2BBAA 1JI6A 3CNAA 2O14A 3POIA 2W9XA 4FFIA 4A6OA 2VUAA 3NNLA 4IV1B 4RS5A 1ZRRA 1O4TA 4XBNA 2UY8A 4JGYA 4XFCA 4DNYA 5C3QA 2BWCA 5FPAA 2Z42A 3OYWB 1GNZA 1SBFA 3BI3A 1F15A 1QKQA 2GZWA 2ZA9A 4URAA 4ZZ5A 2HWC1 3HQUA 1EUUA 1HDKA 2CV6A 3IAQA 1AR92 3W20A 1AF9A 2FCUA 5F6KA 1OH4A 4XETA 4D7YA 1I3HA 4DRVA 1BMV1 4P9YA 4NRQA 1DYPA 1GSLA 2Y6HA 1KFUL 4GAZA 5FZ3A 1AJOA 1RXGA 2VD7A 1NXMA 1YIFA 5FOBB 5JXHA 4CP9A 3U78A 2ZEWA 3PU8A 3I7DA 4QPGB 3PUIA 2ZAAA 4M3CF 3RJRA 3WCSA 3GALA 3WD5A 3C2UA 3I4IA 3IPVA 2VZ1A 4HL0A 3NL1A 2PHRA 4W6WA 3WQ0A 1Z78A 3LOBA 2VW0A 2V73A 4HBNA 5CISA 3POYA 4AL9A 1V0AA 1W6OA 4RGAA 2W87A 4IEYA 4CRQA 2ZEYA 5JXJA 4KMQA 3TBDA 5FYCA 4JCKA 3ZFFC 4HLTA 1W05A 2HWF1 2ZPXA 5EYXA 3M1HA 4Z92B 5T55A 2BFUS 1WW6A 1D2QA 3THCA 4Y5TA 4JKMA 3CO2A 1EAH2 1RHI1 1HRV3 2CSGA 2WNVC 3AL6A 3MO4A 1ZM1A 1IKQA 1MACA 3HNBM 1QQP3 4YGCA 1SHWB 5CFDB 1POV0 1HRV1 3RFRA 1DYOA 2VJXA 3DKWA 1FPN3 2VZQA 2JG9A 2PLV1 3PDQA 4JDNA 4GULA 5FPBA 5FBZA 5FWJA 1MQTB 1RUOA 1COV2 4MXVA 4XQDA 1DZQA 4IEWA 1UYPA 3VZOA 1U5ZA 2WR9A 4HN1A 1Y9GA 1AYM1 4FTSA 2FHRA 1M06G 3O1SA 4AI9A 1U5YA 2WS92 4M4RA 3IT8A 5FYZA 1ENRA 1KFXL 2VQTA 2DYCA 2BPA2 4B8EA 1KDMA 1YFUA 1GQGA 4IGOA 4PLOA 3GYDA 5D2AA 3UV9A 4KBZA 3VBUC 4NE9A 2D6KA 1QXPA 3CZUA 3MHZA 2KR2A 2PAKA 2WQ4A 3SISA 3W59A 2VMFA 4EWDA 3N9OA 3ATGA 1BBT3 1OBNA 2JD4A 4QM9A 2X05A 4BJ0A 3RZZA 1X36A 4QX2A 3DEMA 2GH2A 2W94A 1RJ8A 2PHXA 3VDDC 3VLBB 1FMD3 1OA3A 3SMHA 4KGGA 3IDAA 2FDKA 4SLIA 2D6LX 4O61A 4CVUA 1QJU1 1QU0A 4Y33A 3WP3A 2DCZA 2XB6C 4Q4V2 5JR7B 4YW1A 3FBYA 3ETPA 1IKPA 2VM9A 1RXFA 3M3IA 4XC9A 3SXWA 3TN92 3GCWA 3H1WA 1JOBA 1G6NA 5FZAA 1YFYA 3WW3A 1GWLA 2ZGOA 2R16A 4AHYA 2OZ6A 4UBHA 3O1OA 3BTXA 3VUOA 4CYDA 3KQRA 1W0PA 1CJDA 1HXS2 2XMLA 3MIBA 5AFEA 2AEYA 4W8JA 5D8AA 3VZLA 1UKGA 4IEUA 4YFZA 3BTYA 3T1LA 5FPUA 4NIHA 1KJLA 2CWSA 4LO8A 3LEKA 1IS5A 1W28A 3DL3A 2EIGA 4F3JA 1UF2C 1AJKA 5T5PA 1HB4A 2KD7A 4AQTA 2E51A 1WMFA 5FZCA 1CX4A 1C28A 1QJX1 5K0UB 2A71A 4CCKA 4YW6A 1D4M2 1TME2 2DFBA 3UGFA 4ZZ8A 2DV9A 1L7QA 1N1SA 3LEIA 2ZGPA 5FWEA 3FC0A 1YFWA 4E4HA 2OKXA 5HCFA 1GKBA 3A7QA 3ACFA 3RZHA 2GC1A 3MW4A 5KC6A 1H1AA 3O0WA 2VO5A 4Q4X3 4XTPA 1LGBA 5GALA 4B4PA 4M4PA 5GJ6A 3U10A 5EP9A 3VD5A 1TMF1 2HWD1 4CCOA 5FP9A 1TVGA 3N9PA 2PHLA 4YW4A 4RA0A 5DABA 5T5JA 1H6XA 4DOUA 3HOBA 1WWYA 3ZLIA 2Q8OA 4UWDA 1AX2A 1POV3 2XVLA 4RQPC 5FQ0B 1GOFA 4LHSA 4WM8A 2J1SA 1GYKA 1YQCA 4HANA 2B45X 1QJU2 2W3JA 1PIV2 3SEPA 4MGZE 1PNGA 4AG4A 2ZZQA 5J96B 2FD8A 5JIAA 3W58A 3OPWA 5FZOB 4AR2A 3N36A 4YZ3A 1AL22 1B35B 2WIIB 1PGW1 4MUVA 2CDOA 3B00A 3WNOA 5LA0A 1CQ9A 3H42B 4GZ9A 2OYZA 3LPFA 2PHFA 2UWCA 2A3XA 1SLBA 3CZJA 4OCTA 4LBMA 1JYCA 1O3QA 1CAUB 1FNZA 1IPKA 2VE1A 4XJWA 4CU9A 4FTBA 4L97A 2BU9A 4AXOA 3UETA 3PUSA 3WQ1A 3BIEA 4AYUA 2W91A 3NO8A 1J3PA 3ZYRA 2E9QA 3IM0A 3OBAA 4UT5A 4JZRA 3T0BA 1R092 3R4DB 4OI4A 5DUXA 5IHRA 2HWB3 1H4GA 1HKDA 4LBNA 1QNYA 5CG8A 5EIYB 1CD3G 3FWEA 3LZZA 4O65A 2XHKA 1UX7A 4E8CA 5LASA 5DN2A 4KG8A 3GZEA 1JYVA 3ES4A 4NIDA 5HBAA 5FZ1A 4GMP3 1OFNA 4NIIA 3AYEA 3LSEA 3MGUA 2OQ7A 4PT6A 1D7PM 1RHI3 2R1BA 2LRPA 4AWDA 1Y9MA 4WM8C 1N3OA 2G1MA 3WZ1A 4CDXC 3ZYPA 3TEZA 2A1XA 5K9YA 4BE3A 1H2KA 1X8EA 3OEAA 4OHXA 4JVAA 4ISQA 3M3EA 2HBUA 4OHWA 1XYPA 1F35A 2W0XA 4R4XA 3W9AA 4CPBD 5FUPA 4UI9L 5FYVA 3W21A 1PIV1 4IUGA 3F2ZA 3WG1A 2VULA 2W1QA 2WNOA 2X5IB 3MIEA 3ZXGA 5CZKA 4YZ5A 5FQ0A 1LR5A 1J3QA 4PBOA 1O8SA 1PHMA 1DGWA 4B1MA 1Z7S3 1LODA 4I3GA 1MZEA 3WG4A 4DEQA 3RWNA 1U0AA 1RUH3 2XJVA 4H14A 1VB4A 3Q8BA 2JKBA 4Y1ZA 2PYTA 1WD4A 3UK9A 3VGIA 4QX1A 1C1LA 3SKJE 1NLRA 4BXFA 4GMP1 3MF9A 3EXUA 1EAH1 3N35A 4RGGA 5A32B 3WG3A 2IVJA 2RJLA 3OGJA 5DAXA 3ZYHA 4BQYA 5A3OA 1C1FA 2VVDA 3GJBA 5FPXA 4KBBA 1J83A 2RE9A 3QACA 1T6GC 4K21A 5F5AA 1A34A 1F4AA 1RUF1 2ZACA 2C0ZA 1LOBA 3OY8B 4HSLA 2Z2SB 3CLPA 4KGQA 3N7LA 2Y0OA 5JLVA 2HJIA 2BYVE 1ZBE2 2EALA 1I6XA 2JX9A 3D6EA 1WMXA 3SCGA 5JOYA 3THPA 4XDOA 3R4UA 3RMYA 5B2GB 3KLSA 3PHMA 1W9SA 5HV4A 3PTYA 1RUE3 1MS4A 3AP4A 3ZXEA 2GAUA 1GOHA 3TNQA 4E2QA 3ZN4A 3H7JA 2RR12 4TLFA 5F39A 5CKQA 4QB1A 5BXXA 4LBJA 3T2OA 3BPSA 3WW2A 2A73B 4XJ9A 4Q0SA 3RZLA 2JDHA 1G9BA 2QQNA 3FUOA 5JXIA 5CEHA 1UIKA 2JWPA 1STMA 3NKGA 4I0WB 1ENSA 1WLWA 3RVHA 3AJZA 2WNVA 5EQUA 3UJQA 3ZR5A 4NHYA 2HLEA 4IV3B 1JBCA 4GMP0 3VDAA 4DUWA 5JUVA 1AL0G 1LNSA 4JHZA 4Y1UA 1JZ8A 2X53S 4AE2A 3JBG2 2CWMA 4RFT0 2OX0A 4FP2A 2Q8EA 4BQWA 1V6KA 1MS3A 1SBEA 1O6UA 5JSPA 4IE7A 1ZA7A 4MGQA 1HB2A 3VBSA 1SZBA 1RUG2 3P6BA 3O0VA 1ZZ6A 4L0PA 2RS51 3GBFA 4QD2A 5A7SA 1Q56A 2ORXA 3ZPYA 4CDXB 4OYUA 1R093 3QLQA 3D4KA 3IAPA 3BCWA 3DV8A 4GWIA 5ERLA 1KS4A 4B4QA 5CA6A 2QQUA 3HIFA 4RYDA 1G9FA 3HVDA 2LROA 4G9SB 5CFDA 3OSDA 5CG9A 1XU2A 3J7NA 5LY2A 1UXZA 2G9FA 1F4HA 2DU1A 1S0EA 3JD72 1VBD2 3ITQA 3KCCA 1Q43A 1QQP1 3CDZB 2J42A 3N7JA 4RFRB 4FFFA 3CJIC 5A6ZA 1ZRIA 2VECA 3AXEA 3MIHA 5F3CA 4KQ7A 4UFLA 5FIXA 4FPGA 5A7PA 2EXIA 2BUKA 1CPMA 1SFPA 3EMRA 1XNCA 1PO23 1UOGA 4HVRA 3QD6A 4O7XA 3LA7A 3MUY1 1PX4A 1E5IA 1JN2P 1AR61 2JDKA 4W50A 5ANNA 3BYWA 3UKTA 1OD5A 3NVCA 2BOJA 3J4UH 4PHZA 3A22A 2ZJCA 4QHZA 3INAA 2BERA 4E2GA 4XFBA 1UYZA 2FDGA 1UZVA 2QQWA 1CAVB 3T4VA 1CVNA 2N7GA 1H2LA 1Z0HA 2VOWA 3ZXAC 4D94A 2MEV2 1W0NA 3ILNA 5HV0A 1RUD3 5F5CA 3UKNA 3T2QA 3WG2A 1BBT1 3V0AB 1OT5A 1PM4A 3I2IA 3KVBA 2RDRA 1QH7A 1ASJ3 1CIYA 4H2AA 4NROA 3PURA 1C4RA 4JQTA 3D5OA 1ZBE1 2W68A 4K7JA 3T4HB 1Q3EA 4YPJA 3Q8AA 3TEWA 1XYOA 3HNMA 2A6YA 1V6NA 2I2SA 5CAZA 5FFOC 3VHOA 1MZ5A 1D0GA 2VCBA 4XJAA 2NZ9A 4EWEA 3OF1A 1W8OA 1RUC2 4GB33 1AYN1 1NA1C 2O0OA 3PNAA 3MFAA 3LAGA 4OVEA 4XUNA 4I30A 5I0SA 3MICA 2HYXA 4AFCA 3SQOA 1NLSA 2ILMA 1W6OB 4P14A 2WZ8A 1K3IA 1QH6A 1WA4A 5JWPA 3V0BB 5I0UA 4IGPA 2HWC2 1I5PA 1WCDJ 3AB0A 1QJY3 3AKPA 3JZVA 5A70A 3H8OA 4YSFA 4C0BA 5C8CC 1OA2A 1OFSA 1F5JA 3FBMA 3WDWA 4Q4W2 4COZA 2GMPA 2RVAA 1I5ZA 1EV13 1ZYBA 4WVWA 1HJGA 1MVQA 4I0AA 4MV2A 3K3OA 2DBIA 4SBVA 4YW5A 1ZZBA 2B42B 3VBSB 4DFSA 2RS52 1JTZX 1W03A 4LNVA 3V0AA 2O8QA 1GWMA 1H8VA 3GBWA 2VR4A 4MGKE 4XF4A 3NJZA 2JB4A 1REFA 5T5LA 4MHUA 3WQBA 3R0RA 3EYPA 2OQ6A 3O12A 4GB31 1AYN3 3WP5A 5JIUA 2B9UA 4W6YA 2QQPA 4IL7A 4HSJA 5CFCB 4K1YA 4FSJA 4E4DX 3ZYFA 5BNNC 4LBQB 3U14A 1J1TA 4YGEA 4DY3A 3PVOA 1SCRA 3LSDA 4MGIE 1HRV2 1LOAA 1XBFA 2ZHNA 4YZ2A 1OOPC 4CU8A 1KJRA 4EE2A 2VW2A 2FCVA 5CKMA 3MF6A 5AC92 2WINB 1RITA 1FOD2 3G6JB 4YYOA 2GP3A 3GGLA 3LB9A 4XMAA 1CZVA 1WLTA 3I59B 1FNYA 3JQXA 2GALA 5L7OB 2UWAA 4OMDA 2WLQA 1A3KA 4HK8A 5DDJ3 4J25A 1TQ5A 2GC3A 4DUXA 4GH4B 5J09A 4Y20A 1US3A 3JUUA 2FDIA 5K7PA 2DTYA 2IFRA 5JOWA 1Y7BA 4MLOA 4QPGC 3AFGA 1R1A1 3DPRB 3H8UA 3GZTB 4EZ4A 3E6BA 2XLFA 2QE3A 3HN3A 3ST7A 1ZZ7A 4EN6B 4NMIA 2GDFA 2WT0A 1YLLA 4HMZA 3H8XA 3RDIA 3AL5A 1AR83 1OLQA 2AEZA 5L7OA 3FHIB 4INDA 4AEDA 3VBHC 5FP3A 4IV1C 5IYYA 4R9BA 2P5BA 1UAIA 2NQYA 2B5HA 1MEC2 2W39A 3MIDA 3POWA 4KI5M 5A3LA 5ISLA 2P3KA 1MS0A 3K75B 5ACA2 3DKQA 2VPVA 1O4YA 3KT4A 4U36A 2ZKNA 1WLCA 1G9AA
chains in the Genus database with same CATH topology
