4HVOA

1.75 angstrom x-ray crystal structure of cufe reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 36
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hvoA01
2O8QA 4LUKA 2DCTA 3MPBA 4MGIE 1RTVA 5FDBA 3DL3A 3E6BA 1NE4A 4META 2EVXA 4AQ6A 3H3ZA 5I93A 1OFNA 3GYDA 3H7YA 2GU9A 5HI0A 3IDCB 2BEOA 2UYAA 2BNMA 3ACLA 2BGCA 5KHKA 4HN0A 5KHHA 4IEQA 2Q4SA 3BCWA 1J58A 2XGXA 4O9GA 4XF1A 4IEZA 4F7ZA 4KWLA 1XE7A 2GC1A 4LA3A 2F4PA 1QXRA 3CF6E 2Q0AA 3BU7A 2BNOA 3E6DA 1XRUA 3SXWA 5J7MA 5KHGA 1LRHA 3CEWA 3CL1A 3ST7A 2I45A 4Q0PA 4HLTA 3EQEA 2QDRA 3FE5A 1J3QA 4PIYA 1ZZ9A 4XFHA 1UIKA 4D7SA 4Q29A 3GBFA 3ES1A 4AVAA 4J1XA 1O5UA 4BYYA 2QJVA 4KL1A 3OCPA 1Y3TA 3HIFA 4GULA 3BB6A 5JSOA 3ROUA 3WW2A 3KGZA 2OZ6A 4HVOA 2XL7A 1CAXB 1GQHA 4JV4A 3H7JA 4UBHA 3L2HA 1FXZA 2GH2A 2D5FA 2IXLA 1CAXA 2IXCA 3SHRA 3PVBB 4XF4A 4MV2A 1DGWA 1U12A 1DZRA 2H6BA 3UKNA 3FFQA 2IXJA 4HVRA 5LEJA 1ZRDA 2D40A 2H6CA 3D82A 3IWZA 1VP6A 3ES4A 3LA2A 2KXLA 5J48A 4TLFA 1ZX5A 4H7LA 4RD7A 3NVCA 4FT8A 1CAVB 1FI2A 3M3IA 3MDPA 5CADA 3HQXA 3I59B 1CAVA 2ZCWA 3N4MA 1PMIA 4IEOA 3DV8A 4PIXA 3I54A 5C8WA 2B9UA 3I59A 3NSTA 1DGRA 2IXIA 1RUNA 4HBNA 4YYOA 4XFCA 3SMHA 3O14A 1YWKA 2K9ZA 1XE8A 3UKTA 4IEWA 3U10A 4XF3A 3EHKA 2EAAA 5K8SA 2B5HA 2GAUA 1OMIA 3E6CC 4JTOA 3G7DA 3MYXA 4Z82A 1DZTA 5FQ0A 3IBMA 3KGLA 4OLLA 4Q0VA 3RDIA 4KU7A 2OZJA 4ONUA 2CGPA 2UY9A 5BPXA 3CLPA 3KSCA 1OD5A 5KHIA 4BH9A 2P17A 4IESA 5FLJA 3E5QA 4LLOA 3ETQA 1HW5A 4MZUA 1NZCA 2K0GA 4MX3A 1X7NA 3EO6A 1X8MA 1Q3EA 2HJIA 4P9GA 4IEPA 4FAHA 4R52A 5J3UA 3RZZA 5KHJA 4HSJA 2XLFA 2MNGA 3PNAA 4LUMA 3TNPB 1LR5A 5F1RA 2XLGA 5EFUA 4EWEA 2OYZA 1NE6A 2QVSB 4LA2A 4XFFA 4HSLA 5BUVA 1GQGA 4FAGA 2PHLA 5FCCA 1ZRRA 4DINB 2ET7A 5I91A 5JSRA 4XF9A 1ZZCA 2QCSB 1ZRCA 4B29A 1CX4A 5BXXA 1J1LA 1CAWB 1Y9QA 3BPZA 4E2GA 3WW1A 1ZVFA 2N7GA 4MH0E 4MGYE 1J3RA 1UD1A 4Q0UA 3S7EA 3M70A 4XFAA 1CAWA 4A2UA 2HKXA 4XETA 4KU8A 2Q30A 4I02A 3R6SA 5T3NA 3RYKA 1UIJA 2Z2SB 4N9HA 4NVPA 1UW8A 5I0RA 3RYRA 2ATFA 3QACA 1I5ZA 3FZ3A 4YRDA 2VPVA 1CAUA 4HZFA 3H1YA 1RC6A 2EA7A 2IC1A 1EPZA 3E97A 4IEUA 1G6NA 1J3PA 2ETEA 4HMZA 1O3RA 5E16A 2E9QA 3LOIA 2WFPA 1YLLA 2MHFA 2V09A 4IEVA 1SFNA 3CJXA 1Q43A 4D7TA 2PAEA 5LRSA 2ET1A 3FJSA 3JZVA 4I0BA 4QX5A 1EP0A 5C6CA 4XFIA 4L2NA 4LTAA 2FMYA 2CAVA 2PFWA 4HVQA 2MPFA 3VHRA 4X6QB 1ZREA 4WZCA 2IXHA 1QXJA 4QM9A 3U11A 2VECA 4EV0A 4KWJA 5CU1A 1FT9A 2BYVE 3H3UA 4CYDA 4YNIA 1O3QA 4BHPA 2Z69A 3CO2A 4OFGA 4JVAA 1IPJA 4O9EA 2PAMA 5LEKA 5FQ0B 2B8MA 2ZKLA 4IEYA 1VR3A 4QXKA 4E2QA 2Q1ZB 4I3PA 4ZU7A 3D0JA 2OPKA 3MZHA 3LA7A 4IERA 3NKTA 1ZRFA 3B02A 4I2OA 2PYTA 4UXAA 4I01A 3HT2A 1TQ5A 4K8FA 3H9AA 5EZWA 2UYBA 1VJ2A 3U0ZA 3HT1A 3NW4A 1SEFA 3WW3A 3LZZA 3SCGA 2CV6A 4HN1A 1YFWA 4AQ2A 2XKPA 2XHKA 4XF0A 3DKWA 5E1RA 5I0TA 4LEJA 4EWAA 3ZDSA 1O3SA 3OF1A 1LKNA 5AVPA 4PJYA 1O4TA 3DN7A 3E5XA 1O7FA 1L3JA 1IPKA 4MGKE 5BY5A 3LWCA 3QOPA 1WA4A 1O5LA 1RUOA 4Q0SA 4WBBA 2WC2A 4I0AA 1NXMA 4J1WA 3E5UA 5BV6A 1CGPA 3H50A 4JTNA 4MGZE 3NL1A 2BNNA 4QGMA 5D1IA 2GC0A 5FLHA 4F8AA 1X8EA 1RL3A 2GC3A 4MUVA 4YARA 3H8UA 1YFUA 1NYWA 1I6XA 3FX3A 3EBRA 3EJKA 1SQ4A 2GC2A 4QGLA 1ZZ7A 3LA3A 2PAKA 3SCFA 3LAGA 5JAXA 5I0SA 4AVBA 4N9IA 1ZZ6A 3TNQA 4EROA 1CAUB 4XEZA 3UKVA 3SCHA 4X6RB 1O3TA 3FHIB 3H1MA 5KBFA 2Y0OA 2OA2A 2PHDA 1YUDA 3I7DA 5I8SA 4WVZA 4ZU5A 1YFYA 4QGNA 5LRRA 2D93A 2QNKA 1EY2A 3S7IA 3OTFA 1JUHA 1H1MA 4Z07A 1OI6A 3IIAA 4L11A 1WLTA 4KWKA 1QWRA 3NJZA 4AXOA 4R8HA 1H1IA 1RGSA 4I09A 1ZNPA 2VQAA 3ELNA 2PQQA 3C3VA 1QY4A 3WW4A 4BIFA 3FWEA 4QMAA 2IXKA 2GZWA 2UY8A 1ZZ8A 5CVRA 1Q5OA 5I8YA 2H0VA 1WGPA 4FBFA 4YSFA 3KCCA 2PA7A 4EWDA 4LULA 4XFBA 1LB2A 4PIZA 1YFXA 3RYPA 3KMHA 3USSA 4AVCA 5JSPA 1UCXA 2XL9A 2D5HA 5I0UA 5JCTA 2CAUA 4E2SA 5FPXA 4XFGA 1X82A 5JR7B 3RNSA 4UBGA 1J59A 4Q0QA 3S0MA 2O1QA 3BALA 3D0SA 4QM8A 4ZU4A 2XLAA 3OD0A 1ZZBA 5FPZA 2XKOA 3RPQA 4IEXA 1UPIA 2C0ZA 1EYBA 3H1WA 3PLQA 4ORFA 3OGJA 5FLIA 2FQPA 3IDBB 5I8TA 1V70A 1YHFA 2PTMA 4IETA 1PM7A
chains in the Genus database with same CATH superfamily
1NCQA 1OQ1A 2O8QA 1SCRA 2I74A 3IPVB 4XXAA 1W8WA 5F3CA 3MPBA 2R1DA 4CCDA 3P3NA 5FJHA 5JIUA 1KS5A 2R7EB 3H3ZA 5FZ6A 5F37A 3ILRA 3ZFFC 4Z2WA 5GZCA 2HWC3 2WINB 3F2ZA 1V9U3 1SG3A 1REDA 3WXPA 5GM0A 4Y22A 3AK0A 1C8M1 2QDNA 4N8MA 2Q4SA 1BBT2 1RUH1 1VBA1 4YGCA 3VUOA 2ADDA 4JC1A 3ZSLA 3TEZA 5D8AA 1Q8QA 4FPHA 2VBPA 2ZS6B 1LHVA 1VPHA 2BOIA 4U2AA 4A7ZA 2DUOA 5IAVA 1QU0A 2ENRA 2UU8A 3ZKYA 2GC1A 1VIWB 4CUBA 5JLVA 2BVBA 1W8NA 1QXRA 3THTA 3SISA 2BFUL 5JMCA 2BNOA 1US3A 2VVFA 3HN1A 2ZMKA 2AUYA 3O1MA 5LASA 1HDKA 3SKVA 5CFDB 1WZXA 4Y20A 5J7MA 1IHMA 1RB8G 4K6BA 3KM5A 1H8TB 1SPPB 1C57A 4Q2FA 5FBJA 5C71A 2ARCA 2A6YA 3CL1A 4QPGC 4Z1VA 5E88A 5DUXA 2IVIB 3KV4A 3MUZ1 3VBFA 4HLTA 4K7JA 4IV1C 5DDJ3 1MPXA 2GNDA 1ODMA 3FE5A 3H42B 4GH4C 5FXZA 1VAKA 1OPOA 5IATA 2QQJA 1LENA 3ES1A 3WZ1A 3AVRA 5EYXA 1PGL2 4AVAA 2TNFA 2GMEA 3KCXA 4UFLA 1LHUA 2QJVA 1UZVA 2HH9A 2DUQA 3OCPA 4FO9A 5EP9A 1RITA 1UY1A 5FZ7A 4AF9A 3HIFA 1UXXX 4GULA 4QQPA 1I3HA 1LAJA 3GGLA 3ROUA 2AACA 1SCSA 1UMZA 2AGSA 3KGZA 1CAXB 5HXMA 4UFJA 3H7JA 4TN7A 5LW9A 1XNBA 