3RYPA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rypA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rypA01
3WG9A 4ESJA 2DK8A 2CG4A 4XF1A 1YS7A 5E1XA 1CF7B 3GWZA 3JSOA 1RI7A 2O8XA 3KEQA 1SAXA 1RL3A 2YR2A 2D5HA 2LNBA 1SQ4A 1OYWA 4ZU5A 2DU9A 1O3SA 4MTDA 2ETHA 5KBFA 3KZYA 4QXKA 4M73A 4QX5A 1UB9A 4FAGA 4MV2A 4OMYA 5JAXA 2MH9A 4AIJA 3NL1A 1G3WA 2FBHA 1LJ9A 1ON2A 4HVQA 3MPBA 3SXWA 1BC7C 1LVAA 3LAGA 2L4AA 2VODA 2HTSA 1J3QA 3WGHA 2HZTA 2VQAA 4HF1A 2UY8A 4HDVA 1ZLJA 3H50A 2OYZA 1XSVA 5FCCA 4HX7A 3IC7A 2QLZA 2A69F 2P7VB 2ET1A 4MGRA 3J81K 4L5JA 3NJZA 1EV7A 4IEXA 5AVPA 2VE8A 4FX4A 3HT2A 2B9UA 4PGGA 5K8SA 3KETA 1DUXC 5BPIA 3EETA 1LB2A 2GC2A 1O5UA 4ESBA 2V79A 3LWCA 2EA7A 2ETEA 1XN7A 3JAMZ 1UCXA 2IXHA 2XLGA 5HS8A 4EJTA 1H1IA 2PI0A 2IVMA 3HTSB 2B8MA 4YARA 1YLFA 4A12A 3WW2A 1HQCA 2NNNA 1VP6A 2OD5A 3QU6A 5HS7A 3GYDA 1K78A 5H6RA 4D7TA 1TBXA 1XDUA 3T8RA 3L00A 4XLPF 4L18B 1H9GA 1HBXG 3U9GA 4U0WA 2P4WA 3HT1A 2E1CA 1BI2A 1ZX5A 4K2EA 4XFAA 3DKWA 2KIFA 3F6OA 1W4MA 5AIPA 4N9IA 2UY9A 4OIQF 3MYXA 1QZYA 2CWEA 4YIFA 3I71A 5D5VB 2M30A 1U78A 3TO9A 1JE8A 4YNIA 2QCSB 3RKYA 1WKMA 3FE5A 3FMSA 4G7OF 3HHHA 2IP2A 1PDNC 4XBFA 3TGNA 3JZVA 2ESHA 3WU0A 4D0PA 2PBIA 1T98A 1B1BA 3FMQA 3HRUA 4JTOA 1MDMA 1Y3TA 4Q0VA 4UBGA 1YTYA 1H9TA 4PIZA 2JRTA 3E6DA 2I45A 3RYKA 2PFBA 5BXXA 2E1NA 2A61A 5KK1A 2GXBA 2VE9A 2F2EA 3DEUA 4WX9A 3ETQA 4MEYF 3H92A 4GULA 3JW4A 3D0JA 1SFEA 3LA7A 4OIRF 2EV6A 2FF4A 3E6MA 3WTUC 5JSRA 5CVVA 4IERA 5D4SA 3L2CA 1G3TA 2FA5A 3TO6A 4PCQA 1V70A 3FFQA 2J5PA 3RIRA 4G6DA 3DQVC 2QVSB 2P6TA 3TKYA 5FLHA 3BJAA 3QP6A 4ZU4A 3SHFA 3WTSC 4A5NA 1NHAA 1R22A 5L3BA 3QOPA 5BUVA 5JR7B 2RN7A 4HYEA 2JT1A 4WCGA 1J3PA 2UYAA 3BPXA 1FWZA 4A0YA 4QM8A 2MD5A 3DPLC 2OZUA 4LB6B 4WK8F 3EBRA 1ZYRF 2OA4A 1FOKA 1LQ1A 3FHZA 4YSFA 2DTRA 3R60A 1S8NA 5J8FA 4HDUA 3KP3A 2QENA 3QRFF 1OYYA 1FX7A 3K1PA 4IRIA 4Z2YA 4XFGA 5LEKA 1BC8C 3PVBB 4ENMA 2ZCWA 2DAOA 2EK5A 3RI4A 2ZMEB 2XAQA 3RKWA 4KDPA 2VBXA 2H27A 1HKQA 2DPUA 2PAKA 4WXCA 5DCMB 1CAXA 1ZZ8A 2ZJ2A 2HDCA 3F3XA 5LEJA 4YFNF 3ST7A 3ZMTA 5F64A 2CW0F 2IXKA 4K8FA 5FD5A 1FXZA 3PLQA 1G3SA 4F8AA 3S0MA 5L3EA 3KP2A 4M9XA 1HSTA 5LRRA 2IXJA 4FX0A 4RB3C 1JXSA 2HS5A 4LGWA 2BYVE 1T38A 4Q0PA 4Y13A 5BOXA 4M9SA 2XVCA 3QAHA 2GXGA 2AS5F 1O3TA 2H0VA 2RKHA 4GGGA 1IUYA 5FPXA 4L9VA 1CF7A 4EV0A 3O14A 2A6HF 1WLTA 4M6YA 4AVCA 5I0RA 4M72A 4L9TA 1U8RA 4IJAA 1KA8A 3I64A 4ASNA 1LKNA 1TQ5A 4MZUA 4QGLA 2PHLA 1DGWA 4IPAA 1T0FA 3CO2A 3WW4A 3H3UA 5HDGA 1Z1DA 4OFGA 1FY7A 1P4XA 2RQPA 4IETA 2H09A 4PJYA 2HQRA 4M6XA 2HYFA 2QM3A 2MNGA 5I93A 1YHFA 5HDNA 4HOBA 2E9QA 5HDKA 2V9VA 1P92A 2A3SA 5D8KB 1YW8A 2A07F 4IEOA 3V4GA 5D6FA 3BWGA 3LFKA 2NAZA 3WU1B 4AVBA 2GU9A 1YUDA 1DDNA 2GH2A 2PA7A 5FDBA 4HQMA 3BPZA 1IPJA 1WI9A 4JTNA 2GC3A 2Y0OA 1WGPA 4HVOA 4WZCA 2IPQX 1PUEE 3WGIA 2CFXA 4MQVA 1UFMA 4ONUA 2R3SA 3IKTA 1KYZA 1RC6A 3COAC 2CSOA 1UW8A 1KU2A 2XASA 4RAZA 5LHIA 2CAUA 2QUFA 1UHMA 2OAZA 1NZCA 4NHJA 1J58A 1U2WA 4KT5C 4QGNA 2MLGA 1Q1HA 4Q48A 2OPKA 1DZRA 1QXJA 1UIJA 2XAFA 2NS0A 5JVTA 5C6CA 5DUIA 2VOOA 3O2PE 1TTYA 1RUOA 1MJAA 3NKTA 4XF4A 3HOSA 4A6DA 4P55A 5ILSA 2O3FA 3HRSA 1P6RA 1OI6A 1IZ1A 4O9EA 3NEUA 1XGMA 4HLYA 5E1WA 1FI2A 4KMFA 3G3ZA 3NSTA 1ZREA 4KMUX 4EJWA 2DK5A 4QM9A 4ZU7A 2C0ZA 1ZZ7A 2BE5F 4E70A 1YW9A 5BS6A 3M7GA 5E8IA 2V1XA 2GWRA 3K69A 1CGPA 4LLLA 4J1WA 4IRHA 4HN1A 5FB2A 4KN4X 1I1GA 1DPUA 3JAMK 2P8TA 4KFCA 2VONA 1LDKB 1BI0A 2CYYA 2UXXA 4DINB 1R1TA 5L3DA 2CV6A 1ON1A 3D82A 4MGKE 5FLXZ 3BP8A 3NW4A 2Z99A 3E5XA 3ZMDA 3HIFA 4WXHA 4XF3A 2F5EA 5D8LB 1ZRFA 3M8FA 2ZNYA 3HSFA 5LGTA 4HVRA 2P5VA 3I5UA 5E17F 4KA4A 1HXDA 4ZYEA 2IXLA 3KMHA 1MGTA 5L3CA 1SD4A 2O8QA 2M45A 5JSPA 3ERED 4B29A 1SMTA 2IA0A 5J8CA 3WTVC 2E7XA 3H3ZA 4AIHA 3I4PA 2DW4A 5I0SA 1ONVA 1B59A 1O7LA 5KHJA 4MQ9F 1YFWA 1HKSA 4N0BA 1XCVA 4XFBA 3TDUC 1BJAA 1W7PB 4WF2A 5E1RA 1B9NA 3CL1A 3F8BA 1ZN2A 3NQOA 5IT9Z 5CU1A 4XFIA 1XE8A 2D5FA 3IIAA 3MDPA 3RPQA 1EH8A 3GXOA 4IEVA 1CAVB 1ZNPA 3CUQB 2ZMEA 5DD8A 4KWJA 2EVXA 1QGPA 3WE3A 4ZZDA 1WQ2A 5K5QA 1HW2A 4ENJA 2KJBA 2OQGA 2CAVA 5D5UB 2HEOA 4R8HA 3C7JA 3K9TA 1TQPA 2LDUA 4UVAA 3ACLA 3I0TA 4HF2A 2L54A 4A5MA 4IVNA 1IXCA 2OU2A 4B09A 2PTMA 2PFWA 1W5SA 2YPRA 4HX8A 1VTNC 4ORFA 1Y0UA 1TNSA 2L01A 3CJNA 3MQ0A 2L4MA 3VB2A 4YG2F 4EM1A 5EEHA 5JHUA 2WWYA 3JTHA 4E2GA 2DQRA 5I8YA 4GYGA 1KQ0A 4CHUA 1ZZ9A 4I09A 1LNWA 1R5GA 1T6SA 4KYWA 2FQ3A 1B9MA 2QBYB 3JTGA 2Z3YA 3IBMA 3GFMA 5H6QA 2OZ6A 3R6SA 2GA1A 3VEPA 1O7FA 3MEXA 3H9AA 1EPZA 2PYTA 4A6EA 1OYIA 2IT0A 5FGMA 4OLLA 4XFHA 3F6VA 4LLGF 2OZJA 2YU3A 3SMHA 2HKXA 2B0LA 1FNNA 2WV0A 1RZ4A 4F7ZA 2A68F 4JBAA 3GZ6A 4UHTA 2ZFWA 2L3DA 1TW2A 4E2QA 4MNUA 5L3FA 3PNAA 2XKPA 3LQQA 5I8TA 4FT8A 4LMYA 1FYLA 3FM3A 5DDGA 1DP7P 4WWCA 3DL3A 4D7SA 3N4MA 3LA2A 1VJ2A 2M87A 2OBPA 2P17A 1YG2A 2ESNA 5DUKA 1Y9QA 5ICGA 1OMIA 1DZTA 1D3YA 3S7IA 4IEUA 4M74A 2VXZA 1BIAA 2YSRA 4RGUA 1S7OA 2HKOA 1NE4A 3WODF 3S2WA 3NVCA 2LKPA 4WXDA 4CDGA 4P9GA 5CLSA 4GXOA 1O57A 1U5TB 5CVUA 4I2OA 3FX3A 2B5HA 1A04A 3KP7A 3FXUA 1EY2A 4L9NA 4HMZA 1KGSA 2MBFA 3W6KB 4U0VA 1JHFA 