3RYPA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Catabolite gene activator
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rypA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rypA01
3BWGA 2FQPA 2VE8A 1MD0A 1DDNA 1Y9QA 1O3SA 4MGIE 5I0UA 1LB2A 5TJJA 2Y0MA 4RB0A 2GC0A 5HI0A 2MH9A 1GVJA 3WU0A 1YWKA 2VOPA 4RAZA 5DYMA 2ZBKA 4BYYA 1OPCA 2A69F 1IRFA 3RI4A 5A2QZ 3EETA 4WXCA 2AS5F 3I4PA 4YFKF 3HQXA 3QRFF 3FMRA 2CG4A 5FFXA 1SQ4A 3L2CA 1U5TC 2ISYA 1IXRC 2OAZA 1MKMA 3IRRA 4QGMA 3E5UA 1BJAA 1XMAA 4M74A 4WK8F 3CUOA 5LLQA 2HZTA 1K6OA 3RNSA 4BH9A 4PIXA 4Q0SA 4KWKA 1MJ9A 2QQAA 3F8FA 2DBBA 3WW3A 1P6RA 1CF7A 3KP7A 3SXWA 1FYKA 2CGPA 1R58A 3KP2A 4IF4A 2DFIA 1RL3A 4K2EA 1YS6A 2VXZA 2F2EA 2MHFA 4AIHA 1ZREA 4HX7A 3PNAA 4YFNF 2FA5A 2JZYA 3IWFA 2EWNA 2CSOA 2PAMA 1VTNC 3ZMDA 2M1BA 1Q43A 1DUXC 5C8WA 3RYRA 4X6QB 3WTTC 3BDDA 5E8GA 2PLYA 1ZARA 5D5WB 2DPUA 1YS7A 2P6SA 1X8EA 4XFIA 1OI6A 3KETA 1O7LA 5E1ZB 1LQ1A 1G4DA 3L2HA 5AONA 3SHRA 2RNJA 4WVZA 2O0YA 3MZHA 1I5ZA 3BALA 2FOKA 1KU2A 4LEJA 3I7DA 4U7DA 4P9UA 3L09A 3OGJA 4LB6B 2FBIA 1J7KA 4Y15A 5HLGA 3U10A 2MPFA 4KU8A 3K69A 5LRRA 2QVOA 3H3UA 2K4JA 1YYVA 4EROA 3J7AO 1WWXA 1BC7C 4LLNA 3TDZC 3RKYA 4E70A 1F1ZA 3R0AA 1CAUA 3FF5A 2K27A 2QDRA 2D40A 4M6YA 1YW7A 2FNPA 1O7FA 1XSVA 1XD7A 2Q0OA 3UKNA 5BV6A 4YYOA 2ETHA 1FSEA 4LLOA 1JXSA 3WTUC 2PEXA 1TW3A 4YIIA 1WQ2A 2FMLA 1ON1A 2K0GA 1EH6A 4N9IA 3AAFA 3KGLA 1QNTA 4RGXA 5ICFA 4RGRA 4YRDA 2K9ZA 2RV8A 4NVPA 4TLFA 2XAFA 1IN4A 1D8KA 2W24A 1B1BA 1VJ2A 4KIFA 3WU1B 1O3RA 1FSHA 1XGMA 5AIQA 4EJUA 1K78A 1BIAA 1QWRA 2G7HA 5F64A 2DPDA 5ILSA 1RIOH 3GUDA 4EM2A 2KIUA 3H92A 4IEZA 2B8MA 2X0LA 2IVMA 2VBWA 3K1PA 1QXRA 1FY7A 2D5FA 4IEQA 1UIKA 3DFGA 2QYOA 4YNIA 3LA2A 4U0WA 1FPQA 1KYWA 2LNBA 3IDCB 2D45A 4ON0A 4RD7A 1NXMA 1LDDA 4HQEA 1HKQA 3IKVA 2QJVA 2PI0A 3BB6A 5AIPA 3LWFA 2K4BA 4Z2YA 2HYGD 4I7HA 3NW4A 5ILVA 5DD4A 2D1VA 2XKOA 3F21A 2Z33A 1CGPA 3EYYA 5I93A 2QENA 2W57A 2V1XA 3M3IA 5ED4A 2MC3A 4ZZDA 5KHKA 4IHSA 2P7CB 4PDKA 3LSTA 2UYAA 2VQAA 2PHDA 3BJOA 1ZG1A 2GC1A 4IEXA 3SCFA 3J81K 4L0YB 2RN7A 1IW7F 2QUFA 1ONVA 2Q30A 1WRJA 2CYYA 5D4RA 4FHTA 2DQLA 4G7OF 1O57A 3F8BA 1IF1A 4R8HA 2P8TA 3GFLA 4WBBA 1SFXA 3NJZA 3U11A 3LA3A 1G3TA 4IETA 2VPVA 4UV8A 2ZKZA 4MNUA 2QLZA 3V8JA 3NL1A 4LA3A 3GLXA 5L3CA 1RUNA 2P6TA 4G9YA 1XE8A 4PGGA 3QAHA 3QP6A 1GQHA 2K86A 4EJVA 3CJXA 2FQ3A 3R0JA 5HS9A 3SZPA 2W25A 5J3UA 4HQMA 3GFIA 3W6JB 2BBYA 4U7BA 4E2GA 2PTMA 1B9NA 2QZ8A 5LEJA 1L3JA 2CAUA 1U5TB 1YFHA 1OR7A 3ZMVA 2XVCA 2H6CA 3K0LA 5FCCA 2XROA 2HEOA 1FLIA 2ZJ2A 2XGXA 4GO1A 1GHCA 3WTZA 2H09A 3E6CC 4HSLA 4PJYA 1XSDA 4H7LA 1J3QA 2HQRA 1K7AA 1XRUA 3D5LA 1X82A 2RVCA 5CVVA 3K1MA 1DZTA 4MV2A 3GVAA 2HTJA 3M8EA 3V7SA 4A6DA 2Y0OA 3SCHA 2D5HA 1H0MA 1KQ9A 4M9XA 5CVIA 1TNSA 4G6DA 3Q9VA 2FMYA 1QO0D 3U0ZA 3D0JA 1D8JA 4I98B 3WG9A 1G3YA 3CUQC 3FXQA 3WODF 2HJIA 2P5KA 3FFQA 1T98A 4LG0A 1MJAA 2OA4A 4HZFA 4HX4A 1SEFA 3ZN1A 4JV4A 4L11A 4KICA 2YU3A 2DTRA 1TTYA 4KNYA 3KGZA 4M9SA 2UXXA 1I27A 3I5UA 2O8XA 3KCCA 1FX7A 2VONA 3ZPLA 4EWAA 1FNNA 3KP6A 6PAXA 3GX4X 2NRAC 3OV8A 5DUKA 3C18A 2GH2A 2EA4A 1U12A 3OOPA 4R1HA 4UVBA 2HFHA 2IP2A 4U88A 1Z1DA 2VC0A 2Q8KA 2DW4A 3WW2A 1R22A 1RGSA 3I54A 2DT5A 3CEWA 1XMKA 2FE3A 3MDPA 1NE4A 4BHPA 3WTYC 2ISZA 1HSTA 1S6LA 1SD7A 2Q1ZB 4RAYA 1J58A 1BI0A 1FI2A 2F4PA 2V1DA 5BPXA 4F7ZA 4XETA 4HF2A 2OA2A 4O9GA 1ZG3A 1GXPA 3WE2A 2ZNZA 2JTVA 2CO5A 4IRGA 3TNPB 3ML6A 1YQAA 1MDMB 3KZZA 2BYVE 2GA1A 2WV0A 1Z6RA 1B4AA 2STWA 1LEBA 3H7YA 2Q4SA 5H6RA 4B8XA 3PLQA 3Q9SA 3KE2A 2PJPA 1EPZA 1SMTA 1I1GA 1ZGJA 4PGHA 1G6NA 2A07F 1RNLA 2L4AA 3I53A 4HV6A 1XDUA 3BPZA 3J81Z 1LNWA 1LVAA 4LG0B 1FBUA 4YSFA 1UHWA 4OMZA 3I58A 4KFCA 2VECA 2ADUA 5CYVA 1LKNA 4QGNA 3CTAA 4HF0A 3DEUA 1X7NA 4L9NA 5C6CA 4E2QA 4MQ9F 4DQ2A 3KLOA 1R1UA 3DN7A 1UFMA 5HOOA 3USSA 1ZN2A 2VBZA 2GA2A 3LAPA 4ZU7A 2QWWA 3IWZA 1CAXB 4EM0B 2R3SA 4HVOA 2L3DA 5JCTA 5E8IA 2FEZA 5JAXA 1F5TA 3ZMUA 2BEOA 3ZMZA 4L18B 2DI3A 4I2OA 2WC2A 2QCSB 2NS0A 3ZQ7A 1EYBA 2IJLA 1E17A 3SZTA 4WX9A 1LEAA 3TO6A 1XSXA 4CO8A 3MYXA 4HV5A 3ACLA 3IHUA 1ZRCA 2P7VB 4FX0A 3QACA 2VN2A 2IA2A 1IPJA 4LA2A 4BHBA 4IEYA 5DUIA 4MH0E 4IHTA 2O61A 1JE8A 2HWVA 2EV6A 3CUQA 3ULQB 4Z07A 5LHIA 5HDNA 1EH7A 1GQGA 3EBRA 3BY6A 1ULYA 2R7FA 4AIJA 4CDGA 5BS6A 1VR3A 4LFUA 5CU1A 3B02A 3GO5A 4L9VA 1OMIA 2PQ8A 1MDMA 2FRHA 3HRMA 2DU9A 1FXZA 4QX5A 4OFGA 3FE5A 5E1WA 4CHUA 3G73A 3DP7A 4XF4A 3BJ6A 1J3RA 1ZZ6A 4RGSA 3F22A 5K5OA 3GZ5A 3JW4A 5DV5A 5JVTA 4BQAA 5D5XB 1DGRA 3S7EA 4BIFA 2O3FA 1Q1HA 5F1RA 1JUHA 1YHFA 3GFMA 1KQ8A 3RJPA 3WGHA 1EP0A 5JI6A 3WTSC 2COMA 1MJBA 3BZ6A 2L01A 2NAZA 4MZUA 2IC1A 4D7TA 5KHGA 2Z99A 1HW1A 4HF1A 5JSPA 5JFRA 2FBKA 3C1DA 3NQOA 4IRIA 2KXLA 1BI1A 4P55A 5LGUA 5L3FA 3F23A 1XN7A 2V6CA 2EAAA 1S8NA 2EFWA 1CX4A 1CAVA 3CL1A 4XFCA 2GIVA 3RPQA 2GZWA 2F5FA 5KK1A 3U9GA 1KQ0A 4QWQA 3H8UA 4IXAA 1SFEA 3WE3A 1QQIA 2O8QA 2J5OA 3T5XA 3HT2A 2EVXA 5FDBA 2PMUA 3DF8A 4Q0VA 5J6XA 3KEQA 3L00A 4KT5C 4XF3A 4ESJA 3BPXA 4A5NA 4Q0QA 1UD1A 3F8MA 2WTEA 3HSRA 1NYWA 4A0YA 3JAMZ 4GYGA 4XF9A 1IN5A 3QU6A 2PA7A 2EFPA 4GGGA 