5A7NA 1G9FA 1W3VA 1FXZA 4K1ZA 4NHYA 4UAPA 2D5FA 2IXLA 3MLJA 1UU6A 2RDNA 1OKQA 1G86A 3AKRA 5GLTA 3A4UA 4HANA 2H0BA 4YW4A 1AR73 2W08A 1DF0A 4CUAA 1ND2B 2R0FA 2G1MA 2Q1FA 5LEJA 4CU7A 1KFUL 4EN7B 1DZQA 3W58A 4OI4A 4FTBA 5EIYB 3K2OA 1KFXL 2E7TA 1L7QA 1QXPA 1WCSA 5JI7A 4RQPA 4RYDA 2VOXA 1WLWA 5HCBA 5F3EA 4LIUA 2EIGA 2KXLA 2VVEA 3KS7A 1UY2A 1VAVA 3K4DA 4TLFA 5GLWA 3FBMA 5A3WA 5BNOB 2VCCA 1ULFA 4YG0A 2QUOA 2NZ9A 1DQ4A 5F2SA 3O1UA 5FK7A 1H2LA 2Z79A 2ZGLA 5ABJA 3RZLA 1KEXA 1CONA 1BBT3 1F35A 1SBEA 1WBFA 2X8KA 1OXCA 1YEWA 4PF1A 3DF0A 4C0BA 5BNPB 1LOEA 3AZYA 4M0HA 1PMIA 2VBBA 5FV3A 1RUD2 1W6QB 1QJU1 3I54A 1W8OA 5C8WA 1AR61 3I59A 1ST8A 4OMDA 3AXEA 4IDZA 2RS11 4RA0A 2I07B 3KB5A 4YYOA 3ZSEA 1WMFA 4R4XA 3SMHA 3N9QA 1E5IA 4AHZA 2FCTA 2K9ZA 2RMU2 2WNOA 2OUJA 4IEWA 3P6BA 4XF3A 1ZBA2 3EHKA 3U10A 2ZGRA 1LOGA 2ZKNA 4N7UA 4XACA 5FTTC 1AYM3 5K8SA 1N1YA 1SMVA 2B5HA 2GAUA 2UURA 3HNYM 3TRSB 4OHVA 1NCQB 5KXDA 3E6CC 1ND3A 1HQWA 1Q8OA 5APAA 3DECA 2PHUA 3IBMA 3KGLA 4Q0VA 1UYYA 2A6ZA 5JR2A 4L99A 5AC91 3N3HA 3WVJA 1F5FA 4M4PA 3CLPA 5DAQA 1GZWB 3N9MA 2VZOA 4RGAA 1NLQA 2X5IA 4AI1A 4P5HA 1A6CA 2BGPA 1B35B 1YNAA 4BH9A 1BEV3 2GNBA 5KXEA 2FDFA 1D0GA 4HG6B 2A3XA 2G9FA 1WW5A 2VAUA 1UZZA 2IFWA 2IVJA 2D44A 1YRZA 1XYNA 2W87A 3LEKA 3JQWA 3OGSA 1NOVA 1Y9GA 3MUY1 5D8AB 3AYAA 4Y5TA 1PZ8A 4A42A 2VZRA 1PZ9A 4WVWA 2J1EA 1X8MA 1HB4A 2ZGSA 4P9GA 1C8M2 4QX1A 1BHGA 3RQ0A 3M2MA 4CE8A 5J3UA 1VBA2 4F83A 4CXWA 4P5YA 2XLFA 1VBC3 2DFCA 3ON7A 2XBO2 4Q4Y2 3ZN5A 2A3WA 1D7PM 5JIAA 4IGPA 3VKLA 4BJ0A 1LR5A 2XHNA 4LPLA 2XLGA 1WA6X 2P6HA 2DU1A 3U4XA 2X53S 3LSDA 4NROA 2OYZA 1NZIA 2VZ1A 3MIEA 3VHPA 3VBFB 4GD4A 3WHUA 1N1VA 2AREA 3BODA 4HSLA 4QXCA 3J7MA 3WNNA 4E27A 3S57A 1HQNA 4MGTA 1PGSA 4WVMA 1AX0A 3DYPA 4FFIA 4CDWC 2PHLA 3MGUA 2VW2A 3ACIA 1KD7A 1RUG1 4B29A 5LBCA 3IMMA 3C7HA 2WNEA 2W91A 2ZGMA 4K3UA 1OQEA 5DXDA 2HYKA 5I0DA 5JZGC 2HLEA 4PT6A 4Q0UA 5G05L 3S7EA 1CAWA 3C8XA 4WZFA 5FYUA 3TEXA 4BMBA 4COWA 4PLOA 4OHXA 4RS5C 1GZCA 4HKLA 1Z0HA 3RMYA 3PURA 5F7UA 2WQ4A 3VBSC 1QOSA 3KWVA 5CKNA 1G9CA 5T3NA 1UZYA 2OW4A 1KGYA 2Z2SB 3V0AA 1FNZA 1UW8A 4XYXA 2DCZA 1DGWX 2Q1MA 2NYYA 2J1VA 5EJZB 3ZYFA 5HV4A 4XDOA 1JOJA 1UPSA 3W5NA 1CAUA 1FPN1 2EXJA 3H1YA 1W2NA 2O8OA 1CPMA 1RC6A 1MQTC 3KT4A 1YQ8A 3R0RA 4YWAA 3N7LA 3P1IA 2K2SA 3O1RA 3E97A 2E31A 4CEYB 1G6NA 5IWFA 1J3PA 2ETEA 3OY8A 2R32A 2WZR3 2P3JA 3I2FA 4S2HA 3TYJA 1YLLA 1MACA 2MHFA 1DYPA 2V09A 3OUHA 3GF6A 1UL9A 4IEVA 4Y4YA 5TSWA 4RQPB 4AFAA 4BQ1A 4QQOA 4D7TA 1J84A 2R0HA 4WM7C 3U37A 1ONAA 4QD2A 3USUB 5CEHA 4L2NA 5FFOC 3H8XA 2AR6A 4QU2A 3VZNA 5J36A 3AZZA 4YW2A 4YVSB 1OF3A 1WMDA 5FP7A 2R30A 1O8PA 4AI0A 1OUSA 2RM21 2PFWA 4COYA 1VBD1 4JGZA 3KHBA 2R6QA 2QQKA 2WIIB 5A6YA 5BNQA 5FZHA 1QIQA 4WZCA 1DGLA 1RJ7A 4NHMA 2IXHA 1R091 3PMEA 2B39A 5FUIA 1JTZX 2VMHA 2RDQA 3DXTA 4HXCA 2VTXJ 4BXSV 1UY0A 5FYHA 1C8M3 4KWJA 5KWRA 3K4AA 1FT9A 1LEMA 2BYVE 1POV0 1C4RA 1VBA3 4IW3A 1AR82 4CYDA 3H8RA 4YNIA 2A6VA 2XBO3 3VHOA 1W9YA 1QJU2 2JDMA 3AP9A 1F2NA 3MPPG 4GWNA 1OOPB 1J83A 2RS12 4QX7A 3ENRA 2W3JA 3SEEA 4JVAA 1ZBE2 3B3QE 3S30A 4O9EA 5FY7A 5C9AB 1LU2A 3OEBA 2JDUA 1VRH1 2PAMA 2YMZA 5LY2A 4D7YA 2VZ3A 3D8CA 1TME2 2VMIA 2ZKLA 3RI8A 4IEYA 3ALQA 2XDVA 4GIQA 3WUCA 1JZ3A 1W6PB 4ZU7A 4G9SB 4W8JA 1S0JA 5FAXA 2OPKA 2ZAAA 3CHXA 1PMHX 4TSVA 2R061 4BB3A 3H0OA 2X5IB 5ISLA 3HPNA 3MLKA 5JOYA 1SLIA 3IMNA 2FDKA 3WDUA 4I01A 1STMA 1GP6A 4C90A 3U0ZA 3L2YA 3WW3A 2LS6A 4NPMA 3ZR5A 3IAPA 1NA1C 5HPOA 2CV6A 3LPGA 1KITA 1YFWA 3RFRA 4CRQA 2VTXA 3DKWA 1LODA 3WUDA 1TMF2 2VTFA 5FPUA 4LEJA 5FY4A 4RHV1 2QE3A 5K0UB 3WQ1A 1DQ0A 2QQNA 4NWVA 1CR7A 5AVPA 2F17A 5JUVA 5CFDC 4EYUA 5KXCA 4QHOA 1HRI2 5F9TA 1FX5A 5EYYA 1H8TC 3NV4A 3UGGA 1WCKA 1L3JA 3HWJA 4GJYA 3VD5A 5JOZA 4N7IA 3WEZA 5BY5A 3C2UA 3O1VA 2W9XA 1JZ2A 1WA4A 2VOTA 5DAVA 3URFA 2D7FA 2YBPA 5HBAA 3AVSA 3S5QA 4C1XA 1OH4A 3SH3A 4Q0SA 1RUOA 1ZA4A 3VBUC 3OPTA 5DZEA 4BPZA 4HFSA 5E89A 4FOQA 5BV6A 1ASJ2 4H7MA 4HKOA 3ILNA 3O7OA 5C7GA 3H50A 4MGZE 3IKWA 3NL1A 2XJRA 3THPA 1MEC2 2ZGTA 4GWJA 2GMPA 2GC0A 1H9PA 4JAAA 5FLHA 5K7PA 3VBRC 4Y1YA 2ES3A 1KJLA 3TWIA 5JPNB 1C1FA 3LDKA 3AJZA 4AR2A 5HV0A 1RUG2 4YARA 1V6OA 1H2MA 4XHXA 3TEYA 1ODNA 3NNLA 3EBRA 3EJKA 1LOFA 2QQUA 2Q8CA 5A3OA 3VDDA 2VOVA 3O0WA 4L97A 4AAXA 1LECA 1ZZ7A 1FOD1 2R041 3LA3A 1NCRC 4MVTA 3SCFA 3WDTA 3ZXEA 3V0AB 3O1PA 4ZS2A 3INAA 4IE0A 5I0SA 2XMLA 1D4M1 3WDYA 1YJKA 3TNQA 5B2GB 2WYSA 1CAUB 4EROA 1ND2C 4LE4A 3AYCA 3UKVA 1QJU3 2FBEA 3SCHA 1AR63 1R082 2WWUA 1O3TA 2RS13 3H1MA 2LM3A 3H3LA 3OY8B 4BQWA 5FYIA 2TEPA 5JXIA 4QKNA 3RG0A 4FFGA 1F4HA 4E8DA 1FPN2 3O12A 5F39A 3VN4A 4LBOA 2HWC1 1V0AA 1V9U1 2XQRA 4AI3A 5A1AA 3UESA 3DPRB 3IDEA 5DUUA 4FVVA 3WOGA 3W5MA 3PJQA 4FFHA 1ZYBA 3OTFA 3ILFA 2XB6C 5A7WA 2Q8DA 1H1MA 1OI6A 2X05A 1WLTA 5FP8A 2EALA 4JGZB 4KWKA 3VD4A 5AC93 4N43A 4ZONA 1O4YA 2RS31 5IAXA 2CGOA 1QWRA 2K46A 5FO9B 4W65A 4QX8A 4IL7A 4YVWA 3WNKA 1TMF3 2PQQA 2LALA 3IB3A 4P9IA 1GP4A 1QY4A 3C7OA 1OLMA 1N1TA 1NKGA 1VBD2 4YM1A 3SH4A 1K12A 4FFFA 1VMFA 3ASIA 2ZX1A 2IXKA 3ORJA 2SBAA 3OBAA 2BFUS 2VG9A 3NWKA 1K3IA 3LPFA 4CCJA 