5LBCA

Hif prolyl hydroxylase 2 (phd2/egln1) i280v/r281l/i292v variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/fg2216)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
222
Chain Sequence
b'LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLVLHCNGKLGSYKVNGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLVRVEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
total genus 63
structure length 222
sequence length 227
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbcA00
4KBZA 2HBUA 2FCVA 4XABA 3GJBA 5L9RA 5A3UA 5L9BA 3ITQA 5EPAA 5HV0A 5EQUA 2HBTA 5LB6A 5DAWA 4MHUA 2RDSA 4MHRA 3NNJA 4NHLA 4UWDA 4NMIA 5DAPA 2RDRA 4XACA 4NHKA 4XAAA 4Y5TA 2RDQA 3GJAA 2V4AA 4XCAA 4BQWA 5IAXA 2FCTA 4ZONA 5DAXA 4IW3A 3HQUA 5HV4A 3OUIA 3OUJA 2JIGA 4NHXA 4Y5SA 4BQYA 2JIJA 5M0TA 2OPWA 3OUHA 3DKQA 5DAQA 5IAVA 5C5TA 2Y34A 4Q5OA 2Y33A 5LATA 3KT4A 4J25A 5LA9A 2G1MA 4XCBA 5LBBA 3EMRA 5EP9A 2RDNA 4XC9A 5C5UA 2G19A 5LBEA 2RG4A 3NNLA 3KT7A 2FCUA 3MGUA 5L9VA 4NAOA 2A1XA 3OBZA 3KT1A 4JZRA 5LBCA 4NHYA 3GZEA 3NNFA 3W20A 3BVCA 4NHMA 4ZPIA 4BQXA 5LASA 3PL0A 5DAVA 5ERLA 3W21A 5IATA 3NNMA 5LBFA 3HQRA
chains in the Genus database with same CATH superfamily
4OHXA 4B1LA 1PGW2 4UYBA 2ZGPA 5L19A 4N53C 2SBAA 3S6PA 4I09A 5FMOS 4OQ9A 3H7JA 4JX0A 3WHUA 3PUHA 4P02B 4UFJA 1XE0A 4URAA 3S7EA 2ERFA 2WQ8A 2E51A 2B42B 3MIGA 2GC2A 4RR3C 1DBNA 4Y22B 1KS5A 5I0RA 2ORXA 3M4FA 3WOGA 2XPJA 2W9XA 1WCDJ 3RMYA 4XFHA 4UW5A 1V9U3 2FDGA 4HG6B 4O7XA 3VHNA 4OHWA 3DECA 4KWKA 1SDWA 2JENA 3PTRB 4AHWA 1VALA 5E8AA 4Q4W1 5CA6A 3LFIA 3T0AA 4YG0A 4KU7A 2XUMA 2B9VA 1H9WA 3WQ0A 4WBBA 4LBOA 1C5IA 1RUH3 3ZXJA 5J96B 2RDRA 1PMJX 4Q1PA 3WNLA 5A3NA 4GMP3 1QH7A 3ZFFB 1ACCA 1X8EA 1A78A 3C7EA 2WS93 4BCUA 4XJAA 4BLJA 1RUNA 1H1MA 1W39A 1LCLA 1GU3A 5BNNA 4ZU4A 1GZCA 3FE5A 3ZFGA 1R081 2RDQA 5BNNB 3JD72 5K0UC 1RMU1 1ODNA 5JXHA 5JZGA 2XJPA 1R1A2 2E33A 1XYPA 2KA3A 2W1SA 4HN1A 4IESA 4K21A 4XMIA 4E2GA 2D40A 2JDNA 5FZ7A 1AJKA 4R9AA 3AMMA 3ZN4A 1ZX5A 2YGMA 4MV2A 1KS4A 4QQLA 5DDJ3 2ZHNA 1NZCA 3VKOA 1HV0A 3BTYA 2YROA 2ZPXA 3MFCA 1LULA 2DVGA 1C8NA 1AR81 1QH6A 3CLPA 5JIAA 1PK6C 4N90A 4GJYA 3RGBA 1IZ3A 3FHIB 1OOPC 2WNUB 4MGKE 2PHUA 1TMF2 4XBNA 5CVRA 4EN8B 3V0BA 2MHFA 2HWD2 1MACA 2I2SA 4Q26A 5CG9A 2RMU3 4U36A 5AFBA 4Q0PA 2MEV1 2CU5A 2EF6A 2DCZA 2P1BA 4D3WA 2J42A 3S5AA 2W39A 3D4KA 1QOSA 5A6YA 3HMYA 4O65A 2PFWA 4QB6A 4GWNA 4CDWB 5FYZA 5DDJ2 4CDWA 5A3TA 1UMIA 2ZEWA 5CYYA 3VB9A 3WY6A 1YFXA 2ORZA 4W65A 5KXDA 4FQZA 5BV6A 1OFNA 1ZRIA 3M8LA 2P5BA 2QNKA 1HRI3 5AC93 2C1FA 3E97A 1UOBA 4CP9B 5CIRA 1QIQA 4YGDA 3ZFEC 5E88A 2X53S 1F9KA 2VOVA 4DXSA 4MZUA 2AH2A 3F2ZA 3WCRA 1C1LA 1CAUA 2X09A 2OQ6A 4AQSA 1Y9MA 3CKHA 4XFCA 1OLMA 5JUVA 5A32A 2A3WA 1Q5OA 3OGRA 3KV5A 2W3JA 3N7KA 2E63A 4XYXA 5J98B 3J8F2 4RQPC 4LITA 2FCVA 1ND3C 2PHRA 2DCYA 2VNRA 3AM2A 3T0BA 4E4HA 4KG8A 4LO5B 4DZGA 3VBHB 1UY1A 2C26A 2X05A 4BJ0A 5C8WA 3K4AA 4XF3A 1PVC1 4N43A 2VNGA 3POGA 2NPIA 5FUNA 3KQ4B 5FMDA 4XJZA 3AL6A 1NOVA 4XUPA 4DXZA 5FDBA 5JVVA 3OSDA 2VQ0A 4RR3A 1PGW1 4OI0A 5A3PA 2X5IA 3Q8AA 2GU9A 2QZ3A 2OZ6A 5JSRA 5LEJA 4K20A 1PIV3 2GP3A 3A7QA 4LBJA 1UF2C 3N9LA 4Q1RA 4NHLA 2HWE2 2ZTNA 2LROA 4G9SB 4NMIA 3VGIA 1O3TA 5A6XA 4JAAA 2RJLA 1XC6A 5FZOB 1EV13 1AX2A 3WG2A 3H8RA 3MZHA 4YW6A 2D93A 1I9RA 3VBSC 1Q8OA 3I2GA 1EPWA 4LOSA 3RYRA 5FY0A 1KD7A 2R073 5T54A 5I0DA 1WLWA 3U37A 4AQTA 4XCAA 4UW6A 2WABA 4R4XA 2FDFA 3HQUA 2ZEZA 4GB33 3OBTA 1Q56A 1GLHA 4MUVA 3K48A 4IV1B 1HXS2 1AR93 2XDVA 1OLRA 1NG0A 1FNYA 1X33A 1S0BA 3E1F1 1OOPA 1OVSA 3O0VA 1S55A 2JB4A 4AXOA 4Y24A 2HLEA 1QNYA 3K77A 3MF9A 4ARXA 5DG1A 4W8JA 4Z2WA 5L7OB 1RUH1 2HWD1 3FJSA 3ZPOA 4LHLA 4WM8A 3ETQA 1YC61 1VBC3 4E8CA 5FJKA 5FZ3A 1IOAA 1UY3A 1CZVA 3VBRA 4Q4X2 1OF4A 4QHZA 4AI2A 1G9BA 5HCHA 1YHFA 1JUIA 2G19A 1VRBA 4N53B 5LK5A 4BQ4A 4L92A 4FAHA 2FDJA 3WF2A 1AR72 1H30A 5K7PA 3N9MA 1C5HA 1NA1A 3ZFFC 2BOIA 2EXKA 2FCUA 1CGPA 2QQUA 1J1LA 3GM8A 1IHMA 1IS6A 2VVDA 3I59B 4NUBA 4YW5A 2E26A 5EFUA 4N7UA 4NHYA 4E2SA 3OPWA 3UK9A 4XFGA 1WW7A 3RPQA 1CAXA 3NAPA 1AL23 5FWEA 5FYHA 1HRV2 2BNMA 4HXCA 3MIFA 4Q0SA 5FKBA 4PJYA 2YC2A 4M3CA 4OFGA 3AZWA 1DQ6A 4KQ7A 1JOPA 1PK6B 2YU1A 3ACGA 1JI6A 4GXLA 5K0UA 3T08A 3VZKA 1POV3 1NZIA 2VW1A 5K8SA 4FSJA 2MEV3 4ASKA 4CRQA 1Q8QA 2EIDA 1RHI1 5C4WB 1LEMA 5IATA 5IFPA 3OBAA 2VZQA 4DY3A 3BU7A 1ZA4A 3AFGA 5A33B 3TN91 5LCWL 2ZX0A 1RUE3 3KCCA 3AXDA 1SQ4A 5T55A 2VQTA 3EYPA 3E5QA 2VQUA 1RUC2 2ID4A 4DS0A 3A0KA 3GCXA 4LJHA 2AYHA 5A3UA 2CGOA 1LHWA 2XL7A 4RQPA 2AZ5A 3WV6A 5HCAA 1ZVFA 4ZKTB 2W68A 3LSDA 3MW2A 1HQLA 1F5FA 3KD4A 3O0XA 1KXGA 1SMVA 2EIBA 1W2AX 4X6QB 2QKDA 3SKJE 3GHNA 4GKXA 1HKDA 1HRI1 1J84A 2PAKA 3POEA 1JZ7A 4QPGA 4C8DA 2JECA 3CJIC 3WNXA 2Y0OA 5DZFA 1JYNA 5FREA 4WM7B 4P9YA 3NNJA 3ES1A 1Q8SA 2WNUC 3WLUA 4YW4A 4AGRA 4FFHA 2X5IC 3MV01 2E7AA 1ND2C 1LHOA 4Q4V1 1LRHA 3H1MA 4NE9A 3RI9A 5FZCA 1PO23 3TWIA 4D94A 2BNOA 5GKAC 1BLZA 2C6SA 4TLGA 3K3NA 3LA7A 1ZZ6A 1F35A 1UKGA 2O1QA 3M7AA 4Y20A 4YZ1A 4D6SA 3GJAA 3KCXA 2V4AA 4QX8A 1ENQA 1HB3A 4BQWA 2YB7A 3AXEA 4ZY9A 4ZONA 5JR7B 1W6NA 5DDJ1 1WMXA 4YSFA 1DZQA 4PQ9A 4QPGB 5GJ6A 1CPMA 1EUTA 2XBO3 4ZS2A 2F4PA 1RINA 4AFAA 3ZX7A 4I02A 5T5OA 4QM9A 4YZ2A 1BEV3 3VBUB 1C28A 1LOBA 2ZABA 3MW4A 4RFRB 4ZZ8A 2VBBA 5CFDB 5FP9A 3DKWA 3VBHC 4PDWC 5DAQA 1NYWA 2A71A 5FZKA 2NYYA 1COV1 5I8SA 1OKOA 3I3MA 5LATA 4EN7B 3AC0A 4Q0VA 3H7YA 1JU3A 3VBOC 3I54A 2Y8KA 5A7OA 4CCCA 4TWTA 5EYXA 1LOAA 3K51A 4KGQA 3H1WA 2ZBJA 2I45A 4URTA 2XJVA 4QGLA 4RR3B 1NE6A 1E5IA 1S2KA 4A7ZA 1HQNA 2BVBA 2J1RA 4IEQA 5K0UB 1RVF3 5T5LA 1ENRA 4XAEA 4PF1A 3PU8A 4NPMA 1Q8PA 5GLUA 4L0PA 1O4ZA 2BUKA 3OY8B 1NX9A 3WD5A 4DB5A 2BWCA 1EUUA 3HBKA 5EZWA 3WNOA 2Y26A 4E9KA 5L73A 5BNPC 1LJ7A 3D6EA 4I30A 1UQXA 4KWLA 2ZGSA 3VBUA 3VZLA 3TEYA 2ZAAA 2VGDA 5F5IA 4CU8A 2D3RA 4BQXA 1MS4A 4WZFA 2HWE1 1H1AA 4DNYA 1YLLA 1A8DA 1LU1A 4CCEA 3ZSLA 3AMQA 1LOFC 1W6NB 3NMBA 1OPMA 2PLV1 3NV3A 3WSOA 2JDPA 1HB1A 2YY1A 1Z0HA 3AFKA 2VZVA 5KWRA 1VJ2A 2VG9A 4FPGA 4V2WA 3DL3A 4FVVA 4CSWA 5FYUA 5JLVA 5FO8B 4CZSA 4Y1ZA 3ZMNA 5BNNC 1H4GA 1ZM1A 5DZEA 1P8JA 1VAKA 2RR11 4K1ZA 2WA4A 2PAEA 3GJBA 5L9RA 1MR5A 2PHDA 4XFAA 2GSYA 1UCXA 2W2IA 3AJYA 3EXUA 3FWEA 4RGKA 5EPAA 3VDCA 4CDUA 5E89A 4TLFA 3J7NA 2HBTA 4XIOA 5GALA 2H0VA 1NUKA 2Q5TA 1UXZA 2Z42A 3N9QA 3NWKA 2PYTA 4NWWA 5F6LB 1GWMA 1NY71 1YJLA 1D4M3 3LEKA 1H8TC 1YQ5A 4OUSA 3CHXA 2O0OA 4FPCA 2D6KA 2JG8C 3P6BA 5A7NA 3VKLA 3AB0A 1RL3A 2PELA 4J1XA 4V2VA 4YW1A 5F3IA 4IEZA 1CD3G 1OA2A 4F7ZA 5A1LA 1VB4A 4Q29A 4XMAA 2E7QA 3HR9A 4Z2AA 1K42A 5GLVA 3DF0A 3VZJA 4QHBA 3O1SA 4PT6A 4AFBA 3M70A 4C1XA 4W6XA 3ZYPA 2F4LA 1UY4A 3LOIA 3LB9A 5C3SA 5I0SA 4DUXA 5K9YA 3ILNA 3HWJA 5LY2A 2WO7A 3PIJA 2BPA2 4DRRA 3L9JT 2J1SA 3SH3A 3U1XA 5B2GB 1TEIA 5J09A 3D3AA 1QJZA 4CCKA 2VQAA 3ZSMA 2DCKA 1XQNA 3LAGA 2XVLA 2UY8A 1YFWA 4KGGA 1E5SA 1V6LA 1G8WA 4BH9A 4AQ6A 3TAYA 1D0GA 4Y5SA 3UKTA 3WZ1A 2AACA 2GC1A 1VBA2 5FBJA 2RM21 3FBYA 1XYNA 2RJKA 4C0HA 2WUHA 5C5TA 5FY1A 4MXWB 4JKLA 1IS4A 5BY5A 4NIAA 1OF3A 4IE4A 4J25A 2YBKA 1U5XA 3R4SA 3LKJA 3GBWA 5DPNA 1PGL2 4JQTA 2DCJA 4NWVA 4CDQC 2VCAA 5FPUA 4R4ZA 2OT7A 4ASLA 1DF0A 1HRV3 3SCFA 3MF6A 4IEYA 1D4VB 2GP5A 2Z5WA 3ABZA 4Q0UA 4I3PA 1RUD2 1QJX3 1GWLA 4AFMA 4IGPA 3ZXFA 3AYDA 1YJKA 5EYYA 1RUC1 3IPVB 1ULFA 4Y20B 3ZDVA 2GN7A 3JZVA 2VD7A 1XOYA 2C9KA 3AP9A 5IK4A 2D6MA 4YZ5A 2VO5A 1QJU2 2VL4A 4MG2A 1RXGA 4Q4X3 1WMDA 3GBGA 4BQ5A 2ZMNA 3OYWB 5F9TA 2WT1A 3CBNA 1RHI3 1OFSA 2R6QA 4PIZA 3M2MA 1RC6A 5FXVA 3RI8A 4XEZA 1F2NA 4NR1A 2IXIA 3WR0A 1ND2B 1H6XA 4HANA 5JXJA 2BGOA 1WCKA 4CEYC 3IDAA 5JR2A 2TUNA 3WF1A 4EN0A 2YDEA 1PM7A 1Y43B 2R32A 1JOJA 4UAPA 2DVFA 5JOZA 5LA0A 4AF9A 1NCQB 3MW3A 4MGYE 2YMZA 1FPN3 1RJ8A 3T2PA 1PVXA 1SLLA 3AKSA 2KXLA 1OMIA 4A42A 5FZAA 2P34A 1R1ZA 3AMPA 3ZDSA 4QGNA 2H6CA 1OQ1A 1QJEA 2HWC3 4QGMA 5BUVA 4OI4A 5HV0A 3VBOA 1OH4A 4MO3M 1QEXA 5C8CA 4NIGA 4JC1A 2W47A 1LOGA 5FXXA 2DDUA 1AYN3 2VCMA 4D8MA 1KFXL 1UU6A 5C4WA 3W59A 5GZGA 4H55A 3W9AA 1WKYA 4MHUA 5BNPB 1D0HA 2PHTA 2ATFA 3WHTA 2BDRA 1I5PA 1W6QA 1QJY1 1W3VA 2JDKA 2JG8A 3B00A 3QBQA 5E6HA 2EXJA 1RUG2 1YI9A 2PLV3 3U4SA 3HPNA 4IXLA 5FMCA 2OW4A 3R0RA 4B7KA 5FLHA 2D6LX 2W91A 3GGLA 1GOFA 3PTYA 1XBFA 2EA7A 5DMYA 3ASIA 5FKCA 1MS5A 3TN92 4P9XA 2VOKA 1FAYA 1W2UA 1MZFA 1W8HA 1HN1A 4QD2A 5FYBA 3VV1A 4FPYA 3DCQA 3ZKUA 2DFCA 3OD4A 3RZHA 2Q1ZB 4V1PA 4AEDC 1IKQA 3DUIA 2FCTA 3UJQA 1DYOA 2HWC2 1WCSA 2WO3A 3RZMA 4YM0A 2XH6A 5HV4A 5IK7A 2EIGA 3VZOA 4YLZA 1OA4A 1BYHA 2ZGNA 3A22A 3IDEA 3O0WA 4DQAA 4E2QA 1V9U1 4NHXA 4Y22A 4AEJA 1DZTA 1XRUA 5M0TA 3N3HA 1DGRN 1I3HA 4LO4B 2V09A 2D6OX 5FCCA 3CJIB 1DGLA 1D2SA 4ZU7A 2Y33A 3U75A 1UYPA 2UYBA 4LKFA 4CU6A 3AYCA 4L97A 1V70A 2FD8A 4OMCA 3W5MA 1VMJA 1S0EA 2HWE3 2BOJA 2C9AA 4COZA 1M4WA 2VMIA 3KCYA 2RS31 4JCKA 5C8CB 