2HWC3

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwc300
1EV13 2X5IA 5J98B 2WWSA 2XBO3 1VBE2 3JBG1 2R061 1RUI3 3J8F2 3ZFEB 5JZGA 1AYM3 4CDUB 4LLFA 1VRH1 1FMD1 5BNPA 1MQTC 3VBFC 1HQNA 2FZ1A 1ZBA3 4YVWB 4IV3A 1PIV1 2IZWA 4CDQB 2ZZQA 1PO21 4BCUA 1AL22 4RR3B 4CDXB 1HXS2 1NG0A 2PLV1 4NWWA 1AR71 1EV11 1R091 1TME2 2R043 3VBRB 4CEYA 3JBG2 1K5MC 1ND2C 3HAGA 1BEV2 2Y26A 1V9U2 2HWB1 1R1A1 5C8CB 1BBT3 2RR11 2R071 1RVF1 1VBA1 1VRH3 1D4M3 4Q4X3 3VBFA 3ZFFA 1PO11 3VDDB 1V9U1 2HWB2 2XBO2 1RUE1 1BEV1 2R063 1VBD3 3J8F3 5A32B 1QJY2 1ZBE2 1FPN1 1MEC2 1A6CA 1W39A 5JZGB 1CJDA 2R073 2HWB3 3VBRC 5ABJC 4RHV3 1VBD2 1F8VA 2WS91 3VBUB 4JGYA 4CEYC 1OPOA 1NCRA 1R093 1AR73 2HWE2 1RHI3 1VB2A 2HWF2 4GB31 4PDWB 1FOD2 4NWVA 1PO23 5DDJ2 4CEWC 1VBC3 1VBA2 2FZ2A 1NA1B 1RVF2 4FTBA 5C9AA 1AR82 1PGW1 1R1A2 5J96B 1D4M1 2BBVA 4CEYB 4CEWB 1NA1A 3JD71 3J8F1 5CFCC 1BEV3 1VBD1 2BUKA 5GKAC 3CJIC 1ZBE1 1Z7S2 3VBSB 1F2NA 4EJRA 1RMU3 1AYN3 3VBOA 3ZFGC 5ACA1 1NCQA 4Y5Z0 1VB4A 1VBB2 2BFUL 1POV1 2WZR3 4RS5C 2MEV2 2HWF1 1ASJ1 5JZGC 1QJX3 2R072 2BPA2 2HWE1 3VBSC 2WLPA 1R081 1K5MA 4JGYB 1ZBA2 2WFF2 4RFT0 1AYN1 1FMD2 3VBUA 2RS52 4N53C 3VBHB 4Q4W1 1C8NA 5CFCA 1PIV3 1BMV2 1D4M2 4CDXC 2X5IB 5K0UA 1H8TC 2RS31 1AR61 1QJY3 1QQP2 1HRI2 4N43A 5ABJA 2ZTNA 4Q4V3 4IV1B 2RM23 1MQTB 3VBSA 1POV3 2WZR1 1AR63 4Q4V2 2RS11 2RS33 2HWC1 5L7OB 1RMU1 1AL21 1RUH3 1R082 4Q4W3 1RUD2 4WM8A 3NAPA 3DPRB 1B35B 1CD3G 4PDWA 4RS5B 3VBHA 5BNNB 1HXS3 4N43C 4JGYC 3CJIA 1BBT1 2RR13 1RUJ3 5C4WB 5BNPB 2QQPA 2ZAHA 4IV3B 2RS51 1NCQB 1RHI2 4CDWC 1FPN2 1MEC1 2WZR2 5C9AC 1AUYA 1PVC3 1RUI2 1QJU2 2WS93 1RUE2 4Y4YA 1AL0G 1NA1C 1RUH1 1FOD1 1Z7S3 4WM8C 3NAPB 4FSJA 4PDWC 1QJU1 1AR62 2RMU2 2R042 1AR92 1NOVA 1QJX2 1PVC1 4CDXA 4WM8B 1NCQC 4Q4W2 2HWF3 1QJX1 1QQP3 5C9AB 1NCRC 4CDWA 5LK7B 4YVWA 4N53A 5DDJ1 4GB32 1RUG3 1AL23 5C8CC 1VBA3 4Q4X1 1HRI3 5AC92 1FOD3 4RQPB 5K0UC 4YVSA 2HWC2 2HWE3 3NAPC 4JGZC 1RUF1 4QPIC 3IDEA 2WFF1 1AR91 1TMF3 1GFF2 2HWD2 5BNOB 4RHV2 1K5MB 1ASJ2 5L7OC 4WM7C 3ZFGA 1QQP1 4GMP0 1RUJ2 4RS5A 1PGL2 1ND3A 5CFDA 1RUD1 2MEV3 4RHV1 2VQ0A 1OOPC 4IV1A 1EAH3 3VBUC 4AEDB 5BNNC 5D8AB 4Z92B 4QPIB 4GMP3 1RMU2 3ZFEC 1H8TB 4JGZA 1V9U3 2PLV2 1AYM1 1AR81 1PIV2 1E57A 4CDUC 1ND2B 1H8TA 2DF7A 3S6PA 1AR93 1TMF1 4YVSB 4QPGA 2RS53 4AEDC 1AYM2 1RB8G 5A33B 1HRV2 1OOPA 5D8AC 2RS12 4YVWC 1R092 5C4WA 1PO13 4RR3C 4WM7B 1BBT2 4FTEA 1PVC2 4FTSA 4GMP1 1EAH1 1PGW2 1ZBA1 3CJIB 2BFUS 2MEV1 1OHFA 1VBE3 1RUH2 1SMVA 3VBFB 1POV0 3VBHC 1MEC3 1X36A 1C8M2 1NY71 2WFF3 5FOJB 3VDDA 2GH8A 5FMOS 2HWD1 4AEDA 1RHI1 4Q4Y2 1COV2 1AR83 1HXS1 1VBE1 5AC91 5BNPC 1QJY1 5C4WC 1RUG1 3ZXAC 1ND3C 1PO22 1NCRB 1TME3 2XPJA 3LOBA 3JD73 4N43B 1HRI1 5ABJB 2GSYA 4YVSC 1X33A 1ND3B 5AC93 1BMV1 1RUC2 1VBC1 5DDJ3 3VDDC 1QJZA 5ACA3 4WM7A 4GH4C 2R062 3TN91 1ND2A 2HWD3 1HRV1 5A32A 5BNOA 4Q4V1 4QPGB 4IV1C 5A33A 1ZBE3 4RQPA 5BNNA 1FMD3 2RR12 1Z7S1 4CDWB 5C8CA 1WCDJ 1EAH2 5CFDB 3VBRA 4IV3C 1R1A3 1IHMA 1TME1 1R083 2X5IC 3DPRC 4QPIA 5K0UB 1RUC1 1VBC2 4QPGC 3TN93 2R041 4SBVA 4GH4B 5L7OA 5D8AA 1TMF2 1VBB1 4Q4Y3 5ACA2 3M8LA 4RR3A 5CFDC 1RVF3 1COV1 3JB4C 2WS92 1EV12 1AR72 1VBB3 4Q4Y1 1ASJ3 3ZFGB 1OOPB 3JD72 1QJU3 1RUD3 3ZFEA 1DDLA 4Q4X2 2RS13 3DPRA 3VBOC 1C8M1 1NY72 2HWC3 4CDQC 2PLV3 2RMU1 1RUJ1 4CDUA 2RM21 1RUC3 3ZFFB 1B35A 4JGZB 2RS32 1HRV3 4GH4A 4N53B 1RUF3 1RUI1 4GB33 5BNOC 1VRH2 1RUG2 2RMU3 1C8M3 5FMOL 3ZFFC 4CEWA 1RUF2 3TN92 1M06G 4RQPC 1AYN2 1MQTA 1RUE3 3VBOB 1COV3 1VAKA 1HX6A 1FPN3 3FBMA 3JBG3 2XBO1 1PGL1 4CDQA 1PO12 5CFCB 2RM22 3JB8A 2TBVA 1B35C
chains in the Genus database with same CATH superfamily
2CTVA 3O14A 1Z0HA 3BYWA 2Y0OA 4B7EA 4KGGA 1JXNA 2RVAA 1U5IA 4YW6A 2XBO3 4MSVA 5T5PA 3U4SA 4I0BA 4YLZA 3BU0A 3IAPA 2ZEXA 4CDUB 1Y9MA 2AREA 5FZ6A 1UN1A 1NX9A 1JYCA 1VRH1 4Q0UA 1JI6A 2NQYA 1FMD1 2YDEA 4XE9A 3IPVB 1S2KA 5IK5A 4LA3A 4JTNA 1EY2A 4P9YA 2JXAA 1HQNA 1CAVA 3GXUA 4Q5OA 4V2VA 3N9QA 2FZ1A 3NRUA 2EXJA 4XFIA 1ZBA3 3KB5A 5C3SA 3FHIB 3WHUA 2WO3A 2UY9A 4JKKA 2GN3A 1PIV1 4CDQB 5GZEA 3ZXLA 1IQDC 1JW6A 3K4ZA 3POSA 5FJHA 4CDXB 4D6SA 4NWWA 4V2WA 4P5HA 1NQJA 1JUIA 5CU1A 1VLNA 4CEYA 1ODMA 4GJZA 3JBG2 3IMNA 2QE3A 2VBBA 3AP4A 4E4HA 2XJQA 2GAUA 1V6NA 1OC1A 1ZRFA 1BEV2 2WNEA 3IDAA 5CVRA 1UZVA 2HWB1 3PIGA 2NLRA 1BBT3 2VOXA 4FFGA 2VCMA 3WQ7A 1RVF1 4NE9A 5J48A 5I8SA 3IIAA 1SCRA 3AX4A 2HWB2 2XBO2 4AI0A 1RTVA 1LU2A 1O7FA 1TZOA 1WBLA 2WSVA 1ZZ9A 3OCPA 4NOTA 2VGDA 4XURA 1CGPA 4Q8LA 2XQXA 4EN8B 3O1MA 1Y9GA 3P3PA 4HN1A 3F2ZA 3RYRA 2KM2A 4FXKB 3WLUA 5H9PA 1AX2A 1VBD2 2JX9A 1RUNA 1NUKA 1UMZA 4MGSA 1GZWB 4NAMA 3LPGA 5BYNA 5LATA 2X53S 3U11A 5F1RA 1O3TA 1GP5A 5HCHA 1MR5A 2OZJA 2VO5A 2JE9A 2FCTA 2HWF2 4LOSA 3WF4A 4GB31 5KXEA 5LWBA 4TTGA 1PO23 1UOGA 1ZZ7A 4R8HA 4IEWA 4J1WA 4LBLA 4NR1A 5FPZA 4AI1A 5IYYA 3BI3A 2FZ2A 5A7SA 3I3EA 4FOYA 4KG8A 1PGW1 3M2MA 3HJRA 4LBJA 4UI9L 5LK5A 1W9TA 4BM8A 4DB5A 1EYBA 1D4M1 1Y9QA 2DFCA 1OLMA 3LEKA 5CADA 2BBVA 4XF9A 5FZBA 4CEYB 3QCWA 3NJYA 1LOAA 2JDYA 3POWA 3J8F1 1FI2A 1LRHA 4H2AA 1BEV3 4MH0E 4UT5A 5FY0A 3WF1A 1VBD1 2BUKA 5E88A 4QGLA 