3EO6A

Crystal structure of protein of unknown function (duf1255) (afe_2634) from acidithiobacillus ferrooxidans ncib8455 at 0.97 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GMAPDQQVPATALGKSSRISLDGRRSERSVILADGSMHSLTLLHPGVYTLSSEVAETIRVLSGMAYYHAEGANDVQELHAGDSMVIPANQSYRLEVMEPLDYLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords protein of unknown function (DUF1255)
publication title Crystal structure of protein of unknown function (DUF1255) (AFE_2634) from ACIDITHIOBACILLUS FERROOXIDANS NCIB8455 at 0.97 A resolution
rcsb
source organism Acidithiobacillus ferrooxidans atcc 23270
total genus 21
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3eo6A00
3IWZA 1CAWB 4R8HA 1Q43A 1V70A 3H1YA 4FBFA 4F8AA 2Q4SA 4YSFA 3E6DA 2K0GA 4BYYA 1RUNA 1H1IA 2VPVA 3I59B 4UXAA 4X6QB 5KHJA 5KHHA 3TNQA 1JUHA 3KMHA 4YRDA 5I91A 2QJVA 3H7JA 3ES4A 4PIYA 3DN7A 3RDIA 1EY2A 3LA7A 3NKTA 3FHIB 2IXCA 1ZRDA 1Y9QA 1EPZA 4XF4A 4ZU4A 2IXKA 3MPBA 4JTNA 2BNMA 3S0MA 2CV6A 5JR7B 4IERA 2K9ZA 3E6BA 4YARA 3IBMA 4MZUA 1UIJA 2D40A 3O14A 4E2SA 4IEZA 4A2UA 2EAAA 3GYDA 4EV0A 2HKXA 1X8MA 5I93A 4LULA 1X7NA 1CAVA 1CX4A 4ZU5A 4MV2A 1J58A 3EHKA 4CYDA 5I8YA 1J3PA 4XFFA 3MZHA 4TLFA 4HN0A 5CVRA 4LUKA 5LEJA 4DINB 3RYPA 1UW8A 2OZ6A 3N4MA 4N9IA 4META 2OPKA 4IEVA 4HSJA 1H1MA 3HIFA 3MYXA 5KBFA 3SCHA 1UIKA 2XGXA 3UKTA 2Q1ZB 2P17A 4LA3A 1UCXA 3NVCA 2UY8A 4XF3A 3D0SA 2H6BA 5J48A 1QWRA 5LRRA 4QM9A 2OA2A 1ZRRA 3EBRA 1ZZ8A 3I54A 1YFYA 1EP0A 4WZCA 3ETQA 1RC6A 2ET7A 2QNKA 4I2OA 2GC0A 4XF0A 5J3UA 5BPXA 4HLTA 2H6CA 3NSTA 4IESA 4QGLA 4J1XA 3LWCA 4L11A 1J1LA 3IDCB 2Q30A 5JSOA 4ORFA 4I02A 3WW2A 2GAUA 4HZFA 1FXZA 4N9HA 3WW3A 1NXMA 3IIAA 2IXJA 4I0BA 4FAHA 5AVPA 4MGYE 5BV6A 1VR3A 1IPKA 1ZZCA 2XHKA 5JSPA 3CEWA 4Z82A 1X8EA 2WC2A 3OCPA 3I7DA 1YLLA 4IEYA 1OI6A 1YFXA 4GULA 3ST7A 4J1WA 3E6CC 4LUMA 2XLAA 5I0RA 1LR5A 3OTFA 4LEJA 2PHDA 5HI0A 3WW1A 5KHGA 3DKWA 1SQ4A 3GBFA 4IEXA 4AQ6A 3NL1A 1ZREA 2GC2A 3E97A 1VP6A 2B9UA 3HT2A 1Q5OA 2O8QA 4Q0QA 1O3SA 1ZRCA 4JV4A 4YNIA 1G6NA 4I09A 2PTMA 1DZTA 3H50A 4LLOA 5FLJA 5I0SA 3RPQA 4YYOA 4XFHA 3LA2A 3OD0A 3H7YA 2N7GA 1OD5A 2V09A 3JZVA 1ZVFA 3DV8A 3FE5A 3LOIA 5I8TA 3LAGA 1NZCA 3NW4A 4B29A 2HJIA 3KSCA 3LZZA 1ZRFA 2OZJA 4O9EA 2QDRA 5J7MA 5FQ0A 2Z2SB 3E5XA 3U10A 4OFGA 4FAGA 4Q0PA 5CU1A 5D1IA 5JAXA 2OYZA 2UYAA 4L2NA 1I5ZA 2BYVE 3CF6E 4HBNA 3H3ZA 3FJSA 4AQ2A 1YHFA 1J3QA 1OMIA 1XRUA 1ZZ7A 4Q0VA 4EWEA 2PFWA 1QY4A 1O3RA 1UPIA 5I0UA 1VJ2A 2VECA 2IXHA 4MX3A 3WW4A 1ZZ6A 4KU7A 1ZX5A 1GQHA 5K8SA 2F4PA 2IC1A 4IETA 3FZ3A 1XE8A 4R52A 2MNGA 3QACA 4AVCA 5CADA 4XEZA 1HW5A 4KWLA 4Z07A 3G7DA 5BXXA 2QVSB 5LEKA 5E16A 3BU7A 3H8UA 4X6RB 2PA7A 4HMZA 4MH0E 4XETA 2BNNA 4I01A 1TQ5A 4HN1A 5KHKA 2GC1A 3HQXA 2GU9A 5FLIA 1FT9A 5JCTA 2FMYA 1RTVA 2C0ZA 4KL1A 5FQ0B 3OF1A 1O3TA 4MGIE 3EJKA 4QXKA 2PHLA 3B02A 1OFNA 4HVOA 1NE6A 2E9QA 2GH2A 4EROA 1RUOA 4KWKA 2EVXA 4JVAA 3HT1A 5FPXA 4PJYA 2QCSB 2ETEA 2KXLA 1RGSA 1X82A 3CL1A 2DCTA 3RYKA 4QX5A 4HVRA 4MUVA 2WFPA 1EYBA 1NYWA 1ZZ9A 2PAEA 4Q0SA 1WLTA 2PAKA 2UY9A 2D5FA 1PMIA 4XF9A 4XFBA 1FI2A 4XF1A 3ACLA 3EO6A 2PQQA 2IXIA 1RL3A 5FCCA 1O3QA 1U12A 1IPJA 1PM7A 1YFUA 3OGJA 3SCGA 1QXJA 5T3NA 5BY5A 2GZWA 1SEFA 5FPZA 1L3JA 1ZNPA 3ZDSA 3H3UA 3E5UA 3QOPA 3H9AA 1I6XA 2I45A 3UKVA 4QGMA 4Q0UA 4QMAA 1CGPA 4IEOA 1NE4A 5EZWA 2BEOA 4AXOA 5FDBA 1O5LA 4HSLA 1DGWA 3LA3A 3C3VA 1GQGA 1CAUA 2XL9A 3RYRA 3CLPA 2O1QA 2Z69A 3SHRA 4D7TA 3CO2A 1ZZBA 4F7ZA 1WA4A 4RD7A 1O4TA 3NJZA 3BCWA 3KGZA 4LTAA 4PIXA 4P9GA 3FFQA 2XLGA 3ROUA 5F1RA 4BIFA 3PLQA 3EQEA 4K8FA 5I0TA 2CGPA 4Q29A 2MPFA 5LRSA 4I0AA 3H1WA 2Q0AA 2BNOA 4O9GA 4ZU7A 4AVAA 3U0ZA 3L2HA 2H0VA 3RNSA 4LA2A 5JSRA 1O5UA 2PYTA 1O7FA 4IEWA 3S7EA 2B5HA 2MHFA 1XE7A 3RZZA 1YWKA 3KGLA 5E1RA 4H7LA 2XLFA 4BHPA 3USSA 2XKPA 2ZKLA 1CAXB 1WGPA 2FQPA 4E2QA 2GC3A 1CAWA 3SCFA 4WBBA 3FX3A 1QXRA 1UD1A 4I3PA 3D82A 1CAUB 4D7SA 3I59A 4MGKE 4E2GA 5C6CA 5I8SA 1DZRA 4AVBA 1J3RA 2XKOA 4JTOA 4OLLA 4UBHA 4XFCA 3MDPA 3TNPB 3SXWA 5EFUA 3ES1A 3UKNA 3R6SA 2BGCA 3S7IA 4NVPA 3BPZA 4XFGA 1J59A 3VHRA 1YFWA 3M3IA 2CAVA 3U11A 3SMHA 3IDBB 4UBGA 5KHIA 3M70A 4KU8A 4ONUA 2D93A 3D0JA 1SFNA 2UYBA 4EWAA 2B8MA 2VQAA 3FWEA 4WVZA 2XL7A 3PVBB 4PIZA 3H1MA 5FLHA 4XFIA 4BH9A 4EWDA 4FT8A 1LKNA 3KCCA 3ELNA 1CAVB 1DGRA 3PNAA 2EA7A 1Q3EA 2D5HA 3CJXA 4KWJA 2IXLA 5C8WA 1LB2A 2Y0OA 4QGNA 4IEQA 2PAMA 4MGZE 4QM8A 4HVQA 3BALA 2ET1A 4IEUA 3E5QA 1LRHA 4XFAA 2CAUA 1Y3TA 2ATFA 1YUDA 3BB6A 4IEPA 3DL3A 1CAXA 5BUVA 2ZCWA
chains in the Genus database with same CATH superfamily
