3GGLA

X-ray structure of the c-terminal domain (277-440) of putative chitobiase from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr324a.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
b'DTYTGFCIIKEGTKISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPIGRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative chitobiase
publication title Northeast Structural Genomics Consortium Target BtR324A
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 30
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3gglA00
3T08A 3OEAA 2VZ1A 4A42A 2XONA 2V72A 3PUIA 2VCBA 3CMGA 3ACIA 2JDAA 4XUOA 1PX3A 3PUHA 2VL4A 3LQCA 2QQNA 4IUGA 4RYDA 3WF0A 1O8PA 1XNAA 2VZTA 2J1AA 4A6OA 2ZEZA 2BERA 2VZQA 4JHZA 3WNOA 4FI9A 2CDPA 3OB8A 5IFPA 3T0DA 2HYXA 3WNMA 1H6YA 4YPJA 3ACHA 3GGLA 4A44A 2X09A 4MOAA 3P6BA 3CDZB 2V5DA 1XC6A 4A41A 4ARXA 4CVUA 2L9LA 2W91A 3K46A 1D7PM 4A45A 1OH4A 2WO2A 3IIIA 2EIDA 2VMEA 4QDSA 3HPNA 1UYZA 2WDBA 2J7MA 3HNYM 3IAQA 3C8XA 2EIEA 4OYUA 1W9TA 4OUEA 4AG4A 2VM9A 4P02B 1JYXA 4D0QA 1CZTA 3WNPA 3I2IA 4P00B 2ORXA 4W50A 1F4HA 3C7FA 2B4KA 5LA0A 4XZUG 3T0AA 2KD7A 1NX9A 2EIBA 2VZRA 4QPWA 3HNBM 2VC9A 4CU7A 5LA2A 1UWWA 1W8OA 1WKYA 1PMHX 5IYYA 3WNKA 2J1RA 2VJXA 3CZUA 3CIHA 3FHQA 3MUZ1 1LNSA 2J1EA 2W95A 4QB1A 2J1SA 1GMMA 1L7RA 3FHAA 3BGAA 5HXMA 2BZDA 2YC2A 4UOJA 2VMDA 3ETPA 1TG7A 2WABA 4DUXA 1XPWA 1OD3A 4D8MA 2W5FA 1NAEA 4PF1A 3HJRA 1W9SA 1GNYA 1JZ3A 1J84A 2W46A 4OMDA 2DCJA 2Z4FA 3J7HA 1ULOA 1JZ8A 1SG3A 2X10A 5IFTA 1UX7A 3SKJE 1DP0A 1UZ0A 3GXUA 3THCA 1UYXA 4M4RA 1R64A 3WNNA 5IHRA 2ID4A 4BK5A 4LKSA 3P1IA 3VD4A 3I2JA 2YC4A 2XHNA 3ABZA 1W9WA 1JHJA 1W0NA 3WF1A 1JI6A 2E31A 2ORZA 4LPLA 3OG2A 4RN5A 1NUKA 2VMCA 1UXXX 3K77A 2J1UA 4A4AA 3GDBA 3SEPA 4E8CA 2VCAA 4MGQA 1I5PA 3T09A 5J1XA 1JYNA 3LEGA 1PMJX 3ECQA 1JZ7A 4QDRA 2C26A 2QQKA 4KWUA 4QAWA 4DXSA 4UAPA 2X05A 5DQ0A 3DECA 3WSOA 2WO3A 2YG0A 4TTGA 1SHWB 2W1SA 3K4AA 3W5MA 2ZEWA 5JR2A 2VCCA 2C4XA 3HNMA 2WZ8A 3CZJA 4BK4A 4QX3A 5JUVA 3SEEA 2W1QA 4QX1A 2LS6A 1JYVA 1JZ4A 1JZ2A 1NKGA 3MUY1 3THDA 3NJVA 3A21A 3VD5A 2WN2A 2QBXA 2Y64A 2JD9A 1YQ2A 4MO3M 1JU4A 2WUHA 1L7QA 3HN3A 1HN1A 3NRUA 3IB3A 4BDVB 2VZPA 3HEIA 5CYYA 4JX0A 1JZ6A 2VQTA 3I97A 2HLEA 4W4ZA 2Y8KA 4CUAA 5EJ1B 4DXTA 3VD3A 4GZ9A 5JXHA 1BHGA 2WN3A 2W3JA 3I2GA 3IDAA 4JKKA 1IQDC 3VD9A 3MBWA 4CU6A 2W92A 3A23A 3LPFA 1KEXA 4UI9L 3LEKA 4ET7A 2E32A 1GOFA 1UY1A 1SDDB 4LQRA 2BGPA 2VR4A 3FL7A 2VQUA 4KI5M 5FUIA 5JXIA 1US3A 2XQXA 4QB6A 3WNLA 2CDOA 3BN6A 4KMQA 4XUQA 4MADA 2WBKA 3ZM8A 4XUTA 1RYYA 1OF4A 3A7QA 3F2ZA 3HOBA 3MO4A 3UESA 5JXGA 1ULPA 3OBAA 1GQPA 3WF3A 2OKXA 4OZOA 3AC0A 3T2PA 2YB7A 3MV01 4DUVA 2W94A 3D3AA 1UMIA 1P8JA 1OT5A 5G04L 2VOTA 4QX0A 3DYMA 2ZEYA 2Y6KA 3UNPA 2EICA 4QX2A 2RJ2A 2VO5A 1OF3A 3DYPA 2PQSA 4JKLA 3OEBA 2WAAA 2J1TA 1GU3A 2QQLA 5C70A 4P08A 5F7UA 3EYPA 4PT6A 4XURA 1EUUA 2ZXQA 3C7EA 1T2XA 4DUWA 2WO1A 2JKXA 3T2QA 2QQOA 4CUCA 2RVAA 1GOGA 2E26A 4CUBA 1GOHA 3C7OA 1K45A 2VZVA 5HPOA 2BGOA 4JKMA 4ZY9A 4ZZ5A 2WZEA 3E1F1 3T0BA 4MGSA 4GWIA 1K42A 4GWJA 5C71A 3VDBA 1UYYA 4QDQA 3CQOA 3GM8A 1JZ5A 5B4XA 5LCWL 4E8DA 4A3ZA 4OMCA 2Y6LA 4HG6B 3VDAA 3OGVA 4XUNA 1O59A 2JE8A 3K75B 2W1UA 1CX1A 3EB7A 1W99A 1H6XA 2WAOA 5EIYB 3A22A 2VTFA 4BJ0A 4W8JA 2QQMA 4XVHA 1MPXA 5C7GA 3K4ZA 2R7EB 4QB2A 4LHSA 5B4NA 2QQJA 4ZXEA 1UY0A 4PQQA 2DDUA 2B9VA 5I0DA 5G05L 1O8SA 2BBAA 3C7GA 4XUPA 3NQHA 3OGSA 1TVGA 5DMYA 3WF2A 3VD7A 4BXSV 4CU9A 1DYOA 1KGYA 3ACFA 1K3IA 2Y6GA 2VZOA 3VDCA 3WEZA 1UY4A 2YFZA 4ARYA 3FN9A 3IAPA 1UY3A 2Y6JA 5IJRA 3NJXA 3CKHA 3I3BA 2YFUA 3LEIA 4Z2AA 2J1VA 2VMFA 1EUTA 3I3EA 3I2KA 3OGRA 3UETA 1J83A 5DPNA 1F4AA 2QQIA 3K4DA 2V4VA 3C7HA 1UMHA 3I3DA 1WCQA 5EJZB 2VZSA 1GUIA 4P5YA 1UXZA 5A1AA 2VZ3A 2RV9A 1DLCA 2W9XA 2E33A 2WQ8A 1PX4A 3WQBA 3DYOA 3SKVA 3WF4A 1US2A 3LE0A 5JXJA 1CIYA 4DEQA 4AAXA 3ACGA 4CU8A 3U37A 3T2OA 3LPGA 1CZVA 2W87A 2W1WA 4ZZ8A 1UY2A 5JMOA 3JXSA 1XNTA 5DN2A 2C9KA 2VZUA 2DCKA 2ZEXA 2WYSA 2W47A 1K12A 2Y6HA 2LW8A 4DEVA 1CZSA 3I2HA 4L0PA 1JU3A 1W8NA 3W5NA 5LA1A 3NNGA 1JYWA 2XOMA 5CZKA 2J22A 3I2FA 4DXRA 4M4PA 3MV11 4TXWA
chains in the Genus database with same CATH superfamily
1W28A 1QJFA 3OEAA 4WZFA 1VBC1 3ZKUA 4XJUA 1ZA7A 2DCZA 2XONA 2XUMA 4M3CE 5FYHA 1OD5A 2DTWA 2VCBA 3MIDA 1DCSA 1QXJA 3TBDA 1NXMA 1V6LA 1NA1B 3J8F2 1RUG2 1WMXA 2ZS6B 3GJAA 4URTA 4CP0A 5F1RA 3URFA 2XMLA 4AHZA 2VXJA 1GP5A 2WJSA 2QVSB 2WZR3 2GALA 3KT4A 4QPGA 4RYDA 2BTVC 5FZ6A 2PQQA 2Q5TA 4YG0A 4WZCA 5J48A 5K8SA 1BKZA 4LBQA 1PGW1 4A6OA 5GZGA 5JI9A 3MFCA 3Q8AA 1JTZX 4FI9A 4XFBA 4RQPC 5AC93 4BQ3A 3NV2A 3T0DA 1H6YA 1QJY3 2DF7A 3MHZA 2WZPP 1IPSA 4M0NA 3E97A 3SISA 3WHUA 3VBSC 1DQ1A 2ILMA 5FKBA 1W6OB 1EYBA 3HR9A 1QKQA 4MOAA 4Q4Y2 5IVCA 1SPPB 5GZFA 1U5IA 1RUC2 1XC6A 2CAUA 2O14A 4PI2A 1RINA 1DBNA 1NE6A 1UU4A 5GZDA 1W06A 2WLPA 4Q0PA 1LGBA 4PBOA 5BNPB 1S2EA 2PAEA 2WT1A 2MHFA 2WO2A 2NYYA 3JZVA 1LKNA 1QJU3 1Y4WA 2YYOA 1C8M1 2WDBA 3OYWA 3QCWA 2ARXA 2JG9A 1XE8A 4HZFA 4UFLA 4AR2A 3KF5A 4MGIE 5FIXA 4P02B 2YC0A 1PZ8A 1ZBA2 2DUOA 4Y4RA 1C3HA 4MHRA 4NIAA 1LESA 3TNQA 5FYBA 4XC9A 2A70A 2B4KA 4G4FA 3VBUA 5BNOB 3T0AA 5A7WA 2YMZA 1N1YA 4O7XA 3HT2A 1NCRB 3B02A 4AHYA 3HD8B 2EXJA 3S6PA 2DU1A 5F6LB 5LA2A 1UWWA 1KJLA 3FBMA 1KFXL 3IIAA 4IE7A 4JQRA 1QJX1 3H42B 3CZUA 3J9SA 5EHDA 3POEA 3ROUA 1L7RA 1PK6A 5JR7B 4OI1A 1NQDA 1Z7S2 2Y6FA 4L8QA 4AEJA 3M3OA 1TZOA 3E6BA 2HWE2 1HXS3 1GZCA 1OPMA 5FWEA 3T2TA 3VHOA 5D8AB 4G9SB 4O65A 5FPUA 2VMDA 3ZIWA 3H1YA 1ASJ1 4Q0QA 4AGGA 1TG7A 3UK9A 4R9DA 4IGOA 4FAGA 2E51A 5BNQA 3U0ZA 2WS92 5ACA1 1K5JA 4YARA 2D97A 1OD3A 1OHFA 4BMEA 3ZFGA 2QDNA 1NAEA 3LA3A 5JR2A 1NE4A 2ZHNA 2ZGSA 1OA4A 5CEHA 3PVOA 4WM8C 4AI2A 3ILRA 4FOVA 3ACLA 2DCJA 4XDOA 4GH4A 4AVAA 4NMIA 2A75A 4Q1RA 4PIXA 1SG3A 5FPLA 1HRI2 5IFTA 5A1FA 5FWJA 4EZHA 1DP0A 2OS2A 5AVPA 4K1YA 3UGGA 4LBKA 3BALA 4BK5A 3P1IA 2D93A 1YWKA 3I2JA 4XBNA 4BU2A 4CP1A 4XIKA 1UMZA 2R1DA 3WD5A 2YC4A 4CEWC 4U2AA 4GMP0 4GULA 1LGCA 1D2QA 3MLLA 4CXXA 2J42A 2F17A 3U78A 5SV5A 2DBIA 3GCXA 1VPHA 1W0NA 3LF7A 3S5AA 1JI6A 1RJ8A 4IEPA 3VKFC 2B5HA 2ORZA 3ZPOA 1KFUL 3OTFA 1DQ4A 2WC2A 3OG2A 3KCCA 5A6QA 3K77A 4XF1A 4Z1VA 5CBLA 4UXAA 2JDUA 2QQVA 1SMVA 2DTYA 1JYNA 1W6MA 5A3LA 4JHTA 4LBQD 1SCSA 4BQ1A 4YNIA 4QDRA 4Y4YA 2A71A 2G9ZA 2P5BA 1BBT3 3VBFB 2C26A 1W6NA 3USUA 1NCQC 2RE9A 2BQPA 3R4UA 3O7OA 1BXHA 3POWA 1Q5OA 4QAWA 3IWZA 5FPBA 4DXSA 5FPXA 2X05A 5LRSA 3HQXA 1EPWA 1STMA 2ZGTA 3RGBA 3J7LA 1YNAA 1S55A 2A6ZA 3K4AA 4YM1A 3PL0A 1BK0A 2ZEWA 2RM21 3W5MA 2BW8A 3JD72 5FYYA 1H4GA 4IGQA 5FZ7A 4RFRB 1OI6A 1AVBA 2QUOA 4F8AA 5I93A 2ZGNA 1LTEA 1YYNA 1COV3 2LALA 1ENSA 3F95A 3VKLA 3OF1A 1NYWA 5T54A 4ES8A 5A3MA 2LS6A 5JZGA 4NRQA 2RS32 4QQPA 1OLMA 1ZX5A 1V70A 4LR4A 4EQVA 3M3CA 4XMIA 2R072 5L7OB 3WDUA 2O0OA 1JZ4A 1JZ2A 1NKGA 1C57A 4XQ4A 5I0SA 3IMMA 4N9IA 1RUE3 5GJ6A 1SLLA 2KXLA 3TB0A 3O1UA 3B3QE 4HK8A 2WNOA 5T5OA 2LUWA 3CHXA 4HVOA 2JD9A 3AP9A 1SQ4A 3AKSA 3DV8A 3KT1A 1L7QA 1NG0A 1OH3A 2JDHA 4OHXA 1HN1A 1DLLA 5F3CA 1F2NA 3NRUA 4Z82A 3RWNA 1C5HA 1AXZA 2YDEA 4XJAA 5DAVA 2VZPA 3P3NA 3POIA 5A3OA 3WHTA 3I2OA 3GF6A 1C5IA 1AR83 3GALA 4W4ZA 2HEYF 2VXRA 2IXCA 2K46A 5EYXA 1H2MA 3I4IA 4AEDA 3MIBA 1N3OA 4XMAA 5FZOA 1ND2B 5FUNA 2RM23 4GZ9A 1ZA4A 2RMU2 5DAWA 4AVTA 4EN6B 1BHGA 4URAA 3DL3A 4IEZA 4L11A 2W3JA 4A7ZA 2G9FA 1IQDC 1V9U1 5C8CB 5CG9A 2WINB 4V1PA 3WZ1A 4FBFA 3SCHA 4HONA 1LAJA 3ILNA 3HMYA 5CKMA 4H14A 2QDRA 3TRSB 5FY4A 1KEXA 5GLWA 5SV8A 3LEKA 1PIV2 4ET7A 3BOWA 4AGRA 4HXCA 5BNNB 2AEZA 3D6EA 3WUDA 1R1A2 3D0JA 4LQRA 1GZWB 2EALA 4H2AA 2VR4A 1JUIA 2VNRA 2ADEA 2VQUA 3GBWA 4CDXB 2ZKLA 4B4PA 5IAXA 2D5HA 1E5IA 2GNMA 4O9EA 4UBGA 4EROA 2JIJA 4C1XA 4LO7A 1GP4A 3VZOA 4XHXA 1YQ6A 5DAQA 5DUWA 4RGAA 1RTVA 2RJKA 2V4AA 3ZFFB 5J3UA 4E27A 4PQ9A 1OA3A 4GWMA 2D6PA 3I3QA 3GHMA 5A33B 4NIDA 1D4M1 1BCXA 1MS3A 1PMIA 2OKXA 4QMAA 2WFF2 1ZBE1 2VPVA 1RXGA 5IK5A 4WVMA 4XXPA 3V0BA 4INDA 5IT6A 5LK5A 1V9U3 2H0VA 5JOZA 3MYXA 2E6VA 1P8JA 1OT5A 1YUDA 2WSUA 2B9UA 2VOTA 3CL1A 4QX0A 2Y6KA 2HWC2 3M4FA 3ES1A 5DDJ2 3ZFEA 2W68A 2RJ2A 2X29A 1O5UA 3O1SA 4Q4X2 3OEBA 3N3HA 2B42B 1GU3A 2J1TA 2QQLA 1HJGA 1Y9GA 2PLV2 4HSLA 4CDUA 1OOPB 1RUJ1 2AGSA 5C3OA 4LE3A 2VUAA 4Y20A 1EUUA 3ITQA 4V2WA 3LIGA 3VBRB 4S2GA 1QNWA 4DUWA 2GH2A 5CB7A 4JDNA 1D4VB 1UZZA 1XYOA 2RVAA 4M01A 3D82A 4XILA 4YG3A 4BOWA 2BGOA 5DUVA 4N43A 1VBE1 4ZY9A 3ZXGA 2P3JA 4ZZ5A 1H9WA 2WZEA 4Y1ZA 5L73A 4GMP1 2UYAA 2XQRA 3O12A 3VDBA 1IPJA 1Y43B 3UYJA 4QDQA 3ZYGA 2SLIA 3GM8A 1XU2A 1CAXB 4QPGB 5B4XA 3HIFA 3ZSEA 5LCWL 2SBAA 4E8DA 3PU3A 2HYKA 5FJKA 3W59A 1CPMA 4LBQB 5F3EA 2ZX0A 5JSPA 1ZBE3 2LTNA 1O4TA 1EAH2 3OGVA 5T50A 2GP3A 1H8TC 3AL5A 3MIFA 3U4SA 4EWDA 5C3SA 2ZHKA 1W8ZA 4YZ3A 4CEYC 1IOAA 3HAGA 4NROA 5FY9A 2W1UA 5I8SA 1HQWA 2WSVA 3S7IA 5IVYA 3AZZA 4XBLA 2VOXA 1VE0A 4N8MA 4AFMA 5JPNB 4LK6A 4N7IA 1WCKA 1G9DA 2ZX4A 1FOD2 3AYDA 1IHMA 4HMZA 4NHMA 4FO9A 1BEV3 1C4RA 1ND3A 1TEIA 2MNGA 4CTEA 1MPXA 2VW0A 5FZAA 2R7EB 1GKBA 1QNYA 1XNCA 2UWAA 5F5QA 3OUIA 3RMXA 4KBZA 3JB4C 1G86A 2QZ2A 5B4NA 3MW4A 1FMD1 1E5HA 3B9IA 4XFIA 4ZXEA 3KB5A 2VECA 3WW1A 3OYWB 3M3EA 5AC92 2JG9B 1UO9A 4I3PA 3OSDA 2IC1A 1YQ8A 1O8SA 3S7EA 3V64A 2BNMA 1XNDA 1QJY2 1X7NA 2XBO3 3WDTA 3C7GA 1DGWA 4AE2A 3WW4A 3NQHA 1YIFA 1XBFA 5A7OA 3UKNA 5A6XA 1AR62 1YI7A 2FDHA 4BXSV 4FPGA 2ET1A 2ZGMA 3KMHA 2Q8DA 5AVAA 3VBUB 4AFDA 3BKZA 4B3NA 1K3IA 5A7WB 3AYCA 4FPEA 4OFGA 4N53A 3WEZA 1YFXA 2DCYA 4W65A 1YRZA 4ARYA 1DYPA 4Y5Z0 3IDBB 1VJ2A 3MW3A 3KZ4C 1VBC2 1QJU2 2N7GA 3WY6A 2KR2A 2ZA9A 5ERLA 3D4KA 4UFIA 4AF9A 1EY2A 1RMU3 3I3EA 1ST8A 2VBPA 3OGRA 4KU8A 5EJ3A 5FY5A 1AYM1 4I3GA 1J83A 1AR91 5FQ0A 4XCAA 1AHSA 5F32A 2QQIA 4H55A 2DCTA 5DAPA 2AUYA 2Q30A 2QJVA 1UMHA 4LHNA 3ZXKA 2BJSA 1XSRA 5LEKA 3DKQA 1PGW2 2YGMA 3IT8A 2CGOA 4H7LA 3PTYA 3LIHA 3ZFGB 5FPZA 2VZ3A 4FOYA 2W9XA 2G1MA 5FBJA 3LAGA 1QOSA 2NLRA 4L2NA 3RZMA 1OFNA 3H1WA 1LHOA 3UGHA 2ZOEB 3U75A 4DPNA 4E4SA 3SKVA 4ZKTB 1US2A 1UQXA 2WL1A 3GBFA 1LU2A 3PIJA 1PO21 1CN1A 3RSJA 4OI0A 3CO2A 5C4WA 4CU8A 4D6SA 4XXAA 3BU0A 5I91A 3KVBA 4P9JA 4QT6A 3LGRA 1HXS2 1X36A 3VBOC 2W1WA 3ZYRA 3TEWA 1H1MA 1YFUA 1UY2A 2D5FA 1UU5A 1W6QA 3EO6A 3G6JB 4W6WA 5LY2A 4CCMA 4QKDA 1H1AA 2DCKA 4XQDA 3TNPB 3O0VA 5LZ6A 1HIXA 2Y6HA 4YGDA 5FOJB 1C8M2 1PVC1 3LEMA 2LW8A 3MW2A 4DEVA 4PBPA 4FPHA 1QJZA 4Q8LA 1AXYA 3JQXA 1OA2A 3OUJA 3B9CA 2DWRA 1AYM3 1JU3A 3OBRA 4CDQC 5EWSA 5FPAA 2E63A 1AR93 1UYPA 3H1MA 1O3RA 1ENQA 5LA1A 1ZRDA 3NAPA 2IWGB 4MHUA 3DPRC 2HJIA 2R49A 3I2FA 1TE1B 1LEDA 4TXWA 4BQXA 4ZHNA 1UZWA 1FNYA 2VMHA 3AYAA 2RS33 2DVGA 5DUXA 5GLUA 1W6MB 4LLOA 4NO4A 1F31A 4A42A 4D7SA 1LRHA 2GC3A 4NAMA 2A73B 4DNYA 