2HWC3

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwc300
3JBG1 3ZFEC 1RUD2 3VBUB 4CDQB 1AYM3 5BNPB 5GKAC 1AL21 1BMV2 4CEYB 4IV3C 4N43B 1BEV2 5FMOL 1RUH3 4Q4V2 3JD71 5D8AC 2RR12 1TMF2 1RUC1 3VBSB 1HRI1 1VBA1 1VAKA 2RS12 3ZFGB 5L7OC 3VBRA 4FTBA 1R082 4PDWC 2HWE3 1COV3 1RUE3 2RS51 1Z7S2 4RR3C 2WS92 2HWD3 1VBB2 2HWF2 1PIV2 2WZR3 1EV11 4CDUA 4IV1C 3VDDA 1RMU3 3J8F3 5DDJ1 2FZ2A 2HWC2 1HXS3 1H8TA 4CEWA 5BNNB 2WFF3 1RUJ1 4Y4YA 1PVC3 2RM21 3VBFB 1MQTA 1EAH3 2TBVA 4Q4Y3 1IHMA 4GMP3 1AR71 3JBG2 4RS5B 3TN93 1VBE3 2DF7A 1VBD3 1AL0G 1ND3B 4N53C 3ZFFA 1RUG3 1FMD3 5CFDA 1ASJ1 1MEC3 3JD72 5J96B 1B35B 1WCDJ 2HWB1 1AR81 1RUC2 1HRI2 1VBA2 2BFUS 5C8CC 1PGW2 1VRH1 5ABJC 2MEV1 3ZFEB 4YVWC 1ND2C 1AR61 4QPGB 1RUF1 1C8M1 1BEV3 4IV3B 1GFF2 4CDXC 2RS31 5JZGC 3S6PA 1QJZA 4Q4V3 1RVF3 5D8AB 2RR13 1TMF3 1RUI1 4CDWB 5A32A 1RUJ2 5L7OB 4WM8C 1R083 1OOPC 2RM22 1PO11 4PDWB 1Z7S3 1QQP1 4Q4Y2 4YVSA 2WS93 1DDLA 4RR3B 3VBHA 3TN92 4Q4X2 1VBB3 4GB31 1VBC1 2HWF3 1PIV3 1FOD3 4IV1B 1ZBA1 1CJDA 4WM7A 1MEC2 2HWC3 1ASJ2 2VQ0A 1AR92 2HWB2 1AR82 1ZBE1 3NAPA 5CFCC 4JGYB 3VBRC 2WLPA 1VRH2 1QJU1 1TME1 3JBG3 3DPRA 5FOJB 3FBMA 1PGL2 5C4WA 1AR62 1RUF2 4JGZA 1C8M2 4N53B 1RVF2 4CDUC 3JD73 4GH4A 2PLV1 2R042 1OPOA 1RUC3 1HRI3 1VBA3 5A33B 1RUI2 5C8CB 1H8TC 1FPN1 1RHI1 4CEWC 1PO21 4RQPA 5ABJB 1PO12 1QQP2 4YVWB 1BBT2 1ND2B 1FOD2 4GB32 1VBC2 4CDXB 5JZGB 1ZBA2 5K0UA 2GH8A 4QPGA 1R1A1 2WWSA 1V9U1 1NCQB 1RUJ3 3ZFFC 4IV3A 5CFDC 4RFT0 2RMU1 3CJIA 1R091 2RM23 4WM8B 3VBOA 1OOPB 4RHV1 4AEDA 5ACA1 1OHFA 1ZBE2 4QPIB 3J8F1 4CDWA 4Q4X3 1AR73 1QJU2 1TME2 1AL22 1HRV1 1NA1A 1NCRA 5AC91 5J98B 2X5IA 2BPA2 1NG0A 1ASJ3 1AR93 2XBO1 2PLV2 5BNOB 2HWB3 1AR83 1D4M1 4LLFA 4Q4W1 2R061 1FPN2 1RHI2 1K5MA 5CFCB 2RS52 1VRH3 1X33A 3VBRB 1PO22 3M8LA 1AR63 2XPJA 4YVSC 1RUF3 1EV12 3VBHC 1AYN1 1C8M3 5C9AA 2ZTNA 4JGYA 1QJY1 1NOVA 3VBUA 5DDJ2 4CDQA 5BNPA 4CDUB 1F2NA 4CEYA 2R043 1RUD1 4N43A 4Y5Z0 1RUI3 4WM7C 1R1A2 1V9U2 1W39A 2Y26A 1H8TB 4CEWB 2RMU2 1NY71 1R092 3LOBA 1PO13 3VBSA 1QQP3 4RHV2 5ACA2 1BBT3 1POV0 3ZFGA 1QJX1 1AR72 3NAPC 2RR11 1TMF1 4GB33 1VBC3 2RS11 3HAGA 1HRV2 3DPRC 2BFUL 5FMOS 5C4WC 1POV1 1ZBA3 5AC92 1R081 4YVWA 2R071 4JGZC 3ZFFB 4SBVA 2XBO2 5CFDB 4GH4C 1D4M2 1VB2A 1ZBE3 4Q4W2 5BNNA 2MEV2 2R062 1QJU3 1TME3 1NCQA 2HWC1 3VBFA 4RQPC 1AL23 4WM8A 2RS32 1AYN2 4QPIA 1HQNA 3VDDC 4RS5A 1QJY2 1AYM1 2PLV3 1HX6A 1ND3A 5K0UC 4QPGC 1SMVA 1FPN3 1RHI3 1RUH1 2RS53 5A32B 1NY72 1MQTC 1PO23 1B35A 3CJIC 3VBOC 5BNOA 4AEDC 1QJX2 1EV13 4YVSB 4NWVA 4CDWC 3VBHB 5CFCA 3ZFEA 4BCUA 5DDJ3 2HWE1 1COV1 1RUE1 1NA1C 1PGW1 4Z92B 1NCRC 2R072 2X5IC 3ZXAC 1R1A3 1E57A 4WM7B 2HWD1 2QQPA 1V9U3 2WZR1 2RMU3 1R093 5D8AA 1CD3G 1RMU1 1AUYA 4RHV3 5ACA3 1A6CA 1HXS1 2FZ1A 5L7OA 3NAPB 1C8NA 2WFF1 1K5MC 4PDWA 4GMP0 2ZAHA 1HRV3 1PVC1 3DPRB 5AC93 4RR3A 5C4WB 1RB8G 1EAH1 4Q4Y1 4JGZB 5C9AC 4JGYC 4GMP1 4IV1A 3VBUC 4CDQC 3TN91 2XBO3 1VBE1 4Q4X1 5BNPC 1AYM2 1D4M3 4GH4B 4CEYC 5LK7B 4N43C 4Q4W3 2BBVA 1VBD1 2MEV3 2R063 1RUH2 1RUG1 1FMD1 3JB4C 4EJRA 1MEC1 1X36A 4RQPB 3VBSC 1AR91 3ZFGC 2RS33 1AYN3 2BUKA 1QJY3 3VDDB 2HWE2 1COV2 1RUE2 3JB8A 1F8VA 1RUD3 1VB4A 1BMV1 1PGL1 2HWD2 5K0UB 4N53A 1BEV1 2WZR2 4Q4V1 1MQTB 1RMU2 3CJIB 1RVF1 3J8F2 5A33A 3VBOB 5C8CA 1QJX3 4AEDB 1HXS2 5BNNC 2R041 2WFF2 4FSJA 5ABJA 2RS13 1NCQC 1PVC2 3VBFC 1Z7S1 1POV3 1ND2A 1NA1B 2GSYA 4FTEA 2R073 2WS91 1EAH2 1NCRB 2IZWA 2X5IB 1M06G 1BBT1 4QPIC 4CDXA 5JZGA 1VBB1 4RS5C 2HWF1 1PIV1 1FOD1 1VBE2 4NWWA 2ZZQA 1ND3C 1VBD2 1RUG2 1FMD2 1K5MB 1OOPA 1B35C 4FTSA 5BNOC 3IDEA 5C9AB
chains in the Genus database with same CATH superfamily
1F15A 2YFZA 4UFIA 4P9JA 3ZFEC 4A3XA 2XWBB 4N8MA 1OKQA 1FXZA 1RUD2 2JD4A 2YY1A 4LBJA 4CDQB 5A3LA 5FP8A 5FR3A 1LOBA 5GKAC 2OYZA 5T5OA 5I8SA 2XONA 4IGOA 5A3WA 2E32A 1Y7BA 3WW2A 1W90A 2IXIA 3EBRA 4IV3C 3LEGA 4BQ3A 1JZ5A 2ARBA 3JD71 5FAXA 3E5XA 1W99A 1GZCA 2PHUA 2RR12 3S7EA 5DG2A 4AFCA 3N35A 1SFNA 3DECA 2RDNA 2A6ZA 4P9XA 5L7OC 4A42A 3VBRA 3S30A 5CA6A 1Y43B 1UY2A 1DZRA 4LO5B 3T2QA 1G9AA 1ULGA 4Q27A 5ERLA 3OYWB 3L9JT 3ZYJB 2UYAA 1CAVA 3POSA 3RMXA 5FLHA 3CNAA 3TNQA 3FUQA 1X9TA 4XZPA 4LOSA 2RDQA 2ZMLA 3DYMA 1I6XA 4NMIA 1Y9GA 2K2SA 4EWDA 1GR3A 1GQHA 1RMU3 3MFCA 3NNMA 4LOTA 1W8TA 4RGKA 1XNKA 4HFSA 3LKJA 2WAOA 3WNOA 2A73B 1LOFA 3MIHA 2KR2A 3LD8A 5IVJA 4CTEA 2WFF3 4Y4YA 4P9LA 1BZWA 3AP9A 3OGSA 1MQTA 4YGBA 1V6KA 1GQPA 2EIEA 4Y1XA 2VUCA 4YNIA 5I91A 2TBVA 4HMZA 5T5LA 5A1LA 1RGSA 2I45A 3O0VA 2ZGQA 3ELNA 3NWKA 2C5DA 3WNNA 1ODNA 1WLDA 4YLZA 2P2KA 1GOFA 4XJ8A 3PVNA 3OPWA 4LORA 2P34A 4CP1A 1XB9A 3BOPA 2R1BA 1EY2A 2DF7A 5C3SA 4UF0B 1VBD3 2ZX0A 5F5CA 2PAEA 1RUG3 2VQTA 3B94A 1LOGA 4R9CA 5CFDA 1ASJ1 1MEC3 1NLQA 3JD72 4MXWA 4EWAA 2WA3A 4AI9A 4D7YA 4M3CA 4IEZA 3NJXA 4I09A 5LB6A 2EXIA 1S2KA 1NUKA 3GBGA 4XC9A 3WG3A 5DAWA 4DXTA 4IEWA 4GWJA 3JUUA 3UNPA 3IPVA 3M3OA 1PGW2 4NHXA 4YYOA 4QXHA 4E2QA 5L36A 2QQUA 4A2UA 2DBIA 2ETEA 4OVEA 4UT5A 3R6SA 2PHRA 1BK0A 1HV0A 3LEKA 1S0IA 3FZ3A 5T3NA 4NRQA 1C8M1 1HN1A 1GFF2 5JZGC 5DAQA 4XFAA 5EYYA 1DQ6A 2FMYA 4F8AA 3LWCA 5KHKA 3WG2A 