1OI6A

Structure determination of the tmp-complex of evad
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVRGIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQRQGLLPDYTTSQEIERRLTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PCZA361.16
publication title The Position of a Key Tyrosine in Dtdp-4-Keto-6-Deoxy-D-Glucose-5-Epimerase (Evad) Alters the Substrate Profile for This Rmlc-Like Enzyme
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Isomerase
total genus 50
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oi6A00
2K0GA 3BU7A 1FT9A 1DZTA 2ET7A 3TNQA 3ZDSA 1LRHA 5JR7B 4RD7A 1O4TA 4BYYA 3PLQA 3VHRA 2GAUA 4AQ2A 4QM8A 2GZWA 2EVXA 4OFGA 2GC2A 4UBGA 1CAWA 1G6NA 3E6CC 3N4MA 1CAUB 5EFUA 4XF4A 1X8EA 1O5LA 5BY5A 1V70A 2XL9A 2D40A 4LUKA 2XLGA 1ZRFA 1RTVA 3M3IA 3KSCA 3JZVA 2PAEA 3H9AA 1XE8A 4B29A 4BHPA 3CO2A 1LKNA 3E6DA 3LWCA 1ZZ9A 2GH2A 3SHRA 5J48A 4YNIA 2BEOA 1YFYA 2H0VA 2XKPA 3C3VA 3USSA 4Z07A 3NKTA 2PYTA 2GC0A 2PQQA 3MZHA 2H6BA 4HMZA 3RPQA 3WW2A 4N9HA 3H7JA 4YSFA 3E5UA 5JCTA 3EQEA 1J3QA 2Q1ZB 4NVPA 3I54A 2Y0OA 5LRSA 2I45A 4X6QB 1RGSA 3FZ3A 4ORFA 1XRUA 2GC1A 2V09A 3H1WA 4FBFA 5I0TA 2XLAA 4META 3GYDA 4MGYE 1J1LA 1O5UA 3S7IA 4LLOA 1Y3TA 3RYKA 1Y9QA 2OA2A 1UPIA 3KMHA 4QMAA 5FPXA 4QM9A 5E1RA 3NSTA 3H8UA 3NVCA 4AVCA 1CAVA 1PMIA 1UW8A 4HN1A 5CU1A 2PFWA 4K8FA 2B8MA 3H1YA 4ZU7A 3E5XA 2BNOA 4J1XA 4D7TA 1RUOA 2VECA 3H3UA 3HIFA 5BXXA 2O8QA 3MPBA 1VJ2A 3EHKA 1YWKA 1LB2A 4Q29A 4PIYA 4IEOA 3I59B 3KCCA 4I3PA 1O3QA 1LR5A 4D7SA 3HQXA 3WW4A 3KGLA 1CAUA 4LA3A 4KU8A 1O3RA 2MHFA 3ES4A 3IDBB 4IESA 1X7NA 4JVAA 4PIZA 2IC1A 1YHFA 4AXOA 2UYBA 2P17A 1NXMA 2E9QA 3CL1A 5FLJA 2ATFA 2UY9A 4XFGA 4HBNA 3LA3A 4HN0A 2WFPA 4MH0E 1I6XA 3M70A 3OCPA 1CAXB 2CAVA 3D0JA 1UIJA 4KL1A 2C0ZA 5FQ0B 2IXKA 5JAXA 3S0MA 4OLLA 1RL3A 3RYRA 3B02A 1PM7A 5FCCA 3BB6A 4F8AA 2XL7A 5KHJA 3D0SA 4PJYA 1YLLA 2DCTA 4R52A 1NE4A 1DGRA 1SFNA 4O9EA 3OF1A 2PA7A 3IBMA 4EWAA 1ZZBA 3HT1A 1JUHA 1U12A 5KHHA 4MGIE 4TLFA 4Q0QA 2IXJA 4WVZA 3E5QA 4IEUA 2MPFA 3IDCB 3U0ZA 3IIAA 2EAAA 4E2QA 3NW4A 3H1MA 4R8HA 3CF6E 1QXJA 3TNPB 1FI2A 3FE5A 2GC3A 1L3JA 4XFBA 2BNNA 2Q30A 5FLIA 3PVBB 4AVAA 3KGZA 1YUDA 1UCXA 1YFXA 5J3UA 3NL1A 2CAUA 3MYXA 4IEWA 2PHLA 4XFCA 3H7YA 5KHIA 1DZRA 1EY2A 2UYAA 4Q0PA 5EZWA 1GQGA 1ZZ8A 4XF3A 2QVSB 1J58A 3ACLA 4XFHA 1O3SA 2XKOA 4ZU4A 1CGPA 4E2GA 4EWEA 2QDRA 4J1WA 1QWRA 1X82A 2BYVE 4JV4A 4XFAA 2EA7A 3DL3A 4ZU5A 4Z82A 2O1QA 3BCWA 4O9GA 4MUVA 4KU7A 2XHKA 3ST7A 5I0UA 1ZZCA 1ZRDA 3SCGA 3OTFA 1RC6A 1UD1A 1OMIA 1FXZA 2B5HA 5JSOA 3LAGA 5C6CA 3L2HA 5FDBA 5CADA 4KWKA 3ETQA 2IXCA 2IXIA 4EV0A 3WW1A 4FAHA 1VP6A 2BGCA 4LA2A 3E97A 3CEWA 4GULA 2OZJA 4FAGA 4IEXA 3SCHA 4I01A 1CAXA 1GQHA 3FWEA 3SCFA 4I02A 4Q0UA 4KWJA 2D5HA 5I0RA 1UIKA 2H6CA 4FT8A 1TQ5A 2Q4SA 5LEJA 5C8WA 2PTMA 1EPZA 4HVQA 3FX3A 5CVRA 3EBRA 2VQAA 2ET1A 3NJZA 4XF1A 2IXLA 4IETA 3FJSA 4YRDA 2PHDA 1IPKA 4IERA 4QGNA 3ES1A 3HT2A 4L2NA 4PIXA 1ZRRA 3QACA 1Q43A 1O7FA 4JTOA 4MV2A 5BPXA 2BNMA 1NYWA 3O14A 1WGPA 1ZREA 1QY4A 4CYDA 3I7DA 4QX5A 4DINB 1DGWA 2MNGA 4MGKE 4P9GA 4AQ6A 4IEQA 1YFWA 1YFUA 3R6SA 1J59A 4I0BA 4WZCA 2N7GA 2XGXA 5I8SA 2FQPA 3H50A 5BV6A 2OYZA 2WC2A 5K8SA 5FPZA 4YARA 3GBFA 5I91A 1IPJA 3U11A 4HLTA 4LUMA 4E2SA 4BH9A 4HVOA 4XFIA 1SQ4A 5HI0A 5I8YA 2OZ6A 5LEKA 4MZUA 4JTNA 3ELNA 3E6BA 1OI6A 2F4PA 3FFQA 4EROA 4IEYA 1QXRA 4HVRA 4LULA 3RDIA 2ZKLA 1J3RA 4QXKA 5JSRA 2ETEA 4IEVA 2KXLA 5I93A 1Q3EA 4EWDA 1VR3A 1ZZ6A 3D82A 5AVPA 3SMHA 3RYPA 3SXWA 4Q0VA 3FHIB 3EJKA 2VPVA 3U10A 5E16A 1NZCA 3DN7A 5I0SA 1CAWB 5FLHA 4I2OA 2D93A 4IEPA 3LZZA 3ROUA 2Z2SB 4I0AA 5T3NA 1RUNA 3LOIA 3S7EA 2CV6A 3OGJA 2XLFA 3I59A 4F7ZA 3IWZA 1H1IA 4XF0A 2Z69A 3BALA 2FMYA 4MX3A 3WW3A 4IEZA 5LRRA 1ZZ7A 1XE7A 3H3ZA 2PAKA 4L11A 4QGMA 1HW5A 4UBHA 5I8TA 5KBFA 3LA7A 1EYBA 3OD0A 4QGLA 4MGZE 1ZVFA 2B9UA 4XETA 2HKXA 5J7MA 3MDPA 2CGPA 1ZX5A 3BPZA 2IXHA 4X6RB 4AVBA 4I09A 2UY8A 3LA2A 5FQ0A 3UKNA 4LEJA 4H7LA 4UXAA 3QOPA 3UKVA 1NE6A 5KHGA 4YYOA 1EP0A 1OFNA 4WBBA 5D1IA 2QJVA 4ONUA 2GU9A 4XFFA 5JSPA 1ZRCA 4Q0SA 1O3TA 1CX4A 1H1MA 4XF9A 5BUVA 4A2UA 1WLTA 2QCSB 4BIFA 3UKTA 3CLPA 1ZNPA 3RZZA 1WA4A 3RNSA 3DV8A 2HJIA 1OD5A 3CJXA 2QNKA 4XEZA 1X8MA 1I5ZA 3DKWA 4LTAA 5KHKA 4HSJA 2K9ZA 2D5FA 3EO6A 1CAVB 1SEFA 4KWLA 1Q5OA 2PAMA 3PNAA 4HSLA 4HZFA 2ZCWA 1J3PA 2OPKA 3G7DA 5F1RA 2Q0AA 4N9IA
chains in the Genus database with same CATH superfamily