4RS5A 1NCQC 1WGPA 2YXSA 2V72A 4FBFA 3VBSA 3ZN6A 5L9VA 3Q8BA 4ZS3A 3LCPA 1SZBA 1S2EA 4LULA 4MSVA 2EXKA 3PHMA 4XFBA 1DBNA 1MQTA 1ULOA 3VKNA 1XNTA 3WF1A 4AVCA 4B3NA 4CU8A 5JSPA 1UCXA 4MO3M 5C33A 5JCTA 1VRH2 3M3OA 4NJ4A 2WQ8A 5F32A 1LULA 3LFIA 3O1SA 1X36A 3SKJE 5CNAA 3RNSA 4UBGA 4L0PA 4PCRA 5D8AC 4Q0QA 5FJKA 4P9YA 2O1QA 1RUG3 2R062 1YIPA 2IWGB 4XURA 4OYUA 3DEMA 3GZEA 2ZAHA 4LNVA 5EXOA 3T1LA 3WF4A 4AGGA 5FPZA 4LK7A 2VD7A 4IEXA 3RPQA 2C0ZA 2CDPA 4ORFA 1IKPA 2JB8A 1JHNA 4AL9A 2RR12 4CDXA 5ACA1 3QCWA 1QH6A 3RZMA 3FFZA 3K77A 4ET7A 5IVVA 1GR3A 5A32B 4AVVA 4GJZA 5C8CA 4IETA 2DVFA 1W99A 4XJWA 3ETPA 5IK8A 2VQTA 3T3YA 5E6HA 3VBFC 3N36A 4ZKTB 4AQTA 1JBCA 2WO7A 4LHLA 4LUKA 1NAEA 2DCTA 5T52A 3KT1A 2R49A 1FPN3 3AM2A 3E6BA 1NE4A 4Q1RA 1POQA 1ULCA 5ANNA 3W9AA 1JH5A 2EVXA 1OVPA 3IPVA 5CAZA 1KS4A 1QQP2 1C5IA 2YUEA 2WT0A 1OC1A 1S0EA 3PVEA 2O14A 3IDCB 2VBDA 2OKXA 1XYPA 1BBT1 3FMGA 1G9AA 2PN5A 4ASMB 2CWSA 1XSRA 1PHMA 4IEQA 5KHHA 3ZSKA 1LESA 3BCWA 1WLCA 2GMMA 5LBFA 5C3OA 3J4UH 3PTYA 1V6LA 4J25A 3THCA 3J7LA 2UWBA 1CZVA 4ISRA 4FPFA 1AYN2 5FK8A 4KWLA 2RM23 1XE7A 3VDDB 4LA3A 4URAA 4HONA 1VBD3 2F4PA 1K45A 1AXZA 1SLTA 3I2DA 2QZ2A 5GZFA 5SV8A 3AXDA 1LGBA 1W8ZA 3FLRA 3OBZA 5KHGA 3AL5A 4JDOA 3I3DA 4A44A 1F9KA 4D6QA 2RG4A 3CEWA 1C5HA 1Z7S1 2R042 3T4HB 3V65A 4BQ4A 3LOBA 4AFDA 5HCHA 3LKJA 4RQPC 1AL0G 5FZ3A 4AI2A 3RJ2X 4Q0PA 4SLIA 1LGCA 3BOPA 1IPSA 1H8TA 1SPPA 4FXGB 1TEIA 1HRV1 5JXJA 2W1SA 1J3QA 4PIYA 4XFHA 1JN2P 1PGL1 2C9KA 3BN6A 2IZWA 1S55A 1VRH3 2PHWA 5A7WB 3WG2A 1YQ6A 3WNLA 4LKEA 3UNPA 1PX3A 1PIV1 2W47A 2VQUA 3ACGA 2ORXA 1O5UA 1OURA 4TXWA 4BYYA 2DYCA 3AMQA 4N43B 2E7QA 1Y3TA 1S0IA 2R063 5JSOA 1HJFA 2P34A 1W8HA 1W9WA 4HVOA 2XL7A 4YVWB 1A34A 1GQHA 2ZHLA 3GALA 3NJVA 5FBZA 2VO5A 1MZEA 5CYYA 3ZDVA 1CAXA 2Y6GA 2YYOA 3SHRA 4Y1XA 4XF4A 1OOPC 4CCEA 1OUXA 3F95A 5C9AC 2Y26A 5A1FA 1ND3C 1N3OA 4RHV3 2ZTNA 4HVRA 1BLZA 2WR9A 1DQ1A 1M06G 4NOTA 2D40A 4YM0A 4RFT0 2ILMA 4AVTA 4Z2AA 2A73B 1HJGA 3VB9A 1GOHA 3JB8A 1D2SA 5H9RA 4P14A 1QEXA 2FCVA 1K5JA 5A7SA 1AX2A 2X5IC 4YFZA 2WNVB 1NLRA 3LQCA 1UNBA 4AHWA 2VMEA 4H7LA 3AB0A 3NVCA 5CG8A 1CAVB 1FI2A 4QKBA 1BK0A 2ZGUA 4GQ7A 4HT1T 1UU4A 1XE0A 2VZSA 4P9LA 5BNOA 1PM4A 4IV3B 1XNDA 4LORA 1S2BA 1RUD1 4ATFA 2FCUA 4DOUA 4Y1VA 5FIXA 3ZXGA 3AJYA 2ZGQA 4HK8A 4D8MA 5ERLA 1PNGA 5K0UC 4O7XA 2ZGKA 1AYN3 1AXKA 1K5MA 1H8VA 2RJKA 2RMU1 4HBNA 3U75A 5BNPA 4OMCA 3BYWA 4ASKA 2GN7A 1ZBA1 2W5FA 3KF5A 4JX0A 1W6QA 3AKPA 2B4KA 4U36A 4CDXB 4AHXA 3JD71 2VXJA 3M1HA 1CVNA 3HBZA 4XUTA 3WNOA 3WDVA 1RINA 2Y60A 1WCUA 4SBVA 1LHOA 4LO6B 2R043 1AX1A 1S1AA 3O1OA 1NY72 3MYXA 4UW3A 1DZTA 1D4M3 2W0XA 1RJ8A 5FQ0A 5ACA2 3RDIA 4FOYA 1LHNA 5BNNA 3FHAA 2OZJA 3ZN4A 1I5PA 3KVAA 5BPXA 3JUUA 1AZDA 5JOXA 3UT0A 4CDUA 2YZ4A 4P9XA 1H6YA 1OD5A 3PL0A 2YV8A 5ANQA 2VU9A 2YHJA 3AKTA 5KHIA 3PJYA 1GZWA 1MR5A 1PK6B 3WLUA 5FLJA 4PLMA 3WHTA 3NV1A 4K1YA 2PLV1 2R16A 3ETQA 1B35A 4WVVA 1HW5A 4MZUA 5LCWL 1NZCA 1JHJA 1JI6A 1X7NA 3KZ4C 1VALA 2XOMA 1OHFA 4OCTA 5FMCA 4ASLA 4FAHA 3VD7A 4R52A 2XBO1 4Q4Y1 2F6BA 1UAIA 2RS33 2W68A 4HK9A 2XONA 2JE8A 3M4FA 3T0AA 4HSJA 4LBQB 3IDAA 3FC0A 2VGDA 4YW3A 3EXUA 4CU6A 5FWEA 1L7RA 3TNPB 3GBGA 3QLQA 2HBUA 1UKRA 4V2WA 1O4ZA 2QQIA 2VMDA 1NQDA 1NE6A 2JKXA 2QVSB 2V5DA 5DAPA 4LJHA 4M3CF 5SV5A 4XFFA 2GNTA 3B9IA 3KLSA 1WMXA 5BUVA 1SDDB 2LTNA 4FAGA 5JXGA 2XJTA 4FQZA 1H2NA 1Z7S2 2ET7A 5FCCA 4DINB 5I91A 3BIEA 4XF9A 1ZZCA 2QCSB 3GJBA 4DNYA 5LA1A 1JZ8A 4JGZC 1YCIA 4LO5B 4OI2A 1Y9QA 1HV1A 1ZVFA 2N7GA 4MH0E 1HRV2 2W46A 4MGYE 1UXZA 2WAOA 4FTEA 4AEMA 2WT2A 3VBHB 2VMCA 4KU8A 2X09A 4I02A 5FP9A 3R6SA 1PIV2 4M00A 3QD6A 1W2TA 4FCAA 2QQPA 3R05A 4A41A 4AEKA 1NLSA 3I3BA 2W95A 5L9BA 3QACA 1CWPA 1I5ZA 5FMDA 4ES9A 4LKSA 3LFMA 3MV11 4IEUA 3HJRA 3I2IA 4HMZA 4QQLA 5E16A 3LOIA 2J1TA 4DMIA 3C7EA 4A7KA 3OPZA 5ACA3 1Q43A 2D6PA 2PAEA 3FJSA 4CEYA 4JGYB 3JZVA 3SEPA 3ZSMA 4I0BA 1EP0A 1KXGA 3GM8A 4XFIA 5DAXA 4OI0A 2QTWB 2VZTA 4R9DA 4CCCA 4CVUA 2B9VA 3USUA 2FMYA 2CAVA 2JEMA 3ZM8A 3VZKA 4PQ9A 4A6OA 3ZXDA 2ZZJA 3OGGA 3VHRA 5GJ6A 1ZREA 2J22A 4YGDA 4YVSA 4BZ4A 2C24A 3VL9A 3POGA 1UWWA 1UYPA 2ZGPA 4KWUA 1AR81 3WX5A 1K5MB 2ZGOA 3PDQA 2CWMA 4DY5A 1V6IA 3T2PA 4Q8KA 3JXSA 2P5BA 3WCRA 3DGTA 4BQ5A 4LT5A 2B45X 2Y38A 4LIVA 4NO4A 3W20A 4KI5M 4DO0A 4EZ4A 2E32A 3AMMA 3E1F1 3TN92 2VOWA 1ZBE1 1O3QA 2WO3A 2WKKA 2Z69A 1AR91 3BOWA 1TME1 4NMIA 1S0GA 4D69A 4YW5A 2WN2A 5DMYA 2WA4A 2WDBA 4XZUG 5IVCA 5FQ0B 1FNYA 2BJSA 4LBKA 4R4ZA 3VD3A 1OOPA 3JD72 5BNNB 4QXBA 5C9AA 4QXKA 2WLPA 3CMGA 2G19A 5EPAA 5LA2A 3VKMA 3WY6A 3ZYPA 1SDWA 3D0JA 5FZFA 1Z7S3 4LITA 3DKQA 4CDUB 2JDHA 3AP7A 4IGOA 4IERA 1HKDA 3NKTA 2ZX3A 1ZRFA 3KD4A 4I2OA 1LNSA 1W6PA 3AP4A 2PYTA 4W50A 4OI1A 3N7JA 3U4SA 4NIGA 3R4SA 1E57A 1HRV3 3HT1A 1SEFA 1H1AA 4DXSA 1XXNA 4NAOA 2IUWA 1LOFC 1TMF1 3LZZA 3MIGA 3VDDC 1TZOA 4DFSA 1RUF2 4AQ2A 2V4VA 2NMOA 2XHKA 5GLVA 2VL4A 4CPBA 5E1RA 1H6XA 4EWAA 1PIV3 2YGMA 1GP5A 3T30A 3WF2A 3BTZA 1OF4A 3OF1A 1HRI1 4LXLA 1LKNA 2PLV2 4PJYA 4JHZA 1O4TA 2ZA9A 3AZWA 3E5XA 3NMBA 5KXBA 1HN0A 1O91A 5K0UA 4XQDA 2DCYA 4MGKE 3B9CA 1HX6A 2ZGNA 