3GGLA

X-ray structure of the c-terminal domain (277-440) of putative chitobiase from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr324a.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
DTYTGFCIIKEGTKISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPIGRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative chitobiase
publication title Northeast Structural Genomics Consortium Target BtR324A
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 30
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3gglA00
3WF4A 4QX0A 2VZTA 3ACGA 2WZEA 1DYOA 3IAQA 5EJ1B 3UETA 2XHNA 3OB8A 4XVHA 2QQKA 4ZZ8A 4W50A 2X09A 1JZ6A 1R64A 1LNSA 4OMCA 3IB3A 4QDSA 2Y6KA 4BK4A 2LS6A 3T0AA 2LW8A 1OF4A 5C70A 2EIBA 2VMFA 3HJRA 4M4RA 3NQHA 3IDAA 2VZSA 1NX9A 3NJXA 1CIYA 4DXRA 4LQRA 5J1XA 3VDAA 5DMYA 4E8CA 1PX3A 1CX1A 1W9SA 2XQXA 2W46A 1US2A 4TTGA 2VCBA 2J1EA 3OGRA 3AC0A 4BJ0A 3MO4A 2OKXA 2ID4A 1TG7A 2WZ8A 1JYVA 4ZZ5A 2BGOA 4ARYA 4CU6A 2J1SA 3I97A 2Y6JA 5DQ0A 3K77A 3FHAA 5DN2A 1US3A 4DXSA 5C7GA 1O8SA 4MGSA 3C7FA 3GXUA 3J7HA 1DLCA 4M4PA 3I3DA 2W1SA 2YC2A 2W91A 3T09A 1JZ2A 2VZPA 3NJVA 2C9KA 4GWJA 1UY3A 1JYNA 2WO2A 4LPLA 4JHZA 2WBKA 4P08A 2CDPA 2W9XA 3UNPA 3MUZ1 4MO3M 5JXIA 2PQSA 3WF1A 4DUVA 4DUWA 1K12A 1OT5A 1IQDC 4UI9L 4KI5M 4QDRA 5C71A 1TVGA 2DDUA 2VL4A 3VD3A 3BN6A 1PX4A 5IFPA 4JX0A 1GMMA 4XUPA 3PUIA 4GWIA 3T0DA 4YPJA 3IAPA 5CZKA 4E8DA 3K4ZA 4CUBA 3I2GA 4ZXEA 1NKGA 3EB7A 2YB7A 1JZ3A 1I5PA 4MOAA 2BERA 3T2QA 1W99A 4CU7A 1UWWA 1GU3A 3OEAA 3WNLA 3LPFA 1SG3A 3D3AA 1BHGA 1JHJA 5JXHA 2Y6GA 1JZ7A 1UY1A 2WAOA 2VTFA 1GOFA 4A41A 2V72A 3DECA 2VZQA 3A23A 3MUY1 1H6XA 4BK5A 1XPWA 3PUHA 4MADA 2ORXA 4QB6A 3WNPA 2VQTA 5B4XA 1UX7A 3OGSA 3HPNA 2W1QA 2CDOA 4CVUA 3ABZA 4OUEA 1K42A 2VCCA 2VMEA 2Y64A 4Z2AA 4TXWA 1SDDB 2C26A 3WEZA 5F7UA 1W8OA 2B9VA 1JYXA 4DEVA 2QBXA 2WO1A 4QAWA 2JD9A 2VR4A 3LQCA 3F2ZA 3HNMA 4AAXA 2ZEZA 3I2JA 4XUNA 4HG6B 2JE8A 2BGPA 2VC9A 1JI6A 3GDBA 3VD4A 2VJXA 2E32A 2W92A 4W4ZA 1K45A 2BBAA 2J22A 5DPNA 2Y8KA 2JKXA 3ACFA 3WNKA 1P8JA 2W94A 2EIEA 1OD3A 4A3ZA 3T0BA 3WQBA 3SKVA 1UXXX 3CKHA 2QQLA 2VZUA 5IHRA 1XNTA 4QX2A 4P00B 1J84A 4ZY9A 2VMDA 1CZVA 1NAEA 3K4DA 1EUTA 2J1AA 3GGLA 1UMHA 4MGQA 3BGAA 3HNYM 3EYPA 3C7EA 1GOGA 5A1AA 2VCAA 3C7OA 3WNMA 1DP0A 2QQIA 3MV01 1W9WA 4L0PA 4FI9A 3A21A 2BZDA 4XUOA 1JYWA 3CZJA 3NRUA 1UMIA 2HYXA 4UAPA 3CIHA 4JKMA 1WCQA 4D0QA 3ACHA 1PMHX 3ECQA 1L7QA 1UYZA 1HN1A 4QDQA 2W47A 2XONA 1UXZA 1O59A 4XUTA 1RYYA 3I3BA 1D7PM 3GM8A 5LCWL 1W0NA 3K46A 2YG0A 1F4HA 2V4VA 3LEGA 3T08A 2VMCA 3VDCA 2VZ1A 2X05A 4JKKA 2R7EB 2W5FA 2E31A 2VZRA 3E1F1 4D8MA 3C7GA 1PMJX 4DXTA 4XUQA 5JUVA 3P1IA 3W5MA 2J1TA 4QB1A 1K3IA 2Y6HA 3THDA 4QX3A 1CZTA 3A7QA 1NUKA 3WF2A 3OG2A 1XC6A 2RV9A 3LE0A 4OMDA 4W8JA 3THCA 2ORZA 2J7MA 2VO5A 2WYSA 2JDAA 1UY0A 2E26A 3WF3A 5JXGA 2WN3A 4A4AA 1W9TA 1T2XA 3OBAA 2EIDA 5LA1A 1JZ4A 4QB2A 2YFUA 1JZ5A 3WNNA 3OEBA 4PT6A 3P6BA 2Y6LA 3I2KA 1YQ2A 3WF0A 1O8PA 3DYOA 1J83A 4UOJA 3JXSA 1UYYA 1EUUA 2E33A 3FN9A 5G05L 4A44A 3I2IA 2J1RA 2WABA 4A45A 5I0DA 2VZVA 3DYMA 1JU4A 4AG4A 3OGVA 3VD7A 3CMGA 4JKLA 2ZEXA 4XZUG 3IIIA 4ARXA 4A6OA 2VQUA 2W1UA 3VD5A 3K75B 4QX1A 1GUIA 5CYYA 3NNGA 3UESA 4PF1A 1CZSA 5HXMA 3WSOA 4P5YA 1H6YA 5EIYB 2RJ2A 4CUAA 2WAAA 3U37A 3CDZB 5IYYA 3I2FA 2VOTA 1UZ0A 2DCJA 4LHSA 4ET7A 3HOBA 1WKYA 1MPXA 2J1UA 3C7HA 3I3EA 5JXJA 5G04L 2QQNA 4DUXA 5IFTA 4KWUA 3VD9A 3LPGA 3FL7A 5IJRA 3MBWA 1L7RA 2W87A 4QPWA 3SEPA 3K4AA 3LEKA 2QQOA 5LA2A 4OZOA 1F4AA 1SHWB 5JMOA 4XURA 3SKJE 1OH4A 3T2PA 4DEQA 2B4KA 4RYDA 2EICA 1KGYA 3HN3A 2ZEYA 2WN2A 3LEIA 3C8XA 3WNOA 2XOMA 3A22A 2WUHA 2VM9A 4CU8A 4IUGA 3DYPA 3I2HA 2QQMA 2VZ3A 1UY4A 1ULPA 2RVAA 1UYXA 2VZOA 2WO3A 2WDBA 2W95A 4CU9A 1OF3A 3CQOA 2X10A 4BXSV 5EJZB 4LKSA 4CUCA 3T2OA 1JU3A 1XNAA 2YFZA 4OYUA 2Z4FA 1JZ8A 4P02B 1GNYA 3ETPA 4BDVB 4KMQA 4RN5A 1GOHA 1KEXA 2ZXQA 5JR2A 5B4NA 4A42A 2ZEWA 4PQQA 3MV11 3CZUA 3FHQA 1W8NA 3ACIA 3VDBA 1GQPA 3HEIA 2V5DA 2HLEA 2C4XA 1ULOA 3HNBM 2L9LA 2J1VA 5FUIA 3W5NA 1UY2A 2W1WA 2QQJA 4GZ9A 2W3JA 2KD7A 2DCKA 2WQ8A 5LA0A 2YC4A 5HPOA 3SEEA 3ZM8A
chains in the Genus database with same CATH superfamily
1FAYA 3OD0A 4HONA 4MGIE 4XBNA 4LKFA 1CR7A 3A0NA 3NNFA 2VZTA 4FPFA 1R1ZA 3ACGA 3O7OA 3RJ2X 3N9LA 3PU3A 3BPSA 1E5HA 3ZSJA 4DPNA 2WWUA 4FXGB 4AOCA 5F2WA 1OOPC 2ET7A 4IE6A 1RUH1 2RM22 3LDBA 4UF0B 2D5FA 2XBO2 4M0NA 3TN91 1G9DA 2E6VA 1O7FA 3POSA 2D3RA 1PGW1 3IB3A 1UKGA 4OMCA 1B35B 1D2SA 4BMEA 3H50A 2JICA 3J8F1 2O1QA 1AYN2 5C70A 3NKTA 2EIBA 4BIFA 4OI1A 1PVC3 3AMMA 4GH4A 5DDJ2 1LGNA 1Q5OA 1W04A 1ZBA3 1DGLA 2VZSA 4FFIA 5BNOA 1ZZ8A 3H42B 2JEMA 4Y22A 3S6PA 4LQRA 1YLLA 2ET1A 2PMWB 1RJ7A 2Q8OA 3RZLA 1UPIA 2XLAA 1NZIA 1CX1A 1AXZA 1W9SA 3D8CA 4O7XA 2GU9A 1AL22 3EHKA 3J7LA 4TTGA 3AJYA 3OGRA 1W9FA 2CV6A 4P9GA 3SCHA 4AQSA 1NT0A 1XOYA 2VNVA 1FV2A 2BUKA 2WZ8A 4MVTA 4CCJA 1JYVA 1CGPA 4O9EA 2BGOA 5GLVA 3S30A 1RUNA 2D6PA 3LIHA 1LULA 2BYVE 3I97A 4AVCA 4DQAA 2WRAA 4CCOA 1SLLA 1LRHA 1S0GA 3FLTA 4NAOA 1DF0A 4XMIA 3FHAA 3E97A 3VBSA 1DHKB 5CEHA 4HMZA 3URFA 3MI8A 1H2NA 5FY9A 3ZYRA 4MGSA 1W8ZA 5CB7A 1DLCA 4M4PA 3AZYA 1WMFA 5JLVA 5D8AB 2HWF3 3IPVA 1G9CA 1OQEA 2F4LA 4XDQA 4EV0A 3FZ3A 3HQXA 2ZCWA 2RG4A 3HT1A 4O61A 1S0FA 2OUJA 1HW5A 5LBBA 5J36A 2GC1A 1W39A 1W8HA 4LA3A 1QJY2 3LD8A 5HI0A 2WO2A 4N43B 4N7UA 4OFGA 1LGCA 2HWD1 2A71A 4Q4W3 2WSVA 4I0WB 4J1WA 3TRSB 2NQYA 3QD6A 1NA1B 1QQP3 2A6YA 2DU0A 3VKFC 1MS5A 5BNNA 4H7LA 3WUDA 5AFBA 4MH0E 2PHDA 4MO3M 3UNPA 1RVF3 4OQ8A 3CL1A 4XFBA 2XJTA 4IW3A 4DUVA 1Y7BA 3KV6A 4Z2WA 1BEV3 2Y34A 3EJKA 4NRQA 5FY5A 1SLAA 4Q4Y3 1IQDC 4QKDA 4QU2A 3RG0A 1QF3A 2ZZJA 2VH9A 4YG6A 1ALYA 3BTXA 2GNMA 2DDUA 1PM7A 2VL4A 5KHHA 1DQ0A 5IVFA 5IFPA 1C5IA 2JX9A 5FOJB 1GMMA 4XBLA 4MXWB 4M3CA 5BXXA 3RFRA 3PUIA 2WINB 5KBFA 3T0DA 3CU7A 2PXJA 2D93A 3M2MA 4XTPA 2ZHKA 4E8DA 1OLQA 4YZ2A 3U4XA 3K4ZA 3KF5A 4HSJA 4BIOA 2WNUB 2XH6A 4JC1A 4A2UA 1NKGA 3SQOA 4J25A 3O5SA 3WLUA 4QXKA 2RDSA 2ZACA 2D44A 4B1MA 5JZGC 1NCQA 4LITA 5B2GB 4MOAA 2E9QA 1C5HA 1AR63 4KU7A 3T2QA 2EALA 2QQWA 2PTMA 2EXHA 3BALA 5D8AC 3Q8AA 2XLGA 1LKNA 3DCQA 3EQEA 3WZ1A 1U5ZA 5C3RA 2JDPA 3FBYA 1LHOA 1XE7A 5C4WA 4ASKA 1AR82 2ZHNA 4C90A 5JXHA 1NQJA 1QGLA 1VBC2 1W2UA 4N43C 3VBHA 1K5MC 2JDNA 4IGQA 2I07B 1DFQA 5L19A 1NA1C 2D3SA 5KXEA 1DG6A 3N9MA 4NPMA 2VTFA 1JBCA 1S0DA 3DECA 1QIQA 2GP5A 4R9AA 2JWPA 1OKQA 1BXHA 3JCIA 3M3CA 4JRAA 1HXS1 3A23A 3C3VA 3TN93 1GKBA 4UFHA 4DO0A 4CUGA 2BBVA 3ASIA 5DAQA 2HKXA 5J3UA 1H6XA 5SV8A 4BK5A 4DIQA 2VD7A 2D97A 4B1LA 2ORXA 2VQTA 4Q4V2 2YROA 3GBFA 4MYEA 4XC9A 3OGSA 1LR5A 3HPNA 1TMF2 2W1QA 1MEC1 2CDOA 3BTYA 1ASJ2 3ORJA 5JAXA 3ABZA 1V0AA 4NPRA 1WCKA 3CHXA 1QXPA 3ZYBA 1WMXA 1NLRA 1C3HA 5LBEA 5F3GA 1VAVA 2ZGSA 3VBRB 5D2AA 3T4HB 2E53A 1RUD3 1CX4A 3NW4A 1MQTC 2B9VA 2WO7A 4G3YC 3WQ7A 5A1FA 4R9BA 4ZXKA 5J96B 2A6VA 5LK7B 5GJ6A 2WS92 4J6GA 2B39A 4IV3A 4Q8KA 2VR4A 4GWNA 5L73A 2G9GA 4IGPA 2HEVF 3AL5A 4UFIA 2FDGA 3OTFA 2GH2A 2GC3A 5EJ3A 1ZBE1 3M3OA 1UN1A 2FBEA 4HG6B 3WVJA 4BQ5A 4JDNA 3M4FA 5LW9A 1Q8PA 1I6XA 2FDIA 2VC9A 3LWCA 4QU1A 5FYVA 4BE3A 4E4HA 2VJXA 1BZWA 5F39A 5A32A 3VD4A 4RGKA 1HB1A 2IVIB 4CP9B 5C3SA 4NHKA 4M0HA 2VAUA 3CF6E 1GZWB 2JKXA 1Y3TA 1CVNA 2R49A 3POIA 3KZ4C 2LROA 3KSCA 4QPYA 4CDXA 3WNKA 5A1LA 3I3QA 1J58A 2AYHA 3NL1A 3OUIA 4P9WA 5EP9A 5FLJA 4OQ9A 2W94A 2EIEA 4GD4A 3POGA 2PHTA 2X5IA 2OZ6A 2RHPA 1J1LA 2ZKNA 1UXXX 2VMGA 2QQLA 3CKHA 3VKLA 5IHRA 4AR2A 4ZS2A 2ZZQA 1PGL1 2VMDA 1CZVA 2JG9B 3I4IA 2HWD3 1PVC2 1H30A 5K8SA 1EUTA 2JDKA 5FP3A 1FATA 2X8KA 5JIUA 4OVEA 1BMV2 1WZXA 4YM0A 3EYPA 3C7EA 3U78A 1VB2A 4AI0A 3DKWA 2VQAA 2UY8A 3MLKA 5DAXA 3VBRC 2ZGLA 3P3NA 2ZGKA 1EV12 1TME2 1NXMA 1VB4A 1CJPA 1W9WA 3HQRA 1V6JA 3WP5A 2BZDA 4XUOA 1ZZ6A 3NRUA 4QGMA 4EJRA 5AFEA 5J37A 2YGMA 3ACHA 1ZNPA 4N9HA 3S57A 3B94A 3O0XA 5C71A 1W6PB 2W47A 1DQ6A 2QCSB 2XONA 2VMHA 1O59A 1RYYA 3QCWA 1D7PM 3K46A 3Q8FA 2Q1ZB 4NO4A 4D94A 3D82A 1VAKA 3LEGA 1FPN1 2KM2A 3JQWA 2XQRA 2GMMA 2P4EA 2YU2A 5ABJB 4HPKA 4UFLA 2X05A 3CJIC 2E31A 2VZRA 4CEWB 2B45X 3E1F1 3CLPA 4IEYA 2HWF2 4XETA 3SCGA 4DXTA 5L7OC 5EHDA 5HCFA 2A70A 5C5UA 1R1A1 2J1TA 5IUQA 4FTSA 4QB1A 1CAXB 5FMBA 1POQA 1O3SA 1K3IA 3THDA 2GDFA 1BJQA 3E5UA 5A80A 5FP7A 3VZMA 4AI8A 1GWKA 5GZCA 1XC6A 3H1WA 3MIBA 2RV9A 4LK6A 1VRBA 5FZ6A 1FOD2 2Y26A 1QQP2 1B35A 1KQRA 1OPOA 4XFFA 1OH3A 3THCA 2J7MA 5JOXA 1RVF2 4LO5B 3W21A 1UY0A 2E26A 1BEV2 4NAMA 2VUDA 3ZYGA 1FX5A 1PHMA 2CHHA 1HB2A 3CEWA 2Y0IA 4X8NA 5FYTA 4EN6B 5KWRA 1D4M3 2Y33A 4RQPA 5CU1A 2Z79A 4QPGC 2VOWA 3M3EA 5F6KA 1UF2C 4NIIA 4AVVA 2C6SA 5FY4A 5LA1A 2FD8A 3QOPA 4MSVA 4QKNA 1JZ4A 2PAMA 1MEC3 5AVPA 1DZRA 1O4TA 1RXGA 3LF7A 1X9TA 2XMLA 2NPIA 1YI9A 2Y6LA 3I2KA 1QJX1 4P9LA 4YG3A 3WF0A 3ILRA 2GC0A 4XZPA 2Q8CA 1AL21 2BP6A 4UOJA 2ZAAA 2QFEA 4JGYC 5G05L 3AB0A 3TWIA 4XPVA 3I2IA 2IXLA 2J1RA 1AR62 3RZHA 1YCIA 3MFAA 2YBSA 4CP0A 3ZFEB 1RUJ3 2E7TA 4CEWC 3RQ0A 3ZIWA 3AKRA 3CMGA 5A7SA 1FYUA 4XZUG 1YIFA 3K48A 3N3HA 4GJZA 4Y1UA 5E6HA 5FPVA 2D5HA 5LBCA 5D8AA 4E4ZA 1Q56A 4XFIA 4A6OA 1RGSA 3AYAA 4LHNA 4NROA 1ZA4A 2JD4A 3JQXA 2DFCA 3N35A 1AR71 2R6QA 3AP6A 4LNVA 3HAGA 1IS5A 1IKPA 4AI1A 4AGVA 3OYWB 1REFA 1XBFA 4XF4A 3WHTA 1LOEA 2O8OA 3ZN6B 2B5HA 1RUH2 3MF6A 4FPCA 1NA1A 3H1YA 1QOTA 2R1DA 5FZMA 3TN92 2PELA 1H6YA 1PNFA 4CUAA 1PMIA 4IV1B 1R091 1HN0A 1LHUA 3CDZB 5EIYB 2ZGUA 1PGW2 1MS0A 3POJA 2DCJA 1Q8OA 4BZ4A 1MPXA 4L2NA 4OHVA 5FP8A 2FDJA 3J8F2 4BQ3A 5L9BA 1QH7A 4EE2A 5FOBB 4ISQA 4YFWA 5F3IA 3I3EA 5A7WB 2CWSA 5A3WA 1BBT1 5T5OA 3VBFA 2XG3A 3HT2A 3Q8CA 3MIHA 2ADEA 1ND3B 2HBTA 2OUHA 3H9AA 4PLOA 4DUXA 1WLTA 4HK8A 5IFTA 1Q8VA 4JQTA 1UW8A 3FL7A 4MXWA 3WCRA 2VCMA 5IJRA 5KHGA 3ZPYA 5CG8A 4H2AA 1QU0A 4I01A 2DCTA 2IZWA 2AACA 3K2OA 5JMOA 2IXIA 2WNUA 3VBUB 3THTA 4XTMA 4JGZB 5FYYA 4LO7A 1G6NA 1OH4A 4WM7C 3WQ0A 3ZXGA 3O1RA 1AJOA 1WW4A 2G1MA 4CTEA 4NUBA 2EICA 5EPAA 4LE3A 5JMCA 3VDDB 1U0AA 5KXCA 2K0GA 2P1BA 3PVOA 3ZDVA 3HN3A 1FPN3 2WN2A 2DVFA 3LEIA 1Z7S3 4YARA 1LOGA 3C8XA 4GMP1 2VW1A 3KHCA 4FT8A 2BWAA 3PNAA 3TEYA 1OA2A 4DY5A 1W9YA 5L9VA 4Q4X1 5KC6A 3UYJA 3WG1A 4QPIA 3ZXAC 3BUCA 4MG2A 1R1A3 2FMDA 3B00A 4YZ1A 4UWDA 2VZOA 5JDBA 2UY9A 2W95A 2OW4A 1YI7A 2WDBA 1KJRA 2G4IA 1DDLA 1OF3A 5EJZB 4IEQA 5A7QA 4XAEA 1YQ6A 2HWD2 4JAAA 1YQ8A 3BTZA 2PN5A 4JVAA 4UT5A 5FLHA 2E51A 4AZZA 1ND3C 5FTTC 5GLWA 4RN5A 3BB6A 3O14A 1COV1 1GOHA 1UX6A 4TZDA 2EAKA 5D21A 4L11A 3JB8A 1HJGA 2A6ZA 3VHPA 1SEFA 4FPHA 4PQQA 4NHXA 3I54A 3VBRA 3PUSA 4BCUA 1N1VA 4RS5B 3AXEA 5FZEA 3SXWA 1KITA 1TE1B 4YVWC 2V5DA 1YRZA 4OI2A 3T3YA 2GAUA 1RIRA 5JVVA 2HLEA 5FY1A 4ZHNA 3H1MA 3V64A 5C8CB 2JDMA 1XE8A 4EROA 4RD7A 1QJX3 