5LBCA

Hif prolyl hydroxylase 2 (phd2/egln1) i280v/r281l/i292v variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/fg2216)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
222
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLVLHCNGKLGSYKVNGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLVRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 63
structure length 222
sequence length 227
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbcA00
3NNJA 3NNLA 2RDNA 3KT1A 4JZRA 3OUJA 3GZEA 5LASA 3OUHA 5IAVA 5LBEA 2JIGA 2JIJA 5ERLA 4MHUA 5DAPA 5EPAA 4XCAA 5IATA 2HBTA 4NHMA 5L9BA 5LA9A 3W21A 5LATA 4XAAA 4NHYA 5DAQA 5C5UA 4Q5OA 3OBZA 4XC9A 4ZPIA 4Y5SA 3HQUA 3OUIA 5EP9A 4ZONA 5A3UA 3ITQA 5LBCA 5HV0A 2G19A 2A1XA 5HV4A 4NMIA 2V4AA 4MHRA 4NHXA 4IW3A 3PL0A 4NAOA 2G1MA 5LBBA 2FCTA 4XCBA 2RDSA 2RDQA 2RG4A 4BQYA 3DKQA 5LB6A 3MGUA 4XABA 2Y34A 3W20A 4NHLA 3KT4A 5LBFA 2HBUA 5DAVA 5DAXA 4KBZA 5C5TA 2RDRA 5L9RA 4XACA 3GJAA 2FCVA 4UWDA 5L9VA 5IAXA 5EQUA 2OPWA 3KT7A 2Y33A 3BVCA 3NNMA 4Y5TA 5M0TA 3GJBA 3HQRA 2FCUA 5DAWA 4BQXA 4NHKA 3NNFA 4J25A 4BQWA 3EMRA
chains in the Genus database with same CATH superfamily
5JUVA 2RS12 4LKSA 2RDNA 1F35A 3VBUB 5C7GA 3TNQA 2ZEYA 3WV6A 2R062 3ACGA 1C4RA 3C7GA 5KC6A 4LO8A 2B7YA 3OGVA 1LKNA 2JG8B 1STMA 2WZR1 2EXHA 4QXHA 3ZKYA 2BJSA 2VH9A 1TZOA 2WWJA 5GLWA 1TMF1 4CPBA 3NJZA 1AR92 1O91A 1RUH2 1N47A 4JGYA 4MUVA 1NAEA 2GNTA 3AYAA 4XDQA 1SQ4A 4GH4A 3ALQA 2B9VA 3E97A 1IZ3A 2Q1MA 3B01A 3P3NA 5HCFA 2BTVC 2WNEA 1WUVA 3N7MA 1NQJA 3F95A 3NAPC 4RQPB 1OBNA 3AL5A 1HV0A 3AB0A 2CGNA 5BNPA 5CA6A 2FD8A 4XC9A 1AX2A 2HWE1 2VULA 3O14A 4IE4A 4KMQA 1XSQA 5T5PA 5HCHA 2YC2A 1NX9A 2VVDA 1S0CA 3D8CA 3GGLA 3MIGA 1W05A 3I59A 4BQ5A 1NA1A 3SH5A 4GZ9A 1DGWA 4Y33A 2PHDA 1XU1A 3M3QA 2EA7A 4ZONA 3S7EA 2G9FA 2IVIB 2VW0A 2XBO1 3ECQA 1ND2A 1ZA4A 1V6MA 1IPSA 2K0GA 2OZ6A 2W3JA 1UF2C 4OHXA 3IPVA 1WCUA 1UY3A 1VRH2 2YFUA 4NMIA 4GJYA 3QCWA 2V4AA 4P5YA 4AI1A 3LEIA 3MI8A 1BHGA 4NHXA 4BQ3A 3VDCA 2CAUA 3O0WA 3R4SA 4DY5A 2NM1A 2XGXA 1MS8A 2IXHA 3FLRA 5C70A 2ZBJA 2D98A 2ZMNA 1VBA2 4LHKA 4FXGB 4QPIC 1TVGA 1DG6A 3P5BA 5F39A 1SFPA 2X05A 2MNGA 2YBPA 4KH9A 5JWPA 4EJRA 4WM8C 1LHNA 3J7LA 2W1SA 5JOWA 5FZEA 2X8KA 3LPFA 3POJA 2WQZC 3VZKA 2FDIA 4NHLA 1AYM2 3NAPB 2WO7A 2YDEA 2NYYA 4B4RA 1OOPC 3WSOA 1XPWA 4GMP0 5IFPA 5H9SA 4ZU7A 4BHPA 1A8MA 4U2AA 2WA3A 2NP0A 1CJPA 2R1DA 5GLUA 1CD3G 2YXSA 1OFSA 3I2KA 5FY1A 3POFA 3ZOIA 4XUNA 2BVVA 3BB6A 4LIVA 4WVVA 1PGSA 4YWAA 1G9CA 4XTPA 2OS2A 2R0HA 1XU2A 2P1BA 3CBNA 1PGW2 1S0IA 5FO7B 1C57A 2DVBA 3WX5A 2ZGQA 1ND3B 2J1TA 4MX3A 2B8MA 2D93A 2EIBA 1XXNA 3ZXFA 3URFA 3U75A 2Y38A 5C8CA 4I0AA 1RUD2 4N7IA 3M2MA 3ZR5A 4URAA 2B42B 4IERA 3KHCA 4L11A 1WW5A 5FFOC 1C1LA 1SPPB 2ADDA 5BNNA 4MGTA 1DGRN 4FPGA 4K6BA 5FMCA 2VMFA 4QPIB 3PHMA 4JDOA 2NN8A 3GF6A 5JPNB 3KD4A 2ADEA 1APNA 2VW2A 3OUHA 1SEFA 1I9RA 3AXEA 5LBEA 2HWB2 3T1LA 3SXWA 4BMBA 4CUAA 2YMZA 5FYIA 2ZGUA 5ERLA 2ZGPA 3MIDA 5FJKA 4TZDA 3HEIA 4BLJA 2UYAA 3P3PA 2D3SA 1O4YA 1YWKA 1RXGA 3LDKA 5IATA 4CEWC 3H42B 3RG0A 1IQDC 2BV4A 2D44A 1VPHA 2BGPA 2ID4A 3HNMA 4QB1A 4YW1A 1OOPB 1U0AA 3W21A 2DUQA 1CAXB 1JN2P 3CQOA 5GJ6A 4XAAA 1Z0HA 3MLJA 3AJYA 2YGMA 1BK0A 2VVFA 3FHQA 5IVEA 4HK9A 2XWJB 4S2FA 1ENRA 1SACA 3WP5A 5JOXA 5FZGA 1OUSA 4RFRB 4I3PA 1LGNA 1LODA 1W2AX 1PO13 3DL3A 4HPKA 5EJ1B 5F5QA 3ZSEA 1EAH3 3KCCA 3H1WA 1I1EA 1UW8A 4HZFA 4LBJA 4MGQA 4O9EA 3USSA 2WABA 4AEDB 2VQAA 4B4QA 1H6YA 2WNUA 4N53A 3HAGA 3JQWA 1R083 2NMNA 2VXJA 4HL0A 1DDLA 2DCTA 4XPVA 1COV3 1DZQA 5HV0A 4Q4X2 4OI1A 1CPNA 2XHKA 1F5JA 2BP6A 1V9U3 1CX1A 1KFXL 4NPLA 3ILRA 4GWMA 5FQ0B 1AR73 3FFZA 4LNVA 3RZLA 4D6SA 2ZHNA 3OJBA 4FCAA 3ZSJA 4CP9B 1ZRCA 4XIKA 4XW3A 5FZ0A 5AC93 1DZRA 3M4FA 4ZXKA 3GZTB 2A6WA 4FPYA 1YXWA 1SLAA 4NRMA 5FZOB 4DEQA 1PM7A 3SH3A 2G9GA 2Y6GA 3AMMA 5F3IA 4XABA 4CEWB 1HKDA 3WG3A 1ZNPA 1GFF2 2Y0IA 2P3JA 3EB7A 4LITA 5F5CA 3W20A 4FAHA 5KXCA 3WNPA 1CX4A 4FSJA 1AXYA 1E5IA 2WS92 2X10A 4M3CA 2VXRA 2VE1A 1U12A 4RA0A 2Q4SA 3VBOB 2BNMA 1M06G 1J3QA 1KJLA 2QZ3A 3B93A 2YG0A 1YQCA 1HQWA 2YBSA 2J7MA 3PU8A 2ZGOA 3OBTA 3UT0A 1W6QB 4H55A 5IVJA 3H8XA 5KHJA 2RS53 1LGCA 3JD73 2A7AA 1W2NA 5JXJA 2WWUA 1LOFC 1DLLA 1OF3A 3WDVA 4YG3A 4E2GA 1PK6C 1GOHA 3AM2A 3IWZA 3ZDSA 2JEMA 4CVUA 3M70A 4LMFA 1PO11 5GLTA 1G86A 2I45A 3GCXA 3HNYM 5IVBA 1EAH1 2A6ZA 1OUXA 3K46A 4B1MA 4CCJA 3V56A 2VZOA 4F7ZA 2GU9A 1DF0A 1FXZA 1AF9A 1FPN2 1L7LA 2WT0A 1FAYA 2VOKA 3CEWA 2WO3A 3JB8A 5CKNA 1WD4A 1R081 5D21A 2Y6FA 1TME3 1COV1 2R043 2XKOA 4NE9A 2JDPA 1KXGA 1X82A 3ACLA 3AYDA 1CZTA 2WZEA 3KCYA 4DNYA 1V9U1 4FVVA 1L7RA 3FL7A 2A71A 4Y1ZA 2LALA 3ZFGA 1UOBA 1LU1A 1AR71 1CAUB 4AQ2A 3E1F1 2DTWA 4BE3A 5JXGA 1OH3A 2IXLA 1UAIA 5DPNA 2VMHA 2V72A 1LESA 3H8RA 4HXCA 3GM8A 2QQVA 5AC91 4JQRA 1EUTA 2F17A 3FX3A 1VMJA 1BBT2 2R1BA 5L9BA 5B2GB 2HWD2 2QQKA 5FBZA 1ENXA 4LLOA 4NIAA 3ZIWA 4C91A 4TTGA 4KG8A 4AEJA 5A3NA 1HW5A 3AMHA 4IEZA 3WHUA 1N1SA 1WWYA 4COYA 4UOJA 2XUMA 4FOVA 1MVEA 4YNIA 1US2A 1MS4A 3AVRA 4AI2A 4AWDA 2D3PA 5E1RA 3WR0A 2UURA 1CGPA 1I6XA 2YPJA 4HFSA 1PK6B 4A44A 1S4CA 2BFUS 2EIEA 2JDKA 5F32A 4JC1A 4YGDA 3BKZA 4IGPA 1UY4A 4CU8A 4A2UA 5LRSA 3N7LA 3JD71 4JAAA 1CESA 2BNOA 1BQPA 1O5LA 2J1AA 2JG9A 4ORFA 2OZJA 4IEPA 1Q8VA 2ZX0A 4LHLA 3SEEA 3VBUA 1W2TA 2ZX1A 4MHRA 2E7AA 4DINB 3PUAA 5CFDC 4BK4A 4HLTA 2Q8DA 4FFGA 4JDNA 4E8CA 4ZKTB 5IYYA 2JG8A 3WQ0A 4EROA 5A3MA 2WSVA 3WF0A 3WDWA 4QQPA 1J84A 4HK8A 2NZ9A 1PO22 1MPXA 1DU3D 2OVUA 3ACIA 3O0VA 1W8WA 1GP4A 1WCSA 4LPLA 1TME1 3SMHA 3D5OA 2R041 1OPOA 1YEWA 1F4HA 4WM7C 2AYHA 2CV6A 1H1AA 3T2OA 4PQQA 4PI2A 1KD7A 4UAPA 4PBOA 3RJ2X 3AMQA 3GCWA 1JYVA 2PHUA 2VBPA 2HBUA 4LKEA 2QKDA 4RQPA 4YVSC 1W2OA 4UW3A 5AFEA 1GZ9A 2HEWF 2D6KA 3RI9A 4FPCA 4FI9A 3WDYA 3B00A 4AFCA 2PFWA 4O9GA 1W9SA 2OQ6A 2WL1A 1S0JA 4KWUA 3WW2A 1V00A 3ME2A 4XF1A 3WUCA 1LHOA 1PMJX 1IOAA 1BYHA 3A22A 2Y6HA 3WNXA 1GYKA 1RGSA 3AYEA 4JX0A 3GXUA 4PIYA 2WAOA 3IIAA 5FO9B 2AACA 3LWCA 5SV8A 3I8TA 1UMIA 3HQRA 4INDA 4CRQA 4CDXC 1GANA 4WV8A 5F1RA 2PAEA 4NHKA 4IV3C 4IQPA 4E4HA 3S5AA 5JAXA 1VR3A 3DXTA 3J8F2 3LFMA 5CFDB 3VGIA 4CCEA 1XNCA 2WC2A 3X29B 4IE6A 1QNYA 4OMCA 1QOTA 1YJKA 1H30A 3IB3A 3LB9A 5JXIA 2E63A 1HB4A 1O6UA 2VUDA 3IZOA 2BYVE 2VQUA 3UNPA 5C71A 1ASJ3 1VMFA 3BYWA 3EHKA 4HANA 5DDJ2 1FMD3 2J1EA 4C90A 1BVVA 4FOQA 4WM7B 3A4UA 4WZCA 4A41A 2FDGA 3L9JT 1W3XA 2PQQA 1Y4WA 3O5SA 2WN3A 1JHNA 1NCRC 2ZXQA 3AVSA 3EQEA 3NJXA 4QX8A 4H2AA 4XFGA 2BDRA 3NAPA 3THCA 4QDQA 1VBC2 1GKBA 1MS9A 1Z7S3 5B4XA 2ERFA 2ZTNA 4PLOA 5LA9A 4BIOA 1W0OA 2W1WA 4NHYA 1H1IA 3DPRC 4M0HA 2B5HA 4LOSA 3RYKA 1OQ1A 4XQ4A 3EXUA 4Q0SA 1OLQA 1D2SA 4YW7A 5KXEA 3GZAA 1B09A 4ARXA 3ZXLA 1YLLA 3INAA 1EYBA 4CDQC 3ST7A 3ZN6B 4ZZ5A 3PVOA 3TOJA 4V2WA 1ND3A 2CHHA 3T2PA 1O8PA 4QGNA 1O4ZA 4JCKA 2K2SA 3IDAA 3VL9A 2DVDA 2PHRA 3K3OA 1PMHX 5C3OA 2RJKA 4LT5A 4IV3B 1KGYA 3POSA 2QQLA 3LPGA 5JCTA 3VZLA 3BTZA 3VB9A 5FY8A 4QHBA 4YZ4A 5C33A 1SPPA 4LJHA 4FOWA 1LOAA 5BPXA 3H50A 4D6QA 5FO8B 4QPIA 2DF7A 3S5QA 3TRSB 5CG8A 4DXRA 1XBFA 2WQ4A 2ZCWA 1EY2A 1D7PM 2VZVA 2WNVB 3B69A 3FMGA 3PU3A 4NRPA 3BUCA 5J36A 3IIIA 1J3RA 3KVBA 1K5JA 1UIKA 4EV0A 5LY1A 5FZLA 3MF6A 1SBFA 4E4SA 3O1RA 3I2FA 1LNSA 2F6BA 4RYDA 2C5DA 2DUPA 4RFT0 4LE3A 2BOIA 1W03A 2VD7A 1MZ6A 1ZZCA 5BNOC 3LE0A 2JX9A 3JBG2 2VNRA 2BEOA 4TYSA 1OOPA 2VTXJ 1XE8A 1ASJ1 2W94A 4MZUA 1CAXA 4XF9A 4E8DA 1FMD1 1H8TC 1POQA 3KQ4B 1QJFA 1UKRA 2JDAA 3DPRB 1RUI3 1VAMA 5DQ0A 1XJAA 3FUQA 1OLRA 5FLJA 1RUJ3 2D43A 3POIA 1XNTA 1UIJA 3K75B 4KBZA 2GDFA 2XUEA 5LEJA 4IE7A 5ACA2 1HN0A 1XNAA 2ZMKA 2TUNA 3K4AA 1Z7S1 4IL7A 5C4WC 3R4UA 4CDQB 1LOBA 1IPKA 5IVFA 1ZRFA 4AVVA 2UYBA 3NVCA 5FZ6A 3SLIA 3JQXA 4GXLA 2VR4A 3RYRA 2D3RA 2Y33A 3SCFA 1N3QA 1WMXA 4NUBA 5FREA 1RUG2 4AEDA 3EBRA 5CG9A 1UOGA 4CCLA 3LEMA 3I49A 1HJGA 4QD2A 2ZGLA 4CXYA 3N3HA 2W5FA 5CISA 3CIHA 1ZM1A 4C1XA 1W8TA 3A0NA 1ZREA 1UMHA 4KWKA 4LBOA 3U1XA 5KHKA 2DU1A 3C3VA 4QXKA 4D7SA 4YZ5A 1T2XA 4RGKA 2SBAA 4L97A 1WCDJ 5E6HA 4A45A 4OHWA 1UX7A 5FQ0A 4KI5M 1W9FA 4Q29A 2LROA 3BTYA 4NIDA 1UZWA 1URXA 1HB2A 4CP9A 1MS1A 4P9IA 3VKNA 5FYMA 2Y6KA 4QPWA 1JZ6A 2BBVA 1ZZ9A 2ZAAA 2E51A 1VJ2A 4HKOA 4I3GA 3HVDA 5FZOA 5IAVA 3WF2A 1ENSA 1ULFA 3OEBA 4MHUA 3T2QA 1CQ9A 1EPWA 2B4KA 3OGGA 3WP6A 2ARAA 3ROUA 1PZ9A 3LD8A 5BNOB 3TEXA 3ZVXA 1QMJA 3ETQA 3H1MA 5JDBA 5J37A 2FDFA 1H8TB 1CAWB 2W52A 2XJQA 2XLGA 5A7SA 1OLMA 4QX3A 2FMDA 4MOAA 3VBOA 5FJHA 2EICA 2HWC3 1RVF2 1O3TA 4CP2A 2VW1A 4M0NA 2B9UA 4AQTA 2PAMA 4I30A 1RUC3 3E5UA 2VO5A 2RM22 1MEC3 1W6QA 1YIPA 2WSUA 3M3EA 1W8ZA 1RUI1 4UBHA 1RUJ1 2JB4A 5J48A 4AVCA 4IEUA 1SLIA 3OUIA 3IN9A 3ZM8A 1UU4A 1ZBE2 4N7UA 1OHFA 2ZGSA 5FZMA 1RUF2 5K0UC 3WCSA 1LTEA 2PAKA 4QPGC 1VB2A 2MEV3 4XOGA 4IEVA 1XB9A 3AMNA 3KF5A 2C9KA 4JRAA 1DYKA 2PELA 1FV2A 2W08A 2FHRA 