2BVVA

Sugar ring distortion in the glycosyl-enzyme intermediate of a family g/11 xylanase.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLFGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ENDO-1,4-BETA-XYLANASE)
publication title Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bvvA00
1KS4A 1TE1B 1XNKA 3VGIA 3B7MA 1QH6A 1XNCA 1C5IA 1REDA 3MF6A 2BWAA 2NQYA 4S2FA 3WQ1A 1XXNA 4S2DA 1UKRA 1AXKA 3VLBB 1OLQA 3MF9A 3B5LB 5K7PA 2QZ2A 4XPVA 3WXPA 1BVVA 3LGRA 1HV0A 2Z79A 3VZJA 3HD8B 2B42B 3WQ0A 2JEMA 2DCYA 1OA4A 1XNDA 1H0BA 4XQWA 5HXVA 1REFA 2VG9A 2BW8A 3VZOA 1XYPA 3WP6A 3AKQA 3WR0A 3AMNA 3MFAA 5K9YA 3VHNA 1NLRA 1REEA 1YNAA 4S2HA 1UU6A 3WP5A 4HKWA 2NLRA 1H1AA 2C1FA 1XNBA 1BK1A 1HIXA 3MFCA 2VUJA 3VHPA 2DCJA 1M4WA 1PVXA 3AKPA 3AKSA 3WX5A 1XYOA 3RI9A 5EJ3A 4HKLA 3WY6A 3VZMA 2DFBA 3WT3A 2B46X 1T6GC 2JICA 3VZKA 2QZ3A 1UU5A 3WQ7A 3VZLA 1H4HA 1KS5A 1OA2A 2DFCA 3VL9A 3ZSEA 3WP3A 1F5JA 3VL8A 1HV1A 1W2UA 4HK9A 1C5HA 2D97A 2F6BA 1IGOA 1ENXA 1BCXA 2DCZA 2VULA 3EXUA 2BVVA 4H7MA 4NPRA 3RI8A 4XQDA 3AKRA 3WP4A 3VHOA 2JENA 1OLRA 3M4FA 3AMHA 4XQ4A 3LB9A 2DCKA 4HKOA 4S2GA 1OA3A 1H8VA 1UU4A 3AMPA 4HK8A 1H4GA 2D98A 3AMQA 3AMMA 3VZNA 1QH7A 2B45X 1XYNA 3O7OA 2BWCA 2VGDA 4IXLA 3AKTA
chains in the Genus database with same CATH superfamily
1OF4A 1RUG3 2HLEA 1FAYA 1W8WA 3AZVA 1Z7S3 2FBEA 2I74A 3VGIA 1GQPA 2O1QA 4ES9A 4JKLA 1Q8SA 1J59A 5T55A 1PO13 1FNZA 1W6NA 5ACA1 5AC91 3USUA 2R073 2NQYA 3OBRA 1D4M1 4E8DA 1J83A 2OVUA 3HQRA 4WVZA 3VBSC 4YZ1A 5L19A 3JXSA 2JX9A 1JS9A 1OLQA 5J09A 1XBFA 2XL7A 4GMP3 4RGKA 4RS5C 3MLJA 1H8TB 2UYAA 1JN2P 3ZN6A 1WGPA 2A6ZA 2E63A 2CGNA 2R072 3HT2A 4QPIA 2HYKA 3LDKA 2GN7A 3LKJA 2RDQA 3POBA 4CCMA 5A6ZA 2VBDA 4QX7A 3DV8A 3KS7A 2JE7A 5FK7A 3SKJE 1Q43A 4CCCA 2VZSA 3SITA 2BTVC 3POGA 3AZWA 5E88A 3OBAA 1H6YA 3ETQA 4IV1B 2QQLA 1PHMA 1Z0HA 2OS2A 1BKZA 2OUJA 2W39A 4Q4V3 5CKMA 4DFSA 1PM7A 2DU0A 3KQRA 3FFZA 4YVSA 1O4TA 1UF2C 1YC61 4BMBA 4EYUA 4CDXB 1TMF3 2XJVA 1JZ5A 1R083 1N1TA 5C9AA 2WJSA 4H2AA 1US2A 4LHLA 2WFPA 1GP6A 1IQDC 2O0OA 5H9RA 3ES1A 2NYYA 4E4DX 3JCIA 4HKLA 4XILA 5FYSA 2XUMA 4CU8A 3OPWA 4RA0A 2HYXA 4XBNA 1TMF2 4P00B 3HVDA 2QBXA 3OTFA 1VBD3 3ZPYA 3M3EA 3BPZA 2A6WA 3VD7A 4YARA 2HWE1 2IVIB 1YEWA 3BGAA 3J8F1 5BXXA 4BQWA 1CAWA 3NKTA 4OUEA 1HXS3 2WUHA 2X8KA 2XJQA 5FIXA 3VL9A 4DXZA 3RFRA 3E6CC 3ZSEA 1RMU1 5EQUA 4QHOA 2GDFA 1WA6X 3BIWE 3O0WA 3OPZA 1YFWA 2V4VA 1NLQA 4UYBA 3U14A 1DLLA 2RHPA 3K48A 2VQAA 3ECQA 2XHNA 5DUUA 3ZYGA 1J3QA 4D7TA 2VZUA 3AC0A 4NPMA 5IVVA 3WDTA 4QPGB 3PTRB 5C8CA 4PBPA 3LSDA 3K3OA 1ZZ7A 2FCUA 2JWPA 2AREA 1K45A 3VD5A 1FMD1 2DTYA 4FTBA 2EIEA 2W95A 5FUNA 5DUWA 4IQPA 4AFCA 4YM1A 4IEXA 3AX4A 5FMOS 3KM5A 1ZRDA 1BXHA 3UL2A 4BXSV 1IZ3A 2CU5A 3OYWB 5ACA3 5AC93 5FZFA 1D4M3 3N9OA 3UKNA 5LA1A 2JG8C 1ULOA 5JR7B 1XNTA 1AL23 2DTWA 2GC0A 4YW1A 5DUXA 1SLIA 1XC6A 4NIIA 1A6CA 1LENA 5AC92 5ACA2 1GQHA 1E5IA 1RUC1 5DG2A 5AFBA 3PU3A 4UW3A 2WQZC 3K77A 3I2FA 4DS0A 2YU1A 5FY0A 1XNAA 4E8CA 5L7OB 3AKTA 2RS51 4G3YC 2QE3A 1K42A 4CDUC 1UO9A 1YLLA 4JRAA 1CAUA 3MIDA 4GKXA 2KA3A 3O1PA 3SH5A 4CDWC 1DU3D 3ILFA 1AYM1 5LBEA 5GLZA 1JYWA 3ZYBA 3ZXDA 2BFUL 5JOXA 1NKGA 2C4XA 3FJSA 5GLTA 3WVJA 4CXXA 4UFIA 4COYA 1HB2A 3P1IA 1P8JA 5I0TA 4FP3A 2WKKA 3KCCA 4EROA 1WMEA 2A71A 4AWDA 1DGLA 2C24A 1TZOA 2EIGA 1H0BA 1VBC3 1IS4A 1UMHA 3GBGA 1REFA 3WEZA 3WSOA 5BNOB 2ZGNA 3KT1A 4NIDA 4ZXEA 1NE6A 1COV1 1UNBA 2HWE3 2VU9A 3J8F3 4R8HA 2PLV1 5GLVA 2C5DA 1J84A 4CTEA 5F3CA 1AHSA 4D3WA 4AOCA 2VY0A 3PUAA 5CBLA 5KHKA 1RMU3 1H1AA 1V00A 1YFXA 2GH8A 1XNBA 4XETA 3UK9A 3CQOA 2AC1A 1JUHA 3J26N 4KWLA 2D93A 2HWE2 4MGIE 4AI9A 2QCSB 2YB7A 3H3ZA 3FE5A 5FZOB 3AKSA 4BQ3A 4ISRA 3SHRA 1VBE1 1ZBA1 2VOKA 4FPEA 1RVF2 3R0RA 4D6SA 1OBNA 3JQWA 3I97A 2D6KA 2ET7A 3NO8A 4EE2A 3ENRA 3MIBA 3WCSA 4AQSA 3ZMOA 4EV0A 5GZGA 4XUTA 1RUF1 3VDDC 1QJU3 4ASMB 1MEC2 3QBQA 5FCCA 3KCXA 2RV9A 3VD4A 1ST8A 4A7KA 5IAXA 1DQ1A 1RYYA 4N53C 1ZZ8A 1FMD2 5A7SA 4DY5A 1AJKA 4XFAA 4JAAA 2JXAA 3HIFA 4N43C 1PGSA 5FLJA 3J9SA 1BJQA 2BOJA 4O7XA 1LODA 2VZ3A 5C4WB 5JDBA 1O3SA 2KR2A 1NCRA 4KGQA 4IETA 3OY8B 5I0SA 1RUC3 2C9KA 4LJHA 3DPRA 5FWEA 3AB0A 2XGXA 1X50A 1YUDA 5B4XA 2GNTA 2YBPA 2ZGTA 1BCXA 2Q1FA 3MW4A 2ZGLA 4NPLA 1WCQA 1QDOA 4Y24A 5HCFA 1PO21 3WW3A 1SFNA 1E5HA 5FZ6A 2J22A 1SEFA 1GR3A 2YGLA 4A7YA 1BK0A 2AUYA 1UAIA 4CDQC 4XUNA 3WP4A 4YZ4A 1CAXB 3ON7A 1AYM3 3AM2A 5HCHA 3ZYFA 1QY4A 4NIAA 1EUTA 2RS52 4BK4A 1H8VA 1PIV1 1GUIA 4N9HA 3KV5A 1ASJ1 2XJPA 1H4GA 2X29A 4OZXA 3N4MA 1QJX2 1B35C 1PX3A 1RHI1 3OJBA 3GCXA 3WDXA 1CX1A 1F35A 4IEPA 4XEZA 3ZXFA 5FZ0A 2V73A 3ZFEC 4BXFA 2FMYA 1DQ0A 1CAVA 1J58A 4PF5A 1O7FA 3LOIA 5FO9B 1R1ZA 4ZZ8A 4MX3A 1O4ZA 5JOWA 3RWKX 1ND3A 1W90A 5FZ9A 1COV3 2XVLA 1G9FA 2EXJA 1KDMA 5LBBA 2PLV3 4NO4A 2Y64A 1F9KA 2UWCA 4BQ4A 3NNMA 2RE9A 1QOSA 2EXKA 4JVAA 3W58A 3MV01 4AK3A 2BGPA 1UKRA 4LULA 5FXVA 1AXKA 4LKSA 1COV2 2PLV2 2JKXA 3POIA 1SMVA 3NMBA 4OLLA 4AEDA 1ZBA3 1V9U1 3OUIA 3ZFFB 2DCTA 4L9BA 3I54A 3J7HA 3E6DA 4BISA 4Q1RA 1JXNA 2YZ4A 3APBA 1XB9A 1ULDA 1NYWA 3WF0A 1W3XA 5F3EA 1LKNA 4QGLA 2A3XA 3HNBM 4IE0A 1HRI1 1VBE2 