5ABJA

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
296
structure length
286
Chain Sequence
DPIADMISLTALQVLPTAANTEASSHRLGTGVVPALQAAETGASSNASDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGTEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
total genus 47
structure length 286
sequence length 296
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjA00
4CEWC 1QJU1 1X36A 4Q4V2 5C4WB 5L7OC 1RUD2 1C8M3 4N53B 1AYM1 1C8M1 2R061 1HQNA 5AC92 1VBB2 1HRV3 5FMOS 2HWD3 1RVF3 1RUH3 1ZBE2 1HRV1 2QQPA 1PGW2 1RUH1 3VBSC 2RS52 4CDWB 4QPIC 3VDDC 3CJIC 1B35A 5J96B 1OPOA 2RS33 4LLFA 4WM8B 1AR91 1QQP1 4YVWB 1VBA2 1HRI3 4CEWA 4RHV3 1NCRB 4RHV1 3JBG2 4CEYC 1K5MC 2MEV2 4PDWB 1DDLA 4WM7B 3JB4C 1PGL1 4IV1C 2PLV2 2ZTNA 1AL22 1R091 1QJU2 3ZFFC 1X33A 4Q4X2 1ZBA3 3VDDA 1MEC3 4Q4Y3 1PIV3 2RMU1 4GH4C 1ZBA1 3VBFC 1AYM2 1MEC1 1C8M2 1AR82 4Q4Y1 4AEDC 1PIV1 2R062 1F8VA 1H8TC 5C8CC 1AYN1 4GMP1 1VBE3 4CDUA 1OOPB 2HWE3 3J8F3 2HWE1 4IV3A 4Q4V3 3J8F1 3TN91 1RUH2 2WWSA 1RUD3 3VBUB 4RS5C 1RUD1 2TBVA 4N43B 1TME3 5CFCA 4FTEA 1AR92 1QQP2 5AC93 1RHI1 1TME1 5BNNC 3ZFFA 2GH8A 4RR3A 2BUKA 4RHV2 1FPN1 4GH4A 1MQTB 5JZGA 1RUF2 1RUI3 1PGL2 1VBA3 4WM8C 4YVWC 1RUI1 1ND2B 1R092 2HWC3 5FMOL 2HWC1 2MEV3 1M06G 5C4WA 2R073 4GB31 2RMU2 4JGZB 1ZBA2 2R071 1MEC2 1FOD1 4Q4Y2 1PIV2 2PLV3 1COV1 1AYN2 4JGYB 1IHMA 4RQPB 2HWE2 5LK7B 3J8F2 3TN92 4BCUA 4CDWA 4QPGB 1AYM3 5K0UB 3VBOB 1AR83 3DPRB 2R063 1HX6A 4WM8A 1QJY3 4YVWA 1RHI2 1AR81 1TME2 3S6PA 1QJY1 1NCQC 1NCRA 5ABJB 1RUJ2 1FPN2 2WZR3 4PDWA 5A32B 4WM7A 3VBRB 5C9AB 2WZR1 2ZAHA 1AR93 1QQP3 4N43C 1RUI2 1RUE3 2IZWA 1AR61 1RUE1 4CDUC 2HWC2 1HXS1 4CDXC 1WCDJ 2FZ2A 4GB32 4IV3C 2R072 1MQTC 1RUF3 1FOD2 1AR73 5D8AC 1COV2 1RUF1 1SMVA 1AR71 1R1A1 5CFCC 1R093 1OOPA 1NCQA 3VBHB 1ND2C 1PO13 4YVSC 4RR3C 1PO11 2X5IC 3VBUA 2RMU3 5BNOB 2BPA2 2ZZQA 4N43A 1AYN3 4GMP3 5JZGC 3NAPC 1QJY2 4CDQB 5CFDB 1NA1B 3ZFEC 3TN93 4CDXA 1Z7S1 1MQTA 2WZR2 4QPGC 5C4WC 5D8AA 2HWF3 1BBT3 1POV0 1RHI3 1NY72 4N53C 5L7OB 2HWF1 1QJZA 1BBT1 1ND2A 1VB2A 1VRH3 4YVSA 1VB4A 1VBC3 1AR62 1EAH1 1RUE2 1RUJ3 1FPN3 1HXS2 3ZFGB 1VRH1 2X5IA 1VBC1 1RUJ1 1TMF1 2R043 1NOVA 4CDWC 2R041 3VBSB 4JGYA 3NAPA 5BNPB 1AR72 1A6CA 4QPIB 1R1A2 3VDDB 3CJIB 1BEV3 1D4M1 3ZFEA 4RQPA 1BEV1 2WFF3 4Y5Z0 4Q4W2 1PO12 1NCRC 4GB33 2WFF1 4QPGA 3VBOA 1FOD3 4PDWC 3DPRA 4CEYB 4WM7C 4N53A 1K5MB 1COV3 3FBMA 2RM23 4RFT0 1ND3B 2RM21 5ACA3 2XBO3 1VBD3 1BMV1 1RUG1 5ABJA 4IV1B 5ACA1 2XBO1 1VBD1 1Z7S2 2GSYA 5C9AA 4EJRA 3HAGA 3ZFFB 2XPJA 2HWF2 1BBT2 4GH4B 3VBFB 2HWB1 1V9U3 2Y26A 1VAKA 4AEDB 3JD71 1EAH2 1H8TB 1OOPC 5C8CB 1V9U1 1VRH2 1VBC2 2FZ1A 1RUC1 5FOJB 1R083 1TMF2 2RS12 1OHFA 4Z92B 1R081 3VBUC 2R042 5A33B 1NY71 4RS5B 1PO23 3VBHA 4FTBA 1D4M2 1AR63 1PO21 1BEV2 1HXS3 1RB8G 1PVC3 3ZFGC 5BNNB 2WFF2 1PVC1 1ASJ3 1F2NA 5BNOA 1W39A 1C8NA 3LOBA 1ASJ1 4Y4YA 2WS92 2HWD1 1RVF1 1R1A3 5BNPC 2RM22 4CDQA 1RMU3 5CFDA 1BMV2 1RUG2 3JB8A 2DF7A 1NA1A 2RR13 5ACA2 2XBO2 1VBD2 1RMU1 2BFUS 4Q4W3 1E57A 2RR11 2RS31 3IDEA 4Q4W1 4GMP0 1HRI1 4JGZC 4FSJA 4NWWA 5L7OA 2HWB2 1ND3C 4JGYC 3JD72 4SBVA 1B35B 1V9U2 3ZFGA 3ZXAC 1Z7S3 1RUC2 5DDJ3 4RQPC 5DDJ1 4CEWB 1FMD3 1R082 1AL0G 3VBSA 1FMD1 5BNPA 3VBOC 5K0UC 4QPIA 3DPRC 3CJIA 1EV13 2VQ0A 5J98B 1QJX3 1EAH3 1EV11 1PO22 4NWVA 1QJX1 5ABJC 1TMF3 2RS13 4Q4X3 1PVC2 1CJDA 1NCQB 2RS11 1VBE1 4JGZA 4Q4X1 1ASJ2 3VBRC 4CEYA 1K5MA 5C9AC 1HRV2 2HWD2 1RVF2 1ND3A 4Q4V1 1D4M3 4IV1A 1RMU2 1GFF2 2RR12 2RS32 1POV3 1VBB3 5AC91 1CD3G 1HRI2 1POV1 1VBB1 1ZBE3 4CDUB 4FTSA 2WS93 5K0UA 4CDXB 1ZBE1 2RS53 2WS91 4IV3B 3VBFA 1PGW1 1RUG3 2BBVA 4AEDA 2RS51 5D8AB 5GKAC 1H8TA 3VBHC 5C8CA 1NG0A 5CFCB 1VBA1 3VBRA 5A32A 5DDJ2 4YVSB 3JBG3 1AUYA 4RR3B 5BNOC 1FMD2 2WLPA 2X5IB 5A33A 3JBG1 4RS5A 2HWB3 2MEV1 3JD73 1EV12 1QJX2 4CDQC 5JZGB 1B35C 5CFDC 2BFUL 1RUC3 5BNNA 1AL23 3NAPB 1NA1C 2PLV1 1QJU3 1AL21 3M8LA 1VBE2 3ZFEB