3AYEA 3JQXA 2J1UA 4X6QB 4YGCA 3SQOA 2VOVA 1F2NA 5G05L 1RMU3 3MBWA 2VECA 4YW1A 1D0GA 3NSTA 5B4NA 4HLTA 2VQAA 2FQPA 1UKRA 1WGPA 3DECA 1QXJA 1QJX3 2G9ZA 3WF0A 4W50A 5FQ0B 2WLPA 1IS3A 4OUMA 5C8WA 4L9BA 2BNNA 1AYN1 2ZGMA 3WP3A 4GWIA 4BMEA 2EXHA 1UW8A 1VP6A 2RS52 2GMPA 4YPJA 4JZRA 2FDHA 4LHKA 1WA4A 1O3RA 1C5HA 2D6KA 4QKNA 4HONA 4Q4W1 1GV9A 1V6MA 3B94A 5CIRA 4KBBA 4V1PA 4DRVA 3ZX7A 3WP4A 3KV6A 4XFFA 4COZA 1UNBA 1BMV2 5A7WB 4CP9A 3Q8FA 2X5IB 1YUDA 1HIXA 1F9KA 4NAOA 2RS31 1IS5A 3ZSKA 4OHYA 1AR61 1MZFA 4CZSA 4LQRA 1WW5A 1HRI2 1T2XA 2OUJA 2WDBA 1OURA 2ZBJA 4GIQA 5FZKA 1XE8A 2WNOA 5ABJA 5L36A 5FZAA 4Q4V3 3CL1A 2D97A 4N9IA 3HD8B 1OLQA 4X6RB 1O6UA 4YNIA 2H0BA 1PNFA 3AFGA 3VBSA 2WZR1 2Q4SA 1AR63 5FP7A 2QVSB 3VZOA 4AW7A 5KXBA 3WW2A 1AVBA 2VU9A 3I2JA 2ZJCA 1H6XA 3IZOA 4XHBA 4XXAA 2VMIA 2YXSA 5B4XA 1AL21 5I93A 2ZXQA 2E51A 2X29A 5HI0A 1Q8PA 3A0NA 3IMMA 3PMEA 3MUY1 1AJKA 4META 1I5ZA 4AFMA 4WM8A 2GC0A 5LEKA 5FY9A 4PDWA 2VR4A 1W3VA 5BNNB 3U4XA 3UJQA 1GNYA 3L2HA 4JGYC 4LT5A 3DKWA 3WNLA 2XR4A 2DDUA 4Q0SA 4RD7A 4XC9A 5FZ3A 5BNPB 3FHAA 1ZRCA 1VR3A 2ZAHA 1GZ9A 1XU2A 1LGNA 3KCYA 4YM1A 4ASLA 4BLIA 1XYPA 4BQ3A 4LHSA 2ET7A 3JXSA 3V0BB 4Y5SA 4AI3A 3PTYA 3MI8A 1IPJA 1VE0A 3O1RA 2GP3A 1N47A 1RINA 1C1LA 4RA0A 4FCAA 1RUE2 1LHWA 4XABA 3GNEA 4Y4YA 1SLLA 1EUUA 2BQPA 5FYHA 2W1QA 3IB3A 1Z7S3 4IQPA 2EIBA 4CCKA 3NAPB 4S2FA 3ITQA 4MYEA 4BJ0A 5T55A 1AR62 1T6GC 2R30A 3HQRA 3LPFA 1AR92 1OVSA 1UO9A 2ZGRA 4ZU5A 3ZYPA 5FPUA 3KQ4B 5K7PA 1PVC1 4CDXA 3IT8A 2VW2A 3UJOA 3BCWA 4KWJA 2Z79A 4CUGA 1PM7A 1FV2A 3UGGA 3J7LA 1EPZA 2J22A 2XL7A 1OFSA 2ZX3A 5HV0A 4E8DA 2CU5A 2XJVA 1V6IA 4QM9A 1JOJA 4Z1VA 1HQLA 4OQ9A 4XAEA 4WZFA 1OH3A 1OQ1A 1UZZA 2VBDA 2HYKA 4MXVA 1RXGA 1WCSA 2VOTA 4ASMB 2ET1A 2JIJA 4Q1PA 1H2NA 1RUG3 4XFGA 4D0QA 4KNCA 2YFUA 1AF9A 2Y8KA 1GWLA 1VBA3 4Q4X1 4NIGA 4XILA 1DZTA 4A3ZA 3B5LB 4JQTA 4FPLA 2CWSA 1O4TA 1U5XA 2DTYA 3WG3A 5K0UC 1W2TA 4HT1T 1YJLA 4QGNA 4PI2A 4MHUA 4JGZC 1RGSA 4F3JA 3ZOIA 4A3XA 3IDEA 4QHOA 4ISRA 2GN7A 3N7KA 2J42A 1OVPA 3B7MA 3H3ZA 3GHMA 4IW3A 2WA3A 1K5MB 2WRAA 4Z2WA 1W04A 2WABA 4LHNA 1UYPA 3MF9A 2XVKA 1X8MA 4YSFA 2JG9B 2PA7A 5FZ4A 3WSOA 2VMFA 3N7MA 4FQ4A 3J26N 2J7MA 1W8NA 2GC1A 2SLIA 3CLPA 4GMP0 3H50A 4LK6A 4LORA 4RS5A 5CFDA 1PGL2 1RUD1 3N35A 4YM2A 4C1XA 2P17A 1FXZA 1G6NA 2D6LX 4DINB 4WZCA 2G9FA 3ZYGA 1ENSA 3EYPA 5EJ1B 1ENXA 1UXXX 2BERA 2Z5WA 4CUAA 5C3RA 2VQTA 1VJ2A 5IHRA 5I0RA 2H6CA 1RMU2 3NJXA 3E5UA 2VOKA 5FK8A 5FPXA 2RE9A 3MIHA 4LLOA 2QJVA 3CNAA 2K0GA 1Q43A 1AYM1 4HANA 1OKOA 1AR81 1PVXA 3PJYA 4Y22B 4DRRA 1GP6A 2C4XA 1E57A 3LAGA 1H2MA 4CCDA 1DP0A 1H8TA 2BNOA 2W52A 4FOWA 1W99A 1TMF1 3KT4A 1N3OA 4D8MA 2FCUA 4DEVA 5HCBA 5IVEA 2RS53 5FP8A 2WAOA 2GDFA 3WD5A 2W94A 5FUIA 2BWAA 2WNVA 1MS0A 2H0VA 2QQVA 4N7UA 4XBLA 4Y1ZA 3TNQA 3T08A 4CXYA 4CXWA 3T2OA 3U10A 2ZHKA 4AQ2A 4LJHA 1W0OA 3POYA 1ULCA 2Y38A 3UGHA 1R092 4LBQA 5HPOA 5JPNB 4L11A 4FTSA 1BBT2 4FP3A 3VKOA 1UCXA 3SXWA 1PGW2 4GD4A 1UKGA 2W68A 3ACHA 3RQ0A 4C91A 1OFNA 2FDKA 1YQ8A 2BFUS 3C2UA 1QY4A 3LA7A 1X36A 3OBTA 1H4GA 3RZZA 5FOJB 4XVHA 3SHRA 4NPRA 2WNUA 5GLUA 1QU0A 2CSGA 2UY8A 1RHI1 1POQA 3FLTA 3NW4A 4Q4Y2 5HXVA 2WZPP 4BIOA 4P9LA 1GQHA 3ZYFA 1RITA 4B4QA 4N8MA 5DZGA 3ACIA 2Y34A 4FOQA 1VBE1 4P9IA 1IOAA 3J9SA 1QJY1 1OA3A 5C4WC 3I2OA 1RL3A 4YZ1A 3NV1A 3NNJA 4D6RA 1KXGA 1PO22 4UW6A 3LOBA 4B1LA 2WYSA 2E7QA 3BOPA 3O0XA 2OYZA 4AVTA 3LB9A 5LEJA 3WDTA 1XPWA 3ZMOA 4NHXA 1X33A 1BCXA 1XE7A 4JCKA 4PLMA 2W3JA 3LDKA 3CMGA 5FZDA 3TB0A 2JDUA 1ND3B 4JDNA 4C0BA 5AC93 1VIWB 2ZAAA 3I2GA 1QOOA 4Q29A 3SISA 1FNZA 5ACA3 3ZIXA 4I3GA 1C1FA 3AP9A 5JPMB 4QQLA 4DS0A 4NMIA 5F5CA 3MLKA 1HRV1 4BK4A 2DWRA 3KCXA 1JOPA 3ZO0B 1JZ5A 2QZ2A 4ET7A 5I8YA 5C33A 3ABZA 4NIIA 3WNNA 1URXA 4QPWA 4EE2A 2HYXA 2WFPA 2BEOA 2C6SA 3OSDA 4FQZA 3FN9A 4P00B 3NQHA 1WLTA 5EQUA 1O3SA 4OMCA 4D7YA 1GQGA 2DFBA 2XJUA 1UOJA 5FY4A 2ZA9A 4CCJA 3GZEA 1H9PA 2A70A 1LOFC 4EZHA 4LKFA 4CDWB 5F32A 5FPVA 5FZ8A 1OBNA 1W28A 1EAH2 4M4RA 5CFDB 3VBRA 2DUQA 1XU1A 1A8DA 5FO8B 2BVBA 4MGQA 1W9FA 4A2UA 3VV1A 1PMHX 3NV2A 5H9QA 1TME1 2Y6FA 4IEYA 2HJIA 3ZXJA 5K0UB 1UZYA 3PLQA 1LAJA 2XKPA 3GYDA 3VB9A 3TN93 3A23A 1UX6A 2R041 1YNAA 2FMDA 2W87A 2XMLA 3PVNA 5CBLA 3ZN6B 1X7NA 5KR7A 4Y1VA 1UZWA 4MGTA 1TMF2 2JIGA 2B5HA 2WO7A 2BVVA 2DBIA 5BXXA 1W8HA 4YZ5A 5ACA2 1QWRA 2D5FA 3AYDA 3N3HA 3WP5A 2DVGA 3IKWA 4RFRB 3EBRA 3GALA 2CDOA 2ZGQA 1RVF3 3ACLA 4B29A 5L9RA 1DGWA 4ISQA 2VUAA 3E5QA 2A6ZA 4Z8BA 1AR72 4NPLA 4Q4Y1 5B2GB 3ZFGB 4LUMA 3JD72 4HKLA 1UL9A 3PU8A 2XWJB 3AL6A 2RS13 3DPRA 4AG4A 1Q56A 2HWC3 4WVWA 4OI0A 3VKFC 3H8XA 2VZTA 5E1RA 5FFOC 3O1PA 2WINB 3WF3A 2Q8EA 4CDUA 3DYOA 2UU8A 3ZFFB 3GBFA 2QQLA 1JYIA 1GBGA 3PNAA 1ST8A 1QXPA 4HVOA 1HRV3 2YBKA 4GH4A 3ZIWA 3ST7A 4QXHA 4YG0A 4GB33 1PMIA 1N1YA 1VRH2 4LITA 2JE8A 3SITA 3AC0A 1C8M3 1UPIA 4A41A 1PZ7A 3B9IA 4L99A 5DMYA 3C7FA 2XJPA 4F8AA 1U5ZA 5CG8A 5DUVA 4DIQA 3OYWA 3N9MA 1AX1A 4ONUA 1IKPA 5AVPA 3TN92 4ARXA 4RQPC 3GF6A 4H55A 1PM4A 4IEUA 3RZGA 1AYN2 2NPIA 1RUE3 1WD3A 1UYYA 1JZ3A 5CYYA 2ZKNA 1DU3D 3N7JA 3POGA 5KC6A 5ANNA 3KF3A 