4HVOA

1.75 angstrom x-ray crystal structure of cufe reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
b'MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 36
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hvoA01
3FHIB 4PIZA 4O9EA 3GBFA 5KHGA 5J7MA 3NSTA 4Q0UA 5FLHA 5EFUA 3HQXA 4AVCA 1YFWA 1NE4A 3ELNA 4LUMA 2OZJA 5I0TA 3PNAA 2XL9A 4QX5A 5I8YA 1O3RA 3IDBB 5I0RA 1ZX5A 3C3VA 5BXXA 3DL3A 4I2OA 2H6BA 3RNSA 1DGRA 2H0VA 4QMAA 1Q5OA 4BH9A 1HW5A 3CF6E 3E6CC 1X8MA 3FFQA 1I6XA 3IIAA 4JV4A 4YYOA 4META 4B29A 5C8WA 4IEZA 3OTFA 4IEOA 4E2QA 5LEKA 3HIFA 4E2SA 4ZU4A 2K9ZA 1CAUB 3SCGA 1CAWA 1SEFA 2GZWA 4HZFA 3CJXA 4QGNA 1NZCA 4WZCA 4AQ2A 3SMHA 2PFWA 1UD1A 1O3TA 4JVAA 1IPJA 2EAAA 4HLTA 3JZVA 2ATFA 4TLFA 4N9IA 5C6CA 5I8TA 4MZUA 4X6RB 3SCHA 2GC0A 2D93A 3FX3A 2CAVA 2IC1A 5KBFA 1OI6A 4XF9A 1UCXA 4HVQA 1TQ5A 3LA3A 1CX4A 2O1QA 4XF0A 4D7TA 2PQQA 4XFAA 3EHKA 4XF3A 2UY8A 3S7IA 2Z69A 3OD0A 2ET7A 4J1WA 2Q30A 2PAKA 1J58A 2UY9A 2MPFA 5JCTA 3QOPA 3RYPA 2H6CA 1ZREA 3LOIA 4LLOA 2BYVE 1RTVA 2N7GA 2ZCWA 4XETA 3PVBB 5EZWA 3I59A 1PMIA 4XEZA 4KWJA 3EBRA 5AVPA 5BV6A 4LA2A 5I93A 3TNQA 2CGPA 3GYDA 4R52A 1ZZ7A 1YFXA 3I59B 2I45A 1YWKA 3CL1A 4AVBA 4L2NA 4XFIA 5I0UA 4BHPA 1RGSA 3SXWA 3I54A 4QGMA 2XKOA 1J1LA 1Q3EA 4LA3A 1L3JA 5JSRA 5LRRA 1J3PA 3E5QA 4HBNA 3O14A 1U12A 4HVRA 2PTMA 1XE7A 4XF4A 5J3UA 4HSLA 1ZNPA 3OGJA 5D1IA 3BU7A 1DZRA 3ETQA 3NW4A 4O9GA 5FDBA 2XHKA 4N9HA 4HMZA 1DGWA 3RPQA 3R6SA 2VECA 3IDCB 2XLAA 5KHHA 1ZZ9A 2XLGA 2D40A 3UKTA 5JAXA 1SFNA 4MGYE 2PA7A 2XL7A 3LWCA 4I09A 3ES4A 3N4MA 5T3NA 5CVRA 2GC3A 2B9UA 4IEPA 4L11A 5KHIA 4ZU5A 1JUHA 2Q1ZB 1QXRA 1RC6A 1QY4A 2KXLA 4I0AA 3LA2A 2OA2A 5JSPA 5FLJA 1O3QA 3VHRA 2XKPA 4Q0PA 4EWDA 1RL3A 3MYXA 1X82A 2O8QA 3NVCA 1WLTA 3ST7A 4IEQA 3BPZA 2GU9A 4XFBA 3ES1A 4YRDA 3U10A 5HI0A 3IWZA 4CYDA 2Q4SA 3E6BA 1ZRRA 4IEVA 5FCCA 4GULA 4QGLA 3USSA 1UIJA 3RYRA 3SHRA 1CAWB 1LR5A 3CEWA 2ZKLA 3KGZA 4RD7A 2HJIA 5CU1A 1Y9QA 4KWKA 3LAGA 4EV0A 1J59A 3H3ZA 3KSCA 4Q0VA 3BCWA 2BEOA 4XFCA 4HN0A 2BNNA 2Z2SB 3HT1A 4R8HA 4MUVA 1CGPA 2CAUA 3H8UA 3EJKA 3WW2A 4FBFA 2XLFA 1VP6A 3H7JA 3HT2A 2IXKA 5FLIA 4KWLA 5F1RA 4MGZE 4PIXA 4IEWA 5K8SA 1J3RA 4MX3A 1UIKA 4F7ZA 4F8AA 4XF1A 3WW1A 2PHDA 2BNOA 2QJVA 4BYYA 1CAVA 3E5XA 2D5HA 5FQ0A 2EA7A 3ACLA 3NJZA 4MGIE 4AXOA 3DKWA 1EY2A 2MHFA 2E9QA 1XRUA 3KCCA 4PJYA 5JR7B 3EQEA 4IEUA 2GH2A 3NL1A 2B5HA 5I0SA 2ETEA 4IESA 2GC1A 5JSOA 1FT9A 4LUKA 3OF1A 2WC2A 4BIFA 4IETA 4P9GA 4WBBA 2FQPA 2OYZA 2B8MA 1GQGA 1ZRDA 2C0ZA 2QDRA 4WVZA 1RUOA 2IXJA 1ZVFA 3PLQA 2QNKA 1CAXA 5KHKA 4QXKA 3MZHA 1O5UA 4FAHA 3FE5A 3WW4A 4UBHA 1O5LA 1Q43A 2DCTA 1QWRA 4QM8A 2ET1A 1NXMA 4HN1A 2Q0AA 5KHJA 1EYBA 5BY5A 3S0MA 2BNMA 1RUNA 3MDPA 1SQ4A 4UBGA 1YHFA 1YFUA 3M70A 1XE8A 4YSFA 1VJ2A 3RDIA 1H1MA 4Q0SA 5J48A 3D0SA 2IXLA 4I01A 1IPKA 1YFYA 4MGKE 2K0GA 4A2UA 3H1YA 1Y3TA 3WW3A 2OPKA 5E16A 4QM9A 1FI2A 2MNGA 4IEXA 5BPXA 2UYBA 1LKNA 1G6NA 3FJSA 3BALA 4EROA 3UKNA 3H3UA 5FPZA 4OFGA 3RZZA 3L2HA 3ROUA 1X7NA 1DZTA 4KL1A 4OLLA 1OFNA 1LRHA 4JTOA 2FMYA 3SCFA 4XFFA 4HVOA 2BGCA 3BB6A 1CAUA 4JTNA 2XGXA 3H9AA 1ZZCA 3H7YA 4LEJA 3CLPA 5CADA 4MV2A 3I7DA 4IERA 2IXCA 2V09A 1YLLA 3IBMA 2OZ6A 1O7FA 2PHLA 2VQAA 2D5FA 5I91A 3LA7A 1PM7A 1YUDA 3OCPA 4KU8A 1QXJA 1ZZ8A 4LTAA 2QCSB 4FAGA 2F4PA 4NVPA 2Y0OA 4Z07A 4PIYA 4J1XA 4YNIA 4I0BA 3U11A 4ONUA 3FWEA 4ZU7A 5I8SA 2PAMA 1WA4A 2EVXA 3E5UA 3D0JA 3H50A 5LRSA 4XFGA 4K8FA 1ZZBA 2PYTA 4ORFA 5FPXA 2IXHA 3FZ3A 4IEYA 2QVSB 3H1WA 3KGLA 2GC2A 3QACA 4FT8A 5BUVA 2PAEA 3E6DA 3NKTA 1LB2A 4HSJA 3LZZA 1ZZ6A 1I5ZA 1UW8A 2CV6A 4KU7A 2WFPA 2GAUA 4UXAA 3UKVA 4I02A 1GQHA 4D7SA 2HKXA 4H7LA 1ZRFA 2VPVA 4Q29A 3KMHA 4Q0QA 1EPZA 1OMIA 1ZRCA 3D82A 1V70A 1O3SA 3S7EA 1CAVB 3ZDSA 3RYKA 5FQ0B 4AQ6A 1OD5A 3DV8A 1J3QA 1NYWA 4XFHA 1FXZA 4EWEA 2IXIA 3G7DA 3TNPB 3H1MA 3EO6A 3M3IA 4YARA 3MPBA 2UYAA 3U0ZA 1WGPA 1X8EA 4EWAA 4E2GA 4LULA 2P17A 5E1RA 3E97A 1CAXB 1UPIA 1NE6A 3DN7A 5LEJA 4MH0E 4I3PA 4X6QB 3B02A 4DINB 1VR3A 1EP0A 4Z82A 1H1IA 1O4TA 4AVAA 3CO2A
chains in the Genus database with same CATH superfamily
3KZ4C 3R4DB 1ZRIA 4CTEA 3ZN6A 1MEC2 1ND2A 5A7WA 2VXRA 3UGGA 2OQ7A 3HAGA 5DUWA 1F35A 2QZ2A 3POYA 5FWEA 5A6XA 1PK6A 4LBQA 4AFCA 4D94A 3HMYA 5LW9A 2CYFA 1K42A 3IB3A 1LOFC 1TME1 1V6KA 1W6NB 1IKPA 2ARXA 2BWAA 2GSYA 1FNYA 5CA6A 5FZGA 2HWF2 2YGLA 2DF7A 2RS11 2JD9A 3O1OA 2FDIA 4BK4A 1JUIA 3PNAA 3FL7A 4N43B 1O3RA 2A3XA 1SBFA 3D3AA 2Q5TA 1FPN1 2LTNA 3VDBA 3K2OA 1HRV2 3T30A 3IDBB 1QJY1 5I0RA 2W94A 4Y5SA 2OIIA 2H6BA 5FRAA 1DGRA 1AL23 4BXSV 3PTRB 1HW5A 4P9WA 3FFQA 4RYDA 4Z2WA 3J8F2 1WLWA 1UNBA 4META 4YZ5A 1SLTA 2CSGA 3ZXEA 1H8TC 4IEZA 4HETA 3I2GA 3JB4C 4XQWA 4CCNA 2CU5A 5LEKA 1C8M2 4E2QA 4AGVA 1HRI1 3CQOA 4HPKA 4P9IA 2YBKA 3AP5A 3BIWE 3HIFA 1RUJ3 5ACA1 2LALA 5HCAA 2W46A 5CNAA 5IVJA 5JZGB 1CAUB 1SEFA 2WIIB 1C8NA 1JS9A 5IAVA 3SMHA 1AF9A 1UY1A 2AZ5A 3MF9A 4YVSA 1QEXA 4AI3A 4LO5B 2PMWB 5IFPA 2XJPA 2JX9A 5D2AA 1YQ6A 3KB5A 1IPJA 1WUVA 4XZUG 3ZFGA 3N9NA 1GV9A 2VNRA 3PUIA 1JYTA 3H8XA 2ZMNA 1SCRA 2RM23 2HH9A 4YW1A 3W58A 4MZUA 2E7TA 4INDA 3ACFA 3MBWA 5CFCC 5IHRA 