2BVVA

Sugar ring distortion in the glycosyl-enzyme intermediate of a family g/11 xylanase.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLFGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (ENDO-1,4-BETA-XYLANASE)
publication title Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase.
pubmed doi rcsb
source organism Bacillus circulans
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bvvA00
1UU6A 1NLRA 3VZKA 1TE1B 2NQYA 3AMMA 4S2DA 3WQ7A 3VHOA 2BWCA 2DCJA 1YNAA 2BWAA 3AKTA 3VZLA 1H0BA 3MFCA 3WP4A 1XNDA 1OA4A 2DFCA 2QZ3A 1XNBA 3AMHA 1H8VA 1ENXA 2DCYA 3WP6A 1BCXA 4IXLA 4XQWA 5HXVA 3VZMA 1UKRA 1XNCA 3VGIA 4XQDA 1M4WA 3WR0A 3B5LB 3O7OA 3AMNA 3WQ1A 1OA3A 1OA2A 3WT3A 2VG9A 5K7PA 2NLRA 1HIXA 2B45X 3M4FA 1XYOA 1W2UA 3WQ0A 4HKWA 4S2FA 4HK9A 1XYPA 3AKSA 2VUJA 2VULA 3VL8A 1F5JA 3WY6A 3VL9A 1QH7A 3VZNA 3WX5A 1UU5A 2DCKA 1T6GC 4HK8A 4H7MA 1HV0A 1XYNA 1OLQA 1BK1A 5K9YA 3VZJA 1KS5A 3WXPA 1REFA 3ZSEA 1XXNA 3MFAA 3AKQA 1AXKA 2QZ2A 2DFBA 1HV1A 3RI9A 2D97A 3AKRA 3AMQA 3B7MA 4HKLA 3WP5A 1QH6A 3AMPA 2BW8A 1H1AA 3AKPA 3LGRA 1C5HA 3RI8A 2JICA 1BVVA 2D98A 1REDA 1H4HA 4S2HA 1IGOA 4S2GA 2Z79A 1XNKA 2C1FA 1REEA 3EXUA 1C5IA 2B46X 2VGDA 3VHPA 2F6BA 2B42B 2BVVA 3WP3A 2JEMA 3VHNA 4XPVA 2DCZA 1PVXA 1KS4A 2JENA 3VLBB 1OLRA 4XQ4A 3MF6A 4HKOA 3MF9A 3HD8B 3LB9A 3VZOA 1UU4A 5EJ3A 1H4GA 4NPRA
chains in the Genus database with same CATH superfamily
5F8PA 3CLPA 2WNOA 1VBE1 4JRLA 4RYDA 2GNDA 1TG7A 1HN1A 3A22A 4KWJA 1BEV3 1NX9A 1PO13 2Z2SB 1FOD1 1DGWA 2X8KA 2Y26A 1W8UA 2IVIB 2V4VA 3H3ZA 4YNIA 2OS2A 4B7KA 4HFSA 1BK0A 2DVBA 4DEVA 3P3PA 1RUF2 3UGFA 5CFCC 3ZKUA 1H8VA 2LALA 3LIGA 5DPNA 3ZYPA 4CXYA 5EFUA 3HT1A 3NV4A 5IVCA 2VUDA 1DQ1A 1UY3A 3TAYA 1QGLA 5KC6A 4Q0PA 1YFWA 1SDWA 4YW4A 2YBSA 1LENA 1RUC2 1QJZA 1PZ8A 1S0IA 4Q4V3 4BLJA 4CYDA 1JOPA 5F7UA 1HB4A 4YVSB 1PGW1 3A21A 4QGNA 1YQ6A 4XHXA 2FDIA 2ES3A 1WBLA 4AVTA 1FMD3 2YXSA 5KR7A 1CGPA 2V5YA 2I2SA 4QMAA 4JGZC 3R4DB 3SMHA 4XC9A 3KZ4C 3ZSLA 2BEOA 4AR2A 3S0MA 5A33A 1YQCA 5FFOC 3IWZA 1MEC1 1UW8A 1ZRIA 2VMFA 5ACA2 2D5HA 5L7OB 1XU1A 4AQ6A 5IJRA 1RJ7A 2WSUA 2AUYA 4NE9A 1CAXA 2D3SA 5FYTA 1ENQA 5L9BA 1JYTA 2FBEA 2ZGRA 1AZDA 1U5XA 2VZUA 3IPVA 4H2AA 1TME3 4DXSA 1XYNA 2O1QA 3ITQA 4KBZA 4LITA 3VD3A 5C8WA 1J3RA 5F6LB 2RDRA 4YZ3A 1H1MA 3ZYGA 1HRV1 3PLQA 4JDOA 1QF3A 1RMU3 2BVBA 1WMFA 2IXKA 2HH9A 4IUGA 5FY4A 3NNLA 5F9TA 3NNGA 2ZMNA 4LHSA 5FZCA 5F5IA 1RUG2 4BK4A 1ENRA 2BZDA 4CDXA 1MVEA 2QZ2A 3HNYM 1W99A 3FC0A 3VB9A 3SISA 1DGLA 2XUMA 3MLKA 4JQTA 4BCUA 1HXS3 1Q56A 4LIVA 2VOXA 5LA2A 3I3QA 1A8DA 4CEWA 3THDA 1PVC2 1LU1A 1FXZA 2JB8A 4ZHNA 2F4PA 5CADA 1GQHA 1XSQA 3SH5A 1Q8OA 3N9NA 1YWKA 4LT5A 2RR13 4P9XA 2A71A 2YFUA 4RHV3 1YIFA 1VBC3 3QH7A 5ERLA 3RRDA 5LASA 4CU6A 2MEV3 5FZ4A 1COV1 2EIGA 3MUY1 1E5SA 2WZ8A 4KH9A 2VCMA 1IG0A 4C91A 2ZABA 4CCOA 1D7PM 3BCWA 3PTYA 2QQIA 4FCAA 4CDXC 4MGIE 1O3SA 1HRI2 2CNAA 1TNFA 2KD7A 3E6CC 1WZXA 5HBAA 4AEJA 2ZGSA 2CWSA 3P5BA 4Y1VA 5DUWA 1OURA 1W6MA 1J59A 2R16A 5KXBA 4FTBA 2BGPA 3JXSA 5C5UA 3LB9A 4XXPA 3VKOA 1S0DA 4CEWC 1H4GA 2HEVF 4XW3A 4I3PA 4QHOA 1QJX2 2WQZC 2XJRA 4NPRA 1RIRA 3IBMA 1MZ5A 3KQRA 3VZKA 4AE2A 2RS33 3TEYA 1TE1B 5SV5A 5T5JA 2RS12 4XTMA 1EAH1 1DGRN 3E5UA 4DQAA 4BQ3A 1JI6A 3NQHA 4OHXA 4TXWA 4M3CB 2ARBA 5GLTA 2BNMA 1QWRA 4AI8A 3K4AA 1LHWA 5JVVA 4B3NA 1DP0A 1K3IA 2JDMA 4BJ0A 3GBGA 1YHFA 3PIGA 2A3XA 4G4FA 4Q1RA 4D8MA 4XFIA 1NCRC 1NQJA 4LXLA 3WG3A 3ZXEA 4AVSA 4QQPA 2YG0A 5F5AA 5CU1A 3WHUA 3RFRA 2P17A 1TME2 2PHDA 4GWMA 4YGBA 5A6YA 5FMOS 1WLWA 4YGCA 4NN0A 3NAPB 5FZ9A 2YPJA 5A7QA 4COWA 3BTYA 1RMU2 2RJKA 3I2GA 2DDUA 1RHI1 5K7PA 2CDPA 1DG6A 3E6BA 3RYKA 4UFLA 4JCKA 2W3JA 1R092 2IXIA 3VUOA 2C5DA 3WF1A 4Z07A 3M1HA 3ZSMA 2R0HA 1J3PA 4RD7A 4KQ7A 5DAWA 2FDFA 3G7DA 4CU7A 1HXS2 4Z8BA 4Y22B 5LW9A 3AJYA 2W0XA 1MQTA 1ULOA 3D0SA 2F4LA 2A3WA 1PO22 3D8CA 5F5CA 1RJ8A 2JX9A 5AC92 1NCQB 4I30A 2C4XA 1FPN3 2J1AA 4L9BA 4OFGA 1QY4A 1OLMA 2VE1A 5FY8A 3VBUB 1P8JA 3NNFA 4QPIC 2VZSA 2XBO2 5B2GB 3MV11 1ND2A 3KB5A 4NRPA 2Q8OA 3J7LA 3J8F3 3B93A 1AXKA 3BIWE 2G19A 2RJ2A 2PLV3 5JSRA 3AZWA 2JD4A 1TVGA 5CEHA 3WDVA 2RHPA 1H9WA 1HV1A 1NZIA 1YQ2A 2WWJA 4HKLA 3DPRC 4NWVA 1ZA7A 3NVCA 2XPJA 1QH6A 1RVF1 4Q4X2 3IM0A 1VBD1 2OPWA 3ZYRA 3JB4C 4UFJA 3H8RA 5FZKA 3S7IA 4QPGA 3NJXA 4M4PA 1KXGA 4Q0SA 5C33A 4FXGB 2GH2A 4LKFA 5FY0A 4XJ9A 4JDNA 1MQTC 1C5HA 2QQJA 5BPXA 5CBLA 5F5QA 4L2NA 2C0ZA 3WCSA 1PZ9A 2ZA9A 1A3KA 1O5UA 1VRH3 1AHSA 4GB32 4AAPA 4LHNA 3ZFEB 1WBFA 4FPYA 4NIHA 1I6XA 3KGZA 5HPOA 4B29A 1HQNA 2WL1A 1H8TA 2WQ8A 1F9KA 4FOQA 4M3CE 4QPYA 1OOPB 2B42B 2B9VA 1LHVA 5DG2A 3K3OA 1S2EA 1PVXA 2WS92 3KWVA 4O9EA 2G9ZA 2NP0A 2P34A 3M3OA 3ZVXA 3VBFA 1QNWA 4Q4W1 1J1TA 1X9PA 5L9RA 2VW1A 4QPGC 3VD7A 5BNNA 2DU0A 3OPZA 2HEYF 2CL2A 3AMMA 4K21A 5H9PA 3SQOA 1GBGA 2RS52 4TYSA 2HJIA 5J36A 1QJY3 4XJAA 4AOCA 3EQEA 1WLDA 1U12A 3P3NA 4E4ZA 1C1LA 3H8UA 5DZFA 3OUJA 5FYZA 2BU9A 2VNVA 1QQP3 4AGRA 1D0GA 3LDBA 4ARYA 3HJRA 4BHPA 4GJYA 4XUNA 2IVJA 3O12A 4Y5SA 3LDKA 4K9SA 2ETEA 4OUSA 2R063 4UWDA 1JXNA 1IQAA 1VMJA 5CG9A 1BLZA 3WDWA 3WP6A 5FY7A 4XBQA 5FREA 5T5PA 3ZN4A 1O6UA 