1AYM2 3BU7A 3CIHA 4FPFA 2AGSA 3ZDSA 2ZMNA 3AZYA 1HKDA 1IKQA 3VKLA 5I0DA 2Z79A 4BXSV 3K2OA 2E53A 3JB8A 1PMJX 4XJUA 3I2GA 4ARYA 5A80A 2E32A 4Q26A 4RS5C 4BIOA 4B1MA 1XXNA 2Z4FA 3M8LA 2GC2A 1MS8A 2DFCA 2QQUA 4AI0A 2ZGTA 1G6NA 1N1SA 2YBKA 4ISRA 5HXVA 4QPGA 2JD4A 1CAUB 5FY4A 2CGOA 5F3GA 1VRH3 1MVQA 2HWE3 4XF4A 5DPNA 2QFEA 5DN2A 1X8EA 4Y22A 3V0BA 1S0CA 4OHWA 1GP5A 1HB4A 1EAH2 1X33A 3N7KA 3RJRA 2DUQA 4AGVA 4XPVA 2ZEWA 3THTA 1F5JA 2VNOA 1D4VB 4BQ3A 2QUOA 3OPTA 3MV01 1S0BA 1IG3A 1QJY3 3M3IA 2BGPA 3JZVA 4XXAA 4PT6A 3H9AA 4CP9B 4B29A 4KGGA 3GJBA 2DCJA 5GLTA 2GNBA 2ZGRA 5LA2A 2VUAA 1K5MC 4H2AA 5DDJ1 3MUZ1 1UZYA 3VBSC 1VBA3 3V0BB 1SDDB 3ZN6B 4CUCA 4RGGA 2ZKNA 3UJOA 4FPCA 2XOMA 4GMP3 1RXFA 3IB3A 4HMZA 3CZJA 4FFFA 3WW2A 3F2ZA 3T0DA 2NQYA 4A7KA 4LO7A 3H8XA 2A6YA 3VZMA 4M3CB 1PGSA 1W6PA 5L73A 2YG0A 3PU8A 2F4LA 2YU2A 3E5UA 3MFCA 1J3QA 1UYZA 3HVDA 2G19A 4MLOA 4YM1A 3UJQA 1QOSA 2OKXA 1OH3A 1RVF1 4I0WB 2YC0A 4X6QB 1QH7A 2DV9A 2HWC3 1BZWA 4IV1B 2GH8A 1OVPA 5CEHA 2DF7A 1EV11 3VBHB 1W9SA 3ZIWA 4OMCA 3T3YA 3ECQA 2W0XA 3VDDA 3VD4A 3R4DB 2P3YA 4P9JA 3ZKUA 2A6ZA 1Y3TA 4LLOA 2NYYA 2RJLA 4FPKA 3FFZA 4K20A 3KMHA 2DBNA 1D2QA 2PXJA 3MBWA 2VOXA 4ET7A 5LK7B 1KQRA 1JYXA 1JUIA 2LTNA 4PLMA 4LO6B 2PFWA 4K8FA 2W47A 4LQRA 3VBOB 3LFMA 2WO1A 1KITA 4ZU7A 1OPOA 1RUG1 1PO21 4XC9A 1H8TB 1Y4WA 1Z78A 2ARAA 4XOGA 3E1F1 4J1XA 4Y5SA 1ULEA 1JZ8A 1FMD3 4GWMA 2A6WA 1F8VA 2PLV3 4RR3A 1GP6A 1TZOA 2PHUA 4OI4A 4LOTA 2YC4A 2Z42A 3JD71 2BWCA 4AFCA 4S2DA 2W87A 1KJRA 4BCUA 2VZPA 2XBO3 4ES9A 1GOGA 1A8DA 4LJHA 1MS5A 5JZGB 2R043 4OHXA 4Q29A 4MYEA 3OGSA 3LSDA 4K1ZA 4Z92B 4IV1C 5IWFA 2ZMLA 3ON7A 4I3PA 1AXKA 3VBHC 4CDUA 1O6UA 3W21A 4D7SA 1AR82 3O1PA 4LA3A 4KU8A 4KGQA 3OBTA 2XJVA 1OVSA 1Z7S1 4IE6A 4OUMA 2GDFA 3LDRA 1WCKA 1X7NA 1OD3A 2VVDA 3QBQA 5BNPA 2HWD1 4JGZC 4RA0A 1HJFA 2P17A 1WLDA 1VBB3 3LB9A 3AMPA 2C5DA 1UMIA 3O1RA 1H4HA 3RI8A 1LOEA 3DYMA 3LA3A 4GH4C 2Z5WA 3M70A 3D0JA 1RUE1 1W0NA 3K4DA 4LE3A 4LBQD 1ZRIA 4RGKA 5F3EA 1GP4A 3VBOC 3I2IA 4H7MA 2JWPA 2K2SA 4PLNA 5EJZB 1H8TC 1PM7A 3VD7A 1VRH2 2HWE2 3BB6A 3POEA 1H30A 1HB3A 1Y9MA 1QJFA 2WIIB 1DQ2A 3OGVA 4Q4V3 1G9DA 2A5ZA 2W1QA 3O1OA 4S2HA 1WMFA 4YW5A 2WL1A 3S57A 3H3LA 2EIDA 2V5DA 3B3QE 2RJ2A 4YGEA 2BZDA 2B4KA 3OF1A 3P1IA 5E6HA 2PA7A 5FWEA 1CJPA 1QJY2 4TLGA 5BNQA 4YZ4A 5JZGC 1HB1A 5KHHA 2VL4A 4C91A 5D8AA 2E26A 2KM2A 2WO3A 4TLFA 1ODNA 4Q0QA 4DUXA 1OA3A 3THCA 1W05A 2YGMA 3VN4A 3LEKA 4CU6A 2GMMA 3I3DA 3NRUA 2VY0A 1O4ZA 1BVVA 3B9CA 5FYSA 5IK5A 4CDQA 2XONA 3WDWA 3ABZA 4QKBA 3WV6A 3U0ZA 1PGL2 1VBA2 1VAVA 3IIAA 1GKBA 1ZA4A 5JOWA 5FY0A 3NW4A 1DHKB 1CESA 3TNPB 1VB4A 3BODA 2LW8A 2QKDA 3P5BA 1R093 5L9VA 3KQ4B 1DG6A 5IATA 4YGDA 1IS6A 4QX3A 4HKWA 1H2NA 5FP8A 1DBNA 5CFCA 1W8WA 1W39A 3KF3A 1B09A 2C9AA 4YM3A 1RUD1 4DIQA 1NOVA 2B9VA 3KGZA 1AR63 1Q8PA 4P14A 1LOAA 4COVA 4W6WA 4DXTA 2CGNA 1W9TA 1NA1B 2CAUA 5JXIA 5A33A 3TRSB 1AYN1 4F3JA 1UZWA 2HWC2 3IPVB 2PHLA 3N9MA 4Q4W1 5EP9A 3H7YA 3TN92 4CU7A 2V5YA 1WKYA 5FTTC 4UW3A 4OUSA 3N7JA 1R081 4P9WA 2A73B 4DEQA 2XUEA 2QQWA 4RS5A 1GQGA 3B9IA 1NX9A 1AZDA 3SQOA 1CGPA 1F35A 5T5LA 4E2GA 4LLFA 1ND3A 2ADEA 4EWEA 3IIIA 3NNJA 4GB31 3RSJA 4J1WA 1WD3A 3C7FA 4JV4A 3OY8B 2O0OA 1QQP1 4N7IA 3QCWA 2ARXA 4TYSA 1BBT1 4PF1A 2O1QA 5FZKA 4AI1A 4QX7A 2A3WA 4MUVA 3TAYA 3FLTA 1D4M1 2GSYA 4XYXA 4YW4A 3ST7A 4UOJA 1L7RA 1SLCA 1ZZCA 2LRPA 4QPIB 2E6VA 3LOBA 2J1RA 4CEYA 1UD1A 3ZYIB 4L9BA 4CUGA 1FXZA 1W90A 4H55A 3O1VA 2B5HA 5IFTA 1FMD2 2ZGOA 1NAEA 3LAGA 2R1DA 4LBQB 2PLV2 4A45A 1E5RA 1PX4A 3WZ1A 1I5PA 4EV0A 5LA1A 2WNVA 4YM2A 2BGCA 3MV11 4V1PA 4C0HA 1JYWA 4WVMA 4GULA 4AGRA 3ZSJA 4A3XA 1NA1C 2XBO2 3N9PA 2J1EA 2A75A 2R042 3UGGA 3J8F3 2BFUL 2YZ4A 2ENRA 4CPBA 3FWEA 4FPGA 5FFOC 4CVUA 1DZQA 2DTYA 2BFUS 1NCQB 3ACIA 2C4XA 5FKBA 2JDKA 5FZOA 5I0RA 2Q8CA 2CWMA 1W6MA 2H6CA 5J96B 1FPN1 1H9WA 3J26N 4HVQA 4KMQA 2DDUA 5CVRA 2VQAA 5IT6A 4QQOA 3SC7X 2RS51 2ET1A 1N3QA 2Y60A 4YW7A 1VBB2 2ZX2A 4IERA 3SEPA 4CZSA 2R063 2VTXA 2VJXA 3HT2A 4L2NA 5FMOL 1ZRRA 1LOFC 4NMIA 3VV1A 4XABA 5FMOS 3H0OA 1VBE3 2ZS6B 1HRV3 1Q43A 2CU5A 3POJA 2XHNA 1DGRN 2VMHA 4MV2A 1PO13 4CP9A 4UF0A 2BNMA 4Q4V2 5DAXA 4CCLA 3POIA 3U78A 1WGPA 5JMCA 1DP0A 4P5YA 4DOUA 1ZREA 4PF5A 4CYDA 2VMFA 3I7DA 5L7OA 4DINB 1OLMA 5FP4A 2VULA 3WDVA 4AQ6A 2QTWB 5FYZA 3WNXA 1R64A 4AFBA 1JH5A 3GZTB 2BQPA 4Y20B 1F9KA 2FCVA 1YRZA 1DLLA 1F4HA 4XW3A 1C8NA 1DGWX 1NCQC 1ZA7A 4XBLA 5EJ3A 4ISQA 3H50A 3O0VA 4XURA 1CIYA 1JOPA 3GCXA 5T52A 1IZ3A 4IW3A 1GMMA 2Y6HA 1LHVA 3OPZA 3A21A 1LENA 4E9KA 1UO9A 3GBFA 3OPWA 2ZOEB 3CHXA 4V2VA 1IPJA 4RQPC 1R092 1JZ6A 4HLTA 4LUMA 1REDA 5FPLA 1D0HA 2PMWB 2QZ2A 4ZY9A 3AXEA 1RUF1 1WCUA 1VBC1 1W6OB 2I07B 5F3IA 4PDWB 5JR2A 5I8YA 3WF4A 1GSLA 2R071 2Y6GA 1XU1A 4MZUA 1AR71 3ETPA 3I97A 1OF3A 2VMIA 5EV7A 3T1MA 1AR62 4X8NA 2VM9A 3KD4A 1CPMA 3LDKA 4H14A 1XJAA 2CWSA 5J37A 2AC1A 3FFQA 4EROA 4D6RA 2PN5A 5A3WA 4XQ4A 4FPHA 1CPNA 4Q5OA 3U1XA 3RDIA 5CISA 2RDRA 2VMCA 1O8PA 1FOD1 1SACA 5JSRA 5FZBA 1JYVA 1XBFA 1JMUB 3ZMNA 5I93A 1PVC3 1UYXA 2X8KA 3NV1A 1Q3EA 4B4PA 3X29B 5J98B 1VR3A 4V2WA 5T5PA 3ZPYA 1GWLA 3WP5A 4Q2FA 2J1VA 4XAAA 3RYPA 2W5FA 4Q0VA 5M0TA 1BEV3 5DABA 4DUWA 4MGSA 3ZYPA 4DS0A 3K51A 4QU1A 3T2TA 4OQ9A 2SBAA 3R4SA 2VMEA 4AVTA 2OVUA 1TME3 2QQKA 3LZZA 4Y22B 1MS3A 5T3NA 4CCDA 3Q9OA 2C1FA 3AFGA 3DXTA 3LOIA 4WM7A 3S7EA 3LCPA 1LOGA 3OGJA 4ZZ8A 1G9AA 1BXHA 3VKMA 1D2SA 1AF9A 3ACFA 3IWZA 4PDWC 4DUVA 1H1IA 1LEMA 5F2SA 2D97A 4J6GA 5FO7B 1H8VA 3CDZB 3MLLA 1QJZA 2VZOA 3D8CA 4QB6A 3T2PA 5LRRA 3NNGA 1XE7A 3UT0A 4RFT0 3ZYRA 3VZLA 2JG9C 2JDUA 2WO2A 1RUC3 1PIV3 3J8F2 3KF5A 4KNCA 1OQ1A 5JLVA 2RS13 1EYBA 2CY6A 3B00A 3OD0A 1NY71 4QGLA 2R49A 4L97A 2B9UA 3RMYA 3WF3A 4Y5TA 3LQCA 5J7MA 5GZFA 1C5HA 3MDPA 1ZX5A 2JE8A 2IXHA 1ASJ3 1PZ7A 5C71A 4KBZA 3KVAA 5A32B 1F2NA 3A0NA 4H7LA 2BUKA 2D3RA 3AVRA 2JIJA 3D5OA 4UXAA 5GLVA 1NQDA 2QE3A 