4QLCU 2CGPA 3LQRA 3SHRA 3BALA 3KP5A 3BCWA 2P5LC 3DP7A 2MHFA 2Z9OA 3RJPA 4ENNA 3KEOA 4CZZA 1EH6A 3R4KA 2K0GA 3D0SA 3MZYA 4NQWA 4AQ2A 1QQIA 3LZZA 1CAUB 3GLXA 2UYBA 1R36A 5CYVA 1TLHB 3BB6A 2EJRA 3FZVA 1K6OA 3ZMUA 4A0ZA 5ILVA 4MUVA 1T39A 1P2FA 2ATFA 4IXAA 1ZGAA 4UVBA 2VBYA 2K4JA 3GZ5A 1V3FA 3QU3A 3L09A 2HOEA 4S04A 1J9IA 1XDSA 4AXOA 3DF8A 1FSHA 1I1SA 1BM9A 3TO7A 4YYOA 3PQJA 2XGXA 4U88A 5JR3A 4HLTA 4UBHA 5I91A 1YYVA 1QNTA 3VHRA 2QQBA 2EA4A 1SFXA 2EFWA 4RGRA 4EWDA 2MC3A 2UWMA 5JI6A 1RIOH 2XLFA 3QP5A 2FNPA 3H1YA 1PP7U 4CO8A 3ZN0A 1X3UA 4OIOF 5JCTA 2XAHA 5J7MA 1TQIA 4U7BA 3HUGA 4Z82A 3WTYC 3BZ6A 3ELNA 5CVJA 4HA8A 3L9FA 4EGYA 3I54A 2XAGA 2IRFG 2K4BA 3DFGA 5FLIA 1IN5A 2BEOA 4OMZA 5E20A 5ICEA 3I59B 1W5TA 1QBJA 1HKTA 2HJIA 3RYRA 1IAWA 1RUNA 2PG4A 2WTEA 2PAEA 4AQ6A 1IRFA 1W7PA 4I7HA 1J0RA 3ML6A 1IRGA 3EQLF 3CLOA 2ELHA 2WC2A 3WE2A 1IXRC 1O3RA 1RGSA 2R7DA 4ENKA 2Q8KA 5F1RA 4UVCA 1CAVA 2GIVA 1ODDA 3CUQA 3OV8A 1XMKA 3HSEA 2C6YA 5ICCA 3J81Z 1Q5OA 2Q0OA 4KUMA 1ZZCA 4E2SA 4KIGA 5TJJA 3F22A 2IW5A 4IHSA 3RDIA 2K86A 3UKTA 2RVCA 3RZZA 1XB4A 3U10A 3C3WA 1LRHA 1FBQA 1IN4A 4KIFA 4Y17A 2GC0A 3HHGA 3SZTA 3BU7A 2STWA 4Q0UA 3G73A 4IESA 1FYMA 4HV5A 1KYWA 2BV6A 1MD0A 1R58A 2PQ8A 2WFPA 3VFZA 1R5HA 5FLJA 4KN7X 1XE7A 1UD1A 5I8SA 4B8XA 4RB1A 4MGZE 4ZH4F 4GCVA 2XROA 1O3QA 4PIYA 3KE2A 2ISYA 2XV4S 2PQQA 4TV7A 2V1DA 1UHWA 4JQFA 1BI1A 1XGNA 4RGXA 2BNMA 3OGJA 3GFJA 4MTEA 1QWRA 2D40A 3EQEA 1JGSA 3LSTA 4IHTA 1ZVFA 2QBYA 1J5YA 3GW2A 3W6JB 5LLQA 3ES4A 1SD5A 2XUBA 5H20A 4QMAA 1G3YA 2FRHA 1ZLKA 4G7HF 5BPDA 1F5TA 2V1UA 1IF1A 1X8MA 3KLNA 3VOEA 3WTWC 3H1WA 1F1ZA 4PGHA 4IRGA 4M9ZA 4XSZF 1MZBA 2UXNA 1WSUA 5JSOA 5CADA 4HQEA 2KXLA 5ERIA 3GVAA 5FQ0B 1W7PD 4KICA 3IRRA 2M1BA 3V7CA 2D1HA 2V6CA 3M3IA 1B4AA 3LWFA 4LG0B 2A5YB 5T3NA 5FD6A 5A2QZ 2G7UA 3WGGA 3CJXA 3IDBB 3O3KA 2W85A 4FHTA 4GO1A 2IXCA 4A2UA 3M9AA 4J1XA 2RGVA 1FT9A 4IEPA 1F9NA 4PIXA 3HRTA 3GFIA 4QGMA 1FBUA 2DCTA 4Q29A 5I0UA 3SXYA 4RGSA 1PM7A 2JPCA 3KLOA 3OTFA 3SCFA 2MH2A 1ZARA 3C1DA 2ZKLA 3F8CA 3KP6A 1TNTA 2OQRA 1XRUA 3S7EA 2VECA 4CXFA 2EFPA 4JV4A 4L0ZB 1ZAOA 5FO5A 3GX4X 1Z91A 2VBZA 3SZPA 1D8KA 1C0WA 4H7LA 2XAJA 2JPBA 1KQ9A 4HW0A 1I5ZA 3ABTA 4ETSA 1U5TA 2FMYA 3QPTA 4IF4A 2O61A 1SMYF 2DO7A 4U7DA 5D4RA 1R1UA 1QO0D 1DGRA 3VODA 3HYIA 2ADUA 4M71A 4UXNA 5J6XA 3HTUA 4BNCA 1PMIA 3LOIA 3FXQA 1I27A 5LHHA 3K1MA 4I3PA 1EH7A 1B6AA 4ZYDA 4KU8A 1MJBA 4LULA 4IEYA 3WW1A 5HLGA 3TDZC 1AOYA 4L9JA 1BIBA 1YW7A 4X6RB 3E5QA 4Q47A 2VT3A 1YFHA 1J59A 3KP4A 1E2XA 3H1MA 2GAUA 2GQQA 3H7YA 3U1DA 2HGCA 3DV8A 2Y48A 4L2NA 3KGLA 1P4WA 3UKNA 2P6SA 1FC3A 1MKMA 1YWKA 5CVRA 2D2WA 3RTRA 3GBFA 4I0AA 4EROA 5K1YA 4NB5A 5AONA 3IL2A 4XF9A 4P5OA 4Y15A 3P7NA 2G7HA 1PP8F 3J80Z 1GVJA 2YX4A 2HYGD 2FBKA 2K7LA 1GXPA 3EUHA 3SCHA 2P5KA 2JZYA 3EDPA 4I01A 4I02A 3ZP5A 1XD7A 3ZMSA 3GUDA 2STTA 1X82A 2J5OA 1IN7A 4JK1X 4BAYA 4CYDA 1R00A 1FBSA 3F21A 3R61A 3B02A 4P96A 3OOPA 4QWQA 2O03A 4OU0A 3ECHA 1BBYA 1J75A 4G9YA 4BH9A 4LJZF 4YIIA 1VR3A 2M8EA 1G4DA 4KNYA 1LEBA 1T2KA 2Q4SA 4L11A 2FXAA 3IWFA 1SD6A 3V8KA 3I59A 4MHGA 2FBIA 1RNLA 2BNNA 3F8FA 4O9GA 5DCMA 4XSXF 2HR3A 2KKOA 2VC0A 1UCRA 1CAWB 3U0ZA 4MGIE 3ES1A 5KHKA 1BOAA 1USTA 2NYXA 4G94A 4XRFA 2K9ZA 4BXUA 5I0TA 4IEZA 2EAAA 4HSLA 2W24A 3H7JA 4UNOA 5DD4A 1U3EM 2FU4A 3Q9SA 3T5XA 4L5IA 5KVRA 2Q1ZB 1Z6TA 1WWXA 1KU7A 1IXSB 3DPTA 3ELKA 5BV6A 1OR7A 1STZA 3BOQA 3CLPA 1QPMA 4P9UA 3LAJA 1USSA 1P4AA 1XGSA 3D5LA 4UUVA 3Q9VA 1XCBA 1XSXA 5K5OA 3LA3A 4O6JA 4IEQA 1UIKA 4G8XA 3U2RA 5J48A 1TQMA 4LB5A 5HI0A 4R79A 3KCCA 2D1VA 3KFWX 3OF1A 3CUQC 3MCZA 2PHDA 2IA2A 5EEGA 2Z69A 4KWKA 2H6BA 3T8TA 2N7GA 2K27A 3Q5FA 3NRVA 4UV9A 1K7AA 4UV8A 4G7ZF 4OOIA 4META 3CO6C 2PJPA 3SCGA 2R7FA 2ISZA 2QWWA 1JUHA 2VC1A 4HLXA 2QYOA 3QACA 2Y75A 3ABUA 4N9HA 1SD7A 2D93A 2FOKA 3CDHA 1GXQA 5E16A 4BQAA 1I6XA 3N97A 2ACJA 1FLIA 3C3VA 2Q0AA 3REOA 2JSCA 2Z33A 4OIPF 3GF2A 1YFXA 5FQ0A 2KJCA 3F8MA 2DLLA 3BPVA 2MA3A 1FYKA 1X8EA 4LG0A 4LA3A 2KIMA 3F8NA 3G7DA 2EFNA 1IPKA 2F5CA 4KL1A 1X7NA 3E3VA 2YX7A 4LD5A 3CF6E 2K02A 5ILUA 3L2HA 1V4RA 1NXMA 2EWNA 3K0LA 3T0YA 5F6FA 2BNOA 3HQXA 4I0BA 2DFIA 4AVPA 5TRDA 2UZKA 1CX4A 5K5RA 2W57A 3SFZA 1S29A 2FMLA 4H0EA 4EWEA 4RB2C 3M70A 5FPZA 4G6QA 2XIGA 2XKOA 5KHHA 4LTAA 4ZZLA 2W25A 1SEFA 1OPCA 3ZMZA 4U0YA 5EFUA 4OINF 1Q3EA 4RD7A 3F23A 5D5WB 3WTXC 2COMA 3E97A 4DNCA 3FHIB 4BHBA 2HFHA 3P9IA 2XHKA 3F72A 5A2QK 3CEWA 5LGNA 3M8EA 2ZNZA 1UPIA 5BY5A 2O0YA 4Q5SF 4Z07A 1IN8A 2ZBKA 3V8LA 1WRJA 1R23A 1TW3A 3TOAA 3U11A 1EP0A 5E18F 1FP1D 2DI3A 2PN6A 3CTAA 1S7AA 2QQ9A 4CICA 4AD9A 4XF0A 3ECOA 4KU7A 4HV6A 3CO7C 2Q2EA 4KWLA 1ZZ6A 4UXAA 1U5TC 2IA1A 1U12A 1F4KA 2FE3A 1L3JA 1LDJA 2QNKA 4HF0A 2Y0MA 1E17A 2FQPA 5FFXA 4EMSA 2PMHA 3BROA 3P9KA 2QVOA 4YRDA 4WBBA 4AIKA 3K2ZA 2Z2SB 1BI3A 3ROUA 3GO5A 2BGCA 1ZRCA 3IRQA 4EM2A 2H94A 4HBNA 1ZG5A 2KRFA 4FAHA 2GA2A 3MZHA 3ULQB 1KU3A 1HSJA 5FLXK 3RKXA 4EWAA 1BN5A 2EFOA 2PEXA 4BHCA 1SFNA 4HSJA 4Q0SA 5DV5A 1D8JA 3KSCA 3ZPLA 2P7CB 2X0LA 4A0XA 5EZWA 3FXRA 3EO6A 4IEWA 3WW3A 4HBLA 5CVIA 2VPVA 1FP2A 1HW1A 2RC4A 4LFUA 