3EYIA 2M8EA 2M30A 1FBQA 4HLYA 2M87A 2KJCA 1V70A 2W85A 2BGCA 5FLHA 4M73A 5FQ0B 2P4WA 1NE6A 4KN7X 4OIPF 5JR3A 4JTOA 4FAHA 3ZN0A 3IKTA 4UVCA 3IC7A 5JR7B 1LDJA 1TQ5A 1HSJA 1R5HA 3L9FA 3I59A 4HYEA 2XV4S 3KP5A 1U3EM 1EV7A 3VFZA 1YFWA 5DCMB 3WTXC 4O3MA 1ON2A 4GCVA 5LHGA 2GC2A 1EH8A 3FM5A 3HTUA 4HA8A 2XHKA 2ZKLA 4ONUA 2DQRA 1KU7A 1IN8A 3E97A 5E18F 2LF8A 3WGIA 2GC3A 4ZYEA 4K8FA 2GWRA 1YFXA 3ERED 1FC3A 4ZH4F 1IXSB 1R7JA 1HKSA 2UY9A 3BP8A 4F8AA 4XLPF 2DCTA 4J1WA 1S7AA 4XLNF 4ENNA 1YUDA 5HDGA 3V7CA 2O6GE 4KWJA 3ST7A 3FX3A 1O4TA 1RUOA 5L3GA 4HN1A 5D4SA 4EMSA 4ZZLA 1ZH5A 3DL3A 4GULA 1S7OA 4P96A 3FHIB 4M6XA 1FZPB 1KU3A 3WTWC 2Z69A 3OF1A 4PZJA 5EEHA 1TQMA 2EFNA 1W5TA 1W5SA 5K8SA 4YG2F 1BBYA 3M1EA 4HX8A 3RZZA 1WKMA 3HSFA 4ORFA 3N4MA 3KFWX 4DNCA 1FP1D 5CLSA 5DEQA 1XE7A 3EUHA 1T39A 1ZRRA 4Z82A 1EY2A 2ZNYA 2BV6A 2XAJA 2CV6A 3DPLC 4IRHA 1YFUA 1SD5A 2ZO4A 5CVJA 2EA7A 2H27A 1Z91A 3V8KA 2XASA 1ZZBA 2HGCA 5HVQC 3M70A 1XGSA 2MH2A 3MCZA 2BNNA 3VEPA 5DCMA 2G9WA 2IA1A 2XL7A 4IEOA 1IUYA 5F6FA 1P4XA 1UCXA 1DPRA 3S2WA 3T8TA 4EJOA 2Z2SB 4OLLA 3ECHA 2XL9A 2NYXA 2IPQX 1CAWA 4WF2A 1PP8F 2H0VA 2IXHA 4WXDA 3N97A 1LJ9A 1TQPA 4LB5A 2OQGA 5I0RA 4CYDA 3H1WA 1QBJA 2ELHA 4AVPA 5BMZA 2OZJA 1U5TA 3M7GA 2MLGA 4GYIA 1SFUA 4D0PA 5JSOA 3HT1A 4PIZA 3R4KA 1QY4A 3G3ZA 5I8TA 4XRFA 2L4MA 3G7DA 2QM3A 4KU7A 3ZDSA 1R36A 4OIOF 4A12A 1B6AA 1DP7P 2FBHA 4HMZA 1FBSA 2XKPA 3MQ0A 4I0AA 2LKPA 2RC4A 3JTGA 4HSJA 3UKTA 4A2UA 1IXCA 1J1LA 3H50A 4Y17A 1S29A 5E20A 1Y0UA 2QBYB 1U2WA 2HKXA 1YLFA 2JPCA 1UPIA 1HW5A 2ZMEA 2IRFG 2IXLA 2X4HA 4LTAA 2ESHA 2Z3YA 2FNAA 5L3BA 2OZUA 4UXNA 4MTDA 3LQQA 4M71A 1HBXG 5IT9K 2PHLA 4AQ6A 3ELKA 4G7HF 1NZCA 4ENMA 2IT0A 1G3WA 4TV7A 1TNTA 2MNGA 3W6KB 4JVAA 3D0SA 2CFXA 4I02A 4QM8A 3O2PE 5I0SA 4WWCA 1WI9A 1PMIA 4RB2C 4U0YA 4U0VA 1TQIA 4HN0A 1LRHA 2KKOA 4LMYA 3NVCA 1H9TA 2O03A 1ZX5A 3CUQB 2XLFA 4EVIA 3I0TA 4QXKA 3S7IA 2ET7A 3FJSA 3I71A 5D8LB 4Q48A 3DQVC 1U6GA 3WW1A 5D8KB 4UV9A 4QGLA 1FT9A 5DCFA 4BXUA 2Y75A 3S0MA 3HRTA 4XF0A 4ZYGA 4OMYA 2GQQA 3FZ3A 3DV8A 1ZZ8A 3DPTA 1CAUB 5D1IA 3PQJA 1YO5C 3M8FA 5IT3A 3KSCA 2A61A 3U2RA 4KWLA 3HOSA 3JAMK 4EM1A 3L7WA 1S3JA 5KBFA 2GAUA 2DAOA 3QOPA 5KVRA 1XGOA 3DKWA 1Z7UA 2HQNA 1T0FA 2AXLA 1ZG5A 5LRSA 5BY5A 3P7NA 1YLLA 3HRSA 1ZRDA 2M5WA 3F8CA 3H1MA 3JSPA 4KUMA 1REPC 1PUEE 3RKWA 3QP5A 4IEWA 2UYBA 4L9TA 2RGVA 3FXRA 4KMFA 2EFQA 2PG4A 1CAVB 4WZCA 1J2XA 3J80Z 2HOEA 4G94A 4LD5A 4FAGA 4EV0A 5BPIA 4NHJA 2D1HA 4QLCU 4LK1F 4HVRA 4XF1A 2UY8A 3ZMSA 1ZVFA 4KIGA 3VOEA 3E6DA 4LJZF 1SD4A 3BU7A 5EZWA 1B9MA 1O5UA 4UNOA 2HR3A 3EJKA 3OCPA 4IEVA 1FYLA 1I6XA 3D82A 1LDKB 4LGWA 3ETQA 2OPKA 3FHZA 4EWDA 4RGUA 1V4RA 5DDGA 3MFKA 3IRQA 4L5JA 5LGNA 5K5QA 1T38A 2ESNA 3E6BA 3TOAA 4AXOA 2XAGA 4O9EA 4KN4X 2V09A 5H6QA 4KYWA 1UB9A 3SQNA 1O5LA 1KYZA 3GF2A 4BNCA 4H0EA 2IXCA 4JQFA 4ETSA 4AIKA 1ZNPA 3E6MA 4G8XA 4MEXF 2F5DA 5AVPA 2LSOA 3MPBA 4YFXF 4XFGA 1USTA 1U78A 4IESA 1D3YA 5E16A 2OZ6A 1SFNA 1WLTA 2D2WA 1U8RA 5I0TA 4MGKE 3WW4A 4MGRA 4EJWA 4BHCA 1H1IA 3GYHX 4R52A 4HBLA 3E3VA 3IIAA 5J48A 4KA4A 2HDCA 1MGTA 4MUVA 5FGMA 3HSEA 1OFNA 3CLOA 3CJNA 4Q0UA 4O5VA 3ES4A 4A6EA 4BAYA 3NRVA 4L0ZB 5IT9Z 1YW9A 5JSRA 4DINB 3LWCA 1PM7A 4IEPA 4ZU5A 3ZMTA 4Q47A 4L9JA 1YW8A 4HW0A 1HW2A 4Q0PA 5I8SA 4MTEA 5FLIA 2BE5F 2MA3A 1QZYA 5BUVA 3I59B 4NB5A 2MD5A 3HHGA 5J7MA 3DXJF 5TRDA 1DGWA 4OU0A 4HDUA 2E7XA 2E1CA 1Z6TA 2E9QA 1QXJA 2IW5A 4HOBA 2ETEA 5D5VB 5EEGA 2PAEA 5E1RA 3R61A 1O3QA 1F9NA 2KJBA 4D7SA 1W7PD 2I45A 3MAJA 4AWXB 3SHFA 2A6EF 3ABTA 1ZZ7A 1YFYA 2ZFWA 1T6SA 3RKXA 4N0BA 1W4MA 2KIMA 1BI2A 3HUGA 1CF7B 4RB3C 2Z5UA 4ESFA 2OYZA 3IBMA 4LULA 3HOTA 1A04A 3VHRA 5BOXA 2Q0AA 3K9TA 4HVQA 1FWZA 4ENJA 2GU9A 4KIBA 4S05A 3H9AA 1E2XA 1D5VA 3LZZA 3IL2A 3TO9A 3GXOA 1J5YA 2Q2EA 3CF6E 3CO2A 2VT2A 4RS8A 4EGYA 1RC6A 4ZU4A 1OYYA 3KP3A 2VOOA 5FO5A 3SXYA 3FMQA 1YG2A 2RDPA 4MHGA 4P9FA 2P5LC 2TDXA 3PFIA 1OKRA 4G7ZF 1KGSA 1ZHFA 2D93A 2C0ZA 2E7WA 3P9IA 3GW2A 2XIGA 2OBPA 3LOIA 4B29A 1DZRA 2ET1A 1USSA 2QQBA 2CQKA 3P9CA 5FPZA 2E1NA 1G3SA 1ZRFA 4R79A 2YPRA 3BOQA 3LQRA 4JTNA 5HS7A 2EB7A 1PDNC 2IA0A 4EJTA 3F8NA 3KZYA 1V3FA 5CVUA 1SMYF 1P2FA 1P92A 2KRFA 5BPDA 2W84A 5BXXA 3TOBA 2R7DA 4AVAA 1VP6A 3SCGA 3KLNA 4Y13A 5I91A 3I64A 2OU2A 4I01A 2V79A 5E17F 2EK5A 3RPUA 3FWEA 2A68F 1MZBA 3O14A 2QVSB 1H1MA 4QM9A 1YTYA 2FU4A 1X3UA 2JT1A 1XCBA 3CDHA 4FBFA 1BI3A 4P5OA 5KHJA 3FMSA 1XB4A 4M72A 3REOA 1CAXA 5EFUA 4IEUA 4QMAA 2MLKA 1J75A 3QPTA 1ZZCA 5D6FA 1TLHB 3U1DA 3T1BA 5ICCA 4XFAA 1W7PB 4Q5SF 2PBIA 2VBYA 5FQ0A 5FLXZ 3BROA 1RTVA 5FPXA 1CAWB 3HTSB 1ZZ9A 3C7JA 3PVBB 4OIRF 1O3TA 3ISPA 4PIYA 3VB2A 2KIFA 4YIFA 1IAWA 2PQQA 1FOKA 2JRTA 3ZP5A 4META 1F4KA 4CICA 2L02A 3RYKA 4J1XA 3LAGA 4HAMA 5CJ9A 5CVRA 5LEKA 1Z9CA 1STZA 4LUMA 2XUBA 3TKYA 2B0LA 2DK8A 3F3XA 4B09A 2STTA 3EQEA 3HRUA 5KHIA 5CADA 3CLPA 4G6QA 1OYWA 3RDIA 1L3LA 4LLGF 4OOIA 1LR5A 1X8MA 4IPAA 5ICEA 3R60A 2ATFA 3ROUA 2NNNA 2UWMA 4WCGA 1KA8A 2C6YA 1JGSA 1YIOA 4CXFA 3LA7A 3TO7A 4HLTA 3RTRA 5KHHA 5K1YA 4CZZA 3EQLF 4UBGA 3J80K 1R00A 2LDUA 3C3WA 5D6EA 4XEZA 4ZYDA 3KMHA 4KMUX 