1OI6A

Structure determination of the tmp-complex of evad
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVRGIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQRQGLLPDYTTSQEIERRLTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PCZA361.16
publication title The Position of a Key Tyrosine in Dtdp-4-Keto-6-Deoxy-D-Glucose-5-Epimerase (Evad) Alters the Substrate Profile for This Rmlc-Like Enzyme
pubmed doi rcsb
source organism Amycolatopsis orientalis
total genus 50
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oi6A00
2IXHA 2O1QA 4AXOA 1CAVB 3DV8A 5LEKA 2IXLA 1IPJA 4JV4A 3RPQA 4XFCA 3HT2A 2GZWA 2H6BA 3H1WA 4AQ6A 5KBFA 3DKWA 1L3JA 1QXJA 3CLPA 4N9IA 2BGCA 3KGLA 2QJVA 3H50A 4KU7A 1YUDA 2GC1A 1DZRA 4O9EA 4XFGA 5J48A 2Y0OA 4I09A 5C8WA 1CAVA 4IEWA 1UIKA 1XE8A 4XFAA 5FPZA 1J3RA 2PHDA 4QX5A 5E16A 3EHKA 4YARA 2CAVA 1ZRRA 5FLHA 4LLOA 4AVAA 3E6DA 1ZVFA 2PAMA 1OMIA 3KSCA 4FAGA 2XGXA 3BPZA 5JR7B 2B5HA 4QGMA 2VPVA 1CAWB 2BNMA 4HN1A 4I01A 1YLLA 2UYBA 2ZKLA 3UKVA 5I0UA 4ZU5A 5JCTA 4XFFA 3TNQA 4BYYA 3L2HA 4L11A 4IEOA 1J58A 3CF6E 3I7DA 4I2OA 3B02A 1UIJA 4BH9A 4XF9A 4YSFA 4Q0PA 4Q0UA 4ZU7A 3WW2A 3LWCA 3IBMA 1WA4A 2PA7A 1FI2A 2B9UA 1CAWA 1WLTA 1RUOA 4F7ZA 3FFQA 1LKNA 5LRRA 2CGPA 2B8MA 1XE7A 2OZ6A 1U12A 4IEQA 2EA7A 4HN0A 2ATFA 4JTOA 1YFXA 4XFHA 2Q30A 2H6CA 2PAEA 4HLTA 3RYKA 1UW8A 4IERA 3H3UA 4XF4A 1V70A 4K8FA 4TLFA 4B29A 5BXXA 5KHKA 4UXAA 1ZREA 1CX4A 3M70A 4LEJA 3NSTA 3D82A 4LULA 2P17A 2V09A 1X8EA 3OD0A 4LA2A 4PJYA 4J1XA 5FCCA 4HVOA 4LUKA 2GAUA 1O3SA 4H7LA 2Q4SA 2XKOA 1UD1A 1VR3A 2MHFA 2QCSB 1SQ4A 2XLAA 1RL3A 4GULA 4YYOA 5FQ0B 3ZDSA 3IDCB 1CAXB 1OD5A 4Z82A 5LRSA 2IXIA 2QNKA 5CVRA 4MGYE 1Y3TA 4DINB 3ES4A 4Q0VA 5J3UA 3RNSA 1UCXA 5I8SA 1ZRCA 3FZ3A 4Q29A 5I93A 4XETA 2XKPA 1RGSA 3E97A 3LA2A 4AVBA 4D7TA 1RUNA 5I0TA 5FQ0A 2QVSB 1CAUB 3I54A 1CAXA 1EP0A 4PIYA 3N4MA 3MZHA 2ETEA 1EYBA 2H0VA 2PHLA 3QOPA 4KWJA 1O3RA 3RYPA 3EO6A 4KWKA 4IESA 2PTMA 1NXMA 1QWRA 3E5QA 5BPXA 3VHRA 3EBRA 4XFIA 1O7FA 3USSA 1J59A 4YRDA 1YWKA 1CAUA 3E6CC 3D0SA 2GU9A 4D7SA 5KHIA 4UBHA 1J3QA 2C0ZA 3H7JA 1HW5A 1EPZA 4I3PA 2ET7A 4MGKE 4HSJA 4IETA 1NE4A 3NVCA 3NKTA 2OPKA 4XF3A 3CEWA 3D0JA 5I0SA 1FXZA 5HI0A 2PQQA 1XRUA 3S7IA 2BNOA 4HBNA 2EVXA 4WBBA 1IPKA 4A2UA 4AVCA 1I6XA 2N7GA 1Q43A 1ZZ9A 1ZZCA 4EROA 2D5HA 4IEVA 4F8AA 3OCPA 1EY2A 2OZJA 4BIFA 2ZCWA 4KU8A 5C6CA 4NVPA 4MX3A 1GQHA 3OGJA 1ZZ7A 4PIZA 4BHPA 2IXJA 3LA7A 4IEUA 5CADA 3DL3A 3LZZA 3H3ZA 5I8YA 3CO2A 3KGZA 2UY9A 1QY4A 2F4PA 4E2GA 4HVQA 4LA3A 1NE6A 4IEXA 3NW4A 1Q5OA 4Q0QA 1H1IA 3NL1A 4HSLA 3MYXA 1VP6A 1J1LA 4N9HA 4KWLA 4Z07A 1ZRFA 4ORFA 3G7DA 4JTNA 3WW4A 2XL9A 3EJKA 5I8TA 4QM9A 5K8SA 2MNGA 5FPXA 5FDBA 2GC3A 5JSOA 3RZZA 4MH0E 2BNNA 2Z69A 4JVAA 4EV0A 1NZCA 5FLIA 2Z2SB 5JAXA 3E6BA 3PNAA 1ZX5A 4LTAA 1ZZ8A 5J7MA 4ZU4A 2FQPA 3H1MA 2WC2A 2PYTA 4META 4MV2A 1TQ5A 5EFUA 3SCFA 3M3IA 3OTFA 1O5UA 1O4TA 2XHKA 1SFNA 5F1RA 3RDIA 5JSRA 2UY8A 5KHHA 4HVRA 5E1RA 1FT9A 1YFUA 2EAAA 4E2SA 4Q0SA 2ET1A 4XF1A 2FMYA 1H1MA 4R52A 3FE5A 2UYAA 1OFNA 3CL1A 3S7EA 1QXRA 4PIXA 1O3QA 5KHJA 1WGPA 5CU1A 4EWDA 2I45A 3EQEA 2HJIA 3R6SA 3LA3A 4XEZA 1RC6A 3FWEA 2IXCA 5I91A 4QMAA 3U11A 2OYZA 4UBGA 4XF0A 2GH2A 2MPFA 3C3VA 1O5LA 3PLQA 1JUHA 5BY5A 2GC2A 4I0AA 3WW3A 3HIFA 3KMHA 1YFWA 4CYDA 1LB2A 4QXKA 3BU7A 3UKNA 3U10A 3SCGA 1Q3EA 5JSPA 3H1YA 1Y9QA 1I5ZA 4FAHA 2D93A 3ETQA 3UKTA 1G6NA 3H9AA 2D40A 4I02A 1NYWA 1J3PA 3S0MA 4EWAA 5AVPA 3I59B 3FX3A 4AQ2A 2IXKA 4QGNA 4OFGA 4HMZA 5BV6A 2Q0AA 3ES1A 2DCTA 2K9ZA 3ST7A 1OI6A 3GYDA 3H8UA 4FBFA 4WVZA 2IC1A 4MGZE 2HKXA 4E2QA 4IEPA 1DGWA 3I59A 3E5XA 4OLLA 3RYRA 3SMHA 2D5FA 3SHRA 4MZUA 4J1WA 4QGLA 1DZTA 2E9QA 2KXLA 3TNPB 1VJ2A 3LAGA 3QACA 1PM7A 1X8MA 4ONUA 3U0ZA 1CGPA 2BEOA 2QDRA 3KCCA 4KL1A 4IEYA 2Q1ZB 4R8HA 4XFBA 1RTVA 4MGIE 2XL7A 2PFWA 3ROUA 3MPBA 3BCWA 3IWZA 3HQXA 1PMIA 3IIAA 3FHIB 4LUMA 5LEJA 3LOIA 1X82A 4EWEA 3NJZA 2PAKA 3DN7A 3E5UA 2O8QA 4I0BA 1YFYA 4O9GA 3MDPA 4RD7A 3BB6A 3PVBB 4P9GA 3O14A 5BUVA 3OF1A 4WZCA 1LRHA 2K0GA 4L2NA 2VECA 5T3NA 5I0RA 3BALA 3CJXA 1ZZ6A 2VQAA 3SXWA 1ZNPA 3HT1A 2XLFA 2XLGA 2WFPA 2OA2A 3GBFA 3FJSA 1ZRDA 2GC0A 1YHFA 1GQGA 3ACLA 4IEZA 4X6QB 4HZFA 5EZWA 1X7NA 3WW1A 1UPIA 4QM8A 1O3TA 4FT8A 3IDBB 4MUVA 5FLJA 3SCHA 2CV6A 4YNIA 1LR5A 5KHGA 4X6RB 2BYVE 3H7YA 1DGRA 1SEFA 3ELNA 5D1IA 3JZVA 2CAUA 1ZZBA
chains in the Genus database with same CATH superfamily