1O5LA 3LAPA 1ZG3A 4AWXB 2H6CA 5FFZA 5LBQA 4LUMA 2NRAC 3FZ3A 5D6EA 4MH0E 3OCPA 4EM0B 3FWEA 1D5VA 1YIOA 2LF8A 4L0YB 3J80K 3FJSA 4GYIA 1Q43A 2ZXJA 1WA4A 2RDPA 4YFKF 2KIUA 3BY6A 2PAMA 5DEQA 1CAWA 4FBFA 3H8UA 1U6GA 1ZRDA 2GZWA 3IHUA 1YS6A 1YFYA 2NNYA 3I58A 3KGZA 1ZHFA 5HLIA 4LLNA 4R52A 4ON0A 3TOBA 2VOPA 4BIFA 2VBWA 3IWZA 4RAYA 4TLFA 5L3GA 1QXRA 2XL9A 1XMAA 5IT9K 1ZG1A 5CJ9A 5DCFA 1IN6A 5D5XB 4XFFA 3AAFA 1XSDA 4Q4ZF 2FSWA 5HS9A 4YFXF 1IW7F 3E6BA 2LF7A 6PAXA 4LUKA 1GQGA 5E1ZB 4EGZA 5KHIA 2L02A 1KQ8A 3V7SA 1YO5C 5E8GA 2F5DA 5BPXA 3RYPA 4XLNF 1NYWA 2CQKA 4ZYHA 3MWMA 3P9CA 1L3LA 1AWCA 3ZQ7A 3E6CC 3DN7A 1EYBA 3BJOA 1J2XA 4ZYGA 2FEZA 2BBYA 5AIQA 1NE6A 2GC1A 2AXLA 3B73A 3J7AO 5BQTA 1JHHA 5KHGA 4LLOA 2QQAA 3EJKA 2EV5A 1K78B 4LK0F 1O4TA 2MLKA 4XETA 3GYHX 3MAJA 1R1VA 4MEXF 5HVQC 4KIBA 3FF5A 3L7WA 1HW5A 4XEZA 4BYYA 2DQLA 1J7KA 3EYYA 3RPUA 5C8WA 3DXJF 2QDRA 2ZO4A 3ZDSA 3BDDA 5HLHA 1KU9A 1GQHA 2QZ8A 1ZH5A 2HTJA 3EHKA 2V09A 1LDDA 3R0AA 1OKRA 3OD0A 2Q30A 1GHCA 3M1EA 1OFNA 1ZGJA 4HN0A 4BHPA 2DT5A 4WVZA 4NVPA 3C18A 2IJLA 1MDMB 2TDXA 1SFUA 5ICFA 2F4PA 2E7WA 2XRNA 1QZZA 2EFQA 3CUOA 3EYIA 1H0MA 3WTZA 1OD5A 4O3MA 3PFIA 1L0OC 4EJUA 1Z6RA 2PLYA 2MPFA 3E5UA 1DPRA 2A6EF 1H1MA 2VN2A 2PMUA 4JVAA 1LR5A 2HQNA 1CAUA 2M5WA 3BJ6A 4P9FA 3HRMA 1ZZBA 4AVAA 1J1LA 4ESFA 1S6LA 1FPQA 2HWVA 4PZJA 1ULYA 2Z5UA 3PQKA 4XFCA 1REPC 3FMRA 4HZFA 5LGUA 5HOOA 4PDKA 4LA2A 3RNSA 4EVIA 2EV0A 3FM5A 4HAMA 3ISPA 4R1HA 4X6QB 4DQ2A 4S05A 1J3RA 2QJVA 4HX4A 2LSOA 2EB7A 5D1IA 4EQQA 1R7JA 1S3JA 3KZZA 2IXIA 3IDCB 2JTVA 2XLAA 5LHGA 4LEJA 5ED4A 2G9WA 3MFKA 5DYMA 3I53A 3QPHA 4CGZA 5IT3A 1Z7UA 3ZMVA 4MGYE 2DBBA 1Z05A 3TQNA 2VT2A 1RTVA 3UKVA 1K79A 3WTTC 1YQAA 3GFLA 3SQNA 3TNQA 1G6NA 3I7DA 2IC1A 3TNPB 2X4HA 3IKVA 2O6GE 2W84A 2XL7A 4RB0A 3K1NA 1CAXB 1LEAA 2OA2A 5BMZA 3JSPA 1YFUA 3HSRA 5J3UA 1QY4A 4O5VA 1XGOA 2CO5A 2EA2A 2ZKZA 4RS8A 4Q0QA 2F5FA 3O6BB 4LK1F 3T1BA 2FNAA 3V7RA 5JFRA 1Z9CA 1ZRRA 4MX3A 4EJOA 5LRSA 3R0JA 2D45A 1YLLA 2RV8A 4I98B 1FZPB 2ET7A 2RNJA 3USSA 3HOTA 2O1QA 1MJ9A 3ZN1A 1FSEA 3GEZA 3V8JA 4EJVA 2DPDA
chains in the Genus database with same CATH superfamily
3WG9A 1LHVA 2DK8A 2E26A 3HPNA 2CG4A 4BDZA 3ZFGB 1VBA1 1YS7A 3I2OA 1CF7B 2O8XA 3KEQA 5APAA 1SQ4A 2WB1N 2DU9A 3N9LA 1VBD2 2ETHA 2QE3A 2DMUA 3GXUA 1AU7A 1WH7A 3A4CA 2K2SA 1NKGA 4M73A 5DABA 4AOCA 5JAXA 3J8F3 4XLCA 1YX5A 4E4ZA 2F6CA 2VQHA 1LJ9A 1ON2A 5FZ0A 2O8KA 4XVHA 3MPBA 4KITB 1MBFA 1LAJA 2G4IA 3WGHA 2CDOA 4IXLA 1F8VA 5FYVA 4HDVA 3BKZA 3H50A 1D0HA 1F31A 1XSVA 5KHDA 3N05A 2A69F 3JD72 4MGRA 2AQFA 1Q8OA 2W1UA 5AVPA 2HPIA 4FX4A 3S3NA 2COBA 4G9SB 3I3QA 3HT2A 5K8SA 2CGOA 2ZEWA 5C4XJ 4DS0A 1LB2A 4WM7C 3JD71 1O5UA 4AEDA 1PVXA 2XGEA 4MO3M 2HLEA 4Q4W3 2V79A 3LWCA 4BOWA 2NQYA 3JAMZ 2XLGA 5BNOB 5A3UA 1H1IA 2IVMA 1JGGA 4BQXA 4BLJA 2O5RA 1V6LA 1UG0A 3RCOA 3QU6A 1K45A 4EZHA 5M5WJ 5FMOL 4L18B 5LA1A 4RA2A 4U0WA 2JA5J 1N1SA 2CU5A 3SISA 3ABKH 4YZ5A 2BY0A 2E1CA 1BI2A 1TNRA 1VAMA 4XFAA 4IEJA 3A02A 2KIFA 4XJUA 1R64A 1OLRA 5CFDA 2UY9A 4OIQF 3MYXA 2CWEA 4RAGA 3I71A 5JZGA 1WKMA 1W2OA 3V56A 1Q56A 4XBFA 2NMOA 2HWF2 3Q0UA 3TGNA 2PBIA 2NS8A 5DMYA 1RHI3 2R7OA 3AMPA 1YTYA 5A7PA 4MHRA 2E1MB 2ZGKA 4HETA 3E6DA 4JX4A 1A6CA 5LBEA 2HWF1 2A61A 5LFAA 3HJEA 3CP2A 2VUJA 4W97A 3H92A 5FMDA 4E7ZA 3JW4A 3D0JA 2JJ6A 4OIRF 1JTYA 2EV6A 2WA3A 3M3OA 1IV8A 2FF4A 3WTUC 4DNYA 2Y38A 4IERA 2NN8A 1AZDA 1NLQA 5D4SA 3HBKA 5FKNA 3A7QA 4II2A 4PCQA 1IG7A 3BTIA 4Q4Y2 1A5JA 2ZA9A 2QQ8A 1YE9A 2IBDA 2QZ3A 3VBUC 3SYTA 2IS1A 2QVSB 2LLKA 5D8AB 3FBMA 4ZU4A 3SHFA 2VB6A 3KZIC 4R4ZA 4A5NA 1NHAA 4E9KA 4Q4Y1 2JT1A 4WCGA 4HKWA 1MVQA 2XG3A 5J4YA 2MD5A 3DPLC 5A7SA 2DDUA 4YSFA 3R60A 2HEYF 4HDUA 1OOPB 1SVLA 3NAUA 3WLUA 1ITYA 3Q8AA 4XICA 3ZKYA 1CJDA 1FX7A 2DFBA 4Z2YA 4GB32 5KXCA 5LEKA 4NR1A 3HZJA 3PVBB 1LENA 4O61A 3JRGA 2RS12 5AFEA 3RI4A 3WR0A 3B6AA 2XAQA 3OS2A 1XYOA 4X8NA 4GB31 2H27A 3HR9A 3CZUA 2YPDA 2HDCA 9ANTA 2RS11 3WINE 4YFNF 4AEMA 2CW0F 2IXKA 3QBQA 2Y33A 5IWFA 3DKYA 3THPA 1Q8QA 2ADEA 1EV13 4F8AA 5L3EA 3UJQA 1NA1A 2KRCA 5J37A 2DT7B 2IXJA 4RB3C 1JXSA 1AL23 2HS5A 3OYKA 4LHKA 2DXIA 3KF5A 3OEAA 3LOCA 3WDVA 5BOXA 5JMOA 1QRYA 1KONA 3HBZA 5GM0A 1VQ7I 2RM23 3ASNH 4YW1A 1RUC3 3ZFGA 5FPXA 2FQ4A 1CF7A 5EYYA 1KDKA 3O14A 3GALA 1WH5A 1AXKA 2WWUA 1WLTA 2J1VA 4B4CA 4M72A 4FFHA 2Z79A 2FD5A 2YHJA 1LGBA 3K46A 4C1XA 1XSQA 3FLRA 4X1EA 2JG9B 4Q26A 4MZUA 4DUVA 2PHLA 3MIDA 1VQ5I 2CV2A 2OF7A 1T0FA 3CO2A 5HDGA 2HVSA 4OFGA 2YV8A 3T08A 1UMIA 4K6BA 4IETA 1FMD3 2E5ZA 2HYFA 2W00A 4FVVA 2QM3A 3AP5A 3KYCB 1GQPA 3TAYA 1HDDC 2JENA 2Y0SN 5HDKA 2V9VA 2A07F 3KIOA 4IV3C 3LFKA 4AVBA 1VB2A 2F4LA 3TBIA 4DXSA 1AX1A 4JTNA 1DYPA 3OYLA 1WGPA 3HQRA 2WB1A 4WZCA 1X50A 2LBFB 3WGIA 4M4PA 3HC7A 3VYTB 1VFCA 4ONUA 1KYZA 1UW8A 2FDJA 4RAZA 3K4CA 2WSVA 4GRIA 1CQ9A 4XK4A 2R0HA 1POV0 1HDKA 1EPWA 1MS3A 4D3WA 1MBHA 1LHNA 5BNOA 3J7HA 5JXHA 3PL0A 5KC6A 3G1MA 1UY4A 2XAFA 4OHZA 2LW8A 2NS0A 4Y5SA 3HKZN 5C6CA 5HV4A 2VOVA 3IDAA 3I56I 2R5YA 2HWD3 1H8AC 3DPRC 2AHQA 3CF5F 1RUOA 2R1DA 4XMYA 3HOSA 1AR63 4A6DA 1O4YA 4P55A 5ILSA 4IZZA 