1PIV2 4QHOA 1RVF1 3U78A 1MEC1 2ZXQA 3H3ZA 3L2HA 4WVWA 2WFPA 1ZA7A 3ATGA 3SC7X 3N9NA 4HONA 2HWF2 1AXZA 4CDQA 1SCRA 2D3SA 4A6SA 4I2OA 1NCRC 2GNBA 1S2BA 4TSVA 1VBE2 2OXBA 2XLFA 2RG4A 1GNZA 1CONA 2WIIB 4AHXA 3ZYBA 4LBNA 2A3XA 5LRSA 1FMD3 4NIIA 2B7YA 2GMMA 4AWDA 3J7HA 2BFUS 1REFA 2VBDA 2Z79A 5GLZA 1IG0A 2E32A 2ZX2A 3GHMA 3AYAA 3H42B 4PF5A 4YPJA 2QQIA 3ZYFA 3BPZA 1SG3A 1WD4A 3VZNA 5FZ1A 4AEKA 4LLFA 1HXS1 1QXRA 1T2XA 3TBDA 5FY5A 2UYAA 2WL1A 4JGZA 1QOOA 4AVBA 4ZPIA 5FMOL 4XUTA 5FZMA 4OZXA 2A6ZA 4M4PA 1UO9A 1UX7A 2X5IB 3PL0A 3T1MA 4XFIA 1US2A 4A41A 1C57A 1F15A 1HRV1 5J48A 1TVGA 1UOGA 4OI2A 4QXHA 3RZKA 1ASJ1 1VBA3 1OH3A 4KBZA 4AVVA 1W9WA 1UL9A 1V00A 2WZR1 1DDLA 4WM7A 5FIXA 5FTTC 2Y6FA 2WZPP 3AK0A 4NAMA 3VUOA 4HPKA 1AXYA 3POSA 4HOOA 4RGAA 1ENXA 4XBQA 1AUYA 4IL7A 1CPNA 3I49A 1W8UA 3GBFA 1TZOA 5C7GA 3CNAA 2QJVA 1ZBE2 4G3YC 1NLQA 1RUI2 5E1RA 5K4LA 3HN3A 3KV4A 3ILFA 1WA4A 2HYXA 2XHNA 3POIA 4P08A 1C8M1 4L11A 2WLPA 1J83A 2VZRA 3ZSKA 2W87A 1RUH2 1UPIA 4MLOA 1FT9A 3DPRA 3RZZA 1WA6X 4FPOB 2HWF1 4D6RA 4XDPA 3ELNA 4JRLA 5FOJB 5DAPA 1MEC2 1DYKA 3IZOA 1AL22 1QJFA 2JDZA 2UWBA 3MIHA 2ZS6B 5GLWA 4UOJA 5F5AA 1G9AA 3E6CC 1VBD2 3IAPA 3ILRA 1W06A 3TYJA 2ZKLA 1HX6A 2NQYA 2ZGQA 2BZDA 3RRDA 1REEA 1W0PA 2DCTA 1UXXX 2DVDA 5DUUA 1UKRA 3CJXA 2A5ZA 4BM8A 1F4HA 1W6MB 2X8KA 1ASJ2 4I0BA 4R52A 4COUA 3ZVXA 4AE2A 3HN1A 3WF4A 5BNOB 1O4YA 1PGSA 4FOWA 4AOCA 4BQYA 2HH9A 2JDAA 2WSUA 2D5FA 5FY7A 3WDTA 5IT6A 1K3IA 1XNCA 3LCPA 4QX0A 4AI8A 1W90A 2WS92 3OD0A 1CAVA 1RUF2 2RMU1 4RS5A 2XJRA 5D8AB 5G04L 3HEIA 4B4QA 1ND2A 1SBEA 2I74A 3KT4A 4YG6A 1W9TA 2DV9A 3VD9A 1VPHA 3ACHA 1AR83 1FX5A 3KSCA 1BCXA 1EY2A 2B45X 3HQXA 3VD3A 4AHYA 3EMRA 1S0GA 3CO2A 4YM2A 2XJSA 3POFA 1SLBA 4IEXA 4Y4YA 1YQ6A 2PAMA 4HETA 2IVJA 4XF4A 3RSJA 2GNTA 2ENRA 4R9DA 5ACA1 4LTAA 5HPOA 4JGYA 2JE7A 4QXCA 4RD7A 4QT6A 4XE9A 5IVCA 3WCSA 1NKGA 5ABJB 4QMAA 1J3RA 1GV9A 1PZ7A 1C8M2 2QE3A 5LW9A 2QQJA 1RVF2 2J22A 4OYUA 1WMEA 1FV2A 4Q4Y3 4XDOA 2FQPA 1ZBE1 2BQPA 4GWMA 3ORJA 1J1TA 1E57A 2VECA 4IE7A 4LKDA 1G9DA 4JVAA 5EHDA 2WYFA 3ACLA 1F8VA 5T3NA 3MYXA 1SLAA 2ZMKA 4BK4A 4N8MA 1WUVA 3FL7A 4LIUA 2K0GA 2Q8EA 3ZXDA 3O5SA 1SCSA 2BEOA 1VRH3 4DUWA 2XB6C 1W04A 1MS0A 2X29A 1G9FA 3X29B 1DLCA 1AYN2 1ULEA 1WW5A 2CY6A 3V65A 3J7MA 4ZXEA 1RB8G 2F6BA 5JPMB 1EYBA 3E6BA 2VUCA 1TNFA 2P37A 1BMV2 4IGQA 1N3OA 1Z7S3 3WW1A 1WLDA 3DGTA 4XABA 3C7GA 4D6QA 3BODA 4GZ9A 2NMNA 2P3IA 3S7IA 3LZZA 2UWAA 3KV6A 1V6JA 2XOMA 1AL21 3IAQA 3BCWA 3N9PA 2QVSB 3LF7A 2QDNA 5A80A 3T1LA 4ZHNA 3SXWA 2W52A 2GDFA 2R30A 4G4FA 2GN3A 4YG3A 3N7MA 3OJBA 3HJRA 1WLTA 3PIGA 4FTBA 4MHRA 5FP8A 4EZHA 1Q8VA 5CFDA 4FP2A 3LWCA 2WN3A 5A32B 4M0HA 3ZFEB 2QQOA 3VL8A 4BQ2A 2WNVA 1VE0A 1XSQA 2D7FA 4EN6B 1LEDA 4H2AA 1OSGA 2PHFA 4U2AA 4LA2A 3BOPA 3NNGA 4XJ8A 1A34A 2DFBA 4IEPA 2XQRA 3CEWA 2A70A 3UKVA 1EAH1 1NCQC 3FX3A 1U0AA 1OUXA 1K45A 1EV11 3AP5A 5BNOA 3QACA 4GQ7A 1GWKA 4MGIE 4BXFA 3JD71 4YGEA 5DAXA 2YBPA 2FDIA 1JYTA 4I3GA 1QKQA 2VH9A 2CDPA 4QU2A 2VVEA 2YBSA 5D2AA 5ANNA 5F2WA 3ZR5A 1JXNA 1WLCA 3NAPC 3WNPA 3J7LA 4IQPA 2CV6A 1GKBA 5DQ0A 4GB31 2IZWA 3HNMA 2IXCA 1YNAA 2W0XA 2CWMA 2JE9A 2R062 4K6BA 4JHTA 1JW6A 1LOCA 4PLNA 2HWF3 1OPOA 1NAEA 1ODMA 3QCWA 4IETA 4PCRA 1FYUA 4COYA 3EO6A 4NJ4A 4RHV2 1XU1A 2K46A 3LPGA 3TOJA 4JKMA 3KF3A 2E7TA 3JCIA 4Y33A 1GR3A 1MPXA 5FYIA 2GMPA 4QX5A 4XZPA 3KM5A 3FZ3A 1UPSA 1W8NA 3VKMA 4JKKA 1KJLA 3LDBA 1KJRA 4XC9A 3K3OA 3WG4A 4UT5A 5CU1A 1BQPA 1TNRA 2J1EA 3LEGA 1HV1A 1LGBA 3OGVA 1KGYA 4WM8C 3ZXKA 5FZLA 1O5UA 5B4NA 4UFIA 1AJOA 3E6DA 4BHPA 2WWSA 3ROUA 2PN5A 3I3DA 4AVCA 4E4DX 2JG9B 4I01A 2A1XA 3ZPYA 5IYYA 1QQP1 3HNYM 1RUJ2 2XHKA 4NVPA 2ZJCA 3VBFB 2BTVC 1SBDA 4HK8A 4QQ2A 5FZ9A 2CL2A 5CKNA 4XIKA 3M1HA 1JYWA 2BW8A 1COV3 2W92A 4QPGC 2P6CA 2OYZA 3I2HA 4M01A 5FZFA 1LNSA 5FPXA 1JODA 1W6OA 3F95A 4LBQB 5TSWA 4CP1A 1IKPA 1W8ZA 3NAPB 5C3PA 1V9U2 1X8MA 3BN6A 3D0JA 1Z78A 1ONAA 3PVBB 5CKQA 1H1IA 1SPPB 2ZEYA 3HQRA 4A3XA 1CQ9A 4JGZB 5I91A 5JXIA 2NLRA 3O1UA 1U5IA 2JDYA 2OQ7A 1O7FA 4FPFA 5CNAA 1X7NA 4P9GA 5KHGA 2Y6GA 5KHIA 4AI3A 4CXYA 4PI0A 4AI9A 1TQ5A 1V6OA 4RS5B 4S2DA 1CAVB 5ABJC 1VAVA 4LBKA 3MIBA 3FMGA 4Y5Z0 5ISLA 1W0NA 1CIYA 3UJOA 2R16A 3SNMA 1G6NA 4ISQA 2IUWA 3VHPA 1UMHA 1PZ8A 3NQHA 4B8EA 2VOXA 4LUMA 5FR3A 2P17A 2A73B 1O3SA 1RTVA 4B4PA 4RFT0 5L7OA 3K4DA 4FOYA 1N1TA 3B5LB 1F31A 4MYEA 4YZ3A 5EV7A 4ATEA 4GKYA 1EAH2 4GD4A 2QTWB 1Y7BA 1VBB1 2Q30A 1RUD1 1BBT1 1OD5A 2ZGRA 4DEQA 4AGVA 1NY72 5D21A 1GQPA 1XYOA 1OC1A 1QXPA 3B02A 1UX6A 1SHWB 5IVJA 2DUQA 5IWFA 3ZFGC 3SITA 3CJIA 4AW7A 4Q4Y2 4BA6A 3PMEA 4A3ZA 4AVSA 1PO21 3FN9A 3MLLA 5FFOC 4C90A 2RR13 3AKPA 5CBLA 5I0UA 1DQ5A 1IPKA 1COV2 4RQPB 1LAJA 3I97A 1R082 2CSGA 4Z07A 3WW3A 1KRIA 4KL1A 1AR62 4CXWA 3CF6E 3MLJA 3OTFA 3MV11 4HT1T 3P1IA 4EZ4A 3WT3A 2AGSA 1K5MA 1W8TA 2CAVA 1GZWB 1W6PB 4UW4A 3T09A 5C70A 2BJSA 3O1OA 1PX4A 4IE6A 4XUQA 4CE8A 3SISA 3V0AA 3Q8BA 4CCLA 1SFYA 3MLKA 1CIWA 1YI7A 4HPKB 3OCPA 1PX3A 4UFLA 5HXVA 2J1TA 2G9FA 2XONA 5FZIA 4HVRA 1U12A 2QCSB 2G1MA 4PIXA 4TXWA 1VIWB 4Y4RA 5F3CA 2JDHA 1JYXA 3N35A 3J4UH 2Y6KA 1VRH1 2YPDA 2WDBA 4IE0A 5FBZA 3WNMA 2AC1A 3RQ0A 1ZNPA 2K2SA 2WYSA 4FFIA 3VBHA 2XBO2 1MQTC 4FFFA 3R6SA 1H2KA 1A8MA 4Q4V2 4EJRA 1RMU3 1W28A 1IG3A 5KC5A 4CDXA 2VM9A 4JDMA 4NIDA 2WA3A 4O61A 5FP4A 3D8CA 2VZ3A 5FLIA 1IS5A 4B3NA 3CZJA 3V0AB 1UZYA 1GQGA 1NA1B 3KT7A 3R4UA 3UETA 2P2KA 5EJ3A 5FV3A 1D7PM 4JZRA 4FAGA 3IDCB 4KG0A 3PU3A 3UGGA 1GMMA 2IXHA 1KFUL 2OA2A 2VMFA 4NRPA 1A3KA 2VUJA 2JDUA 4LHSA 5D1IA 1SLCA 3VBRB 1SEFA 3C8XA 5ANQA 3ZYHA 1H8VA 5CEHA 2V72A 1AX1A 2B46X 4K1YA 4Z1VA 2XGXA 4PLMA 1JOBA 3MUY1 4CU7A 3DPRC 5FOBB 4CEWA 2ZACA 3ZYIB 2A6YA 4BK5A 2I07B 4PDWB 4HVQA 4QQOA 3KMHA 3HVDA 4QDRA 3U14A 1UZZA 2IXKA 2R061 4FPHA 4NPLA 4Q0QA 5CFCC 2HBUA 4IV1A 1H4HA 4BDVB 2IC1A 2UWCA 5LRRA 3RNSA 4A2UA 4WVMB 4N43C 3JU9A 4XURA 4FTEA 2ES3A 3GXUA 1GOGA 1CESA 3IKWA 3IPVA 4JQRA 3MIDA 1QHDA 1H0BA 5L7OC 4FFGA 1VBE3 1JS9A 3BIWE 5C3OA 2IWGB 4CYDA 2R0HA 3H50A 4OZOA 5LWBA 4X8NA 2VPVA 4WVVA 2ZX4A 3WG1A 2WT0A 1STMA 1NCRA 3IT8A 3L2YA 3ME2A 4XQDA 5FZBA 1RUJ1 1YIPA 2E6VA 2A75A 4AL9A 5JWPA 3WP6A 5FYSA 3PURA 2JX9A 4NIHA 2P3JA 4DO0A 2FDKA 1N1SA 1SPPA 2ETEA 3E5UA 4PQQA 3ZN6B 1X50A 4YVWC 1VBB2 4KBBA 5CB7A 4NHKA 4ARYA 4H7LA 3KS7A 2XWBB 5C3RA 2EICA 1HJFA 5FP7A 3OGSA 5F3EA 2VTFA 5F5QA 1HDKA 4O9GA 2XXZA 3EHKA 3KHBA 2R043 3CZUA 2A6XA 4HL0A 4ZXKA 4CDUC 2RM23 1VMFA 5CAZA 4W4ZA 2BGPA 5CKMA 1VR3A 2XL9A 3OUJA 4FPLA 1C1FA 2YC4A 3BGAA 4IV3B 3VBFC 3N4MA 4FP3A 3WP4A 3NW4A 3GDBA 1H8TB 2DYCA 3FLPA 2HWB2 5A1AA 1US3A 1GZWA 1CAWA 2DTWA 1BMV1 1UOJA 4WM7C 1E5HA 3NJZA 1YUDA 1UD1A 3M3QA 5IVFA 1HB4A 1YFYA 4FPEA 1DQ2A 1PO12 2XJQA 4CP9A 2VXRA 1MQTA 3HT2A 3PHMA 1W8FA 4LPLA 1PO13 5GM0A 3POJA 1WWYA 5FP3A 4C1WA 1KDKA 5A7SA 1H2LA 4WVMA 5IVYA 5IVEA 2OX0A 1PHMA 5KHJA 2O8QA 3VDDA 1RUF3 2WJSA 1AR71 3GALA 1S2EA 1G86A 3FLTA 3JB4C 4LA3A 4QU1A 5FYMA 4BISA 3R4DB 1ENSA 3GF6A 2R072 1NXD1 5I8YA 3SEPA 4FXGB 2DUOA 5F39A 4Q4X1 1AR91 3P3NA 5APAA 3AVRA 4P9LA 3WDYA 3C2UA 2VUDA 4A6OA 4F83A 1H6YA 2ZOEB 2WQ4A 2GMEA 1N3QA 1S0IA 3B93A 2DTYA 3ECQA 3LQCA 1FATA 2RS11 5FMBA 2L9LA 4A44A 4XF1A 4CPBD 1JBCA 3O14A 4QPIC 4CCDA 2ARBA 3BUCA 1W8WA 4HSLA 5LASA 1OQEA 2G4IA 3DYMA 2C0ZA 3UYJA 1S4CA 1ZZ9A 5FWJA 4FI9A 2HKXA 4J6GA 4EE2A 3B7MA 4HSJA 4DXTA 1CZSA 3I3BA 3Q8CA 3VHOA 2ARCA 1MEC3 4YYOA 1JZ5A 3AYEA 4ET7A 3MBWA 4TZDA 1DQ0A 2NP0A 4X6RB 2WS91 1B35A 5F5CA 4IV3A 3OY8A 5J3UA 3NKGA 1PVC3 1QJU3 4CDXB 1DU3D 3ZMOA 1S0FA 4XPVA 1FMD1 2DU0A 1AYN1 2VC9A 5I8TA 5L9BA 1GZ9A 1QDOA 1W6OB 5EQUA 2JG9C 2G9GA 1WBLA 1ZZ7A 1LESA 3S30A 1REDA 1LTEA 1YO8A 4Q2FA 4Y3OA 4OI1A 1YYNA 2VUAA 1XE8A 3AKQA 2JJ6A 3N7JA 4Z8BA 4AFCA 3H8OA 1QJX2 1RUD3 2DF7A 1BKZA 3TEWA 1FI2A 4COWA 3OBRA 5EXOA 3WDWA 2LW8A 1HRI2 1VBD1 3M3IA 3VBOB 2AUYA 1DYPA 4D7YA 5JZGC 1ZREA 2CTVA 3WINE 4YM1A 2HEWF 2FMDA 2ZGLA 2MEV2 1QMJA 1UIKA 3BPSA 2OS2A 3BTAA 1RUE1 2AREA 2R063 2WO2A 3B9IA 3I3QA 3I2KA 1PMHX 4GA9A 4SBVA 4FTSA 1QJY2 2LRPA 3ALQA 2CGNA 2VNOA 4K8RB 4GH4A 4YVWA 2Q8OA 1N1YA 3AZVA 4YFWA 1OQDA 3MIEA 4CEYB 3KWVA 4R8HA 4XJWA 3LA3A 4YZ4A 4CCNA 1WW6A 3AMHA 2R1DA 3B01A 3ST7A 3S5QA 1R091 1Z7S2 1S0DA 1ULPA 2GH8A 3WW4A 2RMU2 1W9FA 1AX0A 2IFRA 2AEYA 4IEUA 4Q27A 1BVP1 2HWD3 1JH5A 4OHYA 4Y1XA 2VZPA 3PMSA 5IAVA 1MZ6A 4AG4A 4JGYB 2Y34A 3IIIA 5F6KA 1XE7A 2RS33 1RMU2 4JGZC 4Q4V3 3VDAA 4A7KA 3MPPG 4XVHA 3RYPA 5J7MA 5AC91 1JYCA 2XJUA 4UFMA 4XF9A 1ALYA 4FXKB 1LENA 4AYUA 3VN4A 1L7RA 4XXAA 5A7WB 1BK0A 1OA3A 2VVFA 4E8DA 5D8AA 5C5UA 1HW5A 4AZZA 5JAXA 5T5PA 1UN1A 1UW8A 2VMHA 4PIYA 4ISRA 2WKKA 2P3YA 4IGOA 1PMIA 2DVAA 3LDKA 3MDPA 3MGUA 4LT5A 1DQ4A 1MVQA 3U0ZA 1Q43A 5LBCA 1OD3A 2V5DA 5FPZA 2WBKA 3T2TA 5C4WC 1JYVA 3AJZA 3NNFA 4IEWA 3RZJA 1DLLA 3OPZA 1VBE1 1YQ8A 2VCBA 3O1TA 4KNCA 5ACA2 3ACIA 4XZUG 