1YIFA 5FMOS 3ATGA 3DYMA 1EAH1 1WBLA 1YI9A 1R1A2 3QOPA 2JJ6A 4HOOA 4UWDA 1ENQA 1WKYA 1QH7A 1ASJ1 4R9BA 3FLPA 3WP3A 1W0PA 1NXMA 2V4AA 1DDLA 4J1WA 3E5UA 4PI2A 1MEC1 2YBKA 2ORZA 1BCXA 3EMRA 1CGPA 1ACCA 4QGMA 1W8TA 4CUGA 5D1IA 1LOBA 4N43C 1IOAA 4FXKB 5F5AA 3HR9A 4JRLA 3R4UA 1SFPA 4QDQA 2EF6A 2V5YA 1UX6A 2GC3A 4YVWC 4AQSA 1QJY1 4W6YA 4BISA 3BUCA 4R9AA 2XJPA 4QDSA 1POV1 3WINE 4IE7A 4AZZA 3FHQA 2O0OA 2X29A 3MLLA 1IS6A 2J1RA 2R072 1U5XA 3VV1A 3FLTA 2DVDA 1RUD3 5JAXA 4XVHA 3S5AA 4QB2A 1QJFA 1R081 1S0DA 4AVBA 2JX9A 3AP5A 1HN1A 3QH7A 1PNFA 4AEDB 2XWJB 4XEZA 1BKZA 2F4LA 3U07A 3A7QA 5J98B 4C8DA 3CU7A 4X6RB 2RMU3 5K9YA 5CKMA 4MYEA 1QJZA 3VL8A 1ZBA3 2XXZA 1DU3D 3VZJA 2J1UA 3KQRA 3LEMA 5T5LA 4CDQA 5T5OA 1TG7A 3JD73 4M01A 5I8SA 1YFYA 2WNVC 3UETA 5CFCA 5FY5A 3EB7A 1F4AA 5A33B 1VBB2 2VMFA 3K48A 5DG2A 3DUIA 2CSGA 3GZUC 3S7IA 1JUHA 3ZFEB 4DB5A 5FZ1A 3T2OA 5FZLA 1HB1A 1JYCA 2XUMA 3IIAA 4IV3C 3DPRA 3M3EA 5A6ZA 2VCAA 4AFMA 4D6RA 4XMIA 2VW1A 3GZTB 1GQPA 4K20A 4CUCA 2RDRA 3RZHA 3NJZA 1H1IA 1RGSA 2GSYA 3K4ZA 3MIBA 4Q4V2 3ZFGB 1F8VA 5FMBA 2V73A 2YY1A 2P3YA 3C3VA 3MI8A 3T08A 1MS1A 4BIFA 4CDXC 2HWB1 3AYEA 4LOTA 5F8PA 2VULA 2PLV3 2AZ5A 1ZZ8A 5CVRA 4AFBA 5C8CC 1KRIA 1HB3A 4YFWA 4AW7A 3MW2A 5JXHA 4PBPA 3PUSA 3A0KA 4GXLA 2PA7A 4EWDA 2VCBA 1JZ7A 4Q4Y3 2BU9A 3BU0A 1CPNA 1LB2A 2C1FA 4CPBD 3N9NA 3A21A 4CCNA 4AI8A 1S0FA 1Y4WA 3HQRA 3ZYGA 4GB31 1YFXA 3ITQA 3RYPA 3QBQA 3Q8CA 1AR92 4LR4A 4NHKA 1ULPA 2DVBA 2GN3A 2D5HA 3I97A 3LIHA 1W04A 4ZZ8A 2G9GA 5D21A 3WP6A 2CAUA 3OJBA 4E2SA 4P9WA 4QPWA 2NN8A 2NQYA 2HBTA 4DUWA 1PK6C 4XFGA 3IM0A 4EN8B 2XPJA 1QOTA 1X82A 5JR7B 2J1SA 2KA3A 5FZCA 1IZ3A 4YGEA 2AC1A 4EQVA 4IGQA 3S0MA 1V6MA 3LDBA 1VE0A 1TNRA 5A7QA 2XLAA 3OD0A 5LATA 1UPIA 5DABA 2RR11 3H1WA 3PLQA 4BMEA 3DXUA 2R073 2Y8KA 4NPRA 3ZXJA 4BDVB 2A3YA 5HCFA 3K3OA 4CTEA 3I3QA 4H55A 1V70A 5FWJA 5FYSA 4Q8LA 1J1TA 2DBIA 2C4XA 1GWKA 3ABZA 3NNJA 1GKBA 2PHRA 4KGQA 3BPSA 1PO22 2FDGA 4MGIE 4TWTA 1RTVA 5A32A 3I3EA 4W4ZA 1GFF2 4FTSA 2VM9A 4META 1QQP1 5AFEA 1UMHA 4KBBA 5I93A 1VBB3 3GYDA 3I49A 1BJQA 4LO8A 1EAH2 5L7OB 1OLQA 1S2KA 2GU9A 5CKQA 5IK4A 2BEOA 4QX3A 2VZPA 4GWMA 5IFTA 1JYXA 3ZX7A 1GICA 3GJAA 3I8TA 1VLNA 4QKDA 3ACLA 2BBAA 2BGCA 5KHKA 4NIIA 2DVAA 1EV11 4LBMA 3VBHC 3B93A 1J58A 5FYVA 1AYN1 4M0NA 3AFKA 4QDRA 4XF1A 4X8NA 3UGHA 4F7ZA 3POSA 1BQPA 1IS3A 5FXXA 3KF3A 3UL2A 4N53B 1W2UA 2WZEA 4C91A 5F3GA 4CEWB 4EE2A 2CYFA 2Q0AA 3BTXA 2LROA 2XJVA 1XRUA 1OT5A 4GWIA 1QJY2 3SXWA 4BA6A 1VBE2 2KR2A 3HD8B 1IQDC 1LRHA 3ZXAC 5IK5A 3KQ4B 1AR83 1BZWA 1REFA 4OZXA 5C3PA 1JXNA 1Z78A 1RUJ2 1PGW2 4QB1A 1GZTA 4OUEA 4Z92B 4NHLA 4CDQB 1FAYA 4ZHNA 1ULDA 2DWRA 3OUJA 2W39A 1ZBE3 2QDRA 4GAZA 3ZFFB 4YLZA 5CFCB 4XCBA 2UWCA 2Y33A 1AR93 1TME3 1ZZ9A 2LUWA 4DXZA 3GCWA 1HLCA 1OFSA 4AEJA 2HEYF 5BNOC 4QAWA 5FUPA 5FYBA 4MGQA 4NRQA 4KL1A 3J8F2 5DZFA 4AVSA 3J7HA 1JYNA 3BB6A 1V00A 2ZX0A 5FZ0A 2E26A 1ALYA 5GLUA 1K5MC 2OZ6A 5BNPC 5IFPA 1HV0A 2ZEXA 3BVCA 1G7YA 4CXYA 1U5ZA 5AVAA 4UBHA 4FPGA 1DCSA 4HPKA 4XDQA 4IE5A 5JI9A 4XMAA 2EIEA 3WNXA 3WNPA 4Z8BA 4JRAA 3NAPA 5FY8A 1DGWA 2HWF2 2XR4A 1DZRA 4E8CA 3UKNA 4FSJA 2YROA 1GUIA 2IXJA 3OYWB 1HRI3 2HWB2 1S4CA 2KM2A 5BNNC 1PO23 4XUNA 3WV6A 2H6CA 1W8UA 3IWZA 1H0BA 1VP6A 4GH4B 2ZJCA 5FMOL 3RWNA 4BQYA 4CDUC 4QHZA 3LA2A 2JG8B 2YG0A 2XUEA 5CISA 4LOSA 1EAH3 1CD3G 5C4WB 1OSGA 4FT8A 1H30A 2JIGA 4NAMA 5JPMB 2BBVA 5FZ4A 2WZPP 5GALA 1ASJ3 1TNFA 3FUQA 3OD4A 1E5HA 2WNVA 2WJSA 5FZMA 2BZDA 4GB32 2ZPXA 2QFEA 3IZOA 1B35C 4OZOA 1MEC3 4P9JA 4BWOA 3HQXA 2JE7A 3UYJA 1CAVA 2ZCWA 5CA6A 3POIA 3N4MA 4IEOA 4OQ8A 1XYOA 2J1AA 2OT7A 3DV8A 4IV3A 1UYZA 3NSTA 4PDWB 1DGRA 2IXIA 1UOBA 1RUNA 3JBG2 3ZMNA 4AOCA 1WWYA 5C3SA 2P3IA 1YQ2A 3O14A 5FZDA 2WL1A 1RUE1 2WUHA 5J37A 1XE8A 3UKTA 5FY0A 2C6SA 4PI0A 3GNEA 1QJY3 2EAAA 1E5RA 1POV3 1NY71 5LY1A 4MADA 4JTOA 3G7DA 5FPVA 4Z82A 3T0DA 4NRPA 2BWAA 1R083 4KNCA 4OLLA 1JU3A 4KU7A 2BP6A 1LHWA 1ZRIA 1OPMA 3AMPA 2VNGA 1AL21 2Z5WA 4ONUA 4OUSA 4TLGA 2A75A 3KV5A 4YG6A 2UY9A 2TBVA 2Y6FA 1ZA7A 4XJ8A 1NXD1 2ZXQA 3WDWA 4ZPIA 4LO4B 2DUPA 5AFBA 4INDA 1UOFA 3T4VA 4CP9B 4KBZA 2ZMNA 3AKQA 2YPDA 4DS0A 4CCKA 3B01A 2P17A 3MW4A 5IVJA 1BMV1 3POYA 2JG9A 1RVF2 4IESA 2HWD2 4XW3A 4ATEA 1T6BX 3OBRA 1PZ7A 4LLOA 2XJUA 5CBLA 4UFHA 3FUOA 4YW6A 1UKGA 4B7KA 1Y7BA 2RS51 1COV2 3WP5A 1PK6A 2K0GA 1WUVA 2Z42A 4MX3A 3EO6A 4W6XA 1RMU2 1W39A 1Q3EA 2HJIA 1N1SA 1PX4A 2MEV1 2XVLA 3HMYA 4IEPA 4XBNA 2DCJA 4C0HA 1EV12 3WF3A 3RZZA 5KHJA 3DYOA 4QHBA 4LUMA 4XIOA 2HWF3 4D3WA 1GWLA 5EFUA 2A6XA 4LBQA 4EWEA 2VH9A 2HWB3 4XIKA 1MS4A 1KJRA 2NLRA 1Q8VA 4LA2A 4DRVA 1KQRA 4CEYC 4FQ4A 4QPIB 5EJ1B 4K21A 2VW0A 3O0VA 2DF7A 1RXGA 1TVGA 4NRMA 3ZOIA 4XPVA 3IN9A 1ZRRA 5FO8B 1O6UA 1PVXA 1XQNA 1CX4A 3ZKUA 1GNYA 3L9JT 1X9PA 3RRDA 3BPZA 4A4AA 5FP4A 4YVSC 5H9SA 4GB33 3WW1A 3WNMA 4YM3A 1QJX1 2ADEA 3ME2A 3M70A 3VKFC 3DCQA 3OSDA 2LW8A 3RS6A 1XPWA 2PHTA 4XETA 5EQUA 2Q30A 1UU5A 3O1TA 2VZUA 1W8FA 1N3QA 3JBG3 4RL7A 4N9HA 3J9SA 4HPKB 4XBQA 1ENXA 2QQOA 2ATFA 3VBHA 3FZ3A 4LHNA 4YRDA 5FY1A 2CNAA 4B4RA 3NAPB 4OHZA 1Q8SA 4FPJA 4L92A 2EA7A 2FDHA 