3RYPA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rypA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rypA01
4KIFA 3I7DA 2XLFA 2RV8A 1OYIA 1J0RA 4Q4ZF 3USSA 3MEXA 3V7CA 1AWCA 3BJOA 2F5FA 2P5VA 2PJPA 2YR2A 3ELKA 2GU9A 2DU9A 1I6XA 4MGRA 1K6OA 3IIAA 1SFUA 4M9XA 1T0FA 1XDUA 2F5DA 5HLIA 4I02A 1W7PD 3RTRA 4D0PA 3FE5A 2VONA 4XFIA 1U78A 1OKRA 4IPAA 4LULA 2B9UA 4EJTA 2BNOA 2H0VA 1UIJA 5I91A 2M30A 2QLZA 3RI4A 5CYVA 4MTDA 4M71A 3J80Z 2CAVA 2Q0OA 2IP2A 5FQ0A 5HVQC 1LNWA 1O3SA 4OIRF 3D0SA 4RAYA 4EVIA 4CGZA 2F2EA 2MD5A 1NZCA 2D2WA 1YHFA 3MAJA 2ETHA 4LJZF 2EFWA 3OCPA 4Q0QA 1QGPA 2XAFA 1EP0A 2ZFWA 4G6DA 3GBFA 1FZPB 3RPUA 3WODF 2DK5A 4WBBA 1QNTA 4IEXA 3S7IA 3HTUA 4BH9A 2EFQA 3ES4A 4UV9A 4HYEA 1F1ZA 2FMLA 1WGPA 4F8AA 5FD6A 4META 4UVAA 3HSRA 1H0MA 3F8MA 5L3DA 4NHJA 4Q5SF 3I4PA 5T3NA 2A3SA 3N4MA 4MHGA 3EQEA 4A2UA 4HV5A 1XGOA 3ECOA 2L02A 4EGZA 4HDVA 1FOKA 2E7WA 1OMIA 1LR5A 4KYWA 3BOQA 5LGNA 4XFBA 2V1XA 2V1DA 3LSTA 5HDKA 4P9GA 3WW3A 2P17A 2ZKLA 3GLXA 1SFEA 2EV0A 1Q43A 3RDIA 1FX7A 1NE4A 5L3FA 5D5UB 4O9GA 2AXLA 1O5UA 4O3MA 4QGNA 1KGSA 5E1WA 2IW5A 3H50A 1G3WA 4XRFA 3L2HA 1LDKB 4LB6B 5JAXA 1O7FA 4WWCA 1HKTA 2K9ZA 2R3SA 4OOIA 1D8JA 4KWLA 1WKMA 4KDPA 2QVSB 2M45A 5CVIA 4KIGA 2EA2A 3ZMSA 2M87A 1ZX5A 3G3ZA 1BOAA 1VTNC 4Z82A 1HW2A 1Y9QA 4MH0E 4A6DA 5FCCA 5L3GA 3IWZA 4R79A 3BJ6A 3JTHA 3RYPA 1QO0D 5ED4A 3PQKA 3I5UA 4HW0A 2IA0A 2CGPA 1JE8A 1LB2A 3W6KB 3V7SA 5L3EA 2KJCA 2P5KA 2P7CB 5D5VB 4MQVA 3QU6A 3DF8A 2PQ8A 2HQNA 4LEJA 1J3PA 4EJUA 3CEWA 4EWDA 4BHCA 1J3RA 3CO6C 2X4HA 4OU0A 4U7BA 2ISYA 3DN7A 1FYKA 5I0SA 1P92A 4ONUA 3DKWA 4YFNF 3WE3A 2QQ9A 5D8KB 4MTEA 3IRRA 1FYMA 3EYIA 4LUMA 1ONVA 4IRIA 1IPKA 4XSZF 2XUBA 5LHGA 2RC4A 2H09A 2CQKA 2HKXA 4F7ZA 4S05A 3FWEA 3M1EA 1J59A 1PMIA 3REOA 1BC7C 4BQAA 3J81K 1U12A 1IW7F 1SQ4A 3OTFA 1XGSA 3Q9SA 1R00A 4AVBA 2VN2A 3V8LA 4KT5C 1BIBA 1S7AA 4MV2A 3FM5A 5IT9Z 3FM3A 4KWJA 4QXKA 3AAFA 2XL7A 2H6BA 1MDMB 4N9IA 2K27A 1HXDA 3V8KA 3HSFA 3R0AA 1RZ4A 4WX9A 4IEYA 4ZU7A 1W7PB 2OQGA 2QUFA 2UY9A 4JK1X 4L9NA 4WXCA 3JAMZ 3HTSB 5I0TA 5AONA 4WCGA 1O5LA 1IXCA 1ZZ8A 4GO1A 2B0LA 4JTOA 2ESNA 1LKNA 4CXFA 1G3TA 5JSOA 2VXZA 1GVJA 4GULA 5LHIA 5EZWA 3KLNA 3WTUC 2VT3A 1YG2A 3BB6A 2PHLA 1ZGAA 1T2KA 3SHRA 3IC7A 2DQLA 4AWXB 5HS8A 1OYYA 2PQQA 4Z07A 4BXUA 5DYMA 2QZ8A 1RUOA 1H9TA 3IL2A 1K7AA 2IXHA 4MX3A 2W24A 2OAZA 1I1GA 1Z05A 3WE2A 2EK5A 1WI9A 5HLGA 1XB4A 1FYLA 3HRTA 5DD8A 3F8BA 5DV5A 3LWFA 3MZYA 2IPQX 5I0UA 1GXPA 2BEOA 1QZZA 3LWCA 2GC2A 3GEZA 4QM8A 4MGYE 2KJBA 3VFZA 2XV4S 1WSUA 3TO6A 4XF3A 1LQ1A 1PP8F 2O3FA 1GQHA 4UUVA 4XLNF 3E5UA 2RNJA 1LEBA 4KICA 4Y15A 4CHUA 2MNGA 5DUKA 2M8EA 2IT0A 4E2SA 1DZRA 2BGCA 2OZJA 2K7LA 2DI3A 1TTYA 2IVMA 2L3DA 3DQVC 3PLQA 4AQ2A 3ML6A 3FZVA 4GYGA 2EA7A 5J8CA 4DQ2A 1ZG5A 4LD5A 2QYOA 5BXXA 3SMHA 2HGCA 2DAOA 3I53A 1K78B 1ZNPA 5EEHA 1XSXA 4LA3A 3GO5A 5FFXA 4L9TA 1YFYA 1B4AA 4ENMA 2EA4A 2DW4A 3H1WA 2IXCA 1ZHFA 4IESA 5DCFA 4XFGA 4I0AA 3T0YA 1B9NA 2L4AA 1O3RA 5BPDA 2P6SA 1YQAA 3F72A 2XIGA 4LUKA 3TOAA 1KYZA 4UXNA 1QXJA 2BNNA 4ZYEA 2XRNA 5LEJA 5KHKA 3U1DA 5HLHA 1WLTA 4LTAA 3B02A 2MH2A 4HAMA 1O3QA 1FI2A 1K79A 3LA7A 2RQPA 3SCGA 2XL9A 1S8NA 3EETA 1YUDA 3GYDA 2OZ6A 2VC0A 3I71A 4FHTA 2EV5A 2GXGA 3E6CC 4D7TA 5FLIA 2Z5UA 2VODA 1RL3A 4RGRA 1IAWA 2RVCA 4P9UA 1G3SA 1IN6A 2EV6A 5AVPA 1CX4A 1YYVA 3ZMTA 2BYVE 3H3UA 3FMSA 1SFNA 4OIQF 5K5OA 4RB3C 3H9AA 3SCFA 1V4RA 2O03A 1R1VA 4HF0A 1YLLA 2XHKA 2HYGD 3BU7A 1EV7A 2EFOA 1Y0UA 2FBIA 4L9JA 2OYZA 1IRFA 3TNQA 4HZFA 2QM3A 3FXRA 4Y17A 4RB2C 1PM7A 1PUEE 5L3BA 2JRTA 1YFWA 5DDGA 5JHUA 5I8TA 4UHTA 4CYDA 3O2PE 1FC3A 5E1RA 1R1UA 1QZYA 1J3QA 2ESHA 5I0RA 3CO2A 2PLYA 1NE6A 1FBUA 3J81Z 3ZP5A 1ZZBA 3VB2A 4I98B 2Q4SA 4A0YA 1W7PA 4FX4A 4MNUA 3CF6E 4KNYA 1ZN2A 1L0OC 4HX7A 2A07F 1DPUA 1X82A 4IF4A 3RZZA 5BUVA 1LEAA 5ICFA 1ZZCA 4QGMA 2LSOA 1Z6TA 1FSEA 3WGIA 5E17F 2ZJ2A 4TLFA 3EUHA 5JI6A 4O5VA 1F5TA 1CAXB 2L01A 3F8CA 1SMTA 1U2WA 2DBBA 2K86A 2XAQA 5LGTA 1AOYA 4BIFA 4E2GA 3R60A 3KSCA 4NB5A 5C8WA 4S04A 4JVAA 4AVPA 1R5HA 2ZXJA 2ELHA 3KETA 4UNOA 2FA5A 2GIVA 2VBZA 2P6TA 4O9EA 1WWXA 4EM0B 3ACLA 5F1RA 2DQRA 3H1MA 4U0VA 4YIIA 4JQFA 5F64A 3GYHX 1UIKA 1HW5A 3IBMA 4UVCA 3I59B 3FJSA 3HHHA 1CAVB 4OMZA 3ECHA 1NYWA 1F4KA 4HOBA 4PGHA 4AIHA 1FPQA 2ETEA 1PDNC 4A12A 4G7OF 2BNMA 3OOPA 4XF4A 1SEFA 3GWZA 2GXBA 1RNLA 1YS6A 2OA2A 3UKNA 3VOEA 3F23A 4B8XA 4Q0VA 4IRGA 2O61A 3WU1B 1ZLJA 1J1LA 3L9FA 1U5TB 2A6EF 5LGUA 2VT2A 1J75A 2XLGA 3WTXC 1IXRC 1ON2A 1P4XA 3S7EA 2FNPA 1Q1HA 5J8FA 2EWNA 1W5TA 2FBHA 1YO5C 1DPRA 3GZ5A 1HKQA 4XBFA 2VOPA 2VECA 3ES1A 1K78A 2LNBA 2WV0A 2FXAA 3TKYA 4KL1A 2Y0OA 3QRFF 4XLPF 4HF1A 1SD6A 1BBYA 2JT1A 3T1BA 5E16A 4N9HA 3D5LA 1XE8A 4L9VA 2XLAA 5J48A 2HKOA 3MQ0A 5BQTA 3MYXA 1KQ0A 3CUQA 1H1IA 4XF0A 3RYKA 3CDHA 3CJNA 5HDNA 5CU1A 2RKHA 4ENNA 3GFJA 4GYIA 2STWA 2WC2A 1E2XA 2NS0A 4HLXA 3V4GA 3DPLC 3SQNA 1RGSA 2JPBA 2EVXA 3HHGA 3K2ZA 3WTSC 3KP2A 4OLLA 5E20A 5BY5A 5BMZA 1NHAA 4AQ6A 3QU3A 4IHTA 2O1QA 1H1MA 3FX3A 2COMA 2ZMEB 3O6BB 2K0GA 2P5LC 4HF2A 4ASNA 5FPXA 3C1DA 1O7LA 1CAUA 3KP6A 5K5QA 