4AVVA 4G9SB 4PCRA 3UKVA 4B8EA 5FJKA 2A1XA 2RM21 4LKSA 1RUH2 2ZACA 3JCIA 2HBUA 5EPAA 4QPGC 1OFNA 1SLBA 1CD3G 2R062 2WSUA 1L7QA 2YFZA 3I49A 2PQSA 1GWMA 2WS91 4M4PA 4Q1RA 5CFDB 5HV0A 4ATEA 2WFF3 1VBE2 3LF7A 1HRV2 4N90A 2J1AA 4QX0A 1CX4A 1HDKA 4QD2A 1PO12 5BUVA 2QCSB 4BIFA 3VDDB 3IZOA 4YZ5A 4Q4Y2 3RZZA 2DUOA 1OOPA 2HJIA 3N9LA 4XEZA 3AC0A 2XG3A 2R0HA 4NIIA 5JOZA 1R1A1 4DMIA 1K42A 4CRQA 3ZXGA 1OC1A 1AXZA 4LHNA 4UFJA 3OEAA 2VW2A 3WR0A 4YFZA 5FIXA 1QEXA 3HBKA 3ORJA 1HN1A 1SEFA 2Y26A 3AMQA 4LBNA 4MGQA 4YVWA 2E7AA 2CYFA 1Q5OA 2DURA 4AHZA 5FY1A 1AXYA 2ZCWA 4NIDA 1SG3A 3BOPA 1OUXA 3WHUA 2D3PA 3SEEA 4QB1A 4MG2A 1RINA 3GBWA 1OLRA 2K0GA 3TNQA 1FT9A 3VZJA 2RMU1 4NIHA 4CXWA 1KDKA 3AKQA 4AW7A 1UYPA 4RR3B 4LMFA 2B42B 4RN5A 1C3HA 4I30A 2HYKA 3MIHA 1O4TA 5K0UA 1XPWA 4M00A 2H0BA 5A6ZA 4KQ7A 5C9AA 5C7GA 4DY5A 1BQPA 1UY0A 1UXXX 2WDBA 4AQ2A 1U5IA 4YLZA 3BGAA 2BV4A 2EVXA 2VW1A 3KV4A 4G4FA 5FXXA 5LW9A 3ZO0B 2CNAA 4CDUB 1ULCA 2XQRA 3VKFC 4RFRB 3NMBA 5EYYA 2D43A 3VDDC 1X9PA 3HBZA 2XH6A 1W9WA 3AJYA 4YG3A 4OULA 1YEWA 1O5LA 3S6PA 1N1VA 3W58A 4BQXA 4R9DA 2C24A 1UF2C 1V70A 1SBDA 1DYOA 5FBZA 4OMDA 5BNPB 2OXBA 1OA2A 1PVC2 2RS31 4PHZA 4WM8B 4PBOA 4Q4X1 5CKNA 1WMXA 1S0IA 3KSCA 4NIAA 1BMV2 4QPIA 1POV0 1HRI3 2DVFA 3PVOA 4ZS2A 4DNYA 5FYHA 3ZXJA 2AZ5A 1UU6A 4BHPA 2BPA2 1BEV2 3CO2A 1LKNA 2W92A 3H8RA 1TE1B 3E6DA 4XIKA 4LBQA 3T30A 5EHDA 4CP0A 1NG0A 3POYA 1ZZ9A 2J42A 4KI5M 4YG6A 3DCQA 1TME2 4HK9A 5FZGA 2WJSA 2D6KA 4QKNA 3UNPA 3WNNA 4N43B 4RR3C 5A7NA 2VXJA 5IVEA 4FPJA 1RUJ1 3WY6A 3M1HA 5GALA 1AYM1 3W59A 5D8AB 4NWWA 1JXNA 4JDMA 3EQEA 4CDUC 4NVPA 4AEMA 2QQOA 1RUC2 1AHSA 1PIV2 4CDQB 4EN0A 5LRSA 2GP3A 1LU1A 2RS12 4QAWA 4IL7A 4BQ5A 3OBZA 1RGSA 1SLTA 3IMNA 3A22A 4FFIA 2V09A 5FOJB 5BNPC 1K5JA 2FZ1A 2J1SA 2ZX3A 4YG0A 4FBFA 2XLAA 3I2OA 4Y1YA 2ZGPA 1PNFA 3I2KA 1AUYA 1ASJ2 3GYDA 3KZ4C 4OZXA 1J1LA 1QHDA 1O5UA 1RMU2 3ENRA 4FTSA 5ANNA 4A6OA 3BN6A 3WXPA 1V6NA 2OA2A 1EAH1 3V56A 1AR93 1DU3D 1H4GA 5BNNA 4BU2A 2JECA 5BNOB 3K77A 4RHV3 3BTXA 4GQ7A 2LUWA 4QMAA 1RIRA 5FPXA 4QM9A 4XACA 5F32A 3NVCA 3OJBA 2DCYA 2QQPA 4UW6A 4XTPA 1LGNA 5LB6A 2ZZJA 1UW8A 2VVEA 4NHMA 5LATA 3CNAA 1GFF2 2WFF2 3GGLA 1ZM1A 3OUHA 5FBJA 5DZEA 2QQVA 3DPRB 3AL5A 3OBAA 1VALA 1IQDC 4YW6A 3WLUA 1SHWB 4LBOA 4AVSA 2VECA 2YYOA 1UY3A 1ND3B 1C57A 5D8AC 4HANA 3EB7A 1JZ2A 1UYYA 2DCZA 2BJSA 1YWKA 3D4KA 3OGGA 4CDQC 2XMLA 1LB2A 1IS5A 1YQ5A 2VNGA 1U5YA 4PIYA 2J1UA 4IEOA 4C8DA 4JDOA 5HCBA 4EE2A 3TEWA 2DCKA 3AXDA 1W0PA 1UZVA 1O3QA 3ZFGA 3N3HA 3HQXA 3KGLA 2BTVC 2EIBA 3IAPA 2DU1A 3FHQA 4IV3B 4UAPA 3ZYHA 2BVVA 4ASLA 2WWUA 1QXPA 3MPPG 1T6GC 2E7TA 3ZIXA 5CFCC 4YPJA 1JI6A 2IC1A 2QBXA 1F15A 4M0HA 4QQPA 5D21A 4PQ9A 5JVVA 4WVMB 2CL2A 1NXMA 3R05A 5FPAA 4QB2A 3CL1A 5FLJA 4XFGA 4FPYA 1MS1A 3INAA 3I2HA 3MEPA 2JKXA 2WFPA 4LHSA 1RB8G 3MIDA 1JHNA 1VBD2 4AHWA 1UIJA 3ZXAC 5FQ0B 1H6YA 2JXAA 2VTXJ 5LBEA 1TMF3 1RL3A 5FZOB 3KVBA 5FZEA 5GZDA 1TNRA 3NJXA 3OBRA 4F8AA 2EAKA 3I2FA 1W6MB 5F1RA 1REFA 3B94A 3MIEA 1O8SA 2DCTA 1ND3C 5F6LB 5IJRA 5FP7A 2KR2A 4QQHA 3VHNA 4O9EA 1Q8SA 5LASA 1UMHA 2OQ6A 3IBMA 4HOOA 1ZZBA 5FZCA 1EPWA 1WMEA 3ZXFA 1U12A 3M2MA 4FQZA 4U2AA 1HRI2 4CDXA 3ZFFA 2X53S 1CN1A 5E8AA 2IXJA 2YY1A 3I3MA 5A70A 3V0AA 1Y9GA 1W8UA 1QOTA 1WUVA 4TN7A 2VD7A 5C4WA 1GQPA 4DQAA 4CEYC 3IDCB 4Q8KA 4YZ1A 1QH6A 4UF0B 1GLHA 4XDQA 1NLRA 4JDNA 4MHUA 5IVBA 2ORXA 4AE2A 4KBBA 3ZYBA 1FI2A 1QOOA 5JMOA 3FE5A 3VD3A 2WNVC 2BWAA 5L7OB 5FRAA 4NAOA 4Y33A 2E7QA 2VBPA 1AR81 1FX5A 1RUI1 4E4SA 4YVSA 1MEC3 4DFSA 4GJZA 5G05L 1CZSA 2Q30A 5FLIA 3PVBB 4EN6B 1JN2P 4YGCA 4AVAA 1YUDA 5KWRA 1UCXA 1YFXA 1PGW1 1CVNA 4L92A 5SV5A 3ZYGA 3MO4A 5A6XA 1VMHA 1YQ6A 3SISA 4AK3A 4TSVA 2PHFA 1APNA 2W2IA 3AP5A 4GXLA 3WNKA 1DZRA 4ZS3A 2UYAA 3NV4A 3T2OA 2QDNA 4O7XA 1KDMA 3WDTA 3WF0A 1S0EA 3TN93 1OPMA 5CFDA 2ERFA 1CJDA 4CE8A 5DUVA 4LHLA 1OT5A 1VRH1 2HWE1 3PUAA 4KWUA 2WINB 4CU9A 4LIUA 2ZGKA 2BBVA 1QWRA 1W8FA 1X82A 2WA4A 1AR92 2LROA 3DL3A 2VOTA 4RHV2 4QT6A 4J25A 3WUDA 4N53A 3VKOA 4FOYA 1V6OA 1QJEA 1VMJA 1WCQA 1QJY1 4X8PA 2A3YA 3RRDA 3BTZA 4YM0A 3T4VA 4UFKA 3CMGA 5L7OC 4XDOA 3K3NA 5GM0A 5BYNA 3AMNA 1ZRDA 3SCGA 3VKNA 5A6QA 4K9SA 1SFPA 2OUHA 4CCCA 1Z7S3 1VBA1 3POWA 3O1SA 1PGL1 4N8MA 3VDCA 2NN8A 3AM2A 3AL6A 3WW1A 4CCKA 1VP6A 3DUIA 2VH9A 3W9AA 4FAHA 3W5NA 4XVHA 3GNEA 2VNRA 4FAGA 2ZHLA 1O91A 4GMP1 5F5CA 2FDKA 5FXZA 1JOBA 1GNZA 1RXGA 2VW0A 2ZAHA 2ZHKA 3SCHA 2ADDA 2IVIB 2ZHNA 3PUQA 5D2AA 4W6YA 5FPBA 2VMDA 3WG1A 4KWJA 4WM7B 5KXEA 3ZFEA 2FD8A 1JW6A 4XE9A 4FT8A 1TQ5A 2Q4SA 1EPZA 5FUIA 1ULGA 4QPYA 4QHOA 3FX3A 4IE7A 2D6PA 4FP3A 1GZWA 2HWC1 3SKJE 2WWSA 5FZLA 5IVFA 3HJRA 2AYHA 4MXVA 2ARCA 2LS6A 3WHTA 2W3JA 2IXLA 4MHRA 3FJSA 3SKVA 4CUAA 2PHDA 2D98A 2ILMA 2VOKA 4GIQA 3ES1A 4PIXA 3TB0A 3OUJA 4CCEA 3AK0A 1RJ7A 4WM8A 4BMEA 1UKGA 1BKZA 1WA6X 3L2YA 4CXXA 1TVGA 1CIWA 3VGIA 1H6XA 3I4IA 1JTZX 1SMVA 1TMF2 5FMBA 1N3OA 2EIEA 3LFIA 4FPLA 4NO4A 3WD5A 4TZDA 3TBDA 3WNMA 4P08A 1Z0HA 3AVSA 2X09A 1A8MA 2BBAA 2MNGA 3OB8A 4FOWA 2YBSA 4AL9A 4CEWA 2JDHA 3WCSA 1S1AA 1EUUA 1PK6A 3O5SA 4N43A 5F5QA 4I0BA 3CJIA 3TEZA 2F6BA 4Q8LA 2VG9A 1C8M1 1D0GA 1HV0A 1FMD1 1POQA 2N7GA 