5FLXK 3P9KA 1UIJA 4N9HA 1R1TA 3JSOA 3K2ZA 4I09A 1PP7U 3TGNA 3K1NA 3GWZA 3GBFA 3V7RA 2IXIA 3CO7C 3HIFA 1QGPA 5L3EA 2FF4A 1IZ1A 4EWEA 2DLLA 1H9GA 2YX4A 4MEYF 3BJAA 3ABUA 3FM3A 2EJRA 4IJAA 2XLAA 1UCRA 5HLIA 2N7GA 1GXQA 5D5UB 2EA2A 1JHHA 3TDUC 4UHTA 4E2SA 3GEZA 3NSTA 1T2KA 2XRNA 3IDBB 4HDVA 5H20A 4MGZE 3JZVA 4FT8A 1TW2A 5BQTA 3OD0A 2VBXA 3F6OA 3WTVC 2ZMEB 2B5HA 4LK0F 5E1XA 1RZ4A 2WFPA 1Q3EA 5T3NA 2OQRA 3E5XA 1SD6A 5FD5A 1ODDA 3UKVA 2QNKA 1UW8A 2PFWA 2P17A 4WXHA 1ZYRF 3JTHA 5FFZA 4L2NA 1IN7A 4XSXF 2RKHA 2O1QA 5FLJA 5ERIA 2F5CA 5LHHA 4NQWA 1BC8C 4AD9A 4P9GA 3RIRA 2F5EA 3NKTA 2BNMA 4AVBA 1HQCA 1NHAA 1B59A 1XGNA 2K7LA 4O6JA 3H1YA 2IXKA 2V1UA 2A6HF 1WSUA 3KEOA 1K79A 4OIQF 1UHMA 2HS5A 4KDPA 1I1SA 4ASNA 3LFKA 1QPMA 1BIBA 2QQ9A 2Z9OA 3H7JA 4M9ZA 2IXJA 2V9VA 1Q5OA 5LGTA 1WA4A 4A5MA 2K02A 1OYIA 3H3ZA 4L5IA 5J8CA 1HKTA 2DO7A 2H6BA 5HS8A 1Y3TA 3T0YA 3QU3A 1SAXA 2A3SA 1Z05A 2FSWA 5HLHA 4EGZA 4X6RB 3SMHA 5A2QK 4ESBA 1W7PA 2CAVA 5FD6A 2EV5A 3SFZA 5LBQA 2ZXJA 1AWCA 2PMHA 2UZKA 4IERA 3TQNA 4EQQA 2ACJA 2WWYA 1J3PA 4UBHA 5K5RA 1JHFA 2JSCA 3PQKA 3R6SA 5J8FA 3CO6C 1IPKA 3BCWA 4MX3A 3F6VA 1BN5A 4RB1A 2PAKA 1L0OC 1FYMA 2VC1A 2PYTA 2HYFA 4LLLA 3MWMA 4GXOA 2ZCWA 3V4GA 3WGGA 1DPUA 2GXBA 5HDKA 1QZZA 2A5YB 3E5QA 1IRGA 2L54A 4CGZA 3V8LA 2B9UA 3EDPA 2P5VA 2XLGA 3OTFA 4PCQA 1J0RA 2FXAA 2HKOA 1OD5A 3GFJA 4YARA 4UUVA 3MEXA 4KL1A 2VODA 4I0BA 2XAQA 1AOYA 1ZLJA 4HBNA 1HXDA 3B73A 3M9AA 2YX7A 5FB2A 1K78B 3QPHA 2M45A 1BM9A 2MBFA 1XDSA 3FXUA 3Q5FA 3COAC 1ZLKA 3EHKA 3O6BB 1J59A 3ELNA 5DD8A 1R5GA 1RI7A 3RYPA 4Q29A 3NEUA 3GYDA 4S04A 2PFBA 3T8RA 3F72A 4A0XA 4A0ZA 1WGPA 3TNQA 2LF7A 3C3VA 1R23A 4JK1X 2VT3A 4ZYHA 4ENKA 2Y48A 3KP4A 2PN6A 1XCVA 1J9IA 2EFOA 4Q4ZF 5ILUA 4XFFA 1TBXA 4UXAA 5ICGA 3GZ6A 2YSRA 2GXGA 4HLXA 3ES1A 2G7UA 4XFHA 1P4AA 2BNOA 4AQ2A 1ZGAA 3LAJA 1R1VA 3MZYA 4XBFA 2CWEA 2H94A 4XFBA 2NNYA 2HTSA 2UXNA 4UVAA 4OINF 4FX4A 2RQPA 3BPVA 4IVNA 2OD5A 4MGYE 2XAHA 1BOAA 4XSZF 2QBYA 2DK5A 3VODA 3O3KA 1P4WA 1ZAOA 5L3DA 2CW0F 4JBAA 2VE9A 3EO6A 3FZVA 2J5PA 1FP2A 3HHHA 2JPBA 5I8YA 3HYIA 4I3PA 3ECOA 1IN6A 2YR2A 5JHUA 2EV0A 4MQVA 4LUKA 1KU9A 1C0WA 4AVCA
chains in the Genus database with same CATH superfamily
3BWGA 3L1PA 3S1MJ 4H14A 2Y69H 2IAIA 2VPRA 1MD0A 1MS8A 5F3EA 1FPN2 3GGLA 1QIQA 2A6WA 3SITA 5EJ3A 4GIQA 2ZHNA 2VZSA 3VBUC 5EHDA 1YWKA 1OPCA 3RI4A 3EETA 4WXCA 3IH2A 4BLIA 4XJAA 5D8AB 4GWIA 2CG4A 4YM3A 2HBUA 5FFXA 3L2CA 4A42A 1PJRA 4Q1PA 4WM7C 4I76A 5F04A 1JTZX 3MKWB 2R5ZB 3IRRA 3RRDA 2D6MA 3E5UA 1YI2I 2WAQA 3PSFA 3CUOA 5LLQA 2HZTA 4BH9A 3GZNB 4PFPA 1GWMA 1PO21 4Q0SA 4KWKA 1MJ9A 4QX3A 1F31A 5IK7A 2CW7A 3IN9A 5JVVA 4XCAA 3SFIA 3RI8A 1W3XA 4WM8C 2DMNA 2CGPA 1MZ6A 3GZTB 4O7XA 4ZXKA 4LO6B 4IF4A 2R0FA 1RL3A 1X3ZB 2KLOA 4PDWB 4M4PA 1I50J 3BZKA 4AIHA 3MV11 1AKHA 3PNAA 3CCQI 2FA5A 2JZYA 2EWNA 1MPXA 3MF9A 3H0OA 2CSOA 3BG5A 5C4XJ 4A3FJ 3FK6A 4LKFA 5F3CA 3ZMDA 4WM8A 2M1BA 3OG2A 3UETA 4AQTA 1D4M2 4X6QB 2QCOA 1ULFA 3OYWA 2D6OX 4EEFG 1MMDA 1IUFA 2CUZA 4JGZC 3JR9A 2PLYA 4XVHA 4XUQA 2VM9A 3SEZA 2UWBA 1ZBE3 3ZFEB 1YS7A 2ECBA 2EXHA 1D2SA 1OI6A 3CF5F 1JYXA 1O7LA 4YGBA 1UJ8A 5E1ZB 3GBWA 3L2HA 5SV8A 5AONA 3SHRA 3A7QA 4WVZA 3RZJA 1QJX3 5C3RA 2FOKA 1LOGA 1H8TC 2XVLA 4P9UA 3L09A 3OGJA 2VTFA 1XYPA 4LB6B 3LMMA 5LBBA 1J7KA 5HLGA 1GOHA 3OYBA 2BFUS 4BQNA 5LA2A 3KPHA 1CVNA 5LRRA 1X2NA 3J7AO 4KI5M 1KJLA 3P3NA 1UY2A 1LFBA 4E7IA 3CJRB 3VYTB 3ZVXA 1L7LA 1FMWA 3R0AA 4C0BA 3T2QA 1DU3D 3I3BA 5IAVA 5FP7A 1CAUA 2ZJCA 5JOZA 3FF5A 3I2HA 3SQOA 2W7NA 3K4MA 1Y9MA 1YQCA 2FNPA 4J01A 1O7FA 2R93J 2IS1A 1XSVA 5EDNA 3N7JA 4LO5B 5CBLA 1JXSA 5FYTA 5JR2A 1TW3A 4YIIA 2AQFA 1WQ2A 2XBO3 3TOJA 1ON1A 2JB8A 4JP0A 2W82A 2YGLA 1QNTA 4RGXA 2ZZQA 2XAFA 5FY7A 1VQPI 2W24A 3LSHA 1MVQA 2VZOA 3USUB 4BM8A 2NM1A 4KIFA 1FSHA 5AIQA 2E53A 5LCWL 2DMPA 3OPWA 3GBGA 1QWRA 2LP0A 2YU9J 2P3JA 2QQPA 1JUSA 2BQPA 1K3IA 3POEA 4EM2A 2NVUB 3DBHB 4OHWA 3H92A 5L9RA 1R083 2ZEZA 5FZBA 2X0LA 3WG7H 4Z2AA 1POV1 2DU0A 1QXRA 1FY7A 5A7OA 2JECA 5C4JJ 3DFGA 1UIKA 4NO4A 2DVDA 4YNIA 4U0WA 3UT0A 3NNLA 3CDIA 4FE4A 1LE8A 2Y6KA 1UHSA 4LG3A 1NXMA 4AGRA 2DBNA 5IUQA 3PUFA 2O14A 3JRBA 5FZEA 2K4BA 4PBPA 4BQOA 3NW4A 4EJRA 4OUSA 5M5WJ 5DD4A 2M9HA 2DDBA 2HLEA 4CCJA 2QA4I 5FYMA 4E7ZA 2HU9A 1VE0A 3NWSA 2D6KA 3SDBA 3HOVJ 2NVYJ 4QKBA 3FK7A 1BZWA 3VBUB 4BE3A 5ACA3 4FQ4A 2WINB 2RN7A 5A3TA 1IW7F 1QOTA 1UQXA 3NAUA 1FMVA 5D4RA 4JHZA 4Y3OA 3CJIB 4R8HA 3S1RJ 4PF1A 4WBBA 4DZGA 3NJZA 4AFAA 2HWC1 1G3TA 4IETA 4XMAA 1UL9A 2EIKH 4XUNA 4KMQA 2QLZA 2E26A 1RUNA 1GZ9A 1F9KA 1VQ4I 4G9YA 3RWNA 1T8IA 5CFCC 2K86A 4LBKA 1YITI 3CJXA 4PJMA 5HS9A 4P02B 2LS6A 4AEMA 3H1CA 4E2GA 2H8RA 3GTGJ 4PSXA 3ZM8A 3AFGA 3ZMVA 1WZ2A 1D7PM 3UESA 1LVKA 5FCCA 3VDCA 1NY71 4MFEA 1O4XA 4YG3A 2K9QA 3W2AA 4GO1A 3E6CC 1N1TA 4CCDA 4ZXEA 3M3QA 2OUMA 1WUVA 1K7AA 4XLFA 3J7AY 3K1MA 1Q8SA 3IPVB 3GVAA 4IE5A 1H8TB 3SCHA 3VD9A 3RJ2X 4G6DA 5KXCA 1D8JA 4I98B 2A7AA 3ZYFA 3HZJA 5FPLA 3FFQA 3FKJA 2JSPA 2OA4A 3BTCA 3ASOH 5FMCA 1SEFA 1CIWA 1VBE2 1WZXA 4QQ2A 2GOMA 4KICA 1YRZA 1GV2A 2QQNA 2DTRA 1BEV2 3BG9A 4M3BA 4W6YA 5DTDA 