3EO6A

Crystal structure of protein of unknown function (duf1255) (afe_2634) from acidithiobacillus ferrooxidans ncib8455 at 0.97 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GMAPDQQVPATALGKSSRISLDGRRSERSVILADGSMHSLTLLHPGVYTLSSEVAETIRVLSGMAYYHAEGANDVQELHAGDSMVIPANQSYRLEVMEPLDYLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein of unknown function (DUF1255) (AFE_2634) from ACIDITHIOBACILLUS FERROOXIDANS NCIB8455 at 0.97 A resolution
rcsb
source organism Acidithiobacillus ferrooxidans atcc 23270
molecule tags Structural genomics, unknown function
molecule keywords protein of unknown function (DUF1255)
total genus 21
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3eo6A00
4N9IA 4I0BA 3BCWA 3OD0A 4Q29A 1OMIA 1O5UA 3RNSA 3G7DA 4E2QA 3CJXA 4HBNA 1ZRDA 4O9GA 3BPZA 1RGSA 2GC0A 5I93A 4Q0VA 4LUKA 3EO6A 5FQ0A 1NYWA 3SCGA 4LTAA 3MYXA 1RUNA 3UKNA 1XE7A 4EWAA 3CLPA 4EWEA 4QXKA 1IPKA 4I0AA 2Z69A 4N9HA 5E1RA 3I59A 1GQHA 2OZ6A 1H1MA 5BPXA 2IXCA 4IEXA 5BXXA 5KHJA 5JR7B 3LZZA 1U12A 4IEWA 4QGNA 4QGMA 1DZRA 1XRUA 4MH0E 5CVRA 3H1YA 4IEYA 1FT9A 3MPBA 2CV6A 3I54A 2Y0OA 3USSA 2O8QA 3OCPA 2IXLA 4O9EA 1O3TA 1FXZA 2ATFA 2PHLA 2BEOA 3OF1A 4ZU4A 4BYYA 2PA7A 2UY9A 4IEZA 4XFFA 2Q4SA 4E2SA 3IDBB 5LRRA 1IPJA 3ST7A 2Q1ZB 1UCXA 4Z07A 3RDIA 3ETQA 4KWKA 3E5UA 4Q0UA 3H8UA 3PVBB 5KHKA 3DN7A 3FX3A 2PFWA 3NJZA 3HQXA 5E16A 2B5HA 2CAVA 4J1WA 4UBGA 4OLLA 4Q0QA 1CAWB 2ZKLA 4I02A 3VHRA 5KBFA 1Y9QA 3U11A 3H9AA 4ZU5A 2PAEA 2K9ZA 3ES1A 2QVSB 1CAVB 2IXHA 4XFIA 4I3PA 2P17A 1QWRA 2UYBA 1YFXA 2OZJA 4HN1A 1CAXB 2GU9A 1I6XA 2DCTA 4ZU7A 4ONUA 1YLLA 3E6DA 5FLHA 1ZRFA 2IC1A 3M70A 4KWJA 2D93A 2VQAA 1WLTA 2OA2A 3RYRA 4X6QB 5JAXA 4QM9A 2MHFA 1UIKA 2BGCA 1X82A 3NVCA 3PLQA 5EFUA 4XEZA 3GYDA 1CGPA 1Q43A 1LKNA 5CU1A 5JSPA 1EYBA 1ZX5A 1NE6A 4BH9A 4WVZA 4XFCA 2BNMA 4NVPA 3FJSA 4A2UA 3H1MA 3OGJA 3E6CC 4QMAA 4CYDA 3JZVA 1SQ4A 5HI0A 4HLTA 4HVRA 2GC2A 4JV4A 5JCTA 2IXKA 2PAMA 1VP6A 2ETEA 2XLGA 3CEWA 3RPQA 4FAGA 5FDBA 5C6CA 3BALA 1O3RA 3ELNA 3QOPA 1ZZCA 4XFGA 5JSRA 5LEJA 4PJYA 1L3JA 1WA4A 3ACLA 3M3IA 4IEQA 4YARA 2H6CA 4R52A 4PIXA 2F4PA 4IEPA 4XFBA 3SXWA 1CAVA 3KSCA 2XL7A 2XHKA 4LEJA 1LR5A 5D1IA 1RTVA 1CAUA 1ZZBA 4HSJA 4HSLA 4LA2A 2D40A 4MZUA 4YYOA 3N4MA 1OD5A 3KCCA 4XETA 3RZZA 3D0SA 3DV8A 4BIFA 4MGKE 1O5LA 3NL1A 3IIAA 2GH2A 4Z82A 3KGZA 2WFPA 3H7JA 1FI2A 1CX4A 5I0SA 3UKVA 4MX3A 3O14A 3QACA 1O7FA 3BU7A 3IDCB 4XFAA 3CL1A 5I91A 5I0UA 3EJKA 4MUVA 4QX5A 5F1RA 4UBHA 1I5ZA 1YFUA 3WW2A 4HMZA 2PTMA 2HKXA 4B29A 3H3UA 4LA3A 4LUMA 3TNPB 4X6RB 5EZWA 2FMYA 5FPXA 2B8MA 5FLJA 1EPZA 4MGYE 3KGLA 5KHGA 3FFQA 1EY2A 1RUOA 1WGPA 3FE5A 3E5XA 4AQ6A 5LRSA 2MPFA 2E9QA 5BUVA 1PMIA 1DGRA 1V70A 1QXRA 3I59B 2VECA 3NSTA 3H7YA 4QM8A 4I01A 4RD7A 4FT8A 2GAUA 2GC1A 1NE4A 3HT1A 5I8TA 4P9GA 4AVAA 3R6SA 3SMHA 1X8MA 5C8WA 2CAUA 4QGLA 1YFWA 2N7GA 4JTOA 4MV2A 2K0GA 5FQ0B 1OFNA 4DINB 4HVQA 2VPVA 3BB6A 4FAHA 4MGIE 1X7NA 2O1QA 4WBBA 1DZTA 3SCHA 5BV6A 2QDRA 4KU8A 2BYVE 2GC3A 3CF6E 3UKTA 3DKWA 3SHRA 4XF4A 4LULA 1RL3A 5I0TA 3GBFA 4EV0A 4HN0A 3EHKA 5I8SA 4AQ2A 4XF3A 3FWEA 4YSFA 1Q3EA 2IXJA 3ES4A 4TLFA 1YWKA 3RYKA 3LA2A 5K8SA 4I09A 2OPKA 1J3PA 1CAWA 5AVPA 2HJIA 2ET7A 3LWCA 4IETA 2CGPA 4F7ZA 2XLFA 4KWLA 4XF0A 4IERA 5CADA 3ZDSA 2V09A 4OFGA 1J59A 1SFNA 5I8YA 1O3QA 3WW3A 3HIFA 1J58A 4IEUA 2EVXA 3RYPA 1G6NA 4AVCA 2XLAA 3S7IA 3H3ZA 3FHIB 4EROA 1Y3TA 2D5FA 4GULA 5JSOA 4K8FA 3MZHA 1ZZ6A 2PHDA 3DL3A 1NZCA 2IXIA 1EP0A 4XFHA 2EA7A 4J1XA 2D5HA 3NW4A 1VJ2A 1ZRRA 1CAXA 4IEOA 4PIZA 4IESA 4H7LA 3EBRA 3LA3A 3PNAA 1J3QA 2GZWA 2ZCWA 4PIYA 2PYTA 2FQPA 4YRDA 1ZZ8A 2PQQA 3C3VA 2EAAA 4LLOA 4WZCA 4ORFA 5J48A 2Q30A 1UPIA 4EWDA 5FCCA 1DGWA 1YHFA 1Q5OA 5FPZA 1H1IA 3LA7A 4UXAA 3WW1A 4D7SA 3KMHA 4I2OA 2B9UA 3LAGA 2Z2SB 5KHIA 1ZVFA 2WC2A 3U0ZA 5I0RA 1ZZ9A 4L11A 1UD1A 3WW4A 1QXJA 5FLIA 1O3SA 2BNOA 2UY8A 1QY4A 4L2NA 3E5QA 3ROUA 3D82A 3EQEA 2QCSB 4XF9A 4R8HA 1VR3A 4FBFA 2H0VA 5J7MA 3FZ3A 2I45A 1XE8A 1YUDA 2ET1A 2Q0AA 1ZNPA 1UIJA 4YNIA 3MDPA 4KL1A 4XF1A 5J3UA 4IEVA 3S0MA 1X8EA 1LB2A 2C0ZA 2H6BA 1J1LA 2MNGA 2KXLA 4E2GA 4AVBA 2UYAA 3IWZA 4Q0PA 1HW5A 1NXMA 4HZFA 1O4TA 4Q0SA 3U10A 1ZRCA 3OTFA 2BNNA 4KU7A 5T3NA 3TNQA 4HVOA 1CAUB 1GQGA 3S7EA 3HT2A 2XGXA 3D0JA 1JUHA 3LOIA 5BY5A 5KHHA 1TQ5A 5LEKA 2XKPA 2XKOA 3E97A 1OI6A 4MGZE 3I7DA 2PAKA 3CO2A 3IBMA 3L2HA 3E6BA 2XL9A 2QJVA 4AXOA 4F8AA 1SEFA 1ZREA 1UW8A 4JVAA 3SCFA 3B02A 1PM7A 1LRHA 4BHPA 1J3RA 4D7TA 1ZZ7A 1YFYA 4JTNA 3H50A 3NKTA 1RC6A 4META 2OYZA 2QNKA 3H1WA
chains in the Genus database with same CATH superfamily