2A7AA 5AVAA 3URFA 1HB2A 2O1QA 3DV8A 3OYWB 5C71A 5EIYB 5LEKA 1RUC1 1NXD1 1UY2A 2A3WA 1JBCA 2VM9A 2X5IA 3ZYHA 3UK9A 4AOCA 4XUOA 5FYVA 2GZWA 2JDAA 3JUUA 2X10A 3H1WA 3T3YA 3DKWA 1BK0A 4GB33 4LHSA 4OHVA 3DEMA 3W9AA 3ZDVA 4CUAA 4ZONA 1TNFA 4LK7A 4XJZA 1QXJA 3MICA 5DUXA 3I3BA 2YC4A 4LBLA 2XUEA 2I2SA 2QJVA 4MLOA 1UY4A 3MFAA 1HIXA 3OD4A 2XG3A 2A6YA 4XJWA 5FZ0A 2P6HA 2ZGNA 1YUDA 2ZGLA 3IPVB 4LQRA 5FPVA 2V72A 4JC1A 4O9EA 4XMIA 1W6QB 3V65A 2VBDA 2Y0OA 4ZZ5A 1CAVA 2P2KA 4CVUA 3K4DA 4RR3C 2D6MA 1XE8A 3PTYA 4XFAA 3RWNA 3VKNA 1D7PM 2BPA2 1J3RA 2RG4A 4TLGA 3SH4A 1QU0A 3WG1A 2VCAA 2IUWA 4XDPA 4UT5A 1OPMA 1QJY1 4Q4V2 2CAVA 1ZRRA 1ASJ3 3CMGA 5A1FA 2SLIA 2W46A 3I2GA 1NT0A 1RUH2 2DUOA 4B1LA 2CHHA 2CYFA 2PAMA 3AZWA 1C5IA 3F2ZA 4BWOA 3BTXA 3DYOA 4Z1VA 4FAGA 2XGXA 3BPZA 2E51A 1DP0A 4QQPA 2WFF1 5EV7A 1MS0A 1GOGA 5BYNA 3ZLIA 4PLOA 2DFCA 1XYNA 2ZGOA 2UYBA 2RJLA 2ZKLA 2HWD3 4HN1A 4I01A 3UKVA 2V4AA 5EJ3A 5C70A 2CNAA 5FP3A 1G9CA 3F95A 4CDXB 5EPAA 5C4WA 5JOZA 2OX0A 4IGOA 1ACCA 3IAQA 2ILMA 1UMIA 1HB3A 3I7DA 1W8NA 2DUPA 1PK6C 3CJIB 5LBFA 3BU0A 2VOVA 5J1XA 1ZBE2 5JR2A 5M0TA 4LT5A 4YSFA 2QQPA 2FDKA 1PZ8A 1IG0A 1POV3 1SFYA 1HRV2 3IBMA 1RITA 3ZFEA 3CDZB 2B39A 1FI2A 3QH6A 1O6UA 1U0AA 1WLTA 2GALA 3OGGA 4JQRA 4CP9A 4ZKTB 2PHFA 3FFQA 1JUIA 2PHUA 1K12A 5T55A 5DPNA 2DV9A 1RUF2 2B8MA 4B4PA 4BA6A 4D7YA 4EN9B 2VMIA 1U12A 4YLZA 2OKXA 4IEQA 4LHKA 4LBKA 2EA7A 2TNFA 2FBEA 4XW3A 5FIXA 4AQTA 2HWC1 5F3CA 2GNMA 1OF3A 4MYEA 4HPKA 4QX8A 5A7OA 3U37A 1UL9A 2RDSA 1W8TA 2W9XA 1XB9A 4PDWA 5HXMA 1HXS1 1ND2C 3RYKA 1UW8A 4KMQA 3ZYGA 4CDQA 1N47A 1AHSA 4BE3A 1O4ZA 5G05L 1V70A 3FUOA 4TLFA 5FY4A 3T2TA 5ABJA 5AFEA 4QD2A 5KHKA 1G9BA 3RSJA 1CX4A 4QU1A 2G4IA 4NHYA 1PGW2 5DN2A 4C0BA 3GBGA 2ZHLA 2EAKA 5GLTA 2RM21 1X8EA 2AYHA 4AEKA 4LA2A 4N53B 1QJX1 2DF7A 1NCRA 1AXKA 2QZ3A 3BN6A 1DU3D 2DDUA 1UF2C 4LKDA 5DDJ3 2DUQA 2GAUA 3RMYA 1O3SA 2QQIA 1W6OA 3WUCA 1FNZA 3FN9A 4AFCA 2MHFA 2VMFA 3KCYA 2RE9A 3VBUB 4QPGB 3R4UA 1SPPB 4YYOA 4FPJA 3VD9A 5FZIA 4NHLA 1UWWA 4PLNA 4FP2A 3LOBA 3IDCB 4UW6A 3O1OA 2VNOA 4OI0A 1CAXB 2XJSA 4D8MA 4UFLA 1SLIA 3O1MA 4LO6B 4MGYE 2P1BA 5CNAA 3VBHC 1UXXX 1Y3TA 2ARCA 3N9LA 4FFHA 1YC61 1AR63 2Y6KA 2J1EA 3FZ3A 2DVFA 1W3VA 2JD9A 2XKPA 2K2SA 2ZKNA 4YGBA 2R32A 5FZ1A 4DRVA 4V1PA 3OGRA 2GNDA 5IVYA 5I0TA 1Y43B 3M2MA 5BNNB 5FQ0A 2WLQA 1JS9A 3WINE 5EP9A 1GANA 4NIHA 1MVQA 4RQPB 1WKYA 1YRZA 1ODMA 1WZXA 1EP0A 1DG6A 1H4GA 3I54A 3JQWA 2ZPXA 1EYBA 2NP0A 4CPBD 4NIAA 5EQUA 3RYPA 1FMD3 2QQKA 4B1MA 1SZBA 4E8CA 1HQNA 4RS5A 1OLQA 3WNXA 3VHRA 2VAUA 4RFRB 4CCLA 4JRAA 1MZ6A 1ZYBA 4YW5A 3VZKA 5F3IA 2J22A 1MVEA 5H9RA 2A1XA 1W8OA 5HCFA 1PX3A 3OG2A 1OLME 3OGSA 2R043 1S0JA 1GSLA 1RUJ3 3O1TA 1CAUA 2D97A 3E6CC 4GWNA 3O1SA 1MS5A 2B45X 4B4QA 5A3UA 3N9OA 2EIBA 4LXLA 2CDOA 1CZVA 2YBKA 5DG2A 5FYCA 4DRRA 3U78A 3K3NA 4LIVA 3B01A 3UV9A 1AYM3 4CEWB 2B7YA 5KHIA 3X29B 1DHKB 4EJRA 1XOYA 1J3QA 3FL7A 1GU3A 2C0ZA 3H7JA 2VUAA 3VKFC 1EPZA 4P5HA 3WX5A 1E5HA 3U14A 3LGRA 4AI1A 1LOGA 2WNUC 1Q8QA 2BZDA 1HDKA 2A6WA 5LK7B 1W6MB 3CQOA 3IIIA 1VBA1 4K21A 3NKTA 1PGL2 1YYNA 2WRAA 3VBRC 5JZGA 3OEBA 4XF3A 2J42A 2X05A 5I0SA 1FXZA 2VXRA 5JIAA 4M3CA 1XRUA 5T5LA 5H9QA 4DPNA 1UPSA 1C57A 1IGOA 3S7IA 2LROA 4Y1ZA 1B35C 3VDBA 2UWCA 2W1QA 2BRTA 3ECQA 4LIUA 5A3TA 1IPKA 5IUQA 3PURA 1W03A 5AC91 1I6XA 1H2NA 1HQLA 2F17A 1KJLA 3OOXA 4AR2A 1W04A 1QJU2 2O0OA 1XYPA 1JYWA 1MQTB 4K20A 4CCJA 3DPRA 2W0XA 5LA1A 4KU8A 2XDVA 2Q1FA 5EYXA 2RS11 4HANA 1R081 4WVWA 4I3GA 3SNMA 1H0BA 2VE1A 3S5AA 3HD8B 3T2OA 1LU1A 3MIHA 2EIDA 3ZSEA 4ES9A 4IEUA 4P9JA 1F15A 3R0RA 4NHMA 3WP6A 3H3ZA 4BK5A 2JG9C 1BEV3 1PHMA 2PLV1 3LF7A 4RGKA 4FPHA 5F8PA 5FAXA 5FUIA 5FTTC 4CCDA 3HNBM 5C8CC 1O8PA 3HN1A 3APBA 1UOGA 3GGLA 3N9MA 1R092 1J83A 4Y1UA 1PM4A 3NW4A 4XUQA 5BNPC 2Y60A 2Z5WA 1OUSA 2XBO2 3TYJA 1VP6A 2P3IA 4Z07A 1W06A 2VMGA 2YPJA 5A7PA 3G7DA 4JTNA 1S55A 2JKXA 4GH4C 5FZ6A 3M7AA 1C1LA 4I0WB 5FDBA 2ZXQA 2JD4A 1AYN1 2D6KA 4JVAA 4RR3B 1SLAA 5A7SA 3O1VA 3KD4A 3B00A 2OW4A 4KQ7A 2PQSA 2A6ZA 3POGA 3M3EA 1NQDA 4UW4A 1RHI3 2C5DA 5FLIA 3E6BA 4AVTA 2R061 4QB6A 3WF2A 3I3QA 3MF6A 2HEYF 3VKMA 1ZZ8A 5J7MA 1PO11 2JDPA 2FQPA 2HWB3 2WC2A 4META 4BCUA 2A3XA 2R6QA 5EFUA 4RHV3 1CPNA 2Q5TA 1SLCA 2VOWA 4XUPA 1NA1A 1O4TA 3U75A 1TNRA 1DFQA 4NPMA 2HH9A 1HQWA 3ZOIA 4HT1T 4XAEA 4DEVA 5JSRA 4H7MA 4M3CF 2IVIB 2UY8A 2Y6GA 2ZHKA 4HVRA 4R4ZA 4DS0A 1Z0HA 2JICA 5KXBA 1DYOA 4Q8KA 1FX5A 4N7UA 5G04L 1BBT2 3NRUA 4H14A 3UESA 3ZN6B 4AEJA 1GP6A 4XF1A 1RUC3 4R9DA 2FMYA 3Q8CA 5FMOL 1H1MA 5LASA 4D6RA 3FE5A 3THDA 2FDFA 2UYAA 1Q8PA 3V0AB 1PK6B 3V56A 1ZBA1 3I2OA 3RFRA 5KHJA 1RUI2 2XQXA 1F4HA 4JAAA 3BOWA 3GZTB 3HOBA 5EWSA 1SLTA 2HJIA 3UL2A 5J36A 5CFCA 1NOVA 2VBPA 1VRH1 4Q1PA 4XEZA 2QBXA 1W6PA 5A70A 2FMDA 3B7MA 4GQ7A 1QEXA 3R05A 1WLCA 4TSVA 5F39A 3PMEA 4BQ1A 3U11A 2OYZA 3WY6A 2WYSA 4UBGA 4JKMA 2MPFA 2P3KA 5E89A 1AJKA 1NCQA 5BY5A 3UYJA 1JUHA 2DVDA 3VD5A 4LMFA 3NNJA 2CSGA 3T09A 1QJY3 1MPXA 1QKQA 3WNLA 1ND2B 4CYDA 5T5PA 1D2SA 1UU6A 2BW8A 4WVMB 2DBNA 5FMDA 3H1YA 1OVSA 2QKDA 2JDMA 4L8QA 3DF0A 4Y26A 4A3ZA 1SLBA 3UKTA 1AR72 1JHJA 5IWFA 1WW5A 1XU2A 2D40A 2WFF3 4QHBA 5JI9A 1J3PA 2VULA 1WUVA 3HVDA 3KM5A 4FPEA 3VDAA 4EWAA 1AJOA 4AGRA 3KB5A 2YBSA 1DYKA 4X8PA 3I2DA 4J25A 3OBZA 1DQ2A 4NPLA 3SKVA 4A44A 3CNAA 4HMZA 2ORXA 1GR3A 3MEPA 4WM8A 1LOFC 3OUJA 1NX9A 3K46A 4FPOB 1UKGA 1W6NA 2K9ZA 3L2YA 4W65A 3RZMA 1OOPA 1OI6A 1ULCA 2ZX1A 2QTWB 4FOQA 2DVAA 4Q8LA 3ZVXA 3U4XA 3GYDA 1HB4A 3GBWA 4S2DA 4Q4V1 2JECA 1UNBA 1P8JA 3Q8BA 3C7GA 2E6VA 4WM7A 1E5SA 3OPWA 1C8NA 2VCCA 1WBFA 4J6GA 3VBOC 4JGZA 3M3QA 5K9YA 1RUH1 4IEPA 2W1SA 4E4HA 2XVGA 3I59A 3M1HA 4YG3A 5L9BA 2RDQA 3SHRA 3WDVA 4XJ8A 4XXPA 4J1WA 4DZGA 1I9RA 3NAPA 3WNPA 1IPSA 4QGLA 5HCAA 2EICA 4COUA 3KZ4C 1IHMA 2HWC3 5FOBB 1W28A 4MGTA 2VUJA 2D3RA 3LE0A 3CZJA 3WQ7A 5H9PA 5D8AA 3LAGA 5IT6A 3LIGA 3QACA 4A6SA 3P3NA 