5AC93 3HWJA 1OD3A 3AYEA 2JEMA 4DQAA 2Q4SA 4XBLA 3V0BA 4MGSA 1LU1A 1DQ5A 1AL21 5FZIA 3O0XA 1LGBA 1SACA 3ZFFA 1UU4A 4EYUA 5KHJA 3TEYA 3KM5A 1GV9A 1JUHA 1LHVA 1ULPA 2QQMA 1GP5A 1AX2A 4YRDA 2VUAA 4FXKB 4NHXA 2HWE1 4CUBA 2W52A 2Y0IA 2XJVA 3LA7A 1GNYA 5FMBA 3ZKYA 3WP5A 4H2AA 4AWDA 4FPCA 1AYM1 1W9YA 2WDBA 1YC61 1ZRDA 1NAEA 1QOOA 3LEGA 1BJQA 1W06A 4XF4A 2XH6A 3AYAA 4M01A 1JZ4A 4SLIA 2ZX1A 5C3SA 3MPBA 4AVVA 4JTNA 2BNMA 2VBBA 5FWJA 5A6XA 1D7PM 1OOPA 3WY6A 3ZYHA 1H30A 1WMFA 1W6NA 4PBOA 4NHYA 5IHRA 1HN0A 3MV11 3WNLA 5GLUA 4IV3C 1LECA 1V9U3 4NHLA 4EJRA 3J7MA 1PIV2 5LBCA 3V65A 3KQ4B 1X50A 2A6XA 2J7MA 5IK8A 1PM4A 1GWLA 3PUHA 3MUZ1 2VXJA 4ATFA 4KQ7A 4YVWC 1QJX3 3KV4A 1VBA3 4KBBA 1UX6A 1X8MA 2K46A 4N43C 1RUH3 2VW2A 2A3YA 4MXWB 5LATA 4CP9B 5I93A 2BPA2 3S57A 2JE7A 4WM8B 5DZEA 5IUQA 1PO23 1DIWA 1J58A 1UZ0A 1J3PA 1F5FA 2JWPA 3B00A 4QXBA 3NNGA 3VBOC 5HPOA 3MZHA 4TLFA 5AFEA 5CKMA 1ND2A 3CKHA 4MGTA 1A8MA 1VRBA 1IS3A 1DQ2A 3HBZA 4CDWB 4IE0A 4DINB 2NP0A 4QKFA 3VL9A 2R32A 3ILRA 3N4MA 4ITCA 2NYYA 4META 1OA4A 3DECA 3N7KA 4V2VA 4JGZA 3SNMA 5EJZB 3WG4A 1AYM3 3T0AA 1ODMA 2JDPA 1YI9A 1UCXA 4QQ2A 4WM7A 2WZEA 3ENRA 3C7OA 5FP3A 1FOD1 4AEDC 2Y6FA 2W9XA 3F95A 4OMDA 4K1ZA 4UFKA 5A7QA 2GH8A 2VUCA 2VUJA 1LU2A 2GALA 2DYCA 4IW3A 1BK0A 4NN0A 4OUSA 4XILA 3WQ7A 3VZLA 5A1FA 5C5UA 3I2HA 1QWRA 5LRRA 1ZRRA 1Y4WA 3ZOIA 2R071 2WYSA 4YFZA 2HYKA 3SH3A 3AC0A 1OOPC 3ETQA 3OGVA 2V73A 5JPMB 2WZPP 2HWB1 3UNPA 4IL7A 5J3UA 3WP3A 2H6CA 4KH9A 4E4ZA 1H4HA 3ETPA 4XUPA 4IESA 1FPN1 3AKRA 1UXXX 1UY1A 4J1XA 3LF7A 3ZLIA 2WT2A 4ORFA 4AGVA 2WFF2 2DV9A 5FXXA 3I97A 4Y4YA 1FXZA 2WUHA 3HMYA 4S2HA 3M1HA 1GP6A 3AFGA 4P14A 5IVYA 1S1AA 5BV6A 1BLZA 1EV12 2VZSA 3P5BA 2ZABA 1IPKA 1TMF2 1GZWB 3MLLA 4L8QA 3ZN6B 4HG6B 2RMU1 4LHKA 4QPGC 3A21A 3WD5A 4TWTA 3KT1A 3WXPA 1JS9A 3IAPA 4LBLA 3OCPA 1NCRB 3I4IA 2FBEA 3O1TA 5FJHA 1FOD3 1D4M1 4J1WA 2XLAA 2D6PA 2BU9A 4CDWA 3FUOA 2O0OA 2UWAA 3VL8A 1PGL1 2WBKA 2XVLA 4JDNA 4IEXA 3GBGA 5ANQA 3M3CA 1ZREA 2W0XA 4PLNA 2GC2A 2R073 4CXYA 2DCJA 1E57A 2BZDA 2B9UA 3UK9A 2VC9A 4FPJA 2HWB3 2YBKA 1ZRCA 1HJGA 1R1A2 4JV4A 3O1SA 1S0FA 2WSUA 4E9KA 1FPN3 1DZTA 4NO4A 3H50A 1A8DA 2E32A 4M00A 4DB5A 1VBC2 5FKCA 4XQDA 2OXBA 1HQNA 2P3IA 3GJAA 2RVAA 2V09A 5FZOA 4ET7A 3JZVA 4CTEA 4DRRA 1XQNA 4Z2WA 3KS7A 2DF7A 4LO4B 4CUGA 5L9RA 3DYMA 2QQWA 2ZBJA 4J25A 4CCOA 4N53A 4B29A 4E4SA 5IK7A 4SBVA 3ZXDA 1ZRFA 2ZZQA 3AKPA 3RI8A 2ZGLA 4K9SA 4MXVA 2YUEA 3U10A 4BQ2A 4W8JA 3POIA 2CDPA 1AR61 3LIGA 4XQWA 2OYZA 2UYAA 2YYOA 1GICA 1D4M3 1I5ZA 4HBNA 4NRPA 4WM8C 1VPHA 5HBAA 3P3PA 2X53S 4GAZA 1YYNA 1GZ9A 5BNNB 5DDJ2 3POFA 5FZ7A 1GZWA 3GCWA 4AGGA 1NLQA 3ZN6A 1BVP1 2XXZA 1O3RA 2YC0A 3LKJA 2ZMKA 1XBFA 4N90A 4FSJA 1COV1 2HWF2 2NMOA 1VJ2A 1IG3A 2J42A 4XJZA 5FYSA 5LA1A 2E53A 4FOYA 1HRV1 1MS8A 3UL2A 1ZZ6A 4LO8A 3K4ZA 2V5YA 4TTGA 1GQHA 1LCLA 5ACA2 3A0KA 1OVPA 2D3SA 2IC1A 3HN3A 4TXWA 2OKXA 1XE8A 3MGUA 4W50A 5LASA 3WLUA 2CTVA 4R52A 5L9BA 3VDDA 3PVNA 4BLIA 2YDEA 4OYUA 4XEZA 1S4CA 1HW5A 2HEWF 4KWLA 4YLZA 2VY0A 3NV3A 4AQSA 5DAPA 2WZR1 1W0NA 3MHZA 4K40A 5DABA 5JIAA 2X10A 3Q8EA 5C4WA 4UFIA 5E16A 3VBFC 4Z1VA 5A1LA 4BXFA 1JBCA 4A7YA 4FVVA 4HETA 3H8UA 2B9VA 4X6RB 5HV4A 4MH0E 4LOSA 3K4AA 1LHWA 5H9RA 1OUSA 1BMV1 4I01A 1DGWX 1OF3A 4XHXA 5BNOA 5KHKA 1CJPA 4QPYA 2LS6A 4MHUA 4YZ3A 4I30A 5FZDA 5KXDA 2UWBA 1U5YA 1C4RA 5FY7A 3AXDA 1ENXA 2Y8KA 4XUOA 5T5LA 2XVGA 2XUMA 3OF1A 2Y64A 4XPVA 1QJFA 2XG3A 4MGIE 1COV3 5FYUA 4FQZA 1PK6B 2GNDA 5IVJA 3AMNA 3B02A 1WW7A 2A5ZA 4DXSA 1HRV3 3FMGA 4WVWA 2WQ4A 3LQCA 1A6CA 5GZDA 2AUYA 2GH2A 4EROA 1CPNA 1RUF1 1DYOA 3ZM8A 3ZSLA 4CPBD 2RS11 2VNRA 1NCRC 5BNNA 2KXLA 5JR2A 2WWSA 3CIHA 1RGSA 4GZ9A 3VBRB 1D2SA 2WT0A 2VE1A 2H0BA 3NJXA 3WF4A 2D6NA 5HCBA 4B4QA 3VKNA 2ARBA 2JDNA 2B46X 3AP7A 3ZSMA 1ALYA 1ZZ9A 2WZR3 3ZXJA 3HNBM 1WLTA 4OZXA 2AH2A 2QKDA 1F2NA 2D5FA 1RUE2 1PMIA 2UY9A 3J4UH 4FP3A 2ARAA 1RMU1 5DUWA 2WS92 1MR5A 1WBFA 1FI2A 4LBQD 2DVAA 3MI8A 1V6NA 4V1PA 3OBTA 3SH4A 5LK7B 5F2WA 3MPPG 1R091 1W99A 2DUQA 2RV9A 3BODA 4QD2A 3JB8A 1LNSA 3N3HA 4RQPA 3VBSB 2W91A 4ZY9A 1O59A 4A7ZA 2XJUA 5BNPB 4CU6A 5JVVA 1H9PA 3ZDSA 2B4KA 3H9AA 2R7EB 4GJZA 1AR73 1Z7S1 4FPHA 4XOGA 2P3YA 3PIJA 4AK3A 4CEYB 2QFEA 1QQP3 5FZKA 5FP9A 2BEOA 2X09A 4YGDA 3ZO0B 1JZ2A 1WMDA 3ZYFA 3MIBA 4JGYA 2OVUA 4L92A 2BOJA 3LA3A 4LPLA 1GSLA 5LA2A 4AFAA 3FN9A 3OPTA 2WNEA 1RUF3 4UFMA 3RJRA 1PGW2 1GQGA 1CAUA 3BI3A 2OQ7A 2RS13 4AFBA 3BN6A 3ZMOA 3DKQA 2ZHLA 3KF3A 4CCCA 3IDEA 2ORXA 3N9NA 2VCMA 2Z69A 1VAMA 4Q4X1 1PO12 3SHRA 3BTYA 4D7TA 1PK6A 1GZTA 1ZZBA 3WV6A 1W6OB 3ZFEC 1V9U2 1VRH1 1O4TA 3PMSA 5FZEA 4LTAA 3GNEA 4IE6A 3PMEA 5F1RA 1RMU3 2XLGA 2GNBA 3F2ZA 4A3XA 5LY1A 2IWGB 1QJX2 3EQEA 5F5IA 4BQWA 1UZYA 4XJ9A 2D6OX 3RZJA 5K4LA 1XYNA 1UY0A 1F31A 1KJRA 2EXIA 3VBRA 1WZXA 1R093 2VNVA 3JD71 3N35A 3WINE 4JHZA 1HKDA 4D0QA 5FYIA 4NIGA 1AL22 1FV2A 3KD4A 1UY2A 2D98A 4BLJA 1XC6A 2BNOA 1PHMA 1NA1B 3TOJA 3O1RA 3K3OA 2JJ6A 1POV1 3HAGA 3LPGA 3MW4A 3AYCA 1S0GA 4QX3A 1Z7S3 5DG1A 5FUIA 1UY3A 2WA4A 1MEC3 1H8TB 1LOGA 1CX1A 1UZZA 2JENA 4Z8BA 2VULA 5F39A 2XBO2 4PDWB 4LK6A 3RNSA 2VGDA 2HWE2 4NHMA 1O7FA 4ES8A 3T4HB 1RUJ1 1W9SA 2JIGA 1GQPA 5IVFA 1CZTA 2B5HA 3RZLA 3TWIA 5A3UA 2VH9A 1AJKA 1YWKA 3KGLA 1AYM2 2XONA 1U5IA 1U0AA 5A7NA 3USSA 1GWKA 4P9YA 1NT0A 3T2TA 1CN1A 5F3GA 3S5AA 4EN0A 4Q4X3 4DNYA 5IT6A 2GC3A 3D8CA 2W87A 1VRH3 1YQ2A 3FX3A 5FPLA 4QXCA 2GMMA 4I3PA 1CD3G 2RM23 4UW3A 3MICA 3I59A 4MGKE 2VNGA 1TNRA 1KITA 2GP3A 1HRI1 4BZ4A 1SLBA 4GKXA 4UBHA 3JD73 4AEJA 4XJAA 3AP5A 4EZHA 1NG0A 3ECQA 2JB4A 2BUKA 3PUQA 4JKMA 1W6OA 4PI2A 5GM0A 1S2KA 1UYYA 4RS5A 1POV3 4XFGA 2W1UA 3RMXA 3PJYA 5FBZA 3SMHA 1W2UA 5ANNA 1KXGA 1RVF2 4NAMA 1XNTA 4FOQA 4FPYA 3GZEA 3KHBA 4HANA 1H2LA 5IVEA 5C71A 4GMP0 3JB4C 2GMPA 3O1MA 4YGEA 