3RYPA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Catabolite gene activator
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rypA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rypA01
3JSPA 3DN7A 2XKOA 2M30A 1U5TA 3SZPA 4F7ZA 4LB6B 1SMTA 1YS6A 5HI0A 3EJKA 1U2WA 4IEWA 3F8BA 4KA4A 1SFEA 4IEOA 4BAYA 4ENMA 4IETA 1EH7A 5JFRA 3K9TA 4LULA 2CG4A 1K6OA 2V1XA 5LHHA 3T1BA 2ZJ2A 1XGOA 1XDUA 3HT2A 4MNUA 1XCVA 5J48A 5L3EA 2WC2A 3DPTA 2A3SA 3F6OA 5CVJA 1IN7A 3DEUA 2V6CA 1MDMB 2KJBA 2IXLA 4RD7A 1XGSA 2Z33A 3K1MA 4XSZF 1B6AA 1OYYA 5ICFA 4LLLA 1P4AA 3DFGA 2ZO4A 1KYWA 5L3GA 1BBYA 4MEYF 1R1TA 4KN7X 4XFAA 4Z82A 4G94A 2PAMA 5DEQA 4KUMA 3VB2A 2QQBA 4HVQA 4GYIA 3SXYA 5FFXA 1F5TA 1XSVA 2GZWA 3WGHA 3HHGA 5HS8A 2FEZA 3GFIA 5FLXK 4ONUA 3Q9SA 4Q48A 5J7MA 4G7HF 1P2FA 3LA3A 3OTFA 1O4TA 2KJCA 3MWMA 1F1ZA 3I59B 2F5CA 3WTZA 2ELHA 1ON1A 4HLYA 5TRDA 4FX4A 2JZYA 1U5TB 1A04A 2K02A 2M45A 4LK1F 1QNTA 2EB7A 2STWA 3WTWC 2Z3YA 4G6QA 4EWDA 1U12A 1TQIA 2H6CA 5K5QA 2F4PA 2VOOA 3E5UA 3I58A 2IXKA 4E2GA 1RI7A 3GFMA 1SQ4A 5AVPA 3HRMA 3G73A 3H3ZA 3GBFA 4YSFA 3FMSA 4IHSA 4IF4A 1J3QA 1YFUA 4GGGA 3FF5A 2PJPA 3LFKA 1KGSA 5LBQA 3GW2A 5FPXA 1ZN2A 4HDUA 3GZ6A 1Y0UA 4Y13A 2IRFG 2YR2A 2KRFA 3BALA 2FMYA 1USTA 2BYVE 5JR3A 2VONA 3D0JA 1P92A 1J58A 3KETA 3J81Z 4LA2A 4A5NA 5FDBA 5K1YA 1CAWB 3GZ5A 2QYOA 5KBFA 3I5UA 2DPUA 2IA1A 3F21A 3FMQA 1OYIA 2UWMA 2N7GA 1DZTA 1I1GA 2Y0MA 4MQVA 3SCGA 4IXAA 3N97A 1W4MA 2MH9A 5FPZA 5LGNA 1TW2A 2WTEA 1G6NA 1YG2A 2ZNZA 3FM5A 2Y0OA 1YTYA 1CF7A 1BIBA 1ZLKA 2XAJA 1LJ9A 1TW3A 3KP7A 1FSHA 5DCFA 3EQLF 4HSLA 2E1CA 3K69A 4JBAA 1FI2A 1T38A 1WLTA 2XAQA 2XL7A 3CUOA 2GC1A 3H9AA 2HYFA 3F6VA 4KN4X 4WX9A 2BE5F 3U10A 2HOEA 3ROUA 1WKMA 2PQ8A 2K7LA 3SQNA 1ZAOA 4XFCA 1YS7A 2YSRA 3BJ6A 3BU7A 3TDZC 4YFKF 2A6EF 1DP7P 3FXRA 3DPLC 4CZZA 3ERED 1ZHFA 2ESHA 4FX0A 3U9GA 1Z91A 1LB2A 5BMZA 5KVRA 4ZYEA 5J8CA 2EK5A 1UHMA 1UCRA 4LA3A 1P4XA 1ZARA 3CTAA 1OFNA 3RJPA 2DQRA 4HQEA 2RVCA 1B1BA 1DGWA 4JTNA 3E5XA 4EQQA 1TNSA 2VBXA 1JHHA 3FM3A 1GQHA 3IBMA 1XMKA 3USSA 3R0JA 1ZREA 3C18A 3OGJA 1ZZCA 1QGPA 3HSEA 2F5DA 1XGNA 3BOQA 4I01A 5BPIA 4KL1A 1BM9A 3TOBA 3BZ6A 4DQ2A 3VFZA 4WVZA 1O3TA 3NEUA 2E9QA 5DD8A 3EYYA 2D40A 3HRUA 5EEGA 1JUHA 3TO6A 3S7IA 5L3DA 4Z2YA 4EWEA 3RNSA 2ETHA 4LLOA 4XFHA 1BC7C 4HSJA 1YFYA 5CYVA 4WWCA 3CUQA 2COMA 1ZZ7A 1S7OA 1DGRA 5ED4A 4L18B 1QPMA 3WTUC 5JSRA 1RUOA 4ASNA 4O6JA 1D8JA 2ET7A 1TQMA 4U88A 5I8SA 3S7EA 2TDXA 3C3VA 4LJZF 2DI3A 2FXAA 1WA4A 4ZYGA 1IRGA 1HW1A 2VT3A 2FA5A 1IW7F 1S8NA 1UB9A 2QLZA 1ZRFA 2BNMA 1BC8C 2K27A 3U11A 1O5LA 2VC1A 1F9NA 4ZYDA 4LGWA 1NZCA 1I6XA 2EFPA 4YG2F 3OV8A 2QDRA 4M6YA 2H94A 4I3PA 2HFHA 3TKYA 2Z99A 4XSXF 1LR5A 4PGGA 2VPVA 5J8FA 5D6FA 3AAFA 3LA2A 1R00A 1VR3A 2MPFA 2ISYA 1QQIA 4L9NA 2XRNA 2OQRA 1FY7A 2DBBA 3NKTA 3V8LA 4ZU5A 3R4KA 1RL3A 4O9EA 5K5RA 4ENJA 1YLFA 2YX4A 1QY4A 2XAHA 3N4MA 3UKNA 1JGSA 3PQJA 3M1EA 3QOPA 4HBLA 5FD5A 2PMUA 5F64A 2ATFA 5I8TA 5JR7B 1ZVFA 1YFXA 2QQAA 1OYWA 1PM7A 1XD7A 3H50A 4XF1A 2LDUA 1I27A 2IJLA 1O3QA 5DCMB 1R1VA 3ML6A 3LZZA 2W57A 4CICA 4G7ZF 2JRTA 5E8GA 1YIOA 5BOXA 2G9WA 3RPQA 3V7CA 3U0ZA 4QGLA 4P9FA 2GQQA 5CADA 1CAWA 1K78B 1H9GA 2VC0A 2OBPA 3F8FA 2VXZA 5CVVA 1ZZ6A 3ZMTA 1OPCA 1GQGA 4Q0SA 2UY8A 4A6EA 3FXQA 2W24A 4M73A 5D8KB 1FXZA 3E6DA 4Q29A 1J59A 3PQKA 3R0AA 3L7WA 4K8FA 4BYYA 1EYBA 2ESNA 3I4PA 2B9UA 4HZFA 4HW0A 4L11A 2ET1A 2ISZA 4L9VA 1CX4A 5HS9A 2XAFA 5HOOA 2CW0F 2DW4A 3I59A 3C3WA 5LLQA 2PFBA 3FHZA 2GAUA 3QPHA 2XIGA 3SFZA 1YFWA 4E2QA 5J3UA 3PVBB 1RC6A 2PFWA 4KNYA 2CV6A 4I0AA 1XE7A 2P5VA 3KGLA 2NNYA 5CU1A 3G7DA 4YFXF 3NVCA 2NAZA 4KIGA 2GC3A 2M1BA 3MAJA 4ORFA 4HLTA 2O6GE 4L0YB 3FMRA 5JI6A 4PIXA 2QVOA 1WGPA 2H09A 4IRGA 4KYWA 3ES1A 1OKRA 3WU0A 2PAEA 2Q2EA 4XLPF 1Y9QA 3P9KA 2PHDA 4ZU4A 2D1HA 5H20A 1FBQA 4HLXA 4JTOA 4RGRA 2BGCA 2MLGA 5KHKA 4EGYA 2QVSB 1Z6TA 3PFIA 5JAXA 3I54A 4HN0A 3J7AO 2A61A 3EUHA 2MLKA 4RB3C 1T98A 2P5LC 3E6MA 4IPAA 4LUMA 4KMUX 3CO7C 3K1PA 2BEOA 2KXLA 2H27A 3TNQA 5DD4A 1CAUA 1YW9A 3D0SA 3GO5A 3OF1A 1TQPA 5HDKA 4OMZA 4M9ZA 5EFUA 1XGMA 2Q0AA 2K86A 1VP6A 1RNLA 2L01A 2CSOA 4CHUA 4AXOA 2RQPA 1Q3EA 3KP6A 1E17A 3RZZA 2ZBKA 4RAYA 4HMZA 1R23A 3KMHA 4ON0A 2Z9OA 4OIOF 1NYWA 1XSXA 2A69F 3CUQB 3QAHA 2XL9A 4M6XA 2XGXA 4RS8A 5F6FA 4LG0A 4WXCA 2CYYA 5D5XB 1SMYF 3GFJA 2J5OA 1BOAA 2UZKA 4QM8A 2HTSA 5LRSA 3ZMUA 3I71A 1T2KA 3IWZA 2IXIA 4HF0A 3U1DA 4YFNF 1PMIA 5HS7A 2MNGA 1BI0A 4LUKA 2LF7A 5D8LB 4HAMA 2HEOA 3HT1A 1V3FA 1RUNA 2IA0A 3E97A 1YFHA 1FSEA 2L54A 5KHJA 4G9YA 2FQ3A 3KFWX 2HTJA 4M71A 3EETA 2VBZA 2HKOA 2WWYA 3I7DA 1IXCA 1FPQA 4CO8A 2XLAA 1FBUA 3HRTA 1JE8A 4L9JA 1WWXA 1O5UA 4HN1A 2A07F 4XETA 4MGKE 2JSCA 4ZZDA 1Z6RA 5LHIA 2HWVA 4KFCA 2H6BA 3T8TA 1O7FA 4OOIA 2PMHA 4M9SA 5DYMA 5ILVA 2A68F 2XASA 3DQVC 1AOYA 2FE3A 1BJAA 3ZN0A 1J2XA 2CQKA 4F8AA 3UKVA 1YUDA 4AIJA 1ZH5A 2A5YB 1NXMA 2KIFA 5F1RA 2O0YA 1G3TA 3ES4A 2PEXA 3SHRA 1FP1D 2DLLA 3O6BB 1ZX5A 1ZG1A 4XF4A 3LOIA 1J5YA 1SD7A 5H6QA 2Q8KA 4I2OA 1U78A 3IKTA 2FSWA 4KICA 1XRUA 1BI3A 2UYBA 4UVBA 1R58A 4I09A 3KZYA 4XF0A 5D4RA 3KEQA 1G3SA 5D5VB 