5JMCA 2RMU2 3B5LB 1HXS3 2K46A 4CDWA 5IVFA 4KL1A 2Q1ZB 2YXSA 3IM0A 4DEQA 5IHRA 1JZ5A 1GZTA 4W6WA 3B94A 4NHKA 1FYUA 5K0UC 2PFWA 3ROUA 1ZBE1 3ZIWA 2R7EB 2ZGSA 2EXHA 5GLZA 3MI8A 4NRPA 1PMIA 3SKJE 1HRV1 2ZGMA 2YGMA 2RM23 4P9LA 3VZLA 1K5MA 4YZ5A 5T5OA 3WQ1A 3N9PA 1QJX3 3OBRA 3LOIA 2WNVB 4V2WA 5F3GA 2E26A 4C0HA 1J84A 4I0BA 5A6XA 1RUF1 4A45A 4N43B 4XHXA 3LSEA 4RD7A 3ZIXA 3PVBB 3D3AA 3H0OA 1H8TA 2R1BA 1VE0A 2D6OX 3ZSKA 4ARYA 2ZJCA 3OF1A 2BBAA 1LRHA 4AF9A 2CY6A 1DZQA 1ULPA 2VECA 5C33A 1AUYA 4W4ZA 1NG0A 5I0RA 3A4UA 3MIEA 1ULEA 2QUOA 2WNUB 5L73A 3A0KA 1DLCA 4N90A 3ZYBA 2ZEXA 3SXWA 3VBRB 2XLFA 3B9IA 3TOJA 1H9WA 5FMBA 1S2KA 1PGW1 3ZN6A 5JDBA 1AVBA 3I3EA 1JZ8A 4C90A 5BNOC 3BI3A 3WV6A 3SQOA 1KDMA 1F35A 1CQ9A 1ZRDA 1B35B 4AFAA 5BNQA 3N7LA 4IEZA 3AKQA 4ZXKA 2FZ2A 1TE1B 4HOOA 5FY8A 5A80A 5IAXA 2NMOA 1ENRA 4FT8A 2DURA 1DBNA 2ENRA 1V9U2 1W9SA 5CKQA 4AEMA 3D6EA 3NV2A 1VBC2 1BVVA 4LBQB 3HPNA 3OBAA 5CG9A 1XYOA 4CCNA 3RZGA 5FJHA 2QQJA 3I3DA 4G3YC 5FYSA 4B8EA 3JZVA 3ON7A 1LENA 1DQ5A 1YNAA 1LHNA 3MIDA 2B9VA 5CG8A 2VO5A 4AEDA 1HX6A 1W0NA 2JG8A 2JG9B 3QBQA 2IXLA 2WS93 3J7HA 3ZMNA 3NV1A 3NNLA 3HT2A 1YEWA 1O4YA 3T30A 3NO8A 5IATA 1XNDA 1S0IA 4AQ6A 1VRBA 2WO3A 1C28A 4QX0A 4FTSA 1FMD1 5FRAA 3CLPA 4M4PA 5L7OA 2QE3A 3VD3A 4B3NA 4LLFA 5T52A 4Q4W2 3I2KA 2WA4A 4FTBA 4KU7A 1VBA3 4K9SA 1GZWB 2W3JA 1XSQA 4QXBA 1X50A 2GC1A 2P6CA 3N36A 2XVLA 5B4XA 4I09A 4L0PA 5ANNA 1GOFA 1OXCA 1R1A2 2DFBA 2VUDA 4YZ3A 2WO2A 3OYWA 4GH4B 3WNKA 3Q8FA 3O1RA 1UIKA 1IZ3A 4A7ZA 4KGGA 4QX5A 2DBIA 3EXUA 1COV2 5K4LA 1W2OA 1AYM1 5DMYA 3VL9A 5FLHA 4QKNA 5ACA2 5FPBA 4LLOA 3J9SA 3E6DA 3C2UA 3TEXA 3W21A 2EIEA 4ZHNA 4RYDA 1W8HA 1ENXA 1XNCA 5EYYA 5A3PA 2WKKA 3IPVA 1OSGA 1ZM1A 3HR9A 2RS13 3A0NA 1N1SA 3HNYM 4QGMA 5SV5A 1JZ2A 4CU9A 1S0GA 3AM2A 1SFPA 1CAWB 1QNYA 3K48A 4BK4A 1CIWA 2VG9A 4UW5A 3HAGA 5I0UA 1U5IA 4ZU5A 1PGL1 1Y9GA 3TNQA 2LUWA 1JYXA 1LGBA 4HKLA 1GWKA 2PLV3 2V4VA 3L2HA 4XHBA 4B4RA 2E33A 1L7LA 2H0BA 2VW1A 1QJFA 2X5IC 3PJYA 5CIRA 2P4EA 5DAXA 2OVUA 3POYA 5CFDA 3ZFGB 3AK0A 3I49A 4O7XA 2UURA 2ZMNA 3WW2A 2JDKA 3LWCA 4XC9A 4GKYA 4DUXA 2PA7A 4QHOA 1QJU1 2B9UA 3WCRA 1RUOA 5CYYA 4IQPA 5FZKA 1XE7A 4YZ4A 3KT4A 4CDXA 3ZKYA 2VMHA 4N8MA 4FQ4A 4ZY9A 4HN0A 2ATFA 4JTOA 5GJ6A 1AYN3 1FPN2 1VALA 1YFXA 4X8NA 5GKAC 1NY72 2Q30A 1AL0G 1MS1A 4HLTA 2JJ6A 2AH2A 3IN9A 3PU8A 4XZPA 2R063 3JBG2 4IERA 2ZX2A 5F2WA 1I5PA 4QPWA 2YROA 4K8FA 1PO13 4QXCA 5BXXA 2OS2A 1RVF2 1ZREA 1R091 3NSTA 3D82A 1RXFA 2VZVA 2E7QA 1K3IA 4P08A 1PX4A 3OD0A 4DO0A 4RSUA 4EZ4A 4HVOA 4M00A 3VBSB 4LUKA 2RS52 5J09A 1PVC2 4NRQA 5F5AA 4BOWA 5LATA 1UD1A 3G6JB 1M06G 1W0PA 1YCIA 5C4WC 5FREA 1SQ4A 2HWF2 4Y1YA 3ZYJB 3RZHA 1W2NA 2E31A 1QOSA 3WHTA 2XH6A 3OY8B 1ZBA3 4ZZ8A 2GH8A 3KV9A 4NUBA 3WZ1A 4MG2A 2VCBA 2QNKA 5CVRA 4LR4A 3ZFEC 1C8M2 4N53A 4DINB 2WAAA 4Q0VA 3MW3A 1OVPA 4BQ2A 5FZAA 1UCXA 1W9YA 1XPWA 1VRH3 4YZ2A 4UYBA 4Q29A 5I93A 4XETA 3LA2A 1RINA 4QPGA 4D7TA 1N3OA 1SPPA 4AG4A 3ZSMA 2QVSB 1GICA 3LPFA 1NLRA 2XJTA 3TWIA 1CAXA 1LJ7A 4Y4RA 1T2XA 3OPTA 3N4MA 1BBT1 3AYEA 1GP5A 4GWMA 4OZOA 4PDWC 3ZXLA 3MZHA 4CDQC 2PHLA 2BU9A 3QOPA 2ZX3A 4KWJA 4U36A 1FOD2 1QNWA 1JODA 4KWKA 4LO5B 5ABJC 1NXMA 4IV3B 5K0UB 5C3OA 4Z92B 5IK5A 1A8MA 3EBRA 2WZR2 2QQMA 3T0AA 1O7FA 4FI9A 2AENA 1X9TA 3PL0A 4IGPA 2DVBA 2VVEA 3NQHA 4YRDA 5BNNA 1NCRC 4QDSA 2FHRA 1CN1A 2WJSA 4RQPA 3D0SA 5GZFA 3TEWA 2GNTA 2VQTA 5FXXA 4D7SA 1S0FA 1FAYA 4NHXA 4BMBA 4UBHA 5DZEA 3W58A 3POWA 4OI2A 4KH9A 3ZO0B 1VMHA 2PHRA 2ET7A 1ULFA 4URAA 3THPA 4Q26A 4Q4V3 4IETA 1G8WA 4AHXA 3NVCA 5F5CA 1AX2A 1DYPA 2D3PA 2FDJA 3HNMA 1RUH3 1RMU2 3N7JA 5FBZA 5A1LA 3CEWA 3KVBA 1AR71 2W08A 5JXIA 3IDAA 2BNOA 4TYSA 2IFWA 3ZKUA 1O8SA 2BUKA 2WYFA 3SH5A 4CSWA 4CEWA 2C6SA 3PU3A 3TN92 2EXIA 2YB7A 4DY5A 4EROA 2G19A 4IW3A 4IEVA 4S2HA 5FXWA 5IVJA 1JYNA 2ZTNA 3ETPA 1RUE2 2AZ5A 1UOFA 1W6MA 3HMYA 2OZJA 2ZAAA 4CRQA 2ZCWA 5JOXA 1MZFA 4RS5C 1ZBE3 4HONA 4YW6A 1W0OA 3ZXEA 4FFIA 1ULGA 1HRV3 5CAZA 1V6LA 1G9FA 2R072 3LA7A 3OUHA 3POJA 4MXWB 3WD5A 1CPMA 1YI9A 3DL3A 2W1UA 1WLDA 1OHFA 3PJQA 4E4DX 3OEAA 4GA9A 5I8YA 2R073 2IFRA 1ODNA 1RUF3 2HLEA 5EHDA 2XMLA 2UY9A 5A7NA 3AKTA 1W90A 1QY4A 1XNKA 3JB8A 2XQRA 1V0AA 3IKWA 2FD8A 5IAVA 5FYMA 4OHYA 3T0BA 1JHNA 3LEIA 1NE6A 4HG6B 2X8KA 2RMU1 3ZSJA 2W5FA 4QWNA 5A6YA 1SLLA 2HYKA 1D0GA 4M0NA 2YFZA 3PIGA 4D69A 1RYYA 2NPIA 2GDFA 4NO4A 1J1LA 4IL7A 1UO9A 5JZGC 5KWRA 5CA6A 2C1FA 4FOWA 4ORFA 5DUUA 3WW4A 2WSUA 3HJRA 2TUNA 1WW7A 2JDUA 2MNGA 3GXUA 4YW2A 1TMF2 2RR12 4QXHA 5JSOA 4MH0E 4ATEA 4JZRA 2QFEA 1G86A 4YZ1A 1NZCA 4CCOA 5FJKA 3VN4A 1U5ZA 1HV0A 3WNOA 5JAXA 3UT0A 2DTYA 4GD4A 2Y34A 5F6LB 5JVVA 1L7RA 5LWBA 4IXLA 3H42B 5JUVA 1OA2A 3DPRC 4EZHA 4EQVA 1QXPA 4A4AA 1Z7S2 3IAPA 1BQPA 3M3IA 3OTFA 5D2AA 4NAOA 1CONA 1S4CA 1Z7S3 4FVVA 5E88A 4B7KA 4RR3A 2OPWA 4L9BA 1WCKA 5KHHA 1REEA 3WF4A 1TME2 1CZSA 3ACIA 3AL6A 2E7TA 2JDNA 4ET7A 2ET1A 4FCAA 5A7WB 2Y33A 1GNZA 4AAXA 2X5IB 1AXZA 1OFNA 3S7EA 4JRLA 2J1UA 4PIXA 1SBDA 3AMNA 4Y1VA 2VZ3A 4PI0A 5FZMA 1WGPA 4AGVA 5DZFA 3AMPA 1V9U1 2R49A 1BJQA 3FC0A 2WUHA 3EQEA 1VBC1 3KV5A 3LA3A 4BQXA 4P9YA 2VOKA 1JH5A 1QH7A 1UU5A 4CCMA 2W87A 1RUG2 