4HVOA

1.75 angstrom x-ray crystal structure of cufe reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
total genus 36
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hvoA01
3PLQA 1UIKA 1O7FA 1IPKA 3EO6A 2XLFA 2GU9A 3FX3A 3E6BA 3GYDA 4QM9A 2IXHA 4OLLA 2BNMA 1QY4A 2BEOA 1HW5A 2GC2A 1QWRA 2Z2SB 1J58A 2GZWA 4O9EA 5I0SA 2GAUA 4ZU7A 4RD7A 4XF4A 4UXAA 3HQXA 4BIFA 5CU1A 3CJXA 3KMHA 4D7SA 5HI0A 3NSTA 1RUOA 1FI2A 1DZTA 4E2SA 5LRSA 4HVQA 3EBRA 2VECA 2OZJA 3PVBB 1IPJA 3OCPA 4N9HA 1ZZ9A 2Q0AA 4KL1A 4E2GA 4MH0E 3MZHA 1XRUA 5BY5A 2MHFA 3WW2A 2UY9A 4HZFA 4F7ZA 4BYYA 1NYWA 4I0AA 1O5UA 2BNOA 4IEVA 4D7TA 4Q0PA 3L2HA 4NVPA 1U12A 4O9GA 3DL3A 3O14A 1VR3A 4MUVA 2OPKA 3EHKA 3WW1A 1GQHA 4CYDA 4YARA 2XLGA 1LRHA 5FLHA 1PMIA 5JSOA 1RUNA 4MX3A 2ET7A 2FMYA 5EZWA 4XF9A 4F8AA 2HKXA 3NJZA 2UYBA 3UKTA 4WVZA 2O1QA 1UIJA 1SQ4A 5I0TA 4WBBA 1CAUB 1I6XA 2QJVA 4QMAA 5BUVA 1WLTA 4FAGA 4I2OA 1NZCA 4J1WA 3IWZA 1XE7A 1ZZ6A 1DGRA 2H6BA 4HVRA 4ONUA 4LLOA 5EFUA 4IEPA 4LA2A 3C3VA 5LEKA 1ZZ8A 3PNAA 5I93A 2QNKA 3TNPB 4I3PA 3LA7A 2H0VA 1J3RA 4XFCA 5CVRA 2E9QA 4PJYA 4XFFA 3H1YA 4L2NA 1CAVB 1LB2A 4KWLA 3FHIB 3USSA 2D5HA 4Q29A 4QXKA 3U10A 1SEFA 2PAEA 2DCTA 3M70A 4TLFA 3ELNA 1WGPA 2K0GA 1H1MA 1ZRFA 1J3QA 3R6SA 1YFWA 2Q4SA 5FLIA 4QM8A 1EP0A 2PTMA 1H1IA 2IXJA 4MZUA 5KHHA 4OFGA 4BHPA 3E5QA 3LA3A 2IC1A 5K8SA 3KSCA 2OYZA 3LWCA 2P17A 3I7DA 4XEZA 3UKVA 4Z82A 4A2UA 3E97A 1EY2A 2N7GA 4IEYA 4AQ6A 4L11A 3ACLA 1I5ZA 3NKTA 3CEWA 4AVBA 1TQ5A 1DZRA 1EPZA 4LA3A 3VHRA 5FPZA 4ZU5A 1UW8A 4IEUA 2IXKA 3FWEA 2PAKA 4IETA 1UCXA 2UY8A 1XE8A 3E5XA 3I59B 4K8FA 2ET1A 3D0JA 3TNQA 2Q1ZB 3N4MA 1SFNA 1YUDA 2PHLA 4LUKA 3E6CC 4QGMA 2BGCA 5FQ0B 1CX4A 3RDIA 1ZX5A 3IDBB 3IDCB 1CAWA 4EWAA 1Q3EA 5AVPA 4HN1A 3G7DA 1YHFA 5I8SA 1J1LA 3FZ3A 4IESA 5JAXA 4YRDA 2F4PA 1OD5A 1LKNA 3RYPA 4XFHA 4AQ2A 1NE4A 4XFBA 5CADA 3MDPA 5KBFA 2Q30A 3B02A 1RTVA 3DV8A 2CAVA 1ZRRA 4PIXA 3ZDSA 1OMIA 4JV4A 4Q0QA 2K9ZA 3NW4A 3KGZA 4HVOA 5I8YA 3H7JA 2XGXA 4UBGA 3RYRA 1OFNA 4AVAA 3I54A 4GULA 2D93A 4KWKA 4HLTA 5I8TA 4I01A 4I02A 4MGYE 1YWKA 2BYVE 2XL9A 3WW4A 2O8QA 1O3SA 4JTNA 5J48A 3CL1A 3HT2A 3CO2A 4R8HA 5FLJA 3BU7A 5C6CA 2WC2A 2EA7A 4EROA 4LUMA 1FT9A 4XFGA 3SCGA 5KHKA 5LRRA 4HN0A 3D0SA 4AVCA 4Q0VA 4KWJA 1VJ2A 4AXOA 3H50A 1GQGA 1ZZCA 1YFYA 4IEXA 5KHJA 3KGLA 4Q0UA 4MV2A 3KCCA 4FBFA 1O3RA 4LULA 3E6DA 2OA2A 2B8MA 5I0UA 3OD0A 4WZCA 4P9GA 4EV0A 4B29A 5JSRA 3FJSA 2PAMA 3MPBA 4ORFA 1CAXB 2EAAA 5BV6A 5FQ0A 1ZRDA 4XF1A 3DN7A 1O3QA 1X7NA 3ETQA 4IEOA 2B5HA 3H1MA 4FT8A 4FAHA 3NVCA 1L3JA 1YFXA 3SCHA 4X6QB 3SMHA 2MNGA 3NL1A 3D82A 3SCFA 2IXLA 2PYTA 1JUHA 4IEWA 5FCCA 5JR7B 3ES1A 2I45A 4QX5A 4KU8A 5BPXA 3H1WA 3RYKA 1G6NA 3IIAA 4LEJA 3QOPA 3RPQA 2GH2A 1DGWA 4J1XA 5FPXA 1X8EA 1RC6A 1QXRA 2FQPA 3CLPA 5J3UA 3BALA 4IERA 1Q5OA 3H3UA 5LEJA 1QXJA 3U11A 5C8WA 2EVXA 4IEQA 2PQQA 3MYXA 4QGNA 2ZCWA 2QVSB 3S7IA 3SXWA 3H3ZA 3GBFA 1CGPA 2BNNA 2QCSB 4ZU4A 5KHIA 1FXZA 1WA4A 4I0BA 1ZNPA 1CAXA 2GC0A 3BB6A 2PHDA 4R52A 4JVAA 1CAVA 3M3IA 3BPZA 4LTAA 3JZVA 1ZZ7A 4MGZE 4YNIA 2D5FA 3EQEA 3H7YA 5J7MA 5JSPA 5JCTA 2CGPA 4XFAA 5D1IA 3H8UA 1J59A 1O4TA 3ES4A 4META 5T3NA 4YSFA 5BXXA 4Z07A 1O3TA 1ZREA 1CAWB 3FE5A 4EWEA 1NXMA 4XF3A 2VPVA 1VP6A 4PIZA 3U0ZA 1CAUA 2IXIA 4PIYA 4E2QA 2UYAA 2XKOA 2HJIA 4XFIA 3CF6E 5I0RA 3RZZA 3UKNA 1UD1A 2GC1A 4BH9A 2H6CA 2ZKLA 1ZZBA 3LZZA 2B9UA 1OI6A 5E16A 3OTFA 1EYBA 2CAUA 1V70A 4N9IA 4IEZA 3H9AA 2Z69A 4DINB 2XKPA 4HSLA 1Y3TA 4X6RB 1ZRCA 2PA7A 3E5UA 4KU7A 4H7LA 3RNSA 5E1RA 4UBHA 2PFWA 4HMZA 3ST7A 2GC3A 4MGIE 1PM7A 2C0ZA 1ZVFA 4XETA 3FFQA 3SHRA 3LOIA 2IXCA 2XL7A 1RL3A 4XF0A 1O5LA 2QDRA 4YYOA 2VQAA 3QACA 3LA2A 4Q0SA 1X82A 1Y9QA 4HBNA 1YLLA 5FDBA 3IBMA 4HSJA 5F1RA 2OZ6A 3HIFA 1YFUA 3OGJA 2KXLA 3EJKA 3ROUA 4JTOA 5I91A 5KHGA 2WFPA 2Y0OA 4EWDA 3S0MA 3OF1A 3LAGA 1RGSA 2CV6A 2XHKA 1X8MA 2V09A 4QGLA 3I59A 1NE6A 1J3PA 3HT1A 2MPFA 3DKWA 1Q43A 2ETEA 3S7EA 2ATFA 4MGKE 1UPIA 2D40A 4I09A 2XLAA 3WW3A 1LR5A 3BCWA
chains in the Genus database with same CATH superfamily
4S2GA 5JPNB 4RHV3 1OD3A 1PO12 2F4LA 3LF7A 2QDNA 4IXLA 4R4XA 3ECQA 3KWVA 2DU1A 3POJA 1W8HA 3BODA 4UAPA 4UBHA 1PNGA 2C6SA 2IXHA 1APNA 2X53S 1OH3A 1A3KA 3VDDB 2XJQA 2FD8A 1WCDJ 1R1ZA 3O12A 3GJBA 3J7HA 4MLOA 4RN5A 4XMIA 2YGLA 5DAPA 1J58A 1T6BX 4O9EA 2QE3A 3JB4C 1XYPA 3N9OA 4FPCA 3UESA 1W04A 3ZXGA 4JKLA 1RITA 4GMP3 1LOAA 3UGFA 3GZTB 5FYCA 4XF4A 4XBLA 4XIOA 1QDOA 1NCQA 4JRLA 3OBTA 3HQXA 3ZN6B 3NSTA 2VM9A 4YVSC 2VZ3A 5GZDA 4D8MA 1DZTA 2DVDA 2FCVA 3PL0A 4OVEA 3SKJE 3GF6A 4JGYC 4E2SA 4HVQA 1FPN2 3OEAA 1KGYA 1F15A 2OZJA 3ZYGA 3MW4A 4GALA 1HV0A 3K2OA 3KT1A 5EXOA 3V0BB 4UT5A 3BTXA 3OGGA 3N7KA 3AMQA 5F8PA 1LTEA 2DTWA 4KL1A 4Y22A 2B4KA 2NN8A 2XWBB 1MS5A 3T1MA 1XRUA 4W8JA 5BY5A 2WBKA 4F7ZA 4W6XA 1GYKA 2VBPA 4M3CE 5FREA 4K8RB 5CFCC 2Y6KA 3GCWA 3PUIA 4CSWA 5C5UA 5D21A 3DGTA 1RUC2 2XG3A 4Q0PA 4Q4V1 3RS6A 1RIRA 3W58A 4CDWB 2WZR3 3CBNA 3O14A 5ANNA 1PK6A 1VR3A 2C26A 4YFZA 3VZNA 4D69A 2OPKA 3POFA 5A32A 5K0UB 3UJQA 5FZKA 1GQHA 3ZSJA 2VNVA 3WUDA 4JGYA 5FZ6A 4YARA 2VMIA 1JTZX 4L97A 4YVSA 3RJRA 1PMIA 5JSOA 