1X8MA 3ZMVA 5FLIA 2UY9A 1S7AA 3PLQA 3TO9A 4Q0VA 5FLHA 2HKXA 4NB5A 2QJVA 1WRJA 1B9MA 3K0LA 4CDGA 4YRDA 1FZPB 1SFUA 2L02A 4QWQA 4O5VA 2W84A 1MZBA 4MGYE 1MDMA 2D2WA 3L2CA 4UBHA 2P6SA 3CJNA 2NNNA 2DK8A 1HSJA 3L09A 1UW8A 2BV6A 4IESA 3F23A 4JQFA 4AVCA 2VQAA 4X6RB 4Y17A 4A2UA 5JSPA 1HXDA 4K2EA 1RTVA 2O61A 3GEZA 2LF8A 2CAUA 5I0RA 2STTA 2FBHA 1B59A 1K79A 3V4GA 4DINB 1UCXA 4WF2A 3TQNA 2C0ZA 1V4RA 1OMIA 1CAVA 4U0YA 2FQPA 3CDHA 4PIZA 4UHTA 2QM3A 1T39A 4KMFA 3D82A 3EO6A 4JV4A 1ZG5A 2IW5A 1KU7A 5EZWA 2FNPA 2VN2A 3VODA 2PA7A 1J7KA 2MD5A 2YU3A 5D4SA 3K1NA 2UXNA 2XHKA 1JXSA 1EPZA 2X0LA 2RN7A 4AVBA 3L9FA 3FE5A 3H92A 1R7JA 3F3XA 5FLXZ 3BY6A 3BJAA 4AIHA 3BPXA 3E3VA 4A0YA 4GULA 3JW4A 1ZNPA 1RIOH 2L4MA 4QLCU 3KP2A 4UUVA 4LMYA 3TGNA 3RYKA 3LWCA 1ZZ9A 2P17A 3JTGA 4IEUA 1FT9A 4QX5A 3ZDSA 1ODDA 3M8EA 2XLGA 4AQ2A 2EV6A 3I0TA 1HQCA 2CGPA 3ELNA 2IXCA 5FLJA 3K2ZA 3FFQA 1KU9A 4PCQA 2O03A 2QENA 3V7SA 2LKPA 4UVCA 5E16A 4ENKA 1W5SA 1W7PA 3LQRA 4RB2C 4ZH4F 4CYDA 5E1ZB 3G3ZA 1J75A 3SCHA 1P4WA 2G7UA 1P6RA 1J3PA 2VE8A 4CXFA 3ZN1A 3GFLA 4BH9A 3T8RA 2ZXJA 3RIRA 5L3CA 3J80K 4J1XA 2O8QA 4AVPA 1VTNC 3OD0A 4PDKA 4HV6A 3WW3A 4IRIA 5D6EA 1IPKA 2HJIA 1SAXA 1LEAA 1E2XA 2V1DA 4I02A 4H0EA 4KWLA 4R79A 3MFKA 3ZP5A 1CAUB 2BBYA 2EV5A 3PNAA 1IF1A 2Z2SB 5JCTA 4HV5A 2KIUA 3F72A 3CEWA 1MD0A 1IAWA 2GXGA 4M74A 1V70A 1ZYRF 2OD5A 5CVRA 4MEXF 4AQ6A 3WW2A 2VECA 1W5TA 1XSDA 2DAOA 2CFXA 2IC1A 3LWFA 1G3YA 3V7RA 3HSRA 2WFPA 2R7FA 4OMYA 2ADUA 1NHAA 1QWRA 2DT5A 3SXWA 2P7CB 5I0SA 4FAGA 2EAAA 1MJBA 1S3JA 4QXKA 4AVAA 4HF1A 5D1IA 5ICCA 4IEYA 5CVIA 5C8WA 2OZJA 2MC3A 4ESJA 2OAZA 1Q1HA 2VBYA 3H3UA 4EGZA 1FWZA 3M9AA 1PP8F 2NYXA 3CO2A 1YHFA 3LA7A 2DTRA 1ZRDA 3TOAA 4O3MA 4R8HA 4L0ZB 2RKHA 1FNNA 4XFGA 1FP2A 1EH8A 3E6BA 5BXXA 5E1XA 4EVIA 4GXOA 2ZFWA 2YPRA 3NRVA 2ACJA 2M5WA 5BV6A 3W6JB 1U3EM 5A2QK 3SZTA 5CJ9A 5E18F 3LQQA 5ICEA 4IJAA 1ON2A 2GXBA 5HLGA 1SFXA 3NSTA 1TQ5A 3RKYA 2X4HA 3RTRA 3H7JA 1HKTA 2HZTA 4WZCA 1FYLA 3GYHX 1U8RA 2E7XA 1IN6A 4IEVA 3FHIB 1CF7B 1XN7A 3KE2A 3C1DA 4X6QB 2R7DA 2XROA 3CUQC 4MHGA 4B09A 4P9GA 3ACLA 3P7NA 3CLOA 2Z5UA 3U2RA 1RZ4A 1LDKB 1Z9CA 1G4DA 1SFNA 2PI0A 1Y3TA 4OFGA 3MEXA 4Y15A 4LK0F 4A0ZA 4A5MA 3FJSA 1J9IA 4MH0E 2K4BA 4IERA 2EFNA 3ZQ7A 2JPCA 5BPDA 3WGGA 1BN5A 1R5GA 4ESFA 2F5FA 1D8KA 2XKPA 1H1IA 2EJRA 2Q4SA 2MA3A 3M8FA 4JVAA 5ILSA 3QPTA 3EYIA 2P6TA 3KP3A 1KQ8A 3ST7A 2ZMEB 2O1QA 4NVPA 4LB5A 2VBWA 3WGIA 3LAGA 3WE2A 4E2SA 3RKXA 3HTSB 4L2NA 2LNBA 3BDDA 3NJZA 2E1NA 4P5OA 4UBGA 1ZGJA 4LFUA 1PDNC 4B8XA 4TV7A 4UXNA 4HOBA 3KCCA 2DK5A 1T0FA 1QZYA 2UXXA 2VT2A 2Q30A 2QBYB 3CO6C 2K0GA 4AIKA 1ZGAA 2FRHA 1B4AA 1LNWA 2I45A 1UIJA 2Y75A 2GU9A 5D5UB 2XAGA 3UKTA 3MPBA 3NW4A 3HIFA 1X7NA 4ZU7A 1ZZBA 4WK8F 4UV9A 4LTAA 2L3DA 4AD9A 3WTVC 3IKVA 3MYXA 1XE8A 4MGZE 4M9XA 2HDCA 1XMAA 3IDBB 1GXQA 3S0MA 1WI9A 3MQ0A 2OPKA 5DCMA 4ZZLA 4MGRA 3J80Z 1S29A 1IXRC 1SD6A 1GVJA 2E7WA 2PAKA 1MJAA 3VHRA 4YIFA 5I0TA 4BQAA 3H1YA 4BXUA 1IN5A 3RYPA 2MHFA 1X3UA 5L3FA 1G3WA 1LQ1A 2IXHA 2RC4A 4IEZA 3DF8A 3HRSA 2JT1A 3FWEA 1T6SA 3D5LA 2FF4A 3SHFA 5LGTA 1R5HA 3MDPA 5FGMA 4H7LA 3KP5A 2MBFA 2D5HA 2RGVA 1ZLJA 1Z1DA 1H0MA 1IZ1A 4HX4A 5KK1A 1GXPA 4S05A 1KYZA 5TJJA 2EVXA 4Q4ZF 4HDVA 1SD5A 3H1WA 5JSOA 2PG4A 5I8YA 2CO5A 4N9IA 4WXHA 2MH2A 2XUBA 4OINF 3ZMDA 4EWAA 2PQQA 1CAXB 3R6SA 5LHGA 3IRQA 5LGUA 2ZKZA 4YYOA 5JVTA 1DUXC 4XFBA 2OZUA 3TDUC 4KU8A 4KU7A 3ZPLA 5EEHA 4N0BA 2O8XA 5T3NA 3WTTC 1TNTA 4XRFA 3GF2A 1VJ2A 1SD4A 4UNOA 3WTYC 4G6DA 1R36A 4ESBA 3DV8A 1MKMA 3F8CA 4XEZA 2ZNYA 1H9TA 1CAVB 5DDGA 3M7GA 2V1UA 4NHJA 2JPBA 2QZ8A 3VEPA 1XDSA 2W25A 4AWXB 1PUEE 5IT3A 2FMLA 4GO1A 2BNNA 4R1HA 4HX8A 4EV0A 1LKNA 5HLHA 4IVNA 4E70A 3O2PE 2QQ9A 4IEXA 4D7SA 3BCWA 3COAC 3W6KB 2PTMA 2HQNA 2PBIA 3KP4A 1J1LA 2D93A 5LEJA 2HGCA 5FB2A 3EQEA 4Q47A 1IUYA 2P5KA 3REOA 1CAXA 1ZG3A 1XCBA 3ELKA 2O3FA 3B73A 3CL1A 5LRRA 1TTYA 5K8SA 3BROA 4IRHA 2H0VA 3HTUA 1GHCA 4I7HA 5KHIA 2VODA 5H6RA 2ZKLA 4N9HA 5IT9Z 5E8IA 2GWRA 4GYGA 3MCZA 3DL3A 1OD5A 4B29A 1OI6A 4BHCA 1YW8A 4XFFA 4GCVA 4BHPA 4U7DA 2PYTA 1K7AA 1HKQA 3BPVA 4EM0B 1YLLA 3KZZA 3T5XA 3HUGA 4LEJA 3WG9A 4RB0A 1OR7A 4TLFA 3FZ3A 2K4JA 5K5OA 3WW4A 5E1RA 4I0BA 5LEKA 2V79A 3GWZA 6PAXA 4Q0PA 3O3KA 3CLPA 1FC3A 2FOKA 1IPJA 4RAZA 4A6DA 2GA1A 3Q9VA 4L9TA 1L0OC 1FX7A 4KT5C 4G7OF 2OQGA 2LSOA 4Q0QA 3OOPA 1NE4A 4XF9A 2V9VA 4XF3A 3GUDA 3WE3A 3GVAA 3NQOA 4PIYA 2GH2A 1J0RA 1IN4A 2QBYA 1K78A 2HR3A 2R3SA 2YX7A 3QP5A 4EMSA 1ZRCA 5C6CA 5FCCA 3FXUA 2QNKA 1UHWA 2DCTA 1YYVA 2UYAA 3S2WA 2IVMA 1BI1A 2DQLA 3M70A 3NL1A 4R52A 3H1MA 1YW7A 4NQWA 1UPIA 4BNCA 3ETQA 4WBBA 4M72A 2L4AA 4OIQF 4RGUA 5I93A 2A6HF 2FNAA 3BJOA 3QU3A 4EJOA 4O9GA 2D1VA 4MGIE 1D3YA 3I53A 5E17F 3SMHA 3FX3A 4HVOA 3LAJA 4QM9A 1FBSA 4XBFA 4RB1A 3I64A 1EH6A 4P9UA 1S6LA 4JK1X 1UD1A 4MV2A 2CWEA 1IXSB 2B5HA 1NE6A 4HA8A 1Q5OA 2DO7A 4OIPF 5AONA 1YO5C 3T0YA 3IL2A 5J6XA 5DUIA 1H1MA 2ETEA 2EA4A 1UFMA 3C7JA 4MX3A 4EROA 1HSTA 4YARA 2CAVA 4FT8A 3KEOA 3QRFF 1LDJA 3CF6E 2ZMEA 4XFIA 3IIAA 3ULQB 1KQ0A 3HYIA 3VOEA 4FBFA 2Q1ZB 1CGPA 3L00A 3QP6A 1O3RA 1LEBA 3JZVA 2GIVA 