1OI6A

Structure determination of the tmp-complex of evad
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVRGIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQRQGLLPDYTTSQEIERRLTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Position of a Key Tyrosine in Dtdp-4-Keto-6-Deoxy-D-Glucose-5-Epimerase (Evad) Alters the Substrate Profile for This Rmlc-Like Enzyme
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Isomerase
molecule keywords PCZA361.16
total genus 50
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oi6A00
4XFAA 5T3NA 3OF1A 4L2NA 5C6CA 1YUDA 2QCSB 3NW4A 3LZZA 3L2HA 4KWLA 4META 1CAWA 4IERA 4XFBA 1DGRA 2PAEA 2OYZA 1CX4A 4QM8A 2XHKA 4PIYA 4AVAA 2D40A 1YLLA 4J1XA 4O9GA 3E6DA 4IEPA 5J7MA 4QGLA 4BIFA 1YFWA 4EWAA 3KSCA 3UKTA 1RC6A 1VP6A 2F4PA 3ACLA 2IC1A 2MPFA 4E2SA 1L3JA 3H1MA 4YNIA 3WW2A 3FJSA 4IEWA 1I5ZA 3BB6A 3I7DA 1CAWB 4KU7A 2PHLA 5E1RA 4WVZA 4HMZA 4MUVA 2V09A 1LKNA 1YHFA 2HKXA 4AVCA 3SCFA 4JVAA 3BPZA 3I54A 3H8UA 3ST7A 3B02A 3BCWA 3SCGA 1OFNA 3H1WA 2UYAA 3SMHA 4XFCA 2C0ZA 3EJKA 2MNGA 2GU9A 4Q0PA 4D7TA 3FHIB 4QMAA 1X8MA 3E5QA 4QXKA 3HQXA 4MX3A 4XF1A 3E97A 3WW4A 2MHFA 2Q4SA 2PYTA 4PIXA 3TNPB 5JSPA 3QOPA 3GBFA 1X7NA 3NKTA 4GULA 3UKVA 5LEJA 4ONUA 3CL1A 5JSOA 1CAVB 3DV8A 5I93A 5C8WA 3E6CC 3BALA 1IPKA 1ZREA 1J1LA 5BUVA 1H1IA 2H0VA 1EPZA 1O3TA 1O4TA 3FX3A 3WW1A 1HW5A 2O8QA 4HN1A 1J3PA 3KGLA 2UY8A 3ES1A 4Q29A 1UPIA 4WZCA 1RL3A 3RYPA 4FT8A 2UY9A 2GAUA 3R6SA 1LR5A 1J3RA 2B9UA 2Y0OA 1J3QA 1FT9A 3RPQA 4HN0A 4IESA 2ET7A 3H7YA 3U0ZA 1ZX5A 4BH9A 1J58A 1CAVA 1ZVFA 4HVRA 1EY2A 3FWEA 4AQ6A 1O7FA 4OFGA 1I6XA 5JCTA 1OI6A 4ZU7A 3LWCA 2IXIA 3KMHA 3MPBA 2OZ6A 3RNSA 4XF9A 1J59A 1NE6A 2CV6A 4CYDA 1IPJA 5FQ0A 1Q3EA 2XKOA 3M70A 4PJYA 3HT2A 3SXWA 2VECA 3FZ3A 3DN7A 5I0RA 4R52A 3EHKA 2B8MA 3MDPA 1QXRA 4I3PA 2EA7A 5JR7B 2GZWA 4YYOA 5J3UA 4X6RB 4BYYA 5JSRA 2BYVE 2VPVA 4MGIE 3ZDSA 2D93A 4EROA 1FXZA 4HVOA 4E2QA 1EP0A 3DL3A 1YFUA 1RTVA 1ZZ6A 5F1RA 4LUMA 3H50A 4IEOA 3PVBB 3OGJA 2E9QA 3LAGA 2PA7A 3OD0A 4EWEA 5FPZA 3E6BA 4NVPA 1XE8A 1GQHA 4LA2A 3NL1A 4R8HA 1QXJA 1RUNA 3RYRA 1JUHA 3PLQA 1WA4A 2ETEA 1CAUB 1CGPA 2GC1A 4MGZE 4UXAA 3CJXA 4IEXA 4K8FA 2QNKA 1XRUA 1CAXA 4KWKA 4I2OA 5LEKA 3NJZA 3NSTA 5KHJA 2GH2A 2IXHA 1NE4A 1ZRCA 4EWDA 5CVRA 4JTNA 2XGXA 3EO6A 4I01A 3U11A 1UIKA 5I0TA 4LEJA 2XL7A 4LULA 3KGZA 2Q30A 2CGPA 1LRHA 4XEZA 5HI0A 3DKWA 4I09A 4HSJA 3O14A 3CEWA 2XLFA 2XLAA 1Q43A 1XE7A 5EZWA 4A2UA 4XF0A 1YFXA 2ZCWA 1O5LA 2O1QA 2BEOA 3EQEA 1DGWA 4KL1A 3HT1A 3OCPA 1RGSA 5FPXA 3LA7A 3CF6E 1QWRA 4JTOA 4Z07A 5FDBA 2PTMA 5KHIA 1SFNA 3RYKA 2WC2A 2QDRA 4MGKE 2OA2A 1Q5OA 4YRDA 4AVBA 1DZRA 4L11A 1ZRRA 4QGMA 5CU1A 3OTFA 2K9ZA 3SHRA 4HVQA 5D1IA 4JV4A 3LA2A 1ZNPA 3NVCA 1Y3TA 3QACA 5I8SA 2CAUA 2XLGA 3RDIA 2ZKLA 1SQ4A 1WLTA 4XFHA 4XFIA 1PMIA 4D7SA 1FI2A 1UW8A 4XETA 1X8EA 3FE5A 5I8TA 3VHRA 5I91A 4IEYA 2WFPA 4I0BA 3HIFA 2D5FA 2EAAA 1QY4A 1H1MA 3LOIA 1O3QA 5CADA 3I59A 4KWJA 4B29A 4ZU4A 1CAUA 1EYBA 4N9HA 2B5HA 3H7JA 3D82A 2IXJA 1O5UA 2I45A 3IDCB 4N9IA 5FLJA 3S7EA 3LA3A 2Z69A 4RD7A 3IBMA 4ORFA 1YFYA 2GC3A 5EFUA 2D5HA 5I8YA 4LLOA 5LRSA 3MYXA 2PFWA 1OD5A 4HSLA 4MGYE 1U12A 2VQAA 1ZZCA 2BGCA 4J1WA 3KCCA 1UD1A 3G7DA 1PM7A 4O9EA 3H3ZA 2IXLA 4LUKA 2P17A 2FQPA 3ES4A 3RZZA 1X82A 1YWKA 4LTAA 2Z2SB 3JZVA 5BXXA 2FMYA 5E16A 4QX5A 5BY5A 4AXOA 3ELNA 1TQ5A 4KU8A 2N7GA 4Q0UA 5FCCA 4FAGA 4FAHA 3E5UA 3S0MA 4MH0E 3GYDA 4XFFA 2Q0AA 4QM9A 4XF4A 2HJIA 4F8AA 2OPKA 4Q0VA 2BNNA 1V70A 2UYBA 3N4MA 2IXCA 3CO2A 3H9AA 5FQ0B 2GC2A 4YSFA 1G6NA 1NXMA 4PIZA 4X6QB 2ATFA 3I59B 3D0SA 5J48A 3U10A 2GC0A 1ZRDA 3IIAA 1ZZ9A 2BNOA 3ROUA 4ZU5A 4IEVA 3UKNA 4F7ZA 1RUOA 2H6BA 3M3IA 4Z82A 3ETQA 1WGPA 3IWZA 1ZRFA 2IXKA 5K8SA 1UCXA 2QVSB 1SEFA 2PAKA 1ZZBA 4OLLA 4TLFA 4XFGA 1O3SA 4QGNA 5KHGA 4H7LA 5KHHA 4IEQA 4EV0A 4I0AA 4XF3A 2XL9A 3PNAA 5I0UA 1O3RA 3CLPA 5AVPA 5KHKA 3H1YA 1VR3A 2Q1ZB 3C3VA 5BPXA 3S7IA 5KBFA 2H6CA 1UIJA 3H3UA 4HLTA 4AQ2A 3IDBB 2DCTA 1VJ2A 3WW3A 3MZHA 2PQQA 4UBHA 2PHDA 5FLHA 4BHPA 5LRRA 2ET1A 4IETA 5JAXA 4HBNA 4E2GA 5BV6A 1LB2A 2KXLA 2BNMA 4MZUA 3TNQA 4LA3A 1OMIA 1Y9QA 5FLIA 4P9GA 4IEUA 2CAVA 2PAMA 1ZZ8A 4IEZA 4FBFA 2EVXA 1DZTA 4YARA 4HZFA 1NZCA 1NYWA 2OZJA 3BU7A 2QJVA 4I02A 1CAXB 1GQGA 3D0JA 4Q0QA 4UBGA 4MV2A 2XKPA 3SCHA 4WBBA 2K0GA 4Q0SA 5I0SA 3FFQA 3USSA 4DINB 3E5XA 1ZZ7A 3EBRA
chains in the Genus database with same CATH superfamily