1RUNA 5HV4A 4K6BA 5F5CA 4H55A 3ZFGC 3T08A 3DPRC 4BXSV 1LOCA 1JODA 2HKXA 1AR72 2UYBA 1OH4A 4YM2A 3UKTA 2O1QA 3V64A 3VKLA 4BQYA 5EIYB 1UIJA 5I0TA 1W6QA 1GICA 4P9YA 4ZPIA 3ZO0B 1CAUB 4D0QA 4DXSA 1I6XA 2W9XA 2DYCA 3KV5A 4WVMA 2RE9A 2VZQA 2WN3A 4DZGA 2ARAA 2RR13 1UO9A 2A73B 1RUC1 2VULA 4AAPA 1D4M1 1NZCA 2VL4A 2YBKA 1ZBA3 1DGRA 3ZLIA 2R1BA 4HVRA 2YUEA 5EFUA 2RS13 1PM4A 4HL0A 1EV13 1IS5A 2PHTA 3JD73 1BCXA 3TNPB 2Z5WA 2JICA 3LA7A 3NAPA 3T2PA 5KWRA 1STMA 3SH5A 1I1EA 2E9QA 5FPLA 1K3IA 5DDJ3 4GB33 5A7WA 5L9VA 1OUXA 4A4AA 2DTYA 4QPGC 4WM7A 3H1YA 3M1HA 3BOPA 4GQ7A 1AHSA 4QHOA 3OGSA 1W6QB 2LM3A 3Q8BA 4LKEA 4N90A 3J8F1 5FY8A 4FPKA 4OMCA 5CIRA 3J4UH 4QXKA 4MHRA 4CU7A 1SEFA 4RGGA 1LOBA 4RL7A 2KD7A 1O8SA 1UZ0A 4GKXA 2K0GA 2GNTA 4Y33A 4GAZA 3WG2A 1EUTA 3N9QA 5JOZA 3N35A 1SLLA 1YFWA 1LULA 4QM8A 1I5PA 4YM3A 4XIKA 1BK0A 1QH7A 3GHNA 1SACA 2WZEA 4XDOA 4QQOA 3PMEA 3LA3A 2XQXA 1VMFA 3IB3A 1DLLA 4NE9A 1OF4A 4CDWA 3GZAA 5IVYA 5LA2A 4L99A 4CEWC 4LKSA 2WNUB 3X29B 2PHUA 2A71A 3HAGA 4JHZA 1AYN1 3WP6A 3NNLA 3UKVA 4LBOA 4BQ3A 2WZR1 1VAMA 2NLRA 3IDEA 5A6XA 3W9AA 2N7GA 3PUQA 2VQUA 4P00B 1N3PA 5JWPA 1V6OA 3THDA 4XVHA 4AHYA 1N1YA 1JU4A 1LHOA 3MW3A 3WG1A 1TG7A 3QBQA 1FOD1 1QJFA 1DGWX 2RS51 3B00A 1E5HA 3PUHA 4JQRA 3LDKA 1TQ5A 1UYZA 4H3WA 5FZFA 4XW3A 4BQ1A 4Y5Z0 1CZSA 3VHRA 3K4DA 2DVAA 3D6EA 1UW8A 2A6VA 4K20A 4UWDA 3TOJA 4DO0A 1VMHA 1WMXA 1UCXA 3BU0A 3AKQA 2JG8B 3AKPA 2VZOA 4IE7A 4LO4B 2CYFA 2D6LX 4XC9A 2Y60A 3TNQA 2ZGSA 1BEV1 1QJY2 4AQTA 5H9QA 4K1YA 4LUKA 1GMMA 2AYHA 2Q5TA 4DRVA 2YU1A 1H6YA 1WMDA 1NQDA 3MFAA 2BGCA 4K21A 4QT6A 3O1SA 3PIGA 3IDBB 4IGPA 1RUC3 4D3WA 4NIAA 4COZA 2JIGA 3I3MA 1CAWA 2JDMA 4EWAA 1Q3EA 3QD6A 1WZXA 2JWPA 3OPZA 5AVPA 5AC91 1WW6A 4P9IA 5I8SA 1J1LA 3O5SA 3THCA 3VHNA 4QB2A 5JAXA 4FOVA 1ULGA 4YRDA 1BK1A 2JDUA 1OD5A 3B94A 1AR63 3BI3A 3VBFB 1LODA 1BZWA 2GNBA 4YVWB 4IV3A 1AZDA 2RR11 5C71A 3HBZA 4QXCA 4LOSA 3WINE 1RTVA 2IWGB 3FHAA 2GP3A 3LDBA 3ZDSA 4JV4A 4Q0QA 1HXS2 3LEMA 2K9ZA 3NJVA 2VE1A 2AACA 2VZSA 2XVGA 4KG0A 1SG3A 3ILFA 3KZ4C 3GCXA 1TME2 5I8YA 3H7JA 2XGXA 3VD3A 3IN9A 4Q27A 1GP6A 4CXXA 4ATFA 4HPKB 3JD71 2HH9A 1A8DA 4NAMA 1BKZA 1OOPB 4E8CA 3K75B 4FVVA 3DPRB 3T0DA 2DBIA 2XL9A 1GNZA 3LEIA 1UKGA 2O8QA 4OHZA 4JTNA 1O3SA 3HMYA 4LITA 3PU3A 1L7LA 3L2YA 4PLMA 5FPBA 1RINA 3VL8A 3HT2A 1YXWA 1UY4A 3CO2A 2VZVA 1ND3C 4CCLA 2WC2A 3T0BA 3VBHC 1GUIA 3UJOA 2X5IA 4UI9L 1CJDA 3UETA 3JD72 1G86A 4RHV1 4LUMA 3LEKA 5C3SA 3LEGA 3AK0A 3BTYA 3D3AA 5FZDA 3UNPA 4DUXA 4AVCA 1TVGA 2Q8OA 3H50A 2RJKA 3AVRA 4QQPA 3MF6A 5FZ7A 4KBZA 5IW0A 2QQWA 1GWKA 2OT7A 5IVEA 3AXDA 5L9RA 4ZKTB 3KGLA 4I30A 5C9AC 1O8PA 5FYBA 1O3RA 1NZIA 3VHOA 1HN1A 2OA2A 3NJYA 2WO3A 2XVLA 3MFCA 3ASIA 3JQWA 4EV0A 1CPMA 1WLWA 5JSRA 4AEDB 2VVDA 3AB0A 1OA4A 5FQ0A 1ZRDA 1AYM3 3ZXEA 4ZXEA 3B5LB 5D2AA 3DN7A 2ZGQA 3AJZA 4YW1A 2YDEA 5FZGA 4V1PA 1H9WA 3MIBA 3ETQA 2GMPA 1BEV3 4IEOA 3JBG2 1AX2A 3VZKA 4IV1C 2WT0A 3NVCA 2R1DA 3ILNA 3SMHA 4AW7A 2P1BA 1N3QA 3HNBM 5GZCA 1YRZA 3GZUC 2YFZA 2PYTA 4JX0A 1VRH1 2A3WA 5JR7B 1HV1A 2QQUA 3POYA 3MI8A 4IGOA 4O7XA 1OLQA 4CDUC 3HPNA 5A3MA 3FUQA 3RYKA 1G6NA 5A70A 1GP4A 5JPMB 4G3YC 1YQ8A 3WQBA 1W6OB 4J1XA 2JJ6A 1TNFA 1RMU3 3NNMA 1RC6A 2A3XA 1QXRA 5GM0A 4CEWB 4C90A 1V6IA 5J3UA 1W0NA 3WP5A 1US2A 4A3XA 4Q8LA 3E1F1 5SV5A 5CA6A 1Q5OA 2Y38A 5D8AB 1BJQA 2JE7A 2DVFA 3M4FA 3GXUA 1NA1A 2MEV3 1NUKA 4JGZA 2ZX3A 4JGZB 4C8DA 2WZR2 3WXPA 4IEQA 1B35C 1QEXA 1WBFA 1FPN3 4CPBD 4OCTA 2Q8CA 3ZXDA 5CYYA 2JB4A 2XB6C 4YZ1A 1PZ9A 3T09A 3LCPA 4WVMB 4EN9B 1W8WA 3GBFA 4OHVA 1CGPA 2BNNA 4AVVA 4YW7A 1POV0 5T5JA 1SFYA 3WT3A 1PZ7A 4DOUA 3AP9A 2YC2A 3D5OA 1YCIA 1QGLA 5LW9A 5G04L 2LRPA 4F3JA 3V0AB 4AI2A 2CWMA 1XJAA 1KXGA 3M3IA 3WG4A 1JZ6A 1ZZ7A 2A7AA 2D43A 4CUBA 2ZX4A 4MGZE 4NHKA 3RWNA 3ME2A 4Y4YA 3KT4A 4D6SA 3NO8A 1G9BA 3ZDVA 4AQSA 3AKRA 5JSPA 4CDQC 5JCTA 1S0GA 4XYXA 2G19A 4XFAA 5D1IA 5F39A 1Y9MA 3A4UA 4BDVB 1Q8PA 2RM21 3N9NA 1W06A 3MBWA 3OBRA 4DY3A 2YV8A 1O4TA 2QZ3A 3TEYA 1OUSA 4JKKA 4Z07A 1JW6A 4GB31 2OUHA 5ANQA 5BXXA 4OHXA 2VQTA 1CPNA 1JYWA 3AZZA 3FE5A 5FXWA 3B9IA 1UYPA 2WN2A 3OY8A 4LHLA 1UOJA 1VP6A 2PQSA 1F5JA 1CAUA 1D4M2 4CDWC 4IE0A 4MVTA 2EXHA 1W9SA 2XKOA 5L73A 2WA4A 2DUQA 1C5IA 2HJIA 4XFIA 3RZZA 5EQUA 3WVJA 1R1A1 3UKNA 5CB7A 3R4UA 4FOQA 5GJ6A 4FQZA 3AP6A 2BU9A 1MQTB 3MICA 5C3OA 2YB7A 5FMOL 5FYHA 5E16A 4AI9A 1GZTA 2VJXA 2IVIB 1AR71 3TEXA 5LK5A 4DQAA 3VDAA 1PO23 2NQYA 5A6ZA 1HRV1 2RJ2A 3H9AA 1RXGA 1RMU1 1W8NA 4DINB 2CGNA 1FV3A 2XKPA 2AUYA 4HSLA 1Y3TA 3CJIC 5HXVA 2BTVC 3TWIA 2QQJA 3RJ2X 4WZFA 4X6RB 1ZRCA 2PA7A 4RQPC 4ARYA 4KU7A 4MG2A 5ACA2 3JU9A 3RNSA 1QJX1 3Q8EA 4GD4A 3EXUA 3NV3A 2PFWA 1JOJA 1UL9A 1F31A 1UMHA 3B69A 4Q2FA 4EZHA 2VCAA 3AL5A 3ST7A 3CU7A 2B39A 3LGRA 5CISA 1YIPA 4CCNA 2W5FA 5APAA 5JZGC 3O1OA 1LCLA 2YFUA 5F3GA 3FFQA 5J98B 5C3RA 2PHWA 2Y6LA 2ZAAA 3I2DA 3LOIA 5EJZB 2BDRA 3AZYA 1XB9A 3PJQA 5T5PA 4KGGA 2W87A 2QDRA 2V72A 3C7EA 3TEZA 4LO7A 4ISQA 4ZONA 1MACA 1GLHA 4YYOA 4Q8KA 3QACA 4P9WA 4UF0B 1Y9QA 1HKDA 5FDBA 1DFQA 1X36A 4PDWB 4OI2A 4DUVA 2W0XA 5F1RA 5HCHA 1C3HA 1NCRB 4RGKA 4EQVA 