5LBCA

Hif prolyl hydroxylase 2 (phd2/egln1) i280v/r281l/i292v variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/fg2216)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
222
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLVLHCNGKLGSYKVNGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLVRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 222
sequence length 227
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbcA00
4JZRA 2FCUA 3OUJA 4NHMA 2RG4A 2RDSA 3GJBA 5DAVA 2RDQA 4XCAA 4BQXA 5LA9A 2JIGA 5C5UA 2FCVA 5LB6A 2RDNA 5LBBA 3KT7A 2A1XA 4J25A 4NHLA 2G1MA 3KT4A 2HBTA 4NHYA 5DAPA 3OBZA 5DAWA 5LBFA 3MGUA 5LASA 3EMRA 2Y33A 3DKQA 4Q5OA 5DAXA 4MHRA 3NNLA 3GZEA 5LBCA 3PL0A 5L9RA 5EQUA 5ERLA 5IAXA 5M0TA 4XACA 5LATA 5EP9A 4XC9A 5IATA 2OPWA 4ZONA 2FCTA 4BQYA 4NHKA 3NNMA 4UWDA 4Y5TA 3HQUA 2V4AA 4BQWA 3BVCA 3OUHA 4IW3A 4NHXA 5C5TA 5HV0A 4XAAA 3ITQA 3GJAA 3NNFA 4NMIA 4XABA 2RDRA 3W21A 2G19A 3W20A 5LBEA 3HQRA 4MHUA 2HBUA 5L9BA 2Y34A 5DAQA 5HV4A 5EPAA 4KBZA 4XCBA 5L9VA 2JIJA 4Y5SA 3KT1A 3NNJA 3OUIA 4ZPIA 4NAOA 5A3UA 5IAVA
chains in the Genus database with same CATH superfamily
2QQPA 5FPLA 4B4RA 1V9U1 2NMNA 5CYYA 3HAGA 1HXS2 3I3EA 4YW3A 3L2YA 4XDQA 1VBA3 5CKMA 4Y33A 5A3LA 1CIYA 2EVXA 2P37A 1FPN3 4U36A 1AR72 4FOVA 5JOXA 1SLBA 1NUKA 3POIA 1EAH1 3T2QA 3KD4A 5B4XA 5F6LB 5FZFA 3NKTA 4MGTA 1RUH3 1VBD1 2VBDA 3WP4A 2XLAA 2P2KA 3HPNA 2DVGA 4AGVA 1NOVA 1W3VA 1A8DA 2A1XA 2D6MA 2J7MA 3K4ZA 3VBOC 2PHDA 1UYXA 2BTVC 2WL1A 3KVAA 3WQ1A 4A42A 2YXSA 2Q8EA 1R083 1W3XA 3AVRA 2JG9C 3FL7A 3IDAA 4Y24A 1NLQA 2VQTA 4GWMA 4WM7A 4KNCA 3SQOA 4UFMA 2VU9A 4L97A 3H8OA 2GMEA 3AZZA 3QACA 1WMXA 1JXNA 1ONAA 1OQ1A 4GB31 4DY5A 4AR2A 1QDOA 4RQPC 2GC1A 1PGSA 3W5NA 3H3LA 2R043 3IMMA 5FWJA 2XJSA 2W2IA 1J3RA 2XJTA 3KS7A 5I91A 5FCCA 3NNLA 2B46X 5DDJ1 4FQZA 3MIEA 1AYM2 3T0AA 4HXCA 4XYXA 2XVLA 3ZFGC 3AMHA 5EQUA 4E2SA 4Q8KA 4FXKB 1UY4A 1Z7S1 2ZGNA 1ULCA 1Z78A 1VRBA 3TNPB 5IVFA 3RZGA 4ASKA 2WAAA 2BNOA 4LK6A 4RA0A 5LA0A 1AR82 1X36A 1LOEA 2I2SA 2J1VA 2PFWA 3J9SA 4PI2A 5FY9A 4AI3A 1MQTC 4Q4X1 3PUAA 1W90A 3T30A 5A6ZA 4CRQA 1CR7A 3CF6E 4MZUA 1RUC2 4XJAA 1CAXA 5JMCA 2WN3A 1QXRA 1RL3A 2JG9A 3OF1A 4P5YA 4I30A 2R063 4YM1A 2VNRA 4YG3A 3ZXGA 2LUWA 3OD0A 4U2AA 3THDA 2EXKA 3LSDA 4YVSB 2V73A 1OOPB 1QJU1 2VCCA 2QQWA 2ZBJA 5F8PA 4CUAA 1UZWA 3OGJA 4N9HA 4IV3A 5FY8A 5HCHA 3E1F1 4XE9A 1H2NA 5H9SA 4B29A 4UFLA 4OFGA 3LA2A 1OKQA 3VBRC 1AL23 2C4XA 2XB6C 4W65A 3U78A 1SBDA 4WZCA 3WG2A 5ISLA 2VOXA 2DWRA 1VBE1 2Y6LA 3B7MA 4UF0A 3WOGA 3ZXJA 2WO7A 5F3IA 1TMF2 4R52A 4RFRB 3ACGA 3VD4A 1QJY1 1RXFA 2BGPA 1V6NA 2XWBB 1HKDA 1F15A 2Y34A 2R6QA 1FOD3 3AZYA 3IAQA 3U37A 4RR3C 3I59B 3V56A 5KXEA 2OYZA 3EBRA 5EZWA 3ZLIA 1QQP3 3RRDA 4KBZA 3W58A 3IPVB 1TVGA 3MF9A 3K2OA 1YQ2A 1MQTA 3THTA 2XWJB 5A7PA 3MF6A 3T08A 2ORZA 1J1LA 2AUYA 3OEAA 1C28A 5EHDA 1RUI1 3CMGA 2CV6A 4XUNA 4YYOA 4CVUA 1O3SA 1YO8A 4BK4A 5AVPA 3ALQA 2BDRA 2ARAA 3MPBA 4OVEA 1MACA 5DAVA 3THPA 4IEWA 1LOGA 4IE5A 4XUPA 1D2SA 3DV8A 4LE4A 4QU1A 1AR71 5DPNA 3NAPA 5HCAA 3RI9A 3VBRA 1GSLA 2D98A 2GNTA 3AMQA 2LW8A 1W8TA 3IDCB 5ACA3 2D3PA 1CAVA 2WNVC 4XF4A 4LO7A 3ZXKA 4DS0A 3QCWA 2SLIA 2VXRA 2A3XA 3LCPA 1CJDA 2WFPA 3U75A 2RR11 3VBFB 2JWPA 2ZAHA 1J1TA 1HN0A 4XJ9A 1PO12 2VUCA 1F4AA 4RR3A 1JZ3A 1MS4A 4WVZA 2D3RA 3MIBA 4EN7B 3NVCA 4J6GA 1JYNA 1O5LA 3POWA 5IK8A 1W2TA 2Z4FA 4LHLA 2EA7A 1POV3 5F3CA 1GYKA 2DUQA 3ACIA 5DAXA 2D6NA 2IC1A 5JI7A 1DQ2A 5CAZA 3RZLA 3ILNA 3VHOA 5GZDA 2YY1A 4XVHA 5LBCA 4X8NA 1ENSA 2O14A 3SCFA 3WW4A 1FV3A 4CPBD 1ULPA 1UL9A 1UPIA 1AYM1 1YEWA 1UWWA 1A8MA 1OFSA 3A7QA 3ORJA 4L99A 2QTWB 1S2BA 4GH4A 4KI5M 4CCCA 5F2WA 4WVMA 4JDNA 1MS0A 2B9VA 1Q8OA 1ULGA 2JE9A 4XC9A 4F3JA 5FXXA 2Q5TA 1AX0A 2CAUA 1AR81 1RVF3 2EALA 2P17A 3OGVA 4NE9A 3POJA 1UYZA 4DEVA 4INDA 1LRHA 2XJPA 2XMLA 4A4AA 1R64A 4E4ZA 3VUOA 1OVSA 4PDWB 4CP0A 5C4WC 1DGLA 1XQNA 2QCSB 3OCPA 2WNUB 3KB5A 1REDA 4BLIA 1WZXA 2NZ9A 2ZX0A 2QQUA 5J96B 3T0DA 1PVC2 1R093 2DBIA 2DVFA 2ZZQA 3BVCA 3H50A 3J8F3 4QQPA 1YLLA 2P1BA 5JSOA 5FO9B 2JB8A 3ST7A 3V0AB 4LHSA 3FHIB 2RV9A 1YFWA 4CDUA 1YI7A 3ZIXA 3H7JA 3T1LA 2HWF2 1QIQA 4UBGA 3WCRA 2RM23 5E6HA 1ULOA 3KHBA 2OX0A 1O3QA 3NQHA 4CCEA 4OHWA 3SKJE 2XVGA 4D3WA 5JOZA 1IS5A 1MZEA 1AYN2 2OZJA 4ISRA 1W6QA 1COV2 3WDUA 1DQ5A 5KXBA 1TMF1 1QMJA 1PGW1 2QKDA 1IGOA 2W3JA 4LKDA 3UT0A 2HWD3 4NIHA 1OI6A 1N3PA 3BYWA 4IERA 4G4FA 3LDKA 3LGRA 2VZRA 5F39A 1UPSA 4DXTA 3NNJA 4GAZA 4K1YA 3ZM8A 5A7OA 4ATEA 4PBPA 3MO4A 1MEC3 2JE8A 4LOTA 2XUMA 2EICA 4LBLA 5GJ6A 3NO8A 3M3OA 1MS1A 5L7OC 3EXUA 1UO9A 3ZFFB 5FBZA 1IZ3A 2VZQA 4CCNA 1OXCA 3NWKA 3CEWA 2RS33 5JWPA 2JDMA 4D6RA 2UURA 3HMYA 3KVBA 4LBQD 4AQ2A 5EYYA 1SDDB 1W99A 1BK0A 3BKZA 2RMU3 5I93A 1JZ4A 1ULFA 1ZBE3 5I0UA 4AVBA 4YGDA 4IE6A 2HLEA 1DU3D 1QOOA 1G8WA 4E8DA 4GD4A 4G9SB 2XHKA 4XFHA 1SZBA 2P3KA 4KWKA 1IPSA 4MSVA 3AP9A 4YM3A 1SLTA 4WM7B 4NIAA 4FPGA 4Q27A 5FYVA 3JD72 4IETA 3QOPA 4N90A 1O8SA 4M3CB 2ZHLA 5A33A 1SFNA 4B3NA 2ZX2A 4IEOA 2XJVA 4XF3A 1TNFA 2W68A 5HCBA 4FO9A 4QQHA 4OHZA 4BM8A 3N3HA 1RMU3 1ZRIA 4AEJA 4XJZA 1H4GA 4XFCA 2YV8A 1LB2A 1X7NA 2VULA 2CNAA 4LT5A 1RUD1 5IAXA 3JXSA 4QPIC 4N43C 3J26N 5M0TA 3BIEA 3FHAA 3CZUA 4K20A 3IDBB 4B4QA 4PT6A 4XACA 1JZ5A 4MLOA 3W9AA 3RZJA 4FQ4A 4HT1T 1UMIA 5LY2A 4C0BA 4H7MA 4G3YC 2OUJA 4M01A 2ZZJA 4JRLA 4LJHA 3OG2A 3SLIA 5FTTC 1UX7A 2GAUA 3VBOB 2VOVA 3AP7A 4NO4A 4UWDA 1VBB3 5A3TA 1W8HA 3O14A 4D6SA 4CP2A 3I2FA 4NWVA 1FATA 2PHXA 3P3NA 5J7MA 1QJEA 1SPPB 2W1SA 4FFHA 2HWC3 5FZAA 3A0KA 1OBNA 3SNMA 3SC7X 4IW3A 5L73A 4FXGB 1PVC1 2WZR3 4R4XA 3O0WA 4RQPB 1W0OA 2ETEA 2GN7A 5FYBA 4MGKE 2VMGA 1UU6A 3CJIA 4BA6A 4NMIA 1VB2A 2C24A 3N7MA 1LGBA 1JU4A 4JV4A 4FPLA 5FPXA 2D97A 1GICA 1QEXA 2HWF1 2O1QA 2UU8A 2VAUA 4O7XA 3HBZA 3W20A 4GA9A 4AYUA 4E2GA 2EXHA 5BNOA 3VZKA 1UY1A 3WW2A 3EHKA 4J1WA 2FHRA 4NN0A 4XFBA 3ZFGB 5EV7A 3GZTB 3AKTA 2J1AA 1AYN1 2IXCA 3H3ZA 4N43A 4YM2A 3I49A 1DGWA 3ECQA 1RUG2 3ASIA 3URFA 5CVRA 4JVAA 1W8OA 5F5CA 5KBFA 2WINB 2DF7A 2PQQA 4FOWA 3C2UA 3I97A 1XNBA 2ES3A 1CJPA 4BK5A 2BOJA 1MR5A 3WG3A 4QKBA 3PUIA 3NNGA 1WLWA 3DKWA 2WO2A 1EV11 2WLPA 3Q8BA 5FZLA 2VW2A 3D3AA 3JQWA 4LBNA 2Y6FA 4RGGA 3VBHB 3N9NA 3AYEA 3I3DA 3I3BA 3MYXA 5CKQA 5GALA 3VHNA 3VKNA 1HRV2 5H9RA 2WZEA 1I5ZA 1VPHA 4WV8A 1I6XA 1FI2A 4LUMA 1JHNA 4N53C 4QD2A 4Z2AA 1PGL2 3DPRC 3C7EA 4IGOA 2HEVF 4QPGA 2Q0AA 2FMDA 3JBG2 1D0HA 4QM9A 5FP7A 2W87A 1IS4A 5JR7B 1IS3A 3KCYA 4FPYA 2HBTA 1V9U3 1F4HA 4H2AA 4N7UA 5FY5A 5FOBB 5C3RA 1RYYA 2VH9A 3FLRA 1O91A 2X5IC 4KWUA 5JSPA 1HDKA 1RHI2 3JD71 5BNNB 1DQ1A 1K42A 4M4PA 4EN9B 4AWDA 5F5IA 1VMHA 4FTSA 3G6JB 4JHZA 4BIFA 4COWA 5AFEA 1EAH3 1B35C 1NQJA 5L36A 1OUSA 1VBD3 5DABA 4CCMA 2R0HA 4YW5A 3NJYA 1OD3A 3CU7A 1US3A 4EN8B 3PVNA 2W52A 2D40A 5T5JA 4B8EA 1BZWA 1RUJ2 1V6LA 1L3JA 4A45A 2F4LA 1DYPA 5C8CC 2BPA2 4NJ4A 5CFCB 3HT2A 5AFBA 4MYEA 3D4KA 2BBVA 4E2QA 4GB33 2X09A 3HNMA 2ZMKA 1EY2A 2KM2A 3MLLA 1JTZX 1OOPC 1VRH1 2QQLA 2Q1ZB 4LO6B 3PLQA 3TN93 2MNGA 3ZSMA 1KEXA 1IKPA 2XLGA 3KCCA 3NSTA 4XBNA 1PNGA 1W9WA 1EUUA 4OZOA 4HK9A 4NHKA 4Q1RA 3H9AA 4FOYA 5AVAA 1G7YA 3MFAA 2WNVB 2W91A 5BV6A 3QH6A 1J3QA 1W2OA 4IDZA 2VCBA 4XF1A 5DDJ3 3WNPA 1SDWA 1ASJ2 1F2NA 4AK3A 3IBMA 4DOUA 5J48A 2BUKA 3JU9A 4L0PA 5EWSA 1HLCA 1Z7S3 3JCIA 4OLLA 2B7YA 3RWNA 1WGPA 5HXVA 4EE2A 4EWAA 3EQEA 4ARXA 3D0JA 4ZZ8A 2OXBA 2VGDA 1OPMA 1F9KA 2D7FA 4S2HA 3LDBA 1K5MC 5I0DA 4CZSA 2CTVA 2EF6A 2ZEZA 3ZO0B 1FNYA 4Q4X3 3USSA 3ZIWA 4E9KA 5HBAA 4W6YA 1DYOA 5IK4A 1Q8SA 5H9PA 5FYMA 4CDWC 4QGNA 4CSWA 1ZRDA 2UY9A 2A3YA 4BZ4A 2PAKA 5JPNB 2W92A 4YRDA 1LOCA 2E7AA 2ERFA 3VDDC 1QJU3 1RUG1 2WDBA 5HV4A 1YFUA 5T54A 3WNKA 1DLCA 1W0PA 4YVSA 1OOPA 3IB3A 2BJSA 3WNMA 1KRIA 2Y60A 5FZBA 1CN1A 4I0BA 5FZIA 2VVEA 2W0XA 4UYBA 2EAAA 4IEZA 1OVPA 3OUIA 3TYJA 4CU9A 5EFUA 4AI2A 5FMCA 2XR4A 1Q8VA 5F32A 1VBE3 2YYOA 5C4WB 1WWYA 3I2DA 5FLIA 4P5HA 1ZBA2 3E6BA 4DUWA 1PX3A 1GWKA 4IQPA 4JX0A 1H30A 4R9DA 1R1A2 1QJY3 3MIGA 2EXJA 5B2GB 2VW0A 3KLSA 3VZOA 5IW0A 3FLTA 5CBLA 1O4TA 5A1LA 3ZSEA 2QQIA 4D6QA 1K5MA 3I59A 3LDRA 1BVVA 3ZYJB 4CUBA 2VTXA 3IPVA 1XE7A 4LLFA 1XOYA 4OUSA 3ZFEC 4CU8A 2YDEA 5JIUA 1PGL1 3UJOA 2O8OA 3N36A 3IWZA 5LRSA 3JBG1 1WCQA 2B4KA 4V2VA 1FNZA 1RUI3 1X8MA 5JR2A 1AJKA 1GOFA 5FMBA 2DVBA 2O8QA 4BQ4A 4Z1VA 4AEDC 1C8M2 1RHI1 5A6YA 3FUOA 3HOBA 2VOTA 1AR73 1HJFA 2YB7A 1ZA7A 3J7HA 4YM0A 2NM1A 4MHRA 2TUNA 3NJXA 3B5LB 5FXZA 3NV4A 5D8AB 4Y1UA 2F17A 1WA6X 2IVJA 4COUA 1C1LA 4HKLA 2ILMA 3PJQA 5L7OB 3M2MA 4BE3A 4DRRA 1SCSA 1RUJ1 4LNVA 2RR13 4AW7A 1GZWB 1LODA 1PM7A 4M3CE 5K9YA 3CZJA 4XW3A 4LK7A 3VBFA 1GFF2 2R1BA 3K3OA 2WQ8A 5K7PA 4YG6A 3ZVXA 5CFCC 3F95A 2FCTA 4NR1A 3WG4A 1YYNA 5C6CA 3S30A 3O1PA 2CAVA 4KQ7A 5EXOA 1BBT2 1HQNA 2ZMNA 5FZMA 5K0UB 5C3SA 4LPLA 1HV0A 1A34A 2OT7A 5IK5A 