2W1WA 3LAGA 4IESA 5CNAA 2DF7A 2DVGA 4LOTA 3VHOA 3Q8BA 4Y4RA 3TEZA 4GWMA 2KD7A 2WQ8A 3WUCA 4XFGA 4YNIA 1QJU1 2HWC1 4Z07A 5IAVA 5LA0A 3M3QA 3SEEA 1ACCA 2QQVA 4QX0A 4YGEA 2BTVC 4CDWB 4KBBA 3R0RA 5IVYA 2GMPA 4R4XA 1FV3A 1OA3A 1OBNA 1O3RA 1VJ2A 2PHLA 4JDMA 3B01A 3OJBA 4NE9A 4LUMA 2V09A 3ST7A 1Q3EA 2X09A 3WG4A 5HBAA 1WD3A 4MGTA 1LCLA 3IZOA 1R64A 1YXWA 3S5QA 1AR73 1LNSA 1ULEA 1JN2P 5A6ZA 4QDSA 3KHBA 1S1AA 3N7LA 5JR7B 3USUB 5GALA 4BK4A 3MPPG 3R4DB 4NVPA 3NJYA 1LOFA 1OF4A 2JG9A 1VRH1 2VMFA 4AK3A 2A73B 4M4RA 1HXS2 3AMQA 3VZOA 4URAA 1NX9A 2WSUA 2QDRA 3NJXA 3O1MA 1CIYA 1L7LA 2BJSA 5TSWA 5DAPA 5J1XA 2FZ2A 5FXZA 4EN9B 5DMYA 2VW2A 4W6YA 1ZBA1 4GQ7A 1PX3A 1HRV1 3A0KA 4UBHA 3O1VA 1MEC2 2BU9A 4KG8A 4LOSA 5KXBA 4FAGA 1IKQA 4XFCA 4Q8LA 2RE9A 4XQDA 1EAH3 1W6MB 2VCBA 2J1EA 4MXVA 3AC0A 4Q26A 3JUUA 3VB9A 3WW1A 2CNAA 2FMYA 4BJ0A 4EZ4A 1NE6A 2ID4A 4XDPA 1TG7A 3VKNA 4RFRB 5C9AB 1KXGA 1W6PA 1T6GC 4LBMA 4IEOA 5A7NA 2BNNA 4Q27A 1JXNA 1R081 5FZ4A 5CFDC 4FOVA 2WA3A 5DN2A 1APNA 4D6SA 1US3A 3J7NA 1NY71 4DXSA 5H9PA 3WF3A 2DTWA 5ABJA 1O8SA 4PI2A 4Z82A 3SH3A 1POV0 3J7HA 1XNBA 3D4KA 4ES8A 1A8MA 3I3DA 3WINE 3PLQA 4FPOB 2W91A 5FXVA 1J3PA 1S2BA 2VOVA 1CAXA 3I2OA 3GF6A 2HWF1 1LB2A 1DQ2A 5DZEA 2JIJA 4GMP3 1JYNA 2DVAA 4LIUA 2WBKA 4AEJA 3KB5A 2ZX2A 4QHBA 2CDPA 2W9XA 4Q4X3 4FO9A 3ALQA 4EWAA 1IS3A 4MZUA 1GBGA 3ENRA 3FBMA 3PL0A 1WCSA 2Q0AA 4Q4W1 3UGHA 4JRLA 2QQPA 3FLPA 3WF1A 1F15A 1VPHA 4LO8A 5FJKA 3QH6A 4HT1T 1PGL2 4CDUC 1OOPB 1QJFA 4KI5M 3ZX7A 1LU1A 4M3CF 4DNYA 3MF9A 3HWJA 1YNAA 4Q4Y1 4YVSB 3V65A 1PX4A 5EV7A 5I8YA 2SBAA 3OBTA 1COV3 5FYMA 4IEVA 4XUPA 2GC2A 3OBZA 2A6WA 4GWIA 3HIFA 5FZIA 5C9AC 5F2SA 3ZKUA 3IAPA 5CZKA 5C3PA 1VMHA 5FLIA 1JHNA 3BCWA 4A7YA 4OHZA 2ZA9A 2XKPA 4COZA 4AHYA 1M06G 4W6WA 1S2EA 3O1OA 2D43A 1BK1A 3WT3A 5IVEA 4AEMA 5K9YA 3SNMA 3ZFEA 1U5IA 1VBB1 1W99A 2PA7A 4LKEA 3GNEA 5HV4A 2B9UA 5BNPC 5CG9A 4CCMA 1KDKA 1WA4A 3I49A 1FPN2 3WNLA 1AR61 3U07A 3W58A 1I5ZA 4FOWA 5D1IA 1SG3A 1SFNA 1WMEA 3GCWA 4R9CA 1GR3A 2IFWA 1QJU3 4Q5OA 1W8TA 3VBOC 1JHJA 4QKBA 5FZDA 2PFWA 2FQPA 4FQZA 2R0FA 4GA9A 2RR11 4ASLA 1UZYA 2WAOA 2ZGOA 4JCKA 4RR3C 2W08A 1R1A2 3OYWA 3P3PA 1WUVA 4Q0VA 4XF1A 3WDUA 5A3UA 2EAAA 4XMAA 4ORFA 2W52A 3ZN6A 5FMOS 1DCSA 1PIV1 4CPBD 4WM8C 3L9JT 4PJYA 4IV1A 5F6LB 2WJSA 2ZHMA 1XPWA 1JUHA 4MADA 2RMU3 1VBE1 5A7WA 2VG9A 4YVSC 1TNRA 1VRH3 3AXDA 3RMXA 4CVUA 3N9QA 1GZTA 4GULA 1ND3A 1IS4A 4OUEA 2HYKA 1WCUA 4BYYA 5CVRA 1K42A 4RGAA 3ZXJA 4FP2A 2VCCA 2AENA 4MV2A 1PZ7A 3JD71 1OKOA 4QHZA 1SDDB 5FJHA 4PBPA 3WEZA 2EIGA 1HRV3 4ATEA 2JJ6A 3KGLA 4LBQA 5LATA 4DEVA 2QBXA 4WVVA 2R061 4ATFA 1RUD1 3N4MA 3VBUA 1IOAA 4UXAA 3I3MA 1C1FA 5FPLA 3U1XA 1QJX2 1ZRFA 4JGZA 3K3NA 3F2ZA 5GZFA 1DLLA 4YW4A 5APAA 4Z92B 5J09A 4QX7A 3LB9A 1ZZ9A 1UYPA 1R083 3VDDA 1NLSA 3EXUA 2Q1MA 1VBA1 2XJQA 4WBBA 1LESA 1JI6A 4EQVA 3GDBA 4YW6A 4XAAA 4XBQA 4BOWA 4F7ZA 2W92A 4FTEA 4LULA 3ZR6A 1V6LA 1AVBA 2ZHLA 3I8TA 4UFKA 5DUWA 4YYOA 3WV6A 4XXPA 3RVHA 3W20A 4Y1ZA 5IK4A 1C4RA 5JZGB 4D7YA 5EZWA 4IE0A 3NV4A 1AR72 3DN7A 1DQ5A 4NRMA 1O3QA 1GLHA 4HANA 3WQBA 2WWJA 2NMOA 2CU5A 1EPWA 1LU2A 3F95A 1BVP1 4QM8A 2VZUA 5FUNA 2QDNA 1XNTA 4CP2A 1WW7A 3AZVA 1J84A 2A3WA 2RDQA 3K4DA 3LFIA 4DB5A 3ZR5A 1RL3A 4IE5A 4Q0QA 2OQ6A 1C8NA 4L8QA 1UMHA 3BU0A 1R092 3HNYM 2WT1A 5T3NA 1NCRB 3GZAA 1K5MB 3IWZA 5EQUA 2BFUS 5IT6A 5T55A 3ILFA 1DP0A 1N1TA 2QQIA 3GJAA 3IKWA 2JKBA 2ATFA 1BBT2 2JB8A 4O65A 5K4LA 2NP0A 3O12A 3CZJA 3HMYA 4LT5A 5IATA 4RS5A 3C2UA 3KLSA 2RS31 4JKMA 4UAPA 2OIIA 4D0QA 1AJKA 1YC61 4A3XA 3BI3A 4EYUA 2GH8A 1PMHX 2JG8C 4YW5A 1POV1 1UYZA 4FFGA 1IPKA 4CP1A 1FI2A 2NYYA 2VTXJ 5C8CA 1TZOA 2EXIA 1W3XA 4H7MA 4K8RB 2GP3A 1F4HA 1OLRA 1YQCA 3KV4A 2VMCA 4QX5A 3RGBA 2GNTA 4NWVA 3B69A 1STMA 2GN3A 5KXDA 3AZXA 4JKKA 3OPWA 5T54A 1D4VB 1JOJA 1MQTB 4AW7A 3THPA 1ND2C 1VBB3 1S0CA 3HVDA 4CDWA 5IVCA 3C7GA 4UW4A 4XUQA 5JUVA 4EN7B 3MIEA 4FXKB 2P3YA 3ZFFB 1F8VA 4NIAA 4NIGA 4EWEA 1TQ5A 4WVMB 5FCCA 2ZX4A 1XSQA 2A6XA 2IFRA 2XJRA 1CN1A 4HLTA 2Y6HA 4UBGA 3AP4A 5I91A 4I3PA 1OFSA 3LSEA 4P9JA 2VVDA 1DGWA 4XIKA 5FPBA 3OG2A 4PLMA 2RR13 3D0JA 4Q4X2 1VLNA 1UMZA 5GZDA 1AXYA 2VO5A 4LLOA 1FMD1 2JDHA 1NE4A 2P3IA 2UYBA 1NCRC 3AFGA 3LZZA 3PJYA 4PI0A 3ZYIB 1PIV3 5ACA1 1ZRIA 1ULDA 4A4AA 4KL1A 4PLNA 2Z5WA 1GNHA 3DPRC 5FZOB 1GZ9A 1QKQA 3ZXLA 1MR5A 2FCTA 2O14A 1W9TA 3H8XA 3RWNA 1VBE3 1H1IA 3UKTA 4PDWB 1D4M1 5LRRA 2G9ZA 1COV2 4LHLA 1J3QA 4QB2A 1JZ5A 3OUHA 4N53B 1AYM1 1KFXL 4OZXA 4PT6A 1LOBA 3V56A 1N1SA 1W6MA 1XXNA 4FFFA 4LBLA 2BDRA 3P6BA 4LBJA 1YQ2A 2ETEA 4NMIA 3JD73 1O8PA 2YGLA 5E16A 1LAJA 1C8M1 2XJUA 3TBDA 4BQ1A 1V9U1 1LECA 1KS5A 1UYYA 2Q5TA 2WT0A 2XB6C 2ZX1A 4LO6B 1W03A 4N7IA 3RWKX 5A7PA 1PZ8A 2R063 2WIIB 2VTXA 2WABA 2G9FA 5BY5A 2VZVA 4MGYE 3HQUA 4V2VA 4YM3A 1UCXA 4ISRA 2LUWA 3OGVA 2CY6A 2JDYA 4FPGA 3RI9A 3WW3A 1QOOA 3ZFFC 1RUJ1 1QJU2 2HWC2 2QKDA 4HZFA 2Q1FA 1FNZA 4CEYA 1G86A 1MVEA 1QNWA 4K9SA 1VBA3 1JOBA 3K75B 1MS4A 4QX1A 1GUIA 5CYYA 3CBNA 5FK8A 3ZOIA 4CCLA 4LBOA 4YFZA 3UESA 3O1TA 5DXDA 1E5SA 1LOCA 3AJZA 4YM1A 2UWBA 5FYUA 2P6CA 2UYAA 1YIPA 3CJIB 4P5YA 4RHV3 4L92A 4UW5A 1G7YA 1RXFA 2YY1A 3ES1A 4LR4A 2RJ2A 2NZ9A 3FHIB 2WAAA 5L7OB 4N90A 1ST8A 2VOTA 1UZ0A 1XNCA 4S2GA 2NN8A 2R32A 3T4VA 5IW0A 4QXBA 3VV1A 3BTAA 1VRH2 1OOPA 3IDCB 1X50A 5C3QA 4JZRA 4PDWC 5G04L 3TAYA 5A6XA 3AYEA 4P14A 3NAPB 4YVSA 1MS9A 2P37A 4N53C 2C24A 4Y20B 1SFYA 3VD9A 4BQ4A 3UJOA 4UFJA 3AL6A 4AGRA 2J42A 2OZJA 4XACA 1ZBA2 1YO8A 1NXD1 1VE0A 4QPWA 1HRV2 3D6EA 1OA4A 1F4AA 3IN9A 1YHFA 1SHWB 2RJLA 3M1HA 2ZGQA 4HETA 4Q1PA 2XXZA 5C3OA 2RS33 5FZ7A 4XURA 4QPGB 1POV3 1RUF1 1W2TA 2B4KA 5FZ8A 3PVBB 5HCHA 2V4AA 2WNVC 1R082 1UOFA 3KT4A 3MDPA 3LA7A 4MUVA 5FO7B 3O1UA 3U75A 2ZEYA 2WYFA 1NY72 4LBKA 4PIXA 2UU8A 3MGUA 3E6BA 3WNOA 4CCKA 1AX1A 2WUHA 3KGZA 2D40A 4AHXA 1RUC1 4CU8A 4LTAA 1ZYBA 3CJXA 4HOOA 1Z7S1 3KT1A 4JGYB 4LKDA 4UW3A 5CKMA 5F37A 4IERA 1IZ3A 1VBD1 1RUE3 5CFCB 1UYXA 2R041 2VY0A 2WO3A 3SMHA 4AI3A 5EWSA 3X29B 3KD4A 4V2WA 3CQOA 4JV4A 3EMRA 4AXOA 4CCCA 2YPJA 3OBRA 1H0BA 1MVQA 2PHXA 3AMPA 4LJHA 3T2OA 2ADDA 3V0AB 2VBPA 2Z4FA 4UF0A 1IG0A 1XRUA 4IL7A 2WT2A 3NAPC 1FMD3 4Q4W2 4IE4A 2Y60A 4BDVB 4CDQC 2QZ3A 5FZLA 5ACA3 3R6SA 2KXLA 2ARCA 3ZKYA 4AF9A 3E6CC 2YU1A 4NRPA 4XCAA 4A42A 2XDVA 2VBBA 4QQOA 2ZEWA 4K21A 3I7DA 2H0VA 1SBDA 3PMSA 4DZGA 5KHKA 3JBG1 3CO2A 3G6JB 4IETA 1OVPA 1UU5A 2DVDA 4Q4Y2 1PK6C 5A3PA 5IAXA 4Y3OA 5FQ0B 4I2OA 4YGBA 5T50A 3TNPB 3UL2A 1SACA 1AYM3 1BLZA 3AM2A 4U36A 4C0BA 2ZGTA 1ULOA 2WL1A 2J1VA 4BMBA 3BODA 4ZKTB 1CAUB 5FMOL 5BUVA 3OGJA 1C8M3 2MNGA 2W3JA 1X7NA 1V9U3 4JTOA 1ZZBA 2C5DA 5IVVA 2C1FA 1KS4A 2YC4A 4B4PA 5HPOA 5EYYA 2W0XA 3ZM8A 3WF4A 5JOYA 1H1AA 1VBB2 5GZGA 4RGGA 5ANNA 5A6QA 3KV9A 4AWDA 5FKCA 1DYOA 3IAQA 3H0OA 2OQ7A 3A4UA 5CFCC 3RZZA 1JYTA 2K46A 2XHNA 3OB8A 4WM7B 2QQKA 2ZMLA 4ZZ8A 5JZGA 2E63A 3N7JA 4EN8B 5H9RA 4E9KA 2H0BA 3ZFGC 3AKTA 4K40A 1HRI1 1A6CA 2RR12 5JSPA 4B29A 2PAEA 1S2KA 3N36A 4XYXA 5E89A 3T0AA 2LW8A 2CSGA 4BLJA 3EBRA 1A8DA 3GZTB 2CTVA 2ARXA 1PIV2 2DCYA 5JCTA 2CAVA 1RMU1 3ZSLA 1RINA 1SBFA 3IDAA 3LA3A 4N43A 1Y9QA 4B7EA 1K5MA 4DXRA 2XPJA 1AL0G 4BLIA 1JW6A 4XDOA 3VDAA 4IDZA 3RI8A 5FZ0A 1VBE2 2EVXA 1SPPB 3PTRB 5FBZA 4QM9A 4COUA 4FSJA 1MACA 3NV2A 4L9BA 3RDIA 2OT7A 5A3NA 2BEOA 1DGRA 2XQXA 1WBLA 3BKZA 3LSDA 2DWRA 1US2A 3PDQA 4WZCA 1XU2A 1YFXA 3JD72 3MO4A 4CE8A 4BQ2A 1O6UA 3RNSA 1V00A 2VXJA 3M7AA 1AX2A 1EAH1 1UOBA 1H4GA 1BKZA 2V5YA 3BOWA 3OCPA 4ARYA 5K0UC 4D6QA 1CAVB 3S0MA 4CU6A 1AR93 2J1SA 4Y5TA 2R062 2F17A 4WVZA 1GWMA 1PO23 1MS3A 1Y4WA 1RUD2 1QH6A 2Y6JA 4XFHA 2SLIA 1YFYA 5DQ0A 3ZLIA 3K77A 4Q0PA 2FDFA 5C7GA 2VQ0A 1XE0A 4FPYA 3GZUC 4ZS3A 2XR4A 1RUF3 4AEDC 4K8FA 4KGQA 4YVWB 1MQTA 5FUPA 3C7FA 3GXUA 5F5IA 5T5LA 4LHKA 1LHWA 1OUSA 1GV9A 1Y43B 2BFUL 4QXCA 1CQ9A 5FZHA 4AEKA 1VBA2 4CPBA 3B93A 2VPVA 4WVMA 5FXWA 5FZGA 5C5TA 2C9KA 4DRVA 2WLPA 1UY3A 5AC91 1Y9MA 2P34A 1KDMA 3OPTA 4JHZA 4LE4A 1RUC3 2MHFA 5FP4A 4F83A 4R52A 4XILA 4CCNA 2DCZA 4Y22B 4RHV2 5LEJA 3FMGA 3H7YA 1VBD3 2IXKA 2I74A 1LOAA 2PQSA 2R043 5JXIA 1PM4A 3GBGA 2YYOA 3INAA 4W65A 3BPZA 4I30A 2ZMKA 4XJ9A 3NMBA 5FP9A 3IDEA 1H4HA 4R9DA 4DUWA 1K12A 3ZIXA 2ZGRA 3E6DA 3LOIA 3KVBA 4LMFA 1TVGA 4AI9A 4FAHA 4FPKA 5FZOA 4N8MA 3NSTA 2HWB3 1OXCA 3LFMA 5LA9A 1QNYA 4JX0A 4Z8BA 2D6OX 1HV0A 2BPA2 3DKQA 1HDKA 1OI6A 3IIAA 4NN0A 5FZ3A 2BGCA 4YPJA 3USSA 2H6BA 1DYKA 1O5UA 1YFUA 4DFSA 3VBSB 1OMIA 1UNBA 3JBG3 2RS32 5T5PA 3I2GA 5LASA 4XJZA 4NPLA 1H2LA 4JQRA 2E7AA 5E88A 4OCTA 1I5PA 5FPAA 1JZ3A 4RFT0 2D98A 1V6NA 1YYNA 5FYIA 3PVEA 1UWWA 1GU3A 2WQZC 4CXWA 3OEAA 1CJDA 1KFUL 4XW3A 2XBO3 3D3AA 4L99A 2HEWF 1BHGA 1W6NB 4OHXA 5F8PA 5A33B 3WDWA 3PUAA 2WKKA 1S0EA 4GH4C 2HH9A 2Y6GA 4LIVA 2N7GA 1UU4A 1UY1A 5BNOC 4OUSA 1GZCA 3SISA 5CFDB 3LDRA 2Q8EA 1JS9A 3AKPA 3D5OA 2XWJB 3W59A 3ZXEA 3RYRA 3ZN4A 4A41A 2V72A 3AZZA 2JXAA 5LY2A 4CP9A 1BYHA 2WQ4A 3CJIA 2VZQA 4H3WA 4IEZA 4PQ9A 5FREA 1GZWA 3VKOA 4AFCA 5KC5A 5L7OA 1HRI3 5IK8A 1HKDA 3DGTA 4XF3A 3POBA 2FDKA 3MUY1 1CPNA 3R4SA 3B9CA 2ZGPA 1FMD2 1JYCA 5B4XA 4Q0UA 1VMJA 1QXJA 4YM2A 5ACA2 1HQNA 3B7MA 5FPUA 3RYPA 2RMU1 1RMU3 4NIHA 2DBIA 1U5XA 2VVEA 4DS0A 4V1PA 1AUYA 4Y20A 1CPMA 4TWTA 1C28A 2UWAA 3J26N 1LHVA 2VMEA 4Z2AA 5JPNB 3VBSC 4TXWA 4I3GA 2C26A 1NCQB 4Y5Z0 1D4M2 1HB3A 4COVA 1KD7A 1W8OA 5CIRA 5F7UA 5J48A 2FCUA 3APBA 1AYM2 5FK7A 4AVTA 4CDUB 4UW6A 3ZYFA 3MW2A 3POYA 1S0BA 1V6OA 4QPGA 3ROUA 1NG0A 1E5IA 2A1XA 3BIWE 1C8M2 1QWRA 1WW5A 3HNMA 4AAXA 2AGSA 4CXXA 1V9U2 5C4WB 5HCBA 4B4RA 1GWLA 2QE3A 1G8WA 3VBHB 3LCPA 3KQRA 2XLFA 5BNNC 3SITA 1LGBA 5F3CA 4I0BA 2DUOA 4BWOA 4Q2FA 5F1RA 3FFZA 4C8DA 1N3QA 4X6QB 3CNAA 5FZFA 2YMZA 3LDKA 2BBAA 4QX8A 5DPNA 2Y8KA 1RUJ2 3ACFA 4EN0A 1SZBA 3AMNA 1BK0A 1H2MA 1I3HA 4HXCA 5DG2A 3OY8B 1EY2A 3AVRA 3N7MA 4JGYA 1YJLA 3UGGA 5LY1A 1XNDA 1P8JA 4CEWA 5CFCA 3NV1A 4XF9A 4KWKA 5F5CA 5C8WA 5BNPB 5HXVA 5FZKA 5AC93 3WDYA 4OUMA 1JH5A 2VU9A 4QX2A 4ZY9A 3V0AA 2WWSA 3OUJA 3UK9A 3ZMOA 2EXJA 3VBOB 1W8UA 1GP4A 4XF0A 3SH4A 2AUYA 3UGFA 3BGAA 2DTYA 1H8TB 2K2SA 1DQ4A 4H14A 1YUDA 2GMEA 1GOGA 3FFQA 4RR3B 4NJ4A 2B7YA 2DFBA 2IXCA 4FP3A 5A1AA 3C7OA 3WNMA 4CCDA 4QWNA 3WXPA 1E57A 1NCQC 3MV01 1G9FA 2Z2SB 4IV3B 4WM8B 1BCXA 2ZGMA 2AREA 2HYXA 2XVGA 3CIHA 5FQ0A 2WZR3 3R4UA 2GALA 2WNEA 2XJVA 3ECQA 1L7QA 4WZFA 1GQHA 1HN1A 5BNQA 4K20A 5I0RA 5GM0A 5C4WC 1QJZA 3I3BA 2YPDA 5LCWL 3PJQA 1CAUA 4X6RB 1F31A 1PO22 2BWCA 2YBKA 4LO4B 3VBHC 2YG0A 1JTZX 4YG0A 2Q8DA 1VR3A 2A3XA 3UV9A 3VDCA 2VZ1A 1RUF2 2ZJCA 5HCAA 2W5FA 4CA9A 5JSOA 1W6OB 4D8MA 4Y1VA 2BOJA 5I0UA 4XOGA 3VN4A 5A3LA 1W3VA 4XQWA 4AQ6A 1D0GA 1JOPA 2O8QA 3P1IA 1PGSA 3UKVA 5FIXA 