2PN5A 4GMP0 4BYYA 3LFIA 5F3EA 4Y1XA 4JTOA 5I91A 3MO4A 1C28A 4KNCA 3RQ0A 4EWDA 1NA1C 3S0MA 5FXZA 2ZHNA 1RGSA 4NRPA 2ZGTA 5FUIA 3HR9A 4B4RA 2CV6A 2KM2A 4P5HA 5HPOA 1NCRA 1MS0A 2RS12 2W3JA 4R9DA 5F2WA 5FP4A 3I59A 1V9U2 4CDQA 2YU2A 4LHKA 4XUOA 3ZIXA 1AL23 1RUG1 1S2BA 3HT1A 3M3OA 1XC6A 1PNFA 2MPFA 2ETEA 3RWKX 3MLLA 1RUH1 2JD9A 5M0TA 2ATFA 4PF1A 4ES9A 5AVAA 1C1FA 3NMBA 1JXNA 5JXJA 4B1MA 3WW3A 5AC92 2R30A 2G4IA 1H2MA 3BCWA 4LO5B 4URTA 2JDZA 4GH4A 1NX9A 1UIKA 2ZX0A 1K42A 2E6VA 1GANA 1KRIA 3I3QA 3RG0A 3U75A 1BYHA 2C5DA 4QM9A 3GYDA 1C8M2 2PHXA 3I2IA 3UGHA 3GDBA 4TXWA 5H9SA 4CE8A 1GNHA 1XOYA 2RDNA 4CEYB 2BNMA 3JXSA 5A6QA 2ZHLA 4C1XA 2GC2A 1QWRA 1WD3A 2IZWA 2WS93 3MIDA 4NPMA 5HCBA 5IK5A 1V6KA 1N1VA 4YW2A 4ZU7A 3N36A 5DZFA 4HONA 2Y6FA 1CD3G 4BIFA 1FOD2 4LMFA 3KMHA 5DUVA 4D7SA 1RUOA 3SKVA 2W1SA 5EJ3A 3ZYFA 2VO5A 4AL9A 4RR3B 4BM8A 3K3NA 5KXDA 3AP7A 5LRSA 4Y1ZA 3LKJA 2C9AA 3RI9A 3PVBB 1DYKA 4FPLA 1AYN2 5EYXA 1ZRIA 1W9WA 2BUKA 2FCTA 4BQ2A 3N9PA 3NNJA 3OPTA 4RSUA 3U14A 3DYPA 4LKDA 3TRSB 4ZZ5A 1CIYA 2GSYA 5A7WB 3WW2A 4HZFA 1ENRA 4Y26A 5FYZA 1NYWA 4I0AA 2OUJA 5LBEA 1IOAA 4W6WA 4AF9A 1J83A 3FUOA 5HCFA 4D7TA 4LR4A 1KITA 2ZABA 4YVWC 4NVPA 4E4ZA 4LBQA 5I0DA 2VCCA 4NRMA 1K5MC 3DL3A 1S55A 4HETA 4DIQA 4ISRA 1G9CA 2NPIA 1MVQA 5BNPC 2XR4A 4N43C 2YYOA 3WW1A 2QQPA 2XJVA 4CYDA 4BIOA 1LRHA 4DXZA 3RSJA 3W20A 3C8XA 1J1TA 2V5DA 2VMDA 1RVF2 1XNBA 1RVF1 2X10A 1HRI1 3O0VA 3CZUA 4LBJA 2VOVA 4XF9A 4YG0A 2A6WA 1SFPA 2QTWB 2ZZJA 3K51A 3KT7A 4LE3A 1LESA 4NHMA 5FYVA 3ZKYA 3ZYBA 5FOJB 3KS7A 2LS6A 1CZTA 2LALA 4QDQA 2TUNA 3VKMA 2KR2A 4XJWA 3S6PA 3KF5A 2ZJCA 1ZA4A 5A3NA 3VBHB 1RUI3 1RUG2 2GMMA 2J1TA 3DECA 5BUVA 1Q8OA 4EZ4A 3T3YA 2WNVB 2L9LA 4A7KA 3AP4A 4I2OA 2CWSA 4ATEA 4CVUA 1JYNA 5K0UA 4B7KA 1R64A 4GH4C 3IWZA 1Q8VA 5A7NA 1PVC1 2BRTA 4QQHA 3THPA 1LU2A 1LHWA 4QX7A 2P6HA 4LLOA 3QLQA 4IUGA 3C3VA 1EV11 3N3HA 3KHCA 2TBVA 5I93A 4YM1A 2DCKA 3R05A 1C8M1 1J3RA 2DV9A 1CWPA 4XFFA 2ZMKA 3S5QA 1LB2A 4JAAA 4KWLA 1NCRC 3D8CA 1AR93 4QU2A 2RMU1 2Y0IA 1ODMA 2P37A 3J8F3 4KBBA 1LU1A 3U10A 2QQIA 1MS4A 3WLUA 4PI0A 1ZA7A 4TLFA 4TTGA 3URFA 1XYOA 4FP2A 1J3QA 3C7FA 4C0HA 5C4WB 3I2OA 3W21A 2Q4SA 4LBLA 2XHNA 3ZXJA 4ZHNA 4FTSA 2BP6A 2IFRA 3EB7A 1U5YA 5IVBA 1RUF3 4OFGA 3OGRA 5FJKA 3MV11 4CUGA 2ARCA 4MADA 2DUPA 4MOAA 5BNPB 2WNEA 3LIGA 5K8SA 1RMU2 3MUZ1 1RXFA 2C24A 1OOPC 3ZFFA 2ZXQA 1JN2P 2OYZA 3O1RA 2W2IA 2ZMNA 1W6NB 3LWCA 5FO8B 5ACA3 1QJEA 1UF2C 3J7LA 1PGW2 2DVGA 2YGMA 1EY2A 3E97A 3W5MA 1GQPA 1POV1 3MIHA 5GZEA 1B35A 2VMEA 4QX3A 4L92A 5FY0A 1XYNA 4AAXA 4CEYC 1F35A 2JEMA 4UFIA 4M4RA 1R1A3 1DZRA 2AEYA 1BVP1 5FYSA 4CZSA 3FN9A 2Z4FA 1VB2A 4ZU5A 4HKLA 4IEUA 2ZBJA 3KD4A 4KMQA 4D94A 2PAKA 4IETA 2W1WA 2VW0A 1VE0A 2UY8A 2NZ9A 3E5XA 4N43A 4BE3A 3BKZA 5ACA1 4WM8B 4W6YA 1YUDA 2B45X 4M0NA 3VUOA 4CEWA 4YZ5A 4NIGA 1MS1A 2OS2A 4FTEA 4AI3A 1DQ0A 1CX4A 1NLQA 2WDBA 3RDIA 2X29A 2Z42A 3IDCB 3RMXA 5DPNA 2JDKA 3MLJA 1ZBA2 4JDMA 1AX0A 1W0PA 1PX3A 3ZYRA 1GR3A 4HN1A 1YHFA 5FZOB 3FZ3A 1AXYA 4FPGA 4IESA 4KG8A 4QB6A 3H42B 2OW4A 1D2QA 3FBYA 1W05A 4HANA 4IV3B 1OFSA 3RYPA 3T4HB 4AQ2A 1QJU2 3IAQA 3POSA 3JB8A 2QQOA 1Z7S1 2VVFA 3DV8A 2VNGA 2CAVA 4FXGB 5FZEA 4YZ4A 3WSOA 1WUVA 2UWCA 2R7EB 1MQTA 1V6MA 1VAKA 3AZXA 3NW4A 4HVOA 1KJRA 2NM1A 3ZOIA 4LBNA 5JLVA 4ET7A 4NIDA 2Z79A 1XU2A 5IFTA 4XBQA 4CA9A 2VH9A 3ACIA 1DGLA 1MS9A 2DUOA 1AXKA 2EXIA 5JVVA 2VUCA 2D93A 4KWKA 4HLTA 5I8TA 4I01A 1LECA 3GJAA 4QAWA 1YWKA 4TLGA 1DZQA 3AP5A 2BERA 3WP4A 5FMDA 5FXVA 3CL1A 1RUF2 2ZOEB 2F17A 1D4M3 3ZPYA 5A7OA 4SBVA 3WR0A 2O8OA 1VIWB 1NLRA 4NR1A 4R8HA 2P2KA 1FOD3 3POIA 2HWB1 5FLJA 5C6CA 2EA7A 4A6OA 1AR62 1SBDA 4CCCA 1MEC3 5TSWA 3NWKA 2PLV2 1WW7A 4XFGA 5FYIA 3VBUA 1BBT2 2WFF3 5DQ0A 1W8UA 5H9PA 1BBT1 2VBDA 3NRUA 5FY1A 4YG3A 4YW6A 4HN0A 1HQNA 3D0SA 2ZKNA 4KWJA 1BMV2 1GQGA 5FMCA 2WR9A 3WDUA 1AR61 1OA2A 2BW8A 1IS6A 4FP3A 5KHJA 4MV2A 4LO6B 4XZPA 3WDVA 3VHPA 1UU4A 1UU5A 2B8MA 1CX1A 2UWBA 4WVWA 2EIBA 2XJTA 1W9TA 4P9GA 1PO22 3MIGA 5T52A 2UWAA 1H30A 1ENXA 3MPBA 1CAXB 1FNZA 1ASJ3 2R072 4N7IA 2CSGA 2RVAA 5FP9A 4G4FA 5LY1A 5KXCA 2RDSA 1XNKA 4QQLA 1NOVA 5BNQA 3H1MA 4FAHA 1I9RA 1L3JA 4GXLA 1YFXA 1FV2A 4X6QB 3SCHA 5GLVA 2ORXA 2XDVA 3NL1A 4B3NA 3VBFC 1XPWA 2AEZA 2ZGMA 4QX5A 4KU8A 1HB3A 2VW1A 4XUTA 4Y4RA 4CP1A 1IQAA 2D97A 1XXNA 3H1WA 1LOFC 2VVEA 5BNOC 1UZYA 1JUIA 4WM7B 2A1XA 4LEJA 4OI4A 4QKNA 2GH2A 3KB5A 5EPAA 1S0IA 3WNLA 1US3A 1XNTA 2Y6JA 3IDAA 4Z92B 2K46A 4RA0A 1HJFA 3SH4A 1ZBA1 2HWE1 1N47A 2WL1A 3FC0A 2JG8A 2AGSA 2DF7A 3H3UA 4DXTA 5GLTA 5JIAA 5LEJA 5IK4A 5C8WA 5L36A 5FY4A 3PVNA 5ERLA 4RFT0 3IZOA 1AL22 2EVXA 4FFFA 3J7MA 2W39A 4PBOA 2J1RA 3DXUA 3PJYA 4XHXA 5IT6A 3MYXA 3WNMA 1X9TA 4U36A 3S7IA 3SXWA 3B3QE 3VBFA 1R083 3H3ZA 1C1LA 2CY6A 4INDA 4L0PA 2D44A 2QCSB 4ZU4A 5KHIA 1AUYA 1VRH2 1FXZA 2K2SA 3SITA 1IS3A 3LIHA 1U5IA 4QX0A 1CAXA 5IVFA 2GC0A 1XNDA 2Y8KA 3BB6A 4KGQA 4WM8C 3K77A 4R52A 3FMGA 2J22A 1CAVA 5L9BA 2PLV3 4XOGA 4OHYA 3BPZA 3OSDA 1X50A 3ZKUA 5A3TA 5BNNC 4YNIA 3KQRA 2RHPA 1LGNA 3NKGA 5J7MA 3OGVA 5CBLA 2CGPA 1PK6B 5DAQA 3ZN4A 1UU6A 3C7HA 2BGPA 1S0JA 