4HVOA

1.75 angstrom x-ray crystal structure of cufe reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title An Iron Reservoir to the Catalytic Metal: THE RUBREDOXIN IRON IN AN EXTRADIOL DIOXYGENASE.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 36
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hvoA01
4E2QA 4Q29A 2UY9A 3BCWA 2CAUA 3IWZA 1RTVA 3GBFA 3I59B 1CAWA 4TLFA 1NE4A 3ZDSA 5JSRA 1LKNA 4E2SA 2PA7A 3E5QA 2OPKA 4D7TA 2GAUA 5JSOA 4I0AA 1ZX5A 5BPXA 2QVSB 4IETA 4X6QB 3H1MA 2KXLA 3H7JA 4I2OA 3M70A 1QXJA 3H7YA 4JV4A 1DGRA 1JUHA 2H6CA 3CO2A 4I3PA 4I02A 1ZZCA 3FFQA 4OLLA 4AVBA 4H7LA 5BXXA 4YYOA 4HSLA 5J48A 3JZVA 3E6BA 4XETA 1RUOA 2OYZA 3SHRA 3ELNA 3OTFA 3ETQA 1H1IA 1UCXA 5KHKA 2IXCA 5FLJA 4Z07A 4FBFA 3RYPA 1WLTA 4IEOA 3CEWA 4LA2A 3FJSA 2PAKA 2Q0AA 4MZUA 1LR5A 4MGZE 1OMIA 1YWKA 4HLTA 1O3TA 4IEUA 4JVAA 3ES4A 1OI6A 3PLQA 3EQEA 2EAAA 4R8HA 4B29A 4KU8A 5I8YA 1DZRA 3KCCA 4XF4A 4YNIA 3CJXA 4KWKA 2D5HA 1YFYA 4HVQA 3HIFA 4MGKE 5LEJA 2O8QA 2PYTA 3RYKA 4XF0A 1EYBA 1J3QA 5LEKA 4XFGA 2ATFA 3WW1A 4FAGA 3DV8A 5E16A 1GQHA 2ZKLA 1DGWA 1SEFA 4HBNA 2Q4SA 2ZCWA 3ES1A 3MDPA 1ZNPA 3B02A 4AXOA 1NYWA 1CAXB 1EPZA 1YHFA 4N9IA 2Z69A 1OD5A 1CAVB 4XFBA 3USSA 1RC6A 4BYYA 4JTNA 3E5UA 1RUNA 2PTMA 2H0VA 4LUKA 4Q0QA 1GQGA 2VECA 4N9HA 4MX3A 1UW8A 3LA3A 4I01A 3RPQA 3U10A 5BY5A 1ZZ9A 1CGPA 3OGJA 2PAEA 3G7DA 4MUVA 1YFUA 4NVPA 1VP6A 3OF1A 2OZ6A 4LULA 2QCSB 3H9AA 1EY2A 1VR3A 3H3ZA 2OA2A 1X7NA 2MNGA 5I0TA 3ACLA 4KL1A 1J3RA 3UKTA 2GZWA 2VPVA 1ZZ7A 4PIYA 4IEYA 2FMYA 3TNQA 4META 4LEJA 2BEOA 4X6RB 3LOIA 3SCFA 5I93A 1YFWA 2MPFA 1YUDA 4HN1A 3RZZA 3DKWA 4YARA 3HT1A 1WGPA 2XLAA 3HQXA 4GULA 4AQ6A 2PHDA 2XL9A 2UY8A 4IESA 5E1RA 3I59A 3VHRA 3OD0A 4O9GA 3SXWA 3S0MA 2IC1A 5I0UA 1HW5A 4P9GA 5CU1A 3E6CC 5JCTA 3WW2A 2FQPA 4DINB 5J7MA 4IEQA 3FHIB 1X8MA 2IXIA 1Q5OA 3EO6A 1SFNA 4ONUA 2PAMA 3U0ZA 3KMHA 4QXKA 5LRSA 3CF6E 1PM7A 4Q0VA 1IPKA 5BV6A 4KWLA 2Z2SB 3D0SA 1FT9A 3EJKA 3FX3A 5J3UA 4FT8A 2GC0A 4I0BA 2CAVA 3DL3A 4XFCA 1QWRA 2PHLA 2GU9A 1J3PA 2XGXA 1RL3A 4YSFA 3ST7A 3CL1A 1ZRRA 4EWEA 4XFFA 3FE5A 4BIFA 5I0RA 4Q0UA 3UKNA 5K8SA 3R6SA 3E5XA 3EBRA 5C6CA 3L2HA 3LZZA 3RDIA 4WZCA 1SQ4A 2PFWA 2CV6A 4WVZA 2WFPA 3WW3A 1WA4A 2MHFA 3NW4A 1O5UA 4XEZA 2XLFA 2Y0OA 3NJZA 2EA7A 5FPZA 2Q30A 4AQ2A 1Q43A 3E6DA 5KHGA 2BGCA 3TNPB 3IIAA 4WBBA 1NZCA 3C3VA 1ZRDA 4IERA 4PIZA 5AVPA 5CADA 2XHKA 1ZRCA 1Y9QA 4MGIE 3BPZA 5FLIA 5T3NA 1O3QA 4QX5A 3QOPA 1Y3TA 1CAUB 4EWDA 1DZTA 3H50A 1XE8A 2XKOA 4XFIA 3BALA 1CAXA 1ZVFA 4LA3A 3PVBB 3E97A 2UYBA 1CAVA 5FQ0B 4BH9A 1UPIA 1FXZA 2BNMA 4LUMA 1IPJA 4XF1A 4A2UA 2EVXA 4I09A 5D1IA 5JAXA 1ZREA 4JTOA 4QMAA 3HT2A 5BUVA 2F4PA 5FCCA 3UKVA 3MZHA 5JSPA 5I8TA 2QDRA 3WW4A 4HN0A 5EZWA 2VQAA 4XF3A 4EV0A 1I6XA 4BHPA 3OCPA 1LRHA 4IEVA 3LA2A 3H1WA 4PIXA 5EFUA 4LTAA 4E2GA 4QGMA 5I8SA 3N4MA 1J1LA 1CAWB 4J1XA 4UXAA 4LLOA 4Q0SA 3D0JA 2IXLA 5FLHA 2BYVE 4RD7A 4R52A 3I54A 3H1YA 2ET1A 2QJVA 3H3UA 3QACA 4YRDA 1O4TA 2UYAA 1O7FA 3D82A 4HMZA 1YFXA 1UIJA 1X8EA 2HJIA 3BB6A 4HVRA 1X82A 4F8AA 4PJYA 4MH0E 4OFGA 4FAHA 3SCHA 4CYDA 4EWAA 2IXKA 4QM9A 1ZZ8A 4IEWA 2B8MA 1Q3EA 4XFAA 1ZRFA 3S7EA 1NE6A 1V70A 3IDBB 1O3RA 2XL7A 3FZ3A 2DCTA 1LB2A 2QNKA 2D5FA 2OZJA 2PQQA 1NXMA 3IDCB 1ZZBA 2N7GA 4QGLA 1XE7A 1FI2A 1UD1A 2GC2A 2IXHA 4Q0PA 2CGPA 2I45A 5LRRA 3S7IA 1L3JA 2B5HA 1PMIA 3NKTA 4L2NA 4AVCA 1U12A 3KGZA 3RNSA 2BNNA 4K8FA 1YLLA 3EHKA 4O9EA 5JR7B 2E9QA 2Q1ZB 3O14A 5I91A 4ZU7A 3SMHA 4HVOA 5CVRA 3LA7A 1J59A 4QM8A 3ROUA 3GYDA 3NSTA 3MPBA 1XRUA 3U11A 4XFHA 2P17A 3PNAA 4MV2A 2HKXA 4ORFA 2D93A 5KHHA 4J1WA 2GH2A 2D40A 3CLPA 5FDBA 5FPXA 4ZU4A 5HI0A 5KHJA 1TQ5A 5KBFA 2ET7A 2K0GA 3FWEA 2GC3A 5I0SA 2K9ZA 3M3IA 3KGLA 5KHIA 1G6NA 4KWJA 4IEPA 3H8UA 3IBMA 1VJ2A 3RYRA 1J58A 4L11A 2IXJA 1H1MA 4HSJA 4UBHA 1EP0A 2BNOA 3LAGA 4IEXA 3BU7A 1CAUA 4KU7A 3DN7A 4UBGA 2B9UA 1OFNA 2C0ZA 1RGSA 4ZU5A 4QGNA 1QY4A 4IEZA 1O5LA 5FQ0A 2XKPA 2H6BA 2WC2A 2ETEA 2GC1A 3I7DA 4Z82A 1UIKA 1CX4A 5C8WA 3NVCA 4XF9A 3KSCA 1ZZ6A 1I5ZA 4AVAA 1O3SA 3MYXA 3NL1A 2V09A 4EROA 4HZFA 4MGYE 3LWCA 3SCGA 2XLGA 4F7ZA 4D7SA 5F1RA 1QXRA 2O1QA
chains in the Genus database with same CATH superfamily
2W0XA 4K40A 1UY4A 1UZWA 1Q8PA 4Q29A 4DB5A 2CAUA 1EAH3 1SBEA 3GBFA 3WF4A 5FMCA 2WUHA 3GJBA 1XNBA 1N1YA 2DBIA 4DZGA 3ZSEA 1Q8VA 1QEXA 1QJEA 4PDWB 3JQWA 4XTMA 1MZ6A 4D7TA 2OPKA 2GAUA 3SNMA 1QJX1 4NIHA 1AL23 4EN8B 1ZX5A 4COZA 2HWD3 4RGGA 4GAZA 2ZEYA 2VY0A 1AR91 1R091 3DKQA 5FZOB 1XBFA 2E26A 2R072 4CPBA 2AR6A 4AHWA 5L7OA 5F9TA 2IFWA 2E7QA 3I8TA 4JV4A 1C1FA 5FO8B 3HN3A 3K77A 2YC4A 5FYVA 3POFA 1UU4A 4Q8LA 1XPWA 1W2TA 4Q4W3 4ASKA 1IKPA 2FDIA 1WCKA 3VHOA 3RFRA 4YYOA 2P5BA 5J48A 4XQWA 3BYWA 3PUHA 2YGLA 3K3NA 4MGQA 5A7WA 1VPHA 1UMHA 3C7HA 1W99A 1D4M1 1ONAA 4LHSA 5JIUA 1LOAA 1M4WA 1HX6A 3DPRA 5AC92 4N53A 3E1F1 2VZ3A 4FSJA 3VKFC 3VUOA 3LEMA 4RS5C 3UGGA 1YI9A 5DAPA 1W3VA 3MW4A 2BRTA 4D94A 2VL4A 5HPOA 5L9VA 2CDPA 2IXCA 3ZN5A 5A3NA 1T2XA 2VOKA 3OBZA 4LA2A 3IN9A 4EE2A 3FJSA 3IMNA 5F5CA 2Q0AA 3M8LA 3JD73 2VD7A 1W6QB 5KXEA 1YWKA 2W1UA 3TBDA 3M2MA 5FY1A 4ES9A 5A3LA 4D6SA 2QTWB 3RMXA 