5GZEA 5LRRA 1W6NB 2V72A 3USUB 1V6OA 5FYUA 3CMGA 2JDAA 4Y1UA 1XB9A 4CCLA 1VB2A 3CEWA 5KC5A 5LBEA 1POV3 3UV9A 1PX3A 2VL4A 5GLTA 4LBNA 4QKNA 4B8EA 1O3QA 1NA1C 3LQCA 2G4IA 3OBZA 1VLNA 3TN91 3WF0A 3WX5A 1O8PA 1XNAA 3NJZA 1ASJ2 2VOVA 2A7AA 2R0FA 1FT9A 2ZEZA 4JHZA 5JI7A 5FZ4A 1H2LA 2OPKA 1DGRA 4IE6A 3JQWA 2CDPA 2IXJA 1NT0A 2PHWA 3OGJA 2CU5A 4I0WB 2WWSA 2D7FA 5JZGB 3TYJA 3WNMA 1WA4A 3ZYHA 1BBT2 2BNNA 2MEV3 3NV4A 3ACHA 4YPJA 3TEYA 1ZZCA 4MVTA 1ACCA 2XLAA 3PUSA 4BYYA 4JRAA 2ZGKA 1JBCA 5IWFA 3THTA 2A5ZA 2G19A 2OVUA 3VBSA 2EVXA 2VE1A 3FFQA 4ARXA 1R1ZA 4KQ7A 4OUSA 2W91A 4OI4A 4UYBA 2ZCWA 3H8UA 4DRVA 1D7PM 1A8MA 4TLFA 2GN7A 2YPDA 1X50A 4QU2A 3IIIA 5BNPC 4Q4V1 2GNDA 3K3OA 2J7MA 4FP3A 4QM8A 4XFCA 1COV2 3C8XA 2Y33A 1JN2P 4EJRA 5APAA 2WKKA 4OUEA 2VG9A 5D1IA 3FLPA 4AG4A 1JYXA 2ZX2A 4D0QA 4I30A 1CZTA 3WG2A 3I2IA 3WXPA 4W50A 4DY3A 1OQDA 1F4HA 1A78A 4R52A 3ATGA 5FYZA 4AEDB 4J25A 4XIOA 5FZOB 1S0IA 3TN93 5LA0A 4R9BA 1NLQA 2UWBA 2KD7A 4OQ9A 2NMOA 3DXUA 2EIBA 2VZRA 5BNOC 1F35A 1VMHA 1HQLA 2AH2A 4KH9A 3ZYBA 2OUJA 5H9SA 4WM7C 2A3XA 1W9YA 2PYTA 4BPZA 4ITCA 1NCRC 1WKYA 1PMHX 5I0TA 1PM4A 3AKTA 5FMBA 2J1RA 1LULA 1QQP3 3MPBA 3Q8CA 2FCTA 3CIHA 4QQHA 4TZDA 1SBDA 1O4YA 1HB2A 1LNSA 5M0TA 4QB1A 1AR82 1GMMA 1OFSA 3WDVA 3RYRA 3NVCA 5FO9B 3MI8A 5GZCA 3LOBA 2XLFA 2XWBB 3PUQA 2RM22 2YY1A 3BODA 4Z92B 2WQZC 5D8AC 2XKOA 4B1MA 3KD4A 2VW1A 2DUPA 2QFEA 3FMGA 5JOXA 1ZZ8A 4RR3A 4IV3B 4YGBA 1KDMA 4NHYA 1ULFA 1AJOA 2IVJA 2W5FA 4XF9A 4Q4X3 2JDZA 4ATEA 2EAAA 2HWD3 2V73A 4BWOA 2PN5A 1L3JA 1QH7A 4IEVA 2P17A 2QKDA 5KHHA 4P9LA 3RVHA 4OMDA 5E89A 4YSFA 1GQGA 1VBD1 3MF9A 1LU1A 1R081 1UX6A 2I2SA 3SH4A 5J7MA 1LHVA 4IEWA 1UZ0A 3GXUA 3THCA 4QQ2A 1UNBA 3I54A 4GB31 4QHZA 4WVMB 4FQZA 5IHRA 4X6QB 1OURA 2JD4A 4LKSA 2BFUS 1UN1A 5TSWA 4MYEA 5CFDA 1W2UA 1JODA 4FFIA 3BU7A 2P6HA 3N7JA 4AFAA 3ILFA 2EXIA 1RVF1 1PVXA 3WCSA 2GP5A 2ZABA 3U14A 3KV4A 4D6RA 2E9QA 5DABA 2X53S 3ZFEB 4CP9A 2XHNA 5DG1A 1RUD1 3MDPA 1YJKA 3ABZA 1W9WA 2WIIB 3WDYA 2RDNA 4LUKA 3HWJA 2OZJA 3NKGA 3N9MA 4HKOA 5FP9A 1EAH3 2VU9A 2ARBA 4CDUB 2NZ9A 1LOCA 4YVWA 1D2SA 2RR11 2JDMA 4RN5A 4Y20B 2IVIB 2B39A 3KSCA 1VB4A 2GC1A 3VBHA 3ZN6A 2P37A 3BPSA 1LENA 2VCAA 5J1XA 3JCIA 2ZACA 1DQ0A 3LEGA 1MEC1 3LWCA 1FOD3 1FYUA 3HQUA 3B01A 4EN8B 1V9U2 3LDKA 4MXWA 4N43B 5JIUA 2BWCA 3RMYA 2HH9A 1RUH1 4KWUA 1LOBA 4UAPA 3VKMA 5DQ0A 4C8DA 1C1LA 1VBD3 4Y1XA 2V09A 4FXGB 4XTMA 1BMV1 2WO3A 1SHWB 2ZGPA 5E6HA 2P34A 1UKGA 4HT1T 4RGKA 4UWDA 4WVZA 4PLMA 4NOTA 3AKQA 1AL0G 4AQSA 3QACA 1H30A 4KWLA 1SACA 1AR63 4C1WA 3VHPA 3PVBB 4YFZA 4FQ4A 4Y5TA 3X29B 5F5CA 1E5SA 5ABJC 5DZEA 1RUD3 4WVVA 4CSWA 5BUVA 2Q4SA 1CD3G 2BNOA 1ND3B 1IG3A 1ZZ7A 1SBFA 5L7OC 3POSA 3THDA 1YQ5A 1YCIA 4IE0A 4ASMB 4JGYA 4CPBA 1VBC3 3A21A 5IVVA 3KLSA 3VD5A 5C9AC 4K7JA 2QBXA 1ZBE2 4MO3M 4Y22A 1LOAA 4XUOA 2WUHA 1MEC3 4K40A 1WW5A 1BQPA 5JWPA 3BCWA 1REDA 4QXCA 2HBTA 3ES4A 2Y0IA 3VUOA 1A34A 1WW7A 3HEIA 2QNKA 1JZ6A 2NPIA 3H3UA 4YW3A 2F4LA 4HOOA 3CJXA 1W2OA 2Y8KA 3ZO0B 1BEV2 2XVKA 1AF9A 3V0AA 3ZKYA 1YFYA 5JIAA 4IGPA 2CWSA 4DXTA 3N9OA 3VD3A 4N53B 3WUCA 5JXHA 2EA7A 2JXAA 1ULDA 3AKPA 2WT2A 3KCXA 3IDAA 4C91A 4TN7A 4EYUA 1O6UA 1SFNA 2XJQA 2XB6C 3H50A 3IBMA 5ANNA 4NE9A 5F39A 3RZGA 4NUBA 3VD9A 3TEXA 2FMDA 4CU6A 5C8CC 1VBE2 2FQPA 1GQHA 2W92A 3A23A 3CJIA 3LPFA 2DFBA 2XBO2 3NO8A 4P9GA 1V6IA 4UI9L 5F8PA 5FYMA 1KDKA 2PTMA 4BQWA 2E32A 4IDZA 5FQ0B 1GOFA 3U10A 1RHI1 3VLBB 1S0FA 3GBGA 5BNNC 5LATA 1V6MA 1MZFA 2X5IA 3IZOA 1CPNA 2BGPA 3ZXDA 3GHNA 2DVDA 3VV1A 1C8M3 3FL7A 1REFA 2BUKA 3KGLA 4ZXKA 1KJRA 4KI5M 4XFGA 3FC0A 2UYBA 4CDXC 2FCVA 4Z8BA 1US3A 2R6QA 2D3SA 3FJSA 5FXVA 4QB6A 4AZZA 4QHBA 4A6SA 3AZYA 1OUXA 4CZSA 2QCSB 5D21A 3BN6A 1KITA 3AVRA 4MADA 2WBKA 4AGVA 1RMU2 5FY7A 5IVEA 2IXHA 2VVDA 2HEWF 3ZFFC 4EWEA 1C8NA 4R9CA 3AMPA 5C4WB 2FBEA 2Y60A 4XF3A 4AI3A 3LDRA 2EXKA 1IZ3A 4IXLA 2WWUA 3A7QA 3F2ZA 3MGUA 3MO4A 2RDRA 3SMHA 2YBKA 3UESA 1ULPA 3OBAA 1GQPA 4YW2A 1W6QB 4EN7B 5JXGA 3OD4A 3WF3A 1JW6A 3O0WA 4OZOA 1N1TA 1QJX3 4AFBA 2PHTA 1FMD2 2P6CA 3KQRA 2ATFA 4LULA 1X8MA 4COWA 5F9TA 5CVRA 1UMIA 5G04L 3LA2A 3ZMNA 3AZXA 1WLCA 4S2FA 2WA3A 3UNPA 2CGNA 2HWB1 2ZPXA 4QX2A 5KXEA 2JDKA 5CG8A 2ZGLA 2VO5A 4IEQA 1OF3A 3DYPA 3IPVB 5IK4A 3ZSLA 1ASJ3 1RHI3 4AQ6A 3ZYJB 3NAPB 3K51A 3KM5A 1GICA 1PM7A 2WAAA 4PCRA 4IV1C 5K0UC 4QPIA 4FXKB 4DY5A 3NSTA 3R4DB 3RJRA 4P08A 1WWYA 4R9AA 4EN9B 4PT6A 5CISA 3MEPA 2ARAA 5F7UA 1OOPC 3NWKA 4D94A 4FTBA 2DURA 4JC1A 5LA9A 4NR1A 1NY71 1IG0A 1T2XA 3Q8BA 4UT5A 5EZWA 5HI0A 3T2QA 2QQOA 4SLIA 3VBRC 4CUCA 2NN8A 1VALA 5JVVA 3PNAA 4CUBA 2VZVA 4MUVA 4PDWA 4COUA 5HPOA 1CJDA 1BVP1 1QHDA 1VRH1 3ZIXA 2VOKA 3T0BA 1BVVA 2Y0OA 3PURA 2K9ZA 4NPRA 3WINE 3SHRA 1K42A 1CESA 1AYM2 1SEFA 1WD4A 3GCWA 5CNAA 1DGLA 1B35A 1AR92 2WNEA 3CQOA 5FZHA 2D6KA 2H6BA 2ZAAA 4A7YA 1JZ5A 4YRDA 4AHWA 1TME1 1X33A 4QPGC 3SLIA 3BTXA 3RZLA 2ES3A 4OMCA 4LBLA 4HG6B 4HL0A 3BVCA 4K6BA 3FX3A 1BLZA 4CPBD 4FTSA 2FDJA 4XUNA 4XF4A 2D3RA 4FT8A 2VTXJ 1WD3A 3OY8A 2JE8A 3FWEA 4MH0E 1QY4A 3BI3A 1CQ9A 1H8TA 2ZGOA 2WAOA 1TMF1 5DAXA 1QXPA 4B29A 1RC6A 1HJFA 3AL6A 3PU8A 3RDIA 2OXBA 1PO22 3ZLIA 1QDOA 4W8JA 2VY0A 4XQWA 2XL7A 1ENXA 2OT7A 3K4ZA 4NHLA 2R1BA 5LW9A 4QXKA 5FZLA 4UFJA 1NQJA 1HLCA 1EV11 2QQJA 4RS5A 4NHKA 2IFRA 3R05A 1CAVA 4HLTA 1SZBA 3ZMOA 3AFGA 4XF0A 4DQAA 4PF5A 3SQOA 4BLJA 1PVC2 1LECA 1F5FA 4JDMA 2R061 4JTOA 5J96B 4FFHA 3POGA 4UFMA 3SC7X 4LE4A 5FKCA 2KM2A 2MEV2 3WNXA 3NNJA 2GDFA 4XUPA 1IS6A 5FP7A 5FBZA 2D6OX 2BFUL 2ETEA 2PA7A 3RZJA 1TVGA 4E2QA 3LB9A 4CU9A 1U5XA 1KGYA 4RGGA 3LFIA 5FZBA 1R091 1TME3 2ET7A 3ACFA 2XJPA 3INAA 2JEMA 4O61A 3VBUC 5CADA 2CSGA 4ZU5A 1O3TA 3JBG1 5FR3A 1O5LA 1G8WA 5FMOS 2Z69A 3L2YA 5GALA 4I02A 3AJZA 3IAPA 3S57A 4DS0A 3RQ0A 2B46X 4YG6A 3I3BA 3NJYA 3I49A 3AYEA 2ZX1A 1VBB1 4OLLA 3CLPA 2O8QA 5CFCC 1NLSA 4O9GA 1UPSA 4G3YC 2VQAA 4LOTA 2PHXA 1Y3TA 2XLGA 5FK8A 4BLIA 5A6ZA 5FZ1A 5A3NA 2A6YA 2FMYA 1VMFA 5JMCA 4XBQA 4QXBA 1G9BA 3TN92 3WT3A 2GC2A 3M70A 4V2VA 5FY0A 1VP6A 4RR3B 1O7FA 4UF0A 1UXZA 1K5MA 5E1RA 2G9GA 2HBUA 3AP5A 4IE4A 2PXJA 4C0BA 1DLCA 2R063 2A3WA 3ZFGC 4MX3A 1JYIA 2WQ8A 2X8KA 5BV6A 1OKQA 5BXXA 1QQP2 3DYOA 4JGZC 2QQWA 3I59A 1CIYA 3OPZA 3UGFA 2PMWB 1ZVFA 3ACGA 1SBEA 3D0SA 1GWKA 5I0RA 4JCKA 3N7LA 5LBBA 3T2OA 4D7TA 4QX7A 5IK7A 4ZZ8A 4Q4Y1 3A4UA 1C28A 1MVEA 1RUC1 4E4ZA 3J4UH 1XNBA 4M0HA 2C9KA 3M3IA 5FYVA 2K0GA 5CFDB 2ZEXA 1H2NA 4Q4V2 1WZXA 1XE7A 2XG3A 4Q8KA 1YIPA 2O1QA 2AENA 4LUMA 1VIWB 1W90A 2WYFA 1SLBA 1UAIA 4L0PA 2HWD2 4CP9B 2A3YA 1PNFA 4L92A 3Q9OA 1YHFA 4JTNA 4XJZA 1G9CA 1D0GA 2WNUC 3JU9A 4BISA 5FK7A 3W5NA 2UY9A 5FZMA 4YVSA 3NNGA 4YVWB 1PGL2 1ZBA1 1MQTA 2GMPA 5KR7A 3V56A 2J22A 4CDQA 4WBBA 2A6WA 2EAKA 4LEJA 5J37A 4DB5A 3VBHB 3ZN6B 2C6SA 2Q8EA 4MLOA 3AKRA 4KNCA 3AXDA 3S0MA 2CHHA 3MPPG 4FOWA 4AEKA 4BHPA 2BOJA 2W08A 3AX4A 4AW7A 3L9JT 4NVPA 3ACIA 3OPWA 2WR9A 1D4M3 2I45A 4COYA 5FZCA 2R32A 2H0BA 3E5QA 4I0AA 5L9RA 4YW1A 2GNTA 3OOXA 4HPKA 2HWF1 3RYPA 1LCLA 3RZHA 2QZ3A 1S4CA 3E5XA 4FCAA 4FPOB 1NA1A 1Z7S1 2AEYA 3SCFA 4YLZA 1RJ7A 3W20A 2BERA 3RYKA 2HWE1 4CUGA 1GYKA 4XYXA 4CCJA 5FO8B 5KC6A 3ZR5A 3H8XA 4NIGA 3O5SA 5IFPA 2WNVA 3IKWA 3GZEA 4ISRA 1S0GA 1W6PA 4A44A 1N1SA 1RUJ3 4JAAA 4I2OA 3WR0A 3AB0A 3P6BA 3CDZB 4BZ4A 3TWIA 1VBD2 2V5DA 4A41A 4DOUA 4DZGA 3ENRA 4JGYB 4QGMA 1R082 5A70A 4CVUA 4M3CA 2CV6A 1DQ6A 2ERFA 5FZEA 5FP3A 2RG4A 3KF3A 4NHXA 1VBE3 1OH4A 4Y22B 3IN9A 1HRV1 3HPNA 4GMP3 5C3PA 1UYZA 3HNYM 3PLQA 4XJ8A 4CXYA 2EIEA 1Q8QA 5AFEA 1QJEA 3KQ4B 3T1MA 3W9AA 3ZX7A 4N9HA 5BNPA 4XJWA 4GA9A 2ZMKA 1RUD2 1OC1A 1OLRA 3QOPA 3ZXJA 3WNPA 4B1LA 1SFPA 4HANA 2JG8C 1JOJA 3V0AB 1I3HA 4RHV1 4XZUG 3NV3A 1NX9A 4QPWA 3HNBM 2IUWA 3ETQA 1HDKA 4OULA 5AFBA 4CU7A 4ATFA 3NNMA 2GSYA 4KG8A 4MGZE 5KXBA 2B45X 1FNZA 1MEC2 2CY6A 1PK6B 2VVFA 3CJIB 4R4XA 4Q4W1 4JQTA 4WM7A 5IYYA 4AI9A 2VJXA 3A0NA 4CRQA 4EN0A 1XOYA 2J1EA 4UFHA 4RFT0 2W95A 2J1SA 5K4LA 2GNBA 4Y33A 2X5IB 3VDDA 5T5LA 1FMD3 3BGAA 4GJZA 4R8HA 1W3VA 5HXMA 4OI2A 3SNMA 2BZDA 5IVJA 4YW7A 3OD0A 1IPKA 4FFFA 1QOTA 2OYZA 2P2KA 3VL9A 4CA9A 1CAWA 3THPA 3ASIA 4AVBA 2FDFA 3J26N 5HV4A 1HRV3 4IERA 2WABA 4UW3A 2ZMLA 3FHIB 4DUXA 3MFAA 4KU7A 1DQ2A 2PHUA 4IV3C 4WVWA 4GH4B 4CDWC 2A1XA 4PF1A 3ZXLA 5FLJA 3HJRA 1GNYA 1URXA 2RS11 3KGZA 2W46A 1YLLA 2BYVE 4AYUA 1YFWA 2JDNA 1QH6A 2JKBA 2B8MA 2FZ1A 2Z4FA 3J7HA 3JUUA 3RJ2X 1LOGA 3N7KA 1U5ZA 2JDYA 1CGPA 2R30A 1H2KA 3UT0A 5CA6A 2JE9A 2XUEA 1ZM1A 3BYWA 3B00A 4XEZA 2JB8A 1UYXA 1AYN1 1R64A 3CF6E 2XWJB 2XL9A 5LB6A 3WNNA 2ID4A 2YGLA 4AQTA 2CAVA 4K21A 5HXVA 4E2GA 3VD4A 3IDEA 4Q27A 3V65A 4MXVA 3AMQA 5T55A 1JOPA 3BTAA 3IMNA 1FPN1 4F3JA 3GJBA 1REEA 1YO8A 4QGNA 3W21A 2DU0A 4AQ2A 4DFSA 3RFRA 1JHJA 5EFUA 3ZFEC 4AVSA 3S30A 1NZIA 3DCQA 2YU1A 2E31A 2ZGUA 4QPIB 1WCSA 2GZWA 1RITA 2ZTNA 3R4SA 1HB1A 2GC0A 5F2SA 3WV6A 4CDUC 1LOFC 1G7YA 1J1TA 5FLIA 3NMBA 3T1LA 3GYDA 2J1UA 4XPVA 1QJX2 3SEPA 3ME2A 2VUJA 4E8CA 4MGQA 5HCFA 1I5PA 1LGNA 3T09A 1ZYBA 1Q3EA 1JZ7A 1H8VA 4PDWB 1EP0A 1PO23 4YW6A 2BVVA 4EWAA 1MZ6A 1LHNA 1N1VA 4N43C 3POBA 2C1FA 1RUF1 1FX5A 3LD8A 5DUUA 5FMOL 2VUDA 2IXIA 4YWAA 4NPMA 1B35B 3DECA 3LKJA 5FDBA 1RHI2 4C0HA 2MPFA 2XDVA 5DZGA 5T5JA 5J09A 3TEZA 1O91A 4TTGA 1PIV1 5EV7A 4BQ5A 3H9AA 4DINB 5ACA2 1PVC3 2VCCA 2C4XA 3PJQA 2WZ8A 5FUPA 3T3YA 4BK4A 4QPYA 4BXFA 3GNEA 4GWNA 4RQPA 5EPAA 4QX3A 4LT5A 4LHKA 1FPN3 2GH8A 3H3ZA 4Q5OA 3SEEA 2DUQA 5C33A 3B94A 1ZRRA 3RI8A 3PJYA 4B4RA 4P5HA 4BB3A 2OZ6A 2WT0A 4IEUA 3MUY1 4KWKA 4ISQA 4D6QA 1QU0A 2Y34A 5ABJA 1ND3C 2C24A 4E4HA 3NJVA 4Q29A 1CIWA 4FPFA 4IEOA 2RS51 1UW8A 4RS5B 3QH7A 3ZYPA 4NPLA 1J3RA 2AZ5A 1CAVB 1AXKA 1S0BA 1W03A 2BV4A 3ZXAC 1JU4A 5C9AA 1U5YA 4UBHA 4QX8A 2CL2A 2WLQA 1E5RA 4AAPA 4JZRA 1JYTA 1RUF3 1SLIA 1ULCA 3K3NA 4TYSA 2HWB2 5CYYA 4JX0A 4YM0A 2W52A 2VQTA 2WRAA 3GZAA 1FV2A 2ZZJA 2Q8CA 3I97A 1H4HA 4LKDA 2HWC1 5BYNA 5DDJ1 1H0BA 3VN4A 5EJ1B 4BCUA 4X8PA 1KQRA 2WN3A 3KS7A 5I8YA 3J7MA 4N53C 2OPWA 4YM3A 1N47A 1PNGA 3I2GA 3QH6A 3SH5A 1XYPA 2FCUA 4JKKA 3WDWA 4L99A 5CAZA 4LKEA 3LZZA 2HEVF 3MBWA 1DIWA 1NZCA 1S0JA 1FAYA 4NAOA 2DFCA 3BPZA 3RPQA 1IS3A 2DV9A 4K8FA 1VRH2 2RDQA 2TEPA 5I8TA 1DDLA 1IGOA 2D6NA 4QX5A 4LA2A 3PVNA 4UW5A 5FZ9A 1Q56A 1D0HA 1TQ5A 2BRTA 2Z42A 1JXNA 5IUQA 4AI1A 4Q4V3 4XDQA 2R0HA 1TME2 2KA3A 1S0DA 2RS53 5CKNA 3AMHA 3I8TA 1AR71 4MGTA 5IAVA 4UF0B 5FUIA 5JSRA 4QQOA 1I5ZA 4OHVA 1K5MB 5JXIA 1VBA1 4XZPA 2XQXA 1HB3A 4FSJA 4LHLA 2D43A 4P9WA 2Y26A 2R041 3WNLA 5CKQA 2CDOA 4S2HA 4WM8A 4YW4A 1CAUA 4KMQA 5FTTC 3GZUC 4CXWA 2PHRA 4ZS3A 5A3TA 5J36A 3I59B 3O1MA 3ZM8A 2PHLA 4XUTA 1MS0A 4PIYA 4WV8A 5DZFA 3ST7A 4PLNA 1RYYA 5C4WC 1OF4A 3V0BB 1VR3A 1W8WA 