2WABA 2VZ1A 1T2XA 4A3ZA 3HPNA 3JXSA 3NRUA 1US2A 2V72A 2W87A 2ZEYA 1GMMA 4KMQA 2VZ3A 2VZOA 3K4AA 5JXJA 3ECQA 1GU3A 1PMJX 3I2KA 2WAAA 3VD9A 2WBKA 3THCA 2YFUA 4JKMA 3MO4A 2JDAA 2ZEXA 4DUVA 3HNBM 1SHWB 5DMYA 1DYOA 2VJXA 5DPNA 2VZQA 4MO3M 4CUCA 2BGOA 4TXWA 1NKGA 1JU4A 1K12A 4DEVA 2W92A 4UAPA 1UY0A 2Y6KA 1YQ2A 4A41A 2WO3A 4LPLA 4D0QA 4M4RA 2W1UA 1KEXA 2VQTA 3NJVA 3CIHA 3FHQA 1OF4A 3FL7A 4CU6A 3THDA 3W5NA 3CZUA 2YC2A 5J1XA 2QQLA 2VMFA 2VZPA 2X05A 4BJ0A 3CQOA 4QX2A 3WNKA 2W94A 1EUTA 3EB7A 2WZEA 3C7OA 4AAXA 3DYOA 4QPWA 3IDAA 2W5FA 3J7HA 5C70A 1HN1A 2B4KA 4CVUA 1R64A 3FHAA 4ARYA 1XC6A 2WQ8A 3ETPA 1O8PA 2VM9A 4LQRA 3K4DA 2VTFA 4A4AA 1L7RA 1PMHX 1IQDC 2E32A 4DXSA 2C4XA 4P00B 3UNPA 1J84A 4W8JA 3UESA 3IB3A 4A45A 3LEKA 3NNGA 1GNYA 2QQOA 2KD7A 3WNLA 2Y6JA 4ZXEA 1GOGA 4ZZ8A 1L7QA 3LEIA 3LEGA 1CZTA 2BGPA 2OKXA 3A7QA 2YG0A 3ACFA 2WO2A 4ARXA 5LA1A 4ET7A 2VO5A 3K46A 3T0AA 2EIEA 3GXUA 5CYYA 4M4PA 1W9TA 1JZ6A 3VD5A 2YB7A 3VD7A 2J7MA 1TVGA 3WNNA 1H6XA 5F7UA 3HOBA 3VD4A 2WDBA 1GOFA 4LHSA 2EIDA 3HEIA 4QB2A 2WUHA 2J1SA 2W3JA 3SEPA 3HNYM 4AG4A 1ULOA 1KGYA 1UYXA 3W5MA 3I97A 3I2FA 1JZ4A 3NJXA 3WNOA 2CDOA 5LA0A 4GZ9A 1UWWA 3WNMA 2WAOA 4BK4A 3LPFA 3LE0A 2J1TA 3CZJA 1GUIA 3OGRA 3I2JA 1RYYA 2DDUA 4LKSA 4XUOA 4QAWA 3MV11 3DYPA 2VZUA 4CU9A 3ACIA 3UETA 2W91A 3OBAA 3T0BA 4OMCA 3LPGA 5IHRA 3VDCA 1W9WA 2QQIA 2WYSA 1W8NA 3FN9A 5EIYB 2RJ2A 3DYMA 1UX7A 1UZ0A 4E8CA 5DN2A 2DCJA 1JYVA 2J1EA 3WSOA 3A23A 1JZ2A 2L9LA 4PT6A 2XHNA 1UY3A 1D7PM 2LS6A 5B4XA 4QB6A 3OEAA 2CDPA 2VCCA 1NAEA 2QBXA 4QDQA 3C7HA 4UI9L 4IUGA 3F2ZA 5DQ0A 2W1QA 4P08A 4QX0A 5CZKA 5IFTA 3VDBA 4GWJA 1O8SA 3CKHA 4KWUA 4DEQA 1P8JA 4BK5A 5I0DA 4CUAA 3WF4A 4JKLA 3AC0A 3LQCA 4MOAA 2EICA 4QX1A 3MUZ1 3SKJE 2E33A 3HJRA 2J22A 4BXSV 2VCAA 5LCWL 5G04L 2Y8KA 4XUQA 1J83A 3NQHA 3WF1A 3I3DA 5HPOA 1F4AA 1DP0A 3OGSA 3P1IA 5FUIA 3VD3A 1UYYA 3GM8A 2XONA 3U37A 5EJ1B 2JE8A 2JD9A 4DXRA 3MV01 4CUBA 3WF0A 1W9SA 4QX3A 3BN6A 2V5DA 3OEBA 5A1AA 1XPWA 1K45A 1GOHA 3C7EA 3OG2A 2VL4A 1JYXA 3ABZA 1MPXA 1XNTA 4P02B 2QQMA 4QB1A 3SEEA 3T2OA 2RV9A 2Y6LA 3ACGA 5LA2A 2J1RA 2QQNA 2VMDA 5JXIA 1W99A 2WO1A 2HLEA 3VDAA 4DUWA 5JUVA 2Y64A 1LNSA 4JHZA 2C9KA 1JZ8A 2B9VA 2J1VA 4A42A 3IIIA 2J1AA 2C26A 5JMOA 4MGQA 2X10A 2Z4FA 3P6BA 4L0PA 4PF1A 2ZEZA 2ORXA 4OYUA 3IAPA 4GWIA 4UOJA 4XVHA 4E8DA 5C71A 4RYDA 4D8MA 2XQXA 1UMHA 1UXZA 1NX9A 3C7GA 4QDSA 1F4HA 2QQJA 1JU3A 4XUTA 5G05L 3ACHA 3CDZB 1SDDB 2LW8A 5HXMA 3C7FA 4XZUG 4OZOA 1UY2A 3WF2A 4DXTA 2ID4A 3WNPA 3MUY1 1PX4A 2W95A 3T08A 4W50A 2PQSA 2VZTA 1BHGA 3BGAA 4CU7A 3A22A 2BERA 1UYZA 2JKXA 2ORZA 4FI9A 1JZ7A 1PX3A 2ZXQA 5EJZB 1W0NA 1O59A 3T2QA 2YC4A 4OUEA 2W1WA 4P5YA 1OT5A 1JYWA 3I2IA 3SKVA 1CIYA 3MBWA 1JZ3A 2W46A 3WEZA 1OD3A 4YPJA 1UXXX 3HNMA 1SG3A 3PUHA 1CX1A 2XOMA 1ULPA 2VCBA 5B4NA 2J1UA 2E26A 3T2PA 1W8OA 4XUNA 4W4ZA 1UY1A 2E31A 4HG6B 2HYXA 4ZY9A 4MADA 1DLCA 2WZ8A 1K3IA 4RN5A 1TG7A 3CMGA 2VOTA 3I3EA 1I5PA 2EIBA 2W1SA 3I3BA 3GDBA 2WN3A 2RVAA 1GQPA 1UY4A 2DCKA 2YFZA 1NUKA 4XUPA 5C7GA 2R7EB 5JR2A 2VZRA 3D3AA 1OF3A 5IFPA 2VR4A 3C8XA 3K4ZA 2VC9A 3I2HA 3EYPA 3I2GA 2QQKA 3WQBA 2X09A 2WN2A 2VMCA 1JYNA 2VZSA 3E1F1 3K77A 2VZVA 1K42A 1H6YA 3T0DA 4JX0A 4QDRA 4BDVB 1CZSA 3ZM8A 4CU8A 4JKKA 2BZDA 1WCQA 4PQQA 2Y6GA 2V4VA 2VQUA 3WF3A 3A21A 3GGLA 1CZVA 3DECA 2BBAA 1JI6A 4OMDA 1JHJA 2W9XA 4A6OA 4DUXA 1US3A 4A44A 5JXGA 1JZ5A 3T09A 1WKYA 4ZZ5A 3HN3A 1EUUA 4TTGA 4XURA 3IAQA 1OH4A 3OB8A 2VMEA 2Y6HA 5IYYA 4MGSA 4Z2AA 5JXHA 3OGVA 4KI5M 2ZEWA 3K75B 3PUIA 5IJRA 1XNAA 2W47A 1UMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAB A;  2VZ1 A;  1T2X A;  4A3Z A;  3HPN A;  3JXS A;  3NRU A;  1US2 A;  2V72 A;  2W87 A;  2ZEY A;  1GMM A;  4KMQ A;  2VZ3 A;  2VZO A;  3K4A A;  5JXJ A;  3ECQ A;  1GU3 A;  1PMJ X;  3I2K A;  2WAA A;  3VD9 A;  2WBK A;  3THC A;  2YFU A;  4JKM A;  3MO4 A;  2JDA A;  2ZEX A;  4DUV A;  3HNB M;  1SHW B;  5DMY A;  1DYO A;  2VJX A;  5DPN A;  2VZQ A;  4MO3 M;  4CUC A;  2BGO A;  4TXW A;  1NKG A;  1JU4 A;  1K12 A;  4DEV A;  2W92 A;  4UAP A;  1UY0 A;  2Y6K A;  1YQ2 A;  4A41 A;  2WO3 A;  4LPL A;  4D0Q A;  4M4R A;  2W1U A;  1KEX A;  2VQT A;  3NJV A;  3CIH A;  3FHQ A;  1OF4 A;  3FL7 A;  4CU6 A;  3THD A;  3W5N A;  3CZU A;  2YC2 A;  5J1X A;  2QQL A;  2VMF A;  2VZP A;  2X05 A;  4BJ0 A;  3CQO A;  4QX2 A;  3WNK A;  2W94 A;  1EUT A;  3EB7 A;  2WZE A;  3C7O A;  4AAX A;  3DYO A;  4QPW A;  3IDA A;  2W5F A;  3J7H A;  5C70 A;  1HN1 A;  2B4K A;  4CVU A;  1R64 A;  3FHA A;  4ARY A;  1XC6 A;  2WQ8 A;  3ETP A;  1O8P A;  2VM9 A;  4LQR A;  3K4D A;  2VTF A;  4A4A A;  1L7R A;  1PMH X;  1IQD C;  2E32 A;  4DXS A;  2C4X A;  4P00 B;  3UNP A;  1J84 A;  4W8J A;  3UES A;  3IB3 A;  4A45 A;  3LEK A;  3NNG A;  1GNY A;  2QQO A;  2KD7 A;  3WNL A;  2Y6J A;  4ZXE A;  1GOG A;  4ZZ8 A;  1L7Q A;  3LEI A;  3LEG A;  1CZT A;  2BGP A;  2OKX A;  3A7Q A;  2YG0 A;  3ACF A;  2WO2 A;  4ARX A;  5LA1 A;  4ET7 A;  2VO5 A;  3K46 A;  3T0A A;  2EIE A;  3GXU A;  5CYY A;  4M4P A;  1W9T A;  1JZ6 A;  3VD5 A;  2YB7 A;  3VD7 A;  2J7M A;  1TVG A;  3WNN A;  1H6X A;  5F7U A;  3HOB A;  3VD4 A;  2WDB A;  1GOF A;  4LHS A;  2EID A;  3HEI A;  4QB2 A;  2WUH A;  2J1S A;  2W3J A;  3SEP A;  3HNY M;  4AG4 A;  1ULO A;  1KGY A;  1UYX A;  3W5M A;  3I97 A;  3I2F A;  1JZ4 A;  3NJX A;  3WNO A;  2CDO A;  5LA0 A;  4GZ9 A;  1UWW A;  3WNM A;  2WAO A;  4BK4 A;  3LPF A;  3LE0 A;  2J1T A;  3CZJ A;  1GUI A;  3OGR A;  3I2J A;  1RYY A;  2DDU A;  4LKS A;  4XUO A;  4QAW A;  3MV1 1;  3DYP A;  2VZU A;  4CU9 A;  3ACI A;  3UET A;  2W91 A;  3OBA A;  3T0B A;  4OMC A;  3LPG A;  5IHR A;  3VDC A;  1W9W A;  2QQI A;  2WYS A;  1W8N A;  3FN9 A;  5EIY B;  2RJ2 A;  3DYM A;  1UX7 A;  1UZ0 A;  4E8C A;  5DN2 A;  2DCJ A;  1JYV A;  2J1E A;  3WSO A;  3A23 A;  1JZ2 A;  2L9L A;  4PT6 A;  2XHN A;  1UY3 A;  1D7P M;  2LS6 A;  5B4X A;  4QB6 A;  3OEA A;  2CDP A;  2VCC A;  1NAE A;  2QBX A;  4QDQ A;  3C7H A;  4UI9 L;  4IUG A;  3F2Z A;  5DQ0 A;  2W1Q A;  4P08 A;  4QX0 A;  5CZK A;  5IFT A;  3VDB A;  4GWJ A;  1O8S A;  3CKH A;  4KWU A;  4DEQ A;  1P8J A;  4BK5 A;  5I0D A;  4CUA A;  3WF4 A;  4JKL A;  3AC0 A;  3LQC A;  4MOA A;  2EIC A;  4QX1 A;  3MUZ 1;  3SKJ E;  2E33 A;  3HJR A;  2J22 A;  4BXS V;  2VCA A;  5LCW L;  5G04 L;  2Y8K A;  4XUQ A;  1J83 A;  3NQH A;  3WF1 A;  3I3D A;  5HPO A;  1F4A A;  1DP0 A;  3OGS A;  3P1I A;  5FUI A;  3VD3 A;  1UYY A;  3GM8 A;  2XON A;  3U37 A;  5EJ1 B;  2JE8 A;  2JD9 A;  4DXR A;  3MV0 1;  4CUB A;  3WF0 A;  1W9S A;  4QX3 A;  3BN6 A;  2V5D A;  3OEB A;  5A1A A;  1XPW A;  1K45 A;  1GOH A;  3C7E A;  3OG2 A;  2VL4 A;  1JYX A;  3ABZ A;  1MPX A;  1XNT A;  4P02 B;  2QQM A;  4QB1 A;  3SEE A;  3T2O A;  2RV9 A;  2Y6L A;  3ACG A;  5LA2 A;  2J1R A;  2QQN A;  2VMD A;  5JXI A;  1W99 A;  2WO1 A;  2HLE A;  3VDA A;  4DUW A;  5JUV A;  2Y64 A;  1LNS A;  4JHZ A;  2C9K A;  1JZ8 A;  2B9V A;  2J1V A;  4A42 A;  3III A;  2J1A A;  2C26 A;  5JMO A;  4MGQ A;  2X10 A;  2Z4F A;  3P6B A;  4L0P A;  4PF1 A;  2ZEZ A;  2ORX A;  4OYU A;  3IAP A;  4GWI A;  4UOJ A;  4XVH A;  4E8D A;  5C71 A;  4RYD A;  4D8M A;  2XQX A;  1UMH A;  1UXZ A;  1NX9 A;  3C7G A;  4QDS A;  1F4H A;  2QQJ A;  1JU3 A;  4XUT A;  5G05 L;  3ACH A;  3CDZ B;  1SDD B;  2LW8 A;  5HXM A;  3C7F A;  4XZU G;  4OZO A;  1UY2 A;  3WF2 A;  4DXT A;  2ID4 A;  3WNP A;  3MUY 1;  1PX4 A;  2W95 A;  3T08 A;  4W50 A;  2PQS A;  2VZT A;  1BHG A;  3BGA A;  4CU7 A;  3A22 A;  2BER A;  1UYZ A;  2JKX A;  2ORZ A;  4FI9 A;  1JZ7 A;  1PX3 A;  2ZXQ A;  5EJZ B;  1W0N A;  1O59 A;  3T2Q A;  2YC4 A;  4OUE A;  2W1W A;  4P5Y A;  1OT5 A;  1JYW A;  3I2I A;  3SKV A;  1CIY A;  3MBW A;  1JZ3 A;  2W46 A;  3WEZ A;  1OD3 A;  4YPJ A;  1UXX X;  3HNM A;  1SG3 A;  3PUH A;  1CX1 A;  2XOM A;  1ULP A;  2VCB A;  5B4N A;  2J1U A;  2E26 A;  3T2P A;  1W8O A;  4XUN A;  4W4Z A;  1UY1 A;  2E31 A;  4HG6 B;  2HYX A;  4ZY9 A;  4MAD A;  1DLC A;  2WZ8 A;  1K3I A;  4RN5 A;  1TG7 A;  3CMG A;  2VOT A;  3I3E A;  1I5P A;  2EIB A;  2W1S A;  3I3B A;  3GDB A;  2WN3 A;  2RVA A;  1GQP A;  1UY4 A;  2DCK A;  2YFZ A;  1NUK A;  4XUP A;  5C7G A;  2R7E B;  5JR2 A;  2VZR A;  3D3A A;  1OF3 A;  5IFP A;  2VR4 A;  3C8X A;  3K4Z A;  2VC9 A;  3I2H A;  3EYP A;  3I2G A;  2QQK A;  3WQB A;  2X09 A;  2WN2 A;  2VMC A;  1JYN A;  2VZS A;  3E1F 1;  3K77 A;  2VZV A;  1K42 A;  1H6Y A;  3T0D A;  4JX0 A;  4QDR A;  4BDV B;  1CZS A;  3ZM8 A;  4CU8 A;  4JKK A;  2BZD A;  1WCQ A;  4PQQ A;  2Y6G A;  2V4V A;  2VQU A;  3WF3 A;  3A21 A;  3GGL A;  1CZV A;  3DEC A;  2BBA A;  1JI6 A;  4OMD A;  1JHJ A;  2W9X A;  4A6O A;  4DUX A;  1US3 A;  4A44 A;  5JXG A;  1JZ5 A;  3T09 A;  1WKY A;  4ZZ5 A;  3HN3 A;  1EUU A;  4TTG A;  4XUR A;  3IAQ A;  1OH4 A;  3OB8 A;  2VME A;  2Y6H A;  5IYY A;  4MGS A;  4Z2A A;  5JXH A;  3OGV A;  4KI5 M;  2ZEW A;  3K75 B;  3PUI A;  5IJR A;  1XNA A;  2W47 A;  1UMI A; 
