4HVOA

1.75 angstrom x-ray crystal structure of cufe reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
total genus 36
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hvoA01
4CYDA 2BGCA 1QXRA 1ZNPA 2H0VA 4OLLA 1VP6A 4XFGA 4LULA 5FPXA 3CO2A 1CAVA 4JV4A 3LZZA 5C8WA 4AVBA 5FPZA 1I6XA 4GULA 5I0SA 5LEKA 5FLHA 4Q0PA 4MV2A 2QVSB 4R8HA 4QGLA 4IETA 4HZFA 2D5HA 4O9EA 3SXWA 3OD0A 2PYTA 5I0RA 4YRDA 3N4MA 4HVQA 3KSCA 3I59A 4BHPA 1ZRFA 3H8UA 1U12A 5BY5A 3NKTA 4L2NA 3MDPA 5J7MA 3CF6E 2GC1A 1Y3TA 2PAKA 4EWAA 2ET1A 4XEZA 2XHKA 2EVXA 2PAEA 2C0ZA 1Y9QA 4ORFA 1HW5A 4XF4A 1YFYA 2XLFA 5FQ0A 1UD1A 1O5LA 3IDBB 4WBBA 5I0UA 3U11A 4EWEA 4EWDA 3PNAA 1ZRCA 4PIZA 2XL9A 4NVPA 3FWEA 4LEJA 3SHRA 4JTOA 4EV0A 4XFCA 5AVPA 1O7FA 1XE7A 1ZZBA 2KXLA 2XLGA 2XL7A 3MYXA 5I91A 2D40A 2Y0OA 3M70A 4DINB 1PM7A 3I7DA 3LAGA 3DKWA 4K8FA 5J3UA 3NJZA 1J59A 3B02A 1TQ5A 4LA3A 2EAAA 2GC0A 4MGYE 4EROA 1G6NA 4XF0A 4BYYA 2Q30A 2OZJA 3MPBA 1CX4A 3OF1A 4I02A 1X82A 1JUHA 1SQ4A 4HMZA 4YARA 5E1RA 3H3UA 3UKNA 2QJVA 1XRUA 3ES4A 4AXOA 3WW1A 1ZZ9A 3PVBB 1O4TA 4QGMA 3C3VA 3M3IA 4KWJA 1YWKA 4FT8A 4LTAA 2MHFA 3H7JA 1GQHA 4FAHA 3FZ3A 3S0MA 3HIFA 4HSJA 3O14A 4IEZA 1X7NA 4HVOA 5CVRA 1LKNA 5T3NA 2DCTA 4PIYA 3R6SA 3WW2A 3RYPA 1CAUB 2GC2A 5BXXA 1YLLA 5CU1A 5JR7B 3FHIB 2Q4SA 4BIFA 3BPZA 1IPKA 4Q29A 1UPIA 5I8TA 3RYRA 3WW3A 4FAGA 1RC6A 4JVAA 1VR3A 4ZU5A 5K8SA 1Q5OA 3E5QA 3QACA 1CAXA 2ETEA 5LRRA 3H1WA 1EY2A 2PAMA 2Q0AA 2XKOA 3E6DA 1IPJA 1YUDA 4YSFA 3OCPA 1ZVFA 4KU8A 3TNQA 3FFQA 5LEJA 3CEWA 1V70A 3SCHA 4LUKA 1J3RA 2PTMA 4F8AA 4MGIE 3I54A 4Q0SA 4XETA 4WVZA 5I8YA 4J1WA 2CGPA 3SMHA 2B9UA 2H6BA 5JSRA 1RTVA 1UCXA 2IXHA 1O5UA 4QX5A 3U10A 4ONUA 1EYBA 2I45A 2HJIA 1ZZ8A 3OTFA 1DGRA 4QGNA 3KGLA 1RGSA 4UXAA 3ETQA 1CAWA 3LA2A 2B8MA 3EBRA 4MH0E 2FMYA 3GBFA 1PMIA 3KCCA 3S7IA 3E6BA 3VHRA 4Q0UA 3H1YA 4Z07A 1CGPA 1ZREA 2H6CA 2UYAA 2IXCA 1QY4A 3LA7A 4AQ2A 2PFWA 4YNIA 1CAUA 2XGXA 2IXKA 1DZTA 1J58A 2UY9A 4KU7A 2D5FA 4LA2A 2XLAA 4D7SA 1O3TA 3EQEA 2B5HA 4Z82A 4IEXA 4E2QA 2IC1A 1EP0A 3BALA 4UBHA 1YFUA 2IXIA 1ZZCA 2BNNA 1O3QA 1Q43A 3LA3A 3KGZA 4MGKE 4IEPA 4JTNA 2PHDA 3HQXA 1UIKA 2HKXA 4META 3D0JA 2PA7A 3HT2A 4J1XA 5KHJA 1SEFA 1OFNA 3DN7A 4F7ZA 4KWLA 4MX3A 1SFNA 4RD7A 1CAVB 1J3QA 3ZDSA 3NL1A 3CJXA 5EFUA 1H1MA 1OI6A 2BNOA 4QXKA 3QOPA 1RL3A 2OA2A 3FX3A 2WC2A 1YHFA 2P17A 1NZCA 2CV6A 2D93A 3KMHA 1LRHA 4Q0VA 2MNGA 1UIJA 5KHGA 4AVAA 4XFFA 2VQAA 4YYOA 4E2GA 4XFIA 1L3JA 5KHHA 1VJ2A 4IEVA 1Q3EA 4P9GA 1FXZA 4IEWA 2GZWA 3D0SA 4H7LA 3H9AA 2BNMA 2PHLA 4X6RB 4L11A 1DZRA 1EPZA 1OD5A 1OMIA 2UY8A 1WGPA 3NVCA 2OYZA 1ZRDA 1O3SA 5CADA 5F1RA 4QM9A 4HBNA 4I0BA 3RPQA 1QXJA 3IBMA 4MUVA 3WW4A 4BH9A 2ZCWA 4ZU4A 4AVCA 4X6QB 5I0TA 5FCCA 3BU7A 3E6CC 1XE8A 1H1IA 1ZRRA 4HLTA 3ACLA 2QCSB 5E16A 5HI0A 1WLTA 3U0ZA 2F4PA 4I2OA 4XFAA 5JSPA 2IXJA 4D7TA 4I01A 1J1LA 4HVRA 4IEYA 2Z2SB 4IEOA 5FLIA 4IEQA 5KBFA 3ST7A 5KHKA 1GQGA 4KWKA 4Q0QA 3CL1A 5BPXA 1WA4A 3H50A 4E2SA 4QMAA 3IWZA 4HN1A 3RYKA 1LB2A 4IESA 2O1QA 5KHIA 2QDRA 3ROUA 3JZVA 2MPFA 4TLFA 4KL1A 4R52A 4A2UA 2GC3A 5JAXA 3FJSA 3CLPA 1UW8A 1LR5A 3EHKA 1FT9A 4MGZE 5JSOA 1NE6A 3E5XA 2EA7A 4XF3A 2Z69A 4B29A 3RZZA 4XFBA 4I0AA 4I3PA 1I5ZA 1NXMA 1CAXB 4IERA 3EO6A 3RNSA 3DV8A 2IXLA 4AQ6A 3BB6A 3NSTA 3H1MA 2OPKA 2QNKA 5I8SA 5C6CA 5BUVA 1DGWA 2VPVA 3D82A 4UBGA 4WZCA 3USSA 3ELNA 3S7EA 3OGJA 2BEOA 2Q1ZB 4IEUA 3LOIA 4HSLA 2CAUA 2V09A 3SCFA 1ZX5A 3H7YA 5FDBA 5J48A 2K9ZA 3FE5A 4XFHA 1YFWA 2UYBA 3DL3A 3H3ZA 3I59B 4PJYA 4I09A 1QWRA 2VECA 4O9GA 3UKVA 1J3PA 2GAUA 5BV6A 4FBFA 2O8QA 2ATFA 1X8EA 2CAVA 2K0GA 5JCTA 1NYWA 2GH2A 2XKPA 3TNPB 3RDIA 1NE4A 1ZZ7A 3ES1A 3L2HA 3NW4A 4XF9A 4N9HA 1O3RA 2PQQA 2N7GA 3LWCA 2FQPA 4ZU7A 2ZKLA 1RUNA 1CAWB 5EZWA 4XF1A 3PLQA 4MZUA 4LLOA 5FQ0B 2BYVE 3EJKA 2WFPA 1RUOA 5I93A 4QM8A 4PIXA 3IIAA 3G7DA 3HT1A 2E9QA 3SCGA 2OZ6A 3BCWA 2GU9A 4OFGA 3UKTA 3E5UA 3GYDA 5LRSA 3E97A 1YFXA 3IDCB 4HN0A 1X8MA 1ZZ6A 1FI2A 2ET7A 5FLJA 4LUMA 3MZHA 5D1IA 4N9IA
chains in the Genus database with same CATH superfamily
4CYDA 3ORJA 2CGNA 4CU8A 3A4UA 2BFUS 2WUHA 1QXRA 4LK6A 1ZNPA 3SKJE 4B1MA 2YXSA 4BMBA 5JZGC 1A3KA 4FTSA 4D6RA 4JGYB 1W90A 2VMHA 5GM0A 4WVVA 3ON7A 4FP3A 1YJKA 4BQWA 1NOVA 3WW4A 4JKKA 4IV1C 5HCAA 4HFSA 1AR92 3KM5A 5C8WA 1RUJ3 2Y38A 1I6XA 5FPZA 3BTZA 4GULA 5I0SA 5LEKA 2PLV3 1X36A 3WP6A 3RZKA 5IVYA 1JZ4A 3MIHA 4O9EA 3MLLA 3SXWA 1A8DA 5K0UA 1IKQA 3AZYA 2PYTA 1W2OA 3U14A 3CMGA 4FXGB 4QU1A 3BYWA 1VBD2 4FP2A 1ZRFA 3H8UA 1H4GA 4HANA 5BY5A 2WO2A 1QQP1 4MOAA 1PX3A 4L2NA 1DGWX 1Q8VA 3MDPA 4MSVA 4Q5OA 3VHNA 4FPEA 3O1RA 1AVBA 1VBC2 3CF6E 3UT0A 1Y3TA 2HWD2 1WW6A 2WL1A 2X8KA 2XVLA 5FRAA 4XEZA 1V6MA 3VBHC 2XHKA 5D8AA 4GJYA 3MIEA 2ZXQA 4B4PA 1UNBA 1VBE2 2WO7A 5SV5A 4JGZC 1YIFA 4LBMA 2ZKNA 2CDOA 4OHVA 5F3IA 2OW4A 3VBSC 1YFYA 5FQ0A 1RINA 4M3CE 2IWGB 4WBBA 3U11A 4EWEA 2XL9A 3HEIA 1ALYA 4LEJA 2XXZA 2R072 4HKWA 3B93A 1QH7A 4XFCA 1XE7A 3ZSKA 2AREA 3JBG1 1XYPA 2EXJA 2ZAHA 2Y0OA 1M4WA 3LAGA 5GLUA 5GZEA 1TQ5A 1AR61 1HXS1 1I3HA 4FO9A 1ASJ3 3FBYA 4DB5A 4N8MA 5H9QA 2RDNA 5FPVA 5CFCC 1JS9A 5JXJA 3SLIA 3UESA 