3EO6A

Crystal structure of protein of unknown function (duf1255) (afe_2634) from acidithiobacillus ferrooxidans ncib8455 at 0.97 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GMAPDQQVPATALGKSSRISLDGRRSERSVILADGSMHSLTLLHPGVYTLSSEVAETIRVLSGMAYYHAEGANDVQELHAGDSMVIPANQSYRLEVMEPLDYLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein of unknown function (DUF1255)
publication title Crystal structure of protein of unknown function (DUF1255) (AFE_2634) from ACIDITHIOBACILLUS FERROOXIDANS NCIB8455 at 0.97 A resolution
rcsb
source organism Acidithiobacillus ferrooxidans atcc 23270
molecule tags Structural genomics, unknown function
total genus 21
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3eo6A00
1CX4A 3EQEA 1SEFA 4Q0UA 4IEWA 4E2GA 2MPFA 3IIAA 5AVPA 4KL1A 3ACLA 3CEWA 3KCCA 3WW4A 1O4TA 1HW5A 1CGPA 3DN7A 1J59A 4AVAA 4XFBA 4ZU5A 3USSA 3CLPA 2HKXA 5HI0A 3CL1A 3EO6A 1I5ZA 3HT2A 4XEZA 3RDIA 4FAGA 2BYVE 3TNQA 4ZU4A 3BPZA 1YFXA 2GZWA 3MYXA 1YFWA 2UY9A 5FQ0B 2I45A 1YLLA 4TLFA 3NKTA 1FXZA 3ELNA 3M70A 4P9GA 1RUNA 2CV6A 2EA7A 1DGWA 1O7FA 4J1XA 4QGLA 4XETA 3ROUA 4AQ6A 4PJYA 4EWAA 5D1IA 2XLGA 2GC1A 3R6SA 4HN1A 3CO2A 1GQHA 1RTVA 3IBMA 3E6BA 3I54A 4BHPA 4FBFA 2D40A 3SMHA 2GAUA 2D5FA 2H0VA 3ZDSA 4XFHA 1ZZ8A 2BNOA 4XFAA 3JZVA 5JCTA 1RC6A 4MGZE 4UBHA 1NYWA 5BXXA 1ZREA 4QM9A 3DV8A 2O8QA 2F4PA 4Q0PA 1VR3A 4R8HA 5KBFA 2B8MA 2ZCWA 1PM7A 1L3JA 2UYAA 1J1LA 3I59B 4R52A 4XF1A 3E97A 4Q0VA 4JV4A 4KWKA 5FLJA 4MH0E 1OMIA 4N9IA 4MX3A 3EHKA 1EPZA 2MNGA 2QDRA 3D82A 4QXKA 2ET1A 3LA3A 4Q0SA 4N9HA 1EY2A 3GBFA 2OYZA 5KHKA 1XE8A 4AVBA 5I0SA 4KU7A 2UYBA 2PQQA 1J3PA 1I6XA 1SQ4A 1OFNA 3DKWA 2XLFA 5LEJA 2GU9A 3C3VA 4D7TA 2O1QA 2PTMA 3H1WA 2FMYA 1PMIA 5JSPA 1ZZ9A 1CAWB 3UKTA 5K8SA 4GULA 4IEVA 3RYRA 5BY5A 4RD7A 1QXRA 4O9EA 5I0TA 4MUVA 1UPIA 4HVRA 1X8EA 1OD5A 2B9UA 3ES1A 5EZWA 3NJZA 1RUOA 1OI6A 4XFCA 1WLTA 5J7MA 4LA3A 4ZU7A 5CU1A 4IEQA 1V70A 2ETEA 3ES4A 1FT9A 4I0BA 3HIFA 4LTAA 3E5UA 2D93A 4AQ2A 1NE4A 3WW3A 2K9ZA 4X6QB 4HBNA 4QGMA 1NXMA 3BB6A 3KMHA 3LAGA 1O3SA 3SCHA 1WA4A 1U12A 3H3UA 2Y0OA 1CAUA 4OLLA 1H1MA 3QOPA 4Z82A 2D5HA 3NSTA 3M3IA 4EROA 2Q30A 4I02A 2K0GA 1EP0A 3LZZA 3FE5A 4I0AA 4HVOA 3WW2A 4I01A 4L11A 4IESA 1VJ2A 3FJSA 1O3RA 3EJKA 4XF3A 1JUHA 5JAXA 1CAXB 4HMZA 4I2OA 1RGSA 4MV2A 3H3ZA 4XFIA 5FDBA 3E5QA 5I0UA 1DZTA 4ONUA 4YARA 1O5LA 3NVCA 4XFFA 4HZFA 3VHRA 4IEUA 4OFGA 1O3QA 1YWKA 3RYKA 2BEOA 4IERA 2BNNA 3RNSA 4JVAA 3SXWA 3DL3A 2ET7A 1ZZ6A 2CAUA 3FFQA 2PAMA 4F7ZA 5F1RA 3IDBB 5KHGA 3HT1A 2GC3A 4HSLA 1ZRRA 1SFNA 5T3NA 4JTOA 3LA2A 1ZX5A 2XKOA 2BGCA 2XHKA 5C6CA 2ZKLA 3LWCA 1ZRFA 4LUKA 3E5XA 4WZCA 4LA2A 4CYDA 1UW8A 1NZCA 5FQ0A 3RPQA 4AVCA 3ST7A 5I0RA 1Q3EA 3OGJA 4J1WA 4KU8A 5C8WA 3H7JA 2IXHA 2PFWA 1CAVB 2EVXA 2MHFA 1O3TA 2UY8A 4EV0A 4O9GA 5FLIA 4LUMA 3N4MA 3MPBA 2Q4SA 3KGZA 4UBGA 2Z69A 2KXLA 3IWZA 3I7DA 4BH9A 1UD1A 5CVRA 2DCTA 5I93A 2OZJA 2IXCA 3GYDA 3QACA 4H7LA 4IEXA 4HLTA 3H9AA 3S7IA 5JSOA 1J58A 2XGXA 4META 5E1RA 5EFUA 5I8TA 3PNAA 1XE7A 2OZ6A 1FI2A 1YUDA 4XFGA 5J48A 5I8SA 2GC0A 4Q29A 1QXJA 3H7YA 4IEPA 1J3RA 3KGLA 1YHFA 3HQXA 4I3PA 3OCPA 5FPZA 1ZVFA 3O14A 1O5UA 1ZNPA 1X7NA 3I59A 4X6RB 2E9QA 3H1MA 3OD0A 1UCXA 2Q1ZB 3MDPA 5JR7B 1J3QA 2GH2A 3BCWA 2BNMA 5KHHA 1EYBA 3KSCA 4BIFA 3CJXA 3NL1A 4L2NA 4PIZA 3ETQA 5BV6A 2XKPA 2PAEA 2PHDA 3FX3A 2GC2A 2XL7A 4AXOA 2VQAA 4IEYA 4XF9A 4A2UA 4B29A 1IPJA 2C0ZA 1X82A 4PIYA 1ZZCA 3PVBB 2IXIA 4EWDA 2ATFA 3UKNA 2WC2A 3H8UA 1CAWA 4YSFA 2CAVA 3FZ3A 3L2HA 4DINB 1YFUA 1LR5A 2EAAA 2IXJA 2PYTA 4MGKE 4YYOA 2QVSB 5CADA 4QMAA 3SHRA 1RL3A 5E16A 3LA7A 4XF0A 1GQGA 5J3UA 4QGNA 4MZUA 2FQPA 1ZRCA 5LEKA 3SCFA 2XLAA 2OA2A 4LLOA 4YNIA 5KHIA 3E6DA 3CF6E 2QJVA 1X8MA 5LRSA 1TQ5A 1DZRA 4Q0QA 4FAHA 4Z07A 4MGIE 2PA7A 3NW4A 1H1IA 1VP6A 4HSJA 3WW1A 3FWEA 4ORFA 2IC1A 1YFYA 1XRUA 2IXLA 3UKVA 4E2QA 5I8YA 3BU7A 3EBRA 4F8AA 1UIKA 2OPKA 1CAXA 1NE6A 2Q0AA 4NVPA 1G6NA 3OF1A 4KWLA 2QNKA 3LOIA 1QY4A 1DGRA 4MGYE 1Q5OA 3U10A 4I09A 3D0JA 2HJIA 4K8FA 3MZHA 3PLQA 4HVQA 3E6CC 4QM8A 1QWRA 4XF4A 2PHLA 4EWEA 1ZZ7A 4D7SA 5LRRA 1Y9QA 3G7DA 2IXKA 3SCGA 3B02A 3IDCB 3S0MA 4YRDA 2VPVA 4HN0A 4UXAA 1ZZBA 3TNPB 2H6BA 4BYYA 1WGPA 2WFPA 5I91A 1CAVA 2PAKA 3FHIB 4FT8A 5FCCA 1IPKA 1UIJA 2B5HA 2CGPA 2H6CA 2Z2SB 4IETA 5BPXA 5BUVA 2V09A 3U0ZA 1ZRDA 3H1YA 4LEJA 3S7EA 5FPXA 3D0SA 1CAUB 3BALA 4E2SA 4IEOA 1LB2A 3H50A 4JTNA 4WBBA 4IEZA 3U11A 4KWJA 3RYPA 3RZZA 1LRHA 2P17A 5KHJA 1LKNA 4PIXA 4WVZA 2VECA 3OTFA 2N7GA 2QCSB 4LULA 1Q43A 4QX5A 1Y3TA 5FLHA 5JSRA 2XL9A
chains in the Genus database with same CATH superfamily