5A33A 1GP4A 4X8PA 1RXFA 1QDCA 1W6QB 1XNDA 1TME2 3J8F1 4FQ4A 4MX3A 4IV3C 1GANA 1NQJA 3T3YA 5BNOC 4EQVA 4OULA 4QPIA 2BBAA 3PVEA 5FQ0A 1XNBA 3ZKYA 2EAAA 2EIEA 3DEMA 4WZCA 1XNKA 2RVAA 4BZ4A 1KEXA 1CWPA 2JG9A 3LD8A 3SMHA 4ES9A 1Y9GA 5DXDA 5LA2A 1AZDA 4O9EA 1CJDA 2WZR2 5FY9A 1GQHA 4UBHA 4IE5A 2H0BA 2XQXA 5FO7B 3USUA 3T0DA 2RHPA 4LE4A 1QF3A 2UU8A 1ASJ3 1VBA1 3I59A 3VD4A 2W1UA 2PA7A 4YM3A 1GNHA 3NRUA 1SDDB 4L8QA 5JSOA 2RV9A 5JMCA 1FXZA 3VD5A 1YFUA 5KC6A 3HD8B 3WNNA 3T2QA 1FOD3 5DAWA 4ZZ5A 4E27A 4BIFA 2CAUA 2JKBA 3VZMA 1JYIA 1FPN2 5F37A 5A3OA 5T52A 4S2HA 4XW3A 2ZGUA 2XMLA 1TME1 2YGLA 2ZGMA 4ASMB 3MHZA 1LODA 2E31A 4E4SA 4LOTA 2J7MA 1ZBA3 3BTZA 5C33A 2Z69A 3BI3A 2HWB3 4P5YA 4KU8A 1ULGA 4ES8A 4LO8A 1GOHA 5DABA 5IJRA 1GBGA 3CU7A 1H2NA 4CDXC 2YV8A 3OEAA 3PUAA 2ZHKA 4GH4C 1SLIA 2XJTA 4PLOA 4QWNA 4LHKA 5I93A 3KVBA 1W03A 5SV5A 1NQDA 2A6VA 5FPLA 2VR4A 5FZGA 2ZGOA 1BVVA 4LE3A 4LR4A 3HT1A 3VBRC 3H3UA 3OUHA 3DKQA 1CR7A 2PMWB 1B35C 2PQQA 2RS13 1UU5A 3AP7A 1VBD3 3GZTB 3MPBA 2VMEA 1TG7A 4FOQA 4PBPA 5EJ1B 3WDVA 3POYA 1ZZCA 1PO11 4YFZA 4P14A 3GZUC 2XLAA 4NO4A 1RUOA 4RHV1 4XCBA 4LXLA 2DURA 5GLTA 3EBRA 2WQZC 3NV1A 5KHKA 1JTZX 3BTXA 4LO6B 4LHNA 3T4VA 4QQHA 1TMF3 2KD7A 3CIHA 3H8UA 4LLOA 5FQ0B 3WDXA 3TEXA 2YYOA 3VHRA 2OUJA 5LBEA 3PJQA 4N43B 4YARA 3THPA 2ET7A 5G05L 2LM3A 1QJU1 2TBVA 4LUKA 3UESA 3AKRA 1AR61 4NAOA 3CQOA 4LNVA 1CAXB 4LBLA 5DUWA 5HCFA 4WV8A 3FHAA 3SLIA 4AI1A 3VBSA 2ZCWA 3EQEA 2QDRA 4P9WA 2W95A 1PNGA 1IS3A 4HVOA 4Q4Y1 2WN2A 3THTA 2P4EA 5FYTA 2WLQA 4HK9A 1JN2P 4IEVA 3RG0A 1MS9A 1O8PA 2BP6A 3I7DA 2VBPA 4IUGA 4IV1C 1CAUB 2VZUA 2YUEA 5F7UA 4N53A 1AHSA 2LTNA 4BIOA 2Z4FA 2CDOA 2WFF2 1WMFA 4FCAA 4D7TA 5ERLA 4EROA 4JDNA 5KBFA 1PGL1 3RS6A 1U5ZA 1HJGA 1EP0A 5H9PA 1GNYA 1IQAA 1R1A1 4CDUB 4F3JA 1OLME 4H14A 1MS1A 4B7EA 2O8OA 4DXRA 2BGCA 2B5HA 4HZFA 3LIGA 4MSVA 1RUC3 4YW7A 3UL2A 4JRAA 3ON7A 4CCOA 2MPFA 3FFQA 3IMMA 2ARAA 4UI9L 4YWAA 3DYPA 3PDQA 4E4ZA 1AYM3 1D4M1 2PHLA 4AK3A 2VOWA 1DQ1A 2VZOA 2PXJA 3ETPA 3GCWA 5FYYA 3VKNA 4CUBA 5T50A 5LB6A 4FO9A 4TYSA 5FUPA 4BE3A 4XUNA 1J58A 4P5HA 4Q4W3 1R093 5DZGA 5E16A 4AGGA 2WT2A 4CP0A 1ZBA2 1UU4A 1YXWA 5C8CC 1BEV1 4RA0A 3IDBB 2W94A 3N7LA 4UFHA 5FPBA 1OLQA 1DIWA 3INAA 4I0AA 4GMP1 4M3CF 4IEOA 2O14A 3BKZA 1NT0A 1MQTB 2FHRA 1O3QA 1BHGA 1HLCA 5FLJA 2ZHMA 1GFF2 1B09A 1LGCA 2WNUA 1KQRA 2JD4A 3N9OA 2HJIA 1MS3A 1POQA 3SQOA 3OGJA 3ZYJB 4OUEA 1HIXA 2OZJA 4TN7A 2Q0AA 4LEJA 4KWUA 3LIHA 2XVKA 4EWEA 5FYCA 4GULA 4AAXA 1LU2A 3VL9A 1WCQA 4XJUA 5CG8A 4OLLA 1AR92 3QH7A 3I2IA 2WFF1 5IVVA 2EAKA 3O1VA 2D6NA 1G7YA 4MOAA 4XFFA 3LDRA 2VZSA 4BMBA 5JOYA 3MFAA 4QPIB 3JBG2 4FBFA 1OBNA 1R083 1AF9A 1NLSA 4QKFA 5C6CA 2GZWA 4QKNA 1URXA 5FK8A 4JDOA 4UF0A 2WNEA 3DPRB 5H9RA 2UY9A 3JB8A 4CPBA 5CFCA 3V56A 3JXSA 4Q5OA 2EVXA 5HI0A 2ZHLA 4OHZA 4XETA 3ZN6A 1MS8A 1XPWA 2VMGA 3LEIA 3PUIA 2B8MA 2KR2A 1PZ9A 2V4VA 3MI8A 4QXBA 5FY4A 1RUG3 2PLV2 1RHI2 4N7IA 3WQBA 1T6BX 3FFZA 4QX7A 2HWB1 3HBZA 2TNFA 5EP9A 5JI7A 1WCUA 2BU9A 2FZ2A 4GB32 3KB5A 1RIRA 3ZIWA 5KXEA 4YGCA 1LGNA 5IK8A 3VD7A 4QDQA 3C7OA 4XXPA 5DUXA 3WX5A 5FY8A 2NMOA 3SHRA 5SV8A 2VAUA 5IVBA 5KR7A 2BWAA 3GZAA 2QZ2A 5BNPA 1EV12 3NJVA 4TTGA 1XSRA 2Q8CA 2GH2A 3K75B 2DBIA 2QQLA 5AVPA 3BVCA 1CVNA 5CISA 4QB1A 3VLBB 1QY4A 1YRZA 5T5JA 3PLQA 1W3XA 2GNDA 3I2OA 1PNFA 4LBMA 2MNGA 1BBT2 1UY2A 2JICA 3VBUC 5IW0A 1LHVA 5AVAA 1POV0 3RWNA 3P5BA 4QX1A 2WZ8A 4AEDB 3C3VA 3IMNA 1TME3 2G9ZA 2VTXJ 3JUUA 4CUCA 5FPAA 2VOTA 4ORFA 4NN0A 1HB2A 1PM4A 3LSEA 5A6QA 2FZ1A 1DP0A 3RJRA 1QU0A 2DBNA 5I0TA 1UZVA 3WQ7A 4DFSA 2R7EB 1T6GC 2BFUL 1ULCA 2AENA 2WZEA 1CAWB 2VNVA 3AVSA 3B69A 4CDQB 3GNEA 1FPN1 1O8SA 4OMDA 1H8TA 2D43A 4AR2A 4Z82A 2ZA9A 1UAIA 3D82A 3WP3A 1DGWA 1WW4A 5A3MA 2W1WA 5JDBA 4RYDA 4Q8KA 1M06G 1GICA 1O59A 2DWRA 3OYWA 5A6ZA 5AFEA 2CYFA 5H9SA 3NV4A 4QQPA 1ULOA 1XNTA 1YQCA 2E53A 3W58A 4JGYC 4LK6A 1V0AA 3H3LA 1D2QA 3U11A 1F4AA 2R1BA 3NV2A 4N9HA 3BIEA 2YXSA 3SH5A 3H0OA 5AC92 2XKOA 3ES4A 3Q8FA 4Q8LA 3OGGA 2A7AA 2VY0A 3RDIA 5F32A 3QOPA 3THDA 2B4KA 4CUAA 2A3YA 2D6PA 2BVVA 4HN0A 1BK1A 4XBLA 4BPZA 1OURA 4HMZA 3C7HA 2WWJA 3R05A 1DG6A 1HQWA 2Z2SB 1W6PA 3HOBA 1NLRA 4A4AA 5BYNA 4QPYA 3PJYA 4XHXA 4DOUA 3U10A 4K3UA 3BYWA 1WGPA 4MXWA 4BQ3A 1PVC2 3NJYA 2XKPA 3OUIA 5CFCB 5J1XA 2PQSA 3G6JB 5A3LA 2XG3A 4LO7A 3TNQA 2RE9A 1S0CA 3SCHA 2JG8B 2OPWA 2IVIB 2WAAA 1Y3TA 3KV9A 3AMNA 1GSLA 4BYYA 2VW2A 4P9JA 3J9SA 5LA9A 5CZKA 3WP5A 2HEVF 3MO4A 1SACA 2OUHA 5EJZB 2VTXA 1DCSA 4EYUA 3JQXA 4KWJA 3M3CA 1BXHA 1VBC2 2J1VA 1QGLA 4GAZA 2Y60A 3VDDB 1I6XA 2D44A 4BU2A 3T30A 1GP6A 1L3JA 3KLSA 1R1A3 3ZSJA 1XXNA 2DVBA 5J36A 5JI9A 1D4M2 1UY0A 3OEBA 1CZTA 4J1WA 4XUOA 4P9IA 4R9CA 5FPVA 3URFA 3WDUA 3WXPA 5JMOA 1XU2A 1L7LA 1GP5A 2Y0IA 2W46A 3NNLA 2JD9A 4GH4B 5JPNB 5L9VA 2RS52 3HIFA 2HEYF 3V0BB 1HXS3 3KT1A 1AYM1 2Y6HA 3AX4A 2HWC1 4QXKA 2PTMA 5GZCA 3ZOIA 5A3WA 1UMZA 2ARXA 3BOWA 3NVCA 3H1YA 4NHMA 2BBVA 3LE0A 1F5JA 2CWSA 2YFUA 4QPWA 1BZWA 2K9ZA 5DAVA 4EWAA 3O1RA 3TN93 2GC3A 5F3GA 3AL5A 4MXVA 3UKNA 1GZTA 5HBAA 1X36A 4ZS3A 4A45A 1O91A 4GJZA 2BV4A 3ZFGB 4XQWA 1POV1 2QQWA 4UW3A 5LY1A 1BJQA 4CXXA 3LFMA 4HFSA 1RUI1 2C5DA 2LS6A 3ZFFA 1C4RA 4BXSV 2QQMA 2Q8DA 5FRAA 2R071 4EN9B 2XLGA 3I2JA 4CU9A 1X82A 2WC2A 2WZR3 1C8M3 3ZXGA 2DUPA 4YRDA 4BB3A 1CX1A 1OXCA 5A1FA 1O5LA 1NCRB 5BNQA 2UURA 3O1PA 2P3KA 4K8FA 1K5MB 5FXWA 1AYM2 2C24A 5CFDC 1V6IA 3ZYRA 3U4XA 2OPKA 4CA9A 3KGZA 4CCMA 1I1EA 4L99A 2ZAHA 2ZZQA 1YCIA 1Y9QA 2YHJA 3FUQA 2VMCA 3NJXA 4ITCA 1XJAA 3FLRA 3MEPA 4YVSA 3ZXAC 4XQ4A 2D5HA 2AR6A 3WUCA 4UWDA 3NKTA 3O7OA 4JHZA 4ONUA 4GALA 1VBC1 1RUJ3 2BERA 2WRAA 2VXJA 2WFF3 3TB0A 1R092 1Z7S1 4Q4W2 2RS53 3BU0A 4S2GA 3I3EA 1QQP2 1DZRA 4N9IA 4M3CB 3OG2A 3QH6A 1JHJA 4GWJA 1N3PA 3K46A 2E9QA 4PDWA 4HKLA 4AVTA 4DRVA 1K12A 2XVGA 3POWA 2LUWA 1QXJA 3IB3A 4IW3A 4AEMA 4AQ2A 3RZLA 1J3QA 1VB2A 5F8PA 3WF3A 3AKTA 3D0SA 1YQ2A 1RUE2 4NOTA 5BXXA 2YU2A 5HXMA 4Z92B 4EWDA 1UOFA 1RYYA 3KHCA 3UGHA 1OT5A 2GALA 2YC0A 5C71A 2RS32 3QD6A 4SLIA 4XHBA 1LR5A 1JHNA 2BYVE 2WINB 1U5YA 1UIJA 4BWOA 5A70A 2VJXA 2QBXA 1RUF1 5LBBA 2QQVA 1Q3EA 2D97A 5DUVA 1L7QA 3ZXLA 4BQ1A 4GIQA 3ZYGA 1W2NA 3ZLIA 4C0BA 2FBEA 1J3PA 3KQRA 4XTPA 3WF0A 2C4XA 2ADDA 2J1AA 3PUQA 4LULA 5JZGB 1ST8A 1ZBE3 1UWWA 1FMD2 4M4RA 1YWKA 1VAMA 5A7PA 4UXAA 1N1VA 1DFQA 4DEVA 1N47A 4KH9A 1ZRDA 1APNA 1AR73 1W05A 3M3EA 3RMXA 3RWKX 3VBFA 1O6UA 4K9SA 3N36A 1JUHA 3AZYA 2R49A 4YGBA 5LZ6A 1UYXA 4JTNA 4M00A 4AAPA 4D0QA 2GNMA 4DINB 3D5OA 3O12A 5JXGA 3AP6A 4PBOA 5A7QA 1DGRA 1W9SA 3ZXEA 1VLNA 3ZR6A 3KVAA 3K4ZA 2VE1A 3LPFA 1IPSA 2RS12 2CGPA 2Y6JA 2ADEA 5EIYB 1CX4A 4W6WA 3UV9A 4UF0B 4XILA 3VDDC 3WVJA 2Q1MA 5FZ0A 1OUSA 2VZ1A 1SZBA 4IERA 2OVUA 3I2DA 2V73A 4CDWC 5JOXA 4NROA 5LEKA 3ITQA 2N7GA 4QKDA 4LQRA 4JV4A 4XTMA 1H9PA 4Y26A 3FUOA 3IWZA 4GWIA 2RR12 5ABJA 4CVUA 2XBO1 3A21A 5FZDA 2FDHA 3EJKA 4YVSC 5BPXA 1VRH2 2Q4SA 4AHZA 4OCTA 4W50A 1H2MA 1KITA 2GC0A 2W08A 2WO1A 2ZEXA 3OF1A 1UYYA 4OUMA 2YG0A 4FOVA 4QX2A 2OKXA 4DUVA 3BALA 3IBMA 2WSVA 1EAH3 1LHNA 4M3CE 3WEZA 1UZWA 4XACA 5C3QA 5IK5A 2FMYA 4DPNA 2VW0A 5IUQA 2WNVB 4XAAA 1UNBA 2ZX1A 3MICA 5A7WA 4F8AA 4YW2A 2VCCA 4Y5TA 1K5JA 4NPRA 1ND3A 1ZZBA 2NN8A 4QKBA 3UGFA 1W99A 5ACA3 5C9AB 5IAXA 1J59A 2W5FA 4H7MA 1UZ0A 4QX3A 2B9UA 1NA1C 1O3RA 3I2FA 2Y6LA 2XR4A 4H3WA 3LA2A 3IN9A 1GYKA 4LBQA 1A6CA 4DMIA 4LIVA 4MADA 2JIJA 5CADA 3T4HB 1SFNA 1AR82 1V6NA 3DYOA 1NE4A 3JBG1 3G7DA 2JB8A 3OOXA 1EPZA 3ZM8A 1KDMA 3WG3A 3B3QE 5L36A 2JWPA 4AFDA 1C3HA 1I5ZA 1CN1A 2PHWA 1S0JA 1K5MC 2IXLA 2YZ4A 4FT8A 1JZ6A 4XFBA 4CUGA 1QJX1 3LEMA 4RS5C 1MVEA 2IFWA 2IXJA 4YVSB 4NRMA 3RVHA 4CEYA 3DXUA 3VKFC 2NZ9A 2VZTA 4YVWB 2RS51 2PHXA 4B1MA 2TEPA 3MUZ1 5F1RA 3VBSB 4C91A 2VU9A 3W5NA 2RM22 2HYKA 1O4TA 2VULA 4LBQD 2V5YA 4YW3A 1AVBA 3Q9OA 4BLIA 4CTEA 1W8OA 4DY5A 5KXBA 1IQDC 2YPJA 3M3OA 5FZHA 2WR9A 1BEV2 4ZU5A 1HN0A 4XJ9A 1MZEA 2LALA 3DN7A 3OBZA 4QB2A 4XDQA 1YEWA 3C7FA 1R64A 4LORA 5F2SA 3SKVA 3KF5A 3J8F3 1UYZA 4BOWA 2ILMA 3AZXA 4LKSA 4XF0A 3I4IA 4D7SA 3LGRA 5JCTA 1W0OA 2GAUA 4AVAA 2NM1A 1MZ5A 3KGLA 5FK7A 4W6YA 3RJ2X 4CEWC 5LA1A 1JZ4A 1RITA 2Q1FA 3RYKA 2D3PA 3U07A 4LKEA 4RHV3 3B9CA 4Y1YA 4KMQA 4PI2A 3Q8EA 3W21A 5J37A 4RN5A 1RUI3 3P3PA 1TMF1 5C9AA 1B35B 1PO22 2CNAA 4A7YA 4YNIA 5IHRA 5GZEA 5D8AC 4LK7A 1QOTA 3J26N 3PNAA 1NXMA 3CDZB 4RL7A 1JZ8A 4MGZE 5FZ6A 2QQNA 3S57A 2R0FA 3CMGA 5H9QA 3FC0A 5FZ4A 3LOBA 3UT0A 1FOD1 1DHKB 1VMHA 3A4UA 4OQ8A 1LHUA 3PUSA 1V6KA 3JD73 1W2OA 2EALA 4HKWA 4NRQA 1RGSA 2EXHA 1QJY3 1OI6A 4WM8B 1V6MA 4XOGA 4LMFA 5FZ8A 5B4XA 3V64A 2AEZA 3BB6A 5HCBA 4CCJA 4GMP0 2WAOA 4MVTA 3KZ4C 3H9AA 2RDSA 4KI5M 3T2OA 3JQWA 2RJ2A 4HBNA 4HLTA 4R9BA 1OOPB 5JOWA 2JXAA 1ZBA1 2W1QA 2P6HA 3THCA 4COVA 5IFTA 3ZN5A 2QQPA 2BNNA 1VP6A 2B39A 2H6BA 1OHFA 3E5XA 2WNOA 3WNKA 1X9TA 1YIFA 