3BOWA 2VO5A 5I8SA 3VBFB 1S2BA 1KS4A 2FQPA 4WM7C 5BV6A 2OYZA 4LPLA 5FPZA 2JDPA 2R1BA 3VHOA 2XBO1 4EQVA 5B4XA 4LOSA 2R041 3R4UA 3WOGA 1ZBA1 1C1FA 4GWJA 3U11A 1OOPB 1UPSA 1FNYA 2Y8KA 5FZMA 2B45X 1POV3 2VZSA 3OOXA 1MEC2 1SBFA 2YGLA 3N7LA 5FOBB 4CCNA 2P6CA 3N35A 5B4NA 1W8OA 2VBDA 2R32A 3E6BA 4YVWB 3IKWA 1WCSA 3MIFA 1LHUA 1OI6A 1VBB1 4OVEA 4RSUA 3D6EA 2XXZA 5BNOA 1BBT3 3A7QA 4OHYA 4GD4A 4LULA 1BLZA 2ZKLA 4QXKA 1AL23 2ETEA 2Y34A 5FPUA 3S30A 4AFMA 2X10A 2TUNA 4QHBA 1OLQA 5CIRA 4OUEA 3S5AA 2GP5A 4R9BA 5K0UB 2OX0A 4D7YA 1XNDA 1ZZ6A 1GOFA 3DPRA 5AVPA 2MEV3 4EJRA 4NPLA 1MACA 2EXKA 3SITA 3SMHA 5C9AB 1REEA 4NPRA 5FAXA 3FHIB 4Y1UA 1NCRA 3PJYA 3U10A 4DPNA 1JYCA 1NZCA 3DN7A 5FUNA 5T55A 4TTGA 4XUTA 1I1EA 4I2OA 3Q8FA 1ENQA 3B93A 3FBYA 4YFWA 3VD5A 4AI3A 3HWJA 4D6QA 3WQ7A 3ROUA 4D8MA 2Z2SB 1RUNA 3WEZA 2VCMA 4DY3A 3GCWA 3B7MA 1OOPC 2B46X 2XWJB 2XJSA 5FMCA 3FLRA 1KEXA 3DYPA 4NIGA 5A3TA 2A6XA 1QMJA 2GNTA 4JKKA 4W50A 1Z7S2 4XF0A 5FZ7A 1AVBA 5FYVA 2WZR3 2VCAA 1YIFA 4FFGA 1CR7A 4IV3A 1QJU3 1SLIA 1WZXA 4MX3A 3WX5A 1R1ZA 3KCXA 4BLIA 4YVWC 4FCAA 1R091 1V9U3 4P02B 2PAKA 4L11A 3EXUA 4QGMA 4AAPA 3ASIA 4KH9A 1HQLA 1W3XA 4B3NA 3PMSA 2RR13 5I8TA 5KBFA 3HEIA 2G1MA 1G86A 2P2KA 3BI3A 1JZ7A 5FZ8A 1HXS1 3NKGA 1AR61 2HKXA 1ENRA 1SFYA 2P3IA 3V65A 4C90A 3BPZA 2VGDA 1IOAA 3NO8A 1SPPA 1W03A 4I09A 2IZWA 2UY8A 4GWNA 5FQ0A 5K0UC 3LDBA 3UKNA 4NHKA 1PMHX 4E27A 3B69A 3AYCA 3VZNA 5A1AA 1VMFA 5C9AC 3H8OA 5FV3A 4LKEA 3MIBA 1AX1A 2JENA 1WWYA 1IKPA 3TEXA 1Q8QA 4L99A 5GZCA 4NRPA 4YYOA 1HV1A 4P9IA 1Y43B 4FVVA 4HK8A 2YXSA 2C26A 4MSVA 1MZ5A 2AR6A 4WBBA 5D1IA 4BQWA 4ONUA 1QNWA 5JSPA 1ZRCA 5JDBA 5H9SA 1G8WA 1RUH3 3PMEA 1H1MA 5T5OA 1HQWA 2Q8OA 3UKTA 4QDSA 3NAPA 3QH6A 5LBBA 5LY1A 3BVCA 2JDMA 1NQJA 4QPIC 3DV8A 4QHZA 3RZMA 4Y24A 5A1FA 3CJXA 3ZSLA 1X8MA 2Q1FA 1I5ZA 5BNNB 1NT0A 2O14A 4LTAA 4IE0A 4Q4Y3 5K7PA 4HSJA 2K9ZA 1RUF3 1VBC3 4QKFA 1W04A 2KD7A 2NMNA 4B1LA 4UW4A 1ULFA 1H2LA 2FBEA 4EN8B 1A6CA 1ZYBA 4COWA 1LECA 2W94A 3G7DA 1J1TA 2Q0AA 4N9IA 3KV6A 5A3NA 1LJ7A 3ZXLA 3J8F1 2ET7A 3UGHA 4R4XA 3HMYA 3ZSEA 3GDBA 3RWNA 5LBCA 4AEDB 2JE9A 2ZGNA 4XJ8A 5IFPA 1OXCA 2KA3A 4XMIA 2VZRA 4BYYA 5F7UA 2NP0A 2AH2A 3PLQA 5A7SA 3MLKA 4HT1T 2B7YA 1CX1A 1S0JA 2HWF3 3BIWE 4UBGA 4PQQA 4AHYA 1CAWA 2D6NA 4IDZA 4MXWA 3RVHA 3ZFGB 5T5JA 4BQ1A 1GANA 3N4MA 5EFUA 1QJX3 1XU2A 4XUPA 1BBT2 1F31A 2R061 2DVBA 4GZ9A 2BU9A 4DXRA 5BY5A 1AL22 1U5ZA 1JZ5A 2XL9A 3O12A 5FZ6A 2D40A 5BNNC 3MF6A 1VBE1 1HRV1 1YYNA 1VPHA 2ZEYA 1RTVA 1PO11 3HNBM 2MEV2 1S2EA 1G9FA 1GNHA 3CU7A 3MW2A 4O65A 5DUXA 3N9NA 3LWCA 1BYHA 4WVVA 2WNUA 4UW5A 3TOJA 1IHMA 3KCYA 5J48A 5IK7A 2BEOA 4ARXA 1KGYA 2H0VA 5FK7A 3PUSA 1H1AA 4GA9A 4WZFA 4CTEA 4Y4YA 5FKCA 3C3VA 1C28A 3USSA 2JDNA 2CTVA 4ZHNA 1MVEA 4Z07A 5C3RA 3NKTA 2FZ2A 1MQTA 2XVGA 3IM0A 2GC0A 4BB3A 1XOYA 1DDLA 2PQQA 2ZXQA 5FZ4A 3AZXA 4N9HA 1M4WA 2WZR2 4UFHA 3FUOA 2QQLA 2BOJA 3H7JA 2I74A 4XQDA 1QJU2 3VBUB 5T50A 3ZFFB 4QDRA 2E51A 2G9ZA 1OLME 4YSFA 3I2DA 5JCTA 1V9U2 2Q1ZB 3ZFGC 4AEKA 3V0AB 3M3QA 4P9YA 4CSWA 1ULOA 5C4WB 2FMDA 4A7ZA 4ZKTB 2RR12 4MGTA 1XSQA 2LALA 3FZ3A 1FV2A 1XRUA 2GC1A 4ORFA 3C7GA 2WQ4A 1CQ9A 3DXUA 2XJQA 4B7KA 5ACA3 1YO8A 2OW4A 4META 4M3CE 1LEDA 2TBVA 3CBNA 5FY7A 2E63A 3J7NA 4MGYE 3F95A 4JRLA 5LA9A 3U4XA 3GBGA 1DYKA 3MFAA 1QU0A 2V4VA 4YVSB 2WT2A 1YI9A 1GZTA 1BCXA 2VR4A 3AMMA 4QDQA 3RZKA 1UPIA 2NMOA 1RMU3 4LKDA 4Z2AA 1PVC1 4IE4A 2JG8A 3H8UA 1RHI3 1CAVA 4NE9A 5A3UA 1OKOA 4JZRA 4FO9A 1BMV1 1PMIA 1QKQA 3AP4A 4HN1A 3WF2A 1GICA 5CU1A 3I8TA 4M01A 5GLWA 1BEV1 1GWKA 1JU4A 2B8MA 2Q1MA 2HWB3 3E5XA 1W6NB 1LODA 5FP9A 1WLWA 3SH3A 2RV9A 4XUOA 4D7TA 3VBFA 2CHHA 4CP2A 1RUOA 2Y0IA 2P1BA 2VZ3A 3R0RA 3H3UA 1COV3 1TME1 4CDXC 2VUDA 1UKRA 2XR4A 4OI1A 3UYJA 3ZFFC 1K3IA 2JICA 5AC91 1UZ0A 3AX4A 3MPBA 4WV8A 3AKPA 3EHKA 2BP6A 5C4WC 4N53B 1RUF2 1STMA 1VBC2 1GZ9A 1UU4A 2PHRA 3ZR5A 3I59B 2OPWA 2D44A 4UWDA 3FN9A 1W8HA 2XVLA 3O1MA 3RG0A 4D94A 5TSWA 4IGQA 1LGBA 3GHMA 1VAMA 1D7PM 1PM4A 1RUC1 1WW5A 2MHFA 3IDBB 1PIV1 4IESA 4S2GA 5K9YA 1O3RA 1V6JA 2ZAAA 4JVAA 2AEZA 2RS11 4JGYA 4PIZA 2ZJCA 2OIIA 3ITQA 4YVSC 5FJHA 4AXOA 5FWJA 2ZGLA 2UYBA 5FUPA 2RVAA 3A23A 2HYXA 2NLRA 4FSJA 5DZGA 1LHWA 5GZGA 2E9QA 3JQWA 1UXZA 4K3UA 1ASJ1 2WLQA 5LCWL 5GJ6A 4NJ4A 1GBGA 4HN0A 4MH0E 3USUB 1I6XA 3OCPA 5FXWA 2CAVA 2HWF2 1O4YA 4FTBA 4XJWA 1OHFA 4IXLA 2WT0A 5DAPA 4E8CA 3S0MA 2DTWA 4IE5A 4OLLA 1I9RA 4QQ2A 3RYRA 3B02A 5FCCA 1QJX2 3ZFEB 4BJ0A 5LWBA 1W2TA 5A3OA 1S0GA 5CFDC 4ZONA 2DVDA 1VBD3 1YCIA 1YLLA 2RDSA 1GU3A 3N9OA 1ZBE3 1GZWB 1N1YA 3MUY1 5CG8A 2VCCA 1JOJA 2WFF1 2YBPA 4EWAA 2WR9A 2XJTA 4P9XA 2WA3A 4IGOA 3HT1A 4N53C 3B5LB 3ZPOA 2IFRA 3ZX7A 1RUJ3 1K12A 4R4ZA 3FL7A 1KFXL 4MGIE 4DRVA 4A4AA 1ALYA 4WVZA 3E5QA 3PVNA 1IPSA 4DB5A 2JB4A 4XXPA 2Y38A 5A7OA 3FLPA 5JXGA 3EMRA 2F17A 3WQ1A 2EAAA 2JB8A 1OQEA 3JBG3 4E2QA 1OUSA 5A3PA 5JXJA 3H1MA 4R8HA 3CF6E 5DUUA 4CXYA 4OI0A 3LGRA 5FY9A 3J7LA 4BPZA 2UWAA 2ARBA 3WP3A 5IVYA 3VBRB 1T6BX 4CEWB 2WUHA 2WNEA 2DUPA 4PBPA 4ZPIA 1PK6B 3AJZA 4FQ4A 2P5BA 2PELA 3GZAA 1JHJA 2GMEA 3C2UA 4Y1ZA 5IK8A 5C70A 3CJIB 2VE1A 2HLEA 1FV3A 2SLIA 5J3UA 5CKQA 3B01A 3CZUA 1G9CA 