3SH5A 4KNYA 3A22A 2F6BA 4M9SA 2UXXA 5GPCA 2NVQJ 1YJWI 5HCFA 1X1CA 2VZ1A 3T2PA 3KP6A 1W05A 3N35A 2EA4A 1U12A 2IP2A 2VMCA 1QH6A 1S2EA 1ULCA 3WW2A 3BU0A 3I54A 2DT5A 3CEWA 3HOBA 4BOWA 2ORZA 1UXXX 2FE3A 1XSRA 2VVEA 1NE4A 2WSVA 2ISZA 1S6LA 5FRAA 1Z3XA 1J58A 1T2XA 1BI0A 3G1MA 1V5FA 1YCIA 2A6ZA 4AYBN 5BPXA 1WMXA 3WE2A 1SPPA 2CO5A 3KZZA 1X50A 2BYVE 2PMWB 3J7ZI 2WV0A 1Z6RA 1GWLA 5A33B 4WVWA 1B4AA 2STWA 2VMDA 3I4MJ 2Q4SA 5IYDJ 4H55A 1YOVB 4OMDA 3AG2H 2LY2A 2PJPA 2QF7A 1SMTA 1IJWC 5KXBA 4PGHA 4BQ5A 1RNLA 3I53A 4XPVA 4RMNA 2KD7A 3BPZA 4PQ9A 2WAEA 2OTJI 2VUDA 2YBKA 4YSFA 3PVOA 2VECA 3OYMA 5CYVA 1G9CA 2K3FA 2WR9A 4DQ2A 1UMHA 4PDWA 3G4SI 3NWTA 3LDRA 3DN7A 5F2SA 4IOAF 2E60A 4IXLA 1A6QA 4FO9A 1IV6A 3JB4C 2GA2A 2V73A 5J36A 3THCA 1PIV2 2QWWA 1FV3A 1VBA2 1G8WA 2FEZA 3WU2C 3H9GA 1UYYA 1TG7A 3PUIA 2NS0A 3ZQ7A 2H1LA 1BQPA 3NV3A 4G12A 4URTA 1RETA 4Z92B 2C26A 2RM23 3IDAA 2Y31A 2IXSA 5FO7B 2WQ8A 4JX6A 3QACA 3MEPA 4OUMA 1V5GA 1W6NA 4B47A 2HWVA 1OUSA 3RS6A 4L97A 3ULQB 4YVSA 5LHIA 5HDNA 4MVTA 1EH7A 2B45X 2M2EA 2R7FA 4PFOA 2O8KA 3U21A 2E35A 1ZELA 3S16J 1OMIA 1W36D 2DU9A 3UJOA 1JZ5A 3DKYA 4QX5A 4D7NA 4OFGA 3FE5A 3AZVA 1PGL1 1OOPA 3DCQA 3CQOA 4XF4A 1X1BA 2AQEA 4PLOA 1R081 5K5OA 3JW4A 1GNYA 5F1RA 1XNKA 1JUHA 3TP3A 4FTHA 2ZXIA 1KQ8A 3T0DA 1MJBA 3BZ6A 5FRMA 4NHKA 4DYQA 3CIHA 4MZUA 1X1AA 1OOPC 1C3HA 3W9AA 1HW1A 5JSPA 5JFRA 3C1DA 4A3JJ 1BI1A 2VZPA 2V6CA 2WQZC 2WWUA 3IDEA 4D5FA 2GIVA 2GZWA 1KQ0A 3IAM2 4QPOA 4LK7A 3VSKA 2V4AA 4C2UA 3JQWA 2VKDA 1VMFA 1B8IA 5FDBA 5F32A 4QX2A 3KHCA 5J6XA 4KT5C 3VHNA 2AC1A 3CP8A 5C44J 4ESJA 2BOJA 1W03A 4A5NA 3LSEA 4Q0QA 1UD1A 3HSRA 3Q8EA 4YVWB 4GDFA 1QQP3 3GTPJ 4XQWA 1V6LA 4B48A 4A0YA 3JRHA 4GYGA 2WDBA 2UWCA 2EFPA 2AENA 2M30A 1R71A 2JG9C 4QQLA 1YJ9I 2DOFA 2M87A 1DGWX 1SCRA 1RUI3 1BLZA 2W85A 2BGCA 4AI9A 3OIPA 2P4WA 4NRPA 4KN7X 2DT6A 4BQWA 3DU6A 2ZTNA 5LA0A 1X9TA 3IKTA 2CUEA 3IC7A 3I4NJ 3M8JA 1GZCA 1AR62 2WB1N 1MBHA 4HYEA 3KP5A 1NLQA 5B1BH 1W3VA 1S7EA 3OY9A 2DBIA 2WNUB 1JT6A 3AP6A 4QU2A 2XHKA 1N1SA 1VRBA 2DQRA 4JKKA 1KU7A 1IS6A 1RESA 1SPPB 3I3DA 3WGIA 1YFXA 3IM0A 4ZH4F 1ZA4A 1IXSB 1UN1A 3ZPYA 4K1YA 3BQZA 4J1WA 1NK3P 2VNRA 1WPKA 1RUE1 3BKZA 2TUNA 5HDGA 1HDPA 2W0XA 4WV8A 1BR4A 3DWLE 3UJQA 4GMP0 4ZZLA 3ZXFA 4I6ZA 1ZH5A 3DL3A 2XF6A 4P9IA 2DT7B 5JOXA 1HA8A 1FZPB 3FHIB 3WTWC 2Z69A 3OF1A 1TWCJ 3GZEA 5EEHA 1AJOA 3ZN6A 5A3LA 3DKQA 1WLCA 5A3WA 3HKZN 2E36A 3I2FA 3PL0A 4UOJA 5FZHA 3EPZA 5GLZA 3V0AB 2EZKA 3HSFA 1RINA 3KFWX 1FP1D 3KZIC 4EE2A 3ECQA 5FKBA 3O1OA 3GHMA 5L9BA 1XPXA 1NX9A 4BB3A 2P37A 1ULOA 2VXJA 3QCWA 2HGCA 5HVQC 5DABA 4WZFA 2VUJA 3TRSB 1C28A 4BZ4A 2IA1A 3S3MA 2JB4A 3PL8A 1UMIA 4EJOA 2HDWA 3WDUA 2Z2SB 2JIJA 5L7OA 3ONQA 1QQP1 5LBEA 4OHVA 2XL9A 2KZGA 1W39A 3ZIWA 1ULGA 5C7GA 2IPQX 2H0VA 3BR1A 3LOCA 4CEYA 1CZSA 1QNYA 3SKVA 5LATA 2RS12 1QBJA 2ARAA 4RA2A 1IO2A 1WKYA 4UFHA 1SFUA 3HNMA 2Y64A 4A3LJ 2OUHA 2HVQA 3G3ZA 4I3GA 4XRFA 2QM3A 4KU7A 1FNZA 1MH4A 1R36A 1TME1 5CPRB 1JZ2A 1VBA3 1UZVA 1YQ6A 5EJCA 4HMZA 4HSJA 2LKPA 1ERDA 3UKTA 2QQJA 1J1LA 4Y17A 2XJUA 3OYIA 2QBYB 3H42B 5FYBA 1WH5A 1YLFA 3AL0C 2IRFG 4L0PA 2KDOA 1U5YA 2Z3YA 4AFMA 2X8KA 4UXNA 4MTDA 5IT9K 1HBXG 3DTIA 2R5YA 2IT0A 2WIIB 5EGOA 3W6KB 3LE0A 2Q8CA 2CFXA 3OOUA 3KZ4C 3O2PE 5BNOB 1BKZA 1PMIA 3BLYA 3SJMA 2EZIA 2ERFA 5F5CA 4U0VA 3J7YJ 3Q0VA 4HN0A 1LRHA 4XAAA 2RS32 5GLTA 2RS52 3WV6A 4XOTA 4I99C 2V9KA 1WD4A 2HYXA 3VDAA 3FJSA 3PJRA 3I71A 1OFSA 4QHBA 5D8LB 3UR3C 3VBRB 4W6WA 2DDAA 4Q48A 2QZ2A 1JHNA 3WW1A 5D8KB 2UURA 4GMP1 2ZMLA 2JVHA 2Y0SA 4ISQA 3L2VA 3KV4A 3KVBA 1VQ8I 4XRSA 1UELB 2R7EB 2O5RA 3DPTA 3WLUA 3CDZB 2VUMJ 5ANQA 4QDQA 3U4SA 3NARA 2BU9A 5FP3A 3HOSA 5A7NA 1LESA 3GMEA 2L9VA 2GAUA 5FYYA 2X5IC 4AI0A 4OI4A 5HCAA 2LKSA 1XGOA 4XCBA 4V19K 2AXLA 5LRSA 3TEYA 5BY5A 3PFYA 4B3XA 4QB1A 1ZRDA 3H1MA 2C9KA 3KT1A 3H5NA 2EFQA 4P5YA 4E4ZA 2VMIA 3HXLA 5KXEA 4EV0A 3VKLA 1RVF2 5K7PA 4RQPC 3VHPA 4QLCU 1RUJ2 4LK1F 1XQNA 3WUCA 4XF1A 1G7YA 1UY1A 1F36A 4BS9A 2VCAA 1GICA 3E6DA 4LJZF 5FBZA 2LH9A 3BU7A 1MBJA 1B9MA 2D6PA 4E4SA 1SFKA 2HR3A 1JUIA 3USUA 3PU3A 2YUEA 5HPOA 2JKBA 3D82A 4LGWA 4EWDA 4KNCA 3N7MA 1OPMA 1SLLA 4L5JA 1U5ZA 1VBC1 5FZOB 5K5QA 1T38A 1PX4A 1MVEA 2Y6GA 3MN2A 4P00B 3E6BA 3TOAA 4AXOA 5CFDB 2XAGA 1OLMA 4IHXA 4XDOA 1UB9A 1OLTA 2SBAA 5HNHA 3HEIA 1HQLA 2WKKA 5M3MJ 1HQWA 4ZS2A 3ZN6B 2IXCA 1LPQA 3HOUJ 1ZNPA 3E6MA 2Q8OA 2J1RA 1HXS2 3MPBA 2BVBA 2JKXA 1U78A 3MBWA 2VZRA 1D3YA 4NR1A 4UT5A 3MV01 5FTTC 5I0TA 3BN6A 1JS9A 2NOJB 4MGKE 2C6SA 4CDXB 3BGAA 1PK6B 4EJWA 3C7EA 1H1IA 3FHAA 1VBD1 3E3VA 3ILFA 5FFOC 2HDCA 4YGEA 2AR6A 3ASIA 1IZ3A 1NLRA 2GN7A 1VMHA 1BXHA 3THDA 4BAYA 1HXS1 4Y4YA 2Y60A 4L0ZB 1QJU3 1GMMA 4E6KG 1LAJA 4IQPA 5FZGA 5CFCB 1H6XA 1GNZA 5K4LA 3K3NA 1V5EA 5FXWA 4XYXA 4NC7A 1YC61 4IEPA 1VAKA 2JE9A 3JU9A 2R072 2HPIA 4HK8A 1XNCA 4UFLA 2W92A 1LECA 5CYYA 2Y26A 4O65A 1AYN1 4FPCA 4NB5A 5K0UC 3WNOA 3HHGA 3KLSA 1DGWA 4HDUA 1KQRA 2ETEA 4HOBA 3FFZA 4DOZA 3THTA 3MAJA 3BOPA 4DOUA 3NJVA 3ABTA 3OIOA 2BP6A 2VTXJ 1WJAA 2DMUA 4CCMA 5C4WB 1T6SA 1YI7A 2RNGA 4N0BA 1W4MA 2P6HA 1CF7B 2Z5UA 1AYN2 