2Y8KA 4BK5A 3ZSMA 1YHFA 1CPNA 4KWKA 1VAVA 1H2MA 2QUOA 2YPJA 3ZXJA 4TZDA 1OH4A 1QMJA 2E6VA 2HJIA 3PLQA 3H1WA 1URXA 4YPJA 2NLRA 1GSLA 3VBRB 5JCTA 2O8OA 2ZABA 4XF1A 4EN6B 3RZKA 1AR93 1F4HA 4XZUG 3S7EA 3T3YA 5FXXA 5BV6A 2QQJA 2NPIA 3JU9A 1GLHA 1PVXA 2ENRA 3U11A 3A21A 3PDQA 3DN7A 4LITA 2H6BA 1RUF2 3CF6E 1Z78A 4LUKA 2LTNA 2F4PA 3MDPA 4P9YA 1HJFA 2HWC1 2ZGMA 1AR61 1S0FA 5CFCA 1HW5A 4D7SA 5CG8A 5ABJB 2XOMA 4WBBA 2R0FA 2NZ9A 1NAEA 3WT3A 4A6OA 3UNPA 1XPWA 1MQTA 2TBVA 2R0HA 4QXBA 5AVPA 4JRLA 2IXHA 3VZKA 2ZGOA 4YVWB 1PO23 2VUDA 2CHHA 2HBTA 1LESA 2Y34A 2LROA 5BNNA 1CZVA 1HQNA 2PN5A 2E7TA 3AJYA 3RSJA 4AQ6A 5JZGC 3TAYA 4B4QA 4TYSA 3IDBB 1YO8A 3D4KA 4Q8KA 1YJKA 3HNYM 1LECA 1PO22 3GZAA 3ME2A 2N7GA 4AL9A 2R1DA 2ZX0A 1JU4A 4XFBA 1PIV3 1ASJ3 4OHXA 3MYXA 1C5HA 2DUOA 1GOFA 5LY2A 2K9ZA 1TNFA 1G9BA 1WD3A 2XPJA 5ERLA 4W6XA 4M01A 2AEYA 3R4UA 1OSGA 1UMZA 2ORZA 2WS91 4BE3A 2VC9A 4LK6A 1ASJ2 4AVTA 5A1FA 1IS5A 1TG7A 3NJXA 4DUXA 5FYBA 1RHI2 4NAOA 4JDMA 3THPA 1IG3A 3NNJA 5A7WA 1EAH2 1ULCA 4ZKTB 1WMXA 2D3RA 3E5QA 5IUQA 3WG2A 3ZYHA 3MICA 4JDNA 4WVWA 3K2OA 1S0IA 4D69A 3PJQA 1FI2A 1ZRRA 3WDWA 2HEWF 2XWBB 2Z4FA 5FZMA 3POWA 1V9U3 2AACA 5DN2A 2DUPA 2B9VA 1UY4A 2QTWB 4UFLA 3C7GA 4PIYA 1XYNA 3TRSB 2P3JA 2VZRA 5A3LA 1ONAA 3OG2A 1WUVA 4IE6A 3MV11 1V9U2 3KVBA 3EBRA 5FZKA 4Y1ZA 2BFUS 2YPDA 4GWJA 2FHRA 1NE4A 2X10A 4PLMA 4CYDA 3HQUA 4MXWB 3AP7A 5E6HA 4XMAA 2W47A 3CZUA 1SCRA 3FLTA 3KV4A 1HRI2 1K5JA 2Y6FA 1VMHA 3B5LB 3LQCA 4OVEA 5FO7B 1R091 2JB4A 2Z79A 3Q8FA 2RJLA 4HBNA 3C7FA 1JHJA 3HD8B 2HWC3 1AR63 3IB3A 4LO6B 5FKCA 3NSTA 4P14A 4EJRA 2DCYA 1MS4A 2OIIA 2R041 2AGSA 2YYOA 5LASA 2B39A 4XQWA 1SDWA 1AR73 1NCQB 3PNAA 1OLMA 2OQ6A 2RG4A 1YWKA 4AG4A 1QHDA 2VMEA 1AR62 4QX5A 1LU1A 4BQXA 1WW4A 3VBUA 4S2HA 5F1RA 1S0EA 3C7HA 4CP9B 5A3NA 1LGNA 1GBGA 1I1EA 4XFCA 4CXYA 2A3WA 1S0GA 5LB6A 5C9AC 1ZNPA 4OMCA 2A73B 1D0GA 2VMHA 3OB8A 2EXIA 5CA6A 4I0WB 1MZ5A 2FDKA 5C70A 2YC0A 2JIJA 2BNOA 2PHUA 5A32B 4LO4B 4C8DA 1AR82 1POV1 1QJFA 2QQNA 1C8NA 1RUNA 2WS93 1UU5A 4E9KA 1YFUA 1DHKB 4JX0A 4JGZB 2K0GA 2QFEA 4RHV1 1RJ8A 1HRV2 2VOTA 5FXWA 5KHGA 1DYPA 1KJRA 2WS92 5LRSA 3I2GA 4Q0PA 1DIWA 4LNVA 5JXHA 4TTGA 3WG4A 5LEKA 1VR3A 2I07B 4DIQA 1RUE1 1BBT3 4XJ9A 2VL4A 3AP6A 3EJKA 4OI4A 1VAKA 4DXSA 5JR2A 2Y6HA 5F5QA 4YW2A 4WV8A 4CCDA 2W68A 1OFNA 2R49A 3KV9A 1A3KA 4MGZE 5A3WA 2ZACA 1VP6A 3IIIA 4M3CE 4A4AA 1D2QA 2WFF1 4R9BA 4UBGA 5KXCA 3NRUA 4H7MA 4RYDA 4GB32 1CIWA 5J96B 2QQPA 3KZ4C 5HV0A 3OBZA 4HVQA 4RGGA 3E97A 4QX8A 3HWJA 3VHOA 5LY1A 2Q0AA 2DU1A 4N7UA 2FCTA 3BTXA 2G4IA 2Z5WA 4FAGA 3JD71 3Q8BA 2D6PA 4ATEA 5JXJA 4HZFA 2FZ2A 3AXDA 4SBVA 5JWPA 3I2IA 3WW2A 5FZHA 1OPMA 2MHFA 2QKDA 2QVSB 2X09A 1R093 3H0OA 4N43A 2WWUA 4HOOA 1DFQA 3ZYJB 4NJ4A 1JU3A 2D7FA 3VD3A 1W6QB 2VQTA 3OBTA 5C33A 5JXGA 1UL9A 3N35A 5CISA 4GH4A 2R043 2VGDA 4N7IA 4QT6A 4LBMA 4K21A 1RUI1 1H2LA 2IXKA 3CLPA 1W0OA 1W6MB 1R092 4LLOA 2VVEA 4PDWA 3QH7A 3BUCA 2RS12 4Z07A 2R7EB 3O14A 3UESA 1UY0A 4KU7A 1QJY1 1QH6A 1REDA 3PVEA 4CXWA 3LD8A 1ZYBA 3AYAA 2YBKA 4QKDA 5GZEA 3WW4A 4CDQA 5FQ0B 5K0UB 4ASKA 4M3CF 1BEV2 5HCAA 3FLRA 1G8WA 5A1LA 2RR12 3MW2A 5FZIA 3W5MA 4TLGA 1BQPA 5L9RA 1NY72 5BY5A 5HI0A 3PUQA 1WBFA 2YY1A 2Q8CA 1WMDA 3NWKA 2UYBA 5I93A 3WF3A 2D40A 4QPIB 4K1YA 3ZFGA 5D8AB 1BLZA 2ID4A 2WIIB 4UFHA 4PHZA 1RUJ2 3H50A 3WP6A 4BB3A 3V64A 3L2YA 3LCPA 3WNOA 4OFGA 3I2OA 3AMNA 3IDAA 1A78A 1DLCA 4FCAA 1JOJA 1NLRA 4UOJA 2GNBA 4NRQA 2DVGA 3B9CA 3VBOA 2VTFA 1OXCA 2HWD1 2ZMLA 5EYXA 1V6KA 2BERA 4QWNA 2RM22 4UF0A 3U37A 4YVSB 4RHV2 4CCOA 4IEUA 1UY3A 1OT5A 1RUE3 2G19A 3P6BA 5IVEA 1QQP2 5A3UA 2WNVB 2IFWA 2R32A 4BLIA 3T2TA 5BNQA 2ZHLA 2FCVA 2J1TA 2P17A 2PTMA 4NHMA 5GLUA 3WHTA 3WINE 3C3VA 2EA7A 5IW0A 5FO8B 2J1RA 3TWIA 1RUE2 3GF6A 4AVAA 1C8M3 2J42A 4JDOA 4KBBA 1RUG1 3BTAA 3LEGA 5FZ3A 3THDA 1Z7S1 3QOPA 1E5SA 4XTMA 4QXHA 4I3GA 1S2BA 1PO11 1CAWB 4LHKA 1MVQA 4BPZA 1PZ7A 3GZTB 3M70A 3NAPB 4IL7A 3THTA 4TLFA 2WFF2 4AEJA 3JD73 2ZEXA 4YW5A 2CAUA 4O61A 1W2UA 3ILNA 3OGRA 1KFXL 1RJ7A 3KGZA 4Q0SA 3T2QA 4MGTA 3M7AA 3OOXA 5LK5A 1J3RA 4L0PA 3DPRC 5GALA 2R30A 3PL0A 3KSCA 1UY1A 1W0PA 3MPPG 4JQRA 5FZ1A 4MG2A 4XHXA 4LLFA 1SBDA 1UOBA 1RUI3 4MGYE 4QXCA 4YGDA 4WM7B 5BNPC 5FP8A 2EAAA 5C3OA 1V6JA 4FAHA 5I0DA 4CU6A 1SG3A 4IEVA 3ACHA 3FFQA 2UU8A 3BN6A 1QJY3 4HETA 4HN1A 4D6QA 1W06A 1KRIA 4A44A 4Y1YA 2WAAA 1OLRA 1POV0 3BOPA 1GQGA 2PELA 3AYDA 2SBAA 3AMHA 3MIFA 3MW3A 2W87A 4FOWA 1RUI2 4L11A 4PBOA 5JZGA 4FTSA 4BU2A 4RD7A 4DXRA 2H0BA 1UX6A 4P9WA 1ND2B 2WYFA 1QJY2 3OUHA 1VMFA 2ZGRA 3AMQA 4C1WA 3RZHA 4KBZA 1HQLA 3RS6A 1W8TA 4YZ3A 4MVTA 4LHNA 1WA4A 5DZFA 1ND3C 4ZPIA 3V0BA 4XAEA 1SPPB 2VZVA 1DYOA 2VBBA 4PLNA 1DZTA 2ZZQA 4EQVA 1XQNA 1YQ2A 5FY9A 2O14A 1HXS1 4ONUA 1W03A 4XFFA 2VMDA 1LOBA 2Q5TA 5IK8A 1S0JA 2BWAA 1MZ6A 2KXLA 4NWVA 1ZZCA 4S2DA 1WLTA 5T5JA 1RXGA 2HWD3 1ZZ6A 2G1MA 2WZ8A 5I8TA 3DKWA 2X5IB 2IXJA 4FXKB 4KH9A 3ZSKA 4AEDC 5AVAA 1GU3A 4J25A 3IDCB 3AP4A 3FWEA 4CCJA 4IEYA 4YZ2A 2V5DA 3SCFA 4KL1A 3B69A 1BHGA 1IOAA 2Y38A 4XURA 1BMV1 2HWD2 3CJIB 1SBEA 3QLQA 3D8CA 3R4DB 4MUVA 5T5OA 3SCGA 3I49A 1IPSA 1LAJA 2J1UA 