2ZGTA 5LK7B 4META 5DN2A 1ULDA 3EB7A 2QQKA 4CEWB 2YFZA 5FYVA 3SEEA 3HAGA 1BBT3 3TEZA 3B94A 3ZO0B 5FXZA 1TE1B 3TNPB 2F17A 1XB9A 2Y38A 4HKOA 4AI0A 1S1AA 4M0NA 4QDSA 3S0MA 1CJPA 1SLTA 1ZRFA 4FPKA 2SLIA 1AL0G 1ZZ8A 4DIQA 2ZMLA 3PVOA 4MGQA 4MGSA 2CHHA 5FAXA 2BRTA 4QAWA 3SCGA 2ZX3A 5FJHA 3HNBM 2X10A 5FZOA 2JDMA 3USUB 2D98A 2JIGA 1SFPA 4S2FA 4EV0A 3RFRA 2J1UA 3CL1A 1QQP3 3OB8A 1OKQA 2OIIA 3TRSB 4Y1VA 1PIV1 2ET1A 2JKXA 1LECA 4L2NA 3NSTA 4OVEA 5EWSA 3ZSEA 3WQ1A 2WWUA 1OVPA 3GYDA 3UNPA 1AXKA 2JE8A 2VMDA 3RZGA 4L9BA 2QUOA 2KM2A 1PK6A 3DXTA 3A0NA 4INDA 1GUIA 1LOFA 3IIAA 3AP4A 2DU1A 4MH0E 1IGOA 1LOEA 1W2TA 1E5RA 2A6WA 4UBGA 2RDNA 3APBA 4ATFA 1AR63 1IPJA 3O1MA 3H8XA 1JMUB 2JEMA 3OPTA 5JSPA 4Y1UA 3USSA 5KXCA 2R041 4K7JA 4B29A 3FBMA 1ND3B 1RJ7A 1JZ3A 4CP2A 5GZFA 2XUEA 2XWJB 5FO9B 3DV8A 3POBA 5JIUA 3ACFA 1FNZA 1X9PA 2WNVC 3QLQA 4P00B 1XNAA 1Y4WA 2QFEA 5FUIA 3WUDA 4QM8A 1FV3A 1SBFA 3JBG3 3K2OA 4IDZA 4K40A 1JU4A 4RSUA 1G9CA 4I0WB 3GZEA 5GZDA 5C9AC 2R042 1ZYBA 1JZ2A 3A23A 4FPJA 3W20A 3WW2A 3VDBA 1NCQA 3ZFEA 5DG2A 5KHHA 1QWRA 1W9YA 2ZGKA 3AZZA 3FHQA 4JTOA 2ZKNA 4RGGA 3IM0A 2ZZJA 4AEDA 2Y64A 1DGWX 1RUG1 1WD3A 3NL1A 1ZRRA 1WZXA 3ZIXA 4MGTA 1QNWA 1VBB3 3PVNA 3SH4A 1W6MA 1LKNA 3ENRA 4WVZA 3I8TA 3NO8A 4UFKA 1FOD2 3NNMA 1WBFA 2EXIA 5FZEA 4D69A 4OHVA 5LBFA 1LB2A 4B4RA 1ZRCA 4BMEA 4PHZA
chains in the Genus database with same CATH topology
4KBZA 2HBUA 2FCVA 4XABA 3GJBA 5L9RA 5A3UA 5L9BA 3ITQA 5EPAA 5HV0A 5EQUA 2HBTA 5LB6A 5DAWA 4MHUA 2RDSA 4MHRA 3NNJA 4NHLA 4UWDA 4NMIA 5DAPA 2RDRA 4XACA 4NHKA 4XAAA 4Y5TA 2RDQA 3GJAA 2V4AA 4XCAA 4BQWA 5IAXA 2FCTA 4ZONA 5DAXA 4IW3A 3HQUA 5HV4A 3OUIA 3OUJA 2JIGA 4NHXA 4Y5SA 4BQYA 2JIJA 5M0TA 2OPWA 3OUHA 3DKQA 5DAQA 5IAVA 5C5TA 2Y34A 4Q5OA 2Y33A 5LATA 3KT4A 4J25A 5LA9A 2G1MA 4XCBA 5LBBA 3EMRA 5EP9A 2RDNA 4XC9A 5C5UA 2G19A 5LBEA 2RG4A 3NNLA 3KT7A 2FCUA 3MGUA 5L9VA 4NAOA 2A1XA 3OBZA 3KT1A 4JZRA 5LBCA 4NHYA 3GZEA 3NNFA 3W20A 3BVCA 4NHMA 4ZPIA 4BQXA 5LASA 3PL0A 5DAVA 5ERLA 3W21A 5IATA 3NNMA 5LBFA 3HQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBZ A;  2HBU A;  2FCV A;  4XAB A;  3GJB A;  5L9R A;  5A3U A;  5L9B A;  3ITQ A;  5EPA A;  5HV0 A;  5EQU A;  2HBT A;  5LB6 A;  5DAW A;  4MHU A;  2RDS A;  4MHR A;  3NNJ A;  4NHL A;  4UWD A;  4NMI A;  5DAP A;  2RDR A;  4XAC A;  4NHK A;  4XAA A;  4Y5T A;  2RDQ A;  3GJA A;  2V4A A;  4XCA A;  4BQW A;  5IAX A;  2FCT A;  4ZON A;  5DAX A;  4IW3 A;  3HQU A;  5HV4 A;  3OUI A;  3OUJ A;  2JIG A;  4NHX A;  4Y5S A;  4BQY A;  2JIJ A;  5M0T A;  2OPW A;  3OUH A;  3DKQ A;  5DAQ A;  5IAV A;  5C5T A;  2Y34 A;  4Q5O A;  2Y33 A;  5LAT A;  3KT4 A;  4J25 A;  5LA9 A;  2G1M A;  4XCB A;  5LBB A;  3EMR A;  5EP9 A;  2RDN A;  4XC9 A;  5C5U A;  2G19 A;  5LBE A;  2RG4 A;  3NNL A;  3KT7 A;  2FCU A;  3MGU A;  5L9V A;  4NAO A;  2A1X A;  3OBZ A;  3KT1 A;  4JZR A;  5LBC A;  4NHY A;  3GZE A;  3NNF A;  3W20 A;  3BVC A;  4NHM A;  4ZPI A;  4BQX A;  5LAS A;  3PL0 A;  5DAV A;  5ERL A;  3W21 A;  5IAT A;  3NNM A;  5LBF A;  3HQR A; 
#chains in the Genus database with same CATH topology
 4OHX A;  4B1L A;  1PGW 2;  4UYB A;  2ZGP A;  5L19 A;  4N53 C;  2SBA A;  3S6P A;  4I09 A;  5FMO S;  4OQ9 A;  3H7J A;  4JX0 A;  3WHU A;  3PUH A;  4P02 B;  4UFJ A;  1XE0 A;  4URA A;  3S7E A;  2ERF A;  2WQ8 A;  2E51 A;  2B42 B;  3MIG A;  2GC2 A;  4RR3 C;  1DBN A;  4Y22 B;  1KS5 A;  5I0R A;  2ORX A;  3M4F A;  3WOG A;  2XPJ A;  2W9X A;  1WCD J;  3RMY A;  4XFH A;  4UW5 A;  1V9U 3;  2FDG A;  4HG6 B;  4O7X A;  3VHN A;  4OHW A;  3DEC A;  4KWK A;  1SDW A;  2JEN A;  3PTR B;  4AHW A;  1VAL A;  5E8A A;  4Q4W 1;  5CA6 A;  3LFI A;  3T0A A;  4YG0 A;  4KU7 A;  2XUM A;  2B9V A;  1H9W A;  3WQ0 A;  4WBB A;  4LBO A;  1C5I A;  1RUH 3;  3ZXJ A;  5J96 B;  2RDR A;  1PMJ X;  4Q1P A;  3WNL A;  5A3N A;  4GMP 3;  1QH7 A;  3ZFF B;  1ACC A;  1X8E A;  1A78 A;  3C7E A;  2WS9 3;  4BCU A;  4XJA A;  4BLJ A;  1RUN A;  1H1M A;  1W39 A;  1LCL A;  1GU3 A;  5BNN A;  4ZU4 A;  1GZC A;  3FE5 A;  3ZFG A;  1R08 1;  2RDQ A;  5BNN B;  3JD7 2;  5K0U C;  1RMU 1;  1ODN A;  5JXH A;  5JZG A;  2XJP A;  1R1A 2;  2E33 A;  1XYP A;  2KA3 A;  2W1S A;  4HN1 A;  4IES A;  4K21 A;  4XMI A;  4E2G A;  2D40 A;  2JDN A;  5FZ7 A;  1AJK A;  4R9A A;  3AMM A;  3ZN4 A;  1ZX5 A;  2YGM A;  4MV2 A;  1KS4 A;  4QQL A;  5DDJ 3;  2ZHN A;  1NZC A;  3VKO A;  1HV0 A;  3BTY A;  2YRO A;  2ZPX A;  3MFC A;  1LUL A;  2DVG A;  1C8N A;  1AR8 1;  1QH6 A;  3CLP A;  5JIA A;  1PK6 C;  4N90 A;  4GJY A;  3RGB A;  1IZ3 A;  3FHI B;  1OOP C;  2WNU B;  4MGK E;  2PHU A;  1TMF 2;  4XBN A;  5CVR A;  4EN8 B;  3V0B A;  2MHF A;  2HWD 2;  1MAC A;  2I2S A;  4Q26 A;  5CG9 A;  2RMU 3;  4U36 A;  5AFB A;  4Q0P A;  2MEV 1;  2CU5 A;  2EF6 A;  2DCZ A;  2P1B A;  4D3W A;  2J42 A;  3S5A A;  2W39 A;  3D4K A;  1QOS A;  5A6Y A;  3HMY A;  4O65 A;  2PFW A;  4QB6 A;  4GWN A;  4CDW B;  5FYZ A;  5DDJ 2;  4CDW A;  5A3T A;  1UMI A;  2ZEW A;  5CYY A;  3VB9 A;  3WY6 A;  1YFX A;  2ORZ A;  4W65 A;  5KXD A;  4FQZ A;  5BV6 A;  1OFN A;  1ZRI A;  3M8L A;  2P5B A;  2QNK A;  1HRI 3;  5AC9 3;  2C1F A;  3E97 A;  1UOB A;  4CP9 B;  5CIR A;  1QIQ A;  4YGD A;  3ZFE C;  5E88 A;  2X53 S;  1F9K A;  2VOV A;  4DXS A;  4MZU A;  2AH2 A;  3F2Z A;  3WCR A;  1C1L A;  1CAU A;  2X09 A;  2OQ6 A;  4AQS A;  1Y9M A;  3CKH A;  4XFC A;  1OLM A;  5JUV A;  5A32 A;  2A3W A;  1Q5O A;  3OGR A;  3KV5 A;  2W3J A;  3N7K A;  2E63 A;  4XYX A;  5J98 B;  3J8F 2;  4RQP C;  4LIT A;  2FCV A;  1ND3 C;  2PHR A;  2DCY A;  2VNR A;  3AM2 A;  3T0B A;  4E4H A;  4KG8 A;  4LO5 B;  4DZG A;  3VBH B;  1UY1 A;  2C26 A;  2X05 A;  4BJ0 A;  5C8W A;  3K4A A;  4XF3 A;  1PVC 1;  4N43 A;  2VNG A;  3POG A;  2NPI A;  5FUN A;  3KQ4 B;  5FMD A;  4XJZ A;  3AL6 A;  1NOV A;  4XUP A;  4DXZ A;  5FDB A;  5JVV A;  3OSD A;  2VQ0 A;  4RR3 A;  1PGW 1;  4OI0 A;  5A3P A;  2X5I A;  3Q8A A;  2GU9 A;  2QZ3 A;  2OZ6 A;  5JSR A;  5LEJ A;  4K20 A;  1PIV 3;  2GP3 A;  3A7Q A;  4LBJ A;  1UF2 C;  3N9L A;  4Q1R A;  4NHL A;  2HWE 2;  2ZTN A;  2LRO A;  4G9S B;  4NMI A;  3VGI A;  1O3T A;  5A6X A;  4JAA A;  2RJL A;  1XC6 A;  5FZO B;  1EV1 3;  1AX2 A;  3WG2 A;  3H8R A;  3MZH A;  4YW6 A;  2D93 A;  1I9R A;  3VBS C;  1Q8O A;  3I2G A;  1EPW A;  4LOS A;  3RYR A;  5FY0 A;  1KD7 A;  2R07 3;  5T54 A;  5I0D A;  1WLW A;  3U37 A;  4AQT A;  4XCA A;  4UW6 A;  2WAB A;  4R4X A;  2FDF A;  3HQU A;  2ZEZ A;  4GB3 3;  3OBT A;  1Q56 A;  1GLH A;  4MUV A;  3K48 A;  4IV1 B;  1HXS 2;  1AR9 3;  2XDV A;  1OLR A;  1NG0 A;  1FNY A;  1X33 A;  1S0B A;  3E1F 1;  1OOP A;  1OVS A;  3O0V A;  1S55 A;  2JB4 A;  4AXO A;  4Y24 A;  2HLE A;  1QNY A;  3K77 A;  3MF9 A;  4ARX A;  5DG1 A;  4W8J A;  4Z2W A;  5L7O B;  1RUH 1;  2HWD 1;  3FJS A;  3ZPO A;  4LHL A;  4WM8 A;  3ETQ A;  1YC6 1;  1VBC 3;  4E8C A;  5FJK A;  5FZ3 A;  1IOA A;  1UY3 A;  1CZV A;  3VBR A;  4Q4X 2;  1OF4 A;  4QHZ A;  4AI2 A;  1G9B A;  5HCH A;  1YHF A;  1JUI A;  2G19 A;  1VRB A;  4N53 B;  5LK5 A;  4BQ4 A;  4L92 A;  4FAH A;  2FDJ A;  3WF2 A;  1AR7 2;  1H30 A;  5K7P A;  3N9M A;  1C5H A;  1NA1 A;  3ZFF C;  2BOI A;  2EXK A;  2FCU A;  1CGP A;  2QQU A;  1J1L A;  3GM8 A;  1IHM A;  1IS6 A;  2VVD A;  3I59 B;  4NUB A;  4YW5 A;  2E26 A;  5EFU A;  4N7U A;  4NHY A;  4E2S A;  3OPW A;  3UK9 A;  4XFG A;  1WW7 A;  3RPQ A;  1CAX A;  3NAP A;  1AL2 3;  5FWE A;  5FYH A;  1HRV 2;  2BNM A;  4HXC A;  3MIF A;  4Q0S A;  5FKB A;  4PJY A;  2YC2 A;  4M3C A;  4OFG A;  3AZW A;  1DQ6 A;  4KQ7 A;  1JOP A;  1PK6 B;  2YU1 A;  3ACG A;  1JI6 A;  4GXL A;  5K0U A;  3T08 A;  3VZK A;  1POV 3;  1NZI A;  2VW1 A;  5K8S A;  4FSJ A;  2MEV 3;  4ASK A;  4CRQ A;  1Q8Q A;  2EID A;  1RHI 1;  5C4W B;  1LEM A;  5IAT A;  5IFP A;  3OBA A;  2VZQ A;  4DY3 A;  3BU7 A;  1ZA4 A;  3AFG A;  5A33 B;  3TN9 1;  5LCW L;  2ZX0 A;  1RUE 3;  3KCC A;  3AXD A;  1SQ4 A;  5T55 A;  2VQT A;  3EYP A;  3E5Q A;  2VQU A;  1RUC 2;  2ID4 A;  4DS0 A;  3A0K A;  3GCX A;  4LJH A;  2AYH A;  5A3U A;  2CGO A;  1LHW A;  2XL7 A;  4RQP A;  2AZ5 A;  3WV6 A;  5HCA A;  1ZVF A;  4ZKT B;  2W68 A;  3LSD A;  3MW2 A;  1HQL A;  1F5F A;  3KD4 A;  3O0X A;  1KXG A;  1SMV A;  2EIB A;  1W2A X;  4X6Q B;  2QKD A;  3SKJ E;  3GHN A;  4GKX A;  1HKD A;  1HRI 1;  1J84 A;  2PAK A;  3POE A;  1JZ7 A;  4QPG A;  4C8D A;  2JEC A;  3CJI C;  3WNX A;  2Y0O A;  5DZF A;  1JYN A;  5FRE A;  4WM7 B;  4P9Y A;  3NNJ A;  3ES1 A;  1Q8S A;  2WNU C;  3WLU A;  4YW4 A;  4AGR A;  4FFH A;  2X5I C;  3MV0 1;  2E7A A;  1ND2 C;  1LHO A;  4Q4V 1;  1LRH A;  3H1M A;  4NE9 A;  3RI9 A;  5FZC A;  1PO2 3;  3TWI A;  4D94 A;  2BNO A;  5GKA C;  1BLZ A;  2C6S A;  4TLG A;  3K3N A;  3LA7 A;  1ZZ6 A;  1F35 A;  1UKG A;  2O1Q A;  3M7A A;  4Y20 A;  4YZ1 