5LBCA

Hif prolyl hydroxylase 2 (phd2/egln1) i280v/r281l/i292v variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/fg2216)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
222
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLVLHCNGKLGSYKVNGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLVRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 63
structure length 222
sequence length 227
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbcA00
5IATA 4NHXA 2Y34A 3OUIA 5ERLA 5LBEA 3HQRA 5EP9A 4XCAA 3NNJA 5LBCA 2FCUA 5EPAA 2RDSA 4Y5TA 4NHKA 2RG4A 2A1XA 4XC9A 3KT4A 3NNLA 4NAOA 4NHLA 5L9RA 4J25A 5LBFA 3GJAA 4BQYA 5LBBA 3BVCA 4BQXA 4XABA 4MHRA 4IW3A 4NHMA 2JIGA 5L9BA 2RDNA 4BQWA 5IAVA 2RDRA 2RDQA 3GJBA 4NMIA 3W21A 4UWDA 4XAAA 3OUJA 4MHUA 2G19A 3ITQA 5DAWA 2V4AA 5LATA 2FCTA 4NHYA 4Q5OA 5DAQA 2HBUA 5EQUA 3GZEA 5M0TA 5DAVA 5A3UA 5L9VA 3NNFA 5DAXA 4XCBA 5LASA 5C5TA 3NNMA 3HQUA 4Y5SA 4ZONA 3EMRA 4XACA 5IAXA 2G1MA 3KT7A 3MGUA 2JIJA 2OPWA 3PL0A 3OUHA 3DKQA 5HV0A 4JZRA 5HV4A 2HBTA 4ZPIA 2Y33A 5LA9A 3OBZA 5DAPA 5C5UA 2FCVA 5LB6A 3W20A 4KBZA 3KT1A
chains in the Genus database with same CATH superfamily
3JD73 2PAEA 1VB2A 1POV3 2VNOA 2Y8KA 3VLBB 5JPMB 4AOCA 2X10A 1PIV2 2VUDA 5FP3A 2JDNA 3LAGA 5DMYA 4KG0A 4GB31 5CFCA 4QPWA 4NRPA 3SEPA 2VMDA 4XFIA 5FMOL 4AQ6A 4BIOA 2VQ0A 4KQ7A 4M3CF 4WM8C 4B29A 5C3SA 4OHWA 1QY4A 5ISLA 1SBEA 4UI9L 1NCRC 3WUDA 2DYCA 4N8MA 3WP6A 4DXRA 3N9LA 4W4ZA 3RZGA 1W6QB 4MGTA 4UOJA 5HCHA 4M0NA 1PZ9A 2OYZA 5FQ0A 5I0RA 5T55A 4IGQA 4XFGA 4QPGC 2Q30A 2BGPA 1TMF2 1O8SA 4P5YA 1W8ZA 4QPIC 4S2DA 1JYCA 1SLLA 4B7KA 2ZGMA 2EIDA 4HK8A 4N43B 1R1A2 3J26N 3NAPC 4Y1VA 4ZS2A 1S0JA 1WCSA 2JG8C 2JG8A 3D5OA 4LBNA 1VPHA 3PIJA 4YGEA 4PDWC 4GQ7A 1TME3 1VJ2A 3HNBM 1UYYA 1QXRA 3Q9OA 4XUQA 1A78A 3AP9A 1PK6B 2IXCA 1XB9A 3LEMA 3MIDA 5L9BA 1ZYBA 2CNAA 3OG2A 3T08A 3B00A 4E4SA 4FFFA 3VL8A 1GBGA 1W8FA 3UL2A 2J7MA 1WLTA 4NMIA 4AHYA 1NCRB 1RUD1 3OUJA 4YG0A 1W6NB 2VVFA 3ZN4A 1WA6X 1NCRA 1WWYA 3IDCB 5FY4A 1VBB1 3CIHA 1IKPA 2D3RA 1UOFA 5FQ0B 1CX1A 1O91A 2VU9A 1HQWA 1GQPA 5F5IA 1I5PA 4KH9A 4AI8A 4CDXB 5C3QA 1NG0A 3O1RA 1MACA 1YHFA 2WNOA 2R32A 5FRAA 5H9SA 3POSA 2A6XA 3ST7A 1DQ4A 1NCQC 2A71A 1BK1A 1W9FA 4Q5OA 5KBFA 3H1WA 1DGLA 1LOCA 2BOIA 2JD9A 3GBGA 2D44A 1HX6A 1BLZA 1ODMA 3U14A 1DDLA 1S2EA 2ZEXA 3LIGA 4QDSA 4UT5A 4EWDA 1DBNA 4QKDA 4LKSA 2ZJCA 1L7RA 4MYEA 5BNNB 3EHKA 3BTZA 3W5NA 2BU9A 1Q8PA 1V0AA 4XBLA 2JD4A 1G9AA 1D4VB 2QZ3A 2WSVA 4KWKA 5LEKA 4JHZA 4XQDA 1CIWA 4XOGA 5D2AA 1C1FA 5FREA 4LIVA 4N53A 5FFOC 2R071 1HIXA 4JZRA 5HV4A 1UU4A 4NIIA 4Y22A 1RUC1 1MZ6A 1RUF1 2PAMA 3GCXA 1QNYA 4Q2FA 1I3HA 5L19A 3FL7A 5CG8A 1XNKA 1K5JA 3W20A 2BUKA 4LUMA 3C8XA 3KF5A 4LJHA 1IHMA 1ZBA3 1BK0A 2XQRA 3SHRA 3CDZB 2WBKA 4HETA 1GU3A 3FHIB 1MEC3 2WN3A 2Z2SB 3HAGA 3T2TA 5AVAA 4GWJA 4YYOA 1KITA 4EV0A 2Y34A 4Q4V3 1H4HA 3RMYA 3IAQA 1OA4A 1QJFA 4GMP0 3POIA 5LCWL 1AUYA 3DF0A 2X5IB 2BTVC 2LTNA 1V6MA 3H3UA 1L3JA 3TN92 4RHV2 1KXGA 3IKWA 3VGIA 1E5SA 4DRRA 4E2QA 1U12A 5ACA2 3MPPG 5BXXA 1GZ9A 5FTTC 3NKGA 5FZLA 3PNAA 2WLPA 2FDHA 4Q4V2 1KJLA 5KHHA 1W8HA 2NP0A 4P00B 2XJRA 3KD4A 3B7MA 4Y33A 4AVBA 1JYVA 1AR73 1F9KA 4WVVA 2RM21 1GP6A 3T4VA 4BISA 1COV1 1LOGA 3D0JA 4AGVA 4CVUA 1XPWA 3AK0A 1PMIA 1SLCA 2IFWA 3JCIA 3OGSA 4PLOA 1C5HA 4D69A 4UW6A 3BI3A 4MZUA 1RUG3 4Y20A 2F17A 2W3JA 5FZ4A 4YPJA 2WO2A 4Z2WA 2J1UA 5JXJA 2GNDA 1OA3A 4LA3A 4CDQA 2W47A 2ZGSA 4IEQA 4D7TA 3UJOA 5J96B 4CCCA 4BQ5A 4BQ3A 3RSJA 4Q8LA 1SLAA 4B1LA 4KWLA 4MUVA 4N53B 2ARAA 5KHJA 4LBLA 4YW3A 2H6CA 5IAVA 1ULCA 3BTYA 5EHDA 3N7LA 1OD5A 1AL22 3CJIC 3PURA 4UWDA 3T2QA 1O3QA 4DMIA 4PDWB 4QHZA 2VJXA 1UKRA 5C71A 1NUKA 2HWB3 5A3LA 1LOFA 3P6BA 1M06G 3OY8A 3RZHA 2WS93 3KZ4C 4FPEA 5FK8A 5FMDA 3SLIA 4K6BA 1SQ4A 1ND2A 3WF1A 1XE8A 2JB4A 1YFUA 3POFA 2WNUA 3FWEA 3THTA 2GNTA 2R043 4C0BA 4QGNA 1WW5A 4PIYA 1AL23 3EYPA 3PU8A 1D2QA 1X9PA 3ZPYA 3UESA 4IEUA 1ZX5A 2WAOA 2YMZA 4M3CA 4TTGA 4ASLA 2DF7A 4BB3A 5FYTA 1YFYA 5A7OA 1HB3A 3BIEA 1QJEA 4OZXA 4N7IA 2VMGA 4IV3B 2E32A 1VAMA 1HLCA 1ND3A 4NE9A 3LZZA 3IWZA 5GZFA 3RZMA 5L7OA 1DGWX 1DGWA 4LO6B 3L2YA 2VQAA 4P9JA 5FLIA 2CV6A 1SPPA 3SKVA 3CLPA 1ULPA 4LIUA 4D6SA 2PFWA 4XJZA 5ANQA 2RS31 1QJY1 4OI4A 5FY0A 1RGSA 2FMYA 1NXD1 1QXJA 3FLPA 2RHPA 4B4PA 2ZGUA 5DAPA 1RVF2 2QE3A 5BNNC 5C5UA 2ORXA 5DQ0A 3A0KA 1V6NA 2ORZA 3NW4A 4R4ZA 1J1TA 1QGLA 2VH9A 1ZRCA 2ZGKA 4I0BA 3H1YA 3OOXA 3AP5A 3J8F3 1DG6A 3A0NA 2P3IA 4HXCA 1VBE1 2X8KA 1X8MA 4JDMA 1XYOA 1W6QA 2JG9B 4DXZA 2VVDA 4DRVA 2QFEA 3N9QA 1GR3A 4J1WA 1IOAA 1AYM2 3LE0A 1NY71 2R49A 3FHAA 4BK4A 3HR9A 4HL0A 5BNOA 4DQAA 5IUQA 3VBFC 1MS8A 2A3XA 4E4DX 1X36A 1Z7S1 4X6RB 1C8NA 2P2KA 4HBNA 3T2PA 2KR2A 1YQ6A 2QDRA 5G04L 5JLVA 4XC9A 3V0AB 3BIWE 4IE5A 2HH9A 3LOIA 4HLTA 4JGYA 1PGL2 2XLGA 1N1SA 5CIRA 1OD3A 5FWJA 2WT0A 2NLRA 3OGGA 2WNVB 3Q8FA 1AYM3 2B46X 5DUVA 5A7SA 1WLDA 1JZ8A 1PIV1 2D6MA 1NLQA 3O1SA 5CKMA 1SACA 2D98A 1E5RA 1W9TA 2C9KA 1QJX1 2HWC3 1US2A 2ENRA 2W91A 2YC2A 3AZZA 3HIFA 3NJVA 4XDQA 1QNWA 3ZMOA 4BMEA 2DTYA 1DU3D 3S30A 1F5FA 1KFXL 2ZMNA 2DVFA 1LU2A 3AP4A 3H0OA 2P3KA 5DUUA 1N47A 3AP7A 1GV9A 3VZLA 1WZXA 1AL0G 1YQ2A 2C9AA 1RL3A 3AC0A 5CYYA 1KS4A 4I30A 3E6BA 1UCXA 4TXWA 2P6CA 1WLWA 3VBFB 3VKLA 4PCRA 4AW7A 1HQNA 2IFRA 3HJRA 3LFMA 4CYDA 3K48A 2OUHA 5F3EA 1B09A 3U4SA 3WEZA 4H2AA 2LALA 4W65A 1RMU1 1FNZA 2WO1A 4META 1IS3A 1RUI1 4QQ2A 1TZOA 4I09A 1HXS3 2RJKA 5K8SA 5FOJB 5FPUA 5I8TA 4M3CE 5ABJC 3OYWB 2DTWA 4JQTA 4ZZ8A 1ZBE3 1CAXA 2AREA 2XVGA 3E6CC 2XBO3 5FZOA 5GKAC 4OI1A 2VOVA 1YJLA 4DUXA 2GC1A 1BEV3 2FMDA 3GYDA 1GP5A 2P4EA 4LMFA 4LR4A 3ZLIA 4AVCA 3B3QE 3FLTA 2IXJA 2YDEA 3HT2A 5EV7A 5K0UB 2E7TA 2XPJA 3UETA 2PQQA 3CL1A 5FPAA 4CEWA 1ND2B 2AUYA 2VE1A 2HWD3 1DYKA 1QU0A 4XUTA 1YI9A 1ZVFA 3KF3A 3OY8B 1F31A 4MVTA 2R30A 3VV1A 3AXEA 2W08A 5HV0A 4LK6A 3TN91 1QEXA 3B9CA 2RV9A 1C3HA 3NO8A 1TMF1 3P3PA 1CAWA 3JD72 3PIGA 3PUQA 4AHXA 1N1VA 5E88A 1O3RA 2MEV1 4H55A 2NQYA 5IHRA 2NZ9A 2E33A 1UPSA 2VW1A 3OBAA 1O3TA 4AVTA 4LBQA 2Z42A 2VZQA 3ZYGA 4PIXA 3AB0A 2O1QA 4Q1RA 1SFPA 2IUWA 5JSPA 3ZM8A 2W1SA 4CEYB 2V5DA 4Z82A 5IATA 3X29B 3ZFFB 1CZVA 4QDRA 1MQTA 1D4M2 4MGZE 1CJPA 1Q43A 3PVNA 4BPZA 4AFBA 4ZKTB 5EP9A 2ID4A 5KHKA 1JZ3A 1DQ1A 1JXNA 4XCAA 3SCHA 3DXTA 5D8AA 4XQWA 2D6OX 4FPFA 4KMQA 1AR93 1C57A 5ACA3 1OH4A 5FMOS 4QM9A 2JX9A 4KGGA 1DQ5A 1F15A 2VZVA 4Y3OA 1Z7S2 4O7XA 4YG6A 3NV4A 2QDNA 1OOPB 4K40A 2RJ2A 3HT1A 1CAUB 1CPNA 1YIPA 4GKXA 3I2JA 3FC0A 1E57A 1NA1B 2JDPA 4ARXA 4CCMA 1O7FA 2YG0A 4C0HA 2C4XA 5ABJB 1NYWA 4N7UA 3ALQA 5A3WA 1K12A 4JQRA 1POV0 4J25A 4PBOA 2OX0A 4HPKA 2BFUL 2D5HA 5DDJ1 5LBBA 3ES4A 1GFF2 4CRQA 4GKYA 1LEDA 4K7JA 5I0TA 1JZ7A 2GAUA 1PO21 1JH5A 1GMMA 5KXCA 4ZXKA 3WT3A 4B1MA 1JU4A 5LA1A 1G9FA 1VRH2 3PUHA 3SEEA 4AI3A 3VBOC 3KM5A 4FPGA 1CAVA 1STMA 2EAAA 2WQ4A 3PMSA 1JU3A 5FAXA 5FYBA 5CFDA 3W21A 4F8AA 2NYYA 4IV1C 5LA0A 2X5IA 5KHIA 1QDOA 1ZA7A 5FZFA 3B02A 4F83A 2ZGPA 2YC4A 3ELNA 2RMU3 1VBB2 3EQEA 3LDRA 4NVPA 1RMU2 4OMCA 1CAUA 1KD7A 2B8MA 2EAKA 2YV8A 4FBFA 2YHJA 2V73A 4FOYA 2WFF3 2WZR1 1RXFA 2ZPXA 3N3HA 4N9IA 4OHZA 5LK7B 4R9BA 1XOYA 5CU1A 5JZGA 4CDWA 3U75A 2HYXA 2VZRA 1OURA 1AR63 3H7JA 1ULFA 2VNGA 2Q1MA 4OMDA 4Z07A 5A1AA 3BB6A 1JZ4A 4HG6B 3NVCA 1I5ZA 2CWSA 5A3TA 5DZEA 5F2SA 3MV01 1WKYA 1W04A 3GALA 3NNFA 3ZSKA 4BDVB 3KSCA 4OI0A 1PNGA 3QACA 3FUOA 3MI8A 4QM8A 2Z69A 4A42A 3KQRA 3WX5A 3K75B 4ZONA 1W2TA 3VBOA 1DHKB 1TEIA 1UN1A 3OPTA 5A6QA 1ZBA1 5IJRA 5KXEA 3GHMA 4E2GA 2SLIA 4XPVA 5E6HA 5JOZA 1RVF3 4D0QA 1LJ7A 2FQPA 3CEWA 5LA9A 2HWE2 3LA3A 3IMMA 1MVQA 3WG4A 1RUJ2 1COV2 4I02A 5D21A 1OFSA 1OBNA 5KC5A 2QJVA 3ZSLA 4PBPA 4NUBA 2B7YA 1BVP1 4IV3C 1JYNA 1HKDA 2D6NA 5A6YA 3Q8AA 1ULGA 4AL9A 1CESA 3B9IA 3KB5A 3O0XA 4R9AA 4W6XA 3HQRA 4YVWC 5F3CA 4XFCA 2XDVA 1C8M1 1R1A3 2I07B 4NIGA 4R4XA 1XJAA 5LBCA 1AR71 1CAXB 4N90A 1PK6C 3IDAA 4XTMA 1QH7A 1V6KA 3OYWA 1PM7A 3ZSMA 3MW4A 4P08A 4WM8B 3T3YA 4YW6A 2ZTNA 3J4UH 4DFSA 2R073 2FZ2A 5T52A 4CUCA 2CGPA 1RUG2 3JQXA 3M1HA 4DEQA 1RUC3 3ZN6B 2AH2A 1ZRRA 3VDBA 5TSWA 1N3QA 1YLLA 5A7WA 3WOGA 3ZKUA 3CJXA 3J7LA 1UAIA 4QPIA 1IKQA 3F95A 3SQOA 1R64A 5G05L 3U37A 4LNVA 3V65A 2HLEA 5FZ0A 1G86A 5F3GA 2R16A 4YM3A 3FN9A 4CUBA 1MS0A 1Z0HA 1Q5OA 4TYSA 1V70A 5BY5A 4YGDA 4PDWA 4L92A 3M3EA 3B69A 5IK8A 2CU5A 4CP9A 2J1SA 2PHRA 2EXKA 4WBBA 3WQ7A 1XNDA 3LEIA 3N7MA 3E97A 5FV3A 1X8EA 3ZIWA 4ORFA 4RS5C 1NQDA 4TLGA 4XF3A 4BQWA 4RR3A 1GZTA 4FFHA 2WNVC 4K1YA 3O14A 2DWRA 3RMXA 3VHOA 4A7ZA 2VGDA 5A6ZA 2QQUA 3RJRA 1WW6A 2K9ZA 3NMBA 4BXSV 1AL21 1GKBA 2ET1A 1Q8OA 2PLV2 3JUUA 3O1OA 5CKNA 5A3MA 2IXLA 3EO6A 4LTAA 5JIAA 4RD7A 1WW7A 2ERFA 5T5LA 4V1PA 5GJ6A 2O8QA 3VB9A 1R092 3LWCA 5FXXA 5C8CB 3WY6A 5BNOB 4D6QA 2HWE3 1UIKA 3LGRA 4WZCA 5IVYA 2F6BA 4LOSA 4R8HA 3HMYA 2CSGA 2VMFA 1BVVA 