4IERA 1SLAA 4Y5Z0 3FBMA 1LU2A 4QB2A 1DF0A 1OQ1A 2D6MA 2VM9A 3VDAA 2Y6JA 1UXZA 4Y5SA 4AI3A 4YZ5A 1Y43B 3I3BA 5GZCA 1MS1A 1LJ7A 2BPA2 1L3JA 1LRHA 1O91A 1ZRIA 2GH2A 4FTEA 3CO2A 2J1EA 5FOJB 3V0AB 3RZGA 1Q5OA 3TNQA 4A41A 5KXDA 5CNAA 5F37A 1RUG2 1AL21 4Q2FA 1Z7S2 4LEJA 5CFCC 1TME1 3WX5A 3BU0A 5G04L 3CEWA 4QB1A 1PO12 3JUUA 3MIGA 4MOAA 1MQTC 1UPSA 4AF9A 4OHZA 3OGSA 4NIHA 1W2AX 4MH0E 1RC6A 2PFWA 1OI6A 3VBFA 3VKLA 2X53S 3A7QA 3RMYA 1Y4WA 3PURA 3OGVA 4AVBA 5A3MA 1H4HA 2F17A 4IGOA 4LXLA 4AEKA 5BNNC 1JYIA 4GALA 3T08A 2ZTNA 3W21A 1LNSA 4A3ZA 4CP1A 5A33B 5CG9A 4IE7A 2FDIA 4Y22B 5A3OA 1LEMA 2BOIA 2W1UA 2QQUA 1VRH1 2RJ2A 3RYRA 5BNOC 1PGL2 1N3PA 4Q4V2 3MUZ1 1UZ0A 4B1MA 3JB8A 5ANQA 1IGOA 2Y33A 3OUJA 1VBC1 2K46A 3A0KA 1PZ8A 5FY4A 1R082 4CEWB 4CU7A 2E32A 5EIYB 4H14A 4UWDA 1GZWA 4F7ZA 4NVPA 1RIRA 1MACA 2JG9C 1MS0A 2W1QA 4LBQD 4RQPA 5CKNA 1GWLA 3I2DA 4R9DA 1UOGA 2CDPA 3DYMA 4XQ4A 4COZA 4FXGB 3FC0A 1VBD2 2OQ7A 4Y20A 2OA2A 1G9AA 5IFPA 5DZGA 5IVFA 2ZPXA 1HXS2 1NOVA 1UZWA 2VNRA 2WSVA 3SEEA 1GWKA 3ILRA 1VIWB 5C3QA 1G7YA 3M3QA 4MLOA 4L92A 4XABA 4AI8A 1SBFA 4AW7A 1V70A 4GMP0 3D5OA 4M3CB 3LIHA 1TE1B 2DURA 3IAPA 2AENA 4U2AA 4UI9L 5IHRA 3AL6A 2JDPA 1DYKA 1Q8VA 1QJU1 1OD5A 4LORA 2ILMA 1LOCA 4QMAA 3T2OA 4XCBA 3NKGA 1NA1B 3MIEA 4PIZA 5IK5A 3S0MA 1R64A 4GULA 2YC4A 1XXNA 5FY1A 1H1IA 2I45A 4MGQA 3T2PA 2D3SA 3OGJA 3MF9A 4UFKA 2HWF1 4XPVA 1BVVA 3LGRA 5IVJA 2XR4A 1TME3 1VE0A 3VZJA 1QEXA 4QU1A 2ZX1A 5FBZA 1UYPA 2UY8A 1KD7A 3ACLA 1Y9QA 1D4M2 1OA4A 4AVSA 4WM8A 2PHRA 4QXKA 5DZEA 1K5MB 3WDYA 1AL22 5KC6A 1YI9A 3VBUC 5CFDA 4K20A 4JHTA 2Q1MA 5DG1A 2PHDA 3H1YA 1LCLA 5FUPA 4AFMA 3B01A 4DUVA 2RS31 3W9AA 2CY6A 2WWSA 5CU1A 1FV2A 1H6XA 3OPTA 1BK1A 5A7PA 3ZR5A 4CCLA 1OOPA 3MFCA 3O1RA 2DCJA 2L9LA 3RZLA 1ZVFA 1PM4A 2XBO3 1VRH3 2VZ1A 4P5YA 5E16A 5C5UA 4B1LA 3VBSB 5DAXA 3OEBA 4XIOA 3VB9A 5EP9A 4RS5B 4YLZA 5JPMB 2ZX4A 3TYJA 1W0NA 2D6OX 4UT5A 5LWBA 4RR3A 4NUBA 2WNUA 4JQTA 4Q0UA 4IV3C 2WC2A 3RMXA 1FX5A 4BIOA 1RGSA 4KWJA 5FMDA 5KC5A 3N9LA 3CKHA 5FP9A 1W6OA 2JDHA 3C7OA 1S2KA 5DXDA 4PF1A 4Q27A 4GWNA 1PX4A 2YDEA 1JUIA 4HPKA 2BGCA 1U5YA 5F6LB 1PK6A 5FYCA 1VBC2 1HKDA 4LOSA 1ZRCA 1OURA 1HV1A 4J1XA 2IXIA 4UW4A 3Q8EA 4ORFA 4BDVB 4HK9A 4XIKA 1UWWA 3J8F2 2RDRA 3TEXA 1OKQA 4ZU7A 5IVBA 2FZ1A 1ACCA 4QX0A 3ZDVA 1RMU2 2P3YA 4YSFA 2KM2A 4UBHA 3GHMA 5JI9A 5EPAA 3USSA 1ODNA 3VBRC 2JDYA 3RZZA 2NP0A 3EO6A 2JDUA 4XDOA 2QQVA 4NHLA 1PZ9A 5LBFA 2BQPA 3DCQA 3T4HB 4COVA 4Z8BA 4NPRA 3TN93 4CEYC 3LIGA 4ZU4A 3N7JA 4YW6A 5F32A 1YXWA 1IG0A 1W9TA 1H8TA 1AR91 1OF3A 1LOAA 4LOTA 2BUKA 3T1MA 4DRRA 1OA3A 2PMWB 3UKVA 1LHVA 3LPGA 5FP4A 2DUQA 3PUSA 2HWF3 1QJU2 1LOGA 4LUMA 5C8WA 2D98A 4ATFA 2XJTA 3IWZA 4GH4C 5C7GA 1EPZA 5FXZA 1Q8PA 1DQ5A 2VVFA 3UYJA 2VCCA 4AFDA 3M3OA 3T0AA 4KU8A 4PDWC 1AL0G 1O6UA 2PQQA 3TNPB 4AGVA 2GN3A 5BNPA 1RUC2 1QDCA 1OHFA 3K4DA 4H3WA 2RS33 1JZ2A 3GBFA 4CDXA 3U0ZA 4FPFA 5FYVA 2D3PA 5H9SA 3TB0A 1CR7A 3RRDA 4OI1A 4P02B 4EWAA 4XJ8A 1RXFA 2QZ2A 3C7EA 4JGYC 2VMCA 1HQWA 3QH6A 3SLIA 3N36A 1DGWA 2VR4A 2JE8A 2P5BA 2JG8B 3ZFGC 1AYM2 3I2JA 2VTXA 3NNLA 1JH5A 3AZXA 5JVVA 2P34A 2UWBA 1Q8QA 5JSPA 2GMPA 1VB2A 3VZOA 4BMEA 1LHOA 4F3JA 1XYPA 2CL2A 5KBFA 4URTA 3U78A 2BYVE 3E5XA 5FK8A 3LDRA 3VBOC 2EIBA 2G9GA 1OPOA 3T4VA 2C1FA 5D2AA 2OZ6A 4CDUB 4E2QA 4CDWB 4CVUA 3FHIB 3VBHB 4QM8A 4WVMB 2OW4A 2PHWA 1LGCA 2YV8A 4LBKA 4YYOA 1SLLA 3TEYA 3ASIA 4BH9A 1YQCA 4HSLA 2FDFA 3WY6A 3RGBA 3MGUA 2P4EA 1QXPA 2FMDA 4KQ7A 4Q26A 4DPNA 3FUQA 1L7QA 2JD9A 4YM0A 3LF7A 3V65A 4AEMA 3OYWA 2VCMA 3D6EA 3IT8A 1ZBA2 1OA2A 2A6XA 3CZJA 1SQ4A 5EXOA 1W6PB 2MNGA 4I02A 1MS8A 5CIRA 4LBNA 2J1AA 2WZEA 2ZBJA 5FJKA 5CADA 2GNDA 5F5CA 2DWRA 3T1LA 3DXUA 4CPBA 2XG3A 3NV3A 3S5AA 3EMRA 3POSA 4Q4X1 4LE3A 4TWTA 1CZTA 2WNOA 4K7JA 1W2TA 3WNPA 1FOD1 5L7OA 1GOGA 2VZQA 1UN1A 2ZGSA 2W5FA 1AR92 4IDZA 5FPZA 1NLSA 3GALA 1RUOA 4YWAA 3WUDA 1VBB1 1NG0A 2BEOA 3AK0A 1LOFA 5LEJA 1AR71 5DUVA 4XJAA 3ZVXA 5FDBA 4XDPA 1W2OA 4AFBA 1VLNA 4JKMA 2WRAA 5FJHA 3G7DA 2ZKLA 4W4ZA 1OVPA 4MV2A 3GNEA 2ZHKA 4FPLA 1JZ7A 3OCPA 3WHUA 4IW3A 3BPSA 4M00A 5FR3A 3D3AA 5JMCA 5DAPA 3VDDB 1ZA7A 2P37A 5DAQA 5F9TA 4PI0A 4BJ0A 5TSWA 1US3A 4HMZA 5HCBA 4N53B 2W08A 4LA2A 4Z92B 4XOGA 4EWEA 5BNOA 3I3MA 1DZQA 1EP0A 5C71A 1N3OA 3B94A 4LE4A 4Y1XA 1AX1A 1DP0A 2WO3A 5A7NA 1XOYA 2R061 3C8XA 1PIV2 3IMNA 1O8PA 3VD9A 3TEWA 3NV4A 3H3LA 2W3JA 2ZCWA 3GGLA 2TUNA 4OQ9A 1XNCA 3HR9A 1D0HA 1K3IA 1POQA 4XUQA 3ZO0B 1KEXA 2JG9A 5FZOA 2B9UA 3H8RA 1W8NA 3IPVB 4NOTA 1W04A 5HV4A 1T6BX 2WA4A 4MGKE 3EQEA 3IMMA 5FY8A 4CDQB 4D6RA 1FXZA 1YYNA 1BBT1 3VHRA 2B42B 3WQ0A 2JEMA 4AR2A 4OHYA 4X8NA 3ACFA 2DBIA 3DECA 5HXVA 2GAUA 2LM3A 5FYIA 1B35B 4LBQB 4LKDA 4LR4A 4NAMA 4BM8A 5IATA 1X9PA 3CJXA 3J7LA 4GZ9A 3D0SA 3BKZA 5CYYA 1DQ4A 3INAA 1JBCA 5E89A 3ZFEB 1NXMA 4INDA 4R4ZA 1WWYA 5EWSA 5C4WA 2IXCA 1GOHA 2HWB1 2IVJA 2QQMA 2J1SA 3OGGA 4HLTA 5I0RA 5FMBA 2QDNA 1OH3A 4Q4X3 5KHJA 3UT0A 3LEIA 1GP5A 3W20A 5F5IA 3AVRA 1FOD3 1U5XA 1Y9MA 2EAKA 3VBFC 3VV1A 5DMYA 4A6SA 5A6YA 4CE8A 4XF0A 1VBB3 5EJ1B 1VBA1 2ARAA 2I2SA 4B3NA 3HQXA 4B7EA 1N3QA 4JTNA 5IWFA 3F2ZA 1XU1A 3FBYA 4F83A 1X82A 4L97A 5A70A 2HWC2 4XFGA 5B2GB 4Y1VA 2JIGA 5FZLA 3WP3A 1F5JA 4COUA 2JDNA 4LBLA 1VBB2 4XJUA 3I59B 3O12A 5FYTA 1O59A 1W8FA 4XVHA 2Y6GA 1AR72 5LCWL 2FDHA 4I3PA 2Q1ZB 4Q4Y1 1S0CA 4CUAA 3MZHA 4OYUA 1YI7A 3K46A 4HVOA 4OHVA 1RUH1 4YW7A 4Q29A 4AHWA 1UYZA 2F6BA 3I2KA 4IE4A 1AXZA 1SCSA 2J7MA 2CNAA 1V6NA 5LRRA 4DRVA 3DGTA 3MPBA 4B29A 2VAUA 2R063 4QQHA 1STMA 2A5ZA 4RQPC 3VKFC 5DDJ1 2Y0OA 4YG0A 2ZX3A 3HJRA 4XQDA 2JE9A 4IV3A 3NQHA 4FBFA 3HBKA 1Y3TA 1GMMA 4CUCA 4ZS2A 3U07A 2A1XA 4LIUA 2RVAA 2AYHA 1SZBA 1VALA 2W92A 2R062 3BCWA 2H6CA 4MADA 3O1VA 3E1F1 3H9AA 3I3QA 1MS9A 1RL3A 3ZFFA 3K4ZA 5JIAA 1S0DA 4QB6A 5JZGB 1UU4A 1GZTA 1C3HA 1FYUA 3PMSA 2QDRA 2VZOA 4YM2A 1EY2A 5JUVA 2ZEWA 2ARCA 2XL9A 2VMIA 1WKYA 3MIHA 4IGPA 1J3PA 4K6BA 1BBT2 1C8M1 5FZ4A 3VBRA 4OHWA 3V0BB 3GYDA 1CGPA 1QXJA 3HPNA 1W3VA 1IPJA 2IUWA 4F8AA 1H9WA 1V0AA 2ORXA 4CEYA 2AR6A 3GM8A 3CU7A 2HWB3 1QWRA 3V56A 1QU0A 2VOXA 1A8MA 4E4HA 1XE0A 3QCWA 3WNKA 5ABJA 3AFKA 4V2WA 1CPMA 1N1SA 1O5LA 2GNMA 2XWJB 1OKOA 3H7JA 2XVGA 3TOJA 4MXVA 4TXWA 2Z69A 4UXAA 4WM8C 4YW4A 1KDKA 1GICA 2WO7A 3LFMA 1XNDA 4QQLA 4YVWA 3A23A 3URFA 2ATFA 4LKEA 3WG3A 4CPBD 5DABA 2XVKA 1VBA3 5CFDC 1GKBA 1GYKA 1ULGA 3SH4A 2PAMA 2WN3A 3RNSA 2YU2A 4QQ2A 1UD1A 3VHNA 4R9CA 3ZX7A 1YNAA 3O0XA 3DUIA 4RFT0 3WP5A 4CUBA 1OOPC 1CJPA 4IUGA 2R042 2GU9A 1VBA2 3SMHA 5T54A 1W6NB 3CHXA 3ZLIA 4P9LA 3USUB 4ITCA 4Q4Y3 2QJVA 4NROA 2DVBA 4XAAA 2D6LX 2JDZA 2Q4SA 4P9JA 1RUH3 5F7UA 1JYVA 5BPXA 4JGYA 2D6NA 4FP2A 3U4XA 4IEQA 3ZN6B 4AHYA 4RR3C 5FYMA 2WNUC 3KLSA 4XTPA 4Q4Y2 3KV6A 1WCSA 2CWMA 3ZIWA 3UJQA 1F4AA 4FQZA 2KD7A 1KS5A 4B8EA 1S0BA 2X5IC 2FDJA 5DDJ3 3NNGA 1PK6C 2CTVA 5FMOL 4W8JA 5J98B 3O1OA 3LZZA 2CYFA 4QM9A 1N1YA 1FATA 2TNFA 4IEZA 4YGBA 4Q5OA 5KXBA 3NJZA 1W9FA 3MEPA 3M3CA 4YG6A 3PIJA 1ENQA 1HB1A 1K12A 1PGW1 1U0AA 3KT4A 4FPYA 3WF2A 1X8MA 3N7MA 4M4PA 1W9WA 2D97A 3ST7A 3UJOA 2NMOA 5C9AB 5CEHA 1HB3A 2IZWA 2JD4A 3SKVA 1W9SA 2XDVA 3VDBA 2Q8OA 1LHWA 4DOUA 5FAXA 3EXUA 2RMU1 2VJXA 4XUOA 2VZTA 4FOVA 5J37A 1XE7A 1KXGA 1EV11 1S1AA 4MXWA 1LR5A 4MZUA 5F6KA 3UGFA 1G9DA 1OQDA 1OMIA 3BVCA 1H8TC 3K4AA 3FHAA 4FFGA 3RJ2X 2Y60A 4A2UA 3M4FA 4D0QA 4CP0A 4ARXA 5EYYA 3LB9A 4YGEA 2OYZA 3GZUC 1C8M2 2R16A 3QD6A 3KCYA 4ZONA 3W59A 4QGNA 4L8QA 1PNFA 1IHMA 1NCQA 2WN2A 3JQXA 5FMCA 3S7IA 2B45X 4IV1C 3JD72 4XHBA 5CKQA 5BUVA 2YFZA 2BU9A 4QX1A 4Y4YA 4HT1T 1Q56A 3HT1A 4FI9A 3B93A 4EN8B 5C8CB 1R1A3 1JOPA 2WABA 4YNIA 4Z1VA 5D21A 5FLHA 4CDXC 4OCTA 4KNCA 5HPOA 3WLUA 3OEAA 3DEMA 3O5SA 2LW8A 2WO2A 4LKFA 4H7LA 4E4ZA 5K4LA 4Q0QA 3SC7X 3AYEA 1JW6A 1IS3A 3PIGA 2P6CA 1XSQA 5I8SA 3M3IA 1XE8A 4R4XA 5HXMA 1I3HA 5A32A 2A6VA 2CGOA 4ES8A 4D8MA 1WD4A 4QQOA 3O0VA 4JGZA 1XU2A 2CV6A 3AL5A 2BW8A 2VG9A 3ACGA 1LTEA 4BA6A 1CWPA 3Q8AA 4HVRA 2DVDA 2E31A 2NMNA 2V72A 2WINB 2B7YA 4NHYA 3IDEA 5JSOA 1ULPA 4YW3A 4XC9A 1UOJA 3IAQA 3PVOA 4BWOA 1CAUB 1LEDA 1HIXA 1YIPA 5IJRA 2E9QA 3WOGA 3PJYA 4QPGC 3ZOIA 1IKPA 2XKPA 3RZMA 1UIKA 1BZWA 2VNOA 3PTYA 3G6JB 4BQ1A 5F39A 3CBNA 3R05A 3T09A 4BOWA 2O8QA 2UWAA 4GKYA 5FYUA 3RQ0A 3VBHC 3ZMNA 5GKAC 2RJKA 3IN9A 4ET7A 1NA1C 1RTVA 2VMFA 3H8UA 4HL0A 5F2WA 2ET1A 2FD8A 2PHXA 1DGRA 3ZR6A 1PGW2 3WQ7A 3VZLA 3H8XA 2RMU3 1YRZA 4EN7B 5LK7B 1QNYA 3BU7A 4FFIA 1PMIA 2DVFA 1NQJA 1EV13 3HNMA 3OSDA 1C1FA 3H42B 1ZBE1 1F8VA 1AVBA 3VL8A 4CU9A 1CONA 2D5HA 3O1SA 1OQEA 5G05L 4HPKB 2LALA 1SFYA 2OZJA 4LIVA 2EF6A 4W65A 2WR9A 3KVAA 3HN3A 4UFJA 1S4CA 1W6QA 2HKXA 2VXJA 5C3SA 2WLPA 4XYXA 3AVSA 3LA2A 4ARYA 5L7OC 3BALA 3BODA 2ZGQA 5FKBA 5KR7A 1Y7BA 3AXEA 1LOEA 1NXD1 2WA3A 4FFFA 3POJA 4XF9A 1LOFC 2HBUA 4UFMA 5JI7A 2VULA 1YQ6A 3D0JA 4XUPA 2E51A 2XHKA 1JI6A 4I2OA 2WDBA 3RI8A 4I0AA 2P2KA 5K0UA 4DY3A 5FQ0A 1H9PA 1TEIA 1UZZA 4LO7A 2HEYF 3NJVA 1F15A 1F2NA 2VOWA 5FZ7A 4PCRA 1ZA4A 1NUKA 3CNAA 5JPNB 3PVBB 2VNVA 4WVVA 5FP3A 2DCKA 4AAXA 2AH2A 4B7KA 5LA2A 5FOBB 1DGRN 3WV6A 1OUSA 3AYCA 3AZZA 2XBO1 3C2UA 3P5BA 1JOBA 1YFYA 2XJUA 5JMOA 1GANA 4GWIA 4Y1UA 5D8AA 4AI0A 3AMMA 1NCRB 3DF0A 2VW1A 2LRPA 5FTTC 3DPRB 2K2SA 1KS4A 2VECA 3Q9OA 4BLJA 2YC2A 2QQWA 4AVVA 4V1PA 3GXUA 2OUHA 1C5IA 2W1WA 1V6LA 4UW5A 1YQ5A 1JYCA 5BNPB 3EB7A 4NMIA 3WQ1A 5KWRA 2GP5A 4I09A 1H1MA 4RN5A 5T5LA 2ZEYA 2WNVA 2C26A 5JIUA 4IESA 2BVBA 1DDLA 1JZ4A 3GBWA 3HOBA 1U12A 2IFRA 3I7DA 3CMGA 1AYN1 1CVNA 4XF3A 1QKQA 4RFRB 3KD4A 2ZXQA 1H2KA 3FZ3A 1H2NA 3LSEA 2J1VA 5SV8A 2Y6LA 1MZEA 4URAA 3KQ4B 1ZRFA 1C1LA 3LAGA 3QACA 4GJYA 4FOQA 4XMIA 3UV9A 4EN0A 5FPVA 4FSJA 4FVVA 5H9QA 5FLIA 3ZSLA 3AKQA 1CAVB 3MFAA 4EZHA 2TEPA 3NAPA 2WO1A 1RVF1 3AFGA 3TN91 1ND3B 1IKQA 4HKWA 5C4WC 4KG8A 5ISLA 1BMV2 1ZBE3 1NQDA 2CGPA 4AE2A 2D44A 4O9GA 4P9GA 4Q0VA 2BBVA 3I4IA 4E2SA 1RUD1 4Z2WA 4AYUA 2YMZA 3LEMA 2XLGA 1PNGA 3LFIA 4P9XA 5T5PA 2GSYA 3RVHA 1MEC1 1ZBE2 3J7NA 4PI2A 5EJ3A 3SNMA 3UGHA 3M1HA 1FPN1 2DFBA 3JBG1 5FV3A 3U1XA 4WM7A 3VZMA 4AEDB 5FREA 5FY5A 4XJZA 5J3UA 1H30A 2XQRA 3O1TA 3AP5A 3IZOA 2WQ8A 4BZ4A 1ZREA 3DYPA 1TME2 4OZOA 2BV4A 3NV1A 5FZEA 4Y33A 2DFCA 5LZ6A 3LOBA 2VUAA 4C90A 1W99A 1J1LA 2W94A 1DZRA 5KHHA 1ND2A 1QOOA 4C91A 3WNNA 1MVEA 3OD0A 4QQPA 3MI8A 1D7PM 2XJRA 5L9BA 