3RYPA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Catabolite gene activator
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rypA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rypA01
3RYRA 2FE3A 1ZZ9A 3PFIA 4UVBA 5D5XB 1FNNA 2QQBA 1SMTA 2MLGA 4RB1A 3I7DA 1J1LA 1UW8A 3P7NA 4WK8F 3ZP5A 4AIHA 3HHGA 1EH6A 2FNAA 3T8RA 2O1QA 2VBYA 5FDBA 1QBJA 2RNJA 4GO1A 4QXKA 2VONA 4A0YA 3BJAA 1YO5C 2V1XA 1U6GA 4UBGA 1X8MA 4ZH4F 5JVTA 1ZRDA 5I93A 1YYVA 3ZMZA 1BI1A 1FXZA 2IT0A 1GVJA 4EM0B 3TGNA 4L9JA 1BIAA 5BPIA 1CAVA 3G73A 4LB6B 3WU1B 3GYHX 3GBFA 4EJUA 2PBIA 5BPDA 4OFGA 4CXFA 4QLCU 5K8SA 1QNTA 5CVJA 4ZU7A 3GFMA 2E1NA 4RGSA 4HLTA 5FLHA 2CQKA 4IHSA 3T0YA 2HKXA 4RB3C 5LEJA 1HKTA 3R0AA 3GVAA 3I5UA 4E70A 5L3FA 2D40A 3KP7A 5ICGA 2JT1A 3ECOA 3JAMZ 1O3QA 2C6YA 4X6RB 5DDGA 1IAWA 4MGYE 2K7LA 3TDZC 4LK1F 1E2XA 4AVAA 2GC3A 4UV8A 4XF3A 3FMSA 2NYXA 5AIQA 1BOAA 3ECHA 2MA3A 4TV7A 3SCFA 3J7AO 5J48A 3PNAA 3F72A 3ISPA 4F8AA 1YW8A 5E1RA 3S7EA 2JPCA 4HLYA 4LB5A 1LEBA 3TO7A 2ZBKA 3K0LA 5IT9K 4WZCA 3GLXA 1TBXA 1BI3A 2ACJA 2LKPA 2OAZA 4YG2F 1XDSA 3J80Z 4QX5A 4CGZA 2Z69A 1IN8A 1IXCA 2PQQA 4PIZA 2XAGA 1HW5A 3D0SA 1LRHA 3EETA 5H6RA 4U7BA 2RGVA 4L9VA 3HIFA 4AXOA 4IEQA 2IXHA 3L2HA 5H20A 2A07F 1XGOA 4Y13A 2P6SA 3G7DA 5BQTA 3WTSC 3JSPA 4XF0A 1F1ZA 5DD8A 4MNUA 4EGYA 3WE3A 2Q30A 1PP8F 1R58A 2O8XA 2QBYA 4FAHA 5D6EA 2EJRA 3H8UA 2KJBA 4MTEA 4L11A 2HDCA 2M30A 1FBSA 1R5HA 4BNCA 5FD5A 1P2FA 4OIRF 1TQ5A 2EK5A 4BHCA 4MX3A 3ZDSA 4Q5SF 1W4MA 2XLAA 1T0FA 1X8EA 3EJKA 2H0VA 2CYYA 1UHWA 3H50A 2D5HA 3DEUA 2IA2A 3E97A 3IHUA 1IUYA 1YFXA 4ETSA 5BY5A 2R7FA 5KVRA 4IRGA 4GULA 3CO6C 4FHTA 4G6QA 1O3TA 2HQNA 5A2QK 1NE4A 5CYVA 2A5YB 1XRUA 2BV6A 3Q9SA 4O3MA 3QPTA 2PHLA 4P5OA 4M6YA 3M70A 3TO9A 3IKVA 4Q0PA 3BY6A 2PG4A 4ZU4A 1VR3A 3L2CA 2BBYA 2DQLA 4RGXA 4ZYGA 2VN2A 2ESHA 3U10A 4Q29A 5FQ0B 1LEAA 4NQWA 3SFZA 4EROA 4IERA 3EDPA 1OYWA 2KKOA 4LFUA 4XFAA 2GC0A 5HDGA 4A6DA 5ILSA 1DDNA 4B29A 4A0XA 1ZN2A 2FBKA 3GUDA 4PDKA 1S7AA 1USTA 4DQ2A 1EP0A 5HI0A 2XIGA 3H3UA 4KT5C 1NHAA 3L9FA 5CLSA 3W6KB 1U5TB 3L09A 1CF7A 1SFXA 3BCWA 3H7JA 3OOPA 1DPRA 2K4JA 1DPUA 3HRUA 2Q1ZB 4AWXB 3FXQA 1OD5A 2BNOA 3HYIA 1K78A 3I53A 3K1PA 5BPXA 1ZZCA 4EVIA 1FYKA 1K7AA 2YX7A 1B59A 3RPQA 2BNNA 4MQVA 2BGCA 3NW4A 3GX4X 1IXSB 1F9NA 2ZO4A 3WU0A 1CX4A 3D5LA 5KHHA 3DPLC 3WODF 4CHUA 4KIGA 3C7JA 2HKOA 1JUHA 3PQKA 2YSRA 2LDUA 3LQRA 3JTHA 5I8TA 3WW1A 5HS8A 1HW1A 5JFRA 1SFUA 1RGSA 2Q8KA 3QAHA 4IETA 1UCXA 2HGCA 1V70A 3E6MA 4META 2L4MA 5ILUA 4P9UA 1ZRFA 2W85A 2F5CA 4MGRA 3V8KA 2D1VA 1ODDA 4LTAA 4XF4A 3HSFA 3LWCA 4WXDA 4Z07A 3O3KA 2QM3A 2RQPA 3PVBB 1ZG3A 2ISYA 3KFWX 3IRRA 3M9AA 2ET7A 2K4BA 4ORFA 4OIPF 2GA2A 5LLQA 5HDNA 1GQHA 1XSVA 1KU3A 2PTMA 2EV0A 4UVAA 4XFBA 2FMLA 1PMIA 5CU1A 1G4DA 4GCVA 5DYMA 1FOKA 5ICEA 4OINF 3T1BA 4N0BA 1UFMA 4O9EA 1OMIA 2GC1A 4AVBA 4Y17A 1J7KA 4MQ9F 2L3DA 2NAZA 2XAFA 2HWVA 1KYZA 2OQGA 3ETQA 3IDCB 1IW7F 3PQJA 3GEZA 4NHJA 2E9QA 4KNYA 1J3PA 5K5OA 3RKYA 3JTGA 5HS7A 1KQ9A 2V1DA 4AVPA 2YR2A 3HT1A 3S2WA 5F1RA 4Z82A 2Z99A 3HT2A 1S3JA 4LUKA 1G3TA 4WXCA 1U8RA 1QGPA 1P4WA 1Z05A 1RUNA 5EEGA 1ZHFA 2IRFG 1HXDA 4R52A 3M8EA 2HR3A 2STWA 2OYZA 3KP5A 4XLNF 5J8FA 2EV6A 4M9ZA 2M8EA 4IVNA 2A6HF 2IC1A 4E2SA 2P4WA 1O7FA 2ZJ2A 1KU9A 4M73A 2PHDA 4HF2A 2DT5A 2K02A 3CLOA 2G7HA 2XHKA 4L9TA 1MJBA 2B0LA 5JSPA 5CJ9A 1GQGA 3DXJF 5D6FA 4RS8A 1QWRA 1IF1A 4JVAA 1ON1A 2XASA 1FP2A 3FZVA 3FFQA 1Y9QA 4A12A 3IWZA 3BP8A 4QGLA 2VC1A 2P5VA 2P6TA 1U5TC 2YX4A 5EFUA 1TQIA 4Z2YA 1ZZ6A 2GZWA 3HUGA 1DZRA 2VBWA 4MGZE 3KGLA 5FLXZ 2PLYA 1IZ1A 2KIMA 2W25A 2E7WA 4IPAA 4G9YA 1QPMA 3WTZA 1RUOA 3WW2A 1XSDA 1R1VA 3CLPA 3V8JA 2A6EF 5L3DA 3OGJA 2M87A 1STZA 2F5FA 4JBAA 3GW2A 5DCMB 3JSOA 2IPQX 2CV6A 3ACLA 2O0YA 2I45A 3B02A 4Q0SA 2IXJA 6PAXA 4HF1A 5HLHA 3Q5FA 2X4HA 1VJ2A 4HV5A 5BOXA 2IXKA 4HYEA 2G7UA 4I0AA 3EBRA 4UUVA 2XL7A 1Y0UA 1SD6A 4EJVA 5K5RA 4B09A 5E1WA 1P4XA 4J1WA 3ZN0A 1NE6A 1OPCA 4RB2C 3IIAA 1YFUA 2HS5A 4EMSA 3IL2A 4K8FA 1YLLA 4BHBA 1WGPA 2JZYA 3I59A 3EQEA 3BZ6A 2QWWA 2FA5A 1SFEA 2C0ZA 4S05A 1FZPB 3USSA 4N9HA 3NRVA 1ZRCA 2Y0OA 5E18F 4LG0B 2TDXA 4MGKE 1K6OA 4MZUA 3DL3A 4GYGA 5LHHA 1Z91A 2R7DA 3REOA 3LAGA 1T6SA 4LD5A 2HQRA 4LLNA 5F64A 3SXWA 1HSTA 2PMHA 4Q47A 4A5NA 1UIKA 3HHHA 3ZMSA 1MJAA 1RTVA 1LB2A 1YW7A 3H1YA 3H1MA 4HMZA 3WTUC 2V79A 3DKWA 4WF2A 4I02A 2HEOA 1YFWA 1S29A 1BC7C 2EWNA 4HDVA 5IT3A 4IEVA 5D1IA 4YYOA 1QQIA 2H09A 3IDBB 2DW4A 1G3WA 5I0SA 2DK5A 2PQ8A 1B9NA 3U9GA 4OIOF 5T3NA 3SCHA 1AOYA 1BBYA 3LQQA 3D0JA 2IXIA 1RNLA 3NKTA 1FI2A 1BI2A 1YG2A 2NNYA 4E2QA 1ULYA 3E6CC 3E5XA 4RB0A 3CJXA 2H6BA 3MPBA 2PAEA 2Y0MA 1XGNA 1O3SA 1K79A 4UNOA 2Y48A 5KHIA 1IXRC 4KWLA 4IEWA 1R36A 3QP6A 4G7ZF 2Q0AA 3KLOA 5FB2A 3GXOA 2FU4A 3M8FA 2GXBA 3CEWA 2OD5A 4OIQF 5HS9A 5I0RA 3MCZA 4JK1X 4KU8A 1ZRRA 2PAMA 4PGGA 2DO7A 2QDRA 5K5QA 4YRDA 2A61A 4O5VA 4HX4A 4CICA 1IRFA 3CJNA 3DFGA 1XSXA 2KIUA 1LR5A 5DUIA 2LSOA 2DI3A 5I8SA 3F6VA 4EWDA 4OMYA 4KUMA 4QGMA 1H9GA 1ZG1A 1REPC 5CADA 3N4MA 3K69A 1XGMA 5TRDA 1PUEE 4UV9A 4Q0QA 4S04A 2F2EA 4HBLA 3KCCA 4L0ZB 2STTA 4IEUA 4FX4A 