chains in the Genus database with same CATH superfamily
4DRRA 1S0EA 2D98A 4QX2A 2QZ3A 3ZX7A 2YUEA 3GJBA 4IW3A 4XF3A 1KEXA 2CWSA 2NPIA 2VOTA 2WR9A 2Z5WA 5F6LB 4N7UA 2DVBA 4X8NA 3TBDA 4QX8A 2QDRA 4IEWA 3KWVA 2NQYA 4LNVA 3J4UH 3E5QA 2BEOA 3V65A 5LCWL 4UFJA 4Y1YA 2BGOA 1VBB2 1W2OA 2VY0A 5FMOS 2VZPA 2HWD3 1RVF3 3SEPA 4OFGA 1V6OA 4FP3A 4LUKA 3WR0A 4UBGA 2QQPA 1PGW2 5IUQA 2FDKA 2W47A 3AJZA 2Z79A 4AFDA 3VDDC 4CDWB 1B35A 5JVVA 2XKPA 2D93A 1CIWA 2D6PA 1OPOA 5IWFA 2RS33 3WV6A 4XFHA 4YVWB 5F1RA 2C0ZA 4CRQA 4ES8A 1VBA2 2WNUC 4KGQA 1PX3A 1D0HA 1YC61 1ZZ9A 2ZGKA 3ETPA 4KH9A 1UY2A 1CAXB 2QQIA 4M00A 4NROA 1PZ8A 1QXPA 4B4QA 4RHV1 1Y43B 2FCTA 4AR2A 5JR7B 4AHXA 3DN7A 1K5MC 1PMIA 3PJYA 4GWMA 1O3QA 4QQLA 4X6QB 4EWAA 3LEMA 2A3YA 3E5XA 4QX1A 4MHRA 2G9GA 3PUQA 4Z1VA 1QGLA 1RL3A 1ULCA 2WYSA 5T5JA 3NNGA 4CP0A 1ZZCA 1PGL1 1XB9A 4EQVA 3ZYIB 3N9LA 4HLTA 1G9FA 1QNYA 3H7YA 3MPBA 2L9LA 3HT2A 3HEIA 3KV6A 5FXZA 1X33A 5FK8A 1J3QA 3DCQA 5CBLA 4E4HA 4YZ2A 1WBFA 3M7AA 1W2AX 1U5XA 2EAKA 1MS9A 2XVKA 3VDDA 4N8MA 4CCJA 4Q4Y3 3PUSA 3SMHA 3ES4A 2RMU1 4FFFA 1MEC1 4YZ4A 5K4LA 1FXZA 3RPQA 4CCNA 3PHMA 4FFGA 3O1OA 4LXLA 4D8MA 5F2WA 5C8CC 3OUJA 4MUVA 5FZ1A 3DECA 4CPBA 1VR3A 3UKTA 4CDUA 2PQSA 5HPOA 3U1XA 1POQA 5LA2A 5L9RA 3A22A 4Q4V3 3TN91 5HI0A 5L7OB 1J59A 2WWSA 5GLVA 1RUD3 4LO4B 1MS1A 2OS2A 2W08A 2VUJA 2OVUA 2Y8KA 3KS7A 3M1HA 4AWDA 2TBVA 1V6IA 1TME3 1H8VA 1N3OA 1DLCA 2ZABA 3C7HA 3POIA 4UAPA 3TNQA 5AC93 2ZPXA 3H8UA 4UFIA 4YWAA 2CL2A 2SBAA 3LE0A 3THPA 3IKWA 5D2AA 3RZZA 3WNMA 2QQOA 4RHV2 1H4GA 5FMCA 4BQ4A 3O1VA 1KS4A 3MHZA 5IVJA 3ALQA 4LR4A 5F3IA 