3RYPA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rypA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rypA01
3GEZA 4MTEA 3WODF 1TNSA 3EDPA 1QQIA 1BI3A 2VBZA 4FHTA 2R7DA 1BOAA 1C0WA 4RGRA 4M71A 3T8TA 4XFFA 3H1WA 1XGMA 3IDCB 4CZZA 2LF7A 3R0AA 2K27A 5HVQC 2IW5A 1XB4A 1QXJA 1QO0D 3GX4X 2FNPA 4Q0QA 3G73A 5CLSA 2GA2A 3F3XA 2VQAA 1MJ9A 3KGLA 5E1RA 1RTVA 3U0ZA 2CAVA 4Q29A 5L3GA 4OIPF 2Z99A 3ETQA 4M72A 1JUHA 5D4SA 3KZZA 2A68F 3ZMDA 4IJAA 4IERA 5ERIA 4UXNA 1NHAA 1LEBA 4G8XA 1K6OA 2Z9OA 5D5XB 2BNOA 4YARA 2VN2A 3I71A 3KP3A 4CO8A 2OZJA 4KN7X 2QWWA 3CUQC 1J75A 2VONA 2EJRA 4XETA 3AAFA 4BAYA 3QP6A 3QPHA 4IPAA 2F2EA 3PFIA 1FBUA 3RKYA 3V7RA 4BYYA 1FP2A 1Z7UA 3WGHA 1R1TA 2RDPA 3HRMA 1K78B 3FXUA 1ULYA 4HX4A 4M6YA 3FJSA 4NVPA 3I59B 1YLLA 3MCZA 4FX4A 2ZFWA 4Z07A 1XD7A 2XVCA 4HOBA 4QXKA 1FZPB 1J7KA 1KYZA 2OPKA 4K8FA 1V4RA 3FM3A 2P5VA 5DV5A 2RGVA 3ROUA 3ES1A 4IEOA 5JR3A 2GAUA 4CGZA 3HTUA 5C8WA 1OYIA 3QPTA 5CJ9A 3BDDA 5LLQA 2PN6A 2XAQA 3DN7A 3IWZA 4XFAA 3KGZA 4XF4A 1A04A 4IESA 2JT1A 2BGCA 1G4DA 3BWGA 4Q0SA 2ISYA 2MBFA 1IN8A 2UY9A 1U2WA 2HKXA 5DEQA 2VOOA 4HX8A 4QMAA 1R7JA 1R1UA 4KU7A 4LUKA 3CJXA 3F8MA 4ZH4F 1J5YA 3DPLC 2ZKZA 3KZYA 4HAMA 4U88A 1IZ1A 4RGXA 5FO5A 3FHZA 1DUXC 4EV0A 3L00A 4BNCA 1E17A 2BNMA 2K4BA 3JSOA 4J1XA 3HHGA 5IT3A 5ILVA 4TLFA 1R5HA 1ZZ8A 2ZNZA 1QBJA 4YSFA 4R52A 3LA3A 3IWFA 2OA4A 5LRSA 1YFUA 3E6DA 1W7PB 1P6RA 4ESFA 1R58A 2PYTA 1XDSA 3DQVC 4BHCA 4EMSA 4IRGA 2DI3A 5D5WB 4G7HF 3BJOA 2F5CA 3FE5A 3MEXA 1RL3A 1O7FA 4S04A 3J81Z 4LLOA 1ZGJA 4HBNA 1ZHFA 4F8AA 4I98B 3IHUA 1IAWA 1YWKA 3ZMTA 2HWVA 4LULA 1CF7A 5JSRA 1W5TA 5AONA 2DPUA 3UKNA 3FFQA 3F21A 2OZUA 2VT2A 1BBYA 3IKTA 4EGZA 4L5JA 1J3PA 5BS6A 2K0GA 1J1LA 3SZPA 2IA0A 3GVAA 2FBHA 4DINB 4WX9A 1HKSA 2XAJA 3F8CA 4A5NA 2O61A 4AVBA 4YNIA 3EQEA 1RUOA 1DGRA 3IBMA 2HKOA 2VXZA 3CLPA 1SD5A 2FNAA 3HRUA 4WZCA 3BCWA 1UCRA 1O57A 4MQVA 1ZREA 5E1WA 2EV6A 4LTAA 4I01A 5E8IA 1VR3A 5D1IA 1DPUA 1UPIA 2XAGA 2GA1A 4GULA 2XRNA 1EP0A 2V79A 4L9JA 1U3EM 1Q43A 2P7CB 3EYIA 3H3ZA 3QOPA 1ZGAA 4ZYEA 1GVJA 2EFNA 3SCGA 1CAVA 3TQNA 2OZ6A 4Z2YA 4KNYA 2CWEA 3C3WA 1FXZA 1ZVFA 5E8GA 3TGNA 2PBIA 5D8LB 3ZMUA 2FBIA 3P9CA 1TBXA 1YFWA 1SFNA 3H7JA 2XROA 3NVCA 2EFOA 4JQFA 1VP6A 4ENMA 1S29A 1FPQA 4EJOA 3ML6A 1QWRA 2FEZA 2EA4A 4S05A 3K0LA 1FYMA 3MAJA 3ERED 1Z9CA 4P96A 2ETEA 5HS8A 4KMFA 4HSLA 2F5DA 1FC3A 4WXDA 1T39A 2B8MA 2JRTA 4L9VA 3Q5FA 1E2XA 3L7WA 1IRGA 4Q4ZF 1NZCA 1OPCA 1KU3A 5CVUA 1XCVA 2QQ9A 2Q8KA 4O3MA 1WKMA 5E17F 1CAXA 5KHHA 3B02A 1ZG1A 3P9KA 4AQ2A 1YIOA 3ABUA 2PAMA 1IN7A 5LEJA 1FSEA 2R7FA 5CVIA 4JTNA 3E6BA 3RKWA 2FXAA 3RYKA 2UYAA 2XIGA 1WQ2A 2DQLA 1PDNC 2PI0A 5D5UB 5ICEA 3WW2A 2D2WA 3LAJA 4EGYA 4RD7A 4YIIA 1XSVA 1U8RA 4AIKA 3PQKA 1QNTA 1ZZCA 2YX7A 5BOXA 1DZTA 2ZJ2A 1ZNPA 4OMYA 5JFRA 4KL1A 1LDDA 2EV0A 2KKOA 3KFWX 4YFXF 1LJ9A 2BV6A 1G6NA 1J0RA 4ZYHA 1Z05A 3FX3A 4D7TA 1ZZBA 1BI0A 4KUMA 5JI6A 1UHWA 4UBGA 2MH9A 1FWZA 3SXWA 3TOBA 3M7GA 5KK1A 2DK8A 4O6JA 2FRHA 1B6AA 3M1EA 3BALA 3WTTC 4MGIE 4QGNA 2PA7A 1XGOA 4M6XA 2H09A 4HLYA 1XGNA 5LHIA 3SCHA 2XASA 4J1WA 4WWCA 1D5VA 1DZRA 4P9GA 1O5LA 5K1YA 1K78A 1FYKA 4FAGA 1XCBA 3GLXA 4HF0A 2CGPA 3T5XA 3KLOA 3I59A 1RNLA 2UYBA 3ELNA 2EV5A 4EVIA 1EY2A 1HKQA 3I0TA 5HS7A 4XSXF 4ONUA 3HRTA 3GW2A 4MEXF 5TRDA 3FZ3A 5ILSA 3I64A 1EPZA 4R79A 1CF7B 4HF2A 5I8TA 1YFHA 3GWZA 5AIQA 2Z33A 3EO6A 4HZFA 3HTSB 4F7ZA 5KHGA 4K2EA 4G7ZF 1U6GA 4EJTA 5CADA 4L0ZB 3MZHA 1H1MA 2V1XA 1QXRA 4LJZF 5DUKA 1P4WA 2XV4S 2EFQA 5H20A 5D5VB 5JVTA 2FQPA 3C3VA 1W7PD 5CU1A 3NKTA 4HYEA 4AD9A 1GQGA 2PAKA 4RB2C 3L2CA 3BU7A 4PGGA 4LA2A 1QGPA 1RGSA 4IEWA 4IHSA 1R1VA 2EFWA 4HX7A 2F5FA 3VOEA 1IPJA 3CUOA 1CAVB 6PAXA 4UNOA 5I8SA 1B1BA 5JSOA 3K1NA 2JSCA 2Z2SB 2IXHA 1W7PA 2KJBA 5LGUA 4IEZA 5JSPA 4MGYE 3CO6C 4QGLA 3VODA 2B0LA 1ZZ9A 2RKHA 2XLFA 1X82A 1GHCA 2EFPA 5JR7B 4KN4X 4LLNA 4YYOA 2M45A 3OCPA 1O3TA 1WSUA 2IXCA 3UKTA 1XGSA 1RC6A 1Z6TA 4D7SA 1R22A 1LDKB 2VC0A 4B29A 3VFZA 1SD6A 1HSJA 5HLIA 3MWMA 5BV6A 4IETA 1RI7A 4OOIA 2PHDA 3M8EA 2OQGA 4LGWA 3PVBB 1S6LA 3L09A 3J80Z 1BJAA 4LB5A 3CEWA 1KA8A 5I0SA 2HJIA 1I1GA 1YW9A 3GUDA 3DP7A 2GXBA 5KBFA 1ODDA 4UVAA 2EK5A 4JVAA 2QM3A 1Y9QA 4GO1A 3EBRA 5HDKA 2IT0A 2STWA 1CAXB 4IEYA 1OFNA 4XLPF 4U0WA 3E6CC 2WWYA 2FE3A 3HSFA 1J2XA 4P55A 1MZBA 3DF8A 4UBHA 5BXXA 5JCTA 2QNKA 4AWXB 1FY7A 1Y0UA 1KQ9A 1YLFA 3GFLA 3TO7A 4OIOF 1PM7A 3OV8A 1MGTA 2XLAA 3T1BA 1IPKA 3OGJA 3H8UA 1D8JA 4RGUA 1ONVA 2STTA 1KU9A 4ZZDA 4Q48A 2V6CA 3KEOA 2H94A 2FSWA 1SMTA 4MUVA 3QP5A 4TV7A 2JPCA 2NAZA 3KCCA 2FMLA 4ESJA 1OMIA 2B5HA 3H1YA 1R5GA 1ON1A 3NL1A 1TNTA 2ISZA 5K5RA 4MZUA 1XRUA 2DAOA 2OYZA 3BPXA 3GO5A 2P17A 4Q0PA 2BBYA 1LR5A 4CICA 2K7LA 3FF5A 5AVPA 1YQAA 3H1MA 3LAGA 3LA7A 2XAHA 3I5UA 2ET1A 2C6YA 2UWMA 1R23A 5LEKA 1S7AA 3WE2A 1CAUB 4U0YA 5HDGA 4KWKA 3WTYC 4HV6A 5FLJA 1R36A 4WXHA 1V3FA 3BZ6A 3LWFA 4A0YA 2DBBA 2GWRA 3ZMVA 1SD7A 2O1QA 5FLXZ 2B9UA 4XFIA 4EQQA 2QVSB 1LB2A 4XFHA 3GXOA 3F6VA 3M70A 3J81K 5JHUA 1H9GA 4QWQA 2FA5A 2PAEA 2PMUA 4GYGA 1W5SA 2GU9A 1J59A 3M3IA 4E2GA 4RB3C 1DP7P 3FMSA 4UHTA 