3RYPA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
b'QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rypA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rypA01
4P9GA 4KIGA 3RYRA 1S29A 1YWKA 5E17F 2H09A 4M9SA 1QO0D 3KLNA 4G8XA 4XETA 3IHUA 3LA7A 2EJRA 3H3UA 5CVJA 3M8EA 4YARA 2DFIA 4IRIA 2PA7A 3RKYA 1B4AA 1J75A 1IXSB 1MD0A 4LLOA 4QX5A 1Q1HA 4HLXA 3N97A 1H1MA 2V1DA 1Q5OA 1MDMB 1QXJA 2ESNA 2EV5A 1KYWA 2VC1A 3CDHA 4LMYA 3WG9A 1TQIA 4Q47A 2HKOA 4MUVA 4HSJA 4XSXF 5J8CA 4LA2A 2NAZA 3BCWA 2RDPA 4PIYA 3HSRA 3HOSA 4HQEA 4MTDA 5EZWA 1SMYF 4KNYA 3JAMK 3CTAA 4HX7A 3TDUC 5FO5A 4PGGA 5J3UA 3H1MA 2O6GE 4PJYA 4XF0A 2KRFA 2VC0A 2MNGA 2IXIA 4XRFA 5IT9K 2VT2A 3M9AA 3GBFA 1JE8A 1U5TC 2Z5UA 2F5FA 3HRTA 1HKTA 2CAUA 2V1UA 4TV7A 3S0MA 2QWWA 4QLCU 4P9UA 2PAEA 3IDCB 3ZP5A 3PQJA 3L9FA 4AQ2A 5TRDA 1YO5C 2M8EA 2PMUA 5LRSA 4NVPA 3P9KA 1SFEA 4QGLA 1F5TA 3EDPA 2QZ8A 2CG4A 2K9ZA 3L7WA 2EV0A 1MZBA 2F2EA 4Y17A 1QNTA 4ENKA 1BJAA 1CAUB 3WU0A 5JCTA 3H1WA 1KQ8A 2UYBA 1O3QA 4XBFA 4WK8F 1YHFA 5D5UB 2X0LA 3VEPA 4ESFA 1OPCA 3HSFA 2XLFA 5E8IA 2DPUA 2YX4A 1MJBA 4E2SA 3MDPA 3KP2A 1T98A 4D0PA 1DGRA 4J1WA 4OU0A 1KYZA 5L3DA 2ZO4A 2AXLA 5ICEA 1GQHA 3ZMTA 1YUDA 2OZUA 3MFKA 4IEQA 2XAQA 3K0LA 1QZZA 1XSDA 4ZYEA 4I0BA 5LEKA 4IEXA 2IXCA 2VN2A 4A6DA 3FMRA 1L3JA 5JSRA 1TW2A 1P4AA 3GVAA 4WX9A 5KHKA 5BXXA 4IESA 1CAWA 3RDIA 5HOOA 3NKTA 2H6BA 2XLAA 1J3RA 2Q30A 5FLJA 5A2QK 4F7ZA 2MHFA 2O1QA 4IETA 4DINB 3DV8A 4L0YB 2IA2A 4QM8A 4HDUA 1G3SA 3KZYA 1P4WA 5FLHA 4GYIA 4MGYE 1SD7A 2VBWA 3TO9A 1RNLA 2HGCA 4AD9A 1HSTA 4RGXA 4RS8A 2KIUA 4RAYA 1SQ4A 3FMSA 2C0ZA 1XD7A 2VPVA 1A04A 2QYOA 3E5QA 3E97A 3V8JA 3F21A 2GZWA 4EGZA 2PHLA 3KEOA 1XN7A 3LFKA 2DO7A 5I93A 4A6EA 3TOBA 1JHHA 1Z05A 1IUYA 3I54A 2XAFA 5I0SA 5J48A 1P6RA 3MCZA 2EA7A 4KWLA 2HTSA 4MZUA 3C7JA 2OYZA 1I27A 3WGHA 2HTJA 1YLLA 5BS6A 2OA4A 1FSHA 3KGLA 3HHHA 2K86A 2STTA 3I71A 3DEUA 4B29A 3ETQA 3DF8A 4EMSA 3H9AA 3Q5FA 1RIOH 2IT0A 4OIOF 2IXJA 3KP5A 4IERA 4KMUX 1QBJA 1XMKA 5F1RA 1BOAA 4MX3A 1SD6A 2KKOA 1J3PA 1D3YA 1LVAA 1S8NA 5J8FA 4Z07A 5LGUA 3K1MA 5JVTA 4FAGA 5D1IA 5CVRA 2M1BA 2QLZA 2IC1A 5LGNA 1DPUA 2H6CA 4N9IA 2FXAA 3IIAA 1FPQA 2FBKA 3K9TA 1CAXA 2ZNZA 4JBAA 1TNSA 2GH2A 1J59A 3EETA 3FXRA 4L9NA 2W85A 4YNIA 1J7KA 3OGJA 3PNAA 4I09A 3WTVC 4ZZLA 2DK5A 4CXFA 1KU9A 2UY8A 1F4KA 2KIFA 2GXGA 1HW1A 1X3UA 1U3EM 3ZN0A 3T8RA 1T38A 4EV0A 4LLGF 3TNQA 5JSOA 3HOTA 4HZFA 2BYVE 5LHHA 3I4PA 3NEUA 3LA3A 1R7JA 2FBHA 4DQ2A 3WGGA 3ZPLA 3OOPA 4KWJA 1MKMA 1ZZBA 5HS7A 5L3BA 1XSVA 4EWAA 2RN7A 2QDRA 5CVUA 1WSUA 4AIHA 5BPDA 1EY2A 4KFCA 5EFUA 1LB2A 4X6RB 1KU7A 3E3VA 2ZFWA 1CAWB 4G7HF 1LQ1A 3IC7A 2RNJA 2ZJ2A 4A2UA 3LAJA 2B0LA 3HRMA 2A6EF 4PCQA 1GHCA 1V4RA 5IT3A 3JSOA 1R5HA 4GGGA 3FF5A 4F8AA 2GC1A 4LFUA 4KN4X 4MGZE 5LLQA 5LRRA 1LDKB 2B5HA 1J1LA 1UFMA 2M30A 2D5FA 4B8XA 3VHRA 1UCRA 4PZJA 4RGRA 3RYPA 3F3XA 5E18F 2CAVA 2A69F 3V7RA 1YS6A 4UVCA 4BH9A 3IRRA 1ZRCA 1ZZCA 1K7AA 3HT1A 3H1YA 1RGSA 2W57A 4WCGA 1UIKA 1YQAA 5KK1A 5L3FA 1FBQA 3L00A 2TDXA 2P17A 4M71A 4E70A 2OZ6A 3DN7A 2D1VA 3IWFA 3SCHA 1CF7A 3GFIA 2A07F 3BOQA 2P5VA 3IBMA 3O6BB 3WTUC 5FLXZ 3GXOA 2GAUA 3L2HA 4KWKA 2ZMEB 2JPCA 1QPMA 3G7DA 2XIGA 2UWMA 3QU3A 2Z99A 5HVQC 4CO8A 1LEAA 3J80K 5K5QA 2HR3A 5D6EA 1YFYA 5FGMA 3OF1A 3ZMZA 3ST7A 1SD4A 3ABUA 4LEJA 1CAXB 5HDGA 2MBFA 1KU3A 2FF4A 3SMHA 1PP8F 1YW9A 4U0YA 1IF1A 1MJ9A 1EV7A 2MD5A 1J58A 1VJ2A 3CO2A 2Q8KA 2GWRA 3R0AA 4XF4A 5JR3A 4G94A 2VBXA 1WWXA 5DD8A 1XGMA 1O5LA 1K78A 3DFGA 4IXAA 3B02A 4G6DA 3CO7C 3BPZA 3FZVA 1ZAOA 1ZRFA 4FHTA 2CGPA 1ZRRA 5J7MA 4BYYA 3U1DA 5DCFA 4P55A 5J6XA 2GA1A 2W25A 3BDDA 1SFNA 2YPRA 3W6JB 2W84A 1DPRA 1EH8A 2VOOA 4MGKE 4OIRF 2EWNA 3WW4A 4OINF 4I02A 5ILSA 2RV8A 2JZYA 4YYOA 1CAVA 4CHUA 3D0SA 2XKOA 3PLQA 3H8UA 1BI0A 2H27A 3V7SA 2WV0A 2IA1A 3KCCA 1J2XA 3HYIA 1XDSA 1ZLJA 1OI6A 4UUVA 3FHIB 2VBYA 4LULA 4U0WA 4XFHA 3MZYA 1NYWA 2HZTA 2H0VA 3GYDA 4Z2YA 2XGXA 1WI9A 1UW8A 2PQQA 3UKNA 3GFLA 3EHKA 1XGOA 5BOXA 4O6JA 2UY9A 2V6CA 2ETHA 3CJNA 2IP2A 4L2NA 4GULA 2W24A 4IEUA 3BWGA 5K1YA 3EBRA 4IVNA 3FXUA 2GU9A 3KSCA 2PI0A 3GX4X 5E1ZB 4JK1X 2FQPA 4L9JA 4UNOA 3OTFA 3V8LA 3JAMZ 2Z3YA 2VOPA 4XF9A 4HBLA 1JXSA 2OQGA 4O5VA 2KJCA 1FC3A 1ZZ8A 4BNCA 3EJKA 1CF7B 4R79A 2XLGA 5IT9Z 4MQVA 3TQNA 4MNUA 2D40A 2QVSB 3M7GA 3OD0A 4HF0A 2PHDA 4NQWA 4UHTA 2FE3A 2QJVA 3U0ZA 4FAHA 5BPIA 4R8HA 2PLYA 4MEYF 1QQIA 1EYBA 3P9IA 3FFQA 4UV8A 4TLFA 1EPZA 4HLTA 3SFZA 2RKHA 3C1DA 1PMIA 1IN6A 1B59A 4IEVA 2WTEA 3J7AO 3TO6A 2GA2A 3FMQA 5LBQA 2CWEA 4HN1A 4MV2A 4MGIE 2CSOA 4XFGA 4XFCA 4GXOA 1YFXA 2MH2A 3JSPA 5LHIA 4RB3C 1WLTA 2O8QA 3VFZA 4I2OA 5FDBA 3VB2A 5KHIA 2DQLA 3DP7A 1FP1D 1LDDA 2HJIA 2XL9A 3M8FA 4HBNA 4ESBA 1K78B 3QPHA 4HLYA 1I1GA 4K2EA 1I1SA 5CLSA 1R36A 2Y0OA 1S7OA 4YIIA 1IXCA 3ECOA 1USTA 4MH0E 2E7WA 3HHGA 4LB5A 5K5RA 4HF2A 2F5EA 3I7DA 1W5TA 4A12A 1G3TA 3C18A 1ODDA 2F4PA 1RI7A 4I01A 1B1BA 1VTNC 2O61A 4BHBA 3ZQ7A 2OZJA 3K1PA 5I0TA 3TDZC 1I6XA 3IDBB 3ZDSA 1CAVB 4ONUA 1ZGAA 4HN0A 2V09A 4ENNA 3F8NA 1UPIA 2E1CA 3ERED 5ICFA 2GQQA 3FHZA 1R1UA 2IA0A 2PAMA 2PMHA 2V9VA 