4KGQA 2VL4A 1PIV2 4Q4X2 3SEEA 3WG3A 1JOPA 1R64A 2VNVA 2WS91 5A1AA 3WXPA 1HV1A 3U07A 1WMEA 1JYVA 1W9FA 4O61A 3B3QE 1RB8G 2VMCA 2XVKA 3GHMA 4Q4X3 3OSDA 3VBFC 3HIFA 4OHZA 1YFWA 3WR0A 3DKQA 5DXDA 3CHXA 5JI7A 1LHUA 3WF3A 1OA4A 1IKPA 3UKNA 1H8VA 4QT6A 2L9LA 1H6YA 1HRI2 4BB3A 2HYXA 3C7HA 2XWBB 4BXFA 4GJZA 1DCSA 2D93A 4KBBA 5LBCA 1Y7BA 3HQUA 4K1ZA 4CU8A 3H9AA 4JKLA 1PNFA 4I02A 4QHZA 1NYWA 5FZ7A 1NZIA 4PBOA 2Q8EA 3RVHA 1PO22 3S0MA 5IYYA 3RZKA 1U5XA 4Q4W1 2ZX0A 4MOAA 5FO7B 4XOGA 4AQ2A 1YJKA 1JXNA 2FCUA 4QGNA 1KFUL 3VD4A 4OFGA 1R1A1 3DCQA 4INDA 1ND2A 3DGTA 4EN7B 2ZOEB 4LO4B 1KGYA 2DCTA 4YW4A 3QH7A 5FY1A 4WVMA 3ST7A 4CDUC 5IVVA 5SV8A 2D43A 4MGSA 2WWUA 1COV1 2HEWF 1DGWX 5FKCA 3T1MA 3ZR5A 4CTEA 4WVZA 2IC1A 4AI8A 4CEYC 4RL7A 4LNVA 5ACA1 2D6PA 5IFPA 4GAZA 1QJU3 1SACA 1GUIA 3NJXA 3ZFEB 4B7EA 2Z79A 2YY1A 1ZRIA 4PQQA 4QB2A 1Z78A 2D5FA 3I8TA 4MZUA 1EUUA 4PQ9A 1K42A 4OUSA 3DXUA 1C3HA 1DZTA 5C3QA 2P3YA 3MV11 1UOJA 5CKMA 2E9QA 2VNRA 2KXLA 2YUEA 3TNPB 4NR1A 3USUB 5KC6A 2YMZA 3BGAA 4UAPA 3AZYA 2WIIB 3QLQA 4XBNA 1E5IA 1KFXL 1PM7A 1QOTA 4FO9A 3RI9A 1CGPA 3AJZA 2RHPA 3RI8A 2KR2A 2W95A 5A6ZA 5C9AA 2OUHA 4Z8BA 3RJRA 2CTVA 4W8JA 4XYXA 4Q2FA 2XL7A 3IMMA 3KHCA 4XDOA 1R093 1U5YA 5FZHA 4P02B 4YW7A 2JE9A 1SCRA 3HBKA 2ZX4A 5A3NA 1APNA 2EF6A 1HLCA 3OBTA 4AI3A 2Y6HA 1UY1A 1X82A 2ZGRA 3NJZA 4OQ9A 3ZYRA 1UYPA 2PAKA 1NCRB 2XBO3 3E5UA 5FPLA 1D4M2 3AL5A 1YFYA 4LOTA 4O9GA 4IV1C 1F5FA 3I2JA 2HWE2 4WM8C 4AYUA 1RUNA 5BUVA 1FPN1 1NY71 3K3OA 1OOPC 1TZOA 3K4AA 4L2NA 1VAMA 4GALA 4WZCA 4KWUA 4XBLA 4YFWA 3WLUA 3J8F2 4YWAA 5DAWA 4IE6A 5FZ3A 3JBG1 4YVSC 4WM7C 1AX0A 3O0VA 3JXSA 4COZA 1QQP2 2AR6A 4JGZC 4LPLA 4W50A 4Y20B 5FKBA 1VPHA 2WNVA 1RVF1 5T50A 1ZNPA 3HT1A 3KWVA 1BVP1 2WO7A 3LEGA 1IS5A 2NM1A 2DU1A 2WFPA 2ZEWA 1BHGA 4N43A 3FJSA 3UGGA 4BQ3A 2KA3A 3IZOA 1N3PA 4ASKA 2WN2A 1GQGA 4R9AA 3WOGA 2RJ2A 2RS51 1PVC1 4X6QB 1BLZA 5D8AC 1LAJA 4NAMA 5EZWA 1O3TA 2BFUS 3TEZA 1AR82 4YGDA 1BBT3 1QJEA 3IDBB 4FPLA 4UWDA 2YC2A 2HWF1 2WNUA 1OF4A 1V6JA 3AZVA 3GM8A 2WNEA 4XURA 4XXAA 1JZ4A 5FLJA 2JB8A 2YU1A 3ZXDA 3ZN4A 3K4ZA 4RA0A 3VBRA 1LR5A 2J1SA 1MZEA 4RS5B 4YM3A 5KHGA 4X6RB 1DQ4A 5CB7A 1RUI3 2XXZA 5J96B 3PUSA 4LBOA 1C8M1 1SEFA 3ELNA 1KXGA 5D1IA 3ZXGA 2CAUA 2VZOA 2IZWA 4XZUG 1ZZBA 1OD3A 3WHUA 1UOBA 1YI7A 1XNAA 1F9KA 3DECA 3POSA 4QX2A 4UF0B 3UETA 1W2TA 4R9BA 4AXOA 2VVFA 2LRPA 1F31A 2X29A 4JV4A 4YVWC 1H8TC 2H6BA 2Z4FA 4LBQA 2DWRA 3Q8EA 4AWDA 5KBFA 3M3OA 4NRMA 3GF6A 3VUOA 1L3JA 4AE2A 5C3PA 4XQ4A 2YYOA 3AVSA 4N9IA 4XPVA 1DQ0A 2BGCA 2R30A 3KGLA 4W6XA 3H8RA 4DXSA 2VZSA 4IUGA 3H50A 1FOD1 3INAA 1EPWA 3POEA 1DGRN 3M8LA 4JGYA 2A75A 4HL0A 5C8WA 3AP6A 5ERLA 5JZGB 2BP6A 5D21A 2WZR1 4FXKB 1AR73 3N35A 4IEWA 1D4VB 4RN5A 5L9RA 2ZEYA 1A6CA 2PHDA 5CEHA 4KBZA 3ZSLA 1GZ9A 1PMJX 5AC92 1LNSA 4HKOA 1H6XA 3KQ4B 1WWYA 2Y26A 1X9PA 3SC7X 4AVAA 1VBB2 3O5SA 1JU3A 2PHTA 3RZLA 2A71A 2G9GA 3GJAA 3W20A 5GLUA 3VDDC 1GZWA 2W39A 1OMIA 4JQTA 5L19A 3KSCA 5B4NA 1VBB3 1QHDA 2VPVA 4COVA 3VBHB 2J7MA 3U1XA 4GH4A 1VBE2 1JZ7A 3NNMA 1JOBA 2BNMA 3C8XA 1YLLA 4LITA 5JCTA 1RMU1 4BYYA 2ZMKA 3NNGA 3LEMA 4XVHA 4ISQA 4AEDC 1STMA 2JG8C 2V5DA 3CF6E 5FXVA 1E57A 1OC1A 1R1ZA 2JEMA 4CP0A 4FSJA 5I0DA 4BH9A 1V6NA 4BLJA 2DCJA 4Q0PA 1MS8A 3TN91 4D6SA 2DCYA 1PVXA 2VQUA 2ZZJA 2RMU3 3CIHA 1CAWA 1W99A 1RUE1 1ALYA 2Y6JA 1UN1A 1FNYA 4UFHA 1EUTA 4XTMA 3RGBA 4F7ZA 2WINB 3NJYA 4PI2A 5LRRA 1WD4A 2ID4A 4DNYA 2QQLA 2WNOA 3TEYA 4GWIA 2R071 3ZFGA 3LQCA 4E4ZA 4XFHA 1YO8A 5C5UA 3NNFA 2PAEA 1Y4WA 4JDOA 4BMEA 2ARBA 1QH6A 5FYUA 5KR7A 3SISA 3VBFB 3MUY1 1LHOA 3H3UA 3VHOA 1UX6A 1XNTA 2P3JA 4B29A 2Y38A 4QPIC 1LCLA 2CGNA 2XOMA 5IVBA 4LEJA 3C7OA 3MPPG 1MACA 3T4HB 3RJ2X 4DOUA 5F32A 4CU6A 3IB3A 2MEV2 2HBTA 2V09A 3KCXA 4LULA 1ENSA 4XMAA 3ZFFC 2D98A 1QOOA 1LHVA 2ADDA 2YU2A 3POIA 4MGQA 3ZX7A 2XJPA 5A3MA 1S0BA 4CCCA 4H55A 1O91A 1LHWA 3JB4C 5GLVA 2Q4SA 5FOJB 4Q5OA 5B2GB 2LM3A 1HJFA 1XBFA 2B42B 5HCBA 4BISA 2QCSB 1OH4A 1TMF1 2ORZA 2XLAA 1RL3A 1DQ1A 5CFDC 3AYCA 4C91A 2YHJA 3P3PA 4CDUB 1OD5A 4Z82A 2BVVA 1Q8SA 4COWA 2IXIA 4LE4A 5LRSA 1H9PA 2P37A 3UGHA 1AL22 4CEYB 1V9U3 4BQ5A 5JPMB 3ES4A 2A6VA 3ACHA 1VBC3 2HEVF 3RNSA 3VBSA 3OUIA 5CZKA 1AR92 5I8SA 4Q4Y2 1Z7S1 1ZRCA 3D5OA 4HETA 1G9DA 1UKRA 1W6PB 1B09A 3O12A 5FUPA 4AHZA 4DB5A 1RGSA 4E4SA 1DF0A 4JHZA 1RXGA 5FYTA 5FZFA 1Q8OA 1VAVA 1JU4A 3ME2A 4G4FA 1OFSA 1UXZA 2QQNA 3FBMA 1LOFA 3LB9A 2E63A 5A32B 4CCKA 1OLMA 2YZ4A 4K6BA 5DG1A 1TME1 3OY8A 4LBNA 5FV3A 4QKFA 3NKGA 5C8CB 3GCXA 5FPAA 1ND3A 1W8ZA 5FY9A 3EO6A 3ZPYA 4IESA 4AVSA 2PTMA 2C26A 4XCBA 2Y6FA 1QWRA 3ORJA 4Y5TA 1W2UA 3E5QA 5BPXA 3LKJA 3DUIA 5FZOB 2D6LX 2Y8KA 2VZRA 3ABZA 4XFIA 4Y3OA 5BNPB 4OMCA 5JXJA 2VOTA 4P9IA 1DLLA 2P34A 3WG4A 2A70A 1NQJA 3MFCA 2D6NA 4Q4W3 1YWKA 4BDVB 3I2HA 1H2LA 4TWTA 1XXNA 2GN7A 2D7FA 1R1A3 1BMV2 3P6BA 2VR4A 4IV1B 1RUG1 4UI9L 1PIV1 4Q4X1 1GZCA 1UZ0A 5LA9A 4IV3A 3JCIA 5K0UA 2CL2A 1COV3 2KM2A 4I3PA 3S5QA 3VZMA 4HSJA 3VV1A 2VW2A 1N1VA 1WA6X 5FP4A 1K45A 1NE4A 5ACA3 3M3CA 4YVSB 4N53C 1ST8A 1W6QA 3LIHA 2XHNA 4WM7B 4NWWA 5IFTA 2JIJA 2JKBA 4JGZB 3D0JA 4K8RB 3NV3A 2PQQA 1BCXA 4HBNA 4YM1A 2XWJB 1LU2A 4IE7A 