#chains in the Genus database with same CATH topology
 2WAB A;  4NHL A;  4A2U A;  4R9D A;  4A3Z A;  4BIF A;  2C24 A;  3HPN A;  3HBK A;  4CP2 A;  4FFG A;  1US2 A;  2GC0 A;  2WSV A;  3WIN E;  2VBD A;  2VZ3 A;  2VZO A;  1UKR A;  3K4A A;  1RVF 1;  1GU3 A;  2WWJ A;  3HQR A;  3POG A;  1PMJ X;  1H8T C;  1WMD A;  3ZN5 A;  5C5U A;  1HIX A;  3VD9 A;  3VBS C;  2DF7 A;  2NM1 A;  3OPT A;  2JXA A;  3SH3 A;  3PME A;  5IAT A;  4ORF A;  5FYT A;  1ULE A;  1BEV 2;  1FPN 1;  5FMO L;  4A7Y A;  3FMG A;  4ASL A;  2Q4S A;  3ZFG C;  2D44 A;  1ASJ 1;  2IFW A;  1B09 A;  3VL8 A;  5FZE A;  4MO3 M;  1QJY 2;  4TXW A;  1PMI A;  2RM2 1;  1W2N A;  3SNM A;  5A7Q A;  4TZD A;  4C1W A;  4PLM A;  1APN A;  2VOV A;  3R4S A;  5D21 A;  2X5I A;  5CFC C;  2W92 A;  5FZ6 A;  1UY0 A;  5BNN B;  2WNV B;  3E6C C;  3TNP B;  1YQ2 A;  3IKW A;  3MIG A;  3OPZ A;  3RNS A;  3SCF A;  3WLU A;  1UL9 A;  2WO3 A;  2OUH A;  4LPL A;  1NY7 1;  3WDY A;  2W1U A;  3AP6 A;  5LB6 A;  4NAO A;  3NJV A;  2A6W A;  3RGB A;  5HXV A;  3R05 A;  2FQP A;  4GWM A;  2Y38 A;  5C4W C;  4P9L A;  1VRH 3;  1UQX A;  4CU6 A;  4LEJ A;  4XCA A;  4NAM A;  4BQ4 A;  3ZFE B;  4Q4X 2;  1DFQ A;  5IVC A;  2NP0 A;  2D6O X;  1HN0 A;  2SBA A;  3UKV A;  4BCU A;  5J1X A;  1SLC A;  4H7M A;  3ZN6 B;  3ZSJ A;  1HRI 1;  1KXG A;  4YWA A;  2ZML A;  4BB3 A;  3CQO A;  1S2K A;  4Q0V A;  5C9A A;  3NJY A;  4K9S A;  3O1V A;  3ELN A;  4LOR A;  5KXD A;  2WZE A;  3NKT A;  4FXK B;  3WDV A;  3DYO A;  1LEM A;  1QMJ A;  2XVK A;  2VUD A;  1IPS A;  1J3R A;  5C3S A;  2RS1 2;  3K48 A;  2ENR A;  1DBN A;  1R64 A;  5FY8 A;  1PIV 3;  1FOD 3;  4ARY A;  1OQ1 A;  4N43 A;  2WT2 A;  3L2H A;  1S55 A;  1UW8 A;  5K4L A;  1O8P A;  3VDD B;  4LQR A;  3THT A;  5LEK A;  4MVT A;  4FT8 A;  1C57 A;  4WM7 A;  4UF0 A;  3B69 A;  1HLC A;  3AFK A;  3S0M A;  1PMH X;  2EVX A;  1R1A 2;  1DGW X;  5D1I A;  3Q9O A;  4RR3 A;  1XE0 A;  2XJQ A;  4XOG A;  1C5H A;  1DG6 A;  2BOI A;  2MEV 1;  4YNI A;  4CDX A;  1UU6 A;  2CTV A;  3SHR A;  3VKM A;  4C0H A;  4DXS A;  3OD4 A;  4YM3 A;  1WA6 X;  1J84 A;  3UES A;  3KCX A;  1POV 1;  3P3P A;  3MIF A;  2YXS A;  4MYE A;  2RJK A;  1H2N A;  3HD8 B;  1H8T B;  2NN8 A;  4K8F A;  1ALY A;  2UWB A;  1QEX A;  1YC6 1;  2PTM A;  3AYD A;  5ACA 1;  2CGO A;  3AX4 A;  3H8R A;  2EAK A;  1ONA A;  2VNG A;  5BY5 A;  5ACA 3;  3AKR A;  2KXL A;  3FX3 A;  4LHL A;  5FXW A;  2NMO A;  2WZP P;  4AHW A;  3IIA A;  1CZT A;  4YG3 A;  1SPP B;  2ATF A;  4GKY A;  2IXI A;  4OUS A;  4ARX A;  2WO2 A;  5LA1 A;  1W9F A;  1GWK A;  2PAM A;  1NCQ B;  1UPS A;  4GXL A;  4JDM A;  3K46 A;  4GD4 A;  1EYB A;  3H0O A;  3KV5 A;  1XE8 A;  3CL1 A;  4RHV 2;  4EN0 A;  1W9T A;  3PJQ A;  5FMO S;  1XSQ A;  3LOI A;  2I07 B;  2ZZJ A;  4AZZ A;  4CSW A;  1PVC 3;  2J7M A;  3PIG A;  4N43 B;  4COY A;  3BOW A;  3OUI A;  1BEV 3;  4N53 A;  5F7U A;  1RTV A;  2P34 A;  2YY1 A;  3IN9 A;  4GAL A;  5EFU A;  5C4W B;  2WDB A;  5IWF A;  3ILR A;  4YFW A;  3MYX A;  2PAE A;  1VBB 2;  3WHU A;  5GM0 A;  5DUW A;  4XXA A;  5C9A B;  5AVA A;  3RG0 A;  4QGM A;  4B3N A;  3IZO A;  4LKF A;  2FDF A;  4FAG A;  5FO8 B;  1PZ9 A;  3OOX A;  1WGP A;  5E6H A;  4UFK A;  1KD7 A;  4AEJ A;  4MHR A;  1WBL A;  5F3G A;  4QM8 A;  1ODM A;  3VBF A;  4QPY A;  3UT0 A;  4QGN A;  2K2S A;  4FPC A;  4OQ9 A;  4Q4X 1;  5I0R A;  3NV1 A;  1UWW A;  3AKQ A;  1ZZC A;  2WAO A;  3VKN A;  3WNM A;  1K5M A;  4AVB A;  4JHT A;  4YW7 A;  4BK4 A;  4ISR A;  2UYB A;  3ZYI B;  3I2J A;  5A7W B;  3RJ2 X;  4OUL A;  4LUL A;  2IXC A;  3MV1 1;  1VBA 1;  3TAY A;  3M3Q A;  1C8M 3;  3MPB A;  4Q8L A;  4NIA A;  2MNG A;  4IGQ A;  2P6H A;  2ET7 A;  1AYM 3;  2A75 A;  2PHT A;  2XLG A;  1IHM A;  1XSR A;  2JG9 B;  2EF6 A;  3LPG A;  1FXZ A;  2XJS A;  2Y34 A;  4BLI A;  5L36 A;  1VBE 3;  3B93 A;  2H0B A;  3VDC A;  4WM8 B;  4TN7 A;  2WYS A;  2BBV A;  3U07 A;  3DGT A;  2BJS A;  3FFZ A;  3IWZ A;  2DCJ A;  1RUE 2;  3J26 N;  5EYY A;  4ITC A;  2BV4 A;  4P9X A;  4M0N A;  4RHV 1;  1Q8O A;  3HAG A;  2XLA A;  3GNE A;  4FPK A;  2F6B A;  3M3C A;  4AVT A;  4BZ4 A;  4JC1 A;  2L9L A;  2RR1 1;  2Z69 A;  5D8A C;  2XHN A;  1UY3 A;  4XF9 A;  3KT1 A;  2XGX A;  4LIU A;  4R9A A;  2HWE 2;  4C91 A;  5K0U A;  4QB6 A;  4K1Z A;  1DCS A;  3IDC B;  1GZT A;  2G4I A;  1NCQ C;  2K46 A;  4RL7 A;  2VCC A;  2WJS A;  3LF7 A;  2AEN A;  1ULD A;  1HB3 A;  1D2S A;  3JBG 1;  4XMI A;  1RUJ 2;  5DQ0 A;  2VQA A;  5IVF A;  1D4M 1;  2VH9 A;  3PIJ A;  4LA3 A;  4AED B;  4QPI B;  2D5H A;  1D4V B;  1MQT A;  4QXH A;  3FLT A;  2P4E A;  2VUJ A;  5A3T A;  3ALQ A;  3CKH A;  1DIW A;  1F9K A;  4HN0 A;  2VMG A;  1DHK B;  1P8J A;  4BK5 A;  1S0J A;  1IS6 A;  1GV9 A;  4CUA A;  2V5Y A;  4H7L A;  3LQC A;  3VBF B;  4CPB A;  1GBG A;  2EIC A;  2VNV A;  3SLI A;  3MUZ 1;  4RS5 B;  1SLL A;  1YFX A;  2CAV A;  4N9I A;  4OLL A;  1RUI 3;  2D6M A;  5HI0 A;  3RI9 A;  2HKX A;  4FOY A;  5IT6 A;  2FZ2 A;  4LOT A;  2R30 A;  5G04 L;  4ZU7 A;  1YHF A;  2Y60 A;  3VBU A;  3AP5 A;  1U5X A;  3GBG A;  3I3D A;  4EN8 B;  1Q8V A;  3B9C A;  3NNM A;  3AKT A;  3ZXD A;  1OMI A;  2UYA A;  3I2O A;  4YRD A;  3U37 A;  2XKP A;  1LOF A;  3MV0 1;  4CUB A;  3WF0 A;  2B8M A;  4OI1 A;  5KXB A;  2RS3 3;  3J8F 3;  4NPR A;  5GLT A;  4S2G A;  3AMH A;  4E27 A;  4NOT A;  4OZX A;  4PIX A;  2ARB A;  1XPW A;  4YVW C;  5BNP C;  5T54 A;  5DZG A;  2R6Q A;  4QXK A;  3OG2 A;  2VL4 A;  4S2D A;  1GAN A;  3GCX A;  4XAE A;  5FLJ A;  1MPX A;  4XIO A;  1XNT A;  2PFW A;  1VMF A;  2UY9 A;  4YW3 A;  5A6X A;  2Q1F A;  4AEM A;  1CIW A;  2JG9 C;  2Y6L A;  2F17 A;  1V70 A;  1OVS A;  5LA2 A;  1G9C A;  2VMD A;  1XXN A;  1ENX A;  2HWE 1;  1AHS A;  4NRM A;  5CNA A;  3VB9 A;  5A3M A;  1RIR A;  4Y4R A;  5AVP A;  4EN7 B;  4LIV A;  4XAC A;  3JB4 C;  1QOT A;  3WOG A;  1NCR B;  2J1V A;  4PI2 A;  4CCM A;  3BU7 A;  3AZY A;  3III A;  4ERO A;  1XRU A;  5DAQ A;  5LBF A;  3VBR C;  1PGL 2;  1CJP A;  2X10 A;  5JOZ A;  2Q8D A;  3O1P A;  3U75 A;  1PNF A;  4AI3 A;  3O0X A;  5SV5 A;  4UOJ A;  1RUE 1;  2Y26 A;  4UF0 B;  3EQE A;  1DQ6 A;  1RJ7 A;  1Y43 B;  4PDW C;  3CF6 E;  2BDR A;  2XWJ B;  2X29 A;  2DVD A;  1NX9 A;  2WRA A;  3GZU C;  2E7Q A;  2QQJ A;  4I09 A;  5APA A;  1O7F A;  2E63 A;  4QPI C;  4XF0 A;  5G05 L;  2DUP A;  3S57 A;  1TMF 3;  2HWD 3;  3ME2 A;  4FQ4 A;  1C8M 1;  2CHH A;  4CEY C;  4RD7 A;  3NAP A;  3ENR A;  2ETE A;  1VRB A;  2ZCW A;  3C7F A;  3J9S A;  3NST A;  4XZU G;  4OZO A;  1VR3 A;  1SQ4 A;  5EZW A;  1OXC A;  4QQH A;  4X8P A;  1XND A;  4JGY C;  4RS5 C;  1VBE 1;  3POE A;  4D6Q A;  3WNP A;  1YWK A;  5IAV A;  1MZ6 A;  3D82 A;  4QWN A;  1QJX 2;  4HVO A;  2OPW A;  3Q8E A;  1R08 3;  4NIG A;  1RUJ 3;  4JV4 A;  1W3X A;  4Q1P A;  2VZT A;  1BHG A;  2RS5 3;  3BGA A;  3ACL A;  3CJI B;  4CU7 A;  1LHU A;  5C3P A;  4AGG A;  1YI9 A;  3GHM A;  5A6Q A;  2E7T A;  2ORZ A;  5FOJ B;  4OHY A;  2RR1 3;  3ZIW A;  2D40 A;  2VTX J;  4XFH A;  5E89 A;  4COV A;  5FZB A;  4LE3 A;  4EV0 A;  4Z8B A;  