2OA2A 4A6DA 4IEVA 1O4TA 2XHKA 3K1MA 3I7DA 1KQ8A 1U78A 4G6DA 4I3PA 4ESBA 4ZU5A 3RDIA 2CFXA 2ELHA 3Q9SA 3KP7A 2CG4A 3QU6A 5F6FA 4O9GA 3SCFA 3SHRA 4PZJA 4NB5A 4I0BA 4KYWA 4KWJA 5FCCA 2ESHA 2IA2A 5HLGA 4L9NA 1B4AA 2ET7A 3GZ6A 2Z5UA 4UUVA 2J5PA 2EB7A 2MA3A 5L3DA 1VTNC 3E6MA 5D4RA 3PQJA 3CL1A 1D3YA 1MD0A 3P7NA 4RB1A 4P9FA 2A69F 2XKPA 3KP4A 4RAZA 4ETSA 3CTAA 1LEAA 4L18B 1J9IA 4CYDA 2PQ8A 3S7IA 4BHBA 3OD0A 2E9QA 2QQAA 1YO5C 3MZYA 3ZMSA 4LB6B 3L9FA 1X7NA 2ZCWA 1XMAA 5I8YA 2IXIA 3BPZA 1DPRA 2QQBA 3WGGA 2D40A 3I53A 2KIMA 3ABTA 1SFEA 1H1IA 4ORFA 1IW7F 1TW3A 3CF6E 3RYRA 4M9SA 5FFZA 3ULQB 2Q0OA 4MX3A 3IIAA 1ZG3A 5BY5A 4HDVA 2DPDA 2DK5A 1YYVA 2GQQA 1WGPA 1ZRFA 4BIFA 1I27A 5J3UA 1IN6A 3LA2A 3MDPA 1G3YA 1S3JA 4B8XA 4LMYA 3TOAA 3WW1A 4ENNA 3I4PA 4HA8A 3H3UA 1ZX5A 4XEZA 4L11A 5AIPA 4QLCU 4AVAA 3UKVA 5K8SA 2Y48A 1L0OC 2H27A 2FOKA 3SHFA 1CGPA 4Y17A 4A5MA 5KHKA 1H0MA 1LVAA 2HOEA 2K86A 2L4MA 1Z6RA 4HV5A 1NYWA 4XF1A 1PMIA 4XRFA 3I58A 3BB6A 3F23A 3OF1A 3RI4A 2E1CA 5H6QA 1FP1D 2P7VB 4RB0A 3GZ5A 5J48A 2Y0OA 1EYBA 2CYYA 2LF8A 3LWCA 1LKNA 4Y13A 1OI6A 2FMYA 2Y0MA 3JW4A 3RYPA 2V9VA 3R0JA 3S7EA 1KGSA 5KHJA 3WE3A 5J6XA 2QVOA 4LK0F 3ZDSA 2YR2A 1CAWA 1XE7A 5DD4A 4ZZLA 4YG2F 2M1BA 3F8BA 3BOQA 2ZMEA 2AXLA 5D6EA 2OD5A 1GXPA 1WLTA 4HVQA 2PFBA 2CQKA 1Y3TA 2QLZA 2KXLA 3IC7A 4M9XA 3DPTA 5E20A 2NS0A 3HIFA 1ZZ6A 2GH2A 3K9TA 3FM5A 4H0EA 2P5LC 1BM9A 4ZYDA 2UY8A 2Z3YA 5EEGA 5LHGA 1YHFA 3V8JA 2M5WA 5FDBA 3F8NA 3F6OA 4RAYA 2ACJA 1BC8C 4YFKF 1J58A 3GFMA 2WV0A 4IEPA 5EEHA 5J7MA 5BQTA 1ON2A 2BEOA 1BI1A 5EZWA 2HQNA 5DD8A 2PJPA 1UCXA 4MEYF 2GC3A 2Q4SA 5E1ZB 3ST7A 2VBXA 1V70A 3ZP5A 2PTMA 1TLHB 3VEPA 1YW7A 1KU2A 5E16A 4EJWA 4KIGA 3JAMZ 5LHHA 4KFCA 2PQQA 1AOYA 4HLXA 1HSTA 4PGHA 4L9TA 1X3UA 1S8NA 3SFZA 3VB2A 3E97A 5FPZA 4OINF 3G7DA 2O6GE 4KDPA 1R00A 1SMYF 1ZN2A 4IF4A 3CO2A 4KT5C 4LLLA 4E2QA 3KETA 1PP8F 4L2NA 3R4KA 2PG4A 1B59A 1QPMA 2IVMA 1CAUA 4U0VA 5L3FA 3SZTA 3RPUA 5DCMA 1LQ1A 1F9NA 1U5TA 1KU7A 4RGSA 1Z91A 4L0YB 1J3QA 1GXQA 3ZN0A 3DFGA 2DQRA 3DKWA 4CDGA 1OD5A 5ED4A 2L4AA 2G7UA 3SXYA 4M9ZA 3D0JA 4A6EA 2QZ8A 1LDJA 3C1DA 2CV6A 1FI2A 3ELKA 1CX4A 4PCQA 2VECA 1TQIA 5LBQA 2GC1A 2G7HA 3DXJF 2VE9A 3GFIA 4HN1A 4META 4LUMA 3R6SA 2MH2A 2E7XA 3RJPA 3H7YA 3BPVA 3WG9A 1REPC 3Q9VA 4HBLA 3J80K 3IL2A 2HFHA 2CSOA 2O03A 2DTRA 3HOTA 1MJBA 3FXQA 2O8XA 4L5IA 4ENKA 3NJZA 2EA2A 2DO7A 4FX0A 2DU9A 1T98A 2W25A 5FFXA 4IRIA 5KHIA 2P4WA 2QENA 3JSPA 1O3QA 4QM8A 2XLGA 3CDHA 1AWCA 1WA4A 1EH7A 5DYMA 1BIBA 4H7LA 3K69A 1K79A 1Z1DA 2V1UA 3NSTA 1T38A 1P4XA 3QRFF 3F72A 3LAPA 2IRFG 4DQ2A 2IC1A 5LGTA 1NXMA 2XL9A 1XMKA 3HYIA 1JE8A 1SQ4A 1X8MA 1MDMA 2W57A 1MJAA 1SD4A 4LFUA 1DGWA 1BN5A 3WU1B 5FD6A 4EJVA 4HVOA 1HXDA 3LQQA 2HZTA 4AVPA 1HKTA 1CAWB 2MLKA 5ILUA 3H92A 5LRRA 1SFUA 5IT9K 2QDRA 2CW0F 4EM1A 2HR3A 1F1ZA 2ZMEB 4YRDA 2IP2A 2COMA 1SFXA 3V4GA 2HGCA 1H9TA 1G3WA 3MYXA 4U7BA 3CUQA 1TQMA 3F8FA 1UIKA 3O3KA 4R8HA 3E3VA 5BMZA 5T3NA 2IXLA 1IXSB 1TW2A 2D1VA 2ZNYA 4XFGA 3MFKA 4OFGA 2EWNA 2I45A 5FQ0A 2RQPA 1ZLJA 2XAFA 3B73A 2BNNA 2K4JA 3C7JA 2IXKA 2F5EA 3H9AA 4WF2A 3O2PE 5HOOA 2DFIA 2F4PA 1OKRA 4OIQF 3GBFA 1BI2A 3FHIB 1Q1HA 2L02A 4EWAA 5FLXK 3J7AO 4E70A 2C0ZA 3VHRA 1XE8A 3KLNA 3WW4A 5ICGA 4OIRF 2Q30A 4MGRA 2A3SA 3HUGA 3TDUC 1ZAOA 4JK1X 1L3LA 2KIUA 1YS7A 4Q0VA 1RIOH 3GF2A 3F22A 1HW5A 4LLGF 4BQAA 2IA1A 4ON0A 2X4HA 5IT9Z 2JZYA 2Z69A 1ZRRA 4IVNA 4PDKA 4LEJA 1TQPA 3RNSA 1NE4A 1G3TA 3GYHX 1U12A 2RC4A 1IF1A 5I0UA 4CHUA 4N9IA 2LNBA 2MPFA 4D0PA 4O9EA 3U10A 1I5ZA 2FU4A 1P2FA 4ZU7A 2BYVE 4XFBA 3RKXA 2PEXA 3N4MA 4G6QA 1UD1A 4ENJA 3ZN1A 2P8TA 3HT2A 3JTHA 2PHLA 2JTVA 3TKYA 3RTRA 1QZYA 5ICFA 4JTOA 3E5UA 3ECOA 4LG0A 3ISPA 5DCMB 1OR7A 2QCSB 1U5TB 2HS5A 4FAHA 2X0LA 3N97A 4XF9A 3O14A 4E2SA 4HQMA 4ZU4A 1Q3EA 2QBYB 1WRJA 3HHHA 3HSRA 3OOPA 3LSTA 3WTZA 4U7DA 2M87A 1USSA 3CLOA 2MD5A 4OMZA 2OBPA 2OU2A 4EM2A 4MTDA 1ZRCA 3TO6A 3SQNA 2AS5F 1FBQA 4IEXA 3LQRA 1O5UA 3REOA 4AXOA 3L2HA 2YPRA 3R60A 2O0YA 4LA3A 3HQXA 1FLIA 3K2ZA 4R1HA 3RPQA 4EWDA 2OAZA 1LRHA 1YTYA 1P92A 4BH9A 4JV4A 2CO5A 3TNPB 2NRAC 2VPVA 4I02A 3EETA 2HTSA 4KA4A 1XSXA 3M9AA 3KP5A 4BXUA 2D5FA 5FPXA 2PFWA 1UHMA 2HQRA 1O3SA 4JBAA 2BE5F 4N9HA 1L3JA 1O3RA 2EVXA 4I0AA 2A07F 1JHHA 2O8QA 3T8RA 2GXGA 2VODA 1J3RA 2A5YB 1OYWA 1W4MA 1RZ4A 1FSHA 5CYVA 4WBBA 5D8KB 3I54A 1USTA 4I09A 3HSEA 4NQWA 1MDMB 2Q1ZB 2VT3A 3LOIA 2OQRA 3O6BB 1I1SA 2DCTA 4B09A 1HW1A 4HDUA 4MGZE 4PIZA 2JPBA 3RZZA 2N7GA 1G3SA 1ZLKA 5KVRA 5BUVA 3D5LA 2LSOA 2ZKLA 4LK1F 1IXCA 2A61A 3WGIA 5C6CA 3W6JB 2W24A 4PIYA 4M73A 4GYIA 2DW4A 3TO9A 3BP8A 3DV8A 3U9GA 5DDGA 4DNCA 2RNJA 1TQ5A 2VOPA 3CUQB 1STZA 1DDNA 3USSA 3ZPLA 3WTWC 4I2OA 1SAXA 4KIFA 2DLLA 3LFKA 3EJKA 4HSJA 4X6QB 5FLIA 2VC1A 1ZARA 2RV8A 3KEQA 5A2QK 2P6TA 5FQ0B 2W84A 4P9UA 3JZVA 1IUYA 3MPBA 3TDZC 4EM0B 5L3EA 4I7HA 2KIFA 2QYOA 4M74A 4G94A 1JGSA 1F5TA 1KYWA 1SEFA 2FF4A 2WTEA 2PMHA 1UIJA 4XFCA 1XSDA 5L3CA 3GYDA 1IN4A 1O7LA 4UV8A 3H50A 4IRHA 5BPDA 3P9IA 4HN0A 5HDNA 4AIJA 5HLHA 5F1RA 4WCGA 3FMQA 1ZG5A 2HTJA 3U11A 2XL7A 5L3BA 1WI9A 1MKMA 3EQLF 3GFJA 4AIHA 