3GGLA

X-ray structure of the c-terminal domain (277-440) of putative chitobiase from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr324a.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
DTYTGFCIIKEGTKISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPIGRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Putative chitobiase
publication title Northeast Structural Genomics Consortium Target BtR324A
rcsb
source organism Bacteroides thetaiotaomicron
total genus 30
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3gglA00
1JZ7A 1GNYA 2WUHA 2VTFA 2CDPA 3VD9A 2QBXA 2BGOA 3DYPA 2C26A 1BHGA 2WAOA 2J1VA 1UWWA 4PF1A 4OMDA 4A44A 1O8SA 1P8JA 1I5PA 3NJXA 5JMOA 1GQPA 1OF3A 3FHQA 3VDBA 3FHAA 4OUEA 1XC6A 2YFZA 5G04L 3K4DA 1JZ8A 1UXXX 3OBAA 2V4VA 1PMJX 2VZSA 2RVAA 2VZPA 1GOFA 3WNMA 3FN9A 2ZEYA 4LPLA 2VZRA 1JZ3A 3GM8A 3J7HA 3OGSA 4CU6A 1JU4A 3UETA 4HG6B 4E8DA 1D7PM 4PT6A 1UY3A 2WZEA 2V5DA 2HLEA 5G05L 2YFUA 2VZQA 3P6BA 2EIBA 4QB1A 2X05A 2WN2A 3UNPA 1TVGA 5JXJA 3HN3A 3T09A 3I2KA 3VDCA 2ID4A 1HN1A 3I2GA 2JDAA 3WF3A 5EJZB 3MUY1 4DEVA 3CIHA 2YB7A 4XZUG 4D8MA 3K77A 4W50A 3C7OA 4MGSA 4QX1A 3WNPA 3IDAA 4LKSA 3UESA 3ACFA 4TXWA 2VZ3A 3IAPA 5A1AA 1MPXA 4JKMA 1UY2A 3ETPA 2VMEA 1GMMA 4GWIA 3OGRA 4LHSA 1NKGA 2X10A 2VMCA 2XHNA 2WABA 5JXIA 3IB3A 3VD7A 4ARXA 4XUPA 1W9WA 2ZXQA 2QQMA 1JI6A 2JD9A 3HNBM 5F7UA 3OG2A 1J83A 3K4ZA 3GXUA 1US3A 1JZ2A 1H6YA 2EIEA 2J7MA 4QDQA 3HEIA 4PQQA 2W46A 3ZM8A 1WCQA 4MOAA 2ZEXA 2W9XA 4E8CA 1UYYA 4P00B 4D0QA 3FL7A 3I2JA 1KEXA 2Y6LA 4ZY9A 1GOGA 5IJRA 4DUXA 1K42A 1UYZA 4ARYA 4DXRA 1NAEA 3A22A 4A3ZA 4CUBA 2VQUA 3THCA 4BK4A 4UOJA 2EICA 3MUZ1 5C70A 2DDUA 3A21A 3EB7A 5DN2A 3T2QA 2WQ8A 2VZVA 5B4XA 4CUCA 1JHJA 2J1AA 1JZ6A 2YC4A 5DQ0A 5JXGA 4OYUA 4DUVA 4A41A 2E32A 4P02B 4UI9L 5CYYA 4DXTA 4QX3A 1EUUA 3I3DA 4LQRA 2PQSA 2QQJA 3T2OA 2Y64A 4MADA 4BXSV 4A6OA 1UX7A 1RYYA 3A23A 4BK5A 3PUIA 1UY1A 4ZZ5A 3I3BA 1GU3A 1US2A 2QQNA 5FUIA 2W5FA 3MV01 1CIYA 2OKXA 2QQIA 3WEZA 4QDRA 3WF0A 1F4HA 4W4ZA 5IFPA 2Y6HA 2Y6JA 3F2ZA 1JZ5A 5IYYA 4ZZ8A 2DCKA 1OT5A 3P1IA 3VD3A 3WSOA 3JXSA 3I2HA 3CKHA 2VR4A 2W3JA 2VL4A 3DYMA 4MGQA 5LA1A 3ECQA 4P08A 4M4PA 3NJVA 2VMFA 1UMHA 2ORZA 2Y6KA 3OEAA 1UYXA 3SKVA 4DXSA 2XONA 4QPWA 3LQCA 4QAWA 4ZXEA 3T0AA 1SHWB 3WNLA 2BGPA 1H6XA 1JYNA 3VD5A 3OEBA 3CDZB 5LA0A 2VC9A 5C71A 1LNSA 3WNKA 4A4AA 2DCJA 5I0DA 3CMGA 4JKLA 4XVHA 1R64A 4QDSA 2QQKA 3T0DA 1K45A 1W8OA 3W5NA 4DEQA 1W9TA 2RJ2A 2L9LA 5LA2A 1JYWA 1DYOA 4A42A 1F4AA 1UXZA 1DLCA 5EJ1B 3PUHA 5DPNA 3WF4A 4KWUA 3THDA 2XOMA 1W9SA 2C9KA 3ACIA 2EIDA 2E33A 3C8XA 4XUOA 3C7FA 4KI5M 3SEPA 2J1EA 3WF1A 1ULPA 1W0NA 4P5YA 2ORXA 1XPWA 4CU7A 1IQDC 2VJXA 2W92A 1XNTA 3BGAA 1K12A 2J1SA 1SG3A 2VQTA 2J1UA 2Y8KA 1OF4A 1ULOA 1UZ0A 3IAQA 4CU8A 2HYXA 1JYXA 3HNMA 5LCWL 2WYSA 3CQOA 3C7EA 4QX2A 4KMQA 1JYVA 3DYOA 2ZEWA 3WNNA 1YQ2A 1CZSA 3CZUA 3HJRA 3LE0A 4BJ0A 3ABZA 2YG0A 2WZ8A 1SDDB 4AG4A 2JE8A 2VM9A 1CX1A 4XUTA 4OZOA 4XURA 1TG7A 3LEIA 2VZOA 4QB2A 1JZ4A 2VZ1A 3I2FA 2RV9A 2WBKA 3I3EA 3NRUA 2W47A 3EYPA 1L7RA 1O59A 1OH4A 5HXMA 1WKYA 3E1F1 4JX0A 3U37A 5IFTA 3I97A 1L7QA 5B4NA 2V72A 3CZJA 3MBWA 3MO4A 4GWJA 2VZUA 3T08A 3ACGA 4TTGA 3HOBA 3SKJE 2B9VA 4XUNA 5HPOA 2W94A 2WDBA 3IIIA 4UAPA 2X09A 1GUIA 4QX0A 4CUAA 2QQLA 3LPFA 2B4KA 5IHRA 4MO3M 4XUQA 1PX3A 4AAXA 3C7HA 4IUGA 2W91A 2WO3A 2E31A 2WO2A 2LS6A 5EIYB 1OD3A 1PX4A 1W99A 2WAAA 2VCAA 3A7QA 3VD4A 3C7GA 3HPNA 2WO1A 1K3IA 2W1QA 2W95A 1CZTA 4A45A 5JXHA 3LPGA 3OB8A 1CZVA 3D3AA 4GZ9A 4YPJA 2C4XA 2J1TA 2W87A 3K75B 4Z2AA 2VO5A 4ET7A 4QB6A 5JUVA 4DUWA 3AC0A 3SEEA 4FI9A 1KGYA 4CU9A 2J22A 1UMIA 3LEKA 4OMCA 4L0PA 1PMHX 2WN3A 3MV11 3WF2A 4JHZA 4RYDA 2R7EB 3GDBA 3NQHA 1UY0A 3I2IA 2CDOA 2BZDA 1NUKA 4BDVB 1EUTA 3OGVA 2VMDA 3BN6A 3NNGA 1UY4A 5DMYA 2BBAA 2J1RA 2W1SA 5J1XA 5JR2A 2VOTA 4CVUA 2Z4FA 4RN5A 4W8JA 3T0BA 1DP0A 1XNAA 2QQOA 3WNOA 1T2XA 2LW8A 3DECA 1O8PA 3HNYM 1W8NA 2VCBA 3GGLA 2XQXA 3K4AA 1NX9A 2KD7A 2ZEZA 3WQBA 5C7GA 2W1WA 4M4RA 3LEGA 1J84A 1JU3A 2BERA 2VCCA 5CZKA 2E26A 3T2PA 2W1UA 2YC2A 3W5MA 3VDAA 2VZTA 2JKXA 3K46A 2Y6GA 4JKKA 3ACHA 1GOHA
chains in the Genus database with same CATH superfamily
2WNUC 3FUQA 3QCWA 4AVBA 5I8YA 2AGSA 3NNMA 5DABA 2VTFA 4LMFA 2CDPA 1HB1A 4GMP0 3W58A 2C26A 2XB6C 4LR4A 1UWWA 4A44A 3BOPA 4IGQA 4CP2A 3TNPB 4COUA 1O8SA 2CWSA 1AZDA 2FCUA 5A1FA 1S2KA 4XAAA 1W2NA 1VBB2 5BNOB 4RGAA 2HEWF 4P9YA 1KS5A 3H3UA 1VBC3 2EXKA 5JMOA 3NMBA 1XNDA 3PURA 1EV13 3TN91 5IATA 4DFSA 1Q3EA 4WM8C 2DCTA 1MZEA 4UW6A 3QACA 2A75A 3NAPA 1OLQA 2LTNA 3FHAA 3S30A 4B29A 1ENQA 5A7OA 1JUIA 2YFZA 3K4DA 4MG2A 2YZ4A 4IEVA 1WZXA 2HKXA 2XUMA 1DGWA 2V4VA 5FKCA 5FZHA 3UJOA 2VZSA 5C4WA 2RG4A 1Y9GA 2GAUA 4FP2A 4QXCA 2DU1A 2VZPA 4CUGA 1PIV1 1FNYA 1CAXA 4XF9A 1ND2A 1AYM3 2XL9A 1UOFA 3H7YA 4IERA 5DZGA 1OKQA 3MIFA 2VBDA 1RUD2 4ASLA 4AWDA 4ORFA 4QPIB 2YHJA 3BKZA 1W2OA 4CU6A 5E6HA 1S1AA 2BVBA 4LBOA 4QQPA 3THDA 4YYOA 3ZR6A 4E8DA 4Z1VA 3B5LB 4PT6A 5FY5A 5ABJA 2NLRA 1UY3A 3ZYBA 1V70A 4HLTA 2GN3A 1AXYA 3VBOA 5G05L 1Z78A 2YFUA 4QM9A 5FZKA 3KT4A 1SDWA 3WG3A 1QJFA 2VZQA 5L19A 2EIBA 4DIQA 1DHKB 2RR13 2IVJA 1HXS1 4CDWB 3DGTA 4MXWB 3WDUA 4CDQC 3UNPA 4GH4A 3BYWA 1A8MA 1DQ6A 3AZWA 5CBLA 4I2OA 1XYPA 4UF0A 3DPRC 5EJZB 3R4SA 4N9IA 3CIHA 4OFGA 2DYCA 2X5IB 4RQPC 2BRTA 4WVZA 2AC1A 1OURA 3HBZA 2DUQA 1E5IA 4W50A 1E5SA 5F5AA 4Q4Y2 4MGSA 1M4WA 3GCWA 3PTYA 5K0UC 2PAKA 5FMDA 5FZDA 5T52A 4UFJA 4YZ1A 1QJEA 4AHZA 1JBCA 2RS51 5BNNA 2VNOA 5A1AA 4HL0A 5FOJB 3BIEA 1DFQA 3SH5A 3AYDA 2R32A 4IEPA 2GMPA 2C24A 4JKMA 4DRVA 1I5ZA 4JC1A 2JENA 1C8M2 1GMMA 1Q8SA 3LDRA 2VW0A 4QXBA 3OGRA 4LHKA 4LHSA 5F3CA 1UN1A 3IM0A 1BYHA 4AE2A 2VE1A 2VMCA 4FPJA 2WABA 3UV9A 4LXLA 1PHMA 3ZLIA 1Y4WA 2JB8A 4I09A 5EPAA 5C6CA 3H0OA 1V9U2 5EYXA 1JI6A 1J58A 1Z0HA 3HT1A 4MUVA 4YVWA 2BDRA 2O0OA 5EP9A 3ZSJA 5KWRA 3A0KA 4RR3B 1REDA 1ULCA 5IWFA 1W0PA 5C8WA 1L7LA 3AP9A 3IDEA 4JGYA 5FMBA 3OYWA 2H0BA 1IHMA 3GXUA 2ZGRA 3N3HA 1BQPA 1JZ2A 1C5IA 1YEWA 2J7MA 3ZPYA 3HEIA 2W46A 2HWC2 4XF1A 5T55A 2YPDA 4MOAA 3O1MA 1EY2A 5BNPC 1UYYA 1RUC2 3AZZA 4P00B 3LOBA 4MGIE 3GYDA 1KEXA 5FZ8A 5BPXA 1FMD1 5IJRA 3ZFFC 2RDQA 2ZGSA 3IDBB 4AI9A 2YBKA 2Y26A 1S0DA 4WM7B 4OI1A 1HB4A 3ALQA 2EXIA 3JD72 4N7UA 3WV6A 1YFYA 5J09A 2WZR1 3L2HA 3POFA 3VBUA 2RS32 1ZBE1 3GNEA 2VQUA 4X8PA 4O9EA 3LSEA 4XTMA 4UOJA 3ROUA 1RUG3 3E6CC 4XQ4A 2BJSA 3AZVA 4YWAA 3CJIC 5C70A 3D0SA 1XB9A 2DDUA 1ULDA 2ZKLA 4V2WA 5JOXA 1VRH3 3WY6A 1ZA7A 4KWKA 2G1MA 1XXNA 3T2QA 2WQ8A 3OGGA 5J98B 4FPOB 1UOJA 2ZKNA 1FOD1 2WLQA 3AZYA 1SQ4A 3I7DA 2WS92 5FUNA 4AEDC 3O1VA 2G4IA 3DUIA 1ZZBA 3FUOA 3T30A 5A3NA 2CU5A 2Y60A 1LOEA 1JYIA 4M3CB 4IV1A 1V0AA 3EQEA 1U5ZA 2E7AA 4GB32 3OY8B 4QX3A 3I3DA 4LQRA 4G3YC 5GJ6A 2JECA 1QH6A 4IEYA 2Y64A 2AREA 1Z7S2 2UURA 1W6MB 2FCTA 1CWPA 4S2GA 2WNUA 3MPBA 4XFGA 3WDTA 4D7TA 2W08A 3PUIA 1UY1A 4ZZ5A 1RUF1 3I3BA 1LOFC 1WD3A 2ES3A 3BIWE 2YDEA 1CAUA 2RDSA 5FZ3A 1NY71 2ARAA 2B45X 3MPPG 2OKXA 4O9GA 3WF0A 5FBZA 2V5YA 5IFPA 1VRBA 1SFYA 1XNKA 3MZHA 4COYA 3F2ZA 1JZ5A 4CPBA 4AVSA 3I2OA 4LULA 2DCKA 2WRAA 1GICA 1ZZ6A 1OA2A 3MEPA 3P1IA 3VD3A 5DAWA 2VH9A 1AR62 1DQ2A 3OPTA 4XE9A 5DDJ2 5SV8A 1O4ZA 2DUOA 1Y43B 4YW4A 4ASKA 4FSJA 3GBWA 4AYUA 1LU2A 1QY4A 3GHMA 4RA0A 3O1SA 5LA1A 1MQTC 4P08A 1TE1B 2XQRA 1QJX3 3NJVA 5FYIA 3N7MA 3V64A 1UYXA 3FE5A 4BQ5A 1RXFA 4MH0E 2GZWA 5BUVA 2X29A 4LBQB 4QPWA 3KV5A 4EN7B 3CEWA 4QAWA 3SCFA 1UZZA 4AHXA 2R043 3T0AA 1YIPA 2BGPA 4CEYB 4C1XA 2G9GA 1ZREA 3CDZB 2VOXA 2CGOA 3LZZA 3SXWA 2DVGA 4RHV3 1KD7A 1POV1 2WA4A 3AXEA 4UBGA 1UKGA 3WNKA 4BPZA 5IVCA 2OQ7A 3H8XA 4A4AA 1RMU1 5I0DA 5JOZA 1UW8A 1IPSA 2Q5TA 1LAJA 4PJYA 3H50A 5D8AC 2ENRA 5DAQA 1YHFA 2DTYA 4Q4V3 3T0DA 1PK6B 1GZ9A 4Y5Z0 1W8OA 2B42B 1SEFA 1UMZA 1B35B 4DEQA 3WDWA 3AFKA 3EHKA 2Q8EA 1HRI2 1W2TA 4QKFA 2L9LA 5F9TA 4HXCA 4K3UA 2R30A 1OQEA 1WW5A 5A3PA 4CDXC 3POEA 4CDQA 1N47A 4NPMA 2RDRA 1Q8QA 2D6NA 4P5HA 5A3UA 4QGMA 2XOMA 1W9SA 2C9KA 3DPRA 1G7YA 4GULA 4XUOA 4BE3A 4N43B 4AFDA 3C7FA 4NE9A 1CD3G 1N3QA 1PGW2 5LBFA 3MHZA 4RQPA 3SEPA 1DCSA 1EAH2 3CBNA 2HEYF 2JD4A 4XXAA 2ORXA 3A4UA 4Q27A 4QQ2A 4RS5B 5K0UA 4HN1A 1TQ5A 1XPWA 2R073 2JG9B 2YXSA 1FI2A 4AHWA 5GZFA 3U0ZA 3NVCA 3MGUA 5EJ3A 1UAIA 3I3QA 5GLUA 1RTVA 1AR93 1SBFA 5FZAA 2YMZA 1K12A 3KQRA 5L9RA 1NCQB 2J1SA 3UGFA 3E97A 5FZIA 1SG3A 2QQVA 3AJZA 2XGXA 2C9AA 1YC61 1ASJ1 4YW2A 1LOGA 4XBQA 4HVQA 1ULOA 4S2HA 4LK6A 1AX1A 3KGLA 3HNMA 1LRHA 1JYXA 2HWD1 4OQ9A 4AFAA 4R8HA 3RS6A 4LBQD 1N1SA 4HN0A 4OULA 4ZKTB 3W20A 3URFA 4K21A 3D4KA 4NUBA 1IS3A 1ZYBA 3ZFEA 1WD4A 1G6NA 4FQZA 4D3WA 1GQGA 2DFBA 5ERLA 5C3RA 3OD0A 1TNFA 1NQJA 2H6BA 3CZUA 3FLRA 3ABZA 1Y3TA 1LOCA 3QLQA 4P9JA 4TLGA 1V6IA 5I93A 4PLMA 1JW6A 4XIOA 2YC0A 5J3UA 1VBC2 1ZRIA 2WZ8A 3PMEA 4UFKA 3V65A 3ZYJB 1PO21 2P6HA 1EV12 2BFUS 5KXBA 2VPVA 3VBFC 1PVC3 1GZCA 2K0GA 3U78A 5BNPA 2JXAA 3R4DB 4IE6A 2WBKA 1LHOA 5FREA 3NO8A 3AKSA 4H14A 1JHNA 2VGDA 4I02A 2EF6A 3PU8A 1C3HA 3ZFFA 1L7RA 1O59A 1SFPA 2ET1A 3I59B 4LBKA 1WKYA 4GKXA 1HQWA 4JX0A 1HRV1 1PO13 1VJ2A 4TWTA 5KHGA 2XDVA 1VIWB 2V72A 3CZJA 3MBWA 1W8TA 1AYM2 1NOVA 2VZUA 3T08A 5EQUA 1HV1A 4CCEA 2XJUA 1D0HA 2CAVA 3E6BA 3GCXA 3CJIA 3SKJE 3GALA 1Q8OA 2X09A 4CUAA 4A7KA 4EN9B 2AENA 4M3CE 1ACCA 3VL8A 2XHKA 3LPFA 5IHRA 2VNRA 1ND3C 2XXZA 3C7HA 5FZ9A 1O5UA 1SLAA 2RS13 3KVBA 5FK7A 2WO2A 3VHPA 1OD3A 4QT6A 4CCCA 1TME1 2B46X 4M0NA 5FZOB 1KQRA 2WAAA 5FWEA 2W2IA 2VCAA 3QH7A 3A7QA 1QH7A 5FY0A 3WX5A 3TEWA 4PF5A 1QNWA 5JXHA 3AMHA 1H1IA 3LDBA 4QX8A 1LOFA 5FZBA 4XYXA 5T5OA 3VHOA 3ZYHA 4AVVA 3VBRB 4JCKA 5J96B 5JPMB 2J1TA 1RUD3 3K75B 2VQAA 1W03A 1TNRA 2IXIA 4ET7A 4A6SA 4QB6A 3VUOA 1UO9A 3DXUA 1OVSA 3KMHA 4FI9A 2P1BA 1LHNA 4RSUA 4WZFA 1VMFA 4COZA 2DUPA 4CCMA 3HAGA 1J1LA 5JMCA 5FZ6A 4OVEA 4JGZC 3RYRA 4CU9A 3LEKA 4YVSA 4N53A 2OXBA 4NIAA 2OYZA 1LODA 3ZYPA 4L97A 3WF2A 1AYN2 1G9FA 5L73A 5C5TA 4QMAA 1MQTA 2JB4A 5LY2A 3BU0A 2A70A 1TMF3 4DMIA 1ENSA 4YM0A 5KHHA 3PUQA 3MLKA 1GZWB 4AVTA 4CP9A 2WQZC 3I2IA 1VBA1 4NIDA 2CDOA 2BZDA 3B94A 4AVCA 3Q9OA 4FFHA 2NZ9A 4L2NA 2VBBA 3MYXA 4IV3B 4MGKE 3RG0A 4ZU4A 1W2AX 2J1RA 3ZXDA 4X8NA 5J1XA 1LHUA 5JR2A 2BPA2 2VOTA 4LBJA 4UFMA 4CVUA 4YZ2A 3S57A 5FDBA 4NR1A 5D8AA 4D6SA 5LY1A 4RN5A 4W8JA 2BTVC 4I0WB 1DP0A 1XNAA 2ZX3A 5ANQA 2QQOA 3PL0A 3KCXA 4JVAA 4RD7A 3ASIA 2RM23 1DU3D 2HWF2 3DECA 1O8PA 3HNYM 2LRPA 5DZEA 1JYTA 5FZLA 4CDXA 1VAMA 1RUG2 3AMMA 1V9U3 4KQ7A 3I49A 1RVF3 4ZS2A 1NCRC 1YLLA 1H2MA 2LALA 2OUHA 5FPZA 1VRH2 1YWKA 5C7GA 3KCYA 4BLJA 4ZU7A 2R1BA 4AOCA 2XKOA 2W39A 3IKWA 3R6SA 5A6ZA 1H2NA 4WV8A 4DB5A 5HXVA 2BERA 1WW6A 2VCCA 4GAZA 5CZKA 1CJDA 1F5JA 1W3XA 2EAKA 2CY6A 