2D93A 1L7LA 5BNPC 1C1LA 1ENXA 2ADDA 3RVHA 5IVFA 4LO7A 2AEYA 2XJVA 5FZOB 2ZS6B 4XF9A 5DUUA 1UCXA 1TQ5A 1LNSA 3AVRA 3LA3A 3ILRA 1OOPA 5LA2A 2PQQA 3PURA 4XFAA 2DUOA 3EHKA 1G86A 4BJ0A 2PHXA 5LATA 5GZDA 3WG1A 4Q4V2 4AEJA 3OD0A 2Q30A 3FBMA 4CCDA 4W6XA 4CXXA 4E8CA 4XC9A 1PK6C 3ZMOA 4ES8A 2PAKA 2BBAA 2WO1A 4JGZB 2VUAA 2UY9A 2WFF2 2WSUA 3J7MA 3AMQA 4LBLA 4UFHA 1WW6A 1RHI2 2H6CA 2Y6HA 2FZ2A 2BYVE 4OHZA 5DG2A 4XQ4A 2ZCWA 1QH6A 4XETA 3KCYA 4AFAA 1YI9A 5DDJ3 2A75A 3NNMA 2OXBA 5J96B 3GZAA 4YG3A 4GMP3 1S0JA 2VCBA 4D7YA 4Q1PA 4QT6A 4QQOA 2PHRA 1PMIA 2QUOA 4CDWC 2VD7A 1BBT3 4LOSA 3Q8FA 3QH6A 5JIUA 2FDHA 4KWJA 2DBIA 2RS33 1VBC2 3NWKA 1DGLA 4CEYB 1BXHA 3I8TA 3M8LA 4M3CE 4U36A 3S6PA 4GMP0 3TEZA 1W9WA 4JKKA 2HWC2 2A3WA 1BEV1 4LXLA 5BV6A 5IK4A 5CG8A 5A33A 3CJIA 4FFFA 2ZXQA 3AP9A 2BPA2 4R52A 3PIGA 1W6PB 2W91A 3D6EA 5I0UA 2W47A 2RDSA 2XB6C 1PO21 3ALQA 4EN9B 1HDKA 1SACA 2Y0IA 5F2WA 5FZMA 2P4EA 3WDTA 2FD8A 2YC0A 5BNOB 2W68A 5T55A 1DQ5A 1TMF3 1Q3EA 2VW1A 1AR63 1L3JA 3E5QA 1AXKA 2ZGTA 4HBNA 2PHWA 3O14A 4GB33 4Q8LA 4YVSC 5LBFA 3WR0A 1J1TA 4HVRA 4KH9A 3ATGA 3SEPA 1OUSA 2RDRA 4Q27A 5J3UA 2DCKA 2R043 3C7OA 2WQ8A 3OGJA 2JEMA 2Y8KA 4XUQA 5D1IA 5DZGA 3LEIA 2RMU1 1W8WA 4YGBA 1AYN3 2JWPA 3B9CA 4S2GA 3OD4A 2NYYA 3ETQA 3F2ZA 4M3CA 4XDQA 4XXAA 2WNEA 1VRH3 3FLTA 4O9GA 3AXEA 5FDBA 5FUIA 2XHKA 2GNDA 1F4AA 4HMZA 5DN2A 4C91A 1YNAA 4FOQA 3HWJA 3OB8A 4NIGA 3R6SA 4MADA 1FATA 1NCQA 3VGIA 1VB2A 2WS93 4XUNA 1SPPB 2QDNA 2XLGA 1YRZA 2Y38A 2V4AA 2XL7A 2KM2A 2WUHA 3G6JB 1JOJA 2E7AA 1YO8A 3NNGA 3MGUA 2GNTA 3POFA 3ES4A 5C33A 3RZMA 5T3NA 3NNLA 4PLNA 4K1ZA 1CVNA 4M00A 2NP0A 4NIDA 5A3NA 4Y26A 4Y1ZA 4RGAA 3RS6A 3DPRB 4LKSA 4XACA 1QHDA 2WA3A 4ZU5A 3M2MA 1JUHA 2Q1ZB 2GALA 1IS4A 3PDQA 2KXLA 4I0AA 5FZIA 2JKXA 5JSPA 4E4ZA 3BUCA 4BWOA 3MW4A 2XKPA 5M0TA 1D4M3 1RL3A 5FY8A 4C8DA 1QOTA 2HWE1 1O8SA 4AR2A 4IEQA 1Q8SA 2VMFA 3VZMA 4A7KA 1YQCA 2ERFA 4HT1T 1FV3A 4YRDA 4E4HA 4S2FA 1GYKA 1W0PA 3WD5A 1NA1B 1YYNA 3PVNA 1QJX2 1NCRA 2B45X 1REDA 2VCMA 3POIA 4LK6A 5D21A 1NX9A 1T6GC 2BQPA 5FCCA 4NPRA 4QGLA 1JW6A 3RYRA 1APNA 2GNBA 4P14A 4XURA 3CEWA 4LBMA 3T0AA 1W2TA 1TG7A 4Q4Y1 4BOWA 4KWKA 3LFIA 1QQP3 2Y6LA 3UESA 1B09A 1GICA 1ZBE3 1OF3A 3CO2A 1UYXA 1P8JA 2WO7A 3OGRA 4BIOA 4AVSA 3BVCA 5F3IA 1PGW1 3BOPA 2EXJA 1QNYA 2BEOA 2P3YA 3NO8A 3VHOA 3AM2A 3ZXFA 4AF9A 3ZN4A 4GJYA 1IQAA 2VQUA 1VAKA 5A3LA 2HWF1 3AYAA 4R8HA 1JU4A 4MUVA 1VPHA 1COV2 4J6GA 1DIWA 3H8UA 2ZACA 3EJKA 1W6QA 4MGSA 1S0CA 1PO11 5C4WC 1HRV1 1ASJ1 3RWNA 5DAPA 2RHPA 1W2AX 1H9PA 1KDMA 2VZRA 1R64A 4BISA 5FLIA 1ODMA 3PVOA 4KWLA 5F1RA 5FZ1A 1G9AA 4PIXA 5K8SA 5LWBA 5LK7B 5DXDA 1AR93 4EQVA 5T54A 1Y7BA 2DCYA 3T1MA 2FBEA 4F8AA 5LBBA 1W8FA 2PHDA 3FMGA 4WVWA 2BNOA 4D6QA 3GALA 2QJVA 2ZGUA 4Y3OA 1JYXA 3O1VA 1D7PM 3QD6A 2EA7A 3NJZA 1HQWA 1IGOA 4H7MA 4Y33A 5BNQA 3DKWA 2MHFA 2E9QA 3O0WA 2YC4A 3R4UA 4UW6A 4XTPA 3UK9A 5JR7B 1R093 3T2QA 3R4SA 5FYMA 5IAXA 2WT1A 5I0SA 4MG2A 2W08A 1HN0A 1RUD3 2GC1A 3VV1A 3O1SA 4LK7A 3VZKA 4UT5A 1WLDA 2R32A 1FOD3 3GBGA 1UX7A 1VB4A 2OYZA 4CXWA 2HWD2 4ISRA 2GMPA 2RR11 1BK1A 2WN3A 4LITA 1RUOA 2ZOEB 2QNKA 2AACA 2BRTA 1AR71 3POBA 2VE1A 4QXKA 5KHKA 3S57A 4EZ4A 3RQ0A 3SKJE 4Q4V3 1O5UA 3MZHA 2LRPA 4LO8A 3THPA 5LY2A 4JDOA 4LT5A 2WFF3 2WT0A 3FLRA 3C7GA 2J7MA 2WO3A 3O12A 5F8PA 3VKNA 1NLSA 4HN1A 4EJRA 4FQ4A 2AENA 5CFCB 4MHRA 1ONAA 1CIYA 1Z7S2 3S5QA 4DS0A 3APBA 2WZR3 2XJQA 2EXIA 1X50A 4JGYC 3Q9OA 1H1MA 2R062 2XWJB 4Q0SA 1FMD1 3M3EA 4XBNA 4MXVA 1VBB2 4AI8A 3WOGA 5DAWA 4LLFA 1RHI1 2RVAA 3PIJA 4DXRA 2DU0A 1QKQA 4MGKE 2V5YA 2K0GA 4FPHA 5FYTA 5DUXA 1VLNA 2JECA 2HWC3 1FNZA 3AZXA 4N43A 3WW3A 4AG4A 4DUWA 3C8XA 2RS53 5FJKA 3JCIA 1DDLA 1KS5A 3VHNA 1VBD3 1MS0A 5EJ1B 5B2GB 2Y26A 2ARCA 2RJLA 1IHMA 1VBC1 2BVVA 1OUXA 3BALA 1QOSA 1QDOA 3UKNA 1RMU2 3VBOB 4ES9A 2D6NA 4IGPA 4LIUA 4NIAA 4FTEA 1O4YA 2HYKA 3L9JT 4YGCA 3RZZA 4CDWB 4Y5TA 3AKPA 1PGL1 2C5DA 1X7NA 1SCSA 1H2LA 2BDRA 4OLLA 4LBKA 3J7HA 1GOHA 3WDVA 2J1EA 1O59A 4JTOA 3IMMA 5C5TA 4Q4W2 3K51A 3ZDVA 5JZGA 1AR83 3AP6A 1ZBA3 3SLIA 2BGCA 1CAUA 4GAZA 4YPJA 2H0BA 1UO9A 3A7QA 4XJ9A 1ZZCA 4W6YA 1AYM3 1IS5A 4GA9A 1VMJA 2FDJA 4QX1A 5CADA 4PF5A 3EYPA 1RINA 3O7OA 4CU9A 4EN7B 1N3OA 1KFXL 1RIRA 4LMFA 5FAXA 3IBMA 1KQRA 1CONA 1LENA 1O7FA 1NG0A 3LIHA 3WP4A 3WHTA 2VQAA 4BQYA 2Y6GA 5LASA 1UF2C 1RUI2 3QCWA 3U78A 4NIHA 2QCSB 4DEVA 2Y0OA 4Z07A 3T2OA 5FZOA 3WF0A 2B46X 4YG0A 4J1XA 1W28A 3D5OA 4YNIA 4I0BA 2LROA 4FOVA 5FV3A 1W8HA 4TWTA 4ONUA 3JU9A 4GALA 4HKWA 2QQMA 4CCLA 2PAMA 5FP9A 1ZM1A 1WBFA 4XMIA 1WW7A 3D0JA 4V1PA 3WF2A 3ZSKA 3H50A 3T4HB 1UXXX 5AC93 3F95A 2JENA 5CEHA 4JGZA 4H55A 2WNVB 4I3GA 2PYTA 4CEWB 1BMV1 2ZAHA 4HKOA 1S0IA 2ZHKA 5FPXA 2XJUA 2IXHA 1REFA 3FZ3A 3WXPA 3MICA 3NV1A 4FI9A 4KG8A 5H9PA 4AHZA 1XNKA 2W95A 3H1WA 2B7YA 3KS7A 4FOYA 4K7JA 3TN92 4QX8A 4OI1A 1DQ2A 3J9SA 3WNPA 3LIGA 1RUE2 1LHUA 1AXZA 1LJ7A 1QJU3 5J98B 4OMCA 4FQZA 4AHYA 5A1LA 1F4HA 4DQAA 5A6YA 1ZZ6A 1I5ZA 5B4XA 4CEYA 3RZGA 1W0NA 2GAUA 2EF6A 4M4RA 5JIAA 5FXWA 1QU0A 4D7SA 2YMZA 2RV9A 2VPVA 4LOTA 4NWVA 1W6PA 1K3IA 3K77A 1OMIA 1XJAA 3ZYBA 4WZFA 3AJYA 