4XBFA 1YW8A 2CAUA 4PJYA 3SMHA 3C18A 1PP7U 1LNWA 2ADUA 5D6FA 2GC0A 3T0YA 4ZYGA 2RN7A 2FQ3A 3JAMK 2KRFA 2TDXA 2WC2A 2MLGA 4Q0UA 5A2QZ 3FMRA 4UVCA 4XLNF 4CXFA 2YX4A 4LG0B 3S2WA 3RIRA 4UXAA 3LZZA 3WTXC 4NHJA 3DEUA 4OLLA 1YUDA 2ATFA 1S7OA 2E7WA 3D0SA 3IKVA 2Y75A 2NNYA 1X8EA 2QUFA 5LGNA 4XSZF 1FBSA 1XN7A 2P6SA 3KE2A 3NEUA 3QACA 5EFUA 2MC3A 2KJCA 3ZQ7A 5J8FA 3EUHA 1T0FA 2VE8A 2H6CA 3E5XA 3KP6A 3OTFA 3V8LA 4WXCA 3WU0A 4MNUA 3WTVC 1ZYRF 4MV2A 3V7CA 2M8EA 5I0RA 1HW2A 4EROA 2HYGD 4KIBA 4IEQA 1VJ2A 3R61A 4ASNA 2DT5A 3IRQA 2XGXA 2LDUA 4GCVA 1YS6A 2QJVA 2L01A 3QU3A 1FT9A 3MQ0A 2VBYA 1YG2A 4A0XA 1KQ0A 3IRRA 1QZZA 5ICCA 1IXRC 1QY4A 2M30A 2PLYA 4FT8A 3HOSA 2UXNA 3WTUC 3NQOA 4GGGA 2D45A 1JHFA 2O3FA 5HI0A 3V8KA 2Q2EA 3W6KB 1IN5A 3FZVA 2WFPA 4WVZA 3BROA 1ZH5A 3HT1A 4MH0E 1HQCA 1UFMA 4AQ6A 2G9WA 2MNGA 4Y15A 2P5KA 4YFNF 5K5OA 4KICA 5FGMA 4P5OA 4MQ9F 4Q5SF 1EH8A 2IJLA 5FLHA 2W85A 4HF1A 3FXRA 4MGKE 1FOKA 4LD5A 5K5QA 4O5VA 2R3SA 4IEUA 2EA7A 4PIXA 2ZXJA 3NRVA 1WWXA 4A2UA 5BPXA 1FX7A 4XF0A 4HMZA 2UXXA 2GC2A 4A12A 2V09A 2HDCA 2NNNA 4G9YA 1IRFA 1D8KA 2QBYA 1NE6A 3JTGA 5FD5A 1FYLA 4HW0A 5I93A 2EAAA 5CVRA 3CO7C 4KU8A 3S0MA 3BJ6A 3COAC 2K9ZA 1YFYA 1BIAA 3QAHA 2RVCA 1B9NA 4OU0A 3DL3A 4GXOA 4UVBA 1PUEE 3D82A 1XDUA 3ZMZA 2A6EF 2FBKA 1UB9A 5J8CA 4EJUA 2XUBA 2E1NA 1K7AA 2LKPA 1TTYA 3WTSC 2D1HA 2ZBKA 4Z82A 1FNNA 2H0VA 2HYFA 4N0BA 4RS8A 1EV7A 1EH6A 3CJNA 4YIFA 5HS9A 5TJJA 3M8FA 2IXJA 5JAXA 4Q47A 2D93A 4XF3A 4KWLA 2L3DA 5FB2A 4QX5A 5DUIA 3G3ZA 3BY6A 2ESNA 3BJAA 2GZWA 2IPQX 2XKOA 2A6HF 4MHGA 3K1PA 1HBXG 2ZO4A 2HEOA 2D5HA 4AVCA 3ES4A 2NYXA 4HVRA 4HQEA 5CVVA 2GIVA 3KMHA 1U5TC 5DCFA 4KMUX 3U1DA 3EYYA 5E18F 2Q0AA 1OYYA 1GQHA 5F64A 5E1XA 2ETHA 1P4AA 3KP2A 1YFXA 1RUNA 3NW4A 3ACLA 4X6RB 3EHKA 5CVJA 2H6BA 1F4KA 1BC7C 1Q5OA 1B9MA 2V1DA 3ECHA 4UV9A 3HRSA 3KSCA 2MHFA 2UZKA 4EWEA 1JXSA 2J5OA 3PLQA 4QM9A 4QGMA 4IXAA 2L54A 4BHPA 4A0ZA 1T2KA 1ZRDA 2YSRA 4IHTA 2YU3A 3U2RA 4G7OF 3PNAA 4FBFA 2VBWA 5BPIA 2K02A 4HLTA 5I0TA 3IDBB 1ZZ7A 3E5QA 4WK8F 5H6RA 3WW3A 3V7SA 3TNQA 3FWEA 1T6SA 1UW8A 1I6XA 5I91A
chains in the Genus database with same CATH superfamily
4DY5A 4MTEA 1W1WE 1TNSA 1WJ5A 3A1YA 3CIHA 4PF5A 1ITYA 4N43C 4YW7A 2VNRA 1OCTC 4C3JJ 1KQRA 4RGRA 4M71A 4XFFA 1P7IA 3H1WA 3IDCB 5H9PA 1BLZA 1UZWA 1XB4A 1QXJA 3ILNA 1GP6A 2JDAA 3U1KA 2AZ5A 4Q0QA 3G73A 2GA2A 1MJ9A 5M3MJ 3MZ8A 5L3GA 4FCAA 2OW4A 2P3YA 2HOSA 3ETQA 5D4SA 3KZZA 2A68F 4MXWA 4IJAA 5T5PA 1LEBA 3BR6A 3U37A 4BQ3A 2BV4A 3CZJA 4A7ZA 2HLEA 5D5XB 4YARA 3WF3A 1QEXA 3FLRA 1W3VA 1W9TA 3D3AA 2R16A 5T52A 4BM8A 1F4AA 1UMZA 1R1A2 2VU9A 1QU0A 4YZ1A 2ZHKA 4XETA 3QP6A 1E0EA 2F2EA 2XJTA 5B4NA 1BEV1 4GKXA 4N53B 3V7RA 2VD7A 4XCBA 2Y31A 2PQSA 3AYDA 1K78B 1FPN1 1I9RA 4CUGA 4NVPA 2JG9A 5F2SA 1TWGJ 2AEYA 4LE3A 3BZKA 5E3LA 5JOYA 4MSVA 4FX4A 2ZFWA 4Z07A 2VASA 2LYCA 4HOBA 1XG1A 1FZPB 3TBIA 4AAPA 3F2ZA 1WLWA 4KGQA 4UUSA 3OB8A 2RGVA 1ULGA 4IEOA 5BNNC 5BNGA 5KHDA 1FTTA 1NLQA 4URAA 1DGLA 1US3A 2XAQA 1XSQA 4RLQA 3GJBA 4XDPA 2HWC2 1R4MB 4LO8A 4Y4YA 1U2WA 1W05A 4M3GA 1UZZA 2HKXA 5JWPA 5GZCA 4QMAA 1R7JA 1R1UA 2PHXA 4JP0A 3DPLC 4HAMA 1S0GA 2G19A 4YM2A 1HQNA 1W9SA 2ZXHA 2HPMA 1E17A 1SFKA 3HOBA 1S0JA 4QXBA 4D7YA 2DCYA 3PUHA 1TMF1 4QB2A 5IT3A 2P81A 4DNYA 2ZNZA 1QBJA 1W8ZA 3AJYA 2RDNA 3LA3A 4MVTA 3E1SA 3JQWA 1W7PB 1P6RA 2QGUA 3GBGA 1CZSA 4PI0A 3IUOA 2ZXQA 2OPTA 1UYYA 5HCFA 1RUJ3 4IRGA 1G7YA 4Y22A 1FYUA 3D8CA 4XUQA 1JYXA 3WNPA 1ENXA 4JRLA 1TNFA 4LLOA 1ZGJA 4XILA 3HN1A 3LSDA 2ZGQA 1Y4WA 2LY9A 3JRHA 4Y1UA 5J4VA 3ZMTA 2VZTA 3S30A 4R9CA 1HRV1 5JSRA 5KXCA 1W5TA 2VT2A 4NIGA 4EGZA 4L5JA 1JOBA 4PBOA 2CGOA 4ZPIA 4A42A 3GVAA 1JTZX 2DDBA 4Q27A 4EN7B 1W0NA 3I3LA 4DINB 1GZWA 3UESA 2XAJA 2O61A 4BQ4A 1V00A 1QJZA 4DEQA 1DGRA 1RPWA 3A22A 3IBMA 2VXZA 2ZGSA 2VMGA 1D4VB 4WZCA 2EV6A 3SEEA 3BKZA 1DPUA 2XAGA 2GA1A 4M3FA 3I55I 4GULA 3BUCA 3Q0VA 1Q43A 3CCLI 5JOXA 3PIGA 4ZDOA 2QQLA 1DQ2A 4MYEA 3ZXDA 3ZXLA 4AIDA 2DTWA 3SCGA 4BU2A 5BYNA 2OZ6A 2AHQA 3CDZB 4CDXB 5B2GB 5IK7A 2V7FA 2B45X 3ZYPA 4YZ3A 4EN9B 4PF1A 3ZMUA 1REDA 3P9CA 2NPIA 1BMV2 1D7PM 3LF7A 4AG4A 2XROA 2EFOA 1X58A 4EJOA 3ML6A 2WAQA 2IWGB 4XTMA 4LNVA 5CZKA 1FYMA 1KGYA 4HPKA 4KBZA 4E4ZA 4G4FA 3IMMA 1RR8C 5C71A 2BY2A 2JRTA 1D5YA 3MV11 2BWAA 3FISA 2GN3A 5FYSA 3AL0B 4FOQA 3FXKA 3RSNA 3T0BA 1KU3A 5CVUA 5FYMA 2QQ9A 5J09A 3ZYHA 1GMMA 1W8WA 2BZTA 1ZG1A 3AB0A 1XMXA 3ABUA 2HWE1 4CP9B 1WH5A 1FSEA 2R7FA 5CVIA 3RZGA 1VRBA 2WNUA 2FXAA 2RJLA 1WQ2A 5LBEA 4EJRA 4Z92B 3WCRA 3LAJA 4PSWA 1U8RA 1QNTA 1ZZCA 3BOWA 4CUCA 3I97A 1IQAA 1ZNPA 4OMYA 2O5RA 2ZSHB 1JUIA 1IRXA 4FCYA 1LULA 3WDUA 3KFWX 2BV6A 1G6NA 3Q8AA 2WB1A 2J22A 4H7MA 1BI0A 2GOMA 5JI6A 4UBGA 2MH9A 1FWZA 2MG4A 2LS6A 1MSEC 5KK1A 3UGGA 2FRHA 4JGZA 1L7LA 3TBDA 3K4ZA 4GA9A 4JYKA 1NCQB 4MGIE 1W2TA 4QGNA 5FOJB 4B47A 3ALQA 2BTVC 1XGOA 1W6QA 2H09A 4X8PA 4B1LA 3AKSA 2RNGA 2XASA 2DCKA 3HKZN 3DKYA 2R7WA 3A0BC 1D5VA 5ANNA 2L9LA 5K1YA 4XJAA 4FAGA 1XCBA 2JIGA 1MH3A 4TN7A 1LE8A 2UYBA 3WDXA 3ELNA 4XKBA 4N7IA 2L2OA 5F27A 2VM9A 3ENRA 2R49A 4ONUA 1J09A 3HRTA 3GW2A 4MEXF 2QSGX 