1SLLA 5A6ZA 2JE9A 2HWC3 1M4WA 4ZS3A 4CZSA 4GB32 3VBHC 4O9GA 3I3MA 3BPZA 1RUH3 2XH6A 2VBDA 3PIGA 4LUKA 4R9DA 4DMIA 4Q4W1 3W9AA 4MADA 2R041 1RUNA 3KB5A 3UKNA 3WF3A 3B69A 1LGBA 1OKQA 3CJIB 4NHLA 1U5XA 3WXPA 1QIQA 4I0AA 5FZLA 4MO3M 3AMNA 1LEDA 2MEV1 4W6WA 5E1RA 4CP9B 2GALA 3MLJA 2XMLA 2RHPA 5EXOA 3W58A 4E9KA 1U12A 4RA0A 3AB0A 1MACA 4IEWA 1DZRA 1XRUA 4QQOA 3LOBA 3ME2A 2BTVC 3ZFFB 4JC1A 5JOYA 2DVBA 4Y5Z0 1WCQA 1REDA 5FJHA 1HB3A 2OXBA 3WNNA 5A6QA 1KEXA 1U0AA 1UMHA 3ON7A 2O8QA 4Q8LA 2P3KA 2AENA 2HEWF 2VGDA 2GH8A 2BDRA 2BPA2 5IATA 5F37A 1X33A 2B7YA 3MIFA 3IKWA 2BJSA 2GP3A 4IV3C 1SBFA 2ATFA 5DN2A 1GMMA 3TBDA 1RXFA 3ZKUA 4BYYA 3TEWA 2ARAA 1V6KA 2HWD1 2EICA 4HPKA 5FXZA 4E2SA 5LRRA 2HBUA 5AC93 1IPJA 3ST7A 1ND2A 3IAPA 2Q1ZB 4GJZA 4Z07A 1BEV1 1OF4A 4JGZC 3SEEA 3VDCA 3OY8A 1UU4A 5FP4A 1TME2 3WNOA 4CSWA 4Q0UA 1JZ2A 1VLNA 5KHKA 3HNYM 1JOPA 4SLIA 2E7QA 1ZYBA 2D6KA 3NJZA 1GQPA 1NCQA 3AXEA 1SLAA 4AWDA 5FKBA 5IYYA 2MEV2 2ZGSA 2ZHKA 4QPGA 4E4SA 3O1PA 4I02A 1PX3A 2YBPA 2DU1A 4BQXA 2JXAA 3WNMA 3ES1A 1Y7BA 2VTFA 1CAVB 1GV9A 1OT5A 1JHJA 2YDEA 1GFF2 3RGBA 3VBRB 1YFXA 1ZBA1 4HN1A 2B46X 1CAXB 1DQ5A 1UY4A 2CHHA 2EIEA 4CCJA 3MW3A 4ZU7A 3ZYHA 2AR6A 1W6MB 3N7KA 3ZO0B 2IWGB 3L9JT 3E6DA 4LPLA 1BEV3 1XQNA 2Y6KA 1WLWA 2X09A 3O0WA 3HNBM 1KFUL 1JYNA 2P3JA 5AC91 4GH4B 2ZTNA 2OA2A 4XC9A 5LK5A 1RVF1 4LBQD 4DXTA 3D6EA 1SPPB 4Y4RA 4OULA 1C8M1 1Y9MA 3WINE 3AZZA 1JYTA 3KS7A 4Y1YA 4E8DA 3H8OA 2BGCA 1IKQA 2WZ8A 5FUNA 1C8M3 3TN92 3BOWA 1CGPA 2V5YA 3TAYA 3WDXA 3AMHA 5D8AB 1XBFA 1QJX1 2Y60A 3S57A 1F2NA 1ODNA 1OFSA 4CDUB 2J1TA 4LKDA 5AC92 1AYM1 2WUHA 3I2HA 5FY1A 2ZXQA 1KDMA 2F17A 5T5OA 3MLKA 2HYXA 4RS5C 3POYA 1HQNA 4YFZA 1K42A 1H4GA 2PN5A 3AM2A 3WHTA 4WZFA 2QQVA 4FO9A 4HVRA 4FPKA 1HRV3 5C4WA 4MGTA 4JV4A 1YQ5A 4XILA 3GZEA 3VBOC 1UOJA 1VP6A 4RGAA 1LENA 3CEWA 3RPQA 5C6CA 5CIRA 4BCUA 4Q4X1 1VMFA 5IW0A 2JIGA 3THDA 3A23A 1Y9GA 1YQCA 2DFBA 3ELNA 1W2OA 1BKZA 1LULA 3Q8AA 1W8TA 4OZXA 4PJYA 5HXVA 1L3JA 3HNMA 1H8TB 5FZOB 4IGOA 4P9XA 2WN2A 2Q5TA 4OUEA 4XUOA 2QQPA 4B4QA 4UWDA 1ZA7A 2F4PA 1VE0A 2WZR3 4C0BA 3DYOA 5EYYA 3DKQA 5FP3A 2VUCA 1PK6B 1RUI1 2NYYA 4UFKA 1BEV2 3MIHA 4R4ZA 4B3NA 4MYEA 1R1A2 1MS5A 2Q1FA 2XHKA 4LEJA 1TMF3 5T5PA 5IFTA 5D1IA 1V9U3 1VBD3 1EUTA 3HBZA 4PLMA 4XZUG 5FRAA 1CAUA 2BWAA 4M3CB 4A3ZA 5C71A 1AX0A 3AP7A 2A6VA 3L2YA 4IV3A 4D8MA 5IVBA 2VCAA 5FK7A 1JOBA 2HH9A 2D40A 4YYOA 1I3HA 5CFCB 1HQWA 1OD5A 2JD4A 1S2KA 2XOMA 2ZACA 3M3QA 4GD4A 1COV3 1U5ZA 3RZZA 4D6RA 4BXSV 1LOFA 2WR9A 3POGA 5FAXA 1GZWB 1TG7A 5GALA 5L9BA 4QQLA 3AKSA 1UU6A 2W3JA 1JYWA 2OKXA 2AACA 5FREA 4CPBA 3IIAA 2GH2A 1HV0A 2VULA 2WFPA 2HWE2 2W5FA 3H7JA 4BQ5A 1RUJ3 3HOBA 3SH4A 1FI2A 2D6LX 2ZAHA 5EJ1B 5I0SA 1V9U2 1VBD2 4RFT0 4MX3A 1EV11 4N43A 2JG9C 2WZEA 4ITCA 1PZ7A 1UXZA 3HEIA 1HV1A 1QOOA 4LNVA 4WM7C 1WCDJ 5DDJ1 5JOXA 4JGYB 4XFAA 3PUHA 2ID4A 2V72A 5I0UA 4YVSC 5K9YA 4F3JA 2HBTA 4AR2A 3SQOA 2JDKA 1SLBA 5FY9A 2HYKA 2ZX2A 1YFUA 1HIXA 3VZMA 1LOBA 1XSRA 5FO8B 5FOBB 4B29A 1DP0A 3C2UA 3O0VA 3KQRA 1C28A 2JJ6A 4LO4B 4CUAA 4LUMA 3VD7A 1DLCA 1R082 4AZZA 4X6RB 4PT6A 1ZA4A 2ADDA 4XUPA 5FY8A 3PJYA 4XXPA 5F2SA 4BM8A 1AL23 1H9WA 5LK7B 1EPZA 2A71A 4S2FA 5F3CA 1UZZA 4RYDA 1RUOA 1EY2A 5DAPA 4FTEA 3OUHA 1VMHA 2W39A 3OEAA 1VPHA 5F6LB 2VMIA 1KJLA 3M3CA 2A70A 1JZ5A 5FXXA 2MPFA 4RR3C 2TUNA 1RYYA 1YYNA 5FXWA 1V70A 4TSVA 1JYCA 3U14A 3NNGA 3U75A 3VBSC 2WDBA 3I2JA 2VECA 3IT8A 1VBB1 3KZ4C 3NSTA 3VGIA 1SFYA 3H7YA 1Q8SA 4U2AA 2D3PA 3MO4A 2P1BA 1WMFA 4FT8A 1XPWA 4LT5A 1PZ9A 5HCFA 3HT1A 5I8TA 5A33B 1GZ9A 1W6NB 2ZOEB 1RUJ2 4Z1VA 5A1FA 4O61A 2VZTA 2ZJCA 4AVAA 3WCRA 1OA3A 4QHOA 3ZXJA 2NMOA 3POSA 4ZY9A 5C8WA 2CAUA 3NAPA 2A3WA 3R4UA 4AOCA 4ARXA 5JZGA 2K0GA 1C4RA 5GLWA 2E26A 1RINA 5DDJ3 3WUCA 3H8RA 2WN3A 1MEC1 4MGIE 1XNAA 4PLOA 3MIBA 2DF7A 3SCHA 5C4WC 5FY0A 5FXVA 4I30A 1TEIA 2CDPA 2GC3A 4Y33A 1RUJ1 5GM0A 1MQTA 4KNCA 5K0UA 4XF4A 1HRV1 5BNPC 1ULPA 1RL3A 4ZHNA 1QQP3 4HETA 4UF0A 5ANQA 3BTYA 4QX7A 1AVBA 1EAH1 1O6UA 1O8SA 4JRLA 2QKDA 3GBFA 3LDRA 3OG2A 1W06A 4L92A 5DPNA 5FYIA 3G6JB 4EV0A 1JZ7A 4KQ7A 3I3DA 1X9TA 5I8SA 1GNHA 1Q3EA 4LBQA 1COV1 2VMEA 3KVBA 4TLFA 4C1WA 3RYKA 3LA2A 1NUKA 1ENQA 4XUNA 2P5BA 2TEPA 1SFPA 1Z7S3 1LJ7A 3ACGA 3BOPA 2OPKA 1J3PA 2VZ1A 2EXJA 2BGOA 1N1SA 5AVPA 5SV5A 3LWCA 3ZSMA 2J22A 1OOPB 1W6PA 2VVFA 2XLFA 2ZGUA 1S2BA 2ZMKA 4CDQC 1GZCA 4KWLA 5BNPA 2XUMA 4YVSB 5A3UA 2XJTA 3S5QA 2W1WA 4YPJA 2V09A 4OFGA 4AQSA 1JUIA 4FCAA 1Z0HA 1QJU1 2VQ0A 1W6MA 2WFF2 2YBKA 4XW3A 3USUB 4RQPA 1ACCA 3HIFA 2WZR1 1D0GA 1PO22 2WINB 2EVXA 1G6NA 1JYXA 2LM3A 3T2OA 1STMA 4HKLA 3DECA 1BCXA 1Y3TA 1LGNA 2D5FA 4OI2A 2KR2A 3MZHA 4A3XA 1QJU3 5FZGA 1ZZ6A 1W9SA 1YQ2A 4H2AA 4COVA 2KA3A 2PHXA 4FPEA 2YY1A 5DZFA 1CZVA 3RWKX 1JBCA 1FNZA 2AEYA 2PHDA 1WLDA 2ZMNA 1UZVA 5FZFA 2EA7A 4FQZA 4IXLA 2AZ5A 2C5DA 4K9SA 1KRIA 3AL6A 3RJRA 1QJZA 4BU2A 2A6XA 4IEOA 4QB6A 4IESA 4H7LA 2V4VA 5HPOA 2VM9A 4JX0A 5F5QA 4D6QA 1VBE3 3DGTA 1JYVA 3PNAA 1F9KA 3ZN6B 1ZBE2 4YGCA 2P3IA 2VQUA 2FQPA 2O0OA 1A8DA 3AVRA 1AF9A 3C3VA 4IUGA 2EAAA 2WJSA 4LLOA 2VNOA 3OPZA 4ORFA 4QD2A 4QXCA 2ZEZA 4QT6A 3WP6A 4C90A 2BBAA 4EWDA 3UJOA 3M4FA 1HQLA 3AP5A 3PU8A 3FHAA 4QQ2A 2B4KA 3OGVA 2DCKA 2HEVF 1HRV2 3PMEA 3KMHA 2JKBA 1RVF3 4I2OA 2B9UA 4FPHA 5FZOA 4LITA 2YFUA 1XYOA 3LAGA 5FPLA 3DXTA 4NWVA 4XVHA 5A7WB 4FSJA 4WM8A 3DPRA 2Z79A 1ZVFA 4ATFA 2WC2A 5JIAA 2G1MA 4Q4V2 3PU3A 2R043 2Y0IA 1OH3A 1ZZ9A 5JVVA 3U0ZA 3J7LA 1AXKA 4UW6A 2JG9A 1QXJA 4CEWA 5IVYA 4PQQA 1NLSA 3UL2A 4D69A 2ORZA 1SACA 4RS5B 4HXCA 1AR71 1DQ6A 3T4HB 2GMMA 5FP8A 4KMQA 4GWNA 1IS5A 2QCSB 4QPIA 4XF9A 1CJPA 4M3CE 4YW1A 1DGRN 3NQHA 4J25A 4YW3A 5J7MA 1R1A3 4N53B 3FZ3A 1UXXX 5C5TA 2YU1A 2Q0AA 2ET1A 2A6ZA 5C70A 3ENRA 2VE1A 3T2QA 2QQIA 4HANA 4L0PA 3WQ7A 2WWUA 1VBB3 