1UU4A 2EVXA 1PO21 4BM8A 2VTXA 4HKWA 4UFMA 1EAH2 4A2UA 1VBD2 4DXTA 2N7GA 4Y22B 1Q43A 2R1DA 4EYUA 5LCWL 1IS3A 4LBMA 1NUKA 3HEIA 3K2OA 1EY2A 3TRSB 2VJXA 3VD7A 1M4WA 2ZABA 5FZ9A 4BQYA 4NVPA 1GQHA 2VY0A 3ITQA 3OGJA 1GP4A 2JB4A 4PIZA 2Q8OA 4AAPA 3WF1A 1YIFA 5LY2A 4BHPA 4E8DA 4GIQA 3AP7A 2CWSA 1MEC2 5BNNC 1CR7A 2HBUA 1KDKA 3LZZA 4AFDA 3BTZA 2ARAA 1A3KA 1PZ9A 4R9CA 1W9WA 2R0FA 4RQPC 2DYCA 3KGZA 4CA9A 4CP2A 1W8FA 3CJIA 3HWJA 1QJZA 1UAIA 4OHWA 5FK7A 5A3WA 4E2GA 4HVQA 2WN3A 1Q56A 2ADEA 2F6BA 2WBKA 5EJZB 3I3MA 1FPN3 4YVWB 1H8TB 2PN5A 4LA3A 3WP4A 3ILRA 1N1TA 4IEXA 4ISRA 2NLRA 5FZEA 3I4IA 3WT3A 1CZTA 3WNMA 2WAOA 2ZBJA 2W91A 3JBG3 2WT0A 3NL1A 4HSLA 2LS6A 4XAAA 4D3WA 1S0EA 3WDTA 1HJGA 1G9AA 1CJPA 1MZ5A 2FCTA 4KWLA 2WL1A 1RVF3 4NROA 4Z2AA 2XL9A 4BQ4A 1SMVA 5K8SA 5GZDA 1ZA7A 3HBZA 1LOCA 2DU0A 1RUD2 2XBO1 4HFSA 1ONAA 4NE9A 3C7FA 2GSYA 5E6HA 3RZZA 4EV0A 3AVRA 1I1EA 2RS53 2Z2SB 1PVC3 4AW7A 3MW4A 2XPJA 4F3JA 1D4M1 4LBQD 2OQ6A 4LTAA 5F2SA 4K40A 5LK5A 3BKZA 4XUTA 2HWE1 4WVVA 4Y4YA 4ZU4A 3SITA 2FDIA 1EV12 2HWF3 4ZS3A 5KC5A 2PYTA 4MV2A 5L9VA 1TQ5A 2BJSA 1T6BX 1JYCA 1V6OA 3VDDB 3BYWA 3UNPA 3D8CA 4QB1A 1EV13 1J1TA 1VLNA 4LHNA 1O5UA 3J8F1 5FZCA 1CIYA 3JD72 1IOAA 3VBOB 2XHKA 1LEDA 4YW3A 3A21A 1SFNA 1C8M3 4HK9A 1QQP1 2Z42A 2ZHMA 3PVEA 5ANQA 3LSDA 3IMNA 3VB9A 3MIGA 1FT9A 1YFUA 5E1RA 3VDCA 2QZ2A 3VBUA 3WQ0A 3NV4A 3WUDA 2B46X 2EAAA 2WT2A 3ZN5A 3N9NA 1GBGA 4Q0SA 2BQPA 3BODA 2PELA 2WZEA 2WABA 4R52A 5C3RA 5F7UA 2W47A 2VZUA 4ITCA 2D44A 4EN0A 1QXRA 1XJAA 4I30A 4S2FA 4CP1A 5A3LA 4UOJA 1AR81 4D6QA 5LB6A 4PLMA 2I45A 2UWBA 1FOD3 1RUI1 4Y5Z0 3NMBA 3FWEA 2IXCA 5FP8A 3ZYFA 5I91A 4BLIA 4RGAA 2OQ7A 4BU2A 2WSVA 4QMAA 2BWAA 1D2QA 2WZR3 1W9TA 3PUHA 4XF0A 4FFFA 4QX1A 3DXTA 3KQRA 4OZXA 5A7WA 3ALQA 3PLQA 3MV01 4GB32 4YM2A 1WD3A 3Q8AA 3R4DB 1IG3A 4I0AA 1JI6A 1GMMA 5DUWA 4IE4A 2X09A 3S30A 4DIQA 2W92A 1WCSA 1YQ5A 1YQ2A 4EN6B 3JU9A 5T5JA 3WF0A 3AP4A 3BU7A 3ZXJA 5A6QA 1LB2A 1MS4A 1T6GC 3Q9OA 4NIIA 3SCGA 3AKRA 2QQOA 1IQDC 1Y9QA 1I5ZA 4QPIB 5IVCA 1G6NA 4NMIA 4TTGA 4MO3M 3ZXKA 2CWMA 4TN7A 4OQ8A 3ZFFB 4XE9A 4D94A 2GP5A 2FDGA 4DQAA 3FX3A 3AXEA 1RMU3 3IDEA 1REFA 4LKEA 1ASJ2 2IXKA 3P1IA 5BNOB 1SDDB 5FP9A 4NN0A 4XABA 1V00A 1S1AA 4QQHA 2R16A 4FPGA 1AX1A 5FYHA 3O0WA 5CFDB 1OQEA 2VMDA 3TN93 1VMFA 1SCSA 1LGCA 4MGZE 4AHWA 3RMXA 2HWD2 1VBB1 1GNHA 3GHNA 2HKXA 4E2QA 1RUE3 1MR5A 2UU8A 4LK6A 3SLIA 1DGWA 2VCMA 5KXCA 2VOXA 4OYUA 3E5XA 3W5NA 2ZGPA 2AC1A 1X33A 3C7EA 3GZUC 2JX9A 3RYRA 3A22A 4Z2WA 1PMHX 5FBJA 5LBEA 4ATFA 1VBE1 4LOSA 4OCTA 3T0DA 2BGOA 4OHXA 2ZS6B 2NMNA 3MLLA 4M4RA 3SEPA 1VJ2A 2ARXA 2DTWA 4DUWA 2J1TA 4LBJA 1QDOA 2J1RA 1X8MA 1MQTA 3DYMA 3U0ZA 2BEOA 1CJDA 1LGNA 3KCCA 4IEYA 3BOPA 4R8HA 5A3OA 4JX0A 1QGLA 1XNBA 2ES3A 5APAA 4QPYA 4MGIE 5FY5A 3CZUA 5A7QA 3V0BB 1POQA 3BVCA 3GDBA 2BFUL 3BCWA 3KT7A 3IWZA 3MPBA 5EXOA 3BTAA 3HN3A 4FFGA 4FOVA 5FY7A 5FZLA 4KG8A 3D4KA 4CZSA 1OH3A 1V6IA 1KD7A 3IIAA 3FHIB 4DMIA 4LUMA 2I07B 1TG7A 3EYPA 3T08A 5LEJA 3USUA 4EWEA 4CXYA 2V73A 4OUEA 3DN7A 2O8QA 2I74A 4CU7A 3VKOA 5FK8A 4H3WA 4QDRA 1GNYA 2FDHA 4XCAA 4XILA 5HCHA 1TMF3 2RR13 3O14A 4P9GA 1JW6A 3WEZA 3MO4A 3T4VA 3AZZA 2BGPA 4O65A 1RJ8A 2VD7A 3DYPA 5A33B 2Y64A 4AHYA 5T3NA 2G9FA 3BIEA 2G9ZA 2C4XA 3LDRA 1UZWA 4MSVA 5FO8B 4SLIA 2CU5A 4UFIA 5DDJ2 3VHPA 3CJXA 2VQAA 1H4HA 2XLGA 4AZZA 3MF9A 1W2AX 2MEV1 2OA2A 3GBFA 1IS6A 2W2IA 4OMDA 4AK3A 3PUQA 1BKZA 5JOYA 1UYZA 1YHFA 3ACLA 3MBWA 4QQ2A 3SH3A 2RDRA 3KV6A 3POBA 4HZFA 5LBBA 1GV9A 1X7NA 1TME3 1UPIA 3POFA 1C1FA 1NKGA 2AEYA 2A73B 3MIBA 1KQRA 1HN0A 2JE8A 2LW8A 5FUNA 5C9AC 4UW3A 4Y20A 3AJYA 3OJBA 1IQAA 2XJQA 5HV4A 1AR62 4YNIA 2XJVA 1UZYA 1IS4A 5C7GA 2J1AA 3H7YA 1DGRA 4P00B 1HN1A 1AL21 4PF1A 2Q8DA 4GMP0 1AR91 2ZHNA 3AMQA 4Q27A 1F4AA 1GKBA 2IXHA 4FPCA 4Q4Y1 3I97A 2PHWA 1CAVB 4YG6A 1IPJA 2ZACA 3RPQA 2Q1MA 1FMD2 3V0AA 4XFCA 1PK6A 1A78A 1RUG3 3UJQA 2WQ8A 1US3A 2UWAA 1PIV3 3WDXA 4GKXA 2BVBA 2OXBA 1WW4A 2VVDA 1XE0A 2C24A 2DVGA 2R042 1OQ1A 1W8UA 2ZA9A 1RUJ2 4V2VA 5C5TA 1K5JA 5FFOC 5IVEA 2JDZA 1DZRA 1NA1C 1HRI3 1PGSA 2WNVC 4XFGA 4JCKA 4DUVA 3PMSA 3PUIA 4UF0A 5J48A 4QKDA 1VMJA 3KF5A 1E5RA 2OIIA 4QQLA 4BJ0A 4EE2A 3H8XA 3RZJA 2Y6LA 1GWMA 1VB4A 2XUMA 4N43C 2O14A 1AYM2 4BXSV 5FPZA 1PO23 1HKDA 2WT1A 3LDBA 3QD6A 4E9KA 2JENA 5E16A 4U2AA 3EHKA 2KD7A 4XQDA 4A42A 4YARA 1VAKA 1O59A 2XB6C 3VZJA 5C4WB 2LALA 3WDYA 3M4FA 1BMV1 3MLKA 4XDQA 1AXYA 3NJVA 1XC6A 1ZVFA 2VBBA 2TBVA 4BPZA 5J37A 3W59A 2VXJA 4L97A 2DCKA 1WMDA 2B5HA 2VNGA 5JR7B 2BBVA 4JDMA 3WQBA 1LTEA 3FHQA 5CFCC 3THTA 5HXVA 3VHNA 4ES8A 3OGVA 4CP9B 3KV4A 1FATA 2WQ4A 4XFFA 4XBQA 3ZXFA 3S6PA 2V5YA 4ARXA 3AKSA 5FPUA 4L11A 4IEOA 1J58A 1NCQC 1REDA 2VTXJ 3O0XA 1N1YA 3PTRB 2X53S 4P9XA 2WR9A 4HPKB 1EAH1 4I2OA 3B02A 3VZNA 1UIJA 5JWPA 2G1MA 3L9JT 1VBD1 4XF9A 3T1LA 4ASLA 4PDWB 4Q0UA 4ZU7A 4CDQB 1JYTA 3FLPA 1WA4A 4NWVA 2AACA 3VBHA 4AI9A 4BIOA 1ZA4A 4OI4A 2CDPA 4Y33A 5ABJB 1UZVA 3J4UH 1LKNA 2D3SA 2VU9A 1BEV2 1OURA 3CBNA 1POV0 2WQZC 4JGYC 4COYA 2CGPA 1BZWA 2OZ6A 2RJKA 4QQOA 1UYYA 1OT5A 1LULA 1YJLA 1Y9MA 2EIGA 3N9QA 3ZPOA 4LO8A 4GXLA 3AMHA 2RS32 1MEC1 3VZOA 1LOEA 2H6CA 3U4SA 1W6OB 