3RWNA 5F2WA 2ZZJA 2XONA 1OVSA 2HH9A 2BW8A 4XBNA 4R4ZA 4NAOA 5A80A 2EXJA 5KXDA 3NV2A 3Q8FA 2WZPP 1LENA 1AR83 4COUA 5EZWA 4FT8A 5IHRA 4L2NA 2D6NA 1FOD3 2QE3A 4AHYA 1CAUA 2VZQA 5A1LA 1W06A 2VQTA 2GAUA 5FZ8A 5FXWA 5A7WB 3D82A 1KS5A 3M3OA 4HKWA 2VOXA 2EAKA 1W99A 3ZFEC 4HVRA 4XJWA 1N3PA 1RIRA 1U5YA 1V6NA 1RHI3 3KT4A 1AUYA 2BGOA 2VPVA 5DAXA 1EPZA 1EV13 5F7UA 1LB2A 1VLNA 2GH8A 2QQJA 3R4DB 1AL0G 4BQ1A 3NL1A 5BV6A 3LAGA 4FPLA 4ZZ8A 1O3SA 1JOJA 2FQPA 2H0BA 5FZFA 1W9WA 1MS3A 3VHNA 3W5NA 2HWC1 1BXHA 4Z8BA 1LOFA 3MZHA 5GALA 1ZBA2 1S0EA 4HSLA 1O8SA 4L0PA 1PK6A 2R49A 2Z79A 5E16A 3NJVA 4AAPA 2WT1A 1HRV3 1MEC1 2Q5TA 3FHIB 4R9CA 1CIWA 5K0UB 2WINB 3B5LB 1QJX3 2VCCA 3RZZA 2DFBA 5GLVA 3THPA 1GWKA 1W3VA 1CZVA 1RMU3 2RV9A 4Q4W3 2PLV2 2Y6JA 1XSRA 4HKLA 2HWE3 2IC1A 2ORZA 2AZ5A 1AXZA 4YW5A 4DQAA 4UW6A 3IAPA 4AEMA 4CUGA 2MEV1 2VGDA 4OMDA 1UOJA 1D2QA 1N1TA 2IXKA 2RS13 3KQRA 3QH7A 1JZ8A 2BRTA 4JHZA 3VD4A 2R063 3KWVA 4IEWA 5IK4A 4X6RB 3O1OA 1VBD2 1K3IA 3BOWA 1MR5A 4H14A 4IV1B 3RNSA 1AR81 4N43C 1NLQA 1VBE3 3LSDA 3MUZ1 1TNRA 4B7EA 1AR93 1FOD1 5EPAA 1XRUA 1XNDA 1F5FA 4KG0A 3AFGA 1RUH3 4YZ3A 4CXXA 4LO6B 5LEKA 1CJDA 3ZMNA 3D3AA 2DVAA 3MICA 1QH7A 3KV6A 1UZYA 1TMF2 2J42A 4AYUA 1ULDA 1RHI1 4LBKA 4QMAA 2E32A 2H6BA 4YSFA 4Y20B 1JYNA 2CY6A 4AFMA 2WZ8A 3MLKA 3ZSKA 1GU3A 4META 4MG2A 4DIQA 1EV11 5JZGC 5DUVA 1D4VB 2P6CA 2ET7A 1D0HA 2OIIA 2YFZA 2WR9A 5F2SA 3GZUC 3MW3A 4BMEA 3T30A 5FP8A 5LCWL 3K48A 2ATFA 1TQ5A 4UFKA 5GZDA 2GNBA 2C6SA 5FY7A 1NE4A 4RGGA 4XFHA 5LA1A 4AOCA 4N9HA 4NIGA 3MIFA 5A3UA 1HRV1 5CFDA 1YQ8A 4NIIA 1OA3A 1QJX1 2QBXA 4N90A 3FBMA 1OD3A 4OUEA 2BOJA 2Q30A 1VRH3 3I3BA 3RDIA 1KEXA 2JDNA 3ES1A 4HVOA 3SCHA 3ZR6A 1RMU1 4Q4W1 2HYKA 4GB32 5KHHA 1LHWA 4GA9A 4AR2A 3SHRA 2RG4A 2VNGA 4WM7A 5JSOA 5LA2A 1VBA3 3AZWA 2NQYA 4O61A 2HKXA 2R0FA 4V2VA 3WINE 1IS5A 2RS11 4FTEA 2Z5WA 4YRDA 2R061 4YVSA 4EN8B 3ZSLA 5A70A 3T4VA 1C5HA 2A75A 3T0BA 1ZYBA 3OEAA 2ZX4A 4OQ9A 5I8YA 4DS0A 1AYM3 3HBKA 1H0BA 4AVSA 1VBE1 4LBLA 2CAVA 1RYYA 1AR91 3F2ZA 4MYEA 5DABA 3WEZA 4E4DX 5FIXA 1RUH1 4LKDA 2AEZA 1HN1A 3ZDVA 4ARYA 5JZGB 4K9SA 1XNKA 2DVGA 2EIGA 4ASLA 5J98B 5L9VA 1HXS2 3FC0A 3ZN6A 2FDKA 2WKKA 3NO8A 5FZ9A 4E2QA 2CGPA 1RUNA 1ULGA 3H8OA 4OHYA 2VBBA 1ACCA 2UWCA 3ZXJA 1BKZA 3BVCA 3J26N 1W90A 3NWKA 2VMCA 3AK0A 3CJXA 2ARCA 3CZUA 4IV3A 4Q4V2 5FMDA 3I2IA 1BEV2 5DMYA 4YFWA 4YW3A 3UJQA 4XVHA 1BJQA 3NNFA 3K4ZA 4M00A 4Y1XA 1YFUA 3RQ0A 3E6CC 1ONAA 1RUD3 4MADA 3WDTA 3BI3A 4URTA 2WNVA 1JXNA 3G6JB 4QKNA 4B4PA 1FNZA 3H3UA 4JDMA 1A78A 4LA2A 1GP5A 3C7FA 5L19A 3CU7A 4CEYC 2W95A 3CLPA 1REEA 1VRH1 3IMMA 4AG4A 1SLCA 3POYA 4XFAA 3RZMA 2HWB3 4PF1A 1DFQA 1QJU2 2P3KA 3PDQA 4AHXA 1ULCA 5EIYB 2YUEA 1NQDA 2QQIA 3OGJA 4B7KA 4BPZA 1NUKA 1VBA1 3DPRA 2JXAA 3TWIA 5BYNA 5C6CA 4IGQA 3OF1A 1Q8SA 1A6CA 2VY0A 4NHMA 1OA4A 4UT5A 3AYCA 4IGOA 1QGLA 2O8QA 2QUOA 2Q1FA 4FOYA 4F8AA 5JSRA 4Q4Y2 1NY72 2DUOA 1H9PA 2R32A 2QQUA 3DN7A 3AP7A 1H1MA 1BVP1 1HV1A 1RXFA 2A3WA 2KR2A 4XJZA 1CAVB 4RN5A 3VHOA 5FOBB 1AYM1 1UZVA 3AKSA 1KJRA 4OUMA 1GOGA 2ZHLA 2EXIA 3H7JA 4MSVA 1VP6A 4NWVA 4R9AA 4XF0A 5LRRA 1U5XA 4FQ4A 2GZWA 4WM8B 3ZYIB 1UKGA 4KL1A 5FWJA 3KVAA 4R9BA 1J58A 2PTMA 1WD3A 4X8PA 1WGPA 2WNOA 1YYNA 5JIAA 3ELNA 2P5BA 2GMMA 3ITQA 3WF4A 2QDRA 1DCSA 3CMGA 3AP4A 3H9AA 5GZFA 3FZ3A 4QQOA 3DYOA 5FMOS 1PGW1 3BGAA 1GV9A 4Q4X3 5K7PA 2R7EB 1U5IA 2RR12 1BLZA 4LHNA 3RFRA 1EP0A 2Z42A 1HQNA 4ATFA 3V0BB 1RUD1 1RB8G 4BOWA 3GBFA 1WBLA 3B9IA 5BNOA 4IDZA 2W2IA 1UPIA 3GHMA 1ODNA 4YVWC 2VTXA 4XILA 2VOWA 1H8TA 4QT6A 1CAWA 3UKNA 1GLHA 4GD4A 4MVTA 1S2KA 2O0OA 2ZEWA 4OUSA 5DUXA 2RJLA 4XETA 3WF1A 4CTEA 2VVEA 3GBGA 4QXBA 3WCRA 3DECA 3WXPA 1FYUA 1UQXA 2HWB1 3OD0A 5APAA 5LBFA 5DAVA 3BOPA 2EAAA 2OYZA 4Q0QA 4BB3A 2WS93 4CXWA 4GKYA 3ZFFC 5I0SA 1SBDA 1LU2A 2A3YA 2RDRA 2TNFA 1UY1A 3VKFC 1GWLA 5CEHA 1PIV2 1R1A2 3KV4A 4AL9A 3T0AA 5JMCA 3JXSA 2W68A 1G9BA 4GWJA 4RHV2 4GULA 1C1FA 2QQOA 1UZZA 2I07B 4IUGA 3WQ7A 3S57A 1JBCA 1OI6A 3K4DA 5CNAA 4O7XA 1W8FA 3IM0A 1SFYA 4RR3C 2JDUA 1QJY2 5FPUA 4CZSA 1PGL2 1J1LA 1QXPA 2XOMA 5I0UA 4F3JA 5CADA 3MFAA 4LBNA 3ZXGA 2CSGA 1MQTC 5L36A 5GM0A 3ZIXA 5CFCC 2J22A 5HI0A 1MZEA 4EZ4A 2JD4A 3VZOA 4XEZA 2VUJA 4IE5A 4PBPA 3ZPOA 1FPN3 1Y9MA 4DXZA 3TB0A 5FAXA 3FFQA 1QQP2 4TWTA 4W6YA 2CWMA 2HWF2 5T52A 1BMV2 2BQPA 4HOOA 3TNPB 1X8MA 2HJIA 3VN4A 4Q4X1 4XJUA 5A7WA 4A7ZA 2V09A 1FV3A 3AZXA 5ABJC 3Q8EA 1QDCA 4ZY9A 4LE4A 2E33A 3ZXAC 2IFRA 3U78A 1W8OA 4AZZA 3D4KA 3FBYA 4CP1A 3TEZA 1JUHA 4E2SA 3ZFFB 1V9U2 2F4LA 2KXLA 5LATA 1BBT3 4H3WA 4XMAA 2ZGNA 4Q5OA 1W39A 1RC6A 2G4IA 1V6LA 1RUE2 4XJAA 4OI0A 3A0KA 4AK3A 2WS91 4ZU5A 4PCRA 1H8VA 1O7FA 1VAVA 1XE7A 1GP6A 3WP4A 4I2OA 4QHZA 5K0UA 1D4M2 1WW4A 4JTNA 4RR3B 3OOXA 4FPHA 4QPGA 2D6OX 4LTAA 1LR5A 4Q2FA 3NV4A 4E27A 4CU6A 4DEVA 3W59A 2G9ZA 2E9QA 2ZA9A 4ASMB 5A6ZA 4CDWC 4Z82A 1C28A 5T3NA 3BPSA 1MQTB 3MLLA 4UFMA 4DUXA 3KV9A 4AVBA 2E26A 4HBNA 5A7NA 2XQRA 5CFCB 2P3IA 3SKVA 1OPMA 2FZ1A 5F6LB 4LBQD 1KDKA 3I3MA 4QB6A 2XQXA 5HXMA 5FYZA 2VCBA 5C9AC 4W65A 4C0HA 4L92A 1GOFA 5LK7B 2RS52 1POV3 2YZ4A 1QOSA 1W8NA 4Z92B 4FFIA 4XFCA 3OCPA 4PF5A 3GBWA 3ZKUA 3N7JA 2EXKA 2BGCA 4IV1A 4LORA 2R6QA 3KGLA 3ZFEA 5TSWA 1FPN1 1JOBA 2K9ZA 3MW2A 5A32B 1GBGA 5LB6A 3T2TA 4AFDA 1G6NA 1PO23 3FWEA 3J9SA 3MGUA 2KD7A 4Q26A 3ZXEA 5JVVA 4ASKA 1CN1A 2IXIA 4QX0A 3CKHA 2JENA 2BUKA 3JU9A 5FUPA 1DP0A 1IGOA 5G05L 3I2DA 1DQ1A 3TBDA 1VRBA 1GNYA 5D2AA 4PLNA 1JU4A 4Z1VA 5T5LA 2GP3A 3VHRA 3WVJA 5FZHA 2WBKA 3WT3A 4Y20A 4JTOA 3ZPYA 3O1PA 2VAUA 5FLHA 2DFCA 2DBIA 4A3XA 2V4VA 3MUY1 2JD9A 1YFWA 3HWJA 4GIQA 2B45X 3OBRA 2ETEA 1BBT1 5EQUA 1RJ8A 1NT0A 2J1VA 3JB4C 2HWD1 3KB5A 4LO7A 5C3RA 4RD7A 4P9GA 3HMYA 5I91A 1ZRRA 4AI8A 3E6DA 1W8UA 3KSCA 4QM8A 5F8PA 2YGLA 3N9PA 4ONUA 4PLMA 4XDPA 1PZ8A 4QXCA 4JGYC 3HN1A 2VU9A 5C9AB 3K3NA 1NCQC 3VD9A 2XLAA 2SLIA 4NPMA 3J8F3 1DQ2A 4HN1A 2VMEA 2E53A 5D8AC 4OI2A 3T1MA 4JKLA 1UX6A 1N1VA 1DQ4A 2W1UA 2VM9A 4YARA 4P5HA 1FI2A 3U10A 4HVQA 1QOOA 1OVPA 5JR7B 1OQEA 4KU7A 2DBNA 3MYXA 1POV1 5DDJ3 1S2EA 3MO4A 4QGMA 5T50A 5GZEA 4CA9A 3ZYJB 3VDDC 2RS32 4NAMA 5KHIA 3MPBA 5JOYA 4QX5A 1AX0A 1UL9A 3M1HA 3AP9A 1PO21 3AJZA 4GKXA 2W0XA 1VBC3 3TN92 5JZGA 2LM3A 2XJSA 1F2NA 5BNQA 2O8OA 4K3UA 4NR1A 3BALA 4P08A 1A34A 4D7YA 3ZYGA 2YU1A 1PVC2 3UV9A 2WFF2 2AEYA 1RUOA 1HRI2 4AI3A 3VD7A 3WNMA 2ES3A 1W9YA 4MGIE 3H3LA 3C7OA 1DGLA 4EQVA 2JICA 2P6HA 4X8NA 1C8M2 2F4PA 4QKFA 2D7FA 5CBLA 4DRRA 2GN3A 3CNAA 2QQMA 4YVSB 5FK7A 1JOPA 1MACA 1NCQB 5C3SA 2O1QA 1V6OA 4XZPA 4QQLA 5F5IA 3KHBA 4K7JA 2ZPXA 4CPBD 3POWA 1YO8A 2JE9A 3I4IA 3ACHA 5D8AB 5I8TA 3VLBB 4FFHA 3FLPA 3WDUA 2NLRA 1DZTA 4BLIA 3NW4A 4PQ9A 5EYYA 1I5PA 5F5AA 4LKFA 4R52A 4BQYA 3J8F1 2DCZA 3VD3A 4XJ9A 1UCXA 2OXBA 3Q8BA 5I93A 3M3IA 1I3HA 1GZTA 2RE9A 3ORJA 4LQRA 4IEOA 3RPQA 4CCDA 3VDDB 1SLTA 4LLFA 4OLLA 1H2KA 4Z07A 4CDXB 5LA0A 4P9YA 4FPKA 1IKQA 1PVXA 1XE0A 4M01A 4Q0PA 3MIBA 2VOVA 5DDJ1 3HT1A 2C4XA 3HIFA 3OPTA 5C8CC 5FLIA 1IQAA 2ARBA 1CAVA 1HQLA 1ZZ8A 5FZ1A 1G7YA 2XJUA 5DUWA 2ARXA 4MO3M 1GQHA 4J6GA 5ACA3 1JYTA 3C2UA 4QDSA 5JSPA 1VBC1 2B46X 5IAXA 1UPSA 1YC61 4WM8A 3V0AB 3LOIA 4OHZA 3N36A 4FPJA 1OURA 5FZ3A 1A3KA 1GNHA 1Y3TA 2AREA 2CNAA 5M0TA 4QPYA 1RUG3 1XYPA 1NCRB 2C26A 5FYYA 2VZSA 1VB4A 3GJBA 5FYUA 4FAGA 5A7QA 2A73B 5DZGA 2FCUA 4XYXA 4UYBA 3USUB 4AF9A 4BZ4A 1VBB2 3DUIA 1K45A 4DXSA 5CYYA 3VBRC 4LEJA 3NNJA 3NNLA 4EWDA 2ZJCA 5H9RA 5FYSA 1YCIA 4CEYA 5FK8A 5FYVA 2R072 4JZRA 3WD5A 2D40A 1H6XA 3I2HA 4YYOA 3WDXA 3WOGA 3V0BA 1SDWA 1IS6A 3E5QA 3WQ1A 4H7LA 3ZX7A 3QOPA 3OPZA 5LWBA 1Q5OA 3A7QA 3VV1A 3IDEA 3VHPA 5FP9A 1US3A 3T08A 2YY1A 4A7KA 1OC1A 4RS5C 2WFPA 5FWEA 2PMWB 2OQ7A 4XBLA 2DVFA 2IVJA 4K1ZA 4EN0A 2CTVA 2QQNA 3RZKA 1W6PB 4NPRA 4FTSA 4UXAA 5K9YA 3A23A 1FT9A 4YLZA 1UU5A 2Q1ZB 2CGOA 3B3QE 1OSGA 4JKMA 5DAQA 1FX5A 1RVF3 4BISA 2ZKLA 1L7QA 3FLTA 3ZXKA 4LO5B 2P3YA 1W8HA 3L2HA 3JBG1 5K4LA 4HN0A 4XFFA 5J1XA 2W1QA 2XKPA 5ANQA 2BERA 2RM23 3N7KA 4YM1A 3NKTA 3RZGA 1QWRA 2JDYA 1MVQA 2PQSA 3HQUA 3ENRA 5F37A 2C1FA 1ULPA 1V6IA 2EVXA 4S2GA 5FZDA 1YQ5A 3AP6A 4S2DA 2XH6A 2AH2A 4KQ7A 5ACA1 5EP9A 3NKGA 5EJZB 4KU8A 1ZBE3 4P02B 1YI7A 4EZHA 1RUF3 3N35A 2XJRA 2R30A 4ATEA 2XXZA 4B8EA 5GZGA 4P9XA 5FYHA 3APBA 3VBRB 1AR62 3DEMA 1RUG1 4GALA 3QBQA 2X09A 3AZYA 4UBGA 4YG0A 4UW5A 2YU2A 4DUWA 2W87A 1OF4A 4YG6A 1PX4A 2AENA 5C4WB 1PNFA 1GR3A 2VOTA 1GZWB 4C1WA 4FFFA 3VUOA 1KQRA 4A6SA 3TAYA 1ZVFA 5A7PA 4CCOA 2RDQA 4MGKE 2VCMA 1JZ3A 4Y4YA 5AVAA 3MDPA 4RS5B 2EIDA 4XHXA 4NWWA 1R092 4CCCA 1L3JA 4TLGA 3ZFFA 4BYYA 2B39A 1R1ZA 3PMSA 1J3PA 2IXJA 4LIUA 1WKYA 1Y9QA 1GQGA 2Q8EA 4BH9A 4DZGA 2HEVF 5E88A 2RMU2 4LOTA 1OXCA 4OI4A 5DG2A 5LZ6A 1OT5A 3DV8A 3Q9OA 4OYUA 3R05A 4BK5A 5FUNA 2V5YA 1JW6A 2GNDA 4RR3A 2VMDA 2BWCA 3QH6A 4L8QA 1JU3A 4QB2A 1RVF1 1AYN2 3WNOA 4TN7A 1ZBA3 