2P3YA 2HLEA 3HAGA 2FDGA 2B7YA 1G6NA 1JU4A 2UU8A 3ZYFA 2OZJA 2WS92 3BODA 1GNYA 4AGVA 4WM7A 2AR6A 1CX4A 1PO13 2D6PA 1A8MA 2V72A 2WBKA 3OF1A 3OPTA 4AAPA 5JXIA 3BUCA 1NLRA 2GALA 2R062 2VQ0A 4QPGB 2Q8EA 1ZYBA 1NY71 1H9PA 3PUQA 2A6YA 3DPRA 1QJU3 4K3UA 3C7GA 4HK9A 4YM1A 2JDKA 2OQ6A 2WZEA 1LOFC 1S2EA 4AK3A 3AP5A 4LMFA 1Q8OA 4HMZA 5E1RA 1RVF3 2CL2A 5FZGA 4RQPC 4N43A 2JG9A 3HPNA 4Q1RA 5A7WB 1Y43B 3FL7A 1QJX3 3AVRA 1JW6A 3WW1A 1IQDC 3RQ0A 1AJOA 1C8NA 2NMNA 3MPPG 5IFPA 1GNZA 2HWE1 2RS13 4KWJA 2BVVA 5FYVA 5FYIA 5L7OC 2D43A 1YWKA 4LTAA 3VDDA 4GMP0 1COV3 5FR3A 1NCQC 1AL22 4OVEA 3VBUA 4YW5A 3J9SA 2BQPA 4FAHA 5JLVA 1CJDA 3S0MA 5F5QA 3HIFA 1LJ7A 2VBPA 3O14A 4P5YA 4Y20A 5FXWA 2VO5A 4DNYA 1CR7A 2JWPA 1LKNA 3POIA 4BK5A 3Q8FA 4SLIA 4YW3A 2FMDA 3ZKYA 1DYPA 1AR81 4I0WB 3WD5A 2GN3A 4MXWB 3DUIA 2G19A 4YZ2A 1ULGA 3R6SA 4BQ3A 3WF0A 2VNRA 3WW2A 1UAIA 3W5MA 4BH9A 2D7FA 4B7KA 1PGL2 3FBMA 3B9CA 2PHXA 5BXXA 5CU1A 1POV1 5A70A 4GB33 4AG4A 4BIFA 5JOZA 1IPKA 3WW3A 2W0XA 2D3PA 2RM22 1JODA 4GAZA 1MQTA 5IK7A 5K8SA 2W1UA 1NKGA 2DVGA 4H7MA 1Q5OA 3VBRA 3E5QA 4BA6A 1RUD3 3LKJA 4LR4A 3WP3A 1VBA3 1NA1B 2Q0AA 1C3HA 4GMP3 2WT1A 3E6DA 3V0BB 2KR2A 2Y64A 5FREA 3OCPA 2UWBA 3I3BA 5A3WA 3GM8A 5JWPA 1FMD1 1UU4A 3VGIA 3KB5A 4FPYA 1C8M2 4BWOA 3LSDA 1HB1A 4LUKA 1QIQA 3VDAA 5A7SA 1VBB1 3K4DA 1OPMA 4LK7A 1B35B 1F31A 3HNYM 4AVTA 5BNPB 4Q4Y2 2VW2A 3ZO0B 3T2TA 1EV11 3PJYA 3VL9A 5FAXA 2CWSA 2F6BA 1UU6A 2WYFA 3SMHA 3WF4A 1V9U1 2YBPA 1XYOA 1SLBA 3VZMA 4FPJA 4Q4V3 2IXHA 5DDJ3 1OVPA 4LO7A 5JPNB 1OXCA 3HNMA 4CCKA 1ZZ8A 2WKKA 1RUC2 5LY2A 3AMNA 2OS2A 4LHSA 4XUOA 1RGSA 2HYKA 1U0AA 2GDFA 2C4XA 3VZLA 3KQRA 3POGA 3OUIA 2B8MA 2P4EA 3RG0A 1EAH1 3GBFA 2VMGA 4XJ9A 1JZ5A 2E7AA 3S7IA 3E6BA 2VTFA 3VBFC 4RS5B 4Q0UA 3NNMA 1F15A 3TAYA 4NRPA 3D3AA 2EF6A 1XC6A 4CUAA 3PURA 1BJQA 2WSUA 2VMDA 1MZ6A 3KCYA 4YNIA 1CAUA 3THCA 3K3NA 2Q5TA 1W9SA 4YWAA 2IXKA 1PGSA 3JQXA 1DZTA 1J58A 2LW8A 4A6OA 5FY8A 4Y26A 1JYNA 1CX1A 2XLAA 2QBXA 2ZEYA 5A6XA 2EIBA 4D69A 2B5HA 1GZWB 1ULCA 1PNGA 1CZTA 2BERA 4QX0A 4Z82A 1IQAA 1R082 2V5YA 4IEXA 2IC1A 1DYOA 1EP0A 3GDBA 4MGQA 1PVC3 1TME1 3R4DB 4HG6B 1IS6A 4NHLA 5L73A 4A3ZA 5J09A 1OC1A 3DYMA 2XHNA 3KGZA 1OH4A 4IEPA 1PK6C 1LTEA 3HQXA 1LGCA 1GOHA 2X5IC 2XJVA 3AP4A 2WWSA 1DQ6A 1Z7S1 1NQJA 3A0KA 4META 2PMWB 3HT2A 3IM0A 5CG9A 2W1QA 4ES9A 3MI8A 4LKEA 2B42B 1CONA 1SFNA 3POFA 4NN0A 1J3QA 3O1OA 3PUAA 2IUWA 4BISA 1W0OA 1TNRA 3L9JT 5A32A 1OI6A 1NQDA 2BNOA 4QXKA 3T1LA 4M3CF 2ZGUA 3MF9A 1KEXA 1W8WA 3MICA 2J1UA 3UGFA 3WG3A 2WINB 1HB3A 1ODMA 3AP9A 3T0DA 1HRV2 3DYOA 3K75B 5K0UB 4WM8A 4OUSA 2BBVA 3KCXA 5FZ8A 1ULFA 2WT2A 3PUIA 4QHOA 5GLZA 1MEC3 2CV6A 4V2VA 4M00A 5GALA 1D4M3 1OVSA 1UIJA 2Y26A 2J1SA 3KQ4B 1WCKA 3M7AA 3I2JA 1ZBA3 2P3IA 2RR13 3LDRA 3PTYA 3RRDA 3PJQA 4NAOA 2ZGSA 1BBT3 4YYOA 2XDVA 4XFIA 3N7MA 3NAPB 2VZRA 5B4XA 4Q1PA 4CCNA 4E2GA 1L3JA 1QOTA 5JZGA 3BU0A 4L99A 3CJIC 1A6CA 1RUF2 1VMFA 5D8AB 3T2OA 1SPPA 3D4KA 2ZX0A 3DEMA 3D0SA 4H7LA 4IEWA 4OMDA 1FYUA 5C3QA 4NIAA 4Y1XA 1G9DA 2BNMA 1SBEA 2XB6C 4X6RB 5DXDA 5FPAA 2QQJA 3AFKA 4L11A 5ACA2 1XPWA 2TEPA 3E1F1 2FDFA 2RS31 2Z4FA 4ZXEA 2OXBA 4YZ1A 3MIBA 5FBJA 2DVFA 3WZ1A 3WNXA 1PO21 2PHFA 3T30A 3T4VA 2ZMNA 4QX2A 5FP4A 1XNCA 3NVCA 1O3SA 2QUOA 3AL5A 2HWC1 1VB4A 1RXGA 4I0BA 2UWCA 5E89A 4YZ5A 2Y6GA 1AZDA 4COUA 3K48A 3PDQA 3HBZA 4N53C 2PHTA 5FCCA 5I0TA 1R1A2 4WM7B 1ZRRA 3PMEA 3MV01 3ACLA 4NOTA 2QCSB 4UF0A 4I30A 4AYUA 5E16A 3WT3A 5LASA 1OD3A 3THTA 2E63A 3ZFGC 3DPRB 2XWBB 4I2OA 4XACA 4JGZA 4W6XA 3UNPA 1X50A 4FFIA 4AVSA 4E9KA 2GP3A 3VD7A 4DUVA 4HVRA 3VUOA 4LHLA 3PIJA 1LENA 4OI1A 4CCEA 4IEOA 2WLQA 2QFEA 4RHV3 3HR9A 3OEAA 4N43B 2JG9B 5KXEA 4AGRA 4E4HA 5KBFA 2VCAA 4IDZA 2JDPA 2Q8CA 5KHKA 3WHTA 1ND3C 1IS4A 4J6GA 1GQGA 4KWKA 5DQ0A 1OUXA 1OQ1A 3UJQA 5BPXA 5FY7A 4OYUA 4XUTA 4URAA 1URXA 3F2ZA 4E2SA 3LDBA 5FYYA 4ZS3A 3RYKA 4Y20B 3JB4C 1LB2A 1DQ0A 5DAXA 3T08A 3FUOA 3JQWA 2TNFA 3R4UA 4XUQA 1HJGA 2QDRA 3ROUA 4BQXA 2Q8OA 2XR4A 4QKBA 4A2UA 2GC3A 2ZEZA 1UKGA 4K20A 2VOKA 3UK9A 2VVDA 4A7KA 4LBOA 1AYN1 2O0OA 4YGBA 1JZ8A 1RUI2 1UY1A 2P5BA 1ZBE2 4R4XA 5FUPA 1A34A 2AUYA 4A3XA 2ZGMA 4UFLA 1VPHA 5DABA 2Y6LA 2BPA2 2PN5A 4CUCA 2EA7A 2RVAA 2DVAA 2L9LA 2RG4A 2YDEA 4CCJA 1JYCA 1MQTB 4MLOA 1W3XA 4YGCA 4BLIA 5L7OA 3VBRB 1NXMA 2NLRA 4AR2A 4DQAA 4XQWA 5JR2A 1GNHA 5FOJB 5FP9A 4DS0A 4QPIC 4YW4A 1JYIA 3R05A 1S2BA 3MGUA 1R64A 1NCQA 2VY0A 4QQPA 1VMHA 4Z2AA 3R0RA 4AL9A 1QDCA 5C8CB 1FATA 2R16A 4ASLA 5EIYB 3SNMA 5BUVA 2Q8DA 2HH9A 1UZVA 2VVFA 4XDOA 1F35A 4GJZA 5ERLA 5KXBA 3OGJA 2WO3A 3I3QA 2WQ8A 1W6QB 2Q1MA 1W9YA 3N7LA 1MS0A 2CAUA 1FOD1 1V0AA 5DAPA 1K5JA 1DQ1A 5FY0A 2HWF1 3BN6A 2IVJA 2K9ZA 3NV2A 4YGDA 4YW6A 5SV8A 1HRI1 5AC92 5FK7A 3NJYA 4LBJA 5IFTA 4YFWA 1QQP3 4JDNA 1LOEA 4CPBD 1XNDA 4I09A 1QWRA 3VHPA 1AR72 2KM2A 1CIYA 2O8QA 1TG7A 2ATFA 1REDA 3EMRA 4AWDA 2AEYA 3MUZ1 3GJAA 5JCTA 4AAXA 1NYWA 2GH2A 2JDUA 3TNPB 3RDIA 2WZR2 2DBNA 4BOWA 1SFPA 3BIWE 3T0AA 3VZJA 4AI3A 5IK4A 4K40A 3NW4A 1PGL1 5EYYA 3RS6A 4EN8B 2FQPA 4HPKA 1IS3A 2ZACA 3CHXA 3ZPYA 5DAWA 3NNFA 2WWJA 5KWRA 4LLOA 3JBG3 2X05A 3RI9A 