3HOBA 3WQ7A 2OW4A 3HT1A 3ZFFA 4LKFA 2JIGA 2QTWB 3LFMA 1OLQA 1EV12 3AC0A 3T2PA 2YB7A 3MV01 1MACA 2EXHA 1SFYA 5L36A 3VL8A 5A7SA 2WZR1 2W94A 3D3AA 1HW5A 2XKPA 4META 2VUCA 3I3MA 3AP6A 4CEWA 1ULEA 2R062 3DYMA 5JPMB 2ZEYA 1VAMA 2EICA 1OBNA 2XXZA 5AC91 4OHWA 4BH9A 1DU3D 2PQSA 4YVSB 4XACA 5J98B 1WBFA 1MQTB 3NAPC 3ZSMA 1S0CA 1LODA 4CDQB 3AP7A 5FXZA 1LHWA 3ZOIA 3OCPA 3N36A 4IW3A 4D69A 4Y1YA 1AR73 4XTPA 5FYCA 3SXWA 3P5BA 5K0UA 3JBG2 4IV1A 2LROA 3C7EA 1Q43A 3VBFC 2WO1A 3R0RA 5LBFA 1FV3A 2OIIA 3WW3A 1F15A 1GOGA 2E26A 2K2SA 1GOHA 2VVEA 1K45A 3C7OA 3N7MA 2R043 2VNOA 4HETA 2YBSA 1NCQA 3E6DA 2XJVA 1R083 3E1F1 5C6CA 3VBRA 4HFSA 2VQ0A 2XJSA 4Q4W2 1QJU1 4MGSA 2YROA 4GWIA 4BA6A 4MG2A 5HCAA 1TNFA 5LWBA 3AMMA 4GB33 3G7DA 4HPKB 5EP9A 4LORA 4NWWA 5GLVA 4LTAA 3OBTA 2VAUA 4A3ZA 3O14A 4EZ4A 4K20A 1RVF3 5IATA 1LB2A 4KG0A 3KVAA 3U11A 4LXLA 4GIQA 1CAXA 4KGQA 1GWMA 1WMEA 2BVBA 3WP4A 1OVSA 2WNVB 5T3NA 3K75B 5BPXA 1CX1A 1VAVA 1Y9MA 1W6PB 2D6LX 2VCMA 3EB7A 4LOSA 1ZNPA 2ADDA 5EIYB 1D4M2 1AL21 3BIWE 5KXCA 2RR13 2ZMNA 5F2WA 4NIHA 4H3WA 1RIRA 4SBVA 5FRAA 5C7GA 2XH6A 4M3CB 3DKWA 1S0EA 1SCRA 2VGDA 1W2TA 2D6MA 3N9NA 4QB2A 1QF3A 4LHSA 5F5IA 5IVBA 1PO11 4YFWA 4LMFA 1WCDJ 2FD8A 1HXS1 1RUH3 4BQYA 5HBAA 1RUNA 2DDUA 2UU8A 1V6KA 5FOBB 2B9VA 2PELA 2YV8A 3Q8FA 4ZONA 5FP4A 3PVEA 4CCOA 2P3IA 3CNAA 4PI0A 1Q8SA 2BBAA 3BB6A 1RUJ2 3ORJA 3LCPA 5A7PA 5JSOA 1GFF2 1ND2C 4XETA 5DMYA 5FJHA 1DYOA 4COZA 1POQA 2JDPA 2YPJA 1RUI1 2Y6GA 2VZOA 3VGIA 4BIOA 3UJOA 5A32A 5FLHA 3VDCA 3NW4A 1S2KA 1UY4A 2VULA 3WP6A 2YFZA 1XQNA 3FN9A 4MGYE 5IJRA 4AI8A 3CKHA 4Z2WA 3U07A 5DG2A 1MS9A 4QGLA 5JOWA 4B7KA 4WM7B 2E7AA 2ZAHA 4EE2A 5FY1A 5C3RA 2J1VA 4U36A 5LK7B 1EUTA 1F5JA 5HCHA 4P9YA 1AL23 1UF2C 5CIRA 4ZU4A 1KS5A 1AX1A 3H3LA 1ONAA 3KHCA 4I01A 1LHUA 3UETA 1AUYA 3VDDB 4J1WA 4L97A 5DPNA 1HKDA 4ONUA 1F4AA 4XDPA 1X8EA 3K4DA 5CFCA 2V4VA 2HWF2 1WCQA 2P1BA 1XYNA 1CAWB 3I7DA 3T4VA 2PFWA 2AACA 4XOGA 2VZSA 2YBPA 3VHNA 1GUIA 4P5YA 2JWPA 3O1VA 1PO13 4AHXA 3EXUA 3DN7A 4JVAA 5A1AA 4RR3C 3BTZA 1XSQA 1AX2A 1FXZA 4LO8A 2E33A 3HBZA 4N7UA 4UW6A 3WQBA 1BYHA 4FPCA 1JH5A 5A3PA 2IFWA 1J58A 1QMJA 4S2DA 3LE0A 4YYOA 1GWLA 3WF4A 1J59A 3MIGA 1ZREA 4CE8A 1DHKB 3A0KA 4ZS2A 4ES9A 1MZEA 1BBT1 3U37A 2NP0A 1HB4A 4JGZA 2XPJA 4Q0SA 1W0PA 1RUI3 3LPGA 1CZVA 4K3UA 4AXOA 4DMIA 3FZ3A 4XFAA 1AZDA 1UZVA 5JMOA 1UIKA 5KHJA 1XNTA 5JCTA 5DN2A 2EIGA 1HRV2 4XHBA 2AR6A 3ZDVA 1ZZ6A 5CFDC 4TLGA 4MGKE 5FZIA 3NL1A 1CZSA 1GZTA 4FFGA 3E5UA 4W6YA 1CR7A 1VAKA 4FPJA 1X82A 3WP3A 1G9AA 1COV1 4P14A 1G9FA 2BPA2 2XOMA 1MS8A 1W8TA 3FLRA 1PZ9A 4LK7A 2WNUA 4YVWC 4RHV2 3ZYFA 4N90A 4M4PA 1IS5A 1W39A 2YUEA 3O1PA 2D98A 2NQYA 1XRUA 4IESA 4XAEA 3ZVXA 4LO6B 2F4PA 1UOJA 3T08A 3VBHC 1RUE1 2VZ1A 2QQPA 5JLVA 3C3VA 2JECA 4QQLA 3ZSJA 1OPOA 2Q0AA 4FPKA 3PUIA 1KXGA 1GZ9A 1RL3A 1H1IA 2YU2A 2YZ4A 1HV0A 1JS9A 2ARCA 3IDCB 1A3KA 1S2BA 3NNLA 1YXWA 1WW4A 4TWTA 1GLHA 3PUHA 1M4WA 4QD2A 4RD7A 4HN1A 4GAZA 2QQNA 4IUGA 1MS1A 2D40A 1XNKA 1HQNA 1IQAA 1GV9A 1AR81 4W6XA 1CWPA 3WLUA 1J3PA 3QBQA 1J3QA 2VZTA 3PMEA 5C5TA 2J1AA 4NN0A 4RQPB 2VZQA 4QKFA 3EBRA 2ZGRA 5FZDA 2HWB3 3WNOA 2P3KA 1QEXA 4CEYA 3OB8A 1GNZA 2GN3A 4B4QA 4CYDA 4XCBA 4GJYA 1WW6A 2HYXA 4HKLA 2WFPA 4XW3A 3VBSB 5A80A 2RS12 3GGLA 1IS4A 3POFA 3WW2A 2X09A 5ABJB 3CBNA 1DZRA 5EQUA 2A6XA 3MLKA 4X6RB 4JGYC 4IL7A 2L9LA 4NIIA 3UKTA 3K46A 5JOYA 2W0XA 2JG9C 1AYN2 4A45A 1CJPA 4B7EA 5C9AB 1VRH3 2EIDA 1UCXA 2VMEA 4QDSA 5FZ0A 3WVJA 5DXDA 3O1RA 1JUHA 2YXSA 5JDBA 4COVA 4EV0A 3WQ0A 1OUSA 1FATA 1FPN2 3IAQA 4A3XA 2H6CA 4OYUA 1ULGA 3B7MA 1W9TA 4QHOA 1XJAA 4NRMA 2VM9A 4Y26A 1I1EA 4P00B 1JOBA 2ORXA 4PJYA 1QOOA 1VRBA 4CCEA 3O1TA 1JYCA 5C8WA 4QWNA 3C7FA 4QKBA 2FDIA 3AZWA 1G6NA 4FP2A 2JG8A 1V00A 4IEXA 2TNFA 5ISLA 1IKPA 2VC9A 5B2GB 4E9KA 4GKYA 3OJBA 4XJ9A 2C0ZA 2TUNA 1TMF3 4E4DX 1QWRA 2ZJCA 2Q1FA 3ALQA 3WOGA 3VHRA 1W8OA 3WP5A 1O3SA 1PHMA 3HBKA 2GU9A 1PK6C 3WNKA 3CJIC 1RUF2 4QM9A 2IXKA 1OQ1A 2GAUA 3FHQA 1ODNA 3MUZ1 4KL1A 5E16A 3J8F1 3LDBA 1RUG1 3LSEA 2D3PA 4JV4A 5A7NA 1EV13 5ACA3 5KHIA 1OMIA 1DG6A 2I74A 3FHAA 2CYFA 1S1AA 1POV0 2X5IC 2YC2A 3PHMA 4UOJA 3VB9A 3PUAA 4RA0A 5H9PA 1MZ5A 1Q8VA 3ETPA 4IE5A 4MZUA 3EMRA 5FMCA 1XPWA 3ZXEA 2CTVA 4D8MA 5KHGA 3D8CA 4K9SA 5LBCA 1DQ5A 1W9SA 4GH4C 4WM8B 1CAUB 5A6YA 1JZ3A 2BDRA 4LIVA 1J84A 4CDWA 4IV3A 1R093 4OCTA 4D7YA 4CCNA 2WQ4A 2VOWA 1ULOA 3JBG3 4LBJA 2JICA 5FZGA 1JZ8A 2UWCA 3NNFA 3Q8EA 2X10A 5FO7B 1UX7A 1YC61 3HN1A 5A7QA 3AVSA 3SKJE 3VBOA 4AEMA 4ASLA 2OX0A 2CNAA 2RS52 2O8OA 2ZGQA 4M4RA 3N9QA 3B93A 1VBB3 2ZHLA 3RNSA 2AYHA 3DEMA 5A3WA 4A2UA 1WMFA 4LO4B 4Y24A 4CEWB 4YW5A 3WQ1A 5A1LA 4HN0A 3KCYA 2PHDA 4HSJA 3ZDSA 4M00A 1J1LA 3J8F3 3M3QA 1RUG3 3DXTA 3RS6A 5F3GA 3WF1A 5F37A 3BUCA 2VBDA 3H7JA 2W39A 2ZHMA 3FBYA 3DPRA 4LPLA 5LY1A 3USSA 4QPIC 1M06G 4MXWB 4NJ4A 3N35A 1NUKA 2VMCA 1LOEA 1UXXX 1OKOA 4IV1B 3WG1A 4DO0A 1BEV1 5K0UB 4A4AA 3GDBA 3H7YA 4YGCA 1UZYA 3WDXA 2VBBA 3MIHA 4XFFA 1LOFA 1PMJX 3UKVA 5C5UA 3ECQA 1WLTA 5ANQA 1WMDA 4E2SA 4AVCA 1NCQB 4PDWC 5FPVA 2VW2A 5FZ3A 1LEMA 2QQKA 2JENA 4P9XA 1ENRA 3ZYIB 1GR3A 4I09A 4NWVA 4AI0A 1UIJA 3AFKA 4Q4Y3 1RUC3 3WSOA 1O4ZA 1B35C 1HN0A 2XBO1 3VZMA 4CP2A 4DIQA 2YG0A 2W1SA 1Z78A 1RUOA 5C3QA 3P3PA 3K48A 1QDCA 3DGTA 3HNMA 4BQ4A 4QXHA 1AR72 3CZJA 2C5DA 4GKXA 4CCDA 2F6BA 5FREA 1W8UA 2WS91 5JZGC 3AMNA 4J6GA 5JUVA 1VBA2 3KWVA 3ELNA 3DUIA 4TSVA 2WO7A 3H8OA 1BZWA 3LSDA 2BBVA 2E53A 2RDSA 2W1QA 2R042 4QX1A 5IW0A 2PAMA 1B09A 4AVVA 4F7ZA 1N3QA 1ZBA3 1U12A 1WUVA 5L9VA 2GMEA 1JYVA 3EJKA 1WBLA 1APNA 2P4EA 3T4HB 5I0UA 1W6OA 3RG0A 2VMIA 3M1HA 4LITA 1WA6X 4R4ZA 3OGGA 4GB32 1HRI1 1SPPA 2AREA 1RMU1 2JB4A 4QU1A 5FYTA 4BM8A 1DFQA 2P3YA 2DVBA 1JMUB 2OQ7A 2CWMA 3NKTA 1UOBA 2WN2A 1UOGA 1XE0A 1UOFA 5EYYA 2I07B 2Z5WA 5FV3A 1RVF2 3EQEA 2Y64A 4RS5C 1YQ2A 2DVAA 3M7AA 1WLDA 2WZR2 3HN3A 1BK1A 3TOJA 2NM1A 1GSLA 3O1OA 1Y9QA 4AK3A 2OQ6A 1V6JA 1X9PA 3H0OA 3FFZA 1HX6A 3IB3A 4HKWA 4RL7A 4BDVB 1F8VA 4KGGA 3HVDA 4AEDC 4IQPA 2HWF3 5EXOA 5JAXA 1KS4A 2RR12 3GZTB 2HLEA 1E57A 1Z7S3 3RI9A 4CUAA 1V0AA 1ZZBA 2HWE3 2OA2A 1CONA 3KV9A 2QQUA 5A32B 3N9LA 5BNOA 1GANA 3FUOA 1DGRN 5FCCA 1MS4A 2EF6A 3T30A 1TNRA 3WG3A 2WS93 2JE7A 3KT7A 4OHZA 1NCRA 1RUH2 3KV6A 4IEYA 1W05A 5FMDA 1UKRA 4DRRA 1QXRA 3PDQA 4PIZA 2VNGA 5D2AA 1BMV2 3O0XA 5K7PA 4YZ1A 4GQ7A 5L19A 1UY1A 1OVPA 3WCRA 5CFCB 1HRI3 4HVQA 1SDDB 3R6SA 5F5AA 4DXZA 2Q1ZB 5D8AA 3JD71 1IKQA 2AC1A 3VZNA 3AP4A 1ZZ9A 1L7LA 3UL2A 1GP6A 4XFHA 4BMBA 3I2DA 1K5MC 5GKAC 4OVEA 3ZPYA 2DVFA 4NRPA 3U4XA 2RS31 2Z2SB 2FDKA 4LJHA 4XUQA 5KXDA 4K8RB 4AWDA 4KWJA 3VZKA 2R071 2BEOA 4RHV3 1AL22 5FZFA 4YZ2A 1PGSA 3ON7A 3SCGA 4JGZB 2E7TA 4Q2FA 4XAAA 1POV1 2Z79A 4Y1VA 5HCBA 5L9BA 4Q4W3 3KHBA 1PO12 5GLZA 4DUVA 3S5QA 2ZKNA 1NOVA 2LRPA 4BQ2A 2PHFA 5KBFA 1X9TA 4RSUA 4X8NA 5GM0A 2CGPA 5H9RA 1YJLA 3LOIA 3AXEA 3UJQA 1KD7A 4L9BA 3ZN5A 3MIEA 2E7QA 3N4MA 1OLME 1I9RA 1W2NA 4FTEA 4BE3A 1AX0A 2D44A 1RGSA 4JKLA 1VMJA 4AL9A 1OXCA 4KBBA 1JHNA 4YVSC 2MEV1 1MS5A 1A6CA 2WNUB 3APBA 1CVNA 3W58A 1AJKA 5C70A 1MQTC 2XJUA 1RUI2 2RMU1 2W2IA 3EYPA 3JD73 3IPVA 3SH3A 5FFOC 4XURA 3VZLA 3WG4A 1DGWX 2ZXQA 4Q0UA 3AM2A 1NLRA 2RS13 2JKXA 1W2AX 2TBVA 5F3IA 3RZKA 5LEJA 1YQCA 2ENRA 1WLWA 4JKMA 1SLCA 4Y3OA 1T6BX 3VBFA 2XJRA 4YZ5A 4HK9A 3BOPA 2R073 3DF0A 1EPZA 3AZVA 4GWJA 5BY5A 5C71A 1UYYA 1AYN3 4Y5SA 1R1A1 1LR5A 4C90A 1UPIA 2XHKA 4UFKA 1UD1A 1W8FA 2LM3A 4GD4A 3OY8B 1H9PA 4LA3A 5F6KA 2Y6LA 3IM0A 3VDAA 2DBNA 1H8TB 2Q8OA 3RZZA 1QIQA 4CEYB 1O59A 2VTXA 4BIFA 1SLAA 4FVVA 3E6CC 1MR5A 3MLJA 1U0AA 3MZHA 2WNVC 2VMGA 2UURA 2VNVA 3J7NA 1W99A 1ZRIA 1H6XA 1W04A 2V5YA 4Z07A 2FDGA 2VTFA 3A22A 1HV1A 4A7KA 4LNVA 4YM2A 2WA4A 3PMSA 4BJ0A 5L7OA 4P9IA 2PAKA 3B5LB 2R16A 3OUHA 2QQMA 1WCUA 4ORFA 4OUMA 4XVHA 4YGEA 1QQP1 3VKOA 5K9YA 2NMNA 1GBGA 1F9KA 2RMU3 2XVGA 4Q0VA 1KRIA 2JJ6A 1N3PA 1YI9A 1SLTA 2WFF1 2XR4A 1DZQA 2IZWA 4IETA 2VD7A 1UY0A 4FOQA 4PQQA 4J1XA 3VZJA 1A8DA 3BIEA 3D5OA 3RWKX 1FI2A 4M3CF 5I0DA 5G05L 4LLFA 3RRDA 3M2MA 4LBMA 2WWJA 5FZ8A 2XVLA 1PIV3 1OSGA 2ZZQA 3K2OA 4YZ4A 4Q26A 5FZKA 4PLOA 3U1XA 5IVFA 4Q4X1 3ZSKA 3FE5A 3OGSA 1R1A3 2HWD1 3WF2A 3VD7A 2GMMA 3N9PA 4GALA 5E88A 4LO5B 4CCKA 2PLV1 2YHJA 1Q8OA 1NY72 2JG8B 3AJYA 1CX4A 1Z0HA 3OPTA 3TAYA 4D3WA 1ND2A 3KV5A 3POYA 5E8AA 1RB8G 3ZR6A 3QLQA 1PGL1 1RXFA 3ZN4A 1T6GC 4MV2A 4I0BA 1UY3A 1NXD1 2Y6JA 3FLTA 3HQRA 1RUE2 3NJXA 1LJ7A 1W3XA 2VH9A 5C8CA 1XXNA 2YFUA 3LEIA 4Z2AA 1MVQA 4PHZA 1V6NA 2VMFA 5CU1A 2BOIA 3I2KA 2BWAA 4ASKA 2FHRA 3VKNA 3FUQA 1DZTA 3C2UA 3NV1A 4OZXA 4Q1PA 5FY8A 4OQ8A 3B69A 5BNNA 3H8RA 4GXLA 5FP8A 3VDDC 1Y7BA 4XABA 5FYSA 1GZWA 1SDWA 3C7HA 3I3DA 3EHKA 5EJZB 5KWRA 2DYCA 1DYKA 1PZ7A 1WGPA 2WFF3 1ZRFA 2FZ2A 1EAH1 4CDXA 1YEWA 5FYIA 3MF6A 5A3UA 1TMF2 4FPYA 3M8LA 2UY8A 2RV9A 5T5PA 3L2HA 2RJLA 1PX4A 2HWC3 2BU9A 3LA7A 4H7MA 3AK0A 5DDJ3 4CDWB 1OQEA 2HKXA 1FOD1 2ZBJA 3ZXFA 5JXJA 3BTYA 1ALYA 1Q8PA 4DEQA 2JX9A 3CU7A 4AAXA 3SITA 1ZRCA 3VBOB 2PLV3 5A33A 2BGCA 2A6VA 2RHPA 2XJTA 3MICA 4LIUA 2W87A 1QGLA 1W0OA 1UL9A 5FXXA 4UW4A 5H9QA 4AOCA 1UU6A 4MSVA 2ZX3A 3JXSA 1BJQA 2Q1MA 4HVRA 4LBOA 4XE9A 5HV0A 2VZUA 4FAHA 1W8HA 4ZU7A 2WYSA 3QD6A 2W47A 1K12A 3PIGA 1XU1A 1DF0A 1GNHA 1C1FA 2BP6A 4OHYA 1QJY1 3I2HA 4JRLA 2QE3A 5LASA 4ZPIA 3PTRB 4FPLA 4F83A 5KHKA 4AFCA 1R092 5T52A 1AR61 5FAXA 1W8NA 2B7YA 2OUHA 4CCCA 1JYWA 5CZKA 2IXLA 1I6XA 3DPRB 1VBA3 3POJA 1W9FA 2Y38A 5IK8A 2XGXA 4DXRA 1OOPA 2C9AA 4K1ZA 4HBNA 3JB8A 3MV11 5FXWA 4JDOA 1ODMA 1VBB2
chains in the Genus database with same CATH topology