4L99A 2VG9A 2VBDA 1F31A 1MQTA 3MHZA 3NNMA 4K20A 4YM3A 3MV01 2RM21 1PX3A 1AHSA 5CFCA 2J1SA 2X53S 2BPA2 4NO4A 4O65A 1NZCA 5DAWA 3VBSC 3ZN4A 4W8JA 4QM9A 1W9TA 1RUC2 1CIYA 4COWA 3RYPA 1ZBE1 2UU8A 2PLV3 2Y6LA 1HB3A 2KM2A 3VZMA 2RHPA 1YI9A 1RUF1 1JUIA 3OYWB 1VE0A 3R0RA 2V73A 3GZEA 3AKQA 1IKPA 4KNCA 3ZO0B 4AHZA 1AL22 4A6OA 1DYOA 1HIXA 1TE1B 5ABJA 1B35C 5A32A 4Y1VA 3AKTA 3R6SA 3T0DA 5C3PA 1XYNA 4BA6A 1VBD3 4JRLA 5KR7A 2BBAA 1IS4A 1W2UA 3IMNA 4QU2A 2BFUL 1JZ2A 5A3OA 5FPXA 3IAQA 4QPGB 2BWAA 3D6EA 3FE5A 3WG1A 4ES9A 3N9NA 5J3UA 3CF6E 4I01A 2XL9A 4LULA 2ENRA 4XF4A 3OG2A 2L9LA 5AVPA 2P4EA 4LK7A 4D69A 2VJXA 3E5XA 1OKOA 1JYCA 3MEPA 5DN2A 5DUUA 1RINA 4OULA 4KGQA 4A3ZA 1UYPA 1V6JA 5FY9A 3LOBA 3HD8B 1JZ5A 5FTTC 5IVVA 5FP3A 2DCYA 5LK5A 1UXZA 3RRDA 4Y5SA 1NXMA 4BU2A 3EO6A 5GKAC 1LOCA 4W4ZA 4MGSA 5T54A 2OT7A 4K40A 2WLQA 3PUSA 1DIWA 2VTFA 3UETA 1X7NA 2JKBA 3I2JA 3VD5A 3ASIA 1S55A 5EHDA 1ZZ7A 3VBSB 3ZFEB 3PIJA 3H7YA 4B29A 4EE2A 3WHTA 5IJRA 3KZ4C 1ZBA1 3BODA 3KMHA 5C9AA 3O1VA 1AZDA 3UESA 1AJOA 2QCSB 3S0MA 2WZR2 2PHXA 4LHSA 2OUJA 4AAXA 4UFHA 3NQHA 1IG3A 4RQPC 4UF0B 2I74A 1PZ7A 2E6VA 2BZDA 3WY6A 1B35B 1UMZA 2FCTA 3IBMA 4NROA 4RL7A 3PVBB 2PLV1 1AXKA 2QQPA 5A1FA 3SISA 4K1YA 3UL2A 3CDZB 1J83A 1OLME 2FBEA 3DKQA 5A33B 3O1MA 4BJ0A 4Q1PA 1O5UA 4ZU4A 1QEXA 1X50A 1LGBA 4EN7B 1ZA7A 1SZBA 2VC9A 2HWE2 4I09A 2OA2A 2PHTA 4XZUG 4YGEA 1O3QA 3RSJA 3U37A 1VBD1 3M3CA 5DZFA 3NSTA 3KLSA 3PJYA 5EYXA 1E57A 4JQTA 4DRVA 1VMHA 5IK8A 2QJVA 1YJLA 5B4NA 3HPNA 2ZGKA 3GJAA 2GP5A 2WN2A 1HDKA 1QXJA 1ZZ6A 4NJ4A 2XBO2 4XURA 3O1TA 4QX7A 1NLRA 1NYWA 1HXS3 4QX1A 1SDDB 1VBE2 2W46A 1WW6A 3WW3A 4N43B 3LA3A 4COZA 4OQ8A 2IWGB 4QGLA 5F3GA 4Q4V3 5A3PA 1NCQA 2ZMLA 1X33A 4TLFA 1BEV3 2A3XA 5FY0A 2XWBB 3MW4A 2CWSA 4XUQA 5L7OC 2D6PA 1QU0A 1E5SA 2LRPA 2VNVA 2XVLA 1C8NA 2YC4A 5D8AA 3IDCB 2KA3A 3SC7X 3LA7A 3VBFC 4P9JA 3H8UA 5HCBA 3CHXA 2JE8A 1ALYA 1MS0A 1G9DA 1H2LA 1QDOA 5FBJA 4XQDA 1N1YA 4YGCA 5FYBA 4XE9A 3VDDA 2UY9A 1PM4A 2BNNA 3B7MA 3OY8B 4CDXA 4CCMA 4GB31 5DAPA 1QJU3 1M4WA 1PMIA 3SKJE 4BCUA 1ND3C 1BK1A 4G9SB 2XPJA 2AGSA 2CDOA 3MFCA 4OZXA 1UD1A 4Y22B 4WBBA 3DYPA 4W50A 3ZLIA 3LFIA 5A6QA 5HBAA 4KGGA 3WNNA 2QFEA 5L73A 5C5UA 2E7QA 1DQ0A 1OA2A 5IFTA 1T6BX 4Q4Y3 3POGA 4UFLA 2DCKA 2C9AA 3HN3A 4QQHA 1E5HA 4ZPIA 3V0AA 1JYIA 3U0ZA 1C5IA 1QNWA 4EN9B 4CDUC 3OBAA 4C8DA 1G8WA 4NIHA 4HONA 1NCRA 4GJZA 3USUA 5KHGA 1PNGA 3D0SA 1Y9GA 4G4FA 2QTWB 2NPIA 3MIEA 1RITA 1HXS1 1SCRA 5FPAA 3C7HA 1MZ5A 3ATGA 5L7OB 4AXOA 1NG0A 2GNMA 3WQBA 1OFNA 2A6YA 3G7DA 2JWPA 3VBFB 3MPPG 1MZFA 4Q4V1 4D0QA 4I0BA 4IW3A 2H0VA 3HNBM 1YUDA 1BEV1 3ZYFA 2ZEXA 3BN6A 1Q43A 4XXPA 2X29A 2D97A 4QDRA 3OSDA 1XQNA 2RR13 3KM5A 1IS3A 3PUHA 2VL4A 4DB5A 1QIQA 3N9LA 4HT1T 3SITA 2GN7A 3LIHA 4IETA 4XUPA 3ES4A 4XIOA 4CCKA 1LAJA 5FZAA 5FCCA 5F9TA 5SV5A 1W6PA 5EV7A 3DXUA 4Y3OA 5EWSA 4AEDC 2VUAA 4GAZA 5J96B 4FTBA 2X5IC 1LRHA 5LY2A 4QKBA 1QJU1 2EF6A 4ZHNA 1W04A 5L9RA 1S0DA 1ZRIA 2XLFA 3KS7A 5J7MA 4R9DA 4CUBA 4ET7A 5A6XA 3LIGA 4Y24A 1PIV3 1R1A3 4AI9A 4CDUB 4CEYB 4IE0A 1YFXA 2Z4FA 4RHV3 2OPWA 3ZYPA 2JDHA 1LEMA 2ZEZA 1NY71 1QKQA 4Q4Y1 5JR2A 4FP3A 2QVSB 4XUTA 4XMIA 1JYWA 3BTAA 5CVRA 2JDMA 1RTVA 2MPFA 3WG2A 5DG1A 1QJY3 2AC1A 5G04L 1WLCA 3O12A 5F6KA 4YW2A 4WVZA 3VBRA 2XJTA 1AX1A 4FO9A 5I0DA 1QY4A 4N9IA 5KBFA 4BQWA 3HQXA 4HG6B 4C0BA 4DUVA 5BY5A 1OQDA 2DCJA 5C4WA 1GZWA 3VBOC 3KT1A 1NLSA 3IKWA 3UYJA 1POV0 3WG4A 5E8AA 1OH4A 1QJZA 4JGZC 3VDAA 1WBFA 4HSJA 4X6QB 1LECA 4CSWA 2XVGA 4P9LA 4RS5A 3DGTA 2CL2A 1QQP3 2P2KA 3VBHC 1S0BA 1SLLA 2HWF3 3J7MA 4QX2A 5FXXA 3EYPA 4WVWA 2NMOA 3S6PA 2ILMA 4XHBA 1DGWX 5C8WA 2E31A 4MGZE 1X8EA 2RR11 5D1IA 1YQ6A 4SBVA 2X5IB 5FRAA 3TEWA 3BIWE 2YV8A 1JODA 1LOGA 2HBTA 2ET1A 2WRAA 3HBZA 2W9XA 1UZ0A 2VNOA 4AGVA 4H7MA 4QHOA 4J1XA 4AGRA 2VZ3A 5FZBA 2IUWA 2AR6A 2ZX3A 4AVAA 3I3DA 1W6OB 2GMPA 2VUCA 1REFA 4DOUA 4GMP3 4S2HA 2PHFA 2VZUA 4CP0A 5ABJB 3AC0A 1PO12 2VMGA 1RUE3 1EAH2 1KITA 1S0GA 4BM8A 5JOZA 1DHKB 2Z69A 3DKWA 1UY2A 3CO2A 3ILFA 3LCPA 4YVWB 1X36A 2FDJA 1DGRA 3HT2A 3WNLA 5I0TA 4CUCA 1D4M3 4XUOA 1PIV1 1R1A1 2YYOA 1DQ5A 1H4HA 2IZWA 2QDNA 5A1AA 4JHTA 4RHV1 1R082 1XYOA 2D6LX 1COV2 3ZYBA 2XG3A 1FNYA 4N8MA 2V5DA 5FMBA 1BCXA 2A1XA 2D5FA 1UNBA 3OYWA 4YFZA 1QJY1 4LO4B 4XXAA 1AR72 2ZGMA 4JGZB 2HYXA 1R64A 1H9WA 2RVAA 3GNEA 4I0WB 5DZEA 5FXVA 5GZCA 2G1MA 2HWD3 2ZX2A 3ZN5A 5LBBA 4CEWA 3O1SA 3VBHB 3W5MA 4BIFA 5AC92 3PJQA 5EJ3A 1ULEA 1H2MA 2ZHMA 3WW1A 1FATA 4Z2AA 5ISLA 4E9KA 4LBMA 3TEYA 3I2GA 3B94A 2P34A 4LBQB 1REDA 4MXVA 2DDUA 2ZHKA 2RJ2A 3B02A 3KF3A 5HCAA 2C24A 5FP7A 1QQP1 2XDVA 3LEGA 3T4HB 2HWF1 2YB7A 1BMV1 4RGAA 4AFAA 1DYPA 3UKTA 4WVMB 1SG3A 3FUOA 2BVBA 1JH5A 2VZRA 4K21A 1K5MC 1J1TA 5FZCA 3NMBA 2FCVA 2CYFA 3HR9A 3K2OA 4UWDA 4AEKA 3LDBA 4HETA 2UWBA 3J4UH 4CE8A 2WA4A 5FY5A 2TBVA 3JD72 3C7EA 1W6NB 3WW4A 3I54A 3D0JA 1VALA 2YHJA 4GMP1 1W28A 3ACFA 1H2NA 3I3EA 4V1PA 3VBSA 4Y5TA 4XFIA 1RUE1 4CYDA 1HLCA 4Q8KA 3NRUA 3VZNA 3Q8AA 1KS4A 4DPNA 4F83A 4XBQA 4M4PA 4ZS2A 1UWWA 2D5HA 4PDWC 2ZZQA 4FP2A 1D4M1 4LXLA 1HB1A 2K46A 3CJIC 4K8FA 2Y8KA 3P1IA 1PGL1 4UF0A 2LW8A 2ZS6B 4IEXA 4J1WA 4BDVB 1B35A 3OGRA 3BTXA 1TME2 1W6MA 2R042 2OKXA 1AVBA 3MV11 5LASA 4Q0UA 1VAKA 4XQWA 5H9QA 3A21A 3WNKA 4CU7A 5KC5A 2GC1A 2GMEA 1YRZA 3JCIA 3JUUA 2OPKA 5A33A 4EYUA 1YHFA 2WJSA 4MGYE 4ZXEA 4R4XA 4MXWB 2OUHA 4CDWB 4QAWA 1F15A 4FPFA 3RI8A 1XNBA 1WCQA 4XJ8A 1WLDA 2AUYA 2RS51 4XCAA 1O3RA 3LSEA 5FR3A 3SH4A 2OX0A 3C8XA 4P00B 2RS33 5FKCA 4XDOA 3ETPA 1LHUA 4KWLA 1K5MB 5J09A 2VECA 1PHMA 4GH4C 4W6WA 4JV4A 1S1AA 4XF3A 3TN93 3K51A 3OBZA 3AZVA 4MLOA 2JECA 3PUQA 3KGZA 2PXJA 3H1YA 1KDMA 1CR7A 4AVTA 1Q8PA 5BNPC 3PVEA 1PVC3 1SFNA 4N43A 5FDBA 2WFF3 1ZX5A 1HRI3 3WP3A 5IK7A 4YZ1A 4KBBA 4YM2A 4PT6A 3VKOA 4Q27A 4D6RA 3UK9A 4AQSA 1U5ZA 1S2BA 4M3CE 1F8VA 2YPDA 4FQZA 1K42A 4PDWB 1NA1C 3ZYRA 2Y0OA 2WYSA 3CJIB 1C8M3 2WIIB 2FZ2A 2XJPA 4Y26A 5FZ7A 3PLQA 1WW7A 1CVNA 3HOBA 1ND2C 4W6XA 4LK6A 4OZOA 3PL0A 5DXDA 2Y60A 3ZYHA 2GH2A 2WYFA 4YW4A 2XB6C 1C3HA 1ST8A 3QACA 4Q8LA 3SNMA 4YZ2A 2Z2SB 2HEYF 3OY8A 1NXD1 3B9CA 5FYCA 1LULA 1SHWB 4GQ7A 5IVYA 1SCSA 2LUWA 4R8HA 4Y22A 3VDBA 1TG7A 3OGSA 4JGYB 3AXDA 4BWOA 1WMDA 3AZZA 4GH4B 1IPJA 5CKQA 5BXXA 3ZXDA 3MF9A 1GQPA 1WLTA 1DQ6A 4AHWA 1Q8OA 1UXXX 3PTRB 4IEYA 4D8MA 5IVCA 1JZ4A 2RS31 5IW0A 3O0XA 1GICA 5BNPB 3LDRA 2WNVC 3PUIA 2I2SA 2A6XA 1ODMA 3QLQA 3E6BA 4Q1RA 2WAAA 3J7HA 3UGGA 5CZKA 3TN91 1KFUL 5JI9A 3WUDA 3BPZA 3UJOA 3I59B 1NA1B 1Z78A 2XVKA 2DU0A 3VKMA 5L7OA 5IK5A 3THDA 4IEQA 3ZSMA 2VQ0A 1PVC1 1W0NA 3U4SA 3I2OA 1YIFA 2WFF1 1OD5A 1HRI1 1UYYA 3VBFA 4BQXA 2QQWA 3IT8A 3JBG3 3SCGA 4A4AA 4Y1YA 1ZRDA 4FPEA 4GWIA 4JKKA 1ND2B 1VBB3 3Q8CA 4OCTA 2MHFA 5HPOA 1WA6X 2Y26A 1I5ZA 2JB8A 3IPVB 1EUUA 3O7OA 5FXZA 2PHLA 1C8M1 4AGGA 5T55A 3OUJA 3I7DA 4QWNA 3LA2A 2R073 2DURA 2XJVA 5KWRA 1ASJ2 4AE2A 3W9AA 1FMD2 5BNNC 2WUHA 2YBKA 3NNGA 5GLZA 2JIJA 5IT6A 2UY8A 2YROA 3PURA 3H0OA 4LR4A 2W47A 2GALA 1NKGA 4ISRA 4OVEA 3RS6A 3U07A 3VL8A 5FOJB 5CKMA 1TEIA 3GDBA 1Z7S2 3AKRA 3BU7A 1GWMA 3LF7A 3M7AA 3NV1A 4XFBA 4IXLA 4NVPA 1WMEA 5KXBA 1G9FA 2XHNA 5FPBA 1QXRA 5FMOL 1WMFA 3H3ZA 4CDUA 4KWJA 3AL6A 4YM0A 5FPVA 2WO2A 4DY3A 1GZCA 3CL1A 2VZ1A 5BUVA 3JZVA 5LW9A 2PYTA 2WLPA 1BZWA 4PIZA 2VZTA 4UI9L 3ON7A 3EJKA 5JIUA 1ULOA 2LS6A 3M8LA 4BQ2A 3AP5A 1MS5A 1SBEA 2Q0AA 1QF3A 2DWRA 2GC0A 2W39A 2ZKNA 5I8SA 5I0RA 5CAZA 2WT2A 1HJFA 1WCKA 3T09A 3WLUA 5FZIA 1XOYA 5JLVA 3GHNA 4XTMA 5C8CB 2G19A 4DXTA 2ZOEB 4IESA 4E4ZA 1Y7BA 5FUIA 5FZKA 1AR63 2WNUC 1DBNA 2LTNA 4N53C 1XC6A 1D0GA 3S7IA 5FPLA 4DFSA 1CPMA 2XL7A 3UKVA 4Y4RA 4AI0A 1F9KA 1UYZA 2GC3A 5HXVA 2FDHA 4CDQA 5BNNB 3CZJA 1VBB1 3POEA 2RDSA 4XCBA 1JZ7A 3THTA 1DLCA 2W92A 3LKJA 4YW6A 2WWSA 3AFKA 1JS9A 3ZMOA 3KV5A 1JYXA 3V64A 2ORXA 4JVAA 2X5IA 3TYJA 4YGBA 2R071 1Q56A 4Z2WA 2ZAHA 5H9PA 2TEPA 1LHVA 1R093 5IUQA 1AJKA 2R16A 4MV2A 1OMIA 1RUI2 2GSYA 2FMYA 2WQ8A 4DMIA 1O4TA 1RUJ2 2HLEA 2OW4A 3DCQA 4OFGA 1N3OA 2Q8CA 2A70A 1W6OA 1GUIA 2PA7A 1JI6A 3PMEA 3POBA 4CCNA 1HX6A 4FBFA 4AFBA 4P9WA 5C5TA 4D94A 2VMIA 2RMU3 2VCAA 3LZZA 3AKPA 4ZS3A 4EN6B 3RVHA 2JE7A 1UOFA 1JTZX 3VKLA 1G9AA 3PTYA 3AX4A 3BIEA 4L9BA 3IDBB 4RSUA 4YVWA 1V70A 3KT7A 5CB7A 4SLIA 1Q3EA 3I3QA 3T3YA 1AYN3 4HPKB 2PN5A 1YFYA 2JDZA 5F3CA 1RJ7A 2P17A 3FJSA 1LCLA 4Q0VA 3SQOA 4G3YC 4FPOB 3RZHA 2JKXA 1IG0A 1GMMA 4EWAA 3O1UA 2J1RA 4CU9A 2WNUB 3OPWA 1WZXA 4N53B 1H4GA 3DYMA 3OB8A 1Y43B 4JGZA 3BU0A 3W58A 3RGBA 1VIWB 3L2YA 3PIGA 1YQ2A 1LEDA 4ES8A 3RWKX 1KRIA 3VBHA 2ZGTA 4ISQA 4A42A 1X9PA 4AQ6A 4D7TA 3N9QA 3LQCA 1CONA 1WLWA 3UGFA 5JMOA 1CZSA 2PHWA 2VZPA 4LBQA 1AR61 1T6GC 1WA4A 4MH0E 1AL23 4BXSV 2ZABA 2JIGA 2P37A 2N7GA 3K77A 4GWNA 2CU5A 5FY4A 1UO9A 1NE6A 4D3WA 3NV3A 3FHAA 1TNFA 4NRQA 4UFJA 4ITCA 5E89A 2Y64A 5A3WA 5C3QA 4WVMA 4QKDA 3ZFGC 