1HX6A 4MGZE 1FPN3 3ZXKA 4LMFA 3W58A 3KZ4C 1YFWA 3H1YA 2VCBA 4IL7A 1AX0A 2ZEZA 4YWAA 3U1XA 3VZNA 5FP3A 4E2SA 2R16A 5CFCB 4HN0A 1SLCA 3RRDA 4AQTA 3ON7A 3AZYA 5F3GA 1H6YA 3POBA 5J98B 2WBKA 1EUTA 2XB6C 1CPNA 2VUCA 3WW3A 4QM8A 2OXBA 1AXKA 1I3HA 2VZ1A 4R52A 3JBG1 5DUXA 1LNSA 2R061 4XUQA 1UMIA 3J8F2 3PUAA 4G4FA 4P02B 3RI8A 1OD3A 2W92A 4COWA 1X82A 4R9BA 1WW6A 2WT1A 4LLFA 5FZEA 1DQ5A 2PXJA 1ULDA 2AUYA 4AR2A 5BNPA 4XF0A 3OB8A 4P9JA 3UK9A 3Q8AA 3BTZA 1CIYA 2TUNA 1AXYA 1HDKA 4YVWB 1O5UA 2ARXA 1GKBA 4IV3A 4LEJA 5I91A 1X8EA 3VGIA 4GKXA 1N1TA 4XDPA 1W2NA 2UWAA 4K7JA 3NL1A 5FZIA 5KXDA 4FFFA 1UOBA 1HXS2 3K51A 1MS8A 2BGPA 4K20A 1AR71 3QH7A 3VBRB 3E1F1 3ZYBA 4KWUA 1E5SA 1K5MC 3OD4A 4XJUA 1ND2C 4WVZA 1SBFA 1QXRA 5I8TA 3DKQA 3RZMA 1V00A 5JSPA 1V9U2 1R1A1 4FAGA 4YZ4A 1IS4A 1R1ZA 4YW2A 3WNKA 4E4DX 5FR3A 3O1UA 4HKWA 1HB2A 2X05A 4PJYA 1VBA1 4Q4X3 4UF0B 4Q26A 4MGKE 4I2OA 1YWKA 1RUE1 1BEV1 2GNBA 2V4VA 4OHXA 3J8F3 4AHZA 1ZBE2 1FPN1 2XH6A 1A6CA 4YW7A 5LA2A 2R073 2HWB3 3ASIA 3UKVA 3WUDA 5LY1A 1CJPA 1HLCA 4RGKA 3OTFA 2NMNA 2ZGSA 2LS6A 1RIRA 2GC3A 2XUMA 1LTEA 4CEYC 4AE2A 1OPOA 4QXCA 3V0BA 3POJA 3RWKX 2HWE2 1RHI3 1TE1B 5EZWA 4IE4A 4IGQA 2X8KA 2ZGOA 1E5IA 1DGWX 3HQUA 5AVAA 2JDZA 2OUHA 3LA2A 2RJLA 5DDJ2 3WG4A 4E9KA 4CEWC 1VBA2 2N7GA 2Y6LA 1NA1B 1NXD1 3MPPG 1GNHA 4IEOA 4OZXA 5C9AA 1FATA 5A1FA 2JECA 3AMQA 1UY4A 3LGRA 5GZDA 2PHWA 3NNGA 5IUQA 3WQ1A 4D3WA 3W59A 4NIDA 4PF1A 4QQ2A 5IVVA 4NJ4A 2GMEA 2CAUA 5GKAC 3POEA 4NIHA 3OYWB 1D0HA 4OI2A 5A70A 1Z7S2 3VBSB 4IEQA 4BIFA 2Y6GA 1G8WA 4URAA 3H3UA 4E8CA 3C7HA 1L7RA 2GH2A 3A22A 4Y5Z0 5KHGA 2HEVF 1VBB2 2BFUL 2WZR3 4COUA 1Q8VA 2VULA 1QEXA 2R1DA 4G9SB 1HJGA 1CR7A 4PHZA 1CVNA 3WDYA 5EWSA 4BZ4A 1LOCA 2R072 2ZGLA 2BPA2 4CP0A 3J7HA 3VBSC 4C0HA 4JGYB 1R081 1L7QA 1CONA 2UWCA 2A3XA 4GQ7A 3MPBA 3SCGA 2Y0IA 4X8NA 1DGRN 4N53C 4UFIA 2DURA 1ZX5A 3CZJA 4DUVA 3BTXA 4R4ZA 2JDKA 3B3QE 5FYIA 1XOYA 2GP5A 3TEWA 5A7NA 1S0BA 1D4M2 2WKKA 4M01A 4PI0A 5FAXA 4CDXC 2O14A 2WZ8A 3H8UA 1H8TC 5JAXA 1APNA 2FDIA 4BE3A 3QACA 5F5IA 2W46A 5KC5A 1SFPA 1QJY3 1QQP2 2AC1A 2IUWA 5FPLA 1QNYA 2IVIB 3BPZA 1S2EA 3QD6A 3N4MA 1CAXB 2Q30A 3AZWA 3NNFA 1F31A 2EIEA 5CNAA 4D6QA 2BNMA 2J1VA 1WBFA 2XVLA 4Q4V2 2HH9A 3USSA 4LBOA 3RS6A 5L7OB 1RMU1 1W6QA 4R9DA 1O91A 1YHFA 3ES1A 3OPWA 1PNGA 3WT3A 1OQEA 3ZYHA 1JOBA 1KQRA 3UKNA 4CE8A 1HB1A 1RUD2 5L9VA 3O0WA 4UXAA 2OQ7A 3RZKA 4LA2A 1DG6A 3OGVA 5CZKA 4PBPA 3VBHA 1W03A 4XETA 2W1UA 4YARA 4NUBA 1OUSA 4Y5TA 3IDBB 4AFCA 5FV3A 1WUVA 4KI5M 2Q8DA 4S2DA 3CJIA 3FMGA 1UU6A 2ZZJA 2OKXA 1PX4A 1JYXA 3C3VA 5C4WB 3VD9A 3HT1A 2X09A 4GULA 1PGSA 4QB2A 2RS51 2ZMLA 3EO6A 2GNTA 2E32A 2W95A 2JKXA 2A7AA 4LBQD 5BUVA 4LNVA 1YQCA 1FPN2 2EXIA 5FCCA 2BGCA 5F6KA 1AUYA 1PVC3 1RUI2 1QJU2 4AEMA 4MG2A 4W65A 4M0NA 1XNCA 1OXCA 1WLCA 5EHDA 3S7EA 1MS9A 5DN2A 3GJBA 5FZMA 4QKBA 2ID4A 1RUH1 1UY3A 4IGPA 3G6JB 4WM8C 3GGLA 3LFMA 1FV3A 4Y1XA 2DUPA 4YG6A 2QQJA 4QQOA 2DTWA 4UOJA 5LZ6A 4FSJA 2JG8B 4B8EA 1ZRRA 1IGOA 1XQNA 5EPAA 3AMPA 4D94A 3KT7A 5FXVA 4R9AA 4IE0A 4AEKA 1W6QB 3WW4A 3PDQA 5FXXA 4D7TA 4XFAA 3L2YA 2VOWA 1NZCA 3M70A 1CAWA 2VXJA 4BHPA 3ZN4A 5IATA 1MS3A 4XJAA 5FMBA 4XFCA 4LKEA 1IKQA 1W3XA 4QGMA 4FI9A 1MVEA 3V65A 4CU8A 3FFQA 3K3OA 1E5HA 3LZZA 3ZMNA 3KT1A 4J6GA 4CP1A 2ZX1A 3NO8A 4N53A 5DDJ1 4NHLA 4XCAA 4GB32 2ZMKA 3HNYM 4M0HA 4YYOA 5C8CC 3ETQA 1J84A 1MACA 2VUDA 3TAYA 4JTOA 1REEA 4PCRA 1DQ1A 1V6KA 2FHRA 3GJAA 4RQPB 2LROA 4DY5A 2XXZA 2HWC2 3CKHA 2HWE3 1JU4A 3NAPC 3WNOA 1UY2A 1RUF1 3D0SA 4WVVA 5KXCA 1NXMA 4K1ZA 1BKZA 3FUQA 1YQ2A 1AR91 5KHJA 2E9QA 1GFF2 2HWD2 3FHQA 1QMJA 2VMEA 2QQWA 2WO2A 3UESA 4RHV2 3CJXA 2YROA 5FY1A 4M3CB 1QIQA 1UXZA 4HXCA 3FBYA 4IEZA 4WM7C 3ZFGA 4IEPA 3O0VA 3DCQA 5TSWA 1RUJ2 4N9HA 1SACA 3IN9A 4XIKA 5IW0A 2JENA 2BBAA 2BGOA 5IT6A 2VQ0A 1UOFA 5JIAA 2VAUA 3KVAA 1CAXA 3MDPA 3UNPA 2WJSA 1UY1A 3M3EA 4AEDB 1HQWA 2YGLA 5BNNC 5D8AB 3MW4A 3PUIA 2W0XA 5FZ0A 4A6OA 1KFXL 5KHIA 1LESA 4FPOB 3SCHA 2QDRA 4JGZA 1NLQA 5CKNA 5T54A 2ILMA 1JZ2A 3Q9OA 2XOMA 4FP2A 4XUPA 5I0DA 3MW2A 3X29B 5FXZA 2AGSA 2VTFA 5T3NA 4CDUC 4AQ6A 3RSJA 4ASKA 3FL7A 2XHKA 1G9DA 4QPGA 2HKXA 4CA9A 5CAZA 2V73A 2MPFA 4QX7A 2WWJA 4Q1RA 1RB8G 4AZZA 1SLBA 3KVBA 1UIJA 2DVBA 2J1AA 1GP4A 1H8VA 2ZHMA 3I59B 4DQAA 5D8AC 2JB4A 2R32A 5IVJA 4KU8A 2CWMA 5C4WA 3RZHA 1PO13 1CQ9A 3MLLA 3TYJA 4FTEA 4M3CA 4P14A 5F8PA 3MZHA 4EWDA 1PX3A 3TBDA 2PYTA 5FOBB 1W8TA 2QKDA 4XF4A 4LK7A 1MZEA 4MZUA 2ZGNA 1US3A 3BGAA 1PK6B 2QBXA 3AXDA 3A21A 2JDPA 1OHFA 2CY6A 4IEVA 1VBE3 3VBFB 1W6NB 3S5QA 4XFBA 1NY71 4IE5A 4CCNA 2VZPA 2W47A 4IUGA 5T5JA 3AP5A 3VDDA 4P08A 4AEDA 5F7UA 2BTVC 2V5YA 2Z2SB 3J7MA 3OY8A 2WNVC 4IE7A 1HV1A 5L9BA 5EIYB 2IXHA 4Y24A 2VMCA 3KM5A 1UMHA 2NN8A 1SDDB 2WT0A 4KG0A 4OI1A 3O1VA 5DAWA 1COV2 2EF6A 1AR83 4TN7A 4ZHNA 1C57A 5AC91 5BNPC 3ZSJA 1LOEA 4LBKA 3ZXAC 1ND3C 2ARCA 3AZZA 3N9NA 1ULOA 1NCRB 1TME3 4U2AA 2XPJA 1WMXA 5FYCA 5C7GA 3EJKA 4MO3M 3PUSA 4FBFA 1Q8QA 1U5YA 4CCMA 5ABJB 2GSYA 1WZXA 2ZX0A 4BQYA 1JN2P 4RN5A 4OZOA 1W2OA 2LTNA 2PTMA 1QDOA 2XLAA 4JHZA 1DZRA 1Z78A 1PZ8A 2VL4A 3KQRA 4CCOA 