A;  4D6S A;  3GJA A;  3KCX A;  2V4A A;  4QX8 A;  1ENQ A;  1HB3 A;  4BQW A;  2YB7 A;  3AXE A;  4ZY9 A;  4ZON A;  5JR7 B;  1W6N A;  5DDJ 1;  1WMX A;  4YSF A;  1DZQ A;  4PQ9 A;  4QPG B;  5GJ6 A;  1CPM A;  1EUT A;  2XBO 3;  4ZS2 A;  2F4P A;  1RIN A;  4AFA A;  3ZX7 A;  4I02 A;  5T5O A;  4QM9 A;  4YZ2 A;  1BEV 3;  3VBU B;  1C28 A;  1LOB A;  2ZAB A;  3MW4 A;  4RFR B;  4ZZ8 A;  2VBB A;  5CFD B;  5FP9 A;  3DKW A;  3VBH C;  4PDW C;  5DAQ A;  1NYW A;  2A71 A;  5FZK A;  2NYY A;  1COV 1;  5I8S A;  1OKO A;  3I3M A;  5LAT A;  4EN7 B;  3AC0 A;  4Q0V A;  3H7Y A;  1JU3 A;  3VBO C;  3I54 A;  2Y8K A;  5A7O A;  4CCC A;  4TWT A;  5EYX A;  1LOA A;  3K51 A;  4KGQ A;  3H1W A;  2ZBJ A;  2I45 A;  4URT A;  2XJV A;  4QGL A;  4RR3 B;  1NE6 A;  1E5I A;  1S2K A;  4A7Z A;  1HQN A;  2BVB A;  2J1R A;  4IEQ A;  5K0U B;  1RVF 3;  5T5L A;  1ENR A;  4XAE A;  4PF1 A;  3PU8 A;  4NPM A;  1Q8P A;  5GLU A;  4L0P A;  1O4Z A;  2BUK A;  3OY8 B;  1NX9 A;  3WD5 A;  4DB5 A;  2BWC A;  1EUU A;  3HBK A;  5EZW A;  3WNO A;  2Y26 A;  4E9K A;  5L73 A;  5BNP C;  1LJ7 A;  3D6E A;  4I30 A;  1UQX A;  4KWL A;  2ZGS A;  3VBU A;  3VZL A;  3TEY A;  2ZAA A;  2VGD A;  5F5I A;  4CU8 A;  2D3R A;  4BQX A;  1MS4 A;  4WZF A;  2HWE 1;  1H1A A;  4DNY A;  1YLL A;  1A8D A;  1LU1 A;  4CCE A;  3ZSL A;  3AMQ A;  1LOF C;  1W6N B;  3NMB A;  1OPM A;  2PLV 1;  3NV3 A;  3WSO A;  2JDP A;  1HB1 A;  2YY1 A;  1Z0H A;  3AFK A;  2VZV A;  5KWR A;  1VJ2 A;  2VG9 A;  4FPG A;  4V2W A;  3DL3 A;  4FVV A;  4CSW A;  5FYU A;  5JLV A;  5FO8 B;  4CZS A;  4Y1Z A;  3ZMN A;  5BNN C;  1H4G A;  1ZM1 A;  5DZE A;  1P8J A;  1VAK A;  2RR1 1;  4K1Z A;  2WA4 A;  2PAE A;  3GJB A;  5L9R A;  1MR5 A;  2PHD A;  4XFA A;  2GSY A;  1UCX A;  2W2I A;  3AJY A;  3EXU A;  3FWE A;  4RGK A;  5EPA A;  3VDC A;  4CDU A;  5E89 A;  4TLF A;  3J7N A;  2HBT A;  4XIO A;  5GAL A;  2H0V A;  1NUK A;  2Q5T A;  1UXZ A;  2Z42 A;  3N9Q A;  3NWK A;  2PYT A;  4NWW A;  5F6L B;  1GWM A;  1NY7 1;  1YJL A;  1D4M 3;  3LEK A;  1H8T C;  1YQ5 A;  4OUS A;  3CHX A;  2O0O A;  4FPC A;  2D6K A;  2JG8 C;  3P6B A;  5A7N A;  3VKL A;  3AB0 A;  1RL3 A;  2PEL A;  4J1X A;  4V2V A;  4YW1 A;  5F3I A;  4IEZ A;  1CD3 G;  1OA2 A;  4F7Z A;  5A1L A;  1VB4 A;  4Q29 A;  4XMA A;  2E7Q A;  3HR9 A;  4Z2A A;  1K42 A;  5GLV A;  3DF0 A;  3VZJ A;  4QHB A;  3O1S A;  4PT6 A;  4AFB A;  3M70 A;  4C1X A;  4W6X A;  3ZYP A;  2F4L A;  1UY4 A;  3LOI A;  3LB9 A;  5C3S A;  5I0S A;  4DUX A;  5K9Y A;  3ILN A;  3HWJ A;  5LY2 A;  2WO7 A;  3PIJ A;  2BPA 2;  4DRR A;  3L9J T;  2J1S A;  3SH3 A;  3U1X A;  5B2G B;  1TEI A;  5J09 A;  3D3A A;  1QJZ A;  4CCK A;  2VQA A;  3ZSM A;  2DCK A;  1XQN A;  3LAG A;  2XVL A;  2UY8 A;  1YFW A;  4KGG A;  1E5S A;  1V6L A;  1G8W A;  4BH9 A;  4AQ6 A;  3TAY A;  1D0G A;  4Y5S A;  3UKT A;  3WZ1 A;  2AAC A;  2GC1 A;  1VBA 2;  5FBJ A;  2RM2 1;  3FBY A;  1XYN A;  2RJK A;  4C0H A;  2WUH A;  5C5T A;  5FY1 A;  4MXW B;  4JKL A;  1IS4 A;  5BY5 A;  4NIA A;  1OF3 A;  4IE4 A;  4J25 A;  2YBK A;  1U5X A;  3R4S A;  3LKJ A;  3GBW A;  5DPN A;  1PGL 2;  4JQT A;  2DCJ A;  4NWV A;  4CDQ C;  2VCA A;  5FPU A;  4R4Z A;  2OT7 A;  4ASL A;  1DF0 A;  1HRV 3;  3SCF A;  3MF6 A;  4IEY A;  1D4V B;  2GP5 A;  2Z5W A;  3ABZ A;  4Q0U A;  4I3P A;  1RUD 2;  1QJX 3;  1GWL A;  4AFM A;  4IGP A;  3ZXF A;  3AYD A;  1YJK A;  5EYY A;  1RUC 1;  3IPV B;  1ULF A;  4Y20 B;  3ZDV A;  2GN7 A;  3JZV A;  2VD7 A;  1XOY A;  2C9K A;  3AP9 A;  5IK4 A;  2D6M A;  4YZ5 A;  2VO5 A;  1QJU 2;  2VL4 A;  4MG2 A;  1RXG A;  4Q4X 3;  1WMD A;  3GBG A;  4BQ5 A;  2ZMN A;  3OYW B;  5F9T A;  2WT1 A;  3CBN A;  1RHI 3;  1OFS A;  2R6Q A;  4PIZ A;  3M2M A;  1RC6 A;  5FXV A;  3RI8 A;  4XEZ A;  1F2N A;  4NR1 A;  2IXI A;  3WR0 A;  1ND2 B;  1H6X A;  4HAN A;  5JXJ A;  2BGO A;  1WCK A;  4CEY C;  3IDA A;  5JR2 A;  2TUN A;  3WF1 A;  4EN0 A;  2YDE A;  1PM7 A;  1Y43 B;  2R32 A;  1JOJ A;  4UAP A;  2DVF A;  5JOZ A;  5LA0 A;  4AF9 A;  1NCQ B;  3MW3 A;  4MGY E;  2YMZ A;  1FPN 3;  1RJ8 A;  3T2P A;  1PVX A;  1SLL A;  3AKS A;  2KXL A;  1OMI A;  4A42 A;  5FZA A;  2P34 A;  1R1Z A;  3AMP A;  3ZDS A;  4QGN A;  2H6C A;  1OQ1 A;  1QJE A;  2HWC 3;  4QGM A;  5BUV A;  4OI4 A;  5HV0 A;  3VBO A;  1OH4 A;  4MO3 M;  1QEX A;  5C8C A;  4NIG A;  4JC1 A;  2W47 A;  1LOG A;  5FXX A;  2DDU A;  1AYN 3;  2VCM A;  4D8M A;  1KFX L;  1UU6 A;  5C4W A;  3W59 A;  5GZG A;  4H55 A;  3W9A A;  1WKY A;  4MHU A;  5BNP B;  1D0H A;  2PHT A;  2ATF A;  3WHT A;  2BDR A;  1I5P A;  1W6Q A;  1QJY 1;  1W3V A;  2JDK A;  2JG8 A;  3B00 A;  3QBQ A;  5E6H A;  2EXJ A;  1RUG 2;  1YI9 A;  2PLV 3;  3U4S A;  3HPN A;  4IXL A;  5FMC A;  2OW4 A;  3R0R A;  4B7K A;  5FLH A;  2D6L X;  2W91 A;  3GGL A;  1GOF A;  3PTY A;  1XBF A;  2EA7 A;  5DMY A;  3ASI A;  5FKC A;  1MS5 A;  3TN9 2;  4P9X A;  2VOK A;  1FAY A;  1W2U A;  1MZF A;  1W8H A;  1HN1 A;  4QD2 A;  5FYB A;  3VV1 A;  4FPY A;  3DCQ A;  3ZKU A;  2DFC A;  3OD4 A;  3RZH A;  2Q1Z B;  4V1P A;  4AED C;  1IKQ A;  3DUI A;  2FCT A;  3UJQ A;  1DYO A;  2HWC 2;  1WCS A;  2WO3 A;  3RZM A;  4YM0 A;  2XH6 A;  5HV4 A;  5IK7 A;  2EIG A;  3VZO A;  4YLZ A;  1OA4 A;  1BYH A;  2ZGN A;  3A22 A;  3IDE A;  3O0W A;  4DQA A;  4E2Q A;  1V9U 1;  4NHX A;  4Y22 A;  4AEJ A;  1DZT A;  1XRU A;  5M0T A;  3N3H A;  1DGR N;  1I3H A;  4LO4 B;  2V09 A;  2D6O X;  5FCC A;  3CJI B;  1DGL A;  1D2S A;  4ZU7 A;  2Y33 A;  3U75 A;  1UYP A;  2UYB A;  4LKF A;  4CU6 A;  3AYC A;  4L97 A;  1V70 A;  2FD8 A;  4OMC A;  3W5M A;  1VMJ A;  1S0E A;  2HWE 3;  2BOJ A;  2C9A A;  4COZ A;  1M4W A;  2VMI A;  3KCY A;  2RS3 1;  4JCK A;  5C8C B;  1PIV 2;  4QHO A;  1RVF 1;  3U78 A;  1MEC 1;  2ZXQ A;  3H3Z A;  3L2H A;  4WVW A;  2WFP A;  1ZA7 A;  3ATG A;  3SC7 X;  3N9N A;  4HON A;  2HWF 2;  1AXZ A;  4CDQ A;  1SCR A;  2D3S A;  4A6S A;  4I2O A;  1NCR C;  2GNB A;  1S2B A;  4TSV A;  1VBE 2;  2OXB A;  2XLF A;  2RG4 A;  1GNZ A;  1CON A;  2WII B;  4AHX A;  3ZYB A;  4LBN A;  2A3X A;  5LRS A;  1FMD 3;  4NII A;  2B7Y A;  2GMM A;  4AWD A;  3J7H A;  2BFU S;  1REF A;  2VBD A;  2Z79 A;  5GLZ A;  1IG0 A;  2E32 A;  2ZX2 A;  3GHM A;  3AYA A;  3H42 B;  4PF5 A;  4YPJ A;  2QQI A;  3ZYF A;  3BPZ A;  1SG3 A;  1WD4 A;  3VZN A;  5FZ1 A;  4AEK A;  4LLF A;  1HXS 1;  1QXR A;  1T2X A;  3TBD A;  5FY5 A;  2UYA A;  2WL1 A;  4JGZ A;  1QOO A;  4AVB A;  4ZPI A;  5FMO L;  4XUT A;  5FZM A;  4OZX A;  2A6Z A;  4M4P A;  1UO9 A;  1UX7 A;  2X5I B;  3PL0 A;  3T1M A;  4XFI A;  1US2 A;  4A41 A;  1C57 A;  1F15 A;  1HRV 1;  5J48 A;  1TVG A;  1UOG A;  4OI2 A;  4QXH A;  3RZK A;  1ASJ 1;  1VBA 3;  1OH3 A;  4KBZ A;  4AVV A;  1W9W A;  1UL9 A;  1V00 A;  2WZR 1;  1DDL A;  4WM7 A;  5FIX A;  5FTT C;  2Y6F A;  2WZP P;  3AK0 A;  4NAM A;  3VUO A;  4HPK A;  1AXY A;  3POS A;  4HOO A;  4RGA A;  1ENX A;  4XBQ A;  1AUY A;  4IL7 A;  1CPN A;  3I49 A;  1W8U A;  3GBF A;  1TZO A;  5C7G A;  3CNA A;  2QJV A;  1ZBE 2;  4G3Y C;  1NLQ A;  1RUI 2;  5E1R A;  5K4L A;  3HN3 A;  3KV4 A;  3ILF A;  1WA4 A;  2HYX A;  2XHN A;  3POI A;  4P08 A;  1C8M 1;  4L11 A;  2WLP A;  1J83 A;  2VZR A;  3ZSK A;  2W87 A;  1RUH 2;  1UPI A;  4MLO A;  1FT9 A;  3DPR A;  3RZZ A;  1WA6 X;  4FPO B;  2HWF 1;  4D6R A;  4XDP A;  3ELN A;  4JRL A;  5FOJ B;  5DAP A;  1MEC 2;  1DYK A;  3IZO A;  1AL2 2;  1QJF A;  2JDZ A;  2UWB A;  3MIH A;  2ZS6 B;  5GLW A;  4UOJ A;  5F5A A;  1G9A A;  3E6C C;  1VBD 2;  3IAP A;  3ILR A;  1W06 A;  3TYJ A;  2ZKL A;  1HX6 A;  2NQY A;  2ZGQ A;  2BZD A;  3RRD A;  1REE A;  1W0P A;  2DCT A;  1UXX X;  2DVD A;  5DUU A;  1UKR A;  3CJX A;  2A5Z A;  4BM8 A;  1F4H A;  1W6M B;  2X8K A;  1ASJ 2;  4I0B A;  4R52 A;  4COU A;  3ZVX A;  4AE2 A;  3HN1 A;  3WF4 A;  5BNO B;  1O4Y A;  1PGS A;  4FOW A;  4AOC A;  4BQY A;  2HH9 A;  2JDA A;  2WSU A;  2D5F A;  5FY7 A;  3WDT A;  5IT6 A;  1K3I A;  1XNC A;  3LCP A;  4QX0 A;  4AI8 A;  1W90 A;  2WS9 2;  3OD0 A;  1CAV A;  1RUF 2;  2RMU 1;  4RS5 A;  2XJR A;  5D8A B;  5G04 L;  3HEI A;  4B4Q A;  1ND2 A;  1SBE A;  2I74 A;  3KT4 A;  4YG6 A;  1W9T A;  2DV9 A;  3VD9 A;  1VPH A;  3ACH A;  1AR8 3;  1FX5 A;  3KSC A;  1BCX A;  1EY2 A;  2B45 X;  3HQX A;  3VD3 A;  4AHY A;  3EMR A;  1S0G A;  3CO2 A;  4YM2 A;  2XJS A;  3POF A;  1SLB A;  4IEX A;  4Y4Y A;  1YQ6 A;  2PAM A;  4HET A;  2IVJ A;  4XF4 A;  3RSJ A;  2GNT A;  2ENR A;  4R9D A;  5ACA 1;  4LTA A;  5HPO A;  4JGY A;  2JE7 A;  4QXC A;  4RD7 A;  4QT6 A;  4XE9 A;  5IVC A;  3WCS A;  1NKG A;  5ABJ B;  4QMA A;  1J3R A;  1GV9 A;  1PZ7 A;  1C8M 2;  2QE3 A;  5LW9 A;  2QQJ A;  1RVF 2;  2J22 A;  4OYU A;  1WME A;  1FV2 A;  4Q4Y 3;  4XDO A;  2FQP A;  1ZBE 1;  2BQP A;  4GWM A;  3ORJ A;  1J1T A;  1E57 A;  2VEC A;  4IE7 A;  4LKD A;  1G9D A;  4JVA A;  