4Y33A 3WQBA 2OS2A 4E4SA 2BRTA 1XJAA 2IC1A 2ZX2A 1UF2C 2CGNA 2RR13 4EN9B 1EPZA 2VNVA 5J96B 5GZEA 5F5CA 4NR1A 4XZPA 1GYKA 4QU1A 2DTWA 2PELA 2WFPA 3JCIA 4V2VA 1SFNA 2I2SA 5LRSA 2ET1A 3TB0A 4K9SA 2P1BA 3UK9A 3V56A 4KGGA 3HOBA 2OX0A 4WV8A 2Y6KA 5C6CA 1S0CA 3PMSA 1JODA 2JIJA 3WG4A 4JGYA 2VUAA 3HN3A 1QOOA 1FATA 2VZQA 4LTAA 4JKLA 2Q8OA 1QQP3 4HVQA 5LA9A 3I2KA 3K46A 2MPFA 2YBSA 4QX2A 4AFCA 2RV9A 1RVF3 2B46X 4GKXA 1W0NA 3SC7X 2VCMA 3U78A 1A8DA 1QXJA 4AGVA 1UOJA 3U11A 2Q5TA 3ZXLA 1RMU3 4FPEA 5F6KA 5EJ3A 2VVDA 5L73A 1EV13 3H3UA 5CU1A 3NRUA 3TN91 4CP0A 2EICA 2RE9A 4QX0A 3WR0A 5J1XA 4GZ9A 5HCAA 1FYUA 2DDUA 1UMIA 1VB4A 3THDA 4M3CE 1HXS2 1CIWA 2GNMA 3LB9A 5L36A 3AKSA 3N9PA 2FZ2A 1XSQA 1IPJA 4UOJA 1XNCA 5DDJ2 5FXWA 2ZEZA 4LBLA 4QWNA 5LEKA 4Y5Z0 4NUBA 1RUE2 3V0BA 3RJRA 1RYYA 2D97A 2CY6A 4S2DA 4WM7B 3K3NA 3POWA 3WP4A 2AEZA 3O5SA 4GA9A 1DLLA 4I3PA 2ZHMA 4OUMA 1DYKA 4ES8A 5IVEA 5L7OC 3MZHA 2E63A 1AJKA 2XVKA 1IGOA 4Y3OA 5GLZA 3D5OA 3B02A 1CJPA 2QQVA 4BLJA 2EXHA 2OXBA 3MFCA 1TQ5A 4K8FA 3H9AA 1AL22 5EZWA 2UYBA 4LBQD 4TYSA 1GLHA 2JG9B 1RUF1 5FYZA 1W2AX 1JYTA 2AYHA 1RUI2 3BGAA 2ERFA 3SCGA 4EZHA 1GNHA 3VD9A 2VOKA 1OA4A 2C5DA 3CNAA 4HN1A 3RSJA 3AFGA 1VRBA 1C28A 4Y26A 3VGIA 3OB8A 3ZDSA 4A45A 1BMV2 1NUKA 1AR72 5FPAA 3PIJA 2W92A 4GKYA 3PIGA 5IUQA 4DUVA 2RS52 1QKQA 3DN7A 5CZKA 3KVBA 3NV2A 1O7FA 5J09A 1YYNA 2ZHKA 1R1A1 2PHXA 3M8LA 2D43A 4E9KA 4JDNA 4UFKA 4OHWA 4QXHA 2MEV2 3ZYRA 2A5ZA 4CDQC 4GMP1 2JICA 2Q8EA 1OA2A 1YQCA 1O5LA 5A70A 1AHSA 3IAQA 2DURA 5CFCC 5FXVA 2VUJA 4WBBA 4HETA 2BDRA 2WC2A 2WS91 4I0AA 3NNGA 2JECA 1XB9A 3GHMA 2OQ6A 1SFYA 2JXAA 4JTNA 2D6NA 2ZX4A 4EJRA 2JD9A 2BNNA 3DPRC 5L9RA 5FRAA 3Q9OA 1W3XA 2W2IA 4B4PA 4F3JA 1X8EA 4Q5OA 2YU1A 1F31A 3C7GA 3JQXA 1NA1B 1X50A 4WM8A 4IUGA 1PVC2 4Y5SA 5A3PA 2E6VA 4C1WA 1IG0A 4MUVA 2FHRA 4PBOA 1NYWA 2YFUA 3FX3A 2R071 4COZA 1SQ4A 2WSUA 4OVEA 1QDCA 1FMD2 1WW6A 1AXYA 2GC2A 3Q8FA 4QGLA 3HVDA 2PAKA 4DEQA 3HEIA 1AYM2 1QJX2 2VUDA 4NE9A 3RI9A 3AYDA 1V6NA 2WFF1 4MLOA 1ZZ6A 3OPWA 4H14A 2D3PA 4R9CA 5FOBB 1GOGA 3VBOB 1CQ9A 1HXS3 5FZOB 3UV9A 3MEPA 4DEVA 2ZACA 1GWMA 3CDZB 2D6MA 4XUQA 2QQMA 1MZ6A 3D3AA 3J26N 5C70A 4AEDA 4DQAA 3VBUB 1RUE3 2PHDA 4JKKA 1MS0A 2AH2A 4UF0A 1VBB1 1YUDA 1P8JA 3I7DA 5LBEA 5A80A 2JG8C 4LO7A 3RWKX 4FI9A 3G6JB 2G9ZA 4JCKA 2PHFA 5DN2A 5LRRA 5LZ6A 1D2QA 1LTEA 2A6WA 5C4WC 2D93A 4UT5A 1BEV2 1VAMA 5GZGA 1PO12 3KV9A 4GMP0 5FZEA 3VBRB 1Q8PA 2BOJA 5A33A 4D94A 2CDOA 2TUNA 3BTAA 4XABA 3KCYA 3LSEA 1AL23 4TTGA 3ZFEA 1U5YA 4Q4V1 4LKDA 2ZMLA 1RUI3 2ARXA 1Q56A 1YC61 4AXOA 2PXJA 3NKGA 1H9WA 4PDWC 3OEAA 5A6XA 2VQAA 3ELNA 5A3TA 4LE3A 4AGRA 2FDIA 4B8EA 3GHNA 4D0QA 4A3XA 1NCRB 4LLFA 4AG4A 4BQ2A 1VBC2 1XOYA 5DUVA 3SQOA 4DXRA 2ZOEB 3S6PA 3FWEA 4QMAA 1LGNA 4XBLA 3ZYJB 3ZFGA 2QBXA 2UY8A 1T2XA 4JQTA 1QHDA 5D2AA 3TOJA 5L19A 3T1MA 2RS53 1QF3A 5I8YA 2H0VA 4GALA 3BI3A 4OQ9A 4YSFA 3KCCA 3I4IA 2MEV3 3NNFA 1GBGA 4NIAA 4M4RA 5F6LB 3OGVA 4Q4W2 4BOWA 3POJA 1DIWA 3NO8A 3V0BB 3OUIA 3MW3A 4I0WB 4PIZA 3B00A 2LRPA 5F5IA 2JKBA 2HEVF 3USSA 4LBNA 2BW8A 2BVVA 1WCDJ 3ZYBA 3MV01 3PUHA 4MXWB 1C3HA 5T5PA 3Q8AA 1ENRA 3N7MA 5FZ9A 4P02B 3N7KA 4G4FA 2GP3A 2WQZC 4XAEA 4CSWA 4CXXA 5A3UA 1PVC3 1G9DA 1DGRN 2JENA 3ZIWA 1J59A 3BALA 4FOVA 4QM8A 4IE6A 4ZU4A 2AENA 4DUXA 3NV3A 1S0BA 5K4LA 4YPJA 1YXWA 2RJ2A 1ZZBA 2CL2A 4RSUA 4XHBA 1FMD3 4E4DX 1EYBA 1Y43B 1JYIA 1BVP1 5FLIA 1W6OA 1HB2A 3VZLA 4CP2A 1QJX3 2VUCA 4V1PA 2W94A 1RXFA 2G4IA 2ZEYA 3IDBB 5JVVA 1BXHA 3CJIA 5I8TA 1MZ5A 1YJLA 1RUC1 4XDPA 1SBDA 2WZR2 1YHFA 2YPJA 1D4VB 5CIRA 1IS4A 4YM2A 4AI9A 2JDPA 3WG1A 1PO21 1PM7A 1OQDA 2GH8A 1URXA 3N35A 4QPIC 4RR3A 5C3QA 5IVBA 3SITA 1W9TA 2EXIA 2W1QA 2FDJA 5FDBA 3DL3A 1CN1A 1RIRA 3MO4A 2J7MA 2WNUA 2DV9A 3FN9A 4AQ6A 4BK5A 1OFNA 1W6MA 2JDYA 2E53A 3ACHA 2EIDA 1UYXA 2VQ0A 1W2OA 3B69A 3H7YA 4L8QA 4Y22B 4Q4X1 1PO13 1NG0A 3IIIA 2ARBA 5HI0A 2WABA 2UYAA 4I3GA 5A3LA 5FYCA 2P6CA 2WYFA 2WS92 5IT6A 2BNMA 4XJUA 5A6QA 2E33A 4ZY9A 1WW7A 3CKHA 4HN0A 4WM8B 4XTMA 4FPOB 4LMFA 3TBDA 4BU2A 5T5JA 2XGXA 1W6NA 2VC9A 3WF0A 5FR3A 4O9GA 1RUH2 3A0NA 4IEZA 3ZO0B 3LIGA 5C5UA 2HWE1 1SHWB 2OQ7A 3SLIA 5LA0A 4Y20B 1NT0A 2E7AA 3NAPC 4UW6A 5EWSA 4Q1PA 3CF6E 5GKAC 4YGBA 4BQXA 1VBE1 2D6KA 5M0TA 3BU7A 3VZMA 3E6DA 1BK1A 1WD3A 4BCUA 2QQWA 1RUJ1 1PGW1 4N53A 2CHHA 5F3IA 5IW0A 1LEDA 2IFRA 2P2KA 2VNRA 5FYTA 1VMJA 4CEWA 2J42A 2C9AA 1W06A 3KHCA 4YZ2A 3ST7A 3TN93 4Q4W3 4DZGA 1MZFA 2VY0A 3CIHA 2I45A 2WFF2 4UF0B 5EHDA 3VZOA 4LQRA 1SACA 1FV3A 1UZ0A 3EQEA 3PUQA 3X29B 3RGBA 3P3PA 2VNOA 2OVUA 1IKQA 1XU2A 3I2JA 5EV7A 4AHYA 3BKZA 1UIKA 4ZZ5A 1LCLA 4D7SA 4Q29A 3GBFA 3ZFFA 2WSVA 3J8F1 5H9QA 4J1XA 3M3QA 3VDBA 1RHI1 1GZ9A 4RN5A 2P37A 3RZJA 4DRRA 3OOXA 4NIDA 4URTA 2WA3A 1GMMA 2JDZA 5T50A 2EIBA 5FZBA 2WBKA 1WLDA 2ID4A 3PVOA 3WW2A 2D3SA 1DP0A 1NX9A 1SLBA 2W52A 2GALA 3NJYA 4JV4A 1ULEA 5FY9A 1CZTA 3RZGA 1JMUB 1RUF3 3L2HA 2HWF1 3IT8A 2GH2A 1DG6A 1JS9A 1U5IA 1UY3A 2IXCA 3Q8EA 4ZXKA 2FMDA 3PVBB 4UFIA 3CBNA 4MV2A 5JDBA 3C7FA 3VDAA 1OLRA 1U12A 4NPLA 2SLIA 2EAKA 4BQ3A 2H6BA 1BYHA 2C26A 1E5SA 1QMJA 3FFQA 5BYNA 2ZBJA 5FUNA 