1RUC2 3VDDC 1HJFA 2RG4A 3ZXGA 1XNKA 2WT2A 1GZTA 3AVSA 4K3UA 4A42A 5A1LA 5IVFA 3ZM8A 4LE4A 2R062 1W05A 4LIUA 1NYWA 3OJBA 3MV01 3VL8A 5JI7A 2VCAA 5BNOA 2D44A 3OBRA 4XFHA 5HXMA 2Z4FA 3KS7A 4ES9A 2VXRA 3W5MA 3RZJA 4HFSA 2ARAA 3D6EA 5G04L 5GLTA 1PZ9A 3LIGA 2P6CA 3ILNA 3ZVXA 5CA6A 4F83A 5LA0A 5J7MA 1H1AA 2BOIA 1CZTA 1I5PA 5DAVA 3O1SA 4QX8A 5BNNA 4LIVA 3FFZA 3DXUA 3OUIA 5FTTC 3SCFA 2CYFA 3SKJE 4YM3A 1CZVA 2WR9A 1Z7S1 3KHBA 3V56A 4Z2AA 2Z42A 2Q8CA 5C8CA 4K8RB 2XVGA 4BA6A 1DIWA 3E97A 3HBKA 2CGPA 1J1TA 3IAQA 4P9GA 4EN7B 3O12A 5A7QA 1R1A3 4E27A 4Y3OA 5LBBA 1IHMA 1R083 1BYHA 3DPRC 2WQZC 4BMBA 5C70A 1VBC2 1ODNA 1V6LA 3RYPA 3WNXA 4A44A 5LRSA 3AFKA 4EN9B 5LA9A 2K46A 3WW1A 4XXPA 1OA2A 5L7OA 4EN6B 1UY0A 1W06A 3KV9A 3WDVA 5FP9A 1DLLA 1VALA 2BWCA 5FLHA 5FP4A 5FIXA 2PAMA 5F2SA 4Q0PA 3UKTA 1GZCA 1W6MB 5JSRA 2AZ5A 1GQPA 4YZ3A 5EJ3A 3AB0A 4XBQA 3JB4C 4EROA 1EV12 3ELNA 1WW4A 1LENA 1LHUA 1DHKB 1OA4A 3AMNA 2Y33A 1J3QA 3I59A 4E4SA 3AP6A 3ZFEA 1RUD3 2PHFA 4NHYA 4Q4X2 2E63A 1C8M1 4FPFA 2VZQA 1LU1A 2RMU1 4YFWA 3URFA 1OMIA 3I97A 2OS2A 2RM21 4B7KA 1B35A 3LIHA 1Y3TA 2GMMA 3B69A 3DEMA 5A1AA 1G9CA 1RYYA 4QB6A 2YB7A 3USUA 2AH2A 5LRRA 3SKVA 1TQ5A 4QX5A 1KJLA 4XDQA 4GAZA 4DEQA 5J37A 5FZCA 5FMCA 4BISA 5A3LA 1A78A 3ACGA 3FE5A 1HV0A 1W2AX 3I4IA 4LBMA 3UL2A 2C5DA 2PMWB 3ME2A 4OUSA 2ZS6B 3VBOB 2DCJA 1HKDA 5F39A 3RZLA 3DF0A 5KBFA 1QHDA 2SBAA 3NWKA 1PGL1 2J1EA 3UT0A 1OKQA 4CDQA 4N7IA 2Z69A 1LGCA 2WYFA 3APBA 4M00A 2GU9A 5FPAA 3UV9A 3THDA 4DOUA 3WOGA 2BYVE 3JB8A 3KV5A 4W6WA 4XYXA 3ZKYA 3IWZA 5C5UA 1S4CA 1B35C 3VKMA 1AXZA 4PT6A 4QX1A 4AEJA 4L97A 4LO6B 5DAQA 2CHHA 1EV13 4XW3A 4AHXA 2ADEA 3AYCA 2DUOA 2OVUA 2XHNA 4XAAA 3MF6A 4Y1YA 4H7LA 4Q0VA 1W9SA 4LO8A 1RUI3 3ZFEB 4JKLA 5JVVA 5JZGA 3MUZ1 4HVQA 3B01A 2EA7A 2C24A 1US2A 5FPBA 5FY5A 5FZFA 3AVRA 1MQTC 2QFEA 1Y4WA 5DAXA 5IK4A 2NMOA 3AJZA 1I9RA 3DUIA 3H3LA 1LULA 4NVPA 2VE1A 1DYKA 4XUOA 4K1YA 2WL1A 4A7ZA 5A3OA 1F15A 1K3IA 3FJSA 4UW3A 2IZWA 5DQ0A 1OPMA 2ZZQA 2JD4A 2VVFA 2IWGB 4K21A 2CDPA 1AL22 1F4HA 3CQOA 3HN3A 3EB7A 1YI7A 3MIFA 4RR3B 1NG0A 1LEDA 4Y4RA 3OY8B 4ATEA 1D4VB 1D2QA 3LDBA 5GZCA 5FYYA 4NPMA 1TME2 2R043 5CKMA 5A6ZA 4FT8A 3I49A 2CNAA 2EICA 2OA2A 4I02A 1JZ8A 3HAGA 5F3EA 2CV6A 1LHVA 2DU0A 3WQ0A 4AAXA 2Y26A 3IIIA 5EYXA 1SLAA 4H3WA 3RJ2X 2VNGA 3GHNA 2PQSA 4AXOA 4H14A 3E6CC 1BZWA 1GR3A 1PO11 1OI6A 1V0AA 1ZREA 5IK7A 2XJSA 3D82A 4I30A 4QD2A 2R063 1OT5A 2IC1A 3T0BA 2BW8A 4FPCA 3WZ1A 1UYZA 3A0KA 3I2HA 2Y60A 2ZGKA 3AZVA 3OGSA 1CJDA 4W4ZA 4ITCA 2VPVA 5JZGB 3VBRC 1RUOA 1NLSA 1TG7A 4XEZA 4RHV3 5GALA 2WS91 3VBUB 4B1MA 3EMRA 3ACFA 4DPNA 4JGYA 3ECQA 5ISLA 4E4ZA 5A3UA 1R093 1BHGA 1S2BA 1AR73 2I07B 4EN0A 3LEGA 2R49A 3HN1A 1VB2A 4CU9A 1SHWB 4XPVA 2WA4A 2QNKA 3PTRB 4DUXA 4PDWB 5FYZA 1FOD2 3P5BA 3QLQA 4NWVA 5FQ0A 2VNOA 2XJRA 4DZGA 1GICA 2WN2A 2Y6HA 5GJ6A 3T3YA 1J1LA 4IE6A 5EXOA 4FTBA 1AR82 2ZKLA 1ZZCA 3KSCA 2FDFA 2QCSB 1R1A2 3KHCA 5J96B 3L9JT 4UBGA 4XMIA 1RC6A 3EHKA 5FY7A 4CEWB 1NA1A 4K40A 2VZSA 4URTA 4R9CA 2DVAA 4ZU7A 3RJRA 1Y7BA 1K5JA 3CJIC 1SCSA 2QQKA 2IXIA 3FX3A 1JBCA 1ZBE1 1JYVA 1FT9A 2FDJA 3JCIA 2VJXA 4NIAA 3WDXA 3I8TA 1AYN3 4GA9A 4XF3A 4FFHA 3VBOA 2ZOEB 1HN1A 1NCQA 4FPJA 4GWNA 3V64A 1QH7A 4RS5C 1GOFA 3I2DA 3VHRA 2P2KA 3CDZB 3LWCA 1LOGA 1SDWA 1W8FA 2HWE1 3N9PA 1AZDA 4HBNA 4AI8A 4OVEA 1FMD2 3VBUA 2QQUA 3C8XA 4JRAA 3T30A 2F6BA 3VBHB 2WQ4A 1CWPA 5FUNA 3VZKA 3RFRA 2O1QA 2KA3A 4XJWA 5CFCA 4CRQA 1YC61 4LE3A 4M3CE 5F6LB 4OFGA 5FBJA 2R1BA 2AENA 3HOBA 5FRAA 1YFYA 4RL7A 5CB7A 3OEBA 3THPA 3WX5A 2YUEA 3DGTA 1GOGA 2ENRA 4N43A 3LEIA 1ZZ6A 4ZZ8A 3WG1A 4DY3A 2JG9C 5A6YA 2O8QA 1SPPA 5F3IA 3NV3A 4XBNA 1JYTA 2W39A 3BKZA 2W5FA 4AYUA 1MS5A 4XTPA 4JV4A 3OPTA 4R4XA 1JHNA 2H6BA 2GZWA 3U07A 1POV3 1E5RA 1DQ4A 2RS11 5AFBA 2A5ZA 2HWC1 4QU2A 2EXKA 5JXGA 3O5SA 3ORJA 4ZONA 4PF5A 3H42B 1A34A 3PMSA 1RUH3 4RYDA 4YM0A 2C0ZA 4PLNA 2RJ2A 3ZYJB 1JZ4A 3NAPA 2JWPA 2D6PA 3VKLA 1CD3G 1L7LA 2YBPA 1SBEA 3BIWE 1JHJA 2BOJA 4HK8A 4I0WB 4RS5B 3WNPA 5JMCA 3VDAA 5IFTA 4N43C 5A7OA 2WIIB 3MO4A 4MUVA 3R4UA 4KBZA 4EWEA 4QXBA 1KEXA 1YYNA 2C26A 4D7SA 1BBT1 2HLEA 1CX1A 3CZUA 2OIIA 5E89A 5FLJA 2PAEA 4ZPIA 2PHLA 1KJRA 1ZYBA 4L2NA 4E2GA 2QQPA 1QF3A 4B4RA 1C5IA 2VCCA 3GBWA 3HVDA 3GBGA 4IETA 3F95A 1SBDA 5JLVA 1DQ0A 1TVGA 4KWLA 4CDWC 1SLIA 5C9AC 3RPQA 1YI9A 2Q0AA 4UAPA 4YGBA 2Y64A 5GLVA 5LBEA 4P9XA 4IXLA 4QQHA 2B9VA 2WO1A 3H7YA 4LO4B 2KR2A 2AYHA 1AL0G 5LW9A 1FOD1 2VM9A 2LRPA 3V0AB 3RNSA 5C3OA 2A6VA 2D6MA 2WNVB 4PDWC 4OMDA 2LM3A 2RMU2 2F17A 2DVDA 2R042 4LR4A 3ZXEA 4BB3A 4DUWA 4UW4A 2EALA 2I2SA 3ZPYA 4AQSA 1QH6A 1IPKA 1YFUA 2WLQA 3QOPA 3R4SA 2WAAA 4MHRA 3C7EA 3WEZA 4PIZA 2CGOA 3K4AA 4TSVA 1SFYA 1PK6A 4ZU4A 3VL9A 3M1HA 2HWF3 3FZ3A 3K75B 4A45A 3LFIA 4GKYA 2W91A 5C9AB 5D21A 1W6NA 4AFDA 4CDWA 1ZA7A 3LKJA 4TLGA 5LK7B 2JE7A 4CP9B 1CAWB 3IPVA 2JEMA 2E53A 4MV2A 3LQCA 4K8FA 4YVWA 5F2WA 2YU1A 3D0JA 2VNVA 3WHTA 5BNQA 5F9TA 2ZX2A 2DCYA 1AL23 1I1EA 5FZGA 3VN4A 3AM2A 1RXFA 1WMFA 1MZ6A 1XSQA 3LDRA 1KS5A 5AC92 4FPYA 3U37A 2Y6JA 2LALA 4CCCA 3VD3A 3T2QA 1GLHA 2E31A 2I45A 