5A2QZ 3NSTA 3J81K 2BNNA 3NJZA 4RGSA 1Z6RA 2K27A 3NRVA 1I5ZA 3F22A 1R58A 4L18B 1HW5A 5H20A 4ZU7A 5C8WA 3ACLA 2I45A 1MGTA 2N7GA 5AIQA 1BM9A 2B8MA 1LDJA 2ZXJA 1X82A 3DL3A 1RL3A 2H94A 4I98B 4S05A 3R60A 1S6LA 3FM3A 1ULYA 2R3SA 3HRSA 3CUOA 4XFAA 1DGWA 5E1WA 5I0UA 4GO1A 1J5YA 4HX4A 1UIJA 4HVRA 2RVCA 5AIPA 2B9UA 3T5XA 4LUKA 3I59A 2LSOA 2VONA 2KJBA 1U78A 1LEBA 3H7YA 3SXYA 1C0WA 1EH6A 2Z33A 2EFNA 1LNWA 5HLGA 3FM5A 3G3ZA 4LG0A 4I7HA 3RYKA 4KMFA 4UVAA 2ZCWA 5FD6A 4HMZA 5D8LB 3DPLC 3M1EA 4ON0A 3E6CC 4L11A 1WGPA 2MPFA 1XCBA 3GEZA 4JV4A 4KT5C 2V79A 4LLNA 3JW4A 4EGYA 5HLIA 1YIOA 1QGPA 1R22A 4L0ZB 3CF6E 2G7HA 1K6OA 1EP0A 1V70A 1SFUA 2EFQA 2WC2A 1NE6A 4NB5A 3RKWA 4HVOA 4RAZA 3KLOA 3T0YA 2M87A 1ZNPA 4EJOA 3U11A 3GFJA 4KL1A 1B9MA 2ZMEA 3CUQA 2G9WA 1HKQA 4JTOA 4IHTA 3F72A 4OMZA 1IRFA 2ATFA 1YFWA 1G3YA 4E2QA 2PG4A 3RKXA 1LKNA 5EEGA 4UXAA 3TKYA 4YIFA 3OV8A 4M9ZA 3ELNA 5E20A 3S2WA 2OD5A 3EO6A 4I0AA 4RB0A 3BU7A 1E2XA 5FB2A 5HDKA 1S3JA 5HS8A 5D4SA 2VXZA 2PTMA 4HDVA 2M5WA 4RB2C 1QXRA 4AWXB 4ZZDA 1Y3TA 1FBSA 4G9YA 3KP7A 3RPQA 5LEJA 2E1NA 3S7EA 4AXOA 3MQ0A 3QP5A 4M9XA 2DTRA 3E6DA 1W7PA 4KYWA 5E1RA 2UYAA 1U8RA 5E8GA 4MTEA 4X6QB 4L9VA 1O4TA 2G7UA 4U88A 1QZYA 3V4GA 4P5OA 3TGNA 3C3VA 4YG2F 1FWZA 5KHHA 2Q2EA 1AWCA 2NRAC 2GC3A 3F23A 3IKTA 2HQRA 1UHMA 4M6YA 2OA2A 4RD7A 5CU1A 3I64A 1BIAA 1T0FA 2DT5A 1DDNA 3GZ6A 4Q0SA 3NQOA 1Y9QA 4ENJA 4G7OF 1EH7A 1OYYA 3E5UA 2GIVA 2GC2A 4LLLA 5CYVA 1RUNA 5DCMB 2XROA 2LF7A 4CZZA 3LZZA 4EQQA 2ZKLA 2RQPA 5FQ0B 4XF3A 3ZMDA 4YFNF 3PQKA 1BIBA 5D5XB 3E6BA 4K8FA 1UB9A 1IRGA 4JVAA 3BPXA 3I59B 2DAOA 2YR2A 3COAC 1U6GA 3GO5A 4PIZA 1BBYA 3DPTA 4LG0B 3WODF 5LGTA 2Y48A 4HF1A 2ET7A 4XFIA 3FE5A 2QQBA 3I5UA 3GZ5A 1J9IA 5ERIA 4EM0B 5D4RA 1W7PD 3J80Z 1PDNC 2IW5A 2HYFA 3F8MA 1T39A 1IN5A 2DCTA 3REOA 1D8JA 2K02A 3O14A 1RTVA 4LUMA 3FJSA 2UXNA 3ROUA 1BN5A 2HQNA 3CUQB 2CV6A 2MLKA 5FCCA 5FFXA 2P6TA 2P5KA 3DXJF 4KDPA 2MA3A 4LB6B 3RNSA 2VT3A 1TW3A 3GW2A 5BV6A 4OIPF 1P2FA 1BI1A 3U2RA 4MQ9F 1ZHFA 5F64A 3I58A 3T8TA 5BMZA 2OU2A 3WU1B 4IJAA 3F8CA 3N4MA 2P6SA 3CLOA 3CEWA 4ZYHA 3QACA 4ASNA 3EYYA 2NS0A 3FZ3A 4HQMA 1ON1A 3BJOA 1FZPB 2JTVA 5DEQA 3SHFA 2Q0AA 1W7PB 2FMLA 4AVBA 3FWEA 5FD5A 3LWCA 2R7DA 2D45A 1T2KA 2GXBA 2STWA 3WTYC 3F8BA 4PGHA 4QGMA 2VECA 4M6XA 2ELHA 2P7CB 1FY7A 1FI2A 2COMA 1E17A 1U12A 1IZ1A 1IXRC 1SAXA 4KA4A 1HXDA 1HKSA 3K1NA 1ZRDA 3CUQC 1HW2A 1ZGJA 4PDKA 2FMYA 4AQ6A 4Q0UA 2M45A 4EROA 2ZKZA 3EYIA 2PFWA 5CVVA 4RGUA 2QUFA 2VQAA 4META 2XRNA 4QGNA 1O7FA 4I3PA 4UXNA 1H1IA 1XDUA 1Z6TA 4A0YA 4ZYDA 3FXQA 4AIJA 4AVCA 4GCVA 1IN4A 2DK8A 2MLGA 1GQGA 2L02A 2HFHA 1IPJA 2X4HA 1KU2A 4IEPA 3M3IA 1U2WA 2FQ3A 1GXQA 2OBPA 2CYYA 4Q0VA 1GVJA 1NHAA 4ZU4A 4OFGA 4HV5A 1KA8A 3TO7A 2L54A 4LTAA 3HTUA 3HRUA 2QM3A 4M73A 4QXKA 1QY4A 2PYTA 2ZNYA 5FFZA 5L3GA 5K8SA 1F9NA 4HYEA 4UVBA 3WE3A 3CLPA 2XVCA 1STZA 3SXWA 3QP6A 1XE8A 4KICA 2PAKA 2A5YB 2Y75A 4U7DA 1X7NA 2XAHA 2ZBKA 5JSPA 4QWQA 4LK1F 1F1ZA 3AAFA 4JQFA 1MJAA 4YFXF 2PN6A 2XASA 4A5MA 3SCGA 2AS5F 1OR7A 3VODA 4P9FA 4EJUA 3IL2A 3I0TA 1RUOA 3GWZA 4OIQF 4PIXA 1YYVA 3ECHA 2BGCA 4G6QA 3E5XA 4BXUA 4OOIA 3SQNA 5ILUA 3MZHA 2PFBA 2QCSB 5ICCA 3HT2A 1FYLA 1REPC 1FT9A 2V1XA 2VBZA 3HIFA 3KMHA 3HTSB 2CFXA 3ZMVA 4KU7A 5AVPA 3HQXA 1YTYA 3IKVA 3Q9SA 5F6FA 1YS7A 6PAXA 3DKWA 1FNNA 3KETA 3H7JA 2EB7A 3F8FA 5JAXA 4EJTA 3WW2A 3ISPA 2ISZA 1D5VA 2O3FA 4IHSA 2EFWA 3Q9VA 5L3EA 1ONVA 4M72A 4LJZF 4ZH4F 1OFNA 3J81Z 2RGVA 4U7BA 2QVOA 3RTRA 2OAZA 1B9NA 1S7AA 3SZTA 5DYMA 5JR7B 4L5IA 2EAAA 1P92A 2LNBA 3R61A 2D5HA 1ZARA 2YX7A 2LKPA 2Q4SA 5BUVA 2FNPA 3BY6A 1LJ9A 1ZREA 4P96A 4L5JA 3KP3A 2JT1A 4UBHA 3LSTA 4IRHA 4YRDA 3BP8A 4CYDA 4XSZF 5D5WB 4Q4ZF 2WFPA 1B6AA 3WTWC 1XMAA 1NE4A 1J3QA 3QPTA 3IWZA 3CO6C 1ZLKA 4WZCA 1QWRA 1O7LA 4UBGA 5JFRA 1XGSA 2DW4A 3H3ZA 2QBYA 1P4XA 4AIKA 1SEFA 5KVRA 1Z91A 1YFHA 3EQLF 3E6MA 3JZVA 4IRGA 3F6VA 1YW7A 2O03A 2FEZA 3VOEA 4WBBA 3GLXA 1XGNA 3F6OA 3TOAA 1BI3A 3WTXC 2XUBA 5DCMA 2Z9OA 2BBYA 5DUIA 4LA3A 2XAGA 4EWEA 1G3WA 1H9TA 5DUKA 4YFKF 5L3CA 4Q0PA 2FU4A 5FQ0A 1KGSA 1R1VA 1D8KA 2Q1ZB 2EA4A 3R4KA 3LQQA 2A6HF 2DPDA 5FLIA 2F5DA 4EVIA 2F5CA 1OYIA 1TTYA 3SCFA 2FSWA 5D5VB 2DI3A 4IF4A 2IRFG 5KHJA 4QM9A 5TJJA 4WVZA 2K7LA 5LHGA 3JTGA 2J5PA 4CGZA 1O57A 1ZG3A 2L4MA 4EM2A 5K5OA 2DBBA 4KUMA 2JRTA 3FX3A 3RPUA 3UKTA 4A5NA 2ETEA 2P4WA 1H9GA 2YU3A 4Q5SF 3USSA 2MC3A 1ZVFA 1WQ2A 5E1XA 1KQ9A 2KXLA 1YG2A 1DZTA 1V3FA 2BNOA 4BAYA 1TBXA 3TNPB 4A0ZA 1FOKA 1SD5A 4O9EA 1Z9CA 5KHGA 2OQRA 4OMYA 3BZ6A 1HSJA 1GXPA 1XE7A 2QENA 3W6KB 4Y13A 3QOPA 1ZN2A 2A68F 3HUGA 1PUEE 3I53A 1ZG1A 1SFXA 1NXMA 3QAHA 1R5GA 4N0BA 2L3DA 1PP7U 4HAMA 2OPKA 3BB6A 2IXKA 2K0GA 4WXDA 1FYMA 3V8KA 5AONA 3ML6A 3WTZA 4BHCA 2K4JA 3KE2A 1IW7F 2Q0OA 4FT8A 1FBUA 3MPBA 3ELKA 3O3KA 1R00A 1JUHA 4UV9A 1XB4A 3EUHA 5CVIA 3QRFF 2VODA 1RZ4A 2GC0A 1UHWA 1G4DA 4JTNA 5HDNA 3KP4A 3HSEA 1Y0UA 3KGZA 1ZG5A 3BPVA 5HLHA 4XLNF 1Q43A 2HOEA 1TQMA 5I8SA 4U0VA 2Z69A 4IEZA 5HS9A 3IRQA 1FP2A 5ILVA 2KIMA 5BPXA 2CO5A 1ON2A 2ET1A 1O3TA 3LOIA 1IN7A 4Q0QA 2PQ8A 5D8KB 2HKXA 4ESJA 4HV6A 1Z1DA 1TLHB 4NHJA 