1UYZA 3NNMA 2KDOA 4PFPA 4HF2A 5I8TA 3FUOA 4UFJA 5GPAA 1R1ZA 4F7ZA 1NCRC 4JOMA 1LEMA 1JZ7A 1W8NA 3RGBA 2R7XA 4IOCF 5EHDA 5CADA 4LIUA 1Z3XA 2V1XA 4ARYA 4YM3A 1QXRA 2RV9A 2E7TA 4AYBN 4E4DX 4EATA 3B9CA 5D5VB 1AR92 2FQPA 3DBHB 4NHKA 1D2SA 4DY3A 1OUXA 2CWSA 1GQGA 4AFAA 2CSGA 2TUNA 4TYSA 4CCCA 3BU7A 1OSGA 5AFBA 3ZPYA 5A3PA 1S4CA 1UKGA 3AKRA 4WM8C 4AEDB 1MMGA 1FNZA 2F5FA 1DQ5A 1IPJA 2ENRA 4Q1PA 4FPGA 5FZ1A 4UNOA 2ZEYA 2CH0A 5L7OB 5GKAC 4FQZA 2Z2SB 1SFYA 5DAXA 2FBEA 2KJBA 5LGUA 1BHGA 4IEZA 5JSPA 3CJIB 3MIDA 2NYYA 2V5DA 3ZR8X 3CO6C 3RWKX 5IATA 4B1RA 2XLFA 2GBYA 1X82A 2MSYA 5JR7B 1VBC2 2VXRA 2M45A 3OCPA 4QHBA 1WSUA 1RC6A 1Z6TA 3A21A 2CUEA 2VQ0A 4B29A 2WZPP 2MYSA 3VFZA 3W5NA 4R9AA 3GTQJ 3CMAI 3CJTB 2YDEA 1PX4A 4K9SA 5BV6A 4IETA 3RZDJ 1RI7A 4Q4V1 2HEVF 1N3OA 1TP4A 2PHDA 1VFCA 4P9YA 3M8EA 4UFHA 4LGWA 3PVBB 3VYRB 1F35A 4LB5A 5FZBA 1FIPA 3GUDA 3BQYA 2Y6HA 3A0HC 4BMEA 3DP7A 2GXBA 4UVAA 3V42A 2QM3A 1CAXB 3LDBA 4IEYA 1OFNA 5AFEA 3E6CC 3KM5A 4RR3C 3R4UA 4P55A 1MZBA 2LKSA 4UBHA 2LBFB 2NN8A 5GM0A 2QNKA 4AWXB 2CDOA 1FY7A 1XS9A 3B01A 3GFLA 4E6KG 5DXDA 2WRAA 1VQMI 1PM7A 3OV8A 2QFEA 1BL0A 2JG8C 3T1BA 3H8UA 2RR12 5A6XA 4ZZDA 3PNYA 2V6CA 2F4MB 4LR4A 2H94A 1SMTA 3O5SA 3FK6A 1OMIA 4GJYA 4DOZA 2J1SA 5FOBB 3NL1A 1ZBA3 4K1YA 2ISZA 1NA1B 3H35A 4HNVA 1VBB3 5K7HA 3C8XA 2DAOA 4NWVA 2CL2A 3BPXA 2P17A 2VZOA 4Q0PA 4RGGA 4I3GA 2JEMA 4CICA 2OCCH 1O91A 2K7LA 3I49A 3NARA 3PL8A 3LAGA 3VZNA 4RL7A 2R5YB 3LA7A 2XAHA 5HCBA 5FYBA 5B1BH 1ENQA 3J26N 3JBG3 3WE2A 2KPMA 2CGNA 2RS33 4CU8A 2LROA 1WD4A 1V3FA 5KR7A 3UNPA 2BW3B 1W9WA 3BZ6A 3LWFA 3VLBB 2XMLA 2YBKA 2TCTA 1JUPA 4Z2AA 5GLVA 1E3PA 4BMBA 2O1QA 1WCUA 2IZWA 4W1UA 2MEV2 3P5JA 2B9UA 4COZA 2R7OA 4FQGA 4FTSA 4XFHA 3LSKA 3M70A 5JHUA 1H9GA 2CQXA 2P34A 4NMIA 3GBWA 2PMUA 1JMUB 4YGBA 1E57A 2CJJA 2VCAA 5C3SA 2PN5A 3SH3A 4UHTA 2OA2A 5M0TA 4JDOA 4ZHNA 4IEVA 3OOUA 2XHKA 3K1MA 1KQ8A 1R093 1U78A 4G6DA 1FV3A 4X8NA 5DAQA 1TNRA 3NNLA 3Q9SA 1PGSA 3KP7A 4XURA 4CEYA 3S5AA 2JDZA 4QU1A 5F6FA 3SCFA 2OF7A 4LBJA 1EV12 2ARXA 3KV5A 4KYWA 2HYKA 2FZ2A 4KWJA 1OQ1A 2LALA 4IDZA 4LBQA 1JU4A 2DJIA 2OKXA 3JUUA 2ET7A 2V9PA 3GTMJ 2AH2A 2EB7A 1AVBA 4N43B 1WKYA 4CE8A 5L3DA 5D4RA 3HDDA 2JG9C 1MD0A 1YJWI 2RS12 3ZR6A 4P9FA 2XKPA 3KP4A 4ETSA 1LEAA 1HB1A 3OD0A 4GB32 4BE1A 4LO7A 3PIJA 5FK8A 2E36A 4AVSA 2IXIA 1T95A 3WGGA 1F31A 4PI2A 3ABTA 4XUNA 3CCUI 2CTVA 3J8F1 1JODA 1MMAA 3BR3A 2DCZA 3T08A 1ZBA1 2W4SA 2WO7A 3CF6E 1S2EA 5FFZA 2H8RA 2Q0OA 3OG2A 3IIAA 4V2FA 4DOUA 1UZYA 2P3KA 1OOPC 5BY5A 3OYFA 1QGLA 3MMYB 4XJZA 1ENHA 1UU6A 4BIFA 1I27A 5J3UA 3MDPA 1S3JA 3HEIA 1A34A 3MUZ1 4PSXA 4HA8A 5FY1A 2RS31 5A3UA 1VE0A 3N9OA 3K7AJ 2Y48A 1IV6A 4SBVA 5B1AH 2KP6A 4IV1A 3AM2A 5DDJ2 3ILRA 2HWC3 4HV5A 4XF1A 3W2WA 1A8MA 3FBIB 5A7PA 2W87A 2KQRA 3ZIWA 2QQMA 3WDTA 3T2QA 1AZDA 4E8CA 4ZY9A 2Y0OA 4BZ4A 1SLLA 3ERMA 4KQ7A 3LWCA 1LKNA 2H1LA 2FMYA 3SDBA 3RCOA 3I2IA 1AX1A 3M2MA 1KGSA 4K1ZA 5FO7B 5KHJA 5J6XA 2HBUA 4WVWA 2QKMB 4LK0F 1OD3A 2YR2A 3NV3A 1QIQA 5DD4A 3S57A 1ZBE3 3NAPA 4E7SA 4M0NA 2XPWA 4Q4Y3 2LRDA 1VBE3 2VGDA 1WLTA 1X9TA 2WA4A 4Z2WA 5CFCB 3ZRGA 5A1FA 4M9XA 5E20A 1LHOA 2QQPA 1YRNB 2LMDA 2I2SA 1HN1A 1YIJI 4BJ0A 2M5WA 3AZXA 1CR7A 2ACJA 3I2DA 4ZZ8A 1BC8C 4YFKF 3EMRA 4AW7A 3ITQA 4BDVB 5BQTA 4Q2FA 2BEOA 5HCAA 1MBKA 1R1A1 2EPFA 3CJRB 1GKBA 2IUWA 3KF5A 4Q4X3 2XG3A 5H9SA 5EYRA 5A32B 2ZABA 1SPPA 2GC3A 4XUTA 4HL0A 3GTLJ 1ODMA 4I0WB 4IXLA 2PTMA 4B3NA 2J1EA 1KU2A 4UOJA 2XB6C 4C9YA 4CCNA 1JJ8C 3JAMZ 3VBUB 4HLXA 4ZZ5A 3MD2A 3DCQA 4ZONA 3UNGC 1GP4A 1UELB 1X1PA 3SFZA 3HKZA 5GLZA 3VBFA 4DXTA 4IX7A 2WS92 3FHAA 1AXKA 4KDPA 3LDRA 3UT0A 4AHZA 2DJNA 2ARCA 2LTNA 4XOTA 4C1XA 5TISC 4L2NA 1UOBA 4AEJA 3M3YJ 2JMWA 2GMPA 1ND2A 4U0VA 2HWC1 5JMCA 5DCMA 5LD2C 1LQ1A 2QUOA 1R5ID 4J25A 1DP3A 4IL6C 3I2JA 5FXXA 3ZN0A 3DFGA 3CC2I 4P00B 2WNUC 4YGDA 3O1RA 2QZ8A 1LDJA 1DP0A 4FASD 2CV6A 3S15J 5EWSA 1FI2A 3WV6A 3ELKA 1F8VA 4PCQA 4AYBA 2W2IA 3NAUA 3ZXFA 2GC1A 4QIWN 4AAXA 2G7HA 3KVAA 1RUF2 5GLUA 5JZGB 1PVC2 4META 1R71A 3R6SA 2BQPA 2MH2A 2AR6A 4CXXA 2E7XA 3BPVA 3ZFEA 3VD7A 1Q1VA 1WJDA 3J80K 4QX2A 2DTRA 2P1BA 1MJBA 3WY6A 5DG1A 1POV3 3NJZA 1SEUA 1AYM2 5FFXA 5F5CA 3LSJA 3ZR5A 2AYHA 2W91A 1Y0NA 1NAEA 2XLGA 1WD3A 2KR2A 4DZPA 3V0AB 1AWCA 2KM2A 1EH7A 3W21A 5M3FJ 2K5CA 1BIBA 3K69A 3TP0A 1YJNI 4QU2A 1Z78A 5KXEA 3VWBA 4E8DA 2NOJB 2V1UA 3K48A 1C8NA 3O7OA 1P4XA 4ISQA 3F72A 2IRFG 1ULDA 4DQ2A 3ZOBA 4C2UA 2IC1A 1J1TA 1NXMA 3HYIA 1JYTA 5EJCA 1FMD2 1JKOC 4XAEA 2AXTC 1SD4A 5A1AA 1DGWA 1HXDA 3IKWA 2HZTA 2M0CA 1RYYA 2XAUA 1SFUA 5IT9K 2WA3A 2CW0F 4EM1A 4YRDA 1ENRA 1QZEA 3I2FA 4ZTJA 2HGCA 5DG2A 1SDWA 1S1AA 3MYXA 4U7BA 3SISA 4ASLA 3CP2A 3OEBA 1TQMA 3IN9A 1VB2A 1HOMA 3KZ4C 5DMYA 2LUWA 2VJJA 3E3VA 3ACFA 3UL2A 1IKQA 2IXLA 2PHUA 1Y9MA 4A69C 2D1VA 3AG2H 2V4VA 2ZNYA 3LEGA 4XFGA 3ASNH 2NMNA 4XBQA 1ZLJA 2JRMA 2LG4A 5LBBA 1BMV1 1BW5A 2OPWA 1UG0A 5EGOB 1SLIA 4WF2A 3WVJA 2B39A 1Y7BA 3WF4A 4AGRA 3O2PE 5HOOA 1KRIA 2F4PA 1OKRA 4OIQF 2X9DA 3BR5A 1AR82 3FHIB 2L02A 2JN6A 2C0ZA 2ZAHA 3M1CA 5ICGA 4M3CF 2Q30A 1AR93 3TDUC 1TVGA 2UWCA 