4LJHA 2IUWA 2VH9A 1I1EA 5FYTA 3WUCA 2WABA 3LDRA 4L0PA 4OI4A 1CAUB 4GWIA 1RUI1 3OGGA 1JS9A 3NRUA 2WINB 4WM8C 4KI5M 2CGPA 1R083 4DFSA 1P8JA 3H50A 4PDWB 3GBWA 3ZPOA 2FCVA 2XMLA 4G9SB 2VU9A 4F7ZA 3E5QA 3KT7A 3AM2A 4S2GA 4LBKA 4BJ0A 3VBHA 5FYYA 5FYUA 1SQ4A 2G9FA 4GB31 1GZTA 1VBC1 3RNSA 1ZZCA 3TRSB 1OA3A 3C7GA 5FWEA 3MIDA 2VOWA 5LASA 3T4HB 4OYUA 1C4RA 2YXSA 4WM7A 1W6NA 5CKMA 4Q29A 1DP0A 4AXOA 1WA4A 5K8SA 1AX0A 1QOTA 4YZ5A 3NJVA 1NKGA 1ASJ2 3GNEA 2VQ0A 2XQRA 4O7XA 3AB0A 1KGYA 5J37A 3B3QE 2RDSA 1LESA 5BNQA 3O1RA 4B7KA 3J7NA 4Q0QA 1LOAA 4JGYB 1SHWB 1MPXA 3MIBA 3RG0A 2MNGA 2WLPA 3DL3A 4IETA 3VBRC 1QJU1 3JBG3 2VTFA 1UZVA 1PGL2 5C4WA 5FZ0A 3JCIA 3P3NA 1XYPA 3N9MA 1KS4A 4PQQA 4Z1VA 1VRBA 3FWEA 3GCXA 4JQRA 1C8M2 2NMNA 3LGRA 2A3WA 3G6JB 1ZRIA 4E9KA 4N53B 3NKTA 1RVF2 5EJ1B 4C0HA 4FBFA 2XL9A 3H1MA 4RN5A 3R4DB 4GH4A 2ZKNA 1O3TA 1O4YA 1Q8OA 2R042 1OPOA 1RUC3 1O4TA 1JBCA 1VBA3 4FXKB 5T54A 5KHIA 1RUI2 1NXMA 1LOFC 2IFRA 1N47A 2WAAA 5HV4A 2ZA9A 4PHZA 2J1EA 4DEQA 3UGFA 4PBOA 3FN9A 4NUBA 1PO21 1GLHA 5ABJB 1ZZBA 1N1YA 2DUOA 3MW4A 4A7YA 5C70A 1WCKA 2ZEZA 2YU1A 3MBWA 4NROA 1FOD2 1N1VA 4ARXA 2BVBA 3TEXA 2VVFA 3RI8A 4GB32 1VBC2 4FQZA 2Y0IA 1FYUA 4C90A 4Y5SA 3OUJA 4MO3M 1JYIA 4XFCA 1WW4A 2P3IA 3HR9A 4Y20A 5EZWA 3NO8A 3KD4A 2FDGA 4IE4A 2C26A 3BTZA 3POJA 4ZHNA 4UYBA 1UMHA 1DQ1A 3NJZA 3CO2A 1NCQB 3O1TA 2R0FA 4AVAA 1WW7A 2FCUA 3ACFA 5CFDC 2RMU1 5I0TA 4XETA 3VBOA 1NYWA 5DABA 5T50A 4MZUA 4KG8A 4RHV1 4I2OA 1YJLA 4XHXA 5FPAA 3VDCA 2WA4A 2Q1FA 2K46A 4CDWA 2JX9A 1UOJA 3AP6A 3H1YA 5FXXA 4AFBA 4QX1A 3THDA 4OQ9A 1QJU2 4IEPA 1J3RA 3WDXA 4AYUA 5JDBA 1HRV1 3K75B 5FZIA 1NA1A 2EVXA 1NAEA 3FFZA 4FOVA 2X5IA 1U12A 3B00A 5FYSA 1CN1A 2AEZA 4W8JA 4CP0A 3IT8A 3P3PA 5A7OA 4P00B 3ZYIB 1AR93 1VMFA 2XBO1 2YDEA 2JXAA 2VQAA 4N7UA 5AFEA 1SLBA 2GC3A 4R9DA 5CZKA 1EPZA 4CUAA 1FV3A 4K40A 4KWJA 3CJXA 2ZAAA 2DVGA 4JTOA 4I3GA 2PMWB 3WF1A 5IHRA 5C3RA 2DV9A 4RA0A 2QNKA 1VRH3 3OBZA 4XJUA 4DNYA 1ENXA 1PO22 5FZGA 4FFGA 5JSRA 2C24A 1JU3A 2WWJA 2R30A 2LTNA 4JRAA 2L9LA 3K2OA 3U1XA 5FZMA 3WV6A 3ZN5A 1UNBA 1AR63 5FCCA 2IXHA 4HETA 1O6UA 3J7MA 4CCDA 3VBHC 3B5LB 3H3UA 1ZM1A 1QJY1 2CAUA 3KZ4C 5GZGA 5SV8A 4JZRA 1A8MA 2AC1A 2WKKA 4WM7C 1I3HA 2XL7A 4CXXA 3IDCB 4YW1A 5A3UA 1CGPA 1SDWA 1LJ7A 2NLRA 2RMU2 1OUXA 4HSLA 3OGRA 2J1AA 4HOOA 3VD4A 2B4KA 4HN1A 5CKQA 2XVKA 2A75A 3K51A 1BVVA 4RHV2 5FLIA 3CF6E 3ZFGA 4ZU5A 1QJX1 4AI3A 5FK8A 2BJSA 2QQIA 3PUQA 1JYXA 4X6RB 4ZPIA 2W52A 4LITA 3RWNA 3V0BA 2R49A 1RXFA 5FBZA 2RS11 1PK6A 1DZTA 1HRV2 2VC9A 3DYPA 5HXMA 4LHNA 2IXJA 5C4WC 3N9LA 1ALYA 3PIGA 3OCPA 5FZ8A 1R081 4XUPA 1EUUA 5JOWA 1YQ2A 2JG9A 2BEOA 5IFPA 4META 3O1OA 3HN1A 4DUWA 1WKYA 2ZEYA 2WQ4A 3RSJA 2XBO2 4GH4C 1RJ7A 2X10A 2VD7A 1REFA 1UQXA 4LIUA 3LDKA 1ZBE3 1GICA 3KLSA 4D6SA 2WQZC 2RHPA 1CAXB 5FFOC 1XNTA 1H1AA 1TME3 2XVLA 1JN2P 4LBQA 4UFHA 3SNMA 1W2AX 4H14A 5FXVA 1W6MB 4A44A 2VNRA 1CJPA 3W5MA 2DFBA 2F4PA 4QPIA 1ZZ6A 4HLTA 3VDDC 3URFA 3AYAA 1QJY2 3PTRB 4H2AA 1O3SA 2Y6FA 3RYRA 1RUNA 4IXLA 1S4CA 4IEVA 4YW5A 1AYM1 5IVVA 3O1SA 3AK0A 3WX5A 3AKQA 2X8KA 3PUHA 1HX6A 3E6BA 4W6XA 1YQ8A 3GZEA 1W8NA 2QKDA 1UXZA 5F3EA 3F95A 4EN0A 5CISA 1GZWA 3AZVA 3J9SA 1ZVFA 3BTYA 4TN7A 3WY6A 2GC2A 4YM2A 3VBOC 2VO5A 5JAXA 1QDOA 4XILA 3WXPA 1QJX2 4XQWA 5FZEA 4CXYA 1HQLA 3N36A 3W58A 1MS1A 4CDWC 3OSDA 4ES9A 3VKOA 1PM7A 1MVQA 4GAZA 3FX3A 4BCUA 5DDJ3 1LU1A 3LA2A 4AE2A 3N7JA 1NA1C 4HK9A 4ZZ5A 4NPLA 2ZGLA 3GCWA 4JDNA 3ZYBA 2X5IC 4N90A 3VV1A 3POGA 4M0NA 1OLRA 2BWCA 1E57A 2HWD1 3KB5A 3I2GA 4TLFA 4CU7A 3WQ0A 2HBUA 2CWSA 3CZUA 4JKLA 5FZLA 5D8AA 3S7IA 5FZOB 3U0ZA 3AC0A 3RGBA 4YW6A 1O5UA 2VTXJ 4N9HA 4COYA 1GUIA 5ACA3 2VULA 2FBEA 4MGIE 4BLIA 2ZHMA 2JE7A 4DRVA 1H2NA 2OIIA 4XCBA 4CP2A 1SG3A 1LRHA 2ZAHA 5JPMB 1OLME 3DPRB 3UK9A 3CQOA 3JQWA 3D0JA 2RJLA 1HB3A 3I2JA 4DOUA 1K3IA 1EAH1 1LGCA 1WLWA 1UX7A 3N9NA 4HL0A 1UW8A 3TYJA 3U78A 2JE8A 4JGZB 1HB1A 4LBMA 1VJ2A 2UY8A 3HT1A 5FY0A 1JUIA 1YFYA 2VBDA 4BISA 4A7ZA 1AYM2 3SITA 3MYXA 2VQUA 1D4M3 4PI0A 1LEMA 5HCBA 5EYXA 3LEIA 4LR4A 1QJEA 4I30A 1TVGA 2ARAA 3OPZA 4Q4W3 4XFFA 4DS0A 5A3TA 1BJQA 2OXBA 3S5AA 2UWAA 5F3CA 2JG8A 3ETQA 1UX6A 4DXZA 2FCTA 1PX3A 1AR91 1DG6A 3NV1A 1H4HA 1LGBA 3WQBA 3ZFGC 3VL8A 1AYN3 4XUTA 5IK5A 5A7NA 5FPUA 5C5TA 1PK6C 3AMHA 1LHUA 2EIBA 1WMEA 2WN2A 3PDQA 1UF2C 4Y26A 2VBPA 5TSWA 4DY5A 1JU4A 1DQ2A 1RUD3 2YC4A 4E4DX 3LZZA 2HWD2 1JZ8A 1IZ3A 2C9KA 2JG9C 4GD4A 4XDOA 3DEMA 4ATEA 1XU2A 5LA0A 3IIAA 2A70A 2WYFA 2FD8A 3INAA 4COVA 1LAJA 1Q8VA 4DRRA 4FP2A 2BW8A 2FMDA 4DEVA 2HH9A 2IVIB 5C8CA 2JJ6A 4P08A 1BVP1 2O0OA 2WNEA 4LKEA 4AHZA 1YRZA 4V2WA 1TE1B 1FX5A 3AZWA 1HLCA 1WD3A 5E88A 4YARA 3K4AA 1LCLA 3A22A 1AJOA 3C8XA 3A0KA 1Z7S1 1POV3 3FL7A 1SDDB 1JYCA 1SLCA 5FYHA 1CAWB 2PFWA 1EAH2 2IZWA 2WS91 3K77A 4CUCA 5FYVA 3A21A 4QPIC 3ZDSA 4LK7A 4BXSV 4CXWA 3NNLA 2HWF1 1PIV1 3KT4A 3ROUA 3V0AA 4MADA 1IG0A 4QX7A 2XH6A 4L2NA 4E27A 5FZKA 1PZ9A 4BQ1A 5LW9A 1OVSA 1W28A 5GZEA 2RE9A 3WZ1A 4YZ2A 2VZTA 2R1DA 5DZEA 4GQ7A 4I01A 5JPNB 2OA2A 4QDRA 1DGWX 2BV4A 2RVAA 2WN3A 3ON7A 4MUVA 1W9SA 4OLLA 1OOPA 3EQEA 