1VBA2 1CX4A 2VCAA 4YGDA 5EWSA 2BW8A 4Q0UA 3HQUA 4B1MA 5A32A 2DFBA 2VCCA 5LBFA 1GUIA 2W1UA 5A3LA 1PO21 3AYDA 3MUY1 2A1XA 4AAXA 3VKLA 4DXZA 2WO3A 4E27A 4AI8A 1FPN3 1O4TA 4YZ3A 2WFF2 2HWB2 3H8RA 5FY7A 1HJGA 1LGBA 4KWUA 1AVBA 1GMMA 2W0XA 3BI3A 1YI7A 4QPGB 3RZJA 1CN1A 2ENRA 2XONA 5FYYA 1I5ZA 1QJU3 5C71A 4XEZA 4YM3A 1US3A 3D8CA 1GZTA 3KM5A 1WBLA 2VUAA 4D94A 2R041 5FPUA 3EMRA 2ZHLA 3AK0A 1W9YA 5JPNB 5LY2A 2VQUA 1H4GA 4XVHA 3CBNA 4HT1T 4ZU4A 3VD3A 3ZR5A 1AR71 5BNOC 4PQ9A 1MZFA 1ND2C 2VUDA 1VE0A 2JECA 3MYXA 4W6WA 3FLPA 4QHBA 5LCWL 1MQTB 1AL23 2JB8A 2JE8A 3ECQA 4RHV1 3ZYPA 5JIUA 5DPNA 5IVCA 2Y6JA 1RUNA 1HRI2 1MEC1 2CV6A 3SQOA 1A34A 2FDFA 4PQQA 1DGWA 3JBG3 4UF0A 3HD8B 2PHTA 4A7ZA 4AQ6A 1PGL1 2TEPA 3WHTA 1B35C 4EWAA 2NYYA 2A71A 3IPVB 2XLGA 4EN6B 1PK6B 1JW6A 3ZSLA 2VMHA 3R05A 4PT6A 1GQHA 4CZSA 3UESA 1WW7A 1REEA 5IJRA 5IVEA 3H8XA 4HANA 4XBQA 4DXTA 3TOJA 1HXS2 5GM0A 4HXCA 3WDUA 1ULGA 5FY0A 2BP6A 2D5FA 2H0VA 3ZDSA 1BLZA 1SBDA 2BNOA 5DDJ1 2FCUA 1DYOA 3RVHA 3JQXA 2QQOA 4NUBA 4CYDA 2WJSA 4UBHA 5BXXA 1ZREA 2QQVA 5H9QA 1HB4A 1QJX3 1GP6A 3DV8A 5T54A 1RUG2 5A6XA 3MW4A 5C8CB 4UWDA 2HWE3 1B35A 3Q8BA 2Y6KA 2PELA 2B8MA 2ZCWA 5DUVA 3UT0A 5A6ZA 1L3JA 4OI1A 1JYXA 1PIV3 2GNMA 4AGGA 4YVWC 4CDUC 5A3PA 1JH5A 5FYBA 2J1SA 4IE4A 4CDWC 1X36A 4XF1A 2FMDA 3N9MA 2C9AA 2FDJA 4BU2A 4AHXA 4KWKA 1X9PA 4MGQA 2YG0A 1FV3A 1S1AA 1S2BA 1S0EA 4RQPC 2A6VA 4MH0E 4MX3A 1W0NA 1LULA 2CGOA 1ZBE2 1IHMA 3EHKA 1D4M1 1IG0A 2LW8A 4Q4Y1 2ARXA 1G9CA 3U0ZA 4EQVA 1W6MA 5FZIA 2X05A 1CZSA 3C7GA 4W4ZA 4BMEA 2Q5TA 1EAH3 3I97A 4PHZA 2P5BA 2AGSA 1GR3A 4N9HA 1POV3 1RUC1 1W9FA 5LA9A 5I0SA 1ENSA 2UYBA 2ZGNA 3ZFFB 3BOWA 1I6XA 4DRRA 3W5MA 5CFDC 1FOD3 1MS8A 2PXJA 2RS12 1BBT2 2XLFA 5LEJA 2GU9A 1D4VB 1W6PA 2A5ZA 3ZXLA 3MLLA 2VZ3A 2XBO3 1S0DA 3RI8A 2XWJB 4CDWA 2JD4A 5FZ1A 5EXOA 3KF3A 1ALYA 2YBPA 5FMOS 3RWNA 3CKHA 2G9GA 4A4AA 2CNAA 5FZ6A 2NZ9A 4RR3B 1KGYA 1BEV1 1JU3A 1W6OB 2FBEA 3OPWA 4LBQA 1UPIA 1UL9A 3B3QE 3AMHA 1W28A 1J83A 1G8WA 1C8NA 2B9UA 3ES1A 4AEMA 2MEV2 3JCIA 4OMCA 3S57A 3ME2A 4LIUA 5L9BA 2WQ8A 2VW0A 5FYCA 4AF9A 5FREA 4E4DX 3K2OA 3UYJA 2DVBA 2K46A 5IFPA 3WOGA 4HOOA 3LDKA 4XHBA 1FT9A 2YDEA 4AQ2A 3POGA 4AHYA 4Q26A 2WYFA 4CEWB 3WW3A 1H8TA 5FZFA 3POJA 1SLAA 3M8LA 4XE9A 4LPLA 1SHWB 2D6MA 5BNNB 1RMU2 1WA4A 3CJIC 4I0WB 4AQSA 2YU1A 1NT0A 2Y0OA 4Q4X3 1UMIA 1CAUA 2YPJA 2QE3A 5IWFA 2WR9A 4EJRA 1STMA 4Z82A 1CPNA 1LOGA 2NM1A 3HVDA 4QPGC 2YUEA 4LORA 5T5OA 4I02A 1EP0A 4NAMA 3LZZA 1OT5A 1PGSA 3USUA 3FE5A 5FMCA 1S2KA 5FYVA 1SFPA 1UZWA 1G9FA 4ZXEA 2YPDA 4AYUA 4XF3A 5JAXA 1DF0A 3TYJA 4HMZA 2ZGRA 5LBBA 3VDDC 1W05A 2C9KA 1RHI1 4MV2A 5HCBA 4YW4A 5FDBA 5LA0A 2IWGB 1GZWB 3EYPA 4IV1B 4ONUA 5I0UA 4CU6A 1O5LA 1REFA 5JVVA 4HK8A 1MQTC 4HZFA 4COUA 4QKBA 4FXKB 4OFGA 5FFOC 2WNVB 2BEOA 4DUVA 3TB0A 4DUWA 3RNSA 3NV1A 1H2LA 1OLMA 4AL9A 5F3CA 2W1QA 5IT6A 4ATFA 4YW2A 3ZFGC 2RR13 4QPGA 3O1UA 1OSGA 3ZPYA 1VBB1 3GZTB 1FNZA 3V0AB 2VZQA 4HPKB 1TZOA 2PAMA 1PK6C 2CDOA 3IDAA 3NAPB 3DEMA 2GNDA 3ZYFA 3NV4A 2CTVA 2ZMKA 4GA9A 4LKEA 2AREA 1UXZA 1CX1A 4JTOA 2R0HA 3LA2A 2XKOA 2XVKA 1DLLA 2BGCA 4ZPIA 3I8TA 2EIEA 2ZKLA 3FHAA 4Y5SA 5J37A 4BK4A 2BFUS 2C1FA 1NZCA 1RJ7A 1MQTA 3H42B 1DQ0A 4LLFA 4O7XA 2XVGA 4YZ4A 1OQEA 4UYBA 3O1PA 5I0RA 1XU2A 1ZBA2 2ERFA 1DQ1A 1LNSA 5LA2A 1LEDA 2IXHA 1CAVB 5CG9A 2EVXA 5C8CC 5BNPB 1O3TA 5FLIA 5FPVA 3A22A 1SACA 3MPBA 1PK6A 3I3MA 4UBGA 2WS91 4ZHNA 2IZWA 2Z69A 4ITCA 2YB7A 1C3HA 2KXLA 4Q4V2 1UD1A 1VBE2 1QGLA 2BVVA 2CYFA 1K5MB 2DCTA 2VTFA 3I3BA 2OZJA 3R4SA 4JAAA 4QKNA 5JI9A 3S6PA 3KWVA 3QACA 2YY1A 4NWVA 2RS32 3AYEA 3LF7A 3WNKA 1J58A 5JSOA 3PDQA 5FR3A 4HONA 5I8TA 2PMWB 4UW5A 2OZ6A 1VBD1 1YUDA 2GMEA 2RM21 5J48A 2R072 1Y9GA 1RUG3 2VO5A 3ZFFC 1J3RA 4JQRA 3VDCA 4ASLA 5IK4A 1UYXA 1V6MA 2KA3A 3HQXA 4I3PA 3KQ4B 3OCPA 1K3IA 4LO6B 5C8CA 3POEA 2VVEA 5FPZA 1GICA 2JD9A 3M3OA 3KD4A 5CKNA 2OVUA 1XQNA 4OCTA 1QQP3 3TBDA 3KV4A 2D7FA 4IXLA 1P8JA 4Z92B 4UOJA 1F15A 2Q1ZB 5FZ7A 4CCDA 4Z2AA 2AUYA 1OOPA 4RR3C 2W91A 1ASJ1 3ZN6B 2VZOA 2J22A 2OIIA 2GH2A 5EJ3A 5FP8A 1LEMA 5KHHA 1XYNA 1Y43B 5AC91 2NMNA 4PIZA 3LCPA 3ETQA 4MXWB 3WUDA 2W68A 2XKPA 1UOFA 2VOKA 3POWA 4L9BA 1WMXA 2PHDA 5C7GA 1D2QA 3FX3A 2NP0A 5CKMA 2VOXA 3OG2A 1DG6A 4IEYA 3ZFFA 4BK5A 5E88A 4Y33A 1EPWA 5ANQA 2VOTA 4CCCA 2BOJA 3WD5A 3ZOIA 5APAA 4H55A 4GMP1 4KGQA 4TSVA 4ARXA 1TME2 1MS9A 4CEWC 2A70A 4CXXA 1OVSA 3FUQA 5FZDA 3EB7A 5HXMA 2IXIA 5FMDA 5FMBA 3HPNA 5E89A 5J1XA 2BZDA 3J7HA 3AKQA 3LD8A 1QH7A 3PUQA 1AR63 4HK9A 1HLCA 2OX0A 4QPYA 3C8XA 4URAA 5BNNC 4HETA 1AR93 1BVP1 4RR3A 3AKRA 1OLRA 1W6OA 2EAAA 3AL6A 2QQUA 1COV1 3I2JA 1HDKA 2WDBA 4ISRA 4MHRA 2PYTA 4MGKE 1JZ2A 4P9WA 5CADA 4NR1A 1TVGA 3N7LA 4DNYA 5A3WA 3ZMNA 5FYMA 1GQGA 1RUD3 5GZDA 5A7OA 5LB6A 5DAVA 1IG3A 4QGNA 1ZA4A 1VIWB 3O0VA 2FQPA 4CXYA 5G04L 3JXSA 4AEDA 3SCFA 1LHNA 2XLAA 4HKOA 4CXWA 2OA2A 4LLOA 1K42A 4CCLA 1WMDA 4CEWA 3CF6E 3ZXAC 2QQKA 5BYNA 3RZKA 2J42A 4NHXA 5DQ0A 1D0GA 3OOXA 1GOFA 4EN7B 2W46A 1KXGA 2HBTA 3ZSEA 4FAHA 5A3TA 5BNNA 4N53C 5JUVA 2ZHMA 2R062 4Z07A 1IZ3A 5FIXA 5IAVA 1S0GA 2EIGA 2WNVC 4CPBD 4FXGB 3T2OA 2RDQA 4KBZA 1KJRA 2AEZA 4RN5A 2W5FA 1KJLA 3MHZA 4ORFA 3VBRB 1YFYA 3AZVA 5FP4A 1GNHA 4G4FA 5CKQA 4LT5A 3O0WA 3DF0A 4E2QA 3Q8EA 1DQ6A 1FPN1 4P00B 5T5JA 1DYPA 1MZ6A 3ZN5A 3SC7X 3C2UA 2VNVA 2C4XA 3VKFC 4KBBA 5F3EA 4FPOB 1KS5A 2WZEA 4P14A 1GZWA 4IV1A 1QJU1 2NPIA 1OPMA 3K48A 3MGUA 2BOIA 3OF1A 4OHYA 4OVEA 3V64A 3N9OA 3J7NA 3AFGA 2K2SA 1DGRA 1DZQA 4MGYE 3SLIA 2F6BA 1OLQA 1RINA 1VBC3 4PF5A 2HWD3 3U10A 2WNVA 4W6YA 5KXBA 2TNFA 5DG1A 2YC4A 2WNUB 3MIBA 1AJOA 2BJSA 2HLEA 2QQIA 2E26A 2W94A 4YGEA 5BNPC 3UGFA 5FUIA 2ADDA 4Z1VA 3MBWA 3I2IA 3V0AA 4HPKA 1AYM3 1CD3G 4FFIA 1TEIA 3NAPA 4QXBA 2ZEYA 4CE8A 3ACGA 1DGLA 