3WTTC 1LRHA 3H92A 4XEZA 3ZN1A 4BIFA 3B73A 4Q48A 4CICA 3DQVC 1JGSA 1IAWA 5D6FA 1O3SA 2JSCA 2D1HA 4KU8A 4IEYA 4GYGA 1DP7P 1YLFA 2QBYB 2A61A 3SHRA 4AVPA 2XL7A 1HQCA 1BC8C 1IPKA 4LGWA 3ZMUA 4HSLA 4EM1A 4OLLA 4ENMA 3PVBB 4L9TA 5BQTA 3ES1A 4R52A 2XHKA 1PM7A 2BNMA 2YSRA 3KEQA 1VR3A 3D5LA 3S7IA 1Z7UA 2K4BA 3QU6A 2EVXA 4WWCA 2XAJA 3GYHX 3L2CA 3P9CA 1NZCA 2D93A 2HYGD 5JI6A 2D2WA 3R0JA 4IEWA 5C6CA 1XRUA 2P5LC 1L0OC 2EV6A 2VE8A 3LAGA 4WXHA 2QNKA 2ISYA 1O3RA 1WA4A 2CQKA 2NNYA 2ESHA 5E16A 4HW0A 4R1HA 4CDGA 2HEOA 3M70A 4O3MA 2MH9A 1DZRA 4EWDA 4KIFA 1FSEA 5CADA 4ORFA 1XCVA 1HBXG 1OYWA 5KBFA 2P7VB 5ED4A 2ACJA 1X8MA 1YW8A 5HI0A 3MYXA 4AVAA 4BHPA 4S04A 3D0JA 2XV4S 2FBIA 4XFFA 3K2ZA 5BY5A 2FRHA 2EK5A 3KFWX 2EFPA 1ZZ7A 3WW1A 4RB1A 3WGIA 2IXLA 4IPAA 1CX4A 2P8TA 3PFIA 4D7TA 1U5TA 4Q29A 4XF1A 3ABTA 5H6QA 4QMAA 3R6SA 1BI2A 1SMTA 5I0RA 4EJWA 4FBFA 2UXXA 1FX7A 4M74A 2JPBA 2L4AA 4WXCA 2VE9A 1UCXA 2C6YA 4MHGA 3G73A 2DLLA 2CW0F 1WKMA 2LF8A 1WRJA 2EA2A 1IN8A 4MEXF 2BE5F 1FYKA 3MEXA 4BQAA 1BC7C 1K79A 2Y0MA 1TNTA 4N9HA 2E9QA 1W4MA 2J5OA 4ZYGA 3BROA 2O0YA 2PJPA 1R23A 2QQ9A 4Z82A 2IXHA 3MWMA 1TQPA 3RI4A 3ES4A 2BEOA 4DNCA 2FNAA 2DQRA 1MDMA 3ULQB 3UKVA 2RC4A 2XKPA 4H7LA 1LR5A 1CGPA 4HX8A 1T6SA 1ZZ6A 4HVQA 4G7ZF 1X8EA 3NL1A 1H0MA 2L01A 4B09A 5FPZA 4A0XA 4FX4A 1ZH5A 4HOBA 2DU9A 2EFOA 4O9GA 2PEXA 4KN7X 5EEHA 1Q3EA 5I91A 3BJAA 1AOYA 3NW4A 2IVMA 1L3LA 3C3WA 3NVCA 1ZYRF 1RC6A 3CL1A 5ICGA 3H50A 3OCPA 2A3SA 2R7FA 3K69A 4ETSA 3GF2A 4XFBA 4HA8A 3LAPA 4MGRA 5FLXK 5CJ9A 1VP6A 2HS5A 3JTHA 5JHUA 1FXZA 3EQEA 2ADUA 4ZU5A 4EJVA 3WTSC 4D7SA 4Y15A 4LD5A 1UD1A 4XLPF 2LDUA 1R1TA 5T3NA 3KP6A 1TQ5A 2QQAA 1YFUA 1ZZ9A 2FA5A 1USSA 2O8XA 4E2GA 3RZZA 3WW3A 2BV6A 5FPXA 3U10A 3LA2A 1CAUA 3T1BA 2NNNA 4J1XA 3D82A 2HDCA 5H6RA 5DD4A 1FLIA 3GFMA 1XSXA 1G6NA 2E7XA 5I8YA 2IPQX 4KIBA 4WF2A 1KQ0A 3GUDA 1DUXC 3O2PE 3CJXA 4H0EA 1OKRA 2UZKA 3LQRA 5I8TA 3BALA 3U9GA 3MAJA 5DV5A 2FOKA 2NYXA 3KZZA 2Z2SB 1OD5A 1ZX5A 2HWVA 1O5UA 4FX0A 1JHFA 3WE2A 4LK0F 1OMIA 1W5SA 3RIRA 2IJLA 3BJ6A 3LWFA 2PBIA 1J0RA 1U5TB 4IEOA 5DDGA 3ZMSA 3RJPA 4YSFA 3P7NA 3V7CA 3L09A 2WWYA 3SZPA
chains in the Genus database with same CATH superfamily
1GBGA 1K45A 1PK6B 3KLNA 4FPFA 2W4SA 4XETA 1VQ7I 5DUVA 3H3UA 2DFIA 3S2DJ 1B4AA 4D6QA 1J75A 2IVJA 3MIBA 2BHZA 4GRIA 3N97A 1R082 3LDBA 3HEFA 4C2MJ 1WJ5A 2V7FA 1VRH1 3KYDB 2EV5A 1OOPB 1KYWA 5C70A 3WG9A 1PVC1 1TQIA 4Q47A 3R4UA 4HSJA 3WHBA 5JUVA 3HOSA 4HQEA 4QIWN 3OOXA 1SMYF 4KNYA 4D5FA 1GOHA 5K9YA 1BEV2 3SH3A 4Y3OA 4QKDA 4A3JJ 5HXMA 2PMZA 2X1EA 1HJFA 1W3VA 1LEDA 3FUQA 2XWBB 1LGBA 5FKMA 2DT6A 3GBFA 5F2WA 5B4NA 2EZLA 4QX8A 2DVDA 2F5FA 3P3NA 2R5ZA 3AZVA 5FJKA 3I2DA 3TMOA 1OQDA 1W6QB 3VZJA 4AQ2A 5TRDA 5IW0A 4QTRA 1YO5C 2PMUA 1PK6C 4NVPA 3P9KA 4QGLA 3KV5A 4HK8A 2ZX2A 3LEIA 2QZ8A 2K9ZA 3L7WA 3AK0A 2EV0A 1MZBA 2F2EA 4UUSA 2DJIA 3FKJA 3OYHA 2FDIA 2XGEA 4ANJA 1OOPC 3AG4H 4XUTA 4ESFA 3HSFA 4DFSA 2JDAA 1GKBA 1YOVB 4Z6YA 2DPUA 4XKWA 1RUC2 3MDPA 4QPIC 2ZXHA 3KP2A 5JPNB 4D0PA 3HWJA 4J1WA 2AXLA 4QU1A 2VVFA 1A78A 2OZUA 3MFKA 5C4WA 1R093 3BTCA 3LPFA 2ZXQA 5JMOA 5LEKA 1NG0A 3FMRA 1L3JA 1TW2A 3GVAA 4K6BA 1N77A 4U2AA 2HYKA 4Y22B 2I5UA 4GA9A 3NKTA 1MH4A 4E7IA 3N9QA 2XLAA 4BA6A 4NBQA 5DPNA 3BKZA 2ZHNA 4LHKA 5IHRA 4PDWA 2DCJA 4QM8A 2W82A 4XXAA 2H0BA 4PSXA 3BTYA 4CA9A 5FLHA 3RJRA 4NMIA 2HXOA 1XNCA 4XIKA 3CQZJ 5EHDA 2HGCA 1QU3A 1DG6A 4RGXA 4RS8A 4MXVA 5CISA 5IVVA 2MW8A 1XD7A 1OQYA 3E5QA 3S14J 3E97A 3KEOA 5CZKA 2WKKA 5GAGJ 3CCJI 3TOBA 3OYGA 3LFIA 3WCSA 1QVUA 2N8GA 3J9SA 3T1MA 1P6RA 4KITB 2EA7A 2VJXA 1YI2I 2HTSA 4NIIA 2VL8A 2HTJA 1IKQA 4I30A 3QPLA 1CJPA 4C3JJ 2VG9A 1SACA 4BMBA 4EMSA 5FP7A 2P5BA 3BI3A 5KAFC 1VFCA 1CIWA 5EZGA 1UXXX 4B3NA 1J3PA 1D3YA 3FL7A 5FZ3A 5J8FA 4D9JA 1EUUA 2JIGA 3A21A 2QLZA 2H6CA 4JAAA 2YHJA 5F9TA 1FPQA 4LO8A 4GIQA 4ZDLA 2IXSA 2XVGA 5IFTA 1TNSA 1VRBA 4XLCA 1J59A 3POFA 3FXRA 4XQFA 2OVUA 1QJX2 2QCOA 1J7KA 3OGJA 3WTVC 2DK5A 1S5LC 1HXS1 3VBHC 2Y0SA 2M4KA 3N3HA 2GXGA 5FZOB 5FXWA 3T8RA 1T38A 3TNQA 1IJWC 1QJU1 1C5IA 3HL2A 4P5HA 2B9SA 1ODNA 3T4VA 3I4PA 2VQTA 3LA3A 3M4FA 3OOPA 2G0EA 5L3BA 4BM8A 4IL7A 4EWAA 2VJ5A 3RCOA 2HWF2 4AIHA 3MEPA 3AKRA 5B3SH 3UESA 3MW4A 3CKHA 1Z7S1 1B09A 1RUE3 1KU7A 4YW7A 5CPRB 4QQPA 5K7ZA 1CAWB 2ZJ2A 4F3QA 1ND3B 3HRMA 2ID3A 5FOBB 1V4RA 4E4SA 1XNKA 2GC1A 4KN4X 3K4AA 3ZXEA 2OPTA 4IHVA 1W0NA 2XQRA 5CB7A 1ZM1A 1BMV1 3JB4C 4PFOA 1UCRA 5E3LA 4RGRA 2DUPA 3F3XA 3A1YA 2VJIA 3OUHA 1QJZA 5FZFA 2A69F 4BH9A 3IRRA 5JLWA 3TAYA 1K7AA 4BQ3A 4FTSA 1UIKA 3UR3C 3ZN4A 3CZJA 1PMHX 4LT5A 1RHI1 1XBFA 5FZCA 2P17A 4M71A 1RR7A 4NDLA 4E70A 4AFMA 2JUGA 1AR63 1RETA 2VCBA 2D1VA 3SCHA 1CF7A 2A07F 2KHMA 3BOQA 2E26A 3LDRA 3MVPA 2F17A 5FLXZ 3GXOA 4S2DA 3L2HA 2Y6GA 4KWKA 4FI9A 2TUNA 4B8EA 4N43B 5LA0A 2VIXA 2R072 1AXYA 4TLGA 1ZQ3P 4UFMA 2LALA 4JGZA 5KWRA 2HR3A 5D6EA 2HBTA 4ZONA 1ND3C 1YFYA 2Y38A 4XJWA 1SBFA 3JRBA 3CCLI 1NY71 5F5AA 1PGW1 5ACA1 5HCHA 2RVAA 3LSKA 1KU3A 1Z0HA 2HBUA 3SMHA 1RVF3 1VBA3 1B72A 5EP9A 3NWKA 2JB8A 3IH2A 2MD5A 1J58A 3HAGA 3VYRB 2XHNA 2GWRA 1Q8QA 1WWXA 3PJQA 3FXOA 