4D7YA 1AYM3 5LA2A 1ASJ1 3H1WA 5JPMB 5BNPA 1YUDA 1GOGA 2A73B 1DHKB 3PHMA 3ZXLA 3NW4A 4QQOA 4RGKA 3J4UH 1DZTA 2FMYA 3ATGA 2ENRA 1TZOA 2ZABA 1EPWA 1F5FA 2WNEA 4IESA 4QX3A 1CWPA 1ULDA 3HD8B 3NNFA 3RMYA 1SFYA 3HNYM 4QGLA 4OQ8A 2RDRA 1AR83 2ZEXA 1QY4A 4RHV1 2JEMA 5FZ1A 1SLIA 1HB4A 5LBEA 3MEPA 5IK7A 3WDWA 1E5RA 1OPOA 2IXJA 2XG3A 1LEDA 1LKNA 3CLPA 4HK8A 4L92A 4GMP1 2VZPA 4QPIB 4ISQA 3WP5A 5AC92 1W39A 4YFWA 4ARYA 2DBNA 3AMMA 2VZVA 4PDWA 4TWTA 1O4ZA 5E1RA 2WNUA 1OD5A 3QBQA 2JDKA 3VKOA 3ZFFC 1OT5A 2JD9A 3AZWA 5CFCA 5JVVA 1YFXA 4H14A 2YMZA 4NPLA 2FZ1A 3POSA 4Y5SA 3ZSJA 3V0AA 2G9ZA 5FYHA 2WWUA 1XE0A 3C7OA 3P6BA 3W5MA 3PIJA 1MZ6A 1J3PA 3BTAA 5LWBA 4XFAA 3IM0A 1UZVA 3OGGA 5FLHA 3BGAA 3OUJA 1PHMA 3IIAA 5FMOS 5CFDC 5FUIA 3B69A 1UKRA 5GLUA 1QXJA 1BCXA 2HYKA 2VMFA 1C3HA 2QJVA 4OHVA 4WVVA 1TMF3 2AGSA 3S0MA 3KCXA 1R1A1 1GKBA 4XCAA 4QX2A 3DL3A 4Q0VA 4BQXA 2A75A 2JXAA 3K4DA 1KGYA 2CYFA 4UW4A 1RINA 4ZU4A 4EZ4A 1XSRA 4QDQA 2GP3A 2L9LA 4ATFA 3ILRA 3MLKA 1PNFA 4BYYA 1K45A 3U0ZA 5BYNA 1JI6A 2IFRA 1U5ZA 2Y64A 3GF6A 2WC2A 4A6SA 1VLNA 4TXWA 4KBBA 3BU0A 4PQQA 1AXZA 3K4AA 4DINB 1N1VA 2ZPXA 3AKSA 3BI3A 3PIGA 4N8MA 3TWIA 4BMBA 2ZX1A 1MS8A 5JDBA 3ZFFA 5FKCA 1OH4A 2ZEYA 4QPWA 1LENA 3KM5A 1F5JA 3DKQA 5FYUA 3RFRA 4CTEA 2JG8B 3LA7A 1ZVFA 1C8M1 2BOIA 4IE4A 1A78A 4H55A 4M0NA 4KMQA 2FDIA 5JXIA 5KWRA 4HLTA 5A32B 3V64A 4OI2A 1M4WA 1OA3A 3ACFA 1NA1C 3Q9OA 1NLSA 2PYTA 3IT8A 5CFDA 4OHXA 2R49A 2ZGLA 2XKOA 3OYWB 2RVAA 4RSUA 5D2AA 3GCWA 3VGIA 5FP4A 4PIYA 5T55A 4AVCA 4OHYA 1N3OA 2E33A 3K77A 2A5ZA 1UIJA 2BW8A 3KV9A 3ZYHA 1ZREA 2Q1FA 4BXFA 3C3VA 4MGZE 3WQBA 4GWNA 1TQ5A 2XBO2 3KF3A 2XVKA 2Q8DA 3RDIA 2VY0A 3MV01 4M3CA 2QQMA 2RS52 4N53B 2VG9A 5GZEA 4MOAA 1JW6A 3DPRB 2YC2A 3S6PA 5C9AC 4Z2WA 4A2UA 2VUAA 2MEV2 4LEJA 4KG8A 2OZ6A 2VCMA 1BBT1 4NRPA 2VPVA 5GZGA 4QX5A 2DCYA 4ZXEA 4AFMA 2XJUA 3CO2A 3M3QA 3AK0A 1CESA 1PMJX 3DYPA 1RUD3 3NKGA 4JKMA 3O1SA 1TE1B 4EWEA 2X5IB 3E97A 4AG4A 5HV0A 5SV5A 2DCZA 1RUF1 1LHNA 5DG2A 2A71A 2WT0A 1B35B 3N35A 3N7JA 1GNZA 4LBMA 1DLLA 1YWKA 1LR5A 5A3MA 3U07A 2TBVA 4Q4Y2 4XZPA 4QX8A 3U10A 1XU1A 4XUTA 3CL1A 4XIKA 3VBOA 2PLV2 4XXPA 2DV9A 5C8CB 4ZHNA 4X8PA 3MFCA 3TB0A 5AC91 4K3UA 1JZ8A 3OEBA 2QDRA 3POYA 4IEPA 3DYMA 3M4FA 1SPPA 4XCBA 4IV1C 3VBHC 3UKVA 1PVC3 2LALA 3MIHA 4D7TA 5T5OA 5IHRA 2WJSA 4PLOA 5JLVA 5L9VA 2WFF2 2ZGSA 2D5FA 3TEZA 5A6XA 4RQPA 5H9QA 2ADEA 1TME2 5CG8A 1E5IA 2BBAA 1NAEA 4NAOA 3T2OA 5C5UA 4OMDA 5FZ3A 3OTFA 5IVBA 1GOHA 3N9LA 3H3UA 2HWF3 3N9OA 2FCUA 2EXIA 4CXWA 1H6YA 3GALA 5GM0A 1FMD2 4A3ZA 2RG4A 4PIZA 2RDSA 1AYN3 5ANNA 4KU7A 3ZFGA 2V5DA 5I0RA 4JDMA 3GCXA 1H2LA 4N7IA 4HN1A 2X53S 5BNPB 1K5MB 4AAXA 3BTZA 5K4LA 3WP6A 1YC61 5BNNC 1Q3EA 4GIQA 4QX7A 5C33A 3E5UA 1K3IA 3M3IA 3WD5A 5FZ6A 1VBC1 2G1MA 5FWEA 3LFMA 3GZAA 1G9FA 2HWB2 5T5LA 3RWKX 1L7QA 4CDWB 1EV13 4YW4A 1JYIA 4IE0A 5EYXA 3HEIA 2B8MA 5FYSA 3VD5A 3HWJA 3N9MA 4Q4V3 5E88A 1CPMA 1ZZ8A 2BQPA 2GU9A 3VDDB 1HXS1 3PU3A 3VBHA 3H8UA 4BQ1A 4EQVA 2WRAA 1RJ8A 3KGZA 3CDZB 3I2HA 4SLIA 3PUQA 1APNA 4JDOA 5GLVA 1ND3C 2ZHKA 4QU2A 4UT5A 3HN3A 3PVBB 5JOYA 3RMXA 2TNFA 3C8XA 4JCKA 5LW9A 3RYRA 1AF9A 3DEMA 3PU8A 1N1TA 4AHXA 1SFPA 2ZX4A 4BDVB 1RUNA 2WT2A 2XQRA 2NMOA 4GMP0 5DZGA 2VQUA 1Y7BA 4AI0A 2D3SA 1XBFA 5B4NA 3HR9A 2WIIB 2WUHA 2Y8KA 1IKQA 2D43A 1EPZA 2R1DA 4E4SA 5IFTA 3JD73 4XFIA 2BYVE 2B5HA 4IUGA 1AX2A 4XIOA 1JN2P 4XPVA 4P9LA 5BNNA 2BWAA 4BQYA 3WNXA 2XBO1 1JUIA 5J37A 4FAGA 1LAJA 2RS51 4DQAA 3VV1A 3ZFEB 4O65A 1J83A 2GMMA 3BIWE 3IAPA 2MEV1 5BNQA 1EP0A 4JC1A 2QQJA 3VLBB 4P14A 2DU1A 2QVSB 3I4IA 3ZDVA 4AXOA 1NCRC 1R082 3R4UA 5FXVA 4BOWA 2KA3A 2A70A 2QE3A 4FTEA 4LTAA 4LULA 1LOFC 4AEDB 5J1XA 1UXZA 4AEMA 4IEYA 3U4XA 1VRH3 1X33A 1N47A 2J42A 3I2KA 3KQ4B 3OSDA 3RPQA 3TAYA 1GU3A 4DEQA 2QUOA 4P9XA 3HN1A 3SH3A 4PF5A 2ARCA 2ET1A 3BTXA 3N7KA 4Q4Y1 3BOPA 4HOOA 4HVRA 1POQA 2WNVA 4NWWA 4EN0A 1OQDA 3VZMA 1PIV2 1ZNPA 4BH9A 5L9BA 5T5PA 2VMCA 2PLV1 2VTFA 4ZZ5A 4FPKA 2GC2A 2WSUA 2LS6A 3PUHA 5FY0A 1XNDA 3WDVA 3WQ0A 3ZN6B 1RUC1 3O1MA 3ZXDA 3R05A 2AYHA 4BLJA 4ITCA 2VL4A 4DXSA 5IVEA 1CPNA 2ZJCA 1IG3A 2YUEA 3IDEA 4ET7A 2E31A 4UFIA 2G9FA 4LOSA 1NXD1 2WFF1 3ZOIA 1HJGA 3ZXEA 4BCUA 1SLLA 3A0NA 2FDKA 4BIOA 3T4HB 4QHBA 4QT6A 1SEFA 5LCWL 2ZAAA 4CDQC 2GP5A 3KSCA 2ZX3A 3KQRA 5FJKA 4H7LA 4MG2A 3AYAA 1OFNA 1NCRA 2OUHA 3MICA 5BY5A 2WAOA 1HW5A 1IS6A 2DU0A 1UU5A 2PHUA 2R073 4XDOA 1PMIA 5FYZA 5LA9A 2Q8OA 1RUG3 2VZ1A 1DZQA 4QDRA 4P08A 1JBCA 2SBAA 4EZHA 2BNNA 2GMPA 2IXKA 4HBNA 4QHOA 1S0DA 2GALA 1LOAA 1SBFA 2PHFA 3WG1A 2DUPA 1W6OB 4MV2A 4UW3A 4YGBA 3WQ7A 2YZ4A 2WKKA 4NHYA 1NX9A 1L7RA 2VC9A 3IMNA 3K48A 3I54A 5D8AC 1V0AA 5DUUA 4C90A 2GNMA 1QKQA 3PURA 5C4WA 5LBFA 4FI9A 3OBRA 2H0VA 1WW5A 1PZ8A 2Y33A 3J7MA 3D82A 5A1AA 4CEWC 1FOD2 1OLME 4Q5OA 1L7LA 4OZXA 1OMIA 1GNHA 3IN9A 4K7JA 1S0BA 2DFCA 5KHJA 1QQP2 4KH9A 1U5YA 1ODNA 5F7UA 1CGPA 1YIPA 4BMEA 1UZ0A 4LLOA 4NVPA 3ZKUA 5CFDB 4RD7A 3EB7A 3LD8A 3WNOA 5K0UC 2VUJA 3JBG3 3TEYA 3AXDA 1VJ2A 4NPRA 3SCHA 4C0HA 1JYTA 2WQZC 1C57A 1NYWA 1WD4A 2WQ4A 1ODMA 1HB1A 2VZUA 2CSGA 2OPWA 4B1MA 1ZX5A 2A6YA 5FJHA 4GWIA 3WP3A 2WZPP 1PO11 2Y0IA 3OPTA 3ZYRA 4Y1XA 5DQ0A 4QXKA 4AQTA 3LWCA 3NNMA 1AR62 4EROA 3L9JT 4BQ3A 4P00B 1W9TA 1S0GA 4HG6B 5D8AA 1ST8A 1VP6A 4XBLA 2JECA 2VBBA 4GULA 5FMDA 1RUJ3 3HNBM 4NHXA 5L7OA 1JHJA 1FT9A 1UX6A 2D6OX 4I0WB 4JQTA 3U11A 4FPFA 3RG0A 1OKOA 4XUOA 3BN6A 1GZWA 5C3QA 4XABA 1WLCA 1GZCA 3QH7A 4KGGA 4LITA 2VJXA 3W21A 2A6XA 3D6EA 4J1XA 1NA1B 2ZGMA 3GBFA 4AVAA 5JCTA 2D44A 1RUE2 1ALYA 2HBUA 4HL0A 4A7YA 3ZPOA 1QNWA 1IPKA 5K0UA 4UFHA 1SBEA 4TLFA 3UESA 3S7IA 3VL9A 4EYUA 1LU2A 1PIV1 4A44A 1PK6C 1S1AA 2YGLA 5LK7B 2BWCA 3C7FA 2IFWA 3E5QA 4NIDA 1DBNA 2JIJA 2VECA 1GBGA 3IZOA 1Y43B 3S57A 4CU7A 4Q8LA 5C9AB 4EN6B 3NV2A 5IAVA 3WVJA 5A3UA 3PJYA 3TNQA 4RHV3 2EIGA 4FAHA 3E6CC 1BMV2 2UWBA 1RVF2 3LQCA 5FPUA 5JXHA 1W0NA 2E32A 4BPZA 2J22A 3DXTA 3FE5A 1AUYA 1MS5A 3D5OA 4NHMA 1NY72 4GMP3 3RSJA 2I07B 2VW1A 4WM8C 2VMHA 4QPIA 4P9YA 2RE9A 1AR92 1COV1 4XHXA 2GNBA 5LB6A 1ZRCA 3DYOA 1ZA4A 3ILFA 3MPPG 1Q43A 1QJZA 2RDNA 1R092 4URTA 1W28A 2GC0A 4AGRA 2BNMA 3WF4A 1UOJA 1YI9A 3V65A 1G9BA 1LOBA 2JG8C 4K6BA 2KD7A 3AZVA 3KT4A 4LE3A 5FR3A 1H8VA 5FZOA 1YQ6A 3KV5A 4FP2A 4OULA 5FO7B 4D94A 2HYXA 4HETA 1SCRA 5KC5A 2BP6A 1BEV2 4PQ9A 4UI9L 4C1WA 2NPIA 3MGUA 4FCAA 4K1ZA 4K8RB 5CNAA 1R1A3 3LB9A 1GZTA 3Q8CA 4IV1B 4XF0A 4L2NA 4MGQA 1GLHA 2WA4A 3MLJA 4CEYC 3MV11 4QXHA 4JGZC 3WDYA 5KHHA 5LRRA 4Z07A 1S0CA 2HWD2 1XYNA 1MZ5A 5DN2A 1YFYA 2WZ8A 3KWVA 2JE7A 1CX1A 1JH5A 2VZSA 1OLMA 4XILA 3AKQA 4UOJA 1IQDC 4Q2FA 1X9PA 4LBQB 1B09A 3NV3A 4HVOA 4XEZA 2D6PA 5A6QA 1DDLA 1KFXL 1UIKA 4XAEA 3THCA 1XNAA 4A6OA 1LTEA 5CKNA 3ZYBA 4UW5A 4C1XA 2Z69A 4GKYA 1PO22 5D21A 2RS32 3WDXA 1NE4A 3RZZA 1RB8G 3AM2A 2JJ6A 4S2GA 1BKZA 1C8M3 1ENXA 1KITA 1W2UA 1JOPA 3O5SA 1RC6A 4Y26A 3SITA 2JG8A 1US2A 1QNYA 1ZBE2 4XTPA 2EIEA 1AR61 5A32A 3AMNA 1YQCA 4GKXA 1SLCA 4W50A 5SV8A 2PXJA 3LF7A 4RFT0 2UWCA 4COVA 3A4UA 4AFBA 4YPJA 5FUPA 3OYWA 1P8JA 2XHNA 2XXZA 1AXYA 4XAAA 1WD3A 2DCJA 3IKWA 2VZ3A 2A6VA 1AX1A 2JDUA 2QQVA 4MO3M 5FMOL 2ZGQA 2FDHA 1ND3B 1W8UA 3O1TA 4FPCA 2VVFA 3WX5A 5L19A 1UD1A 4N53A 3DPRA 1RUE1 1BBT3 1YQ8A 2YBKA 3T4VA 1RMU2 4CU6A 3HBKA 1MVQA 1W2NA 4NUBA 4LO8A 2W46A 4V2WA 2UYAA 3VBSB 5EPAA 1X50A 4CXXA 5E89A 1XRUA 3PDQA 2KR2A 4AHWA 3VDAA 2X5IA 3RJRA 2LM3A 1XNKA 2P34A 1RUF3 1W9YA 1IQAA 1SG3A 5DUWA 4S2FA 1HV1A 2GC3A 5EJZB 1B35A 1W8WA 2H6BA 5LK5A 1O59A 4Y1VA 3ZYFA 3NMBA 4NIIA 1C5HA 2FD8A 3PTRB 1BMV1 1NCQC 2VNGA 1VBB2 2UYBA 3R0RA 3VZJA 1H1IA 1XNCA 3LPFA 1NCRB 1PM4A 2PHRA 4XJWA 5C8CA 5FO8B 5AC93 5IT6A 2MHFA 3USUB 2X10A 5JUVA 1T6GC 5JAXA 1AR91 3K46A 3SEEA 5JZGC 1KDKA 1Q5OA 4ZS2A 2ZOEB 5FZCA 1C8NA 2Z2SB 1UW8A 2WZR2 1X9TA 3BU7A 1V00A 2KXLA 3H1YA 2YHJA 2I74A 3ELNA 4BWOA 2Q4SA 1DGRN 4AQ6A 3ENRA 5T3NA 1KD7A 3GBGA 5DAWA 3OGSA 2GSYA 5HI0A 3AYCA 1ZM1A 3O0VA 1BEV1 5ABJB 1GQGA 1W8NA 2LRPA 2QZ3A 2XKPA 4P9GA 1OF3A 5FK8A 2AACA 3FWEA 3WY6A 2YC0A 1XE8A 4YNIA 4K8FA 5FPVA 1HRV1 2ATFA 1AVBA 1VBC3 4BU2A 1HX6A 4V1PA 2H0BA 4YVWC 3OJBA 2YPJA 4CDQB 3N4MA 5A7WB 3L2HA 1TEIA 5CISA 1UYYA 4CDWA 4Q26A 2ZEWA 2K2SA 4EJRA 4IEVA 2WS92 4L11A 4QX0A 1HXS3 5DUXA 2C1FA 1VAMA 3TRSB 3VDDA 4MGIE 1A6CA 1J58A 1PO21 3RZMA 2JD4A 3LPGA 3PTYA 4FFGA 4ORFA 5F5QA 2VVDA 2XONA 1XB9A 4FT8A 3SKVA 3X29B 3O1VA 1IPJA 4XF9A 2WYSA 3JZVA 3FBMA 3VL8A 3OBAA 5A70A 4BQWA 5HPOA 2OVUA 3T2PA 4X6RB 3SXWA 1OUXA 5FZ0A 4MXWB 4Y3OA 2J1EA 2VO5A 4XHBA 5LEJA 2ARXA 2E51A 4A41A 3VKMA 1QJX2 2WLQA 1REEA 5BUVA 4Z82A 5FZDA 3WF3A 4CEWB 5APAA 2GH8A 1HB2A 2ZKNA 4CPBA 3POEA 2YBPA 1W6MB 3SEPA 2XBO3 4AFAA 2YG0A 3HQRA 4MHUA 3BALA 2RS53 1EAH2 1DGRA 1ZZBA 1W6NB 2CGNA 3N9QA 1VBD2 4KGQA 2BEOA 4OUEA 5A7NA 2MEV3 3A23A 3ZFEA 1W9FA 3AFKA 4ES9A 4TZDA 3CBNA 2IUWA 