5LZ6A 1TEIA 3ZSJA 1JUHA 1RJ8A 2H6BA 3PNAA 5IK8A 2J1VA 4HVOA 5A7WB 5CNAA 1YNAA 4CZSA 1VMJA 5DUWA 2PA7A 5JR7B 3K4ZA 3IDEA 3ZYPA 1BYHA 3PIJA 2I07B 2QDRA 4XF1A 5DPNA 3VBUB 2WNUA 5BNPB 4UFMA 2NQYA 3H8UA 4LEJA 3I59B 5IVYA 2ERFA 4KNCA 4TSVA 4DPNA 3U75A 2Z2SB 3MV01 3HOBA 5FMOL 4BMBA 5FUIA 1HDKA 5GLUA 3DXUA 1ULFA 4AI2A 2E31A 3ZXJA 4FPHA 5D8AC 1GQGA 1BHGA 1IG3A 1TMF2 1UZYA 4XABA 1HRI1 2JEMA 1OMIA 5C71A 1X9PA 1H6YA 1IPSA 2XOMA 3HNBM 4Y1ZA 4UFKA 3KQRA 1TNRA 2OQ7A 2V5DA 4ARYA 2WIIB 4FTBA 2WWUA 2EIDA 2HWE3 1COV3 1RUE3 2J22A 1Z7S2 3D3AA 4AEKA 2B5HA 3WLUA 2OVUA 2WS92 3TB0A 1S0JA 3A0NA 1U0AA 2G1MA 5CKNA 2YU2A 2HWF2 1PIV2 3U37A 4OHXA 4CDUA 1QNWA 1GU3A 1ULOA 3PVEA 1O8PA 1Y9MA 2A6XA 1PNGA 2Q4SA 4BQWA 3VZNA 5BV6A 1EP0A 5DDJ1 2NP0A 2UWBA 2VVEA 2VBBA 1LTEA 1GWMA 2P6CA 5JVVA 3U4XA 2DUPA 4LQRA 3KQ4B 2HWC2 1H8TA 1OF4A 2KD7A 2VMFA 3JXSA 2NM1A 4GULA 3ECQA 1PVC3 2VVDA 1QOSA 2JG8C 2E26A 5IW0A 4Q1PA 3O1MA 3UJOA 4O9GA 2UU8A 1K12A 3EYPA 2LRPA 1W6QB 1HV1A 3D0SA 5C5UA 1T6GC 1IHMA 3W9AA 1E5IA 1WUVA 1AR71 4GMP3 4MX3A 3U10A 2MHFA 3TEZA 3KHCA 2Y6GA 5FJHA 1BCXA 4LO8A 2ZX4A 4PLNA 5IT6A 2V5YA 4AQ2A 2BTVC 4R4ZA 3RRDA 3BTAA 4AVVA 1JYVA 1DYKA 5LBCA 3ZFFA 2ZACA 5J96B 4PCRA 1QY4A 2XUMA 4QHOA 4R8HA 1AR81 1PMIA 5A7QA 2BERA 1HRI2 1BQPA 3RJRA 2BFUS 1DGRA 3MW3A 4K8RB 4Y24A 5C8CC 3WHTA 2ATFA 5J7MA 4BQ4A 5JOYA 1JYWA 1VPHA 4LXLA 5EFUA 4AWDA 4QHZA 2O8QA 2ZABA 3MUY1 4AR2A 2WSVA 4Q8KA 4URAA 5KXCA 4CU8A 1YQCA 3ZFEB 3BODA 4YVWC 2W95A 4V2VA 1VE0A 4KG0A 2JDUA 2VZPA 4QPGB 4YG3A 1RUF1 2Q0AA 3WF3A 1F4HA 4I0BA 1BEV3 4IV3B 4CPBA 4X8NA 3S6PA 4LNVA 1QJZA 4Q4V3 3M3QA 2A6VA 3NV3A 3M3IA 2Q5TA 1RVF3 3KHBA 1W8FA 2QCSB 2DU0A 2N7GA 3OGVA 5A32A 5IWFA 4LHLA 2VMHA 5L7OB 2VCBA 1QOOA 1JMUB 1EYBA 3AZZA 1OOPC 5EIYB 2O14A 2BNNA 5CG9A 5GM0A 1QQP1 1V6JA 4Q4Y2 3LA7A 5ANNA 1QKQA 2WT1A 1IS4A 2XWJB 3POBA 2P6HA 2A1XA 1NE6A 2R7EB 3TN92 5FQ0A 4Q4X2 1VBB3 5J09A 3VN4A 5FKBA 2UWCA 4WZCA 1FOD3 4XYXA 4XACA 2ZMKA 2I74A 2JKBA 2WUHA 2GDFA 3VB9A 4GXLA 2B42B 2WNUC 3M1HA 3PU8A 3OYWA 1CZVA 3M3CA 4OHWA 1SPPB 3AYDA 4QPWA 1YO8A 4YZ3A 1DCSA 4QMAA 3T1LA 2DFCA 1V6MA 3N9QA 4CCKA 1MS4A 4CRQA 1V0AA 3MEPA 1AR82 1OVPA 3DGTA 4LO7A 5SV5A 1U5IA 2ADDA 2XUEA 3NAPA 5CFCC 3ALQA 3A7QA 2WFPA 1PX4A 3WUDA 4QGMA 3KM5A 3Q8BA 4AEJA 5JWPA 2WT2A 3USUA 4LKFA 4Q26A 4BE3A 5HPOA 3PLQA 3PJQA 1C5IA 4KU8A 1FATA 4HVRA 1ENRA 2HYKA 5HBAA 1YLLA 2PHTA 2ZGOA 1RUF2 4FOYA 1UY0A 2V4VA 5GALA 3SH4A 1O7FA 3DF0A 2JD9A 2A6WA 3WNPA 2VOKA 5EWSA 2D6PA 4QXKA 3WEZA 4CDUC 2K9ZA 2D98A 4JVAA 4O9EA 4CA9A 1U5XA 2A6YA 2PLV1 2WDBA 4MSVA 2VZRA 2YFUA 3O14A 1R64A 3N9OA 4QKNA 3WDUA 4ZS2A 1IQDC 5A33B 3OGJA 1NLRA 2E51A 2XJPA 3I2IA 4OHVA 1H8TC 4FOWA 4UF0A 1OXCA 1FPN1 1LEDA 1MR5A 1RHI1 1UOBA 3D82A 1QF3A 5M0TA 3RZLA 2ZGUA 4LK6A 2AYHA 1ZRCA 4FPLA 1DYPA 2QDNA 4I0AA 2XHKA 1QQP2 1Q3EA 3ZMOA 3O1VA 1BBT2 3AL5A 3MGUA 4A7KA 5JUVA 4XBLA 1OPMA 4FO9A 2H6CA 1XXNA 5FYIA 5JXJA 5FZ9A 2YROA 3WDWA 5JZGB 4B4RA 4NN0A 1K42A 2AACA 1ZRRA 4YZ4A 2E63A 2D3RA 1UYYA 2Z79A 3ZIXA 2TNFA 4AFAA 4LT5A 4D8MA 3RZHA 5ISLA 1W03A 2QE3A 1SCRA 1U5YA 2WWSA 4RL7A 1YFUA 4BK4A 1RUJ3 2P3YA 4L97A 3ZFFC 4XMAA 1ZNPA 2DVAA 3ETPA 4RFT0 3CJIA 5IK4A 2P4EA 4BU2A 2RM23 3BU7A 4WM8B 3GZTB 1OFSA 3AL6A 3OBRA 5KXBA 2ZCWA 2VZSA 4AEDA 4RGGA 3PMSA 4ZXKA 3U14A 2GMPA 2WO2A 3GZAA 2VPVA 2D44A 3AZXA 3QH7A 3K4DA 4EE2A 2RV9A 5FMCA 4NHMA 4QKFA 1SBFA 2YGLA 5FZAA 5KC6A 2W68A 3U07A 1DZQA 1NCRA 2ZMNA 3GHNA 2BPA2 1QXRA 3I2FA 5F9TA 4XFIA 4XFHA 3MV11 3AP7A 4YM0A 2GALA 4TYSA 4YGCA 5GZFA 5T52A 5FOBB 2ZKLA 2PLV2 2HWB3 1OA2A 1OH3A 3MLLA 2WZ8A 2F17A 4LLFA 3IB3A 4FPEA 4QX5A 4NVPA 1CWPA 4CUBA 5C6CA 3BU0A 3ST7A 1FPN2 1RHI2 1K5MA 3LAGA 4LO6B 3UETA 5FDBA 1X33A 3VBRB 3VD9A 4FOQA 3I2HA 4LTAA 1URXA 4LE4A 2XPJA 3ORJA 5DUUA 4QQLA 1NT0A 2PHFA 4KGQA 4YW4A 4B1MA 5C9AA 1CAVB 4GIQA 1OBNA 1UAIA 1MACA 2HKXA 4JGYA 5GZDA 5JLVA 3Q9OA 3MLJA 4B3NA 5DUVA 3WINE 4ISRA 3C7OA 1F2NA 5JIAA 1WA6X 1WLTA 2B7YA 4BXFA 4CEYA 5F37A 1A8DA 4N43A 4Y5Z0 5FZ3A 4WVVA 1GNYA 1ZZ7A 3N7LA 1UO9A 4NJ4A 1W39A 5A70A 5KHHA 5CVRA 1ONAA 4QT6A 4QX3A 1PO13 4G3YC 3VBSA 4NHKA 4NHLA 3ACIA 4XAEA 2HEWF 2WR9A 1G8WA 2XG3A 1C57A 4LBNA 5DAVA 2W47A 3NAPC 4FXGB 1YI9A 4V1PA 1Q8PA 2JDKA 2OPWA 2P1BA 5HCHA 3VZLA 3NVCA 3VHPA 2VUJA 4XXAA 5GLTA 2D6MA 1Y9QA 1Z0HA 1ZBA3 4HT1T 5A80A 1BXHA 1HB4A 4FP3A 3LIHA 4OUSA 1WCUA 3VKMA 3DYOA 4JKKA 4QAWA 3RVHA 3GDBA 3AFKA 4XF3A 2RDRA 1NXD1 4S2DA 4SBVA 4XBQA 1L7RA 2A5ZA 4DZGA 3QLQA 3LSDA 4MXWB 5CFDB 5FYBA 4OUEA 4YM3A 4EN8B 2DU1A 2CYFA 2X29A 2YPJA 4ITCA 1DGRN 4CYDA 2OW4A 5BNNA 1UU4A 2VZ1A 2WNVA 3KSCA 1UKRA 4M4RA 1LOCA 4ZY9A 1HB2A 3OBAA 4QB1A 2BVVA 3OEBA 1NCQA 3IPVB 1RYYA 3VBFA 1AL23 5F6KA 2CU5A 4RD7A 1TZOA 4DUXA 5F5QA 1WZXA 3N9PA 1CPMA 2E9QA 1HQNA 3HT2A 3LB9A 2YUEA 4RS5A 4GWNA 2RJKA 2Y33A 4CCLA 3C2UA 4WVZA 2VY0A 4JRLA 5LBBA 3ZN6B 1C1LA 1AVBA 1ND3A 1ENSA 3NSTA 4HONA 4CCJA 1G9BA 1NX9A 1YCIA 2I2SA 1SMVA 2XHNA 3HD8B 1WBLA 2F6BA 2RS53 2YBPA 4HKOA 4MYEA 4XXPA 2OZ6A 3R4UA 1MQTC 5DZFA 1B35A 1A78A 3CIHA 3CJIC 1QDCA 4PF1A 5H9QA 2W1WA 1NQJA 4YW3A 5FYZA 5LEJA 2W94A 4ZU7A 4GJYA 