1CJDA 1XYPA 4MG2A 2HWC2 3AKTA 1W6OB 2VMHA 2YBSA 4FAGA 1SLBA 1H1AA 2G9FA 1KRIA 1LGBA 1W6MB 1WD3A 2V5YA 1CAVB 4G3YC 2PN5A 4HT1T 3NNMA 1WCQA 5DABA 2JDZA 2GALA 4Y5SA 4HVQA 1GZWB 3ZVXA 4C1XA 3POGA 3MGUA 5LY2A 3C7EA 1QOOA 1UMIA 3UNPA 4AVSA 2LUWA 4CDXC 1W8OA 1V6JA 2RS32 3T4HB 4A3ZA 2CDOA 1HJFA 4CUAA 4A4AA 1B35A 4ONUA 3LEKA 4QKBA 2FCVA 4A45A 3WW3A 1KS5A 3O0VA 3D8CA 1AHSA 4I3GA 1R082 4FTSA 2VY0A 3H7YA 1FAYA 4FTBA 4X8PA 4MV2A 2RE9A 3E5UA 5FXVA 2C6SA 1UYZA 1VP6A 3KWVA 2Q5TA 2RVAA 3VBRA 3ON7A 1W2AX 4YZ2A 3O1VA 1VR3A 1W9SA 3V56A 3PJYA 1BZWA 1SBDA 1XNCA 4M3CB 4P14A 3RRDA 5SV5A 3H50A 4PF1A 2XWBB 3CU7A 3VKFC 2JDHA 2R1DA 4S2HA 3RI8A 1BKZA 2EIEA 2XLAA 4IEYA 4NROA 4LHNA 5HCBA 5T3NA 2X5IC 3WUCA 4CEYC 1WMDA 1VAKA 2VZTA 1X50A 2ZS6B 3MW2A 1PIV3 1T6GC 3BU7A 4Z1VA 1FV3A 3SMHA 4GWIA 5L36A 4AFMA 2IWGB 4Q4W1 2G9GA 1RHI2 2TUNA 3FJSA 4ES8A 1YWKA 3DXUA 2XHKA 3T0BA 3NJXA 4PHZA 1EPZA 3TEZA 3IB3A 3UJQA 1T2XA 4TLFA 5FMBA 4FPYA 1H6YA 4QQPA 4YW7A 5BNPA 4WM8A 1TNFA 1GP4A 5FZEA 2JDKA 4LBMA 3VBRB 1D2SA 1OUXA 2VMIA 3PVOA 4LLFA 4NHMA 3BTAA 2NPIA 1NE4A 3WDWA 2AEZA 3AJYA 1YEWA 2YU2A 2RS52 2I2SA 4RQPC 4CZSA 3JB8A 4P9YA 1HXS1 1LB2A 3RG0A 1O6UA 2HWB1 4HANA 2WZR2 3ECQA 2A6ZA 1PX4A 2CL2A 4Y5Z0 3M3CA 4FPJA 2WO3A 4SBVA 5FO7B 2XBO1 2EXIA 1ULOA 1KDKA 1ZZ9A 4Y1XA 3GXUA 1WCKA 3WW1A 1BEV1 5FPLA 2R6QA 3KCYA 1CD3G 5FZHA 2FDGA 5D8AC 3QH7A 5J3UA 4KBBA 4AQTA 1NZCA 4MO3M 1JYWA 2JE7A 4N43A 3O1TA 1FATA 1J83A 3ZYRA 4HZFA 1OQ1A 4UFLA 1Q8VA 5JOXA 3USUA 1W6MA 4QHBA 1CONA 2HEWF 1W0NA 3UKNA 1AYN3 3WXPA 1RC6A 1VB4A 3U10A 1FMD3 2QQPA 3U0ZA 2YBKA 3VBOB 5A3UA 1NA1C 1REFA 3BGAA 1XNBA 4X6QB 1H2MA 1VMFA 2GU9A 2VVEA 3CO2A 2HWD2 3D82A 3WDVA 1MEC2 4FP3A 5EIYB 4E2SA 3WV6A 4EWAA 2MEV3 1QJY3 5HCFA 1O4ZA 1OLMA 5LASA 2HWF1 5IVEA 1K5MA 3HQUA 3MLJA 3GDBA 4D7YA 2R1BA 4H7MA 5EJZB 1DGRN 5I91A 1N1TA 1HN0A 2MPFA 2R072 5JSRA 1IPSA 1PHMA 1UU5A 1FPN2 3KCXA 2GNBA 4Y22B 2OW4A 5FZ3A 2Y33A 4SLIA 1ACCA 1NCQA 3ZXAC 2ZX1A 2JENA 3O5SA 3T09A 3WSOA 5I93A 2EIGA 4JKMA 4Q4Y3 2YFZA 1V9U3 1VBA1 3N35A 1ZA4A 4CA9A 4MLOA 2D40A 5EYYA 1ZBE1 2H0VA 3FX3A 3POEA 4LBOA 4MADA 3J7HA 2BYVE 4L8QA 4RN5A 5BNNA 2TNFA 4KU8A 2WR9A 1ALYA 4QU1A 4AFAA 1LESA 1NX9A 3IN9A 1D4M1 1V6IA 3UGHA 3L2HA 4QX7A 4JRAA 1ZRIA 2ZGLA 3LPGA 3NNJA 4JDNA 2VL4A 4YFWA 3V64A 2Q8DA 4FPHA 3PDQA 3ZR5A 3MIHA 2VZ1A 4HFSA 3I3BA 3ZSEA 4FQZA 1BBT3 1F8VA 5FXZA 1VIWB 3TEYA 3WP5A 1IGOA 4Y5TA 3AVRA 2IVJA 2VNVA 3I3QA 1UY0A 4HKOA 1AR62 1RHI1 2W92A 3HNYM 2BBVA 3HEIA 2OQ6A 4AGGA 2CDPA 1J84A 3CZJA 5JMOA 2QUOA 4IESA 5FZCA 1PO23 2PLV1 4Q29A 3USUB 3GGLA 3RYKA 2BVBA 4QX5A 1K45A 1RITA 5CFDC 4DPNA 3MFCA 1LGNA 2FD8A 3WHTA 3FBYA 2VQUA 2JG9C 4XUPA 1H1MA 5FZ8A 5LB6A 3CKHA 1PZ7A 4QB1A 4WVMB 5AFEA 3RZKA 1JHJA 3GHNA 4AEMA 4QXCA 4CXXA 1R1ZA 1RUD3 3AYAA 4XZUG 1LOBA 3AYEA 1FOD1 2O14A 4XTPA 5KXDA 1IS4A 1HB2A 5JMCA 4BHPA 1SPPB 1S0EA 2XUMA 3FLRA 5DZGA 4FPCA 2X05A 4XJAA 4BQ1A 5JXHA 4HSLA 2GN3A 3MUZ1 4XMIA 1OQEA 2UURA 1MQTB 2AACA 3D4KA 5K0UC 3GJBA 5A80A 5IK5A 2DURA 1RUJ3 4DXSA 2VTFA 1RMU3 3MO4A 4XAAA 2JDYA 4UFHA 4DOUA 2BWCA 1LGCA 2VULA 2LW8A 1EYBA 1WA4A 5A1FA 4AYUA 5BNPB 3ZXLA 4AEDC 1OLME 4XEZA 5FZBA 4CDUA 3R05A 3VN4A 4AE2A 2ES3A 4GZ9A 3FFZA 2BGOA 2OUJA 5F39A 4CDUB 1LKNA 1WMXA 4LBQD 3LSDA 2FBEA 4LITA 1DQ6A 5CZKA 4X8NA 3IMNA 3WG2A 4HONA 1JOPA 2BNNA 4IEVA 4DEVA 5CADA 4Q0SA 4Q4Y2 3ACFA 4JTOA 2J1AA 1WBLA 3FBMA 5FO8B 5IFPA 1UD1A 1XU2A 2A6WA 3QD6A 3BKZA 1RUE2 1LU1A 4L99A 4AFCA 5L9VA 3ZX7A 3AZXA 1UZZA 2R0HA 5DAXA 3RQ0A 1JUIA 4CEWB 1YQ8A 3LB9A 2NN8A 4URTA 4U36A 4NWVA 5A7WB 1UIJA 1C4RA 4ISQA 1RUC2 5A1LA 3I97A 2DVGA 2CTVA 3Q8CA 1TMF3 4IDZA 1JOJA 2JXAA 2YPJA 4Y1ZA 2WWUA 1RUNA 3CBNA 1QJY2 3H8UA 4E9KA 1U5IA 2E31A 2XKOA 2QNKA 2YC0A 4G9SB 3RZZA 2XH6A 5CFDB 3U11A 4AGRA 2EXHA 3WF4A 1CVNA 4AAPA 4CDUC 4JAAA 2BPA2 1YJKA 2Q0AA 2XKPA 1S0GA 2ZA9A 4QGLA 1DZRA 3LPFA 5I0UA 1HV1A 5GZDA 4QWNA 2AGSA 2JDUA 1ULEA 4LLOA 4LORA 3VBSB 4CUGA 3CHXA 1B35B 4UBGA 2GH2A 2PMWB 2WWSA 5FKBA 2VCAA 4HN0A 5C4WC 1AR91 1QHDA 3PU3A 5FZDA 4MGSA 4FXGB 5ACA1 4BMBA 5L7OC 4IUGA 1XNTA 5J98B 2BDRA 1N3PA 1HQLA 1YCIA 2O8OA 2VQTA 2XWJB 4HKWA 5FZIA 5JR7B 5KHGA 4ZS3A 5A32B 4K8RB 4FTEA 3K2OA 5C6CA 4BH9A 1W6OA 4ASMB 3AMHA 1G7YA 4M01A 3ROUA 3R4SA 3GM8A 3UKTA 5FR3A 1S0FA 4CP0A 2RS13 1YQ5A 3DYPA 2AEYA 1D7PM 1ENQA 2ZKLA 3R4UA 1CQ9A 4XIOA 2ZBJA 1RUG1 3M2MA 2GMPA 2C0ZA 3Q8EA 1BBT2 1MZ5A 4Y24A 4Q8KA 2P3JA 4URAA 2Q1ZB 3AM2A 3MBWA 1C5IA 3D6EA 1LR5A 3NJYA 3ACHA 4YW5A 1M4WA 4YZ1A 2YUEA 3RDIA 3RJ2X 3VZMA 1LHOA 4LPLA 3ZXEA 1LENA 1W9WA 3A22A 5GZCA 4GMP3 2PQSA 2SBAA 2A73B 4MGYE 3ZFFA 3I2FA 3K3NA 5A7QA 3WQBA 4XJ9A 2XBO2 2E7QA 2DBIA 1X9TA 4HK9A 2WFPA 4AEJA 4CCNA 3K4AA 5BPXA 5DN2A 4RR3B 4ITCA 4M4RA 3PUIA 2VZOA 1RJ8A 4QHOA 1O4TA 4K21A 4ATEA 1HDKA 3HBKA 4EE2A 3CF6E 1APNA 4CXWA 3INAA 3FHQA 2R041 4XE9A 1Y43B 3T0DA 1AR61 3ITQA 4HKLA 1NE6A 3UK9A 5FYIA 2A6VA 3TYJA 1WMEA 2DU1A 3ZXJA 4QPIB 3ABZA 4LQRA 4AR2A 1N3OA 1PVC3 2OS2A 5K0UA 4YZ5A 1J3PA 1GWKA 1LHVA 5F6LB 4CDXA 5M0TA 3DN7A 2WRAA 1AR81 1RUE1 3AXDA 4I0WB 4FFGA 4ET7A 3APBA 3ILFA 2Q4SA 3U78A 2XONA 3OD0A 3MV11 4H3WA 4XJ8A 3ZPOA 1MS4A 4EQVA 2WIIB 2CWMA 3SITA 2VBPA 2CGOA 2ZEYA 4UBHA 1EY2A 2ADDA 2VNRA 3WCRA 4FFIA 4JCKA 1RVF1 4QXKA 5JXIA 5J09A 2Y60A 3ZYIB 4YFZA 2D6PA 3KGZA 4HMZA 3WW4A 1VBA2 5FP4A 3AZYA 1JS9A 5DG1A 3UGGA 2TBVA 1PVC2 2XMLA 4XF4A 3RYRA 2GP5A 2YPDA 3LDKA 1LCLA 1H8TC 5FZAA 2P3YA 2J1EA 4I2OA 1Y9QA 3N9NA 4XURA 4YRDA 3QLQA 4PQ9A 5IVBA 4FI9A 3AFGA 1Y4WA 2Q8CA 5DPNA 1I1EA 5IK4A 1KEXA 2XGXA 3DEMA 4WVZA 2BNOA 3M3QA 2W39A 4XIKA 5JI7A 3ACGA 2WC2A 1ZRDA 3ZR6A 3IM0A 5GZEA 4JGZA 3PLQA 3DECA 3J8F2 4Y4YA 1W6PB 5CEHA 1RIRA 1G9DA 1W05A 2GH8A 5J7MA 4W6YA 4XHBA 4Q4W3 3WP3A 2WNVA 3BYWA 1G8WA 1XQNA 3THDA 2WO7A 2P5BA 2LROA 5FZ1A 5IT6A 5AVPA 2XJQA 1V6LA 4YLZA 4ZXEA 4CCJA 1OQDA 5EPAA 1P8JA 1VBE2 2VZSA 4OUSA 1HV0A 1TE1B 2HYKA 2W68A 2D43A 4COUA 3WLUA 1VRH3 1H30A 2A5ZA 5FPVA 4AF9A 2Y0OA 3KCCA 1V00A 2RR13 2Y26A 4XFHA 2EF6A 5F5CA 2BERA 2KXLA 4UW3A 3DYOA 3AMMA 4D3WA 3ACIA 1QJX3 3H3LA 4NOTA 2BV4A 1LOAA 2Y0IA 4L11A 4QB2A 1PGW2 3TBDA 1PNFA 2WFF2 1ND2C 3VBUB 4QX0A 2PYTA 5HPOA 5K4LA 4M0HA 1F5JA 5C9AB 3S0MA 2DVDA 5C8CC 4RA0A 3P3NA 1CWPA 3LDBA 1CZTA 1SG3A 3VDDA 5FCCA 3VDDB 4WV8A 3O1MA 3ATGA 4WM7C 2JIGA 4JGYC 4KWUA 2A3WA 4XFAA 1FPN3 1UWWA 3AMQA 2GC2A 3ASIA 5FYMA 2AENA 1UMZA 4L9BA 3CNAA 3PUSA 3DPRB 4TSVA 4XUOA 5DUXA 1YFWA 2V09A 4GAZA 5F6KA 5FY5A 3ZXDA 1W28A 1OF4A 2VW2A 4NAMA 5KC6A 2R042 3J9SA 3I2IA 2P34A 1TME2 1FMD1 3BPZA 4EN9B 5JUVA 3B94A 4UYBA 5A70A 4FXKB 3K3OA 3HD8B 4B7EA 4CP1A 4LKDA 3EXUA 5LATA 4BWOA 3POYA 4NHYA 3T1MA 3M3IA 1ZBE2 4LKFA 2DCJA 2VG9A 3LCPA 3PHMA 5DAQA 2D6LX 1XBFA 5EQUA 3OCPA 3LIHA 2ZGTA 4UFJA 1UYXA 2RS53 1PO12 1X7NA 5FWEA 4F7ZA 1PMHX 1VALA 2VUJA 2VBBA 4HOOA 5CBLA 5FYYA 3BALA 1NY72 4P9WA 3G6JB 1AJOA 4EN6B 5KR7A 4OHXA 1AR92 1DYPA 4LBKA 5BNQA 4Q4Y1 1V9U1 4QKNA 3E6DA 5AFBA 3EMRA 2CGNA 3WINE 4K3UA 4LO4B 5H9PA 4Q27A 3AX4A 1SEFA 1EAH3 4C90A 1WW4A 2A7AA 1DGRA 2JIJA 1RUI2 2PHLA 3PL0A 3OUHA 4CCOA 1DCSA 3C2UA 1CX4A 3P5BA 1L7LA 3OBTA 3H42B 2XJSA 4DUVA 3I2DA 3OGRA 2ZAAA 4EN0A 2PTMA 3T2OA 4JC1A 3TRSB 4UF0A 4EZ4A 1SCSA 4COZA 3KGLA 1QQP3 2J22A 5JI9A 4AWDA 4A7KA 1AYN1 2W1WA 2PHTA 2ZMLA 3KT1A 1HRV2 2JEMA 1QJX2 2YBPA 2GP3A 1W39A 1AR82 1FOD2 3U1XA 3RNSA 1REEA 2ZHMA 4MOAA 1RHI3 2OXBA 4QB6A 4YM0A 5FKCA 3UT0A 5JR2A 1REDA 1MS9A 3W58A 2YYOA 5CKQA 5F5AA 2WAAA 2XJUA 4LO7A 1GQHA 2OT7A 2DV9A 2Q8EA 1GQGA 3A7QA 2AYHA 5FXWA 2VM9A 1JUHA 3AYCA 1LNSA 3LFIA 4QQHA 1W99A 1TVGA 2JJ6A 4R9CA 2XOMA 2FDKA 5C4WB 1ZBA2 1ZZ6A 4IL7A 4LHSA 2Y6KA 1UXXX 2NMNA 3W5MA 2Y6JA 1RUH3 1YFXA 1B35C 3CJIA 5IVVA 3O1PA 1WD4A 2KD7A 3EBRA 3M4FA 1SFYA 4I3PA 1VBA3 4NAOA 1BMV1 2XUEA 1EUTA 4LO8A 4DXTA 4CCLA 1PGW1 1VE0A 3V0BA 4CDQC 1W8WA 2UY9A 4ASKA 4GULA 4BQYA 3NKTA 3AMPA 1HRI2 1HW5A 4N9HA 3SH3A 1YC61 2QTWB 4FPLA 2VD7A 3VZJA 1H6XA 3LSEA 3HVDA 3MLLA 4AG4A 4E27A 1R093 1ST8A 4OZOA 2YROA 4RQPA 5FYHA 1SBFA 4W8JA 3DL3A 4BU2A 4ZU5A 1N1YA 1W2UA 4JKKA 2E53A 4QT6A 3VBSC 2PHWA 5FJHA 4CPBA 3MIBA 1BBT1 2WA4A 3WVJA 1OI6A 4GH4A 4CDWB 1CN1A 2BNMA 4RSUA 2WQZC 1W90A 1ZRFA 2DUOA 1ENSA 4UW4A 3PTRB 2D3SA 1NOVA 1W2OA 3ILNA 2LM3A 5DAWA 3AKQA 2BGCA 4P9GA 2PLV3 4D6RA 2D5FA 3SH4A 3NJZA 1EV11 2VZPA 1WBFA 2OZJA 5EXOA 4CDQB 5EJ1B 3VZNA 1FT9A 1JBCA 3K51A 3SH5A 3HBZA 3PTYA 4RR3C 3GZEA 1OFNA 4O9GA 3VZKA 2QCSB 1PGSA 1MVEA 3MUY1 4K9SA 1R083 1ONAA 4RS5A 5BUVA 4HVRA 5JXGA 4QDQA 2UWAA 1K5MB 4V2VA 1GUIA 3WQ0A 4A6OA 5FY1A 2LS6A 4KNCA 1SDDB 1J1LA 1YO8A 3POWA 2GMEA 1DF0A 3VKMA 1PO13 1RUJ1 4BZ4A 4QMAA 2VCMA 1NAEA 1UY2A 2DCZA 2W2IA 3DKQA 3SCGA 3VBHB 2Y64A 3ZFGA 3GCWA 3OBZA 4JGZC 4Q0PA 3L9JT 1JZ6A 4XFFA 4XZPA 4XFBA 2Q8OA 3ZYPA 3LOBA 4DO0A 3GBWA 3KV5A 5FJKA 2B9UA 1T6BX 1PK6A 1GOHA 1D4M3 3LQCA 4YM2A 1SCRA 1PX3A 1H8TA 2GC0A 