2DUPA 4WVMB 1QEXA 3UGGA 5M0TA 5FYSA 4GMP0 3V56A 2EALA 4E8DA 1K5MC 3JBG1 1SBFA 4LOSA 3AP9A 2IXKA 1Q8PA 2W47A 1N1YA 4L8QA 1GANA 4HKWA 2VUJA 2VPVA 2I07B 2ZHNA 1W8OA 4P9JA 3ZXKA 4W50A 5GZFA 4PLOA 3TNPB 1GFF2 3GCWA 5KWRA 1ZBA3 2E7AA 3W5NA 4M3CF 1RUI3 1A6CA 2JX9A 1GNZA 3D4KA 3ZYHA 3UJQA 5I91A 2X29A 3GBGA 1CAVA 2B42B 2Y64A 5L73A 3MIDA 4A3XA 4ASMB 5BNPA 5F37A 5L9VA 3LOBA 3T4HB 1IPKA 1UIJA 4XABA 4LXLA 2I74A 2YU2A 3VB9A 3OYWB 1ULDA 2AACA 4G3YC 3I2HA 1AR83 3F2ZA 1VBE3 2WNOA 1HJFA 2JDYA 3N7MA 3LEMA 1QJX1 3B9IA 5JXIA 5DG2A 1E5IA 1WW6A 1F5JA 1EV13 1SMVA 1KITA 2P1BA 4ES9A 2HWE1 4DQAA 4EE2A 1JYTA 2FDGA 2PLV2 3U1XA 2OT7A 4AFDA 3JD72 1BXHA 1PIV1 4QDQA 4LBKA 4QKDA 4WBBA 3DPRA 2R32A 2XB6C 1S2EA 3TAYA 2PQSA 4CVUA 2JDKA 4NE9A 2P17A 3Q8CA 4H14A 4L92A 1NY71 4PIXA 4AZZA 3AB0A 4LIVA 1J1TA 2ZGOA 2VECA 3OTFA 2N7GA 2D44A 2V73A 2Q8OA 1Y3TA 4JX0A 3PUIA 4S2HA 4YZ5A 5FYUA 4XW3A 3FLRA 4FTBA 1JOPA 3TEYA 2VVDA 5JI7A 1Q8VA 4BQXA 4AGRA 3M4FA 4IEWA 4OI4A 1W3XA 5HPOA 4OI0A 1POV1 2NLRA 2LS6A 4XACA 5ACA2 2WZR3 2JDAA 2GP3A 5AVPA 1FOD1 4XUPA 3ZN6A 1DBNA 1LOFA 4CUCA 2JEMA 5L19A 1HW5A 1V9U1 4YG3A 2XJPA 4AFBA 1ULEA 3T3YA 3DN7A 2Q1MA 4AVAA 4IUGA 4RFRB 1VALA 1LODA 4J25A 4MXWA 5C70A 3HOBA 2XBO1 2VBDA 2ZOEB 4ZU5A 4V2VA 2R49A 2UWAA 3M2MA 3OUJA 1CPMA 4EN9B 3HT2A 1B09A 1SG3A 1OVPA 5DABA 2ZX3A 3AVSA 5FRAA 2ILMA 1HRV2 3VD9A 4FTEA 4FAGA 3R4DB 5J36A 4PBPA 1WUVA 1DHKB 3UV9A 1AL0G 2D97A 3DYMA 1VRH3 2WQZC 4QQ2A 5A3OA 1JUIA 2UY9A 5FQ0B 3DECA 4COVA 1V00A 4K1YA 3FN9A 4Q4W2 3WHUA 2BQPA 3IAQA 4FCAA 3OUIA 3M70A 4XURA 4Q1RA 1UOGA 4LITA 3OPZA 2YMZA 4AR2A 4GJYA 1I9RA 1O7FA 4J1XA 4AVSA 4PBOA 3O1MA 4D8MA 5FY8A 4PJYA 5LBEA 5D1IA 3VBRC 4Y22B 2BTVC 2OUJA 4BXSV 2BVBA 1RJ8A 2ZGUA 3URFA 4GXLA 1LECA 1RTVA 2DDUA 2RS52 4YPJA 5IVBA 4Q4X1 5IVYA 3BUCA 1PGW1 4P5YA 5HXVA 3HMYA 1R082 2EF6A 4A3ZA 2ARBA 2C26A 2XR4A 4BHPA 3PHMA 4YVSC 4XIKA 5T50A 2GAUA 3U75A 4NRPA 5T52A 2ZZQA 5IVJA 2SBAA 5JCTA 5DAPA 5ISLA 2IVJA 4TN7A 4JC1A 3IMMA 1IS6A 2DUOA 2EIBA 3OEAA 4I30A 3Q8AA 4ASKA 3P3NA 1E5RA 4JZRA 3BIWE 1CIWA 1HV1A 4P9XA 5FKBA 1LGCA 2XQRA 1Y4WA 5KBFA 1O8PA 3VBRA 5CFCB 2J1VA 1PM7A 1JI6A 5DZGA 4B8EA 1NAEA 3GF6A 5EQUA 2B46X 2HWF2 4R52A 3K3OA 3N36A 2A6WA 4XHXA 3T30A 4UFIA 4Y5TA 4JDMA 5HBAA 1ENXA 1TG7A 1OMIA 4N9IA 3PU8A 2RR11 3M3QA 1EPZA 1WMFA 2RHPA 4OMDA 5GLUA 2J7MA 2PHRA 5CZKA 4A44A 3O7OA 2D6NA 1R092 2V5DA 4QXKA 4GWIA 5ERLA 3LA3A 3KF5A 1JS9A 1YNAA 1EY2A 1IGOA 2XG3A 2OYZA 1OKQA 2GMMA 2HEWF 5FWEA 1WLWA 2ARCA 2PQQA 1J3PA 1SQ4A 3ILNA 2WNUA 3PJQA 4LMFA 1OXCA 4MVTA 5GKAC 2TBVA 3WDVA 1GOHA 1W2NA 4V1PA 4ATEA 2A6XA 1CESA 1RVF3 5F6KA 1AYN2 3D6EA 2ORZA 2O1QA 3KHBA 2DVDA 2P3IA 1PMIA 1FMD2 4OI2A 5FBJA 5IK7A 5JDBA 2DVFA 4NROA 4IW3A 4WVVA 4RFT0 1JYNA 3LFIA 4HL0A 5FXVA 4RD7A 4O9EA 1QNYA 1S0CA 5I0TA 3U78A 4QHZA 4HVRA 4DB5A 1JHNA 1RUH3 1OF3A 2JB4A 1GWLA 3VBUB 1XNCA 4FI9A 5JXHA 1TMF2 3C7FA 3TRSB 3WF2A 1WLTA 1JBCA 3NNJA 4LA3A 3ZVXA 5LZ6A 5DAQA 4M01A 4QXHA 4ZU7A 1PNFA 1X33A 2AZ5A 4QQHA 5EP9A 1YQ8A 1QMJA 5FKCA 1V70A 3ES4A 4GB32 3HIFA 2W39A 3E5UA 2D93A 1H6XA 3FLTA 5FZ9A 4DS0A 2HYXA 2LM3A 1W8HA 3BKZA 4KNCA 3OYWA 1NE4A 3SITA 4C0HA 3BTAA 2K9ZA 4LO4B 4XJAA 1GP5A 4CP1A 1DGRN 4GWNA 3WZ1A 1RUG1 2LUWA 2Z4FA 1A8DA 3BB6A 4UFHA 2RMU3 1RUJ2 1W39A 3K77A 4QU1A 2Y60A 5F5CA 1U12A 3H3UA 1XNKA 3AZZA 4BLJA 2UWBA 3PMSA 4BISA 1QQP1 1RUE2 1L7QA 1V6LA 3MIFA 1BJQA 4FPJA 3MW2A 3M3IA 2A6ZA 1W0OA 2P4EA 5B4XA 2R7EB 4I01A 4L11A 4QX1A 3FJSA 1GZCA 3HNYM 5FY4A 3THDA 3RMYA 5A3MA 1CAXB 4I2OA 1A3KA 1GYKA 4FO9A 4Y5Z0 2ZAHA 1LCLA 3LB9A 3H3ZA 4ZY9A 3E5QA 1DZTA 1GV9A 1VLNA 2E7TA 2YC0A 3I3EA 4LOTA 4NPMA 4AHWA 4Z8BA 1G86A 5K0UB 2WO2A 2JDHA 3S30A 3NVCA 3POIA 1JODA 4CCEA 2Q1FA 4IEUA 3ETPA 1O4YA 4C0BA 3O5SA 1YWKA 2O0OA 4GWMA 2EICA 1HQWA 3JUUA 2DVAA 5FK8A 1QKQA 1RUF2 2Y6FA 3J8F3 1LHWA 2CAUA 3I2OA 4FP2A 1HRV3 3MF6A 4R9AA 1AR61 3HT1A 1A78A 1C8M3 4NIHA 1AR91 2GC3A 3PUAA 1E5HA 3VDAA 2VMDA 4NMIA 1ZRRA 4LBQD 1S55A 2IFWA 1W04A 2WN3A 3ZIXA 2DCZA 4H3WA 3AL5A 3VKNA 1M06G 1IQAA 2XHKA 1YIFA 3RQ0A 3ZSJA 1RUD1 3LWCA 4PI2A 3ENRA 3OUHA 3FMGA 2X10A 4Q27A 4B4QA 4CCJA 2Z79A 3KLSA 5FZ4A 5FQ0A 3ZFEB 3A4UA 2CWMA 3RFRA 1WWYA 5IUQA 2EIDA 5IVVA 3CHXA 4BCUA 1OFSA 3OBRA 1UNBA 2ZACA 4E9KA 3H7JA 2I2SA 2PFWA 3M7AA 3ZYBA 5C3PA 1QHDA 4CTEA 2V4AA 1MS1A 2VL4A 4CP2A 1Z78A 1N1VA 2P3YA 4LUMA 4Y22A 4FPGA 1V6JA 3WP6A 3N4MA 3N35A 1OOPB 1XNDA 1PO22 4YM1A 1R64A 4OQ9A 3AKTA 5DMYA 3AZXA 3IWZA 2HYKA 1GZ9A 4FFGA 4BH9A 4CU8A 3RSJA 1KS4A 3MI8A 2VW2A 4LJHA 4BQ1A 3RG0A 4IEXA 2AENA 3KZ4C 2HWC3 2VR4A 5EHDA 4WM7B 5TSWA 4AOCA 5E1RA 1NA1B 3PNAA 5FUPA 3ACIA 1FI2A 2PN5A 1LENA 2R042 1V9U3 3SH3A 3HEIA 1QXJA 1AXYA 1UU5A 1FAYA 5JOZA 1YHFA 1H8TC 2E53A 3J9SA 4M4PA 5JWPA 3B5LB 1ZVFA 5DUUA 3O14A 4JHZA 1AR72 4QX0A 2ZZJA 5CFCA 2JXAA 1HB2A 2YGLA 4LKSA 3W9AA 1XJAA 3NRUA 1ZRDA 2OXBA 3WV6A 1Y7BA 1PO13 5LK7B 3H1MA 4GKYA 1VBC1 4RHV2 2HWD1 3OD0A 4WV8A 3IKWA 1UCXA 4B4PA 4MGSA 1DQ4A 1ND3B 3LE0A 5EIYB 4A6SA 1MEC2 3KCXA 1J3QA 3MLJA 1XSQA 2GP5A 1QJZA 2O14A 3KSCA 1PGL2 4OZXA 1SLBA 4XUOA 1AYM1 1CQ9A 4W65A 3O12A 3VBUC 5BV6A 5C3QA 5CAZA 2GNTA 4AEDB 2W9XA 2R16A 2DVGA 5L36A 3OGGA 3TN93 3KVBA 1JZ8A 3HQRA 3B00A 