2P3IA 4BISA 1W8ZA 1UU4A 4CCLA 4MADA 1NT0A 1W9SA 1URXA 3B02A 4KG0A 2ZA9A 1XC6A 4LR4A 3H42B 2R7EB 2N7GA 5G04L 1Q56A 1VIWB 3T1MA 4COYA 2PTMA 4E27A 1WCDJ 1V70A 4GB32 4HMZA 4AEDA 3TN92 4DPNA 3N9PA 3VD3A 4XDPA 1O3TA 1NXMA 2J1RA 3VD7A 4UAPA 1UOGA 1WLDA 4Q4Y3 5FLJA 4BB3A 4FSJA 3H0OA 1HRI2 4YZ3A 1G6NA 1VBB1 2PLV3 4RS5B 1V6KA 3VD9A 4D0QA 1RUC3 4PIXA 2W1WA 1LHOA 2CDOA 3KV4A 3RI8A 1Z7S2 4UXAA 2ARBA 4QHZA 3ZN6A 4Q0QA 3LE0A 5FY1A 3VHPA 3MW2A 1QHDA 3KT7A 1UOBA 3PMEA 2VOWA 1V6IA 4HPKB 2WFF3 1AL0G 4KL1A 1QDCA 5FZOB 3EO6A 3F2ZA 5FREA 1UZYA 3ES4A 5TSWA 3RS6A 3I7DA 1MZFA 4Q4X2 5FXWA 2Q30A 5C71A 3OBZA 1PK6B 1D4M2 1HB3A 3EMRA 4DB5A 1XSQA 5FZGA 4UFKA 1WUVA 5CU1A 1ZBA1 2HH9A 4DXZA 4GJYA 5EIYB 1ZZ9A 3T3YA 1Q8QA 4AI1A 5C7GA 1IG0A 1FAYA 1KS5A 4QAWA 2XOMA 1DIWA 1OSGA 1FX5A 3U1XA 4Q4W2 1UMZA 1LJ7A 3LSEA 2JX9A 3PVOA 1PZ9A 5JOWA 3WHTA 1CZSA 3D0SA 1W6OA 2LROA 3S5QA 4WM8B 4YG0A 3KMHA 3B9IA 1VBE2 1K12A 1GP6A 1SMVA 5EP9A 5C3PA 2YFZA 4A7ZA 2WWSA 2WBKA 1NZCA 1QJY2 1LULA 3P1IA 4R9AA 1I5PA 1GQHA 1BK1A 2WS91 3HVDA 3VN4A 2BRTA 1OQEA 3P5BA 1WBLA 4XBQA 5CG9A 4JGYB 1VB4A 5HCFA 2QQOA 4IEQA 3Q8FA 4LQRA 1OC1A 3E6DA 1K5JA 2IXLA 4HSLA 2Q1MA 1E5SA 4ZS3A 5A7QA 4AAPA 1U5IA 3J7LA 2OPKA 3AFGA 1SACA 1VR3A 3QLQA 1TG7A 2E26A 3J7NA 4GXLA 3WV6A 4CYDA 2QBXA 1LECA 1FV2A 1HQWA 3FC0A 5GLZA 2XPJA 4ZU7A 4UFJA 4CA9A 1O6UA 2OA2A 2OS2A 1WW4A 2PAMA 2HWE2 3M70A 1RUI2 3OPZA 4FFFA 1XNTA 1NKGA 1E57A 1CVNA 4NRQA 3UV9A 3H1MA 1NLRA 2E9QA 5FV3A 4CEYB 4DO0A 1QJX1 4JGZB 5CEHA 1CQ9A 4O9GA 4AVTA 1PO13 1J59A 1YJLA 1UOFA 3ACHA 3U4SA 2BV4A 1IHMA 2MPFA 1ZYBA 2Y6GA 3ZN4A 4LXLA 5A7SA 3UKNA 2YU2A 3ZX7A 4QM8A 4CCJA 4ONUA 4IL7A 3VHRA 5LZ6A 2CGOA 4HN0A 4AEKA 1LCLA 1LGCA 2A6WA 2AREA 4D8MA 2WR9A 3MUY1 2IVIB 2RR12 3FX3A 4XFFA 3A21A 1VAKA 1QH7A 3POFA 3SH5A 3EYPA 4LO4B 5G05L 5A3OA 4IGQA 2V5YA 3RVHA 2C9AA 4BHPA 4IV3C 3ZXFA 3TN91 3DN7A 3M3EA 4FPEA 4LBKA 3AB0A 5CZKA 3S5AA 5F3GA 4X6QB 2VNVA 4YZ5A 3MZHA 1NA1A 3FBYA 3ZSKA 4XQWA 4YARA 4PBOA 3WF0A 4OQ9A 4DZGA 2IWGB 2RJKA 1PIV3 1HRI1 1LEMA 3ON7A 3Q8EA 3GYDA 4HKOA 1JUHA 2QNKA 3WZ1A 1S0FA 2W5FA 4QXCA 4XMIA 4LIUA 3O0XA 4MUVA 2YU1A 1F31A 1H8TC 2XDVA 3JUUA 3MW4A 1FXZA 5K8SA 1G86A 1S0EA 2R0FA 4P9IA 5FZ4A 3ZR6A 3WEZA 1YCIA 2FDFA 1N3QA 2VMIA 4QQLA 3AXEA 5C9AA 3WINE 3ZYGA 2UY8A 3POGA 3K51A 1H9PA 3O1UA 4QQ2A 4HSJA 2ADDA 5C70A 2AC1A 5DG1A 2ZMLA 2OQ7A 5GLTA 4B7EA 2D6KA 2JDHA 2VZOA 2Y0OA 1N1YA 4AI9A 3MBWA 1D4M1 1ENRA 1COV3 1UY0A 4YW7A 4ZU5A 3TEWA 3PL0A 2DCKA 2R32A 4MXVA 2DCTA 2NLRA 1ND2B 2IXHA 1H2KA 5L9RA 4ZXKA 4CCKA 3RZKA 5FP9A 2VNOA 1DP0A 1W03A 3NRUA 1H2MA 3B3QE 4Q4W1 1BVP1 1DZRA 1KS4A 2PAEA 1NCQB 2LTNA 2RS12 3NAPC 2EIBA 4YZ1A 1RJ7A 3EJKA 4NAMA 2RJLA 1NZIA 2D93A 3I3QA 3KZ4C 2HEYF 4P9WA 4AGGA 1OLQA 5JZGB 2FZ2A 1JOJA 1PGW2 1Y9QA 5LY1A 5FQ0B 1H8TA 3AL6A 4IV1A 3ME2A 5FZ9A 1UKGA 4BQ5A 1YRZA 3UL2A 3WLUA 3H8RA 3CJXA 1NE6A 3DECA 2FBEA 5DZFA 1W04A 2BZDA 2G9GA 2O0OA 2V4AA 4KWLA 3K75B 5E16A 3NJVA 4R9CA 2AZ5A 2QZ2A 3LIGA 5C3OA 3IIIA 1Y3TA 2JDAA 2ZGOA 3FUQA 5F6KA 4LBQA 5A3NA 2ZXQA 4Q0PA 4QB6A 2D6LX 2HJIA 2HWE1 4N9IA 3VBSC 1UMHA 5I0SA 2RJ2A 2VD7A 1VBA2 4LIVA 3LOBA 4GH4C 4LHKA 3QD6A 1REFA 1FPN2 2CWMA 1QU0A 3AP5A 1CAWA 2JENA 3WHUA 5CA6A 3BUCA 1QH6A 1U5XA 5F9TA 1U0AA 2WNOA 4YVWB 1AR63 5GZFA 5KHGA 1RUH2 3V0BB 2V09A 4OI1A 5FYTA 1I9RA 3MHZA 5DAQA 5IVYA 3WCSA 4GQ7A 4AOCA 3SMHA 3INAA 1UZZA 3GHMA 4JRAA 3WSOA 3VZLA 3OBTA 1ZRRA 2CY6A 3W59A 3WXPA 5IVVA 5FY7A 4CP9B 3UKTA 5FZHA 2GH2A 3M7AA 5CB7A 3ZMNA 2JICA 3H7YA 4YLZA 4B4PA 1UF2C 2PA7A 2ID4A 5FP3A 1AHSA 1XPWA 4LBOA 4F7ZA 5FPAA 2FDJA 3UNPA 1ND3A 4FFIA 1QJFA 4BXSV 5KHIA 2XJRA 4CDUC 5A3WA 2R042 5FPZA 1RUE3 2PMWB 3I2OA 2FDGA 2CWSA 4YFZA 2ZTNA 4Y22B 3O1RA 2FCVA 2EAKA 2VMDA 4PLNA 2BFUS 1YJKA 2VXJA 1RUD2 3AYDA 1OH3A 3VBSA 3ZR5A 5ABJC 1H1AA 1T6BX 3KGLA 4QWNA 2QDNA 4RGAA 3C7GA 1GUIA 4LO5B 1DYKA 3SH4A 1ENQA 4OI4A 1TME1 4YZ4A 2W47A 5F5AA 2BU9A 3MIDA 4LKEA 2VMEA 2E7TA 4AF9A 4MH0E 2QFEA 1FMD1 3H8XA 4RYDA 1KXGA 4ZY9A 4DUXA 1H4HA 1O8PA 4WVWA 4XXAA 2W1UA 4Y20B 1WCKA 1AR93 2GDFA 2R062 4W4ZA 5I0TA 2DYCA 1LOFA 1W06A 1CZVA 2PN5A 3USUA 1CAUB 4KWJA 3ZN5A 1O3RA 2WA3A 3PMSA 4I02A 2WO3A 3NL1A 4LORA 4AFCA 1JS9A 3DUIA 1AXKA 1AL22 1DQ6A 2RS11 2G4IA 4R9BA 1KJLA 2NN8A 3MDPA 1DGWX 5IVJA 1YNAA 2HWB1 3B00A 1D7PM 3UGFA 2A7AA 4CDXB 1BEV3 4ZONA 3KHCA 2ZACA 3HT1A 2VCAA 4JTNA 2VQAA 1DFQA 4E4DX 5ABJA 1YIFA 2YGMA 4ES8A 3R6SA 4Y4YA 4Y5TA 1RUOA 1SQ4A 5EJ1B 3RGBA 3OB8A 3LOIA 3HQUA 4O61A 1HRV3 4PJYA 1CONA 4I3GA 4F83A 1BJQA 4P02B 2GN3A 4TSVA 1LESA 2DTWA 4AHZA 1LGNA 3VBUB 2Z5WA 5C5TA 4XFGA 2X05A 1GNYA 1EV12 1W6PB 4M00A 4CDQA 2BGOA 4AZZA 3OY8B 2X8KA 5A7WA 1PX4A 1DF0A 4QDSA 4Q1PA 3GJAA 4W6WA 4DUVA 4Q4V2 3UGGA 2XJQA 5FZ8A 2CHHA 4KU8A 3NJZA 5D1IA 3OD4A 4NROA 2G19A 1ACCA 3GHNA 1PO23 4XTMA 4OI0A 1JMUB 1VBA1 4R4ZA 1RHI3 2IXIA 2GZWA 4L9BA 1W8FA 4LMFA 1FPN1 2CDPA 1RITA 1MPXA 3ETPA 2W94A 4YGCA 4CP1A 4DRVA 1DQ4A 1LHUA 5FFOC 1VE0A 4QKNA 2Q8CA 2WO1A 1XXNA 4JKLA 2B42B 2Y6HA 4PCRA 2YPDA 4YW6A 3WDTA 3ZKYA 3FN9A 4CCOA 2C9KA 2EIDA 5KXCA 1RUH1 3VDCA 3WR0A 5ACA2 5F2SA 2B39A 2PELA 3FLPA 4NPMA 3UK9A 1GQPA 2DVDA 2PHLA 1ULEA 3ZPYA 2NYYA 3KT1A 4MXWA 4XURA 4RS5C 1UAIA 3BTYA 3ZSLA 1AJOA 4NOTA 1R081 5FRAA 2WWJA 1JZ7A 3S7EA 1CZTA 4JKKA 4CEWA 1JODA 1N1SA 1U12A 1RXGA 3FJSA 2ZKLA 3BOWA 3AL5A 1QOSA 1H9WA 1W6MA 1MS9A 2W95A 1ZZ6A 2AH2A 5FBJA 3CJIC 1W6NA 4XZUG 2R041 4PHZA 1F35A 3ETQA 4IEXA 4MX3A 5FYIA 1PZ7A 4PLMA 4DY3A 5BNOC 4QPYA 1XU2A 1V6OA 3SCGA 1JOBA 4A7KA 1ASJ3 4COZA 4D69A 3B01A 2JDNA 2WYFA 5LBBA 4JAAA 4QXBA 3M8LA 5F3EA 3VZNA 3WF2A 4I0AA 3UYJA 5I8TA 3BPSA 3JB4C 1YQ5A 2XUEA 3R4DB 5LEKA 3I2GA 1I3HA 4FVVA 3FFZA 4LKSA 1VRH2 1Q8PA 4Q29A 4HVQA 1JYWA 5DMYA 4AQSA 1OA2A 3RNSA 1UCXA 3AVSA 1Y4WA 4DFSA 4M3CF 5LASA 4WBBA 2NQYA 1O7FA 1WKYA 2WABA 4Q0UA 1H0BA 3RJ2X 1OF4A 1CAXB 2VE1A 5DXDA 2JG9B 2VUDA 4RS5A 3E5XA 3ES1A 4CUCA 3P3PA 3WUCA 2P3YA 3LZZA 1WBFA 4HFSA 2R061 4QX1A 2Y26A 4QKFA 1YHFA 3ZYPA 4SBVA 4FPHA 2VBPA 3CKHA 5BXXA 4IV3B 4Y1ZA 3J8F2 2A6ZA 3RYKA 5JXGA 4JGYC 1X82A 2E53A 1HN1A 2C5DA 1C4RA 1GMMA 4HPKA 3JB8A 4IXLA 5LATA 1WW6A 4I2OA 2AR6A 2RM22 1AL21 1GV9A 3VKFC 1AZDA 4QPGC 3JQXA 4UW6A 4UF0B 4K21A 1ZZCA 2BERA 1PK6A 3DCQA 1ZBA3 1JZ6A 1KJRA 4Z92B 1BLZA 5BPXA 2R072 1H8TB 1PMHX 2Y38A 3FMGA 4UBHA 5FYYA 5FDBA 5GZCA 1Y9GA 5F1RA 4FOQA 4LBJA 1SLAA 1I1EA 2H6CA 1FOD1 1GP4A 1W05A 5IFPA 2K9ZA 2ZCWA 2PHWA 4R8HA 1QQP1 2CL2A 1HIXA 2P6CA 4IGPA 1MQTB 3PNAA 2QQNA 2YFUA 3A22A 3UJQA 5F37A 2AEZA 2C26A 4JHTA 3KF5A 4K40A 1MEC2 1WA4A 4WM8A 4OMCA 3OGRA 3AX4A 1VAVA 1ZZ7A 1V6JA 2WS93 4Q4V1 3BPZA 2ZHMA 2W1QA 3B93A 2X29A 2P5BA 1CAWB 1WLTA 3CNAA 1GWLA 3GBWA 2J1SA 3GZUC 3T09A 4JGYA 5DZEA 2DTYA 3AKPA 2VR4A 2RMU2 3NAPB 3MIFA 4O9EA 4TN7A 3VBRB 4YZ2A 5FZ7A 3ROUA 3C7HA 5J36A 1BHGA 1CAVB 1S2KA 1W2AX 1S0JA 4FPOB 1TNRA 3TOJA 4QKDA 5ACA1 1JYXA 1UQXA 1KDMA 4CXYA 3RQ0A 4YW1A 2ET7A 4LUKA 3VB9A 4D7SA 4TYSA 4ZPIA 1H6XA 1QJX3 1O4YA 3DGTA 4PI0A 4RR3B 4CEYA 3RZHA 4DNYA 2NP0A 4JGZA 1ZRFA 5J09A 1OA4A 5A1FA 1MVEA 3ABZA 1H1MA 4QB2A 3GJBA 2UWAA 3Q8AA 4XETA 1S55A 4W8JA 1BXHA 2JKBA 2C6SA 2RDQA 1QF3A 2YBSA 3FFQA 4HANA 2DVAA 5FAXA 5FUNA 2JIGA 1V6MA 1POV1 2BVBA 4XOGA 2HEWF 4M4RA 2ZGRA 5JIAA 3NV1A 5KC6A 4EV0A 2J1UA 3MI8A 4URAA 4C91A 5IVCA 2Y6KA 1EUTA 4GH4B 3ZYIB 4BJ0A 2ORXA 4GALA 4WVMB 2YROA 2DUOA 4IE7A 2FQPA 3BCWA 1BYHA 4LA2A 3G7DA 3HJRA 4NRMA 3GDBA 5DAPA 5I8SA 4GZ9A 4E8CA 1G9CA 4YVSC 2I45A 3LEIA 1ND2C 4AI8A 4MGYE 3ZXAC 4XMAA 3WT3A 2OQ6A 1S2EA 3HIFA 4YWAA 1RVF1 1CIWA 2WSVA 2ZGKA 3TEXA 1HRI3 3BB6A 3AC0A 5ANQA 1GANA 1NY71 4H3WA 4QB1A 2VM9A 3I8TA 3O7OA 1D2QA 1WMEA 3GZEA 3R4SA 4I01A 5FYCA 3I2IA 4ASLA 5C8WA 1STMA 3CIHA 1DCSA 2OIIA 2HWC2 3K3NA 3T0BA 2BVVA 4OUMA 5ERLA 5J98B 1HQLA 2R16A 1R091 2DFBA 3AJYA 2OW4A 3J8F1 3CQOA 4CDUB 4QMAA 1LHWA 5IJRA 4XJ8A 4RHV2 1QWRA 1GP5A 3AP4A 2V4VA 5IATA 5KR7A 2J1TA 2VTXJ 4I3PA 2RM21 1D4VB 1KFUL 4FPJA 1OLRA 3OPWA 1YXWA 2F6BA 1C5IA 1W6QB 1D4M3 2XL7A 3PUSA 5FZEA 2K0GA 1R1ZA 3MW3A 4FP3A 2DURA 4XJUA 5T52A 5CIRA 4FTBA 1G9AA 2R071 1RGSA 3LFIA 3WF1A 5JSRA 1IOAA 1J84A 2ZGUA 3VDBA 3UGHA 1ND2A 4Q4W3 4META 1QGLA 3O12A 2RHPA 2HWD1 4ZKTB 1LU1A 3OUHA 1S0IA 4RL7A 5E8AA 5FKBA 4YSFA 3ZMOA 3N7LA 4XUQA 1NCQA 2E6VA 2ZGPA 3DXUA 3PVEA 3AMPA 2P4EA 3M1HA 4BQ2A 1OHFA 1MEC1 2B9UA 4AHYA 1WMDA 1XYPA 1JYCA 3LAGA 2BGCA 5JZGA 4LA3A 1UN1A 4S2DA 5HXMA 5FQ0A 3VBFC 2RS31 1NQDA 2VOKA 4K9SA 3DF0A 2JDZA 1KQRA 2HKXA 3CHXA 1GWMA 4A3XA 2RMU1 4DXRA 5EJ3A 4AL9A 4TLGA 4OCTA 4I09A 2OKXA 1ZBE1 1DQ0A 2Z42A 4L8QA 4MVTA 1OURA 4HONA 5FK7A 4CCDA 4AE2A 2VQ0A 5FY4A 1F8VA 5JI9A 1V9U2 2HWE3 1D0GA 3LEMA 3VKLA 2V72A 3B94A 3WNLA 4C8DA 3APBA 4JZRA 5IWFA 2WN2A 2IZWA 5BNPC 5CADA 1Z0HA 3LEKA 4Y4RA 4E4HA 5JXJA 5A33B 1T2XA 1VALA 4HZFA 1M06G 4XQDA 5IYYA 5A80A 3WW1A 2QQKA 4YGEA 1S4CA 3TBDA 1UYPA 