4MQ9F 2D45A 3CO7C 3B73A 1MJAA 4X6QB 4PGGA 4ZZLA 2DPDA 1OPCA 1JXSA 1TQIA 4AXOA 3HQXA 3IHUA 4ESFA 3WW1A 5E1ZB 1MD0A 4GXOA 3H1YA 2PMHA 1TLHB 3DP7A 2OD5A 4DINB 3J7AO 5ILVA 1BM9A 2AS5F 5AIQA 2ZO4A 5E8GA 4HLTA 2IA2A 1STZA 2O6GE 3U2RA 3R61A 2L4MA 1HW1A 2PBIA 4LLOA 2Y75A 3BALA 2HYFA 5CVJA 2CV6A 1TQ5A 3GF2A 2FEZA 4PIYA 3RIRA 1ZH5A 2A6HF 3M7GA 3FF5A 1EY2A 4LLGF 1X8MA 3U11A 5HDGA 3C7JA 3E6BA 3HRMA 2IC1A 3DEUA 4MEYF 2UYAA 5CJ9A 5H6RA 3NJZA 4L18B 2EB7A 4KMFA 3F22A 1PP7U 2PAMA 1BIAA 1YWKA 1Q5OA 1Z91A 2DTRA 4U88A 4IEWA 5AIPA 2R7DA 4HVQA 2KXLA 4AVCA 4UV8A 2OPKA 3T8TA 2A69F 1KYWA 5FLJA 1UD1A 1UB9A 2GA1A 1CF7B 4H7LA 5CVVA 2NNYA 4EJVA 3RYRA 1U8RA 2QBYB 4YARA 3NL1A 2VBWA 1GQGA 3FMQA 1B6AA 3IKVA 3BY6A 3ERED 4J1WA 1CAWB 3COAC 1UW8A 4LLNA 2P4WA 5JSPA 2VBXA 1XRUA 3OGJA 1HQCA 4JV4A 4HA8A 3I59A 3PVBB 5E18F 4H0EA 3SZTA 2PAEA 1YTYA 3GFMA 3HYIA 3F8NA 4IHSA 2EFPA 3RKYA 4HMZA 4LFUA 1P2FA 1LRHA 1LDDA 5JCTA 3HT1A 1FXZA 4D7SA 3IKTA 3L7WA 1BI2A 2X0LA 4LGWA 3WW4A 1U5TA 1FBSA 1FNNA 3JSPA 5CADA 3ISPA 2VBYA 1EH7A 3CTAA 4ORFA 1BI3A 3LQRA 1E17A 3VEPA 1S6LA 1RUNA 2HEOA 2PTMA 3HT2A 4OIOF 3MPBA 4HN1A 2P7VB 4HN0A 2ET7A 4QMAA 1EH6A 3H3ZA 4WZCA 5HS9A 2XKPA 1R23A 1WA4A 1ZZ7A 5E8IA 4MUVA 1QPMA 1IN7A 3KMHA 2HTSA 2QDRA 3DL3A 3FXQA 4GGGA 2UXXA 4KA4A 4HVRA 3SXWA 1YW8A 4MGZE 2XROA 3CJXA 5ICCA 5D8LB 1R58A 5BV6A 2IXLA 5JR7B 4R8HA 1SD5A 1EPZA 4HBNA 1FBQA 3KCCA 4XFFA 4EQQA 2CYYA 4X6RB 5D4RA 2D1HA 3BP8A 1ZZ9A 4P55A 4A6EA 2W25A 3ST7A 3ELNA 3BPVA 2RN7A 4PJYA 3LZZA 2PMUA 3K1MA 2LF7A 4ENJA 3CL1A 3ZPLA 3C3WA 1FWZA 2A61A 5FD5A 3FMRA 2M5WA 2QWWA 2EAAA 1V70A 2ZMEA 5ICEA 2CW0F 3U0ZA 5JVTA 2XAHA 3IRQA 3KGLA 5KVRA 3HUGA 1TW3A 3P9IA 3J80K 5TJJA 2D93A 2QQBA 5FFZA 2HR3A 2DT5A 1MJBA 4ZU5A 5DUIA 3MWMA 3F21A 3PNAA 2D1VA 1D5VA 3TO7A 1B59A 2Q2EA 2V6CA 2H6CA 1R5GA 4G7HF 4JTNA 3SCHA 1H9GA 4Q29A 4G9YA 1DZTA 3ZMVA 3MCZA 2Z3YA 1WRJA 4PCQA 4YRDA 3TDUC 1EH8A 3GUDA 2CFXA 1Z7UA 4A0ZA 2GC3A 4B29A 2JSCA 1ZRDA 2QJVA 3HOTA 1L3JA 2Y48A 3Q5FA 3D82A 3GVAA 5LEKA 1IRGA 3ABUA 1YIOA 1R22A 1ZAOA 5K8SA 2HQRA 4LB5A 5BPXA 2FNAA 4L5IA 1KU7A 4YFXF 2GC1A 2W57A 2DK8A 5JSRA 2IXIA 4I01A 3LFKA 2NYXA 1MGTA 4EV0A 3TGNA 3KLOA 1T39A 2O8XA 4M6YA 4M72A 4IXAA 1BJAA 4U7DA 4J1XA 2PEXA 4P96A 1D8KA 1KU9A 3EHKA 3OD0A 2MA3A 5BS6A 4RGSA 2Q1ZB 4EWEA 4L11A 2J5PA 2Z33A 3NQOA 1KU3A 3F6VA 1QQIA 3G73A 4I7HA 3OV8A 1L3LA 3BJAA 4PDKA 4ESJA 4A5MA 2VPVA 3ZN1A 4RGXA 3JTGA 2Q30A 5LRRA 2QBYA 3F8FA 6PAXA 5I8YA 1XMKA 4XFHA 2JZYA 3KEOA 4UXAA 3KEQA 1CAWA 3ROUA 1XN7A 2MLKA 1XMAA 2D5FA 5KK1A 1ZREA 1YFUA 4IVNA 4DNCA 2D40A 4I2OA 1OYWA 4L5JA 1S3JA 1T6SA 2ATFA 4ZU4A 2DLLA 2Z99A 1R36A 2V9VA 5ERIA 1U3EM 4E70A 4Q0PA 4KUMA 3K9TA 1MDMA 3BZ6A 1G3YA 3ZMZA 4WVZA 4RB0A 3KZYA 1ZRCA 4HDUA 4K2EA 5KHGA 2Q0AA 5FPZA 2IXJA 5FDBA 1OI6A 5H20A 3KZZA 4FT8A 2O8QA 2IA1A 2V79A 2UXNA 2XAJA 4AD9A 2OQRA 2CO5A 1SMYF 4EM2A 2RGVA 3HRSA 4OMYA 4M74A 1RTVA 3CLOA 2VE8A 2FF4A 3K1PA 2UWMA 2OA4A 1OD5A 5HOOA 2NAZA 3CLPA 2RDPA 1ZLKA 3FZ3A 2M1BA 5L3CA 3S0MA 2YX4A 3KP4A 2FSWA 5K1YA 2OZUA 1DP7P 2FOKA 1X3UA 3ABTA 3E5XA 1ZRFA 3GXOA 1ZG3A 4BHPA 3E6MA 5DD4A 2QENA 3GFLA 3WTWC 4ON0A 3H8UA 2G7HA 1SAXA 3LAPA 2Q8KA 4WXDA 4HSJA 3KP5A 2HJIA 1LDJA 3BPXA 2PA7A 2BV6A 3JW4A 3I64A 2KIUA 1YW7A 5CVUA 4FBFA 3P7NA 4B09A 1XGMA 5IT9K 5J7MA 3EO6A 3W6JB 2BBYA 1Q3EA 1I5ZA 2K02A 5IT3A 3WU0A 4CZZA 1UCXA 1NXMA 2XAGA 3WTZA 3V7RA 4IEZA 2MBFA 3JAMK 4U0YA 1VJ2A 3K0LA 4KMUX 2WTEA 3QPTA 1XDSA 1REPC 1XSVA 1HBXG 3NW4A 1XSDA 3WTVC 4IEQA 5EFUA 2Z69A 2LDUA 4PIXA 3VODA 1FSHA 3SXYA 4YFKF 2LKPA 1IN5A 2MHFA 4EWAA 2CAUA 1F9NA 3WG9A 2PHDA 5A2QK 2GAUA 2E7XA 2ZNYA 1JHHA 2JTVA 1A04A 4G7ZF 1LVAA 2OBPA 1B9MA 4ENKA 1KQ9A 5D4SA 1OFNA 3PFIA 5H6QA 3NVCA 3ZN0A 5DCMB 2QVOA 4CO8A 3O3KA 4LK1F 3DPTA 3QP5A 4KN4X 1CGPA 3CUOA 1SD4A 4EJOA 4WK8F 4FX0A 2EFNA 1Z1DA 3H7JA 3RKXA 1C0WA 2F5CA 3NKTA 3FFQA 3HRUA 1BN5A 2DO7A 3NRVA 5KHHA 4U0WA 3R0JA 5FO5A 4M6XA 1HSTA 3FHIB 5ILUA 4ZYGA 3IDBB 5HS7A 4XF1A 2WWYA 1FP2A 1O57A 3QPHA 4UBHA 2XASA 3RNSA 4WF2A 4HX4A 3JSOA 2STTA 1Y3TA 1XCVA 1XGNA 1W5SA 1O4TA 5D1IA 1SD7A 4NQWA 2MH9A 1G4DA 1T38A 4LG0B 1JHFA 3QACA 1S29A 4YNIA 3WTYC 2MLGA 4BNCA 2VOOA 4Q0UA 2ZKZA 1ODDA 2GA2A 4G94A 3TQNA 2E1NA 2JPCA 1TBXA 1FY7A 4Y13A 4KU8A 5JR3A 4OFGA 4HLYA 1UPIA 1RC6A 5KBFA 1R7JA 4MEXF 2MPFA 3E3VA 5DEQA 2W84A 4RB1A 3D0JA 3U10A 3KE2A 4XF9A 3DXJF 3EQLF 2DFIA 4XFCA 3K69A 1BI0A 1FP1D 5LLQA 4P9FA 1YFHA 3IDCB 3TOBA 5FLHA 2FMYA 4PZJA 2ZCWA 1YW9A 5KHJA 5FGMA 1CAXA 1TQPA 1XCBA 3WGGA 1MKMA 2HWVA 2XKOA 2UY8A 2EJRA 2IRFG 2F4PA 3RPQA 1OR7A 3QAHA 3E5QA 2HTJA 3BCWA 3BWGA 4Z2YA 1TW2A 1I27A 3M8EA 3OF1A 1ZARA 4EROA 3QOPA 1V3FA 1UCRA 5ILSA 1X7NA 2A68F 2G9WA 5F6FA 3T8RA 1IN4A 3BROA 4ZZDA 3RKWA 2QNKA 5HI0A 2W85A 1GHCA 1CAVA 3L2CA 3HSEA 3L09A 4QX5A 4IEVA 4YSFA 1P4AA 3M9AA 3WW2A 1B1BA 2G7UA 2Z2SB 3MDPA 4XEZA 3BPZA 3M70A 1Z9CA 3EJKA 4EMSA 4HBLA 5D6EA 4L2NA 3F6OA 1BC8C 4IEOA 2XVCA 2YU3A 1JGSA 2HFHA 4UVBA 3SHFA 2FE3A 5I8SA 4E2QA 2GH2A 4YG2F 3QP6A 1VR3A 4AVAA 2L54A 4RGUA 3GZ6A 2UZKA 4L0ZB 5C6CA 4BYYA 3DFGA 3RJPA 1HSJA 3O14A 1J58A 2KIMA 2N7GA 