1D8JA 2BEOA 2XUBA 4XF1A 1IPJA 1XN7A 2DAOA 1KU7A 3VFZA 1H0MA 2DPUA 4IF4A 2RDPA 2VBXA 3DP7A 4P96A 3HSEA 1SD4A 2R3SA 2W57A 2CW0F 3ZPLA 1IPKA 1CGPA 3PLQA 1R7JA 2OPKA 1RI7A 5HVQC 3RTRA 3GO5A 3CO7C 2KIFA 4ENMA 1WQ2A 2PN6A 4G7OF 4NB5A 3TO6A 2VPVA 3R4KA 2PFBA 4KMFA 1CAXA 2P5KA 2IJLA 2K0GA 1AWCA 2DCTA 5E8IA 4IEXA 3EUHA 3U11A 1YTYA 2XGXA 4U88A 5DUKA 2F5DA 5J6XA 5DCFA 2QJVA 2M1BA 5ERIA 2ZFWA 1YLFA 2A68F 5J3UA 5ICCA 4IXAA 2FNPA 3F8MA 4HBNA 3JAMK 1HBXG 3KZZA 2DLLA 1PDNC 5FD6A 3FXUA 4YFKF 3KGZA 1YFYA 3TNPB 1UCRA 5E16A 1LJ9A 3KEOA 4KFCA 4CDGA 1S8NA 3C3VA 4IEYA 2VODA 3MFKA 5KK1A 1FYLA 3F22A 3T8TA 4JV4A 1RIOH 1I1SA 3U0ZA 3FM3A 1YS7A 4KDPA 3LA3A 4XEZA 4I7HA 3E5QA 3UKTA 5LGTA 3LAPA 1Q5OA 1YQAA 1O7LA 3UKVA 5HLGA 4KU7A 1FY7A 1P4AA 2FEZA 3FHZA 1VP6A 1CF7B 2XLGA 1U12A 5E1XA 5ICFA 4KL1A 2IP2A 1CAUB 3KP6A 3FJSA 4HQEA 1S7OA 3HRMA 2GU9A 1H1MA 1J3QA 2XKOA 4Q48A 3KP2A 3F8NA 4AVCA 2WWYA 4ESBA 1JXSA 4IEPA 4LK0F 5FGMA 1G6NA 3IC7A 4XFFA 3ZMVA 1QY4A 5D4SA 3T5XA 2CWEA 3H3ZA 2IVMA 2PFWA 2ZMEA 2GIVA 4JTNA 5E8GA 2O3FA 3DN7A 4CZZA 1FSEA 2QVSB 1W7PD 1ZAOA 1ZGAA 1T39A 5FCCA 1MZBA 1OFNA 2D2WA 3OF1A 4AQ6A 2EB7A 1SEFA 1WA4A 3FE5A 2M5WA 5JHUA 5D5UB 1EH7A 2EA4A 3TQNA 1SMYF 2AXLA 3E5UA 3Q9VA 1XE8A 3CUOA 4P55A 1Q1HA 1MDMB 2CAVA 5KBFA 3TDUC 2HJIA 2HTJA 3QRFF 4D0PA 5DCMA 3GWZA 4IEZA 2UYAA 2HTSA 2QENA 3ES1A 2HFHA 2CSOA 3KSCA 1S6LA 1Z7UA 5I8YA 4OMZA 2J5PA 3TOBA 4HZFA 4KYWA 5LEKA 3TOAA 3F8FA 4IRHA 2MD5A 3I64A 4KIBA 5C8WA 4M74A 3I59B 1J75A 4DINB 4XRFA 2VT2A 1YWKA 1USSA 3EO6A 4XFHA 1QXJA 3WTYC 1L3LA 3R61A 1KQ0A 1LVAA 2GAUA 4IJAA 4IRIA 1G3YA 3G3ZA 2DBBA 2ATFA 4KN7X 4BAYA 2YPRA 5JAXA 1OYIA 3KLNA 1WI9A 3F3XA 4HV6A 4YIFA 5AVPA 2KRFA 2VC0A 4HVOA 3BDDA 5HDKA 1U2WA 1BN5A 3LA2A 3CDHA 3QP5A 1MD0A 4IEOA 1J9IA 1SD7A 3CF6E 3H9AA 3J80K 3C3WA 1XGSA 4LULA 3F23A 3FMRA 4EQQA 3WTWC 2GWRA 1ZG5A 3WW3A 4FX0A 5IT9Z 1CAVB 1MKMA 3RKXA 1K78B 5EZWA 1CAXB 4FAGA 4BIFA 1EH8A 3MYXA 4R8HA 5LHGA 1YW9A 3FZ3A 3BWGA 2FQ3A 4KA4A 3GFIA 1J0RA 2MH2A 1TTYA 2Y75A 1TNTA 1ZZ8A 4G7HF 3FX3A 4KWJA 2FQPA 4U0YA 3ES4A 1NZCA 1YUDA 2A3SA 4ZYEA 1T2KA 1R00A 1YHFA 2D93A 2IA0A 2P8TA 4QGNA 1QZYA 1ON2A 2ZKZA 4M71A 3LAJA 2LF8A 3CUQC 1T98A 3W6JB 4EGZA 3RNSA 4LA3A 4XSXF 4EJWA 1XE7A 4IESA 4HW0A 3LA7A 3QOPA 3HQXA 1BM9A 2IW5A 5AIPA 5KHJA 1ZLJA 4ENKA 2CAUA 2UYBA 2KJCA 2VBZA 1TQPA 1WRJA 3O14A 5K1YA 4ESFA 5L3BA 5L3GA 2EAAA 3I4PA 2PEXA 4LJZF 1I1GA 4I09A 3CTAA 1SAXA 2W24A 5BMZA 3D82A 1JGSA 5A2QZ 1ZGJA 1J2XA 3KMHA 4BQAA 4MV2A 1W7PA 3EHKA 2IXLA 1E17A 3V7SA 2L4AA 2GH2A 5LRRA 4LLLA 4RGRA 2VE9A 4UVCA 2VECA 1B1BA 3ZMUA 5D8LB 4ON0A 5I0TA 4XFGA 2AS5F 4EJOA 2BYVE 4EWEA 4RGUA 4UBHA 1HKQA 4O6JA 1NXMA 3RKWA 3NL1A 1WLTA 1FBUA 3TNQA 5JR7B 4I2OA 3GZ6A 1J58A 4ZU5A 2UZKA 2O61A 1IN4A 4X6QB 2E7XA 4OLLA 4TLFA 3IKTA 2QLZA 4XFCA 2FRHA 2VE8A 2V1UA 2Q4SA 4XLPF 5LGUA 4Y15A 2JTVA 3SZTA 3IWFA 2CO5A 2B9UA 3KEQA 3COAC 2Z33A 4HX7A 4ZZLA 4LEJA 5BV6A 4WWCA 4A0ZA 4A6EA 4HQMA 2VOOA 3DV8A 2N7GA 3VB2A 4MTDA 2CGPA 3KE2A 1KA8A 4BYYA 1DGWA 1EV7A 5E1ZB 5CVIA 3V7RA 4G8XA 4GGGA 5FQ0A 3F8CA 5AONA 1VTNC 3EYYA 3I58A 4I98B 2GC2A 3NVCA 2Z3YA 4LUMA 3WTXC 1Z6TA 4ASNA 2QQ9A 5LBQA 4PIYA 2H6CA 2DK8A 3J81K 1H1IA 1Q3EA 3L00A 5FLIA 2UXNA 3KP3A 2WC2A 2GA1A 1NYWA 2L02A 4G94A 3HRSA 3FWEA 3LFKA 5D5VB 1DUXC 1MJ9A 4YFXF 4FBFA 5FPXA 4L2NA 1KU2A 1W7PB 2XKPA 5CVUA 2XV4S 2D5FA 2UY8A 3M3IA 3NQOA 1XDUA 3ELKA 4IHTA 3R6SA 3P9IA 4L0YB 1EY2A 2K9ZA 4WBBA 4H7LA 1UD1A 1MGTA 4U0WA 2HZTA 2V09A 4LLGF 2FOKA 1UHMA 3MZHA 5LHIA 2VOPA 3E6BA 3SCGA 1D5VA 2IA1A 4ZYDA 2QQAA 3GFJA 2QBYB 2NRAC 2K27A 3RYPA 3NSTA 4BH9A 1R5GA 2XL9A 3EQLF 3HTUA 1UB9A 1YS6A 3N97A 1JHFA 2PAKA 2QUFA 3V4GA 2E1CA 2VT3A 4KIFA 2BE5F 2B8MA 5BUVA 1GHCA 3ZMDA 1GXQA 2HYFA 4Q0UA 3H92A 2ZMEB 2VXZA 4Q0VA 3FHIB 3LZZA 5DD4A 3WW4A 1T38A 3ABTA 2XVCA 5I91A 2UXXA 1ZVFA 3VHRA 1EPZA 3SQNA 3IBMA 4D7SA 2X0LA 3MQ0A 3OTFA 1R1TA 3MDPA 3ZN1A 1LDDA 3RIRA 1ZX5A 1JE8A 1I6XA 3R0JA 3RJPA 2L01A 5KHGA 1UPIA 1O57A 1D3YA 2RC4A 4R79A 1ZH5A 2ETEA 3ZQ7A 2QVOA 2OZUA 1ZZBA 3BU7A 4P9FA 1HSJA 2H27A 2DQRA 1WSUA 3RDIA 2ADUA 1KYWA 1YIOA 1KQ8A 4M72A 4NVPA 1OR7A 1L3JA 5ILVA 5KHKA 4A2UA 4MUVA 3ULQB 4I01A 4EM1A 5CVVA 3WTTC 3FMQA 1A04A 3DPTA 4F7ZA 3FXRA 2ZXJA 4G6DA 3RZZA 1QXRA 3BJOA 4KICA 1DZTA 2MHFA 5TJJA 1SQ4A 2OZ6A 3IRQA 3CO2A 3JZVA 2O03A 5JR3A 2GQQA 2RKHA 2B5HA 5L3CA 2P17A 4ONUA 2KXLA 1ZNPA 1KGSA 4UXNA 5BXXA 3LWFA 4JTOA 1PM7A 1X7NA 1PP7U 1B4AA 4UXAA 2LNBA 3F21A 3QU3A 4PCQA 2ISZA 4YNIA 4GXOA 4HX8A 4HVQA 3R60A 2WFPA 4WVZA 4PZJA 1V4RA 1B6AA 2HOEA 3K9TA 1O3RA 3J81Z 1P92A 2G9WA 4MH0E 3UKNA 1R23A 3WG9A 1C0WA 1FP1D 1IN7A 1CAWA 1LDKB 1ZARA 3E3VA 3RPUA 4M9XA 1FT9A 5LRSA 3ZMTA 4HAMA 2FBIA 1R1UA 1XB4A 2NS0A 2L54A 1FWZA 1HKSA 2CFXA 3WGIA 4QM9A 2MBFA 1P6RA 4P9GA 2ZCWA 4N9IA 3P9CA 2XAJA 2P7VB 3K2ZA 2Q0OA 2A69F 5HOOA 1FX7A 4R1HA 2VQAA 2XROA 4KWKA 3TKYA 3FF5A 2PI0A 1QO0D 1IN6A 2EFWA 2V9VA 3SXYA 1TW2A 2GXGA 3WTVC 3C1DA 2F5EA 3M1EA 4YSFA 1TW3A 3SZPA 4EWAA 1OI6A 4HOBA 3MZYA 2FSWA 4L9NA 1ZYRF 5DEQA 3RI4A 4FT8A 1LKNA 4HSJA 2XRNA 1FLIA 1H9TA 4QWQA 4XF9A 4LA2A 4LGWA 4ESJA 1X3UA 