2BYVE 3FHQA 2VTXJ 3EJKA 1J1TA 1RUG2 4UT5A 1G9FA 4M4RA 5HPOA 3AZWA 5IVBA 4WVWA 2WFF2 2ADEA 1KFXL 1IHMA 4AEKA 1AR63 1HXS3 2E9QA 5GZFA 4A4AA 4YFZA 3WQ1A 5ABJB 2ZGOA 1HN0A 4CEWA 3DF0A 4XDPA 4DRVA 4RR3C 5A3UA 5LRSA 1GKBA 1YFXA 2OX0A 3H0OA 5AFEA 5JOXA 3WR0A 3IDCB 4A7ZA 1JYTA 2ZZJA 3OSDA 4W65A 2D6OX 3X29B 3AMMA 3RZHA 2D6MA 2AGSA 4ITCA 5FLJA 4XABA 1UZZA 3WNNA 1JI6A 2ZBJA 3T09A 3SISA 4PBOA 1O8PA 5FMOS 1EUTA 3AKRA 1QJY2 1W3VA 2H0VA 1WLWA 4OLLA 4R9DA 1D7PM 2D44A 3BTAA 3QLQA 3FLTA 2RDSA 1H8TC 3VBFA 3WP4A 1C4RA 2V5DA 2YG0A 1D4VB 2WNOA 2X29A 2HWE3 1PZ9A 3M3QA 4CXWA 3CDZB 3FHAA 2VAUA 2XOMA 1JZ2A 3TRSB 2R7EB 1WMEA 3RGBA 3C7EA 1RB8G 2QVSB 4R8HA 4IETA 1MS5A 2FHRA 1B09A 2ARXA 4JKLA 4K9SA 4UFIA 4DO0A 4R9BA 1W2NA 1AR83 3TOJA 4YRDA 1RITA 4WM8B 3N4MA 1PGW2 3I59A 4BHPA 1LOBA 3ZFGA 3NKTA 4IW3A 4Q8LA 4M4PA 5J7MA 2CSGA 1E57A 1C8M3 4XQDA 2XPJA 1JN2P 1POV3 1GP4A 1DFQA 1Y9MA 2WN2A 2ET1A 1WMXA 3C7HA 5F6LB 2X5IA 3UGGA 3ZFFC 1D2SA 1DBNA 2RR11 3POWA 1ND2C 4GXLA 2BOIA 5C4WB 1WLDA 1L7LA 2P37A 1GWMA 2R6QA 4YZ4A 4ORFA 1WBLA 1SPPB 4PQQA 5E88A 5FXVA 4XF4A 2JIJA 1GP5A 2XLFA 1O5LA 2LS6A 4KG8A 4FQZA 3BIEA 1ZRCA 4PIZA 3ACHA 1LU2A 2A7AA 2JE9A 2Y6KA 1KS5A 3JCIA 3PU3A 1OF3A 4JTOA 5FK8A 4GH4C 1H30A 1LNSA 1O7FA 2E7QA 2KXLA 2XLGA 2Y0IA 4Y5Z0 1YXWA 2ZS6B 3M70A 2P3JA 4D7YA 2D98A 4DXZA 3ZXAC 1FMD3 3B02A 1R091 2ARAA 2EAAA 1CVNA 2BU9A 3J8F2 5FMCA 3RFRA 2GC0A 3LB9A 5L9VA 1CWPA 3I2OA 2P34A 2W3JA 4EROA 1VBB3 4AEDB 4BYYA 3K51A 3RZMA 4Z8BA 2VXRA 5D2AA 5ANNA 1EV13 1DP0A 1N1SA 1H2KA 3GF6A 5LATA 4DMIA 1YI7A 1N1YA 2YHJA 2PHWA 1V9U3 3W20A 3CJIA 3ACIA 5FZ6A 2EALA 2XONA 1X82A 4I02A 4JGZB 4NAMA 3T1MA 4P5HA 5LA2A 5FMOL 4DIQA 1K5MC 1VAMA 2H0BA 2ID4A 3ZXFA 2GH8A 1VAVA 1OQDA 4KWUA 3D6EA 2QJVA 1XRUA 2TBVA 2ZMLA 2CYFA 3ES4A 3AZVA 3NNLA 1RHI1 5FUIA 4DUWA 3CKHA 4CCCA 5JXHA 1O4TA 4LHNA 3C3VA 1RUE2 2A6XA 4S2FA 3MV11 3IZOA 1EAH3 3WDXA 1XQNA 2MHFA 3BOWA 5FZOB 4MADA 4BLJA 2PQSA 4BM8A 3KS7A 3LQCA 2HEWF 1GQHA 4IV3C 3ZXLA 4AI1A 2BDRA 1ENQA 1TE1B 2JEMA 3PTRB 3AMQA 4XUNA 3AKTA 3VBOB 4HVOA 5CVRA 5F39A 3AKPA 2C1FA 3VKMA 3JXSA 4LBQD 2V4VA 1SBFA 2VJXA 4OI2A 2EICA 1UYPA 3ME2A 1US3A 1WZXA 4CCOA 5T50A 3VKOA 4KNCA 1UPSA 4S2GA 1HQNA 3HQUA 3ZXKA 2PHRA 1YLLA 1AR91 1I5PA 2D97A 4PDWC 4Q26A 4EE2A 4K1YA 5J37A 3CNAA 5C9AA 1TME3 4NWVA 4XBLA 1X9TA 3RYRA 1RC6A 2DYCA 2E53A 3SC7X 3BTXA 1OLME 4UWDA 2OUHA 3Q8BA 4RA0A 5DUUA 2R042 4BMEA 4K7JA 3I2GA 1Z7S3 1CAXA 1LOGA 1ND3A 4AHXA 5LA0A 1S2KA 1VBD1 2WNEA 3CZJA 3UJOA 4B3NA 4XIKA 1OOPC 3S57A 2VZ1A 1ZVFA 2VH9A 2DFBA 2WR9A 4KU8A 3JD72 1VBC1 2HWD1 4BJ0A 5FP7A 5LEJA 1PIV2 4XCBA 1V70A 4QDSA 4EZ4A 1W28A 3J4UH 1UQXA 2WNUC 1J3RA 4CXYA 2PTMA 5BNOA 3WG4A 1VBE1 2VE1A 4CXXA 1VE0A 1LHUA 5FKBA 4Q0SA 1FNZA 4PCRA 2DCYA 1CJPA 4FVVA 4HKLA 5FZHA 2R071 3O1MA 2B9UA 2H6BA 3MIFA 2WA4A 3AC0A 3OB8A 1FV2A 4E4ZA 1RTVA 3LIGA 3U10A 4ONUA 3RWNA 5A7NA 3MBWA 3M3EA 5JOYA 2HJIA 4COYA 4R9CA 4YW7A 3OTFA 2VL4A 1DGRA 2WN3A 3O12A 4QPIA 4PLOA 1APNA 2EIGA 3OBAA 4P14A 1NZIA 3GXUA 5IT6A 3HOBA 2WS91 4XJ8A 1CAWA 3LA2A 4CDQA 3LEMA 3EBRA 2VUAA 4DPNA 4LOTA 2FMYA 4UI9L 2RS33 1GOGA 1OF4A 2LM3A 2R061 3AYEA 3KCCA 4PLMA 4XJZA 4JDOA 4CEYB 3VD9A 1S0JA 4Y1YA 2E7TA 1PO23 4ZPIA 4CDUC 1MPXA 3H1YA 4CDXB 1CGPA 4XHXA 4GZ9A 3P5BA 3ZYPA 4ET7A 2YPDA 2HWC3 2JD4A 5DN2A 2QZ3A 5F9TA 2GMEA 2IXCA 4BDVB 4CEWB 3LA7A 3LD8A 3ZFEA 1QDOA 2GNDA 3O5SA 5IVVA 4XDQA 1YQ2A 4QPWA 5LBBA 5DMYA 2X09A 3I8TA 3ILNA 3MLKA 4KU7A 4LA2A 1OT5A 2VTXA 4NHKA 3W9AA 1ZRIA 2W46A 4D7SA 1O3TA 1LODA 1GWKA 4OUMA 4WVMA 1PNFA 4E2QA 1VRH1 3I97A 3CU7A 5JMCA 1WBFA 5CNAA 3V64A 1AL21 1G9BA 5ISLA 1O3QA 1POQA 1NCRC 2R0HA 4MGKE 4MGSA 3LFMA 1R1ZA 3ZVXA 4NIGA 4Q4W2 3WLUA 1OPOA 2ZGKA 3JUUA 3AP7A 5FZFA 3RMXA 3H8RA 4PF1A 2BFUL 4YM3A 4NHYA 1AX2A 4MX3A 2GNBA 4BXFA 5L19A 5CKNA 1BEV2 4L0PA 3CJXA 4Q4X1 1PMJX 5F2SA 4YVWC 5BNNA 2WT0A 1LU1A 4AFAA 1XB9A 2VZVA 1RL3A 1JMUB 1F4HA 4JQRA 5KC5A 5FYZA 1F5FA 1VRH2 1Y9GA 1QJFA 2RM21 4IGOA 2NPIA 3LDKA 2JG8C 1SFYA 5FY5A 1DDLA 2G9GA 1Y7BA 1NZCA 1GANA 2AACA 2D93A 5IVJA 3KMHA 4Q0VA 4JHTA 1T6GC 4HONA 1AYN3 4XFFA 4OHZA 1WCQA 3HNBM 2VQAA 4E4DX 1G9AA 2DVDA 5C33A 2IVIB 1W8ZA 5FYSA 2XH6A 2XUEA 1HB2A 4Q4X2 4YVSA 1C8M1 1VJ2A 1SZBA 3TN92 4AF9A 5EWSA 3OD4A 3OBZA 4D8MA 3O1SA 2BRTA 2ORZA 2J7MA 3H9AA 4JGYC 5F3CA 3VKNA 2A3XA 5EJ1B 4EN0A 1V6IA 4B4RA 3I3EA 1LEMA 2ZGNA 1W9FA 4Q4Y1 3O1UA 3ZXDA 5IAXA 4Y24A 1C1LA 1OMIA 4B8EA 5GZGA 2AH2A 5DUVA 3BVCA 4BU2A 3JU9A 1DQ2A 4FXKB 4AZZA 1MS3A 1DZQA 1ZRDA 1OLRA 2WZR3 2C9AA 5CADA 1H0BA 1N3OA 1RUH2 4EZHA 1SLTA 1N47A 1Q8PA 3IBMA 1RUC1 1OA3A 2WJSA 4GKYA 5D21A 5GZCA 3OBRA 1CPNA 3H42B 1FOD3 1S0GA 5F3EA 5A1AA 2HWF3 3ACFA 2CHHA 4PI2A 1XE8A 1GSLA 1HRI3 1W39A 5HI0A 5IVCA 3ACGA 3ZFFA 1OUSA 3MFAA 4AI9A 3U0ZA 5GLWA 5A3OA 3CJIB 4MO3M 1MZ5A 5JSPA 5FFOC 2IXJA 1UMIA 3R4SA 2EIDA 2R1DA 4I01A 4M3CA 1DU3D 3S6PA 1O6UA 5K7PA 1UXZA 2DTWA 3IT8A 5CFDA 2Z2SB 5A3NA 1UMZA 5F5CA 3I2DA 1DHKB 4GH4A 2VZSA 4JCKA 4PBPA 2ZHMA 1W9TA 1KDKA 4ATEA 4CDWA 5HV4A 4KH9A 4FPHA 3ST7A 1WD4A 1LHNA 1CN1A 1D0HA 1T2XA 3SITA 4DXSA 2AEZA 1WCSA 1WA4A 3IMMA 2D6NA 1S0DA 4FSJA 