2BYVE 2AEYA 5JMCA 1GKBA 4K1YA 4AEDC 3ITQA 1EV13 2PHLA 5I0RA 4FCAA 4NWVA 3VBHB 1R1ZA 5E89A 4D6RA 4HPKA 1HKDA 5F2SA 2C4XA 1NCRC 3PVOA 4NE9A 2W46A 3ZXAC 1CPNA 1R1A3 2Y60A 2V73A 1W6NB 4WM7B 2QQPA 4LBQD 1F4AA 3VHNA 1V9U3 2GNDA 5A3OA 3VKLA 1Y4WA 1XYNA 4FVVA 5JCTA 1JYNA 5H9RA 5FPXA 1R093 3IZOA 3VUOA 1JZ7A 2Q1MA 2QQKA 1RMU1 4YGDA 5JXHA 3H1WA 1UZ0A 1AUYA 3P1IA 4DQAA 5F1RA 1ZREA 4JHZA 4P9GA 4WVMA 1A6CA 3I3BA 4XEZA 2FZ1A 2WYSA 4INDA 1YIFA 3IDAA 1C8NA 2KXLA 1K5MC 1ZYBA 2WFF1 1IPJA 1QXJA 2AENA 3LCPA 4WZFA 1DQ4A 2FDHA 4K7JA 4QQ2A 4UXAA 1AX1A 2WT0A 4HZFA 5GLWA 4RR3A 5AC93 5C4WB 2GP5A 3MIGA 1AX2A 2JIJA 4URTA 4IEUA 4BQYA 4UW5A 3OTFA 3I97A 5C9AC 5J48A 1UU6A 4JGYC 1O4ZA 2VTXA 3AYCA 4L11A 4IV1A 4YG6A 1I9RA 3KCCA 4AVCA 3THTA 4GH4B 1L7QA 4CEYC 1GNZA 1W0OA 2BGCA 4D6QA 4N43C 3SQOA 2CDPA 3FC0A 3ME2A 4PJYA 1VBD1 1W6OA 2MEV3 2TEPA 2R063 2XJUA 5F3GA 3HQUA 1RUG1 3H3ZA 1MEC1 1X36A 4ZONA 3VBSC 4K9SA 1PZ8A 2CTVA 4IESA 3MZHA 3IAQA 2QQOA 2YBSA 3EMRA 2KA3A 1HQWA 1MS0A 2RS33 3ACHA 4NHYA 2UYBA 4IEOA 2BUKA 4XMIA 3Q8CA 3VDDB 1N1TA 4FPJA 4FFIA 1UN1A 4MGKE 1T6BX 2D6LX 3C7EA 1KXGA 1EUTA 2BBAA 4I02A 4XW3A 3ZIWA 4LBLA 3SH5A 1LHWA 4CU6A 4Y20B 3FBYA 4XUQA 2D6KA 2YV8A 5I0UA 1K45A 4XHBA 3PUSA 4BQ2A 5GJ6A 1UMIA 1OD5A 1RMU2 3P5BA 4HG6B 4M01A 3VBOB 2GAUA 1D2QA 1LKNA 4L9BA 4J25A 4NIIA 3RI9A 5HV0A 1QJFA 5CU1A 3LEMA 2VMCA 3QBQA 5BNNC 4FAGA 2WNVC 4I3PA 2WFF2 3EO6A 2A3YA 5FYCA 4B7EA 1AXZA 3B02A 1NCQC 5FZCA 2W2IA 2Q8EA 3VBFC 1J1TA 2P37A 1IKPA 1ND2A 1NA1B 3N7MA 3LQCA 2R073 3I2OA 2VCMA 2X5IB 5KC5A 3PVBB 4K1ZA 5FBJA 1WGPA 4AHWA 4CDXA 5IVEA 1M06G 4ORFA 4RS5C 2FDKA 4QQOA 3LOIA 2YC2A 2Q8CA 4C1WA 1N1SA 1O59A 5AFBA 3NW4A 5IFTA 3HQXA 5BUVA 5BYNA 3KCYA 3AJZA 1REDA 3UYJA 1ND3C 4A41A 1VBD2 4X8PA 4B8EA 5HCAA 1ZX5A 3KV5A 1RUG2 3OEAA 4M4PA 1W6PA 2VNOA 5FZ4A 1ZZ8A 1ZRDA 1B35C 1QHDA 2ZGPA 2DCTA 5F7UA 3F2ZA 5FO9B 1UWWA 3SC7X 4BB3A 1GOHA 2ARCA 4LUKA 3ATGA 2NN8A 4FPFA 4LLOA 3JBG1 4K8FA 2CHHA 2DWRA 4F83A 3DV8A 5DG1A 4Y1YA 4QB6A 1AL21 2OQ6A 2V72A 1UYZA 3HPNA 5EPAA 3ZXDA 1HJFA 5ANQA 5JXGA 1G9CA 3T1MA 2RJ2A 1RUH3 3VZOA 2CWMA 4H55A 3I2KA 2YMZA 1OI6A 4XIKA 3RZZA 1GP6A 1RUC1 1VBA1 1VAKA 1W2TA 1XOYA 3DCQA 2ZPXA 1MZ6A 1UZWA 2RS12 3UGGA 3ZFGB 3BUCA 3ZN4A 1UOFA 4QXBA 4CP9A 1R082 3MW2A 4IEYA 4JTNA 3V0BB 1PK6B 2RS51 3PJYA 3KS7A 3AKTA 1QH6A 4P02B 4QGLA 4RR3C 3O1UA 1REEA 4A6OA 4LMFA 3HJRA 3CZJA 4Q5OA 2WZR3 1UU5A 2JG9B 1EV11 1LODA 4IE5A 1APNA 3KMHA 4IV1C 4J6GA 1LB2A 2Z69A 5B4XA 2OT7A 3O12A 3J8F3 4NIGA 4IE7A 1GP4A 1O5LA 3LPFA 2FZ2A 1HXS3 4CEWA 5JSPA 4Y5TA 2Y8KA 4IE0A 3TWIA 2LS6A 4R9BA 1PMHX 1Q5OA 3PTYA 4QQHA 4LBQB 3QH6A 1OURA 2H0BA 2QJVA 3HEIA 4Q4Y3 5FK7A 2NMOA 3AFGA 3VZMA 1CVNA 2WJSA 2CDOA 2JB8A 3CEWA 3JBG2 2VMIA 4QDQA 4WBBA 5FY8A 1OA4A 2JICA 4QM9A 1VBE3 1XSQA 3TN93 1ULPA 4MLOA 3KV4A 5LRRA 2W91A 3ZXEA 2QVSB 2D43A 1H1IA 4IGPA 5JI7A 1YXWA 4BLJA 5A3MA 4XZUG 5LY1A 3OD4A 5F6LB 1AL0G 3J7HA 4B29A 1XE8A 1GZWB 2X09A 3WHUA 1FMD3 4QX2A 4ZKTB 5BY5A 1UOGA 3O1PA 2EXHA 1JHJA 1DU3D 4P9YA 1OT5A 1WCDJ 1S1AA 1SBEA 3MPPG 1RUC2 2FQPA 1N3OA 1VBA2 4G4FA 4LKSA 3RFRA 4CU9A 3VHRA 3THCA 3UGHA 3ZOIA 3H42B 1NE4A 1CR7A 4PIXA 1N3PA 4OZXA 1MZEA 5A7SA 3UV9A 1VRH1 2HLEA 3LA3A 4QKBA 4GZ9A 2MEV1 3DN7A 4ASLA 5LBEA 4KWLA 3ZYGA 1CONA 2YHJA 3QOPA 4XQ4A 5LK5A 1UPIA 1ND2C 1UZZA 1AR61 1LENA 1UYPA 4GKYA 4OI0A 5LEKA 1ST8A 3SKJE 3AXDA 3MI8A 4N9IA 4CDXC 4CSWA 2RS31 4QM8A 1S55A 5KHGA 3JZVA 3WP4A 2DCYA 5IAXA 4FQ4A 1PM4A 1US2A 2JB4A 2WSUA 5LA9A 2BQPA 2NZ9A 4Y22A 4GWMA 3WQ1A 4Z8BA 1JOPA 5D8AB 2RR13 4XF9A 2D5HA 4TZDA 1S0FA 5HI0A 3WF4A 2LM3A 2Y6LA 1KJRA 1C1FA 1LHVA 2D97A 2BU9A 5J36A 2OX0A 1GZ9A 2OUHA 3WG1A 2P5BA 2Y38A 4Q0VA 4YVSA 1DDLA 1Q43A 5CYYA 4JAAA 4BHPA 1OF3A 5IVFA 3EHKA 1I5PA 4PF5A 1JW6A 5FY1A 3UT0A 1AF9A 4KGGA 3WVJA 2ZS6B 3X29B 1E5RA 1CJDA 4KH9A 2BGPA 1G9FA 3OY8A 1LR5A 4COWA 2VMGA 2YB7A 2ZGSA 1OFNA 1ACCA 5DQ0A 5L9VA 3FHIB 1OC1A 1AR92 1OD3A 2JDPA 3A23A 3J26N 3H8OA 1DBNA 5GLZA 1ZBE1 4L8QA 2JENA 2GMEA 4CPBD 1W9YA 4YWAA 1IOAA 4L99A 2ZGTA 2NPIA 1RINA 1VRH2 4J1XA 3R05A 3KV9A 1TME1 1WCSA 4Q0PA 5FOJB 1U5ZA 2A3XA 3MIEA 5EJ3A 1WW6A 3ZR6A 1AR62 3NV4A 3POFA 2ZHKA 1IGOA 2AZ5A 4Q1RA 2B8MA 4XTMA 4TTGA 3WSOA 3CDZB 4HKWA 4OZOA 1IKQA 4BOWA 3IAPA 5FREA 2OKXA 3GJBA 5KWRA 3S57A 3JD73 1SACA 5CIRA 4AHYA 4DB5A 4AAPA 1G7YA 4NAOA 3H8XA 5KBFA 2WZEA 4AQSA 5C8CB 1WMXA 2DBNA 4Q2FA 4CEWC 5FTTC 3RS6A 2D3SA 3DKQA 4RQPA 3AMNA 4DIQA 4YVWB 4DO0A 3T2OA 1XU1A 2EALA 4R4XA 2XXZA 2GNBA 1C3HA 1PHMA 1EPWA 2VXRA 4CE8A 3V0AB 2XDVA 4HBNA 3KV6A 2WQ8A 3R4SA 4NPRA 1L3JA 3GBFA 5K0UA 1W2NA 4QPGA 1DIWA 4IEQA 2Z42A 3TOJA 3ZXKA 1S2BA 3T0BA 5LA1A 1RITA 3APBA 4IV3A 3SLIA 1F35A 2WO1A 3BVCA 5A6YA 1OOPB 1C28A 1CIYA 3KCXA 3HBZA 2XJQA 1W8HA 5FJKA 1OHFA 1ZBE2 2B45X 3PURA 5ACA1 1G9DA 1SZBA 3L2HA 5H9PA 3U4SA 3J8F1 5I8TA 1UMZA 1SLTA 3O0XA 2ZGMA 1TME2 1IS3A 3E6DA 4BWOA 3MUZ1 1D0HA 3VKNA 3ZSLA 3V64A 3JU9A 3OJBA 5J98B 3WF0A 2XVGA 2WNUB 4R52A 2XKPA 3FLTA 4OI2A 1SFPA 4A45A 1NG0A 4H7LA 4C1XA 4RYDA 1ASJ3 2XKOA 5LCWL 2GZWA 3D8CA 2IXKA 5BNOB 1D4M1 3SKVA 4U36A 3LSEA 3VZJA 1UYXA 2IXLA 