3MAJA 5I0UA 1I5ZA 2DU9A 5D5WB 2DFIA 1ONVA 2OA4A 5JSOA 3I54A 4XFIA 1FYMA 3CL1A 1EYBA 2EA7A 4RAYA 2ZNYA 2ELHA 4MEYF 1O4TA 3OV8A 4KMUX 2Z2SB 4HSLA 3DQVC 5FFZA 5L3EA 4CYDA 2IXCA 1SFNA 1CAWB 4QMAA 4M6XA 3BALA 1RZ4A 1HQCA 2D1HA 1W5SA 3I71A 2EVXA 2FXAA 1GXPA 1XCBA 3HOTA 2OQRA 2JRTA 4U0VA 3V7CA 3QACA 3K1MA 3V8LA 1XMKA 1J5YA 4LLOA 3K1NA 3KP4A 2JPBA 4MGIE 2WV0A 4XSZF 2EA2A 2UWMA 3S7IA 1OKRA 4ZZDA 3BJ6A 4BHPA 3VODA 1G3SA 4YFNF 4LG0A 4WX9A 2PA7A 4WXHA 3H7YA 1D8KA 4OOIA 1BIBA 3ERED 5HLIA 5E17F 2EFQA 4E2GA 1U5TA 2OU2A 3C18A 2ETHA 2FF4A 1FC3A 3EYIA 1DGRA 1B9MA 3M7GA 5FLJA 3ABUA 1RC6A 4RD7A 1LQ1A 2Q2EA 2MLKA 1U3EM 1BJAA 3BPVA 5JI6A 3MEXA 3OD0A 1BC8C 3U1DA 1QZZA 5DV5A 4YIIA 3KZYA 1IRGA 4LMYA 5EEHA 3LOIA 4MHGA 2PYTA 1CAUA 2W84A 1Z1DA 2RVCA 2K86A 1DP7P 4A5MA 2D45A 2P7CB 3FM5A 2ET1A 2V6CA 3VEPA 1ZZ7A 2OBPA 3ROUA 4GYIA 5CVRA 5C6CA 1LDJA 4EM2A 3I0TA 1X82A 1V3FA 3BB6A 4XETA 2Z5UA 4D7TA 4RAZA 5LGNA 3BPZA 4M9SA 3GFLA 4ZYHA 2JSCA 1XMAA 1BI0A 4QM8A 1R22A 4HA8A 2EFNA 2OA2A 2BNMA 2F4PA 4PIXA 3GF2A 3CUQB 5FO5A 2QNKA 3QPHA 3WGHA 2PJPA 2XLFA 1F4KA 1FPQA 2WTEA 2DPDA 1XCVA 2ZKLA 5FLXK 3WGGA 5J8CA 4MEXF 3GZ5A 2FBHA 4EV0A 2FMYA 5F6FA 2Z9OA 5FFXA 4CO8A 1J59A 2EV5A 2DTRA 1SD5A 1TNSA 5D8KB 4J1XA 1Q43A 4U7DA 4H0EA 4DNCA 4ENJA 2P5LC 4WCGA 3O6BB 4AIJA 1O5LA 4K2EA 3SHFA 4HF0A 4AQ2A 4I0BA 4HN0A 3DF8A 1ZLKA 2YU3A 3QU6A 3HSRA 2RV8A 4ENNA 5JCTA 1U78A 5D4RA 2COMA 3BROA 4PGHA 5ED4A 3L7WA 4AIKA 3WE2A 4HN1A 1JHHA 1O5UA 4L5IA 2RN7A 2H94A 4YARA 3NEUA 4JQFA 4I3PA 3E6DA 1FSHA 4L5JA 2EFPA 1Z6RA 1WKMA 1L0OC 4Q4ZF 3JW4A 4HLXA 3HTSB 3BPXA 2MC3A 1TQMA 1IN5A 2LF7A 1TLHB 4B8XA 3HOSA 4HDUA 1Z9CA 2PMUA 1ZREA 4KN4X 5JSRA 1RL3A 2EFOA 1HW2A 1LNWA 2CG4A 1J3RA 3U2RA 3BOQA 3NJZA 1YFHA 3GYDA 2NNNA 3AAFA 4HVRA 1XD7A 3F6OA 3KETA 1F5TA 3ST7A 2OZJA 4EJTA 2XAQA 1WWXA 2M45A 2MNGA 4AD9A 2O8QA 3H1WA 2QCSB 1W5TA 3F8BA 1MDMA 4PJYA 3HRTA 3P9KA 4UHTA 2QYOA 4BXUA 3B73A 1UIJA 1FBQA 2MPFA 5FPZA 3ML6A 5E20A 5H6QA 3OCPA 3RYKA 2O6GE 4XBFA 1OYYA 4L18B 1Y3TA 3SHRA 2UY9A 2HYGD 2XAHA 3O2PE 2ESNA 2QZ8A 4OU0A 3VOEA 3ELNA 3SMHA 3LSTA 4O9GA 5BS6A 2MH9A 1I27A 3S0MA 2J5OA 2ZNZA 5J7MA 3MWMA 3CUQA
chains in the Genus database with same CATH superfamily
3RYRA 2FE3A 3HAGA 1TWHJ 2VW2A 4NRPA 4Y22B 4FQGA 2QQBA 4R4ZA 1PM4A 2LY1A 4CDWC 2EXKA 3S2HJ 3ZQFA 3I7DA 3H5NA 4YLZA 4P02B 4ABZA 2FNAA 1QVTA 4XRSA 2O1QA 1HDPA 1JT0A 2R30A 1HLCA 4GO1A 3ZR8X 1OLRA 1J09A 1IHMA 2LTNA 1X8MA 1RUJ1 2VGDA 1CJPA 5FUIA 3ZMOA 3ESWB 1YYVA 3ZMZA 1FXZA 2DWRA 1W9FA 3TGNA 5FZ8A 1BIAA 1YI7A 2O7OA 3WU1B 2A3YA 2ZGPA 4NHKA 2IXSA 1S1AA 3AJZA 1W8ZA 2NM1A 1XOYA 2NMNA 3SKVA 4AAPA 4XONA 2HKXA 4RB3C 5FYSA 3D4KA 5LEJA 3THCA 1HKTA 4A7ZA 3BYWA 4FPLA 4E70A 3K3NA 4UW5A 1BL0A 4CU6A 2JE9A 2ID6A 3KP7A 1UYZA 2VMDA 4QD2A 5GTIC 3JD72 2JT1A 3UV9A 4P5HA 2C6YA 1T08B 4IZZA 4DNYA 2Y0SA 4LKSA 2HBTA 1E2XA 1R081 2KRHA 2GC3A 2DYCA 3A4UA 3ZYFA 3FMSA 2NYXA 4RFT0 4C3JJ 5AVAA 3SCFA 3P5BA 2VOTA 2A71A 2VZRA 1ORKA 2Y8KA 4B3AA 1NT0A 3GLXA 3AXDA 3KYDB 1TBXA 5CFCB 2ACJA 2OAZA 4MHRA 3H42B 4YG2F 1VRH2 2ZMEC 4XUOA 5DAVA 4QX5A 1C8M2 2VW1A 2RS33 2XAGA 1HW5A 4AGGA 3D0SA 3MIDA 4U7BA 2QBXA 3VZOA 4L9VA 4YM3A 3HIFA 1U5IA 1TMF1 3KD4A 2ZZJA 4IEQA 1OPOA 4ZXEA 4LK7A 3L2HA 5H20A 2A07F 4Y13A 3MHZA 4D7NA 1OC1A 4EGYA 1U9NA 1SBDA 2O8XA 5F5CA 5HXMA 2GSYA 1EUTA 4MTEA 2DFEA 4TN7A 1P2FA 1RVF1 3AFHA 4Q5SF 4NC7A 2GDFA 1T0FA 3BCAA 2QQWA 1X8EA 2H0VA 3H50A 2VOWA 2EIMH 2IA2A 3E97A 1H6XA 4K9SA 1K42A 3IHUA 1T2XA 1WFXA 2ZABA 2IWGB 4GJYA 4XQ4A 1RESA 4WM7B 2R7FA 1COV1 5FXVA 2XQXA 2EIGA 4COZA 3RMYA 1NE4A 2ORZA 5IP9J 1Q8OA 1X1BA 3RZGA 4XNFA 1UN1A 1XRUA 1ZBE3 3Q9SA 4E7SA 2PHLA 4M6YA 2BBAA 5JVGF 4XBQA 3IKVA 1VR3A 2ELJA 1V6IA 4PBPA 3VHNA 2ESHA 1DDLA 4Q29A 1W2NA 2E6VA 5FZFA 3ME2A 1OYWA 4LFUA 4BLIA 4W1UA 3CJIB 2AEZA 4A0XA 3KVBA 4YVWC 3WSOA 4JX6A 2J1VA 1T8IA 1WGXA 2ZX0A 1S7AA 2YU1A 4DQ2A 2WO1A 4CPBD 4RR3C 3A23A 3L9FA 5FMOL 3ZPOA 1SFXA 1TME1 3BCWA 1DPRA 5KAFC 3CQOA 1Z0HA 1Z7S3 2RJ2A 2Q1ZB 4UFJA 5F2WA 1I1EA 4MADA 1ETWA 4FPOB 4FPHA 1K7AA 2BNNA 4NPLA 2YV8A 3U75A 1IXSB 4M3DA 5K7PA 3WQ1A 3LEIA 1PGL1 2WRAA 1JU4A 4KIGA 4K7JA 3C7JA 4BPZA 1ERDA 3OUHA 4YM0A 4TSVA 5FYCA 1V6OA 4DXTA 3JTHA 4YWAA 2WNOA 1WMDA 2L9RA 2ZGNA 2R5YA 4MFDA 1OH3A 1REDA 2R071 2JDMA 4HL0A 3I3DA 1QJZA 4NQWB 4QXCA 3AVSA 4NRMA 5ILUA 1F36A 2W85A 3I4IA 3C2HA 3VD4A 2D1VA 1ODDA 4LTAA 3HSFA 2JDAA 4WXDA 1UY0A 3OR2C 5C5UA 3VYUB 2BVBA 1A3KA 1XNAA 1Q8SA 2GOXB 4FPCA 4AI0A 3KV4A 4W8JA 1QNYA 2ARAA 2VO5A 4ORFA 1N77A 2XJRA 4NWVA 1HV1A 4HSTA 1XSVA 4P14A 3FK6A 4UVAA 3K48A 1XS9A 1VI0A 4XLEA 1JU3A 2ZXWH 1OFSA 2ECBA 4CXXA 5DYMA 2W3JA 3T1BA 4CEYB 4B48A 1HRV1 3FXJA 1VBA1 3KF3A 3DLLF 4XMYA 1BXHA 5EGOA 2YPJA 1ASJ1 5ACA3 3B9CA 4IOAF 1KRIA 1K6YA 5BNOA 4NHJA 2E9QA 1GNHA 2M4KA 3VKMA 3HQRA 1G2HA 2QQUA 2YDEA 3HOXJ 3VKNA 1TME2 3NWKA 4X8PA 1D0HA 4KITB 3HT2A 5FYHA 1Y9MA 2KZGA 3UESA 4RLFA 5KHDA 2Q8CA 1UMHA 4Y5Z0 3ZFGA 3H36A 2XPWA 4CZCA 2STWA 2OYZA 1Y7BA 1VBB1 3GZTB 2IC1A 4A42A 4E2SA 1NCQC 4C2TA 1V6NA 3T2PA 1O7FA 1KU9A 1C8M3 5J1UA 2VC9A 1XB9A 2BXZA 3FXMA 2DT5A 4M3EA 1UZZA 2G7HA 4JX5A 