5FZEA 4LBOA 4AVVA 2J42A 4IEVA 2QQMA 3S0MA 3OUJA 4P5HA 4XJUA 2VOTA 4UAPA 5L73A 2JX9A 3VBUB 3FN9A 3VHOA 3M2MA 4DXZA 1MPXA 2MNGA 2KXLA 4AVBA 3LDKA 4GA9A 4A44A 1KDKA 3QLQA 4IGQA 4DY5A 1S2EA 5A6XA 1F31A 1XB9A 2DBNA 1HW5A 1NXMA 2V5DA 4HZFA 3UJQA 3K48A 3P3PA 3FLPA 1UWWA 4L9BA 4BISA 5LA0A 3Q8BA 4WVMA 3VLBB 1LU1A 3TNQA 3OBRA 1G9AA 3CDZB 2WNUC 1NY71 2BVVA 3KD4A 1W2NA 1UY2A 1O8PA 4KWUA 3HT2A 2Z4FA 1AR93 5C33A 2CWSA 2SBAA 2WNVA 4M4RA 3D0JA 1AJKA 1ULDA 2WAOA 3LIHA 3M7AA 1W0NA 5BY5A 1MS0A 3AZXA 2RE9A 1QOTA 2VTXA 2R0HA 4QPGC 3ZN5A 3E97A 2HWF2 3S5AA 1W2AX 4W50A 3ZLIA 2WYSA 3R4SA 1B35B 5ACA1 4LHSA 4Q1RA 3ZYPA 2RM22 3O5SA 2Y6HA 1UN1A 3EYPA 4XAAA 4HPKB 4GALA 4DS0A 1GR3A 4AQTA 3AX4A 4QPIC 1NOVA 4AI9A 2JDMA 1DYOA 4PQ9A 4W8JA 1DIWA 5FPVA 2DVGA 4NRQA 4M00A 1RUF2 4DPNA 3K3OA 4P14A 3WHUA 3BIEA 2ZGKA 1PHMA 5DUUA 3VHNA 4CXXA 5C9AA 2BW8A 4D7TA 5DZGA 5FZKA 1PO23 4FQ4A 4CEWC 3V0AA 3IM0A 1XNCA 4C0HA 4CCLA 3M8LA 5BNOC 3NNLA 2OYZA 3MUY1 3ZPOA 1HRI2 1U5YA 2VZRA 1YIPA 4I0BA 1OHFA 4Q29A 3ATGA 1OMIA 3RMXA 1O5UA 2C24A 3RNSA 1ND3C 2WFF1 3N9QA 3PMSA 1ZRDA 4AEJA 2WABA 2Y38A 1OF3A 1TMF1 2GC0A 2WSUA 5I93A 1GP6A 1FATA 1X36A 2PLV1 2WSVA 3GF6A 4NRPA 5LBCA 4CCNA 4M01A 3SCGA 2YROA 1V6MA 3WG4A 3JQWA 5FZAA 2YV8A 2O14A 1KITA 5A7SA 5F3IA 4CEYA 2YU2A 4EWAA 5ACA3 5IVVA 1Y4WA 2BU9A 4XTPA 1AR63 1R081 1NKGA 4B1LA 5E6HA 3I59A 1GQHA 4AHXA 3K4DA 4GXLA 5BPXA 3RQ0A 4CCKA 2IXCA 1K5MB 2A3XA 2PMWB 5BXXA 5A7QA 2WNEA 1OOPC 5F5AA 4CCDA 4IV1A 4P02B 2ADEA 4QGMA 2ZZQA 3ZYJB 3ZFGB 4D3WA 4ES8A 1HLCA 1TNRA 3T4VA 1UX6A 3SC7X 1ND3B 4IEYA 5LB6A 3MPBA 2HWE3 1O4YA 2Y0OA 5E88A 3USSA 3WG2A 1PGL2 2YXSA 4P9JA 2RS51 2ARCA 5L7OB 2EIBA 3HD8B 4URTA 2YUEA 5JPNB 2PHUA 3GALA 4JGZA 2XPJA 1O3TA 2VZSA 2BFUL 2UY9A 3AKPA 3K2OA 2VZPA 1PX4A 2ZGMA 3AKQA 1BK0A 2Q4SA 3AYDA 4IEZA 4XFFA 3ZFEA 4P9WA 3R0RA 3BTAA 4Q4Y3 2IFRA 3FLRA 4FOVA 3PUAA 3ZIWA 2R042 3MIEA 4PCRA 4BQ2A 3H8UA 2HEYF 1MS3A 2D6PA 1Z78A 4QPWA 3N7MA 1QOSA 1B35C 2WT2A 2XBO3 3J8F3 3N3HA 4NIIA 4OI4A 3HQXA 2R16A 5E16A 3VKFC 2B5HA 4UYBA 3RJ2X 2J1VA 3AYEA 1IG0A 3LPGA 5T5JA 1H8TA 1VAMA 1OPMA 1RUH2 1ZBA3 1ZRIA 4OLLA 3U37A 3WDUA 4E27A 5HCAA 3ZYFA 3K75B 1HB2A 3U11A 2DYCA 1OA4A 4GAZA 3H9AA 3KV5A 4JDOA 4KBZA 1AR61 1R083 5FYYA 5ABJA 2K9ZA 5CFDB 1H6YA 2DTWA 2WS91 1QWRA 2GN3A 5FYCA 5ISLA 1MZEA 2VXJA 4FI9A 4NPLA 2QDNA 1RUF1 4OCTA 3AP4A 2DCTA 5K4LA 5C9AC 4MXWB 4AFBA 4QB1A 4ONUA 1F5JA 3ZN6A 2NM1A 5FLHA 1RIRA 2IC1A 3KWVA 5EYXA 1NX9A 3NRUA 4MGQA 4NOTA 2YC4A 1PGW1 2W9XA 3M70A 4KWJA 2E7TA 2VQAA 1QEXA 1CX1A 4N8MA 1KS5A 4IQPA 3VBHA 2I07B 4XBQA 3BODA 4NPRA 4S2DA 5JAXA 2FCVA 3AKRA 4PBPA 3W5NA 2FHRA 3N9LA 3W21A 3VHPA 3IIIA 3PLQA 4XUQA 2R7EB 3SLIA 4TTGA 1LKNA 5JSPA 4GJYA 1YEWA 4N53C 5J36A 1V9U1 1VBD1 1DF0A 1WCSA 3MF6A 4WVZA 4YZ3A 3WF1A 4AEDB 2JE8A 5GLZA 2BFUS 3H1MA 2RS31 5DAXA 3U07A 2XR4A 2JE7A 4JGYC 5J98B 4QXBA 3E6CC 1CWPA 5DMYA 4YVWC 1SQ4A 2JDZA 5JIUA 4CU8A 4K8RB 2WS93 4ASMB 2VMHA 5A7OA 3VBSA 4R9CA 1RHI1 5F5IA 5JCTA 4CCEA 1GSLA 3RVHA 3PVNA 3BUCA 1T2XA 4QX3A 3O1TA 1E5HA 2MEV3 1UX7A 4AHZA 4YW2A 3WQ1A 1GLHA 1US2A 4N53A 2DUQA 1W8WA 5HXMA 3V0BA 4YZ5A 1AX2A 2BWCA 3GNEA 3IN9A 3QOPA 1ZZCA 3ILNA 4JRAA 1CIWA 4LIUA 1WA4A 3ACLA 3M3IA 4IEQA 2QZ3A 2E31A 4Y4YA 5DZEA 1DFQA 4AI0A 3AZVA 1SG3A 3HQRA 2W1UA 1XNTA 2H6CA 3ZYIB 4R52A 2K46A 3I2KA 1JTZX 3OGSA 4PIXA 5FV3A 1ZM1A 3AFKA 4LE4A 3B93A 3O1UA 1UYPA 2HLEA 1XYPA 2ZX3A 4MOAA 3GZUC 2ZHLA 4YZ2A 1LR5A 4WVMB 3LPFA 5JDBA 4NUBA 2VBPA 5C8CB 1QQP1 3BYWA 4Z2WA 4AFMA 3MICA 1RHI2 3SKJE 5ABJC 1W0OA 4HFSA 1YO8A 2VQTA 4GKXA 1AR83 2D98A 2XBO2 3NNJA 3B3QE 3DV8A 1KGYA 4EYUA 5FWEA 3QCWA 2ARBA 4LBJA 2RS53 3GCXA 3TEZA 3W5MA 4XXAA 1N3PA 4XDOA 2LALA 2W91A 3KGZA 2W2IA 2PHFA 1B35A 1CQ9A 5H9QA 2RMU3 2C9AA 5D2AA 1G9DA 3LFIA 2XWJB 5J37A 4W6XA 2C9KA 2AGSA 4FPGA 2VW0A 1AR92 1O7FA 5K0UB 4A7YA 1BMV2 3BU7A 4PDWA 4COUA 3UV9A 5AFBA 2RVAA 3C7HA 2BV4A 4LE3A 2WO7A 1H0BA 2XVLA 5FMCA 3WW2A 1REEA 4GB31 2RJKA 1GUIA 2C26A 5KXBA 2IFWA 5A3WA 3HWJA 2HKXA 4GMP1 4MHUA 2Q1MA 5FPAA 1IPSA 1W6OB 3J4UH 4LBKA 2DURA 3JB4C 1V00A 3R05A 1D0HA 4N7IA 1Q56A 4BQ1A 3VD5A 1BK1A 4I0WB 3AZWA 1RMU2 2Y8KA 5F39A 5FZHA 4MGYE 3AZYA 5CKQA 1SBEA 3ZR6A 5KHGA 3FFQA 3D3AA 2UU8A 2LRPA 4CEYB 5IWFA 2PHRA 1VAVA 3K4AA 2A1XA 1YI7A 4AI2A 3NO8A 1W2UA 1QXRA 3I59B 1GICA 3K51A 5FKCA 2VUAA 3OEBA 1DLLA 1S0DA 4GQ7A 5A80A 1K5MA 3O1OA 1FPN1 2G9ZA 4QM8A 2VU9A 3ZSEA 4CDQA 2RS52 4RD7A 2GAUA 2UURA 1RMU1 3CHXA 3UGFA 1R091 2GC1A 1RUG3 1ASJ1 1RUD3 2ERFA 2CYFA 4CDWB 4XJ8A 1WZXA 3KT4A 2VZOA 5FK8A 1I9RA 1HDKA 3ZYGA 2Q8DA 2LUWA 3O1SA 1YFWA 4JTOA 3KF5A 2HWD2 1VRH1 1VB4A 4MV2A 3T09A 1EAH2 3BB6A 2R6QA 3NWKA 1VBC1 4OYUA 3A22A 4JGZB 4WBBA 4JQRA 1HN1A 4D6SA 1XNBA 3NKGA 5FP9A 1APNA 2YHJA 1URXA 2RMU1 3UKTA 4BA6A 1AZDA 2D3RA 5FZ0A 3RS6A 4CE8A 1QHDA 1GOFA 2FDHA 4A4AA 3GZTB 1ULFA 3OY8B 3RZMA 1LGCA 3POJA 3QH7A 4HN0A 4CDXB 1VBE2 2O8OA 4AQ2A 2WT0A 4EQVA 2IXJA 5HBAA 3OD4A 2EXIA 5FY4A 4I09A 1LTEA 3Q9OA 5CISA 1YQ6A 3QBQA 2B39A 4EN7B 3ACFA 4F7ZA 3B00A 2OUHA 3IB3A 5IK5A 1ENXA 2NZ9A 1PIV1 3VZOA 4IERA 3VBRA 1LHNA 2QTWB 4CEWB 1G9CA 5DG1A 3ZDSA 1UPSA 1OKOA 3ZPYA 4XBLA 2HWB3 4RL7A 1NLQA 1XJAA 4UFIA 4AL9A 1BBT1 5GZFA 