2Y34A 2ID4A 2DDBA 2YC4A 1XYNA 1XGMA 2JRMA 5GZCA 4B4PA 4OULA 2DYSH 4HLYA 3IV5A 1FI2A 4KMUX 2Y31A 1NQDA 4FPYA 1F5JA 2TRTA 1H30A 4A3EJ 4X8PA 4HG2A 4E70A 3M7GA 5E8IA 3SLIA 4CEWB 1YQ8A 4HN1A 1G86A 3ZQQA 3OJBA 5FB2A 3ITQA 2P8TA 4NHYA 4A3LJ 2TBVA 4H55A 3H8XA 1TMF3 5F32A 4FTHA 1R1TA 4IE6A 2EALA 3DEEA 2WNUB 1E3HA 3QOEA 5DZFA 3DCQA 2XSDC 4FPLA 3GM8A 2Y9ZA 4WXHA 4DEQA 1POV3 3UL2A 2F5EA 3ZN6A 3KHCA 4C0HA 1ZRFA 3M8FA 3HSFA 3P5BA 2OTLI 3S5AA 5E17F 1VBE2 1HXDA 4PF5A 4IOAF 4RHV2 1MGTA 1OQDA 5A3LA 3NNMA 3TOJA 1J83A 2XGDA 2O8QA 4HXCA 3OUHA 2P3JA 3HUGB 5D8AA 4B29A 4G3YC 1SMTA 5J8CA 1VBE1 4RHV1 2H1LA 3SH4A 5JOZA 2G9FA 5I0SA 1ONVA 3HMYA 3BG6A 1X1DA 5GZEA 5FTTC 1ENXA 4D1QA 4N0BA 1QJX2 2VIXA 3PTRB 1OOPA 1BJAA 2KR2A 5EJ1B 4JDMA 1B9NA 1EUUA 5E6HA 1W8FA 5FK7A 3U1XA 1V55H 1EH8A 4IEVA 1DP3A 2AXTC 1QJX1 1ZNPA 4LQRA 1W9YA 4PF1A 2Y6HA 4QAWA 5IAXA 4M3FA 2XQRA 4RS5B 2MGQA 4DFSA 3MBWA 3A0HC 1QGPA 3WE3A 4JP0A 5FYYA 4ENJA 2KJBA 2W2IA 5D5UB 3SNMA 5GZGA 4R8HA 3C7JA 2A5ZA 3K9TA 1TQPA 4HPKB 1KS5A 1OPOA 4RQPA 1RB8G 4IVNA 1IXCA 4B09A 2E71A 4ASKA 2XMLA 4HX8A 3CP8A 3CJNA 5B3SH 2ZMKA 1V6MA 5A70A 3VB2A 4ZONA 1HOMA 1Z7LA 2WWYA 2DQRA 1MS8A 3ZFFB 4CHUA 2RG4A 1JW6A 1ZZ9A 4I09A 2HWB3 1LNWA 1UELB 3JBG3 3VBOB 2WWJA 1WZ2A 1UOFA 2FDGA 1XC5A 1GLHA 1PIV2 5FLMJ 1S0FA 3IBMA 3GFMA 3H9AA 2XGCA 3I3BA 4LO7A 2PYTA 1HXS3 2OUJA 3NV3A 5A3WA 4M6VA 5FGMA 4OLLA 4XFHA 2AACA 3F6VA 2R063 1SDWA 3SMHA 3PSFA 3L2WA 1R1A2 2WV0A 3GMEA 5EZGA 2WQZC 4F7ZA 3SH5A 4UHTA 2L3DA 2DA6A 2VQGA 3J7ZI 1MZEA 5IUQA 3LQQA 3POJA 1UF2C 1YOVB 4LMYA 3DL3A 1S4CA 3RQ0A 1R1A1 5L9RA 1A6IA 1ETXA 3T30A 2M87A 1ULOA 1YNAA 5DAWA 2LBFA 1LCLA 4LKSA 2BBVA 4IEUA 4M74A 2PHFA 2QTWB 4BJ5C 1NE4A 2WDBA 3CJIC 2XQXA 3VBRB 1A35A 3S2WA 3NVCA 2LKPA 4CDGA 1GDTA 4P9GA 5CLSA 4XZPA 4HFSA 2Y6JA 1XC6A 4QHOA 2E51A 1XB9A 3HEFA 2ZSHB 3KP7A 3FXUA 1EY2A 4LE3A 1YQ2A 1UYPA 4Q2FA 4CE8A 4HMZA 1KGSA 1MMAA 2OQ6A 3L2UA 4KMQA 5L9BA 3DP7A 3RJPA 3DWLE 4ENNA 1CPMA 4FTBA 1EH6A 3FXOA 5C3PA 2K0GA 4XTPA 2G19A 2ZXHA 3LL7A 3V42A 3GLXA 1MS9A 1NTCA 3VKFC 3A0NA 5CYVA 1TLHB 4DZPA 4CEWA 3PUIA 3CZ6A 3ZMUA 2RS53 4D8MA 1VQOI 3AXDA 4NHMA 4W65A 3ILFA 2OQ7A 2VKEA 1ZGAA 4UVBA 2LKSA 3GZ5A 1V3FA 4XLHA 2IEKA 3L09A 3UGGA 5B2GB 4HG6B 2WNUA 4HNTA 1XDSA 1D5YA 4JKLA 4HL0A 1YEWA 1BM9A 3TO7A 4U88A 3I9V2 1W3XA 3HB9A 4MIMA 1GZWB 5GLUA 4YVWB 1JUSA 5FY8A 3VHRA 3W2AA 1SFXA 2EFWA 5DS9A 5J47A 5EEAA 3AK0A 5F6KA 2BVVA 1N1TA 2FNPA 4HNUA 3H1YA 2ZX2A 1UU5A 5DUVA 2XAHA 3HUGA 3WTYC 3OYWB 4P1WA 3ELNA 3FMGA 4FXKB 3KM5A 5CVJA 1DCSA 1F2NA 4HA8A 3W5MA 4EGYA 2IRFG 3DFGA 5FLIA 2DFHA 1SLTA 2ZZJA 1F35A 1MH3A 4OMZA 1X3WB 3SDGA 3JRFA 2P3YA 3PM1A 3AG2H 1RINA 4NRMA 3S14J 2VCMA 1HKTA 1RUNA 2PG4A 2OX0A 5F27A 1W8NA 4AQ6A 2ADDA 4XABA 3CLOA 3MEPA 1O3RA 2CQNA 4RDUA 2HU9A 1MS4A 3NARA 2WS92 1W0PA 4N8MA 1ODDA 2H8RA 3BQYA 1W9FA 2G1MA 1ZZCA 1AR92 4ITVA 3F22A 1JKQC 4RS5A 2VCBA 1QNWA 2RVCA 3RZZA 1JYXA 3C3WA 2VMHA 2JDPA 2WS91 1LEDA 1LRHA 1FBQA 2WFF3 3ZSLA 4HPKA 2V4AA 2FZ2A 2K3FA 3B9CA 4Q0UA 1JUIA 1K42A 3OBZA 1G9AA 1NLRA 1R58A 3BR6A 1R5HA 5FLJA 1DLLA 3H0OA 1GANA 4IUGA 5I8SA 3E1F1 3K2AA 4EE2A 1GT0C 2L7MP 2EXJA 2WZ8A 3ZFFA 2JXAA 3OGJA 1I39A 4Y4RA 2D40A 4E7LA 3VBOA 5A80A 3KD4A 1K61A 3GW2A 3PUBA 3TW6A 1SD5A 1BK0A 2XUBA 4UAPA 4QMAA 1G3YA 1OISA 2X6YA 4RYDA 1ORKA 1ZLKA 1Z67A 4Q1PA 3OR2C 2V1UA 1X8MA 4XUNA 4Y4YA 5DM6F 3H1WA 4M9ZA 4JGYC 1QVUA 1D1BA 2KXLA 5FQ0B 4MVTA 4F3QA 3VBFC 3ZSMA 5FJ8J 1TWHJ 1DQ1A 5T3NA 2A5YB 2JDYA 1UOBA 5CKTA 3O3KA 3O8HA 1TEIA 1N47A 3LOBA 3USUB 1FT9A 4M4RA 4PIXA 3HRTA 1GICA 5L7OB 1PM4A 2LY1A 3GFIA 3MF9A 5IHRA 2DCTA 3A22A 3OTFA 3LDKA 2ZMNA 3GLLA 4XDQA 1BYHA 3F8CA 3KP6A 1TNTA 5LB6A 1XRUA 2HOTA 3VBRA 4D94A 4CXFA 3P5JA 4L0ZB 5CZKA 5FO5A 3GX4X 2VBZA 3CCUI 4BY1J 2PHXA 2XAJA 2FMYA 3N36A 4IF4A 3T1LA 2DO7A 2FDHA 4U7DA 1JKRC 3ATGA 1ULPA 2JUCA 1B72B 4R9CA 1DGRA 2BVLA 5IK4A 2ADUA 1G9FA 2HI3A 4M71A 4BNCA 1LOFC 1I27A 5LHHA 2QQWA 1QVTA 2JN6A 1YCIA 4RFT0 4KU8A 1ND2B 2CV0A 3GTLJ 3POSA 3KV4A 4OHVA 3DKXA 4F55A 1BIBA 2DURA 1IRZA 1TZOA 1J59A 1ZGWA 3I4NJ 3H1MA 2Q2EB 2HGCA 4OAYA 2I2SA 2FMDA 4QB2A 2P6SA 1MKMA 2W1SA 1YWKA 1QOTA 1JTZX 3GCWA 2JDHA 3NAPB 2A3YA 2DFCA 3U21A 1AKHB 4NB5A 5AONA 4UF0B 4Y15A 3W9AA 2D98A 1PP8F 3J80Z 1V9U3 2GH8A 3PUAA 3T2TA 2YX4A 3T0DA 3SFIA 2QUOA 3Q0VA 1GZWA 3EDPA 4I02A 4UYBA 4HSRA 3ZMSA 4ABZA 3GUDA 3VZLA 1WKYA 1JYTA 1IN7A 1HJFA 2LM3A 1LHWA 4ZS3A 1UZCA 1POQA 3B02A 5GZDA 2BP6A 4QWQA 4AGVA 3I4IA 3UJOA 3MICA 1BBYA 3LEMA 3OYWA 4B1MA 1RR8C 1VR3A 2L9VA 5JPMB 4BQNA 2EIDA 1J84A 2PX9A 5CB7A 2FBIA 1RNLA 3OOXA 4AU7A 4Z2AA 3J7YJ 2CSGA 5FZFA 3VGIA 2HR3A 5JPNB 4J25A 1JKPC 3GBGA 2WNEA 4MGIE 3EXUA 1JI6A 4AEJA 1PZ7A 3CJTB 4WM7B 2NYXA 3WNXA 4H14A 2IGKA 4XRFA 2K9ZA 5EWSA 3MUY1 4F93B 2VUCA 1K6YA 2ZAAA 1MZ6A 1BL0A 2NLRA 1S7EA 4CCDA 2W24A 3BOPA 3MFAA 3SJMA 1FTZA 3GF6A 3AMMA 2Q1ZB 1Z6TA 5GLTA 1IXSB 3B9IA 2ZXIA 1B35C 3PO2J 1WW6A 3BOQA 5F3EA 3LAJA 1XGSA 3TEDA 1PNGA 3QODA 4IDZA 2VXDA 4L5EA 1D0XA 3M07A 2E31A 2ZKNA 2BPA2 4MXVA 2R7XA 5HI0A 2B46X 5HODA 1CR7A 1YITI 1SFPA 2P5BA 4QPIC 2IA2A 3CCVI 1FNYA 3V65A 