1LGBA 4L9TA 3DWLE 1LOEA 2Z4FA 2OCCH 1YO8A 4AC0A 3NNLA 4PCRA 3OGRA 1POGA 4RM3A 5D6FA 2BOLA 5JMCA 4N43B 3HN1A 5J1YA 3LFIA 4JVAA 5HNFA 2F6BA 1W9YA 1BR1A 3G1OA 5GM0A 5T52A 4QGLA 4BQXA 2VC1A 4FFHA 2CGNA 3A0NA 5FOBB 5JLVA 5A3NA 4M3FA 1TQIA 2V4AA 3HUGA 4MGZE 3KGLA 2X53S 3KZIC 1QPMA 3WTZA 3K70D 4PJLA 3UNGC 2Y31A 1HV0A 5L3DA 4COWA 4YG0A 2W00A 3BN6A 4NN0A 5CG8A 2I45A 2WLQA 3B02A 4Q0SA 4E4SA 3MGUA 2KQRA 5FZOA 3H3VK 2HPMA 5JI7A 5ERLA 5EHDA 2IXKA 2G7UA 1AR62 5A80A 5ABJA 4PHZA 2I5UA 2DFFA 2GNBA 5E1WA 1P4XA 1C8M1 2M2EA 1WLCA 4NOTA 2W82A 4JDNA 4K8FA 3H3LA 1B09A 1H9PA 4AWDA 2NOGA 1UG0A 3P5JA 1RUH3 2DA7A 2BP6A 5K0UB 4UUTA 2C0ZA 4N9HA 3O1VA 1F4AA 2QZ3A 3S1QJ 5E18F 1K6OA 3DL3A 1S2BA 2R7DA 3WF0A 3MIHA 2OV7A 2GMPA 3VBUC 1HSTA 3N7LA 3KV6A 4Q47A 1W8HA 3AL6A 1UIKA 3GDBA 3H1MA 1LB2A 2RMU2 3WTUC 1X19A 2Q8EA 4I02A 2DCEA 2EWNA 4HDVA 1GUIA 2H09A 4BISA 3LSPA 5EJZB 4FPGA 2JDNA 2DK5A 1RXFA 1PMHX 3QBQA 1B9NA 1YI9A 5A7WB 3SCHA 4AFBA 4BOWA 1BBYA 2QKLB 3LQQA 3D0JA 4CXYA 2HPIA 1YG2A 4E2QA 4XIDA 5IVJA 4RB0A 2H6BA 1SG3A 1LECA 1K5MC 3M3OA 3DPRA 2Z79A 5JLWA 3CMGA 1S0CA 5FB2A 4YGCA 2WB1N 2OD5A 5I0RA 2WNVC 3SJMA 3AC0A 4CCLA 4YGBA 1M1EB 2DVBA 2DO7A 2Y6KA 3MV01 3Q9OA 4BBRJ 3CJNA 3IN9A 3DFGA 2DDUA 4FOVA 5JOYA 4E7KA 5I8SA 1TWGJ 1YE9A 5BNOB 4BQOA 4KUMA 4QGMA 5DDJ2 1REPC 1Y39A 3K69A 4EQVA 3AYAA 3JU9A 3K4ZA 1A34A 2P3JA 2F2EA 1E5HA 5C4WB 4BE0A 2UURA 4FX4A 4LT5A 2O14A 5L7OA 2CMPA 1W28A 3BTYA 2R0QC 4B4CA 1YQ5A 1DYPA 4RGKA 4Q4V1 2RDPA 2XAUA 1SD4A 3ZPLA 2W57A 1EAH1 1IPKA 3CC7I 4TWTA 3K4NA 5HVQC 5LW9A 4ENMA 5L19A 1FV2A 2JG8A 3TO6A 1JMUB 3VHPA 1WJAA 1C1LA 3R4KA 5FPLA 1CZTA 1BYHA 4N53A 4ATEA 2P5KA 2XGEA 4LBQA 1ZA7A 2XUMA 2K0GA 2DCTA 2WQ8A 5E8IA 1YIPA 4IEXA 3JR9A 2XGXA 4CDXA 2B4KA 5J6XA 1OCCH 2EPFA 2ZJCA 3NKGA 3T1MA 2HWD2 2ZFWA 2LTPA 4FCAA 2LROA 4W50A 4HBNA 3U14A 1V0AA 5FD6A 4YFKF 4XR6A 3OSGA 3TNPB 5EG0B 1LJ9A 3KEOA 4KFCA 5K0UC 2CY6A 3MLLA 4AR2A 4DOZA 2VQGA 4JV4A 4B7EA 3U0ZA 1FOD3 2KT0A 2W5FA 1WD4A 3SITA 2BPA2 3U37A 1JTXA 3UKTA 1Q5OA 4AQTA 3GCXA 2W95A 4CYCA 4AVTA 3FHZA 2ADEA 5BNNB 3A4CA 1CF7B 3U1XA 1H8TB 1GVDA 4YVSA 5ICFA 4KL1A 3JREA 1JYCA 1CAUB 3KP6A 4S2FA 4XJ8A 4AU7A 3AXEA 4PLMA 3HRMA 1A36A 3TRSB 4CDWB 4JDMA 2P1BA 5IUQA 2XKOA 2ENRA 4OQ8A 4C1WA 3F8NA 2WWYA 3VN4A 4LK0F 5LWBA 4XFFA 3TN91 1W6OB 3NWTA 5D4SA 3GTJJ 3ITQA 1PYVA 3H3ZA 2IVMA 1JW6A 1A5JA 1ND2B 2GIVA 5E8GA 2O3FA 1ZGAA 3OF1A 1SEFA 3FE5A 5JHUA 1VRH1 1R9TJ 3D6EA 3ZFEC 1Q8QA 1SMYF 3T09A 5IVEA 1VQMI 3MBWA 3J7NA 4CUCA 1RB8G 1XE8A 3NV4A 2EZKA 5FXZA 1IPSA 1OCPA 3TDUC 1PO23 1MSEC 5FJKA 2VI6A 4IEZA 3Q8EA 3GXUA 2YC4A 2HTSA 1JT6A 3CF2A 2DJIA 3OYCA 2CSOA 4KBBA 3AZZA 4EATA 2Y6LA 1WVRA 5I8YA 4OMZA 3TOBA 2WSUA 2LFBA 3N9OA 2A1XA 2XJVA 2R7UA 1GP6A 2L7KA 4HZFA 1YITI 1CONA 2VD7A 4AEDA 1W6QB 5F6KA 4C30A 3I64A 4KIBA 5C8WA 2V4VA 4DINB 1YWKA 4CP2A 2X5IB 3OBTA 2XBO2 4IRIA 3G3ZA 3TL4X 4M3CE 4XMAA 5J3LA 4O7XA 2NVUB 1POQA 1KXGA 1BN5A 5FRMA 2BXYA 4IUGA 3QP5A 4MGTA 1SD7A 2G4IA 3CF6E 3H9AA 3J80K 1U5ZA 5L36A 2R073 3F23A 1C28A 3WTWC 1CAVB 2WDBA 3AVRA 1UL9A 1K78B 4HXCA 5EZWA 4YZ1A 2RS31 4FAGA 4BIFA 2A75A 4YELA 1ZR4A 1EH8A 3MYXA 5ACA1 2HLEA 1MEC3 3TOJA 4KA4A 1OA3A 3V0BB 4RR3A 4BCUA 3GFIA 2W87A 2E7QA 2WA3A 5EPAA 3ZFFA 4RA0A 2KZVA 2KR2A 1NZCA 5FYMA 1T2KA 1R00A 4CEWB 3LB9A 2DMPA 1XTAA 3VWBA 1XSQA 3PIJA 1T98A 3S3OA 2D6OX 5IY5H 3L2YA 5A32B 2R7XA 3RNSA 2CDPA 4MLOA 3B6AA 5A6QA 1TZOA 1XU2A 5FJ8J 4A69C 3POIA 1R093 1ZBE2 2IW5A 1XMXA 2UYBA 4DGWB 2KJCA 1FOD1 5J4VA 3AP5A 5K1YA 1S0JA 3VBSA 4ESFA 4PJJA 4R4XA 5F6LB 5L3GA 3OB8A 2EAAA 3MI8A 4LJZF 1RR8C 4HPQA 3TBDA 3ZO0B 4GD4A 1UZ0A 3BR0A 1J2XA 2L7FP 1RR7A 1LE8B 1W7PA 3UYJA 1E17A 3OL4A 3IZOA 1O4XA 2VE9A 3OUIA 1B1BA 3ZMUA 4IGOA 5IYDJ 2AQEA 4HOOA 4QPGC 2CUZA 3WDTA 1GZWA 5I0TA 3DLAA 4XFGA 2WZR2 1K83J 5KAIC 1S9HA 4EJOA 4AHWA 2BYVE 1FMD2 4EWEA 1QJY2 4UBHA 1NXMA 3ETPA 3MUY1 3TNQA 5JR7B 2UZKA 2O61A 2WV1A 1LOAA 3S93A 1YNAA 4GWJA 4TLFA 1FOWA 5EGOB 2WAAA 3IKTA 1QU3A 4J25A 3BZKA 2V5DA 3I56I 5LGUA 2DTYA 3MIFA 4LOTA 2LRDA 3SZTA 3IWFA 4SLIA 3KHCA 1PNFA 1D2SA 1JOBA 2B9UA 1VRH3 1B8IB 4HX7A 4ZZLA 5HCFA 1H2MA 4HQMA 4D6SA 4AFDA 3MIGA 2N7GA 3PJQA 2VCAA 3VB2A 4NMIA 3TEDA 4BQQA 2CGPA 1DLCA 5ABJC 3KE2A 2BVMA 1TT5B 1KA8A 1COV2 3PURA 1EV7A 3V7RA 1NOVA 5AONA 1MR5A 5BNPB 3I58A 2Y6HA 1QMJA 4ET7A 3CC2I 2Z3YA 4K3UA 4QX0A 3H5AA 2E35A 4PIYA 3L00A 1FTZA 4WM8C 1GWMA 3PJYA 3MF6A 1CIYA 2K5CA 3ABMH 4BGDA 4NBQA 2AYHA 2L02A 3I2HA 4G94A 3HEFA 3LFKA 3MIEA 4K1YA 3VBUA 2R4GA 4XQWA 2C5DA 4FBFA 4L2NA 1KU2A 5CIRA 2XV4S 2EILH 2P3IA 2D5FA 4AVSA 2QQOA 3M3IA 1XDUA 3ELKA 5IYYA 4IHTA 1T0FC 1ONAA 5EF6A 3R6SA 3P9IA 3S15J 5M3FJ 4WBBA 4H7LA 4NHMA 2L7MP 2E26A 1FX5A 1ULCA 4XQDA 1N3OA 5FOJB 1RUJ3 3E6BA 1JGGA 2W47A 2QBYB 4INDA 3RYPA 3NSTA 1GR3A 1U8BA 4IW3A 4BH9A 3NQHA 4XN0A 1OLTA 3RKQA 3ZYBA 2W94A 4E7ZA 3V4GA 2VCCA 3FFZA 1T95A 2HYFA 5FROA 1X50A 3FHNA 2ZMEB 4Q0VA 2QSHX 2JA2A 5DD4A 4M0HA 4M6VA 1S0DA 4RS5A 3ABTA 4XUNA 3IBMA 4CUBA 2L9NA 1JHJA 5EWSA 1OA2A 3IIIA 2WL1A 4D7SA 3VYRB 1R1TA 3H8OA 5B4XA 1S0BA 4DXZA 1ZX5A 4F52A 1YJLA 3R0JA 5FBJA 1W36C 4MG2A 