4Q4W1 5F5AA 4KWKA 1J59A 4A6SA 5CFCB 5F5IA 1S0GA 2ZHNA 1GMMA 4LULA 3UJQA 5KXDA 1PMJX 3K48A 3N3HA 2DURA 4W65A 3WP3A 1DGLA 5FO7B 3SEPA 3T4VA 2QQLA 2C6SA 2HEYF 2G19A 2ORZA 4YVSC 3ZKUA 1KJLA 5A1FA 1AYN1 1C8M3 5I0DA 1W2UA 1H2MA 4OQ8A 3SH3A 1NOVA 3WNXA 3VDBA 1MVEA 2AR6A 4O61A 5DDJ2 4CDQA 2GNMA 5DZGA 3J7LA 5LBFA 3ZVXA 4CDUB 3WF2A 2R043 1W8OA 2YYOA 1RUD1 4MHUA 2CY6A 1RUI3 3VZKA 4AVTA 1OQ1A 5FRAA 2Y26A 2GNTA 1H8TB 3ES1A 1NY71 4K3UA 1H2LA 4NRMA 4FPOB 4AGGA 4MGTA 1FNYA 2W5FA 5ACA2 1POV0 5F3IA 2LW8A 3EXUA 2FDIA 1AR72 1DF0A 2RR11 5HCFA 2O8OA 1W0NA 1VBC3 4GB33 4LUMA 5LWBA 1TNFA 5JR2A 5EV7A 1G86A 2G9ZA 4OULA 3KWVA 4XDQA 5FMOS 4XVHA 1POV1 1VLNA 1A3KA 3AP5A 1LU2A 4OMDA 1SLLA 2HYXA 5F39A 3CHXA 3ZM8A 4DXSA 4NIDA 3VLBB 5FZ1A 4AK3A 4MGSA 5C7GA 3ZFFB 4IQPA 3ZMNA 4JC1A 2XGXA 4UBGA 5CBLA 1D4M2 2R16A 2EXJA 1V6OA 3NKGA 4BA6A 1YJKA 4Q4W2 3I49A 1X8MA 2BNOA 2WO7A 3UKTA 3BALA 1QJU3 3T0DA 2YC0A 1CIWA 1JH5A 3ES4A 4RQPC 1SLAA 1W05A 3IKWA 4W50A 4WM8A 4OI1A 2ET1A 4K20A 2JDMA 4A4AA 5CAZA 5C8WA 2VOTA 3CBNA 5FY7A 1AYN2 2Y6JA 3IIIA 2ZHLA 3K46A 5G04L 2EAAA 4IW3A 5FP7A 1VP6A 3NMBA 1CX4A 1J3PA 5T55A 1OLMA 3OOXA 4ZZ8A 3TEYA 1I5ZA 2MPFA 2W0XA 4BIFA 4XOGA 5K0UC 4QPGC 5E16A 5IUQA 5A32B 1NY72 3ILFA 1PO23 1WD4A 1W06A 3BPSA 3Q8EA 4TWTA 2X05A 4E4ZA 1S2EA 1YFWA 3C3VA 3D4KA 2XJRA 4P5YA 5BXXA 3ZKYA 4AEMA 1J84A 1Q56A 5FYMA 3GJAA 4Z07A 2PN5A 4QKDA 5FQ0B 3ZSMA 1LOEA 1OQDA 1XRUA 2HWE1 1COV1 1RUE1 1Z78A 1W8WA 1PGW1 2Y0OA 3I7DA 4S2FA 5IK7A 4YRDA 1W2OA 4PT6A 3GM8A 2ORXA 4SLIA 3RDIA 3RJ2X 4E8DA 3LFIA 2FDFA 4XTPA 3G7DA 3WW3A 4DUVA 5JXIA 1DLCA 1H1MA 2RMU3 2XQXA 1UCXA 4OCTA 4IDZA 5L9RA 3RQ0A 3I2DA 3IMNA 3FUOA 1CAUA 1H30A 1KFXL 1PGSA 4RHV3 4AAXA 1W0PA 3SISA 3AKPA 3AMQA 4XJWA 3RPQA 3NAPB 4UFJA 3DXTA 2JDZA 2XLFA 4AVSA 4PDWA 4GMP0 1HRV3 1PVC1 5EXOA 1YQ6A 1UIKA 1X7NA 4M0HA 5FMBA 4AI8A 3USUB 2WRAA 4UW3A 1E5HA 3VKFC 4E4HA 2LROA 2CL2A 2JDNA 1GBGA 2CNAA 5FZ6A 5A1AA 1O8SA 3I8TA 4GMP1 2VE1A 4FPYA 1F9KA 4CDQC 2XBO3 2OS2A 3CLPA 1ULEA 1GSLA 4HN0A 2J1SA 3IDBB 3DKWA 3I54A 4QX8A 3VGIA 5I0SA 3BN6A 2W1UA 4BH9A 3AZYA 3JB4C 3ZPYA 4EJRA 1V6LA 3SEEA 2AGSA 2OZJA 4JDOA 3SCGA 2C9AA 2PHDA 3V56A 2A71A 2PYTA 5FO8B 3GXUA 4YGEA 3C7FA 1AZDA 1XNCA 3PUAA 1UY1A 1WBFA 1ZZ9A 3MICA 1DGWA 4LHKA 5DXDA 5L9BA 3VL9A 3I4IA 3VD3A 1QJY3 3M7AA 1XNBA 4EN9B 4X6QB 4R9AA 2ZX2A 2HWE2 1COV2 1RUE2 2DCZA 4WV8A 3JB8A 3NV2A 4H7MA 3AKRA 2P17A 5B4NA 3BOWA 3IBMA 1PGL1 1BMV1 1F8VA 3AP4A 3RZGA 4UFLA 5G05L 3W20A 2PHWA 1W8UA 4N53A 4LHSA 1BEV1 2BGOA 2DVFA 4BZ4A 2P3JA 2YBKA 5A6XA 5C3OA 3I3MA 1JHNA 3BI3A 1QGLA 3N4MA 1H4GA 4Q4V1 4B1LA 1NLSA 1MQTB 4AI0A 3CJIB 4D69A 1CX1A 1RVF1 4Z2AA 3AJYA 4AG4A 2WNOA 1DQ0A 2BDRA 3VD7A 1QJX3 3ZN6A 4NIAA 3J4UH 4XIOA 3WW1A 4AEDB 2R041 4Z2WA 5LATA 2Y64A 2BOJA 3M4FA 3ZSEA 5ABJA 5JMOA 1L7LA 2RS13 4BM8A 3K3OA 4FSJA 1AXKA 1QMJA 1PVC2 3KVAA 1YQ5A 1MS3A 2UURA 3V65A 3KGLA 3AVRA 2GU9A 3WCSA 4COZA 3ZDVA 3WT3A 5C33A 4FTEA 4XFBA 1NCRB 4LIVA 1OSGA 1LECA 1YI7A 3OF1A 3VD5A 4ASKA 1KS5A 1VBB1 1J3QA 1WW5A 2VECA 3B93A 4JX0A 2XJVA 1FOD1 4XFGA 2QTWB 5LA2A 2VMDA 3FHQA 3HN3A 4M3CB 2YPDA 4QU1A 1VR3A 4RGAA 2AUYA 3GYDA 4QD2A 1S0CA 1H2KA 1V70A 4AI1A 4B4QA 2ZGRA 4O65A 3AMPA 1AXYA 4QB2A 4UW6A 1K5MB 5AVAA 4XQDA 1AHSA 2IC1A 3LIGA 3TBDA 1XE0A 1DHKB 1KITA 3DUIA 4AQ6A 1SLIA 2W92A 1MS8A 4JDMA 4MV2A 1XE7A 5E6HA 5C9AB 3GALA 1CESA 2BWAA 3PHMA 4A3ZA 1AYM3 1US3A 4W6YA 2QQNA 2VM9A 3W5NA 3PUIA 1BMV2 3HNMA 4PQ9A 4CEYB 1O3RA 1X82A 4N43B 1QIQA 1BEV2 4ES8A 2VUDA 3WDYA 3FE5A 4GKXA 4Q4V2 4COUA 4CCOA 3OBTA 4EYUA 4BMEA 4Z82A 2QQWA 4IUGA 3CMGA 2EF6A 4XJ9A 3VBSB 1LNSA 4H3WA 1V00A 2GMMA 5F2WA 2CAVA 3BIEA 4E4SA 1LGNA 2Y34A 4PDWC 1YHFA 4UWDA 1XBFA 2VR4A 4C91A 5FUNA 5FIXA 3PU3A 4QDSA 1JZ6A 4Y33A 1X8EA 2PQQA 1FAYA 1QNYA 2W87A 2C0ZA 2ZOEB 5FZFA 2R6QA 3H0OA 2HWD3 3ZLIA 1VBB2 1JOJA 5J3UA 2VW1A 5FUPA 1MS9A 3VDDA 1C5HA 1W3XA 1GNHA 3ZO0B 3ZYRA 1RXGA 3WQ7A 3FMGA 1WCQA 2GP3A 3W21A 3ACLA 1DYOA 1GWKA 1QXPA 1KDMA 1YFXA 3OPTA 2XLGA 4P5HA 5BNNB 1F31A 2WNVB 3MLKA 1RUJ1 4HVQA 2ES3A 2IVJA 1ULDA 2RM21 3T3YA 2DVDA 4UW4A 3VBFB 4EROA 5FKCA 1W3VA 2W9XA 1EAH3 3ZXFA 2XB6C 4OMCA 4N7IA 3USSA 1D4VB 4YG0A 3FLRA 4RS5B 4HSJA 5FPLA 1FNZA 1IQAA 2W1QA 2QZ3A 1PZ7A 3C7HA 3Q8AA 3UESA 3H8RA 3B9IA 3ZR5A 1WLCA 2SLIA 4QQPA 3AXEA 1DLLA 1ND3B 1O91A 3MF9A 4N53C 1YIPA 3OB8A 5A6ZA 5T5JA 3UKVA 5FZDA 4KMQA 1B35B 2EA7A 2HWB1 4BPZA 5IJRA 4AFDA 3P6BA 4HXCA 4WVWA 4XJZA 4QXCA 4QHBA 4XE9A 1CAXA 2GC1A 2Q1ZB 5FV3A 3O0WA 5FY5A 5JI9A 2J1UA 2PAMA 3R0RA 4M00A 5FY4A 1XNDA 2EICA 1E5SA 3MFAA 4JHTA 5C3QA 5ABJC 3RZKA 5JIUA 1W9FA 2ADEA 4HPKB 1W6MA 4EZHA 5FPVA 2JDAA 2XLAA 2X53S 3GZUC 2VCAA 1YWKA 4BIOA 3KF3A 4NIHA 4AOCA 3BTXA 1GYKA 3H3LA 5FLJA 4D3WA 4DY3A 3M3EA 3AYEA 3RYPA 1UD1A 2ENRA 4Q0SA 5D2AA 2J1TA 1TMF3 2GN3A 5T5PA 3S5QA 1Q8QA 4CDWB 1UY3A 4WVMB 1NZCA 1RUJ2 1M4WA 3WNMA 3PMEA 2VZ3A 2RM22 4OFGA 1D7PM 1PO11 4QPYA 5EJZB 1Z7S3 2HEVF 3K3NA 1Q8SA 4YFZA 1CZSA 3LPGA 5I93A 5DMYA 2WS93 3VHOA 4RR3B 4XURA 3AX4A 2ILMA 3NNJA 3E97A 2VZOA 2HWF3 1PIV3 5EQUA 4D94A 5KR7A 1JZ4A 1GP5A 2FDJA 2JECA 4E2GA 4IV1B 2ARXA 