5IYYA 1GZWB 1TEIA 4HETA 1LESA 5T3NA 3PU3A 1FMD3 1R091 2EIBA 4L2NA 2EIDA 2JDAA 1MS3A 1H2MA 2QCSB 4CRQA 4QPIC 1S4CA 1CIWA 4XFBA 5LBBA 4AEKA 3WHTA 3AP7A 5JOYA 4FPCA 4NMIA 1GQPA 4N7UA 4KI5M 4PIYA 1IKPA 3BIWE 4JKLA 3NNMA 4HOOA 5FY9A 5F7UA 4XDPA 2D40A 1H4HA 2ZXQA 4WVVA 1MQTA 1AYM1 4IDZA 5H9SA 5EJZB 2JEMA 3VZLA 5FZGA 1QGLA 4MHRA 4KG8A 4IEPA 5A6XA 4BJ0A 5HV4A 4CUCA 3KT4A 4DO0A 1VBE3 3POYA 3POFA 3AC0A 1ST8A 4RGAA 5A3UA 3HNYM 1C1LA 3UJOA 1TE1B 4Y1YA 5A1FA 1NCQC 2X8KA 4RR3B 1ZBA2 3K2OA 3LEKA 1MVEA 4ZKTB 3WW2A 2Y33A 3FJSA 2XQRA 3ZFGB 4IEWA 1BYHA 2DFBA 2VW2A 3AP6A 1ODMA 4KU7A 4IGPA 1EAH3 4LO7A 5HV0A 4QQLA 2WNVA 5A32A 5E1RA 1QQP3 2ID4A 2G4IA 5FZHA 4AVCA 1MZ5A 4OQ9A 4EZ4A 5L9RA 3BPZA 4LE4A 1DG6A 1JH5A 1F35A 2KR2A 3NNJA 3JU9A 1VBA2 3ZR6A 3BCWA 1RIRA 4Y22B 4FCAA 2JDKA 1JUIA 4BWOA 4CXYA 1LTEA 1D4M3 2UYAA 2ZEYA 3C2UA 3KQ4B 3SMHA 2C0ZA 3EJKA 4LBNA 1DZQA 1Y7BA 1WCUA 2GU9A 2MNGA 4Q4V3 4D0QA 2I07B 5BNPC 1X9PA 4QMAA 1LECA 4ASKA 4E4SA 2JD9A 4DY5A 4OI1A 4QXKA 2VW1A 4NUBA 3ZDVA 1NKGA 4MX3A 4ZZ8A 4Y33A 2ADEA 4XF1A 3E97A 1KITA 5A3TA 2C5DA 1YIPA 2MHFA 2R49A 1UOGA 2Q4SA 1R082 4KBZA 3GBGA 4COZA 3SC7X 1ZBE2 1X7NA 4GULA 5J09A 3H8XA 3JD71 1LGCA 3GCWA 1L7LA 1VRH3 4JGZA 5DN2A 1XB9A 3WHUA 5HCAA 5EJ3A 4ONUA 4FTEA 1CAVB 4XW3A 4KQ7A 1D2SA 1KFUL 2VCMA 2HWF3 2ZEWA 5C8WA 3JB4C 2WWSA 1OURA 4ZPIA 1RUE3 4Q4W3 3BTAA 1URXA 1S0JA 3BALA 3FL7A 5F6KA 4AHWA 1NY72 3WNMA 4ATFA 1KS5A 4N7IA 1H1IA 1MS9A 2PHTA 2H0VA 3K48A 1F31A 1LHWA 4Q27A 5CG8A 4OMDA 4XVHA 2RS11 2WSUA 2Q1FA 4Z92B 1HW5A 1ZYBA 2FZ1A 3OG2A 1R1A3 2JXAA 1KEXA 3OGGA 4Y1XA 1K42A 2DU1A 3AJZA 4E8CA 1X9TA 1UPIA 2XUEA 2DVFA 2UY9A 2IWGB 3R6SA 1XNAA 4UYBA 5A3WA 1CR7A 1J3RA 1VRH1 1EV12 1V9U2 4NE9A 4XILA 5CG9A 2ZA9A 5GZFA 3ZXDA 1VB4A 1V6OA 2MEV1 1VPHA 2TUNA 2C26A 2VQTA 3B5LB 5DUUA 4NIIA 3RPQA 4A45A 2CSGA 2ET7A 5LA1A 4XHBA 4BH9A 2FCVA 5FY7A 1D7PM 5FZ4A 1L7RA 2WFF2 4XHXA 3JUUA 4DRVA 4QHZA 3B01A 4R9CA 3QD6A 4QXCA 1SLAA 3NRUA 5IVEA 3VV1A 3ZN6B 3VB9A 1O7FA 5IVYA 4LBLA 1TG7A 2WSVA 4Q4Y2 1JZ2A 4XDQA 5H9QA 2IXIA 2WAAA 2ZZJA 3H42B 2HEVF 3KMHA 3MGUA 3AXEA 2RDSA 2B7YA 4JRAA 3MV11 4LHSA 5KC5A 3NO8A 1QKQA 1N47A 4RS5C 1NE6A 4CVUA 1NAEA 2HWB2 3K4ZA 2XXZA 3AKSA 4QKBA 5FUIA 4EN0A 3AB0A 1ULGA 5JVVA 3P5BA 1IPJA 4XJ9A 2X53S 5C4WA 2JE7A 3SXWA 2VECA 1VBC3 3WDVA 1SLTA 3DN7A 3FZ3A 1JZ5A 5FYYA 1JYTA 3OUJA 1PK6B 2E6VA 4QB6A 5B2GB 5FWEA 2J7MA 2X29A 4Y26A 1QXRA 2FBEA 3ZLIA 2XBO3 1QHDA 5J3UA 4X6RB 3AKRA 5A80A 2F17A 3KHBA 4AFDA 3TN91 1ENRA 3KVAA 4XZPA 1OQDA 4RYDA 5EP9A 4DQAA 3AZWA 4I3GA 1XNKA 3HAGA 4HVOA 1AR81 3UYJA 1IS3A 1DHKB 1V6MA 1YFUA 2ILMA 2Z4FA 3SH4A 5F1RA 4LUMA 3H50A 2W0XA 4L9BA 3L9JT 1I1EA 3KD4A 5T5PA 3SKVA 2BFUS 3OGJA 1Q8OA 3IMNA 3LAGA 1JZ4A 3OD0A 1JOBA 4CZSA 1IS6A 3KV4A 5FPZA 1UXZA 4JDNA 3E6BA 1K45A 2RJ2A 4KH9A 3NMBA 5E6HA 1RUI2 2XB6C 1PO21 4IE4A 4OHXA 4IE5A 1AX2A 5KR7A 5L73A 5C8CA 1JXNA 4JHZA 3UK9A 4BE3A 1G8WA 3AZYA 3DPRB 2VU9A 2JECA 3GHNA 4P9YA 4IEXA 1COV1 1ZRIA 2CYFA 2DYCA 2VNGA 3MIBA 4K8FA 5LA2A 2DCKA 3G6JB 4CU9A 3Q8EA 4KWKA 4LQRA 1JYXA 1UNBA 3WF1A 3D6EA 2V4AA 5KHJA 4LKSA 1LOBA 1NT0A 2V5DA 3CZUA 5C3RA 3SH3A 3VD3A 4D6SA 3HVDA 4XAEA 1SFYA 3ZXFA 1SACA 4IV1C 4I01A 1W8ZA 4JGYA 4M3CB 4P5YA 4AVTA 1VBD3 1UIKA 4ZS2A 3KCXA 2VW0A 1VBB1 5T50A 2R071 3ILRA 4F3JA 4AI2A 5EQUA 4GXLA 2BWCA 2WA3A 3I3QA 1VBA3 4GB32 2BRTA 3WZ1A 1H2NA 3LF7A 1OLQA 1QJU3 2A3YA 3VKMA 4AGRA 4PI0A 4DXTA 4LE3A 1XE7A 4PLMA 4AWDA 3WNXA 2XH6A 4FPOB 5EZWA 4A2UA 4AAXA 1YFXA 2WN2A 4AK3A 3DCQA 4KL1A 2WABA 1OUXA 2ZGRA 3HT1A 3JQWA 1HV0A 4XBLA 2XJUA 5LK7B 4XUNA 1W9SA 3BTXA 3U37A 4Q26A 2W47A 4QQ2A 5FDBA 2ZGKA 1YQ8A 4YFWA 4CEWA 4CUGA 1OF3A 1RUJ3 2AUYA 3RYKA 3ZM8A 2VZQA 5BNNC 1WA6X 2WZR1 3GDBA 1C3HA 1MPXA 4COWA 1DZRA 2VMFA 1PVXA 4HL0A 1G9FA 2EXHA 3SEEA 5GZGA 5DUXA 4K3UA 2HWC1 4JV4A 3W21A 5C7GA 3O1PA 4FVVA 4V2WA 1VBC2 4Q4W2 1ZNPA 3NVCA 5JXIA 1UOJA 2FZ2A 3QACA 2XLGA 2YV8A 2ZKLA 1WLTA 3T2QA 4D7SA 3WEZA 4I30A 4Z1VA 4FPYA 1SLLA 1GBGA 3FE5A 2ZJCA 5I8TA 2XJVA 1OFSA 1OH3A 5FUNA 4P14A 3VHRA 1W2AX 3IAPA 4BQ5A 1I5PA 1DU3D 1WUVA 4OHZA 2SLIA 1SCSA 2VOVA 1UWWA 2EIEA 5I91A 5BNNB 4CEYB 2D5FA 1WLCA 1QY4A 1VIWB 1H1MA 4AYUA 5CADA 4S2FA 2OXBA 3B94A 3C8XA 3ON7A 2ZX4A 4CXWA 3BTYA 3ZVXA 2YXSA 3ABZA 4NOTA 5L7OB 1J84A 5CA6A 3C7FA 2QUOA 1ND2B 3DPRC 1QXPA 5EWSA 3ZFFC 3V65A 4Y20A 4COUA 1UQXA 1W6QB 1UMHA 2VZ1A 1O5UA 2I45A 5FLJA 4QU1A 2WIIB 3SH5A 4B3NA 2VR4A 5IK4A 3OGVA 1G86A 2W2IA 3POSA 3GZAA 2Z69A 1UXXX 2JG9A 2B39A 2FDIA 4RD7A 2JDPA 3SITA 2P34A 4A41A 3LD8A 1WMEA 5C3QA 2D3SA 2D5HA 5FXZA 1GWKA 2YBSA 2RS33 3OEAA 2VO5A 1HXS1 4QU2A 2WZEA 1XNCA 2W1QA 4P9JA 1NA1B 4NJ4A 2VQAA 2HWD3 2Y8KA 2VUDA 5T52A 3P6BA 2E63A 2R061 1H6YA 4CEYC 2WNVC 1ND3B 1OLMA 1UN1A 1UD1A 1N1YA 3K3NA 3T08A 1EAH2 4R9BA 3VBUB 4OUMA 3FLTA 3ZN5A 2IXLA 2QQNA 1WZXA 3RWNA 3FBYA 1V6NA 3ES4A 3DXUA 4GMP1 3IT8A 3F95A 1SDDB 4AE2A 2TEPA 3JZVA 5E16A 1W06A 4P08A 4AXOA 1IG3A 1TQ5A 1UKGA 1WMDA 3BOPA 3MHZA 3KCYA 2AGSA 4Q0UA 4PDWB 3S0MA 2FDFA 3AMPA 1UX6A 1N1VA 4RR3C 4XFFA 5FZ6A 3MI8A 5DAWA 3WV6A 2DVAA 3I2GA 4B4PA 4FPHA 1U5IA 4F8AA 2WO7A 4CPBA 1FNYA 1GUIA 1OBNA 4NR1A 3VBSA 4DZGA 5K9YA 2VE1A 1UZ0A 3I3EA 5JOXA 1W39A 4A44A 1RINA 2XVLA 2VXRA 2E26A 2GC2A 2I74A 2CTVA 5DZGA 4PIZA 5FYVA 1JI6A 1JYWA 1VAKA 2ATFA 1HN0A 1MZEA 3DECA 2ZPXA 5D8AA 2R7EB 2HYKA 3U10A 3H8RA 5J37A 1E5IA 2GC0A 1J83A 3LEMA 1A8DA 1ZZ9A 3WVJA 2ADDA 3ROUA 4ZU5A 4XJWA 5C5UA 5DUVA 4LOSA 1VBE2 2E7AA 2H6BA 3TB0A 3JQXA 4LHKA 4G3YC 3SKJE 3X29B 1BHGA 2WO1A 2R16A 1QJX1 3FHQA 3IWZA 2X10A 5FYZA 1H2KA 2PHRA 3WDTA 3WT3A 3ZX7A 3QH6A 3KHCA 1S55A 4XBNA 5FMCA 3OPTA 4PDWC 1UCXA 4AL9A 3VBFC 4P00B 4RFRB 1SEFA 2PAKA 4XMIA 2UU8A 1CN1A 1GP5A 1JYCA 2VMDA 5F2SA 4CDQB 3O1TA 4W4ZA 2QQPA 4KGGA 2ZMKA 1QOSA 2B46X 1O3SA 1W0NA 2DBNA 2X5IC 2VCBA 4GZ9A 4H7LA 4IEQA 3J9SA 2CDOA 4WV8A 1NLQA 3ECQA 2WZPP 3PNAA 5I0UA 4N43C 4IGOA 3HQRA 2A6ZA 