2E1CA 3BDDA 2GC0A 1HKSA 1RIOH 4RD7A 4MZUA 4WXHA 1YLFA 3H7YA 4AIKA 1KA8A 3SZPA 3ZMDA 3KP3A 4R1HA 3FXUA 5D6FA 2FQPA 2ET1A 4M9ZA 5FLXK 5DCMA 2PG4A 1IN8A 4MGIE 1XE7A 2GQQA 1ZRRA 1USTA 4CICA 5A2QZ 2KRFA 3LA3A 4QWQA 2NRAC 3TO9A 2PI0A 4GCVA 4A0XA 2NNNA 1WQ2A 3GFIA 3ZMUA 1DDNA 1IF1A 3H92A 4AIJA 4KWKA 1SFXA 4ZH4F 2D5HA 3GX4X 4XSXF 3CUQC 3WTTC 2WFPA 2IJLA 3KP7A 2VE9A 3KGZA 1Z6RA 2PN6A 4LK0F 2KIFA 4R52A 3I58A 3C3VA 2ACJA 5CVRA 3EDPA 3SFZA 3E97A 4HQEA 1D3YA 2YX7A 3NEUA 1TQMA 2BE5F 4OINF 1QBJA 2V09A 3LQQA 2V1UA 1JUHA 4FAGA 4I3PA 1FT9A 4HQMA 5BPIA 4M73A 2HZTA 2GZWA 1IZ1A 4ZYHA 4RS8A 3C18A 2Z9OA 1S7OA 3T5XA 4IETA 4LG0A 2FBKA 2KKOA 3LAGA 4EGYA 3ZQ7A 4NVPA 5ICGA 1J9IA 5FQ0B 2FU4A 1I1SA 2K4JA 4G6QA 4O6JA 1UHMA 1USSA 1QY4A 5J3UA 2HOEA 5JFRA 1P4WA 3U9GA 2TDXA 1X8EA 1FLIA 4IEUA 4EM1A 3M3IA 4ETSA 2CSOA 4BAYA 5D5WB 1IPJA 4PIZA 1KU2A 2VC1A 2E9QA 4FAHA 4QLCU 2CWEA 2J5OA 3IWFA 1P6RA 1R1TA 4L0YB 3WGHA 3E6DA 2C0ZA 4QGLA 4QM9A 3JZVA 2VQAA 3CUQB 1DGWA 4YYOA 2CG4A 2MC3A 4ZYDA 2FQ3A 3EYYA 3L00A 1BI1A 1ZVFA 2A5YB 5E1XA 4IJAA 1MJ9A 2OU2A 4Q0SA 2YSRA 2DPUA 2C6YA 4KIBA 3I0TA 1RI7A 4EJWA 4ESBA 4IEPA 1QXRA 4G8XA 1J2XA 1IXSB 2IXKA 5KHIA 3M8FA 3ETQA 4HX8A 5J6XA 3UKVA 2H94A 4M9SA 1KQ8A 1CF7A 3LA2A 5CLSA 4HSLA 2FRHA 3PQJA 3G7DA 5K5RA 1QWRA 2PAKA 4XETA 1O3TA 1ULYA 1ZYRF 4KU7A 2B8MA 4I09A 1T98A 4HVOA 2Y0MA 3KFWX 3Q9VA 2PYTA 4Q48A 3LAJA 3I54A 1CAUB 1XD7A 4KN7X 2QCSB 4JBAA 4I0BA 2XGXA 2ZNZA 3DV8A 2LF8A 3UKTA 5BOXA 3TDZC 3K1NA 3TNPB 4Q47A 1YS7A 1IUYA 3VHRA 5TRDA 3EBRA 1GXQA 3HIFA 4UBGA 1J5YA 5FB2A 4RAZA 2HS5A 1TNTA 4YIFA 2YPRA 4TV7A 4CDGA 2P8TA 5LRSA 3P9KA 4XFAA 1VP6A 5EEGA 3FHZA 1U6GA 1UHWA 2I45A 3MFKA 1DUXC 2B5HA 1YFXA 5D5XB 2H27A 2R7FA 2O0YA 5LHHA 4MGKE 4LLLA 1U5TC 5I93A 1W4MA 2ZBKA 2F5EA 2ISZA 1ON1A 2PFBA 3V8JA 4IRHA 4P5OA 1J7KA 1TNSA 4N0BA 2DCTA 2UYBA 3HOSA 3S2WA 3F3XA 4LA2A 1ZG1A 1EYBA 1ZZ6A 4OIPF 2K4BA 4K8FA 2PFWA 3ZDSA 3NSTA 1UFMA 1G6NA 2GWRA 2ADUA 4HV6A 1LJ9A 3GW2A 3N97A 3R4KA 5LBQA 3MZHA 1ZGJA 4IERA 5FLXZ 4LMYA 1DGRA 3P9CA 3ULQB 2QQAA 4BHBA 4KFCA 3LOIA 1MZBA 3R6SA 2HDCA 4A5NA
chains in the Genus database with same CATH superfamily
2Y2ZA 3B9CA 2WNVC 1R082 2EH3A 5FK7A 1OYIA 4Q4ZF 3J8F3 3TBDA 3IP4B 3V7CA 3BJOA 2JE9A 4HPQA 2GU9A 3WVJA 2KL4A 1XBFA 1I6XA 3S15J 3WNKA 1W6OA 4M9XA 3WF2A 2BPA2 1YQ2A 3WT3A 2R7QA 2LMDA 3RTRA 1W2NA 4M6VA 2CQ7A 2ZMEC 4XXPA 4IPAA 4BLIA 2B9UA 1GBGA 2HVQA 4XJAA 4QPOA 3OYGA 5IVEA 1XMXA 3KQRA 3DEWA 4B3NA 1QJX2 5FY0A 3IB3A 3OY9A 1P9QC 4PUSA 1LNWA 2X1CA 4CGZA 5FYCA 2MD5A 1CJDA 1NZCA 2A3WA 1S0GA 4A41A 2ETHA 3OCPA 3VD7A 3S2DJ 5CG8A 1HJGA 1RKTA 1QGPA 2JDYA 3MI8A 4P9IA 4LNVA 3ABMH 1SCRA 3GTJJ 4S2DA 4Y5SA 2ZGOA 1I3QJ 4M3GA 3ZLIA 1NA1C 2R1DA 3HTUA 4CA9A 2R7RA 5FD6A 1UY0A 1K5JA 4Q5SF 4NHJA 1A34A 2PHXA 5JR2A 2DU1A 2PX9A 4RDUA 1E5SA 1UJ8A 3K70D 5ACA2 2E7WA 3ACHA 3K4CA 1K61A 1WA6X 3RQ0A 1A5JA 3IV5A 3ZVXA 3BOQA 5LGNA 1VQNI 1OURA 2V1XA 2Y31A 3GLXA 2Y69H 2EV0A 2LOOA 4AEDC 1R1A2 5L3FA 4PDWC 4O9GA 4IHYA 1O5UA 5EXOA 1S0EA 2QZ2A 4MLOA 2DBIA 3GMEA 3WY6A 4A3CJ 1E5HA 5FZEA 1O7FA 3VBSB 2ZJPF 1FOXA 5J1XA 3DPRC 1D8JA 3M2MA 1E3OC 1WKMA 2QVSB 5CVIA 2D7FA 5IYYA 3S1MJ 2D3PA 3ASOH 3SKJE 2HNHA 3Q8BA 4FOWA 5IAVA 5LASA 1BOAA 4L8QA 2BFUL 1VTNC 4XICA 2F6BA 1Y9QA 9ANTA 2IFWA 4MH0E 4A6DA 4LO4B 5L3GA 2Q8EA 1WH5A 5FZDA 4RGGA 4R79A 4M00A 2X6OA 4D94A 3I5UA 3ZXAC 2CGPA 3QH6A 3V7SA 3ERMA 2KJCA 3K75B 4XIOA 2P7CB 5F08A 1J1TA 5C3OA 5D5VB 1EV13 3OBRA 3LFIA 1VBD2 4LEJA 3TBIA 2O5RA 4EWDA 1KRIA 2X1EA 4QPIC 4B3AA 4OU0A 2O9LA 3DN7A 1V6NA 1NQDA 1MH3A 4ITVA 1G8WA 3FK7A 1EV11 4FPJA 3MKZA 3KV9A 5D8KB 1BL0A 5T5LA 2BP6A 3LSJA 2EILH 2RC4A 4Y1VA 1X36A 3BTYA 4YG6A 4V2VA 3VDDA 2CMPA 1J59A 3M07A 3REOA 5CNAA 2XXZA 1X1CA 3DTIA 4BQAA 4QPGB 2LFBA 4BXSV 1X3ZB 4AVBA 3AMNA 5A32B 2YBPA 1UYPA 3JD73 3UR3C 3ZQQA 3RVHA 2DVGA 4KT5C 3MLLA 1PK6C 3L2VA 5C5TA 2P6CA 2W9XA 5IT9Z 3CF5F 3FM3A 3URFA 2GNDA 4KJZA 1MS1A 1MDMB 1HRI3 4N9IA 2R7UA 4AI3A 4XBQA 3JD71 2UY9A 5I0TA 5DABA 5AONA 5FK8A 5FPVA 4JGYC 4OYUA 1RUE3 4WCGA 4OULA 3PURA 2VVEA 1HRI1 1A6QA 2P4EA 1LKNA 2VMEA 4CXFA 1G3TA 2HWB3 5JSOA 4GULA 1H9WA 4FPFA 3T4VA 1G9FA 4PJ0C 3K4JA 1GFF2 3BB6A 2XF6A 3HNYM 1MQTB 2PHLA 3KCYA 1RUE1 5FYYA 1ZGAA 1QJY2 4YZ4A 5F6KA 2FZ1A 2JKXA 3O0VA 3MKWB 4Z07A 5FY9A 3G1OA 4URTA 2HWB1 5F39A 1RUOA 1H9TA 3EUAA 4XAEA 3IL2A 3HBZA 1AUYA 2JEMA 4MX3A 2Q5TA 2W24A 2OAZA 1CWPA 1WI9A 5HLGA 2ARXA 5KHDA 2KRHA 1CQTA 5K0UA 2GH8A 2RDQA 2BEOA 1W36D 2WAQN 5FR3A 1AL22 2VH9A 2KJBA 2JA5J 3TO6A 4XF3A 4L0PA 2DURA 1Z77A 5FZKA 1AU7A 3E5UA 1OPMA 2LYCA 2VMHA 2M8EA 1OFCX 3SC7X 2K7LA 2IVMA 3POFA 1US2A 2AHQA 4XBLA 1OCTC 4U36A 4JKLA 1UAIA 4Q26A 4DQ2A 4MYEA 2WA3A 4BQYA 1C57A 2ZXIA 2HGCA 1LFUP 2DAOA 3L2WA 1B4AA 1VZ0A 3PUQA 3H1WA 5D8AC 1W2UA 3RKQA 4A3EJ 4IESA 2KZVA 1O3RA 5BPDA 1N78A 1YQAA 2C4XA 3T30A 3VD4A 1HDPA 4N53B 2BNNA 4XXAA 3JCIA 1XNDA 4B4CA 2Z42A 3IAQA 3QQAA 3HOUJ 4LTAA 3HJEA 1YIPA 2SLIA 2RQPA 3IDEA 1OT5A 2OZ6A 2VC0A 3I71A 3OEAA 4LG3A 1O4YA 3FLPA 2EV5A 2GXGA 3VD9A 3RZHA 1I3HA 3A0HC 2VODA 1RL3A 1IAWA 3QCWA 3RZDJ 5BNNB 1CX4A 3H3UA 3VGIA 