1IPJA 4AFCA 4PIXA 1RUD1 5L19A 3CU7A 4MGTA 4X8NA 1AYM2 2A6WA 1S2KA 2OZ6A 3VBFC 4K8FA 5DAQA 4BQ5A 2JG8B 4QWNA 2J1EA 4UW5A 1PIV3 5FP3A 3JD73 5C3QA 2E31A 2CGOA 3NWKA 3BB6A 2QQLA 4P9YA 5SV8A 3JU9A 1OFSA 4E9KA 5F2WA 1PMJX 1JZ7A 4SBVA 1JHJA 3PVOA 4S2FA 2BBVA 2DVAA 4P00B 1GLHA 1CPNA 4XCBA 3VDDA 1O7FA 3AVRA 5LRSA 1CR7A 3VKLA 4QX1A 1V6LA 2UWAA 1SLAA 4N90A 2JG9B 2FQPA 2VNGA 4Q4Y3 5FIXA 4NIIA 4AQ2A 2XJUA 1AR62 1LJ7A 3IDCB 1UCXA 4AVCA 1POV1 2WR9A 1MS9A 1RUH3 5IVBA 2NPIA 1CPMA 1SACA 3USUA 3LEGA 1CIWA 4OULA 5FZ1A 4AYUA 1DQ2A 1PMIA 2HWE1 4XF9A 4FBFA 5F37A 4QU2A 2HWC3 1B09A 5A3NA 1TNRA 3OPTA 3W5MA 3OY8B 4Q2FA 1BEV1 1QHDA 3VN4A 1LEMA 4ORFA 1PO11 1JYNA 3ZFFA 5IK8A 1AVBA 2JDZA 5B4NA 5A3LA 5F3GA 1C28A 2ZGNA 5C8CA 5H9QA 2D7FA 1IKQA 2J1TA 2VQTA 3O1RA 4IGQA 1RB8G 1DLLA 3B00A 1UO9A 1RITA 4UFHA 2XVGA 3ABZA 3AXEA 1JW6A 4PBOA 4XYXA 3S57A 5L36A 2H0BA 4NMIA 3H42B 2WKKA 1LOGA 2KXLA 2E32A 1HB1A 4Q4V1 4XJ8A 5T3NA 4YARA 5FY1A 2GDFA 5LBFA 4NRQA 1X9TA 2RG4A 4D7YA 3EXUA 2BOIA 5I91A 1HLCA 1C5IA 3I2HA 2V09A 2ZHLA 3LFMA 2HWB3 1FMD1 5DDJ1 5E6HA 1AR92 5FRAA 4IV3A 4YG6A 1ULPA 3KGLA 2ARCA 1IOAA 4FOYA 4XF0A 5BV6A 1W6QB 4NAMA 3UKNA 5CA6A 2ZCWA 5A3PA 1NLQA 4Y1ZA 1VB2A 4HVOA 3ZN6A 1OVPA 1UYZA 1JTZX 4MADA 1WA4A 4PQ9A 3U0ZA 4E4DX 4GH4B 1UWWA 2IXLA 2RV9A 4XMAA 4YSFA 1GSLA 1NE4A 4BB3A 4E4SA 2FMDA 4ARXA 1GP6A 3DF0A 2HWF2 1H0BA 3MFCA 4LHLA 4N53B 1PMHX 3BOWA 1XNDA 3W9AA 4DIQA 5CISA 4MG2A 2E26A 5JZGB 3I59B 2OYZA 5KHJA 1LOBA 2DTWA 5FKCA 2PYTA 3CHXA 4LO6B 5D1IA 2DCYA 2GNBA 2WFF3 2Y6LA 4IXLA 1L7RA 2ZX4A 4PI2A 2VMGA 1ZZ8A 3R05A 5GZDA 4LIUA 4IV3C 4AEMA 1LOEA 3ZYHA 2ENRA 1GWKA 1BHGA 1U5IA 2PQSA 2QKDA 3GBWA 5EPAA 3FLTA 1AJOA 1Z7S3 5AVPA 4BMEA 3POEA 3UGHA 3LEMA 1QDOA 1TZOA 2UYAA 5GJ6A 4V1PA 4XOGA 1KITA 3IDBB 3MGUA 4OMDA 5DUVA 3BTAA 4L11A 3OJBA 2LM3A 1YJKA 3FFZA 4CCKA 1BKZA 3R6SA 1NZCA 2RR11 4RHV1 2PN5A 1JN2P 1VBC1 1GZ9A 1SZBA 2XHNA 3CL1A 3M4FA 3N7LA 3OB8A 4XBNA 4D6SA 2MEV1 4YZ1A 2VECA 4HKWA 4R9CA 3SCFA 1GQPA 3LPFA 4XXAA 1ONAA 5T54A 1W8NA 2VXJA 5ANNA 5IVYA 2VMDA 3SEPA 5JCTA 1ZBA2 5FZHA 2JKXA 2EICA 5JOZA 2WSVA 1KGYA 2VC9A 3VBRA 4CCDA 3J7HA 5IFPA 4XJUA 2CHHA 1NA1A 1VALA 4QXCA 2AH2A 1RUJ3 3CIHA 4RR3C 3BTZA 1HV0A 3I2KA 1SLTA 5BNPC 1OLQA 1V00A 1UOFA 1TEIA 2I74A 2ZBJA 4RN5A 5FXXA 4AVVA 1KJRA 2UURA 2WNUB 1YCIA 3RQ0A 1VP6A 1K5MB 1UZZA 2YMZA 4CEYA 2JIJA 4CUBA 5F1RA 5ABJB 5FMCA 1C4RA 1DLCA 3HOBA 2RS31 3NJVA 4RS5A 4QX0A 3ES4A 1K12A 2XVKA 1K42A 5EZWA 3A0NA 4CDWA 5FLHA 4LQRA 2TEPA 1QXJA 3DXUA 5F3EA 2WUHA 4I2OA 4MXWB 1UIKA 3JB8A 1FNYA 3WP5A 3H1YA 3VDAA 4OHZA 1W9SA 1OF4A 2Q4SA 2EIEA 3VBRC 1VBA2 4YW3A 3P6BA 4GAZA 2QDNA 4WM8B 1W2AX 3VBHA 2P37A 3O0WA 1MS5A 3VDBA 1G7YA 3A7QA 2A6XA 2IWGB 2GC2A 2VZRA 3PUQA 2Q1ZB 3OOXA 3KF3A 3O1SA 2D98A 2R043 4N43B 2ATFA 4F7ZA 1PGL1 2BOJA 3U4XA 2Q30A 1RL3A 2G4IA 4QX5A 2VOKA 3RNSA 4CEYC 4YZ5A 3UETA 2RE9A 1OSGA 4D6RA 1RC6A 2QQPA 4BQ4A 1ST8A 5JLVA 4CPBD 2DVFA 4ES9A 4YW5A 4CDWC 5HCAA 3ENRA 1WW4A 3AYDA 3DGTA 3ZX7A 1X7NA 1EV13 3KV9A 1MACA 3JBG3 4LBNA 4H14A 4IW3A 4AWDA 3VZOA 4GMP3 2VQUA 5M0TA 3N3HA 1W6NB 5FWJA 3N9PA 5FWEA 2NQYA 3I3MA 1I5PA 2XL9A 5C71A 3CMGA 1DCSA 1FPN1 2VVDA 3ECQA 4YW7A 3AZVA 3WG1A 3WDYA 4JAAA 4NR1A 1J1LA 5EWSA 1E57A 3WNPA 1CAVB 1OD3A 1S0JA 3V64A 2W68A 3J7NA 1AR83 1V0AA 2VTXJ 4P5HA 2FCVA 1H6YA 2QZ3A 3IDAA 4D7TA 3J8F1 4JZRA 2GZWA 2OW4A 5FPLA 1UN1A 2PLV1 1CIYA 5FZ8A 4OI1A 2ZX1A 4RFRB 2EAKA 2C24A 5D8AB 4BWOA 5CFDA 2MPFA 4XBLA 4WZFA 2WZPP 4JVAA 5F2SA 3HMYA 1POV0 3ZLIA 5FMOL 1NXD1 2QCSB 3PNAA 5FBZA 4BIFA 1Y9MA 4KGGA 1BBT3 5J37A 1W0PA 3ORJA 4Y24A 4AEKA 1R082 4I0BA 3UK9A 1I5ZA 1VRH1 3C7GA 4FXKB 4O61A 5HCBA 1D4M3 2B45X 1W03A 3WQ0A 1XNAA 4UF0B 3QH6A 4URTA 1YFYA 2ORZA 3WEZA 2Y33A 5F32A 5FP9A 4AGGA 2ZGQA 4FT8A 3KCCA 4Q8LA 4CP9B 4OHYA 1AF9A 5HV0A 4IV1A 2LW8A 3NJYA 3WX5A 1SLLA 2H6BA 4XE9A 4CDQA 3GHMA 1FATA 5FY5A 1ND3A 1EUUA 1FAYA 1NOVA 2VL4A 1VMHA 3OBAA 2DF7A 4FOVA 5FP8A 1UPIA 5A7OA 1BYHA 4LBLA 5JAXA 4F3JA 1BK1A 1JU4A 1NXMA 1U0AA 4NHMA 5CFDC 4L92A 1MZFA 5C4WB 3O1MA 2WNEA 4NROA 2CGPA 2YYOA 1PX4A 3ZXDA 1H9PA 2X53S 3E6DA 5CKNA 4HSJA 1VMFA 4XABA 1WCDJ 2ILMA 3WW4A 4CP1A 2SLIA 5G05L 5GLZA 1QJY1 2WABA 2WZEA 2GH8A 1RUF3 1UOGA 3GCWA 1QQP1 1WD3A 3S5QA 5FV3A 4YLZA 3H9AA 5AFBA 4DUVA 3MW4A 4Y1YA 4COVA 5KXCA 4CDUB 1LGBA 1NLSA 2R061 2Y6GA 4GKYA 4IV1C 5FXZA 5K0UB 1NY71 4CDQC 1RUC3 1GZCA 3LGRA 4OUEA 2X5IC 1ND3C 5E16A 5GM0A 3KHCA 2B9UA 4EYUA 1Y9QA 4GJZA 3T2PA 3KCYA 3Q8EA 4LBKA 1WUVA 1U5ZA 2XG3A 3LAGA 5A3MA 4YVSA 3VBSB 1PIV1 3JD71 1D2SA 4LOTA 3KQ4B 1JOJA 3IAQA 4LK6A 3B3QE 3IDEA 3WQBA 1J58A 3N7MA 4R9AA 3N7KA 5ACA3 3RDIA 1OF3A 5LA0A 2BTVC 2DCZA 1M06G 3EBRA 3U4SA 3ES1A 5A32B 5BNQA 1O8PA 2WRAA 3KF5A 5IAXA 1R1A1 2WA4A 4IE7A 1W8FA 3WUDA 1UAIA 3Q8CA 4CUGA 5L7OA 3MF9A 2ZX2A 5KHKA 4Q4Y1 1UIJA 1JYWA 1PHMA 2XQXA 4YPJA 3MW3A 2D3PA 1NYWA 2Y8KA 4JTNA 1OQ1A 2HEWF 4WM7B 2JDPA 3OGGA 4UYBA 5I93A 4E2GA 1KRIA 4CUAA 3AP7A 1RUH1 2BWCA 1PM7A 1DHKB 4P9LA 2JKBA 3E1F1 1W05A 1ZM1A 4FI9A 4RA0A 3VBOB 2HLEA 2XJVA 1QOSA 1RUG3 1AYN2 2R0FA 1DZRA 1B35B 3H7YA 4OHVA 2QUOA 4YVSC 1D4M2 3CJIB 2HWC1 3OGSA 1F2NA 3MIBA 1C8NA 4PLNA 4AFDA 