2F2EA 5BUVA 4L5JA 2XVCA 3KSCA 5CVUA 3CJXA 5JHUA 3IRRA 2HYGD 1X8EA 3JAMK 3R60A 3QU6A 1WQ2A 1C0WA 2J5PA 3OCPA 3F8NA 4LG0B 3BB6A 2AXLA 1O3SA 1PP7U 2OA2A 2DPDA 1ULYA 5HLIA 3ZMZA 2V09A 1HKSA 3BP8A 3FZVA 1JHFA 5D5WB 3QACA 2Z69A 2XLFA 3ECHA 4LLNA 5DV5A 3TO7A 4EJTA 2B0LA 3RYRA 4DNCA 4HF2A 5CLSA 1UIKA 2G7HA 5HDNA 2M8EA 1D5VA 4L5IA 4QGNA 2QUFA 1BI2A 1LVAA 3ABUA 1TBXA 2HS5A 1FOKA 1SEFA 4KDPA 3MZYA 4HBNA 3B02A 2IA2A 1R22A 4U7BA 2QWWA 1KU3A 1IRFA 4U0VA 1KA8A 2DFIA 3ABTA 5L3BA 1DZRA 1YWKA 2Q0OA 1ONVA 1LDDA 3JAMZ 3E6CC 4UVAA 1U5TC 1I1SA 4HVRA 4EM1A 2IXJA 1ZZ8A 2GC0A 1QZZA 3HOSA 3GYDA 4G8XA 1B9NA 1STZA 3V8JA 4BHBA 3V8KA 3TNPB 3HSFA 4META 2GC2A 1O7LA 2PHLA 3EBRA 4RGSA 4MQ9F 3RDIA 4PZJA 3BWGA 5KHGA 2FU4A 3HHHA 4HQMA 3DXJF 1ZRRA 4QMAA 3RPUA 3ECOA 4Q0UA 5AIQA 5E20A 4PJYA 3WW1A 2AS5F 2PLYA 2EV0A 4XLNF 4EJUA 4A0XA 1HW2A 1MGTA 4OU0A 4S04A 1QO0D 3R61A 1FYKA 2KIMA 4LD5A 4LLGF 4IEQA 2NRAC 3SCFA 5FO5A 3EDPA 3IHUA 4P55A 4ENNA 3BPZA 1Q43A 2P8TA 1KQ9A 2JTVA 3P9IA 4IHTA 3F8MA 4D0PA 2EFWA 1YQAA 4P96A 4YNIA 2IT0A 3GX4X 1Z7UA 3HOTA 2DU9A 2OYZA 5ICGA 2GA2A 3L2HA 1I5ZA 4Z07A 4U0WA 4BIFA 1DDNA 4I98B 4Q5SF 4UV8A 3LSTA 3JTHA 4RGXA 4YIIA 3ZMSA 4CGZA 2K9ZA 2QCSB 1HBXG 1FLIA 3MZHA 2EA7A 2P7VB 1O57A 1HW5A 2OZ6A 1BIAA 1MJ9A 4QGMA 4D7TA 2VOPA 4IEPA 2HQRA 3IWFA 4UXAA 5HDGA 3RI4A 3DKWA 2F5EA 5FQ0B 1RGSA 3EHKA 4ETSA 1AWCA 5BY5A 3LAPA 3F22A 3O14A 4WCGA 1WSUA 5BPXA 4FHTA 1R1UA 5ILUA 1FYMA 1EV7A 5IT9K 4KIFA 2NS0A 2B8MA 2RV8A 4WXDA 5I0UA 3KLNA 4MUVA 3WTXC 2RNJA 3KGZA 3J81K 2EWNA 2P4WA 2OA4A 2EA2A 1QXRA 3H7YA 4PGHA 4EJVA 3ISPA 1F4KA 1L3LA 4ZYHA 3IC7A 2WV0A 4KWJA 2C6YA 3IDCB 5E1WA 4EJWA 1IN8A 2KKOA 4A12A 2BNOA 1W7PD 3GLXA 5I91A 2FBIA 4OLLA 1EY2A 2VE9A 5ERIA 4FAHA 3GXOA 1KU2A 4MZUA 4HX7A 5BS6A 5HVQC 3KLOA 4EM2A 4OIRF 5BQTA 5FD6A 1USSA 2FBKA 1X82A 1TLHB 3HQXA 4KWKA 1EP0A 4MTDA 3RKWA 3Q5FA 3H8UA 4J1WA 3M3IA 5AIPA 1DPUA 5FFZA 1U6GA 1REPC 2OU2A 1Z05A 3E5QA 1QXJA 3WTSC 3WODF 2EFQA 2D5FA 1QBJA 2PN6A 3DP7A 2EFOA 5FQ0A 2M87A 4KIBA 2W85A 2RDPA 2XV4S 3P9CA 2Y48A 1DPRA 5DUKA 3WU1B 1W7PB 1LRHA 5KHHA 4MTEA 3JSOA 2D45A 2IP2A 1L3JA 1XB4A 2IPQX 1J3RA 5A2QZ 4HYEA 2ZCWA
chains in the Genus database with same CATH superfamily
2JIGA 1OFCX 4A69C 2XKOA 5JUVA 1SLTA 1GV9A 3GCXA 5HI0A 4MVTA 2XRLA 3F8BA 4KA4A 1IS3A 4JDMA 1X3WB 4XDPA 4Y3OA 4XW3A 2J1VA 3RCOA 4IEOA 1WCDJ 5M5YJ 1A8DA 4IETA 4XKVA 2ZS6B 1K6OA 1WLWA 5LHHA 4AWDA 2ZJ2A 5FV3A 5IYBJ 5LA1A 4A3KJ 5JWPA 1F31A 1OCZH 1H4HA 5A7WB 4XQDA 1MDMB 4I6ZA 3BTAA 3K1MA 4XSZF 1OLRA 3LSEA 4B8EA 4QQ2A 4A3MJ 1HN1A 3WF4A 1A6IA 2VXDA 5T54A 1ND3C 4QPOA 3N35A 4XFAA 1JOBA 1CJPA 2PAMA 4XRMA 2MABA 5IVJA 4KWUA 3BG7A 4DXSA 3VB2A 1WZ2A 1EUTA 3SXYA 5LASA 5CG9A 4YG6A 3A0KA 3AKRA 5JXJA 4BE1A 3GFIA 2YPDA 4ONUA 3Q9SA 2ENRA 1P2FA 4CDQA 2F5CA 4QHOA 1K5MA 1U5TB 2XVKA 4PHZA 1MSFC 1MMDA 1A04A 3AKPA 4QX7A 3UK9A 3USUB 5BNNA 3R05A 4OYUA 2STWA 1XNAA 2ZSIB 2QQLA 2VOOA 3EMRA 5FZHA 4E2GA 5IFTA 2GN7A 3EXUA 5AVPA 4S2DA 2G19A 5IVCA 4HG2A 1XQNA 3LFKA 1D0GA 3GW2A 1WJCA 3GZ6A 4E7IA 1XSRA 2KRFA 3SEEA 3BALA 4UFIA 1X1DA 1D5YA 4UUSA 1UZVA 2VONA 3D0JA 4FOVA 1SDWA 2ZMKA 4BE2A 3J81Z 5K1YA 3WG1A 3GZ5A 3I5UA 3LDRA 1UZYA 5EQUA 2IA1A 5A32A 5F0FA 5FZMA 4ZS3A 4CUAA 2XOMA 1JYXA 1ENSA 2UWMA 4F93B 4URTA 2YC2A 1R082 4MQVA 1RVF3 4HETA 1XBFA 3IAQA 3N97A 2W7NA 3NAPB 5LD2C 2DVAA 3TEXA 1TW2A 1YG2A 3C2BA 1NXD1 5J40A 4AK3A 5FKNA 2AEYA 1BOBA 1YTYA 2FJ1A 3AYCA 4OHYA 2QQ8A 1ZLKA 2YMZA 3B00A 2BQPA 3Q8CA 4XUQA 5IFPA 1FSHA 4M3BA 2GP5A 1FEXA 1POGA 2E1CA 1LOGA 3K69A 3WG7H 4JBAA 1YRNA 1W6MB 2V9PA 3QQAA 3M7AA 5BYNA 4WM8C 3MIHA 3ZMOA 3WHTA 3CCLI 3U10A 2HOEA 2NXNB 3ZQQA 3WZ1A 2GNBA 1W04A 1C28A 2OKXA 1IUFA 3TW7A 3TDZC 2E33A 3T4HB 3CJRB 5FYZA 4CZZA 1S1AA 2CTVA 1DQ0A 1ZHFA 2ESHA 3U9GA 4ZYEA 3IP4B 2EK5A 4DW6A 4LA3A 1P4XA 3CCJI 4LIUA 4IOCF 1W0NA 4Y1VA 1BMV2 4BLJA 1RUG2 1TWCJ 3CP2A 4HQEA 2RVCA 2R7QA 4JTNA 3FDYA 1W9YA 4NIIA 2QQJA 1TNSA 4NWWA 5F2WA 1HQLA 1GQHA 3IBMA 1XMKA 3USSA 3ASIA 3R0JA 2D7FA 1BR4A 5ANQA 4N53C 1KFXL 4JX4A 4IHXA 2F5DA 3PU3A 5F5AA 3B7MA 4EN9B 1ZBA3 1RR7A 1ERDA 4PFOA 3BZ6A 5GTHC 1QJU1 2WNEA 4WVZA 4EN6B 1OCPA 5EZHA 1I1EA 4DYRA 3I3LA 3HRUA 2WA0A 4I3GA 2OTLI 3LFMA 3RNSA 5FROA 3J26N 2ETHA 4XFHA 2XR4A 1BC7C 4HEA2 4MGSA 1D4M1 4WWCA 1G9FA 3CUQA 5CISA 4LNVA 5ED4A 3CJIC 2R16A 1QQP3 2EZIA 2R7VA 5LWBA 1VRBA 3S7EA 1I39A 3VKOA 4RS5A 3B69A 2ZAHA 3AL6A 5K0UA 1P7IA 4AIDA 3QLQA 2FA5A 1S8NA 1YJWI 2QLZA 1HC8A 1OUXA 2HLEA 1ZBA1 1ZK8A 1NZCA 2EFPA 3LEIA 3OV8A 1R081 3DBLB 4LKDA 4I3PA 4RQPA 4XSXF 4PGGA 3AAFA 4J19A 3JRBA 5FY5A 2CU7A 3I2GA 3GTGJ 1YIPA 3POSA 4AFDA 1B09A 2UWAA 3IMNA 1DLCA 4V2FA 4ZU5A 2ZEXA 1AR81 2DUPA 2PJRA 1IS6A 1K3IA 2IXSA 1JTZX 2XAHA 3UKNA 1PK6C 4E7KA 1S0CA 4F52A 5A1LA 3M1EA 3QOPA 4HBLA 4BKXA 1SCRA 2PMUA 1V6LA 5I8TA 4IQ4A 2ZXWH 4FOQA 1JI6A 3OR1C 4XICA 4GALA 2LDUA 1GANA 3QCWA 5DCMB 3LZZA 2TNFA 5IUQA 3PUSA 4QB1A 4QTRA 4DS0A 4G7ZF 3H0OA 5E8GA 1OKOA 2PXJA 1YIOA 1AL23 4EE2A 4UWDA 2R061 1RUJ2 1C1FA 3NNGA 3V7CA 2Y34A 3OL3A 1XJAA 1CAWA 5JIAA 1GQPA 3ZFEA 1OPCA 2Y69H 2UY8A 4K40A 3FXQA 2NMOA 2W24A 4M73A 3TN91 