3GZUC 5EYYA 1SG3A 3WUCA 3ZN5A 3W5NA 3ZKUA 4WVMB 1U12A 4RGGA 3RGBA 1S0DA 3PURA 4PBOA 4JDMA 2ZEYA 5BNOB 4QXKA 5HCAA 1W8ZA 3JZVA 3ZSEA 4FFIA 4G3YC 3H1MA 4B4PA 1QQP1 3AYAA 4WV8A 3VD7A 1S55A 1MZ5A 4BPZA 1V6OA 4IESA 1ZRDA 2VTXJ 3E5XA 4TWTA 5F5QA 4ZS3A 3RWNA 2E7AA 5H9SA 1ND3A 5DZFA 5FZOB 3NJVA 4XCBA 1CAUA 1DLCA 2OPWA 2MEV3 3MFCA 4RHV1 5JWPA 3SEPA 3NKTA 4YG3A 1OOPC 3KGLA 3ZYIB 4CCLA 1BK0A 5JSOA 4YFZA 1YXWA 5FKBA 1EAH3 3VBUC 4BQ4A 2RDSA 3HQXA 2YZ4A 4AVCA 4QPIB 5FO9B 3FWEA 5FUPA 3NJZA 1SEFA 4OHZA 3ZFEC 1W8OA 3PUQA 4LTAA 5CKQA 5FBZA 3M3CA 4INDA 4LOTA 1DQ6A 4ZS2A 5KHHA 5FYTA 4XZPA 3P6BA 1OD5A 2GNMA 2JG8A 1PIV2 2JJ6A 2GC2A 4A4AA 5JOYA 2O8OA 2OW4A 2V4AA 1ND2B 1XXNA 4QQPA 1AR93 5DXDA 4YVSB 1SZBA 3WCRA 4UBHA 3WP6A 2JG9A 1BVP1 3S57A 2P3YA 5A33B 4PQ9A 3FUOA 3WDWA 1J83A 4FXGB 2NYYA 1HRV2 3BVCA 4Y20B 4NN0A 1VRBA 2JKBA 4GALA 3T2PA 2A73B 2FMYA 1QDCA 2LW8A 4BH9A 4PIYA 4YVWC 1NE6A 4UWDA 2B39A 4RR3C 5E16A 3LE0A 4GMP1 5JUVA 1L3JA 1QJFA 1GANA 1ZBA1 3PHMA 3AKPA 1YEWA 1FAYA 3CJIB 4CSWA 3PVEA 4GWMA 5D2AA 3OPZA 1GYKA 2KXLA 5A6XA 2ZPXA 4OULA 3S0MA 1SMVA 4FO9A 4CPBD 5JIUA 3VUOA 4PLOA 1POV0 1WLWA 4L8QA 1W6OB 3S7IA 1KDMA 2XJTA 3EXUA 4AVAA 3BOWA 1WA6X 1GNZA 5FDBA 5FMOS 2HWD1 1UWWA 2F4PA 4W6YA 3UGFA 2OZ6A 3WY6A 4DXTA 1OF3A 1YQ5A 4C8DA 1O3QA 2XLFA 3P1IA 1KDKA 1HXS1 5IVYA 1UAIA 4K9SA 2K9ZA 3HPNA 4MGYE 4YRDA 4XUTA 2P1BA 1C4RA 1IG0A 1HN0A 5LASA 4TZDA 2ARBA 3GDBA 3JD73 2YBSA 1HRI1 3K4DA 2RDRA 4HMZA 2MNGA 1LEMA 4YVSC 2VVEA 2D93A 5DABA 2UYAA 3S30A 2QZ3A 4OLLA 4AFBA 1BMV1 1VBC1 2VQUA 4J25A 5DDJ3 4BYYA 1ALYA 1YRZA 2JICA 3FLRA 4AI2A 1ZNPA 2VZOA 2A3YA 3BALA 3THCA 5FWEA 4GH4C 4QX3A 4XHXA 1V6JA 4XOGA 1YIPA 3HNMA 4S2GA 1MS4A 5FLIA 5JXIA 1PK6C 4Q4V1 2E7TA 1XE0A 3TEYA 1O8SA 1XB9A 4BXFA 4QPGB 2FD8A 4U36A 4XQDA 5FYMA 1JMUB 1W9YA 4DXRA 3ALQA 3H8RA 4GXLA 3Q8EA 4KWKA 2DBNA 4IV1C 1DFQA 2XGXA 3R6SA 4AGGA 4RQPA 2R0HA 5ERLA 3JU9A 4IERA 5JOZA 3M3OA 4QDQA 3CHXA 1FMD3 1LHOA 2D7FA 3WDUA 1GWKA 3DYMA 5A3MA 1J3RA 3ZPOA 1MS1A 3THTA 1WCDJ 4LKSA 2YMZA 2P3JA 5BPXA 3BU7A 3WCSA 3ZXDA 4DO0A 5JCTA 1W0PA 4HOOA 3GCWA 4JQRA 5CISA 4HZFA 1JZ7A 4AGVA 2XONA 3B02A 2PHUA 1H2LA 4XACA 4YW4A 3USUB 1DYPA 2EVXA 2RJKA 2B4KA 5C3QA 4QPIA 2TNFA 1RUC1 1IPSA 1S1AA 3BTAA 4QPGC 5EP9A 4XF1A 3O1OA 5ANQA 2XQRA 3ES4A 5FYUA 5I0TA 4XUNA 5JXJA 1Y43B 2B42B 4HSJA 1XC6A 4KU7A 2D40A 5E8AA 4ZXKA 4GH4B 5DZEA 3OBAA 4SLIA 3VZLA 3VDCA 4QHBA 5D8AA 2ETEA 1EP0A 3NMBA 4PIXA 4Q4Y3 1WMDA 4AGRA 3R05A 1UQXA 1SLTA 3N9LA 1CAVB 4BQ1A 1QGLA 4I0AA 5CFDC 2XUEA 1F5FA 3PJQA 4NHKA 1UPSA 4BXSV 4L0PA 1EPWA 3POFA 2DVFA 3O1TA 2Q1FA 4JAAA 2OQ6A 4QKFA 2YY1A 3D4KA 3SC7X 4BQXA 1DF0A 4I09A 5L73A 1H1MA 4LULA 4QWNA 4XMAA 4AF9A 4EV0A 4BQWA 1REFA 5FZ7A 5T5LA 2J1RA 3T4HB 3VBOC 2E6VA 1TNFA 1ZZ8A 3PIJA 2YPJA 2PLV3 2WNUC 4P9WA 3WF2A 1OLRA 5EV7A 3M3IA 1CESA 2J1TA 3R4DB 1RUJ1 3HNBM 3MFAA 3Q8CA 1KITA 3WQBA 1ZZBA 3ZDSA 3PUHA 3U78A 4DXZA 3KF5A 3MIGA 5FO7B 1H2KA 3BB6A 5FY8A 3ZDVA 4JHTA 1RUF3 1RUI1 5DG2A 3POIA 3OG2A 3T09A 5SV5A 1JH5A 5FMOL 3KV4A 5HV4A 2CAVA 3NKGA 3ILRA 2QQOA 4CEWA 3CBNA 2HBTA 1M06G 1SQ4A 4KQ7A 5FXWA 4FOVA 3TNPB 1COV3 1W0NA 4LKDA 2RV9A 1VAKA 1BQPA 3OEAA 3FBMA 4HK9A 4NROA 1F4AA 1QJEA 2CL2A 1PO12 3W20A 4LUKA 1ZRIA 2VNRA 1RJ8A 3BTYA 2E33A 2G19A 4Z82A 5FKCA 1STMA 4KH9A 5AFEA 2X5IA 1UIKA 3GZAA 1JZ6A 1HB3A 4C1WA 4MX3A 1F5JA 1JYWA 4I01A 2WWSA 3DN7A 1OLME 1H1IA 2GNDA 1VBE2 3DL3A 4HETA 1VPHA 5K4LA 4CP2A 2TEPA 1UD1A 1AYM3 1JUHA 1UYXA 4Q8KA 4GJYA 3MGUA 2IVJA 5K9YA 1ACCA 4O61A 3HR9A 5FZ9A 1VMJA 2P37A 3PU3A 4M4PA 5A7PA 4X8PA 5DAPA 1J3PA 1Q8OA 2VW1A 3HT2A 4W8JA 3VBFC 5I0SA 2B8MA 5IWFA 3WV6A 4EWAA 3VD5A 5A3TA 5A6QA 2PFWA 3EQEA 4FPGA 4XTMA 2FCVA 3N9OA 1ZM1A 2IXKA 4YZ2A 1PO21 2RHPA 1OUXA 2ERFA 4B3NA 3K46A 4BCUA 4PQQA 2WUHA 2VG9A 2XDVA 3D5OA 2PLV1 2J1SA 5JR7B 1D7PM 3MHZA 3ZYRA 4OI4A 4OQ8A 1EV11 1R091 1LB2A 1TEIA 2P6HA 4XJ8A 2DCTA 3JQWA 4Z07A 4MLOA 3ZLIA 5JDBA 3LA3A 2K2SA 4LO7A 4JKMA 1NE4A 1N1SA 1WLDA 4ARYA 2QUOA 3H1WA 4NHMA 2W08A 3W9AA 3WINE 5C8CB 2RR11 2R071 5GZGA 4RGAA 4AHYA 4NRMA 1VRH3 1D4M3 3VBFA 5IK8A 2OX0A 1X50A 3AMMA 1UZ0A 1VMFA 3MIEA 3ZFFA 5J1XA 3VDDB 2VMGA 1V9U1 1XRUA 3C7OA 1YJKA 4HVRA 4BQ5A 3ZXFA 3MW3A 1VBD3 3CF6E 2RDNA 3PVOA 5GLZA 5FREA 5A32B 1QJY2 3OBZA 1F35A 1MEC2 1W39A 5FYBA 1NLRA 3BN6A 3OOXA 5CEHA 4EYUA 5ABJC 1CPMA 1F8VA 1UF2C 1VAVA 4UFLA 4AWDA 4FPKA 2NP0A 2BJSA 3Q8BA 3D8CA 5K8SA 4S2HA 4QT6A 1NCRA 1O4YA 1K42A 1M4WA 3AMHA 5KWRA 1N3QA 1VMHA 4OUEA 1XNDA 4XQ4A 5C71A 3H7JA 3CU7A 5DUUA 4WVMA 2A71A 3K77A 5IAVA 3LCPA 4MGIE 1SFNA 1VBC3 2XG3A 1RVF2 2P5BA 1O5LA 2IFWA 2IXJA 4Q27A 2GALA 5SV8A 3G7DA 2BV4A 4EQVA 4L92A 2VBPA 2WC2A 3JD71 4QU1A 4AVVA 3W21A 1FX5A 1JTZX 4MVTA 2VTXA 5LB6A 4EZ4A 1XYNA 5J3UA 2JB8A 4UW5A 4C90A 1X9PA 2P34A 3NNMA 2ADDA 3ETPA 3OUJA 4EJRA 1BK1A 3ZFGC 1ENRA 1W8WA 3I3DA 3T1MA 1R64A 5ACA1 1VB4A 1X9TA 5A3PA 3WXPA 1POV1 2YV8A 1OH4A 4Y1UA 2MEV2 2HWF1 1ASJ1 1WWYA 2YC2A 1JS9A 2ZMNA 2PN5A 4COVA 2YC0A 1W9WA 4QX2A 1K5MA 5C6CA 1ZBA2 3B9CA 2WFF2 1ZA4A 4RFT0 4D69A 2G9GA 3T4VA 5APAA 4CU7A 3D3AA 3OGGA 4OHVA 2VZVA 1IS6A 3U75A 