1LOFC 4KU8A 5I8YA 1DZRA 3MEPA 4XF4A 4RR3C 5FKBA 3FC0A 1NCRC 1Q56A 1X33A 3FLRA 4L9BA 4YNIA 5FZDA 3WLUA 2B42B 4HVQA 3HIFA 3THDA 4EQVA 4FPJA 2DUOA 5IK5A 2O8QA 2V5YA 2X5IC 4UYBA 4WV8A 5FYTA 5A1FA 2PYTA 3RYKA 3MLKA 1EYBA 5F3CA 4D3WA 2IWGB 1KQRA 1GNZA 1XYPA 2ATFA 1NT0A 2VTFA 3PMEA 3DV8A 2ZX2A 5IVJA 5HCHA 1FOD1 4N90A 1DGWA 4K21A 1A78A 3ZFFC 2GNMA 4W4ZA 3LIHA 3ZXFA 1BBT1 1WCSA 4A6SA 4ATFA 1SLIA 5DXDA 3RI8A 1XYNA 5FR3A 5DQ0A 2QBXA 3ZMOA 3ACIA 3C7GA 4KH9A 1V6MA 3KV6A 4JGYC 4NIIA 2FCVA 1OD5A 1CAVB 4AZZA 4P02B 3USSA 2AH2A 4XDQA 3VBFA 4JTNA 1HN0A 4LBQB 3VBOB 3VDBA 2JX9A 2Q5TA 4FPOB 1PZ7A 2KR2A 3WV6A 2PTMA 3ZLIA 3NJXA 4P9WA 4NR1A 5GLUA 1BEV2 4LBKA 4Q0QA 4L0PA 4YVWA 2VOWA 1GQGA 2R30A 4MX3A 3LA3A 2VZTA 1W8ZA 3ON7A 2V5DA 2ARBA 3U10A 4RQPB 2E51A 3N7LA 1SFYA 3PJYA 2ERFA 3VBOA 4P9LA 2YBPA 2D7FA 3OGJA 4MGTA 4XUPA 3VZLA 1W8WA 1YFUA 3KS7A 4NVPA 4QPWA 2ZGUA 3FBMA 4GWIA 3OF1A 2PHFA 5FP7A 2R041 3H9AA 1OA3A 1RUF3 4FOWA 5FBZA 2R073 4Z1VA 4CEWC 3UJOA 3R05A 1Z7S1 1H9PA 2OA2A 1JOJA 2OUJA 5C9AC 5I0TA 4C1XA 2RDNA 5LW9A 5CB7A 1BBT2 3MUZ1 2GZWA 2W68A 4MVTA 4PIYA 5C8CB 4PLNA 2ZHLA 4AVVA 5CEHA 1XC6A 3K75B 3PVNA 2RM22 3TNQA 4LXLA 2WNVA 1WBFA 4IGOA 2VW2A 2VTXJ 2XMLA 3PTYA 2ZA9A 1HB3A 3U37A 1VAVA 3DKWA 3VBHB 2XLAA 1UZ0A 3IIIA 4QU1A 2ZACA 3ALQA 4ISQA 5BNPC 5FFOC 2YFUA 1R081 1HV1A 1LGNA 2PHDA 2Y34A 1W90A 4IESA 2CWMA 1MVQA 3I59A 5E1RA 3OD0A 3QD6A 5C3SA 5D8AB 1PO21 1JZ8A 1S0EA 2WNUA 5CU1A 2ZMLA 5HXMA 3E6CC 5T52A 2A1XA 5C7GA 1KS5A 1VE0A 3WNMA 5M0TA 4YWAA 3AMPA 5HCBA 1X8MA 2A6VA 5E89A 1N47A 1HN1A 3VHNA 1AR93 1R093 2R042 2WFF1 2QE3A 4X8NA 1E5HA 1KS4A 3O12A 4IV1B 4Q1PA 1QMJA 1ENXA 3V65A 1MS3A 5B4XA 4Q0VA 2ZHNA 3SEPA 1ACCA 5JUVA 1COV1 3CJIC 1SDWA 2O0OA 3S6PA 1DZQA 1HB4A 4BQXA 4NN0A 5LWBA 3R4DB 2Y0IA 1VBA1 4HOOA 2AYHA 2DFCA 1ZYBA 2PHXA 4IW3A 2ZGLA 1JZ7A 4AQSA 3D5OA 1RHI2 3LE0A 1OF4A 1D4M3 4IV1A 4ZZ8A 4C91A 2NM1A 4XDPA 1J3PA 1ULGA 3F2ZA 4GB31 3X29B 3ASIA 2BOIA 3PUIA 1QU0A 3LGRA 3JBG2 5CFCC 4EWEA 4XFFA 2YBSA 1DQ6A 3NNLA 1WLDA 4P00B 3RSJA 5JMCA 2J1UA 2WT0A 1GZWB 5H9RA 1UN1A 2DURA 2Y8KA 1ND3C 3SEEA 3R6SA 5IHRA 1VRBA 5K8SA 3DECA 5LK5A 3P1IA 4DRRA 1QOSA 2WZR2 3LZZA 2V72A 4LIVA 1W9TA 4CCOA 2JIJA 2PFWA 4WVZA 1AXKA 1LHUA 2DF7A 4A6OA 5IVBA 3SKJE 1QQP1 1DQ1A 4XDOA 2XBO1 1ULPA 2WKKA 1O5UA 4BJ0A 4N43B 1DGWX 2DVAA 1ZA4A 4QKDA 4AQ2A 1Q43A 2FZ1A 3N9NA 3AKPA 3H3LA 1E5IA 1W9WA 2BGCA 2NLRA 3IM0A 1WZXA 4WBBA 4CPBD 2I74A 1GV9A 1NZCA 3PDQA 4E4DX 3I2IA 4PIZA 4LIUA 1OOPA 1W8OA 4WM7B 1MS5A 1KEXA 1AR61 5FK8A 3O0WA 4KBBA 5FLIA 2V4AA 3CMGA 2A3YA 4KMQA 5JOYA 1FOD3 4QX5A 4AG4A 1Y3TA 2KM2A 4EWDA 3OBTA 4CTEA 3MO4A 4A4AA 4Q8KA 4AHZA 1BBT3 5F5QA 3RJRA 2J7MA 2VW0A 1C1LA 5HV0A 3GCWA 1KRIA 1DBNA 1ZVFA 4LA3A 3PVBB 3W58A 2D6KA 3ME2A 2RM23 3E97A 5FP4A 4XILA 2QQKA 1PHMA 2QZ3A 2YYOA 1NOVA 4LUMA 1VAMA 1N1SA 2C5DA 3NAPB 4QX1A 1OC1A 4RGAA 1W2NA 5JPMB 5EXOA 5SV8A 2ZGOA 4FTEA 1XQNA 2F4PA 3GJAA 4XXAA 5FCCA 2RJ2A 3WF3A 1L7RA 1KD7A 1GNYA 4BM8A 2ZKNA 2JG9A 3DYPA 1B35A 4PDWC 1ZA7A 4NROA 2RVAA 1LODA 2YY1A 1H2NA 3ACFA 1L7QA 3FUOA 2IFRA 2W1QA 2JDUA 2DV9A 2KA3A 3FHQA 4CCEA 3LSDA 4JGZB 4JQTA 5CKMA 2R043 1CZSA 2V73A 2XH6A 4OUSA 4A7ZA 4PBPA 1Z7S3 3RS6A 4PLOA 5FUIA 4YLZA 4YRDA 1UX6A 3QACA 3P5BA 3ZXKA 2UYAA 1O7FA 4Z92B 4A45A 1QIQA 1O4ZA 2UWAA 5FY8A 2GNTA 2EIEA 4HMZA 2PN5A 3HNBM 1X82A 4P5YA 5G05L 5FXXA 4JGZA 4ASMB 1GOFA 3GZTB 1OLQA 4LKDA 4OQ8A 1VIWB 4DOUA 2ZGRA 3WXPA 3VGIA 3POBA 2J1SA 3R4SA 2OXBA 5EPAA 4EWAA 2IXKA 3OYWA 5FZ7A 1R083 4E8DA 4JX0A 2E7TA 2ZX3A 2G9ZA 1NG0A 5FUNA 3P3NA 1RITA 2VMIA 1PO23 4IQPA 4QPGC 1VB2A 5T5LA 3KM5A 2E31A 3MUY1 4TSVA 3B3QE 1O3RA 4GQ7A 5FZ8A 2XL7A 3JUUA 2E63A 4UAPA 1UU5A 4YG6A 4AI2A 1CPNA 1GYKA 4M3CE 2DCTA 5FKCA 5IUQA 4XJ8A 2P3YA 3VBUC 2D5FA 2OZJA 2PQQA 2W5FA 1NXMA 2XJPA 4IE4A 3USUB 4QGLA 2VVEA 3WP4A 1LTEA 4CCNA 1FI2A 2IXHA 4AFCA 3UNPA 2CGPA 1GMMA 4R9DA 3FBYA 5GLZA 2B5HA 1JYXA 4LJHA 1J1TA 1LU2A 4IV3A 2YUEA 3U4XA 4L8QA 1TNRA 2Q1MA 3NKTA 4DIQA 5FIXA 2EXJA 5FMDA 3RNSA 2ZGNA 3ZSKA 3WNXA 1VBA3 1YI7A 2W08A 2QQLA 1H2LA 1RVF1 2ZX1A 4FP2A 2R0HA 4O9EA 1ODMA 2HWC1 3FFZA 1PM4A 4XUOA 4L92A 4GD4A 4DY5A 3IPVA 2XDVA 1AR81 2H0BA 3NJYA 1XB9A 4I30A 1DYKA 5JMOA 4GB33 5DAVA 2JJ6A 3W21A 4RS5B 3AKRA 1FV3A 2Q8DA 3Q8BA 1R1A2 1QJU1 3GM8A 3OY8A 2P17A 1JHNA 4MV2A 1QHDA 4CCLA 2WQZC 1AX0A 1WCDJ 4PLMA 5FZKA 2JENA 5KHHA 1IS4A 5FPBA 1RUD2 4CXXA 4BMBA 3INAA 3M4FA 2WT2A 1HRI2 1QQP3 4OHXA 5EYXA 4RS5A 5AVAA 3T09A 1W0OA 3VN4A 1S1AA 5FPXA 5HI0A 1LULA 2VMCA 2DU1A 1UYZA 3GNEA 4UT5A 4FOYA 5I0SA 4LKSA 4Y26A 3AJYA 1W9SA 1ENQA 4AVSA 4BISA 3KHCA 4RQPC 1OUSA 1PZ9A 4JDMA 5FYIA 2XVGA 3A22A 3B9IA 2WQ8A 2PHUA 2FZ2A 2VTXA 3IBMA 1VJ2A 2JG8C 3ZSJA 1J58A 3AL5A 3T30A 1KFUL 5FV3A 3A23A 1UYYA 2RG4A 4Y4YA 4LR4A 4M4RA 1AR63 2BNOA 4NOTA 3T3YA 3W5NA 1LOFA 4IEXA 4GMP1 3WD5A 1TMF1 2W92A 3ZFGC 1F4HA 4HETA 4Q27A 1OH3A 1QJFA 2HH9A 4RR3A 1NCRA 1WCUA 4FPFA 1SLAA 1CAUA 1QOTA 4XJZA 5CG9A 2YU1A 5C8CC 4AAPA 3CKHA 2BVBA 2B9UA 3VD3A 4Y3OA 4LT5A 1XXNA 3OEBA 2X5IA 2DTWA 5CG8A 1TME1 4COWA 3ZPYA 1O5LA 1US2A 4Y5TA 4GH4C 2XKPA 4BCUA 4HKWA 3VBHC 3TN92 3Q8AA 3WDVA 2ZEWA 