5EHD A;  2WYF A;  3ACL A;  1F8V A;  5T3N A;  3MYX A;  1SLA A;  2ZMK A;  4BK4 A;  4N8M A;  1WUV A;  3FL7 A;  4LIU A;  2K0G A;  2Q8E A;  3ZXD A;  3O5S A;  1SCS A;  2BEO A;  1VRH 3;  4DUW A;  2XB6 C;  1W04 A;  1MS0 A;  2X29 A;  1G9F A;  3X29 B;  1DLC A;  1AYN 2;  1ULE A;  1WW5 A;  2CY6 A;  3V65 A;  3J7M A;  4ZXE A;  1RB8 G;  2F6B A;  5JPM B;  1EYB A;  3E6B A;  2VUC A;  1TNF A;  2P37 A;  1BMV 2;  4IGQ A;  1N3O A;  1Z7S 3;  3WW1 A;  1WLD A;  3DGT A;  4XAB A;  3C7G A;  4D6Q A;  3BOD A;  4GZ9 A;  2NMN A;  2P3I A;  3S7I A;  3LZZ A;  2UWA A;  3KV6 A;  1V6J A;  2XOM A;  1AL2 1;  3IAQ A;  3BCW A;  3N9P A;  2QVS B;  3LF7 A;  2QDN A;  5A80 A;  3T1L A;  4ZHN A;  3SXW A;  2W52 A;  2GDF A;  2R30 A;  4G4F A;  2GN3 A;  4YG3 A;  3N7M A;  3OJB A;  3HJR A;  1WLT A;  3PIG A;  4FTB A;  4MHR A;  5FP8 A;  4EZH A;  1Q8V A;  5CFD A;  4FP2 A;  3LWC A;  2WN3 A;  5A32 B;  4M0H A;  3ZFE B;  2QQO A;  3VL8 A;  4BQ2 A;  2WNV A;  1VE0 A;  1XSQ A;  2D7F A;  4EN6 B;  1LED A;  4H2A A;  1OSG A;  2PHF A;  4U2A A;  4LA2 A;  3BOP A;  3NNG A;  4XJ8 A;  1A34 A;  2DFB A;  4IEP A;  2XQR A;  3CEW A;  2A70 A;  3UKV A;  1EAH 1;  1NCQ C;  3FX3 A;  1U0A A;  1OUX A;  1K45 A;  1EV1 1;  3AP5 A;  5BNO A;  3QAC A;  4GQ7 A;  1GWK A;  4MGI E;  4BXF A;  3JD7 1;  4YGE A;  5DAX A;  2YBP A;  2FDI A;  1JYT A;  4I3G A;  1QKQ A;  2VH9 A;  2CDP A;  4QU2 A;  2VVE A;  2YBS A;  5D2A A;  5ANN A;  5F2W A;  3ZR5 A;  1JXN A;  1WLC A;  3NAP C;  3WNP A;  3J7L A;  4IQP A;  2CV6 A;  1GKB A;  5DQ0 A;  4GB3 1;  2IZW A;  3HNM A;  2IXC A;  1YNA A;  2W0X A;  2CWM A;  2JE9 A;  2R06 2;  4K6B A;  4JHT A;  1JW6 A;  1LOC A;  4PLN A;  2HWF 3;  1OPO A;  1NAE A;  1ODM A;  3QCW A;  4IET A;  4PCR A;  1FYU A;  4COY A;  3EO6 A;  4NJ4 A;  4RHV 2;  1XU1 A;  2K46 A;  3LPG A;  3TOJ A;  4JKM A;  3KF3 A;  2E7T A;  3JCI A;  4Y33 A;  1GR3 A;  1MPX A;  5FYI A;  2GMP A;  4QX5 A;  4XZP A;  3KM5 A;  3FZ3 A;  1UPS A;  1W8N A;  3VKM A;  4JKK A;  1KJL A;  3LDB A;  1KJR A;  4XC9 A;  3K3O A;  3WG4 A;  4UT5 A;  5CU1 A;  1BQP A;  1TNR A;  2J1E A;  3LEG A;  1HV1 A;  1LGB A;  3OGV A;  1KGY A;  4WM8 C;  3ZXK A;  5FZL A;  1O5U A;  5B4N A;  4UFI A;  1AJO A;  3E6D A;  4BHP A;  2WWS A;  3ROU A;  2PN5 A;  3I3D A;  4AVC A;  4E4D X;  2JG9 B;  4I01 A;  2A1X A;  3ZPY A;  5IYY A;  1QQP 1;  3HNY M;  1RUJ 2;  2XHK A;  4NVP A;  2ZJC A;  3VBF B;  2BTV C;  1SBD A;  4HK8 A;  4QQ2 A;  5FZ9 A;  2CL2 A;  5CKN A;  4XIK A;  3M1H A;  1JYW A;  2BW8 A;  1COV 3;  2W92 A;  4QPG C;  2P6C A;  2OYZ A;  3I2H A;  4M01 A;  5FZF A;  1LNS A;  5FPX A;  1JOD A;  1W6O A;  3F95 A;  4LBQ B;  5TSW A;  4CP1 A;  1IKP A;  1W8Z A;  3NAP B;  5C3P A;  1V9U 2;  1X8M A;  3BN6 A;  3D0J A;  1Z78 A;  1ONA A;  3PVB B;  5CKQ A;  1H1I A;  1SPP B;  2ZEY A;  3HQR A;  4A3X A;  1CQ9 A;  4JGZ B;  5I91 A;  5JXI A;  2NLR A;  3O1U A;  1U5I A;  2JDY A;  2OQ7 A;  1O7F A;  4FPF A;  5CNA A;  1X7N A;  4P9G A;  5KHG A;  2Y6G A;  5KHI A;  4AI3 A;  4CXY A;  4PI0 A;  4AI9 A;  1TQ5 A;  1V6O A;  4RS5 B;  4S2D A;  1CAV B;  5ABJ C;  1VAV A;  4LBK A;  3MIB A;  3FMG A;  4Y5Z 0;  5ISL A;  1W0N A;  1CIY A;  3UJO A;  2R16 A;  3SNM A;  1G6N A;  4ISQ A;  2IUW A;  3VHP A;  1UMH A;  1PZ8 A;  3NQH A;  4B8E A;  2VOX A;  4LUM A;  5FR3 A;  2P17 A;  2A73 B;  1O3S A;  1RTV A;  4B4P A;  4RFT 0;  5L7O A;  3K4D A;  4FOY A;  1N1T A;  3B5L B;  1F31 A;  4MYE A;  4YZ3 A;  5EV7 A;  4ATE A;  4GKY A;  1EAH 2;  4GD4 A;  2QTW B;  1Y7B A;  1VBB 1;  2Q30 A;  1RUD 1;  1BBT 1;  1OD5 A;  2ZGR A;  4DEQ A;  4AGV A;  1NY7 2;  5D21 A;  1GQP A;  1XYO A;  1OC1 A;  1QXP A;  3B02 A;  1UX6 A;  1SHW B;  5IVJ A;  2DUQ A;  5IWF A;  3ZFG C;  3SIT A;  3CJI A;  4AW7 A;  4Q4Y 2;  4BA6 A;  3PME A;  4A3Z A;  4AVS A;  1PO2 1;  3FN9 A;  3MLL A;  5FFO C;  4C90 A;  2RR1 3;  3AKP A;  5CBL A;  5I0U A;  1DQ5 A;  1IPK A;  1COV 2;  4RQP B;  1LAJ A;  3I97 A;  1R08 2;  2CSG A;  4Z07 A;  3WW3 A;  1KRI A;  4KL1 A;  1AR6 2;  4CXW A;  3CF6 E;  3MLJ A;  3OTF A;  3MV1 1;  4HT1 T;  3P1I A;  4EZ4 A;  3WT3 A;  2AGS A;  1K5M A;  1W8T A;  2CAV A;  1GZW B;  1W6P B;  4UW4 A;  3T09 A;  5C70 A;  2BJS A;  3O1O A;  1PX4 A;  4IE6 A;  4XUQ A;  4CE8 A;  3SIS A;  3V0A A;  3Q8B A;  4CCL A;  1SFY A;  3MLK A;  1CIW A;  1YI7 A;  4HPK B;  3OCP A;  1PX3 A;  4UFL A;  5HXV A;  2J1T A;  2G9F A;  2XON A;  5FZI A;  4HVR A;  1U12 A;  2QCS B;  2G1M A;  4PIX A;  4TXW A;  1VIW B;  4Y4R A;  5F3C A;  2JDH A;  1JYX A;  3N35 A;  3J4U H;  2Y6K A;  1VRH 1;  2YPD A;  2WDB A;  4IE0 A;  5FBZ A;  3WNM A;  2AC1 A;  3RQ0 A;  1ZNP A;  2K2S A;  2WYS A;  4FFI A;  3VBH A;  2XBO 2;  1MQT C;  4FFF A;  3R6S A;  1H2K A;  1A8M A;  4Q4V 2;  4EJR A;  1RMU 3;  1W28 A;  1IG3 A;  5KC5 A;  4CDX A;  2VM9 A;  4JDM A;  4NID A;  2WA3 A;  4O61 A;  5FP4 A;  3D8C A;  2VZ3 A;  5FLI A;  1IS5 A;  4B3N A;  3CZJ A;  3V0A B;  1UZY A;  1GQG A;  1NA1 B;  3KT7 A;  3R4U A;  3UET A;  2P2K A;  5EJ3 A;  5FV3 A;  1D7P M;  4JZR A;  4FAG A;  3IDC B;  4KG0 A;  3PU3 A;  3UGG A;  1GMM A;  2IXH A;  1KFU L;  2OA2 A;  2VMF A;  4NRP A;  1A3K A;  2VUJ A;  2JDU A;  4LHS A;  5D1I A;  1SLC A;  3VBR B;  1SEF A;  3C8X A;  5ANQ A;  3ZYH A;  1H8V A;  5CEH A;  2V72 A;  1AX1 A;  2B46 X;  4K1Y A;  4Z1V A;  2XGX A;  4PLM A;  1JOB A;  3MUY 1;  4CU7 A;  3DPR C;  5FOB B;  4CEW A;  2ZAC A;  3ZYI B;  2A6Y A;  4BK5 A;  2I07 B;  4PDW B;  4HVQ A;  4QQO A;  3KMH A;  3HVD A;  4QDR A;  3U14 A;  1UZZ A;  2IXK A;  2R06 1;  4FPH A;  4NPL A;  4Q0Q A;  5CFC C;  2HBU A;  4IV1 A;  1H4H A;  4BDV B;  2IC1 A;  2UWC A;  5LRR A;  3RNS A;  4A2U A;  4WVM B;  4N43 C;  3JU9 A;  4XUR A;  4FTE A;  2ES3 A;  3GXU A;  1GOG A;  1CES A;  3IKW A;  3IPV A;  4JQR A;  3MID A;  1QHD A;  1H0B A;  5L7O C;  4FFG A;  1VBE 3;  1JS9 A;  3BIW E;  5C3O A;  2IWG B;  4CYD A;  2R0H A;  3H50 A;  4OZO A;  5LWB A;  4X8N A;  2VPV A;  4WVV A;  2ZX4 A;  3WG1 A;  2WT0 A;  1STM A;  1NCR A;  3IT8 A;  3L2Y A;  3ME2 A;  4XQD A;  5FZB A;  1RUJ 1;  1YIP A;  2E6V A;  2A75 A;  4AL9 A;  5JWP A;  3WP6 A;  5FYS A;  3PUR A;  2JX9 A;  4NIH A;  2P3J A;  4DO0 A;  2FDK A;  1N1S A;  1SPP A;  2ETE A;  3E5U A;  4PQQ A;  3ZN6 B;  1X50 A;  4YVW C;  1VBB 2;  4KBB A;  5CB7 A;  4NHK A;  4ARY A;  4H7L A;  3KS7 A;  2XWB B;  5C3R A;  2EIC A;  1HJF A;  5FP7 A;  3OGS A;  5F3E A;  2VTF A;  5F5Q A;  1HDK A;  4O9G A;  2XXZ A;  3EHK A;  3KHB A;  2R04 3;  3CZU A;  2A6X A;  4HL0 A;  4ZXK A;  4CDU C;  2RM2 3;  1VMF A;  5CAZ A;  4W4Z A;  2BGP A;  5CKM A;  1VR3 A;  2XL9 A;  3OUJ A;  4FPL A;  1C1F A;  2YC4 A;  3BGA A;  4IV3 B;  3VBF C;  3N4M A;  4FP3 A;  3WP4 A;  3NW4 A;  3GDB A;  1H8T B;  2DYC A;  3FLP A;  2HWB 2;  5A1A A;  1US3 A;  1GZW A;  1CAW A;  2DTW A;  1BMV 1;  1UOJ A;  4WM7 C;  1E5H A;  3NJZ A;  1YUD A;  1UD1 A;  3M3Q A;  5IVF A;  1HB4 A;  1YFY A;  4FPE A;  1DQ2 A;  1PO1 2;  2XJQ A;  4CP9 A;  2VXR A;  1MQT A;  3HT2 A;  3PHM A;  1W8F A;  4LPL A;  1PO1 3;  5GM0 A;  3POJ A;  1WWY A;  5FP3 A;  4C1W A;  1KDK A;  5A7S A;  1H2L A;  4WVM A;  5IVY A;  5IVE A;  2OX0 A;  1PHM A;  5KHJ A;  2O8Q A;  3VDD A;  1RUF 3;  2WJS A;  1AR7 1;  3GAL A;  1S2E A;  1G86 A;  3FLT A;  3JB4 C;  4LA3 A;  4QU1 A;  5FYM A;  4BIS A;  3R4D B;  1ENS A;  3GF6 A;  2R07 2;  1NXD 1;  5I8Y A;  3SEP A;  4FXG B;  2DUO A;  5F39 A;  4Q4X 1;  1AR9 1;  3P3N A;  5APA A;  3AVR A;  4P9L A;  3WDY A;  3C2U A;  2VUD A;  4A6O A;  4F83 A;  1H6Y A;  2ZOE B;  2WQ4 A;  2GME A;  1N3Q A;  1S0I A;  3B93 A;  2DTY A;  3ECQ A;  3LQC A;  1FAT A;  2RS1 1;  5FMB A;  2L9L A;  4A44 A;  4XF1 A;  4CPB D;  1JBC A;  3O14 A;  4QPI C;  4CCD A;  2ARB A;  3BUC A;  1W8W A;  4HSL A;  5LAS A;  1OQE A;  2G4I A;  3DYM A;  2C0Z A;  3UYJ A;  1S4C A;  1ZZ9 A;  5FWJ A;  4FI9 A;  2HKX A;  4J6G A;  4EE2 A;  3B7M A;  4HSJ A;  4DXT A;  1CZS A;  3I3B A;  3Q8C A;  3VHO A;  2ARC A;  1MEC 3;  4YYO A;  1JZ5 A;  3AYE A;  4ET7 A;  3MBW A;  4TZD A;  1DQ0 A;  2NP0 A;  4X6R B;  2WS9 1;  1B35 A;  5F5C A;  4IV3 A;  3OY8 A;  5J3U A;  3NKG A;  1PVC 3;  1QJU 3;  4CDX B;  1DU3 D;  3ZMO A;  1S0F A;  4XPV A;  1FMD 1;  2DU0 A;  1AYN 1;  2VC9 A;  5I8T A;  5L9B A;  1GZ9 A;  1QDO A;  1W6O B;  5EQU A;  2JG9 C;  2G9G A;  1WBL A;  1ZZ7 A;  1LES A;  3S30 A;  1RED A;  1LTE A;  1YO8 A;  4Q2F A;  4Y3O A;  4OI1 A;  1YYN A;  2VUA A;  1XE8 A;  3AKQ A;  2JJ6 A;  3N7J A;  4Z8B A;  4AFC A;  3H8O A;  1QJX 2;  1RUD 3;  2DF7 A;  1BKZ A;  3TEW A;  1FI2 A;  4COW A;  3OBR A;  5EXO A;  3WDW A;  2LW8 A;  1HRI 2;  1VBD 1;  3M3I A;  3VBO B;  2AUY A;  1DYP A;  4D7Y A;  5JZG C;  1ZRE A;  2CTV A;  3WIN E;  4YM1 A;  2HEW F;  2FMD A;  2ZGL A;  2MEV 2;  1QMJ A;  1UIK A;  3BPS A;  2OS2 A;  3BTA A;  1RUE 1;  2ARE A;  2R06 3;  2WO2 A;  3B9I A;  3I3Q