3ZYJB 1Z0HA 4AWDA 1SLCA 1LOCA 1LU2A 4BXFA 4BLIA 2C0ZA 1O6UA 5A3UA 4B1LA 5FP3A 4PIYA 5KR7A 4MGTA 1ZZCA 2A75A 5FZ8A 3N7KA 3UKNA 3WCSA 1SCSA 1BVVA 1ZBA1 4INDA 1RUI1 4CCOA 5FXZA 4M3CB 2H0BA 1JTZX 2IFRA 4AG4A 3T08A 1LR5A 2CY6A 1POQA 4QX7A 4KH9A 5FZAA 3H3LA 1US2A 1XXNA 2WIIB 4XBNA 5AVAA 3B9CA 4YYOA 2JKXA 4YFWA 2QQWA 4A45A 5C4WB 1TMF3 3IMNA 3VBUA 1XB9A 2BFUL 1F2NA 4Q8KA 2JIJA 1AR81 4ZS3A 3POFA 1VBE1 1VBA3 1RL3A 3GJBA 3LA7A 2E32A 1NLRA 3GDBA 3PJYA 4BQ5A 4E8CA 5EYXA 3S5AA 4KMQA 5C3OA 2Q8CA 5J3UA 1XYOA 4FOYA 4MZUA 1UU4A 5A33B 1EV11 4UFJA 3HNBM 3RGBA 1QU0A 3VHOA 5JOXA 3T2QA 2XPJA 1CONA 5LEKA 1ODNA 2VM9A 4CSWA 1E5SA 4Q4Y2 3T1MA 3VBOB 1D4M2 1GSLA 5KHIA 1YYNA 2WFF3 4NIIA 1X8MA 2HWB3 1TQ5A 1XU1A 5L9RA 3ZXFA 5K0UC 4BZ4A 4FVVA 3THCA 3LFMA 2KM2A 1RUC2 4Q0QA 4YG6A 2EXHA 4MGIE 2PA7A 4K20A 2WKKA 4YW5A 5LWBA 4QAWA 3ZM8A 3HJRA 4HSJA 2DBIA 1UAIA 2YYOA 2JDUA 4XBLA 3WW1A 2G1MA 4MYEA 1SDDB 4C1XA 4NRMA 3WR0A 3FWEA 1QJY2 2ZA9A 5T55A 4CU9A 4FQ4A 2WZR1 1XOYA 1W99A 2HBUA 4M00A 4FFFA 2W95A 2W52A 2BWAA 3UKVA 4LBJA 1BMV1 1HIXA 1LJ7A 3FUOA 3OD4A 3EBRA 1BEV2 3H8OA 1XC6A 2OPKA 5A6YA 4CEYB 1CAXA 2ZEXA 2ZX1A 2Q0AA 4FPLA 5C3RA 3U14A 1HRI3 1W6NA 2XJUA 4BE3A 3ACHA 5K0UA 1F5FA 2BUKA 4KWLA 4BDVB 1SFYA 1UYYA 4OHVA 3LOIA 3ZFEC 3UGHA 2ID4A 3NJXA 1SPPB 3HAGA 3VBHB 1H30A 5DUXA 3K3NA 2HJIA 3U4SA 3WG4A 5K4LA 4BQ2A 1WA6X 2XOMA 3AMPA 2CWSA 1VRH1 2D6PA 3E6CC 5KXEA 3QBQA 4JGZB 3T2PA 1HXS3 1ODMA 3KT7A 1IQDC 1OOPC 4EWEA 1W2OA 2CHHA 1SCRA 1WD4A 2JENA 5LRRA 5FV3A 1NXD1 4LKFA 2J1TA 4CRQA 4C90A 2AH2A 2SLIA 1KQRA 3DPRB 3G7DA 3SCGA 2VQ0A 3IDCB 2VZPA 1OKOA 3WXPA 4FTSA 1O8SA 1Q56A 3ILFA 3ZFEA 1OUXA 2VTXA 1WGPA 2PHXA 2WFPA 5C5UA 1WD3A 2ZS6B 1NX9A 2WL1A 2HEVF 3LDBA 4CP0A 3DCQA 1LU1A 4KG8A 1NCRB 1W2UA 2GDFA 3DXTA 1C1LA 2PAKA 3FC0A 4QB6A 3SISA 1RHI2 2CGPA 4NHKA 1YXWA 1ZBE3 3C7HA 3JB8A 2VBPA 2XH6A 3VZLA 4E4ZA 5DXDA 1S0FA 3WQBA 3AC0A 3B7MA 4MXVA 5C9AB 4IETA 3OB8A 1C28A 1TNRA 4DEQA 3VKOA 1D7PM 1AXZA 2B7YA 1OA2A 3H1YA 4LEJA 1ULFA 3NNFA 4JCKA 1OUSA 3E1F1 4SBVA 3S7EA 5FJHA 4CDXB 3VHPA 4IEOA 4WM7A 3T0AA 3THTA 3W21A 2RS13 1BBT3 1NA1A 1LHUA 5ABJA 4AFAA 3U11A 4LBOA 4GWJA 4KWJA 1VRBA 1YJLA 4AEDC 3OPTA 3RZZA 1LRHA 2JJ6A 3RJRA 5FO9B 1WLDA 5FXXA 4E4HA 4LULA 4QX5A 4D6SA 3I49A 3MF9A 3ON7A 4J6GA 3BN6A 2IXLA 2VMGA 2XL9A 3MV01 4RGGA 3RRDA 4NIGA 3K46A 3FFZA 2QQJA 3EQEA 3VBSB 2FD8A 2DF7A 1SEFA 2X8KA 3ZSKA 1Z7S2 5F2WA 4AI3A 1MZ5A 1O59A 1C5IA 1H9WA 3K4ZA 1YI9A 2ES3A 2VJXA 1UY2A 2MEV3 4Q5OA 5FPBA 1R1A2 2VH9A 2MPFA 3I3QA 3ZMOA 4TTGA 1OF4A 1ND3A 4OQ8A 4KL1A 3ACLA 3CEWA 3KCCA 3WW4A 1WCKA 4FOQA 1RVF1 1CGPA 1ULOA 1N3OA 3KCYA 5D8AB 1J59A 3WNXA 4XFBA 4GD4A 1JZ4A 2HKXA 5HI0A 1OH3A 3CL1A 3M3CA 1W9TA 1CWPA 3RDIA 4AFCA 1N47A 3ZKYA 2YXSA 2BYVE 4IV1C 3TNQA 3L2YA 4Q8LA 1RMU3 3VBOC 1RUH1 1QF3A 4YGCA 1GU3A 1HV0A 2E7QA 2LROA 3BPZA 2QDNA 1UX7A 1U5YA 2RM22 4P9YA 3AX4A 1W8UA 3A7QA 1W8ZA 3IB3A 3H0OA 1ONAA 4M3CA 5FZOB 1YLLA 3MEPA 4XJ9A 1FXZA 2JG8B 3ELNA 3VL8A 4P9GA 4NN0A 3KT1A 2FDHA 3T0DA 5GLVA 2EA7A 5C4WA 1GWKA 3NAPC 4GJZA 4MADA 4XJ8A 3G6JB 4QGLA 3WF1A 2ZX2A 3GM8A 1H0BA 3K4AA 4K3UA 5FK7A 5FYTA 4Y4YA 4DXSA 1G9DA 2ZGPA 2RMU1 3N9QA 2YC2A 3DUIA 3R6SA 5A33A 4HN1A 3GNEA 3IBMA 1ASJ2 1MVQA 2B9VA 2BBVA 5JZGB 3VBOA 1UY0A 4ZKTB 3I54A 3IIIA 3K51A 1NUKA 1UYPA 3D5OA 3R0RA 5AC92 2DTWA 3OBAA 4E4SA 2D40A 4R4XA 1CJPA 3O1VA 2D3PA 4FPKA 4NHMA 3SMHA 4XFHA 2HEYF 1ZZ8A 4AI0A 2X09A 4OYUA 5C5TA 4S2GA 4XFAA 3ZSMA 3JZVA 3VBHC 1LOAA 1NLSA 1RC6A 1YQCA 4YZ2A 1ENRA 2DCKA 3RJ2X 1NYWA 3MFCA 1OPOA 1WZXA 2VUCA 4XTMA 1GNYA 5FY9A 5KC6A 3CZJA 4QM9A 3WF0A 2P6CA 3WG1A 3KT4A 1VR3A 3PUHA 4IDZA 4Q0PA 4QXCA 4JGZC 3PIGA 3J26N 5FP9A 5JLVA 3LEIA 2UYAA 1PVC2 2W2IA 1JZ6A 2FCTA 4JV4A 1COV2 3NNMA 4CEYA 3LEGA 1D0HA 3DPRC 5FLJA 4BQ4A 4CUGA 5L7OB 2G4IA 5CG8A 4PDWB 3J8F1 1VMHA 2MNGA 3FHQA 4DY3A 5G05L 1HRV1 5FZ3A 3PL0A 3D82A 3NNGA 4D6RA 4RYDA 1C8M1 1IOAA 2ET1A 2J1RA 2WO1A 1RXFA 3F95A 4IL7A 4Q0SA 2Z42A 2QQPA 1SPPA 2ZEZA 3GBFA 3VBHA 4DOUA 5KHKA 2ZBJA 4JHTA 2VZTA 4L0PA 2A3WA 1AX0A 1DQ2A 2PHWA 2WO7A 1NCRC 4ZXKA 4XZPA 5IHRA 3B69A 4Q4V3 1OLME 2V4VA 5FOJB 1ZM1A 3C3VA 4JGZA 4PLNA 2VOVA 1YC61 2CL2A 3NV2A 4BJ0A 4D7TA 3H1WA 1UZYA 1ZRIA 1W8WA 4DFSA 5JSPA 2RS33 1A8MA 1HN1A 1LOFC 3FBYA 1W90A 1WCDJ 1YJKA 5FY1A 3S5QA 3UKTA 5K8SA 5C9AC 3J4UH 3ZKUA 2CSGA 2R073 2R0FA 5LASA 2RV9A 1C57A 1UU6A 1J84A 4A41A 4RA0A 4CDXC 1X8EA 1OD5A 1XNBA 4Y1YA 1RUOA 4AW7A 2W08A 1OI6A 1XBFA 1QXPA 2BPA2 1HQLA 2VCBA 4HFSA 4YFZA 3FBMA 1UZVA 3J7MA 2AEYA 4LKDA 3OBTA 4QX8A 4XOGA 1NCRA 2RDSA 5CU1A 4AK3A 4IEQA 1XNTA 1CR7A 1EUTA 2ETEA 2UU8A 4U36A 5DAWA 5A7NA 2HWC1 4DEVA 1XPWA 3VBSC 4UW4A 1QJU2 3MICA 5FO7B 4D3WA 5IK8A 3MIHA 1RB8G 1SBEA 4XZUG 2ZJCA 3A21A 4QGMA 5C9AA 3KVAA 4FPYA 1VMFA 3LAGA 1BKZA 4XCAA 3HN3A 2WWJA 3K75B 4QB2A 4JDOA 1I1EA 5FZHA 1NLQA 1TE1B 1Q8QA 2XUMA 2NQYA 3HWJA 4CDXA 1IS5A 4OLLA 1H1MA 3QOPA 5D8AC 1VAMA 3KHCA 4AVTA 1PO11 2VW1A 3INAA 1F9KA 1TME3 3RWKX 1AL22 1VB2A 3J7LA 3IAPA 4IGOA 3VZMA 2VMEA 3AZYA 1WBFA 5A80A 3U07A 2VXJA 4I0AA 4HVOA 3WW2A 4OUMA 3JBG2 3KQRA 2A6YA 2BRTA 2VTXJ 1O3RA 2WNEA 1JUHA 2XMLA 4MOAA 1PMHX 1Z7S3 1DIWA 3K4DA 3GHNA 3N7JA 5CIRA 3VBSA 1AZDA 2ZMLA 2VG9A 