1BMV2 1SZBA 4DGWB 5IFTA 1R1VA 3HOVJ 4JRLA 2YC2A 3KT4A 3CJIA 3ZSJA 2NQYA 3VHNA 5FKBA 4XUPA 5IATA 3WEZA 5KNLA 5TISC 1YFWA 1ZKGA 4RLFA 3WHBA 5I8TA 3LIGA 1FC3A 4Z2AA 2LR8A 1RHI1 1QZYA 4JYKA 5GZGA 4FPLA 3CO2A 1OC1A 2PLYA 1V6JA 5FJHA 5A7SA 5FYBA 1QJFA 3ZYGA 1W7PA 4COVA 4KNYA 1FPN2 1ZN2A 1GWMA 1NAEA 5FRAA 2BERA 1OQYA 1TME2 4RLQA 1X1PA 5BUVA 1LEAA 2VW2A 5ICFA 1JTXA 4J19A 3ZIXA 4IXLA 4TLFA 1F5TA 2L01A 1U2WA 2K86A 4XPVA 1DU0A 4LHLA 5C8WA 3UYJA 5E79C 1R5HA 1MPXA 2DQRA 1A36A 3HM5A 4E4HA 1JT6A 4XKBA 3DYMA 3SISA 3J7YJ 3HHHA 1CAVB 4TSVA 1F4KA 3VDBA 4AIHA 1E3PA 1FPQA 5HCBA 1R64A 1PDNC 4A12A 3W5NA 3RWKX 1SEFA 4F83A 4DO0A 4IV1C 1YS6A 2OA2A 2DJNA 2WN3A 5FO7B 3LSKA 4B8XA 4B8EA 4A6OA 4Q0VA 2O61A 4IKFA 2VM9A 3S14J 1J1LA 3BZKA 5JOWA 3FUQA 4W8JA 2MEV3 2XLGA 1AR63 5HXMA 1W3XA 1U9NA 5FO9B 1Q1HA 3FIWA 1T6BX 4M0HA 1IGOA 3A4UA 4ZYAA 4XQ4A 2FBHA 5FZ6A 5C9AB 3BUCA 1YO5C 1DPRA 3UT0A 3MEPA 2R042 1HKQA 3H5RA 1OUSA 1HLVA 2HLEA 2L7ZA 5GAEJ 1K78A 1AR61 5FXXA 4LIUA 4KL1A 5CKNA 4XKWA 1SD6A 4HONA 1BBYA 1TNRA 2JT1A 4FI9A 5J36A 4N9HA 3VN4A 2J1SA 1XE8A 4L9VA 2XLAA 3MQ0A 5JZGA 5BQTA 3J7ZI 2B46X 2ID4A 3PNTA 1W9YA 5HDNA 5CU1A 4DOUA 1RUI3 2PQSA 4AGRA 2WC2A 1E2XA 2XJQA 3SQNA 2WAOA 4HNVA 1W6QA 3HHGA 4LQRA 4RR3B 5J4VA 3DECA 4BMBA 4OI2A 1RUI1 5E20A 3AMQA 1AYM3 3FX3A 1ONAA 2P5LC 3KD4A 3HXLA 4ASNA 1NK3P 2I2SA 3R4UA 4OHVA 1ACCA 1NCRC 1DIWA 3LSRA 1AYM1 5JIUA 3KP6A 4MQ9F 2D45A 3BR1A 2OUJA 5CFCA 2DPDA 2L5QA 1HQWA 2QSGX 2BRTA 3MHZA 2JDAA 5IK4A 3I3MA 1TQIA 4ESFA 1PYVA 4CXWA 4GXOA 3QD6A 2NLRA 3DP7A 5ILVA 5AIQA 2ZO4A 2DVAA 2O6GE 4Z8BA 4IQPA 3JUUA 4LLOA 1HW1A 4HEA2 2Y75A 3BALA 2HYFA 4LT5A 2VLAA 2M0MA 1TQ5A 3Q8CA 2FEZA 3M7GA 2A73B 2VL4A 3UNGC 1VAKA 1T2XA 3NWTA 1AKHA 3S17J 3TWIA 4FE7A 3WR0A 2W46A 2AH2A 2K9SA 1Z7S2 3IAPA 4GH4C 3NJZA 4L18B 5SV8A 3FBMA 4BE1A 1MEC3 4KMFA 1YQ6A 3EXUA 1PP7U 3CU7A 5DZGA 2PAMA 3I55I 2QDNA 1YJ9I 4CE8A 1W06A 1Z91A 4U88A 4XIDA 1YIFA 3H8OA 2L2OA 4HG2A 2YFZA 3JB8A 2A69F 3WF4A 3DU5A 5FLJA 1UD1A 1UB9A 2E35A 1MEC1 1CF7B 5CVVA 4D1QA 4BQ5A 3BR2A 4YARA 4RQPB 2VBWA 3MKLA 1GQGA 4H3WA 4GMP0 5FP9A 2LLKA 4LOSA 5CQEA 5HCAA 4WM7C 1NY72 2WAFA 2JRMA 3T2PA 1SPPB 1MS5A 4DYQA 4HA8A 3I59A 3RZJA 2EQRA 3DXTA 4C1XA 4A3JJ 3GFMA 4NJ4A 2EFPA 2R93J 2HWF2 4HMZA 4D8MA 1MNEA 5EJCA 3FHQA 1K12A 5JCTA 3HT1A 3PMSA 2FDGA 2LROA 4KT6A 3SEEA 5H9SA 1RR8C 3L7WA 4GRIA 4LGWA 2J1RA 4OMCA 5F2WA 3WW4A 1U5TA 1EH7A 4ORFA 2JK3A 1T0FC 4YVWB 4P1WA 2RM23 1UO9A 1VQ7I 3JRGA 3I4IA 3HL2A 2B4KA 2P7VB 4K8RB 3TAYA 4DUXA 4EEFG 4QTRA 1OCOH 2XKPA 1JU4A 4DOZA 5TSWA 2CDOA 1IN7A 1P8JA 3FXQA 4HVRA 2EXJA 2Q8OA 2QEXI 2D6KA 3ZXJA 4CDWA 5BV6A 4LXLA 4M3FA 5C4WB 4L99A 1Y8QB 4E7ZA 4R8HA 5D2AA 2XVGA 2JB4A 3WDUA 3H9GA 4CU8A 1FBQA 5ANQA 4S2GA 1ZZ9A 5FYUA 4J01A 4FQGA 4A6EA 1F36A 3LSMA 1R4MB 4QKFA 3ST7A 3ELNA 1W2OA 4PJYA 5IT6A 4ENJA 2E26A 5HXVA 1PNGA 3ZPLA 2M5WA 1HJFA 3IH2A 3RZMA 2IEKA 4U87A 5JVTA 2V6EA 1Z78A 3OPZA 1TW3A 3VBOB 3ZFEC 3LKJA 2BU9A 1CONA 1HB4A 3OPWA 4XZUG 3F21A 5IPAA 3C7OA 1D5VA 2D97A 2V6CA 2H6CA 4YW3A 1GV9A 4G7HF 1XSRA 3SCHA 1H9GA 4Q29A 1GWKA 1UMIA 5E3MA 2R5YA 1UYXA 2XC7A 1H2LA 3CF2A 1DZTA 3MCZA 5J09A 3AG3H 4LE4A 4HANA 2L9NA 1EH8A 3EYPA 4B29A 2FDIA 1URXA 3OGSA 2EZIA 2JSCA 1ZRDA 4BQQA 5DAWA 1L3JA 2PMWB 3HQUA 3PHMA 4B7EA 3NKGA 4AE2A 1JJ8C 5DAXA 5BNPB 1ZAOA 2HQRA 3K3OA 1DBNA 5BPXA 2ZHLA 2E33A 2HYXA 4YFXF 4V19K 3UGGA 1PVC2 1NUKA 5JSRA 3GTMJ 3S57A 5JI7A 2L7FP 2O8XA 4IXAA 1BJAA 2BBVA 5CPRB 5FYHA 2HZDA 4ZTFA 2GP3A 1JYWA 4BB3A 3PVEA 1QJEA 1CPMA 2KMUA 3F6VA 2D6PA 3OYCA 3WF0A 3ZMNA 4A5MA 4GQ7A 3OGRA 2QBYA 5JUVA 4XFHA 4QDRA 2YU9J 1LOCA 2MD0A 1A31A 1XN7A 2MLKA 4XCBA 3SLIA 1YFUA 1ZREA 5DAQA 3LOBA 4DNCA 3OYBA 2LRDA 3FBNB 4O61A 2FCVA 2JA8J 2RS52 2K2SA 3TN92 3K9TA 3BZ6A 1G3YA 3KZYA 3V0BA 2XR4A 1K6YA 5KHGA 2P6HA 1MS3A 5FRMA 4IW3A 2VCBA 3ZXKA 3CCSI 3SNMA 5F37A 3BC8A 2AQFA 1W05A 2PLV3 3KYCB 2V79A 2UXNA 2VASA 4EQVA 2CO5A 2DA1A 1SMYF 2R5ZB 1PUFA 1H6XA 3HRSA 4D3WA 2IGOA 3GLLA 2CNAA 2YZ4A 4YW1A 2VY0A 5FWJA 2FF4A 4UUTA 2UWMA 2PLV1 3CCJI 2WO7A 1OD5A 1CD3G 2P3IA 5IK5A 4CCEA 1ZLKA 2OCEA 3ZGKA 3S0MA 3KP4A 3S5AA 2FOKA 1ETYA 1X3UA 3ABTA 4WVVA 3ZFFA 4BHPA 2LC2A 5EZHA 4ON0A 5T5PA 3T08A 1VAMA 1XNCA 4HSJA 5A1FA 3KP5A 2HJIA 4XRMA 1JU3A 1AF9A 1LDJA 4XR6A 3BPXA 3I64A 3N3HA 2KIUA 4JGZA 2RR13 1BK0A 2FZ2A 5J7MA 3CCMI 4E7IA 3W6JB 2BBYA 2E31A 5FJ8J 5BNOB 3H8XA 3WNLA 2MBFA 3JAMK 2QQOA 1NXD1 2RR11 3IPVB 1WCKA 1REPC 3WV6A 5HODA 3NW4A 1UOFA 4Q4Y3 4UF0B 4PIXA 4AVTA 3VODA 3O1OA 1RUH2 3SXYA 2WAEA 2DOEA 3FISA 2NP0A 1NLRA 2PHDA 2VZ3A 3IIIA 3PTYA 4Q4Y1 5C4JJ 1AHDP 3BYWA 1JHHA 2DA6A 1PO23 2LBFA 3PUAA 3RFRA 5FO8B 1UMZA 1VAVA 2ZGRA 3MIGA 5EEAA 5D4SA 1HCRA 1AX1A 3PFIA 3VBSC 3WNOA 3NVCA 3ZN0A 5DCMB 1Q8PA 5JXHA 2QVOA 4CO8A 2ZFUA 4ES8A 1YI2I 4HKOA 3DPTA 3OBZA 1BBT3 3C2UA 3WOGA 5F2SA 4GXLA 4AYBN 3JRAA 5F5IA 3QP5A 4ES9A 3CUOA 1PO21 1YC61 4YW7A 4FX0A 3RKXA 1C0WA 1VQKI 1WCSA 2XQRA 3NRVA 5E3LA 5KHHA 1LEDA 1BBT1 3WG3A 3THCA 3ZN6A 4GB33 1Q8OA 1X1AA 3WUDA 4COZA 2IGKA 3I3BA 3BQYA 1BR2A 3QH7A 4CCKA 1US3A 3VDCA 1EKEA 5JMOA 1AR72 5F6LB 4XF1A 2ZGPA 