1R081 4TTGA 3FC0A 4BB3A 4NPRA 4HN1A 4QMAA 4AHZA 3VD4A 3ALQA 5IWFA 2MEV2 1S0BA 3N7JA 3FLPA 4JRLA 4HOOA 1FPN2 4XPVA 1RIRA 3RZLA 2P6CA 3JZVA 1W6MA 5H9RA 4EN7B 2J1AA 2MPFA 3KV6A 3PUHA 1VIWB 2WNVA 3SH4A 4QPGC 4AQTA 5DUXA 3MIGA 3WDWA 2AC1A 5IYYA 3FJSA 4NRMA 1HLCA 1LR5A 2AYHA 3N9MA 3WNLA 1K5MA 3EHKA 4LBKA 2VZ3A 4COWA 4FPLA 3UGHA 5C9AB 3E5XA 3A0NA 4B29A 2RMU1 3WF3A 4QB6A 4IGPA 3RZZA 1UZYA 4Y5SA 1AYM2 1GP6A 1QF3A 4I0AA 1V6LA 1I5ZA 4RGKA 5C71A 1HRV1 1W2AX 3BKZA 3QD6A 1PM4A 1FV3A 1CAXB 1ND3B 1YC61 3OYWA 4W6WA 2CY6A 3B3QE 1W06A 2XJUA 2YPJA 3EO6A 3O0VA 5JVVA 4P9XA 4UW4A 2ZJCA 1U5XA 1QJEA 2IXLA 1MS8A 3RNSA 4C0BA 3BB6A 1JYVA 4QU2A 4XAEA 2W9XA 2QNKA 2ZPXA 1WD3A 3WXPA 5C6CA 4RFT0 4QX1A 1DGWA 5LCWL 3D82A 3NRUA 4UBGA 3TYJA 2G9ZA 1BKZA 4P08A 4OHXA 4CCMA 3ELNA 1H8VA 3S7EA 2BEOA 2Q1ZB 1DGLA 3KT4A 4TN7A 1STMA 2ZZQA 1RUF1 3LOIA 4HSLA 4B4QA 5BNOB 2HWB2 2ZGRA 1N1TA 2RMU2 2VM9A 4H55A 5A80A 3U37A 3ASIA 4URTA 3I2FA 1UOJA 2WO1A 4KI5M 4PDWA 5A3MA 1SACA 2D3RA 5ACA1 1ENSA 2OQ7A 2YFZA 4IE6A 2CDPA 4PJYA 2WLPA 3J8F3 4O9GA 2VGDA 2BUKA 2GAUA 2XBO2 5JDBA 1QHDA 4N90A 3B00A 3BI3A 2RJKA 4ZS2A 1TMF2 4YG6A 1OH3A 2K0GA 2JJ6A 4Y3OA 5DZGA 2FCVA 1JOPA 2EAKA 2DU1A 5HCFA 2A3WA 3LEKA 4Y33A 4N9HA 1O3RA 2BWCA 1NA1C 5FXZA 3LWCA 1REFA 3APBA 3GHNA 1V6OA 2JDYA 1VRBA 1CAWB 3ZLIA 4CDQB 4S2DA 1R1A1 4MZUA 4IV1A 1Q8SA 4QDRA 4XUPA 5FQ0B 3OUJA 5GLVA 4ZY9A 1VB2A 2P3KA 5JI9A 4XVHA 3DYPA 3WEZA 3J7NA 1CPMA 2FCTA 1N3QA 4D6SA 3IIAA 4AFMA 3B94A 3BCWA 4LNVA 1R093 2GU9A 2VCBA 3IPVA 2VMCA 4OFGA 5FYHA 5L36A 5LBCA 3M2MA 5JIAA 5L9RA 1B35C 4UFHA 2XJPA 1SLCA 3AX4A 3E5UA 3GYDA 5BNPC 3ZFEB 2YFUA 1W6PA 1MS1A 3J7MA 4HN0A 1QJZA 4TYSA 2HEVF 5FYCA 1WCUA 3WF1A 4RL7A 5FZBA 1RUJ2 1KDMA 3WVJA 3ENRA 1E5SA 3EB7A 4LUMA 5D1IA 3MZHA 5GLTA 2PLV2 1BXHA 1WW4A 1UX6A 4LBQA 4YG3A 3VBHA 1O4ZA 4N9IA 1W2TA 2A70A 1VLNA 3CBNA 1AHSA 4ASMB 1UO9A 2SLIA 2YBSA 1JOBA 5C7GA 3V0AA 1VP6A 1RHI3 4M0HA 1ODNA 4LULA 4XFGA 5FYMA 2ZMKA 3CO2A 3I2IA 3PHMA 4XHBA 2WAAA 4YM0A 4EJRA 5FZ7A 1RUI1 4RS5C 3LZZA 5C5TA 1ZBE1 5BNNB 3VDBA 3AM2A 2HBTA 3WP5A 4LHKA 2DUOA 2DVBA 4LIVA 4Q0PA 3VDDB 1C5HA 4QGLA 3BTYA 4HZFA 5A3LA 4E8CA 5CFCA 3URFA 2OPWA 5LK7B 1IKPA 3OD0A 1F4AA 1YJLA 3PL0A 5FIXA 5HXVA 1XJAA 3VBUB 3H3LA 2GN7A 2B46X 4LT5A 4XTMA 4XJAA 3U07A 3WNPA 1U12A 3N9OA 1S55A 2YGMA 2ZGPA 3NWKA 1SLAA 4CP9A 1AL0G 1YQ5A 4HETA 1NCRA 1AR93 4FQ4A 1RJ7A 2PAKA 1ASJ2 3AK0A 1OSGA 4UFMA 4TXWA 1LOFA 2A1XA 3WV6A 1Z78A 2EVXA 4CRQA 5HCHA 4OZXA 2C0ZA 1V6JA 1WCDJ 4YVSB 5HV0A 2RV9A 1OBNA 2VNGA 2E32A 4RQPA 1HN1A 5I0UA 1KXGA 3IDBB 2X10A 4U2AA 1PO12 4EWDA 2WABA 4NVPA 3VLBB 3FWEA 2CTVA 5AC91 4YVWA 5AVPA 1VBD3 2VNVA 3O0XA 1ZZBA 3POJA 1QJU2 5I91A 3H8OA 1W6NA 2D40A 1LAJA 3JB8A 3MEPA 4JQTA 3I7DA 4DINB 3DKWA 4EN6B 3INAA 1VBC3 3NJZA 5FZEA 1J59A 3KT1A 1AR71 3N9PA 2HWD3 5EHDA 1RVF2 4CE8A 1GQPA 4LA3A 4PLNA 3ZPOA 2VCMA 5IVEA 3N36A 1AUYA 4LLFA 5KR7A 1MR5A 4MGYE 4L97A 1VBE3 1QJX2 2WZR1 2XWJB 1UU5A 1LESA 2Q30A 4WV8A 4AGGA 2DUQA 2NN8A 3KV5A 2RS12 3DKQA 4V1PA 4GD4A 4MHRA 4QX8A 1EPWA 1COV2 3BPSA 2R073 3PUSA 4XJWA 5A7PA 1J84A 5FZDA 1W6OA 3VN4A 3NAPC 1US2A 4P9JA 1RUG1 1WA6X 2YGLA 5CZKA 1HV0A 1A78A 1QGLA 1PZ8A 5FZ9A 2WQ4A 3RMYA 5A1LA 2A5ZA 5KC6A 2WFF1 5K9YA 1SQ4A 4UW6A 4M3CB 4YARA 4XIOA 3NNJA 3OJBA 4A42A 5CFDB 2WZ8A 5A6ZA 5L9BA 2FDKA 1PZ7A 1QH6A 1W8TA 1LHVA 4UOJA 2BBAA 2JDZA 4GH4B 3A7QA 4FOQA 5IK8A 2WS93 1TEIA 3GBGA 3UL2A 3VDCA 4QGMA 4KBBA 4OULA 4CDWB 2B39A 4KGQA 4RYDA 5F3GA 4FT8A 1D2QA 1UY2A 2R063 4GB32 5A7QA 3H7JA 5JXGA 1H2MA 2WDBA 2ILMA 4DY5A 4ARYA 2XJQA 1C5IA 3WUDA 1GR3A 1X7NA 2ZX4A 3NV3A 4UYBA 1QJY1 1W0PA 1RUD2 2ZHKA 4XCAA 1VBA2 4YW2A 3S5AA 1H4HA 2OUJA 4WM7C 2E6VA 3NJVA 1DGRN 3GCWA 2QKDA 5FJHA 3UETA 2EIEA 2VU9A 2WNVB 5F8PA 1E5RA 2W95A 1SBDA 1D0GA 4N7IA 3S30A 1CAUB 2GC2A 3DPRC 4Q27A 5JR7B 4CCDA 3FHIB 4R9AA 2PHUA 1SCSA 2Q4SA 1VRH3 3BPZA 5CIRA 2J1RA 5I8TA 1AL23 3KVAA 4CP0A 4JVAA 1CD3G 1VR3A 4AEJA 1N1VA 3POBA 4N43C 2VUCA 2J22A 4DOUA 1QEXA 2J42A 4ZONA 2ETEA 3H1WA 3OGRA 1POV0 2DFCA 2PAMA 2VUJA 3AXDA 5C70A 1PGW1 3OYWB 2XKOA 5A3PA 2FD8A 1IPJA 3DECA 2YBKA 1DG6A 4YSFA 3POEA 3ZIXA 4IUGA 1QKQA 4Q4V2 5DDJ2 4LJHA 3GALA 1W9WA 3CIHA 3PVEA 2XJRA 1QXPA 4Q4X3 3TN93 1BVP1 1H6YA 3J26N 4C91A 3UV9A 1ENXA 3CQOA 3GNEA 1W04A 5A32B 2RM23 3N35A 4F8AA 5JOWA 1VAKA 4MGIE 2JKBA 3I54A 2RHPA 3L2YA 1BMV2 4CTEA 4WVZA 1VMJA 3N7KA 2RE9A 3OBTA 5FYBA 2ZOEB 3U1XA 3ILRA 3P3PA 4OZOA 2XJTA 3FFZA 4NROA 5JSRA 4FTBA 3MW4A 2WWUA 4QD2A 1UCXA 4WZFA 2I74A 2KD7A 4KMQA 1S0EA 2JDHA 3IAPA 2CWMA 2I45A 1BZWA 3MHZA 4FFHA 4W6YA 3VZOA 1MQTC 3J8F1 4LQRA 1MS9A 1AF9A 3OOXA 2QQNA 4DXTA 3LE0A 3KGLA 3T2QA 1PK6A 2C9KA 3M4FA 3VBRC 4GQ7A 1YI9A 1WMDA 4AFCA 5JZGB 4XBNA 4FPCA 5KXDA 1HJFA 2NZ9A 2ZGTA 4Q4Y3 4MH0E 5JI7A 3ILFA 1HB4A 4F83A 5C8CC 4IV1B 1JZ7A 5FPUA 1PMIA 2NYYA 1MVQA 1PVC2 4LO5B 4Z2WA 4N7UA 1HQLA 3VHRA 3AXEA 4Z07A 4MXWA 3LEIA 1P8JA 1PX4A 1H2NA 1HX6A 2A75A 2ZX2A 4MHUA 4AW7A 3ZN6A 2H6CA 4ISQA 5FY4A 1RUC3 2UYAA 3DXUA 2A6WA 3VL8A 4AQ2A 5A1FA 1CIWA 2BW8A 4AE2A 3WSOA 1YIPA 1IGOA 2D5FA 4CCLA 4LE3A 1RUE1 4AEMA 2XVGA 4HXCA 1IG3A 3D8CA 2ZEWA 