1FV2A 3A7QA 3ILNA 2ZZQA 2RS33 1D4M3 3AFGA 3UJOA 4A41A 3HQRA 1SDWA 1F2NA 5LZ6A 1YQ6A 4XF4A 4CXXA 2HWE3 2PMWB 1KEXA 5DAVA 2W52A 4UXAA 2C9KA 2IWGB 2W94A 2QQWA 3M70A 5IK8A 3VKLA 4YW1A 5CBLA 2CGOA 4IE0A 2P17A 5E8AA 3WCSA 2J1VA 3OPZA 3J8F3 4OVEA 2WWSA 3WSOA 1TVGA 4J1XA 4PJYA 3BIWE 1MS3A 5FCCA 5FZGA 5GZEA 4KNCA 4URTA 4W6YA 1LEMA 1QQP3 4XJUA 1RHI2 3K77A 4H7LA 3KHBA 3E1F1 1H30A 1WLWA 2XKOA 3NAPC 5DQ0A 2WWJA 1VR3A 3AYAA 3GNEA 3MUZ1 3VBFA 1RUD1 4GULA 4K3UA 2HWB2 3ATGA 1H2MA 1LECA 5FQ0B 1DGLA 5JMOA 3ZDSA 4DXRA 4RHV2 1C5HA 1CVNA 4CDWC 5IK7A 1GQPA 1XQNA 3AXDA 2ZAHA 5IK4A 1W05A 1AR83 3QCWA 3THCA 5FO9B 4LKSA 1EV11 5GZCA 3ZXAC 5J3UA 4FPKA 4OULA 2E32A 4JHTA 1OQDA 3KVAA 4DXZA 2VZPA 1YQ8A 1K5MC 4HXCA 3O1UA 1B35A 1RUC2 2R0HA 1UX7A 3ILFA 3E97A 3JD71 3PUAA 4AVBA 3W5MA 4FOYA 1H1AA 4QX7A 1N3QA 1CWPA 5K7PA 3ZFGC 1CAUB 1CESA 5GM0A 4CDUA 1JZ6A 4PIYA 3FBYA 2ETEA 2GMEA 2H0VA 4ASMB 2RV9A 1O3RA 4CEYA 3J26N 3ZR6A 1AZDA 4CUBA 4TZDA 1JTZX 1YQCA 3AX4A 4NJ4A 4L92A 1JN2P 4GMP1 4QX3A 5FXZA 2JE7A 2TEPA 4WZFA 5CKNA 2NN8A 3FUQA 3USSA 1J59A 1VIWB 1YXWA 5FY0A 2WZPP 5A32A 2E53A 2WO1A 2JG9A 4M3CB 1QJY2 2A6XA 2GU9A 1ULOA 1RJ7A 4AGGA 1WCUA 4A6OA 4AQSA 4BZ4A 5C8CA 4XQWA 1A8DA 2WLPA 4C1XA 2WA3A 2LTNA 4GB31 4PT6A 3AZXA 1HW5A 3IT8A 4AI2A 1WMFA 4MGKE 2WFF2 1OUXA 5FZOA 3FMGA 5FZBA 4AFBA 5BNPA 5JXHA 1DQ6A 5F5QA 3AB0A 3MLJA 1X36A 2JXAA 4XIOA 3DPRB 4N7IA 1TEIA 2OPKA 3H3LA 4FPYA 2P5BA 3VBSC 1SBEA 5FMCA 3WG2A 4C8DA 4ZS2A 5L36A 5HI0A 2VTFA 3K75B 2YG0A 4IGQA 4LKFA 2JIGA 5EJ1B 3GZAA 1WCDJ 4IV1A 4WBBA 1VBE3 1CX1A 2ZMLA 4AVCA 4FPFA 5JOWA 1IKQA 1YIPA 4NOTA 1ZZ9A 2BWCA 1D0HA 1ZZCA 1C4RA 1Q8VA 1ASJ1 2VZ1A 1UY0A 2RVAA 2D5HA 1UMHA 3A23A 3FLRA 4IE5A 5FZ4A 4F8AA 1AF9A 4YM0A 3OCPA 3LFMA 4LJHA 4MHRA 3KT1A 3WDWA 1ND3C 4XTPA 3AYDA 4YVSA 5JIUA 4BIFA 1URXA 5C6CA 5C9AB 5FWJA 4MX3A 4LHLA 4JDNA 5L7OC 1ZZ7A 2Q8CA 3VLBB 4LO7A 4NIDA 1S0DA 2VUCA 2HWC2 2IXJA 2ERFA 2HWD1 4P14A 5DUVA 4GZ9A 1MS9A 3TBDA 3ZYIB 4Y5SA 5CADA 4JKKA 1RIRA 1LOBA 4A7KA 4Y22A 1HXS2 1QMJA 2PXJA 3CO2A 3ASIA 4GWJA 5JXGA 2F4PA 3RWKX 2JWPA 1HB1A 3AKPA 2QDNA 1VB2A 1WW6A 4IV3C 3T2PA 1POV1 5FR3A 4NIGA 1GYKA 2RM22 1Q5OA 3LD8A 4UFJA 4FQZA 3AC0A 3B93A 2GMMA 4Q0QA 3TAYA 1H1IA 1QJX2 3V64A 3MYXA 4A3XA 3BTYA 1OKQA 4N9HA 4YPJA 3ACGA 1ZRFA 3P5BA 1SBFA 1NA1B 3EJKA 3GCWA 4C1WA 5I8TA 4QM9A 3WP3A 2YC0A 5FPXA 2MEV3 2GC3A 5GALA 3AP9A 5F37A 5JPNB 4MXVA 2BNNA 2Z69A 5C3SA 2ZGTA 4YG0A 4YVWA 3WNNA 5DABA 2RR11 1KS5A 3PNAA 1ZX5A 1KITA 1SHWB 5FZDA 5CISA 4NPRA 1H2KA 2NQYA 4TXWA 1ENQA 3H1MA 3MHZA 4UFKA 5F9TA 3SCFA 2VC9A 5HBAA 3LEKA 2BTVC 2VH9A 3AP5A 4S2GA 1SG3A 5FYBA 2YV8A 4QAWA 2YGLA 1JOJA 2RDNA 1AL23 3ENRA 5CFCB 5DDJ1 2AREA 3R4SA 4K7JA 3RDIA 5F1RA 3NWKA 3FFZA 4CDXC 1AR93 4M0HA 3J7MA 4Q4Y3 3S57A 2AEZA 3LFIA 1V6MA 3I2FA 4E2SA 2VQ0A 3CJIC 2BOIA 3BPSA 4IDZA 4RFT0 1NCQB 5TSWA 5LW9A 2FZ1A 3FLTA 3H8OA 5F3EA 2YBPA 3CL1A 4P9WA 1NLQA 5GLWA 1UYXA 3B69A 3CKHA 3O7OA 2OT7A 2XONA 3VDDA 1O3QA 4YGCA 5CU1A 3FHAA 4L99A 4LORA 2VZQA 3VBOA 5FYIA 4EWDA 4KI5M 4Q1RA 4R4XA 3R6SA 4MADA 3T2QA 1RC6A 3UGFA 1AR61 2BERA 1S0CA 2O8OA 2WS92 4JGYB 3AFKA 4DFSA 1KJRA 3MGUA 5FYYA 2SBAA 5H9SA 2GH2A 3C3VA 1WMXA 1O5LA 4XIKA 5IJRA 1BYHA 2WDBA 2GC2A 3WVJA 1DDLA 3OB8A 3WW3A 2F4LA 1ULDA 1WCQA 1JMUB 3LDKA 1PZ7A 3KMHA 3N7MA 4G9SB 4GJYA 4PF5A 4WM8B 3WP5A 4CE8A 4QXKA 1XU1A 4A7YA 4KG0A 1VBA2 1W6NB 4QKBA 3U10A 1Q3EA 1OOPB 5JSPA 2ZGQA 1LESA 3KLSA 5KXEA 4FAHA 1DIWA 3ETQA 5HPOA 1WBLA 3I2IA 3K51A 4PHZA 4EN8B 5LA2A 1HRI1 1OBNA 3N3HA 4YFZA 4CUGA 1KS4A 2R041 4OUMA 2EALA 1RUJ1 2YDEA 5AVPA 5FMOS 3I59B 3PIJA 1NAEA 2GN3A 3KS7A 5IW0A 1JZ3A 4HK8A 2ZGKA 1S2BA 2GP3A 2VZTA 4Y1XA 5FWEA 4QU2A 3VBUC 4QPGC 3NAPB 5AC93 5BV6A 1JYIA 3PVNA 2Q0AA 2YPDA 3ES1A 2QQVA 1QDCA 3PVOA 5ISLA 4LE3A 1OLRA 5DZGA 2FCVA 3GJBA 1CD3G 1EAH3 5D8AB 2RS12 4CPBA 2NZ9A 4QPIA 5HV0A 5JLVA 4ZXEA 3H8UA 1R082 1VBD3 3ACFA 4FBFA 4AL9A 4AI0A 4CDWB 2XR4A 5AFBA 4WV8A 4M3CE 5FZ8A 2W1WA 4XUNA 1FV3A 1R083 3ZFFA 4E27A 3BUCA 4D0QA 3WDUA 2PLV2 4OLLA 1I3HA 4MHUA 3SMHA 2Y0IA 4FTEA 3JQXA 5BNOA 3RS6A 1K5MB 3J7LA 2E7AA 4OI1A 2B4KA 4XACA 1US2A 4FXGB 2YFUA 1MEC3 1UQXA 4MVTA 3EB7A 2C9AA 4ONUA 3GZEA 3ZYPA 1OKOA 2EXJA 2QDRA 4CCEA 1QF3A 5LA0A 3ZM8A 4XFBA 4XJAA 1RTVA 4YGEA 4PBPA 4ZPIA 3MIFA 2OUJA 1L7QA 3HQXA 3N7KA 1F8VA 4MXWA 1V6KA 1AYN2 3O1PA 3PHMA 2BDRA 2IVJA 4QDQA 2NYYA 3PDQA 2XJUA 2VW0A 1GWLA 1NLSA 3GALA 1BEV1 1LODA 4M01A 3KF3A 1QIQA 2R062 2BV4A 4AFMA 1UZZA 3MDPA 3BB6A 1G7YA 4H2AA 4FP3A 1PO12 2AGSA 2QQUA 4CEWC 1RUD3 5DAQA 1OPOA 2RS31 2BOJA 1LOAA 4CXWA 4AVVA 1W3XA 1BXHA 2K0GA 3V0BA 4P5YA 3LCPA 4XJ9A 2JDYA 3RG0A 3RQ0A 3LPGA 3BALA 2GNBA 5FP7A 3VGIA 1W39A 4CUCA 3VL8A 5DAPA 4DY3A 1PNGA 1ZZ6A 4RGGA 5FYZA 4BQWA 1UY3A 2W68A 2PHXA 2A5ZA 4K1YA 2DCZA 2EXKA 4Y24A 1GOHA 2ZEZA 5T54A 2VGDA 3JD73 5GZGA 1UMZA 1W8WA 2GC0A 3AMMA 1KRIA 3RRDA 5F5IA 1ZBA2 4F83A 1RHI1 4AEDB 3WW1A 4QM8A 5A33A 2JG8B 2WZ8A 3TB0A 1OA3A 1MQTC 3CU7A 1XSRA 2A3YA 4SBVA 5LY1A 2GMPA 2HWB1 3MW2A 4MUVA 1ND3B 1VRH2 2JDHA 3SCHA 2ZGUA 4PCRA 4RHV1 2AUYA 2CV6A 1F5JA 3J7NA 4GMP3 5F6KA 2VMEA 1S2EA 5L7OB 2BYVE 1BK1A 1A34A 5J98B 1GFF2 5KXDA 3B9CA 3ZMOA 3EMRA 1GLHA 2XJRA