2MEV1 3E6DA 5L73A 2LROA 1SPPA 1XG1A 4Y33A 3PQKA 1IZ3A 4Q4X1 1EYBA 1OLME 4MO7A 1EAH3 2E32A 4L11A 3H36A 2ISZA 1CX4A 5HS9A 2EIJH 1H2MA 1RUI1 4ZYAA 3I59A 1C8NA 1DZQA 4AVZA 2PFBA 5HODA 3SFZA 1TMF1 3S32A 2YU9J 4KH9A 3PVBB 1MMGA 5IOYA 4I30A 2WQ8A 2NNYA 5CU1A 3T1MA 4BY7J 2LREA 2W68A 3BZCA 2X5IA 4ORFA 4XZUG 2VW2A 3FMRA 1TME3 2DJNA 1WGPA 1JI8A 2W47A 1GLNA 4IRGA 1GWMA 3WU0A 2I5UA 1PO21 1J84A 2HXIA 4XYXA 1DQ4A 4ZU4A 3P9KA 4HFSA 2D1HA 3T08A 5H20A 1FBQA 1QZEA 3QYEA 5EJ1B 3AL5A 4RGRA 1CJDA 1Z6TA 1GOHA 2HI3A 4AEKA 2G1MA 1T56A 3MKWB 2DBNA 3PSIA 4RM2A 3M07A 3L2RA 4AAXA 2VOWA 3EUHA 3KB5A 3ZDVA 4OHXA 1R091 3O1PA 1FOD3 1OVPA 4KMUX 4YM2A 1JYWA 2H27A 1CAUA 1YW9A 1TWFJ 3I3MA 1W6OB 3POJA 3D0SA 3ZRGA 2VUCA 1LOFC 2D3RA 1B8IA 4M3FA 5HDKA 1NX9A 2FCUA 2E71A 2L01A 4PDWC 5DQ0A 2V72A 2CSOA 4CHUA 5GLZA 2ZBKA 4RAYA 4FOYA 5JZGB 3VDDB 4ON0A 3EYPA 4OIOF 3I2DA 4Z6YA 4DXTA 2XL9A 1BJQA 1O4YA 4KNCA 1RJ8A 2Q8DA 3SH5A 3ZN6A 4WXCA 2CYYA 5DABA 3MN2A 3GFJA 5HCAA 2TCTA 3AZWA 3VD3A 3E1F1 4P9LA 5LRSA 2VQ0A 3ZMUA 4CYCB 2JDUA 2YBSA 3U1DA 3PVEA 4YFNF 5TGTA 2VVFA 5DM6F 4V2GA 3HT1A 5DUWA 3E97A 1YFHA 5FK7A 2EIKH 2VC9A 1PVC1 4IL7A 2HWE3 2JG9C 2VBZA 3OYDA 1IXCA 1YE9A 5IAVA 3DLAA 1UZCA 1OVSA 2XLAA 4DPNA 2JDYA 1TZOA 1OBNA 2DCJA 5JLXA 1PMHX 1QJY2 1BQPA 3T09A 4HN1A 1X1BA 1ZR4A 1AYN3 2OW4A 1WFXA 4FASD 3ZFEC 4TTGA 3OS1A 3K46A 2JSCA 4ZZDA 1KRIA 4YFZA 4OOIA 2DFCA 2YY1A 2HWC1 3DQVC 1ZM1A 1AOYA 1JW6A 2ELKA 4ES9A 3ZN0A 4D5CA 1P8JA 5IYYA 1WMEA 1J2XA 2HVQA 3G4SI 1SBDA 1YUDA 2A5YB 2LRPA 1LFUP 2DYSH 1VRH2 2KIFA 1S0GA 3ES4A 3N05A 3S3MA 1CX1A 1FP1D 3O6BB 4QX3A 5H6QA 3T0AA 1BL0A 3QH6A 5FOBB 5J1YA 4CA9A 4SBVA 1VMFA 1XRUA 2VCMA 1GWKA 4WVMB 3UL2A 4UVBA 4I09A 2BFUL 3KZYA 4XF0A 1ST8A 2LTPA 4V19K 2R6QA 1BHGA 5D5VB 2VMHA 2KR2A 1ORKA 3CCMI 1G7YA 1S7AA 1BLZA 3OPTA 2RDRA 4HL0A 1IRXA 2XDVA 4FPJA 4CCNA 2QJVA 1AXKA 1YJLA 1B9MA 3TB0A 3K0LA 1H8TB 1NA1C 4CDGA 2JRMA 2V5YA 1LU2A 3L2CA 2B9VA 2NLRA 2P6SA 1GLHA 1MPXA 1W99A 3HPNA 1HSJA 3F23A 2VOTA 2X53S 4JQFA 3VYUB 5IK4A 3M1HA 4AVCA 2VQAA 4X6RB 3W2AA 4H4KC 2A6TA 4QAWA 3EUHC 5F5IA 2X1DA 2XB6C 3FFZA 3IH3A 2Y6JA 2WQ4A 1UF2C 1W8UA 3I2OA 1ULFA 2WIIB 1HB1A 3LFUA 4Y5Z0 4FFFA 3RI8A 2FBHA 2STTA 1S2EA 4XHXA 2HH9A 1UCXA 4WF2A 2VJ4A 2P34A 1X3ZB 2FQPA 4K3UA 1A6QA 3GBWA 4KI5M 5A7OA 3V64A 1T39A 3D82A 3EO6A 1ZG5A 1F15A 2ZA9A 3PMEA 1QJX2 2YU3A 5D4SA 3B94A 1GYKA 1UU4A 2DCYA 1ND3B 1KS5A 2RN7A 2JENA 1JMUB 5GZDA 1MBJA 5FLXZ 1VBE1 4PJ0C 3CCEI 1W9TA 1VBD1 3BPXA 2YDEA 3S15J 1RIOH 4UUVA 4LMYA 3DTEA 2A6VA 1JZ4A 3JTGA 5E3MA 4AQTA 1VBC3 1WKYA 1VRH3 4BQWA 4CRQA 1MEC2 1ODDA 4FPGA 1HQCA 3WNMA 3PUBA 2JA2A 3ELNA 2IXCA 1W0UA 1FTTA 1G59A 2FHRA 2TUNA 2VZQA 5E16A 4C91A 4JQRA 1AYN1 4LBQA 3C7EA 4XUNA 1OXCA 4BL0B 5E1ZB 5FBJA 3G3ZA 5FYTA 1KQRA 1UU6A 3FLTA 3SCHA 1L7QA 2ID4A 1PNFA 1UWWA 2VE8A 3AP9A 4HK8A 2VZPA 3AKTA 2LKXA 1DGRN 1AYM3 4TN7A 5CFDB 3T8RA 2P2KA 3OSGA 3J80K 2F17A 2C24A 4YG0A 3VDAA 3AC0A 4AVPA 4GJYA 3OD0A 1ZGWA 3LSIA 2W2IA 4PDKA 3DXTA 2M4GA 3KVAA 2DOFA 4IRIA 3AK0A 4IE6A 4C3JJ 5J4VA 4WM8A 4I02A 4A3FJ 4R79A 3KZIC 3HPGA 2KA3A 1IF1A 5A3TA 2KIUA 2A75A 3F72A 3CEWA 2K85A 4M74A 2V73A 4YW3A 5FUPA 2OD5A 1WJFA 4CUCA 4MEXF 3WW2A 4D6SA 3LDBA 2RM22 5H2FC 3HSRA 3V42A 2WFPA 5I0SA 2DT5A 4LBOA 1S3JA 4AVAA 1F4HA 5D1IA 5ICCA 4LKFA 5FYHA 1H30A 3RVHA 2MC3A 4ZTJA 5FPAA 1JTYA 1KD7A 4NPMA 2Y60A 4NQWB 2DA6A 1A34A 5F08A 4ZZ8A 2NYXA 3DECA 5FXXA 3HKZN 4U2AA 2WKKA 5DM7F 1MBGA 1PGW2 1YHFA 3LA7A 2UWCA 3PJQA 4DO0A 2R5YB 4QB2A 3IKWA 3AZZA 4B7EA 4XFGA 1FP2A 5BXXA 3W59A 1H2LA 3H5AA 2ZFWA 3HJRA 5GLTA 2M5WA 4GA9A 5BV6A 2GOXB 3K2AA 5M5XJ 1JTXA 3LQQA 4JKMA 4MLOA 2WV1A 1UY2A 5F0CA 5HLGA 1TQ5A 3RTRA 3KV5A 2DFHA 1SFKA 3H7JA 1LODA 5A3UA 1HKTA 4BISA 2ZGSA 2GALA 1FYLA 4C3HJ 1MQTA 4F92B 1IN6A 4IEVA 3FHIB 2EIEA 3C1DA 4X6QB 4PQQA 2C9KA 3CUQC 4B09A 2JA5J 3ACLA 1UL9A 1RZ4A 3MPPG 2PI0A 3PM1A 3MEXA 4OI1A 4B47A 4RLQA 1VQ8I 3NNLA 4N53B 3NNMA 1UOFA 1DIWA 3VBFB 1GFF2 3JREA 2GP3A 1GZTA 4MH0E 4U87A 1BN5A 2Y6LA 5CYYA 1JYTA 2XKPA 2JA6J 2OPTA 1COV3 1GP4A 3M8FA 2VOVA 4JVAA 3EYIA 2P6TA 3KP3A 1KQ8A 2O1QA 4E2SA 2XHNA 2J1AA 3HTSB 2LNBA 3MLLA 3I3EA 1URXA 4P5OA 3PDQA 4RGAA 4GAZA 5IPAA 1SMVA 4S0HB 1PDNC 4B8XA 3OGGA 5EYRA 5B3SH 2RNGA 3ZXLA 4UXNA 3KCCA 2DK5A 1QZYA 2UXXA 4BMEA 2VT2A 2Q30A 2A6XA 2JD4A 1QH7A 2RS13 2I45A 3K2OA 1AL22 3OB8A 3CJQB 3TEDA 4MHUA 3PNYA 5FJKA 2XAGA 2E7AA 3NW4A 1TE1B 5K7ZA 3ZMNA 4Q4X2 1LEDA 4UV9A 4LTAA 2ORZA 3WTVC 1QMJA 4LXLA 3IKVA 3QYFA 5L19A 4MGZE 1COV1 3NV4A 1XMAA 3KT7A 5KNLA 2WADA 3LNQA 2P1BA 4Y20A 3RG0A 4ABZA 2OPKA 4N43C 1NCRB 2RE9A 4MGRA 3J80Z 3ZOIA 4AVVA 3VHRA 4AFBA 1V0AA 5KXDA 2JN6A 2ADDA 5A3WA 4K9SA 4YGDA 3CMEI 3NAUA 4HRIA 2VL4A 3CHXA 3MIFA 1X3UA 5L3FA 4FPYA 1PK6B 1LQ1A 4LBNA 1POV0 3DF8A 4ATEA 2PHRA 1RKTA 2JT1A 3FWEA 1NLSA 2M7AA 4AGGA 5LGTA 5FGMA 2FDGA 1JZ8A 4FPLA 3P5BA 1R1A2 1OT5A 1NTCA 1RB8G 4CDUC 5ACA2 5KK1A 1GXPA 4S05A 1HQWA 2O14A 4PBOA 2Z79A 3BKZA 4XIDA 4HDVA 4E7JA 4BBSJ 2YU2A 5A7SA 1SLIA 1PGSA 5IK8A 3GTJJ 4WXHA 1SC7A 2LS6A 2AEZA 5C71A 2PQQA 1RUD1 4COVA 3R6SA 2WNUB 5FMDA 3HNBM 1KITA 5GJ6A 2E63A 