2BFUL 2OQ6A 2JDUA 4BLIA 1S0BA 4COYA 4PIZA 4G3YC 1PVC3 4NIDA 1CD3G 1HKDA 1K5JA 4FAGA 2GMMA 4PCRA 3AYEA 4EQVA 3VD9A 2WO2A 2VCBA 1CN1A 4IDZA 2B5HA 2AACA 2EF6A 4BE3A 4XTPA 2ZEYA 4K1YA 1MS1A 1F8VA 1ASJ2 2P4EA 3WNXA 1G9AA 1FT9A 4LUMA 3SITA 3E97A 3AP4A 1SPPB 2ET1A 1GV9A 5FTTC 2Y60A 3I3DA 1G6NA 3MIEA 4JGYB 1BMV2 4BZ4A 1X8EA 2TUNA 1RUOA 3U11A 1EP0A 1HRI3 1UZWA 4PF5A 4OVEA 3ATGA 3L2YA 2YGLA 4YYOA 2HWB1 3FLRA 4HMZA 3VZNA 3HAGA 4Y5Z0 4LBOA 3J26N 4NO4A 1XBFA 3U10A 1OHFA 2CDOA 4K8RB 5C70A 1GYKA 4INDA 2ZMLA 2ZJCA 3FWEA 3GNEA 3BKZA 1WKYA 1QJX3 2RM22 3TEXA 4C8DA 4FSJA 3ZXFA 3IT8A 1N3QA 2CY6A 2RS13 3FLPA 3B02A 4GD4A 3WXPA 1W06A 3RMXA 3S5AA 2A3YA 3A23A 4LTAA 3EJKA 4ZS2A 3ZM8A 2JE9A 3AL6A 4HLTA 2QJVA 2R6QA 4Z1VA 4N9HA 1OUSA 2DTYA 1RUI2 1SFYA 1W2NA 4ISQA 3RZHA 4FP2A 4YVWA 4M3CA 3ZMNA 5C3RA 3DYOA 1Z78A 2DFBA 5A70A 2D6OX 1I1EA 3UNPA 3N36A 1AL0G 3OGJA 5FUPA 4Y3OA 4AHYA 3KT1A 4IEWA 5FUNA 1W8WA 2WFF1 2B7YA 5FPZA 3SKVA 1WMEA 1VAKA 3MDPA 3ZN5A 2LUWA 3T30A 5FP7A 3BPZA 3PU8A 1F4HA 4YFWA 2Q8DA 4JHTA 2JICA 1SCSA 4XZPA 1A78A 2W95A 1Z7S1 1LESA 2CWMA 5JI7A 4CCLA 3U07A 1W90A 3NAPA 1W04A 3POSA 1V70A 1R093 5J96B 4RQPB 3TN92 4D69A 5JXHA 1JU3A 2JEMA 1UQXA 2EIDA 2Z69A 4Z92B 4ITCA 1G86A 4YVWC 1UPSA 2Q0AA 1JMUB 4KU8A 5LRRA 3SC7X 3UL2A 3VLBB 4BA6A 4ISRA 5IWFA 2BNNA 5DZGA 2D6MA 2VD7A 3FX3A 4XQ4A 2AEZA 1PO23 3N9OA 2G9FA 3NJZA 4AHWA 5CVRA 4LBQB 1WCQA 4Y22A 3HPNA 4KGQA 3RG0A 4OI4A 1YC61 1UZ0A 5FZ7A 4CCNA 1RUJ1 1OKOA 1NCQA 1PX3A 4OZXA 1AUYA 4OMCA 3WW3A 1S0FA 2XBO3 1YNAA 2PHFA 4KI5M 5FPBA 3VBUA 4ASLA 1W6PB 5IT6A 2Q8EA 1WCKA 2WINB 4TSVA 4E2QA 3HEIA 3NAPC 4Q0QA 2I45A 2YGMA 5EJZB 1C8M1 3AMHA 2VOVA 3N35A 5A1FA 1ENSA 1ZRRA 2YPDA 3WUCA 4BU2A 4EZ4A 4A2UA 4Q4X3 5T5OA 4GWIA 2PAEA 5EHDA 2KR2A 4PF1A 1XNCA 3CDZB 2GN7A 2FMYA 1UMZA 2D6NA 3KHBA 4J25A 4ZKTB 1LB2A 3MI8A 5A7PA 3D82A 3DL3A 4JGZB 1CESA 3THTA 4FPOB 2ZZJA 3WR0A 2WA3A 3O7OA 1ULDA 1HX6A 4GB33 3WQ1A 4Y4YA 4AFAA 1T2XA 2VBDA 4C1WA 1URXA 2JWPA 2R041 3ZFEA 1OC1A 5JI9A 2LROA 2ZHNA 1IKPA 2VZ1A 3VBUC 2AEYA 1E5IA 5IK4A 1XYPA 3AKSA 3H1MA 3IMMA 4FFGA 4PDWB 2WS93 3V65A 1OOPA 2ZX0A 4YGDA 3POYA 2R072 5CKMA 5J98B 2GU9A 4A6SA 1SDDB 2VQAA 5KHGA 1SLIA 1X82A 3OYWB 3T09A 4HK8A 3W58A 4H7MA 5FYVA 4I3GA 5DMYA 5KWRA 1VBB2 1EV11 2CSGA 1CZSA 3K77A 1UZVA 4FTSA 3JBG1 3I2FA 1D2QA 1KEXA 2PA7A 4I0WB 4GMP1 3OBTA 4K40A 2RS53 1ZBE2 3LE0A 2P6HA 3VKNA 1YQ8A 2VMIA 1QJEA 4P02B 4QDSA 2OKXA 3WDTA 4X6QB 4L0PA 3ZKYA 4AXOA 3V0AB 3WNNA 3FBYA 4RGKA 1FV3A 5G04L 1AR81 3M8LA 1UMIA 1OBNA 2VU9A 3FN9A 1AJKA 4LO5B 3T3YA 3RZGA 4QT6A 1AYM3 1OPOA 1E5HA 1F31A 3V0BB 3HQUA 4A7YA 3K4ZA 3OUIA 2W91A 1CZTA 3B9IA 4XJZA 4NPLA 3RJRA 5A3WA 5I0TA 5LY1A 2ARXA 4X6RB 2JG8A 1VAVA 2XJPA 4FQ4A 2J1SA 2VVEA 4GQ7A 5F39A 3SLIA 3O1OA 4S2HA 2DCTA 2YFZA 1BBT1 1G8WA 3HQRA 5DXDA 4JKMA 1U5YA 3PVBB 3OG2A 2VMHA 1ODNA 4XPVA 3MIDA 3R4SA 1ULFA 2IFWA 4DINB 2EAAA 5T5LA 2PMWB 1YXWA 5FO7B 5C5TA 1N3OA 1W9FA 1ZZCA 2ORXA 1AR63 4E2SA 3UJOA 4LE4A 1H2KA 4S2DA 4IEOA 5DUXA 3VHOA 3M3QA 2WYSA 1V9U2 2WAOA 5LATA 4FPHA 2VTXA 5JSOA 1CVNA 1UOJA 2JG8C 1NCRB 2P6CA 1XE0A 1VE0A 2C26A 1RXGA 2QQVA 2ARAA 2JDAA 1J84A 2RMU2 1ND2C 4HN0A 3LD8A 3OY8A 1JUHA 1S4CA 2XJSA 1ODMA 3POFA 3LZZA 4MGQA 1RUF1 3VZMA 3J9SA 4NRMA 5F6KA 1W2TA 4EN7B 3DN7A 4XQDA 4Y5TA 5CYYA 4UI9L 2RVAA 4PIYA 2VZQA 2XHKA 2C9AA 2XWJB 2YC0A 1ULCA 1UNBA 3AJZA 3RS6A 3AMNA 1RUC1 4B4RA 1OA3A 2JDKA 3AX4A 2E51A 3BODA 2EXJA 1V6MA 2ZGKA 1CONA 1HJFA 5A80A 3I2OA 4XURA 2FHRA 3U14A 1W8OA 2VOWA 4DEQA 1JYVA 3RZJA 2WN2A 3ELNA 4TLGA 4X8PA 1AL22 4KG0A 5FO8B 1AR93 3K3NA 3N9QA 1H8TC 2Y6JA 2ZAAA 5LEKA 3POBA 4OLLA 4DO0A 4HZFA 5ACA1 2V72A 4M3CF 4QPIB 2A6ZA 3AP6A 5AFEA 1W6QA 1PM4A 1AR72 1US3A 2R7EB 3NW4A 4R4ZA 4AQSA 2VBBA 2UWCA 3ZYJB 4MGZE 5LEJA 3K51A 4XMIA 5JXJA 3C8XA 3AP5A 1F15A 4GH4A 4QXHA 4QD2A 4R9BA 2WT2A 2OIIA 2HWF3 5BNNC 3DPRB 4MUVA 5FXVA 5C3OA 5FMBA 1N47A 1TMF2 5JXGA 4UFKA 1FI2A 3KMHA 4H7LA 1N1SA 3ZXGA 4N53A 4HG6B 5I0SA 1RUG1 2A6VA 3VD5A 4EJRA 5JZGA 1XE8A 3I59A 1OH4A 4BQYA 1ZZ9A 4FFHA 2OZJA 2X10A 1V6KA 2JB4A 3WNKA 5CAZA 1RUE2 2VUAA 4LMFA 1XPWA 4R4XA 5BUVA 1PVC1 3JQXA 1SEFA 4GXLA 4QDQA 3W5NA 2OT7A 4Q0VA 4B1LA 4C90A 1XE7A 3NSTA 1HJGA 1UYPA 2XMLA 4KWUA 2P3YA 2W1QA 3PTRB 4UW3A 2Q8CA 3UYJA 4L99A 4HOOA 2A70A 2IXCA 2Y6KA 3LEIA 3S30A 5LCWL 3WF2A 1JZ5A 4OCTA 2XLAA 4MO3M 5IVVA 3ILFA 4Q29A 4XUPA 3WP3A 4NHYA 4PJYA 3AK0A 3T0DA 4AQTA 1ZBA3 3NNMA 3I2JA 5FJKA 4AF9A 4N53C 1LODA 1PNFA 1W6OB 2CAVA 3SKJE 2X09A 3R4UA 4UW4A 3VDDC 5JZGC 2E33A 1HRI1 1YQ5A 4BM8A 5FCCA 1X50A 3WCRA 3WVJA 4XF1A 1MS3A 4IE4A 1Y3TA 1NLRA 5DQ0A 2XKPA 3SH3A 4CA9A 2WDBA 1QJX1 1DZTA 5I8TA 4M0NA 3WNLA 3BN6A 1ZRCA 1O59A 2VPVA 2WNUA 3D3AA 1K5MA 2RS11 5FZLA 4FFFA 3LSEA 4ONUA 5ABJA 2XWBB 5DABA 5DAXA 2UY9A 4O7XA 5HXMA 1BCXA 1S0EA 2QQMA 3ZFFC 5J7MA 3AZZA 4PI0A 2ZGUA 4MXWA 4ET7A 1VBA3 4AI9A 1WGPA 1QOOA 4XFAA 5C8CC 1VIWB 1JUIA 2FCUA 3T4HB 4AI1A 2VCCA 4D0QA 1PGSA 3KS7A 1OMIA 2WWSA 3H8OA 2E7AA 1O3QA 1TME1 4IE5A 3AFKA 4W65A 3AM2A 4GMP0 1QMJA 4NIAA 2IFRA 5FYMA 2GP3A 2VM9A 2W08A 2ZKLA 1WW6A 3BGAA 2FZ2A 4ZXKA 4N43A 3H7JA 1RMU1 1DBNA 3CZJA 1JZ3A 1Q8SA 2D6KA 