3ZFEC 1Y7BA 2RM22 2YPJA 2QZ3A 4IEWA 4NN0A 2Y6KA 2EICA 4XFCA 3OEBA 4HKLA 5KHIA 3IMMA 4CCOA 2C9KA 5DXDA 5ACA2 2FDIA 1QGLA 4XF3A 4FPEA 3FUQA 1SDWA 5DAVA 2VAUA 1O3SA 4ZU4A 4AQTA 2WQ8A 3HD8B 2RDQA 2QDRA 4BE3A 1N1TA 3RJ2X 4WM8C 2EA7A 5CZKA 2PHXA 2ID4A 5DAWA 1A34A 3LPGA 2VQUA 4Z82A 4ZU5A 3WDXA 3K75B 1RHI2 5A3LA 4YWAA 5F37A 4AGGA 3NQHA 1V6IA 2C6SA 1HLCA 3K4ZA 3MF9A 3PIGA 4KU7A 5EWSA 2TNFA 5I0UA 3OUIA 2HWB2 5C8CA 3OTFA 1RC6A 2Q8EA 1LULA 4CEWC 2HH9A 5C3PA 4LT5A 5L9BA 3KHCA 1ONAA 1PK6C 5JSOA 2VTFA 3MI8A 1WBLA 1COV2 1T2XA 4LITA 1H0BA 4N43C 5CADA 5FDBA 5JOXA 3CJIC 3ETQA 2IXCA 2IXIA 4BDVB 1W8ZA 1JZ3A 3N7MA 2B39A 1C4RA 3CEWA 4XDPA 5FYYA 3ZXKA 1NCRB 3AMHA 3MW4A 4OHZA 4AEDA 3ZSKA 1CZVA 1CAXA 5APAA 1JS9A 4NUBA 1IS3A 3SCFA 4W65A 4BXFA 1YJLA 3MICA 1UOGA 3HQUA 2XJPA 1ENXA 2HEYF 1UIKA 3THDA 5LZ6A 5LEJA 1N47A 2PTMA 5FYUA 5C8WA 2E33A 5ABJA 1WLCA 5A32A 5FY5A 1WD4A 4LBJA 5IVCA 2DVGA 4XF1A 4LBKA 3GZUC 3AP7A 2VQ0A 2EXJA 4KG0A 4YRDA 3RS6A 3UESA 2V4AA 2G4IA 3MLJA 1IPKA 2FDJA 2RS32 3RZHA 4FPOB 4YZ2A 5BNOC 3PUHA 2WBKA 5DG2A 4ZZ5A 3ILFA 3IDAA 3K46A 2W52A 4XCBA 1AR91 3FC0A 1ACCA 1O7FA 3M7AA 1JYIA 4JTOA 4RHV1 3POSA 4LO4B 2IFWA 3K48A 3O14A 3IT8A 3PIJA 4CU8A 1SPPB 1LAJA 1NLQA 3OD4A 1I3HA 1ZBE2 1QY4A 2FCUA 3DPRC 4JQRA 1MS0A 2XDVA 1OFSA 1CONA 1UAIA 1OSGA 4JAAA 4QX5A 4MGKE 2DYCA 3ALQA 4P9GA 5FO9B 1W28A 2JDYA 2VUCA 2ZGQA 5E88A 1ULDA 1YFWA 3V64A 1NCRC 3PDQA 5DDJ3 3R6SA 2CDOA 4EZHA 1J59A 2JX9A 2XB6C 3JXSA 4AR2A 1WCDJ 2VC9A 1RUJ2 3JU9A 1RUI3 4WZCA 1GOHA 2Y6LA 4INDA 2XGXA 4NRMA 5FZ0A 2FDGA 3O1TA 4NR1A 4B7EA 3VBUA 1X36A 5K8SA 3RI9A 3JBG2 5F5IA 5DG1A 1URXA 3NAPB 3VUOA 3FMGA 1XE0A 3OGRA 4QXBA 5CAZA 5I91A 1V00A 4IV3C 1FATA 4HG6B 4LO5B 3AYAA 4E2SA 2WQZC 4XJAA 1UWWA 1RVF3 1UY1A 4BH9A 1TNFA 4HVOA 4XFIA 5DZFA 1SQ4A 2NPIA 3Q8AA 4HL0A 2VVFA 3WG4A 2R7EB 5LEKA 3TWIA 1IG0A 1EV13 1UX7A 2R16A 1S2KA 3DGTA 3PU3A 5L9RA 5F3CA 1DLCA 4A44A 4SBVA 2BERA 2D6LX 2F4PA 4AAXA 4TWTA 1GYKA 2AENA 2GNDA 3FBMA 1BHGA 3FHAA 5AFEA 2E31A 2W08A 5IVJA 1XYOA 4LR4A 5L19A 3NV3A 1UOJA 1XQNA 3AKRA 3WDYA 5EIYB 2YHJA 1TMF1 3ZMOA 4PI2A 3WINE 4EWDA 1XNAA 1MS4A 1JU3A 4HPKA 1AX0A 3D82A 4Y26A 3GHNA 5H9RA 4AFAA 1W6NA 2WN2A 3C7OA 4JQTA 5A7PA 4AFDA 3KHBA 1B35A 4NOTA 2JDAA 4FXGB 3WP4A 5JIUA 3EJKA 1RUG3 1PO23 2VPVA 2WAAA 5L36A 1XSRA 1KS5A 2JKBA 1CAWB 2VBBA 2WN3A 4MXWB 3ZYJB 5I0SA 2FDHA 1Q8VA 3LPFA 2Y6FA 4P5HA 1DQ0A 1W8TA 1YQ8A 3NAPC 4W6XA 2D6MA 3JD73 2CV6A 2W95A 2WZ8A 1KRIA 2ZX4A 2XLFA 3I59A 4L8QA 4ES8A 5HBAA 3MW3A 5CYYA 4N7UA 3Q8CA 2YFUA 2Z69A 3BALA 3ME2A 5ERLA 2VCBA 4CCMA 2VUJA 4AZZA 2ZABA 1OURA 2VZ1A 5EQUA 3H3ZA 2UWBA 3DKQA 5K4LA 4NHXA 1DQ4A 4LBMA 2XJRA 1HW5A 3A4UA 2BGOA 2J7MA 4K40A 2WNUB 1QIQA 5G04L 3LA7A 4CCJA 1MEC1 4E8DA 2HWD3 3ZOIA 5C3SA 3RMXA 4MGZE 4AHXA 5FPVA 3WQBA 4I3GA 1ZVFA 2DVAA 4XETA 3ZN5A 3KT7A 1LNSA 4JGZB 3USUA 1H9PA 4LIVA 4OI2A 1MQTB 1XB9A 5GKAC 5ANQA 1JYTA 3QH7A 2ZBJA 1RUE3 4LEJA 1GR3A 1RJ8A 3VHPA 3TYJA 4GH4B 5GZEA 3QOPA 2RJKA 5HV4A 1NE6A 1QNYA 1YIPA 1LHOA 1EP0A 3TN91 5DAQA 1PZ9A 2Y6JA 1YQ2A 2YUEA 3HAGA 1G7YA 2ZHMA 3PTRB 1AJOA 4QXHA 2JEMA 2W1UA 1C8M3 3BKZA 5KXCA 1O3TA 3VLBB 4XF9A 1Q8OA 1WW4A 2BDRA 3PURA 5LY2A 4A2UA 1AL0G 1M06G 1UNBA 4YW2A 2V73A 3CLPA 1ZNPA 2VMGA 3NJVA 4YW3A 1YI7A 1O59A 1WMDA 2DWRA 1OH4A 5IUQA 4A6SA 3U37A 4S2FA 1RYYA 2QNKA 1ZBA3 4EN9B 2Y33A 1UMZA 5FYTA 5DDJ2 4L0PA 4NAMA 4XMAA 4LE4A 5KHKA 5F8PA 4Z1VA 5F6KA 2YC2A 2WNUC 2JG8B 1RUI2 1CAVB 3A0KA 3EO6A 3HNMA 3GZEA 3VBRA 3VDAA 5KC5A 4RGAA 5KXBA 5F5AA 5CB7A 3PNAA 4HSLA 4HZFA 3ATGA 1PGW2 2YROA 1GV9A 2OPKA 2D7FA 2L9LA 4E4ZA 3M3OA 1SCRA 1MQTC 3AZVA 4WVWA 2PLV1 1DZTA 1MPXA 1W06A 1RUD3 5FYBA 4W8JA 4XZUG 2HEVF 1LRHA 1W2UA 4ASKA 4JRAA 3MHZA 4HONA 5JR7B 3T09A 1VLNA 1RVF2 4AOCA 4D69A 2LM3A 4RD7A 1AYN3 2JD9A 4BK5A 3BU0A 1DFQA 4Q4W3 1C1LA 2Y64A 3VHRA 2GAUA 1EV12 3NNMA 2W9XA 4QU2A 3LIHA 4QM8A 1R083 2GZWA 4ZXKA 4OFGA 5SV8A 2ZTNA 2XJUA 2A70A 3O0XA 5LA0A 2JIGA 4LNVA 1GUIA 3E6CC 1DQ5A 3VL9A 1UL9A 1XYNA 2GN3A 2OUJA 3DEMA 2EALA 1UZZA 3KT4A 4FP2A 4GB33 4MO3M 1CWPA 3CQOA 4MVTA 2W68A 1OQDA 1FAYA 1QQP3 4JGYB 1KD7A 1W0OA 4XBNA 1W6QA 4Y3OA 4LUKA 2XLGA 1XNTA 4PLOA 1ZRFA 3ZYFA 3DF0A 2YV8A 2O8OA 3RQ0A 4URTA 2JG8C 1SLLA 1D4M3 2PAEA 2EXIA 2ZZQA 1XE8A 1YXWA 2DU0A 3BYWA 5DMYA 2WAOA 4IQPA 1RUG2 1PO22 4XBQA 3WNPA 3ACHA 1E5SA 4Q4V1 5FR3A 1SBEA 2I2SA 3T4HB 2X5IA 5J1XA 1PZ8A 2GH2A 2WRAA 3GM8A 1A3KA 1BVP1 3SHRA 4YNIA 3M3CA 3VBFC 2W39A 1YFYA 1LHNA 2FCTA 1HIXA 4BWOA 4MADA 3JD72 2XKPA 4R9CA 3D3AA 1E57A 4ITCA 1IS4A 1F4AA 3PUIA 4XILA 4PI0A 1HXS3 1V6LA 2P3KA 2PYTA 1ND2A 2JDZA 5FXVA 3MZHA 2H6BA 3LD8A 1Q56A 2PHTA 3RPQA 5IAXA 4G3YC 5A7WA 4OQ8A 4QX8A 3NNLA 1YC61 4M4RA 4HETA 3I2JA 5C5UA 1JZ4A 4XTMA 3UL2A 3WF1A 5F2WA 3I54A 1FPN3 1OKQA 2Y0OA 4C0BA 1POV1 2I45A 3DYOA 4FFHA 3AP6A 5C5TA 2RS53 2HWD2 4K21A 4HXCA 3HPNA 2VNVA 3H1WA 4JGYC 4XQWA 2RG4A 3J7MA 5FK8A 1W3VA 5I0TA 1X9TA 2WYSA 1LOBA 4LK7A 1VAKA 1SCSA 2ZX1A 3S7IA 3SLIA 1OBNA 1RUE2 3ZXDA 3APBA 3RYKA 1Y9QA 4SLIA 4M3CF 4AF9A 3ZLIA 1W8NA 1AL21 1LESA 4LK6A 3SNMA 5EJ1B 5HCFA 1JYNA 5C3OA 3LIGA 3P3PA 3NSTA 3PVEA 5E1RA 5A7QA 2X05A 4AVCA 3OYWA 1US2A 4QQLA 1FYUA 2WABA 