5FKCA 1WLCA 4Z1VA 3BALA 5CAZA 1W2UA 4ZHNA 4UBHA 2MEV3 4NPLA 4UF0B 3MO4A 1ZZCA 4A41A 3VBHB 2BNNA 3OPWA 2JDMA 3LA3A 1C57A 1DQ5A 2HEYF 2JB8A 4JTNA 4EQVA 5FO8B 2PHDA 3I49A 5LY1A 4GALA 1UIKA 4PHZA 1MEC2 4HKOA 3D0JA 2PA7A 1D4M2 5FP8A 1BCXA 3DN7A 4F7ZA 2W2IA 1OKQA 4KWLA 1AXZA 1ZBA2 3V65A 4EV0A 4JHZA 4NRQA 3ZDSA 1BBT2 3ZYIB 2D6LX 1XBFA 2ZHLA 3NL1A 4TWTA 3A23A 2G4IA 5FYTA 1YQ6A 5IATA 4L9BA 5A6QA 1JXNA 4JAAA 1UYYA 1R083 2W5FA 3PU8A 5ABJC 4BE3A 3GZAA 1HDKA 1QMJA 1WUVA 3A22A 1XNKA 1MZEA 5CFCB 1OA2A 4MXVA 2WC2A 2DCZA 2I07B 3ZMNA 1KD7A 2C5DA 2R041 3J7HA 5C3OA 1U5YA 3WOGA 1BK1A 4N53A 4A45A 4QQHA 5LW9A 2MNGA 1JH5A 3AFGA 2YC0A 4NR1A 3HVDA 1BK0A 2PELA 4FOVA 4AVAA 4BZ4A 5FZAA 4TLGA 1W8FA 1XSQA 4QPYA 3WDYA 3WNMA 5FWJA 4Z92B 1XNBA 4K6BA 4NIHA 3JD71 4JRAA 2ZAAA 2Y6FA 1PIV1 1DCSA 5DG1A 2RMU3 1Q3EA 1ULEA 2QQWA 4IEVA 4P9GA 4M01A 3F95A 5A33A 2JECA 4HK8A 5FO7B 1C28A 4RSUA 4RQPB 1NLSA 4D6QA 1HRV3 2B9VA 3DCQA 4P9WA 4FI9A 2PHLA 1OLQA 1OHFA 1OQEA 3AYAA 3KWVA 1DZRA 4LORA 1EPZA 1OD5A 1Y4WA 2C6SA 2DUPA 5L7OB 1UYZA 1W6NB 3WCSA 4LO6B 3RZGA 3K77A 2XJSA 1WGPA 1NCQB 5FZMA 2DU0A 1G8WA 1XOYA 2B4KA 5GJ6A 2OYZA 2P6HA 4FPGA 1IG0A 3GCXA 1IPSA 4GWMA 4QM9A 3RPQA 1QXJA 4MUVA 1RUF3 5J36A 2ZCWA 2NMOA 2F17A 4WM8C 4IXLA 4YW1A 1U5ZA 3ZN4A 2A73B 4AVCA 4LE4A 2XUMA 1GZWA 2A3YA 1BQPA 1KS4A 2QDNA 3BU7A 1SLLA 3CZUA 1H1IA 4HLTA 5G04L 2Y6JA 4G4FA 5ACA3 1WLTA 1LGBA 1QU0A 4XMAA 5FJKA 3N9NA 1W6OB 2F4PA 2XQRA 3QCWA 3OEBA 4XFAA 5CISA 4D7TA 5C4WC 1UL9A 3IAQA 5FOBB 4NIIA 4IEYA 4A7YA 4BIOA 1O59A 2B45X 4NIDA 1G86A 2HYXA 1DIWA 1F8VA 5IW0A 4XYXA 5FLIA 4IEQA 5FV3A 2ORXA 5FY9A 3U4XA 3AJYA 3ZYRA 4G9SB 3NMBA 3I2KA 2OVUA 4ATFA 2VUDA 1R1A3 2DCKA 3ZYBA 4R4ZA 1NX9A 3CL1A 4QB1A 3LFIA 4AOCA 2RS52 3SEPA 2DWRA 4HPKB 3HMYA 4IL7A 2Y6HA 4ASKA 4C1XA 2ZX3A 1NLQA 5FPLA 5F5IA 3VKLA 3RJ2X 2HBUA 1K45A 3NJXA 4FFGA 2O1QA 4NUBA 1AXKA 2ZTNA 5EYXA 4AEDC 4UW5A 4KG0A 4F3JA 4XBQA 4Q4W1 2JD9A 4R52A 2NM1A 5FZ1A 3VBSA 4CZSA 3NAPA 3HD8B 5JAXA 1W03A 1IOAA 3OY8A 5EJZB 4OMCA 1CZVA 3A21A 3AYDA 1NT0A 2VNOA 3LPGA 3OG2A 1HKDA 5T5PA 2AENA 4BQ2A 1K42A 1BEV1 1LOCA 4AI0A 1FT9A 1LULA 3ZX7A 4CP2A 5T5OA 4JZRA 1NE6A 4XF3A 4Y4YA 2Z69A 4LBNA 5J1XA 2FZ1A 3EXUA 4INDA 2C24A 2X53S 4I3PA 2CNAA 3WG1A 1XE0A 4EN9B 3TEYA 4IERA 4C0HA 4UFKA 2VZQA 3GZEA 3B5LB 4H14A 4RGGA 1QQP2 4XC9A 3TEWA 2ENRA 2QQMA 3ZDVA 4AQ6A 3NSTA 1XU2A 2OPKA 3ETPA 4DEQA 4QKNA 5I0DA 2VMFA 1RUI3 1ZBE3 3VBFB 2K46A 1PVXA 1GZCA 2BGPA 2VW1A 3USSA 3VBOC 1L7RA 4P9IA 4FPOB 3SCFA 1HQWA 2YV8A 1KJRA 1WMFA 3TN91 1O91A 4XZUG 3M3OA 2LALA 4XAAA 4OHWA 4Y1ZA 1NG0A 3WCRA 4XILA 4D0QA 4RR3A 1JYWA 3ZOIA 4QDQA 5T5LA 3H7YA 5T5JA 1W05A 3JBG2 5DZFA 5EV7A 3FE5A 1GWLA 5JUVA 1GLHA 2XG3A 3I59B 1OLMA 2VECA 3ZFGB 5EJ3A 1AR62 1J3PA 1HXS2 1XXNA 4QWNA 4ISRA 3RVHA 4FBFA 5FO9B 1X8EA 3BOPA 2CAVA 3KV4A 2OT7A 2YU2A 3H8XA 4QX7A 1S1AA 4QQLA 2XKPA 3AKSA 1MZFA 1RUH1 1LHOA 1NE4A 2JENA 4LKDA 3U78A 1BLZA 1PK6B 3L2HA 2CGOA 1RMU1 2X5IB 4NMIA 4XZPA 3THPA 4ZZ8A 1ST8A 1S0IA 3AZXA 2N7GA 1CESA 1FAYA 2LTNA 3GJBA 3ZYGA 2BZDA 2ZKLA 5C5UA 1RUNA 5EZWA 4XF1A 1H8TA 1YQ8A 1ACCA 1JU3A 1NY72 3PLQA 3T3YA 3HJRA 5AC93 3OGGA 4CPBA 4C8DA 3IDAA 2ZHNA 1C1FA 4QM8A 1OURA 4PIXA 5I93A 4D94A 3IKWA 2UWAA 1ZA4A 2DBIA 3HT1A 5E6HA 1AR73 3SCGA 2BJSA 4OUEA 2JX9A 1UMHA 3ZN6B 2WAOA 4O61A 1BVVA 1NAEA 4YGEA 3T2PA 2FDHA 4LBLA 3AMPA 4X8PA 1X8MA 1XSRA 2HWE2 3ECQA 3C8XA 1RMU2 1LECA 2ET7A 3WDUA 3ZN5A 5CBLA 1GFF2 1F2NA 1YO8A 3I3MA 5JMOA 2Y60A 1LEDA 1RUG3 2YUEA 4BCUA 1KFUL 4Q2FA 2QQOA 2WFF3 1QNWA 3M8LA 1ND2A 2GSYA 4O65A 5FTTC 3SQOA 2BGCA 4NJ4A 3MUY1 5EP9A 4XOGA 1AR82 3LEGA 2MEV1 4JDMA 5FZCA 2R30A 1FPN1 1UX7A 2VW0A 5C8CA 1KRIA 1YYNA 1F5JA 3PMSA 5FPXA 1WW7A 4C1WA 1CAVA 4JV4A 4CEYC 2YZ4A 2VQUA 3FMGA 4CA9A 1S0FA 2YU1A 2VZTA 2BP6A 4J25A 5IUQA 1UKRA 3B69A 5LB6A 4CDXC 1W6QA 3AB0A 4AVBA 1REEA 2WSVA 5FLHA 3MW3A 4MV2A 4L8QA 2AZ5A 4IGQA 1MVEA 2D5HA 2JB4A 2JE8A 3I2HA 4L92A 4QT6A 4CU6A 4CEWC 1QJY3 1AYM1 3V56A 3OUHA 5I0RA 4HVQA 3KSCA 1QOOA 1W99A 3NKGA 4N53B 1W8NA 4FOWA 5FMBA 1H6XA 5IAVA 5J98B 4LOSA 5DUWA 4OI4A 2IZWA 1FMD2 4QKDA 1QNYA 3AMHA 1BYHA 1UOGA 2GC1A 4W4ZA 4XXAA 1DLLA 4MGTA 4I3GA 4EWAA 3VD5A 2VZPA 4DRRA 1Z0HA 3I3DA 4Y4RA 4CU9A 2PAEA 5FZ3A 1DF0A 3USUA 1Y9QA 3OGSA 1LCLA 1GBGA 4XW3A 1VBB2 2QQVA 1SMVA 1QOSA 1HW5A 5A33B 1UYXA 1UD1A 3Q8EA 2HWB1 2LRPA 3LOBA 4P02B 1EV12 5ANQA 3PNAA 1GZTA 1FX5A 3WUCA 1XNAA 4TSVA 3SHRA 3ZSMA 3WQ7A 1V9U2 2XL7A 2BOJA 3MYXA 4QHBA 5DZEA 5ABJA 4PF5A 5CG8A 4P9LA 3WF2A 5J3UA 1PM7A 4K8FA 1W0NA 2FZ2A 4IV3A 2XBO1 4LKSA 3KF5A 3GZTB 4P00B 4Y5TA 4CUGA 1AXYA 1TMF1 3POSA 2O8OA 5A3TA 2QZ2A 2JXAA 1UXXX 4XF0A 3O1TA 1H9WA 4ZZ5A 2WA3A 3B01A 3MPBA 4LIUA 4MG2A 4OQ8A 5CEHA 4GWJA 1EAH2 1V6NA 5FWEA 4XMIA 3W59A 4E27A 5FZ4A 2W68A 4GWIA 5K4LA 4AHYA 1GMMA 3TBDA 1ULDA 3W58A 2A71A 3IN9A 1NUKA 3G6JB 2DURA 4FPKA 1JUHA 2W1SA 4S2HA 4EYUA 1O8SA 1WKYA 2DF7A 1X33A 4AFBA 2W92A 3ABZA 4XTPA 3H3UA 5F2WA 3UKNA 3WY6A 4QXCA 5DAQA 3HN1A 2TUNA 3TB0A 4CSWA 3WQBA 1DYKA 4AXOA 4E8DA 2NP0A 1OKOA 1ZZ9A 2GNTA 3P6BA 3PVBB 4UFJA 2BGOA 2V73A 5FBZA 2ZGLA 3M3IA 4QPIB 3GBWA 1MS4A 