4LKFA 3RYPA 2GNDA 4YVWA 2A3WA 2E63A 2XH6A 3O1OA 3MUZ1 5J3UA 3V0BA 3AP6A 1BQPA 2JB4A 1RMU1 4JQRA 3FHQA 1NG0A 4J25A 4NHLA 4CP9A 4W6XA 3AZXA 4PDWC 2VZTA 4ASMB 4EWDA 2WNUC 3WNNA 2R30A 3GXUA 4AVVA 4DIQA 5JMOA 1WCSA 4MGSA 1UY2A 3GGLA 1UXXX 3M3CA 2XQXA 1CD3G 1WW7A 2P6HA 3B9CA 5DDJ2 2E7QA 4Y5Z0 3UETA 1XJAA 2B45X 5GLWA 1O5UA 4Y22A 1VMJA 4Y1YA 1DG6A 3BODA 4CDXC 2JDPA 1VMFA 1PVXA 5GKAC 3LIHA 2AENA 3T2TA 3I2JA 2PQSA 2XL9A 2CGPA 1RUF2 2HWC1 2D5HA 3GM8A 3U14A 1JU3A 1WMFA 2WZR1 3ACLA 3CJIB 4M0HA 5DUVA 1TME3 5I8YA 3FZ3A 1FYUA 2PHTA 2ZGTA 1QOTA 2K46A 5T50A 4GJZA 1JZ2A 5A3PA 4WZFA 1X8EA 2TEPA 5BNOB 2W9XA 4AFDA 1EYBA 2JKXA 3WW3A 3LEGA 3D8CA 4LHNA 1FMD3 3VBUC 1E5HA 3LA3A 5FPBA 4PF1A 4N43B 3KV6A 5IUQA 1SHWB 2Z79A 1LNSA 4B7KA 1XYOA 2W39A 1JYVA 2CU5A 4Y20A 1QJU2 4IEUA 3LKJA 1GR3A 1CAUA 4RN5A 5FZKA 1G9DA 3AKRA 3HQXA 2AEYA 2RS13 4YW2A 1POV0 1CX4A 5LA1A 1LHVA 3ITQA 3GNEA 1WCUA 2F4PA 2HWB3 5FIXA 4AVSA 5KHKA 3SISA 2Y6JA 2P3JA 2XLFA 4Z8BA 4XQ4A 4CDXA 1C1FA 1UNBA 1RIRA 3OOXA 4GWJA 5FP8A 4TTGA 4FBFA 1UY3A 2ZS6B 5FOJB 3POBA 2BFUL 4WM7C 4P9JA 1MS3A 4CE8A 2JDYA 2XGXA 4QGMA 3WUDA 1GZ9A 4B1LA 2W08A 1VBC2 2ZHNA 4JTOA 4OYUA 1RTVA 3SHRA 2C0ZA 4CUGA 3ZDSA 1A3KA 4QPGB 4Q0SA 4F8AA 3I3MA 4HKWA 1QXPA 2YC4A 5KXDA 2DDUA 3AJZA 3VBUA 4NIGA 4DMIA 1W6PA 1Y9MA 2WT1A 3OY8A
chains in the Genus database with same CATH topology
4JZRA 2FCUA 3OUJA 4NHMA 2RG4A 2RDSA 3GJBA 5DAVA 2RDQA 4XCAA 4BQXA 5LA9A 2JIGA 5C5UA 2FCVA 5LB6A 2RDNA 5LBBA 3KT7A 2A1XA 4J25A 4NHLA 2G1MA 3KT4A 2HBTA 4NHYA 5DAPA 3OBZA 5DAWA 5LBFA 3MGUA 5LASA 3EMRA 2Y33A 3DKQA 4Q5OA 5DAXA 4MHRA 3NNLA 3GZEA 5LBCA 3PL0A 5L9RA 5EQUA 5ERLA 5IAXA 5M0TA 4XACA 5LATA 5EP9A 4XC9A 5IATA 2OPWA 4ZONA 2FCTA 4BQYA 4NHKA 3NNMA 4UWDA 4Y5TA 3HQUA 2V4AA 4BQWA 3BVCA 3OUHA 4IW3A 4NHXA 5C5TA 5HV0A 4XAAA 3ITQA 3GJAA 3NNFA 4NMIA 4XABA 2RDRA 3W21A 2G19A 3W20A 5LBEA 3HQRA 4MHUA 2HBUA 5L9BA 2Y34A 5DAQA 5HV4A 5EPAA 4KBZA 4XCBA 5L9VA 2JIJA 4Y5SA 3KT1A 3NNJA 3OUIA 4ZPIA 4NAOA 5A3UA 5IAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZR A;  2FCU A;  3OUJ A;  4NHM A;  2RG4 A;  2RDS A;  3GJB A;  5DAV A;  2RDQ A;  4XCA A;  4BQX A;  5LA9 A;  2JIG A;  5C5U A;  2FCV A;  5LB6 A;  2RDN A;  5LBB A;  3KT7 A;  2A1X A;  4J25 A;  4NHL A;  2G1M A;  3KT4 A;  2HBT A;  4NHY A;  5DAP A;  3OBZ A;  5DAW A;  5LBF A;  3MGU A;  5LAS A;  3EMR A;  2Y33 A;  3DKQ A;  4Q5O A;  5DAX A;  4MHR A;  3NNL A;  3GZE A;  5LBC A;  3PL0 A;  5L9R A;  5EQU A;  5ERL A;  5IAX A;  5M0T A;  4XAC A;  5LAT A;  5EP9 A;  4XC9 A;  5IAT A;  2OPW A;  4ZON A;  2FCT A;  4BQY A;  4NHK A;  3NNM A;  4UWD A;  4Y5T A;  3HQU A;  2V4A A;  4BQW A;  3BVC A;  3OUH A;  4IW3 A;  4NHX A;  5C5T A;  5HV0 A;  4XAA A;  3ITQ A;  3GJA A;  3NNF A;  4NMI A;  4XAB A;  2RDR A;  3W21 A;  2G19 A;  3W20 A;  5LBE A;  3HQR A;  4MHU A;  2HBU A;  5L9B A;  2Y34 A;  5DAQ A;  5HV4 A;  5EPA A;  4KBZ A;  4XCB A;  5L9V A;  2JIJ A;  4Y5S A;  3KT1 A;  3NNJ A;  3OUI A;  4ZPI A;  4NAO A;  5A3U A;  5IAV A; 
#chains in the Genus database with same CATH topology
 2QQP A;  5FPL A;  4B4R A;  1V9U 1;  2NMN A;  5CYY A;  3HAG A;  1HXS 2;  3I3E A;  4YW3 A;  3L2Y A;  4XDQ A;  1VBA 3;  5CKM A;  4Y33 A;  5A3L A;  1CIY A;  2EVX A;  2P37 A;  1FPN 3;  4U36 A;  1AR7 2;  4FOV A;  5JOX A;  1SLB A;  1NUK A;  3POI A;  1EAH 1;  3T2Q A;  3KD4 A;  5B4X A;  5F6L B;  5FZF A;  3NKT A;  4MGT A;  1RUH 3;  1VBD 1;  2VBD A;  3WP4 A;  2XLA A;  2P2K A;  3HPN A;  2DVG A;  4AGV A;  1NOV A;  1W3V A;  1A8D A;  2A1X A;  2D6M A;  2J7M A;  3K4Z A;  3VBO C;  2PHD A;  1UYX A;  2BTV C;  2WL1 A;  3KVA A;  3WQ1 A;  4A42 A;  2YXS A;  2Q8E A;  1R08 3;  1W3X A;  3AVR A;  2JG9 C;  3FL7 A;  3IDA A;  4Y24 A;  1NLQ A;  2VQT A;  4GWM A;  4WM7 A;  4KNC A;  3SQO A;  4UFM A;  2VU9 A;  4L97 A;  3H8O A;  2GME A;  3AZZ A;  3QAC A;  1WMX A;  1JXN A;  1ONA A;  1OQ1 A;  4GB3 1;  4DY5 A;  4AR2 A;  1QDO A;  4RQP C;  2GC1 A;  1PGS A;  3W5N A;  3H3L A;  2R04 3;  3IMM A;  5FWJ A;  2XJS A;  2W2I A;  1J3R A;  2XJT A;  3KS7 A;  5I91 A;  5FCC A;  3NNL A;  2B46 X;  5DDJ 1;  4FQZ A;  3MIE A;  1AYM 2;  3T0A A;  4HXC A;  4XYX A;  2XVL A;  3ZFG C;  3AMH A;  5EQU A;  4E2S A;  4Q8K A;  4FXK B;  1UY4 A;  1Z7S 1;  2ZGN A;  1ULC A;  1Z78 A;  1VRB A;  3TNP B;  5IVF A;  3RZG A;  4ASK A;  2WAA A;  2BNO A;  4LK6 A;  4RA0 A;  5LA0 A;  1AR8 2;  1X36 A;  1LOE A;  2I2S A;  2J1V A;  2PFW A;  3J9S A;  4PI2 A;  5FY9 A;  4AI3 A;  1MQT C;  4Q4X 1;  3PUA A;  1W90 A;  3T30 A;  5A6Z A;  4CRQ A;  1CR7 A;  3CF6 E;  4MZU A;  1RUC 2;  4XJA A;  1CAX A;  5JMC A;  2WN3 A;  1QXR A;  1RL3 A;  2JG9 A;  3OF1 A;  4P5Y A;  4I30 A;  2R06 3;  4YM1 A;  2VNR A;  4YG3 A;  3ZXG A;  2LUW A;  3OD0 A;  4U2A A;  3THD A;  2EXK A;  3LSD A;  4YVS B;  2V73 A;  1OOP B;  1QJU 1;  2VCC A;  2QQW A;  2ZBJ A;  5F8P A;  4CUA A;  1UZW A;  3OGJ A;  4N9H A;  4IV3 A;  5FY8 A;  5HCH A;  3E1F 1;  4XE9 A;  1H2N A;  5H9S A;  4B29 A;  4UFL A;  4OFG A;  3LA2 A;  1OKQ A;  3VBR C;  1AL2 3;  2C4X A;  2XB6 C;  4W65 A;  3U78 A;  1SBD A;  4WZC A;  3WG2 A;  5ISL A;  2VOX A;  2DWR A;  1VBE 1;  2Y6L A;  3B7M A;  4UF0 A;  3WOG A;  3ZXJ A;  2WO7 A;  5F3I A;  1TMF 2;  4R52 A;  4RFR B;  3ACG A;  3VD4 A;  1QJY 1;  1RXF A;  2BGP A;  1V6N A;  2XWB B;  1HKD A;  1F15 A;  2Y34 A;  2R6Q A;  1FOD 3;  3AZY A;  3IAQ A;  3U37 A;  4RR3 C;  3I59 B;  3V56 A;  5KXE A;  2OYZ A;  3EBR A;  5EZW A;  3ZLI A;  1QQP 3;  3RRD A;  4KBZ A;  3W58 A;  3IPV B;  1TVG A;  3MF9 A;  3K2O A;  1YQ2 A;  1MQT A;  3THT A;  2XWJ B;  5A7P A;  3MF6 A;  3T08 A;  2ORZ A;  1J1L A;  2AUY A;  3OEA A;  1C28 A;  5EHD A;  1RUI 1;  3CMG A;  2CV6 A;  4XUN A;  4YYO A;  4CVU A;  1O3S A;  1YO8 A;  4BK4 A;  5AVP A;  3ALQ A;  2BDR A;  2ARA A;  3MPB A;  4OVE A;  1MAC A;  5DAV A;  3THP A;  4IEW A;  1LOG A;  4IE5 A;  4XUP A;  1D2S A;  3DV8 A;  4LE4 A;  4QU1 A;  1AR7 1;  5DPN A;  3NAP A;  5HCA A;  3RI9 A;  3VBR A;  1GSL A;  2D98 A;  2GNT A;  3AMQ A;  2LW8 A;  1W8T A;  3IDC B;  5ACA 3;  2D3P A;  1CAV A;  2WNV C;  4XF4 A;  4LO7 A;  3ZXK A;  4DS0 A;  3QCW A;  2SLI A;  2VXR A;  2A3X A;  3LCP A;  1CJD A;  2WFP A;  3U75 A;  2RR1 1;  3VBF B;  2JWP A;  2ZAH A;  1J1T A;  1HN0 A;  4XJ9 A;  1PO1 2;  2VUC A;  1F4A A;  4RR3 A;  1JZ3 A;  1MS4 A;  4WVZ A;  2D3R A;  3MIB A;  4EN7 B;  3NVC A;  4J6G A;  1JYN A;  1O5L A;  3POW A;  5IK8 A;  1W2T A;  2Z4F A;  4LHL A;  2EA7 A;  1POV 3;  5F3C A;  1GYK A;  2DUQ A;  3ACI A;  5DAX A;  2D6N A;  2IC1 A;  5JI7 A;  1DQ2 A;  5CAZ A;  3RZL A;  3ILN A;  3VHO A;  5GZD A;  2YY1 A;  4XVH A;  5LBC A;  4X8N A;  1ENS A;  2O14 A;  3SCF A;  3WW4 A;  1FV3 A;  4CPB D;  1ULP A;  1UL9 A;  1UPI A;  1AYM 1;  1YEW A;  1UWW A;  1A8M A;  1OFS A;  3A7Q A;  3ORJ A;  4L99 A;  2QTW B;  1S2B A;  4GH4 A;  4KI5 M;  4CCC A;  5F2W A;  4WVM A;  4JDN A;  1MS0 A;  2B9V A;  1Q8O A;  1ULG A;  2JE9 A;  4XC9 A;  4F3J A;  5FXX A;  2Q5T A;  1AX0 A;  2CAU A;  1AR8 1;  1RVF 3;  2EAL A;  2P17 A;  3OGV A;  4NE9 A;  3POJ A;  1UYZ A;  4DEV A;  4IND A;  1LRH A;  2XJP A;  2XML A;  4A4A A;  1R64 A;  4E4Z A;  3VUO A;  1OVS A;  4PDW B;  4CP0 A;  5C4W C;  1DGL A;  1XQN A;  2QCS B;  3OCP A;  2WNU B;  3KB5 A;  1RED A;  4BLI A;  1WZX A;  2NZ9 A;  2ZX0 A;  2QQU A;  5J96 B;  3T0D A;  1PVC 2;  1R09 3;  2DBI A;  2DVF A;  2ZZQ A;  3BVC A;  3H50 A;  3J8F 3;  4QQP A;  1YLL A;  2P1B A;  5JSO A;  5FO9 B;  2JB8 A;  3ST7 A;  3V0A B;  4LHS A;  3FHI B;  2RV9 A;  1YFW A;  4CDU A;  1YI7 A;  3ZIX A;  3H7J A;  3T1L A;  2HWF 2;  1QIQ A;  4UBG A;  3WCR A;  2RM2 3;  5E6H A;  1ULO A;  3KHB A;  2OX0 A;  1O3Q A;  3NQH A;  4CCE A;  4OHW A;  3SKJ E;  2XVG A;  4D3W A;  5JOZ A;  1IS5 A;  1MZE A;  1AYN 2;  2OZJ A;  4ISR A;  1W6Q A;  1COV 2;  3WDU A;  1DQ5 A;  5KXB A;  1TMF 1;  1QMJ A;  1PGW 1;  2QKD A;  1IGO A;  2W3J A;  4LKD A;  3UT0 A;  2HWD 3;  4NIH A;  1OI6 A;  1N3P A;  3BYW A;  4IER A;  4G4F A;  3LDK A;  3LGR A;  2VZR A;  5F39 A;  1UPS A;  4DXT A;  3NNJ A;  4GAZ A;  4K1Y A;  3ZM8 A;  5A7O A;  4ATE A;  4PBP A;  3MO4 A;  1MEC 3;  2JE8 A;  4LOT A;  2XUM A;  2EIC A;  4LBL A;  5GJ6 A;  3NO8 A;  3M3O A;  1MS1 A;  5L7O C;  3EXU A;  1UO9 A;  3ZFF B;  5FBZ A;  1IZ3 A;  2VZQ A;  4CCN A;  1OXC A;  3NWK A;  3CEW A;  2RS3 3;  5JWP A;  2JDM A;  4D6R A;  2UUR A;  3HMY A;  3KVB A;  4LBQ D;  4AQ2 A;  5EYY A;  1SDD B;  1W99 A;  1BK0 A;  3BKZ A;  2RMU 3;  5I93 A;  1JZ4 A;  1ULF A;  1ZBE 3;  5I0U A;  4AVB A;  4YGD A;  4IE6 A;  2HLE A;  1DU3 D;  1QOO A;  1G8W A;  4E8D A;  4GD4 A;  4G9S B;  2XHK A;  4XFH A;  1SZB A;  2P3K A;  4KWK A;  1IPS A;  4MSV A;  3AP9 A;  4YM3 A;  1SLT A;  4WM7 B;  4NIA A;  4FPG A;  4Q27 A;  5FYV A;  3JD7 2;  4IET A;  3QOP A;  4N90 A;  1O8S