4RBOA 3O8HA 3IBMA 5J1YA 1RHI3 3RMXA 4BISA 1NG0A 2X48A 1U9OA 5BOXA 2VOVA 2XOMA 1FWZA 2I10A 2A6XA 3ENRA 1CQTA 1VALA 2KHMA 3AVSA 3IL2A 3TO9A 2VCBA 1J5YA 1ZR4A 2J1UA 4NN0A 2D44A 1GFF2 3K2OA 3ZMNA 1RR7A 3SXYA 2W1WA 2RDPA 5M3FJ 5HNFA 4E4DX 4MHGA 1X33A 1HB2A 5JMCA 2E7WA 3LOIA 2HQ5A 4BQ3A 1USSA 3P9CA 2GDFA 1SACA 4HPKB 4DUWA 3CZJA 3OGGA 3VBHA 3VZLA 3LQRA 1W2OA 3S93A 5FAXA 3MUZ1 2IA0A 3KZYA 3JRGA 1P92A 4Q26A 2QQOA 4CUBA 2DFHA 4K3UA 4R9BA 3TOBA 2G9FA 2VPLA 3S6PA 1VP6A 2LVSA 3IT8A 5FWEA 4Y13A 5I91A 1JYNA 3GCWA 3I64A 2OU2A 4I01A 4PCRA 5D21A 4XLHA 5E17F 3HMYA 3RPUA 2OS2A 1WW5A 1Y1VJ 3WNKA 1VB2A 1GNHA 1X3UA 2DYRH 2JT1A 4GMP3 4P1WA 5ANNA 1BI3A 2DA4A 5KHJA 5FLVA 3FMSA 4GQ7A 1K42A 4K6BA 1NAEA 2QUOA 3WF2A 4QMAA 2BY1A 1AL22 2E2HJ 1TLHB 1W28A 4FSJA 1GR3A 5ICCA 3BODA 4IUGA 1GV5A 5IP9J 3MIGA 4KJZA 1W6OB 4MG2A 3WY6A 1GUUA 3BROA 1CAWB 4IKFA 3C7JA 1O3TA 2ZMNA 3H5AA 2KIFA 4OCTA 3BI3A 3AG3H 1NOVA 4META 1RVF3 3M3CA 1F4KA 3A23A 5CZKA 3VZOA 2K3PA 4CICA 4Y7NJ 4D1QA 3HOZJ 1V6NA 3LAGA 3WQ0A 4AVZA 1HQNA 3ZXSA 1STMA 4NRMA 1GZWB 2XUBA 3KF3A 5EZGA 3AMMA 4AW7A 2R0HA 3H3LA 2DOAA 4MOAA 5CADA 1UZZA 2OXBA 2F48A 3RDIA 4LLGF 4OOIA 1SEUA 1X8MA 1KXGA 4GA9A 1H2KA 4IPAA 5ICEA 3R60A 2ATFA 2NNNA 4DZPA 2Y38A 4WCGA 1V6OA 2ARCA 3KT7A 2XBO2 3VV1A 1B35C 2WAFA 4AR2A 2E71A 4C8DA 1RUF2 3TO7A 2VTXA 3O0XA 4BGDA 3RTRA 2ZJPF 5CA6A 4PDWC 3W2WA 2X6YA 3ZXGA 4UBGA 3J80K 3C3WA 3BUCA 4V2WA 4BJTA 5D6EA 2XONA 4XEZA 1PVC3 4QPGB 3KQRA 5G04L 2GN3A 5FLXK 2VMGA 1HRV2 2F6CA 1JU3A 2WSUA 4I09A 1PP7U 3HBZA 3OSFA 4KISA 3V7RA 1XNTA 3GBFA 2P5BA 3ACHA 5L3EA 5JOYA 1OXCA 2DTZA 1CZTA 2RV9A 2YX4A 5IY5H 2BV4A 3BC8A 2GNMA 2ZOEB 4IJAA 4AVTA 2N7GA 2VJIA 4QHOA 3X2QH 5C3QA 5JPMB 1JUPA 3GEZA 3NSTA 3QBQA 3VD5A 1W0PA 1W1WE 1T2KA 5H20A 1Q8QA 4MGZE 3JZVA 4XIOA 4B8EA 5KR7A 2VBXA 4XW3A 5E1XA 1ULDA 3POSA 4UB6C 3E5XA 1LULA 5FD5A 3UKVA 2O8OA 4E7HA 1UW8A 2P17A 2E34A 1PM4A 3HGGA 5FFZA 4L2NA 1O59A 5DAPA 2F4OB 2R1BA 3O5SA 3T4VA 2RKHA 3K51A 5JVGF 5ERIA 1E3PA 4N4NB 4D6QA 1BC8C 5EEAA 1V9U3 3LPFA 5FYIA 4AVBA 5LY2A 1MZEA 1UXZA 3FISA 1SDDB 2K7LA 2A6HF 3HJRA 3HR9A 4IV3C 2Z9OA 1BIBA 4CCKA 1W8FA 1VB4A 1H2MA 3W5NA 4QXHA 1Q5OA 3I2IA 4P08A 3IV5A 1QJZA 1Y6IA 2J22A 3T4HB 3CCUI 1OH3A 1Y3TA 4JX4A 3T0YA 4CU7A 1SAXA 2FSWA 2JQ7A 4X6RB 3SMHA 3ZR6A 2OPTA 4PLMA 2M7BA 2EV5A 4N90A 2ZXJA 4QX0A 1UY3A 1OISA 3ILRA 4IERA 4EQQA 2ACJA 4DB5A 4P5HA 3WNXA 4UBHA 1ND3B 5GTIC 3AYAA 1SBEA 2J42A 4HSTA 1HN1A 4IV1A 1VBD2 1VLNA 1COV3 4MX3A 5FKNA 1BBT1 2WZ8A 4RB1A 2PAKA 1L0OC 1VMJA 2VC1A 4LKEA 3MWMA 4GXOA 3WGGA 3ZQQA 2GXBA 1HRV1 3E5QA 4CGZA 1ETKA 3VDDC 2ZMEC 3PO3J 4BQXA 4PCQA 2VQTA 1J0RA 2FXAA 4FI9A 1JOJA 2JN6A 1C8M2 3K75B 2MEV3 2NZ9A 4HETA 3I8TA 2XAQA 1JUMA 1N25A 4AUXA 5BNPA 2OTLI 1HXDA 1WJFA 3CHXA 1NCRC 3CP2A 5FB2A 3P1IA 1XDSA 3KS7A 4XQ4A 4QPGA 3COAC 5DAWA 1R4NB 2AZ5A 3GALA 3QH6A 3RYPA 4Q29A 2W9XA 5GKAC 5F7UA 1SLCA 1UKRA 1R1A2 4LORA 4JGZA 1WGPA 1NCRA 3C3VA 1QVTA 3G1LA 2H1KA 3GTQJ 3J8F1 1XCVA 4BXFA 2OT7A 1TBXA 3ZX7A 5ICGA 2VJJA 3M3YJ 3D4KA 2E5NA 3AJYA 3KYDB 1GV9A 3RPUD 4XFHA 5A3UA 1XS9A 5C5TA 3OB8A 1VRH2 3LAJA 4XJUA 3VGIA 4CCLA 2EILH 1COV1 2LFBA 2HTSA 2I74A 4EN9B 2NOGA 1CPNA 1ENHA 2LBFB 4MGYE 2XAHA 1BOAA 3ZYIB 2LUWA 3VODA 2KDZA 5L3DA 2CW0F 4JBAA 1H9PA 1FP2A 2JPBA 4BQ1A 4BXSV 3VZKA 3W6VA 5I8YA 4PHZA 1IN6A 4COYA 3J9SA 2DCYA 1LNSA 3A4UA 1D4M3 2FQPA 2VE8A 2R4GA 5EYYA 2A73B 1O3SA 4DGWB 1QMJA 4RB0A 3WUDA 3IMMA 2QQ8A 4HG2A 3S32A 3WU0A 5GPAA 2DOEA 2A69F 1IRFA 4CEWB 3CBNA 1PGL2 2AS5F 5IK8A 3MKZA 4YFKF 1EV13 3BTLA 1JJ8C 1PZ7A 1UZWA 2RM22 3BTIA 1SQ4A 2ISYA 2YXSA 4YFWA 3AG1H 4FP3A 4M74A 1XU2A 4WK8F 4D5CA 2VQGA 2KT0A 2M34A 1MACA 1K6OA 3ZPOA 2P34A 4PIXA 2P6CA 2FX0A 5BNOA 5JWPA 4ZDLA 2BHYA 1JYCA 1LOFA 2JE8A 3FHQA 2DBBA 4KBZA 2HOSA 1NT0A 4NIGA 1CF7A 2GNBA 4HKLA 1NTCA 2CMPA 3TBDA 4DYRA 4ZDPA 2E19A 4K2EA 3D5OA 1YS6A 4P9XA 2VXZA 1ENRA 4NBQA 3RZMA 2MHFA 1K4SA 4HX7A 2ZGUA 1WMEA 4XR6A 1WJEA 3RMYA 2CV2A 3VZNA 1AX0A 1VTNC 1G9FA 1HX6A 1DUXC 2AREA 5C8WA 4NIHA 2X5IB 2FZ1A 3N9NA 1SDWA 1IV8A 3OYCA 1ACIA 4A3DJ 4BDYA 5D5WB 1XSQA 1POV0 4L92A 2R062 5A1LA 1S0GA 5GM0A 2HI3A 1LUJB 4XFIA 2VW2A 4RHV2 1LHNA 2D97A 5FJKA 1I5ZA 1A8DA 4COVA 4LEJA 1NCRB 1RKWA 3I7DA 3A0HC 4Q4W2 4U7DA 5FOJB 1TME2 3EXUA 5CFDC 2PX9A 4YZ4A 4FPLA 3U10A 5F37A 2J7MA 2QVOA 3C2HA 2K4JA 4XICA 4EROA 1AR73 2HEYF 1ASJ3 1BC7C 1DQ2A 3RKYA 1H8AC 3LB9A 4A3BJ 2ZAAA 1SANA 1MEC3 4FPHA 5DQ0A 3ON7A 3IH4A 4NC8A 1IS5A 5GLWA 4WM7B 3WCSA 4Y4RA 4M6YA 2XJQA 1YW7A 1F8VA 1T08B 5C3EJ 2IGNA 3NKGA 3ZR8X 4YYOA 3D5RC 4JDNA 2ETHA 4LLOA 3WT3A 4CXXA 1W8ZA 4N9IA 1FOD3 3AAFA 3J4UH 4CH7A 1RITA 4RGRA 4YRDA 4E9KA 2RV8A 1RUF1 2LRDA 4TLFA 3LSMA 4HANA 3H9JA 1IN4A 4RR3B 3WP6A 1OH4A 1W5CC 1VJ2A 1RMU2 3OYEA 3PJYA 1RIOH 3VWBA 2KIUA 2L2OA 1OQ1A 2CFOA 3PIGA 4JGYC 2VBWA 3G1OA 4B3NA 3DPRA 2D5FA 4IEQA 2PHTA 4WVMA 2QYOA 2I5UA 2JMWA 1JI6A 1OC1A 3KV6A 2CTVA 1FPQA 2LNBA 2K9SA 4CSWA 5LK5A 4G4FA 4HQEA 3IKVA 2QJVA 5AIPA 1UOFA 2VMHA 3LSIA 4XK4A 2WB1A 4Z2YA 4XQFA 3F21A 2WY7Q 3WDXA 1HRI2 1KGYA 4EQVA 3M3IA 5DDJ3 2MC3A 2IGOA 4PDKA 3VL9A 2UYAA 1MMAA 1AVBA 