5F3CA 2VZOA 2WNUC 1HQWA 2WFPA 1K5MC 2HWD2 4XAEA 4BDVB 2I07B 4YZ2A 1F5JA 5ABJC 1G9FA 5C6CA 1R091 3CZUA 2W5FA 3I49A 2D5FA 1XOYA 2Q1FA 2UYBA 2DCKA 4N9IA 2G9GA 4FPLA 4XF3A 4BXFA 3B69A 1HXS1 1QJU2 2JXAA 1J3QA 3GZUC 3ZOIA 1HB3A 1PO21 3VZJA 3OBRA 3QD6A 2WZR2 3NO8A 3BPSA 4FPEA 5FQ0B 1JZ8A 1CX4A 3PU3A 3NV3A 2QBXA 3ZIXA 5I0DA 2A5ZA 1NKGA 2ZX3A 2FDHA 1ZNPA 1W9YA 1D4VB 2XBO1 4ZU4A 2J1UA 2HYXA 1CAVA 1S2BA 2DV9A 5FKBA 1H2MA 4N43C 5L73A 4DNYA 5A6XA 3DECA 1O4ZA 3EYPA 3VD4A 2D97A 4GULA 2J1RA 5A6QA 3CNAA 3HBZA 4J1WA 4M0HA 3WLUA 1HRV3 1X33A 3C7EA 3UGGA 3GM8A 1Q8QA 3PMSA 4Q4X1 4HETA 5IVFA 4TN7A 5D8AA 4PBPA 1O91A 2AYHA 4YW1A 2FDGA 4A6OA 2ZACA 1W28A 2E7TA 1REDA 2XLGA 4BISA 1IS6A 4G9SB 4DUWA 3I7DA 4MOAA 1R083 5IW0A 1SHWB 2PHRA 2W92A 5CNAA 1AXYA 1YYNA 2BGOA 4GB31 4YFZA 1XNKA 1YO8A 5KHIA 4I09A 4MZUA 3O1VA 2VGDA 3NV1A 5FLJA 2JD9A 1GP4A 2BQPA 1JZ6A 1KFXL 1V6NA 5FP4A 1JBCA 1MZ6A 3QOPA 4UF0A 4XETA 4UT5A 3ACFA 1Q5OA 2PQQA 3K2OA 4XACA 1OLRA 1OQEA 1GR3A 3MLJA 4OUMA 1WA6X 4CP9A 2BP6A 1X8MA 2DYCA 3SCGA 4FO9A 2WS91 3W21A 4NUBA 2ZTNA 1VBE2 2R1BA 3TNPB 3PHMA 5FMDA 5HCHA 5T55A 1ZZ6A 2BERA 1FOD2 1NA1C 4XUOA 1F4AA 4JHZA 3ILNA 2DCJA 3GGLA 5C4WA 1WWYA 3KV5A 3WHTA 2JJ6A 2Y6FA 4CU8A 2RS51 2PHUA 3ZO0B 3O14A 4CP0A 3E5QA 3AC0A 4FPFA 4M00A 4RS5C 2BUKA 2IXHA 2YUEA 1CJPA 2DURA 3PIJA 4FOWA 1ALYA 2C6SA 4RSUA 4WVZA 2JIGA 3UT0A 3H0OA 4E8DA 4W8JA 2GSYA 4IE0A 1XB9A 4QAWA 4QX3A 5C9AA 1ZYBA 1QEXA 3F2ZA 1PGW2 3PL0A 1UKGA 1W8ZA 2OXBA 3MIFA 2GMEA 3M3IA 1Y7BA 2K9ZA 5K0UA 2ZAHA 4AEDB 1O3TA 5LK7B 1AYM1 1GZWB 5IAVA 1F5FA 4XDOA 1YI9A 3VBHC 3RGBA 3I54A 4DZGA 5BY5A 1L7QA 1IHMA 1R64A 4FFIA 1VAMA 1J83A 2PAMA 4WVVA 1MEC2 3ZFGB 5IVEA 1W2UA 4YM0A 1EY2A 1ZRFA 3VBSA 5FDBA 3WV6A 1GNHA 1ACCA 1JS9A 2R32A 4RR3B 2DUOA 1IS3A 3B01A 5FZIA 5BNPB 2ZOEB 1MR5A 3VL9A 2YB7A 4LORA 5KXDA 5EIYB 4LO4B 1UU5A 2HBTA 1IPKA 3NMBA 1I3HA 4JTOA 3HN1A 4IESA 1HQLA 3FBMA 2D44A 4N7UA 4QQOA 3IKWA 2YDEA 1HRV2 3T1LA 4ES8A 2AREA 5A32A 2EA7A 3LIHA 4DS0A 3GJBA 1EPWA 4UBHA 4D94A 5C9AC 3PDQA 3WDXA 1AR61 2QFEA 1CAUB 4QKNA 2CYFA 3TWIA 5HV4A 5K0UC 4WM7A 3KLSA 1CAWB 4ZS3A 1HDKA 2K2SA 1AYN3 4CE8A 5IUQA 4URAA 4GWJA 4LULA 1KQRA 4QQLA 1T6BX 2UU8A 2W1UA 3RWNA 3VBOA 2A75A 2Y0OA 1B35A 5A7WB 1CZVA 3VBSC 4DRRA 4FTEA 3RI9A 4CZSA 4R52A 3CJIA 4DPNA 4IEVA 1ZZ7A 1C57A 1MVQA 1LULA 4XUTA 3FMGA 4CXXA 4FAHA 3HR9A 4NPMA 2YHJA 2D93A 1H1AA 1UD1A 1DYOA 3AKPA 3BYWA 3WNMA 1COV2 3AYAA 4AHZA 4M01A 4QM9A 2O0OA 5A1AA 1ASJ3 4CCEA 4IGPA 4YZ4A 5EYYA 1LHNA 2A6YA 2B4KA 2L9LA 3WF0A 2ZGPA 3LFIA 2YC2A 4P5YA 4FPJA 3PVNA 5BXXA 4QKFA 5A7NA 3ZXJA 4A3XA 4S2GA 2DUPA 4JC1A 1RVF3 5FZEA 3VHPA 1Y43B 1OD5A 3DYPA 5FZDA 4EWEA 3NNJA 1UY4A 3N9LA 4JGYA 4W6XA 3VBOC 1KS4A 1XNTA 1V6JA 2DBIA 3I4IA 4IL7A 4V2WA 1B35C 1AR91 1SBDA 5JR7B 2VZPA 3CJIC 2CTVA 3T1MA 3UKTA 4A7KA 5IK7A 4Z2WA 1UF2C 1VRBA 4Q8KA 1JYIA 2RM23 4E4HA 1EAH2 1UU6A 1OXCA 1KFUL 2LS6A 5GZGA 4A7ZA 4DFSA 4AAXA 4HONA 3AKTA 2XKOA 3RYPA 3VZLA 3JUUA 3BUCA 4LO7A 3WP4A 1G9BA 3RVHA 5FYYA 1RUI3 3WOGA 4C1XA 1YLLA 1W9WA 2HWF1 4J6GA 4Y1XA 4DXTA 3RMYA 2VTFA 1LR5A 5E88A 4I02A 3W20A 1H30A 3THCA 4HBNA 3PUSA 1ENXA 4EWAA 4IEYA 4ATEA 5IVJA 5HXVA 3AZYA 4NHLA 1UKRA 4HPKB 4JGYC 3Q8FA 2FD8A 1ZRDA 2P3KA 1S0GA 4Q27A 2FDKA 3H8XA 2PHTA 3VGIA 4H3WA 1W2OA 2IC1A 4W4ZA 1DF0A 2WNVB 3ACLA 3VKFC 5A3UA 5LK5A 3IAPA 4EN9B 4WVMB 2PXJA 1RHI2 3B5LB 5A1LA 4B1MA 2LRPA 3HQXA 4WZCA 1RGSA 4AW7A 1OVSA 3ILRA 2VMCA 3U37A 3UJQA 3WT3A 4A3ZA 4DXZA 3PJYA 2JDYA 2PFWA 3Q8AA 4CTEA 5JPMB 5K4LA 3H1WA 3TN93 4XUQA 4YRDA 3BALA 4KU7A 4BPZA 4B8EA 2ADEA 3VHRA 4RQPA 3MO4A 2BBAA 2ERFA 3WDUA 4IEXA 3K4DA 1ZBA1 3OEAA 5LZ6A 1UX6A 3TEWA 2P3IA 3H3LA 5L7OC 1WCUA 2EVXA 2QVSB 2R49A 5D21A 3AVSA 4LBQA 5DAPA 4JQRA 4EE2A 1DDLA 4LA2A 1I9RA 1PK6B 1ZVFA 1NQDA 2QQKA 3POWA 5BNOB 3EB7A 2N7GA 2BYVE 5J48A 3WNOA 2XDVA 1H1IA 3AKQA 3T2TA 4AI2A 4Q1PA 1O8SA 5FY9A 1QKQA 2WLPA 1W6PA 3MICA 1RVF2 2VOTA 3LPGA 3B9CA 1VBD2 4IEZA 3C3VA 3LA3A 2X5IB 5FZOB 2HYKA 2DVDA 3WG2A 3AMQA 1POV3 4P9IA 3LWCA 4CCJA 3E5XA 1QDCA 4RQPC 3NL1A 5E89A 3T0AA 1N1YA 2B39A 2MNGA 3GZTB 2DU1A 2XL7A 3ACHA 3IZOA 1MPXA 1UY0A 3CJXA 4QB6A 2OUHA 2VO5A 1BXHA 1VBA1 1W39A 5DZEA 2PTMA 4LPLA 4K3UA 4JGZA 4QB1A 4CVUA 1GU3A 2YY1A 4AVAA 4ASKA 2ZHMA 1RYYA 2CU5A 3GBFA 2WLQA 4LR4A 1SG3A 5FK8A 2BVVA 3KVBA 4BOWA 5FO9B 4JV4A 4Q4W2 1LU2A 3GJAA 1LHOA 2R073 5LY2A 2QQWA 4P14A 4Y26A 1OPMA 4PDWA 1WW7A 3HBKA 4MGKE 4IE6A 4AL9A 4DMIA 5A3TA 1VBB3 4W6WA 5JWPA 3OYWA 5GLVA 3D6EA 2KM2A 4L97A 4ZZ8A 3C7OA 1DGRA 1GNZA 4Y20B 3TOJA 3WQ7A 3TEZA 1QU0A 1ZBE3 4MHRA 2WYFA 3LA7A 5DDJ3 5JSPA 4XJWA 3VDCA 4I01A 5E1RA 4P9JA 3M3EA 1MS8A 3BIEA 2O8QA 1VR3A 3GXUA 2YBKA 4Y33A 2DFCA 2R1DA 2PAKA 4QX7A 3MBWA 4N8MA 1RUD2 2RDSA 3GF6A 3V0AA 2EALA 3ZIWA 4KBBA 5FPVA 5LA1A 4GA9A 3ZMOA 3MIHA 5C3SA 1XU2A 3U75A 3ZYBA 3DXTA 1DU3D 2D43A 3ETQA 2FCTA 4HT1T 3VV1A 1M4WA 3ZDVA 4PDWC 4BMBA 4XIOA 1OH3A 2Y6HA 1LNSA 5ISLA 3ASIA 5FYIA 3V0BA 1S1AA 2A1XA 4A44A 5JR2A 3ZPYA 5CFCB 1LOAA 4BYYA 4LLFA 1Y9GA 3OSDA 1BQPA 2VG9A 4GIQA 1W0OA 4EN6B 1CX1A 2Z4FA 1QXRA 1R081 4HVQA 2W1SA 4DXRA 1STMA 3VL8A 3POGA 1KDKA 3FJSA 2J1VA 3AP9A 1QH7A 1SMVA 