2C5DA 4WVWA 3TEWA 4FOWA 5ERLA 4LOTA 3KVBA 3FE5A 3I2OA 4ATFA 3MF6A 1A8MA 1UZVA 3IIIA 4IE7A 2GMMA 2QVSB 1ND3B 3LD8A 5IW0A 1E5IA 4NJ4A 4DIQA 4LHKA 4CEYA 3AFKA 1QKQA 4DINB 5BV6A 3VD9A 5I0DA 3BUCA 1GNYA 1GICA 3NQHA 1UMHA 1U5ZA 3DUIA 4QX2A 4NO4A 4QXBA 3BODA 2ZEWA 4GB33 2PXJA 2IVIB 3T0AA 4RHV3 1W6PA 5KXBA 2WSUA 2CAVA 2RG4A 3D3AA 5LRRA 4IQPA 5FZ7A 2A1XA 3Q8BA 4IEOA 5LEJA 1CAWB 3AL5A 1UNBA 3QCWA 2ZGOA 2A3YA 3KT4A 4CP9B 3JZVA 2WNUB 4WM7A 5L9RA 1A6CA 3WQ1A 4PLMA 4CP2A 4I0AA 4OFGA 1OLQA 2BW8A 5LBFA 5CISA 5F1RA 3ZO0B 5LY1A 4AEDA 4DNYA 4OI2A 3B5LB 3FMGA 3BVCA 4XDOA 1C8M2 4FPKA 3WNLA 5FUIA 3RI9A 4YW4A 2XJVA 1ZREA 4YGBA 1AR72 4IEZA 5GLVA 1SHWB 1UXZA 4AZZA 2FDFA 4XHXA 1O8PA 1TG7A 1UKGA 4LA2A 4XVHA 3N7JA 1HXS2 2Z5WA 1JHNA 4FVVA 5FPXA 5BYNA 3ZFEB 2VZ3A 4MXVA 5GZGA 4FSJA 3HQXA 2VAUA 4P02B 3KMHA 1F35A 1NQJA 1PVC1 3I2GA 1LHWA 2Z4FA 3JBG3 3N36A 1HB1A 2HWE1 1S0BA 3S5AA 3MIFA 3WP4A 1AVBA 3O12A 4Y20B 1GOGA 1UY3A 5JDBA 3OTFA 1ULDA 5BNPC 1DLCA 2FCTA 5FPZA 1VBD1 3ZMNA 5CFCC 1C28A 2DDUA 1GZCA 2J1RA 4TZDA 4CCKA 3C7OA 1JMUB 4QGMA 2UYBA 2XL9A 4IE4A 1Q3EA 2W1QA 4CEWC 4Y1YA 2F4PA 2R061 4A3XA 4LK7A 5AC93 1HN1A 4XJUA 2WDBA 2ZACA 5FYZA 1ZZ7A 4GXLA 4OULA 3MICA 2ZHLA 2DVAA 3IDBB 4MGQA 1RINA 4TWTA 5FP7A 3NV3A 3VBHA 2ZZJA 1J58A 1IG3A 1SZBA 5FZGA 5JSOA 2XQXA 5SV8A 5C9AA 5GALA 2K0GA 4Y26A 2VOTA 1A3KA 1PVXA 3TNPB 2OPWA 4CU6A 2KA3A 1ZM1A 4FOVA 3M70A 3O0WA 2GC3A 4B8EA 4JGYB 3H1MA 1LODA 4ZPIA 2C26A 3HN1A 4YVWB 3ZSJA 3M8LA 4XUNA 5C3OA 2ARXA 3G7DA 3KV6A 1WCUA 3ETPA 1UX7A 4H7LA 4IEWA 4UFIA 5B4XA 4Z2AA 4C91A 4QX3A 2PAKA 3VHNA 1K42A 4AI0A 3NV1A 1RUF3 1FXZA 1UPIA 4IETA 3SCFA 3N9MA 1AXZA 2TEPA 2XB6C 2XJPA 3C7HA 3I2HA 2PHDA 4QAWA 3HOBA 1JI6A 4UW5A 3HPNA 1AX1A 1V9U2 3WNPA 4P9XA 3WF2A 4HVOA 1SDWA 1H2KA 1S0CA 2N7GA 2W87A 4Y4RA 3V0BB 1ASJ2 3MF9A 1JYTA 2ZZQA 1MEC1 2RS11 5HCAA 2FHRA 3ZYFA 3VD3A 3H8OA 2FCUA 4KWJA 2OQ7A 2DUPA 1U5XA 2BVVA 3C3VA 4RFT0 3CMGA 4I01A 5C33A 2WNEA 3UGFA 5FDBA 5A7PA 1BJQA 3THCA 4RQPB 3H9AA 1BXHA 3DCQA 3IPVB 1X82A 1O4YA 1GANA 2WL1A 3RS6A 3TEXA 5A33B 1JZ5A 2PHFA 2WUHA 3A4UA 4QXHA 3N7KA 4BQ2A 4YW2A 3VBSA 4NPMA 1S1AA 2DFCA 5DZFA 3I2KA 2J1VA 4XQ4A 2ZGRA 1UU6A 4BA6A 5A3OA 1QQP2 2D3PA 4HPKB 1VBC1 3NWKA 2ZX0A 4OCTA 5C8WA 5L7OB 2HKXA 2Q1FA 1UZWA 2BZDA 5IVJA 2YZ4A 4IW3A 4Q26A 2VOKA 2WYSA 4OQ9A 3LEGA 2NMOA 2VTXJ 4A2UA 2WZPP 4NIDA 1UY1A 3E5QA 3S6PA 1CGPA 1OOPA 2CYFA 4Q4X3 2OIIA 1KJRA 3OJBA 2BP6A 4QPYA 1DZTA 1LULA 1BHGA 2XJTA 3PMEA 2ZX4A 2E63A 2VC9A 4DS0A 1DFQA 1H2NA 3MIGA 1H8VA 2AC1A 1W8NA 3I8TA 4YWAA 5D1IA 2RS51 1FNYA 4LUKA 3VKNA 5A3PA 5HI0A 2E7AA 2RR11 2B4KA 2D6KA 1W0OA 1UZYA 1QWRA 4MGKE 4PIZA 3S7IA 1POQA 1DQ2A 4AVVA 1AR83 4FAHA 1JYIA 2CAUA 2H0BA 4AEKA 1AYN2 3N9PA 5C7GA 2HBUA 1J3QA 1HRV1 2WJSA 4CDWC 4C8DA 5FY9A 5T50A 1KFUL 1UOJA 4RGGA 5F37A 5DAVA 1OT5A 2OA2A 5F3IA 2VR4A 3RVHA 3WD5A 5FP8A 3WDTA 1LOFC 1XC6A 2WINB 4AI9A 4CU8A 3AL6A 1A8DA 3UV9A 1XU1A 1FPN1 1I9RA 4AHWA 5K9YA 1I6XA 3GZAA 3O7OA 4COWA 2GNMA 2JE9A 5T5OA 2ZHKA 4E8CA 1OKQA 1OHFA 4JVAA 2VXRA 1NKGA 1YI7A 1W8UA 3SISA 1H8TB 2VO5A 1IPKA 3QBQA 4CXYA 2HBTA 3GNEA 3N4MA 4W50A 3SNMA 1S2BA 3TB0A 4EZHA 5JZGB 4WVMA 3I59A 2RM22 3KV4A 1F4AA 5JAXA 1BMV2 3BN6A 5H9RA 5IWFA 4EWEA 4CU9A 4OLLA 4QPGB 3RWNA 5H9QA 2D93A 5GLTA 4AK3A 3VUOA 4ZU4A 4KBZA 3ZFGB 1GYKA 2ZX3A 3QH6A 2WABA 1GLHA 4JDOA 4Y1UA 4U2AA 3CQOA 5JPNB 1L7QA 1Q8SA 1JZ2A 4ZY9A 5LBEA 4D94A 1NLRA 1NXMA 4CCEA 5C9AC 1IG0A 4AHZA 1OC1A 3VBHC 2GN7A 3OGVA 5EFUA 4NPRA 2XL7A 2ZX2A 1YQCA 2DUQA 1RUH2 2LRPA 2EXJA 5LK5A 2QQVA 4K8FA 4YVSB 3DPRA 2RDSA 2W94A 4EYUA 3MW3A 5FP9A 1GZWA 1HRI3 2JECA 1BCXA 4NHKA 3ZYHA 4Z8BA 5FZ6A 2UWCA 3R4DB 1DIWA 4QX8A 5B2GB 4MGIE 1IPJA 1D0GA 1UYPA 1ZZ8A 3WNXA 2Y6FA 5FY8A 3WF0A 3ES1A 2ZAHA 1UOGA 4DB5A 2ZXQA 1FV2A 3K4DA 3WNKA 3BU0A 3LA2A 4ZZ5A 1QQP1 1FOD3 4DUWA 1J59A 4FT8A 2BFUS 4O61A 1VBC2 5I8YA 2ZCWA 4ZHNA 1ND3C 4DZGA 5IVFA 2GDFA 2ZEZA 3OF1A 1NCQB 3GBFA 1W9YA 4YGCA 3ZKYA 1GSLA 2WKKA 5F5QA 4BQ4A 3V0AA 1BQPA 2B42B 5LWBA 1BYHA 5D8AB 3D0SA 5CAZA 4IV1A 2RDNA 4BE3A 2XXZA 5I8SA 2YY1A 4L97A 1PZ8A 4XBQA 1JOBA 5FOBB 4COVA 3MDPA 2O0OA 1ASJ1 4JKLA 5F2WA 3VZOA 1EP0A 3QOPA 1KQRA 1URXA 2RDQA 3MEPA 4KG8A 1VBD2 2WNUC 2YGLA 3DPRC 2QQIA 2VUAA 2XR4A 1ENXA 2YFUA 4MHUA 2QQLA 3OB8A 4XDPA 5FUPA 2P6HA 1S4CA 3BOPA 3ZN6A 2X09A 4IGOA 3WG1A 2VCBA 4GWNA 2W0XA 4YW1A 4PT6A 5IK7A 3B01A 2JE8A 2RMU2 4RL7A 1QIQA 3ORJA 3A21A 3AYDA 3M3OA 3KLSA 4IE0A 1QJU3 3RFRA 3TWIA 4BCUA 1IQAA 5FBJA 2V4VA 4BIFA 1Z78A 3LKJA 4OUEA 1XE0A 2VECA 1LECA 1RUI3 5AC92 1D0HA 4ISRA 4NR1A 4H14A 2PA7A 1Q8QA 5J36A 2VBDA 2XG3A 2ILMA 3DGTA 3GZTB 3IT8A 1UQXA 5C5TA 3P1IA 1UW8A 2YXSA 3VHRA 1LTEA 2OPKA 5T5JA 4BLJA 2HEYF 4GIQA 5IAXA 2JICA 2G1MA 5T5PA 2B39A 2QQJA 2W46A 4LE4A 4NIHA 4W6WA 3TAYA 1F4HA 1OKOA 3BOWA 2WN2A 1GWMA 5FZ9A 3HN3A 4D7SA 5FO9B 5IFTA 1GOFA 4IV3A 4P9IA 3AJZA 3F2ZA 4J6GA 3J7MA 4Q4X2 4QQOA 4NRQA 2VW0A 3W9AA 2OKXA 1LAJA 1CZSA 1G6NA 1NT0A 2OZ6A 4JTNA 3WCSA 5E89A 5K7PA 1ODNA 4UF0B 5T54A 5LA2A 1X33A 1O5LA 2R062 2GSYA 2VTXA 3TN93 5DXDA 4LT5A 1QH6A 5FLHA 5FLJA 2BWAA 1XSQA 5CVRA 2MEV2 2WT1A 3M7AA 1QMJA 1IS5A 1O5UA 4OHYA 3B93A 1Q56A 5E1RA 2H6BA 3HWJA 4FO9A 5CFCB 1QF3A 5JZGC 5J37A 3CZUA 4LULA 3MIEA 2QBXA 3EJKA 1RB8G 4K1ZA 1LRHA 3VHPA 4OHVA 4UAPA 4KU7A 1RUH1 5JVVA 1MS5A 3JD71 4E8DA 4ARYA 1POV1 3NAPA 1JN2P 3USSA 2QQKA 3BTXA 3ZFFC 4RFRB 2E6VA 2KM2A 5JIUA 2K2SA 1VBB3 5GLZA 2RS12 3ACLA 5FIXA 3TOJA 4BXFA 3OPWA 1UZ0A 2A6YA 4A44A 4GMP1 4GH4B 4QKFA 3WHUA 5A32A 4YM1A 4BOWA 3LA7A 4NHLA 3GZUC 2G4IA 1VRBA 1VMJA 1S2KA 3AKPA 3FFQA 2L9LA 4YVSC 4YVSA 4P9LA 4BQXA 4GWMA 5FY7A 1G9CA 3MZHA 5C70A 4JV4A 3SC7X 4C1WA 4XABA 1COV3 3IZOA 3I3MA 3JBG1 4MHRA 3ZYJB 2BQPA 3MPBA 4O65A 2OVUA 4EROA 2DCTA 3OSDA 1MPXA 5DDJ2 5CG9A 3JXSA 1RXGA 5KWRA 1H9PA 3FZ3A 3VD4A 2VXJA 4OUMA 4F3JA 4K20A 1U5YA 3ZXGA 2VOWA 5APAA 1DYOA 5ABJA 1HB4A 4MXWA 3ENRA 3I3DA 1TME1 1VMHA 2JDAA 3OEAA 4YG3A 1EV13 4PQQA 5C3RA 3DV8A 3KS7A 3RPQA 1AXKA 3WF3A 1RUE3 2V4AA 1H1IA 3KHBA 5I0SA 2EIBA 2WQ8A 4G4FA 2J42A 3POBA 4P5HA 4BM8A 1H2LA 1QDCA 1RUOA 2ATFA 4NPLA 4DY5A 2WS91 3VDCA 2FDIA 2W95A 1GNHA 2B45X 1XYNA 4B3NA 2RR12 4QQLA 2WFF1 2EA7A 1K5MC 2WZR3 3WNMA 4N53C 3R0RA 1OUSA 2XVLA 1C1LA 5HXMA 1LHUA 4PF5A 3NSTA 2JWPA 4E4HA 5CB7A 3RYPA 2VUCA 3HNMA 2X53S 2ZGQA 2JKBA 3OGJA 1NA1A 2ZMKA 2P17A 4OVEA 1YNAA 3ZFEA 4LBQB 5BNOC 4XACA 1DZQA 1H0BA 4EJRA 1MQTC 4CTEA 2BBAA 2D7FA 1J3RA 4XYXA 5E16A 1IZ3A 3WR0A 4JGZB 2WA3A 4L0PA 2QQMA 3C7GA 3W59A 4LE3A 2Y6LA 4MSVA 1W8TA 1S0DA 1W06A 4HSJA 5EZWA 2WWJA 5EYXA 2RS33 3WDUA 1MZEA 3IDEA 4XBNA 2RM23 3RZLA 3VL9A 4XXPA 5FYVA 3IIAA 1NZIA 1PM4A 2RJLA 2I74A 2IXKA 4O9EA 1IQDC 3WW2A 4RGKA 5C3PA 5LRSA 5E8AA 1NLSA 1Y3TA 2ZABA 3K77A 2MNGA 2FDJA 5FYCA 2R063 4LEJA 5EJ3A 1PO22 1YYNA 4AQ2A 5AC91 2YB7A 2AR6A 3AKSA 3C7FA 4OYUA 4CPBD 3A23A 1RTVA 4XW3A 4EN8B 1VRH1 2XHNA 2IXHA 2CY6A 4MX3A 4AXOA 3VBUC 1RYYA 4TN7A 3RZJA 1OPMA 1W6NA 1MS1A 4RHV1 3SXWA 4XF9A 4QU2A 1W3VA 1XRUA 3JB4C 4Q4V1 1C8M3 2WLQA 2PHUA 2Z79A 1R1A1 4YNIA 1EUUA 2MHFA 4ES9A 3PUAA 3ZFGC 3AZWA 2ZHNA 3AMNA 4XILA 3ZYBA 4R9DA 2DVBA 4LHLA 5FUNA 1XNAA 5A33A 3NNLA 4YZ4A 3VDAA 4GD4A 4AQSA 3WNNA 3SKJE 3IPVA 2ET7A 5F7UA 4UXAA 5EWSA 1AZDA 1OVPA 2QQOA 4Q1PA 1XXNA 5A7NA 3GJAA 1AXYA 2XVKA 2BRTA 5J48A 1ZZBA 1Y9GA 4IEPA 3J7NA 3I54A 1OMIA 3NV2A 3T1LA 4GB32 1LHNA 4J1XA 4PLNA 5JWPA 1KDMA 1F2NA 5DUWA 1ENRA 5GLUA 2FZ1A 3OD4A 4KI5M 5B4NA 4GH4C 1W3XA 1FMD2 3LF7A 3VBUA 2E51A 3AP6A 1S55A 1WGPA 3DYMA 3MYXA 4CU7A 2HWC1 5JOWA 1AX0A 4GJZA 3U4XA 4FOQA 2QKDA 2QQNA 4A6SA 2ZOEB 3VKOA 4FQ4A 3IAPA 1VBD3 1S0IA 5FYSA 5JCTA 2ARBA 4QX1A 3VBFA 3WNOA 3PJQA 1SFNA 2XLFA 4AFDA 2VMEA 1YIFA 2G19A 4CSWA 4RS5B 3JQWA 1QXPA 2WZEA 4Q0UA 1JYXA 4Z92B 4Q0VA 4YARA 1US3A 3WG3A 1QJU2 1UX6A 4YVWA 4HN1A 1FI2A 1OA2A 1SLTA 1UY4A 2W9XA 2DBNA 3ZN5A 5J1XA 1TQ5A 3WDXA 1VBC3 2HEVF 3EB7A 1DLLA 3I4IA 3J8F1 4INDA 2A75A 4LKEA 1XE7A 2ZGNA 4XXAA 2R0FA 1H9WA 1VBE3 3R6SA 3UKVA 4BYYA 4XMAA 1DP0A 4OQ8A 1EAH1 3PVBB 2Y38A 1OF3A 4V2WA 2VZUA 4XCBA 2D97A 3ZFEC 4IERA 3E5XA 3N9OA 2HWF2 2X29A 2UY8A 2ZKNA 2VPVA 3OPZA 4M00A 4CE8A 4DY3A 4Q4X1 4QD2A 4IGPA 1QJZA 3AKRA 1CR7A 3ETQA 3H8XA 5A3NA 5GLWA 1FYUA 3KT7A 1SLIA 4L2NA 5FMCA 4NN0A 2UWBA 5GM0A 2DCYA 4A7YA 2AZ5A 4FCAA 3E1F1 3TNQA 4COYA 2WZ8A 4KGQA 2B5HA 4XF1A 4XF0A 5CA6A 1QOTA 3FUQA 2P37A 2JKXA 2JG9A 3T30A 1UL9A 3I3EA 4AI1A 2E9QA 1EV12 1W03A 2P1BA 1H4GA 1HRV3 1GNZA 1RJ7A 1WUVA 2ADEA 2NM1A 3IBMA 1U0AA 2BJSA 4S2FA 3ZXFA 1JODA 1YXWA 2IXIA 4NHXA 3CJIB 2VCCA 2W1UA 1MS3A 3OUIA 4QPGA 1HRI1 4PI0A 4E4ZA 2WYFA 3ZOIA 5C4WA 1VLNA 3OBRA 1VAVA 4IEXA 1QOSA 4GALA 4A41A 4N43C 5HBAA 3AVSA 2IC1A 3O1UA 1RUF2 4WZFA 1IS6A 2W5FA 2JG8B 2BEOA 3VD5A 2YU1A 4AEDB 2HWB2 3NNGA 4GJYA 4CCDA 4JHTA 1OSGA 1OOPC 4WM7B 3S57A 1UO9A 1PGL1 4B4QA 1ZNPA 5F8PA 4RGAA 1R091 