1BLZA 1D0GA 2GALA 2CQNA 4GB31 4W1UA 2EAKA 4D69A 4UBHA 1R49A 2WAQA 3RNSA 3IDAA 5LY2A 1N3QA 3ZFEA 1AJKA 4IHVA 1Y3TA 2VNVA 1JZ4A 1W5SA 1O4TA 4NQWA 4HPKA 4CVUA 4BXXJ 1G4DA 3Q3SA 1J83A 3QACA 1OKQA 1W2TA 2XPUA 2XH6A 3WNXA 3M3OA 4LBKA 2JG8A 3WTYC 2MLGA 2CHHA 3ZO0B 4BQ4A 2ZKZA 1FIPA 3AKZA 2A3XA 3V0AB 2CRGA 3LEIA 4Q4V2 2E1NA 2IGNA 4E7KA 1TBXA 4Y13A 4KU8A 4C9YA 4HLYA 2VUAA 1TT5B 5FKCA 4ZJZA 3POWA 2R7VA 4XUQA 2DFIA 3UNPA 2PJRB 3K69A 4XFCA 1IRXA 2YV8A 1XSQA 1TNFA 1RMU2 2VB6A 3FBIB 4AFBA 4CYCB 1LHOA 3PIOF 3SJMA 2FMYA 3F0CA 3W3CA 3PO2J 2HVRA 3LIHA 1MH4A 3I2GA 5J1YA 1WD3A 5FGMA 2M8GX 3VD3A 4RA0A 5A3NA 1FX5A 2HOTA 4XUNA 2XKOA 5B4NA 3N35A 2M9HA 4M3CE 4YZ2A 4B44A 2CWMA 2Z4FA 1OR7A 3N7KA 2HTJA 5FZBA 5FY5A 2ID6A 3CDIA 4YM0A 1MQTC 1TW2A 3IAS2 5A3PA 4I6ZA 4HRIA 1S72I 2HPMA 1UCRA 2YB7A 1JTZX 3RKWA 2QNKA 2JDMA 1GHCA 2WO1A 2ARCA 2OIIA 4Q4W3 2FHRA 4JDOA 3L2CA 3HSEA 3M9AA 3HOZJ 3K48A 2VZPA 2G7UA 3CMGA 2Z5WA 3MDPA 1K5MC 1Z9CA 3PJRA 5F7UA 3KT7A 4Q4W1 5D6EA 4L2NA 5DUVA 1BC8C 3GXUA 4BJTA 1QPIA 2Q1MA 2RS33 1JGSA 1WCUA 2FE3A 4YG2F 4OHYA 3K70C 2R072 3KWVA 1ETOA 2R7EB 4BYYA 3NNJA 2RS31 4M3DA 1HSJA 1J58A 2VE1A 2N7GA 4YM1A 1HKSA 1GMMA 4WXHA 3ZKUA 3GZAA 4AIKA 1KA8A 3T1LA 1FATA 1JZ6A 1SBEA 3RS6A 4D9JA 5F9TA 4QSHA 4R1HA 1RUG2 3KYDB 1V6IA 2QTWB 4QXBA 2PG4A 4MGIE 5FP3A 5A2QZ 4CICA 2OS2A 5EG0B 3LA3A 1CZTA 4UB6C 3ZMUA 3RRDA 1AR92 3H92A 1W6NA 4NIAA 1SFXA 5A80A 1XE0A 4NBQA 3KV6A 3LDKA 4N53C 3P5JA 4XVHA 2VE9A 3KGZA 1BZWA 4LK0F 1TT0A 2KIFA 1DP0A 4DPNA 3VYUB 1G2HA 5GP9A 3E7LA 1W6OB 4NMIA 3HPGA 4M3BA 2M7BA 2V09A 3LQQA 1JUHA 4YVSC 2DUOA 5FUPA 2HZTA 3TEDA 3DBRB 2K9LA 4K7JA 3T5XA 1NCQA 1CVNA 2R7SA 4AK3A 4XONA 5A7QA 4NPRA 2FBKA 3LAGA 4EGYA 1KD7A 1QXPA 4AEMA 3LDBA 3NARA 2FU4A 2HOEA 5EPAA 3I4NJ 3TEWA 1X8EA 3S5QA 4FVVA 3WP4A 1WMEA 4IEUA 4EM1A 2QQNA 3M3IA 2CSOA 5D5WB 2F17A 4PIZA 2VC1A 5FZFA 2J5OA 1P6RA 3FXMA 1X1DA 1MMSA 2DMTA 3CKHA 4V2GA 1DQ2A 2WRAA 4FTEA 4QM9A 4P9LA 2MC3A 2FQ3A 3L00A 1BI1A 2VQGA 3VKFC 2A5YB 2CW8A 3TEYA 1UZ0A 1MJ9A 2DPUA 3RI8A 3WCRA 2XRLA 3M4FA 2IFRA 1QXRA 1J2XA 1IXSB 1RUD2 2G9GA 3M8FA 3J7LA 4HX8A 4J25A 3ILNA 2XBO3 4EATA 1ETVA 4M9SA 3K6GA 5FMDA 3NO8A 1OBNA 4PJJA 4HSLA 3G7DA 4QB2A 1IC8A 5EF6A 5FPLA 5J37A 4I76A 5FY1A 2Z1DA 2QQ8A 4I09A 2XBO1 1T98A 1OA2A 2XF5A 1W0UA 2W39A 1ZA4A 5DDJ2 5A7OA 3M8JA 2CWSA 2NVUB 4KN7X 2DFCA 1WW4A 2GXAA 4AI0A 4OI4A 4ASMB 3RMYA 5BOXA 3CDLA 3TDZC 2HWE3 3K1NA 4WM8B 4Q47A 3V42A 4XK4A 1XXNA 5TRDA 2O14A 3KS7A 5HNFA 2PN5A 1XQNA 2GSYA 5FB2A 5IP7J 3BTXA 4XOTA 1W36C 2HWE1 2DCJA 1HXS2 1LOFC 1ZK8A 2P8TA 3P9KA 2VCAA 4QQLA 1VP6A 5IP9J 2GOMA 1S0JA 4BWOA 1U6GA 2I45A 2EIBA 3MFKA 1UY2A 2R32A 1E5IA 1GWLA 2E6VA 5FBZA 1BCXA 4A3KJ 4MGKE 2XQXA 1H4GA 4I99C 3AP4A 1ON1A 2PFBA 4GZ9A 1XNAA 4R9DA 3UL2A 2VOKA 4IRHA 1TNSA 1O8SA 4N0BA 2UYBA 2RG4A 3HOSA 3S2WA 1DU6A 4UB8C 3CMAI 3TP0A 2KPMA 1KXGA 2KLOA 3ZXFA 3ZFGC 3H9QA 2DA3A 5FKLA 2ZGUA 4AVZA 2ADUA 4HV6A 2YYOA 1S0BA 3TW7A 3S3OA 1RITA 5LBQA 3HC7A 3VDDB 2Y9ZA 1RUC2 2W1UA 4BQXA 3P9CA 3I2KA 4XOGA 2DFFA 2V9PA 3LOIA 1I1EA 3ABLH 4QHBA 4KIFA 1JS9A 2VJ5A 2B45X 2WR9A 1J0RA 3MEXA 1AWCA 2PJPA 2P5VA 1SC7A 4RR3C 2DU0A 2WZPP 2DVFA 5FPAA 4MGRA 1TWAJ 1CQ9A 4O65A 3SDBA 2ZB9A 4CZSA 4DNYA 1XDUA 1D4M2 4COUA 4I02A 1W7PD 4IL6C 4L9BA 3FE5A 2RJLA 5IHRA 5A1LA 3WDWA 5F5CA 2DYSH 2MABA 3AMPA 1UIJA 5I91A 2M30A 4UYBA 1HB3A 5FQ0A 4BK5A 2KQRA 5HVQC 1GV2A 1O3SA 2E2IJ 5C33A 4RAYA 2VW1A 5LW9A 1I39A 1UZWA 1TMF2 2OW4A 3WP6A 1JUIA 3O1RA 4X1EA 1EP0A 1FAYA 5BNGA 1MVQA 3CCLI 4G6DA 1UPSA 1T33A 3HPHA 3RPUA 1FZPB 2DK5A 1QNTA 1SDDB 3S7IA 3WNNA 4BH9A 2EFQA 4UV9A 4HYEA 3OMYA 3CLQA 4F8AA 5LA2A 3MGUA 2HOAA 2WL1A 4UVAA 5K0UB 5L3DA 2VMIA 3O0XA 4XOPA 2YBKA 3EQEA 2WAAA 1ZBE1 1UAAA 5F3CA 2XJTA 4KBZA 1VBA2 1GLHA 1XGOA 3K4NA 2L02A 4UFKA 1KS5A 3MKYB 4IE6A 2OKXA 1OMIA 2QQJA 1UX6A 1UELB 3CNAA 5FYVA 2V1DA 3OWTA 3KZIC 2P17A 4KQ7A 3PSIA 1CESA 3QYFA 2AXTC 1Q43A 2UWBA 2QFEA 3UJOA 5D5UB 5EQUA 2RMU2 1ZQ3P 3K2OA 3M7AA 2IW5A 1G9CA 1FOD2 2OQ6A 4XRFA 1BEV1 3L2HA 1LDKB 1TP4A 2XSDC 4RQPC 2R3SA 2B42B 4OOIA 2WV1A 4V2WA 2BGPA 3ALQA 5JPMB 2VUMJ 3NNLA 2EA2A 3ZQHA 2X5IA 2WFF3 4A4AA 2F6CA 5EDNA 4Z82A 1NA1B 2ZXQA 2BY0A 4HT1T 1U5ZA 5IUQA 2YU1A 5FCCA 1OFSA 3IWZA 1DU3D 3N7MA 4JCKA 2WFF1 2EIKH 4MHUA 2IA0A 3W6KB 3A7QA 1TZLA 3AYCA 2WZR2 4BJ0A 4MIMA 2Y33A 3UGHA 2XVLA 4MQVA 1A8MA 2PQ8A 2LY2A 2HQNA 4YVWC 4XQDA 4EJUA 3CEWA 1J3RA 2LALA 4BE2A 5FRNA 3SKVA 1H0BA 1B8IB 1RVF2 5I0SA 1P92A 3DKWA 4AEDB 2QQ9A 4A42A 2M34A 4CSWA 1Q1VA 5ANNA 3ZXSA 1FYMA 5C8CC 1SBDA 1IPKA 5CKQA 5LHGA 2H09A 1BQPA 2CQKA 1C1FA 2JDPA 3CJIB 3FWEA 5CFDC 5C4WC 3M1EA 1PMIA 3DPRB 3J81K 1U12A 1IW7F 2VUJA 2GBYA 4CDXA 3Q9SA 1F15A 4CEYC 3W2AA 1MBKA 3AP6A 3V8LA 2QBXA 4P9JA 1BIBA 4BKXA 1G9AA 3FM5A 1LESA 2H6BA 5K7ZA 3DEEA 4W97A 2DTWA 1LHVA 2IUWA 3HSFA 4WX9A 2WT1A 1W7PB 4L9NA 3JAMZ 3DLLF 1REDA 5M0TA 2WNUC 3ZQLA 2R7ZJ 4LHKA 1DG6A 2HXIA 2XGCA 3LMMA 2B0LA 4JTOA 4WZFA 2LTNA 3VBOC 2VXZA 1GVJA 2HWC3 5LHIA 2AACA 3KLNA 4L97A 1IV6A 1W6PA 3VBHA 2BQPA 3VBUA 2F5VA 2AC1A 4XACA 3IC7A 4AWXB 4BQ3A 1XPWA 1JUMA 2HWC1 3ZFGA 