3C7FA 1UXXX 5EYXA 5L9VA 5FZFA 1T6GC 3PUIA 3MIGA 4MGYE 3IIIA 2HWE2 3HNMA 1DGWX 2OA2A 2VNRA 1IG3A 1S55A 4WV8A 1Y4WA 4MYEA 4QM8A 4DRVA 3G6JB 5FJHA 4MHUA 1BEV2 1V9U3 3OGVA 1PO12 4EWDA 4EZHA 1XXNA 1O4TA 4XAAA 1NCQC 5GZCA 2LTNA 5DUUA 4YM3A 2GN3A 2RMU3 4IERA 1UOBA 1W3XA 1NCRA 2AGSA 4GALA 2C9KA 2VW0A 5LWBA 4R8HA 3OD0A 1LKNA 2WJSA 4XFHA 3ZXLA 4BQ1A 2W46A 2WT0A 4XFFA 2VY0A 2BW8A 1RINA 2TNFA 1QOTA 4UBGA 4FPCA 3HN3A 1UYXA 3V56A 5FYBA 4Q4V2 3MPBA 1IS4A 3QBQA 5C3PA 2P5BA 3FL7A 4YW2A 3DCQA 3MEPA 2QQNA 2ZGOA 4EV0A 1GZTA 4QXKA 1ULGA 1FMD2 1L3JA 3HVDA 3FUOA 5DDJ2 4YVWB 4ZZ5A 5A33B 5I0RA 1NUKA 5DAVA 3PJQA 1SFNA 4MX3A 1AL23 4NWWA 1YUDA 4PLMA 3INAA 5FZAA 4SLIA 3AB0A 2XUEA 1CAXB 3O1TA 4NAOA 3ZFEC 2Q5TA 1MZEA 2JENA 2QE3A 3IPVB 5IYYA 1JODA 3MUZ1 1A6CA 3NKTA 1GOGA 4UAPA 3MF6A 1LHUA 5FYSA 2SBAA 1O4YA 1WLCA 3HD8B 5F3IA 4TZDA 1OOPC 1AR73 3ZR5A 5APAA 1JZ2A 4QPIA 1WLTA 3USSA 2JDHA 2GC1A 4BQ2A 4CDXB 2DWRA 4Y4RA 3ZPOA 4K1ZA 4YM1A 3PUHA 2D6LX 3D0JA 3L2HA 2J7MA 1TMF3 5A6ZA 3AXDA 2A7AA 1YRZA 3RWKX 4HL0A 3DPRA 3FUQA 3PURA 4AFBA 4BQXA 2Y38A 1AYN1 3URFA 4CEWB 1JHNA 1D4M1 1GWLA 2H0VA 3FZ3A 2XJTA 4BK5A 4XQWA 1ZA4A 5LBCA 1HB2A 1K45A 4ZU5A 1RUE3 3H3UA 4GZ9A 4P9WA 2JG9A 5I8SA 2ID4A 4UOJA 3CEWA 3BI3A 2RR12 3LDRA 4RHV2 3H50A 1VBC2 4QKBA 4UW6A 1OA2A 2GC0A 3SH4A 2MEV2 4OYUA 3EMRA 4XZUG 1CQ9A 5JIAA 3A0KA 3M3CA 3BU0A 1ASJ1 1LECA 4HSLA 3QLQA 3ZR6A 2Y64A 4CP2A 3TBDA 4CCMA 2CAUA 2OVUA 2VUCA 2Q1MA 4FQZA 3M7AA 4RL7A 5GZEA 2Z42A 2P1BA 2VUJA 3THPA 1XRUA 2VVFA 4IETA 1BMV1 1W6MB 5HI0A 2QDRA 2XVLA 1ZREA 4CUCA 3CKHA 3OPWA 3ZXKA 4PQQA 1W6OA 4RGGA 3ZDSA 1Q3EA 2XONA 3I2DA 3UESA 4ZONA 2WC2A 3GALA 4OHWA 4D6QA 1OQDA 2ZS6B 2BDRA 1QJFA 5FPUA 2RS32 2JG9C 2YU2A 2RM21 4PT6A 2O8OA 3PMEA 5JDBA 3GZAA 5LBBA 3BU7A 4W50A 4XILA 4LO8A 5LB6A 4QB2A 4XCAA 4IQPA 2E6VA 2WO3A 2YU1A 1IQDC 3D4KA 5EP9A 5CB7A 2AC1A 4K6BA 3LCPA 2G1MA 5FYUA 5FZMA 1RUI1 3WF3A 1S0CA 2Y0IA 2FZ1A 2ZZQA 4LKDA 2NYYA 2ZKNA 1EYBA 1GUIA 1SQ4A 4GKXA 2OQ7A 2QNKA 3LF7A 1PGL2 2VZ3A 3LEKA 1C3HA 4IEUA 3PUAA 3VKMA 4QHZA 1WMXA 1YFUA 5FPAA 1DFQA 3N7JA 1H4HA 2DUQA 2BV4A 4OI0A 1POQA 1GNYA 2C1FA 2JDNA 2VR4A 2XGXA 3HT2A 3MZHA 2BFUS 2HWD3 4JKKA 5JPNB 2VZVA 3WZ1A 1MQTB 1BJQA 5FUIA 3TN91 2RJLA 1JYCA 3N4MA 5FXWA 1DQ0A 3DV8A 4HANA 1KD7A 1QJU3 2UWBA 4LBJA 3WINE 1FPN2 5A3OA 1UX7A 3R0RA 4V2VA 2D6PA 1ND2B 2WZR3 2O14A 2PHXA 2AZ5A 4UFIA 3BTXA 2DBNA 2NZ9A 3SHRA 3TYJA 3TNQA 1XSRA 3O0XA 5EQUA 3LSDA 3J8F2 5FQ0A 5CG8A 1UY2A 1WMDA 1OA4A 3AL5A 4GH4C 5JOWA 4QQHA 1LAJA 5H9SA 4MGSA 1R1A3 2PLV2 3ST7A 1QNYA 4XFBA 1Q8PA 4QPGB 1TQ5A 2B8MA 1BZWA 2VXRA 3RSJA 3MYXA 5FOJB 3J4UH 1KDMA 1V6OA 3IMNA 2X05A 2PHWA 2V4AA 4YGEA 3I8TA 5IK5A 1A34A 4LNVA 2GNTA 3I3BA 1DQ5A 1VRH2 4YG0A 4HXCA 1WD4A 3FHIB 4QX8A 4DUXA 4UFMA 3RZKA 1UMHA 4XHBA 1H8TB 2NMOA 2VNOA 2NLRA 5EJ1B 1JOBA 1XYOA 4IGOA 5J09A 2ET7A 1IPSA 3O5SA 3IB3A 1NG0A 4Q0UA 1WW5A 3NRUA 3LA2A 4KWLA 4LOSA 3VBFB 4XFGA 1ZX5A 3UV9A 4AI0A 3L9JT 2V73A 4DB5A 3K46A 4TTGA 4U2AA 5AC93 5LA9A 3JQWA 4O65A 3ACGA 2H6CA 1VLNA 4KNCA 4QU1A 1AX2A 1QIQA 1VBE3 5FZ6A 1AXZA 2R071 4XIKA 4A45A 4CCCA 5BNNB 1G9DA 4N7IA 1UZYA 3UKVA 1FOD3 4OQ9A 1RUNA 2VJXA 4NHKA 4WM8A 1VBB1 3F95A 3M70A 1REFA 1QJY2 1DQ6A 1LCLA 3A4UA 1GANA 3MFAA 5GKAC 1JYXA 1QQP2 1H6XA 1OT5A 3FE5A 3JZVA 5E8AA 1ZBE1 2PHLA 1YI7A 3LOIA 1LOCA 2V5DA 3S6PA 1RXFA 1LGNA 4XDQA 4ZY9A 2QQUA 3T0BA 2E63A 2PELA 1FX5A 2NN8A 2R062 3M2MA 3RZZA 5FZ0A 1UY1A 1NY72 4O9GA 1MS0A 1PNGA 1LTEA 1NT0A 2IUWA 2XLFA 1XJAA 3CBNA 2E9QA 4QDRA 2ZEZA 4EN0A 2CV6A 2VH9A 2YZ4A 4MSVA 3O0VA 1OLME 1PIV2 3JD72 4F83A 3QACA 5HCFA 3HWJA 3RZMA 2ZHKA 1V6IA 1OUXA 4FPKA 2ZGMA 1W6NA 3OBZA 2BJSA 4AEDA 4EROA 1GZWA 5JIUA 4FPGA 4Y1UA 5KHHA 3JCIA 5I0UA 4WM8C 2DVGA 3TRSB 2Z79A 3GDBA 1MEC3 3VDDB 3ROUA 4XFCA 1XQNA 4RFT0 4WVWA 5CZKA 2MHFA 4JRAA 1OKQA 1R1A2 3ZFGA 1ULEA 5AVAA 4AFMA 4Z2AA 1HW5A 2Z5WA 4RR3A 3TB0A 2IXJA 2VQ0A 3OEBA 5BNPA 3X29B 3T08A 4Q4Y2 4QHBA 2EXHA 2TBVA 2J22A 5FLIA 4HKOA 3USUB 4Q26A 1H2NA 1GMMA 3APBA 5LBEA 2AENA 1UU4A 1N1TA 1SBEA 1RUH2 1W8HA 4ATFA 3T4VA 4J1XA 4COZA 2KA3A 1Q43A 3KVAA 5FPXA 4AK3A 4BH9A 3KT4A 2A73B 3U1XA 3LKJA 1YFXA 3ME2A 2BWAA 2HWC2 1CAUA 3ZFFB 5TSWA 1O5LA 1BVP1 1GKBA 1QXPA 3J7MA 4AEDC 4B4PA 2ZEWA 4XEZA 5GZFA 1CAWA 1V9U1 2WO7A 4QGMA 4B7EA 2XB6C 1HN0A 1XNBA 2GC3A 1JH5A 2JECA 5CIRA 5C8CB 3SCHA 3WD5A 5B4XA 2RDQA 3D5OA 1NAEA 4ZXEA 2RMU1 1GOFA 3CO2A 3GHNA 4KL1A 1LOFA 5A7WA 3ZFGC 4A41A 2QQOA 2ZMKA 3ETPA 3KV6A 4MVTA 4JX0A 5KBFA 1IS5A 4Z82A 3WW1A 4AGVA 1SCRA 1COV3 4A42A 2VZTA 2YBPA 1OI6A 4AVBA 5D2AA 5D8AC 4OI2A 4JKLA 2WBKA 5DG1A 1KJLA 4BQWA 1C8M3 1W3VA 2XXZA 3Q8BA 4LK7A 4AZZA 4D7SA 3FHAA 3HNBM 4QX2A 2D3RA 3CQOA 1FNZA 1UXZA 3LQCA 4IV3B 2HWB2 3P1IA 4HK9A 4KWKA 4LE3A 5J3UA 3U78A 3ON7A 2W52A 4AHXA 4DOUA 4L8QA 1RTVA 2WT1A 1AL21 4H55A 1AX1A 2GNMA 5I8YA 3ZN6B 5EXOA 4BXSV 4GWNA 5AC91 1DQ4A 3DKWA 1LOFC 2GMPA 2RDNA 2VW2A 1YJLA 4CDUA 4MV2A 1EAH3 3K75B 5A7SA 1YIPA 4P08A 5FR3A 2J42A 2NMNA 2ZEXA 1AR71 4B4QA 2W1WA 3ZSEA 1N3PA 5JMCA 1EPZA 2OUJA 3C2UA 1APNA 2W94A 4FP3A 2VBPA 3GYDA 3W59A 4AI3A 4E27A 2K0GA 3PVEA 5FZBA 3GZEA 2ZXQA 5C4WC 4K20A 4IEPA 4PLOA 4NHXA 