2J1TA 1UOBA 4D8MA 3MHZA 4BJ0A 3I7DA 2WT2A 1MZFA 4LXLA 3ZIXA 1MR5A 2R7EB 1XSRA 2EALA 1ASJ3 1V6OA 1Z7S3 2PHXA 2UYAA 4Q4W2 1EPWA 1PMJX 5DG2A 4JX0A 2BOJA 2W52A 4RYDA 2DCKA 4IXLA 3URFA 3BPSA 4NIAA 2Y6HA 4YSFA 1GWLA 5FBZA 3KHCA 4NRMA 3H8RA 4PJYA 1LOEA 1OLRA 3ZXKA 3BCWA 2VMCA 2EICA 4LO5B 1G9BA 1O3SA 2GZWA 2PELA 4XAEA 5FPBA 5FZMA 2RDRA 1AYM1 1FX5A 4BLIA 2DU0A 5FZKA 1OXCA 5F9TA 2HWD1 3PVEA 4IV1B 2ETEA 1CPMA 1K3IA 3K46A 3POJA 4R52A 5A6XA 4B4RA 2ARCA 3NL1A 2A70A 1CIYA 1RUD2 1YUDA 3GF6A 3KQ4B 4PI2A 2VOXA 3VBRC 3NRUA 4FP2A 1OPOA 4NWWA 2CHHA 3WDYA 5IVCA 2WS92 1W0PA 5L73A 5F32A 4LBJA 2K46A 4XETA 5FK7A 2C24A 3MFAA 1R081 1AF9A 4IE6A 1WLCA 5FZOB 4BK5A 2RMU1 2V72A 4FPOB 4MXWB 5ANNA 3JBG2 3THPA 2YGMA 2G9ZA 3RWKX 2QQWA 1Y9MA 1YRZA 3ZDVA 2JB8A 4Q0QA 1JW6A 1UF2C 4AVAA 1E5HA 3JU9A 3K4ZA 3ILRA 4UFKA 1PO11 1EAH2 4JRLA 4YZ3A 2B9VA 2F4LA 3VDDC 3H3ZA 3AZVA 3S7EA 2I45A 4M4PA 1ZZCA 2Y6GA 3KVAA 4UFMA 5C8CA 3KV9A 5LW9A 3VD7A 4KL1A 1O59A 5CNAA 3DKWA 1WCDJ 1BEV2 3MLKA 1AX2A 1A34A 3U07A 1W2NA 2HJIA 1Y7BA 2IZWA 4XJWA 3UYJA 4GA9A 5JOYA 5LZ6A 1OVSA 3ZDSA 4EN7B 3RGBA 1LEMA 2JDMA 1TNRA 2UU8A 3S5QA 2HWF3 4S2GA 5FYUA 5IYYA 5HXVA 4MH0E 1SMVA 3WZ1A 2E26A 1KGYA 2C1FA 1AJKA 2EVXA 3OEBA 3I49A 1JTZX 1WMFA 1HJGA 2QZ2A 1DQ0A 1QJU1 3NAPB 3I59B 4AI2A 4ZU7A 5DDJ3 3ME2A 4AAXA 2DFBA 1OH3A
chains in the Genus database with same CATH topology
5IATA 4NHXA 2Y34A 3OUIA 5ERLA 5LBEA 3HQRA 5EP9A 4XCAA 3NNJA 5LBCA 2FCUA 5EPAA 2RDSA 4Y5TA 4NHKA 2RG4A 2A1XA 4XC9A 3KT4A 3NNLA 4NAOA 4NHLA 5L9RA 4J25A 5LBFA 3GJAA 4BQYA 5LBBA 3BVCA 4BQXA 4XABA 4MHRA 4IW3A 4NHMA 2JIGA 5L9BA 2RDNA 4BQWA 5IAVA 2RDRA 2RDQA 3GJBA 4NMIA 3W21A 4UWDA 4XAAA 3OUJA 4MHUA 2G19A 3ITQA 5DAWA 2V4AA 5LATA 2FCTA 4NHYA 4Q5OA 5DAQA 2HBUA 5EQUA 3GZEA 5M0TA 5DAVA 5A3UA 5L9VA 3NNFA 5DAXA 4XCBA 5LASA 5C5TA 3NNMA 3HQUA 4Y5SA 4ZONA 3EMRA 4XACA 5IAXA 2G1MA 3KT7A 3MGUA 2JIJA 2OPWA 3PL0A 3OUHA 3DKQA 5HV0A 4JZRA 5HV4A 2HBTA 4ZPIA 2Y33A 5LA9A 3OBZA 5DAPA 5C5UA 2FCVA 5LB6A 3W20A 4KBZA 3KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IAT A;  4NHX A;  2Y34 A;  3OUI A;  5ERL A;  5LBE A;  3HQR A;  5EP9 A;  4XCA A;  3NNJ A;  5LBC A;  2FCU A;  5EPA A;  2RDS A;  4Y5T A;  4NHK A;  2RG4 A;  2A1X A;  4XC9 A;  3KT4 A;  3NNL A;  4NAO A;  4NHL A;  5L9R A;  4J25 A;  5LBF A;  3GJA A;  4BQY A;  5LBB A;  3BVC A;  4BQX A;  4XAB A;  4MHR A;  4IW3 A;  4NHM A;  2JIG A;  5L9B A;  2RDN A;  4BQW A;  5IAV A;  2RDR A;  2RDQ A;  3GJB A;  4NMI A;  3W21 A;  4UWD A;  4XAA A;  3OUJ A;  4MHU A;  2G19 A;  3ITQ A;  5DAW A;  2V4A A;  5LAT A;  2FCT A;  4NHY A;  4Q5O A;  5DAQ A;  2HBU A;  5EQU A;  3GZE A;  5M0T A;  5DAV A;  5A3U A;  5L9V A;  3NNF A;  5DAX A;  4XCB A;  5LAS A;  5C5T A;  3NNM A;  3HQU A;  4Y5S A;  4ZON A;  3EMR A;  4XAC A;  5IAX A;  2G1M A;  3KT7 A;  3MGU A;  2JIJ A;  2OPW A;  3PL0 A;  3OUH A;  3DKQ A;  5HV0 A;  4JZR A;  5HV4 A;  2HBT A;  4ZPI A;  2Y33 A;  5LA9 A;  3OBZ A;  5DAP A;  5C5U A;  2FCV A;  5LB6 A;  3W20 A;  4KBZ A;  3KT1 A; 
#chains in the Genus database with same CATH topology
 3JD7 3;  2PAE A;  1VB2 A;  1POV 3;  2VNO A;  2Y8K A;  3VLB B;  5JPM B;  4AOC A;  2X10 A;  1PIV 2;  2VUD A;  5FP3 A;  2JDN A;  3LAG A;  5DMY A;  4KG0 A;  4GB3 1;  5CFC A;  4QPW A;  4NRP A;  3SEP A;  2VMD A;  4XFI A;  5FMO L;  4AQ6 A;  4BIO A;  2VQ0 A;  4KQ7 A;  4M3C F;  4WM8 C;  4B29 A;  5C3S A;  4OHW A;  1QY4 A;  5ISL A;  1SBE A;  4UI9 L;  1NCR C;  3WUD A;  2DYC A;  4N8M A;  3WP6 A;  4DXR A;  3N9L A;  4W4Z A;  3RZG A;  1W6Q B;  4MGT A;  4UOJ A;  5HCH A;  4M0N A;  1PZ9 A;  2OYZ A;  5FQ0 A;  5I0R A;  5T55 A;  4IGQ A;  4XFG A;  4QPG C;  2Q30 A;  2BGP A;  1TMF 2;  1O8S A;  4P5Y A;  1W8Z A;  4QPI C;  4S2D A;  1JYC A;  1SLL A;  4B7K A;  2ZGM A;  2EID A;  4HK8 A;  4N43 B;  1R1A 2;  3J26 N;  3NAP C;  4Y1V A;  4ZS2 A;  1S0J A;  1WCS A;  2JG8 C;  2JG8 A;  3D5O A;  4LBN A;  1VPH A;  3PIJ A;  4YGE A;  4PDW C;  4GQ7 A;  1TME 3;  1VJ2 A;  3HNB M;  1UYY A;  1QXR A;  3Q9O A;  4XUQ A;  1A78 A;  3AP9 A;  1PK6 B;  2IXC A;  1XB9 A;  3LEM A;  3MID A;  5L9B A;  1ZYB A;  2CNA A;  3OG2 A;  3T08 A;  3B00 A;  4E4S A;  4FFF A;  3VL8 A;  1GBG A;  1W8F A;  3UL2 A;  2J7M A;  1WLT A;  4NMI A;  4AHY A;  1NCR B;  1RUD 1;  3OUJ A;  4YG0 A;  1W6N B;  2VVF A;  3ZN4 A;  1WA6 X;  1NCR A;  1WWY A;  3IDC B;  5FY4 A;  1VBB 1;  3CIH A;  1IKP A;  2D3R A;  1UOF A;  5FQ0 B;  1CX1 A;  1O91 A;  2VU9 A;  1HQW A;  1GQP A;  5F5I A;  1I5P A;  4KH9 A;  4AI8 A;  4CDX B;  5C3Q A;  1NG0 A;  3O1R A;  1MAC A;  1YHF A;  2WNO A;  2R32 A;  5FRA A;  5H9S A;  3POS A;  2A6X A;  3ST7 A;  1DQ4 A;  1NCQ C;  2A71 A;  1BK1 A;  1W9F A;  4Q5O A;  5KBF A;  3H1W A;  1DGL A;  1LOC A;  2BOI A;  2JD9 A;  3GBG A;  2D44 A;  1HX6 A;  1BLZ A;  1ODM A;  3U14 A;  1DDL A;  1S2E A;  2ZEX A;  3LIG A;  4QDS A;  4UT5 A;  4EWD A;  1DBN A;  4QKD A;  4LKS A;  2ZJC A;  1L7R A;  4MYE A;  5BNN B;  3EHK A;  3BTZ A;  3W5N A;  2BU9 A;  1Q8P A;  1V0A A;  4XBL A;  2JD4 A;  1G9A A;  1D4V B;  2QZ3 A;  2WSV A;  4KWK A;  5LEK A;  4JHZ A;  4XQD A;  1CIW A;  4XOG A;  5D2A A;  1C1F A;  5FRE A;  4LIV A;  4N53 A;  5FFO C;  2R07 1;  1HIX A;  4JZR A;  5HV4 A;  1UU4 A;  4NII A;  4Y22 A;  1RUC 1;  1MZ6 A;  1RUF 1;  2PAM A;  3GCX A;  1QNY A;  4Q2F A;  1I3H A;  5L19 A;  3FL7 A;  5CG8 A;  1XNK A;  1K5J A;  3W20 A;  2BUK A;  4LUM A;  3C8X A;  3KF5 A;  4LJH A;  1IHM A;  1ZBA 3;  1BK0 A;  2XQR A;  3SHR A;  3CDZ B;  2WBK A;  4HET A;  1GU3 A;  3FHI B;  1MEC 3;  2WN3 A;  2Z2S B;  3HAG A;  3T2T A;  5AVA A;  4GWJ A;  4YYO A;  1KIT A;  4EV0 A;  2Y34 A;  4Q4V 3;  1H4H A;  3RMY A;  3IAQ A;  1OA4 A;  1QJF A;  4GMP 0;  3POI A;  5LCW L;  1AUY A;  3DF0 A;  2X5I B;  2BTV C;  2LTN A;  1V6M A;  3H3U A;  1L3J A;  3TN9 2;  4RHV 2;  1KXG A;  3IKW A;  3VGI A;  1E5S A;  4DRR A;  4E2Q A;  1U12 A;  5ACA 2;  3MPP G;  5BXX A;  1GZ9 A;  5FTT C;  3NKG A;  5FZL A;  3PNA A;  2WLP A;  2FDH A;  4Q4V 2;  1KJL A;  5KHH A;  1W8H A;  2NP0 A;  4P00 B;  2XJR A;  3KD4 A;  3B7M A;  4Y33 A;  4AVB A;  1JYV A;  1AR7 3;  1F9K A;  4WVV A;  2RM2 1;  1GP6 A;  3T4V A;  4BIS A;  1COV 1;  1LOG A;  3D0J A;  4AGV A;  4CVU A;  1XPW A;  3AK0 A;  1PMI A;  1SLC A;  2IFW A;  3JCI A;  3OGS A;  4PLO A;  1C5H A;  4D69 A;  4UW6 A;  3BI3 A;  4MZU A;  1RUG 3;  4Y20 A;  2F17 A;  2W3J A;  5FZ4 A;  4YPJ A;  2WO2 A;  4Z2W A;  2J1U A;  5JXJ A;  2GND A;  1OA3 A;  4LA3 A;  4CDQ A;  2W47 A;  2ZGS A;  4IEQ A;  4D7T A;  3UJO A;  5J96 B;  4CCC A;  4BQ5 A;  4BQ3 A;  3RSJ A;  4Q8L A;  1SLA A;  4B1L A;  4KWL A;  4MUV A;  4N53 B;  2ARA A;  5KHJ A;  4LBL A;  4YW3 A;  2H6C A;  5IAV A;  1ULC A;  3BTY A;  5EHD A;  3N7L A;  1OD5 A;  1AL2 2;  3CJI C;  3PUR A;  4UWD A;  3T2Q A;  1O3Q A;  4DMI A;  4PDW B;  4QHZ A;  2VJX A;  1UKR A;  5C71 A;  1NUK A;  2HWB 3;  5A3L A;  1LOF A;  3P6B A;  1M06 G;  3OY8 A;  3RZH A;  2WS9 3;  3KZ4 C;  4FPE A;  5FK8 A;  5FMD A;  3SLI A;  4K6B A;  1SQ4 A;  1ND2 A;  3WF1 A;  1XE8 A;  2JB4 A;  1YFU A;  3POF A;  2WNU A;  3FWE A;  3THT A;  2GNT A;  2R04 3;  4C0B A;  4QGN A;  1WW5 A;  4PIY A;  1AL2 3;  3EYP A;  3PU8 A;  1D2Q A;  1X9P A;  3ZPY A;  3UES A;  4IEU A;  1ZX5 A;  2WAO A;  2YMZ A;  4M3C A;  4TTG A;  4ASL A;  2DF7 A;  4BB3 A;  5FYT A;  1YFY A;  5A7O A;  1HB3 A;  3BIE A;  1QJE A;  4OZX A;  4N7I A;  2VMG A;  4IV3 B;  2E32 A;  1VAM A;  1HLC A;  1ND3 A;  4NE9 A;  3LZZ A;  3IWZ A;  5GZF A;  3RZM A;  5L7O A;  1DGW X;  1DGW A;  4LO6 B;  3L2Y A;  2VQA A;  4P9J A;  5FLI A;  2CV6 A;  1SPP A;  3SKV A;  3CLP A;  1ULP A;  4LIU A;  4D6S A;  2PFW A;  4XJZ A;  5ANQ A;  2RS3 1;  1QJY 1;  4OI4 A;  5FY0 A;  1RGS A;  2FMY A;  1NXD 1;  1QXJ A;  3FLP A;  2RHP A;  4B4P A;  2ZGU A;  5DAP A;  1RVF 2;  2QE3 A;  5BNN C;  5C5U A;  2ORX A;  5DQ0 A;  3A0K A;  1V6N A;  2ORZ A;  3NW4 A;  4R4Z A;  1J1T A;  1QGL A;  2VH9 A;  1ZRC A;  2ZGK A;  4I0B A;  3H1Y A;  3OOX A;  3AP5 A;  3J8F 3;  1DG6 A;  3A0N A;  2P3I A;  4HXC A;  1VBE 1;  2X8K A;  1X8M A;  4JDM A;  1XYO A;  1W6Q A;  2JG9 B;  4DXZ A;  2VVD A;  4DRV A;  2QFE A;  3N9Q A;  1GR3 A;  4J1W A;  1IOA A;  1AYM 2;  3LE0 A;  1NY7 1;  2R49 A;  3FHA A;  4BK4 A;  3HR9 A;  4HL0 A;  5BNO A;  4DQA A;  5IUQ A;  3VBF C;  1MS8 A;  2A3X A;  4E4D X;  1X36 A;  1Z7S 1;  4X6R B;  1C8N A;  2P2K A;  4HBN A;  3T2P A;  2KR2 A;  1YQ6 A;  2QDR A;  5G04 L;  5JLV A;  4XC9 A;  3V0A B;  3BIW E;  4IE5 A;  2HH9 A;  3LOI A;  4HLT A;  4JGY A;  1PGL 2;  2XLG A;  1N1S A;  5CIR A;  1OD3 A;  5FWJ A;  2WT0 A;  2NLR A;  3OGG A;  2WNV B;  3Q8F A;  1AYM 3;  2B46 X;  5DUV A;  5A7S A;  1WLD A;  1JZ8 A;  1PIV 1;  2D6M A;  1NLQ A;  3O1S A;  5CKM A;  1SAC A;  2D98 A;  1E5R A;  1W9T A;  2C9K A;  1QJX 1;  2HWC 