4O61A 1VBB1 1PMJX 1F4HA 1W05A 1NA1A 2VQAA 4M3CA 3OUIA 5FYMA 4B7KA 3W5NA 3I2FA 3B9IA 2X05A 5FLHA 1GOGA 1C5IA 4P9LA 1FATA 4XHBA 1PX4A 2O14A 3VBSC 1SFPA 4PDWA 3IB3A 5BNPC 3WCRA 2ZMLA 3OPZA 1JYVA 4LE4A 1YEWA 5HXMA 1CAVB 3ATGA 4CEYC 3BTAA 2R072 3KV6A 5FTTC 2D5HA 4Q1RA 2IXLA 3UESA 1RUG1 4XAAA 5JOXA 4QGNA 4XZPA 5F5QA 3FC0A 1S0CA 2HWB2 4JC1A 4A3ZA 4QM8A 4QT6A 1HRI3 1LRHA 4AGRA 1AZDA 4HOOA 1FPN2 3K75B 4O7XA 2E31A 4TN7A 2RE9A 3KLSA 4AHZA 4DY5A 3IWZA 3M3QA 5LBFA 3T2QA 1CAWB 4R8HA 1Q43A 1PMHX 4FBFA 4BK5A 4F8AA 2XJSA 4AE2A 4E4HA 4YVSB 2XWBB 2X8KA 2ARCA 1H1IA 1GUIA 2VPVA 4Y4RA 4W6WA 5FMCA 4AI2A 5KC6A 3N7MA 5KHHA 5FJKA 3POBA 2FDHA 4HXCA 4WVMB 3TN92 5DUUA 4GWNA 2RMU2 1UYPA 5CFCB 2VM9A 4OULA 4AFCA 1VE0A 2QJVA 4Y20B 3ZFGC 1IS4A 5L7OB 2CU5A 3RDIA 3TEXA 2JICA 3B3QE 2JX9A 1D4M2 3VZNA 3I2DA 2IXCA 3N36A 3NNJA 2EIBA 3N9MA 1EPZA 1NA1C 2BERA 1IZ3A 4OUEA 4ZU4A 4ATEA 2DVFA 5FPVA 1PGL2 4CXWA 1B35A 4XUTA 1JZ7A 4K21A 3PHMA 1D2QA 2WJSA 1H8TC 4RR3B 3THDA 2CV6A 2JG9B 4OHWA 1RUG3 3B7MA 3AVSA 2YROA 5CB7A 1TE1B 3AVRA 4BM8A 4YARA 3IBMA 1H6YA 4WZFA 3OGSA 2E26A 3W5MA 2P2KA 2X5IA 3JCIA 5DG2A 1TME1 1EUUA 1O91A 1JTZX 2MEV1 1UXZA 5JI7A 5JOYA 1KRIA 5FV3A 4Q4W1 4EV0A 1Y43B 2HKXA 2RDNA 4LULA 1X7NA 2R1DA 2GDFA 1CAVA 4OHYA 2WRAA 4CUCA 4ZU5A 2YG0A 2EIDA 1US3A 3WF1A 5FP7A 1LAJA 4CYDA 4PBPA 5I8YA 5L9VA 4IQPA 1K5MC 3N9QA 5FXWA 4U2AA 2YBSA 3KF5A 2WWJA 2J1RA 4W6YA 3RYPA 5EXOA 3WDVA 3VKFC 3AMPA 1XSQA 4IEVA 1AR62 4HSJA 1H1MA 4XCAA 1UOFA 1C3HA 2PHTA 3HIFA 5ERLA 3V0BB 4Z92B 1FMD1 1UU5A 1UIKA 1WLDA 2XGXA 5K7PA 2XPJA 3HBKA 4D6QA 1HV1A 1R083 1UU6A 2FDGA 1ENSA 1LENA 2P17A 2VMDA 3ZFFB 5JXHA 1UPSA 4RYDA 3BU0A 2RS53 5IVVA 1K3IA 2W94A 1WW5A 3ZXAC 3ORJA 2VNOA 1AJOA 1RYYA 2UY8A 1LOFC 3FLPA 3PUIA 1WCQA 2H6BA 5J48A 3VBHA 4YFWA 2VMHA 4LQRA 4UT5A 4Y20A 4FFGA 2BOIA 1OPOA 5A3OA 4BQ4A 2BBVA 1LESA 2OA2A 3HEIA 3AM2A 3K3NA 4PQ9A 1HRV2 3EBRA 3SQOA 1ZZ8A 3I54A 1YFYA 4NRQA 3H42B 1EP0A 1TME3 1GNZA 4OHXA 2QNKA 1O8PA 1ASJ1 2BW8A 5FXZA 4Q4W3 1SDWA 1WLWA 1Y9GA 3OB8A 2VBDA 4HLTA 1ZBE2 4JKLA 1GMMA 4XACA 4XUNA 1GFF2 3UYJA 4WV8A 2E63A 2Z4FA 4RR3A 1J1LA 4CDQB 1IQDC 1OQDA 2JG9A 4QXHA 4Q5OA 5FP4A 4ZU7A 1UMHA 4AEMA 5JSOA 3QBQA 2Y38A 2GAUA 4GWJA 2WZR2 2WA3A 3O1UA 3WW3A 4UYBA 1NXMA 1QU0A 4I0BA 1P8JA 5FMOS 1C1FA 5F7UA 3KQRA 2ZEWA 4HK9A 4MGYE 3AZYA 5LA0A 4ARYA 4QAWA 5KR7A 1Q8SA 3BPSA 1ACCA 3DPRA 2BFUS 1BMV2 3VDCA 1LGCA 4GH4A 4Z82A 4PCRA 2J1UA 5JI9A 2D44A 2PHFA 4A4AA 2WC2A 4ZHNA 2C24A 5C3OA 1REFA 2W39A 1ND2B 2ZEZA 3IKWA 4C1XA 1H9WA 1UNBA 2JKXA 4YVSC 3E6CC 3W58A 3I3EA 2PHDA 3ZIWA 5HI0A 4DUXA 1VBA1 2AC1A 4QPWA 1RUH1 3ACHA 3M2MA 1SQ4A 1W8FA 2A71A 1QJY1 4QHOA 1VLNA 4UOJA 3IT8A 4KI5M 2C9AA 2DVDA 4OMCA 5IW0A 4IE5A 3O5SA 4A42A 3VDBA 5CBLA 4JGZB 2DVBA 2ZTNA 1F9KA 2EXHA 1PO21 1BKZA 5CFCC 5SV8A 2FDKA 1RUF2 1AR93 3P3NA 4WM7B 2O8QA 3AMQA 1ASJ3 1WMXA 4Q0QA 2RS12 3K4DA 5EYXA 3WDTA 3ZPOA 1JU4A 3UV9A 4FFHA 2R042 4R9AA 4YNIA 5L7OC 1F8VA 1G6NA 3Q9OA 2Q1MA 2YZ4A 1BBT1 4C90A 4TLGA 1RHI3 5I0SA 1WCSA 1MS0A 1SG3A 1W8UA 1LODA 5C8CA 4XFHA 3R0RA 1NLSA 3U75A 3T1LA 4CXXA 3RZMA 3I2JA 4UI9L 2ZEYA 5FYZA 4C0BA 4INDA 1J83A 2ZGMA 1AR81 4LITA 2N7GA 4IDZA 2VBPA 3I3DA 1W2NA 4PF5A 4Y5TA 2G9ZA 1ZVFA 4QHZA 1KDMA 1RMU2 2ZGQA 2ES3A 3WOGA 2OUJA 3GZTB 2HJIA 3SISA 2NPIA 1VALA 3RVHA 2R1BA 4O9EA 4YW7A 2QDRA 2VTXJ 1R092 2G19A 4CDQA 5FQ0A 4OFGA 2ID4A 4MSVA 2G1MA 4FAGA 3ZYRA 5CU1A 5D1IA 1REDA 2JG8A 3SKJE 1Z7S2 2BYVE 5FK7A 2DUPA 5EJ1B 3H3ZA 5A80A 3NAPB 5D8AB 5F5AA 4CE8A 1Z78A 2DUOA 1YHFA 4KGQA 1OMIA 1CWPA 1GBGA 2WQZC 4L97A 4EWEA 1QJY3 3MFCA 1JUIA 3DGTA 5FPUA 3PURA 3LPFA 4K20A 2AEZA 3RWNA 3VKLA 3A22A 1MS9A 1LGNA 4AEKA 5I0UA 4LXLA 4TZDA 4E2SA 2VOWA 3W59A 4CU8A 3AP9A 5F3IA 1XXNA 4UW5A 2QZ2A 5FY5A 1BBT3 1DQ4A 2WR9A 4FFIA 4Q4X2 3ZFFC 5J09A 2VAUA 2EXKA 5AVAA 1XOYA 2F4PA 3T30A 3WDUA 3FZ3A 4XVHA 2VZRA 1VRH2 1SCRA 2Y34A 1AR83 3NRUA 4FPOB 2KA3A 1KEXA 3QACA 2EICA 3T4VA 3WF2A 2VJXA 3ILNA 2P6HA 4Z07A 2P6CA 5B2GB 2J1SA 4DXZA 3V0AB 3G7DA 5BXXA 1QJU1 3WNXA 1SLLA 2Y6LA 3GM8A 2EF6A 3EB7A 3JD72 4LKSA 2WIIB 1H0BA 3USUA 3WHUA 3AZZA 2W1SA 5EIYB 4DRVA 1SBDA 5T54A 1E5IA 3R05A 5FZOB 3TEZA 4B1LA 3VUOA 1TQ5A 4HN1A 3KV9A 3AP4A 1WWYA 2GC1A 4N53B 4QQLA 5T5JA 2GU9A 5F32A 3ZDVA 3VD5A 1RUJ2 1YI7A 1S0DA 2WQ8A 2C0ZA 4MLOA 2JE9A 4QPIA 1UF2C 3OY8A 5EJ3A 2C1FA 2DBNA 2PQSA 5FZHA 5L73A 5JUVA 2QQPA 4XTPA 4DXTA 1RB8G 3O7OA 2PHLA 2RG4A 1D0HA 4S2FA 4HVOA 3Q8AA 5FBJA 2ERFA 3BUCA 1JZ6A 2F4LA 2CL2A 2KM2A 1AYN3 3ILFA 3NV2A 3NAPA 5D8AA 4FPEA 5CA6A 2A1XA 2AEYA 3MLJA 2V72A 2EVXA 4JVAA 1IS6A 4PJYA 1H6XA 3K46A 1ND2C 2VU9A 3LEMA 2DCTA 5CNAA 4JQRA 3CBNA 1I1EA 1F5JA 1JH5A 1NYWA 1ZRIA 2YV8A 1QJU3 2PAKA 1HRI2 2WAOA 5FZFA 3WT3A 4JGZC 2PHUA 1MVEA 2BBAA 2GSYA 4HPKB 1QIQA 4WM7C 2I2SA 1MZ5A 3LFIA 4P00B 2XHNA 4JKKA 5AFBA 5FCCA 3OGRA 4PQQA 1IPJA 5G04L 3VDDB 4UF0B 3OGJA 4YZ5A 5T3NA 5BY5A 2GZWA 2R6QA 5A7WB 2W68A 4AFMA 5FXVA 1O4ZA 3V0AA 3PTRB 1I6XA 5C4WB 2I45A 1Q8VA 5A6ZA 1MZEA 4XTMA 3APBA 2FZ1A 3P6BA 5FYCA 3WDWA 1CGPA 3CZUA 1VBB2 1ND3A 4XE9A 1YQ6A 3WQ0A 3MF6A 2VZVA 4FOWA 4XCBA 4BISA 4QQPA 5FDBA 1O5LA 1DGWA 2XR4A 3EXUA 4N8MA 4COZA 5BNOB 4BDVB 5GZGA 2WNUB 2Z42A 1C57A 3GDBA 