5JZGC 2AEZA 1XNTA 3VLBB 3RMYA 1C8NA 1LOBA 1XJAA 4O9GA 4FAHA 1PIV3 3HMYA 3E6DA 3N36A 1W6PB 3VD4A 1TNRA 2IXCA 4GZ9A 4XIOA 3SNMA 5E6HA 3KMHA 5K0UA 2IXLA 4UFMA 1BVVA 3FLPA 1FNYA 1NQDA 4JRLA 1YCIA 2PQQA 2AEYA 4HPKA 4LPLA 5J09A 2ZTNA 4ATFA 1ZVFA 3IM0A 1CX4A 4UF0A 4A7KA 5C3PA 5M0TA 4IV1B 4JC1A 4CYDA 2RM23 4AAPA 1FYUA 3H8OA 1MQTB 4BQ2A 1A8MA 3FC0A 1S0FA 4OYUA 2RS33 5DUWA 2E26A 1YQ6A 2B9UA 5C5TA 1GMMA 1GSLA 2DU1A 3K2OA 5FZHA 3RI9A 1G7YA 1LR5A 2UWBA 1R082 3I2FA 3S5AA 4Q4W3 2ZGUA 5EJZB 4UFKA 1H4HA 3PVBB 2ORXA 1YO8A 2HEYF 3DPRB 1B35B 3HWJA 5A3NA 3A7QA 2ZGPA 5IAXA 1GUIA 2WWUA 1K12A 2QQIA 4AOCA 4LBNA 5FYVA 1HXS3 5FZ1A 3T1LA 4CPBA 5IFPA 2A75A 5CG9A 2CGNA 1PMJX 2RR13 3MIDA 1JODA 1IZ3A 4BK5A 1RUJ3 3KLSA 1GU3A 1LJ7A 3MEPA 2VY0A 3JUUA 1GZWA 3KWVA 3MIBA 3OGRA 4IV3B 1XNBA 1BXHA 2F4LA 5F5AA 3IBMA 4ZKTB 1NCQB 3ENRA 3J4UH 5JOXA 3R0RA 2JDMA 1NKGA 1RHI2 2I74A 1MEC1 2WZR2 2V5DA 2VUJA 3TWIA 2D3SA 2PHDA 2WS93 4CUCA 1H9WA 2LUWA 4GWJA 2ZACA 1NA1C 3AJYA 5IVCA 4DXSA 3AKQA 1DCSA 2DCKA 2AR6A 2DYCA 2ZX4A 1YIFA 5CFCC 2W9XA 1QJU1 3CIHA 1P8JA 2ZGTA 2YFZA 2BU9A 4XDOA 2B46X 1NOVA 1W90A 1QJX2 2Q5TA 2VZUA 3ILFA 4WM8B 1NCQC 1QKQA 1N3PA 2P3IA 5BV6A 4Q4W2 5LBFA 1H30A 4O65A 3I54A 3VHPA 1QJX1 2R7EB 4HL0A 1GOHA 1QQP3 5GZFA 4LXLA 4CCEA 2XKOA 1NCRC 1BJQA 3OF1A 1O8PA 3VZJA 1AHSA 1H0BA 3BUCA 3NV4A 4QDSA 2WN3A 4LHLA 5LCWL 2X10A 3K3NA 3DXTA 2Q8OA 1KRIA 2A1XA 4JVAA 2ZHNA 5T52A 3GZTB 1WCQA 1Q3EA 1K45A 1WMEA 3WR0A 2QTWB 1HRI3 3DYPA 4RSUA 3T0AA 4AHWA 3RMXA 3TRSB 1UU5A 1FOD3 3GM8A 3N7LA 5D1IA 2VMHA 4K6BA 4QMAA 1DZQA 3BPSA 4YVSA 4YW5A 4DMIA 5KHKA 5I0UA 2D3RA 2ZCWA 4QPIC 1KD7A 3LF7A 2O0OA 1S0JA 1TMF3 2WFF1 3SLIA 4E2QA 3LD8A 1W2UA 2BP6A 4Y20A 4AVBA 2YGMA 2B45X 2C9AA 2NZ9A 1ASJ2 3OGJA 5L7OC 1D2SA 2YPDA 1JYNA 3VHOA 5FWJA 1B09A 4KL1A 2FBEA 2VMDA 5LBCA 2YHJA 3C7GA 3MICA 4F7ZA 1NAEA 4NRPA 4NRQA 4CVUA 4Y26A 3TOJA 5JOWA 2A6WA 4DNYA 2W1SA 1Q5OA 4IV1A 2V72A 4QHZA 3VHNA 3TEZA 2YG0A 4AL9A 5T5OA 1N1VA 1OF4A 3ZR6A 2EIGA 2VVDA 2P4EA 1QOSA 4GMP3 4I3PA 4Z92B 1MVQA 1WD4A 1JU3A 4IEXA 1H8TB 3BODA 2A6XA 1V9U3 2L9LA 2PLV2 1SPPB 3I3MA 1KFUL 2EAKA 5GLWA 3TEXA 3T2TA 1WW7A 3RG0A 2DF7A 3S6PA 3AKTA 3MLJA 4P5YA 3I2IA 3PL0A 3LSEA 2WZEA 4AEDC 1AYM2 1NT0A 1S0GA 4UFJA 5GM0A 1J59A 2HBUA 5LY2A 3SH5A 5JXHA 4MADA 5JMOA 2ZHLA 1ONAA 3AP7A 4FPEA 5A7WA 1OOPA 1T6BX 5FYSA 4COYA 1I6XA 2RS12 2EAAA 3AKSA 4IDZA 2D43A 4WM7B 1PVC2 1EAH1 1W6PA 4YGDA 1KS4A 4XQWA 1J58A 1GWMA 3U14A 5L19A 4OCTA 4TYSA 2MEV1 1ULEA 2FDGA 1RUH2 2DV9A 3AL5A 3SH3A 3VBHC 1ULGA 1A3KA 1MEC3 1W6MA 2DCZA 1C8M2 2PHXA 2WFF3 3I2KA 3UYJA 2ORZA 4NO4A 2GH8A 5T50A 3I7DA 3IDCB 2C1FA 3OD0A 4MOAA 1AJOA 2R6QA 3VDBA 4MXWA 1OQDA 3P3NA 2G1MA 4XZUG 4FVVA 1XNAA 4BWOA 4ZXEA 3J7NA 2QQMA 3RVHA 2EIDA 3M3QA 4QAWA 2VH9A 3NNLA 5F37A 2OPKA 4JX0A 2BZDA 3AKRA 2A6YA 1RUG1 4BOWA 3RYKA 1UU4A 3A4UA 5FZOA 4CTEA 1S0IA 1HW5A 4ES8A 1CAUB 2P3KA 1QNWA 3WG2A 4N43B 2RDQA 1G9BA 1LODA 1C28A 2B7YA 1LOFA 2C9KA 4OHWA 3NVCA 1LECA 2JD9A 1MPXA 2YC4A 1LCLA 3M4FA 4W6XA 1V70A 4ZY9A 3LSDA 1KGYA 3B00A 5DPNA 5HBAA 3WVJA 4DFSA 1QJZA 2VD7A 4TLFA 1G86A 5JI9A 3I3QA 1YLLA 1RJ7A 3KD4A 4XJZA 2JG8C 2UURA 4HSLA 4WM7A 1VAMA 5H9RA 3TN91 4AVSA 4ORFA 1ULFA 1ND2A 2HWD3 2ATFA 4M3CF 5A32A 5LA1A 4FPHA 4QKDA 2XLGA 5EFUA 3T0DA 4UYBA 4AI9A 2YYOA 4QB1A 5A33A 1ZBE3 3AZXA 1LGBA 4BLJA 4J1XA 3OUHA 4ZZ5A 1O59A 2PHRA 3RDIA 3VKNA 5IVBA 5A3WA 2JDNA 2D5HA 1WCKA 4BDVB 3HBZA 2RR12 2JDHA 3HEIA 5FZLA 2QDNA 4Y33A 3MYXA 3CEWA 4HPKB 4IV3C 4QX0A 1ULPA 2XWBB 3INAA 1CIWA 1O4ZA 3ZR5A 3KGZA 1S0CA 2A3WA 3VZMA 2D98A 2VW0A 2X5IC 4UFHA 1DGLA 3ZN6A 4AFAA 2MHFA 4O9EA 3GCXA 1LKNA 4Y22A 1UX7A 4AK3A 2YU2A 1HB4A 4SBVA 1W8UA 3E6BA 4KGQA 2KD7A 5FK7A 4XJ9A 3DV8A 4YW3A 3I3BA 3V0AA 4A7YA 4Q2FA 1U0AA 5HCFA 1XYOA 5IJRA 1VBB1 2VZ3A 3LEMA 1C3HA 3QBQA 5JR2A 3M8LA 3H9AA 4QDRA 4RR3A 4O7XA 2NM1A 5FJKA 3M7AA 2W1WA 2WQ8A 1XSRA 3U0ZA 1S0EA 2AACA 3ZSLA 1COV1 1G9FA 1CN1A 2WS92 2IFRA 2HEWF 4LBQB 1ENQA 4CU6A 3WNMA 2D3PA 1VBB3 2V09A 1ASJ3 3KCCA 1DYOA 1OOPB 5FMDA 2BRTA 5J36A 1QJU3 2R0FA 5BY5A 2PELA 3B93A 4HG6B 1DDLA 1PHMA 1NY72 1LHNA 2Q1MA 4WBBA 3SH4A 3SMHA 3O7OA 4CDQC 3ROUA 4JDOA 2JDAA 2VC9A 4TXWA 1DBNA 2W2IA 4YGEA 1CZSA 1RUC3 1NZIA 1QOTA 1DQ2A 5DG1A 4JGZB 3AK0A 3AXEA 2QQNA 2RS32 3H0OA 2Y6KA 4Q0QA 4BU2A 1REDA 4N53B 1IG3A 2PAKA 2WSUA 2WNUB 4HKOA 4CUBA 3MV11 5BNOC 1Q8SA 3CO2A 4A6SA 1RUG2 1XBFA 2RMU3 3K48A 5F3CA 3BIEA 1DGRA 2ZABA 2BDRA 3ZFFC 3ZSMA 1RUF2 1WCUA 4MXWB 3QH6A 2D6OX 4IGOA 4CXXA 2UYBA 1MQTA 2OT7A 3ATGA 1IQAA 4N90A 1WKYA 4H7MA 1W6OA 2D6NA 3LOIA 1BLZA 3HIFA 3SEEA 1G9AA 3JBG3 2XBO1 5A80A 2G4IA 2VZRA 2Q1ZB 4KMQA 4QPYA 1YFXA 2PHTA 3UETA 4LO5B 2RM22 2ZEWA 1OSGA 2TBVA 2XL9A 2ES3A
chains in the Genus database with same CATH topology