1XGMA 5JDBA 1ASJ2 4LIUA 3KYLA 3OYEA 1F2NA 2EXHA 4AVSA 3FZVA 3MD2A 4RFT0 1MS9A 4BYYA 3U1DA 4V2GA 5A3OA 5FP8A 2YPRA 2W84A 5CFDB 1EV12 4OIRF 1RUJ1 2EWNA 2VOKA 4PI0A 2JDMA 5F5QA 1JOBA 2QKMB 5FMDA 3VD4A 3A23A 5IP9J 2Q8OA 1VBE2 3VKLA 3OBRA 1Y9MA 1F4HA 1EAH1 3N7JA 3D0SA 3IKWA 3WHTA 3H8UA 1VQ8I 4JHZA 1A31A 2IA1A 3HG9A 1W8HA 2RJKA 4FQZA 3ZXKA 1XDSA 1AHDP 3OGGA 1BR4A 3FLTA 4XFHA 5CKTA 1NTCA 3G6JB 3VBOB 2ELKA 2H0VA 5H9QA 2TCTA 1PUFA 3VDCA 1WI9A 5E88A 1UW8A 4RR3A 2PQQA 2PQSA 4BEHB 1AR91 1PM4A 4QHZA 2YXSA 5BOXA 2UY9A 3KV4A 5J40A 2W24A 4YZ4A 3BWGA 4UW6A 1H0BA 4IVNA 3J8F3 3ATGA 2GU9A 5J1UA 3PUHA 4IE7A 2P4EA 4OUSA 1RUI3 1X9TA 3GM8A 1FOWA 2FQPA 4L9JA 3OTFA 3WDTA 2ZABA 3JAMZ 2A3XA 1RRJA 1MBHA 5CFDC 4DOZA 2WWJA 4HBLA 2ZEZA 3QYEA 3H3VK 4JX4A 3N9OA 4ATEA 3T3YA 2ZGKA 2VUMJ 5IT9Z 4MQVA 2R042 3TQNA 2QVSB 2R5YA 3OD0A 4ISRA 2X1CA 2FE3A 2DV9A 2Y6HA 4XN3A 4IE5A 4Y20A 2VMHA 4R8HA 2PLYA 4MEYF 1QQIA 3FFQA 4HK9A 1YIFA 4LO6B 2JRMA 5FZKA 4UWDA 4PLOA 2RKHA 2CY6A 3B69A 1KS5A 2WTEA 3J7AO 3VBOC 4DIQA 4CEYA 3RGBA 3LSEA 4YM0A 4MV2A 3P3PA 2CSOA 3RZDJ 2MH2A 2E19A 3JSPA 1T08B 4IOAF 2X8KA 3VBSB 1JYVA 2WO7A 4BLJA 2ZTNA 3VB2A 4Z8BA 2Q8DA 1AHSA 2X51A 1D4M3 2QQOA 1FP1D 3OL4A 1US3A 4IQ4A 1AF9A 2X1DA 3M8FA 1O91A 5A3PA 5F0HA 1F31A 2WQ4A 1I1GA 1I1SA 5CLSA 1JKPC 1RKTA 4MH0E 2E7WA 3HHGA 4ZXEA 3BG5A 3BODA 5K5RA 3L2RA 2F5EA 1FMD2 1W5TA 4EEFG 4A12A 3ZXSA 1ODDA 3WDUA 1RI7A 1VTNC 2O61A 4BHBA 3W20A 4BL0B 3FXLA 3H42B 3TDZC 1I6XA 1QEXA 3IDBB 1X58A 2YC2A 1CAVB 2GLOA 2GNTA 4ENNA 1RYYA 4OI2A 5GP9A 2E1CA 2GQQA 3FHZA 1R1A2 2ORXA 2VOVA 5A2QZ 3J81K 2NQYA 3K4NA 1Z6RA 1FX5A 2L0KA 3F22A 2R0QC 5C71A 3A7QA 2I45A 5GLWA 3VBSC 1H9WA 1VIWB 3S3MA 3FMGA 1Z78A 1LDJA 4BQQA 1V6NA 1I5PA 3DL3A 2H94A 4S05A 2XB6C 4XJ9A 3TN91 4OMDA 2JMWA 4CEWC 4Q4X2 1BCXA 1TME2 1DGWA 1J5YA 3VB9A 2E51A 4HX4A 4HONA 1HQNA 1W9SA 3T5XA 4LUKA 2VONA 4WV8A 4A3FJ 1LEBA 1UZYA 5C9AA 5GLTA 3OYLA 4OZOA 4LG0A 4I7HA 2CV2A 3RYKA 4DXRA 5JOWA 1TC3C 5FD6A 1D2SA 4XDOA 1Y1VJ 2RS33 4CU6A 3DTKA 4FOYA 4MADA 4LLNA 4BKXA 3JW4A 5IYCJ 1QGPA 2LG4A 5E3OA 3CF6E 3X2QH 1GNYA 3PSIA 1LHWA 2G7HA 3JREA 4LBLA 2FDGA 1SFUA 4CZSA 3UGHA 4QXBA 3ACGA 2W00A 3UGGA 4BWOA 3T09A 3PUSA 2M87A 2JWTA 4YEJA 3S93A 1ZNPA 1DYPA 3TW6A 3J7AY 4KL1A 3U37A 2ZMEA 3CESA 2ME6A 4BDZA 2G9WA 5GPAA 5FBJA 3F72A 3UV9A 2Y0IA 1YFWA 3NNLA 4OAYA 1LEMA 4LJHA 1LKNA 2XMLA 2BW8A 4AVTA 1OPMA 2DMUA 3S1RJ 2LW8A 5E8AA 4RGGA 3T30A 4AFAA 5FUPA 4QX0A 1E2XA 4ZC3A 1R49A 4M0NA 1IG0A 4KBZA 5D4SA 2L7ZA 4CPBA 3HXLA 4RB2C 4GAZA 2Y33A 2DA2A 1W39A 1QJY2 4AWXB 2DYCA 1BBT2 1FBSA 3D5OA 3RPQA 3KVAA 4CDQB 4Y7NJ 1KZHA 3VYUB 3OGSA 5A80A 3QP5A 3A02A 5C3QA 1W7PA 4KYWA 5E1RA 3RPUD 3VDDC 4LO4B 1NAEA 3IAPA 3E0JB 1O4TA 4PBOA 2ZSIB 2JVHA 4QPGB 4YM1A 5TSWA 3ZFEC 2NRAC 1W8OA 1AVBA 5T52A 3F23A 3QWLA 3IKTA 2HQRA 1NX9A 2OA2A 4RD7A 3NV4A 2CYFA 5CU1A 5FMOL 3DUIA 1DDNA 3T0BA 4Y24A 3CC2I 3A0NA 4XHBA 3Q0UA 5CYVA 1RUNA 1HB1A 5DCMB 4IXLA 3AVSA 5A3LA 4CZZA 2ZZJA 3JCIA 4EQQA 1G59A 2RQPA 2K85A 1YJWI 3ZMDA 1UB9A 1IRGA 3POBA 3BPXA 3I59B 2DAOA 2YR2A 3COAC 3GO5A 4OHYA 1NZIA 1REDA 1SANA 1R71A 2QEXI 5A7QA 2L7MP 5BNOB 3O5SA 5FR3A 4O65A 1VBD2 2ET7A 3T4HB 4AHYA 1PZ9A 2R1DA 3GZ5A 3A01B 5D4RA 4EM0B 1DGRN 4BLIA 1PDNC 2K46A 5IAXA 2RE9A 5C3PA 3F8MA 2RS52 2OUJA 2K02A 4QPGC 2CRGA 2YGLA 2J1VA 5FO8B 3KWVA 5M5WJ 3ETPA 5EGOA 2UXNA 4N8MA 5L7OA 2VO5A 2VQLA 1BN5A 2R7TA 2FBEA 4DGWB 1RUF3 5DMYA 2W7NA 3DXJF 2KLOA 4B1MA 3H5NA 4JKLA 3WHCA 3NAPB 4MQ9F 4FFIA 2OU2A 3K6GA 1BA5A 2P6SA 2L9SA 3CLOA 1TG7A 3CEWA 5BNOC 1US2A 3FIWA 1VPHA 2CMPA 3BJOA 1VALA 2DMTA 4DBQA 4BE3A 3UKGA 5CA6A 1QQP1 4M3BA 4OHVA 2KISA 2EIGA 2ME0A 1LNSA 3WNNA 2GXBA 3WR0A 5CEHA 1C57A 4BE2A 4M3DA 2GMMA 3IN9A 2E32A 5DTDA 3O0WA 4M0HA 2ELHA 1FY7A 3M1HA 3MLJA 2CU7A 2GM4A 1AXZA 1U12A 1DQ1A 5AFBA 3K2OA 4YVWA 3H8XA 1W99A 1SAXA 4KA4A 1HKSA 3ZYPA 1H88C 2IGNA 2EINH 5JOYA 4QX2A 4MO3M 4AQ6A 1PX3A 4CUCA 3U4XA 3F0CA 3EYIA 5CVVA 4A6SA 4RGUA 2QUFA 2YMZA 3RZMA 1QH6A 4XUNA 3WLUA 4IEJA 1MW7A 3NAPC 5EF6A 1F36A 4EN9B 1UNBA 4J00A 1W6OB 1H1IA 1XDUA 1Z6TA 2ZACA 2YGMA 2R92J 2HFHA 1AR81 1IPJA 3HB9A 3I2FA 1GXQA 2OBPA 2CYYA 2AYHA 3FBNB 2FMDA 1KA8A 5FYTA 3TO7A 1UY0A 2L54A 4LTAA 1SLTA 4Q4W2 1AX1A 4QXKA 2M0MA 3POWA 1QY4A 3M3CA 2DJNA 2R0HA 1JJ8C 3R05A 1STZA 3QP6A 1ENHA 1X3WB 1QIQA 4AF9A 1FNYA 3M8LA 1MJAA 3VLBB 4ZYAA 3QODA 1T0FC 2IGMA 3G1OA 4P9FA 4E6KG 1YJLA 2MGQA 4BQYA 1RUOA 1JZ6A 3LSGA 1LFBA 1C5HA 4PIXA 4K21A 1YYVA 2K5CA 5ILUA 2V1NA 2ERFA 2IWGB 2QCSB 5ICCA 1FYLA 2VW0A 1FT9A 2OW4A 3H9QA 5AVPA 1YTYA 5F6FA 1JS9A 1YS7A 4IX7A 3CF5F 4N7UA 4A3EJ 4CP9B 2M4GA 3LEKA 1UELB 2ZGUA 2ISZA 4DRRA 4GKXA 5L3EA 2WZR2 1X1CA 1ETYA 4ZH4F 2VB6A 4XLEA 1KJLA 3KHBA 3OGRA 2ZJPF 2QDNA 3DLLF 5EJ1B 1S7AA 3R61A 1ZARA 5J37A 4XILA 3W59A 2JDZA 3ZFFC 1ENXA 2J42A 1GUUA 3VHPA 1LJ9A 3ASOH 4MVTA 2XBO1 4XKVA 4LHLA 4L5JA 1MS8A 2JE8A 2RM22 2BOLA 3R4DB 1HRV3 4YRDA 3BP8A 3OBAA 4CYDA 4GWMA 3JRHA 5DQ0A 2J1SA 3WTWC 2OTLI 1J3QA 3QPTA 1CX1A 3QYFA 5K4LA 2WZEA 1ZBE3 2TRTA 4UBGA 3DTEA 2DW4A 2JENA 1P4XA 3RZJA 1XC5A 3HGYA 3CCSI 2WA0A 3B93A 5KVRA 3ZMNA 2DOEA 