3AKSA 4OI4A 2VW2A 4XPVA 5HNHA 4G7ZF 4OOIA 4UFHA 2SBAA 3CO6C 2PJPA 3SCGA 2R7FA 1YI9A 2X85A 2QYOA 1VB4A 4N9HA 1H8TC 3DU6A 1SD7A 2D93A 3NNJA 3CDHA 3HDDA 1GXQA 5E16A 2LREA 3KVAA 3GNEA 1T56A 2ECBA 3DU5A 3JRDA 4BB3A 5LA2A 1LHOA 2Z33A 4NHXA 4PFPA 1U5ZA 5FQ0A 4PJMA 4NWWA 3F8MA 3O5SA 2DLLA 4MSVA 3U37A 3G7DA 3AYCA 3I2IA 2EFNA 1K5MC 4OCTA 2RNGA 3VBUB 3USUA 2YX7A 2O8OA 4LD5A 2PLV3 3CF6E 4EQVA 3L2HA 2EWNA 4UFKA 3T0YA 5L7OA 3O0VA 1SBDA 4I0BA 1OCRH 2DFIA 2OCCH 1JYNA 2BXZA 4MGTA 3SFZA 3LSGA 4EWEA 4XIOA 4RB2C 2XR4A 3M70A 1OVSA 4XCAA 2W25A 2L7ZA 4XIKA 4QX0A 3U75A 4NBQA 4RD7A 5K4LA 4DNCA 2BFUL 1B72A 3FHIB 1W5CC 3BCBA 1GNZA 2W47A 4YW3A 3EUAA 4H2AA 3M8EA 2ZNZA 2BOLA 1WMDA 3A23A 3ZYPA 5F7UA 2V72A 2VW1A 2C9KA 2V1NA 1MBKA 1R23A 1ND2A 3V0BB 4P9JA 1IKPA 4PI2A 3ECQA 4XUPA 5T54A 3CCLI 5DQ0A 2QKDA 3U11A 4IE4A 3BUCA 1ZELA 5E18F 1DYKA 5GLWA 4B3AA 2UU8A 2DI3A 3KVBA 4NPRA 3CTAA 5F2WA 1R093 3BTLA 1REFA 4KU7A 3F2ZA 2Q2EA 3FFZA 2ELKA 1U5TC 4DY3A 4PLNA 1RXGA 2DCZA 1MMDA 1QPIA 5C7GA 1AKHA 4UF0A 5A6QA 5C33A 4QQLA 4WBBA 5A7WB 2EICA 5DG1A 3RSJA 5C5TA 3ROUA 2BGCA 3IRQA 3O1PA 1XE0A 5FJKA 3MZHA 1Z7S1 3K75B 3RKXA 1BN5A 1PZ9A 2WQ4A 3QH6A 2XJPA 1SFNA 4FO9A 4XTMA 5IVJA 3KSCA 1X4PA 2XPJA 2YMZA 3FXRA 4IV3B 3P3PA 3LE0A 2RC4A 4LFUA 4QU1A 3LAPA 3ERMA 3R05A 5LBQA 4LUMA 3EUHC 4EM0B 3FWEA 4L0YB 2M2EA 4EEFG 1V54H 2ZXJA 3T3YA 2RDPA 4YFKF 3AYDA 2CUZA 1OQ1A 1ETKA 1G9CA 3UKGA 3BY6A 2PAMA 3CZJA 5DEQA 3S93A 4FBFA 3H8UA 1S0JA 4ZPIA 3VKOA 1YFYA 4WM7A 4B3NA 5IVEA 3I58A 2H8WA 4AGRA 1OCZH 4XKVA 3ZVXA 1BR1A 4ON0A 1ZQ3P 3ZX7A 1U8BA 1COV2 3AL0C 3OYEA 3DTIA 5M0TA 4RAYA 4TLFA 5L3GA 1RUG3 4BDVB 5FPBA 4JKKA 3I8TA 4AI0A 5F5QA 4BBSJ 2H0BA 3DPRB 2W52A 2FSWA 4YFXF 1IW7F 3E6BA 1COV1 4K40A 2VOWA 2LF7A 1DQUA 5HCAA 4YG3A 1WLCA 4GWMA 5E1ZB 2GDFA 2NXNB 4A3XA 3C7GA 1YO5C 2RDNA 1FATA 1VBB2 2VBDA 4Y5TA 3VWBA 4ZZ5A 5GADJ 3NMBA 4IW3A 2HDDA 5KXBA 4ZYHA 3P9CA 4K20A 4YGDA 2YBPA 4YW7A 1SMVA 1A8DA 5T55A 3ZQLA 2DBIA 4XAEA 1JZ3A 4TYSA 3ILRA 3BJOA 3ZSEA 3F9KA 3J7AO 1QQP2 5BQTA 1E5HA 1QJFA 2P37A 4HOOA 2IS2A 2YU1A 2A5WA 1BVVA 4XR6A 1EAH3 1O4TA 4P5HA 4XLFA 3POWA 3WDUA 1AYN3 1R1VA 4MEXF 5HVQC 4IHXA 3L7WA 1HW5A 4BYYA 4IE7A 1KFXL 3VKLA 1HRI2 5EP9A 3RPUA 3DXJF 1C8M3 2ZAHA 2R4GA 5F04A 4BJ0A 3MGUA 1GQHA 4RR3C 3L2QA 1JYCA 3NNLA 1WMEA 2Q8CA 4JX6A 1HRI1 4NIAA 1QH6A 1APNA 1GHCA 2W95A 3DBHB 5FY0A 3PIJA 4WVZA 3VYSB 3VBUA 1BR4A 1TE1B 2IJLA 1VBC2 5GKAC 4XHXA 2R7TA 2F4PA 3JRHA 1W2AX 3MKLA 1H0MA 1I9RA 1OD5A 1L0OC 2CHHA 2Y60A 1OD3A 4EJRA 1IQDC 1I50J 1YRZA 3KQRA 1DPRA 1H1MA 4BEHB 2DCJA 1YQ6A 1LR5A 1UZZA 4GMP0 1DZQA 4A3GJ 3BJ6A 2XBO3 1VALA 4AVAA 3ZYIB 2VCCA 2DOFA 1ULYA 1KJLA 4AAPA 4XFCA 5C70A 1WD3A 4HZFA 5HOOA 4PDKA 1XNBA 1ZBE2 3ISPA 3MKZA 4DQ2A 3V0BA 2XJQA 4FPGA 2QJVA 2EB7A 2ORZA 5D1IA 5FP3A 5IATA 4NUBA 4NHLA 1F5FA 1ZBE1 2IXIA 2JTVA 1YYNA 2FOWA 4Q4X3 3K7AJ 4B1RA 4B7EA 4LEJA 3A0BC 1RUD2 1X3ZB 1N3QA 1CQTA 4CGZA 4BIOA 2VKDA 4MGYE 2M3AA 4OQ9A 1Z05A 1RTVA 1LULA 1D0YA 2KA3A 5FZGA 1G6NA 4BACA 1BVP1 4Q5OA 1LVKA 2IC1A 5A7WA 1KDMA 4QU2A 2A6TA 2W84A 4LHLA 2R073 5FY7A 4OMCA 3HSRA 5J3UA 2CO5A 3NWKA 2EA2A 2RVAA 5FUPA 2ZKZA 2DMPA 4RS8A 4GMP3 3I2DA 4KG0A 3V7RA 3JRBA 5H9RA 1JN2P 2BWAA 2CQXA 3OBTA 5EIYB 3I55I 2RV8A 4X0GA 2ZJPF 2P4EA 2DU1A 2F5VA 2RNJA 1FZPB 5A3NA 4FE7A 3ACFA 1E5RA 5J98B 4XN0A 2O1QA 3ZN1A 4IV3A 3VBSC 4CUGA 4UFIA 4F83A 5E1XA 3MW2A 3GWZA 3JSOA 2BGOA 2GNBA 3BIEA 1SAXA 2D5HA 2LNBA 4ZU5A 4E7KA 1KS4A 3LIHA 1AYM3 3WU2C 1I5PA 4P9WA 3L1PA 1WJFA 1UB9A 2GMPA 4OMYA 2MH9A 2FBHA 4Q4W2 1RR7A 1JUPA 4HVQA 4KBBA 3SXWA 1Z78A 1LVAA 4C1WA 1HV1A 3LAGA 1J3QA 4LORA 4BL0B 2R7EB 4Q4W1 4HF1A 2X09A 3CMMA 2BOIA 5FUNA 2DA5A 4C0BA 4IL6C 5FCCA 4E6KG 3DPRA 3IC7A 1NX9A 3PVNA 2JIJA 3NJZA 2ZS6B 1EV7A 4IEXA 2KISA 5LW9A 4C30A 5E3OA 3R4SA 4L99A 1VQMI 3BQZA 3J4UH 4PGGA 5FRAA 3IAQA 1H9PA 4COUA 2EA7A 2ZGUA 1UCXA 4BLIA 2E7AA 5HS8A 4EJTA 4CXXA 2B8MA 2OPTA 1OA3A 4LBMA 1HQCA 4S0HB 4V19K 1VP6A 5HS7A 2M8GX 4LBJA 3KV9A 4D7TA 1XDUA 3T8RA 4XOGA 5F0HA 1H9GA 4Z92B 5DM7F 2P4WA 3HL2A 2I74A 3M8LA 2F48A 3HT1A 1TG7A 5A33B 1OUXA 1RHI1 1Y43B 4QPQA 2GP3A 2Y6KA 1ENHA 4N9IA 2B7YA 5DAPA 2L9NA 1U78A 3TO9A 1JE8A 1H1AA 1HRV2 4NMIA 3FE5A 3OPTA 4OVEA 2YUEA 3HHHA 1JTXA 2M34A 2IP2A 1D2SA 2ESHA 1QHDA 2E63A 3FMQA 1B1BA 1W8ZA 4GZ9A 4JTOA 4JC1A 1JZ5A 5FAXA 1H9TA 3ZYHA 3RWKX 4WV8A 3C2GA 4QDQA 3HVDA 4PJNA 3MN2A 3ZXKA 2PFBA 5KK1A 5J1UA 2GXBA 2F2EA 3DEUA 3ETQA 4MEYF 4MXWB 3O12A 4NROA 3WD5A 1SFEA 3LA7A 1ENQA 4XXAA 4BEHA 2RREA 5JSRA 1W8OA 3WNPA 1W0TA 2ZHMA 2FCTA 5ANQA 4XBNA 1H2MA 1TNFA 3R4UA 1BXHA 2Y26A 3BCAA 4UW5A 4G6DA 2BERA 2P6TA 3QP6A 1R22A 1DDLA 3K51A 4B1LA 5JR7B 2EIKH 2RN7A 2UYAA 2LS6A 3S1QJ 1HB3A 5EYXA 2QQUA 5L73A 2HBUA 2OZUA 4MLOA 3EBRA 1FOKA 4D6QA 2DCEA 3ZR8X 3FHZA 3PJQA 4LBQB 1S8NA 3MW3A 1K12A 2HEWF 1PO23 1ZTRA 3U07A 2Z42A 3HXLA 1YIFA 1OYYA 3HAGA 4KG8A 4IRIA 4B4RA 4GJYA 1BC8C 1WCDJ 5A1FA 1EV11 3U78A 4MFEA 4JCKA 1PX4A 5DAQA 2WZR3 4DBQA 2JD4A 1W8WA 2AR6A 2RM22 3PTYA 4XQDA 5K7HA 5T50A 1FMVA 3PJRA 2DPUA 1ZZ8A 1OLTA 4M3CF 3F3XA 5LEJA 2RM21 4GQ7A 3ST7A 5F64A 5FD5A 