4PQQA 1X50A 3CJIB 3NV3A 2NMOA 4OYUA 1RUF3 1ND2C 5EYYA 3ZXKA 1RUJ1 4CDWB 3MUZ1 5KHKA 2Q1ZB 5KBFA 2WDBA 1ACCA 4QDQA 3ATGA 1D4M2 4AQ2A 2V73A 3HN1A 2ZACA 4Y1VA 5JLVA 1NCRC 3TOJA 2DCTA 1DBNA 1UOBA 1VJ2A 2YUEA 1W9TA 4U36A 3UJQA 1UU4A 1NQDA 4LK6A 2PHDA 5FZAA 3WINE 5LRRA 4YG0A 3K51A 5BNOA 4AR2A 1VBB2 3VBHA 4WVMB 3FN9A 1LB2A 2YGMA 3A4UA 4P9XA 5D8AC 4AFCA 1GOFA 4LA3A 5GLVA 1J1TA 1CVNA 1PK6A 5FLIA 1RUI3 3B9IA 4GB31 2A1XA 2X5IB 3GALA 1E5HA 1OLRA 4AEDC 3BKZA 3JBG1 4YVWC 3TEWA 2XDVA 3VBUC 1JHNA 2IUWA 5GALA 3ILNA 3ZN4A 2AC1A 3M3QA 4N53B 1RJ8A 1GANA 4LMFA 5CAZA 4HKWA 2VJXA 3A0KA 3FLPA 1UU6A 3OEBA 2CAVA 4DEQA 1AXKA 1V6LA 5DUWA 2Q8EA 2HWF2 1XNDA 3B3QE 2W52A 2W5FA 1VRBA 2Z5WA 1CZVA 1WCSA 4MYEA 1NZCA 3BVCA 2PHWA 2QBXA 5M0TA 5JMOA 3NNLA 5IT6A 2X09A 2OZJA 3SISA 1AF9A 3ILFA 1CAXB 2RS31 1H2LA 4Q0QA 4UBGA 4MV2A 1POQA 3PUIA 4RHV2 1HXS3 5FYUA 4Q0SA 5C3SA 3VBOA 2HEWF 1WW5A 4C0BA 2VBPA 3USSA 1AR83 1H4GA 3OBAA 3E5XA 3BUCA 2EXJA 2DCJA 4ZZ5A 4WM7B 1FPN3 1TMF3 4XFAA 3RGBA 4GWJA 2C9AA 1G7YA 4FPGA 5IK5A 4ES9A 1U5ZA 1UPSA 4QPYA 3WG2A 4IERA 5IVJA 4ZHNA 3B00A 4NRPA 5BNOB 4YLZA 5KXDA 4MXVA 2E51A 4QM8A 5KC6A 1V6KA 1BBT1 3RFRA 2IFRA 1AVBA 3ZMNA 2HWE1 1POV1 1T6BX 4J1XA 1GYKA 2WFF3 3E6DA 1H8TB 5CFCA 1E5RA 4NO4A 3AZXA 4QGLA 1DLCA 1COV3 2WZ8A 1RUD2 1UYPA 3ZFFA 4EWAA 2GP5A 1O8PA 1XOYA 1RC6A 3KSCA 4JGZB 5DAPA 1AL0G 1VP6A 3CJIA 3PTYA 3VZOA 4JKKA 3Q8AA 3R0RA 1W2UA 1ZBA3 2OQ7A 4AI9A 4AQSA 2JWPA 1L3JA 3A7QA 5IAXA 1XNTA 2J1UA 3AMMA 2VGDA 4K6BA 5DG1A 5FO9B 1MEC2 3RG0A 4M3CE 1GU3A 3VKLA 4W6WA 4CCJA 5GKAC 3I7DA 1CAWB 2DV9A 2QTWB 1W6OA 4YG3A 5LASA 1DQ5A 2JKXA 4WVZA 5JOWA 1BCXA 4MUVA 5FP8A 1LKNA 5HCFA 4C91A 1BBT3 1QNWA 4YM2A 5AVAA 1ULCA 1JU4A 3VBFA 3H8UA 3OBZA 3I2KA 4JC1A 4XCAA 3SCGA 3ST7A 4YZ1A 1X33A 5DDJ1 1OFNA 3H1WA 4EN8B 1C5IA 4NPMA 1HDKA 5KWRA 4LIUA 5JXHA 5B4XA 4D7TA 5JUVA 3FHIB 1BXHA 1JW6A 1Q8QA 1X8MA 3PURA 4W8JA 1ZBA1 4OQ8A 2WNUA 3GF6A 4ASMB 4XQDA 4Q8LA 1OA2A 3ZYHA 2ZMLA 3M3OA 1PVC3 2PYTA 4W6YA 2WRAA 4CCNA 5JSPA 5L9VA 2FMDA 1XYPA 3DUIA 1ND3A 3GBFA 2RMU1 1W8HA 3NKTA 4RGGA 4CCLA 4D8MA 4NRMA 3RZJA 1OOPC 3UKVA 1CX1A 2VZSA 5LEJA 1RUD3 2R1BA 3CL1A 1JU3A 3T09A 4PBOA 5JWPA 5A3LA 4Z2AA 1OPMA 1RUE1 5L19A 2OS2A 4XOGA 2A6XA 1EUUA 2DTYA 2PQSA 4ISRA 1VBA1 1GICA 2G19A 4GH4C 3VKNA 2BVBA 2HWD2 3MV01 1APNA 1IPKA 1YJLA 3UV9A 2VAUA 2YYOA 3WP3A 1ASJ1 1W9YA 2W94A 1MS1A 3VBRB 3WW1A 2WLPA 4FOWA 5APAA 3TWIA 1UY1A 4FP3A 4ZONA 2KA3A 3SQOA 1JZ8A 2UWAA 4BQ2A 1XSRA 5C9AC 1PGSA 4LJHA 3IPVB 2JIJA 2C1FA 5ERLA 3RYPA 1RL3A 5E88A 2WN3A 1W0OA 1UAIA 2PMWB 2D44A 4LOTA 2BERA 2BZDA 4Y5TA 4MLOA 4H7MA 1PGW2 1W9FA 3T4HB 4COYA 2G1MA 1FT9A 2D7FA 5FFOC 4M0HA 2WAOA 2HWF1 2AENA 1YC61 3JXSA 2VOTA 3H7YA 3K46A 4JGZC 3U0ZA 3OD4A 3THDA 3J8F1 1QJY1 2GNDA 1UMIA 1YI7A 2E32A 3KT1A 3DGTA 3IAQA 2PN5A 1KRIA 4BXSV 1RUJ2 2RR12 3FUQA 3FWEA 2YU1A 4OFGA 1I6XA 3W5MA 3AMQA 5FUPA 3KF5A 3ZPYA 3FBMA 3LWCA 1K5MB 4MXWB 4AG4A 4DEVA 4JHTA 2BQPA 4FOVA 4FTBA 3RWKX 3RNSA 3GJBA 2GN3A 1J59A 4XIOA 3O0VA 4UI9L 3ZYIB 2F4LA 3EMRA 1ULFA 1YQ5A 3KWVA 4AI0A 1NLRA 4WM8C 3V0BA 3WCRA 1AR71 1LHVA 2RDRA 3PVEA 5FQ0A 1Q3EA 2XKOA 4PJYA 5IVFA 3ZKYA 3SLIA 3ZSLA 4BQYA 3AZZA 4LKEA 5FYIA 4KGQA 5I0RA 2DCZA 2J1AA 4LBQB 2B8MA 5FY0A 5CFDB 3PUSA 1KFXL 4I3PA 2EA7A 4JDOA 2GZWA 4UW4A 4XMAA 5A7PA 1BBT2 2JDZA 4BYYA 1D4M1 2BYVE 4QAWA 4XZUG 1DFQA 1JOJA 2WFF1 1QJY3 3WP4A 4DUWA 3RMYA 1UY4A 5C5TA 1B35A 3D4KA 2IZWA 4CU7A 3ZXJA 4CSWA 1IQDC 2FHRA 4MGIE 5A6QA 1B35C 3V56A 4YZ5A 3I2DA 5FP7A 4M3CF 2LUWA 3LE0A 1VLNA 1C4RA 5CBLA 1ULEA 1RTVA 4L92A 3M4FA 5C71A 3PVBB 4DS0A 3AKPA 3KZ4C 1N3OA 2E9QA 2J42A 5F5CA 5K0UC 5LW9A 1DQ1A 2WQZC 4BOWA 4L8QA 1XE0A 4CDWA 2ZGNA 1YNAA 4JGYB 1F4AA 2GNTA 3HMYA 1XE8A 4L99A 1DQ4A 4G4FA 3NL1A 4X8NA 2ES3A 1BJQA 3NJVA 3RYRA 5FBZA 1TME2 2D98A 4A3XA 2ETEA 2XONA 1O4ZA 2QQMA 5LB6A 2E31A 2W3JA 4LBQD 1ZBE1 3N9OA 4A7ZA 2FCTA 3LKJA 2P3JA 1BKZA 1D0HA 2VZRA 4NAMA 2ZEXA 2ZHNA 2HWB3 1ODNA 1IOAA 2YBPA 4I2OA 5LEKA 3NJZA 4HFSA 4YG6A 1DYKA 1XYNA 2W9XA 1K12A 2XJSA 3OGSA 4PHZA 3KV9A 2GP3A 3FUOA 4NPRA 5CVRA 4BB3A 1ALYA 1MS0A 2P4EA 4DXSA 4JTNA 2XGXA 3EO6A 3MW4A 2PELA 4OHYA 2WUHA 3GM8A 3MIFA 2EICA 1KDMA 1Z7S2 2JG8B 3IZOA 4LEJA 1REFA 2XL7A 3T30A 3KGZA 2CGPA 1LRHA 4XEZA 1U0AA 1H8TA 2VCCA 3HOBA 4HSJA 1W3VA 1MACA 2FCUA 4MADA 3HD8B 3NV2A 2XLFA 4Q1PA 3CZJA 2LROA 4H3WA 4QHBA 1HQLA 2RG4A 2R043 5CB7A 3VKOA 1O6UA 2VZTA 1JOPA 2O1QA 2ZCWA 3R4DB 5FPXA 2JE9A 1BVVA 1RGSA 1UF2C 3LCPA 1KQRA 4CDQC 4C90A 3NQHA 3CF6E 3WCSA 4JTOA 2HEYF 4QHOA 3ZSKA 2ZGSA 5FY4A 3THCA 2YG0A 2PTMA 1SFNA 3U14A 2WC2A 3FMGA 2CNAA 3NAPB 1H0BA 4MGKE 2VZOA 2YDEA 4FFIA 2ZAHA 1OOPA 2WNVB 3AM2A 1ND3C 3IPVA 4QGMA 4A6OA 3USUB 3OTFA 2LTNA 5FZOA 2XQXA 3WQBA 2EAKA 5D1IA 1HV1A 1Y43B 2D6PA 3LA2A 3QBQA 1OUSA 2XJRA 1US2A 3I97A 2ZZQA 5LA0A 1MS8A 2MEV3 5C4WB 1Y3TA 4GAZA 3TN92 4CP0A 1AJKA 2RM23 3UGGA 2X05A 2VY0A 1OPOA 3WNNA 3NJYA 3EB7A 1PMIA 1NLSA 1Y4WA 2D6LX 1FI2A 3ETPA 1DLLA 3OPZA 4XJUA 3MF9A 2GMPA 4Y3OA 1NCRA 1ULOA 1X8EA 3T2OA 1JYNA 5DDJ2 3DKQA 1AR82 4NIHA 1LEDA 4EN7B 1YCIA 2AREA 2DURA 2I2SA 5FWJA 4L0PA 3THPA 3SEPA 1ND2A 3U4XA 2JX9A 3HIFA 2EAAA 4K1YA 1WBLA 2WZR2 