4M0NA 1OOPA 3T0BA 1RUJ1 1TME2 2VOXA 2Z5WA 2E26A 3AVSA 3FZ3A 5C3RA 2PLV1 3WG2A 3DXTA 4HSJA 3NV1A 4IEZA 3W5NA 5A6YA 2WNUA 1G7YA 2ADDA 5T3NA 5J96B 1Z7S2 1F9KA 5BYNA 3MFCA 2XVKA 2DCTA 2WIIB 1J83A 4G3YC 4H2AA 3U75A 3VZNA 5T55A 5JIUA 2VBBA 4PIYA 3VBSB 3K46A 2W1WA 4XE9A 5F32A 2R49A 3RYPA 2RDRA 3ZSEA 4BK4A 5CKQA 3OY8B 1RUE3 5C4WA 1YEWA 2XQXA 3POYA 1W8HA 3MF6A 4NWWA 3O0WA 1GV9A 4Y22A 3ITQA 5FZ0A 1DLCA 4Q29A 1UPIA 3TWIA 4FAGA 3KD4A 2QQKA 3IIIA 4ZU5A 5H9PA 5LK5A 3K3OA 4WVMB 1YQCA 4PT6A 2G1MA 2P2KA 5G05L 4CVUA 4GWNA 2WYSA 1XNTA 3KHBA 3QACA 5FP3A 5LRRA 1EY2A 3SKVA 3W21A 3ZXGA 3ZR5A 2DCJA 1SDDB 4W50A 4X8NA 3C2UA 1YUDA 4NHMA 1OFSA 2YMZA 2LUWA 1XU1A 1UF2C 2VC9A 5DPNA 4FOYA 3P1IA 5LWBA 3AYCA 3TNQA 4BQYA 3FFQA 4BQ1A 4AEDA 4CDUA 1ASJ1 3CEWA 2V4AA 3PVOA 4LO4B 1UZWA 3SCHA 5BNQA 3THDA 3O1VA 4COZA 2GMPA 2ZX1A 5FZLA 4HT1T 3SEEA 3VV1A 5J48A 3FLRA 2KA3A 1UOBA 2RJLA 3NQHA 4RR3B 2J1EA 4OQ9A 2R043 1S4CA 1PO11 4XETA 2RS32 5I8YA 1JUIA 1LOAA 4J1WA 5B2GB 2CGPA 1JHJA 1RJ8A 4U36A 2WRAA 1PO22 1QJU1 3S5QA 3OPZA 3HN3A 4JKMA 3OGVA 4QX5A 1O5UA 3O1PA 5B4NA 5C9AC 3JD73 3LSEA 1EYBA 2HWC2 3LPFA 1RVF1 1PIV3 4QHZA 2E33A 1YCIA 4QGNA 4KQ7A 4UXAA 2G9FA 3WHUA 1JZ6A 1JYXA 5EPAA 3ETQA 3KHCA 1SG3A 1QJX1 4RGAA 5FZOA 4B7EA 4IE4A 1MACA 3VZKA 4NO4A 3RJRA 2PXJA 2RS11 1UY3A 5FZIA 1H8TB 3BGAA 3NV4A 3ZIWA 1V6KA 1PMHX 3ZXJA 1COV1 3VBOA 1BHGA 2WQZC 4QXHA 1WW5A 2DDUA 3ZKUA 3MIDA 3P3NA 4DXRA 1ZREA 3ZM8A 3ZYHA 3HQRA 5BNOC 2EXIA 2JDNA 4UAPA 1QY4A 3Q8CA 4HL0A 4QKFA 2PFWA 1UOFA 3VB9A 2A6VA 1T6BX 1W8UA 2XGXA 2JG8A 1JZ3A 3LGRA 1UN1A 2VOTA 2W94A 2UY9A 3K2OA 4DFSA 5K0UC 2NQYA 4V2WA 2VOWA 2VVEA 2RS53 3EQEA 3LF7A 3ZMOA 3AJZA 4GB31 2BV4A 2K2SA 4LITA 4IE0A 2FBEA 3N9QA 4GA9A 1YFUA 2VMEA 1SCRA 1XYNA 2IXIA 3KV9A 1UWWA 2P1BA 4AVVA 4QQ2A 4QXBA 3ZFFB 1Q43A 3WX5A 4BPZA 5CYYA 1ND2B 5LZ6A 2VR4A 2GMMA 3RWKX 5AVAA 4E4SA 4JGYA 1VALA 1YRZA 2HKXA 1RUD1 5D8AC 3SH5A 1ULOA 4J1XA 4CDQC 1SEFA 1VBA1 3RSJA 5KHJA 4GMP1 1OFNA 1AYN2 2C26A 2F4LA 3HWJA 4RD7A 4K1ZA 1CAVB 2FCUA 3WDTA 1H2LA 5EFUA 5EXOA 1H1MA 2A6ZA 4KBZA 2VBDA 2OA2A 3QOPA 4IQPA 2JICA 4FCAA 3FX3A 4NPMA 1DQ4A 2VULA 2E31A 3LIHA 5EQUA 3ZFEC 1GICA 1YHFA 2P17A 2Q1FA 4Q4W3 3ZSJA 3KZ4C 2UURA 3EYPA 1LRHA 4LKFA 5KHGA 3PVNA 2VOVA 1IZ3A 1W6MB 1RXFA 2ARCA 2VQTA 2JE7A 1RYYA 5KXCA 2XMLA 4Q4V1 5DDJ1 4QAWA 1BEV3 1IS5A 3NO8A 2YROA 4PQ9A 3M3CA 2RDQA 1X9PA 1SDWA 4AHWA 1EUUA 4UW3A 5KHHA 5LA9A 1UZ0A 2VD7A 3ZR6A 4ES8A 1G9CA 3USUB 4P9YA 4DY3A 1FXZA 1K5MB 2GZWA 4YZ3A 2YY1A 1FOD2 4A6SA 2HWF2 3B9IA 4CEYA 2IFWA 1HRI2 1FNYA 2GNMA 5LBEA 2VZOA 2EXHA 1BMV1 4CDXA 1JTZX 2JG9C 4GIQA 1LHWA 2D3SA 2I2SA 1GOFA 2J1TA 2UY8A 2Z79A 3C7OA 4LPLA 5BNNC 4BXSV 5IJRA 1Q56A 1Q8QA 1ZA7A 2RJ2A 4GKXA 2ES3A 4IV3B 1NXD1 2QQUA 3VDDC 3ZSLA 3K4ZA 2JDAA 5F1RA 4HBNA 1I1EA 1OA4A 3VBUC 4AI8A 3MLJA 1W8OA 3B7MA 5GKAC 3FN9A 1HIXA 4ZU4A 5GZDA 5A7OA 1CZSA 1TVGA 4AQSA 3T4HB 3PIGA 4X6QB 2JIGA 4PI0A 2CU5A 1L7QA 3E6CC 2Z42A 4CP1A 4QX3A 4QPGA 5FY1A 1JHNA 2YYOA 3O7OA 3KLSA 4MYEA 5IVFA 2VG9A 1PVC1 3AP6A 4PDWB 3VHOA 4OCTA 1JOJA 4OI0A 4YVSC 1J1LA 1I9RA 3I4IA 3WDVA 2OIIA 3KF3A 2VCCA 3VKFC 3J7LA 5H9SA 5FYUA 1RUH3 1V00A 4IE7A 1TZOA 3C7FA 3D5OA 5A7WA 4ZKTB 3QH6A 1RMU3 2O14A 4CU7A 2BWAA 4DZGA 1GZ9A 1K3IA 2W08A 5HBAA 1ENRA 2ZA9A 5TSWA 1UY4A 5FUNA 3IDEA 4YPJA 2EXKA 3SH3A 3UYJA 3RZJA 4DUXA 4Q0QA 1OOPB 5AFBA 3H50A 3Q9OA 2E51A 4K21A 5FXXA 3IWZA 5C3SA 3AKQA 1E5IA 4IESA 5KHIA 3AL6A 2WNUB 5F7UA 2VZUA 2D6KA 2QQPA 5FZKA 3ZYJB 1AX1A 5APAA 3GGLA 2ZGQA 5DAVA 3LCPA 1S0CA 4KL1A 4TLFA 1MEC1 3IPVB 4W8JA 3N9LA 1D4M1 4COVA 1O4YA 3ATGA 3K4AA 4BQ4A 3FUQA 1CQ9A 4DEVA 1ZBA1 2ZABA 3CLPA 1UW8A 3WNOA 1GUIA 1W6PB 2WZPP 1BBT1 1JBCA 2IFRA 3KT7A 1H1AA 1TNFA 2W87A 2YC2A 3Q8AA 4MVTA 4MGZE 4JX0A 4Y1VA 4Y22B 1M06G 4QB2A 2DV9A 2BVBA 4QQOA 2W47A 5JSOA 3IMNA 2W39A 5CFDC 2OKXA 1WWYA 2SBAA 2YC4A 4YM2A 2W91A 3ZXEA 4XFBA 4ZXKA 3TEXA 4B1LA 2QTWB 4NE9A 4FFFA 4LBQB 2GP5A 3GZUC 1FPN3 4RFRB 1NA1A 4CUBA 3V0BA 4CDWC 5IK5A 3QH7A 1K12A 4H3WA 3DV8A 4C90A 3H1MA 2ZEXA 3N3HA 4ARXA 1GYKA 3V0AB 5I8SA 5F6KA 1U5IA 5DG2A 4NHXA 1ONAA 2RR12 1KJLA 2VPVA 2Y34A 4CDUB 4WZCA 4K8RB 5LA1A 4LO8A 2Y8KA 4JC1A 4FTEA 1ULPA 5HXMA 4IEUA 2ERFA 2VXJA 2R32A 1GU3A 2Y33A 1B35A 5FPBA 1AYM3 5BNPA 2FDIA 2V09A 2J1VA 1ZX5A 5CKMA 5FDBA 5CA6A 1N3PA 2QE3A 2WNVC 4KGGA 1KITA 1PHMA 5T54A 5CB7A 4LXLA 5HCBA 3IB3A 1KQRA 3KVBA 4XFHA 1YFWA 5T52A 2W52A 4D3WA 3HBKA 2UYBA 3DL3A 3H3ZA 4YG0A 5BV6A 4XQ4A 3UKVA 3M1HA 5E8AA 1R092 4IE5A 3GHMA 4Q8KA 4FPFA 3AZZA 4AFDA 4CP9B 4Y1UA 1NCRB 4A44A 1ZZ7A 1AJKA 4XJUA 4RHV1 3ES1A 4XF9A 2HWB3 2PQQA 3RI8A 3WINE 4BQ5A 1ZM1A 4ZU7A 1HV1A 2YB7A 3U4SA 2JKXA 5LBFA 4RN5A 5IHRA 2ARBA 1AX0A 3WQ0A 3MW2A 1KGYA 1RUOA 2WFPA 5M0TA 4RS5A 1SLIA 5F37A 4YVWB 3G7DA 3QBQA 4SBVA 5F5AA 2XBO3 3DGTA 2OZ6A 5JPMB 4O7XA 2DTYA 1YNAA 2R1BA 1SHWB 1TMF3 4YLZA 2FDJA 2LROA 3UKTA 4XURA 3E97A 1RHI2 4TZDA 4AI2A 2JG8B 2QQLA 4RHV2 1ZZ6A 3WNKA 1FI2A 5C3PA 1UY0A 2BTVC 1LGNA 3NNGA 3VD3A 2VMIA 5FMDA 4XXPA 1E5HA 2RS51 4OHYA 2QQIA 2R0FA 3TEZA
chains in the Genus database with same CATH topology