2WY7Q 1GZCA 4D0QA 4LR4A 4MFDA 2V5DA 4G6TB 1D1AA 3KP2A 3OD4A 4AHYA 4M9XA 1W6NB 5LRRA 1ZA4A 4J00A 4M0HA 2QZ2A 4JGYB 3WY6A 4DO0A 3HWJA 4P08A 4M9SA 5J3LA 4XILA 3VBFB 3K4DA 4KQ7A 3QAHA 3AB0A 1C57A 4PJJA 1FMD1 3A4UA 3GJBA 1O3TA 1F43A 4L9VA 1QJU2 4LOSA 4M6YA 5I0RA 5LCWL 1JI8A 1HQNA 2X29A 4NPMA 3I64A 3MMYB 4XAAA 1QJU1 3H3UA 1Z1DA 1APLC 3TP3A 1LGNA 3CJIA 2HQRA 1T8IA 4LBNA 1UN1A 4D5CA 1D4M3 1LJ7A 4ZTFA 5FO9B 3AKPA 4WVVA 1R49A 5HDNA 3G4SI 3CCRI 3RRDA 2NVYJ 1P92A 5D8KB 1YW8A 2VZ1A 5D6FA 3R4DB 3BWGA 3WU1B 2WN3A 1YUDA 4AGGA 2R7QA 4CUAA 3WZ1A 3ZSJA 4S2GA 4HQMA 3BPZA 2ZFUA 5DG2A 2GC3A 2ZHNA 5EPAA 2Y0OA 4ET7A 4W6YA 5HXVA 2BJSA 2IPQX 4CCJA 2J1AA 4RGAA 4MQVA 2HWD1 1UFMA 3IKTA 2DVDA 2CSOA 1KU2A 2XASA 1AR61 5LHIA 4A7KA 2CAUA 4OUEA 5M5YJ 1U2WA 4KT5C 1UY3A 3GTKJ 2OS2A 4LO5B 3OG2A 4Q48A 2CGNA 1DZRA 1UIJA 1R6RA 4CP1A 1E5SA 1ACCA 3GTMJ 4JRLA 2KRHA 1H9WA 1QJZA 5HCFA 1SFYA 2VOOA 1PO12 1MJAA 3NKTA 4XF4A 2DA2A 4B47A 4ES8A 1NG6A 2O3FA 2RV9A 1P6RA 1OI6A 5A33A 2OUMA 3NEUA 4XLAA 2W91A 1O6UA 1XTAA 5IYBJ 2LYCA 1PO11 2WAOA 5FOJB 3G3ZA 4GD4A 4IGPA 1ZREA 3JR9A 1N3PA 3B7MA 4EJWA 4QM9A 3KV5A 1ZZ7A 4CCNA 1VQ6I 2YB7A 1YW9A 4J1WA 2V1XA 2RS32 3NWTA 1GV2A 4QB6A 3PUFA 1POV1 1DGWY 4AWDA 1DFQA 3LIGA 1DPUA 1F15A 1QU3A 4KFCA 4COZA 1LDKB 3WT3A 2UXXA 1LU2A 3ZQCA 1ON1A 1ULGA 1X1PA 1W04A 2V26A 2RR12 4ZDPA 2Z99A 3N3HA 4EYUA 4FSJA 3MI8A 4MXWA 4LLFA 1TL8A 5H9SA 5FJHA 4XF3A 4GALA 3C2BA 2WT0A 1CVNA 5AVAA 1OPMA 2ZNYA 3VD3A 4HVRA 5LGTA 1W06A 1QDCA 3AYAA 1RUI2 4Y33A 2P2KA 2RR11 4DRRA 1YO8A 2NPIA 4NAMA 4ZYEA 3VDCA 3IDEA 3LSKA 1SD4A 1FPN3 5FZKA 2M45A 1RUI1 5DUUA 1PVC2 2IA0A 2B42B 3H1CA 4JX0A 4Y1ZA 2E7XA 2VL8A 4AIHA 3I4PA 1N75A 1O7LA 1B35B 3AVSA 3LSHA 5LASA 2VMFA 3BZKA 4E4SA 3BTCA 4EN6B 4LBQA 3KYLA 2KDOA 4XFBA 1S9HA 1W7PB 4C8DA 4O65A 1RUH3 4WF2A 2VM9A 1ZN2A 1ZK8A 1NQJA 3MDPA 4HT1T 1VRH3 2CUJA 2Q1FA 2SLIA 4TLGA 4QPIB 5LBFA 4ISRA 1RUJ2 2WNVC 1MMNA 5DD8A 2EVXA 3VB9A 2OQGA 1N77A 5JIAA 2HEOA 1GKBA 1HB2A 1RUJ1 3LB9A 3AG1H 1XPXA 2TCTA 1SANA 1CJPA 4YG6A 1H8TB 1SACA 1AHSA 3JBG1 2JMWA 3BTJA 1IJWC 1MZ5A 3BR5A 3Q9OA 2PTMA 1XJAA 2LROA 2PFWA 2R062 2YPRA 2RQQA 1VTNC 1W6NA 1Y0UA 3RG0A 3OL4A 2L01A 2WZPP 3K70D 3KS7A 4CU7A 4JGYA 5C4WC 2K9QA 4YG2F 4EM1A 4XURA 1VNDA 3JB4C 5JHUA 3E0JB 3JTHA 3VBFA 3EPZA 3B5LB 5I8YA 4Z8BA 1VBA3 1KQ0A 2R061 1NAEA 5FK8A 3VSKA 1K5MB 1S72I 5JLVA 3VYRB 3OGSA 2QBYB 3U1KA 2VXJA 3JTGA 4LO4B 1RMU3 3AMQA 4E4HA 3O1SA 4CCKA 1NK2P 2OZ6A 4YZ4A 1FOD2 1QZEA 1O7FA 3MD2A 3MEXA 2KL4A 3WG7H 3RZKA 1SVMA 1VBD3 1SAUA 1G9DA 2YU3A 2DMQA 1BCXA 1DU3D 4QHZA 1FOD1 2A68F 1OC1A 2ID6A 2J7MA 3J26N 4JBAA 5F3CA 3OSGA 3MIHA 4CYCB 2QQLA 1TW2A 3H9QA 5E79C 1XBFA 4LIVA 4MNUA 3PNAA 2XKPA 3BVCA 1OFCX 4FT8A 5FZOB 2EAKA 4I30A 1W6OA 4QKFA 2EIMH 2P0WA 4JYKA 1LOFA 3I3DA 3WP6A 1YG2A 1Z0XA 5ICGA 1GLNA 1D3YA 4FXGB 3JD73 2GALA 1BIAA 4RGUA 1S7OA 2LTPA 2DA3A 1XYPA 5F0CA 4WXDA 4XKCA 5A32A 2RS52 2FUG2 3S32A 4XRSG 1O57A 1W6MB 1WCUA 1U5TB 4I2OA 4LNVA 4Y22B 2JA8J 5K9YA 3W6KB 4U0VA 4QLCU 3CC4I 4DMIA 3LQRA 3CCSI 2RS51 3SHRA 3KP5A 2ZEZA 3BCWA 2P5LC 2DJIA 5C3EJ 3KEOA 4CZZA 3R4KA 1JT0A 3MZYA 2WYSA 3OYHA 5IY5H 5DAXA 3LZZA 4V1PA 3ZDVA 3QYEA 1W0OA 4JDOA 4BGDA 4BXXJ 2NZ9A 1CAUB 1IGOA 4E7IA 3MPPG 3BB6A 2EJRA 3ME2A 3D6EA 4BU2A 5A3TA 3GZTB 2DA4A 3MVPA 4A0ZA 1AR72 2D7FA 4QSHA 4BE2A 1T39A 1ULDA 2P6HA 4MUVA 4RLFA 3BIWE 2E2JJ 3WNKA 5DPNA 3WF1A 1UYZA 2K4JA 3UGHA 1YJ9I 2HWF3 4LITA 1Y8QB 4F3JA 1J9IA 4AXOA 1W2TA 5EHDA 1AR71 3H9JA 4XJZA 3WHCA 2Q1MA 3MIGA 5I91A 1YYVA 1W99A 2XPVA 5FP7A 1QNTA 2LD5A 2QQBA 2MC3A 1LFBA 1ND3C 3S2DJ 2JB8A 2CS3A 4QPGC 3JXSA 2R93J 2EIEA 2L9SA 3WDXA 4CO8A 3ZN0A 1SFOJ 1X3UA 4OIOF 2J1SA 3WP4A 5J7MA 3AL0B 2JSPA 1LU1A 3I54A 2WFF2 5F37A 4AIDA 2BEOA 1FAYA 1F4AA 5ICEA 3H8OA 2WO1A 3I59B 4LKEA 1QBJA 4JHZA 2Y2ZA 1B35A 2HJIA 3SKVA 2JE8A 4OUSA 5H9PA 1IQAA 5FXVA 1RPWA 2DCKA 2WFF1 1IRFA 1W7PA 4LHNA 2ELHA 1IXRC 4RM2A 1MBJA 4ENKA 5C3QA 1G7YA 4GKXA 5E8AA 5EXOA 1XMKA 2C6YA 4QPIA 3FISA 3IUOA 1RRJA 4E2SA 4KIGA 4IHSA 3KPHA 3K48A 2K86A 4GB33 2E35A 1JZ4A 2DBNA 2LMDA 5LWBA 3N9OA 2XUEA 2D43A 1Y9GA 3UT0A 1BR2A 2RS13 1IN4A 3QYBA 3D3AA 4AUXA 3V64A 4CVUA 1MBEA 1SFKA 3EUKL 3G73A 1B09A 2RMU3 1FYMA 1H8TA 5FKOA 4HV5A 3A0KA 3FLPA 1N78A 1MD0A 5JXJA 1SVOA 1NH3A 2VKHA 3VFZA 4KN7X 2QQKA 2IWGB 4PT6A 1UAIA 4M3CE 1HN0A 4ZYAA 4AK3A 4WVMB 2ZX0A 4RR3B 4GCVA 2MYSA 1O3QA 2BHZA 2ISYA 2R49A 3AJYA 1OT5A 1BZWA 2GNMA 1UHWA 3ZM8A 3TRSB 2ZMEC 1T2XA 5D2AA 3GFJA 1K5MA 4MTEA 1QWRA 3HG9A 3EQEA 1JGSA 3LSTA 4IHTA 2QBYA 1M4WA 1ZRIA 2C6SA 1CIYA 2WZEA 4KGQA 5FYCA 5B1BH 1F5TA 5C8CC 4D7YA 1Y7BA 1FYUA 4U36A 1O8PA 3VOEA 2CDPA 2VQ0A 4BM8A 1BW6A 4MGSA 4OZXA 3G2BA 4XSZF 2UXNA 1V6JA 3RQ4A 2HH9A 4AHXA 5ERIA 3GVAA 4KICA 1JOPA 2K9LA 4AFMA 4FTSA 5F5IA 4CYCA 5FD6A 3WGGA 2DF7A 5C71A 3ZYBA 4FHTA 3ZPOA 2L9RA 4Y1VA 5FZOA 4A2UA 5FPAA 3U4SA 4J1XA 4BQ4A 4IEPA 1F9NA 3WG2A 4RFRB 5JMCA 3OYFA 5B5EC 1OCPA 4QGMA 2DFEA 3SXYA 3IKWA 1PM7A 2JPCA 4FPCA 2BXYA 3SCFA 3L9JT 5CFDB 2MH2A 3H5RA 2WINB 2ZKLA 4P00B 2JJ7A 2OQRA 2VECA 4V2WA 2EFPA 3BGAA 3H8RA 1ALYA 5FZ1A 5FP9A 4H7LA 2R5ZB 