3EQLF 1CZSA 1WPKA 2GNBA 2R061 3Q8AA 2FEZA 3SC7X 4CDXB 4BQ1A 3ACHA 2PHFA 3F6OA 3TOAA 4ATFA 1R083 3OSDA 3GCXA 2AO9A 1V00A 3HOWJ 2Z9OA 3HOVJ 2BBYA 2YS9A 4XLFA 5DUKA 4YFKF 2FU4A 2RR13 1W6PA 5FQ0A 2O7OA 1KGSA 1D8KA 2EPFA 4NHXA 1VMJA 3WF3A 2A6HF 2E7TA 1J83A 2F5DA 1W8TA 4DMIA 3VSLA 2DI3A 2Y9YA 4QM9A 4WVZA 5LHGA 3JTGA 2J5PA 4CGZA 1O57A 1PO22 2DBBA 4KUMA 3FX3A 4XUQA 5FP9A 2KRHA 3UKTA 4A5NA 5JLXA 2RS12 1H9GA 2YU3A 1ZRIA 3MLKA 4IUGA 1ZVFA 1KQ9A 2ZPXA 1X19A 1YG2A 1V9U3 1DZTA 2RMU1 1A34A 3TNPB 4DZGA 1OXCA 1AU7A 4E9KA 2XJUA 1UU6A 1LOGA 2WADA 1XSRA 4YFZA 2QENA 3LNQA 4QB1A 4XICA 2PHRA 3MZ8A 4XVHA 3TL4X 1WLDA 1ZG1A 3QLQA 4N0BA 1SBDA 5IK8A 1PP7U 2OPKA 4JHTA 3S3OA 3BB6A 4CDXC 2K0GA 1DFQA 5ANNA 4CE8A 3HKZN 5FY7A 3KE2A 1D0GA 3SH5A 2CTVA 2VNGA 5ABJB 3UNPA 4D94A 3FXKA 2QUOA 3APBA 3LSMA 2Y30A 4DYQA 3DYPA 5JOZA 2FX0A 4JTNA 1ZKGA 3KP4A 1ULOA 3BPVA 3GXUA 1Q43A 4AEDA 2ADDA 1FMVA 2Z69A 4YFWA 3WNPA 3MO4A 1FP2A 5HXVA 1DYKA 2KIMA 2CO5A 5GZFA 1ON2A 3MGUA 5FPUA 2O14A 1IN7A 3DPUA 4RL7A 3WV6A 3B00A 3OEAA 4ESJA 2JN6A 3JUUA 4XXPA 4YELA 1UYZA 3PURA 3HBZA 3U14A 1DF0A 4AI9A 2W48A 2W95A 1DP7P 3PM1A 3QD6A 3ZKYA 3K51A 4AVPA 2XL7A 1BC8C 4LGWA 1UYXA 4HSLA 2WN2A 4EM1A 4ISQA 2X5IA 2HQ5A 3PO2J 1B35B 4ENMA 4R52A 4NE9A 2XHKA 4ZPIA 2E5NA 1VQLI 3S7IA 1Z7UA 3V0AA 1ZBA1 3Q3SA 2UWCA 1VAKA 5DN2A 1W6NB 5ABJC 5GLZA 2J1TA 2XAJA 3GYHX 2CWSA 2VLAA 2CW7A 3PNVA 1NZCA 1UAAA 5DZFA 5FK8A 5C6CA 4YRVA 1L0OC 2EV6A 4IGPA 2VE8A 5E3NA 4WXHA 4XUPA 1BW5A 1WA4A 4A45A 5IK5A 2COBA 1YQ2A 4Y33A 4R1HA 2HEOA 1NCQB 4ES8A 3OOUA 2MH9A 1RIRA 5FZAA 4KIFA 2YZ4A 1HBXG 1AZDA 2K9SA 1VMFA 3I2HA 4DB5A 2R6QA 1MS1A 2OT7A 1X8MA 2VZUA 5FTTC 2QQIA 1H2MA 1PGL1 1FEXA 3WG2A 4BHPA 2FBIA 5A3NA 1ETVA 4XFFA 3K2ZA 1MQTB 5BY5A 2FRHA 4A69C 4OI1A 1BYHA 1ZZ7A 1TT0A 3WGIA 2ZFUA 4IPAA 4INDA 4Q29A 4K1YA 3ABTA 5H6QA 4QMAA 3AKTA 3RZOJ 3IDEA 3POJA 4PF1A 4XQDA 5EV7A 5J4YA 2VTXJ 1B35C 4GJYA 3KS7A 1UCXA 1WMFA 1A6QA 2CGOA 3AXDA 1BXHA 2DLLA 2CW0F 1S2KA 1WRJA 4PBPA 2A6WA 2YBPA 4BJTA 5C3EJ 4MEXF 1RUF1 5JMCA 1BC7C 1OD3A 4KISA 1BL0A 4A7KA 1TNTA 1W4MA 2J5OA 4ZYGA 1S0EA 3IPVA 5JIAA 2PJPA 2NM1A 3ZQQA 5L9RA 1YNAA 1TQPA 3RI4A 2VOTA 4LBMA 4ARXA 2DTZA 2DODA 3LF7A 5FZ6A 1MDMA 3VKNA 4H7LA 4OHWA 4J25A 4HX8A 3FC0A 3M3OA 1T6SA 1HB2A 1DYOA 3RMYA 1X8EA 3NL1A 4MXWB 1RMU3 3BU0A 5AC93 2OV7A 2EFOA 2J1AA 4XBLA 1NCQC 2PEXA 5FP3A 3BIEA 2R7EB 5EEHA 1UYYA 3TBDA 4X1EA 2P2KA 1L3LA 2JWPA 3H5AA 2HWF3 3HEIA 1JOJA 2K3FA 2Q1MA 2BXYA 5ICGA 5FZ0A 1A3KA 4FPKA 2WDBA 3K69A 4QX1A 3M7AA 4XFBA 4HA8A 3LAPA 3WHUA 2WAFA 1YQCA 4MGRA 3DWLE 3WP5A 1S1AA 2OUHA 2PHWA 4PLNA 1IDZA 3EQEA 3P6BA 5IAVA 2R7XA 1PO12 3HBKA 2ADUA 1N3PA 2WNUA 2VCMA 4LD5A 3KX2A 3T2QA 4XLPF 1ITYA 1TQ5A 3PMEA 2QQAA 3H1CA 1H8TB 3JD73 3OPWA 1YFUA 1ZZ9A 1ONAA 2I2SA 1SLCA 1USSA 2FUG2 3RZZA 2CH0A 1VAMA 2ZEXA 3ZXLA 4E8CA 1CAUA 3BOPA 1CN1A 2HDCA 1F5FA 5FZMA 5H6RA 3GFMA 1XSXA 4K1ZA 1PIV2 3GUDA 4RGAA 3VKMA 5A6YA 2Z5WA 3CJXA 4C3IJ 3LQRA 1ENRA 1JU4A 4AYUA 2LC2A 2YROA 4LBKA 4COVA 3MAJA 5DV5A 2WT0A 2NYXA 3B6AA 1D0YA 2DYSH 4BUPA 1G9DA 4IHXA 2Z2SB 2JA8J 5A33B 1YX3A 1OD5A 4DYRA 2V4JC 1CVNA 2R073 5EG0B 2QA4I 1ND2A 2WLPA 3MIHA 2IJLA 3LFMA 3LWFA 2PBIA 2NVTJ 4FPOB 4WVWA 3P7NA 4AK3A 2AC1A 3SZPA 4KIGA 2EXKA 3WQ0A 3ZXGA 1QF3A 4Z2AA 4IDZA 3CMEI 1QO0D 1H8TC 3RSJA 2VPLA 3UL2A 2EJRA 5CVJA 3M8EA 1N78A 5FP4A 5LBFA 1KEXA 1ASJ3 5A6XA 4LLOA 2EZKA 4QX5A 5JVVA 4QXCA 2ZX1A 4NHYA 3ZSJA 1DGRM 3QH6A 2V1DA 1QXJA 1VB2A 3WDWA 3CDHA 5F0CA 2W46A 3AMHA 2RDPA 3HSRA 1MMSA 4DEVA 5FZLA 4E7JA 2OQ7A 3BTIA 3UNGC 5J3UA 3H1MA 2F6CA 5DAPA 2P34A 3FHNA 3TP0A 4RLQA 2KRFA 3SFIA 2MNGA 2K9QA 4XRFA 2CJJA 1OLQA 1COV1 1O6UA 3SZGA 4OZXA 1JE8A 1W2UA 3CBNA 2ZGOA 3B9CA 5IYBJ 2E2JJ 1HKTA 2V1UA 4TV7A 3EUAA 4QLCU 3WVJA 4P9UA 1DHKB 1DQ4A 1VQ5I 3CCYA 3PDQA 4LE4A 3AMQA 5LRSA 2GDFA 5CFCB 2R4GA 2CQ7A 1HRI3 5B2GB 2OXBA 2QQKA 2HVQA 1QZEA 3JRCA 4Y17A 2YUSA 1NLQA 2XOMA 1OSGA 1RINA 5F32A 1KQ8A 1I39A 1W9YA 3POEA 4AHZA 4IO9F 3BIWE 4XBFA 3DCQA 1YHFA 3EMRA 4RS5B 2X0LA 3RS6A 5G05L 2M7AA 1SDWA 4AI1A 1WW4A 2B9VA 1PJRA 3BZKA 4FVVA 1MJBA 4E2SA 1R081 2I74A 1E57A 1XMXA 4OU0A 1DGWX 1ACCA 5L3DA 5A7WB 2V5DA 2ZO4A 3IZOA 5FZDA 1WKYA 1LU1A 3NKGA 3IAQA 3W5MA 4XOTA 1C4RA 3HNBM 1XNAA 3GNEA 2DU1A 4IEXA 4GH4B 2VVDA 1YYNA 1P4AA 5JVGF 1BEV1 5BXXA 4IESA 4E27A 3P5JA 2O9LA 2KR2A 2H6BA 1AL23 1J3RA 4F7ZA 3ME2A 2VOWA 4CDUC 2G4IA 3MBWA 5CFCC 4DINB 1TWFJ 4HDUA 1G3SA 1LCLA 1D2QA 3KZYA 1JT0A 4AEMA 2K9MA 4HFSA 1SD7A 3TO9A 1RB8G 3OPZA 1E3HA 3JBG2 3GLLA 2HNHA 3OD4A 4SBVA 1WZXA 4RAYA 3FMSA 1LHVA 1OLMA 5A3WA 2VKDA 1NQDA 2DFBA 1NA1A 1A04A 2QYOA 4RS5C 1WH7A 2GZWA 2P3JA 4FP3A 2IUWA 2DF7A 3LFKA 2WNOA 2DO7A 3OYCA 1DQ5A 4WM7A 4TXWA 1JZ3A 1IUYA 3I54A 1UF2C 2HEVF 1C8M2 5IT6A 1OCPA 5J48A 1UHSA 4KWLA 2HVRA 3D4KA 3OJBA 3WGHA 1VLNA 2UV1A 3K75B 2HWC3 2OA4A 1FSHA 3OYJA 3KGLA 3HHHA 1RUC1 3I71A 4A7YA 4XIOA 3DF8A 2HI3A 4DUXA 2JKXA 1JUMA 3A0BC 1W2OA 3LQCA 4OIOF 2D6NA 3I2IA 3RQ4A 4B3XA 1UL9A 4IERA 4OUMA 5F1RA 1BOAA 4H55A 2R5ZB 1QJEA 5M3FJ 4CP1A 5GZCA 3K1MA 4P9IA 3BTZA 3LE0A 5IVFA 3IIAA 1OJLA 1P7IA 2R30A 5BNPB 4JBAA 