5JMCA 3SNMA 2OZUA 3FC0A 4JDNA 5JXHA 4RSUA 3L2QA 5AC93 2DU1A 4N0BA 2LC2A 2O8XA 3WTTC 4XRFA 2EXJA 4EZHA 1RUI2 4JCKA 4QQHA 4OULA 3BGAA 4XEZA 2CUZA 2DUOA 4NHJA 5L7OB 2JPBA 4NAOA 2ZOEB 3K4AA 1XDSA 2W25A 2VUMJ 2VKVA 1PUEE 4R1HA 3I56I 2VMCA 1VBA2 1GOFA 5ERLA 5JPNB 4IUGA 3COAC 2J42A 1ODNA 2EINH 3KP4A 2D93A 3T0BA 1IUYA 4RHV1 4DUVA 3REOA 2XGCA 5FPLA 2CHHA 3WT3A 4LBQD 1ZG3A 1XCBA 3AXEA 2ZXHA 4E6KG 4JP0A 1F2NA 3GF6A 2JICA 1LFBA 2W1UA 3F2ZA 2VULA 2VODA 5KHIA 3HOUJ 5H6RA 4NN0A 4QDRA 2ZKLA 4N9HA 3TYJA 5C3PA 2WZ8A 4ARYA 2W82A 3FKIJ 2XB5A 2HEWF 4IE0A 2G4IA 1OD5A 2Y6GA 4B29A 2JG8C 4UOJA 3DKXA 1QJU3 1PZ8A 3AKQA 2JWTA 1D4VB 4Q8LA 4XQFA 2PYTA 5FZOB 3THDA 1FOWA 3U1XA 3JBG1 3HUGA 4UUSB 4HK9A 1JZ5A 2VJ5A 4MIMA 3VBRB 3N9NA 5FOJB 3WW4A 5E1RA 4I0BA 5LEKA 2WFF3 2RMU3 4Q0PA 1UHSA 1MZ5A 5C7GA 1JH5A 4RAZA 3AL0C 1MEC3 3AP6A 2L2OA 4G9SB 2K3FA 2OQGA 1XC6A 1X50A 3U37A 5B66C 4X8NA 3NQOA 1S5LC 2XPUA 3QP5A 1ZRCA 2X9DA 1UYPA 3H0GJ 2OF7A 5CG8A 2QNKA 4CU8A 2SBAA 1MBEA 4DUXA 2VE1A 1E5SA 1BI1A 4A45A 2ZGPA 3H1MA 2RS11 2X5IC 2DFBA 4YM3A 2V4JC 4M72A 1HCRA 4FETA 4FI9A 3WNOA 4RHV3 3HC7A 3QU3A 4EJOA 4O9GA 5F04A 1YJKA 1V6MA 3I53A 1ND2C 3G1LA 3CMGA 1VBC2 2WR9A 3FX3A 2WSVA 2WZR2 1FOD1 4Q4Y3 4L99A 2WYSA 3O0WA 3NRUA 2EIDA 4MV2A 4FCYA 2CWEA 1IXSB 3B93A 1W0TA 1NE6A 4HA8A 4ITVA 2VO5A 3OY8B 4HG6B 1ETVA 1UFMA 4ZDLA 2O7OA 1F5FA 2VW1A 4MX3A 4GWIA 2VPRA 2ZMEA 1RETA 3CNAA 5FZCA 3X2QH 2W5FA 1KQ0A 5CKTA 1WJAA 3VOEA 1O3RA 2PLV1 3ETPA 5DUVA 1H8AC 5BUVA 3J7AY 4L5JA 1CZSA 1FOXA 3AG2H 2CQXA 1XOYA 2HYGD 1RHI2 2R041 3JAMK 5FZBA 4AZZA 5FLVA 4GWJA 3OCPA 1W6QA 1IQDC 2PX9A 2Q5TA 2L7KA 4LG0B 2DOAA 4FTEA 1W6NA 3IPVA 2QQWA 2DPDA 1ULYA 3ZXSA 1W2OA 5FUIA 3BP8A 1ONAA 1OF3A 5D5WB 5FMCA 2KZVA 3JRCA 1C1LA 3FISA 1VLNA 2M4KA 3J7MA 4ZTFA 3KM5A 3N7MA 4EJTA 1V6KA 3U21A 2KT0A 4TYSA 2WZEA 4HF2A 1UIKA 2QZ3A 1MR5A 4PJMA 1BVVA 4L5IA 1LVAA 3VL8A 3RFRA 1X9PA 5DAWA 4NOTA 1KJRA 4IDZA 2HOAA 1ZR2A 1RJ7A 1IRFA 2D6OX 2YXSA 3DLLF 4JZRA 1YIFA 1PO23 5FO8B 4QXCA 4MXWA 3E6CC 5JHFA 1I1SA 3DYOA 3JRIA 4C2MJ 1IV6A 5EGOB 4RQPB 1QZZA 4C3IJ 4KBBA 3HOSA 4DRRA 4BDZA 1CIWA 1STZA 1CZVA 3GZNB 4BHBA 1K5MB 4CCCA 1YQ5A 3HSFA 1IQAA 3OY9A 5CZKA 1HDDC 2P4EA 4RGSA 3NNJA 5C3QA 4A93J 3OYLA 3LPFA 4YW5A 4BWOA 5KHGA 3MIDA 2FU4A 3DXJF 1ZBA2 2Y6HA 2O8KA 1WH7A 4QMAA 1R71A 2IGOA 2RREA 3AFKA 5E20A 4W97A 4A7KA 2XG3A 5JVVA 3K4DA 1LHWA 5EJCA 1IGNA 3LB9A 5GLUA 4EJUA 4L92A 1MGTA 4OU0A 2EIBA 5F37A 4NDLA 3UT0A 1DGWX 2TEPA 1CESA 1D0YA 4LLGF 4IEQA 4P9JA 3IHUA 4P55A 3VL9A 2P8TA 2H8WA 3A23A 5T5LA 1KQ9A 1W6QB 3F8MA 2W94A 4DB5A 5LATA 1YQAA 2R7WA 4YNIA 1Z7UA 3S2DJ 2ARCA 4CDQB 3L2HA 1CZTA 1I5ZA 1RIRA 2WDBA 2AREA 2K9ZA 2EA7A 3I3QA 1P7JA 2P7VB 3I4MJ 4RL7A 3ZYHA 5BNGA 2OZ6A 4YLZA 2LTNA 1MJ9A 4ZONA 2FZ2A 4DXZA 3POEA 2BHZA 5HDGA 4NRQA 3ZXFA 4Q4V3 3DBHB 5E79C 1LU1A 1RGSA 1QIQA 5JDBA 1H0BA 5BY5A 3F22A 1MS9A 4RLFA 2Y26A 1YCIA 5KCMA 4AF9A 3Q0VA 1PUFA 4FFIA 5CKMA 4IV3B 1W2AX 4XBNA 5IT9K 1EA3A 5JR2A 1UYYA 2X05A 2B8MA 2JDNA 2WUHA 1K45A 3S3OA 5FZGA 1YITI 3WTXC 3LDKA 5E88A 1NCQA 3ISPA 3BLYA 1M06G 2J22A 4ZYHA 1DCSA 1TME2 1XU2A 4EJWA 3N9QA 4A12A 2R1DA 2Z5WA 2WQZC 3JBG2 4NPLA 3CBNA 4GH4A 5ERIA 2WAEA 1AR61 1KU2A 2XWBB 5HVQC 5F3GA 3GGLA 3F0CA 2JDHA 3B6CA 3LIGA 5CA6A 1X82A 2KD7A 1EP0A 2YGMA 3ESWB 3TP0A 3Q5FA 1VNDA 3M3IA 3MICA 5AIPA 2OU2A 4AR2A 4FPCA 2E5ZA 5FR3A 2ZZJA 4JGYB 4CEYA 3KLSA 4QPWA 2EFOA 2R0QC 2W52A 2M87A 2BFUS 2XONA 2DMUA 2X51A 2RDPA 3HG9A 1FMD1 3U1KA 2JDPA 3CCQI 2F6BA 2VJJA 4MTEA 2BWAA 1AJKA 1L3JA 3HOWJ 4QPGB 5FYUA 2QSFX 4HNVA 1J3RA 1GZCA 2ZCWA 3DN7A 4UYBA 1VQ9I 1AR91 4LB6B 1U2WA 4E7HA 4IEWA 3FLRA 4EN7B 2J1EA 2V4AA 4BAYA 3DCQA 4ENMA 4YVSB 4BM8A 2LK2A 1R4MB 5KC6A 2CG4A 2CRGA 2LY2A 1UYXA 1Q8QA 4NIGA 1XGOA 3DU5A 2HYKA 5J48A 2WC2A 3WCRA 4CP9B 3VBFC 3DPTA 4AUXA 2VKDA 3DF0A 5EV7A 4GMP1 3Q8FA 3F6OA 1IN7A 5EWSA 1W9FA 1Y1WJ 2RQQA 2IXLA 4RD7A 1Y9GA 1JS9A 1OPOA 2ZX2A 1B6AA 4XUOA 4HSRA 1OYYA 4LLLA 3VBHA 1P4AA 3DEMA 3CKHA 4AEDC 1KYWA 1IHMA 3OYHA 2K9SA 3VHNA 1XXNA 4MEYF 4KN7X 3HGGA 4G94A 2AUYA 1QNWA 4D1QA 5DEQA 3OIOA 2WN2A 2QQBA 1YI9A 2NPIA 1XSVA 3WGHA 1PVC3 1LFPA 1T8IA 3HHGA 5HS8A 4DY3A 3I97A 2L9LA 1OURA 4AW7A 2DDUA 4Q48A 1ULOA 1AU7A 4Y5TA 4IL6C 5L9VA 1F1ZA 1C4RA 4RN5A 3ZKYA 2DT6A 1ON1A 2ZXIA 5TRDA 5FMOL 5A3LA 4J25A 2VZSA 1VB4A 2X1EA 2XJVA 3OYCA 2DWRA 2WT0A 4M3DA 4XAAA 3E5UA 2ZABA 1V55H 2CV2A 2Y30A 1ACIA 4XMAA 1SQ4A 1RRJA 4HNTA 4N43B 5LBFA 4CZSA 4CCKA 3MFAA 4IF4A 4YM1A 3RWNA 3RZGA 1J3QA 1YFUA 3IB3A 2PJPA 5FPXA 1AX0A 2VXJA 4HDUA 2R073 1HJFA 5DUXA 1FX5A 3S1NJ 4Q1RA 1USTA 2P3JA 2W08A 1TWGJ 1S9HA 5E3NA 3KETA 2GN3A 1NK3P 4R9BA 5HBAA 1XNDA 1WGXA 2ECCA 2HBTA 4FCAA 2FD8A 2LBFB 3J8F3 2BY1A 3FMQA 1OYIA 3CC2I 1N3OA 4CDUB 1K12A 1DZTA 1A36A 1LOCA 2Y0MA 1IG7A 3SCGA 4XM3A 4PLNA 3CZ6A 3HEIA 3FM5A 3HKZA 5DMYA 3NAPC 1BIBA 2E1MC 2XAJA 3GHMA 4UW4A 1TW3A 1ULCA 1ETOA 3EQLF 1UG2A 4HSLA 2VQGA 3ASNH 3KT4A 1T38A 4CCJA 3CCRI 5H9SA 3CUOA 1X1CA 2K3PA 3H9AA 2DA5A 2F4OB 3MKYB 1WWYA 4WX9A 4BBRJ 3ROUA 5F3CA 3IUOA 2WA4A 2JX9A 1WKMA 2PQ8A 4XKCA 3S14J 3C7GA 4CP1A 2K7LA 3SQNA 1ZAOA 1SLLA 