2CTVA 3O14A 1Z0HA 4B7EA 2Y0OA 4KGGA 1JXNA 1U5IA 2XBO3 4MSVA 5T5PA 4I0BA 4YLZA 4CDUB 2AREA 1UN1A 1JYCA 1VRH1 4Q0UA 2NQYA 2YDEA 1FMD1 4XE9A 3IPVB 1S2KA 5IK5A 4LA3A 4JTNA 1EY2A 4P9YA 2JXAA 1HQNA 1CAVA 2FZ1A 4XFIA 2EXJA 1ZBA3 3KB5A 3FHIB 3WHUA 2UY9A 2GN3A 1PIV1 4CDQB 5GZEA 3ZXLA 1JW6A 3POSA 4CDXB 4NWWA 4P5HA 1NQJA 1JUIA 5CU1A 1VLNA 4CEYA 3JBG2 3IMNA 2QE3A 3AP4A 2XJQA 2GAUA 1V6NA 1ZRFA 1BEV2 2WNEA 5CVRA 2HWB1 2NLRA 1BBT3 2VOXA 3WQ7A 1RVF1 5J48A 5I8SA 3IIAA 1SCRA 3AX4A 2HWB2 2XBO2 4AI0A 1RTVA 1LU2A 1O7FA 1WBLA 2WSVA 3OCPA 1ZZ9A 4NOTA 1CGPA 2VGDA 4Q8LA 4EN8B 3P3PA 4HN1A 3RYRA 2KM2A 4FXKB 3WLUA 5H9PA 1AX2A 1VBD2 2JX9A 1RUNA 1UMZA 1GZWB 5BYNA 2X53S 3U11A 5F1RA 1O3TA 1MR5A 2OZJA 2JE9A 2HWF2 5KXEA 4GB31 1PO23 1ZZ7A 4R8HA 4IEWA 4J1WA 4LBLA 4NR1A 5FPZA 4AI1A 2FZ2A 4FOYA 4KG8A 4LBJA 1PGW1 3M2MA 5LK5A 4BM8A 4DB5A 1EYBA 1D4M1 1Y9QA 2DFCA 5CADA 2BBVA 4XF9A 4CEYB 3QCWA 3POWA 1LOAA 3J8F1 1FI2A 1LRHA 4MH0E 1BEV3 5CFCC 1VBD1 2BUKA 5E88A 4QGLA 3AYEA 3JQXA 4X6QB 4YGCA 2VOVA 1F2NA 1RMU3 2VECA 4YW1A 1D0GA 3NSTA 4HLTA 2VQAA 1UKRA 1WGPA 2FQPA 1QXJA 1QJX3 5FQ0B 2WLPA 1IS3A 4OUMA 5C8WA 4L9BA 2BNNA 1AYN1 2ZGMA 3WP3A 4BMEA 2EXHA 1UW8A 1VP6A 2RS52 2GMPA 4LHKA 1WA4A 1C5HA 2D6KA 4Q4W1 1GV9A 1V6MA 3B94A 5CIRA 4KBBA 4V1PA 4DRVA 3ZX7A 3WP4A 4XFFA 4COZA 1BMV2 2X5IB 1YUDA 1HIXA 1F9KA 2RS31 1IS5A 3ZSKA 4OHYA 1AR61 1MZFA 4CZSA 1WW5A 1HRI2 2OUJA 4GIQA 2ZBJA 5ABJA 1XE8A 4Q4V3 3CL1A 2D97A 4N9IA 3HD8B 1OLQA 4X6RB 4YNIA 2H0BA 1PNFA 3AFGA 3VBSA 2WZR1 2Q4SA 1AR63 2QVSB 3VZOA 4AW7A 5KXBA 3WW2A 1AVBA 2VU9A 2ZJCA 4XHBA 4XXAA 2VMIA 2YXSA 1AL21 5I93A 2E51A 2X29A 5HI0A 1Q8PA 3A0NA 3PMEA 1AJKA 4META 1I5ZA 4AFMA 4WM8A 2GC0A 5LEKA 4PDWA 5BNNB 3U4XA 3UJQA 3L2HA 4JGYC 4LT5A 3DKWA 4RD7A 4Q0SA 5BNPB 1ZRCA 1VR3A 2ZAHA 1GZ9A 1XU2A 1LGNA 3KCYA 4YM1A 4ASLA 4BLIA 1XYPA 2ET7A 3V0BB 4AI3A 3PTYA 3MI8A 1IPJA 1N47A 1RINA 1C1LA 4RA0A 4FCAA 1RUE2 1LHWA 4Y4YA 3GNEA 1SLLA 2BQPA 4IQPA 1Z7S3 3NAPB 4S2FA 4MYEA 5T55A 1AR62 1T6GC 2R30A 1AR92 4ZU5A 2ZGRA 3ZYPA 5K7PA 1PVC1 4CDXA 3IT8A 2VW2A 3UJOA 3BCWA 4KWJA 2Z79A 1PM7A 1FV2A 1EPZA 2XL7A 1OFSA 2ZX3A 2XJVA 1V6IA 4QM9A 1JOJA 4Z1VA 1HQLA 4WZFA 1OQ1A 1UZZA 2HYKA 4MXVA 1WCSA 4ASMB 2ET1A 4Q1PA 1H2NA 1RUG3 4XFGA 4KNCA 1AF9A 1VBA3 4Q4X1 4XILA 1DZTA 3B5LB 4FPLA 2CWSA 1O4TA 1U5XA 2DTYA 3WG3A 5K0UC 4HT1T 1YJLA 4QGNA 4JGZC 1RGSA 4F3JA 4A3XA 3IDEA 4ISRA 2GN7A 3N7KA 3B7MA 3H3ZA 3GHMA 2WA3A 1K5MB 4Z2WA 4LHNA 3MF9A 2XVKA 1X8MA 4YSFA 2JG9B 2PA7A 3N7MA 4FQ4A 3J26N 4GMP0 2SLIA 2GC1A 4RS5A 3CLPA 5L36A 3H50A 1PGL2 5CFDA 1RUD1 3N35A 4YM2A 4C1XA 2P17A 1FXZA 1G6NA 2D6LX 4DINB 4WZCA 2G9FA 3ZYGA 1ENSA 1ENXA 2Z5WA 1VJ2A 5I0RA 2H6CA 1RMU2 3E5UA 2VOKA 5FPXA 2RE9A 3MIHA 4LLOA 2QJVA 3CNAA 2K0GA 1Q43A 1AYM1 4HANA 1PVXA 1AR81 4Y22B 3PJYA 4DRRA 1O3RA 1E57A 3LAGA 1H2MA 1H8TA 2BNOA 2W52A 4FOWA 1TMF1 3KT4A 1N3OA 5HCBA 2RS53 2GDFA 3WD5A 2BWAA 2WNVA 1MS0A 2H0VA 4N7UA 4XBLA 4Y1ZA 3U10A 2ZHKA 4AQ2A 1W0OA 3POYA 1ULCA 2Y38A 1R092 4LBQA 5JPNB 4L11A 4FTSA 1BBT2 4FP3A 3VKOA 1UCXA 3SXWA 1PGW2 1UKGA 2W68A 3RQ0A 4C91A 1OFNA 2BFUS 3C2UA 1QY4A 3LA7A 1X36A 3OBTA 1H4GA 3RZZA 5FOJB 3SHRA 4NPRA 2WNUA 5GLUA 1QU0A 2UY8A 1RHI1 3FLTA 3NW4A 4Q4Y2 5HXVA 2WZPP 4BIOA 4P9LA 1GQHA 4B4QA 1RITA 5DZGA 4FOQA 1VBE1 4P9IA 1IOAA 3J9SA 1QJY1 1OA3A 5C4WC 1RL3A 4YZ1A 3NV1A 1KXGA 1PO22 4UW6A 3LOBA 2E7QA 3BOPA 3O0XA 2OYZA 4AVTA 3LB9A 5LEJA 3WDTA 3ZMOA 1X33A 1BCXA 1XE7A 4JCKA 4PLMA 3TB0A 1ND3B 4JDNA 4C0BA 5AC93 1VIWB 2ZAAA 1QOOA 4Q29A 3SISA 1FNZA 5ACA3 3ZIXA 4I3GA 1C1FA 3AP9A 5JPMB 4QQLA 4DS0A 3MLKA 1HRV1 2DWRA 3KCXA 3ZO0B 2QZ2A 5I8YA 5C33A 1URXA 2WFPA 2BEOA 4FQZA 1WLTA 1O3SA 4D7YA 1GQGA 2DFBA 2XJUA 2ZA9A 1H9PA 2A70A 1LOFC 4CDWB 1EAH2 5CFDB 3VBRA 2DUQA 1XU1A 1A8DA 5FO8B 2BVBA 4A2UA 3VV1A 5H9QA 3NV2A 1TME1 4IEYA 2HJIA 3ZXJA 5K0UB 1UZYA 3PLQA 2XKPA 3GYDA 3TN93 1UX6A 2R041 1YNAA 2FMDA 3PVNA 5CBLA 3ZN6B 1X7NA 4Y1VA 1TMF2 2B5HA 2BVVA 4YZ5A 5BXXA 5ACA2 1QWRA 2D5FA 3AYDA 3N3HA 3WP5A 2DVGA 3IKWA 3EBRA 3GALA 2ZGQA 1RVF3 3ACLA 4B29A 1DGWA 4ISQA 2VUAA 3E5QA 2A6ZA 4Z8BA 1AR72 4Q4Y1 5B2GB 3ZFGB 4LUMA 3JD72 4HKLA 1UL9A 2XWJB 4AG4A 2RS13 3DPRA 1Q56A 2HWC3 4WVWA 4OI0A 3VKFC 5E1RA 5FFOC 2WINB 4CDUA 3ZFFB 2UU8A 3GBFA 1JYIA 1GBGA 3PNAA 1QXPA 4HVOA 1HRV3 4GH4A 3ZIWA 3ST7A 4YG0A 4GB33 1PMIA 1N1YA 1VRH2 3SITA 1C8M3 1UPIA 1PZ7A 3B9IA 4L99A 5CG8A 2XJPA 4F8AA 1U5ZA 5DUVA 3OYWA 1AX1A 4ONUA 1IKPA 5AVPA 3TN92 4RQPC 3GF6A 4H55A 4IEUA 1AYN2 2NPIA 1RUE3 1WD3A 2ZKNA 1DU3D 3N7JA 5KC6A 4MGZE 1HX6A 3ZXKA 1FPN3 3W58A 3KZ4C 1YFWA 3H1YA 4IL7A 1AX0A 3VZNA 4E2SA 2R16A 5CFCB 4HN0A 1SLCA 3RRDA 4AQTA 3AZYA 5J98B 2XB6C 1CPNA 3WW3A 4QM8A 1AXKA 1I3HA 4R52A 3JBG1 5DUXA 2R061 3J8F2 4G4FA 3RI8A 4COWA 1X82A 4R9BA 1WW6A 2WT1A 4LLFA 1DQ5A 1ULDA 2AUYA 5BNPA 4XF0A 4P9JA 3UK9A 2TUNA 1AXYA 1HDKA 4YVWB 1O5UA 2ARXA 1GKBA 4IV3A 4LEJA 5I91A 1X8EA 3VGIA 4GKXA 1N1TA 2UWAA 4K7JA 3NL1A 5KXDA 1HXS2 3K51A 1MS8A 4K20A 1AR71 3QH7A 3VBRB 1K5MC 3OD4A 4XJUA 1ND2C 4WVZA 1SBFA 1QXRA 5I8TA 1V00A 5JSPA 1V9U2 1R1A1 4FAGA 4YZ4A 1IS4A 1R1ZA 4YW2A 4E4DX 4HKWA 4PJYA 1VBA1 4Q4X3 4Q26A 4MGKE 4I2OA 1YWKA 1RUE1 1BEV1 2GNBA 4OHXA 3J8F3 4AHZA 1ZBE2 1FPN1 2XH6A 1A6CA 2R073 2HWB3 3ASIA 3UKVA 3WUDA 1CJPA 1HLCA 3OTFA 2NMNA 2ZGSA 1RIRA 2GC3A 2XUMA 1LTEA 4CEYC 4AE2A 1OPOA 3V0BA 2HWE2 1RHI3 1TE1B 5EZWA 2X8KA 2ZGOA 1DGWX 5AVAA 3WG4A 2JDZA 2OUHA 3LA2A 2RJLA 5DDJ2 4E9KA 4CEWC 1VBA2 2N7GA 