1WW4A 3CLPA 3I2KA 2BTVC 1E5SA 4DUVA 5A7PA 3ZMNA 1ULFA 1RUG2 2E6VA 1OT5A 2LRPA 1VBE1 4F7ZA 3FBMA 4NPMA 4AOCA 3NJZA 2PHRA 3KGZA 4BXSV 3GHNA 4PIXA 2P3JA 4P9GA 2VTXA 4K8FA 2VMIA 4NRMA 4QX2A 4YW4A 4Q29A 1QEXA 1Q8PA 2C5DA 2MPFA 4ISQA 4LE3A 5LRSA 1WLCA 3WZ1A 5J36A 2YB7A 4CDWC 4W6XA 2VOVA 1W6MA 2WO2A 4NE9A 1K42A 2Q0AA 3PIGA 4LHLA 4O9GA 5E88A 5A3NA 3V64A 2VOKA 3T2OA 4HT1T 3O0VA 3AXEA 4AZZA 5LY2A 4DZGA 4AVAA 5DXDA 2ZX2A 2VW1A 3L2HA 1KS5A 4HPKA 3GCXA 4QDRA 3AMHA 4ZKTB 3I3MA 3WUDA 3ZSEA 1OBNA 2PYTA 3OPWA 4KNCA 4CCMA 1OSGA 4LBQA 2LTNA 4UF0A 4M0HA 2CWSA 4RQPB 2BVVA 3CHXA 4PHZA 2E33A 5A7WA 5C33A 4DUWA 1DFQA 2PXJA 2XKPA 2BWAA 3KCXA 1RIRA 3ZYIB 2NMNA 2Y33A 2ZAHA 2B7YA 4COVA 2WZ8A 2BJSA 3RSJA 5A3TA 1V6LA 1LOBA 2FQPA 3T0DA 4N53C 3NNFA 1VBE3 5EHDA 4JGYB 1NUKA 5A3LA 1QXRA 1DLCA 1TME2 2MEV2 1CAUB 2WNUA 4GIQA 4P02B 4E2GA 4Q4W2 5I8SA 4LO5B 1N1SA 1AR71 4RFT0 4FPFA 4S2GA 5LCWL 1QQP1 2J1AA 1OQEA 2XKOA 1HJFA 4OLLA 4PI0A 1BQPA 5H9QA 2GNMA 4EQVA 3CMGA 3MDPA 4LK7A 3SXWA 2D43A 3ES1A 4CVUA 3B94A 3AP6A 3KCYA 5DPNA 4D6RA 4MG2A 5A1AA 3UJOA 3POJA 1N3PA 2BRTA 2EXJA 2XJTA 2IVIB 1UN1A 4FPKA 3U11A 3MIFA 3B9CA 1OH3A 2OQ6A 3M70A 5IVBA 1DHKB 4DXRA 3D0JA 4BQYA 3W20A 2UYBA 1YNAA 1JOJA 1FMD2 4LHNA 1MZFA 4M3CF 1D0GA 4QU2A 3GZAA 4V2WA 4EWAA 4E8DA 4ISRA 1WKYA 3FWEA 3VB9A 3K2OA 4KBZA 3GZUC 4PIZA 5IYYA 5FO8B 3VDDC 1ZA4A 2C6SA 2ZGUA 4Y33A 5FZ9A 2WO3A 4JRAA 5AC92 4OI0A 4FT8A 5F3EA 1J1TA 4KWUA 3FLTA 4JQTA 3ZSKA 4OZOA 2Y6GA 1JOBA 5C4WC 1E5RA 1SDDB 3D4KA 4P08A 1DGRA 3AKTA 3PNAA 4QB2A 3HOBA 2EA7A 2W1WA 3CJXA 1D4VB 4CCLA 1RITA 2DDUA 4YW3A 4JRLA 1ASJ2 1W3XA 1KFXL 3RQ0A 2IVJA 1N3OA 3MIHA 5EV7A 2ET1A 4IEUA 1MEC1 1F4AA 2ATFA 2CAUA 4ASKA 5DAQA 5BNOC 4LHSA 5LA9A 1UY4A 3LSEA 1XB9A 5A6YA 1MS5A 1LEDA 1DZQA 5FFOC 2Q1FA 2ZGKA 1NCQA 1HXS1 4NIIA 2HEVF 5HV0A 4XC9A 2RS31 3S30A 4XIKA 4XJWA 4BYYA 1LHOA 2JB8A 5KWRA 1IS5A 3I59B 3D5OA 1PVC3 4UXAA 3R4SA 1CONA 2B42B 2D6MA 2P1BA 4HK8A 2JDZA 4LBKA 4AW7A 2E51A 3WDYA 5J1XA 5GKAC 1C8NA 3K77A 4FOVA 4YW2A 2VZUA 2A70A 4M3CE 2VO5A 2BVBA 3O12A 5I91A 5K0UB 3THTA 4Q27A 3H7JA 4XJ8A 5BNNC 5J37A 2W95A 5FPBA 2YC4A 3PVEA 1WCKA 4RS5B 2R0FA 5K9YA 5FR3A 1W04A 5FZ0A 2PHWA 1EY2A 2RM21 4Y1UA 2DTYA 3IN9A 3ZSJA 2OUHA 1YJLA 4P9XA 3MIGA 2GMEA 1UKGA 2C4XA 1VBA2 1S55A 5C3PA 5CG9A 1RUH2 1RUD1 1QJY2 5FO7B 1W6PB 4CCNA 2IXKA 4LBOA 3C7EA 3IAQA 3RZHA 1OXCA 3S0MA 4YGBA 3WF0A 1PO22 3VD4A 4IERA 4M3CB 2K9ZA 3E6BA 3POWA 4MZUA 4BOWA 1UIJA 2D40A 5FZGA 2VXRA 4CCJA 1US2A 3MIDA 2NZ9A 3NKGA 3QH7A 4PT6A 1AL0G 2ZAAA 1N3QA 4Q4V1 1BBT2 1LOCA 2EAAA 4RQPC 3KZ4C 4XDQA 5D2AA 3MV01 3OBRA 4ZXKA 3FFZA 1BK1A 1KS4A 2FD8A 4YM2A 1HXS3 2XVKA 3OSDA 1AR82 4LO7A 3T0BA 1CX4A 4G9SB 2RS33 3OUHA 3ZXKA 4AL9A 3HJRA 1K5JA 3N7LA 2ZGNA 3EHKA 2JECA 4P5HA 1UOBA 3RS6A 5T55A 5L19A 3IMNA 4JGYC 2UURA 4HN0A 1VB4A 4IV1B 4RHV1 1OURA 1PIV3 1QH6A 3T09A 3JXSA 3SKVA 5GJ6A 5LEJA 1W0PA 1SCSA 1V6KA 1QKQA 2YBPA 2PLV1 3KVAA 1S0EA 5FKBA 4DPNA 4N9IA 4CSWA 1GKBA 3BOWA 2LUWA 1GNHA 2XDVA 3MEPA 4FXGB 2SLIA 1LOEA 5KXEA 3ZX7A 1I9RA 4CZSA 5C3QA 1K45A 1PK6C 1JODA 3NMBA 1OLQA 1RUD3 3V56A 1G9BA 1OPMA 3NVCA 4RGGA 3WF3A 4XF3A 2AACA 5HCFA 3U14A 1JYTA 2D6KA 5K0UA 3J7HA 2JD4A 4B1MA 4BA6A 1SMVA 4QM9A 3VBRC 1RUI1 5LBBA 5T52A 2VVFA 2QQUA 1MQTB 3A23A 4BMBA 1XNKA 4Q4V3 4XQ4A 1VMHA 2CGOA 4QU1A 4BPZA 1Z0HA 2BWCA 4XF0A 4AQTA 1SHWB 1S0BA 1LULA 1B35B 2OPWA 1W6PA 4CDXB 2QQOA 3NSTA 5DMYA 1BXHA 4JDOA 2WT1A 2Y60A 4B3NA 2R30A 2RDQA 3C7FA 1W9FA 3IDCB 3D3AA 2VR4A 3QCWA 1W8HA 2WNVB 2YGLA 4XYXA 1N1YA 4LNVA 3WW2A 4X8NA 1FOD2 2X5IB 3I2GA 3N9OA 4HZFA 1W8TA 3MF9A 3OD4A 4LLFA 4RHV3 3IIAA 4FAHA 1N1TA 2A3WA 2W92A 5AVPA 2JKBA 5LB6A 2LW8A 3FHQA 2OIIA 1OH4A 2PLV3 4X8PA 1CESA 2PMWB 2QE3A 3URFA 1ZZCA 2R061 1H8VA 2WN3A 2XHKA 4BQ1A 5JSPA 4Y3OA 3RFRA 1G9CA 1JYIA 5E89A 2HWC1 2D6LX 5FYVA 2YFUA 1UKRA 4NPLA 5DAVA 2WFF3 1UMZA 3JQWA 5FYYA 4IEYA 1OI6A 1YFXA 2X29A 1W0OA 4IV1A 5F5CA 5FWEA 1NLRA 3ST7A 3TYJA 4F3JA 1OVSA 1CJDA 1LR5A 2FDJA 3P1IA 4LEJA 3WP6A 3WW1A 5KHGA 1F35A 1GANA 3DKWA 2WL1A 2AR6A 3FBYA 4CCDA 4H55A 3B01A 2EIGA 4CDUA 3VBUA 5GLTA 2IZWA 1HB3A 4CU9A 1C8M1 1RUI3 2J22A 1SLIA 3ON7A 3E97A 2ZJCA 2VTFA 2QQVA 4FPGA 3W21A 4CP2A 4COYA 5JZGA 5FZ6A 1RJ8A 2PELA 3ZVXA 1Q5OA 4EN6B 4BU2A 2ZOEB 4KMQA 1T6GC 4YW1A 4AI8A 3RZGA 3MUY1 4CP1A 4NIDA 3VZMA 4RS5C 3AK0A 4LO6B 4RGAA 4P5YA 1EUTA 1HB2A 1PZ9A 3BIWE 1YRZA 4GMP1 5CFDB 4LLOA 1UO9A 1UQXA 3VBHB 4E8CA 5IVCA 5JWPA 2Z5WA 3ACFA 2A73B 4QKNA 2DFCA 3ZIXA 2ADDA 1O6UA 1XNCA 2JIJA 1MQTA 1R081 4MADA 4YM0A 5C9AB 4QDQA 3VZOA 5IFPA 4LT5A 3DV8A 3FE5A 5IJRA 5I8TA 2RS51 4A45A 1NZCA 1SBFA 4RN5A 4RL7A 2R063 4CDXA 2HBTA 1NX9A 3WR0A 1IPSA 2YPDA 4OI2A 3RZKA 2HWC3 3KHCA 4AAXA 3I3QA 3OYWA 4PDWC 3CU7A 1W8OA 5CYYA 2WNVA 1AX1A 3A7QA 1JXNA 5CKNA 2UU8A 4AI0A 5T50A 5A70A 1RXFA 3CF6E 4IXLA 3FJSA 3AYDA 2W1QA 1J3QA 5F6LB 2A6ZA 1N47A 3VKMA 1XRUA 2ADEA 5FZLA 4FP2A 3BTXA 2VOXA 2PFWA 4DO0A 1UX7A 2XWJB 3DPRB 1C8M3 1OUXA 5I0DA 1IOAA 5A32B 4GH4B 1UPIA 2VZPA 3C8XA 4Y5SA 3WEZA 3G6JB 4LOTA 5ABJA 5EQUA 5IK5A 2IXHA 2RJLA 4MX3A 1TG7A 3OUJA 2W08A 5A7SA 3N7JA 4GMP3 4KU7A 3HD8B 1OHFA 5K8SA 5FZCA 3MBWA 1VBE2 4E4DX 5DDJ3 1XNBA 4IE4A 1MS1A 