2ZABA 3LIHA 4RFRB 3TRSB 1WMDA 2ERFA 1RUJ3 2W1UA 4M00A 4WBBA 2I07B 5IVBA 2DVDA 1FV3A 3W5MA 1VBB1 1RUC3 4HONA 4Q8KA 2EXJA 1KITA 4JKKA 5FPLA 5FR3A 3POGA 5FPVA 1NXMA 5BY5A 4BOWA 1JZ7A 1LKNA 1K5MC 1R1A3 1W6OB 1X50A 2XJRA 4KG8A 1DIWA 2ET7A 4BMBA 3VBSC 3VD9A 4B1LA 3PDQA 1QJU1 5CKQA 2PLV3 3DYPA 4FXGB 2CGNA 3H3ZA 1DG6A 1UQXA 2RS33 3L2YA 2MPFA 4D94A 2OPWA 2P2KA 3H3LA 3Q8EA 1AR72 3BB6A 5F32A 2PMWB 2LM3A 4Z8BA 4L99A 1RUH3 3IN9A 4OI2A 2MNGA 2XH6A 2ZZJA 4XJZA 1QJZA 2BUKA 1RJ8A 3OCPA 1I5PA 4C91A 2BP6A 5SV5A 1PNFA 2KR2A 3KT1A 4FAGA 5A32A 2WS93 4D6QA 3AX4A 2A1XA 3WG4A 1KJLA 3A0NA 1O3RA 4PDWB 5KC5A 1H2LA 1DZTA 1QF3A 3PIGA 3S7IA 5KR7A 3VBFA 4YW1A 4UF0B 2Z2SB 3AJYA 4OUEA 4LITA 4XF3A 1W39A 2D40A 1T6GC 1SMVA 1JUHA 4HVRA 2OZ6A 4JAAA 4P9GA 5G04L 3USUA 4OCTA 4B4QA 5GZCA 4U2AA 2LROA 4C90A 1W05A 3VZLA 1G9DA 1SLLA 2RVAA 5CFCC 5FQ0A 2KXLA 1FATA 5IVEA 3AFGA 5A33B 4LO6B 2Y6FA 1W6NA 1FPN3 3ITQA 2ZEYA 1O4YA 3WZ1A 1JODA 1I9RA 4LPLA 4ES9A 1JZ3A 4YARA 3RYKA 1STMA 4Y24A 4QKBA 4RHV2 1JU4A 1OSGA 1W8FA 3IWZA 4AI8A 1JH5A 1CAWB 1J3RA 2IWGB 4AW7A 4Q4Y1 4X6QB 5GLWA 2WZEA 1J1TA 4Q4V2 5HCBA 1W6QB 2O14A 3P6BA 4E4SA 1NA1B 3EO6A 4PIZA 5JWPA 1O3TA 1AR63 2D98A 1VPHA 3RZZA 1ND3A 2EA7A 2WN2A 3ME2A 4Y1ZA 4DXZA 4FP3A 5JXJA 1C8M1 3T09A 2WNVC 3VDCA 3VZOA 5CAZA 3I2GA 1OPMA 4GWMA 4R9CA 4JZRA 4XACA 4Y33A 5E16A 3WF3A 3OPZA 4DRRA 1BBT3 4XFAA 2RMU1 4JGYC 3TB0A 3C7OA 3USSA 4QX1A 4XIKA 2PQQA 3EBRA 4IESA 3MW3A 2XLFA 3AP6A 5A7SA 3D82A 4ISRA 4IGPA 3AL5A 1ZRRA 2ILMA 4AVAA 3ZDSA 2V73A 3WVJA 5JCTA 1RHI3 3SC7X 2VMEA 4BQ4A 2RJKA 5IK8A 1LGCA 3FBYA 4O7XA 1GV9A 1AR92 2VNGA 4GWIA 3ZX7A 4XFCA 4P9LA 1QDCA 4HOOA 2HWC1 1BCXA 2XHNA 5AC93 5F5IA 3SH4A 1REFA 4ARXA 4JV4A 4JGZA 2IXHA 4DY5A 1NXD1 1KXGA 2GSYA 2PHWA 2ZXQA 3E6DA 2JDZA 5A7WB 5IVJA 2JD9A 2R16A 4NPLA 3HQRA 5E8AA 1SACA 2G9ZA 1UD1A 1VBE1 2WIIB 5F7UA 2WKKA 2Z79A 5JPNB 3JD71 1OOPB 3LIGA 5CNAA 1VMJA 1W9FA 4R4XA 1MZ5A 4JHTA 1R1ZA 1COV3 2EIEA 3J4UH 4LKFA 4QDQA 3PVEA 4IV1B 1KS4A 3ZM8A 1WCQA 1ULGA 3WHTA 2ZEXA 1WLTA 2W9XA 5F2WA 5FP4A 4E8CA 4FTEA 1VLNA 1UIJA 1PVC2 2OIIA 4QM8A 4XQDA 3VDDB 4D0QA 3CHXA 3FL7A 3I2JA 5DXDA 4CXYA 2Y6LA 2D97A 2JG8A 4ZY9A 4LLFA 3T2TA 2VVEA 1R093 3L9JT 4EN8B 1UYZA 5F3GA 1GSLA 5C33A 3A22A 1SLTA 1PO12 3TBDA 4GB31 4BK4A 4CUBA 1IOAA 4H55A 2E7TA 4YW3A 4KU7A 5DAPA 4BISA 1D4M1 3BI3A 1Z7S1 1YQ8A 3D6EA 3ZDVA 3PTRB 1NCRA 2QDRA 2D7FA 1S0CA 5FP7A 5I8SA 4EN0A 5FPBA 1GANA 4LT5A 1CIWA 3FZ3A 5EXOA 3R4UA 3UGHA 4M0HA 3UKVA 1XE7A 3BCWA 1AR83 3CU7A 2YC4A 4WM8B 4AL9A 4OYUA 5FZ0A 1AXKA 1X8MA 4CP0A 3BUCA 1DGRA 2Q8CA 3WT3A 1J3PA 4A7ZA 5CYYA 3AVSA 2AYHA 3VKFC 4BB3A 3ZXFA 2ZTNA 4A3XA 2PQSA 2QQJA 4HFSA 2RS12 2WR9A 4L92A 3T2OA 2OW4A 5BXXA 3POIA 4LIUA 3HQUA 2WWJA 4MADA 4BXSV 1K5MA 2ZGLA 3JQXA 1UX7A 4A6OA 1IZ3A 2FQPA 5DDJ1 2JDNA 2QTWB 4BK5A 4BQWA 4YSFA 1ZBA1 4FTBA 1GU3A 1W6PA 3VBSA 2FMYA 3VZMA 4GMP3 4MX3A 4YFWA 1CGPA 4YNIA 2B9UA 5GALA 1CIYA 3FFQA 5F3EA 1F4HA 4UT5A 4W4ZA 2Y6HA 1DZQA 1GWKA 2Y6JA 3ENRA 4AFCA 2A3WA 2WWSA 5BNOC 2BNOA 1LEMA 1OQDA 2WFPA 4B3NA 4I30A 1IS5A 2HWE3 3UJQA 1CONA 1CVNA 4XCBA 3JXSA 3I2HA 2BW8A 1CAVB 2TNFA 2VR4A 3IIAA 4Q0PA 1ULEA 3IDCB 4NPRA 2B5HA 2PA7A 3IPVA 4CDQB 2GALA 2A6XA 4HANA 2ZMKA 2D6MA 5DAVA 4Y5SA 1GFF2 4HK8A 2AACA 4L9BA 5FMCA 4NO4A 5EFUA 1TMF2 1A6CA 1HRI1 1CJPA 2XONA 2YGLA 3AKTA 1X82A 4YGDA 5J48A 1XYOA 2VMIA 5EYYA 1SHWB 1H6XA 5CFCA 2VY0A 1VR3A 3VD5A 4XDQA 2BBVA 4LIVA 1V6MA 5FPAA 1WWYA 5I0RA 4QPIC 2MEV2 3RWNA 2VC9A 2O1QA 2R062 1QOTA 4IETA 3BVCA 4CDUC 1W8UA 1QQP2 3CMGA 1PGW1 1NT0A 4QGLA 1OUXA 1EAH1 3GZEA 4RL7A 4WVVA 4BCUA 4NIGA 4GKYA 1K45A 2F17A 1HB2A 3W5NA 2ZCWA 3C2UA 1W9TA 3HQXA 4CDWC 4Y22A 5L7OC 1BVVA 5LA2A 1QJY1 4K6BA 4QX7A 4BQ1A 3WW3A 4JQRA 1DYOA 2RM22 4A42A 1RB8G 2D43A 1V00A 4H7LA 1AYN3 1EP0A 1POV0 2E6VA 3PUHA 5F5QA 3WCRA 4LA3A 2WNVA 1S0JA 4LE4A 3ACIA 2TUNA 1RVF2 1HLCA 3N9OA 4K1YA 4Y20B 4F83A 1AF9A 4QGNA 2ARXA 3AYCA 4HKOA 3ZFEC 2VG9A 4F3JA 4KI5M 2P17A 2ZGOA 3BALA 4OLLA 5FO7B 5IAXA 2CSGA 1N1YA 3MIGA 4LNVA 5DUXA 4FBFA 3GF6A 3TWIA 5E1RA 1H1MA 3SQOA 3OPWA 5IK7A 1NZIA 1LU1A 1RUJ2 2MHFA 5DZFA 2W92A 3OD4A 3VV1A 1YNAA 3ZFFB 5C8CB 3BGAA 4UW5A 5KXCA 1D4VB 1AJOA 2VQTA 4SBVA 1VBC1 4B1MA 1X33A 2Y8KA 1NLRA 1R1A2 1EV11 3RRDA 4E4ZA 3POYA 2GC1A 5DUUA 4B8EA 2K46A 1UZ0A 5F3IA 4CU8A 3HBKA 3W59A 5FLJA 4HZFA 2PLV2 4Y5TA 3T1MA 3CQOA 2HWF3 2XJVA 5E88A 3VBHB 4QX2A 3N9LA 1WGPA 3DYOA 5LEJA 3LWCA 3BODA 2EXHA 1LCLA 3WUDA 4N8MA 1PM7A 1RUH2 1S0FA 3KQ4B 5FYMA 4AEDB 4AQ6A 4BJ0A 5C9AB 4LOTA 1ZA4A 2PHDA 2Y0IA 4HMZA 3VKLA 5C3SA 3AKPA 3NNFA 1J3QA 4OHWA 2YG0A 1AYM1 3WHUA 4KWLA 4ZPIA 4AG4A 4BIFA 1CX1A 1YFWA 4XUTA 2PAMA 1C4RA 2YU1A 2I74A 3M3EA 5LATA 4BM8A 2BWCA 2R0FA 5JDBA 4TYSA 2ADDA 4QB2A 1HW5A 5FLHA 5LK5A 1C5HA 2C6SA 3I2FA 4HKWA 3JBG2 3O1UA 4LKEA 3SCHA 4S2FA 1DGLA 1LULA 4JRLA 4BQYA 4IEQA 4WM7C 1WMEA 2W47A 2SLIA 1GZTA 4YM3A 1MEC2 5HXMA 2NMNA 3E1F1 3IZOA 4NHXA 2KM2A 4PIXA 3I97A 4DS0A 2RR11 1S4CA 3B01A 1YFUA 2PHRA 3HN1A 4NVPA 2QNKA 2EALA 1FPN2 4GWJA 3WLUA 4YGCA 2R6QA 1AR73 2VW1A 3HOBA 4XJAA 5HPOA 1SPPB 2GNBA 2WDBA 3AP4A 1AUYA 3VZNA 3AYEA 4TLFA 4QX0A 1CQ9A 1DGWX 3H42B 1QIQA 1R083 2QQLA 5FO8B 4Q4W3 1GYKA 3M3QA 3N7KA 5J7MA 1G86A 4AAXA 5HCFA 4DQAA 1LGBA 4E9KA 3OUJA 5FZGA 4TZDA 2W91A 1XQNA 2YPJA 3GZAA 3KF3A 4YVSC 4N53C 3N9PA 1RINA 2LS6A 5IW0A 2G9FA 2UY8A 4CP9B 4Q1RA 5FJHA 1W99A 1U0AA 2P34A 1YQCA 1MS9A 1AL23 2VW2A 3SHRA 1KFUL 1U5XA 2OUJA 3C7GA 5M0TA 2R0HA 2WO1A 4FTSA 3ORJA 1BBT2 4A45A 2W95A 1CZTA 1AYN1 2EAAA 3BOWA 3OB8A 3D3AA 4BQ3A 2FDGA 1YI7A 5FZ1A 2JE9A 2W87A 2Z5WA 4IE5A 5D8AB 1V6NA 5BNOA 1RHI2 1WA6X 4EWDA 3FMGA 2XBO3 4UFLA 1EPZA 2GN7A 4G4FA 4LKDA 1PIV2 1H8TB 1KGYA 2XG3A 4E2QA 3V0AB 1XSRA 3KLSA 4V2VA 3BTXA 2VMHA 4L0PA 1E57A 4EROA 1XOYA 1NG0A 5AC92 1PMHX 1VP6A 4FOQA 3MV11 4MHRA 4JHZA 5CISA 2DWRA 5A3LA 4ZU5A 1Q5OA 4PBPA 2XLGA 1KJRA 3PLQA 3MF6A 3VN4A 5AFBA 3NQHA 5L9VA 4Q4X3 3KWVA 5GM0A 1Y7BA 4KBZA 3J7LA 2CNAA 1NUKA 2WQ4A 4CEYC 1IS6A 3B3QE 3OGVA 4BIOA 5EHDA 1XE0A 1COV2 2VMDA 3AL6A 2B8MA 2WT0A 3BN6A 1RUG1 3NNGA 4IE4A 3NSTA 1FYUA 3NNLA 5DMYA 4QPIA 2P5BA 3JB8A 3PJQA 4YW6A 1S0BA 1VRH1 1RUE3 3FBMA 2ZGPA 5FYSA 5JR7B 4CDUA 3JU9A 5FRAA 1PK6C 1G9BA 2R49A 1MVEA 1B35C 2D6KA 5LRSA 1K5JA 2Z4FA 1RXGA 3AVRA 1IKQA 3T0BA 4YZ3A 3MICA 1R092 3RI9A 3ZFGB 3KV9A 3SITA 5I8TA 1RGSA 2FDJA 4CDWA 5L7OA 4RGKA 4MXWA 1OKOA 2CAUA 2UWBA 3J7NA 3WDVA 3NJZA 1C1FA 4XTPA 5EWSA 4MV2A 1HV0A 2XQXA 1BK1A 3NV2A 1NX9A 4XJ8A 1QXPA 4N43C 3WQBA 2X5IA 2W1WA 5J36A 2OX0A 3Q8AA 2UU8A 5A32B 3I3MA 4IEWA 2Q1MA 2QJVA 4M4RA 4RS5C 1GQHA 2CGPA 1D2SA 2X8KA 5JZGB 3VBFB 4QKDA 1AR82 4D7SA 1L3JA 5FY8A 3WP4A 2NMOA 2WT1A 2YC2A 1X7NA 3VDAA 1DZRA 2JKXA 2OT7A 4FOVA 2Y6GA 1LJ7A 1HX6A 1NCQC 2WL1A 4GALA 4XAEA 5ACA3 1GOHA 2JE8A 1PZ8A 2Y34A 4MGTA 1GNYA 2F4PA 2WUHA 1QXJA 1EPWA 2JDPA 4JDMA 1HKDA 1RUI3 2QBXA 3M8LA 3B69A 4H3WA 4DNYA 2DVFA 3RI8A 1G9CA 4XFBA 5B2GB 4C8DA 1BHGA 2WAOA 4UFHA 3KVAA 4JDOA 4OMDA 5APAA 2VTXA 5K9YA 5H9SA 2VOWA 3UK9A 1QJX1 3N7LA 2DVBA 1OLME 1OA4A 3C3VA 1O91A 3O0VA 4RR3A 1PM4A 4XHXA 3ZN6A 4FPKA 2GC2A 4UW3A 1GP6A 3RGBA 1UPSA 1ZRCA 5LB6A 3F95A 2R041 5KHIA 1GQPA 4LTAA 1OF3A 2HWE2 1ND3B 4QPGB 1RJ7A 4I01A 4Y1YA 3MF9A 4HPKA 3RWKX 4RHV1 1DQ1A 3RDIA 4NJ4A 4I3PA 2PN5A 5FO9B 3ZXKA 2QQWA 1UXXX 3M7AA 4Q4V1 2WC2A 1MS3A 3KD4A 1FOD2 1OH3A 2JKBA 4WM7A 4LEJA 1E5HA 1H4GA 1CPMA 5BV6A 5FXZA 3ZMOA 3BTAA 4FOWA 2WWUA 4RGGA 4GIQA 4Q0SA 1X9PA 4OHVA 2XJQA 1I3HA 1YJKA 4PIYA 4AI0A 1OLRA 3GM8A 2QDNA 5FFOC 5H9QA 5CFDC 1MVQA 1Q56A 3U1XA 1D2QA 2ZHKA 3UETA 4HG6B 2ETEA 3EXUA 3TEZA 4CEWC 4FPEA 2QVSB 1BEV3 2V5DA 4NMIA 5H9RA 2QQPA 1PGL1 1DQ4A 2HLEA 4PHZA 2YYOA 4LO8A 2R071 2QE3A 4NWVA 3DF0A 1NY72 4SLIA 1S0EA 3VKMA 1KDKA 1TVGA 1ZZ9A 2N7GA 3OY8A 2GNMA 1F31A 3HN3A 1SLBA 3N35A 1H9PA 1IS4A 1AR91 1HN1A 2IC1A 2VVFA 4MXVA 2VTXJ 1AX0A 1W6MA 1LESA 3HVDA 3VL9A 3ZSKA 4H2AA 2FDFA 4XZUG 3D5OA 2D6PA 3LDKA 4LO5B 2P37A 2FCVA 1YFXA 4MYEA 4URTA 4LUMA 4LKSA 1DYPA 1S0IA 4Q0VA 3UESA 3ACFA 3POJA 3U4XA 3ATGA 4XMAA 3RSJA 4TXWA 2VZ3A 3IAPA 3AB0A 5HV4A 1MPXA 1VBD3 2EIGA 1OD5A 2MEV3 2IXJA 4XCAA 4ZHNA 1IPKA 2R063 1JYCA 2HBUA 4LE3A 4XJWA 5HBAA 2CV6A 5LBEA 1QQP3 1SCSA 3ZYGA 3V0BB 2DBIA 2VUAA 1JXNA 2B7YA 1QGLA 1VMHA 4QD2A 5GLZA 4MHUA 2JG8C 2K9ZA 1WA4A 5JSOA 4AFBA 5HCAA 4N90A 4OI4A 3AXDA 2IFRA 4AI3A 1BK0A 5JSRA 4QXHA 1WCKA 2IXLA 3IB3A 1EYBA 3RJRA 3VD7A 1PVC1 1LB2A 2HWB3 1GNZA 1OMIA 1U5YA 1W9WA 4XUPA 1S55A 3T1LA 1AXZA 3S6PA 4FPFA 3OG2A 4LBQA 4CCLA 3V56A 2JDMA 1US3A 1PO11 1WLCA 3MLJA 1H6YA 3Q8CA 4CP1A 4CEYA 4W6XA 1A3KA 3AP7A 4IV3C 4XDPA 2WFF3 5A6XA 3ZPOA 3HMYA 4IDZA 4E2SA 4BLIA 1BVP1 3NAPB 3S0MA 4XZPA 1CX4A 1BMV2 3J8F3 4QQHA 4W6YA 3Q8FA 3K3NA 3NNJA 4JRAA 1JMUB 2ZX4A 4MZUA 4CCJA 1PK6A 4LO7A 5C3OA 4DUXA 5FV3A 5BYNA 1B35A 3MW2A 4EZHA 4Q0UA 4ARYA 5C4WB 5CIRA 5IVVA 3RYPA 2BV4A 2IUWA 3ILNA 4A3ZA 4XFFA 1CAXB 2XMLA 1ND2B 4E4DX 3KT7A 4AFMA 2RS11 4MGZE 1ODNA 1W8WA 5GLTA 5GZEA 4DOUA 2XJPA 1DF0A 1HQNA 2GNDA 3A21A 1BKZA 3RZGA 4IE7A 1ENRA 2C5DA 3APBA 4AZZA 4N43A 4TN7A 5LZ6A 5B4XA 4ES8A 4CUCA 4K9SA 5ABJB 1GP5A 1PGSA 1JHJA 1W9YA 4XEZA 3VBOB 2J1AA 5FYZA 4GJZA 1JZ6A 1OXCA 2ZAHA 4RS5A 5IAVA 1UU6A 1YO8A 4DUVA 1R082 2BYVE 4Q4W2 1XE8A 2E32A 1AL0G 1HB3A 2HWD2 4FO9A 3ACLA 3ZXLA 4BA6A 4UI9L 5A7QA 4CE8A 2I45A 1RUD1 4ATEA 2HEVF 1Q8PA 4D6RA 4GH4B 4UXAA 5KHJA 1EUUA 2ATFA 5FMOL 2IVIB 1GBGA 1MR5A 1ZRFA 3RZHA 1NCQA 3JBG3 4W65A 1XU1A 4LHNA 3A23A 5DG1A 1AL22 4AXOA 1MEC3 3MDPA 1CR7A 4CRQA 1SLIA 3K48A 2QQUA 2W0XA 2ZGTA 1QHDA 1XYNA 2QQIA 4DZGA 4QDRA 5BNNB 1HJFA 5JVVA 1CPNA 1TMF1 5TSWA 2HBTA 3U10A 4QU2A 4XBNA 5FXWA 2NM1A 4CA9A 5FYHA 4ZZ8A 1SBEA 2Q8OA 1H8VA 5L9BA 4Y22B 3WOGA 2A5ZA 2QCSB 1HRV2 5LWBA 2XPJA 2XBO2 4PDWC 4UYBA 2DTWA 3GBGA 4NHKA 4Z82A 3BTYA 2BGCA 1N3OA 2VL4A 2OQ6A 2Q0AA 1QXRA 2XL7A 5I0SA 4FQ4A 5CVRA 3ZO0B 4AK3A 4MGQA 2KA3A 4QXKA 4R52A 4M4PA 4NRMA 4YVWB 4AR2A 5L36A 1PVXA 2VMFA 3THTA 1UMHA 4GWNA 4AQTA 4LBMA 2ORZA 3ZIWA 4V1PA 3WCSA 1KRIA 2Q4SA 2ZX0A 3SKVA 1W8ZA 4DXSA 5KXDA 2BOJA 3I59A 4JGYB 3OYWB 4NIIA 3POBA 4Q4X2 1QMJA 1V6JA 2Y38A 5FLIA 3LA2A 3MFCA 4U36A 3M3IA 3BTZA 3WNLA 2A6WA 2RM21 3TN93 3ZKUA 2D3SA 1Q43A 3NKGA 3KF5A 2VU9A 1S0GA 1V9U1 2Q8DA 1LNSA 4B4PA 2D6LX 4C0BA 1RVF1 5K4LA 1F8VA 3W9AA 1IPJA 5FXVA 3WG2A 1OUSA 3WDXA 5IK5A 5CFDA 4LUKA 3VLBB 1RUE2 5JOYA 4OI0A 1YQ6A 4UBHA 1ULFA 2BU9A 2O8QA 4CEWA 3QH6A 1OHFA 2VCMA 4FAHA 3H8RA 5FZMA 1Q8VA 1NA1C 3NWKA 1QOSA 1UL9A 1VE0A 2RJ2A 4AAPA 4LHLA 1PIV3 2AZ5A 3VBUB 2NN8A 1RUJ1 1F4AA 1UXZA 2DCZA 1RUC1 1DLCA 1O3QA 5DPNA 3WF4A 3MIHA 4LBNA 1KDMA 3NJYA 1PNGA 2GP5A 2E9QA 3BPZA 3FJSA 4NHYA 4KWUA 2Y33A 5DG2A 2EIDA 2E33A 1R1A1 5FZOA 5CKNA 