4A7YA 1UY0A 1IHMA 5JPMB 3U4XA 3LGRA 3SEPA 2HWC2 1LOEA 1SMVA 4XAEA 3WZ1A 5F3EA 1GNZA 3P6BA 4M3CB 3RMXA 2ZGRA 1R091 1MEC2 5JI7A 1O59A 4NN0A 3V65A 2E7TA 3FN9A 4OHVA 4AW7A 1W6NA 4Y1UA 1J59A 1QHDA 1A8DA 4FXKB 5CIRA 4EWEA 4LA3A 1UYXA 1ENQA 4BXFA 4B3NA 2C0ZA 3PVNA 5FV3A 2RMU1 4M4RA 4QU1A 4NOTA 1RL3A 2WO1A 3ABZA 3S30A 1OKQA 1QJEA 3DF0A 4IV1C 2MEV2 5A3TA 4LUMA 2A6VA 2XR4A 4U36A 3U11A 1S0FA 4K8RB 1AYN1 5LBCA 3VZJA 5FP4A 1K12A 1LJ7A 2QNKA 3N9OA 4B1LA 2EALA 5HV4A 4Y5Z0 1GSLA 2IFWA 3QD6A 2WZR3 2JG9C 3NJYA 1AR82 3OD4A 4QQ2A 3MBWA 5T5JA 1TMF3 3I97A 4PJYA 2A5ZA 1X9TA 1FOD2 1JMUB 2J1UA 3PNAA 1UN1A 1UU6A 5IWFA 3VBUC 4DO0A 4P14A 3AMPA 5A7OA 3UGHA 4MXWA 1RUC1 2W91A 3HJRA 4CDWA 1Q8QA 1NZIA 5K8SA 1QH6A 2H6CA 4I02A 2JG8C 2D6MA 5A3LA 3ILNA 3ZFGB 2DYCA 2JJ6A 3GALA 2WDBA 2ZACA 5A6YA 2Y34A 1RHI2 1AL21 2XMLA 4PHZA 1V6KA 5FKBA 2DV9A 4PIXA 1YNAA 1EV12 1K5MA 3KCXA 1CWPA 4COVA 2IXCA 4HMZA 4UW4A 4PI0A 5AFBA 4XACA 5FZ4A 4YPJA 4WZFA 3RJRA 5EXOA 2DTYA 4UFIA 5T5OA 1F4AA 5FYTA 2CDPA 3OTFA 4M3CF 2Q8OA 1V0AA 1W6MB 2YC0A 1HRV2 3MIHA 4GB33 4LUKA 2UWAA 2XBO3 3RZJA 1JHJA 5ANNA 1QJX2 1ZZBA 1E5RA 2GC2A 1SLBA 4PDWA 1P8JA 1W0PA 3GYDA 5EFUA 3CJIA 5FPZA 2O14A 3U14A 4BQ4A 1RMU2 2QZ2A 4Q4W2 3BCWA 4TSVA 5CU1A 5JXHA 4J25A 3WF3A 3EMRA 3J7NA 3N9MA 2BU9A 1NOVA 2JG9B 3LEKA 3RMYA 3N4MA 4TXWA
chains in the Genus database with same CATH topology
3NNJA 3NNLA 2RDNA 3KT1A 4JZRA 3OUJA 3GZEA 5LASA 3OUHA 5IAVA 5LBEA 2JIGA 2JIJA 5ERLA 4MHUA 5DAPA 5EPAA 4XCAA 5IATA 2HBTA 4NHMA 5L9BA 5LA9A 3W21A 5LATA 4XAAA 4NHYA 5DAQA 5C5UA 4Q5OA 3OBZA 4XC9A 4ZPIA 4Y5SA 3HQUA 3OUIA 5EP9A 4ZONA 5A3UA 3ITQA 5LBCA 5HV0A 2G19A 2A1XA 5HV4A 4NMIA 2V4AA 4MHRA 4NHXA 4IW3A 3PL0A 4NAOA 2G1MA 5LBBA 2FCTA 4XCBA 2RDSA 2RDQA 2RG4A 4BQYA 3DKQA 5LB6A 3MGUA 4XABA 2Y34A 3W20A 4NHLA 3KT4A 5LBFA 2HBUA 5DAVA 5DAXA 4KBZA 5C5TA 2RDRA 5L9RA 4XACA 3GJAA 2FCVA 4UWDA 5L9VA 5IAXA 5EQUA 2OPWA 3KT7A 2Y33A 3BVCA 3NNMA 4Y5TA 5M0TA 3GJBA 3HQRA 2FCUA 5DAWA 4BQXA 4NHKA 3NNFA 4J25A 4BQWA 3EMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NNJ A;  3NNL A;  2RDN A;  3KT1 A;  4JZR A;  3OUJ A;  3GZE A;  5LAS A;  3OUH A;  5IAV A;  5LBE A;  2JIG A;  2JIJ A;  5ERL A;  4MHU A;  5DAP A;  5EPA A;  4XCA A;  5IAT A;  2HBT A;  4NHM A;  5L9B A;  5LA9 A;  3W21 A;  5LAT A;  4XAA A;  4NHY A;  5DAQ A;  5C5U A;  4Q5O A;  3OBZ A;  4XC9 A;  4ZPI A;  4Y5S A;  3HQU A;  3OUI A;  5EP9 A;  4ZON A;  5A3U A;  3ITQ A;  5LBC A;  5HV0 A;  2G19 A;  2A1X A;  5HV4 A;  4NMI A;  2V4A A;  4MHR A;  4NHX A;  4IW3 A;  3PL0 A;  4NAO A;  2G1M A;  5LBB A;  2FCT A;  4XCB A;  2RDS A;  2RDQ A;  2RG4 A;  4BQY A;  3DKQ A;  5LB6 A;  3MGU A;  4XAB A;  2Y34 A;  3W20 A;  4NHL A;  3KT4 A;  5LBF A;  2HBU A;  5DAV A;  5DAX A;  4KBZ A;  5C5T A;  2RDR A;  5L9R A;  4XAC A;  3GJA A;  2FCV A;  4UWD A;  5L9V A;  5IAX A;  5EQU A;  2OPW A;  3KT7 A;  2Y33 A;  3BVC A;  3NNM A;  4Y5T A;  5M0T A;  3GJB A;  3HQR A;  2FCU A;  5DAW A;  4BQX A;  4NHK A;  3NNF A;  4J25 A;  4BQW A;  3EMR A; 
#chains in the Genus database with same CATH topology
 5JUV A;  2RS1 2;  4LKS A;  2RDN A;  1F35 A;  3VBU B;  5C7G A;  3TNQ A;  2ZEY A;  3WV6 A;  2R06 2;  3ACG A;  1C4R A;  3C7G A;  5KC6 A;  4LO8 A;  2B7Y A;  3OGV A;  1LKN A;  2JG8 B;  1STM A;  2WZR 1;  2EXH A;  4QXH A;  3ZKY A;  2BJS A;  2VH9 A;  1TZO A;  2WWJ A;  5GLW A;  1TMF 1;  4CPB A;  3NJZ A;  1AR9 2;  1O91 A;  1RUH 2;  1N47 A;  4JGY A;  4MUV A;  1NAE A;  2GNT A;  3AYA A;  4XDQ A;  1SQ4 A;  4GH4 A;  3ALQ A;  2B9V A;  3E97 A;  1IZ3 A;  2Q1M A;  3B01 A;  3P3N A;  5HCF A;  2BTV C;  2WNE A;  1WUV A;  3N7M A;  1NQJ A;  3F95 A;  3NAP C;  4RQP B;  1OBN A;  3AL5 A;  1HV0 A;  3AB0 A;  2CGN A;  5BNP A;  5CA6 A;  2FD8 A;  4XC9 A;  1AX2 A;  2HWE 1;  2VUL A;  3O14 A;  4IE4 A;  4KMQ A;  1XSQ A;  5T5P A;  5HCH A;  2YC2 A;  1NX9 A;  2VVD A;  1S0C A;  3D8C A;  3GGL A;  3MIG A;  1W05 A;  3I59 A;  4BQ5 A;  1NA1 A;  3SH5 A;  4GZ9 A;  1DGW A;  4Y33 A;  2PHD A;  1XU1 A;  3M3Q A;  2EA7 A;  4ZON A;  3S7E A;  2G9F A;  2IVI B;  2VW0 A;  2XBO 1;  3ECQ A;  1ND2 A;  1ZA4 A;  1V6M A;  1IPS A;  2K0G A;  2OZ6 A;  2W3J A;  1UF2 C;  4OHX A;  3IPV A;  1WCU A;  1UY3 A;  1VRH 2;  2YFU A;  4NMI A;  4GJY A;  3QCW A;  2V4A A;  4P5Y A;  4AI1 A;  3LEI A;  3MI8 A;  1BHG A;  4NHX A;  4BQ3 A;  3VDC A;  2CAU A;  3O0W A;  3R4S A;  4DY5 A;  2NM1 A;  2XGX A;  1MS8 A;  2IXH A;  3FLR A;  5C70 A;  2ZBJ A;  2D98 A;  2ZMN A;  1VBA 2;  4LHK A;  4FXG B;  4QPI C;  1TVG A;  1DG6 A;  3P5B A;  5F39 A;  1SFP A;  2X05 A;  2MNG A;  2YBP A;  4KH9 A;  5JWP A;  4EJR A;  4WM8 C;  1LHN A;  3J7L A;  2W1S A;  5JOW A;  5FZE A;  2X8K A;  3LPF A;  3POJ A;  2WQZ C;  3VZK A;  2FDI A;  4NHL A;  1AYM 2;  3NAP B;  2WO7 A;  2YDE A;  2NYY A;  4B4R A;  1OOP C;  3WSO A;  1XPW A;  4GMP 0;  5IFP A;  5H9S A;  4ZU7 A;  4BHP A;  1A8M A;  4U2A A;  2WA3 A;  2NP0 A;  1CJP A;  2R1D A;  5GLU A;  1CD3 G;  2YXS A;  1OFS A;  3I2K A;  5FY1 A;  3POF A;  3ZOI A;  4XUN A;  2BVV A;  3BB6 A;  4LIV A;  4WVV A;  1PGS A;  4YWA A;  1G9C A;  4XTP A;  2OS2 A;  2R0H A;  1XU2 A;  2P1B A;  3CBN A;  1PGW 2;  1S0I A;  5FO7 B;  1C57 A;  2DVB A;  3WX5 A;  2ZGQ A;  1ND3 B;  2J1T A;  4MX3 A;  2B8M A;  2D93 A;  2EIB A;  1XXN A;  3ZXF A;  3URF A;  3U75 A;  2Y38 A;  5C8C A;  4I0A A;  1RUD 2;  4N7I A;  3M2M A;  3ZR5 A;  4URA A;  2B42 B;  4IER A;  3KHC A;  4L11 A;  1WW5 A;  5FFO C;  1C1L A;  1SPP B;  2ADD A;  5BNN A;  4MGT A;  1DGR N;  4FPG A;  4K6B A;  5FMC A;  2VMF A;  4QPI B;  3PHM A;  4JDO A;  2NN8 A;  3GF6 A;  5JPN B;  3KD4 A;  2ADE A;  1APN A;  2VW2 A;  3OUH A;  1SEF A;  1I9R A;  3AXE A;  5LBE A;  2HWB 2;  3T1L A;  3SXW A;  4BMB A;  4CUA A;  2YMZ A;  5FYI A;  2ZGU A;  5ERL A;  2ZGP A;  3MID A;  5FJK A;  4TZD A;  3HEI A;  4BLJ A;  2UYA A;  3P3P A;  2D3S A;  1O4Y A;  1YWK A;  1RXG A;  3LDK A;  5IAT A;  4CEW C;  3H42 B;  3RG0 A;  1IQD C;  2BV4 A;  2D44 A;  1VPH A;  2BGP A;  2ID4 A;  3HNM A;  4QB1 A;  4YW1 A;  1OOP B;  1U0A A;  3W21 A;  2DUQ A;  1CAX B;  1JN2 P;  3CQO A;  5GJ6 A;  4XAA A;  1Z0H A;  3MLJ A;  3AJY A;  2YGM A;  1BK0 A;  2VVF A;  3FHQ A;  5IVE A;  4HK9 A;  2XWJ B;  4S2F A;  1ENR A;  1SAC A;  3WP5 A;  5JOX A;  5FZG A;  1OUS A;  4RFR B;  4I3P A;  1LGN A;  1LOD A;  1W2A X;  1PO1 3;  3DL3 A;  4HPK A;  5EJ1 B;  5F5Q A;  3ZSE A;  1EAH 3;  3KCC A;  3H1W A;  1I1E A;  1UW8 A;  4HZF A;  4LBJ A;  4MGQ A;  4O9E A;  3USS A;  2WAB A;  4AED B;  2VQA A;  4B4Q A;  1H6Y A;  2WNU A;  4N53 A;  3HAG A;  3JQW A;  1R08 3;  2NMN A;  2VXJ A;  4HL0 A;  1DDL A;  2DCT A;  4XPV A;  1COV 3;  1DZQ A;  5HV0 A;  4Q4X 2;  4OI1 A;  1CPN A;  2XHK A;  1F5J A;  2BP6 A;  1V9U 3;  1CX1 A;  1KFX L;  4NPL A;  3ILR A;  4GWM A;  5FQ0 B;  1AR7 3;  3FFZ A;  4LNV A;  3RZL A;  4D6S A;  2ZHN A;  3OJB A;  4FCA A;  3ZSJ A;  4CP9 B;  1ZRC A;  4XIK A;  4XW3 A;  5FZ0 A;  5AC9 3;  1DZR A;  3M4F A;  4ZXK A;  3GZT B;  2A6W A;  4FPY A;  1YXW A;  1SLA A;  4NRM A;  5FZO B;  4DEQ A;  1PM7 A;  3SH3 A;  2G9G A;  2Y6G A;  3AMM A;  5F3I A;  4XAB A;  4CEW B;  1HKD A;  3WG3 A;  1ZNP A;  1GFF 2;  2Y0I A;  2P3J A;  3EB7 A;  4LIT A;  5F5C A;  3W20 A;  4FAH A;  5KXC A;  3WNP A;  1CX4 A;  4FSJ A;  1AXY A;  1E5I A;  2WS9 2;  2X10 A;  4M3C A;  2VXR A;  2VE1 A;  1U12 A;  4RA0 A;  2Q4S A;  3VBO B;  2BNM A;  1M06 G;  1J3Q A;  1KJL A;  2QZ3 A;  3B93 A;  2YG0 A;  1YQC A;  1HQW A;  2YBS A;  2J7M A;  3PU8 A;  2ZGO A;  3OBT A;  3UT0 A;  1W6Q B;  4H55 A;  5IVJ A;  3H8X A;  5KHJ A;  2RS5 3;  1LGC A;  3JD7 3;  2A7A A;  1W2N A;  5JXJ A;  2WWU A;  1LOF C;  1DLL A;  1OF3 A;  3WDV A;  4YG3 A;  4E2G A;  1PK6 C;  1GOH A;  3AM2 A;  3IWZ A;  3ZDS A;  2JEM A;  4CVU A;  3M70 A;  4LMF A;  1PO1 1;  5GLT A;  1G86 A;  2I45 A;  3GCX A;  3HNY M;  5IVB A;  1EAH 1;  2A6Z A;  1OUX A;  3K46 A;  4B1M A;  4CCJ A;  3V56 A;  2VZO A;  4F7Z A;  2GU9 A;  1DF0 A;  1FXZ A;  1AF9 A;  1FPN 2;  1L7L A;  2WT0 A;  1FAY A;  2VOK A;  3CEW A;  2WO3 A;  3JB8 A;  5CKN A;  1WD4 A;  1R08 1;  5D21 A;  2Y6F A;  1TME 3;  1COV 1;  2R04 3;  2XKO A;  4NE9 A;  2JDP A;  1KXG A;  1X82 A;  3ACL A;  3AYD A;  1CZT A;  2WZE A;  3KCY A;  4DNY A;  1V9U 1;  4FVV A;  1L7R A;  3FL7 A;  2A71 A;  4Y1Z A;  2LAL A;  3ZFG A;  1UOB A;  1LU1 A;  1AR7 1;  1CAU B;  4AQ2 A;  3E1F 1;  2DTW A;  4BE3 A;  5JXG A;  1OH3 A;  2IXL A;  1UAI A;  5DPN A;  2VMH A;  2V72 A;  1LES A;  3H8R A;  4HXC A;  3GM8 A;  2QQV A;  5AC9 1;  4JQR A;  1EUT A;  2F17 A;  3FX3 A;  1VMJ A;  1BBT 2;  2R1B A;  5L9B A;  5B2G B;  2HWD 2;  2QQK A;  5FBZ A;  1ENX A;  4LLO A;  4NIA A;  3ZIW A;  4C91 A;  4TTG A;  4KG8 A;  4AEJ A;  5A3N A;  1HW5 A;  3AMH A;  4IEZ A;  3WHU A;  1N1S A;  1WWY A;  4COY A;  4UOJ A;  2XUM A;  4FOV A;  1MVE A;  4YNI A;  1US2 A;  1MS4 A;  3AVR A;  4AI2 A;  4AWD A;  2D3P A;  5E1R A;  3WR0 A;  2UUR A;  1CGP A;  1I6X A;  2YPJ A;  4HFS A;  1PK6 B;  4A44 A;  1S4C A;  2BFU S;  2EIE A;  2JDK A;  5F32 A;  4JC1 A;  4YGD A;  3BKZ A;  4IGP A;  1UY4 A;  4CU8 A;  4A2U A;  5LRS A;  3N7L A;  3JD7 1;  4JAA A;  1CES A;  2BNO A;  1BQP A;  1O5L A;  2J1A A;  2JG9 A;  4ORF A;  2OZJ A;  4IEP A;  1Q8V A;  2ZX0 A;  4LHL A;  3SEE A;  3VBU A;  1W2T A;  2ZX1 A;  4MHR A;  2E7A A;  4DIN B;  3PUA A;  5CFD C;  4BK4 A;  4HLT A;  2Q8D A;  4FFG A;  4JDN A;  4E8C A;  4ZKT B;  5IYY A;  2JG8 A;  3WQ0 A;  4ERO A;  5A3M A;  2WSV A;  3WF0 A;  3WDW A;  4QQP A;  1J84 A;  4HK8 A;  2NZ9 A;  1PO2 2;  1MPX A;  1DU3 D;  2OVU A;  3ACI A;  3O0V A;  1W8W A;  1GP4 A;  1WCS A;  4LPL A;  1TME 1;  3SMH A;  3D5O A;  2R04 1;  1OPO A;  1YEW A;  1F4H A;  4WM7 C;  2AYH A;  2CV6 A;  1H1A A;  3T2O A;  4PQQ A;  4PI2 A;  1KD7 A;  4UAP A;  4PBO A;  3RJ2 X;  3AMQ A;  3GCW A;  1JYV A;  2PHU A;  2VBP A;  2HBU A;  4LKE A;  2QKD A;  4RQP A;  4YVS C;  1W2O A;  4UW3 A;  5AFE A;  1GZ9 A;  2HEW F;  2D6K A;  3RI9 A;  4FPC A;  4FI9 A;  3WDY A;  3B00 A;  4AFC A;  2PFW A;  4O9G A;  1W9S A;  2OQ6 A;  2WL1 A;  1S0J A;  4KWU A;  3WW2 A;  1V00 A;  3ME2 A;  4XF1 A;  3WUC A;  1LHO A;  1PMJ X;  1IOA A;  1BYH A;  3A22 A;  2Y6H A;  3WNX A;  1GYK A;  1RGS A;  3AYE A;  4JX0 A;  3GXU A;  4PIY A;  2WAO A;  3IIA A;  5FO9 B;  2AAC A;  3LWC A;  5SV8 A;  3I8T A;  1UMI A;  3HQR A;  4IND A;  4CRQ A;  4CDX C;  1GAN A;  4WV8 A;  5F1R A;  2PAE A;  4NHK A;  4IV3 C;  4IQP A;  4E4H A;  3S5A A;  5JAX A;  1VR3 A;  3DXT A;  3J8F 2;  3LFM A;  5CFD B;  3VGI A;  4CCE A;  1XNC A;  2WC2 A;  3X29 B;  4IE6 A;  1QNY A;  4OMC A;  1QOT A;  1YJK A;  1H30 A;  3IB3 A;  3LB9 A;  5JXI A;  2E63 A;  1HB4 A;  1O6U A;  2VUD A;  3IZO A;  2BYV E;  2VQU A;  3UNP A;  5C71 A;  1ASJ 3;  1VMF A;  3BYW A;  3EHK A;  4HAN A;  5DDJ 2;  1FMD 3;  2J1E A;  4C90 A;  1BVV A;  4FOQ A;  4WM7 B;  3A4U A;  4WZC A;  4A41 A;  2FDG A;  3L9J T;  1W3X A;  2PQQ A;  1Y4W A;  3O5S A;  2WN3 A;  1JHN A;  1NCR C;  2ZXQ A;  3AVS A;  3EQE A;  3NJX A;  4QX8 A;  4H2A A;  4XFG A;  2BDR A;  3NAP A;  3THC A;  4QDQ A;  1VBC 2;  1GKB A;  1MS9 A;  1Z7S 3;  5B4X A;  2ERF A;  2ZTN A;  4PLO A;  5LA9 A;  4BIO A;  1W0O A;  2W1W A;  4NHY A;  1H1I A;  3DPR C;  4M0H A;  2B5H A;  4LOS A;  3RYK A;  1OQ1 A;  4XQ4 A;  3EXU A;  4Q0S A;  1OLQ A;  1D2S A;  4YW7 A;  5KXE A;  3GZA A;  1B09 A;  4ARX A;  3ZXL A;  1YLL A;  3INA A;  1EYB A;  4CDQ C;  3ST7 A;  3ZN6 B;  4ZZ5 A;  3PVO A;  3TOJ A;  4V2W A;  1ND3 A;  2CHH A;  3T2P A;  1O8P A;  4QGN A;  1O4Z A;  4JCK A;  2K2S A;  3IDA A;  3VL9 A;  2DVD A;  2PHR A;  3K3O A;  1PMH X;  5C3O A;  2RJK A;  4LT5 A;  4IV3 B;  1KGY A;  3POS A;  2QQL A;  3LPG A;  5JCT A;  3VZL A;  3BTZ A;  3VB9 A;  5FY8 A;  4QHB A;  4YZ4 A;  5C33 A;  1SPP A;  4LJH A;  4FOW A;  1LOA A;  5BPX A;  3H50 A;  4D6Q A;  5FO8 B;  4QPI A;  2DF7 A;  3S5Q A;  3TRS B;  5CG8 A;  4DXR A;  1XBF A;  2WQ4 A;  2ZCW A;  1EY2 A;  1D7P M;  2VZV A;  2WNV B;  3B69 A;  3FMG A;  3PU3 A;  4NRP A;  3BUC A;  5J36 A;  3III A;  1J3R A;  3KVB A;  1K5J A;  1UIK A;  4EV0 A;  5LY1 A;  5FZL A;  3MF6 A;  1SBF A;  4E4S A;  3O1R A;  3I2F A;  1LNS A;  2F6B A;  4RYD A;  2C5D A;  2DUP A;  4RFT 0;  4LE3 A;  2BOI A;  1W03 A;  2VD7 A;  1MZ6 A;  1ZZC A;  5BNO C;  3LE0 A;  2JX9 A;  3JBG 2;  2VNR A;  2BEO A;  4TYS A;  1OOP A;  2VTX J;  1XE8 A;  1ASJ 1;  2W94 A;  4MZU A;  1CAX A;  4XF9 A;  4E8D A;  1FMD 1;  1H8T C;  1POQ A;  3KQ4 B;  1QJF A;  1UKR A;  2JDA A;  3DPR B;  1RUI 3;  1VAM A;  5DQ0 A;  1XJA A;  3FUQ A;  1OLR A;  5FLJ A;  1RUJ 3;  2D43 A;  3POI A;  1XNT A;  1UIJ A;  3K75 B;  4KBZ A;  2GDF A;  2XUE A;  5LEJ A;  4IE7 A;  5ACA 2;  1HN0 A;  1XNA A;  2ZMK A;  2TUN A;  3K4A A;  1Z7S 1;  4IL7 A;  5C4W C;  3R4U A;  4CDQ B;  1LOB A;  1IPK A;  5IVF A;  1ZRF A;  4AVV A;  2UYB A;  3NVC A;  5FZ6 A;  3SLI A;  3JQX A;  4GXL A;  2VR4 A;  3RYR A;  2D3R A;  2Y33 A;  3SCF A;  1N3Q A;  1WMX A;  4NUB A;  5FRE A;  1RUG 2;  4AED A;  3EBR A;  5CG9 A;  1UOG A;  4CCL A;  3LEM A;  3I49 A;  1HJG A;  4QD2 A;  2ZGL A;  4CXY A;  3N3H A;  2W5F A;  5CIS A;  3CIH A;  1ZM1 A;  4C1X A;  1W8T A;  3A0N A;  1ZRE A;  1UMH A;  4KWK A;  4LBO A;  3U1X A;  5KHK A;  2DU1 A;  3C3V A;  4QXK A;  4D7S A;  4YZ5 A;  1T2X A;  4RGK A;  2SBA A;  4L97 A;  1WCD J;  5E6H A;  4A45 A;  4OHW A;  1UX7 A;  5FQ0 A;  4KI5 M;  1W9F A;  4Q29 A;  2LRO A;  3BTY A;  4NID A;  1UZW A;  1URX A;  1HB2 A;  4CP9 A;  1MS1 A;  4P9I A;  3VKN A;  5FYM A;  2Y6K A;  4QPW A;  1JZ6 A;  2BBV A;  1ZZ9 A;  2ZAA A;  2E51 A;  1VJ2 A;  4HKO A;  4I3G A;  3HVD A;  5FZO A;  5IAV A;  3WF2 A;  1ENS A;  1ULF A;  3OEB A;  4MHU A;  3T2Q A;  1CQ9 A;  1EPW A;  2B4K A;  3OGG A;  3WP6 A;  2ARA A;  3ROU A;  1PZ9 A;  3LD8 A;  5BNO B;  3TEX A;  3ZVX A;  1QMJ A;  3ETQ A;  3H1M A;  5JDB A;  5J37 A;  2FDF A;  1H8T B;  1CAW B;  2W52 A;  2XJQ A;  2XLG A;  5A7S A;  1OLM A;  4QX3 A;  2FMD A;  4MOA A;  3VBO A;  5FJH A;  2EIC A;  2HWC 3;  1RVF 2;  1O3T A;  4CP2 A;  2VW1 A;  4M0N A;  2B9U A;  4AQT A;  2PAM A;  4I30 A;  1RUC 3;  3E5U A;  2VO5 A;  2RM2 2;  1MEC 3;  1W6Q A;  1YIP A;  2WSU A;  3M3E A;  1W8Z A;  1RUI 1;  4UBH A;  1RUJ 1;  2JB4 A;  5J48 A;  4AVC A;  4IEU A;  1SLI A;  3OUI A;  3IN9 A;  3ZM8 A;  1UU4 A;  1ZBE 2;  4N7U A;  1OHF A;  2ZGS A;  5FZM A;  1RUF 2;  5K0U C;  3WCS A;  1LTE A;  2PAK A;  4QPG C;  1VB2 A;  2MEV 3;  4XOG A;  4IEV A;  1XB9 A;  3AMN A;  3KF5 A;  2C9K A;  4JRA A;  1DYK A;  2PEL A;  1FV2 A;  2W08 A;  2FHR A;  3RWN A;  5F2W A;  2ZZJ A;  2XON A;  1OVS A;  2HH9 A;  2BW8 A;  4XBN A;  4R4Z A;  4NAO A;  5A80 A;  2EXJ A;  5KXD A;  3NV2 A;  3Q8F A;  2WZP P;  1LEN A;  1AR8 3;  4COU A;  5EZW A;  4FT8 A;  5IHR A;  4L2N A;  2D6N A;  1FOD 3;  2QE3 A;  4AHY A;  1CAU A;  2VZQ A;  5A1L A;  1W06 A;  2VQT A;  2GAU A;  5FZ8 A;  5FXW A;  5A7W B;  3D82 A;  1KS5 A;  3M3O A;  4HKW A;  2VOX A;  2EAK A;  1W99 A;  3ZFE C;  4HVR A;  4XJW A;  1N3P A;  1RIR A;  1U5Y A;  1V6N A;  1RHI 3;  3KT4 A;  1AUY A;  2BGO A;  2VPV A;  5DAX A;  1EPZ A;  1EV1 3;  5F7U A;  1LB2 A;  1VLN A;  2GH8 A;  2QQJ A;  3R4D B;  1AL0 G;  4BQ1 A;  3NL1 A;  5BV6 A;  3LAG A;  4FPL A;  4ZZ8 A;  1O3S A;  1JOJ A;  2FQP A;  2H0B A;  5FZF A;  1W9W A;  1MS3 A;  3VHN A;  3W5N A;  2HWC 1;  1BXH A;  4Z8B A;  1LOF A;  3MZH A;  5GAL A;  1ZBA 2;  1S0E A;  4HSL A;  1O8S A;  4L0P A;  1PK6 A;  2R49 A;  2Z79 A;  5E16 A;  3NJV A;  4AAP A;  2WT1 A;  1HRV 3;  1MEC 1;  2Q5T A;  3FHI B;  4R9C A;  1CIW A;  5K0U B;  2WIN B;  3B5L B;  1QJX 3;  2VCC A;  3RZZ A;  2DFB A;  5GLV A;  3THP A;  1GWK A;  1W3V A;  1CZV A;  1RMU 3;  2RV9 A;  4Q4W 3;  2PLV 2;  2Y6J A;  1XSR A;  4HKL A;  2HWE 3;  2IC1 A;  2ORZ A;  2AZ5 A;  1AXZ A;  4YW5 A;  4DQA A;  4UW6 A;  3IAP A;  4AEM A;  4CUG A;  2MEV 1;  2VGD A;  4OMD A;  1UOJ A;  1D2Q A;  1N1T A;  2IXK A;  2RS1 3;  3KQR A;  3QH7 A;  1JZ8 A;  2BRT A;  4JHZ A;  3VD4 A;  2R06 3;  3KWV A;  4IEW A;  5IK4 A;  4X6R B;  3O1O A;  1VBD 2;  1K3I A;  3BOW A;  1MR5 A;  4H14 A;  4IV1 B;  3RNS A;  1AR8 1;  4N43 C;  1NLQ A;  1VBE 3;  3LSD A;  3MUZ 1;  1TNR A;  4B7E A;  1AR9 3;  1FOD 1;  5EPA A;  1XRU A;  1XND A;  1F5F A;  4KG0 A;  3AFG A;  1RUH 3;  4YZ3 A;  4CXX A;  4LO6 B;  5LEK A;  1CJD A;  3ZMN A;  3D3A A;  2DVA A;  3MIC A;  1QH7 A;  3KV6 A;  1UZY A;  1TMF 2;  2J42 A;  4AYU A;  1ULD A;  1RHI 1;  4LBK A;  4QMA A;  2E32 A;  2H6B A;  4YSF A;  4Y20 B;  1JYN A;  2CY6 A;  4AFM A;  2WZ8 A;  3MLK A;  3ZSK A;  1GU3 A;  4MET A;  4MG2 A;  4DIQ A;  1EV1 1;  5JZG C;  5DUV A;  1D4V B;  2P6C A;  2ET7 A;  1D0H A;  2OII A;  2YFZ A;  2WR9 A;  5F2S A;  3GZU C;  3MW3 A;  4BME A;  3T30 A;  5FP8 A;  5LCW L;  3K48 A;  2ATF A;  1TQ5 A;  4UFK A;  5GZD A;  2GNB A;  2C6S A;  5FY7 A;  1NE4 A;  4RGG A;  4XFH A;  5LA1 A;  4AOC A;  4N9H A;  4NIG A;  3MIF A;  5A3U A;  1HRV 1;  5CFD A;  1YQ8 A;  4NII A;  1OA3 A;  1QJX 1;  2QBX A;  4N90 A;  3FBM A;  1OD3 A;  4OUE A;  2BOJ A;  2Q30 A;  1VRH 3;  3I3B A;  3RDI A;  1KEX A;  2JDN A;  3ES1 A;  4HVO A;  3SCH A;  3ZR6 A;  1RMU 1;  4Q4W 1;  2HYK A;  4GB3 2;  5KHH A;  1LHW A;  4GA9 A;  4AR2 A;  3SHR A;  2RG4 A;  2VNG A;  4WM7 A;  5JSO A;  5LA2 A;  1VBA 3;  3AZW A;  2NQY A;  4O61 A;  2HKX A;  2R0F A;  4V2V A;  3WIN E;  1IS5 A;  2RS1 1;  4FTE A;  2Z5W A;  4YRD A;  2R06 1;  4YVS A;  4EN8 B;  3ZSL A;  5A70 A;  3T4V A;  1C5H A;  2A75 A;  3T0B A;  1ZYB A;  3OEA A;  2ZX4 A;  4OQ9 A;  5I8Y A;  4DS0 A;  1AYM 3;  3HBK A;  1H0B A;  4AVS A;  1VBE 1;  4LBL A;  2CAV A;  1RYY A;  1AR9 1;  3F2Z A;  4MYE A;  5DAB