4JGYA 2ZHKA 2GH2A 3S1MJ 4B7KA 1WUVA 3LSJA 4DXZA 2W85A 1W8NA 4FXKB 2KZGA 4UUSB 3KLSA 1LVKA 1B8IA 3PNAA 5FBZA 4I09A 3PUIA 3Q0WA 4ZZLA 2FDFA 4TZDA 4M3CF 4AVVA 4B4RA 1HW1A 1U3EM 1POQA 2WFF2 5JSOA 3HOTA 2MEV2 1JHJA 2BBVA 4QX3A 5LHHA 2KZVA 1LTEA 5KXCA 2XUMA 2JG9B 2FBHA 4DQ2A 3ZPLA 3DYMA 5C4WB 1MKMA 1ZZBA 5HS7A 4NR1A 3WDXA 3JB8A 5LBCA 5FMBA 3P1IA 1FMWA 2QDRA 2XPUA 1X33A 5CVUA 1WSUA 4A3GJ 2GSYA 4KGQA 5BPDA 1UU4A 4KFCA 3NV2A 1SAUA 1S0JA 4DZJA 1LB2A 4MG2A 5FO7B 1LULA 3E3VA 1JYTA 1UMZA 4G7HF 1XG1A 4AAXA 1TVGA 1ULPA 2UUZA 2B0LA 1LFUP 2A6EF 1GHCA 4YG0A 3T0AA 2OCEA 4GGGA 4F8AA 2ZZQA 2FOWA 1S0CA 2Z4FA 5KXBA 4MGZE 1QDCA 5FPAA 1QMJA 2V6EA 2AXTC 2B5HA 1QQP2 2MYSA 1J1LA 4EN6B 2DMNA 4G6TB 3WNKA 4XIDA 3K7AJ 3ZXAC 5EYXA 1SLBA 2JDYA 1RJ7A 2VJ4A 4FISA 2ZAAA 4PF5A 1WCMJ 1OKQA 1IDYA 4FPGA 2CAVA 1QJX1 1RUH3 1ZZCA 1VQKI 1PNFA 2DCYA 3VBRA 1JGGA 1YQAA 1AYN2 2DCZA 1FBQA 3L00A 4PLMA 3L2WA 2OZ6A 4XCBA 2VZ1A 5C4WC 2Z42A 2KP6A 4ABZA 4I6ZA 3GFIA 2WRAA 1G9FA 2B39A 1RKWA 4FSJA 3VZKA 2BVVA 1H89C 5FZIA 1QPMA 2QSHX 2XIGA 1G8WA 2LYCA 2UWMA 4AEKA 2LP0A 3QU3A 2Z99A 5HVQC 4CO8A 2FCTA 4FFFA 5DS9A 3J80K 5K5QA 4CDWA 5A7SA 4CXWA 3HJEA 3OF1A 3PU3A 3D5RC 4PDWC 3ST7A 3O8HA 1FTTA 2C5DA 2JG8A 3K4MA 2HH9A 4UAPA 3ABUA 4OVEA 4NC7A 1YEWA 2MBFA 2FF4A 3R4SA 3K4JA 3SEZA 5EPAA 2R49A 3AMPA 3C7HA 5DAQA 1IF1A 1VJ2A 2C9AA 3I97A 4XF4A 5JR3A 5DD8A 4IXAA 4HNUA 2CV1A 2D6MA 5IUQA 3BPZA 2BVBA 1ZAOA 2HWD2 3GTMJ 5J6XA 2GA1A 2W25A 2EF6A 1DPRA 1EH8A 5A1AA 2AACA 3WW4A 3M3EA 1UOJA 3I2KA 4DRVA 3ZYIB 4OINF 2WZ8A 4I02A 1KJRA 1JKQC 2HOTA 2VZRA 2RV8A 2RS53 4CHUA 4AFDA 2XKOA 4LK6A 1CZVA 4MFDA 2DTYA 5FWJA 2WV0A 4L0PA 3CDIA 2LS6A 3KCCA 1ZELA 1ZLJA 2VBYA 2ECCA 4LULA 2XH6A 3HPNA 5HV0A 1NYWA 2HZTA 5FJ8J 3GYDA 2RJLA 2YG0A 5KR7A 3AB0A 3TB0A 3AYAA 3EHKA 1ODMA 2ICWG 1P9QC 1CIYA 3MF9A 5DAWA 4IV1A 1T2XA 3W2VA 2LY1A 3GX4X 1LJ7A 5IVCA 4Q4V2 4IE0A 5K0UA 4U87A 4UNOA 2D98A 2XBO2 5HNHA 5DDJ2 2XB5A 5FYVA 4Y5Z0 2D3SA 2VOPA 1R5ID 2IGOA 5HODA 2AQFA 2A7AA 5A70A 2KJCA 1FC3A 1ZZ8A 4BNCA 1CF7B 4R79A 4S2GA 4YW6A 4MNUA 2D40A 3M7GA 2YPJA 1NK3P 2PHDA 4UHTA 2QJVA 2R7RA 2YDEA 1EV11 4IOCF 3U0ZA 4FAHA 4D7NA 2R7VA 1EYBA 4UV8A 2JDNA 4TLFA 1VNDA 1VBE1 4JGZB 1JOPA 2ZGRA 4FOQA 3U4SA 4P14A 1W9TA 1VQ6I 2OIIA 5LBQA 2CWEA 3KF3A 2IVIB 2EBIA 4NAOA 4HN1A 3ILRA 4AUXA 4MGIE 4XFGA 3MW3A 4XFCA 1YFXA 1JTYA 4LE3A 3PTRB 1PVC3 1X3ZB 1B72B 5KHIA 1KITA 4XJZA 3G71I 4OI4A 2TBVA 1Y39A 1YO8A 2D3RA 2HJIA 4ESBA 2BJSA 3RMXA 3DBHB 1S7OA 4YIIA 4G9SB 1BJZA 2J7MA 4HF2A 2LROA 4QKNA 1IS5A 5IVJA 3MICA 3VD3A 1QKQA 4QQOA 2Y31A 3I3EA 4I01A 4RA0A 4Q4W3 1POGA 2HEWF 3I4IA 5L36A 2OZJA 1D0ZA 3BTAA 4BJ0A 4RAGA 1HB3A 4XBNA 4ONUA 1A36A 3RQ0A 5H9RA 1UPIA 2E71A 2JD9A 4BPZA 2UU8A 3POYA 2PMHA 2R041 3NSTA 5F6KA 4JGZC 3NJZA 1I5ZA 1Z7LA 1R58A 5GZEA 1HJGA 1ALYA 2RREA 3B3QE 1HW5A 5H20A 3WG7H 3RVHA 1PUFB 3JU9A 3PTYA 1HX6A 1GMMA 4RR3B 3I3DA 4XJUA 5J96B 1BM9A 2LUWA 4JC1A 3AL5A 2B8MA 4Y1ZA 1X82A 3CP8A 4CUAA 4I98B 4OQ9A 1S6LA 2VMIA 2FJ1A 2D6OX 3K46A 3OPTA 3HRSA 1CJDA 4S2FA 4QPYA 5SV8A 1ULDA 2ID6A 4MYEA 3IT8A 2VQUA 2HWB1 4ET7A 1UIJA 4HVRA 2RVCA 3EPZA 5JXGA 4I99C 1DQ0A 3G2BA 1UMIA 2IS6A 1UG2A 2KJBA 4Q4Y2 3HZJA 3I56I 3FBIB 4XL9A 5C3SA 5CG9A 2WZR3 5DM7F 2EFNA 1YRNB 3FM5A 3G3ZA 3GTJJ 3OY8A 1UMQA 4AM3A 4M3GA 1RUD2 2A73B 2SLIA 4HMZA 2R5YB 5D8LB 1FMD1 1L7QA 3M1EA 3G1MA 4BB3A 3E6CC 4Y20B 1RJ8A 1XCBA 2MPFA 4KT5C 4JDMA 5HLIA 1O4XA 3W5NA 2QBXA 1N1YA 2PXJA 1GOGA 1K6OA 4EN0A 2BY2A 3H0GJ 1ZBA2 2WS91 5JI7A 2EFQA 2RM23 4MLOA 4CEYB 3RKWA 1R1A1 3KLOA 4RR3C 2ZHMA 1WCUA 1IZ3A 1A35A 1B9MA 3CUQA 3HBLA 4PK4A 3V65A 4QSHA 4HKLA 4N43A 1IRFA 1QXPA 2ATFA 3ZQFA 2PG4A 2VKVA 5EEGA 3CZ6A 1K4TA 3TKYA 4M9ZA 2VVEA 3ELNA 3S2WA 2OD5A 5GAEJ 4E4ZA 3HR9A 4M3EA 1MNDA 2L7FP 4UOJA 5HDKA 3FK6A 4Q4X1 2VXZA 3EYPA 1TME1 1H6YA 4R4ZA 4PJMA 2M5WA 1QXRA 3PJRA 3TOJA 1Y3TA 4G9YA 1X36A 1MACA 1W8ZA 4UI9L 4AXOA 3MQ0A 4AL9A 4M9XA 2DTRA 1TWGJ 2FD8A 5IOYA 1FAYA 4CP2A 5CKQA 1GOFA 3MHZA 2A6XA 2BXZA 4NPLA 1QZYA 2KT0A 3V4GA 4CCKA 4N7IA 3AVRA 1GANA 1FWZA 5F3GA 4BQXA 2RS13 4CEYC 1BLZA 3MUZ1 1UHMA 1HXS3 3M07A 3T0DA 4KBBA 1WHUA 1BIAA 5FKKA 3E1F1 5T5LA 1JMUB 2W1SA 4XW3A 1Y9QA 4V2VA 4ENJA 1QNYA 1QJU3 1OQEA 1A6CA 3SEPA 1EH7A 1OYYA 2VTXA 2X6XA 5LA9A 4LLLA 3LDKA 3LZZA 4ZJZA 1F35A 4N4NB 3K70D 1FNZA 1K3IA 3PNTA 4YFNF 3PQKA 4CSWA 3O0VA 3E6BA 4K8FA 4RQPA 4XQ4A 3LSIA 5KNLA 5C9AB 3S1NJ 1QDOA 1BBYA 2Y2ZA 1Z7S3 4LG0B 4CPBD 1POV0 4GB32 2DDUA 1QU0A 4HF1A 1WD3A 2GP5A 2CUFA 1C1LA 4XFIA 3G1LA 5ERIA 1W7PD 1SCSA 4LBNA 1QJY1 1IN5A 4DJAA 1BBT1 5F37A 3LEGA 3I8TA 4AYBN 3BUCA 3FHQA 1HKDA 1RTVA 3IDAA 1XPXA 2Y6KA 3OEBA 1SLLA 3NV3A 3BYWA 5GADJ 4R4XA 4NJ4A 4E4HA 2CV6A 2AENA 2MLKA 5FCCA 4LBQD 2P6TA 2YC4A 3OBTA 2GOXB 1RHI3 1PYVA 4LKEA 4LB6B 3OS0A 2DVAA 3CDZB 1NG6A 2X29A 3WDYA 3I2OA 2KIQA 5BMZA 3WU1B 4ZXKA 3LPGA 5C9AC 2DA4A 3BOWA 3GTKJ 2JEMA 3EYYA 2I8DA 2XSJC 1UQXA 1ON1A 1FZPB 4G3YC 4OQ8A 2JTVA 5DEQA 1W7PB 1DQUA 4AVBA 3FWEA 3OS1A 5FD5A 3ZQCA 3LWCA 4AI2A 3VD7A 3ZX7A 4YZ2A 1H1AA 3AZZA 1UKGA 1VBD1 1LESA 3SH4A 2ZAHA 4PGHA 4QGMA 1WH5A 3EUKL 1Z0XA 2HOAA 3OBZA 