1J59A 3WW3A 2RDRA 5FIXA 5GLVA 4EJRA 2QQJA 5GKAC 2XLAA 2B9VA 2XJSA 1BZWA 3FHIB 3W59A 3WUDA 4EROA 3I8TA 2PLV2 2R071 1E57A 1RUE2 4CU9A 2DCYA 5DXDA 3OJBA 5FZDA 5F8PA 3DYMA 5EV7A 1PNGA 5JXHA 2WZPP 3ZXLA 1C5HA 5IAVA 1FMD1 4YW4A 5F7UA 4DEVA 1I1EA 2CNAA 5BNQA 3BTXA 1VJ2A 1JZ6A 3VD4A 4AEDA 4H55A 4CCCA 4CDUA 3RSJA 4V2WA 5LWBA 4QKBA 4BLIA 1FV2A 3EBRA 5F3GA 4ZXEA 2Q8OA 3RZHA 1JW6A 3LA3A 3BTZA 1J3QA 4NRMA 4WM7A 2NLRA 1UNBA 4PIYA 4B8EA 2HWF1 4CEYC 4A7ZA 2ZS6B 4H7MA 3MV11 3EMRA 4WZCA 1OQEA 2VVEA 2HWE1 2Q30A 1US3A 1LAJA 1G9BA 1WCUA 1XNDA 1DGWA 1OLRA 3FBMA 4LR4A 5JPMB 5IAXA 4IE0A 3UETA 4D0QA 3BU0A 1H1IA 3J26N 3CBNA 4UXAA 2IZWA 2BGPA 2JIJA 5A6YA 1POV1 5FZ9A 1QDOA 3WW1A 1CR7A 2JDAA 3APBA 4UOJA 3VBUC 4LBLA 3OYWA 3V0BB 4D7SA 2DDUA 1W8UA 2WAAA 2DVDA 3LDBA 1QMJA 4AEKA 2YGMA 4A6OA 4AGGA 1TE1B 5BNOA 4XYXA 4BXFA 2JECA 1VBB2 1NCRC 1C8NA 3WD5A 2WNUB 1S55A 3OGRA 4Y5TA 5LA9A 4AHWA 2VD7A 5I0RA 5JLVA 3WW4A 3BI3A 2FZ1A 1KXGA 1SLCA 2VOWA 2BVBA 1V6JA 3ITQA 4C8DA 1QY4A 4Q27A 3N35A 4L2NA 3ROUA 4M0HA 3EQEA 2WA4A 2EIDA 1GBGA 4OUSA 2GNMA 4S2GA 5FZ4A 5T50A 3WG1A 4ZKTB 3V0AB 3C8XA 4QB2A 3ZSJA 1VR3A 2H0VA 4M3CA 1ZBA2 1CZSA 1N47A 4QU2A 4TWTA 1FNYA 1NCRB 3MGUA 3T30A 4MG2A 1XE8A 5CA6A 2VUJA 1POV3 2XONA 3NNMA 5CFCA 2J1SA 2XDVA 1AR72 4LXLA 4XF1A 3RG0A 3ZIXA 2VZUA 3J8F1 3I3BA 5JOWA 2WNOA 1N3QA 1X8EA 3KV4A 1UKGA 1JHNA 4Y3OA 2TBVA 4Y5SA 2EIGA 2C0ZA 1J1LA 3AFGA 2HWF3 1W05A 2E32A 4KI5M 3IWZA 2E33A 2JDHA 4Q0SA 1VRBA 4NE9A 4CP9A 2YFZA 4GZ9A 1ZRCA 2BNNA 4N90A 2R30A 3I2IA 4PF5A 1MS1A 3EB7A 3LIGA 4XE9A 4Y1VA 4JGYA 1ST8A 4IE5A 4XZPA 3KHCA 4IV1B 3S7EA 5B4NA 2VZVA 3FBYA 3SNMA 2ILMA 1IS6A 3DXUA 5HCHA 1JUHA 3CNAA 4YM1A 2VCCA 2AUYA 4CP2A 1TQ5A 5LEKA 3VBFA 2XKPA 3WNXA 2UWAA 4MHRA 2X05A 4OMCA 3LCPA 2W08A 2ZPXA 1YXWA 3LKJA 4YG6A 1OI6A 4COYA 3ETPA 3CO2A 4OHXA 2DTYA 4NR1A 3E6BA 5FUPA 3VZNA 2CWMA 4XHBA 5JOZA 1H2NA 1XC6A 2QJVA 1HB1A 1AR81 1W99A 4AXOA 1SEFA 1GP4A 1LHVA 2VL4A 4XMIA 5A3OA 4F8AA 1ZREA 1D4VB 4IL7A 4JVAA 2ZKNA 1NT0A 1LOCA 1ULOA 2FBEA 4KGGA 3B01A 2FDJA 3MIGA 2VNVA 1YJLA 4ES9A 4HG6B 5DQ0A 2CY6A 4YVWB 2J1UA 4AI3A 3HN1A 1J3RA 3ZOIA 3ZXKA 1ZZ7A 1PVC2 1YFYA 4JTNA 1Q8VA 2WFF3 3AMPA 5T55A 1QJY1 2PELA 4YZ4A 5FMDA 1S0EA 3OBAA 1QJU2 4NJ4A 3URFA 4N9IA 3BCWA 3MV01 5A33A 2WZR2 4Y24A 5JR2A 3ZFFC 3HMYA 4E2QA 3CJXA 4HBNA 4K20A 4XACA 3I3EA 1MZ5A 1RGSA 3NAPB 3ECQA 4Q0VA 1YQ8A 4CPBD 1BYHA 2JDPA 2FDFA 3QH6A 5EJ3A 3PVEA 3EO6A 4P5YA 1NYWA 4PI2A 4PF1A 4FPLA 2X5IA 3MYXA 3POFA 4LTAA 4CDXC 5A3MA 1W8HA 1XE7A 3A4UA 4NAMA 4OI1A 3UGHA 4A41A 1DDLA 5A3PA 1KFXL 3AVSA 4QXKA 1IPKA 3NJVA 3VD9A 4FPYA 2BUKA 3H42B 3WNPA 3AXDA 4KH9A 3CJIC 4FP3A 1E5IA 2RR12 1OLME 4B7EA 4CTEA 2D6MA 4RFRB 1RHI3 4UF0B 3LZZA 5JR7B 4CUCA 5KHJA 4JDMA 3TOJA 5L19A 4NIDA 4QGNA 1CPMA 5CFDC 1NZIA 1WD3A 3T1MA 4B1MA 3T0AA 2RDQA 4MH0E 5CVRA 1AX1A 3H1YA 3WY6A 4DNYA 4NAOA 4K7JA 2CTVA 3I54A 3N36A 5FPUA 4G4FA 4CXWA 4AAPA 5A32A 1P8JA 4FOYA 1S0GA 2WO1A 5JXIA 3OCPA 3JQXA 4IDZA 2IXLA 2PHWA 3AMQA 4O9EA 2VC9A 1FXZA 2PHLA 2WBKA 2BEOA 4PDWC 4ZU4A 5FYUA 2Q8CA 1J1TA 5BNPB 1LNSA 2OQ7A 1ULEA 2VR4A 2JD9A 5E8AA 3WP3A 5C4WB 1UCXA 4RR3B 1R092 1OUSA 3RDIA 3USUA 3V65A 4N43C 4KWKA 4COWA 3E5UA 1REFA 2G19A 3UESA 3PVBB 2V73A 3DN7A 3MLLA 1VBC2 1AUYA 3GXUA 4KG0A 2PFWA 5CB7A 2QQLA 1GANA 2ZEWA 2KD7A 1DGWX 2WLPA 4J1WA 1DZQA 1GNYA 3C7EA 4Y26A 5GLTA 1LOFC 1BJQA 4Q0QA 3JXSA 4QKFA 1Y9QA 2RG4A 2R072 5A7PA 1QXPA 1HRI1 2PAEA 1AR73 2QVSB 3ZFGC 1PK6A 1BHGA 2P17A 2PHTA 2VNRA 3IPVA 1DBNA 1XE0A 4I3PA 4UT5A 5APAA 5FBJA 3VKNA 4AGVA 4Y22B 2GU9A 3RRDA 2P34A 2DV9A 2VOXA 4Q26A 1H2KA 1A8MA 2JG8A 4Q4X3 1DYPA 1YLLA 2JDUA 4DOUA 5IT6A 4XHXA 3C7GA 3OOXA 4QKNA 4WM7B 4AFDA 1OLMA 3SH3A 4OHVA 4DXSA 3WOGA 1QJX3 2D93A 2VY0A 3AJYA 1CJDA 3EXUA 1FOD2 4DFSA 1A78A 1WLTA 3RYRA 5LBFA 2FCTA 5E89A 2OVUA 1I5PA 4BDVB 4BQ4A 2MHFA 3NAPC 1UIKA 3H0OA 4N7UA 1JU3A 3ZSKA 5T52A 1ONAA 3KVAA 5FTTC 3ZFFA 1EAH3 3GYDA 4XEZA 5DDJ2 3OYWB 3MIDA 1Q43A 1N3OA 1EYBA 4ISRA 1NE6A 2P2KA 2EXKA 2D97A 4J6GA 1KQRA 4NVPA 1W8FA 3T0DA 3OGJA 2WNUA 1W6QB 2P37A 3JZVA 1TME3 1YI9A 2ZZJA 4QDRA 1LODA 1PO13 1QJFA 4BK5A 3TEYA 1G86A 2JG9B 2D3SA 4AI1A 4NWWA 1FMD3 3ZMNA 2LW8A 3SH5A 3I3QA 4BE3A 1RUI2 5HCBA 4DRRA 5FY5A 5J1XA 3JBG1 2IXKA 2XJVA 4XIKA 5FUIA 1PK6C 2FD8A 1TMF2 2D6OX 5KXCA 1PVC3 4NIHA 4FPCA 4E4ZA 1AL0G 1H30A 1FOD1 2PQSA 4DUWA 4DIQA 1O3RA 3THPA 1ASJ3 1RUG1 5FBZA 3I2GA 3NV2A 5LATA 1DYKA 3I2FA 4YARA 4NHXA 3VBUA 1Y43B 4NIAA 2HWC1 3WP5A 5KWRA 5FYBA 1QNWA 5KC6A 4IEPA 1FPN2 3S6PA 2P6CA 3SXWA 2DU0A 1CAVA 1HXS2 4RHV2 1H1AA 4ZZ8A 1W2TA 3SISA 4XBNA 1V6NA 4ZS2A 1SLIA 3W20A 4WVWA 4Z2AA 5FR3A 1UY0A 2BERA 2DUOA 4QXHA 4UFHA 5C3OA 4TXWA 4R9AA 1LEMA 4XMAA 3INAA 2E63A 2LS6A 4LJHA 5JWPA 2VO5A 3CQOA 3DPRC 5LASA 2GMEA 2R1BA 1D4M3 1Z7S2 1ZZBA 2AH2A 2VMGA 1JXNA 2XG3A 1YJKA 4HSJA 4LA2A 4YW7A 5H9RA 2WNVB 1W6NA 3N4MA 3D8CA 4H14A 4UW5A 4QDSA 5CKNA 3RI9A 5C3RA 3O7OA 1W8ZA 5DAQA 2ES3A 4JAAA 3TB0A 1VAKA 4BIFA 3PVOA 3VB9A 3ZXDA 1S4CA 3ZYBA 4Z82A 5KXDA 1O91A 3AL5A 3C7OA 3VL8A 5LZ6A 4BQ3A 1CX4A 2ZEXA 4JKLA 3BVCA 4GH4C 2VNGA 4LBNA 5KXEA 3UKVA 4XURA 4Y1XA 3U78A 1R093 2A6YA 2JG8C 3D5OA 3DYPA 5BNNB 3P1IA 2VCMA 3P6BA 3CL1A 1ASJ2 