2DFC A;  3PLQ A;  5BNO C;  1CGP A;  5FPZ A;  2ET1 A;  2W52 A;  3M4F A;  5I8T A;  3QH6 A;  2D6N A;  2IXH A;  3LFI A;  3FLR A;  4NN0 A;  2W1W A;  2ZMN A;  1JYW A;  4DIQ A;  1LGC A;  3HQX A;  5L9R A;  2FDJ A;  5FBJ A;  1RUF 2;  2BEO A;  2R0H A;  3BB6 A;  4TWT A;  3AZW A;  1V9U 3;  3S7I A;  1PK6 A;  5FZ9 A;  5AC9 1;  1N47 A;  1ZRF A;  4A7Z A;  1FAT A;  1G8W A;  3U0Z A;  2Q8C A;  1VBC 3;  4FPH A;  1WBF A;  1FOD 1;  3LA3 A;  1SG3 A;  5JCT A;  1CAX A;  5CU1 A;  2ZGQ A;  1FYU A;  5DAV A;  5B4N A;  2J1U A;  2E26 A;  3AMP A;  4JQR A;  5GZC A;  1ZNP A;  2EA7 A;  1NCR C;  1UNB A;  2XDV A;  4XAB A;  1URX A;  1UY1 A;  4LO4 B;  2E31 A;  3KT7 A;  4HG6 B;  2XUM A;  4ZY9 A;  3NNJ A;  4Q27 A;  2AUY A;  5JI9 A;  5LEJ A;  3OYW A;  4EZH A;  3RRD A;  3VBR B;  1W04 A;  4Y20 B;  2PA7 A;  1C8N A;  3I3E A;  2W1S A;  2BTV C;  1W6M B;  1QF3 A;  2WLP A;  2BRT A;  5KHK A;  4QXC A;  3VL9 A;  4EN9 B;  5T5O A;  1AR8 2;  5JZG C;  2ZS6 B;  4KWJ A;  2VNO A;  1BVP 1;  3PVB B;  4ATF A;  4CA9 A;  2DCK A;  5C33 A;  2K9Z A;  2C1F A;  1O3R A;  4BQ1 A;  1NUK A;  4CDU A;  2GNB A;  3WY6 A;  4AQS A;  4DY5 A;  3T30 A;  4AHX A;  2ZX3 A;  2R7E B;  4CEY B;  1Y3T A;  1GZW A;  4AEK A;  4LR4 A;  2D93 A;  5DDJ 1;  4BM8 A;  5JSR A;  5FZF A;  2WNU C;  1JOJ A;  1CAW B;  5C5T A;  5C8C B;  1W39 A;  2VC9 A;  3I2H A;  3I2G A;  1AUY A;  1RUH 1;  2QQK A;  4QHB A;  4JGY B;  4TYS A;  3BUC A;  2WN2 A;  1ND3 C;  1AVB A;  1RVF 2;  1JHN A;  3LWC A;  3EBR A;  3E1F 1;  4Z2W A;  4LUK A;  5FYY A;  2VZV A;  1K42 A;  3H3U A;  4XBQ A;  3FFQ A;  4GKX A;  2ARC A;  1JOP A;  4AI8 A;  4NHX A;  1XNB A;  2PLV 2;  2RHP A;  3ZM8 A;  4COW A;  2YHJ A;  1KRI A;  1W6N B;  2CYF A;  1AXZ A;  1K5J A;  4JKK A;  4ES8 A;  5A1L A;  2BZD A;  3KMH A;  5JI7 A;  1TNF A;  2WZR 1;  2ZGL A;  3NV2 A;  3POJ A;  4RSU A;  1ULC A;  2XL9 A;  2A3W A;  3CHX A;  3EO6 A;  5E8A A;  3A21 A;  5C3O A;  4XDP A;  3PU3 A;  1H2M A;  2WS9 1;  4FTE A;  1PK6 B;  3DEC A;  4ZS3 A;  5FKB A;  1ZZ9 A;  1RUC 3;  1OPO A;  1W6P B;  2VMI A;  2I45 A;  3BKZ A;  2ZMK A;  4Q26 A;  2P1B A;  5FV3 A;  1BCX A;  1O4Z A;  1UZZ A;  2QNK A;  2B7Y A;  4L11 A;  4N9H A;  4EQV A;  1CAV A;  4A44 A;  5JXG A;  1JZ5 A;  3T09 A;  4YM2 A;  1PM7 A;  3H1M A;  1WW7 A;  4TTG A;  3VKL A;  2AYH A;  1XYN A;  4B1L A;  1DGR N;  1V6L A;  3KS7 A;  1XU1 A;  3N9N A;  1IS4 A;  2DUQ A;  4H3W A;  2JEN A;  3H9A A;  2VME A;  5DAW A;  3ZYB A;  2A6X A;  3QH7 A;  2AC1 A;  2LM3 A;  2RG4 A;  2VBB A;  3VBO A;  4DMI A;  4DPN A;  4Z2A A;  3WT3 A;  4AF9 A;  2BW8 A;  3OGV A;  1R08 1;  3UJO A;  4AI2 A;  2PHD A;  3OUH A;  4IV3 A;  5IJR A;  1YQ6 A;  3K3N A;  1XNA A;  1BK0 A;  4D6R A;  1UMI A;  3BPZ A;  4JRA A;  4LBQ D;  4OHV A;  4Q4V 1;  1OUR A;  2XJU A;  4FOV A;  2RS1 3;  3ZFG B;  1H30 A;  3E5U A;  3NRU A;  3DN7 A;  4ZU4 A;  3VBH B;  1C3H A;  4R8H A;  3VHN A;  4HPK B;  3BAL A;  1ND2 A;  1AYN 2;  3TN9 1;  1LKN A;  3ON7 A;  3TEX A;  3I2K A;  3USU B;  3EHK A;  1DQ1 A;  1U12 A;  2WBK A;  3G7D A;  4JGZ B;  4LUM A;  5EPA A;  2YFU A;  4ATE A;  1RGS A;  2HWF 3;  1R1A 3;  2JDA A;  2ZEX A;  1YQ8 A;  5FCC A;  5DMY A;  2R0F A;  1SBD A;  4L2N A;  5FK7 A;  5FPL A;  1AR8 1;  4BLJ A;  3NAP C;  1GZW B;  2ZOE B;  5JZG B;  5KXE A;  1N1Y A;  3PVE A;  4LLF A;  1K12 A;  4FCA A;  4E9K A;  4C90 A;  1MS9 A;  2JE7 A;  3HWJ A;  4PCR A;  4QPI A;  5FRA A;  1PO2 1;  1S0B A;  1SEF A;  1NQD A;  2A70 A;  2VAU A;  3O5S A;  5DDJ 2;  3DCQ A;  4PF5 A;  2JG8 B;  2JDM A;  4XFI A;  2XKO A;  3X29 B;  3AK0 A;  3VZN A;  3CIH A;  1OF4 A;  3ZYJ B;  2WL1 A;  1LB2 A;  2VOK A;  3FL7 A;  4AFD A;  4XW3 A;  4IET A;  5FP8 A;  4RQP B;  3TWI A;  5FMB A;  1W8H A;  5FMC A;  4DQA A;  5FY0 A;  5IK4 A;  2K0G A;  2ZX2 A;  1LU1 A;  5FP4 A;  2QQL A;  1RED A;  5CAD A;  1SFY A;  4YGB A;  2VZP A;  1J1L A;  3MI8 A;  1PVC 2;  2XUE A;  2YV8 A;  1A6C A;  4LK7 A;  1S0C A;  2HEY F;  1QY4 A;  5KXC A;  2ZX0 A;  2CGN A;  3EB7 A;  1UPI A;  3C7O A;  4CXX A;  1B35 C;  4QPW A;  1VAM A;  1FX5 A;  2W5F A;  1I9R A;  1AX1 A;  3MDP A;  1ULF A;  5C70 A;  1HN1 A;  2XG3 A;  3EJK A;  4XF3 A;  5C3R A;  2WQ8 A;  3D8C A;  1X9T A;  1WUV A;  1TE1 B;  2CL2 A;  5J48 A;  2YGM A;  2MPF A;  5JAX A;  1V6I A;  4E4Z A;  2AZ5 A;  1UU4 A;  5T3N A;  4BIO A;  2VTF A;  3H50 A;  1L7R A;  1NOV A;  1W8W A;  4HT1 T;  4XDQ A;  1S2B A;  1IQD C;  2ERF A;  3MPP G;  4UW4 A;  1JW6 A;  4WVM B;  4YVS A;  3ZX7 A;  2JDY A;  4I2O A;  2D3P A;  3KZ4 C;  5DXD A;  3UYJ A;  4CDQ C;  1L7L A;  5LBB A;  4LKD A;  3ZSM A;  4IE4 A;  1AX0 A;  2DU0 A;  4P00 B;  3UNP A;  3V65 A;  2EXH A;  4PJY A;  4Q5O A;  4XFA A;  2HEV F;  3IB3 A;  3URF A;  5FJK A;  3M7A A;  1E5R A;  2CY6 A;  3WX5 A;  3LDR A;  4XFF A;  3ZYG A;  4N8M A;  3E97 A;  2V4A A;  3JCI A;  3POB A;  2DWR A;  1BKZ A;  1CN1 A;  1QDC A;  5H9Q A;  4XHB A;  1LEC A;  1GOG A;  4AW7 A;  1YI7 A;  5DG2 A;  4XIL A;  4AOC A;  4YG6 A;  2YPJ A;  2WC2 A;  3DUI A;  4QU2 A;  2YG0 A;  2FZ1 A;  1MQT C;  2P3I A;  4M01 A;  4ET7 A;  4Q1R A;  2XR4 A;  1G7Y A;  2YBS A;  2EIE A;  3AVR A;  3T0A A;  1GZ9 A;  4LHK A;  4AFB A;  1SAC A;  3H3L A;  1KIT A;  2R32 A;  1QHD A;  3T3Y A;  5LBC A;  3VD7 A;  3WW4 A;  4GJY A;  4F83 A;  2VVE A;  2BFU L;  1QGL A;  1A8M A;  1WCU A;  3VD4 A;  2OA2 A;  3O1U A;  1IS3 A;  1XNK A;  3KM5 A;  1OC1 A;  5I8S A;  3VZK A;  3HEI A;  4V1P A;  3USS A;  2WUH A;  3OCP A;  3KD4 A;  2JE9 A;  2DUO A;  2VMH A;  3U1X A;  3VBU B;  4QKF A;  3AYC A;  2G19 A;  5F2W A;  1ZBA 2;  1COV 3;  3I54 A;  5FZ7 A;  1S1A A;  5A3N A;  4N7I A;  4XJZ A;  4KG0 A;  3GJA A;  3HNY M;  1WLD A;  1ULO A;  1UYX A;  4P9G A;  1UO9 A;  4AHZ A;  5GLV A;  5JVV A;  1W0O A;  3ETQ A;  4J1X A;  3KWV A;  3NJX A;  1ZVF A;  1VAL A;  5FYH A;  4WVM A;  4YVS B;  1SPP A;  2CAU A;  4IER A;  4A7K A;  4FQZ A;  3AP9 A;  2J1T A;  5A6Y A;  3OGR A;  1HQW A;  2A3Y A;  1DQ4 A;  1RYY A;  5A3P A;  1O5L A;  1DZT A;  5EJ3 A;  4QAW A;  4X8N A;  1OUX A;  2WA4 A;  1HXS 1;  4FPL A;  4I3P A;  3DYP A;  3H3Z A;  1GFF 2;  3FLP A;  5GZE A;  2IXK A;  4OI0 A;  4C8D A;  3ACI A;  4CTE A;  5J37 A;  2ADE A;  1V6J A;  4BWO A;  2NPI A;  1LHW A;  1JOD A;  5F2S A;  3KGL A;  5FY1 A;  5BPX A;  1W2O A;  1FMD 2;  4CDQ B;  4OMC A;  1UX6 A;  1W9W A;  3AMM A;  3HMY A;  2QQI A;  3LA2 A;  4MSV A;  4NO4 A;  1ENQ A;  1W8N A;  3FN9 A;  5KR7 A;  1ZRD A;  2RJ2 A;  2WNE A;  3DYM A;  1UZ0 A;  3BU0 A;  4LHN A;  4GJZ A;  3BVC A;  2H0V A;  2OPK A;  2BGC A;  2XBO 2;  2QTW B;  4ZS2 A;  4CP0 A;  4ES9 A;  3JD7 3;  2OII A;  2W2I A;  1Y9Q A;  3A23 A;  3WSO A;  1JZ2 A;  5ABJ A;  2Z79 A;  5K8S A;  5L19 A;  3HR9 A;  4M00 A;  2TUN A;  2LS6 A;  4X6Q B;  5FZK A;  4MG2 A;  1G9D A;  5B4X A;  3WDT A;  1YYN A;  1ULG A;  4F7Z A;  2CDP A;  3QCW A;  3ZXK A;  2WWU A;  3PMS A;  1QXR A;  5GLZ A;  4DZG A;  1DQ2 A;  4XCB A;  3KV6 A;  4QU1 A;  3C7H A;  5FUN A;  4XBL A;  2H6B A;  2IZW A;  4CCD A;  2YU2 A;  1UN1 A;  2JIG A;  5FY4 A;  5IFT A;  3VDB A;  1RMU 1;  4GWJ A;  3ZN6 A;  5GZF A;  4C1X A;  2Q1M A;  2ZGR A;  4RR3 B;  4UXA A;  4K20 A;  3DPR A;  4Y1Y A;  3M2M A;  4HOO A;  5ANQ A;  4ZXK A;  1B35 A;  2CNA A;  4JKL A;  3AC0 A;  3TOJ A;  3I3M A;  3BOD A;  4LO5 B;  4WV8 A;  4LO7 A;  2MEV 3;  5FR3 A;  4GH4 A;  2ZHM A;  5C8W A;  1PGW 2;  4AVA A;  3HJR A;  2J22 A;  4MXW B;  3VV1 A;  2Q30 A;  4CXY A;  5GZG A;  4ZON A;  1AXY A;  3ZVX A;  1UIJ A;  5LCW L;  1IZ3 A;  3AKS A;  1ASJ 2;  2VUC A;  3A0N A;  3PUQ A;  4IXL A;  2Y8K A;  1LEN A;  4XUQ A;  1AR7 2;  1IPJ A;  1H9W A;  1PO1 2;  4O9G A;  1SLI A;  2XVG A;  4UW6 A;  