A;  4M3C B;  2ZHL A;  5A33 A;  1SFN A;  4B3N A;  2ZX2 A;  4IEO A;  2XJV A;  4XF3 A;  1TNF A;  2W68 A;  5HCB A;  4FO9 A;  4QQH A;  4OHZ A;  4BM8 A;  3N3H A;  1RMU 3;  1ZRI A;  4AEJ A;  4XJZ A;  1H4G A;  4XFC A;  2YV8 A;  1LB2 A;  1X7N A;  2VUL A;  2CNA A;  4LT5 A;  1RUD 1;  5IAX A;  3JXS A;  4QPI C;  4N43 C;  3J26 N;  5M0T A;  3BIE A;  3FHA A;  3CZU A;  4K20 A;  3IDB B;  4B4Q A;  4PT6 A;  4XAC A;  1JZ5 A;  4MLO A;  3W9A A;  3RZJ A;  4FQ4 A;  4HT1 T;  1UMI A;  5LY2 A;  4C0B A;  4H7M A;  4G3Y C;  2OUJ A;  4M01 A;  2ZZJ A;  4JRL A;  4LJH A;  3OG2 A;  3SLI A;  5FTT C;  1UX7 A;  2GAU A;  3VBO B;  2VOV A;  3AP7 A;  4NO4 A;  4UWD A;  1VBB 3;  5A3T A;  1W8H A;  3O14 A;  4D6S A;  4CP2 A;  3I2F A;  4NWV A;  1FAT A;  2PHX A;  3P3N A;  5J7M A;  1QJE A;  1SPP B;  2W1S A;  4FFH A;  2HWC 3;  5FZA A;  3A0K A;  1OBN A;  3SNM A;  3SC7 X;  4IW3 A;  5L73 A;  4FXG B;  1PVC 1;  2WZR 3;  4R4X A;  3O0W A;  4RQP B;  1W0O A;  2ETE A;  2GN7 A;  5FYB A;  4MGK E;  2VMG A;  1UU6 A;  3CJI A;  4BA6 A;  4NMI A;  1VB2 A;  2C24 A;  3N7M A;  1LGB A;  1JU4 A;  4JV4 A;  4FPL A;  5FPX A;  2D97 A;  1GIC A;  1QEX A;  2HWF 1;  2O1Q A;  2UU8 A;  2VAU A;  4O7X A;  3HBZ A;  3W20 A;  4GA9 A;  4AYU A;  4E2G A;  2EXH A;  5BNO A;  3VZK A;  1UY1 A;  3WW2 A;  3EHK A;  4J1W A;  2FHR A;  4NN0 A;  4XFB A;  3ZFG B;  5EV7 A;  3GZT B;  3AKT A;  2J1A A;  1AYN 1;  2IXC A;  3H3Z A;  4N43 A;  4YM2 A;  3I49 A;  1DGW A;  3ECQ A;  1RUG 2;  3ASI A;  3URF A;  5CVR A;  4JVA A;  1W8O A;  5F5C A;  5KBF A;  2WIN B;  2DF7 A;  2PQQ A;  4FOW A;  3C2U A;  3I97 A;  1XNB A;  2ES3 A;  1CJP A;  4BK5 A;  2BOJ A;  1MR5 A;  3WG3 A;  4QKB A;  3PUI A;  3NNG A;  1WLW A;  3DKW A;  2WO2 A;  1EV1 1;  2WLP A;  3Q8B A;  5FZL A;  2VW2 A;  3D3A A;  3JQW A;  4LBN A;  2Y6F A;  4RGG A;  3VBH B;  3N9N A;  3AYE A;  3I3D A;  3I3B A;  3MYX A;  5CKQ A;  5GAL A;  3VHN A;  3VKN A;  1HRV 2;  5H9R A;  2WZE A;  1I5Z A;  1VPH A;  4WV8 A;  1I6X A;  1FI2 A;  4LUM A;  1JHN A;  4N53 C;  4QD2 A;  4Z2A A;  1PGL 2;  3DPR C;  3C7E A;  4IGO A;  2HEV F;  4QPG A;  2Q0A A;  2FMD A;  3JBG 2;  1D0H A;  4QM9 A;  5FP7 A;  2W87 A;  1IS4 A;  5JR7 B;  1IS3 A;  3KCY A;  4FPY A;  2HBT A;  1V9U 3;  1F4H A;  4H2A A;  4N7U A;  5FY5 A;  5FOB B;  5C3R A;  1RYY A;  2VH9 A;  3FLR A;  1O91 A;  2X5I C;  4KWU A;  5JSP A;  1HDK A;  1RHI 2;  3JD7 1;  5BNN B;  1DQ1 A;  1K42 A;  4M4P A;  4EN9 B;  4AWD A;  5F5I A;  1VMH A;  4FTS A;  3G6J B;  4JHZ A;  4BIF A;  4COW A;  5AFE A;  1EAH 3;  1B35 C;  1NQJ A;  5L36 A;  1OUS A;  1VBD 3;  5DAB A;  4CCM A;  2R0H A;  4YW5 A;  3NJY A;  1OD3 A;  3CU7 A;  1US3 A;  4EN8 B;  3PVN A;  2W52 A;  2D40 A;  5T5J A;  4B8E A;  1BZW A;  1RUJ 2;  1V6L A;  1L3J A;  4A45 A;  2F4L A;  1DYP A;  5C8C C;  2BPA 2;  4NJ4 A;  5CFC B;  3HT2 A;  5AFB A;  4MYE A;  3D4K A;  2BBV A;  4E2Q A;  4GB3 3;  2X09 A;  3HNM A;  2ZMK A;  1EY2 A;  2KM2 A;  3MLL A;  1JTZ X;  1OOP C;  1VRH 1;  2QQL A;  2Q1Z B;  4LO6 B;  3PLQ A;  3TN9 3;  2MNG A;  3ZSM A;  1KEX A;  1IKP A;  2XLG A;  3KCC A;  3NST A;  4XBN A;  1PNG A;  1W9W A;  1EUU A;  4OZO A;  4HK9 A;  4NHK A;  4Q1R A;  3H9A A;  4FOY A;  5AVA A;  1G7Y A;  3MFA A;  2WNV B;  2W91 A;  5BV6 A;  3QH6 A;  1J3Q A;  1W2O A;  4IDZ A;  2VCB A;  4XF1 A;  5DDJ 3;  3WNP A;  1SDW A;  1ASJ 2;  1F2N A;  4AK3 A;  3IBM A;  4DOU A;  5J48 A;  2BUK A;  3JU9 A;  4L0P A;  5EWS A;  1HLC A;  1Z7S 3;  3JCI A;  4OLL A;  2B7Y A;  3RWN A;  1WGP A;  5HXV A;  4EE2 A;  4EWA A;  3EQE A;  4ARX A;  3D0J A;  4ZZ8 A;  2OXB A;  2VGD A;  1OPM A;  1F9K A;  2D7F A;  4S2H A;  3LDB A;  1K5M C;  5I0D A;  4CZS A;  2CTV A;  2EF6 A;  2ZEZ A;  3ZO0 B;  1FNY A;  4Q4X 3;  3USS A;  3ZIW A;  4E9K A;  5HBA A;  4W6Y A;  1DYO A;  5IK4 A;  1Q8S A;  5H9P A;  5FYM A;  4CDW C;  4QGN A;  4CSW A;  1ZRD A;  2UY9 A;  2A3Y A;  4BZ4 A;  2PAK A;  5JPN B;  2W92 A;  4YRD A;  1LOC A;  2E7A A;  2ERF A;  3VDD C;  1QJU 3;  1RUG 1;  2WDB A;  5HV4 A;  1YFU A;  5T54 A;  3WNK A;  1DLC A;  1W0P A;  4YVS A;  1OOP A;  3IB3 A;  2BJS A;  3WNM A;  1KRI A;  2Y60 A;  5FZB A;  1CN1 A;  4I0B A;  5FZI A;  2VVE A;  2W0X A;  4UYB A;  2EAA A;  4IEZ A;  1OVP A;  3OUI A;  3TYJ A;  4CU9 A;  5EFU A;  4AI2 A;  5FMC A;  2XR4 A;  1Q8V A;  5F32 A;  1VBE 3;  2YYO A;  5C4W B;  1WWY A;  3I2D A;  5FLI A;  4P5H A;  1ZBA 2;  3E6B A;  4DUW A;  1PX3 A;  1GWK A;  4IQP A;  4JX0 A;  1H30 A;  4R9D A;  1R1A 2;  1QJY 3;  3MIG A;  2EXJ A;  5B2G B;  2VW0 A;  3KLS A;  3VZO A;  5IW0 A;  3FLT A;  5CBL A;  1O4T A;  5A1L A;  3ZSE A;  2QQI A;  4D6Q A;  1K5M A;  3I59 A;  3LDR A;  1BVV A;  3ZYJ B;  4CUB A;  2VTX A;  3IPV A;  1XE7 A;  4LLF A;  1XOY A;  4OUS A;  3ZFE C;  4CU8 A;  2YDE A;  5JIU A;  1PGL 1;  3UJO A;  2O8O A;  3N36 A;  3IWZ A;  5LRS A;  3JBG 1;  1WCQ A;  2B4K A;  4V2V A;  1FNZ A;  1RUI 3;  1X8M A;  5JR2 A;  1AJK A;  1GOF A;  5FMB A;  2DVB A;  2O8Q A;  4BQ4 A;  4Z1V A;  4AED C;  1C8M 2;  1RHI 1;  5A6Y A;  3FUO A;  3HOB A;  2VOT A;  1AR7 3;  1HJF A;  2YB7 A;  1ZA7 A;  3J7H A;  4YM0 A;  2NM1 A;  4MHR A;  2TUN A;  3NJX A;  3B5L B;  5FXZ A;  3NV4 A;  5D8A B;  4Y1U A;  2F17 A;  1WA6 X;  2IVJ A;  4COU A;  1C1L A;  4HKL A;  2ILM A;  3PJQ A;  5L7O B;  3M2M A;  4BE3 A;  4DRR A;  1SCS A;  1RUJ 1;  4LNV A;  2RR1 3;  4AW7 A;  1GZW B;  1LOD A;  1PM7 A;  4M3C E;  5K9Y A;  3CZJ A;  4XW3 A;  4LK7 A;  3VBF A;  1GFF 2;  2R1B A;  3K3O A;  2WQ8 A;  5K7P A;  4YG6 A;  3ZVX A;  5CFC C;  3F95 A;  2FCT A;  4NR1 A;  3WG4 A;  1YYN A;  5C6C A;  3S30 A;  3O1P A;  2CAV A;  4KQ7 A;  5EXO A;  1BBT 2;  1HQN A;  2ZMN A;  5FZM A;  5K0U B;  5C3S A;  4LPL A;  1HV0 A;  1A34 A;  2OT7 A;  5IK5 A;  4D7Y A;  1AYM 3;  5LA2 A;  1ASJ 1;  3H1W A;  5JPM B;  5BNP A;  1YUD A;  1GOG A;  2A73 B;  1DHK B;  3PHM A;  3ZXL A;  3NW4 A;  4QQO A;  4RGK A;  3J4U H;  1DZT A;  2FMY A;  3ATG A;  2ENR A;  1TZO A;  2ZAB A;  1EPW A;  1F5F A;  2WNE A;  4IES A;  4QX3 A;  1CWP A;  1ULD A;  3HD8 B;  3NNF A;  3RMY A;  1SFY A;  3HNY M;  4QGL A;  4OQ8 A;  2RDR A;  1AR8 3;  2ZEX A;  1QY4 A;  4RHV 1;  2JEM A;  5FZ1 A;  1SLI A;  1HB4 A;  5LBE A;  3MEP A;  5IK7 A;  3WDW A;  1E5R A;  1OPO A;  2IXJ A;  2XG3 A;  1LED A;  1LKN A;  3CLP A;  4HK8 A;  4L92 A;  4GMP 1;  2VZP A;  4QPI B;  4ISQ A;  3WP5 A;  5AC9 2;  1W39 A;  4YFW A;  4ARY A;  2DBN A;  3AMM A;  2VZV A;  4PDW A;  4TWT A;  1O4Z A;  5E1R A;  2WNU A;  1OD5 A;  3QBQ A;  2JDK A;  3VKO A;  3ZFF C;  1OT5 A;  2JD9 A;  3AZW A;  5CFC A;  5JVV A;  1YFX A;  4H14 A;  2YMZ A;  4NPL A;  2FZ1 A;  3POS A;  4Y5S A;  3ZSJ A;  3V0A A;  2G9Z A;  5FYH A;  2WWU A;  1XE0 A;  3C7O A;  3P6B A;  3W5M A;  3PIJ A;  1MZ6 A;  1J3P A;  3BTA A;  5LWB A;  4XFA A;  3IM0 A;  1UZV A;  3OGG A;  5FLH A;  3BGA A;  3OUJ A;  1PHM A;  3IIA A;  5FMO S;  5CFD C;  5FUI A;  3B69 A;  1UKR A;  5GLU A;  1QXJ A;  1BCX A;  2HYK A;  2VMF A;  1C3H A;  2QJV A;  4OHV A;  4WVV A;  1TMF 3;  2AGS A;  3S0M A;  3KCX A;  1R1A 1;  1GKB A;  4XCA A;  4QX2 A;  3DL3 A;  4Q0V A;  4BQX A;  2A75 A;  2JXA A;  3K4D A;  1KGY A;  2CYF A;  4UW4 A;  1RIN A;  4ZU4 A;  4EZ4 A;  1XSR A;  4QDQ A;  2GP3 A;  2L9L A;  4ATF A;  3ILR A;  3MLK A;  1PNF A;  4BYY A;  1K45 A;  3U0Z A;  5BYN A;  1JI6 A;  2IFR A;  1U5Z A;  2Y64 A;  3GF6 A;  2WC2 A;  4A6S A;  1VLN A;  4TXW A;  4KBB A;  3BU0 A;  4PQQ A;  1AXZ A;  3K4A A;  4DIN B;  1N1V A;  2ZPX A;  3AKS A;  3BI3 A;  3PIG A;  4N8M A;  3TWI A;  4BMB A;  2ZX1 A;  1MS8 A;  5JDB A;  3ZFF A;  5FKC A;  1OH4 A;  2ZEY A;  4QPW A;  1LEN A;  3KM5 A;  1F5J A;  3DKQ A;  5FYU A;  3RFR A;  4CTE A;  2JG8 B;  3LA7 A;  1ZVF A;  1C8M 1;  2BOI A;  4IE4 A;  1A78 A;  4H55 A;  4M0N A;  4KMQ A;  2FDI A;  5JXI A;  5KWR A;  4HLT A;  5A32 B;  3V64 A;  4OI2 A;  1M4W A;  1OA3 A;  3ACF A;  1NA1 C;  3Q9O A;  1NLS A;  2PYT A;  3IT8 A;  5CFD A;  4OHX A;  2R49 A;  2ZGL A;  2XKO A;  3OYW B;  2RVA A;  4RSU A;  5D2A A;  3GCW A;  3VGI A;  5FP4 A;  4PIY A;  5T55 A;  4AVC A;  4OHY A;  1N3O A;  2E33 A;  3K77 A;  2A5Z A;  1UIJ A;  2BW8 A;  3KV9 A;  3ZYH A;  1ZRE A;  2Q1F A;  4BXF A;  3C3V A;  4MGZ E;  3WQB A;  4GWN A;  1TQ5 A;  2XBO 2;  3KF3 A;  2XVK A;  2Q8D A;  3RDI A;  2VY0 A;  3MV0 1;  4M3C A;  2QQM A;  2RS5 2;  4N53 B;  2VG9 A;  5GZE A;  4MOA A;  1JW6 A;  3DPR B;  2YC2 A;  3S6P A;  5C9A C;  4Z2W A;  4A2U A;  2VUA A;  2MEV 2;  4LEJ A;  4KG8 A;  2OZ6 A;  2VCM A;  1BBT 1;  4NRP A;  2VPV A;  5GZG A;  4QX5 A;  2DCY A;  4ZXE A;  4AFM A;  2XJU A;  3CO2 A;  3M3Q A;  3AK0 A;  1CES A;  1PMJ X;  3DYP A;  1RUD 3;  3NKG A;  4JKM A;  3O1S A;  1TE1 B;  4EWE A;  2X5I B;  3E97 A;  4AG4 A;  5HV0 A;  5SV5 A;  2DCZ A;  1RUF 1;  1LHN A;  5DG2 A;  2A71 A;  2WT0 A;  1B35 B;  3N35 A;  3N7J