4UI9L 1N1SA 1R1A3 2ZGKA 5LA1A 4UFMA 1CVNA 4NIDA 4DXRA 3TN91 4LO7A 1H2NA 4BQYA 4OHWA 4XFFA 1DP0A 3VHRA 5LATA 1IPSA 2JG8C 1O3QA 1HQNA 2LALA 3BYWA 1QH6A 3BVCA 4XCBA 2BU9A 5D8AA 3OGVA 2BV4A 3DL3A 2Y0IA 3SXWA 4DPNA 2WT2A 3GGLA 3OJBA 5CB7A 2ADEA 3FFQA 4DO0A 1WKYA 3T4VA 4BM8A 4F7ZA 2QQNA 4XUNA 2ZGMA 2D6LX 4BMBA 4W6XA 1UKGA 1YIPA 3ASIA 1QJX2 4WVWA 1NCQA 4JGYB 4FPFA 4HSLA 1CJDA 2E51A 1PZ8A 4XTPA 1WCSA 5JZGC 2HWE2 3O1RA 2R063 1TMF1 3O1SA 1DQ5A 4OULA 1XNAA 1UZZA 5HV4A 1PIV2 4WZFA 1VBA1 2QQLA 5FPLA 5C6CA 4Y4RA 1ZRFA 3E5XA 4XQWA 4UFKA 3N9LA 2O8OA 1UW8A 1LHOA 3A0KA 2WNUC 4LA2A 4N7UA 3AVRA 1NY72 4R9DA 5FZOA 3RPQA 3WNNA 3UETA 2G9ZA 2G9FA 2JG8A 2WZPP 2A3YA 3ST7A 3VL9A 5HCAA 5HV0A 2WLQA 1IS4A 1Q3EA 3LIHA 3OGJA 3Q9OA 1N3QA 4KU8A 4XDPA 3P5BA 2WFF1 2BGPA 5C8WA 4YW1A 2HWB1 2MHFA 1EAH2 2UY8A 5F5QA 1GKBA 4UW6A 3RI9A 2ZGLA 4JRAA 3QH6A 3LKJA 2VC9A 1DFQA 3JU9A 3VN4A 4Y26A 4C1WA 1FOD2 1POV0 2WN2A 4XJZA 5A1AA 1W3VA 5DUWA 5CVRA 3NNLA 2X5IB 5F32A 4AAPA 5JZGA 4CDUB 2W3JA 4PDWC 4TYSA 3WP5A 1BCXA 4H7LA 4IV3B 2ZX0A 4HLTA 4DUXA 3POYA 2XBO2 3S7IA 3ZDVA 4QT6A 3FL7A 4META 5EFUA 4RQPB 1MVEA 4QHOA 1MS0A 1SLTA 4Q29A 4AGVA 1W03A 3H7YA 4IEPA 2EXJA 1W06A 4QB1A 3WDYA 3ZXDA 1UQXA 3LDRA 1HRI1 1V6OA 4TXWA 1PVC3 2VNOA 2YGMA 4JRLA 1ZNPA 4RGKA 5CFDB 2VQTA 1VMJA 4X6RB 2E9QA 3DGTA 3DKQA 2Y33A 4K7JA 2WZ8A 1W2AX 3ZYGA 2WWUA 3LIGA 4XYXA 5JR7B 5L7OA 3MIEA 4PDWA 3APBA 4PF1A 4CCNA 4RL7A 1UZ0A 3NWKA 1EYBA 3VLBB 1H8VA 3ILRA 1APNA 4MHUA 3B94A 3CJXA 4L2NA 4NHLA 1FX5A 1HXS1 5DZFA 4NPLA 4LHNA 3VGIA 2XL7A 4JKKA 4QQLA 3BODA 2ZPXA 4Q4X2 4GALA 1PGW2 4FOWA 2YFZA 1S0BA 4S2FA 2OUHA 4S2DA 3NKGA 4XF9A 4XXPA 3AXEA 4NOTA 1GWMA 2JG9B 2HH9A 2YV8A 1X82A 4P9LA 3RZMA 2YBSA 3AFKA 3DXUA 3WDWA 3PVBB 2ATFA 2PLV3 2DURA 4Z2WA 2WC2A 3H8UA 5LK5A 3JD73 2CAVA 4YSFA 1JZ5A 2WSVA 3L2HA 4TZDA 1YFUA 1LOEA 4IE7A 2VZ1A 2Y6GA 2DBNA 4AVVA 1GBGA 2F4LA 1VB4A 5H9PA 1ZBE1 2CDPA 1LESA 3AKSA 3CJIB 5HCFA 3WUCA 2P2KA 1ZYBA 5E16A 4XF0A 1GP4A 3PIJA 2OKXA 1WCQA 4BA6A 4JKMA 3AZWA 1UOJA 3AYCA 3P1IA 4QD2A 3I2DA 1TNFA 1CZTA 2VE1A 4OHZA 3T1LA 1W6NB 5ACA3 1ZRCA 5FWJA 5LBCA 3OGSA 4LBMA 5F9TA 2RR12 2RS11 1BBT1 4Y1ZA 2ARAA 5KXDA 3MIGA 3PTYA 1UY1A 1PVXA 2EAKA 2XJRA 2JIGA 1W6QB 1XE0A 1JOBA 1HN0A 2OQ6A 1JU4A 1KD7A 4P5HA 1DZRA 3BPSA 4OHXA 3VDDB 2ZX4A 2R30A 3M3EA 5KXCA 4QQOA 4QPIB 2GMPA 3A0NA 3NW4A 1YQ2A 5AFBA 1OQDA 1H1IA 2VZUA 4LHSA 4EN0A 5FAXA 1V6KA 4N90A 4D6QA 4YM0A 4RSUA 1G9AA 3WSOA 5JOWA 4FPHA 4Y1UA 1ZA7A 2VD7A 3WNOA 3UNPA 4XQ4A 4YLZA 2MEV1 3I2FA 4D0QA 3O0XA 2Y38A 4JGYC 3ZFGB 5I8YA 3QLQA 3V65A 1UIKA 5JIAA 1F4AA 4Q4W3 1CIYA 5FMOL 3NMBA 5DAXA 2DTYA 4NVPA 3WF4A 4G9SB 5FXWA 2VOWA 1D2SA 4Q2FA 4COWA 1IKPA 2WAOA 4YWAA 4YM2A 1NG0A 1JN2P 3GJAA 1KFXL 5HCHA 3WNMA 2OQ7A 1QY4A 4XUQA 1JYVA 4FSJA 5BNOA 3ATGA 1QDCA 4I09A 2XQXA 1ND2A 2IUWA 2UWCA 4IGQA 1RMU1 5CFCC 4RS5B 1SLLA 3MW3A 2QKDA 4K8FA 1O4ZA 4XJWA 3MZHA 1PZ7A 2RS53 4GZ9A 2DCYA 3PLQA 4XJUA 5FYZA 4X8NA 2XJQA 1R083 1K5JA 4QDRA 1QWRA 1G7YA 3MUZ1 4TWTA 1ZZ7A 4M0NA 2IVIB 4JGYA 4CP9B 3CU7A 1N1TA 4COZA 2VULA 4DRVA 2JDPA 2X5IC 3BGAA 4R9CA 4LBNA 4K9SA 5ABJB 2EXIA 3AJZA 4IV3C 3WT3A 1QQP2 2RJKA 4XDQA 4QU2A 4AEJA 3S0MA 4QX3A 4YRDA 1F8VA 1F35A 3M1HA 2R6QA 1ZZBA 3MFAA 4BYYA 4B7EA 4COYA 1NOVA 4IE0A 3OY8B 2YBKA 2XXZA 4O61A 4RGAA 2HWF3 1U5XA 1JHJA 5A7WB 3UK9A 3VBFB 2XWBB 1AF9A 1F4HA 3HR9A 2ZMNA 3L9JT 2FZ1A 5CNAA 5FCCA 2ZKNA 1KRIA 1YQ6A 2B5HA 4YGBA 4H2AA 3T0BA 1YRZA 3LPFA 2H6CA 3SEPA 4BB3A 1FNYA 2Z2SB 5A7PA 4KQ7A 2RE9A 1DLCA 5JXJA 3ZXJA 3RZLA 5FZCA 1UN1A 3AXDA 1R093 5J09A 2X5IA 4GQ7A 1E57A 3VD4A 1QJY1 4Y3OA 2V09A 4TLGA 4YVWA 3SEEA 4LNVA 3UJOA 4CDUA 5H9RA 5IYYA 4IE6A 4IV3A 4QPWA 1OURA 4WM8B 5IW0A 3TWIA 5FPXA 4GKXA 4YG0A 4E2SA 4F83A 3VDBA 1LB2A 2DU0A 3TEXA 4JTNA 4RQPA 4B4RA 4JKLA 5CYYA 2VZSA 1FV2A 4IEZA 5E8AA 1AR62 3RYPA 4ARYA 1AYN3 1R1ZA 1AR92 3WDTA 4AI9A 5KHJA 5FYIA 1UY4A 5DN2A 1FMD3 1G9BA 3I2GA 1Q43A 1S0IA 4XILA 4EN8B 3O1TA 5DDJ2 5FLHA 5JSRA 3RZGA 3CQOA 2JG9C 4OUSA 2JWPA 3ABZA 3WQ7A 1RUD2 1V6NA 4GIQA 5CFDA 1MPXA 5GJ6A 3ACFA 4E2GA 3WINE 3ZR6A 5JPMB 3BU0A 2JE7A 2AC1A 3IIAA 3CZUA 1OBNA 4Q4V1 1JOJA 4A7YA 1S4CA 2YROA 1JZ3A 3VUOA 4GB33 3USSA 2RS31 3CLPA 3WQ1A 1YEWA 2D6OX 3EO6A 2WRAA 4FP3A 3BTXA 1WCUA 5GLTA 4QQPA 3SH5A 3WNPA 1W0PA 2RDNA 2R071 4MSVA 1H2KA 4CCMA 3WCRA 1QNWA 2WINB 2A3XA 2E33A 4UAPA 1RUJ3 2JG9A 1WW5A 2AYHA 1OA4A 3NQHA 3T2TA 5FZLA 1UMHA 2W1WA 1YFXA 5F2SA 3ZIWA 2GZWA 5F3GA 1RUE3 2JDMA 3UL2A 1YFWA 1HKDA 2I45A 3MV11 4ET7A 4TLFA 3NKTA 4QPIC 3OEBA 3CIHA 5F7UA 2WAAA 5FZBA 3TEWA 2ZEWA 5FO8B 2VMFA 3HNMA 4SLIA 4N53B 1KDMA 1N3PA 1UXXX 4XETA 3CJIA 3ROUA 5GZGA 5JXGA 1H2MA 2YZ4A 4ES8A 2QTWB 1Q8OA 2XJVA 1QIQA 3AM2A 1VBC2 2P3KA 1K12A 2GC1A 2HWD2 4OUEA 3WG3A 5KC5A 3CO2A 1SZBA 3WNLA 3ZO0B 2QQMA 3GZAA 2XVLA 2RJLA 2B4KA 5IATA 3E6BA 5JMCA 3R4UA 2VY0A 1UO9A 5K9YA 1H1AA 2Y8KA 1AYM2 4FBFA 1QOTA 1BK0A 1TME1 4V2WA 1W6QA 2ZGQA 4AI1A 2ZHKA 1RUF3 4IGPA 4XXAA 4Y1XA 3VDDA 1H6YA 4BQ3A 1JYCA 1UPSA 4QPIA 4LBLA 3ZYRA 3POBA 4MGZE 4N43B 4BPZA 1I5PA 4RS5C 1Z7S1 1F31A 3NV3A 3ORJA 1SDWA 2O8QA 3QD6A 4PLMA 2C24A 4PCRA 4QWNA 5FZMA 2F4PA 4QKFA 2Y34A 4R8HA 1R1A1 5A6QA 3P3PA 1L7LA 3PMEA 4NO4A 