3WX5A 4GKYA 2C6SA 2YBSA 2Y6FA 4QU1A 2JWPA 4MUVA 3Q8EA 4QX5A 2RS32 4EN0A 5C9AB 2VBBA 4QKDA 4K1YA 3VDAA 4UBHA 3VBRC 5IVCA 5L9VA 3BIWE 4BLJA 3O1RA 5D8AC 3LSEA 1UZ0A 5FOJB 3ZR5A 2PTMA 4QQPA 5EIYB 2A6WA 3B5LB 5FFOC 1DCSA 1RXGA 4Y20A 4DUXA 1BVVA 2WWSA 3FMGA 3H3UA 3TNPB 1ULGA 3FL7A 3PUQA 2FDGA 2W52A 5M0TA 3ZN4A 2V4AA 2B8MA 1NLRA 1C8M2 2UWCA 3ZVXA 3VBOA 3T1LA 1K45A 1SBDA 2VVDA 1QNYA 3VZLA 1O59A 4M3CF 2OW4A 3V56A 4AQ6A 3KQ4B 4Q8KA 5LRSA 1M06G 1XNKA 3OUIA 1DG6A 1QGLA 4YWAA 3NV1A 1V6LA 1AR82 4PHZA 4TLGA 1RUE1 1ULCA 3GJAA 1HXS1 4RHV1 3VUOA 2WS92 4LQRA 4NHKA 4I01A 1FOD3 4IV3B 2R0FA 1QU0A 5L7OC 2OIIA 4XAEA 1NE4A 1AXYA 5FZ7A 1PVC1 1H8VA 1OBNA 3A0KA 3RZJA 3ZMOA 5JXGA 1R1ZA 5FO9B 4LO8A 1EV12 1X8MA 2J1RA 4XJAA 3SMHA 1GZWA 2GDFA 2WA3A 2W1QA 3FUOA 1PMJX 5A32B 3N9MA 5FQ0B 3WLUA 4HVQA 1H9PA 4QX2A 3X29B 4FAHA 1VBA3 3CJIA 4AFCA 1X7NA 3P3NA 1B09A 2O1QA 3J7MA 1DZTA 2YC0A 5FWJA 1K5MC 3PIJA 4IE6A 4AF9A 2QDRA 2C1FA 2BYVE 2RS33 2ZABA 3CF6E 1HKDA 2DCZA 3DKWA 1YCIA 1WLCA 1IQDC 5T54A 2RJLA 3J7NA 5FMBA 2RS11 3IMNA 2QE3A 2FCUA 1ENRA 1LHUA 5I0TA 4INDA 5FZ6A 3ZDVA 4A6SA 4P9LA 1D7PM 5DABA 5GJ6A 4YGDA 2W92A 3ASIA 3POBA 3ZSLA 3ES4A 4UFJA 4AAXA 3AK0A 4YM2A 1WMDA 4RSUA 4P9YA 5FP7A 2JKXA 2ZEYA 1JMUB 5GZDA 1MVQA 2ZA9A 5IVFA 2HJIA 4IETA 4YFWA 2CGPA 4LBMA 2WKKA 1NG0A 2RJ2A 4DO0A 2A3YA 1GKBA 2IVJA 2SLIA 5CFDA 3RZLA 4Q5OA 4XUTA 4XF0A 2Y64A 4DY3A 1VMJA 2CSGA 4HL0A 3O1VA 2QQOA 1OPOA 2DVFA 4Y22A 3VDBA 5IK7A 1OURA 1RUF3 4RS5A 5FPBA 1FV3A 5FYVA 4HT1T 1SFNA 4QWNA 5I8YA 1O3QA 4M4PA 1J58A 4IEUA 3VDDC 4QPIB 4XJWA 3RYPA 3PUSA 4XTMA 1GWLA 3H3ZA 4E8CA 1NCRA 1CIYA 4GULA 2VOKA 4K8FA 2G9GA 3T08A 4URAA 1JH5A 3VBHB 5JI9A 1S0JA 1CN1A 2G9FA 3A0NA 2RV9A 3VBFC 3NMBA 1NZCA 2IXIA 1AR91 2W1SA 1COV2 3MW4A 4PI0A 2EF6A 4LO6B 4J1XA 2NMNA 3M3EA 2D5HA 5F9TA 5FZMA 3F95A 3J9SA 3K46A 3VN4A 3NW4A 1QH7A 4RGGA 1IKPA 1W0PA 3WQBA 4PIZA 1UY1A 2DUPA 4AEMA 1W8OA 4D7YA 3WCSA 2OUJA 2GN7A 1WW5A 3K3NA 4LHNA 3U4XA 2GZWA 2VAUA 1GU3A 1AYM3 2VMDA 2VCBA 4YRDA 2PQQA 3DEMA 5J48A 1UQXA 2CGNA 1UPIA 2D44A 1SPPA 1TVGA 1YHFA 3E1F1 1Q5OA 2DBIA 3ALQA 5FPZA 5LY1A 2LROA 4GWMA 4IE7A 4V1PA 1C1FA 2XB6C 3IAQA 4MVTA 4LLFA 1RUI3 4LBQB 1UO9A 3AYCA 4KBBA 2R1DA 2AREA 4L8QA 5FY7A 3ORJA 5GLUA 4AW7A 5GZCA 2BOJA 4BQYA 5D8AA 4KGQA 1UOGA 5SV8A 5FYSA 3PTYA 2A7AA 1UL9A 1OXCA 2Z2SB 4FVVA 1D2SA 1CPNA 4M0NA 5CYYA 4XPVA 5D21A 3WP4A 4DEQA 3UT0A 4CRQA 1O4ZA 4E4DX 4OQ9A 1XYNA 1QF3A 1RUH1 5FZ1A 1O3SA 3VV1A 3TWIA 2XBO1 1IG3A 1QJY2 3MFCA 4LKEA 5LA1A 1DGLA 1PGSA 1PIV2 2BBVA 3QD6A 5EPAA 4CP1A 1JODA 2FMDA 4QX1A 3WVJA 2I45A 4B7KA 3CU7A 1UYXA 1QQP2 3K77A 3Q8FA 2ZGLA 1YUDA 3BN6A 1ZNPA 2YPDA 1FYUA 1OH4A 1KD7A 4KL1A 3T2TA 4NIGA 1HN0A 3MI8A 1W3XA 3GCWA 2RM21 2GSYA 2WL1A 4EN9B 1LB2A 1H4HA 1UOBA 5CFCC 2OQ6A 1AJOA 5C7GA 2WQ4A 2YGLA 2X5IB 4E2GA 5CZKA 3LQCA 4BOWA 1W90A 1Q8OA 2XJUA 1UZYA 5A1LA 1LOGA 2RS12 2UYAA 3OSDA 3ZXAC 4Q0PA 5C8CC 1QJY3 5IUQA 2ZGQA 4EZ4A 1QKQA 1LCLA 1VIWB 1W3VA 3KV9A 4HOOA 1A34A 3OB8A 1VBC3 3JD73 3OTFA 1OD3A 2EAKA 1SZBA 1BVP1 2CL2A 4QAWA 5BNNA 2ZX0A 2ORXA 3Q8CA 4HVOA 4OMDA 5KR7A 1CAUB 3ZM8A 1C5IA 1WMEA 3H8XA 3ZFGA 4V2VA 1G9FA 1LOAA 4FPOB 4XIOA 3LOIA 1YC61 3B9IA 5KHHA 3NNFA 4CUGA 4DZGA 2AEZA 4Z92B 2XKOA 4B4RA 2VG9A 1S0FA 3MEPA 1W6OA 5EJZB 5H9SA 4MGZE 2D6NA 2PAKA 3IBMA 2VZQA 2VJXA 4XQ4A 4K1ZA 1SLTA 2WIIB 5L36A 4UI9L 3WSOA 3KV6A 3WEZA 4WM8B 5EQUA 3ZFEB 4AHYA 1NY72 4QQHA 1YRZA 3FC0A 3RZKA 1UW8A 1PM7A 1SCRA 3D4KA 4KG8A 2VZ3A 5FYHA 5C3PA 1F4AA 3POEA 4Q4W3 1LRHA 4BPZA 4LO7A 4BHPA 1NA1A 3UGGA 3WDTA 2ZGTA 2W0XA 1WBFA 1RC6A 3IDAA 3NKTA 1UMZA 1OA2A 3ILFA 5FO7B 4CDUC 4AEDC 4DB5A 1MZ6A 4CDQB 2QNKA 3H1WA 5LCWL 3O1MA 1LHWA 2Y6LA 4S2HA 5L9RA 2E6VA 2P4EA 3OD0A 4HKWA 4CDWA 4DUVA 4XCBA 4AI8A 4CXYA 3T2PA 4YW6A 3G7DA 2OS2A 3MF9A 3WDVA 4FP2A 3JUUA 5FYTA 5CNAA 1VALA 3B9CA 2GMPA 4K3UA 1S0IA 3IPVB 3TEXA 3HJRA 1H6XA 2ZHNA 5FQ0A 3O12A 4AE2A 5FZ8A 4MXWA 4A7KA 1PGL1 2OT7A 1IHMA 4FOQA 2KM2A 4LHKA 1DQ1A 3CLPA 4EWEA 4Z8BA 2Z69A 1OLQA 4N9HA 1WW4A 2OZ6A 1QJEA 1RUD2 3WDYA 5IJRA 1H1MA 2ZBJA 4MLOA 4IEXA 2Y34A 2E7AA 1D4M2 3JBG3 1NQJA 4LOSA 1UF2C 1Q8PA 3PJQA 5IVJA 2A5ZA 2G4IA 2R061 3AP9A 3OGGA 4OQ8A 4LK6A 1JOJA 3CMGA 2ENRA 4OUMA 1FT9A 1VBA2 2CV6A 2RDSA 4FXGB 1WD4A 3BGAA 1KJRA 3HPNA 2CDOA 1NQDA 1BQPA 1HXS3 1MEC2 4RHV3 1RVF2 1N1TA 3A7QA 3KHBA 1NXD1 4JCKA 2VH9A 1W8NA 1Z7S1 4F83A 4OZOA 2Z42A 3OF1A 1W6QA 1UKRA 2JEMA 2PA7A 4BZ4A 1A6CA 3IDBB 2W68A 5FZIA 5H9PA 3WF0A 3VBSB 5CBLA 5JMCA 3VDDA 3ACHA 3U4SA 1AL21 4NHMA 2ZGOA 3ETQA 4YM0A 4XDPA 3ZFEC 4JHZA 4A45A 3O0XA 1RUC2 3FX3A 4X8NA 5LBBA 1CVNA 5KC5A 1J83A 5A7NA 4K6BA 1BXHA 2HWC2 3VKMA 2DVAA 2QQKA 3CKHA 4LMFA 2WQ8A 1C1LA 2R063 5DUWA 5A3LA 2CAVA 1FMD2 1MEC3 2XUEA 2R32A 3OPWA 4AFAA 5JXJA 2XQXA 4UBGA 4Y1ZA 1CAWB 2ZKLA 4G3YC 3VHRA 5A70A 5KBFA 5FMOL 2Y26A 5FZBA 1W6PB 1SDWA 3GHMA 3POIA 1W39A 4ZU5A 5GZEA 2ZGRA 2DFCA 1U5IA 2IXHA 1DU3D 4IV1C 4XFIA 3J7HA 1G7YA 3N9OA 1IGOA 2UYBA 4Q4Y2 1R64A 2OZJA 3JBG2 3U1XA 1I6XA 1SCSA 4TYSA 3F2ZA 5J09A 4RQPB 3A21A 3DUIA 1ZRFA 1RUG2 2WWJA 4LKSA 3KLSA 2AC1A 2XJQA 5EHDA 4PLNA 3KF3A 4XJZA 2WLQA 3PUIA 3OBZA 4X6QB 1XU1A 4NROA 1ZBE3 2ZAAA 4QM9A 3WG3A 4NPMA 4A42A 4C1XA 