3TAYA 5JMOA 1ZRDA 4H2AA 4QT6A 1AVBA 3VDCA 1F15A 3POEA 3WQ0A 3D82A 4QPGA 3GBWA 3OYWA 4PF5A 4B4QA 1R1A3 3ES4A 2P3KA 4IV1A 1AJOA 5J48A 1ZX5A 3LDRA 4GMP3 5ABJB 2Y6LA 4RD7A 4GH4A 5KR7A 4KQ7A 5LWBA 3CZJA 3JU9A 1MS9A 4LHSA 2JG9C 2JG8A 1CJDA 2WS93 3PTRB 4KG8A 3M3IA 1DQ2A 3MDPA 1R64A 5C4WA 5CADA 2WAAA 4J6GA 3I59B 5IVYA 4LKFA 3MFAA 4B7EA 4I30A 3VHNA 3WD5A 4ITCA 1JUIA 3JBG1 3MICA 3ZIXA 1RUH3 5B4XA 4PIXA 2JB4A 3PU8A 2B9UA 4YZ5A 5FP3A 2Y34A 1V6KA 4PHZA 1W6OB 4XFCA 4A6SA 5FO7B 1AR62 1O8SA 1YWKA 4COUA 4PDWA 3CJIB 1L7LA 1ND3B 2BWCA 4ZXEA 2D6LX 4O61A 3A23A 3JB4C 1UN1A 1Y9MA 1DHKB 3BIWE 1OMIA 4RR3B 1HIXA 2WLQA 1SLAA 1G9BA 3GDBA 1A78A 2A70A 2WFF3 2XH6A 1C8NA 4AAPA 1RUC2 2P4EA 2WNUB 3ACFA 2CGPA 4CZSA 3FBYA 1W6MB 2NMNA 2BTVC 1K42A 3LEIA 4JKMA 3KSCA 4MGSA 4AK3A 1JZ5A 1H4HA 4QB6A 3U1XA 5AC92 1RVF1 2ZEWA 2HWD1 4B1MA 1HQLA 1C1LA 1ULGA 3NJXA 2A7AA 1COV1 5C5TA 3E5QA 5DUWA 1YO8A 4CP9A 1W6NB 4Q4X2 2RDSA 4YZ4A 1EPWA 1RMU1 4MXVA 5B4NA 2QZ3A 4FPKA 4G3YC 5A7PA 4RGKA 3K51A 1IS5A 3ZMOA 1VMHA 5A7OA 1DQ6A 3UGFA 4DPNA 5DPNA 1GU3A 4Q4V3 1DQ5A 3VBOC 3TEWA 3T0BA 1D0HA 2JD4A 2MNGA 2RHPA 1U0AA 1XBFA 2FZ1A 3PNAA 4NHXA 4CP1A 5IK7A 2BGOA 1AF9A 5F1RA 2HWE2 1R1ZA 5G04L 4XILA 3CQOA 1W9SA 4WVMB 1EUUA 1WD4A 1SLCA 5H9PA 4AWDA 4CU9A 4EN6B 2BPA2 5LK7B 1AUYA 1XU1A 1QGLA 5LBBA 3WDXA 1H4GA 1T6GC 3KV6A 1GQGA 5IVFA 2W1WA 3AL6A 4Q26A 5F5QA 3U14A 2D6OX 4FOWA 1JW6A 3MF6A 3PUIA 3AZVA 4JGYC 4QPIA 3T2QA 5JSRA 4JQRA 4LHKA 1ZRCA 3EYPA 3ZVXA 1OVSA 5BXXA 1J1LA 2ZABA 4IXLA 4QQHA 4L9BA 5E8AA 1CAWB 1REEA 3AP6A 4E2GA 3I2OA 4E4HA 2XJSA 1JOBA 4YW1A 1J3RA 2PMWB 5DG1A 1I1EA 1UD1A 1CIYA 3P5BA 5KC5A 3POBA 4XFAA 1OH3A 1SLLA 3WG3A 4A2UA 2NP0A 2HKXA 3GZAA 1CESA 2WRAA 3OBTA 3J7NA 1RHI2 2BUKA 2VE1A 4Q27A 3FL7A 3RYKA 1UIJA 4FP2A 4NVPA 4NIHA 3VKOA 5I0RA 2X10A 3RYRA 3UJQA 2XJQA 3B7MA 2VPVA 2VJXA 4HZFA 4HKWA 5JOWA 3V64A 4H3WA 2CTVA 5FYYA 2XG3A 2QKDA 3RMXA 2ZHNA 1UOGA 1O3RA 2E9QA 4UYBA 3CJXA 3NNMA 4QPGB 2D3RA 1RUC3 2NM1A 3LF7A 4YZ1A 3WSOA 1QJEA 4QX5A 1MVEA 4IV1B 1GANA 3WCSA 4XC9A 3BTYA 5IYYA 4E4ZA 4CDWA 1W0OA 4NN0A 1UQXA 2BQPA 3ZXKA 2HYXA 4DIQA 1OKOA 1VB2A 3ZSJA 2VR4A 2WO1A 3AMHA 2L9LA 4XQWA 1BVVA 4KH9A 4X6QB 2RM22 4JZRA 4B1LA 4Q4X3 1XNAA 1XC6A 4QM9A 3MHZA 1MVQA 2BERA 5JZGA 3HBKA 4UW4A 2VECA 1DFQA 2Y6HA 1R092 1WMEA 1V6JA 4LBJA 1N3PA 4EN0A 4EV0A 3H8OA 3N9LA 4RFRB 3SH5A 1OBNA 5FZIA 2B42B 1HXS1 3MBWA 1H2KA 1IG3A 3CZUA 4QKFA 5L7OA 4X8PA 3LEGA 5DDJ1 1JYVA 2YDEA 4AYUA 3GXUA 5F2WA 5IJRA 4BHPA 1X33A 2HWE3 3CO2A 2XQXA 2Y64A 2WT1A 3PU3A 4OFGA 3D4KA 4PQQA 1OA3A 3PUAA 1VBE3 1B09A 2B8MA 2DBNA 5KC6A 4QQ2A 1ENSA 3LD8A 1VR3A 4E2QA 2Q1ZB 1RUJ3 3MIFA 4ISQA 3ZYIB 2B7YA 5IHRA 2RVAA 3T2TA 2YC2A 1QNWA 1GSLA 3HQUA 3LA7A 2JE9A 1JOPA 4WM7A 5CG9A 1UX7A 2DU0A 4DXTA 1NQJA 3ZPYA 5FPLA 3R4DB 4UXAA 3KT7A 3ZXFA 4WM8C 2HEWF 3HT2A 1RUI1 3WT3A 4XXPA 4OHYA 2AEYA 3MIHA 1CX1A 1VJ2A 5FREA 4K40A 3NW4A 2OIIA 4Y1UA 2XWBB 2JWPA 2R1BA 1JU4A 2E51A 4CCOA 3AC0A 3B5LB 5LB6A 2A1XA 1LJ7A 1XNKA 2XKPA 4COVA 4XF0A 3J8F3 1AR71 1RHI3 1JYWA 5I0TA 1UY4A 1O3SA 4BIOA 4OULA 2DCKA 4RHV2 2W1UA 2Y0IA 1F5JA 1APNA 1MS3A 1SBFA 2WO2A 1DYOA 2WZ8A 1IPKA 4M3CA 3W21A 4AEDC 2YU2A 1M4WA 1US2A 3LWCA 2A71A 1UO9A 5T55A 4Y4RA 4MHRA 3W59A 2VMGA 3I3MA 2VXRA 1IQAA 1GV9A 1WCQA 3K75B 3MIDA 3PVNA 4XUOA 3APBA 4A3ZA 2BV4A 1CZSA 4YZ3A 1JZ6A 1N47A 1LOCA 2WN3A 2Z4FA 4XJAA 4QPYA 3RVHA 3ZFEC 1PVC1 4P08A 3POFA 4F8AA 1RL3A 5FOJB 4PLNA 4XCAA 2JDAA 1A3KA 3N9OA 3GCXA 3H8UA 1YFUA 1FMD1 1I6XA 4AE2A 2PQSA 1NA1A 1OLME 1AYM1 1R093 2KD7A 3ZFGC 1EUTA 2YB7A 3LAGA 4LK6A 3M3CA 2NPIA 4N9IA 1FOD2 5C3RA 1YQ5A 5DZGA 3UJOA 3D6EA 4XJZA 5CFDA 1D4M2 2YC4A 4K8RB 3FHIB 3MF9A 4Y24A 5KBFA 1W28A 4JDMA 5DQ0A 5HXVA 2Y0OA 5FPBA 1WW4A 3VBOA 3ZYHA 2OA2A 5FZOA 2GDFA 2OPWA 4MG2A 2Y6JA 1BEV1 4IQPA 4WVZA 4QGNA 4ZU5A 1PO11 2XVGA 4DY3A 5ABJC 3AX4A 4A7YA 5A3NA 2WWJA 4ARXA 3VBUA 2QNKA 1KDKA 4W6WA 4UI9L 4XAAA 1EY2A 2HWC2 3ZLIA 4CDWB 1V9U2 2DTYA 3ECQA 1MS8A 3NQHA 4P00B 4Z07A 4CCMA 4L11A 1LU1A 3AMNA 5FKCA 4FPLA 4HL0A 1OD3A 3QH6A 4FPCA 4XTPA 3VBRA 4CCLA 1ZM1A 4BK4A 2UWAA 5FKBA 4R8HA 1VBC1 4I09A 1ZNPA 5LK5A 1GOFA 2RS32 4BE3A 3M7AA 5GZDA 5JZGB 3ZR6A 4XJ9A 5FZ8A 2HWD3 1A8MA 1X9TA 3WQ7A 3WW4A 4BLIA 4MHUA 4RS5B 4CA9A 4D6SA 1COV3 3CJIC 4O65A 2GZWA 3VBSB 3ZN6B 1W05A 2QQLA 1NCRA 5FYMA 1Q5OA 3B94A 1W03A 5T54A 3AZXA 4RR3C 2WWSA 2ZZQA 4Q4W1 1ND2A 1O59A 4FP3A 1DLCA 1I9RA 4KG0A 1MQTB 4BXFA 4ARYA 3LE0A 4UFMA 2WNUC 5CB7A 1GNZA 2JDNA 5FZKA 3OGRA 1KDMA 1UZWA 2D98A 4MOAA 4S2GA 3ZPOA 4YG3A 5DAWA 3VLBB 3KMHA 2FD8A 2RJLA 4NWWA 4Y1ZA 1LOAA 2XL9A 3SNMA 1G8WA 5I0UA 4BM8A 5FZAA 5JWPA 3HAGA 1MS5A 4S2FA 5FPXA 4N90A 3HNMA 2OUHA 4IE4A 4XE9A 3HNBM 5A1LA 3I2HA 2ARAA 4XOGA 4RGGA 1QDOA 1W90A 4YW7A 2DFBA 3LGRA 3OG2A 3D0SA 4MXWA 4XUPA 1YI7A 2DVGA 1TE1B 4TZDA 5FZGA 4UW5A 1PMJX 3T09A 1QNYA 5A3MA 1W9FA 2XKOA 2GP5A 4JHTA 4XQ4A 3OGJA 1FV2A 2CU5A 2YFZA 2VZVA 5C8CB 2FQPA 1JZ4A 4FPYA 2WZR1 3RZKA 4KMQA 2YC0A 4N53C 1FOD3 3O0XA 3I2GA 4CEWC 3A22A 2YGLA 2PTMA 4M3CB 2JDKA
chains in the Genus database with same CATH topology