4IV3C 5B2GB 4OHWA 1H8TB 2D98A 2J1AA 3CNAA 1LHVA 1QJY1 3AMNA 5T3NA 4YSFA 2C1FA 2YMZA 5FY7A 2BQPA 2WT2A 3KV6A 4AEKA 3FL7A 3WV6A 2VTFA 4BQXA 3WDXA 2FMDA 4K40A 5FZCA 3CHXA 1NXMA 4XF3A 3LPFA 2XBO2 3F95A 2JECA 1H2LA 3NV2A 3U0ZA 3WNXA 1OOPA 4IDZA 4PIYA 4E2QA 1G7YA 2UYAA 5J96B 1OKQA 2HWD3 5BNOB 1AR73 2E51A 3CF6E 4GJZA 4N43B 4QX1A 2GN7A 4RYDA 1Z78A 1PMJX 1UD1A 4BU2A 1WCSA 1SLTA 4Q1PA 4CP9A 1NQJA 2I07B 4LIUA 1CVNA 1ZZBA 3LZZA 1O6UA 2ZHKA 2B9UA 1OI6A 4HOOA 3IT8A 3MPPG 1V70A 3A22A 1PO21 4GKYA 2CGOA 1FPN1 1O4YA 2R49A 1RUE1 1SMVA 1FX5A 1TME1 4NIHA 2GH8A 1CONA 2W46A 2Y64A 2Z69A 3INAA 2NMNA 1JBCA 2XJPA 4Q4V3 1UXZA 1POQA 4P9JA 4ITCA 1ND2C 3KHBA 3O1TA 1MR5A 1EAH1 5FTTC 5HV0A 4YVSB 5JOYA 3OJBA 3A0KA 2CL2A 4WM8A 5IUQA 4RR3C 1SPPB 2WO2A 2IXCA 2DU0A 4XF0A 2RMU2 5C4WA 2D6MA 3I2GA 3O0WA 5FZMA 1PGL1 4BK4A 2ZGKA 2AH2A 3KVBA 4HBNA 1YLLA 3Q8AA 4TSVA 5CFCA 1R081 3VBRB 1C57A 3GNEA 3IBMA 3WQ1A 2ILMA 1WCUA 3HIFA 4Y1UA 1XNAA 2B9VA 4Q4X3 3BOWA 1OURA 3ROUA 3C7OA 2BBVA 4JKMA 5KHGA 5AFEA 1U5ZA 1XSRA 1VBB3 4W50A 5F7UA 1XNCA 4RQPA 3VGIA 4AR2A 1NY72 2BOIA 2HLEA 3A0NA 4NPLA 4K3UA 4BXFA 1UOBA 4Y22B 4AI1A 2VGDA 1YO8A 3CJIA 4QPYA 2RS32 1QOTA 2OVUA 3AFGA 4YZ2A 3VD9A 1YQCA 2RS52 1QKQA 1Z0HA 3CMGA 4NHLA 4XDPA 1NY71 2R0HA 1Q43A 1OC1A 3NAPC 5IVVA 1AJKA 1GWMA 1TEIA 4NRQA 1WCQA 2HEYF 1LOFA 3LPGA 3S7EA 3SNMA 5EYYA 4OZXA 1UPIA 2VZTA 4I09A 3WF1A 3AZVA 4C91A 3ZFFC 3DYMA 3IM0A 1FNYA 3WD5A 1LR5A 5JXIA 5LCWL 1PHMA 1G9FA 4YGBA 5A32B 1ULPA 4BOWA 1PGL2 1UY3A 2XONA 1UQXA 4TWTA 5B4XA 2VQ0A 3EO6A 5C33A 2ADEA 2LUWA 2HWB3 3RI8A 2O0OA 1YI7A 5FZOA 3PVOA 3HQUA 5T55A 2CHHA 3HD8B 1LOGA 4ZZ8A 3SEPA 5F2SA 2YBPA 4OLLA 1H6XA 3BIEA 3CJIB 4XJAA 1QY4A 5LASA 4Q4Y1 1HW5A 5LB6A 2Z2SB 4GIQA 5A3OA 1S2EA 2ADDA 3T1LA 3ZIWA 1QQP1 2HWC3 1BQPA 3PURA 1G9AA 1H9PA 1ND2B 3ZFGA 1JZ8A 3I8TA 1H8VA 4UXAA 3PVEA 1DHKB 4KI5M 5HI0A 5CU1A 3CJXA 1UPSA 2HWD1 1TZOA 4XBNA 5JXGA 2WQZC 1NXD1 4FPHA 1FI2A 5DG1A 3UV9A 1HB1A 1JS9A 3M2MA 5CZKA 5K4LA 3EBRA 5A7PA 2DDUA 1YEWA 4MXWA 3TAYA 2VECA 3APBA 1IPJA 4CDQB 2RMU3 1NCQB 4P08A 4D6QA 5FWJA 1AR92 1EPWA 3H0OA 3OCPA 4N9HA 5IATA 1IPSA 1RUH2 4MH0E 1ULFA 1OXCA 1VLNA 4E4HA 2B7YA 2VOWA 2EALA 2J1EA 2VY0A 1D2SA 3IMMA 1WA6X 2HWD2 4AI0A 3OG2A 1O5UA 2J7MA 4ZS3A 3T30A 5C7GA 3O1UA 5C4WC 5J37A 3OPWA 3FBMA 4MXWB 3VDBA 2D7FA 2EF6A 1U12A 3MF9A 4COUA 1HN0A 3WQ0A 1HB2A 1JHNA 2VZUA 4NROA 4M0HA 4M01A 4MUVA 4O61A 4CP0A 4GWNA 1EAH3 3EHKA 1DIWA 4Q26A 3WDWA 4BMEA 4EJRA 3NV1A 4BLIA 4HK8A 1ST8A 3J7NA 1BHGA 1H0BA 1MQTC 3KV4A 3K4AA 2VCBA 3POWA 1W2NA 1AJOA 1PO11 5FY9A 3M3EA 4IL7A 5FP7A 2ET7A 3ZSMA 3ON7A 5EZWA 2FDJA 4TYSA 4F8AA 3ZFEB 2EIEA 3NJZA 4GWMA 1CIWA 5KC5A 1R093 4LK7A 5SV8A 1K5MA 4LNVA 3K46A 1SQ4A 1W6MA 1IZ3A 4WBBA 1YNAA 2XOMA 1CN1A 2E26A 1GSLA 2BVVA 4CDXB 1W99A 5AC93 1F9KA 4QMAA 1WLTA 2HEWF 1COV1 2ARXA 4Q4V2 2Y6GA 5DAXA 4FAGA 3USUB 1UZWA 5JZGB 4J1WA 1H8TA 2X8KA 1ZZ6A 4QDSA 2RV9A 3POBA 3T4VA 5A80A 2H6BA 4N8MA 5FRAA 4AFMA 4OQ8A 2ZMLA 3I49A 4PI2A 4LJHA 1QU0A 1K45A 2JE8A 4XPVA 3PIJA 4LA2A 5JMCA 5J1XA 5LEKA 3S5AA 4OUEA 1ZZ8A 3PNAA 3VKFC 1AR91 2QNKA 3B7MA 4GB32 2ZGUA 4W4ZA 2H0VA 2WNVA 1N1SA 2WO7A 2VUDA 1CQ9A 5CVRA 3VBRC 2MEV2 4AEDC 2RDQA 1HRI2 1OPOA 4PJYA 4DY5A 2E33A 4L2NA 2JG9A 3DKQA 4NMIA 1VBD3 4Y20B 5FZBA 2HBUA 1O91A 2ZGOA 5IK8A 1LENA 5L7OA 1BBT3 2WFF2 4RS5A 4CU6A 3RZJA 1RUJ1 2PAEA 4AGRA 1JZ4A 2VZPA 1SHWB 1YI9A 2DCTA 3M70A 4ZY9A 1S1AA 1DLCA 5FO7B 3ELNA 3IAPA 3HBKA 1H2KA 1WGPA 5C5TA 1H1MA 1VBC3 2SBAA 4XHBA 3ACFA 3M7AA 2AREA 2W1UA 1IKQA 2XWJB 3R6SA 4UFMA 2E7AA 4NN0A 5DN2A 1XQNA 5CKNA 1QQP3 2HWC1 2PTMA 3KV9A 1H1IA 2IXJA 4B4PA 5KHHA 3ZSEA 5CFDA 3ALQA 1HJGA 3HN1A 3WNNA 1IS4A 2RS31 1WW5A 2RM22 4BHPA 4BQWA 1F8VA 4XTMA 3E5QA 4Y1YA 4ASKA 2GDFA 2IC1A 1W3VA 2W91A 1KFXL 3N9MA 1SBFA 5A1FA 5KR7A 4RGAA 4ZXKA 2P17A 5DAVA 4XCBA 1FMD3 1ULCA 3I2KA 4MGQA 3GZEA 2KA3A 1D0GA 1G8WA 1H4GA 2VUJA 2OQ6A 4IEYA 4OUMA 1L7QA 3HEIA 3LE0A 2ORZA 3OYWA 1C5HA 4HG6B 5DXDA 4AQ6A 4CU8A 1RUD2 1SLCA 1UN1A 4LK6A 3WNPA 3U78A 4CP2A 3NKTA 3S57A 3CEWA 3H8RA 2ZPXA 2HWF1 4YGEA 2Y34A 1RHI2 1HDKA 2VMGA 1OVPA 1KS4A 5FPZA 4IQPA 1VRH3 2J42A 2W68A 4DMIA 3RZKA 5LATA 2JDNA 4B7EA 3O1VA 1VBA2 2UURA 5FMBA 1JYTA 1IG3A 5C9AB 1XE8A 2CU5A 4WVVA 3VZOA 2ET1A 3D0JA 1FATA 2Q1ZB 4HK9A 2E63A 1YJLA 3AM2A 4XTPA 2PHLA 4CCEA 1VBC1 3Q8CA 5C70A 1W6OA 3VN4A 3VLBB 3FFZA 3ZYHA 5FZ4A 1REEA 4ZS2A 2ZTNA 3HNYM 2YXSA 1PX4A 4GMP1 1RUF1 1PIV2 1WBLA 2D6OX 5F5IA 2JENA 1UX6A 3ACHA 5EJ1B 4Q1RA 2P3YA 4UW4A 3U1XA 4URAA 1VBD2 3FLRA 4IE6A 4M4PA 2F4PA 3MEPA 1WW4A 3BPSA 4NAOA 3AJYA 1ASJ1 2GNMA 2TEPA 2YBSA 4CUAA 1MZ6A 2BJSA 5CADA 5KBFA 3H8XA 2Q30A 3B02A 2W94A 4YFWA 2RS11 1SBEA 4BK5A 3AMHA 1ZRRA 5A3LA 5C8CC 1OMIA 3K4ZA 1JZ3A 1ULDA 3GALA 3THTA 2ZEZA 3BTAA 3P1IA 4JRAA 4XJZA 3ATGA 5LK7B 4G9SB 1DYPA 1OF3A 4PBPA 4KWUA 1OQ1A 1ZBE2 3RYRA 1OFNA 4AVAA 5A1AA 3I54A 2BOJA 4RHV2 4COYA 2R063 2ID4A 1DG6A 1RUI1 4YGDA 3VBUC 3I2FA 2WS92 2BYVE 3WW4A 3LSEA 1KJLA 3ZFEC 2A6XA 1F5FA 1UOGA 3VD4A 1R092 4AFCA 2W92A 5GLWA 3UT0A 4A7ZA 5GZFA 5E8AA 1LNSA 3LOBA 4DUWA 1GKBA 1PO13 2WKKA 2A6ZA 4TN7A 3R4SA 