3JCIA 5FYIA 1D0XA 5CB7A 2YSRA 3BU7A 5I0DA 1JKOC 1RUC1 4IGOA 3T2QA 1DP7P 3FXRA 3H1CA 3DPLC 1W8ZA 3CDIA 3UGFA 4XNFA 4AEMA 4BQ1A 1RUF1 5FKKA 5J8CA 5FKBA 3HB9A 1UHMA 1ZARA 1BZWA 3I2KA 3RJPA 5C9AB 2JKBA 1B1BA 3VZMA 4EQQA 1MNEA 3TBIA 1WMXA 3PUHA 4COZA 2DVDA 4DOZA 2DYCA 2J7MA 2Y0SN 4CU9A 1LGCA 2QQKA 1ZA4A 2FDJA 2HNHA 3HSEA 1W90A 4AEDA 3ZKUA 3BOQA 1APLC 5BPIA 2QUOA 2OUJA 4DQ2A 4RR3B 2QTWB 4SLIA 2R4GA 1O3TA 4NIAA 3A03A 2F6CA 3WVJA 3O12A 3EYYA 3AMQA 1T33A 1QNYA 2RMU1 2C4XA 5EEGA 2WA3A 3HWJA 5L3DA 3AMNA 4Z2YA 2NS8A 3I8TA 4EWEA 4LLOA 4E7SA 1WJBA 4BY1J 1OD3A 3ZSJA 3TEWA 1XX5A 1YFYA 1MNMC 1STMA 1T2XA 1ETXA 2UV1A 1ZZ7A 1DGRA 4L18B 3G71I 3WTUC 3ZFGB 2AGSA 3OIPA 2ZGTA 3V0BA 4ASNA 4O6JA 1OA4A 4CSWA 3POFA 1V9U3 2ET7A 1JJ6C 5I8SA 2M0MA 2MG4A 3OYBA 1W6OA 3C3VA 4LJZF 3W6VA 3WDXA 2FXAA 4ZYGA 1IRGA 5B4NA 1FPN3 5JOXA 3IDAA 1UB9A 1ZRFA 2E35A 1BC8C 4BEHB 2K27A 1O5LA 1F9NA 2H8RA 4ZYDA 1DP0A 4GXLA 5C4WB 2H94A 3WDVA 4NE9A 2RDQA 2HFHA 2EPFA 2Z99A 2ERFA 4N4NB 2VPVA 1R1ZA 1V6JA 4FSJA 1HV1A 2MPFA 3SDGA 1QQIA 2OQRA 1FTZA 3WF3A 2DBBA 2EZLA 2E7QA 3V8LA 4LJHA 1RL3A 4O9EA 1OCRH 3WQ7A 5K5RA 1YLFA 2B45X 2YX4A 3WSOA 4K20A 2P5BA 4UW5A 1JGSA 1FMD3 4AI2A 5F39A 1OCTC 1DU6A 5FD5A 2ATFA 2KIQA 1EF4A 1EUUA 4C90A 1ZVFA 4RS5C 4CPBA 1PHMA 3WUCA 1OYWA 3TEZA 1XD7A 1MS3A 3H50A 4XF1A 4YZ4A 3ZN4A 1D4M3 5J1RA 3LL7A 1O3QA 1KZHA 1R1VA 3ML6A 1W06A 1JYIA 1Q56A 3Q8AA 5BOXA 3LSPA 1SCSA 2OV7A 3WR0A 2YV8A 5FXZA 3U0ZA 4QGLA 4BQXA 2GQQA 1QKQA 1JHJA 1R1A1 2XPWA 1ZZ6A 2K5CA 1JBCA 2Y33A 3JD72 4MGQA 1RXFA 1SBEA 5D8KB 4JGZB 4GRIA 5FP3A 2VOKA 2VTFA 3L7WA 3E7LA 2ESNA 4HZFA 5KWRA 4HW0A 2LW8A 3O1MA 2QKLB 3LSJA 2XAFA 4LR4A 2CW0F 3QBQA 2DW4A 1W3VA 4O65A 5LLQA 2NVXJ 2GAUA 2FCVA 1WD3A 1G86A 2VR4A 2XWJB 3N9PA 4E2QA 4M3CA 3GM8A 4KNYA 2ID6A 4I0AA 3VBSC 1XE7A 2P5VA 3KGLA 5DDJ1 3OD4A 1NK2P 2NAZA 4KIGA 4P5HA 5LBCA 2DTZA 1ZBE3 4HLTA 2O6GE 4IHYA 4KYWA 4NR1A 2X6XA 3ZR5A 1WI3A 3RZMA 4XLPF 1Y9QA 1TZLA 3O1VA 3JU9A 2DMNA 2BGCA 2QQNA 1W8HA 4BQ5A 3AMMA 4Y1XA 3ILNA 2QVSB 4BJ5C 3HMYA 3J7AO 3IMMA 1U9NA 4E9KA 1B35C 1T98A 2QQUA 1OOPC 2P5LC 1IG0A 2XPVA 3ZXJA 4IPAA 4B4CA 3D3AA 3CO7C 2KXLA 4YZ2A 3TNQA 1HLCA 5DD4A 4XLHA 2VMGA 1TQPA 3ZXDA 4OMZA 4CU6A 4NIHA 1E3OC 1X19A 1VBE2 2Q0AA 1VP6A 2VQLA 5FZDA 3AJZA 3CMYA 3VD5A 3H35A 1Q3EA 1SLBA 3K77A 2YROA 2B63J 4JGZA 4PDWB 3KMHA 2Z9OA 3FK6A 3NV3A 2BU9A 4OI4A 3KWVA 1V54H 2A69F 4M6XA 2XGXA 2GMEA 4LG0A 2ZHKA 4P9WA 5A32B 3NWKA 1NLQA 1SANA 5LZ6A 4DY5A 4M3EA 1LHNA 2D6LX 4RA2A 2VB6A 1GR3A 4XDQA 4XZPA 2UZKA 4UFKA 5FK8A 4BXFA 1T2KA 3V0AA 2P3KA 2A5WA 3N9MA 5HS7A 1D1CA 2MNGA 2B7EA 3I3BA 4LUKA 2FX0A 5SV8A 1RESA 4DIQA 2V7FA 4JOMA 1RUH2 2ZX4A 1YI7A 1UZWA 4BA6A 3TBDA 1V3FA 1SVOA 1RUNA 2WO7A 1LKXA 2FBEA 2ZX3A 5G04L 4QKNA 3CJIB 4D7YA 4NIDA 4G9YA 1AJOA 3EETA 4M0NA 1AL0G 3CMMA 3SFIA 4LBQB 4XMIA 1JGGA 1XNTA 1XB9A 4CDXA 3ZQGA 1WWXA 4B3AA 5IWFA 4XETA 1UJ8A 2R49A 4B1LA 3VDDA 2A3WA 2GOMA 5LHIA 4A3JJ 2H6BA 1O7FA 4LHLA 4Q4W2 3VBUA 4CXYA 3ZFFC 4BLIA 2X48A 5ILVA 3GXUA 2W87A 3QOEA 4B48A 2QQIA 2QKDA 5GTIC 2VZTA 3LPGA 2JDAA 3UKVA 1ZH5A 1L7LA 1NXMA 5DZGA 2PLV3 4FQGA 4QKDA 3LKJA 4AFMA 3VYRB 1ZX5A 2RS33 4HANA 1U78A 1V5FA 3SYTA 2FSWA 2CS3A 2VCAA 3JBG3 2XJQA 1R58A 3CF2A 3VBSA 5D4RA 2ZACA 4CDWC 1G3SA 1HA8A 3VUOA 2A05A 2DN0A 5FLIA 4URAA 3BCAA 2XJTA 2PHFA 3OYMA 3TO9A 2PJRB 5FLHA 2FMDA 3LSGA 2WFF2 3ZIXA 2JDMA 4IV1B 1BKZA 3ABMH 1MDMA 3IIIA 4QPGC 2D2WA 4M3CF 4DXRA 3I55I 2J1UA 3L09A 3WHBA 5FZAA 1W2TA 1LE8A 3HQUA 1W0PA 4Y17A 2WS92 3C8XA 3RZJA 5JSPA 4ASLA 1HXDA 3OYGA 5C8CC 4B43A 2O61A 1BW5A 3GEZA 3JRGA 5C3EJ 4DINB 2BVVA 3IN9A 2C0ZA 1V4RA 1SFOJ 1OMIA 4U0YA 2IVIB 4IW3A 5D2AA 1H2KA 2Y31A 3PU8A 4U36A 5F5QA 2WT2A 3RI9A 2AXTC 1QJFA 1KU7A 4AEDB 2ZHMA 4UFHA 3BR1A 4V2WA 2ZEWA 2VN2A 5EZWA 3WP5A 2L9VA 2AZ5A 2D6PA 1IO2A 2X6WA 3K1NA 2XVLA 2XHKA 2BXYA 4YEJA 5ABJB 2X0LA 2WNVC 1K4TA 3FE5A 1F8VA 2AENA 1R7JA 2HXOA 3BY6A 3BJAA 3HDDA 2RS53 4G6TB 3THPA 2VKEA 3JW4A 4IXLA 2L4MA 3LF7A 5FKLA 3TGNA 1BMV1 3LWCA 4L0PA 1ZZ9A 4TWTA 2R7XA 3I3DA 2M3AA 4IEUA 4UW6A 1SEUA 2HEYF 1OUSA 1T6GC 1JYVA 3W21A 1LHVA 3M8EA 4YG3A 4AQ2A 2WAAA 2EV6A 3I0TA 2CGPA 2A1XA 4ASMB 4XURA 1FV3A 3P3PA 3K2ZA 4CCLA 3FFQA 1GT0C 2VNGA 2E34A 3T2OA 1OC1A 2QENA 4UVCA 1VMHA 1W5SA 1W7PA 4RB2C 4Y4YA 3K4ZA 2J1RA 2G7UA 1J3PA 5A33A 1U5ZA 3ZYGA 3PIOF 3ZN1A 3BTZA 4CDXC 3NAPA 4CXWA 3QWLA 4OAZA 2Q8EA 5JZGC 1PGW1 5CFDC 1JOJA 2VMFA 1SAXA 1LEAA 3LSHA 4XACA 2V1DA 1NH3A 4YRVA 1CAUB 4YW7A 3ZFFA 3PNAA 1Z3YA 5JCTA 2JG8A 3WEZA 3HM5A 3IH2A 1IAWA 1V70A 1UG0A 2TRTA 5CVRA 1QOTA 2VECA 1W5TA 1FMD2 1WH5A 2DAOA 2L7MP 4PJLA 2CFXA 4XIKA 4HKWA 4GDFA 4OMYA 3SXWA 1QWRA 1NHAA 4FAGA 2EAAA 2E36A 4HF1A 2ZHNA 3FUOA 4IEYA 5CVIA 3WNXA 3Q0UA 5K7HA 1IPSA 1ENRA 3B6AA 1DU3D 3FHAA 2OAZA 1XYOA 4XILA 5A3MA 3M9AA 3OBTA 2M8GX 4CDWA 1MZ6A 1W9WA 1REEA 3AP4A 1IDYA 3CO2A 4LHKA 1ZRDA 4NC7A 2HWC3 2ZX0A 3N7JA 2W4SA 1PYVA 1Y8RB 3OS2A 2GNDA 3KYDB 1X58A 2DU0A 2K2SA 3EB7A 2YPRA 5F7UA 2ACJA 1FATA 2A6ZA 2YUEA 2OUMA 1U3EM 2LUWA 5CJ9A 5ICEA 1ON2A 2WT1A 1J1TA 3JB4C 4XOPA 5CFCB 2GXBA 2V1NA 5J37A 1AXYA 4ZHNA 3NSTA 2VAUA 2LOOA 