1UX7A 4XBQA 4X6RB 1ODMA 4Q1PA 3RJRA 2W2IA 3KHBA 3IIAA 1SPPA 5E1RA 3SEPA 3L2HA 4D94A 5FPAA 5CFCB 1ENXA 5CZKA 1AZDA 1QIQA 2MPFA 1OUXA 3N7KA 3NV2A 4KMQA 5DAWA 5F3GA 5JOZA 2XBO2 1VRH2 4K8FA 1MQTB 2BVVA 1WW7A 3GZEA 4FOYA 3MLKA 1WMFA 2P3KA 4BQYA 1ZZ9A 1QJX1 5LA9A 1UOFA 3POEA 2X5IA 1OFSA 4LBOA 2BNNA 1EPWA 1KQRA 4GQ7A 3ZFFC 5BNNB 1J1TA 1LULA 3DYOA 2ZAAA 1Y9GA 3ZM8A 1S55A 2IWGB 1G86A 3CJIA 1CN1A 4AGRA 1AYN3 3DXTA 4LK7A 3VKOA 4BHPA 5ANNA 3U10A 1T2XA 3ABZA 3ITQA 2ZAHA 1GNYA 1KGYA 1Q3EA 4IXLA 4P9IA 3GJAA 1SLTA 3I2HA 4Z82A 1O3QA 5EV7A 1XNKA 1AYN2 1O4YA 3V0AA 2VCBA 4XDQA 2XJSA 1RVF3 5FPXA 1RB8G 2PHLA 1UW8A 3MF6A 5DQ0A 3S6PA 5JOYA 5IVYA 2DV9A 5I8YA 4BQ5A 5ABJC 5A7WB 2JG9B 2XMLA 5DAVA 1RUD3 3PUHA 4QX3A 5H9PA 5K7PA 5IK4A 3RWNA 3WXPA 1YQ8A 1HV0A 3TN92 3ATGA 4FPHA 2PHFA 1ENRA 3T0DA 1MEC3 4YVWC 1FT9A 1I5ZA 4L2NA 1FPN3 3JBG3 3H3UA 2YUEA 1CX4A 1RUD2 1FMD3 2H0VA 3WNLA 3ACIA 2ZZJA 3Q8CA 2W46A 1SLCA 2HWF2 3FLPA 4IV1A 3THCA 2LS6A 1IQAA 5A33A 5GJ6A 4Y22A 5D1IA 1KJLA 1FPN2 1UU6A 2XUEA 3JBG2 4IEOA 3VN4A 1MPXA 5IAVA 1FNYA 4QKBA 5IVCA 3LE0A 2D5FA 5FYYA 4H55A 4QPWA 3TEZA 1E5RA 1JTZX 4DO0A 4LHSA 2XKOA 4LA3A 4Q4W1 2ZHMA 4IEWA 2V09A 2RS32 4CEWA 3BYWA 2VH9A 4LQRA 4NHXA 5GM0A 1UYXA 2XONA 5FUIA 2JICA 3N3HA 2UY9A 3NVCA 2RS53 3B02A 4FO9A 4GD4A 5FPBA 3PVNA 3K3NA 3UETA 1BYHA 1AUYA 3CL1A 1WCUA 5LA0A 1ZZBA 1QJX3 2XXZA 2WQ4A 3LWCA 4A45A 3KMHA 3VBUB 5AFEA 3M8LA 2WNEA 3GCWA 2QQOA 3X29B 2WT0A 2BJSA 2E33A 1HJGA 4FPGA 2RDNA 1UYYA 4XFHA 2WL1A 4QPGA 1VJ2A 4U36A 2LUWA 2ZX2A 3WNXA 3RDIA 4IGQA 1SLBA 5FPLA 1EAH1 4B4RA 4M3CA 4QX2A 2JB8A 1QXRA 4HXCA 2DCZA 1APNA 3VBHA 2E7QA 1CJDA 2BRTA 1AX0A 1NA1A 3FUOA 3JZVA 3S30A 4M0NA 3W5NA 2WBKA 2NM1A 1DBNA 4A3XA 2EXHA 1WCDJ 2W52A 3MHZA 4RL7A 1I5PA 5GLWA 4AI2A 5CB7A 3WDVA 5IT6A 4IV3B 3NL1A 3LA7A 4HKOA 4S2GA 1DG6A 3SQOA 2OXBA 2R6QA 1SHWB 1CZSA 4CSWA 3S57A 1W9YA 1VBE3 4QDQA 2ERFA 4QDRA 1MZFA 1NCQC 3WQBA 4OI2A 4KGGA 4C0HA 4EN9B 4O65A 4SLIA 1K5MA 1W2NA 3RYKA 5C3RA 2PA7A 2BWCA 4PT6A 2B4KA 2ADDA 1V6OA 1LHNA 3NJYA 4MHUA 2A3YA 2XLFA 4NR1A 4CZSA 2NN8A 3ZXLA 1RUF3 2D43A 4L99A 1UIJA 3AP9A 5FY7A 4GIQA 5J48A 5L73A 4C0BA 2Z2SB 4EWDA 2YGMA 1KITA 4M0HA 3VBSA 4A42A 4CEYB 4CCEA 2ZOEB 1B09A 1CD3G 3I3EA 5CVRA 5JLVA 4OUMA 4RS5A 2WZPP 3K75B 4YM3A 1O5UA 4Q4W3 5EZWA 4OULA 4JGZC 3I3DA 1ULEA 1AX2A 4LO8A 5C6CA 4N43B 1ULFA 4GXLA 1I9RA 2E7AA 1MS3A 4TN7A 4ZZ5A 3O1UA 2VUCA 2ZHNA 3I8TA 3BB6A 4GH4B 2ZJCA 4Q4W2 4YG3A 2QQIA 2ZS6B 5FBJA 1QF3A 3WCRA 1PMJX 5I0UA 4A7ZA 4Y26A 4QHZA 2XH6A 4PDWB 2Y6KA 3RZJA 4I01A 2WT1A 3ZXKA 2EVXA 4LTAA 2FDGA 1AR81 4DNYA 2GP3A 5KHIA 5FZBA 4PJYA 4ZU5A 4DEQA 3AKPA 1ZM1A 4K9SA 2YBSA 2VW0A 1XYOA 4KWUA 3ELNA 1UXXX 3ZYIB 5IFTA 1HRV1 1RHI3 2XB6C 4RSUA 2Y0IA 1C57A 4HONA 2IXLA 2W0XA 5F8PA 3ZSJA 4CRQA 1EAH3 4JTOA 5FZ8A 2B46X 5A7QA 2DBNA 4JGYB 1T6GC 2BZDA 1BVP1 2WZR1 2OKXA 2A6YA 1CESA 3ZFGB 1S2EA 2OPWA 2WLQA 3HAGA 1WCKA 5FRAA 4AFAA 3FL7A 3WNMA 2YROA 4HG6B 4OUSA 5GZDA 3RG0A 2YFUA 4G4FA 4E4SA 3NW4A 4UAPA 1GNHA 1QJZA 3OD4A 4JHZA 1JZ6A 3VBOB 3ALQA 2HEVF 3OY8A 4CCNA 1G9CA 4WZCA 4XF4A 3S5QA 4NIGA 1SACA 4GB31 1O3RA 1GFF2 2VW2A 4UF0B 4FQ4A 2VQ0A 1F5FA 2ZMKA 2FQPA 4OQ8A 2GC1A 1NZCA 2E26A 5BYNA 3LEKA 4J1WA 1C28A 1I6XA 3P3PA 4MYEA 1TNRA 5B4NA 5C5TA 1FV3A 5EHDA 4N8MA 4O9EA 3POFA 1KFUL 1HRI3 4Q4X2 3BTYA 5EFUA 4XFIA 4Y4RA 5K0UC 1CAXA 2VE1A 3UKTA 4Y5TA 2YXSA 4GWMA 1FOD2 1L7LA 1O3TA 3ZYPA 1D2SA 4LPLA 1GWMA 1ENSA 3ORJA 5FP7A 3ZN5A 4E2GA 4DUWA 4AGGA 3H8OA 1QOTA 3FN9A 1HLCA 4HANA 1VPHA 2JG8A 2G9FA 1NX9A 1W8UA 4QPIC 5D8AC 5LATA 2RS11 4WZFA 5LBCA 1UMIA 3L9JT 3M2MA 3R6SA 3JB4C 1W8ZA 1JMUB 5FFOC 3U75A 4AZZA 2ES3A 4ZS3A 2X05A 2ARBA 1WLCA 1BEV1 2ZGKA 1HX6A 1UY2A 4LO5B 2AEZA 2RR11 4XJWA 3H1MA 2B5HA 3U4SA 4QKNA 4CUGA 1NY71 4ASLA 1YIFA 1SDDB 3BIEA 4DZGA 3T0BA 5HBAA 2MEV1 4CDUA 2JDMA 1ZX5A 1JODA 2VOVA 3NNFA 4N90A 4YVSC 1QNWA 2Y26A 4AXOA 4CDWA 1JYTA 4ISQA 5KXEA 3UGGA 1SFPA 1VAMA 2ZA9A 4WVMA 2WNVC 1AR83 3KHCA 1VMJA 3WZ1A 3WW1A 3BOWA 4NE9A 4OI0A 1UQXA 2DDUA 5CAZA 1RUJ1 3CIHA 3ETPA 5J7MA 1OVSA 2XLAA 2C9AA 1A34A 3SXWA 4BYYA 3VKNA 1D4VB 1VB4A 3B3QE 2ZMNA 4NRMA 1HRV3 1XSRA 3ES4A 5A1AA 4AVCA 2CSGA 4Q8LA 4C1XA 1W39A 3K51A 4RGAA 1F31A 2ZKNA 4JKKA 4ZHNA 2Z42A 4YFWA 2AZ5A 1IS6A 1WBLA 2WZR3 1QGLA 4P5HA 2RM21 1PMHX 1W6PA 2PAEA 3NAPC 4AAPA 1W28A 4COWA 1W05A 4PQ9A 4QAWA 3WR0A 2PAKA 2DVAA 5K9YA 1QQP1 2GC3A 1HN1A 1HB4A 3LA3A 4HSJA 1UKGA 5L36A 2WZR2 3N9PA 2VXRA 2V4AA 5FWJA 3VHPA 1X33A 4K3UA 5I91A 1M4WA 5LW9A 4XBLA 1AF9A 5GZFA 3BTZA 3E5UA 1GP4A 4PIXA 3IBMA 1UCXA 1WLWA 2ZGPA 5T3NA 3VKMA 4GB33 4I0BA 4G9SB 5C8CC 1TQ5A 3RI9A 4E27A 4WM7C 5IYYA 4K8RB 1GV9A 4FPJA 5FZGA 2HWB2 2WSUA 3H7YA 2W91A 4DMIA 4HFSA 2E53A 4JV4A 4FT8A 2VTXJ 3WF1A 2ETEA 1R1A1 3FMGA 3ZXGA 3GDBA 3A0NA 3ROUA 3VDDA 1U5ZA 4TSVA 4JC1A 2R1BA 1ND2C 2QQKA 2W1SA 3KWVA 3VDCA 5EJZB 3KB5A 4MHRA 1CQ9A 3OF1A 4N53A 5IK7A 1DQ6A 3WG1A 4YGCA 1XJAA 4FFHA 2VNGA 2RS13 4QD2A 2VVDA 2XQXA 5F2SA 1PVC1 4D7YA 5J1XA 4CCKA 2GMMA 1UPIA 4KI5M 5DPNA 2VMGA 1O8SA 2EICA 1WW5A 3POYA 4X6QB 4XCAA 4XXPA 3RPQA 3SCHA 1C4RA 2VPVA 2IC1A 1BEV3 1DQ2A 1NZIA 2EALA 2RR13 4Y3OA 