2DBNA 2XBO1 1ONAA 2VTXA 3I97A 1JH5A 2RS33 1FT9A 3MV01 5FWEA 5A33B 5KHKA 5LRRA 1YYNA 2R042 4QHZA 2X05A 4RS5C 4Q0VA 1B09A 1OA3A 1VJ2A 1AR81 1OLRA 5L7OC 1W9YA 2PHFA 1DP0A 3QH7A 2JG9C 2JG8C 1RHI3 2RR12 5FXXA 4LULA 3V0AA 1GP5A 1ASJ2 2R073 5K9YA 3LDRA 4A3ZA 4WZCA 2VCMA 2VXRA 1HQLA 1QOOA 2PAMA 4IE5A 4BWOA 4ORFA 2EAAA 5JUVA 3B9CA 3CDZB 2E32A 4QPGB 3TEWA 1C8NA 4UFLA 5FYUA 3UGGA 4AGGA 3ETPA 3C2UA 4CUCA 1ALYA 3ZM8A 4CCMA 2VOKA 2XH6A 4AK3A 4ES8A 3H8OA 3WF0A 1O3QA 5CAZA 3ZXFA 5KC6A 1W90A 2I2SA 3V56A 1R1A2 4LBKA 2SLIA 4YW3A 4FT8A 2Q1MA 3ZMOA 1OSGA 2HWE2 1TE1B 1W6PB 2MNGA 1JU3A 4OZOA 5CEHA 3D82A 4FFHA 3L9JT 3SCFA 2BPA2 4FSJA 2IXLA 4FPEA 1NA1B 5FCCA 1W8FA 2CDPA 3PUSA 4XUQA 4OMDA 5LBFA 4OUSA 1NT0A 4L8QA 2I45A 4UW6A 4AVTA 1DQ6A 1SZBA 1S0EA 2FBEA 5BPXA 1MPXA 1QXPA 2D6KA 4Y20A 4XCAA 4ASMB 4Z1VA 3IIAA 1YC61 3U4XA 3QOPA 4QPIA 4CCOA 1RVF3 1DGWA 1MVEA 3N7LA 1X8EA 4MSVA 1HB4A 4GWJA 1V6NA 1WWYA 4C0BA 2FQPA 3CLPA 1H2NA 4B4QA 3BALA 2Y6HA 5ABJA 5IVCA 2VW2A 2VTXJ 1QXJA 1UKRA 3EYPA 3U11A 3POEA 4JCKA 4YG6A 4DS0A 1JMUB 4LORA 4LE4A 1AL0G 5LBCA 1Y7BA 4CDUA 3USUA 3BYWA 1W28A 4COWA 5IVJA 1CJPA 2ZCWA 1K5JA 2PMWB 2QVSB 5BYNA 1ND3B 3OUJA 2WQ4A 4AI8A 5A1LA 3KLSA 2VNOA 5LY2A 4M3CF 2Q1FA 1WA4A 4I0BA 5FAXA 1TNRA 3I3DA 3I3BA 2HWC2 3UYJA 4RS5B 4BQ5A 2YROA 1ZYBA 3PTYA 4XJUA 4Z2AA 2H0BA 5F37A 5FK7A 3M3QA 2WAOA 2PHDA 5IFPA 3MLKA 2JG9B 5FZLA 4S2DA 2PLV1 3OBAA 4Q5OA 2QQLA 1JOPA 3AMPA 3JZVA 4LTAA 4NOTA 4J6GA 4Y24A 2XPJA 2JX9A 4MYEA 5FZHA 5EP9A 4MHUA 4PCRA 1SLAA 2D5FA 2HWB2 2VOTA 3JBG3 3FLPA 3EQEA 4E4DX 3H7YA 3ZYPA 2R6QA 2WT1A 3HWJA 4HKOA 1NCQC 4LHSA 3RZMA 4Q4X2 5LA9A 3VBOA 4EE2A 1OLME 3BIWE 1OPMA 3DEMA 4BISA 4JDNA 4NJ4A 4BA6A 1Q8QA 2YPDA 1ENQA 1J59A 4HT1T 4XACA 2UU8A 1DYOA 3WHTA 1O3TA 4PQ9A 4NIIA 2XBO3 2GN3A 2WO1A 3IMNA 3B93A 2D6PA 4XJ9A 2IVJA 4DEVA 2LROA 1UY1A 4OQ9A 1KDKA 2D3PA 2ERFA 1YQ5A 4FOWA 3EMRA 2JD4A 1OQEA 2BFUS 2QKDA 2WLPA 4PF5A 1W6MB 1QNYA 3NAPB 1QDCA 1Z7S2 4HPKA 1DQ1A 1TMF3 4YZ3A 2HWE3 1MZ5A 3ZFEA 4FTBA 5K0UC 1DU3D 5F5QA 2ZZQA 2EXKA 3TN91 1XSQA 4MGTA 2HYKA 2GC1A 3SH3A 4BH9A 2H6CA 2JB8A 2ZKLA 1DGRN 2XJUA 4BQ4A 1LOEA 3DCQA 4DNYA 2C4XA 1PGW1 3PHMA 4Q4W3 1S2KA 1HIXA 4Y5TA 2ZS6B 2YZ4A 1EYBA 1KEXA 4XAAA 4J25A 5KXBA 4B8EA 2J1UA 1AF9A 2HYXA 3QH6A 1UXXX 4IEZA 4XZUG 1WMEA 2JDPA 1FMD1 4AGVA 1UYYA 2WABA 1B35B 2BZDA 2ZEWA 4FPYA 3OB8A 4LBQB 1WLCA 3MHZA 4XXPA 1QMJA 3E5UA 1IG0A 4XMAA 4BPZA 4H7LA 3U4SA 1YQ6A 1W2AX 2XUMA 3ORJA 5FZIA 1OLMA 3TB0A 1W6NA 1Y4WA 5L7OB 3CZJA 4HMZA 2ZX1A 2A6YA 3AC0A 2C9KA 2XQRA 3IIIA 2GP5A 2DCJA 4MGIE 5FMOS 5BNPA 1Z7S3 1MEC2 3CKHA 1KDMA 2WA3A 4XAEA 4YW4A 5FO9B 2GNDA 1SCRA 1JYVA 3R0RA 4JGYB 4AFDA 5KXEA 4IE4A 2XL7A 4S2FA 2FZ1A 4QXHA 3ZPOA 4AYUA 1O5LA 5DDJ1 1VMJA 2VQAA 1T6GC 3P5BA 2P4EA 3LA2A 4Y3OA 5HBAA 1S0BA 1X82A 1W0OA 2BFUL 5A3PA 2CTVA 1JOBA 3OEBA 3MGUA 1QF3A 4HSJA 5FZ9A 2BBAA 3OGJA 1V0AA 3AKSA 2IUWA 5JOWA 3MIEA 4AVSA 3WDTA 2R0FA 3PDQA 1REDA 2WFPA 2Y0OA 4R9BA 1GZ9A 4NHXA 3ZR6A 2LW8A 3OF1A 1KQRA 1PGSA 1SDWA 2HBTA 1V9U1 3HJRA 1X8MA 1K5MB 4FFIA 1RUE3 2V09A 2X09A 1DCSA 4QGLA 5IK7A 1Q56A 2FCUA 2XJSA 1NE6A 4FQ4A 1COV2 1XBFA 1H1AA 1POV3 3Q9OA 1GU3A 3WZ1A 1AYN3 3WX5A 5D8AC 2D40A 1BVVA 2WWJA 3T2TA 2XLAA 1VBA3 2WYFA 2IFWA 2R043 5T5OA 2F6BA 2W47A 1PIV1 3IPVA 3BUCA 3PLQA 2E7TA 3G6JB 1V00A 4XUNA 1BLZA 1IPKA 1O7FA 1OKOA 3JQXA 3HNMA 3OBZA 2XLFA 2R061 5DDJ2 3SC7X 4OI0A 2GU9A 4GA9A 3FX3A 1VBC2 2FDHA 1W39A 5C3PA 3J9SA 3E6BA 4MXVA 4CXYA 1QH6A 2TNFA 2YY1A 3RZLA 1UZVA 5HCAA 1J84A 1Q8SA 1EV12 4JHTA 3ZXLA 5FYYA 2BEOA 4QX8A 4Q4Y2 2GZWA 2HEVF 1N1TA 2RM23 4FI9A 3VBSA 2NMOA 4P02B 5I0SA 5DMYA 2GAUA 3KVAA 5F6KA 5FUNA 4RD7A 2G9FA 3RZHA 3KQ4B 3NJXA 1SDDB 1ZBE3 2G9ZA 3P3NA 5CNAA 2HWF2 3BTZA 4E8DA 4PDWA 5T5LA 1H4HA 3OUHA 2J1SA 2WSVA 4CP9B 1V9U3 1AR83 4DEQA 2FZ2A 4QPWA 2B46X 2RDRA 3WG3A 1RUD3 4QPIC 5IHRA 4K9SA 1UNBA 3AYDA 3WNKA 3CIHA 1VBB2 2WYSA 1ZZ9A 4Y1VA 2WZPP 2Q0AA 4CTEA 3VBSB 2YPJA 4E2GA 3MZHA 1H8TC 3U07A 4GJYA 1JZ5A 1UWWA 1DF0A 1PVXA 5GZGA 3I2JA 2MHFA 2UY9A 4OYUA 1AYM1 1W3XA 4KQ7A 4UOJA 5FBJA 3SQOA 2A3YA 3T0AA 4CXWA 2E7QA 2VOXA 1GNYA 2BNOA 2QZ2A 1RB8G 4IEVA 4QKDA 5ISLA 3L2HA 1QJX3 4BCUA 2W95A 1QQP2 2WNUA 3D4KA 4LBMA 1PVC3 4O9GA 4AHWA 1W2TA 2ZGRA 4V2VA 5F5AA 3VBOB 3MUY1 1MZFA 2O14A 3IPVB 5GLZA 2FDIA 1KFUL 2W08A 2JE9A 4H2AA 2ZGPA 3AL6A 2AENA 2XLGA 4AHZA 2AZ5A 2WFF1 1Y43B 4AHXA 4TZDA 1R082 5FLHA 3ENRA 2WWUA 1K12A 4NHYA 2R062 1OHFA 3H3LA 4CRQA 5IWFA 4MX3A 4B1LA 3VD5A 1E57A 4S2HA 1OVSA 2FMYA 1F2NA 1PZ8A 1NLSA 1MS8A 5J09A 5BNOA 3R4DB 5IAXA 4WVZA 1E5RA 2EIDA 2EXJA 2XMLA 5E6HA 3RMYA 4AZZA 2W52A 4NWWA 4UFKA 5JOXA 1UMIA 3TYJA 4YM0A 4RQPB 4Q4W1 2QJVA 5DAWA 1ND3A 4JC1A 3U37A 2A5ZA 4I3GA 3O1PA 4FCAA 2P5BA 2JXAA 1DBNA 3BVCA 3LSDA 4OULA 2V73A 1M06G 2ZHMA 5DG2A 1RJ8A 4FO9A 1VBE3 4NUBA 3O7OA 1TMF1 1XE7A 5G05L 1AYM2 1Y9GA 2W1QA 5A7SA 2VXJA 3K48A 4ONUA 4IEPA 4ARXA 3W5NA 2G1MA 3ZN6A 3VL9A 4E4SA 4YVWA 1VBB1 2WSUA 3OOXA 4I3PA 1JHJA 4K1ZA 4GWIA 4XFCA 3WNOA 1O59A 1OBNA 3FHQA 1D0HA 1NG0A 3TBDA 4QPIB 1SLIA 5JMOA 4H14A 1CAVB 5FFOC 4O65A 2DCZA 3ITQA 1NKGA 2CNAA 3FHIB 4NO4A 1UY0A 