3MPPG 1NA1B 1NXD1 1GNHA 4IEOA 4OZXA 5C9AA 1FATA 2JECA 3AMQA 3LGRA 5IUQA 5GZDA 2PHWA 3WQ1A 4D3WA 3W59A 4QQ2A 2GMEA 2CAUA 5GKAC 3OYWB 1D0HA 4OI2A 1Z7S2 3VBSB 4IEQA 4BIFA 1G8WA 3H3UA 2GH2A 4Y5Z0 5KHGA 2HEVF 1VBB2 2BFUL 2WZR3 4COUA 1Q8VA 2VULA 2R1DA 4G9SB 1CR7A 5JZGC 1CVNA 3WDYA 5EWSA 4BZ4A 1LOCA 2R072 2ZGLA 2BPA2 4CP0A 3VBSC 4C0HA 4JGYB 1R081 1CONA 2UWCA 2A3XA 4GQ7A 3MPBA 3SCGA 2Y0IA 4X8NA 1DGRN 4N53C 2DURA 1ZX5A 4R4ZA 3B3QE 1S0BA 1D4M2 2WKKA 4M01A 5FAXA 4CDXC 3H8UA 1H8TC 5JAXA 1APNA 4BE3A 3QACA 1QJY3 1QQP2 1QNYA 3BPZA 3QD6A 3N4MA 1CAXB 2Q30A 3AZWA 1F31A 5CNAA 2BNMA 1WBFA 2XVLA 4Q4V2 3USSA 4LBOA 3RS6A 5L7OB 1RMU1 1W6QA 4R9DA 1O91A 1YHFA 3ES1A 1PNGA 3WT3A 1OQEA 1KQRA 3UKNA 1RUD2 3O0WA 4UXAA 4LA2A 1DG6A 4PBPA 3VBHA 4XETA 3IDBB 4AFCA 1WUVA 4S2DA 3CJIA 3FMGA 1UU6A 2ZZJA 3C3VA 5C4WB 3HT1A 4GULA 1PGSA 2RS51 2ZMLA 3EO6A 2GNTA 2A7AA 4LBQD 5BUVA 4LNVA 1FPN2 2EXIA 5FCCA 2BGCA 5F6KA 1AUYA 1PVC3 1RUI2 1QJU2 4AEMA 4W65A 4M0NA 1XNCA 1WLCA 3S7EA 1MS9A 4WM8C 1RUH1 4Y1XA 3RNSA 3G6JB 1FV3A 2DUPA 4YG6A 4QQOA 2DTWA 4FSJA 2JG8B 4B8EA 1ZRRA 1IGOA 1XQNA 3AMPA 4D94A 3KT7A 4R9AA 4AEKA 1W6QB 3WW4A 4D7TA 4XFAA 3L2YA 2VOWA 1NZCA 3M70A 1CAWA 4BHPA 3ZN4A 1MS3A 4XJAA 4XFCA 1IKQA 4QGMA 1MVEA 3V65A 3FFQA 3LZZA 3ZMNA 3KT1A 4J6GA 4CP1A 2ZX1A 3NO8A 4N53A 5DDJ1 4NHLA 4GB32 2ZMKA 4M0HA 4YYOA 5C8CC 3ETQA 1MACA 3TAYA 4JTOA 1REEA 4PCRA 1DQ1A 1V6KA 2FHRA 4RQPB 4DY5A 2HWC2 2HWE3 3NAPC 1RUF1 3D0SA 4WVVA 5KXCA 1NXMA 4K1ZA 1BKZA 3FUQA 5KHJA 1AR91 2E9QA 1GFF2 2HWD2 1QMJA 4RHV2 3CJXA 2YROA 4M3CB 4IEZA 3FBYA 4WM7C 3ZFGA 4IEPA 3O0VA 5TSWA 1RUJ2 4N9HA 1SACA 3IN9A 4XIKA 2JENA 5IT6A 2VQ0A 5JIAA 3MDPA 1CAXA 2WJSA 3M3EA 4AEDB 1HQWA 2YGLA 5BNNC 5D8AB 3MW4A 2W0XA 1KFXL 5KHIA 1LESA 4FPOB 3SCHA 2QDRA 4JGZA 5T54A 2ILMA 3Q9OA 4FP2A 3MW2A 3X29B 2AGSA 5T3NA 4CDUC 4AQ6A 3RSJA 2XHKA 1G9DA 4QPGA 2HKXA 5CAZA 2V73A 2MPFA 4Q1RA 1RB8G 1SLBA 1UIJA 2DVBA 1H8VA 2ZHMA 3I59B 4DQAA 5D8AC 2R32A 4KU8A 2CWMA 5C4WA 1PO13 1CQ9A 3MLLA 3TYJA 4FTEA 4M3CA 4P14A 3MZHA 4EWDA 3TBDA 2PYTA 5FOBB 2QKDA 4XF4A 4MZUA 1MZEA 2ZGNA 1PK6B 3AXDA 1OHFA 2CY6A 4IEVA 1VBE3 3VBFB 1W6NB 4XFBA 1NY71 5T5JA 3VDDA 3AP5A 4AEDA 2BTVC 2V5YA 2Z2SB 3OY8A 2WNVC 1HV1A 2IXHA 4Y24A 3KM5A 2NN8A 2WT0A 4KG0A 4OI1A 1COV2 2EF6A 1AR83 1C57A 5AC91 5BNPC 3ZSJA 1LOEA 4LBKA 3ZXAC 1ND3C 3AZZA 1NCRB 1TME3 4U2AA 2XPJA 3EJKA 4FBFA 1Q8QA 1U5YA 5ABJB 2GSYA 2ZX0A 1JN2P 2LTNA 2PTMA 1QDOA 2XLAA 1DZRA 1Z78A 1PZ8A 3KQRA 1RUC2 3VDDC 3ZXGA 1XNKA 2WT2A 4K3UA 4LE4A 2R062 1NYWA 3OJBA 3VL8A 5JI7A 5BNOA 2D44A 3OBRA 4XFHA 4ES9A 3KS7A 2VXRA 4HFSA 3D6EA 5GLTA 3ZVXA 1PZ9A 5CA6A 3ILNA 4F83A 5J7MA 1H1AA 5BNNA 3FFZA 3SCFA 5FTTC 2CYFA 4YM3A 3V56A 1Z7S1 2Z42A 5C8CA 2XVGA 4BA6A 1DIWA 3E97A 2CGPA 1J1TA 4P9GA 4EN7B 3O12A 1R1A3 4E27A 1IHMA 1R083 1BYHA 3DPRC 2WQZC 4BMBA 1VBC2 1V6LA 3RYPA 3WNXA 5LRSA 3AFKA 4EN9B 3WW1A 4XXPA 1OA2A 5L7OA 4EN6B 3WDVA 1DLLA 1VALA 2BWCA 5FLHA 2PAMA 4Q0PA 3UKTA 1GZCA 1W6MB 5JSRA 2AZ5A 4YZ3A 5EJ3A 3AB0A 4XBQA 3JB4C 4EROA 1EV12 3ELNA 1WW4A 1LENA 1LHUA 1DHKB 3AMNA 1OA4A 4E4SA 1J3QA 3I59A 3AP6A 3ZFEA 1RUD3 2PHFA 4Q4X2 2E63A 1C8M1 4FPFA 1LU1A 2RMU1 4YFWA 3URFA 1OMIA 2RM21 4B7KA 1B35A 1Y3TA 3B69A 2GMMA 1G9CA 3USUA 2AH2A 5LRRA 1TQ5A 4QX5A 1KJLA 4XDQA 5J37A 5A3LA 1A78A 3FE5A 1HV0A 3I4IA 4LBMA 3UL2A 2C5DA 3ME2A 4OUSA 2ZS6B 3VBOB 2DCJA 1HKDA 3DF0A 5KBFA 1QHDA 2SBAA 3NWKA 1PGL1 4CDQA 1OKQA 4N7IA 2Z69A 1LGCA 4M00A 3APBA 2GU9A 3UV9A 4DOUA 3WOGA 2BYVE 3JB8A 4W6WA 4XYXA 3IWZA 1B35C 3VKMA 1AXZA 4AEJA 4L97A 4LO6B 1EV13 4XW3A 4AHXA 3AYCA 2DUOA 2OVUA 3MF6A 4Y1YA 4H7LA 4Q0VA 4LO8A 1RUI3 3ZFEB 5JVVA 5JZGA 4HVQA 3B01A 2EA7A 1MQTC 2QFEA 5IK4A 2NMOA 3AJZA 1I9RA 3DUIA 1LULA 4NVPA 1DYKA 4K1YA 2WL1A 4A7ZA 3FJSA 4UW3A 2IZWA 1OPMA 2ZZQA 2JD4A 2VVFA 2IWGB 4K21A 1AL22 3MIFA 4RR3B 1YI7A 4ATEA 1NG0A 1LEDA 3OY8B 1D4VB 1D2QA 5GZCA 1TME2 2R043 4FT8A 2CNAA 4I02A 2OA2A 3HAGA 2CV6A 1LHVA 2DU0A 3WQ0A 2Y26A 5EYXA 1SLAA 4H3WA 3RJ2X 2VNGA 3GHNA 4AXOA 4H14A 3E6CC 1BZWA 1GR3A 1PO11 1OI6A 1ZREA 5IK7A 3D82A 2XJSA 4I30A 4QD2A 2R063 2IC1A 2BW8A 4FPCA 3WZ1A 3A0KA 4YARA 5JZGB 2ZGKA 3AZVA 1RUOA 1CJDA 4ITCA 2VPVA 3VBRC 1NLSA 4XEZA 4RHV3 5GALA 2WS91 3VBUB 4DPNA 4JGYA 3ECQA 4E4ZA 1R093 1S2BA 1AR73 2I07B 4EN0A 2R49A 3HN1A 1VB2A 4XPVA 2WA4A 2QNKA 5KC5A 4PDWB 1FOD2 3QLQA 4NWVA 5FQ0A 2VNOA 2XJRA 4DZGA 1GICA 5GJ6A 1J1LA 5EXOA 4FTBA 1AR82 2ZKLA 1ZZCA 3KSCA 2QCSB 1R1A2 5J96B 3L9JT 4UBGA 4XMIA 1RC6A 3EHKA 4CEWB 1NA1A 4K40A 4URTA 4R9CA 2DVAA 4ZU7A 3RJRA 1Y7BA 3CJIC 1SCSA 2IXIA 3FX3A 1JBCA 1ZBE1 1FT9A 3JCIA 3WDXA 3I8TA 1AYN3 4GA9A 4XF3A 3VBOA 2ZOEB 4FPJA 1NCQA 4GWNA 3V64A 1QH7A 4RS5C 3I2DA 3VHRA 2P2KA 3LWCA 1LOGA 1SDWA 2HWE1 1AZDA 4HBNA 4AI8A 4OVEA 1FMD2 3VBUA 4JRAA 2F6BA 3VBHB 2WQ4A 3VZKA 2O1QA 2KA3A 4XJWA 5CFCA 4CRQA 4LE3A 4M3CE 5F6LB 4OFGA 2R1BA 2AENA 5FRAA 1YFYA 4RL7A 5CB7A 3THPA 3WX5A 2YUEA 3DGTA 2ENRA 4N43A 1ZZ6A 3WG1A 4DY3A 2JG9C 2O8QA 3NV3A 4XBNA 2W39A 4AYUA 1MS5A 4XTPA 4JV4A 4R4XA 1JHNA 2H6BA 2GZWA 3U07A 1POV3 1DQ4A 2RS11 5AFBA 2A5ZA 2HWC1 4QU2A 2EXKA 3O5SA 4PF5A