3SH3A 4XZPA 3VBFB 4AQTA 1RUH2 2WWJA 3A4UA 3IM0A 3HN1A 4K40A 1ALYA 1UZVA 4R52A 4YRDA 2ARXA 5A3TA 2MEV3 1X9TA 1U5IA 2PXJA 3IPVA 1WZXA 2JENA 1N47A 3T30A 5SV5A 1JHNA 2PHTA 2CAVA 5JXIA 2OPKA 1JZ3A 3CJIC 4LT5A 1W8OA 2JDKA 1DGWX 1X36A 1RUJ3 4FPOB 3AMPA 3ZXEA 5K8SA 3KT7A 5DDJ2 2MEV2 4HK8A 1V6MA 2PQSA 1RITA 2EIDA 4W6YA 5E8AA 2JKBA 3N9MA 2OX0A 1CIYA 5T50A 1B35A 2ZEZA 4LBQA 1POV3 3EHKA 5FYZA 4W6WA 2DYCA 3GHNA 3KF3A 3MBWA 4V2VA 5FZCA 3ZFEA 3MO4A 3ZXAC 2CDOA 2RM23 4QHBA 3N9QA 4RHV3 5F3IA 4BCUA 5A3PA 3ZYRA 1QQP3 3B7MA 4MSVA 4QGMA 2WYSA 3HBZA 2WAOA 4FPCA 1GZWB 4S2FA 3ZDSA 3B9IA 1RINA 3DL3A 4N9IA 4DINB 4KG0A 1XRUA 4RQPB 3VLBB 1M06G 4EZ4A 4I30A 1A8DA 2Q8DA 2A7AA 4FPKA 4Y20B 1WLDA 1L7RA 2BNMA 3CDZB 3VUOA 4MGSA 5C3PA 3R4SA 2YHJA 4HN0A 3B00A 5JSRA 2GZWA 2WFF3 1V6IA 3AJZA 2JJ6A 1EYBA 4LMFA 2RDSA 2VD7A 3J7MA 2VQUA 3ZKUA 5M0TA 1EUUA 4XACA 3P3NA 2ADEA 4CP9A 1GZ9A 3I59A 1REEA 1X8EA 4M4RA 4AHXA 2R071 4DXTA 5A80A 2GALA 2OT7A 2V5YA 4K1ZA 4X8PA 1Q8OA 2VUJA 4QU2A 1N1VA 3A22A 4W50A 5T52A 1NCRC 2VCAA 3DKQA 4GMP1 1VRBA 3TBDA 1TVGA 2VBPA 3PUIA 5FYHA 1R1A2 4YFZA 5FPUA 4J6GA 4NRPA 3WD5A 4PLOA 4CEWC 2JDAA 1AXYA 2C6SA 3ZKYA 1NT0A 5L9VA 1PVC3 3PHMA 1DCSA 4LBJA 1JZ8A 4XE9A 2C0ZA 2CWSA 3FHQA 1LGBA 4B4PA 1WW6A 2G9ZA 2QZ3A 4NN0A 2GC2A 3E6BA 2SLIA 5JAXA 2BBAA 2F4LA 4WM8B 4DB5A 3BI3A 3RYPA 4P08A 1IPKA 3WF4A 3N9NA 1OLME 1PVC2 1PGL1 4XXAA 4R9AA 4Q4V1 1MS5A 5J36A 5CFDB 1YCIA 3ZN4A 1E57A 1GZCA 4GA9A 4NWWA 2Q8EA 4DEVA 3IKWA 1TMF1 1R081 1LHUA 2Q30A 1X7NA 3O1MA 4META 4XW3A 4CP2A 1OOPB 1G6NA 5APAA 3FX3A 3ZPOA 4AQ2A 2BGOA 2YG0A 1OC1A 3F95A 1UZYA 2P6HA 1GNZA 5FZAA 4BQ2A 2GMEA 1HN0A 3EYPA 4GAZA 2QNKA 5A6XA 4DQAA 1VBD1 2VO5A 3N7LA 3WUCA 3KGLA 4JCKA 3WDUA 4CA9A 2P1BA 4ZXKA 3SISA 1QJEA 1LB2A 4MO3M 5FZDA 2HH9A 4Z2AA 4AI1A 4RR3B 1AJOA 3AZYA 2WNUB 3AKRA 2W9XA 4QPYA 3PU8A 4PQQA 2UURA 3HEIA 1JYXA 3J4UH 4OMDA 3LPFA 1W6OB 4IE5A 2VZPA 2A75A 1JYNA 4AHZA 4JZRA 4QKFA 4GJZA 1PK6B 2RMU2 1OD3A 3D82A 4ZY9A 1HDKA 1W8HA 4QDSA 2P3IA 1K5MC 4UW6A 1EV12 3MLLA 3MUY1 3GJBA 3HMYA 2WT2A 1YJLA 3VZNA 5A6QA 1QH7A 3LDBA 2PYTA 2B8MA 2DF7A 1W6MA 2BP6A 2JECA 2ZGUA 3O7OA 5A7OA 3ZIXA 4BIFA 3PMEA 4NHKA 1MR5A 5F5AA 2BDRA 2A70A 3KF5A
chains in the Genus database with same CATH topology
1RUG3 1FAYA 3AZVA 1Z7S3 2FBEA 2I74A 3VGIA 2O1QA 4ES9A 1Q8SA 1J59A 5T55A 1PO13 1FNZA 1W6NA 5ACA1 5AC91 3USUA 2R073 2NQYA 3OBRA 1D4M1 4YZ1A 3VBSC 2OVUA 4WVZA 5L19A 2JX9A 1OLQA 5J09A 2XL7A 4GMP3 4RS5C 3MLJA 1H8TB 2UYAA 1JN2P 3ZN6A 1WGPA 2A6ZA 2E63A 2CGNA 2R072 3HT2A 4QPIA 2HYKA 2GN7A 3LKJA 3DV8A 3KS7A 2JE7A 1Q43A 3SITA 2BTVC 5E88A 3AZWA 3ETQA 4IV1B 1PHMA 1Z0HA 1BKZA 2OUJA 2W39A 4Q4V3 4DFSA 1PM7A 2DU0A 3KQRA 3FFZA 4YVSA 1O4TA 1UF2C 4BMBA 4CDXB 1TMF3 2XJVA 1R083 1N1TA 5C9AA 2WJSA 4LHLA 2WFPA 2O0OA 5H9RA 3ES1A 2NYYA 4E4DX 3JCIA 4HKLA 4XILA 2XUMA 4RA0A 4XBNA 1TMF2 3OTFA 1VBD3 3ZPYA 3M3EA 3BPZA 2A6WA 4YARA 2HWE1 5BXXA 3J8F1 1CAWA 3NKTA 1HXS3 2X8KA 2XJQA 3VL9A 4DXZA 3E6CC 3ZSEA 1RMU1 2GDFA 3OPZA 3BIWE 3O0WA 1YFWA 1DLLA 2RHPA 3K48A 2VQAA 3ECQA 5DUUA 3ZYGA 1J3QA 4D7TA 3WDTA 4QPGB 5C8CA 4PBPA 3LSDA 1ZZ7A 2AREA 1FMD1 2DTYA 4FTBA 5DUWA 4IQPA 4AFCA 4YM1A 4IEXA 3AX4A 5FMOS 3KM5A 1ZRDA 1BXHA 3UL2A 1IZ3A 3OYWB 5ACA3 5AC93 1D4M3 3UKNA 2JG8C 5JR7B 1AL23 2DTWA 2GC0A 4YW1A 5DUXA 1SLIA 1A6CA 1LENA 5AC92 5ACA2 1GQHA 1RUC1 5DG2A 5AFBA 4UW3A 2WQZC 4DS0A 5L7OB 3AKTA 2RS51 4G3YC 2QE3A 4CDUC 1YLLA 4JRAA 1CAUA 3MIDA 4GKXA 2KA3A 3SH5A 4CDWC 1DU3D 3ILFA 1AYM1 5GLZA 3ZXDA 5JOXA 2BFUL 3FJSA 5GLTA 3WVJA 4COYA 5I0TA 4FP3A 2WKKA 3KCCA 4EROA 1WMEA 2A71A 4AWDA 1DGLA 2EIGA 1H0BA 1VBC3 1IS4A 3GBGA 1REFA 5BNOB 2ZGNA 3KT1A 1NE6A 1COV1 2HWE3 2VU9A 3J8F3 4R8HA 2PLV1 5GLVA 2C5DA 4CTEA 1AHSA 4D3WA 2VY0A 5CBLA 5KHKA 1RMU3 1H1AA 1V00A 1YFXA 2GH8A 1XNBA 4XETA 3UK9A 1JUHA 3J26N 4KWLA 2D93A 2HWE2 4MGIE 2QCSB 3H3ZA 3FE5A 3AKSA 4ISRA 3SHRA 1VBE1 1ZBA1 2VOKA 4FPEA 1RVF2 3R0RA 3JQWA 2D6KA 2ET7A 3NO8A 3ENRA 3MIBA 3WCSA 4AQSA 3ZMOA 4EV0A 5GZGA 1RUF1 3VDDC 1QJU3 4ASMB 1MEC2 3QBQA 5FCCA 3KCXA 4A7KA 1DQ1A 4N53C 4DY5A 1ZZ8A 1FMD2 1AJKA 4XFAA 4JAAA 2JXAA 3HIFA 4N43C 1PGSA 5FLJA 3J9SA 1BJQA 1LODA 5C4WB 5JDBA 1O3SA 1NCRA 4KGQA 4IETA 3OY8B 5I0SA 1RUC3 3DPRA 3AB0A 2XGXA 1X50A 1YUDA 2GNTA 2ZGTA 1BCXA 3MW4A 2ZGLA 5HCFA 1QDOA 4Y24A 3WW3A 1PO21 1SFNA 4A7YA 2YGLA 1SEFA 1GR3A 2AUYA 1UAIA 4CDQC 3WP4A 4YZ4A 1CAXB 1AYM3 3AM2A 1QY4A 2RS52 1H8VA 1PIV1 4N9HA 1ASJ1 2XJPA 1H4GA 2X29A 4OZXA 3N4MA 1QJX2 1B35C 1RHI1 3OJBA 3WDXA 4IEPA 4XEZA 3ZXFA 2V73A 3ZFEC 2FMYA 1DQ0A 1CAVA 1J58A 4PF5A 1O7FA 3LOIA 5FO9B 1R1ZA 4MX3A 1O4ZA 5JOWA 1ND3A 1COV3 2XVLA 1G9FA 2EXJA 1KDMA 2PLV3 4NO4A 1F9KA 2UWCA 2RE9A 1QOSA 2EXKA 4JVAA 3W58A 4AK3A 1UKRA 4LULA 1AXKA 1COV2 2PLV2 1SMVA 4OLLA 4AEDA 1ZBA3 1V9U1 3ZFFB 2DCTA 4L9BA 3I54A 3E6DA 4Q1RA 1JXNA 2YZ4A 3APBA 1ULDA 1NYWA 1LKNA 4QGLA 2A3XA 1HRI1 1VBE2 3ZSMA 1YHFA 1CPNA 4KWKA 1VAVA 1H2MA 2QUOA 2YPJA 3ZXJA 4TZDA 1QMJA 2E6VA 2HJIA 3PLQA 3H1WA 1URXA 2NLRA 1GSLA 3VBRB 5JCTA 2O8OA 2ZABA 4XF1A 4EN6B 1AR93 3S7EA 5BV6A 3JU9A 2NPIA 1GLHA 1PVXA 2ENRA 3U11A 4D7SA 3DN7A 2H6BA 1RUF2 3CF6E 