2KIUA 4A7YA 4NIDA 2X5IA 4KNCA 2XPJA 5F32A 2HVSA 5FY9A 4BS9A 4BQAA 4QTRA 3BIEA 4C30A 1ZRRA 2BP6A 4NO4A 4PDKA 3RQ0A 5DZEA 4A3GJ 2Q2EB 4PBPA 3BTIA 2Q8OA 4CHUA 1UXXX 2MPFA 1VQNI 3ZQGA 2A6WA 2E19A 2DA5A 4XFBA 2WN3A 5FZAA 4EQVA 5LFAA 1POV1 4G6QA 1XBFA 2WV1A 5GPCA 4COYA 3RTRA 5FYTA 4JTOA 1DQUA 3LSRA 1VBC3 1MZ6A 1U5TB 5F8PA 3O14A 4E2SA 1PNGA 4WM7B 1IZ3A 1S7EA 1MQTB 1FIAA 1WW4A 2R7VA 1PYVA 3BCAA 3CJQB 4W97A 4K8RB 3HHHA 1A78A 1AR72 3LSTA 1U5XA 3BTLA 3PU8A 2SBAA 2V4JC 3SQNA 4CA9A 3UGHA 3JD72 3PUAA 2K46A 2XXZA 4IEXA 2P4EA 4XMAA 5H9RA 3LQRA 2VOXA 5CG9A 2V5YA 3NNFA 5DM6F 5B66C 2ME6A 4AXOA 1LFBA 5B4XA 1URXA 3WT3A 2VQCA 2E6VA 3A23A 4WVMB 4BH9A 2KT0A 4E9KA 2CNAA 2WYSA 1JGGA 2NRAC 4OQ8A 4I02A 1IKPA 1KS5A 4KA4A 2W00A 2OUJA 3M9AA 5FPXA 1UHMA 2HQRA 3AFKA 2BE5F 4N9HA 4GRIA 4JGYA 1O3RA 5K4LA 2IBDA 5D21A 3VBRB 5FZ8A 2HYXA 2RR13 5GTHC 4YG3A 4IZZA 1FSHA 3K4LA 4XTPA 3I54A 1USTA 4NQWA 1MDMB 1E5SA 2VT3A 3LOIA 2DCTA 4RN5A 4B09A 1AR91 4OHYA 1IGNA 3IP4B 1BVVA 4BEHB 2N7GA 4IE6A 1G3SA 3VDCA 2ZJPF 4WVVA 3LIHA 3WHUA 2X51A 4J00A 1IXCA 2K3FA 4NIHA 3VYSB 3BP8A 5F39A 3DTEA 2JA7J 1T08B 3U9GA 2W94A 5DDGA 3JRCA 4DNCA 1VBA1 2ZGMA 4BBSJ 2JECA 3CUQB 1STZA 3USSA 4I2OA 2JK3A 1DYKA 4MHRA 2GIZA 2Y0SN 3EJKA 4YGEA 1YYNA 4X6QB 1QJX3 4GDFA 2JX9A 3RI8A 4CEYC 5L3EA 3NWKA 2E35A 4MGTA 5T50A 5A3LA 1VBC1 1U0JA 4G94A 1JGSA 2IGOA 5A6ZA 1UIJA 4ANJA 2OJED 4GAZA 5L3CA 4LITA 1O7LA 5A33B 5BPDA 5E88A 3HUGB 1H9PA 3KT4A 3AG4H 1X4PA 3ONQA 4XOGA 1D0ZA 1ZG5A 2P37A 3DEWA 4OHVA 2JE9A 1NQJA 5IT6A 1MKMA 2M4GA 2R5ZA 3R0RA 2CAUA 1NT0A 3WXPA 3BTAA 2B63J 4LORA 1LNWA 2GC0A 1JYCA 1LOEA 1EV13 4DO0A 3T0YA 3HWJA 2RN7A 1YC61 4XJ8A 1T33A 2E60A 5FYCA 5ISLA 5A2QZ 2X1CA 1G2HA 4LO4B 1OUSA 4PJ0C 3PUBA 4CXFA 2YX4A 2RS13 3C2HA 2BWCA 3K46A 4UXAA 1U9NA 1ONAA 2R1DA 4CZSA 5CQEA 1GZCA 2ZB9A 1YUDA 2L9SA 2AEZA 3C7OA 2WFF2 2RR11 2Y75A 2EXHA 4XSZF 3AMNA 1XN7A 3NEUA 3KVBA 1XTAA 1EF4A 1V6OA 2WDBA 5C5UA 1RINA 4UUSB 4IV1C 3V8LA 4WXCA 1JKPC 4MNUA 4CDQC 2M7BA 4MV2A 1HIXA 2HOTA 1BBT3 3WF0A 2VKHA 3FXJA 2HYGD 4BQNA 2LK2A 3T09A 4ES8A 2OQ7A 4ASNA 2R7SA 1IGOA 3GNEA 2LDUA 2QJVA 1MS1A 4NPLA 3RJ2X 3LSMA 4XZUG 5C3OA 5C8CA 1A6IA 3K10A 1PO22 2Q5TA 1MBGA 1NLRA 1KXGA 2ZOEB 4NHXA 4Y5TA 3WNLA 3NQOA 2D45A 2GP5A 2FUG2 2JVHA 1IN5A 4FO9A 2Y6KA 2FCUA 2JA6J 1DGWY 1ZH5A 3SKJE 2Y6FA 5A7NA 1UFMA 3CC4I 2MEV1 3NAPC 2G9WA 3KCYA 2P5KA 1UOFA 5K5OA 2R042 4JX4A 1Y56A 2DA6A 3OIPA 3OYLA 5FLHA 2VBDA 1FOKA 4C3IJ 1ORKA 4Z1VA 2DODA 3B6CA 2WNVA 5BPXA 4XF0A 5FREA 2HDCA 4Y22B 1MBHA 3SEPA 3JTGA 4F55A 5EXOA 2L7KA 3U4SA 5F2WA 1UF2C 1FOXA 3K51A 5I93A 3KV6A 3CO7C 4A93J 3S2HJ 1HA8A 3S0MA 3S3MA 1SBFA 2EZLA 3BJ6A 1EV11 3COAC 1VMFA 3CMMA 2K9ZA 1YFYA 4DW6A 5F08A 3KV4A 3UKGA 2RVCA 1B9NA 1AF9A 2YGLA 1SHWB 4OU0A 3RG0A 5FPVA 4UUTA 2WSUA 1GOHA 1UB9A 2L9VA 1GZWB 1QPIA 3EB7A 5FZCA 5JIUA 1TTYA 2RS11 5D8AC 3G1OA 1ZTRA 3ZXEA 3Q8FA 4OUSA 4GB31 1GZ9A 1FNNA 2H0VA 4N0BA 3CJNA 3VBFC 3WP3A 4DUWA 4KWLA 4QX5A 3G3ZA 3ZQQA 4P5HA 3BY6A 4UW6A 3VN4A 4XMIA 3POFA 2HEOA 2D5HA 4XKWA 3FL7A 4AVCA 1ND2C 4D7NA 5JXIA 1X1BA 5CVVA 3GCXA 2JWTA 2GIVA 4BDYA 4XLCA 2ADDA 3DGTA 5FRNA 2XJUA 4QKFA 5E18F 5IAXA 3RI9A 5EQUA 2YUEA 5E1XA 4YPJA 3WP4A 5FZKA 2BBVA 3K2AA 5BNPB 1YI2I 3A4CA 3NW4A 2WS93 5CVJA 2ZHNA 1ULOA 3IAPA 1B9MA 3HQRA 2V1DA 3QYFA 5F0CA 4HPKB 4XABA 2WNOA 3CMYA 3M8LA 3QQAA 1GVDA 1PJRA 3CMGA 4YW6A 2UZKA 1JXSA 3LSIA 4QM9A 1T2XA 5DDJ1 2BRTA 3MF9A 3ZFEC 1T2KA 4A0ZA 3H3VK 3BR0A 3ECQA 2YSRA 3Q3SA 3U2RA 3PNAA 5IVBA 3VZKA 1EAH1 2ZXIA 5I0TA 3IDBB 4D7MA 2ZA9A 2OS2A 4CPBD 1SVLA 3WW3A 3QPLA 4CDWA 5I91A 3WODF 4XHBA 3DWLE 4D6SA 1JOPA 3EDPA 2FX0A 1QQIA 1RUF3 2OCEA 2OIIA 3HL2A 1BOAA 2NVXJ 4C3HJ 2P2KA 2VJXA 3CCYA 5HVQC 2FDKA 1G9FA 2DFFA 1DIWA 3PJYA 2B4KA 5CLSA 2QTWB 2DDUA 1RTVA 3U0ZA 4Q29A 5L36A 4OIPF 2YBPA 3S32A 1JUHA 5G04L 3CQOA 5K7FA 3ON7A 1NHAA 3K4BA 2DVBA 4J01A 2DDAA 2NVTJ 4KBBA 2BNOA 1GU3A 2VN2A 4LE4A 3CZUA 3F95A 5G05L 4JGZB 2ME0A 3I71A 3W3CA 3KP3A 1Z0HA 2OZJA 4KN7X 4S2DA 2QWWA 2RS53 1W6QB 2XPUA 3AAFA 1XPXA 1AJOA 4G6TB 1VAKA 1CJDA 1FP2A 5EJZB 3D1NI 1XNDA 2JKXA 1ULYA 1FMD3 4M6YA 3FJSA 2WAOA 1YLLA 1XD7A 1PM4A 4G3YC 1J7KA 2A6ZA 2R7EB 2OPKA 5C3PA 1V4RA 3ROUA 1EJ9A 3PTYA 5JR3A 3BVCA 5F04A 2GAUA 4HANA 2DT7B 5C8WA 1G9BA 2TBVA 4CP9A 5LLQA 3BTCA 1OPOA 2WLPA 2PHWA 4EN8B 3KGZA 4WZFA 4XF4A 4IESA 2BGCA 1G4DA 2X5IC 1HQLA 4L99A 2C5DA 2MBFA 2UY9A 2W08A 3WQ7A 4LBQD 4DQAA 2VOOA 1X19A 5DPNA 4IHYA 5ABJB 4KU7A 4LUKA 2JA5J 3CJXA 3F8MA 2V73A 4RGXA 2GXAA 5FO5A 2R92J 3FHZA 1Q8SA 1DUXC 3L00A 1OKQA 1UHSA 3WNKA 1UYPA 2BNMA 1AR83 1AL22 3JSOA 4J1XA 4HXCA 3PTRB 1PZ8A 2RMU3 2XBO2 3HHGA 2LKXA 2R32A 1WLDA 5FZIA 3O1UA 5ILVA 1QU3A 3PM1A 2DMTA 2KRCA 4YSFA 4R52A 1W06A 1FOD2 1OHFA 1NCQA 5GP9A 4L5EA 3ZCOA 2D43A 5GAGJ 1RUF1 2KIQA 4O61A 1XDSA 1PVC1 1PIV2 3IIIA 4BHCA 1NX9A 3WR0A 3ACGA 2M0MA 5D5WB 1BXHA 2B42B 1W2UA 1D1CA 3OGVA 2F5CA 3KQRA 3KQ4B 3MEXA 1Z0XA 4OI0A 1UX6A 1O7FA 4A44A 2AENA 1HRI3 5HPOA 1IQDC 1PZ7A 1ZHFA 4QPQA 1R4NB 4CCOA 1UPSA 4I98B 1IAWA 3HXLA 1LNSA 2A6VA 4ES9A 1WW7A 2YC0A 3BTJA 2Y0SA 4LULA 3OD4A 3GLLA 