1AZDA 3EYPA 3LB9A 5CU1A 2VNVA 1JS9A 2G1MA 1MPXA 5A80A 5JZGA 5FZCA 1PGL2 3MV01 2DURA 3URFA 3UKNA 1LEDA 2QTWB 2DU0A 3J7NA 1DGWA 1V6LA 4QX0A 1RUI1 3T0DA 3FLRA 4LPLA 2VXRA 4LOSA 1DLLA 4W4ZA 5FMOL 5FZFA 2ZKNA 4META 4MZUA 4MGYE 1YYNA 2HWC1 2MEV3 4MSVA 3WF0A 4YNIA 5FMDA 1BJQA 3AP5A 3A0NA 2RMU2 3FC0A 4Z07A 2A71A 1MEC2 3WUDA 1KQRA 5M0TA 3PU8A 3RYKA 3GHMA 4R9DA 5DG2A 1IHMA 5FP4A 3VZOA 2WN3A 4Y1VA 3E97A 2WQ8A 5KXDA 2DFCA 1OA3A 4YM1A 5IT6A 4AI1A 4XTMA 1MZFA 3TN92 1PK6C 2WZ8A 3AKSA 2ZHLA 4P9YA 4E4DX 2LS6A 2P6HA 2C9KA 4WZFA 5GJ6A 1BHGA 2ZEWA 2J1VA 4A7YA 1E5IA 5GLZA 3VBOB 3HBKA 2R063 3OGVA 1J3RA 1QJY3 4PCRA 3ZM8A 3L9JT 5FFOC 1JYXA 2YZ4A 4M3CF 1UO9A 3S6PA 2JG8C 4TZDA 1S0CA 2CAVA 5GZCA 1NCQC 1LGBA 1U5YA 1NCRA 4QPYA 5A6QA 2X10A 2XUMA 1C3HA 2WZR3 2AACA 4BHPA 2PN5A 2IC1A 3CLPA 2IXKA 1LODA 3PTRB 2VTFA 3R05A 4WM7A 3KV9A 2FDFA 1JYNA 3KZ4C 2ZAHA 4BA6A 4AFCA 3HT1A 4C91A 4LE3A 2W1QA 5GZFA 4HT1T 1W3VA 4FXKB 1SLCA 1XE0A 4XZPA 1RUI2 2YC0A 5F5QA 2LRPA 2YXSA 3SH5A 5LBFA 1SACA 1OLQA 1ENSA 1W0PA 5JWPA 1LKNA 3I7DA 2B45X 3V0AA 1XNCA 1UU4A 1NX9A 1RUE1 1PK6A 1DQ1A 2ZMNA 4NE9A 2HWC2 3ZSEA 4C0BA 2GC1A 2J1RA 1S0BA 1L3JA 1HB3A 4NOTA 2IFRA 2AZ5A 3GBWA 2BV4A 3VKFC 1MQTC 1JZ3A 4PHZA 2BERA 5BNNA 3I3EA 4XDPA 1W6OB 5J48A 2ARCA 3PUHA 4HVRA 5FZ3A 1OT5A 4OUSA 2JG8A 1RUF1 2XVGA 1W0OA 2Y6FA 1OOPA 1NCQA 3VBHB 3N4MA 2PHXA 4XAEA 2BVVA 1ZRIA 4CP1A 4I2OA 3A0KA 3E6CC 3OUIA 3SISA 2D6MA 2V4AA 3HNYM 4XFBA 2XKOA 3C7GA 4CSWA 5BNOB 3B01A 2MNGA 5JMOA 5BYNA 1AYN3 4GMP3 3MI8A 4BQWA 3IMNA 4HETA 2W5FA 3MW4A 3ACHA 3NNMA 2XWJB 1UIKA 3GGLA 2W1SA 3U78A 1CAVA 3VHPA 4EN9B 5FYSA 3HOBA 3IAQA 1JTZX 2ZGNA 3MBWA 4AEJA 1MQTA 1S0DA 1APNA 1H2KA 1CZSA 2OT7A 1ULOA 3INAA 1XNBA 5C4WC 4W6YA 3I3MA 1POV0 2LW8A 1RHI3 1NY72 1XSQA 4N53C 2RJ2A 4AAPA 4EWEA 4XMIA 1OUSA 2HWF1 2PHUA 4IXLA 3GZTB 3SLIA 