2L01A 2QFEA 2DVAA 1H9WA 1AYN2 1GU3A 2XJSA 2ETEA 3ZQ7A 2OZUA 1RUE3 4XL9A 3RDIA 1KYWA 1KQ8A 2QQMA 4OHWA 2BHZA 4A2UA 1RIRA 4CUGA 4MUVA 2CNAA 1AR81 4W97A 2BWAA 2HI3A 4L0PA 1PO13 1PGW2 1K3IA 3JRIA 4QPGB 2ZXJA 1ZM1A 4KICA 2MHFA 2PHRA 4LO8A 3FKJA 2X1DA 3IRQA 3POWA 2J1SA 3N7KA 1H89C 5JR3A 2RKHA 2P17A 3WINE 4XILA 2KXLA 1ZNPA 1QOSA 3ACFA 2A70A 2ZTNA 2QSFX 2IS1A 1PP7U 4UXAA 2LNBA 1ENSA 3K3OA 1HCRA 4YNIA 1H0BA 5BNPC 1L7RA 5JI9A 3JD71 4R9CA 2WFPA 4WVZA 1V4RA 2VCMA 3M3EA 1B6AA 3BCBA 3K9TA 3UGFA 3AKTA 5GZEA 2NOJB 3J81Z 3P3NA 1P92A 3KF5A 3WG9A 2WKKA 5FWEA 4A6SA 1FP1D 3OGGA 3DTKA 2F6CA 4FTEA 3E3VA 1RUI2 3RZHA 1DP3A 4HAMA 2Z42A 4D9JA 4A3JJ 3WGIA 1I6HJ 3WNNA 4AEDB 1E3OC 4GALA 2P7VB 3UK9A 2Q0OA 3D8CA 3HN3A 5HOOA 4RHV1 2XJTA 2SBAA 3FF5A 2PI0A 5FPBA 1QO0D 4GB31 1IN6A 1Z21A 4QPIA 2EFWA 4LHNA 4XURA 3SXYA 3PSIA 5FO8B 2KRCA 5DABA 3M1EA 1TW3A 1H30A 2Q1FA 2F4OB 2AR6A 4ITVA 5JIUA 1YCIA 3ZIXA 1ZYRF 5DEQA 1WH7A 3RI4A 2KD7A 3GZUC 4FT8A 3JRHA 1SFOJ 5A3MA 1ALYA 3OY8A 4WVMA 5EG0A 4B8EA 2HWB1 1IG3A 1PZ9A 1IS3A 1H9TA 3JBG3 3VLBB 4QX8A 5JHFA 1SFKA 4ESJA 5I0UA 1I5ZA 3VL9A 3T30A 1SFPA 1IRXA 5JSOA 5CBLA 5A70A 3UJQA 4XFIA 1E3HA 3CL1A 2RM23 5LA0A 1EYBA 1X2NA 4YW7A 3BG7A 2ZNYA 2V9PA 1HB1A 3MFAA 4IX7A 3OV8A 2Z2SB 4XTMA 3DQVC 1GOFA 2X10A 2BERA 3J9SA 1CAWB 4M6XA 3BALA 3WQ7A 4NWWA 4BUPA 3C7HA 1YX5A 4L8QA 3M7AA 2A3WA 4XRMA 2NMOA 1LOFA 4CA0A 2JK3A 2NS8A 1YJNI 4AFCA 1XMKA 2QA4I 3H5RA 2RR12 2HWB2 4XCBA 3S5AA 1RUH1 4LLOA 4XRSG 3HPNA 2E5ZA 5C4XJ 1GYKA 2I74A 4XSZF 2EA2A 1ND3B 3M3CA 3ZQIA 4BHPA 1I9RA 3BVCA 4LBJA 2F4MB 4YFNF 3H7YA 1D0YA 3KT7A 3TW7A 1D8KA 1BIBA 3ERED 2OUHA 3GLLA 4N7UA 3DEEA 2R1DA 5JDBA 3J8F1 4DB5A 2HVRA 2OU2A 4AEDC 1O91A 3NMBA 5CFCC 3BR2A 2HQ5A 4OWRB 3EYIA 3M7GA 3ZXSA 3OJBA 5FLJA 1Y8RB 1FAYA 2VZPA 2VU9A 1LQ1A 3L1PA 3BG6A 5BNGA 1CVNA 5JPMB 4JAAA 1VQNI 3A22A 3PO2J 3BPVA 5GLVA 2ME6A 3O1SA 1D4M3 4YIIA 1UU6A 5FZBA 3ONQA 2FCTA 3ZFGB 4MHGA 1AXKA 4DMIA 5FZ3A 2ZX1A 4RN5A 3ENRA 3H0DA 5D21A 2BU9A 4C91A 1F31A 2Y34A 2K86A 1JI8A 2D45A 2P7CB 3BTXA 2ET1A 2BZTA 3KV5A 3LSGA 1ZZ7A 4IGQA 3AZVA 3E1F1 1AHSA 5TGTA 4FTBA 5LBFA 5CVRA 1LDJA 2EZIA 3BTZA 5DZFA 2HEWF 1KGYA 1V3FA 4ZTJA 1NLRA 5C9AC 3M8LA 4M9SA 1EPWA 4ZYHA 4XJWA 5CQGA 5IVFA 1AR83 1L7LA 2I8DA 1R22A 2IGNA 4HA8A 2EFNA 2F4PA 5F3IA 3WP3A 3K51A 4BB3A 5FO5A 2D6KA 2QNKA 1W8OA 3WGHA 2PJPA 2XLFA 3CD6I 2WTEA 2YU2A 5FLXK 2EIDA 2CTVA 3GZ5A 4QDSA 3PNVA 1RUF3 3NARA 5EV7A 1HDDC 2J1UA 2HWF1 1YI2I 5FFXA 3I3QA 2M7AA 4XTPA 3K70C 3T08A 3WY6A 2HYXA 2PMZN 4XIKA 4DNCA 4PQ9A 5DDJ1 1WW4A 1TWAJ 3I9V2 1F43A 2ZAHA 3ZXJA 3S57A 3DBRB 1VQ4I 3O6BB 1DGLA 4XXAA 2ZGMA 4K2EA 3WG7H 3O7OA 1R4MB 3WNKA 5CG9A 1GWKA 1JI6A 4I0BA 4HN0A 5H9SA 4KI5M 4NIIA 2A6TA 4AZZA 2VZOA 1W8WA 2RV8A 2COMA 2HWF3 4PGHA 3WE2A 1O5UA 4I30A 3K4AA 1BBT1 3ACIA 4Q1RA 4QPOA 5FJHA 3KM5A 2RN7A 4I3PA 2VAUA 2RDSA 4LQRA 4L5JA 2EFPA 4YM2A 5F9TA 3I4NJ 4KGQA 3TEWA 2HQAA 2VVDA 2DOEA 2MC3A 3AKZA 2VJ5A 5GP9A 2OUJA 2WIIB 1JUIA 1TLHB 3PMEA 5L73A 3HOSA 5JSRA 2VTXA 2JA8J 1HW2A 1JJ6C 1LNWA 2VH9A 4L9BA 4Z92B 1R1A3 3U2RA 1FNYA 2V5YA 2O8OA 3GYDA 1UMQA 3PJRA 2WN3A 2WBKA 2YBKA 3RI8A 3KETA 2VOXA 2B9SA 3DEWA 2WB1A 3PUHA 2M45A 2LYCA 2DODA 2PHXA 1SBEA 2QCSB 5B1BH 1ZK8A 4PJYA 2K9SA 2B63J 1QJU2 4I3GA 5J09A 4IV3A 3UR3C 4UHTA 1UIJA 1SBFA 5L7OC 3CMMA 2O6GE 1E5IA 4L18B 1Y3TA 2YB7A 3POYA 2CQXA 2HYGD 4UYBA 1CQTA 1REFA 4OU0A 3VOEA 3NJYA 3ELNA 3ZFFC 4Y5SA 3LSTA 2VZTA 1I27A 4ARXA 1Y9GA 2ZNZA 3A1YA 1FIPA 4DUVA 2JG8C 4XBLA 1BKZA 2M8GX 3GZEA 3WG4A 5CKNA 2RAEA 5L7OB 2K9NA 4QU1A 1QOTA 2E19A 1XNDA 3ZXDA 4RB1A 2AACA 5F32A 1J1LA 1UW8A 1VQ6I 1QJU1 1LVKA 4AIHA 4EN6B 3HHGA 5E3NA 5FDBA 2JDZA 1QBJA 4JHZA 3HBKA 3BJAA 1W6PA 3FXKA 3NJVA 5JVTA 1FJLA 3AL5A 1WJ5A 5B66C 4FTSA 4RAFA 5FZHA 2IT0A 3E7LA 5FKOA 4CCEA 4EM0B 2EINH 2F4LA 4L9JA 5F8PA 4TTGA 3RFRA 1SCRA 4B1RA 3GYHX 3T3YA 1WI3A 4BXXJ 1EF4A 5K8SA 3O5SA 1V5GA 4RGSA 4FOWA 3AG1H 4URAA 4NC6A 3A7QA 1ZBA1 2C9KA 4OMCA 4HK8A 5C3PA 3VDCA 3I5UA 5L3FA 2KA3A 3QPLA 1RVF3 3N3HA 1RXGA 1RUD2 2W46A 4Z1VA 5ICGA 2PLV1 1RMU2 1MEC1 4OZXA 1O3QA 2Y38A 3FUOA 1ZA4A 1LEMA 2IVJA 5DDGA 1AR92 4HNUA 2K7LA 3K46A 3O1MA 2ICWG 1AR71 5F2SA 4UFMA 5AIQA 3ECHA 4JKLA 5J48A 4Y26A 1R082 3F72A 3ISPA 1OR7C 1YW8A 5IAVA 5FYBA 1BLZA 3THPA 4XN3A 4RQPC 4LB5A 3TO7A 5IT9K 4S0HB 4WZCA 2BY1A 2LKPA 1OT5A 1ULEA 4QX2A 4CGZA 1GP4A 5ISLA 1NXD1 3HVDA 2VCBA 2PQQA 4CCOA 5BYNA 3NAPB 2XWBB 2LD5A 3EETA 1J84A 4AXOA 2VZ3A 2JA7J 1XGOA 2P6SA 1DP0A 5BQTA 1DQ0A 3JRBA 5A7PA 1PP8F 1EV13 2QBYA 1UF2C 5D6EA 4NDLA 2R042 4XHBA 4GFBA 4L11A 3ZXEA 1BEV3 1FBSA 1R5HA 1HQNA 2EK5A 4BHCA 3FBMA 3K77A 4MVTA 2A6VA 4LHSA 1AYM3 4CYCB 2PLV3 1DQ2A 1FYUA 4OUEA 1WW7A 4IQPA 2XSDC 3DEUA 1SCSA 3WNXA 2LBFA 1YFXA 1WJEA 1RMU1 4HKLA 5BY5A 1OH4A 1LEDA 1BEV1 1O3TA 2HQNA 3A01B 4RL7A 5CYVA 2A5YB 4UOJA 2YY1A 1W99A 3RPUD 3QPTA 4PDWA 2JG9B 2ZOEB 3VBRA 2ZX4A 3SEEA 2H0BA 3TO9A 5C44J 2QUOA 2G9GA 2BBYA 2DQLA 4YG6A 4RGXA 2VN2A 4PF1A 5CFDA 3HPHA 2LR8A 1YX3A 1VIWB 3J8F2 4WV8A 3EDPA 2GC0A 5HDGA 4A6DA 1W8FA 1ZN2A 4K40A 1P7JA 4RAGA 3CCUI 2LK2A 1H2LA 2FBKA 3GUDA 3OYNA 3I2GA 