1AYM1 3LGRA 4P14A 2KHMA 3FFQA 2W7NA 1TG7A 4IV3B 1J3PA 5BS6A 5FZOB 1V6LA 4COWA 1WA6X 1J1LA 3SZPA 2IS4A 4E4HA 4A5NA 1RUOA 2J1RA 1G8WA 1POGA 2HKOA 1AR73 5EZHA 4AK3A 1GV5A 4NRPA 3HRUA 3QH7A 4I99C 1UCRA 1FMD1 4CU9A 4LTAA 4EN6B 4JGYC 3ZKYA 5IY5H 5D1IA 1QDCA 4AUXA 3S1NJ 1U3EM 1N1TA 1H9WA 2VOWA 2E7AA 4AEDA 3E1F1 1ZGAA 2FJ1A 3QPSA 1ACIA 5H9QA 3BI3A 5LBCA 3M3CA 2BY1A 3H5NA 3TQNA 3H36A 4Z2YA 1H30A 3A02A 4BOWA 1ZVFA 4CEWA 4PCRA 2QQNA 3GJAA 3CJIA 4XORA 3NKGA 3BIWE 3TGNA 2PBIA 4LBKA 1TBXA 1UXZA 3JU9A 1YFWA 1X2MA 1I5PA 1S29A 3ZOIA 2EXIA 2Y0IA 2KLOA 2YB7A 1QWRA 2ARAA 2FEZA 2EA4A 5IOYA 2ETEA 3ERED 1Z9CA 1XSRA 2R7ZJ 4KMFA 3NO8A 4II2A 2ICWG 1AR81 3OYAA 3UK9A 1E3HA 2FDGA 4DXZA 2EH3A 2B8MA 1HCRA 4NRQA 3Q5FA 2ARBA 3L7WA 1VBD2 3LNQA 3DTKA 1IRGA 1D0HA 4XVHA 2DFHA 3SH4A 1ETQA 2VPLA 5FZEA 1XCVA 1CIYA 2Q8KA 1BYHA 1T6BX 4O3MA 1WKMA 1CAXA 2JDNA 5IYDJ 3P9KA 1W8UA 3DEEA 5JI9A 2NP0A 2EIKH 4JTNA 2LBFA 4HETA 3E6BA 5FUPA 4XN3A 4B7KA 3V65A 3RKWA 2UYAA 2WZ8A 1O4XA 1ZYBA 1PDNC 2PI0A 2D2WA 4EGYA 4MGQA 4RD7A 4ZDPA 3TW7A 2YX7A 3VYUB 2NXNB 1DZTA 5JFRA 4KL1A 1LDDA 2KKOA 2IS1A 4YFXF 1LJ9A 3BT9A 3GTGJ 4YVSC 1O59A 1J0RA 4K3UA 4LPLA 5HXMA 1CD3G 3TOBA 1AR71 5C4WC 1QQP2 1SC7A 1B6AA 3M1EA 3PSFA 4L0PA 1NA1A 4LBQB 3USUA 3PIOF 1FOWA 2PA7A 1Q8QA 3LSHA 4HLYA 1XGNA 3JD71 4BQWA 5LY2A 1QH6A 5SV5A 1VRH2 4P9GA 4HKLA 4AE2A 2JXAA 1O5LA 1FYKA 3DUIA 2WBMA 3FC0A 3LL7A 5EG0A 3GLXA 3I59A 3OY8B 2RE9A 2Z4FA 3OIQA 5LBFA 1JXNA 2UUZA 4EVIA 1DFQA 1EY2A 3I0TA 5HS7A 2BW3A 1WCSA 5TRDA 3OL4A 5ILSA 1EPZA 4R79A 1MBFA 3K4JA 1YFHA 3O8HA 4JX6A 3L2RA 2DVAA 2Z33A 1U5IA 2HWB3 3NMBA 3HTSB 2CV2A 4MO7A 4A7KA 1ETYA 4LOCA 4AVZA 1MACA 4Y7NJ 3D6EA 2QA4I 4AI8A 5H20A 4N4NB 2GNBA 4AGGA 3QYEA 3PURA 1OA4A 2HYJA 1N3PA 2E33A 5CU1A 3NKTA 1GR3A 4AD9A 2L7FP 4LA2A 4H4KC 4K21A 4Q4W3 2QCOA 2QQJA 2ZX4A 3CDIA 1R1VA 2EFWA 3VOEA 3CUOA 1WCQA 4Y3OA 5CISA 5JSOA 1UMIA 3K1NA 2IXHA 2E1OA 1PO23 1RUH1 1OLQA 1Y8QB 2B0LA 4D94A 2DUQA 4LKDA 3MI8A 1O3TA 4FFFA 2ILMA 1OCOH 3DKXA 2W9XA 2VMHA 3OS1A 2Y33A 5A7WA 1XGSA 2CQNA 4FPCA 1LDKB 1QJFA 2R043 1JKQC 1SD6A 3S3NA 1OVPA 5HLIA 3MWMA 4B8EA 3C7GA 3NAPB 2YPDA 2FD5A 1S6LA 2NVQJ 2NQYA 1KA8A 3FXLA 2JA8J 3O12A 4XKVA 1ND3A 2BPA2 2Y64A 4ZDLA 4YIRX 4JVAA 4A3IJ 3EBRA 4C91A 2STWA 3MIGA 5AC93 4TWTA 3HSFA 2YYOA 4OAYA 2R7UA 2ZGOA 4LHNA 2FD8A 2Z79A 1W2AX 3WQBA 5IHRA 3J7NA 3K3OA 1MGTA 1B35B 1UN1A 2IGNA 3IM0A 1SPPB 4NC6A 4RGUA 1KU9A 4H2AA 4AHYA 3KEOA 1IG3A 2FSWA 4MUVA 2IFWA 1ZK8A 5IVEA 4TV7A 4EE2A 3OIOA 3KCCA 4ISRA 3ZSKA 2WFF1 2BXZA 4I76A 3B5LB 3VBHA 4AVVA 1W6PB 3K4KA 4ASMB 2NLRA 3PVNA 3S6PA 3L2UA 5K5RA 4MZUA 1Q8OA 1XRUA 4AI0A 4IHXA 2HWE2 1H1AA 4F3JA 1LR5A 1QNWA 2WZEA 1YHQI 2BVLA 1XX5A 1ALYA 2VNOA 2ZGRA 2RHPA 3THPA 1SCSA 2VZPA 4GMP3 4KWKA 4WXHA 4GFBA 4GH4A 3PHMA 1PO21 4XRMA 1EUTA 2DBBA 2GWRA 3ZMVA 3HOYJ 3FHQA 2GH8A 2JVGA 1H8TB 2E7QA 4EQQA 4W6XA 5T5JA 2VQLA 1W6MA 2VVEA 4RHV3 3W2VA 4QWQA 5FP7A 2D44A 2GU9A 2O8KA 2R041 2JDMA 4FTBA 4RB3C 1DP7P 3VDAA 4CDXC 2W1WA 1UQXA 1AU7A 4QPWA 3OBZA 4Y52J 5L9VA 1O4TA 3I7DA 5A32A 2L7MP 3S14J 2DV9A 5FR3A 2ELHA 3N9NA 3Q9OA 5KCMA 2JDPA 1QOOA 4NR1A 1WLCA 1MBEA 2GNMA 1UX7A 3QU6A 1RKWA 4I0BA 2W82A 1RKTA 1SLCA 5FCCA 2IA2A 4L9NA 1B4AA 2Z5UA 2J5PA 1QNYA 4XR6A 2RJ2A 3CU7A 4FTHA 3CL1A 2ORXA 3QLQA 5IFTA 3P7NA 3POBA 1TZLA 5F3CA 3F0CA 2WN2A 3CTAA 1J9IA 3M4OJ 1C8M2 4MIMA 3ZMSA 2K2SA 1Y6IA 3M3EA 1RUE3 2ZCWA 3BPZA 3AVSA 1RITA 5IYCJ 3I53A 1CQTA 1UKRA 1WWYA 1VAMA 4IQJA 1H1IA 1IW7F 1UL9A 5FUIA 4YGCA 1TW3A 1U5YA 2QZ3A 3AXDA 3QH6A 3HJRA 2BFUL 4MX3A 2X05A 4XL9A 3ACIA 1ZG3A 3BG3A 5GZFA 5CAZA 3O1OA 2DPDA 1GZTA 3OBRA 1YYVA 1TL8A 3OR2C 3T1LA 1W0OA 2VUCA 3CLQA 1KONA 2LY1A 3LA2A 4GMP1 4YW4A 1GYKA 2YMZA 1DLLA 4LMYA 3WW1A 4ENNA 2KMUA 1ZX5A 2XVKA 4XEZA 4DEVA 1TT0A 2MGQA 5AIPA 5K7ZA 2X09A 4D1QA 1TWCJ 1NCQC 3QCWA 2Q1FA 3GF6A 1CGPA 3MF6A 4A5MA 5KHKA 3N7MA 5A3TA 1H0MA 1LVAA 2WZR2 4LBLA 1NYWA 2K85A 3V0AA 3I58A 1VB4A 4JKMA 3T0DA 3BB6A 4Q1RA 2WR9A 4QX8A 4Z8BA 2E1CA 3BLYA 3UGFA 2QKDA 4QD2A 4TTGA 2VW1A 3H9QA 4BY1J 1FJLA 4RB0A 5TSWA 5J48A 5F9TA 3RZMA 1EYBA 1BOBA 2XBO3 2P5BA 4UB8C 3IZOA 4Y13A 2Y0MA 3JW4A 4BQOA 2NS7A 2K9SA 3J7ZI 1WMFA 1P7JA 1FOD3 5EPAA 1LHVA 4IE5A 1VQ9I 5DUUA 4ZZLA 3M07A 3A2KA 2D6OX 4DZGA 1PIV3 5E6HA 2AXLA 3BG9A 1VQ8I 4W4ZA 2OD5A 3GZUC 1PUFA 2Z5WA 2CQKA 1Y3TA 3MW4A 2NS0A 1ZZ6A 2GH2A 3K9TA 4Q8KA 1BK1A 4QKNA 1DQ0A 1JBCA 4ZYDA 2Z3YA 2VL4A 1YHFA 5LCWL 3QD6A 4A3XA 5K7PA 2V9KA 2YBSA 3F8NA 3F6OA 1PGL2 4AEDC 1J58A 2NM1A 3RQ4A 1BVP1 1V6MA 3IPVB 5EGOA 3VBSB 3PL0A 1TWAJ 4BCUA 4DBRA 5L7OC 1BI1A 2HQNA 3CJIC 2Q4SA 4LT5A 3ST7A 2A70A 1V70A 4LXLA 1TLHB 3ZYFA 1YW7A 2R93J 1CZVA 2A1XA 1R6RA 3C2GA 4AFDA 3EXUA 2WYFA 3FHNA 3GM8A 4JQRA 1D1AA 1LVKA 1IDZA 1H2NA 3GHMA 4L9TA 3PMSA 2BY3A 3VB2A 1HKDA 1QDOA 3E97A 4S2HA 4OINF 2A71A 2ZGKA 4UW4A 1R00A 5J4YA 4HSTA 1TME3 2A3XA 2IEKA 1GBGA 4KT5C 4LLLA 2G9ZA 3VGIA 3OEAA 4E2QA 1PP8F 3AG3H 1B59A 3CCSI 1QPMA 2IVMA 2EQRA 1CAUA 4FPLA 3L2WA 4NQWB 4OVEA 3CF2A 4QQLA 2BHZA 3GDBA 1U5TA 3H42B 2V72A 4WM7A 3IMNA 1J3QA 2DVDA 4A4AA 3ABKH 4BE3A 4XXPA 3ZXSA 2DQRA 2IS2A 