2MEV1 1C8M2 3EYPA 4JKLA 1SLAA 4IGPA 3UETA 3WT3A 1K5MA 3H1YA 5JUVA 2IWGB 2BNOA 3VBSA 2AUYA 1W9YA 1IGOA 4R9AA 1NLSA 4MOAA 3VL8A 2A71A 4AG4A 1GNYA 3M4FA 3H42B 3O1UA 4LXLA 3KT1A 4BLJA 5JXHA 4FI9A 4LO8A 1VB2A 2P37A 3HIFA 1ZBA2 2O8QA 5BXXA 3VB9A 4D0QA 4COYA 5JWPA 1VJ2A 3ILNA 3Q8BA 1VE0A 2VZQA 5JI9A 3I3EA 3POBA 5IW0A 2GNMA 1YNAA 3OG2A 1HN0A 1AJKA 1ST8A 1UX6A 4H3WA 3IAQA 3KCCA 3KWVA 2WZR1 4XJZA 5JPMB 3RFRA 4UT5A 3KB5A 1QJU1 1LR5A 1LGCA 3HOBA 3WW4A 4EN7B 1C5IA 1CAUA 4RQPB 3URFA 1V9U1 5F9TA 5C8CB 4JX0A 2R073 4K6BA 4Y4RA 1AR73 3ES4A 1JODA 1BJQA 1RUD2 2ZPXA 2RR11 1YHFA 4UI9L 5B2GB 1P8JA 4Z2WA 2WWJA 3THPA 1AYN2 3HN3A 1ODMA 4Q4W2 3VDBA 2ATFA 2UY9A 2ZGMA 3O0WA 4HBNA 3KV9A 2OQ7A 4DO0A 1R082 3SH5A 1FOD3 1CAXB 5FYMA 3U07A 1U0AA 1XC6A 4CA9A 1H2KA 4KL1A 2C0ZA 3AB0A 1DQ6A 2IXKA 5JAXA 5CNAA 2VOVA 4LHKA 2WO7A 1U5XA 5ISLA 4GB32 2XL7A 1QF3A 1UU5A 1NKGA 3D0SA 4PJYA 3ZN6A 5KHJA 5ABJB 1MS9A 1NE4A 2XVKA 3OSDA 1DGRA 1QQP2 1SFNA 1S0DA 1YQCA 4R52A 2BVBA 3W5MA 1LCLA 1NXD1 2ZGSA 3ZKYA 1J84A 1W2NA 2RE9A 1RUH1 4COZA 1DCSA 1N3PA 1UY4A 2ZGUA 1JUHA 3JQXA 5JOYA 3KLSA 2QQNA 3WG3A 2VZUA 3VZOA 4M3CA 1D4M2 5FZ3A 5IHRA 3T1LA 2P4EA 4AEJA 3ZM8A 4IEUA 1DQ1A 2QQIA 5JIAA 3UV9A 2UU8A 3W20A 3C8XA 5C8CC 2MPFA 4YZ3A 4Q4Y1 2V72A 3LEIA 4OYUA 4IV1A 3AYDA 3VBHA 1X50A 5FY8A 1QXJA 4FOQA 2P6HA 4E4HA 1KJLA 2IVJA 5FMDA 4K8RB 1IQAA 3JUUA 1XNCA 2D6OX 2DBIA 1HXS2 2GC3A 4JHTA 1L3JA 3HN1A 5GLZA 2W91A 4QX1A 4XFBA 2VXRA 5FYIA 2BNNA 2JG9B 3AP9A 4OZOA 4ZXEA 3AZZA 4YGBA 4XCAA 5FZ9A 4AEDC 4CDWB 4JGZA 4BA6A 1S0FA 4DRRA 2R30A 3WNLA 1QDOA 3N36A 3NL1A 3AKSA 4QPWA 1FPN2 3LKJA 5FYCA 3MYXA 4BMBA 2W46A 1NUKA 3AFKA 2A7AA 4GH4A 2RS52 5CA6A 2K46A 2BOIA 1CZTA 2UURA 3BPSA 5ABJC 5KC6A 2XWBB 1K45A 3VBOA 3BIEA 2P34A 1EY2A 2A3XA 2OS2A 2HWF1 4Q0PA 5EZWA 2NZ9A 2RM23 1H8TA 5J09A 3K4AA 1MR5A 1ZZ8A 2QVSB 1J58A 3ACLA 4XFHA 4A7YA 4Q27A 1KFUL 2XKOA 4AI8A 3K3OA 1QJX1 4COUA 4GMP0 3NWKA 3P6BA 2CSGA 2WS93 3WVJA 4QPGB 1YJKA 4BM8A 2BYVE 4XFAA 3ZR6A 1OA4A 5AC93 2RDNA 4JC1A 2GN7A 3TEYA 5JZGA 2DFBA 4UFMA 2AACA 2X29A 3LSEA 2VOWA 3NV2A 3BCWA 4O9GA 5HXMA 2XQXA 5FZFA 2J22A 4AWDA 3RGBA 4CP1A 2XHKA 1UY2A 1R1A3 2HEWF 2VZVA 4UFIA 4C1XA 3BTYA 4A42A 1MZFA 1OMIA 3MGUA 3RZGA 1G9BA 4Y1VA 1FNZA 1BK1A 4KG8A 5C6CA 3L2HA 4HPKB 4CDWC 4KWKA 1HJGA 2ZX0A 2AREA 5F39A 4LA2A 4AI2A 1B35B 2JE7A 4DEVA 3E97A 4LKFA 1S4CA 2OZJA 4Y1XA 3WSOA 3Q8EA 3J4UH 3VBUC 4IEXA 3L9JT 4NRQA 5DQ0A 2RMU3 3ZSMA 5CBLA 1W9FA 4I01A 1GQHA 3S5QA 4XJ9A 4I02A 4A3ZA 4Q0UA 4P9LA 3MIGA 4HKOA 1WW6A 1NZIA 2D5HA 4BOWA 1E5HA 2UWCA 4QX2A 1W6PB 2R072 1L7LA 5DUWA 1AR72 1E5IA 2ZEXA 3EBRA 1ENSA 1PNGA 3ACGA 3LEMA 4FTEA 4UYBA 1UQXA 3NJZA 1PX3A 1HX6A 4TXWA 4IETA 1PVXA 5ACA1 1LOCA 1UOFA 1V0AA 4C1WA 1V6KA 4GKYA 5IYYA 4QGNA 4FXKB 2ES3A 1FOD2 4NPMA 3QACA 3NJYA 3U75A 2RS33 2PHWA 3C7EA 3RZJA 4Q4X3 5BPXA 1NYWA 1RMU1 2WKKA 4Q1PA 4EZ4A 2EF6A 1RHI1 2YMZA 3U14A 1BK0A 1A78A 3P3NA 3GXUA 4NWVA 4U36A 1DGWA 1MZ6A 1B35C 3DECA 5CKMA 4IEQA 5A1LA 5EYXA 1YFUA 2R0FA 2Q5TA 2XPJA 2HWB1 3C7HA 3M3EA 4RL7A 2WYFA 5KXDA 3N9QA 4XHXA 5J36A 1COV1 5EXOA 3T0BA 4ATFA 4BK4A 4CUBA 3WDUA 4AYUA 1NA1A 3KM5A 2P3JA 2WC2A 3JB4C 3IPVA 3PTYA 4YARA 4EYUA 4Z8BA 1WW7A 4XUQA 3ILRA 1TG7A 1AYM3 1EUTA 4GJYA 3KQRA 2ZEZA 3ZN4A 1RITA 1XYPA 5JPNB 3GJAA 2QQJA 1W2OA 2ORZA 5T54A 4GAZA 5HI0A 4URAA 4NROA 3RWKX 1NY72 2OZ6A 3HQRA 2XUMA 3GF6A 3OY8A 2IUWA 4JTNA 4HFSA 3T2QA 2W1WA 2BW8A 3ELNA 5C3QA 3VZKA 1TEIA 4Y5Z0 5IK4A 5KR7A 1AX2A 5FZAA 4IUGA 4IEYA 1QXRA 3KV5A 5AFBA 4HVRA 3WG2A 1LOFA 4W4ZA 5A3MA 3UGFA 1EAH3 4YW1A 5C33A 1J3RA 2JJ6A 2WZEA 4IEVA 1UOBA 2WNOA 3GALA 5FZHA 4CDXB 2KXLA 1HQNA 3I3BA 3RZLA 1UN1A 1S55A 4O61A 2WS92 2VZTA 2J1TA 1VBD1 3LEGA 3WQ0A 2NM1A 3T0AA 3SH4A 3SXWA 1ZBE1 3UK9A 3J9SA 4UFLA 3LE0A 5AC92 3O7OA 5H9PA 5E16A 2GALA 3WNOA 2AEYA 1DIWA 2WSVA 4XIOA 5FLHA 4F83A 5CG9A 2D93A 4CPBD 1XNBA 2GMPA 4IEPA 3ZVXA 1NCQA 1US3A 3PJQA 3IN9A 4I0AA 4P00B 1R1A2 5IAVA 4JKMA 2ZA9A 3T08A 1JBCA 1DYPA 4GKXA 4AQSA 1W6QB 1MZEA 4DXZA 2W1SA 2R6QA 4F7ZA 5FO8B 4K7JA 4NHLA 5HPOA 1HRI1 4QKDA 4BZ4A 3KS7A 3AYEA 2Q8DA 4NHYA 2YB7A 4RQPA 3JBG1 4DXSA 1HB2A 2FMYA 2YPDA 3WW3A 3VBRC 4IEZA 1GZCA 1ZZ7A 3QD6A 4A41A 4AI9A 4ASMB 2VU9A 4JCKA 1VRBA 3PL0A 3BUCA 1H2MA 2RMU2 3POFA 2X5IB 4UBHA 1W2AX 4FOVA 4QXCA 3PHMA 3G6JB 3WCRA 5CFCB 5FZ1A 2RHPA 4JHZA 1LU2A 2WT1A 2CGPA 4OCTA 1OF4A 3QLQA 4X6RB 5H9QA 4AVBA 1DF0A 1ND2B 2ZMKA 3LA2A 3IDEA 3HNYM 5LK5A 3BTAA 5A7WB 5FZDA 3NNFA 3WUCA 5A33B 3HR9A 4BISA 2EXHA 2CDPA 4RYDA 4XUNA 2OT7A 2VQTA 5KHGA 4Y20A 2WLPA 1QDCA 2D3SA 2G9FA 4RS5B 3VD9A 5FP3A 1W99A 4B4QA 2QJVA 3ZDVA 2GU9A 4DZGA 2TEPA 4XFFA 4K1YA 1F5FA 5A6YA 4Q0SA 4Q4X2 2BRTA 1WLTA 3U4SA 1ULPA 1VIWB 4BQ4A 4D3WA 5FREA 1LTEA 2EIGA 3J7HA 5HCHA 1XNKA 4OHVA 1WA4A 3RNSA 1PHMA 4XZPA 3I3QA 5AVAA 5GLUA 4E4DX 1OD5A 5E89A 5JI7A 1KXGA 2WZPP 4GWIA 2QQMA 1W6OA 5LBFA 4PDWA 2A6VA 3DKWA 2YU1A 5HCAA 4M0NA 4QWNA 4GALA 2X5IC 2G9GA 2FHRA 2D5FA 4CEYB 1SZBA 2YDEA 3AKTA 3OYWB 2FDFA 1DGLA 4D6SA 1J83A 4KWLA 4LBLA 4B4RA 4BQ2A 4XAEA 4LORA 2PAMA 4BQYA 3WP6A 3ZXEA 2JG9A 3POGA 5FZIA 1AR83 5IVVA 1J3PA 1V6MA 3CKHA 1K5MB 3AZWA 4CDWA 4XHBA 2WNVB 1WBFA 3VBSB 1ND2C 2HBTA