5FPAA 1USTA 4JGYC 2F5VA 5BNQA 3G1MA 1NHAA 1NTCA 3W6KB 5IYBJ 1AR73 5FKLA 3H7JA 2E51A 1B72A 2K4JA 1DPUA 3HRUA 2JX9A 1RUC2 2EIKH 1V6JA 2R7SA 1OD5A 1VQPI 1AL23 3I53A 3K1PA 2MEV1 3R4DB 3OUJA 2GP5A 1ZZCA 5FP7A 3W5NA 1B59A 3RPQA 2DUOA 3AMHA 2RDRA 2TUNA 1VFCA 3ACHA 1HRI2 2BGCA 1AA7A 4F3QA 1SLAA 5AC93 2ZO4A 3WU0A 1CX4A 1UY4A 5KHHA 3R4SA 3BC8A 4CHUA 2KLOA 5A7OA 3PQKA 2YSRA 2IS6A 2QDNA 3MEPA 1C3HA 2VW0A 1DQ1A 3WW1A 2WS91 3POFA 5JFRA 2WT2A 4JDOA 5A7QA 2V26A 1UCXA 3POSA 2HGCA 2MW8A 3E6MA 4META 4XKBA 1LHNA 4UAPA 3VDXA 1W1WE 1ZRFA 3KB5A 2HDWA 5HXVA 2VJIA 2PN5A 1HRV2 1IV8A 4E7IA 2JECA 4QPIB 3O3KA 2QM3A 2Y30A 3KFWX 3V65A 3N35A 1NG6A 4AYBA 1V5EA 5IK5A 2JJ6A 1FPN3 3SKJE 4FOQA 1GQHA 4FPEA 3HB9A 1KU3A 5F04A 5IVVA 4CU9A 2E71A 4XFBA 1VBC2 5FTTC 2FMLA 4BK4A 3WX5A 1PMIA 1WMEA 5CU1A 4A45A 1G4DA 2WNUA 4KBZA 4BQNA 2VQ0A 3TB0A 1GMMA 1CZVA 3AMQA 4O9EA 2J42A 2EXIA 4Y17A 2LMDA 5FK7A 4F3JA 2K85A 1V6LA 2RS13 3N9MA 1G9CA 3QYFA 3OEBA 2XAFA 4KQ7A 5AFEA 3R4UA 4LHLA 1KYZA 1MS3A 5L9VA 4CH7A 3ETQA 1IW7F 2R1BA 3P3PA 5EZGA 1F5JA 1LFUP 1I3HA 1UYPA 3RKYA 4DZGA 1QRYA 2V1DA 4AVPA 2YR2A 3GTKJ 3GTQJ 2WO2A 1S3JA 5C4WA 4LUKA 1U8RA 3OWTA 1MQTC 3CU7A 2QE3A 5GZDA 1Z05A 5FLMJ 5EEGA 4BJ6C 2VKVA 2R062 3M8EA 2EXHA 3VBOA 1Z0XA 2HR3A 1XX5A 3KP5A 2X6WA 3S8PA 2M8EA 2P4WA 2HWD1 4UB6C 4RBOA 4OUSA 5JOWA 4FO9A 2ZJ2A 4N43A 5A1AA 2PHDA 3WHUA 2UU8A 2W1UA 2OPTA 4EEFG 4BJ5C 2XHKA 4FFFA 1XYOA 2A6WA 1ZBA2 3VBSC 1VLNA 5JSPA 5CJ9A 3L2QA 1LUJB 3MVPA 1XSRA 1WD3A 3GJAA 1QJX3 5FR3A 4XORA 4Z2AA 3CJIC 2D7FA 2K9MA 1FP2A 3RI9A 2JG8B 4MO7A 1U5TC 2YX4A 4Z2YA 1X33A 2VBWA 1VQLI 2W25A 4LPLA 4G9YA 3VSKA 2QQ8A 3V8JA 2A6EF 4CEWA 1STZA 1ENQA 2F5FA 3JRAA 1RJ7A 4IQ4A 5DCMB 1DQ5A 2CV6A 2NQYA 3ACLA 2O0YA 2JA6J 1K4TA 2VJ4A 4HF1A 3Q5FA 4MIMA 5BOXA 4NAOA 4HYEA 2N8GA 1YJWI 5GPCA 4I0AA 3EBRA 4UUVA 4XMIA 4G4FA 4EJVA 4ZC3A 4LNVA 4M00A 3K7AJ 3ZN0A 1OPCA 3MW4A 2FDFA 3IL2A 3SH3A 1MQTB 5C9AA 2JZYA 1YHQI 3I59A 2QF7A 2DMQA 3TEXA 3OBZA 1U0AA 3I2FA 2ZGRA 4GIQA 2FA5A 1D1CA 4BEHA 2ZJPF 3BTAA 4PK4A 1SFEA 4S05A 5FZEA 3NRVA 3IDAA 3CZUA 1ZRCA 2Y0OA 1EJ9A 2CUEA 4E7HA 2NS7A 3K2AA 4JZRA 1N1VA 4GYGA 5HCBA 3REOA 3LAGA 4UI9L 2RHPA 4CDWA 4IKFA 2HQRA 4ASMB 2RNGA 5B3SH 5F64A 3O1UA 2L9VA 5DAQA 5KC6A 4HMZA 2K3FA 1LFBA 2J1RA 3PSFA 1YFWA 3JQWA 5IT3A 5LB6A 4IE0A 5GZGA 3IDBB 1MZ6A 1C57A 2PQ8A 4Y20A 4GH4C 2CSGA 4LBKA 5T3NA 2DA2A 2VQCA 1AOYA 4ZZ5A 3HGGA 1BI2A 1ULFA 3IDEA 2NNYA 3V56A 4LBMA 1POV3 4IHXA 3CDIA 1O6UA 1BQPA 3CJXA 3M3YJ 5FP8A 4BE1A 2VPLA 4DEVA 4ANJA 3S14J 2IVIB 1YC61 1XGNA 3NNMA 2Y48A 1R36A 3QP6A 2Q0AA 1MH4A 4GQ7A 5IWFA 5IOYA 1DBNA 2QQJA 1QH6A 5CAZA 2O8KA 4OIQF 1OA4A 4D6QA 3MCZA 1OKQA 1X36A 4PGGA 2TRTA 2GNMA 2A61A 4O5VA 2VQTA 4HX4A 1HN1A 1EAH2 3J7ZI 4J01A 4PJMA 4CDUB 5C3RA 2GM4A 1ULPA 2DI3A 2WAQA 3EUAA 4D7YA 5HV0A 3JXSA 3HL2A 1H9GA 1ZG1A 4EZ4A 1V9U3 1PUEE 1VQ5I 4S04A 4HBLA 2VKEA 2BRTA 2STTA 1D8JA 2YHJA 5FMCA 5FZ0A 5GALA 1XN7A 3VFZA 1H0MA 2DPUA 1YRZA 1UELB 3DP7A 2LS6A 3O1TA 3HSEA 2R3SA 1OVSA 1Z3XA 2MGQA 2VIXA 3S3NA 2AUYA 1CGPA 4XUTA 3BTLA 1R7JA 2OPKA 3ZIWA 2H1KA 5M0TA 3CO7C 1VBB3 2R5YB 1WQ2A 3D5OA 2HNHA 3JUUA 1K4SA 2XB5A 2VASA 3KIOA 5GAHJ 5FAXA 1EKEA 3N05A 1N3QA 1KJLA 3U11A 1W2OA 4U88A 1FPN2 4J19A 3N7MA 5DUKA 2F5DA 5DCFA 1APNA 4H7MA 2M1BA 5LD2C 1YRNB 1TP4A 4I99C 4IXAA 5ICCA 1XJAA 2FNPA 2B42B 5HODA 3JAMK 4DEQA 3KZZA 2DLLA 5C8CB 1JKQC 1QZEA 5FMDA 4E4HA 1PDNC 3FXUA 1YFYA 2NLRA 3A01A 1UCRA 3BQZA 4XLAA 4PT6A 3CIHA 1S8NA 2K3PA 2W1OA 5KK1A 4H14A 2Y6GA 2Y69H 3T8TA 1UZYA 1RIOH 2ZMLA 1MS1A 1MS5A 1ZGWA 2ZHMA 3FBYA 1ULGA 4CVUA 4I6ZA 2KDZA 4DOUA 3PUBA 4UF0B 3A03A 4KU7A 5AC92 3M1HA 5L9BA 1P4AA 4L92A 3D5SC 1VB2A 1I50J 5E1XA 4YIRX 3PFYA 4BY1J 2M7BA 2VLAA 2IP2A 2ZHLA 3Q0UA 3CESA 1BOBA 2GU9A 2XC7A 1J3QA 4AOCA 4Q48A 3VPRA 3KP2A 4AVCA 4D0QA 4IEPA 1MMAA 2H8WA 5FGMA 3ZFEB 2L7ZA 3SEPA 1AR72 3T0DA 4DS0A 2ZGSA 3MKZA 1HXS2 1R5ID 3T5XA 1C8NA 3I3EA 1JUMA 2XGDA 4C2UA 2LVSA 1PHMA 3DN7A 4CZZA 1ZAOA 1T39A 1LE8A 3AP4A 1OFNA 1UU4A 1X1PA 2E7AA 3URFA 2VNOA 3TWIA 3LGRA 1EH7A 1VBA2 3TQNA 3GTGJ 1HKDA 2DOFA 1WA6X 5CEHA 3USUA 4F92B 4ZZ8A 5A6YA 2JMWA 3BR5A 3I3BA 1BMV2 4UUSA 2HTJA 1WJFA 1MS8A 3NV2A 1Z78A 5B1AH 2W7NA 1PK6C 3U4XA 4XOPA 3WHTA 2ZEXA 3OBAA 3TYJA 2J5PA 2ZHNA 4N90A 2JDHA 2OQ6A 1YXWA 3ZR6A 5FFOC 2AENA 2JUGA 4LE3A 3F8FA 4IRHA 3WF1A 1RRJA 2H8RA 3KS7A 1J75A 2B9VA 2VT2A 2J1EA 3LSEA 4P5YA 1UYXA 2YPDA 2W92A 1QXJA 1L3LA 2E32A 3R61A 4RLQA 1VBE1 2WR9A 3B94A 1JXNA 3AB0A 2PLV2 2ATFA 2G19A 2YPRA 5JAXA 2L5QA 2MFZA 2E2JJ 2WWSA 3VB9A 4HV6A 5AVPA 2KRFA 4HVOA 2R043 2LH9A 3ZLIA 4Y52J 3LA2A 1C4RA 1EV12 1MD0A 4HKWA 1LHWA 4LULA 3FMRA 3CMYA 4LXLA 3WW3A 5IT9Z 1M06G 4A3IJ 1SFYA 3S30A 4YVWA 2P81A 3J7MA 2VE1A 1VE0A 2ZX3A 4R8HA 5LHGA 1ND3C 3VV1A 3NRUA 1GICA 2MH2A 3H9GA 1WZXA 1TNTA 1ZZ8A 5H9PA 3HPGA 1KJRA 1MQTA 3ES4A 1YUDA 4XOTA 2HWC3 2D93A 2IA0A 2P8TA 4Q4Y2 2ZKZA 1IQAA 4QX1A 4M71A 1XC6A 3W6JB 4FISA 4EGZA 4LA3A 4XSXF 4EJWA 1XE7A 4IESA 3KWVA 3RWKX 3HKZN 1EUUA 4HRIA 4W6YA 3HQXA 1W8UA 3MO4A 1BM9A 4ENKA 2CAUA 3BG5A 1DGRM 1ODNA 1WRJA 1QDOA 4HG6B 5L3BA 1RUD3 1UX7A 4PI0A 1BK1A 