4Q27A 3BJOA 3FXMA 2GC1A 3SCFA 2WV1A 3J81K 2PHFA 2WZR3 3NNJA 1MNMC 2QUFA 1LCLA 3PUQA 4YM0A 3GDBA 4FHTA 3VDBA 1O57A 4BQYA 3KYCB 1IF1A 3GFLA 3GTOJ 5EIYB 1SFXA 3LA3A 2DV9A 3D6EA 4UV8A 4MNUA 1R64A 4UFMA 1OCZH 2VI6A 1PK6A 2R071 4XURA 3AMHA 1GQHA 4EJVA 1WLDA 2VXDA 1QQP2 2KM2A 3WD5A 1CPMA 3R0JA 3MFAA 1YX5A 2EIDA 1B9NA 2QZ8A 5LEJA 1L3JA 2F4IA 2OPWA 5DUUA 4SLIA 4AZZA 1GOGA 3CCVI 1OR7A 2XVCA 4E7SA 3FXOA 1YQ2A 5A6QA 2BW3A 1DLCA 1W6NB 2HEOA 1B35A 3MHZA 2WQ4A 2UWAA 1AKHB 1E5RA 3VYUB 2H09A 4C3IJ 4UI9L 1J3QA 4TYSA 3JRCA 1F4HA 4LOCA 1XRUA 3D5LA 2WAOA 2YBPA 4X1EA 5F0CA 2WYFA 2VJXA 1ENSA 2JA5J 4MV2A 3IIIA 3M8EA 4JKMA 4ABZA 1N1VA 3V7SA 2WO3A 4NWWA 5A3MA 2W87A 1JTXA 1H0MA 2Y30A 1XNBA 1KQ9A 1HLCA 2R7OA 3BR6A 4FP2A 1BL0A 3WG9A 1W2AX 1QJX2 1Q8PA 1W6OA 2XMLA 3FXQA 3L2QA 2NS8A 1AL23 2P5KA 1T98A 4W6XA 4LG0A 5F1JA 1MJAA 4FOWA 3ZMOA 4JDOA 1WBFA 3C2UA 4HZFA 5J47A 4B44A 1RRJA 1D4M1 4L11A 1DGLA 3BIEA 2ES3A 3FXJA 3VBOC 2YU3A 1BR1A 3MLKA 1NA1C 5FY9A 4PI0A 3KGZA 1LEMA 3OYFA 5EG0A 2A6TA 1G9DA 1I27A 3KCCA 2VONA 3ZPLA 2NRAC 4YM2A 3OV8A 5DUKA 2GH2A 4HNVA 4RM2A 4YW2A 3OOPA 4ZZ8A 2HFHA 1H4GA 1EUUA 1OHFA 4F52A 3K77A 1NA1A 2DW4A 1R22A 3J26N 1ZM1A 4OHYA 4Q4X3 4CP0A 1N75A 1BEV1 4DS0A 2FDJA 5J1XA 4BHPA 5IT6A 3U1XA 1HSTA 1SD7A 2Q1ZB 3NV4A 1JODA 3W20A 2LALA 1WI3A 4F7ZA 4XETA 1ZG3A 2W94A 5GALA 2ZNZA 1DQ1A 4IRGA 3Q0WA 1MDMB 4CDQC 1H8VA 2GA1A 3P5BA 1QF3A 3ZR5A 3QLQA 3V64A 1SHWB 2XGCA 3H7YA 2BDRA 4NHLA 1G8XA 3KB5A 2FDKA 3PTYA 1D1CA 3H36A 1DQUA 2WN2A 4HV6A 1AL21 1XDUA 3J81Z 4INDA 3AKPA 4XAEA 5E8AA 1UHWA 4OMZA 4XBLA 2E2IJ 5CIRA 3I58A 2HWF1 3VBFA 4N4OB 5CFCA 1LKNA 2BVLA 3DEUA 2DWRA 5FKKA 4MQ9F 3KLOA 4RAFA 4OHZA 1R1UA 4XJ8A 1HKDA 3S15J 2XHNA 4CCEA 5HOOA 3USSA 1WVRA 3LAPA 4LITA 3CCJI 1JT0A 3AB0A 4YW6A 4LNVA 3WNLA 5LY1A 4HVOA 4A6SA 3HKZA 5JCTA 5E8IA 1W6MB 5EF6A 2WNVB 3N9MA 1KS5A 3BTZA 1F5TA 1N3QA 3IZOA 2BEOA 3ZMZA 3OYJA 3FXKA 1OCPA 2WC2A 1LEAA 2IBDA 4ZTFA 2FD5A 2L7MP 1X4OA 3MYXA 4HV5A 1Z7LA 3IHUA 4FX0A 1WCDJ 2IA2A 1IPJA 1HXS3 3R0RA 4BHBA 4MH0E 1XYOA 5J40A 3CCYA 3RZLA 1AR82 4Z07A 1SAUA 3M1CA 2VJ4A 1GQGA 1Y9GA 5BS6A 4LFUA 4IV3B 5JIAA 3B02A 1MDMA 2FRHA 2L0KA 3HRMA 5JLVA 3ZKYA 3QH7A 5FO9B 1RXGA 3K7AJ 2ZGTA 2FDIA 4CHUA 1IOAA 2QKLB 1PZ9A 4EN7B 1TP4A 5FYHA 1N3OA 5IP6A 5DV5A 4BQAA 1DGRA 2DYSH 1UU4A 4YZ5A 4L9BA 4BMBA 2O3FA 1PO12 3HN1A 4K8RB 5F5IA 3RJPA 3WTSC 4AHXA 4JAAA 5ABJB 2IC1A 2EZHA 5KHGA 1RB8G 2Z99A 1MBEA 4LHNA 4YFZA 1TT0A 3NQOA 5LGUA 3DTEA 5L3FA 3F23A 3KCYA 2EFWA 2ZXWH 3W2VA 3CL1A 1HCRA 4FPJA 3U9GA 4XMYA 3W3CA 1DP3A 4QWQA 5F3IA 3H8UA 1ORKA 3DLAA 1S4CA 1QQIA 2O8QA 1G86A 3T5XA 3HT2A 4BPZA 4HKOA 3OGVA 1ACCA 3LNQA 2P3IA 4Q0VA 2R30A 1WJ5A 3AYEA 3MLLA 3CCMI 4XF3A 2XJTA 1NQJA 1AR81 4XDPA 3BPXA 2JUCA 3AXDA 1A3KA 2JG8C 4QSHA 2WTEA 1NYWA 3JAMZ 5E79C 3QU6A 1ZRIA 3EYIA 2M8EA 2BVMA 4M3DA 1APNA 2GP3A 4U87A 4CDXC 1VQLI 1W9FA 1FAYA 3B6CA 2JD4A 1EUTA 3ZSLA 1Y8QB 5JR3A 4JTOA 3FHNA 5LA1A 3MLJA 4FAHA 3AVRA 1TQ5A 2DURA 3L9FA 2Y9ZA 4XIKA 5FYUA 3WEZA 3WTXC 1YYNA 4IV1C 4O3MA 4HNUA 2L9SA 2GC2A 2WFF2 2XPWA 4J25A 1ASJ2 5HBAA 2ZKLA 2IZWA 1W8OA 2D6LX 1FATA 2VW1A 4OVEA 2NXNB 3HG9A 2AEYA 3E97A 5E18F 3PU8A 4AK3A 1PIV1 4ZYEA 4K8FA 3SNMA 4YZ1A 2Z16A 2LTPA 5TSWA 1VQKI 1HKSA 2JXAA 3BP8A 5DM7F 4XLPF 4C2MJ 3WDTA 1S7AA 3POIA 4M3CA 1YUDA 4TZDA 2Y2ZA 4KWJA 3ST7A 3K4CA 3BG7A 5D4SA 4LJHA 2I07B 4EMSA 3LSPA 2VMEA 1US2A 3WG3A 2BBAA 2CQ7A 1S7OA 1Q8VA 2V72A 3ZQCA 1OURA 3IPVA 4M3EA 2GALA 2XG3A 2YS9A 5A7WA 5FK8A 1F5FA 2BHZA 3M1EA 1WMDA 1T33A 1RUG1 1XC6A 1WKMA 4ORFA 3N4MA 4LHKA 5CLSA 3POBA 4CDUA 5K7FA 5C9AA 3EUHA 1T39A 2XXZA 4Z82A 1EY2A 2BV6A 1OLQA 2XAJA 4B4QA 5J1UA 1SD5A 4F93B 2C5DA 5CVJA 2YHJA 2WO7A 1UX7A 4MHRA 3RQ4A 2GP5A 1E5IA 1XGSA 4LIVA 3MCZA 5CKQA 1TNRA 2ZHKA 2G9WA 2PJRA 4XBNA 1UYZA 3BIWE 1P4XA 1UCXA 1DPRA 3T8TA 1ZR2A 2K9LA 1EAH1 3ME2A 4OLLA 2KR2A 4NIAA 1VBB2 5DUWA 2R7TA 2NYXA 2R7UA 1RUI2 1CAWA 1PP8F 3B93A 2DCEA 3FN9A 1TQPA 4LB5A 2OQGA 3PNVA 4A69C 2W2IA 3CJIA 5GP9A 5I0RA 2CW8A 1KFXL 4HRIA 5T54A 5T5PA 4MXWA 3TB0A 3PM1A 3MIHA 2X6WA 3VBSC 4HSRA 3WQ1A 1YX3A 4XBQA 4GYIA 4ZDOA 1AR61 3UGGA 5JSOA 4FFIA 5ABJC 2XB5A 4C9YA 5I8TA 3ZDSA 4NIDA 3ZFGB 1CX1A 3DBRB 4BY7J 1FMD2 2XVKA 4QPWA 2NS7A 1DP7P 2C24A 2FBHA 4KGQA 4BEHB 1F43A 3MQ0A 2XKPA 4I0AA 3OSGA 3P3PA 2LROA 1LHOA 5HXVA 1RUG2 4OHXA 5E20A 4Q2FA 1U2WA 3LL7A 1TME3 5IPAA 3TYJA 1HW5A 2BW8A 2ESHA 4FPYA 5JZGB 3VBRA 1AR93 1CESA 2OZUA 2PHLA 3LQQA 4M71A 4KWUA 1APLC 2XB6C 2GNDA 3D0SA 5BNNB 1DYOA 3APBA 3AXEA 4DXZA 5I0SA 3FLTA 2NVTJ 2F5VA 2HXIA 3G6EI 1FV2A 3OYAA 1YJLA 4RB2C 1QNWA 1XG1A 4XJZA 2KKOA 3I2GA 4AI1A 3IAQA 3BVCA 3NVCA 3HC7A 2B7YA 2O03A 4DXSA 1X1DA 3GTLJ 1X2MA 4TLGA 3PSIA 4YWAA 1TMF2 3OR1C 5FYCA 1BR2A 1S55A 1BW6A 3JQXA 1PUFA 1TMF3 4CEYB 2ME0A 3H0DA 1UKGA 4V2GA 4UV9A 4XORA 1VRH1 4BXUA 4BIOA 3I3MA 3HRTA 4XF0A 3WDWA 4OMYA 4IX7A 5E89A 3M8LA 1YEWA 2B39A 3FZ3A 3PQJA 2LREA 2M0CA 2XRLA 4Q4Y1 5IT3A 2A61A 4DEQA 2GBYA 3JRDA 5T5OA 1XU1A 1FTTA 2R7SA 3JAMK 1QKQA 2ZABA 3L7WA 1S3JA 1SLTA 5KBFA 1OF3A 1FIPA 2DAOA 5FOBB 1TZLA 3QOPA 1ZKGA 2HYKA 4AEDC 3MO4A 3K46A 1Z7UA 1IDZA 