3M1HA 4FQ4A 4V2WA 4YW1A 1MS4A 1PIV1 3POSA 5FOJB 5A3OA 3KSCA 4AVAA 3NL1A 3JXSA 4ASLA 1QNWA 2RDSA 3ZFFA 1W6MB 2JKBA 1UO9A 5D8AC 2L9LA 3U4SA 4QD2A 4MGYE 3LWCA 2ORXA 1OH4A 2XLGA 4CP9B 5JXHA 4D7SA 4JGYA 1CESA 4Q4Y2 3DCQA 2XWJB 4K1YA 1XNTA 2WZ8A 5DAWA 1AL21 2DUQA 1QH7A 2XXZA 4O7XA 1SCRA 1AJKA 1TNFA 3ZIWA 1KITA 1UOBA 3BCWA 4G9SB 4LBNA 1RUC1 2VBPA 3IWZA 3ABZA 4RSUA 3AVRA 4EN9B 1CAWA 3FN9A 5JOZA 1NE4A 2BDRA 3VL8A 4CEWB 5F6KA 2IVIB 5JSRA 2XG3A 3RG0A 1LKNA 1PVC1 2RV9A 1DFQA 5F8PA 3E5QA 4B4PA 3BI3A 3MW2A 1CZVA 4MG2A 5BPXA 1ZBA2 1Z78A 2YFZA 2NPIA 2VE1A 3H1MA 2TUNA 2J1EA 3KQRA 3POYA 2YXSA 1NA1C 3THTA 4B1LA 4DEVA 1GQPA 4JDNA 1JUHA 5FYYA 3URFA 1BVVA 3UK9A 1PGL1 1D2QA 5FZ1A 3QLQA 3GALA 4FFFA 5B2GB 5JR2A 2W95A 1OKOA 3LEKA 1ZZCA 2TBVA 4MXWA 5T5OA 5C9AA 3Q8CA 4M01A 2FCTA 1XSRA 2WABA 3PU8A 1Y7BA 3POIA 4JDOA 3I3DA 1K5MA 2RDQA 4UOJA 4NHLA 3VBRB 1A34A 2WWJA 4ZZ5A 4XURA 2LS6A 4BZ4A 1T6GC 1HJFA 1C5IA 1R1A3 4HKLA 1YJKA 4QPYA 2Y6HA 4FPEA 4Q26A 3MFAA 3AMNA 1REFA 4QHOA 1UY2A 1SLLA 3PURA 3JZVA 4BQ1A 3E6BA 4QXCA 5JI9A 2XJTA 2OYZA 4AAXA 2P3JA 1KJRA 5BNPA 1RXFA 2VZ1A 1QDOA 1WMEA 1NUKA 3AM2A 4ZXEA 4AHYA 4AGGA 2YGMA 4N43C 5CZKA 4AI0A 4HPKB 4EN6B 5A3MA 5FYSA 5A7NA 3RYPA 1WLTA 1OHFA 2Z79A 3VKNA 3CEWA 2JEMA 4O61A 4OI0A 4J25A 1JBCA 3WDXA 3CJIB 1UY0A 3MV11 4MGZE 3RZHA 4WM7C 5C4WB 4CUGA 1H8VA 1RVF3 1R1ZA 4CUAA 2FD8A 5FYBA 2HWC3 3VZKA 1CZTA 4BQ4A 1XU1A 2EAAA 1C8M1 1F35A 2WS92 1ND2B 4LHLA 4LMFA 4P08A 4R8HA 5F39A 3RGBA 1AR83 3W9AA 4CP1A 3KCCA 4Q4X2 4QB1A 2VZSA 2BTVC 5DUXA 4RHV1 4KWKA 1BYHA 2D6LX 4OCTA 4XUTA 3WF1A 3EMRA 1QJU3 1W8NA 1W05A 3N7KA 4XAEA 1CIWA 4YW7A 4M3CA 4XF0A 3T0AA 3BU0A 2A6WA 5KR7A 4CDWC 1G9CA 1J83A 1JTZX 2WZEA 2ZAAA 3K51A 4FAGA 2VNGA 1RUI2 1S0CA 5A80A 3NAPC 5E16A 5ACA2 2JB4A 1GQHA 3M3EA 4C0BA 3TN93 2ZKLA 1SEFA 4HBNA 1AR71 2Q4SA 5CFCA 4GKYA 2R7EB 1LHWA 3TOJA 3SH4A 4M0HA 4AE2A 5JZGB 1IPSA 1CAXB 1EPZA 1CWPA 1ND3A 1Q8QA 4WVWA 1STMA 3I4IA 5CNAA 3OEAA 1JMUB 3MIEA 4LE4A 1E57A 1BZWA 4XCAA 4B7EA 4DMIA 3M3QA 4Q4Y3 4HG6B 4BYYA 1YQ5A 3E5UA 1FPN2 4BQ2A 1UKGA 3WOGA 4COYA 1RUNA 2JDMA 4BB3A 1FMD2 4NHXA 3AYDA 1XNKA 1POQA 1S4CA 2JB8A 4FFGA 1DP0A 2VECA 2ZS6B 4GMP3 4IUGA 3ZFEB 2SBAA 5J36A 1CR7A 3RPQA 2XQXA 1HQLA 3A7QA 4YVSB 1KDKA 1VLNA 4AEKA 4AVTA 3C7FA 2YC0A 3G7DA 1TME3 4MUVA 1ASJ2 3GHNA 3KF3A 1ZBA3 2Q8CA 5JXGA 3O1MA 1VP6A 3KCXA 2OZ6A 4IE7A 5DAQA 2VZRA 5ERLA 3ZN6A 2XHNA 1E5RA 5GM0A 2CGOA 1IKQA 3V0BB 2QQUA 2XJVA 3MIHA 3T2QA 3UGFA 2MNGA 1W6NA 5AC91 1PIV3 1VBC1 2ZMKA 3ACLA 1J3RA 3HNYM 1WW6A 3BOWA 2JIGA 1ZZ7A 4CSWA 1VBE2 3OPWA 2PHWA 5IFPA 5BNQA 2FMYA 4META 1VB4A 3WG1A 5LK7B 5D2AA 2YC2A 2WRAA 3SCFA 3RRDA 3WX5A 1W28A 1YFWA 2MPFA 2X10A 4UFIA 5FZCA 4CDUC 3RZZA 2VMDA 1LEDA 5H9SA 1U5IA 2VCAA 2Q1FA 2XONA 4DQAA 4QQPA 2ARCA 2NYYA 3O0VA 2SLIA 3P6BA 3WT3A 5FPUA 2XL9A 4NHMA 2C24A 2NN8A 1RUC3 5GZEA 4N7IA 3BOPA 4GA9A 5FZGA 5FZMA 3ZXEA 5I0UA 5FP3A 5FYCA 3OUIA 3OD4A 4PDWA 2FQPA 1PVC3 2G9GA 4WZFA 3ZYGA 5IT6A 4YGBA 5J7MA 1F4AA 2B4KA 3JU9A 1PO12 5ABJB 2Z4FA 2EIGA 1UPSA 4ARYA 4ONUA 5FZOA 2PAMA 1GR3A 1GOHA 2WNOA 3UJQA 3ZR5A 3U0ZA 4H14A 1YJLA 5JXIA 3GXUA 4FVVA 3AP7A 1LAJA 3JB8A 1HJGA 1VBC2 1SMVA 3KV5A 4QXBA 1UQXA 3CF6E 2OPWA 2FDJA 4KWLA 4KWUA 4W50A 4Q4X3 5FWJA 1S0DA 2Z2SB 1GBGA 1WD4A 3EJKA 2FHRA 3N9PA 1PMJX 3FX3A 4SLIA 1AHSA 3GHMA 1UOJA 3VKOA 2YG0A 3O1VA 2GC0A 4QPGB 1RB8G 3DL3A 1UXXX 4XFCA 5HXVA 4D69A 4QT6A 2YB7A 1HLCA 5KXDA 1RL3A 3VBUB 3AFKA 4YSFA 2VJXA 1F15A 1ZRRA 3ZN4A 1SFPA 4CUCA 2P6CA 2XJQA 3FE5A 4BIFA 5GJ6A 5HCAA 5I0RA 3NJVA 3V56A 1D7PM 3JCIA 1GOGA 3N9QA 3NV3A 1BEV1 2HEWF 4DEQA 3V64A 5C6CA 3L2HA 1CIYA 1WMDA 3HOBA 1BMV2 1O8PA 1MS8A 1W6QA 1RMU2 2CV6A 4NRQA 3RZJA 2XJUA 3T0BA 1IS6A 4F83A 4KGGA 4CEYC 1IGOA 1C8M3 1JODA 2RDRA 1G8WA 2D3SA 2DFBA 3W59A 1QGLA 5A3PA 1DQ5A 3WUCA 3E6DA 1DGLA 3ZYIB 3K4AA 3G6JB 1IOAA 4RHV3 3WUDA 1C3HA 1XJAA 2QQOA 1F9KA 1IHMA 4PI0A 4C0HA 3C3VA 1LCLA 3EYPA 3WNPA 4N7UA 1AX1A 3C7OA 4IERA 4Y20B 5FYZA 2ZZQA 3TAYA 1ULFA 2D6NA 1KFXL 2RM21 3U07A 4BE3A 1G9DA 4RN5A 1JUIA 1W6PB 3GZAA 3WZ1A 1YQ8A 4LOTA 1O3QA 2BBVA 1W9YA 4GWNA 5HV4A 4BLJA 4CU7A 4W6YA 1AR73 4NIAA 2CGNA 3WG2A 5FRAA 3OGVA 3APBA 3MIGA 4B8EA 4RL7A 3BALA 5L36A 2BUKA 4QDRA 1FX5A 3WQ7A 1CAVA 5FQ0B 5FZ6A 2LALA 1FXZA 2CTVA 4MSVA 3TEZA 4Q4V2 4M3CF 2AGSA 3DXUA 1VBD2 1HB1A 1HQWA 2C26A 2OQ6A 3ECQA 4LBQA 4WVVA 5D1IA 4OI1A 5JAXA 1M06G 2JG8B 2Q8EA 2AC1A 5EJZB 4CRQA 1NCQB 3A0NA 3HT2A 5BUVA 4KQ7A 3R0RA 5GLWA 1OQ1A 5A32B 3ZOIA 2ES3A 5FOBB 5JSPA 1MACA 2QDRA 2ADDA 3VKMA 3ILNA 3KF5A 1H8TC 5LA9A 3A4UA 3AP4A 4P9JA 3WW4A 3ZFGB 4RQPA 4URAA 4UFJA 1W06A 1OURA 4XF3A 4H7MA 2VZVA 4UW3A 3FL7A 5FYMA 5CKNA 3S5AA 2JG8A 1XU2A 3H1WA 2IZWA 2BFUL 1LGBA 4LTAA 5JXJA 4ATEA 5I8SA 1H4HA 3CU7A 4GXLA 2BQPA 2OUHA 4GH4B 5LBFA 2R1DA 3D0JA 5A3WA 2YROA 3WF2A 1RHI1 1Y9MA 3IB3A 5IJRA 4RD7A 3ZFGA 1UU6A 1VBC3 5AC93 1SBDA 5FMOS 1UY1A 3VBRC 1HKDA 3ZMNA 1GZ9A 1Y4WA 5C8CA 3D82A 3BTAA 4BWOA 3KV9A 3JBG1 2CU5A 4MLOA 4E27A 2VW1A 3AX4A 1AZDA 3ZM8A 1S2BA 4L97A 4A44A 1JU3A 5A1LA 5K0UB 3A21A 4NWWA 1GANA 4OFGA 1IG3A 2DVFA 3VBHA 4FAHA 3SCHA 3O1PA 1F2NA 3L2YA 3N35A 2WZR1 