3PURA 2J1EA 5ANNA 3WV6A 1X82A 3NVCA 5EFUA 1ZBE1 1ND3A 3LEMA 2GNBA 1UU5A 4XABA 5CU1A 3LF7A 1D2QA 4U36A 1MS4A 3VD3A 1ZX5A 4BH9A 1VBE1 3IDEA 4GWIA 4XFCA 5BNOB 2BNMA 3FJSA 3SKVA 1JZ3A 3KT7A 4A2UA 1LHOA 5L7OA 4EZHA 1RUC3 1PGW2 4QMAA 4CYDA 4R9BA 5HI0A 4ET7A 1QDCA 3KM5A 2JDNA 3FHQA 3LGRA 4HLTA 5EWSA 1ND2B 3H3LA 5CEHA 1C3HA 5LA2A 2GC2A 5EP9A 3IMMA 4K21A 4E4HA 1L7QA 3GBGA 2PAMA 2ETEA 2CU5A 2XLGA 4L97A 3N7LA 4FAGA 1HX6A 3HR9A 5FDBA 2J1AA 4JKMA 3BALA 4Y20B 1HRI3 2I2SA 5JSRA 4XFGA 5LEJA 1POV0 2CGOA 1W9YA 5FMOS 4QPGB 5G04L 1GOHA 1CESA 4FFIA 1DQ4A 2AYHA 3NV4A 1JN2P 3GBWA 4BK4A 1PNFA 3DPRB 1UYZA 3HAGA 1WWYA 2ZMLA 2D7FA 2OPWA 4XFBA 1J84A 4OHYA 1OVPA 1WKYA 2JB8A 1BBT3 5DAWA 1MS8A 4ARYA 2W47A 1YNAA 1WUVA 3KSCA 1MVEA 2XL7A 3OPTA 4Y1UA 1W03A 4TZDA 2UWBA 1GWMA 4UFMA 2Y6JA 3TRSB 2FDIA 4OVEA 3ZX7A 1OVSA 3DCQA 5CAZA 1RTVA 1X50A 1W04A 4BB3A 3N7JA 1BLZA 4OI0A 3RI8A 4FTSA 2RS13 1WMXA 1LOEA 1SDDB 1CZTA 2JB4A 4FPFA 4K40A 4Q4V1 3I49A 2P6HA 2WRAA 2XJRA 1LECA 2F6BA 4GH4A 4HSLA 4NO4A 5B2GB 4LK7A 2RR13 4MZUA 4CA9A 4EE2A 1BMV1 2D43A 3AP6A 3KCCA 4XETA 4GIQA 3D0SA 3VBFB 3AC0A 4Q1PA 4AVSA 3UK9A 2YYOA 4MGKE 1O5LA 3NL1A 1S0BA 4EN6B 5F2WA 2QUOA 4GMP3 2ARXA 2XVGA 5DUVA 2XWBB 4HK9A 4WVVA 1ND2C 4XDQA 1WW7A 2VMCA 4OHZA 3I97A 2ZX1A 3R4DB 1EV13 2QZ2A 3O14A 3QACA 3NV3A 4LHLA 3HVDA 2BRTA 1JYIA 4YZ1A 4BQWA 3IDCB 3GJBA 3I2OA 4RQPC 5IHRA 5I91A 2XJPA 1A3KA 2JENA 1RUE3 3EJKA 1NA1B 1GZTA 3LFMA 4QDQA 5F1RA 3C7FA 1I5ZA 1WBLA 1N1VA 3LEIA 5F3EA 2HWB1 4ISQA 3WF4A 3N9PA 1E5RA 1UYYA 4HMZA 3AMMA 1BBT2 3ZYRA 1F8VA 4FFHA 1E5SA 4P00B 4LA3A 3LEKA 5IK8A 1L7LA 2WT1A 1DHKB 5EZWA 1YIFA 5LBEA 1SHWB 2FMYA 5FPXA 1RB8G 4GWJA 5FLJA 1AYN1 5JMOA 1HJFA 3KGLA 5F32A 1WGPA 2VOVA 2WO2A 3E5XA 3FE5A 3THTA 3MW2A 5HV4A 4Q4V3 4YGEA 2ZGNA 2E9QA 1F35A 4Q4X2 1PMIA 1DGRA 5BUVA 2IVIB 1T6BX 2VW2A 4P08A 5LW9A 5FYZA 4ASLA 3M3OA 4IW3A 2IUWA 4JZRA 1L7RA 1K5JA 3GGLA 4ZZ5A 5K7PA 3VKLA 1DQ2A 3LSDA 3MBWA 3M1HA 3P5BA 4LIVA 2VXRA 1LU2A 1F15A 1EUUA 2RMU2 3I2DA 3LEGA 4P9GA 4AYUA 2BZDA 1AL22 3R6SA 4CDWC 3MPPG 3PDQA 4YLZA 4QGLA 4LO5B 2N7GA 4DRVA 3ZKYA 1IOAA 5DAVA 1OSGA 1OFNA 4DINB 1VB2A 1F4HA 2VPVA 3JD72 4XQWA 3GHNA 3V64A 1RUC1 4CU6A 1RUD1 1TME1 2XQRA 2Y33A 2ZGPA 3TN91 3KCYA 4RN5A 5BV6A 3T0BA 2JDYA 1W9FA 3PL0A 4KU8A 3GZAA 1GNZA 1JI6A 3SHRA 4FXKB 2I74A 4LULA 3WR0A 4FOWA 1H2LA 2BP6A 2W94A 4PDWB 3K4ZA 2FZ2A 1TZOA 1AYM2 1X9PA 4QPYA 1UOFA 4YGBA 1PVXA 3EHKA 2YG0A 5FZ3A 2A73B 3FWEA 3JD71 4XF3A 4YSFA 2NPIA 5LY2A 3UNPA 3PHMA 2C4XA 1D4M1 1YWKA 4IE4A 3OBTA 4NMIA 4R4XA 5K8SA 2F4LA 2RR11 1W9TA 3ACIA 1R1A1 4FTBA 5A3TA 5FJKA 5G05L 1CAWA 2X29A 4MXVA 1FAYA 1IS4A 2ET7A 4CU7A 5I0DA 2FDKA 4HKOA 2RM23 1RJ7A 5C3SA 3HBKA 1S0CA 5ERLA 1CD3G 1POQA 3NJYA 1NAEA 1VRH2 5CADA 1W28A 3CIHA 2P3YA 1C57A 4ZPIA 3RMYA 2JG8B 1WCKA 5BNNC 5K0UC 1SMVA 1CONA 5AFEA 1PM4A 1QH6A 1V6IA 2GNDA 5TSWA 4FFFA 2NN8A 4AVCA 3S7IA 5CKMA 1PZ8A 2GNTA 4WM8C 5IVEA 5JSOA 3FFZA 1NCQB 2LTNA 1AYN2 4LOTA 4OHWA 4UW4A 4W65A 1PO11 2R073 2H0BA 2W46A 1W9WA 3I4IA 1S1AA 4HONA 1IS3A 4MSVA 1ALYA 1ODMA 3DL3A 4NHYA 4COZA 4YG3A 1EP0A 1PIV3 2QFEA 4XFHA 4C91A 3BKZA 4QHZA 2WNVC 2NQYA 3AKTA 5ABJB 2EALA 3WZ1A 5JZGB 1GOGA 1XU2A 2HWB2 4QX0A 1ZRRA 4SBVA 3ABZA 1CAXA 1V6OA 4XQDA 1QJX2 5F6KA 1JZ4A 4YM3A 4FPJA 1EPWA 4RGKA 1LESA 2RDNA 4BWOA 1K3IA 2ZCWA 1UZWA 2QQUA 4JQTA 2PYTA 4Q2FA 3RFRA 2VMFA 1XOYA 2OX0A 3JU9A 1HJGA 1ZZ8A 1MQTB 3UYJA 4AVTA 4BJ0A 4CVUA 2BOIA 5HV0A 3RZGA 2BQPA 3IZOA 3ZXEA 5FCCA 4WV8A 3SEPA 2YC2A 4QX8A 1HB4A 2X10A 3MFAA 4IGPA 2X5IC 3LA7A 4P9IA 1XXNA 4XOGA 5FYMA 4CDXA 5IFPA 5AVAA 5CG9A 2B45X 4D94A 2YZ4A 3LE0A 2K2SA 4PBOA 3RWNA 1KS4A 1OC1A 3AYAA 4HK8A 4X8PA 1G8WA 1GP5A 2YMZA 3FLTA 2W95A 1JS9A 1VRH3 4AK3A 2NP0A 3WNKA 5KHIA 3N9NA 3KT1A 1V0AA 1UMIA 3LB9A 2YPJA 1OOPA 1DQ0A 3TYJA 4UW3A 1ENSA 1RITA 2B42B 5T5LA 1NA1C 4YVSA 4EN8B 5B4XA 3WNLA 2X53S 4L11A 1UD1A 5FLIA 2BNOA 2PLV3 1AHSA 2UY8A 3DF0A 1RMU3 3J8F2 3VZJA 4ZXKA 4QHBA 4YVWA 3E5QA 3WF2A 1GWKA 2E53A 3D82A 1AXZA 4I3GA 3SITA 1N1YA 3VKOA 3CZJA 4B4PA 1MR5A 1XSQA 3KCXA 4R8HA 1MS9A 1IZ3A 4FBFA 2YB7A 4Q4W2 4JDNA 2QQWA 5IK4A 4LKFA 4FFGA 2E51A 2DCJA 3ZXFA 1H2MA 2QBXA 2W87A 3VZKA 1UIJA 1FPN3 3NJXA 4YNIA 3THCA 3MDPA 2QQNA 1PO21 2ZX4A 3HN3A 4YW5A 2Y6GA 4ASKA 3VL9A 2ZHMA 5J3UA 4DXRA 3PTRB 5JUVA 2VTXJ 2L9LA 5FZCA 3CZUA 4ZONA 4BMEA 2EXHA 2H6BA 1UY3A 5DG2A 4AGRA 3S30A 2WQZC 2HWD3 2WYFA 1Q8QA 3JCIA 3MHZA 3GM8A 2TNFA 1IQAA 2VW1A 4W6YA 3MUZ1 3ZXGA 4JKKA 4MGSA 4NN0A 4O7XA 5A3NA 3WT3A 1O4TA 3WDWA 4GB33 3U10A 1MQTC 2X8KA 2XHNA 4JHTA 1VBA1 4KU7A 2R49A 5T3NA 1JU4A 1MZFA 3B7MA 3ILRA 5C8CA 2R062 2Z5WA 1GQGA 1FX5A 4LORA 2XGXA 3TN93 5ACA2 3T3YA 3B94A 4XJ9A 4BMBA 2JICA 5A1AA 4GMP0 5F5CA 5JZGC 2WO3A 4TN7A 1T6GC 3WQ0A 4CCOA 1H8TC 1WW6A 2J7MA 1OQ1A 2XVKA 2DWRA 2PXJA 4W4ZA 4BIOA 4H3WA 3I7DA 1PMHX 4DQAA 4XCAA 1UAIA 3L2HA 4UFLA 5C5UA 2XL9A 3LD8A 5DUXA 5A7WA 1NCQC 2VUDA 4CUBA 4O65A 2Q8EA 5GZGA 1GYKA 3VBOB 1OUXA 3BPSA 3POWA 4N43B 1JZ8A 3GDBA 4L99A 4ATEA 3SCFA 3VDDB 3B02A 4RR3A 1F5FA 5BYNA 1RJ8A 1WA6X 1PO12 4AG4A 4CCMA 3FUQA 4YG0A 1TNFA 5JI7A 2A75A 4CP0A 1AR62 2GP5A 5CG8A 3H50A 1K12A 4META 3AJZA 4Q4Y1 3JB8A 2XXZA 3HQUA 4G9SB 5J96B 5C3QA 1OQDA 1AYN3