4FPFA 3AFGA 2Z42A 1YOVB 4M9ZA 3RS6A 1RJ8A 2W3JA 1AL21 3C1DA 5A6YA 2XBO1 1B8IA 3K2OA 1TQIA 5LBQA 2PJRA 3FXOA 2VO5A 1VBD3 3VPRA 1FOD1 2L9NA 2PLV2 1S0EA 2Y6LA 4LUMA 3BU0A 1O4ZA 3H7YA 4LQRA 4KISA 1WCMJ 1REPC 3K75B 2OT7A 3W58A 3H8RA 2HFHA 3RZLA 1C1FA 3MKLA 1YQ6A 1KS4A 4WVMA 1K12A 1NA1C 3JQXA 4L5IA 2Y6GA 2W25A 3HN3A 4ZS3A 2QENA 3J8F2 2PMZN 3B69A 3J4UH 5GLWA 1WA4A 1BEV3 5DYMA 2D5VA 2JDKA 3PUIA 4E7KA 4H7LA 4M4RA 2ELKA 1BW6A 3VBRA 2E5ZA 1Z1DA 3AZYA 2GP3A 4XQDA 4LO5B 5IAVA 3MVPA 4AHXA 1OFSA 4BQ1A 2XL9A 1XMKA 1PMJX 3KT1A 1X8MA 3JRBA 1MDMA 1O8PA 5L9RA 1AX0A 2QBXA 3AK0A 5FYIA 5F0FA 1QQP3 4JKKA 5FD6A 3LQQA 3ZN4A 2L5QA 1W8FA 5ILUA 3H92A 2DOAA 5F5IA 2HR3A 2ZMEB 4YRVA 1VRH3 3UJOA 3H1CA 5FJ8J 1EA3A 1V5EA 1TT5B 3CUQA 1LHNA 3VBOB 1IO2A 1MS5A 2VVDA 1X1AA 5FROA 3J7AY 1A31A 1IXSB 4QDQA 1APLC 4UY8I 2EWNA 3CNAA 1ZRIA 1I39A 1OFCX 2XAFA 1LU2A 3POWA 5CB7A 4ET7A 1TMF3 4FOWA 2UU8A 2WIIB 1FATA 3P6BA 2DFIA 1NH3A 2DA4A 1Q1HA 3N05A 2WO3A 1GNHA 3VDXA 1SFOJ 3J7AO 4E70A 1XE8A 3WDVA 4CH7A 5GTIC 5FY5A 1PO12 5A33A 2A3SA 3HUGA 4HK9A 5FKMA 4IHWA 5C8CB 1DU3D 2PHRA 4Q0VA 4QAWA 1HW5A 2W48A 1MNMC 2HDDA 1VBD1 4GXLA 4YLZA 5IT9Z 5FK7A 2Z69A 1YO8A 3TL4X 1JYIA 4IVNA 3WLUA 3UETA 4LEJA 1TQPA 2HDWA 1G3TA 1HRV3 1WMDA 1F43A 2CHHA 4D0PA 5EJ1B 3U10A 2Q8DA 2WSVA 1P2FA 4ITVA 3WEZA 3S2DJ 3CF5F 1LAJA 1A6CA 1UU5A 3N4MA 3ZN1A 4KT6A 3HT2A 3P1IA 1IOAA 1Z7LA 1QZYA 1ND3C 3JRIA 3E5UA 2WNVB 1MSFC 3POYA 4RQPA 2QQIA 1OR7A 5T5LA 2X0LA 4XF9A 3B93A 4UW5A 5K0UA 2ZMKA 1Q56A 2Y2ZA 4XM3A 2NS8A 3WTZA 4U7DA 4M3CB 3CLOA 2HOAA 2MD5A 2JWPA 1OT5A 2XQRA 1YXWA 4EM2A 4MTDA 2A75A 3DTIA 3I2OA 1QQP1 5FUNA 2DMPA 1QA6A 4BDZA 1UY1A 4P1WA 2LRPA 2YY1A 1WCDJ 3I4IA 3L2HA 2YPRA 4BA6A 2O0YA 3ZGKA 3DF0A 3ZIXA 2VCCA 3K2ZA 4UFMA 3PJRA 1VRH1 1JTYA 1CWPA 4BIOA 3VBHC 1LRHA 1D0XA 1P92A 4RAGA 3TNPB 2EIMH 3MKWB 3CCMI 3HNYM 3EETA 1XYNA 2EZKA 3WG1A 3ZYJB 2D5FA 4V2VA 2WY8Q 4N8MA 2DCJA 4W65A 3UR3C 3VL8A 2EVXA 5EIYB 3W2AA 2DMUA 3T8RA 2HWD2 1OYWA 4NROA 4GWJA 3C2BA 4ZTFA 4BISA 5CFCC 1RZ4A 1IS5A 2B7EA 3MBWA 3D5RC 2D6NA 1YIFA 2EALA 3O6BB 2FDFA 1HW1A 3H3LA 4MGZE 3S5QA 1CESA 3JXSA 4XACA 5BUVA 3C7EA 1V0AA 2HWE3 4BE2A 3WGIA 5C6CA 3W6JB 4PIYA 2DW4A 4F91B 1RUG2 2X85A 4TZDA 2F17A 2ZACA 5DN2A 1LEDA 5E79C 1TQ5A 2CFOA 2VOPA 3WSOA 3K70D 1OLMA 2DLLA 1SBDA 1LHUA 4HSJA 4OI1A 5JVGF 1ZARA 2E5NA 4C2TA 1PVXA 1B72B 5JXGA 2EINH 5FQ0B 4MOAA 2W84A 1MVEA 2VMFA 3C2UA 3JZVA 3OYKA 4RM2A 3MPBA 3OBTA 2QEXI 1SACA 3VBUC 4AZZA 4GZ9A 3VKFC 4V19K 3CCQI 4CDWB 3S1RJ 3QODA 2W46A 2ZGTA 4QX1A 2ZJCA 3RQIA 3KCXA 4R9BA 5IWFA 1F5TA 1KYWA 4A6OA 3T2OA 1SEFA 1W36D 2WTEA 2VQGA 3J7MA 4XFCA 2VB6A 1XSDA 3Q8BA 1X3ZB 3H50A 1JHNA 5A3OA 1WZ2A 3SEZA 3U4XA 5F5QA 1NG7A 4HN0A 3BG7A 3OS0A 3FMQA 2C9AA 3KYDB 1RUC2 3U11A 2XL7A 2X6OA 5LZ6A 1WI9A 3ZYIB 3AZWA 2G9FA 4PJYA 3H0DA 2VQUA 5HV0A 3IAS2 2DBNA 4LIVA 3JAMK 3LEKA 3PNVA 3I3DA 2KRFA 4AI1A 2XF6A 4U2AA 1GDTA 5BNPA 2C26A 3BOPA 2DUPA 2X8KA 3C7HA 4UVCA 5JZGC 3AZVA 3IV5A 5J1RA 2ZBJA 4PJMA 1J83A 2JJ7A 2XGCA 4NHJA 3DEUA 3AYEA 4OLLA 2DMNA 3CMEI 3D0SA 2QUFA 1MR5A 4F92B 2OC6A 1KZHA 4RS5B 3ZXAC 2BW8A 3KE2A 1HJGA 3QACA 4BXSV 5EFUA 1XOYA 3I2GA 2EF6A 1FAYA 2MC3A 4NC7A 1PX3A 3BPSA 1T0FA 2VE8A 2H6CA 3WTVC 1ZYRF 3G71I 2M8EA 5I0RA 3QBQA 1HW2A 2ZX2A 4EROA 3LB9A 4KIBA 1H0BA 2VOVA 5IVVA 3MQ0A 2VBYA 1YG2A 1RXFA 5IVFA 1IXRC 3DYOA 1WJAA 2PLYA 5E89A 1MIJA 1G9CA 3N9QA 2CUFA 2EIGA 3ACHA 2O3FA 1ZM1A 3T3YA 3W6KB 5FBZA 2V26A 5L9BA 3OGGA 1HQCA 1UY3A 2RM21 4XPVA 4Y15A 3V0BB 2WZR3 4Q4V3 1LFUP 1GSLA 4P5OA 4Q5SF 1QH7A 2ZGLA 2OV7A 2IJLA 1ASJ2 4ASKA 4HF1A 1APNA 3I4MJ 4O5VA 4YW2A 2R3SA 4IEUA 1ULEA 2ZXJA 1FX7A 5LA2A 4HMZA 2GC2A 4NPMA 1NG6A 2DCEA 4XLFA 5FZLA 4G9YA 1IRFA 1D8KA 5IP9J 2HZDA 1F15A 1RVF2 3GHNA 1NE6A 4GKYA 3L2VA 1J84A 2W1UA 1WGXA 1YQ5A 2MD0A 5CVRA 2PHFA 4JKLA 1LECA 3OOXA 3THDA 2EAKA 3DLAA 4PJJA 2A73B 3DL3A 3ORJA 4GXOA 2IS6A 3ZMZA 1FTZA 2A6EF 1V6JA 4EJUA 2DUOA 1UAAA 2E1NA 3ME2A 4KI5M 3KB5A 1XB9A 4FOVA 2C1FA 2ZBKA 4Z82A 1C8M1 4DUXA 5ABJA 2PMZA 5HCHA 1EH6A 4IW3A 1JN2P 5HS9A 4GWMA 1I3AA 4QQPA 2D93A 3KV9A 1EUUA 2QQKA 5DUIA 2D98A 4HONA 3BJAA 3AMPA 5JI7A 2IPQX 2XKOA 3K1PA 1HF0A 4Y5SA 1VBA2 5IK5A 3W59A 3ES4A 3SZGA 2NYXA 4INDA 1LFPA 1NQDA 2WT2A 2GLOA 3VV1A 1U5TC 4CEWB 4WM7C 1MQTC 3U1DA 1GWMA 1A36A 1OYYA 4CCJA 5FKCA 4D9JA 3M1HA 1GNYA 1YFXA 5FY0A 5B3SH 1BC7C 1Y1VJ 3ECHA 5CYYA 3H0OA 2ID3A 3HRSA 1H6XA 2VW2A 2CQQA 4EWEA 4QGMA 3AL6A 4IV3A 4W6YA 1GV2A 2WZR1 5FZOA 3RZHA 1GWKA 3ZSMA 1X50A 2DU1A 2OVUA 2VBWA 2VE1A 2K02A 2DN0A 3V7SA 1UW8A 3LSEA 1BR1A 3GEZA 2FCVA 1O6UA 1MW7A 5BNNA 4EN0A 2JSPA 1O8SA 2VBZA 3OYBA 3FK7A 5FZDA 1K42A 2R7DA 3VBRC 3HG9A 2PLV3 4CZZA 2LF7A 3R0AA 2K27A 4NNJA 3UJQA 4CPBA 1RHI2 1UY4A 2FNPA 2RDRA 4XIOA 3BN6A 2VQAA 1ENSA 3KGLA 1RUJ2 3TYJA 5E1RA 2A5ZA 3M7AA 5HODA 2CAVA 1E5HA 1X4OA 2Z99A 3O1SA 2VTFA 2J1AA 3I2HA 3SC7X 5FLMJ 3WDYA 4IERA 3ZMDA 3HBZA 3W20A 5ERIA 5JPMB 4UXNA 3HOUJ 5HNHA 3S8PA 2LFBA 3J8F3 1K6OA 2DF7A 1PGL1 2O0OA 1W0PA 1UZCA 3USUB 3S16J 4CO8A 5EEAA 3CUQC 1J75A 4NHYA 2VONA 1IDYA 4BAYA 3QPHA 4IPAA 1FBUA 4BYYA 2JB4A 2BXYA 3AKPA 