3LOIA 1RJ7A 1GFF2 1OLME 2DDUA 1YIFA 4LKDA 4NHLA 2EF6A 5T55A 4FSJA 3I59A 1KDKA 4KWJA 1FV3A 1AL22 1AYM3 1XXNA 2VTXA 4CP9B 5AFEA 2ARXA 1FATA 4L97A 2HH9A 2YFUA 3OBTA 4D6QA 1GZWA 1X36A 3D82A 3K4AA 3WG3A 4K7JA 4CU8A 3IDCB 2W46A 4C1WA 4D6RA 1M06G 3PL0A 4A6SA 1F5FA 2XWBB 1GSLA 3KF3A 1DGRN 5CYYA 4HPKA 4LLOA 5IJRA 1Y9GA 2VNOA 2WS92 4YVWA 2HWD1 1RVF1 4FFGA 4QX2A 3V0AA 2VZVA 1OD5A 5GLZA 4FPJA 3VBFB 2PHXA 1HX6A 1LGBA 2EXIA 4URTA 2R0FA 5FKCA 1ZZCA 2BGCA 3KCCA 5F3EA 2LALA 2Z42A 2W68A 1HN1A 4LITA 5FV3A 3T0BA 3WDXA 3VN4A 3G7DA 3J26N 2R073 1PM7A 2WNEA 1QH6A 1GR3A 1W6MA 1W9WA 1W6OB 2Y6HA 5LCWL 1WW7A 4LO5B 2RM22 5CFDA 5FPVA 3TEXA 1KJRA 2WT0A 3Q9OA 3OYWB 4LTAA 2Z2SB 3ZO0B 5BXXA 3D5OA 2FMYA 4Q4V1 4QX5A 4CCKA 1WCKA 4HPKB 1OA4A 4XQ4A 3C7OA 2ZGOA 4XAAA 5LWBA 2Q8DA 1W8UA 3GYDA 4M4PA 1JTZX 4FQZA 1AUYA 4LT5A 3ZXEA 5ACA2 3MW2A 1EV13 1V9U3 5F37A 4N53C 5CKQA 1YJKA 2ZTNA 3BODA 4QPWA 3I4IA 3H9AA 2GH8A 4EQVA 1FMD1 1R093 2QQOA 4X6QB 2BUKA 4CXXA 3V0AB 1EAH1 3I59B 3MLJA 3W20A 5J48A 1SCRA 5F2WA 3N9LA 1DCSA 2ZGLA 2DU0A 1PNFA 3IIAA 3N9MA 1FOD1 4DRRA 2BNOA 4KBBA 3WOGA 3VDBA 1RUOA 2QZ3A 4GMP3 1C8NA 3INAA 4ZXEA 3POWA 4LO4B 4AZZA 4K9SA 4OVEA 5FYMA 1WGPA 2JICA 1PK6C 3ACFA 4B8EA 2JG9C 1QOOA 5IK7A 2CHHA 4HKOA 1PNGA 1ASJ3 1XPWA 4JQTA 1W8NA 2OIIA 2QVSB 2BTVC 1S2KA 4Y1UA 3FFZA 1JZ6A 4XC9A 4DNYA 1DDLA 1GKBA 4JCKA 1ZZBA 2VOXA 4YZ3A 1HRV1 4CE8A 3TYJA 1NA1A 1SPPB 3UESA 1SPPA 3N7MA 3KLSA 1JBCA 3ZFGC 1GP6A 4QGNA 4PF5A 5LBEA 2VNVA 1LHOA 3LPFA 4LLFA 4Q2FA 1O3RA 2VZPA 1C8M2 2AZ5A 3MUY1 1QMJA 1OOPB 4AFBA 4GA9A 2YPDA 5TSWA 4GWNA 4IL7A 1NZIA 2NMNA 1GZ9A 4Y24A 5BPXA 2WR9A 3C3VA 2WZR3 3PUQA 1LJ7A 1HRI1 2HBUA 3H3UA 1AR61 5CIRA 4EN6B 3A0NA 4HLTA 1JZ3A 3WG4A 3IDBB 4RQPB 5GZDA 3WW3A 2X5IA 1F9KA 2ZGTA 4M00A 5FLHA 4BHPA 5FZIA 4MGTA 1QJX3 4PLOA 1Q56A 1QJU1 1SHWB 1V6JA 3O7OA 1OXCA 1PZ9A 4Y4RA 1H8TC 3WNKA 1PO11 5BV6A 4CEYA 5IVBA 2BVVA 2W39A 3AXDA 4V2VA 1CIYA 5FY5A 3GXUA 1S0EA 2V5YA 5IUQA 1SBFA 1WLWA 2XUMA 2JDMA 3RS6A 3MIHA 1UU5A 2WL1A 4GALA 3VDDA 4IV3B 2P5BA 3O1MA 4B4QA 2Y6GA 3N9QA 4IEUA 2PAMA 2PXJA 4HK8A 4CEWC 1LHNA 2C4XA 2WA4A 2W08A 4IEZA 5IW0A 1W6NB 2EVXA 3OYWA 4BQWA 3U78A 3K4DA 4Q4X3 1KS4A 5IWFA 4R4XA 1WD3A 3PMSA 2YHJA 3TN93 1GQGA 2PLV3 3D0JA 3SCHA 1R1A2 4TXWA 5DQ0A 3K3OA 3FFQA 1W8TA 4XABA 1V6IA 1LU2A 4FXGB 4P02B 3RZMA 3P3NA 2VMGA 1WCQA 1ZZ7A 4DUVA 3C7EA 3T2PA 3WF3A 1V00A 1S2EA 1MZFA 5GLWA 3OF1A 3RZKA 1IKQA 1XJAA 1ENSA 2ZGUA 4BQ4A 5FP4A 2VG9A 1F2NA 1QJZA 5FKBA 2R063 4KWLA 5HPOA 3DYOA 2PAEA 4N8MA 1CX4A 2GMEA 3KS7A 4BU2A 2RJKA 2NYYA 4KNCA 2XHKA 4GIQA 4AVAA 2ZGMA 1YLLA 1SLBA 2P37A 3NWKA 5CKMA 4O9GA 4ISQA 4FQ4A 4Q4Y3 1LHUA 3NNGA 5J7MA 2RS32 3KB5A 3Q8BA 4BIFA 1ZBE3 3N35A 3IDEA 3MLKA 3O0WA 3NNFA 4HONA 3WY6A 5A7OA 3ZSEA 4Q8KA 2IVIB 3ACLA 2MPFA 4E2SA 1N3QA 5AC91 5C33A 1CWPA 4GD4A 1BZWA 3WDUA 4MO3M 1N3PA 5FZ8A 2JE8A 4K40A 3AVRA 4QT6A 4FPLA 3WD5A 5KXCA 1I5ZA 1EV11 1V9U1 2V72A 2VTFA 4BMBA 1RMU2 5LY1A 2JB8A 1DF0A 3VGIA 1BMV1 1JODA 1GV9A 5J96B 1Z7S3 4TLGA 1W90A 1G9CA 3GZEA 1WLDA 4XQWA 2OW4A 3OUHA 1GOGA 3VD5A 1YHFA 2HKXA 3SCFA 4AVVA 1UYYA 1QQP1 5FXWA 3VDAA 5A3NA 1FPN2 1TMF2 2RDNA 2XG3A 3B02A 3GJAA 3J7NA 3UETA 3B7MA 4XFCA 3POGA 5F32A 1AR92 3GHMA 4E9KA 1BK0A 4UOJA 1RXFA 2GN7A 3E5QA 3ZFEA 4BIOA 1H8VA 3ACGA 4XYXA 4UFIA 3LOBA 1SDWA 2BBVA 3ZFEC 1W6QA 3IN9A 2D6OX 2YC4A 2ZMNA 2YC2A 1QDOA 3I2FA 3H8OA 4XPVA 1UYZA 5AFBA 1RVF2 4PIXA 5L7OA 3RZLA 5IVVA 3URFA 4I0WB 4RS5A 4IE0A 3MEPA 4QPGB 5EYXA 3UKTA 4URAA 5JDBA 3AZVA 3NV1A 5E8AA 5JSOA 4U2AA 2ZEZA 3DV8A 3E6CC 2D6NA 4IGQA 1UL9A 5A6ZA 2JDUA 2G9ZA 4ET7A 2C24A 5FYTA 3MPPG 3AK0A 1WD4A 1OT5A 3N7LA 1KD7A 2AYHA 2VMEA 4H55A 3VL9A 3RJRA 4YM1A 3OBRA 2A75A 1AHSA 3FX3A 1S0CA 2D6KA 3GGLA 4YW2A 2O8QA 4HN1A 4IV1B 1RUI1 1J3PA 1SFPA 2E33A 1AJOA 2BGPA 3NAPC 4GB33 3KGLA 4UW3A 1C8M3 5DAVA 4YFZA 5KXBA 3O1VA 5K0UA 1ZRFA 4D7YA 1T2XA 4GQ7A 3ES1A 4QDRA 1OH4A 1QJFA 2DBIA 1VBD1 3N3HA 4WZCA 4FT8A 4JZRA 1W2OA 2BP6A 2Y0IA 4HG6B 1LOAA 1AL23 3J7LA 4BPZA 2W91A 2VMIA 5FPAA 3BU0A 1Q8PA 2B9UA 4JGYC 3BIEA 5F3IA 1J3QA 3LIGA 4YZ2A 4TYSA 4O61A 4IESA 4C8DA 1YXWA 1OKQA 4EE2A 1IG0A 4A7KA 4QX8A 2W95A 1J58A 2P3KA 1SMVA 1E57A 4LORA 1C57A 2YMZA 5DZEA 5F8PA 3WDYA 4CDUB 5D2AA 2JKBA 3FC0A 3WNLA 5LA9A 2FDHA 1HB3A 5JCTA 2E53A 1OI6A 4ZU7A 3O1SA 4QKNA 3HBZA 3CBNA 3MPBA 4LO8A 2OUHA 4WM8A 1Z78A 2WWUA 2ZHKA 1HRV2 2Y34A 3M2MA 4K8RB 3UNPA 4YVSA 3VD9A 1N1TA 3ITQA 5CISA 3GBWA 3N9NA 4F83A 1RMU3 3CJIC 3T3YA 3PDQA 1MR5A 3AL5A 1TNFA 1VMJA 4DFSA 1MEC1 3OJBA 5FY8A 1LOFA 3PUHA 2R30A 5FMDA 4XJ8A 2FD8A 5JR7B 4IQPA 1T6GC 1RUH3 1OKOA 5FZLA 5SV5A 3KVBA 4N90A 5HXMA 3ZDSA 1REEA 2D93A 4MGQA 4EROA 2ARBA 2P2KA 5BNPB 4NHXA 2A70A 2Q1MA 4E2QA 3DL3A 3AYDA 5FYSA 3AYCA 4IV1A 1ZZ6A 5JMCA 3UGFA 5A70A 3BTZA 4IEOA 2OVUA 3W9AA 4BLJA 1HQWA 3IB3A 1UKRA 1BK1A 1IHMA 2QE3A 4XBQA 4YVWB 4EWEA 3T0DA 4P9LA 1AR72 5FR3A 3LSEA 5FJHA 3R4UA 1FNZA 1GQHA 4Y22A 2A71A 1FOD3 1LODA 2Y60A 1H1AA 2DUPA 1RUNA 1JUHA 4GKYA 1Y9MA 4AAPA 2OQ6A 1WA4A 5FYBA 3WP6A 5A7QA 2HYXA 5FOJB 4QDSA 1CGPA 3PIJA 1OQEA 4MGZE 1O59A 3CJXA 1LENA 1VRH2 3B93A 2RV9A 3LQCA 1OVPA 2RMU2 2RE9A 3B69A 4GH4A 4CP9A 4K1ZA 1LOFC 