5ANQA 2GP5A 1TMF1 4LEJA 2F17A 2WFF2 1GQGA 4OQ8A 3AZXA 3AYCA 3AMPA 2P2KA 3T2OA 2OX0A 2XOMA 5JOXA 4HPKA 1DYPA 1UL9A 1Z7S2 2BGCA 4C0BA 3KCXA 3NV2A 5GLWA 2VCAA 2GALA 5FYCA 4XF4A 1RHI3 2QTWB 1RUE1 1Z0HA 1BVVA 4META 2CGNA 3KV4A 4PHZA 4CDUC 2WNVA 2BPA2 1CWPA 2W2IA 4COUA 5FAXA 3OGRA 3BVCA 4WVMA 1US2A 3SNMA 5JXIA 4LJHA 1SLBA 1GWMA 3HIFA 3NKGA 2UY8A 4YWAA 4LLOA 4CSWA 2B46X 1Q8VA 4K7JA 4LUKA 4UXAA 2F6BA 4LBQD 3VBRB 4I0AA 3IIAA 4KMQA 4ASMB 5EV7A 5JUVA 4QQ2A 1NA1B 2WAAA 1E5RA 4BIOA 4Q5OA 1EUTA 1ZZBA 2ADDA 4NVPA 2XJQA 1RUJ2 5CKQA 5FOBB 5IATA 3KD4A 4MLOA 3DKQA 2VAUA 3DEMA 2JE8A 4CEYB 3KM5A 5IFTA 4W6YA 4LKEA 4RS5B 1W9TA 2HKXA 2EIBA 5FBJA 5FK7A 1L7LA 1GFF2 1X36A 1H2LA 4QKDA 5JOYA 4CDWB 3ZYFA 1DZQA 2WNVC 1PK6A 1C8M2 2HBUA 4WM7C 1SPPA 5BNOA 5GLUA 4LA3A 3BOPA 1FYUA 1VBD3 2R30A 4NJ4A 4LKSA 3RPQA 3WW2A 4CRQA 3MLLA 4F8AA 4EN8B 3POJA 3O1PA 3GCXA 2WO1A 3VBHB 3ZSKA 2ZGLA 1GOHA 2X5IA 2E53A 5FZOA 1LGCA 1CJDA 2W47A 3RJ2X 4OZOA 1NE6A 2GAUA 2YV8A 1F35A 3AFGA 2WIIB 1N1VA 3CF6E 1DYKA 3OD4A 4HVRA 1D0HA 5H9RA 1MS4A 4RGAA 5T52A 3WG4A 1SBFA 3I2IA 4XDPA 5J1XA 3QCWA 2R042 2X29A 5JMOA 1O3RA 5KC5A 3RZLA 3POIA 3ZYIB 2BNOA 5DN2A 2W9XA 4C0HA 2WWUA 4A4AA 4ZPIA 1HIXA 4WBBA 4QXBA 1JZ4A 3B94A 3MV01 4QGLA 4LBMA 4XVHA 3Q9OA 1R1ZA 2YC4A 4P9GA 5GALA 4AG4A 1FV2A 1PK6C 1A8MA 2VULA 4U36A 5FZ3A 4CXWA 5C9AB 4YW6A 5BNOC 3WY6A 4Q4W3 1G9CA 2W39A 3ALQA 3K48A 2EXKA 5K8SA 2HWD1 5FYHA 2XR4A 2JE7A 3LOBA 1EV12 2OPKA 2ZPXA 4KG8A 3JBG2 3ZSJA 1GICA 4TWTA 1GP5A 2FDJA 2IZWA 3EO6A 4HN1A 4D3WA 5K9YA 4NIGA 3MW2A 5FZGA 4ZU7A 3O1UA 1KS5A 3ZXAC 1QJU1 1VB4A 3FHQA 3WSOA 4CPBA 3RYRA 1DIWA 4Y20A 5KXEA 4NOTA 2XQRA 2WZR1 1PZ7A 3I3EA 2K46A 4IEQA 1W0NA 1AR82 4R9DA 5IHRA 1VJ2A 3WF4A 1SFPA 5T50A 4DY3A 1LEDA 1RUD3 4M4RA 4QPWA 3T2QA 3AKRA 3B7MA 2EXIA 2Y34A 3OTFA 5CFDB 2WN3A 2XH6A 1XC6A 2YROA 3MPPG 4CU9A 3DUIA 2ZGTA 2BRTA 3N9MA 3DYMA 4YG3A 3SEEA 2NM1A 3RI8A 3MHZA 1VPHA 4E8CA 3C7HA 1BBT2 4MXVA 1SLCA 1WCSA 4JDMA 5BYNA 4LHKA 2P3JA 4TLFA 3IN9A 3OF1A 4MH0E 3FFQA 1IGOA 3EHKA 1W8TA 5CFCA 1REEA 2WQ4A 3KSCA 3SXWA 1UYYA 4IV1B 2VMEA 1OFNA 3VHNA 4CDQB 5C7GA 3OUHA 4YM2A 1LRHA 2W87A 1IZ3A 1ND3B 4FVVA 1AX0A 2D40A 1C1FA 3S7EA 1YEWA 4DY5A 3OCPA 2AR6A 3ACIA 3I97A 3KT7A 2HWE3 5EJ3A 2E7QA
chains in the Genus database with same CATH topology
3CLPA 1VBE1 4JRLA 2GNDA 4KWJA 1BEV3 1PO13 2Z2SB 1FOD1 1DGWA 2X8KA 2Y26A 3H3ZA 4YNIA 4B7KA 4HFSA 2DVBA 3P3PA 1RUF2 5CFCC 3ZYPA 1H8VA 2LALA 5EFUA 3HT1A 3NV4A 1DQ1A 3TAYA 1QGLA 5KC6A 4Q0PA 1YFWA 1SDWA 4YW4A 1LENA 1RUC2 1QJZA 1PZ8A 1S0IA 4Q4V3 4BLJA 4CYDA 4YVSB 1PGW1 4QGNA 4XHXA 2ES3A 1WBLA 4AVTA 1FMD3 2YXSA 1CGPA 2V5YA 2I2SA 4QMAA 4JGZC 3R4DB 3SMHA 3KZ4C 3ZSLA 2BEOA 3S0MA 5A33A 5FFOC 3IWZA 1MEC1 1UW8A 5ACA2 2D5HA 5L7OB 1XU1A 4AQ6A 1RJ7A 2WSUA 2AUYA 1CAXA 2D3SA 1ENQA 2FBEA 2ZGRA 1AZDA 1U5XA 3IPVA 1TME3 1XYNA 2O1QA 5C8WA 1J3RA 5F6LB 4YZ3A 1H1MA 1HRV1 3PLQA 4JDOA 1QF3A 1RMU3 2BVBA 1WMFA 2IXKA 5F9TA 2ZMNA 1RUG2 1ENRA 4CDXA 1MVEA 2QZ2A 3FC0A 3SISA 1DGLA 2XUMA 3MLKA 4BCUA 1HXS3 1Q56A 2VOXA 1A8DA 4CEWA 1PVC2 1LU1A 1FXZA 2F4PA 5CADA 1GQHA 3SH5A 1Q8OA 1YWKA 4LT5A 2RR13 4P9XA 2A71A 4RHV3 1YIFA 1VBC3 3QH7A 3RRDA 2MEV3 1COV1 2EIGA 4KH9A 4C91A 2ZABA 3BCWA 3PTYA 4FCAA 4CDXC 4MGIE 1O3SA 1HRI2 2CNAA 1TNFA 3E6CC 5HBAA 4AEJA 2ZGSA 2CWSA 4Y1VA 5DUWA 1W6MA 1J59A 2R16A 5KXBA 4FTBA 3LB9A 4XXPA 3VKOA 1S0DA 4CEWC 1H4GA 2HEVF 4XW3A 4I3PA 1QJX2 2WQZC 2XJRA 4NPRA 1RIRA 3IBMA 1MZ5A 3KQRA 3VZKA 4AE2A 2RS33 1TE1B 5SV5A 5T5JA 2RS12 4XTMA 1EAH1 1DGRN 3E5UA 4DQAA 4OHXA 4M3CB 2ARBA 5GLTA 2BNMA 1QWRA 4AI8A 1LHWA 5JVVA 4B3NA 3GBGA 1YHFA 4G4FA 2A3XA 4Q1RA 4XFIA 1NCRC 1NQJA 3WG3A 3ZXEA 4AVSA 4QQPA 3WHUA 5CU1A 2P17A 1TME2 2PHDA 4GWMA 4YGBA 5FMOS 1WLWA 4YGCA 4NN0A 3NAPB 2YPJA 4COWA 1RMU2 2RJKA 1RHI1 5K7PA 1DG6A 3E6BA 3RYKA 4JCKA 1R092 2IXIA 3VUOA 2C5DA 4Z07A 3M1HA 3ZSMA 2R0HA 1J3PA 4RD7A 4KQ7A 3G7DA 1HXS2 4Z8BA 4Y22B 3AJYA 2W0XA 1MQTA 3D0SA 2A3WA 1PO22 3D8CA 1RJ8A 2JX9A 1NCQB 4I30A 1FPN3 4OFGA 4L9BA 1QY4A 3VBUB 4QPIC 2XBO2 5B2GB 1ND2A 3KB5A 2Q8OA 3J8F3 3B93A 1AXKA 3BIWE 2PLV3 5JSRA 3AZWA 2JD4A 3WDVA 2RHPA 1H9WA 1HV1A 4HKLA 3DPRC 4NWVA 2XPJA 3NVCA 1QH6A 1RVF1 4Q4X2 3IM0A 1VBD1 3ZYRA 3JB4C 3S7IA 4QPGA 1KXGA 4Q0SA 5C33A 4FXGB 2GH2A 5CBLA 4XJ9A 4JDNA 1MQTC 1C5HA 5BPXA 5F5QA 4L2NA 2C0ZA 3WCSA 1PZ9A 2ZA9A 1A3KA 1O5UA 1VRH3 1AHSA 4GB32 4LHNA 3ZFEB 1WBFA 4FPYA 1I6XA 3KGZA 4B29A 1HQNA 2WL1A 1H8TA 4QPYA 1F9KA 4FOQA 4M3CE 1OOPB 2B42B 1LHVA 5DG2A 1PVXA 2WS92 4O9EA 2NP0A 2P34A 3M3OA 3ZVXA 3VBFA 1QNWA 4Q4W1 1J1TA 2VW1A 4QPGC 5BNNA 2DU0A 3OPZA 2HEYF 2CL2A 3AMMA 4K21A 5H9PA 1GBGA 2RS52 4TYSA 2HJIA 5J36A 1QJY3 4XJAA 3EQEA 1WLDA 1U12A 3P3NA 4E4ZA 1C1LA 3H8UA 5DZFA 4AGRA 1QQP3 1D0GA 4BHPA 3O12A 4K9SA 2ETEA 4OUSA 2R063 5CG9A 1JXNA 1IQAA 3WP6A 3WDWA 5T5PA 4XBQA 5FREA 3ZN4A 1IPJA 4AFCA 4PIXA 1RUD1 5L19A 3CU7A 4X8NA 1AYM2 2A6WA 1S2KA 2OZ6A 3VBFC 4K8FA 2JG8B 4UW5A 1PIV3 3JD73 2CGOA 3NWKA 3BB6A 4P9YA 5SV8A 3JU9A 1OFSA 4E9KA 4SBVA 3PVOA 4S2FA 2BBVA 2DVAA 1GLHA 1CPNA 3VDDA 1O7FA 5LRSA 1CR7A 3VKLA 1V6LA 2UWAA 1SLAA 4N90A 2JG9B 2FQPA 2VNGA 4Q4Y3 4AQ2A 2XJUA 