3;  1US2 A;  2ENR A;  2W91 A;  2YC2 A;  3AZZ A;  3HIF A;  3NJV A;  4XDQ A;  1QNW A;  3ZMO A;  4BME A;  2DTY A;  1DU3 D;  3S30 A;  1F5F A;  1KFX L;  2ZMN A;  2DVF A;  1LU2 A;  3AP4 A;  3H0O A;  2P3K A;  5DUU A;  1N47 A;  3AP7 A;  1GV9 A;  3VZL A;  1WZX A;  1AL0 G;  1YQ2 A;  2C9A A;  1RL3 A;  3AC0 A;  5CYY A;  1KS4 A;  4I30 A;  3E6B A;  1UCX A;  4TXW A;  2P6C A;  1WLW A;  3VBF B;  3VKL A;  4PCR A;  4AW7 A;  1HQN A;  2IFR A;  3HJR A;  3LFM A;  4CYD A;  3K48 A;  2OUH A;  5F3E A;  1B09 A;  3U4S A;  3WEZ A;  4H2A A;  2LAL A;  4W65 A;  1RMU 1;  1FNZ A;  2WO1 A;  4MET A;  1IS3 A;  1RUI 1;  4QQ2 A;  1TZO A;  4I09 A;  1HXS 3;  2RJK A;  5K8S A;  5FOJ B;  5FPU A;  5I8T A;  4M3C E;  5ABJ C;  3OYW B;  2DTW A;  4JQT A;  4ZZ8 A;  1ZBE 3;  1CAX A;  2ARE A;  2XVG A;  3E6C C;  2XBO 3;  5FZO A;  5GKA C;  4OI1 A;  2VOV A;  1YJL A;  4DUX A;  2GC1 A;  1BEV 3;  2FMD A;  3GYD A;  1GP5 A;  2P4E A;  4LMF A;  4LR4 A;  3ZLI A;  4AVC A;  3B3Q E;  3FLT A;  2IXJ A;  2YDE A;  3HT2 A;  5EV7 A;  5K0U B;  2E7T A;  2XPJ A;  3UET A;  2PQQ A;  3CL1 A;  5FPA A;  4CEW A;  1ND2 B;  2AUY A;  2VE1 A;  2HWD 3;  1DYK A;  1QU0 A;  4XUT A;  1YI9 A;  1ZVF A;  3KF3 A;  3OY8 B;  1F31 A;  4MVT A;  2R30 A;  3VV1 A;  3AXE A;  2W08 A;  5HV0 A;  4LK6 A;  3TN9 1;  1QEX A;  3B9C A;  2RV9 A;  1C3H A;  3NO8 A;  1TMF 1;  3P3P A;  1CAW A;  3JD7 2;  3PIG A;  3PUQ A;  4AHX A;  1N1V A;  5E88 A;  1O3R A;  2MEV 1;  4H55 A;  2NQY A;  5IHR A;  2NZ9 A;  2E33 A;  1UPS A;  2VW1 A;  3OBA A;  1O3T A;  4AVT A;  4LBQ A;  2Z42 A;  2VZQ A;  3ZYG A;  4PIX A;  3AB0 A;  2O1Q A;  4Q1R A;  1SFP A;  2IUW A;  5JSP A;  3ZM8 A;  2W1S A;  4CEY B;  2V5D A;  4Z82 A;  5IAT A;  3X29 B;  3ZFF B;  1CZV A;  4QDR A;  1MQT A;  1D4M 2;  4MGZ E;  1CJP A;  1Q43 A;  3PVN A;  4BPZ A;  4AFB A;  4ZKT B;  5EP9 A;  2ID4 A;  5KHK A;  1JZ3 A;  1DQ1 A;  1JXN A;  4XCA A;  3SCH A;  3DXT A;  5D8A A;  4XQW A;  2D6O X;  4FPF A;  4KMQ A;  1AR9 3;  1C57 A;  5ACA 3;  1OH4 A;  5FMO S;  4QM9 A;  2JX9 A;  4KGG A;  1DQ5 A;  1F15 A;  2VZV A;  4Y3O A;  1Z7S 2;  4O7X A;  4YG6 A;  3NV4 A;  2QDN A;  1OOP B;  4K40 A;  2RJ2 A;  3HT1 A;  1CAU B;  1CPN A;  1YIP A;  4GKX A;  3I2J A;  3FC0 A;  1E57 A;  1NA1 B;  2JDP A;  4ARX A;  4CCM A;  1O7F A;  2YG0 A;  4C0H A;  2C4X A;  5ABJ B;  1NYW A;  4N7U A;  3ALQ A;  5A3W A;  1K12 A;  4JQR A;  1POV 0;  4J25 A;  4PBO A;  2OX0 A;  4HPK A;  2BFU L;  2D5H A;  5DDJ 1;  5LBB A;  3ES4 A;  1GFF 2;  4CRQ A;  4GKY A;  1LED A;  4K7J A;  5I0T A;  1JZ7 A;  2GAU A;  1PO2 1;  1JH5 A;  1GMM A;  5KXC A;  4ZXK A;  3WT3 A;  4B1M A;  1JU4 A;  5LA1 A;  1G9F A;  1VRH 2;  3PUH A;  3SEE A;  4AI3 A;  3VBO C;  3KM5 A;  4FPG A;  1CAV A;  1STM A;  2EAA A;  2WQ4 A;  3PMS A;  1JU3 A;  5FAX A;  5FYB A;  5CFD A;  3W21 A;  4F8A A;  2NYY A;  4IV1 C;  5LA0 A;  2X5I A;  5KHI A;  1QDO A;  1ZA7 A;  5FZF A;  3B02 A;  4F83 A;  2ZGP A;  2YC4 A;  3ELN A;  2RMU 3;  1VBB 2;  3EQE A;  3LDR A;  4NVP A;  1RMU 2;  4OMC A;  1CAU A;  1KD7 A;  2B8M A;  2EAK A;  2YV8 A;  4FBF A;  2YHJ A;  2V73 A;  4FOY A;  2WFF 3;  2WZR 1;  1RXF A;  2ZPX A;  3N3H A;  4N9I A;  4OHZ A;  5LK7 B;  4R9B A;  1XOY A;  5CU1 A;  5JZG A;  4CDW A;  3U75 A;  2HYX A;  2VZR A;  1OUR A;  1AR6 3;  3H7J A;  1ULF A;  2VNG A;  2Q1M A;  4OMD A;  4Z07 A;  5A1A A;  3BB6 A;  1JZ4 A;  4HG6 B;  3NVC A;  1I5Z A;  2CWS A;  5A3T A;  5DZE A;  5F2S A;  3MV0 1;  1WKY A;  1W04 A;  3GAL A;  3NNF A;  3ZSK A;  4BDV B;  3KSC A;  4OI0 A;  1PNG A;  3QAC A;  3FUO A;  3MI8 A;  4QM8 A;  2Z69 A;  4A42 A;  3KQR A;  3WX5 A;  3K75 B;  4ZON A;  1W2T A;  3VBO A;  1DHK B;  1TEI A;  1UN1 A;  3OPT A;  5A6Q A;  1ZBA 1;  5IJR A;  5KXE A;  3GHM A;  4E2G A;  2SLI A;  4XPV A;  5E6H A;  5JOZ A;  1RVF 3;  4D0Q A;  1LJ7 A;  2FQP A;  3CEW A;  5LA9 A;  2HWE 2;  3LA3 A;  3IMM A;  1MVQ A;  3WG4 A;  1RUJ 2;  1COV 2;  4I02 A;  5D21 A;  1OFS A;  1OBN A;  5KC5 A;  2QJV A;  3ZSL A;  4PBP A;  4NUB A;  2B7Y A;  1BVP 1;  4IV3 C;  1JYN A;  1HKD A;  2D6N A;  5A6Y A;  3Q8A A;  1ULG A;  4AL9 A;  1CES A;  3B9I A;  3KB5 A;  3O0X A;  4R9A A;  4W6X A;  3HQR A;  4YVW C;  5F3C A;  4XFC A;  2XDV A;  1C8M 1;  1R1A 3;  2I07 B;  4NIG A;  4R4X A;  1XJA A;  5LBC A;  1AR7 1;  1CAX B;  4N90 A;  1PK6 C;  3IDA A;  4XTM A;  1QH7 A;  1V6K A;  3OYW A;  1PM7 A;  3ZSM A;  3MW4 A;  4P08 A;  4WM8 B;  3T3Y A;  4YW6 A;  2ZTN A;  3J4U H;  4DFS A;  2R07 3;  2FZ2 A;  5T52 A;  4CUC A;  2CGP A;  1RUG 2;  3JQX A;  3M1H A;  4DEQ A;  1RUC 3;  3ZN6 B;  2AH2 A;  1ZRR A;  3VDB A;  5TSW A;  1N3Q A;  1YLL A;  5A7W A;  3WOG A;  3ZKU A;  3CJX A;  3J7L A;  1UAI A;  4QPI A;  1IKQ A;  3F95 A;  3SQO A;  1R64 A;  5G05 L;  3U37 A;  4LNV A;  3V65 A;  2HLE A;  5FZ0 A;  1G86 A;  5F3G A;  2R16 A;  4YM3 A;  3FN9 A;  4CUB A;  1MS0 A;  1Z0H A;  1Q5O A;  4TYS A;  1V70 A;  5BY5 A;  4YGD A;  4PDW A;  4L92 A;  3M3E A;  3B69 A;  5IK8 A;  2CU5 A;  4CP9 A;  2J1S A;  2PHR A;  2EXK A;  4WBB A;  3WQ7 A;  1XND A;  3LEI A;  3N7M A;  3E97 A;  5FV3 A;  1X8E A;  3ZIW A;  4ORF A;  4RS5 C;  1NQD A;  4TLG A;  4XF3 A;  4BQW A;  4RR3 A;  1GZT A;  4FFH A;  2WNV C;  4K1Y A;  3O14 A;  2DWR A;  3RMX A;  3VHO A;  4A7Z A;  2VGD A;  5A6Z A;  2QQU A;  3RJR A;  1WW6 A;  2K9Z A;  3NMB A;  4BXS V;  1AL2 1;  1GKB A;  2ET1 A;  1Q8O A;  2PLV 2;  3JUU A;  3O1O A;  5CKN A;  5A3M A;  2IXL A;  3EO6 A;  4LTA A;  5JIA A;  4RD7 A;  1WW7 A;  2ERF A;  5T5L A;  4V1P A;  5GJ6 A;  2O8Q A;  3VB9 A;  1R09 2;  3LWC A;  5FXX A;  5C8C B;  3WY6 A;  5BNO B;  4D6Q A;  2HWE 3;  1UIK A;  3LGR A;  4WZC A;  5IVY A;  2F6B A;  4LOS A;  4R8H A;  3HMY A;  2CSG A;  2VMF A;  1BVV A;  1CJD A;  1XYP A;  4MG2 A;  2HWC 2;  3AKT A;  1W6O B;  2VMH A;  2YBS A;  4FAG A;  1SLB A;  1H1A A;  2G9F A;  1KRI A;  1LGB A;  1W6M B;  1WD3 A;  2V5Y A;  1CAV B;  4G3Y C;  2PN5 A;  4HT1 T;  3NNM A;  1WCQ A;  5DAB A;  2JDZ A;  2GAL A;  4Y5S A;  4HVQ A;  1GZW B;  3ZVX A;  4C1X A;  3POG A;  3MGU A;  5LY2 A;  3C7E A;  1QOO A;  1UMI A;  3UNP A;  4AVS A;  2LUW A;  4CDX C;  1W8O A;  1V6J A;  2RS3 2;  3T4H B;  4A3Z A;  2CDO A;  1HJF A;  4CUA A;  4A4A A;  1B35 A;  4ONU A;  3LEK A;  4QKB A;  2FCV A;  4A45 A;  3WW3 A;  1KS5 A;  3O0V A;  3D8C A;  1AHS A;  4I3G A;  1R08 2;  4FTS A;  2VY0 A;  3H7Y A;  1FAY A;  4FTB A;  4X8P A;  4MV2 A;  2RE9 A;  3E5U A;  5FXV A;  2C6S A;  1UYZ A;  1VP6 A;  3KWV A;  2Q5T A;  2RVA A;  3VBR A;  3ON7 A;  1W2A X;  4YZ2 A;  3O1V A;  1VR3 A;  1W9S A;  3V56 A;  3PJY A;  1BZW A;  1SBD A;  1XNC A;  4M3C B;  4P14 A;  3RRD A;  5SV5 A;  3H50 A;  4PF1 A;  2XWB B;  3CU7 A;  3VKF C;  2JDH A;  2R1D A;  4S2H A;  3RI8 A;  1BKZ A;  2EIE A;  2XLA A;  4IEY A;  4NRO A;  4LHN A;  5HCB A;  5T3N A;  2X5I C;  3WUC A;  4CEY C;  1WMD A;  1VAK A;  2VZT A;  1X50 A;  2ZS6 B;  3MW2 A;  1PIV 3;  1T6G C;  3BU7 A;  4Z1V A;  1FV3 A;  3SMH A;  4GWI A;  5L36 A;  4AFM A;  2IWG B;  4Q4W 1;  2G9G A;  1RHI 2;  2TUN A;  3FJS A;  4ES8 A;  1YWK A;  3DXU A;  2XHK A;  3T0B A;  3NJX A;  4PHZ A;  1EPZ A;  3TEZ A;  3IB3 A;  3UJQ A;  1T2X A;  4TLF A;  5FMB A;  4FPY A;  1H6Y A;  4QQP A;  4YW7 A;  5BNP A;  4WM8 A;  1TNF A;  1GP4 A;  5FZE A;  2JDK A;  4LBM A;  3VBR B;  1D2S A;  1OUX A;  2VMI A;  3PVO A;  4LLF A;  4NHM A;  3BTA A;  2NPI A;  1NE4 A;  3WDW A;  2AEZ A;  3AJY A;  1YEW A;  2YU2 A;  2RS5 2;  2I2S A;  4RQP C;  4CZS A;  3JB8 A;  4P9Y A;  1HXS 1;  1LB2 A;  3RG0 A;  1O6U A;  2HWB 1;  4HAN A;  2WZR 2;  3ECQ A;  2A6Z A;  1PX4 A;  2CL2 A;  4Y5Z 0;  3M3C A;  4FPJ A;  2WO3 A;  4SBV A;  5FO7 B;  2XBO 1;  2EXI A;  1ULO A;  1KDK A;  1ZZ9 A;  4Y1X A;  3GXU A;  1WCK A;  3WW1 A;  1BEV 1;  5FPL A;  2R6Q A;  3KCY A;  1CD3 G;  5FZH A;  2FDG A;  5D8A C;  3QH7 A;  5J3U A;  4KBB A;  4AQT A;  1NZC A;  4MO3 M;  1JYW A;  2JE7 A;  4N43 A;  3O1T A;  1FAT A;  1J83 A;  3ZYR A;  4HZF A;  1OQ1 A;  4UFL A;  1Q8V A;  5JOX A;  3USU A;  1W6M A;  4QHB A;  1CON A;  2HEW F;  1W0N A;  3UKN A;  1AYN 3;  3WXP A;  1RC6 A;  1VB4 A;  3U10 A;  1FMD 3;  2QQP A;  3U0Z A;  2YBK A;  3VBO B;  5A3U A;  1NA1 C;  1REF A;  3BGA A;  1XNB A;  4X6Q B;  1H2M A;  1VMF A;  2GU9 A;  2VVE A;  3CO2 A;  2HWD 2;  3D82 A;  3WDV A;  1MEC 2;  4FP3 A;  5EIY B;  4E2S A;  3WV6 A;  4EWA A;  2MEV 3;  1QJY 3;  5HCF A;  1O4Z A;  1OLM A;  5LAS A;  2HWF 1;  5IVE A;  1K5M A;  3HQU A;  3MLJ A;  3GDB A;  4D7Y A;  2R1B A;  4H7M A;  5EJZ B;  1DGR N;  5I91 A;  1N1T A;  1HN0 A;  2MPF A;  2R07 2;  5JSR A;  1IPS A;  1PHM A;  1UU5 A;  1FPN 2;  3KCX A;  2GNB A;  4Y22 B;  2OW4 A;  5FZ3 A;  2Y33 A;  4SLI A;  1ACC A;  1NCQ A;  3ZXA C;  2ZX1 A;  2JEN A;  3O5S A;  3T09 A;  3WSO A;  5I93 A;  2EIG A;  4JKM A;  4Q4Y 3;  2YFZ A;  1V9U 3;  1VBA 1;  3N35 