1G9BA 1XRUA 4YW7A 3MO4A 4QD2A 1SZBA 1CAXA 4CCEA 4CTEA 3KV5A 2R0HA 1ULPA 4FPEA 2ORZA 4SBVA 3ZFGA 4GMP0 4YGBA 5FZFA 5FXXA 3C7GA 2IXHA 2YY1A 5FZ3A 2VOKA 4XTPA 2J1TA 4R9AA 4Q4X2 2HBTA 5F6LB 3AP9A 1CQ9A 4EWDA 4CDXC 5FY1A 4B1LA 2EXKA 2A73B 2ZX2A 3AKTA 5FPBA 2O14A 1PIV2 1DYOA 2GDFA 1LU1A 4RHV3 3VHNA 2E7QA 4UW6A 4E27A 3DKWA 4I09A 5C3OA 3CEWA 1PGW1 4YZ4A 2VCAA 1RITA 2BV4A 2XLAA 1NCRB 4E4ZA 1DP0A 3J8F3 1Q43A 3R4SA 4J6GA 2JDNA 4B7KA 2DUOA 1PO13 2DVBA 1O5LA 5SV8A 2BEOA 2VTXJ 2B42B 2R062 2WO3A 3RRDA 3ZIWA 1QJEA 3LA7A 4XCBA 4Y4YA 5F5AA 5HBAA 3J4UH 4R9DA 1H9PA 5LY2A 5FMOL 4Z07A 3NV4A 4BQXA 3R05A 3USUA 4BA6A 2AEZA 2ZAAA 1OC1A 2WNOA 1Z0HA 4IW3A 2A5ZA 4RS5B 5AC92 4FFHA 2OA2A 2P3IA 4GKXA 2BU9A 1A8MA 1AR91 2VVDA 1JN2P 3T1LA 1ZRRA 3POIA 3T0AA 5CU1A 3MIGA 1F4HA 1OHFA 2K9ZA 3I8TA 4QX3A 2CDPA 1GZCA 3ZYPA 1AR63 1V0AA 4SLIA 4YW4A 4GWIA 3WX5A 4CDXA 1VMFA 5EIYB 2WYSA 3W5NA 3W58A 5JOZA 2XR4A 3HEIA 3MIEA 4LBJA 2Z79A 2VMCA 4KWUA 5I8SA 2HWC2 1SQ4A 1NCQB 4XFHA 5F5IA 4BM8A 1FPN1 1R64A 1TMF1 3GCXA 4KG0A 4Q4W1 2VNRA 2OPWA 4XETA 1Q8SA 2YU2A 2B4KA 5FZ0A 4YPJA 3THTA 1GP4A 4LIVA 4PLNA 5LK5A 1PX3A 2ZX1A 4IEYA 3L2YA 2WFPA 3EYPA 5L36A 3VBSC 2W1UA 2ZHLA 3WUCA 1O3QA 1IGOA 5FZCA 2XPJA 2QQVA 4COVA 2R042 3CMGA 3O1RA 4ZU4A 1QJX2 4RFT0 4M0NA 1AR73 1EYBA 2CU5A 5A3OA 3RMXA 3JB8A 1JHJA 1FYUA 4Q5OA 5FZDA 3UGHA 2IXJA 1WBFA 1UOFA 3U4SA 3KT7A 2XBO1 2VUCA 3WF0A 1CONA 4E4HA 1NCQA 1P8JA 4XUTA 1OQ1A 1RUG3 2PLV1 3IM0A 1MS5A 3WQ0A 1YFYA 5EFUA 1BLZA 3Q8FA 1RUH1 3AYEA 3LPGA 3WUDA 3VDDB 4EYUA 4AEDB 2VUAA 4MGYE 3POEA 4RSUA 1RUC3 3MICA 5FAXA 3PVOA 4IE7A 2C9KA 3VBSB 1LAJA 4FI9A 1TZOA 4OI0A 3WP5A 2W92A 3I2JA 3LDRA 1W05A 3VBOB 1S0FA 4AFMA 5IATA 1Z7S1 4PI2A 3VBUA 3I3DA 4O9EA 4YVSC 3SNMA 4LUKA 4RQPC 2H0BA 2P17A 2A3WA 2FQPA 2P6HA 4QPIA 2V4VA 4QKFA 5DDJ3 3RZZA 4AFAA 1D0GA 3FHAA 3KV6A 1X82A 4LHNA 5DMYA 4UFJA 3DXTA 4RQPA 4NPLA 5A7WB 1WCDJ 2A6YA 4A4AA 5F3CA 1IPSA 1NOVA 3ELNA 1RUG1 4KU8A 5FCCA 4XACA 3E5UA 4O65A 2Q0AA 4QM9A 4NHMA 2A6VA 3T2TA 4WM7C 4Q0VA 4YW6A 1DQ2A 3UT0A 3ZYRA 2IVJA 1Q8VA 4LK7A 1V70A 1AYM2 1LOCA 2UYBA 2WWJA 3OY8B 1R092 3VDCA 2DCYA 5FQ0B 3VBOC 1YI9A 4HK9A 4NROA 1JMUB 1G6NA 1NXMA 4WVMA 4CUBA 4YSFA 4TN7A 5B4NA 5JZGA 2AEYA 4IV3A 4UF0A 3ZYFA 4S2DA 1W8OA 2P3YA 4OHVA 3WNPA 2WT2A 3VZNA 3VLBB 2WQ8A 3HPNA 5J36A 3ZMOA 1CD3G 1S0DA 1ZRDA 4DOUA 2WS93 4DIQA 4RHV1 4ZS3A 1K5MA 1RB8G 3UKNA 5C3PA 1H9WA 2WQ4A 4IEVA 4QX0A 3ZXLA 4UAPA 2JIGA 1OVSA 3BOWA 1PO23 3PVNA 4Z82A 2PHUA 1MQTC 3ETQA 1SLCA 4GH4B 1XU2A 2IXKA 2NN8A 3N7JA 4UWDA 5G04L 4AW7A 5K8SA 4IXLA 4JX0A 4HT1T 1LCLA 5FREA 5JPMB 2RS53 3VBRC 4OLLA 4TLFA 4RL7A 2ZOEB 1IQAA 1W2TA 5BNNA 2UWBA 2Y6FA 4XFGA 4CCMA 5A33B 3VD4A 5KHHA 2WLQA 4GWMA 4XUPA 4DMIA 4I0AA 4Y1ZA 2XL9A 1HXS2 3CLPA 4Y5SA 3I2IA 4CP1A 1H30A 3VBRA 1AL21 5LBCA 1VAVA 1VR3A 3H1YA 2XVKA 3S7IA 5ABJC 2VOWA 2H6CA 4OCTA 2QQIA 3CU7A 5L7OC 5IK8A 2EIGA 1W28A 2VC9A 5G05L 3ASIA 3KQRA 4XJAA 1N1SA 3FLRA 4QX7A 3AYAA 3QLQA 2DUQA 1D2QA 1JYVA 4YGEA 3Q8CA 1PMHX 2ET1A 5K7PA 1MZ6A 1PIV1 4HBNA 5FP9A 4E2GA 4ITCA 1W6MB 2KXLA 1C28A 2BNMA 4MZUA 2D6MA 5F3GA 2LS6A 5FZEA 5KXEA 3ZOIA 3CKHA 1OMIA 2BDRA 3O1OA 5FXVA 4OI4A 2WKKA 4FO9A 4P9GA 2NLRA 4RA0A 1KJLA 3PTRB 5DAXA 3GZTB 1LULA 2VZ3A 2WNUB 1XSQA 4HANA 3TEYA 1W3XA 4PDWA 1C8M1 3JCIA 5ANQA 2GNMA 1ONAA 2YPJA 3W59A 4WM8B 4Q4X1 5GJ6A 2RMU3 3I2OA 2AACA 2ENRA 4M3CA 4OUSA 3ZSMA 4EZHA 4ZXKA 3UL2A 1DZTA 1DIWA 1BEV3 4FPKA 1RHI3 2B9VA 3LEIA 4W6XA 2KD7A 3OB8A 1NYWA 4AEDA 1DQ0A 4XDOA 1QEXA 2BBAA 3BU7A 4ARYA 4CDUA 2QJVA 4CCOA 4I02A 4A3ZA 1JZ7A 2OX0A 2XKPA 4MSVA 5EXOA 5FIXA 1A6CA 4CDUC 4Z8BA 1JS9A 3VZMA 4WBBA 1LNSA 3PHMA 1W8FA 4HXCA 4OZXA 1ULDA 3APBA 1OF4A 5FO8B 4O7XA 2CGOA 4QWNA 1FV2A 2F6BA 5GZCA 1FAYA 4FOQA 3VD7A 1ZA4A 1O8SA 3EBRA 5FZ1A 4RR3A 3RDIA 1A78A 4JRLA 2QQJA 3CQOA 5FZ7A 4BQ1A 5C6CA 1YUDA 4AF9A 1W2NA 3NW4A 1O91A 5JPNB 3MF6A 3I3MA 4MG2A 3LZZA 4C0HA 1ZA7A 3L2HA 4META 5K0UB 1CAWA 1DGWX 2Q5TA 3CNAA 4S2GA 1DGRA 2HWE3 2OYZA 2ORXA 5FZBA 2VD7A 2P6CA 3HNMA 5A33A 3TBDA 3ZFFB 3RQ0A 4QB1A 1FOD2 1I9RA 4Q4Y1 1PZ7A 3NJXA 1MQTB 1TNRA 2GMMA 1VE0A 1RXGA 1PVC2 3AL6A 4PQ9A 5IHRA 1YFWA 5LBFA 3S5QA 5BYNA 1HB1A 4WZFA 2J22A 4NWWA 1UY3A 2F4PA 4NHYA 5FRAA 5IFPA 1U5XA 5C70A 2IC1A 5FK8A 3H1MA 4YNIA 4XUOA 1UZYA 3WDWA 3T1MA 4OMCA 4CUAA 2XJPA 3AP5A 3HBKA 4QXBA 2ZKNA 3AFGA 3BB6A 4NRQA 1WMFA 3LFIA 4PF1A 4NIDA 4NAOA 3WG1A 1GMMA 2PHLA 4N43B 2PLV2 3H3LA 1CPNA 4LXLA 2VVFA 2QKDA 4HMZA 2JG8C 4XUQA 5FYHA 4Q1RA 2DF7A 1RUH2 2V09A 2YGLA 5A3MA 5GLUA 5JXJA 1QJY2 4BK5A 5DAQA 5K4LA 3VHPA 4BLIA 4QXHA 4JVAA 2DVGA 1A34A 1DQ6A 1W8WA 1CZTA 2R32A 1CPMA 1M4WA 4LHLA 4BDVB 3I54A 3TEZA 1LOEA 5JIUA 4FOYA 1HLCA 3WF2A 4BISA 3WSOA 3ACIA 5J1XA 3WR0A 3BGAA 1QJU2 5EV7A 1NY71 3ZR5A 5CZKA 3OOXA 4E8DA 4Q0PA 1F8VA 2NPIA 1AYN1 4TSVA 4A7YA 1C1FA 1WKYA 2AH2A 2RS13 3RI8A 4B1MA 2WNUC 1POV0 3OY8A 2RS12 2W1WA 1YO8A 3ZSJA 3HQXA 1IS4A 4QPIB 5FPLA 1QF3A 5HCBA 3RZGA 4BXFA 3MIDA 5JI7A 1GNZA 3WW4A 5F9TA 3VZJA 1G9AA 3TNPB 4NIGA 5FO7B 1COV2 3QOPA 3ZN6A 1S2BA 5EHDA 1RUG2 2DWRA 2L9LA 2RR13 3VBHB 4ARXA 5DXDA 3LFMA 5CKNA 5A7WA 5FMOS 4QX1A 3OPWA 5I93A 1YQ6A 3OGRA 1MVQA 4W50A 1HB2A 