3VDBA 2V9PA 1GP6A 5APAA 4M6VA 1IZ1A 2QGUA 2RS51 1IXRC 3A03A 4EATA 1HXDA 3M4OJ 4NIHA 3PU8A 2ZMEC 1XXNA 4J19A 1MS3A 3CDLA 1HW2A 3CD6I 4LBQB 2FMYA 3RKQA 1H8AC 4DW6A 3LKJA 5DXDA 1WJDA 4EROA 2GN7A 2ZKZA 2PFWA 2YFUA 5FKNA 3K70C 3RZGA 4JX6A 1OFCX 1RUJ3 5A3UA 4QGNA 5FWEA 1UJ8A 1NH3A 2DTWA 2YU1A 5L9BA 4GCVA 1EAH3 3OYDA 1YE9A 2X4HA 4V2FA 3OIPA 1U2WA 3PFYA 5H9SA 1COV2 4Q0VA 1NHAA 2PX9A 1O59A 5C8CA 5JZGA 4BK5A 3CMYA 2V26A 2QM3A 3W21A 2ZNYA 3KVBA 5L3GA 4NNJA 3CLPA 1JN2P 1AR93 1AUYA 4FPYA 4RHV1 3CP2A 1W2NA 5LY1A 2FQ4A 2Y75A 4U7DA 1DU3D 1DDLA 1YX5A 4QWQA 1F1ZA 3ERMA 2C24A 2JSPA 1UZZA 4RFRB 5FY4A 2WV1A 4YG3A 5L7OB 3SCGA 1OR7A 4V2WA 2WT1A 4BXSV 2G9FA 1R092 3IL2A 3I0TA 3LSPA 3GWZA 5FZBA 3W6VA 1BQPA 5CAZA 4NRPA 4UUTA 5D2AA 3ECHA 3BTXA 1U0JA 4BXUA 4QHOA 4OOIA 3M1CA 3SQNA 3MZHA 3SDBA 2H8RA 3ZXDA 2ZGMA 3GHNA 3ZO0B 3HIFA 2B7EA 4XKBA 1S0BA 4KU7A 3AP9A 4HSTA 1S2BA 3IKVA 3Q9SA 6PAXA 3DKWA 1LGCA 3J7NA 4LMFA 2WNEA 5FZHA 1A8DA 3H7JA 2EB7A 3F8FA 4EJTA 4QPIB 3ISPA 2KRCA 4IHSA 4YVSA 2GMEA 4RM3A 1OFNA 1OUSA 4B48A 2QVOA 2BBAA 2W1OA 1QJFA 3SZTA 3VBFA 4M3CE 1W2AX 1P92A 4Q4W1 1PZ8A 5FLMJ 1HQWA 2FNPA 1UX7A 5F08A 1ZREA 5L7OC 4CDQA 4YVWB 3ABKH 3KP3A 4IRHA 1XU2A 2WFPA 1B6AA 5C4XJ 1NE4A 3CO6C 1ZLKA 4BQNA 2ZC2A 5JFRA 2NP0A 1LPQA 3I9V2 3ZVXA 5FYBA 3FDYA 4EN7B 2EIEA 2C26A 2XGCA 3OUJA 3JZVA 4D8MA 3F6VA 4WBBA 1XGNA 3L9JT 4LIVA 1BI3A 2XUBA 1S0FA 1ZYBA 2A75A 5DCMA 1S0GA 3NJYA 4EWEA 2DMQA 4AYBA 1G3WA 1H9TA 3VWBA 3UJQA 5L3CA 4CVUA 4DZPA 5IWFA 3N9MA 3AP4A 2NYYA 1TTYA 2VW1A 3SCFA 5D5VB 2WZR1 4AWDA 4XMYA 5TJJA 2K2SA 3TN93 1ZG3A 4EM2A 4Y1YA 3RPUA 4YVWC 3A0HC 3CC4I 2OKXA 3ZOIA 4R9AA 2KXLA 2CSGA 1SPPB 4GALA 4AHWA 1PGSA 4PJNA 1W0TA 2VXDA 3J4UH 4KWUA 3VYSB 4BJ5C 5T55A 2OQRA 5EZHA 1O4YA 2Z16A 3BZ6A 2RM21 1GXPA 5B5EC 1RUE2 3W6KB 4Y13A 3QOPA 2KL4A 2A68F 1PUEE 1NT0A 3VBHB 1GUIA 1IS6A 1MS5A 5FK7A 1NXMA 2L3DA 1M06G 3ZN6A 3OY9A 1GNHA 3WINE 5AONA 3ML6A 4BHCA 2W1WA 2K4JA 1IW7F 2Q0OA 1MZFA 2WWSA 3DXTA 4EZ4A 5HNFA 3EUHA 5CVIA 1IKPA 3ACFA 2GC0A 1DLCA 1UHWA 3HSEA 3KGZA 5F39A 5HLHA 2C4XA 4XLNF 1TQMA 1H6XA 5I8SA 2VULA 3QYBA 2VH9A 2E35A 3ILNA 3CCVI 4BGDA 4FOWA 5J98B 1VBB2 3IRQA 4V1PA 2FD5A 2J22A 4NN0A 3LOIA 4GZ9A 1AR62 4C1WA 3GZAA 3S16J 1Z1DA 4NHJA 2AGSA 1W9WA 1LRHA 3H92A 5FY5A 1PO21 4CCCA 1JGSA 1IAWA 5D6FA 1OCOH 4HPKA 2RS11 2D1HA 3UGFA 4KU8A 4FTHA 1BZWA 1KD7A 1V5FA 1VBC2 1Q1VA 2M2EA 4B47A 1HIXA 2ES3A 1SFKA 1HV1A 5FV3A 1FPN1 3SYTA 4OLLA 2YUEA 3PVBB 3N7LA 3HD8B 3KEQA 3D5LA 3FKIJ 2LREA 2QQJA 4WWCA 5F6LB 1RVF2 1Z77A 3BQYA 1VZ0A 2Y64A 3P9CA 1K42A 2D93A 3I4NJ 1IUFA 2HYGD 1KDKA 4BY7J 1UO9A 1XRUA 1HCRA 2P5LC 1QHGA 1H30A 1SLAA 3LAGA 3RZHA 2ISYA 2CQKA 3MLLA 1MZ5A 2E1OA 5E16A 4CDGA 4O3MA 1DZRA 4EWDA 2E7AA 3THCA 5KBFA 2WAOA 2P7VB 1G9BA 4GFBA 4BE1A 4AVAA 5FIXA 4L5EA 4RM2A 3HOBA 2W0XA 2XV4S 2ZEWA 4BXXJ 2D6PA 4YWAA 2IXLA 1CX4A 2A71A 1S4CA 1U5TA 4RGKA 1XE0A 4D1QA 5HPOA 3AFGA 1WZ2A 1SMTA 2A6ZA 5I0RA 4FBFA 2P3YA 1AYM2 3I3QA 1IQDC 2XVLA 2D6LX 2JPBA 2L4AA 4WXCA 3O8GA 2LK2A 1WKMA 2YYOA 3TEZA 3DGTA 4BQAA 4CU8A 2H1KA 4N9HA 2Y6JA 2E9QA 5FY1A 4AAPA 4Y5SA 5LFAA 3MWMA 5J1XA 3WQ7A 5F1JA 1AX2A 3J8F2 2WFF3 3P5BA 2CQQA 3NWSA 1OCZH 4W97A 3ULQB 1OCRH 1LR5A 3PL8A 4G7ZF 1LOBA 4B09A 4AEDB 5FPZA 4A0XA 1YI9A 5FROA 2DU9A 3OB8A 4CP9A 2F6BA 4KN7X 5C33A 1Q3EA 3WP6A 5FXVA 4U36A 5KXEA 4AQSA 4F55A 1K5MA 1ZYRF 1RC6A 2R7WA 5B1BH 2Y34A 1XYPA 3ZFGA 5FOJB 1UMHA 1GZ9A 5ERLA 4NWVA 4ETSA 3GF2A 4YM3A 1E5SA 5FLXK 1VP6A 2HS5A 1AA7A 4A6OA 4P5YA 3VL8A 4ASLA 3ZQGA 2LLKA 4JCKA 5F7UA 4M3FA 3RJ2X 2EZIA 4Y15A 4A4AA 5LB6A 2LDUA 1R1TA 1QQP3 2TEPA 2O5RA 4CCDA 3V0AB 4BY1J 4DO0A 2O8XA 4E2GA 3WW3A 5FPXA 1KRIA 3T1BA 1D4M2 4BMEA 4J1XA 5C3OA 4GWNA 3VSKA 1FLIA 1W6MA 1YRZA 2IPQX 4WF2A 3LL7A 4AEDC 3PIGA 3LOBA 4MGQA 3X29B 4XMAA 2D6KA 5I8TA 5DZGA 1TNRA 2YBSA 3VDXA 2EIKH 3WUCA 2DN0A 3KZZA 1WD4A 3HQRA 3RWNA 1GV2A 1O5UA 2DXIA 3OYIA 1UOGA 4LK0F 2ZS6B 2RG4A 1RXFA 1AR83 3WF1A 3RZKA 1IGNA 3BJ6A 2JK3A 5GALA 3WZ1A 4PFPA 3ZMSA 3RJPA 4GWIA 5JHFA 2X5IC 2WWYA 1VQPI 4KG0A 3FK7A 2Y6LA 2BU9A 1S29A 1YWKA 4HT1T 1QPIA 4G8XA 4P9WA 4O7XA 3IHUA 4ZS2A 1PO11 3J7HA 4YARA 4E7HA 2LMDA 2QFEA 3IPVB 4IRIA 4A3BJ 3KIOA 1MD0A 4QDQA 1Q1HA 5FJHA 3IM0A 4HLXA 4L8QA 1RR8C 4XDPA 2XF7A 2Q1FA 2HWD3 1MDMB 1XTAA 2WB1N 1KDMA 2CL2A 2HKOA 5J36A 2JECA 1YI7A 3BCWA 1XPWA 2W5FA 4NHKA 4PIYA 2LY9A 3ZGKA 4MTDA 3LIGA 4TTGA 1E5HA 3JAMK 3CTAA 3TDUC 1PIV1 2XWJB 2VBPA 1IHMA 4XF0A 1NOVA 1GU3A 2VC0A 3M8JA 2IXIA 5A1LA 4C2TA 2HWB2 5IT9K 2VT2A 3M9AA 3PHMA 3T2OA 2Z5UA 4CEWB 3L2VA 3I3LA 1TE1B 4FFGA 3ZIXA 3IDCB 4DBRA 2WNUB 3PQJA 3L9FA 1Q8SA 4D0QA 2VZVA 2M8EA 1XNTA 1ULEA 2EILH 1F5TA 1DIWA 2F4LA 3AXEA 4C1XA 4GDFA 4Q1RA 1AL0G 4ENKA 1BJAA 1CAUB 3WG4A 2BQPA 3WU0A 2GH8A 3H1WA 5DM6F 1TWHJ 2XBO3 1RC9A 2UYBA 2WS92 2WZPP 1LOAA 4I3GA 1ACIA 4LR4A 2XLFA 2R93J 2M8GX 5E8IA 2E53A 1OHFA 4AG4A 3AL0C 1T98A 1KYZA 1W6NA 5FFOC 5LZ6A 4XACA 1OT5A 1AR71 3K0LA 1YHQI 5L9VA 1QZZA 3PIPF 1XSDA 4ZYEA 4I0BA 4EQVA 4AI3A 2IXCA 3LGRA 3DEWA 4A6DA 5JSRA 1ND2B 2HXIA 1R4NB 2R063 3SDGA 3CJIC 4II2A 1K61A 4NC8A 5KHKA 1ZK8A 2WNUC 2CS3A 