2NP0A 1AVBA 2OJED 3PIGA 2R7TA 3CTAA 5BMZA 1MMDA 2UWCA 1JGSA 5A2QZ 3V42A 1TL8A 3DCFA 3KMHA 5FUPA 3GTPJ 2CW8A 3HOYJ 3OOUA 2L4AA 1PMJX 5LRRA 5FREA 4RGRA 1QVUA 5CFDB 4COYA 5D8LB 3HJRA 3H35A 1KFUL 2V6EA 3LSHA 4CCNA 3WQ0A 2BOIA 5EP9A 1ITYA 4RGUA 2JD9A 1VBD1 1HKQA 1IZ3A 3NL1A 1GLNA 1WLTA 5IFTA 2ID3A 3GM8A 1J58A 1NA1A 2RJLA 1C1FA 2E7XA 4OLLA 4XFCA 4PBOA 4IOCF 1JYXA 4A3LJ 1EAH3 5IVBA 4BDYA 2Q4SA 4AE2A 2JDUA 4Y15A 1HJFA 4IHVA 2JTVA 3W2WA 1QDCA 3KEQA 4XABA 1BR2A 2BY2A 4AW7A 2VVFA 3HJEA 2JRMA 4A0ZA 2IS2A 3DU5A 3DV8A 4K6BA 3A0HC 2D3PA 3ZM8A 2BFUS 4M3CF 1OVPA 3ZKYA 2XF7A 2ZMNA 1JZ8A 1FMD1 4G8XA 2BY0A 5FY5A 4B7KA 4YRVA 5EDNA 1C5IA 2GC2A 2YUEA 3K4DA 3NVCA 4LUMA 3WTXC 2VMCA 4ASNA 3IH2A 5A3TA 2HOSA 1A8MA 3M4OJ 1H1IA 3KP3A 3FBNB 2GA1A 3M3QA 5EJ1B 2HU9A 3HRSA 3FWEA 5T54A 3ZSJA 2QTWB 4TXWA 1NG0A 1MJ9A 1WBFA 2ID4A 1UAAA 3S16J 3ABLH 4BZ4A 1W7PB 3VBOC 3HEIA 4XOGA 4NJ4A 2G0EA 1NCQB 2VVEA 2K9ZA 4L0YB 1GT0C 1UD1A 1GBGA 2GMMA 4GDFA 2EAKA 2VPRA 1UHMA 2LC2A 2X6XA 2RDQA 4RYDA 5SV5A 3SCGA 2CRGA 4ISQA 4YVSB 2HH9A 2IA1A 2JIJA 1ULDA 3QWLA 1ENRA 4P08A 3WDUA 5AC91 3KYLA 3DPRC 3IMNA 1UB9A 1JHFA 2QUFA 2E1CA 1XXNA 2HWF2 2MC4A 1W6NB 3MKLA 2K40A 1GXQA 3HNMA 3NAPA 3TN92 1VAKA 3H0OA 2ZAAA 1F9KA 3LZZA 2NVYJ 4ARYA 1T38A 1HXS1 2WWUA 2XVCA 2RS51 3I3LA 4IEJA 2YBSA 4ZS2A 3I49A 1UKRA 3ASIA 2MABA 2AC1A 1NUKA 2X0LA 3OTFA 4DJAA 1NY72 3ZN1A 1O4ZA 2B46X 3OIOA 2WABA 5JIAA 4JRLA 1WH5A 4NR1A 1I6XA 3RZKA 5A1LA 5KHGA 1UPIA 1IS4A 4FFIA 1WWYA 1O57A 1D3YA 1ZH5A 2CH0A 1WW5A 4CDXB 1H6YA 1VMFA 2E36A 1TEIA 2JUCA 5JMOA 2DQRA 1WSUA 2AQFA 1YIOA 1W3XA 3USUB 4NVPA 1OR7A 1L3JA 1VMHA 1OCOH 1QIQA 3WG1A 5E6HA 5G04L 1A04A 1QJX2 1SVOA 1MNEA 2ZFUA 4XKWA 3BJOA 1DZTA 3KLSA 2WJSA 2QKDA 3ZQLA 3V64A 5TJJA 2GNDA 4BDVB 2PMWB 4OAZA 1SQ4A 3BZCA 4IE6A 2OZ6A 3VBHA 2DFBA 2O03A 2DMNA 1VQ9I 1BMV1 4LR4A 3OY8B 3G71I 1IDYA 1KGSA 2RDNA 4Q4X3 5BXXA 4OHXA 2NPIA 3LWFA 5FXXA 1PM7A 4XYXA 4V19K 1B4AA 3DTEA 3F21A 4PCQA 4CDXC 1RUD1 2FD5A 2Y9YA 1A78A 3VD5A 3INAA 4CCCA 3R60A 4EZHA 2R7OA 3FKIJ 1WJBA 1LENA 4IL7A 2LP0A 4MH0E 3UKNA 3VZLA 3PVOA 4DXRA 1IN7A 1R6RA 3PU8A 5LRSA 5FP9A 1V6KA 1IUFA 4ZHNA 1CESA 1R1UA 1RUG2 1XB4A 2NS0A 2L54A 1FWZA 1SDWA 2WY7Q 1UJ8A 4PJNA 4RR3B 2HVSA 4N9IA 3P9CA 3BOWA 2XAJA 2CL2A 5IOZA 2A69F 1RUE1 3O8GA 1FX7A 1FEXA 4R1HA 3TKYA 1QOOA 4PDWC 1SVMA 3ZCOA 3WDVA 2UWBA 2HWB3 1PGL2 2IFWA 2GXGA 4FASD 1DZQA 5IW0A 1GP5A 4YSFA 1ZYBA 3SZPA 4Y7NJ 5C9AB 1OI6A 2FDHA 3H1CA 4HOBA 3MZYA 5BNNA 2DUQA 2C6SA 1LKNA 3MW3A 3WR0A 3UNPA 1QPIA 5LBEA 2R5ZB 1D0GA 2VOKA 4PSWA 3DXTA 2M34A 3GNEA 4AK3A 1XPXA 1AHDP 4YW6A 4HT1T 2OA4A 1ONVA 2BJSA 3I54A 1MZ5A 3OR1C 3OPTA 4GJZA 3HUGB 3OSDA 4RAYA 1HRV3 4AEMA 1RC9A 2E1MC 1YOVB 3IP4B 4Q4W3 4KMUX 3ZFGC 5L3EA 4OVEA 3JBG2 4CYDA 2IXCA 1SFNA 2ERFA 3PDQA 4Y5TA 1Z7S1 1DYKA 3QODA 1GOGA 1PO11 5EJ3A 2DF7A 4N4OB 4OULA 4GMP1 3BR1A 3SLIA 2A6XA 2JRTA 5FZ7A 2CS3A 1V9U1 4Y4YA 2WAOA 2WZEA 4JGYB 4UUSB 1H88C 3F2ZA 3KYCB 2JENA 1VAMA 3S7IA 1OKRA 3ZSKA 3BJ6A 1KDKA 5J98B 4WX9A 4LG0A 2PA7A 4NHYA 4WXHA 3KQ4B 2HXIA 5F3EA 1DU6A 3DEMA 4MYEA 3T0BA 3SZGA 2W91A 4XPVA 5HLIA 1RUC3 3OS2A 2X48A 4QHOA 2FF4A 1OLME 4QPQA 1RUI3 1FC3A 1DLLA 4K1ZA 1B9MA 2BHYA 5FYTA 1RC6A 1B35A 3W59A 3VKFC 5GJ6A 4HK9A 4P9LA 5DG1A 3T4HB 2G9ZA 2ME0A 3WNLA 1R64A 2K9LA 3MEXA 1RUC1 1V55H 3KZYA 3Q0VA 1H8VA 3ABZA 4JP0A 3LOIA 4Q4W1 1U9OA 4E7JA 3IUOA 1BJZA 4KGGA 3J8F3 3GMEA 4XHXA 5FYYA 3FHAA 5J36A 2FD8A 4A5MA 1XPWA 4XJ9A 5DM6F 3VEPA 3IAPA 3OD4A 3CCVI 5C6CA 1PX3A 5EIYB 1YEWA 1WUVA 2DCJA 2ILMA 4LO4B 4CCJA 1X82A 1RITA 1QJFA 3BB6A 5F27A 5C7GA 4BY7J 4D7TA 1YQ2A 5JXHA 4RAZA 1OLQA 4NC8A 5HNHA 2FDJA 4Y1ZA 3Q3SA 4F83A 2LREA 2BNMA 4PIXA 2Y2ZA 4YEJA 3CUQB 3WXPA 2OUMA 3RQ4A 4CU8A 2X6YA 1FPQA 4XCAA 1WCDJ 3PUQA 2ADDA 4OHYA 1AYN3 3WGGA 5J8CA 4DPNA 3K4BA 2W52A 1J59A 3ILRA 2DTRA 1JKRC 1TNSA 5D8KB 4J1XA 1Q43A 3EUKL 3CCJI 1XNBA 2CW7A 4QT6A 3WQBA 1MZFA 1D0XA 2P5LC 4KMQA 3FL7A 2A7AA 3WG2A 2WZR1 4AIJA 4IV1C 3SHFA 3LD8A 1QJY1 1QU0A 4AQ2A 2KHMA 4QB2A 2YU3A 2VY0A 2GXAA 3PUIA 5GTHC 4UWDA 4ENNA 1HOMA 3VHOA 1U78A 5D4RA 2HDDA 4GKXA 4EN7B 4D8MA 1JHHA 1NZIA 1S4CA 1K5MA 2H94A 1MNDA 4JQFA 1DHKB 3E6DA 2VUCA 1FSHA 2ZEYA 1REEA 4HNTA 1NCRB 4Q4ZF 3JW4A 2ARXA 5FP4A 1FV3A 3ON7A 1PUFB 1RUJ2 4Q4Y1 1AJOA 3HZJA 3VKLA 2LF7A 2OF7A 1Z9CA 3ZYIB 1WW6A 2PMUA 4KN4X 2XOMA 3RGBA 4ZYAA 1JZ3A 3LSKA 3ZQGA 3HDDA 4AHYA 1OOPC 1J3RA 4LBOA 2JQ7A 4PF5A 1DFQA 1BCXA 5A33B 3AAFA 4HVRA 1XD7A 3P6BA 4KT6A 3F6OA 4GB33 2OZJA 2ARBA 3TAYA 2XAQA 4QX3A 4JQRA 3S32A 1APLC 4AD9A 1S0IA 1A6QA 1VQKI 4XDOA 3H1WA 2R0FA 3F8BA 1MDMA 2ZSHB 2VMHA 1MVEA 1AX0A 4BXUA 5FPVA 4QXBA 3DCQA 4QB1A 1P9QC 3OCPA 1JZ6A 3DU6A 5J47A 3RYKA 1MW7A 4XBFA 3NWSA 4JX4A 4UW4A 3LIHA 2EIEA 1W2TA 2XAHA 4FE4A 2EICA 4S2DA 2ZKNA 5KXEA 3WP4A 1TWCJ 1MMSA 5J7MA 1H8AC 2JWPA 3VL8A 1ZZ9A 4OAYA 4UVBA 5D5XB 3AK0A 3ZN6B 1SMTA 1LU2A 2W68A 5FZDA 3DPUA 2MLGA 3EUHC 3I2JA 4WK8F 5HCAA 4URTA 4XQFA 2VBYA 4JGZC 2RNJA 3K4KA 2WO3A 4QXKA 3OEAA 4A0YA 4OI1A 4C1XA 1YO5C 2V1XA 2LLKA 4H3WA 1U6GA 1R1A1 3PU3A 1FMD3 5A3PA 1DQ4A 4ZH4F 3ZYJB 1WKYA 1NA1B 5DM7F 5I93A 3WT3A 