3T4HB 1JOBA 3C8XA 1FAYA 2JDHA 3DV8A 5HI0A 4YM1A 2PLV1 1W0NA 4XF0A 3IBMA 2RS31 3DKQA 2K2SA 4GD4A 2FBEA 4Q8LA 4AF9A 1YCIA 4MVTA 5FP9A 1HXS3 3KCCA 2VJXA 2P4EA 5AVAA 1RUH1 1F2NA 3LFIA 5T3NA 1XNTA 2E7QA 5ACA2 4IEOA 3CLPA 2Z69A 2WNUB 4L8QA 3B93A 4TSVA 1OF4A 2WS91 4BXFA 1RUI2 1ZVFA 2ZS6B 3IAQA 2HYXA 4BQXA 5FYVA 1CAUB 2VOVA 2WYSA 1XBFA 4Y26A 5FKBA 2RS53 2GH8A 3RQ0A 3C7EA 4QPYA 4KMQA 4OZXA 1JYVA 1HN0A 4YM2A 4BH9A 1JTZX 1OOPC 2ZEWA 1GZWA 3WNNA 2UWCA 2WINB 4FT8A 2E51A 1CZSA 1Y9MA 1QWRA 2PHTA 3WW4A 1IQAA 2DVAA 2E53A 1FPN1 2JJ6A 4HT1T 3KGZA 1DDLA 3CJXA 4IV3A 1ALYA 2XUEA 3RJ2X 1OI6A 3VDDC 4QWNA 3LFMA 4XURA 5I0UA 4WVMA 2GMMA 4FPYA 1JZ4A 2CTVA 1VB2A 2VZ1A 3ES4A 2JWPA 3WW1A 4Y4YA 1OA3A 1GWLA 5I91A 1PZ9A 3ES1A 3I3EA 4YZ4A 2FDHA 3SNMA 1CESA 3NV3A 5IUQA 2P3JA 4J1WA 1WLDA 3EYPA 5E89A 1OH4A 3LD8A 4XFIA 4QQOA 4CXXA 5IFTA 2PYTA 5FY9A 2WO7A 1SBDA 3QD6A 4BYYA 4C0HA 1W90A 1AR61 3ZSMA 5B4NA 4NRPA 5T5JA 3FC0A 4GJYA 3MO4A 3ACGA 1C8NA 3RZJA 2ZOEB 4M3CF 2WZPP 5A7PA 1FNZA 1V6KA 2B9VA 2W94A 3O1PA 1E5RA 3IIIA 1FMD3 3JCIA 1BBT1 3U11A 3HR9A 3H1YA 1SLCA 1BEV2 1QJU2 4MO3M 4YZ5A 2JDUA 5LASA 1PX3A 2CL2A 2WZR3 4P9XA 2IXKA 3H1MA 1ZBE3 4CCNA 5T50A 1WCSA 3EMRA 4XETA 3WD5A 5FYBA 3DXTA 2WO3A 4AEMA 2ZX2A 1RHI1 2GMEA 4HKLA 2WSUA 4XHBA 3LA3A 1W6OA 2VXRA 3DPRB 4J25A 4IL7A 1F15A 4PQ9A 4AGGA 4JDNA 1A34A 3AMPA 3HPNA 3VD4A 1QU0A 4ZXKA 1FOD3 1UU5A 4RQPB 3AZXA 3P5BA 2QFEA 5AC91 1REEA 4PI2A 5F1RA 3OSDA 5DUVA 3VZJA 4BZ4A 3LPGA 2CHHA 1C28A 3B00A 5K0UB 1WBFA 3QBQA 4GZ9A 3VKNA 4CPBD 3WUCA 1JOJA 2C4XA 4CDUB 4IEZA 4O65A 2JEMA 2XVGA 4HETA 2IZWA 4IW3A 4Z2AA 1VBD2 1H0BA 3THPA 2ZMLA 5KBFA 4YGBA 5FZEA 1A78A 3BU7A 4EYUA 2PHLA 3PUAA 2GH2A 3AC0A 4NRQA 3SEEA 1COV1 3UT0A 4COVA 5FP3A 2C0ZA 5L7OB 1RUF3 2W68A 4PDWA 3ILRA 1LGNA 5ANNA 3ZR5A 5CG9A 4NHLA 4OMCA 5F37A 1N1TA 1QOOA 2WN3A 2D5HA 2PTMA 2HWB2 4UWDA 4LO4B 1G8WA 3SLIA 3GDBA 4AEKA 1UYPA 2Q30A 4GA9A 4UFIA 3ZFEB 1R091 2YROA 1UY0A 2GNTA 1WLWA 1Y9QA 2SBAA 3K51A 2JDYA 2X5IC 5JAXA 4BDVB 3LAGA 5A33A 5FIXA 2D5FA 3WINE 5A80A 1U12A 4NHMA 2BNMA 1UY4A 3WR0A 4D7YA 2WFF2 2ZZQA 4EE2A 5JSPA 5LBCA 4YG3A 3N4MA 4Q1PA 1UKRA 4Y4RA 2XLAA 5BNPB 2W1SA 2A6ZA 1HQLA 2WNEA 3CO2A 2CYFA 2VNVA 3J8F2 1CAWA 4KGQA 4JTNA 3ST7A 1YUDA 4CTEA 3M3CA 1KFXL 2YV8A 4NWWA 2UY9A 2ZGNA 2RMU2 3WDYA 1QEXA 4CXWA 4META 3TEYA 2P3IA 1AR81 1W6QA 2QZ3A 4Z92B 1NE4A 3N9NA 3RVHA 1NA1A 2P3KA 1T2XA 4Z07A 4CCDA 4R4ZA 4AGRA 2LW8A 4G9SB 3AMNA 5K7PA 1W8NA 3AM2A 1WCUA 2DURA 3ZN6B 5GZDA 2VCBA 5JIUA 3GGLA 1POV3 1T6BX 4MGYE 2BEOA 2KD7A 2ZMNA 3CJIB 4IGOA 1RMU3 3SCGA 5FXXA 3RFRA 4RR3C 3WQ1A 3ZOIA 3AYAA 5C5UA 4AI1A 5F8PA 4XJ9A 2UWAA 2AH2A 3ILFA 4DPNA 4GMP1 1J84A 2UYBA 4LBLA 4WZCA 2ZACA 4HPKB 3SISA 4XBLA 4K20A 2NP0A 3T2PA 3ZIXA 1S2BA 2E63A 4L11A 4CSWA 4KWJA 3NV4A 4COWA 5C8CC 2XWBB 2XJTA 5FY4A 5JLVA 4OHYA 1VBE2 3ACHA 2GDFA 1IG0A 1ULPA 2OS2A 2V09A 2QKDA 4CYDA 2F6BA 4Y1UA 1WBLA 2HWE1 2VUCA 3RZLA 3O14A 2FMDA 3AK0A 3CNAA 4FCAA 2BGOA 1OQ1A 5A7NA 5FOBB 2J1VA 5A7WA 3VBHC 4PF1A 1RL3A 1W2UA 1H2KA 3POSA 5D2AA 1V6OA 5FYYA 3QOPA 1GLHA 2X53S 1G9AA 1OOPA 1GKBA 5C9AC 1W28A 5A70A 5FPUA 1P8JA 3NJXA 1VAKA 5FTTC 3LF7A 4B4RA 1ASJ3 3FHQA 4LORA 4B7KA 4R9DA 3T4VA 3VDBA 4A7YA 5AFEA 3PMSA 4N53B 4YVSB 2HWD3 4WVWA 1D4M2 3VDDA 1XC6A 1MS0A 2VVDA 1ZZCA 4YW7A 4OHZA 5CKMA 1MQTB 4IEXA 4QU1A 1JZ8A 2ZX1A 3OBAA 2WJSA 1UIKA 1YIFA 5FK8A 3WNXA 2OPKA 5FYCA 2DF7A 2FHRA 1PMJX 5LK7B 4KU8A 3RMYA 4Q26A 1O3SA 1RUOA 3NKTA 1GOFA 2R1DA 3LCPA 1DLLA 5FUPA 3WNMA 3FN9A 5CEHA 2HH9A 1PO23 3U4SA 3TEXA 3CF6E 3TN92 3MIDA 3K2OA 2RE9A 2VZRA 2FDKA 2VECA 3ZYIB 3J7HA 3OGSA 1F5FA 2RJLA 4HVOA 5CA6A 3H1WA 2VXJA 1CN1A 3JUUA 4KG0A 3UL2A 1D7PM 2D44A 1B09A 4HK9A 4Q5OA 2XJSA 3EJKA 4OHXA 3N9QA 2ARCA 3KV6A 1VAVA 1ZBA2 4XJUA 4WM8A 5IK4A 4ASMB 1HRV3 4YG0A 2OZJA 4QB1A 1BZWA 3VKOA 5FP8A 1MZ6A 2X05A 3RMXA 4AQSA 4JQTA 1FX5A 2ADEA 2RDNA 3LA7A 3I2KA 4CDXB 1H9WA 2ID4A 4NROA 2JDAA 3B7MA 3WG1A 4N9HA 2ZJCA 3MUY1 4DEVA 3M2MA 4KH9A 2WLPA 5CG8A 3MFAA 2YB7A 3DKWA 4YLZA 3GHNA 3K77A 4D8MA 5HV0A 2A71A 3ZN5A 5D1IA 2Z42A 2GU9A 3WNPA 3IDAA 3J9SA 3S5QA 2VD7A 1TZOA 4FPCA 4DO0A 2NPIA 2HWF1 1WW7A 5CU1A 3OUHA 4E4HA 1DQ5A 3N9MA 3WQ7A 1HXS2 1UY2A 3ZXJA 2GC0A 2QUOA 3ETPA 4CCKA 4P9WA 1TME3 4AI2A 1C1LA 1I6XA 3ZMNA 3KHCA 1NKGA 2X10A 1H8TC 3ZYFA 2ZGMA 2FDIA 1X36A 4K7JA 4P9IA 1CAVA 1ZZ8A 5JXIA 1M06G 1H30A 1UOBA 3X29B 1PMIA 3PVNA 4UW4A 1BMV1 4AEJA 4KL1A 2VMGA 2FZ2A 4XOGA 2QQMA 4QHZA 2YUEA 3HNBM 2RS52 2PELA 5FY7A 2EVXA 3PJYA 5KHKA 2BWAA 3LGRA 5F5CA 4FPLA 1MACA 1O4TA 1LHVA 2NYYA 1JOPA 2WA3A 4FPGA 4LLOA 2YBSA 4M01A 1J83A 3ELNA 3K4ZA 3WXPA 4EQVA 2PFWA 3H8UA 4NAOA 3JZVA 5FZ7A 5KXEA 4PQQA 1UOGA 2CWMA 5A3TA 1QJY2 3ZYRA 1URXA 3IMNA 2PAEA 3KV4A 1F9KA 4Y3OA 5T54A 1AR71 2JG9C 2AR6A 4ZS3A 3GJAA 4OUMA 2O8OA 3PNAA 1LECA 1O5LA 1DQ0A 3AKRA 3USUB 5LRRA 1GOGA 5F2SA 4YW5A 3ZFGC 1NLSA 1VBA3 1I1EA 1K42A 1R081 2FZ1A 4DXRA 2WYFA 4Q4W1 1YYNA 1NAEA 2ZAAA 3O0XA 2LUWA 5FQ0B 3THCA 1RITA 1W3VA 1W6NB 4PLNA 4XABA 4XF4A 4EN6B 2EICA 3MUZ1 3T3YA 3FWEA 5IVYA 1H4HA 1UU4A 1GP4A 2PHUA 3GJBA 3WW2A 2WSVA 3EB7A 3N36A 4Y20A 2PXJA 4H7MA 5DN2A 2A7AA 1AL21 2TEPA 4IEUA 1WUVA 2VZVA 1XSQA 3G6JB 4ISQA 1FMD2 3VHRA 1OFNA 3H9AA 5JZGC 3M1HA 4QX5A 4AHYA 3ZSEA 4J6GA 5DQ0A 5JXGA 1YI9A 5CB7A 3O12A 4A41A 4P02B 2WZR2 1BLZA 4Q29A 1ZBE2 1GWMA 2WNOA 3KS7A 3LEMA 4DXTA 1ZM1A 2DBNA 3ETQA 3M4FA 3ZVXA 5C8CA 1OC1A 4OQ8A 3DN7A 3MIEA 5ISLA 1DYKA 2XBO1 2JX9A 3IT8A 1RYYA 5LEKA 2IFWA 5FAXA 4P14A 3I2DA 4HSJA 1US2A 2P3YA 2QQNA 3FHIB 3KZ4C 3ZXAC 5FUIA 2W5FA 3MV01 2VUDA 3TAYA 2D3RA 2ZPXA 4EWEA 3U07A 1SCRA 4QHBA 1ONAA 3VBHA 3WEZA 3LOIA 4PCRA 3E5XA 5CFDB 3GZUC 4A2UA 2PHXA 5C3PA 4I0AA 1VBB3 2AEZA 4CEWB 5FY1A 1ZX5A 5JI7A 5IYYA 1OLMA 4Q4X1 1UPIA 1U5IA 4AEDA 4DY3A 5C9AA 3MW4A 4NAMA 3SH3A 1HJGA 4GQ7A 5EV7A 4FFIA 1OT5A 3FFZA 1GNHA 4QPGC 2Q1ZB 4XDOA 3WSOA 4KNCA 1SZBA 2RR12 3CKHA 1QJU3 5C3QA 2UYAA 1DBNA 2W3JA 2J42A 1RUF2 3DYMA 3J26N 5LW9A 4JGZB 4S2DA 3B9IA 2C1FA 3TNQA 1O7FA 1RUE1 3ECQA 4M3CA 4URAA 3WP5A 1NLQA 2YGMA 1W8HA 4AQ2A 4Q2FA 4GXLA 2Y6KA 3IMMA 2DCYA 3OEAA 5T5PA 3VHNA 1O6UA 1VALA 3LQCA 4ZXEA 1MS8A 4YFZA 5FMOS 2WT2A 3NL1A 3TOJA 1JYNA 2NQYA 3OEBA 3I8TA 1ZNPA 4Y1XA 5LA0A 1X9TA 3O5SA 3O1TA 3AMQA 5FYTA 5C71A 3HIFA 4QHOA 3VBRC 4CCOA 4OUSA 1SFNA 1SPPA 1GR3A 4Q0QA 2DCJA 5FBJA 4JKLA 1IG3A 1YJLA 4XVHA 1R64A 2XR4A 2AEYA 2JG8B 2QQKA 4QDSA 5FYUA 3RNSA 2D6OX 2VULA 2P6CA 2OVUA 5FZFA 3OBZA 2VUJA 1JYWA 1LOBA 3E5UA 4MSVA 4QQLA 5EJ1B 5ACA1 2ZGKA 4XC9A 5FPXA 2A6VA 5IVFA 2BFUL 4EZ4A 4PLOA 5JOWA 1NCRB 1W06A 4MLOA 1MS5A 1RMU2 1XNCA 3PU3A 1RUI1 2XKPA 4Q4Y3 3U14A 1IGOA 2JE7A 1D0GA 4EWAA 1W04A 2J1EA 4F7ZA 3FLPA 1LHWA 1WMFA 3WF1A 4P5YA 2Y0OA 2ZGQA 1LENA 2ZHMA 3MI8A 4HSLA 2V4AA 5DAXA 1BJQA 4ONUA 2YBPA 4WVMB 4ZONA 4KGGA 4CU7A 3RZKA 1IQDC 3ZXEA 5AVPA 5F6KA 5A1LA 1JS9A 5F6LB 3I4IA 1C8M3 3HT2A 4C1WA 3H7JA 3DL3A 3DEMA 3W21A 2J1UA 1K5MB 4LA2A 1MZFA 3GZTB 2F4LA 3MLLA 3O1RA 2RMU3 5A3OA 1H8TA 1APNA 1S2EA 3OJBA 3OBRA 4K40A 5GLVA 3SMHA 1W6PB 1HIXA 3VBSB 3V0AA 5LCWL 5IT6A 3B9CA 3RPQA 2VAUA 4YRDA 1IKPA 3NV1A 5K8SA 3DCQA 2D3PA 5FWJA 1UX6A 3K3OA 4YGEA 2BOIA 1YQ2A 4J1XA 2A6YA 3HJRA 4JTOA 3LE0A 4XW3A 4NIHA 1FV2A 1WW4A 5LA9A 2HWC3 1SDDB 3UKNA 3MIBA 4W6WA 1ASJ2 2VM9A 4INDA 3M70A 3NAPC 3G7DA 3IPVB 3Q8BA 4OZOA 4FVVA 1TG7A 2PHFA 3LEIA 3OBTA 2VZOA 3ZN4A 3M3OA 2JG9A 4Z2WA 1LOAA 2RV9A 3INAA 1VBE3 1X8EA 3D8CA 3NRUA 1BEV1 2IXCA 4O61A 2A73B 3JD73 5C4WC 4XMIA 2DFCA 5F39A 1AHSA 2ZBJA 3ZFGA 3U37A 3RZMA 1UCXA 4KBBA 1NZCA 1XNBA 2BQPA 5GKAC 4X6RB 1ND2C 3R05A 2DV9A 1AVBA 3ZXGA 4XILA 1L7QA 5CFCB 2D93A 4IXLA 1ZRDA 1XJAA 2ZHNA 5LBBA 2B39A 2BNNA 4TTGA 1YRZA 1PO22 4HBNA 4XFHA 3ZKYA 4XUNA 3KHBA 5ABJC 5JIAA 4UAPA 5A3WA 5KC6A 3PVBB 4FXKB 1GUIA 1XU2A 3OUIA 1YXWA 4FPHA 1W0OA 3O0WA 3VBOC 4D69A 5T5LA 4R9BA 4RFT0 2I2SA 1UF2C 2B4KA 5JZGA 2VOKA 2YU2A 4XUQA 3HD8B 1F35A 2YY1A 2HJIA 3FX3A 3KSCA 1OPOA 3O7OA 3OF1A 4GB33 4IUGA 4GH4C 5D21A 5FZ4A 1VBD1 2MEV1 4N7IA 1PZ7A 1QJX2 5A6YA 2E31A 2R061 1DGRN 4Y1VA 1D4M3 4ITCA 1Z7S3 5EIYB 4NN0A 4I0BA 3D0JA 4BWOA 1QQP1 1PX4A 2WNVB 1RUNA 1ZZ7A 3HWJA 2R042 2ZHLA 3POWA 4K8FA 1K3IA 2XVLA 4DINB 5FZCA 2W1QA 3N7JA 1BXHA 1YQ5A 1AJKA 2HWB1 4EJRA 5FJKA 1RC6A 2TBVA 1AX2A 2JIJA 4BQ2A 1CZVA 5BNNC 3PVOA 1UNBA 2DU0A 4YPJA 5FCCA 4E27A 1N3PA 1NQDA 1LTEA 2A3XA 5EZWA 5I0TA 3R0RA 1UZVA 2GC3A 3ON7A 3B02A 2VO5A 4XQWA 3UYJA 3WP6A 1NYWA 1ST8A 3VZKA 5JUVA 3OOXA 1UZYA 1TME2 4DUWA 5DDJ3 3LSDA 2WFF1 4QPGA 1ZBA3 4AGVA 4BMEA 4E2GA 4FFGA 1MS4A 2VQ0A 3J7MA 2J22A 1UMIA 4ATFA 2G19A 4F8AA 2FD8A 3H8OA 4YVWC 3J8F1 4XPVA 3NW4A 4K8RB 4LJHA 4RYDA 1ODMA 1FXZA 2R7EB 1QNYA 1FT9A 1OVPA 2BVVA 4XXPA 3PIJA 4YG6A 5A6QA 1PGL2 3PUSA 4IE0A 3UKTA 3PHMA 3TYJA 3BPSA 1TEIA 4PI0A 3U75A 1HDKA 1N1VA 3JB4C 1EUTA 5BNQA 4B7EA 1POQA 2R072 2OA2A 2H0VA 2VBPA 3AP5A 3WQ0A 3AKQA 1VB4A 1XRUA 3OTFA 3S5AA 3UGGA 2BBAA 2ZA9A 4CZSA 2XVKA 3P3NA 2RHPA 2H6CA 4LOSA 3VBRA 3VGIA 3O1OA 1H1AA 1QKQA 5A3MA 4FFFA 1HRI3 3P3PA 4QKNA 3LKJA 3WNOA 4BHPA 1WCDJ 3KB5A 3VBUC 4EV0A 5HCHA 1VBA2 1A8DA 1J59A 4BU2A 3OGJA 2JDKA 1OBNA 1RIRA 2ARBA 3KM5A 1UZWA 1WMXA 4PBOA 3CL1A 2GP3A 5H9PA 1JN2P 3E5QA 2Q1FA 3K4AA 2HYKA 2ZEZA 3JBG1 4FOYA 5JI9A 1V6LA 3I54A 1EAH3 3JQWA 4K1ZA 2AUYA 1MEC1 4R9AA 3LB9A 2JIGA 5CADA 3FLTA 1OFSA 1LR5A 3LEGA 2XWJB 1JU3A 3GBFA 1ENXA 1LEDA 4NOTA 3ZSLA 4LK7A 4IQPA 3VB9A 4IV1C 1NE6A 1QJY3 5J37A 2E26A 1C57A 2QZ2A 3WP3A 3S7EA 4I3GA 5GZGA 2ZGUA 2VZTA 5DUWA 1QDOA 3K46A 2JICA 1MS1A 2W52A 3V0BA 2A3YA
chains in the Genus database with same CATH topology