3EMRA 4URAA 2RJKA 2ZHNA 3POGA 2HWF3 4N43B 4FCAA 3KT7A 5LEKA 1DQ0A 1MQTC 3CJIA 5CFDA 2V5DA 5JLVA 3BU7A 1QGLA 1COV2 5C8CB 5ACA3 5FPAA 3HNMA 1FX5A 1B35C 2PA7A 1JHNA 1VMFA 3ACIA 4HMZA 3VBOB 5IFTA 1XNDA 2DURA 4HKLA 4R9CA 5C9AA 1AR91 1XE0A 2YFZA 2ZGPA 2WKKA 4MHRA 4Q26A 4XMIA 3POEA 4GXLA 1WMEA 1GLHA 3HNYM 4XMAA 5CKQA 5E6HA 2X5IC 5FLIA 4QX8A 2FMYA 1GOHA 2ENRA 1RTVA 4CA9A 5FQ0B 1RHI1 1RUE1 1TNFA 4NMIA 1RINA 2WO7A 1O3TA 1B09A 4UFLA 2AREA 5LWBA 3WCSA 2JG8B 2ZXQA 2UWCA 2BDRA 3SH5A 2E9QA 2Q5TA 4D8MA 2NN8A 4ASLA 5JOWA 3L9JT 1PNFA 4ES9A 4XXPA 2ZS6B 2K2SA 3HT1A 4YZ1A 2DFBA 2QCSB 2VZTA 3T1MA 5LW9A 1M06G 1QH7A 2TBVA 3GXUA 5BYNA 3CL1A 3KB5A 3D6EA 5A32A 4QX5A 3ZXEA 3N9PA 4MUVA 5CEHA 2WFPA 2D3RA 1EYBA 4HFSA 3WHTA 3NNLA 2J1VA 1SLAA 5FZ8A 2VZQA 4RSUA 2PAEA 1AR72 2Y26A 4Q0SA 4Y22A 1SPPA 3B5LB 1MVQA 4O65A 4EN9B 1POQA 2QQIA 3LDBA 1QQP2 4Q2FA 4GQ7A 4XF9A 3DEMA 1X9PA 2VZ3A 4JCKA 1PGW1 2B39A 3ABZA 3T2PA 5DAWA 3SLIA 2QQNA 3EO6A 3OJBA 2PQQA 3T08A 3J7NA 1RL3A 2LALA 1PM7A 3GJBA 4GB31 4K3UA 5EYYA 5IAXA 2FMDA 3THCA 3VBHC 2I74A 1PO11 2VL4A 1SEFA 5FK8A 4YVWA 4EE2A 5FPZA 1L3JA 1ZNPA 2TEPA 5FYBA 4N43A 1IHMA 1BEV1 1CQ9A 4J6GA 2CNAA 3JBG1 4BCUA 3UKVA 1W03A 3ME2A 1MS3A 3ZN5A 4COUA 4QMAA 2AYHA 1RUE3 4IEOA 3ZN4A 5ISLA 2DCZA 5EZWA 3USUB 1ULGA 2RJ2A 3CQOA 1G8WA 4AXOA 1BVVA 3VBOA 5CZKA 4HSLA 2XUEA 4OUMA 4RR3C 3U07A 3LCPA 3C3VA 4G3YC 4QQOA 2JG9C 3AX4A 4BWOA 5CISA 1UL9A 3WQ1A 3SEEA 2WNOA 2XL9A 3O0WA 2QZ3A 4EN7B 4ZZ8A 4DEQA 2ZKNA 4QPIB 2WYFA 3OY8B 4TSVA 4YZ2A 4XUQA 2F17A 2P34A 1HQLA 2G9GA 4QX0A 4YW6A 3MO4A 2XBO1 3BGAA 1ZBA1 4RD7A 5TSWA 4URTA 1W8ZA 3BCWA 1MEC2 3DPRC 1QDCA 4S2DA 4AEDA 2W2IA 4A6OA 4GH4C 4COWA 2WO1A 3JQXA 3WDXA 3FFQA 1JYWA 3BYWA 3PLQA 4BIFA 3OGGA 1JHJA 4ZS2A 5BNQA 2JD9A 1I3HA 1HXS2 3ZXGA 1ZM1A 1EAH1 1URXA 3RRDA 2GNTA 5DN2A 4GB33 2IUWA 2RS32 4HKWA 1PZ7A 5F8PA 3IM0A 2A6WA 4OHVA 1DGRN 2VQUA 1PO13 5GZEA 3VHPA 3WVJA 1IGOA 2L9LA 1XU2A 4IGQA 4YG0A 3UGHA 3NV1A 4LKDA 4CCEA 1QMJA 1BEV3 1PNGA 3R4DB 3ZPYA 1XNAA 2W5FA 3JBG3 2LROA 4R4ZA 5T5OA 1AYN1 4AG4A 1LTEA 1YQ8A 3WUCA 4LA2A 4QKDA 2YHJA 2JDHA 4RFRB 3S7EA 1S0JA 2NQYA 1ULCA 4L99A 1DDLA 1U5XA 1STMA 2MHFA 2RM22 1XE7A 2XMLA 4YZ4A 3RZZA 1IQAA 5E1RA 5C8CC 3OBAA 1AL23 3T3YA 4BHPA 1DCSA 3C7GA 1RUD2 3AKSA 4LBNA 5DUVA 4FTBA 1KJLA 4QWNA 4JHTA 2G4IA 1WGPA 4OCTA 4QPGA 4UW6A 1ND3B 4E2QA 1ONAA 3I8TA 1RVF1 2XBO3 1IKQA 1ZBA3 2E7TA 2XQXA 5A7OA 2HWE3 3RG0A 4NAOA 5C5TA 4P9IA 4MVTA 4A6SA 2E7QA 4Q8LA 2BV4A 1G9FA 3UGFA 4CDQC 3D82A 2BGOA 1CR7A 4Q4V2 2Y6JA 3MIEA 4JAAA 3LE0A 3POSA 4AI9A 1TEIA 3LFMA 4D7SA 2GN7A 2JG8C 2W46A 2RDRA 4Y24A 3SEPA 4CRQA 1EAH3 3AB0A 3Q8BA 4UFHA 4XFCA 2D97A 3VZKA 5DZGA 1CZVA 2HH9A 4ZZ5A 1GU3A 1BYHA 1X9TA 2HWD1 2W3JA 4NVPA 1YJKA 3VHRA 1SFYA 1C1LA 3M3IA 4KG0A 4RHV2 3HQRA 3VBFB 3ZYGA 3TRSB 3IDBB 1OLRA 3WG2A 2PLV2 1Y9MA 3PUAA 4KU8A 4UAPA 4XURA 5C7GA 5J98B 3J8F1 1W28A 1SFNA 3ZKUA 2J1TA 2RHPA 1W6MB 2ZMNA 3ACGA 5HCHA 1JZ3A 3DCQA 3VGIA 2FCVA 4L9BA 2B8MA 3AL6A 3NJVA 4W4ZA 2JDAA 3KT4A 4Q8KA 2I07B 4M4PA 3PVBB 4OVEA 3H1MA 1NQDA 3VKOA 1XPWA 2QUOA 3UETA 5JXJA 5DAXA 2ZGTA 4XFIA 5GALA 4YWAA 5FY8A 1RJ7A 2C26A 2VUDA 1RVF3 4K6BA 1LKNA 1GYKA 3DYOA 5A3WA 2VCBA 4LBQB 3WG3A 4CP9A 3ELNA 4MXWA 1RUI2 4R4XA 5L36A 4C0HA 3LEKA 1QJEA 3TN91 2ORZA 1Y7BA 3LD8A 4HKOA 4WM8A 5H9PA 4D7YA 2XJRA 2Y0OA 1AXZA 3PL0A 4MGZE 5LK5A 5FAXA 2V4AA 3BALA 4UFJA 4YGCA 3A4UA 4LBMA 3FL7A 2NLRA 2YU1A 1YUDA 4DIQA 3DL3A 1JYXA 1GOFA 4KG8A 5BUVA 4Y5Z0 2ZCWA 4DS0A 1DLLA 4QB1A 4M4RA 1UMIA 3AL5A 3DF0A 3MW3A 1V70A 5GLVA 3H1YA 2HWD3 1VAVA 1YQCA 2ILMA 2PN5A 2XJPA 1WUVA 3E6DA 4QPIC 4D94A 3VDAA 2Q8DA 2K0GA 2E7AA 1RUNA 4XDPA 4AR2A 1YXWA 3C7HA 4X6QB 1QXPA 2CSGA 4FI9A 1LJ7A 3S5QA 3IDAA 3UJQA 3LDRA 4FPLA 2R062 4H7MA 3J8F3 4ZS3A 3ZR6A 1GR3A 5FZ1A 3TNQA 1IKPA 2HWC2 3KMHA 3NAPC 4IUGA 5D8AC 2P5BA 3VD3A 3ZXLA 5KC5A 2Y6HA 3I2IA 3OOXA 1DF0A 4H14A 1A78A 1O8SA 3PJQA 3ES4A 3TB0A 4PIYA 3DN7A 5FMOL 3NKTA 1N1VA 5F9TA 3FHIB 1W9WA 2RR11 3RI9A 3VBFA 5A6QA 4OQ8A 4LR4A 5FO9B 1Y9QA 3PUSA 4NWWA 4CPBA 4EN8B 1C8M2 2BFUL 4AHXA 5FRAA 4AHYA 1C28A 4LIVA 3TN93 2RMU3 5JR7B 3LSDA 5JMCA 1JYNA 2GP5A 3LDKA 4BQ5A 1QJZA 2HBUA 3O14A 1AX0A 1PX3A 4NWVA 4P9JA 4Q4Y1 4BMEA 4D3WA 1JOPA 2CWMA 4IEZA 1QNYA 4A2UA 3NJYA 4R9BA 4XZUG 3C2UA 2ZZJA 3GYDA 2F6BA 3HPNA 4NPRA 5FY0A 1G9AA 2Q8OA 2CYFA 3ZFEB 1W3VA 3M3EA 1R082 3RJ2X 4MV2A 1OF4A 2FDFA 2XB6C 1ND3C 2YPJA 1CIYA 1H2MA 2RS52 5F6KA 1Q8QA 4GWMA 1L7LA 4XFFA 1NCRA 4B7EA 2LM3A 4M0NA 5CVRA 4LUKA 1YO8A 4HONA 2ZGSA 1U5ZA 2EAKA 4XXAA 4KGGA 4MGQA 1S0IA 1OQ1A 1E5HA 4XBNA 1WD4A 2VCAA 5JPNB 1UW8A 1NCQB 2OZ6A 3DXTA 3RWKX 1PVXA 2OPKA 4PLMA 3ALQA 4HL0A 1ZBE1 3MYXA 1RUC1 5KBFA 4A44A 4Y1YA 4CP0A 3SCHA 5EP9A 3TBDA 4LJHA 1JMUB 2RR13 4YG6A 2Q1ZB 3UKTA 1SZBA 1HB4A 3OEBA 1JU3A 1KGYA 3FUQA 4LA3A 1QDOA 2CGNA 3NNMA 4A41A 1NY71 2QBXA 3H8OA 1V00A 3OBZA 3GF6A 5IAVA 3D0SA 5FZMA 2EALA 4NIAA 2WLQA 4Q4Y3 1AR63 1DP0A 2JDKA 5LBEA 1AF9A 1HV0A 1SBEA 5FP8A 3GGLA 4GWIA 3X29B 4AI1A 1ULOA 4WZCA 3I49A 2QQKA 1PVC1 1RC6A 2ET7A 4I2OA 3NQHA 2GC0A 5BPXA 1VBD1 4CU7A 3H8XA 3BKZA 1SLTA 3ZYBA 4QGLA 1GWMA 4AVTA 2ARXA 3LWCA 4L11A 4XJUA 5HCAA 2Q30A 3LIHA 2XJQA 4I02A 4JX0A 1S2EA 