1NCQA 1OQ1A 2O8QA 1SCRA 2I74A 3IPVB 4XXAA 3MPBA 2R1DA 3P3NA 5JIUA 1KS5A 3H3ZA 3ILRA 3ZFFC 4Z2WA 5GZCA 2HWC3 2WINB 1V9U3 1REDA 3WXPA 5GM0A 4Y22A 3AK0A 1C8M1 2QDNA 2Q4SA 1BBT2 1RUH1 1VBA1 4YGCA 3VUOA 4JC1A 3ZSLA 5D8AA 1Q8QA 4FPHA 2ZS6B 1LHVA 4U2AA 4A7ZA 2DUOA 1QU0A 2ENRA 2UU8A 2GC1A 1VIWB 5JLVA 2BVBA 1QXRA 3THTA 3SISA 2BFUL 5JMCA 2BNOA 2VVFA 3HN1A 2ZMKA 2AUYA 5CFDB 1HDKA 5J7MA 4Y20A 1IHMA 1RB8G 4K6BA 3KM5A 1H8TB 1C57A 4Q2FA 2A6YA 3CL1A 4QPGC 4Z1VA 5E88A 5DUXA 3VBFA 4HLTA 4K7JA 4IV1C 5DDJ3 2GNDA 3FE5A 4GH4C 1VAKA 1OPOA 1LENA 3ES1A 3WZ1A 5EYXA 1PGL2 4AVAA 2TNFA 2GMEA 3KCXA 1LHUA 2QJVA 3OCPA 2DUQA 4AF9A 4FO9A 1RITA 3HIFA 4GULA 4QQPA 1I3HA 3ROUA 1SCSA 1UMZA 2AGSA 3KGZA 1CAXB 3H7JA 1XNBA 1G9FA 1FXZA 4K1ZA 2D5FA 2IXLA 3MLJA 1UU6A 1OKQA 1G86A 3AKRA 5GLTA 3A4UA 4HANA 2H0BA 4YW4A 1AR73 2W08A 1DF0A 1ND2B 2R0FA 5LEJA 1KFUL 4EN7B 1DZQA 3W58A 4OI4A 4FTBA 1KFXL 2E7TA 1QXPA 1WCSA 5JI7A 4RQPA 2VOXA 1WLWA 5HCBA 2EIGA 2KXLA 2VVEA 3KS7A 4TLFA 1VAVA 3ZIXA 5GLWA 3FBMA 5BNOB 1ULFA 4YG0A 2QUOA 2NZ9A 1DQ4A 5ABJA 1H2LA 2Z79A 2ZGLA 1CONA 1BBT3 1SBEA 1WBFA 2X8KA 4C0BA 3DF0A 5BNPB 1LOEA 3AZYA 4M0HA 1PMIA 1RUD2 1W6QB 1QJU1 3I54A 5C8WA 1AR61 3I59A 3AXEA 2RS11 4RA0A 2I07B 3KB5A 4YYOA 3ZSEA 1WMFA 4R4XA 3SMHA 4AHZA 2K9ZA 2RMU2 2OUJA 4IEWA 3U10A 4XF3A 1ZBA2 3EHKA 2ZGRA 1LOGA 2ZKNA 4N7UA 5FTTC 1AYM3 5K8SA 1N1YA 1SMVA 2B5HA 2GAUA 2UURA 3TRSB 4OHVA 1NCQB 5KXDA 3E6CC 1ND3A 1HQWA 1Q8OA 2PHUA 3IBMA 3KGLA 4Q0VA 2A6ZA 4L99A 5AC91 3N3HA 3WVJA 1F5FA 3CLPA 1GZWB 4RGAA 2X5IA 4AI1A 4P5HA 1A6CA 1B35B 1YNAA 4BH9A 1BEV3 2GNBA 5KXEA 1D0GA 2A3XA 2G9FA 1WW5A 1UZZA 2IFWA 2D44A 1YRZA 1XYNA 3JQWA 1NOVA 5D8AB 3AYAA 1PZ8A 1PZ9A 4WVWA 1X8MA 2ZGSA 4P9GA 1C8M2 3RQ0A 3M2MA 5J3UA 1VBA2 4F83A 2XLFA 1VBC3 2DFCA 3ZN5A 2XBO2 4Q4Y2 2A3WA 5JIAA 3VKLA 1LR5A 2XLGA 3U4XA 2DU1A 2X53S 3LSDA 2OYZA 3MIEA 3VHPA 3VBFB 3WHUA 1N1VA 2AREA 3BODA 4HSLA 4E27A 1HQNA 1PGSA 4WVMA 1AX0A 4CDWC 2PHLA 3MGUA 2VW2A 1KD7A 1RUG1 4B29A 2WNEA 2ZGMA 4K3UA 1OQEA 5DXDA 2HYKA 5JZGC 4Q0UA 3S7EA 1CAWA 4WZFA 4BMBA 4COWA 4PLOA 4OHXA 4RS5C 1GZCA 4HKLA 1Z0HA 3RMYA 2WQ4A 3VBSC 1QOSA 1G9CA 5T3NA 1UZYA 2OW4A 2Z2SB 3V0AA 1FNZA 1UW8A 4XYXA 2DCZA 1DGWX 2Q1MA 2NYYA 1JOJA 1UPSA 1CAUA 1FPN1 2EXJA 3H1YA 4XJ8A 2O8OA 1CPMA 1RC6A 1MQTC 3KT4A 3R0RA 3N7LA 2K2SA 3E97A 4CEYB 1G6NA 1J3PA 2ETEA 3OY8A 2WZR3 2R32A 2P3JA 4S2HA 3TYJA 1YLLA 1MACA 2MHFA 1DYPA 2V09A 4IEVA 3GF6A 1UL9A 4Y4YA 5TSWA 4BQ1A 4RQPB 4AFAA 4D7TA 4QQOA 2R0HA 4WM7C 1ONAA 4QD2A 3USUB 4L2NA 5FFOC 2AR6A 4QU2A 3VZNA 5J36A 3AZZA 4YW2A 4YVSB 1WMDA 4AI0A 2R30A 2RM21 2PFWA 4COYA 1VBD1 4JGZA 2R6QA 2WIIB 5BNQA 4WZCA 1DGLA 1RJ7A 4NHMA 2IXHA 1R091 3PMEA 2B39A 1JTZX 2VMHA 1C8M3 4KWJA 5KWRA 1FT9A 1LEMA 2BYVE 1POV0 1C4RA 1VBA3 4CYDA 1AR82 4YNIA 2A6VA 2XBO3 3VHOA 1QJU2 3AP9A 3MPPG 1F2NA 4GWNA 1OOPB 2RS12 3ENRA 5C9AB 4JVAA 1ZBE2 3B3QE 3S30A 4O9EA 1LU2A 2YMZA 1VRH1 2PAMA 4D7YA 3D8CA 1TME2 2VMIA 2ZKLA 3RI8A 4IEYA 3ALQA 4GIQA 3WUCA 1W6PB 4ZU7A 4G9SB 1S0JA 5FAXA 2OPKA 2ZAAA 4TSVA 2R061 3H0OA 2X5IB 3MLKA 5JOYA 1SLIA 3IMNA 3WDUA 4I01A 4C90A 3U0ZA 3L2YA 3WW3A 1NA1C 2CV6A 1KITA 1YFWA 4CRQA 3DKWA 3WUDA 1LODA 1TMF2 4LEJA 4RHV1 2QE3A 5K0UB 3WQ1A 1DQ0A 4NWVA 1CR7A 5AVPA 5CFDC 5KXCA 1HRI2 5F9TA 1FX5A 5EYYA 1H8TC 3NV4A 1WCKA 1L3JA 3HWJA 5JOZA 4N7IA 5BY5A 3C2UA 1WA4A 3URFA 2D7FA 5HBAA 4C1XA 3SH3A 1RUOA 4Q0SA 1ZA4A 3VBUC 5DZEA 4BPZA 4HFSA 5E89A 4FOQA 5BV6A 1ASJ2 4H7MA 4HKOA 3ILNA 3O7OA 3H50A 4MGZE 3IKWA 3NL1A 2XJRA 3THPA 1MEC2 2ZGTA 2GMPA 2GC0A 1H9PA 4JAAA 5FLHA 5K7PA 3VBRC 4Y1YA 2ES3A 1KJLA 3TWIA 5JPNB 1C1FA 3AJZA 1RUG2 4YARA 1V6OA 1H2MA 4XHXA 3EBRA 3EJKA 1LOFA 3VDDA 2VOVA 3O0WA 4L97A 1LECA 1ZZ7A 1FOD1 2R041 3LA3A 1NCRC 4MVTA 3SCFA 3WDTA 3ZXEA 3V0AB 3INAA 5I0SA 1D4M1 3WDYA 1YJKA 3TNQA 5B2GB 4EROA 1CAUB 1ND2C 4LE4A 3AYCA 3UKVA 1QJU3 2FBEA 3SCHA 1AR63 1R082 1O3TA 2RS13 3H1MA 2LM3A 3OY8B 2TEPA 3RG0A 1FPN2 3O12A 3VN4A 4LBOA 2HWC1 1V9U1 4AI3A 3DPRB 3IDEA 5DUUA 4FVVA 3WOGA 3PJQA 1ZYBA 3OTFA 3ILFA 2XB6C 1H1MA 1OI6A 1WLTA 2EALA 4JGZB 4KWKA 5AC93 4N43A 1O4YA 2RS31 2CGOA 1QWRA 5FO9B 4W65A 4IL7A 4YVWA 1TMF3 2PQQA 2LALA 4P9IA 1QY4A 4YM1A 3SH4A 1N1TA 1VBD2 3ASIA 2ZX1A 2IXKA 2SBAA 2BFUS 2VG9A 3NWKA 4RS5A 1NCQC 1WGPA 2YXSA 4FBFA 3VBSA 3ZN6A 3LCPA 4LULA 4MSVA 2EXKA 3PHMA 4XFBA 1DBNA 1MQTA 3VKNA 4AVCA 4B3NA 5JSPA 1UCXA 5C33A 5JCTA 1VRH2 3M3OA 1LULA 1X36A 5CNAA 3RNSA 4UBGA 4PCRA 5D8AC 4Q0QA 4P9YA 2O1QA 1RUG3 2R062 1YIPA 2IWGB 5EXOA 4LNVA 2ZAHA 3T1LA 4AGGA 5FPZA 3RPQA 4IEXA 2C0ZA 4ORFA 1IKPA 1JHNA 2RR12 4CDXA 5ACA1 3QCWA 1QH6A 3FFZA 1GR3A 5A32B 4AVVA 5C8CA 4IETA 2DVFA 4XJWA 5IK8A 3VBFC 3N36A 4ZKTB 4AQTA 1JBCA 4LUKA 4LHLA 5T52A 2DCTA 3KT1A 2R49A 1FPN3 3AM2A 3E6BA 1NE4A 4Q1RA 1ULCA 3W9AA 1JH5A 2EVXA 3IPVA 5CAZA 1KS4A 1QQP2 1C5IA 2YUEA 2WT0A 1S0EA 3PVEA 3IDCB 1XYPA 1BBT1 3FMGA 1G9AA 2PN5A 4ASMB 2CWSA 1PHMA 4IEQA 5KHHA 3ZSKA 1LESA 3BCWA 1WLCA 2GMMA 3J4UH 3PTYA 1V6LA 2UWBA 3VDDB 4ISRA 4FPFA 1AYN2 4KWLA 2RM23 1XE7A 4LA3A 1VBD3 2F4PA 1AXZA 1SLTA 3I2DA 2QZ2A 5GZFA 5SV8A 3AXDA 1LGBA 3FLRA 5KHGA 4JDOA 1F9KA 3CEWA 1C5HA 1Z7S1 2R042 3V65A 