1W6MB 3S7EA 5FK8A 5IVBA 2IVJA 3NJYA 1VBA1 2CGOA 5JZGC 4QX7A 5BNOA 4BQ4A 5IVVA 1LESA 2ZZJA 4B4PA 1J3QA 5F3CA 4NR1A 2JDMA 1IS6A 1GNYA 3E1F1 3G7DA 3TNPB 5FOJB 1UU5A 3BI3A 1AL22 2NZ9A 3MW2A 3INAA 2GN3A 4YARA 3UNPA 5FKBA 5FZ3A 3TAYA 2C9KA 3VL9A 4BQ5A 4GWIA 5ABJB 2D97A 2ZX4A 2XBO2 2VBDA 4CDXA 1DGWX 1S0BA 3R0RA 4AGRA 5T5PA 3CMGA 5EYXA 4EWAA 4LPLA 3HPNA 4LULA 1S0EA 2P17A 4KQ7A 3BYWA 2VXJA 4QWNA 3ZR6A 4COZA 4CU7A 1RVF3 1UZ0A 3RRDA 3MUY1 2BZDA 1RUJ2 5AFEA 3ZPYA 1BZWA 3B02A 1COV1 2QQLA 4LHKA 3KV5A 4O7XA 1PZ7A 3AP7A 3ZYRA 2ZGMA 1V0AA 3ZYIB 2VCCA 1RUH3 4Q2FA 5AVAA 4Q26A 5CAZA 3URFA 1SPPA 3RZJA 1XXNA 5JLVA 1XB9A 5FPVA 2AC1A 1R081 1EV13 1UU6A 2ENRA 1ENRA 1A78A 4L0PA 4PDWA 2NN8A 4HFSA 3U14A 1V6MA 1YI7A 3JUUA 3WVJA 3GBFA 3KVBA 5FYIA 1S0GA 4B1MA 5J7MA 4Q4X1 2RM22 4COWA 5KHGA 1W2UA 3NSTA 2XHNA 1E5SA 4Q0UA 5FLHA 1QJZA 5JXIA 4PI2A 2YB7A 3HQXA 2OQ6A 4AVCA 1V6IA 1WLCA 3NKGA 1W06A 1NE4A 3ELNA 4LUMA 4Q5OA 4QB2A 5JPNB 1GLHA 5I0TA 5A3OA 4NJ4A 5IT6A 5HV4A 5GALA 5FKCA 2XVKA 4IV3C 4ZY9A 4XUOA 1UXZA 3DL3A 4CEYC 3I49A 4XYXA 4Z8BA 3CBNA 3I4IA 1PGSA 3HQRA 3CF6E 4BPZA 2XJTA 3N9QA 5ANNA 3WQ7A 1QXPA 3K48A 1LCLA 2P6HA 1Y9GA 3WDUA 4GIQA 4ASLA 4B29A 2VG9A 5L7OC 3VD7A 5E8AA 5C8WA 5LCWL 1YIPA 1BKZA 1MZFA 1NZIA 1WMDA 3OGSA 5IVEA 4PF1A 1KJRA 3WT3A 3K3NA 3RZHA 4HXCA 2YC2A 3SH3A 1JBCA 5BNOC 1BBT2 4JC1A 4JRLA 3SCGA 1VBB3 2GZWA 3BU0A 2RS32 3POWA 3WZ1A 2ZA9A 1CPNA 1LGCA 2PFWA 5FP8A 3ILNA 3MIDA 2DUPA 2JDUA 5FZKA 3WLUA 1HXS2 4DFSA 4HLTA 4A4AA 3N35A 4A7YA 2D3SA 3JZVA 3M3OA 4TLFA 2R061 2YDEA 1WZXA 3K75B 4FPGA 4F83A 1BYHA 1U0AA 5G05L 3JQXA 1H6XA 3MF6A 4QHBA 1LULA 3MFAA 1AHSA 3VD4A 3FX3A 4L9BA 1R1A1 1CPMA 2CAVA 2IC1A 1C1FA 1OI6A 1EAH3 1TMF2 3FLPA 4JGYB 4ASKA 4HVQA 5KBFA 1AR62 4XF0A 4BZ4A 4GB32 4YM1A 1RITA 3OOXA 3MIHA 1MS1A 1G8WA 1GANA 2X53S 3IT8A 2ET7A 5HCBA 3VLBB 2VZUA 4C0HA 1AYN2 1A6CA 2MPFA 4RHV2 1UZVA 5JCTA 1HV0A 2OT7A 3LOIA 3POGA 1VRH2 4LKEA 4DXSA 1XNTA 1RTVA 2N7GA 2PLV3 2XJSA 2ZABA 5GKAC 3B3QE 4PBOA 1NAEA 3DPRC 1JZ8A 2ZJCA 2ZTNA 4QKDA 3DF0A 1WW4A 1H8TA 4CDUC 4CU8A 1XU2A 2JD4A 4AVTA 3C2UA 5IYYA 1Y4WA 2YPDA 5DZEA 5A70A 2CTVA 2P34A 5FXXA 3MEPA 4EN6B 3LE0A 3ILFA 1SDDB 3O0VA 3I97A 2A6XA 2AH2A 4LA2A 1DLLA 5ERLA 2OW4A 2BU9A 1GNHA 3BIEA 1OKQA 3I59B 5JOZA 1YWKA 1WCQA 2QQNA 2UWBA 1NA1C 1CIWA 1RUI1 4UF0B 3VDCA 3I54A 2EXKA 4Z1VA 4GWNA 1J1LA 1NY71 2VBPA 2IUWA 4G9SB 1PVC3 1J3PA 1QJEA 2MEV1 4MOAA 1HIXA 1T6BX 2JKBA 4Y1YA 5CFCA 1UKRA 1D4M2 1PIV3 1XNAA 1UYZA 3D8CA 1PZ9A 4AE2A 1U5XA 1Y9MA 1GSLA 2DU1A 3HNYM 4AVVA 1W99A 4N53B 4RS5B 1RUE3 1BJQA 2K46A 1RXFA 3BU7A 4XOGA 4XJWA 4HANA 2A6YA 2VY0A 4CZSA 4G3YC 2A1XA 1GP5A 2VJXA 1GQPA 1PNFA 5J09A 1MVQA 1NQJA 5FYBA 1OVPA 4ARXA 4TSVA 4HONA 4NRQA 4DUVA 1UY2A 2XLAA 2HLEA 3WEZA 1H8VA 5A7NA 1GZCA 5IK5A 1QQP2 1XSRA 4XJUA 1C3HA 4Y24A 4UFMA 3LSDA 2Z5WA 3UKTA 2DVAA 1ZBE2 4KGQA 3WY6A 1TME3 3SQOA 4I09A 4CDWA 1LU2A 1H2KA 3QH7A 2Y6FA 3IAPA 4P9XA 2RS13 5E89A 2DDUA 4JDMA 2D3PA 4CP0A 4ZZ8A 1V00A 4YFZA 4OUSA 3VD9A 1DYKA 5CVRA 1LHWA 2WABA 3B5LB 4EN0A 3VZNA 2GC3A 3KT7A 3AYEA 3ABZA 3FHQA 2E33A 4KWUA 3O1RA 2XBO3 5HXMA 2BTVC 1XNDA 2VMEA 1RUG1 2Y64A 4IE0A 1NLQA 5DPNA 3BTAA 1BVVA 1RC6A 2WLPA 3WG2A 3LKJA 1YXWA 3LA2A 4YZ3A 4DO0A 1H6YA 1W9YA 1AL21 3ZFEB 1O3QA 1U5IA 5F39A 5A3WA 5FXZA 1AR92 4Q0PA 3J26N 3VKFC 3VZJA 1RUC1 3NVCA 3S30A 1HRI3 1V6JA 2VTXJ 2XUMA 1MPXA 5IW0A 3RFRA 1SLAA 4C1WA 1HB4A 3AKQA 3ZSJA 1DGRN 2W1SA 3BPZA 5T50A 5ACA3 4XZPA 5CIRA 1E5HA 5HCFA 3U10A 5HI0A 3GZUC 1CD3G 2TEPA 4LBOA 4CYDA 4ZONA 3UETA 1W2NA 5FTTC 1RUJ1 3AKSA 1NXD1 5BYNA 2JG8B 5CKQA 1ZRRA 1R092 4PLOA 4GULA 3FFZA 3MV11 3ZKUA 3SHRA 1CAWB 1LR5A 4EZHA 3I3QA 1RUD2 2IFWA 3VBRB 1YJLA 5A7SA 1FOD2 1SLIA 1OLME 3B93A 1OH3A 3LAGA 3LCPA 4K3UA 2QQJA 4P9YA 4YZ2A 3BTXA 3LOBA 3UL2A 4RA0A 2WSVA 2WNVA 2YPJA 1QOOA 1AUYA 4JHZA 4CEWA 2CWMA 4Q0VA 1CESA 1F5JA 4DRRA 1SLBA 3BCWA 4OZOA 1RUF1 3GBWA 4XFCA 5CZKA 4AW7A 4HN0A 4B3NA 2Z2SB 1QIQA 2IFRA 1L7RA 3IPVB 4XHXA 2FDFA 1CGPA 2CAUA 3WW2A 4FBFA 2QQVA 3V0BB 2JB4A 3W9AA 4YVWB 3P3PA 4TZDA 4N7IA 3RWKX 5FWJA 1E5IA 3AMHA 4DEQA 2YFZA 1ZA7A 3UJOA 1RJ8A 3VBOC 3VN4A 2WZR2 3NV4A 4TLGA 3WV6A 2VQTA 4GD4A 2G1MA 3ZOIA 1N1YA 4EYUA 5JMOA 1Q56A 4F7ZA 4IV3B 1KDKA 2RDQA 3AFKA 2FHRA 4CU6A 3H0OA 2PHTA 4BLIA 2VOWA 5FYZA 3A21A 5IUQA 3FC0A 1W6MA 2A6VA 4UI9L 1OLMA 2J1VA 2ZX2A 2VZQA 4AAPA 2W1QA 5DDJ1 4LE4A 3RI9A 4B8EA 3O1PA 2FCUA 2RS52 1HXS3 2E6VA 4GMP1 4P00B 1EY2A 4XAAA 5DABA 2ZGRA 3AZVA 2VH9A 5L7OB 1VBD2 1BEV3 4IEUA 1K12A 2JDZA 3NL1A 4JRAA 4M0NA 5FMDA 2B5HA 4C0BA 1DQ4A 4ET7A 1LHOA 4IESA 4YLZA 1POQA 5ABJA 2A73B 2HWB3 1Q8OA 4HG6B 5JDBA 1LOCA 2FQPA 4WBBA 1PO23 4R4ZA 2D6LX 1CR7A 2Y34A 4IE4A 2IXJA 1ZVFA 3JBG1 2R6QA 4QHZA 1MS9A 4K20A 4A45A 1ST8A 4ITCA 2NPIA 4UBHA 5EWSA 1AR82 1W39A 1ZBA2 5FJHA 3RSJA 2DCJA 3VBSB 1T2XA 4JZRA 1O8PA 3ZO0B 1F5FA 4RHV3 1AYM2 2DCTA 2DVFA 2Z42A 5EIYB 1CWPA 4DIQA 4RR3B 2Q0AA 1ZA4A 3OPWA 3POEA 5FPBA 2C24A 5FYYA 2TNFA 5BY5A 2ZGKA 2BNMA 4P02B 4XABA 5CG9A 2PHUA 1SBDA 2R041 3LEKA 4XBQA 4JAAA 1YHFA 2W92A 3WINE 2V5DA 2OUJA 2WNVC 1VJ2A 2D6PA 2V4VA 3OGVA 3RDIA 2GP5A 1SHWB 4CEWC 