A;  3WEZ A;  4E4D X;  5FIX A;  1RUH 1;  4LKD A;  2AEZ A;  1HN1 A;  3ZDV A;  4ARY A;  5JZG B;  4K9S A;  1XNK A;  2DVG A;  2EIG A;  4ASL A;  5J98 B;  5L9V A;  1HXS 2;  3FC0 A;  3ZN6 A;  2FDK A;  2WKK A;  3NO8 A;  5FZ9 A;  4E2Q A;  2CGP A;  1RUN A;  1ULG A;  3H8O A;  4OHY A;  2VBB A;  1ACC A;  2UWC A;  3ZXJ A;  1BKZ A;  3BVC A;  3J26 N;  1W90 A;  3NWK A;  2VMC A;  3AK0 A;  3CJX A;  2ARC A;  3CZU A;  4IV3 A;  4Q4V 2;  5FMD A;  3I2I A;  1BEV 2;  5DMY A;  4YFW A;  4YW3 A;  3UJQ A;  4XVH A;  1BJQ A;  3NNF A;  3K4Z A;  4M00 A;  4Y1X A;  1YFU A;  3RQ0 A;  3E6C C;  1ONA A;  1RUD 3;  4MAD A;  3WDT A;  3BI3 A;  4URT A;  2WNV A;  1JXN A;  3G6J B;  4QKN A;  4B4P A;  1FNZ A;  3H3U A;  4JDM A;  1A78 A;  4LA2 A;  1GP5 A;  3C7F A;  5L19 A;  3CU7 A;  4CEY C;  2W95 A;  3CLP A;  1REE A;  1VRH 1;  3IMM A;  4AG4 A;  1SLC A;  3POY A;  4XFA A;  3RZM A;  2HWB 3;  4PF1 A;  1DFQ A;  1QJU 2;  2P3K A;  3PDQ A;  4AHX A;  1ULC A;  5EIY B;  2YUE A;  1NQD A;  2QQI A;  3OGJ A;  4B7K A;  4BPZ A;  1NUK A;  1VBA 1;  3DPR A;  2JXA A;  3TWI A;  5BYN A;  5C6C A;  4IGQ A;  3OF1 A;  1Q8S A;  1A6C A;  2VY0 A;  4NHM A;  1OA4 A;  4UT5 A;  3AYC A;  4IGO A;  1QGL A;  2O8Q A;  2QUO A;  2Q1F A;  4FOY A;  4F8A A;  5JSR A;  4Q4Y 2;  1NY7 2;  2DUO A;  1H9P A;  2R32 A;  2QQU A;  3DN7 A;  3AP7 A;  1H1M A;  1BVP 1;  1HV1 A;  1RXF A;  2A3W A;  2KR2 A;  4XJZ A;  1CAV B;  4RN5 A;  3VHO A;  5FOB B;  1AYM 1;  1UZV A;  3AKS A;  1KJR A;  4OUM A;  1GOG A;  2ZHL A;  2EXI A;  3H7J A;  4MSV A;  1VP6 A;  4NWV A;  4R9A A;  4XF0 A;  5LRR A;  1U5X A;  4FQ4 A;  2GZW A;  4WM8 B;  3ZYI B;  1UKG A;  4KL1 A;  5FWJ A;  3KVA A;  4R9B A;  1J58 A;  2PTM A;  1WD3 A;  4X8P A;  1WGP A;  2WNO A;  1YYN A;  5JIA A;  3ELN A;  2P5B A;  2GMM A;  3ITQ A;  3WF4 A;  2QDR A;  1DCS A;  3CMG A;  3AP4 A;  3H9A A;  5GZF A;  3FZ3 A;  4QQO A;  3DYO A;  5FMO S;  1PGW 1;  3BGA A;  1GV9 A;  4Q4X 3;  5K7P A;  2R7E B;  1U5I A;  2RR1 2;  1BLZ A;  4LHN A;  3RFR A;  1EP0 A;  2Z42 A;  1HQN A;  4ATF A;  3V0B B;  1RUD 1;  1RB8 G;  4BOW A;  3GBF A;  1WBL A;  3B9I A;  5BNO A;  4IDZ A;  2W2I A;  1UPI A;  3GHM A;  1ODN A;  4YVW C;  2VTX A;  4XIL A;  2VOW A;  1H8T A;  4QT6 A;  1CAW A;  3UKN A;  1GLH A;  4GD4 A;  4MVT A;  1S2K A;  2O0O A;  2ZEW A;  4OUS A;  5DUX A;  2RJL A;  4XET A;  3WF1 A;  4CTE A;  2VVE A;  3GBG A;  4QXB A;  3WCR A;  3DEC A;  3WXP A;  1FYU A;  1UQX A;  2HWB 1;  3OD0 A;  5APA A;  5LBF A;  5DAV A;  3BOP A;  2EAA A;  2OYZ A;  4Q0Q A;  4BB3 A;  2WS9 3;  4CXW A;  4GKY A;  3ZFF C;  5I0S A;  1SBD A;  1LU2 A;  2A3Y A;  2RDR A;  2TNF A;  1UY1 A;  3VKF C;  1GWL A;  5CEH A;  1PIV 2;  1R1A 2;  3KV4 A;  4AL9 A;  3T0A A;  5JMC A;  3JXS A;  2W68 A;  1G9B A;  4GWJ A;  4RHV 2;  4GUL A;  1C1F A;  2QQO A;  1UZZ A;  2I07 B;  4IUG A;  3WQ7 A;  3S57 A;  1JBC A;  1OI6 A;  3K4D A;  5CNA A;  4O7X A;  1W8F A;  3IM0 A;  1SFY A;  4RR3 C;  2JDU A;  1QJY 2;  5FPU A;  4CZS A;  1PGL 2;  1J1L A;  1QXP A;  2XOM A;  5I0U A;  4F3J A;  5CAD A;  3MFA A;  4LBN A;  3ZXG A;  2CSG A;  1MQT C;  5L36 A;  5GM0 A;  3ZIX A;  5CFC C;  2J22 A;  5HI0 A;  1MZE A;  4EZ4 A;  2JD4 A;  3VZO A;  4XEZ A;  2VUJ A;  4IE5 A;  4PBP A;  3ZPO A;  1FPN 3;  1Y9M A;  4DXZ A;  3TB0 A;  5FAX A;  3FFQ A;  1QQP 2;  4TWT A;  4W6Y A;  2CWM A;  2HWF 2;  5T52 A;  1BMV 2;  2BQP A;  4HOO A;  3TNP B;  1X8M A;  2HJI A;  3VN4 A;  4Q4X 1;  4XJU A;  5A7W A;  4A7Z A;  2V09 A;  1FV3 A;  3AZX A;  5ABJ C;  3Q8E A;  1QDC A;  4ZY9 A;  4LE4 A;  2E33 A;  3ZXA C;  2IFR A;  3U78 A;  1W8O A;  4AZZ A;  3D4K A;  3FBY A;  4CP1 A;  3TEZ A;  1JUH A;  4E2S A;  3ZFF B;  1V9U 2;  2F4L A;  2KXL A;  5LAT A;  1BBT 3;  4H3W A;  4XMA A;  2ZGN A;  4Q5O A;  1W39 A;  1RC6 A;  2G4I A;  1V6L A;  1RUE 2;  4XJA A;  4OI0 A;  3A0K A;  4AK3 A;  2WS9 1;  4ZU5 A;  4PCR A;  1H8V A;  1O7F A;  1VAV A;  1XE7 A;  1GP6 A;  3WP4 A;  4I2O A;  4QHZ A;  5K0U A;  1D4M 2;  1WW4 A;  4JTN A;  4RR3 B;  3OOX A;  4FPH A;  4QPG A;  2D6O X;  4LTA A;  1LR5 A;  4Q2F A;  3NV4 A;  4E27 A;  4CU6 A;  4DEV A;  3W59 A;  2G9Z A;  2E9Q A;  2ZA9 A;  4ASM B;  5A6Z A;  4CDW C;  4Z82 A;  1C28 A;  5T3N A;  3BPS A;  1MQT B;  3MLL A;  4UFM A;  4DUX A;  3KV9 A;  4AVB A;  2E26 A;  4HBN A;  5A7N A;  2XQR A;  5CFC B;  2P3I A;  3SKV A;  1OPM A;  2FZ1 A;  5F6L B;  4LBQ D;  1KDK A;  3I3M A;  4QB6 A;  2XQX A;  5HXM A;  5FYZ A;  2VCB A;  5C9A C;  4W65 A;  4C0H A;  4L92 A;  1GOF A;  5LK7 B;  2RS5 2;  1POV 3;  2YZ4 A;  1QOS A;  1W8N A;  4Z92 B;  4FFI A;  4XFC A;  3OCP A;  4PF5 A;  3GBW A;  3ZKU A;  3N7J A;  2EXK A;  2BGC A;  4IV1 A;  4LOR A;  2R6Q A;  3KGL A;  3ZFE A;  5TSW A;  1FPN 1;  1JOB A;  2K9Z A;  3MW2 A;  5A32 B;  1GBG A;  5LB6 A;  3T2T A;  4AFD A;  1G6N A;  1PO2 3;  3FWE A;  3J9S A;  3MGU A;  2KD7 A;  4Q26 A;  3ZXE A;  5JVV A;  4ASK A;  1CN1 A;  2IXI A;  4QX0 A;  3CKH A;  2JEN A;  2BUK A;  3JU9 A;  5FUP A;  1DP0 A;  1IGO A;  5G05 L;  3I2D A;  1DQ1 A;  3TBD A;  1VRB A;  1GNY A;  5D2A A;  4PLN A;  1JU4 A;  4Z1V A;  5T5L A;  2GP3 A;  3VHR A;  3WVJ A;  5FZH A;  2WBK A;  3WT3 A;  4Y20 A;  4JTO A;  3ZPY A;  3O1P A;  2VAU A;  5FLH A;  2DFC A;  2DBI A;  4A3X A;  2V4V A;  3MUY 1;  2JD9 A;  1YFW A;  3HWJ A;  4GIQ A;  2B45 X;  3OBR A;  2ETE A;  1BBT 1;  5EQU A;  1RJ8 A;  1NT0 A;  2J1V A;  3JB4 C;  2HWD 1;  3KB5 A;  4LO7 A;  5C3R A;  4RD7 A;  4P9G A;  3HMY A;  5I91 A;  1ZRR A;  4AI8 A;  3E6D A;  1W8U A;  3KSC A;  4QM8 A;  5F8P A;  2YGL A;  3N9P A;  4ONU A;  4PLM A;  4XDP A;  1PZ8 A;  4QXC A;  4JGY C;  3HN1 A;  2VU9 A;  5C9A B;  3K3N A;  1NCQ C;  3VD9 A;  2XLA A;  2SLI A;  4NPM A;  3J8F 3;  1DQ2 A;  4HN1 A;  2VME A;  2E53 A;  5D8A C;  4OI2 A;  3T1M A;  4JKL A;  1UX6 A;  1N1V A;  1DQ4 A;  2W1U A;  2VM9 A;  4YAR A;  4P5H A;  1FI2 A;  3U10 A;  4HVQ A;  1QOO A;  1OVP A;  5JR7 B;  1OQE A;  4KU7 A;  2DBN A;  3MYX A;  1POV 1;  5DDJ 3;  1S2E A;  3MO4 A;  4QGM A;  5T50 A;  5GZE A;  4CA9 A;  3ZYJ B;  3VDD C;  2RS3 2;  4NAM A;  5KHI A;  3MPB A;  5JOY A;  4QX5 A;  1AX0 A;  1UL9 A;  3M1H A;  3AP9 A;  1PO2 1;  3AJZ A;  4GKX A;  2W0X A;  1VBC 3;  3TN9 2;  5JZG A;  2LM3 A;  2XJS A;  1F2N A;  5BNQ A;  2O8O A;  4K3U A;  4NR1 A;  3BAL A;  4P08 A;  1A34 A;  4D7Y A;  3ZYG A;  2YU1 A;  1PVC 2;  3UV9 A;  2WFF 2;  2AEY A;  1RUO A;  1HRI 2;  4AI3 A;  3VD7 A;  3WNM A;  2ES3 A;  1W9Y A;  4MGI E;  3H3L A;  3C7O A;  1DGL A;  4EQV A;  2JIC A;  2P6H A;  4X8N A;  1C8M 2;  2F4P A;  4QKF A;  2D7F A;  5CBL A;  4DRR A;  2GN3 A;  3CNA A;  2QQM A;  4YVS B;  5FK7 A;  1JOP A;  1MAC A;  1NCQ B;  5C3S A;  2O1Q A;  1V6O A;  4XZP A;  4QQL A;  5F5I A;  3KHB A;  4K7J A;  2ZPX A;  4CPB D;  3POW A;  1YO8 A;  2JE9 A;  3I4I A;  3ACH A;  5D8A B;  5I8T A;  3VLB B;  4FFH A;  3FLP A;  3WDU A;  2NLR A;  1DZT A;  4BLI A;  3NW4 A;  4PQ9 A;  5EYY A;  1I5P A;  5F5A A;  4LKF A;  4R52 A;  4BQY A;  3J8F 1;  2DCZ A;  3VD3 A;  4XJ9 A;  1UCX A;  2OXB A;  3Q8B A;  5I93 A;  3M3I A;  1I3H A;  1GZT A;  2RE9 A;  3ORJ A;  4LQR A;  4IEO A;  3RPQ A;  4CCD A;  3VDD B;  1SLT A;  4LLF A;  4OLL A;  1H2K A;  4Z07 A;  4CDX B;  5LA0 A;  4P9Y A;  4FPK A;  1IKQ A;  1PVX A;  1XE0 A;  4M01 A;  4Q0P A;  3MIB A;  2VOV A;  5DDJ 1;  3HT1 A;  2C4X A;  3HIF A;  3OPT A;  5C8C C;  5FLI A;  1IQA A;  2ARB A;  1CAV A;  1HQL A;  1ZZ8 A;  5FZ1 A;  1G7Y A;  2XJU A;  5DUW A;  2ARX A;  4MO3 M;  1GQH A;  4J6G A;  5ACA 3;  1JYT A;  3C2U A;  4QDS A;  5JSP A;  1VBC 1;  2B46 X;  5IAX A;  1UPS A;  1YC6 1;  4WM8 A;  3V0A B;  3LOI A;  4OHZ A;  3N36 A;  4FPJ A;  1OUR A;  5FZ3 A;  1A3K A;  1GNH A;  1Y3T A;  2ARE A;  2CNA A;  5M0T A;  4QPY A;  1RUG 3;  1XYP A;  1NCR B;  2C26 A;  5FYY A;  2VZS A;  1VB4 A;  3GJB A;  5FYU A;  4FAG A;  5A7Q A;  2A73 B;  5DZG A;  2FCU A;  4XYX A;  4UYB A;  3USU B;  4AF9 A;  4BZ4 A;  1VBB 2;  3DUI A;  1K45 A;  4DXS A;  5CYY A;  3VBR C;  4LEJ A;  3NNJ A;  3NNL A;  4EWD A;  2ZJC A;  5H9R A;  5FYS A;  1YCI A;  4CEY A;  5FK8 A;  5FYV A;  2R07 2;  4JZR A;  3WD5 A;  2D40 A;  1H6X A;  3I2H A;  4YYO A;  3WDX A;  3WOG A;  3V0B A;  1SDW A;  1IS6 A;  3E5Q A;  3WQ1 A;  4H7L A;  3ZX7 A;  3QOP A;  3OPZ A;  5LWB A;  1Q5O A;  3A7Q A;  3VV1 A;  3IDE A;  3VHP A;  5FP9 A;  1US3 A;  3T08 A;  2YY1 A;  4A7K A;  1OC1 A;  4RS5 C;  2WFP A;  5FWE A;  2PMW B;  2OQ7 A;  4XBL A;  2DVF A;  2IVJ A;  4K1Z A;  4EN0 A;  2CTV A;  2QQN A;  3RZK A;  1W6P B;  4NPR A;  4FTS A;  4UXA A;  5K9Y A;  3A23 A;  1FT9 A;  4YLZ A;  1UU5 A;  2Q1Z B;  2CGO A;  3B3Q E;  1OSG A;  4JKM A;  5DAQ A;  1FX5 A;  1RVF 3;  4BIS A;  2ZKL A;  1L7Q A;  3FLT A;  3ZXK A;  4LO5 B;  2P3Y A;  1W8H A;  3L2H A;  3JBG 1;  5K4L A;  4HN0 A;  4XFF A;  5J1X A;  2W1Q A;  2XKP A;  5ANQ A;  2BER A;  2RM2 3;  3N7K A;  4YM1 A;  3NKT A;  3RZG A;  1QWR A;  2JDY A;  1MVQ A;  2PQS A;  3HQU A;  3ENR A;  5F37 A;  2C1F A;  1ULP A;  1V6I A;  2EVX A;  4S2G A;  5FZD A;  1YQ5 A;  3AP6 A;  4S2D A;  2XH6 A;  2AH2 A;  4KQ7 A;  5ACA 1;  5EP9 A;  3NKG A;  5EJZ B;  4KU8 A;  1ZBE 3;  4P02 B;  1YI7 A;  4EZH A;  1RUF 3;  3N35 A;  2XJR A;  2R30 A;  4ATE A;  2XXZ A;  4B8E A;  5GZG A;  4P9X A;  5FYH A;  3APB A;  3VBR B;  1AR6 2;  3DEM A;  1RUG 1;  4GAL A;  3QBQ A;  2X09 A;  3AZY A;  4UBG A;  4YG0 A;  4UW5 A;  2YU2 A;  4DUW A;  2W87 A;  1OF4 A;  4YG6 A;  1PX4 A;  2AEN A;  5C4W B;  1PNF A;  1GR3 A;  2VOT A;  1GZW B;  4C1W A;  4FFF A;  3VUO A;  1KQR A;  4A6S A;  3TAY A;  1ZVF A;  5A7P A;  4CCO A;  2RDQ A;  4MGK E;  2VCM A;  1JZ3 A;  4Y4Y A;  5AVA A;  3MDP A;  4RS5 B;  2EID A;  4XHX A;  4NWW A;  1R09 2;  4CCC A;  1L3J A;  4TLG A;  3ZFF A;  4BYY A;  2B39 A;  1R1Z A;  3PMS A;  1J3P A;  2IXJ A;  4LIU A;  1WKY A;  1Y9Q A;  1GQG A;  2Q8E A;  4BH9 A;  4DZG A;  2HEV F;  5E88 A;  2RMU 2;  4LOT A;  1OXC A;  4OI4 A;  5DG2 A;  5LZ6 A;  1OT5 A;  3DV8 A;  3Q9O A;  4OYU A;  3R05 A;  4BK5 A;  5FUN A;  2V5Y A;  1JW6 A;  2GND A;  4RR3 A;  2VMD A;  2BWC A;  3QH6 A;  4L8Q A;  1JU3 A;  4QB2 A;  1RVF 1;  1AYN 2;  3WNO A;  4TN7 A;  1ZBA 3;  4L99 A;  2VG9 A;  2VBD A;  1F31 A;  1MQT A;  3MHZ A;  3NNM A;  4K20 A;  4YM3 A;  3MV0 1;  2RM2 1;  1PX3 A;  1AHS A;  5CFC A;  2J1S A;  2X53 S;  2BPA 2;  4NO4 A;  4O65 A;  1NZC A;  5DAW A;  3VBS C;  3ZN4 A;  4W8J A;  4QM9 A;  1W9T A;  1RUC 2;  1CIY A;  4COW A;  3RYP A;  1ZBE 1;  2UU8 A;  2PLV 3;  2Y6L A;  1HB3 A;  2KM2 A;  3VZM A;  2RHP A;  1YI9 A;  1RUF 1;  1JUI A;  3OYW B;  1VE0 A;  3R0R A;  2V73 A;  3GZE A;  3AKQ A;  1IKP A;  4KNC A;  3ZO0 B;  4AHZ A;  1AL2 2;  4A6O A;  1DYO A;  1HIX A;  1TE1 B;  5ABJ A;  1B35 C;  5A32 A;  4Y1V A;  3AKT A;  3R6S A;  3T0D A;  5C3P A;  1XYN A;  4BA6 A;  1VBD 3;  4JRL A;  5KR7 A;  2BBA A;  1IS4 A;  1W2U A;  3IMN A;  4QU2 A;  2BFU L;  1JZ2 A;  5A3O A;  5FPX A;  3IAQ A;  4QPG B;  2BWA A;  3D6E A;  3FE5 A;  3WG1 A;  4ES9 A;  3N9N A;  5J3U A;  3CF6 E;  4I01 A;  2XL9 A;  4LUL A;  2ENR A;  4XF4 A;  3OG2 A;  2L9L A;  5AVP A;  2P4E A;  4LK7 A;  4D69 A;  2VJX A;  3E5X A;  1OKO A;  1JYC A;  3MEP A;  5DN2 A;  5DUU A;  1RIN A;  4OUL A;  4KGQ A;  4A3Z A;  1UYP A;  1V6J A;  5FY9 A;  3LOB A;  3HD8 B;  1JZ5 A;  5FTT C;  5IVV A;  5FP3 A;  2DCY A;  5LK5 A;  1UXZ A;  3RRD A;  4Y5S A;  1NXM A;  4BU2 A;  3EO6 A;  5GKA C;  1LOC A;  4W4Z A;  4MGS A;  5T54 A;  2OT7 A;  4K40 A;  2WLQ A;  3PUS A;  1DIW A;  2VTF A;  3UET A;  1X7N A;  2JKB A;  3I2J A;  3VD5 A;  3ASI A;  1S55 A;  5EHD A;  1ZZ7 A;  3VBS B;  3ZFE B;  3PIJ A;  3H7Y A;  4B29 A;  4EE2 A;  3WHT A;  5IJR A;  3KZ4 C;  1ZBA 1;  3BOD A;  3KMH A;  5C9A A;  3O1V A;  1AZD A;  3UES A;  1AJO A;  2QCS B;  3S0M A;  2WZR 2;  2PHX A;  4LHS A;  2OUJ A;  4AAX A;  4UFH A;  3NQH A;  1IG3 A;  4RQP C;  4UF0 B;  2I74 A;  1PZ7 A;  2E6V A;  2BZD A;  3WY6 A;  1B35 B;  1UMZ A;  2FCT A;  3IBM A;  4NRO A;  4RL7 A;  3PVB B;  2PLV 1;  1AXK A;  2QQP A;  5A1F A;  3SIS A;  4K1Y A;  3UL2 A;  3CDZ B;  1J83 A;  1OLM E;  2FBE A;  3DKQ A;  5A33 B;  3O1M A;  4BJ0 A;  4Q1P A;  1O5U A;  4ZU4 A;  1QEX A;  1X50 A;  1LGB A;  4EN7 B;  1ZA7 A;  1SZB A;  2VC9 A;  2HWE 2;  4I09 A;  2OA2 A;  2PHT A;  4XZU G;  4YGE A;  1O3Q A;  3RSJ A;  3U37 A;  1VBD 1;  3M3C A;  5DZF A;  3NST A;  3KLS A;  3PJY A;  5EYX A;  1E57 A;  4JQT A;  4DRV A;  1VMH A;  5IK8 A;  2QJV A;  1YJL A;  5B4N A;  3HPN A;  2ZGK A;  3GJA A;  2GP5 A;  2WN2 A;  1HDK A;  1QXJ A;  1ZZ6 A;  4NJ4 A;  2XBO 2;  4XUR A;  3O1T A;  4QX7 A;  1NLR A;  1NYW A;  1HXS 3;  4QX1 A;  1SDD B;  1VBE 2;  2W46 A;  1WW6 A;  3WW3 A;  4N43 B;  3LA3 A;  4COZ A;  4OQ8 A;  2IWG B;  4QGL A;  5F3G A;  4Q4V 3;  5A3P A;  1NCQ A;  2ZML A;  1X33 A;  4TLF A;  1BEV 3;  2A3X A;  5FY0 A;  2XWB B;  3MW4 A;  2CWS A;  4XUQ A;  5L7O C;  2D6P A;  1QU0 A;  1E5S A;  2LRP A;  2VNV A;  2XVL A;  1C8N A;  2YC4 A;  5D8A A;  3IDC B;  2KA3 A;  3SC7 X;  3LA7 A;  3VBF C;  4P9J A;  3H8U A;  5HCB A;  3CHX A;  2JE8 A;  1ALY A;  1MS0 A;  1G9D A;  1H2L A;  1QDO A;  5FBJ A;  4XQD A;  1N1Y A;  4YGC A;  5FYB A;  4XE9 A;  3VDD A;  2UY9 A;  1PM4 A;  2BNN A;  3B7M A;  3OY8 B;  4CDX A;  4CCM A;  4GB3 1;  5DAP A;  1QJU 3;  1M4W A;  1PMI A;  3SKJ E;  4BCU A;  1ND3 C;  1BK1 A;  4G9S B;  2XPJ A;  2AGS A;  2CDO A;  3MFC A;  4OZX A;  1UD1 A;  4Y22 B;  4WBB A;  3DYP A;  4W50 A;  3ZLI A;  3LFI A;  5A6Q A;  5HBA A;  4KGG A;  3WNN A;  2QFE A;  5L73 A;  5C5U A;  2E7Q A;  1DQ0 A;  1OA2 A;  5IFT A;  1T6B X;  4Q4Y 3;  3POG A;  4UFL A;  2DCK A;  2C9A A;  3HN3 A;  4QQH A;  1E5H A;  4ZPI A;  3V0A A;  1JYI A;  3U0Z A;  1C5I A;  1QNW A;  4EN9 B;  4CDU C;  3OBA A;  4C8D A;  1G8W A;  4NIH A;  4HON A;  1NCR A;  4GJZ A;  3USU A;  5KHG A;  1PNG A;  3D0S A;  1Y9G A;  4G4F A;  2QTW B;  2NPI A;  3MIE A;  1RIT A;  1HXS 1;  1SCR A;  5FPA A;  3C7H A;  1MZ5 A;  3ATG A;  5L7O B;  4AXO A;  1NG0 A;  2GNM A;  3WQB A;  1OFN A;  2A6Y A;  3G7D A;  2JWP A;  3VBF B;  3MPP G;  1MZF A;  4Q4V 1;  4D0Q A;  4I0B A;  4IW3 A;  2H0V A;  3HNB M;  1YUD A;  1BEV 1;  3ZYF A;  2ZEX A;  3BN6 A;  1Q43 A;  4XXP A;  2X29 A;  2D97 A;  4QDR A;  3OSD A;  1XQN A;  2RR1 3;  3KM5 A;  1IS3 A;  3PUH A;  2VL4 A;  4DB5 A;  1QIQ A;  3N9L A;  4HT1 T;  3SIT A;  2GN7 A;  3LIH A;  4IET A;  4XUP A;  3ES4 A;  4XIO A;  4CCK A;  1LAJ A;  5FZA A;  5FCC A;  5F9T A;  5SV5 A;  1W6P A;  5EV7 A;  3DXU A;  4Y3O A;  5EWS A;  4AED C;  2VUA A;  4GAZ A;  5J96 B;  4FTB A;  2X5I C;  1LRH A;  5LY2 A;  4QKB A;  1QJU 1;  2EF6 A;  4ZHN A;  1W04 A;  5L9R A;  1S0D A;  1ZRI A;  2XLF A;  3KS7 A;  5J7M A;  4R9D A;  4CUB A;  4ET7 A;  5A6X A;  3LIG A;  4Y24 A;  1PIV 3;  1R1A 3;  4AI9 A;  4CDU B;  4CEY B;  4IE0 A;  1YFX A;  2Z4F A;  4RHV 3;  2OPW A;  3ZYP A;  2JDH A;  1LEM A;  2ZEZ A;  1NY7 1;  1QKQ A;  4Q4Y 1;  5JR2 A;  4FP3 A;  2QVS B;  4XUT A;  4XMI A;  1JYW A;  3BTA A;  5CVR A;  2JDM A;  1RTV A;  2MPF A;  3WG2 A;  5DG1 A;  1QJY 3;  2AC1 A;  5G04 L;  1WLC A;  3O12 A;  5F6K A;  4YW2 A;  4WVZ A;  3VBR A;  2XJT A;  1AX1 A;  4FO9 A;  5I0D A;  1QY4 A;  4N9I A;  5KBF A;  4BQW A;  3HQX A;  4HG6 B;  4C0B A;  4DUV A;  5BY5 A;  1OQD A;  2DCJ A;  5C4W A;  1GZW A;  3VBO C;  3KT1 A;  1NLS A;  3IKW A;  3UYJ A;  1POV 0;  3WG4 A;  5E8A A;  1OH4 A;  1QJZ A;  4JGZ C;  3VDA A;  1WBF A;  4HSJ A;  4X6Q B;  1LEC A;  4CSW A;  2XVG A;  4P9L A;  4RS5 A;  3DGT A;  2CL2 A;  1QQP 3;  2P2K A;  3VBH C;  1S0B A;  1SLL A;  2HWF 3;  3J7M A;  4QX2 A;  5FXX A;  3EYP A;  4WVW A;  2NMO A;  3S6P A;  2ILM A;  4XHB A;  1DGW X;  5C8W A;  2E31 A;  4MGZ E;  1X8E A;  2RR1 1;  5D1I A;  1YQ6 A;  4SBV A;  2X5I B;  5FRA A;  3TEW A;  3BIW E;  2YV8 A;  1JOD A;  1LOG A;  2HBT A;  2ET1 A;  2WRA A;  3HBZ A;  2W9X A;  1UZ0 A;  2VNO A;  4AGV A;  4H7M A;  4QHO A;  4J1X A;  4AGR A;  2VZ3 A;  5FZB A;  2IUW A;  2AR6 A;  2ZX3 A;  4AVA A;  3I3D A;  1W6O B;  2GMP A;  2VUC A;  1REF A;  4DOU A;  4GMP 3;  4S2H A;  2PHF A;  2VZU A;  4CP0 A;  5ABJ B;  3AC0 A;  1PO1 2;  2VMG A;  1RUE 3;  1EAH 2;  1KIT A;  1S0G A;  4BM8 A;  5JOZ A;  1DHK B;  2Z69 A;  3DKW A;  1UY2 A;  3CO2 A;  3ILF A;  3LCP A;  4YVW B;  1X36 A;  2FDJ A;  1DGR A;  3HT2 A;  3WNL A;  5I0T A;  4CUC A;  1D4M 3;  4XUO A;  1PIV 1;  1R1A 1;  2YYO A;  1DQ5 A;  1H4H A;  2IZW A;  2QDN A;  5A1A A;  4JHT A;  4RHV 1;  1R08 2;  1XYO A;  2D6L X;  1COV 2;  3ZYB A;  2XG3 A;  1FNY A;  4N8M A;  2V5D A;  5FMB A;  1BCX A;  2A1X A;  2D5F A;  1UNB A;  3OYW A;  4YFZ A;  1QJY 1;  4LO4 B;  4XXA A;  1AR7 2;  2ZGM A;  4JGZ B;  2HYX A;  1R64 A;  1H9W A;  2RVA A;  3GNE A;  4I0W B;  5DZE A;  5FXV A;  5GZC A;  2G1M A;  2HWD 3;  2ZX2 A;  3ZN5 A;  5LBB A;  4CEW A;  3O1S A;  3VBH B;  3W5M A;  4BIF A;  5AC9 2;  3PJQ A;  5EJ3 A;  1ULE A;  1H2M A;  2ZHM A;  3WW1 A;  1FAT A;  4Z2A A;  5ISL A;  4E9K A;  4LBM A;  3TEY A;  3I2G A;  3B94 A;  2P34 A;  4LBQ B;  1RED A;  4MXV A;  2DDU A;  2ZHK A;  2RJ2 A;  3B02 A;  3KF3 A;  5HCA A;  2C24 A;  5FP7 A;  1QQP 1;  2XDV A;  3LEG A;  3T4H B;  2HWF 1;  2YB7 A;  1BMV 1;  4RGA A;  4AFA A;  1DYP A;  3UKT A;  4WVM B;  1SG3 A;  3FUO A;  2BVB A;  1JH5 A;  2VZR A;  4K21 A;  1K5M C;  1J1T A;  5FZC A;  3NMB A;  2FCV A;  2CYF A;  3HR9 A;  3K2O A;  4UWD A;  4AEK A;  3LDB A;  4HET A;  2UWB A;  3J4U H;  4CE8 A;  2WA4 A;  5FY5 A;  2TBV A;  3JD7 2;  3C7E A;  1W6N B;  3WW4 A;  3I54 A;  3D0J A;  1VAL A;  2YHJ A;  4GMP 1;  1W28 A;  3ACF A;  1H2N A;  3I3E A;  4V1P A;  3VBS A;  4Y5T A;  4XFI A;  1RUE 1;  4CYD A;  1HLC A;  4Q8K A;  3NRU A;  3VZN A;  3Q8A A;  1KS4 A;  4DPN