A;  1ZA4 A;  4CA9 A;  4MLO A;  2D40 A;  5EYY A;  1ZBE 1;  2H0V A;  3FX3 A;  3POE A;  4LBO A;  4MAD A;  3J7H A;  2BYV E;  4L8Q A;  4RN5 A;  5BNN A;  2TNF A;  4KU8 A;  2WR9 A;  1ALY A;  4QU1 A;  4AFA A;  1LES A;  1NX9 A;  3IN9 A;  1D4M 1;  1V6I A;  3UGH A;  3L2H A;  4QX7 A;  4JRA A;  1ZRI A;  2ZGL A;  3LPG A;  3NNJ A;  4JDN A;  2VL4 A;  4YFW A;  3V64 A;  2Q8D A;  4FPH A;  3PDQ A;  3ZR5 A;  3MIH A;  2VZ1 A;  4HFS A;  3I3B A;  3ZSE A;  4FQZ A;  1BBT 3;  1F8V A;  5FXZ A;  1VIW B;  3TEY A;  3WP5 A;  1IGO A;  4Y5T A;  3AVR A;  2IVJ A;  2VNV A;  3I3Q A;  1UY0 A;  4HKO A;  1AR6 2;  1RHI 1;  2W92 A;  3HNY M;  2BBV A;  3HEI A;  2OQ6 A;  4AGG A;  2CDP A;  1J84 A;  3CZJ A;  5JMO A;  2QUO A;  4IES A;  5FZC A;  1PO2 3;  2PLV 1;  4Q29 A;  3USU B;  3GGL A;  3RYK A;  2BVB A;  4QX5 A;  1K45 A;  1RIT A;  5CFD C;  4DPN A;  3MFC A;  1LGN A;  2FD8 A;  3WHT A;  3FBY A;  2VQU A;  2JG9 C;  4XUP A;  1H1M A;  5FZ8 A;  5LB6 A;  3CKH A;  1PZ7 A;  4QB1 A;  4WVM B;  5AFE A;  3RZK A;  1JHJ A;  3GHN A;  4AEM A;  4QXC A;  4CXX A;  1R1Z A;  1RUD 3;  3AYA A;  4XZU G;  1LOB A;  3AYE A;  1FOD 1;  2O14 A;  4XTP A;  5KXD A;  1IS4 A;  1HB2 A;  5JMC A;  4BHP A;  1SPP B;  1S0E A;  2XUM A;  3FLR A;  5DZG A;  4FPC A;  2X05 A;  4XJA A;  4BQ1 A;  5JXH A;  4HSL A;  2GN3 A;  3MUZ 1;  4XMI A;  1OQE A;  2UUR A;  1MQT B;  2AAC A;  3D4K A;  5K0U C;  3GJB A;  5A80 A;  5IK5 A;  2DUR A;  1RUJ 3;  4DXS A;  2VTF A;  1RMU 3;  3MO4 A;  4XAA A;  2JDY A;  4UFH A;  4DOU A;  2BWC A;  1LGC A;  2VUL A;  2LW8 A;  1EYB A;  1WA4 A;  5A1F A;  4AYU A;  5BNP B;  3ZXL A;  4AED C;  1OLM E;  4XEZ A;  5FZB A;  4CDU A;  3R05 A;  3VN4 A;  4AE2 A;  2ES3 A;  4GZ9 A;  3FFZ A;  2BGO A;  2OUJ A;  5F39 A;  4CDU B;  1LKN A;  1WMX A;  4LBQ D;  3LSD A;  2FBE A;  4LIT A;  1DQ6 A;  5CZK A;  4X8N A;  3IMN A;  3WG2 A;  4HON A;  1JOP A;  2BNN A;  4IEV A;  4DEV A;  5CAD A;  4Q0S A;  4Q4Y 2;  3ACF A;  4JTO A;  2J1A A;  1WBL A;  3FBM A;  5FO8 B;  5IFP A;  1UD1 A;  1XU2 A;  2A6W A;  3QD6 A;  3BKZ A;  1RUE 2;  1LU1 A;  4L99 A;  4AFC A;  5L9V A;  3ZX7 A;  3AZX A;  1UZZ A;  2R0H A;  5DAX A;  3RQ0 A;  1JUI A;  4CEW B;  1YQ8 A;  3LB9 A;  2NN8 A;  4URT A;  4U36 A;  4NWV A;  5A7W B;  1UIJ A;  1C4R A;  4ISQ A;  1RUC 2;  5A1L A;  3I97 A;  2DVG A;  2CTV A;  3Q8C A;  1TMF 3;  4IDZ A;  1JOJ A;  2JXA A;  2YPJ A;  4Y1Z A;  2WWU A;  1RUN A;  3CBN A;  1QJY 2;  3H8U A;  4E9K A;  1U5I A;  2E31 A;  2XKO A;  2QNK A;  2YC0 A;  4G9S B;  3RZZ A;  2XH6 A;  5CFD B;  3U11 A;  4AGR A;  2EXH A;  3WF4 A;  1CVN A;  4AAP A;  4CDU C;  4JAA A;  2BPA 2;  1YJK A;  2Q0A A;  2XKP A;  1S0G A;  2ZA9 A;  4QGL A;  1DZR A;  3LPF A;  5I0U A;  1HV1 A;  5GZD A;  4QWN A;  2AGS A;  2JDU A;  1ULE A;  4LLO A;  4LOR A;  3VBS B;  4CUG A;  3CHX A;  1B35 B;  4UBG A;  2GH2 A;  2PMW B;  2WWS A;  5FKB A;  2VCA A;  4HN0 A;  5C4W C;  1AR9 1;  1QHD A;  3PU3 A;  5FZD A;  4MGS A;  4FXG B;  5ACA 1;  4BMB A;  5L7O C;  4IUG A;  1XNT A;  5J98 B;  2BDR A;  1N3P A;  1HQL A;  1YCI A;  2O8O A;  2VQT A;  2XWJ B;  4HKW A;  5FZI A;  5JR7 B;  5KHG A;  4ZS3 A;  5A32 B;  4K8R B;  4FTE A;  3K2O A;  5C6C A;  4BH9 A;  1W6O A;  4ASM B;  3AMH A;  1G7Y A;  4M01 A;  3ROU A;  3R4S A;  3GM8 A;  3UKT A;  5FR3 A;  1S0F A;  4CP0 A;  2RS1 3;  1YQ5 A;  3DYP A;  2AEY A;  1D7P M;  1ENQ A;  2ZKL A;  3R4U A;  1CQ9 A;  4XIO A;  2ZBJ A;  1RUG 1;  3M2M A;  2GMP A;  2C0Z A;  3Q8E A;  1BBT 2;  1MZ5 A;  4Y24 A;  4Q8K A;  2P3J A;  4URA A;  2Q1Z B;  3AM2 A;  3MBW A;  1C5I A;  3D6E A;  1LR5 A;  3NJY A;  3ACH A;  4YW5 A;  1M4W A;  4YZ1 A;  2YUE A;  3RDI A;  3RJ2 X;  3VZM A;  1LHO A;  4LPL A;  3ZXE A;  1LEN A;  1W9W A;  3A22 A;  5GZC A;  4GMP 3;  2PQS A;  2SBA A;  2A73 B;  4MGY E;  3ZFF A;  3I2F A;  3K3N A;  5A7Q A;  3WQB A;  4XJ9 A;  2XBO 2;  2E7Q A;  2DBI A;  1X9T A;  4HK9 A;  2WFP A;  4AEJ A;  4CCN A;  3K4A A;  5BPX A;  5DN2 A;  4RR3 B;  4ITC A;  4M4R A;  3PUI A;  2VZO A;  1RJ8 A;  4QHO A;  1O4T A;  4K21 A;  4ATE A;  1HDK A;  3HBK A;  4EE2 A;  3CF6 E;  1APN A;  4CXW A;  3INA A;  3FHQ A;  2R04 1;  4XE9 A;  1Y43 B;  3T0D A;  1AR6 1;  3ITQ A;  4HKL A;  1NE6 A;  3UK9 A;  5FYI A;  2A6V A;  3TYJ A;  1WME A;  2DU1 A;  3ZXJ A;  4QPI B;  3ABZ A;  4LQR A;  4AR2 A;  1N3O A;  1PVC 3;  2OS2 A;  5K0U A;  4YZ5 A;  1J3P A;  1GWK A;  1LHV A;  5F6L B;  4CDX A;  5M0T A;  3DN7 A;  2WRA A;  1AR8 1;  1RUE 1;  3AXD A;  4I0W B;  4FFG A;  4ET7 A;  3APB A;  3ILF A;  2Q4S A;  3U78 A;  2XON A;  3OD0 A;  3MV1 1;  4H3W A;  4XJ8 A;  3ZPO A;  1MS4 A;  4EQV A;  2WII B;  2CWM A;  3SIT A;  2VBP A;  2CGO A;  2ZEY A;  4UBH A;  1EY2 A;  2ADD A;  2VNR A;  3WCR A;  4FFI A;  4JCK A;  1RVF 1;  4QXK A;  5JXI A;  5J09 A;  2Y60 A;  3ZYI B;  4YFZ A;  2D6P A;  3KGZ A;  4HMZ A;  3WW4 A;  1VBA 2;  5FP4 A;  3AZY A;  1JS9 A;  5DG1 A;  3UGG A;  2TBV A;  1PVC 2;  2XML A;  4XF4 A;  3RYR A;  2GP5 A;  2YPD A;  3LDK A;  1LCL A;  1H8T C;  5FZA A;  2P3Y A;  2J1E A;  4I2O A;  1Y9Q A;  3N9N A;  4XUR A;  4YRD A;  3QLQ A;  4PQ9 A;  5IVB A;  4FI9 A;  3AFG A;  1Y4W A;  2Q8C A;  5DPN A;  1I1E A;  5IK4 A;  1KEX A;  2XGX A;  3DEM A;  4WVZ A;  2BNO A;  3M3Q A;  2W39 A;  4XIK A;  5JI7 A;  3ACG A;  2WC2 A;  1ZRD A;  3ZR6 A;  3IM0 A;  5GZE A;  4JGZ A;  3PLQ A;  3DEC A;  3J8F 2;  4Y4Y A;  1W6P B;  5CEH A;  1RIR A;  1G9D A;  1W05 A;  2GH8 A;  5J7M A;  4W6Y A;  4XHB A;  4Q4W 3;  3WP3 A;  2WNV A;  3BYW A;  1G8W A;  1XQN A;  3THD A;  2WO7 A;  2P5B A;  2LRO A;  5FZ1 A;  5IT6 A;  5AVP A;  2XJQ A;  1V6L A;  4YLZ A;  4ZXE A;  4CCJ A;  1OQD A;  5EPA A;  1P8J A;  1VBE 2;  2VZS A;  4OUS A;  1HV0 A;  1TE1 B;  2HYK A;  2W68 A;  2D43 A;  4COU A;  3WLU A;  1VRH 3;  1H30 A;  2A5Z A;  5FPV A;  4AF9 A;  2Y0O A;  3KCC A;  1V00 A;  2RR1 3;  2Y26 A;  4XFH A;  2EF6 A;  5F5C A;  2BER A;  2KXL A;  4UW3 A;  3DYO A;  3AMM A;  4D3W A;  3ACI A;  1QJX 3;  3H3L A;  4NOT A;  2BV4 A;  1LOA A;  2Y0I A;  4L11 A;  4QB2 A;  1PGW 2;  3TBD A;  1PNF A;  2WFF 2;  1ND2 C;  3VBU B;  4QX0 A;  2PYT A;  5HPO A;  5K4L A;  4M0H A;  1F5J A;  5C9A B;  3S0M A;  2DVD A;  5C8C C;  4RA0 A;  3P3N A;  1CWP A;  3LDB A;  1CZT A;  1SG3 A;  3VDD A;  5FCC A;  3VDD B;  4WV8 A;  3O1M A;  3ATG A;  4WM7 C;  2JIG A;  4JGY C;  4KWU A;  2A3W A;  4XFA A;  1FPN 3;  1UWW A;  3AMQ A;  2GC2 A;  3ASI A;  5FYM A;  2AEN A;  1UMZ A;  4L9B A;  3CNA A;  3PUS A;  3DPR B;  4TSV A;  4XUO A;  5DUX A;  1YFW A;  2V09 A;  4GAZ A;  5F6K A;  5FY5 A;  3ZXD A;  1W28 A;  1OF4 A;  2VW2 A;  4NAM A;  5KC6 A;  2R04 2;  3J9S A;  3I2I A;  2P34 A;  1TME 2;  1FMD 1;  3BPZ A;  4EN9 B;  5JUV A;  3B94 A;  4UYB A;  5A70 A;  4FXK B;  3K3O A;  3HD8 B;  4B7E A;  4CP1 A;  4LKD A;  3EXU A;  5LAT A;  4BWO A;  3POY A;  4NHY A;  3T1M A;  3M3I A;  1ZBE 2;  4LKF A;  2DCJ A;  2VG9 A;  3LCP A;  3PHM A;  5DAQ A;  2D6L X;  1XBF A;  5EQU A;  3OCP A;  3LIH A;  2ZGT A;  4UFJ A;  1UYX A;  2RS5 3;  1PO1 2;  1X7N A;  5FWE A;  4F7Z A;  1PMH X;  1VAL A;  2VUJ A;  2VBB A;  4HOO A;  5CBL A;  5FYY A;  3BAL A;  1NY7 2;  4P9W A;  3G6J B;  1AJO A;  4EN6 B;  5KR7 A;  4OHX A;  1AR9 2;  1DYP A;  4LBK A;  5BNQ A;  4Q4Y 1;  1V9U 1;  4QKN A;  3E6D A;  5AFB A;  3EMR A;  2CGN A;  3WIN E;  4K3U A;  4LO4 B;  5H9P A;  4Q27 A;  3AX4 A;  1SEF A;  1EAH 3;  4C90 A;  1WW4 A;  2A7A A;  1DGR A;  2JIJ A;  1RUI 2;  2PHL A;  3PL0 A;  3OUH A;  4CCO A;  1DCS A;  3C2U A;  1CX4 A;  3P5B A;  1L7L A;  3OBT A;  3H42 B;  2XJS A;  4DUV A;  3I2D A;  3OGR A;  2ZAA A;  4EN0 A;  2PTM A;  3T2O A;  4JC1 A;  3TRS B;  4UF0 A;  4EZ4 A;  1SCS A;  4COZ A;  3KGL A;  1QQP 3;  2J22 A;  5JI9 A;  4AWD A;  4A7K A;  1AYN 1;  2W1W A;  2PHT A;  2ZML A;  3KT1 A;  1HRV 2;  2JEM A;  1QJX 2;  2YBP A;  2GP3 A;  1W39 A;  1AR8 2;  1FOD 2;  3U1X A;  3RNS A;  1REE A;  2ZHM A;  4MOA A;  1RHI 3;  2OXB A;  4QB6 A;  4YM0 A;  5FKC A;  3UT0 A;  5JR2 A;  1RED A;  1MS9 A;  3W58 A;  2YYO A;  5CKQ A;  5F5A A;  2WAA A;  2XJU A;  4LO7 A;  1GQH A;  2OT7 A;  2DV9 A;  2Q8E A;  1GQG A;  3A7Q A;  2AYH A;  5FXW A;  2VM9 A;  1JUH A;  3AYC A;  1LNS A;  3LFI A;  4QQH A;  1W99 A;  1TVG A;  2JJ6 A;  4R9C A;  2XOM A;  2FDK A;  5C4W B;  1ZBA 2;  1ZZ6 A;  4IL7 A;  4LHS A;  2Y6K A;  1UXX X;  2NMN A;  3W5M A;  2Y6J A;  1RUH 3;  1YFX A;  1B35 C;  3CJI A;  5IVV A;  3O1P A;  1WD4 A;  2KD7 A;  3EBR A;  3M4F A;  1SFY A;  4I3P A;  1VBA 3;  4NAO A;  1BMV 1;  2XUE A;  1EUT A;  4LO8 A;  4DXT A;  4CCL A;  1PGW 1;  1VE0 A;  3V0B A;  4CDQ C;  1W8W A;  2UY9 A;  4ASK A;  4GUL A;  4BQY A;  3NKT A;  3AMP A;  1HRI 2;  1HW5 A;  4N9H A;  3SH3 A;  1YC6 1;  2QTW B;  4FPL A;  2VD7 A;  3VZJ A;  1H6X A;  3LSE A;  3HVD A;  3MLL A;  4AG4 A;  4E27 A;  1R09 3;  1ST8 A;  4OZO