4FPFA 1RUC2 3LGRA 1U5YA 1OSGA 4C1XA 4QQPA 2YC0A 1ZREA 4D69A 1J1LA 1R1ZA 3A23A 3ZYGA 3P1IA 2ZBJA 5BUVA 2R072 3MFAA 4AEMA 3RZHA 3NKGA 1EPZA 4WVWA 5GM0A 1O4TA 2RJLA 2WINB 1O3TA 5FYCA 5IAVA 3BYWA 1GNYA 1O4YA 2RVAA 5JR2A 2JJ6A 2BOJA 1UO9A 3ORJA 5FZKA 2VBBA 4OZOA 4BK4A 2UY8A 4BMEA 3PJYA 3S57A 4Q29A 1AX0A 1R1A1 1RUF1 2GAUA 2CWSA 1BVP1 1LR5A 4TWTA 5FJKA 3ZKUA 2NQYA 4D3WA 1YRZA 5HCHA 3J8F2 4FTSA 1PX4A 5C8CB 2QQKA 2Y0OA 4CDQA 1QNYA 4HN0A 5A7NA 1HKDA 4LBQA 4K20A 1ZX5A 3ZXGA 3VHOA 4AI8A 1CAVA 3LEGA 1RVF3 3IIIA 1UY2A 2FDJA 1AZDA 4Y5Z0 2W87A 4YW1A 4AGVA 5D8AB 1ZVFA 2OT7A 4AHXA 4HVRA 1EY2A 1GWMA 1HJFA 4NHKA 3TRSB 1ENQA 4AQ6A 4CDXB 4AI3A 2JDHA 1IS5A 4ATEA 1WWYA 2NZ9A 1TME3 3I49A 2LM3A 4P9IA 1YQ2A 2OZ6A 4PT6A 3VL8A 4DY3A 5C9AA 5FPUA 3JBG3 1D4VB 4XF9A 4OHWA 4MHUA 4YW3A 5LZ6A 1PZ8A 1RMU1 1FX5A 3POBA 2CV6A 4TZDA 2DTWA 4CYDA 4LR4A 1BMV2 3LB9A 5FZ9A 1STMA 1MEC3 1YYNA 4PBPA 4RGKA 3M70A 2VMHA 3HT2A 1BEV2 2D3PA 3CHXA 5C8CC 3D8CA 2SBAA 2LW8A 4R52A 1HQNA 3EHKA 2WT1A 1QQP2 3I2HA 5FTTC 3VKFC 2WBKA 1PGL1 3MDPA 3GZUC 1VBC1 4YYOA 5JSRA 1XC6A 1PMJX 4XIKA 2VPVA 3MFCA 1SBDA 4JAAA 3MLLA 5EPAA 3M7AA 2VUJA 2GALA 2D97A 2OUJA 1XU1A 2ERFA 1FXZA 4YW5A 1GZTA 3PMEA 3IKWA 1UZVA 2VXJA 1CESA 1EP0A 3WF4A 1ZM1A 2YROA 3I3BA 1WW6A 2VM9A 2A3XA 2UURA 4QKDA 1W99A 3HNBM 1DYPA 3WQ7A 2WJSA 3PUAA 4CDWC 3VBHC 2PA7A 5BNOC 2CY6A 4NVPA 5T54A 3MBWA 3POJA 3MW3A 3N9PA 2G9GA 2RHPA 2WYFA 4LA2A 4AOCA 3DF0A 4R8HA 3ALQA 1QXJA 4K21A 1KGYA 3S30A 4AEJA 4B7EA 3PLQA 4V1PA 3PIGA 3VZKA 4DPNA 4Y20B 1CAUB 4UFMA 2Y6KA 2GC1A 3M3CA 4UXAA 3AJYA 1LGNA 2UWCA 4J25A 2Y64A 1EUTA 1K3IA 2QQWA 3ME2A 3U75A 2JG9B 3U1XA 4N43A 3S6PA 2GNBA 4BCUA 1NUKA 2QNKA 1UMZA 3LIHA 4HKLA 2BW8A 2R6QA 3NSTA 4UFKA 3BPSA 2GH2A 1AX1A 3ZIXA 3VUOA 1NE4A 1ZRCA 1RHI2 2BWAA 1PVC1 1AYN2 5EJ1B 1GWLA 2RR11 4AQTA 5A1AA 1VALA 5FP3A 1SLIA 3U11A 5I0TA 4CCDA 4S2HA 3JD73 1VBD2 2ZGQA 4UF0B 4LULA 5I0DA 2Q30A 4FP2A 3DYMA 4Z2WA 2Y26A 4UFLA 2OKXA 4IE6A 5HI0A 2HLEA 4CPBD 4XTMA 3ZXAC 3T4VA 3AVSA 3O14A 2BFUL 3B9CA 5BNPA 2AR6A 3TAYA 5ISLA 3ZYBA 5CFCC 1F15A 3RSJA 2GSYA 2WS91 2Y6JA 5DABA 1VB2A 1NQJA 4R4ZA 5IVCA 4ASLA 1HJGA 3A21A 4XF0A 3VDDC 4DUXA 3EQEA 2DFCA 3ACHA 1DGWA 2O0OA 3OCPA 2PHFA 4TTGA 1NXD1 5FZMA 1QWRA 2G9FA 5FK7A 4BZ4A 1F5JA 4P5HA 2XMLA 3WQ1A 3AKQA 4LPLA 2RS51 5KHIA 4E4DX 3HN3A 3WLUA 3ZPOA 4YVSB 4XURA 2QDRA 4GJZA 5DPNA 1Q5OA 4P9WA 3PU8A 2J1EA 2BJSA 3IDAA 3LDBA 4YRDA 4AVBA 4L11A 2TNFA 4AHYA 2J1SA 4CEWB 4X8PA 1SBEA 3ZYJB 3N7KA 3AX4A 3SHRA 3BN6A 4HVQA 5T5LA 1L7QA 5CFCB 1HB4A 3J7HA 1DGLA 3HQUA 4MVTA 4FXKB 5GLTA 2YFZA 3D3AA 1OD3A 1LOGA 1PHMA 4UFHA 2CAUA 5ACA1 2D43A 2LRPA 5A32B 1CZSA 4XFIA 3HWJA 1TME1 4XXAA 2BPA2 1UW8A 3RI9A 4B4RA 3V64A 3S5AA 1UYXA 1PIV3 5LATA 4D94A 1IZ3A 2ARAA 2J1RA 2Q8OA 2Q8CA 3EXUA 5C9AB 4I0BA 1AXYA 1TVGA 4LBOA 5DG2A 3C7HA 2D3RA 1OA3A 2XWJB 4UW5A 2E7TA 4QQOA 2ZHMA 2B45X 3N36A 2JD4A 4B29A 4CA9A 2NM1A 2ZGPA 3OUIA 3O1UA 1HIXA 4XXPA 1UX7A 2Y6LA 1CAUA 4JKMA 4LO6B 5F5QA 4BQ3A 1MS4A 2B5HA 4N9HA 4QPGC 2DVDA 2VH9A 5IFTA 2WO2A 1WW4A 3DPRA 3H7JA 4N9IA 2W1SA 5H9RA 1BEV1 2A7AA 2ZX0A 4FFFA 4MOAA 3LA3A 3S7EA 3U07A 3IBMA 3OSDA 3QCWA 2GC3A 3DEMA 4ORFA 4OULA 5AC93 3QH7A 2CL2A 5I8YA 2IFWA 5LRSA 1RUC1 5T5OA 1W6PB 3MYXA 1K5MC 2PFWA 4N53A 3ENRA 4HSLA 2O8OA 1A3KA 1EPWA 1U12A 3CDZB 3JBG2 5FZOB 2RDQA 4J1WA 2ZABA 3M3EA 4IV3C 1W6NA 1AR62 2QDNA 5ABJB 2JB4A 1W0PA 2XJQA 3NAPA 1UZZA 4QQHA 4CCCA 2BGOA 1NX9A 3H3ZA 4JQRA 5ANNA 4WM7A 1YEWA 2C6SA 2VQ0A 5CFDC 1VBE1 1YWKA 1RUF2 2XBO2 2XJTA 4YM0A 5F39A 3AMNA 4YWAA 5BY5A 3LDKA 4LKFA 1AXZA 2QFEA 1GNHA 4QPGA 1LEMA 3PJQA 3GNEA 5JZGB 2N7GA 1QH7A 4FAGA 2JG8A 4JDMA 4FAHA 4MH0E 4G9SB 5GZEA 4Q4V2 2P1BA 3M1HA 4LBMA 4AVSA 1S0IA 2HJIA 4W65A 1FMD2 4XF4A 2OPKA 4YGDA 5J98B 5A3PA 4LNVA 2HWE2 3LSDA 2BNNA 4PCRA 3N4MA 1XBFA 2IXCA 3CO2A 3ZFEB 5FBJA 3AP4A 5JI9A 2TBVA 2R1DA 4CP2A 5BNQA 2JDYA 1SG3A 4MGSA 1RUD1 4QB2A 1VBB3 1W6PA 5DZFA 4AI1A 1H6XA 3D0SA 1XNBA 4IUGA 5A1LA 1S1AA 2YBKA 1W04A 3WNOA 1UZWA 1QIQA 4INDA 5T5JA 1REDA 4NN0A 4DXRA 3P3PA 4F7ZA 2QQUA 2XHNA 3H0OA 1US3A 1QOTA 3M3IA 2VL4A 3IMMA 1CJPA 4EJRA 3HR9A 3WXPA 5L9BA 2FDKA 5JZGC 4YGCA 1HRV3 3O5SA 1PGL2 5CNAA 2A6WA 2HWB1 4GJYA 1E5SA 1R081 3O0XA 2MEV2 1QU0A 2KM2A 3BI3A 4ZY9A 2CGNA 1AYN3 2VBDA 3JD72 4NIAA 5KHGA 3K75B 4EV0A 1KXGA 4XE9A 3RJ2X 4XF3A 4ES8A 1GOHA 1NA1C 2YZ4A 3DYPA 2J1VA 5AVPA 4RN5A 3F2ZA 2ARCA 1XYOA 2XOMA 1UIJA 3RVHA 3J7MA 1AR93 5FMBA 5ACA3 1RYYA 3MZHA 1ENXA 1HRI3 3A22A 1PO12 4KMQA 3E1F1 4EN9B 2PQQA 4UBHA 4CU6A 1HRI2 2FDGA 1WMXA 1VAMA 1PM4A 1B35B 2RM21 1UY0A 5D21A 4AGGA 4IETA 5JAXA 2R041 2XVGA 2QQLA 1B09A 1C5HA 1YQCA 5CEHA 5H9PA 3TNQA 1XQNA 3KM5A 3V0BB 4DXZA 1Y9QA 4H2AA 5A7SA 1BQPA 2VQUA 3M8LA 4H14A 2CWMA 3AMHA 1R083 2K46A 1K5JA 1S0GA 2JENA 4XJZA 4MXWA 1PO22 2EALA 4LBKA 1W03A 1VMHA 4A42A 4DB5A 5JXGA 1CJDA 4OUEA 1JYIA 1GLHA 5E89A 1ASJ2 1NG0A 1RHI1 2ZX3A 1ZZ8A 2VULA 4NWVA 2NP0A 4YM3A 4UT5A 4FBFA 1POV3 4M01A 4YARA 2BOIA 3CIHA 1RUE2 3K77A 1QDCA 4HZFA 2VZUA 2HWC3 4AHZA 5C4WC 2RS52 5A6YA 5FOBB 2Y38A 1S0BA 2ZS6B 5ABJA 1G9DA 2K0GA 5I0SA 1I3HA 2K2SA 4M4RA 2QZ2A 3O12A 4DINB 2YB7A 2VVEA 4OI2A 5JIAA 5HXVA 3AFKA 3HJRA