3LOBA 4AFDA 3LKJA 4RQPC 1AL0G 4AI2A 3RJ2X 4Q0PA 4SLIA 1LGCA 3BOPA 1H8TA 4FXGB 1TEIA 1HRV1 1J3QA 4PIYA 4XFHA 1JN2P 1PGL1 2IZWA 1S55A 1VRH3 2PHWA 3WG2A 1PIV1 1O5UA 4BYYA 2DYCA 3AMQA 4N43B 2E7QA 1Y3TA 1S0IA 2R063 5JSOA 2P34A 4HVOA 2XL7A 4YVWB 1GQHA 2ZHLA 3GALA 5FBZA 1MZEA 1CAXA 2YYOA 3SHRA 4Y1XA 4XF4A 1OOPC 5C9AC 2Y26A 1ND3C 1N3OA 4RHV3 2ZTNA 4HVRA 1DQ1A 1M06G 4NOTA 2D40A 4YM0A 4RFT0 2ILMA 4AVTA 2A73B 3JB8A 1D2SA 5H9RA 4P14A 4YFZA 1AX2A 2X5IC 2WNVB 1NLRA 4AHWA 4H7LA 3AB0A 3NVCA 5CG8A 1CAVB 1FI2A 2ZGUA 4GQ7A 4HT1T 1UU4A 4P9LA 5BNOA 4IV3B 1XNDA 1S2BA 1RUD1 4ATFA 4DOUA 4Y1VA 3ZXGA 3AJYA 2ZGQA 4HK8A 1PNGA 5K0UC 2ZGKA 1AYN3 1AXKA 1K5MA 1H8VA 2RJKA 2RMU1 4HBNA 5BNPA 2GN7A 1ZBA1 1W6QA 3AKPA 4U36A 4CDXB 4AHXA 3JD71 3M1HA 1CVNA 3HBZA 3WDVA 1RINA 4SBVA 1LHOA 4LO6B 2R043 1AX1A 1S1AA 1NY72 3MYXA 4UW3A 1DZTA 1D4M3 2W0XA 1RJ8A 5FQ0A 5ACA2 3RDIA 4FOYA 1LHNA 5BNNA 2OZJA 3ZN4A 5BPXA 3JUUA 1AZDA 5JOXA 4CDUA 2YZ4A 4P9XA 1OD5A 2YV8A 2VU9A 2YHJA 3AKTA 5KHIA 3PJYA 1GZWA 1MR5A 1PK6B 3WLUA 5FLJA 4PLMA 3WHTA 3NV1A 4K1YA 2PLV1 2R16A 3ETQA 1B35A 4WVVA 1HW5A 4MZUA 1NZCA 3KZ4C 1X7NA 1VALA 1OHFA 4ASLA 4FAHA 4R52A 2XBO1 4Q4Y1 2F6BA 1UAIA 2RS33 2W68A 4HK9A 3M4FA 4HSJA 4LBQB 3FC0A 2VGDA 4YW3A 3EXUA 3TNPB 3GBGA 3QLQA 1UKRA 1O4ZA 1NQDA 1NE6A 2QVSB 4M3CF 5SV5A 4XFFA 2GNTA 3B9IA 3KLSA 5BUVA 2LTNA 4FAGA 2XJTA 4FQZA 1H2NA 1Z7S2 2ET7A 5FCCA 4DINB 5I91A 4XF9A 1ZZCA 2QCSB 4DNYA 4JGZC 1YCIA 4LO5B 4OI2A 1Y9QA 1HV1A 1ZVFA 2N7GA 4MH0E 1HRV2 4MGYE 4FTEA 4AEMA 2WT2A 3VBHB 4KU8A 4I02A 3R6SA 1PIV2 4M00A 3QD6A 4FCAA 2QQPA 3R05A 4AEKA 1NLSA 3QACA 1I5ZA 4ES9A 4IEUA 4HMZA 4QQLA 5E16A 3LOIA 4DMIA 4A7KA 3OPZA 5ACA3 1Q43A 2D6PA 2PAEA 3FJSA 4CEYA 4JGYB 3JZVA 3ZSMA 4I0BA 1EP0A 1KXGA 4XFIA 4OI0A 4R9DA 3USUA 2FMYA 2CAVA 2JEMA 3VZKA 4PQ9A 3ZXDA 2ZZJA 3OGGA 3VHRA 5GJ6A 1ZREA 4YGDA 4YVSA 4BZ4A 3VL9A 2ZGPA 1AR81 3WX5A 1K5MB 2ZGOA 4DY5A 2CWMA 1V6IA 4Q8KA 3WCRA 3DGTA 4LT5A 2B45X 2Y38A 4NO4A 3AMMA 3TN92 2VOWA 1ZBE1 1O3QA 2WKKA 2Z69A 1AR91 3BOWA 1TME1 1S0GA 4D69A 4YW5A 2WA4A 5FQ0B 1FNYA 4R4ZA 4LBKA 1OOPA 3JD72 5BNNB 5C9AA 4QXKA 2WLPA 3VKMA 3WY6A 3ZYPA 1SDWA 3D0JA 1Z7S3 4CDUB 3AP7A 4IERA 1HKDA 3NKTA 2ZX3A 1ZRFA 3KD4A 4I2OA 1W6PA 4OI1A 3AP4A 2PYTA 3N7JA 3R4SA 1E57A 1HRV3 3HT1A 1SEFA 1H1AA 1XXNA 1LOFC 1TMF1 3LZZA 3MIGA 3VDDC 4DFSA 1RUF2 4AQ2A 2NMOA 2XHKA 5GLVA 5E1RA 4EWAA 1PIV3 2YGMA 3OF1A 1HRI1 1LKNA 2PLV2 4PJYA 1O4TA 2ZA9A 3AZWA 3E5XA 5KXBA 1O91A 5K0UA 4XQDA 2DCYA 4MGKE 3B9CA 1HX6A 2ZGNA 1YIFA 5FMOS 3ATGA 1EAH1 1WBLA 1YI9A 1R1A2 3QOPA 2JJ6A 1ENQA 1QH7A 1ASJ1 4R9BA 3FLPA 3WP3A 1W0PA 1NXMA 1DDLA 4J1WA 3E5UA 1MEC1 1BCXA 1CGPA 4QGMA 5D1IA 1LOBA 4N43C 1IOAA 4FXKB 3HR9A 4JRLA 3R4UA 2EF6A 2V5YA 1UX6A 2GC3A 4YVWC 4AQSA 1QJY1 4W6YA 4R9AA 2XJPA 3WINE 1POV1 2X29A 2O0OA 3MLLA 1IS6A 3VV1A 2R072 1U5XA 3FLTA 2DVDA 1RUD3 5JAXA 4AVBA 1R081 1S0DA 2JX9A 3AP5A 3QH7A 1PNFA 4AEDB 2XWJB 4XEZA 1BKZA 3U07A 5J98B 3CU7A 4X6RB 2RMU3 5K9YA 4MYEA 1QJZA 3VL8A 1ZBA3 1DU3D 3VZJA 3KQRA 4CDQA 5T5LA 5T5OA 3JD73 4M01A 5I8SA 1YFYA 2WNVC 5CFCA 5A33B 1VBB2 3K48A 5DG2A 3DUIA 3GZUC 3S7IA 1JUHA 3ZFEB 4DB5A 2XUMA 1JYCA 3IIAA 4IV3C 3DPRA 3M3EA 4AFMA 4XMIA 2VW1A 3GZTB 4K20A 3NJZA 1H1IA 1RGSA 2GSYA 3MIBA 4Q4V2 3ZFGB 1F8VA 2V73A 2YY1A 3C3VA 3MI8A 1MS1A 4BIFA 4CDXC 2HWB1 3AYEA 2VULA 2PLV3 2AZ5A 1ZZ8A 5CVRA 4AFBA 5C8CC 1KRIA 4YFWA 4AW7A 3MW2A 4PBPA 3A0KA 4GXLA 2PA7A 4EWDA 4Q4Y3 1CPNA 1LB2A 2C1FA 4AI8A 1S0FA 3ZYGA 4GB31 1YFXA 3RYPA 3QBQA 1AR92 4LR4A 4NHKA 2GN3A 2DVBA 2D5HA 2G9GA 3WP6A 2CAUA 3OJBA 4E2SA 4P9WA 2NN8A 2NQYA 2XPJA 1PK6C 4XFGA 3IM0A 4EN8B 1QOTA 1X82A 5JR7B 2KA3A 1IZ3A 4YGEA 3S0MA 1V6MA 1TNRA 2XLAA 3OD0A 1UPIA 2RR11 3H1WA 3PLQA 4BMEA 2R073 4NPRA 3ZXJA 2A3YA 5HCFA 4CTEA 4H55A 1V70A 4Q8LA 1J1TA 1GKBA 2PHRA 4KGQA 1PO22 4MGIE 4TWTA 1RTVA 5A32A 4FTSA 1GFF2 4META 1QQP1 5AFEA 4KBBA 5I93A 1VBB3 3GYDA 1BJQA 4LO8A 1EAH2 5L7OB 1OLQA 1S2KA 2GU9A 5IK4A 2BEOA 4GWMA 3ZX7A 1GICA 3I8TA 1VLNA 3ACLA 2BGCA 5KHKA 2DVAA 1EV11 4LBMA 3VBHC 3B93A 1J58A 1AYN1 4M0NA 3AFKA 4XF1A 4X8NA 4F7ZA 3POSA 1BQPA 1IS3A 3UL2A 4N53B 1W2UA 4C91A 4CEWB 2CYFA 2Q0AA 2XJVA 1XRUA 1QJY2 3SXWA 4BA6A 1VBE2 3HD8B 5IK5A 1LRHA 3ZXAC 1AR83 1BZWA 1REFA 4OZXA 1JXNA 1Z78A 1RUJ2 1PGW2 4Z92B 4NHLA 4CDQB 1FAYA 1ULDA 2DWRA 2W39A 1ZBE3 2QDRA 3ZFFB 4YLZA 5CFCB 2UWCA 1AR93 1TME3 1ZZ9A 2LUWA 4DXZA 1HLCA 1OFSA 4AEJA 2HEYF 5BNOC 4KL1A 3J8F2 5DZFA 4AVSA 3BB6A 1V00A 2ZX0A 1ALYA 5GLUA 1K5MC 2OZ6A 5BNPC 1HV0A 1G7YA 1U5ZA 5AVAA 4UBHA 4FPGA 4HPKA 4XDQA 5JI9A 4XMAA 3WNXA 4Z8BA 4JRAA 3NAPA 1DGWA 2HWF2 1DZRA 3UKNA 4FSJA 2YROA 2IXJA 3OYWB 1HRI3 2HWB2 2KM2A 5BNNC 1PO23 3WV6A 2H6CA 3IWZA 1H0BA 1VP6A 4GH4B 2ZJCA 5FMOL 3RWNA 4CDUC 3LA2A 2JG8B 1EAH3 1CD3G 5C4WB 1OSGA 4FT8A 1H30A 5JPMB 2BBVA 2WZPP 5GALA 1ASJ3 1TNFA 3FUQA 3OD4A 2WNVA 2WJSA 4GB32 2ZPXA 2QFEA 1B35C 1MEC3 4P9JA 4BWOA 3HQXA 2JE7A 1CAVA 2ZCWA 5CA6A 3N4MA 4IEOA 1XYOA 3DV8A 4IV3A 3NSTA 4PDWB 1DGRA 2IXIA 1RUNA 3JBG2 3ZMNA 2P3IA 3O14A 2WL1A 1RUE1 5J37A 1XE8A 3UKTA 3GNEA 1QJY3 2EAAA 1POV3 1NY71 4JTOA 3G7DA 4Z82A 2BWAA 1R083 4KNC