A;  1GNZ A;  4LBM A;  1DLL A;  1YWK A;  1LR5 A;  5A3M A;  3U07 A;  2TBV A;  4Q4Y 2;  4XZP A;  4QX8 A;  3U10 A;  1XU1 A;  4XUT A;  3CL1 A;  4XIK A;  3VBO A;  2PLV 2;  4XXP A;  2DV9 A;  5C8C B;  4ZHN A;  4X8P A;  3MFC A;  3TB0 A;  5AC9 1;  4K3U A;  1JZ8 A;  3OEB A;  2QDR A;  3POY A;  4IEP A;  3DYM A;  3M4F A;  1SPP A;  4XCB A;  4IV1 C;  3VBH C;  3UKV A;  1PVC 3;  2LAL A;  3MIH A;  4D7T A;  5T5O A;  5IHR A;  2WJS A;  4PLO A;  5JLV A;  5L9V A;  2WFF 2;  2ZGS A;  2D5F A;  3TEZ A;  5A6X A;  4RQP A;  5H9Q A;  2ADE A;  1TME 2;  5CG8 A;  1E5I A;  2BBA A;  1NAE A;  4NAO A;  3T2O A;  5C5U A;  4OMD A;  5FZ3 A;  3OTF A;  5IVB A;  1GOH A;  3N9L A;  3H3U A;  2HWF 3;  3N9O A;  2FCU A;  2EXI A;  4CXW A;  1H6Y A;  3GAL A;  5GM0 A;  1FMD 2;  4A3Z A;  2RG4 A;  4PIZ A;  2RDS A;  1AYN 3;  5ANN A;  4KU7 A;  3ZFG A;  2V5D A;  5I0R A;  4JDM A;  3GCX A;  1H2L A;  4N7I A;  4HN1 A;  2X53 S;  5BNP B;  1K5M B;  4AAX A;  3BTZ A;  5K4L A;  3WP6 A;  1YC6 1;  5BNN C;  1Q3E A;  4GIQ A;  4QX7 A;  5C33 A;  3E5U A;  1K3I A;  3M3I A;  3WD5 A;  5FZ6 A;  1VBC 1;  2G1M A;  5FWE A;  3LFM A;  3GZA A;  1G9F A;  2HWB 2;  5T5L A;  3RWK X;  1L7Q A;  4CDW B;  1EV1 3;  4YW4 A;  1JYI A;  4IE0 A;  5EYX A;  3HEI A;  2B8M A;  5FYS A;  3VD5 A;  3HWJ A;  3N9M A;  4Q4V 3;  5E88 A;  1CPM A;  1ZZ8 A;  2BQP A;  2GU9 A;  3VDD B;  1HXS 1;  3PU3 A;  3VBH A;  3H8U A;  4BQ1 A;  4EQV A;  2WRA A;  1RJ8 A;  3KGZ A;  3CDZ B;  3I2H A;  4SLI A;  3PUQ A;  1APN A;  4JDO A;  5GLV A;  1ND3 C;  2ZHK A;  4QU2 A;  4UT5 A;  3HN3 A;  3PVB B;  5JOY A;  3RMX A;  2TNF A;  3C8X A;  4JCK A;  5LW9 A;  3RYR A;  1AF9 A;  3DEM A;  3PU8 A;  1N1T A;  4AHX A;  1SFP A;  2ZX4 A;  4BDV B;  1RUN A;  2WT2 A;  2XQR A;  2NMO A;  4GMP 0;  5DZG A;  2VQU A;  1Y7B A;  4AI0 A;  2D3S A;  1XBF A;  5B4N A;  3HR9 A;  2WII B;  2WUH A;  2Y8K A;  1IKQ A;  2D43 A;  1EPZ A;  2R1D A;  4E4S A;  5IFT A;  3JD7 3;  4XFI A;  2BYV E;  2B5H A;  4IUG A;  1AX2 A;  4XIO A;  1JN2 P;  4XPV A;  4P9L A;  5BNN A;  2BWA A;  4BQY A;  3WNX A;  2XBO 1;  1JUI A;  5J37 A;  4FAG A;  1LAJ A;  2RS5 1;  4DQA A;  3VV1 A;  3ZFE B;  4O65 A;  1J83 A;  2GMM A;  3BIW E;  3IAP A;  2MEV 1;  5BNQ A;  1EP0 A;  4JC1 A;  2QQJ A;  3VLB B;  4P14 A;  2DU1 A;  2QVS B;  3I4I A;  3ZDV A;  4AXO A;  1NCR C;  1R08 2;  3R4U A;  5FXV A;  4BOW A;  2KA3 A;  2A70 A;  2QE3 A;  4FTE A;  4LTA A;  4LUL A;  1LOF C;  4AED B;  5J1X A;  1UXZ A;  4AEM A;  4IEY A;  3U4X A;  1VRH 3;  1X33 A;  1N47 A;  2J42 A;  3I2K A;  3KQ4 B;  3OSD A;  3RPQ A;  3TAY A;  1GU3 A;  4DEQ A;  2QUO A;  4P9X A;  3HN1 A;  3SH3 A;  4PF5 A;  2ARC A;  2ET1 A;  3BTX A;  3N7K A;  4Q4Y 1;  3BOP A;  4HOO A;  4HVR A;  1POQ A;  2WNV A;  4NWW A;  4EN0 A;  1OQD A;  3VZM A;  1PIV 2;  1ZNP A;  4BH9 A;  5L9B A;  5T5P A;  2VMC A;  2PLV 1;  2VTF A;  4ZZ5 A;  4FPK A;  2GC2 A;  2WSU A;  2LS6 A;  3PUH A;  5FY0 A;  1XND A;  3WDV A;  3WQ0 A;  3ZN6 B;  1RUC 1;  3O1M A;  3ZXD A;  3R05 A;  2AYH A;  4BLJ A;  4ITC A;  2VL4 A;  4DXS A;  5IVE A;  1CPN A;  2ZJC A;  1IG3 A;  2YUE A;  3IDE A;  4ET7 A;  2E31 A;  4UFI A;  2G9F A;  4LOS A;  1NXD 1;  2WFF 1;  3ZOI A;  1HJG A;  3ZXE A;  4BCU A;  1SLL A;  3A0N A;  2FDK A;  4BIO A;  3T4H B;  4QHB A;  4QT6 A;  1SEF A;  5LCW L;  2ZAA A;  4CDQ C;  2GP5 A;  3KSC A;  2ZX3 A;  3KQR A;  5FJK A;  4H7L A;  4MG2 A;  3AYA A;  1OFN A;  1NCR A;  2OUH A;  3MIC A;  5BY5 A;  2WAO A;  1HW5 A;  1IS6 A;  2DU0 A;  1UU5 A;  2PHU A;  2R07 3;  4XDO A;  1PMI A;  5FYZ A;  5LA9 A;  2Q8O A;  1RUG 3;  2VZ1 A;  1DZQ A;  4QDR A;  4P08 A;  1JBC A;  2SBA A;  4EZH A;  2BNN A;  2GMP A;  2IXK A;  4HBN A;  4QHO A;  1S0D A;  2GAL A;  1LOA A;  1SBF A;  2PHF A;  3WG1 A;  2DUP A;  1W6O B;  4MV2 A;  4UW3 A;  4YGB A;  3WQ7 A;  2YZ4 A;  2WKK A;  4NHY A;  1NX9 A;  1L7R A;  2VC9 A;  3IMN A;  3K48 A;  3I54 A;  5D8A C;  1V0A A;  5DUU A;  4C90 A;  2GNM A;  1QKQ A;  3PUR A;  5C4W A;  5LBF A;  4FI9 A;  3OBR A;  2H0V A;  1WW5 A;  1PZ8 A;  2Y33 A;  3J7M A;  3D82 A;  5A1A A;  4CEW C;  1FOD 2;  1OLM E;  4Q5O A;  1L7L A;  4OZX A;  1OMI A;  1GNH A;  3IN9 A;  4K7J A;  1S0B A;  2DFC A;  5KHJ A;  1QQP 2;  4KH9 A;  1U5Y A;  1ODN A;  5F7U A;  1CGP A;  1YIP A;  4BME A;  1UZ0 A;  4LLO A;  4NVP A;  3ZKU A;  5CFD B;  4RD7 A;  3EB7 A;  3LD8 A;  3WNO A;  5K0U C;  2VUJ A;  3JBG 3;  3TEY A;  3AXD A;  1VJ2 A;  4NPR A;  3SCH A;  4C0H A;  1JYT A;  2WQZ C;  1C57 A;  1NYW A;  1WD4 A;  2WQ4 A;  1ODM A;  1HB1 A;  2VZU A;  2CSG A;  2OPW A;  4B1M A;  1ZX5 A;  2A6Y A;  5FJH A;  4GWI A;  3WP3 A;  2WZP P;  1PO1 1;  2Y0I A;  3OPT A;  3ZYR A;  4Y1X A;  5DQ0 A;  4QXK A;  4AQT A;  3LWC A;  3NNM A;  1AR6 2;  4ERO A;  3L9J T;  4BQ3 A;  4P00 B;  1W9T A;  1S0G A;  4HG6 B;  5D8A A;  1ST8 A;  1VP6 A;  4XBL A;  2JEC A;  2VBB A;  4GUL A;  5FMD A;  1RUJ 3;  3HNB M;  4NHX A;  5L7O A;  1JHJ A;  1FT9 A;  1UX6 A;  2D6O X;  4I0W B;  4JQT A;  3U11 A;  4FPF A;  3RG0 A;  1OKO A;  4XUO A;  3BN6 A;  1GZW A;  5C3Q A;  4XAB A;  1WLC A;  1GZC A;  3QH7 A;  4KGG A;  4LIT A;  2VJX A;  3W21 A;  2A6X A;  3D6E A;  4J1X A;  1NA1 B;  2ZGM A;  3GBF A;  4AVA A;  5JCT A;  2D44 A;  1RUE 2;  1ALY A;  2HBU A;  4HL0 A;  4A7Y A;  3ZPO A;  1QNW A;  1IPK A;  5K0U A;  4UFH A;  1SBE A;  4TLF A;  3UES A;  3S7I A;  3VL9 A;  4EYU A;  1LU2 A;  1PIV 1;  4A44 A;  1PK6 C;  1S1A A;  2YGL A;  5LK7 B;  2BWC A;  3C7F A;  2IFW A;  3E5Q A;  4NID A;  1DBN A;  2JIJ A;  2VEC A;  1GBG A;  3IZO A;  1Y43 B;  3S57 A;  4CU7 A;  4Q8L A;  5C9A B;  4EN6 B;  3NV2 A;  5IAV A;  3WVJ A;  5A3U A;  3PJY A;  3TNQ A;  4RHV 3;  2EIG A;  4FAH A;  3E6C C;  1BMV 2;  2UWB A;  1RVF 2;  3LQC A;  5FPU A;  5JXH A;  1W0N A;  2E32 A;  4BPZ A;  2J22 A;  3DXT A;  3FE5 A;  1AUY A;  1MS5 A;  3D5O A;  4NHM A;  1NY7 2;  4GMP 3;  3RSJ A;  2I07 B;  2VW1 A;  4WM8 C;  2VMH A;  4QPI A;  4P9Y A;  2RE9 A;  1AR9 2;  1COV 1;  4XHX A;  2GNB A;  5LB6 A;  1ZRC A;  3DYO A;  1ZA4 A;  3ILF A;  3MPP G;  1Q43 A;  1QJZ A;  2RDN A;  1R09 2;  4URT A;  1W28 A;  2GC0 A;  4AGR A;  2BNM A;  3WF4 A;  1UOJ A;  1YI9 A;  3V65 A;  1G9B A;  1LOB A;  2JG8 C;  4K6B A;  2KD7 A;  3AZV A;  3KT4 A;  4LE3 A;  5FR3 A;  1H8V A;  5FZO A;  1YQ6 A;  3KV5 A;  4FP2 A;  4OUL A;  5FO7 B;  4D94 A;  2HYX A;  4HET A;  1SCR A;  5KC5 A;  2BP6 A;  1BEV 2;  4PQ9 A;  4UI9 L;  4C1W A;  2NPI A;  3MGU A;  4FCA A;  4K1Z A;  4K8R B;  5CNA A;  1R1A 3;  3LB9 A;  1GZT A;  3Q8C A;  4IV1 B;  4XF0 A;  4L2N A;  4MGQ A;  1GLH A;  2WA4 A;  3MLJ A;  4CEY C;  3MV1 1;  4QXH A;  4JGZ C;  3WDY A;  5KHH A;  5LRR A;  4Z07 A;  1S0C A;  2HWD 2;  1XYN A;  1MZ5 A;  5DN2 A;  1YFY A;  2WZ8 A;  3KWV A;  2JE7 A;  1CX1 A;  1JH5 A;  2VZS A;  1OLM A;  4XIL A;  3AKQ A;  4UOJ A;  1IQD C;  4Q2F A;  1X9P A;  4LBQ B;  1B09 A;  3NV3 A;  4HVO A;  4XEZ A;  2D6P A;  5A6Q A;  1DDL A;  1KFX L;  1UIK A;  4XAE A;  3THC A;  1XNA A;  4A6O A;  1LTE A;  5CKN A;  3ZYB A;  4UW5 A;  4C1X A;  2Z69 A;  4GKY A;  1PO2 2;  5D21 A;  2RS3 2;  3WDX A;  1NE4 A;  3RZZ A;  1RB8 G;  3AM2 A;  2JJ6 A;  4S2G A;  1BKZ A;  1C8M 3;  1ENX A;  1KIT A;  1W2U A;  1JOP A;  3O5S A;  1RC6 A;  4Y26 A;  3SIT A;  2JG8 A;  1US2 A;  1QNY A;  1ZBE 2;  4XTP A;  2EIE A;  1AR6 1;  5A32 A;  3AMN A;  1YQC A;  4GKX A;  1SLC A;  4W50 A;  5SV8 A;  2PXJ A;  3LF7 A;  4RFT 0;  2UWC A;  4COV A;  3A4U A;  4AFB A;  4YPJ A;  5FUP A;  3OYW A;  1P8J A;  2XHN A;  2XXZ A;  1AXY A;  4XAA A;  1WD3 A;  2DCJ A;  3IKW A;  2VZ3 A;  2A6V A;  1AX1 A;  2JDU A;  2QQV A;  4MO3 M;  5FMO L;  2ZGQ A;  2FDH A;  1ND3 B;  1W8U A;  3O1T A;  4FPC A;  2VVF A;  3WX5 A;  5L19 A;  1UD1 A;  4N53 A;  3DPR A;  1RUE 1;  1BBT 3;  1YQ8 A;  2YBK A;  3T4V A;  1RMU 2;  4CU6 A;  3HBK A;  1MVQ A;  1W2N A;  4NUB A;  4LO8 A;  2W46 A;  4V2W A;  2UYA A;  3VBS B;  5EPA A;  1X50 A;  4CXX A;  5E89 A;  1XRU A;  3PDQ A;  2KR2 A;  4AHW A;  3VDA A;  2X5I A;  3RJR A;  2LM3 A;  1XNK A;  2P34 A;  1RUF 3;  1W9Y A;  1IQA A;  1SG3 A;  5DUW A;  4S2F A;  1HV1 A;  2GC3 A;  5EJZ B;  1B35 A;  1W8W A;  2H6B A;  5LK5 A;  1O59 A;  4Y1V A;  3ZYF A;  3NMB A;  4NII A;  1C5H A;  2FD8 A;  3PTR B;  1BMV 1;  1NCQ C;  2VNG A;  1VBB 2;  2UYB A;  3R0R A;  3VZJ A;  1H1I A;  1XNC A;  3LPF A;  1NCR B;  1PM4 A;  2PHR A;  4XJW A;  5C8C A;  5FO8 B;  5AC9 3;  5IT6 A;  2MHF A;  3USU B;  2X10 A;  5JUV A;  1T6G C;  5JAX A;  1AR9 1;  3K46 A;  3SEE A;  5JZG C;  1KDK A;  1Q5O A;  4ZS2 A;  2ZOE B;  5FZC A;  1C8N A;  2Z2S B;  1UW8 A;  2WZR 2;  1X9T A;  3BU7 A;  1V00 A;  2KXL A;  3H1Y A;  2YHJ A;  2I74 A;  3ELN A;  4BWO A;  2Q4S A;  1DGR N;  4AQ6 A;  3ENR A;  5T3N A;  1KD7 A;  3GBG A;  5DAW A;  3OGS A;  2GSY A;  5HI0 A;  3AYC A;  1ZM1 A;  3O0V A;  1BEV 1;  