2ZX3A 1CVNA 2HYXA 3QD6A 4EZ4A 4N9HA 1CPMA 5T5PA 5FY9A 2VZ1A 2IXJA 4G4FA 3NWKA 4C91A 1V6JA 5DUXA 4YSFA 2Q8EA 5GLZA 3LOBA 1LEMA 1VR3A 5G05L 2R041 4LMFA 1L7QA 1ZBE3 3CEWA 1RUC3 4JZRA 3ZFEA 4NHKA 3OG2A 1OA2A 2GN3A 3PDQA 1AR92 1MPXA 1HIXA 2A7AA 3HVDA 2WLPA 4IGOA 3O1OA 2ZX4A 4ZXEA 1X8EA 1TVGA 1NQJA 3AFKA 3I7DA 1YLLA 3MLKA 1W2AX 4GULA 1QOSA 2ZX0A 4LUMA 4LBJA 5I0RA 1RHI2 2Z79A 3OTFA 1A34A 2WNUC 4YW5A 1OKQA 4IE7A 1XJAA 5A3PA 3GBFA 4FO9A 2AGSA 3POYA 2A6VA 4AQ6A 1XYOA 1AHSA 3NL1A 2FCUA 4ZPIA 1VP6A 4NR1A 1YCIA 4RGKA 1ULEA 2VMCA 3HT2A 2YMZA 4QDSA 1VAKA 2VQTA 1O3SA 1POV0 2KD7A 4P9WA 1PIV1 1XYPA 2HEYF 1VBD3 2BGPA 2R49A 2YY1A 2AZ5A 4TYSA 5APAA 1CZSA 4I09A 4AF9A 2PTMA 3VHOA 4CEWB 1AUYA 3HQUA 2DVGA 2VMGA 5FLJA 1RXGA 3RPQA 1VB2A 4YYOA 1DYPA 3LA2A 1JI6A 1UYZA 3OD0A 3QLQA 3H7YA 3NV4A 3H8RA 4YPJA 1OD5A 4BQ3A 3BOPA 1NXD1 5M0TA 1ODNA 2DWRA 5FZAA 1KQRA 5JXGA 3DXUA 3LOIA 3LAGA 3NW4A 3KSCA 4FTSA 3LZZA 3I3BA 3U1XA 3HR9A 2R043 1HN1A 1F15A 5F37A 4NOTA 2OZJA 5J7MA 2A3XA 1REEA 4GB32 1W2OA 1CIWA 2Z2SB 3E5XA 3HN1A 4LKEA 5D21A 3B93A 4Q0PA 3AZXA 4ARXA 5JAXA 1K12A 3CZJA 1BEV2 4L2NA 3JBG2 2IFWA 2HLEA 3GBWA 2CDOA 1MZ6A 2P4EA 2RDSA 4AQ2A 1TZOA 2PHXA 1V0AA 2WWUA 4XW3A 3IZOA 5DQ0A 3VN4A 3O1PA 2ZPXA 4K7JA 3ZFGB 1XU1A 1ZZ7A 2D3PA 3NO8A 4Q0VA 2DCYA 4GA9A 3UGGA 3B69A 2ZGOA 3M3OA 1LHNA 1QY4A 4MO3M 5FUPA 3WNNA 3WNMA 4U36A 2YXSA 4FQ4A 2R16A 1ZA7A 3M7AA 1NCQC 5SV5A 3IMMA 2VG9A 2VECA 1S2BA 1W39A 2P37A 2VCCA 1DG6A 4NUBA 3WW4A 1W9TA 1ZX5A 1FV3A 1ZBA2 4CDUB 4IETA 3VBUB 1X33A 2EIEA 1R1ZA 2VMEA 2DBIA 5KXBA 5KXCA 1C5HA 1W8WA 5JZGB 4BJ0A 1DQ1A 2BP6A 1EPWA 1M4WA 2MNGA 4PF1A 4AVCA 5CADA 2FZ2A 1OC1A 2WFF1 3VBSA 1GP4A 1WW6A 5LZ6A 1Q56A 4FFFA 1SLCA 5BNPA 1NOVA 1L7RA 2QVSB 1PZ8A 1EAH2 4MYEA 4B4RA 4CEWA 4CEYA 4C1WA 5FOJB 3INAA 3WX5A 3ZYJB 3LEIA 1EV11 1VMJA 2YGMA 1TMF1 1K5MB 2BNNA 3N9LA 2WAAA 4XETA 3VLBB 1YQ5A 1AYN2 2JDUA 2VW0A 1DU3D 3IIIA 1JN2P 3HQXA 3ZYPA 3L2YA 3M4FA 4UWDA 3RGBA 1FT9A 1X36A 2DU0A 4N7IA 5JCTA 4XDOA 4KL1A 2IFRA 2DTWA 2P3KA 4QX7A 4QX1A 1GZCA 3OYWB 4BK4A 1G9DA 2V4VA 4YM1A 4DOUA 3U37A 1OFSA 2XQRA 3EJKA 4XABA 4QXKA 4AVSA 2BQPA 1H2NA 4A7KA 2YU2A 1OFNA 1QJU2 3H0OA 5EPAA 1NE6A 1JYCA 2ZACA 1KD7A 5J96B 1APNA 1RUOA 4KWKA 1DGLA 1PGSA 5FPXA 1R1A1 3ZFGA 2QQJA 1MS4A 3CDZB 2ETEA 4NROA 3KWVA 1RUJ3 1X82A 3RYKA 4WVVA 3VV1A 1AXKA 2O8OA 4HVRA 3VHNA 1IG0A 3ZR5A 1VBC1 5ABJB 4W65A 5FOBB 2WSVA 1FYUA 2QQLA 1HX6A 4LORA 3PTYA 3BVCA 5CG8A 4QB6A 4YG3A 1BZWA 5GZCA 1H8TA 4XFBA 4E27A 1UOGA 3K48A 1OLME 3O1VA 3U4XA 4QKBA 4XF1A 3ACLA 1EV13 2IXIA 1W2TA 1NZIA 2SBAA 1AVBA 1TMF3 2HWD2 2TNFA 3JU9A 2NM1A 4I3GA 5IWFA 2DCKA 1U12A 2VQ0A 4QHBA 1O3QA 1YFUA 2DU1A 2OT7A 1UWWA 2VOTA 3SCGA 4CEWC 1WBLA 2A75A 1QXJA 3S6PA 5A3MA 5K0UC 3U4SA 5FY1A 4BIOA 5B4NA 1JZ8A 3H3UA 3E5UA 3QOPA 3W9AA 3GHMA 5FYHA 3ITQA 3J8F2 3CJIB 4QGMA 1V6IA 4Q0UA 5C70A 5FYTA 4Y1ZA 4IGPA 1NE4A 1ENRA 1KFUL 3H3LA 2VVDA 3DYPA 1ST8A 5DDJ1 1Q8OA 3TAYA 1K5MA 4OHZA 5JDBA 4BE3A 4F83A 4AAPA 3KVBA 3LB9A 4H3WA 2HWF1 1H2KA 3Q8CA 2G9FA 5JIUA 1R1A3 3RYRA 4ASMB 5GZFA 5FZBA 3WP4A 3J7LA 4DY3A 5IK4A 3J9SA 1DBNA 2O1QA 2KR2A 2QTWB 2VMFA 3OEAA 1G7YA 1VIWB 3IPVB 3QH6A 4OQ9A 5ACA1 5C3RA 1VBC3 1FNYA 1VBB3 3CO2A 2FHRA 3AZVA 2FDIA 1WA4A 1QHDA 4FTEA 4XBQA 2JDMA 1XSRA 3K51A 3PU3A 3PU8A 3A0NA 3J26N 3M8LA 1W6QB 2QDNA 1LOFA 2VVEA 4CCKA 1AXYA 1LHUA 1KDKA 1W8NA 3ROUA 3SC7X 1V6OA 5HXVA 5I0TA 2CGPA 5F3CA 4IV1C 4K8RB 1HQWA 3WNPA 1G86A 1DQ6A 2TUNA 3MFAA 4Y1XA 5E8AA 4I0AA 4CUAA 3H1WA 3U78A 3GALA 1UZVA 1T2XA 3Q8FA 3BTZA 1JW6A 2OS2A 2ZA9A 4RA0A 4Y22B 1DYKA 1LOAA 5B4XA 1HB1A 3VBUC 3VZJA 4CDUC 1SPPB 3WNKA 5JOZA 2WINB 1YIPA 1H1AA 5JZGC 4Y26A 5FIXA 3U0ZA 3ASIA 4K1YA 4QQHA 3RMYA 1WCDJ 2H0VA 1MACA 5A33B 4B4PA 2C9KA 5JSRA 1O5UA 5FZ4A 1UOJA 4IV3B 4IEWA 1YIFA 2W47A 1WCUA 2VD7A 5IATA 5GLWA 5DZFA 4B8EA 4NIHA 4OI1A 3BIEA 2RR12 2JXAA 5JMOA 4YVWB 4H7LA 2XLFA 2AENA 2JDYA 4Q1PA 3AJYA 4GKYA 3KV5A 4R9DA 2YC2A 3VD9A 2ZKLA 5JXIA 3WQBA 1CAXB 1BHGA 2VZOA 1ULDA 5FY4A 3THPA 4L0PA 3TEWA 1W90A 3LGRA 1OLMA 1CAWA 1WD3A 3SCFA 4CDXC 4Q4Y2 4WBBA 4D69A 1BCXA 4NJ4A 1T6BX 1UD1A 2OW4A 3AMMA 4Y1VA 4YVSA 1NKGA 3SITA 2WABA 1A3KA 2B45X 1QNWA 2WNVC 4N7UA 2XOMA 4LKFA 5C6CA 1DZRA 2WN2A 3R4UA 2ZHMA 4AVBA 1J3RA 4GALA 1ENQA 1FAYA 3FLRA 4C8DA 3AZWA 1UYXA 4JTOA 4WVMA 2FCTA 5CAZA 3IPVA 3I2OA 1HLCA 5FZ3A 2WS91 1UZWA 3TNPB 4DMIA 3FHAA 2OX0A 5EFUA 5AC91 5CFCA 3UKNA 1OA3A 3R6SA 2BGCA 3S7IA 3BPZA 5L7OA 1J59A 4AEDB 4GJYA 1YFWA 1FNZA 1W6QA 4PLOA 3VD7A 4YM3A 2CAVA 3PVOA 3WSOA 4OI4A 2R0HA 2MEV3 4XIOA 2A6YA 4UBGA 5ABJC 5KHIA 4BQXA 4AYUA 5EWSA 4ONUA 3E1F1 3MW2A 4ZONA 2D93A 5FUNA 1RUC2 4I0WB 3ZXFA 3WNOA 1R64A 1ZYBA 1OOPB 2JE8A 3WG1A 1QF3A 1W6NB 4WVZA 4BB3A 3CNAA 4D6SA 4XAEA 2XL7A 1NY72 1I5PA 3UT0A 5CIRA 5F2SA 2Q8CA 4DFSA 5A33A 1J84A 4BH9A 4EWDA 4JDMA 4AFDA 1O4YA 2ZEXA 4IV3A 2ZHKA 3KCCA 5H9SA 4Z2AA 1QOTA 2CHHA 3JUUA 2D7FA 4AI3A 1H4GA 3DUIA 1UAIA 3CJIC 5CFDC 1HDKA 1OKOA 1Q3EA 1WA6X 1FMD3 3AJZA 4KWJA 5C8WA 1LB2A 1V6MA 3AKQA 1PVC2 4LIUA 4GD4A 4IEQA 2Y6KA 2PAMA 5FMDA 5FREA 4UW4A 2ZGRA 1V9U1 4HVQA 4AHWA 1VBD2 3E5QA 4MOAA 4XFAA 4IEPA 1Y3TA 2CY6A 3EYPA 3BB6A 1JZ5A 5C9AC 4QPGB 1CAXA 4DEVA 2J1EA 2WS93 1QJX1