A;  4F83 A;  4XBQ A;  4M4P A;  4ZS2 A;  1UWW A;  2D5H A;  4PDW C;  2ZZQ A;  4FP2 A;  1D4M 1;  4LXL A;  1HB1 A;  2K46 A;  3CJI C;  4K8F A;  2Y8K A;  3P1I A;  1PGL 1;  4UF0 A;  2LW8 A;  2ZS6 B;  4IEX A;  4J1W A;  4BDV B;  1B35 A;  3OGR A;  3BTX A;  1TME 2;  1W6M A;  2R04 2;  2OKX A;  1AVB A;  3MV1 1;  5LAS A;  4Q0U A;  1VAK A;  4XQW A;  5H9Q A;  3A21 A;  3WNK A;  4CU7 A;  5KC5 A;  2GC1 A;  2GME A;  1YRZ A;  3JCI A;  3JUU A;  2OPK A;  5A33 A;  4EYU A;  1YHF A;  2WJS A;  4MGY E;  4ZXE A;  4R4X A;  4MXW B;  2OUH A;  4CDW B;  4QAW A;  1F15 A;  4FPF A;  3RI8 A;  1XNB A;  1WCQ A;  4XJ8 A;  1WLD A;  2AUY A;  2RS5 1;  4XCA A;  1O3R A;  3LSE A;  5FR3 A;  3SH4 A;  2OX0 A;  3C8X A;  4P00 B;  2RS3 3;  5FKC A;  4XDO A;  3ETP A;  1LHU A;  4KWL A;  1K5M B;  5J09 A;  2VEC A;  1PHM A;  4GH4 C;  4W6W A;  4JV4 A;  1S1A A;  4XF3 A;  3TN9 3;  3K51 A;  3OBZ A;  3AZV A;  4MLO A;  2JEC A;  3PUQ A;  3KGZ A;  2PXJ A;  3H1Y A;  1KDM A;  1CR7 A;  4AVT A;  1Q8P A;  5BNP C;  3PVE A;  1PVC 3;  1SFN A;  4N43 A;  5FDB A;  2WFF 3;  1ZX5 A;  1HRI 3;  3WP3 A;  5IK7 A;  4YZ1 A;  4KBB A;  4YM2 A;  4PT6 A;  3VKO A;  4Q27 A;  4D6R A;  3UK9 A;  4AQS A;  1U5Z A;  1S2B A;  4M3C E;  1F8V A;  2YPD A;  4FQZ A;  1K42 A;  4PDW B;  1NA1 C;  3ZYR A;  2Y0O A;  2WYS A;  3CJI B;  1C8M 3;  2WII B;  2FZ2 A;  2XJP A;  4Y26 A;  5FZ7 A;  3PLQ A;  1WW7 A;  1CVN A;  3HOB A;  1ND2 C;  4W6X A;  4LK6 A;  4OZO A;  3PL0 A;  5DXD A;  2Y60 A;  3ZYH A;  2GH2 A;  2WYF A;  4YW4 A;  2XB6 C;  1C3H A;  1ST8 A;  3QAC A;  4Q8L A;  3SNM A;  4YZ2 A;  2Z2S B;  2HEY F;  3OY8 A;  1NXD 1;  3B9C A;  5FYC A;  1LUL A;  1SHW B;  4GQ7 A;  5IVY A;  1SCS A;  2LUW A;  4R8H A;  4Y22 A;  3VDB A;  1TG7 A;  3OGS A;  4JGY B;  3AXD A;  4BWO A;  1WMD A;  3AZZ A;  4GH4 B;  1IPJ A;  5CKQ A;  5BXX A;  3ZXD A;  3MF9 A;  1GQP A;  1WLT A;  1DQ6 A;  4AHW A;  1Q8O A;  1UXX X;  3PTR B;  4IEY A;  4D8M A;  5IVC A;  1JZ4 A;  2RS3 1;  5IW0 A;  3O0X A;  1GIC A;  5BNP B;  3LDR A;  2WNV C;  3PUI A;  2I2S A;  2A6X A;  1ODM A;  3QLQ A;  3E6B A;  4Q1R A;  2WAA A;  3J7H A;  3UGG A;  5CZK A;  3TN9 1;  1KFU L;  5JI9 A;  3WUD A;  3BPZ A;  3UJO A;  3I59 B;  1NA1 B;  1Z78 A;  2XVK A;  2DU0 A;  3VKM A;  5L7O A;  5IK5 A;  3THD A;  4IEQ A;  3ZSM A;  2VQ0 A;  1PVC 1;  1W0N A;  3U4S A;  3I2O A;  1YIF A;  2WFF 1;  1OD5 A;  1HRI 1;  1UYY A;  3VBF A;  4BQX A;  2QQW A;  3IT8 A;  3JBG 3;  3SCG A;  4A4A A;  4Y1Y A;  1ZRD A;  4FPE A;  4GWI A;  4JKK A;  1ND2 B;  1VBB 3;  3Q8C A;  4OCT A;  2MHF A;  5HPO A;  1WA6 X;  2Y26 A;  1I5Z A;  2JB8 A;  3IPV B;  1EUU A;  3O7O A;  5FXZ A;  2PHL A;  1C8M 1;  4AGG A;  5T55 A;  3OUJ A;  3I7D A;  4QWN A;  3LA2 A;  2R07 3;  2DUR A;  2XJV A;  5KWR A;  1ASJ 2;  4AE2 A;  3W9A A;  1FMD 2;  5BNN C;  2WUH A;  2YBK A;  3NNG A;  5GLZ A;  2JIJ A;  5IT6 A;  2UY8 A;  2YRO A;  3PUR A;  3H0O A;  4LR4 A;  2W47 A;  2GAL A;  1NKG A;  4ISR A;  4OVE A;  3RS6 A;  3U07 A;  3VL8 A;  5FOJ B;  5CKM A;  1TEI A;  3GDB A;  1Z7S 2;  3AKR A;  3BU7 A;  1GWM A;  3LF7 A;  3M7A A;  3NV1 A;  4XFB A;  4IXL A;  4NVP A;  1WME A;  5KXB A;  1G9F A;  2XHN A;  5FPB A;  1QXR A;  5FMO L;  1WMF A;  3H3Z A;  4CDU A;  4KWJ A;  3AL6 A;  4YM0 A;  5FPV A;  2WO2 A;  4DY3 A;  1GZC A;  3CL1 A;  2VZ1 A;  5BUV A;  3JZV A;  5LW9 A;  2PYT A;  2WLP A;  1BZW A;  4PIZ A;  2VZT A;  4UI9 L;  3ON7 A;  3EJK A;  5JIU A;  1ULO A;  2LS6 A;  3M8L A;  4BQ2 A;  3AP5 A;  1MS5 A;  1SBE A;  2Q0A A;  1QF3 A;  2DWR A;  2GC0 A;  2W39 A;  2ZKN A;  5I8S A;  5I0R A;  5CAZ A;  2WT2 A;  1HJF A;  1WCK A;  3T09 A;  3WLU A;  5FZI A;  1XOY A;  5JLV A;  3GHN A;  4XTM A;  5C8C B;  2G19 A;  4DXT A;  2ZOE B;  4IES A;  4E4Z A;  1Y7B A;  5FUI A;  5FZK A;  1AR6 3;  2WNU C;  1DBN A;  2LTN A;  4N53 C;  1XC6 A;  1D0G A;  3S7I A;  5FPL A;  4DFS A;  1CPM A;  2XL7 A;  3UKV A;  4Y4R A;  4AI0 A;  1F9K A;  1UYZ A;  2GC3 A;  5HXV A;  2FDH A;  4CDQ A;  5BNN B;  3CZJ A;  1VBB 1;  3POE A;  2RDS A;  4XCB A;  1JZ7 A;  3THT A;  1DLC A;  2W92 A;  3LKJ A;  4YW6 A;  2WWS A;  3AFK A;  1JS9 A;  3ZMO A;  3KV5 A;  1JYX A;  3V64 A;  2ORX A;  4JVA A;  2X5I A;  3TYJ A;  4YGB A;  2R07 1;  1Q56 A;  4Z2W A;  2ZAH A;  5H9P A;  2TEP A;  1LHV A;  1R09 3;  5IUQ A;  1AJK A;  2R16 A;  4MV2 A;  1OMI A;  1RUI 2;  2GSY A;  2FMY A;  2WQ8 A;  4DMI A;  1O4T A;  1RUJ 2;  2HLE A;  2OW4 A;  3DCQ A;  4OFG A;  1N3O A;  2Q8C A;  2A70 A;  1W6O A;  1GUI A;  2PA7 A;  1JI6 A;  3PME A;  3POB A;  4CCN A;  1HX6 A;  4FBF A;  4AFB A;  4P9W A;  5C5T A;  4D94 A;  2VMI A;  2RMU 3;  2VCA A;  3LZZ A;  3AKP A;  4ZS3 A;  4EN6 B;  3RVH A;  2JE7 A;  1UOF A;  1JTZ X;  3VKL A;  1G9A A;  3PTY A;  3AX4 A;  3BIE A;  4L9B A;  3IDB B;  4RSU A;  4YVW A;  1V70 A;  3KT7 A;  5CB7 A;  4SLI A;  1Q3E A;  3I3Q A;  3T3Y A;  1AYN 3;  4HPK B;  2PN5 A;  1YFY A;  2JDZ A;  5F3C A;  1RJ7 A;  2P17 A;  3FJS A;  1LCL A;  4Q0V A;  3SQO A;  4G3Y C;  4FPO B;  3RZH A;  2JKX A;  1IG0 A;  1GMM A;  4EWA A;  3O1U A;  2J1R A;  4CU9 A;  2WNU B;  3OPW A;  1WZX A;  4N53 B;  1H4G A;  3DYM A;  3OB8 A;  1Y43 B;  4JGZ A;  3BU0 A;  3W58 A;  3RGB A;  1VIW B;  3L2Y A;  3PIG A;  1YQ2 A;  1LED A;  4ES8 A;  3RWK X;  1KRI A;  3VBH A;  2ZGT A;  4ISQ A;  4A42 A;  1X9P A;  4AQ6 A;  4D7T A;  3N9Q A;  3LQC A;  1CON A;  1WLW A;  3UGF A;  5JMO A;  1CZS A;  2PHW A;  2VZP A;  4LBQ A;  1AR6 1;  1T6G C;  1WA4 A;  4MH0 E;  1AL2 3;  4BXS V;  2ZAB A;  2JIG A;  2P37 A;  2N7G A;  3K77 A;  4GWN A;  2CU5 A;  5FY4 A;  1UO9 A;  1NE6 A;  4D3W A;  3NV3 A;  3FHA A;  1TNF A;  4NRQ A;  4UFJ A;  4ITC A;  5E89 A;  2Y64 A;  5A3W A;  5C3Q A;  4WVM A;  4QKD A;  3ZFG C;  4A7Y A;  1UY0 A;  1IHM A;  5JPM B;  3U4X A;  3LGR A;  3SEP A;  2HWC 2;  1LOE A;  1SMV A;  4XAE A;  3WZ1 A;  5F3E A;  1GNZ A;  3P6B A;  4M3C B;  3RMX A;  2ZGR A;  1R09 1;  1MEC 2;  5JI7 A;  1O59 A;  4NN0 A;  3V65 A;  2E7T A;  3FN9 A;  4OHV A;  4AW7 A;  1W6N A;  4Y1U A;  1J59 A;  1QHD A;  1A8D A;  4FXK B;  5CIR A;  4EWE A;  4LA3 A;  1UYX A;  1ENQ A;  4BXF A;  4B3N A;  2C0Z A;  3PVN A;  5FV3 A;  2RMU 1;  4M4R A;  4QU1 A;  4NOT A;  1RL3 A;  2WO1 A;  3ABZ A;  3S30 A;  1OKQ A;  1QJE A;  3DF0 A;  4IV1 C;  2MEV 2;  5A3T A;  4LUM A;  2A6V A;  2XR4 A;  4U36 A;  3U11 A;  1S0F A;  4K8R B;  1AYN 1;  5LBC A;  3VZJ A;  5FP4 A;  1K12 A;  1LJ7 A;  2QNK A;  3N9O A;  4B1L A;  2EAL A;  5HV4 A;  4Y5Z 0;  1GSL A;  2IFW A;  3QD6 A;  2WZR 3;  2JG9 C;  3NJY A;  1AR8 2;  3OD4 A;  4QQ2 A;  3MBW A;  5T5J A;  1TMF 3;  3I97 A;  4PJY A;  2A5Z A;  1X9T A;  1FOD 2;  1JMU B;  2J1U A;  3PNA A;  1UN1 A;  1UU6 A;  5IWF A;  3VBU C;  4DO0 A;  4P14 A;  3AMP A;  5A7O A;  3UGH A;  4MXW A;  1RUC 1;  2W91 A;  3HJR A;  4CDW A;  1Q8Q A;  1NZI A;  5K8S A;  1QH6 A;  2H6C A;  4I02 A;  2JG8 C;  2D6M A;  5A3L A;  3ILN A;  3ZFG B;  2DYC A;  2JJ6 A;  3GAL A;  2WDB A;  2ZAC A;  5A6Y A;  2Y34 A;  1RHI 2;  1AL2 1;  2XML A;  4PHZ A;  1V6K A;  5FKB A;  2DV9 A;  4PIX A;  1YNA A;  1EV1 2;  1K5M A;  3KCX A;  1CWP A;  4COV A;  2IXC A;  4HMZ A;  4UW4 A;  4PI0 A;  5AFB A;  4XAC A;  5FZ4 A;  4YPJ A;  4WZF A;  3RJR A;  5EXO A;  2DTY A;  4UFI A;  5T5O A;  1F4A A;  5FYT A;  2CDP A;  3OTF A;  4M3C F;  2Q8O A;  1V0A A;  1W6M B;  2YC0 A;  1HRV 2;  3MIH A;  4GB3 3;  4LUK A;  2UWA A;  2XBO 3;  3RZJ A;  1JHJ A;  5ANN A;  1QJX 2;  1ZZB A;  1E5R A;  2GC2 A;  1SLB A;  4PDW A;  1P8J A;  1W0P A;  3GYD A;  5EFU A;  3CJI A;  5FPZ A;  2O14 A;  3U14 A;  4BQ4 A;  1RMU 2;  2QZ2 A;  4Q4W 2;  3BCW A;  4TSV A;  5CU1 A;  5JXH A;  4J25 A;  3WF3 A;  3EMR A;  3J7N A;  3N9M A;  2BU9 A;  1NOV A;  2JG9 B;  3LEK A;  3RMY A;  3N4M A;  4TXW A; 
#chains in the Genus database with same CATH homology
 3NNJ A;  3NNL A;  2RDN A;  3KT1 A;  4JZR A;  3OUJ A;  3GZE A;  5LAS A;  3OUH A;  5IAV A;  5LBE A;  2JIG A;  2JIJ A;  5ERL A;  4MHU A;  5DAP A;  5EPA A;  4XCA A;  5IAT A;  2HBT A;  4NHM A;  5L9B A;  5LA9 A;  3W21 A;  5LAT A;  4XAA A;  4NHY A;  5DAQ A;  5C5U A;  4Q5O A;  3OBZ A;  4XC9 A;  4ZPI A;  4Y5S A;  3HQU A;  3OUI A;  5EP9 A;  4ZON A;  5A3U A;  3ITQ A;  5LBC A;  5HV0 A;  2G19 A;  2A1X A;  5HV4 A;  4NMI A;  2V4A A;  4MHR A;  4NHX A;  4IW3 A;  3PL0 A;  4NAO A;  2G1M A;  5LBB A;  2FCT A;  4XCB A;  2RDS A;  2RDQ A;  2RG4 A;  4BQY A;  3DKQ A;  5LB6 A;  3MGU A;  4XAB A;  2Y34 A;  3W20 A;  4NHL A;  3KT4 A;  5LBF A;  2HBU A;  5DAV A;  5DAX A;  4KBZ A;  5C5T A;  2RDR A;  5L9R A;  4XAC A;  3GJA A;  2FCV A;  4UWD A;  5L9V A;  5IAX A;  5EQU A;  2OPW A;  3KT7 A;  2Y33 A;  3BVC A;  3NNM A;  4Y5T A;  5M0T A;  3GJB A;  3HQR A;  2FCU A;  5DAW A;  4BQX A;  4NHK A;  3NNF A;  4J25 A;  4BQW A;  3EMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...