2K9MA 2HXOA 4II2A 4PK4A 3OY8A 4NAMA 4CCMA 1K7AA 2UWCA 1I1GA 2BW3A 1N25A 3WE2A 5H2FC 3U14A 2EK5A 1PO13 4ZXEA 3RJRA 4YW2A 1XB4A 1FYLA 3HRTA 5FKKA 2WWSA 5DD8A 1W04A 5DV5A 1ZELA 3MZYA 5BNPC 3WG4A 3CC4I 1SLAA 1QZZA 3LWCA 2GC2A 3GEZA 3VDXA 1BOBA 2XV4S 1WSUA 1ZBA1 1PO11 3OSFA 1GQHA 1BKZA 3MIBA 1LEBA 4KICA 4CHUA 2WDBA 4JAAA 1N1SA 2XVKA 5DUKA 2IT0A 1GYKA 2ZAAA 5KXBA 2XUMA 1F4HA 1T56A 1FMWA 2DI3A 1TTYA 3PLQA 4AQ2A 2H8WA 3ML6A 3SEQA 4LKFA 2DT7B 2KD7A 5L73A 3ZYJB 3OS1A 4FFGA 4A3MJ 1WVRA 3C2GA 1K78B 1ZNPA 1LU1A 1GV5A 4C8DA 3GO5A 5FFXA 4L9TA 1POV3 4ENMA 3U37A 3ORJA 3AP9A 4E4ZA 5DCFA 1B9NA 2L4AA 1D1AA 3AJZA 2CH0A 5FBJA 1WKYA 2XJVA 4UXNA 1QXJA 2VVFA 1POV1 3B6AA 4BU2A 1VE0A 4AYBA 5LEJA 1BXHA 4PQ9A 5HLHA 1GUIA 1WLTA 2VPRA 1W6QB 1DYOA 4Y3OA 3ACFA 3PU8A 5GLZA 1V6MA 1FI2A 2YHJA 2KR2A 3LA7A 5HV0A 3SCGA 3NRUA 5FREA 4H55A 3SH4A 1QGLA 3MLJA 3E6CC 4F3JA 1RESA 5FLIA 2BXZA 3LEGA 3ZX7A 2RVCA 1G3SA 2EV6A 5AVPA 4UUSA 4B3XA 1XG1A 3A4CA 3FMSA 4OIQF 1IDYA 1V4RA 4HF0A 4JKKA 4UOJA 5J4YA 2HYGD 3BU7A 1EV7A 5FZGA 2EFOA 1Y0UA 4L9JA 3APBA 3MIHA 2OYZA 1IRFA 1IS3A 3TNQA 5F1JA 3AYAA 1EV12 2WWUA 4Y17A 4RB2C 1W1WE 1PM7A 1QOSA 4XJ9A 3I3DA 4NOTA 5JHUA 4UHTA 5D8AB 5FY7A 4JX0A 4K6BA 3I2JA 4BACA 2GIZA 1YQ8A 4I30A 4UY8I 5I0RA 1OCZH 3E1SA 5BNOC 1NE6A 3ZP5A 2M4GA 1GR3A 3OYWA 4LLFA 2JVGA 2NVYJ 1ZZBA 2HWD3 4I98B 2Q4SA 4DY3A 2ZZJA 4RM2A 1G59A 4W6WA 2AEZA 4A0YA 2DFBA 4FX4A 3CF6E 4C2UA 3ASIA 2O8OA 3OSGA 1L0OC 1AKHB 5EJ1B 2VD7A 4IF4A 1VQ6I 3JD72 4QGMA 2HWD1 3WGIA 1UZYA 5F8PA 4NR1A 2V4JC 2ZJ2A 3EUHA 3B5LB 3F8CA 1ULPA 1AOYA 5K4LA 3I9V2 2CQQA 1HRI2 4XQWA 4NB5A 3NJXA 3LSIA 4AVPA 4JVAA 1MBJA 1FOYA 2GIVA 1GQPA 3G71I 2VUDA 2VMGA 5TGTA 1RUE2 5F1RA 1RUF3 2HWB2 4WV8A 5GTIC 1HA8A 4CEWC 1UIKA 3FKJA 2IVIB 4CEYA 4UVCA 3I59B 1FTZA 1BW6A 3ECHA 4XJWA 5A3OA 3OYNA 1RUF1 5L9VA 4HOBA 4PGHA 5FXVA 5EGOA 2JMWA 4A3FJ 5CKTA 2NMNA 1QJY3 2BHZA 2GXBA 1RNLA 1D1BA 3VOEA 3RZGA 1V6KA 3L1PA 5K7PA 4IRGA 3WU1B 3L9FA 1U5TB 5LGUA 3M3QA 2JVHA 2VL8A 1P4XA 4YZ3A 2FNPA 1AX0A 2EWNA 3OG2A 3GZ5A 2WS93 1SFPA 3MIDA 1LNSA 3L2UA 2Y0OA 3QRFF 4XLPF 4PQQA 2RS13 3ZSKA 4HOOA 3QLQA 3T1BA 3SEPA 2WS91 4CDWB 3D5LA 2A7AA 3POGA 1UG2A 3CUQA 2VBDA 3RYKA 3ZYHA 1YI9A 4N8MA 2RKHA 3KPHA 2RS11 3GFJA 2LG4A 2G4IA 2NS0A 3V4GA 3VBFA 2EVXA 4NE9A 4UFLA 3VWBA 4ASKA 2LREA 4XJ8A 3K2ZA 3WTSC 2E7QA 5H9RA 3JRHA 2RREA 2BZTA 4G9SB 4OLLA 2WBMA 5BY5A 4CDQC 3AP7A 5BMZA 3PL0A 2O1QA 2ORXA 4Y4RA 1H1MA 4DEQA 4YM2A 5LK5A 1ZTRA 1W5CC 3RZKA 3FXJA 1U0AA 1F4AA 1YIJI 1CAUA 1V55H 2DOFA 2JDKA 3SYTA 4X6QB 1HRV3 2VZQA 2RAEA 3NAPA 2ZS6B 1I3AA 3IHUA 5E1ZB 4ZC3A 4MO3M 2YG0A 3H1YA 2PMHA 3RQIA 3IMNA 3WDXA 1TLHB 2OD5A 4DINB 1BM9A 2AS5F 4AI2A 1HRV1 5E8GA 1PJRA 4HLTA 2B63J 5FOBB 5HBAA 1V9U3 4BUPA 2PBIA 3VKOA 4XTPA 3KHBA 4JP0A 5IYDJ 4XN0A 2B9VA 2CU5A 4Q2FA 1ZH5A 1RHI2 2A6HF 3FF5A 1EY2A 4LLGF 1V9U1 3HEIA 3C7JA 3E6BA 2IC1A 4H7MA 2UYAA 1M4WA 5H6RA 4QX0A 1XJAA 2VMCA 5A7WB 1TWFJ 2ZGKA 1YWKA 4HVQA 2R7DA 1X9PA 2OPKA 2ECCA 1UU6A 4Y4YA 3FDYA 4LITA 2W95A 1NCRB 1GDTA 4BL0B 2YC0A 2NNYA 4XYXA 3IUOA 2QBYB 3NL1A 5FPUA 3ZRGA 3MFAA 1Q56A 2WKKA 3P3PA 1FPN3 2NS7A 1UW8A 2VZ1A 1UOBA 4EN7B 2NZ9A 4JV4A 4X0GA 2VZSA 2R0FA 4NHLA 4BZ4A 1BA5A 2CFOA 1E0EA 3ZXGA 3F8NA 3RKYA 3MZ8A 1UF2C 2VTXA 2W08A 1LRHA 2FDHA 4MO7A 3LEKA 3V0BB 3CESA 1PNFA 3AG1H 5AC93 4D7SA 3POSA 1P7JA 1SFKA 3K4ZA 1FBSA 1ORKA 5CADA 5G05L 2JG9A 4D6RA 4COWA 3F9KA 5FLVA 1PUFB 2O0OA 1RUNA 2JA7J 5AC91 1IRZA 2CS3A 4HN0A 4BS9A 4XKVA 4QMAA 1YE9A 1JHJA 4QPWA 5AFBA 2YFUA 5HS9A 1R23A 3PUIA 4MUVA 4OUMA 2EBIA 2ILMA 2QDRA 4GGGA 2UXXA 4KA4A 4NIIA 4HETA 4X6AJ 2ZGNA 3I3QA 5IP6A 4FE4A 5JR7B 1AR62 2WNEA 3PL8A 4XDOA 1CX1A 3DTEA 3CIHA 1SD5A 4XFFA 2ZHKA 2Y6JA 5D4RA 2D1HA 4P55A 4JGZB 2L9SA 2VG9A 1GP5A 3NQHA 3LZZA 4GKYA 2PMUA 5IAXA 3K1MA 2HYJA 5HPOA 1VB4A 4Q8KA 2JUGA 2K46A 1FWZA 2A61A 4LBQA 4BBSJ 1U9OA 3FMRA 4N4OB 3GALA 3NNFA 2DVDA 4SLIA 2EAAA 1V70A 1NG0A 4IE7A 5ICEA 2WIIB 3CMEI 2RV9A 2XHNA 4HKWA 1JTYA 1OA4A 1RUI2 5JOZA 2Y6FA 5KVRA 4IOCF 3P9IA 3J80K 5TJJA 1LODA 1PZ7A 4KWUA 2QQBA 5HNHA 1ENRA 4ZU5A 1MJBA 5JXIA 1R5ID 3BOPA 2E2HJ 3BODA 1UY3A 2ZX3A 1WCDJ 3TO7A 1B59A 1AYM2 4FSJA 2BHYA 1R5GA 2LBFB 2J7MA 5GZEA 5FZOA 3ZMVA 3GHNA 3N36A 5FYIA 2VQUA 3GUDA 2CFXA 1Z7UA 2XGDA 4IQ4A 3WQBA 5GLWA 1R6RA 3JXSA 3D82A 3GVAA 4RYDA 1HDDC 1YIOA 2GN3A 2HEWF 4CCDA 1WJBA 3H3LA 4LB5A 4L5IA 2GC1A 1H2NA 2DK8A 2JN6A 1OLME 2YPDA 1RKWA 5CKMA 4GA9A 4I01A 3G1LA 4RGKA 3TGNA 4U7DA 4J1XA 2A71A 3B3QE 1D8KA 1KU9A 4ET7A 3DLAA 1ASJ3 2K3PA 3OD0A 4LPLA 2Q1ZB 2DXIA 2E7AA 2VCCA 5DN2A 1QHHD 3NQOA 3CJQB 1QQIA 1H8TA 5FXWA 3W2VA 3OV8A 3ZFEB 4B47A 4PDKA 1VQ9I 2W1OA 3ZN1A 1ASJ1 3C7HA 4NQWB 6PAXA 3THDA 2JIJA 4V1PA 1WLDA 1FMD3 3SDGA 1CAWA 1DGRM 3ROUA 4QPGA 1MEC2 2QQUA 2JG8B 3OYMA 5I0DA 3ZDVA 4MFDA 2D40A 1H1AA 5JVGF 1RRJA 2WBKA 3VDDC 4XILA 1R36A 4AFAA 1FMD1 5ERIA 4CXXA 1YQCA 1T6GC 3HB9A 4KUMA 1MDMA 1EUUA 1C1LA 3ZMZA 1MBFA 1SFOJ 1ZRCA 4NHXA 2QQLA 2P3KA 4K2EA 5FPZA 1ZGWA 2IXJA 5FDBA 5H20A 3NWSA 1XYNA 4FT8A 1I9RA 4MFEA 1VQ4I 3T2OA 3MUZ1 5IOYA 4AD9A 3KHCA 2XMLA 3OYJA 4FCAA 3AKQA 1UY1A 