2YYOA 1SFPA 3D0SA 4I01A 3BODA 1YFYA 3POSA 3JD71 3WP5A 4NHXA 5JMCA 5KXCA 4A2UA 2VBBA 1A8MA 1MR5A 1UN1A 3H1YA 1Y3TA 3X29B 2OPKA 3I2IA 1JZ4A 2W2IA 1AX1A 2ARBA 1TEIA 1FI2A 1LHVA 2MNGA 2X5IC 4XAEA 5FREA 2UYBA 2WS91 4K6BA 2OKXA 1G6NA 3FJSA 5A3MA 1DHKB 4KBZA 5AC92 5FOBB 1OA4A 2C9AA 1JI6A 5FPZA 4COYA 4OFGA 3LDRA 3Q8CA 3DECA 4FP3A 4CDUB 5A32B 2HYXA 2DUQA 5L9RA 4IL7A 2WO2A 3AMMA 3ACGA 4RN5A 3ROUA 3Q8BA 3ZPOA 2A70A 2TUNA 4KL1A 5FPAA 5FR3A 2W1UA 3VB9A 1QJU2 4HVOA 4W50A 1W0OA 4AZZA 5I0DA 2QTWB 2XGXA 3H9AA 2ORZA 1VMHA 3GZEA 3VL8A 4RFT0 2D44A 3CLPA 3J7LA 5APAA 1AJOA 4CDQC 3I7DA 1D4M1 5F5IA 5ABJC 4N8MA 2FDKA 1POV3 2IXCA 2V09A 1XYPA 1YLLA 2WZ8A 3C7FA 4L92A 2AREA 3IKWA 5GLVA 3ZYHA 2WZPP 3T3YA 3ACHA 3VHPA 4KU8A 1MEC1 4R9AA 1OFSA 1PNGA 1ZZ8A 3ZXKA 1POV0 2FZ1A 4CPBA 3HOBA 3Q8EA 4JGYA 2X10A 1QGLA 1SG3A 4Q4Y3 4OUMA 3VUOA 2HEYF 2Q1MA 2W39A 4DNYA 3FWEA 4H3WA 4QX0A 3HNMA 4V2VA 5GJ6A 3E5UA 3IM0A 2VM9A 1DBNA 2JG9B 4R9CA 4XFGA 1H0BA 5FZ7A 3RMXA 2P5BA 3CIHA 4MXWB 4CUBA 1AZDA 5IFTA 1GZWB 3TEWA 3H8RA 4QDQA 4ORFA 1RVF2 2EIBA 5JOXA 1FV2A 3B01A 1DF0A 1PO13 4IE7A 5GZCA 3VKMA 2QVSB 1NKGA 2BERA 2R0FA 3J8F1 4RFRB 5B4NA 1JYVA 4BQXA 1NQDA 3SEEA 1CX1A 4GXLA 4KMQA 4CP9B 5BUVA 5CFDB 3KF5A 4LO6B 1RUH2 4HSJA 4I30A 1V9U3 2VMDA 3LZZA 1C8M1 1YEWA 1EV12 4DY5A 3I3MA 4NN0A 5L36A 1GQHA 3A4UA 2HKXA 3QBQA 3V56A 3ZXJA 3VBUC 3VZOA 4OI2A 5LB6A 1JODA 2VVEA 5C9AB 4QQLA 1JZ6A 1Y43B 2VMIA 3NV3A 4HK9A 3KHCA 1ZRCA 2JDNA 3GHNA 1UOBA 1H4HA 3RMYA 3D82A 1V70A 1OXCA 2QE3A 2Y6KA 5IK7A 3LDBA 2ZGQA 5FMOL 4Y4YA 4UF0A 3UJQA 4UYBA 5FYSA 5T5OA 1W6OB 5FQ0B 1MS3A 1NLRA 4A41A 1WW5A 3BGAA 3WUCA 1S4CA 2RJKA 4RSUA 4ZXKA 3K3OA 4XPVA 1UMHA 3AKTA 2R073 1VBE3 2R30A 4FCAA 1AR73 4N53A 3OUIA 4RS5A 2X09A 1J84A 1OQEA 1S2KA 2XUEA 1K45A 4E2GA 4ZXEA 2TBVA 3SISA 1OD3A 4CCEA 1H2NA 4Q4V1 1UPIA 1NE6A 2DVBA 2YU2A 1G9BA 1SMVA 1M06G 2QQOA 2VZTA 4XHBA 4XMAA 2E53A 2KR2A 3AYDA 3AVSA 4YZ4A 2WFF1 4QXHA 5IJRA 1W6NA 3PVEA 1W8ZA 2GH8A 1H1IA 1O4TA 3RZKA 5JXHA 4NRPA 1OC1A 2VW2A 1B35B 5FZDA 2NM1A 4Y1XA 3WDXA 1FMD3 3KV9A 5IWFA 1FX5A 1LODA 3SC7X 3O1UA 3FHIB 3K46A 5LZ6A 3KWVA 2DBNA 4O9EA 4R9DA 4D3WA 1PM4A 1I1EA 1N1TA 2J1AA 5H9QA 5EFUA 1DQ1A 4PT6A 4K21A 3M4FA 5E88A 1YFWA 2HWC1 1EAH2 1YC61 2CHHA 2OZJA 2RS51 1IZ3A 2XL9A 1D0HA 1VAMA 1ND2B 3DUIA 4L99A 4QX5A 4QXBA 4ZS3A 3LEGA 5JI9A 2C6SA 4YGEA 2NLRA 3Q8AA 4S2DA 4FPKA 3C3VA 5BXXA 2XPJA 2CY6A 5CBLA 3PMEA 1MZ5A 4I2OA 2VR4A 5F37A 1BQPA 2H0VA 1Q5OA 4D69A 5FZ6A 2BUKA 1G9FA 1CJPA 3HEIA 3E6CC 1I6XA 3IIAA 1I5PA 1OLRA 2QBXA 3K4ZA 4YW4A 4YYOA 2DTWA 1IKQA 3WNNA 3WNMA 3TRSB 5A3PA 5F5AA 5ISLA 2VOVA 4KBBA 3T2TA 2PLV2 3P3NA 3B00A 2BV4A 3FUOA 3OTFA 4FPJA 4UW4A 2SBAA 3GZTB 2XWBB 1ZBA1 4E2SA 2DV9A 2CDOA 1CAWA 3CJXA 1OPOA 1DG6A 2VQ0A 5F2SA 2QQUA 3VBRA 3LD8A 1YQ5A 1UD1A 3HBKA 1KRIA 3J4UH 3N36A 4XJAA 1O3TA 4QPGC 4N53C 4M4PA 4RS5C 3DKQA 1GWMA 1YIFA 4AHXA 3TYJA 3VD3A 4H2AA 2I07B 3HJRA 1ULEA 2JDPA 4AYUA 1U5YA 3SH5A 2WNUC 5C6CA 5I8TA 5KC5A 3SCHA 5H9SA 2GC0A 3OUHA 3OPTA 3WQ0A 1FYUA 3BN6A 1LU1A 4U2AA 1PMJX 1LGBA 2J1RA 3N9LA 1CZVA 2VO5A 2ZMLA 3IPVA 4DOUA 1PVC2 3V0BA 5GM0A 1LEMA 3IDAA 4YVWA 1RJ7A 4AHWA 1UQXA 1N1SA 4F3JA 1PIV2 1OHFA 2UY8A 4OULA 3S7IA 3PMSA 4XCAA 2XVGA 2D6KA 5AC91 4J1WA 2J1TA 2X5IB 4IGQA 3OJBA 4IV3A 4GJZA 1J58A 1ND3C 1US3A 2C1FA 1UY4A 3QOPA 3RYPA 3O0XA 4NHKA 1K5JA 1LTEA 5CYYA 3ZMNA 3FUQA 1UOJA 4CXYA 5EZWA 4YFWA 2VMCA 4UAPA 5L7OA 3ZYFA 5FP7A 3LEMA 1RYYA 4Q1RA 3I2DA 4XE9A 1HV1A 4W65A 4XEZA 2BOJA 4ARYA 4YGDA 3ZFEC 1W03A 1TME2 1QJX1 4IDZA 3OBZA 3N3HA 4W8JA 3ASIA 2A71A 2RS12 4LBNA 3BTZA 4A7ZA 2BGOA 3TNQA 5IVCA 2DCZA 4N7UA 1ZZ7A 1YFXA 2I45A 3CL1A 1E5RA 4QD2A 4AVBA 4CDQB 4OCTA 2O8OA 5DQ0A 2WAAA 1RGSA 2YV8A 1JH5A 3VBSA 3ETPA 2W52A 3SXWA 1Q8QA 2JG8C 3MIGA 1G7YA 4QGMA 1QMJA 3PU8A 3U75A 4LA3A 1PMHX 1XBFA 4RR3A 5JSRA 5LRRA 3VBRC 3RJRA 2WQ4A 3GJAA 5A6QA 1D0GA 3I2FA 1XE7A 4WM8B 1HKDA 1HRI2 4HSLA 1N3PA 1ZNPA 4TXWA 5ACA2 4C90A 3WQ1A 3A0KA 4JQRA 5HPOA 4O65A 4MO3M 1RVF1 2GMMA 3KLSA 1DZRA 2KD7A 5LK5A 3N9OA 1OKOA 3D4KA 2J42A 4N9HA 1DGWA 2JDKA 1R083 4YW3A 5FY0A 4XJ8A 3ITQA 4BM8A 4YVWC 3IDCB 5JR2A 4KNCA 1SLLA 4YW7A 1H4GA 1GWKA 1ZZ9A 3THDA 1EV11 3DPRA 1SFNA 1ULDA 2VMGA 4NPLA 4E9KA 2QQPA 3LWCA 3AXDA 4CDUA 2ZGLA 3N9PA 2FMDA 5A32A 4Y4RA 4X8PA 5JOWA 1AJKA 3VBHB 3W5NA 4DY3A 1ULGA 4OI4A 4HL0A 5F3EA 1WCUA 2B39A 2E32A 2ZHLA 2B9UA 1XPWA 4IEPA 3T0DA 3VBUB 3K4DA 4NO4A 3OY8B 2HWD1 1GNZA 4BK5A 5T5JA 4CCJA 2W0XA 3KQRA 1EUTA 2OVUA 1Q8PA 4KG0A 1QY4A 1NA1A 3A22A 2OA2A 2DFCA 5A7OA 4A3ZA 1ACCA 5FLJA 3VHRA 5FO8B 1IS3A 4IXLA 3MYXA 1X82A 2DVDA 2BOIA 5FY9A 3H42B 2R49A 1WLTA 3KF3A 3ST7A 5GLZA 2ZBJA 1PX3A 2GU9A 1DFQA 3AZZA 3MIBA 4OZXA 5F6LB 4RGGA 1Z7S1 3IWZA 5K9YA 5DAQA 2A5ZA 4BCUA 3VBSC 2W3JA 4QHOA 4AI9A 5FY7A 3E6BA 3WP3A 3W20A 1BEV2 4LR4A 1VBB1 1UIJA 3MW3A 4FFGA 2JXAA 4RR3C 3W5MA 2VUCA 2Z79A 1I9RA 2ZKLA 4RD7A 2ZEYA 3RG0A 4WV8A 2HJIA 1JTZX 1TNRA 2EIDA 2JG9A 2HWB2 3CDZB 4CUAA 1JZ5A 2XR4A 2R16A 1PO22 3KT1A 3KM5A 1J59A 3VBFB 5F3GA 3H8OA 1KITA 4MXWA 4CRQA 1HJFA 1GZWA 3C7EA 5BNNC 5FZ4A 3HN3A 4FPOB 3K4AA 4JKLA 2CDPA 1RMU1 2QKDA 