2HQNA 2BXZA 3RJRA 1D0XA 1KITA 3P7NA 3ZYGA 1N77A 2M5WA 5H9PA 4YW1A 4W97A 4L9TA 3FXRA 1CAVB 4WZCA 5CFDA 4G94A 4LD5A 2CV0A 2R32A 4X8PA 4FAGA 5BPIA 4NHJA 4I0WB 4EZ4A 3BR2A 3FKIJ 1K5MC 4RGAA 4DIQA 4KIGA 5C33A 4F92B 2A70A 1SD4A 3JB8A 5EZWA 4AU7A 4RFRB 2VQLA 2WUHA 2RS31 4COUA 1V6IA 3OCPA 2R7RA 3AJZA 1I6XA 5F9TA 1LDKB 2W91A 3WCRA 3LOBA 5LGNA 4BE1A 2ESNA 3F9KA 1WGXA 3UKGA 4QDSA 2PHUA 1R082 3K4LA 2M4KA 4KN4X 3ABMH 2V09A 3O8GA 3T1MA 3DTKA 3SYTA 3GF2A 5FKCA 4BNCA 4BWOA 1UOGA 4JQFA 4ETSA 2FHRA 1WHUA 4MEXF 3HDDA 1FEXA 5HXMA 4XFGA 4IESA 1IG0A 1R6RA 3ZFEA 2WNOA 2EZLA 1MW7A 3MKLA 3ITQA 5IYYA 4QTRA 1FJLA 4IE7A 3S2DJ 4R52A 4HONA 2ZSIB 3IIAA 2RR13 4KA4A 1MGTA 4MUVA 3ALQA 4XTMA 4O5VA 4Y1XA 3ES4A 2HOTA 4A6EA 4DINB 5EXOA 2MG4A 1GU3A 2RJ2A 4L9JA 4XABA 4HW0A 5JXGA 5I8SA 4MTEA 4E7KA 4Y5SA 5FLIA 2BE5F 2MA3A 1MS1A 2PELA 5BUVA 3N9QA 2ME6A 4BUPA 4RYDA 2PMZA 2QDNA 2ZGSA 5J7MA 5GTHC 3DXJF 2HWC2 3WF4A 3E0JB 2E1CA 1R093 5FUPA 1Z6TA 2E9QA 1QXJA 5CKMA 5D5VB 3PHMA 2PAEA 4BY1J 2XGDA 2KJBA 1W7PD 2I45A 3S3OA 1EAH3 2EAKA 3SHFA 1WW4A 2XUEA 2A6EF 2RS51 5IVFA 4MO7A 1YFYA 4FISA 2X85A 2ZFWA 4Y5TA 3RKXA 5AC93 2KIMA 3TBIA 4RB3C 1A35A 4ESFA 2D7FA 5FUIA 1ND2C 4LULA 3HOTA 1Z3YA 5FXXA 5C4WA 4B1MA 5J4VA 1HB4A 1DFQA 1IDYA 3WVJA 5C3OA 2R49A 1E2XA 1ZYBA 4QX1A 2LLKA 3GXOA 5BNNA 2Q2EA 4DBRA 3BTJA 1V0AA 3CF6E 2VBPA 3CO2A 3GJAA 4R9CA 4RS8A 1RC6A 1F5JA 5JMOA 5LZ6A 4IE4A 4XJWA 3MMYB 4PBOA 4OQ9A 2XQXA 3S5AA 5K7HA 4WVVA 2P5LC 1VQ5I 2TDXA 5L36A 3CNAA 2MYSA 3RKQA 2D93A 3HOXJ 5AC91 3CJTB 5B4NA 2ID4A 1RUI1 3KEYA 1TE1B 1DZRA 1V6MA 2DCKA 1RHI1 4B29A 4IZZA 1X36A 1ZA7A 2QQBA 5IVEA 1X19A 1KRIA 1XYNA 4A7KA 4CDQB 4XHBA 2E1NA 1ZRFA 3AP7A 2EALA 3H8RA 4URAA 4FFGA 4CCCA 1V3FA 5CVUA 2M4GA 2KRFA 4E27A 4XN3A 1PO11 2W84A 4GJYA 2R7DA 2RAEA 4ASMB 1X3WB 3SCGA 4ZZ5A 1MS9A 2ID6A 2YY1A 3L9JT 2W1QA 1POV3 2QGUA 3SKJE 2V79A 3AL6A 2EK5A 1WCMJ 5L73A 1MZBA 2CNAA 1RJ7A 1YTYA 2FU4A 3F2ZA 4Q1RA 1UY0A 1DQ6A 4FBFA 1CAXA 5EFUA 1UY4A 4IEUA 3HD8B 3AX4A 1J75A 2AO9A 1ZZCA 5D6FA 2QSFX 2VBYA 5FQ0A 5LB6A 5FLXZ 1OCRH 2IGKA 4RN5A 1GUIA 2QZ3A 1DP0A 2IVJA 3WHUA 3VB2A 2G4IA 1OA4A 3ZP5A 3RI9A 1AR83 3OEAA 5C8CB 3WF1A 1DF0A 2BGOA 4HAMA 3TKYA 2L9RA 2DK8A 4CDXA 3GNEA 1OFCX 3G2BA 3EMRA 2STTA 3AKSA 3ZYJB 5A32B 4G6QA 4RFT0 4LR4A 2XB0X 4KH9A 1FX5A 4M3CB 5FY4A 1ETWA 3T08A 4BDZA 4M0NA 4A3EJ 4CRQA 1WH7A 3ROUA 2PHRA 2UWMA 3UYJA 2IFWA 1KA8A 2HWF2 1RKTA 3VDDA 3LA7A 5DG2A 3IAPA 3H5RA 5KHHA 1PVC1 4XJ9A 1REDA 4UW5A 3ZRGA 2X9DA 1U8BA 4B43A 1R00A 2LDUA 4QIWN 4V2VA 3KT4A 1O6UA 4Q5OA 5HV0A 2Y0IA 1VRH3 4MSVA 2GLOA 3C7HA 4KMUX 1UIJA 2B7EA 1QJU1 4N9HA 2DVBA 4TWTA 3UGFA 3K2ZA 2PHXA 3CC7I 1ND3C 4CTEA 1QGPA 3J7NA 4HG6B 4CUCA 1ALYA 3ZXDA 2FDFA 2XLAA 3O1UA 4IHVA 5F6LB 4DMIA 1GXQA 2EA2A 1GP6A 4UHTA 4N53A 2Q8DA 5M5YJ 5FPUA 3IDBB 3GLLA 2WT1A 3AP5A 1FOWA 2WA3A 2ZMEB 4NIIA 4LK0F 3AKTA 3DBLB 3RZGA 1RZ4A 3B5LB 3A4CA 2X10A 5FREA 4XIDA 4UWDA 5T3NA 1RIRA 1DQ4A 2ZX0A 2B9SA 5DZFA 3D1NI 2PFWA 2ZJRF 1GBGA 2O1QA 3OYDA 5A3OA 5IVBA 5KC6A 4NQWA 4AD9A 1AJKA 4P9GA 3TEXA 1A36A 2X29A 1HQCA 1SG3A 2ORXA 1V54H 1R091 1QOSA 1XGNA 1TWAJ 3H1YA 2IXKA 2P1BA 1QGLA 4D8MA 1QPMA 2QQ9A 1XC5A 2E2JJ 1SVMA 2V5YA 3KD4A 4NAOA 2IXJA 2V9VA 3CMYA 2J1TA 4C3JJ 4M6VA 3AMNA 4ASKA 2JG9A 4A5MA 4AQSA 2K02A 2VNGA 4IO9F 2Y6FA 3H3ZA 4L5IA 1XXNA 2QQLA 1AXZA 4OUEA 2KQRA 1EF4A 2XGEA 1Z05A 4RS5C 4EGZA 5A2QK 3W21A 5LBQA 1AWCA 1XBFA 2UZKA 1T95A 2YFUA 5LA9A 3TQNA 2IEKA 2L7KA 3T3YA 2WWYA 1J3PA 5ABJA 1JHFA 2JSCA 3PQKA 2RVAA 2UU8A 4N7IA 5J8FA 2XUMA 3CO6C 1HV1A 4OYUA 2LW8A 4C30A 2V9PA 2HYFA 3HJEA 1NCQA 4HKWA 5A80A 1DPUA 2DFEA 1QZZA 2A5YB 3V8LA 1IGOA 4NDLA 4E8DA 3EDPA 2XLGA 3OTFA 3RZHA 2YZ4A 3HN3A 2HEVF 1PHMA 4IL7A 4UUVA 2OIIA 5L7OB 1OVPA 2VODA 2JDNA 4B1LA 1IKQA 3NAPA 4I0BA 2E51A 1ZLJA 3B6AA 4HBNA 1JW6A 2WO2A 1IS3A 3M9AA 2W1OA 4EN6B 3QPHA 1BM9A 3EHKA 1J59A 3HNYM 3ELNA 3S2HJ 5IOZA 1S0FA 3NEUA 3J7MA 1UG2A 3F72A 4A0XA 2V4VA 2YPJA 3D8CA 2MEV1 4ENKA 2Y48A 3KP4A 1J9IA 1TWHJ 4Q4ZF 2AYHA 2OCEA 3QPSA 4B4RA 5DPNA 3ES1A 1AYM3 4Y26A 1P4AA 2BNOA 1ZGAA 1ZBA1 3VD4A 2BRTA 1O4YA 3QQAA 1R1VA 3K70C 3POGA 3PVNA 3MUY1 3MZYA 2R5YB 2H94A 4XFBA 2UXNA 2XC7A 4FX4A 5EPAA 2VG9A 4IVNA 2OD5A 4XKCA 2GMEA 1QU3A 3HOYJ 3O3KA 4PF5A 1ZTRA 5E88A 3GZUC 4CYCA 2Q5TA 3ASNH 2J5PA 3DU5A 3BTAA 4OZOA 4W4ZA 3MIDA 2LRPA 5FV3A 1S2KA 1KD7A 4JCKA 2JDHA 3B7MA 4AVCA 3URFA 3V0BA 1SLAA 5FYSA 3PNTA 1Y9QA 3B01A 1NLSA 4MGIE 2Y0MA 5A6ZA 3C8XA 4Q4V2 4QKNA 1IKPA 5GAEJ 2JG8B 3ZQIA 2MH9A 4Q4V3 3SH4A 1GVJA 4XKBA 1YIJI 2VOPA 5C9AB 4RAZA 4RHV3 1US3A 2BTVC 2ZAHA 4GKXA 1S5LC 1Y56A 5A2QZ 5CQGA 2W1UA 2MEV2 3CJIC 3KV9A 3I4PA 1WJCA 4OQ8A 3FMRA 3AC0A 1Q56A 2FCUA 4JGYA 1IXRC 2OAZA 1MKMA 4CUAA 5FY0A 4QGMA 3UNGC 3GCXA 3Q8FA 2J1AA 3RNSA 3LFMA 2QQAA 3S1NJ 2DU1A 1MS0A 1LGBA 4II2A 2VB6A 3WW3A 2VD7A 3SXWA 1FYKA 5JHFA 2R0QC 3KP2A 2P0WA 2DFIA 3LEIA 5JLWA 1LFUP 3INAA 3ACGA 2CQXA 5FJ8J 4BBRJ 2F2EA 1WCQA 3WXPA 5BNGA 5CAZA 2LTNA 2Q2EB 1Y8RB 1CR7A 1X58A 4B3AA 2VXRA 5J4YA 3RSNA 3RG0A 2A3YA 5IAXA 3IUOA 3WTTC 3ZO0B 2B9VA 4MGSA 2VW0A 5E8GA 4RS5B 2JA8J 4KG8A 1QDCA 4X8NA 3VUOA 