4AFM A;  5HPO A;  1DP0 A;  2C5D A;  1KS5 A;  2RM2 2;  2WZR 3;  3L2Y A;  1V00 A;  4CDQ A;  3IPV B;  5FUI A;  2VY0 A;  3BOP A;  2ZTN A;  4BA6 A;  2XON A;  1O5U A;  4YVS C;  2GH8 A;  1AR6 2;  1IOA A;  3NNF A;  5C6C A;  1ODN A;  2ARE A;  1LUL A;  2VG9 A;  3RZM A;  3VN4 A;  1ZBA 3;  2DVF A;  3P3N A;  2V5D A;  5A1A A;  5IVJ A;  1K45 A;  3DXT A;  1YIP A;  2DVA A;  5F3E A;  4BH9 A;  2I74 A;  4CCE A;  5JPM B;  4JGZ A;  1EP0 A;  5TSW A;  3MZH A;  1MS1 A;  4XEZ A;  1JYX A;  1HW5 A;  1NZC A;  5BUV A;  3LFM A;  4FFH A;  5I0T A;  1JYT A;  2HWC 3;  1AL2 3;  3ES1 A;  3SEE A;  3T2T A;  5M0T A;  3ACG A;  5A7N A;  5LY1 A;  1S0F A;  4WM7 B;  2XL7 A;  1OH3 A;  4Y4Y A;  1EPZ A;  4Q4W 3;  3IMM A;  4FPY A;  4YVW B;  3VBO B;  4IDZ A;  4PLN A;  4UW3 A;  2PHW A;  3VKO A;  1N3P A;  4B4R A;  5IVB A;  2Y64 A;  3HT2 A;  2C9K A;  3RI8 A;  1NA1 B;  4A42 A;  1COV 1;  2YZ4 A;  4PI0 A;  2OXB A;  2D5F A;  3MFC A;  1V9U 2;  5J36 A;  4QQO A;  1LAJ A;  1GP6 A;  2J1A A;  4A6S A;  1ZRC A;  1BJQ A;  5JMO A;  1T6B X;  1AXK A;  1RMU 2;  1TZO A;  2VXJ A;  1A78 A;  1LGN A;  5C4W A;  3S6P A;  1JYI A;  2YYO A;  3N7K A;  3IDE A;  4IE6 A;  3VHP A;  1S0I A;  5FZD A;  1FV3 A;  2HWB 2;  4I01 A;  2NLR A;  1YJK A;  4XVH A;  5CB7 A;  1V6M A;  3RQ0 A;  4UFH A;  4NHK A;  3C3V A;  4D8M A;  1QXJ A;  5FY9 A;  1IG0 A;  3UGH A;  4H55 A;  5CIR A;  1UMH A;  3C7G A;  2IUW A;  4IEZ A;  4QDS A;  3ZOI A;  3NV3 A;  1W6P A;  2X5I C;  5CFC A;  1JU3 A;  2P6C A;  3ACH A;  1Q8P A;  1UCX A;  2BWA A;  4LO6 B;  1XQN A;  1W6Q B;  3U4S A;  5HXM A;  4Q4W 1;  1VB2 A;  3TYJ A;  3M8L A;  1UY2 A;  3Q8C A;  1SLA A;  4Y22 A;  3WF2 A;  4QX8 A;  3AZV A;  4XFG A;  4QGL A;  5GKA C;  4W65 A;  4WVV A;  3LEM A;  1WD3 A;  2D3R A;  2Q0A A;  2RS3 2;  2W95 A;  3J8F 2;  1ZZ8 A;  3MLK A;  2PQS A;  5L9B A;  5BNO B;  2O8O A;  1AZD A;  2SLI A;  4FPO B;  3ZFE A;  2AAC A;  2ZX1 A;  2ZGS A;  5EV7 A;  1W06 A;  1NZI A;  1VE0 A;  3MLL A;  5LW9 A;  3FUQ A;  2R04 3;  5KHH A;  3AM2 A;  1S0D A;  2ZXQ A;  3H1Y A;  1UOF A;  4LE4 A;  4CZS A;  4Z1V A;  1RVF 3;  5EJZ B;  1QDO A;  4ASK A;  1DLL A;  2KM2 A;  2R04 1;  2R1D A;  3IMN A;  2QDR A;  4R52 A;  3UGG A;  4HPK A;  3D0J A;  4GWN A;  4M3C E;  1GZC A;  1BMV 2;  1W9Y A;  5L7O C;  4CDU B;  3SKV A;  4QKB A;  1VBA 3;  2P37 A;  2ZHL A;  1ND3 A;  4Q0Q A;  3BTZ A;  2W46 A;  2AR6 A;  4Y22 B;  2ZGM A;  5LBE A;  1NG0 A;  1WCS A;  2RM2 3;  2WZR 2;  4Y5Z 0;  2WNU A;  5FY7 A;  1OD3 A;  3RSJ A;  3WEZ A;  3WW1 A;  3ZMO A;  1UXX X;  3A0K A;  2GN7 A;  2IXJ A;  3WP6 A;  4XZP A;  2HWB 1;  4CCC A;  1RUG 1;  1WW5 A;  2GN3 A;  3WUD A;  4LBQ A;  2A6V A;  3PUH A;  3LGR A;  1CX1 A;  3RWK X;  2UU8 A;  5FYU A;  2R06 1;  2DCT A;  3PJY A;  5FZ0 A;  4XAA A;  1OI6 A;  2WKK A;  4LOS A;  3V64 A;  5DZF A;  3KGZ A;  1DQ0 A;  5IVV A;  3OBR A;  1VPH A;  4MAD A;  3VHR A;  5IK7 A;  5E1R A;  1N1T A;  1TMF 2;  2HWD 2;  4RN5 A;  1I1E A;  2GP5 A;  4E4S A;  1S0G A;  2XJT A;  4PBP A;  4BQ3 A;  2EIB A;  2QJV A;  1OQE A;  2LUW A;  2O1Q A;  3I3B A;  4LT5 A;  4BQX A;  1AR9 3;  3GDB A;  3B02 A;  1YXW A;  2JB8 A;  1OSG A;  3RYR A;  1UY4 A;  3ZKY A;  4KU7 A;  5IW0 A;  5FYB A;  1OQD A;  4J6G A;  1ND3 B;  1JMU B;  5AFB A;  3AZZ A;  1R08 2;  3JBG 3;  4Y3O A;  4S2H A;  2E7A A;  2GME A;  1OF3 A;  5I93 A;  1W6N A;  1RMU 3;  1YCI A;  4OFG A;  3ROU A;  5FPV A;  5F1R A;  1RUG 3;  4AI0 A;  3QOP A;  5IFP A;  5GZD A;  2P2K A;  4AAP A;  4IW3 A;  1Z7S 1;  3DXU A;  3RZK A;  4BQ2 A;  1UMZ A;  1ZA4 A;  2YMZ A;  4FXG B;  4LTA A;  5FLH A;  3SCH A;  2X09 A;  3IDB B;  1NYW A;  3N9Q A;  5LK7 B;  3Q8F A;  4YW2 A;  2VMC A;  1JYN A;  1OKQ A;  3ZDS A;  2FCT A;  1MZF A;  3GF6 A;  3ZSL A;  2P3Y A;  3K77 A;  1H6Y A;  3T0D A;  2HBT A;  1RUI 1;  3WDU A;  4HFS A;  5JZG A;  1GNH A;  1CZS A;  1Q5O A;  1QJY 1;  4K3U A;  5DUU A;  5E88 A;  3WHT A;  1O3S A;  1UOB A;  5EHD A;  1WCK A;  2IWG B;  4URT A;  1WCQ A;  1CON A;  3OY8 A;  1ST8 A;  2D7F A;  2OW4 A;  2Y6G A;  1GLH A;  2ZAB A;  4AQ6 A;  2IC1 A;  1MS5 A;  1UZW A;  2QKD A;  5IVY A;  2V4V A;  3J7L A;  4WZF A;  4QKN A;  3ZFE C;  1HQN A;  3E5X A;  3K2O A;  5F8P A;  4EWA A;  5BYN A;  4Q4Y 2;  2IXL A;  1NCR A;  1SFN A;  2JJ6 A;  2PEL A;  4NHM A;  3LDK A;  3OBT A;  4YAR A;  4NR1 A;  2YUE A;  1SDW A;  3LCP A;  2QZ2 A;  2WS9 3;  1JHJ A;  1V6O A;  4PQ9 A;  4HXC A;  1VLN A;  1RUC 1;  4M3C B;  5JSO A;  1WKY A;  1PVX A;  2P3J A;  3MW3 A;  3PL0 A;  2R04 2;  5FO7 B;  5FY5 A;  4NWW A;  4CDW B;  4QKD A;  4V2V A;  4HK9 A;  1PK6 C;  1YQ5 A;  4FVV A;  4XUR A;  3IBM A;  4UW5 A;  3BTA A;  3OB8 A;  2DVG A;  4LLO A;  4OI2 A;  4B7E A;  1X50 A;  4HKW A;  1IG3 A;  3S5A A;  1PVC 1;  4QQL A;  2R07 3;  4MGS A;  4Q0U A;  2BVB A;  4PDW A;  2WSU A;  1F5F A;  4XHX A;  2WFF 2;  2TEP A;  1LHN A;  1OLM A;  5F5Q A;  2W47 A;  2QFE A;  4LBK A;  2VCM A;  1T2X A;  2ZGK A;  5J3U A;  5FYI A;  3JXS A;  3VBR A;  1LJ7 A;  1VP6 A;  2V72 A;  1W6Q A;  2VOX A;  2JDN A;  1GMM A;  3NAP B;  1DYK A;  3ECQ A;  4RHV 3;  1H1I A;  4ZHN A;  4XTM A;  2WAA A;  4LJH A;  3SC7 X;  2DBN A;  5FXX A;  5H9P A;  1W8F A;  2ZGT A;  3TN9 3;  4GA9 A;  2ES3 A;  2WT1 A;  3N3H A;  3OUJ A;  4LBL A;  3JU9 A;  4DUV A;  5A3U A;  2PLV 3;  1HRI 3;  2G9G A;  4MZU A;  4Q29 A;  1QJF A;  1VMJ A;  4KH9 A;  5DPN A;  5FZG A;  4CUC A;  2BGO A;  2F4L A;  3CJI A;  3ZFF B;  4CEY A;  1VBB 3;  1GP5 A;  4FP3 A;  4XQ4 A;  1NKG A;  1JU4 A;  4R4Z A;  5FKC A;  4DEV A;  1O3T A;  2WQZ C;  1QJE A;  4JGZ C;  1GIC A;  5F6L B;  2EAA A;  4UAP A;  5BNP A;  1HJF A;  1WW4 A;  3AJY A;  2Y6K A;  4FBF A;  1CAU A;  3E5Q A;  1HB1 A;  3E6D A;  3NV4 A;  4J1W A;  5EWS A;  4N7U A;  4A41 A;  5CFD C;  4NJ4 A;  5A7W A;  2JDZ A;  4D0Q A;  1PGL 1;  4FPF A;  2DUR A;  1KEX A;  1LOF C;  1BXH A;  4P5H A;  4XE9 A;  1OVP A;  3VZJ A;  3O1R A;  4MH0 E;  3MEP A;  1DU3 D;  3FHQ A;  2D97 A;  1LOG A;  3HT1 A;  1CWP A;  3J7M A;  3RMX A;  4DS0 A;  1JS9 A;  2QCS B;  2ARA A;  2BP6 A;  2OT7 A;  3KF5 A;  4RGK A;  3THD A;  1GP4 A;  3WQ7 A;  4JAA A;  4MGT A;  3W5N A;  1AR9 1;  2YC2 A;  4HET A;  4KU8 A;  1EPW A;  1VRH 1;  2VGD A;  2GMM A;  3B3Q E;  4DB5 A;  1C8M 2;  4NUB A;  2OVU A;  3ASI A;  3NW4 A;  3WNK A;  1CPN A;  4BME A;  4GH4 C;  1EUT A;  4XYX A;  1NLQ A;  2CU5 A;  4DXZ A;  4ASM B;  1VBB 1;  4AAX A;  5FTT C;  2YC0 A;  3AXD A;  2RDS A;  3DPR C;  1VBE 2;  3J7H A;  4MET A;  4YZ4 A;  3ZR6 A;  2B4K A;  2RS3 1;  3J8F 1;  1BVV A;  5L9V A;  5A32 A;  1ZBA 1;  2RDQ A;  3FHA A;  2GNT A;  3M3O A;  1XC6 A;  4Q0P A;  4R9C A;  4Z07 A;  3KHC A;  2ADD A;  4YVW A;  1ACC A;  4XXP A;  1QJZ A;  1VAV A;  4BHP A;  2RDN A;  3K4D A;  1NCQ A;  4A4A A;  4BOW A;  4HVQ A;  1REE A;  2E6V A;  2RMU 1;  1K5M B;  4X6R B;  5FZL A;  5FXZ A;  2E32 A;  1BLZ A;  1BYH A;  1QOO A;  2YPD A;  4KNC A;  1QQP 2;  5K0U C;  4QQ2 A;  4ZPI A;  2HWE 3;  2BNM A;  1DGL A;  3ZIX A;  1OLR A;  4G4F A;  1X8M A;  1BEV 1;  1FPN 2;  2C9A A;  3KSC A;  2C4X A;  4WZC A;  4GIQ A;  2D98 A;  1H1M A;  2LTN A;  1IQA A;  4I02 A;  5ABJ C;  4XPV A;  5F32 A;  4P9J A;  4A45 A;  3NNG A;  4Y1V A;  1GNY A;  4MGY E;  2QQO A;  3LIH A;  2WFF 1;  1FMD 1;  3WNL A;  2Y6J A;  5A33 B;  4LMF A;  1MEC 3;  3UL2 A;  4ZXE A;  1ZRE A;  5KC5 A;  4NVP A;  1XE7 A;  3FJS A;  5FK8 A;  2WFF 3;  3VKF C;  1HV1 A;  4AGV A;  2A6Z A;  3O14 A;  5BV6 A;  3KV4 A;  2Y6F A;  3KQ4 B;  2BGP A;  3LEG A;  3NMB A;  4N53 B;  1CES A;  2R06 2;  1VMH A;  4L8Q A;  3ZO0 B;  1TNR A;  4IE5 A;  4BYY A;  4KWK A;  2YBK A;  3RYP A;  2XBO 1;  5LAT A;  3ZXJ A;  3GXU A;  5CYY A;  