3AJZA 1RB8G 2JIJA 1W8TA 3HT1A 2NMOA 1EAH1 4K8RB 3ZM8A 2PELA 3BKZA 5CFDA 1ALYA 4CP9A 3ZSEA 2D6OX 4LHLA 5L9BA 4OMDA 4CCMA 2XLFA 4O61A 1GP4A 1MZ6A 1R1ZA 1VP6A 2RMU2 3VDDC 1K5MB 3H7JA 1JYIA 3AZWA 2ADEA 3BPSA 1MACA 2IXKA 4LKDA 3MLLA 2PQSA 2ARAA 5C4WB 4Q4W1 1OQ1A 4P9LA 1J3RA 4C1XA 4AEDC 2VULA 2WINB 1JU3A 3AL5A 4XF1A 3PTYA 5KXBA 1G9CA 1VRBA 4OVEA 3WW1A 5JXGA 3UGFA 1WD4A 2XXZA 4BYYA 4FSJA 3OGGA 2Z4FA 5FPLA 5FQ0A 2LS6A 3N7LA 4AXOA 2HEWF 4MLOA 1XRUA 3LSEA 1N47A 4LIVA 3KCCA 5AFBA 2NMNA 1F31A 1SFYA 3AK0A 5A7PA 4A44A 5LA1A 4E27A 5K0UB 2ETEA 3OG2A 3DEMA 4DXZA 2YU1A 2WWSA 2D7FA 3AL6A 1S1AA 1SBEA 1S2BA 1NT0A 3OF1A 5FYCA 2WC2A 4BIFA 1TZOA 4IETA 2BGPA 4P9GA 4IW3A 5EYYA 5L9VA 2B8MA 1ZRDA 3PLQA 2VUJA 5IK8A 1TVGA 4BDVB 1XNBA 4QPGB 4FAHA 3PHMA 2RE9A 2MEV3 1W3XA 4LHNA 3WW4A 5IATA 3PUAA 5CKMA 5FP3A 1JYCA 2XMLA 2AYHA 4LORA 5C3PA 2RJ2A 4QB6A 4MGQA 5F5QA 1XQNA 1PVC1 2AGSA 2WNUB 2HWE2 3LPGA 3EMRA 1HB2A 4XW3A 1D2QA 2WQZC 4P5HA 2ET1A 2JE7A 4OHVA 4E4SA 1B35A 5GLWA 2NQYA 5ANQA 1EYBA 1WCDJ 2RG4A 1UOGA 2JG9C 2WN2A 5H9RA 3TN91 3GCWA 3S0MA 1IOAA 1RUNA 3RI8A 2ZHNA 2WKKA 3DXUA 1RUE1 3RZLA 1X9PA 1XE8A 4YSFA 4TN7A 5DG1A 2AUYA 4AOCA 1MVEA 3DYPA 3SH4A 2P1BA 3ZXLA 2UWAA 3NRUA 4MHUA 2IXLA 5FZBA 1AL0G 1IPKA 1KGYA 3L2YA 3VBOA 3P5BA 2BWCA 2E26A 3ZR5A 4X8NA 1QH7A 4Q4Y2 4QAWA 3A23A 3AX4A 5CFDC 4QM9A 1ND3B 3GF6A 3THTA 2P3KA 1W8UA 1FPN3 4IEXA 5BPXA 2A6ZA 2GMEA 1QJY3 4L8QA 3WUDA 5FMOS 1LKNA 4DPNA 1PGW2 2AR6A 2JE9A 5F6KA 4EROA 2GN7A 3C7HA 2BBVA 3H3UA 3HR9A 2BFUL 1WWYA 4B7EA 3GNEA 4QPIB 3M3CA 5C9AC 4AI2A 1UYPA 2SLIA 1Z78A 2B4KA 2GDFA 4LBQD 3KVAA 1S0DA 1FAYA 3TBDA 1KD7A 1PO12 1RUG3 3DCQA 1VMFA 1ASJ2 3MUZ1 3HQUA 5EPAA 4CP2A 1H2MA 1GZTA 1OA2A 1JOPA 1UMIA 1WD3A 2OUHA 4JDNA 3WF4A 2XBO1 5FZ0A 1HN1A 5J37A 2VNVA 2VZ1A 3WNOA 5F7UA 1UX6A 1XC6A 2DWRA 4NROA 4XFFA 1W9TA 3BB6A 4XTMA 3SCFA 3OEAA 4CA9A 1V9U2 2VAUA 2I74A 4M01A 1RUC3 1TNFA 1WA6X 2G4IA 1LEDA 2V73A 3ZYPA 1LOGA 3AMPA 1UMZA 3CU7A 4QB1A 5C3SA 4MV2A 5F32A 3TOJA 1PZ8A 3ZXAC 1GP6A 3NAPC 2O0OA 5JXJA 5J36A 5J1XA 1PVXA 2WBKA 4OI0A 2Y60A 4IE5A 2KA3A 2D6MA 2D5FA 1DYPA 5I91A 1OVSA 4KGGA 4MVTA 1W9FA 4AFMA 4CVUA 3OPZA 4LTAA 1J83A 2FCVA 4NVPA 4A6OA 1W90A 1CQ9A 4PIYA 4BMEA 2RM21 4ZS2A 3JQWA 3WDYA 3U11A 1UZWA 2JE8A 1GZ9A 2VVFA 5A7QA 2VCAA 4LJHA 4TYSA 1B35C 5I8SA 2RR12 1H30A 1MQTC 2R072 1VBE2 1AR72 5FIXA 2X29A 5FYVA 1ENQA 4K8FA 1RUF3 2X5IA 4Y22B 4YW5A 1IQDC 4BA6A 1Z0HA 1JXNA 3AB0A 3KCXA 1KFUL 4P9JA 3WF3A 2YBSA 1HB1A 1H1AA 4IEYA 1GFF2 3DYOA 1S0FA 4QPYA 1PHMA 5FY4A 3U4SA 1ND2C 3QACA 4FT8A 4QQ2A 2PAEA 2XH6A 3E6DA 4QDSA 5FBZA 5FPUA 1FMD2 2VZSA 1YCIA 4KU7A 2CV6A 3ZFFB 2CGNA 2WFPA 4BLJA 4UXAA 4FPCA 4I02A 3VKLA 1ZRFA 4H7LA 1BBT1 3KV6A 1UY0A 3BOWA 2WWJA 3LQCA 1XYNA 2RS31 3KMHA 5GLTA 5D8AB 4D6SA 2CWSA 4W4ZA 3PUSA 4DUXA 1X9TA 4CDQA 2VMHA 2L9LA 1O3SA 2ZX0A 3HNBM 1CAVB 1W2OA 3LFMA 3ZDSA 4B7KA 4DZGA 1HXS1 5JUVA 3RYKA 4AQ6A 1LHNA 3DV8A 4ZKTB 4OHXA 3M3QA 4BQ2A 5C3QA 2ZEXA 3A0NA 1NYWA 4XFHA 1FXZA 1SLCA 3WNXA 4EWEA 4AAXA 3H1MA 3EO6A 4B1LA 1OA3A 2VW0A 3M3IA 1PGL2 3V64A 1GBGA 3MPBA 2YGMA 4WM8A 3JBG3 1TMF1 2HWB1 1UU4A 2UYAA 3U0ZA 1AR61 3QLQA 1W05A 2E51A 4AEMA 3EB7A 4GB31 4K1YA 4TTGA 2RMU3 5LBCA 1EUUA 2C4XA 1V6NA 1JN2P 3GDBA 1WCSA 3E97A 3NNFA 1CAXB 4NAOA 4E8DA 5DAVA 5FYUA 1HQLA 2UURA 3DN7A 1TE1B 4G4FA 5EXOA 5FBJA 3GCXA 2XVLA 1AYN1 4I3PA 1KEXA 4X6QB 5BNNB 5C7GA 4RHV1 3WNLA 1JYWA 4R4XA 1VR3A 2K2SA 2ZGPA 3ZFGC 4A6SA 1EP0A 2A7AA 4WM7B 4Z82A 4AFBA 4Y1VA 4CDXB 1VRH1 4FOWA 4IV1B 4XXPA 4FVVA 5F5CA 3U37A 3SKVA 5FZEA 5C70A 2DYCA 1HQNA 1QNWA 3I2KA 1WMEA 4RQPB 3NJXA 4GH4B 3JD73 4PIZA 3UV9A 4HK8A 4DXTA 2VUDA 3VBHA 3WCRA 5HXVA 4FPFA 3VDDB 5C8CB 5DUVA 2BJSA 1N3QA 1OOPC 3JXSA 4PHZA 2Y6JA 4AEDB 4UFJA 2X8KA 3VBUA 4IE6A 3OY8A 5I8YA 4V2WA 1UOFA 2ZAAA 4PDWB 5A1AA 1ZX5A 4CUCA 2XQRA 5A1FA 3USUB 1BMV2 3U07A 3RNSA 3FBYA 4QMAA 4QU2A 4MGTA 3KHBA 3PUHA 1UYYA 1W8OA 2A6WA 4BH9A 5C5UA 2QFEA 3V0AB 1X8MA 4JV4A 5C71A 1A8DA 1KJLA 2HWE3 5FZ8A 4LO4B 1O4ZA 1GUIA 3THCA 2EXHA 3TWIA 2WYSA 4IEOA 2P6CA 3WG4A 2P3JA 2G9ZA 4LNVA 2D3RA 1JHNA 1ULFA 2FCTA 3GXUA 4ZU4A 4NOTA 4PLMA 2K9ZA 2P3IA 4D8MA 4Y20B 5K4LA 1ODNA 5KR7A 3CJIC 3ZYJB 4HZFA 4QGNA 4WZCA 1NZCA 4UW3A 4AQ2A 1BHGA 5LY1A 4OUEA 5CKNA 2Q8DA 2ZX1A 4WM8C 1POV1 2D98A 1MEC3 4JVAA 1JZ3A 4FPYA 3VBFA 1VBA2 2EAAA 5JVVA 4UOJA 4FTBA 2J1SA 2ATFA 1UPSA 1S55A 2IWGB 5DAXA 4EN8B 5FY1A 2UU8A 2HBUA 4N9IA 5FUNA 1QQP1 3CZJA 2XJRA 4X6RB 1ZBE1 2HBTA 2B42B 3NNJA 4QKBA 3WSOA 4FFIA 4P08A 2Q8OA 2HWF3 2CNAA 2EICA 2WZEA 4JQTA 1OLQA 3HD8B 5JOYA 4OQ8A 1CX4A 2O1QA 2G9FA 1QDCA 4GKXA 4D7TA 1REEA 4URAA 2VVDA 2PHFA 1HRV3 1K5MA 3S5AA 1ASJ3 3HVDA 3OSDA 3OBAA 4XF3A 4COVA 2W9XA 4MYEA 4QX3A 5FZHA 3LDKA 3N7JA 2ES3A 5FXVA 5C4WA 1VALA 2Z69A 2ZHMA 1OSGA 2F17A 2QQKA 4AL9A 4JKMA 3ZVXA 5T5LA 2QQIA 1L7QA 3VBHC 4CPBD 4CCOA 5F9TA 4JHTA 3J8F3 1YJKA 2D43A 2GP3A 1CN1A 2GNMA 2WYFA 4AQSA 2A3YA 4CCKA 3RGBA 1ZREA 4LLOA 1NCQC 1LGNA 2R0HA 1AR91 3LGRA 4AWDA 2E63A 4QXCA 4NIIA 5A3UA 1V6OA 2DURA 3PVBB 1C8M3 1R082 4UFLA 3VD5A 3ECQA 3LB9A 1CZTA 4URTA 1H9WA 4ASMB 2YG0A 1LAJA 1WKYA 2YBPA 3I59A 3ZYGA 