4CYDA 2CGNA 4YZ1A 3A4UA 2BFUS 1QXRA 4BMBA 1ZNPA 2YXSA 5JZGC 1A3KA 4FTSA 4JGYB 2VMHA 5GM0A 4WVVA 4FP3A 1YJKA 1NOVA 4IV1C 5HCAA 4HFSA 1AR92 3KM5A 5C8WA 1RUJ3 2Y38A 1I6XA 5FPZA 4GULA 5I0SA 5LEKA 2PLV3 1X36A 3WP6A 3MIHA 4O9EA 3MLLA 3SXWA 1A8DA 5K0UA 1IKQA 3AZYA 2PYTA 4FXGB 1ZRFA 1VBD2 4FP2A 3H8UA 1H4GA 4HANA 5BY5A 1QQP1 4L2NA 1DGWX 1Q8VA 3MDPA 4MSVA 3VHNA 4FPEA 1AVBA 1VBC2 3CF6E 1Y3TA 2WL1A 1WW6A 2HWD2 2X8KA 2XVLA 5FRAA 4XEZA 1V6MA 3VBHC 2XHKA 5D8AA 3MIEA 4B4PA 1VBE2 5SV5A 4JGZC 1YIFA 4LBMA 2ZKNA 4OHVA 2OW4A 1YFYA 5FQ0A 1RINA 4M3CE 2IWGB 4WBBA 3U11A 4EWEA 2XL9A 1ALYA 4LEJA 2R072 4HKWA 3B93A 1QH7A 4XFCA 1XE7A 3ZSKA 2AREA 3JBG1 1XYPA 2EXJA 2ZAHA 2Y0OA 1M4WA 3LAGA 5GLUA 5GZEA 1TQ5A 1AR61 1HXS1 1I3HA 4FO9A 1ASJ3 3FBYA 4DB5A 5H9QA 5CFCC 3SLIA 3HAGA 2B7YA 1G6NA 2UU8A 2OZJA 2WS92 3BODA 4AGVA 4WM7A 2AR6A 1CX4A 1PO13 2D6PA 1A8MA 3OF1A 1NLRA 2GALA 2R062 2VQ0A 4QPGB 1ZYBA 1NY71 1H9PA 2A6YA 3DPRA 1QJU3 4K3UA 4HK9A 4YM1A 1LOFC 4AK3A 3AP5A 1Q8OA 4HMZA 5E1RA 1RVF3 2CL2A 4RQPC 4N43A 2JG9A 4Q1RA 1Y43B 1QJX3 1JW6A 3WW1A 3RQ0A 1AJOA 1C8NA 2NMNA 3MPPG 1GNZA 2HWE1 2RS13 4KWJA 2BVVA 5L7OC 2D43A 1YWKA 4LTAA 3VDDA 4GMP0 1COV3 1NCQC 1AL22 4OVEA 3VBUA 4YW5A 3J9SA 2BQPA 4FAHA 5JLVA 1CJDA 3S0MA 5F5QA 3HIFA 1LJ7A 3O14A 4Y20A 4DNYA 1CR7A 1LKNA 4SLIA 4YW3A 2FMDA 1DYPA 1AR81 4I0WB 3WD5A 2GN3A 4MXWB 3DUIA 4YZ2A 1ULGA 3R6SA 2VNRA 3WW2A 1UAIA 2D7FA 4B7KA 3FBMA 3B9CA 2PHXA 5BXXA 5CU1A 1POV1 4GB33 4AG4A 4BIFA 5JOZA 1IPKA 3WW3A 2W0XA 2D3PA 2RM22 1MQTA 5IK7A 5K8SA 2DVGA 4H7MA 1Q5OA 3VBRA 3E5QA 4BA6A 1RUD3 3LKJA 4LR4A 3WP3A 1VBA3 1NA1B 2Q0AA 1C3HA 4GMP3 2WT1A 3E6DA 3V0BB 5FREA 3OCPA 2UWBA 5JWPA 1FMD1 1UU4A 3VGIA 3KB5A 4FPYA 1C8M2 4BWOA 3LSDA 4LUKA 1VBB1 1OPMA 1B35B 1F31A 4AVTA 5BNPB 4Q4Y2 2VW2A 3ZO0B 3T2TA 1EV11 3PJYA 3VL9A 5FAXA 2CWSA 2F6BA 1UU6A 3SMHA 1V9U1 1XYOA 1SLBA 3VZMA 4FPJA 4Q4V3 2IXHA 5DDJ3 4LO7A 5JPNB 1ZZ8A 2WKKA 1RUC2 3AMNA 1RGSA 2HYKA 1U0AA 2GDFA 3VZLA 3KQRA 2B8MA 3RG0A 1EAH1 3GBFA 2VMGA 4XJ9A 2E7AA 3S7IA 3E6BA 3VBFC 4RS5B 4Q0UA 3TAYA 2EF6A 1BJQA 2WSUA 1MZ6A 3KCYA 4YNIA 1CAUA 2Q5TA 2IXKA 1PGSA 3JQXA 1DZTA 1J58A 4Y26A 2XLAA 4D69A 2B5HA 1GZWB 1ULCA 1PNGA 4Z82A 3ZFGC 1IQAA 1R082 2V5YA 4IEXA 2IC1A 1EP0A 3U4XA 5L73A 1PVC3 1TME1 3R4DB 4NHLA 1IS6A 5J09A 3KGZA 4IEPA 1PK6C 1LTEA 3HQXA 1LGCA 2X5IC 2XJVA 3AP4A 2WWSA 1DQ6A 1Z7S1 1NQJA 3A0KA 4META 3HT2A 3IM0A 5CG9A 4ES9A 3MI8A 2B42B 1CONA 1SFNA 4NN0A 1J3QA 1W0OA 1TNRA 3L9JT 5A32A 1OI6A 1NQDA 2BNOA 4QXKA 3T1LA 4M3CF 2ZGUA 3MF9A 3MICA 3WG3A 2WINB 3AP9A 1HRV2 5K0UB 4WM8A 4OUSA 2BBVA 3KCXA 1ULFA 2WT2A 5GLZA 1MEC3 2CV6A 4M00A 5GALA 1D4M3 1UIJA 2Y26A 1WCKA 3M7AA 3PTYA 1ZBA3 2P3IA 2RR13 3RRDA 3PJQA 2ZGSA 1BBT3 4YYOA 4E2GA 4XFIA 3N7MA 3NAPB 4Q1PA 5JZGA 1L3JA 1QOTA 4L99A 3CJIC 1A6CA 1RUF2 5D8AB 3D4KA 2ZX0A 4IEWA 3D0SA 4H7LA 1FYUA 4Y1XA 1G9DA 2BNMA 1SBEA 2XB6C 4X6RB 5DXDA 3AFKA 4L11A 5ACA2 2TEPA 2RS31 3MIBA 2DVFA 3WZ1A 3WNXA 1PO21 2PHFA 2ZMNA 1XNCA 3NVCA 1O3SA 2QUOA 1VB4A 2HWC1 4I0BA 2UWCA 5E89A 4YZ5A 1AZDA 4COUA 3K48A 4N53C 3HBZA 5I0TA 2PHTA 5FCCA 1R1A2 4WM7B 1ZRRA 3PMEA 3ACLA 4NOTA 2QCSB 4I30A 4AYUA 5E16A 3WT3A 3THTA 2E63A 3DPRB 2XWBB 4I2OA 4JGZA 4W6XA 1X50A 4AVSA 4E9KA 4HVRA 3VUOA 4LHLA 4OI1A 1LENA 4IEOA 2WLQA 2QFEA 4RHV3 3HR9A 4N43B 2JG9B 5KXEA 4AGRA 5KBFA 5KHKA 3WHTA 1ND3C 1IS4A 4J6GA 1GQGA 4KWKA 3UJQA 1OQ1A 5BPXA 1URXA 4E2SA 3RYKA 4Y20B 3JB4C 1LB2A 1DQ0A 3FUOA 3JQWA 2TNFA 3R4UA 2QDRA 3ROUA 2Q8OA 4A2UA 2GC3A 1UKGA 4K20A 2VOKA 3UK9A 2VVDA 4A7KA 4LBOA 1AYN1 2O0OA 4YGBA 1RUI2 1ZBE2 4R4XA 2AUYA 4A3XA 2ZGMA 2BPA2 2PN5A 2EA7A 2DVAA 2YDEA 1JYCA 1MQTB 4MLOA 4YGCA 4BLIA 5L7OA 3VBRB 1NXMA 2NLRA 4DQAA 4XQWA 1GNHA 5FOJB 4DS0A 4QPIC 4YW4A 1JYIA 3R05A 1S2BA 3MGUA 1NCQA 2VY0A 4QQPA 3R0RA 1QDCA 5C8CB 1FATA 2R16A 4ASLA 3SNMA 5BUVA 2VVFA 5KXBA 3OGJA 1W6QB 2Q1MA 3N7LA 1MS0A 2CAUA 1FOD1 1DQ1A 5SV8A 2HWF1 3SCFA 3NV2A 2K9ZA 4YGDA 3VBSC 5AC92 5J48A 1HRI1 4LBJA 4YFWA 1QQP3 4JDNA 1LOEA 1XNDA 4I09A 1QWRA 3VHPA 1AR72 2KM2A 2O8QA 2ATFA 4AWDA 1REDA 5JCTA 1NYWA 2GH2A 3TNPB 3RDIA 2WZR2 4BOWA 5IK4A 3BIWE 3VZJA 4AI3A 4K40A 3NW4A 1PGL1 5EYYA 3RS6A 4EN8B 2FQPA 4HPKA 1IS3A 2ZACA 3ZPYA 5KWRA 4LLOA 3JBG3 3RI9A 2BYVE 3EJKA 1J1TA 1RUG2 1G9FA 3AZWA 4WVWA 2WFF2 1KFXL 1IHMA 4AEKA 1AR63 1HXS3 2E9QA 5GZFA 4YFZA 3WQ1A 5ABJB 2ZGOA 4CEWA 3DF0A 4DRVA 4RR3C 5LRSA 1GKBA 1YFXA 3H0OA 5JOXA 5AFEA 3WR0A 3IDCB 4A7ZA 2ZZJA 4W65A 2D6OX 3X29B 3AMMA 2D6MA 2AGSA 4ITCA 5FLJA 1UZZA 2ZBJA 3SISA 4PBOA 5FMOS 3AKRA 1QJY2 2H0VA 1WLWA 4OLLA 4R9DA 2D44A 3BTAA 3QLQA 3FLTA 1H8TC 3VBFA 3WP4A 1C4RA 1D4VB 2X29A 2HWE3 1PZ9A 3M3QA 3TRSB 1WMEA 1RB8G 2QVSB 4R8HA 4IETA 1MS5A 2FHRA 1B09A 2ARXA 4K9SA 4R9BA 1AR83 3TOJA 4YRDA 1RITA 4WM8B 3N4MA 1PGW2 3I59A 4BHPA 1LOBA 3ZFGA 3NKTA 4Q8LA 5J7MA 1E57A 1C8M3 4XQDA 2XPJA 1JN2P 1POV3 1DFQA 5F6LB 2ET1A 2X5IA 3ZFFC 1D2SA 1DBNA 2RR11 3POWA 1ND2C 4GXLA 5C4WB 1WLDA 2P37A 2R6QA 4YZ4A 4ORFA 1WBLA 5E88A 4XF4A 2XLFA 1O5LA 4KG8A 4FQZA 1ZRCA 4PIZA 1LU2A 2A7AA 2JE9A 3JCIA 1KS5A 4JTOA 4EV0A 4GH4C 1H30A 1O7FA 2E7QA 4Y5Z0 2KXLA 2Y0IA 2XLGA 1YXWA 2ZS6B 3M70A 2P3JA 4D7YA 2D98A 4DXZA 3ZXAC 1FMD3 3B02A 1R091 2EAAA 3J8F2 1CVNA 2GC0A 3LB9A 2P34A 4EROA 1VBB3 4AEDB 4BYYA 3K51A 4Z8BA 2VXRA 1EV13 1N1SA 3GF6A 1H2KA 4DMIA 1YI7A 1N1YA 2YHJA 2PHWA 1V9U3 3CJIA 2EALA 4I02A 1X82A 4JGZB 3T1MA 4P5HA 5FMOL 1K5MC 1VAMA 2H0BA 3ZXFA 2GH8A 1VAVA 1OQDA 3D6EA 2QJVA 1XRUA 2TBVA 2ZMLA 2CYFA 3ES4A 3AZVA 1RHI1 1O4TA 4LHNA 3C3VA 1RUE2 2A6XA 4S2FA 1EAH3 3WDXA 1XQNA 2MHFA 3BOWA 4BLJA 4BM8A 3KS7A 4IV3C 2HEWF 1GQHA 3ZXLA 4AI1A 1ENQA 1TE1B 2JEMA 3AMQA 3AKTA 3VBOB 4HVOA 5CVRA 3AKPA 2C1FA 3VKMA 4LBQD 4OI2A 1SBFA 3ME2A 5T50A 3VKOA 4KNCA 1UPSA 4S2GA 1HQNA 3ZXKA 2PHRA 1YLLA 1AR91 2D97A 4PDWC 4Q26A 4K1YA 5J37A 3CNAA 5C9AA 1TME3 4NWVA 4XBLA 3RYRA 1RC6A 2DYCA 2E53A 2OUHA 4RA0A 5DUUA 2R042 4BMEA 4K7JA 1Z7S3 1CAXA 1LOGA 1ND3A 4AHXA 1S2KA 1VBD1 2WNEA 3UJOA 4B3NA 4XIKA 1OOPC 1ZVFA 2VH9A 2DFBA 4KU8A 3JD72 1VBC1 2HWD1 5LEJA 1PIV2 1V70A 3J4UH 2WNUC 1J3RA 2PTMA 5BNOA 3WG4A 1VBE1 1LHUA 4Q0SA 1FNZA 4PCRA 2DCYA 1CJPA 4FVVA 4HKLA 2R071 2B9UA 2H6BA 3MIFA 2WA4A 1FV2A 4E4ZA 1RTVA 3U10A 4ONUA 3RWNA 3M3EA 5JOYA 2HJIA 4COYA 4R9CA 3OTFA 1DGRA 3O12A 4QPIA 4PLOA 1APNA 2EIGA 4P14A 5IT6A 4CDQA 2WS91 4XJ8A 1CAWA 3LA2A 3EBRA 2VUAA 4DPNA 2FMYA 2RS33 2R061 2LM3A 3AYEA 4XJZA 4CEYB 3KCCA 4PLMA 4JDOA 1S0JA 4Y1YA 2E7TA 1PO23 4CDUC 3H1YA 4CDXB 1CGPA 4XHXA 3ZYPA 2HWC3 2JD4A 2QZ3A 5F9TA 2GMEA 2IXCA 4CEWB 3LA7A 3ZFEA 1QDOA 2GNDA 3O5SA 4XDQA 3I8TA 3ILNA 4KU7A 3MLKA 4LA2A 4NHKA 3W9AA 4D7SA 1O3TA 1LODA 4OUMA 4WVMA 1PNFA 4E2QA 1VRH1 3CU7A 5JMCA 1WBFA 5CNAA 3V64A 1AL21 1G9BA 1O3QA 1NCRC 2R0HA 4MGKE 1R1ZA 3ZVXA 4Q4W2 3WLUA 1OPOA 2ZGKA 3JUUA 3AP7A 3RMXA 2BFUL 4YM3A 1AX2A 4MX3A 2GNBA 5L19A 1BEV2 3CJXA 4Q4X1 5BNNA 4YVWC 2WT0A 1LU1A 4AFAA 1RL3A 4JQRA 5KC5A 1F5FA 1VRH2 2RM21 2NPIA 2JG8C 1SFYA 1DDLA 2G9GA 1Y7BA 1NZCA 1GANA 2D93A 3KMHA 4Q0VA 1T6GC 1AYN3 4XFFA 4OHZA 2VQAA 4E4DX 1G9AA 2DVDA 5C33A 2XH6A 4Q4X2 3TN92 4YVSA 1C8M1 1VJ2A 4AF9A 5EWSA 3OD4A 3H9AA 4JGYC 3VKNA 2A3XA 4EN0A 1V6IA 4B4RA 1LEMA 2ZGNA 4Q4Y1 3ZXDA 4Y24A 1C1LA 1OMIA 4B8EA 5GZGA 2AH2A 5DUVA 3JU9A 1DQ2A 4FXKB 1MS3A 1DZQA 1ZRDA 2WZR3 1OLRA 2C9AA 5CADA 1H0BA 1N3OA 1RUH2 1SLTA 1N47A 1Q8PA 3IBMA 1RUC1 1OA3A 2WJSA 4GKYA 5GZCA 3OBRA 1CPNA 1FOD3 1S0GA 2HWF3 1XE8A 1GSLA 1HRI3 1W39A 5HI0A 3ZFFA 3MFAA 3U0ZA 5GLWA 3CJIB 1MZ5A 5JSPA 5FFOC 2IXJA 3R4SA 4I01A 2R1DA 3S6PA 4M3CA 1DU3D 5K7PA 2DTWA 3IT8A 5CFDA 2Z2SB 1UMZA 3I2DA 1DHKB 4GH4A 4JCKA 4PBPA 2ZHMA 1KDKA 4ATEA 4CDWA 4KH9A 4FPHA 3ST7A 1WD4A 1LHNA 1CN1A 1D0HA 3SITA 1WCSA 1WA4A 2D6NA 1S0DA 4FSJA 1R081 3FC0A 4NPRA 4HN1A 4QMAA 4AHZA 3ALQA 2MEV2 1S0BA 3N7JA 3FLPA 4JRLA 4XPVA 1FPN2 1RIRA 3JZVA 1W6MA 5H9RA 4EN7B 2MPFA 1VIWB 2WNVA 3SH4A 4QPGC 4AQTA 5DUXA 3MIGA 3WDWA 3FJSA 1HLCA 1LR5A 2AYHA 1K5MA 3EHKA 4LBKA 4COWA 4FPLA 5C9AB 3E5XA 3A0NA 4B29A 2RMU1 3RZZA 1UZYA 1AYM2 1QF3A 4I0AA 1V6LA 1I5ZA 1HRV1 3QD6A 4W6WA 1FV3A 1CAXB 1ND3B 3OYWA 2CY6A 3B3QE 2XJUA 2YPJA 3EO6A 3O0VA 5JVVA 4P9XA 4UW4A 2ZJCA 1U5XA 2IXLA 3RNSA 1MS8A 4C0BA 3BB6A 4QU2A 2QNKA 2ZPXA 1WD3A 3WXPA 5C6CA 4RFT0 1DGWA 3D82A 4UBGA 3TYJA 1BKZA 4OHXA 3ELNA 1H8VA 3S7EA 2BEOA 2Q1ZB 1DGLA 3KT4A 2ZZQA 1RUF1 3LOIA 4HSLA 4B4QA 5BNOB 2HWB2 2ZGRA 1N1TA 2RMU2 4H55A 3ASIA 4URTA 4PDWA 5A3MA 1SACA 2D3RA 5ACA1 1ENSA 4PJYA 2WLPA 3J8F3 4O9GA 2VGDA 2BUKA 2GAUA 2XBO2 5JDBA 1QHDA 4N90A 3B00A 2RJKA 1TMF2 4YG6A 2K0GA 2JJ6A 5DZGA 2DU1A 2EAKA 5HCFA 2A3WA 4N9HA 1O3RA 2BWCA 1NA1C 3LWCA 1REFA 3APBA 3GHNA 1V6OA 4CDQB 1CAWB 4S2DA 1R1A1 4MZUA 4IV1A 1Q8SA 5GLVA 5FQ0B 1VB2A 2P3KA 5JI9A 1CPMA 1N3QA 3IIAA 4AFMA 3B94A 3BCWA 4LNVA 1R093 2GU9A 3IPVA 4OFGA 5L36A 3M2MA 5JIAA 1B35C 2XJPA 1SLCA 3AX4A 3E5UA 3GYDA 5BNPC 3ZFEB 1W6PA 1MS1A 4HN0A 1QJZA 4TYSA 2HEVF 4RL7A 1RUJ2 1KDMA 3WVJA 3ENRA 4LUMA 3MZHA 5D1IA 5GLTA 2PLV2 1BXHA 1WW4A 1UX6A 4LBQA 4YG3A 3VBHA 1O4ZA 4N9IA 2A70A 1VLNA 4ASMB 1AHSA 2SLIA 3V0AA 1VP6A 1RHI3 4M0HA 4LULA 4XFGA 2ZMKA 3CO2A 3PHMA 4XHBA 4EJRA 4YM0A 1RUI1 4RS5C 3LZZA 1ZBE1 5BNNB 3AM2A 3WP5A 4LHKA 2DUOA 2DVBA 4Q0PA 3VDDB 1C5HA 4QGLA 4HZFA 5A3LA 5CFCA 3URFA 5LK7B 1IKPA 3OD0A 1YJLA 5HXVA 3VBUB 2GN7A 2B46X 4LT5A 4XTMA 4XJAA 3U07A 1U12A 1S55A 2YGMA 2ZGPA 3NWKA 1SLAA 1AL0G 4HETA 1NCRA 1AR93 4FQ4A 1RJ7A 2PAKA 1ASJ2 3AK0A 1OSGA 1LOFA 3WV6A 1Z78A 2EVXA 4CRQA 4OZXA 2C0ZA 1V6JA 1WCDJ 4YVSB 2VNGA 4RQPA 5I0UA 1KXGA 3IDBB 4U2AA 1PO12 4EWDA 4NVPA 3VLBB 3FWEA 2CTVA 5AC91 4YVWA 5AVPA 1VBD3 3O0XA 1ZZBA 1QJU2 5I91A 1W6NA 2D40A 3JB8A 3MEPA 4DINB 3I7DA 3DKWA 4EN6B 3INAA 1VBC3 3NJZA 1J59A 3KT1A 1AR71 2HWD3 1RVF2 4LA3A 4PLNA 3N36A 1AUYA 4LLFA 1MR5A 4MGYE 4L97A 1VBE3 1QJX2 2WZR1 2XWJB 1UU5A 1LESA 2Q30A 4WV8A 4AGGA 2DUQA 2NN8A 2RS12 4V1PA 1EPWA 1COV2 2R073 4XJWA 3VN4A 1W6OA 3NAPC 4P9JA 1RUG1 2YGLA 3RMYA 1HV0A 1A78A 1QGLA 1PZ8A 2WQ4A 2A5ZA 5KC6A 2WFF1 5K9YA 1SQ4A 4UW6A 4M3CB 4YARA 4XIOA 3OJBA 5CFDB 1PZ7A 1QH6A 1LHVA 2JDZA 4GH4B 4FOQA 5IK8A 2WS93 1TEIA 3GBGA 3UL2A 4QGMA 4KBBA 4OULA 4CDWB 2B39A 4KGQA 4FT8A 1D2QA 2R063 4GB32 3H7JA 1H2MA 2ILMA 4DY5A 2XJQA 1C5IA 3WUDA 1GR3A 1X7NA 2ZX4A 3NV3A 1QJY1 1W0PA 1RUD2 2ZHKA 1VBA2 4YW2A 1H4HA 2OUJA 4WM7C 2E6VA