1XU1A 3USSA 2D5HA 3VV1A 2RJLA 4Q29A 2OQ7A 2WIIB 3WF4A 5DUXA 3ZXKA 4Z2WA 5FZ3A 1MEC1 5LWBA 4IV1B 3MIFA 1EAH2 1ZRFA 1SLBA 5C8CB 5FP3A 1C8M3 4PLOA 4A6SA 1IKPA 1ULOA 1QJX2 5FLIA 3A7QA 1EP0A 1CZVA 2OX0A 3C7GA 4PQQA 1VB4A 4MZUA 4BZ4A 5FZAA 3KF3A 2JIJA 1FMD2 1QIQA 5FBZA 5JI9A 3KSCA 4M00A 3ZMNA 3O1MA 2XUEA 1QOSA 2WZ8A 3LB9A 3I7DA 1JI6A 1TME3 3ILRA 4XEZA 1HLCA 4LO8A 4X8NA 2ARBA 4Z82A 2Q8DA 1W8TA 4A2UA 3ZX7A 4AEJA 1WCKA 1ULEA 4A7YA 4P5YA 1V6LA 2P6CA 4L11A 1DQ5A 3ACLA 3Q8FA 3T2QA 4NWVA 1I5ZA 2DURA 2XXZA 4H7MA 2XJRA 1IHMA 4XUPA 1S0FA 1AXZA 4AVBA 4CDXC 1EPZA 4LA3A 4LBQD 2YC4A 3P6BA 4PLNA 4NPRA 1X33A 1T2XA 1UY2A 2IXKA 3FWEA 4CU9A 4EN6B 2WNVC 2FDFA 2NP0A 2Y33A 2P3IA 5LA1A 3HN3A 5ABJB 3I59B 3K3OA 1VRBA 4K8FA 4UFJA 4FFGA 3N4MA 2BVBA 1SFNA 4XE9A 2RG4A 1JYXA 2Q8EA 3E6CC 4QGMA 3GM8A 4I0WB 2VG9A 5FQ0B 3AX4A 1QJY3 1ZX5A 3OY8B 4FXKB 5FV3A 4XURA 3VKOA 3WDYA 4C1WA 4A41A 1DDLA 3OD4A 2JDHA 4E9KA 3NNGA 5CFDC 3VDDA 2WUHA 4Y5SA 3NV4A 4MGSA 1HRV2 4OI1A 2WS91 1GOHA 4COVA 3CQOA 3G7DA 3MW2A 3DUIA 2DFCA 4CPBA 4D7YA 2VAUA 5CFCB 1W6PA 4QKBA 3F2ZA 3PU8A 3WOGA 1IQDC 3KCYA 2WNOA 1JZ7A 2QUOA 3ZR5A 3V65A 1LKNA 1XE0A 4XFHA 3KCXA 1NE4A 4XFBA 3MDPA 1SPPA 5FPAA 4QQ2A 4AWDA 5FK8A 3VDCA 1W8ZA 4M3CB 4CDUB 4PIXA 1BXHA 3VBOC 4BB3A 1AVBA 2J1VA 2QQKA 2VZRA 4QPGA 3JCIA 4KH9A 4U2AA 4WM7C 4EN0A 5FPVA 5F3CA 1BMV1 3AVSA 3KGZA 5FP8A 1JYCA 2VMFA 1QHDA 3LFMA 3SLIA 1LEMA 2V4AA 2JKBA 4UBGA 2VC9A 2R32A 1F4AA 3RRDA 4ASLA 5CG8A 5CG9A 3AKTA 4GULA 2I74A 4N53A 1E5SA 1LHUA 1ZM1A 2WINB 5H9RA 1S0DA 2QQNA 1AL21 4I02A 4MGYE 3T2OA 4FOYA 1ODNA 4FPFA 5A6YA 5FPUA 1PIV3 2X5IC 2OIIA 1HRV3 3BGAA 5J48A 2AR6A 1A78A 3A23A 3WQ7A 3TN92 3VZJA 5LA0A 2ES3A 3VZMA 1NAEA 1GBGA 3ZYJB 1RYYA 3PMSA 3VZLA 3ZXAC 2BWCA 2HWF3 1ACCA 3BU7A 1VPHA 1N3OA 4YPJA 2VUAA 4A45A 4UFHA 4EROA 5F3IA 1UOFA 4A44A 2ENRA 5FKCA 3SCGA 5JXHA 3JUUA 5D8AA 1VBA1 3DYOA 4CCKA 3WF3A 5IJRA 4CCDA 5C3QA 4AE2A 2QFEA 1VBE2 3A21A 2PHRA 3WHUA 4AXOA 5K7PA 5EV7A 1ZZCA 1YFYA 2R16A 2ZA9A 4IEXA 5GKAC 4A42A 5HXMA 5ABJC 3SEEA 4Q0UA 3KCCA 4FBFA 3JBG1 2PELA 3WUCA 3E6DA 4Q4X1 5I0UA 5BNNB 1WMFA 1RUE2 3OD0A 1QNWA 4B29A 2G9GA 3FJSA 1VALA 1RUD1 3WCSA 3KM5A 1W2OA 2LTNA 1GZWA 2E31A 3N9LA 4AOCA 5BV6A 2EIGA 1PK6C 1SCSA 4XF1A 5GLUA 5E88A 2R071 2CDOA 1A8MA 4X8PA 1C4RA 5FUPA 3O0XA 3NQHA 4P9LA 1FAYA 1X7NA 1U0AA 4YLZA 2B5HA 1WD4A 5A33A 4IW3A 4JQTA 2DVBA 1QJZA 2BV4A 1GOFA 1IGOA 1EUUA 5DUUA 1JUHA 4IEWA 1PMHX 1O4ZA 4QDRA 5T50A 4LPLA 1VBE1 2EAKA 3ES1A 4LQRA 1V6JA 3VD7A 3HOBA 2BGOA 2VZ1A 2VMCA 4N53C 4QKFA 1MZEA 4QB1A 3DXTA 3N7MA 3DF0A 5J36A 3RPQA 4EN8B 4XQDA 4F83A 4DXRA 5FZ0A 4QWNA 5FPXA 2WJSA 1HX6A 1RUJ2 4Q4Y3 4JZRA 2ZGNA 3J8F2 3IKWA 2OPWA 4GZ9A 4IERA 4BLJA 2FHRA 5DZGA 5C9AA 3QCWA 4PT6A 1LGBA 1S0CA 2ZAHA 3OUIA 3ABZA 2WAAA 3ZFFB 1P8JA 2JDAA 2VBBA 2MEV1 2WRAA 1FYUA 1L7RA 1UX7A 4LOTA 4LIVA 3ZN5A 4FPOB 3TN93 2PQQA 4K7JA 2VMHA 4QGNA 4HXCA 2ZEXA 2YHJA 5FZ8A 5FJHA 3SISA 5IAVA 1F4HA 4Z8BA 3VBHA 4W65A 5CKMA 4XILA 2Y26A 2DWRA 3VDDC 3OYWB 1W03A 1OT5A 2NYYA 1DQ2A 3I2HA 4YGCA 3WCRA 2AC1A 2WLQA 4E27A 5L19A 1ZNPA 1GZWB 4XQWA 4R9CA 1CESA 3WP3A 2QQMA 1QJU1 2R041 2P34A 3ZVXA 4JVAA 4QX2A 1WKYA 1HXS3 5FZ1A 2OKXA 1VBD1 2QBXA 4LHNA 4UW5A 1ENSA 1AX1A 5CFDB 3P3PA 3GHMA 1GZCA 2ZGLA 3N7JA 4PDWC 5T54A 5JDBA 2DCYA 3PTRB 4BJ0A 1W9FA 1HQWA 1REFA 3UL2A 5A7QA 3S30A 5C8CA 4HFSA 1VAVA 4EN7B 5AFBA 1GOGA 2A70A 1YQ2A 3H8UA 4JDOA 4LXLA 3VBSC 3ES4A 4META 4AFAA 4WV8A 3J26N 4DPNA 1UYXA 4AEDA 3GBWA 1AR82 4UYBA 4DB5A 1ZREA 1CAWB 2JKXA 4EWEA 2FDKA 4MO3M 1ZBE1 3RGBA 1DQ4A 2VNRA 2D3SA 5DUWA 3LD8A 2VPVA 4XJ8A 4R4ZA 4EYUA 1PVC2 4PIZA 3WY6A 2XVKA 1UMZA 4LLFA 1URXA 1HXS1 2IXIA 5FIXA 5FYMA 4L9BA 2B42B 1G9DA 5F6LB 1LEDA 4RFRB 3RFRA 1R091 3GBGA 3RVHA 4AFBA 5GALA 5I0RA 3RZGA 4HKWA 1GV9A 3VBUB 4RR3A 3POGA 4D6RA 1LJ7A 1U5XA 2V4VA 1RUH3 2FDGA 3ZSKA 1HRI3 3M3CA 2X5IB 5FY5A 4DRRA 2ZX2A 1RUG3 1RUI2 3B01A 4M3CA 5IYYA 3VB9A 5E89A 3OTFA 5DABA 2CAUA 1ND2A 3HQRA 3PUAA 3ZFGB 3BN6A 5JI7A 4LT5A 2P3JA 5F9TA 1D4VB 1S4CA 4N9IA 2D3RA 2WQ8A 1JYIA 4JGZC 5JR2A 4QHBA 3AMMA 2GMEA 2P3KA 3DPRA 4AEMA 1LAJA 4PHZA 4P14A 4BMBA 1LGCA 1OQDA 3HVDA 3I3EA 1UAIA 5E1RA 1E5IA 1MS3A 1W2UA 5EWSA 3AYEA 1KD7A 2E53A 5EHDA 2WWSA 3UK9A 3WEZA 5BNNA 3LQCA 2GC3A 3ZYIB 5DZEA 5A3UA 1RUJ3 4UW3A 1PM7A 2C0ZA 4GH4B 4IGQA 1ZVFA 3W59A 4XETA 2A75A 1I3HA 2BWAA 4P9XA 5A3WA 3SHRA 4AG4A 1UZZA 1RJ7A 2VD7A 3V0BA 1LHNA 3AYCA 5FR3A 1RHI1 1RL3A 2JDYA 1GFF2 3M8LA 5CKQA 1KS5A 1W8OA 2DFBA 4V2WA 4DFSA 4Q0SA 3NNFA 4XQ4A 2OXBA 4IV1A 5LZ6A 1JZ2A 4R9AA 2ZEYA 5B4NA 3GGLA 3WF2A 5JZGA 2OZ6A 1QJU3 3AZWA 1A34A 1BEV2 1YFUA 4XXAA 5FYTA 2KXLA 4QXBA 4XABA 2D6NA 3EJKA 5JIUA 3AYAA 3I4IA 4YW5A 5LBBA 3VKNA 5F32A 3AFKA 2QQVA 5FKBA 3ACGA 4CDXA 3LAGA 2V5YA 2RS53 2YC0A 1TMF2 1GWLA 2GALA 1COV3 3FLTA 2YG0A 2XHKA 4LKFA 4QU1A 3ZSLA 2PXJA 4CEYA 4XDQA 4N53B 1WLDA 5FOBB 4SLIA 1J3PA 2ZACA 3VBRA 3AXEA 4QD2A 4CCJA 3DKWA 2EICA 2VR4A 4Q4W2 4UF0A 4N7UA 1A6CA 1YJKA 4MGKE 1CR7A 1YIFA 2VU9A 4YWAA 4FPJA 2WNUC 1D7PM 1X9PA 1M4WA
chains in the Genus database with same CATH topology