3W5MA 3AKQA 4CCEA 1LTEA 3K3OA 1O4YA 2B42B 3WY6A 2YBPA 4WM7A 4Q1RA 3ZN5A 4FFHA 4QKFA 1RUC2 4PCRA 1CZTA 3OGGA 4UYBA 1NUKA 5ERLA 3WP6A 3WF2A 1VALA 1Z7S2 2VW0A 2YC0A 4LEJA 1VMFA 3POFA 1BVVA 1VBD2 4OMDA 1WLWA 4LA2A 4GAZA 4W8JA 4QQLA 2R042 2OVUA 3SLIA 1H8TC 1QOSA 5LWBA 4FOQA 4RA0A 4I09A 4YSFA 1DZTA 3SHRA 3AKSA 3NNMA 5GLUA 2Z69A 3AK0A 1NOVA 1UIJA 3V0BB 2ZABA 1PO11 3B9IA 1AF9A 2GSYA 4IV3C 3FUOA 4E4DX 1SPPA 1T2XA 2P3JA 3OBAA 1O91A 3WCSA 2WS93 1ZZCA 4IEXA 1Z78A 2X29A 2YFUA 5JI7A 3WNNA 3WOGA 4CXYA 2PAKA 3TB0A 3UKNA 5FZCA 1ULGA 1IQAA 3HD8B 2ZBJA 3JBG2 4HK9A 1ZX5A 4Y33A 3PVNA 3FJSA 1CONA 3DYOA 4XJ8A 1J83A 4B3NA 3L2YA 4XHXA 1FNYA 3NJZA 1RUG1 1EUUA 1CAVA 2LRPA 4XE9A 5CKQA 4AYUA 3KV5A 5J7MA 4CDXC 4DOUA 4A45A 4K1ZA 4AHWA 2FZ1A 2ZKLA 1S4CA 2WR9A 5L36A 1MS1A 2X5IC 3UT0A 4AG4A 5CKNA 3VD7A 4YVWA 2PLV3 2BRTA 4E27A 3ON7A 2JG8B 5BYNA 1RHI1 1KRIA 2VQUA 2W1UA 2AR6A 5I0TA 3HBKA 2C0ZA 5AVAA 5M0TA 4JDOA 1A3KA 5LBFA 2B46X 4BQXA 4OI4A 3BIEA 2UWCA 4GB31 5IWFA 4PF1A 5FYCA 3WNXA 2JDZA 4AVBA 5HXMA 2FHRA 3OPZA 3WSOA 2VECA 3WDXA 4RQPB 4C0HA 1OLMA 4FBFA 1C57A 1ND2B 3KMHA 4AL9A 4A7KA 1HRI2 1YEWA 2CGOA 3U37A 3AMHA 5CAZA 2ZOEB 1EV13 1TME3 4LHSA 4MLOA 4RHV1 2CGNA 2JDUA 4XCBA 4NHLA 3ZSEA 3S7EA 4D69A 1XU1A 2RDRA 3T30A 5FAXA 4D7TA 2XGXA 1IS6A 2QQNA 1W2AX 2TNFA 4HSLA 1J1TA 1RMU2 5C33A 1JODA 5FO8B 3OD4A 2Y38A 5F3EA 4QQHA 4TYSA 2XJPA 3N9OA 2HWE1 3T1MA 5IVJA 2F4PA 3RZJA 3OOXA 4D6RA 2W87A 3AX4A 4MGZE 1ZRCA 2WNOA 3K4AA 3LEKA 1HQLA 1S0IA 5FDBA 5LA2A 4KGGA 4IEUA 3M3IA 5EXOA 3MW3A 4X8PA 3KS7A 4ONUA 3MICA 1PZ9A 1OPMA 4MHUA 1ULFA 3DPRB 3SKJE 2I2SA 2O0OA 2ARAA 4BH9A 4S2HA 5ANQA 1WGPA 3E5XA 3WG2A 1AXKA 1EPZA 3LA2A 1EAH2 1GFF2 4DEQA 3H8OA 2DUPA 3IT8A 4ITCA 1H9WA 2VUAA 4C91A 1N47A 1B35C 2VBDA 3I2DA 1GANA 1V6MA 4UFMA 2P17A 2G19A 3H7JA 1V6KA 5FWEA 3ZXKA 5A33A 1W6NA 2XOMA 1FOD3 3A22A 1NYWA 2BVBA 5FY0A 3N7KA 3KCXA 5FFOC 4YW7A 4IUGA 5CFDA 1N1YA 4LORA 2JIGA 2QNKA 2ZTNA 4RQPC 1UY4A 3G7DA 1ULPA 4G4FA 3K51A 1G9BA 5JOWA 1HJFA 2AEYA 2BNOA 5AC92 3VBFB 4Y24A 4B7KA 1DZQA 2X10A 1RUE1 4IGOA 4LKSA 4QMAA 4WV8A 1JU3A 2JE9A 2R073 1F35A 2YFZA 4GXLA 2DVBA 4OYUA 5LK5A 4XFAA 4TLFA 1MZ6A 4Y1YA 1DU3D 4P02B 1GNYA 3ETPA 2WFF1 4COYA 2IUWA 3M8LA 3PURA 3USUA 1SMVA 4ZONA 4BU2A 1CAWB 5B4NA 3GJBA 4K6BA 4AI2A 1PO13 3MV11 4MHRA 3VZKA 3CZUA 1WWYA 3PIJA 4HVOA 3RSJA 3VLBB 1QEXA 4AE2A 2PHFA 3HEIA 4H55A 2P6HA 2WZR2 4LK7A 3L2HA 4KQ7A 4SBVA 2JE7A 3WG3A 1A34A 4CDUA 5DUXA 2C4XA 2L9LA 3HNBM 1X8MA 5FUIA 2B8MA 1ZRRA 3PHMA 2YXSA 3B3QE 1WD4A 4EWDA 4GZ9A 4Q29A 3ELNA 4RL7A 1RUG3 4HBNA 2D7FA 1W8WA 5C9AA 1JUIA 3AFKA 1V70A 2MPFA 3EO6A 4P5HA 4QPIB 3RRDA 3TEXA 1MZFA 4BA6A 1TNFA 4AGGA 1HIXA 1A78A 2OPWA 1RUH3 1G9AA 1S55A 2WZEA 3S5AA 1OQDA 5EJ1B 5F5AA 3U4SA 1RUI1 3TOJA 1VP6A 3OY8A 3UETA 3ZSMA 2X53S 1QJEA 2W39A 4XVHA 4B4QA 3H3ZA 1RHI3 1ZZ7A 4W50A 5H9QA 3VBFC 1JZ6A 2H6CA 1SLBA 5FRAA 3ZSKA 1LHNA 2WNVB 2WLQA 3J8F3 5BNPA 1QDOA 4FQ4A 1W0OA 4C1XA 2ERFA 2OS2A 2RDNA 2Y6KA 4ZU4A 5SV5A 2LS6A 4GB33 4E2QA 1XSRA 5F5QA 3RYKA 4JTNA 5F32A 1AX0A 4K3UA 1RB8G 4F8AA 4HKWA 2AEZA 3BVCA 4XABA 3VBOA 3HJRA 4I02A 2CGPA 5FZAA 3NQHA 3WD5A 3ZMNA 2A3YA 2DURA 4NHMA 1H8TA 3U11A 5CA6A 5LZ6A 1AZDA 2OXBA 1URXA 1UZVA 2OPKA 2WNUC 1X9PA 1ENXA 4RR3A 5E1RA 3WHUA 3FWEA 3D0SA 4E8CA 4TSVA 3TYJA 1OVSA 4Y1XA 5GZEA 1EP0A 1F5JA 5T52A 2QVSB 5A3OA 5A70A 4I0AA 4WM8A 3SH5A 2AH2A 2RMU2 2W46A 5ISLA 3ETQA 4BISA 2XL7A 3IDBB 2HWE3 3POEA 3VUOA 1ODMA 2ENRA 4Q0SA 3J4UH 4YW2A 4N9IA 1LEMA 2RJKA 4KU8A 2OKXA 2TUNA 5FPXA 2PHRA 2WZPP 4ZZ5A 4CDQB 5I8TA 3LGRA 1ZM1A 3BU7A 4ASMB 4XIOA 3M70A 3GZEA 2VUCA 4QPIC 3ZVXA 1AR91 1PNGA 1N3PA 2BVVA 1PK6B 2Z42A 1PO21 5HV0A 2PLV2 2ZMNA 1XB9A 1XJAA 1W6OA 2P5BA 3DL3A 1J3RA 5FYBA 1BQPA 1XYOA 1I9RA 5IVBA 2W1SA 2YC2A 2P3KA 3T09A 1JZ2A 5FWJA 4AFAA 3MFCA 4PBOA 2VZPA 1XQNA 3NJVA 4GMP0 1MZ5A 2BNMA 4GWJA 3KWVA 5T5JA 3T1LA 3VL9A 2EF6A 3BOPA 3MEPA 1VIWB 4LPLA 4XQ4A 1UQXA 2XKOA 5I8SA 2BOIA 2YHJA 4P08A 2TEPA 5DG1A 2RS51 5JPMB 1RITA 4QT6A 1WMDA 1YWKA 3MUZ1 3Q8EA 3T2TA 2ARBA 2RS11 5DUVA 4YW1A 3O1PA 1WCDJ 3KCYA 1ZREA 5DAWA 1OLME 2R16A 1OT5A 4YWAA 3SC7X 3LEMA 4UI9L 2D6LX 2D3PA 3V0BA 4QDRA 1LODA 1YJKA 4LUKA 1H2KA 2I45A 2P2KA 2XUEA 4R8HA 3J7MA 3ZYHA 4YZ5A 4JHTA 5LEKA 1W0PA 3ZFGB 5I93A 4FPEA 3VD3A 3S7IA 2WFF3 3BN6A 3NNLA 4GKXA 4AQTA 1W06A 1OFNA 4HFSA 2HWB1 3ZYPA 3GHMA 1WLCA 2CL2A 5FYZA 3IBMA 4LBQD 1IHMA 4B8EA 2IC1A 5L9RA 4CUBA 2V73A 4ZXEA 1H1MA 2ZS6B 2JENA 1QHDA 3EB7A 2MEV1 2YB7A 3ATGA 3FUQA 3NNJA 5FBJA 2GZWA 2BERA 3AVSA 4CU7A 4MGKE 4CZSA 5FR3A 2XVLA 4KNCA 4META 2PHWA 4XJAA 3KCCA 1OSGA 1SBEA 3B5LB 4C1WA 2JG8A 3LPFA 1W6QB 1LOFC 1W05A 4A6SA 2JG9C 3POWA 1HQWA 3WX5A 2FCVA 1FT9A 2RM21 3MIGA 1CWPA 1F5FA 3N9NA 4TN7A 3P5BA 2FDHA 3O1SA 2XBO1 4W6XA 3ZYJB 5K0UB 4OHYA 3WP3A 1JZ7A 3ZXFA 5EFUA 2D6MA 4J1XA 3OF1A 5IK7A 1H8VA 2TBVA 3MYXA 1HXS3 1RUI3 3MLLA 1GOFA 1AYN1 2QZ2A 4FPLA 2A75A 4AEDB 4FCAA 4DMIA 1SCRA 5DDJ1 2CAUA 1ND2A 1GICA 1IGOA 2R072 2DV9A 3I59B 4GALA 1IPSA 4CYDA 1FXZA 3PUHA 1DIWA 4QB6A 3WNPA 1IPJA 1UX7A 5JWPA 4QGNA 4COWA 3IM0A 4M3CE 3RPQA 2NLRA 3WW4A 1PO12 2QTWB 1XYPA 3PTYA 1JMUB 4HN0A 3VZNA 5FZBA 4KH9A 2Y64A 4K7JA 3DXTA 4YZ4A 1D2QA 4IEPA 5ABJC 4M01A 1NCRA 2IVJA 4KWLA 3TEWA 1JYXA 1GYKA 4DXZA 2VGDA 1ZRDA 2WO1A 2NMNA 3N9PA 2ZPXA 5FZ9A 3HR9A 5JSRA 4YZ3A 4QAWA 5H9SA 2JD9A 3O0VA 3DPRA 3LQCA 1ZBE3 3RS6A 1DGWX 5EYXA 2VULA 4LLFA 2Q30A 2IXHA 2WA4A 2Y6FA 1MZEA 4S2DA 5DZFA 2ZEZA 3I2JA 3VL8A 4XUNA 5KHIA 1RUG2 3DUIA 4HKLA 4Z1VA 5FO9B 1QXRA 1HLCA 1DYPA 5LRSA 3MLJA 4P9YA 4XEZA 2JE8A 4NHYA 3RZMA 2NM1A 2BGPA 1Q8SA 1CD3G 1X8EA 2K9ZA 1AHSA 2E32A 2XVKA 4W4ZA 3UJQA 1K45A 4ES9A 1UAIA 1QJY1 2J22A 3RJRA 3U0ZA 1W28A 1NZCA 5A3MA 1RHI2 2R1BA 1RC6A 3J9SA 4HKOA 2QJVA 1OD3A 5JIAA 4A3ZA 3T0BA 4GIQA 3SKVA 3AYDA 4GB32 3ZFFA 2YZ4A 1Y9GA 4P00B 2ES3A 1ULCA 1OHFA 2VNOA 2PYTA 1NAEA 3VGIA 2KA3A 3VKMA 2J1AA 2RS53 4GH4B 3GGLA 3W9AA 1LENA 4FVVA 4MGQA 5A3TA 2W68A 4QQ2A 1Q43A 5DZGA 1X33A 5BNOB 2RS13 1UO9A 3GYDA 3JZVA 4LBQB 5FY8A 3ITQA 1XYNA 2VCAA 1CAWA 1T6BX 3PUQA 3QACA 2GNDA 3ZDSA 4BPZA 4PF5A 4IXLA 5JI9A 5DABA 4FOYA 4L0PA 4FI9A 3ZFEC 5FXXA 3A21A 1UZZA 1JYWA 4QXHA 4FTBA 1UMIA 3ES4A 3NVCA 4BHPA 3ME2A 2VOKA 5KHJA 4BQWA 1O3TA 1WCQA 2HWE2 3DV8A 2QQUA 1ODNA 1ZA7A 1ENRA 1W8FA 2HEYF 1NQDA 2Q4SA 2HJIA 3LKJA 4QDQA 2WZR1 2XL9A 4PDWA 1UXZA 4XUTA 3GM8A 4QHOA 1W0NA 1JYIA 3R05A 4N53A 4BXFA 2WFPA 1CIWA 2V4VA 4LBNA 1ENQA 1OUXA 3T08A 5CISA 1NLQA 2MEV3 5J98B 3RMYA 2R7EB 4YGDA 5FYHA 3WDTA 4P9XA 2DYCA 2HBUA 1AR81 5FYSA 3GHNA 4IV1C 1PMJX 1VBC1 3H3LA 3IPVB 5FMDA 4HVQA 4TLGA 1DBNA 1O4ZA 3AZWA 4GJYA 2A5ZA 1X36A 1EYBA 3AP7A 1REDA 1WBFA 3VHRA 2RM23 1UD1A 2KR2A 3KT7A 4NWWA 4QX3A 5C6CA 3A7QA 1UOJA 4YLZA 4D3WA 2WNVA 3AP9A 3LE0A 2F6BA 3MPBA 5BNNB 4R4ZA 4KWJA 1GQGA 2ORZA 1GNZA 2GNBA 2DBNA 3IMNA 2Y0OA 1DGRN 4Q4V1 2WYSA 1AYN3 2JDAA 1UPSA 4NR1A 2WC2A 1TMF1 1RUE2 4HVRA 4IE7A 3QBQA 4XJUA 5DDJ3 1ASJ1 3U14A 2WN3A 5JXGA 4OI0A 4ZU7A 3VBUC 4CRQA 5FV3A 4AHZA 3VHNA 4JGZC 2WFF2 2PHUA 1QY4A 2EIDA 2LALA 3GBWA 5FZ1A 2BV4A 1DQ1A 5GKAC 4O9GA 2JB4A 1OC1A 4BQYA 3HN1A 4M3CB 2W2IA 3OEBA 3VDDC 3VZJA 1AL23 1SQ4A 2WS91 1L3JA 1W2NA 4PIZA 1V6IA 1SLTA 3FLRA 2R30A 3NAPA 5LB6A 4CDQA 3JXSA 3MW4A 4E2GA 2VNGA 1J59A 2E33A 3FN9A 5BPXA 4A44A 1OD5A 4WVWA 2ZAHA 1E5RA 4INDA 4KBZA 1IG3A 5I0DA 1SDWA 3DYMA 1JU4A 3WW2A 3RZGA 1SLCA 4E2SA 5A6YA 1MS8A 1PK6A 1VAMA 2UURA 3WDVA 1RUOA 4JKLA 2ZEXA 4SLIA 5F9TA 1RJ8A 3IIIA 4U2AA 4AFDA 4ARXA 1GP5A 4YW3A 5FY7A 1H9PA 3NWKA 2PLV1 1WLDA 4FPJA 3VD5A 1QMJA 1C1LA 5FKBA 1HV1A 1QDCA 4G9SB 1LEDA 3NNGA 4URTA 1QJY3 1RUI2 1WA6X 4RSUA 2OYZA 3U10A 3LIGA 3NV3A 2CYFA 1CZSA 2OX0A 1R093 3QLQA 4K1YA 1PVC1 1Q8QA 5CBLA 2ZX0A 4CSWA 3NKGA 4BM8A 3KF3A 1Z0HA 1UU6A 3LOBA 4RS5C 4ZPIA 3I2FA 5IYYA 1BMV1 4AQ2A 1BBT3 4Y26A 4AVAA 3HOBA 1WKYA 4S2FA 4ET7A 2ZX3A 4XHBA 3NO8A 2J1UA 3C7HA 1SLIA 2YUEA 4IEWA 4PHZA 1EV11 1TME1 5JXJA 5C8CC 3WQ1A 3WP4A 2XWBB 3ZFGA 4M00A 3AYCA 5BV6A 2A7AA 3QH7A 4Y4YA 3HBZA 4KWUA 3LPGA 1U12A 2ZGNA 1L7RA 2LTNA 3MBWA 3MIFA 5E8AA 2XJSA 3SEPA 3MZHA 3PMEA 1ZVFA 2QQOA 4OZOA 1SFPA 4CDWC 4HN1A 4ZU5A 3PU8A 5I0SA 2EXKA 4NOTA 3H8RA 2YV8A 1HB4A 4D7SA 1ZBE2 4A7ZA 5IK5A 4PIYA 4YRDA 3ACLA 3B02A 1TEIA 1UOGA 5KR7A 3E5QA 4MX3A 3PIGA 2D6NA 5FPZA 3T2PA 3WR0A 4CEYB 1I1EA 4RYDA 4Y5SA 1N3OA 3DEMA 5DAVA 2AC1A 4QD2A 2OA2A 3DXUA 4IQPA 2DUQA 1PVXA 3AP5A 1KGYA 4YGCA 3GCXA 1F2NA 1UKRA 3JU9A 2CWMA 3IMMA 4AFMA 2VXRA 1AR92 3BYWA 1W6QA 2ILMA 5FMCA 5A7OA 3SCFA 2IWGB 2VMIA 5A32B 1RTVA 3TNQA 1WW6A 5K0UA 2VM9A 1X82A 4OULA 3ZPOA 1AR83 2JECA 4AFBA 4XJWA 4CDXB 1VBC3 3DYPA 1KJLA 3I2HA 1FOD1 1OURA 1QQP1 2QQMA 4AVSA 2VE1A 2VZ3A 4DY3A 4DINB 4EZHA 2DU1A 2D6KA 2RVAA 4P9IA 1RVF1 1K5JA 1OQ1A 2X5IB 3O0WA 2BW8A 4AEDA 4L97A 4BB3A 1YQ5A 4CU9A 1BEV1 1D0HA 4BXSV 1UZWA 3FX3A 4CUCA 4QGLA 1XNAA 2YDEA 3Q9OA 1F9KA 4KG0A 4OLLA 3I59A 3RZKA 2RS52 1JZ8A 3FE5A 1U5YA 2VOXA 3H8UA 3KVAA 3KQ4B 4AAPA 2R071 5GLZA 2RS12 1GSLA 4Q4V3 4KMQA 1O5LA 2PQQA 3GALA 3MIDA 1KEXA 1TMF3 2BQPA 2ZXQA 5GLTA 5JR2A 2VUJA 1ASJ3 3VZLA 2XHKA 1M4WA 4QQPA 4GKYA 4NIDA 1YFWA 5DUUA 3KM5A 3JB4C 2QUOA 1ONAA 1UIKA 3FHQA 1XNKA 1W8NA 3ACIA 4F3JA 1GQPA 2GN7A 4LXLA 3H3UA 3VDBA 2E7QA 5K7PA 2AZ5A 1REEA 1LJ7A 2C9AA 2IXJA 2VNRA 2VVFA 1SCSA 3ZXDA 1GP6A 2HWB2 1W2OA 4OHWA 1UL9A 3ILNA 3OSDA 4HL0A 3FC0A 1W90A 4CEYC 1HX6A 1B09A 3DF0A 1S0JA 5CADA 5JOZA 3W5NA 1UY2A 3MHZA 2HWC3 2R0HA 2QQJA 4XXAA 1CESA 4DRRA 3ZO0B 2DCKA 2MEV2 2XUMA 1ENSA 4E4SA 2LM3A 4HPKB 2EA7A
chains in the Genus database with same CATH topology