2YC0A 3T0BA 1KQ9A 3MFCA 4AG4A 4BY7J 1I5ZA 1W6MA 1U5TA 1Y8RB 2NVQJ 4Y22A 4ZTJA 5D4RA 1R1UA 4AI8A 3HYIA 3MZ8A 2JDZA 3NNFA 4BE1A 1DHKB 3QPSA 1PMIA 3FXQA 3LOIA 3OEBA 4I3PA 5IVYA 2WR9A 2D3RA 1B6AA 4ZYDA 1IUFA 4LULA 2HYKA 5HV0A 3WW1A 3NO8A 1AOYA 4L9JA 3VZKA 1IC8A 2R30A 4Q47A 4FOWA 1WJCA 3URFA 2VT3A 1YFHA 2KD7A 2WAQN 5FREA 3OOUA 3BZCA 1AX0A 3H7YA 3DV8A 2Y48A 3KGLA 2V4VA 1P4WA 1PZ8A 2M0MA 3UKNA 5CVRA 1GZTA 2R0FA 1AA7A 3ZFEC 5FP4A 3RTRA 4P5OA 2HYJA 1WLWA 2G7HA 3ZXEA 2HYGD 3DEMA 2K7LA 1R083 5IVCA 3EUHA 1OCTC 5FWEA 5EJCA 3LDRA 3IP4B 1U0AA 2VJ4A 2JK3A 4V2GA 3KZ4C 3UV9A 2STTA 1X82A 2J5OA 1RITA 3QH7A 2VVEA 3ZPYA 2VASA 1FBSA 3F21A 2XAUA 1XXNA 1C1FA 2J42A 5H2FC 2IGNA 4YW5A 4ASLA 2IVIB 4BH9A 4RHV3 1AX2A 4LJZF 4XCBA 2A7AA 4I99C 3HGYA 2FXAA 3IWFA 1RVF3 3CNAA 1UNBA 4N43C 4OI1A 3I59A 4IHVA 4LBLA 4MHGA 3OGVA 4PK4A 4O9GA 2R32A 5DCMA 4XSXF 5LBBA 1MSEC 1UCRA 2J1EA 1CAWB 3U0ZA 1BOAA 1OH4A 1USTA 3Q8CA 1QJX3 3IT8A 1BHGA 3POBA 4FTEA 3ZKUA 5J1YA 2GM4A 4KNCA 3DEWA 1JS9A 4HNVA 3A01A 4UNOA 5DD4A 1WJDA 4BPZA 1G59A 2JDNA 1IO2A 1QHGA 2JKBA 1ZR4A 3MKWB 1XNTA 3ZN5A 4MADA 1KU7A 5BV6A 1HN1A 1STZA 4UUVA 3Q9VA 3IM0A 2AENA 3JB8A 2BGPA 5K5OA 2DWRA 3LA3A 1TME2 2J1UA 3ZQIA 4G8XA 4D6SA 5J48A 4WVMA 4RR3A 2R92J 2O9LA 4R79A 3KCCA 1HC8A 3KFWX 3CUQC 3MCZA 2PHDA 1F36A 1GVDA 2CMPA 4QXHA 1TME1 3D5OA 2H6BA 3T8TA 1VMJA 3HPHA 1YQCA 4C2TA 4META 1H2KA 2IFRA 2ISZA 4AYBN 2QWWA 1JUHA 3JQXA 4LOCA 4HLXA 2ZXQA 3AFHA 4A3MJ 2JDAA 3J7NA 3QACA 3PNYA 2W46A 4H4KC 2PLV1 3HNMA 2FOKA 1AJOA 4LIUA 4QXBA 1PIV3 5CQGA 1FLIA 3C3VA 2Q0AA 4L8QA 3CF2A 2JSCA 1SLCA 3WX5A 4ARYA 3ACHA 4OIPF 3GF2A 4LO8A 3DF0A 3BOWA 4IV1C 4NOTA 4ZXKA 1FYKA 2YG0A 2R5YB 2XVLA 4D69A 3N7LA 1R1A3 4KL1A 3E3VA 1RESA 3K0LA 2X10A 4OAZA 1D1CA 5LY1A 2ARXA 4AVPA 3TW7A 4A93J 2FMLA 4H0EA 5FPZA 4G6QA 2FZ1A 4JZRA 4C90A 2BDRA 4LTAA 3ZMZA 4U0YA 3K2OA 3POIA 4XBQA 3A03A 2JQ7A 1H4GA 2P34A 2R5ZA 2ZZQA 1Q3EA 1E5IA 1EUTA 2DVFA 1CZTA 1E0EA 4A3JJ 1BJQA 3FUQA 2HFHA 3LSRA 5A2QK 3CEWA 4UW4A 4NIHA 1HB4A 1HX6A 5K0UC 2ICWG 5BY5A 2O0YA 2L9LA 4Z07A 2ZBKA 3AMNA 3ZN6B 1HLCA 1UMHA 3HBLA 1QU0A 1OUSA 2VOKA 3IIIA 1FP1D 4LO6B 3JRCA 3M3YJ 2QQ9A 4CICA 3T2OA 1NG7A 5FKCA 3ECOA 4HV6A 1VIWB 5LATA 3S15J 2GMMA 3CQOA 1IRXA 3N9NA 1F4KA 1L3JA 3WUDA 1E17A 2P81A 4JQRA 5CKNA 3ZXGA 4YW2A 3H5AA 2W1OA 5FFXA 3VBSA 3BROA 1MR5A 2Z2SB 1BI3A 3ZQGA 3I2JA 4DJAA 3OYCA 4XJAA 1ZRCA 4CZSA 1SHWB 4AFBA 4HBNA 1ZG5A 4EN9B 1XG1A 5IK7A 3ULQB 1KU3A 3NV1A 4KGGA 4EWAA 2ZGLA 3LPGA 2PHTA 4Q0SA 2VR4A 5FROA 1NG0A 2JEMA 2X8KA 2P7CB 1RETA 4A0XA 5EJZB 5EZWA 1A3KA 4CUCA 3NJVA 3EO6A 3K4ZA 4P9XA 3TN93 5CVIA 1FP2A 5ISLA 1HW1A 1O5LA 3ZYGA 4AWXB 5FO8B 1LNSA 4RBOA 4RQPB 5CG9A 1D5VA 1Y1WJ 2J1RA 2LF8A 1QOOA 2HWE3 2WA4A 3FJSA 3K4AA 2ZGRA 1Q43A 1W36C 1WA4A 5LA9A 2XB6C 1UKRA 2DCYA 3AL6A 1IDYA 4DXZA 2RJKA 1CAWA 1W39A 1U6GA 5FZ3A 2CQQA 2GZWA 1YS6A 2JG8C 4YW6A 1ZHFA 2VNOA 5HLIA 4ASMB 2R7WA 1DLCA 4AL9A 4YZ3A 4YPJA 4DUWA 4QQOA 1OFSA 3TOBA 4BIFA 4YFZA 1XMAA 1ZG1A 5DCFA 4ISQA 3DXUA 2E2IJ 5D5XB 3AAFA 1XSDA 1AR93 5HS9A 2R043 2XH6A 3LD8A 1UX6A 1XPWA 5A6ZA 2HBTA 1GQGA 2JA2A 4B7KA 2QDNA 3BU0A 1C8M2 3RWNA 4A44A 5JI9A 1EAH1 2F5DA 3RYPA 1AYN1 1NY71 2Y8KA 1NYWA 2CQKA 2FJ1A 4M3BA 2GLOA 5DZEA 1QJY2 3E6CC 3DN7A 2VJ5A 1C8M1 2ZHLA 2BBYA 5AIQA 1NE6A 2AXLA 5J36A 1LEMA 1W0NA 5KHGA 3O0WA 4LLOA 2X5IC 2QQAA 3O1VA 4B3XA 3LQCA 3EJKA 2EV5A 1K78B 4UW3A 4K7JA 4BA6A 1QJY1 3DECA 3FBNB 3D5SC 2VU9A 1OR7C 2RDRA 5GAGJ 4U2AA 2WLPA 3FF5A 5JOWA 4AR2A 4RLQA 3LEIA 4PLMA 5C8WA 5JXGA 1AR82 2QDRA 4XONA 2ZO4A 4NPLA 2JG9C 2VVFA 3HQUA 4A4AA 1JZ8A 1KU9A 2QZ8A 2V73A 3EHKA 2V09A 1QHHD 1OKRA 3OD0A 1AR81 1N25A 2NMNA 3M1EA 2YBSA 4B8EA 1FIPA 2WQ8A 2VTXA 3C18A 1BLZA 1QGLA 2YGLA 3LSPA 1ZR2A 5ICFA 3N7JA 4AYBA 5I0DA 1QZZA 4URTA 4YGEA 3IMNA 2WAAA 2DA7A 3LSDA 3J7AY 2DT6A 4O3MA 3PFIA 4YGCA 2XF6A 3L2RA 4J19A 1Z6RA 2BY2A 3E5UA 2A6EF 3G1OA 1FIAA 2PMUA 2C26A 3TWIA 2HQNA 1ZA7A 2VPRA 2M5WA 3DCFA 2CJJA 3HRMA 1ENSA 2HWVA 3GZNB 2XJTA 1JMUB 5FPVA 4Y7NJ 2Z5UA 2VZVA 2WNVB 1HKDA 3FMRA 4KI5M 2QSFX 5LGUA 3O1OA 4AI1A 1UAAA 2EV0A 3FM5A 4HAMA 4Y52J 2A6VA 3T2PA 5K7FA 3IN9A 4GJZA 4EN8B 1GNHA 3ZOIA 4RGGA 2WJSA 1NT0A 2HXOA 1A31A 3KZZA 4OMDA 2VLAA 1U0JA 1PGL2 1VQLI 2R071 3RPUD 2QQNA 1TT0A 5FR3A 2G9WA 4AVVA 4LBOA 4GMP1 3CKHA 2EQRA 5C4WB 5IT3A 1Z7UA 3ZMVA 3O0XA 1PGL1 1OF3A 4UW6A 2VT2A 3U14A 2VZSA 3GFLA 3KB5A 3TNQA 2Y9YA 2WAEA 2YFZA 3TNPB 2O6GE 4A41A 1CAXB 2OA2A 1X9TA 2E36A 1Z77A 1AVBA 4O5VA 4JOMA 1OBNA 4IE0A 3OSFA 4Q0QA 1PJRA 3O6BB 1E57A 1KEXA 3OBAA 2FNAA 1AYM1 2OXBA 3VZNA 5JFRA 5IP7J 4MX3A 4EJOA 3VN4A 5LRSA 1DGWX 3SITA 1OQYA 2D45A 3CMEI 4DW6A 1U5YA 4IHYA 3RZMA 4HANA 5FWJA 1FSEA 3GEZA 1HB1A 2VZRA 1XU1A 1BBT2 4EJVA 2DPDA 3LNQA 1U5IA 2ZGNA 4XF1A 4A3KJ 1QJEA 5IVVA 1OYWA 3MLKA 2JWTA 1O3SA 4MTDA 3I97A 4FOQA 3KZYA 2OV7A 5C5UA 1BBT1 3RZHA 3DUIA 2A3WA 2WYFA 4FAGA 5JI7A 2LY9A 2BW3B 3MIBA 4N7IA 4AI3A 4N7UA 2VMEA 3ETPA 1FMWA 3WQ1A 4IOCF 1BC7C 1HA8A 2L4AA 2A1XA 2K5CA 1JYIA 3DBRB 2B9SA 2HZTA 1SPPA 2UY8A 5CG8A 5T52A 2VOTA 1ZLJA 2P6CA 3M1CA 1REEA 1QXPA 4HX7A 2QLZA 4R9BA 1K5JA 