1DDLA 3AMHA 4QHZA 1QH6A 4PI2A 1PGW2 1U5YA 1ZZ8A 1GKBA 1VBB2 2R0FA 4IEWA 3T4HB 1ODNA 1OQDA 5C5TA 5D8AA 3ZKYA 4OYUA 1K45A 2B8MA 2ENRA 1RUJ2 4XYXA 2BU9A 4YW6A 5FY0A 1JS9A 3LDKA 1NE6A 5FZ4A 1V70A 4AFBA 2BVVA 2VMHA 3RJ2X 2WJSA 2YV8A 4GWJA 1REDA 5IVFA 5C4WC 2UURA 2QNKA 4XHBA 3IDCB 2PHTA 2N7GA 5D21A 4XMIA 1OXCA 1XE7A 2GC2A 4EJRA 3N3HA 4XAAA 1D0GA 5EV7A 5A7SA 2BV4A 1ND2C 4Y1YA 1CD3G 3H42B 1L3JA 1NA1B 1PMIA 4OULA 4RYDA 5A6QA 1HXS2 2LM3A 4BA6A 3LDBA 5LA0A 4ZS2A 4XZUG 1WBLA 4AVCA 1U12A 3VB9A 2LRPA 2YMZA 1WMXA 1POV1 3EHKA 5GZFA 4H55A 5CBLA 1OVPA 5LBEA 2D43A 4QAWA 1JYNA 1ENRA 4CCJA 1Q8OA 1BQPA 2Q1ZB 3CHXA 4J6GA 3WG3A 3O14A 3OUJA 4Y24A 1AUYA 4ZU7A 3H8XA 5CVRA 4MOAA 1J59A 2ZGQA 3ROUA 3GYDA 1XNCA 5FMOL 3NSTA 4CE8A 5A6XA 4OHYA 1W6OB 3WDUA 5IW0A 3ZXDA 5JZGC 5GZDA 3WQ1A 1XRUA 4BIOA 5KC6A 1IQDC 1GZWA 3LKJA 4NIGA 5FZEA 2ID4A 3PNAA 1BEV3 3FLPA 5IWFA 3C8XA 2Y6FA 5F32A 3SKVA 1LGCA 2QQJA 4J1WA 2VBDA 5FYHA 5A70A 2D40A 4OI2A 1US3A 1FYUA 3HAGA 4WM8C 5FDBA 5DZFA 1VBD3 2DDUA 4P9IA 5KHJA 3KQ4B 5KBFA 4EN0A 1OKQA 2R32A 3ENRA 2GC3A 4N43A 2XQRA 2ZGTA 3ZFEC 3SC7X 4K8RB 2Y26A 5KHIA 2WSVA 2WYFA 4KWJA 4BK4A 1F5FA 2G9FA 4AOCA 4DY3A 2Y60A 5J1XA 4Y1XA 4YVSC 3WVJA 4JCKA 1OLMA 3HNMA 1S0FA 3IZOA 3PJQA 5GZGA 4WM7A 1U0AA 2IXJA 4S2GA 1H1MA 4XJUA 3VZNA 4Z8BA 5J37A 2R16A 2W94A 3ATGA 4UBHA 4CDWB 3V0AB 1WLWA 5FP8A 1A8MA 1UAIA 3N36A 2WWUA 4UFHA 1GZTA 3BU7A 3AVSA 1JZ4A 3CQOA 4KU7A 3DN7A 1MZFA 5A33B 4I3GA 2VGDA 5FREA 2OVUA 4ZY9A 1RGSA 3RWNA 4QGNA 1W2AX 3JQXA 3ZYFA 2XVKA 4CDWA 5T5PA 4BQ5A 4WVMB 2WC2A 2VMGA 3WDWA 4GMP0 3NAPA 1UIKA 2J1TA 2FMDA 3B9CA 4DXZA 4NIDA 3P3PA 4PBOA 4D7YA 2NZ9A 1ZZ6A 4QU2A 3WCRA 1GP4A 4QQHA 1O3SA 5A33A 4LITA 2LROA 3JB4C 3NRUA 3ZIXA 3AP6A 2ZHKA 3B7MA 1JZ2A 1VBB3 1SACA 4HZFA 2CHHA 1C4RA 4LHKA 4F7ZA 2VZOA 4NE9A 4YZ4A 5CA6A 4FPCA 4B4RA 5ABJC 1IZ3A 2RJKA 4QQLA 3VZOA 3GGLA 1XOYA 3J9SA 3LB9A 3T2PA 5FO9B 2HWF2 1OSGA 1W3XA 2WNEA 2WN2A 5FZBA 3K4DA 3LQCA 5C3OA 5FAXA 1YXWA 3ZXJA 3WNLA 4Y22B 4YG0A 3ZDSA 1AVBA 1Y9GA 2D6MA 1RHI3 3KD4A 3AZVA 4AWDA 1S2KA 4DUVA 2P4EA 4PQ9A 5CAZA 3NV2A 1SG3A 4UW6A 5FP9A 2PA7A 5DZEA 1JYVA 3VD4A 1TG7A 3LDRA 2VCBA 3OB8A 4XPVA 5JSOA 1AYM2 2WO1A 3ILFA 3JBG3 3WNOA 2QVSB 2HBTA 4X6QB 1LECA 2ZHMA 1R1A1 3H7JA 3AYEA 4AEDB 3AMQA 1QXJA 4I2OA 3WQBA 1OD3A 3MLLA 3H7YA 1DGRA 4CDUB 2B39A 5F5IA 4YM3A 5GZCA 4XOGA 1HQNA 1VRH2 2WZR3 1RUD1 1YQ2A 4I02A 2FDKA 4OLLA 1D4VB 1O91A 1RINA 1RUG2 4AVBA 5F37A 2R6QA 2VNRA 4EYUA 1HRI1 1V6OA 4W65A 4CXYA 4OZXA 2Z42A 4LBQD 2CSGA 2WL1A 1OT5A 4UFMA 2GN7A 2WA3A 4CDUA 2B46X 2JE9A 3PMSA 4XETA 3USUA 2YU2A 2A70A 3CZJA 2NMNA 3SHRA 1PZ8A 4X8PA 2AACA 3ELNA 2FCUA 3Q9OA 2P3KA 3D6EA 1VMJA 5DDJ2 3SISA 2VQUA 3BIWE 1J84A 1H1IA 1UCXA 1IG0A 1QJY2 4UWDA 5T5JA 5KHKA 1E5SA 1QF3A 4Z07A 4C90A 2X09A 3O1OA 2XOMA 5LATA 4ITCA 3PTRB 1S0IA 2UWCA 2PAKA 4MZUA 2VCMA 5BNOB 4P14A 2WO7A 4AFAA 1LR5A 4LO4B 1POV3 1OMIA 4RFT0 5GLTA 4HLTA 3GBGA 1O3TA 3J26N 3KHBA 4IEUA 3MIDA 4JVAA 4D6QA 1SLBA 3OPZA 1N1TA 2PQSA 1OI6A 2TNFA 1W2UA 1DYOA 3EQEA 3FHAA 1N3PA 1ZBE2 4Y1UA 4NUBA 3VZMA 3AP9A 4HONA 3TN91 4FTBA 1DQ4A 4LBMA 5F5AA 2OX0A 3UL2A 1BCXA 2D5HA 2HEYF 3HR9A 4E4HA 2OIIA 2E32A 4HXCA 3T1MA 3O7OA 4XQDA 5LEJA 4XBNA 2YBKA 1BJQA 1GFF2 4S2DA 5FPLA 1JYCA 5T50A 3SQOA 4AF9A 2RMU2 1SDDB 5FZFA 4YVWC 3WW1A 2B9VA 4AL9A 4ZKTB 4KBZA 4Q4Y1 2J42A 3GZUC 2WYSA 3N9MA 5CIRA 1ULEA 5A7OA 2VUJA 1X9TA 4QX3A 3POGA 2LW8A 4CDXB 3ES1A 1NCQC 4OZOA 3GCXA 2VQTA 4CEYB 5DUUA 4CCDA 2JDNA 1NYWA 4DS0A 1YHFA 4YGEA 1EV13 1F31A 4N9IA 3BKZA 3NNGA 1WA6X 4MHRA 4E4SA 1I9RA 4U2AA 1W39A 1NKGA 4DXSA 4W6XA 1AX2A 3F95A 1GSLA 2VUAA 4A41A 5EHDA 1ZBA1 2A71A 2A75A 2D97A 2R062 3BODA 3ZKUA 1RUH2 2PLV2 4LUKA 3D3AA 5FZ0A 1URXA 3Q8EA 4N9HA 4I01A 4YZ1A 1HIXA 1O59A 3HMYA 5KXBA 5FZIA 5BY5A 4NO4A 4OHZA 3B01A 1UZZA 1ZZ9A 3QH7A 4H2AA 4XJWA 1PK6B 1YQCA 2MEV2 4QDQA 1G7YA 4AEJA 2PAEA 5LB6A 3S30A 5K0UC 1IS3A 4JHTA 1C8NA 1H2KA 2AENA 2DCZA 2ZXQA 3DF0A 4LULA 3FLTA 4NPMA 2K46A 5LBBA 1VR3A 3AMMA 1X7NA 3B00A 1HDKA 3PUAA 1YIFA 2VPVA 3VBSB 3S57A 1RUG3 1W6MA 4IEYA 3B5LB 4S2FA 1KGYA 4QQ2A 5A6ZA 2EXIA 4YPJA 4LEJA 2BEOA 3RZLA 4CP9A 1UYXA 4X6RB 2VULA 1V0AA 3LOIA 4NPRA 3T2TA 5I93A 4HN1A 4UI9L 1H8TB 2VC9A 3MI8A 4NHKA 1CJPA 1WGPA 5JIAA 2VG9A 4XUQA 3U14A 1NZIA 3ZYJB 4DRVA 4SBVA 1YIPA 2C9AA 4GULA 1G9BA 3RZKA 4YW3A 3KLSA 1DGRN 2UY8A 4O65A 2A6ZA 4O9GA 4R9CA 3S0MA 2IC1A 4URTA 3ZYBA 4P9GA 4CEWA 2P3IA 5FK7A 1SCSA 1P8JA 1NAEA 1QJY3 2WS91 2E53A 3LF7A 3WW2A 5HBAA 2QUOA 4DINB 3LEIA 2Z5WA 4Q4X1 4IEQA 4K6BA 3FHIB 4NHYA 3B69A 3EO6A 2PHRA 3WQ0A 1H4GA 1O4YA 3UV9A 1XYOA 1DQ0A 3WHUA 2XPJA 2RS12 3LSEA 3GF6A 4HK8A 2RJLA 3WSOA 3TB0A 1PM7A 3V0BA 1OLRA 1RUI1 1RUD3 3CDZB 1DLLA 1EV12 2Y33A 5ACA1 5BV6A 5EIYB 2D6PA 4MHUA 5DZGA 3VBRA 5J96B 4NJ4A 1HRI3 5FXWA 1Q8SA 3OJBA 2P6HA 4BPZA 3FMGA 5J3UA 1T6BX 5BNNB 4FT8A 4LBOA 3J8F1 2JECA 2QZ2A 1UY3A 3D4KA 4I0BA 3PIGA 2CAVA 3HD8B 4CDQB 1QWRA 3VDDB 2GU9A 2WT1A 2RMU3 2PMWB 2XGXA 3CNAA 4QPIB 5F2WA 3N7JA 1PMHX 3HPNA 3MGUA 4FPYA 4KNCA 4S2HA 4TYSA 3ST7A 2HWD2 5L9BA 4A3ZA 2GMMA 1FPN1 1YC61 3O5SA 4D8MA 4FQZA 4HPKA 3IKWA 1UF2C 1FMD1 2QFEA 2VNVA 