chains in the Genus database with same CATH topology
1SLLA 2JE9A 2HWC3 1M4WA 4CZSA 4GB32 3VBHC 4O9GA 3BPZA 1RUH3 2XH6A 4R9DA 4LUKA 4DMIA 4Q4W1 3W9AA 2R041 1RUNA 3KB5A 3UKNA 3B69A 1LGBA 1OKQA 3CJIB 4NHLA 1U5XA 3WXPA 4I0AA 3AMNA 1LEDA 2MEV1 4W6WA 5E1RA 2GALA 3MLJA 2RHPA 5EXOA 3W58A 4E9KA 1U12A 4RA0A 3AB0A 1MACA 4IEWA 1DZRA 1XRUA 4QQOA 3LOBA 3ME2A 2BTVC 3ZFFB 4JC1A 5JOYA 2DVBA 4Y5Z0 1REDA 1U0AA 4Q8LA 2O8QA 2AENA 2HEWF 2P3KA 2VGDA 2GH8A 2BPA2 1X33A 2B7YA 3MIFA 3IKWA 4IV3C 1SBFA 2ATFA 3TBDA 4BYYA 1V6KA 2HWD1 4HPKA 4E2SA 5LRRA 5AC93 1IPJA 3ST7A 1ND2A 2Q1ZB 4Z07A 1BEV1 4JGZC 3OY8A 1UU4A 1TME2 4Q0UA 1VLNA 5KHKA 4SLIA 2E7QA 1ZYBA 2D6KA 3NJZA 1NCQA 3AXEA 1SLAA 4AWDA 2MEV2 2ZGSA 2ZHKA 4QPGA 4E4SA 4I02A 2DU1A 2JXAA 3ES1A 1Y7BA 1CAVB 1GV9A 2YDEA 1GFF2 3VBRB 1YFXA 1ZBA1 4HN1A 2B46X 1CAXB 1DQ5A 4ZU7A 3MW3A 2AR6A 1W6MB 3N7KA 3ZO0B 2IWGB 3L9JT 3E6DA 1BEV3 1XQNA 1WLWA 3O0WA 1KFUL 2P3JA 5AC91 4GH4B 2ZTNA 2OA2A 5LK5A 1RVF1 4LBQD 5JPNB 3D6EA 4OULA 1C8M1 3WINE 3AZZA 3KS7A 4Y1YA 2BGCA 1IKQA 1C8M3 3TN92 3BOWA 1CGPA 2V5YA 3TAYA 3WDXA 3AMHA 5D8AB 1QJX1 1F2NA 1OFSA 4CDUB 5AC92 1AYM1 1KDMA 5T5OA 3MLKA 4RS5C 3POYA 1HQNA 1H4GA 2PN5A 3AM2A 3WHTA 4WZFA 4FO9A 4HVRA 4FPKA 1HRV3 5C4WA 4JV4A 4XILA 3VBOC 1VP6A 4RGAA 1LENA 3CEWA 3RPQA 5C6CA 5CIRA 4BCUA 4Q4X1 2DFBA 3ELNA 1BKZA 1LULA 4OZXA 4PJYA 5HXVA 1L3JA 1H8TB 4P9XA 2Q5TA 2QQPA 4B4QA 2F4PA 2WZR3 4C0BA 5EYYA 1PK6B 1RUI1 2NYYA 1BEV2 4R4ZA 4B3NA 4MYEA 1R1A2 1MS5A 2XHKA 4LEJA 1TMF3 5T5PA 5D1IA 1V9U3 1VBD3 4PLMA 3HBZA 5FRAA 1CAUA 2BWAA 4M3CB 1AX0A 3AP7A 2A6VA 3L2YA 4IV3A 2D40A 4YYOA 1I3HA 5CFCB 1HQWA 1OD5A 2JD4A 1S2KA 2ZACA 3M3QA 1COV3 1U5ZA 3RZZA 1LOFA 5FAXA 1GZWB 5GALA 4QQLA 3AKSA 1UU6A 5FREA 3IIAA 2GH2A 1HV0A 2VULA 2WFPA 2HWE2 3H7JA 1RUJ3 3SH4A 1FI2A 2D6LX 2ZAHA 5I0SA 1V9U2 1VBD2 4RFT0 4MX3A 1EV11 4N43A 2JG9C 4ITCA 1PZ7A 5JOXA 1HV1A 1QOOA 4LNVA 4WM7C 1WCDJ 5DDJ1 4JGYB 4XFAA 5I0UA 4YVSC 5K9YA 4F3JA 1SLBA 2HYKA 2ZX2A 1YFUA 1HIXA 3VZMA 1LOBA 5FO8B 5FOBB 4B29A 3O0VA 3C2UA 3KQRA 1C28A 2JJ6A 4LO4B 4LUMA 1R082 4X6RB 1ZA4A 3PJYA 4XXPA 4BM8A 1AL23 1H9WA 5LK7B 1EPZA 2A71A 4S2FA 1UZZA 1RUOA 1EY2A 4FTEA 2W39A 5F6LB 2VMIA 1KJLA 3M3CA 2A70A 2MPFA 4RR3C 2TUNA 1YYNA 1V70A 4TSVA 1JYCA 3VBSC 2VECA 3IT8A 1VBB1 3KZ4C 3NSTA 3VGIA 1SFYA 3H7YA 1Q8SA 4U2AA 2D3PA 1WMFA 4FT8A 4LT5A 1PZ9A 5HCFA 3HT1A 5I8TA 5A33B 1GZ9A 1W6NB 2ZOEB 1RUJ2 4Z1VA 4AVAA 2ZJCA 3WCRA 1OA3A 3ZXJA 2NMOA 3POSA 5C8WA 2CAUA 3NAPA 2A3WA 3R4UA 5JZGA 2K0GA 1C4RA 5GLWA 1RINA 5DDJ3 3WUCA 1MEC1 4MGIE 4PLOA 3MIBA 2DF7A 3SCHA 5C4WC 4I30A 1TEIA 2GC3A 1RUJ1 5GM0A 1MQTA 4KNCA 5K0UA 4XF4A 1HRV1 5BNPC 1RL3A 1QQP3 4HETA 1AVBA 1EAH1 4JRLA 2QKDA 3GBFA 4L92A 4EV0A 3G6JB 4KQ7A 5I8SA 1GNHA 1Q3EA 4LBQA 1COV1 4TLFA 4C1WA 3RYKA 3LA2A 1ENQA 2TEPA 1Z7S3 1LJ7A 3BOPA 2OPKA 1J3PA 2EXJA 1N1SA 5AVPA 5SV5A 3LWCA 3ZSMA 2ZGUA 2ZMKA 1OOPB 1W6PA 2VVFA 2XLFA 1S2BA 4CDQC 1GZCA 4KWLA 5BNPA 2XUMA 4YVSB 2XJTA 2V09A 4OFGA 4AQSA 1JUIA 4FCAA 1Z0HA 1QJU1 2VQ0A 1W6MA 2WFF2 4XW3A 3USUB 4RQPA 3HIFA 2WZR1 1D0GA 1PO22 2WINB 2EVXA 1G6NA 2LM3A 4HKLA 1BCXA 1Y3TA 1LGNA 2D5FA 4OI2A 3MZHA 4A3XA 1QJU3 1ZZ6A 4COVA 2KA3A 2PHXA 4FPEA 2YY1A 5DZFA 1JBCA 1FNZA 2PHDA 1WLDA 2ZMNA 2EA7A 4FQZA 4IXLA 2AZ5A 2C5DA 4K9SA 1KRIA 3RJRA 1QJZA 2A6XA 4IEOA 4IESA 4H7LA 5F5QA 1VBE3 3DGTA 3PNAA 1F9KA 3ZN6B 1ZBE2 4YGCA 2P3IA 2FQPA 2O0OA 1A8DA 1AF9A 3C3VA 4AI8A 2EAAA 2WJSA 4LLOA 2VNOA 3OPZA 4ORFA 4QD2A 4C90A 4QT6A 3WP6A 4YFZA 4EWDA 3UJOA 3M4FA 1HQLA 3AP5A 4QQ2A 2DCKA 2HEVF 1HRV2 3PMEA 3KMHA 2JKBA 1RVF3 4I2OA 2B9UA 4FPHA 3LAGA 1XYOA 4NWVA 4FSJA 4WM8A 3DPRA 2Z79A 1ZVFA 4ATFA 2WC2A 5JIAA 4Q4V2 3U0ZA 2R043 2Y0IA 1ZZ9A 5JVVA 4UW6A 1AXKA 4CEWA 2JG9A 1QXJA 1NLSA 3UL2A 4D69A 4RS5B 1SACA 1AR71 1DQ6A 2GMMA 4GWNA 1IS5A 2QCSB 4QPIA 4XF9A 1CJPA 4M3CE 4YW1A 1DGRN 4YW3A 5J7MA 1R1A3 4N53B 3FZ3A 2Q0AA 2ET1A 2A6ZA 3ENRA 4HANA 3WQ7A 4AVVA 1VBB3 4LBOA 4IEVA 3S0MA 4P5HA 4XJUA 5L73A 3VBUB 3VHOA 2JX9A 3M2MA 4DXZA 2MNGA 2KXLA 4AVBA 4GA9A 1KDKA 3QLQA 4DY5A 1F31A 1HW5A 1NXMA 3UJQA 4HZFA 3K48A 3P3PA 3FLPA 4L9BA 3VLBB 4WVMA 1LU1A 3TNQA 3OBRA 1G9AA 2WNUC 1NY71 2BVVA 3KD4A 3HT2A 1AR93 5C33A 2CWSA 2SBAA 2WNVA 3D0JA 1AJKA 1ULDA 3M7AA 5BY5A 1MS0A 3AZXA 2RE9A 1QOTA 3ZN5A 2R0HA 4QPGC 3E97A 2HWF2 3R4SA 1B35B 5ACA1 4Q1RA 3ZYPA 2RM22 3O5SA 1UN1A 4HPKB 4GALA 4DS0A 1GR3A 4AQTA 3AX4A 4QPIC 1NOVA 4PQ9A 1DIWA 2DVGA 4M00A 1RUF2 4DPNA 4P14A 3WHUA 2ZGKA 1PHMA 5DUUA 3VHNA 5C9AA 2BW8A 4D7TA 5DZGA 1PO23 4FQ4A 4CEWC 3V0AA 3IM0A 1XNCA 4C0HA 3M8LA 5BNOC 2OYZA 1HRI2 1U5YA 1YIPA 4I0BA 1OHFA 4Q29A 3ATGA 1OMIA 3RMXA 1O5UA 3RNSA 1ND3C 2WFF1 3PMSA 1ZRDA 4AEJA 2Y38A 1TMF1 2GC0A 2WSUA 5I93A 1X36A 1FATA 2PLV1 2WSVA 3GF6A 4M01A 3SCGA 2YROA 1V6MA 3WG4A 3JQWA 2YV8A 1KITA 4CEYA 4EWAA 5ACA3 4XTPA 1AR63 1R081 3I59A 1GQHA 4AHXA 4GXLA 5BPXA 3RQ0A 2IXCA 1K5MB 2A3XA 5BXXA 2WNEA 1OOPC 4IV1A 4QGMA 2ZZQA 3ZYJB 3ZFGB 4D3WA 4ES8A 1HLCA 1TNRA 1UX6A 1ND3B 4IEYA 3MPBA 2HWE3 1O4YA 2Y0OA 5E88A 3USSA 3WG2A 1PGL2 2YXSA 4P9JA 2RS51 5L7OB 3HD8B 4URTA 2YUEA 1O3TA 2PHUA 3GALA 4JGZA 2XPJA 2BFUL 2UY9A 3AKPA 3MIHA 2ZGMA 4IEZA 3AKQA 2Q4SA 3AYDA 4XFFA 