2ADEA 5B1AH 4WZCA 1FV2A 3VKMA 4XPVA 3UYJA 1TT5B 2XROA 4MHGA 1JOPA 3HBKA 3NO8A 3RRDA 2KDZA 4OFGA 1W9SA 4XRSA 3KD4A 4Y15A 5EG0A 3VSLA 3NWSA 3FJSA 4DMIA 1F5JA 4BDVB 5C3RA 2K4BA 9ANTA 2HPMA 1TWHJ 4Y22B 5FYCA 3GALA 2ZMEC 4IQJA 1QQP2 2RMU2 2P3IA 3ZOBA 5FY0A 5LBBA 5EJ3A 3QPTA 3UV9A 3ATGA 2VBWA 2Y6FA 2KRHA 5K0UC 4CP2A 3FKJA 1Y8QB 4PK4A 4RGKA 4Q4W3 1ZGJA 4IZZA 1LGNA 4QXHA 4DRVA 1E57A 4E4SA 4Q4Y1 1XNKA 4TV7A 1T0FA 2DMTA 3K70D 1BJZA 2QBYB 3ZGKA 4OUEA 2ZB9A 2HDWA 1A35A 4JRAA 1G9CA 1AR71 5F8PA 2L3DA 1FIPA 3M2MA 2HDCA 2GLOA 3S0MA 1HDKA 1WI9A 2CDOA 5DCMA 4NHYA 3HD8B 1TG7A 1C3HA 1ETWA 5D8AC 2PAKA 4YIFA 1NCRC 4HPKB 4LBJA 5JOYA 1UELB 2DODA 2R7TA 3BR6A 1LOBA 3QH7A 1QOOA 3EUKL 3AMPA 3D5LA 3J7NA 2FF4A 3LSRA 4RS5B 3GJAA 3PUIA 2DXIA 3OGSA 3MDPA 4EZ4A 2W00A 1WBLA 2RGVA 2VTXJ 1ZLJA 1H0MA 2IGMA 5C5TA 1CWPA 2X8KA 5TJJA 1PVEA 4Q4ZF 4UF0B 2JECA 5LW9A 3CIHA 3TOJA 3PJYA 2CO5A 5EYYA 1H8TA 4N9IA 3JD71 5F6KA 3ZMDA 4K1YA 4R4XA 2DBIA 1V6OA 5DDJ3 1U0AA 1OFSA 2X1CA 2ZKZA 5A7QA 4YYOA 4LT5A 4BQ4A 3TDUC 4KU8A 4H7MA 1MZEA 4KU7A 5EEHA 2JXAA 3JRAA 1O8SA 1TNTA 2VLAA 1SG3A 4UNOA 2QSHX 1VE0A 1R36A 3L1PA 2ILMA 3BTYA 3J4UH 2JA7J 4F91B 1VFCA 3RZKA 3M7GA 4CEWB 1NG7A 3VEPA 1WCSA 4OI2A 1HXS3 2WZR1 2EIMH 1UX6A 4ISQA 3KF3A 1VQ5I 2K9NA 2BNNA 1YQ8A 2OS2A 2VVDA 4MSVA 1OPMA 3RKQA 4E70A 5IVYA 2VJXA 2QQ9A 1RUF3 3W6KB 2PTMA 2HQNA 1UMIA 2CH0A 5LEJA 5FB2A 4Q47A 4JYKA 2P5KA 4IV1A 2D3PA 3VD7A 2XBO3 2R7OA 2O3FA 4PCRA 2GM4A 2O8OA 4Q5OA 5LRRA 1JU4A 2C5DA 3BROA 2H0VA 1GHCA 1JJ8C 2FD5A 1BW6A 1HLVA 3OYNA 3BTCA 5AFBA 4LG3A 3C7OA 1UQXA 2GWRA 2BGPA 1OSGA 4GYGA 1RUG1 3MCZA 4ZXKA 4B3XA 2BW3A 4LHNA 3VV1A 3JD73 1OCCH 3WHCA 3W58A 1RVF2 4Q4V1 3AMHA 3DEWA 3RS6A 1YW8A 1SVLA 2RHPA 2E26A 3CC7I 3DWLE 3ZQCA 4ZY9A 1S0JA 3ZSLA 3BPVA 4EM0B 1YLLA 5LBEA 3BN6A 3T5XA 4AFAA 3LGRA 1UXZA 1ODMA 3S3NA 1OR7A 5FJ8J 4TSVA 4TLFA 3MBWA 1LCLA 1BK1A 4M4PA 3BR2A 2P37A 2ZXQA 3CLPA 4IHWA 2QFEA 4A6DA 2UU8A 4W6XA 2GA1A 5KHDA 1GVDA 4G7OF 4B44A 4Q0QA 5K9YA 1N1VA 1Y4WA 3GUDA 1C5HA 3HXLA 1K78A 2R3SA 2UURA 4LORA 4DFSA 3BG3A 5B1BH 1MBFA 4KMQA 1YQ6A 4F55A 3H3LA 1HRI2 5FKOA 1YYVA 1AHDP 2Z1DA 2DQLA 4R52A 1GOGA 2D97A 5H9QA 4EYUA 3RZOJ 2NM1A 1MMAA 5K7PA 4NQWA 3S16J 4BNCA 3ETQA 4JRLA 2CJJA 4H14A 2L4AA 3EPZA 2YC4A 1EV13 2MSYA 5T5PA 3CMAI 4DQAA 4PJNA 4QX0A 2VL8A 3J7ZI 4K21A 2LFBA 2BBAA 1FBSA 1W6PB 4XBFA 1BBT1 3I64A 1EH6A 1S6LA 1C57A 1OF4A 4Q4W1 3SDBA 2K9MA 2CQQA 2XPJA 3MUZ1 3K4KA 4OIPF 3H3VK 1SLAA 2VUDA 4UUTA 1YO5C 3T0YA 1V00A 1H1MA 2JK3A 3C7JA 1OCOH 3TWIA 3CQZJ 3K51A 1HSTA 1QJU2 2F48A 4YARA 2CAVA 3QRFF 4HSTA 4FBFA 3HEFA 4RDUA 1LEBA 3LMMA 2LP0A 4YPJA 4XOGA 2GIVA 2F2EA 3CJXA 3WP4A 3DYPA 5JHUA 1EV11 4ES8A 4IE7A 1X8EA 5A1AA 4MADA 3R60A 3FLPA 1VBA1 1C0WA 2X29A 3USUA 5BNNB 5IVBA 4S2GA 2HWD1 3CQOA 4N53A 3JCUC 3ZPYA 1VB2A 4XN3A 1O3SA 3FBIB 3BUCA 1N75A 2OA2A 3CP8A 1AX1A 2KHMA 5HLIA 1C8M3 3VPRA 1WW5A 1HKSA 3FZVA 3QACA 2Z69A 1FMVA 5IVVA 4M4RA 2RM23 2J1TA 4LLNA 3A21A 4G3YC 3SQOA 3TO7A 3BYWA 1EKEA 4AL9A 2YPJA 1HV0A 5J09A 1R9TJ 1FOYA 2G7HA 4Y7NJ 1BI2A 3ABUA 2DFEA 4YIRX 1M4WA 2WNUC 2P0WA 2IA2A 2E53A 4U7BA 2HWB3 4H55A 1KU3A 1KA8A 1AXZA 3ABTA 2VIXA 5L3BA 4AVTA 2CGNA 1DZRA 1PGL1 2BHYA 3UR3C 4JHTA 4HVRA 4EM1A 3H8OA 2IXJA 3OUHA 3PJRA 3OL4A 1ZZ8A 4HKLA 5GM0A 3JRFA 3L2WA 2OXBA 3GYDA 1ZRIA 4MXVA 1O7LA 1V9U2 4QWNA 4B1MA 4MQ9F 3RDIA 3BWGA 1F9KA 3O1TA 1UKRA 3MIBA 3G2BA 5A6ZA 3ECOA 1W6MA 5HXVA 5FZ1A 2VBPA 3BOWA 4GKYA 1SACA 2AS5F 3O0XA 2A3XA 4XLNF 3UKGA 1MS0A 1UY0A 4N7IA 3VYTB 4B1RA 3CC4I 2R32A 4EQVA 5A3PA 2E7TA 1R093 3R61A 2AC1A 3OS0A 3OOUA 1MACA 5J98B 5JZGA 5FYMA 3K4BA 3GTLJ 1AUYA 4ET7A 4GB31 1UY4A 3WUDA 1BBT2 3H42B 5FZ3A 5K4LA 4D0PA 4P96A 4MG2A 1GZ9A 1X33A 1RKWA 2E51A 3RJ2X 3I4NJ 1I5PA 3MKLA 2UUZA 4P02B 2GA2A 2OQ6A 4BIFA 2Y8KA 1D1AA 4I98B 1HRV3 4Q5SF 3ZSKA 3LSTA 2LALA 2R93J 2QCSB 4A4AA 1MH3A 1O57A 3GCWA 5GZCA 2YS9A 1GKBA 4E4HA 3IWFA 2ZGLA 2HDDA 3SISA 4OWRB 3DKWA 3AZYA 5FQ0B 3I2IA 2CYFA 3MUY1 3RJRA 4AHYA 2YGLA 1I6HJ 4OHWA 3W2WA 3LAPA 3O14A 1CONA 1GU3A 2QQPA 3W20A 4F3JA 3LIHA 1EV7A 5FZ8A 4I99C 5I0UA 4MUVA 2V5DA 3KGZA 2P4WA 2PMZN 3ECQA 3PHMA 2XBO1 4O7XA 3H7YA 3ZQLA 1R083 1F4KA 3WP3A 1HQNA 2DTWA 5DG1A 3AG4H 2WV0A 4KWJA 4FQZA 3IDCB 4FFGA 2KKOA 3R4SA 2EZKA 2JDKA 4OLLA 1EY2A 1X2MA 2XJRA 3FBYA 1E3HA 3GXOA 2ZZQA 2LLKA 5DDJ2 4HPQA 4HX7A 4MZUA 3KLOA 5CQEA 4UB8C 4OIRF 5BQTA 2CGOA 5FD6A 2VBBA 1USSA 4YVWC 1TLHB 3QPSA 4MTDA 3RKWA 2RR11 5C33A 1V6IA 4QPQA 1DPUA 1A31A 1U6GA 3E5QA 3BR5A 1JT6A 3WTSC 4P1WA 3NJXA 4WM7C 4BE3A 3HOYJ 3TL4X 5IHRA 4FISA 1OQ1A 5DUKA 3WU1B 1W7PB 5KHHA 2RDSA 1TNFA 3GTKJ 3CLQA 5H9RA 3MIGA 2IP2A 1NCQC 4RYDA 2IPQX 5A2QZ 4AHWA 3HQRA 3RZDJ 2GDFA 2RDNA 3GCMA 4A3EJ 2M30A 4IE4A 4F7ZA 1SMTA 1YS6A 4FXKB 4PI0A 1K83J 3DPRB 1RUJ3 5JFRA 2VPLA 5TISC 3K9TA 5LA9A 3SEQA 3W5NA 4YM0A 2V1XA 3T1BA 3VZJA 4A3LJ 2YB7A 3UESA 2WSUA 1ASJ3 5E89A 4MNUA 1PO11 5L3EA 3JRDA 1YXWA 2RJKA 2CFOA 1UKGA 1UPSA 2A3SA 5CVJA 2NYYA 1QRYA 2KJBA 3BI3A 1N3QA 3E1SA 3JRHA 2Z33A 3PMSA 5L9BA 4XJ9A 3BTIA 5ICFA 4P9YA 5L3GA 4KT6A 1NAEA 1PNGA 2VMIA 2MGQA 1F5TA 2GZWA 1I50J 4EEFG 