1VB2A 3JZVA 3ZOIA 4OUMA 5CA6A 4W6XA 2ZS6B 1EAH1 1K3IA 1RUJ3 1RUE2 3I8TA 4XF0A 2I2SA 1NLQA 3U11A 5FLJA 1UYYA 1W8ZA 3K51A 2JENA 3W21A 2VZRA 2R043 5ERLA 3N9PA 3VKLA 2IFWA 3BTYA 1NOVA 2JDYA 3AK0A 5EJ3A 4CCOA 1US3A 1CONA 3VBSB 3A21A 4W8JA 1LHOA 3N9QA 2OYZA 2VOXA 1A6CA 4ZU7A 4QPIB 1I5PA 5DG1A 1DHKB 5EIYB 5F3EA 4TLFA 2ZHKA 5L19A 1QKQA 5FY4A 1GOGA 1BEV1 3EJKA 3ZYPA 4AVVA 4CUAA 2JE9A 3SNMA 1KFUL 1MZ6A 1KGYA 5AVPA 4JAAA 4E4ZA 2NM1A 4XFGA 1FOD3 1N1SA 3DPRA 4N53A 5L36A 2PHRA 2YFZA 3WG1A 2R0FA 1QDCA 2RM23 2ZEZA 5LW9A 4RGGA 1YFXA 2JG9C 1RJ7A 2OA2A 5F32A 3Q8AA 1BMV1 1ZA7A 1RUG1 4S2GA 2UYAA 4IV1B 2B5HA 1OVPA 2CWMA 3I3BA 5ACA1 5D1IA 2FQPA 4B3NA 1YHFA 2W52A 3NQHA 5BXXA 3ZFFB 2QCSB 5KC6A 1XXNA 1SPPB 1UOJA 5CKNA 2GN3A 1X9PA 2HWF2 5DUXA 1LRHA 4PLNA 2JB4A 1UOGA 1JN2P 2UWBA 3ILRA 4GH4B 4PIXA 4F8AA 2W92A 2ES3A 2EVXA 4M0NA 2YBSA 2CAUA 3JD71 4AEDB 1EAH2 2PHDA 2AUYA 2JDZA 2OQ6A 1DP0A 1SLIA 3FLTA 1LOCA 2BGPA 5LZ6A 3OD0A 4U36A 1Y4WA 1OHFA 3GDBA 4AI0A 1F35A 1R081 2ZX3A 2W68A 3LOIA 1WW7A 3AXDA 4Q0QA 3VBUC 3VDBA 3ZN6B 4GQ7A 5CNAA 2Z2SB 1W6PA 1FI2A 2JG9A 1HW5A 5A33B 5GLWA 2UY9A 5I91A 5B4NA 5I8TA 4CZSA 1RJ8A 5CG9A 4A3ZA 3LA7A 3AKTA 4LBOA 1AXKA 1BEV2 1HXS3 2JIJA 3KVBA 1DYPA 3ZFGC 1X8EA 3T2OA 4O7XA 5FZKA 2ADEA 2Y64A 4D0QA 2K2SA 4XACA 1C8NA 2WNEA 2PELA 4DY5A 1ASJ1 4XZUG 3LOBA 4Y4YA 4GKXA 2WS92 2V5YA 3GF6A 2HWD1 1RVF1 4XBLA 4Q1PA 4CUGA 1GWMA 1MR5A 4E2GA 4O65A 3WD5A 2VMGA 4JCKA 4K20A 5CFDA 1BMV2 1RUG2 1IKPA 2DF7A 3OGJA 4NHXA 4DMIA 2QFEA 2RR13 5ACA2 2VQTA 4CPBD 2GU9A 3OPTA 1E57A 4QKFA 2RS31 3RI8A 3KF5A 4Q4W1 3ACFA 3THDA 4MG2A 1WA6X 2FDGA 2Y33A 4Q0UA 5FZMA 2Y60A 3N9MA 4IETA 4DUWA 1W8UA 4JKLA 1RUOA 4ATEA 4LO7A 4JGYC 5AFBA 5JOYA 3JD72 1GYKA 4SBVA 5FPLA 4AEKA 5C6CA 1MZEA 1VMJA 3ZFGA 4B8EA 1Z7S3 1ZZBA 3THTA 5CEHA 4KG8A 4UFHA 4RN5A 1STMA 2JDNA 