chains in the Genus database with same CATH topology
1GZWB 1TEIA 4HETA 1LESA 5T3NA 4L2NA 1FMD3 1R091 1MS3A 1H2MA 2QCSB 4CRQA 4QPIC 1CIWA 4XFBA 4AEKA 3WHTA 3AP7A 5JOYA 4FPCA 4N7UA 4PIYA 1IKPA 3BIWE 2D40A 1H4HA 4WVVA 5H9SA 1MQTA 1AYM1 3VZLA 2JEMA 1QGLA 4KG8A 4IEPA 3KT4A 1VBE3 3POYA 4RGAA 1C1LA 3UJOA 1TE1B 4Y1YA 1NCQC 2X8KA 4RR3B 1ZBA2 1MVEA 4ZKTB 3WW2A 3FJSA 3ZFGB 4IEWA 1BYHA 2DFBA 2VW2A 3AP6A 4KU7A 1EAH3 4LO7A 4QQLA 2WNVA 5A32A 5E1RA 1QQP3 2G4IA 4AVCA 1MZ5A 3BPZA 4LE4A 1DG6A 1JH5A 3JU9A 1VBA2 3BCWA 1RIRA 4Y22B 4FCAA 4BWOA 1JUIA 1LTEA 1D4M3 2UYAA 3C2UA 3SMHA 2C0ZA 3EJKA 4LBNA 1DZQA 1Y7BA 2GU9A 2MNGA 4Q4V3 2I07B 5BNPC 4QMAA 1LECA 4E4SA 4DY5A 4OI1A 4QXKA 2VW1A 4MX3A 4XF1A 3E97A 1KITA 2C5DA 1YIPA 2MHFA 2R49A 2Q4SA 1R082 3GBGA 4COZA 1ZBE2 1X7NA 4GULA 5J09A 3JD71 1LGCA 1VRH3 4JGZA 3WHUA 5HCAA 4FTEA 5EJ3A 4ONUA 1CAVB 4XW3A 4KQ7A 1D2SA 1KFUL 2HWF3 5C8WA 3JB4C 2WWSA 1RUE3 4Q4W3 3BTAA 1URXA 1S0JA 3BALA 5F6KA 4AHWA 1NY72 4ATFA 1KS5A 4N7IA 1H1IA 1MS9A 2PHTA 2H0VA 3K48A 1F31A 1LHWA 4Q27A 5CG8A 2RS11 2WSUA 4Z92B 1HW5A 1ZYBA 2FZ1A 1R1A3 2JXAA 3OGGA 4Y1XA 2DU1A 3AJZA 1UPIA 2DVFA 2UY9A 2IWGB 3R6SA 1CR7A 1J3RA 1VRH1 1EV12 1V9U2 5CG9A 4XILA 2ZA9A 5GZFA 3ZXDA 1VB4A 1V6OA 2MEV1 2TUNA 3B5LB 5DUUA 3RPQA 2ET7A 4XHBA 4BH9A 2WFF2 4DRVA 4XHXA 3JUUA 3B01A 4R9CA 3QD6A 1SLAA 3VV1A 3ZN6B 1O7FA 4LBLA 2WSVA 4Q4Y2 4XDQA 5H9QA 2IXIA 3KMHA 2ZZJA 2HEVF 3MGUA 4JRAA 3AXEA 2B7YA 5KC5A 3NO8A 1QKQA 1N47A 4RS5C 1NE6A 2HWB2 3AKSA 4EN0A 3AB0A 1ULGA 5JVVA 1IPJA 4XJ9A 2X53S 5C4WA 2JE7A 3SXWA 2VECA 1VBC3 3WDVA 1SLTA 3DN7A 3FZ3A 1PK6B 2E6VA 5B2GB 2X29A 4Y26A 1QXRA 2FBEA 2XBO3 1QHDA 5J3UA 4X6RB 3AKRA 4AFDA 3TN91 1ENRA 4XZPA 1OQDA 4DQAA 3AZWA 4I3GA 1XNKA 3HAGA 4HVOA 1AR81 1IS3A 1DHKB 1V6MA 1YFUA 2ILMA 3SH4A 5F1RA 4LUMA 3H50A 2W0XA 4L9BA 3L9JT 1I1EA 3KD4A 5T5PA 2BFUS 3OGJA 1Q8OA 3IMNA 3LAGA 3OD0A 4CZSA 1IS6A 5FPZA 4JDNA 3E6BA 4KH9A 1RUI2 2XB6C 1PO21 4OHXA 1AX2A 5L73A 5C8CA 1JXNA 4BE3A 1G8WA 3AZYA 3DPRB 2VU9A 2JECA 3GHNA 4P9YA 4IEXA 1COV1 2CYFA 2DYCA 2VNGA 3MIBA 4K8FA 2DCKA 3G6JB 4KWKA 3D6EA 5KHJA 1LOBA 3SH3A 1SFYA 3ZXFA 1SACA 4IV1C 4I01A 4JGYA 4M3CB 4AVTA 1VBD3 1UIKA 3KCXA 2VW0A 1VBB1 5T50A 2R071 3ILRA 4F3JA 4AI2A 4GXLA 2BWCA 2WA3A 1VBA3 4GB32 3WZ1A 1H2NA 1OLQA 1QJU3 2A3YA 3VKMA 4AGRA 4LE3A 1XE7A 4PLMA 4AWDA 3WNXA 2XH6A 4FPOB 5EZWA 4A2UA 4AK3A 1YFXA 4KL1A 2ZGRA 3HT1A 3JQWA 1HV0A 4XBLA 2XJUA 5LK7B 4Q26A 4QQ2A 5FDBA 2ZGKA 4YFWA 4CEWA 1RUJ3 3RYKA 2AUYA 5BNNC 2WZR1 1C3HA 4COWA 1DZRA 4HL0A 1PVXA 1G9FA 2EXHA 5GZGA 5DUXA 4K3UA 2HWC1 4JV4A 4FVVA 1VBC2 4Q4W2 1ZNPA 3NVCA 2FZ2A 3QACA 2XLGA 2YV8A 2ZKLA 1WLTA 4D7SA 4I30A 4Z1VA 4FPYA 1SLLA 1GBGA 3FE5A 2ZJCA 5I8TA 2XJVA 1OFSA 4P14A 3VHRA 5I91A 1DU3D 1WUVA 4OHZA 2SLIA 1SCSA 2VOVA 5BNNB 4CEYB 2D5FA 1WLCA 1QY4A 1VIWB 1H1MA 4AYUA 5CADA 4S2FA 3B94A 2ZX4A 3ZVXA 2YXSA 4NOTA 5L7OB 5CA6A 2QUOA 1ND2B 3DPRC 1QXPA 5EWSA 3ZFFC 3V65A 4Y20A 4COUA 1W6QB 1O5UA 2I45A 5FLJA 3SH5A 2WIIB 4B3NA 5IK4A 1G86A 3POSA 3GZAA 2Z69A 2JG9A 2B39A 4RD7A 3SITA 2P34A 1WMEA 2D3SA 2D5HA 2RS33 1HXS1 4QU2A 1XNCA 4P9JA 1NA1B 2VQAA 2HWD3 5T52A 2E63A 2R061 4CEYC 2WNVC 1ND3B 1UN1A 1UD1A 1N1YA 1EAH2 4R9BA 3VBUB 4OUMA 3FLTA 3ZN5A 2IXLA 3RWNA 3FBYA 1V6NA 3ES4A 4GMP1 3IT8A 4AE2A 2TEPA 3JZVA 5E16A 4AXOA 1TQ5A 1UKGA 1WMDA 3BOPA 3KCYA 2AGSA 4Q0UA 4PDWB 3S0MA 3AMPA 1UX6A 1N1VA 4RR3C 4XFFA 4B4PA 3MI8A 3WV6A 4F8AA 2DVAA 4FPHA 1U5IA 1FNYA 4NR1A 3VBSA 4DZGA 5K9YA 1W39A 1RINA 2XVLA 2VXRA 2GC2A 5DZGA 2CTVA 2I74A 4PIZA 1VAKA 2ATFA 1MZEA 2ZPXA 5D8AA 2HYKA 3U10A 5J37A 2GC0A 1A8DA 1ZZ9A 3WVJA 3ROUA 4ZU5A 4XJWA 5DUVA 3TB0A 1VBE2 2E7AA 2H6BA 3JQXA 4LHKA 4G3YC 3X29B 2R16A 1QJX1 3IWZA 3ZX7A 3WT3A 1H2KA 2PHRA 3QH6A 1S55A 4XBNA 4PDWC 1UCXA 3VBFC 1SEFA 2PAKA 4XMIA 2UU8A 1CN1A 4CDQB 1JYCA 2QQPA 4KGGA 2ZMKA 1QOSA 2B46X 1O3SA 2X5IC 4H7LA 4IEQA 3J9SA 4WV8A 3ECQA 2WZPP 3PNAA 5I0UA 4N43C 4Y1UA 2A6ZA 5EYYA 1X50A 3CJIB 3NV3A 2NMOA 3ZXKA 1RUF3 1ND2C 4AFMA 1RUJ1 4CDWB 5KHKA 2Q1ZB 5KBFA 3ATGA 1D4M2 4AQ2A 2V73A 3HN1A 2ZACA 4Y1VA 5JLVA 1NCRC 3TOJA 2DCTA 1DBNA 2YUEA 1VJ2A 3UJQA 4U36A 1UU4A 1NQDA 2PHDA 3WINE 5LRRA 4YG0A 3K51A 5BNOA 1VBB2 3VBHA 4WVMB 1LB2A 2YGMA 3A4UA 4P9XA 5D8AC 4AFCA 4LA3A 5GLVA 1J1TA 1CVNA 1PK6A 5FLIA 1RUI3 3B9IA 4GB31 2X5IB 3GALA 1OLRA 4AEDC 3JBG1 4YVWC 3VBUC 1JHNA 5GALA 3ZN4A 3ILNA 3M3QA 4N53B 1RJ8A 1GANA 5CAZA 4HKWA 3A0KA 3FLPA 1UU6A 2CAVA 1AXKA 1V6LA 5DUWA 2HWF2 1XNDA 3B3QE 2W52A 2Z5WA 1WCSA 4MYEA 1NZCA 2PHWA 5IT6A 2OZJA 3SISA 1AF9A 3ILFA 1CAXB 2RS31 1H2LA 4Q0QA 4UBGA 4MV2A 4RHV2 1HXS3 4Q0SA 3VBOA 2HEWF 1WW5A 4C0BA 3USSA 1AR83 1H4GA 3E5XA 2EXJA 2DCJA 4WM7B 1FPN3 1TMF3 4XFAA 2C9AA 1G7YA 4FPGA 5IK5A 4ES9A 1U5ZA 1UPSA 4QPYA 4IERA 3B00A 5BNOB 4YLZA 5KXDA 4MXVA 2E51A 4QM8A 5KC6A 1V6KA 1BBT1 2IFRA 1AVBA 3ZMNA 2HWE1 1POV1 4J1XA 1GYKA 2WFF3 3E6DA 1H8TB 5CFCA 4NO4A 3AZXA 4QGLA 1COV3 1RUD2 3ZFFA 4EWAA 3KSCA 3UK9A 4JGZB 1RC6A 3UKTA 1AL0G 1VP6A 3CJIA 3PTYA 3VZOA 3R0RA 1W2UA 1ZBA3 4AQSA 1L3JA 3AMMA 4K6BA 2VGDA 5DG1A 5FO9B 1MEC2 3RG0A 4M3CE 3VKLA 4W6WA 5GKAC 3I7DA 1CAWB 2DV9A 1W6OA 4YG3A 1DQ5A 4WVZA 5JOWA 1BCXA 