1J84A 1JKOC 3JCUC 1W6MA 2AEYA 4OQ8A 2UU8A 1DF0A 3CLOA 3K1PA 2ZHMA 5F0FA 5GM0A 2VQLA 2CV1A 2BDRA 2YMZA 3FZ3A 2M1BA 2YX4A 2FSWA 3E5XA 1REFA 1ODNA 5FZ4A 1YX5A 1LAJA 3GFLA 2Q8KA 5L9RA 1WW6A 2PA7A 3JW4A 2VXDA 1VNDA 1XGMA 3ECQA 3ME2A 3WU0A 2Y6LA 1VRH3 1NXMA 3UESA 4N4NB 4U0YA 5K0UC 3M8LA 1MZEA 1XS9A 5SV5A 2FDKA 2G0EA 3BR6A 3VYSB 5LA9A 1XDSA 4FPCA 1HBXG 1UWWA 4QQHA 1VRH1 5EFUA 5T52A 3WQ1A 2ZX2A 1IN5A 2YUSA 2MHFA 1LOAA 1NG6A 2D6MA 3J8F1 4BQOA 4EZHA 1QDOA 3MN2A 4C3IJ 2ZNYA 2X6WA 1NLQA 4AHZA 3Q9OA 3X29B 2JWPA 4R9CA 3D5OA 1UKRA 2OBPA 3K46A 3L9JT 2BOJA 1PVXA 1OFNA 3P5BA 4B48A 5IK7A 2R7XA 1LUJB 3OS0A 2W5FA 4KN4X 1CGPA 2BY3A 2WQ8A 1SD4A 4WK8F 1IS6A 5IOZA 2EFNA 3ZKYA 2MC4A 3ZCOA 1QH7A 3FBYA 2V7FA 1W6NB 1D0HA 4C91A 2XPWA 1KGYA 4RGAA 5DMYA 1JODA 4BE3A 5FO5A 4IE5A 2W1SA 2KHMA 1PVEA 5LZ6A 1HSTA 3GJBA 3P3NA 4BLJA 3I8TA 3FHIB 4YPJA 3LOCA 3AKRA 3D8CA 5BNNA 3TOJA 3QPHA 1H8VA 4ATFA 4ISQA 5FLMJ 2XASA 4GKXA 3JSOA 3ZXDA 3CZJA 4YGCA 4KBBA 5D1IA 3M3CA 2MH9A 2Y0IA 1NCQB 5FUIA 2ZEWA 2VOOA 4DZPA 4ZPIA 3P6BA 4PF1A 3KB5A 3CJIC 3IT8A 1LECA 2JPCA 1B72B 4XQFA 3HZJA 3ENRA 5JR3A 4OFGA 4GALA 3VL9A 3BVCA 1R7JA 3E3VA 3QPLA 3WP5A 5DEQA 4XLEA 3OIOA 2WABA 2BBAA 3J7HA 3NNMA 4OZXA 4FFFA 1B09A 4XLAA 3DXJF 1XC6A 3JRFA 3RPUD 3ETPA 1P7IA 3GTOJ 2XUEA 3BG6A 5B1AH 1YFHA 4OUEA 3TOBA 4FXKB 5LA0A 4F3QA 4LKSA 1C8NA 2IAIA 5FLHA 2DMPA 2FX0A 2PXJA 4MG2A 2R6QA 3BI3A 3WGGA 2QA4I 2UY8A 2EJRA 2WO2A 3HOYJ 5EJ3A 2E60A 1GP6A 3O1SA 3BT9A 2D6LX 2VTFA 1WMXA 1KZHA 2W68A 2PLV2 2E5NA 1DGRN 3R0RA 2C26A 4OHXA 1DZQA 3VZKA 1RJ7A 3TRSB 1ZARA 4EROA 3QOPA 2DCYA 2A68F 1IN4A 3BROA 2NVXJ 4JHTA 1FV3A 4BQ2A 2W85A 3V64A 1CAVA 1WBLA 5JLXA 3J4UH 2LW8A 1FTTA 4F91B 5LBEA 1SBFA 2Z2SB 2XJPA 2YROA 4FFIA 3BPZA 3G1MA 4P9WA 3MF9A 3EJKA 4NC7A 3WG2A 2CDPA 3BTCA 3JU9A 2Y9YA 3F6OA 5C7GA 3H5AA 4NWVA 1D7PM 5KWRA 2HFHA 1IG0A 1N77A 5FZCA 4BEHA 3QP6A 3KM5A 5K7HA 4RGUA 2RR12 3GZ6A 2UZKA 3AVSA 5C4XJ 3U4SA 4GWJA 5C9AA 1GNZA 4YIRX 1ULFA 1Y8RB 2ZACA 3RJPA 4DY5A 3CP8A 3HWJA 5IVCA 2KIMA 1XB9A 4PLNA 1WMFA 1YLFA 2DODA 2JENA 3PNYA 3SZPA 4QHZA 4PLOA 1UKGA 5JDBA 3WF3A 1H2KA 4Q4Y2 4H2AA 4D7NA 1XE7A 4UW6A 2GQQA 3NV4A 1USTA 1RB8G 4CZCA 2DBNA 1X3WB 2KRFA 2DV9A 3DCQA 2NNNA 1DDNA 4B1RA 4LORA 2GNMA 3WDTA 4AIJA 2BOLA 1A6IA 4C3JJ 3OJBA 3I2OA 2NPIA 5JZGC 3GX4X 1PO22 4RS5A 5F3EA 3ZM8A 2HH9A 5DUUA 2B9SA 2GMEA 3U1XA 2DTZA 1Z6RA 1SDWA 1K5MB 2PN6A 4H4KC 3I58A 2GDFA 1BBT2 2ACJA 4ASLA 3SFZA 1JW6A 3E97A 5E3NA 1D3YA 4FPKA 2G1MA 4IGOA 4RM3A 2YX7A 2DMNA 3Q8FA 5CZKA 4CPBA 3NEUA 5J47A 3WQ7A 1TVGA 1EF4A 4OINF 3BLYA 4JX4A 1F43A 2L7MP 3VLBB 4GB32 5BPIA 1IZ3A 3CQOA 2GZWA 5J3LA 4RS8A 3C18A 3T0BA 1U5YA 2DUQA 1BHGA 1GZ9A 2KKOA 5C3EJ 1X58A 2TUNA 1YO8A 3AZWA 5FXZA 4NVPA 1UG0A 5FQ0B 5CFCC 5J3UA 2GMPA 5A6ZA 1P4WA 1UYYA 1FLIA 3LD8A 4ETSA 4BAYA 1G9DA 2TCTA 4XLCA 1JT0A 2J42A 2GN7A 4YGEA 4NHKA 2E9QA 4FAHA 4R4ZA 4NDLA 4ISRA 3OYIA 4M3CA 2V1NA 3J26N 2R4GA 5CEHA 4FPHA 4L0YB 2ZGMA 3WGHA 3E6DA 3JZVA 2VQAA 4KISA 3N9OA 1DGWA 1K4TA 4KGQA 4OAZA 4ZYDA 3O8GA 1CZVA 2CUEA 1ZVFA 2GM4A 2JWTA 1XNKA 2YSRA 3VSKA 5L9BA 4KIBA 4NPMA 4ESBA 2I8DA 2IXKA 2VGDA 3AVRA 3RJ2X 5KHIA 3JBG3 5J6XA 3UKVA 4XNFA 1KQ8A 1CF7A 5CLSA 2FRHA 4YVSB 2VPLA 1QWRA 1JN2P 4ZKTB 5FOJB 4XMAA 2NYYA 2XJSA 3JBG1 4KU7A 2KFDA 5FYZA 1EJ9A 2YBSA 3C7FA 3LAJA 2Y64A 1RPWA 3VB9A 1VBE3 2ZMKA 4PSWA 1QEXA 2OX0A 3FLTA 2ZNZA 3DV8A 3CCYA 3UKTA 5FMOS 1TE1B 1VBE1 3VHRA 4QHOA 1W3VA 2X5IB 3EBRA 3DEMA 2HDWA 1GXQA 2VBPA 4E4SA 1N47A 4W4ZA 2HEVF 3VZLA 4YIFA 2YPRA 2E2JJ 2WSUA 5LRSA 1NK2P 5DUWA 1WCMJ 2X51A 4XFAA 3GZNB 4IV3C 1C28A 4QDQA 4Q4W2 3HOXJ 1DUXC 2B5HA 1YFXA 3VSLA 3KV5A 5D5XB 3OYLA 1OKOA 5LHHA 2OPWA 5DS9A 4LLLA 1U5TC 2C5DA 2HBUA 3S6PA 2ZBKA 5A3WA 4XE9A 4Y1XA 3OYHA 2RS32 2ZC2A 3FHAA 3OEBA 2D98A 3JB4C 4MVTA 4AQSA 5M5YJ 2WA4A 2A5WA 3PIJA 4BJ5C 1EYBA 4S0HB 1ZZ6A 4OUSA 2K4BA 4QXCA 1IHMA 1OPOA 3FL7A 1UFMA 3VBRA 4CDWC 5FLXZ 2I5UA 2JJ7A 5B2GB 4CDXB 3ULQB 4GIQA 2QQAA 1DQ4A 4XN3A 1MZBA 2HDCA 4PHZA 3I7DA 2XLFA 2D43A 2RV8A 3USSA 4AF9A 2UUZA 2VZUA 3WHUA 3ELKA 1DGLA 4AYUA 1WLCA 2ZMNA 1GZWA 1SFUA 1OH3A 2ARBA 4RL7A 2F5DA 5HLIA 3R4DB 4D0PA 1GNYA 1K3IA 4XFIA 4TTGA 1U78A 3RMXA 4LULA 4EJTA 2BNOA 4E8CA 4QX3A 2OJED 2IS4A 1BK1A 3RI4A 4BJ6C 4MTDA 1S5LC 4M71A 3J80Z 4NROA 4ZXKA 2IP2A 3K4KA 1W6PB 3VBHB 1A3KA 3VBUB 1YHFA 4Y33A 2LKSA 2MEV1 1D1CA 4UWDA 2DWRA 4LJZF 2EFWA 1IGNA 3ZFGB 4IO9F 3OY8B 5FZ9A 4YG3A 3GBFA 3KF3A 3NNGA 2XG3A 2HI3A 3AZZA 3WODF 4P08A 4PT6A 5BNQA 2UWAA 5LBCA 2D44A 1R71A 2H8RA 2BW3B 3P1IA 1F1ZA 4PBPA 4Q4X3 1H0MA 3JREA 1WD4A 4A2UA 4CDUC 4ITCA 4HV5A 3ECOA 1TC3C 4S2HA 3HJRA 4EGZA 2MW8A 4HDVA 3BR5A 1FOKA 3BTIA 4Q4X1 2BV4A 5JLVA 4KYWA 3KF5A 3LSTA 2TBVA 5HDKA 2FMDA 2WADA 3BG7A 2VJJA 2ZKLA 1QA6A 1NE4A 2AXLA 4QX7A 4QGNA 2EF6A 5E1WA 1MMNA 3FMGA 2KIQA 1XC5A 3MVPA 3AXEA 2QUOA 1G3WA 3BQZA 4FQZA 2XBO2 4C0BA 4KDPA 2M45A 1VLNA 1F35A 3FXKA 4XW3A 3CD6I 4KIGA 2P2KA 4W6XA 5IWFA 2WQZC 3RG0A 2M87A 5M3MJ 4CTEA 4HXCA 4NPLA 2P0WA 2LD5A 1ZA7A 4AVSA 2A6WA 3WDYA 1SACA 2WUHA 2VKVA 3JTHA 3UK9A 3RYPA 4LHSA 2JB8A 5L7OA 1GUUA 2R5ZA 5ED4A 3PQKA 