1AR62 1LJ7A 3IDCB 1UCXA 4AVCA 1POV1 1MS9A 1RUH3 2NPIA 1CPMA 1SACA 3USUA 1CIWA 4OULA 4AYUA 1DQ2A 1PMIA 2HWE1 4XF9A 4FBFA 4QU2A 2HWC3 1B09A 1TNRA 3OY8B 4Q2FA 1BEV1 1QHDA 3VN4A 1LEMA 4ORFA 1PO11 3ZFFA 5IK8A 1AVBA 2JDZA 5A3LA 1C28A 2ZGNA 5C8CA 5H9QA 2D7FA 1IKQA 1RB8G 1DLLA 3B00A 1RITA 2XVGA 3AXEA 1JW6A 4PBOA 4XYXA 5L36A 2H0BA 2WKKA 1LOGA 2KXLA 5T3NA 4XJ8A 4Q4V1 4YARA 2GDFA 4D7YA 3EXUA 5I91A 1HLCA 1C5IA 2V09A 2ZHLA 2HWB3 1FMD1 5DDJ1 1AR92 5FRAA 4IV3A 4YG6A 3KGLA 4XF0A 1IOAA 4FOYA 5BV6A 1W6QB 5CA6A 3UKNA 2ZCWA 4Y1ZA 1VB2A 4HVOA 3ZN6A 1JTZX 1WA4A 4PQ9A 3U0ZA 4E4DX 4GH4B 2IXLA 4XMAA 4YSFA 1GSLA 1NE4A 4E4SA 2FMDA 3DF0A 2HWF2 1H0BA 3MFCA 4LHLA 4N53B 3BOWA 1XNDA 3W9AA 5JZGB 3I59B 2OYZA 5KHJA 1LOBA 2DTWA 2PYTA 4LO6B 5D1IA 2DCYA 2GNBA 2WFF3 4IXLA 2ZX4A 2VMGA 1ZZ8A 3R05A 5GZDA 4IV3C 4AEMA 1LOEA 2ENRA 1U5IA 3GBWA 2QKDA 3FLTA 1AJOA 1Z7S3 5AVPA 4BMEA 1QDOA 2UYAA 5GJ6A 4V1PA 4XOGA 1KITA 3IDBB 3MGUA 5DUVA 3BTAA 4L11A 3OJBA 2LM3A 1YJKA 3FFZA 1BKZA 3R6SA 1NZCA 2RR11 4RHV1 2PN5A 1JN2P 1VBC1 1GZ9A 3N7LA 3CL1A 3M4FA 4XBNA 2MEV1 4YZ1A 2VECA 4HKWA 4R9CA 3SCFA 4XXAA 1ONAA 5T54A 5JCTA 1ZBA2 5JOZA 2WSVA 3VBRA 4XJUA 1NA1A 1VALA 2AH2A 1RUJ3 4RR3C 1HV0A 1SLTA 5BNPC 1OLQA 1V00A 2I74A 1TEIA 2ZBJA 4AVVA 1KJRA 2UURA 2WNUB 1YCIA 3RQ0A 1VP6A 1K5MB 1UZZA 2YMZA 4CEYA 5F1RA 5ABJB 1C4RA 4RS5A 2RS31 3ES4A 2XVKA 5EZWA 3A0NA 4CDWA 5FLHA 2TEPA 1QXJA 4I2OA 4MXWB 1UIKA 3JB8A 1FNYA 3WP5A 3H1YA 4OHZA 2Q4SA 3VBRC 1VBA2 4YW3A 2QDNA 4WM8B 3VBHA 2P37A 3O0WA 1MS5A 1G7YA 2A6XA 2IWGB 2GC2A 2Q1ZB 2D98A 2R043 4N43B 2ATFA 4F7ZA 1PGL1 3U4XA 2Q30A 1RL3A 2G4IA 4QX5A 2VOKA 3RNSA 4CEYC 4YZ5A 2RE9A 1OSGA 1RC6A 2QQPA 5JLVA 2DVFA 4ES9A 4YW5A 4CDWC 5HCAA 3ENRA 1WW4A 3AYDA 3DGTA 3ZX7A 1X7NA 1EV13 1MACA 3JBG3 4LBNA 4H14A 4AWDA 3VZOA 4GMP3 3N3HA 1W6NB 2NQYA 2XL9A 1FPN1 2VVDA 3ECQA 3WG1A 3WDYA 3AZVA 4JAAA 4NR1A 1J1LA 5EWSA 1E57A 1CAVB 1S0JA 3V64A 2W68A 1AR83 4P5HA 2QZ3A 4D7TA 3J8F1 2GZWA 2OW4A 1UN1A 2PLV1 4OI1A 2ZX1A 2EAKA 5D8AB 4BWOA 5CFDA 2MPFA 4XBLA 4WZFA 2WZPP 4JVAA 3HMYA 1POV0 5FMOL 1NXD1 2QCSB 3PNAA 5FBZA 4BIFA 4KGGA 1BBT3 5J37A 1W0PA 4Y24A 4AEKA 1R082 4I0BA 3UK9A 1I5ZA 1VRH1 4FXKB 5HCBA 1D4M3 2B45X 3WQ0A 3QH6A 4URTA 1YFYA 4AGGA 2ZGQA 4FT8A 3KCCA 4Q8LA 4OHYA 1AF9A 4IV1A 3WX5A 1SLLA 2H6BA 4XE9A 4CDQA 3GHMA 1FATA 1ND3A 1FAYA 1NOVA 2DF7A 4FOVA 1UPIA 5JAXA 1BYHA 4LBLA 4F3JA 1BK1A 1NXMA 1U0AA 4NHMA 5CFDC 4L92A 1MZFA 5C4WB 2WNEA 2CGPA 2YYOA 3ZXDA 1H9PA 2X53S 3E6DA 4HSJA 1WCDJ 2ILMA 3WW4A 4CP1A 2SLIA 5GLZA 1QJY1 2GH8A 1RUF3 1QQP1 1WD3A 5AFBA 4YLZA 3H9AA 5KXCA 3MW4A 4Y1YA 4COVA 4CDUB 1LGBA 1NLSA 2R061 4GKYA 4IV1C 5K0UB 1NY71 4CDQC 1RUC3 1GZCA 3LGRA 2X5IC 1ND3C 5E16A 5GM0A 2B9UA 1Y9QA 3KCYA 4LBKA 1WUVA 1U5ZA 2XG3A 3LAGA 5A3MA 4YVSA 3VBSB 1PIV1 3JD71 1D2SA 1JOJA 3B3QE 3IDEA 1J58A 3N7MA 4R9AA 3N7KA 5ACA3 3RDIA 2BTVC 2DCZA 1M06G 3EBRA 3ES1A 5A32B 5BNQA 1R1A1 2WA4A 3WUDA 1UAIA 5L7OA 3MF9A 2ZX2A 5KHKA 4Q4Y1 1UIJA 1PHMA 3MW3A 2D3PA 1NYWA 4JTNA 4WM7B 1OQ1A 2HEWF 3OGGA 5I93A 4E2GA 1KRIA 3AP7A 1RUH1 2BWCA 1PM7A 1DHKB 4P9LA 2JKBA 4RA0A 1ZM1A 3VBOB 2XJVA 1QOSA 1RUG3 1AYN2 2R0FA 1DZRA 1B35B 3H7YA 4OHVA 2QUOA 4YVSC 1D4M2 3CJIB 2HWC1 1F2NA 3MIBA 1C8NA 4PLNA 4AFDA 2BFUL 4BLIA 1S0BA 4COYA 4PIZA 4G3YC 1PVC3 1CD3G 1HKDA 4FAGA 2GMMA 4PCRA 3AYEA 1CN1A 2B5HA 2EF6A 4BE3A 4XTPA 4K1YA 1MS1A 1F8VA 1ASJ2 1G9AA 1FT9A 4LUMA 3SITA 3E97A 3AP4A 2ET1A 1GV9A 5FTTC 1G6NA 3MIEA 4JGYB 1BMV2 4BZ4A 1X8EA 2TUNA 1RUOA 3U11A 1EP0A 1HRI3 4PF5A 4OVEA 3ATGA 3L2YA 2YGLA 4YYOA 2HWB1 3FLRA 4HMZA 3VZNA 3HAGA 4Y5Z0 4LBOA 3J26N 4NO4A 3U10A 1OHFA 1GYKA 4INDA 2ZMLA 2ZJCA 3FWEA 3GNEA 1QJX3 2RM22 4FSJA 3ZXFA 3IT8A 1N3QA 2CY6A 2RS13 3FLPA 3B02A 3WXPA 3RMXA 2A3YA 4LTAA 3EJKA 2JE9A 4HLTA 2QJVA 2R6QA 4Z1VA 4N9HA 2DTYA 1RUI2 1SFYA 4ISQA 4FP2A 4YVWA 4M3CA 3ZMNA 1Z78A 2DFBA 2D6OX 1I1EA 3N36A 1AL0G 3OGJA 4AHYA 3KT1A 4IEWA 2WFF1 2B7YA 5FPZA 1WMEA 1VAKA 3MDPA 3ZN5A 2LUWA 3BPZA 4YFWA 2JICA 1SCSA 4XZPA 1A78A 1Z7S1 1LESA 2CWMA 5JI7A 3U07A 3NAPA 3POSA 1V70A 1R093 5J96B 4RQPB 3TN92 4D69A 2JEMA 2Z69A 4Z92B 4ITCA 1G86A 4YVWC 1UPSA 2Q0AA 4KU8A 5LRRA 3UL2A 3VLBB 4BA6A 4ISRA 2BNNA 5DZGA 2D6MA 4XQ4A 3FX3A 1PO23 3NJZA 2G9FA 4AHWA 5CVRA 4LBQB 4Y22A 4KGQA 3RG0A 4OI4A 1RUJ1 1NCQA 4OZXA 1AUYA 3WW3A 2XBO3 1S0FA 1YNAA 2PHFA 3VBUA 4ASLA 1W6PB 5IT6A 1WCKA 2WINB 4TSVA 4E2QA 3NAPC 4Q0QA 2I45A 2YGMA 1C8M1 3AMHA 2VOVA 3N35A 1ENSA 1ZRRA 3WUCA 4A2UA 4Q4X3 5T5OA 2PAEA 1XNCA 2GN7A 2FMYA 1UMZA 2D6NA 4ZKTB 1LB2A 3MI8A 3WR0A 3D82A 3DL3A 4JGZB 1CESA 3THTA 4FPOB 2ZZJA 2WA3A 3O7OA 1ULDA 1HX6A 4GB33 3WQ1A 4Y4YA 4AFAA 4C1WA 1URXA 2R041 3ZFEA 5JI9A 2ZHNA 1IKPA 3VBUC 5IK4A 1XYPA 3AKSA 3H1MA 4PDWB 2WS93 3V65A 1OOPA 2ZX0A 4YGDA 3POYA 2R072 5J98B 5KHGA 2GU9A 2VQAA 1SLIA 1X82A 3OYWB 3W58A 4HK8A 4H7MA 4I3GA 5KWRA 1VBB2 1EV11 4FTSA 3JBG1 1D2QA 2PA7A 4I0WB 4GMP1 3OBTA 4K40A 2RS53 1ZBE2 3VKNA 2VMIA 3WDTA 4X6QB 4AXOA 3V0AB 3FBYA 1FV3A 1AR81 3M8LA 2VU9A 4LO5B 1AJKA 4QT6A 1AYM3 1OPOA 1F31A 3V0BB 4A7YA 3B9IA 4XJZA 3RJRA 5I0TA 2ARXA 4X6RB 2JG8A 1VAVA 2XJPA 4FQ4A 2VVEA 4GQ7A 3SLIA 4S2HA 2DCTA 1BBT1 1G8WA 5DXDA 