4MUVA 1LKNA 5HCFA 4C91A 1BBT3 1QNWA 4YM2A 5AVAA 1ULCA 3VBFA 3H8UA 4JC1A 3ST7A 3SCGA 4YZ1A 1X33A 5DDJ1 1OFNA 3H1WA 4EN8B 1C5IA 1HDKA 4D7TA 3FHIB 1BXHA 1JW6A 1Q8QA 1X8MA 1ZBA1 2WNUA 3GF6A 4ASMB 4XQDA 4Q8LA 1OA2A 2ZMLA 3M3OA 1PVC3 2PYTA 4W6YA 5JSPA 2FMDA 1XYPA 3DUIA 1ND3A 3GBFA 2RMU1 3NKTA 4RGGA 5KWRA 1OOPC 3UKVA 5LEJA 1RUD3 2R1BA 3CL1A 4PBOA 5JWPA 5A3LA 5L19A 1OPMA 1RUE1 4XOGA 2A6XA 2DTYA 4ISRA 1VBA1 1GICA 4GH4C 3VKNA 2BVBA 2HWD2 1APNA 1IPKA 1YJLA 3UV9A 2YYOA 3WP3A 1ASJ1 1MS1A 3VBRB 3WW1A 2WLPA 4FOWA 3TWIA 4FP3A 2KA3A 2UWAA 5C9AC 1PGSA 3IPVB 2C1FA 3RYPA 1RL3A 5E88A 1W0OA 1UAIA 2D44A 4MLOA 4H7MA 1PGW2 4COYA 1FT9A 2D7FA 5FFOC 4M0HA 3WG2A 2HWF1 2AENA 3ZIWA 4JGZC 3H7YA 5JOXA 3U0ZA 3OD4A 3J8F1 1QJY1 1YI7A 2GNDA 3KT1A 3DGTA 2PN5A 1KRIA 1RUJ2 2RR12 3FUQA 3FWEA 4OFGA 1I6XA 3AMQA 3ZPYA 3FBMA 3LWCA 1K5MB 4MXWB 4AG4A 2BQPA 4FOVA 4FTBA 3RNSA 2GN3A 1J59A 4XIOA 3O0VA 3ZYIB 3V0BA 1ULFA 4AI0A 1NLRA 4WM8C 3WCRA 1AR71 1LHVA 3PVEA 5FQ0A 1Q3EA 2XKOA 4PJYA 3SLIA 3ZSLA 3AZZA 5I0RA 4KGQA 2DCZA 4LBQB 2B8MA 5CFDB 1KFXL 4I3PA 2EA7A 4JDOA 2GZWA 4UW4A 4XMAA 1BBT2 2JDZA 4BYYA 1D4M1 2BYVE 3WP4A 1DFQA 1JOJA 2WFF1 1QJY3 3RMYA 1B35A 3D4KA 2IZWA 3ZXJA 2FHRA 4MGIE 1B35C 3V56A 4YZ5A 3I2DA 4M3CF 2LUWA 1VLNA 1C4RA 5CBLA 1ULEA 1RTVA 4L92A 3M4FA 3PVBB 4DS0A 3AKPA 3KZ4C 1N3OA 2E9QA 5K0UC 1DQ1A 2WQZC 4BOWA 4L8QA 4CDWA 2ZGNA 1YNAA 4JGYB 3HMYA 2GNTA 1XE8A 4L99A 1DQ4A 4G4FA 3NL1A 4X8NA 2ES3A 1BJQA 3RYRA 5FBZA 1TME2 2D98A 4A3XA 2ETEA 1O4ZA 4LBQD 1ZBE1 4A7ZA 3LKJA 2P3JA 1BKZA 1D0HA 2ZHNA 2HWB3 1IOAA 4I2OA 5LEKA 3NJZA 4HFSA 4YG6A 1DYKA 1XYNA 2XJSA 3FUOA 4NPRA 5CVRA 1ALYA 1MS0A 4JTNA 2XGXA 3EO6A 3MW4A 2PELA 4OHYA 3MIFA 1KDMA 1Z7S2 2JG8B 4LEJA 1REFA 2XL7A 3KGZA 2CGPA 1LRHA 4XEZA 1U0AA 1H8TA 4HSJA 1MACA 3HD8B 3NV2A 2XLFA 4Q1PA 4H3WA 4QHBA 1HQLA 5CB7A 2R043 3VKOA 2ZCWA 2O1QA 3R4DB 5FPXA 2JE9A 1BVVA 1RGSA 1UF2C 3LCPA 1KQRA 4CDQC 4C90A 3CF6E 3WCSA 4JTOA 2HEYF 3ZSKA 2ZGSA 2PTMA 1SFNA 2WC2A 3FMGA 2CNAA 3NAPB 1H0BA 4MGKE 2YDEA 2ZAHA 1OOPA 2WNVB 3AM2A 1ND3C 3IPVA 4QGMA 3USUB 3OTFA 2LTNA 2EAKA 5D1IA 1HV1A 1Y43B 2D6PA 3LA2A 3QBQA 2XJRA 2ZZQA 1MS8A 2MEV3 5C4WB 1Y3TA 3TN92 4CP0A 1AJKA 2RM23 2VY0A 1OPOA 1PMIA 1NLSA 2D6LX 3OPZA 1FI2A 1DLLA 4XJUA 3MF9A 2GMPA 1NCRA 1X8EA 5DDJ2 1AR82 1LEDA 4EN7B 1YCIA 2AREA 2DURA 2I2SA 3THPA 1ND2A 3U4XA 2JX9A 3HIFA 2EAAA 4K1YA 2WZR2 1WBLA 3LOIA 1RJ7A 1GFF2 4NHLA 3WDTA 1YIFA 5T55A 2EF6A 4FSJA 3I59A 1KDKA 4KWJA 1FV3A 1AL22 1AYM3 1XXNA 5AFEA 2ARXA 1FATA 4L97A 3OBTA 1GZWA 1X36A 3D82A 3WG3A 4K7JA 3IDCB 4C1WA 1M06G 2XWBB 1F5FA 1GSLA 1DGRN 4HPKA 4LLOA 2VNOA 2WS92 4YVWA 2HWD1 1RVF1 3V0AA 1OD5A 5GLZA 4FPJA 3VBFB 2PHXA 1HX6A 1LGBA 2EXIA 4URTA 2R0FA 1ZZCA 2BGCA 3KCCA 2LALA 2Z42A 2W68A 3WDXA 3VN4A 3G7DA 3J26N 2R073 1PM7A 2WNEA 1QH6A 1GR3A 1W6MA 1W6OB 1WW7A 4LO5B 2RM22 5CFDA 1KJRA 2WT0A 3Q9OA 3OYWB 4LTAA 2Z2SB 3ZO0B 5BXXA 3D5OA 2FMYA 4Q4V1 4QX5A 1WCKA 4HPKB 1OA4A 4XQ4A 2ZGOA 3GYDA 1JTZX 4FQZA 1AUYA 4LT5A 3ZXEA 5ACA2 3MW2A 1EV13 1V9U3 4N53C 1YJKA 2ZTNA 3BODA 3I4IA 3H9AA 2GH8A 1FMD1 1R093 4X6QB 2BUKA 3V0AB 1EAH1 3I59B 3MLJA 5J48A 1SCRA 2ZGLA 2DU0A 1PNFA 3IIAA 4DRRA 1FOD1 2BNOA 4KBBA 3WOGA 1RUOA 2QZ3A 4GMP3 1C8NA 3INAA 3POWA 4LO4B 4K9SA 4OVEA 1WGPA 2JICA 1PK6C 5IK7A 4B8EA 2JG9C 1QOOA 1ZRFA 4HKOA 1PNGA 1ASJ3 2OIIA 2QVSB 2BTVC 1S2KA 3FFZA 4DNYA 1DDLA 1GKBA 4JCKA 1ZZBA 2VOXA 4YZ3A 1HRV1 3TYJA 1NA1A 3N7MA 3KLSA 1JBCA 3ZFGC 4QGNA 4PF5A 1LHOA 4LLFA 4Q2FA 1O3RA 1C8M2 2AZ5A 1QMJA 1OOPB 4AFBA 4GA9A 5TSWA 4GWNA 4IL7A 2NMNA 1GZ9A 4Y24A 5BPXA 3C3VA 2WZR3 1LJ7A 1HRI1 3H3UA 1AR61 5CIRA 4EN6B 3A0NA 4HLTA 3WG4A 3IDBB 4RQPB 5GZDA 3WW3A 2X5IA 1F9KA 2ZGTA 4M00A 5FLHA 4BHPA 1QJX3 4PLOA 1Q56A 1QJU1 1V6JA 3O7OA 1PZ9A 1H8TC 1PO11 5BV6A 4CEYA 2BVVA 2W39A 3AXDA 1S0EA 2V5YA 5IUQA 1SBFA 1WLWA 2XUMA 3RS6A 3MIHA 1UU5A 2WL1A 4GALA 3VDDA 4IV3B 4B4QA 4IEUA 2PAMA 4HK8A 4CEWC 1LHNA 2WA4A 2W08A 4IEZA 1W6NB 2EVXA 3OYWA 4Q4X3 1KS4A 4R4XA 1WD3A 3PMSA 2YHJA 3TN93 1GQGA 2PLV3 3D0JA 3SCHA 1R1A2 3FFQA 1V6IA 1LU2A 4FXGB 3P3NA 2VMGA 1ZZ7A 1V00A 1MZFA 5GLWA 3OF1A 1IKQA 2ZGUA 1ENSA 2VG9A 1F2NA 1QJZA 2R063 4KWLA 2PAEA 1CX4A 2GMEA 3KS7A 2RJKA 2NYYA 4KNCA 2XHKA 4GIQA 4AVAA 2ZGMA 1YLLA 1SLBA 2P37A 3NWKA 4O9GA 4ISQA 4FQ4A 4Q4Y3 1LHUA 5J7MA 2RS32 3KB5A 4BIFA 1ZBE3 3N35A 3IDEA 3MLKA 3O0WA 3WY6A 3ZSEA 4Q8KA 3ACLA 2MPFA 4E2SA 1N3QA 5AC91 5C33A 1BZWA 3WDUA 1N3PA 4K40A 4QT6A 4FPLA 3WD5A 5KXCA 1I5ZA 1EV11 1V9U1 4BMBA 1RMU2 1DF0A 3VGIA 1BMV1 1GV9A 5J96B 1Z7S3 1G9CA 1WLDA 4XQWA 2OW4A 1YHFA 2HKXA 3SCFA 4AVVA 1QQP1 1FPN2 1TMF2 2XG3A 3B02A 3B7MA 4XFCA 1AR92 3GHMA 4E9KA 2GN7A 3E5QA 3ZFEA 4BIOA 1H8VA 4XYXA 3LOBA 1SDWA 2BBVA 3ZFEC 1W6QA 3IN9A 2D6OX 2ZMNA 1QDOA 4XPVA 5AFBA 1RVF2 4PIXA 5L7OA 3URFA 4I0WB 4RS5A 3MEPA 4QPGB 5EYXA 5JDBA 3AZVA 3NV1A 5E8AA 5JSOA 4U2AA 3DV8A 3E6CC 2D6NA 1UL9A 3MPPG 3AK0A 1WD4A 3N7LA 1KD7A 2AYHA 4H55A 3VL9A 3RJRA 4YM1A 3OBRA 2A75A 1AHSA 3FX3A 1S0CA 2D6KA 4YW2A 2O8QA 4HN1A 4IV1B 1RUI1 1J3PA 4GB33 1AJOA 3NAPC 3KGLA 4UW3A 1C8M3 4YFZA 5KXBA 5K0UA 4D7YA 4GQ7A 3ES1A 3N3HA 1VBD1 4WZCA 4FT8A 2Y0IA 1LOAA 1AL23 4BPZA 2VMIA 1Q8PA 2B9UA