1WW4A 2E31A 1UOBA 1RUI2 2D98A 1J1LA 3I59B 1QJEA 5FOBB 3ZFGA 1KFUL 2Z5WA 4P02B 3E97A 4Q0VA 2JKBA 4WM7C 3IPVA 4LHKA 3WVJA 1NA1C 5ABJC 3NJVA 2QUOA 3QCWA 3VD7A 2QDRA 5B4NA 1AR82 3VZNA 1S0JA 5H9SA 1JXNA 2EXKA 4CUAA 3BOPA 4ZONA 3RMXA 1EV12 1XE8A 4AVBA 4RS5A 1PO23 4XUTA 2R061 4KU7A 5EYYA 5F8PA 4BWOA 3VBFC 1IS3A 1OFNA 1BQPA 1HB3A 4IE5A 5IVFA 2NMOA 3DKWA 3PURA 4QX2A 1MR5A 2WBKA 4ZS2A 1ND3C 2PTMA 2V72A 2FMYA 4GH4B 1ZZ9A 1CAWB 2X53S 2YHJA 3WP3A 4CP9A 2ZAAA 4GULA 2KD7A 4IEVA 3VD5A 2GN3A 3RYRA 4ISQA 5AFEA 5BY5A 3I2KA 1VBB2 2A7AA 2D3RA 1QXRA 2R043 1K45A 1GOGA 3THPA 4WM8C 5FBZA 4MUVA 2D6KA 1ENQA 1PMJX 1VPHA 1LHVA 3I4IA 5GALA 5CISA 2RVAA 1NZIA 3GALA 3GZEA 1MZEA 5EZWA 3VHNA 2WZR2 3NJZA 3AP6A 4W8JA 1AR73 3CMGA 2PHFA 4XFCA 1X9TA 4AQTA 5A70A 1AHSA 5J7MA 3OY8A 4XQDA 3WF3A 5GZCA 2GN7A 3AJYA 2FHRA 1BMV2 2XJSA 1M4WA 1LTEA 2ZABA 4RHV3 4LQRA 5A7WA 3VBFA 1WLCA 3OGRA 1W8FA 5I0DA 4I0BA 5ANNA 5EJ1B 2ZXQA 4LTAA 2WA3A 1QDOA 1MEC3 1AX1A 1NQDA 4X6QB 5A1FA 5J96B 4LE3A 4AFMA 4HBNA 1HB1A 3JQWA 4FOVA 2VNRA 2DU1A 2KR2A 2J1AA 1NXMA 4UW3A 5A7SA 3WX5A 5C4WC 2V5YA 1UF2C 3KMHA 4CDQB 1O3SA 2BDRA 3SCHA 3BTZA 1KEXA 3IZOA 2WS92 3N9NA 1PVC1 3OSDA 4WM8A 2JE9A 4OZOA 1VRH2 1PM4A 3I3DA 2BGOA 1MS5A 2C6SA 2D5HA 2OS2A 1PX4A 3Q8FA 5CA6A 3NSTA 1NCQB 1XSRA 1PNGA 5GLZA 4EROA 2Q30A 4UFLA 2K0GA 2ZTNA 1RITA 4A6OA 5DDJ3 5EV7A 2LRPA 4B3NA 3PU3A 4IESA 2P34A 1VJ2A 4DMIA 3EJKA 1UY3A 1VBD2 1ACCA 1OH4A 1RGSA 5BNQA 5FUNA 4XFIA 4KGGA 3ZXGA 2F17A 4YARA 4Y20B 1JZ7A 2B45X 2JICA 1MACA 3EXUA 2J1EA 3DYOA 4L97A 3WG2A 1BYHA 2P6HA 3N3HA 3RYKA 4IERA 3VV1A 2BNNA 3OBZA 1GLHA 4JVAA 4Q1PA 4LK7A 2ET7A 2PLV1 1ZZ6A 1KDKA 4Q4Y3 1D4M3 3JD71 4MO3M 1LAJA 4PI0A 2DYCA 2B39A 4XIOA 4CEYC 5F1RA 3IDBB 3B01A 4O65A 5KHGA 1OC1A 1LGNA 2P37A 1W9SA 4M0HA 5F39A 4C8DA 4DY5A 2D43A 1RUC3 3VKMA 1SFNA 4X8PA 5T3NA 1AX2A 2RJ2A 1T6GC 4CA9A 1ZX5A 5JOYA 5DZEA 2WSUA 4LUKA 4Y24A 4WZCA 1V0AA 1QJY3 3V0BB 2P3JA 2BWCA 4N7IA 4YZ1A 4JQTA 5ACA1 3BTYA 4N43C 1DGWX 4AVCA 2WA4A 4YVSB 4F3JA 2OPWA 2Q8DA 4J1WA 3U37A 5IK5A 4XPVA 2QZ2A 5E6HA 4N53A 4YW6A 3HN1A 1BEV3 3X29B 4XDOA 4EV0A 2VZRA 4O9GA 3MLKA 5T5LA 1U5ZA 4GAZA 4M4RA 2XJTA 2Q4SA 5A7QA 1PZ9A 3KGZA 3TEZA 2Y26A 4XC9A 5C3SA 1BHGA 1NQJA 1LOBA 1AXKA 2ORXA 3I7DA 1REDA 1JYIA 4NAOA 5I93A 3ZLIA 1VAKA 3VZKA 1RVF2 4DIQA 1AL21 2IXCA 3GYDA 5D2AA 2LTNA 1W8NA 2CU5A 2WUHA 3H9AA 5B2GB 3QH7A 3WLUA 2XGXA 4P9IA 3AMMA 1XE7A 5D21A 4URTA 1T6BX 2CGNA 4XFGA 5FPAA 4ZZ5A 5F5IA 5I8SA 4N43A 1RIRA 2GC0A 3KV5A 2R1BA 4Q4W1 4FPEA 4N8MA 2WWSA 3KGLA 1HX6A 1RUH2 4HKLA 1OHFA 4CPBA 3C7EA 1UMZA 1JMUB 1C4RA 1O5UA 1C1FA 3SKVA 2A73B 1UX6A 1H4HA 5CBLA 3O1OA 2L9LA 4GH4C 3PVEA 1GQPA 5A32B 2FDKA 1X7NA 3I59A 2ZGSA 4AE2A 3KV9A 2RG4A 2VAUA 3MDPA 5SV5A 2RS51 1C5HA 4D69A 5CEHA 2TUNA 5GLWA 3BCWA 2VBBA 5F3IA 2BNMA 2RDRA 1R081 4BIOA 4LE4A 4BIFA 4C91A 1FPN2 3NL1A 2W1SA 4LR4A 1K5MA 3SKJE 2PAEA 1RHI3 2VZVA 2RMU2 2GC2A 5JMOA 1H9PA 4CCKA 2VMIA 3VZOA 1FYUA 4AXOA 2VQAA 2VNGA 5SV8A 1CZVA 3ZX7A 4LHLA 3LSDA 4A2UA 1QJFA 4B29A 4KI5M 1UWWA 3SH4A 1IPJA 3POSA 4A42A 4I3GA 2VCMA 3C7OA 1OD3A 3AMQA 1WMEA 4GH4A 3WQ0A 4EWDA 1CAWA 1L7RA 2GALA 2QBXA 2ZGTA 1VBB3 3FZ3A 4DINB 2HWF1 2WQ4A 1EAH1 4CDQC 2DCJA 1BK1A 3W59A 1OA3A 1ULCA 3WEZA 3MO4A 5T5PA 2IXJA 2E63A 4Y1VA 5A3NA 3W58A 2BBAA 4XAEA 1FATA 2QVSB 4UF0B 4QMAA 1NKGA 1PHMA 1JYWA 2PHUA 3AMNA 1NCQC 3SHRA 4AHZA 3GBWA 1R091 4XAAA 2FDIA 4MLOA 5F6LB 4MG2A 3B93A 5FJKA 1MS3A 4LO8A 3J8F2 2WLPA 1ULPA 3IT8A 3GHMA 5LW9A 4YNIA 3E6DA 3HBKA 5FP7A 1W9WA 2BERA 3MPPG 4R4ZA 4NIAA 3WDXA 2QJVA 3ZPOA 4AI2A 1BZWA 2VXRA 4NPRA 5BNOB 1VAVA 5LRSA 1AYN1 1C8M2 1RYYA 1ND2B 1QOSA 3PTRB 1DDLA 5J98B 2UURA 1FMD1 3IN9A 5FZGA 2YFUA 2WS93 3IDEA 4UT5A 4CDQA 4EZ4A 1AUYA 2VU9A 5LY1A 1AJKA 1VP6A 1UYZA 2WT1A 1O91A 2R1DA 1YO8A 1I3HA 4NRQA 2D3SA 3VZJA 4KG0A 1Y9MA 1URXA 3WY6A 5K7PA 1B35B 3CDZB 4AEKA 3BIEA 2IC1A 2C5DA 5GZEA 1XRUA 3ITQA 4CUBA 2QZ3A 5IAXA 1UKRA 1VBD3 4FFHA 2RM23 4XMIA 5A1LA 3P6BA 3BU7A 5EPAA 4JDNA 4F8AA 2DUQA 3PUSA 3RZHA 1NE6A 1W2TA 4H7MA 4NWWA 3PVOA 3W20A 4YW7A 4GB31 2FZ2A 4A7KA 5F5AA 1G6NA 2DWRA 1T2XA 4Y20A 1W6MB 3RS6A 2QNKA 3GXUA 1YQ5A 2OW4A 3KV6A 2FCVA 1Q5OA 1DCSA 4QDSA 3ZN4A 1DU3D 4D7YA 1RXGA 3AP7A 3D0JA 1RUJ1 2J1UA 2W87A 4EYUA 4U2AA 2HWC2 2XUEA 1IKQA 1ASJ3 3PVNA 4HVQA 1Q8SA 3LPGA 4BOWA 5C33A 4XMAA 3N9PA 4QM8A 2W92A 3KS7A 4K40A 1RUE1 4K21A 1W6PB 5AC93 4LO5B 3LEKA 2QFEA 4XF4A 2PHLA 5EJZB 1V9U2 5L7OC 4YVWB 3ALQA 2GSYA 4D7SA 5FTTC 4CDWB 2WABA 3DYPA 2Y6HA 3SNMA 4YW3A 2GH8A 4BQWA 4DZGA 1Y9QA 1XYPA 3WP4A 4EZHA 3HBZA 2DV9A 3GCXA 3B02A 2Q8EA 4K1ZA 2NN8A 4GMP3 3JB4C 4LBQB 1DYKA 1PO12 1U0AA 4HN0A 4UXAA 3IM0A 1X50A 5FYHA 3V0BA 3KB5A 2H6BA 4K8RB 4M3CE 5FZ0A 4YVSA 4K6BA 1MS4A 2Y6LA 5JR2A 3AKPA 2VVFA 3NJYA 2WT0A 3LQCA 1EUUA 3FHIB 4FT8A 1COV3 4R9BA 2JDZA 5FY5A 1W8TA 1RUF1 3AYAA 3AP5A 3CNAA 3D3AA 1PX3A 3TN92 1ST8A 1H8TB 4LK6A 5FZEA 4NJ4A 2AR6A 4B7KA 1YCIA 2XHNA 5IFTA 2VMCA 1U5IA 5BPXA 5BUVA 2JDNA 3NO8A 4HG6B 4FQZA 2VGDA 2WYSA 4WVMA 3GZUC 3LGRA 2GNBA 4IQPA 3D0SA 1CAUB 1SLIA 3BALA 3AP4A 3A23A 2DFCA 3H50A 3U4XA 2XDVA 4L99A 2G19A 3T09A 4CU7A 1V6IA 3ZYIB 1LKNA 2E6VA 3LSEA 4WVZA 3USUB 4ZZ8A 3ZXEA 2QCSB 5FZKA 4FPCA 1QOOA 4P08A 4NHYA 1OQ1A