A;  3I2K A;  1PMH X;  4GA9 A;  4SBV A;  4FTS A;  1QJY 2;  2LRP A;  3ALQ A;  2CGN A;  2VNO A;  4K8R B;  4GH4 A;  4YVW A;  2Q8O A;  1N1Y A;  3AZV A;  4YFW A;  1OQD A;  3MIE A;  4CEY B;  3KWV A;  4R8H A;  4XJW A;  3LA3 A;  4YZ4 A;  4CCN A;  1WW6 A;  3AMH A;  2R1D A;  3B01 A;  3ST7 A;  3S5Q A;  1R09 1;  1Z7S 2;  1S0D A;  1ULP A;  2GH8 A;  3WW4 A;  2RMU 2;  1W9F A;  1AX0 A;  2IFR A;  2AEY A;  4IEU A;  4Q27 A;  1BVP 1;  2HWD 3;  1JH5 A;  4OHY A;  4Y1X A;  2VZP A;  3PMS A;  5IAV A;  1MZ6 A;  4AG4 A;  4JGY B;  2Y34 A;  3III A;  5F6K A;  1XE7 A;  2RS3 3;  1RMU 2;  4JGZ C;  4Q4V 3;  3VDA A;  4A7K A;  3MPP G;  4XVH A;  3RYP A;  5J7M A;  5AC9 1;  1JYC A;  2XJU A;  4UFM A;  4XF9 A;  1ALY A;  4FXK B;  1LEN A;  4AYU A;  3VN4 A;  1L7R A;  4XXA A;  5A7W B;  1BK0 A;  1OA3 A;  2VVF A;  4E8D A;  5D8A A;  5C5U A;  1HW5 A;  4AZZ A;  5JAX A;  5T5P A;  1UN1 A;  1UW8 A;  2VMH A;  4PIY A;  4ISR A;  2WKK A;  2P3Y A;  4IGO A;  1PMI A;  2DVA A;  3LDK A;  3MDP A;  3MGU A;  4LT5 A;  1DQ4 A;  1MVQ A;  3U0Z A;  1Q43 A;  5LBC A;  1OD3 A;  2V5D A;  5FPZ A;  2WBK A;  3T2T A;  5C4W C;  1JYV A;  3AJZ A;  3NNF A;  4IEW A;  3RZJ A;  1DLL A;  3OPZ A;  1VBE 1;  1YQ8 A;  2VCB A;  3O1T A;  4KNC A;  5ACA 2;  3ACI A;  4XZU G;  5A33 A;  1GP4 A;  4X8P A;  1RXF A;  1QDC A;  1W6Q B;  1XND A;  1TME 2;  3J8F 1;  4FQ4 A;  4MX3 A;  4IV3 C;  1GAN A;  1NQJ A;  3T3Y A;  5BNO C;  4EQV A;  4OUL A;  4QPI A;  2BBA A;  3PVE A;  5FQ0 A;  1XNB A;  3ZKY A;  2EAA A;  2EIE A;  3DEM A;  4WZC A;  1XNK A;  2RVA A;  4BZ4 A;  1KEX A;  1CWP A;  2JG9 A;  3LD8 A;  3SMH A;  4ES9 A;  1Y9G A;  5DXD A;  5LA2 A;  1AZD A;  4O9E A;  1CJD A;  2WZR 2;  5FY9 A;  1GQH A;  4UBH A;  4IE5 A;  2H0B A;  2XQX A;  5FO7 B;  3USU A;  3T0D A;  2RHP A;  4LE4 A;  1QF3 A;  2UU8 A;  1ASJ 3;  1VBA 1;  3I59 A;  3VD4 A;  2W1U A;  2PA7 A;  4YM3 A;  1GNH A;  3NRU A;  1SDD B;  4L8Q A;  5JSO A;  2RV9 A;  5JMC A;  1FXZ A;  3VD5 A;  1YFU A;  5KC6 A;  3HD8 B;  3WNN A;  3T2Q A;  1FOD 3;  5DAW A;  4ZZ5 A;  4E27 A;  4BIF A;  2CAU A;  2JKB A;  3VZM A;  1JYI A;  1FPN 2;  5F37 A;  5A3O A;  5T52 A;  4S2H A;  4XW3 A;  2ZGU A;  2XML A;  1TME 1;  2YGL A;  2ZGM A;  4ASM B;  3MHZ A;  1LOD A;  2E31 A;  4E4S A;  4LOT A;  2J7M A;  1ZBA 3;  3BTZ A;  5C33 A;  2Z69 A;  3BI3 A;  2HWB 3;  4P5Y A;  4KU8 A;  1ULG A;  4ES8 A;  4LO8 A;  1GOH A;  5DAB A;  5IJR A;  1GBG A;  3CU7 A;  1H2N A;  4CDX C;  2YV8 A;  3OEA A;  3PUA A;  2ZHK A;  4GH4 C;  1SLI A;  2XJT A;  4PLO A;  4QWN A;  4LHK A;  5I93 A;  3KVB A;  1W03 A;  5SV5 A;  1NQD A;  2A6V A;  5FPL A;  2VR4 A;  5FZG A;  2ZGO A;  1BVV A;  4LE3 A;  4LR4 A;  3HT1 A;  3VBR C;  3H3U A;  3OUH A;  3DKQ A;  1CR7 A;  2PMW B;  1B35 C;  2PQQ A;  2RS1 3;  1UU5 A;  3AP7 A;  1VBD 3;  3GZT B;  3MPB A;  2VME A;  1TG7 A;  4FOQ A;  4PBP A;  5EJ1 B;  3WDV A;  3POY A;  1ZZC A;  1PO1 1;  4YFZ A;  4P14 A;  3GZU C;  2XLA A;  4NO4 A;  1RUO A;  4RHV 1;  4XCB A;  4LXL A;  2DUR A;  5GLT A;  3EBR A;  2WQZ C;  3NV1 A;  5KHK A;  1JTZ X;  3BTX A;  4LO6 B;  4LHN A;  3T4V A;  4QQH A;  1TMF 3;  2KD7 A;  3CIH A;  3H8U A;  4LLO A;  5FQ0 B;  3WDX A;  3TEX A;  2YYO A;  3VHR A;  2OUJ A;  5LBE A;  3PJQ A;  4N43 B;  4YAR A;  3THP A;  2ET7 A;  5G05 L;  2LM3 A;  1QJU 1;  2TBV A;  4LUK A;  3UES A;  3AKR A;  1AR6 1;  4NAO A;  3CQO A;  4LNV A;  1CAX B;  4LBL A;  5DUW A;  5HCF A;  4WV8 A;  3FHA A;  3SLI A;  4AI1 A;  3VBS A;  2ZCW A;  3EQE A;  2QDR A;  4P9W A;  2W95 A;  1PNG A;  1IS3 A;  4HVO A;  4Q4Y 1;  2WN2 A;  3THT A;  2P4E A;  5FYT A;  2WLQ A;  4HK9 A;  1JN2 P;  4IEV A;  3RG0 A;  1MS9 A;  1O8P A;  2BP6 A;  3I7D A;  2VBP A;  4IUG A;  4IV1 C;  1CAU B;  2VZU A;  2YUE A;  5F7U A;  4N53 A;  1AHS A;  2LTN A;  4BIO A;  2Z4F A;  2CDO A;  2WFF 2;  1WMF A;  4FCA A;  4D7T A;  5ERL A;  4ERO A;  4JDN A;  5KBF A;  1PGL 1;  3RS6 A;  1U5Z A;  1HJG A;  1EP0 A;  5H9P A;  1GNY A;  1IQA A;  1R1A 1;  4CDU B;  4F3J A;  1OLM E;  4H14 A;  1MS1 A;  4B7E A;  2O8O A;  4DXR A;  2BGC A;  2B5H A;  4HZF A;  3LIG A;  4MSV A;  1RUC 3;  4YW7 A;  3UL2 A;  4JRA A;  3ON7 A;  4CCO A;  2MPF A;  3FFQ A;  3IMM A;  2ARA A;  4UI9 L;  4YWA A;  3DYP A;  3PDQ A;  4E4Z A;  1AYM 3;  1D4M 1;  2PHL A;  4AK3 A;  2VOW A;  1DQ1 A;  2VZO A;  2PXJ A;  3ETP A;  3GCW A;  5FYY A;  3VKN A;  4CUB A;  5T50 A;  5LB6 A;  4FO9 A;  4TYS A;  5FUP A;  4BE3 A;  4XUN A;  1J58 A;  4P5H A;  4Q4W 3;  1R09 3;  5DZG A;  5E16 A;  4AGG A;  2WT2 A;  4CP0 A;  1ZBA 2;  1UU4 A;  1YXW A;  5C8C C;  1BEV 1;  4RA0 A;  3IDB B;  2W94 A;  3N7L A;  4UFH A;  5FPB A;  1OLQ A;  1DIW A;  3INA A;  4I0A A;  4GMP 1;  4M3C F;  4IEO A;  2O14 A;  3BKZ A;  1NT0 A;  1MQT B;  2FHR A;  1O3Q A;  1BHG A;  1HLC A;  5FLJ A;  2ZHM A;  1GFF 2;  1B09 A;  1LGC A;  2WNU A;  1KQR A;  2JD4 A;  3N9O A;  2HJI A;  1MS3 A;  1POQ A;  3SQO A;  3OGJ A;  3ZYJ B;  4OUE A;  1HIX A;  2OZJ A;  4TN7 A;  2Q0A A;  4LEJ A;  4KWU A;  3LIH A;  2XVK A;  4EWE A;  5FYC A;  4GUL A;  4AAX A;  1LU2 A;  3VL9 A;  1WCQ A;  4XJU A;  5CG8 A;  4OLL A;  1AR9 2;  3QH7 A;  3I2I A;  2WFF 1;  5IVV A;  2EAK A;  3O1V A;  2D6N A;  1G7Y A;  4MOA A;  4XFF A;  3LDR A;  2VZS A;  4BMB A;  5JOY A;  3MFA A;  4QPI B;  3JBG 2;  4FBF A;  1OBN A;  1R08 3;  1AF9 A;  1NLS A;  4QKF A;  5C6C A;  2GZW A;  4QKN A;  1URX A;  5FK8 A;  4JDO A;  4UF0 A;  2WNE A;  3DPR B;  5H9R A;  2UY9 A;  3JB8 A;  4CPB A;  5CFC A;  3V56 A;  3JXS A;  4Q5O A;  2EVX A;  5HI0 A;  2ZHL A;  4OHZ A;  4XET A;  3ZN6 A;  1MS8 A;  1XPW A;  2VMG A;  3LEI A;  3PUI A;  2B8M A;  2KR2 A;  1PZ9 A;  2V4V A;  3MI8 A;  4QXB A;  5FY4 A;  1RUG 3;  2PLV 2;  1RHI 2;  4N7I A;  3WQB A;  1T6B X;  3FFZ A;  4QX7 A;  2HWB 1;  3HBZ A;  2TNF A;  5EP9 A;  5JI7 A;  1WCU A;  2BU9 A;  2FZ2 A;  4GB3 2;  3KB5 A;  1RIR A;  3ZIW A;  5KXE A;  4YGC A;  1LGN A;  5IK8 A;  3VD7 A;  4QDQ A;  3C7O A;  4XXP A;  5DUX A;  3WX5 A;  5FY8 A;  2NMO A;  3SHR A;  5SV8 A;  2VAU A;  5IVB A;  5KR7 A;  2BWA A;  3GZA A;  2QZ2 A;  5BNP A;  1EV1 2;  3NJV A;  4TTG A;  1XSR A;  2Q8C A;  2GH2 A;  3K75 B;  2DBI A;  2QQL A;  5AVP A;  3BVC A;  1CVN A;  5CIS A;  4QB1 A;  3VLB B;  1QY4 A;  1YRZ A;  5T5J A;  3PLQ A;  1W3X A;  2GND A;  3I2O A;  1PNF A;  4LBM A;  2MNG A;  1BBT 2;  1UY2 A;  2JIC A;  3VBU C;  5IW0 A;  1LHV A;  5AVA A;  1POV 0;  3RWN A;  3P5B A;  4QX1 A;  2WZ8 A;  4AED B;  3C3V A;  3IMN A;  1TME 3;  2G9Z A;  2VTX J;  3JUU A;  4CUC A;  5FPA A;  2VOT A;  4ORF A;  4NN0 A;  1HB2 A;  1PM4 A;  3LSE A;  5A6Q A;  2FZ1 A;  1DP0 A;  3RJR A;  1QU0 A;  2DBN A;  5I0T A;  1UZV A;  3WQ7 A;  4DFS A;  2R7E B;  1T6G C;  2BFU L;  1ULC A;  2AEN A;  2WZE A;  1CAW B;  2VNV A;  3AVS A;  3B69 A;  4CDQ B;  3GNE A;  1FPN 1;  1O8S A;  4OMD A;  1H8T A;  2D43 A;  4AR2 A;  4Z82 A;  2ZA9 A;  1UAI A;  3D82 A;  3WP3 A;  1DGW A;  1WW4 A;  5A3M A;  2W1W A;  5JDB A;  4RYD A;  4Q8K A;  1M06 G;  1GIC A;  1O59 A;  2DWR A;  3OYW A;  5A6Z A;  5AFE A;  2CYF A;  5H9S A;  3NV4 A;  4QQP A;  1ULO A;  1XNT A;  1YQC A;  2E53 A;  3W58 A;  4JGY C;  4LK6 A;  1V0A A;  3H3L A;  1D2Q A;  3U11 A;  1F4A A;  2R1B A;  3NV2 A;  4N9H A;  3BIE A;  2YXS A;  3SH5 A;  3H0O A;  5AC9 2;  2XKO A;  3ES4 A;  3Q8F A;  4Q8L A;  3OGG A;  2A7A A;  2VY0 A;  3RDI A;  5F32 A;  3QOP A;  3THD A;  2B4K A;  4CUA A;  2A3Y A;  2D6P A;  2BVV A;  4HN0 A;  1BK1 A;  4XBL A;  4BPZ A;  1OUR A;  4HMZ A;  3C7H A;  2WWJ A;  3R05 A;  1DG6 A;  1HQW A;  2Z2S B;  1W6P A;  3HOB A;  1NLR A;  4A4A A;  5BYN A;  4QPY A;  3PJY A;  4XHX A;  4DOU A;  3U10 A;  4K3U A;  3BYW A;  1WGP A;  4MXW A;  4BQ3 A;  1PVC 2;  3NJY A;  2XKP A;  3OUI A;  5CFC B;  5J1X A;  2PQS A;  3G6J B;  5A3L A;  2XG3 A;  4LO7 A;  3TNQ A;  2RE9 A;  1S0C A;  3SCH A;  2JG8 B;  2OPW A;  2IVI B;  2WAA A;  1Y3T A;  3KV9 A;  3AMN A;  1GSL A;  4BYY A;  2VW2 A;  4P9J A;  3J9S A;  5LA9 A;  5CZK A;  3WP5 A;  2HEV F;  3MO4 A;  1SAC A;  2OUH A;  5EJZ B;  2VTX A;  1DCS A;  4EYU A;  3JQX A;  4KWJ A;  3M3C A;  1BXH A;  1VBC 2;  2J1V A;  1QGL A;  4GAZ A;  2Y60 A;  3VDD B;  1I6X A;  2D44 A;  4BU2 A;  3T30 A;  1GP6 A;  1L3J A;  3KLS A;  1R1A 3;  3ZSJ A;  1XXN A;  2DVB A;  5J36 A;  5JI9 A;  1D4M 2;  1UY0 A;  3OEB A;  1CZT A;  4J1W A;  4XUO A;  4P9I A;  4R9C A;  5FPV A;  3URF A;  3WDU A;  3WXP A;  5JMO A;  1XU2 A;  1L7L A;  1GP5 A;  2Y0I A;  2W46 A;  3NNL A;  2JD9 A;  4GH4 B;  5JPN B;  5L9V A;  2RS5 2;  3HIF A;  2HEY F;  3V0B B;  1HXS 3;  3KT1 A;  1AYM 1;  2Y6H A;  3AX4 A;  2HWC 1;  4QXK A;  2PTM A;  5GZC A;  3ZOI A;  5A3W A;  1UMZ A;  2ARX A;  3BOW A;  3NVC A;  3H1Y A;  4NHM A;  2BBV A;  3LE0 A;  1F5J A;  2CWS A;  2YFU A;  4QPW A;  1BZW A;  2K9Z A;  5DAV A;  4EWA A;  3O1R A;  3TN9 3;  2GC3 A;  