4J1WA 2DDUA 1ZBA1 4XBNA 1W9TA 2BP6A 2VCCA 2DTWA 3FFQA 4W6WA 1ZA7A 2B9UA 4YFWA 1RL3A 5CB7A 3WP6A 1MEC2 2HWC3 3POYA 4XDPA 1N3QA 3TAYA 1LULA 3IWZA 1W6OB 5IYYA 5FZOA 1O3QA 1F5FA 3S0MA 2W1SA 2KM2A 1ULCA 1TQ5A 2HWB2 3BGAA 3L2YA 1X50A 3H9AA 4IL7A 1VMHA 1V6IA 2VJXA 5AVPA 4PBPA 2VW2A 4Q0UA 4F3JA 3DPRA 3FBMA 2D6OX 3CU7A 1STMA 3OD0A 1RIRA 4JQTA 2D93A 2OUJA 2SBAA 3BPZA 3MPBA 5FP3A 3BIWE 4AHXA 5H9SA 4JGZA 2VMEA 2D3PA 1JOBA 1RC6A 4B4PA 2W39A 2EXKA 3WR0A 4IGQA 2V4AA 2DCKA 2UY9A 4LE3A 3T09A 3T2PA 2O1QA 5FWJA 1A34A 4FT8A 1HRI3 5FMDA 2W3JA 3LDBA 3ILNA 3E5UA 4AFMA 3LF7A 2PELA 4KWUA 4PLOA 2Y6HA 4BQ5A 2HJIA 2FHRA 4AF9A 1PO12 2YGMA 4FFHA 1FV2A 1WWYA 4JV4A 2ZX3A 3WD5A 1UL9A 4NR1A 1ND2B 1BLZA 5FZBA 4MVTA 5CEHA 5IATA 1DQ5A 4PLMA 1KFUL 3QCWA 5KHJA 4CDXB 1UKGA 4D0QA 5BPXA 3WOGA 1Y3TA 1D2SA 2WLQA 1SFYA 1W9WA 2D5FA 4EWEA 1ZBA2 4CCMA 3LE0A 2WBKA 5DAXA 4K21A 4AQTA 2D7FA 2GH8A 4UOJA 1R1A1 2ZBJA 3BB6A 1BKZA 1SCSA 1V9U1 3LFMA 3ENRA 4OHYA 1R091 1W6PB 3ABZA 3WNLA 3MIFA 1QWRA 3CKHA 4QPIB 2BOIA 2P3KA 4EQVA 5KXEA 3MO4A 2VOVA 4Q4X3 3B01A 1AR73 4K6BA 2RG4A 2DCJA 4E2SA 2JIGA 1UIJA 1AL22 4NPMA 5CADA 4UI9L 3THPA 1GWLA 3CL1A 4HK8A 1CAWA 3U11A 5AC91 3NL1A 2J42A 3QD6A 4AGRA 3FHAA 4E8CA 2JDYA 3D5OA 3PL0A 4P14A 2G9GA 4MOAA 2PTMA 4Y1VA 3SHRA 1VAVA 2GH2A 1VIWB 4AZZA 5F32A 2E7QA 2E7TA 1XSRA 2W08A 3B69A 4TLGA 1AR83 2Q8DA 1KEXA 2ZEXA 2LALA 2QUOA 2ID4A 1MS5A 3AKSA 4TXWA 2Z5WA 2B9VA 4HKLA 2R061 2JWPA 5A6QA 2RS52 2BRTA 2IWGB 4CP9B 2EAKA 2VGDA 1UY4A 3M8LA 3I3EA 5FY9A 2VNGA 5A7WA 3NJYA 1JZ2A 1XPWA 1PVXA 3H7JA 3OUHA 1T2XA 1POQA 4LBOA 3UKNA 5JOXA 4P9IA 1RUF3 2BNMA 2B39A 1EV12 4UBHA 3T08A 3ZXGA 2Y6KA 4MGYE 2ZTNA 1CQ9A 2IFWA 3RMYA 3VBUA 4NAMA 3HQRA 2C1FA 4NOTA 2K0GA 2VZVA 5BNPA 1GV9A 4BDVB 3IM0A 3I59A 4GALA 3WNKA 1GANA 4ZS3A 1IS5A 4UAPA 1ENQA 4RSUA 1R1A2 3M2MA 5L73A 5A3PA 1NZIA 1KDKA 1V9U2 2QBXA 1TG7A 4CEWB 3QACA 2VL4A 1R092 3GHMA 3LOBA 2VW0A 4BK5A 2HBTA 5E1RA 2VAUA 1QQP3 4BQXA 5F8PA 5FXZA 5C3PA 1ZRFA 1BBT3 3BKZA 1IPKA 2VG9A 1SEFA 1XYOA 4FI9A 2Q8OA 1TMF1 4CUGA 2BZDA 3N7KA 3ZYHA 4MG2A 1F5JA 3HAGA 4YZ1A 4M3CE 4MH0E 4YPJA 5A3NA 3DPRC 2BFUL 4YSFA 3KF5A 3I3QA 3FLPA 5AC92 3B7MA 4JCKA 4KQ7A 4M3CF 4YVWA 4JKMA 2R071 4ZU4A 3POEA 4JGZC 1PNFA 1BK1A 3E1F1 4MHRA 4GJZA 2JG8B 2CSGA 4S2HA 3GGLA 2IXCA 2AH2A 1HW5A 5FPZA 3ACGA 1VB2A 1KD7A 5K9YA 3RZJA 3O5SA 2MEV2 4LPLA 1VAMA 1MZFA 2J7MA 2JKXA 2R062 2VOXA 4FPKA 2WO3A 1XC6A 3HVDA 2HWC1 4NO4A 2QQJA 5GLVA 5A7PA 3Q8FA 1ZA4A 1HJGA 4XPVA 1FT9A 2ZGKA 5FPBA 2WC2A 1H9PA 2NYYA 1W6QA 3MDPA 2RS32 1JYTA 1HIXA 4QU2A 3RWKX 2PAKA 1QU0A 4IE6A 5LY2A 3WP5A 4YW2A 2QQMA 4PI2A 5B2GB 3HMYA 3MHZA 2V09A 2PLV3 1OQEA 2A7AA 4Y22B 4CCCA 3I3DA 1W8ZA 3WDVA 5FZ7A 3ZYFA 4MXVA 4L92A 1FPN3 1RHI3 1RUH1 3IMMA 4D7SA 5DN2A 3GF6A 2VUAA 1XNAA 2ZXQA 5FXWA 4EN6B 5JOZA 2CGNA 5EHDA 2YG0A 4C0BA 4FAHA 5BNOA 3VDAA 3D6EA 2PXJA 2QZ2A 1JI6A 1H8VA 1K5JA 4KBZA 4YVSB 3ILRA 4CCEA 4EV0A 3IN9A 2PHXA 4Y4RA 4DINB 4EZ4A 2J1RA 1W04A 5CFCA 3ZFEA 3SXWA 4CVUA 1YYNA 4IERA 3POWA 5J1XA 3A4UA 1JZ3A 1S0EA 2XR4A 3RYKA 4Z92B 3KGZA 2QQVA 1JODA 1J1LA 1OUSA 2R072 3JQXA 1RUOA 1J58A 1ODMA 3OY8B 4FPCA 2WZR1 2CGOA 2OPKA 3BYWA 1H6XA 4GA9A 4MGZE 4OUMA 3T2TA 1DFQA 4LA3A 4D7TA 1CD3G 3EB7A 1FI2A 1YEWA 2ZZJA 5FP9A 1S0DA 1H0BA 2E7AA 3EJKA 4FPGA 2GC0A 4QX0A 5CG8A 2TUNA 4XAAA 1JXNA 2B46X 2GN7A 1HXS1 1HN0A 2D6NA 5HXVA 5L7OA 1LHOA 4OHZA 2DTYA 1UPSA 4XJAA 2EIGA 4MGQA 1YUDA 1D0GA 2E53A 2R0HA 1GOGA 3UL2A 4DXRA 4AVBA 3KT1A 5L19A 3HIFA 3KVBA 3NNGA 4IEXA 1RB8G 4KBBA 5APAA 2WZPP 4Q4Y1 4LA2A 1V6NA 2QFEA 2E33A 2JDHA 1OH4A 1J83A 2Q30A 3VBUC 3TN91 4Q4X1 1VBE1 5BNPC 5GZCA 2XJSA 2ZJCA 4Q8LA 1IS6A 4XUOA 5LK7B 4QWNA 1SPPA 4FFFA 3SCHA 2BBVA 5DAPA 4XF4A 1RUH2 1FMD1 1JTZX 3TEWA 1RTVA 2WL1A 4P9WA 4ASMB 4PIZA 4RQPB 5EP9A 3WDTA 5I8YA 1LHNA 1VALA 4HANA 4NRPA 4ONUA 5K7PA 5D21A 5LRSA 3HBKA 3NQHA 4C8DA 2G4IA 2YZ4A 5E8AA 4EN7B 3E6CC 2DYCA 1OKOA 1YC61 4XUNA 5K4LA 4RFRB 3HNYM 4AW7A 2H0VA 1B09A 3RZMA 4XF0A 2R32A 1UXXX 3T0AA 2ET7A 1VB4A 5D1IA 3AVSA 4Y3OA 3TNPB 3ASIA 1AJKA 3OUIA 3SCFA 3W59A 5K0UB 4DMIA 5DUXA 4ISQA 2VZQA 1S0BA 2WZR2 1KQRA 3WCRA 4LKDA 1G6NA 4KU7A 3M70A 4KL1A 5IVBA 5A33A 3J8F2 3T30A 3WG4A 4CCNA 4Y1UA 1SBDA 1WMDA 2Z4FA 4QGNA 1HXS2 1OLQA 3MF6A 2AREA 2ZEWA 1H9WA 2ZGNA 3OG2A 1XJAA 2VXJA 5FZHA 4YW7A 2GSYA 4AGVA 3HWJA 5IVCA 3H7YA 4XCAA 4U2AA 3B9CA 1BBT1 1NQDA 2VNVA 3SMHA 1MZ5A 3BCWA 4W4ZA 4YM1A 3O7OA 3WW4A 5JZGA 3ZSKA 2D40A 1VBE2 2F4LA 4ZXEA 2PQSA 4NWWA 2LUWA 1QH7A 2DVBA 2ZZQA 1KRIA 2DUQA 1XQNA 3NNFA 4AL9A 5JSOA 5IAVA 2VZUA 3ZX7A 1FMD2 2XJTA 3POIA 1WMFA 3ZXLA 4LO4B 4ATFA 3AMMA 4I0WB 4FTSA 1CZTA 2CV6A 3FJSA 5BNOC 1QEXA 4BYYA 5FP4A 2ZX1A 4PIYA 2E6VA 4ET7A 2JE9A
chains in the Genus database with same CATH topology