3S5Q A;  3WUC A;  5F37 A;  3DF0 A;  1JZ6 A;  2VXR A;  2YB7 A;  3AP7 A;  4AQ2 A;  3OTF A;  1BBT 2;  2GNM A;  1PGS A;  3WNN A;  3FE5 A;  1N3Q A;  5FJH A;  1X9P A;  2Y33 A;  3MW2 A;  2WA3 A;  3OJB A;  4AVS A;  3B9I A;  2EID A;  1QWR A;  4QB2 A;  4QQP A;  3VBF C;  4CXW A;  4JRL A;  2CGP A;  4FPJ A;  5FYS A;  1UD1 A;  2HYK A;  1MS8 A;  1L3J A;  4IQP A;  1W90 A;  2A7A A;  4IE0 A;  2ZX4 A;  4AGR A;  3MLJ A;  4XJU A;  3WVJ A;  3NWK A;  1IGO A;  4QXB A;  5DZE A;  5GLU A;  3WXP A;  3B94 A;  1KGY A;  3SH4 A;  3W5M A;  1Z7S 2;  1X82 A;  2Z5W A;  5FZ4 A;  3I97 A;  1RUH 2;  4TSV A;  3I2F A;  1JZ4 A;  1XOY A;  2XXZ A;  4D7S A;  2OZJ A;  5GLW A;  2PMW B;  4CCL A;  2PHU A;  4FO9 A;  1UZY A;  1VRH 2;  2GSY A;  3LE0 A;  1HXS 3;  3OGG A;  2NMN A;  4WBB A;  1LHV A;  4YGD A;  1GUI A;  4BPZ A;  1NE6 A;  1LRH A;  4OQ8 A;  4FOW A;  3WP4 A;  2DDU A;  4LKS A;  3RYK A;  2VQ0 A;  4XUO A;  5FZO A;  4B29 A;  5IVE A;  3N4M A;  3OBZ A;  4QMA A;  2A5Z A;  2QQV A;  4NWV A;  5T52 A;  1BQP A;  5BNP B;  2VZU A;  3RZJ A;  2V09 A;  1GQH A;  3KV9 A;  3K51 A;  5LA9 A;  3APB A;  1K5M C;  1U5I A;  1D4M 3;  1TME 3;  2YU1 A;  4U2A A;  2VTX A;  5J7M A;  2FMD A;  2ZHK A;  4TLG A;  4F8A A;  1SLT A;  4AVV A;  3ORJ A;  5FZH A;  2OS2 A;  4QX5 A;  3SH5 A;  4B7K A;  4LA2 A;  4JDO A;  3D0S A;  5FAX A;  3POS A;  5ABJ B;  1F8V A;  5LRR A;  1PZ7 A;  3WR0 A;  1W3V A;  2G9Z A;  2VU9 A;  4PIZ A;  2JEM A;  5FZ8 A;  4IEO A;  4HZF A;  1FAY A;  3GHN A;  4MXW A;  1FT9 A;  5T50 A;  2J1E A;  4N90 A;  4UFJ A;  5CVR A;  4IEX A;  1ND2 B;  5J98 B;  5L73 A;  5FLI A;  1OHF A;  1E5H A;  2DCY A;  1DZR A;  1LU2 A;  5KHJ A;  2TNF A;  4RQP A;  5HCH A;  3KHB A;  4ONU A;  4YM1 A;  3AMQ A;  2VBP A;  3LIG A;  4RR3 C;  3RZG A;  1OUS A;  2BQP A;  2XQR A;  4N53 C;  1LCL A;  3O7O A;  1UOJ A;  3S7E A;  4IEQ A;  2EXK A;  1LOE A;  2HEW F;  1NAE A;  1QJU 3;  1FI2 A;  2QBX A;  4QDQ A;  4CCN A;  2E53 A;  1DDL A;  4QHO A;  1LTE A;  2QZ3 A;  4IEV A;  4P08 A;  4QX0 A;  4LBO A;  4N43 C;  5FP7 A;  5A80 A;  4W6X A;  2YBP A;  4BMB A;  1RC6 A;  4KWU A;  1VAK A;  3HN1 A;  1DF0 A;  5I0D A;  5JOX A;  3GZA A;  2XJR A;  3TEY A;  2OUJ A;  3WF4 A;  2D3S A;  4MOA A;  2QUO A;  3AMN A;  3I3Q A;  2R06 3;  1JUI A;  1AL2 1;  4D3W A;  5KHI A;  2E33 A;  5C9A C;  2AH2 A;  4UFI A;  2FBE A;  2QDN A;  4FOQ A;  5DAP A;  2VNR A;  4BXS V;  1LHO A;  2VCA A;  4CP1 A;  1W2T A;  4M0H A;  1RUF 3;  4UYB A;  4HKL A;  4JTN A;  5LRS A;  3R6S A;  3WF1 A;  3NQH A;  2Q1Z B;  1RIN A;  3H7Y A;  3N9M A;  5DG1 A;  1MEC 1;  3OGS A;  5LWB A;  1HQL A;  5F3I A;  3P1I A;  1VBC 2;  5DUV A;  3VD3 A;  4D6S A;  1UYY A;  3GM8 A;  4P9I A;  5H9S A;  3PUA A;  5EJ1 B;  1WME A;  1PO2 2;  5SV8 A;  1YO8 A;  2JD9 A;  2JE8 A;  1EV1 1;  1XB9 A;  2AGS A;  3BIW E;  3ZSE A;  4DXR A;  2FDH A;  1NT0 A;  2YDE A;  3PTR B;  1R09 1;  4WM7 C;  3RS6 A;  2JDU A;  4YM0 A;  5CBL A;  3A4U A;  4QX3 A;  3BN6 A;  1GR3 A;  4DIN B;  3OEB A;  4V2W A;  2HH9 A;  5JMC A;  2XBO 3;  4LIT A;  5FO9 B;  1HV0 A;  5HCB A;  3C7E A;  4Q8K A;  3AYA A;  2WFP A;  3ABZ A;  5E16 A;  2UUR A;  3P5B A;  4P02 B;  2QQM A;  4YZ1 A;  1RHI 2;  3I49 A;  3O1T A;  4LKE A;  2RV9 A;  1FV2 A;  3WDX A;  1Q8Q A;  4XF1 A;  2J1R A;  3VDD A;  3POF A;  1W99 A;  2R49 A;  4XIK A;  1MVE A;  1NXD 1;  2BNO A;  2WO1 A;  1XJA A;  1SMV A;  3ZDV A;  1J58 A;  1QNW A;  3I59 A;  2B9V A;  4AVC A;  3ZSK A;  4XQW A;  2VVF A;  1OLM E;  1ND2 C;  2NYY A;  1X33 A;  2GU9 A;  2VW1 A;  1DGR A;  3CJX A;  2C26 A;  1AYM 2;  3I8T A;  4G3Y C;  5D8A B;  1RUJ 1;  1NY7 2;  2Z4F A;  5EXO A;  4CEW B;  4GQ7 A;  4PF1 A;  2C6S A;  2ZEZ A;  4BQ5 A;  4QX7 A;  3SIT A;  3VBO C;  2ZGN A;  1A8D A;  4IV3 C;  4LK6 A;  1VJ2 A;  1CR7 A;  4EJR A;  2TBV A;  4Y24 A;  4K40 A;  4E8D A;  5C71 A;  2F4P A;  1M4W A;  4D7T A;  4GB3 2;  2BVV A;  4QT6 A;  1RB8 G;  2DTW A;  2XQX A;  2RMU 2;  1S4C A;  3ILF A;  4AED C;  2BNN A;  1RUD 1;  4XUT A;  3S30 A;  1DQ5 A;  3WNX A;  2QVS B;  4XJ8 A;  5F5I A;  4Y26 A;  4COU A;  3V56 A;  1AR7 3;  1PO1 3;  3JB8 A;  4Y5S A;  1SDD B;  2LW8 A;  5KWR A;  5IK8 A;  1YJL A;  2WNU B;  3M70 A;  3ZPO A;  3ZFG A;  5FMD A;  1OKO A;  1ZBE 3;  1AR6 3;  1W2A X;  4DXT A;  3B01 A;  2WWS A;  4AI1 A;  5A33 A;  2ID4 A;  4ZU5 A;  1EV1 2;  1UU5 A;  2R07 1;  3T08 A;  2X8K A;  1F2N A;  1F31 A;  4CE8 A;  1H8T A;  1W8T A;  3LKJ A;  5FZI A;  1LED A;  1E57 A;  1W2U A;  3FZ3 A;  3LD8 A;  3RPQ A;  3ZFF A;  3T1M A;  1YUD A;  1W8Z A;  3AVS A;  3LDB A;  2DVB A;  4KL1 A;  1WZX A;  2JKX A;  1PZ8 A;  4CCJ A;  3KVA A;  4P9W A;  5JDB A;  2B46 X;  4DO0 A;  1NQJ A;  4FI9 A;  3CU7 A;  1JZ7 A;  1YEW A;  2XJP A;  1PX3 A;  3N7M A;  1O91 A;  4O9E A;  5CKN A;  3USU A;  1X7N A;  5JPN B;  1O59 A;  5A3W A;  2JIJ A;  5I91 A;  1JH5 A;  1SCS A;  1OPM A;  2YC4 A;  3N9L A;  4OUE A;  1RUI 2;  4IV1 A;  1LES A;  1QIQ A;  1BK1 A;  2H6C A;  3JQW A;  4P5Y A;  3VBH A;  1AR7 1;  1OA4 A;  1PO1 1;  3CEW A;  2ZBJ A;  4EYU A;  4JTO A;  3MBW A;  3CBN A;  1JZ3 A;  3KCY A;  4E2S A;  1VBC 1;  3F95 A;  2D43 A;  1JUH A;  3B5L B;  3KB5 A;  4QPG A;  1TME 1;  4Q4Y 1;  4CUG A;  5FXV A;  4CP9 B;  1TEI A;  5AC9 3;  1MR5 A;  3L9J T;  1H0B A;  4K6B A;  1Y4W A;  4Q4Y 3;  1H9P A;  4L9B A;  3ZMN A;  2JEC A;  2XOM A;  1ULP A;  4CDU C;  5A1F A;  1BZW A;  2XH6 A;  1Q8S A;  1R1Z A;  1E5S A;  5H9R A;  3T2P A;  2MHF A;  3KF3 A;  4W4Z A;  4AK3 A;  5I8Y A;  4CDW A;  5F9T A;  1EAH 3;  5FRE A;  3VZM A;  2HWF 2;  4DRR A;  1VBD 3;  3JD7 1;  1YRZ A;  4OUM A;  5FZM A;  4FAH A;  1J59 A;  1DLC A;  2W08 A;  2YGL A;  4S2F A;  3WV6 A;  5A7O A;  4BU2 A;  2D6P A;  2WYF A;  4CEW C;  1TG7 A;  2GND A;  1CAX B;  2LAL A;  1VBD 1;  2PN5 A;  2VOT A;  2Y0I A;  3CMG A;  4HON A;  3ZXF A;  4KWL A;  2XWB B;  4NRP A;  2ZGU A;  2JG8 A;  3I2D A;  3OD0 A;  1OOP A;  1C5I A;  2WN3 A;  1W8U A;  1GQP A;  3B7M A;  2B39 A;  4PDW B;  1G86 A;  4YLZ A;  4HKO A;  1V9U 1;  2P17 A;  2R07 2;  1NA1 A;  3PVN A;  2YFZ A;  3WCR A;  4ZKT B;  5BNN A;  1QOS A;  2YRO A;  2PXJ A;  3AZX A;  4XUP A;  5C7G A;  2ZKL A;  5IUQ A;  3ZKU A;  1W6M A;  4UFM A;  4AFA A;  5JR2 A;  4IEP A;  1KQR A;  2VZR A;  3D3A A;  4YG0 A;  1H4H A;  5HCA A;  3V0B A;  2JIC A;  3C8X A;  3K4Z A;  4M3C A;  2Q5T A;  4K8R B;  1D0H A;  4NPM A;  4WVZ A;  4D69 A;  4Y1X A;  2EXJ A;  4UBG A;  1S2E A;  4LXL A;  4Z82 A;  5KBF A;  1POQ A;  2VZS A;  1KDK A;  4NPL A;  1RL3 A;  1RUD 2;  3O1M A;  3TRS B;  5IAX A;  1VIW B;  1YNA A;  5LK5 A;  4JX0 A;  2RMU 3;  4QDR A;  4FPE A;  1NE4 A;  4BDV B;  5LZ6 A;  1CAW A;  5C8C A;  3TB0 A;  2XPJ A;  1HRI 2;  1VBA 2;  1HX6 A;  5BNO A;  5KHG A;  5IK5 A;  2JG8 C;  1RUN A;  2IVI B;  1LOC A;  4A3X A;  4IES A;  4L99 A;  1ZX5 A;  4L92 A;  3U11 A;  2ARX A;  4CEW A;  4PQQ A;  4Q2F A;  4OHZ A;  1N1V A;  2WO7 A;  3QBQ A;  3U4X A;  4PIY A;  4BIS A;  4MX3 A;  2FMY A;  2VQU A;  4I0B A;  1JXN A;  2GC2 A;  4Q4V 3;  3WF3 A;  3ZXL A;  4CDW C;  5FDB A;  2ZAH A;  2RS1 1;  2JDP A;  2PQQ A;  2KA3 A;  5FYM A;  1EY2 A;  5BNQ A;  3HBZ A;  1OOP B;  1QJX 3;  2BBA A;  1JI6 A;  3CNA A;  2O14 A;  3POI A;  2W9X A;  4FFI A;  4A6O A;  2VUA A;  3NNL A;  4IV1 B;  4RS5 A;  1ZRR A;  1O4T A;  4XBN A;  2UY8 A;  4JGY A;  4XFC A;  4DNY A;  5C3Q A;  2BWC A;  5FPA A;  2Z42 A;  3OYW B;  1GNZ A;  1SBF A;  3BI3 A;  1F15 A;  1QKQ A;  2GZW A;  2ZA9 A;  4URA A;  4ZZ5 A;  2HWC 1;  3HQU A;  1EUU A;  1HDK A;  2CV6 A;  3IAQ A;  1AR9 2;  3W20 A;  1AF9 A;  2FCU A;  5F6K A;  1OH4 A;  4XET A;  4D7Y A;  1I3H A;  4DRV A;  1BMV 1;  4P9Y A;  4NRQ A;  1DYP A;  