3WF4A 4QX0A 2VZTA 3ACGA 2WZEA 1DYOA 3IAQA 5EJ1B 3UETA 2XHNA 3OB8A 4XVHA 2QQKA 4ZZ8A 4W50A 2X09A 1JZ6A 1R64A 1LNSA 4OMCA 3IB3A 4QDSA 2Y6KA 4BK4A 2LS6A 3T0AA 2LW8A 1OF4A 5C70A 2EIBA 2VMFA 3HJRA 4M4RA 3NQHA 3IDAA 2VZSA 1NX9A 3NJXA 1CIYA 4DXRA 4LQRA 5J1XA 3VDAA 5DMYA 4E8CA 1PX3A 1CX1A 1W9SA 2XQXA 2W46A 1US2A 4TTGA 2VCBA 2J1EA 3OGRA 3AC0A 4BJ0A 3MO4A 2OKXA 2ID4A 1TG7A 2WZ8A 1JYVA 4ZZ5A 2BGOA 4ARYA 4CU6A 2J1SA 3I97A 2Y6JA 5DQ0A 3K77A 3FHAA 5DN2A 1US3A 4DXSA 5C7GA 1O8SA 4MGSA 3C7FA 3GXUA 3J7HA 1DLCA 4M4PA 3I3DA 2W1SA 2YC2A 2W91A 3T09A 1JZ2A 2VZPA 3NJVA 2C9KA 4GWJA 1UY3A 1JYNA 2WO2A 4LPLA 4JHZA 2WBKA 4P08A 2CDPA 2W9XA 3UNPA 3MUZ1 4MO3M 5JXIA 2PQSA 3WF1A 4DUVA 4DUWA 1K12A 1OT5A 1IQDC 4UI9L 4KI5M 4QDRA 5C71A 1TVGA 2DDUA 2VL4A 3VD3A 3BN6A 1PX4A 5IFPA 4JX0A 1GMMA 4XUPA 3PUIA 4GWIA 3T0DA 4YPJA 3IAPA 5CZKA 4E8DA 3K4ZA 4CUBA 3I2GA 4ZXEA 1NKGA 3EB7A 2YB7A 1JZ3A 1I5PA 4MOAA 2BERA 3T2QA 1W99A 4CU7A 1UWWA 1GU3A 3OEAA 3WNLA 3LPFA 1SG3A 3D3AA 1BHGA 1JHJA 5JXHA 2Y6GA 1JZ7A 1UY1A 2WAOA 2VTFA 1GOFA 4A41A 2V72A 3DECA 2VZQA 3A23A 3MUY1 1H6XA 4BK5A 1XPWA 3PUHA 4MADA 2ORXA 4QB6A 3WNPA 2VQTA 5B4XA 1UX7A 3OGSA 3HPNA 2W1QA 2CDOA 4CVUA 3ABZA 4OUEA 1K42A 2VCCA 2VMEA 2Y64A 4Z2AA 4TXWA 1SDDB 2C26A 3WEZA 5F7UA 1W8OA 2B9VA 1JYXA 4DEVA 2QBXA 2WO1A 4QAWA 2JD9A 2VR4A 3LQCA 3F2ZA 3HNMA 4AAXA 2ZEZA 3I2JA 4XUNA 4HG6B 2JE8A 2BGPA 2VC9A 1JI6A 3GDBA 3VD4A 2VJXA 2E32A 2W92A 4W4ZA 1K45A 2BBAA 2J22A 5DPNA 2Y8KA 2JKXA 3ACFA 3WNKA 1P8JA 2W94A 2EIEA 1OD3A 4A3ZA 3T0BA 3WQBA 3SKVA 1UXXX 3CKHA 2QQLA 2VZUA 5IHRA 1XNTA 4QX2A 4P00B 1J84A 4ZY9A 2VMDA 1CZVA 1NAEA 3K4DA 1EUTA 2J1AA 3GGLA 1UMHA 4MGQA 3BGAA 3HNYM 3EYPA 3C7EA 1GOGA 5A1AA 2VCAA 3C7OA 3WNMA 1DP0A 2QQIA 3MV01 1W9WA 4L0PA 4FI9A 3A21A 2BZDA 4XUOA 1JYWA 3CZJA 3NRUA 1UMIA 2HYXA 4UAPA 3CIHA 4JKMA 1WCQA 4D0QA 3ACHA 1PMHX 3ECQA 1L7QA 1UYZA 1HN1A 4QDQA 2W47A 2XONA 1UXZA 1O59A 4XUTA 1RYYA 3I3BA 1D7PM 3GM8A 5LCWL 1W0NA 3K46A 2YG0A 1F4HA 2V4VA 3LEGA 3T08A 2VMCA 3VDCA 2VZ1A 2X05A 4JKKA 2R7EB 2W5FA 2E31A 2VZRA 3E1F1 4D8MA 3C7GA 1PMJX 4DXTA 4XUQA 5JUVA 3P1IA 3W5MA 2J1TA 4QB1A 1K3IA 2Y6HA 3THDA 4QX3A 1CZTA 3A7QA 1NUKA 3WF2A 3OG2A 1XC6A 2RV9A 3LE0A 4OMDA 4W8JA 3THCA 2ORZA 2J7MA 2VO5A 2WYSA 2JDAA 1UY0A 2E26A 3WF3A 5JXGA 2WN3A 4A4AA 1W9TA 1T2XA 3OBAA 2EIDA 5LA1A 1JZ4A 4QB2A 2YFUA 1JZ5A 3WNNA 3OEBA 4PT6A 3P6BA 2Y6LA 3I2KA 1YQ2A 3WF0A 1O8PA 3DYOA 1J83A 4UOJA 3JXSA 1UYYA 1EUUA 2E33A 3FN9A 5G05L 4A44A 3I2IA 2J1RA 2WABA 4A45A 5I0DA 2VZVA 3DYMA 1JU4A 4AG4A 3OGVA 3VD7A 3CMGA 4JKLA 2ZEXA 4XZUG 3IIIA 4ARXA 4A6OA 2VQUA 2W1UA 3VD5A 3K75B 4QX1A 1GUIA 5CYYA 3NNGA 3UESA 4PF1A 1CZSA 5HXMA 3WSOA 4P5YA 1H6YA 5EIYB 2RJ2A 4CUAA 2WAAA 3U37A 3CDZB 5IYYA 3I2FA 2VOTA 1UZ0A 2DCJA 4LHSA 4ET7A 3HOBA 1WKYA 1MPXA 2J1UA 3C7HA 3I3EA 5JXJA 5G04L 2QQNA 4DUXA 5IFTA 4KWUA 3VD9A 3LPGA 3FL7A 5IJRA 3MBWA 1L7RA 2W87A 4QPWA 3SEPA 3K4AA 3LEKA 2QQOA 5LA2A 4OZOA 1F4AA 1SHWB 5JMOA 4XURA 3SKJE 1OH4A 3T2PA 4DEQA 2B4KA 4RYDA 2EICA 1KGYA 3HN3A 2ZEYA 2WN2A 3LEIA 3C8XA 3WNOA 2XOMA 3A22A 2WUHA 2VM9A 4CU8A 4IUGA 3DYPA 3I2HA 2QQMA 2VZ3A 1UY4A 1ULPA 2RVAA 1UYXA 2VZOA 2WO3A 2WDBA 2W95A 4CU9A 1OF3A 3CQOA 2X10A 4BXSV 5EJZB 4LKSA 4CUCA 3T2OA 1JU3A 1XNAA 2YFZA 4OYUA 2Z4FA 1JZ8A 4P02B 1GNYA 3ETPA 4BDVB 4KMQA 4RN5A 1GOHA 1KEXA 2ZXQA 5JR2A 5B4NA 4A42A 2ZEWA 4PQQA 3MV11 3CZUA 3FHQA 1W8NA 3ACIA 3VDBA 1GQPA 3HEIA 2V5DA 2HLEA 2C4XA 1ULOA 3HNBM 2L9LA 2J1VA 5FUIA 3W5NA 1UY2A 2W1WA 2QQJA 4GZ9A 2W3JA 2KD7A 2DCKA 2WQ8A 5LA0A 2YC4A 5HPOA 3SEEA 3ZM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WF4 A;  4QX0 A;  2VZT A;  3ACG A;  2WZE A;  1DYO A;  3IAQ A;  5EJ1 B;  3UET A;  2XHN A;  3OB8 A;  4XVH A;  2QQK A;  4ZZ8 A;  4W50 A;  2X09 A;  1JZ6 A;  1R64 A;  1LNS A;  4OMC A;  3IB3 A;  4QDS A;  2Y6K A;  4BK4 A;  2LS6 A;  3T0A A;  2LW8 A;  1OF4 A;  5C70 A;  2EIB A;  2VMF A;  3HJR A;  4M4R A;  3NQH A;  3IDA A;  2VZS A;  1NX9 A;  3NJX A;  1CIY A;  4DXR A;  4LQR A;  5J1X A;  3VDA A;  5DMY A;  4E8C A;  1PX3 A;  1CX1 A;  1W9S A;  2XQX A;  2W46 A;  1US2 A;  4TTG A;  2VCB A;  2J1E A;  3OGR A;  3AC0 A;  4BJ0 A;  3MO4 A;  2OKX A;  2ID4 A;  1TG7 A;  2WZ8 A;  1JYV A;  4ZZ5 A;  2BGO A;  4ARY A;  4CU6 A;  2J1S A;  3I97 A;  2Y6J A;  5DQ0 A;  3K77 A;  3FHA A;  5DN2 A;  1US3 A;  4DXS A;  5C7G A;  1O8S A;  4MGS A;  3C7F A;  3GXU A;  3J7H A;  1DLC A;  4M4P A;  3I3D A;  2W1S A;  2YC2 A;  2W91 A;  3T09 A;  1JZ2 A;  2VZP A;  3NJV A;  2C9K A;  4GWJ A;  1UY3 A;  1JYN A;  2WO2 A;  4LPL A;  4JHZ A;  2WBK A;  4P08 A;  2CDP A;  2W9X A;  3UNP A;  3MUZ 1;  4MO3 M;  5JXI A;  2PQS A;  3WF1 A;  4DUV A;  4DUW A;  1K12 A;  1OT5 A;  1IQD C;  4UI9 L;  4KI5 M;  4QDR A;  5C71 A;  1TVG A;  2DDU A;  2VL4 A;  3VD3 A;  3BN6 A;  1PX4 A;  5IFP A;  4JX0 A;  1GMM A;  4XUP A;  3PUI A;  4GWI A;  3T0D A;  4YPJ A;  3IAP A;  5CZK A;  4E8D A;  3K4Z A;  4CUB A;  3I2G A;  4ZXE A;  1NKG A;  3EB7 A;  2YB7 A;  1JZ3 A;  1I5P A;  4MOA A;  2BER A;  3T2Q A;  1W99 A;  4CU7 A;  1UWW A;  1GU3 A;  3OEA A;  3WNL A;  3LPF A;  1SG3 A;  3D3A A;  1BHG A;  1JHJ A;  5JXH A;  2Y6G A;  1JZ7 A;  1UY1 A;  2WAO A;  2VTF A;  1GOF A;  4A41 A;  2V72 A;  3DEC A;  2VZQ A;  3A23 A;  3MUY 1;  1H6X A;  4BK5 A;  1XPW A;  3PUH A;  4MAD A;  2ORX A;  4QB6 A;  3WNP A;  2VQT A;  5B4X A;  1UX7 A;  3OGS A;  3HPN A;  2W1Q A;  2CDO A;  4CVU A;  3ABZ A;  4OUE A;  1K42 A;  2VCC A;  2VME A;  2Y64 A;  4Z2A A;  4TXW A;  1SDD B;  2C26 A;  3WEZ A;  5F7U A;  1W8O A;  2B9V A;  1JYX A;  4DEV A;  2QBX A;  2WO1 A;  4QAW A;  2JD9 A;  2VR4 A;  3LQC A;  3F2Z A;  3HNM A;  4AAX A;  2ZEZ A;  3I2J A;  4XUN A;  4HG6 B;  2JE8 A;  2BGP A;  2VC9 A;  1JI6 A;  3GDB A;  3VD4 A;  2VJX A;  2E32 A;  2W92 A;  4W4Z A;  1K45 A;  2BBA A;  2J22 A;  5DPN A;  2Y8K A;  2JKX A;  3ACF A;  3WNK A;  1P8J A;  2W94 A;  2EIE A;  1OD3 A;  4A3Z A;  3T0B A;  3WQB A;  3SKV A;  1UXX X;  3CKH A;  2QQL A;  2VZU A;  5IHR A;  1XNT A;  4QX2 A;  4P00 B;  1J84 A;  4ZY9 A;  2VMD A;  1CZV A;  1NAE A;  3K4D A;  1EUT A;  2J1A A;  3GGL A;  1UMH A;  4MGQ A;  3BGA A;  3HNY M;  3EYP A;  3C7E A;  1GOG A;  5A1A A;  2VCA A;  3C7O A;  3WNM A;  1DP0 A;  2QQI A;  3MV0 1;  1W9W A;  4L0P A;  4FI9 A;  3A21 A;  2BZD A;  4XUO A;  1JYW A;  3CZJ A;  3NRU A;  1UMI A;  2HYX A;  4UAP A;  3CIH A;  4JKM A;  1WCQ A;  4D0Q A;  3ACH A;  1PMH X;  3ECQ A;  1L7Q A;  1UYZ A;  1HN1 A;  4QDQ A;  2W47 A;  2XON A;  1UXZ A;  1O59 A;  4XUT A;  1RYY A;  3I3B A;  1D7P M;  3GM8 A;  5LCW L;  1W0N A;  3K46 A;  2YG0 A;  1F4H A;  2V4V A;  3LEG A;  3T08 A;  2VMC A;  3VDC A;  2VZ1 A;  2X05 A;  4JKK A;  2R7E B;  2W5F A;  2E31 A;  2VZR A;  3E1F 1;  4D8M A;  3C7G A;  1PMJ X;  4DXT A;  4XUQ A;  5JUV A;  3P1I A;  3W5M A;  2J1T A;  4QB1 A;  1K3I A;  2Y6H A;  3THD A;  4QX3 A;  1CZT A;  3A7Q A;  1NUK A;  3WF2 A;  3OG2 A;  1XC6 A;  2RV9 A;  3LE0 A;  4OMD A;  4W8J A;  3THC A;  2ORZ A;  2J7M A;  2VO5 A;  2WYS A;  2JDA A;  1UY0 A;  2E26 A;  3WF3 A;  5JXG A;  2WN3 A;  4A4A A;  1W9T A;  1T2X A;  3OBA A;  2EID A;  5LA1 A;  1JZ4 A;  4QB2 A;  2YFU A;  1JZ5 A;  3WNN A;  3OEB A;  4PT6 A;  3P6B A;  2Y6L A;  3I2K A;  1YQ2 A;  3WF0 A;  1O8P A;  3DYO A;  1J83 A;  4UOJ A;  3JXS A;  1UYY A;  1EUU A;  2E33 A;  3FN9 A;  5G05 L;  4A44 A;  3I2I A;  2J1R A;  2WAB A;  4A45 A;  5I0D A;  2VZV A;  3DYM A;  1JU4 A;  4AG4 A;  3OGV A;  3VD7 A;  3CMG A;  4JKL A;  2ZEX A;  4XZU G;  3III A;  4ARX A;  4A6O A;  2VQU A;  2W1U A;  3VD5 A;  3K75 B;  4QX1 A;  1GUI A;  5CYY A;  3NNG A;  3UES A;  4PF1 A;  1CZS A;  5HXM A;  3WSO A;  4P5Y A;  1H6Y A;  5EIY B;  2RJ2 A;  4CUA A;  2WAA A;  3U37 A;  3CDZ B;  5IYY A;  3I2F A;  2VOT A;  1UZ0 A;  2DCJ A;  4LHS A;  4ET7 A;  3HOB A;  1WKY A;  1MPX A;  2J1U A;  3C7H A;  3I3E A;  5JXJ A;  5G04 L;  2QQN A;  4DUX A;  5IFT A;  4KWU A;  3VD9 A;  3LPG A;  3FL7 A;  5IJR A;  3MBW A;  1L7R A;  2W87 A;  4QPW A;  3SEP A;  3K4A A;  3LEK A;  2QQO A;  5LA2 A;  4OZO A;  1F4A A;  1SHW B;  5JMO A;  4XUR A;  3SKJ E;  1OH4 A;  3T2P A;  4DEQ A;  2B4K A;  4RYD A;  2EIC A;  1KGY A;  3HN3 A;  2ZEY A;  2WN2 A;  3LEI A;  3C8X A;  3WNO A;  2XOM A;  3A22 A;  2WUH A;  2VM9 A;  4CU8 A;  4IUG A;  3DYP A;  3I2H A;  2QQM A;  2VZ3 A;  1UY4 A;  1ULP A;  2RVA A;  1UYX A;  2VZO A;  2WO3 A;  2WDB A;  2W95 A;  4CU9 A;  1OF3 A;  3CQO A;  2X10 A;  4BXS V;  5EJZ B;  4LKS A;  4CUC A;  3T2O A;  1JU3 A;  1XNA A;  2YFZ A;  4OYU A;  2Z4F A;  1JZ8 A;  4P02 B;  1GNY A;  3ETP A;  4BDV B;  4KMQ A;  4RN5 A;  1GOH A;  1KEX A;  2ZXQ A;  5JR2 A;  5B4N A;  4A42 A;  2ZEW A;  4PQQ A;  3MV1 1;  3CZU A;  3FHQ A;  1W8N A;  3ACI A;  3VDB A;  1GQP A;  3HEI A;  2V5D A;  2HLE A;  2C4X A;  1ULO A;  3HNB M;  2L9L A;  2J1V A;  5FUI A;  3W5N A;  1UY2 A;  2W1W A;  2QQJ A;  4GZ9 A;  2W3J A;  2KD7 A;  2DCK A;  2WQ8 A;  5LA0 A;  2YC4 A;  5HPO A;  3SEE A;  3ZM8 A; 
#chains in the Genus database with same CATH topology
 1FAY A;  3OD0 A;  4HON A;  4MGI E;  4XBN A;  4LKF A;  1CR7 A;  3A0N A;  3NNF A;  2VZT A;  4FPF A;  1R1Z A;  3ACG A;  3O7O A;  3RJ2 X;  3N9L A;  3PU3 A;  3BPS A;  1E5H A;  3ZSJ A;  4DPN A;  2WWU A;  4FXG B;  4AOC A;  5F2W A;  1OOP C;  2ET7 A;  4IE6 A;  1RUH 1;  2RM2 2;  3LDB A;  4UF0 B;  2D5F A;  2XBO 2;  4M0N A;  3TN9 1;  1G9D A;  2E6V A;  1O7F A;  3POS A;  2D3R A;  1PGW 1;  3IB3 A;  1UKG A;  4OMC A;  1B35 B;  1D2S A;  4BME A;  3H50 A;  2JIC A;  3J8F 1;  2O1Q A;  1AYN 2;  5C70 A;  3NKT A;  2EIB A;  4BIF A;  4OI1 A;  1PVC 3;  3AMM A;  4GH4 A;  5DDJ 2;  1LGN A;  1Q5O A;  1W04 A;  1ZBA 3;  1DGL A;  2VZS A;  4FFI A;  5BNO A;  1ZZ8 A;  3H42 B;  2JEM A;  4Y22 A;  3S6P A;  4LQR A;  1YLL A;  2ET1 A;  2PMW B;  1RJ7 A;  2Q8O A;  3RZL A;  1UPI A;  2XLA A;  1NZI A;  1CX1 A;  1AXZ A;  1W9S A;  3D8C A;  4O7X A;  2GU9 A;  1AL2 2;  3EHK A;  3J7L A;  4TTG A;  3AJY A;  3OGR A;  1W9F A;  2CV6 A;  4P9G A;  3SCH A;  4AQS A;  1NT0 A;  1XOY A;  2VNV A;  1FV2 A;  2BUK A;  2WZ8 A;  4MVT A;  4CCJ A;  1JYV A;  1CGP A;  4O9E A;  2BGO A;  5GLV A;  3S30 A;  1RUN A;  2D6P A;  3LIH A;  1LUL A;  2BYV E;  3I97 A;  4AVC A;  4DQA A;  2WRA A;  4CCO A;  1SLL A;  1LRH A;  1S0G A;  3FLT A;  4NAO A;  1DF0 A;  4XMI A;  3FHA A;  3E97 A;  3VBS A;  1DHK B;  5CEH A;  4HMZ A;  3URF A;  3MI8 A;  1H2N A;  5FY9 A;  3ZYR A;  4MGS A;  1W8Z A;  5CB7 A;  1DLC A;  4M4P A;  3AZY A;  1WMF A;  5JLV A;  5D8A B;  2HWF 3;  3IPV A;  1G9C A;  1OQE A;  2F4L A;  4XDQ A;  4EV0 A;  3FZ3 A;  3HQX A;  2ZCW A;  2RG4 A;  3HT1 A;  4O61 A;  1S0F A;  2OUJ A;  1HW5 A;  5LBB A;  5J36 A;  2GC1 A;  1W39 A;  1W8H A;  4LA3 A;  1QJY 2;  3LD8 A;  5HI0 A;  2WO2 A;  4N43 B;  4N7U A;  4OFG A;  1LGC A;  2HWD 1;  2A71 A;  4Q4W 3;  2WSV A;  4I0W B;  4J1W A;  3TRS B;  2NQY A;  3QD6 A;  1NA1 B;  1QQP 3;  2A6Y A;  2DU0 A;  3VKF C;  1MS5 A;  5BNN A;  4H7L A;  3WUD A;  5AFB A;  4MH0 E;  2PHD A;  4MO3 M;  3UNP A;  1RVF 3;  4OQ8 A;  3CL1 A;  4XFB A;  2XJT A;  4IW3 A;  4DUV A;  1Y7B A;  3KV6 A;  4Z2W A;  1BEV 3;  2Y34 A;  3EJK A;  4NRQ A;  5FY5 A;  1SLA A;  4Q4Y 3;  1IQD C;  4QKD A;  4QU2 A;  3RG0 A;  1QF3 A;  2ZZJ A;  2VH9 A;  4YG6 A;  1ALY A;  3BTX A;  2GNM A;  2DDU A;  1PM7 A;  2VL4 A;  5KHH A;  1DQ0 A;  5IVF A;  5IFP A;  1C5I A;  2JX9 A;  5FOJ B;  1GMM A;  4XBL A;  4MXW B;  4M3C A;  5BXX A;  3RFR A;  3PUI A;  2WIN B;  5KBF A;  3T0D A;  3CU7 A;  2PXJ A;  2D93 A;  3M2M A;  4XTP A;  2ZHK A;  4E8D A;  1OLQ A;  4YZ2 A;  3U4X A;  3K4Z A;  3KF5 A;  4HSJ A;  4BIO A;  2WNU B;  2XH6 A;  4JC1 A;  4A2U A;  1NKG A;  3SQO A;  4J25 A;  3O5S A;  3WLU A;  4QXK A;  2RDS A;  2ZAC A;  2D44 A;  4B1M A;  5JZG C;  1NCQ A;  