2WLPA 4XJAA 1BK0A 1WLCA 2C4XA 1LESA 3E5XA 5F3IA 1MEC1 4Q1RA 2QQVA 3EBRA 4FP3A 4CVUA 3O1RA 3VHPA 3RDIA 3CJIA 2FDFA 4WZCA 1SQ4A 3K46A 3O0XA 4QX0A 4BQ3A 2JDAA 5C4WA 3I97A 4Q4W2 5DABA 3QH6A 4AEMA 3WW3A 2XR4A 3OGGA 1UZYA 5FY5A 1HB2A 1PNFA 2DWRA 1JU4A 4FOQA 4GKXA 4XEZA 1ASJ1 1NX9A 1ND2A 2VMEA 1XNDA 2GN3A 2VMFA 3NJZA 3GBWA 4YW5A 2EA7A 4NWVA 2PLV3 4D6RA 2Q30A 4LNVA 5K7PA 2XB6C 1FNZA 2K2SA 4AFMA 4PF5A 4AHXA 4LBJA 4LKFA 2J22A 2TEPA 4YZ5A 3OPTA 3TNPB 4TN7A 3IIAA 1N3OA 4FO9A 2RE9A 3J8F2 5ANQA 5AVPA 2QQPA 1VBE1 5CADA 3BIEA 2OS2A 1X9PA 3HWJA 1ZRCA 4NPLA 1Y9QA 4FCAA 4OMCA 4MGIE 4JC1A 1APNA 3ZR6A 1OPOA 2G19A 2CDOA 2RS32 5T3NA 2VO5A 3K48A 1GWMA 3JD72 1VALA 3T2OA 4WM8B 3O1TA 3WDTA 1IS5A 3AXEA 3QOPA 4HL0A 1AL0G 3H50A 2Y6GA 4GJYA 3IT8A 5CFDB 4GALA 1XE8A 5JZGA 2W87A 2XKOA 1MEC2 3KB5A 1CAXA 1MS1A 1PGSA 1VMFA 2JD4A 4OUMA 3TEYA 5IFTA 5F3EA 3NWKA 5LZ6A 4XTPA 1IQAA 1DU3D 3OSDA 4XABA 3LIGA 3BTZA 3AC0A 3HQRA 4A2UA 2EVXA 4I09A 1PO11 2XJSA 1W8UA 5EWSA 2ZX4A 4G4FA 2RR12 3PUQA 1GWLA 4JKKA 5SV5A 3B93A 3VD7A 3WG4A 3ZFEA 2JWPA 1OQEA 1ST8A 2Y6KA 1RXGA 2NQYA 3I2GA 3POWA 5EZWA 4XACA 3H0OA 4UF0B 2RS52 2VQAA 4LO6B 4EV0A 4MGSA 1ULCA 5L19A 2LTNA 3GZEA 4YVSA 4BHPA 4CZSA 5IK7A 1DQ2A 3LA2A 4PIXA 1W9FA 5EFUA 4AEDC 2JXAA 2HWE2 1RYYA 4E2GA 4B1MA 1GLHA 4QGMA 3N4MA 4QKFA 1LOCA 4J1XA 2A6XA 4LLOA 1K3IA 4Q0SA 2JDKA 3L9JT 5FLHA 1LOGA 2BYVE 4PHZA 2D44A 3I54A 4R52A 2OT7A 5IATA 3H1YA 2A5ZA 2QJVA 2WR9A 3H3UA 2IVJA 3W5MA 2O14A 4EZHA 4BK5A 2VCCA 3K2OA 4M0NA 2OW4A 1CX1A 2ZAHA 4IDZA 5FJKA 4HVRA 2HJIA 3BB6A 1AYN1 3MV01 1WMFA 4XXPA 1I1EA 4F8AA 5L7OB 5FO7B 4DFSA 1W0PA 2BPA2 4MH0E 3VD9A 3NV1A 1DCSA 5ANNA 4LE3A 4IV3C 3UT0A 1EUTA 2JE8A 2EXKA 4QM9A 1BMV1 1LEMA 1R64A 4YW4A 1JOPA 2WDBA 1RMU1 2CY6A 1SZBA 1LNSA 2W2IA 1HRV2 2V4VA 1PVXA 1RUF2 4XFAA 3ZDVA 4CUBA 3BTYA 1ZRFA 1FV2A 2AEZA 2WS93 3MW3A 1W0NA 1NLSA 3S7EA 3TWIA 4XMAA 2AUYA 2J1RA 1GUIA 1H6YA 1LHNA 5BNOC 5ABJA 4P9YA 2F17A 3OGRA 3DPRB 3LPFA 5EJ1B 4N53B 3I2FA 1XNAA 4BXFA 4AK3A 4E4ZA 4FPHA 1ZZBA 3PHMA 3AB0A 4DUXA 1V6NA 2GMEA 4Q0PA 1JHJA 5FXVA 1NLQA 4N8MA 3SITA 2GP3A 1OA2A 1OLME 3I3BA 3M3OA 4UFLA 5LRRA 4C8DA 3K4ZA 1I5PA 1RUI3 2Y64A 1MPXA 4L2NA 5ACA3 1RIRA 3KGZA 1REEA 2BNNA 1AYN2 3ACGA 2JDZA 2DCYA 4LPLA 4U36A 4LK6A 3ZYPA 3WEZA 1LHOA 2Y6LA 4XQ4A 1KJLA 1UXZA 3LCPA 3POJA 3J8F3 4QPGA 2HLEA 4JHZA 5E6HA 5JR7B 2E9QA 4LBLA 5A1AA 4CCKA 4ZS3A 3SLIA 2CWSA 3VBUA 4UW4A 4Q4V1 4HVOA 1QJX2 3PU3A 2RS33 2BFUS 2XUEA 1VBD1 2ZOEB 4QM8A 4CDXC 1FPN3 3AKQA 1AR92 1R092 1POV0 1ZRIA 3MPBA 1YQ6A 2QQWA 4OHWA 1FMD3 2WINB 3RMYA 4FTSA 4XJ9A 2W46A 1MEC3 2HKXA 3T0DA 5DUVA 3WNKA 2I07B 2D93A 4ZPIA 1A8DA 2F6BA 1JN2P 3VD5A 3J7LA 4YG3A 3ZVXA 3J7MA 2ZGKA 4ZU4A 1TVGA 4JRAA 1TQ5A 1H9WA 4A7KA 3DGTA 4PQQA 3AZXA 3OBAA 5FY4A 1TZOA 1ASJ3 2W1WA 5JLVA 4K7JA 2K9ZA 2RR13 1D4M2 2VR4A 3KGLA 1NXD1 3M3IA 4P9XA 2NP0A 1G6NA 2KD7A 5LASA 3LOBA 1AXZA 4XC9A 1EPWA 1MQTC 5DUWA 3I2OA 2CYFA 1PK6C 2VZQA 5HCFA 3WY6A 2ARXA 2RS53 3VBFB 3I2KA 4Y20A 3RYRA 5C3QA 4L11A 1C57A 1VBE3 4CU9A 5LY2A 1CPMA 1EP0A 2HWE3 2NMOA 1W6PA 4TLGA 4ZXKA 3WP5A 1JZ3A 5DAXA 4YVWB 2UU8A 5AFEA 5ISLA 2DTYA 2PXJA 5F6LB 5DG2A 2X53S 3QBQA 5FXZA 1O8SA 3VBSC 1TEIA 2DVGA 4Y4RA 1JH5A 3Q8FA 4FI9A 4R4ZA 4HANA 4UBGA 3HVDA 1PGW1 1YO8A 1VBB1 1BKZA 2C0ZA 2YHJA 2VOTA 2DCKA 4GWMA 1S2EA 5FQ0A 3ZX7A 1SPPB 3VV1A 1RUJ1 4KG8A 5LA2A 4QHBA 4QQOA 1GU3A 1I3HA 2GC1A 1UOFA 3I7DA 4XIOA 1MZ5A 2D6OX 4QB2A 4NAMA 1S0JA 3NVCA 4YM2A 5C8WA 4XF9A 1PO13 1D2SA 5F2SA 2J1VA 1W8FA 1WKYA 1I5ZA 2O8OA 3MYXA 1NCQA 5L73A 3ZSLA 4H3WA 5A32A 2V09A 1UOGA 4EROA 4FPKA 4LHNA 1W04A 4OQ9A 1HRV3 3I3QA 2WNVB 3AK0A 4EZ4A 1SPPA 5JI7A 4TZDA 1YRZA 4A7YA 5F1RA 1HXS1 3BGAA 1GP6A 1FOD2 3LFMA 1QXRA 1DLCA 3EXUA 5FBJA 4E2QA 1ALYA 2UY9A 1K5MC 2AEYA 3ZO0B 1RJ7A 1RTVA 3I59B 4GH4A 4TLFA 3KT1A 4YM0A 2W3JA 3NNMA 3ACHA 1LOBA 2WNUB 2A3WA 2ZBJA 1MS0A 3IDEA 4E2SA 5JOWA 2DVDA 4AI9A 4I0AA 3HEIA 4IETA 5BNNC 1AF9A 1AYN3 2BOJA 2JDHA 2KXLA 2C9KA 3DXTA 4YM1A 1V6JA 5K0UA 3M70A 1L7LA 2DCJA 4C1WA 2FDHA 4CXWA 2VQ0A 4LO8A 4BXSV 3UGHA 4CDQC 5LY1A 3VDDC 4JZRA 4OVEA 4IGQA 2QQIA 3THPA 4QPIC 1GNHA 1V00A 2ZPXA 1H0BA 2GP5A 2H6CA 3CO2A 4I3PA 1NQDA 1G9FA 1HV0A 2E33A 1N1VA 2VZUA 3FFQA 4XVHA 3KZ4C 3MHZA 1RMU3 4H7LA 5BXXA 1XSQA 1QJX3 4XBLA 2EXHA 2OQ7A 4IL7A 3T08A 3ORJA 1OPMA 5T55A 4HSLA 4R4XA 4A3XA 3NNFA 3O1UA 1Z7S2 4XE9A 2WN3A 4LORA 3POEA 1X50A 1N3QA 1JOBA 3DUIA 4KI5M 3SH3A 1CONA 5G04L 1RUOA 3M3CA 2G4IA 1V6IA 5A7PA 2ARAA 4B7KA 2VVFA 1X36A 3OTFA 3ETQA 1NA1A 4ARXA 2P34A 2VXRA 5FLJA 4FBFA 3DYOA 4IEOA 1WWYA 2XJRA 1WW7A 3LFIA 4XCBA 4I0WB 3N9OA 4RA0A 1R082 5C71A 1UYPA 3O1SA 3RQ0A 1RJ8A 1Y43B 2E7AA 4Y33A 4AGRA 5KWRA 1YEWA 4YZ2A 4CCCA 1ULOA 1V6LA 2WO3A 1PO22 3ES4A 2ZEZA 3NKGA 4IE0A 3U78A 1U5XA 1H6XA 2X8KA 4AR2A 3PLQA 1C28A 4B29A 5EQUA 1UNBA 2QQMA 4XBQA 2Y38A 4JQRA 4UW5A 4LQRA 2WAOA 4BDVB 4KGQA 4Q4V3 5F7UA 1A6CA 2GSYA 4CU8A 2JDPA 1NLRA 2JDYA 3CJXA 3NV4A 5CFDC 4YFWA 1YFYA 1W6OA 1W03A 4QXHA 5LBCA 2WFF2 4MGKE 1AXYA 3MICA 2D3PA 3VZJA 3WHTA 3AYCA 4QB6A 5C5UA 2AREA 3I2JA 5IVVA 4V1PA 1H30A 2ZEXA 1OOPB 5JOXA 2W91A 1BK1A 1J3QA 4GIQA 4XIKA 