1JZ7A 1GNYA 2WUHA 2VTFA 2CDPA 3VD9A 2QBXA 2BGOA 3DYPA 2C26A 1BHGA 2WAOA 2J1VA 1UWWA 4PF1A 4OMDA 4A44A 1O8SA 1P8JA 1I5PA 3NJXA 5JMOA 1GQPA 1OF3A 3FHQA 3VDBA 3FHAA 4OUEA 1XC6A 2YFZA 5G04L 3K4DA 1JZ8A 1UXXX 3OBAA 2V4VA 1PMJX 2VZSA 2RVAA 2VZPA 1GOFA 3WNMA 3FN9A 2ZEYA 4LPLA 2VZRA 1JZ3A 3GM8A 3J7HA 3OGSA 4CU6A 1JU4A 3UETA 4HG6B 4E8DA 1D7PM 4PT6A 1UY3A 2WZEA 2V5DA 2HLEA 5G05L 2YFUA 2VZQA 3P6BA 2EIBA 4QB1A 2X05A 2WN2A 3UNPA 1TVGA 5JXJA 3HN3A 3T09A 3I2KA 3VDCA 2ID4A 1HN1A 3I2GA 2JDAA 3WF3A 5EJZB 3MUY1 4DEVA 3CIHA 2YB7A 4XZUG 4D8MA 3K77A 4W50A 3C7OA 4MGSA 4QX1A 3WNPA 3IDAA 4LKSA 3UESA 3ACFA 4TXWA 2VZ3A 3IAPA 5A1AA 1MPXA 4JKMA 1UY2A 3ETPA 2VMEA 1GMMA 4GWIA 3OGRA 4LHSA 1NKGA 2X10A 2VMCA 2XHNA 2WABA 5JXIA 3IB3A 3VD7A 4ARXA 4XUPA 1W9WA 2ZXQA 2QQMA 1JI6A 2JD9A 3HNBM 5F7UA 3OG2A 1J83A 3K4ZA 3GXUA 1US3A 1JZ2A 1H6YA 2EIEA 2J7MA 4QDQA 3HEIA 4PQQA 2W46A 3ZM8A 1WCQA 4MOAA 2ZEXA 2W9XA 4E8CA 1UYYA 4P00B 4D0QA 3FL7A 3I2JA 1KEXA 2Y6LA 4ZY9A 1GOGA 5IJRA 4DUXA 1K42A 1UYZA 4ARYA 4DXRA 1NAEA 3A22A 4A3ZA 4CUBA 2VQUA 3THCA 4BK4A 4UOJA 2EICA 3MUZ1 5C70A 2DDUA 3A21A 3EB7A 5DN2A 3T2QA 2WQ8A 2VZVA 5B4XA 4CUCA 1JHJA 2J1AA 1JZ6A 2YC4A 5DQ0A 5JXGA 4OYUA 4DUVA 4A41A 2E32A 4P02B 4UI9L 5CYYA 4DXTA 4QX3A 1EUUA 3I3DA 4LQRA 2PQSA 2QQJA 3T2OA 2Y64A 4MADA 4BXSV 4A6OA 1UX7A 1RYYA 3A23A 4BK5A 3PUIA 1UY1A 4ZZ5A 3I3BA 1GU3A 1US2A 2QQNA 5FUIA 2W5FA 3MV01 1CIYA 2OKXA 2QQIA 3WEZA 4QDRA 3WF0A 1F4HA 4W4ZA 5IFPA 2Y6HA 2Y6JA 3F2ZA 1JZ5A 5IYYA 4ZZ8A 2DCKA 1OT5A 3P1IA 3VD3A 3WSOA 3JXSA 3I2HA 3CKHA 2VR4A 2W3JA 2VL4A 3DYMA 4MGQA 5LA1A 3ECQA 4P08A 4M4PA 3NJVA 2VMFA 1UMHA 2ORZA 2Y6KA 3OEAA 1UYXA 3SKVA 4DXSA 2XONA 4QPWA 3LQCA 4QAWA 4ZXEA 3T0AA 1SHWB 3WNLA 2BGPA 1H6XA 1JYNA 3VD5A 3OEBA 3CDZB 5LA0A 2VC9A 5C71A 1LNSA 3WNKA 4A4AA 2DCJA 5I0DA 3CMGA 4JKLA 4XVHA 1R64A 4QDSA 2QQKA 3T0DA 1K45A 1W8OA 3W5NA 4DEQA 1W9TA 2RJ2A 2L9LA 5LA2A 1JYWA 1DYOA 4A42A 1F4AA 1UXZA 1DLCA 5EJ1B 3PUHA 5DPNA 3WF4A 4KWUA 3THDA 2XOMA 1W9SA 2C9KA 3ACIA 2EIDA 2E33A 3C8XA 4XUOA 3C7FA 4KI5M 3SEPA 2J1EA 3WF1A 1ULPA 1W0NA 4P5YA 2ORXA 1XPWA 4CU7A 1IQDC 2VJXA 2W92A 1XNTA 3BGAA 1K12A 2J1SA 1SG3A 2VQTA 2J1UA 2Y8KA 1OF4A 1ULOA 1UZ0A 3IAQA 4CU8A 2HYXA 1JYXA 3HNMA 5LCWL 2WYSA 3CQOA 3C7EA 4QX2A 4KMQA 1JYVA 3DYOA 2ZEWA 3WNNA 1YQ2A 1CZSA 3CZUA 3HJRA 3LE0A 4BJ0A 3ABZA 2YG0A 2WZ8A 1SDDB 4AG4A 2JE8A 2VM9A 1CX1A 4XUTA 4OZOA 4XURA 1TG7A 3LEIA 2VZOA 4QB2A 1JZ4A 2VZ1A 3I2FA 2RV9A 2WBKA 3I3EA 3NRUA 2W47A 3EYPA 1L7RA 1O59A 1OH4A 5HXMA 1WKYA 3E1F1 4JX0A 3U37A 5IFTA 3I97A 1L7QA 5B4NA 2V72A 3CZJA 3MBWA 3MO4A 4GWJA 2VZUA 3T08A 3ACGA 4TTGA 3HOBA 3SKJE 2B9VA 4XUNA 5HPOA 2W94A 2WDBA 3IIIA 4UAPA 2X09A 1GUIA 4QX0A 4CUAA 2QQLA 3LPFA 2B4KA 5IHRA 4MO3M 4XUQA 1PX3A 4AAXA 3C7HA 4IUGA 2W91A 2WO3A 2E31A 2WO2A 2LS6A 5EIYB 1OD3A 1PX4A 1W99A 2WAAA 2VCAA 3A7QA 3VD4A 3C7GA 3HPNA 2WO1A 1K3IA 2W1QA 2W95A 1CZTA 4A45A 5JXHA 3LPGA 3OB8A 1CZVA 3D3AA 4GZ9A 4YPJA 2C4XA 2J1TA 2W87A 3K75B 4Z2AA 2VO5A 4ET7A 4QB6A 5JUVA 4DUWA 3AC0A 3SEEA 4FI9A 1KGYA 4CU9A 2J22A 1UMIA 3LEKA 4OMCA 4L0PA 1PMHX 2WN3A 3MV11 3WF2A 4JHZA 4RYDA 2R7EB 3GDBA 3NQHA 1UY0A 3I2IA 2CDOA 2BZDA 1NUKA 4BDVB 1EUTA 3OGVA 2VMDA 3BN6A 3NNGA 1UY4A 5DMYA 2BBAA 2J1RA 2W1SA 5J1XA 5JR2A 2VOTA 4CVUA 2Z4FA 4RN5A 4W8JA 3T0BA 1DP0A 1XNAA 2QQOA 3WNOA 1T2XA 2LW8A 3DECA 1O8PA 3HNYM 1W8NA 2VCBA 3GGLA 2XQXA 3K4AA 1NX9A 2KD7A 2ZEZA 3WQBA 5C7GA 2W1WA 4M4RA 3LEGA 1J84A 1JU3A 2BERA 2VCCA 5CZKA 2E26A 3T2PA 2W1UA 2YC2A 3W5MA 3VDAA 2VZTA 2JKXA 3K46A 2Y6GA 4JKKA 3ACHA 1GOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZ7 A;  1GNY A;  2WUH A;  2VTF A;  2CDP A;  3VD9 A;  2QBX A;  2BGO A;  3DYP A;  2C26 A;  1BHG A;  2WAO A;  2J1V A;  1UWW A;  4PF1 A;  4OMD A;  4A44 A;  1O8S A;  1P8J A;  1I5P A;  3NJX A;  5JMO A;  1GQP A;  1OF3 A;  3FHQ A;  3VDB A;  3FHA A;  4OUE A;  1XC6 A;  2YFZ A;  5G04 L;  3K4D A;  1JZ8 A;  1UXX X;  3OBA A;  2V4V A;  1PMJ X;  2VZS A;  2RVA A;  2VZP A;  1GOF A;  3WNM A;  3FN9 A;  2ZEY A;  4LPL A;  2VZR A;  1JZ3 A;  3GM8 A;  3J7H A;  3OGS A;  4CU6 A;  1JU4 A;  3UET A;  4HG6 B;  4E8D A;  1D7P M;  4PT6 A;  1UY3 A;  2WZE A;  2V5D A;  2HLE A;  5G05 L;  2YFU A;  2VZQ A;  3P6B A;  2EIB A;  4QB1 A;  2X05 A;  2WN2 A;  3UNP A;  1TVG A;  5JXJ A;  3HN3 A;  3T09 A;  3I2K A;  3VDC A;  2ID4 A;  1HN1 A;  3I2G A;  2JDA A;  3WF3 A;  5EJZ B;  3MUY 1;  4DEV A;  3CIH A;  2YB7 A;  4XZU G;  4D8M A;  3K77 A;  4W50 A;  3C7O A;  4MGS A;  4QX1 A;  3WNP A;  3IDA A;  4LKS A;  3UES A;  3ACF A;  4TXW A;  2VZ3 A;  3IAP A;  5A1A A;  1MPX A;  4JKM A;  1UY2 A;  3ETP A;  2VME A;  1GMM A;  4GWI A;  3OGR A;  4LHS A;  1NKG A;  2X10 A;  2VMC A;  2XHN A;  2WAB A;  5JXI A;  3IB3 A;  3VD7 A;  4ARX A;  4XUP A;  1W9W A;  2ZXQ A;  2QQM A;  1JI6 A;  2JD9 A;  3HNB M;  5F7U A;  3OG2 A;  1J83 A;  3K4Z A;  3GXU A;  1US3 A;  1JZ2 A;  1H6Y A;  2EIE A;  2J7M A;  4QDQ A;  3HEI A;  4PQQ A;  2W46 A;  3ZM8 A;  1WCQ A;  4MOA A;  2ZEX A;  2W9X A;  4E8C A;  1UYY A;  4P00 B;  4D0Q A;  3FL7 A;  3I2J A;  1KEX A;  2Y6L A;  4ZY9 A;  1GOG A;  5IJR A;  4DUX A;  1K42 A;  1UYZ A;  4ARY A;  4DXR A;  1NAE A;  3A22 A;  4A3Z A;  4CUB A;  2VQU A;  3THC A;  4BK4 A;  4UOJ A;  2EIC A;  3MUZ 1;  5C70 A;  2DDU A;  3A21 A;  3EB7 A;  5DN2 A;  3T2Q A;  2WQ8 A;  2VZV A;  5B4X A;  4CUC A;  1JHJ A;  2J1A A;  1JZ6 A;  2YC4 A;  5DQ0 A;  5JXG A;  4OYU A;  4DUV A;  4A41 A;  2E32 A;  4P02 B;  4UI9 L;  5CYY A;  4DXT A;  4QX3 A;  1EUU A;  3I3D A;  4LQR A;  2PQS A;  2QQJ A;  3T2O A;  2Y64 A;  4MAD A;  4BXS V;  4A6O A;  1UX7 A;  1RYY A;  3A23 A;  4BK5 A;  3PUI A;  1UY1 A;  4ZZ5 A;  3I3B A;  1GU3 A;  1US2 A;  2QQN A;  5FUI A;  2W5F A;  3MV0 1;  1CIY A;  2OKX A;  2QQI A;  3WEZ A;  4QDR A;  3WF0 A;  1F4H A;  4W4Z A;  5IFP A;  2Y6H A;  2Y6J A;  3F2Z A;  1JZ5 A;  5IYY A;  4ZZ8 A;  2DCK A;  1OT5 A;  3P1I A;  3VD3 A;  3WSO A;  3JXS A;  3I2H A;  3CKH A;  2VR4 A;  2W3J A;  2VL4 A;  3DYM A;  4MGQ A;  5LA1 A;  3ECQ A;  4P08 A;  4M4P A;  3NJV A;  2VMF A;  1UMH A;  2ORZ A;  2Y6K A;  3OEA A;  1UYX A;  3SKV A;  4DXS A;  2XON A;  4QPW A;  3LQC A;  4QAW A;  4ZXE A;  3T0A A;  1SHW B;  3WNL A;  2BGP A;  1H6X A;  1JYN A;  3VD5 A;  3OEB A;  3CDZ B;  5LA0 A;  2VC9 A;  5C71 A;  1LNS A;  3WNK A;  4A4A A;  2DCJ A;  5I0D A;  3CMG A;  4JKL A;  4XVH A;  1R64 A;  4QDS A;  2QQK A;  3T0D A;  1K45 A;  1W8O A;  3W5N A;  4DEQ A;  1W9T A;  2RJ2 A;  2L9L A;  5LA2 A;  1JYW A;  1DYO A;  4A42 A;  1F4A A;  1UXZ A;  1DLC A;  5EJ1 B;  3PUH A;  5DPN A;  3WF4 A;  4KWU A;  3THD A;  2XOM A;  1W9S A;  2C9K A;  3ACI A;  2EID A;  2E33 A;  3C8X A;  4XUO A;  3C7F A;  4KI5 M;  3SEP A;  2J1E A;  3WF1 A;  1ULP A;  1W0N A;  4P5Y A;  2ORX A;  1XPW A;  4CU7 A;  1IQD C;  2VJX A;  2W92 A;  1XNT A;  3BGA A;  1K12 A;  2J1S A;  1SG3 A;  2VQT A;  2J1U A;  2Y8K A;  1OF4 A;  1ULO A;  1UZ0 A;  3IAQ A;  4CU8 A;  2HYX A;  1JYX A;  3HNM A;  5LCW L;  2WYS A;  3CQO A;  3C7E A;  4QX2 A;  4KMQ A;  1JYV A;  3DYO A;  2ZEW A;  3WNN A;  1YQ2 A;  1CZS A;  3CZU A;  3HJR A;  3LE0 A;  4BJ0 A;  3ABZ A;  2YG0 A;  2WZ8 A;  1SDD B;  4AG4 A;  2JE8 A;  2VM9 A;  1CX1 A;  4XUT A;  4OZO A;  4XUR A;  1TG7 A;  3LEI A;  2VZO A;  4QB2 A;  1JZ4 A;  2VZ1 A;  3I2F A;  2RV9 A;  2WBK A;  3I3E A;  3NRU A;  2W47 A;  3EYP A;  1L7R A;  1O59 A;  1OH4 A;  5HXM A;  1WKY A;  3E1F 1;  4JX0 A;  3U37 A;  5IFT A;  3I97 A;  1L7Q A;  5B4N A;  2V72 A;  3CZJ A;  3MBW A;  3MO4 A;  4GWJ A;  2VZU A;  3T08 A;  3ACG A;  4TTG A;  3HOB A;  3SKJ E;  2B9V A;  4XUN A;  5HPO A;  2W94 A;  2WDB A;  3III A;  4UAP A;  2X09 A;  1GUI A;  4QX0 A;  4CUA A;  2QQL A;  3LPF A;  2B4K A;  5IHR A;  4MO3 M;  4XUQ A;  1PX3 A;  4AAX A;  3C7H A;  4IUG A;  2W91 A;  2WO3 A;  2E31 A;  2WO2 A;  2LS6 A;  5EIY B;  1OD3 A;  1PX4 A;  1W99 A;  2WAA A;  2VCA A;  3A7Q A;  3VD4 A;  3C7G A;  3HPN A;  2WO1 A;  1K3I A;  2W1Q A;  2W95 A;  1CZT A;  4A45 A;  5JXH A;  3LPG A;  3OB8 A;  1CZV A;  3D3A A;  4GZ9 A;  4YPJ A;  2C4X A;  2J1T A;  2W87 A;  3K75 B;  4Z2A A;  2VO5 A;  4ET7 A;  4QB6 A;  5JUV A;  4DUW A;  3AC0 A;  3SEE A;  4FI9 A;  1KGY A;  4CU9 A;  2J22 A;  1UMI A;  3LEK A;  4OMC A;  4L0P A;  1PMH X;  2WN3 A;  3MV1 1;  3WF2 A;  4JHZ A;  4RYD A;  2R7E B;  3GDB A;  3NQH A;  1UY0 A;  3I2I A;  2CDO A;  2BZD A;  1NUK A;  4BDV B;  1EUT A;  3OGV A;  2VMD A;  3BN6 A;  3NNG A;  1UY4 A;  5DMY A;  2BBA A;  2J1R A;  2W1S A;  5J1X A;  5JR2 A;  2VOT A;  4CVU A;  2Z4F A;  4RN5 A;  4W8J A;  3T0B A;  1DP0 A;  1XNA A;  2QQO A;  3WNO A;  1T2X A;  2LW8 A;  3DEC A;  1O8P A;  3HNY M;  1W8N A;  2VCB A;  3GGL A;  2XQX A;  3K4A A;  1NX9 A;  2KD7 A;  2ZEZ A;  3WQB A;  5C7G A;  2W1W A;  4M4R A;  3LEG A;  1J84 A;  1JU3 A;  2BER A;  2VCC A;  5CZK A;  2E26 A;  3T2P A;  2W1U A;  2YC2 A;  3W5M A;  3VDA A;  2VZT A;  2JKX A;  3K46 A;  2Y6G A;  4JKK A;  3ACH A;  1GOH A; 
#chains in the Genus database with same CATH topology
 2WNU C;  3FUQ A;  3QCW A;  4AVB A;  5I8Y A;  2AGS A;  3NNM A;  5DAB A;  2VTF A;  4LMF A;  2CDP A;  1HB1 A;  4GMP 0;  3W58 A;  2C26 A;  2XB6 C;  4LR4 A;  1UWW A;  4A44 A;  3BOP A;  4IGQ A;  4CP2 A;  3TNP B;  4COU A;  1O8S A;  2CWS A;  1AZD A;  2FCU A;  5A1F A;  1S2K A;  4XAA A;  1W2N A;  1VBB 2;  5BNO B;  4RGA A;  2HEW F;  4P9Y A;  1KS5 A;  3H3U A;  1VBC 3;  2EXK A;  5JMO A;  3NMB A;  1XND A;  3PUR A;  1EV1 3;  3TN9 1;  5IAT A;  4DFS A;  1Q3E A;  4WM8 C;  2DCT A;  1MZE A;  4UW6 A;  3QAC A;  2A75 A;  3NAP A;  1OLQ A;  2LTN A;  3FHA A;  3S30 A;  4B29 A;  1ENQ A;  5A7O A;  1JUI A;  2YFZ A;  3K4D A;  4MG2 A;  2YZ4 A;  4IEV A;  1WZX A;  2HKX A;  2XUM A;  1DGW A;  2V4V A;  5FKC A;  5FZH A;  3UJO A;  2VZS A;  5C4W A;  2RG4 A;  1Y9G A;  2GAU A;  4FP2 A;  4QXC A;  2DU1 A;  2VZP A;  4CUG A;  1PIV 1;  1FNY A;  1CAX A;  4XF9 A;  1ND2 A;  1AYM 3;  2XL9 A;  1UOF A;  3H7Y A;  4IER A;  5DZG A;  1OKQ A;  3MIF A;  2VBD A;  1RUD 2;  4ASL A;  4AWD A;  4ORF A;  4QPI B;  2YHJ A;  3BKZ A;  1W2O A;  4CU6 A;  5E6H A;  1S1A A;  2BVB A;  4LBO A;  4QQP A;  3THD A;  4YYO A;  3ZR6 A;  4E8D A;  4Z1V A;  3B5L B;  4PT6 A;  5FY5 A;  5ABJ A;  2NLR A;  1UY3 A;  3ZYB A;  1V70 A;  4HLT A;  2GN3 A;  1AXY A;  3VBO A;  5G05 L;  1Z78 A;  2YFU A;  4QM9 A;  5FZK A;  3KT4 A;  1SDW A;  3WG3 A;  1QJF A;  2VZQ A;  5L19 A;  2EIB A;  4DIQ A;  1DHK B;  2RR1 3;  2IVJ A;  1HXS 1;  4CDW B;  3DGT A;  4MXW B;  3WDU A;  4CDQ C;  3UNP A;  4GH4 A;  3BYW A;  1A8M A;  1DQ6 A;  3AZW A;  5CBL A;  4I2O A;  1XYP A;  4UF0 A;  3DPR C;  5EJZ B;  3R4S A;  4N9I A;  3CIH A;  4OFG A;  2DYC A;  2X5I B;  4RQP C;  2BRT A;  4WVZ A;  2AC1 A;  1OUR A;  3HBZ A;  2DUQ A;  1E5I A;  4W50 A;  1E5S A;  5F5A A;  4Q4Y 2;  4MGS A;  1M4W A;  3GCW A;  3PTY A;  5K0U C;  2PAK A;  5FMD A;  5FZD A;  5T52 A;  4UFJ A;  4YZ1 A;  1QJE A;  4AHZ A;  1JBC A;  2RS5 1;  5BNN A;  2VNO A;  5A1A A;  4HL0 A;  5FOJ B;  3BIE A;  1DFQ A;  3SH5 A;  3AYD A;  2R32 A;  4IEP A;  2GMP A;  2C24 A;  4JKM A;  4DRV A;  1I5Z A;  4JC1 A;  2JEN A;  1C8M 2;  1GMM A;  1Q8S A;  3LDR A;  2VW0 A;  4QXB A;  3OGR A;  4LHK A;  4LHS A;  5F3C A;  1UN1 A;  3IM0 A;  1BYH A;  4AE2 A;  2VE1 A;  2VMC A;  4FPJ A;  2WAB A;  3UV9 A;  4LXL A;  1PHM A;  3ZLI A;  1Y4W A;  2JB8 A;  4I09 A;  5EPA A;  5C6C A;  3H0O A;  1V9U 2;  5EYX A;  1JI6 A;  1J58 A;  1Z0H A;  3HT1 A;  4MUV A;  4YVW A;  2BDR A;  2O0O A;  5EP9 A;  3ZSJ A;  5KWR A;  3A0K A;  4RR3 B;  1RED A;  1ULC A;  5IWF A;  1W0P A;  5C8W A;  1L7L A;  3AP9 A;  3IDE A;  4JGY A;  5FMB A;  3OYW A;  2H0B A;  1IHM A;  3GXU A;  2ZGR A;  3N3H A;  1BQP A;  1JZ2 A;  1C5I A;  1YEW A;  2J7M A;  3ZPY A;  3HEI