4S2GA 5JPNB 4RHV3 1PO12 2QDNA 4IXLA 4R4XA 3ECQA 2DU1A 3BODA 1PNGA 2IXHA 1APNA 2X53S 1A3KA 3VDDB 2XJQA 1WCDJ 1R1ZA 3O12A 4MLOA 4XMIA 2YGLA 1J58A 4O9EA 2QE3A 3JB4C 1XYPA 4FPCA 3ZXGA 1RITA 4GMP3 1LOAA 3GZTB 4XF4A 4XBLA 4XIOA 1QDOA 1NCQA 4JRLA 3OBTA 3HQXA 3ZN6B 3NSTA 4YVSC 5GZDA 1DZTA 2DVDA 4E2SA 4OVEA 3GF6A 4JGYC 4HVQA 1FPN2 3ZYGA 2OZJA 3MW4A 4GALA 1HV0A 3KT1A 5EXOA 3V0BB 3OGGA 3N7KA 3AMQA 1LTEA 2DTWA 4KL1A 4Y22A 2NN8A 2XWBB 1MS5A 3T1MA 1XRUA 5BY5A 4F7ZA 4W6XA 1GYKA 4M3CE 5FREA 5CFCC 3DGTA 1RUC2 2XG3A 4Q0PA 4Q4V1 3RS6A 1RIRA 3W58A 4CDWB 2WZR3 3O14A 1PK6A 1VR3A 4YFZA 3VZNA 4D69A 2OPKA 5A32A 5K0UB 3UJQA 1GQHA 3ZSJA 3WUDA 4JGYA 4YARA 2VMIA 1JTZX 4L97A 4YVSA 3RJRA 1PMIA 5JSOA 1RUNA 4K6BA 4H55A 3ZFGC 3DPRC 1LOCA 2HKXA 1AR72 2UYBA 4YM2A 3UKTA 2O1QA 3V64A 3VKLA 1UIJA 5I0TA 1W6QA 1GICA 4P9YA 3ZO0B 1CAUB 1I6XA 2DYCA 4WVMA 2RE9A 4DZGA 2RR13 2A73B 1RUC1 2VULA 1D4M1 1NZCA 1ZBA3 1DGRA 2R1BA 4HVRA 2YUEA 5EFUA 2RS13 4HL0A 1EV13 1IS5A 2PHTA 3JD73 1BCXA 3TNPB 2Z5WA 2JICA 3LA7A 3NAPA 5KWRA 3SH5A 1I1EA 2E9QA 5DDJ3 4GB33 2DTYA 4QPGC 4WM7A 3H1YA 3M1HA 3BOPA 4GQ7A 1AHSA 1W6QB 2LM3A 4N90A 3J8F1 4FPKA 5CIRA 3J4UH 4QXKA 1SEFA 4RGGA 1LOBA 4RL7A 4GKXA 2K0GA 2GNTA 3WG2A 5JOZA 3N35A 1SLLA 1YFWA 1LULA 4QM8A 4YM3A 4XIKA 1QH7A 3GHNA 1SACA 4QQOA 3PMEA 3LA3A 1DLLA 4CDWA 3GZAA 4L99A 4CEWC 3X29B 2WNUB 2PHUA 2A71A 3HAGA 3WP6A 1AYN1 3UKVA 4LBOA 2WZR1 1VAMA 2NLRA 3IDEA 5JWPA 3W9AA 2N7GA 1N3PA 1V6OA 4AHYA 1N1YA 1LHOA 3MW3A 3WG1A 3QBQA 1FOD1 1DGWX 2RS51 3B00A 4JQRA 1TQ5A 4H3WA 4XW3A 4BQ1A 4Y5Z0 3VHRA 4K20A 2DVAA 3D6EA 1UW8A 2A6VA 3TOJA 1UCXA 3AKQA 2JG8B 3AKPA 4LO4B 2CYFA 2D6LX 3TNQA 2ZGSA 1BEV1 1QJY2 4AQTA 5H9QA 4K1YA 4LUKA 2AYHA 2Q5TA 4DRVA 3MFAA 4K21A 1WMDA 1NQDA 4QT6A 2BGCA 3IDBB 1RUC3 4D3WA 4COZA 1CAWA 4EWAA 1Q3EA 3QD6A 3OPZA 5AVPA 5AC91 1WW6A 4P9IA 5I8SA 1J1LA 3O5SA 3VHNA 5JAXA 4FOVA 1ULGA 4YRDA 1BK1A 1OD5A 3B94A 1AR63 3VBFB 1LODA 1BZWA 2GNBA 4YVWB 4IV3A 1AZDA 2RR11 3HBZA 3WINE 1RTVA 2IWGB 3ZDSA 4JV4A 4Q0QA 1HXS2 2K9ZA 2XVGA 4KG0A 3KZ4C 3ILFA 5I8YA 1TME2 3H7JA 2XGXA 3IN9A 4Q27A 4ATFA 4HPKB 3JD71 1A8DA 1BKZA 1OOPB 4FVVA 3DPRB 2XL9A 1GNZA 4OHZA 1UKGA 2O8QA 1O3SA 4JTNA 3HMYA 3L2YA 4PLMA 3VL8A 1RINA 3HT2A 1YXWA 3CO2A 1ND3C 2WC2A 3VBHC 3UJOA 2X5IA 1CJDA 3JD72 1G86A 4RHV1 4LUMA 3AK0A 4AVCA 2Q8OA 3H50A 2RJKA 4QQPA 3MF6A 3AXDA 5C9AC 4ZKTB 3KGLA 4I30A 1O3RA 3VHOA 2OA2A 2XVLA 3MFCA 3ASIA 3JQWA 4EV0A 1CPMA 1WLWA 5JSRA 4AEDB 2VVDA 3AB0A 1OA4A 5FQ0A 1ZRDA 1AYM3 3ZXEA 3B5LB 3DN7A 2ZGQA 3AJZA 4YW1A 2YDEA 4V1PA 1H9WA 3MIBA 3ETQA 2GMPA 1BEV3 4IEOA 3JBG2 1AX2A 3VZKA 4IV1C 2WT0A 3NVCA 2R1DA 3ILNA 3SMHA 4AW7A 1N3QA 5GZCA 1YRZA 3GZUC 2PYTA 1VRH1 2A3WA 5JR7B 1HV1A 3POYA 3MI8A 1OLQA 4CDUC 5A3MA 3FUQA 3RYKA 1G6NA 5JPMB 4G3YC 1W6OB 4J1XA 2JJ6A 1TNFA 1RMU3 5GM0A 1RC6A 2A3XA 1QXRA 4CEWB 4C90A 1V6IA 5J3UA 3WP5A 4A3XA 4Q8LA 5SV5A 5CA6A 1Q5OA 2Y38A 5D8AB 1BJQA 2JE7A 2DVFA 3M4FA 1NA1A 2MEV3 4JGZA 2ZX3A 4JGZB 2WZR2 3WXPA 4IEQA 1B35C 1WBFA 1FPN3 3ZXDA 2XB6C 4YZ1A 1PZ9A 4EN9B 3LCPA 4WVMB 3GBFA 1CGPA 4OHVA 2BNNA 4AVVA 1POV0 5T5JA 1SFYA 3WT3A 1PZ7A 4DOUA 3AP9A 3D5OA 1YCIA 1QGLA 4F3JA 3V0AB 4AI2A 2CWMA 1KXGA 3M3IA 3WG4A 1ZZ7A 2A7AA 2D43A 2ZX4A 4MGZE 4NHKA 3RWNA 3ME2A 4Y4YA 3KT4A 3NO8A 1G9BA 4AQSA 3AKRA 5JSPA 4CDQC 5JCTA 1S0GA 4XYXA 4XFAA 5D1IA 3A4UA 1Q8PA 2RM21 3OBRA 4DY3A 2YV8A 1O4TA 2QZ3A 5BXXA 4Z07A 1JW6A 4GB31 2OUHA 4OHXA 1CPNA 3AZZA 3FE5A 3B9IA 3OY8A 4LHLA 1VP6A 1F5JA 1CAUA 1D4M2 4CDWC 4MVTA 2EXHA 2XKOA 5L73A 2WA4A 2DUQA 1C5IA 2HJIA 4XFIA 3RZZA 3WVJA 1R1A1 3UKNA 5CB7A 3R4UA 4FOQA 5GJ6A 4FQZA 3AP6A 1MQTB 3MICA 5FMOL 5E16A 1AR71 5LK5A 4DQAA 1PO23 2NQYA 1HRV1 3H9AA 1RMU1 4DINB 2CGNA 1FV3A 2XKPA 2AUYA 4HSLA 1Y3TA 3CJIC 5HXVA 2BTVC 3TWIA 3RJ2X 4WZFA 4X6RB 1ZRCA 2PA7A 4RQPC 4KU7A 5ACA2 3JU9A 3RNSA 1QJX1 4UBHA 5FO9B 3EXUA 3NV3A 2PFWA 1JOJA 1UL9A 1F31A 3B69A 4Q2FA 3ST7A 3CU7A 2B39A 3LGRA 1YIPA 5JZGC 1LCLA 3FFQA 5J98B 2PHWA 2ZAAA 3I2DA 3LOIA 3AZYA 3PJQA 5T5PA 4KGGA 2QDRA 4LO7A 4ISQA 4YYOA 1MACA 1GLHA 4Q8KA 3QACA 4P9WA 1Y9QA 1HKDA 5FDBA 1DFQA 1X36A 4PDWB 4OI2A 2W0XA 5F1RA 1C3HA 1NCRB 2PN5A 4GMP0 4Y1XA 4JTOA 5I91A 1C28A 4KNCA 3RQ0A 4EWDA 1NA1C 3S0MA 2ZHNA 1RGSA 2ZGTA 3HR9A 4B4RA 2CV6A 2KM2A 4P5HA 1NCRA 1MS0A 2RS12 4R9DA 3I59A 1V9U2 4CDQA 4LHKA 3ZIXA 1AL23 1RUG1 1S2BA 3HT1A 3M3OA 1PNFA 2MPFA 2ETEA 3MLLA 1RUH1 2ATFA 4ES9A 5AVAA 1C1FA 1JXNA 5AC92 3WW3A 2R30A 3BCWA 2G4IA 1H2MA 4LO5B 4URTA 2JDZA 4GH4A 1UIKA 2ZX0A 2E6VA 1GANA 1KRIA 3RG0A 1BYHA 2C5DA 4QM9A 3GYDA 1C8M2 2PHXA 5H9SA 1GNHA 4CEYB 2BNMA 2ZHLA 4C1XA 2GC2A 1QWRA 1WD3A 2IZWA 2WS93 3MIDA 5HCBA 5IK5A 1V6KA 1N1VA 4YW2A 4ZU7A 3N36A 5DZFA 1CD3G 4BIFA 1FOD2 4D7SA 3KMHA 5DUVA 1RUOA 5EJ3A 5KXDA 4RR3B 4BM8A 5LRSA 3AP7A 4Y1ZA 3LKJA 2C9AA 3RI9A 3PVBB 1DYKA 4FPLA 1AYN2 5EYXA 2BUKA 4RSUA 3TRSB 2GSYA 3WW2A 4HZFA 1ENRA 4Y26A 4AF9A 1NYWA 4I0AA 2OUJA 4BYYA 1IOAA 4W6WA 3FUOA 5HCFA 4D7TA 4LR4A 1KITA 2ZABA 4YVWC 4NVPA 4E4ZA 4LBQA 1K5MC 3DL3A 1S55A 4HETA 1G9CA 4ISRA 2NPIA 1MVQA 5BNPC 4N43C 2YYOA 3WW1A 2QQPA 2XJVA 4CYDA 4BIOA 1LRHA 4DXZA 3RSJA 1J1TA 1RVF2 1XNBA 1RVF1 