3T08A 3OEAA 2VZ1A 4A42A 2XONA 2V72A 3PUIA 2VCBA 3CMGA 3ACIA 2JDAA 4XUOA 1PX3A 3PUHA 2VL4A 3LQCA 2QQNA 4IUGA 4RYDA 3WF0A 1O8PA 1XNAA 2VZTA 2J1AA 4A6OA 2ZEZA 2BERA 2VZQA 4JHZA 3WNOA 4FI9A 2CDPA 3OB8A 5IFPA 3T0DA 2HYXA 3WNMA 1H6YA 4YPJA 3ACHA 3GGLA 4A44A 2X09A 4MOAA 3P6BA 3CDZB 2V5DA 1XC6A 4A41A 4ARXA 4CVUA 2L9LA 2W91A 3K46A 1D7PM 4A45A 1OH4A 2WO2A 3IIIA 2EIDA 2VMEA 4QDSA 3HPNA 1UYZA 2WDBA 2J7MA 3HNYM 3IAQA 3C8XA 2EIEA 4OYUA 1W9TA 4OUEA 4AG4A 2VM9A 4P02B 1JYXA 4D0QA 1CZTA 3WNPA 3I2IA 4P00B 2ORXA 4W50A 1F4HA 3C7FA 2B4KA 5LA0A 4XZUG 3T0AA 2KD7A 1NX9A 2EIBA 2VZRA 4QPWA 3HNBM 2VC9A 4CU7A 5LA2A 1UWWA 1W8OA 1WKYA 1PMHX 5IYYA 3WNKA 2J1RA 2VJXA 3CZUA 3CIHA 3FHQA 3MUZ1 1LNSA 2J1EA 2W95A 4QB1A 2J1SA 1GMMA 1L7RA 3FHAA 3BGAA 5HXMA 2BZDA 2YC2A 4UOJA 2VMDA 3ETPA 1TG7A 2WABA 4DUXA 1XPWA 1OD3A 4D8MA 2W5FA 1NAEA 4PF1A 3HJRA 1W9SA 1GNYA 1JZ3A 1J84A 2W46A 4OMDA 2DCJA 2Z4FA 3J7HA 1ULOA 1JZ8A 1SG3A 2X10A 5IFTA 1UX7A 3SKJE 1DP0A 1UZ0A 3GXUA 3THCA 1UYXA 4M4RA 1R64A 3WNNA 5IHRA 2ID4A 4BK5A 4LKSA 3P1IA 3VD4A 3I2JA 2YC4A 2XHNA 3ABZA 1W9WA 1JHJA 1W0NA 3WF1A 1JI6A 2E31A 2ORZA 4LPLA 3OG2A 4RN5A 1NUKA 2VMCA 1UXXX 3K77A 2J1UA 4A4AA 3GDBA 3SEPA 4E8CA 2VCAA 4MGQA 1I5PA 3T09A 5J1XA 1JYNA 3LEGA 1PMJX 3ECQA 1JZ7A 4QDRA 2C26A 2QQKA 4KWUA 4QAWA 4DXSA 4UAPA 2X05A 5DQ0A 3DECA 3WSOA 2WO3A 2YG0A 4TTGA 1SHWB 2W1SA 3K4AA 3W5MA 2ZEWA 5JR2A 2VCCA 2C4XA 3HNMA 2WZ8A 3CZJA 4BK4A 4QX3A 5JUVA 3SEEA 2W1QA 4QX1A 2LS6A 1JYVA 1JZ4A 1JZ2A 1NKGA 3MUY1 3THDA 3NJVA 3A21A 3VD5A 2WN2A 2QBXA 2Y64A 2JD9A 1YQ2A 4MO3M 1JU4A 2WUHA 1L7QA 3HN3A 1HN1A 3NRUA 3IB3A 4BDVB 2VZPA 3HEIA 5CYYA 4JX0A 1JZ6A 2VQTA 3I97A 2HLEA 4W4ZA 2Y8KA 4CUAA 5EJ1B 4DXTA 3VD3A 4GZ9A 5JXHA 1BHGA 2WN3A 2W3JA 3I2GA 3IDAA 4JKKA 1IQDC 3VD9A 3MBWA 4CU6A 2W92A 3A23A 3LPFA 1KEXA 4UI9L 3LEKA 4ET7A 2E32A 1GOFA 1UY1A 1SDDB 4LQRA 2BGPA 2VR4A 3FL7A 2VQUA 4KI5M 5FUIA 5JXIA 1US3A 2XQXA 4QB6A 3WNLA 2CDOA 3BN6A 4KMQA 4XUQA 4MADA 2WBKA 3ZM8A 4XUTA 1RYYA 1OF4A 3A7QA 3F2ZA 3HOBA 3MO4A 3UESA 5JXGA 1ULPA 3OBAA 1GQPA 3WF3A 2OKXA 4OZOA 3AC0A 3T2PA 2YB7A 3MV01 4DUVA 2W94A 3D3AA 1UMIA 1P8JA 1OT5A 5G04L 2VOTA 4QX0A 3DYMA 2ZEYA 2Y6KA 3UNPA 2EICA 4QX2A 2RJ2A 2VO5A 1OF3A 3DYPA 2PQSA 4JKLA 3OEBA 2WAAA 2J1TA 1GU3A 2QQLA 5C70A 4P08A 5F7UA 3EYPA 4PT6A 4XURA 1EUUA 2ZXQA 3C7EA 1T2XA 4DUWA 2WO1A 2JKXA 3T2QA 2QQOA 4CUCA 2RVAA 1GOGA 2E26A 4CUBA 1GOHA 3C7OA 1K45A 2VZVA 5HPOA 2BGOA 4JKMA 4ZY9A 4ZZ5A 2WZEA 3E1F1 3T0BA 4MGSA 4GWIA 1K42A 4GWJA 5C71A 3VDBA 1UYYA 4QDQA 3CQOA 3GM8A 1JZ5A 5B4XA 5LCWL 4E8DA 4A3ZA 4OMCA 2Y6LA 4HG6B 3VDAA 3OGVA 4XUNA 1O59A 2JE8A 3K75B 2W1UA 1CX1A 3EB7A 1W99A 1H6XA 2WAOA 5EIYB 3A22A 2VTFA 4BJ0A 4W8JA 2QQMA 4XVHA 1MPXA 5C7GA 3K4ZA 2R7EB 4QB2A 4LHSA 5B4NA 2QQJA 4ZXEA 1UY0A 4PQQA 2DDUA 2B9VA 5I0DA 5G05L 1O8SA 2BBAA 3C7GA 4XUPA 3NQHA 3OGSA 1TVGA 5DMYA 3WF2A 3VD7A 4BXSV 4CU9A 1DYOA 1KGYA 3ACFA 1K3IA 2Y6GA 2VZOA 3VDCA 3WEZA 1UY4A 2YFZA 4ARYA 3FN9A 3IAPA 1UY3A 2Y6JA 5IJRA 3NJXA 3CKHA 3I3BA 2YFUA 3LEIA 4Z2AA 2J1VA 2VMFA 1EUTA 3I3EA 3I2KA 3OGRA 3UETA 1J83A 5DPNA 1F4AA 2QQIA 3K4DA 2V4VA 3C7HA 1UMHA 3I3DA 1WCQA 5EJZB 2VZSA 1GUIA 4P5YA 1UXZA 5A1AA 2VZ3A 2RV9A 1DLCA 2W9XA 2E33A 2WQ8A 1PX4A 3WQBA 3DYOA 3SKVA 3WF4A 1US2A 3LE0A 5JXJA 1CIYA 4DEQA 4AAXA 3ACGA 4CU8A 3U37A 3T2OA 3LPGA 1CZVA 2W87A 2W1WA 4ZZ8A 1UY2A 5JMOA 3JXSA 1XNTA 5DN2A 2C9KA 2VZUA 2DCKA 2ZEXA 2WYSA 2W47A 1K12A 2Y6HA 2LW8A 4DEVA 1CZSA 3I2HA 4L0PA 1JU3A 1W8NA 3W5NA 5LA1A 3NNGA 1JYWA 2XOMA 5CZKA 2J22A 3I2FA 4DXRA 4M4PA 3MV11 4TXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T08 A;  3OEA A;  2VZ1 A;  4A42 A;  2XON A;  2V72 A;  3PUI A;  2VCB A;  3CMG A;  3ACI A;  2JDA A;  4XUO A;  1PX3 A;  3PUH A;  2VL4 A;  3LQC A;  2QQN A;  4IUG A;  4RYD A;  3WF0 A;  1O8P A;  1XNA A;  2VZT A;  2J1A A;  4A6O A;  2ZEZ A;  2BER A;  2VZQ A;  4JHZ A;  3WNO A;  4FI9 A;  2CDP A;  3OB8 A;  5IFP A;  3T0D A;  2HYX A;  3WNM A;  1H6Y A;  4YPJ A;  3ACH A;  3GGL A;  4A44 A;  2X09 A;  4MOA A;  3P6B A;  3CDZ B;  2V5D A;  1XC6 A;  4A41 A;  4ARX A;  4CVU A;  2L9L A;  2W91 A;  3K46 A;  1D7P M;  4A45 A;  1OH4 A;  2WO2 A;  3III A;  2EID A;  2VME A;  4QDS A;  3HPN A;  1UYZ A;  2WDB A;  2J7M A;  3HNY M;  3IAQ A;  3C8X A;  2EIE A;  4OYU A;  1W9T A;  4OUE A;  4AG4 A;  2VM9 A;  4P02 B;  1JYX A;  4D0Q A;  1CZT A;  3WNP A;  3I2I A;  4P00 B;  2ORX A;  4W50 A;  1F4H A;  3C7F A;  2B4K A;  5LA0 A;  4XZU G;  3T0A A;  2KD7 A;  1NX9 A;  2EIB A;  2VZR A;  4QPW A;  3HNB M;  2VC9 A;  4CU7 A;  5LA2 A;  1UWW A;  1W8O A;  1WKY A;  1PMH X;  5IYY A;  3WNK A;  2J1R A;  2VJX A;  3CZU A;  3CIH A;  3FHQ A;  3MUZ 1;  1LNS A;  2J1E A;  2W95 A;  4QB1 A;  2J1S A;  1GMM A;  1L7R A;  3FHA A;  3BGA A;  5HXM A;  2BZD A;  2YC2 A;  4UOJ A;  2VMD A;  3ETP A;  1TG7 A;  2WAB A;  4DUX A;  1XPW A;  1OD3 A;  4D8M A;  2W5F A;  1NAE A;  4PF1 A;  3HJR A;  1W9S A;  1GNY A;  1JZ3 A;  1J84 A;  2W46 A;  4OMD A;  2DCJ A;  2Z4F A;  3J7H A;  1ULO A;  1JZ8 A;  1SG3 A;  2X10 A;  5IFT A;  1UX7 A;  3SKJ E;  1DP0 A;  1UZ0 A;  3GXU A;  3THC A;  1UYX A;  4M4R A;  1R64 A;  3WNN A;  5IHR A;  2ID4 A;  4BK5 A;  4LKS A;  3P1I A;  3VD4 A;  3I2J A;  2YC4 A;  2XHN A;  3ABZ A;  1W9W A;  1JHJ A;  1W0N A;  3WF1 A;  1JI6 A;  2E31 A;  2ORZ A;  4LPL A;  3OG2 A;  4RN5 A;  1NUK A;  2VMC A;  1UXX X;  3K77 A;  2J1U A;  4A4A A;  3GDB A;  3SEP A;  4E8C A;  2VCA A;  4MGQ A;  1I5P A;  3T09 A;  5J1X A;  1JYN A;  3LEG A;  1PMJ X;  3ECQ A;  1JZ7 A;  4QDR A;  2C26 A;  2QQK A;  4KWU A;  4QAW A;  4DXS A;  4UAP A;  2X05 A;  5DQ0 A;  3DEC A;  3WSO A;  2WO3 A;  2YG0 A;  4TTG A;  1SHW B;  2W1S A;  3K4A A;  3W5M A;  2ZEW A;  5JR2 A;  2VCC A;  2C4X A;  3HNM A;  2WZ8 A;  3CZJ A;  4BK4 A;  4QX3 A;  5JUV A;  3SEE A;  2W1Q A;  4QX1 A;  2LS6 A;  1JYV A;  1JZ4 A;  1JZ2 A;  1NKG A;  3MUY 1;  3THD A;  3NJV A;  3A21 A;  3VD5 A;  2WN2 A;  2QBX A;  2Y64 A;  2JD9 A;  1YQ2 A;  4MO3 M;  1JU4 A;  2WUH A;  1L7Q A;  3HN3 A;  1HN1 A;  3NRU A;  3IB3 A;  4BDV B;  2VZP A;  3HEI A;  5CYY A;  4JX0 A;  1JZ6 A;  2VQT A;  3I97 A;  2HLE A;  4W4Z A;  2Y8K A;  4CUA A;  5EJ1 B;  4DXT A;  3VD3 A;  4GZ9 A;  5JXH A;  1BHG A;  2WN3 A;  2W3J A;  3I2G A;  3IDA A;  4JKK A;  1IQD C;  3VD9 A;  3MBW A;  4CU6 A;  2W92 A;  3A23 A;  3LPF A;  1KEX A;  4UI9 L;  3LEK A;  4ET7 A;  2E32 A;  1GOF A;  1UY1 A;  1SDD B;  4LQR A;  2BGP A;  2VR4 A;  3FL7 A;  2VQU A;  4KI5 M;  5FUI A;  5JXI A;  1US3 A;  2XQX A;  4QB6 A;  3WNL A;  2CDO A;  3BN6 A;  4KMQ A;  4XUQ A;  4MAD A;  2WBK A;  3ZM8 A;  4XUT A;  1RYY A;  1OF4 A;  3A7Q A;  3F2Z A;  3HOB A;  3MO4 A;  3UES A;  5JXG A;  1ULP A;  3OBA A;  1GQP A;  3WF3 A;  2OKX A;  4OZO A;  3AC0 A;  3T2P A;  2YB7 A;  3MV0 1;  4DUV A;  2W94 A;  3D3A A;  1UMI A;  1P8J A;  1OT5 A;  5G04 L;  2VOT A;  4QX0 A;  3DYM A;  2ZEY A;  2Y6K A;  3UNP A;  2EIC A;  4QX2 A;  2RJ2 A;  2VO5 A;  1OF3 A;  3DYP A;  2PQS A;  4JKL A;  3OEB A;  2WAA A;  2J1T A;  1GU3 A;  2QQL A;  5C70 A;  4P08 A;  5F7U A;  3EYP A;  4PT6 A;  4XUR A;  1EUU A;  2ZXQ A;  3C7E A;  1T2X A;  4DUW A;  2WO1 A;  2JKX A;  3T2Q A;  2QQO A;  4CUC A;  2RVA A;  1GOG A;  2E26 A;  4CUB A;  1GOH A;  3C7O A;  1K45 A;  2VZV A;  5HPO A;  2BGO A;  4JKM A;  4ZY9 A;  4ZZ5 A;  2WZE A;  3E1F 1;  3T0B A;  4MGS A;  4GWI A;  1K42 A;  4GWJ A;  5C71 A;  3VDB A;  1UYY A;  4QDQ A;  3CQO A;  3GM8 A;  1JZ5 A;  5B4X A;  5LCW L;  4E8D A;  4A3Z A;  4OMC A;  2Y6L A;  4HG6 B;  3VDA A;  3OGV A;  4XUN A;  1O59 A;  2JE8 A;  3K75 B;  2W1U A;  1CX1 A;  3EB7 A;  1W99 A;  1H6X A;  2WAO A;  5EIY B;  3A22 A;  2VTF A;  4BJ0 A;  4W8J A;  2QQM A;  4XVH A;  1MPX A;  5C7G A;  3K4Z A;  2R7E B;  4QB2 A;  4LHS A;  5B4N A;  2QQJ A;  4ZXE A;  1UY0 A;  4PQQ A;  2DDU A;  2B9V A;  5I0D A;  5G05 L;  1O8S A;  2BBA A;  3C7G A;  4XUP A;  3NQH A;  3OGS A;  1TVG A;  5DMY A;  3WF2 A;  3VD7 A;  4BXS V;  4CU9 A;  1DYO A;  1KGY A;  3ACF A;  1K3I A;  2Y6G A;  2VZO A;  3VDC A;  3WEZ A;  1UY4 A;  2YFZ A;  4ARY A;  3FN9 A;  3IAP A;  1UY3 A;  2Y6J A;  5IJR A;  3NJX A;  3CKH A;  3I3B A;  2YFU A;  3LEI A;  4Z2A A;  2J1V A;  2VMF A;  1EUT A;  3I3E A;  3I2K A;  3OGR A;  3UET A;  1J83 A;  5DPN A;  1F4A A;  2QQI A;  3K4D A;  2V4V A;  3C7H A;  1UMH A;  3I3D A;  1WCQ A;  5EJZ B;  2VZS A;  1GUI A;  4P5Y A;  1UXZ A;  5A1A A;  2VZ3 A;  2RV9 A;  1DLC A;  2W9X A;  2E33 A;  2WQ8 A;  1PX4 A;  3WQB A;  3DYO A;  3SKV A;  3WF4 A;  1US2 A;  3LE0 A;  5JXJ A;  1CIY A;  4DEQ A;  4AAX A;  3ACG A;  4CU8 A;  3U37 A;  3T2O A;  3LPG A;  1CZV A;  2W87 A;  2W1W A;  4ZZ8 A;  1UY2 A;  5JMO A;  3JXS A;  1XNT A;  5DN2 A;  2C9K A;  2VZU A;  2DCK A;  2ZEX A;  2WYS A;  2W47 A;  1K12 A;  2Y6H A;  2LW8 A;  4DEV A;  1CZS A;  3I2H A;  4L0P A;  1JU3 A;  1W8N A;  3W5N A;  5LA1 A;  3NNG A;  1JYW A;  2XOM A;  5CZK A;  2J22 A;  3I2F A;  4DXR A;  4M4P A;  3MV1 1;  4TXW A; 
#chains in the Genus database with same CATH topology
 1W28 A;  1QJF A;  3OEA A;  4WZF A;  1VBC 1;  3ZKU A;  4XJU A;  1ZA7 A;  2DCZ A;  2XON A;  2XUM A;  4M3C E;  5FYH A;  1OD5 A;  2DTW A;  2VCB A;  3MID A;  1DCS A;  1QXJ A;  3TBD A;  1NXM A;  1V6L A;  1NA1 B;  3J8F 2;  1RUG 2;  1WMX A;  2ZS6 B;  3GJA A;  4URT A;  4CP0 A;  5F1R A;  3URF A;  2XML A;  4AHZ A;  2VXJ A;  1GP5 A;  2WJS A;  2QVS B;  2WZR 3;  2GAL A;  3KT4 A;  4QPG A;  4RYD A;  2BTV C;  5FZ6 A;  2PQQ A;  2Q5T A;  4YG0 A;  4WZC A;  5J48 A;  5K8S A;  1BKZ A;  4LBQ A;  1PGW 1;  4A6O A;  5GZG A;  5JI9 A;  3MFC A;  3Q8A A;  1JTZ X;  4FI9 A;  4XFB A;  4RQP C;  5AC9 3;  4BQ3 A;  3NV2 A;  3T0D A;  1H6Y A;  1QJY 3;  2DF7 A;  3MHZ A;  2WZP P;  1IPS A;  4M0N A;  3E97 A;  3SIS A;  3WHU A;  3VBS C;  1DQ1 A;  2ILM A;  5FKB A;  1W6O B;  1EYB A;  3HR9 A;  1QKQ A;  4MOA A;  4Q4Y 2;  5IVC A;  1SPP B;  5GZF A;  1U5I A;  1RUC 2;  1XC6 A;  2CAU A;  2O14 A;  4PI2 A;  1RIN A;  1DBN A;  1NE6 A;  1UU4 A;  5GZD A;  1W06 A;  2WLP A;  4Q0P A;  1LGB A;  4PBO A;  5BNP B;  1S2E A;  2PAE A;  2WT1 A;  2MHF A;  2WO2 A;  2NYY A;  3JZV A;  1LKN A;  1QJU 3;  1Y4W A;  2YYO A;  1C8M 1;  2WDB A;  3OYW A;  3QCW A;  2ARX A;  2JG9 A;  1XE8 A;  4HZF A;  4UFL A;  4AR2 A;  3KF5 A;  4MGI E;  5FIX A;  4P02 B;  2YC0 A;  1PZ8 A;  1ZBA 2;  2DUO A;  4Y4R A;  1C3H A;  4MHR A;  4NIA A;  1LES A;  3TNQ A;  5FYB A;  4XC9 A;  2A70 A;  2B4K A;  4G4F A;  3VBU A;  5BNO B;  3T0A A;  5A7W A;  2YMZ A;  1N1Y A;  4O7X A;  3HT2 A;  1NCR B;  3B02 A;  4AHY A;  3HD8 B;  2EXJ A;  3S6P A;  2DU1 A;  5F6L B;  5LA2 A;  1UWW A;  1KJL A;  3FBM A;  1KFX L;  3IIA A;  4IE7 A;  4JQR A;  1QJX 1;  3H42 B;  3CZU A;  3J9S A;  5EHD A;  3POE A;  3ROU A;  1L7R A;  1PK6 A;  5JR7 B;  4OI1 A;  1NQD A;  1Z7S 2;  2Y6F A;  4L8Q A;  4AEJ A;  3M3O A;  1TZO A;  3E6B A;  2HWE 2;  1HXS 3;  1GZC A;  1OPM A;  5FWE A;  3T2T A;  3VHO A;  5D8A B;  4G9S B;  4O65 A;  5FPU A;  2VMD A;  3ZIW A;  3H1Y A;  1ASJ 1;  4Q0Q A;  4AGG A;  1TG7 A;  3UK9 A;  4R9D A;  4IGO A;  4FAG A;  2E51 A;  5BNQ A;  3U0Z A;  2WS9 2;  5ACA 1;  1K5J A;  4YAR A;  2D97 A;  1OD3 A;  1OHF A;  4BME A;  3ZFG A;  2QDN A;  1NAE A;  3LA3 A;  5JR2 A;  1NE4 A;  2ZHN A;  2ZGS A;  1OA4 A;  5CEH A;  3PVO A;  4WM8 C;  4AI2 A;  3ILR A;  4FOV A;  3ACL A;  2DCJ A;  4XDO A;  4GH4 A;  4AVA A;  4NMI A;  2A75 A;  4Q1R A;  4PIX A;  1SG3 A;  5FPL A;  1HRI 2;  5IFT A;  5A1F A;  5FWJ A;  4EZH A;  1DP0 A;  2OS2 A;  5AVP A;  4K1Y A;  3UGG A;  4LBK A;  3BAL A;  4BK5 A;  3P1I A;  2D93 A;  1YWK A;  3I2J A;  4XBN A;  4BU2 A;  4CP1 A;  4XIK A;  1UMZ A;  2R1D A;  3WD5 A;  2YC4 A;  4CEW C;  4U2A A;  4GMP 0;  4GUL A;  1LGC A;  1D2Q A;  3MLL A;  4CXX A;  2J42 A;  2F17 A;  