A;  2W46 A;  2HWC 2;  4XF1 A;  5T55 A;  2YPD A;  4MOA A;  3O1M A;  1EY2 A;  5BNP C;  1UYY A;  1RUC 2;  3AZZ A;  4P00 B;  3LOB A;  4MGI E;  3GYD A;  1KEX A;  5FZ8 A;  5BPX A;  1FMD 1;  5IJR A;  3ZFF C;  2RDQ A;  2ZGS A;  3IDB B;  4AI9 A;  2YBK A;  2Y26 A;  1S0D A;  4WM7 B;  4OI1 A;  1HB4 A;  3ALQ A;  2EXI A;  3JD7 2;  4N7U A;  3WV6 A;  1YFY A;  5J09 A;  2WZR 1;  3L2H A;  3POF A;  3VBU A;  2RS3 2;  1ZBE 1;  3GNE A;  2VQU A;  4X8P A;  4O9E A;  3LSE A;  4XTM A;  4UOJ A;  3ROU A;  1RUG 3;  3E6C C;  4XQ4 A;  2BJS A;  3AZV A;  4YWA A;  3CJI C;  5C70 A;  3D0S A;  1XB9 A;  2DDU A;  1ULD A;  2ZKL A;  4V2W A;  5JOX A;  1VRH 3;  3WY6 A;  1ZA7 A;  4KWK A;  2G1M A;  1XXN A;  3T2Q A;  2WQ8 A;  3OGG A;  5J98 B;  4FPO B;  1UOJ A;  2ZKN A;  1FOD 1;  2WLQ A;  3AZY A;  1SQ4 A;  3I7D A;  2WS9 2;  5FUN A;  4AED C;  3O1V A;  2G4I A;  3DUI A;  1ZZB A;  3FUO A;  3T30 A;  5A3N A;  2CU5 A;  2Y60 A;  1LOE A;  1JYI A;  4M3C B;  4IV1 A;  1V0A A;  3EQE A;  1U5Z A;  2E7A A;  4GB3 2;  3OY8 B;  4QX3 A;  3I3D A;  4LQR A;  4G3Y C;  5GJ6 A;  2JEC A;  1QH6 A;  4IEY A;  2Y64 A;  2ARE A;  1Z7S 2;  2UUR A;  1W6M B;  2FCT A;  1CWP A;  4S2G A;  2WNU A;  3MPB A;  4XFG A;  3WDT A;  4D7T A;  2W08 A;  3PUI A;  1UY1 A;  4ZZ5 A;  1RUF 1;  3I3B A;  1LOF C;  1WD3 A;  2ES3 A;  3BIW E;  2YDE A;  1CAU A;  2RDS A;  5FZ3 A;  1NY7 1;  2ARA A;  2B45 X;  3MPP G;  2OKX A;  4O9G A;  3WF0 A;  5FBZ A;  2V5Y A;  5IFP A;  1VRB A;  1SFY A;  1XNK A;  3MZH A;  4COY A;  3F2Z A;  1JZ5 A;  4CPB A;  4AVS A;  3I2O A;  4LUL A;  2DCK A;  2WRA A;  1GIC A;  1ZZ6 A;  1OA2 A;  3MEP A;  3P1I A;  3VD3 A;  5DAW A;  2VH9 A;  1AR6 2;  1DQ2 A;  3OPT A;  4XE9 A;  5DDJ 2;  5SV8 A;  1O4Z A;  2DUO A;  1Y43 B;  4YW4 A;  4ASK A;  4FSJ A;  3GBW A;  4AYU A;  1LU2 A;  1QY4 A;  3GHM A;  4RA0 A;  3O1S A;  5LA1 A;  1MQT C;  4P08 A;  1TE1 B;  2XQR A;  1QJX 3;  3NJV A;  5FYI A;  3N7M A;  3V64 A;  1UYX A;  3FE5 A;  4BQ5 A;  1RXF A;  4MH0 E;  2GZW A;  5BUV A;  2X29 A;  4LBQ B;  4QPW A;  3KV5 A;  4EN7 B;  3CEW A;  4QAW A;  3SCF A;  1UZZ A;  4AHX A;  2R04 3;  3T0A A;  1YIP A;  2BGP A;  4CEY B;  4C1X A;  2G9G A;  1ZRE A;  3CDZ B;  2VOX A;  2CGO A;  3LZZ A;  3SXW A;  2DVG A;  4RHV 3;  1KD7 A;  1POV 1;  2WA4 A;  3AXE A;  4UBG A;  1UKG A;  3WNK A;  4BPZ A;  5IVC A;  2OQ7 A;  3H8X A;  4A4A A;  1RMU 1;  5I0D A;  5JOZ A;  1UW8 A;  1IPS A;  2Q5T A;  1LAJ A;  4PJY A;  3H50 A;  5D8A C;  2ENR A;  5DAQ A;  1YHF A;  2DTY A;  4Q4V 3;  3T0D A;  1PK6 B;  1GZ9 A;  4Y5Z 0;  1W8O A;  2B42 B;  1SEF A;  1UMZ A;  1B35 B;  4DEQ A;  3WDW A;  3AFK A;  3EHK A;  2Q8E A;  1HRI 2;  1W2T A;  4QKF A;  2L9L A;  5F9T A;  4HXC A;  4K3U A;  2R30 A;  1OQE A;  1WW5 A;  5A3P A;  4CDX C;  3POE A;  4CDQ A;  1N47 A;  4NPM A;  2RDR A;  1Q8Q A;  2D6N A;  4P5H A;  5A3U A;  4QGM A;  2XOM A;  1W9S A;  2C9K A;  3DPR A;  1G7Y A;  4GUL A;  4XUO A;  4BE3 A;  4N43 B;  4AFD A;  3C7F A;  4NE9 A;  1CD3 G;  1N3Q A;  1PGW 2;  5LBF A;  3MHZ A;  4RQP A;  3SEP A;  1DCS A;  1EAH 2;  3CBN A;  2HEY F;  2JD4 A;  4XXA A;  2ORX A;  3A4U A;  4Q27 A;  4QQ2 A;  4RS5 B;  5K0U A;  4HN1 A;  1TQ5 A;  1XPW A;  2R07 3;  2JG9 B;  2YXS A;  1FI2 A;  4AHW A;  5GZF A;  3U0Z A;  3NVC A;  3MGU A;  5EJ3 A;  1UAI A;  3I3Q A;  5GLU A;  1RTV A;  1AR9 3;  1SBF A;  5FZA A;  2YMZ A;  1K12 A;  3KQR A;  5L9R A;  1NCQ B;  2J1S A;  3UGF A;  3E97 A;  5FZI A;  1SG3 A;  2QQV A;  3AJZ A;  2XGX A;  2C9A A;  1YC6 1;  1ASJ 1;  4YW2 A;  1LOG A;  4XBQ A;  4HVQ A;  1ULO A;  4S2H A;  4LK6 A;  1AX1 A;  3KGL A;  3HNM A;  1LRH A;  1JYX A;  2HWD 1;  4OQ9 A;  4AFA A;  4R8H A;  3RS6 A;  4LBQ D;  1N1S A;  4HN0 A;  4OUL A;  4ZKT B;  3W20 A;  3URF A;  4K21 A;  3D4K A;  4NUB A;  1IS3 A;  1ZYB A;  3ZFE A;  1WD4 A;  1G6N A;  4FQZ A;  4D3W A;  1GQG A;  2DFB A;  5ERL A;  5C3R A;  3OD0 A;  1TNF A;  1NQJ A;  2H6B A;  3CZU A;  3FLR A;  3ABZ A;  1Y3T A;  1LOC A;  3QLQ A;  4P9J A;  4TLG A;  1V6I A;  5I93 A;  4PLM A;  1JW6 A;  4XIO A;  2YC0 A;  5J3U A;  1VBC 2;  1ZRI A;  2WZ8 A;  3PME A;  4UFK A;  3V65 A;  3ZYJ B;  1PO2 1;  2P6H A;  1EV1 2;  2BFU S;  5KXB A;  2VPV A;  3VBF C;  1PVC 3;  1GZC A;  2K0G A;  3U78 A;  5BNP A;  2JXA A;  3R4D B;  4IE6 A;  2WBK A;  1LHO A;  5FRE A;  3NO8 A;  3AKS A;  4H14 A;  1JHN A;  2VGD A;  4I02 A;  2EF6 A;  3PU8 A;  1C3H A;  3ZFF A;  1L7R A;  1O59 A;  1SFP A;  2ET1 A;  3I59 B;  4LBK A;  1WKY A;  4GKX A;  1HQW A;  4JX0 A;  1HRV 1;  1PO1 3;  1VJ2 A;  4TWT A;  5KHG A;  2XDV A;  1VIW B;  2V72 A;  3CZJ A;  3MBW A;  1W8T A;  1AYM 2;  1NOV A;  2VZU A;  3T08 A;  5EQU A;  1HV1 A;  4CCE A;  2XJU A;  1D0H A;  2CAV A;  3E6B A;  3GCX A;  3CJI A;  3SKJ E;  3GAL A;  1Q8O A;  2X09 A;  4CUA A;  4A7K A;  4EN9 B;  2AEN A;  4M3C E;  1ACC A;  3VL8 A;  2XHK A;  3LPF A;  5IHR A;  2VNR A;  1ND3 C;  2XXZ A;  3C7H A;  5FZ9 A;  1O5U A;  1SLA A;  2RS1 3;  3KVB A;  5FK7 A;  2WO2 A;  3VHP A;  1OD3 A;  4QT6 A;  4CCC A;  1TME 1;  2B46 X;  4M0N A;  5FZO B;  1KQR A;  2WAA A;  5FWE A;  2W2I A;  2VCA A;  3QH7 A;  3A7Q A;  1QH7 A;  5FY0 A;  3WX5 A;  3TEW A;  4PF5 A;  1QNW A;  5JXH A;  3AMH A;  1H1I A;  3LDB A;  4QX8 A;  1LOF A;  5FZB A;  4XYX A;  5T5O A;  3VHO A;  3ZYH A;  4AVV A;  3VBR B;  4JCK A;  5J96 B;  5JPM B;  2J1T A;  1RUD 3;  3K75 B;  2VQA A;  1W03 A;  1TNR A;  2IXI A;  4ET7 A;  4A6S A;  4QB6 A;  3VUO A;  1UO9 A;  3DXU A;  1OVS A;  3KMH A;  4FI9 A;  2P1B A;  1LHN A;  4RSU A;  4WZF A;  1VMF A;  4COZ A;  2DUP A;  4CCM A;  3HAG A;  1J1L A;  5JMC A;  5FZ6 A;  4OVE A;  4JGZ C;  3RYR A;  4CU9 A;  3LEK A;  4YVS A;  4N53 A;  2OXB A;  4NIA A;  2OYZ A;  1LOD A;  3ZYP A;  4L97 A;  3WF2 A;  1AYN 2;  1G9F A;  5L73 A;  5C5T A;  4QMA A;  1MQT A;  2JB4 A;  5LY2 A;  3BU0 A;  2A70 A;  1TMF 3;  4DMI A;  1ENS A;  4YM0 A;  5KHH A;  3PUQ A;  3MLK A;  1GZW B;  4AVT A;  4CP9 A;  2WQZ C;  3I2I A;  1VBA 1;  4NID A;  2CDO A;  2BZD A;  3B94 A;  4AVC A;  3Q9O A;  4FFH A;  2NZ9 A;  4L2N A;  2VBB A;  3MYX A;  4IV3 B;  4MGK E;  3RG0 A;  4ZU4 A;  1W2A X;  2J1R A;  3ZXD A;  4X8N A;  5J1X A;  1LHU A;  5JR2 A;  2BPA 2;  2VOT A;  4LBJ A;  4UFM A;  4CVU A;  4YZ2 A;  3S57 A;  5FDB A;  4NR1 A;  5D8A A;  4D6S A;  5LY1 A;  4RN5 A;  4W8J A;  2BTV C;  4I0W B;  1DP0 A;  1XNA A;  2ZX3 A;  5ANQ A;  2QQO A;  3PL0 A;  3KCX A;  4JVA A;  4RD7 A;  3ASI A;  2RM2 3;  1DU3 D;  2HWF 2;  3DEC A;  1O8P A;  3HNY M;  2LRP A;  5DZE A;  1JYT A;  5FZL A;  4CDX A;  1VAM A;  1RUG 2;  3AMM A;  1V9U 3;  4KQ7 A;  3I49 A;  1RVF 3;  4ZS2 A;  1NCR C;  1YLL A;  1H2M A;  2LAL A;  2OUH A;  5FPZ A;  1VRH 2;  1YWK A;  5C7G A;  3KCY A;  4BLJ A;  4ZU7 A;  2R1B A;  4AOC A;  2XKO A;  2W39 A;  3IKW A;  3R6S A;  5A6Z A;  1H2N A;  4WV8 A;  4DB5 A;  5HXV A;  2BER A;  1WW6 A;  2VCC A;  4GAZ A;  5CZK A;  1CJD A;  1F5J A;  1W3X A;  2EAK A;  2CY6 A;  2ZAB A;  3LIH A;  4RFR B;  3TRS B;  1WMD A;  2ERF A;  1RUJ 3;  2W1U A;  4M00 A;  4WBB A;  2I07 B;  5IVB A;  2DVD A;  1FV3 A;  3W5M A;  1VBB 1;  1RUC 3;  4HON A;  4Q8K A;  2EXJ A;  1KIT A;  4JKK A;  5FPL A;  5FR3 A;  3POG A;  5FPV A;  1NXM A;  5BY5 A;  4BOW A;  1JZ7 A;  1LKN A;  1K5M C;  1R1A 3;  1W6O B;  1X50 A;  2XJR A;  4KG8 A;  1DIW A;  2ET7 A;  4BMB A;  3VBS C;  3VD9 A;  4B1L A;  3PDQ A;  1QJU 1;  5CKQ A;  2PLV 3;  3DYP A;  4FXG B;  2CGN A;  3H3Z A;  1DG6 A;  1UQX A;  2RS3 3;  3L2Y A;  2MPF A;  4D94 A;  2OPW A;  2P2K A;  3H3L A;  3Q8E A;  1AR7 2;  3BB6 A;  5F32 A;  2PMW B;  2LM3 A;  4Z8B A;  4L99 A;  1RUH 3;  3IN9 A;  4OI2 A;  2MNG A;  2XH6 A;  2ZZJ A;  4XJZ A;  1QJZ A;  2BUK A;  1RJ8 A;  3OCP A;  1I5P A;  4C91 A;  2BP6 A;  5SV5 A;  1PNF A;  2KR2 A;  3KT1 A;  4FAG A;  5A32 A;  2WS9 3;  4D6Q A;  3AX4 A;  2A1X A;  3WG4 A;  1KJL A;  3A0N A;  1O3R A;  4PDW B;  5KC5 A;  1H2L A;  1DZT A;  1QF3 A;  3PIG A;  3S7I A;  5KR7 A;  3VBF A;  4YW1 A;  4UF0 B;  2Z2S B;  3AJY A;  4OUE A;  4LIT A;  4XF3 A;  1W39 A;  2D40 A;  1T6G C;  1SMV A;  1JUH A;  4HVR A;  2OZ6 A;  4JAA A;  4P9G A;  5G04 L;  3USU A;  4OCT A;  4B4Q A;  5GZC A;  4U2A A;  2LRO A;  4C90 A;  1W05 A;  3VZL A;  1G9D A;  1SLL A;  2RVA A;  5CFC C;  5FQ0 A;  2KXL A;  1FAT A;  5IVE A;  3AFG A;  5A33 B;  4LO6 B;  2Y6F A;  1W6N A;  1FPN 3;  3ITQ A;  2ZEY A;  1O4Y A;  3WZ1 A;  1JOD A;  1I9R A;  4LPL A;  4ES9 A;  1JZ3 A;  4YAR A;  3RYK A;  1STM A;  4Y24 A;  4QKB A;  4RHV 2;  1JU4 A;  1OSG A;  1W8F A;  3IWZ A;  4AI8 A;  1JH5 A;  1CAW B;  1J3R A;  2IWG B;  4AW7 A;  4Q4Y 1;  4X6Q B;  5GLW A;  2WZE A;  1J1T A;  4Q4V 2;  5HCB A;  1W6Q B;  2O14 A;  3P6B A;  4E4S A;  1NA1 B;  3EO6 A;  4PIZ A;  5JWP A;  1O3T A;  1AR6 3;  2D98 A;  1VPH A;  3RZZ A;  1ND3 A;  2EA7 A;  2WN2 A;  3ME2 A;  4Y1Z A;  4DXZ A;  4FP3 A;  5JXJ A;  1C8M 1;  3T09 A;  2WNV C;  3VDC A;  3VZO A;  5CAZ A;  3I2G A;  1OPM A;  4GWM A;  4R9C A;  4JZR A;  4XAC A;  4Y33 A;  5E16 A;  3WF3 A;  3OPZ A;  4DRR A;  1BBT 3;  4XFA A;  2RMU 1;  4JGY C;  3TB0 A;  3C7O A;  3USS A;  4QX1 A;  4XIK A;  2PQQ A;  3EBR A;  4IES A;  3MW3 A;  2XLF A;  3AP6 A;  5A7S A;  3D82 A;  4ISR A;  4IGP A;  3AL5 A;  1ZRR A;  2ILM A;  4AVA A;  3ZDS A;  2V73 A;  3WVJ A;  5JCT A;  1RHI 3;  3SC7 X;  2VME A;  4BQ4 A;  2RJK A;  5IK8 A;  1LGC A;  3FBY A;  4O7X A;  1GV9 A;  1AR9 2;  2VNG A;  4GWI A;  3ZX7 A;  4XFC A;  4P9L A;  1QDC A;  4HOO A;  2HWC 1;  1BCX A;  2XHN A;  5AC9 3;  5F5I A;  3SH4 A;  1REF A;  4ARX A;  4JV4 A;  4JGZ A;  2IXH A;  4DY5 A;  1NXD 1;  1KXG A;  2GSY A;  2PHW A;  2ZXQ A;  3E6D A;  2JDZ A;  5A7W B;  5IVJ A;  2JD9 A;  2R16 A;  4NPL A;  3HQR A;  5E8A A;  1SAC A;  2G9Z A;  1UD1 A;  1VBE 1;  2WII B;  5F7U A;  2WKK A;  2Z79 A;  5JPN B;  3JD7 1;  1OOP B;  3LIG A;  5CNA A;  1VMJ A;  1W9F A;  4R4X A;  1MZ5 A;  4JHT A;  1R1Z A;  1COV 3;  2EIE A;  3J4U H;  4LKF A;  4QDQ A;  3PVE A;  4IV1 B;  1KS4 A;  3ZM8 A;  1WCQ A;  1ULG A;  3WHT A;  2ZEX A;  1WLT A;  2W9X A;  5F2W A;  5FP4 A;  4E8C A;  4FTE A;  1VLN A;  1UIJ A;  1PVC 2;  2OII A;  4QM8 A;  4XQD A;  3VDD B;  4D0Q A;  3CHX A;  3FL7 A;  3I2J A;  5DXD A;  4CXY A;  2Y6L A;  2D97 A;  2JG8 A;  4ZY9 A;  4LLF A;  3T2T A;  2VVE A;  1R09 3;  3L9J T;  4EN8 B;  1UYZ A;  5F3G A;  1GSL A;  5C33 A;  3A22 A;  1SLT A;  1PO1 2;  3TBD A;  4GB3 1;  4BK4 A;  4CUB A;  1IOA A;  4H55 A;  2E7T A;  4YW3 A;  4KU7 A;  5DAP A;  4BIS A;  1D4M 1;  3BI3 A;  1Z7S 1;  1YQ8 A;  3D6E A;  3ZDV A;  3PTR B;  1NCR A;  2QDR A;  2D7F A;  1S0C A;  5FP7 A;  5I8S A;  4EN0 A;  5FPB A;  1GAN A;  4LT5 A;  1CIW A;  3FZ3 A;  5EXO A;  3R4U A;  