4B1LA 4HW0A 2CGOA 1F31A 2HWE2 1JE8A 1LB2A 1S0CA 1POQA 1CJPA 4ZS3A 2CV2A 3DF8A 5GAGJ 4A7ZA 3N9PA 5JVVA 1J3PA 2EPFA 3ZSEA 4JX6A 3F2ZA 5F0HA 4BHCA 1UY4A 4QT6A 1IDZA 2X4HA 4IGPA 4U7BA 2I07B 4UUSB 1FYKA 3J7AY 2H1KA 4YFNF 1TG7A 3WE3A 1Z7LA 2QSFX 4LBLA 3CCVI 2AO9A 3EYIA 2XUBA 4XSZF 3BGAA 1QKQA 1V5FA 3OBAA 3ZFFC 4F7ZA 1WZXA 2DTYA 4UW4A 2BWCA 1BC7C 3ATGA 1SQ4A 1GANA 3HMYA 1R00A 2Y8KA 2VN2A 4D6SA 3HDDA 4JGZC 1VBC3 1VMFA 4QKNA 3KLSA 4BPZA 1S7AA 1W0TA 1R093 5FZHA 2XB0X 2XL7A 2MYSA 1NX9A 1WW7A 1YITI 3OYWB 4IV3A 1HXDA 1HLCA 2VBBA 3R0AA 4ZU7A 1VBC1 2OQGA 4JK1X 3HTSB 4WXCA 4FPOB 5LBFA 2YGLA 5DG2A 1QHGA 1R091 2B39A 4A44A 3CHXA 2OVUA 1O5LA 1SLCA 1IXCA 4GO1A 3RQ4A 2ESNA 4F92B 2MGQA 2NOJB 4H14A 3WTUC 3ACGA 2VT3A 2ZJRF 4B4QA 4LE3A 4A69C 1PX3A 1YNAA 1JYTA 2K5CA 1C8M3 3SHRA 1YJKA 2DQLA 4MGQA 1OYYA 4NAOA 2PELA 4BXUA 3JRIA 2RM21 5C8CB 2QZ8A 4DRVA 3HBKA 4CCLA 3BIWE 1JJ6C 5CFDB 1C8M1 1VRBA 3OUJA 2M0CA 3A01A 2VQTA 1YHQI 3AK0A 2YU2A 4CEYB 5M5XJ 3C2HA 3F8BA 1KITA 1LHUA 1OUXA 3VZMA 4DZJA 5I0UA 1RXGA 3OYDA 1GXPA 4QM8A 4MGYE 3VFZA 1DQUA 4M01A 4LKEA 2CTVA 1PP8F 2O3FA 5EYYA 3LEMA 4UUVA 4XLNF 2RNJA 4Y15A 5IK8A 2Z16A 4YW6A 3S8PA 2MNGA 4A7YA 2F48A 1ZBE2 2BGCA 2OZJA 5GZFA 5FROA 2WNUB 3AC0A 3PVOA 4GAZA 1QZEA 3FZVA 5FYSA 3WCSA 4GYGA 1TZOA 2EA7A 3RSJA 4D7MA 1S2KA 1ZG5A 1VMHA 5BXXA 3ASNH 3I97A 3I53A 4RHV2 3MMYB 2JG8C 3S1RJ 3BG3A 2EA4A 2DW4A 2VQHA 4C90A 1BEV2 2IXCA 1ZHFA 1B35A 4Y20A 2P6SA 2QGUA 3ZN5A 3TB0A 3F72A 3TOAA 1SVMA 3VZJA 4AFMA 2ZJCA 3W9AA 4FPGA 4ZYEA 1E3HA 3EPZA 4CYCA 3U1DA 1NT0A 1ST8A 3NMBA 2R0HA 1JI6A 1PZ8A 3VBFB 4AM3A 3H35A 4XJUA 4JZRA 2MH2A 4HAMA 5J96B 4CDUA 1S1AA 3EETA 4LO7A 3GYDA 2WFF2 4FHTA 4LBQD 4CUAA 3C2BA 2BVLA 3WDVA 2IBDA 4KG8A 1VQOI 1IN6A 1APNA 1YYVA 1GU3A 4ARYA 3DXUA 2HU9A 2X6YA 5K5OA 4RB3C 3SCFA 2Y0SN 2QQMA 3NJVA 3KVBA 2XHKA 3LFMA 2FBIA 3LNQA 1OR7C 3OB8A 3NAPB 3NWKA 3T09A 2DOAA 2VZVA 1PZ9A 1ACIA 4XURA 3ZOBA 1MBEA 2VW0A 1Y6IA 1ZR2A 1PUEE 5L3BA 2JRTA 5DDGA 5E1RA 3LSEA 1R1UA 3OPTA 1QIQA 2JE8A 1J3QA 5FP7A 1DQ6A 2A6YA 2V5DA 1NLSA 1FBUA 4CU9A 1UMHA 2EZHA 3MIEA 2X48A 1ND3C 4BY7J 2JD4A 5C44J 2VJIA 4TYSA 1I50J 4M3CF 3G4SI 1EAH3 4HX7A 1DPUA 1Y56A 2QCOA 3RZZA 3CZUA 1ODMA 1ZZCA 2LSOA 1Z6TA 3KYLA 3S3NA 3C7EA 2OTJI 1VB2A 1AYN3 5JI6A 5CQGA 4O5VA 1CAXB 3T3YA 3ZYPA 1SMTA 2DBBA 4BIFA 2OC6A 4AIDA 4S04A 1EAH1 1ITYA 5DQ0A 3QYBA 2ELHA 3KETA 4UNOA 1X9TA 2ME6A 2VBZA 2P6TA 2MG4A 1ND2C 1AYN1 3HQRA 4O9EA 1WWXA 3ACLA 4G3YC 2OUMA 3H1MA 5EHDA 4U0VA 2OUHA 3B93A 4YIIA 1UZVA 4JQFA 4DXSA 3X2QH 2E1OA 1V6OA 2HWC2 2SBAA 3INAA 3GYHX 1HW5A 3FJSA 1XNBA 2BVVA 4M3EA 5CAZA 1LGBA 4DEVA 2ETEA 4IEJA 1Y9GA 2J1UA 2BNMA 3H5NA 1APLC 1JZ2A 4QX2A 4XF4A 4YRVA 1S0DA 3UKNA 1N3OA 3O1PA 3F23A 4WVMA 1GICA 1ZLJA 2OCCH 1ZBA2 4RN5A 3BCAA 1PO12 3RZOJ 2A6EF 2VT2A 2JG9B 3OIPA 1WUVA 1ON2A 3S7EA 2QQKA 2V9KA 3K4DA 2E7TA 3Q0WA 2XB5A 4XBFA 3QBQA 4K21A 1NCQC 4DUWA 3ES1A 4A3GJ 2LNBA 1X1BA 3TKYA 2Y60A 4PJMA 4BDVB 3IH4A 3U78A 1S2EA 2DA5A 2F4OB 2RJKA 5E16A 1GZTA 1SAUA 2DYRH 1ZYBA 3MYXA 2KA3A 4CCJA 2BVBA 4CEWB 4XF0A 3CDHA 3CJNA 4HLXA 4FTBA 4KI5M 3DPLC 2YS9A 3KP2A 3AZVA 2ZABA 3J9SA 4RAGA 1FOWA 4LBQB 4NN0A 1O6UA 2WO3A 4OHZA 4AQ6A 3QU3A 2QQIA 1ULEA 3O6BB 1WGXA 3A21A 1VQPI 4HF2A 4DYRA 2WA0A 3C1DA 2J1VA 1ETXA 3CJTB 4R9AA 1OOPC 2DJIA 5K5QA 3CO7C 4W6YA 1MJAA 4IGQA 4DYCA 4PGGA 4ZZLA 3IM0A 1OPCA 2ZA9A 4AXOA 4WM8A 1DLLA 3WW1A 2VIXA 1AR83 1E57A 3MBWA 1C5HA 1F8VA 1Y39A 2JSPA 5FZOB 1UMQA 2IA2A 2L4MA 2ZPXA 5GLVA 4NC6A 3OYEA 3HG9A 1AR81 2BWAA 4XTMA 1W8UA 3GJAA 1U8BA 4FOVA 2CV6A 3GF2A 2E34A 3PU3A 1X8MA 4A45A 5HDGA 1JOPA 3HRMA 2VZRA 3DEUA 5CJ9A 4AFDA 4JHZA 3HR9A 2BUKA 4LO5B 1W9WA 5AFEA 4CP9A 2R1BA 2EB7A 4CDQB 2ES3A 3F22A 2AYHA 1BIAA 3T4HB 1KFXL 1Q5OA 2NXNB 3POEA 5AIPA 4IEWA 2A6XA 4UV8A 1DYKA 3RI9A 1VPHA 3T8TA 2HWD2 1H8TB 3HD8B 3ZMOA 3PMEA 3SH5A 3HKZN 2ZXWH 1SLIA 4H7LA 2RQQA 2VKEA 1NQJA 3A1YA 1OQDA 3IKVA 2LK2A 3ERED 1Z0XA 1CAWB 1G9BA 3COAC 5ABJA 4QKBA 1QH6A 2P4WA 3Q8EA 1Z21A 1AVBA 3I49A 1XRUA 4Y1YA 4FASD 1K83J 3AFGA 3BTAA 1I5PA 5E18F 2PAEA 1YTYA 1QU3A 3GCXA 2UV1A 3HYIA 4XAAA 4IHSA 1LDDA 1TWCJ 4DXZA 2C9KA 1FXZA 1RUF2 2IWGB 1ND3A 3IKTA 4AI8A 4V2FA 1LE8A 2FJ1A 1BI2A 2X0LA 1K42A 4XHBA 3EUKL 1FNNA 2VBYA 1DYPA 3LQRA 4GFBA 2H1LA 3VEPA 5HV4A 2PTMA 3HT2A 4ABZA 3A0KA 3KEYA 3ZXEA 3OOUA 4OIOF 1W6MB 4CUBA 1OD3A 5GADJ 2ET7A 5FTTC 1O91A 4IL7A 5KR7A 3H3ZA 3WINE 5D21A 3HAGA 3AYEA 1A35A 2HTSA 3DL3A 4BBRJ 4AUXA 2J1TA 2WT0A 1RUJ3 2R063 3SXWA 1YW8A 1ND2A 2XROA 4JDNA 3CJXA 5D8LB 1R58A 1MSEC 2IXLA 3BOWA 5JOYA 4ZDLA 3PVNA 2MFZA 1DP3A 1EPZA 4HBNA 4MGTA 1SLLA 2CYYA 2WS92 2Q1FA 4X6RB 1RUJ1 2R061 3BP8A 2WNVA 2JIGA 2W25A 5IVBA 3BPVA 3L2RA 5FP8A 3GTQJ 4FETA 2P1BA 2Z79A 2RS12 1VBB3 4QD2A 3Q0VA 2IGMA 3CL1A 1CN1A 3C3WA 3OR2C 3N9NA 4BISA 2WZ8A 4LOCA 2QZ3A 2QWWA 2ZMEA 5IJRA 2K9NA 3KGLA 1VBB1 3HUGA 3IZOA 5GLTA 2WN2A 2HR3A 2DT5A 3A22A 5DUIA 3MWMA 2NVQJ 1W9TA 3PNAA 2DA4A 2IVJA 1XOYA 4Y5TA 2Q2EA 2QQPA 2L0KA 4OQ9A 5A6XA 1QDCA 2J22A 2Z3YA 3CJRB 4PCQA 1OISA 2DMUA 1JI8A 4INDA 4N7IA 4YRDA 1HOMA 4A0ZA 4QDSA 1KONA 3RGBA 1QJU3 1NA1A