5F3G A;  3AL5 A;  4MXV A;  3UKN A;  1GZT A;  5HBA A;  1X36 A;  4ZS3 A;  4A45 A;  1O91 A;  4GJZ A;  2BV4 A;  3ZFG B;  4XQW A;  1POV 1;  2QQW A;  4UW3 A;  5LY1 A;  1BJQ A;  4CXX A;  3LFM A;  4HFS A;  1RUI 1;  2C5D A;  2LS6 A;  3ZFF A;  1C4R A;  4BXS V;  2QQM A;  2Q8D A;  5FRA A;  2R07 1;  4EN9 B;  2XLG A;  3I2J A;  4CU9 A;  1X82 A;  2WC2 A;  2WZR 3;  1C8M 3;  3ZXG A;  2DUP A;  4YRD A;  4BB3 A;  1CX1 A;  1OXC A;  5A1F A;  1O5L A;  1NCR B;  5BNQ A;  2UUR A;  3O1P A;  2P3K A;  4K8F A;  1K5M B;  5FXW A;  1AYM 2;  2C24 A;  5CFD C;  1V6I A;  3ZYR A;  3U4X A;  2OPK A;  4CA9 A;  3KGZ A;  4CCM A;  1I1E A;  4L99 A;  2ZAH A;  2ZZQ A;  1YCI A;  1Y9Q A;  2YHJ A;  3FUQ A;  2VMC A;  3NJX A;  4ITC A;  1XJA A;  3FLR A;  3MEP A;  4YVS A;  3ZXA C;  4XQ4 A;  2D5H A;  2AR6 A;  3WUC A;  4UWD A;  3NKT A;  3O7O A;  4JHZ A;  4ONU A;  4GAL A;  1VBC 1;  1RUJ 3;  2BER A;  2WRA A;  2VXJ A;  2WFF 3;  3TB0 A;  1R09 2;  1Z7S 1;  4Q4W 2;  2RS5 3;  3BU0 A;  4S2G A;  3I3E A;  1QQP 2;  1DZR A;  4N9I A;  4M3C B;  3OG2 A;  3QH6 A;  1JHJ A;  4GWJ A;  1N3P A;  3K46 A;  2E9Q A;  4PDW A;  4HKL A;  4AVT A;  4DRV A;  1K12 A;  2XVG A;  3POW A;  2LUW A;  1QXJ A;  3IB3 A;  4IW3 A;  4AEM A;  4AQ2 A;  3RZL A;  1J3Q A;  1VB2 A;  5F8P A;  3WF3 A;  3AKT A;  3D0S A;  1YQ2 A;  1RUE 2;  4NOT A;  5BXX A;  2YU2 A;  5HXM A;  4Z92 B;  4EWD A;  1UOF A;  1RYY A;  3KHC A;  3UGH A;  1OT5 A;  2GAL A;  2YC0 A;  5C71 A;  2RS3 2;  3QD6 A;  4SLI A;  4XHB A;  1LR5 A;  1JHN A;  2BYV E;  2WIN B;  1U5Y A;  1UIJ A;  4BWO A;  5A70 A;  2VJX A;  2QBX A;  1RUF 1;  5LBB A;  2QQV A;  1Q3E A;  2D97 A;  5DUV A;  1L7Q A;  3ZXL A;  4BQ1 A;  4GIQ A;  3ZYG A;  1W2N A;  3ZLI A;  4C0B A;  2FBE A;  1J3P A;  3KQR A;  4XTP A;  3WF0 A;  2C4X A;  2ADD A;  2J1A A;  3PUQ A;  4LUL A;  5JZG B;  1ST8 A;  1ZBE 3;  1UWW A;  1FMD 2;  4M4R A;  1YWK A;  1VAM A;  5A7P A;  4UXA A;  1N1V A;  1DFQ A;  4DEV A;  1N47 A;  4KH9 A;  1ZRD A;  1APN A;  1AR7 3;  1W05 A;  3M3E A;  3RMX A;  3RWK X;  3VBF A;  1O6U A;  4K9S A;  3N36 A;  1JUH A;  3AZY A;  2R49 A;  4YGB A;  5LZ6 A;  1UYX A;  4JTN A;  4M00 A;  4AAP A;  4D0Q A;  2GNM A;  4DIN B;  3D5O A;  3O12 A;  5JXG A;  3AP6 A;  4PBO A;  5A7Q A;  1DGR A;  1W9S A;  3ZXE A;  1VLN A;  3ZR6 A;  3KVA A;  3K4Z A;  2VE1 A;  3LPF A;  1IPS A;  2RS1 2;  2CGP A;  2Y6J A;  2ADE A;  5EIY B;  1CX4 A;  4W6W A;  3UV9 A;  4UF0 B;  4XIL A;  3VDD C;  3WVJ A;  2Q1M A;  5FZ0 A;  1OUS A;  2VZ1 A;  1SZB A;  4IER A;  2OVU A;  3I2D A;  2V73 A;  4CDW C;  5JOX A;  4NRO A;  5LEK A;  3ITQ A;  2N7G A;  4QKD A;  4LQR A;  4JV4 A;  4XTM A;  1H9P A;  4Y26 A;  3FUO A;  3IWZ A;  4GWI A;  2RR1 2;  5ABJ A;  4CVU A;  2XBO 1;  3A21 A;  5FZD A;  2FDH A;  3EJK A;  4YVS C;  5BPX A;  1VRH 2;  2Q4S A;  4AHZ A;  4OCT A;  4W50 A;  1H2M A;  1KIT A;  2GC0 A;  2W08 A;  2WO1 A;  2ZEX A;  3OF1 A;  1UYY A;  4OUM A;  2YG0 A;  4FOV A;  4QX2 A;  2OKX A;  4DUV A;  3BAL A;  3IBM A;  2WSV A;  1EAH 3;  1LHN A;  4M3C E;  3WEZ A;  1UZW A;  4XAC A;  5C3Q A;  5IK5 A;  2FMY A;  4DPN A;  2VW0 A;  5IUQ A;  2WNV B;  4XAA A;  1UNB A;  2ZX1 A;  3MIC A;  5A7W A;  4F8A A;  4YW2 A;  2VCC A;  4Y5T A;  1K5J A;  4NPR A;  1ND3 A;  1ZZB A;  2NN8 A;  4QKB A;  3UGF A;  1W99 A;  5ACA 3;  5C9A B;  5IAX A;  1J59 A;  2W5F A;  4H7M A;  1UZ0 A;  4QX3 A;  2B9U A;  1NA1 C;  1O3R A;  3I2F A;  2Y6L A;  2XR4 A;  4H3W A;  3LA2 A;  3IN9 A;  1GYK A;  4LBQ A;  1A6C A;  4DMI A;  4LIV A;  4MAD A;  2JIJ A;  5CAD A;  3T4H B;  1SFN A;  1AR8 2;  1V6N A;  3DYO A;  1NE4 A;  3JBG 1;  3G7D A;  2JB8 A;  3OOX A;  1EPZ A;  3ZM8 A;  1KDM A;  3WG3 A;  3B3Q E;  5L36 A;  2JWP A;  4AFD A;  1C3H A;  1I5Z A;  1CN1 A;  2PHW A;  1S0J A;  1K5M C;  2IXL A;  2YZ4 A;  4FT8 A;  1JZ6 A;  4XFB A;  4CUG A;  1QJX 1;  3LEM A;  4RS5 C;  1MVE A;  2IFW A;  2IXJ A;  4YVS B;  4NRM A;  3RVH A;  4CEY A;  3DXU A;  3VKF C;  2NZ9 A;  2VZT A;  4YVW B;  2RS5 1;  2PHX A;  4B1M A;  2TEP A;  3MUZ 1;  5F1R A;  3VBS B;  4C91 A;  2VU9 A;  3W5N A;  2RM2 2;  2HYK A;  1O4T A;  2VUL A;  4LBQ D;  2V5Y A;  4YW3 A;  1AVB A;  3Q9O A;  4BLI A;  4CTE A;  1W8O A;  4DY5 A;  5KXB A;  1IQD C;  2YPJ A;  3M3O A;  5FZH A;  2WR9 A;  1BEV 2;  4ZU5 A;  1HN0 A;  4XJ9 A;  1MZE A;  2LAL A;  3DN7 A;  3OBZ A;  4QB2 A;  4XDQ A;  1YEW A;  3C7F A;  1R64 A;  4LOR A;  5F2S A;  3SKV A;  3KF5 A;  3J8F 3;  1UYZ A;  4BOW A;  2ILM A;  3AZX A;  4LKS A;  4XF0 A;  3I4I A;  4D7S A;  3LGR A;  5JCT A;  1W0O A;  2GAU A;  4AVA A;  2NM1 A;  1MZ5 A;  3KGL A;  5FK7 A;  4W6Y A;  3RJ2 X;  4CEW C;  5LA1 A;  1JZ4 A;  1RIT A;  2Q1F A;  3RYK A;  2D3P A;  3U07 A;  4LKE A;  4RHV 3;  3B9C A;  4Y1Y A;  4KMQ A;  4PI2 A;  3Q8E A;  3W21 A;  5J37 A;  4RN5 A;  1RUI 3;  3P3P A;  1TMF 1;  5C9A A;  1B35 B;  1PO2 2;  2CNA A;  4A7Y A;  4YNI A;  5IHR A;  5GZE A;  5D8A C;  4LK7 A;  1QOT A;  3J26 N;  3PNA A;  1NXM A;  3CDZ B;  4RL7 A;  1JZ8 A;  4MGZ E;  5FZ6 A;  2QQN A;  3S57 A;  2R0F A;  3CMG A;  5H9Q A;  3FC0 A;  5FZ4 A;  3LOB A;  3UT0 A;  1FOD 1;  1DHK B;  1VMH A;  3A4U A;  4OQ8 A;  1LHU A;  3PUS A;  1V6K A;  3JD7 3;  1W2O A;  2EAL A;  4HKW A;  4NRQ A;  1RGS A;  2EXH A;  1QJY 3;  1OI6 A;  4WM8 B;  1V6M A;  4XOG A;  4LMF A;  5FZ8 A;  5B4X A;  3V64 A;  2AEZ A;  3BB6 A;  5HCB A;  4CCJ A;  4GMP 0;  2WAO A;  4MVT A;  3KZ4 C;  3H9A A;  2RDS A;  4KI5 M;  3T2O A;  3JQW A;  2RJ2 A;  4HBN A;  4HLT A;  4R9B A;  1OOP B;  5JOW A;  2JXA A;  1ZBA 1;  2W1Q A;  2P6H A;  3THC A;  4COV A;  5IFT A;  3ZN5 A;  2QQP A;  2BNN A;  1VP6 A;  2B39 A;  2H6B A;  1OHF A;  3E5X A;  2WNO A;  3WNK A;  1X9T A;  1YIF A;  2ZGT A;  5LK7 B;  4MET A;  5DN2 A;  1ULD A;  3EB7 A;  2QQK A;  4CEW B;  2YFZ A;  5FYV A;  3SEE A;  3HAG A;  1BBT 3;  3TEZ A;  3B94 A;  3ZO0 B;  5FXZ A;  1TE1 B;  3TNP B;  2F17 A;  1XB9 A;  2Y38 A;  4HKO A;  4AI0 A;  1S1A A;  4M0N A;  4QDS A;  3S0M A;  1CJP A;  1SLT A;  1ZRF A;  4FPK A;  2SLI A;  1AL0 G;  1ZZ8 A;  4DIQ A;  2ZML A;  3PVO A;  4MGQ A;  4MGS A;  2CHH A;  5FAX A;  2BRT A;  4QAW A;  3SCG A;  2ZX3 A;  5FJH A;  3HNB M;  2X10 A;  5FZO A;  2JDM A;  3USU B;  2D98 A;  2JIG A;  1SFP A;  4S2F A;  4EV0 A;  3RFR A;  2J1U A;  3CL1 A;  1QQP 3;  3OB8 A;  1OKQ A;  2OII A;  3TRS B;  4Y1V A;  1PIV 1;  2ET1 A;  2JKX A;  1LEC A;  4L2N A;  3NST A;  4OVE A;  5EWS A;  3ZSE A;  3WQ1 A;  2WWU A;  1OVP A;  3GYD A;  3UNP A;  1AXK A;  2JE8 A;  2VMD A;  3RZG A;  4L9B A;  2QUO A;  2KM2 A;  1PK6 A;  3DXT A;  3A0N A;  4IND A;  1GUI A;  1LOF A;  3IIA A;  3AP4 A;  2DU1 A;  4MH0 E;  1IGO A;  1LOE A;  1W2T A;  1E5R A;  2A6W A;  4UBG A;  2RDN A;  3APB A;  4ATF A;  1AR6 3;  1IPJ A;  3O1M A;  3H8X A;  1JMU B;  2JEM A;  3OPT A;  5JSP A;  4Y1U A;  3USS A;  5KXC A;  2R04 1;  4K7J A;  4B29 A;  3FBM A;  1ND3 B;  1RJ7 A;  1JZ3 A;  4CP2 A;  5GZF A;  2XUE A;  2XWJ B;  5FO9 B;  3DV8 A;  3POB A;  5JIU A;  3ACF A;  1FNZ A;  1X9P A;  2WNV C;  3QLQ A;  4P00 B;  1XNA A;  1Y4W A;  2QFE A;  5FUI A;  3WUD A;  4QM8 A;  1FV3 A;  1SBF A;  3JBG 3;  3K2O A;  4IDZ A;  4K40 A;  1JU4 A;  4RSU A;  1G9C A;  4I0W B;  3GZE A;  5GZD A;  5C9A C;  2R04 2;  1ZYB A;  1JZ2 A;  3A23 A;  4FPJ A;  3W20 A;  3WW2 A;  3VDB A;  1NCQ A;  3ZFE A;  5DG2 A;  5KHH A;  1QWR A;  1W9Y A;  2ZGK A;  3AZZ A;  3FHQ A;  4JTO A;  2ZKN A;  4RGG A;  3IM0 A;  2ZZJ A;  4AED A;  2Y64 A;  1DGW X;  1RUG 1;  1WD3 A;  3NL1 A;  1ZRR A;  1WZX A;  3ZIX A;  4MGT A;  1QNW A;  1VBB 3;  3PVN A;  3SH4 A;  1W6M A;  1LKN A;  3ENR A;  4WVZ A;  3I8T A;  3NO8 A;  4UFK A;  1FOD 2;  3NNM A;  1WBF A;  2EXI A;  5FZE A;  4D69 A;  4OHV A;  5LBF A;  1LB2 A;  4B4R A;  1ZRC A;  4BME A;  4PHZ A; 
#chains in the Genus database with same CATH homology
 4KBZ A;  2HBU A;  2FCV A;  4XAB A;  3GJB A;  5L9R A;  5A3U A;  5L9B A;  3ITQ A;  5EPA A;  5HV0 A;  5EQU A;  2HBT A;  5LB6 A;  5DAW A;  4MHU A;  2RDS A;  4MHR A;  3NNJ A;  4NHL A;  4UWD A;  4NMI A;  5DAP A;  2RDR A;  4XAC A;  4NHK A;  4XAA A;  4Y5T A;  2RDQ A;  3GJA A;  2V4A A;  4XCA A;  4BQW A;  5IAX A;  2FCT A;  4ZON A;  5DAX A;  4IW3 A;  3HQU A;  5HV4 A;  3OUI A;  3OUJ A;  2JIG A;  4NHX A;  4Y5S A;  4BQY A;  2JIJ A;  5M0T A;  2OPW A;  3OUH A;  3DKQ A;  5DAQ A;  5IAV A;  5C5T A;  2Y34 A;  4Q5O A;  2Y33 A;  5LAT A;  3KT4 A;  4J25 A;  5LA9 A;  2G1M A;  4XCB A;  5LBB A;  3EMR A;  5EP9 A;  2RDN A;  4XC9 A;  5C5U A;  2G19 A;  5LBE A;  2RG4 A;  3NNL A;  3KT7 A;  2FCU A;  3MGU A;  5L9V A;  4NAO A;  2A1X A;  3OBZ A;  3KT1 A;  4JZR A;  5LBC A;  4NHY A;  3GZE A;  3NNF A;  3W20 A;  3BVC A;  4NHM A;  4ZPI A;  4BQX A;  5LAS A;  3PL0 A;  5DAV A;  5ERL A;  3W21 A;  5IAT A;  3NNM A;  5LBF A;  3HQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...