1U5YA 3PVBB 2VMHA 4XPVA 3MIDA 3R4SA 1ULFA 2IFWA 4DINB 2EAAA 5T5LA 5FO7B 1YXWA 1N3OA 1ZZCA 1AR63 4E2SA 3UJOA 4LE4A 1H2KA 4S2DA 4IEOA 5DUXA 3VHOA 3M3QA 1V9U2 4FPHA 5JSOA 1CVNA 2JG8C 1NCRB 2RMU2 4HN0A 1ND2C 3OY8A 1JUHA 2XJSA 3LZZA 1RUF1 3VZMA 3J9SA 5F6KA 4EN7B 3DN7A 4XQDA 4PIYA 2XHKA 2C9AA 2XWJB 2YC0A 1ULCA 3AJZA 4B4RA 3RS6A 3AMNA 1RUC1 1OA3A 3AX4A 2E51A 3BODA 2EXJA 1V6MA 2ZGKA 1CONA 2FHRA 2VOWA 3ELNA 4X8PA 1AL22 4KG0A 5FO8B 1AR93 1H8TC 2ZAAA 5LEKA 4OLLA 4HZFA 5ACA1 4M3CF 4QPIB 2A6ZA 3AP6A 5AFEA 1W6QA 1AR72 3NW4A 4R4ZA 4AQSA 5LEJA 2UWCA 3ZYJB 4MGZE 3K51A 4XMIA 4R9BA 3AP5A 4GH4A 4QD2A 2WT2A 2OIIA 2HWF3 5BNNC 3DPRB 4MUVA 1N47A 1TMF2 1FI2A 3KMHA 4H7LA 1N1SA 3ZXGA 4N53A 5I0SA 1RUG1 2A6VA 4EJRA 5JZGA 1XE8A 3I59A 1ZZ9A 2OZJA 1V6KA 5CAZA 1RUE2 2VUAA 4R4XA 5BUVA 1PVC1 3JQXA 1SEFA 4GXLA 4Q0VA 4C90A 1XE7A 3NSTA 4UW3A 4L99A 2A70A 2IXCA 3S30A 2XLAA 3ILFA 4Q29A 3WP3A 4PJYA 3AK0A 4AQTA 1ZBA3 4AF9A 4N53C 1LODA 1PNFA 1W6OB 2CAVA 3R4UA 4UW4A 3VDDC 5JZGC 1HRI1 4BM8A 5FCCA 1X50A 3WCRA 3WVJA 4XF1A 1MS3A 1Y3TA 1NLRA 2XKPA 3SH3A 1QJX1 1DZTA 5I8TA 4M0NA 1ZRCA 2VPVA 2WNUA 1K5MA 2RS11 4ONUA 3LSEA 5ABJA 2XWBB 2UY9A 1BCXA 1S0EA 3ZFFC 5J7MA 3AZZA 2ZGUA 4MXWA 1VBA3 1WGPA 1QOOA 4XFAA 5C8CC 1VIWB 1JUIA 4AI1A 1PGSA 3KS7A 1OMIA 2WWSA 2E7AA 1O3QA 1TME1 3AFKA 4W65A 3AM2A 4GMP0 1QMJA 2IFRA 2W08A 2ZKLA 1WW6A 2FZ2A 4ZXKA 4N43A 3H7JA 1RMU1 1DBNA 1Q8SA 2D6KA 2WNUC 1HQWA 2WFPA 1K5MC 2HWD2 2I07B 4YZ2A 1F5JA 5ABJC 1G9FA 5C6CA 1R091 2D5FA 2UYBA 2DCKA 4N9IA 2G9GA 4FPLA 4XF3A 3B69A 1HXS1 1QJU2 2JXAA 1J3QA 3GZUC 1PO21 3VZJA 3OBRA 3QD6A 2WZR2 3NO8A 5FQ0B 4FPEA 1CX4A 3NV3A 3ZIXA 2A5ZA 2ZX3A 1ZNPA 1D4VB 2XBO1 4ZU4A 1CAVA 1S2BA 2DV9A 1H2MA 4N43C 5L73A 4DNYA 1O4ZA 2D97A 4GULA 3CNAA 3HBZA 4J1WA 4M0HA 3WLUA 1HRV3 1X33A 1Q8QA 3PMSA 4Q4X1 4HETA 5D8AA 4PBPA 1O91A 2AYHA 4YW1A 2ZACA 2E7TA 1REDA 2XLGA 1IS6A 4G9SB 3I7DA 1R083 2PHRA 5CNAA 1AXYA 1YYNA 4GB31 4YFZA 1XNKA 1YO8A 5KHIA 4I09A 4MZUA 2VGDA 3NV1A 5FLJA 2BQPA 1KFXL 1V6NA 1JBCA 1MZ6A 3QOPA 4XETA 1Q5OA 2PQQA 1OLRA 1OQEA 1GR3A 3MLJA 4OUMA 4ES8A 5AC92 2DYCA 1X8MA 3SCGA 4FO9A 2WS91 2ZTNA 1VBE2 2R1BA 3TNPB 3PHMA 5T55A 1ZZ6A 1FOD2 1NA1C 3ILNA 2DCJA 5C4WA 3WHTA 2JJ6A 2RS51 2PHUA 3ZO0B 3O14A 4CP0A 3E5QA 4FPFA 4M00A 4RS5C 2BUKA 2IXHA 2YUEA 1CJPA 2DURA 4RSUA 4FOWA 1ALYA 4WVZA 3H0OA 2GSYA 5C9AA 1ZYBA 1PGW2 1UKGA 3MIFA 2GMEA 3M3IA 1Y7BA 2K9ZA 5K0UA 2ZAHA 4AEDB 1O3TA 5LK7B 1AYM1 1GZWB 1F5FA 1YI9A 3VBHC 5BY5A 3I54A 4DZGA 1IHMA 1VAMA 2PAMA 4WVVA 1MEC2 3ZFGB 1ZRFA 1W2UA 4YM0A 1EY2A 3VBSA 5FDBA 3WV6A 1GNHA 4RR3B 2R32A 2DUOA 1IS3A 3B01A 5BNPB 2ZOEB 1MR5A 3VL9A 5KXDA 4LO4B 1UU5A 1IPKA 1I3HA 4JTOA 3HN1A 4IESA 1HQLA 3FBMA 2D44A 4N7UA 4QQOA 3IKWA 2YDEA 1HRV2 3T1LA 5A32A 2AREA 2EA7A 4DS0A 4UBHA 1EPWA 4D94A 5C9AC 3WDXA 1AR61 2QFEA 1CAUB 2CYFA 3TWIA 5K0UC 4WM7A 3KLSA 1CAWB 1HDKA 2K2SA 1AYN3 5IUQA 4LULA 1KQRA 4QQLA 2UU8A 3RWNA 3VBOA 2A75A 2Y0OA 1B35A 3VBSC 4DRRA 4FTEA 3RI9A 4CZSA 4R52A 3CJIA 4DPNA 4IEVA 1ZZ7A 1C57A 1MVQA 1LULA 3FMGA 4FAHA 3HR9A 2YHJA 2D93A 1H1AA 1UD1A 3AKPA 1COV2 3AYAA 4AHZA 4M01A 4QM9A 2O0OA 1ASJ3 4YZ4A 5EYYA 1LHNA 2A6YA 2ZGPA 4FPJA 3PVNA 5BXXA 3ZXJA 4A3XA 4S2GA 2DUPA 4JC1A 1RVF3 3VHPA 1Y43B 1OD5A 4EWEA 4JGYA 4W6XA 3VBOC 1KS4A 1V6JA 3I4IA 4IL7A 5JR7B 1B35C 1AR91 1SBDA 3CJIC 2CTVA 3T1MA 3UKTA 4A7KA 5IK7A 4Z2WA 1UF2C 4Q8KA 1JYIA 2RM23 1EAH2 1UU6A 1KFUL 5GZGA 4A7ZA 4DFSA 3AKTA 2XKOA 3RYPA 3VZLA 3JUUA 4LO7A 3WP4A 1G9BA 1RUI3 3WOGA 4C1XA 1YLLA 2HWF1 4J6GA 4Y1XA 3RMYA 1LR5A 5E88A 4I02A 1H30A 4HBNA 1ENXA 4EWAA 4IEYA 4ATEA 5HXVA 3AZYA 4NHLA 1UKRA 4HPKB 4JGYC 1ZRDA 2P3KA 1S0GA 4Q27A 2PHTA 3VGIA 4H3WA 2IC1A 1DF0A 2WNVB 3ACLA 3VKFC 5LK5A 4EN9B 4WVMB 1RHI2 3B5LB 3HQXA 4WZCA 1RGSA 4AW7A 3ILRA 4DXZA 3UJQA 3WT3A 3PJYA 2PFWA 4CTEA 5JPMB 3H1WA 3TN93 4YRDA 3BALA 4KU7A 4BPZA 4B8EA 3VHRA 4RQPA 2ERFA 3WDUA 4IEXA 1ZBA1 1UX6A 2P3IA 5L7OC 2QVSB 2EVXA 2R49A 4LBQA 4JQRA 1DDLA 4LA2A 1I9RA 1PK6B 1ZVFA 1NQDA 3POWA 5BNOB 2N7GA 2BYVE 5J48A 1H1IA 3AKQA 3T2TA 4AI2A 4Q1PA 1QKQA 2WLPA 1W6PA 3MICA 1RVF2 3B9CA 1VBD2 4IEZA 3C3VA 3LA3A 2X5IB 2HYKA 2DVDA 3WG2A 3AMQA 1POV3 4P9IA 3LWCA 3E5XA 1QDCA 4RQPC 3NL1A 5E89A 1N1YA 2B39A 2MNGA 3GZTB 2DU1A 2XL7A 3CJXA 2OUHA 1BXHA 1VBA1 1W39A 5DZEA 2PTMA 4K3UA 4JGZA 2YY1A 4AVAA 2ZHMA 3GBFA 2WLQA 4LR4A 2BVVA 4BOWA 5FO9B 4JV4A 4Q4W2 1LU2A 1LHOA 2R073 4P14A 4Y26A 1OPMA 4PDWA 1WW7A 4MGKE 4DMIA 1VBB3 4W6WA 5JWPA 3OYWA 5GLVA 3D6EA 2KM2A 4L97A 1DGRA 1GNZA 4Y20B 3TOJA 3WQ7A 1QU0A 1ZBE3 5DDJ3 3LA7A 5JSPA 4XJWA 4I01A 5E1RA 4P9JA 3M3EA 1MS8A 2O8QA 1VR3A 2DFCA 2R1DA 2PAKA 1RUD2 3GF6A 3V0AA 2EALA 3ZIWA 4KBBA 4GA9A 3ZMOA 3MIHA 1XU2A 1DU3D 2D43A 3ETQA 4HT1T 3VV1A 1M4WA 4PDWC 4BMBA 4XIOA 3ASIA 3V0BA 1S1AA 3ZPYA 5CFCB 1LOAA 4BYYA 4LLFA 1BQPA 2VG9A 4GIQA 1W0OA 4EN6B 1QXRA 1R081 4HVQA 3VL8A 1KDKA 3FJSA 3AP9A 1QH7A 1SMVA 5EYXA 1T6GC 3MIGA 4MGYE 2HWE2 1DGWX 2OA2A 2VNRA 4WV8A 1S55A 4MYEA 4QM8A 4DRVA 3G6JB 1BEV2 1V9U3 1PO12 4EWDA 1XXNA 1O4TA 1NCQC 5GZCA 2LTNA 5DUUA 4YM3A 2GN3A 2RMU3 4IERA 1NCRA 2AGSA 4GALA 2VW0A 4R8HA 3OD0A 1LKNA 2WJSA 4XFHA 3ZXLA 4BQ1A 4XFFA