5ABJ B;  1GQG A;  1W8N A;  2LRP A;  2QZ3 A;  2XKP A;  4P9G A;  1OF3 A;  5FK8 A;  2AAC A;  3FWE A;  3WY6 A;  2YC0 A;  1XE8 A;  4YNI A;  4K8F A;  5FPV A;  1HRV 1;  2ATF A;  1AVB A;  1VBC 3;  4BU2 A;  1HX6 A;  4V1P A;  2H0B A;  4YVW C;  3OJB A;  2YPJ A;  4CDQ B;  3N4M A;  5A7W B;  3L2H A;  1TEI A;  5CIS A;  1UYY A;  4CDW A;  4Q26 A;  2ZEW A;  2K2S A;  4EJR A;  4IEV A;  2WS9 2;  4L11 A;  4QX0 A;  1HXS 3;  5DUX A;  2C1F A;  1VAM A;  3TRS B;  3VDD A;  4MGI E;  1A6C A;  1J58 A;  1PO2 1;  3RZM A;  2JD4 A;  3LPG A;  3PTY A;  4FFG A;  4ORF A;  5F5Q A;  2VVD A;  2XON A;  1XB9 A;  4FT8 A;  3SKV A;  3X29 B;  3O1V A;  1IPJ A;  4XF9 A;  2WYS A;  3JZV A;  3FBM A;  3VL8 A;  3OBA A;  5A70 A;  4BQW A;  5HPO A;  2OVU A;  3T2P A;  4X6R B;  3SXW A;  1OUX A;  5FZ0 A;  4MXW B;  4Y3O A;  2J1E A;  2VO5 A;  4XHB A;  5LEJ A;  2ARX A;  2E51 A;  4A41 A;  3VKM A;  1QJX 2;  2WLQ A;  1REE A;  5BUV A;  4Z82 A;  5FZD A;  3WF3 A;  4CEW B;  5APA A;  2GH8 A;  1HB2 A;  2ZKN A;  4CPB A;  3POE A;  2YBP A;  1W6M B;  3SEP A;  2XBO 3;  4AFA A;  2YG0 A;  3HQR A;  4MHU A;  3BAL A;  2RS5 3;  1EAH 2;  1DGR A;  1ZZB A;  1W6N B;  2CGN A;  3N9Q A;  1VBD 2;  4KGQ A;  2BEO A;  4OUE A;  5A7N A;  2MEV 3;  3A23 A;  3ZFE A;  1W9F A;  3AFK A;  4ES9 A;  4TZD A;  3CBN A;  2IUW A;  2P3I A;  4BIS A;  1W8Z A;  1UU4 A;  4CCL A;  4MAD A;  1NT0 A;  1W9S A;  1URX A;  3B02 A;  4KG0 A;  2ZA9 A;  1XC6 A;  4LR4 A;  3H42 B;  2R7E B;  2N7G A;  5G04 L;  1Q56 A;  1VIW B;  3T1M A;  4COY A;  2PTM A;  4E27 A;  1WCD J;  1V70 A;  4GB3 2;  4HMZ A;  4AED A;  3TN9 2;  4DPN A;  3N9P A;  3VD3 A;  4XDP A;  1O3T A;  1NXM A;  2J1R A;  3VD7 A;  4UAP A;  1UOG A;  1WLD A;  4Q4Y 3;  5FLJ A;  4BB3 A;  4FSJ A;  3H0O A;  1HRI 2;  4YZ3 A;  1G6N A;  1VBB 1;  2PLV 3;  4RS5 B;  1V6K A;  3VD9 A;  4D0Q A;  1RUC 3;  4PIX A;  2W1W A;  1LHO A;  2CDO A;  3KV4 A;  3RI8 A;  1Z7S 2;  4UXA A;  2ARB A;  4QHZ A;  3ZN6 A;  4Q0Q A;  3LE0 A;  5FY1 A;  3VHP A;  3MW2 A;  1QHD A;  3KT7 A;  1UOB A;  3PME A;  2VOW A;  1V6I A;  4HPK B;  2WFF 3;  1AL0 G;  4KL1 A;  1QDC A;  5FZO B;  3EO6 A;  3F2Z A;  5FRE A;  1UZY A;  3ES4 A;  5TSW A;  3RS6 A;  3I7D A;  1MZF A;  4Q4X 2;  5FXW A;  2Q30 A;  5C71 A;  3OBZ A;  1PK6 B;  1D4M 2;  1HB3 A;  3EMR A;  4DB5 A;  1XSQ A;  5FZG A;  4UFK A;  1WUV A;  5CU1 A;  1ZBA 1;  2HH9 A;  4DXZ A;  4GJY A;  5EIY B;  1ZZ9 A;  3T3Y A;  1Q8Q A;  4AI1 A;  5C7G A;  1IG0 A;  1FAY A;  1KS5 A;  4QAW A;  2XOM A;  1DIW A;  1OSG A;  1FX5 A;  3U1X A;  4Q4W 2;  1UMZ A;  1LJ7 A;  3LSE A;  2JX9 A;  3PVO A;  1PZ9 A;  5JOW A;  3WHT A;  1CZS A;  3D0S A;  1W6O A;  2LRO A;  3S5Q A;  4WM8 B;  4YG0 A;  3KMH A;  3B9I A;  1VBE 2;  1K12 A;  1GP6 A;  1SMV A;  5EP9 A;  5C3P A;  2YFZ A;  4A7Z A;  2WWS A;  2WBK A;  1NZC A;  1QJY 2;  1LUL A;  3P1I A;  4R9A A;  1I5P A;  1GQH A;  1BK1 A;  2WS9 1;  3HVD A;  3VN4 A;  2BRT A;  1OQE A;  3P5B A;  1WBL A;  4XBQ A;  5CG9 A;  4JGY B;  1VB4 A;  5HCF A;  2QQO A;  4IEQ A;  3Q8F A;  4LQR A;  1OC1 A;  3E6D A;  1K5J A;  2IXL A;  4HSL A;  2Q1M A;  1E5S A;  4ZS3 A;  5A7Q A;  4AAP A;  1U5I A;  3J7L A;  2OPK A;  3AFG A;  1SAC A;  1VR3 A;  3QLQ A;  1TG7 A;  2E26 A;  3J7N A;  4GXL A;  3WV6 A;  4CYD A;  2QBX A;  1LEC A;  1FV2 A;  1HQW A;  3FC0 A;  5GLZ A;  2XPJ A;  4ZU7 A;  4UFJ A;  4CA9 A;  1O6U A;  2OA2 A;  2OS2 A;  1WW4 A;  2PAM A;  2HWE 2;  3M70 A;  1RUI 2;  3OPZ A;  4FFF A;  1XNT A;  1NKG A;  1E57 A;  1CVN A;  4NRQ A;  3UV9 A;  3H1M A;  1NLR A;  2E9Q A;  5FV3 A;  4CEY B;  4DO0 A;  1QJX 1;  4JGZ B;  5CEH A;  1CQ9 A;  4O9G A;  4AVT A;  1PO1 3;  1J59 A;  1YJL A;  1UOF A;  3ACH A;  3U4S A;  2BV4 A;  1IHM A;  2MPF A;  1ZYB A;  2Y6G A;  3ZN4 A;  4LXL A;  5A7S A;  3UKN A;  2YU2 A;  3ZX7 A;  4QM8 A;  4CCJ A;  4ONU A;  4IL7 A;  3VHR A;  5LZ6 A;  2CGO A;  4HN0 A;  4AEK A;  1LCL A;  1LGC A;  2A6W A;  2ARE A;  4D8M A;  2WR9 A;  3MUY 1;  2IVI B;  2RR1 2;  3FX3 A;  4XFF A;  3A21 A;  1VAK A;  1QH7 A;  3POF A;  3SH5 A;  3EYP A;  4LO4 B;  5G05 L;  5A3O A;  4IGQ A;  2V5Y A;  3RVH A;  2C9A A;  4BHP A;  4IV3 C;  3ZXF A;  3TN9 1;  3DN7 A;  3M3E A;  4FPE A;  4LBK A;  3AB0 A;  5CZK A;  3S5A A;  5F3G A;  4X6Q B;  2VNV A;  4YZ5 A;  3MZH A;  1NA1 A;  3FBY A;  3ZSK A;  4XQW A;  4YAR A;  4PBO A;  3WF0 A;  4OQ9 A;  4DZG A;  2IWG B;  2RJK A;  1PIV 3;  1HRI 1;  1LEM A;  3ON7 A;  3Q8E A;  3GYD A;  4HKO A;  1JUH A;  2QNK A;  3WZ1 A;  1S0F A;  2W5F A;  4QXC A;  4XMI A;  4LIU A;  3O0X A;  4MUV A;  2YU1 A;  1F31 A;  1H8T C;  2XDV A;  3JUU A;  3MW4 A;  1FXZ A;  5K8S A;  1G86 A;  1S0E A;  2R0F A;  4P9I A;  5FZ4 A;  3ZR6 A;  3WEZ A;  1YCI A;  2FDF A;  1N3Q A;  2VMI A;  4QQL A;  3AXE A;  5C9A A;  3WIN E;  3ZYG A;  2UY8 A;  3POG A;  3K51 A;  1H9P A;  3O1U A;  4QQ2 A;  4HSJ A;  2ADD A;  5C70 A;  2AC1 A;  5DG1 A;  2ZML A;  2OQ7 A;  5GLT A;  4B7E A;  2D6K A;  2JDH A;  2VZO A;  2Y0O A;  1N1Y A;  4AI9 A;  3MBW A;  1D4M 1;  1ENR A;  1COV 3;  1UY0 A;  4YW7 A;  4ZU5 A;  3TEW A;  3PL0 A;  2DCK A;  2R32 A;  4MXV A;  2DCT A;  2NLR A;  1ND2 B;  2IXH A;  1H2K A;  5L9R A;  4ZXK A;  4CCK A;  3RZK A;  5FP9 A;  2VNO A;  1DP0 A;  1W03 A;  3NRU A;  1H2M A;  3B3Q E;  4Q4W 1;  1BVP 1;  1DZR A;  1KS4 A;  2PAE A;  1NCQ B;  2LTN A;  2RS1 2;  3NAP C;  2EIB A;  4YZ1 A;  1RJ7 A;  3EJK A;  4NAM A;  2RJL A;  1NZI A;  2D93 A;  3I3Q A;  3KZ4 C;  2HEY F;  4P9W A;  4AGG A;  1OLQ A;  5JZG B;  2FZ2 A;  1JOJ A;  1PGW 2;  1Y9Q A;  5LY1 A;  5FQ0 B;  1H8T A;  3AL6 A;  4IV1 A;  3ME2 A;  5FZ9 A;  1UKG A;  4BQ5 A;  1YRZ A;  3UL2 A;  3WLU A;  3H8R A;  3CJX A;  1NE6 A;  3DEC A;  2FBE A;  5DZF A;  1W04 A;  2BZD A;  2G9G A;  2O0O A;  2V4A A;  4KWL A;  3K75 B;  5E16 A;  3NJV A;  4R9C A;  2AZ5 A;  2QZ2 A;  3LIG A;  5C3O A;  3III A;  1Y3T A;  2JDA A;  2ZGO A;  3FUQ A;  5F6K A;  4LBQ A;  5A3N A;  2ZXQ A;  4Q0P A;  4QB6 A;  2D6L X;  2HJI A;  2HWE 1;  4N9I A;  3VBS C;  1UMH A;  5I0S A;  2RJ2 A;  2VD7 A;  1VBA 2;  4LIV A;  3LOB A;  4GH4 C;  4LHK A;  3QD6 A;  1REF A;  1FPN 2;  2CWM A;  1QU0 A;  3AP5 A;  1CAW A;  2JEN A;  3WHU A;  5CA6 A;  3BUC A;  1QH6 A;  1U5X A;  5F9T A;  1U0A A;  2WNO A;  4YVW B;  1AR6 3;  5GZF A;  5KHG A;  1RUH 2;  3V0B B;  2V09 A;  4OI1 A;  5FYT A;  1I9R A;  3MHZ A;  5DAQ A;  5IVY A;  3WCS A;  4GQ7 A;  4AOC A;  3SMH A;  3INA A;  1UZZ A;  3GHM A;  4JRA A;  3WSO A;  3VZL A;  3OBT A;  1ZRR A;  2CY6 A;  3W59 A;  3WXP A;  5IVV A;  5FY7 A;  4CP9 B;  3UKT A;  5FZH A;  2GH2 A;  3M7A A;  5CB7 A;  3ZMN A;  2JIC A;  3H7Y A;  4YLZ A;  4B4P A;  1UF2 C;  2PA7 A;  2ID4 A;  5FP3 A;  1AHS A;  1XPW A;  4LBO A;  4F7Z A;  5FPA A;  2FDJ A;  3UNP A;  1ND3 A;  4FFI A;  1QJF A;  4BXS V;  5KHI A;  2XJR A;  4CDU C;  5A3W A;  2R04 2;  5FPZ A;  1RUE 3;  2PMW B;  3I2O A;  2FDG A;  2CWS A;  4YFZ A;  2ZTN A;  4Y22 B;  3O1R A;  2FCV A;  2EAK A;  2VMD A;  4PLN A;  2BFU S;  1YJK A;  2VXJ A;  1RUD 2;  3AYD A;  1OH3 A;  3VBS A;  3ZR5 A;  5ABJ C;  1H1A A;  1T6B X;  3KGL A;  4QWN A;  2QDN A;  4RGA A;  3C7G A;  1GUI A;  4LO5 B;  1DYK A;  3SH4 A;  1ENQ A;  4OI4 A;  1TME 1;  4YZ4 A;  2W47 A;  5F5A A;  2BU9 A;  3MID A;  4LKE A;  2VME A;  2E7T A;  4AF9 A;  4MH0 E;  2QFE A;  1FMD 1;  3H8X A;  4RYD A;  1KXG A;  4ZY9 A;  4DUX A;  1H4H A;  1O8P A;  4WVW A;  4XXA A;  2W1U A;  4Y20 B;  1WCK A;  1AR9 3;  2GDF A;  2R06 2;  4W4Z A;  5I0T A;  2DYC A;  1LOF A;  1W06 A;  1CZV A;  2PN5 A;  3USU A;  1CAU B;  4KWJ A;  3ZN5 A;  1O3R A;  2WA3 A;  3PMS A;  4I02 A;  2WO3 A;  3NL1 A;  4LOR A;  4AFC A;  1JS9 A;  3DUI A;  1AXK A;  1AL2 2;  1DQ6 A;  2RS1 1;  2G4I A;  4R9B A;  1KJL A;  2NN8 A;  3MDP A;  1DGW X;  5IVJ A;  1YNA A;  2HWB 1;  3B00 A;  1D7P M;  3UGF A;  2A7A A;  4CDX B;  1BEV 3;  4ZON A;  3KHC A;  2ZAC A;  3HT1 A;  2VCA A;  4JTN A;  2VQA A;  1DFQ A;  4E4D X;  5ABJ A;  1YIF A;  2YGM A;  4ES8 A;  3R6S A;  4Y4Y A;  4Y5T A;  1RUO A;  1SQ4 A;  5EJ1 B;  3RGB A;  3OB8 A;  3LOI A;  3HQU A;  4O61 A;  1HRV 3;  4PJY A;  1CON A;  4I3G A;  4F83 A;  1BJQ A;  4P02 B;  2GN3 A;  4TSV A;  1LES A;  2DTW A;  4AHZ A;  1LGN A;  3VBU B;  2Z5W A;  5C5T A;  4XFG A;  2X05 A;  1GNY A;  1EV1 2;  1W6P B;  4M00 A;  4CDQ A;  2BGO A;  4AZZ A;  3OY8 B;  2X8K A;  5A7W A;  1PX4 A;  1DF0 A;  4QDS A;  4Q1P A;  3GJA A;  4W6W A;  4DUV A;  4Q4V 2;  3UGG A;  2XJQ A;  5FZ8 A;  2CHH A;  4KU8 A;  3NJZ A;  5D1I A;  3OD4 A;  4NRO A;  2G19 A;  1ACC A;  3GHN A;  1PO2 3;  4XTM A;  4OI0 A;  1JMU B;  1VBA 1;  4R4Z A;  1RHI 3;  2IXI A;  2GZW A;  4L9B A;  1W8F A;  4LMF A;  1FPN 1;  2CDP A;  1RIT A;  1MPX A;  3ETP A;  2W94 A;  4YGC A;  4CP1 A;  4DRV A;  1DQ4 A;  1LHU A;  5FFO C;  1VE0 A;  4QKN A;  2Q8C A;  2WO1 A;  1XXN A;  4JKL A;  2B42 B;  