A;  2YRO A;  4RQP A;  5FYH A;  1SBF A;  4W8J A;  3DL3 A;  4BU2 A;  4ZU5 A;  1N1Y A;  1W2U A;  4JKK A;  2E53 A;  4QT6 A;  3VBS C;  2PHW A;  5FJH A;  4CPB A;  3MIB A;  1BBT 1;  2WA4 A;  3WVJ A;  1OI6 A;  4GH4 A;  4CDW B;  1CN1 A;  2BNM A;  4RSU A;  2WQZ C;  1W90 A;  1ZRF A;  2DUO A;  1ENS A;  4UW4 A;  3PTR B;  2D3S A;  1NOV A;  1W2O A;  3ILN A;  2LM3 A;  5DAW A;  3AKQ A;  2BGC A;  4P9G A;  2PLV 3;  4D6R A;  2D5F A;  3SH4 A;  3NJZ A;  1EV1 1;  2VZP A;  1WBF A;  2OZJ A;  5EXO A;  4CDQ B;  5EJ1 B;  3VZN A;  1FT9 A;  1JBC A;  3K51 A;  3SH5 A;  3HBZ A;  3PTY A;  4RR3 C;  3GZE A;  1OFN A;  4O9G A;  3VZK A;  2QCS B;  1PGS A;  1MVE A;  3MUY 1;  4K9S A;  1R08 3;  1ONA A;  4RS5 A;  5BUV A;  4HVR A;  5JXG A;  4QDQ A;  2UWA A;  1K5M B;  4V2V A;  1GUI A;  3WQ0 A;  4A6O A;  5FY1 A;  2LS6 A;  4KNC A;  1SDD B;  1J1L A;  1YO8 A;  3POW A;  2GME A;  1DF0 A;  3VKM A;  1PO1 3;  1RUJ 1;  4BZ4 A;  4QMA A;  2VCM A;  1NAE A;  1UY2 A;  2DCZ A;  2W2I A;  3DKQ A;  3SCG A;  3VBH B;  2Y64 A;  3ZFG A;  3GCW A;  3OBZ A;  4JGZ C;  4Q0P A;  3L9J T;  1JZ6 A;  4XFF A;  4XZP A;  4XFB A;  2Q8O A;  3ZYP A;  3LOB A;  4DO0 A;  3GBW A;  3KV5 A;  5FJK A;  2B9U A;  1T6B X;  1PK6 A;  1GOH A;  1D4M 3;  3LQC A;  4YM2 A;  1SCR A;  1PX3 A;  1H8T A;  2GC0 A;  2C5D A;  4WVW A;  3TEW A;  4FOW A;  5ERL A;  4LOT A;  3KVB A;  3FE5 A;  3I2O A;  4ATF A;  3MF6 A;  1A8M A;  1UZV A;  3III A;  4IE7 A;  2GMM A;  2QVS B;  1ND3 B;  3LD8 A;  5IW0 A;  1E5I A;  4NJ4 A;  4DIQ A;  4LHK A;  4CEY A;  3AFK A;  1QKQ A;  4DIN B;  5BV6 A;  3VD9 A;  5I0D A;  3BUC A;  1GNY A;  1GIC A;  3NQH A;  1UMH A;  1U5Z A;  3DUI A;  4QX2 A;  4NO4 A;  4QXB A;  3BOD A;  2ZEW A;  4GB3 3;  2PXJ A;  2IVI B;  3T0A A;  4RHV 3;  1W6P A;  5KXB A;  2WSU A;  2CAV A;  2RG4 A;  3D3A A;  5LRR A;  4IQP A;  5FZ7 A;  2A1X A;  3Q8B A;  4IEO A;  5LEJ A;  1CAW B;  3AL5 A;  1UNB A;  3QCW A;  2ZGO A;  2A3Y A;  3KT4 A;  4CP9 B;  3JZV A;  2WNU B;  4WM7 A;  5L9R A;  1A6C A;  3WQ1 A;  4PLM A;  4CP2 A;  4I0A A;  4OFG A;  1OLQ A;  2BW8 A;  5LBF A;  5CIS A;  5F1R A;  3ZO0 B;  5LY1 A;  4AED A;  4DNY A;  4OI2 A;  3B5L B;  3FMG A;  3BVC A;  4XDO A;  1C8M 2;  4FPK A;  3WNL A;  5FUI A;  3RI9 A;  4YW4 A;  2XJV A;  1ZRE A;  4YGB A;  1AR7 2;  4IEZ A;  5GLV A;  1SHW B;  1UXZ A;  4AZZ A;  2FDF A;  4XHX A;  1O8P A;  1TG7 A;  1UKG A;  4LA2 A;  4XVH A;  3N7J A;  1HXS 2;  2Z5W A;  1JHN A;  4FVV A;  5FPX A;  5BYN A;  3ZFE B;  2VZ3 A;  4MXV A;  5GZG A;  4FSJ A;  3HQX A;  2VAU A;  4P02 B;  3KMH A;  1F35 A;  1NQJ A;  1PVC 1;  3I2G A;  1LHW A;  2Z4F A;  3JBG 3;  3N36 A;  1HB1 A;  2HWE 1;  1S0B A;  3S5A A;  3MIF A;  3WP4 A;  1AVB A;  3O12 A;  4Y20 B;  1GOG A;  1UY3 A;  5JDB A;  3OTF A;  1ULD A;  5BNP C;  1DLC A;  2FCT A;  5FPZ A;  1VBD 1;  3ZMN A;  5CFC C;  1C28 A;  2DDU A;  1GZC A;  2J1R A;  4TZD A;  4CCK A;  3C7O A;  1JMU B;  4QGM A;  2UYB A;  2XL9 A;  4IE4 A;  1Q3E A;  2W1Q A;  4CEW C;  4Y1Y A;  2F4P A;  2R06 1;  4A3X A;  4LK7 A;  5AC9 3;  1HN1 A;  4XJU A;  2WDB A;  2ZAC A;  5FYZ A;  1ZZ7 A;  4GXL A;  4OUL A;  3MIC A;  2ZHL A;  2DVA A;  3IDB B;  4MGQ A;  1RIN A;  4TWT A;  5FP7 A;  3NV3 A;  3VBH A;  2ZZJ A;  1J58 A;  1IG3 A;  1SZB A;  5FZG A;  5JSO A;  2XQX A;  5SV8 A;  5C9A A;  5GAL A;  2K0G A;  4Y26 A;  2VOT A;  1A3K A;  1PVX A;  3TNP B;  2OPW A;  4CU6 A;  2KA3 A;  1ZM1 A;  4FOV A;  3M70 A;  3O0W A;  2GC3 A;  4B8E A;  4JGY B;  3H1M A;  1LOD A;  4ZPI A;  2C26 A;  3HN1 A;  4YVW B;  3ZSJ A;  3M8L A;  4XUN A;  5C3O A;  2ARX A;  3G7D A;  3KV6 A;  1WCU A;  3ETP A;  1UX7 A;  4H7L A;  4IEW A;  4UFI A;  5B4X A;  4Z2A A;  4C91 A;  4QX3 A;  2PAK A;  3VHN A;  1K42 A;  4AI0 A;  3NV1 A;  1RUF 3;  1FXZ A;  1UPI A;  4IET A;  3SCF A;  3N9M A;  1AXZ A;  2TEP A;  2XB6 C;  2XJP A;  3C7H A;  3I2H A;  2PHD A;  4QAW A;  3HOB A;  1JI6 A;  4UW5 A;  3HPN A;  1AX1 A;  1V9U 2;  3WNP A;  4P9X A;  3WF2 A;  4HVO A;  1SDW A;  1H2K A;  1S0C A;  2N7G A;  2W87 A;  4Y4R A;  3V0B B;  1ASJ 2;  3MF9 A;  1JYT A;  2ZZQ A;  1MEC 1;  2RS1 1;  5HCA A;  2FHR A;  3ZYF A;  3VD3 A;  3H8O A;  2FCU A;  4KWJ A;  2OQ7 A;  2DUP A;  1U5X A;  2BVV A;  3C3V A;  4RFT 0;  3CMG A;  4I01 A;  5C33 A;  2WNE A;  3UGF A;  5FDB A;  5A7P A;  1BJQ A;  3THC A;  4RQP B;  3H9A A;  1BXH A;  3DCQ A;  3IPV B;  1X82 A;  1O4Y A;  1GAN A;  2WL1 A;  3RS6 A;  3TEX A;  5A33 B;  1JZ5 A;  2PHF A;  2WUH A;  3A4U A;  4QXH A;  3N7K A;  4BQ2 A;  4YW2 A;  3VBS A;  4NPM A;  1S1A A;  2DFC A;  5DZF A;  3I2K A;  2J1V A;  4XQ4 A;  2ZGR A;  1UU6 A;  4BA6 A;  5A3O A;  1QQP 2;  2D3P A;  4HPK B;  1VBC 1;  3NWK A;  2ZX0 A;  4OCT A;  5C8W A;  5L7O B;  2HKX A;  2Q1F A;  1UZW A;  2BZD A;  5IVJ A;  2YZ4 A;  4IW3 A;  4Q26 A;  2VOK A;  2WYS A;  4OQ9 A;  3LEG A;  2NMO A;  2VTX J;  4A2U A;  2WZP P;  4NID A;  1UY1 A;  3E5Q A;  3S6P A;  1CGP A;  1OOP A;  2CYF A;  4Q4X 3;  2OII A;  1KJR A;  3OJB A;  2BP6 A;  4QPY A;  1DZT A;  1LUL A;  1BHG A;  2XJT A;  3PME A;  2ZX4 A;  2E63 A;  2VC9 A;  4DS0 A;  1DFQ A;  1H2N A;  3MIG A;  1H8V A;  2AC1 A;  1W8N A;  3I8T A;  4YWA A;  5D1I A;  2RS5 1;  1FNY A;  4LUK A;  3VKN A;  5A3P A;  5HI0 A;  2E7A A;  2RR1 1;  2B4K A;  2D6K A;  1W0O A;  1UZY A;  1QWR A;  4MGK E;  4PIZ A;  3S7I A;  1POQ A;  1DQ2 A;  4AVV A;  1AR8 3;  4FAH A;  1JYI A;  2CAU A;  2H0B A;  4AEK A;  1AYN 2;  3N9P A;  5C7G A;  2HBU A;  1J3Q A;  1HRV 1;  2WJS A;  4CDW C;  4C8D A;  5FY9 A;  5T50 A;  1KFU L;  1UOJ A;  4RGG A;  5F37 A;  5DAV A;  1OT5 A;  2OA2 A;  5F3I A;  2VR4 A;  3RVH A;  3WD5 A;  5FP8 A;  3WDT A;  1LOF C;  1XC6 A;  2WIN B;  4AI9 A;  4CU8 A;  3AL6 A;  1A8D A;  3UV9 A;  1XU1 A;  1FPN 1;  1I9R A;  4AHW A;  5K9Y A;  1I6X A;  3GZA A;  3O7O A;  4COW A;  2GNM A;  2JE9 A;  5T5O A;  2ZHK A;  4E8C A;  1OKQ A;  1OHF A;  4JVA A;  2VXR A;  1NKG A;  1YI7 A;  1W8U A;  3SIS A;  1H8T B;  2VO5 A;  1IPK A;  3QBQ A;  4CXY A;  2HBT A;  3GNE A;  3N4M A;  4W50 A;  3SNM A;  1S2B A;  3TB0 A;  4EZH A;  5JZG B;  4WVM A;  3I59 A;  2RM2 2;  3KV4 A;  1F4A A;  5JAX A;  1BMV 2;  3BN6 A;  5H9R A;  5IWF A;  4EWE A;  4CU9 A;  4OLL A;  4QPG B;  3RWN A;  5H9Q A;  2D93 A;  5GLT A;  4AK3 A;  3VUO A;  4ZU4 A;  4KBZ A;  3ZFG B;  1GYK A;  2ZX3 A;  3QH6 A;  2WAB A;  1GLH A;  4JDO A;  4Y1U A;  4U2A A;  3CQO A;  5JPN B;  1L7Q A;  1Q8S A;  1JZ2 A;  4ZY9 A;  5LBE A;  4D94 A;  1NLR A;  1NXM A;  4CCE A;  5C9A C;  1IG0 A;  4AHZ A;  1OC1 A;  3VBH C;  2GN7 A;  3OGV A;  5EFU A;  4NPR A;  2XL7 A;  2ZX2 A;  1YQC A;  2DUQ A;  1RUH 2;  2LRP A;  2EXJ A;  5LK5 A;  2QQV A;  4K8F A;  4YVS B;  3DPR A;  2RDS A;  2W94 A;  4EYU A;  3MW3 A;  5FP9 A;  1GZW A;  1HRI 3;  2JEC A;  1BCX A;  4NHK A;  3ZYH A;  4Z8B A;  5FZ6 A;  2UWC A;  3R4D B;  1DIW A;  4QX8 A;  5B2G B;  4MGI E;  1IPJ A;  1D0G A;  1UYP A;  1ZZ8 A;  3WNX A;  2Y6F A;  5FY8 A;  3WF0 A;  3ES1 A;  2ZAH A;  1UOG A;  4DB5 A;  2ZXQ A;  1FV2 A;  3K4D A;  3WNK A;  3BU0 A;  3LA2 A;  4ZZ5 A;  1QQP 1;  1FOD 3;  4DUW A;  1J59 A;  4FT8 A;  2BFU S;  4O61 A;  1VBC 2;  5I8Y A;  2ZCW A;  4ZHN A;  1ND3 C;  4DZG A;  5IVF A;  2GDF A;  2ZEZ A;  3OF1 A;  1NCQ B;  3GBF A;  1W9Y A;  4YGC A;  3ZKY A;  1GSL A;  2WKK A;  5F5Q A;  4BQ4 A;  3V0A A;  1BQP A;  2B42 B;  5LWB A;  1BYH A;  5D8A B;  3D0S A;  5CAZ A;  4IV1 A;  2RDN A;  4BE3 A;  2XXZ A;  5I8S A;  2YY1 A;  4L97 A;  1PZ8 A;  4XBQ A;  1JOB A;  5FOB B;  4COV A;  3MDP A;  2O0O A;  1ASJ 1;  4JKL A;  5F2W A;  3VZO A;  1EP0 A;  3QOP A;  1KQR A;  1URX A;  2RDQ A;  3MEP A;  4KG8 A;  1VBD 2;  2WNU C;  2YGL A;  3DPR C;  2QQI A;  2VUA A;  2XR4 A;  1ENX A;  2YFU A;  4MHU A;  2QQL A;  3OB8 A;  4XDP A;  5FUP A;  2P6H A;  1S4C A;  3BOP A;  3ZN6 A;  2X09 A;  4IGO A;  3WG1 A;  2VCB A;  4GWN A;  2W0X A;  4YW1 A;  4PT6 A;  5IK7 A;  3B01 A;  2JE8 A;  2RMU 2;  4RL7 A;  1QIQ A;  3ORJ A;  3A21 A;  3AYD A;  3M3O A;  3KLS A;  4IE0 A;  1QJU 3;  3RFR A;  3TWI A;  4BCU A;  1IQA A;  5FBJ A;  2V4V A;  4BIF A;  1Z78 A;  3LKJ A;  4OUE A;  1XE0 A;  2VEC A;  1LEC A;  1RUI 3;  5AC9 2;  1D0H A;  4ISR A;  4NR1 A;  4H14 A;  2PA7 A;  1Q8Q A;  5J36 A;  2VBD A;  2XG3 A;  2ILM A;  3DGT A;  3GZT B;  3IT8 A;  1UQX A;  5C5T A;  3P1I A;  1UW8 A;  2YXS A;  3VHR A;  1LTE A;  2OPK A;  5T5J A;  4BLJ A;  2HEY F;  4GIQ A;  5IAX A;  2JIC A;  2G1M A;  5T5P A;  2B39 A;  2QQJ A;  2W46 A;  4LE4 A;  4NIH A;  4W6W A;  3TAY A;  1F4H A;  1OKO A;  3BOW A;  2WN2 A;  1GWM A;  5FZ9 A;  3HN3 A;  4D7S A;  5FO9 B;  5IFT A;  1GOF A;  4IV3 A;  4P9I A;  3AJZ A;  3F2Z A;  4J6G A;  3J7M A;  4Q4X 2;  4QQO A;  4NRQ A;  2VW0 A;  3W9A A;  2OKX A;  1LAJ A;  1CZS A;  1G6N A;  1NT0 A;  2OZ6 A;  4JTN A;  3WCS A;  5E89 A;  5K7P A;  1ODN A;  4UF0 B;  5T54 