3U78 A;  5SV5 A;  2DBI A;  3GCX A;  1VPH A;  1W0N A;  3LF7 A;  3S5A A;  1JI6 A;  1RJ8 A;  4IEP A;  3VKF C;  2B5H A;  2ORZ A;  3ZPO A;  1KFU L;  3OTF A;  1DQ4 A;  2WC2 A;  3OG2 A;  3KCC A;  5A6Q A;  3K77 A;  4XF1 A;  4Z1V A;  5CBL A;  4UXA A;  2JDU A;  2QQV A;  1SMV A;  2DTY A;  1JYN A;  1W6M A;  5A3L A;  4JHT A;  4LBQ D;  1SCS A;  4BQ1 A;  4YNI A;  4QDR A;  4Y4Y A;  2A71 A;  2G9Z A;  2P5B A;  1BBT 3;  3VBF B;  2C26 A;  1W6N A;  3USU A;  1NCQ C;  2RE9 A;  2BQP A;  3R4U A;  3O7O A;  1BXH A;  3POW A;  1Q5O A;  4QAW A;  3IWZ A;  5FPB A;  4DXS A;  5FPX A;  2X05 A;  5LRS A;  3HQX A;  1EPW A;  1STM A;  2ZGT A;  3RGB A;  3J7L A;  1YNA A;  1S55 A;  2A6Z A;  3K4A A;  4YM1 A;  3PL0 A;  1BK0 A;  2ZEW A;  2RM2 1;  3W5M A;  2BW8 A;  3JD7 2;  5FYY A;  1H4G A;  4IGQ A;  5FZ7 A;  4RFR B;  1OI6 A;  1AVB A;  2QUO A;  4F8A A;  5I93 A;  2ZGN A;  1LTE A;  1YYN A;  1COV 3;  2LAL A;  1ENS A;  3F95 A;  3VKL A;  3OF1 A;  1NYW A;  5T54 A;  4ES8 A;  5A3M A;  2LS6 A;  5JZG A;  4NRQ A;  2RS3 2;  4QQP A;  1OLM A;  1ZX5 A;  1V70 A;  4LR4 A;  4EQV A;  3M3C A;  4XMI A;  2R07 2;  5L7O B;  3WDU A;  2O0O A;  1JZ4 A;  1JZ2 A;  1NKG A;  1C57 A;  4XQ4 A;  5I0S A;  3IMM A;  4N9I A;  1RUE 3;  5GJ6 A;  1SLL A;  2KXL A;  3TB0 A;  3O1U A;  3B3Q E;  4HK8 A;  2WNO A;  5T5O A;  2LUW A;  3CHX A;  4HVO A;  2JD9 A;  3AP9 A;  1SQ4 A;  3AKS A;  3DV8 A;  3KT1 A;  1L7Q A;  1NG0 A;  1OH3 A;  2JDH A;  4OHX A;  1HN1 A;  1DLL A;  5F3C A;  1F2N A;  3NRU A;  4Z82 A;  3RWN A;  1C5H A;  1AXZ A;  2YDE A;  4XJA A;  5DAV A;  2VZP A;  3P3N A;  3POI A;  5A3O A;  3WHT A;  3I2O A;  3GF6 A;  1C5I A;  1AR8 3;  3GAL A;  4W4Z A;  2HEY F;  2VXR A;  2IXC A;  2K46 A;  5EYX A;  1H2M A;  3I4I A;  4AED A;  3MIB A;  1N3O A;  4XMA A;  5FZO A;  1ND2 B;  5FUN A;  2RM2 3;  4GZ9 A;  1ZA4 A;  2RMU 2;  5DAW A;  4AVT A;  4EN6 B;  1BHG A;  4URA A;  3DL3 A;  4IEZ A;  4L11 A;  2W3J A;  4A7Z A;  2G9F A;  1IQD C;  1V9U 1;  5C8C B;  5CG9 A;  2WIN B;  4V1P A;  3WZ1 A;  4FBF A;  3SCH A;  4HON A;  1LAJ A;  3ILN A;  3HMY A;  5CKM A;  4H14 A;  2QDR A;  3TRS B;  5FY4 A;  1KEX A;  5GLW A;  5SV8 A;  3LEK A;  1PIV 2;  4ET7 A;  3BOW A;  4AGR A;  4HXC A;  5BNN B;  2AEZ A;  3D6E A;  3WUD A;  1R1A 2;  3D0J A;  4LQR A;  1GZW B;  2EAL A;  4H2A A;  2VR4 A;  1JUI A;  2VNR A;  2ADE A;  2VQU A;  3GBW A;  4CDX B;  2ZKL A;  4B4P A;  5IAX A;  2D5H A;  1E5I A;  2GNM A;  4O9E A;  4UBG A;  4ERO A;  2JIJ A;  4C1X A;  4LO7 A;  1GP4 A;  3VZO A;  4XHX A;  1YQ6 A;  5DAQ A;  5DUW A;  4RGA A;  1RTV A;  2RJK A;  2V4A A;  3ZFF B;  5J3U A;  4E27 A;  4PQ9 A;  1OA3 A;  4GWM A;  2D6P A;  3I3Q A;  3GHM A;  5A33 B;  4NID A;  1D4M 1;  1BCX A;  1MS3 A;  1PMI A;  2OKX A;  4QMA A;  2WFF 2;  1ZBE 1;  2VPV A;  1RXG A;  5IK5 A;  4WVM A;  4XXP A;  3V0B A;  4IND A;  5IT6 A;  5LK5 A;  1V9U 3;  2H0V A;  5JOZ A;  3MYX A;  2E6V A;  1P8J A;  1OT5 A;  1YUD A;  2WSU A;  2B9U A;  2VOT A;  3CL1 A;  4QX0 A;  2Y6K A;  2HWC 2;  3M4F A;  3ES1 A;  5DDJ 2;  3ZFE A;  2W68 A;  2RJ2 A;  2X29 A;  1O5U A;  3O1S A;  4Q4X 2;  3OEB A;  3N3H A;  2B42 B;  1GU3 A;  2J1T A;  2QQL A;  1HJG A;  1Y9G A;  2PLV 2;  4HSL A;  4CDU A;  1OOP B;  1RUJ 1;  2AGS A;  5C3O A;  4LE3 A;  2VUA A;  4Y20 A;  1EUU A;  3ITQ A;  4V2W A;  3LIG A;  3VBR B;  4S2G A;  1QNW A;  4DUW A;  2GH2 A;  5CB7 A;  4JDN A;  1D4V B;  1UZZ A;  1XYO A;  2RVA A;  4M01 A;  3D82 A;  4XIL A;  4YG3 A;  4BOW A;  2BGO A;  5DUV A;  4N43 A;  1VBE 1;  4ZY9 A;  3ZXG A;  2P3J A;  4ZZ5 A;  1H9W A;  2WZE A;  4Y1Z A;  5L73 A;  4GMP 1;  2UYA A;  2XQR A;  3O12 A;  3VDB A;  1IPJ A;  1Y43 B;  3UYJ A;  4QDQ A;  3ZYG A;  2SLI A;  3GM8 A;  1XU2 A;  1CAX B;  4QPG B;  5B4X A;  3HIF A;  3ZSE A;  5LCW L;  2SBA A;  4E8D A;  3PU3 A;  2HYK A;  5FJK A;  3W59 A;  1CPM A;  4LBQ B;  5F3E A;  2ZX0 A;  5JSP A;  1ZBE 3;  2LTN A;  1O4T A;  1EAH 2;  3OGV A;  5T50 A;  2GP3 A;  1H8T C;  3AL5 A;  3MIF A;  3U4S A;  4EWD A;  5C3S A;  2ZHK A;  1W8Z A;  4YZ3 A;  4CEY C;  1IOA A;  3HAG A;  4NRO A;  5FY9 A;  2W1U A;  5I8S A;  1HQW A;  2WSV A;  3S7I A;  5IVY A;  3AZZ A;  4XBL A;  2VOX A;  1VE0 A;  4N8M A;  4AFM A;  5JPN B;  4LK6 A;  4N7I A;  1WCK A;  1G9D A;  2ZX4 A;  1FOD 2;  3AYD A;  1IHM A;  4HMZ A;  4NHM A;  4FO9 A;  1BEV 3;  1C4R A;  1ND3 A;  1TEI A;  2MNG A;  4CTE A;  1MPX A;  2VW0 A;  5FZA A;  2R7E B;  1GKB A;  1QNY A;  1XNC A;  2UWA A;  5F5Q A;  3OUI A;  3RMX A;  4KBZ A;  3JB4 C;  1G86 A;  2QZ2 A;  5B4N A;  3MW4 A;  1FMD 1;  1E5H A;  3B9I A;  4XFI A;  4ZXE A;  3KB5 A;  2VEC A;  3WW1 A;  3OYW B;  3M3E A;  5AC9 2;  2JG9 B;  1UO9 A;  4I3P A;  3OSD A;  2IC1 A;  1YQ8 A;  1O8S A;  3S7E A;  3V64 A;  2BNM A;  1XND A;  1QJY 2;  1X7N A;  2XBO 3;  3WDT A;  3C7G A;  1DGW A;  4AE2 A;  3WW4 A;  3NQH A;  1YIF A;  1XBF A;  5A7O A;  3UKN A;  5A6X A;  1AR6 2;  1YI7 A;  2FDH A;  4BXS V;  4FPG A;  2ET1 A;  2ZGM A;  3KMH A;  2Q8D A;  5AVA A;  3VBU B;  4AFD A;  3BKZ A;  4B3N A;  1K3I A;  5A7W B;  3AYC A;  4FPE A;  4OFG A;  4N53 A;  3WEZ A;  1YFX A;  2DCY A;  4W65 A;  1YRZ A;  4ARY A;  1DYP A;  4Y5Z 0;  3IDB B;  1VJ2 A;  3MW3 A;  3KZ4 C;  1VBC 2;  1QJU 2;  2N7G A;  3WY6 A;  2KR2 A;  2ZA9 A;  5ERL A;  3D4K A;  4UFI A;  4AF9 A;  1EY2 A;  1RMU 3;  3I3E A;  1ST8 A;  2VBP A;  3OGR A;  4KU8 A;  5EJ3 A;  5FY5 A;  1AYM 1;  4I3G A;  1J83 A;  1AR9 1;  5FQ0 A;  4XCA A;  1AHS A;  5F32 A;  2QQI A;  4H55 A;  2DCT A;  5DAP A;  2AUY A;  2Q30 A;  2QJV A;  1UMH A;  4LHN A;  3ZXK A;  2BJS A;  1XSR A;  5LEK A;  3DKQ A;  1PGW 2;  2YGM A;  3IT8 A;  2CGO A;  4H7L A;  3PTY A;  3LIH A;  3ZFG B;  5FPZ A;  2VZ3 A;  4FOY A;  2W9X A;  2G1M A;  5FBJ A;  3LAG A;  1QOS A;  2NLR A;  4L2N A;  3RZM A;  1OFN A;  3H1W A;  1LHO A;  3UGH A;  2ZOE B;  3U75 A;  4DPN A;  4E4S A;  3SKV A;  4ZKT B;  1US2 A;  1UQX A;  2WL1 A;  3GBF A;  1LU2 A;  3PIJ A;  1PO2 1;  1CN1 A;  3RSJ A;  4OI0 A;  3CO2 A;  5C4W A;  4CU8 A;  4D6S A;  4XXA A;  3BU0 A;  5I91 A;  3KVB A;  4P9J A;  4QT6 A;  3LGR A;  1HXS 2;  1X36 A;  3VBO C;  2W1W A;  3ZYR A;  3TEW A;  1H1M A;  1YFU A;  1UY2 A;  2D5F A;  1UU5 A;  1W6Q A;  3EO6 A;  3G6J B;  4W6W A;  5LY2 A;  4CCM A;  4QKD A;  1H1A A;  2DCK A;  4XQD A;  3TNP B;  3O0V A;  5LZ6 A;  1HIX A;  2Y6H A;  4YGD A;  5FOJ B;  1C8M 2;  1PVC 1;  3LEM A;  2LW8 A;  3MW2 A;  4DEV A;  4PBP A;  4FPH A;  1QJZ A;  4Q8L A;  1AXY A;  3JQX A;  1OA2 A;  3OUJ A;  3B9C A;  2DWR A;  1AYM 3;  1JU3 A;  3OBR A;  4CDQ C;  5EWS A;  5FPA A;  2E63 A;  1AR9 3;  1UYP A;  3H1M A;  1O3R A;  1ENQ A;  5LA1 A;  1ZRD A;  3NAP A;  2IWG B;  4MHU A;  3DPR C;  2HJI A;  2R49 A;  3I2F A;  1TE1 B;  1LED A;  4TXW A;  4BQX A;  4ZHN A;  1UZW A;  1FNY A;  2VMH A;  3AYA A;  2RS3 3;  2DVG A;  5DUX A;  5GLU A;  1W6M B;  4LLO A;  4NO4 A;  1F31 A;  4A42 A;  4D7S A;  1LRH A;  2GC3 A;  4NAM A;  2A73 B;  4DNY A;  5GZE A;  5LRR A;  1W6N B;  2V72 A;  3USU B;  1V6O A;  5FYU A;  3CMG A;  2JDA A;  4Y1U A;  1XB9 A;  4CCL A;  1VB2 A;  3CEW A;  5KC5 A;  5LBE A;  1POV 3;  3UV9 A;  1PX3 A;  2VL4 A;  5GLT A;  4LBN A;  4QKN A;  4B8E A;  1O3Q A;  1NA1 C;  3LQC A;  2G4I A;  3OBZ A;  1VLN A;  3TN9 1;  3WF0 A;  3WX5 A;  1O8P A;  1XNA A;  3NJZ A;  1ASJ 2;  2VOV A;  2A7A A;  2R0F A;  1FT9 A;  2ZEZ A;  4JHZ A;  5JI7 A;  5FZ4 A;  1H2L A;  2OPK A;  1DGR A;  4IE6 A;  3JQW A;  2CDP A;  2IXJ A;  1NT0 A;  2PHW A;  3OGJ A;  2CU5 A;  4I0W B;  2WWS A;  2D7F A;  5JZG B;  3TYJ A;  3WNM A;  1WA4 A;  3ZYH A;  1BBT 2;  2BNN A;  2MEV 3;  3NV4 A;  3ACH A;  4YPJ A;  3TEY A;  1ZZC A;  4MVT A;  1ACC A;  2XLA A;  3PUS A;  4BYY A;  4JRA A;  2ZGK A;  1JBC A;  5IWF A;  3THT A;  2A5Z A;  2G19 A;  2OVU A;  3VBS A;  2EVX A;  2VE1 A;  3FFQ A;  4ARX A;  1R1Z A;  4KQ7 A;  4OUS A;  2W91 A;  4OI4 A;  4UYB A;  2ZCW A;  3H8U A;  4DRV A;  1D7P M;  1A8M A;  4TLF A;  2GN7 A;  2YPD A;  1X50 A;  4QU2 A;  3III A;  5BNP C;  4Q4V 1;  2GND A;  3K3O A;  2J7M A;  4FP3 A;  4QM8 A;  4XFC A;  1COV 2;  3C8X A;  2Y33 A;  1JN2 P;  4EJR A;  5APA A;  2WKK A;  4OUE A;  2VG9 A;  5D1I A;  3FLP A;  4AG4 A;  1JYX A;  2ZX2 A;  4D0Q A;  4I30 A;  1CZT A;  3WG2 A;  3I2I A;  3WXP A;  4W50 A;  4DY3 A;  1OQD A;  1F4H A;  1A78 A;  4R52 A;  3ATG A;  5FYZ A;  4AED B;  4J25 A;  4XIO A;  5FZO B;  1S0I A;  3TN9 3;  5LA0 A;  4R9B A;  1NLQ A;  2UWB A;  2KD7 A;  4OQ9 A;  2NMO A;  3DXU A;  2EIB A;  2VZR A;  5BNO C;  1F35 A;  1VMH A;  1HQL A;  2AH2 A;  4KH9 A;  3ZYB A;  2OUJ A;  5H9S A;  4WM7 C;  2A3X A;  1W9Y A;  2PYT A;  4BPZ A;  4ITC A;  1NCR C;  1WKY A;  1PMH X;  5I0T A;  1PM4 A;  3AKT A;  5FMB A;  2J1R A;  1LUL A;  1QQP 3;  3MPB A;  3Q8C A;  2FCT A;  3CIH A;  4QQH A;  4TZD A;  1SBD A;  1O4Y A;  1HB2 A;  1LNS A;  5M0T A;  4QB1 A;  1AR8 2;  1GMM A;  1OFS A;  3WDV A;  3RYR A;  3NVC A;  5FO9 B;  3MI8 A;  5GZC A;  3LOB A;  2XLF A;  2XWB B;  3PUQ A;  2RM2 2;  2YY1 A;  3BOD A;  4Z92 B;  2WQZ C;  5D8A C;  2XKO A;  4B1M A;  3KD4 A;  2VW1 A;  2DUP A;  2QFE A;  3FMG A;  5JOX A;  1ZZ8 A;  4RR3 A;  4IV3 B;  4YGB A;  1KDM A;  4NHY A;  1ULF A;  1AJO A;  2IVJ A;  2W5F A;  4XF9 A;  4Q4X 3;  2JDZ A;  4ATE A;  2EAA A;  2HWD 3;  2V73 A;  4BWO A;  2PN5 A;  1L3J A;  1QH7 A;  4IEV A;  2P17 A;  2QKD A;  5KHH A;  4P9L A;  3RVH A;  4OMD A;  5E89 A;  4YSF A;  1GQG A;  1VBD 1;  3MF9 A;  1LU1 A;  1R08 1;  1UX6 A;  2I2S A;  3SH4 A;  5J7M A;  1LHV A;  4IEW A;  1UZ0 A;  3GXU A;  3THC A;  4QQ2 A;  1UNB A;  3I54 A;  4GB3 1;  4QHZ A;  4WVM B;  4FQZ A;  5IHR A;  4X6Q B;  1OUR A;  2JD4 A;  4LKS A;  2BFU S;  1UN1 A;  5TSW A;  4MYE A;  5CFD A;  1W2U A;  1JOD A;  4FFI A;  3BU7 A;  2P6H A;  3N7J A;  4AFA A;  3ILF A;  2EXI A;  1RVF 1;  1PVX A;  3WCS A;  2GP5 A;  2ZAB A;  3U14 A;  3KV4 A;  4D6R A;  2E9Q A;  5DAB A;  2X53 S;  3ZFE B;  4CP9 A;  2XHN A;  5DG1 A;  1RUD 1;  3MDP A;  1YJK A;  3ABZ A;  1W9W A;  2WII B;  3WDY A;  2RDN A;  4LUK A;  3HWJ A;  2OZJ A;  3NKG A;  3N9M A;  4HKO A;  5FP9 A;  1EAH 3;  2VU9 A;  2ARB A;  4CDU B;  2NZ9 A;  1LOC A;  4YVW A;  1D2S A;  2RR1 1;  2JDM A;  4RN5 A;  4Y20 B;  2IVI B;  2B39 A;  3KSC A;  1VB4 A;  2GC1 A;  3VBH A;  3ZN6 A;  2P37 A;  3BPS A;  1LEN A;  2VCA A;  5J1X A;  3JCI A;  2ZAC A;  1DQ0 A;  3LEG A;  1MEC 1;  3LWC A;  1FOD 3;  1FYU A;  3HQU A;  3B01 A;  4EN8 B;  1V9U 2;  3LDK A;  4MXW A;  4N43 B;  5JIU A;  2BWC A;  3RMY A;  2HH9 A;  1RUH 1;  4KWU A;  1LOB A;  4UAP A;  3VKM A;  5DQ0 A;  4C8D A;  1C1L A;  1VBD 3;  4Y1X A;  2V09 A;  4FXG B;  4XTM A;  1BMV 1;  2WO3 A;  1SHW B;  2ZGP A;  5E6H A;  