2BFUL 1TG7A 4GA9A 3OYJA 1E5RA 1OQ1A 1RKTA 4LB6B 2EQRA 3GBFA 4EJUA 5BPDA 4OFGA 2XHNA 4QLCU 1SHWB 4ZU7A 2E1NA 4XZUG 4HLTA 5FLHA 2R49A 3KCXA 4FXGB 1XU1A 3T0YA 3OYLA 2BVLA 2A73B 4V2WA 2VNGA 2DT7B 3R0AA 1UOGA 3CCYA 1DIWA 5C8CA 5JR2A 4CUAA 3TEYA 4IV3B 4ES9A 3CDLA 2E7TA 4II3A 4RSUA 3JAMZ 5KR7A 3NAUA 2CUJA 1HF0A 2ZXQA 4C9YA 4UFHA 3OOXA 4HPKB 3LF7A 3MIBA 2D3SA 3TMOA 1V00A 5C71A 4GRIA 1BOAA 2MA3A 1LOGA 2F17A 4F8AA 3WHCA 1VF9A 5E1RA 2YU9J 2R041 1UWWA 1LEBA 2PELA 2ZBKA 3K0LA 4RS5B 2Y0SN 2VR4A 1XDSA 3J80Z 3RQ0A 3F95A 1FNZA 2Z1DA 2PJRA 1IXCA 3APBA 4PIZA 4D69A 4II2A 1LRHA 5H6RA 2DJNA 1G9BA 1CQ9A 3ZXGA 1NCRA 2IXHA 3VDDB 2GBYA 2XPJA 5CYYA 5DD8A 4MNUA 1D4VB 1ZRIA 2JVHA 3WE3A 2Q30A 1QNWA 1R58A 2LKXA 3BPSA 4TZDA 4E7LA 2WS93 2M30A 2LBFB 2PHWA 4BNCA 5FD5A 2TCTA 4DUXA 4MX3A 3ZDSA 2DURA 4ATFA 1W4MA 3AZWA 3D5RC 4BU2A 3AKSA 3G6EI 1B8IA 1UHWA 4G6TB 4L97A 2D5HA 3VBOB 2KPMA 3LDBA 4NHLA 5FZIA 4ETSA 4A3EJ 4M01A 3HWJA 4IRGA 1PUFA 3CO6C 4FHTA 2WZ8A 3RSJA 2X29A 3WVJA 4ZONA 2BDRA 3VDDC 3K4LA 5T5PA 2BV6A 4O3MA 3M70A 3OYDA 2ZSIB 2E63A 4MSVA 4Q0PA 3BY6A 2PG4A 3NAPC 4ZU4A 3V0AB 2JA5J 1B72B 4ZYGA 2W08A 3A02A 4Q4X1 1W6QA 2M9HA 4RS5C 1LEAA 4NQWA 4EROA 3KT4A 3LNQA 1NLSA 5ILSA 3EXUA 5KCMA 1D4M2 5C3QA 2P0WA 4GKYA 1ND3A 1J83A 2VUDA 3Q8BA 1EA3A 2WAQN 2B7EA 1EP0A 4B3XA 5HI0A 3OYGA 5E88A 4LBLA 1TMF2 1H4GA 2AZ5A 5CLSA 3L09A 1CF7A 4HNVA 3OOPA 4O61A 2HZDA 2LG4A 3I4MJ 1VMJA 3VYTB 1JOPA 2E2IJ 4AFAA 2BNOA 2Q2EB 3HYIA 3QYEA 1K78A 2JIGA 4KNCA 4EVIA 3AFGA 2JDYA 2YX7A 1UO9A 2EXJA 1IQDC 2FOWA 4WM7A 1ETOA 3BUCA 2QSGX 3AP7A 3NW4A 2WZPP 1F9NA 3OG2A 1VALA 1Y8QB 2RR13 3DPLC 3KCYA 2J22A 2HKOA 1JUHA 5F5IA 4M3CB 1K61A 5DXDA 2LDUA 3QLQA 1FOD2 3PO3J 2XRLA 1HW1A 4CP1A 3IPVB 1SFUA 4DIQA 1RGSA 4P9WA 3QAHA 1TMF3 4BM8A 2OKXA 1A8DA 2L4MA 1SLIA 5IT6A 2VBBA 1D2QA 2FZ2A 2F5CA 4MGRA 3V8KA 2VL4A 5FPUA 5A3WA 5K7HA 4M0NA 2QKMB 2Y0IA 3OYKA 2M4GA 3LWCA 5DMYA 3H9QA 2A6ZA 4B4RA 1BK0A 3AYDA 2BW3B 3AYEA 2RQPA 3PVBB 1FMWA 4DXSA 2ISYA 2GH8A 4QKFA 3SH4A 3IRRA 3LL7A 3M9AA 2ET7A 3OPWA 2ZXIA 1GZCA 2K4BA 4E9KA 1MH3A 4BE3A 1N1YA 2GA2A 5LLQA 5FY8A 1ETXA 5HDNA 2YXSA 1PZ7A 4XW3A 1P7IA 5IVCA 5IATA 2OTLI 1W39A 1KONA 4R9DA 3LEGA 5TISC 3AFKA 4Z2WA 2RV9A 3PMSA 4PSXA 4HKOA 1U0JA 4LBNA 3N36A 3QYBA 4LOCA 4D5FA 5ICEA 4OINF 3D1NI 1UFMA 1OMIA 2CGOA 4AVBA 1WMFA 4MQ9F 2X09A 2XVKA 2L3DA 3QCWA 2JEMA 2NAZA 3VBUB 5FZAA 3IDCB 3OYEA 3PQJA 4JHTA 3VYSB 3H8RA 4KNYA 1SLLA 1AXYA 4P00B 2P3KA 4X0GA 3CMAI 1AU7A 1W2AX 3FLRA 5LFAA 3NO8A 4LORA 3S2WA 5F1RA 3CCRI 1DG6A 4Z82A 3S3MA 4XBNA 2X1CA 3ZYRA 1W0PA 1N47A 1P4WA 5DDJ3 3AKQA 2R7RA 1PVEA 2H1LA 3CNAA 1I39A 3WP5A 3X29B 4NPMA 1ZHFA 1IV6A 2IRFG 4R52A 3ZX7A 3HQUA 1XNKA 5E3OA 3VD3A 2CV0A 2OT7A 2A6HF 2PHFA 3KT1A 2JB4A 1PO21 2DMUA 4HF2A 1GQPA 3O12A 2K02A 3CLOA 3KPHA 3FLPA 4XM3A 4GZ9A 3HOZJ 4E8DA 2ES3A 1MJBA 1KQRA 4X1EA 2VQLA 4OYUA 1WJDA 3DXJF 2VMEA 4Q27A 4RS8A 1QWRA 3UL2A 2GOMA 1IF1A 4NRQA 1ON1A 4QPYA 4Y1XA 4YW3A 2Y6JA 3FZVA 3FFQA 1Y9QA 4Q8KA 3IWZA 3BP8A 1NY71 3I2OA 1UXXX 5DAWA 5CFCA 1I3QJ 1BHGA 5JZGC 5GKAC 2ELKA 1ZZ6A 2GZWA 2XPVA 3LFUA 1GFF2 2HOTA 5H9RA 5FLXZ 2LALA 1IZ1A 5FBZA 3FDYA 1W8NA 2JJ7A 4IQJA 5T5LA 2RMU3 3BR6A 1RUOA 2R5ZA 3GCMA 3CLPA 1MS9A 3OGJA 2M87A 1E57A 2FUG2 2KP6A 5F5AA 3VBSB 4COVA 3JSOA 1G86A 4QQPA 1YRNA 1UQXA 1DU3D 1VBD2 6PAXA 1LULA 5HLHA 1VJ2A 2C1FA 4Y1VA 4IV3C 3BIEA 4Q8LA 4HV5A 2IBDA 3J7LA 5GLUA 1RUH2 1QKQA 1KD7A 2XL7A 1SD6A 2XB6C 4IL6C 2L0KA 4WVVA 1NE6A 4F93B 1QGLA 1YFUA 4YZ4A 4DFSA 4AIDA 4EMSA 2EIJH 4AHXA 1MIJA 4R9AA 3EQEA 3PTRB 2QWWA 3ZOIA 1AL0G 5M5YJ 5APAA 1AR63 2CWMA 4X6AJ 3JCIA 3A2KA 3HM5A 2BGPA 5E89A 1ZBE1 1MPXA 2TDXA 1AR91 1BW5A 2QQVA 1Z91A 1JKPC 3VDAA 1F8VA 1R091 5E3MA 2JE7A 2PMHA 1LHOA 4BXSV 1WHUA 3HHHA 3ZMSA 1Q1VA 1RTVA 1YW7A 1O8SA 3G1LA 3L2RA 4DY5A 3N9LA 2V79A 4WF2A 3OYWB 1S29A 1BC7C 1S2KA 4YYOA 2FHRA 1QJEA 3J7YJ 4IV1A 1G3WA 3J7HA 3MUZ1 3HD8B 1LOBA 2KL4A 4OIOF 4DYRA 5FZMA 3FHQA 3BG9A 1X3WB 5FZLA 3WNPA 1JKOC 2WWJA 3E6CC 4GB32 2VG9A 3MPBA 3PM1A 2Y0MA 1O3SA 1COV3 4UNOA 2JG9C 4PFPA 5KHIA 1IXRC 4KWLA 4IEWA 4G7ZF 1CX1A 4P9XA 3KLOA 4P9IA 4QPIC 2FDGA 2FU4A 5DUUA 5FRNA 3M8FA 4YZ3A 1HB3A 2GXBA 3CEWA 1STMA 1KEXA 4JK1X 4KU8A 1ZRRA 4YRDA 5BNNC 3B69A 1IRFA 5KXDA 1G9AA 2FX0A 5FY9A 1LR5A 5F0HA 2LSOA 3W3CA 4K21A 5FZ4A 5DN2A 4EWDA 4RQPA 1PK6B 3N4MA 4V2GA 1XGMA 1ZQ3P 4CP9A 1R71A 4Q0QA 1TME3 2VUAA 1VBD3 1ND2A 4L0ZB 4IEUA 5F7UA 2BEOA 1QHGA 5IHRA 2XUBA 4XF1A 1IPJA 2DAOA 3U4SA 1FPN1 4Y3OA 3WP6A 1ZR2A 3BKZA 1TVGA 1SPPA 3K2OA 4P96A 2CW0F 4ZTFA 2A6YA 2PN6A 2DFHA 4G7OF 1W6OA 2VPVA 3BOPA 2PFBA 1R092 1ACIA 2KDOA 2CV2A 2DDAA 2IJLA 2XUEA 3U21A 1ZTRA 1YTYA 4ZDOA 2ZXHA 2QJVA 3CJTB 1W9TA 5H9QA 1YLFA 5J3UA 3WUDA 1S55A 3J7AY 2DMTA 4BLJA 3LEMA 3GJBA 1HBXG 4Y24A 1D7PM 3KGZA 3THTA 4C3IJ 4N7IA 3WOGA 4QHBA 3IAS2 1F35A 3C3VA 4IEYA 1YQ6A 5EYYA 2VODA 1UY2A 3LPFA 3F22A 3AYCA 4U36A 3BODA 2GIZA 1HQWA 4Y1YA 4QPWA 2R072 4BXFA 1I1SA 2M3AA 2VJJA 4I7HA 3E5QA 4FQZA 5LGTA 4H2AA 1ENXA 3VUOA 5IK7A 2J1AA 5HLGA 4B47A 1WZ2A 1FY7A 2VBPA 1PNGA 1W6PB 4GMP0 2FEZA 4BIOA 1VP6A 1JUPA 2X5IA 3HGYA 1U12A 2RS11