2YZ4A 2ZZJA 4QWNA 5LEKA 4XFGA 1GZCA 2ORZA 4LKEA 2YPDA 4CA9A 3H8OA 1COV2 2EICA 4XUNA 1WD3A 3K3OA 3T1LA 4DXRA 1S55A 3NO8A 3NQHA 2QQNA 2ZCWA 3MDPA 1XE0A 1VBA2 4LO5B 1MVEA 3IDAA 1ZNPA 4Y1ZA 2HWF1 4BU2A 3B02A 2HBUA 4AXOA 5AFBA 5FPAA 3KVAA 1VAKA 3WP3A 2Z69A 2VZPA 1JZ6A 4GB32 4XFBA 2C6SA 1RC6A 3N9LA 3AZYA 5TSWA 4RGKA 3LD8A 1S0BA 1AYM1 5FY9A 1QJZA 2R1BA 3PVEA 4YZ3A 5C3PA 3V0AA 1GWKA 2H0VA 5C3RA 4XW3A 1UW8A 2JG9B 4P5HA 1B35B 1VMHA 4COVA 4FFIA 2JD9A 2Q8OA 1LJ7A 1QQP2 1VRH1 3WF0A 5IK4A 1RUE1 2XBO2 1RUG1 3ZSMA 4LK7A 1CGPA 4JRLA 2BWAA 5IVYA 5L7OC 2D98A 5FZ3A 4XHXA 1WCQA 4INDA 4L99A 3WINE 4WVMA 2QCSB 5FZHA 1RUJ3 5A6YA 1LHVA 1JXNA 1EY2A 4CP0A 3H3ZA 1QOOA 1WW5A 4K20A 1H2MA 3RZMA 4KL1A 3KWVA 3OUHA 1C5HA 1QKQA 1DIWA 2W9XA 4FFHA 3UKTA 3ILRA 1PX3A 3SH5A 2XWBB 3BN6A 3M7AA 3C7EA 4FPGA 5DDJ1 3ZPOA 3HN1A 1AR62 1A3KA 3MLJA 4HK9A 1QJY1 2WA4A 1YUDA 1DHKB 1FAYA 1GP5A 5JWPA 1HXS3 3DPRC 2EAKA 4N53C 4YARA 3DYMA 3HT1A 2FDGA 3OOXA 3HQXA 4D0QA 2B45X 3A0KA 3OYWB 4AQ6A 3KVBA 4W6WA 5B4NA 3H8RA 4JKMA 1D0HA 1CQ9A 4AI3A 3VHRA 1UWWA 2BGOA 1O6UA 3MF6A 4Y22A 3SXWA 4YFZA 4E9KA 1HW5A 3J4UH 4MO3M 3PL0A 2W52A 5JCTA 2DU0A 5C70A 1DF0A 1RUE2 1ZBE1 2VXJA 5LCWL 1AJOA 3AKTA 1JYIA 2ZX0A 4QX7A 4KG0A 4Y1VA 2IXIA 5H9QA 1YYNA 4M4PA 4QDSA 1Q5OA 1UMZA 1SFNA 3AYAA 3CBNA 1F8VA 4AEDA 3BTXA 2VOVA 1UKRA 3KMHA 3OG2A 4QXKA 5DN2A 2ZABA 5LRSA 2XVLA 2RMU1 3LPGA 1TE1B 3WDYA 2ZGSA 3VDCA 4DPNA 4IV3B 1IPKA 2WWSA 3ZYRA 5H9PA 3I3EA 1ZM1A 3D0SA 1FT9A 4Y5Z0 1MR5A 3J7NA 2WFF3 3MF9A 2HYXA 1FNYA 1OUXA 3WCSA 5BYNA 4MXVA 5FZ9A 2JE7A 5I0DA 1H1AA 1F5JA 2PHLA 2X29A 3IPVB 4Q5OA 3VL9A 3RI9A 3I49A 5FY7A 2GMPA 3CL1A 5EP9A 1COV3 4K9SA 3VDAA 1CVNA 5KXCA 1NY71 4EN7B 1LENA 4GZ9A 1Z0HA 2R061 4Q0UA 4Y5SA 2R49A 1RUH1 3AZWA 3UKNA 2PLV1 3OY8B 4B4QA 2GALA 3ZXAC 1JW6A 5A3UA 5FTTC 3C2UA 5BNOA 2WLQA 2A73B 3OGSA 3VBFC 2VVDA 2ZGMA 3I3MA 2WFPA 1UMIA 2MEV1 4DO0A 5J98B 1WA4A 2BP6A 2MHFA 3NW4A 3OBRA 2ILMA 2XLFA 2Y0OA 4CU6A 4Z2WA 4OUEA 4DNYA 2J1AA 5FPZA 3RVHA 3AZZA 4TXWA 3DEMA 5KHGA 1SHWB 2ZJCA 2BWCA 1W8TA 3VBOC 2BJSA 2OKXA 4AGVA 1ZRDA 2P2KA 4COUA 2XBO3 3GDBA 4A42A 4BOWA 2XHKA 4BQYA 3BPZA 1QDCA 2HWB1 1BXHA 4FOVA 4AW7A 2IUWA 4ZONA 5EJ3A 2DYCA 1JYTA 4RR3B 1PX4A 5IAXA 1NY72 1NCRB 3TRSB 4R9BA 4K3UA 1CAUB 4CDXA 1DZTA 3S5QA 4CEYA 1W8HA 3IAQA 1V9U1 4PF1A 4FXGB 2HWF3 1RVF2 3HQUA 4XFIA 3U1XA 4ZHNA 2HWC2 3LEGA 5IVCA 2X5IB 2WNVC 2UYBA 5IK8A 1AR82 5FWEA 4BH9A 4CCMA 1UPIA 2BNMA 1IPJA 1ENSA 4ISRA 4LOSA 4XF1A 1MQTB 1KDMA 5FMBA 1SLCA 1ZREA 3B94A 4JTOA 5DPNA 3WR0A 1AYM3 1QJU2 4B3NA 2P1BA 2ZMNA 3KCYA 4QMAA 2E6VA 4JAAA 3ZFFB 3UKVA 2BERA 3MZHA 2WBKA 3AJZA 4HFSA 5EYYA 2QDNA 5K4LA 5I8TA 2WNUC 2RS11 3AL6A 5JPNB 3T4VA 3TEXA 2LUWA 1WUVA 2B7YA 5FYUA 2EIDA 3PUSA 4JGYB 3VLBB 4HN0A 3J7HA 5FZAA 2I2SA 1G86A 1MQTA 1VRH3 1I6XA 3IMMA 3RZGA 1EV11 1MZEA 1PK6A 1LRHA 1RUE3 2DVBA 3OCPA 3PIJA 4IEVA 4QKNA 5GLVA 1DG6A 2HWB2 1B09A 1EAH1 2WAAA 3IAPA 2UWBA 1J1LA 5F3GA 3FUQA 3THCA 4ES8A 1CAWB 4UXAA 5C33A 4F3JA 2IXLA 3MIFA 4AFDA 4NRMA 1OBNA 2ET1A 2D3RA 1UX7A 2CNAA 1O4TA 1V9U2 4HKOA 4QKBA 3UESA 3VBSA 1S0GA 1OFSA 4CP2A 2HWD1 1YFXA 1UIJA 1X8EA 4OMDA 5DDJ3 5DG1A 4AQTA 3QCWA 1PNGA 3BPSA 1K42A 4IXLA 1OF3A 2F4LA 4PJYA 5JDBA 4IV1C 1TMF2 1H8TA 3I2DA 4G3YC 4HT1T 4MYEA 4UFKA 4IGPA 4OI4A 2VAUA 5E88A 3PVOA 4CYDA 5A3TA 3WP6A 4MXWB 2BW8A 4Q2FA 5C9AB 3TEWA 2HYKA 3MBWA 4IE5A 4NMIA 1EUUA 1K5MB 4Q4W1 1TME2 3HJRA 3KV4A 5KC5A 3UYJA 2X05A 1Q3EA 2ADEA 2YDEA 4LO7A 4AYUA 3W20A 5A7QA 3IDBB 5FPVA 1ZBE3 3MPPG 1PIV2 3FZ3A 2ZGPA 1LB2A 1EAH2 3TYJA 1W2OA 5BNPB 3I2HA 3MIBA 1CN1A 3ITQA 1UD1A 4BMEA 2I45A 5L9RA 4W8JA 3S7IA 5CKQA 2A7AA 1GICA 2EIBA 4PCRA 5T54A 1AL22 2RS31 5LA1A 2A6YA 2CL2A 3AP5A 3JD71 1K5JA 5FJHA 3R4UA 2HEVF 2PELA 4K8FA 1YLLA 4M00A 1RUC2 2C1FA 1OOPC 3D8CA 5BNNA 3KT4A 5FUPA 4LLFA 1SLTA 1JI6A 3CZUA 4BQWA 5A7WB 4CDQA 2VUCA 1PVC2 3NMBA 3VDDA 5I91A 4QPIA 3N7MA 5IVEA 3SMHA 3LA7A 4GJZA 5CISA 5CYYA 4FPLA 1BVP1 2WSUA 4QX8A 2BBAA 1K12A 2GNDA 4YW2A 2R063 3U11A 2RR11 4XFHA 1RUH3 4M3CB 2GDFA 5GKAC 1UL9A 1DYPA 4ORFA 1PGL2 1UZVA 2DUPA 4DXTA 4PT6A 2WIIB 1NQJA 4XZPA 2GH2A 1BHGA 2EALA 3CLPA 2RS51 1JZ5A 1FATA 2RHPA 4R9AA 2VBBA 3HBKA 2VM9A 2WO2A 2MEV3 3AFGA 5CFCB 2ET7A 2K0GA 3FWEA 2HWE1 3RWKX 4QX2A 1JYWA 1LU1A 2JG9C 3EB7A 1B35C 1ND3B 2DBNA 4AI1A 1BLZA 2ZTNA 4IEPA 4FXKB 3H8UA 3KT7A 4NRPA 3AKSA 2VUDA 4K1ZA 4JKLA 4YGDA 5JVVA 1G9AA 4V2VA 5DMYA 3ZYHA 2EF6A 2QKDA 1CJDA 2WZPP 2Y6JA 4TTGA 2VOXA 4HSJA 3ZXLA 1SBFA 2HWB3 4NAOA 5FZLA 2JICA 3LAGA 2GNBA 1KXGA 4RFRB 1OA4A 5J09A 3ZXGA 4TWTA 4WM8A 4IE6A 4AI8A 2BGPA 3AXDA 3NNJA 5CFDA 3HBZA 1OVSA 2BZDA 1V9U3 5GALA 3BUCA 1OFNA 2AZ5A 4DUWA 4MADA 1YNAA 4ZU5A 3U75A 3VKLA 4JGZC 1QY4A 2W1SA 1HRV1 1C8M2 4IEZA 1LOEA 5IAVA 4BLIA 1U5ZA 2GH8A 2VNOA 1RUF1 1V6KA 3ZN6B 2H6BA 2R071 2VH9A 2XUMA 2ETEA 4Z82A 5APAA 2JKXA 2P37A 1TMF3 4RHV2 2W47A 1CX4A 4OHVA 1QXPA 1WW4A 3BVCA 5K9YA 1W6NB 2YPJA 3MFCA 3UETA 4E8CA 5E8AA 1QNYA 3WNNA 1MS9A 2WQ4A 4YGCA 2A3XA 3ETPA 2FBEA 2RS13 3SCGA 2G1MA 2W39A 4UF0A 4Z2AA 4ET7A 3CIHA 5IYYA 2O1QA 1YCIA 1AR72 1ULDA 2VU9A
chains in the Genus database with same CATH topology
2W0XA 4K40A 4Q29A 4DB5A 1Q8PA 2CAUA 1EAH3 1SBEA 3GBFA 1XNBA 1N1YA 4DZGA 3ZSEA 1Q8VA 4PDWB 3JQWA 4XTMA 1MZ6A 4D7TA 2OPKA 2GAUA 3SNMA 1QJX1 1AL23 4EN8B 1ZX5A 4COZA 2HWD3 4RGGA 2VY0A 1AR91 1R091 5L7OA 2R072 2AR6A 4AHWA 5F9TA 2IFWA 2E7QA 3I8TA 4JV4A 1C1FA 5FO8B 1UU4A 4Q8LA 4Q4W3 1IKPA 1WCKA 3VHOA 4YYOA 5J48A 4XQWA 2YGLA 5JIUA 1D4M1 1ONAA 1LOAA 1M4WA 1HX6A 3DPRA 5AC92 4N53A 4FSJA 3VKFC 3VUOA 4RS5C 1YI9A 3MW4A 4D94A 2IXCA 3ZN5A 2VOKA 4LA2A 3IN9A 3FJSA 3IMNA 2Q0AA 3M8LA 3JD73 1W6QB 5KXEA 1YWKA 3TBDA 3M2MA 4ES9A 5A3LA 3RMXA 1LOFC 4KU8A 5I8YA 1DZRA 3MEPA 4XF4A 4RR3C 3FC0A 1NCRC 1Q56A 1X33A 3FLRA 4L9BA 4YNIA 3WLUA 2B42B 4HVQA 3HIFA 5IK5A 4FPJA 2DUOA 2O8QA 2V5YA 2X5IC 4WV8A 2PYTA 3RYKA 3MLKA 1EYBA 4D3WA 2IWGB 1KQRA 1GNZA 1XYPA 2ATFA 3PMEA 3DV8A 2ZX2A 1FOD1 4N90A 1DGWA 4K21A 1A78A 3ZFFC 2GNMA 3ZXFA 1BBT1 1WCSA 4ATFA 1SLIA 5DXDA 3RI8A 1XYNA 3ZMOA 4KH9A 1V6MA 4JGYC 1OD5A 1CAVB 3USSA 2AH2A 4XDQA 3VBFA 4JTNA 4LBQB 3VBOB 2JX9A 2Q5TA 4FPOB 1PZ7A 3WV6A 2PTMA 4P9WA 4NR1A 5GLUA 1BEV2 4LBKA 4Q0QA 4YVWA 2VOWA 1GQGA 2R30A 4MX3A 3LA3A 2ARBA 3U10A 4RQPB 2E51A 3N7LA 1SFYA 3PJYA 2ERFA 3VBOA 4P9LA 2D7FA 3OGJA 3VZLA 1YFUA 3KS7A 4NVPA 2ZGUA 3FBMA 3OF1A 2PHFA 4Z1VA 2R041 3H9AA 1OA3A 1RUF3 4FOWA 5FBZA 2R073 4CEWC 3UJOA 3R05A 1Z7S1 1H9PA 2OA2A 1JOJA 2OUJA 5C9AC 5I0TA 4C1XA 5CB7A 1BBT2 2GZWA 2W68A 4MVTA 4PIYA 5C8CB 4PLNA 2ZHLA 4AVVA 3PVNA 2RM22 3TNQA 2WNVA 1WBFA 2VW2A 3PTYA 2ZA9A 1VAVA 3DKWA 3VBHB 2XLAA 2ZACA 3ALQA 4ISQA 5BNPC 5FFOC 1R081 1HV1A 1LGNA 2PHDA 4IESA 2CWMA 1MVQA 3I59A 5E1RA 3OD0A 3QD6A 5D8AB 1PO21 1S0EA 2WNUA 5CU1A 2ZMLA 3E6CC 5T52A 1KS5A 3AMPA 5HCBA 1X8MA 2A6VA 5E89A 1N47A 3VHNA 1AR93 1R093 2R042 2WFF1 2QE3A 4X8NA 1KS4A 3O12A 4IV1B 4Q1PA 1QMJA 1ENXA 3V65A 1MS3A 4Q0VA 2ZHNA 1COV1 3CJIC 1SDWA 2O0OA 3S6PA 1DZQA 4NN0A 3R4DB 2Y0IA 1VBA1 2AYHA 2DFCA 1ZYBA 2PHXA 2ZGLA 4AQSA 3D5OA 1RHI2 4IV1A 1D4M3 4C91A 2NM1A 1J3PA 1ULGA 4GB31 3X29B 3ASIA 1QU0A 3LGRA 3JBG2 5CFCC 4EWEA 4XFFA 1DQ6A 1WLDA 3RSJA 5JMCA 2WT0A 1GZWB 5H9RA 1UN1A 2DURA 5K8SA 1ND3C 3R6SA 5LK5A 4DRRA 1QOSA 2WZR2 3LZZA 2PFWA 4WVZA 1LHUA 1AXKA 2DF7A 1QQP1 1DQ1A 2XBO1 2WKKA 1O5UA 4N43B 1DGWX 2DVAA 1ZA4A 4AQ2A 1Q43A 2FZ1A 3AKPA 3IM0A 2BGCA 2NLRA 4WBBA 2I74A 1GV9A 1NZCA 4PIZA 4WM7B 1OOPA 1MS5A 1AR61 3O0WA 4KBBA 5FLIA 2A3YA 5JOYA 1FOD3 4QX5A 4AG4A 1Y3TA 2KM2A 4EWDA 3OBTA 4CTEA 4Q8KA 4AHZA 1BBT3 5F5QA 3RJRA 2VW0A 1C1LA 1KRIA 1DBNA 1ZVFA 4LA3A 3PVBB 3W58A 2D6KA 3ME2A 2RM23 3E97A 4XILA 2QZ3A 1PHMA 2YYOA 1NOVA 4LUMA 1VAMA 1N1SA 2C5DA 3NAPB 4RGAA 5JPMB 5EXOA 5SV8A 2ZGOA 4FTEA 1XQNA 2F4PA 4XXAA 5FCCA 1KD7A 4BM8A 2ZKNA 2JG9A 4PDWC 1B35A 1LODA 2YY1A 1H2NA 3FUOA 2IFRA 2DV9A 2KA3A 3LSDA 4JGZB 2R043 2V73A 2XH6A 4OUSA 4A7ZA 4PBPA 1Z7S3 3RS6A 4PLOA 4YLZA 4YRDA 1UX6A 3QACA 3ZXKA 4Z92B 2UYAA 1O7FA 2UWAA 1O4ZA 2GNTA 4HMZA 2PN5A 1X82A 4JGZA 4ASMB 3GZTB 1OLQA 1VIWB 4DOUA 2ZGRA 3WXPA 3VGIA 4EWAA 3R4SA 2IXKA 3OYWA 1R083 2E7TA 2ZX3A 1NG0A 3P3NA 1RITA 2VMIA 1PO23 4IQPA 4QPGC 1VB2A 5T5LA 3KM5A 4TSVA 1O3RA 3B3QE 4GQ7A 2XL7A 3JUUA 2E63A 4YG6A 1UU5A 4AI2A 1CPNA 1GYKA 4M3CE 2DCTA 5IUQA 3VBUC 4XJ8A 2D5FA 2OZJA 2PQQA 2XJPA 1NXMA 3USUB 4QGLA 2VVEA 3WP4A 1LTEA 1FI2A 2IXHA 4AFCA 2CGPA 4R9DA 3FBYA 5GLZA 2B5HA 1J1TA 1LU2A 4IV3A 2YUEA 3U4XA 4L8QA 1TNRA 2Q1MA 3NKTA 2EXJA 3RNSA 2ZGNA 3ZSKA 3WNXA 1VBA3 1YI7A 2W08A 2ZX1A 1H2LA 1RVF1 4FP2A 2R0HA 4O9EA 2HWC1 3FFZA 4L92A 4DY5A 3IPVA 1AR81 2H0BA 4I30A 1DYKA 4GB33 2JJ6A 4RS5B 3AKRA 1FV3A 1R1A2 1QJU1 3OY8A 2P17A 1JHNA 4MV2A 1QHDA 2WQZC 1AX0A 1WCDJ 4PLMA 2JENA 5KHHA 1IS4A 1RUD2 4BMBA 3INAA 3M4FA 2WT2A 1HRI2 1QQP3 4OHXA 5EYXA 4RS5A 5AVAA 3VN4A 1W0OA 5FPXA 1S1AA 5HI0A 1LULA 2DU1A 3GNEA 4FOYA 5I0SA 4Y26A 3AJYA 1ENQA 4AVSA 4RQPC 1PZ9A 4JDMA 2XVGA 3B9IA 2PHUA 2FZ2A 3IBMA 1VJ2A 2JG8C 3ZSJA 1J58A 1KFUL 4Y4YA 4LR4A 1AR63 2BNOA 4NOTA 1LOFA 4IEXA 4GMP1 3WD5A 1TMF1 3ZFGC 4HETA 4Q27A 4RR3A 1NCRA 4XJZA 4FPFA 1SLAA 1CAUA 1QOTA 5CG9A 5C8CC 2BVBA 2B9UA 4LT5A 1XXNA 2X5IA 2DTWA 5CG8A 1TME1 4COWA 3ZPYA 1O5LA 4GH4C 2XKPA 4BCUA 4HKWA 3VBHC 3TN92 3WDVA 3M1HA 4FQ4A 4YW1A 1MS4A 1PIV1 3POSA 5FOJB 3KSCA 4AVAA 3NL1A 4ASLA 1QNWA 3ZFFA 1W6MB 2JKBA 5D8AC 4QD2A 4MGYE 3LWCA 2XLGA 4D7SA 4JGYA 1CESA 4Q4Y2 2XWJB 4K1YA 1AL21 2DUQA 1QH7A 1SCRA 1AJKA 1TNFA 3ZIWA 1KITA 3BCWA 4LBNA 4G9SB 1RUC1 3IWZA 4RSUA 4EN9B 1CAWA 5JOZA 1NE4A 3VL8A 4CEWB 5F6KA 5JSRA 2XG3A 3RG0A 1LKNA 1PVC1 1DFQA 3E5QA 4B4PA 3MW2A 5BPXA 1ZBA2 1Z78A 2NPIA 3H1MA 2TUNA 3KQRA 3POYA 2YXSA 1NA1C 3THTA 4JDNA 1JUHA 3URFA 1BVVA 3UK9A 1PGL1 1D2QA 3QLQA 3GALA 5B2GB 4MXWA 5T5OA 5C9AA 1ZZCA 2TBVA 3V0BB 4M01A 5J98B 1Y7BA 4JDOA 1K5MA 3VBRB 4NHLA 4BZ4A 1T6GC 1C5IA 1R1A3 4HKLA 1YJKA 4QPYA 4FPEA 4Q26A 3MFAA 3AMNA 1REFA 1SLLA 3JZVA 4BQ1A 3E6BA 5JI9A 2XJTA 2OYZA 5BNPA 2P3JA 1KJRA 1QDOA 1WMEA 3AM2A 4AHYA 4AGGA 2YGMA 4N43C 5A3MA 4AI0A 4HPKB 4EN6B 3RYPA 1WLTA 1OHFA 2Z79A 3VKNA 3CEWA 2JEMA 4OI0A 1JBCA 3WDXA 3CJIB 4MGZE 4WM7C 5C4WB 1H8VA 1RVF3 1R1ZA 2HWC3 3VZKA 1XU1A 2EAAA 1C8M1 2WS92 4R8HA 1ND2B 4LHLA 3W9AA 1AR83 4CP1A 3KCCA 4Q4X2 2BTVC 5DUXA 4RHV1 4KWKA 1BYHA 2D6LX 