2P34 A;  1UKG A;  4HT1 T;  4RGK A;  4UWD A;  4WVZ A;  4PLM A;  4NOT A;  3AKQ A;  1AL0 G;  4AQS A;  3QAC A;  1H30 A;  4KWL A;  1SAC A;  1AR6 3;  4C1W A;  3VHP A;  3PVB B;  4YFZ A;  4FQ4 A;  4Y5T A;  3X29 B;  5F5C A;  1E5S A;  5ABJ C;  5DZE A;  1RUD 3;  4WVV A;  4CSW A;  5BUV A;  2Q4S A;  1CD3 G;  2BNO A;  1ND3 B;  1IG3 A;  1ZZ7 A;  1SBF A;  5L7O C;  3POS A;  3THD A;  1YQ5 A;  1YCI A;  4IE0 A;  4ASM B;  4JGY A;  4CPB A;  1VBC 3;  3A21 A;  5IVV A;  3KLS A;  3VD5 A;  5C9A C;  4K7J A;  2QBX A;  1ZBE 2;  4MO3 M;  4Y22 A;  1LOA A;  4XUO A;  2WUH A;  1MEC 3;  4K40 A;  1WW5 A;  1BQP A;  5JWP A;  3BCW A;  1RED A;  4QXC A;  2HBT A;  3ES4 A;  2Y0I A;  3VUO A;  1A34 A;  1WW7 A;  3HEI A;  2QNK A;  1JZ6 A;  2NPI A;  3H3U A;  4YW3 A;  2F4L A;  4HOO A;  3CJX A;  1W2O A;  2Y8K A;  3ZO0 B;  1BEV 2;  2XVK A;  1AF9 A;  3V0A A;  3ZKY A;  1YFY A;  5JIA A;  4IGP A;  2CWS A;  4DXT A;  3N9O A;  3VD3 A;  4N53 B;  3WUC A;  5JXH A;  2EA7 A;  2JXA A;  1ULD A;  3AKP A;  2WT2 A;  3KCX A;  3IDA A;  4C91 A;  4TN7 A;  4EYU A;  1O6U A;  1SFN A;  2XJQ A;  2XB6 C;  3H50 A;  3IBM A;  5ANN A;  4NE9 A;  5F39 A;  3RZG A;  4NUB A;  3VD9 A;  3TEX A;  2FMD A;  4CU6 A;  5C8C C;  1VBE 2;  2FQP A;  1GQH A;  2W92 A;  3A23 A;  3CJI A;  3LPF A;  2DFB A;  2XBO 2;  3NO8 A;  4P9G A;  1V6I A;  4UI9 L;  5F8P A;  5FYM A;  1KDK A;  2PTM A;  4BQW A;  2E32 A;  4IDZ A;  5FQ0 B;  1GOF A;  3U10 A;  1RHI 1;  3VLB B;  1S0F A;  3GBG A;  5BNN C;  5LAT A;  1V6M A;  1MZF A;  2X5I A;  3IZO A;  1CPN A;  2BGP A;  3ZXD A;  3GHN A;  2DVD A;  3VV1 A;  1C8M 3;  3FL7 A;  1REF A;  2BUK A;  3KGL A;  4ZXK A;  1KJR A;  4KI5 M;  4XFG A;  3FC0 A;  2UYB A;  4CDX C;  2FCV A;  4Z8B A;  1US3 A;  2R6Q A;  2D3S A;  3FJS A;  5FXV A;  4QB6 A;  4AZZ A;  4QHB A;  4A6S A;  3AZY A;  1OUX A;  4CZS A;  2QCS B;  5D21 A;  3BN6 A;  1KIT A;  3AVR A;  4MAD A;  2WBK A;  4AGV A;  1RMU 2;  5FY7 A;  5IVE A;  2IXH A;  2VVD A;  2HEW F;  3ZFF C;  4EWE A;  1C8N A;  4R9C A;  3AMP A;  5C4W B;  2FBE A;  2Y60 A;  4XF3 A;  4AI3 A;  3LDR A;  2EXK A;  1IZ3 A;  4IXL A;  2WWU A;  3A7Q A;  3F2Z A;  3MGU A;  3MO4 A;  2RDR A;  3SMH A;  2YBK A;  3UES A;  1ULP A;  3OBA A;  1GQP A;  4YW2 A;  1W6Q B;  4EN7 B;  5JXG A;  3OD4 A;  3WF3 A;  1JW6 A;  3O0W A;  4OZO A;  1N1T A;  1QJX 3;  4AFB A;  2PHT A;  1FMD 2;  2P6C A;  3KQR A;  2ATF A;  4LUL A;  1X8M A;  4COW A;  5F9T A;  5CVR A;  1UMI A;  5G04 L;  3LA2 A;  3ZMN A;  3AZX A;  1WLC A;  4S2F A;  2WA3 A;  3UNP A;  2CGN A;  2HWB 1;  2ZPX A;  4QX2 A;  5KXE A;  2JDK A;  5CG8 A;  2ZGL A;  2VO5 A;  4IEQ A;  1OF3 A;  3DYP A;  3IPV B;  5IK4 A;  3ZSL A;  1ASJ 3;  1RHI 3;  4AQ6 A;  3ZYJ B;  3NAP B;  3K51 A;  3KM5 A;  1GIC A;  1PM7 A;  2WAA A;  4PCR A;  4IV1 C;  5K0U C;  4QPI A;  4FXK B;  4DY5 A;  3NST A;  3R4D B;  3RJR A;  4P08 A;  1WWY A;  4R9A A;  4EN9 B;  4PT6 A;  5CIS A;  3MEP A;  2ARA A;  5F7U A;  1OOP C;  3NWK A;  4D94 A;  4FTB A;  2DUR A;  4JC1 A;  5LA9 A;  4NR1 A;  1NY7 1;  1IG0 A;  1T2X A;  3Q8B A;  4UT5 A;  5EZW A;  5HI0 A;  3T2Q A;  2QQO A;  4SLI A;  3VBR C;  4CUC A;  2NN8 A;  1VAL A;  5JVV A;  3PNA A;  4CUB A;  2VZV A;  4MUV A;  4PDW A;  4COU A;  5HPO A;  1CJD A;  1BVP 1;  1QHD A;  1VRH 1;  3ZIX A;  2VOK A;  3T0B A;  1BVV A;  2Y0O A;  3PUR A;  2K9Z A;  4NPR A;  3WIN E;  3SHR A;  1K42 A;  1CES A;  1AYM 2;  1SEF A;  1WD4 A;  3GCW A;  5CNA A;  1DGL A;  1B35 A;  1AR9 2;  2WNE A;  3CQO A;  5FZH A;  2D6K A;  2H6B A;  2ZAA A;  4A7Y A;  1JZ5 A;  4YRD A;  4AHW A;  1TME 1;  1X33 A;  4QPG C;  3SLI A;  3BTX A;  3RZL A;  2ES3 A;  4OMC A;  4LBL A;  4HG6 B;  4HL0 A;  3BVC A;  4K6B A;  3FX3 A;  1BLZ A;  4CPB D;  4FTS A;  2FDJ A;  4XUN A;  4XF4 A;  2D3R A;  4FT8 A;  2VTX J;  1WD3 A;  3OY8 A;  2JE8 A;  3FWE A;  4MH0 E;  1QY4 A;  3BI3 A;  1CQ9 A;  1H8T A;  2ZGO A;  2WAO A;  1TMF 1;  5DAX A;  1QXP A;  4B29 A;  1RC6 A;  1HJF A;  3AL6 A;  3PU8 A;  3RDI A;  2OXB A;  1PO2 2;  3ZLI A;  1QDO A;  4W8J A;  2VY0 A;  4XQW A;  2XL7 A;  1ENX A;  2OT7 A;  3K4Z A;  4NHL A;  2R1B A;  5LW9 A;  4QXK A;  5FZL A;  4UFJ A;  1NQJ A;  1HLC A;  1EV1 1;  2QQJ A;  4RS5 A;  4NHK A;  2IFR A;  3R05 A;  1CAV A;  4HLT A;  1SZB A;  3ZMO A;  3AFG A;  4XF0 A;  4DQA A;  4PF5 A;  3SQO A;  4BLJ A;  1PVC 2;  1LEC A;  1F5F A;  4JDM A;  2R06 1;  4JTO A;  5J96 B;  4FFH A;  3POG A;  4UFM A;  3SC7 X;  4LE4 A;  5FKC A;  2KM2 A;  2MEV 2;  3WNX A;  3NNJ A;  2GDF A;  4XUP A;  1IS6 A;  5FP7 A;  5FBZ A;  2D6O X;  2BFU L;  2ETE A;  2PA7 A;  3RZJ A;  1TVG A;  4E2Q A;  3LB9 A;  4CU9 A;  1U5X A;  1KGY A;  4RGG A;  3LFI A;  5FZB A;  1R09 1;  1TME 3;  2ET7 A;  3ACF A;  2XJP A;  3INA A;  2JEM A;  4O61 A;  3VBU C;  5CAD A;  2CSG A;  4ZU5 A;  1O3T A;  3JBG 1;  5FR3 A;  1O5L A;  1G8W A;  5FMO S;  2Z69 A;  3L2Y A;  5GAL A;  4I02 A;  3AJZ A;  3IAP A;  3S57 A;  4DS0 A;  3RQ0 A;  2B46 X;  4YG6 A;  3I3B A;  3NJY A;  3I49 A;  3AYE A;  2ZX1 A;  1VBB 1;  4OLL A;  3CLP A;  2O8Q A;  5CFC C;  1NLS A;  4O9G A;  1UPS A;  4G3Y C;  2VQA A;  4LOT A;  2PHX A;  1Y3T A;  2XLG A;  5FK8 A;  4BLI A;  5A6Z A;  5FZ1 A;  5A3N A;  2A6Y A;  2FMY A;  1VMF A;  5JMC A;  4XBQ A;  4QXB A;  1G9B A;  3TN9 2;  3WT3 A;  2GC2 A;  3M70 A;  4V2V A;  5FY0 A;  1VP6 A;  4RR3 B;  1O7F A;  4UF0 A;  1UXZ A;  1K5M A;  5E1R A;  2G9G A;  2HBU A;  3AP5 A;  4IE4 A;  2PXJ A;  4C0B A;  1DLC A;  2R06 3;  2A3W A;  3ZFG C;  4MX3 A;  1JYI A;  2WQ8 A;  2X8K A;  5BV6 A;  1OKQ A;  5BXX A;  1QQP 2;  3DYO A;  4JGZ C;  2QQW A;  3I59 A;  1CIY A;  3OPZ A;  3UGF A;  2PMW B;  1ZVF A;  3ACG A;  1SBE A;  3D0S A;  1GWK A;  5I0R A;  4JCK A;  3N7L A;  5LBB A;  3T2O A;  4D7T A;  4QX7 A;  5IK7 A;  4ZZ8 A;  4Q4Y 1;  3A4U A;  1C28 A;  1MVE A;  1RUC 1;  4E4Z A;  3J4U H;  1XNB A;  4M0H A;  2C9K A;  3M3I A;  5FYV A;  2K0G A;  5CFD B;  2ZEX A;  1H2N A;  4Q4V 2;  1WZX A;  1XE7 A;  2XG3 A;  4Q8K A;  1YIP A;  2O1Q A;  2AEN A;  4LUM A;  1VIW B;  1W90 A;  2WYF A;  1SLB A;  1UAI A;  4L0P A;  2HWD 2;  4CP9 B;  2A3Y A;  1PNF A;  4L92 A;  3Q9O A;  1YHF A;  4JTN A;  4XJZ A;  1G9C A;  1D0G A;  2WNU C;  3JU9 A;  4BIS A;  5FK7 A;  3W5N A;  2UY9 A;  5FZM A;  4YVS A;  3NNG A;  4YVW B;  1PGL 2;  1ZBA 1;  1MQT A;  2GMP A;  5KR7 A;  3V56 A;  2J22 A;  4CDQ A;  4WBB A;  2A6W A;  2EAK A;  4LEJ A;  5J37 A;  4DB5 A;  3VBH B;  3ZN6 B;  2C6S A;  2Q8E A;  4MLO A;  3AKR A;  4KNC A;  3AXD A;  3S0M A;  2CHH A;  3MPP G;  4FOW A;  4AEK A;  4BHP A;  2BOJ A;  2W08 A;  3AX4 A;  4AW7 A;  3L9J T;  4NVP A;  3ACI A;  3OPW A;  2WR9 A;  1D4M 3;  2I45 A;  4COY A;  5FZC A;  2R32 A;  2H0B A;  3E5Q A;  4I0A A;  5L9R A;  4YW1 A;  2GNT A;  3OOX A;  4HPK A;  2HWF 1;  3RYP A;  1LCL A;  3RZH A;  2QZ3 A;  1S4C A;  3E5X A;  4FCA A;  4FPO B;  1NA1 A;  1Z7S 1;  2AEY A;  3SCF A;  4YLZ A;  1RJ7 A;  3W20 A;  2BER A;  3RYK A;  2HWE 1;  4CUG A;  1GYK A;  4XYX A;  4CCJ A;  5FO8 B;  5KC6 A;  3ZR5 A;  3H8X A;  4NIG A;  3O5S A;  5IFP A;  2WNV A;  3IKW A;  3GZE A;  4ISR A;  1S0G A;  1W6P A;  4A44 A;  1N1S A;  1RUJ 3;  4JAA A;  4I2O A;  3WR0 A;  3AB0 A;  3P6B A;  3CDZ B;  4BZ4 A;  3TWI A;  1VBD 2;  2V5D A;  4A41 A;  4DOU A;  4DZG A;  3ENR A;  4JGY B;  4QGM A;  1R08 2;  5A70 A;  4CVU A;  4M3C A;  2CV6 A;  1DQ6 A;  2ERF A;  5FZE A;  5FP3 A;  2RG4 A;  3KF3 A;  4NHX A;  1VBE 3;  1OH4 A;  4Y22 B;  3IN9 A;  1HRV 1;  3HPN A;  4GMP 3;  5C3P A;  1UYZ A;  3HNY M;  3PLQ A;  4XJ8 A;  4CXY A;  2EIE A;  1Q8Q A;  5AFE A;  1QJE A;  3KQ4 B;  3T1M A;  3W9A A;  3ZX7 A;  4N9H A;  5BNP A;  4XJW A;  4GA9 A;  2ZMK A;  1RUD 2;  1OC1 A;  1OLR A;  3QOP A;  3ZXJ A;  3WNP A;  4B1L A;  1SFP A;  4HAN A;  2JG8 C;  1JOJ A;  3V0A B;  1I3H A;  4RHV 1;  4XZU G;  3NV3 A;  1NX9 A;  4QPW A;  3HNB M;  2IUW A;  3ETQ A;  1HDK A;  4OUL A;  5AFB A;  4CU7 A;  4ATF A;  3NNM A;  2GSY A;  4KG8 A;  4MGZ E;  5KXB A;  2B45 X;  1FNZ A;  1MEC 2;  2CY6 A;  1PK6 B;  2VVF A;  3CJI B;  4R4X A;  4Q4W 1;  4JQT A;  4WM7 A;  5IYY A;  4AI9 A;  2VJX A;  3A0N A;  4CRQ A;  4EN0 A;  1XOY A;  2J1E A;  4UFH A;  4RFT 0;  2W95 A;  2J1S A;  5K4L A;  2GNB A;  4Y33 A;  2X5I B;  3VDD A;  5T5L A;  1FMD 3;  3BGA A;  4GJZ A;  4R8H A;  1W3V A;  5HXM A;  4OI2 A;  3SNM A;  2BZD A;  5IVJ A;  4YW7 A;  3OD0 A;  1IPK A;  4FFF A;  1QOT A;  2OYZ A;  2P2K A;  3VL9 A;  4CA9 A;  1CAW A;  3THP A;  3ASI A;  4AVB A;  2FDF A;  3J26 N;  5HV4 A;  1HRV 3;  4IER A;  2WAB A;  4UW3 A;  2ZML A;  3FHI B;  4DUX A;  3MFA A;  4KU7 A;  1DQ2 A;  2PHU A;  4IV3 C;  4WVW A;  4GH4 B;  4CDW C;  2A1X A;  4PF1 A;  3ZXL A;  5FLJ A;  3HJR A;  1GNY A;  1URX A;  2RS1 1;  3KGZ A;  2W46 A;  1YLL A;  2BYV E;  4AYU A;  1YFW A;  2JDN A;  1QH6 A;  2JKB A;  2B8M A;  2FZ1 A;  2Z4F A;  3J7H A;  3JUU A;  3RJ2 X;  1LOG A;  3N7K A;  1U5Z A;  2JDY A;  1CGP A;  2R30 A;  1H2K A;  3UT0 A;  5CA6 A;  2JE9 A;  2XUE A;  1ZM1 A;  3BYW A;  3B00 A;  4XEZ A;  2JB8 A;  1UYX A;  1AYN 1;  1R64 A;  3CF6 E;  2XWJ B;  2XL9 A;  5LB6 A;  3WNN A;  2ID4 A;  2YGL A;  4AQT A;  2CAV A;  4K21 A;  5HXV A;  4E2G A;  3VD4 A;  3IDE A;  4Q27 A;  3V65 A;  4MXV A;  3AMQ A;  5T55 A;  1JOP A;  3BTA A;  3IMN A;  1FPN 1;  4F3J A;  3GJB A;  1REE A;  1YO8 A;  4QGN A;  3W21 A;  2DU0 A;  4AQ2 A;  4DFS A;  3RFR A;  1JHJ A;  5EFU A;  3ZFE C;  4AVS A;  3S30 A;  1NZI A;  3DCQ A;  2YU1 A;  2E31 A;  2ZGU A;  4QPI B;  1WCS A;  2GZW A;  1RIT A;  2ZTN A;  3R4S A;  1HB1 A;  2GC0 A;  5F2S A;  3WV6 A;  4CDU C;  1LOF C;  1G7Y A;  1J1T A;  5FLI A;  3NMB A;  3T1L A;  3GYD A;  2J1U A;  4XPV A;  1QJX 2;  3SEP A;  3ME2 A;  2VUJ A;  4E8C A;  4MGQ A;  5HCF A;  1I5P A;  1LGN A;  3T09 A;  1ZYB A;  1Q3E A;  1JZ7 A;  1H8V A;  4PDW B;  1EP0 A;  1PO2 3;  4YW6 A;  2BVV A;  4EWA A;  1MZ6 A;  1LHN A;  1N1V A;  4N43 C;  3POB A;  2C1F A;  1RUF 1;  1FX5 A;  3LD8 A;  5DUU A;  5FMO L;  2VUD A;  2IXI A;  4YWA A;  4NPM A;  1B35 B;  3DEC A;  3LKJ A;  5FDB A;  1RHI 2;  4C0H A;  2MPF A;  2XDV A;  5DZG A;  5T5J A;  5J09 A;  3TEZ A;  1O91 A;  4TTG A;  1PIV 1;  5EV7 A;  4BQ5 A;  3H9A A;  4DIN B;  5ACA 2;  1PVC 3;  2VCC A;  2C4X A;  3PJQ A;  2WZ8 A;  5FUP A;  3T3Y A;  4BK4 A;  4QPY A;  4BXF A;  3GNE A;  4GWN A;  4RQP A;  5EPA A;  4QX3 A;  4LT5 A;  4LHK A;  1FPN 3;  2GH8 A;  3H3Z A;  4Q5O A;  3SEE A;  2DUQ A;  5C33 A;  3B94 A;  1ZRR A;  3RI8 A;  3PJY A;  4B4R A;  4P5H A;  4BB3 A;  2OZ6 A;  2WT0 A;  4IEU A;  3MUY 1;  4KWK A;  4ISQ A;  4D6Q A;  1QU0 A;  2Y34 A;  5ABJ A;  1ND3 C;  2C24 A;  4E4H A;  3NJV A;  4Q29 A;  1CIW A;  4FPF A;  4IEO A;  2RS5 1;  1UW8 