2RAEA 3MIFA 5A2QK 2BGPA 2MHFA 4LLFA 2O1QA 3WF0A 1KGYA 1WBLA 3RWKX 3G6EI 1N3OA 4NIAA 5CIRA 4GYIA 3J7YJ 2XJVA 2NS8A 1MQTA 1XNDA 4AD9A 3BLYA 3O1TA 3F9KA 2BPA2 2JDUA 1HSTA 2R7QA 2KIUA 2J1RA 2V5YA 4AR2A 2LFBA 1SQ4A 5D8AA 2C0ZA 2VPVA 3V42A 2QQVA 1W28A 4XOPA 4YLZA 2PHLA 3VDDB 2DFCA 1XN7A 1V6KA 4A6EA 3HGGA 2WYSA 3AYDA 4HOOA 2RMU3 2XAFA 3PVOA 3N7KA 1GWKA 3MCZA 5FKBA 3ZFEB 3C7JA 4LITA 5EJZB 3GZNB 4FFHA 1JZ4A 2IEKA 2ZHLA 4B29A 3W58A 4OYUA 1ND2C 1WMEA 3DU6A 2IT0A 2IXJA 4MHRA 1L7RA 5FPVA 1XMKA 1WCDJ 4XOGA 2A6YA 5H9PA 1SD6A 2QF7A 2KKOA 1UXZA 3BR3A 1KFXL 2CQXA 1S8NA 4Z07A 1OISA 5LGUA 5JVTA 4FAGA 3N9NA 5D1IA 2M1BA 1SFPA 5LGNA 4N9IA 2JIJA 2FBKA 4QDRA 2OJED 1CAXA 2DT7B 1GICA 4Q2FA 2JA7J 3EETA 4LOSA 2NPIA 3QH7A 3RRDA 4MGTA 2VMEA 3F2ZA 2Q5TA 1WW7A 1KU9A 2KPMA 1GZCA 1F4KA 3AMNA 1W04A 2KIFA 3I2JA 3ZR8X 1X3UA 1OVSA 3ZN0A 4Q4Y3 1VQ4I 5C44J 3JBG1 4F52A 5A7OA 5LD2C 5GLUA 3MIEA 1ETQA 4UB6C 3WGGA 3LD8A 5JXJA 4AC0A 4QQLA 1LFPA 1JI8A 2GBYA 2K9NA 4V19K 1C8M1 2PJRA 4X8PA 3J7LA 2CU5A 4D6SA 2VU9A 4AU7A 2R32A 5GZGA 1ZBA3 2ZFWA 3WP4A 4X0GA 1I3QJ 2RNJA 5IFPA 1TL8A 1ST8A 3E1SA 4PCQA 4C9YA 3JSOA 1R5HA 3FF5A 2BV4A 3PO3J 4FTBA 5F27A 5LRRA 3ABMH 3AJYA 3JQXA 1LDKB 2WB1A 4BISA 1UFMA 3W9AA 2PHXA 4XM3A 2RV9A 3VHRA 3FXJA 1NA1B 1G9AA 3DEMA 3T2TA 2VQ0A 5E18F 1MSEC 1YS6A 4UVCA 1D1BA 2P1BA 3FBYA 3E7LA 1ZRCA 3HT1A 4WM7B 2WA4A 4WCGA 2BY1A 1WJFA 3IB3A 5IK7A 2L2OA 2TDXA 3FXMA 2P37A 1Q8VA 3KYCB 1AJOA 2P6HA 5HCFA 2WFF1 2MEV1 3OYAA 2GAUA 5T50A 5LK5A 2JPCA 3V0BA 3G7DA 3DXUA 2UURA 3ZOBA 2QQUA 1I50J 1T33A 5E6HA 3KQ4B 4GQ7A 3WUDA 1YJNI 3FHAA 2LR8A 4FCAA 5FYMA 2VMFA 3MIGA 1SD4A 4QAWA 4EE2A 3L2QA 2X9DA 3OWTA 1HB4A 1SG3A 4JGYB 3GZUC 1IC8A 3AC0A 2DFEA 2VMGA 1MJ9A 1EV7A 3DKXA 3CO2A 4RHV2 3TEDA 2JA5J 2HWE1 2A6TA 3WX5A 4G94A 1NA1C 1K78A 3DFGA 2VBBA 1OF3A 1V6MA 3CO7C 3ORJA 2ADEA 4MFEA 1I6HJ 1LOFA 4WM7C 2CGPA 4NOTA 3KZ4C 5J7MA 5CYYA 3BZCA 1SFNA 4KGGA 4GB33 1Y7BA 3Q0VA 4MGKE 4FPJA 1OCCH 1BK1A 1LODA 2R7UA 3S30A 5BYNA 5CQGA 1WCKA 2P3KA 3A4CA 1AYN1 4LOTA 5IP7J 1BVVA 2B7YA 3THPA 4Y4RA 3PLQA 1BI0A 2W91A 2OX0A 2OCCH 3LMMA 2A1XA 1J2XA 5F5CA 1OA3A 3WF4A 4AOCA 2R7SA 3ENRA 2GMPA 5IK4A 3PIOF 2DURA 2ZJCA 1UY3A 2FZ1A 3DCFA 1CPNA 2LRPA 4AFBA 2XGXA 3L2UA 3URFA 1LHUA 4JGYC 3UKNA 1HLCA 1XB9A 3EB7A 3GFLA 3EXUA 2V6CA 4GH4A 1FATA 3MUY1 1HRV2 2LY2A 3ZYRA 4IEUA 3AZYA 4KNCA 3KSCA 5DZEA 3FFZA 3GJAA 1YC61 2B4KA 5E1ZB 1EPWA 1ZBE2 2VQGA 2XDVA 1IOAA 2AHQA 3PUFA 4XK4A 3VBRB 5JIUA 3WY6A 5T54A 2IFRA 3WNOA 3B9IA 4DEQA 1GZWA 5EWSA 1GDTA 4ZS3A 3ZFFB 4HXCA 1FIAA 2OQGA 4BIOA 3EJKA 3PVEA 2XLGA 2CGNA 4AQTA 1VMHA 2HWD1 5FZ9A 5SV5A 4NQWA 2E5ZA 3H0DA 1DGWY 2X6OA 4WVVA 3CCRI 4B7EA 1SVOA 2RR12 3P9IA 4AVZA 1EPZA 2ZOEB 5IATA 4A44A 3SEQA 4UW5A 4CDWB 4UF0A 1B59A 3ZQHA 1SLIA 4IEVA 5DG1A 3TO6A 1JUSA 3FMQA 5JLVA 3NQHA 1J84A 2W9XA 2JG8B 2BGOA 2BOJA 3VKFC 3O1OA 4ZDPA 5LHIA 1LE8A 4I2OA 5FDBA 2LH9A 2X48A 1WWYA 5AVAA 2VL4A 1V9U2 2VAUA 5FXXA 2XL9A 3WDVA 2DOAA 4HL0A 3PIJA 2DA7A 2DUOA 4HLYA 3C7OA 1UWWA 4K2EA 2Y0OA 2X10A 3ECOA 3OR2C 1USTA 1U5ZA 2E63A 3VBRC 4DS0A 4XAAA 5BNPA 1VQMI 3I7DA 3WNLA 3KEYA 1COV3 2JE7A 1OA2A 2VCCA 1G3TA 4Q4V1 2F4PA 5IP6A 2F4IA 1B1BA 1Y8QB 4P9JA 4EJRA 5I0TA 3K1PA 1DU6A 5DDJ1 3ZSMA 1U9OA 4QKBA 1PHMA 2LD5A 1XJAA 4NIDA 4II3A 1YJ9I 4HN0A 2V09A 3F8NA 1JYCA 2W94A 5ICFA 1N25A 2B46X 2XJQA 3RI9A 4KMQA 1R1UA 2V9VA 2W68A 4CDWC 3VD5A 3GTQJ 4RGSA 1GR3A 4I76A 1JJ6C 3NRVA 4HKWA 2JG9A 1MMNA 2AH2A 4L18B 3AZXA 3DBLB 1JI6A 2JG8C 4URTA 2QQNA 3ZPYA 3KD4A 5C8WA 4AEJA 2ZMKA 3B94A 3H9GA 2N7GA 3U78A 3S15J 4HETA 3MV11 4HG6B 1S55A 1W8FA 4IV1B 3R60A 3FM3A 1ULYA 1V0AA 2Y8KA 3CUOA 4XFAA 5DAXA 3ZKUA 4GO1A 1Y4WA 3AKQA 4XBQA 5K0UB 2B9UA 1X1DA 3K3NA 2LSOA 5FYYA 2Q8EA 3H7YA 1W06A 3SXYA 4OAZA 1EH6A 2RDRA 2YU9J 3HC7A 2Z33A 3MW2A 5HLGA 3A2KA 1BEV3 1UZWA 4S2HA 4KMFA 4KG8A 4COWA 2ZCWA 3KT4A 3CLQA 2O0OA 3H3LA 3L2YA 3DECA 4YW1A 3OYFA 5FRMA 4L11A 2VI6A 1DQ2A 1FPN2 2V79A 2VZSA 4EGYA 4L0ZB 3N36A 2A05A 1GP4A 1IO2A 2GOMA 3M2MA 1OA4A 2BVLA 1V70A 2D3PA 2WC2A 4HVOA 1AXKA 3NWTA 1SVLA 4QPOA 3GF6A 1U5IA 3U11A 3GFJA 4QX7A 1UPSA 3S5QA 1V5GA 2QZ2A 1HKQA 3KT7A 4IV1C 3AKPA 3PUQA 3PVNA 3DF0A 4OMZA 3USUA 2HEYF 3C7FA 2VZQA 1LECA 2B42B 4E2QA 3RKXA 1UG0A 4UXAA 2ZJQF 4A42A 3OV8A 2ZXWH 5E20A 4CP0A 1MVEA 5K0UC 1UZ0A 3EO6A 3ZRGA 4I0AA 3O1RA 1RUC3 1V6LA 1XSQA 1FIPA 5HS8A 2VE1A 1SFOJ 1QNWA 5FZGA 4M00A 1HDPA 2F5VA 3ZDVA 3V56A 3WOGA 1M4WA 4YZ5A 4H3WA 5L73A 2CDPA 4JX0A 1GV5A 4ES9A 5BNNA 3BG7A 1DZQA 4Q4Y1 2UYAA 1UY4A 2YPDA 1U8RA 1KQRA 3MMYB 2K3PA 5E8GA 3ZYBA 1IRZA 2EAKA 2PLV1 1HN1A 2WUHA 1T8IA 2G7UA 4TN7A 1VI0A 1RUD1 3TGNA 3C3VA 4YG2F 1JUPA 4DUVA 5KHHA 2Q2EA 1AWCA 1RMU2 1U5YA 5AC92 5ISLA 2GC3A 5D21A 2MABA 4M6YA 1CQ9A 2C9KA 2XONA 2VNRA 3K77A 4QPQA 3QCWA 3S6PA 3NQOA 4G7OF 5FY0A 3E5UA 5L19A 5GPCA 2GC2A 5GJ6A 4RYDA 3WD5A 2VXJA 4YW4A 2LOOA 1E5RA 3S2HJ 4C30A 1ENQA 2WSUA 4XF3A 3HN1A 1BIBA 3UK9A 1ZR4A 1AKHA 4JVAA 4XABA 4F92B 5IVBA 5F3IA 1OH3A 3LCPA 3CIHA 3BC8A 2EH3A 4GMP0 4GD4A 1MBGA 3WODF 3OY8B 5LGTA 2Y48A 3JD72 1YJKA 3CMMA 4FETA 3FE5A 2X53S 2WINB 3S3NA 3SQOA 2IW5A