1QJU3 3N7KA 1CIWA 4M3CA 4XF0A 2A6WA 4CDWC 1G9CA 1JTZX 2ZAAA 3K51A 4FAGA 2VNGA 1RUI2 1S0CA 3NAPC 5E16A 5ACA2 3M3EA 1GQHA 4C0BA 3TN93 2ZKLA 1SEFA 4HBNA 1AR71 2Q4SA 5CFCA 4GKYA 1LHWA 3TOJA 3SH4A 4M0HA 4AE2A 5JZGB 1CAXB 1EPZA 1ND3A 1Q8QA 4WVWA 3I4IA 5CNAA 4LE4A 3MIEA 1E57A 1BZWA 4DMIA 3M3QA 4Q4Y3 4BYYA 3E5UA 1FPN2 1UKGA 3WOGA 4COYA 1RUNA 1FMD2 3AYDA 1XNKA 2VECA 2ZS6B 4GMP3 3ZFEB 2SBAA 5J36A 1CR7A 3RPQA 1HQLA 4YVSB 1KDKA 1VLNA 4AEKA 4AVTA 2YC0A 3G7DA 1TME3 4MUVA 1ASJ2 3GHNA 1ZBA3 1VP6A 3KCXA 2OZ6A 3ZN6A 5GM0A 2CGOA 1IKQA 3MIHA 2XJVA 2MNGA 1W6NA 5AC91 1PIV3 1VBC1 2ZMKA 3ACLA 1J3RA 1WW6A 3BOWA 1ZZ7A 1VBE2 2PHWA 5BNQA 2FMYA 4META 1VB4A 3WG1A 5LK7B 3SCFA 3RRDA 3WX5A 1YFWA 2MPFA 4CDUC 3RZZA 1LEDA 5H9SA 1U5IA 4DQAA 4QQPA 2NYYA 3O0VA 2SLIA 3WT3A 2XL9A 4NHMA 2NN8A 1RUC3 5GZEA 4N7IA 3BOPA 4GA9A 3ZXEA 5I0UA 3OD4A 4PDWA 2FQPA 1PVC3 2G9GA 4WZFA 3ZYGA 5IT6A 4YGBA 5J7MA 3JU9A 1PO12 5ABJB 2EIGA 1UPSA 4ONUA 2PAMA 1GR3A 3UJQA 3U0ZA 4H14A 1YJLA 4FVVA 3AP7A 3JB8A 1VBC2 1SMVA 3CF6E 4KWLA 4Q4X3 1S0DA 2Z2SB 1GBGA 1WD4A 3EJKA 2FHRA 3FX3A 4SLIA 1AHSA 3GHMA 3VKOA 2GC0A 4QPGB 1RB8G 3DL3A 4XFCA 5HXVA 4D69A 5KXDA 4QT6A 1HLCA 1RL3A 3VBUB 3AFKA 4YSFA 3ZN4A 1ZRRA 2XJQA 3FE5A 4BIFA 5GJ6A 5HCAA 5I0RA 3V56A 3JCIA 3NV3A 1BEV1 2HEWF 3V64A 5C6CA 3L2HA 1WMDA 1BMV2 2CV6A 1MS8A 1W6QA 1RMU2 2XJUA 1IS6A 4F83A 4KGGA 4CEYC 1IGOA 1C8M3 1G8WA 2D3SA 2DFBA 3W59A 1QGLA 1DQ5A 3WUCA 3E6DA 1DGLA 3ZYIB 3G6JB 1IOAA 4RHV3 3WUDA 1C3HA 1F9KA 1IHMA 4C0HA 3C3VA 1LCLA 4B7EA 4N7UA 1AX1A 3TAYA 4IERA 4Y20B 2ZZQA 1ULFA 2D6NA 1KFXL 2RM21 3U07A 4BE3A 1G9DA 1JUIA 1W6PB 3GZAA 3WZ1A 2BBVA 1O3QA 4GWNA 4BLJA 4W6YA 1AR73 2CGNA 3WG2A 5FRAA 3APBA 3MIGA 4B8EA 4RL7A 3BALA 5L36A 2BUKA 1FX5A 3WQ7A 1CAVA 5FQ0B 2LALA 1FXZA 2CTVA 4MSVA 4Q4V2 4M3CF 2AGSA 1VBD2 1HQWA 4LBQA 4WVVA 3ECQA 4OI1A 1M06G 5D1IA 5JAXA 2JG8B 4CRQA 1NCQB 3A0NA 3HT2A 5BUVA 4KQ7A 3R0RA 5GLWA 1OQ1A 5A32B 2ES3A 5FOBB 5JSPA 1MACA 2QDRA 3VKMA 3ILNA 1H8TC 3WW4A 3A4UA 3AP4A 4P9JA 3ZFGB 4RQPA 4XF3A 4H7MA 4UW3A 2JG8A 1XU2A 3H1WA 2IZWA 2BFUL 1LGBA 4LTAA 4ATEA 5I8SA 1H4HA 3CU7A 4GXLA 2BQPA 2OUHA 4GH4B 2R1DA 3D0JA 2YROA 1RHI1 4RD7A 3ZFGA 1UU6A 1VBC3 5AC93 1SBDA 5FMOS 3VBRC 1HKDA 3ZMNA 1GZ9A 5C8CA 3D82A 3BTAA 4BWOA 3JBG1 4MLOA 4E27A 2VW1A 3AX4A 1AZDA 1S2BA 4L97A 5K0UB 4NWWA 1GANA 4OFGA 2DVFA 3VBHA 4FAHA 3SCHA 1F2NA 3L2YA 3N35A 2WZR1 1DDLA 3AMHA 1QH6A 1PGW2 1U5YA 1GKBA 1VBB2 1ZZ8A 2R0FA 4IEWA 1OQDA 5D8AA 2B8MA 2ENRA 1RUJ2 4XYXA 1NE6A 1V70A 4AFBA 2BVVA 2VMHA 3RJ2X 2WJSA 2YV8A 1REDA 5C4WC 2UURA 2QNKA 4XHBA 3IDCB 2PHTA 2N7GA 4XMIA 1XE7A 2GC2A 4EJRA 3N3HA 1D0GA 5EV7A 1ND2C 4Y1YA 1CD3G 1L3JA 1NA1B 1PMIA 4OULA 1HXS2 2LM3A 4BA6A 1WBLA 4AVCA 1U12A 2YMZA 5GZFA 1POV1 3EHKA 4H55A 5CBLA 2D43A 1ENRA 1Q8OA 1BQPA 2Q1ZB 3WG3A 4J6GA 3O14A 4Y24A 1AUYA 4ZU7A 5CVRA 1J59A 2ZGQA 3ROUA 3GYDA 1XNCA 5FMOL 3NSTA 4OHYA 1W6OB 3WDUA 5JZGC 3ZXDA 5GZDA 3WQ1A 1XRUA 4BIOA 5KC6A 1GZWA 3LKJA 3PNAA 1BEV3 3FLPA 1LGCA 4J1WA 2D40A 4OI2A 4WM8C 1FYUA 3HAGA 5FDBA 5DZFA 1VBD3 4P9IA 5KHJA 5KBFA 4EN0A 1OKQA 2R32A 3ENRA 2GC3A 4N43A 2ZGTA 3ZFEC 2Y26A 5KHIA 2WSVA 4KWJA 1F5FA 2G9FA 4DY3A 4Y1XA 4YVSC 3WVJA 4JCKA 1S0FA 3PJQA 5GZGA 4WM7A 1U0AA 2IXJA 4S2GA 1H1MA 4XJUA 3VZNA 4Z8BA 5J37A 2R16A 3ATGA 4UBHA 4CDWB 3V0AB 1WLWA 1A8MA 1UAIA 3N36A 3BU7A 4KU7A 3DN7A 1MZFA 5A33B 4I3GA 2VGDA 5FREA 2OVUA 1RGSA 3RWNA 4QGNA 3JQXA 2XVKA 4CDWA 5T5PA 4WVMB 2WC2A 2VMGA 3WDWA 4GMP0 3NAPA 1UIKA 3B9CA 2FMDA 4DXZA 3P3PA 4PBOA 4D7YA 2NZ9A 1ZZ6A 4QU2A 3WCRA 4QQHA 1O3SA 5A33A 3JB4C 3ZIXA 3AP6A 2ZHKA 3B7MA 1VBB3 1SACA 4HZFA 1C4RA 4LHKA 4F7ZA 4YZ4A 5CA6A 4FPCA 4B4RA 5ABJC 1IZ3A 2RJKA 4QQLA 3VZOA 3J9SA 3LB9A 5FO9B 2HWF2 1OSGA 2WNEA 5FAXA 1YXWA 3ZXJA 4Y22B 4YG0A 3ZDSA 1AVBA 2D6MA 3KD4A 1RHI3 3AZVA 4AWDA 1S2KA 5CAZA 4PQ9A 3NV2A 4UW6A 2PA7A 5DZEA 5JSOA 1AYM2 3ILFA 3JBG3 2QVSB 4X6QB 1LECA 2ZHMA 1R1A1 3H7JA 3AYEA 4AEDB 3AMQA 1QXJA 4I2OA 3MLLA 3H7YA 1DGRA 4CDUB 2B39A 4YM3A 5GZCA 4XOGA 1HQNA 1VRH2 2WZR3 1RUD1 4I02A 4OLLA 1D4VB 1O91A 1RINA 1RUG2 4AVBA 2R6QA 2VNRA 1HRI1 1V6OA 4W65A 4OZXA 2Z42A 4LBQD 2WL1A 4CDUA 2GN7A 2WA3A 2B46X 2JE9A 3PMSA 4XETA 3USUA 2A70A 2NMNA 3SHRA 1PZ8A 4X8PA 3ELNA 3Q9OA 2P3KA 3D6EA 5DDJ2 3SISA 3BIWE 1H1IA 1UCXA 1QJY2 5T5JA 5KHKA 1QF3A 4Z07A 4C90A 4ITCA 1S0IA 2UWCA 2PAKA 4MZUA 5BNOB 4P14A 4AFAA 1LR5A 4LO4B 1POV3 1OMIA 4RFT0 5GLTA 4HLTA 3GBGA 1O3TA 3J26N 4IEUA 3MIDA 4JVAA 1SLBA 3OPZA 1N1TA 1OI6A 2TNFA 1W2UA 3EQEA 1N3PA 1ZBE2 4Y1UA 3VZMA 3AP9A 4FTBA 3TN91 1DQ4A 4LBMA 3UL2A 1BCXA 2D5HA 2HEYF 3HR9A 2OIIA 5LEJA 3T1MA 3O7OA 4XQDA 4XBNA 1BJQA 1GFF2 4S2DA 1JYCA 5T50A 2RMU2 4ZKTB 4YVWC 3WW1A 4Q4Y1 3GZUC 5CIRA 1ULEA 2VUJA 4CDXB 3ES1A 1NCQC 4CEYB 5DUUA 1NYWA 4DS0A 1YHFA 4YGEA 1EV13 1F31A 4N9IA 4E4SA 1I9RA 4U2AA 1W39A 4W6XA 1AX2A 1GSLA 2VUAA 1ZBA1 2A71A 2A75A 2D97A 2R062 3BODA 1RUH2 2PLV2 4LUKA 1URXA 4N9HA 4I01A 4YZ1A 1HIXA 3HMYA 5KXBA 5BY5A 4NO4A 4OHZA 3B01A 1UZZA 1ZZ9A 3QH7A 4XJWA 1PK6B 2MEV2 1G7YA 4AEJA 2PAEA 3S30A 5K0UC 1IS3A 1C8NA 1H2KA 2AENA 2DCZA 3DF0A 4LULA 3FLTA 1VR3A 3AMMA 1X7NA 3B00A 1HDKA 1YIFA 2VPVA 3VBS