1Z78A 4LUKA 2LTNA 2F4PA 3MDPA 4P9YA 2HWC1 2ZGMA 1AR61 1S0FA 5CFCA 1HW5A 5CG8A 5ABJB 4WBBA 2R0FA 2NZ9A 3WT3A 1MQTA 2TBVA 2R0HA 5AVPA 4JRLA 2IXHA 3VZKA 2ZGOA 4YVWB 1PO23 1LESA 5BNNA 1HQNA 2PN5A 2E7TA 3AJYA 3RSJA 4AQ6A 5JZGC 3TAYA 4B4QA 4TYSA 3IDBB 1YO8A 3D4KA 4Q8KA 1YJKA 1LECA 1PO22 3GZAA 3ME2A 2N7GA 2R1DA 2ZX0A 4XFBA 1PIV3 1ASJ3 4OHXA 3MYXA 1C5HA 2DUOA 2K9ZA 1TNFA 1G9BA 1WD3A 2XPJA 4W6XA 4M01A 4BE3A 3R4UA 1OSGA 1UMZA 2WS91 1ASJ2 4AVTA 1IS5A 1RHI2 4JDMA 3THPA 1EAH2 1ULCA 4ZKTB 2D3RA 3E5QA 5IUQA 3WG2A 3MICA 4JDNA 4WVWA 1S0IA 4D69A 3PJQA 1FI2A 1ZRRA 3WDWA 2HEWF 2XWBB 3POWA 1V9U3 2DUPA 3TRSB 4PIYA 1XYNA 2P3JA 5A3LA 1ONAA 1WUVA 1V9U2 3EBRA 4Y1ZA 2BFUS 2FHRA 1NE4A 4PLMA 4CYDA 4MXWB 3AP7A 4XMAA 3FLTA 1SCRA 1HRI2 3B5LB 4OVEA 5FO7B 1R091 2Z79A 2RJLA 4HBNA 3HD8B 2HWC3 1AR63 4LO6B 3NSTA 4P14A 4EJRA 2DCYA 1MS4A 2OIIA 2R041 2AGSA 2YYOA 2B39A 4XQWA 1SDWA 1AR73 1NCQB 3PNAA 1YWKA 4AG4A 1QHDA 1AR62 4QX5A 1LU1A 1WW4A 3VBUA 4S2HA 5F1RA 1S0EA 1LGNA 1GBGA 1I1EA 4XFCA 2A3WA 1S0GA 5C9AC 1ZNPA 2A73B 1D0GA 2VMHA 2EXIA 5CA6A 4I0WB 1MZ5A 2YC0A 2BNOA 2PHUA 5A32B 4LO4B 1AR82 1POV1 1C8NA 1RUNA 2WS93 1UU5A 4E9KA 1YFUA 1DHKB 4JGZB 2K0GA 2QFEA 4RHV1 1RJ8A 1HRV2 5KHGA 1DYPA 1KJRA 2WS92 5LRSA 4Q0PA 1DIWA 4LNVA 5LEKA 3WG4A 1VR3A 2I07B 1RUE1 1BBT3 4XJ9A 3AP6A 3EJKA 4OI4A 1VAKA 5F5QA 4YW2A 4WV8A 2W68A 1OFNA 2R49A 4MGZE 1A3KA 2ZACA 1VP6A 4M3CE 1D2QA 2WFF1 4R9BA 4UBGA 5KXCA 4H7MA 4GB32 1CIWA 5J96B 2QQPA 3KZ4C 4HVQA 4RGGA 3E97A 3HWJA 3VHOA 2Q0AA 2DU1A 4N7UA 2G4IA 2Z5WA 4FAGA 3JD71 2D6PA 4ATEA 4HZFA 2FZ2A 3AXDA 4SBVA 5JWPA 3WW2A 1OPMA 2MHFA 2QKDA 2QVSB 1R093 3H0OA 4N43A 1DFQA 3ZYJB 2D7FA 1W6QB 5C33A 3OBTA 1UL9A 3N35A 4GH4A 2R043 2VGDA 4N7IA 4QT6A 4LBMA 4K21A 1RUI1 2IXKA 1H2LA 3CLPA 1W0OA 1W6MB 1R092 4LLOA 2VVEA 4PDWA 3QH7A 2RS12 4Z07A 3O14A 4KU7A 1QJY1 1QH6A 1REDA 3PVEA 1ZYBA 3AYAA 5GZEA 3WW4A 4CDQA 5K0UB 1F8VA 5FQ0B 4M3CF 1BEV2 5HCAA 3FLRA 1G8WA 2RR12 3MW2A 1BQPA 1NY72 5BY5A 5HI0A 1WBFA 2YY1A 1WMDA 3NWKA 2UYBA 5I93A 3ZFGA 2D40A 4QPIB 4K1YA 5D8AB 2WIIB 1RUJ2 3H50A 3WP6A 3V64A 3L2YA 3LCPA 4OFGA 3AMNA 4FCAA 1A78A 1JOJA 1NLRA 2GNBA 2DVGA 3B9CA 3VBOA 2HWD1 2ZMLA 5EYXA 1V6KA 2RM22 4YVSB 4RHV2 4IEUA 1RUE3 1QQP2 2WNVB 2IFWA 2R32A 4BLIA 3T2TA 5BNQA 2ZHLA 4NHMA 2P17A 2PTMA 5GLUA 3WHTA 3WINE 3C3VA 2EA7A 5FO8B 3TWIA 1RUE2 3GF6A 4AVAA 1C8M3 4KBBA 4JDOA 1RUG1 3BTAA 1Z7S1 3QOPA 4XTMA 4I3GA 1S2BA 1PO11 1CAWB 4LHKA 1MVQA 4BPZA 1PZ7A 3GZTB 3M70A 3NAPB 4IL7A 3THTA 4TLFA 2WFF2 4AEJA 3JD73 4YW5A 2CAUA 1W2UA 3ILNA 4Q0SA 1KFXL 1RJ7A 3KGZA 3M7AA 5LK5A 1J3RA 3DPRC 5GALA 2R30A 3KSCA 1W0PA 3MPPG 4JQRA 4XHXA 4LLFA 1SBDA 5BNPC 1RUI3 4MGYE 4WM7B 2EAAA 1V6JA 4FAHA 4IEVA 3FFQA 2UU8A 4HN1A 1QJY3 4HETA 1KRIA 4Y1YA 1OLRA 1POV0 3BOPA 1GQGA 2PELA 3AYDA 2SBAA 3AMHA 3MIFA 3MW3A 4FOWA 4PBOA 1RUI2 4L11A 5JZGA 4FTSA 4RD7A 1UX6A 2H0BA 4P9WA 1ND2B 1QJY2 3AMQA 2ZGRA 4C1WA 1HQLA 3RS6A 4YZ3A 4MVTA 4LHNA 1WA4A 5DZFA 1ND3C 3V0BA 4PLNA 1DZTA 2ZZQA 1XQNA 1HXS1 4ONUA 4XFFA 1LOBA 2Q5TA 5IK8A 1S0JA 2BWAA 1MZ6A 2KXLA 4NWVA 1ZZCA 4S2DA 1WLTA 5T5JA 2HWD3 1ZZ6A 5I8TA 3DKWA 2X5IB 2IXJA 4FXKB 4KH9A 3ZSKA 4AEDC 5AVAA 3IDCB 3AP4A 3FWEA 4IEYA 4YZ2A 3SCFA 4KL1A 3B69A 1IOAA 2Y38A 1BMV1 2HWD2 3CJIB 1SBEA 3QLQA 3D8CA 3R4DB 4MUVA 5T5OA 3SCGA 4IERA 1SLAA 4Y5Z0 3FBMA 1LU2A 1DF0A 1OQ1A 2D6MA 4AI3A 4YZ5A 1Y43B 5GZCA 1MS1A 1LJ7A 2BPA2 1L3JA 1LRHA 1O91A 2GH2A 4FTEA 3CO2A 5FOJB 3V0AB 1Q5OA 3TNQA 5KXDA 5CNAA 1RUG2 1AL21 4Q2FA 1Z7S2 4LEJA 5CFCC 1TME1 3WX5A 3CEWA 1PO12 3JUUA 3MIGA 1MQTC 1UPSA 4AF9A 4OHZA 4MH0E 1RC6A 2PFWA 1OI6A 3VBFA 3VKLA 2X53S 3RMYA 4AVBA 5A3MA 1H4HA 4AEKA 1JYIA 5BNNC 4GALA 2ZTNA 4CP1A 5A33B 5CG9A 4Y22B 1LEMA 1VRH1 3RYRA 5BNOC 1PGL2 1N3PA 4Q4V2 3JB8A 1IGOA 1VBC1 3A0KA 1PZ8A 4CEWB 1R082 4H14A 1GZWA 4F7ZA 4NVPA 1RIRA 1MACA 2JG9C 1MS0A 4RQPA 4LBQD 4R9DA 3I2DA 4XQ4A 4COZA 4FXGB 3FC0A 1VBD2 4Y20A 1G9AA 2OA2A 5DZGA 2ZPXA 1HXS2 1NOVA 2VNRA 2WSVA 3ILRA 1VIWB 1G7YA 3M3QA 4MLOA 4L92A 4AI8A 1SBFA 4AW7A 1V70A 4GMP0 3D5OA 4M3CB 1TE1B 2DURA 4U2AA 2AENA 1DYKA 1Q8VA 1QJU1 1OD5A 4QMAA 2ILMA 1LOCA 3VBHB 3NKGA 1NA1B 3MIEA 4PIZA 5IK5A 3S0MA 4GULA 1XXNA 1H1IA 2I45A 2D3SA 3OGJA 3MF9A 2HWF1 4XPVA 1BVVA 3LGRA 1TME3 3VZJA 2ZX1A 5FBZA 2UY8A 1KD7A 3ACLA 1Y9QA 1D4M2 1OA4A 4AVSA 4WM8A 2PHRA 4QXKA 5DZEA 1K5MB 3WDYA 1AL22 5KC6A 1YI9A 3VBUC 5CFDA 4K20A 2Q1MA 5DG1A 2PHDA 3H1YA 1LCLA 4AFMA 3B01A 2RS31 3W9AA 2CY6A 2WWSA 5CU1A 1FV2A 1BK1A 1OOPA 3MFCA 2DCJA 1ZVFA 2XBO3 1VRH3 5E16A 3VBSB 4XIOA 4RS5B 4YLZA 5JPMB 2ZX4A 3TYJA 2D6OX 4RR3A 2WNUA 4Q0UA 4IV3C 2WC2A 3RMXA 1FX5A 4BIOA 1RGSA 4KWJA 5KC5A 1W6OA 1S2KA 5DXDA 4Q27A 4GWNA 2YDEA 1JUIA 4HPKA 2BGCA 1U5YA 5F6LB 1PK6A 1VBC2 1HKDA 1ZRCA 1HV1A 4J1XA 2IXIA 4UW4A 4ORFA 4HK9A 4XIKA 3J8F2 1OKQA 4ZU7A 2FZ1A 1RMU2 4YSFA 2KM2A 4UBHA 3GHMA 5JI9A 3USSA 3VBRC 3RZZA 2NP0A 3EO6A 4NHLA 1PZ9A 2BQPA 4COVA 4Z8BA 4NPRA 3TN93 4CEYC 4ZU4A 3N7JA 1YXWA 1H8TA 1AR91 1LOAA 3T1MA 2BUKA 4DRRA 1OA3A 3UKVA 1LHVA 2DUQA 2HWF3 1QJU2 1LOGA 4LUMA 5C8WA 2D98A 4ATFA 2XJTA 3IWZA 4GH4C 1EPZA 1Q8PA 1DQ5A 2VVFA 4AFDA 3M3OA 4KU8A 4PDWC 