4LIT A;  5B2G B;  4MOA A;  2E9Q A;  1C5H A;  1AR6 3;  4KU7 A;  3T2Q A;  2EAL A;  2QQW A;  2PTM A;  2EXH A;  3BAL A;  5D8A C;  3Q8A A;  2XLG A;  1LKN A;  3DCQ A;  3EQE A;  3WZ1 A;  1U5Z A;  5C3R A;  2JDP A;  3FBY A;  1LHO A;  1XE7 A;  5C4W A;  4ASK A;  1AR8 2;  2ZHN A;  4C90 A;  5JXH A;  1NQJ A;  1QGL A;  1VBC 2;  1W2U A;  4N43 C;  3VBH A;  1K5M C;  2JDN A;  4IGQ A;  2I07 B;  1DFQ A;  5L19 A;  1NA1 C;  2D3S A;  5KXE A;  1DG6 A;  3N9M A;  4NPM A;  2VTF A;  1JBC A;  1S0D A;  3DEC A;  1QIQ A;  2GP5 A;  4R9A A;  2JWP A;  1OKQ A;  1BXH A;  3JCI A;  3M3C A;  4JRA A;  1HXS 1;  3A23 A;  3C3V A;  3TN9 3;  1GKB A;  4UFH A;  4DO0 A;  4CUG A;  2BBV A;  3ASI A;  5DAQ A;  2HKX A;  5J3U A;  1H6X A;  5SV8 A;  4BK5 A;  4DIQ A;  2VD7 A;  2D97 A;  4B1L A;  2ORX A;  2VQT A;  4Q4V 2;  2YRO A;  3GBF A;  4MYE A;  4XC9 A;  3OGS A;  1LR5 A;  3HPN A;  1TMF 2;  2W1Q A;  1MEC 1;  2CDO A;  3BTY A;  1ASJ 2;  3ORJ A;  5JAX A;  3ABZ A;  1V0A A;  4NPR A;  1WCK A;  3CHX A;  1QXP A;  3ZYB A;  1WMX A;  1NLR A;  1C3H A;  5LBE A;  5F3G A;  1VAV A;  2ZGS A;  3VBR B;  5D2A A;  3T4H B;  2E53 A;  1RUD 3;  1CX4 A;  3NW4 A;  1MQT C;  2B9V A;  2WO7 A;  4G3Y C;  3WQ7 A;  5A1F A;  4R9B A;  4ZXK A;  5J96 B;  2A6V A;  5LK7 B;  5GJ6 A;  2WS9 2;  4J6G A;  2B39 A;  4IV3 A;  4Q8K A;  2VR4 A;  4GWN A;  5L73 A;  2G9G A;  4IGP A;  2HEV F;  3AL5 A;  4UFI A;  2FDG A;  3OTF A;  2GH2 A;  2GC3 A;  5EJ3 A;  1ZBE 1;  3M3O A;  1UN1 A;  2FBE A;  4HG6 B;  3WVJ A;  4BQ5 A;  4JDN A;  3M4F A;  5LW9 A;  1Q8P A;  1I6X A;  2FDI A;  2VC9 A;  3LWC A;  4QU1 A;  5FYV A;  4BE3 A;  4E4H A;  2VJX A;  1BZW A;  5F39 A;  5A32 A;  3VD4 A;  4RGK A;  1HB1 A;  2IVI B;  4CP9 B;  5C3S A;  4NHK A;  4M0H A;  2VAU A;  3CF6 E;  1GZW B;  2JKX A;  1Y3T A;  1CVN A;  2R49 A;  3POI A;  3KZ4 C;  2LRO A;  3KSC A;  4QPY A;  4CDX A;  3WNK A;  5A1L A;  3I3Q A;  1J58 A;  2AYH A;  3NL1 A;  3OUI A;  4P9W A;  5EP9 A;  5FLJ A;  4OQ9 A;  2W94 A;  2EIE A;  4GD4 A;  3POG A;  2PHT A;  2X5I A;  2OZ6 A;  2RHP A;  1J1L A;  2ZKN A;  1UXX X;  2VMG A;  2QQL A;  3CKH A;  3VKL A;  5IHR A;  4AR2 A;  4ZS2 A;  2ZZQ A;  1PGL 1;  2VMD A;  1CZV A;  2JG9 B;  3I4I A;  2HWD 3;  1PVC 2;  1H30 A;  5K8S A;  1EUT A;  2JDK A;  5FP3 A;  1FAT A;  2X8K A;  5JIU A;  4OVE A;  1BMV 2;  1WZX A;  4YM0 A;  3EYP A;  3C7E A;  3U78 A;  1VB2 A;  4AI0 A;  3DKW A;  2VQA A;  2UY8 A;  3MLK A;  5DAX A;  3VBR C;  2ZGL A;  3P3N A;  2ZGK A;  1EV1 2;  1TME 2;  1NXM A;  1VB4 A;  1CJP A;  1W9W A;  3HQR A;  1V6J A;  3WP5 A;  2BZD A;  4XUO A;  1ZZ6 A;  3NRU A;  4QGM A;  4EJR A;  5AFE A;  5J37 A;  2YGM A;  3ACH A;  1ZNP A;  4N9H A;  3S57 A;  3B94 A;  3O0X A;  5C71 A;  1W6P B;  2W47 A;  1DQ6 A;  2QCS B;  2XON A;  2VMH A;  1O59 A;  1RYY A;  3QCW A;  1D7P M;  3K46 A;  3Q8F A;  2Q1Z B;  4NO4 A;  4D94 A;  3D82 A;  1VAK A;  3LEG A;  1FPN 1;  2KM2 A;  3JQW A;  2XQR A;  2GMM A;  2P4E A;  2YU2 A;  5ABJ B;  4HPK A;  4UFL A;  2X05 A;  3CJI C;  2E31 A;  2VZR A;  4CEW B;  2B45 X;  3E1F 1;  3CLP A;  4IEY A;  2HWF 2;  4XET A;  3SCG A;  4DXT A;  5L7O C;  5EHD A;  5HCF A;  2A70 A;  5C5U A;  1R1A 1;  2J1T A;  5IUQ A;  4FTS A;  4QB1 A;  1CAX B;  5FMB A;  1POQ A;  1O3S A;  1K3I A;  3THD A;  2GDF A;  1BJQ A;  3E5U A;  5A80 A;  5FP7 A;  3VZM A;  4AI8 A;  1GWK A;  5GZC A;  1XC6 A;  3H1W A;  3MIB A;  2RV9 A;  4LK6 A;  1VRB A;  5FZ6 A;  1FOD 2;  2Y26 A;  1QQP 2;  1B35 A;  1KQR A;  1OPO A;  4XFF A;  1OH3 A;  3THC A;  2J7M A;  5JOX A;  1RVF 2;  4LO5 B;  3W21 A;  1UY0 A;  2E26 A;  1BEV 2;  4NAM A;  2VUD A;  3ZYG A;  1FX5 A;  1PHM A;  2CHH A;  1HB2 A;  3CEW A;  2Y0I A;  4X8N A;  5FYT A;  4EN6 B;  5KWR A;  1D4M 3;  2Y33 A;  4RQP A;  5CU1 A;  2Z79 A;  4QPG C;  2VOW A;  3M3E A;  5F6K A;  1UF2 C;  4NII A;  4AVV A;  2C6S A;  5FY4 A;  5LA1 A;  2FD8 A;  3QOP A;  4MSV A;  4QKN A;  1JZ4 A;  2PAM A;  1MEC 3;  5AVP A;  1DZR A;  1O4T A;  1RXG A;  3LF7 A;  1X9T A;  2XML A;  2NPI A;  1YI9 A;  2Y6L A;  3I2K A;  1QJX 1;  4P9L A;  4YG3 A;  3WF0 A;  3ILR A;  2GC0 A;  4XZP A;  2Q8C A;  1AL2 1;  2BP6 A;  4UOJ A;  2ZAA A;  2QFE A;  4JGY C;  5G05 L;  3AB0 A;  3TWI A;  4XPV A;  3I2I A;  2IXL A;  2J1R A;  1AR6 2;  3RZH A;  1YCI A;  3MFA A;  2YBS A;  4CP0 A;  3ZFE B;  1RUJ 3;  2E7T A;  4CEW C;  3RQ0 A;  3ZIW A;  3AKR A;  3CMG A;  5A7S A;  1FYU A;  4XZU G;  1YIF A;  3K48 A;  3N3H A;  4GJZ A;  4Y1U A;  5E6H A;  5FPV A;  2D5H A;  5LBC A;  5D8A A;  4E4Z A;  1Q56 A;  4XFI A;  4A6O A;  1RGS A;  3AYA A;  4LHN A;  4NRO A;  1ZA4 A;  2JD4 A;  3JQX A;  2DFC A;  3N35 A;  1AR7 1;  2R6Q A;  3AP6 A;  4LNV A;  3HAG A;  1IS5 A;  1IKP A;  4AI1 A;  4AGV A;  3OYW B;  1REF A;  1XBF A;  4XF4 A;  3WHT A;  1LOE A;  2O8O A;  3ZN6 B;  2B5H A;  1RUH 2;  3MF6 A;  4FPC A;  1NA1 A;  3H1Y A;  1QOT A;  2R1D A;  5FZM A;  3TN9 2;  2PEL A;  1H6Y A;  1PNF A;  4CUA A;  1PMI A;  4IV1 B;  1R09 1;  1HN0 A;  1LHU A;  3CDZ B;  5EIY B;  2ZGU A;  1PGW 2;  1MS0 A;  3POJ A;  2DCJ A;  1Q8O A;  4BZ4 A;  1MPX A;  4L2N A;  4OHV A;  5FP8 A;  2FDJ A;  3J8F 2;  4BQ3 A;  5L9B A;  1QH7 A;  4EE2 A;  5FOB B;  4ISQ A;  4YFW A;  5F3I A;  3I3E A;  5A7W B;  2CWS A;  5A3W A;  1BBT 1;  5T5O A;  3VBF A;  2XG3 A;  3HT2 A;  3Q8C A;  3MIH A;  2ADE A;  1ND3 B;  2HBT A;  2OUH A;  3H9A A;  4PLO A;  4DUX A;  1WLT A;  4HK8 A;  5IFT A;  1Q8V A;  4JQT A;  1UW8 A;  3FL7 A;  4MXW A;  3WCR A;  2VCM A;  5IJR A;  5KHG A;  3ZPY A;  5CG8 A;  4H2A A;  1QU0 A;  4I01 A;  2DCT A;  2IZW A;  2AAC A;  3K2O A;  5JMO A;  2IXI A;  2WNU A;  3VBU B;  3THT A;  4XTM A;  4JGZ B;  5FYY A;  4LO7 A;  1G6N A;  1OH4 A;  4WM7 C;  3WQ0 A;  3ZXG A;  3O1R A;  1AJO A;  1WW4 A;  2G1M A;  4CTE A;  4NUB A;  2EIC A;  5EPA A;  4LE3 A;  5JMC A;  3VDD B;  1U0A A;  5KXC A;  2K0G A;  2P1B A;  3PVO A;  3ZDV A;  3HN3 A;  1FPN 3;  2WN2 A;  2DVF A;  3LEI A;  1Z7S 3;  4YAR A;  1LOG A;  3C8X A;  4GMP 1;  2VW1 A;  3KHC A;  4FT8 A;  2BWA A;  3PNA A;  3TEY A;  1OA2 A;  4DY5 A;  1W9Y A;  5L9V A;  4Q4X 1;  5KC6 A;  3UYJ A;  3WG1 A;  4QPI A;  3ZXA C;  3BUC A;  4MG2 A;  1R1A 3;  2FMD A;  3B00 A;  4YZ1 A;  4UWD A;  2VZO A;  5JDB A;  2UY9 A;  2W95 A;  2OW4 A;  1YI7 A;  2WDB A;  1KJR A;  2G4I A;  1DDL A;  1OF3 A;  5EJZ B;  4IEQ A;  5A7Q A;  4XAE A;  1YQ6 A;  2HWD 2;  4JAA A;  1YQ8 A;  3BTZ A;  2PN5 A;  4JVA A;  4UT5 A;  5FLH A;  2E51 A;  4AZZ A;  1ND3 C;  5FTT C;  5GLW A;  4RN5 A;  3BB6 A;  3O14 A;  1COV 1;  1GOH A;  1UX6 A;  4TZD A;  2EAK A;  5D21 A;  4L11 A;  3JB8 A;  1HJG A;  2A6Z A;  3VHP A;  1SEF A;  4FPH A;  4PQQ A;  4NHX A;  3I54 A;  3VBR A;  3PUS A;  4BCU A;  1N1V A;  4RS5 B;  3AXE A;  5FZE A;  3SXW A;  1KIT A;  1TE1 B;  4YVW C;  2V5D A;  1YRZ A;  4OI2 A;  3T3Y A;  2GAU A;  1RIR A;  5JVV A;  2HLE A;  5FY1 A;  4ZHN A;  3H1M A;  3V64 A;  5C8C B;  2JDM A;  1XE8 A;  4ERO A;  4RD7 A;  1QJX 3;  2W1W A;  3LAG A;  4IES A;  5CNA A;  2DF7 A;  2DVG A;  4LOT A;  3VHO A;  3Q8B A;  4Y4R A;  3TEZ A;  4GWM A;  2KD7 A;  2WQ8 A;  3WUC A;  4XFG A;  4YNI A;  1QJU 1;  2HWC 1;  4Z07 A;  5IAV A;  5LA0 A;  3M3Q A;  3SEE A;  1ACC A;  2QQV A;  4QX0 A;  4YGE A;  2BTV C;  4CDW B;  4KBB A;  3R0R A;  5IVY A;  2GMP A;  4R4X A;  1FV3 A;  1OA3 A;  1OBN A;  1O3R A;  1VJ2 A;  2PHL A;  4JDM A;  3B01 A;  3OJB A;  4NE9 A;  4LUM A;  2V09 A;  3ST7 A;  1Q3E A;  2X09 A;  3WG4 A;  5HBA A;  1WD3 A;  4MGT A;  1LCL A;  3IZO A;  1R64 A;  1YXW A;  3S5Q A;  1AR7 3;  1LNS A;  1ULE A;  1JN2 P;  5A6Z A;  4QDS A;  3KHB A;  1S1A A;  3N7L A;  5JR7 B;  3USU B;  5GAL A;  4BK4 A;  3MPP G;  3R4D B;  4NVP A;  3NJY A;  1LOF A;  1OF4 A;  2JG9 A;  1VRH 1;  2VMF A;  4AK3 A;  2A73 B;  4M4R A;  1HXS 2;  3AMQ A;  3VZO A;  4URA A;  1NX9 A;  2WSU A;  2QDR A;  3NJX A;  3O1M A;  1CIY A;  1L7L A;  2BJS A;  5TSW A;  5DAP A;  5J1X A;  2FZ2 A;  5FXZ A;  4EN9 B;  5DMY A;  2VW2 A;  4W6Y A;  1ZBA 1;  4GQ7 A;  1PX3 A;  1HRV 1;  3A0K A;  4UBH A;  3O1V A;  1MEC 2;  2BU9 A;  4KG8 A;  4LOS A;  5KXB A;  4FAG A;  1IKQ A;  4XFC A;  4Q8L A;  2RE9 A;  4XQD A;  1EAH 3;  1W6M B;  2VCB A;  2J1E A;  4MXV A;  3AC0 A;  4Q26 A;  3JUU A;  3VB9 A;  3WW1 A;  2CNA A;  2FMY A;  4BJ0 A;  4EZ4 A;  1NE6 A;  2ID4 A;  4XDP A;  1TG7 A;  3VKN A;  4RFR B;  5C9A B;  1KXG A;  1W6P A;  1T6G C;  4LBM A;  4IEO A;  5A7N A;  2BNN A;  4Q27 A;  1JXN A;  1R08 1;  5FZ4 A;  5CFD C;  4FOV A;  2WA3 A;  5DN2 A;  1APN A;  4D6S A;  1US3 A;  3J7N A;  1NY7 1;  4DXS A;  5H9P A;  3WF3 A;  2DTW A;  5ABJ A;  1O8S A;  4PI2 A;  4Z82 A;  3SH3 A;  1POV 0;  3J7H A;  1XNB A;  3D4K A;  4ES8 A;  1A8M A;  3I3D A;  3WIN E;  3PLQ A;  4FPO B;  2W91 A;  5FXV A;  1J3P A;  1S2B A;  2VOV A;  1CAX A;  3I2O A;  3GF6 A;  2HWF 1;  1LB2 A;  1DQ2 A;  5DZE A;  2JIJ A;  4GMP 3;  1JYN A;  2DVA A;  4LIU A;  2WBK A;  4AEJ A;  3KB5 A;  2ZX2 A;  4QHB A;  2CDP A;  2W9X A;  4Q4X 3;  4FO9 A;  3ALQ A;  4EWA A;  1IS3 A;  4MZU A;  1GBG A;  3ENR A;  3FBM A;  3PL0 A;  1WCS A;  2Q0A A;  4Q4W 1;  3UGH A;  4JRL A;  2QQP A;  3FLP A;  3WF1 A;  1F15 A;  1VPH A;  4LO8 A;  5FJK A;  3QH6 A;  4HT1 T;  1PGL 2;  4CDU C;  1OOP B;  1QJF A;  4KI5 M;  3ZX7 A;  1LU1 A;  4M3C F;  4DNY A;  3MF9 A;  3HWJ A;  1YNA A;  4Q4Y 1;  4YVS B;  3V65 A;  1PX4 A;  5EV7 A;  5I8Y A;  2SBA A;  3OBT A;  1COV 3;  5FYM A;  4IEV A;  4XUP A;  2GC2 A;  3OBZ A;  2A6W A;  4GWI A;  3HIF A;  5FZI A;  5C9A C;  5F2S A;  3ZKU A;  3IAP A;  5CZK A;  5C3P A;  1VMH A;  5FLI A;  1JHN A;  3BCW A;  4A7Y A;  4OHZ A;  2ZA9 A;  2XKP A;  4COZ A;  4AHY A;  1M06 G;  4W6W A;  1S2E A;  3O1O A;  2D43 A;  1BK1 A;  3WT3 A;  5IVE A;  4AEM A;  5K9Y A;  3SNM A;  3ZFE A;  1U5I A;  1VBB 1;  1W99 A;  2PA7 A;  4LKE A;  3GNE A;  5HV4 A;  2B9U A;  5BNP C;  5CG9 A;  4CCM A;  1KDK A;  1WA4 A;  3I49 A;  1FPN 2;  3WNL A;  1AR6 1;  3U07 A;  3W58 A;  1I5Z A;  4FOW A;  5D1I A;  1SG3 A;  1SFN A;  1WME A;  3GCW A;  4R9C A;  1GR3 A;  2IFW A;  1QJU 3;  4Q5O A;  1W8T A;  3VBO C;  1JHJ A;  4QKB A;  5FZD A;  2PFW A;  2FQP A;  4FQZ A;  2R0F A;  4GA9 A;  2RR1 1;  4ASL A;  1UZY A;  2WAO A;  2ZGO A;  4JCK A;  4RR3 C;  2W08 A;  1R1A 2;  3OYW A;  3P3P A;  1WUV A;  4Q0V A;  4XF1 A;  3WDU A;  5A3U A;  2EAA A;  4XMA A;  4ORF A;  2W52 A;  3ZN6 A;  5FMO S;  1DCS A;  1PIV 1;  4CPB D;  4WM8 C;  3L9J T;  4PJY A;  4IV1 A;  5F6L B;  2WJS A;  2ZHM A;  1XPW A;  1JUH A;  4MAD A;  2RMU 3;  1VBE 1;  5A7W A;  2VG9 A;  4YVS C;  1TNR A;  1VRH 3;  3AXD A;  3RMX A;  4CVU A;  3N9Q A;  1GZT A;  4GUL A;  1ND3 A;  1IS4 A;  4OUE A;  2HYK A;  1WCU A;  4BYY A;  5CVR