chains in the Genus database with same CATH topology
1AYM2 3BU7A 3ZDSA 4FPFA 2AGSA 2ZMNA 3AZYA 1HKDA 1IKQA 3VKLA 2Z79A 2E53A 3JB8A 4XJUA 4Q26A 4RS5C 4BIOA 1XXNA 3M8LA 2GC2A 1MS8A 2DFCA 4AI0A 2ZGTA 1G6NA 1N1SA 4ISRA 5HXVA 4QPGA 2JD4A 1CAUB 2CGOA 1VRH3 1MVQA 2HWE3 4XF4A 2QFEA 1X8EA 4Y22A 3V0BA 1S0CA 4OHWA 1X33A 1EAH2 3N7KA 3RJRA 2DUQA 4AGVA 4XPVA 3THTA 1F5JA 2VNOA 1D4VB 2QUOA 1S0BA 1QJY3 3M3IA 3JZVA 4XXAA 3H9AA 4B29A 4KGGA 2DCJA 5GLTA 2GNBA 2ZGRA 2VUAA 1K5MC 5DDJ1 1UZYA 3VBSC 1VBA3 3ZN6B 4RGGA 2ZKNA 3UJOA 4FPCA 4GMP3 4HMZA 3WW2A 2NQYA 4A7KA 4LO7A 2A6YA 3VZMA 4M3CB 1PGSA 1W6PA 5L73A 3E5UA 3MFCA 1J3QA 4MLOA 4YM1A 3UJQA 1QOSA 1RVF1 4I0WB 2YC0A 4X6QB 1QH7A 2DV9A 2HWC3 1BZWA 4IV1B 2GH8A 2DF7A 1EV11 3VBHB 3ZIWA 3ECQA 2W0XA 3VDDA 3R4DB 4P9JA 2A6ZA 1Y3TA 4LLOA 2NYYA 2RJLA 4FPKA 3FFZA 4K20A 3KMHA 1D2QA 2VOXA 5LK7B 1KQRA 1JUIA 2LTNA 4PLMA 4LO6B 2PFWA 4K8FA 3VBOB 4ZU7A 1KITA 1OPOA 1RUG1 1PO21 1H8TB 4XOGA 1Z78A 4J1XA 1ULEA 1FMD3 4GWMA 2A6WA 1F8VA 2PLV3 4RR3A 4OI4A 2PHUA 2Z42A 3JD71 2BWCA 4AFCA 4S2DA 1KJRA 4BCUA 2XBO3 4ES9A 1A8DA 1MS5A 5JZGB 2R043 4OHXA 4Q29A 4MYEA 3LSDA 4K1ZA 4Z92B 4IV1C 2ZMLA 4I3PA 1AXKA 3VBHC 4CDUA 4D7SA 1AR82 4LA3A 4KU8A 4KGQA 3OBTA 2XJVA 1Z7S1 4OUMA 2GDFA 1WCKA 1X7NA 3QBQA 2VVDA 5BNPA 2HWD1 4JGZC 4RA0A 2P17A 1WLDA 1VBB3 3LB9A 3AMPA 2C5DA 1H4HA 3RI8A 1LOEA 3LA3A 4GH4C 2Z5WA 3M70A 3D0JA 1RUE1 4LE3A 4LBQD 3VBOC 4H7MA 2K2SA 4PLNA 1H8TC 1PM7A 1VRH2 2HWE2 3BB6A 1H30A 4Q4V3 2WIIB 1DQ2A 1G9DA 2A5ZA 4S2HA 1WMFA 4YW5A 2WL1A 4YGEA 3B3QE 3OF1A 2PA7A 1CJPA 1QJY2 5BNQA 4YZ4A 5JZGC 5KHHA 4C91A 5D8AA 2KM2A 4TLFA 4Q0QA 1OA3A 3VN4A 2YGMA 2GMMA 2VY0A 1O4ZA 1BVVA 3B9CA 5IK5A 4CDQA 3WDWA 3WV6A 3U0ZA 1PGL2 1VBA2 1VAVA 3IIAA 1GKBA 1ZA4A 5JOWA 3NW4A 1DHKB 1CESA 3TNPB 1VB4A 3BODA 2QKDA 1R093 1DG6A 4YGDA 1IS6A 4HKWA 1H2NA 1DBNA 5CFCA 1W39A 1B09A 2C9AA 4YM3A 1RUD1 1NOVA 3KGZA 1AR63 1Q8PA 4P14A 1LOAA 4COVA 4W6WA 2CGNA 2CAUA 1NA1B 5A33A 3TRSB 1AYN1 4F3JA 2HWC2 3TN92 3IPVB 2PHLA 4Q4W1 3H7YA 2V5YA 5FTTC 4UW3A 4OUSA 3N7JA 1R081 4P9WA 2A73B 4RS5A 1GQGA 3B9IA 1AZDA 1CGPA 5T5LA 4E2GA 4LLFA 1ND3A 4EWEA 4GB31 3RSJA 4J1WA 1WD3A 4JV4A 3OY8B 2O0OA 1QQP1 4N7IA 3QCWA 2ARXA 4TYSA 1BBT1 2O1QA 4AI1A 2A3WA 4MUVA 3TAYA 3FLTA 1D4M1 2GSYA 4XYXA 4YW4A 3ST7A 1SLCA 1ZZCA 4QPIB 2E6VA 3LOBA 4CEYA 1UD1A 3ZYIB 4L9BA 1FXZA 4H55A 2B5HA 1FMD2 2ZGOA 3LAGA 2R1DA 4LBQB 2PLV2 3WZ1A 4EV0A 2WNVA 4YM2A 2BGCA 4V1PA 4C0HA 4WVMA 4GULA 4AGRA 3ZSJA 4A3XA 1NA1C 2XBO2 2A75A 2R042 3J8F3 2BFUL 2YZ4A 2ENRA 3FWEA 4FPGA 5FFOC 1DZQA 2DTYA 2BFUS 1NCQB 5I0RA 2CWMA 1W6MA 2H6CA 5J96B 1FPN1 1H9WA 3J26N 4HVQA 5CVRA 2VQAA 5IT6A 4QQOA 2RS51 2ET1A 1N3QA 1VBB2 2ZX2A 4IERA 4CZSA 2R063 3HT2A 4L2NA 5FMOL 1ZRRA 1LOFC 3VV1A 5FMOS 3H0OA 1VBE3 2ZS6B 1HRV3 1Q43A 1DGRN 2VMHA 4MV2A 1PO13 2BNMA 4Q4V2 1WGPA 5JMCA 4DOUA 1ZREA 4PF5A 4CYDA 3I7DA 5L7OA 4DINB 2VULA 3WDVA 4AQ6A 3WNXA 4AFBA 1JH5A 3GZTB 2BQPA 4Y20B 1F9KA 1YRZA 1DLLA 4XW3A 1C8NA 1DGWX 1NCQC 4XBLA 5EJ3A 4ISQA 3H50A 3O0VA 5T52A 1IZ3A 3OPZA 1LHVA 4E9KA 1LENA 3GBFA 2ZOEB 1IPJA 4RQPC 1R092 4HLTA 4LUMA 1REDA 1D0HA 2QZ2A 3AXEA 1RUF1 1VBC1 1W6OB 2I07B 4PDWB 5I8YA 1GSLA 2R071 1XU1A 4MZUA 1AR71 3T1MA 2VMIA 5EV7A 1AR62 4X8NA 4H14A 3KD4A 1CPMA 2CWSA 5J37A 3FFQA 4EROA 2PN5A 4XQ4A 4FPHA 1CPNA 3RDIA 1SACA 1FOD1 5JSRA 3ZMNA 5I93A 1PVC3 2X8KA 3NV1A 1Q3EA 4B4PA 3X29B 5J98B 1VR3A 5T5PA 3ZPYA 3WP5A 4Q2FA 3RYPA 4Q0VA 1BEV3 4DS0A 3ZYPA 3K51A 3T2TA 2SBAA 3R4SA 4AVTA 2OVUA 1TME3 3LZZA 4Y22B 1MS3A 5T3NA 3V0BB 3Q9OA 2C1FA 3AFGA 3LOIA 4WM7A 3S7EA 3LCPA 1LOGA 3OGJA 1G9AA 1BXHA 3VKMA 1D2SA 1AF9A 3IWZA 4PDWC 1H1IA 1LEMA 2D97A 4J6GA 5FO7B 1H8VA 3MLLA 1QJZA 3D8CA 5LRRA 1XE7A 4RFT0 3ZYRA 3VZLA 2JG9C 1RUC3 1PIV3 3J8F2 4KNCA 1OQ1A 5JLVA 2RS13 1EYBA 2CY6A 3B00A 3OD0A 1NY71 4QGLA 2R49A 4L97A 2B9UA 3RMYA 5J7MA 5GZFA 1C5HA 3MDPA 1ZX5A 2IXHA 1ASJ3 1PZ7A 1F2NA 3A0NA 4H7LA 2BUKA 2D3RA 5GLVA 4AVVA 3D5OA 4UXAA 1NQDA 2QE3A 4G9SB 4PCRA 3UKVA 4B8EA 2RM21 1RUH2 2ZACA 3JCIA 4QPGC 1OFNA 1SLBA 1CD3G 2R062 2WSUA 4Q1RA 2WS91 5CFDB 4ATEA 2WFF3 1VBE2 4N90A 1HRV2 1CX4A 1HDKA 4QD2A 1PO12 5BUVA 2QCSB 4BIFA 3VDDB 4YZ5A 4Q4Y2 3RZZA 2DUOA 1OOPA 2HJIA 4XEZA 2XG3A 2R0HA 5JOZA 1R1A1 4DMIA 4CRQA 3ZXGA 4LHNA 1AXZA 3WR0A 4YFZA 2VW2A 1SEFA 2Y26A 3AMQA 4LBNA 4YVWA 2E7AA 2CYFA 1Q5OA 2DURA 4AHZA 1AXYA 2ZCWA 3BOPA 3WHUA 2D3PA 1RINA 3GBWA 1OLRA 2K0GA 3TNQA 1FT9A 3VZJA 2RMU1 1KDKA 3AKQA 4AW7A 4RR3B 2B42B 1C3HA 4I30A 2HYKA 3MIHA 1O4TA 5K0UA 4M00A 2H0BA 4KQ7A 5C9AA 4DY5A 1BQPA 4AQ2A 1U5IA 4YLZA 2EVXA 2VW1A 4G4FA 3ZO0B 2CNAA 4CDUB 1ULCA 3VKFC 5EYYA 2D43A 3VDDC 3HBZA 2XH6A 3AJYA 4YG3A 4OULA 1O5LA 3S6PA 1N1VA 3W58A 4R9DA 1UF2C 1V70A 1SBDA 5BNPB 5FBZA 1OA2A 1PVC2 2RS31 4WM8B 4PBOA 4Q4X1 1S0IA 3KSCA 1BMV2 4QPIA 1POV0 1HRI3 2DVFA 3PVOA 4DNYA 3ZXJA 2AZ5A 1UU6A 4BHPA 2BPA2 1BEV2 3CO2A 1LKNA 1TE1B 3E6DA 4XIKA 4LBQA 4CP0A 1NG0A 3POYA 1ZZ9A 4YG6A 1TME2 4HK9A 2WJSA 2D6KA 4N43B 4RR3C 4FPJA 1RUJ1 3WY6A 3M1HA 5GALA 1AYM1 3W59A 5D8AB 4NWWA 1JXNA 4JDMA 3EQEA 4CDUC 4NVPA 4AEMA 1RUC2 1AHSA 1PIV2 4CDQB 4EN0A 5LRSA 1LU1A 2RS12 4IL7A 1RGSA 1SLTA 3IMNA 