3Q8CA 5EG0B 1W9YA 3I59B 1C5IA 1XC5A 3MCZA 2R0QC 2OX0A 5CBLA 2XVCA 5A80A 4QXKA 3GTKJ 5DV5A 3ES1A 3AXEA 2VW0A 3MW3A 4CGZA 5FZHA 3QPTA 1V5GA 5CJ9A 5KNLA 3BDDA 3WUCA 3N7JA 1CVNA 4JDMA 1A04A 2JT1A 3NJVA 3KF3A 4YVWB 5A3MA 5FWJA 2ISYA 5FMDA 2F4OB 2I74A 3RSJA 2VULA 4ZS2A 5CA6A 3MW2A 1IPSA 3ZM8A 4HX8A 1CQ9A 4ZH4F 1J5YA 3KZYA 1VAVA 1ULCA 1IZ1A 5LA1A 2M34A 4EV0A 2GOXB 2D3RA 2BGOA 2F5VA 3NQHA 4XBLA 3LPGA 4TLFA 1ZZ8A 5JXJA 2VKVA 1Y39A 1PO13 5LRSA 1I6HJ 4L97A 1YFUA 4OYUA 1R58A 4OAZA 2PLV1 1N25A 4EMSA 1QHDA 4G7HF 2JDYA 3FE5A 1F36A 3OY8A 4OZXA 1RL3A 2XJSA 1XXNA 4S04A 3J81Z 2CWMA 4HBNA 5A7WB 1MMDA 3BR2A 1YWKA 4ZXKA 3ZXJA 3K4MA 1R1A3 3UKNA 5CKMA 1HB2A 2OZUA 2BVMA 5C3RA 4L8QA 1XYPA 2K0GA 3PJQA 2KZGA 2FBHA 1H6YA 4WX9A 1HKSA 1S2BA 4YNIA 1OURA 3OUJA 1ND3B 1U9OA 1YQCA 2FNAA 4P9JA 4M3EA 1O57A 4MQVA 4HSRA 2ZHLA 5GAEJ 1UPIA 1X9PA 5FZ4A 1MEC2 2XRNA 2V79A 1D0GA 5IVJA 3EYIA 3OGRA 2BU9A 3KT7A 1VI0A 2VKEA 3HEFA 4KNYA 3L1PA 3JCUC 2WAAA 2ZZQA 4ARXA 3WNMA 4A45A 1EAH2 2ZEWA 5D8LB 3VBHB 3B6AA 1MPXA 2G4IA 1LOBA 2B46X 3NVCA 4JQFA 3X2QH 1VP6A 4ENMA 4KMQA 4XICA 1OQDA 4AFMA 1K4TA 3CBNA 2BERA 4S05A 3ZQIA 3ZN6A 3MAJA 2Y26A 1VQLI 2HWD3 1A3KA 5IVYA 5HS8A 1G9AA 4UB6C 2F5DA 2HU9A 4WXDA 4FISA 2QQUA 4XUPA 1X2NA 1FNYA 4QPGA 4AOCA 3VDBA 4CDUB 1E2XA 4OZOA 4QPIB 1PO11 3HGGA 4FXGB 4Q4ZF 5A3NA 1NZCA 4JC1A 1D2QA 4GH4B 3LIGA 1OPCA 2AC1A 1YI7A 2WQ4A 4J6GA 3FIWA 4YFWA 5E17F 5EYXA 2JE8A 1RUG3 4XN0A 4EZ4A 4D5FA 4AQ2A 2QQOA 2PAMA 2PELA 4CXWA 1W6MB 4CTEA 2IGMA 3AC0A 1IN7A 2HWF2 5LEJA 2RJKA 4U36A 2E32A 2E1MB 3RYKA 2XIGA 1NCRA 3OYDA 4B3XA 3WW2A 1ZA7A 4YIIA 4AIKA 3PQKA 3MLLA 3LEIA 1SDDB 3B3QE 1B35A 4LBNA 3S3OA 5BOXA 2I10A 2K9NA 2JD9A 4Y5Z0 2EV0A 2OUHA 4ZYHA 1OA3A 1RUD1 1Z05A 3FX3A 1UHWA 3IDAA 3SXWA 5BNPC 4JAAA 1W6PA 2DK8A 4O6JA 4OUMA 3BGAA 2VTXJ 4WM8A 1MZ5A 5FYZA 5F3IA 1SBEA 3P3PA 5K9YA 5LHIA 3SCHA 4J1WA 2P6HA 1DZRA 1VMHA 4HF0A 2CGPA 3O0WA 1RNLA 2VMIA 3B7MA 1T0FC 1GICA 2EV5A 3AKZA 1HKQA 4QXHA 4Y1ZA 5FFOC 1NK3P 2VQHA 3GCWA 3OS2A 3AL5A 2EIJH 1CF7B 3MV01 2YPJA 1H8TA 5AIQA 3EO6A 4PJNA 4HZFA 4XC9A 4G7ZF 4M0HA 4EJTA 4L0ZB 3MZHA 2HWD1 1H2KA 1Z7S2 2V1NA 1CIWA 3GXUA 4LJZF 1XPWA 5DUKA 2EFQA 1OLRA 4XKCA 1WW6A 4P9LA 1W7PD 3AJZA 2E31A 1A35A 4HYEA 1OBNA 2J7MA 1IRZA 1HB3A 1KD7A 4RR3A 4PGGA 1CPMA 1JZ8A 2X6XA 1VBB2 4JGZC 3OYWB 4CYCA 4IHSA 4HX7A 4EEFG 4Y1XA 1RUG1 1CAVB 5J96B 2P3IA 1B1BA 3Q0WA 3MKZA 3I56I 2JG8A 3LMMA 3A4UA 5GJ6A 3JBG2 4MGYE 1VNDA 3QOEA 4QGLA 3VODA 2RKHA 3GZNB 1GHCA 2EFPA 1A8DA 4KGGA 4Y1YA 1XU2A 4LLNA 4YYOA 4AGVA 1TWFJ 4BJ5C 5IJRA 5FMCA 4NAOA 4XZPA 1UAIA 2HXIA 1PZ9A 2IXCA 3VUOA 3DCFA 5FP9A 4N90A 4D7SA 4JHTA 2WWUA 4NBQA 1HSJA 3D5SC 4OOIA 1TE1B 5A3WA 3O8GA 1JS9A 1HXS1 3L09A 1PUFB 1BJAA 2J1TA 3CEWA 4XJUA 3POJA 1Y43B 2LR8A 2E63A 1YW9A 1R092 5ABJC 1RUC1 4BKXA 2EK5A 3MICA 4NWWA 5C9AB 4GO1A 2IT0A 2KA3A 3KHBA 4OQ9A 2F4LA 4H14A 1W8HA 3WU2C 1J2XA 1WBLA 3DF8A 5FYUA 5BXXA 1JZ6A 3VHPA 5F1JA 3VKMA 1Y0UA 1KQ9A 2D97A 4RDUA 5C44J 3TO7A 4OIOF 2A6TA 2VLAA 2XLAA 4LHSA 1IPKA 3OWTA 3HNBM 3S1MJ 4Q48A 2IVIB 2VUMJ 5DAVA 4YEJA 3FN9A 2NAZA 4AU7A 4M4PA 1ULFA 3HMYA 3H1YA 4OWRB 4XMYA 1UY0A 1ON1A 5HBAA 1PNFA 3TOJA 1IJWC 2WQZC 5FTTC 3CCEI 4F83A 1VBA3 2Z16A 3NNJA 1OA2A 2XDVA 5J1UA 4IV3C 1W39A 3A7QA 2R30A 4KG8A 2ZC2A 3FF5A 5AVPA 1YQAA 2YC4A 2W95A 3MIFA 3I5UA 2ET1A 2C6YA 1R23A 3ILFA 1CAUB 4U0YA 1S0BA 3DPRA 2XSDC 3VD5A 4W50A 4HRIA 3N35A 3PVEA 2XPVA 2Q8EA 1ETXA 4A0YA 3ETPA 3MGUA 2GN7A 1SD7A 1SFPA 1IS6A 1W0UA 4MO3M 3DU6A 3JB8A 4XQFA 5FLXZ 5JHFA 1LB2A 3GXOA 3F6VA 2FA5A 1B8IB 4LMFA 3IPVA 1W5SA 2PJRB 3WHCA 3M3IA 3WF2A 4XJWA 1VLNA 1YJLA 3VBSA 3IH3A 4YG0A 1ASJ1 4TXWA 4CU6A 3N7LA 1V6IA 2QZ2A 3LDKA 3ABZA 4A6DA 1OOPA 4OHZA 1Y8RB 4MG2A 4I3PA 1N1SA 4ESBA 4UF0A 1OCCH 4ZU5A 3RDIA 4OCTA 2CYFA 3F9KA 2BJSA 2QE3A 1I50J 1TEIA 2XF7A 2CG4A 2JD4A 1AJKA 2FMDA 2D3SA 1RVF1 4OHWA 3SHRA 5T5OA 1QJEA 4UFIA 4NB5A 4MHUA 2ZFUA 4GWIA 5J37A 5HLGA 3RFRA 3HPHA 4OHXA 3ZQFA 5M5WJ 3GZ6A 1ZBE2 2AO9A 4B4QA 1RHI3 2MA3A 4Q4Y2 3E6MA 1VBE2 2JE7A 1DLCA 4RB1A 4LG3A 1H8VA 2VZQA 2XVLA 1FEXA 3LFUA 3MZYA 1REFA 4PT6A 1X7NA 1JH5A 1XMAA 5I8YA 1JZ3A 1DPRA 2QQBA 1JI8A 2WJSA 3SITA 2D40A 5IK4A 2QQVA 2KIMA 1SFEA 2EXKA 4JCKA 3RYRA 4M9SA 5DUVA 3CD6I 4E7ZA 2VOKA 3ULQB 2VJ5A 1ETKA 4Q4X2 3PO2J 3ABLH 2DA3A 4GIQA 3KZIC 1RUH2 3JRDA 4HDVA 3SEQA 1W6NA 1K5JA 3PO3J 2HXOA 2ZEXA 2FOWA 2BGPA 3Q0UA 2F6BA 2DU0A 4IE0A 2VMEA 3PUSA 1WJEA 2VXDA 2MEV3 2VNVA 1MS0A 1E3OC 1YNAA 3W9AA 4UYBA 4RSUA 4D5CA 3UKVA 3T1MA 2H27A 2FOKA 2QQ8A 3A01B 1LPQA 2IXSA 4Y17A 2NZ9A 3ZMOA 2K86A 2L4MA 4Q8LA 4XRFA 4DXRA 2CUJA 3OF1A 1QOSA 5FWEA 5CG8A 5H6QA 4XQ4A 2HVRA 3SDGA 1FP1D 2D6PA 3ZFFB 1WUVA 4SLIA 1V6NA 4NC8A 4NUBA 5KC6A 1S72I 1U8BA 1AXZA 5FXVA 1OI6A 3BQZA 3RYPA 2V9VA 3P3NA 3WE3A 2B7YA 4BK4A 3ZDSA 4E7IA 3INAA 3D4KA 4FPHA 4YG2F 2M1BA 1X1CA 2ZMEA 4XYXA 5D6EA 3DEMA 1GXPA 4HVQA 3WOGA 2QLZA 1COV2 3IC7A 4RQPB 3DPTA 5FLVA 1OXCA 2F48A 2EIDA 1RHI1 3HIFA 1WW5A 3VBOA 4GB33 5K0UB 1KEXA 3CKHA 5HLTA 3VB9A 5CFDB 1RUJ1 2P5LC 1HLVA 2ZHMA 5IFPA 3POIA 2E26A 3ZFGB 5FDBA 1SLBA 2WABA 2GNTA 3GFMA 1XC6A