A;  5LA2 A;  1X33 A;  1O5L A;  2R06 2;  2GSY A;  2VTX A;  3TN9 3;  5DXD A;  4LT5 A;  1QH6 A;  5FLH A;  5FLJ A;  2BWA A;  1XSQ A;  5CVR A;  2MEV 2;  2WT1 A;  3M7A A;  1QMJ A;  1IS5 A;  1O5U A;  4OHY A;  3B93 A;  1Q56 A;  5E1R A;  2H6B A;  3HWJ A;  4FO9 A;  5CFC B;  1QF3 A;  5JZG C;  5J37 A;  3CZU A;  4LUL A;  3MIE A;  2QBX A;  3EJK A;  1RB8 G;  4K1Z A;  1LRH A;  3VHP A;  4OHV A;  4UAP A;  4KU7 A;  1RUH 1;  5JVV A;  1MS5 A;  3JD7 1;  4E8D A;  4ARY A;  1POV 1;  3NAP A;  1JN2 P;  3USS A;  2QQK A;  3BTX A;  3ZFF C;  4RFR B;  2E6V A;  2KM2 A;  5JIU A;  2K2S A;  1VBB 3;  5GLZ A;  2RS1 2;  3ACL A;  5FIX A;  3TOJ A;  4BXF A;  3OPW A;  1UZ0 A;  2A6Y A;  4A44 A;  4GMP 1;  4GH4 B;  4QKF A;  3WHU A;  5A32 A;  4YM1 A;  4BOW A;  3LA7 A;  4NHL A;  3GZU C;  2G4I A;  1VRB A;  1VMJ A;  1S2K A;  3AKP A;  3FFQ A;  2L9L A;  4YVS C;  4YVS A;  4P9L A;  4BQX A;  4GWM A;  5FY7 A;  1G9C A;  3MZH A;  5C70 A;  4JV4 A;  3SC7 X;  4C1W A;  4XAB A;  1COV 3;  3IZO A;  3I3M A;  3JBG 1;  4MHR A;  3ZYJ B;  2BQP A;  3MPB A;  4O65 A;  2OVU A;  4ERO A;  2DCT A;  3OSD A;  1MPX A;  5DDJ 2;  5CG9 A;  3JXS A;  1RXG A;  5KWR A;  1H9P A;  3FZ3 A;  3VD4 A;  2VXJ A;  4OUM A;  4F3J A;  4K20 A;  1U5Y A;  3ZXG A;  2VOW A;  5APA A;  1DYO A;  5ABJ A;  1HB4 A;  4MXW A;  3ENR A;  3I3D A;  1TME 1;  1VMH A;  2JDA A;  3OEA A;  4YG3 A;  1EV1 3;  4PQQ A;  5C3R A;  3DV8 A;  3KS7 A;  3RPQ A;  1AXK A;  3WF3 A;  1RUE 3;  2V4A A;  1H1I A;  3KHB A;  5I0S A;  2EIB A;  2WQ8 A;  4G4F A;  2J42 A;  3POB A;  4P5H A;  4BM8 A;  1H2L A;  1QDC A;  1RUO A;  2ATF A;  4NPL A;  4DY5 A;  2WS9 1;  3VDC A;  2FDI A;  2W95 A;  1GNH A;  2B45 X;  1XYN A;  4B3N A;  2RR1 2;  4QQL A;  2WFF 1;  2EA7 A;  1K5M C;  2WZR 3;  3WNM A;  4N53 C;  3R0R A;  1OUS A;  2XVL A;  1C1L A;  5HXM A;  1LHU A;  4PF5 A;  3NST A;  2JWP A;  4E4H A;  5CB7 A;  3RYP A;  2VUC A;  3HNM A;  2X53 S;  2ZGQ A;  2JKB A;  3OGJ A;  1NA1 A;  2ZMK A;  2P17 A;  4OVE A;  1YNA A;  3ZFE A;  4LBQ B;  5BNO C;  4XAC A;  1DZQ A;  1H0B A;  4EJR A;  1MQT C;  4CTE A;  2BBA A;  2D7F A;  1J3R A;  4XYX A;  5E16 A;  1IZ3 A;  3WR0 A;  4JGZ B;  2WA3 A;  4L0P A;  2QQM A;  3C7G A;  3W59 A;  4LE3 A;  2Y6L A;  4MSV A;  1W8T A;  1S0D A;  1W06 A;  4HSJ A;  5EZW A;  2WWJ A;  5EYX A;  2RS3 3;  3WDU A;  1MZE A;  3IDE A;  4XBN A;  2RM2 3;  3RZL A;  3VL9 A;  4XXP A;  5FYV A;  3IIA A;  1NZI A;  1PM4 A;  2RJL A;  2I74 A;  2IXK A;  4O9E A;  1IQD C;  3WW2 A;  4RGK A;  5C3P A;  5LRS A;  5E8A A;  1NLS A;  1Y3T A;  2ZAB A;  3K77 A;  2MNG A;  2FDJ A;  5FYC A;  2R06 3;  4LEJ A;  5EJ3 A;  1PO2 2;  1YYN A;  4AQ2 A;  5AC9 1;  2YB7 A;  2AR6 A;  3AKS A;  3C7F A;  4OYU A;  4CPB D;  3A23 A;  1RTV A;  4XW3 A;  4EN8 B;  1VRH 1;  2XHN A;  2IXH A;  2CY6 A;  4MX3 A;  4AXO A;  3VBU C;  1RYY A;  4TN7 A;  3RZJ A;  1OPM A;  1W6N A;  1MS1 A;  4RHV 1;  3SXW A;  4XF9 A;  4QU2 A;  1W3V A;  1XRU A;  3JB4 C;  4Q4V 1;  1C8M 3;  2WLQ A;  2PHU A;  2Z79 A;  1R1A 1;  4YNI A;  1EUU A;  2MHF A;  4ES9 A;  3PUA A;  3ZFG C;  3AZW A;  2ZHN A;  3AMN A;  4XIL A;  3ZYB A;  4R9D A;  2DVB A;  4LHL A;  5FUN A;  1XNA A;  5A33 A;  3NNL A;  4YZ4 A;  3VDA A;  4GD4 A;  4AQS A;  3WNN A;  3SKJ E;  3IPV A;  2ET7 A;  5F7U A;  4UXA A;  5EWS A;  1AZD A;  1OVP A;  2QQO A;  4Q1P A;  1XXN A;  5A7N A;  3GJA A;  1AXY A;  2XVK A;  2BRT A;  5J48 A;  1ZZB A;  1Y9G A;  4IEP A;  3J7N A;  3I54 A;  1OMI A;  3NV2 A;  3T1L A;  4GB3 2;  1LHN A;  4J1X A;  4PLN A;  5JWP A;  1KDM A;  1F2N A;  5DUW A;  1ENR A;  5GLU A;  2FZ1 A;  3OD4 A;  4KI5 M;  5B4N A;  4GH4 C;  1W3X A;  1FMD 2;  3LF7 A;  3VBU A;  2E51 A;  3AP6 A;  1S55 A;  1WGP A;  3DYM A;  3MYX A;  4CU7 A;  2HWC 1;  5JOW A;  1AX0 A;  4GJZ A;  3U4X A;  4FOQ A;  2QKD A;  2QQN A;  4A6S A;  2ZOE B;  3VKO A;  4FQ4 A;  3IAP A;  1VBD 3;  1S0I A;  5FYS A;  5JCT A;  2ARB A;  4QX1 A;  3VBF A;  3WNO A;  3PJQ A;  1SFN A;  2XLF A;  4AFD A;  2VME A;  1YIF A;  2G19 A;  4CSW A;  4RS5 B;  3JQW A;  1QXP A;  2WZE A;  4Q0U A;  1JYX A;  4Z92 B;  4Q0V A;  4YAR A;  1US3 A;  3WG3 A;  1QJU 2;  1UX6 A;  4YVW A;  4HN1 A;  1FI2 A;  1OA2 A;  1SLT A;  1UY4 A;  2W9X A;  2DBN A;  3ZN5 A;  5J1X A;  1TQ5 A;  3WDX A;  1VBC 3;  2HEV F;  3EB7 A;  1DLL A;  3I4I A;  3J8F 1;  4IND A;  2A75 A;  4LKE A;  1XE7 A;  2ZGN A;  4XXA A;  2R0F A;  1H9W A;  1VBE 3;  3R6S A;  3UKV A;  4BYY A;  4XMA A;  1DP0 A;  4OQ8 A;  1EAH 1;  3PVB B;  2Y38 A;  1OF3 A;  4V2W A;  2VZU A;  4XCB A;  2D97 A;  3ZFE C;  4IER A;  3E5X A;  3N9O A;  2HWF 2;  2X29 A;  2UY8 A;  2ZKN A;  2VPV A;  3OPZ A;  4M00 A;  4CE8 A;  4DY3 A;  4Q4X 1;  4QD2 A;  4IGP A;  1QJZ A;  3AKR A;  1CR7 A;  3ETQ A;  3H8X A;  5A3N A;  5GLW A;  1FYU A;  3KT7 A;  1SLI A;  4L2N A;  5FMC A;  4NN0 A;  2UWB A;  5GM0 A;  2DCY A;  4A7Y A;  2AZ5 A;  4FCA A;  3E1F 1;  3TNQ A;  4COY A;  2WZ8 A;  4KGQ A;  2B5H A;  4XF1 A;  4XF0 A;  5CA6 A;  1QOT A;  3FUQ A;  2P37 A;  2JKX A;  2JG9 A;  3T30 A;  1UL9 A;  3I3E A;  4AI1 A;  2E9Q A;  1EV1 2;  1W03 A;  2P1B A;  1H4G A;  1HRV 3;  1GNZ A;  1RJ7 A;  1WUV A;  2ADE A;  2NM1 A;  3IBM A;  1U0A A;  2BJS A;  4S2F A;  3ZXF A;  1JOD A;  1YXW A;  2IXI A;  4NHX A;  3CJI B;  2VCC A;  2W1U A;  1MS3 A;  3OUI A;  4QPG A;  1HRI 1;  4PI0 A;  4E4Z A;  2WYF A;  3ZOI A;  5C4W A;  1VLN A;  3OBR A;  1VAV A;  4IEX A;  1QOS A;  4GAL A;  4A41 A;  4N43 C;  5HBA A;  3AVS A;  2IC1 A;  3O1U A;  1RUF 2;  4WZF A;  1IS6 A;  2W5F A;  2JG8 B;  2BEO A;  3VD5 A;  2YU1 A;  4AED B;  2HWB 2;  3NNG A;  4GJY A;  4CCD A;  4JHT A;  1OSG A;  1OOP C;  4WM7 B;  3S57 A;  1UO9 A;  1PGL 1;  4B4Q A;  1ZNP A;  5F8P A;  4RGA A;  1R09 1;  2J1T A;  1UOB A;  4D8M A;  3MHZ A;  4BJ0 A;  3I7D A;  2WT2 A;  1MZF A;  4LXL A;  3ZIX A;  1MR5 A;  2R7E B;  1XSR A;  2EAL A;  1ASJ 3;  1V6O A;  1Z7S 3;  2PHX A;  2UYA A;  4Q4W 2;  1EPW A;  1PMJ X;  5DG2 A;  4JX0 A;  2BOJ A;  2W52 A;  4RYD A;  2DCK A;  4IXL A;  3URF A;  3BPS A;  4NIA A;  2Y6H A;  4YSF A;  1GWL A;  5FBZ A;  3KHC A;  4NRM A;  3H8R A;  4PJY A;  1LOE A;  1OLR A;  3ZXK A;  3BCW A;  2VMC A;  2EIC A;  4LO5 B;  1G9B A;  1O3S A;  2GZW A;  2PEL A;  4XAE A;  5FPB A;  5FZM A;  2RDR A;  1AYM 1;  1FX5 A;  4BLI A;  2DU0 A;  5FZK A;  1OXC A;  5F9T A;  2HWD 1;  3PVE A;  4IV1 B;  2ETE A;  1CPM A;  1K3I A;  3K46 A;  3POJ A;  4R52 A;  5A6X A;  4B4R A;  2ARC A;  3NL1 A;  2A70 A;  1CIY A;  1RUD 2;  1YUD A;  3GF6 A;  3KQ4 B;  4PI2 A;  2VOX A;  3VBR C;  3NRU A;  4FP2 A;  1OPO A;  4NWW A;  2CHH A;  3WDY A;  5IVC A;  2WS9 2;  1W0P A;  5L73 A;  5F32 A;  4LBJ A;  2K46 A;  4XET A;  5FK7 A;  2C24 A;  3MFA A;  1R08 1;  1AF9 A;  4IE6 A;  1WLC A;  5FZO B;  4BK5 A;  2RMU 1;  2V72 A;  4FPO B;  4MXW B;  5ANN A;  3JBG 2;  3THP A;  2YGM A;  2G9Z A;  3RWK X;  2QQW A;  1Y9M A;  1YRZ A;  3ZDV A;  2JB8 A;  4Q0Q A;  1JW6 A;  1UF2 C;  4AVA A;  1E5H A;  3JU9 A;  3K4Z A;  3ILR A;  4UFK A;  1PO1 1;  1EAH 2;  4JRL A;  4YZ3 A;  2B9V A;  2F4L A;  3VDD C;  3H3Z A;  3AZV A;  3S7E A;  2I45 A;  4M4P A;  1ZZC A;  2Y6G A;  3KVA A;  4UFM A;  5C8C A;  3KV9 A;  5LW9 A;  3VD7 A;  4KL1 A;  1O59 A;  5CNA A;  3DKW A;  1WCD J;  1BEV 2;  3MLK A;  1AX2 A;  1A34 A;  3U07 A;  1W2N A;  2HJI A;  1Y7B A;  2IZW A;  4XJW A;  3UYJ A;  4GA9 A;  5JOY A;  5LZ6 A;  1OVS A;  3ZDS A;  4EN7 B;  3RGB A;  1LEM A;  2JDM A;  1TNR A;  2UU8 A;  3S5Q A;  2HWF 3;  4S2G A;  5FYU A;  5IYY A;  5HXV A;  4MH0 E;  1SMV A;  3WZ1 A;  2E26 A;  1KGY A;  2C1F A;  1AJK A;  2EVX A;  3OEB A;  3I49 A;  1JTZ X;  1WMF A;  1HJG A;  2QZ2 A;  1DQ0 A;  1QJU 1;  3NAP B;  3I59 B;  4AI2 A;  4ZU7 A;  5DDJ 3;  3ME2 A;  4AAX A;  2DFB A;  1OH3 A; 
#chains in the Genus database with same CATH homology
 5IAT A;  4NHX A;  2Y34 A;  3OUI A;  5ERL A;  5LBE A;  3HQR A;  5EP9 A;  4XCA A;  3NNJ A;  5LBC A;  2FCU A;  5EPA A;  2RDS A;  4Y5T A;  4NHK A;  2RG4 A;  2A1X A;  4XC9 A;  3KT4 A;  3NNL A;  4NAO A;  4NHL A;  5L9R A;  4J25 A;  5LBF A;  3GJA A;  4BQY A;  5LBB A;  3BVC A;  4BQX A;  4XAB A;  4MHR A;  4IW3 A;  4NHM A;  2JIG A;  5L9B A;  2RDN A;  4BQW A;  5IAV A;  2RDR A;  2RDQ A;  3GJB A;  4NMI A;  3W21 A;  4UWD A;  4XAA A;  3OUJ A;  4MHU A;  2G19 A;  3ITQ A;  5DAW A;  2V4A A;  5LAT A;  2FCT A;  4NHY A;  4Q5O A;  5DAQ A;  2HBU A;  5EQU A;  3GZE A;  5M0T A;  5DAV A;  5A3U A;  5L9V A;  3NNF A;  5DAX A;  4XCB A;  5LAS A;  5C5T A;  3NNM A;  3HQU A;  4Y5S A;  4ZON A;  3EMR A;  4XAC A;  5IAX A;  2G1M A;  3KT7 A;  3MGU A;  2JIJ A;  2OPW A;  3PL0 A;  3OUH A;  3DKQ A;  5HV0 A;  4JZR A;  5HV4 A;  2HBT A;  4ZPI A;  2Y33 A;  5LA9 A;  3OBZ A;  5DAP A;  5C5U A;  2FCV A;  5LB6 A;  3W20 A;  4KBZ A;  3KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...