4P9JA 3ZFEC 4A3XA 2XWBB 1OKQA 1FXZA 1RUD2 2JD4A 2YY1A 4LBJA 4CDQB 5A3LA 1LOBA 5GKAC 2OYZA 5T5OA 5I8SA 1Y7BA 3WW2A 3EBRA 2IXIA 4IV3C 2ARBA 3JD71 5FAXA 3E5XA 1GZCA 2PHUA 2RR12 3S7EA 5DG2A 4AFCA 3N35A 1SFNA 2A6ZA 4P9XA 5L7OC 3VBRA 3S30A 5CA6A 1Y43B 1DZRA 4LO5B 1G9AA 1ULGA 4Q27A 3OYWB 3L9JT 3ZYJB 2UYAA 1CAVA 3POSA 3RMXA 5FLHA 3CNAA 3TNQA 3FUQA 4XZPA 2ZMLA 1I6XA 2K2SA 4EWDA 1GR3A 1GQHA 1RMU3 3MFCA 1XNKA 4HFSA 3LKJA 2A73B 1LOFA 3MIHA 4CTEA 2WFF3 4Y4YA 4P9LA 1BZWA 3AP9A 1MQTA 4YGBA 1V6KA 4Y1XA 4YNIA 5I91A 2TBVA 4HMZA 5T5LA 1RGSA 2I45A 3O0VA 2ZGQA 3ELNA 3NWKA 2C5DA 1WLDA 4YLZA 2P2KA 4XJ8A 3PVNA 2P34A 4CP1A 3BOPA 2R1BA 1EY2A 2DF7A 1VBD3 2ZX0A 2PAEA 1RUG3 4R9CA 3B94A 1LOGA 5CFDA 1ASJ1 1MEC3 3JD72 4MXWA 4EWAA 2WA3A 4D7YA 4M3CA 4IEZA 4I09A 2EXIA 1S2KA 3GBGA 3WG3A 4IEWA 3JUUA 3IPVA 3M3OA 1PGW2 4YYOA 4E2QA 5L36A 4A2UA 2ETEA 4OVEA 3R6SA 2PHRA 1HV0A 1S0IA 3FZ3A 5T3NA 1C8M1 1GFF2 5JZGC 4XFAA 5EYYA 1DQ6A 2FMYA 4F8AA 3LWCA 5KHKA 3WG2A 2VH9A 1I1EA 3WUCA 4OI4A 1CAUB 1RUI1 3OGGA 2WINB 4WM8C 2CGPA 1R083 4DFSA 3H50A 4PDWB 3GBWA 4G9SB 2VU9A 4F7ZA 3E5QA 3KT7A 3AM2A 4S2GA 4LBKA 3VBHA 1SQ4A 2G9FA 4GB31 1VBC1 3RNSA 3TRSB 1ZZCA 1OA3A 3MIDA 2VOWA 1C4RA 2YXSA 4WM7A 1W6NA 4Q29A 5K8SA 4AXOA 1WA4A 1AX0A 1QOTA 4YZ5A 3GNEA 1ASJ2 2VQ0A 3AB0A 5J37A 3B3QE 1LESA 5BNQA 4B7KA 4Q0QA 1LOAA 4JGYB 3MIBA 3RG0A 2MNGA 2WLPA 3DL3A 4IETA 3VBRC 1QJU1 3JBG3 1PGL2 5C4WA 3JCIA 3P3NA 1XYPA 1KS4A 4Z1VA 3FWEA 4JQRA 1C8M2 2NMNA 3LGRA 2A3WA 3G6JB 4E9KA 4FBFA 4N53B 3NKTA 1RVF2 4C0HA 2XL9A 3H1MA 3R4DB 4GH4A 2ZKNA 1O3TA 1O4YA 1Q8OA 2R042 1OPOA 1RUC3 1O4TA 1JBCA 1VBA3 4FXKB 5T54A 5KHIA 1RUI2 1NXMA 1LOFC 2IFRA 1N47A 2ZA9A 4PBOA 1PO21 1GLHA 5ABJB 1ZZBA 1N1YA 2DUOA 3MW4A 4A7YA 1WCKA 1FOD2 1N1VA 2BVBA 2VVFA 3RI8A 4GB32 1VBC2 4FQZA 2Y0IA 1FYUA 4C90A 1JYIA 4XFCA 1WW4A 2P3IA 3HR9A 4Y20A 5EZWA 3NO8A 3KD4A 1DQ1A 3NJZA 3CO2A 1NCQB 2R0FA 4AVAA 1WW7A 5CFDC 2RMU1 5I0TA 4XETA 3VBOA 1NYWA 5T50A 4MZUA 4KG8A 4RHV1 4I2OA 1YJLA 4XHXA 2WA4A 4CDWA 2JX9A 3H1YA 3AP6A 4AFBA 1QJU2 4IEPA 1J3RA 3WDXA 4AYUA 5JDBA 1HRV1 1NA1A 2EVXA 3FFZA 4FOVA 2X5IA 1U12A 3B00A 1CN1A 4CP0A 3IT8A 3P3PA 3ZYIB 1AR93 2XBO1 2YDEA 2JXAA 2VQAA 4N7UA 5AFEA 1SLBA 2GC3A 4R9DA 1EPZA 1FV3A 4K40A 4KWJA 3CJXA 2ZAAA 2DVGA 4JTOA 4I3GA 2DV9A 4RA0A 2QNKA 1VRH3 4DNYA 4XJUA 1ENXA 1PO22 2R30A 2LTNA 4JRAA 3ZN5A 3WV6A 1AR63 5FCCA 2IXHA 4HETA 3VBHC 3B5LB 3H3UA 1ZM1A 1QJY1 2CAUA 3KZ4C 5GZGA 5SV8A 1A8MA 2WKKA 4WM7C 1I3HA 2XL7A 3IDCB 4YW1A 1CGPA 1SDWA 1LJ7A 2NLRA 2RMU2 4HSLA 4HN1A 2XVKA 2A75A 3K51A 1BVVA 4RHV2 5FLIA 3CF6E 3ZFGA 4ZU5A 1QJX1 4AI3A 4X6RB 2W52A 3RWNA 3V0BA 2R49A 5FBZA 2RS11 1PK6A 1DZTA 1HRV2 4LHNA 2IXJA 5C4WC 1ALYA 3OCPA 1R081 5JOWA 2JG9A 2BEOA 4META 3HN1A 2WQ4A 3RSJA 2XBO2 4GH4C 1RJ7A 1REFA 1ZBE3 1GICA 3KLSA 2WQZC 2RHPA 1CAXB 5FFOC 1H1AA 1TME3 2XVLA 1JN2P 4LBQA 3SNMA 4H14A 1W6MB 2VNRA 1CJPA 2DFBA 2F4PA 4QPIA 1ZZ6A 4HLTA 3VDDC 3URFA 3AYAA 1QJY2 1O3SA 3RYRA 1RUNA 4IXLA 4IEVA 4YW5A 1AYM1 3AK0A 3WX5A 3AKQA 2X8KA 1HX6A 3E6BA 4W6XA 4EN0A 2QKDA 1GZWA 3AZVA 3J9SA 1ZVFA 3WY6A 2GC2A 4YM2A 3VBOC 5JAXA 1QDOA 4XILA 3WXPA 1QJX2 4XQWA 1HQLA 3N36A 3W58A 1MS1A 4CDWC 4ES9A 3VKOA 1PM7A 1MVQA 3FX3A 4BCUA 5DDJ3 1LU1A 3LA2A 4AE2A 3N7JA 1NA1C 4HK9A 2ZGLA 4JDNA 2X5IC 4N90A 3VV1A 4M0NA 1OLRA 2BWCA 1E57A 2HWD1 3KB5A 4TLFA 3WQ0A 2CWSA 3U0ZA 5D8AA 3S7IA 1O5UA 4N9HA 4COYA 5ACA3 2VULA 2FBEA 4MGIE 4BLIA 2ZHMA 2JE7A 4DRVA 1H2NA 2OIIA 4CP2A 1LRHA 2ZAHA 5JPMB 3DPRB 3UK9A 3JQWA 3D0JA 2RJLA 4DOUA 1WLWA 1EAH1 1LGCA 4HL0A 3TYJA 1UW8A 4JGZB 4LBMA 1VJ2A 2UY8A 3HT1A 1JUIA 1YFYA 4A7ZA 1AYM2 3SITA 3MYXA 1D4M3 1LEMA 5HCBA 5EYXA 4LR4A 4Q4W3 4I30A 4XFFA 3OPZA 4DS0A 1BJQA 2UWAA 2JG8A 3ETQA 1UX6A 4DXZA 3NV1A 1AR91 1DG6A 1H4HA 1LGBA 3ZFGC 3VL8A 1AYN3 5IK5A 1PK6C 3AMHA 1LHUA 1WMEA 1UF2C 4Y26A 5TSWA 4DY5A 1DQ2A 1RUD3 4E4DX 3LZZA 2HWD2 1IZ3A 2JG9C 4ATEA 1XU2A 3IIAA 2A70A 3INAA 4COVA 1Q8VA 4DRRA 4FP2A 2BW8A 2FMDA 5C8CA 2JJ6A 1BVP1 2O0OA 2WNEA 1YRZA 1TE1B 1FX5A 3AZWA 1HLCA 1WD3A 5E88A 4YARA 1LCLA 1AJOA 3A0KA 1Z7S1 1POV3 1JYCA 1SLCA 1CAWB 2PFWA 1EAH2 2IZWA 2WS91 4QPIC 3ZDSA 2HWF1 1PIV1 3KT4A 3ROUA 3V0AA 4E27A 2XH6A 4L2NA 1PZ9A 4BQ1A 5GZEA 2RE9A 3WZ1A 4YZ2A 5DZEA 2R1DA 4GQ7A 4I01A 5JPNB 2OA2A 1DGWX 4MUVA 4OLLA 1OOPA 3EQEA 1TEIA 3ZSJA 1JUHA 1RJ8A 2H6BA 3PNAA 5IK8A 4HVOA 4CZSA 5CNAA 1YNAA 5DUWA 2PA7A 5JR7B 3IDEA 3ZYPA 1BYHA 2I07B 2QDRA 4XF1A 3VBUB 2WNUA 5BNPB 2NQYA 3H8UA 4LEJA 3I59B 4DPNA 2ERFA 4KNCA 4TSVA 2Z2SB 5FMOL 4BMBA 1HDKA 5GLUA 1ULFA 4AI2A 3ZXJA 4FPHA 5D8AC 1GQGA 1TMF2 1UZYA 1HRI1 2JEMA 1OMIA 4Y1ZA 3KQRA 1TNRA 2WIIB 4FTBA 4AEKA 2HWE3 1COV3 1RUE3 1Z7S2 2B5HA 3WLUA 2OVUA 2WS92 3TB0A 1S0JA 3A0NA 1U0AA 2HWF2 1PIV2 4OHXA 4CDUA 1QNWA 3PVEA 2A6XA 1PNGA 2Q4SA 3VZNA 5BV6A 1EP0A 5DDJ1 2NP0A 2UWBA 2VVEA 1LTEA 5JVVA 3U4XA 2DUPA 2HWC2 1H8TA 2NM1A 4GULA 3ECQA 1PVC3 2VVDA 1QOSA 2JG8C 4Q1PA 3UJOA 4O9GA 2UU8A 1W6QB 1HV1A 3D0SA 1T6GC 1IHMA 3W9AA 1WUVA 4GMP3 1AR71 4MX3A 3U10A 2MHFA 1BCXA 4LO8A 2ZX4A 4PLNA 5IT6A 2V5YA 4AQ2A 2BTVC 4R4ZA 3RRDA 3BTAA 4AVVA 1DYKA 3ZFFA 2ZACA 5J96B 4PCRA 1QY4A 2XUMA 4R8HA 1AR81 1PMIA 1HRI2 1BQPA 3RJRA 2BFUS 1DGRA 3MW3A 5C8CC 4Y24A 5J7MA 3WHTA 2ATFA 5JOYA 4AWDA 5EFUA 2O8QA 2ZABA 4Q8KA 2WSVA 5KXCA 3ZFEB 3BODA 4YVWC 4KG0A 4QPGB 4YG3A 1RUF1 2Q0AA 4I0BA 1BEV3 4IV3B 4X8NA 3S6PA 4LNVA 1QJZA 4Q4V3 3M3QA 2A6VA 3NV3A 3M3IA 2Q5TA 1RVF3 2QCSB 2DU0A 2N7GA 5A32A 