3ZFEA 4P9WA 3R0RA 3BTAA 4Q4Y3 2IFRA 3FLRA 4FOVA 3ZIWA 2R042 3MIEA 4PCRA 3H8UA 2HEYF 1MS3A 2D6PA 1Z78A 3N7MA 1QOSA 1B35C 2WT2A 2XBO3 3J8F3 3N3HA 4OI4A 3HQXA 2R16A 5E16A 3VKFC 2B5HA 3RJ2X 3AYEA 5T5JA 1H8TA 1VAMA 1OPMA 1RUH2 1ZBA3 4OLLA 3WDUA 4E27A 5HCAA 3U11A 2DYCA 1OA4A 3H9AA 4JDOA 1AR61 1R083 5ABJA 2K9ZA 5CFDB 2DTWA 2WS91 1QWRA 2GN3A 1MZEA 5C9AC 2QDNA 1RUF1 3AP4A 2DCTA 4MXWB 4AFBA 4ONUA 1F5JA 3ZN6A 2NM1A 5FLHA 1RIRA 2IC1A 5EYXA 4NOTA 3M70A 1PGW1 4KWJA 2E7TA 2VQAA 1KS5A 4IQPA 3VBHA 2I07B 4XBQA 3BODA 4NPRA 4S2DA 5JAXA 3AKRA 4PBPA 2FHRA 3VHPA 3PLQA 3SLIA 1LKNA 5JSPA 4N53C 5J36A 1V9U1 1VBD1 1DF0A 1WCSA 3MF6A 4WVZA 4YZ3A 4AEDB 5GLZA 2BFUS 3H1MA 2RS31 3U07A 2JE7A 4JGYC 5J98B 3E6CC 4YVWC 1SQ4A 2JDZA 5JIUA 2WS93 4ASMB 2VMHA 3VBSA 4R9CA 1RHI1 5JCTA 1GSLA 3PVNA 2MEV3 4AHZA 4YW2A 3WQ1A 1GLHA 4N53A 2DUQA 3V0BA 4YZ5A 1AX2A 2BWCA 3GNEA 3IN9A 3QOPA 1ZZCA 3ILNA 4JRAA 1CIWA 1WA4A 3ACLA 3M3IA 4IEQA 2QZ3A 4Y4YA 4AI0A 5DZEA 1DFQA 3AZVA 2H6CA 3ZYIB 4R52A 1JTZX 4PIXA 1ZM1A 3AFKA 4LE4A 3B93A 1XYPA 2ZX3A 3GZUC 2ZHLA 4YZ2A 1LR5A 4WVMB 5JDBA 5C8CB 1QQP1 4Z2WA 4AFMA 3MICA 1RHI2 5ABJC 1W0OA 4HFSA 1YO8A 4GKXA 1AR83 2D98A 2XBO2 3B3QE 3DV8A 3QCWA 2ARBA 4LBJA 2RS53 4XXAA 1N3PA 2LALA 3KGZA 2PHFA 1B35A 1CQ9A 5H9QA 2RMU3 2C9AA 1G9DA 2XWJB 5J37A 4W6XA 2AGSA 4FPGA 2VW0A 1AR92 1O7FA 5K0UB 4A7YA 1BMV2 3BU7A 4PDWA 3UV9A 5AFBA 4LE3A 1H0BA 2XVLA 3WW2A 1REEA 4GB31 2RJKA 5KXBA 2IFWA 3HWJA 2HKXA 4GMP1 2Q1MA 1W6OB 3J4UH 4LBKA 2DURA 3JB4C 1V00A 3R05A 1D0HA 4N7IA 1Q56A 4BQ1A 1BK1A 4I0WB 3AZWA 1RMU2 4MGYE 3AZYA 1SBEA 5KHGA 3FFQA 2UU8A 4CEYB 2PHRA 1VAVA 4AI2A 1YI7A 3NO8A 1W2UA 1QXRA 3I59B 1GICA 3K51A 2VUAA 1DLLA 1S0DA 4GQ7A 1K5MA 1FPN1 4QM8A 3ZSEA 2VU9A 4CDQA 2RS52 4RD7A 2UURA 2GAUA 1RMU1 1R091 2GC1A 1RUG3 1ASJ1 1RUD3 2ERFA 2CYFA 4CDWB 4XJ8A 3KT4A 1I9RA 1HDKA 3ZYGA 2LUWA 1YFWA 4JTOA 4MV2A 2HWD2 1VRH1 1VB4A 1EAH2 3BB6A 2R6QA 3NWKA 1VBC1 4JGZB 4WBBA 4JQRA 1XNBA 3NKGA 1APNA 2YHJA 1URXA 2RMU1 3UKTA 4BA6A 1AZDA 2D3RA 3RS6A 1QHDA 3GZTB 1ULFA 3OY8B 1LGCA 3QH7A 4HN0A 4CDXB 1VBE2 2O8OA 4AQ2A 2WT0A 2IXJA 5HBAA 3OD4A 2EXIA 4I09A 1LTEA 3Q9OA 3QBQA 2B39A 4EN7B 4F7ZA 3B00A 2OUHA 5IK5A 1ENXA 2NZ9A 1PIV1 3VZOA 4IERA 3VBRA 1LHNA 4CEWB 1G9CA 5DG1A 3ZDSA 1UPSA 3ZPYA 4XBLA 2HWB3 4RL7A 1J59A 1BBT1 5GZFA 3WW3A 5GLVA 4EJRA 5GKAC 2XLAA 2XJSA 1BZWA 3FHIB 3W59A 4EROA 3I8TA 2PLV2 2R071 1E57A 1RUE2 2DCYA 5DXDA 3OJBA 5EV7A 1PNGA 2WZPP 3ZXLA 1C5HA 1FMD1 4YW4A 1I1EA 2CNAA 5BNQA 1VJ2A 4AEDA 4H55A 4CDUA 3RSJA 4BLIA 1FV2A 3EBRA 2Q8OA 1JW6A 3LA3A 1J3QA 4WM7A 2NLRA 4PIYA 4B8EA 2HWF1 4CEYC 4A7ZA 2ZS6B 4H7MA 4WZCA 1OQEA 2VVEA 2HWE1 2Q30A 1G9BA 1XNDA 1DGWA 1OLRA 3FBMA 4LR4A 5JPMB 1H1IA 3J26N 4UXAA 2IZWA 1POV1 1QDOA 3WW1A 1CR7A 3APBA 3VBUC 4LBLA 3OYWA 3V0BB 4D7SA 2DVDA 1QMJA 4AEKA 2YGMA 4AGGA 1TE1B 5BNOA 4XYXA 2JECA 1VBB2 1NCRC 1C8NA 3WD5A 2WNUB 1S55A 4AHWA 5I0RA 5JLVA 3WW4A 2FZ1A 2VOWA 1KXGA 1SLCA 2BVBA 1V6JA 1QY4A 4Q27A 3N35A 4L2NA 3ROUA 4M0HA 3EQEA 2WA4A 4OUSA 1GBGA 5T50A 2GNMA 4S2GA 3WG1A 3V0AB 4ZKTB 3ZSJA 1VR3A 2H0VA 4M3CA 1ZBA2 1N47A 4QU2A 4TWTA 1FNYA 1NCRB 3MGUA 1XE8A 5CA6A 2VUJA 1POV3 5CFCA 1AR72 4XF1A 3RG0A 3ZIXA 3J8F1 5JOWA 1N3QA 1X8EA 1UKGA 1JHNA 2TBVA 2EIGA 2C0ZA 1J1LA 3AFGA 2HWF3 3IWZA 4Q0SA 1ZRCA 2BNNA 4N90A 2R30A 4PF5A 1MS1A 4XE9A 4Y1VA 4JGYA 4XZPA 4IV1B 3S7EA 3FBYA 3SNMA 2ILMA 1IS6A 1JUHA 3CNAA 4YM1A 2AUYA 4CP2A 1TQ5A 5LEKA 3VBFA 2XKPA 3WNXA 2UWAA 3LCPA 2W08A 2ZPXA 1YXWA 3LKJA 4YG6A 1OI6A 4COYA 3CO2A 4OHXA 2DTYA 4NR1A 3E6BA 3VZNA 2CWMA 4XHBA 5JOZA 1H2NA 2QJVA 1AR81 4AXOA 4F8AA 1SEFA 1LHVA 1ZREA 4XMIA 1D4VB 4IL7A 4JVAA 2ZKNA 1LOCA 2FBEA 4KGGA 3B01A 3MIGA 1YJLA 4ES9A 2CY6A 4YVWB 4AI3A 3HN1A 1J3RA 3ZXKA 1ZZ7A 1PVC2 1YFYA 4JTNA 1Q8VA 2WFF3 3AMPA 5T55A 1QJY1 2PELA 4YZ4A 1S0EA 1QJU2 3URFA 4N9IA 3BCWA 5A33A 2WZR2 4Y24A 3ZFFC 3HMYA 4E2QA 3CJXA 4HBNA 4K20A 1MZ5A 1RGSA 3NAPB 3ECQA 4Q0VA 1BYHA 3QH6A 5EJ3A 3PVEA 3EO6A 1NYWA 4FPLA 2X5IA 3MYXA 4LTAA 4CDXC 5A3MA 1DDLA 1XE7A 3A4UA 4OI1A 1KFXL 4QXKA 1IPKA 4FPYA 2BUKA 3AXDA 4KH9A 3CJIC 4FP3A 2RR12 4B7EA 4CTEA 2D6MA 5JR7B 1RHI3 5KHJA 3LZZA 4JDMA 3TOJA 5L19A 4QGNA 1CPMA 5CFDC 1WD3A 3T1MA 4MH0E 5CVRA 1AX1A 3H1YA 3WY6A 4DNYA 4K7JA 2CTVA 3I54A 3N36A 4G4FA 5A32A 4FOYA 1S0GA 3OCPA 3JQXA 2IXLA 2PHWA 3AMQA 4O9EA 1FXZA 2PHLA 4ZU4A 2BEOA 4PDWC 5BNPB 1J1TA 1ULEA 5E8AA 3WP3A 5C4WB 1UCXA 4RR3B 1R092 3RDIA 3USUA 4COWA 3V65A 4N43C 4KWKA 3E5UA 1REFA 3PVBB 2V73A 3DN7A 3MLLA 1VBC2 1AUYA 4KG0A 2PFWA 5CB7A 1GANA 1DGWX 2WLPA 4J1WA 1DZQA 4Y26A 5GLTA 1LOFC 1BJQA 4Q0QA 1Y9QA 2R072 1QXPA 1HRI1 2PAEA 1AR73 2QVSB 3ZFGC 1PK6A 2P17A 2PHTA 2VNRA 3IPVA 4I3PA 1DBNA 3VKNA 4AGVA 4Y22B 2GU9A 3RRDA 2P34A 2DV9A 2VOXA 4Q26A 1H2KA 1A8MA 2JG8A 4Q4X3 1DYPA 1YLLA 4DOUA 5IT6A 4XHXA 4WM7B 4AFDA 3SH3A 4OHVA 3WOGA 1QJX3 2D93A 2VY0A 3AJYA 1CJDA 3EXUA 1FOD2 4DFSA 1A78A 1WLTA 3RYRA 5E89A 2OVUA 2MHFA 3NAPC 1UIKA 3H0OA 4N7UA 3ZSKA 5T52A 1ONAA 5FTTC 3ZFFA 1EAH3 3GYDA 4XEZA 5DDJ2 3OYWB 3MIDA 1Q43A 1N3OA 1EYBA 4ISRA 1NE6A 2P2KA 2EXKA 2D97A 4J6GA 1KQRA 4NVPA 3OGJA 2WNUA 1W6QB 2P37A 3JZVA 1TME3 1YI9A 2ZZJA 1LODA 1PO13 1G86A 2JG9B 2D3SA 4AI1A 4NWWA 1FMD3