chains in the Genus database with same CATH topology
5AC93 3HWJA 3AYEA 2JEMA 4DQAA 2Q4SA 4XBLA 3V0BA 1LU1A 1DQ5A 1AL21 3O0XA 1LGBA 1SACA 3ZFFA 1UU4A 5KHJA 3KM5A 1GV9A 1JUHA 1LHVA 4YRDA 1AX2A 2VUAA 4FXKB 2HWE1 2W52A 2Y0IA 2XJVA 3LA7A 3WP5A 4AWDA 4FPCA 1AYM1 1ZRDA 1QOOA 1BJQA 4XF4A 2XH6A 3AYAA 4M01A 4SLIA 2ZX1A 3MPBA 4AVVA 4JTNA 2BNMA 1OOPA 3WY6A 1H30A 1WMFA 1W6NA 4PBOA 4EJRA 5GLUA 4IV3C 1LECA 1V9U3 4NHLA 1PIV2 3V65A 1X50A 2A6XA 5IK8A 4ATFA 4KQ7A 4YVWC 1QJX3 1VBA3 4KBBA 1UX6A 1X8MA 4N43C 4EN7B 1RUH3 2VW2A 2A3YA 4MXWB 5I93A 2BPA2 2JE7A 4WM8B 5DZEA 5IUQA 1PO23 1DIWA 1J58A 1J3PA 1F5FA 3B00A 3VBOC 3MZHA 4TLFA 5AFEA 1ND2A 1A8MA 1IS3A 1DQ2A 3HBZA 4CDWB 4DINB 2NP0A 3VL9A 2R32A 3ILRA 3N4MA 4ITCA 2NYYA 4META 1OA4A 3N7KA 4JGZA 3SNMA 3WG4A 1AYM3 4QQ2A 1YI9A 1UCXA 4WM7A 3ENRA 1FOD1 4AEDC 4K1ZA 2GH8A 4XJWA 2VUJA 1LU2A 2GALA 2DYCA 4NN0A 4OUSA 4XILA 3WQ7A 3VZLA 1QWRA 5LRRA 1ZRRA 2R071 4YFZA 2HYKA 3SH3A 1OOPC 3ETQA 5JPMB 2V73A 2WZPP 2HWB1 4IL7A 5J3UA 3WP3A 2H6CA 4KH9A 4E4ZA 1H4HA 4IESA 1FPN1 3AKRA 4J1XA 2WT2A 4ORFA 4AGVA 2WFF2 2DV9A 4Y4YA 1FXZA 3HMYA 4S2HA 3M1HA 4P14A 3AFGA 1S1AA 5BV6A 1EV12 2ZABA 1IPKA 1TMF2 1GZWB 3MLLA 4L8QA 3ZN6B 2RMU1 4LHKA 4QPGC 3WD5A 4TWTA 3KT1A 3WXPA 4LBLA 3OCPA 1NCRB 3I4IA 2FBEA 1FOD3 1D4M1 4J1WA 2XLAA 2D6PA 4CDWA 3FUOA 2O0OA 2UWAA 3VL8A 1PGL1 2XVLA 4JDNA 4IEXA 3GBGA 3M3CA 1ZREA 2W0XA 4PLNA 2GC2A 2R073 2DCJA 1E57A 2B9UA 3UK9A 4FPJA 2HWB3 1ZRCA 1R1A2 4JV4A 1S0FA 2WSUA 4E9KA 1FPN3 1DZTA 4NO4A 3H50A 1A8DA 4M00A 1VBC2 4XQDA 1HQNA 2P3IA 2V09A 3JZVA 4CTEA 4Z2WA 1XQNA 3KS7A 2DF7A 4LO4B 2ZBJA 4N53A 4B29A 4E4SA 5IK7A 4SBVA 3ZXDA 1ZRFA 2ZZQA 3AKPA 3RI8A 2ZGLA 4K9SA 4MXVA 2YUEA 3U10A 1AR61 4XQWA 2OYZA 2UYAA 2YYOA 1GICA 1D4M3 1I5ZA 4HBNA 4WM8C 5HBAA 3P3PA 2X53S 1YYNA 1GZ9A 5BNNB 5DDJ2 1GZWA 4AGGA 3ZN6A 1BVP1 1O3RA 2YC0A 3LKJA 2ZMKA 4N90A 4FSJA 1COV1 2HWF2 2NMOA 1VJ2A 4XJZA 2E53A 4FOYA 1HRV1 1MS8A 3UL2A 1ZZ6A 4LO8A 2V5YA 1GQHA 1LCLA 5ACA2 3A0KA 2D3SA 2IC1A 1XE8A 3MGUA 3WLUA 2CTVA 4R52A 3VDDA 3PVNA 4BLIA 2YDEA 4XEZA 2HEWF 1HW5A 4YLZA 4KWLA 2VY0A 3NV3A 4AQSA 2WZR1 4K40A 5JIAA 5C4WA 5E16A 3VBFC 4Z1VA 1JBCA 4A7YA 4FVVA 4HETA 3H8UA 4X6RB 4MH0E 1LHWA 5H9RA 1BMV1 4I01A 1DGWX 4XHXA 5BNOA 5KHKA 1CJPA 4QPYA 4YZ3A 4I30A 5KXDA 2UWBA 1U5YA 1C4RA 3AXDA 1ENXA 5T5LA 2XVGA 2XUMA 3OF1A 4XPVA 2XG3A 4MGIE 1COV3 4FQZA 1PK6B 2GNDA 3AMNA 3B02A 1WW7A 2A5ZA 1HRV3 3FMGA 4WVWA 2WQ4A 1A6CA 5GZDA 2AUYA 2GH2A 4EROA 1CPNA 1RUF1 3ZSLA 2RS11 2VNRA 1NCRC 5BNNA 2KXLA 2WWSA 1RGSA 3VBRB 1D2SA 2WT0A 2H0BA 2D6NA 5HCBA 4B4QA 3VKNA 2ARBA 2B46X 3AP7A 3ZSMA 1ALYA 1ZZ9A 2WZR3 3ZXJA 1WLTA 4OZXA 2AH2A 2UY9A 2QKDA 1F2NA 1RUE2 1PMIA 2D5FA 3J4UH 4FP3A 1RMU1 5DUWA 2WS92 1MR5A 1WBFA 1FI2A 4LBQD 2DVAA 3MI8A 1V6NA 4V1PA 3OBTA 3SH4A 5LK7B 3MPPG 1R091 2DUQA 3BODA 4QD2A 3JB8A 3N3HA 4RQPA 3VBSB 4A7ZA 2XJUA 5BNPB 5JVVA 1H9PA 3ZDSA 3H9AA 1AR73 1Z7S1 4FPHA 4XOGA 4AK3A 4CEYB 2QFEA 1QQP3 2BEOA 4YGDA 3ZO0B 1WMDA 3MIBA 4JGYA 2OVUA 4L92A 3LA3A 1GSLA 4AFAA 2WNEA 1RUF3 3RJRA 1PGW2 1GQGA 1CAUA 2RS13 4AFBA 3ZMOA 2ZHLA 3IDEA 2Z69A 1VAMA 4Q4X1 1PO12 3SHRA 4D7TA 1PK6A 3WV6A 1ZZBA 1W6OB 3ZFEC 1V9U2 1VRH1 1O4TA 3PMSA 4LTAA 3GNEA 3PMEA 5F1RA 1RMU3 2XLGA 2GNBA 4A3XA 2IWGB 1QJX2 3EQEA 1UZYA 4XJ9A 2D6OX 1XYNA 1F31A 1KJRA 2EXIA 3VBRA 3JD71 1R093 3WINE 3N35A 1HKDA 1AL22 1FV2A 3KD4A 2D98A 4BLJA 2BNOA 1PHMA 1NA1B 3TOJA 2JJ6A 1POV1 3HAGA 3MW4A 5DG1A 3AYCA 1S0GA 1Z7S3 2WA4A 1MEC3 1H8TB 1LOGA 1UZZA 2JENA 4Z8BA 2VULA 2XBO2 4PDWB 3RNSA 2VGDA 2HWE2 4NHMA 1O7FA 4ES8A 1RUJ1 2B5HA 3TWIA 2VH9A 1AJKA 1YWKA 3KGLA 1AYM2 1U5IA 1U0AA 3USSA 4P9YA 3T2TA 1CN1A 4EN0A 4Q4X3 4DNYA 5IT6A 2GC3A 3D8CA 1VRH3 3FX3A 2GMMA 4I3PA 1CD3G 2RM23 4UW3A 3MICA 3I59A 4MGKE 2VNGA 1TNRA 1KITA 1HRI1 4BZ4A 1SLBA 4GKXA 4UBHA 3JD73 4AEJA 4XJAA 3AP5A 1NG0A 3ECQA 2BUKA 1W6OA 5GM0A 1S2KA 4XFGA 4RS5A 1POV3 3RMXA 3PJYA 5FBZA 3SMHA 1W2UA 1KXGA 1RVF2 4FPYA 4FOQA 4HANA 1H2LA 4GMP0 3JB4C 2GMPA 4YGEA 1VBB1 1NA1A 2VQAA 4M3CA 4B7KA 3B9IA 5FLHA 1C5IA 4P9LA 1FATA 4XHBA 3VBSC 4PDWA 5BNPC 3WCRA 2ZMLA 3OPZA 4LE4A 1CAVB 3ATGA 4CEYC 3BTAA 2R072 5FTTC 2D5HA 4Q1RA 2IXLA 5JOXA 1RUG1 4QGNA 4XZPA 5F5QA 3FC0A 1S0CA 2HWB2 4JC1A 4QM8A 4QT6A 1HRI3 1LRHA 4AGRA 1AZDA 1FPN2 2RE9A 3KLSA 4AHZA 4DY5A 3IWZA 3M3QA 1CAWB 4R8HA 1Q43A 4FBFA 4F8AA 2XJSA 4AE2A 4YVSB 2XWBB 2X8KA 1H1IA 2VPVA 4AI2A 4W6WA 5KC6A 3N7MA 5KHHA 4WVMB 3TN92 5DUUA 4GWNA 2RMU2 5CFCB 4OULA 4AFCA 2QJVA 4Y20B 3ZFGC 1IS4A 5L7OB 3RDIA 2JICA 3B3QE 2JX9A 1D4M2 3VZNA 3I2DA 2IXCA 3N36A 1EPZA 1NA1C 4ZU4A 1IZ3A 4ATEA 1PGL2 2DVFA 1B35A 4K21A 3PHMA 1D2QA 2WJSA 1H8TC 4RR3B 2CV6A 2JG9B 4OHWA 1RUG3 3B7MA 2YROA 5CB7A 1TE1B 4BM8A 4YARA 3IBMA 4WZFA 2P2KA 2X5IA 3JCIA 5DG2A 1TME1 5JI7A 1O91A 1JTZX 2MEV1 5JOYA 1KRIA 4Q4W1 4EV0A 1Y43B 2HKXA 4LULA 1X7NA 2R1DA 2GDFA 1CAVA 4OHYA 4ZU5A 4CYDA 4PBPA 5I8YA 4IQPA 1K5MC 4U2AA 4W6YA 3RYPA 5EXOA 3WDVA 3VKFC 3AMPA 4IEVA 1AR62 4HSJA 1H1MA 3V0BB 2PHTA 1C3HA 3HIFA 4Z92B 1FMD1 1UU5A 1UIKA 1WLDA 2XGXA 5K7PA 2XPJA 1HV1A 1R083 1UU6A 1ENSA 1LENA 2P17A 3ZFFB 1UPSA 2RS53 1WW5A 3ZXAC 2VNOA 1AJOA 2UY8A 1LOFC 3FLPA 2H6BA 5J48A 3VBHA 