A;  1K42 A;  4RGA A;  3ZXJ A;  4FP2 A;  2VCC A;  2AEN A;  4MV2 A;  1PZ7 A;  3JD7 1;  1OKO A;  4QHZ A;  1SDD B;  5FJH A;  4PBP A;  3WEZ A;  2EIG A;  1HRV 3;  4ATE A;  2JJ6 A;  3KGL A;  4LBQ A;  5LAT A;  4DEV A;  2QBX A;  4WVV A;  2R06 1;  4ATF A;  1RUD 1;  3N4M A;  3VBU A;  1IOA A;  4UXA A;  3I3M A;  1C1F A;  5FPL A;  3U1X A;  1QJX 2;  1ZRF A;  4JGZ A;  3K3N A;  3F2Z A;  5GZF A;  1DLL A;  4YW4 A;  5APA A;  4Z92 B;  5J09 A;  4QX7 A;  3LB9 A;  1ZZ9 A;  1UYP A;  1R08 3;  3VDD A;  1NLS A;  3EXU A;  2Q1M A;  1VBA 1;  2XJQ A;  4WBB A;  1LES A;  1JI6 A;  4EQV A;  3GDB A;  4YW6 A;  4XAA A;  4XBQ A;  4BOW A;  4F7Z A;  2W92 A;  4FTE A;  4LUL A;  3ZR6 A;  1V6L A;  1AVB A;  2ZHL A;  3I8T A;  4UFK A;  5DUW A;  4YYO A;  3WV6 A;  4XXP A;  3RVH A;  3W20 A;  4Y1Z A;  5IK4 A;  1C4R A;  5JZG B;  4D7Y A;  5EZW A;  4IE0 A;  3NV4 A;  1AR7 2;  3DN7 A;  1DQ5 A;  4NRM A;  1O3Q A;  1GLH A;  4HAN A;  3WQB A;  2WWJ A;  2NMO A;  2CU5 A;  1EPW A;  1LU2 A;  3F95 A;  1BVP 1;  4QM8 A;  2VZU A;  5FUN A;  2QDN A;  1XNT A;  4CP2 A;  1WW7 A;  3AZV A;  1J84 A;  2A3W A;  2RDQ A;  3K4D A;  3LFI A;  4DB5 A;  3ZR5 A;  1RL3 A;  4IE5 A;  4Q0Q A;  2OQ6 A;  1C8N A;  4L8Q A;  1UMH A;  3BU0 A;  1R09 2;  3HNY M;  2WT1 A;  5T3N A;  1NCR B;  3GZA A;  1K5M B;  3IWZ A;  5EQU A;  2BFU S;  5IT6 A;  5T55 A;  3ILF A;  1DP0 A;  1N1T A;  2QQI A;  3GJA A;  3IKW A;  2JKB A;  2ATF A;  1BBT 2;  2JB8 A;  4O65 A;  5K4L A;  2NP0 A;  3O12 A;  3CZJ A;  3HMY A;  4LT5 A;  5IAT A;  4RS5 A;  3C2U A;  3KLS A;  2RS3 1;  4JKM A;  4UAP A;  2OII A;  4D0Q A;  1AJK A;  1YC6 1;  4A3X A;  3BI3 A;  4EYU A;  2GH8 A;  1PMH X;  2JG8 C;  4YW5 A;  1POV 1;  1UYZ A;  4FFG A;  1IPK A;  4CP1 A;  1FI2 A;  2NYY A;  2VTX J;  5C8C A;  1TZO A;  2EXI A;  1W3X A;  4H7M A;  4K8R B;  2GP3 A;  1F4H A;  1OLR A;  1YQC A;  3KV4 A;  2VMC A;  4QX5 A;  3RGB A;  2GNT A;  4NWV A;  3B69 A;  1STM A;  2GN3 A;  5KXD A;  3AZX A;  4JKK A;  3OPW A;  5T54 A;  1D4V B;  1JOJ A;  1MQT B;  4AW7 A;  3THP A;  1ND2 C;  1VBB 3;  1S0C A;  3HVD A;  4CDW A;  5IVC A;  3C7G A;  4UW4 A;  4XUQ A;  5JUV A;  4EN7 B;  3MIE A;  4FXK B;  2P3Y A;  3ZFF B;  1F8V A;  4NIA A;  4NIG A;  4EWE A;  1TQ5 A;  4WVM B;  5FCC A;  2ZX4 A;  1XSQ A;  2A6X A;  2IFR A;  2XJR A;  1CN1 A;  4HLT A;  2Y6H A;  4UBG A;  3AP4 A;  5I91 A;  4I3P A;  1OFS A;  3LSE A;  4P9J A;  2VVD A;  1DGW A;  4XIK A;  5FPB A;  3OG2 A;  4PLM A;  2RR1 3;  3D0J A;  4Q4X 2;  1VLN A;  1UMZ A;  5GZD A;  1AXY A;  2VO5 A;  4LLO A;  1FMD 1;  2JDH A;  1NE4 A;  2P3I A;  2UYB A;  1NCR C;  3AFG A;  3LZZ A;  3PJY A;  4PI0 A;  3ZYI B;  1PIV 3;  5ACA 1;  1ZRI A;  1ULD A;  4A4A A;  4KL1 A;  4PLN A;  2Z5W A;  1GNH A;  3DPR C;  5FZO B;  1GZ9 A;  1QKQ A;  3ZXL A;  1MR5 A;  2FCT A;  2O14 A;  1W9T A;  3H8X A;  3RWN A;  1VBE 3;  1H1I A;  3UKT A;  4PDW B;  1D4M 1;  5LRR A;  2G9Z A;  1COV 2;  4LHL A;  1J3Q A;  4QB2 A;  1JZ5 A;  3OUH A;  4N53 B;  1AYM 1;  1KFX L;  4OZX A;  4PT6 A;  1LOB A;  3V56 A;  1N1S A;  1W6M A;  1XXN A;  4FFF A;  4LBL A;  2BDR A;  3P6B A;  4LBJ A;  1YQ2 A;  2ETE A;  4NMI A;  3JD7 3;  1O8P A;  2YGL A;  5E16 A;  1LAJ A;  1C8M 1;  2XJU A;  3TBD A;  4BQ1 A;  1V9U 1;  1LEC A;  1KS5 A;  1UYY A;  2Q5T A;  2WT0 A;  2XB6 C;  2ZX1 A;  4LO6 B;  1W03 A;  4N7I A;  3RWK X;  5A7P A;  1PZ8 A;  2R06 3;  2WII B;  2VTX A;  2WAB A;  2G9F A;  5BY5 A;  2VZV A;  4MGY E;  3HQU A;  4V2V A;  4YM3 A;  1UCX A;  4ISR A;  2LUW A;  3OGV A;  2CY6 A;  2JDY A;  4FPG A;  3RI9 A;  3WW3 A;  1QOO A;  3ZFF C;  1RUJ 1;  1QJU 2;  2HWC 2;  2QKD A;  4HZF A;  2Q1F A;  1FNZ A;  4CEY A;  1G86 A;  1MVE A;  1QNW A;  4K9S A;  1VBA 3;  1JOB A;  3K75 B;  1MS4 A;  4QX1 A;  1GUI A;  5CYY A;  3CBN A;  5FK8 A;  3ZOI A;  4CCL A;  4LBO A;  4YFZ A;  3UES A;  3O1T A;  5DXD A;  1E5S A;  1LOC A;  3AJZ A;  4YM1 A;  2UWB A;  5FYU A;  2P6C A;  2UYA A;  1YIP A;  3CJI B;  4P5Y A;  4RHV 3;  4L92 A;  4UW5 A;  1G7Y A;  1RXF A;  2YY1 A;  3ES1 A;  4LR4 A;  2RJ2 A;  2NZ9 A;  3FHI B;  2WAA A;  5L7O B;  4N90 A;  1ST8 A;  2VOT A;  1UZ0 A;  1XNC A;  4S2G A;  2NN8 A;  2R32 A;  3T4V A;  5IW0 A;  4QXB A;  3VV1 A;  3BTA A;  1VRH 2;  1OOP A;  3IDC B;  1X50 A;  5C3Q A;  4JZR A;  4PDW C;  5G04 L;  3TAY A;  5A6X A;  3AYE A;  4P14 A;  3NAP B;  4YVS A;  1MS9 A;  2P37 A;  4N53 C;  2C24 A;  4Y20 B;  1SFY A;  3VD9 A;  4BQ4 A;  3UJO A;  4UFJ A;  3AL6 A;  4AGR A;  2J42 A;  2OZJ A;  4XAC A;  1ZBA 2;  1YO8 A;  1NXD 1;  1VE0 A;  4QPW A;  1HRV 2;  3D6E A;  1OA4 A;  1F4A A;  3IN9 A;  1YHF A;  1SHW B;  2RJL A;  3M1H A;  2ZGQ A;  4HET A;  4Q1P A;  2XXZ A;  5C3O A;  2RS3 3;  5FZ7 A;  4XUR A;  4QPG B;  1POV 3;  1RUF 1;  1W2T A;  2B4K A;  5FZ8 A;  3PVB B;  5HCH A;  2V4A A;  2WNV C;  1R08 2;  1UOF A;  3KT4 A;  3MDP A;  3LA7 A;  4MUV A;  5FO7 B;  3O1U A;  3U75 A;  2ZEY A;  2WYF A;  1NY7 2;  4LBK A;  4PIX A;  2UU8 A;  3MGU A;  3E6B A;  3WNO A;  4CCK A;  1AX1 A;  2WUH A;  3KGZ A;  2D40 A;  4AHX A;  1RUC 1;  4CU8 A;  4LTA A;  1ZYB A;  3CJX A;  4HOO A;  1Z7S 1;  3KT1 A;  4JGY B;  4LKD A;  4UW3 A;  5CKM A;  5F37 A;  4IER A;  1IZ3 A;  1VBD 1;  1RUE 3;  5CFC B;  1UYX A;  2R04 1;  2VY0 A;  2WO3 A;  3SMH A;  4AI3 A;  5EWS A;  3X29 B;  3KD4 A;  4V2W A;  3CQO A;  4JV4 A;  3EMR A;  4AXO A;  4CCC A;  2YPJ A;  3OBR A;  1H0B A;  1MVQ A;  2PHX A;  3AMP A;  4LJH A;  3T2O A;  2ADD A;  3V0A B;  2VBP A;  2Z4F A;  4UF0 A;  1IG0 A;  1XRU A;  4IL7 A;  2WT2 A;  3NAP C;  1FMD 3;  4Q4W 2;  4IE4 A;  2Y60 A;  4BDV B;  4CDQ C;  2QZ3 A;  5FZL A;  5ACA 3;  3R6S A;  2KXL A;  2ARC A;  3ZKY A;  4AF9 A;  3E6C C;  2YU1 A;  4NRP A;  4XCA A;  4A42 A;  2XDV A;  2VBB A;  4QQO A;  2ZEW A;  4K21 A;  3I7D A;  2H0V A;  1SBD A;  3PMS A;  4DZG A;  5KHK A;  3JBG 1;  3CO2 A;  3G6J B;  4IET A;  1OVP A;  1UU5 A;  2DVD A;  4Q4Y 2;  1PK6 C;  5A3P A;  5IAX A;  4Y3O A;  5FQ0 B;  4I2O A;  4YGB A;  5T50 A;  3TNP B;  3UL2 A;  1SAC A;  1AYM 3;  1BLZ A;  3AM2 A;  4U36 A;  4C0B A;  2ZGT A;  1ULO A;  2WL1 A;  2J1V A;  4BMB A;  3BOD A;  4ZKT B;  1CAU B;  5FMO L;  5BUV A;  3OGJ A;  1C8M 3;  2MNG A;  2W3J A;  1X7N A;  1V9U 3;  4JTO A;  1ZZB A;  2C5D A;  5IVV A;  2C1F A;  1KS4 A;  2YC4 A;  4B4P A;  5HPO A;  5EYY A;  2W0X A;  3ZM8 A;  3WF4 A;  5JOY A;  1H1A A;  1VBB 2;  5GZG A;  4RGG A;  5ANN A;  5A6Q A;  3KV9 A;  4AWD A;  5FKC A;  1DYO A;  3IAQ A;  3H0O A;  2OQ7 A;  3A4U A;  5CFC C;  3RZZ A;  1JYT A;  2K46 A;  2XHN A;  3OB8 A;  4WM7 B;  2QQK A;  2ZML A;  4ZZ8 A;  5JZG A;  2E63 A;  3N7J A;  4EN8 B;  5H9R A;  4E9K A;  2H0B A;  3ZFG C;  3AKT A;  4K40 A;  1HRI 1;  1A6C A;  2RR1 2;  5JSP A;  4B29 A;  2PAE A;  1S2K A;  3N36 A;  4XYX A;  5E89 A;  3T0A A;  2LW8 A;  2CSG A;  4BLJ A;  3EBR A;  1A8D A;  3GZT B;  2CTV A;  2ARX A;  1PIV 2;  2DCY A;  5JCT A;  2CAV A;  1RMU 1;  3ZSL A;  1RIN A;  1SBF A;  3IDA A;  3LA3 A;  4N43 A;  1Y9Q A;  4B7E A;  1K5M A;  4DXR A;  2XPJ A;  1AL0 G;  4BLI A;  1JW6 A;  4XDO A;  3VDA A;  4IDZ A;  3RI8 A;  5FZ0 A;  1VBE 2;  2EVX A;  1SPP B;  3PTR B;  5FBZ A;  4QM9 A;  4COU A;  4FSJ A;  1MAC A;  3NV2 A;  4L9B A;  3RDI A;  2OT7 A;  5A3N A;  2BEO A;  1DGR A;  2XQX A;  1WBL A;  3BKZ A;  3LSD A;  2DWR A;  1US2 A;  3PDQ A;  4WZC A;  1XU2 A;  1YFX A;  3JD7 2;  3MO4 A;  4CE8 A;  4BQ2 A;  1O6U A;  3RNS A;  1V00 A;  2VXJ A;  3M7A A;  1AX2 A;  1EAH 1;  1UOB A;  1H4G A;  1BKZ A;  2V5Y A;  3BOW A;  3OCP A;  4ARY A;  5K0U C;  4D6Q A;  1CAV B;  3S0M A;  4CU6 A;  1AR9 3;  2J1S A;  4Y5T A;  2R06 2;  2F17 A;  4WVZ A;  1GWM A;  1PO2 3;  1MS3 A;  1Y4W A;  1RUD 2;  1QH6 A;  2Y6J A;  4XFH A;  2SLI A;  1YFY A;  5DQ0 A;  3ZLI A;  3K77 A;  4Q0P A;  2FDF A;  5C7G A;  2VQ0 A;  1XE0 A;  4FPY A;  3GZU C;  4ZS3 A;  2XR4 A;  1RUF 3;  4AED C;  4K8F A;  4KGQ A;  4YVW B;  1MQT A;  5FUP A;  3C7F A;  3GXU A;  5F5I A;  5T5L A;  4LHK A;  1LHW A;  1OUS A;  1GV9 A;  1Y43 B;  2BFU L;  4QXC A;  1CQ9 A;  5FZH A;  4AEK A;  1VBA 2;  4CPB A;  3B93 A;  2VPV A;  4WVM A;  5FXW A;  5FZG A;  5C5T A;  2C9K A;  4DRV A;  2WLP A;  1UY3 A;  5AC9 1;  1Y9M A;  2P34 A;  1KDM A;  3OPT A;  4JHZ A;  4LE4 A;  1RUC 3;  2MHF A;  5FP4 A;  4F83 A;  4R52 A;  4XIL A;  4CCN A;  2DCZ A;  4Y22 B;  4RHV 2;  5LEJ A;  3FMG A;  3H7Y A;  1VBD 3;  2IXK A;  2I74 A;  1LOA A;  2PQS A;  2R04 3;  5JXI A;  1PM4 A;  3GBG A;  2YYO A;  3INA A;  4W65 A;  3BPZ A;  4I30 A;  2ZMK A;  4XJ9 A;  3NMB A;  5FP9 A;  3IDE A;  1H4H A;  4R9D A;  4DUW A;  1K12 A;  3ZIX A;  2ZGR A;  3E6D A;  3LOI A;  3KVB A;  4LMF A;  1TVG A;  4AI9 A;  4FAH A;  4FPK A;  5FZO A;  4N8M A;  3NST A;  2HWB 3;  1OXC A;  3LFM A;  5LA9 A;  1QNY A;  4JX0 A;  4Z8B A;  2D6O X;  1HV0 A;  2BPA 2;  3DKQ A;  1HDK A;  1OI6 A;  3IIA A;  4NN0 A;  5FZ3 A;  2BGC A;  4YPJ A;  3USS A;  2H6B A;  1DYK A;  1O5U A;  1YFU A;  4DFS A;  3VBS B;  1OMI A;  1UNB A;  3JBG 3;  2RS3 2;  5T5P A;  3I2G A;  5LAS A;  4XJZ A;  4NPL A;  1H2L A;  4JQR A;  2E7A A;  5E88 A;  4OCT A;  1I5P A;  5FPA A;  1JZ3 A;  4RFT 0;  2D98 A;  1V6N A;  1YYN A;  5FYI A;  3PVE A;  1UWW A;  1GU3 A;  2WQZ C;  4CXW A;  3OEA A;  1CJD A;  1KFU L;  4XW3 A;  2XBO 3;  3D3A A;  4L99 A;  2HEW F;  1BHG A;  1W6N B;  4OHX A;  5F8P A;  5A33 B;  3WDW A;  3PUA A;  2WKK A;  1S0E A;  4GH4 C;  2HH9 A;  2Y6G A;  4LIV A;  2N7G A;  1UU4 A;  1UY1 A;  5BNO C;  4OUS A;  1GZC A;  3SIS A;  5CFD B;  3LDR A;  2Q8E A;  1JS9 A;  3AKP A;  3D5O A;  2XWJ B;  3W59 A;  3ZXE A;  3RYR A;  3ZN4 A;  4A41 A;  2V72 A;  3AZZ A;  2JXA A;  5LY2 A;  4CP9 A;  1BYH A;  2WQ4 A;  3CJI A;  2VZQ A;  4H3W A;  4IEZ A;  4PQ9 A;  5FRE A;  1GZW A;  3VKO A;  4AFC A;  5KC5 A;  5L7O A;  1HRI 3;  5IK8 A;  1HKD A;  3DGT A;  4XF3 A;  3POB A;  2FDK A;  3MUY 1;  1CPN A;  3R4S A;  3B9C A;  2ZGP A;  1FMD 2;  1JYC A;  5B4X A;  4Q0U A;  1VMJ A;  1QXJ A;  4YM2 A;  5ACA 2;  1HQN A;  3B7M A;  5FPU A;  3RYP A;  2RMU 1;  1RMU 3;  4NIH A;  2DBI A;  1U5X A;  2VVE A;  4DS0 A;  4V1P A;  1AUY A;  4Y20 A;  1CPM A;  4TWT A;  1C28 A;  2UWA A;  3J26 N;  1LHV A;  2VME A;  4Z2A A;  5JPN B;  3VBS C;  4TXW A;  4I3G A;  2C26 A;  1NCQ B;  4Y5Z 0;  1D4M 2;  1HB3 A;  4COV A;  1KD7 A;  1W8O A;  5CIR A;  5F7U A;  5J48 A;  2FCU A;  3APB A;  1AYM 2;  5FK7 A;  4AVT A;  4CDU B;  4UW6 A;  3ZYF A;  3MW2 A;  3POY A;  1S0B A;  1V6O A;  4QPG A;  3ROU A;  1NG0 A;  1E5I A;  2A1X A;  3BIW E;  1C8M 2;  1QWR A;  1WW5 A;  3HNM A;  4AAX A;  2AGS A;  4CXX A;  1V9U 2;  5C4W B;  5HCB A;  4B4R A;  1GWL A;  2QE3 A;  1G8W A;  3VBH B;  3LCP A;  3KQR A;  2XLF A;  5BNN