3UGH A;  4M0H A;  3UKV A;  1XE7 A;  3BCW A;  1AR8 3;  3CU7 A;  2YC4 A;  4WM8 B;  4AL9 A;  4OYU A;  5FZ0 A;  1AXK A;  1X8M A;  4CP0 A;  3BUC A;  1DGR A;  2Q8C A;  3WT3 A;  1J3P A;  4A7Z A;  5CYY A;  3AVS A;  2AYH A;  3VKF C;  4BB3 A;  3ZXF A;  2ZTN A;  4A3X A;  2PQS A;  2QQJ A;  4HFS A;  2RS1 2;  2WR9 A;  4L92 A;  3T2O A;  2OW4 A;  5BXX A;  3POI A;  4LIU A;  3HQU A;  2WWJ A;  4MAD A;  4BXS V;  1K5M A;  2ZGL A;  3JQX A;  1UX7 A;  4A6O A;  1IZ3 A;  2FQP A;  5DDJ 1;  2JDN A;  2QTW B;  4BK5 A;  4BQW A;  4YSF A;  1ZBA 1;  4FTB A;  1GU3 A;  1W6P A;  3VBS A;  2FMY A;  3VZM A;  4GMP 3;  4MX3 A;  4YFW A;  1CGP A;  4YNI A;  2B9U A;  5GAL A;  1CIY A;  3FFQ A;  5F3E A;  1F4H A;  4UT5 A;  4W4Z A;  2Y6H A;  1DZQ A;  1GWK A;  2Y6J A;  3ENR A;  4AFC A;  2A3W A;  2WWS A;  5BNO C;  2BNO A;  1LEM A;  1OQD A;  2WFP A;  4B3N A;  4I30 A;  1IS5 A;  2HWE 3;  3UJQ A;  1CON A;  1CVN A;  4XCB A;  3JXS A;  3I2H A;  2BW8 A;  1CAV B;  2TNF A;  2VR4 A;  3IIA A;  4Q0P A;  1ULE A;  3IDC B;  4NPR A;  2B5H A;  2PA7 A;  3IPV A;  4CDQ B;  2GAL A;  2A6X A;  4HAN A;  2ZMK A;  2D6M A;  5DAV A;  4Y5S A;  1GFF 2;  4HK8 A;  2AAC A;  4L9B A;  5FMC A;  4NO4 A;  5EFU A;  1TMF 2;  1A6C A;  1HRI 1;  1CJP A;  2XON A;  2YGL A;  3AKT A;  1X82 A;  4YGD A;  5J48 A;  1XYO A;  2VMI A;  5EYY A;  1SHW B;  1H6X A;  5CFC A;  2VY0 A;  1VR3 A;  3VD5 A;  4XDQ A;  2BBV A;  4LIV A;  1V6M A;  5FPA A;  1WWY A;  5I0R A;  4QPI C;  2MEV 2;  3RWN A;  2VC9 A;  2O1Q A;  2R06 2;  1QOT A;  4IET A;  3BVC A;  4CDU C;  1W8U A;  1QQP 2;  3CMG A;  1PGW 1;  1NT0 A;  4QGL A;  1OUX A;  1EAH 1;  3GZE A;  4RL7 A;  4WVV A;  4BCU A;  4NIG A;  4GKY A;  1K45 A;  2F17 A;  1HB2 A;  3W5N A;  2ZCW A;  3C2U A;  1W9T A;  3HQX A;  4CDW C;  4Y22 A;  5L7O C;  1BVV A;  5LA2 A;  1QJY 1;  4K6B A;  4QX7 A;  4BQ1 A;  3WW3 A;  4JQR A;  1DYO A;  2RM2 2;  4A42 A;  1RB8 G;  2D43 A;  1V00 A;  4H7L A;  1AYN 3;  1EP0 A;  1POV 0;  2E6V A;  3PUH A;  5F5Q A;  3WCR A;  4LA3 A;  2WNV A;  1S0J A;  4LE4 A;  3ACI A;  2TUN A;  1RVF 2;  1HLC A;  3N9O A;  4K1Y A;  4Y20 B;  4F83 A;  1AF9 A;  4QGN A;  2ARX A;  3AYC A;  4HKO A;  3ZFE C;  2VG9 A;  4F3J A;  4KI5 M;  2P17 A;  2ZGO A;  3BAL A;  4OLL A;  5FO7 B;  5IAX A;  2CSG A;  1N1Y A;  3MIG A;  4LNV A;  5DUX A;  4FBF A;  3GF6 A;  3TWI A;  5E1R A;  1H1M A;  3SQO A;  3OPW A;  5IK7 A;  1NZI A;  1LU1 A;  1RUJ 2;  2MHF A;  5DZF A;  2W92 A;  3OD4 A;  3VV1 A;  1YNA A;  3ZFF B;  5C8C B;  3BGA A;  4UW5 A;  5KXC A;  1D4V B;  1AJO A;  2VQT A;  4SBV A;  1VBC 1;  4B1M A;  1X33 A;  2Y8K A;  1NLR A;  1R1A 2;  1EV1 1;  3RRD A;  4E4Z A;  3POY A;  2GC1 A;  5DUU A;  4B8E A;  2K46 A;  1UZ0 A;  5F3I A;  4CU8 A;  3HBK A;  3W59 A;  5FLJ A;  4HZF A;  2PLV 2;  4Y5T A;  3T1M A;  3CQO A;  2HWF 3;  2XJV A;  5E88 A;  3VBH B;  4QX2 A;  3N9L A;  1WGP A;  3DYO A;  5LEJ A;  3LWC A;  3BOD A;  2EXH A;  1LCL A;  3WUD A;  4N8M A;  1PM7 A;  1RUH 2;  1S0F A;  3KQ4 B;  5FYM A;  4AED B;  4AQ6 A;  4BJ0 A;  5C9A B;  4LOT A;  1ZA4 A;  2PHD A;  2Y0I A;  4HMZ A;  3VKL A;  5C3S A;  3AKP A;  3NNF A;  1J3Q A;  4OHW A;  2YG0 A;  1AYM 1;  3WHU A;  4KWL A;  4ZPI A;  4AG4 A;  4BIF A;  1CX1 A;  1YFW A;  4XUT A;  2PAM A;  1C4R A;  2YU1 A;  2I74 A;  3M3E A;  5LAT A;  4BM8 A;  2BWC A;  2R0F A;  5JDB A;  4TYS A;  2ADD A;  4QB2 A;  1HW5 A;  5FLH A;  5LK5 A;  1C5H A;  2C6S A;  3I2F A;  4HKW A;  3JBG 2;  3O1U A;  4LKE A;  3SCH A;  4S2F A;  1DGL A;  1LUL A;  4JRL A;  4BQY A;  4IEQ A;  4WM7 C;  1WME A;  2W47 A;  2SLI A;  1GZT A;  4YM3 A;  1MEC 2;  5HXM A;  2NMN A;  3E1F 1;  3IZO A;  4NHX A;  2KM2 A;  4PIX A;  3I97 A;  4DS0 A;  2RR1 1;  1S4C A;  3B01 A;  1YFU A;  2PHR A;  3HN1 A;  4NVP A;  2QNK A;  2EAL A;  1FPN 2;  4GWJ A;  3WLU A;  4YGC A;  2R6Q A;  1AR7 3;  2VW1 A;  3HOB A;  4XJA A;  5HPO A;  1SPP B;  2GNB A;  2WDB A;  3AP4 A;  1AUY A;  3VZN A;  3AYE A;  4TLF A;  4QX0 A;  1CQ9 A;  1DGW X;  3H42 B;  1QIQ A;  1R08 3;  2QQL A;  5FO8 B;  4Q4W 3;  1GYK A;  3M3Q A;  3N7K A;  5J7M A;  1G86 A;  4AAX A;  5HCF A;  4DQA A;  1LGB A;  4E9K A;  3OUJ A;  5FZG A;  4TZD A;  2W91 A;  1XQN A;  2YPJ A;  3GZA A;  3KF3 A;  4YVS C;  4N53 C;  3N9P A;  1RIN A;  2LS6 A;  5IW0 A;  2G9F A;  2UY8 A;  4CP9 B;  4Q1R A;  5FJH A;  1W99 A;  1U0A A;  2P34 A;  1YQC A;  1MS9 A;  1AL2 3;  2VW2 A;  3SHR A;  1KFU L;  1U5X A;  2OUJ A;  3C7G A;  5M0T A;  2R0H A;  2WO1 A;  4FTS A;  3ORJ A;  1BBT 2;  4A45 A;  2W95 A;  1CZT A;  1AYN 1;  2EAA A;  3BOW A;  3OB8 A;  3D3A A;  4BQ3 A;  2FDG A;  1YI7 A;  5FZ1 A;  2JE9 A;  2W87 A;  2Z5W A;  4IE5 A;  5D8A B;  1V6N A;  5BNO A;  1RHI 2;  1WA6 X;  4EWD A;  3FMG A;  2XBO 3;  4UFL A;  1EPZ A;  2GN7 A;  4G4F A;  4LKD A;  1PIV 2;  1H8T B;  1KGY A;  2XG3 A;  4E2Q A;  3V0A B;  1XSR A;  3KLS A;  4V2V A;  3BTX A;  2VMH A;  4L0P A;  1E57 A;  4ERO A;  1XOY A;  1NG0 A;  5AC9 2;  1PMH X;  1VP6 A;  4FOQ A;  3MV1 1;  4MHR A;  4JHZ A;  5CIS A;  2DWR A;  5A3L A;  4ZU5 A;  1Q5O A;  4PBP A;  2XLG A;  1KJR A;  3PLQ A;  3MF6 A;  3VN4 A;  5AFB A;  3NQH A;  5L9V A;  4Q4X 3;  3KWV A;  5GM0 A;  1Y7B A;  4KBZ A;  3J7L A;  2CNA A;  1NUK A;  2WQ4 A;  4CEY C;  1IS6 A;  3B3Q E;  3OGV A;  4BIO A;  5EHD A;  1XE0 A;  1COV 2;  2VMD A;  3AL6 A;  2B8M A;  2WT0 A;  3BN6 A;  1RUG 1;  3NNG A;  4IE4 A;  3NST A;  1FYU A;  3NNL A;  5DMY A;  4QPI A;  2P5B A;  3JB8 A;  3PJQ A;  4YW6 A;  1S0B A;  1VRH 1;  1RUE 3;  3FBM A;  2ZGP A;  5FYS A;  5JR7 B;  4CDU A;  3JU9 A;  5FRA A;  1PK6 C;  1G9B A;  2R49 A;  1MVE A;  1B35 C;  2D6K A;  5LRS A;  1K5J A;  2Z4F A;  1RXG A;  3AVR A;  1IKQ A;  3T0B A;  4YZ3 A;  3MIC A;  1R09 2;  3RI9 A;  3ZFG B;  3KV9 A;  3SIT A;  5I8T A;  1RGS A;  2FDJ A;  4CDW A;  5L7O A;  4RGK A;  4MXW A;  1OKO A;  2CAU A;  2UWB A;  3J7N A;  3WDV A;  3NJZ A;  1C1F A;  4XTP A;  5EWS A;  4MV2 A;  1HV0 A;  2XQX A;  1BK1 A;  3NV2 A;  1NX9 A;  4XJ8 A;  1QXP A;  4N43 C;  3WQB A;  2X5I A;  2W1W A;  5J36 A;  2OX0 A;  3Q8A A;  2UU8 A;  5A32 B;  3I3M A;  4IEW A;  2Q1M A;  2QJV A;  4M4R A;  4RS5 C;  1GQH A;  2CGP A;  1D2S A;  2X8K A;  5JZG B;  3VBF B;  4QKD A;  1AR8 2;  4D7S A;  1L3J A;  5FY8 A;  3WP4 A;  2NMO A;  2WT1 A;  2YC2 A;  1X7N A;  3VDA A;  1DZR A;  2JKX A;  2OT7 A;  4FOV A;  2Y6G A;  1LJ7 A;  1HX6 A;  1NCQ C;  2WL1 A;  4GAL A;  4XAE A;  5ACA 3;  1GOH A;  2JE8 A;  1PZ8 A;  2Y34 A;  4MGT A;  1GNY A;  2F4P A;  2WUH A;  1QXJ A;  1EPW A;  2JDP A;  4JDM A;  1HKD A;  1RUI 3;  2QBX A;  3M8L A;  3B69 A;  4H3W A;  4DNY A;  2DVF A;  3RI8 A;  1G9C A;  4XFB A;  5B2G B;  4C8D A;  1BHG A;  2WAO A;  4UFH A;  3KVA A;  4JDO A;  4OMD A;  5APA A;  2VTX A;  5K9Y A;  5H9S A;  2VOW A;  3UK9 A;  1QJX 1;  3N7L A;  2DVB A;  1OLM E;  1OA4 A;  3C3V A;  1O91 A;  3O0V A;  4RR3 A;  1PM4 A;  4XHX A;  3ZN6 A;  4FPK A;  2GC2 A;  4UW3 A;  1GP6 A;  3RGB A;  1UPS A;  1ZRC A;  5LB6 A;  3F95 A;  2R04 1;  5KHI A;  1GQP A;  4LTA A;  1OF3 A;  2HWE 2;  1ND3 B;  4QPG B;  1RJ7 A;  4I01 A;  4Y1Y A;  3MF9 A;  4HPK A;  3RWK X;  4RHV 1;  1DQ1 A;  3RDI A;  4NJ4 A;  4I3P A;  2PN5 A;  5FO9 B;  3ZXK A;  2QQW A;  1UXX X;  3M7A A;  4Q4V 1;  2WC2 A;  1MS3 A;  3KD4 A;  1FOD 2;  1OH3 A;  2JKB A;  4WM7 A;  4LEJ A;  1E5H A;  1H4G A;  1CPM A;  5BV6 A;  5FXZ A;  3ZMO A;  3BTA A;  4FOW A;  2WWU A;  4RGG A;  4GIQ A;  4Q0S A;  1X9P A;  4OHV A;  2XJQ A;  1I3H A;  1YJK A;  4PIY A;  4AI0 A;  1OLR A;  3GM8 A;  2QDN A;  5FFO C;  5H9Q A;  5CFD C;  1MVQ A;  1Q56 A;  3U1X A;  1D2Q A;  2ZHK A;  3UET A;  4HG6 B;  2ETE A;  3EXU A;  3TEZ A;  4CEW C;  4FPE A;  2QVS B;  1BEV 3;  2V5D A;  4NMI A;  5H9R A;  2QQP A;  1PGL 1;  1DQ4 A;  2HLE A;  4PHZ A;  2YYO A;  4LO8 A;  2R07 1;  2QE3 A;  4NWV A;  3DF0 A;  1NY7 2;  4SLI A;  1S0E A;  3VKM A;  1KDK A;  1TVG A;  1ZZ9 A;  2N7G A;  3OY8 A;  2GNM A;  1F31 A;  3HN3 A;  1SLB A;  3N35 A;  1H9P A;  1IS4 A;  1AR9 1;  1HN1 A;  2IC1 A;  2VVF A;  4MXV A;  2VTX J;  1AX0 A;  1W6M A;  1LES A;  3HVD A;  3VL9 A;  3ZSK A;  4H2A A;  2FDF A;  4XZU G;  3D5O A;  2D6P A;  3LDK A;  4LO5 B;  2P37 A;  2FCV A;  1YFX A;  4MYE A;  4URT A;  4LUM A;  4LKS A;  1DYP A;  1S0I A;  4Q0V A;  3UES A;  3ACF A;  3POJ A;  3U4X A;  3ATG A;  4XMA A;  3RSJ A;  4TXW A;  2VZ3 A;  3IAP A;  3AB0 A;  5HV4 A;  1MPX A;  1VBD 3;  2EIG A;  1OD5 A;  2MEV 3;  2IXJ A;  4XCA A;  4ZHN A;  1IPK A;  2R06 3;  1JYC A;  2HBU A;  4LE3 A;  4XJW A;  5HBA A;  2CV6 A;  5LBE A;  1QQP 3;  1SCS A;  3ZYG A;  3V0B B;  2DBI A;  2VUA A;  1JXN A;  2B7Y A;  1QGL A;  1VMH A;  4QD2 A;  5GLZ A;  4MHU A;  2JG8 C;  2K9Z A;  1WA4 A;  5JSO A;  4AFB A;  5HCA A;  4N90 A;  4OI4 A;  3AXD A;  2IFR A;  4AI3 A;  1BK0 A;  5JSR A;  4QXH A;  1WCK A;  2IXL A;  3IB3 A;  1EYB A;  3RJR A;  3VD7 A;  1PVC 1;  1LB2 A;  2HWB 3;  1GNZ A;  1OMI A;  1U5Y A;  1W9W A;  4XUP A;  1S55 A;  3T1L A;  1AXZ A;  3S6P A;  4FPF A;  3OG2 A;  4LBQ A;  4CCL A;  3V56 A;  2JDM A;  1US3 A;  1PO1 1;  1WLC A;  3MLJ A;  1H6Y A;  3Q8C A;  4CP1 A;  4CEY A;  4W6X A;  1A3K A;  3AP7 A;  4IV3 C;  4XDP A;  2WFF 3;  5A6X A;  3ZPO A;  3HMY A;  4IDZ A;  4E2S A;  4BLI A;  1BVP 1;  3NAP B;  3S0M A;  4XZP A;  1CX4 A;  1BMV 2;  3J8F 3;  4QQH A;  4W6Y A;  3Q8F A;  3K3N A;  3NNJ A;  4JRA A;  1JMU B;  2ZX4 A;  4MZU A;  4CCJ A;  1PK6 A;  4LO7 A;  5C3O A;  4DUX A;  5FV3 A;  5BYN A;  1B35 A;  3MW2 A;  4EZH A;  4Q0U A;  4ARY A;  5C4W B;  5CIR A;  5IVV A;  3RYP A;  2BV4 A;  2IUW A;  3ILN A;  4A3Z A;  4XFF A;  1CAX B;  2XML A;  1ND2 B;  4E4D X;  3KT7 A;  4AFM A;  2RS1 1;  4MGZ E;  1ODN A;  1W8W A;  5GLT A;  5GZE A;  4DOU A;  2XJP A;  1DF0 A;  1HQN A;  2GND A;  3A21 A;  1BKZ A;  3RZG A;  4IE7 A;  1ENR A;  2C5D A;  3APB A;  4AZZ A;  4N43 A;  4TN7 A;  5LZ6 A;  5B4X A;  4ES8 A;  4CUC A;  4K9S A;  5ABJ B;  1GP5 A;  1PGS A;  1JHJ A;  1W9Y A;  4XEZ A;  3VBO B;  2J1A A;  5FYZ A;  4GJZ A;  1JZ6 A;  1OXC A;  2ZAH A;  4RS5 A;  5IAV A;  1UU6 A;  1YO8 A;  4DUV A;  1R08 2;  2BYV E;  4Q4W 2;  1XE8 A;  2E32 A;  1AL0 G;  1HB3 A;  2HWD 2;  4FO9 A;  3ACL A;  3ZXL A;  4BA6 A;  4UI9 L;  5A7Q A;  4CE8 A;  2I45 A;  1RUD 1;  4ATE A;  2HEV F;  1Q8P A;  4D6R A;  4GH4 B;  4UXA A;  5KHJ A;  1EUU A;  2ATF A;  5FMO L;  2IVI B;  1GBG A;  1MR5 A;  1ZRF A;  3RZH A;  1NCQ A;  3JBG 3;  4W65 A;  1XU1 A;  4LHN A;  3A23 A;  5DG1 A;  1AL2 2;  4AXO A;  1MEC 3;  3MDP A;  1CR7 A;  4CRQ A;  1SLI A;  3K48 A;  2QQU A;  2W0X A;  2ZGT A;  1QHD A;  1XYN A;  2QQI A;  4DZG A;  4QDR A;  5BNN B;  1HJF A;  5JVV A;  1CPN A;  1TMF 1;  5TSW A;  2HBT A;  