A;  4RS5 B;  3QH7 A;  3ZYP A;  4NPL A;  1J3R A;  2AZ5 A;  1CAV B;  1AXK A;  1S0B A;  1W03 A;  2BV4 A;  3ZXA C;  1JU4 A;  5C9A A;  1U5Y A;  4UBH A;  4QX8 A;  2CL2 A;  2WLQ A;  1E5R A;  4AAP A;  4JZR A;  1JYT A;  1RUF 3;  1SLI A;  1ULC A;  3K3N A;  4TYS A;  2HWB 2;  5CYY A;  4JX0 A;  4YM0 A;  2W52 A;  2VQT A;  2WRA A;  3GZA A;  1FV2 A;  2ZZJ A;  2Q8C A;  3I97 A;  1H4H A;  4LKD A;  2HWC 1;  5BYN A;  5DDJ 1;  1H0B A;  3VN4 A;  5EJ1 B;  4BCU A;  4X8P A;  1KQR A;  2WN3 A;  3KS7 A;  5I8Y A;  3J7M A;  4N53 C;  2OPW A;  4YM3 A;  1N47 A;  1PNG A;  3I2G A;  3QH6 A;  3SH5 A;  1XYP A;  2FCU A;  4JKK A;  3WDW A;  4L99 A;  5CAZ A;  4LKE A;  3LZZ A;  2HEV F;  3MBW A;  1DIW A;  1NZC A;  1S0J A;  1FAY A;  4NAO A;  2DFC A;  3BPZ A;  3RPQ A;  1IS3 A;  2DV9 A;  4K8F A;  1VRH 2;  2RDQ A;  2TEP A;  5I8T A;  1DDL A;  1IGO A;  2D6N A;  4QX5 A;  4LA2 A;  3PVN A;  4UW5 A;  5FZ9 A;  1Q56 A;  1D0H A;  1TQ5 A;  2BRT A;  2Z42 A;  1JXN A;  5IUQ A;  4AI1 A;  4Q4V 3;  4XDQ A;  2R0H A;  1TME 2;  2KA3 A;  1S0D A;  2RS5 3;  5CKN A;  3AMH A;  3I8T A;  1AR7 1;  4MGT A;  5IAV A;  4UF0 B;  5FUI A;  5JSR A;  4QQO A;  1I5Z A;  4OHV A;  1K5M B;  5JXI A;  1VBA 1;  4XZP A;  2XQX A;  1HB3 A;  4FSJ A;  4LHL A;  2D43 A;  4P9W A;  2Y26 A;  2R04 1;  3WNL A;  5CKQ A;  2CDO A;  4S2H A;  4WM8 A;  4YW4 A;  1CAU A;  4KMQ A;  5FTT C;  3GZU C;  4CXW A;  2PHR A;  4ZS3 A;  5A3T A;  5J36 A;  3I59 B;  3O1M A;  3ZM8 A;  2PHL A;  4XUT A;  1MS0 A;  4PIY A;  4WV8 A;  5DZF A;  3ST7 A;  4PLN A;  1RYY A;  5C4W C;  1OF4 A;  3V0B B;  1VR3 A;  1W8W A;  3HOB A;  3WQ7 A;  2OW4 A;  3HT1 A;  3ZFF A;  4LKF A;  2JIG A;  2QTW B;  3LFM A;  1OLQ A;  1EV1 2;  3AC0 A;  3T2P A;  2YB7 A;  3MV0 1;  1MAC A;  2EXH A;  1SFY A;  5L36 A;  3VL8 A;  5A7S A;  2WZR 1;  2W94 A;  3D3A A;  1HW5 A;  2XKP A;  4MET A;  2VUC A;  3I3M A;  3AP6 A;  4CEW A;  1ULE A;  2R06 2;  3DYM A;  5JPM B;  2ZEY A;  1VAM A;  2EIC A;  1OBN A;  2XXZ A;  5AC9 1;  4OHW A;  4BH9 A;  1DU3 D;  2PQS A;  4YVS B;  4XAC A;  5J98 B;  1WBF A;  1MQT B;  3NAP C;  3ZSM A;  1S0C A;  1LOD A;  4CDQ B;  3AP7 A;  5FXZ A;  1LHW A;  3ZOI A;  3OCP A;  3N36 A;  4IW3 A;  4D69 A;  4Y1Y A;  1AR7 3;  4XTP A;  5FYC A;  3SXW A;  3P5B A;  5K0U A;  3JBG 2;  4IV1 A;  2LRO A;  3C7E A;  1Q43 A;  3VBF C;  2WO1 A;  3R0R A;  5LBF A;  1FV3 A;  2OII A;  3WW3 A;  1F15 A;  1GOG A;  2E26 A;  2K2S A;  1GOH A;  2VVE A;  1K45 A;  3C7O A;  3N7M A;  2R04 3;  2VNO A;  4HET A;  2YBS A;  1NCQ A;  3E6D A;  2XJV A;  1R08 3;  3E1F 1;  5C6C A;  3VBR A;  4HFS A;  2VQ0 A;  2XJS A;  4Q4W 2;  1QJU 1;  4MGS A;  2YRO A;  4GWI A;  4BA6 A;  4MG2 A;  5HCA A;  1TNF A;  5LWB A;  3AMM A;  4GB3 3;  3G7D A;  4HPK B;  5EP9 A;  4LOR A;  4NWW A;  5GLV A;  4LTA A;  3OBT A;  2VAU A;  4A3Z A;  3O14 A;  4EZ4 A;  4K20 A;  1RVF 3;  5IAT A;  1LB2 A;  4KG0 A;  3KVA A;  3U11 A;  4LXL A;  4GIQ A;  1CAX A;  4KGQ A;  1GWM A;  1WME A;  2BVB A;  3WP4 A;  1OVS A;  2WNV B;  5T3N A;  3K75 B;  5BPX A;  1CX1 A;  1VAV A;  1Y9M A;  1W6P B;  2D6L X;  2VCM A;  3EB7 A;  4LOS A;  1ZNP A;  2ADD A;  5EIY B;  1D4M 2;  1AL2 1;  3BIW E;  5KXC A;  2RR1 3;  2ZMN A;  5F2W A;  4NIH A;  4H3W A;  1RIR A;  4SBV A;  5FRA A;  5C7G A;  2XH6 A;  4M3C B;  3DKW A;  1S0E A;  1SCR A;  2VGD A;  1W2T A;  2D6M A;  3N9N A;  4QB2 A;  1QF3 A;  4LHS A;  5F5I A;  5IVB A;  1PO1 1;  4YFW A;  4LMF A;  1WCD J;  2FD8 A;  1HXS 1;  1RUH 3;  4BQY A;  5HBA A;  1RUN A;  2DDU A;  2UU8 A;  1V6K A;  5FOB B;  2B9V A;  2PEL A;  2YV8 A;  3Q8F A;  4ZON A;  5FP4 A;  3PVE A;  4CCO A;  2P3I A;  3CNA A;  4PI0 A;  1Q8S A;  2BBA A;  3BB6 A;  1RUJ 2;  3ORJ A;  3LCP A;  5A7P A;  5JSO A;  1GFF 2;  1ND2 C;  4XET A;  5DMY A;  5FJH A;  1DYO A;  4COZ A;  1POQ A;  2JDP A;  2YPJ A;  1RUI 1;  2Y6G A;  2VZO A;  3VGI A;  4BIO A;  3UJO A;  5A32 A;  5FLH A;  3VDC A;  3NW4 A;  1S2K A;  1UY4 A;  2VUL A;  3WP6 A;  2YFZ A;  1XQN A;  3FN9 A;  4MGY E;  5IJR A;  4AI8 A;  3CKH A;  4Z2W A;  3U07 A;  5DG2 A;  1MS9 A;  4QGL A;  5JOW A;  4B7K A;  4WM7 B;  2E7A A;  2ZAH A;  4EE2 A;  5FY1 A;  5C3R A;  2J1V A;  4U36 A;  5LK7 B;  1EUT A;  1F5J A;  5HCH A;  4P9Y A;  1AL2 3;  1UF2 C;  5CIR A;  4ZU4 A;  1KS5 A;  1AX1 A;  3H3L A;  1ONA A;  3KHC A;  4I01 A;  1LHU A;  3UET A;  1AUY A;  3VDD B;  4J1W A;  4L97 A;  5DPN A;  1HKD A;  4ONU A;  1F4A A;  4XDP A;  1X8E A;  3K4D A;  5CFC A;  2V4V A;  2HWF 2;  1WCQ A;  2P1B A;  1XYN A;  1CAW B;  3I7D A;  3T4V A;  2PFW A;  2AAC A;  4XOG A;  2VZS A;  2YBP A;  3VHN A;  1GUI A;  4P5Y A;  2JWP A;  3O1V A;  1PO1 3;  4AHX A;  3EXU A;  3DN7 A;  4JVA A;  5A1A A;  4RR3 C;  3BTZ A;  1XSQ A;  1AX2 A;  1FXZ A;  4LO8 A;  2E33 A;  3HBZ A;  4N7U A;  4UW6 A;  3WQB A;  1BYH A;  4FPC A;  1JH5 A;  5A3P A;  2IFW A;  1J58 A;  1QMJ A;  4S2D A;  3LE0 A;  4YYO A;  1GWL A;  3WF4 A;  1J59 A;  3MIG A;  1ZRE A;  4CE8 A;  1DHK B;  3A0K A;  4ZS2 A;  4ES9 A;  1MZE A;  1BBT 1;  3U37 A;  2NP0 A;  1HB4 A;  4JGZ A;  2XPJ A;  4Q0S A;  1W0P A;  1RUI 3;  3LPG A;  1CZV A;  4K3U A;  4AXO A;  4DMI A;  3FZ3 A;  4XFA A;  1AZD A;  1UZV A;  5JMO A;  1UIK A;  5KHJ A;  1XNT A;  5JCT A;  5DN2 A;  2EIG A;  1HRV 2;  4XHB A;  2AR6 A;  3ZDV A;  1ZZ6 A;  5CFD C;  4TLG A;  4MGK E;  5FZI A;  3NL1 A;  1CZS A;  1GZT A;  4FFG A;  3E5U A;  4W6Y A;  1CR7 A;  1VAK A;  4FPJ A;  1X82 A;  3WP3 A;  1G9A A;  1COV 1;  4P14 A;  1G9F A;  2BPA 2;  2XOM A;  1MS8 A;  1W8T A;  3FLR A;  1PZ9 A;  4LK7 A;  2WNU A;  4YVW C;  4RHV 2;  3ZYF A;  4N90 A;  4M4P A;  1IS5 A;  1W39 A;  2YUE A;  3O1P A;  2D98 A;  2NQY A;  1XRU A;  4IES A;  4XAE A;  3ZVX A;  4LO6 B;  2F4P A;  1UOJ A;  3T08 A;  3VBH C;  1RUE 1;  2VZ1 A;  2QQP A;  5JLV A;  3C3V A;  2JEC A;  4QQL A;  3ZSJ A;  1OPO A;  2Q0A A;  4FPK A;  3PUI A;  1KXG A;  1GZ9 A;  1RL3 A;  1H1I A;  2YU2 A;  2YZ4 A;  1HV0 A;  1JS9 A;  2ARC A;  3IDC B;  1A3K A;  1S2B A;  3NNL A;  1YXW A;  1WW4 A;  4TWT A;  1GLH A;  3PUH A;  1M4W A;  4QD2 A;  4RD7 A;  4HN1 A;  4GAZ A;  2QQN A;  4IUG A;  1MS1 A;  2D40 A;  1XNK A;  1HQN A;  1IQA A;  1GV9 A;  1AR8 1;  4W6X A;  1CWP A;  3WLU A;  1J3P A;  3QBQ A;  1J3Q A;  2VZT A;  3PME A;  5C5T A;  2J1A A;  4NN0 A;  4RQP B;  2VZQ A;  4QKF A;  3EBR A;  2ZGR A;  5FZD A;  2HWB 3;  3WNO A;  2P3K A;  1QEX A;  4CEY A;  3OB8 A;  1GNZ A;  2GN3 A;  4B4Q A;  4CYD A;  4XCB A;  4GJY A;  1WW6 A;  2HYX A;  4HKL A;  2WFP A;  4XW3 A;  3VBS B;  5A80 A;  2RS1 2;  3GGL A;  1IS4 A;  3POF A;  3WW2 A;  2X09 A;  5ABJ B;  3CBN A;  1DZR A;  5EQU A;  2A6X A;  3MLK A;  4X6R B;  4JGY C;  4IL7 A;  2L9L A;  4NII A;  3UKT A;  3K46 A;  5JOY A;  2W0X A;  2JG9 C;  1AYN 2;  4A45 A;  1CJP A;  4B7E A;  5C9A B;  1VRH 3;  2EID A;  1UCX A;  2VME A;  4QDS A;  5FZ0 A;  3WVJ A;  5DXD A;  3O1R A;  1JUH A;  2YXS A;  5JDB A;  4COV A;  4EV0 A;  3WQ0 A;  1OUS A;  1FAT A;  1FPN 2;  3IAQ A;  4A3X A;  2H6C A;  4OYU A;  1ULG A;  3B7M A;  1W9T A;  4QHO A;  1XJA A;  4NRM A;  2VM9 A;  4Y26 A;  1I1E A;  4P00 B;  1JOB A;  2ORX A;  4PJY A;  1QOO A;  1VRB A;  4CCE A;  3O1T A;  1JYC A;  5C8W A;  4QWN A;  3C7F A;  4QKB A;  2FDI A;  3AZW A;  1G6N A;  4FP2 A;  2JG8 A;  1V00 A;  4IEX A;  2TNF A;  5ISL A;  1IKP A;  2VC9 A;  5B2G B;  4E9K A;  4GKY A;  3OJB A;  4XJ9 A;  2C0Z A;  2TUN A;  1TMF 3;  4E4D X;  1QWR A;  2ZJC A;  2Q1F A;  3ALQ A;  3WOG A;  3VHR A;  1W8O A;  3WP5 A;  1O3S A;  1PHM A;  3HBK A;  2GU9 A;  1PK6 C;  3WNK A;  3CJI C;  1RUF 2;  4QM9 A;  2IXK A;  1OQ1 A;  2GAU A;  3FHQ A;  1ODN A;  3MUZ 1;  4KL1 A;  5E16 A;  3J8F 1;  3LDB A;  1RUG 1;  3LSE A;  2D3P A;  4JV4 A;  5A7N A;  1EV1 3;  5ACA 3;  5KHI A;  1OMI A;  1DG6 A;  2I74 A;  3FHA A;  2CYF A;  1S1A A;  1POV 0;  2X5I C;  2YC2 A;  3PHM A;  4UOJ A;  3VB9 A;  3PUA A;  4RA0 A;  5H9P A;  1MZ5 A;  1Q8V A;  3ETP A;  4IE5 A;  4MZU A;  3EMR A;  5FMC A;  1XPW A;  3ZXE A;  2CTV A;  4D8M A;  5KHG A;  3D8C A;  4K9S A;  5LBC A;  1DQ5 A;  1W9S A;  4GH4 C;  4WM8 B;  1CAU B;  5A6Y A;  1JZ3 A;  2BDR A;  4LIV A;  1J84 A;  4CDW A;  4IV3 A;  1R09 3;  4OCT A;  4D7Y A;  4CCN A;  2WQ4 A;  2VOW A;  1ULO A;  3JBG 3;  4LBJ A;  2JIC A;  5FZG A;  1JZ8 A;  2UWC A;  3NNF A;  3Q8E A;  2X10 A;  5FO7 B;  1UX7 A;  1YC6 1;  3HN1 A;  5A7Q A;  3AVS A;  3SKJ E;  3VBO A;  4AEM A;  4ASL A;  2OX0 A;  2CNA A;  2RS5 2;  2O8O A;  2ZGQ A;  4M4R A;  3N9Q A;  3B93 A;  1VBB 3;  2ZHL A;  3RNS A;  2AYH A;  3DEM A;  5A3W A;  4A2U A;  1WMF A;  4LO4 B;  4Y24 A;  4CEW B;  4YW5 A;  3WQ1 A;  5A1L A;  4HN0 A;  3KCY A;  2PHD A;  4HSJ A;  3ZDS A;  4M00 A;  1J1L A;  3J8F 3;  3M3Q A;  1RUG 3;  3DXT A;  3RS6 A;  5F3G A;  3WF1 A;  5F37 A;  3BUC A;  2VBD A;  3H7J A;  2W39 A;  2ZHM A;  3FBY A;  3DPR A;  4LPL A;  5LY1 A;  3USS A;  4QPI C;  1M06 G;  4MXW B;  4NJ4 A;  3N35 A;  1NUK A;  2VMC A;  1LOE A;  1UXX X;  1OKO A;  4IV1 B;  3WG1 A;  4DO0 A;  1BEV 1;  5K0U B;  4A4A A;  3GDB A;  3H7Y A;  4YGC A;  1UZY A;  3WDX A;  2VBB A;  3MIH A;  4XFF A;  1LOF A;  1PMJ X;  3UKV A;  5C5U A;  3ECQ A;  1WLT A;  5ANQ A;  1WMD A;  4E2S A;  4AVC A;  1NCQ B;  4PDW C;  5FPV A;  2VW2 A;  5FZ3 A;  1LEM A;  2QQK A;  2JEN A;  4P9X A;  1ENR A;  3ZYI B;  1GR3 A;  4I09 A;  4NWV A;  4AI0 A;  1UIJ A;  3AFK A;  4Q4Y 3;  1RUC 3;  3WSO A;  1O4Z A;  1B35 C;  1HN0 A;  2XBO 1;  3VZM A;  4CP2 A;  4DIQ A;  2YG0 A;  2W1S A;  1Z78 A;  1RUO A;  5C3Q A;  3P3P A;  3K48 A;  1QDC A;  3DGT A;  3HNM A;  4BQ4 A;  4QXH A;  1AR7 2;  3CZJ A;  2C5D A;  4GKX A;  4CCD A;  2F6B A;  5FRE A;  1W8U A;  2WS9 1;  5JZG C;  3AMN A;  4J6G A;  5JUV A;  1VBA 2;  3KWV A;  3ELN A;  3DUI A;  4TSV A;  2WO7 A;  3H8O A;  1BZW A;  3LSD A;  2BBV A;  2E53 A;  2RDS A;  2W1Q A;  2R04 2;  4QX1 A;  5IW0 A;  2PAM A;  1B09 A;  4AVV A;  4F7Z A;  1N3Q A;  1ZBA 3;  1U12 A;  1WUV A;  5L9V A;  2GME A;  1JYV A;  3EJK A;  1WBL A;  1APN A;  2P4E A;  3T4H B;  5I0U A;  1W6O A;  3RG0 A;  2VMI A;  3M1H A;  4LIT A;  1WA6 X;  4R4Z A;  3OGG A;  4GB3 2;  1HRI 1;  1SPP A;  2ARE A;  1RMU 1;  2JB4 A;  4QU1 A;  5FYT A;  4BM8 A;  1DFQ A;  2P3Y A;  2DVB A;  1JMU B;  2OQ7 A;  2CWM A;  3NKT A;  1UOB A;  2WN2 A;  1UOG A;  1XE0 A;  1UOF A;  5EYY A;  2I07 B;  2Z5W A;  5FV3 A;  1RVF 2;  3EQE A;  2Y64 A;  4RS5 C;  1YQ2 A;  2DVA A;  3M7A A;  1WLD A;  2WZR 2;  3HN3 A;  1BK1 A;  3TOJ A;  2NM1 A;  1GSL A;  3O1O A;  1Y9Q A;  4AK3 A;  2OQ6 A;  1V6J A;  1X9P A;  3H0O A;  3FFZ A;  1HX6 A;  3IB3 A;  4HKW A;  4RL7 A;  4BDV B;  1F8V A;  4KGG A;  3HVD A;  4AED C;  4IQP A;  2HWF 3;  5EXO A;  5JAX A;  1KS4 