1QJY2 3N36A 2DPUA 1VAVA 4AEJA 3MICA 2X5IA 2P6SA 3HBLA 4K1ZA 3KETA 2CU7A 1G9BA 1OT5A 5ACA1 1CZVA 3MZHA 2VKHA 4GWJA 3BALA 4KITB 1KU2A 5JDBA 4HXCA 1U9NA 3UK9A 2B46X 4CEWA 2CYFA 2HWD3 1FMD1 4JQRA 5DXDA 2FBIA 4Y15A 5LD2C 4NRQA 2MPFA 4YELA 3E1F1 4KU8A 3K69A 5FJHA 2ENRA 4DRRA 3H3UA 1VQ7I 4Q4Y2 3SEEA 1WWXA 2X1EA 4DJAA 4ZC3A 3TDZC 4XQDA 2QQIA 1F1ZA 2WADA 1PNFA 5KHDA 2FCTA 5L7OC 2K27A 2QDRA 1PO23 4FOYA 1H2NA 2HPMA 2R7VA 2DUPA 1QH7A 1XD7A 1K4TA 2PHWA 4RAGA 1QJFA 4WVMB 3O1PA 3WTUC 3AFKA 2ZA9A 1K12A 2LMDA 2K0GA 4Y20B 2XPVA 4TXWA 2GH8A 2K9ZA 3JUUA 1AYM2 2XR4A 3WX5A 1D8KA 4ZY9A 2R063 1B1BA 4LIUA 2MABA 3BR0A 1PNGA 4A7ZA 3LQCA 4FTBA 1OPOA 2EIBA 5HCBA 1DU6A 2DA5A 1XGMA 1K78A 1BIAA 3Q9OA 1T56A 1VZ0A 5F64A 3OJBA 3GUDA 2BZTA 2YROA 3WP5A 4IEZA 1MZ5A 3POFA 2B8MA 2IVMA 3K1PA 1VBB3 1SC7A 5FP8A 2DVFA 2WT2A 2CWMA 2D45A 2VVFA 4ON0A 4RD7A 3LSGA 3CZUA 2MSYA 5FYVA 1HKQA 2PI0A 4GFBA 2VLAA 3JCUC 2HDDA 5IYCJ 5ILVA 5FY1A 1YHQI 2D1VA 2XKOA 3O12A 2D43A 2Z33A 1CGPA 4G6TB 5I93A 2FD8A 5F2WA 2W57A 5ED4A 3VDDB 1V6KA 3FBMA 4ZZDA 1FPN1 5KHKA 4IHSA 2P7CB 3LSTA 2EIEA 5IP7J 5AFBA 1ZG1A 1XB9A 1SZBA 5FY5A 2CYYA 1ZBA3 1Z77A 2DQLA 2YC0A 3F8BA 3OBTA 4PUSA 1RUG3 4FCAA 3LDKA 4MGTA 3K6GA 3U11A 2VQ0A 4XDQA 3SZGA 2VPVA 1MMSA 2ZKZA 4QPYA 3V8JA 3K4DA 3NL1A 4LA3A 3GLXA 1CJDA 5L3CA 2P6TA 5GZDA 1XE8A 2EXKA 4PGGA 1MS3A 3QAHA 3QP6A 3ZXKA 1A34A 1OCTC 1GP5A 5CNAA 2FQ3A 1AYN3 3TEWA 3OBZA 3CMAI 2WA0A 2VY0A 4JZRA 1LU2A 3W6JB 2BBYA 3DKXA 5KAFC 4BQ2A 3GZAA 3OBRA 4RR3C 1IC8A 4WM8B 1UZ0A 2H6CA 2IWGB 3JRAA 2XROA 2VASA 1GHCA 3WTZA 3DPUA 4HSLA 2HQRA 1N3PA 4LT5A 2GMMA 5F0FA 1H6YA 2RVCA 1X82A 2W95A 4AFDA 1DZTA 4QB2A 3HBKA 4YW4A 1HRI1 1DZQA 2CDPA 4A6DA 1Z21A 2Y0OA 5FZMA 2WFF3 2VJ5A 5IVJA 1TNSA 3RGBA 3Q9VA 2HWB2 4QHZA 5A7SA 4DUXA 1G3YA 3CUQC 2DCZA 2HJIA 4GALA 1UU5A 2K2SA 3PMSA 4HX4A 3ZN1A 1DGWY 4JV4A 3HWJA 2VQUA 3BT9A 1TTYA 5FY8A 3VLBB 4O61A 5C3SA 5FKMA 2O8XA 2RQQA 1PGW1 1FNNA 5JXJA 2LK2A 3F95A 1IHMA 4R1HA 4UVBA 3O0WA 1RHI2 2DJIA 3LIHA 1Z1DA 3O1MA 1RGSA 2DTYA 4QQHA 1XMKA 2HH9A 1AXKA 3AKRA 5F39A 3K48A 4BDVB 4CA9A 4Q4X1 2HWF3 3WF0A 4RAYA 5FMDA 5C8CC 5FZ4A 1DDLA 1FI2A 2DA7A 1UAIA 1XX5A 2F4PA 2OA2A 4O9GA 1GXPA 4NC6A 3ABZA 4UF0B 2A3XA 1UO9A 1WLWA 3TNPB 3ML6A 5E6HA 4L8QA 1S0EA 2ZXQA 2I2SA 4BK5A 2D5VA 1LEBA 1LGNA 4KT6A 5DAQA 4XC9A 2E7QA 5H6RA 1FMD3 3E1SA 4B8XA 5C8CA 3OS2A 3PLQA 2JD9A 3Q9SA 1GDTA 1URXA 1EPZA 4RLFA 3AFHA 1AU7A 3CMEI 4MO3M 2L4AA 3OOXA 2K46A 2COBA 1W9TA 1LVAA 4LG0B 1WJDA 4PT6A 4ZYAA 4W50A 4X6AJ 5F5QA 2ADUA 2G1MA 4S2GA 1X7NA 2XPUA 5KCMA 2RDQA 4L9NA 1VI0A 1V00A 4E2QA 5IHRA 5A3PA 1Z78A 3I97A 4FOQA 4ZTJA 1JN2P 1OA3A 3K10A 1ZN2A 1QPIA 5E3NA 1WWYA 3GHNA 5A7PA 1CAXB 2VNOA 5BYNA 3A21A 1EA3A 1E3OC 1TVGA 4G9SB 4L18B 1RC9A 2DI3A 3FL7A 4FETA 4I2OA 2QCSB 2VZ3A 4D7YA 1EYBA 4E4HA 2IJLA 4M3CE 2ELKA 4WX9A 2XSDC 1MQTC 5F5AA 4AC0A 1B72B 1L7RA 1XSXA 4LE4A 5EV7A 2X51A 5JOWA 2KP6A 3OS0A 1UMZA 2P7VB 4UUTA 2CGOA 3I2JA 4EN8B 2HZDA 4IEYA 2O61A 1JKPC 5FZ8A 2R16A 2E6VA 4OULA 2HOAA 4CDGA 1VR3A 3ZOBA 3T2TA 3SC7X 4LO7A 5CU1A 4PSWA 2BERA 1ND3A 3S30A 1XPWA 4CE8A 1PMJX 2LOOA 1I9RA 2EIJH 3POWA 3G73A 2V5DA 2W00A 5JXIA 3DP7A 4LKDA 1J3RA 1ZZ6A 2CHHA 5JVTA 3S7EA 1W36C 4BIFA 1FOD2 3WDYA 1EP0A 5ISLA 3S1QJ 1X9PA 4YEJA 3VSLA 3POYA 2ZGPA 2W4SA 2GMPA 2CGNA 4BA6A 1WCKA 4CP1A 2RDRA 2XBO1 2KXLA 2WN3A 1NUKA 1XN7A 4D7MA 4J19A 2EAAA 3L2YA 1CX4A 2AH2A 1CAVA 3N7LA 3U37A 4Z2WA 2M3AA 3RPQA 2X1DA 1SFEA 2RDNA 2WNEA 3NAPB 4PLNA 1G59A 1BK1A 1RPWA 2HWD2 2EVXA 3X29B 4OI0A 1RUE3 1AR92 5F6KA 3DF8A 4BCUA 3Q3SA 3NNMA 1JYIA 2HVRA 3KEQA 1RUJ1 2IS2A 1PYVA 4NWVA 4E7LA 3ZGKA 1SLBA 4CP9B 1WMFA 3BPSA 3CDLA 3EUAA 1IN5A 3VBSA 4GGGA 3I3QA 3RVHA 1FBQA 1Z7S2 4Y22B 4HLYA 3DYMA 1R1A3 4XNFA 4JRLA 4OMCA 4A41A 5FLHA 2ARXA 4M73A 5FQ0B 3HL2A 1NE6A 1VPHA 1MMGA 4AFBA 4UVCA 3PUBA 3A0KA 4DO0A 3PURA 1LDJA 4JRAA 5IJRA 1LOAA 3I59A 4IQJA 2JICA 1W0OA 1U3EM 4CA0A 1VBC3 1EV7A 3OWTA 5DCMB 1KONA 2OX0A 5LHGA 4QPIC 1UG0A 3U75A 3HTUA 4HA8A 1HLVA 1WFXA 5FKLA 3DEMA 4ONUA 2JE7A 1ONAA 1VQOI 2NVXJ 2ZZJA 1IN8A 4UF0A 2EXJA 2GC3A 5IATA 3OYLA 4AOCA 3UNPA 2GWRA 3ZQGA 1A8MA 3ERED 1YXWA 5T5LA 1R7JA 2PXJA 1K5JA 2UY9A 4JDMA 4F8AA 2OKXA 2BW3B 4NPLA 3A01A 5KAIC 3ESWB 2ZS6B 5HV4A 4KG0A 3B3QE 1F35A 1RUOA 5L3GA 3U14A 2FBEA 4FPFA 1POGA 4M3CF 1IRXA 4C0HA 3DYPA 1TQMA 2EFNA 3MKYB 1W5TA 2YFZA 1JH5A 1W5SA 4UYBA 3ZFGC 1RUC1 1SFOJ 2TBVA 5IK5A 1MSEC 3WZ1A 1I3HA 4QDRA 3A03A 1W2NA 1XE7A 4JX5A 2L7ZA 4A45A 4DUVA 2ZNYA 1S0IA 3OEBA 3VDXA 1YFUA 3N9PA 3MPPG 3ZFGA 2H27A 3BYWA 2XASA 3V8KA 4D0QA 1ZZBA 3ZSEA 4A4AA 2EXIA 2DCJA 3BR3A 2ZACA 4A3IJ 1IUYA 3MIEA 4CEYC 4NHXA 1VBA1 5FR3A 1TWGJ 3ECHA 1JZ4A 4CUGA 1RR8C 3V0BB 1AL0G 4WXDA 3N05A 2NP0A 2JWPA 1KEXA 4I30A 1JOPA 2E63A 2JG8A 4CYDA 3Q8CA 3DLLF 1V9U2 1VQ6I 3H1WA 4S2FA 4UUSB 1U5TA 2MLGA 2Y6JA 1Y7BA 1C5HA 2FQ4A 5TISC 3HT1A 4PIZA 1COV2 4IW3A 1Z67A 4U2AA 3OUIA 2Y6LA 2CH0A 2LY1A 4HOOA 3BG3A 4M00A 1YIPA 3G7DA 3LDBA 3ZXEA 2ZEWA 1RMU3 5DG1A 1LOFC 4ET7A 4BJ5C 3JTGA 4W65A 2RC4A 1IXCA 1S29A 2WY8Q 1GSLA 5ERLA 4Q4V1 2ZMEA 2GXAA 4CDUB 2HBTA 1WCSA 5L3BA 1A78A 2K5CA