4YFWA 2VMHA 4Y20A 1OPOA 2BBVA 1LESA 2OA2A 3AM2A 4PQ9A 1HRV2 3EBRA 1ZZ8A 3I54A 1YFYA 1EP0A 1TME3 1GNZA 4OHXA 2QNKA 1ASJ1 2BW8A 4Q4W3 1SDWA 1WLWA 4HLTA 1ZBE2 1GFF2 4WV8A 2E63A 4RR3A 4CDQB 1J1LA 5CAZA 1OQDA 2JG9A 5JSOA 4AEMA 3QBQA 2Y38A 2GAUA 2WZR2 2WA3A 3WW3A 1NXMA 1QU0A 4I0BA 5FMOS 1C1FA 3KQRA 4HK9A 4MGYE 3AZYA 1Q8SA 3DPRA 2BFUS 1BMV2 1LGCA 4GH4A 4Z82A 4PCRA 5JI9A 2D44A 2PHFA 2WC2A 1REFA 2W39A 1ND2B 4C1XA 3IKWA 1H9WA 4YVSC 3E6CC 3W58A 2PHDA 3ZIWA 5HI0A 1VBA1 1RUH1 3M2MA 1SQ4A 2A71A 1QJY1 1VLNA 3IT8A 2C9AA 2DVDA 3O5SA 5CBLA 4JGZB 2DVBA 2ZTNA 1F9KA 2EXHA 1PO21 1BKZA 5CFCC 5SV8A 1RUF2 1AR93 3P3NA 4WM7B 2O8QA 3AMQA 1ASJ3 4Q0QA 4DRRA 2RS12 5EYXA 3WDTA 3UV9A 5L7OC 4R9AA 2R042 4YNIA 1F8VA 1G6NA 3Q9OA 2Q1MA 2YZ4A 1BBT1 4C90A 1RHI3 5I0SA 1WCSA 1MS0A 1LODA 5C8CA 4XFHA 3R0RA 1NLSA 3T1LA 4C0BA 4INDA 2ZGMA 1AR81 2N7GA 4PF5A 1ZVFA 1KDMA 1RMU2 2ZGQA 2ES3A 3WOGA 2OUJA 3GZTB 2HJIA 3SISA 2NPIA 1VALA 2R1BA 4O9EA 2QDRA 1R092 4CDQA 5FQ0A 4OFGA 4MSVA 4FAGA 3ZYRA 5CU1A 5D1IA 1REDA 2JG8A 1Z7S2 2BYVE 2DUPA 3H3ZA 3NAPB 5D8AB 1Z78A 2DUOA 1YHFA 4KGQA 1OMIA 1GBGA 2WQZC 4L97A 4EWEA 1QJY3 3MFCA 1JUIA 3DGTA 4K20A 3RWNA 3VKLA 1MS9A 1LGNA 4AEKA 5I0UA 4TZDA 2VOWA 3W59A 3AP9A 1XXNA 4UW5A 2QZ2A 1BBT3 1DQ4A 4Q4X2 3ZFFC 5J09A 2EXKA 5AVAA 2F4PA 3WDUA 3FZ3A 1VRH2 1SCRA 1AR83 4FPOB 2KA3A 3QACA 3ILNA 4Z07A 5B2GB 4DXZA 3V0AB 3G7DA 5BXXA 1QJU1 3WNXA 1SLLA 2EF6A 3JD72 2WIIB 1H0BA 3USUA 3WHUA 3AZZA 4DRVA 1SBDA 5T54A 3R05A 3VUOA 1TQ5A 4HN1A 3AP4A 2GC1A 4N53B 4QQLA 5T5JA 2GU9A 1RUJ2 1YI7A 1S0DA 2C0ZA 4MLOA 2JE9A 4QPIA 1UF2C 3OY8A 5EJ3A 2C1FA 5L73A 2QQPA 4XTPA 1RB8G 3O7OA 2PHLA 1D0HA 4S2FA 4HVOA 2ERFA 2CL2A 2KM2A 1AYN3 3ILFA 3NV2A 3NAPA 5D8AA 4FPEA 5CA6A 3MLJA 2EVXA 4JVAA 1IS6A 4PJYA 1ND2C 2VU9A 2DCTA 5CNAA 4JQRA 1I1EA 1F5JA 1JH5A 1NYWA 2YV8A 1QJU3 2PAKA 1HRI2 3WT3A 4JGZC 2PHUA 1MVEA 2GSYA 4HPKB 4WM7C 2I2SA 1MZ5A 5AFBA 5FCCA 1IPJA 4YZ5A 3VDDB 3OGJA 5T3NA 5BY5A 2GZWA 2R6QA 2W68A 4AFMA 1O4ZA 3V0AA 1I6XA 5C4WB 2I45A 1Q8VA 1MZEA 4XTMA 3APBA 2FZ1A 3WDWA 1CGPA 1VBB2 1ND3A 4XE9A 3WQ0A 3MF6A 4FOWA 4QQPA 5FDBA 1O5LA 1DGWA 3EXUA 5BNOB 4COZA 5GZGA 2WNUB 2Z42A 1C57A 1WW4A 3CLPA 2BTVC 3ZMNA 1ULFA 1RUG2 2E6VA 1VBE1 4F7ZA 3FBMA 3NJZA 2PHRA 3KGZA 3GHNA 4PIXA 2P3JA 4P9GA 4K8FA 2VMIA 4YW4A 4Q29A 1Q8PA 2C5DA 2MPFA 4ISQA 4LE3A 5LRSA 1WLCA 3WZ1A 5J36A 4CDWC 4W6XA 2VOVA 1W6MA 2Q0AA 4LHLA 4O9GA 5E88A 3V64A 2VOKA 4HT1T 3O0VA 3AXEA 4DZGA 4AVAA 5DXDA 2ZX2A 2VW1A 3L2HA 1KS5A 4HPKA 4ZKTB 3AMHA 3WUDA 3ZSEA 2PYTA 4KNCA 1OSGA 4LBQA 2LTNA 4M0HA 2CWSA 4RQPB 2BVVA 5C33A 1DFQA 2XKPA 2BWAA 3KCXA 1RIRA 3ZYIB 2NMNA 2ZAHA 2B7YA 4COVA 3RSJA 1V6LA 1LOBA 2FQPA 4N53C 1VBE3 4JGYB 5A3LA 1QXRA 1TME2 2MEV2 1CAUB 2WNUA 4GIQA 4E2GA 4Q4W2 5I8SA 4LO5B 1N1SA 1AR71 4RFT0 4FPFA 4S2GA 1QQP1 1OQEA 2XKOA 4OLLA 5H9QA 1BQPA 2GNMA 3MDPA 3SXWA 2D43A 3ES1A 3B94A 3AP6A 3KCYA 3UJOA 1N3PA 2EXJA 2XJTA 1UN1A 4FPKA 3U11A 3MIFA 3B9CA 3M70A 1DHKB 3D0JA 2UYBA 1YNAA 1JOJA 1FMD2 4LHNA 1MZFA 4M3CF 1D0GA 4QU2A 3GZAA 4EWAA 4ISRA 3FWEA 3GZUC 4PIZA 5FO8B 3VDDC 1ZA4A 2ZGUA 4JRAA 5AC92 4OI0A 4FT8A 1J1TA 3FLTA 3ZSKA 5C4WC 3D4KA 1DGRA 3AKTA 3PNAA 2EA7A 3CJXA 1D4VB 1RITA 4YW3A 4JRLA 1ASJ2 1KFXL 3RQ0A 1N3OA 3MIHA 5EV7A 2ET1A 4IEUA 1MEC1 2CAUA 2ATFA 5BNOC 3LSEA 1MS5A 1LEDA 1DZQA 5FFOC 2ZGKA 1NCQA 1HXS1 2HEVF 2RS31 3S30A 4XIKA 4BYYA 1LHOA 5KWRA 1IS5A 3I59B 3D5OA 1PVC3 4UXAA 3R4SA 1CONA 2B42B 2D6MA 4HK8A 2JDZA 4LBKA 4AW7A 2E51A 3WDYA 5GKAC 1C8NA 4FOVA 4YW2A 2A70A 4M3CE 2BVBA 3O12A 5I91A 5K0UB 3THTA 4Q27A 3H7JA 4XJ8A 5BNNC 5J37A 5K9YA 3PVEA 4RS5B 1WCKA 2R0FA 2PHWA 1EY2A 2RM21 4Y1UA 2DTYA 3IN9A 3ZSJA 2OUHA 1YJLA 4P9XA 3MIGA 2GMEA 1UKGA 5CG9A 1VBA2 1S55A 1RUH2 1RUD1 1QJY2 5FO7B 1W6PB 2IXKA 4LBOA 3S0MA 4YGBA 1PO22 4IERA 4M3CB 2K9ZA 3E6BA 3POWA 4MZUA 4BOWA 1UIJA 2D40A 2VXRA 3MIDA 2NZ9A 3NKGA 3QH7A 1AL0G 2ZAAA 1N3QA 4Q4V1 1BBT2 1LOCA 2EAAA 4RQPC 3KZ4C 4XDQA 4ZXKA 3OBRA 3FFZA 1BK1A 1KS4A 4YM2A 1HXS3 2XVKA 1AR82 4LO7A 1CX4A 4G9SB 2RS33 3ZXKA 3N7LA 2ZGNA 3EHKA 2JECA 4P5HA 3RS6A 5T55A 5L19A 3IMNA 4JGYC 2UURA 4HN0A 1VB4A 4IV1B 4RHV1 1PIV3 1QH6A 5GJ6A 5LEJA 1W0PA 1SCSA 1V6KA 1QKQA 2PLV1 1S0EA 4DPNA 4N9IA 1GKBA 3BOWA 2LUWA 1GNHA 3MEPA 4FXGB 2SLIA 1LOEA 5KXEA 3ZX7A 1I9RA 4CZSA 1PK6C 1OLQA 1RUD3 3V56A 1G9BA 1OPMA 3NVCA 4RGGA 4XF3A 5HCFA 2D6KA 5K0UA 2JD4A 4BA6A 1SMVA 4QM9A 3VBRC 1RUI1 5T52A 2VVFA 1MQTB 4BMBA 1XNKA 4Q4V3 4XQ4A 2CGOA 4BPZA 1Z0HA 2BWCA 4XF0A 4AQTA 1S0BA 1LULA 1B35B 1W6PA 4CDXB 3NSTA 1BXHA 4JDOA 2WT1A 4B3NA 2R30A 3IDCB 3QCWA 4XYXA 2WNVB 2YGLA 3WW2A 1N1YA 4LNVA 4X8NA 1FOD2 2X5IB 4HZFA 3MF9A 3OD4A 4LLFA 4RHV3 3IIAA 4FAHA 1N1TA 2A3WA 5AVPA 2JKBA 2OIIA 2PLV3 4X8PA 1CESA 2QE3A 3URFA 1ZZCA 2R061 1H8VA 2XHKA 4BQ1A 5JSPA 1G9CA 1JYIA 5E89A 2HWC1 2D6LX 1UKRA 2WFF3 1UMZA 3JQWA 4IEYA 1OI6A 1YFXA 2X29A 1W0OA 4IV1A 3ST7A 3TYJA 1NLRA 4F3JA 1CJDA 1LR5A 4LEJA 3WP6A 3WW1A 5KHGA 1GANA 3DKWA 2WL1A 2AR6A 3FBYA 4H55A 3B01A 2EIGA 4CDUA 3VBUA 5GLTA 2IZWA 1C8M1 1RUI3 1SLIA 3E97A 2ZJCA 5JZGA 4FPGA 4CP2A 4COYA 1RJ8A 2PELA 3ZVXA 1Q5OA 4EN6B 2ZOEB 4YW1A 1T6GC 4AI8A 4CP1A 3VZMA 4RS5C 3AK0A 4LO6B 4RGAA 4GMP1 1PZ9A 3BIWE 1YRZA