2QGUA 4G7HF 1W5CC 3B3QE 2NZ9A 3LA3A 4BZ4A 1O4TA 2C26A 4P5YA 3MWMA 5A7NA 2DVGA 3I59B 4XJ8A 3WTZA 2ELHA 4HLYA 1X2NA 4FX4A 5FZ6A 1QDOA 3KVBA 4Z8BA 4OMDA 1Q1VA 2K02A 4LK1F 2EB7A 5C44J 1JUPA 4G6QA 4EWDA 1TQIA 3SEZA 5GLWA 2BY0A 5K5QA 2F4PA 2W0XA 3PNVA 3SH3A 3I58A 3PUFA 1WMFA 2R0HA 3HRMA 3K3OA 1R092 3H3ZA 3GBFA 3VBOB 3FMSA 3MW2A 1VI0A 2FDHA 4LBMA 1KGSA 2QBXA 4Q26A 2E19A 1ZN2A 1JN2P 4ANJA 3DEEA 5C4WA 1Y0UA 4Y13A 4OQ9A 2IRFG 1OA3A 1X4PA 2YR2A 5EPAA 4ZKTB 3N36A 4XLEA 2HOTA 1AZDA 1J58A 5FDBA 1CAWB 4NC8A 3HNYM 1MVQA 2DPUA 3CCYA 1W6NB 3F21A 1UO9A 1PX4A 4LQRA 1JHNA 3A7QA 2RJ2A 2EICA 4W6YA 1I1GA 5IT6A 5ISLA 4A6OA 2QDNA 1F36A 5FZ9A 4WZFA 4YELA 2MH9A 5FPZA 5LGNA 2R043 2WTEA 4A44A 2ZNZA 2Y0OA 1W1WE 3MF9A 1CF7A 4HOOA 3RSNA 1LJ9A 3KP7A 5L7OA 5DCFA 1QJX3 2CV1A 1MBHA 4D9JA 1FI2A 4W6WA 2GC1A 2BPA2 3F6VA 3PTRB 4KN4X 5D21A 3HZJA 2BP6A 2JG9B 4XFCA 3QODA 4JAAA 3ILRA 1W36C 3BJ6A 2EH3A 5GADJ 2R5YA 5FJHA 5F3IA 2A6EF 1RITA 4TLGA 1JUMA 3C7HA 2G0EA 2XQRA 1TP4A 3MGUA 4B7KA 3MVPA 1LB2A 4ZZ5A 1REDA 1ZQ3P 1S0EA 3R4DB 1UCRA 2PHXA 4X8PA 2DQRA 1AVBA 3GZUC 3GMEA 1DGWA 4MFDA 2QA4I 3PNTA 1MS1A 3A01A 5C9AC 2FDKA 4DZGA 1HB3A 1ZREA 3DGTA 3SKJE 3BTXA 3C2UA 3OGJA 3NMBA 5J96B 1ZELA 1W2NA 3MLJA 1QGPA 4ZC3A 2NOJB 5IYCJ 1MMSA 4KL1A 3ACGA 4JGYC 3M3CA 2HVRA 1BM9A 2LD5A 4AOCA 3VFZA 3IV5A 5HNHA 1NY72 3FK7A 2E9QA 1A8MA 5DD8A 2XC7A 1YI2I 1JUHA 3TO6A 5A33B 5F27A 3L2UA 1OISA 1YRZA 1KGYA 1IGOA 2RG4A 2LMDA 3ME2A 1D8JA 3ITQA 2NVQJ 4LMFA 3JQWA 1TQMA 4XUTA 1JZ3A 1RUE3 3WNNA 3SC7X 2IZWA 1HIXA 2R072 1S55A 1JZ6A 1HW1A 2VT3A 1GMMA 5B5EC 1IW7F 3A4CA 4F3QA 2HWE1 3AYAA 1UMZA 4IX7A 1I6XA 2QDRA 4YG2F 4OCTA 3LEMA 5LY1A 4M6YA 2JE8A 1VQOI 4NPRA 2CV0A 1GWLA 4CE8A 4ZS2A 1LR5A 1S72I 3OBZA 5J8FA 5HPOA 1WJEA 1R00A 2W1SA 1QVUA 5C4WC 4CU7A 2ISYA 4L9NA 4II2A 3WQ0A 4QIWN 3U14A 3PQJA 5FWJA 3IAM2 1UAIA 1YEWA 5F64A 5JR7B 4AFCA 1YFXA 4DBQA 3PL0A 1PM7A 5F9TA 1I27A 2IJLA 3KV6A 1S7EA 3OSFA 4LBLA 4QX2A 1BEV3 2JRTA 2G9WA 4NHLA 3OG2A 3KIOA 5KXBA 3P1IA 4P9FA 1BYHA 1ENQA 3SZGA 4BB3A 5FP7A 4AAPA 1JKRC 5BNOA 2GBYA 5CVVA 1GQGA 2I2SA 5AC91 3X29B 4AI1A 3POWA 3HOVJ 2XF7A 1PX3A 4Q29A 1WJ5A 3R0AA 4PJJA 1EV12 2EXKA 3BVCA 4K8FA 4BK5A 4BYYA 3I4PA 1BEV2 2HWF1 3DKYA 2JKXA 3WDYA 5LB6A 5HOOA 2BZTA 3C3WA 3L2YA 4EN0A 1A6CA 1Y43B 1H88C 5J3UA 3KCXA 1XE0A 3NQHA 2XJPA 1PK6A 1RUD2 2KRCA 5FYSA 2W3JA 3IZOA 4YFXF 3NVCA 5FY9A 2M1BA 2ZGOA 3LOBA 3NWTA 2O9LA 4L0YB 4PSXA 4PIXA 2YYOA 4BOWA 1VQPI 1K5JA 3J7HA 5DUUA 3K4JA 4XORA 1OKRA 2WN3A 2PAEA 2XUEA 2VI6A 1JODA 1YQ2A 1N25A 1MVEA 2BTVC 1SHWB 4HLXA 4CH7A 2LR8A 4EGYA 3CZUA 3KV9A 5JAXA 1WLDA 4HN0A 2Q8CA 4XAEA 2A61A 2NVYJ 3E0JB 4A3GJ 5FY4A 1JT0A 1AKHA 2WS93 3OYAA 3LSDA 4QB6A 5IK7A 4Z92B 2MEV3 2EBIA 1OOPB 3GO5A 3OF1A 3I2HA 4N43A 3SITA 1YX5A 4HPKA 3ZO0B 4M9ZA 5EFUA 2BRTA 4LE4A 4D6QA 1Z67A 1GP5A 3RQ4A 2K86A 2NN8A 5FIXA 2RQPA 3KP6A 1X1AA 3RZZA 3RSJA 4HMZA 4BQNA 1R23A 4YW4A 4PFPA 1XSXA 1DBNA 4A3ZA 3CUQB 1JKQC 5F6FA 2B46X 3MI8A 2VZVA 3QPLA 2DCKA 4Q2FA 3K4NA 2VTXA 3C2HA 2GH8A 4GQ7A 2Z4FA 1D2QA 4GZ9A 2L7FP 4QM8A 3I71A 2VMEA 4M0HA 4HF0A 1Z21A 5FFOC 4FP2A 1RUC3 1EJ9A 2ZJPF 4AE2A 5D8LB 1LPQA 2OCEA 4RM3A 3B9IA 2L54A 4QU2A 2HTJA 2Z16A 4M71A 5FPBA 2HKOA 2E2HJ 4FPOB 1W8WA 4CO8A 3OMYA 2OX0A 3AP7A 4RR3A 4XBQA 3CD6I 3RMXA 3T2PA 1CPNA 5IP6A 5KAIC 4MGKE 4EATA 4PDWA 4B4PA 2O5RA 2PQSA 2HWVA 4KFCA 2VNRA 4KISA 3FHQA 4D3WA 3JUUA 2XB0X 4M9SA 2IFWA 1Y1VJ 2XASA 2OIIA 3C2GA 5GAGJ 4XRSG 1BJAA 2A3YA 1DQ6A 4F8AA 4LLFA 4AIJA 4KJZA 1RUH3 5CPRB 2A6YA 4PF5A 1E0EA 2CUEA 3OY8A 4B3NA 1G3TA 3RZLA 2PEXA 2LYCA 2JVGA 1YIJI 3C7FA 2ZMLA 1ZG1A 2R7UA 3O1RA 2ZGUA 3LOIA 4I2OA 3IKTA 2WBMA 4KICA 1R1A3 1BI3A 1VIWB 2UYBA 3DTIA 4FO9A 1X8MA 3ZMVA 5EF6A 2QEXI 2UY9A 1GICA 2GIZA 4LKSA 3J9SA 4Q0VA 3KEYA 2HKXA 4NB5A 5C5UA 1WRJA 4LO8A 1FZPB 1SFUA 2L02A 4QWQA 2LKSA 2W84A 1MZBA 2M34A 1NCQB 4MGYE 2D3SA 3VSKA 4CA0A 2NNNA 1UW8A 4IESA 3VBFA 3TEYA 2K9LA 1PVC2 2P6HA 4A2UA 2D6MA 4K2EA 3POBA 1RTVA 2C1FA 3WG2A 3CU7A 1AR92 1OLQA 5GZFA 1G9DA 2RS51 5I0RA 1VALA 2VGDA 4G12A 3TQNA 4XKBA 1W05A 2VZUA 1CAVA 1WCUA 2WAQA 3CDHA 4PIZA 4E7LA 1XU1A 3MW4A 3RGBA 2QM3A 4KMFA 1GNHA 2W91A 4BU2A 5DZFA 2AQEA 1JKPC 2FNPA 2G9ZA 1J7KA 4RGGA 1VQMI 2E60A 1JXSA 1EPZA 1W3XA 3A22A 2WINB 3L9FA 2L0KA 1UYZA 2QZ2A 3H92A 3F3XA 1BXHA 3O8HA 4QPGA 1O4XA 5JXIA 3ABLH 4AIHA 5ABJC 4GULA 4AC0A 1ZNPA 4N90A 4QLCU 2HEVF 5FP8A 3MKZA 3RYKA 2P17A 3KQRA 4NHMA 2JJ7A 1VRH1 5IW0A 2ZGKA 4W50A 2WLPA 4QX5A 3ZDSA 2OJED 2ZPXA 4YVWA 1PM4A 3H8RA 4AYBN 4RHV2 1EAH2 3PSFA 3ZXAC 1XC5A 4GB33 4PCQA 2O03A 1W36D 2IVJA 1W2UA 1U5IA 1XYNA 3WX5A 5GKAC 4ENKA 2CU5A 2RV9A 3LQRA 5FXVA 1RC9A 1PZ7A 5IATA 4G4FA 3A4UA 1P6RA 4EN8B 5FZFA 4CXFA 1VBD3 2ZFUA 5A70A 2RS52 2ZXJA 4FTSA 5L3CA 4J1XA 2WB1A 3FXJA 1IG3A 2O8QA 3CDZB 3UJQA 4HV6A 3WW3A 2DJIA 2BVBA 1IPKA 2HJIA 1WLCA 3INAA 4H0EA 4HV5A 1MQTC 4WV8A 1Q8SA 1MD0A 2GXGA 3BIWE 3OBRA 4M3CB 2Y64A 3AL0B 2BVLA 1XSDA 2IS2A 1E5IA 1PZ9A 3LWFA 2VASA 1Z7S3 1D2SA 1PIV2 5CAZA 2ADUA 2E31A 1MJBA 5LA0A 4QXKA 1RR8C 1BA5A 1C8M1 4LIVA 2OZJA 2XGEA 2IGKA 4XXPA 2VCCA 2D6KA 4LOTA 4PLOA 1Q1HA 3H3UA