chains in the Genus database with same CATH topology
1VBA2 1CX4A 4YGDA 5EWSA 2BW8A 4Q0UA 5A32A 2DFBA 5A3LA 1PO21 3AYDA 3VKLA 4DXZA 4E27A 4AI8A 1FPN3 1O4TA 4YZ3A 2WFF2 2HWB2 1LGBA 1AVBA 2W0XA 1YI7A 4QPGB 1CN1A 2ENRA 1I5ZA 1QJU3 4XEZA 4YM3A 3D8CA 3KM5A 1WBLA 2VUAA 4D94A 2R041 2ZHLA 3AK0A 5JPNB 1H4GA 4ZU4A 4HT1T 5BNOC 1AR71 4PQ9A 1MZFA 1ND2C 2JECA 3MYXA 4W6WA 3FLPA 4QHBA 1MQTB 1AL23 3ECQA 4RHV1 3ZYPA 5JIUA 1RUNA 1HRI2 1MEC1 2CV6A 1DGWA 3JBG3 3HD8B 2PHTA 4A7ZA 4AQ6A 1PGL1 2TEPA 3WHTA 1B35C 4EWAA 2NYYA 2A71A 3IPVB 2XLGA 4EN6B 1PK6B 1JW6A 3ZSLA 2VMHA 3R05A 1GQHA 4CZSA 1WW7A 1REEA 4HANA 4XBQA 3TOJA 1HXS2 5GM0A 3WDUA 1ULGA 2D5FA 2H0VA 3ZDSA 1SBDA 2BNOA 5DDJ1 3JQXA 2WJSA 4UBHA 5BXXA 1ZREA 5H9QA 1QJX3 5T54A 3DV8A 1RUG2 3MW4A 5C8CB 2HWE3 1B35A 2PELA 2B8MA 2ZCWA 5DUVA 1L3JA 4OI1A 1PIV3 2GNMA 4AGGA 4YVWC 4CDUC 1JH5A 4CDWC 1X36A 4XF1A 2FMDA 2C9AA 4AHXA 4KWKA 1FV3A 1S1AA 1S2BA 1S0EA 4RQPC 2A6VA 4MH0E 4MX3A 1LULA 2CGOA 1ZBE2 1IHMA 3EHKA 1D4M1 4Q4Y1 1G9CA 2ARXA 1W6MA 4BMEA 2Q5TA 1EAH3 2AGSA 1GR3A 4N9HA 1POV3 1RUC1 5I0SA 1ENSA 2UYBA 2ZGNA 3ZFFB 3BOWA 1I6XA 4DRRA 5CFDC 1FOD3 1MS8A 2RS12 1BBT2 2XLFA 5LEJA 2GU9A 1D4VB 1W6PA 2A5ZA 3ZXLA 3MLLA 2XBO3 1S0DA 3RI8A 2XWJB 4CDWA 2JD4A 5EXOA 1ALYA 5FMOS 3RWNA 2G9GA 2CNAA 2NZ9A 4RR3B 1BEV1 1W6OB 2FBEA 4LBQA 1UPIA 1UL9A 3B3QE 3AMHA 1G8WA 1C8NA 2B9UA 3ES1A 4AEMA 2MEV2 3JCIA 3ME2A 2VW0A 4AF9A 5FREA 4E4DX 2DVBA 3WOGA 4XHBA 1FT9A 2YDEA 4AQ2A 4AHYA 4Q26A 4CEWB 3WW3A 1H8TA 1SLAA 3M8LA 4XE9A 2D6MA 5BNNB 1RMU2 1WA4A 3CJIC 4I0WB 4AQSA 2Y0OA 4Q4X3 1CAUA 2YPJA 2QE3A 4Z82A 1CPNA 1LOGA 2NM1A 4QPGC 2YUEA 5T5OA 4I02A 1EP0A 3LZZA 3USUA 1PGSA 3FE5A 1S2KA 1G9FA 4AYUA 4XF3A 5JAXA 1DF0A 3TYJA 4HMZA 2ZGRA 3VDDC 1RHI1 4MV2A 5HCBA 4YW4A 5FDBA 2IWGB 1GZWB 4IV1B 4ONUA 5I0UA 1O5LA 1REFA 5JVVA 4HK8A 1MQTC 4HZFA 4COUA 4FXKB 4OFGA 5FFOC 2WNVB 2BEOA 3TB0A 3RNSA 3NV1A 1H2LA 5IT6A 4ATFA 4YW2A 3ZFGC 2RR13 4QPGA 1OSGA 3ZPYA 1VBB1 3GZTB 1FNZA 3V0AB 4HPKB 2PAMA 1PK6C 3NAPB 2GNDA 3NV4A 2CTVA 2ZMKA 4GA9A 2AREA 4JTOA 2R0HA 3LA2A 2XKOA 2XVKA 1DLLA 2BGCA 3I8TA 2ZKLA 2BFUS 2C1FA 1NZCA 1RJ7A 1MQTA 1DQ0A 4LLFA 2XVGA 4YZ4A 1OQEA 5I0RA 1XU2A 1ZBA2 2ERFA 1DQ1A 5CG9A 1LEDA 2IXHA 1CAVB 2EVXA 5C8CC 5BNPB 1O3TA 5FLIA 1SACA 3MPBA 1PK6A 4UBGA 2WS91 2IZWA 2Z69A 4ITCA 1C3HA 2KXLA 4Q4V2 1UD1A 1VBE2 1QGLA 2BVVA 2CYFA 1K5MB 2DCTA 3R4SA 4JAAA 2OZJA 5JI9A 5J37A 3S6PA 3QACA 2YY1A 4NWVA 2RS32 3AYEA 5JSOA 1J58A 5I8TA 4UW5A 2OZ6A 1VBD1 1YUDA 2GMEA 2RM21 5J48A 2R072 1RUG3 3ZFFC 1J3RA 4JQRA 5IK4A 4ASLA 2KA3A 1V6MA 3HQXA 4I3PA 4LO6B 3OCPA 5C8CA 2VVEA 5FPZA 1GICA 3M3OA 3KD4A 2OVUA 1XQNA 1QQP3 3TBDA 2D7FA 4IXLA 4Z92B 2Q1ZB 2AUYA 1OOPA 4RR3C 3ZN6B 1ASJ1 2OIIA 5EJ3A 2GH2A 1LEMA 5KHHA 1XYNA 1Y43B 5AC91 2NMNA 4PIZA 3LCPA 3ETQA 4MXWB 3WUDA 2W68A 2XKPA 3POWA 2VOKA 4L9BA 2PHDA 1D2QA 3FX3A 2NP0A 2VOXA 1DG6A 4IEYA 3ZFFA 5E88A 1EPWA 3WD5A 4H55A 4GMP1 4KGQA 4TSVA 1TME2 1MS9A 4CEWC 2A70A 3FUQA 2IXIA 5E89A 3AKQA 4HK9A 1QH7A 4QPYA 1AR63 5BNNC 1HLCA 4HETA 1AR93 1BVP1 4RR3A 3AKRA 1OLRA 1W6OA 2EAAA 1COV1 1HDKA 4ISRA 2PYTA 4MGKE 4P9WA 5CADA 4NR1A 3N7LA 4DNYA 3ZMNA 1GQGA 1RUD3 5GZDA 4QGNA 1ZA4A 1VIWB 3O0VA 2FQPA 4AEDA 3SCFA 1LHNA 2XLAA 4HKOA 2OA2A 4LLOA 1WMDA 4CEWA 3CF6E 3ZXAC 5BYNA 1D0GA 4EN7B 1KXGA 3ZSEA 4FAHA 5BNNA 4N53C 2ZHMA 2R062 4Z07A 1IZ3A 1S0GA 2EIGA 2WNVC 4FXGB 1KJRA 1KJLA 4ORFA 3VBRB 1YFYA 3AZVA 1GNHA 4G4FA 4LT5A 3O0WA 3DF0A 4E2QA 1DQ6A 1FPN1 5T5JA 1DYPA 1MZ6A 3ZN5A 3C2UA 3VKFC 4KBBA 4FPOB 1KS5A 4P14A 1GZWA 4IV1A 1QJU1 2NPIA 1OPMA 3K48A 3MGUA 3OF1A 4OHYA 4OVEA 3V64A 3AFGA 2K2SA 1DGRA 1DZQA 4MGYE 3SLIA 2F6BA 1OLQA 1RINA 1VBC3 4PF5A 2HWD3 3U10A 2WNVA 4W6YA 5KXBA 2TNFA 5DG1A 2WNUB 3MIBA 1AJOA 4YGEA 5BNPC 4Z1VA 3V0AA 4HPKA 1AYM3 1CD3G 1TEIA 3NAPA 1DGLA 2DUPA 4WVMB 4GMP0 3V56A 2EALA 1K5MC 3JBG1 1SBFA 3AP9A 2IXKA 1Q8PA 1N1YA 4L8QA 1GANA 4HKWA 2VUJA 2VPVA 2I07B 2ZHNA 4P9JA 3ZXKA 5GZFA 4PLOA 3TNPB 1GFF2 5KWRA 1ZBA3 2E7AA 4M3CF 1RUI3 1A6CA 2JX9A 1GNZA 3D4KA 5I91A 3UJQA 2X29A 3GBGA 1CAVA 2B42B 5L73A 4A3XA 3MIDA 3LOBA 4ASMB 5BNPA 1IPKA 1UIJA 2I74A 3OYWB 1ULDA 4G3YC 1AR83 1VBE3 3N7MA 1QJX1 3B9IA 5DG2A 1WW6A 1F5JA 1EV13 1SMVA 1KITA 4ES9A 2HWE1 4DQAA 2PLV2 4AFDA 3JD72 1BXHA 1PIV1 3TAYA 4LBKA 4WBBA 3DPRA 2R32A 2XB6C 2P17A 4H14A 4L92A 1NY71 4PIXA 3AB0A 1J1TA 2ZGOA 2VECA 3OTFA 2N7GA 2D44A 2V73A 2Q8OA 1Y3TA 4S2HA 4YZ5A 4XW3A 3FLRA 4FTBA 2VVDA 5JI7A 1Q8VA 4AGRA 3M4FA 4IEWA 4OI4A 4OI0A 1POV1 2NLRA 5ACA2 2WZR3 5AVPA 1FOD1 3ZN6A 1DBNA 1LOFA 2JEMA 5L19A 1HW5A 1V9U1 4YG3A 2XJPA 4AFBA 1ULEA 3DN7A 2Q1MA 4AVAA 1VALA 1LODA 4MXWA 2XBO1 2ZOEB 4ZU5A 2R49A 2UWAA 3M2MA 1CPMA 4EN9B 3HT2A 1B09A 2ZX3A 5FRAA 2ILMA 1HRV2 4FTEA 4FAGA 3R4DB 5J36A 4PBPA 1WUVA 1DHKB 3UV9A 1AL0G 2D97A 1VRH3 2WQZC 4QQ2A 1JUIA 2UY9A 5FQ0B 4COVA 1V00A 4K1YA 4Q4W2 3WHUA 2BQPA 4FCAA 3M70A 4Q1RA 3OPZA 2YMZA 1I9RA 1O7FA 4J1XA 4AVSA 4PBOA 4PJYA 3VBRC 5D1IA 4Y22B 2BTVC 2OUJA 2BVBA 1RJ8A 2ZGUA 3URFA 4GXLA 1LECA 1RTVA 2RS52 4Q4X1 1PGW1 5HXVA 3HMYA 1R082 2EF6A 2ARBA 4BHPA 3PHMA 4YVSC 4XIKA 5T50A 2GAUA 5T52A 2ZZQA 2SBAA 5JCTA 4JC1A 1IS6A 2DUOA 4I30A 3P3NA 3BIWE 