2Y6H A;  4PCR A;  2YPD A;  4YW6 A;  3WDT A;  3ZKY A;  3FN9 A;  4CCO A;  2C9K A;  2EID A;  5KXC A;  1RUH 1;  3VDC A;  3WR0 A;  5ACA 2;  5F2S A;  2B39 A;  2PEL A;  3FLP A;  4NPM A;  3UK9 A;  1GQP A;  2DVD A;  2PHL A;  1ULE A;  3ZPY A;  2NYY A;  3KT1 A;  4MXW A;  4XUR A;  4RS5 C;  1UAI A;  3BTY A;  3ZSL A;  1AJO A;  4NOT A;  1R08 1;  5FRA A;  2WWJ A;  1JZ7 A;  3S7E A;  1CZT A;  4JKK A;  4CEW A;  1JOD A;  1N1S A;  1U12 A;  1RXG A;  3FJS A;  2ZKL A;  3BOW A;  3AL5 A;  1QOS A;  1H9W A;  1W6M A;  1MS9 A;  2W95 A;  1ZZ6 A;  2AH2 A;  5FBJ A;  3CJI C;  1W6N A;  4XZU G;  2R04 1;  4PHZ A;  1F35 A;  3ETQ A;  4IEX A;  4MX3 A;  5FYI A;  1PZ7 A;  4PLM A;  4DY3 A;  5BNO C;  4QPY A;  1XU2 A;  1V6O A;  3SCG A;  1JOB A;  4A7K A;  1ASJ 3;  4COZ A;  4D69 A;  3B01 A;  2JDN A;  2WYF A;  5LBB A;  4JAA A;  4QXB A;  3M8L A;  5F3E A;  3VZN A;  3WF2 A;  4I0A A;  3UYJ A;  5I8T A;  3BPS A;  3JB4 C;  1YQ5 A;  2XUE A;  3R4D B;  5LEK A;  3I2G A;  1I3H A;  4FVV A;  3FFZ A;  4LKS A;  1VRH 2;  1Q8P A;  4Q29 A;  4HVQ A;  1JYW A;  5DMY A;  4AQS A;  1OA2 A;  3RNS A;  1UCX A;  3AVS A;  1Y4W A;  4DFS A;  4M3C F;  5LAS A;  4WBB A;  2NQY A;  1O7F A;  1WKY A;  2WAB A;  4Q0U A;  1H0B A;  3RJ2 X;  1OF4 A;  1CAX B;  2VE1 A;  5DXD A;  2JG9 B;  2VUD A;  4RS5 A;  3E5X A;  3ES1 A;  4CUC A;  3P3P A;  3WUC A;  2P3Y A;  3LZZ A;  1WBF A;  4HFS A;  2R06 1;  4QX1 A;  2Y26 A;  4QKF A;  1YHF A;  3ZYP A;  4SBV A;  4FPH A;  2VBP A;  3CKH A;  5BXX A;  4IV3 B;  4Y1Z A;  3J8F 2;  2A6Z A;  3RYK A;  5JXG A;  4JGY C;  1X82 A;  2E53 A;  1HN1 A;  2C5D A;  1C4R A;  1GMM A;  4HPK A;  3JB8 A;  4IXL A;  5LAT A;  1WW6 A;  4I2O A;  2AR6 A;  2RM2 2;  1AL2 1;  1GV9 A;  3VKF C;  1AZD A;  4QPG C;  3JQX A;  4UW6 A;  4UF0 B;  4K21 A;  1ZZC A;  2BER A;  1PK6 A;  3DCQ A;  1ZBA 3;  1JZ6 A;  1KJR A;  4Z92 B;  1BLZ A;  5BPX A;  2R07 2;  1H8T B;  1PMH X;  2Y38 A;  3FMG A;  4UBH A;  5FYY A;  5FDB A;  5GZC A;  1Y9G A;  5F1R A;  4FOQ A;  4LBJ A;  1SLA A;  1I1E A;  2H6C A;  1FOD 1;  1GP4 A;  1W05 A;  5IFP A;  2K9Z A;  2ZCW A;  2PHW A;  4R8H A;  1QQP 1;  2CL2 A;  1HIX A;  2P6C A;  4IGP A;  1MQT B;  3PNA A;  2QQN A;  2YFU A;  3A22 A;  3UJQ A;  5F37 A;  2AEZ A;  2C26 A;  4JHT A;  3KF5 A;  4K40 A;  1MEC 2;  1WA4 A;  4WM8 A;  4OMC A;  3OGR A;  3AX4 A;  1VAV A;  1ZZ7 A;  1V6J A;  2WS9 3;  4Q4V 1;  3BPZ A;  2ZHM A;  2W1Q A;  3B93 A;  2X29 A;  2P5B A;  1CAW B;  1WLT A;  3CNA A;  1GWL A;  3GBW A;  2J1S A;  3GZU C;  3T09 A;  4JGY A;  5DZE A;  2DTY A;  3AKP A;  2VR4 A;  2RMU 2;  3NAP B;  3MIF A;  4O9E A;  4TN7 A;  3VBR B;  4YZ2 A;  5FZ7 A;  3ROU A;  3C7H A;  5J36 A;  1BHG A;  1CAV B;  1S2K A;  1W2A X;  1S0J A;  4FPO B;  1TNR A;  3TOJ A;  4QKD A;  5ACA 1;  1JYX A;  1UQX A;  1KDM A;  4CXY A;  3RQ0 A;  4YW1 A;  2ET7 A;  4LUK A;  3VB9 A;  4D7S A;  4TYS A;  4ZPI A;  1H6X A;  1QJX 3;  1O4Y A;  3DGT A;  4PI0 A;  4RR3 B;  4CEY A;  3RZH A;  4DNY A;  2NP0 A;  4JGZ A;  1ZRF A;  5J09 A;  1OA4 A;  5A1F A;  1MVE A;  3ABZ A;  1H1M A;  4QB2 A;  3GJB A;  2UWA A;  3Q8A A;  4XET A;  1S55 A;  4W8J A;  1BXH A;  2JKB A;  2C6S A;  2RDQ A;  1QF3 A;  2YBS A;  3FFQ A;  4HAN A;  2DVA A;  5FAX A;  5FUN A;  2JIG A;  1V6M A;  1POV 1;  2BVB A;  4XOG A;  2HEW F;  4M4R A;  2ZGR A;  5JIA A;  3NV1 A;  5KC6 A;  4EV0 A;  2J1U A;  3MI8 A;  4URA A;  4C91 A;  5IVC A;  2Y6K A;  1EUT A;  4GH4 B;  3ZYI B;  4BJ0 A;  2ORX A;  4GAL A;  4WVM B;  2YRO A;  2DUO A;  4IE7 A;  2FQP A;  3BCW A;  1BYH A;  4LA2 A;  3G7D A;  3HJR A;  4NRM A;  3GDB A;  5DAP A;  5I8S A;  4GZ9 A;  4E8C A;  1G9C A;  4YVS C;  2I45 A;  3LEI A;  1ND2 C;  4AI8 A;  4MGY E;  3ZXA C;  4XMA A;  3WT3 A;  2OQ6 A;  1S2E A;  3HIF A;  4YWA A;  1RVF 1;  1CIW A;  2WSV A;  2ZGK A;  3TEX A;  1HRI 3;  3BB6 A;  3AC0 A;  5ANQ A;  1GAN A;  1NY7 1;  4H3W A;  4QB1 A;  2VM9 A;  3I8T A;  3O7O A;  1D2Q A;  1WME A;  3GZE A;  3R4S A;  4I01 A;  5FYC A;  3I2I A;  4ASL A;  5C8W A;  1STM A;  3CIH A;  1DCS A;  2OII A;  2HWC 2;  3K3N A;  3T0B A;  2BVV A;  4OUM A;  5ERL A;  5J98 B;  1HQL A;  2R16 A;  1R09 1;  2DFB A;  3AJY A;  2OW4 A;  3J8F 1;  3CQO A;  4CDU B;  4QMA A;  1LHW A;  5IJR A;  4XJ8 A;  4RHV 2;  1QWR A;  1GP5 A;  3AP4 A;  2V4V A;  5IAT A;  5KR7 A;  2J1T A;  2VTX J;  4I3P A;  2RM2 1;  1D4V B;  1KFU L;  4FPJ A;  1OLR A;  3OPW A;  1YXW A;  2F6B A;  1C5I A;  1W6Q B;  1D4M 3;  2XL7 A;  3PUS A;  5FZE A;  2K0G A;  1R1Z A;  3MW3 A;  4FP3 A;  2DUR A;  4XJU A;  5T52 A;  5CIR A;  4FTB A;  1G9A A;  2R07 1;  1RGS A;  3LFI A;  3WF1 A;  5JSR A;  1IOA A;  1J84 A;  2ZGU A;  3VDB A;  3UGH A;  1ND2 A;  4Q4W 3;  4MET A;  1QGL A;  3O12 A;  2RHP A;  2HWD 1;  4ZKT B;  1LU1 A;  3OUH A;  1S0I A;  4RL7 A;  5E8A A;  5FKB A;  4YSF A;  3ZMO A;  3N7L A;  4XUQ A;  1NCQ A;  2E6V A;  2ZGP A;  3DXU A;  3PVE A;  3AMP A;  2P4E A;  3M1H A;  4BQ2 A;  1OHF A;  1MEC 1;  2B9U A;  4AHY A;  1WMD A;  1XYP A;  1JYC A;  3LAG A;  2BGC A;  5JZG A;  4LA3 A;  1UN1 A;  4S2D A;  5HXM A;  5FQ0 A;  3VBF C;  2RS3 1;  1NQD A;  2VOK A;  4K9S A;  3DF0 A;  2JDZ A;  1KQR A;  2HKX A;  3CHX A;  1GWM A;  4A3X A;  2RMU 1;  4DXR A;  5EJ3 A;  4AL9 A;  4TLG A;  4OCT A;  4I09 A;  2OKX A;  1ZBE 1;  1DQ0 A;  2Z42 A;  4L8Q A;  4MVT A;  1OUR A;  4HON A;  5FK7 A;  4CCD A;  4AE2 A;  2VQ0 A;  5FY4 A;  1F8V A;  5JI9 A;  1V9U 2;  2HWE 3;  1D0G A;  3LEM A;  3VKL A;  2V72 A;  3B94 A;  3WNL A;  4C8D A;  3APB A;  4JZR A;  5IWF A;  2WN2 A;  2IZW A;  5BNP C;  5CAD A;  1Z0H A;  3LEK A;  4Y4R A;  4E4H A;  5JXJ A;  5A33 B;  1T2X A;  1VAL A;  4HZF A;  1M06 G;  4XQD A;  5IYY A;  5A80 A;  3WW1 A;  2QQK A;  4YGE A;  1S4C A;  3TBD A;  1UYP A;  4LKF A;  3RYP A;  2GND A;  4YVW A;  2A3W A;  2E63 A;  2XH6 A;  3O1O A;  3MUZ 1;  5J3U A;  3V0B A;  3AP6 A;  1BQP A;  2JB4 A;  1RMU 1;  4JQR A;  3FHQ A;  1NG0 A;  4J25 A;  4NHL A;  4CP9 A;  4W6X A;  3AZX A;  4PDW C;  2VZT A;  4ASM B;  4EWD A;  2WNU C;  3WNN A;  2R30 A;  3GXU A;  4AVV A;  4DIQ A;  5JMO A;  1WCS A;  4MGS A;  1UY2 A;  3GGL A;  1UXX X;  3M3C A;  2XQX A;  1CD3 G;  1WW7 A;  2P6H A;  3B9C A;  5DDJ 2;  2E7Q A;  4Y5Z 0;  3UET A;  1XJA A;  2B45 X;  5GLW A;  1O5U A;  4Y22 A;  1VMJ A;  4Y1Y A;  1DG6 A;  3BOD A;  4CDX C;  2JDP A;  1VMF A;  1PVX A;  5GKA C;  3LIH A;  2AEN A;  3T2T A;  3I2J A;  2PQS A;  2XL9 A;  2CGP A;  1RUF 2;  2HWC 1;  2D5H A;  3GM8 A;  3U14 A;  1JU3 A;  1WMF A;  2WZR 1;  3ACL A;  3CJI B;  4M0H A;  5DUV A;  1TME 3;  5I8Y A;  3FZ3 A;  1FYU A;  2PHT A;  2ZGT A;  1QOT A;  2K46 A;  5T50 A;  4GJZ A;  1JZ2 A;  5A3P A;  4WZF A;  1X8E A;  2TEP A;  5BNO B;  2W9X A;  4AFD A;  1EYB A;  2JKX A;  3WW3 A;  3LEG A;  3D8C A;  4LHN A;  1FMD 3;  3VBU C;  1E5H A;  3LA3 A;  5FPB A;  4PF1 A;  4N43 B;  3KV6 A;  5IUQ A;  1SHW B;  2Z79 A;  1LNS A;  4B7K A;  1XYO A;  2W39 A;  1JYV A;  2CU5 A;  4Y20 A;  1QJU 2;  4IEU A;  3LKJ A;  1GR3 A;  1CAU A;  4RN5 A;  5FZK A;  1G9D A;  3AKR A;  3HQX A;  2AEY A;  2RS1 3;  4YW2 A;  1POV 0;  1CX4 A;  5LA1 A;  1LHV A;  3ITQ A;  3GNE A;  1WCU A;  2F4P A;  2HWB 3;  5FIX A;  4AVS A;  5KHK A;  3SIS A;  2Y6J A;  2P3J A;  2XLF A;  4Z8B A;  4XQ4 A;  4CDX A;  1C1F A;  1UNB A;  1RIR A;  3OOX A;  4GWJ A;  5FP8 A;  4TTG A;  4FBF A;  1UY3 A;  2ZS6 B;  5FOJ B;  3POB A;  2BFU L;  4WM7 C;  4P9J A;  1MS3 A;  4CE8 A;  2JDY A;  2XGX A;  4QGM A;  3WUD A;  1GZ9 A;  4B1L A;  2W08 A;  1VBC 2;  2ZHN A;  4JTO A;  4OYU A;  1RTV A;  3SHR A;  2C0Z A;  4CUG A;  3ZDS A;  1A3K A;  4QPG B;  4Q0S A;  4F8A A;  3I3M A;  4HKW A;  1QXP A;  2YC4 A;  5KXD A;  2DDU A;  3AJZ A;  3VBU A;  4NIG A;  4DMI A;  1W6P A;  1Y9M A;  2WT1 A;  3OY8 A; 
#chains in the Genus database with same CATH homology
 4JZR A;  2FCU A;  3OUJ A;  4NHM A;  2RG4 A;  2RDS A;  3GJB A;  5DAV A;  2RDQ A;  4XCA A;  4BQX A;  5LA9 A;  2JIG A;  5C5U A;  2FCV A;  5LB6 A;  2RDN A;  5LBB A;  3KT7 A;  2A1X A;  4J25 A;  4NHL A;  2G1M A;  3KT4 A;  2HBT A;  4NHY A;  5DAP A;  3OBZ A;  5DAW A;  5LBF A;  3MGU A;  5LAS A;  3EMR A;  2Y33 A;  3DKQ A;  4Q5O A;  5DAX A;  4MHR A;  3NNL A;  3GZE A;  5LBC A;  3PL0 A;  5L9R A;  5EQU A;  5ERL A;  5IAX A;  5M0T A;  4XAC A;  5LAT A;  5EP9 A;  4XC9 A;  5IAT A;  2OPW A;  4ZON A;  2FCT A;  4BQY A;  4NHK A;  3NNM A;  4UWD A;  4Y5T A;  3HQU A;  2V4A A;  4BQW A;  3BVC A;  3OUH A;  4IW3 A;  4NHX A;  5C5T A;  5HV0 A;  4XAA A;  3ITQ A;  3GJA A;  3NNF A;  4NMI A;  4XAB A;  2RDR A;  3W21 A;  2G19 A;  3W20 A;  5LBE A;  3HQR A;  4MHU A;  2HBU A;  5L9B A;  2Y34 A;  5DAQ A;  5HV4 A;  5EPA A;  4KBZ A;  4XCB A;  5L9V A;  2JIJ A;  4Y5S A;  3KT1 A;  3NNJ A;  3OUI A;  4ZPI A;  4NAO A;  5A3U A;  5IAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...