4KI5M 1V9U1 3KT4A 4B4RA 4Q4X2 5JPMB 3PU3A 5DMYA 1AX0A 4NHLA 5K0UA 1NUKA 3EBRA 3NJVA 2I2SA 5A80A 3ZSMA 1DZQA 1XE0A 4YW2A 3WP6A 5AVPA 1R091 1JHJA 1DCSA 3T09A 5I93A 2XDVA 3ORJA 5JI7A 2CGPA 3GYDA 2QZ3A 1RUD1 3IN9A 4ATFA 2ZX3A 4N90A 2RR13 1H8TB 1FOD1 1G9DA 3AYCA 4L2NA 4XFIA 1GMMA 1W9SA 4JCKA 3NAPB 4QPGA 2JB8A 4BHPA 3I2JA 5KXDA 4WVMB 4BB3A 4XJZA 2F4LA 1ULCA 4GQ7A 5FUPA 2XKOA 1C28A 2WNUA 2DVGA 1IG0A 3N9MA 4PCRA 4DB5A 1JOBA 3DGTA 4CP1A 4Q8KA 5FK7A 3IZOA 1U12A 3HN1A 3ZXDA 2YUEA 4OHYA 2R071 1VBE1 2PTMA 2QQWA 4XF4A 3OYWB 4K40A 2ZGNA 3VBFC 4QPWA 1QF3A 4Z92B 2W1WA 1NCRC 1QJFA 2WT2A 1MQTB 3MLJA 5GZFA 1RHI3 2WZR1 3KQ4B 3NW4A 2R7EB 5BNPB 1ND3A 3ME2A 2ZZQA 4GWMA 2YXSA 4SBVA 1STMA 1IPSA 4AQTA 1AX2A 1WMXA 3MO4A 3RPQA 5K7PA 2VECA 3PJYA 1K5MC 4UFIA 2YZ4A 4FP2A 5KHHA 4LE3A 2ZEZA 3B9IA 2AEZA 2D40A 3ZN6B 1VBC3 5A7WB 5JAXA 4MGYE 2PA7A 4HOOA 4XCBA 1SDWA 1CJDA 4QPIA 4JX0A 1VBD1 1R1A2 1O91A 1PK6B 1WBLA 2ORXA 4LBQB 4D6RA 4NMIA 5FO9B 3N4MA 4NWWA 3ZFEA 3ZXGA 4W6WA 3MPPG 3TB0A 3MLKA 2WNOA 2DFBA 3WG3A 5FFOC 4L11A 2W87A 5HCHA 5KHIA 1W3VA 5E6HA 3UT0A 5FZCA 2RDNA 3AKRA 2Y33A 2OS2A 1ZYBA 2LM3A 1QXRA 4QKNA 4LBJA 4DRVA 5K0UC 4YM2A 2P37A 1RXGA 2LW8A 4YG6A 2JG8A 1AR81 4SLIA 3PUQA 3SNMA 1VAVA 1VIWB 4EWDA 4B4QA 3IMNA 4AI0A 2Q1FA 3CKHA 1AYM1 2O8QA 2WR9A 3IDEA 5FZLA 3W21A 4XFBA 3ES1A 4XILA 1KS4A 4PQQA 2W5FA 4FFHA 2ILMA 5L19A 3WCSA 2Q4SA 1URXA 4HPKB 1DQ0A 2B9VA 4FO9A 3U1XA 3B94A 3WX5A 4IEVA 3AMNA 3USSA 2VOTA 4BQ3A 2ZMKA 2VTFA 2VTXA 2P2KA 3KGZA 4YVSB 5CU1A 1Y9QA 3DYMA 1N1VA 3OBRA 2X05A 4EV0A 4LKFA 3T08A 4Y22A 3ZIWA 4LQRA 3ZFGB 3H3ZA 2ZPXA 1OPMA 5DZFA 3ENRA 2YY1A 2Q8CA 2VL4A 3KSCA 1NY72 1GU3A 5EJZB 2MEV2 3WHUA 2BFUS 1X36A 2BNNA 5FZ9A 3FHAA 1UZYA 2ZKNA 3NQHA 3CHXA 5FO7B 4XUPA 1DYOA 1F2NA 3KV4A 3AP4A 2XG3A 3O1TA 1OOPB 1W8NA 1JZ2A 3VZLA 1US2A 1HJGA 1HLCA 3DXTA 4NPMA 5KWRA 3HT2A 3ZFFA 4K9SA 1DP0A 4MGZE 4IEWA 4I0WB 4MX3A 4XVHA 1QJU1 4QPIC 1UIKA 4BQWA 1JYNA 2J1UA 4N43C 4BE3A 5D8AA 1F15A 2V72A 3CZUA 3N7KA 4OYUA 4NE9A 3OBTA 1LECA 5FZFA 4BQ1A 2VZPA 1CAVA 3TEYA 4ATEA 3J7NA 2JIGA 2D5HA 3E5XA 2ZGOA 3ACLA 4MGIE 5CISA 2VZVA 1VBA3 4XQDA 1AVBA 1JMUB 2XQXA 5GZEA 1FPN2 1QJX3 4UWDA 1QJY2 4PJYA 3EQEA 3P1IA 4NRMA 1BVP1 1ULOA 2GH2A 1F9KA 2G9GA 2FDGA 5JSOA 5IVYA 4ISQA 4OQ9A 2JDHA 1FT9A 1W04A 4LUKA 4NHYA 3P6BA 5KC6A 2R1BA 3AZYA 2C26A 4FXGB 1GOGA 2E7QA 4PQ9A 5GLUA 4NUBA 3IIIA 3W59A 3CJIB 5EQUA 3SITA 5A33B 2WA4A 1RUG2 1GQGA 3IAQA 1YQ8A 2QDRA 3PJQA 3R05A 4WVZA 1UY3A 4YW6A 1DQ6A 3T1LA 4AEKA 1CAXA 1C5IA 2VOXA 1HB3A 2BP6A 3FE5A 4YM0A 5LA0A 1O5LA 1Q43A 2R1DA 4XBLA 3ZSLA 5BNNA 1X33A 3WDWA 1DU3D 1COV3 1E57A 1RUC2 1QWRA 4WM7A 4QM8A 4Z2AA 1I3HA 1OQDA 1XOYA 2EAKA 1NXMA 4IV1A 5KHJA 3O5SA 3ZIXA 2VOKA 2XONA 4CCCA 1YQ2A 2EALA 4J25A 1EPWA 3MDPA 4RQPA 5SV5A 1SQ4A 4GH4A 4UBGA 5L73A 1YFUA 3M70A 3UYJA 4RL7A 2ZGSA 1MS4A 1RUH1 4GWJA 5GZGA 4M3CF 3VDDA 2IZWA 5C8CA 1C57A 4Q4X3 4UFKA 5J48A 1U5ZA 1OF4A 4XIOA 5JWPA 4AEDA 4BMBA 1XNCA 1NOVA 4M3CB 2EIEA 5C3RA 1OH4A 4YZ1A 4OHWA 5E16A 1SZBA 2VC9A 2WRAA 4Y1UA 2HEVF 4JGZC 1NCQB 3USUA 3ZFFC 3OUJA 1S2EA 3M1HA 1GOFA 3POJA 5CB7A 5T52A 4CUGA 1RUF2 3V0AA 2BW8A 1MZEA 5EHDA 2VNGA 3L2HA 4FPLA 5D8AC 3ZN5A 3I3EA 3T4VA 4A3XA 4IGOA 3MHZA 2HWD3 2VZ3A 4QQPA 1KXGA 1DZTA 5KXEA 3MFCA 3B69A 1OFNA 4PBPA 1LRHA 1JZ7A 3I2HA 2FMYA 2YROA 4M0HA 1D2SA 5FP4A 1C4RA 4QDRA 5A3TA 3I2OA 1Q8VA 4XUTA 4Y20A 4S2HA 2G19A 1D4VB 4JTNA 5HBAA 1WMFA 2JDYA 3H7YA 4LEJA 1UL9A 4AGGA 4ZZ5A 1OBNA 4IERA 2YFUA 1ENSA 5DDJ2 1O6UA 1OT5A 1PX4A 2OZ6A 1Z7S3 4HKLA 5EJ3A 4PI0A 4MSVA 4XIKA 1XU1A 2PHLA 2R063 3BTYA 2WJSA 5LA9A 3LA7A 1PM7A 1YUDA 3OCPA 5FZAA 1QXJA 3I3DA 2VZOA 1LOAA 5FMBA 5TSWA 1IG3A 1V6LA 4ZHNA 1XSQA 4FAGA 2F4PA 4UW5A 4AFDA 1NCRB 4XDPA 1R1A3 4DMIA 4GKYA 4WM7C 3ZKYA 3ACIA 4CDXC 3WF1A 4IV1C 4ZU7A 3T2PA 1XYOA 4IUGA 2WDBA 3WNKA 3JBG2 1WA4A 2EVXA 3UGHA 3PL0A 4FPEA 3ZX7A 4NAMA 2OPWA 4RQPC 1WCKA 4GH4C 3HBZA 1LOBA 5FYHA 5LRSA 2LUWA 3V65A 1RMU3 5FY5A 4QKFA 5EV7A 1HX6A 4NHMA 4D0QA 1F8VA 3GJBA 3N7MA 5EP9A 5C8CC 2IVIB 1ZZBA 3KD4A 5LBEA 4BXFA 1LOFA 1BK0A 4YWAA 3FN9A 4CSWA 3GM8A 3O1MA 1BLZA 3KGLA 2F6BA 2GC2A 3ON7A 1UWWA 3VDAA 2PXJA 2PN5A 4RGKA 4A42A 2J22A 5C9AA 2R042 3NV2A 4PDWC 4Q4W3 5A6ZA 2JDAA 1W6QB 5G04L 3NKTA 2XOMA 3H3LA 2PLV1 4EE2A 3AC0A 1LB2A 1MS8A 4E4DX 4FTSA 5FMCA 4Y5Z0 1UW8A 1W6OA 2YHJA 3AFGA 2JJ6A 1A34A 2WLQA 3UKVA 3JD72 5SV8A 2BVBA 2Q8EA 4XDOA 2WL1A 3MV01 2EIGA 4BU2A 4L97A 4Q29A 1GR3A 4Q0QA 1EPZA 4ZPIA 3OEBA 1ULPA 2VGDA 2WWUA 4R9BA 2DTYA 4P5YA 1UAIA 3VKOA 3NAPA 2WS92 4COUA 1A3KA 3MIEA 1UZZA 4WVMA 1RUI3 1OD5A 3EXUA 1GWLA 3LPFA 3NMBA 4AI1A 2ID4A 1AXYA 1UKGA 4FXKB 2E31A 4H14A 5C3OA 3B7MA 2IXIA 4LHSA 3U4XA 1CZSA 2ZEWA 3MI8A 2UWCA 4QQHA 1MS5A 3OYWA 1M4WA 1WGPA 4YM3A 1X8EA 3T0BA 1C5HA 3GGLA 3CNAA 1MQTA 1PIV1 4QX2A 1GKBA 5E1RA 4AK3A 4WVVA 3GHMA 2OX0A 4CE8A 3I3BA 3JB8A 2JICA 3RJ2X 4IQPA 5LEJA 1BCXA 5BNPA 3WQBA 1DLCA 4MH0E 3MIFA 2WAOA 3TN93 2VU9A 3LF7A 1OURA 4GZ9A 2CL2A 3TEXA 4DINB 3M7AA 1VE0A 2O14A 1LOEA 2VNOA 4QU1A 5HV0A 4AVAA 2C0ZA 3ZLIA
chains in the Genus database with same CATH topology