chains in the Genus database with same CATH topology
2A7AA 5AVAA 3URFA 2O1QA 3DV8A 3OYWB 5LEKA 1RUC1 1NXD1 2X5IA 2A3WA 1JBCA 3UK9A 2GZWA 3JUUA 3H1WA 3DKWA 4OHVA 4GB33 3W9AA 1TNFA 4XJZA 1QXJA 3MICA 5DUXA 4LBLA 4MLOA 2I2SA 2QJVA 3MFAA 1HIXA 3OD4A 2XG3A 2A6YA 4XJWA 2ZGNA 3IPVB 1YUDA 2ZGLA 4JC1A 4O9EA 4XMIA 1W6QB 3V65A 2Y0OA 1CAVA 2P2KA 4RR3C 2D6MA 1XE8A 3PTYA 4XFAA 3RWNA 3VKNA 2BPA2 1J3RA 3SH4A 1QU0A 3WG1A 1OPMA 1QJY1 4Q4V2 2CAVA 1ZRRA 1ASJ3 2SLIA 1RUH2 2DUOA 2CYFA 2PAMA 3AZWA 1C5IA 4BWOA 4Z1VA 4FAGA 2XGXA 3BPZA 2E51A 4QQPA 2WFF1 5EV7A 1MS0A 5BYNA 4PLOA 2DFCA 1XYNA 2ZGOA 2UYBA 2RJLA 2ZKLA 2HWD3 4HN1A 4I01A 3UKVA 5EJ3A 2CNAA 1G9CA 4CDXB 5C4WA 5JOZA 2ILMA 3I7DA 2DUPA 1PK6C 3CJIB 2VOVA 1ZBE2 4LT5A 4YSFA 2QQPA 1PZ8A 1POV3 1SFYA 1HRV2 3IBMA 1RITA 3ZFEA 2B39A 1FI2A 3QH6A 1U0AA 1WLTA 2GALA 3OGGA 4JQRA 4ZKTB 2PHFA 3FFQA 1JUIA 2PHUA 5T55A 2DV9A 1RUF2 2B8MA 4B4PA 4BA6A 4D7YA 4EN9B 2VMIA 1U12A 4YLZA 4IEQA 4LHKA 4LBKA 2EA7A 2TNFA 2FBEA 4XW3A 4AQTA 2HWC1 2GNMA 4MYEA 4HPKA 1UL9A 4PDWA 1HXS1 1ND2C 3RYKA 1UW8A 3ZYGA 4CDQA 1N47A 1AHSA 4BE3A 1O4ZA 1V70A 3FUOA 4TLFA 3T2TA 5ABJA 5AFEA 4QD2A 5KHKA 1G9BA 3RSJA 1CX4A 2G4IA 1PGW2 4C0BA 3GBGA 2ZHLA 2EAKA 5GLTA 2RM21 1X8EA 2AYHA 4AEKA 4LA2A 4N53B 1QJX1 2DF7A 1NCRA 1AXKA 2QZ3A 1DU3D 1UF2C 5DDJ3 2DUQA 2GAUA 3RMYA 1O3SA 3WUCA 1W6OA 1FNZA 4AFCA 2MHFA 3KCYA 2RE9A 3VBUB 4QPGB 3R4UA 4YYOA 4FPJA 4NHLA 4PLNA 4FP2A 3LOBA 3IDCB 4UW6A 2VNOA 4OI0A 1CAXB 2XJSA 1SLIA 4LO6B 4MGYE 5CNAA 3VBHC 1Y3TA 1AR63 3FZ3A 2DVFA 2XKPA 2ZKNA 2K2SA 4YGBA 4DRVA 2R32A 4V1PA 2GNDA 5I0TA 1Y43B 3M2MA 5BNNB 5FQ0A 2WLQA 3WINE 1GANA 1MVQA 4RQPB 1YRZA 3I54A 1EP0A 1DG6A 1H4GA 3JQWA 2ZPXA 1EYBA 3RYPA 1FMD3 1HQNA 4RS5A 1OLQA 3WNXA 3VHRA 4JRAA 1MZ6A 1ZYBA 4YW5A 3VZKA 5H9RA 1MVEA 5HCFA 2R043 1S0JA 1GSLA 1RUJ3 1CAUA 2D97A 3E6CC 4GWNA 1MS5A 2B45X 4B4QA 5DG2A 4DRRA 3B01A 3UV9A 1AYM3 4CEWB 2B7YA 5KHIA 3X29B 1DHKB 4EJRA 1J3QA 2C0ZA 3H7JA 2VUAA 3VKFC 1EPZA 4P5HA 3WX5A 3LGRA 4AI1A 1LOGA 2WNUC 1Q8QA 1HDKA 2A6WA 5LK7B 1W6MB 4K21A 1VBA1 3NKTA 1PGL2 1YYNA 3VBRC 5JZGA 4XF3A 5I0SA 1FXZA 2VXRA 5JIAA 4M3CA 1XRUA 5T5LA 5H9QA 4DPNA 1UPSA 1C57A 1IGOA 3S7IA 4Y1ZA 1B35C 2UWCA 3ECQA 1IPKA 5IUQA 5AC91 1I6XA 1H2NA 1HQLA 1KJLA 1QJU2 2O0OA 1XYPA 1MQTB 4K20A 3DPRA 2W0XA 4KU8A 5EYXA 2RS11 4HANA 1R081 4WVWA 4I3GA 3SNMA 1H0BA 3HD8B 1LU1A 3MIHA 3ZSEA 4ES9A 4IEUA 4P9JA 3R0RA 4NHMA 3WP6A 3H3ZA 2JG9C 1BEV3 1PHMA 2PLV1 5FAXA 5FTTC 4FPHA 5C8CC 3HN1A 3APBA 1R092 4Y1UA 3NW4A 5BNPC 2Z5WA 2XBO2 3TYJA 1VP6A 2P3IA 4Z07A 2VMGA 2YPJA 3G7DA 4JTNA 1S55A 4GH4C 3M7AA 1C1LA 4I0WB 5FDBA 2JD4A 1AYN1 2D6KA 4JVAA 4RR3B 1SLAA 3KD4A 3B00A 2OW4A 4KQ7A 2A6ZA 5FLIA 3M3EA 1NQDA 4UW4A 1RHI3 2C5DA 4AVTA 3E6BA 2R061 3MF6A 2HEYF 3VKMA 1ZZ8A 5J7MA 1PO11 2FQPA 2HWB3 2WC2A 4META 4BCUA 2A3XA 2R6QA 5EFUA 4RHV3 1CPNA 2Q5TA 1SLCA 2VOWA 1NA1A 1O4TA 1TNRA 1DFQA 1HQWA 4HT1T 5JSRA 4H7MA 4M3CF 2UY8A 2ZHKA 4R4ZA 4HVRA 4DS0A 5KXBA 1Z0HA 2JICA 4Q8KA 1FX5A 4N7UA 4AEJA 1BBT2 4H14A 4XF1A 1RUC3 2FMYA 5FMOL 1H1MA 3FE5A 2UYAA 1Q8PA 3V0AB 1PK6B 3V56A 1ZBA1 5KHJA 1RUI2 4JAAA 3BOWA 3GZTB 5EWSA 1SLTA 2HJIA 3UL2A 5J36A 5CFCA 1NOVA 1VRH1 4Q1PA 4XEZA 1W6PA 2FMDA 3B7MA 4GQ7A 3R05A 1WLCA 4TSVA 3PMEA 4BQ1A 3U11A 2OYZA 3WY6A 4UBGA 2MPFA 2P3KA 5E89A 1AJKA 1NCQA 5BY5A 1JUHA 2DVDA 1QJY3 1QKQA 1ND2B 4CYDA 5T5PA 1D2SA 1UU6A 2BW8A 4WVMB 3H1YA 2QKDA 4Y26A 4L8QA 3DF0A 1SLBA 3UKTA 1AR72 1WW5A 1XU2A 2D40A 2WFF3 4QHBA 5JI9A 1J3PA 2VULA 1WUVA 3KM5A 4FPEA 4EWAA 1AJOA 4AGRA 3KB5A 1DYKA 4X8PA 3I2DA 1DQ2A 3CNAA 4HMZA 1GR3A 3MEPA 4WM8A 1LOFC 4FPOB 1UKGA 1W6NA 2K9ZA 3L2YA 4W65A 1OOPA 1OI6A 1ULCA 2ZX1A 4FOQA 3ZVXA 2DVAA 4Q8LA 3U4XA 3GYDA 3GBWA 4S2DA 4Q4V1 2JECA 2E6VA 4WM7A 1C8NA 5K9YA 1WBFA 4J6GA 3VBOC 4JGZA 3M3QA 1RUH1 4IEPA 2XVGA 3I59A 3M1HA 4YG3A 3SHRA 3WDVA 4XJ8A 4XXPA 4J1WA 4DZGA 1I9RA 3NAPA 5HCAA 4QGLA 4COUA 3KZ4C 1IHMA 2HWC3 5FOBB 2VUJA 2D3RA 3WQ7A 5H9PA 5D8AA 3LAGA 5IT6A 3QACA 5JMCA 3P3NA 2RMU2 3B5LB 1HXS3 4CDWA 4KL1A 2Q1ZB 2YXSA 3IM0A 4W6WA 3B94A 4NHKA 1FYUA 5K0UC 2PFWA 3ROUA 1ZBE1 3ZIWA 2ZGSA 2EXHA 5GLZA 3MI8A 1PMIA 1HRV1 2ZGMA 2YGMA 2RM23 4P9LA 3VZLA 1K5MA 4YZ5A 5T5OA 3WQ1A 1QJX3 3OBRA 3LOIA 2WNVB 4C0HA 4I0BA 1RUF1 4N43B 4XHXA 3LSEA 4RD7A 3ZIXA 3PVBB 3H0OA 1H8TA 2R1BA 2D6OX 3ZSKA 2ZJCA 3OF1A 1LRHA 4AF9A 2CY6A 1DZQA 2VECA 5C33A 1AUYA 1NG0A 5I0RA 3A4UA 3MIEA 1ULEA 2QUOA 2WNUB 5L73A 3A0KA 4N90A 3SXWA 3VBRB 2XLFA 3B9IA 3TOJA 1H9WA 3ZN6A 1S2KA 1PGW1 5JDBA 1AVBA 4C90A 5BNOC 3WV6A 1KDMA 1CQ9A 1ZRDA 1B35B 4AFAA 5BNQA 3N7LA 4IEZA 3AKQA 4ZXKA 2FZ2A 1TE1B 2NMOA 1ENRA 4FT8A 2DURA 1DBNA 2ENRA 1V9U2 4AEMA 3D6EA 3NV2A 1VBC2 1BVVA 4LBQB 5CG9A 1XYOA 4G3YC 4B8EA 3JZVA 1LENA 1DQ5A 1YNAA 1LHNA 3MIDA 5CG8A 4AEDA 1HX6A 2JG8A 2JG9B 3QBQA 2IXLA 2WS93 3ZMNA 3NV1A 3HT2A 1O4YA 3NO8A 1XNDA 1S0IA 4AQ6A 1C28A 4FTSA 1FMD1 5FRAA 3CLPA 5L7OA 2QE3A 4B3NA 4LLFA 5T52A 4Q4W2 2WA4A 4FTBA 4KU7A 1VBA3 4K9SA 1GZWB 1X50A 2GC1A 3N36A 2XVLA 4I09A 4YZ3A 1R1A2 2DFBA 3OYWA 4GH4B 1UIKA 1IZ3A 4A7ZA 4KGGA 4QX5A 3EXUA 1COV2 1AYM1 3VL9A 5FLHA 5ACA2 4LLOA 3J9SA 3E6DA 3C2UA 5EYYA 1ENXA 1XNCA 2WKKA 