4LHLA 2VMHA 5L7OB 1QOOA 3AZZA 1EYBA 1OOPC 2BNNA 5CG9A 5GM0A 1QQP1 1V6JA 4Q4Y2 3LA7A 1QKQA 2WT1A 1IS4A 2XWJB 1NE6A 3TN92 5FQ0A 4Q4X2 1VBB3 5J09A 3VN4A 2UWCA 4WZCA 1FOD3 4XYXA 2ZMKA 2I74A 2JKBA 2GDFA 4GXLA 2B42B 2WNUC 3M1HA 3OYWA 3M3CA 4OHWA 3AYDA 4YZ3A 1YO8A 4QMAA 3T1LA 2DFCA 1V6MA 4CRQA 1MS4A 3MEPA 1AR82 3DGTA 4LO7A 5SV5A 1U5IA 3NAPA 5CFCC 3ALQA 2WFPA 3WUDA 4QGMA 3KM5A 4AEJA 5JWPA 2WT2A 3USUA 4Q26A 4BE3A 3PLQA 3PJQA 1C5IA 4KU8A 1FATA 4HVRA 1ENRA 2HYKA 5HBAA 1YLLA 2PHTA 2ZGOA 1RUF2 4FOYA 5GALA 3SH4A 1O7FA 3DF0A 2A6WA 2VOKA 5EWSA 2D6PA 4QXKA 4CDUC 2K9ZA 2D98A 4JVAA 4O9EA 1U5XA 2A6YA 2PLV1 4MSVA 3O14A 5A33B 3WDUA 3OGJA 1NLRA 2E51A 2XJPA 4OHVA 1H8TC 4FOWA 4AHZA 1FPN1 1LEDA 1MR5A 1RHI1 3D82A 1QF3A 2ZGUA 1ZRCA 2AYHA 4FPLA 1DYPA 2QDNA 4I0AA 2XHKA 1QQP2 1Q3EA 3ZMOA 1BBT2 3MGUA 4A7KA 4XBLA 1OPMA 4FO9A 2H6CA 1XXNA 2YROA 3WDWA 5JZGB 4B4RA 4NN0A 1ZRRA 4YZ4A 2E63A 2D3RA 3ZIXA 2Z79A 4AFAA 2TNFA 4LT5A 2QE3A 1SCRA 1U5YA 2WWSA 4RL7A 1YFUA 1RUJ3 4L97A 3ZFFC 5IK4A 4XMAA 1ZNPA 2DVAA 4RFT0 3CJIA 2RM23 3BU7A 4WM8B 3GZTB 1OFSA 3OBRA 5KXBA 2ZCWA 4AEDA 4RGGA 3PMSA 4ZXKA 2GMPA 3GZAA 2VPVA 2D44A 3AZXA 3QH7A 4NHMA 1SBFA 2YGLA 5KC6A 2W68A 3U07A 1DZQA 1NCRA 2ZMNA 3GHNA 2BPA2 1QXRA 5F9TA 4XFIA 4XFHA 3AP7A 4YM0A 2GALA 4TYSA 4YGCA 5GZFA 5T52A 5FOBB 2ZKLA 2PLV2 2HWB3 1OA2A 3MLLA 4LLFA 4QX5A 4FPEA 4NVPA 5C6CA 3ST7A 1FPN2 1RHI2 1K5MA 3LAGA 4LO6B 5FDBA 1X33A 3VBRB 4FOQA 4LTAA 1URXA 4LE4A 2XPJA 5DUUA 4QQLA 2PHFA 4KGQA 4YW4A 5C9AA 1CAVB 4GIQA 1UAIA 2HKXA 1MACA 4JGYA 5GZDA 5JLVA 3Q9OA 3MLJA 4B3NA 5DUVA 3WINE 4ISRA 1F2NA 5JIAA 1WLTA 2B7YA 4CEYA 1A8DA 4N43A 4Y5Z0 4WVVA 1ZZ7A 3N7LA 1W39A 5KHHA 5CVRA 1ONAA 4QT6A 1PO13 4G3YC 3VBSA 4NHKA 4NHLA 2HEWF 1G8WA 2XG3A 1C57A 4LBNA 3NAPC 4FXGB 1YI9A 4V1PA 1Q8PA 3VZLA 3NVCA 3VHPA 2VUJA 4XXAA 5GLTA 2D6MA 1Y9QA 1Z0HA 1ZBA3 4HT1T 1BXHA 4FP3A 4OUSA 3VKMA 3AFKA 4XF3A 1NXD1 4S2DA 4SBVA 4XBQA 2A5ZA 5CFDB 4DZGA 3QLQA 3LSDA 4MXWB 4YM3A 4EN8B 2DU1A 2CYFA 2X29A 2YPJA 4ITCA 1DGRN 4CYDA 2OW4A 5BNNA 1UU4A 2WNVA 3KSCA 1UKRA 1LOCA 2BVVA 1NCQA 3IPVB 3VBFA 1AL23 5F6KA 4RD7A 5F5QA 1CPMA 2E9QA 1HQNA 3HT2A 3LB9A 2YUEA 4RS5A 4GWNA 2RJKA 3C2UA 4WVZA 2VY0A 4JRLA 3ZN6B 1C1LA 1AVBA 1ND3A 1ENSA 3NSTA 1G9BA 1YCIA 2I2SA 1SMVA 3HD8B 4HKOA 1WBLA 2F6BA 2RS53 4MYEA 4XXPA 2OZ6A 3R4UA 1MQTC 5DZFA 1B35A 1A78A 5H9QA 3CJIC 1QDCA 4YW3A 1NQJA 5LEJA 4ZU7A 2BYVE 5JMCA 1GKBA 4K1YA 4AEDC 1EV13 2PHLA 5I0RA 4FCAA 4NWVA 3VBHB 1R1ZA 5E89A 4HPKA 1HKDA 1NCRC 3PVOA 3ZXAC 1CPNA 1R1A3 2V73A 1W6NB 4WM7B 2QQPA 4LBQD 3VHNA 3VKLA 1V9U3 2GNDA 5JCTA 1XYNA 4FVVA 5H9RA 5FPXA 1R093 3VUOA 2Q1MA 1RMU1 4YGDA 3H1WA 1AUYA 1ZREA 4DQAA 5F1RA 4P9GA 4WVMA 1A6CA 4XEZA 2FZ1A 4INDA 1YIFA 1C8NA 2WFF1 1K5MC 1ZYBA 2KXLA 1IPJA 1QXJA 2AENA 3LCPA 4WZFA 1DQ4A 4K7JA 4QQ2A 4UXAA 1AX1A 2WT0A 4HZFA 5GLWA 4RR3A 5AC93 5C4WB 3MIGA 1AX2A 4URTA 4IEUA 4UW5A 3OTFA 5C9AC 1UU6A 4JGYC 1O4ZA 4L11A 3AYCA 4IV1A 4YG6A 1I9RA 3KCCA 4AVCA 3THTA 4GH4B 4CEYC 1GNZA 1W0OA 2BGCA 4N43C 3FC0A 3ME2A 4PJYA 1VBD1 1W6OA 2MEV3 2TEPA 2R063 2XJUA 1RUG1 3H3ZA 1MEC1 1X36A 3VBSC 4K9SA 1PZ8A 2CTVA 4IESA 3MZHA 2KA3A 1HQWA 1MS0A 2RS33 2UYBA 4IEOA 2BUKA 4XMIA 3VDDB 1N1TA 4FPJA 1UN1A 4MGKE 2D6LX 1KXGA 4XW3A 4I02A 3ZIWA 4LBLA 3SH5A 1LHWA 4Y20B 3FBYA 2YV8A 2D6KA 5I0UA 4XHBA 5GJ6A 1OD5A 1RMU2 4M01A 3VBOB 2GAUA 1LKNA 1D2QA 4L9BA 3RI9A 5CU1A 3QBQA 5BNNC 4FAGA 2WNVC 4I3PA 2WFF2 3EO6A 2A3YA 4B7EA 1AXZA 3B02A 1NCQC 3VBFC 1J1TA 2P37A 1IKPA 1ND2A 1NA1B 3N7MA 2R073 2X5IB 5KC5A 3PVBB 4K1ZA 4AHWA 1WGPA 4CDXA 1M06G 4ORFA 4RS5C 4QQOA 3LOIA 4C1WA 1N1SA 5AFBA 3NW4A 3HQXA 5BUVA 5BYNA 3KCYA 3AJZA 1REDA 1ND3C 1VBD2 4X8PA 4B8EA 5HCAA 1ZX5A 1RUG2 1W6PA 2VNOA 1ZZ8A 1ZRDA 1B35C 1QHDA 2ZGPA 2DCTA 5FO9B 4LUKA 3ATGA 2NN8A 4FPFA 4LLOA 3JBG1 4K8FA 2DWRA 4F83A 3DV8A 5DG1A 4Y1YA 1AL21 3ZXDA 1G9CA 3T1MA 1RUH3 3VZOA 2CWMA 4H55A 2YMZA 1OI6A 4XIKA 3RZZA 1RUC1 1VBA1 1VAKA 2ZPXA 1MZ6A 2RS12 3ZFGB 3ZN4A 1R082 3MW2A 4IEYA 4JTNA 3V0BB 1PK6B 2RS51 3PJYA 3KS7A 3AKTA 1QH6A 4QGLA 4RR3C 1REEA 2WZR3 1UU5A 2JG9B 1EV11 1LODA 1LB2A 1APNA 3KMHA 4IV1C 4J6GA 2Z69A 3O12A 3J8F3 1O5LA 2FZ2A 1HXS3 4CEWA 5JSPA 3TWIA 4R9BA 1Q5OA 3PTYA 4QQHA 4LBQB 3QH6A 2H0BA 2QJVA 4Q4Y3 2NMOA 3AFGA 1CVNA 2WJSA 3CEWA 3JBG2 4WBBA 3WG1A 2VMIA 1OA4A 2JICA 4QM9A 1VBE3 3TN93 4MLOA 5LRRA 3ZXEA 2QVSB 2D43A 1H1IA 5JI7A 4BLJA 1YXWA 5A3MA 3OD4A 5F6LB 1AL0G 4B29A 1XE8A 1GZWB 3WHUA 1FMD3 4ZKTB 5BY5A 2EXHA 1DU3D 4P9YA 1WCDJ 1S1AA 1SBEA 3MPPG 1RUC2 1N3OA 2FQPA 1VBA2 4G4FA 3VHRA 1NE4A 1CR7A 4PIXA 1N3PA 4OZXA 1MZEA 3UV9A 1VRH1 3LA3A 4ASLA 2MEV1 3DN7A 3ZYGA 4KWLA 1CONA 2YHJA 3QOPA 4XQ4A 5LK5A 1UPIA 1ND2C 1UZZA 1AR61 1LENA 4GKYA 4OI0A 5LEKA 3AXDA 3MI8A 4N9IA 4CDXC 2RS31 4QM8A 1S55A 5KHGA 3JZVA 3WP4A 2DCYA 4FQ4A 2WSUA 4Z8BA 2BQPA 2NZ9A 4Y22A 4GWMA 3WQ1A 5D8AB 2RR13 4XF9A 2D5HA 4TZDA 1S0FA 5HI0A 2LM3A 1KJRA 1C1FA 1LHVA 2D97A 5J36A 1GZ9A 2OUHA 2Y38A 4Q0VA 4YVSA 1DDLA 1Q43A 4JAAA 4BHPA 3EHKA 4PF5A 1JW6A 1AF9A 4KGGA 3WVJA 2ZS6B 3X29B 1CJDA 4KH9A 3OY8A 1G9FA 4COWA 1LR5A 2VMGA 2ZGSA 1OFNA 3FHIB 1AR92