1AL0G 2PQQA 3TNPB 4AGVA 2GN3A 5BNPA 1RUC2 1QDCA 1OHFA 4H3WA 2RS33 3GBFA 4CDXA 3U0ZA 4FPFA 2D3PA 5H9SA 3TB0A 1CR7A 3RRDA 4OI1A 4EWAA 4XJ8A 2QZ2A 4JGYC 1HQWA 3QH6A 3SLIA 3N36A 1DGWA 2JG8B 3ZFGC 1AYM2 1JH5A 3AZXA 5JVVA 2P34A 2UWBA 1Q8QA 5JSPA 2GMPA 1VB2A 3VZOA 4BMEA 1LHOA 4F3JA 1XYPA 2CL2A 5KBFA 4URTA 2BYVE 3E5XA 3VBOC 2G9GA 1OPOA 2C1FA 2OZ6A 4CDUB 4E2QA 4CDWB 3FHIB 4QM8A 4WVMB 2OW4A 2PHWA 1LGCA 2YV8A 4LBKA 4YYOA 1SLLA 3ASIA 4BH9A 4HSLA 3WY6A 3MGUA 1QXPA 2FMDA 4KQ7A 4Q26A 4DPNA 3FUQA 4YM0A 3V65A 4AEMA 3OYWA 3D6EA 3IT8A 1ZBA2 1OA2A 2A6XA 1SQ4A 5EXOA 1W6PB 2MNGA 4I02A 1MS8A 5CIRA 4LBNA 2ZBJA 5CADA 2GNDA 2DWRA 3T1LA 2XG3A 3NV3A 3POSA 4Q4X1 4TWTA 4LE3A 4K7JA 1FOD1 5L7OA 2ZGSA 1UN1A 1AR92 5FPZA 1RUOA 1NLSA 3GALA 3WUDA 1VBB1 1NG0A 2BEOA 3AK0A 1LOFA 5LEJA 1AR71 5DUVA 4XJAA 3ZVXA 5FDBA 4AFBA 1VLNA 3G7DA 2ZKLA 4MV2A 3GNEA 2ZHKA 4FPLA 3OCPA 3WHUA 5JMCA 4M00A 3VDDB 2P37A 5F9TA 5TSWA 5HCBA 4HMZA 4N53B 2W08A 4LA2A 4Z92B 4XOGA 4EWEA 5BNOA 1DZQA 1EP0A 1N3OA 3B94A 4LE4A 4Y1XA 1AX1A 2R061 3IMNA 1PIV2 3NV4A 2ZCWA 2TUNA 1XNCA 3HR9A 1D0HA 3ZO0B 2JG9A 2B9UA 3IPVB 4NOTA 2WA4A 4MGKE 3EQEA 4CDQB 1FXZA 1YYNA 1BBT1 3VHRA 2B42B 3WQ0A 2JEMA 4OHYA 4X8NA 5HXVA 2GAUA 2LM3A 1B35B 4LBQB 4LR4A 4BM8A 3CJXA 3D0SA 1DQ4A 3INAA 1JBCA 5E89A 3ZFEB 1NXMA 4INDA 4R4ZA 5EWSA 5C4WA 2IXCA 2HWB1 3OGGA 4HLTA 5I0RA 2QDNA 4Q4X3 5KHJA 1FOD3 1U5XA 3VBFC 2EAKA 3VV1A 4XF0A 1VBB3 1VBA1 2I2SA 4B3NA 3HQXA 4B7EA 1N3QA 4JTNA 1XU1A 3FBYA 4F83A 1X82A 4L97A 2HWC2 4XFGA 5B2GB 4Y1VA 3WP3A 1F5JA 4COUA 4LBLA 1VBB2 4XJUA 3I59B 3O12A 1AR72 4I3PA 2Q1ZB 4Q4Y1 1S0CA 3MZHA 1YI7A 4HVOA 4OHVA 1RUH1 4Q29A 4AHWA 2F6BA 1AXZA 1SCSA 2CNAA 1V6NA 5LRRA 4DRVA 3DGTA 3MPBA 4B29A 2R063 4QQHA 2A5ZA 4RQPC 3VKFC 5DDJ1 2Y0OA 4YG0A 2ZX3A 4XQDA 2JE9A 4IV3A 4FBFA 1Y3TA 3U07A 2AYHA 1VALA 2R062 3BCWA 2H6CA 3H9AA 3ZFFA 1MS9A 1RL3A 5JIAA 1S0DA 5JZGB 1UU4A 1C3HA 1FYUA 3PMSA 2QDRA 4YM2A 1EY2A 2XL9A 2VMIA 3MIHA 1J3PA 4K6BA 1BBT2 1C8M1 3VBRA 4OHWA 3V0BB 3GYDA 1CGPA 1QXJA 1IPJA 4F8AA 1H9WA 4CEYA 2AR6A 3CU7A 2HWB3 1QWRA 3V56A 1QU0A 2VOXA 1A8MA 3QCWA 5ABJA 3AFKA 1CPMA 1N1SA 1O5LA 2GNMA 2XWJB 3H7JA 2XVGA 3TOJA 4MXVA 2Z69A 4UXAA 4WM8C 4YW4A 1KDKA 1GICA 4QQLA 4YVWA 1XNDA 3URFA 3WG3A 2ATFA 2XVKA 1VBA3 5CFDC 1GKBA 1GYKA 1ULGA 3SH4A 2PAMA 3RNSA 4QQ2A 1UD1A 3VHNA 4R9CA 3ZX7A 1YNAA 3O0XA 3DUIA 4RFT0 3WP5A 1OOPC 1CJPA 2R042 2GU9A 1VBA2 3SMHA 5T54A 1W6NB 4P9LA 3USUB 4ITCA 4Q4Y3 2QJVA 2DVBA 2D6LX 2JDZA 2Q4SA 4P9JA 1RUH3 5BPXA 4JGYA 2D6NA 4FP2A 3U4XA 4IEQA 3ZN6B 4AHYA 4RR3C 2WNUC 3KLSA 4XTPA 4Q4Y2 1WCSA 2CWMA 3ZIWA 3UJQA 4FQZA 4B8EA 1KS5A 1S0BA 2X5IC 5DDJ3 1PK6C 2CTVA 5FMOL 5J98B 3LZZA 2CYFA 4QM9A 1N1YA 1FATA 2TNFA 4IEZA 4YGBA 5KXBA 3NJZA 3MEPA 3M3CA 4YG6A 4FPYA 1ENQA 1PGW1 1U0AA 3KT4A 1X8MA 3N7MA 3ST7A 2D97A 3UJOA 2NMOA 5C9AB 2IZWA 2JD4A 2Q8OA 1LHWA 4DOUA 5FAXA 3EXUA 2RMU1 4FOVA 5J37A 1XE7A 1KXGA 1EV11 1S1AA 4MXWA 1LR5A 4MZUA 5F6KA 1G9DA 1OQDA 1OMIA 1H8TC 3RJ2X 4A2UA 3M4FA 4CP0A 5EYYA 3LB9A 4YGEA 2OYZA 3GZUC 1C8M2 2R16A 3QD6A 3KCYA 3W59A 4QGNA 4L8QA 1PNFA 1IHMA 1NCQA 3JQXA 3S7IA 2B45X 4IV1C 3JD72 4XHBA 5BUVA 4Y4YA 4HT1T 1Q56A 3HT1A 4EN8B 3B93A 5C8CB 1R1A3 4YNIA 4Z1VA 5FLHA 4CDXC 4KNCA 3WLUA 3O5SA 4H7LA 4E4ZA 4Q0QA 3AYEA 1JW6A 1IS3A 5I8SA 3M3IA 1XE8A 4R4XA 1I3HA 5A32A 2A6VA 2CGOA 4ES8A 1WD4A 4QQOA 3O0VA 4JGZA 1XU2A 2CV6A 2BW8A 2VG9A 1LTEA 4BA6A 4HVRA 2DVDA 2NMNA 2WINB 2B7YA 3IDEA 5JSOA 4YW3A 3PVOA 4BWOA 1CAUB 1LEDA 1HIXA 1YIPA 2E9QA 3WOGA 3PJYA 4QPGC 1IKPA 2XKPA 1UIKA 1BZWA 2VNOA 3PTYA 3G6JB 4BQ1A 3R05A 4BOWA 2O8QA 2UWAA 4GKYA 3RQ0A 3VBHC 3ZMNA 5GKAC 2RJKA 3IN9A 1NA1C 1RTVA 3H8UA 4HL0A 2ET1A 2PHXA 1DGRA 1PGW2 3WQ7A 3VZLA 2RMU3 1YRZA 4EN7B 5LK7B 1QNYA 3BU7A 1PMIA 2DVFA 1NQJA 1EV13 1C1FA 1ZBE1 1AVBA 3VL8A 1CONA 2D5HA 1OQEA 4HPKB 2LALA 1SFYA 2OZJA 4W65A 2EF6A 1W6QA 2HKXA 2WLPA 4XYXA 3LA2A 5L7OC 3BALA 3BODA 2ZGQA 1Y7BA 3AXEA 1LOEA 1NXD1 2WA3A 4XF9A 1LOFC 5JI7A 2VULA 3D0JA 2E51A 2XHKA 4I2OA 3RI8A 4I0AA 2P2KA 5K0UA 4DY3A 5FQ0A 1H9PA 1TEIA 1UZZA 4LO7A 2HEYF 1F2NA 2VOWA 5JPNB 4PCRA 1ZA4A 3CNAA 3PVBB 4WVVA 2DCKA 2AH2A 4B7KA 5FOBB 1DGRN 3WV6A 3AYCA 3AZZA 2XBO1 3C2UA 1YFYA 2XJUA 1GANA 4Y1UA 5D8AA 4AI0A 3AMMA 1NCRB 3DF0A 2VW1A 5FTTC 3DPRB 2K2SA 1KS4A 2VECA 3Q9OA 4BLJA 4AVVA 4V1PA 2OUHA 1C5IA 1V6LA 4UW5A 1JYCA 5BNPB 3WQ1A 5KWRA 4I09A 1H1MA 5T5LA 2WNVA 5JIUA 4IESA 2BVBA 1DDLA 3GBWA 1U12A 2IFRA 3I7DA 1AYN1 1CVNA 4XF3A 1QKQA 3KD4A 1H2KA 3FZ3A 1H2NA 3LSEA 5SV8A 1MZEA 1ZRFA 1C1LA 3LAGA 3QACA 4XMIA 4FOQA 4EN0A 3UV9A 4FSJA 4FVVA 5H9QA 5FLIA 3ZSLA 3AKQA 1CAVB 3MFAA 2TEPA 3NAPA 1RVF1 3AFGA 3TN91 1ND3B 1IKQA 4HKWA 5C4WC 4KG8A 1BMV2 1ZBE3 1NQDA 2CGPA 4AE2A 2D44A 4O9GA 4P9GA 4Q0VA 2BBVA 3I4IA 4E2SA 1RUD1 4Z2WA 4AYUA 2YMZA 2XLGA 1PNGA 4P9XA 5T5PA 2GSYA 1MEC1 1ZBE2 5EJ3A 3SNMA 3M1HA 1FPN1 2DFBA 3JBG1 3VZMA 4WM7A 4AEDB 5FREA 4XJZA 5J3UA 1H30A 3AP5A 4BZ4A 1ZREA 1TME2 3NV1A 3LOBA 2DFCA 2VUAA 4C90A 1J1LA 1DZRA 5KHHA 1ND2A 1QOOA 4C91A 1MVEA 3OD0A 4QQPA 3MI8A 2XJRA 4XBQA 4X6RB 4Q1PA 3RJRA 3IIAA 5E1RA 4D94A 3L2HA 5CFCB 1ENXA 1AZDA 2MPFA 3N7KA 3NV2A 5JOZA