3IPVA 1OSGA 1ZM1A 3HR9A 2RS13 3A0NA 1N1SA 4QGMA 5SV5A 1S0GA 3AM2A 1CAWB 1QNYA 3K48A 1CIWA 2VG9A 4UW5A 3HAGA 5I0UA 1U5IA 4ZU5A 1PGL1 3TNQA 2LUWA 1LGBA 4HKLA 2PLV3 3L2HA 4XHBA 4B4RA 2H0BA 2VW1A 2X5IC 3PJYA 5CIRA 2OVUA 3POYA 5CFDA 3ZFGB 3AK0A 2UURA 2ZMNA 3WW2A 3LWCA 4GKYA 2PA7A 1QJU1 2B9UA 3WCRA 1RUOA 4IQPA 1XE7A 4YZ4A 3KT4A 4CDXA 2VMHA 4FQ4A 4HN0A 2ATFA 4JTOA 5GJ6A 1AYN3 1FPN2 1VALA 1YFXA 4X8NA 5GKAC 1NY72 2Q30A 1AL0G 1MS1A 4HLTA 2JJ6A 2AH2A 3IN9A 4XZPA 2R063 3JBG2 4IERA 2ZX2A 2YROA 4K8FA 1PO13 5BXXA 1RVF2 1ZREA 1R091 3NSTA 3D82A 2E7QA 3OD0A 4RSUA 4HVOA 4M00A 3VBSB 4LUKA 2RS52 5J09A 1PVC2 4BOWA 1UD1A 3G6JB 1M06G 1W0PA 1YCIA 5C4WC 5FREA 1SQ4A 2HWF2 4Y1YA 3ZYJB 3WHTA 1QOSA 2XH6A 3OY8B 1ZBA3 2GH8A 3WZ1A 2QNKA 5CVRA 4LR4A 3ZFEC 1C8M2 4N53A 4DINB 4Q0VA 3MW3A 1UCXA 1VRH3 4YZ2A 4Q29A 5I93A 4XETA 3LA2A 1RINA 4QPGA 4D7TA 1N3OA 4AG4A 3ZSMA 2QVSB 1GICA 1NLRA 2XJTA 3TWIA 1CAXA 1LJ7A 3N4MA 1BBT1 3AYEA 4GWMA 4PDWC 3MZHA 3ZXLA 4CDQC 2PHLA 3QOPA 4KWJA 2ZX3A 4U36A 1FOD2 1QNWA 4KWKA 4LO5B 5ABJC 1NXMA 4IV3B 5K0UB 4Z92B 5IK5A 1A8MA 3EBRA 2WZR2 1O7FA 2AENA 2DVBA 2VVEA 4YRDA 5BNNA 1NCRC 2FHRA 1CN1A 2WJSA 4RQPA 3D0SA 5GZFA 2GNTA 4D7SA 1S0FA 1FAYA 4BMBA 4UBHA 5DZEA 3W58A 3POWA 4OI2A 4KH9A 3ZO0B 2PHRA 2ET7A 1ULFA 3THPA 4Q26A 4Q4V3 4IETA 1G8WA 4AHXA 3NVCA 1AX2A 1DYPA 2D3PA 1RUH3 1RMU2 3N7JA 5FBZA 3CEWA 1AR71 2W08A 4TYSA 2BNOA 2IFWA 2BUKA 3SH5A 4CEWA 3TN92 2EXIA 4DY5A 4EROA 4IEVA 4S2HA 2ZTNA 1RUE2 2AZ5A 1W6MA 3HMYA 2OZJA 2ZAAA 5JOXA 2ZCWA 1MZFA 4RS5C 1ZBE3 1W0OA 3ZXEA 1ULGA 1HRV3 5CAZA 1V6LA 1G9FA 2R072 3LA7A 4MXWB 3WD5A 1CPMA 1YI9A 3DL3A 1WLDA 1OHFA 3PJQA 4E4DX 4GA9A 5I8YA 2R073 2IFRA 1RUF3 2UY9A 3AKTA 1QY4A 1XNKA 3JB8A 3IKWA 4OHYA 1JHNA 1NE6A 2X8KA 2RMU1 3ZSJA 1SLLA 2HYKA 1D0GA 4M0NA 4D69A 2NPIA 2GDFA 4NO4A 1J1LA 4IL7A 5JZGC 5KWRA 5CA6A 2C1FA 4FOWA 4ORFA 5DUUA 3WW4A 2WSUA 4YW2A 2TUNA 1WW7A 2MNGA 1TMF2 2RR12 5JSOA 4MH0E 4ATEA 2QFEA 1G86A 4YZ1A 1NZCA 3VN4A 1U5ZA 1HV0A 5JAXA 2DTYA 5F6LB 5JVVA 4IXLA 1OA2A 3DPRC 1QXPA 1Z7S2 1BQPA 3M3IA 3OTFA 1CONA 1Z7S3 4FVVA 5E88A 4B7KA 4RR3A 4L9BA 1WCKA 5KHHA 1REEA 1TME2 2E7TA 2ET1A 4FCAA 1GNZA 2X5IB 1AXZA 1OFNA 3S7EA 4JRLA 4PIXA 1SBDA 3AMNA 4Y1VA 1WGPA 4AGVA 5DZFA 3AMPA 1V9U1 2R49A 1BJQA 3FC0A 3EQEA 1VBC1 3LA3A 4P9YA 2VOKA 1JH5A 1QH7A 1UU5A 1RUG2 4KGQA 1PIV2 4Q4X2 3WG3A 2WS91 3WXPA 1HV1A 3U07A 1WMEA 1RB8G 3B3QE 2XVKA 3GHMA 4Q4X3 3VBFC 3HIFA 4OHZA 1YFWA 3WR0A 5DXDA 5JI7A 1LHUA 1OA4A 1IKPA 3UKNA 1H8VA 4QT6A 1HRI2 2XWBB 2D93A 4KBBA 1Y7BA 4K1ZA 3H9AA 1PNFA 4I02A 1NYWA 4PBOA 1PO22 3S0MA 1U5XA 4Q4W1 2ZX0A 5FO7B 4XOGA 4AQ2A 1YJKA 1JXNA 4QGNA 1KFUL 4OFGA 1R1A1 4INDA 1ND2A 3DGTA 4EN7B 2ZOEB 4LO4B 4YW4A 2DCTA 3QH7A 3ST7A 4WVMA 4CDUC 5SV8A 2D43A 1COV1 2HEWF 1DGWX 3T1MA 4CTEA 4WVZA 2IC1A 4AI8A 4CEYC 4RL7A 4LNVA 5ACA1 2D6PA 1QJU3 1SACA 3ZFEB 4B7EA 2Z79A 2YY1A 1Z78A 2D5FA 3I8TA 4MZUA 4PQ9A 4OUSA 1C3HA 1DZTA 3USUB 5KC6A 2E9QA 2VNRA 2KXLA 2YUEA 3TNPB 4NR1A 2YMZA 3AZYA 2WIIB 3QLQA 4XBNA 1KFXL 1PM7A 1QOTA 4FO9A 3RI9A 1CGPA 3AJZA 2RHPA 3RI8A 5C9AA 2OUHA 4Z8BA 3RJRA 2CTVA 4XYXA 4Q2FA 2XL7A 1R093 1U5YA 2JE9A 1SCRA 2ZX4A 1APNA 2EF6A 1HLCA 3OBTA 4AI3A 2ZGRA 1X82A 3NJZA 3ZYRA 2PAKA 2XBO3 1NCRB 3E5UA 1D4M2 1YFYA 4O9GA 4IV1C 1F5FA 2HWE2 4WM8C 4AYUA 5BUVA 1FPN1 1NY71 4WZCA 1OOPC 4XBLA 4L2NA 1VAMA 4GALA 4YFWA 3WLUA 3J8F2 3JBG1 4YVSC 4WM7C 1AX0A 3O0VA 4COZA 1QQP2 2AR6A 4JGZC 4Y20B 5T50A 2WNVA 1RVF1 1ZNPA 3HT1A 1BVP1 1IS5A 2NM1A 2DU1A 2WFPA 4N43A 3FJSA 2KA3A 1N3PA 1GQGA 4R9AA 3WOGA 2RS51 1PVC1 4X6QB 5D8AC 5EZWA 1O3TA 2BFUS 1AR82 4YGDA 1BBT3 3IDBB 4FPLA 2HWF1 2WNUA 1V6JA 3AZVA 2WNEA 4XXAA 5FLJA 3ZXDA 3ZN4A 4RA0A 3VBRA 1LR5A 1MZEA 4RS5B 4YM3A 5KHGA 4X6RB 1DQ4A 5CB7A 1RUI3 5J96B 4LBOA 1C8M1 1SEFA 3ELNA 1KXGA 5D1IA 3ZXGA 2CAUA 2IZWA 1ZZBA 3WHUA 1YI7A 1F9KA 3POSA 4R9BA 4AXOA 2VVFA 1F31A 2X29A 4JV4A 4YVWC 1H8TC 2H6BA 4AWDA 4LBQA 2DWRA 5KBFA 3M3OA 3GF6A 3VUOA 1L3JA 4AE2A 4XQ4A 2YYOA 4N9IA 4XPVA 1DQ0A 2BGCA 2R30A 3KGLA 4W6XA 3H50A 1FOD1 3INAA 1EPWA 1DGRN 3M8LA 4JGYA 2A75A 4HL0A 5C8WA 3AP6A 5JZGB 2WZR1 4FXKB 1AR73 3N35A 4IEWA 1D4VB 1A6CA 2PHDA 3ZSLA 1GZ9A 4HKOA 2Y26A 4AVAA 1VBB2 3O5SA 2PHTA 2A71A 2G9GA 5GLUA 3VDDC 1GZWA 2W39A 1OMIA 3KSCA 1VBB3 1QHDA 2VPVA 4COVA 3VBHB 4GH4A 1VBE2 2BNMA 1YLLA 5JCTA 1RMU1 4BYYA 2ZMKA 4ISQA 4AEDC 2JG8C 3CF6E 1E57A 1R1ZA 2JEMA 4CP0A 4FSJA 4BH9A 1V6NA 4BLJA 2DCJA 4Q0PA 1MS8A 3TN91 2DCYA 1PVXA 2ZZJA 2RMU3 1CAWA 1RUE1 1ALYA 1UN1A 1FNYA 4XTMA 4F7ZA 2WINB 5LRRA 1WD4A 4DNYA 2R071 3ZFGA 4E4ZA 4XFHA 1YO8A 2PAEA 4JDOA 4BMEA 2ARBA 1QH6A 3SISA 3VBFB 1LHOA 3H3UA 3VHOA 1UX6A 4B29A 2P3JA 2Y38A 4QPIC 1LCLA 2CGNA 4LEJA 3MPPG 1MACA 3RJ2X 4DOUA 3KCXA 2MEV2 2V09A 4LULA 1ENSA 4XMAA 3ZFFC 2D98A 1QOOA 1LHVA 3ZX7A 2XJPA 5A3MA 1S0BA 4H55A 1O91A 1LHWA 3JB4C 5GLVA 2Q4SA 5FOJB 5B2GB 2LM3A 2B42B 5HCBA 2QCSB 1TMF1 2XLAA 1RL3A 1DQ1A 5CFDC 3AYCA 4C91A 2YHJA 3P3PA 4CDUB 1OD5A 4Z82A 2BVVA 1Q8SA 4COWA 2IXIA 4LE4A 5LRSA 1H9PA 2P37A 1AL22 4CEYB 1V9U3 5JPMB 3ES4A 2A6VA 3VBSA 1VBC3 2HEVF 3RNSA 1AR92 5I8SA 4Q4Y2 1Z7S1 1ZRCA 3D5OA 4HETA 1G9DA 1UKRA 1W6PB 1B09A 3O12A 4AHZA 4DB5A