C;  3SIT A;  1LGB A;  5F3C A;  4I0B A;  2DUO A;  4BWO A;  4Q2F A;  5F1R A;  3FFZ A;  4C8D A;  1N3Q A;  4X6Q B;  3CNA A;  5FZF A;  2YMZ A;  3LDK A;  2BBA A;  4QX8 A;  5DPN A;  2Y8K A;  1RUJ 2;  3ACF A;  4EN0 A;  1SZB A;  3AMN A;  1BK0 A;  1H2M A;  1I3H A;  4HXC A;  5DG2 A;  3OY8 B;  1EY2 A;  3AVR A;  3N7M A;  4JGY A;  1YJL A;  3UGG A;  5LY1 A;  1XND A;  1P8J A;  4CEW A;  5CFC A;  3NV1 A;  4XF9 A;  4KWK A;  5F5C A;  5C8W A;  5BNP B;  5HXV A;  5FZK A;  5AC9 3;  3WDY A;  4OUM A;  1JH5 A;  2VU9 A;  4QX2 A;  4ZY9 A;  3V0A A;  2WWS A;  3OUJ A;  3UK9 A;  3ZMO A;  2EXJ A;  3VBO B;  1W8U A;  1GP4 A;  4XF0 A;  3SH4 A;  2AUY A;  3UGF A;  3BGA A;  2DTY A;  1H8T B;  2K2S A;  1DQ4 A;  4H14 A;  1YUD A;  2GME A;  1GOG A;  3FFQ A;  4RR3 B;  4NJ4 A;  2B7Y A;  2DFB A;  2IXC A;  4FP3 A;  5A1A A;  3C7O A;  3WNM A;  4CCD A;  4QWN A;  3WXP A;  1E57 A;  1NCQ C;  3MV0 1;  1G9F A;  2Z2S B;  4IV3 B;  4WM8 B;  1BCX A;  2ZGM A;  2ARE A;  2HYX A;  2XVG A;  3CIH A;  5FQ0 A;  2WZR 3;  3R4U A;  2GAL A;  2WNE A;  2XJV A;  3ECQ A;  1L7Q A;  4WZF A;  1GQH A;  1HN1 A;  5BNQ A;  4K20 A;  5I0R A;  5GM0 A;  5C4W C;  1QJZ A;  3I3B A;  2YPD A;  5LCW L;  3PJQ A;  1CAU A;  4X6R B;  1F31 A;  1PO2 2;  2BWC A;  2YBK A;  4LO4 B;  3VBH C;  2YG0 A;  1JTZ X;  4YG0 A;  2Q8D A;  1VR3 A;  2A3X A;  3UV9 A;  3VDC A;  2VZ1 A;  1RUF 2;  2ZJC A;  5HCA A;  2W5F A;  4CA9 A;  5JSO A;  1W6O B;  4D8M A;  4Y1V A;  2BOJ A;  5I0U A;  4XOG A;  3VN4 A;  5A3L A;  1W3V A;  4XQW A;  4AQ6 A;  1D0G A;  1JOP A;  2O8Q A;  3P1I A;  1PGS A;  3UKV A;  5FIX A;  3W5M A;  3AKQ A;  4CCE A;  1LTE A;  3K3O A;  1O4Y A;  2B42 B;  3WY6 A;  2YBP A;  4WM7 A;  4Q1R A;  3ZN5 A;  4FFH A;  4QKF A;  1RUC 2;  4PCR A;  1CZT A;  3OGG A;  4UYB A;  1NUK A;  5ERL A;  3WP6 A;  3WF2 A;  1VAL A;  1Z7S 2;  2VW0 A;  2YC0 A;  4LEJ A;  1VMF A;  3POF A;  1BVV A;  1VBD 2;  4OMD A;  1WLW A;  4LA2 A;  4GAZ A;  4W8J A;  4QQL A;  2R04 2;  2OVU A;  3SLI A;  1H8T C;  1QOS A;  5LWB A;  4FOQ A;  4RA0 A;  4I09 A;  4YSF A;  1DZT A;  3SHR A;  3AKS A;  3NNM A;  5GLU A;  2Z69 A;  3AK0 A;  1NOV A;  1UIJ A;  3V0B B;  2ZAB A;  1PO1 1;  3B9I A;  1AF9 A;  2GSY A;  4IV3 C;  3FUO A;  4E4D X;  1SPP A;  1T2X A;  2P3J A;  3OBA A;  1O91 A;  3WCS A;  2WS9 3;  1ZZC A;  4IEX A;  1Z78 A;  2X29 A;  2YFU A;  5JI7 A;  3WNN A;  3WOG A;  4CXY A;  2PAK A;  3TB0 A;  3UKN A;  5FZC A;  1ULG A;  1IQA A;  3HD8 B;  2ZBJ A;  3JBG 2;  4HK9 A;  1ZX5 A;  4Y33 A;  3PVN A;  3FJS A;  1CON A;  3DYO A;  4XJ8 A;  1J83 A;  4B3N A;  3L2Y A;  4XHX A;  1FNY A;  3NJZ A;  1RUG 1;  1EUU A;  1CAV A;  2LRP A;  4XE9 A;  5CKQ A;  4AYU A;  3KV5 A;  5J7M A;  4CDX C;  4DOU A;  4A45 A;  4K1Z A;  4AHW A;  2FZ1 A;  2ZKL A;  1S4C A;  2WR9 A;  5L36 A;  1MS1 A;  2X5I C;  3UT0 A;  4AG4 A;  5CKN A;  3VD7 A;  4YVW A;  2PLV 3;  2BRT A;  4E27 A;  3ON7 A;  2JG8 B;  5BYN A;  1RHI 1;  1KRI A;  2VQU A;  2W1U A;  2AR6 A;  5I0T A;  3HBK A;  2C0Z A;  5AVA A;  5M0T A;  4JDO A;  1A3K A;  5LBF A;  2B46 X;  4BQX A;  4OI4 A;  3BIE A;  2UWC A;  4GB3 1;  5IWF A;  4PF1 A;  5FYC A;  3WNX A;  2JDZ A;  4AVB A;  5HXM A;  2FHR A;  3OPZ A;  3WSO A;  2VEC A;  3WDX A;  4RQP B;  4C0H A;  1OLM A;  4FBF A;  1C57 A;  1ND2 B;  3KMH A;  4AL9 A;  4A7K A;  1HRI 2;  1YEW A;  2CGO A;  3U37 A;  3AMH A;  5CAZ A;  2ZOE B;  1EV1 3;  1TME 3;  4LHS A;  4MLO A;  4RHV 1;  2CGN A;  2JDU A;  4XCB A;  4NHL A;  3ZSE A;  3S7E A;  4D69 A;  1XU1 A;  2RDR A;  3T30 A;  5FAX A;  4D7T A;  2XGX A;  1IS6 A;  2QQN A;  1W2A X;  2TNF A;  4HSL A;  1J1T A;  1RMU 2;  5C33 A;  1JOD A;  5FO8 B;  3OD4 A;  2Y38 A;  5F3E A;  4QQH A;  4TYS A;  2XJP A;  3N9O A;  2HWE 1;  3T1M A;  5IVJ A;  2F4P A;  3RZJ A;  3OOX A;  4D6R A;  2W87 A;  3AX4 A;  4MGZ E;  1ZRC A;  2WNO A;  3K4A A;  3LEK A;  1HQL A;  1S0I A;  5FDB A;  5LA2 A;  4KGG A;  4IEU A;  3M3I A;  5EXO A;  3MW3 A;  4X8P A;  3KS7 A;  4ONU A;  3MIC A;  1PZ9 A;  1OPM A;  4MHU A;  1ULF A;  3DPR B;  3SKJ E;  2I2S A;  2O0O A;  2ARA A;  4BH9 A;  4S2H A;  5ANQ A;  1WGP A;  3E5X A;  3WG2 A;  1AXK A;  1EPZ A;  3LA2 A;  1EAH 2;  1GFF 2;  4DEQ A;  3H8O A;  2DUP A;  3IT8 A;  4ITC A;  1H9W A;  2VUA A;  4C91 A;  1N47 A;  1B35 C;  2VBD A;  3I2D A;  1GAN A;  1V6M A;  4UFM A;  2P17 A;  2G19 A;  3H7J A;  1V6K A;  5FWE A;  3ZXK A;  5A33 A;  1W6N A;  2XOM A;  1FOD 3;  3A22 A;  1NYW A;  2BVB A;  5FY0 A;  3N7K A;  3KCX A;  5FFO C;  4YW7 A;  4IUG A;  5CFD A;  1N1Y A;  4LOR A;  2JIG A;  2QNK A;  2ZTN A;  4RQP C;  1UY4 A;  3G7D A;  1ULP A;  4G4F A;  3K51 A;  1G9B A;  5JOW A;  1HJF A;  2AEY A;  2BNO A;  5AC9 2;  3VBF B;  4Y24 A;  4B7K A;  1DZQ A;  2X10 A;  1RUE 1;  4IGO A;  4LKS A;  4QMA A;  4WV8 A;  1JU3 A;  2JE9 A;  2R07 3;  1F35 A;  2YFZ A;  4GXL A;  2DVB A;  4OYU A;  5LK5 A;  4XFA A;  4TLF A;  1MZ6 A;  4Y1Y A;  1DU3 D;  4P02 B;  1GNY A;  3ETP A;  2WFF 1;  4COY A;  2IUW A;  3M8L A;  3PUR A;  3USU A;  1SMV A;  4ZON A;  4BU2 A;  1CAW B;  5B4N A;  3GJB A;  4K6B A;  4AI2 A;  1PO1 3;  3MV1 1;  4MHR A;  3VZK A;  3CZU A;  1WWY A;  3PIJ A;  4HVO A;  3RSJ A;  3VLB B;  1QEX A;  4AE2 A;  2PHF A;  3HEI A;  4H55 A;  2P6H A;  2WZR 2;  4LK7 A;  3L2H A;  4KQ7 A;  4SBV A;  2JE7 A;  3WG3 A;  1A34 A;  4CDU A;  5DUX A;  2C4X A;  2L9L A;  3HNB M;  1X8M A;  5FUI A;  2B8M A;  1ZRR A;  3PHM A;  2YXS A;  3B3Q E;  1WD4 A;  4EWD A;  4GZ9 A;  4Q29 A;  3ELN A;  4RL7 A;  1RUG 3;  4HBN A;  2D7F A;  1W8W A;  5C9A A;  1JUI A;  3AFK A;  1V70 A;  2MPF A;  3EO6 A;  4P5H A;  4QPI B;  3RRD A;  3TEX A;  1MZF A;  4BA6 A;  1TNF A;  4AGG A;  1HIX A;  1A78 A;  2OPW A;  1RUH 3;  1G9A A;  1S55 A;  2WZE A;  3S5A A;  1OQD A;  5EJ1 B;  5F5A A;  3U4S A;  1RUI 1;  3TOJ A;  1VP6 A;  3OY8 A;  3UET A;  3ZSM A;  2X53 S;  1QJE A;  2W39 A;  4XVH A;  4B4Q A;  3H3Z A;  1RHI 3;  1ZZ7 A;  4W50 A;  5H9Q A;  3VBF C;  1JZ6 A;  2H6C A;  1SLB A;  5FRA A;  3ZSK A;  1LHN A;  2WNV B;  2WLQ A;  3J8F 3;  5BNP A;  1QDO A;  4FQ4 A;  1W0O A;  4C1X A;  2ERF A;  2OS2 A;  2RDN A;  2Y6K A;  4ZU4 A;  5SV5 A;  2LS6 A;  4GB3 3;  4E2Q A;  1XSR A;  5F5Q A;  3RYK A;  4JTN A;  5F32 A;  1AX0 A;  4K3U A;  1RB8 G;  4F8A A;  4HKW A;  2AEZ A;  3BVC A;  4XAB A;  3VBO A;  3HJR A;  4I02 A;  2CGP A;  5FZA A;  3NQH A;  3WD5 A;  3ZMN A;  2A3Y A;  2DUR A;  4NHM A;  1H8T A;  3U11 A;  5CA6 A;  5LZ6 A;  1AZD A;  2OXB A;  1URX A;  1UZV A;  2OPK A;  2WNU C;  1X9P A;  1ENX A;  4RR3 A;  5E1R A;  3WHU A;  3FWE A;  3D0S A;  4E8C A;  4TSV A;  3TYJ A;  1OVS A;  4Y1X A;  5GZE A;  1EP0 A;  1F5J A;  5T52 A;  2QVS B;  5A3O A;  5A70 A;  4I0A A;  4WM8 A;  3SH5 A;  2AH2 A;  2RMU 2;  2W46 A;  5ISL A;  3ETQ A;  4BIS A;  2XL7 A;  3IDB B;  2HWE 3;  3POE A;  3VUO A;  1ODM A;  2ENR A;  4Q0S A;  3J4U H;  4YW2 A;  4N9I A;  1LEM A;  2RJK A;  4KU8 A;  2OKX A;  2TUN A;  5FPX A;  2PHR A;  2WZP P;  4ZZ5 A;  4CDQ B;  5I8T A;  3LGR A;  1ZM1 A;  3BU7 A;  4ASM B;  4XIO A;  3M70 A;  3GZE A;  2VUC A;  4QPI C;  3ZVX A;  1AR9 1;  1PNG A;  1N3P A;  2BVV A;  1PK6 B;  2Z42 A;  1PO2 1;  5HV0 A;  2PLV 2;  2ZMN A;  1XB9 A;  1XJA A;  1W6O A;  2P5B A;  3DL3 A;  1J3R A;  5FYB A;  1BQP A;  1XYO A;  1I9R A;  5IVB A;  2W1S A;  2YC2 A;  2P3K A;  3T09 A;  1JZ2 A;  5FWJ A;  4AFA A;  3MFC A;  4PBO A;  2VZP A;  1XQN A;  3NJV A;  4GMP 0;  1MZ5 A;  2BNM A;  4GWJ A;  3KWV A;  5T5J A;  3T1L A;  3VL9 A;  2EF6 A;  3BOP A;  3MEP A;  1VIW B;  4LPL A;  4XQ4 A;  1UQX A;  2XKO A;  5I8S A;  2BOI A;  2YHJ A;  4P08 A;  2TEP A;  5DG1 A;  2RS5 1;  5JPM B;  1RIT A;  4QT6 A;  1WMD A;  1YWK A;  3MUZ 1;  3Q8E A;  3T2T A;  2ARB A;  2RS1 1;  5DUV A;  4YW1 A;  3O1P A;  1WCD J;  3KCY A;  1ZRE A;  5DAW A;  1OLM E;  2R16 A;  1OT5 A;  4YWA A;  3SC7 X;  3LEM A;  4UI9 L;  2D6L X;  2D3P A;  3V0B A;  4QDR A;  1LOD A;  1YJK A;  4LUK A;  1H2K A;  2I45 A;  2P2K A;  2XUE A;  4R8H A;  3J7M A;  3ZYH A;  4YZ5 A;  4JHT A;  5LEK A;  1W0P A;  3ZFG B;  5I93 A;  4FPE A;  3VD3 A;  3S7I A;  2WFF 3;  3BN6 A;  3NNL A;  4GKX A;  4AQT A;  1W06 A;  1OFN A;  4HFS A;  2HWB 1;  3ZYP A;  3GHM A;  1WLC A;  2CL2 A;  5FYZ A;  3IBM A;  4LBQ D;  1IHM A;  4B8E A;  2IC1 A;  5L9R A;  4CUB A;  2V73 A;  4ZXE A;  1H1M A;  2ZS6 B;  2JEN A;  1QHD A;  3EB7 A;  2MEV 1;  2YB7 A;  3ATG A;  3FUQ A;  3NNJ A;  5FBJ A;  2GZW A;  2BER A;  3AVS A;  4CU7 A;  4MGK E;  4CZS A;  5FR3 A;  2XVL A;  4KNC A;  4MET A;  2PHW A;  4XJA A;  3KCC A;  1OSG A;  1SBE A;  3B5L B;  4C1W A;  2JG8 A;  3LPF A;  1W6Q B;  1LOF C;  1W05 A;  4A6S A;  2JG9 C;  3POW A;  1HQW A;  3WX5 A;  2FCV A;  1FT9 A;  2RM2 1;  3MIG A;  1CWP A;  1F5F A;  3N9N A;  4TN7 A;  3P5B A;  2FDH A;  3O1S A;  2XBO 1;  4W6X A;  3ZYJ B;  5K0U B;  4OHY A;  3WP3 A;  1JZ7 A;  3ZXF A;  5EFU A;  2D6M A;  4J1X A;  3OF1 A;  5IK7 A;  1H8V A;  2TBV A;  3MYX A;  1HXS 3;  1RUI 3;  3MLL A;  1GOF A;  1AYN 1;  2QZ2 A;  4FPL A;  2A75 A;  4AED B;  4FCA A;  4DMI A;  1SCR A;  5DDJ 1;  2CAU A;  1ND2 A;  1GIC A;  1IGO A;  2R07 2;  2DV9 A;  3I59 B;  4GAL A;  1IPS A;  4CYD A;  1FXZ A;  3PUH A;  1DIW A;  4QB6 A;  3WNP A;  1IPJ A;  1UX7 A;  5JWP A;  4QGN A;  4COW A;  3IM0 A;  4M3C E;  3RPQ A;  2NLR A;  3WW4 A;  1PO1 2;  2QTW B;  1XYP A;  3PTY A;  1JMU B;  4HN0 A;  3VZN A;  5FZB A;  4KH9 A;  2Y64 A;  4K7J A;  3DXT A;  4YZ4 A;  1D2Q A;  4IEP A;  5ABJ C;  4M01 A;  1NCR A;  2IVJ A;  4KWL A;  3TEW A;  1JYX A;  1GYK A;  4DXZ A;  2VGD A;  1ZRD A;  2WO1 A;  2NMN A;  3N9P A;  2ZPX A;  5FZ9 A;  3HR9 A;  5JSR A;  4YZ3 A;  4QAW A;  5H9S A;  2JD9 A;  3O0V A;  3DPR A;  3LQC A;  1ZBE 3;  3RS6 A;  1DGW X;  5EYX A;  2VUL A;  4LLF A;  2Q30 A;  2IXH A;  2WA4 A;  2Y6F A;  1MZE A;  4S2D A;  5DZF A;  2ZEZ A;  3I2J A;  3VL8 A;  4XUN A;  5KHI A;  1RUG 2;  3DUI A;  4HKL A;  4Z1V A;  5FO9 B;  1QXR A;  1HLC A;  1DYP A;  5LRS A;  3MLJ A;  4P9Y A;  4XEZ A;  2JE8 A;  4NHY A;  3RZM A;  2NM1 A;  2BGP A;  1Q8S A;  1CD3 G;  1X8E A;  2K9Z A;  1AHS A;  2E32 A;  2XVK A;  4W4Z A;  3UJQ A;  1K45 A;  4ES9 A;  1UAI A;  1QJY 1;  2J22 A;  3RJR A;  3U0Z A;  1W28 A;  1NZC A;  5A3M A;  1RHI 2;  2R1B A;  1RC6 A;  3J9S A;  4HKO A;  2QJV A;  1OD3 A;  5JIA A;  4A3Z A;  3T0B A;  4GIQ A;  3SKV A;  3AYD A;  4GB3 2;  3ZFF A;  2YZ4 A;  1Y9G A;  4P00 B;  2ES3 A;  1ULC A;  1OHF A;  2VNO A;  2PYT A;  1NAE A;  3VGI A;  2KA3 A;  3VKM A;  2J1A A;  2RS5 3;  4GH4 B;  3GGL A;  3W9A A;  1LEN A;  4FVV A;  4MGQ A;  5A3T A;  2W68 A;  4QQ2 A;  1Q43 A;  5DZG A;  1X33 A;  5BNO B;  2RS1 3;  1UO9 A;  3GYD A;  3JZV A;  4LBQ B;  5FY8 A;  3ITQ A;  1XYN A;  2VCA A;  1CAW A;  1T6B X;  3PUQ A;  3QAC A;  2GND A;  3ZDS A;  4BPZ A;  4PF5 A;  4IXL A;  5JI9 A;  5DAB A;  4FOY A;  4L0P A;  4FI9 A;  3ZFE C;  5FXX A;  3A21 A;  1UZZ A;  1JYW A;  4QXH A;  4FTB A;  1UMI A;  3ES4 A;  3NVC A;  4BHP A;  3ME2 A;  2VOK A;  5KHJ A;  4BQW A;  1O3T A;  1WCQ A;  2HWE 2;  3DV8 A;  2QQU A;  1ODN A;  1ZA7 A;  1ENR A;  1W8F A;  2HEY F;  1NQD A;  2Q4S A;  2HJI A;  3LKJ A;  4QDQ A;  2WZR 1;  2XL9 A;  4PDW A;  1UXZ A;  4XUT A;  3GM8 A;  4QHO A;  1W0N A;  1JYI A;  3R05 A;  4N53 A;  4BXF A;  2WFP A;  1CIW A;  2V4V A;  4LBN A;  1ENQ A;  1OUX A;  3T08 A;  5CIS A;  1NLQ A;  2MEV 3;  5J98 B;  3RMY A;  2R7E B;  4YGD A;  5FYH A;  3WDT A;  4P9X A;  2DYC A;  2HBU A;  1AR8 1;  5FYS A;  3GHN A;  4IV1 C;  1PMJ X;  1VBC 1;  3H3L A;  3IPV B;  5FMD A;  4HVQ A;  4TLG A;  1DBN A;  1O4Z A;  3AZW A;  4GJY A;  2A5Z A;  1X36 A;  1EYB A;  3AP7 A;  1RED A;  1WBF A;  3VHR A;  2RM2 3;  1UD1 A;  2KR2 A;  3KT7 A;  4NWW A;  4QX3 A;  5C6C A;  3A7Q A;  1UOJ A;  4YLZ A;  4D3W A;  2WNV A;  3AP9 A;  3LE0 A;  2F6B A;  3MPB A;  5BNN B;  4R4Z A;  4KWJ A;  1GQG A;  2ORZ A;  1GNZ A;  2GNB A;  2DBN A;  3IMN A;  2Y0O A;  1DGR N;  4Q4V 1;  2WYS A;  1AYN 3;  2JDA A;  1UPS A;  4NR1 A;  2WC2 A;  1TMF 1;  1RUE 2;  4HVR A;  4IE7 A;  3QBQ A;  4XJU A;  5DDJ 3;  1ASJ 1;  3U14 A;  2WN3 A;  5JXG A;  4OI0 A;  4ZU7 A;  3VBU C;  4CRQ A;  5FV3 A;  4AHZ A;  3VHN A;  4JGZ C;  2WFF 2;  2PHU A;  1QY4 A;  2EID A;  2LAL A;  3GBW A;  5FZ1 A;  2BV4 A;  1DQ1 A;  5GKA C;  4O9G A;  2JB4 A;  1OC1 A;  4BQY A;  3HN1 A;  4M3C B;  2W2I A;  3OEB A;  3VDD C;  3VZJ A;  1AL2 3;  1SQ4 A;  2WS9 1;  1L3J A;  1W2N A;  4PIZ A;  1V6I A;  1SLT A;  3FLR A;  2R30 A;  3NAP A;  5LB6 A;  4CDQ A;  3JXS A;  3MW4 A;  4E2G A;  2VNG A;  1J59 A;  2E33 A;  3FN9 A;  5BPX A;  4A44 A;  1OD5 A;  4WVW A;  2ZAH A;  1E5R A;  4IND A;  4KBZ A;  1IG3 A;  5I0D A;  1SDW A;  3DYM A;  1JU4 A;  3WW2 A;  3RZG A;  1SLC A;  4E2S A;  5A6Y A;  1MS8 A;  1PK6 A;  1VAM A;  2UUR A;  3WDV A;  1RUO A;  4JKL A;  2ZEX A;  4SLI A;  5F9T A;  1RJ8 A;  3III A;  4U2A A;  4AFD A;  4ARX A;  1GP5 A;  4YW3 A;  5FY7 A;  1H9P A;  3NWK A;  2PLV 1;  1WLD A;  4FPJ A;  3VD5 A;  1QMJ A;  1C1L A;  5FKB A;  1HV1 A;  1QDC A;  4G9S B;  1LED A;  3NNG A;  4URT A;  1QJY 3;  1RUI 2;  1WA6 X;  4RSU A;  2OYZ A;  3U10 A;  3LIG A;  3NV3 A;  2CYF A;  1CZS A;  2OX0 A;  1R09 3;  3QLQ A;  4K1Y A;  1PVC 1;  1Q8Q A;  5CBL A;  2ZX0 A;  4CSW A;  3NKG A;  4BM8 A;  3KF3 A;  1Z0H A;  1UU6 A;  3LOB A;  4RS5 C;  4ZPI A;  3I2F A;  5IYY A;  1BMV 1;  4AQ2 A;  1BBT 3;  4Y26 A;  4AVA A;  3HOB A;  1WKY A;  4S2F A;  4ET7 A;  2ZX3 A;  4XHB A;  3NO8 A;  2J1U A;  3C7H A;  1SLI A;  2YUE A;  4IEW A;  4PHZ A;  1EV1 1;  1TME 1;  5JXJ A;  5C8C C;  3WQ1 A;  3WP4 A;  2XWB B;  3ZFG A;  4M00 A;  3AYC A;  5BV6 A;  2A7A A;  3QH7 A;  4Y4Y A;  3HBZ A;  4KWU A;  3LPG A;  1U12 A;  2ZGN A;  1L7R A;  2LTN A;  3MBW A;  3MIF A;  5E8A A;  2XJS A;  3SEP A;  3MZH A;  3PME A;  1ZVF A;  2QQO A;  4OZO A;  1SFP A;  4CDW C;  4HN1 A;  4ZU5 A;  3PU8 A;  5I0S A;  2EXK A;  4NOT A;  3H8R A;  2YV8 A;  1HB4 A;  4D7S A;  1ZBE 2;  4A7Z A;  5IK5 A;  4PIY A;  4YRD A;  3ACL A;  3B02 A;  1TEI A;  1UOG A;  5KR7 A;  3E5Q A;  4MX3 A;  3PIG A;  2D6N A;  5FPZ A;  3T2P A;  3WR0 A;  4CEY B;  1I1E A;  4RYD A;  4Y5S A;  1N3O A;  3DEM A;  5DAV A;  2AC1 A;  4QD2 A;  2OA2 A;  3DXU A;  4IQP A;  2DUQ A;  1PVX A;  3AP5 A;  1KGY A;  4YGC A;  3GCX A;  1F2N A;  1UKR A;  3JU9 A;  2CWM A;  3IMM A;  4AFM A;  2VXR A;  1AR9 2;  3BYW A;  1W6Q A;  2ILM A;  5FMC A;  5A7O A;  3SCF A;  2IWG B;  2VMI A;  5A32 B;  1RTV A;  3TNQ A;  1WW6 A;  5K0U A;  2VM9 A;  1X82 A;  4OUL A;  3ZPO A;  1AR8 3;  2JEC A;  4AFB A;  4XJW A;  4CDX B;  1VBC 3;  3DYP A;  1KJL A;  3I2H A;  1FOD 1;  1OUR A;  1QQP 1;  2QQM A;  4AVS A;  2VE1 A;  2VZ3 A;  4DY3 A;  4DIN B;  4EZH A;  2DU1 A;  2D6K A;  2RVA A;  4P9I A;  1RVF 1;  1K5J A;  1OQ1 A;  2X5I B;  3O0W A;  2BW8 A;  4AED A;  4L97 A;  4BB3 A;  1YQ5 A;  4CU9 A;  1BEV 1;  1D0H A;  4BXS V;  1UZW A;  3FX3 A;  4CUC A;  4QGL A;  1XNA A;  2YDE A;  3Q9O A;  1F9K A;  4KG0 A;  4OLL A;  3I59 A;  3RZK A;  2RS5 2;  1JZ8 A;  3FE5 A;  1U5Y A;  2VOX A;  3H8U A;  3KVA A;  3KQ4 B;  4AAP A;  2R07 1;  5GLZ A;  2RS1 2;  1GSL A;  4Q4V 3;  4KMQ A;  1O5L A;  2PQQ A;  3GAL A;  3MID A;  1KEX A;  1TMF 3;  2BQP A;  2ZXQ A;  5GLT A;  5JR2 A;  2VUJ A;  1ASJ 3;  3VZL A;  2XHK A;  1M4W A;  4QQP A;  4GKY A;  4NID A;  1YFW A;  5DUU A;  3KM5 A;  3JB4 C;  2QUO A;  1ONA A;  1UIK A;  3FHQ A;  1XNK A;  1W8N A;  3ACI A;  4F3J A;  1GQP A;  2GN7 A;  4LXL A;  3H3U A;  3VDB A;  2E7Q A;  5K7P A;  2AZ5 A;  1REE A;  1LJ7 A;  2C9A A;  2IXJ A;  2VNR A;  2VVF A;  1SCS A;  3ZXD A;  1GP6 A;  2HWB 2;  1W2O A;  4OHW A;  1UL9 A;  3ILN A;  3OSD A;  4HL0 A;  3FC0 A;  1W90 A;  4CEY C;  1HX6 A;  1B09 A;  3DF0 A;  1S0J A;  5CAD A;  5JOZ A;  3W5N A;  1UY2 A;  3MHZ A;  2HWC 3;  2R0H A;  2QQJ A;  4XXA A;  1CES A;  4DRR A;  3ZO0 B;  2DCK A;  2MEV 2;  2XUM A;  1ENS A;  4E4S A;  2LM3 A;  4HPK B;  2EA7 A; 
#chains in the Genus database with same CATH homology
 3WF4 A;  4QX0 A;  2VZT A;  3ACG A;  2WZE A;  1DYO A;  3IAQ A;  5EJ1 B;  3UET A;  2XHN A;  3OB8 A;  4XVH A;  2QQK A;  4ZZ8 A;  4W50 A;  2X09 A;  1JZ6 A;  1R64 A;  1LNS A;  4OMC A;  3IB3 A;  4QDS A;  2Y6K A;  4BK4 A;  2LS6 A;  3T0A A;  2LW8 A;  1OF4 A;  5C70 A;  2EIB A;  2VMF A;  3HJR A;  4M4R A;  3NQH A;  3IDA A;  2VZS A;  1NX9 A;  3NJX A;  1CIY A;  4DXR A;  4LQR A;  5J1X A;  3VDA A;  5DMY A;  4E8C A;  1PX3 A;  1CX1 A;  1W9S A;  2XQX A;  2W46 A;  1US2 A;  4TTG A;  2VCB A;  2J1E A;  3OGR A;  3AC0 A;  4BJ0 A;  3MO4 A;  2OKX A;  2ID4 A;  1TG7 A;  2WZ8 A;  1JYV A;  4ZZ5 A;  2BGO A;  4ARY A;  4CU6 A;  2J1S A;  3I97 A;  2Y6J A;  5DQ0 A;  3K77 A;  3FHA A;  5DN2 A;  1US3 A;  4DXS A;  5C7G A;  1O8S A;  4MGS A;  3C7F A;  3GXU A;  3J7H A;  1DLC A;  4M4P A;  3I3D A;  2W1S A;  2YC2 A;  2W91 A;  3T09 A;  1JZ2 A;  2VZP A;  3NJV A;  2C9K A;  4GWJ A;  1UY3 A;  1JYN A;  2WO2 A;  4LPL A;  4JHZ A;  2WBK A;  4P08 A;  2CDP A;  2W9X A;  3UNP A;  3MUZ 1;  4MO3 M;  5JXI A;  2PQS A;  3WF1 A;  4DUV A;  4DUW A;  1K12 A;  1OT5 A;  1IQD C;  4UI9 L;  4KI5 M;  4QDR A;  5C71 A;  1TVG A;  2DDU A;  2VL4 A;  3VD3 A;  3BN6 A;  1PX4 A;  5IFP A;  4JX0 A;  1GMM A;  4XUP A;  3PUI A;  4GWI A;  3T0D A;  4YPJ A;  3IAP A;  5CZK A;  4E8D A;  3K4Z A;  4CUB A;  3I2G A;  4ZXE A;  1NKG A;  3EB7 A;  2YB7 A;  1JZ3 A;  1I5P A;  4MOA A;  2BER A;  3T2Q A;  1W99 A;  4CU7 A;  1UWW A;  1GU3 A;  3OEA A;  3WNL A;  3LPF A;  1SG3 A;  3D3A A;  1BHG A;  1JHJ A;  5JXH A;  2Y6G A;  1JZ7 A;  1UY1 A;  2WAO A;  2VTF A;  1GOF A;  4A41 A;  2V72 A;  3DEC A;  2VZQ A;  3A23 A;  3MUY 1;  1H6X A;  4BK5 A;  1XPW A;  3PUH A;  4MAD A;  2ORX A;  4QB6 A;  3WNP A;  2VQT A;  5B4X A;  1UX7 A;  3OGS A;  3HPN A;  2W1Q A;  2CDO A;  4CVU A;  3ABZ A;  4OUE A;  1K42 A;  2VCC A;  2VME A;  2Y64 A;  4Z2A A;  4TXW A;  1SDD B;  2C26 A;  3WEZ A;  5F7U A;  1W8O A;  2B9V A;  1JYX A;  4DEV A;  2QBX A;  2WO1 A;  4QAW A;  2JD9 A;  2VR4 A;  3LQC A;  3F2Z A;  3HNM A;  4AAX A;  2ZEZ A;  3I2J A;  4XUN A;  4HG6 B;  2JE8 A;  2BGP A;  2VC9 A;  1JI6 A;  3GDB A;  3VD4 A;  2VJX A;  2E32 A;  2W92 A;  4W4Z A;  1K45 A;  2BBA A;  2J22 A;  5DPN A;  2Y8K A;  2JKX A;  3ACF A;  3WNK A;  1P8J A;  2W94 A;  2EIE A;  1OD3 A;  4A3Z A;  3T0B A;  3WQB A;  3SKV A;  1UXX X;  3CKH A;  2QQL A;  2VZU A;  5IHR A;  1XNT A;  4QX2 A;  4P00 B;  1J84 A;  4ZY9 A;  2VMD A;  1CZV A;  1NAE A;  3K4D A;  1EUT A;  2J1A A;  3GGL A;  1UMH A;  4MGQ A;  3BGA A;  3HNY M;  3EYP A;  3C7E A;  1GOG A;  5A1A A;  2VCA A;  3C7O A;  3WNM A;  1DP0 A;  2QQI A;  3MV0 1;  1W9W A;  4L0P A;  4FI9 A;  3A21 A;  2BZD A;  4XUO A;  1JYW A;  3CZJ A;  3NRU A;  1UMI A;  2HYX A;  4UAP A;  3CIH A;  4JKM A;  1WCQ A;  4D0Q A;  3ACH A;  1PMH X;  3ECQ A;  1L7Q A;  1UYZ A;  1HN1 A;  4QDQ A;  2W47 A;  2XON A;  1UXZ A;  1O59 A;  4XUT A;  1RYY A;  3I3B A;  1D7P M;  3GM8 A;  5LCW L;  1W0N A;  3K46 A;  2YG0 A;  1F4H A;  2V4V A;  3LEG A;  3T08 A;  2VMC A;  3VDC A;  2VZ1 A;  2X05 A;  4JKK A;  2R7E B;  2W5F A;  2E31 A;  2VZR A;  3E1F 1;  4D8M A;  3C7G A;  1PMJ X;  4DXT A;  4XUQ A;  5JUV A;  3P1I A;  3W5M A;  2J1T A;  4QB1 A;  1K3I A;  2Y6H A;  3THD A;  4QX3 A;  1CZT A;  3A7Q A;  1NUK A;  3WF2 A;  3OG2 A;  1XC6 A;  2RV9 A;  3LE0 A;  4OMD A;  4W8J A;  3THC A;  2ORZ A;  2J7M A;  2VO5 A;  2WYS A;  2JDA A;  1UY0 A;  2E26 A;  3WF3 A;  5JXG A;  2WN3 A;  4A4A A;  1W9T A;  1T2X A;  3OBA A;  2EID A;  5LA1 A;  1JZ4 A;  4QB2 A;  2YFU A;  1JZ5 A;  3WNN A;  3OEB A;  4PT6 A;  3P6B A;  2Y6L A;  3I2K A;  1YQ2 A;  3WF0 A;  1O8P A;  3DYO A;  1J83 A;  4UOJ A;  3JXS A;  1UYY A;  1EUU A;  2E33 A;  3FN9 A;  5G05 L;  4A44 A;  3I2I A;  2J1R A;  2WAB A;  4A45 A;  5I0D A;  2VZV A;  3DYM A;  1JU4 A;  4AG4 A;  3OGV A;  3VD7 A;  3CMG A;  4JKL A;  2ZEX A;  4XZU G;  3III A;  4ARX A;  4A6O A;  2VQU A;  2W1U A;  3VD5 A;  3K75 B;  4QX1 A;  1GUI A;  5CYY A;  3NNG A;  3UES A;  4PF1 A;  1CZS A;  5HXM A;  3WSO A;  4P5Y A;  1H6Y A;  5EIY B;  2RJ2 A;  4CUA A;  2WAA A;  3U37 A;  3CDZ B;  5IYY A;  3I2F A;  2VOT A;  1UZ0 A;  2DCJ A;  4LHS A;  4ET7 A;  3HOB A;  1WKY A;  1MPX A;  2J1U A;  3C7H A;  3I3E A;  5JXJ A;  5G04 L;  2QQN A;  4DUX A;  5IFT A;  4KWU A;  3VD9 A;  3LPG A;  3FL7 A;  5IJR A;  3MBW A;  1L7R A;  2W87 A;  4QPW A;  3SEP A;  3K4A A;  3LEK A;  2QQO A;  5LA2 A;  4OZO A;  1F4A A;  1SHW B;  5JMO A;  4XUR A;  3SKJ E;  1OH4 A;  3T2P A;  4DEQ A;  2B4K A;  4RYD A;  2EIC A;  1KGY A;  3HN3 A;  2ZEY A;  2WN2 A;  3LEI A;  3C8X A;  3WNO A;  2XOM A;  3A22 A;  2WUH A;  2VM9 A;  4CU8 A;  4IUG A;  3DYP A;  3I2H A;  2QQM A;  2VZ3 A;  1UY4 A;  1ULP A;  2RVA A;  1UYX A;  2VZO A;  2WO3 A;  2WDB A;  2W95 A;  4CU9 A;  1OF3 A;  3CQO A;  2X10 A;  4BXS V;  5EJZ B;  4LKS A;  4CUC A;  3T2O A;  1JU3 A;  1XNA A;  2YFZ A;  4OYU A;  2Z4F A;  1JZ8 A;  4P02 B;  1GNY A;  3ETP A;  4BDV B;  4KMQ A;  4RN5 A;  1GOH A;  1KEX A;  2ZXQ A;  5JR2 A;  5B4N A;  4A42 A;  2ZEW A;  4PQQ A;  3MV1 1;  3CZU A;  3FHQ A;  1W8N A;  3ACI A;  3VDB A;  1GQP A;  3HEI A;  2V5D A;  2HLE A;  2C4X A;  1ULO A;  3HNB M;  2L9L A;  2J1V A;  5FUI A;  3W5N A;  1UY2 A;  2W1W A;  2QQJ A;  4GZ9 A;  2W3J A;  2KD7 A;  2DCK A;  2WQ8 A;  5LA0 A;  2YC4 A;  5HPO A;  3SEE A;  3ZM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...