3KZ4C 3R4DB 4CTEA 3ZN6A 1MEC2 1ND2A 2VXRA 5DUWA 3HAGA 2QZ2A 3POYA 1PK6A 4LBQA 4AFCA 4D94A 3HMYA 2CYFA 1LOFC 1TME1 1V6KA 1W6NB 1IKPA 2ARXA 2BWAA 2GSYA 1FNYA 5CA6A 2HWF2 2YGLA 2DF7A 2RS11 1JUIA 3PNAA 4N43B 1O3RA 2A3XA 1SBFA 2Q5TA 1FPN1 2LTNA 1HRV2 3IDBB 1QJY1 5I0RA 2OIIA 2H6BA 5FRAA 1DGRA 1AL23 1HW5A 4P9WA 3FFQA 4Z2WA 3J8F2 1WLWA 4META 4YZ5A 1SLTA 3ZXEA 1H8TC 4IEZA 4HETA 3JB4C 4XQWA 5LEKA 1C8M2 4E2QA 4AGVA 1HRI1 4HPKA 4P9IA 3AP5A 3BIWE 3HIFA 1RUJ3 5ACA1 2LALA 5HCAA 5CNAA 5JZGB 1CAUB 1SEFA 2WIIB 1C8NA 3SMHA 1AF9A 2AZ5A 4YVSA 3MF9A 4AI3A 4LO5B 2XJPA 2JX9A 3KB5A 1IPJA 1WUVA 3ZFGA 1GV9A 2VNRA 2ZMNA 1SCRA 2RM23 4YW1A 3W58A 4MZUA 2E7TA 4INDA 5CFCC 2D93A 5BNPC 1C1LA 1ENXA 4LO7A 2XJVA 2ZS6B 4XF9A 5DUUA 1UCXA 1TQ5A 3LA3A 3ILRA 1OOPA 2PQQA 4XFAA 2DUOA 3EHKA 1G86A 2PHXA 5GZDA 3WG1A 4Q4V2 4AEJA 3OD0A 2Q30A 3FBMA 4W6XA 4ES8A 1PK6C 3ZMOA 2PAKA 4JGZB 2VUAA 2UY9A 2WFF2 2WSUA 4LBLA 3AMQA 1WW6A 1RHI2 2H6CA 2FZ2A 2BYVE 4OHZA 5DG2A 4XQ4A 2ZCWA 1QH6A 4XETA 3KCYA 4AFAA 1YI9A 5DDJ3 2A75A 5J96B 3GZAA 4YG3A 4GMP3 1S0JA 4D7YA 4Q1PA 4QT6A 4QQOA 2PHRA 1PMIA 2QUOA 4CDWC 5JIUA 1BBT3 3QH6A 4KWJA 2RS33 1VBC2 3NWKA 1DGLA 4CEYB 1BXHA 3I8TA 3M8LA 4M3CE 4U36A 3S6PA 4GMP0 2HWC2 2A3WA 1BEV1 5BV6A 5IK4A 5CG8A 5A33A 3CJIA 3AP9A 2BPA2 4R52A 1W6PB 3D6EA 5I0UA 2XB6C 1PO21 3ALQA 4EN9B 1HDKA 1SACA 2Y0IA 3WDTA 2YC0A 5BNOB 2W68A 5T55A 1DQ5A 1TMF3 1Q3EA 2VW1A 1AR63 1L3JA 3E5QA 1AXKA 2ZGTA 4HBNA 2PHWA 3O14A 4GB33 4Q8LA 4YVSC 3WR0A 1J1TA 4HVRA 4KH9A 3ATGA 4Q27A 5J3UA 2DCKA 2R043 3OGJA 5DZGA 2JEMA 5D1IA 2RMU1 4YGBA 1AYN3 3B9CA 4S2GA 3OD4A 2NYYA 3ETQA 4M3CA 4XDQA 4XXAA 2WNEA 1VRH3 3FLTA 4O9GA 3AXEA 5FDBA 2XHKA 2GNDA 4C91A 4HMZA 1YNAA 4FOQA 3HWJA 3R6SA 1FATA 1NCQA 3VGIA 1VB2A 2WS93 2QDNA 2XLGA 1YRZA 2Y38A 2XL7A 2KM2A 3G6JB 1JOJA 2E7AA 1YO8A 3MGUA 2GNTA 3ES4A 5C33A 5T3NA 4PLNA 4K1ZA 1CVNA 4M00A 2NP0A 4Y26A 4Y1ZA 4RGAA 3RS6A 3DPRB 1QHDA 2WA3A 4ZU5A 3M2MA 1JUHA 2Q1ZB 2GALA 1IS4A 2KXLA 4I0AA 5JSPA 4E4ZA 4BWOA 3MW4A 2XKPA 1D4M3 1RL3A 1QOTA 2HWE1 4IEQA 1Q8SA 3VZMA 4A7KA 2ERFA 4HT1T 4YRDA 1FV3A 4S2FA 1GYKA 1W0PA 3WD5A 1NA1B 1YYNA 3PVNA 1QJX2 1NCRA 2B45X 1REDA 1T6GC 2BQPA 5FCCA 4NPRA 4QGLA 1JW6A 3RYRA 1APNA 2GNBA 4P14A 3CEWA 4LBMA 4Q4Y1 4BOWA 4KWKA 1QQP3 1B09A 1GICA 1ZBE3 3CO2A 4BIOA 4AVSA 1PGW1 3BOPA 2EXJA 1QNYA 2BEOA 3VHOA 3NO8A 4AF9A 3AM2A 3ZXFA 3ZN4A 1IQAA 5A3LA 1VAKA 2HWF1 3AYAA 4R8HA 4MUVA 1COV2 4J6GA 1DIWA 3H8UA 2ZACA 3EJKA 1W6QA 1S0CA 1PO11 5C4WC 1HRV1 1ASJ1 3RWNA 2RHPA 1H9PA 1KDMA 5FLIA 4KWLA 3PVOA 5F1RA 1G9AA 4PIXA 5K8SA 5LK7B 5DXDA 1AR93 5T54A 1Y7BA 2DCYA 3T1MA 2FBEA 4F8AA 2PHDA 3FMGA 4WVWA 2BNOA 3GALA 2QJVA 2ZGUA 3QD6A 2EA7A 3NJZA 1HQWA 1IGOA 4H7MA 5BNQA 3DKWA 2MHFA 2E9QA 3O0WA 3R4UA 4UW6A 4XTPA 3UK9A 5JR7B 1R093 3R4SA 2WT1A 5I0SA 2W08A 1RUD3 2GC1A 3VV1A 3VZKA 1WLDA 2R32A 1FOD3 3GBGA 1VB4A 2OYZA 2HWD2 4ISRA 2GMPA 2RR11 1BK1A 1RUOA 2ZOEB 2QNKA 1AR71 5KHKA 4QXKA 3RQ0A 3MZHA 4Q4V3 1O5UA 4LO8A 3THPA 4JDOA 4LT5A 2WFF3 2WT0A 3FLRA 3O12A 3VKNA 1NLSA 4HN1A 4EJRA 4FQ4A 2AENA 5CFCB 1ONAA 1Z7S2 4DS0A 3APBA 2WZR3 2XJQA 2EXIA 1X50A 4JGYC 3Q9OA 1H1MA 2R062 2XWJB 4Q0SA 1FMD1 3M3EA 4XBNA 4MXVA 1VBB2 4AI8A 3WOGA 4LLFA 1RHI1 2DU0A 1QKQA 4MGKE 2V5YA 2K0GA 4FPHA 5DUXA 1VLNA 2JECA 2HWC3 1FNZA 3AZXA 4N43A 3WW3A 4AG4A 2RS53 3JCIA 1DDLA 1KS5A 3VHNA 1VBD3 1MS0A 5B2GB 2Y26A 2RJLA 1IHMA 1VBC1 2BVVA 3BALA 1QOSA 1QDOA 3UKNA 1RMU2 3VBOB 4ES9A 2D6NA 4FTEA 1O4YA 2HYKA 3L9JT 4YGCA 3RZZA 4CDWB 3AKPA 1PGL1 2C5DA 1X7NA 1SCSA 1H2LA 4OLLA 4LBKA 3WDVA 4JTOA 4Q4W2 3K51A 5JZGA 1AR83 3AP6A 1ZBA3 3SLIA 2BGCA 1CAUA 2H0BA 4XJ9A 1ZZCA 4W6YA 1AYM3 1IS5A 4GA9A 5CADA 4PF5A 1RINA 3O7OA 4EN7B 1N3OA 1KFXL 1RIRA 5FAXA 3IBMA 1KQRA 1CONA 1LENA 1O7FA 1NG0A 3WP4A 3WHTA 2VQAA 1UF2C 1RUI2 3QCWA 2QCSB 2Y0OA 4Z07A 2B46X 4YG0A 4J1XA 3D5OA 4YNIA 4I0BA 4FOVA 4TWTA 4ONUA 3JU9A 4GALA 4HKWA 2PAMA 1ZM1A 1WBFA 4XMIA 1WW7A 3D0JA 4V1PA 3ZSKA 3H50A 5AC93 2JENA 4JGZA 4H55A 2WNVB 4I3GA 2PYTA 4CEWB 1BMV1 2ZAHA 4HKOA 1S0IA 2ZHKA 5FPXA 2XJUA 2IXHA 1REFA 3FZ3A 3WXPA 3MICA 3NV1A 4KG8A 5H9PA 4AHZA 1XNKA 3H1WA 4FOYA 2B7YA 3KS7A 4K7JA 3TN92 4OI1A 1DQ2A 3J9SA 1RUE2 1LHUA 1AXZA 1LJ7A 1QJU3 5J98B 4AHYA 4FQZA 4DQAA 1ZZ6A 1I5ZA 4CEYA 2GAUA 2EF6A 5JIAA 1QU0A 4D7SA 2YMZA 2VPVA 4NWVA 1W6PA 1OMIA 4WZFA 3AJYA 1W6MB 3S7EA 1VBA1 2CGOA 5JZGC 5BNOA 1LESA 2ZZJA 4B4PA 1J3QA 4NR1A 1IS6A 3G7DA 3TNPB 5FOJB 1UU5A 1AL22 2NZ9A 3MW2A 3INAA 2GN3A 4YARA 3TAYA 3VL9A 5ABJB 2D97A 2ZX4A 2XBO2 4CDXA 1DGWX 1S0BA 3R0RA 4AGRA 5T5PA 5EYXA 4EWAA 4LULA 1S0EA 2P17A 4KQ7A 4COZA 1RVF3 3RRDA 1RUJ2 5AFEA 3ZPYA 1BZWA 3B02A 1COV1 4LHKA 1PZ7A 3AP7A 3ZYRA 2ZGMA 3ZYIB 1RUH3 4Q2FA 5AVAA 4Q26A 5CAZA 3URFA 1XXNA 5JLVA 1R081 1EV13 1UU6A 2ENRA 1ENRA 1A78A 4PDWA 2NN8A 4HFSA 1V6MA 1YI7A 3JUUA 3WVJA 3GBFA 5KHGA 1S0GA 5J7MA 4Q4X1 2RM22 4COWA 1W2UA 3NSTA 4Q0UA 5FLHA 1QJZA 3HQXA 4AVCA 1V6IA 1WLCA 3NKGA 1NE4A 3ELNA 4LUMA 5JPNB 1GLHA 5I0TA 5IT6A 5GALA 2XVKA 4IV3C 3DL3A 4CEYC 4XYXA 4Z8BA 3I4IA 1PGSA 3CF6E 4BPZA 2XJTA 3WQ7A 1QXPA 3K48A 1LCLA 3WDUA 4GIQA 4ASLA 4B29A 2VG9A 5L7OC 5E8AA 5C8WA 1YIPA 1BKZA 