A;  2RR1 2;  3GZT B;  2HLE A;  1E57 A;  1Z7S 3;  3RI9 A;  4CUA A;  1V0A A;  1ZZB A;  2HWE 3;  2OA2 A;  1CON A;  3KV9 A;  2QQU A;  5A32 B;  3N9L A;  5BNO A;  1GAN A;  3FUO A;  1DGR N;  5FCC A;  1MS4 A;  2EF6 A;  3T30 A;  1TNR A;  3WG3 A;  2WS9 3;  2JE7 A;  3KT7 A;  4OHZ A;  1NCR A;  1RUH 2;  3KV6 A;  4IEY A;  1W05 A;  5FMD A;  1UKR A;  4DRR A;  1QXR A;  3PDQ A;  4PIZ A;  2VNG A;  5D2A A;  1BMV 2;  3O0X A;  5K7P A;  4YZ1 A;  4GQ7 A;  5L19 A;  1UY1 A;  1OVP A;  3WCR A;  5CFC B;  1HRI 3;  4HVQ A;  1SDD B;  3R6S A;  5F5A A;  4DXZ A;  2Q1Z B;  5D8A A;  3JD7 1;  1IKQ A;  2AC1 A;  3VZN A;  3AP4 A;  1ZZ9 A;  1L7L A;  3UL2 A;  1GP6 A;  4XFH A;  4BMB A;  3I2D A;  1K5M C;  5GKA C;  4OVE A;  3ZPY A;  2DVF A;  4NRP A;  3U4X A;  2RS3 1;  2Z2S B;  2FDK A;  4LJH A;  4XUQ A;  5KXD A;  4K8R B;  4AWD A;  4KWJ A;  3VZK A;  2R07 1;  2BEO A;  4RHV 3;  1AL2 2;  5FZF A;  4YZ2 A;  1PGS A;  3ON7 A;  3SCG A;  4JGZ B;  2E7T A;  4Q2F A;  4XAA A;  1POV 1;  2Z79 A;  4Y1V A;  5HCB A;  5L9B A;  4Q4W 3;  3KHB A;  1PO1 2;  5GLZ A;  4DUV A;  3S5Q A;  2ZKN A;  1NOV A;  2LRP A;  4BQ2 A;  2PHF A;  5KBF A;  1X9T A;  4RSU A;  4X8N A;  5GM0 A;  2CGP A;  5H9R A;  1YJL A;  3LOI A;  3AXE A;  3UJQ A;  1KD7 A;  4L9B A;  3ZN5 A;  3MIE A;  2E7Q A;  3N4M A;  1OLM E;  1I9R A;  1W2N A;  4FTE A;  4BE3 A;  1AX0 A;  2D44 A;  1RGS A;  4JKL A;  1VMJ A;  4AL9 A;  1OXC A;  4KBB A;  1JHN A;  4YVS C;  2MEV 1;  1MS5 A;  1A6C A;  2WNU B;  3APB A;  1CVN A;  3W58 A;  1AJK A;  5C70 A;  1MQT C;  2XJU A;  1RUI 2;  2RMU 1;  2W2I A;  3EYP A;  3JD7 3;  3IPV A;  3SH3 A;  5FFO C;  4XUR A;  3VZL A;  3WG4 A;  1DGW X;  2ZXQ A;  4Q0U A;  3AM2 A;  1NLR A;  2RS1 3;  2JKX A;  1W2A X;  2TBV A;  5F3I A;  3RZK A;  5LEJ A;  1YQC A;  2ENR A;  1WLW A;  4JKM A;  1SLC A;  4Y3O A;  1T6B X;  3VBF A;  2XJR A;  4YZ5 A;  4HK9 A;  3BOP A;  2R07 3;  3DF0 A;  1EPZ A;  3AZV A;  4GWJ A;  5BY5 A;  5C71 A;  1UYY A;  1AYN 3;  4Y5S A;  1R1A 1;  1LR5 A;  4C90 A;  1UPI A;  2XHK A;  4UFK A;  1UD1 A;  1W8F A;  2LM3 A;  4GD4 A;  3OY8 B;  1H9P A;  4LA3 A;  5F6K A;  2Y6L A;  3IM0 A;  3VDA A;  2DBN A;  1H8T B;  2Q8O A;  3RZZ A;  1QIQ A;  4CEY B;  1O59 A;  2VTX A;  4BIF A;  1SLA A;  4FVV A;  3E6C C;  1MR5 A;  3MLJ A;  1U0A A;  3MZH A;  2WNV C;  2VMG A;  2UUR A;  2VNV A;  3J7N A;  1W99 A;  1ZRI A;  1H6X A;  1W04 A;  2V5Y A;  4Z07 A;  2FDG A;  2VTF A;  3A22 A;  1HV1 A;  4A7K A;  4LNV A;  4YM2 A;  2WA4 A;  3PMS A;  4BJ0 A;  5L7O A;  4P9I A;  2PAK A;  3B5L B;  2R16 A;  3OUH A;  2QQM A;  1WCU A;  4ORF A;  4OUM A;  4XVH A;  4YGE A;  1QQP 1;  3VKO A;  5K9Y A;  2NMN A;  1GBG A;  1F9K A;  2RMU 3;  2XVG A;  4Q0V A;  1KRI A;  2JJ6 A;  1N3P A;  1YI9 A;  1SLT A;  2WFF 1;  2XR4 A;  1DZQ A;  2IZW A;  4IET A;  2VD7 A;  1UY0 A;  4FOQ A;  4PQQ A;  4J1X A;  3VZJ A;  1A8D A;  3BIE A;  3D5O A;  3RWK X;  1FI2 A;  4M3C F;  5I0D A;  5G05 L;  4LLF A;  3RRD A;  3M2M A;  4LBM A;  2WWJ A;  5FZ8 A;  2XVL A;  1PIV 3;  1OSG A;  2ZZQ A;  3K2O A;  4YZ4 A;  4Q26 A;  5FZK A;  4PLO A;  3U1X A;  5IVF A;  4Q4X 1;  3ZSK A;  3FE5 A;  3OGS A;  1R1A 3;  2HWD 1;  3WF2 A;  3VD7 A;  2GMM A;  3N9P A;  4GAL A;  5E88 A;  4LO5 B;  4CCK A;  2PLV 1;  2YHJ A;  1Q8O A;  1NY7 2;  2JG8 B;  3AJY A;  1CX4 A;  1Z0H A;  3OPT A;  3TAY A;  4D3W A;  1ND2 A;  3KV5 A;  3POY A;  5E8A A;  1RB8 G;  3ZR6 A;  3QLQ A;  1PGL 1;  1RXF A;  3ZN4 A;  1T6G C;  4MV2 A;  4I0B A;  1UY3 A;  1NXD 1;  2Y6J A;  3FLT A;  3HQR A;  1RUE 2;  3NJX A;  1LJ7 A;  1W3X A;  2VH9 A;  5C8C A;  1XXN A;  2YFU A;  3LEI A;  4Z2A A;  1MVQ A;  4PHZ A;  1V6N A;  2VMF A;  5CU1 A;  2BOI A;  3I2K A;  2BWA A;  4ASK A;  2FHR A;  3VKN A;  3FUQ A;  1DZT A;  3C2U A;  3NV1 A;  4OZX A;  4Q1P A;  5FY8 A;  4OQ8 A;  3B69 A;  5BNN A;  3H8R A;  4GXL A;  5FP8 A;  3VDD C;  1Y7B A;  4XAB A;  5FYS A;  1GZW A;  1SDW A;  3C7H A;  3I3D A;  3EHK A;  5EJZ B;  5KWR A;  2DYC A;  1DYK A;  1PZ7 A;  1WGP A;  2WFF 3;  1ZRF A;  2FZ2 A;  1EAH 1;  4CDX A;  1YEW A;  5FYI A;  3MF6 A;  5A3U A;  1TMF 2;  4FPY A;  3M8L A;  2UY8 A;  2RV9 A;  5T5P A;  3L2H A;  2RJL A;  1PX4 A;  2HWC 3;  2BU9 A;  3LA7 A;  4H7M A;  3AK0 A;  5DDJ 3;  4CDW B;  1OQE A;  2HKX A;  1FOD 1;  2ZBJ A;  3ZXF A;  5JXJ A;  3BTY A;  1ALY A;  1Q8P A;  4DEQ A;  2JX9 A;  3CU7 A;  4AAX A;  3SIT A;  1ZRC A;  3VBO B;  2PLV 3;  5A33 A;  2BGC A;  2A6V A;  2RHP A;  2XJT A;  3MIC A;  4LIU A;  2W87 A;  1QGL A;  1W0O A;  1UL9 A;  5FXX A;  4UW4 A;  5H9Q A;  4AOC A;  1UU6 A;  4MSV A;  2ZX3 A;  3JXS A;  1BJQ A;  2Q1M A;  4HVR A;  4LBO A;  4XE9 A;  5HV0 A;  2VZU A;  4FAH A;  1W8H A;  4ZU7 A;  2WYS A;  3QD6 A;  2W47 A;  1K12 A;  3PIG A;  1XU1 A;  1DF0 A;  1GNH A;  1C1F A;  2BP6 A;  4OHY A;  1QJY 1;  3I2H A;  4JRL A;  2QE3 A;  5LAS A;  4ZPI A;  3PTR B;  4FPL A;  4F83 A;  5KHK A;  4AFC A;  1R09 2;  5T52 A;  1AR6 1;  5FAX A;  1W8N A;  2B7Y A;  2OUH A;  4CCC A;  1JYW A;  5CZK A;  2IXL A;  1I6X A;  3DPR B;  1VBA 3;  3POJ A;  1W9F A;  2Y38 A;  5IK8 A;  2XGX A;  4DXR A;  1OOP A;  2C9A A;  4K1Z A;  4HBN A;  3JB8 A;  3MV1 1;  5FXW A;  4JDO A;  1ODM A;  1VBB 2; 
#chains in the Genus database with same CATH homology
 3T08 A;  3OEA A;  2VZ1 A;  4A42 A;  2XON A;  2V72 A;  3PUI A;  2VCB A;  3CMG A;  3ACI A;  2JDA A;  4XUO A;  1PX3 A;  3PUH A;  2VL4 A;  3LQC A;  2QQN A;  4IUG A;  4RYD A;  3WF0 A;  1O8P A;  1XNA A;  2VZT A;  2J1A A;  4A6O A;  2ZEZ A;  2BER A;  2VZQ A;  4JHZ A;  3WNO A;  4FI9 A;  2CDP A;  3OB8 A;  5IFP A;  3T0D A;  2HYX A;  3WNM A;  1H6Y A;  4YPJ A;  3ACH A;  3GGL A;  4A44 A;  2X09 A;  4MOA A;  3P6B A;  3CDZ B;  2V5D A;  1XC6 A;  4A41 A;  4ARX A;  4CVU A;  2L9L A;  2W91 A;  3K46 A;  1D7P M;  4A45 A;  1OH4 A;  2WO2 A;  3III A;  2EID A;  2VME A;  4QDS A;  3HPN A;  1UYZ A;  2WDB A;  2J7M A;  3HNY M;  3IAQ A;  3C8X A;  2EIE A;  4OYU A;  1W9T A;  4OUE A;  4AG4 A;  2VM9 A;  4P02 B;  1JYX A;  4D0Q A;  1CZT A;  3WNP A;  3I2I A;  4P00 B;  2ORX A;  4W50 A;  1F4H A;  3C7F A;  2B4K A;  5LA0 A;  4XZU G;  3T0A A;  2KD7 A;  1NX9 A;  2EIB A;  2VZR A;  4QPW A;  3HNB M;  2VC9 A;  4CU7 A;  5LA2 A;  1UWW A;  1W8O A;  1WKY A;  1PMH X;  5IYY A;  3WNK A;  2J1R A;  2VJX A;  3CZU A;  3CIH A;  3FHQ A;  3MUZ 1;  1LNS A;  2J1E A;  2W95 A;  4QB1 A;  2J1S A;  1GMM A;  1L7R A;  3FHA A;  3BGA A;  5HXM A;  2BZD A;  2YC2 A;  4UOJ A;  2VMD A;  3ETP A;  1TG7 A;  2WAB A;  4DUX A;  1XPW A;  1OD3 A;  4D8M A;  2W5F A;  1NAE A;  4PF1 A;  3HJR A;  1W9S A;  1GNY A;  1JZ3 A;  1J84 A;  2W46 A;  4OMD A;  2DCJ A;  2Z4F A;  3J7H A;  1ULO A;  1JZ8 A;  1SG3 A;  2X10 A;  5IFT A;  1UX7 A;  3SKJ E;  1DP0 A;  1UZ0 A;  3GXU A;  3THC A;  1UYX A;  4M4R A;  1R64 A;  3WNN A;  5IHR A;  2ID4 A;  4BK5 A;  4LKS A;  3P1I A;  3VD4 A;  3I2J A;  2YC4 A;  2XHN A;  3ABZ A;  1W9W A;  1JHJ A;  1W0N A;  3WF1 A;  1JI6 A;  2E31 A;  2ORZ A;  4LPL A;  3OG2 A;  4RN5 A;  1NUK A;  2VMC A;  1UXX X;  3K77 A;  2J1U A;  4A4A A;  3GDB A;  3SEP A;  4E8C A;  2VCA A;  4MGQ A;  1I5P A;  3T09 A;  5J1X A;  1JYN A;  3LEG A;  1PMJ X;  3ECQ A;  1JZ7 A;  4QDR A;  2C26 A;  2QQK A;  4KWU A;  4QAW A;  4DXS A;  4UAP A;  2X05 A;  5DQ0 A;  3DEC A;  3WSO A;  2WO3 A;  2YG0 A;  4TTG A;  1SHW B;  2W1S A;  3K4A A;  3W5M A;  2ZEW A;  5JR2 A;  2VCC A;  2C4X A;  3HNM A;  2WZ8 A;  3CZJ A;  4BK4 A;  4QX3 A;  5JUV A;  3SEE A;  2W1Q A;  4QX1 A;  2LS6 A;  1JYV A;  1JZ4 A;  1JZ2 A;  1NKG A;  3MUY 1;  3THD A;  3NJV A;  3A21 A;  3VD5 A;  2WN2 A;  2QBX A;  2Y64 A;  2JD9 A;  1YQ2 A;  4MO3 M;  1JU4 A;  2WUH A;  1L7Q A;  3HN3 A;  1HN1 A;  3NRU A;  3IB3 A;  4BDV B;  2VZP A;  3HEI A;  5CYY A;  4JX0 A;  1JZ6 A;  2VQT A;  3I97 A;  2HLE A;  4W4Z A;  2Y8K A;  4CUA A;  5EJ1 B;  4DXT A;  3VD3 A;  4GZ9 A;  5JXH A;  1BHG A;  2WN3 A;  2W3J A;  3I2G A;  3IDA A;  4JKK A;  1IQD C;  3VD9 A;  3MBW A;  4CU6 A;  2W92 A;  3A23 A;  3LPF A;  1KEX A;  4UI9 L;  3LEK A;  4ET7 A;  2E32 A;  1GOF A;  1UY1 A;  1SDD B;  4LQR A;  2BGP A;  2VR4 A;  3FL7 A;  2VQU A;  4KI5 M;  5FUI A;  5JXI A;  1US3 A;  2XQX A;  4QB6 A;  3WNL A;  2CDO A;  3BN6 A;  4KMQ A;  4XUQ A;  4MAD A;  2WBK A;  3ZM8 A;  4XUT A;  1RYY A;  1OF4 A;  3A7Q A;  3F2Z A;  3HOB A;  3MO4 A;  3UES A;  5JXG A;  1ULP A;  3OBA A;  1GQP A;  3WF3 A;  2OKX A;  4OZO A;  3AC0 A;  3T2P A;  2YB7 A;  3MV0 1;  4DUV A;  2W94 A;  3D3A A;  1UMI A;  1P8J A;  1OT5 A;  5G04 L;  2VOT A;  4QX0 A;  3DYM A;  2ZEY A;  2Y6K A;  3UNP A;  2EIC A;  4QX2 A;  2RJ2 A;  2VO5 A;  1OF3 A;  3DYP A;  2PQS A;  4JKL A;  3OEB A;  2WAA A;  2J1T A;  1GU3 A;  2QQL A;  5C70 A;  4P08 A;  5F7U A;  3EYP A;  4PT6 A;  4XUR A;  1EUU A;  2ZXQ A;  3C7E A;  1T2X A;  4DUW A;  2WO1 A;  2JKX A;  3T2Q A;  2QQO A;  4CUC A;  2RVA A;  1GOG A;  2E26 A;  4CUB A;  1GOH A;  3C7O A;  1K45 A;  2VZV A;  5HPO A;  2BGO A;  4JKM A;  4ZY9 A;  4ZZ5 A;  2WZE A;  3E1F 1;  3T0B A;  4MGS A;  4GWI A;  1K42 A;  4GWJ A;  5C71 A;  3VDB A;  1UYY A;  4QDQ A;  3CQO A;  3GM8 A;  1JZ5 A;  5B4X A;  5LCW L;  4E8D A;  4A3Z A;  4OMC A;  2Y6L A;  4HG6 B;  3VDA A;  3OGV A;  4XUN A;  1O59 A;  2JE8 A;  3K75 B;  2W1U A;  1CX1 A;  3EB7 A;  1W99 A;  1H6X A;  2WAO A;  5EIY B;  3A22 A;  2VTF A;  4BJ0 A;  4W8J A;  2QQM A;  4XVH A;  1MPX A;  5C7G A;  3K4Z A;  2R7E B;  4QB2 A;  4LHS A;  5B4N A;  2QQJ A;  4ZXE A;  1UY0 A;  4PQQ A;  2DDU A;  2B9V A;  5I0D A;  5G05 L;  1O8S A;  2BBA A;  3C7G A;  4XUP A;  3NQH A;  3OGS A;  1TVG A;  5DMY A;  3WF2 A;  3VD7 A;  4BXS V;  4CU9 A;  1DYO A;  1KGY A;  3ACF A;  1K3I A;  2Y6G A;  2VZO A;  3VDC A;  3WEZ A;  1UY4 A;  2YFZ A;  4ARY A;  3FN9 A;  3IAP A;  1UY3 A;  2Y6J A;  5IJR A;  3NJX A;  3CKH A;  3I3B A;  2YFU A;  3LEI A;  4Z2A A;  2J1V A;  2VMF A;  1EUT A;  3I3E A;  3I2K A;  3OGR A;  3UET A;  1J83 A;  5DPN A;  1F4A A;  2QQI A;  3K4D A;  2V4V A;  3C7H A;  1UMH A;  3I3D A;  1WCQ A;  5EJZ B;  2VZS A;  1GUI A;  4P5Y A;  1UXZ A;  5A1A A;  2VZ3 A;  2RV9 A;  1DLC A;  2W9X A;  2E33 A;  2WQ8 A;  1PX4 A;  3WQB A;  3DYO A;  3SKV A;  3WF4 A;  1US2 A;  3LE0 A;  5JXJ A;  1CIY A;  4DEQ A;  4AAX A;  3ACG A;  4CU8 A;  3U37 A;  3T2O A;  3LPG A;  1CZV A;  2W87 A;  2W1W A;  4ZZ8 A;  1UY2 A;  5JMO A;  3JXS A;  1XNT A;  5DN2 A;  2C9K A;  2VZU A;  2DCK A;  2ZEX A;  2WYS A;  2W47 A;  1K12 A;  2Y6H A;  2LW8 A;  4DEV A;  1CZS A;  3I2H A;  4L0P A;  1JU3 A;  1W8N A;  3W5N A;  5LA1 A;  3NNG A;  1JYW A;  2XOM A;  5CZK A;  2J22 A;  3I2F A;  4DXR A;  4M4P A;  3MV1 1;  4TXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...