1HRI1 3O0VA 4LBJA 2VOVA 4XF9A 4YG0A 2A6WA 2ZZJA 3KT7A 3K51A 4NHMA 4LE3A 1LESA 5FOJB 3KS7A 3VKMA 2LALA 2TUNA 4XJWA 3S6PA 2ZJCA 1ZA4A 3VBHB 1RUI3 1RUG2 2GMMA 5BUVA 1Q8OA 2WNVB 4A7KA 3AP4A 4I2OA 2CWSA 4ATEA 5K0UA 4B7KA 4GH4C 3IWZA 1Q8VA 1PVC1 4QQHA 3THPA 1LU2A 1LHWA 4LLOA 3QLQA 3C3VA 1EV11 3N3HA 2TBVA 5I93A 4YM1A 2DCKA 3R05A 1C8M1 1J3RA 2DV9A 4XFFA 2ZMKA 1LB2A 4JAAA 4KWLA 1NCRC 3D8CA 1AR93 4QU2A 2RMU1 2Y0IA 2P37A 3J8F3 4KBBA 1LU1A 3U10A 1MS4A 3WLUA 4TLFA 3URFA 1XYOA 4FP2A 1J3QA 4C0HA 5C4WB 2Q4SA 4LBLA 3ZXJA 4FTSA 2IFRA 1U5YA 1RUF3 4OFGA 2DUPA 5BNPB 2WNEA 5K8SA 1RMU2 1OOPC 3ZFFA 1JN2P 2OYZA 2ZMNA 1W6NB 3LWCA 5FO8B 5ACA3 1UF2C 1PGW2 2DVGA 2YGMA 1EY2A 3E97A 1POV1 5GZEA 3MIHA 1B35A 4L92A 1XYNA 4CEYC 2JEMA 1R1A3 1DZRA 1BVP1 4CZSA 1VB2A 4ZU5A 4HKLA 4IEUA 2ZBJA 3KD4A 4D94A 2PAKA 4IETA 2VW0A 2UY8A 2NZ9A 3E5XA 4N43A 4BE3A 5ACA1 4WM8B 4W6YA 1YUDA 2B45X 4M0NA 3VUOA 4CEWA 4YZ5A 1MS1A 4FTEA 4AI3A 1DQ0A 1CX4A 3RDIA 2X29A 2Z42A 3IDCB 3RMXA 3MLJA 1ZBA2 4JDMA 1AX0A 1W0PA 3ZYRA 1GR3A 4HN1A 1YHFA 3FZ3A 1AXYA 4FPGA 4IESA 4KG8A 2OW4A 1D2QA 3FBYA 4IV3B 4HANA 1OFSA 3RYPA 4AQ2A 1QJU2 3POSA 3JB8A 1Z7S1 2VVFA 3DV8A 2VNGA 2CAVA 4FXGB 4YZ4A 1WUVA 2UWCA 1MQTA 1V6MA 1VAKA 3AZXA 3NW4A 4HVOA 1KJRA 2NM1A 4LBNA 5JLVA 2Z79A 1XU2A 4XBQA 2VH9A 1DGLA 1MS9A 2DUOA 1AXKA 2EXIA 5JVVA 2D93A 4KWKA 4HLTA 5I8TA 4I01A 1LECA 1YWKA 1DZQA 3AP5A 3WP4A 3CL1A 1RUF2 2ZOEB 1D4M3 3ZPYA 4SBVA 3WR0A 2O8OA 1VIWB 1NLRA 4NR1A 4R8HA 2P2KA 1FOD3 5FLJA 2HWB1 5C6CA 2EA7A 1AR62 1SBDA 1MEC3 5TSWA 3NWKA 2PLV2 1WW7A 4XFGA 3VBUA 1BBT2 2WFF3 5H9PA 1BBT1 4YG3A 4HN0A 1HQNA 3D0SA 2ZKNA 4KWJA 1BMV2 1GQGA 3WDUA 1AR61 1OA2A 2BW8A 1IS6A 4FP3A 5KHJA 4MV2A 4LO6B 4XZPA 3WDVA 3VHPA 1UU4A 1UU5A 2B8MA 2UWBA 4WVWA 2XJTA 4P9GA 1PO22 3MIGA 5T52A 2UWAA 1H30A 1ENXA 3MPBA 1CAXB 1FNZA 1ASJ3 2R072 4N7IA 4G4FA 5KXCA 1XNKA 4QQLA 1NOVA 5BNQA 3H1MA 4FAHA 1I9RA 1L3JA 4GXLA 1YFXA 1FV2A 4X6QB 3SCHA 5GLVA 3NL1A 4B3NA 3VBFC 2ZGMA 4QX5A 4KU8A 2VW1A 4CP1A 1IQAA 2D97A 1XXNA 3H1WA 1LOFC 2VVEA 5BNOC 1UZYA 1JUIA 4WM7B 4LEJA 4OI4A 2GH2A 3KB5A 1S0IA 4Z92B 4RA0A 3SH4A 1ZBA1 2HWE1 1N47A 2WL1A 3FC0A 2JG8A 2AGSA 2DF7A 3H3UA 5LEJA 5GLTA 5JIAA 5IK4A 5C8WA 5L36A 3PVNA 4RFT0 1AL22 2EVXA 2W39A 4PBOA 3PJYA 5IT6A 4XHXA 3MYXA 4U36A 3S7IA 3SXWA 3B3QE 3VBFA 1R083 3H3ZA 1C1LA 2CY6A 4INDA 2D44A 2QCSB 4ZU4A 5KHIA 1AUYA 1VRH2 1FXZA 2K2SA 3SITA 1IS3A 1U5IA 1CAXA 2GC0A 1XNDA 3BB6A 4KGQA 4WM8C 4R52A 3FMGA 1CAVA 2PLV3 4XOGA 4OHYA 3BPZA 1X50A 5BNNC 4YNIA 3KQRA 2RHPA 1LGNA 3NKGA 5J7MA 5CBLA 2CGPA 1PK6B 3ZN4A 1UU6A 1S0JA 4IV3C 5B2GB 4OHWA 1H8TB 2D98A 3CNAA 1LHVA 1QJY1 3AMNA 5T3NA 4YSFA 2C1FA 2YMZA 2BQPA 2WT2A 4AEKA 3WV6A 3WDXA 2FMDA 4K40A 1NXMA 4XF3A 2XBO2 2JECA 1H2LA 3NV2A 3U0ZA 3WNXA 1OOPA 4PIYA 4E2QA 1G7YA 2UYAA 5J96B 1OKQA 2HWD3 5BNOB 1AR73 3CF6E 2E51A 4N43B 2GN7A 1Z78A 1UD1A 1WCSA 1SLTA 4Q1PA 1NQJA 2I07B 1CVNA 1ZZBA 3LZZA 2ZHKA 2B9UA 1OI6A 3IT8A 3MPPG 1V70A 1PO21 4GKYA 2CGOA 1FPN1 1O4YA 2R49A 1RUE1 1SMVA 1FX5A 1TME1 2GH8A 2Z69A 1CONA 3INAA 2NMNA 1JBCA 2XJPA 4Q4V3 4P9JA 4ITCA 1ND2C 1MR5A 1EAH1 5FTTC 4YVSB 5JOYA 3OJBA 3A0KA 2CL2A 4WM8A 5IUQA 4RR3C 2IXCA 2DU0A 4XF0A 2RMU2 5C4WA 2D6MA 3O0WA 1PGL1 2ZGKA 2AH2A 4HBNA 1YLLA 4TSVA 5CFCA 1R081 3VBRB 1C57A 3GNEA 3IBMA 3WQ1A 2ILMA 3HIFA 4Y1UA 4Q4X3 3BOWA 3ROUA 2BBVA 5KHGA 5AFEA 1U5ZA 1VBB3 1XNCA 4RQPA 3VGIA 1NY72 3A0NA 4K3UA 4Y22B 4AI1A 3CJIA 2VGDA 1YO8A 4QPYA 2RS32 1QOTA 2OVUA 3AFGA 4YZ2A 2RS52 1QKQA 1Z0HA 4NHLA 1NY71 2R0HA 1Q43A 3NAPC 1AJKA 1TEIA 2HEYF 1LOFA 3S7EA 3SNMA 5EYYA 4OZXA 1UPIA 4I09A 3AZVA 4C91A 3ZFFC 3IM0A 3WD5A 1FNYA 1LR5A 1PHMA 1G9FA 4YGBA 5A32B 4BOWA 1PGL2 4TWTA 2VQ0A 3EO6A 5C33A 2LUWA 2HWB3 3RI8A 2O0OA 1YI7A 5T55A 3PVOA 3HD8B 1LOGA 4OLLA 3CJIB 4XJAA 1QY4A 4Q4Y1 1HW5A 2Z2SB 4GIQA 3T1LA 3ZIWA 1QQP1 2HWC3 1BQPA 1G9AA 1H9PA 1ND2B 3ZFGA 3I8TA 1H8VA 4UXAA 3PVEA 1DHKB 5HI0A 5CU1A 3CJXA 1UPSA 2HWD1 4XBNA 2WQZC 1NXD1 4FPHA 1FI2A 5DG1A 3UV9A 3M2MA 3EBRA 4MXWA 3TAYA 2VECA 3APBA 1IPJA 4CDQB 2RMU3 1NCQB 1AR92 1EPWA 3H0OA 3OCPA 4N9HA 1RUH2 4MH0E 1ULFA 1VLNA 2B7YA 2VOWA 2EALA 2VY0A 1D2SA 2HWD2 4AI0A 1O5UA 5C4WC 5J37A 3FBMA 4MXWB 2D7FA 2EF6A 1U12A 3MF9A 4COUA 3WQ0A 1JHNA 4M0HA 4M01A 4MUVA 4CP0A 4GWNA 1EAH3 3EHKA 1DIWA 4Q26A 3WDWA 4BMEA 3NV1A 4BLIA 4HK8A 1H0BA 1MQTC 3POWA 1AJOA 1PO11 3M3EA 4IL7A 2ET7A 3ZSMA 5EZWA 5KC5A 4TYSA 4F8AA 3ZFEB 3NJZA 4GWMA 1CIWA 1R093 5SV8A 1K5MA 4LNVA 1SQ4A 1W6MA 1IZ3A 4WBBA 1YNAA 1CN1A 1GSLA 2BVVA 4CDXB 5AC93 1F9KA 4QMAA 1WLTA 2HEWF 1COV1 2ARXA 4Q4V2 4FAGA 3USUB 5JZGB 4J1WA 1H8TA 2X8KA 1ZZ6A 2H6BA 4AFMA 5FRAA 2ZMLA 1QU0A 5JMCA 4XPVA 4LA2A 5LEKA 1ZZ8A 3PNAA 3VKFC 1AR91 2QNKA 3B7MA 4GB32 2ZGUA 2H0VA 2WNVA 1N1SA 1CQ9A 5CVRA 3VBRC 2MEV2 4AEDC 1HRI2 1OPOA 4PJYA 4DY5A 4L2NA 2JG9A 1VBD3 4Y20B 5IK8A 2ZGOA 1O91A 1LENA 5L7OA 1BBT3 2WFF2 4RS5A 1RUJ1 2PAEA 4AGRA 1YI9A 2DCTA 3M70A 1S1AA 5FO7B 3ELNA 1H2KA 1WGPA 1H1MA 1VBC3 2SBAA 4XHBA 3M7AA 2AREA 2XWJB 1IKQA 3R6SA 2E7AA 4NN0A 1XQNA 1QQP3 2HWC1 2PTMA 4B4PA 1H1IA 2IXJA 5KHHA 3ZSEA 5CFDA 3ALQA 3HN1A 1IS4A 2RS31 1WW5A 2RM22