3U10 A;  4QU2 A;  4XBN A;  5FXW A;  2NM1 A;  4CA9 A;  5FYH A;  4ZZ8 A;  1SBE A;  2Q8O A;  1H8V A;  5L9B A;  4Y22 B;  3WOG A;  2A5Z A;  2QCS B;  1HRV 2;  5LWB A;  2XPJ A;  2XBO 2;  4PDW C;  4UYB A;  2DTW A;  3GBG A;  4NHK A;  4Z82 A;  3BTY A;  2BGC A;  1N3O A;  2VL4 A;  2OQ6 A;  2Q0A A;  1QXR A;  2XL7 A;  5I0S A;  4FQ4 A;  5CVR A;  3ZO0 B;  4AK3 A;  4MGQ A;  2KA3 A;  4QXK A;  4R52 A;  4M4P A;  4NRM A;  4YVW B;  4AR2 A;  5L36 A;  1PVX A;  2VMF A;  3THT A;  1UMH A;  4GWN A;  4AQT A;  4LBM A;  2ORZ A;  3ZIW A;  4V1P A;  3WCS A;  1KRI A;  2Q4S A;  2ZX0 A;  3SKV A;  1W8Z A;  4DXS A;  5KXD A;  2BOJ A;  3I59 A;  4JGY B;  3OYW B;  4NII A;  3POB A;  4Q4X 2;  1QMJ A;  1V6J A;  2Y38 A;  5FLI A;  3LA2 A;  3MFC A;  4U36 A;  3M3I A;  3BTZ A;  3WNL A;  2A6W A;  2RM2 1;  3TN9 3;  3ZKU A;  2D3S A;  1Q43 A;  3NKG A;  3KF5 A;  2VU9 A;  1S0G A;  1V9U 1;  2Q8D A;  1LNS A;  4B4P A;  2D6L X;  4C0B A;  1RVF 1;  5K4L A;  1F8V A;  3W9A A;  1IPJ A;  5FXV A;  3WG2 A;  1OUS A;  3WDX A;  5IK5 A;  5CFD A;  4LUK A;  3VLB B;  1RUE 2;  5JOY A;  4OI0 A;  1YQ6 A;  4UBH A;  1ULF A;  2BU9 A;  2O8Q A;  4CEW A;  3QH6 A;  1OHF A;  2VCM A;  4FAH A;  3H8R A;  5FZM A;  1Q8V A;  1NA1 C;  3NWK A;  1QOS A;  1UL9 A;  1VE0 A;  2RJ2 A;  4AAP A;  4LHL A;  1PIV 3;  2AZ5 A;  3VBU B;  2NN8 A;  1RUJ 1;  1F4A A;  1UXZ A;  2DCZ A;  1RUC 1;  1DLC A;  1O3Q A;  5DPN A;  3WF4 A;  3MIH A;  4LBN A;  1KDM A;  3NJY A;  1PNG A;  2GP5 A;  2E9Q A;  3BPZ A;  3FJS A;  4NHY A;  4KWU A;  2Y33 A;  5DG2 A;  2EID A;  2E33 A;  1R1A 1;  5FZO A;  5CKN A;  3T4H B;  1JOB A;  3C8X A;  1FAY A;  2JDH A;  3DV8 A;  5HI0 A;  4YM1 A;  2PLV 1;  1W0N A;  4XF0 A;  3IBM A;  2RS3 1;  3DKQ A;  2K2S A;  4GD4 A;  2FBE A;  4Q8L A;  4AF9 A;  1YCI A;  4MVT A;  5FP9 A;  1HXS 3;  3KCC A;  2VJX A;  2P4E A;  5AVA A;  1RUH 1;  1F2N A;  3LFI A;  5T3N A;  1XNT A;  2E7Q A;  5ACA 2;  4IEO A;  3CLP A;  2Z69 A;  2WNU B;  4L8Q A;  3B93 A;  4TSV A;  1OF4 A;  2WS9 1;  4BXF A;  1RUI 2;  1ZVF A;  2ZS6 B;  3IAQ A;  2HYX A;  4BQX A;  5FYV A;  1CAU B;  2VOV A;  2WYS A;  1XBF A;  4Y26 A;  5FKB A;  2RS5 3;  2GH8 A;  3RQ0 A;  3C7E A;  4QPY A;  4KMQ A;  4OZX A;  1JYV A;  1HN0 A;  4YM2 A;  4BH9 A;  1JTZ X;  1OOP C;  2ZEW A;  1GZW A;  3WNN A;  2UWC A;  2WIN B;  4FT8 A;  2E51 A;  1CZS A;  1Y9M A;  1QWR A;  2PHT A;  3WW4 A;  1IQA A;  2DVA A;  2E53 A;  1FPN 1;  2JJ6 A;  4HT1 T;  3KGZ A;  1DDL A;  3CJX A;  4IV3 A;  1ALY A;  2XUE A;  3RJ2 X;  1OI6 A;  3VDD C;  4QWN A;  3LFM A;  4XUR A;  5I0U A;  4WVM A;  2GMM A;  4FPY A;  1JZ4 A;  2CTV A;  1VB2 A;  2VZ1 A;  3ES4 A;  2JWP A;  3WW1 A;  4Y4Y A;  1OA3 A;  1GWL A;  5I91 A;  1PZ9 A;  3ES1 A;  3I3E A;  4YZ4 A;  2FDH A;  3SNM A;  1CES A;  3NV3 A;  5IUQ A;  2P3J A;  4J1W A;  1WLD A;  3EYP A;  5E89 A;  1OH4 A;  3LD8 A;  4XFI A;  4QQO A;  4CXX A;  5IFT A;  2PYT A;  5FY9 A;  2WO7 A;  1SBD A;  3QD6 A;  4BYY A;  4C0H A;  1W90 A;  1AR6 1;  3ZSM A;  5B4N A;  4NRP A;  5T5J A;  3FC0 A;  4GJY A;  3MO4 A;  3ACG A;  1C8N A;  3RZJ A;  2ZOE B;  4M3C F;  2WZP P;  5A7P A;  1FNZ A;  1V6K A;  2B9V A;  2W94 A;  3O1P A;  1E5R A;  3III A;  1FMD 3;  3JCI A;  1BBT 1;  3U11 A;  3HR9 A;  3H1Y A;  1SLC A;  1BEV 2;  1QJU 2;  4MO3 M;  4YZ5 A;  2JDU A;  5LAS A;  1PX3 A;  2CL2 A;  2WZR 3;  4P9X A;  2IXK A;  3H1M A;  1ZBE 3;  4CCN A;  5T50 A;  1WCS A;  3EMR A;  4XET A;  3WD5 A;  5FYB A;  3DXT A;  2WO3 A;  4AEM A;  2ZX2 A;  1RHI 1;  2GME A;  4HKL A;  2WSU A;  4XHB A;  3LA3 A;  1W6O A;  2VXR A;  3DPR B;  4J25 A;  4IL7 A;  1F15 A;  4PQ9 A;  4AGG A;  4JDN A;  1A34 A;  3AMP A;  3HPN A;  3VD4 A;  1QU0 A;  4ZXK A;  1FOD 3;  1UU5 A;  4RQP B;  3AZX A;  3P5B A;  2QFE A;  5AC9 1;  1REE A;  4PI2 A;  5F1R A;  3OSD A;  5DUV A;  3VZJ A;  4BZ4 A;  3LPG A;  2CHH A;  1C28 A;  3B00 A;  5K0U B;  1WBF A;  3QBQ A;  4GZ9 A;  3VKN A;  4CPB D;  3WUC A;  1JOJ A;  2C4X A;  4CDU B;  4IEZ A;  4O65 A;  2JEM A;  2XVG A;  4HET A;  2IZW A;  4IW3 A;  4Z2A A;  1VBD 2;  1H0B A;  3THP A;  2ZML A;  5KBF A;  4YGB A;  5FZE A;  1A78 A;  3BU7 A;  4EYU A;  2PHL A;  3PUA A;  2GH2 A;  3AC0 A;  4NRQ A;  3SEE A;  1COV 1;  3UT0 A;  4COV A;  5FP3 A;  2C0Z A;  5L7O B;  1RUF 3;  2W68 A;  4PDW A;  3ILR A;  1LGN A;  5ANN A;  3ZR5 A;  5CG9 A;  4NHL A;  4OMC A;  5F37 A;  1N1T A;  1QOO A;  2WN3 A;  2D5H A;  2PTM A;  2HWB 2;  4UWD A;  4LO4 B;  1G8W A;  3SLI A;  3GDB A;  4AEK A;  1UYP A;  2Q30 A;  4GA9 A;  4UFI A;  3ZFE B;  1R09 1;  2YRO A;  1UY0 A;  2GNT A;  1WLW A;  1Y9Q A;  2SBA A;  3K51 A;  2JDY A;  2X5I C;  5JAX A;  4BDV B;  3LAG A;  5A33 A;  5FIX A;  2D5F A;  3WIN E;  5A80 A;  1U12 A;  4NHM A;  2BNM A;  1UY4 A;  3WR0 A;  4D7Y A;  2WFF 2;  2ZZQ A;  4EE2 A;  5JSP A;  5LBC A;  4YG3 A;  3N4M A;  4Q1P A;  1UKR A;  4Y4R A;  2XLA A;  5BNP B;  2W1S A;  2A6Z A;  1HQL A;  2WNE A;  3CO2 A;  2CYF A;  2VNV A;  3J8F 2;  1CAW A;  4KGQ A;  4JTN A;  3ST7 A;  1YUD A;  4CTE A;  3M3C A;  1KFX L;  2YV8 A;  4NWW A;  2UY9 A;  2ZGN A;  2RMU 2;  3WDY A;  1QEX A;  4CXW A;  4MET A;  3TEY A;  2P3I A;  1AR8 1;  1W6Q A;  2QZ3 A;  4Z92 B;  1NE4 A;  3N9N A;  3RVH A;  1NA1 A;  2P3K A;  1T2X A;  4Z07 A;  4CCD A;  4R4Z A;  4AGR A;  2LW8 A;  4G9S B;  3AMN A;  5K7P A;  1W8N A;  3AM2 A;  1WCU A;  2DUR A;  3ZN6 B;  5GZD A;  2VCB A;  5JIU A;  3GGL A;  1POV 3;  1T6B X;  4MGY E;  2BEO A;  2KD7 A;  2ZMN A;  3CJI B;  4IGO A;  1RMU 3;  3SCG A;  5FXX A;  3RFR A;  4RR3 C;  3WQ1 A;  3ZOI A;  3AYA A;  5C5U A;  4AI1 A;  5F8P A;  4XJ9 A;  2UWA A;  2AH2 A;  3ILF A;  4DPN A;  4GMP 1;  1J84 A;  2UYB A;  4LBL A;  4WZC A;  2ZAC A;  4HPK B;  3SIS A;  4XBL A;  4K20 A;  2NP0 A;  3T2P A;  3ZIX A;  1S2B A;  2E63 A;  4L11 A;  4CSW A;  4KWJ A;  3NV4 A;  4COW A;  5C8C C;  2XWB B;  2XJT A;  5FY4 A;  5JLV A;  4OHY A;  1VBE 2;  3ACH A;  2GDF A;  1IG0 A;  1ULP A;  2OS2 A;  2V09 A;  2QKD A;  4CYD A;  2F6B A;  4Y1U A;  1WBL A;  2HWE 1;  2VUC A;  3RZL A;  3O14 A;  2FMD A;  3AK0 A;  3CNA A;  4FCA A;  2BGO A;  1OQ1 A;  5A7N A;  5FOB B;  2J1V A;  5A7W A;  3VBH C;  4PF1 A;  1RL3 A;  1W2U A;  1H2K A;  3POS A;  5D2A A;  1V6O A;  5FYY A;  3QOP A;  1GLH A;  2X53 S;  1G9A A;  1OOP A;  1GKB A;  5C9A C;  1W28 A;  5A70 A;  5FPU A;  1P8J A;  3NJX A;  1VAK A;  5FTT C;  3LF7 A;  4B4R A;  1ASJ 3;  3FHQ A;  4LOR A;  4B7K A;  4R9D A;  3T4V A;  3VDB A;  4A7Y A;  5AFE A;  3PMS A;  4N53 B;  4YVS B;  2HWD 3;  4WVW A;  1D4M 2;  3VDD A;  1XC6 A;  1MS0 A;  2VVD A;  1ZZC A;  4YW7 A;  4OHZ A;  5CKM A;  1MQT B;  4IEX A;  4QU1 A;  1JZ8 A;  2ZX1 A;  3OBA A;  2WJS A;  1UIK A;  1YIF A;  5FK8 A;  3WNX A;  2OPK A;  5FYC A;  2DF7 A;  2FHR A;  1PMJ X;  5LK7 B;  4KU8 A;  3RMY A;  4Q26 A;  1O3S A;  1RUO A;  3NKT A;  1GOF A;  2R1D A;  3LCP A;  1DLL A;  5FUP A;  3WNM A;  3FN9 A;  5CEH A;  2HH9 A;  1PO2 3;  3U4S A;  3TEX A;  3CF6 E;  3TN9 2;  3MID A;  3K2O A;  2RE9 A;  2VZR A;  2FDK A;  2VEC A;  3ZYI B;  3J7H A;  3OGS A;  1F5F A;  2RJL A;  4HVO A;  5CA6 A;  3H1W A;  2VXJ A;  1CN1 A;  3JUU A;  4KG0 A;  3UL2 A;  1D7P M;  2D44 A;  1B09 A;  4HK9 A;  4Q5O A;  2XJS A;  3EJK A;  4OHX A;  3N9Q A;  2ARC A;  3KV6 A;  1VAV A;  1ZBA 2;  4XJU A;  4WM8 A;  5IK4 A;  4ASM B;  1HRV 3;  4YG0 A;  2OZJ A;  4QB1 A;  1BZW A;  3VKO A;  5FP8 A;  1MZ6 A;  2X05 A;  3RMX A;  4AQS A;  4JQT A;  1FX5 A;  2ADE A;  2RDN A;  3LA7 A;  3I2K A;  4CDX B;  1H9W A;  2ID4 A;  4NRO A;  2JDA A;  3B7M A;  3WG1 A;  4N9H A;  2ZJC A;  3MUY 1;  4DEV A;  3M2M A;  4KH9 A;  2WLP A;  5CG8 A;  3MFA A;  2YB7 A;  3DKW A;  4YLZ A;  3GHN A;  3K77 A;  4D8M A;  5HV0 A;  2A71 A;  3ZN5 A;  5D1I A;  2Z42 A;  2GU9 A;  3WNP A;  3IDA A;  3J9S A;  3S5Q A;  2VD7 A;  1TZO A;  4FPC A;  4DO0 A;  2NPI A;  2HWF 1;  1WW7 A;  5CU1 A;  3OUH A;  4E4H A;  1DQ5 A;  3N9M A;  3WQ7 A;  1HXS 2;  1UY2 A;  3ZXJ A;  2GC0 A;  2QUO A;  3ETP A;  4CCK A;  4P9W A;  1TME 3;  4AI2 A;  1C1L A;  1I6X A;  3ZMN A;  3KHC A;  1NKG A;  2X10 A;  1H8T C;  3ZYF A;  2ZGM A;  2FDI A;  1X36 A;  4K7J A;  4P9I A;  1CAV A;  1ZZ8 A;  5JXI A;  1M06 G;  1H30 A;  1UOB A;  3X29 B;  1PMI A;  3PVN A;  4UW4 A;  1BMV 1;  4AEJ A;  4KL1 A;  2VMG A;  2FZ2 A;  4XOG A;  2QQM A;  4QHZ A;  2YUE A;  3HNB M;  2RS5 2;  2PEL A;  5FY7 A;  2EVX A;  3PJY A;  5KHK A;  2BWA A;  3LGR A;  5F5C A;  4FPL A;  1MAC A;  1O4T A;  1LHV A;  2NYY A;  1JOP A;  2WA3 A;  4FPG A;  4LLO A;  2YBS A;  4M01 A;  1J83 A;  3ELN A;  3K4Z A;  3WXP A;  4EQV A;  2PFW A;  3H8U A;  4NAO A;  3JZV A;  5FZ7 A;  5KXE A;  4PQQ A;  1UOG A;  2CWM A;  5A3T A;  1QJY 2;  3ZYR A;  1URX A;  3IMN A;  2PAE A;  3KV4 A;  1F9K A;  4Y3O A;  5T54 A;  1AR7 1;  2JG9 C;  2AR6 A;  4ZS3 A;  3GJA A;  4OUM A;  2O8O A;  3PNA A;  1LEC A;  1O5L A;  1DQ0 A;  3AKR A;  3USU B;  5LRR A;  1GOG A;  5F2S A;  4YW5 A;  3ZFG C;  1NLS A;  1VBA 3;  1I1E A;  1K42 A;  1R08 1;  2FZ1 A;  4DXR A;  2WYF A;  4Q4W 1;  1YYN A;  1NAE A;  2ZAA A;  3O0X A;  2LUW A;  5FQ0 B;  3THC A;  1RIT A;  1W3V A;  1W6N B;  4PLN A;  4XAB A;  4XF4 A;  4EN6 B;  2EIC A;  3MUZ 1;  3T3Y A;  3FWE A;  5IVY A;  1H4H A;  1UU4 A;  1GP4 A;  2PHU A;  3GJB A;  3WW2 A;  2WSV A;  3EB7 A;  3N36 A;  4Y20 A;  2PXJ A;  4H7M A;  5DN2 A;  2A7A A;  1AL2 1;  2TEP A;  4IEU A;  1WUV A;  2VZV A;  1XSQ A;  3G6J B;  4ISQ A;  1FMD 2;  3VHR A;  1OFN A;  3H9A A;  5JZG C;  3M1H A;  4QX5 A;  4AHY A;  3ZSE A;  4J6G A;  5DQ0 A;  5JXG A;  1YI9 A;  5CB7 A;  3O12 A;  4A41 A;  4P02 B;  2WZR 2;  1BLZ A;  4Q29 A;  1ZBE 2;  1GWM A;  2WNO A;  3KS7 A;  3LEM A;  4DXT A;  1ZM1 A;  2DBN A;  3ETQ A;  3M4F A;  3ZVX A;  5C8C A;  1OC1 A;  4OQ8 A;  3DN7 A;  3MIE A;  5ISL A;  1DYK A;  2XBO 1;  2JX9 A;  3IT8 A;  1RYY A;  5LEK A;  2IFW A;  5FAX A;  4P14 A;  3I2D A;  4HSJ A;  1US2 A;  2P3Y A;  2QQN A;  3FHI B;  3KZ4 C;  3ZXA C;  5FUI A;  2W5F A;  3MV0 1;  2VUD A;  3TAY A;  2D3R A;  2ZPX A;  4EWE A;  3U07 A;  1SCR A;  4QHB A;  1ONA A;  3VBH A;  3WEZ A;  3LOI A;  4PCR A;  3E5X A;  5CFD B;  3GZU C;  4A2U A;  2PHX A;  5C3P A;  4I0A A;  1VBB 3;  2AEZ A;  4CEW B;  5FY1 A;  1ZX5 A;  5JI7 A;  5IYY A;  1OLM A;  4Q4X 1;  1UPI A;  1U5I A;  4AED A;  4DY3 A;  5C9A A;  3MW4 A;  4NAM A;  3SH3 A;  1HJG A;  4GQ7 A;  5EV7 A;  4FFI A;  1OT5 A;  3FFZ A;  1GNH A;  4QPG C;  2Q1Z B;  4XDO A;  3WSO A;  4KNC A;  1SZB A;  2RR1 2;  3CKH A;  1QJU 3;  5C3Q A;  2UYA A;  1DBN A;  2W3J A;  2J42 A;  1RUF 2;  3DYM A;  3J26 N;  5LW9 A;  4JGZ B;  4S2D A;  3B9I A;  2C1F A;  3TNQ A;  1O7F A;  1RUE 1;  3ECQ A;  4M3C A;  4URA A;  3WP5 A;  1NLQ A;  2YGM A;  1W8H A;  4AQ2 A;  4Q2F A;  4GXL A;  2Y6K A;  3IMM A;  2DCY A;  3OEA A;  5T5P A;  3VHN A;  1O6U A;  1VAL A;  3LQC A;  4ZXE A;  1MS8 A;  4YFZ A;  5FMO S;  2WT2 A;  3NL1 A;  3TOJ A;  1JYN A;  2NQY A;  3OEB A;  3I8T A;  1ZNP A;  4Y1X A;  5LA0 A;  1X9T A;  3O5S A;  3O1T A;  3AMQ A;  5FYT A;  5C71 A;  3HIF A;  4QHO A;  3VBR C;  4CCO A;  4OUS A;  1SFN A;  1SPP A;  1GR3 A;  4Q0Q A;  2DCJ A;  5FBJ A;  4JKL A;  1IG3 A;  1YJL A;  4XVH A;  1R64 A;  2XR4 A;  2AEY A;  2JG8 B;  2QQK A;  4QDS A;  5FYU A;  3RNS A;  2D6O X;  2VUL A;  2P6C A;  2OVU A;  5FZF A;  3OBZ A;  2VUJ A;  1JYW A;  1LOB A;  3E5U A;  4MSV A;  4QQL A;  5EJ1 B;  5ACA 1;  2ZGK A;  4XC9 A;  5FPX A;  2A6V A;  5IVF A;  2BFU L;  4EZ4 A;  4PLO A;  5JOW A;  1NCR B;  1W06 A;  4MLO A;  1MS5 A;  1RMU 2;  1XNC A;  3PU3 A;  1RUI 1;  2XKP A;  4Q4Y 3;  3U14 A;  1IGO A;  2JE7 A;  1D0G A;  4EWA A;  1W04 A;  2J1E A;  4F7Z A;  3FLP A;  1LHW A;  1WMF A;  3WF1 A;  4P5Y A;  2Y0O A;  2ZGQ A;  1LEN A;  2ZHM A;  3MI8 A;  4HSL A;  2V4A A;  5DAX A;  1BJQ A;  4ONU A;  2YBP A;  4WVM B;  4ZON A;  4KGG A;  4CU7 A;  3RZK A;  1IQD C;  3ZXE A;  5AVP A;  5F6K A;  5A1L A;  1JS9 A;  5F6L B;  3I4I A;  1C8M 3;  3HT2 A;  4C1W A;  3H7J A;  3DL3 A;  3DEM A;  3W21 A;  2J1U A;  1K5M B;  4LA2 A;  1MZF A;  3GZT B;  2F4L A;  3MLL A;  3O1R A;  2RMU 3;  5A3O A;  1H8T A;  1APN A;  1S2E A;  3OJB A;  3OBR A;  4K40 A;  5GLV A;  3SMH A;  1W6P B;  1HIX A;  3VBS B;  3V0A A;  5LCW L;  5IT6 A;  3B9C A;  3RPQ A;  2VAU A;  4YRD A;  1IKP A;  3NV1 A;  5K8S A;  3DCQ A;  2D3P A;  5FWJ A;  1UX6 A;  3K3O A;  4YGE A;  2BOI A;  1YQ2 A;  4J1X A;  2A6Y A;  3HJR A;  4JTO A;  3LE0 A;  4XW3 A;  4NIH A;  1FV2 A;  1WW4 A;  5LA9 A;  2HWC 3;  1SDD B;  3UKN A;  3MIB A;  4W6W A;  1ASJ 2;  2VM9 A;  4IND A;  3M70 A;  3NAP C;  3G7D A;  3IPV B;  3Q8B A;  4OZO A;  4FVV A;  1TG7 A;  2PHF A;  3LEI A;  3OBT A;  2VZO A;  3ZN4 A;  3M3O A;  2JG9 A;  4Z2W A;  1LOA A;  2RV9 A;  3INA A;  1VBE 3;  1X8E A;  3D8C A;  3NRU A;  1BEV 1;  2IXC A;  4O61 A;  2A73 B;  3JD7 3;  5C4W C;  4XMI A;  2DFC A;  5F39 A;  1AHS A;  2ZBJ A;  3ZFG A;  3U37 A;  3RZM A;  1UCX A;  4KBB A;  1NZC A;  1XNB A;  2BQP A;  5GKA C;  4X6R B;  1ND2 C;  3R05 A;  2DV9 A;  1AVB A;  3ZXG A;  4XIL A;  1L7Q A;  5CFC B;  2D93 A;  4IXL A;  1ZRD A;  1XJA A;  2ZHN A;  5LBB A;  2B39 A;  2BNN A;  4TTG A;  1YRZ A;  1PO2 2;  4HBN A;  4XFH A;  3ZKY A;  4XUN A;  3KHB A;  5ABJ C;  5JIA A;  4UAP A;  5A3W A;  5KC6 A;  3PVB B;  4FXK B;  1GUI A;  1XU2 A;  3OUI A;  1YXW A;  4FPH A;  1W0O A;  3O0W A;  3VBO C;  4D69 A;  5T5L A;  4R9B A;  4RFT 0;  2I2S A;  1UF2 C;  2B4K A;  5JZG A;  2VOK A;  2YU2 A;  4XUQ A;  3HD8 B;  1F35 A;  2YY1 A;  2HJI A;  3FX3 A;  3KSC A;  1OPO A;  3O7O A;  3OF1 A;  4GB3 3;  4IUG A;  4GH4 C;  5D21 A;  5FZ4 A;  1VBD 1;  2MEV 1;  4N7I A;  1PZ7 A;  1QJX 2;  5A6Y A;  2E31 A;  2R06 1;  1DGR N;  4Y1V A;  1D4M 3;  4ITC A;  1Z7S 3;  5EIY B;  4NN0 A;  4I0B A;  3D0J A;  4BWO A;  1QQP 1;  1PX4 A;  2WNV B;  1RUN A;  1ZZ7 A;  3HWJ A;  2R04 2;  2ZHL A;  3POW A;  4K8F A;  1K3I A;  2XVL A;  4DIN B;  5FZC A;  2W1Q A;  3N7J A;  1BXH A;  1YQ5 A;  1AJK A;  2HWB 1;  4EJR A;  5FJK A;  1RC6 A;  2TBV A;  1AX2 A;  2JIJ A;  4BQ2 A;  1CZV A;  5BNN C;  3PVO A;  1UNB A;  2DU0 A;  4YPJ A;  5FCC A;  4E27 A;  1N3P A;  1NQD A;  1LTE A;  2A3X A;  5EZW A;  5I0T A;  3R0R A;  1UZV A;  2GC3 A;  3ON7 A;  3B02 A;  2VO5 A;  4XQW A;  3UYJ A;  3WP6 A;  1NYW A;  1ST8 A;  3VZK A;  5JUV A;  3OOX A;  1UZY A;  1TME 2;  4DUW A;  5DDJ 3;  3LSD A;  2WFF 1;  4QPG A;  1ZBA 3;  4AGV A;  4BME A;  4E2G A;  4FFG A;  1MS4 A;  2VQ0 A;  3J7M A;  2J22 A;  1UMI A;  4ATF A;  2G19 A;  4F8A A;  2FD8 A;  3H8O A;  4YVW C;  3J8F 1;  4XPV A;  3NW4 A;  4K8R B;  4LJH A;  4RYD A;  1ODM A;  1FXZ A;  2R7E B;  1QNY A;  1FT9 A;  1OVP A;  2BVV A;  4XXP A;  3PIJ A;  4YG6 A;  5A6Q A;  1PGL 2;  3PUS A;  4IE0 A;  3UKT A;  3PHM A;  3TYJ A;  3BPS A;  1TEI A;  4PI0 A;  3U75 A;  1HDK A;  1N1V A;  3JB4 C;  1EUT A;  5BNQ A;  4B7E A;  1POQ A;  2R07 2;  2OA2 A;  2H0V A;  2VBP A;  3AP5 A;  3WQ0 A;  3AKQ A;  1VB4 A;  1XRU A;  3OTF A;  3S5A A;  3UGG A;  2BBA A;  2ZA9 A;  4CZS A;  2XVK A;  3P3N A;  2RHP A;  2H6C A;  4LOS A;  3VBR A;  3VGI A;  3O1O A;  1H1A A;  1QKQ A;  5A3M A;  4FFF A;  1HRI 3;  3P3P A;  4QKN A;  3LKJ A;  3WNO A;  4BHP A;  1WCD J;  3KB5 A;  3VBU C;  4EV0 A;  5HCH A;  1VBA 2;  1A8D A;  1J59 A;  4BU2 A;  3OGJ A;  2JDK A;  1OBN A;  1RIR A;  2ARB A;  3KM5 A;  1UZW A;  1WMX A;  4PBO A;  3CL1 A;  2GP3 A;  5H9P A;  1JN2 P;  3E5Q A;  2Q1F A;  3K4A A;  2HYK A;  2ZEZ A;  3JBG 1;  4FOY A;  5JI9 A;  1V6L A;  3I54 A;  1EAH 3;  3JQW A;  4K1Z A;  2AUY A;  1MEC 1;  4R9A A;  3LB9 A;  2JIG A;  5CAD A;  3FLT A;  1OFS A;  1LR5 A;  3LEG A;  2XWJ B;  1JU3 A;  3GBF A;  1ENX A;  1LED A;  4NOT A;  3ZSL A;  4LK7 A;  4IQP A;  3VB9 A;  4IV1 C;  1NE6 A;  1QJY 3;  5J37 A;  2E26 A;  1C57 A;  2QZ2 A;  3WP3 A;  3S7E A;  4I3G A;  5GZG A;  2ZGU A;  2VZT A;  5DUW A;  1QDO A;  3K46 A;  2JIC A;  1MS1 A;  2W52 A;  3V0B A;  2A3Y A; 
#chains in the Genus database with same CATH homology
 1JZ7 A;  1GNY A;  2WUH A;  2VTF A;  2CDP A;  3VD9 A;  2QBX A;  2BGO A;  3DYP A;  2C26 A;  1BHG A;  2WAO A;  2J1V A;  1UWW A;  4PF1 A;  4OMD A;  4A44 A;  1O8S A;  1P8J A;  1I5P A;  3NJX A;  5JMO A;  1GQP A;  1OF3 A;  3FHQ A;  3VDB A;  3FHA A;  4OUE A;  1XC6 A;  2YFZ A;  5G04 L;  3K4D A;  1JZ8 A;  1UXX X;  3OBA A;  2V4V A;  1PMJ X;  2VZS A;  2RVA A;  2VZP A;  1GOF A;  3WNM A;  3FN9 A;  2ZEY A;  4LPL A;  2VZR A;  1JZ3 A;  3GM8 A;  3J7H A;  3OGS A;  4CU6 A;  1JU4 A;  3UET A;  4HG6 B;  4E8D A;  1D7P M;  4PT6 A;  1UY3 A;  2WZE A;  2V5D A;  2HLE A;  5G05 L;  2YFU A;  2VZQ A;  3P6B A;  2EIB A;  4QB1 A;  2X05 A;  2WN2 A;  3UNP A;  1TVG A;  5JXJ A;  3HN3 A;  3T09 A;  3I2K A;  3VDC A;  2ID4 A;  1HN1 A;  3I2G A;  2JDA A;  3WF3 A;  5EJZ B;  3MUY 1;  4DEV A;  3CIH A;  2YB7 A;  4XZU G;  4D8M A;  3K77 A;  4W50 A;  3C7O A;  4MGS A;  4QX1 A;  3WNP A;  3IDA A;  4LKS A;  3UES A;  3ACF A;  4TXW A;  2VZ3 A;  3IAP A;  5A1A A;  1MPX A;  4JKM A;  1UY2 A;  3ETP A;  2VME A;  1GMM A;  4GWI A;  3OGR A;  4LHS A;  1NKG A;  2X10 A;  2VMC A;  2XHN A;  2WAB A;  5JXI A;  3IB3 A;  3VD7 A;  4ARX A;  4XUP A;  1W9W A;  2ZXQ A;  2QQM A;  1JI6 A;  2JD9 A;  3HNB M;  5F7U A;  3OG2 A;  1J83 A;  3K4Z A;  3GXU A;  1US3 A;  1JZ2 A;  1H6Y A;  2EIE A;  2J7M A;  4QDQ A;  3HEI A;  4PQQ A;  2W46 A;  3ZM8 A;  1WCQ A;  4MOA A;  2ZEX A;  2W9X A;  4E8C A;  1UYY A;  4P00 B;  4D0Q A;  3FL7 A;  3I2J A;  1KEX A;  2Y6L A;  4ZY9 A;  1GOG A;  5IJR A;  4DUX A;  1K42 A;  1UYZ A;  4ARY A;  4DXR A;  1NAE A;  3A22 A;  4A3Z A;  4CUB A;  2VQU A;  3THC A;  4BK4 A;  4UOJ A;  2EIC A;  3MUZ 1;  5C70 A;  2DDU A;  3A21 A;  3EB7 A;  5DN2 A;  3T2Q A;  2WQ8 A;  2VZV A;  5B4X A;  4CUC A;  1JHJ A;  2J1A A;  1JZ6 A;  2YC4 A;  5DQ0 A;  5JXG A;  4OYU A;  4DUV A;  4A41 A;  2E32 A;  4P02 B;  4UI9 L;  5CYY A;  4DXT A;  4QX3 A;  1EUU A;  3I3D A;  4LQR A;  2PQS A;  2QQJ A;  3T2O A;  2Y64 A;  4MAD A;  4BXS V;  4A6O A;  1UX7 A;  1RYY A;  3A23 A;  4BK5 A;  3PUI A;  1UY1 A;  4ZZ5 A;  3I3B A;  1GU3 A;  1US2 A;  2QQN A;  5FUI A;  2W5F A;  3MV0 1;  1CIY A;  2OKX A;  2QQI A;  3WEZ A;  4QDR A;  3WF0 A;  1F4H A;  4W4Z A;  5IFP A;  2Y6H A;  2Y6J A;  3F2Z A;  1JZ5 A;  5IYY A;  4ZZ8 A;  2DCK A;  1OT5 A;  3P1I A;  3VD3 A;  3WSO A;  3JXS A;  3I2H A;  3CKH A;  2VR4 A;  2W3J A;  2VL4 A;  3DYM A;  4MGQ A;  5LA1 A;  3ECQ A;  4P08 A;  4M4P A;  3NJV A;  2VMF A;  1UMH A;  2ORZ A;  2Y6K A;  3OEA A;  1UYX A;  3SKV A;  4DXS A;  2XON A;  4QPW A;  3LQC A;  4QAW A;  4ZXE A;  3T0A A;  1SHW B;  3WNL A;  2BGP A;  1H6X A;  1JYN A;  3VD5 A;  3OEB A;  3CDZ B;  5LA0 A;  2VC9 A;  5C71 A;  1LNS A;  3WNK A;  4A4A A;  2DCJ A;  5I0D A;  3CMG A;  4JKL A;  4XVH A;  1R64 A;  4QDS A;  2QQK A;  3T0D A;  1K45 A;  1W8O A;  3W5N A;  4DEQ A;  1W9T A;  2RJ2 A;  2L9L A;  5LA2 A;  1JYW A;  1DYO A;  4A42 A;  1F4A A;  1UXZ A;  1DLC A;  5EJ1 B;  3PUH A;  5DPN A;  3WF4 A;  4KWU A;  3THD A;  2XOM A;  1W9S A;  2C9K A;  3ACI A;  2EID A;  2E33 A;  3C8X A;  4XUO A;  3C7F A;  4KI5 M;  3SEP A;  2J1E A;  3WF1 A;  1ULP A;  1W0N A;  4P5Y A;  2ORX A;  1XPW A;  4CU7 A;  1IQD C;  2VJX A;  2W92 A;  1XNT A;  3BGA A;  1K12 A;  2J1S A;  1SG3 A;  2VQT A;  2J1U A;  2Y8K A;  1OF4 A;  1ULO A;  1UZ0 A;  3IAQ A;  4CU8 A;  2HYX A;  1JYX A;  3HNM A;  5LCW L;  2WYS A;  3CQO A;  3C7E A;  4QX2 A;  4KMQ A;  1JYV A;  3DYO A;  2ZEW A;  3WNN A;  1YQ2 A;  1CZS A;  3CZU A;  3HJR A;  3LE0 A;  4BJ0 A;  3ABZ A;  2YG0 A;  2WZ8 A;  1SDD B;  4AG4 A;  2JE8 A;  2VM9 A;  1CX1 A;  4XUT A;  4OZO A;  4XUR A;  1TG7 A;  3LEI A;  2VZO A;  4QB2 A;  1JZ4 A;  2VZ1 A;  3I2F A;  2RV9 A;  2WBK A;  3I3E A;  3NRU A;  2W47 A;  3EYP A;  1L7R A;  1O59 A;  1OH4 A;  5HXM A;  1WKY A;  3E1F 1;  4JX0 A;  3U37 A;  5IFT A;  3I97 A;  1L7Q A;  5B4N A;  2V72 A;  3CZJ A;  3MBW A;  3MO4 A;  4GWJ A;  2VZU A;  3T08 A;  3ACG A;  4TTG A;  3HOB A;  3SKJ E;  2B9V A;  4XUN A;  5HPO A;  2W94 A;  2WDB A;  3III A;  4UAP A;  2X09 A;  1GUI A;  4QX0 A;  4CUA A;  2QQL A;  3LPF A;  2B4K A;  5IHR A;  4MO3 M;  4XUQ A;  1PX3 A;  4AAX A;  3C7H A;  4IUG A;  2W91 A;  2WO3 A;  2E31 A;  2WO2 A;  2LS6 A;  5EIY B;  1OD3 A;  1PX4 A;  1W99 A;  2WAA A;  2VCA A;  3A7Q A;  3VD4 A;  3C7G A;  3HPN A;  2WO1 A;  1K3I A;  2W1Q A;  2W95 A;  1CZT A;  4A45 A;  5JXH A;  3LPG A;  3OB8 A;  1CZV A;  3D3A A;  4GZ9 A;  4YPJ A;  2C4X A;  2J1T A;  2W87 A;  3K75 B;  4Z2A A;  2VO5 A;  4ET7 A;  4QB6 A;  5JUV A;  4DUW A;  3AC0 A;  3SEE A;  4FI9 A;  1KGY A;  4CU9 A;  2J22 A;  1UMI A;  3LEK A;  4OMC A;  4L0P A;  1PMH X;  2WN3 A;  3MV1 1;  3WF2 A;  4JHZ A;  4RYD A;  2R7E B;  3GDB A;  3NQH A;  1UY0 A;  3I2I A;  2CDO A;  2BZD A;  1NUK A;  4BDV B;  1EUT A;  3OGV A;  2VMD A;  3BN6 A;  3NNG A;  1UY4 A;  5DMY A;  2BBA A;  2J1R A;  2W1S A;  5J1X A;  5JR2 A;  2VOT A;  4CVU A;  2Z4F A;  4RN5 A;  4W8J A;  3T0B A;  1DP0 A;  1XNA A;  2QQO A;  3WNO A;  1T2X A;  2LW8 A;  3DEC A;  1O8P A;  3HNY M;  1W8N A;  2VCB A;  3GGL A;  2XQX A;  3K4A A;  1NX9 A;  2KD7 A;  2ZEZ A;  3WQB A;  5C7G A;  2W1W A;  4M4R A;  3LEG A;  1J84 A;  1JU3 A;  2BER A;  2VCC A;  5CZK A;  2E26 A;  3T2P A;  2W1U A;  2YC2 A;  3W5M A;  3VDA A;  2VZT A;  2JKX A;  3K46 A;  2Y6G A;  4JKK A;  3ACH A;  1GOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...