1D2QA 1JZ2A 1GV5A 2VE8A 3WNLA 3S8PA 3S30A 1O8SA 2B9UA 3GBWA 4P14A 4CDUC 2K9SA 1DUXC 2M9HA 3FXJA 2GC2A 3O8GA 3ZXSA 3AKRA 5HPOA 1RUE2 5IVBA 5EYRA 1XN7A 2XVGA 5M3FJ 2PI0A 3HTSB 3GTOJ 4A12A 3WW2A 2E34A 2OD5A 1S0CA 3ZMOA 1K78A 5H6RA 1RUE1 4IQPA 1TBXA 1W05A 3L00A 4R9AA 1HBXG 1UL9A 3ENRA 4BK5A 1ZX5A 2QQIA 4URAA 1ASJ3 1RKWA 3F6OA 1W4MA 5AIPA 2CUFA 1QZYA 4FCAA 2YZ4A 4YIFA 5D5VB 2Y0SA 2M30A 3GCMA 3KT4A 4TWTA 2ZGPA 3VSLA 4WM8C 2HDWA 4NIGA 2QQOA 1PDNC 4QPGB 3JZVA 3X2QH 4D0PA 1V5EA 2R0QC 1T98A 4B4QA 4Q0VA 3CC7I 1HF0A 4QTRA 1X2MA 2V5YA 3VL8A 2WT2A 3QLQA 4M3GA 2BV4A 2VE9A 2E32A 4WX9A 1HQWA 3AP7A 4ANJA 4GULA 1XNKA 1MQTC 3DGTA 3J7MA 3E6MA 3R0RA 2I10A 3L2CA 2VO5A 1V70A 2X1DA 5F3IA 4Z2WA 5J1XA 2J1TA 3HKZA 1KZHA 2DUQA 4BJTA 1WCKA 3PUSA 1PO21 4FQ4A 3D8CA 1POGA 3DQVC 3Q3SA 2WNVA 4E4DX 3TKYA 3BJAA 2ZEXA 2EH3A 3WTSC 2WZR1 1J3PA 4HYEA 3HOWJ 3BPXA 4QM8A 4LB6B 4CU6A 2OA4A 1U5XA 4LMFA 1W2NA 5CYYA 1IKQA 5CEHA 5F9TA 2Y0IA 2VUDA 3SC7X 3JCUC 3ZGKA 5FYTA 2DUPA 3K1PA 4XFGA 5IYDJ 4FFGA 1RYYA 5C4WA 1X1AA 1OCCH 1IPSA 2ZCWA 4LKFA 2EK5A 4BXSV 2ZMEB 2NVXJ 1Z0HA 4KDPA 3PUQA 2PAKA 5E3MA 1CAXA 1UYXA 2ZJ2A 2YS9A 1MNDA 3ZMTA 4CTEA 2AUYA 1YRNB 3WG1A 3OR1C 1W0UA 3PLQA 4KT6A 1CPNA 5C8CB 4YVWC 1IGNA 2B7EA 1YI2I 1QOSA 2VZ3A 3Q8FA 5HCBA 2BY1A 2NOGA 5FKMA 3M2MA 2BYVE 3G6EI 4Q0PA 2GOMA 2VTXJ 1OLMA 2XVCA 5CFCC 2D6PA 4XQWA 2GBYA 2GXGA 2IS4A 2AS5F 1DGLA 5IYCJ 1D4M1 1IUYA 2GN3A 2A6HF 4FQGA 1R9TJ 3IAM2 3NNGA 4IQJA 5LK5A 1VMHA 1U8RA 2HXIA 2Y69H 1LKNA 1KXGA 3BLYA 1PNFA 1TQ5A 5IOYA 2ZJRF 2ARAA 1DGWA 4IPAA 3WW4A 4COYA 4UUSB 5CBLA 3RMXA 2BW3A 3BTZA 1FY7A 1P4XA 3RI8A 2RQPA 4Y26A 4M6XA 2NS7A 3PO3J 4CPBA 1WUVA 4II3A 1YHFA 2E9QA 1ACIA 4W6WA 3T2QA 2A3SA 1GUUA 1UXZA 4Z1VA 1OKOA 3PSIA 5FBJA 5FDBA 1COV3 3BT9A 2VKVA 3M8JA 4YLZA 3W6VA 3H36A 3C7FA 1QF3A 1UY2A 1TZLA 1SBEA 2R3SA 1RC6A 4L97A 1ODMA 2D97A 2W48A 4QD2A 2QUFA 2OAZA 1NZCA 3FKJA 3THTA 1P8JA 5EGOA 4NHJA 1H88C 2A3XA 1H0BA 2V9KA 4W1UA 4QGNA 4PCRA 1VBB3 1Q1HA 5C9AC 1JZ6A 2AEZA 2OPKA 3DLAA 5M5XJ 3VKNA 3W58A 1QXJA 5IVFA 2WUHA 1WVRA 1LOGA 4K9SA 5JVTA 3O2PE 3ZFEB 1TTYA 1QQP3 3G1LA 4QX1A 1DF0A 3RJ2X 1FV3A 4O9EA 1UY1A 1T33A 2M7BA 5E1WA 5GPAA 1A8MA 5C3SA 4KMFA 4RL7A 2MD0A 2Y6LA 3WHBA 1PUFB 2DK5A 1DBNA 4ZU7A 4OWRB 4QPYA 2C0ZA 2LVSA 1GFF2 3K69A 3W21A 3RZGA 4IRHA 1ND3A 1FPN2 5SV8A 1GWLA 1I1GA 4QPGA 3JAMK 2VONA 3BG5A 4R4XA 2CYYA 2BHYA 1XQNA 4DINB 2EZLA 1D0ZA 3AP4A 1TWAJ 2ZMLA 4YW4A 1FPN1 4MGKE 4CUBA 3BP8A 2FBEA 1VBC3 3NW4A 4N43B 3E5XA 2JIGA 3ZMDA 3OYNA 3HIFA 1SEUA 1H89C 2L7KA 5D8LB 3JREA 2P5VA 5ACA3 2AH2A 3TB0A 4KA4A 4NRPA 4XRSA 2JB4A 2ZXWH 2IXLA 2FD8A 1S0DA 4LBKA 2IFWA 2KZVA 5JSPA 5LA0A 3ZYRA 1AJKA 3GJAA 5FZ7A 2WWSA 4ZJZA 4NO4A 2TEPA 2KT0A 3WTVC 3BTAA 1NXD1 3H3ZA 1RUF2 1ETVA 2KLOA 2X9DA 1JHNA 5KHJA 2QGUA 4MQ9F 1YFWA 4DYRA 4Q4V2 1XCVA 2AREA 5FXZA 2WN2A 3WNOA 3TDUC 3GGLA 5E1RA 1RUF1 3CL1A 5FYZA 4DB5A 5FZEA 2OCEA 2ZGTA 1TT5B 5IAVA 2VZTA 5CU1A 5H9QA 5FYSA 1K4TA 4XFIA 4BQYA 2D5FA 3IIAA 3GXOA 2GNTA 2ZJQF 2W87A 4AQSA 4Q4V1 3CUQB 4EN7B 5KR7A 3AXEA 2ZMEA 4BBRJ 1GOGA 3OYMA 3POEA 1RUD3 4MO7A 4KWJA 4XC9A 4TZDA 3NAPC 3WG4A 1WQ2A 5K5QA 4ATEA 1HW2A 3S1MJ 3T4HB 3J9SA 2CAVA 4JAAA 3MUZ1 3CCJI 3FBYA 3ACLA 4HF2A 3ZN4A 3ZLIA 4DBRA 1YRNA 3BN6A 4A5MA 1W1WE 1OVPA 3K3OA 5C8CA 3QPLA 1RMU1 4FI9A 4ORFA 3ACGA 3PMSA 3MQ0A 3LSEA 2NYYA 1WMXA 1VBD1 3BG7A 4IV1B 5EDNA 3DYOA 4GYGA 4AFAA 3VDAA 2K46A 1R5GA 1I3AA 1T6SA 2FQ3A 5CNAA 4PI0A 3OGGA 2W9XA 2LRDA 1P9QC 3CC2I 3GTGJ 2VZPA 2Z3YA 4M0NA 1MSFC 3PIOF 1SC7A 3VEPA 1US2A 1HDPA 3AMHA 2D6KA 4NE9A 4UUSA 5FXXA 3TEYA 2HNHA 2IT0A 1JBCA 5CKMA 5BNNC 1M1EB 4FPFA 4LBQD 1FNNA 3SEEA 1W9SA 3OYDA 1MBGA 1DQ4A 3GZ6A 2ZFWA 4CA9A 3H9GA 3TYJA 2ZGOA 4E2QA 2EF6A 1TWGJ 5L19A 2N8GA 5A3PA 4YIRX 2D6OX 1XSRA 2ZACA 1FYLA 5DDGA 3LSIA 4D7SA 1WCMJ 3N4MA 3H3VK 3C2HA 3LA2A 3J7LA 2OBPA 5K0UB 3M3EA 2ESNA 3TEWA 1Y9QA 4XN3A 1DZTA 1Y4WA 3S7IA 3VDDC 1C5IA 1VMFA 2ZOEB 3H0DA 2YSRA 4XDOA 2HWC2 4RMNA 4GXOA 2MEV2 3T09A 1LGCA 1BK1A 4IE5A 2LK2A 1W2UA 3BYWA 3WF2A 3FX3A 4MYEA 3OY8B 2B5HA 1A04A 1W8UA 5F8PA 3ZFEA 1JJ6C 4PFOA 4YGBA 2HWC1 4XJ8A 4CP2A 3AVRA 2CGPA 4LT5A 3CCQI 2JDMA 3BALA 2MEV1 2Z9OA 1I3HA 4E8DA 4XDPA 2X1EA 3D0SA 4AQ2A 1QQIA 4G12A 3WHTA 4ZC3A 1PUFA 1C5HA 2UYBA 3NJXA 3W3CA 4Y5Z0 5FZ6A 2XOMA 4S2FA 2YU2A 4IX7A 1K6OA 2Y6GA 1P2FA 4NC8A 2VZOA 1HRV3 2VBYA 1FNZA 2AYHA 3QU3A 4NN0A 2DDAA 2BRTA 4OHXA 3W59A 4N43A 2XGXA 5JR3A 3JU9A 3MLLA 1CONA 2JD9A 4BQ5A 4UBHA 1D0GA 1OURA 1YJLA 5JUVA 2EA4A 4BS9A 4TTGA 5DUXA 4RGRA 3NQHA 3MKYB 2UWMA 5JI6A 4DRVA 5FYUA 2JG8B 1RIOH 2XLFA 1KD7A 3BG3A 3Q8BA 3PIGA 1PP7U 1Z7S2 4QDSA 1TQIA 4U7BA 1WJAA 1XNDA 3KYDB 3KF3A 2XAGA 1JU3A 1IN5A 3W20A 1PYVA 5E20A 1YXWA 2VQCA 2Y30A 4RA0A 2RMU2 1YQ5A 3I3EA 1BEV2 2GMEA 4CXYA 4I7HA 2K40A 4AVZA 1IRGA 4XIDA 4OHWA 4GFBA 2WC2A 3WE2A 1UHSA 4LOTA 2RMU1 4E7SA 1UXXX 2Q8KA 3CCMI 1LESA 3OYGA 2PN5A 1UZWA 1BEV1 3CUQA 3OV8A 3LGRA 3HSEA 5ICCA 3J81Z 3PUHA 2A71A 1ETQA 4KUMA 1W6PB 2GP5A 5KAIC 2X5IB 3OYJA 1ZBA2 2CYFA 3KT1A 4KIFA 1Y39A 4Y17A 2KPMA 3HHGA 3SZTA 4OI0A 3BU7A 2STWA 3CDLA 1ZBA1 3O1MA 2VJJA