2V09A 5FOJB 5BNPC 2FZ1A 2ZX3A 4FBFA 4YG0A 2XLAA 4Y1YA 2ZGPA 1PNFA 1ASJ2 1AUYA 3GYDA 3KZ4C 4OZXA 1J1LA 1QHDA 1O5UA 1RMU2 3ENRA 4FTSA 3WXPA 1V6NA 2OA2A 1EAH1 3V56A 1AR93 1DU3D 1H4GA 5BNNA 5BNOB 2JECA 4RHV3 4GQ7A 2LUWA 4QMAA 1RIRA 5FPXA 4QM9A 3NVCA 3OJBA 2DCYA 2QQPA 4UW6A 4XTPA 1LGNA 2ZZJA 1UW8A 2VVEA 4NHMA 3CNAA 1GFF2 2WFF2 1ZM1A 5DZEA 3DPRB 1VALA 3WLUA 4LBOA 4AVSA 2VECA 2YYOA 1ND3B 1C57A 5D8AC 4HANA 2DCZA 1YWKA 3D4KA 3OGGA 4CDQC 1LB2A 1IS5A 2VNGA 1U5YA 4PIYA 4IEOA 4JDOA 5HCBA 2DCKA 3AXDA 1W0PA 1O3QA 3ZFGA 3N3HA 3HQXA 3KGLA 2BTVC 2DU1A 4IV3B 2BVVA 4ASLA 1QXPA 3MPPG 1T6GC 2E7TA 3ZIXA 5CFCC 2IC1A 4M0HA 4QQPA 4PQ9A 5JVVA 4WVMB 2CL2A 1NXMA 3R05A 3CL1A 5FLJA 4XFGA 4FPYA 1MS1A 3INAA 3MEPA 2WFPA 1RB8G 3MIDA 1JHNA 1VBD2 4AHWA 1UIJA 3ZXAC 5FQ0B 2JXAA 1TMF3 1RL3A 5GZDA 1TNRA 3OBRA 4F8AA 2EAKA 1W6MB 5F1RA 1REFA 3B94A 3MIEA 2DCTA 1ND3C 5F6LB 4QQHA 3VHNA 4O9EA 1Q8SA 3IBMA 1ZZBA 1EPWA 1WMEA 3ZXFA 1U12A 3M2MA 4FQZA 4U2AA 1HRI2 4CDXA 3ZFFA 2X53S 1CN1A 5E8AA 2IXJA 2YY1A 3V0AA 1QOTA 1WUVA 5C4WA 4DQAA 4CEYC 3IDCB 4Q8KA 4YZ1A 1QH6A 1GLHA 4XDQA 1NLRA 4JDNA 4AE2A 4KBBA 5L7OB 1FI2A 1QOOA 3FE5A 2WNVC 2BWAA 5FRAA 2E7QA 1AR81 1FX5A 1RUI1 4E4SA 4YVSA 1MEC3 4DFSA 2Q30A 5FLIA 3PVBB 4EN6B 1JN2P 4YGCA 4AVAA 1YUDA 5KWRA 1UCXA 1YFXA 1PGW1 1CVNA 4L92A 5SV5A 3ZYGA 3SISA 4AK3A 4TSVA 2PHFA 1APNA 3AP5A 4GXLA 1DZRA 2UYAA 3NV4A 2QDNA 3WDTA 1KDMA 1S0EA 3TN93 1OPMA 5CFDA 2ERFA 1CJDA 5DUVA 4LHLA 1VRH1 2HWE1 2WINB 2ZGKA 2BBVA 1QWRA 1X82A 2WA4A 1AR92 3DL3A 4RHV2 4QT6A 3WUDA 4N53A 3VKOA 4FOYA 1V6OA 4X8PA 1QJY1 2A3YA 3RRDA 4YM0A 5L7OC 5GM0A 5BYNA 1ZRDA 3AMNA 3SCGA 3VKNA 4K9SA 2OUHA 1Z7S3 1VBA1 3POWA 1PGL1 2NN8A 3AM2A 4FAHA 3WW1A 1VP6A 3DUIA 2VH9A 3W9AA 3GNEA 2VNRA 4FAGA 2ZHLA 1O91A 4GMP1 1GNZA 2VW0A 2ZAHA 2ZHKA 3SCHA 2ZHNA 3WG1A 4W6YA 4KWJA 4WM7B 5KXEA 3ZFEA 1JW6A 4XE9A 4FT8A 1TQ5A 2Q4SA 1EPZA 1ULGA 4QPYA 3FX3A 2D6PA 4FP3A 1GZWA 2HWC1 2WWSA 2AYHA 4MXVA 3WHTA 2IXLA 3FJSA 2PHDA 2D98A 2ILMA 2VOKA 4GIQA 3ES1A 4PIXA 3TB0A 3AK0A 1RJ7A 4WM8A 4BMEA 1UKGA 1BKZA 3L2YA 1CIWA 3VGIA 3I4IA 1JTZX 1SMVA 1TMF2 1N3OA 4TZDA 4FPLA 4NO4A 3WD5A 3TBDA 1Z0HA 1A8MA 2MNGA 4FOWA 4CEWA 3WCSA 1S1AA 1PK6A 3O5SA 4N43A 5F5QA 4I0BA 3CJIA 2F6BA 4Q8LA 2VG9A 1C8M1 1D0GA 1FMD1 1HV0A 2N7GA 3BOWA 5I8SA 3VBFB 1S2BA 1KS4A 2FQPA 4WM7C 5BV6A 2OYZA 5FPZA 2R1BA 3VHOA 2XBO1 2R041 3R4UA 3WOGA 1ZBA1 1C1FA 3U11A 1OOPB 1UPSA 1FNYA 2B45X 1POV3 1MEC2 1SBFA 2YGLA 3N7LA 5FOBB 3N35A 2R32A 3E6BA 4YVWB 3IKWA 1WCSA 3MIFA 1LHUA 1OI6A 1VBB1 4OVEA 4RSUA 3D6EA 5BNOA 1BBT3 4OHYA 4LULA 2ZKLA 4QXKA 1AL23 2ETEA 3S30A 4AFMA 2TUNA 4QHBA 1OLQA 5CIRA 4R9BA 5K0UB 4D7YA 1XNDA 1ZZ6A 3DPRA 5AVPA 2MEV3 4EJRA 1MACA 2EXKA 3SITA 3SMHA 5C9AB 1REEA 4NPRA 5FAXA 3FHIB 4Y1UA 1NCRA 3PJYA 3U10A 4DPNA 1JYCA 1NZCA 3DN7A 5T55A 1I1EA 4I2OA 1ENQA 3B93A 3FBYA 4YFWA 4AI3A 3HWJA 3WQ7A 3ROUA 2Z2SB 1RUNA 4DY3A 3B7MA 1OOPC 2B46X 2XWJB 2XJSA 3FLRA 2A6XA 1QMJA 2GNTA 4XF0A 1Z7S2 1AVBA 2WZR3 1YIFA 1CR7A 4IV3A 1QJU3 1SLIA 4MX3A 3WX5A 1R1ZA 3KCXA 4BLIA 4YVWC 4FCAA 1R091 1V9U3 2PAKA 4L11A 3EXUA 4QGMA 3ASIA 4KH9A 1HQLA 4B3NA 3PMSA 2RR13 5I8TA 5KBFA 1G86A 2P2KA 1HXS1 3NKGA 1AR61 2HKXA 1ENRA 1SFYA 2P3IA 3V65A 4C90A 3BPZA 2VGDA 1IOAA 3NO8A 4I09A 2IZWA 2UY8A 4GWNA 5FQ0A 5K0UC 3UKNA 4NHKA 4E27A 3B69A 3AYCA 3VZNA 5C9AC 3MIBA 1AX1A 2JENA 1IKPA 1Q8QA 4L99A 5GZCA 4YYOA 1HV1A 4P9IA 1Y43B 4FVVA 4HK8A 2YXSA 4MSVA 1MZ5A 2AR6A 4WBBA 5D1IA 4ONUA 1QNWA 5JSPA 1ZRCA 5JDBA 5H9SA 1G8WA 1RUH3 3PMEA 1H1MA 5T5OA 1HQWA 2Q8OA 3UKTA 3NAPA 3QH6A 1NQJA 4QPIC 3DV8A 4Y24A 3CJXA 3ZSLA 1X8MA 1I5ZA 5BNNB 4LTAA 4Q4Y3 5K7PA 4HSJA 2K9ZA 1RUF3 1VBC3 2NMNA 4UW4A 1ULFA 1H2LA 2FBEA 4EN8B 1A6CA 1ZYBA 4COWA 1LECA 3G7DA 1J1TA 2Q0AA 4N9IA 1LJ7A 3ZXLA 3J8F1 2ET7A 4R4XA 3HMYA 3ZSEA 3RWNA 4AEDB 2JE9A 2ZGNA 4XJ8A 2KA3A 4XMIA 4BYYA 2NP0A 2AH2A 3PLQA 3MLKA 4HT1T 2B7YA 1S0JA 2HWF3 3BIWE 4UBGA 4AHYA 1CAWA 2D6NA 4MXWA 3ZFGB 5T5JA 4BQ1A 1GANA 3N4MA 5EFUA 1QJX3 1XU2A 1BBT2 1F31A 2R061 2DVBA 5BY5A 1AL22 1U5ZA 2XL9A 3O12A 2D40A 5BNNC 3MF6A 1VBE1 1HRV1 1YYNA 1RTVA 1PO11 2MEV2 1G9FA 1GNHA 3CU7A 3MW2A 5DUXA 3LWCA 1BYHA 4WVVA 2WNUA 4UW5A 3TOJA 1IHMA 3KCYA 5J48A 5IK7A 2BEOA 2H0VA 4CTEA 1H1AA 4GA9A 4WZFA 4Y4YA 3C3VA 1C28A 3USSA 2CTVA 1MVEA 4Z07A 3NKTA 2FZ2A 1MQTA 2XVGA 3IM0A 2GC0A 1DDLA 2PQQA 3AZXA 4N9HA 1M4WA 2WZR2 3FUOA 3H7JA 4XQDA 3VBUB 2I74A 4CDXB 1QJU2 3ZFFB 5T50A 2E51A 4YSFA 3I2DA 5JCTA 1V9U2 2Q1ZB 3ZFGC 4AEKA 3V0AB 3M3QA 4P9YA 5C4WB 2FMDA 4A7ZA 4ZKTB 2RR12 2LALA 3FZ3A 1FV2A 1XRUA 2GC1A 4ORFA 2WQ4A 1CQ9A 2XJQA 4B7KA 5ACA3 1YO8A 2OW4A 4META 4M3CE 1LEDA 2TBVA 2E63A 4MGYE 4JRLA 3U4XA 3GBGA 1DYKA 3MFAA 1QU0A 4YVSB 2WT2A 1YI9A 1BCXA 3AMMA 1UPIA 2NMOA 1RMU3 1PVC1 2JG8A 3H8UA 1RHI3 1CAVA 4FO9A 1BMV1 1PMIA 1QKQA 3AP4A 4HN1A 1GICA 5CU1A 3I8TA 4M01A 5GLWA 1BEV1 2B8MA 2Q1MA 2HWB3 3E5XA 1W6NB 1LODA 1WLWA 3SH3A 4D7TA 3VBFA 4CP2A 1RUOA 2Y0IA 3R0RA 3H3UA 1COV3 1TME1 4CDXC 4OI1A 1UKRA 3ZFFC 5AC91 2JICA 3AX4A 3MPBA 4WV8A 3AKPA 3EHKA 5C4WC 4N53B 1RUF2 1VBC2 1GZ9A 1UU4A 2PHRA 3I59B 2D44A 2XVLA 3RG0A 4D94A 5TSWA 1LGBA 3GHMA 1VAMA 1RUC1 1WW5A 2MHFA 3IDBB 1PIV1