1MZFA 1WMDA 1KJRA 3WT3A 3SH3A 5BNOC 1JBCA 1BBT2 4JC1A 4JRLA 3SCGA 1VBB3 2GZWA 2RS32 3POWA 3WZ1A 2ZA9A 1CPNA 1LGCA 2PFWA 3ILNA 3MIDA 2DUPA 3WLUA 1HXS2 4DFSA 4HLTA 3N35A 4A7YA 2D3SA 3JZVA 3M3OA 4TLFA 2R061 2YDEA 4FPGA 4F83A 1BYHA 1U0AA 3JQXA 3MF6A 4QHBA 1LULA 3MFAA 1AHSA 3FX3A 4L9BA 1R1A1 1CPMA 2CAVA 2IC1A 1C1FA 1OI6A 1EAH3 1TMF2 3FLPA 4JGYB 5KBFA 4HVQA 1AR62 4XF0A 4BZ4A 4GB32 4YM1A 1RITA 3MIHA 1MS1A 1G8WA 1GANA 2X53S 3IT8A 2ET7A 5HCBA 3VLBB 4C0HA 1AYN2 1A6CA 2MPFA 4RHV2 5JCTA 1HV0A 3LOIA 1VRH2 1RTVA 2N7GA 2PLV3 2XJSA 2ZABA 5GKAC 3B3QE 4PBOA 3DPRC 2ZJCA 2ZTNA 3DF0A 1WW4A 1H8TA 4CDUC 1XU2A 2JD4A 4AVTA 3C2UA 5DZEA 2CTVA 2P34A 3MEPA 4EN6B 3ILFA 3O0VA 2A6XA 2AH2A 4LA2A 1DLLA 2OW4A 1GNHA 1OKQA 3I59B 5JOZA 1YWKA 2UWBA 1NA1C 1CIWA 1RUI1 3I54A 2EXKA 4Z1VA 4GWNA 1J1LA 1NY71 4G9SB 1PVC3 1J3PA 4Y1YA 2MEV1 1HIXA 2JKBA 5CFCA 1UKRA 1D4M2 1PIV3 3D8CA 1PZ9A 4AE2A 1U5XA 1GSLA 2DU1A 4AVVA 4N53B 4RS5B 1RUE3 1BJQA 4XOGA 3BU7A 4XJWA 4HANA 2A6YA 2VY0A 4CZSA 4G3YC 1PNFA 5J09A 1MVQA 1NQJA 4TSVA 2XLAA 1H8VA 1GZCA 5IK5A 1QQP2 4XJUA 4Y24A 1C3HA 3UKTA 3LSDA 2Z5WA 2DVAA 1ZBE2 4KGQA 3WY6A 1TME3 4I09A 4CDWA 1LU2A 1H2KA 3QH7A 4P9XA 2RS13 5E89A 4JDMA 4CP0A 2D3PA 1V00A 4YFZA 4OUSA 1DYKA 5CVRA 1LHWA 3B5LB 4EN0A 3VZNA 2GC3A 3KT7A 3AYEA 2XBO3 2BTVC 1XNDA 1RUG1 3BTAA 1BVVA 1RC6A 2WLPA 3WG2A 3LKJA 1YXWA 3LA2A 4YZ3A 1AL21 3ZFEB 1O3QA 1U5IA 1AR92 4Q0PA 3J26N 3VKFC 3VZJA 1RUC1 3NVCA 3S30A 1HRI3 1V6JA 2XUMA 1SLAA 4C1WA 3AKQA 5ACA3 3ZSJA 1DGRN 3BPZA 5T50A 4XZPA 5CIRA 5HCFA 3U10A 5HI0A 3GZUC 1CD3G 2TEPA 4LBOA 4CYDA 5FTTC 1RUJ1 3AKSA 1NXD1 5BYNA 2JG8B 1ZRRA 1R092 4PLOA 4GULA 3FFZA 3SHRA 1CAWB 1LR5A 1RUD2 2IFWA 3VBRB 1YJLA 1FOD2 1SLIA 3B93A 3LCPA 3LAGA 4K3UA 4P9YA 4YZ2A 3LOBA 3UL2A 4RA0A 2WSVA 2WNVA 2YPJA 1QOOA 1AUYA 4CEWA 2CWMA 4Q0VA 1CESA 1F5JA 4DRRA 1SLBA 3BCWA 1RUF1 3GBWA 4XFCA 4AW7A 4HN0A 4B3NA 2Z2SB 2IFRA 3IPVB 4XHXA 1CGPA 2CAUA 3WW2A 4FBFA 3V0BB 3W9AA 4YVWB 3P3PA 4TZDA 4N7IA 3AMHA 3UJOA 1RJ8A 3VBOC 3VN4A 2WZR2 3NV4A 3WV6A 1N1YA 1Q56A 4F7ZA 4IV3B 1KDKA 3AFKA 2FHRA 3H0OA 2PHTA 4BLIA 2VOWA 5IUQA 3FC0A 1W6MA 2A6VA 2ZX2A 5DDJ1 3RI9A 4LE4A 4B8EA 2RS52 1HXS3 2E6VA 4GMP1 1EY2A 5L7OB 2ZGRA 3AZVA 2VH9A 1VBD2 1BEV3 4IEUA 2JDZA 3NL1A 4JRAA 4M0NA 2B5HA 4C0BA 1DQ4A 1LHOA 4IESA 4YLZA 5ABJA 2A73B 2HWB3 1Q8OA 5JDBA 1LOCA 2FQPA 4WBBA 1PO23 4R4ZA 2D6LX 1CR7A 2IXJA 1ZVFA 3JBG1 2R6QA 1MS9A 4K20A 4ITCA 2NPIA 4UBHA 5EWSA 1AR82 1W39A 1ZBA2 3RSJA 3VBSB 2DCJA 3ZO0B 1F5FA 4RHV3 1AYM2 2DCTA 2DVFA 2Z42A 4RR3B 2Q0AA 1ZA4A 5CG9A 2TNFA 5BY5A 2ZGKA 2BNMA 2PHUA 1SBDA 2R041 4XBQA 4JAAA 1YHFA 3WINE 2OUJA 2WNVC 1VJ2A 2D6PA 3RDIA 4CEWC 2YYOA 3D0SA 4I01A 3BODA 1YFYA 3POSA 3JD71 3WP5A 5JMCA 5KXCA 4A2UA 1A8MA 1MR5A 1UN1A 3H1YA 1Y3TA 3X29B 2OPKA 1AX1A 2ARBA 1TEIA 1FI2A 1LHVA 2MNGA 2X5IC 5FREA 2UYBA 2WS91 4K6BA 1G6NA 3FJSA 5A3MA 1DHKB 5AC92 5FOBB 1OA4A 2C9AA 5FPZA 4COYA 4OFGA 4FP3A 4CDUB 5A32B 2DUQA 4IL7A 3AMMA 3ROUA 2A70A 2TUNA 4KL1A 1QJU2 4HVOA 1W0OA 2XGXA 3H9AA 3VL8A 4RFT0 2D44A 3CLPA 1AJOA 4CDQC 3I7DA 1D4M1 5ABJC 1POV3 2IXCA 2V09A 1XYPA 1YLLA 4L92A 2AREA 3IKWA 5GLVA 2WZPP 3VHPA 4KU8A 1MEC1 4R9AA 1OFSA 1PNGA 1ZZ8A 3ZXKA 1POV0 2FZ1A 4JGYA 1QGLA 3VUOA 4Q4Y3 4OUMA 2HEYF 2Q1MA 2W39A 4DNYA 3FWEA 4H3WA 5GJ6A 3E5UA 3IM0A 1DBNA 2JG9B 4R9CA 4XFGA 1H0BA 3RMXA 4MXWB 1AZDA 1GZWB 4ORFA 1RVF2 5JOXA 1FV2A 3B01A 1DF0A 1PO13 5GZCA 3VKMA 2QVSB 2R0FA 3J8F1 1NQDA 4GXLA 5CFDB 5BUVA 4LO6B 1RUH2 4HSJA 4I30A 1V9U3 3LZZA 1C8M1 1EV12 4DY5A 4NN0A 5L36A 1GQHA 3A4UA 2HKXA 3QBQA 3V56A 3ZXJA 3VBUC 3VZOA 4OI2A 2VVEA 5C9AB 4QQLA 1Y43B 2VMIA 3NV3A 4HK9A 1ZRCA 3GHNA 1H4HA 3RMYA 3D82A 1V70A 5IK7A 2QE3A 2ZGQA 5FMOL 4Y4YA 3UJQA 5T5OA 1W6OB 5FQ0B 1MS3A 1NLRA 1WW5A 3WUCA 2RJKA 4RSUA 4ZXKA 4XPVA 3AKTA 2R073 1VBE3 2R30A 4FCAA 1AR73 4N53A 4RS5A 1OQEA 1S2KA 4E2GA 2TBVA 3SISA 1H2NA 4Q4V1 1UPIA 1NE6A 2DVBA 1G9BA 1M06G 1SMVA 4XHBA 4XMAA 2E53A 3AYDA 4YZ4A 2WFF1 1W6NA 3PVEA 2GH8A 1H1IA 1O4TA 2VW2A 1B35B 2NM1A 4Y1XA 3WDXA 1FMD3 1FX5A 1LODA 3FHIB 4R9DA 4O9EA 4D3WA 1I1EA 1N1TA 5H9QA 5EFUA 1DQ1A 4K21A 3M4FA 5E88A 1YFWA 2HWC1 1EAH2 3DUIA 2OZJA 5DUVA 2RS51 1IZ3A 2XL9A 1D0HA 1VAMA 1ND2B 4L99A 4QX5A 5JI9A 4YGEA 2NLRA 4S2DA 4FPKA 3C3VA 5BXXA 2XPJA 2CY6A 5CBLA 3PMEA 1MZ5A 4I2OA 1BQPA 2H0VA 1Q5OA 4D69A 2BUKA 1G9FA 1CJPA 3E6CC 1I6XA 3IIAA 1OLRA 4YW4A 4YYOA 2DTWA 1IKQA 3TRSB 2VOVA 4KBBA 3T2TA 2PLV2 3P3NA 3B00A 3FUOA 3OTFA 4FPJA 4UW4A 2SBAA 3GZTB 2XWBB 1ZBA1 4E2SA 2DV9A 1CAWA 3CJXA 1OPOA 1DG6A 2VQ0A 3VBRA 1UD1A 1KRIA 3J4UH 3N36A 4XJAA 1O3TA 4QPGC 4N53C 4RS5C 1YIFA 4AHXA 3TYJA 2I07B 1ULEA 4AYUA 1U5YA 3SH5A 2WNUC 5C6CA 5I8TA 5KC5A 3SCHA 5H9SA 2GC0A 3WQ0A 1FYUA 1LU1A 4U2AA 1LGBA 2ZMLA 3IPVA 4DOUA 1PVC2 3V0BA 5GM0A 1LEMA 4YVWA 1RJ7A 4AHWA 4F3JA 1N1SA 1PIV2 1OHFA 2UY8A 4OULA 3S7IA 3PMSA 2XVGA 2D6KA 5AC91 4J1WA 2X5IB 3OJBA 4IV3A 1J58A 1ND3C 2C1FA 3QOPA 3RYPA 3O0XA 4NHKA 1LTEA 3ZMNA 3FUQA 5EZWA 4YFWA 5L7OA 4Q1RA 3I2DA 4XE9A 1HV1A 4W65A 4XEZA 4YGDA 3ZFEC 1TME2 1QJX1 3N3HA 3ASIA 2A71A 2RS12 4LBNA 4A7ZA 3TNQA 2DCZA 4N7UA 1ZZ7A 1YFXA 2I45A 3CL1A </