1GSL A;  2Y6H A;  1KFU L;  4GAZ A;  5FZ3 A;  1AJO A;  1RXG A;  2VD7 A;  1NXM A;  1YIF A;  5FOB B;  5JXH A;  4CP9 A;  3U78 A;  2ZEW A;  3PU8 A;  3I7D A;  4QPG B;  3PUI A;  2ZAA A;  4M3C F;  3RJR A;  3WCS A;  3GAL A;  3WD5 A;  3C2U A;  3I4I A;  3IPV A;  2VZ1 A;  4HL0 A;  3NL1 A;  2PHR A;  4W6W A;  3WQ0 A;  1Z78 A;  3LOB A;  2VW0 A;  2V73 A;  4HBN A;  5CIS A;  3POY A;  4AL9 A;  1V0A A;  1W6O A;  4RGA A;  2W87 A;  4IEY A;  4CRQ A;  2ZEY A;  5JXJ A;  4KMQ A;  3TBD A;  5FYC A;  4JCK A;  3ZFF C;  4HLT A;  1W05 A;  2HWF 1;  2ZPX A;  5EYX A;  3M1H A;  4Z92 B;  5T55 A;  2BFU S;  1WW6 A;  1D2Q A;  3THC A;  4Y5T A;  4JKM A;  3CO2 A;  1EAH 2;  1RHI 1;  1HRV 3;  2CSG A;  2WNV C;  3AL6 A;  3MO4 A;  1ZM1 A;  1IKQ A;  1MAC A;  3HNB M;  1QQP 3;  4YGC A;  1SHW B;  5CFD B;  1POV 0;  1HRV 1;  3RFR A;  1DYO A;  2VJX A;  3DKW A;  1FPN 3;  2VZQ A;  2JG9 A;  2PLV 1;  3PDQ A;  4JDN A;  4GUL A;  5FPB A;  5FBZ A;  5FWJ A;  1MQT B;  1RUO A;  1COV 2;  4MXV A;  4XQD A;  1DZQ A;  4IEW A;  1UYP A;  3VZO A;  1U5Z A;  2WR9 A;  4HN1 A;  1Y9G A;  1AYM 1;  4FTS A;  2FHR A;  1M06 G;  3O1S A;  4AI9 A;  1U5Y A;  2WS9 2;  4M4R A;  3IT8 A;  5FYZ A;  1ENR A;  1KFX L;  2VQT A;  2DYC A;  2BPA 2;  4B8E A;  1KDM A;  1YFU A;  1GQG A;  4IGO A;  4PLO A;  3GYD A;  5D2A A;  3UV9 A;  4KBZ A;  3VBU C;  4NE9 A;  2D6K A;  1QXP A;  3CZU A;  3MHZ A;  2KR2 A;  2PAK A;  2WQ4 A;  3SIS A;  3W59 A;  2VMF A;  4EWD A;  3N9O A;  3ATG A;  1BBT 3;  1OBN A;  2JD4 A;  4QM9 A;  2X05 A;  4BJ0 A;  3RZZ A;  1X36 A;  4QX2 A;  3DEM A;  2GH2 A;  2W94 A;  1RJ8 A;  2PHX A;  3VDD C;  3VLB B;  1FMD 3;  1OA3 A;  3SMH A;  4KGG A;  3IDA A;  2FDK A;  4SLI A;  2D6L X;  4O61 A;  4CVU A;  1QJU 1;  1QU0 A;  4Y33 A;  3WP3 A;  2DCZ A;  2XB6 C;  4Q4V 2;  5JR7 B;  4YW1 A;  3FBY A;  3ETP A;  1IKP A;  2VM9 A;  1RXF A;  3M3I A;  4XC9 A;  3SXW A;  3TN9 2;  3GCW A;  3H1W A;  1JOB A;  1G6N A;  5FZA A;  1YFY A;  3WW3 A;  1GWL A;  2ZGO A;  2R16 A;  4AHY A;  2OZ6 A;  4UBH A;  3O1O A;  3BTX A;  3VUO A;  4CYD A;  3KQR A;  1W0P A;  1CJD A;  1HXS 2;  2XML A;  3MIB A;  5AFE A;  2AEY A;  4W8J A;  5D8A A;  3VZL A;  1UKG A;  4IEU A;  4YFZ A;  3BTY A;  3T1L A;  5FPU A;  4NIH A;  1KJL A;  2CWS A;  4LO8 A;  3LEK A;  1IS5 A;  1W28 A;  3DL3 A;  2EIG A;  4F3J A;  1UF2 C;  1AJK A;  5T5P A;  1HB4 A;  2KD7 A;  4AQT A;  2E51 A;  1WMF A;  5FZC A;  1CX4 A;  1C28 A;  1QJX 1;  5K0U B;  2A71 A;  4CCK A;  4YW6 A;  1D4M 2;  1TME 2;  2DFB A;  3UGF A;  4ZZ8 A;  2DV9 A;  1L7Q A;  1N1S A;  3LEI A;  2ZGP A;  5FWE A;  3FC0 A;  1YFW A;  4E4H A;  2OKX A;  5HCF A;  1GKB A;  3A7Q A;  3ACF A;  3RZH A;  2GC1 A;  3MW4 A;  5KC6 A;  1H1A A;  3O0W A;  2VO5 A;  4Q4X 3;  4XTP A;  1LGB A;  5GAL A;  4B4P A;  4M4P A;  5GJ6 A;  3U10 A;  5EP9 A;  3VD5 A;  1TMF 1;  2HWD 1;  4CCO A;  5FP9 A;  1TVG A;  3N9P A;  2PHL A;  4YW4 A;  4RA0 A;  5DAB A;  5T5J A;  1H6X A;  4DOU A;  3HOB A;  1WWY A;  3ZLI A;  2Q8O A;  4UWD A;  1AX2 A;  1POV 3;  2XVL A;  4RQP C;  5FQ0 B;  1GOF A;  4LHS A;  4WM8 A;  2J1S A;  1GYK A;  1YQC A;  4HAN A;  2B45 X;  1QJU 2;  2W3J A;  1PIV 2;  3SEP A;  4MGZ E;  1PNG A;  4AG4 A;  2ZZQ A;  5J96 B;  2FD8 A;  5JIA A;  3W58 A;  3OPW A;  5FZO B;  4AR2 A;  3N36 A;  4YZ3 A;  1AL2 2;  1B35 B;  2WII B;  1PGW 1;  4MUV A;  2CDO A;  3B00 A;  3WNO A;  5LA0 A;  1CQ9 A;  3H42 B;  4GZ9 A;  2OYZ A;  3LPF A;  2PHF A;  2UWC A;  2A3X A;  1SLB A;  3CZJ A;  4OCT A;  4LBM A;  1JYC A;  1O3Q A;  1CAU B;  1FNZ A;  1IPK A;  2VE1 A;  4XJW A;  4CU9 A;  4FTB A;  4L97 A;  2BU9 A;  4AXO A;  3UET A;  3PUS A;  3WQ1 A;  3BIE A;  4AYU A;  2W91 A;  3NO8 A;  1J3P A;  3ZYR A;  2E9Q A;  3IM0 A;  3OBA A;  4UT5 A;  4JZR A;  3T0B A;  1R09 2;  3R4D B;  4OI4 A;  5DUX A;  5IHR A;  2HWB 3;  1H4G A;  1HKD A;  4LBN A;  1QNY A;  5CG8 A;  5EIY B;  1CD3 G;  3FWE A;  3LZZ A;  4O65 A;  2XHK A;  1UX7 A;  4E8C A;  5LAS A;  5DN2 A;  4KG8 A;  3GZE A;  1JYV A;  3ES4 A;  4NID A;  5HBA A;  5FZ1 A;  4GMP 3;  1OFN A;  4NII A;  3AYE A;  3LSE A;  3MGU A;  2OQ7 A;  4PT6 A;  1D7P M;  1RHI 3;  2R1B A;  2LRP A;  4AWD A;  1Y9M A;  4WM8 C;  1N3O A;  2G1M A;  3WZ1 A;  4CDX C;  3ZYP A;  3TEZ A;  2A1X A;  5K9Y A;  4BE3 A;  1H2K A;  1X8E A;  3OEA A;  4OHX A;  4JVA A;  4ISQ A;  3M3E A;  2HBU A;  4OHW A;  1XYP A;  1F35 A;  2W0X A;  4R4X A;  3W9A A;  4CPB D;  5FUP A;  4UI9 L;  5FYV A;  3W21 A;  1PIV 1;  4IUG A;  3F2Z A;  3WG1 A;  2VUL A;  2W1Q A;  2WNO A;  2X5I B;  3MIE A;  3ZXG A;  5CZK A;  4YZ5 A;  5FQ0 A;  1LR5 A;  1J3Q A;  4PBO A;  1O8S A;  1PHM A;  1DGW A;  4B1M A;  1Z7S 3;  1LOD A;  4I3G A;  1MZE A;  3WG4 A;  4DEQ A;  3RWN A;  1U0A A;  1RUH 3;  2XJV A;  4H14 A;  1VB4 A;  3Q8B A;  2JKB A;  4Y1Z A;  2PYT A;  1WD4 A;  3UK9 A;  3VGI A;  4QX1 A;  1C1L A;  3SKJ E;  1NLR A;  4BXF A;  4GMP 1;  3MF9 A;  3EXU A;  1EAH 1;  3N35 A;  4RGG A;  5A32 B;  3WG3 A;  2IVJ A;  2RJL A;  3OGJ A;  5DAX A;  3ZYH A;  4BQY A;  5A3O A;  1C1F A;  2VVD A;  3GJB A;  5FPX A;  4KBB A;  1J83 A;  2RE9 A;  3QAC A;  1T6G C;  4K21 A;  5F5A A;  1A34 A;  1F4A A;  1RUF 1;  2ZAC A;  2C0Z A;  1LOB A;  3OY8 B;  4HSL A;  2Z2S B;  3CLP A;  4KGQ A;  3N7L A;  2Y0O A;  5JLV A;  2HJI A;  2BYV E;  1ZBE 2;  2EAL A;  1I6X A;  2JX9 A;  3D6E A;  1WMX A;  3SCG A;  5JOY A;  3THP A;  4XDO A;  3R4U A;  3RMY A;  5B2G B;  3KLS A;  3PHM A;  1W9S A;  5HV4 A;  3PTY A;  1RUE 3;  1MS4 A;  3AP4 A;  3ZXE A;  2GAU A;  1GOH A;  3TNQ A;  4E2Q A;  3ZN4 A;  3H7J A;  2RR1 2;  4TLF A;  5F39 A;  5CKQ A;  4QB1 A;  5BXX A;  4LBJ A;  3T2O A;  3BPS A;  3WW2 A;  2A73 B;  4XJ9 A;  4Q0S A;  3RZL A;  2JDH A;  1G9B A;  2QQN A;  3FUO A;  5JXI A;  5CEH A;  1UIK A;  2JWP A;  1STM A;  3NKG A;  4I0W B;  1ENS A;  1WLW A;  3RVH A;  3AJZ A;  2WNV A;  5EQU A;  3UJQ A;  3ZR5 A;  4NHY A;  2HLE A;  4IV3 B;  1JBC A;  4GMP 0;  3VDA A;  4DUW A;  5JUV A;  1AL0 G;  1LNS A;  4JHZ A;  4Y1U A;  1JZ8 A;  2X53 S;  4AE2 A;  3JBG 2;  2CWM A;  4RFT 0;  2OX0 A;  4FP2 A;  2Q8E A;  4BQW A;  1V6K A;  1MS3 A;  1SBE A;  1O6U A;  5JSP A;  4IE7 A;  1ZA7 A;  4MGQ A;  1HB2 A;  3VBS A;  1SZB A;  1RUG 2;  3P6B A;  3O0V A;  1ZZ6 A;  4L0P A;  2RS5 1;  3GBF A;  4QD2 A;  5A7S A;  1Q56 A;  2ORX A;  3ZPY A;  4CDX B;  4OYU A;  1R09 3;  3QLQ A;  3D4K A;  3IAP A;  3BCW A;  3DV8 A;  4GWI A;  5ERL A;  1KS4 A;  4B4Q A;  5CA6 A;  2QQU A;  3HIF A;  4RYD A;  1G9F A;  3HVD A;  2LRO A;  4G9S B;  5CFD A;  3OSD A;  5CG9 A;  1XU2 A;  3J7N A;  5LY2 A;  1UXZ A;  2G9F A;  1F4H A;  2DU1 A;  1S0E A;  3JD7 2;  1VBD 2;  3ITQ A;  3KCC A;  1Q43 A;  1QQP 1;  3CDZ B;  2J42 A;  3N7J A;  4RFR B;  4FFF A;  3CJI C;  5A6Z A;  1ZRI A;  2VEC A;  3AXE A;  3MIH A;  5F3C A;  4KQ7 A;  4UFL A;  5FIX A;  4FPG A;  5A7P A;  2EXI A;  2BUK A;  1CPM A;  1SFP A;  3EMR A;  1XNC A;  1PO2 3;  1UOG A;  4HVR A;  3QD6 A;  4O7X A;  3LA7 A;  3MUY 1;  1PX4 A;  1E5I A;  1JN2 P;  1AR6 1;  2JDK A;  4W50 A;  5ANN A;  3BYW A;  3UKT A;  1OD5 A;  3NVC A;  2BOJ A;  3J4U H;  4PHZ A;  3A22 A;  2ZJC A;  4QHZ A;  3INA A;  2BER A;  4E2G A;  4XFB A;  1UYZ A;  2FDG A;  1UZV A;  2QQW A;  1CAV B;  3T4V A;  1CVN A;  2N7G A;  1H2L A;  1Z0H A;  2VOW A;  3ZXA C;  4D94 A;  2MEV 2;  1W0N A;  3ILN A;  5HV0 A;  1RUD 3;  5F5C A;  3UKN A;  3T2Q A;  3WG2 A;  1BBT 1;  3V0A B;  1OT5 A;  1PM4 A;  3I2I A;  3KVB A;  2RDR A;  1QH7 A;  1ASJ 3;  1CIY A;  4H2A A;  4NRO A;  3PUR A;  1C4R A;  4JQT A;  3D5O A;  1ZBE 1;  2W68 A;  4K7J A;  3T4H B;  1Q3E A;  4YPJ A;  3Q8A A;  3TEW A;  1XYO A;  3HNM A;  2A6Y A;  1V6N A;  2I2S A;  5CAZ A;  5FFO