1CIWA 1HV1A 4P9XA 1LGCA 5KBFA 3VBRA 5CFCB 1PM7A 5DZGA 4B8EA 3GF6A 2B46X 2HWF2 4R52A 3N36A 2A6WA 4XHXA 4JDMA 5HBAA 1ENXA 1OMIA 4N9IA 2RR11 3M3QA 1EPZA 1WMFA 2RHPA 5GLUA 2PHRA 3O7OA 2D6NA 1R092 4QXKA 3LA3A 1YNAA 1EY2A 1IGOA 2XG3A 2OYZA 1OKQA 2GMMA 2HEWF 1WLWA 2PQQA 1J3PA 1SQ4A 3ILNA 2WNUA 3PJQA 4MVTA 5GKAC 2TBVA 3WDVA 4V1PA 4ATEA 2A6XA 1CESA 1RVF3 5F6KA 1AYN2 3D6EA 2O1QA 2DVDA 2P3IA 1PMIA 1FMD2 4OI2A 5IK7A 5JDBA 2DVFA 4WVVA 4RFT0 4HL0A 4RD7A 4O9EA 1QNYA 1S0CA 5I0TA 4HVRA 4DB5A 1JHNA 1RUH3 3VBUB 1XNCA 1TMF2 3TRSB 1WLTA 1JBCA 4LA3A 3ZVXA 4M01A 4ZU7A 1PNFA 1X33A 2AZ5A 4QQHA 1QMJA 1V70A 3ES4A 4GB32 3HIFA 2W39A 3E5UA 2D93A 3FLTA 4DS0A 2LM3A 4KNCA 3OYWA 1NE4A 3SITA 4C0HA 3BTAA 2K9ZA 4LO4B 4XJAA 4CP1A 1DGRN 4GWNA 3WZ1A 1RUG1 2LUWA 1A8DA 3BB6A 2RMU3 1RUJ2 1W39A 1U12A 3H3UA 1XNKA 3AZZA 4BLJA 2UWBA 3PMSA 1QQP1 1RUE2 1V6LA 3MIFA 1BJQA 4FPJA 3MW2A 3M3IA 2A6ZA 1W0OA 4I01A 4L11A 3FJSA 1GZCA 3RMYA 5A3MA 1CAXB 4I2OA 1A3KA 1GYKA 4FO9A 4Y5Z0 2ZAHA 1LCLA 3LB9A 3H3ZA 3E5QA 1DZTA 1GV9A 1VLNA 2E7TA 2YC0A 4AHWA 4Z8BA 5K0UB 1G86A 3S30A 3NVCA 4IEUA 1O4YA 4C0BA 3O5SA 1YWKA 2O0OA 4GWMA 1HQWA 3JUUA 2DVAA 1QKQA 1RUF2 3J8F3 1LHWA 2CAUA 4FP2A 1HRV3 3MF6A 4R9AA 1AR61 3HT1A 1A78A 1C8M3 1AR91 2GC3A 1ZRRA 4LBQD 1S55A 2IFWA 3ZIXA 2DCZA 4H3WA 1M06G 3VKNA 1IQAA 2XHKA 1YIFA 3RQ0A 3ZSJA 1RUD1 3LWCA 3ENRA 3FMGA 4Q27A 4B4QA 5FQ0A 2Z79A 3KLSA 3ZFEB 3A4UA 2CWMA 5IUQA 4BCUA 1OFSA 3OBRA 2ZACA 4E9KA 3H7JA 2I2SA 2PFWA 3M7AA 1QHDA 4CTEA 1MS1A 4CP2A 1Z78A 1N1VA 4LUMA 4Y22A 3WP6A 4FPGA 1V6JA 3N4MA 3N35A 1OOPB 1XNDA 1PO22 4YM1A 3AKTA 3AZXA 3IWZA 2HYKA 1GZ9A 4BH9A 3RSJA 1KS4A 3MI8A 2VW2A 4BQ1A 3RG0A 4IEXA 2AENA 3KZ4C 2HWC3 5TSWA 4WM7B 5E1RA 1NA1B 3PNAA 1FI2A 2PN5A 1LENA 2R042 1V9U3 3SH3A 1QXJA 1AXYA 1UU5A 1FAYA 5JOZA 1YHFA 1H8TC 2E53A 3J9SA 5JWPA 3B5LB 1ZVFA 5DUUA 3O14A 1AR72 5CFCA 2ZZJA 2JXAA 2YGLA 3W9AA 3WV6A 1Y7BA 1PO13 5LK7B 3H1MA 4GKYA 1VBC1 4RHV2 2HWD1 3OD0A 4WV8A 3IKWA 1UCXA 4B4PA 1DQ4A 1ND3B 1MEC2 3KCXA 1J3QA 3MLJA 1QJZA 3KSCA 1PGL2 4OZXA 1SLBA 1AYM1 1CQ9A 4W65A 3O12A 3VBUC 5BV6A 5CAZA 2GNTA 4AEDB 2R16A 2DVGA 5L36A 3OGGA 3TN93 3B00A 3ZYJB 1Z0HA 4AWDA 1SLCA 1LOCA 1LU2A 4BLIA 2C0ZA 4PIYA 1ZZCA 2A75A 3N7KA 3UKNA 3WCSA 1SCSA 1BVVA 1ZBA1 4INDA 1RUI1 4M3CB 2H0BA 1JTZX 2IFRA 4AG4A 1LR5A 2CY6A 4KH9A 4XBNA 1XXNA 2WIIB 5AVAA 3B9CA 4YYOA 4YFWA 5C4WB 1TMF3 3IMNA 3VBUA 2BFUL 1F2NA 4Q8KA 1AR81 3RMXA 1VBE1 1VBA3 1RL3A 4EJRA 3LA7A 3PJYA 1NLRA 5EYXA 5J3UA 1XYOA 4FOYA 4MZUA 1UU4A 5A33B 1EV11 3VHOA 5JOXA 2XPJA 1QU0A 1CONA 5LEKA 4Q4Y2 3T1MA 3VBOB 1D4M2 1GSLA 5KHIA 1YYNA 2WFF3 1X8MA 2HWB3 1TQ5A 1XU1A 3ZXFA 5K0UC 4BZ4A 4FVVA 2KM2A 1RUC2 4Q0QA 4YG6A 2EXHA 4MGIE 2PA7A 4K20A 2WKKA 4YW5A 4HSJA 2YYOA 1UAIA 3WW1A 4XBLA 4MYEA 4C1XA 3WR0A 3FWEA 1QJY2 2ZA9A 5T55A 4FQ4A 2WZR1 4M00A 3UKVA 2W52A 2BWAA 4LBJA 1BMV1 1HIXA 1LJ7A 3FUOA 3OD4A 3EBRA 1BEV2 2OPKA 4CEYB 1CAXA 2ZX1A 2Q0AA 4FPLA 1HRI3 1W6NA 2XJUA 4BE3A 5K0UA 1F5FA 2BUKA 4KWLA 1SFYA 4OHVA 3LOIA 3ZFEC 3VBHB 3HAGA 1H30A 5DUXA 2HJIA 3WG4A 3AMPA 2CWSA 1VRH1 2D6PA 3E6CC 5KXEA 3QBQA 4JGZB 1HXS3 3KT7A 1OOPC 4EWEA 1SCRA 1WD4A 2JENA 5LRRA 1NXD1 4CRQA 4C90A 2AH2A 2SLIA 1KQRA 3DPRB 3G7DA 3SCGA 2VQ0A 3IDCB 3WXPA 4FTSA 3ILFA 1Q56A 3ZFEA 1WGPA 2PHXA 2WFPA 1WD3A 2ZS6B 2WL1A 2HEVF 4CP0A 1LU1A 4KG8A 1NCRB 1W2UA 2GDFA 1C1LA 2PAKA 3FC0A 3SISA 1RHI2 2CGPA 4NHKA 1YXWA 1ZBE3 3JB8A 3VZLA 2XH6A 4E4ZA 5DXDA 1S0FA 3B7MA 4MXVA 5C9AB 4IETA 1C28A 1TNRA 3VKOA 1AXZA 2B7YA 1OA2A 3H1YA 4LEJA 1ULFA 4JCKA 3S7EA 4SBVA 4CDXB 3VHPA 4IEOA 4WM7A 3THTA 2RS13 1BBT3 1NA1A 1LHUA 5ABJA 4AFAA 3U11A 4LBOA 4KWJA 1YJLA 4AEDC 3RZZA 1LRHA 2JJ6A 3RJRA 5FO9B 1WLDA 4LULA 4QX5A 3MF9A 4J6GA 2XL9A 2VMGA 2IXLA 3RRDA 4RGGA 3FFZA 3EQEA 3VBSB 2DF7A 1SEFA 2X8KA 3ZSKA 1Z7S2 4AI3A 1MZ5A 1C5IA 1H9WA 1YI9A 2ES3A 2MEV3 1R1A2 2VH9A 2MPFA 3ZMOA 1ND3A 4KL1A 3ACLA 3CEWA 3KCCA 3WW4A 1WCKA 4FOQA 1RVF1 1CGPA 3KCYA 1N3OA 1J59A 5D8AB 3WNXA 4XFBA 2HKXA 5HI0A 3CL1A 3M3CA 3RDIA 4AFCA 1N47A 2YXSA 2BYVE 4IV1C 3TNQA 3L2YA 4Q8LA 1RMU3 3VBOC 1RUH1 1QF3A 4YGCA 1HV0A 2E7QA 3BPZA 2QDNA 1U5YA 2RM22 4P9YA 3AX4A 4M3CA 3H0OA 1ONAA 1YLLA 3MEPA 4XJ9A 1FXZA 2JG8B 3ELNA 3VL8A 4P9GA 4NN0A 3KT1A 5GLVA 2EA7A 5C4WA 3NAPC 4XJ8A 3G6JB 4QGLA 2ZX2A 1H0BA 4K3UA 4Y4YA 1G9DA 2ZGPA 2RMU1 3R6SA 3DUIA 5A33A 4HN1A 3GNEA 3IBMA 1ASJ2 1MVQA 2BBVA 5JZGB 3VBOA 4ZKTB 3I54A 3K51A 3R0RA 3D5OA 5AC92 2DTWA 4E4SA 2D40A 4R4XA 1CJPA 2D3PA 4FPKA 4NHMA 3SMHA 4XFHA 2HEYF 1ZZ8A 4AI0A 4S2GA 4XFAA 3ZSMA 3JZVA 3VBHC 1LOAA 1NLSA 1RC6A 4YZ2A 1ENRA 2DCKA 3RJ2X 1NYWA 3MFCA 1OPOA 4XTMA 5KC6A 4QM9A 3WG1A 3KT4A 1VR3A 4Q0PA 4JGZC 3J26N 5JLVA 2UYAA 1PVC2 4JV4A 1COV2 4CEYA 5FLJA 1D0HA 3DPRC 5L7OB 2G4IA 5CG8A 4PDWB 3J8F1 2MNGA 4DY3A 1HRV1 3D82A 1C8M1 1IOAA 2ET1A 2QQPA 4Q0SA 4IL7A 2Z42A 3VBHA 3GBFA 4DOUA 5KHKA 2ZBJA 2A3WA 1AX0A 1DQ2A 2PHWA 1NCRC 4ZXKA 4XZPA 3B69A 4Q4V3 5FOJB 1ZM1A 3C3VA 4JGZA 4PLNA 2VOVA 2CL2A 3NV2A 4D7TA 3H1WA 1UZYA 4DFSA 5JSPA 2RS33 1A8MA 1LOFC 3FBYA 2BPA2 1WCDJ 1YJKA 3UKTA 5K8SA 5C9AC 3J4UH 2R073 2R0FA 1C57A 1UU6A 4CDXC 4RA0A 1X8EA 1OD5A 1XNBA 4Y1YA 1RUOA 4AW7A 2W08A 1OI6A 1QXPA 1HQLA 4HFSA 4YFZA 3FBMA 3OBTA