C;  3VHO A;  1MZ5 A;  1D0G A;  2VCB A;  4XJA A;  2NZ9 A;  4EWE A;  3OF1 A;  1W8O A;  1RUC 2;  4GB3 3;  1AYN 1;  1NA1 C;  2O0O A;  3PNA A;  3MFA A;  3LAG A;  4OVE A;  4XUN A;  4I30 A;  5I0S A;  3MIC A;  2HYX A;  4AFC A;  3SQO A;  1NLS A;  2ILM A;  1W6O B;  4P14 A;  2WZ8 A;  1K3I A;  1QH6 A;  1WA4 A;  5JWP A;  3V0B B;  5I0U A;  4IGP A;  2HWC 2;  1I5P A;  1WCD J;  3AB0 A;  1QJY 3;  3AKP A;  3JZV A;  5A70 A;  3H8O A;  4YSF A;  4C0B A;  5C8C C;  1OA2 A;  1OFS A;  1F5J A;  3FBM A;  3WDW A;  4Q4W 2;  4COZ A;  2GMP A;  2RVA A;  1I5Z A;  1EV1 3;  1ZYB A;  4WVW A;  1HJG A;  1MVQ A;  4I0A A;  4MV2 A;  3K3O A;  2DBI A;  4SBV A;  4YW5 A;  1ZZB A;  2B42 B;  3VBS B;  4DFS A;  2RS5 2;  1JTZ X;  1W03 A;  4LNV A;  3V0A A;  2O8Q A;  1GWM A;  1H8V A;  3GBW A;  2VR4 A;  4MGK E;  4XF4 A;  3NJZ A;  2JB4 A;  1REF A;  5T5L A;  4MHU A;  3WQB A;  3R0R A;  3EYP A;  2OQ6 A;  3O12 A;  4GB3 1;  1AYN 3;  3WP5 A;  5JIU A;  2B9U A;  4W6Y A;  2QQP A;  4IL7 A;  4HSJ A;  5CFC B;  4K1Y A;  4FSJ A;  4E4D X;  3ZYF A;  5BNN C;  4LBQ B;  3U14 A;  1J1T A;  4YGE A;  4DY3 A;  3PVO A;  1SCR A;  3LSD A;  4MGI E;  1HRV 2;  1LOA A;  1XBF A;  2ZHN A;  4YZ2 A;  1OOP C;  4CU8 A;  1KJR A;  4EE2 A;  2VW2 A;  2FCV A;  5CKM A;  3MF6 A;  5AC9 2;  2WIN B;  1RIT A;  1FOD 2;  3G6J B;  4YYO A;  2GP3 A;  3GGL A;  3LB9 A;  4XMA A;  1CZV A;  1WLT A;  3I59 B;  1FNY A;  3JQX A;  2GAL A;  5L7O B;  2UWA A;  4OMD A;  2WLQ A;  1A3K A;  4HK8 A;  5DDJ 3;  4J25 A;  1TQ5 A;  2GC3 A;  4DUX A;  4GH4 B;  5J09 A;  4Y20 A;  1US3 A;  3JUU A;  2FDI A;  5K7P A;  2DTY A;  2IFR A;  5JOW A;  1Y7B A;  4MLO A;  4QPG C;  3AFG A;  1R1A 1;  3DPR B;  3H8U A;  3GZT B;  4EZ4 A;  3E6B A;  2XLF A;  2QE3 A;  3HN3 A;  3ST7 A;  1ZZ7 A;  4EN6 B;  4NMI A;  2GDF A;  2WT0 A;  1YLL A;  4HMZ A;  3H8X A;  3RDI A;  3AL5 A;  1AR8 3;  1OLQ A;  2AEZ A;  5L7O A;  3FHI B;  4IND A;  4AED A;  3VBH C;  5FP3 A;  4IV1 C;  5IYY A;  4R9B A;  2P5B A;  1UAI A;  2NQY A;  2B5H A;  1MEC 2;  2W39 A;  3MID A;  3POW A;  4KI5 M;  5A3L A;  5ISL A;  2P3K A;  1MS0 A;  3K75 B;  5ACA 2;  3DKQ A;  2VPV A;  1O4Y A;  3KT4 A;  4U36 A;  2ZKN A;  1WLC A;  1G9A A; 
#chains in the Genus database with same CATH homology
 2WAB A;  2VZ1 A;  1T2X A;  4A3Z A;  3HPN A;  3JXS A;  3NRU A;  1US2 A;  2V72 A;  2W87 A;  2ZEY A;  1GMM A;  4KMQ A;  2VZ3 A;  2VZO A;  3K4A A;  5JXJ A;  3ECQ A;  1GU3 A;  1PMJ X;  3I2K A;  2WAA A;  3VD9 A;  2WBK A;  3THC A;  2YFU A;  4JKM A;  3MO4 A;  2JDA A;  2ZEX A;  4DUV A;  3HNB M;  1SHW B;  5DMY A;  1DYO A;  2VJX A;  5DPN A;  2VZQ A;  4MO3 M;  4CUC A;  2BGO A;  4TXW A;  1NKG A;  1JU4 A;  1K12 A;  4DEV A;  2W92 A;  4UAP A;  1UY0 A;  2Y6K A;  1YQ2 A;  4A41 A;  2WO3 A;  4LPL A;  4D0Q A;  4M4R A;  2W1U A;  1KEX A;  2VQT A;  3NJV A;  3CIH A;  3FHQ A;  1OF4 A;  3FL7 A;  4CU6 A;  3THD A;  3W5N A;  3CZU A;  2YC2 A;  5J1X A;  2QQL A;  2VMF A;  2VZP A;  2X05 A;  4BJ0 A;  3CQO A;  4QX2 A;  3WNK A;  2W94 A;  1EUT A;  3EB7 A;  2WZE A;  3C7O A;  4AAX A;  3DYO A;  4QPW A;  3IDA A;  2W5F A;  3J7H A;  5C70 A;  1HN1 A;  2B4K A;  4CVU A;  1R64 A;  3FHA A;  4ARY A;  1XC6 A;  2WQ8 A;  3ETP A;  1O8P A;  2VM9 A;  4LQR A;  3K4D A;  2VTF A;  4A4A A;  1L7R A;  1PMH X;  1IQD C;  2E32 A;  4DXS A;  2C4X A;  4P00 B;  3UNP A;  1J84 A;  4W8J A;  3UES A;  3IB3 A;  4A45 A;  3LEK A;  3NNG A;  1GNY A;  2QQO A;  2KD7 A;  3WNL A;  2Y6J A;  4ZXE A;  1GOG A;  4ZZ8 A;  1L7Q A;  3LEI A;  3LEG A;  1CZT A;  2BGP A;  2OKX A;  3A7Q A;  2YG0 A;  3ACF A;  2WO2 A;  4ARX A;  5LA1 A;  4ET7 A;  2VO5 A;  3K46 A;  3T0A A;  2EIE A;  3GXU A;  5CYY A;  4M4P A;  1W9T A;  1JZ6 A;  3VD5 A;  2YB7 A;  3VD7 A;  2J7M A;  1TVG A;  3WNN A;  1H6X A;  5F7U A;  3HOB A;  3VD4 A;  2WDB A;  1GOF A;  4LHS A;  2EID A;  3HEI A;  4QB2 A;  2WUH A;  2J1S A;  2W3J A;  3SEP A;  3HNY M;  4AG4 A;  1ULO A;  1KGY A;  1UYX A;  3W5M A;  3I97 A;  3I2F A;  1JZ4 A;  3NJX A;  3WNO A;  2CDO A;  5LA0 A;  4GZ9 A;  1UWW A;  3WNM A;  2WAO A;  4BK4 A;  3LPF A;  3LE0 A;  2J1T A;  3CZJ A;  1GUI A;  3OGR A;  3I2J A;  1RYY A;  2DDU A;  4LKS A;  4XUO A;  4QAW A;  3MV1 1;  3DYP A;  2VZU A;  4CU9 A;  3ACI A;  3UET A;  2W91 A;  3OBA A;  3T0B A;  4OMC A;  3LPG A;  5IHR A;  3VDC A;  1W9W A;  2QQI A;  2WYS A;  1W8N A;  3FN9 A;  5EIY B;  2RJ2 A;  3DYM A;  1UX7 A;  1UZ0 A;  4E8C A;  5DN2 A;  2DCJ A;  1JYV A;  2J1E A;  3WSO A;  3A23 A;  1JZ2 A;  2L9L A;  4PT6 A;  2XHN A;  1UY3 A;  1D7P M;  2LS6 A;  5B4X A;  4QB6 A;  3OEA A;  2CDP A;  2VCC A;  1NAE A;  2QBX A;  4QDQ A;  3C7H A;  4UI9 L;  4IUG A;  3F2Z A;  5DQ0 A;  2W1Q A;  4P08 A;  4QX0 A;  5CZK A;  5IFT A;  3VDB A;  4GWJ A;  1O8S A;  3CKH A;  4KWU A;  4DEQ A;  1P8J A;  4BK5 A;  5I0D A;  4CUA A;  3WF4 A;  4JKL A;  3AC0 A;  3LQC A;  4MOA A;  2EIC A;  4QX1 A;  3MUZ 1;  3SKJ E;  2E33 A;  3HJR A;  2J22 A;  4BXS V;  2VCA A;  5LCW L;  5G04 L;  2Y8K A;  4XUQ A;  1J83 A;  3NQH A;  3WF1 A;  3I3D A;  5HPO A;  1F4A A;  1DP0 A;  3OGS A;  3P1I A;  5FUI A;  3VD3 A;  1UYY A;  3GM8 A;  2XON A;  3U37 A;  5EJ1 B;  2JE8 A;  2JD9 A;  4DXR A;  3MV0 1;  4CUB A;  3WF0 A;  1W9S A;  4QX3 A;  3BN6 A;  2V5D A;  3OEB A;  5A1A A;  1XPW A;  1K45 A;  1GOH A;  3C7E A;  3OG2 A;  2VL4 A;  1JYX A;  3ABZ A;  1MPX A;  1XNT A;  4P02 B;  2QQM A;  4QB1 A;  3SEE A;  3T2O A;  2RV9 A;  2Y6L A;  3ACG A;  5LA2 A;  2J1R A;  2QQN A;  2VMD A;  5JXI A;  1W99 A;  2WO1 A;  2HLE A;  3VDA A;  4DUW A;  5JUV A;  2Y64 A;  1LNS A;  4JHZ A;  2C9K A;  1JZ8 A;  2B9V A;  2J1V A;  4A42 A;  3III A;  2J1A A;  2C26 A;  5JMO A;  4MGQ A;  2X10 A;  2Z4F A;  3P6B A;  4L0P A;  4PF1 A;  2ZEZ A;  2ORX A;  4OYU A;  3IAP A;  4GWI A;  4UOJ A;  4XVH A;  4E8D A;  5C71 A;  4RYD A;  4D8M A;  2XQX A;  1UMH A;  1UXZ A;  1NX9 A;  3C7G A;  4QDS A;  1F4H A;  2QQJ A;  1JU3 A;  4XUT A;  5G05 L;  3ACH A;  3CDZ B;  1SDD B;  2LW8 A;  5HXM A;  3C7F A;  4XZU G;  4OZO A;  1UY2 A;  3WF2 A;  4DXT A;  2ID4 A;  3WNP A;  3MUY 1;  1PX4 A;  2W95 A;  3T08 A;  4W50 A;  2PQS A;  2VZT A;  1BHG A;  3BGA A;  4CU7 A;  3A22 A;  2BER A;  1UYZ A;  2JKX A;  2ORZ A;  4FI9 A;  1JZ7 A;  1PX3 A;  2ZXQ A;  5EJZ B;  1W0N A;  1O59 A;  3T2Q A;  2YC4 A;  4OUE A;  2W1W A;  4P5Y A;  1OT5 A;  1JYW A;  3I2I A;  3SKV A;  1CIY A;  3MBW A;  1JZ3 A;  2W46 A;  3WEZ A;  1OD3 A;  4YPJ A;  1UXX X;  3HNM A;  1SG3 A;  3PUH A;  1CX1 A;  2XOM A;  1ULP A;  2VCB A;  5B4N A;  2J1U A;  2E26 A;  3T2P A;  1W8O A;  4XUN A;  4W4Z A;  1UY1 A;  2E31 A;  4HG6 B;  2HYX A;  4ZY9 A;  4MAD A;  1DLC A;  2WZ8 A;  1K3I A;  4RN5 A;  1TG7 A;  3CMG A;  2VOT A;  3I3E A;  1I5P A;  2EIB A;  2W1S A;  3I3B A;  3GDB A;  2WN3 A;  2RVA A;  1GQP A;  1UY4 A;  2DCK A;  2YFZ A;  1NUK A;  4XUP A;  5C7G A;  2R7E B;  5JR2 A;  2VZR A;  3D3A A;  1OF3 A;  5IFP A;  2VR4 A;  3C8X A;  3K4Z A;  2VC9 A;  3I2H A;  3EYP A;  3I2G A;  2QQK A;  3WQB A;  2X09 A;  2WN2 A;  2VMC A;  1JYN A;  2VZS A;  3E1F 1;  3K77 A;  2VZV A;  1K42 A;  1H6Y A;  3T0D A;  4JX0 A;  4QDR A;  4BDV B;  1CZS A;  3ZM8 A;  4CU8 A;  4JKK A;  2BZD A;  1WCQ A;  4PQQ A;  2Y6G A;  2V4V A;  2VQU A;  3WF3 A;  3A21 A;  3GGL A;  1CZV A;  3DEC A;  2BBA A;  1JI6 A;  4OMD A;  1JHJ A;  2W9X A;  4A6O A;  4DUX A;  1US3 A;  4A44 A;  5JXG A;  1JZ5 A;  3T09 A;  1WKY A;  4ZZ5 A;  3HN3 A;  1EUU A;  4TTG A;  4XUR A;  3IAQ A;  1OH4 A;  3OB8 A;  2VME A;  2Y6H A;  5IYY A;  4MGS A;  4Z2A A;  5JXH A;  3OGV A;  4KI5 M;  2ZEW A;  3K75 B;  3PUI A;  5IJR A;  1XNA A;  2W47 A;  1UMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...