4XQ4A 5KWRA 5DDJ1 1R082 2XH6A 3TAYA 5L73A 4XIKA 3VGIA 3O14A 1YO8A 2P4EA 3CJIA 5FZ4A 5IVFA 1LHWA 4OQ8A 1LESA 3VHRA 3NNJA 4OMCA 3CL1A 4WZCA 1QIQA 2DVDA 2A73B 1WGPA 3WZ1A 4YM3A 1REDA 3WG2A 4H3WA 3SKJE 4PIYA 5ABJC 4YFWA 5FJKA 2D6LX 3CIHA 4NPLA 5H9SA 5A7PA 2HBTA 3CNAA 3VZJA 3OGGA 4Q4X1 2DYCA 1ASJ2 3MDPA 3UGFA 3VBRC 4CEYA 5C9AC 1CN1A 4CXWA 2HWD2 1RVF2 4JQRA 4QB1A 4Q4V1 2J1TA 3KCXA 1D4M3 3OB8A 3FZ3A 2DTWA 4QPWA 3A23A 4D6QA 2VECA 5F2SA 3TB0A 1JODA 1VMHA 2VBPA 4CCEA 2D5FA 2VMHA 1GFF2 4GWNA 4KU7A 2RS32 5I8YA 4XXAA 5AC91 2WQ4A 4ORFA 1CD3G 4BJ0A 4FQZA 5A7QA 3M70A 4AAXA 4FTSA 2DU1A 4M3CB 1UZYA 4YG0A 3BVCA 4NHLA 1ENRA 4CDXB 2WABA 1YUDA 5LRRA 2FDIA 1V0AA 3R4UA 3VBFA 4Q29A 5IK5A 1KS5A 4XW3A 1U5ZA 2EXJA 2RS51 2Y0IA 3LQCA 2DUQA 1HDKA 1QOTA 1WA4A 1H8TA 3CBNA 3MFCA 3MUZ1 4XJ9A 1M4WA 3LGRA 5D8AB 5A7WA 3R4DB 3JU9A 4AXOA 1NG0A 4CXYA 3WHTA 3TEWA 3IMMA 3VBRA 2TEPA 3I4IA 3KT4A 5DDJ2 3RSJA 1ODNA 1CWPA 1JU3A 4H55A 1AUYA 2A6WA 3DV8A 4CUBA 1YLLA 1FT9A 1K45A 4QB2A 2JDUA 2V73A 4RR3B 2O8QA 2X5IB 2R32A 2ZEXA 3J7MA 3ZPYA 4RS5A 2HWB3 2Z69A 2MEV1 5I0TA 2A3XA 1N47A 3WNOA 2G9FA 1UF2C 1V6KA 3VL9A 4GKYA 4RYDA 4CDQC 1ZA4A 1RUC3 1P8JA 4MXVA 2W9XA 3U10A 4XBNA 2A70A 2FBEA 4R9BA 4EWDA 1LAJA 1D2SA 1IGOA 1NQJA 2E33A 1AL21 3KGLA 2BWAA 1X8MA 4HBNA 4K21A 2ZGPA 4Q4X2 3ZFEB 1QJU1 4COZA 4YYOA 3SEEA 1WKYA 4QAWA 3FUOA 4Y1XA 3VZMA 1W3XA 4Q4V2 1LOEA 5IVVA 1LB2A 4KMQA 4HONA 5L7OC 1RUD2 3ZIXA 1C8M3 2AGSA 2HEVF 2R16A 3ZYJB 5DZGA 1IZ3A 3W58A 2R061 3I59A 3NJYA 4LBQD 4WVVA 1HIXA 1Q8PA 5JSRA 5AC92 3VD9A 3ILNA 1YXWA 3I2DA 1W2TA 3BOWA 3I2IA 5FZDA 1SLLA 1QWRA 1IS5A 1HRV3 1RUH3 4FOQA 5F3GA 1Y3TA 3DXTA 2RS52 5LRSA 1D0GA 5FZLA 3PNAA 4XXPA 3WW4A 2LROA 1SG3A 4LTAA 4MOAA 2YGMA 4WM8B 3FHIB 4LO6B 2Q8EA 3RMXA 1TE1B 5DAPA 4XUTA 3A7QA 4YW1A 4R9CA 1HV1A 4RFRB 1O8PA 1ZZ7A 1VAMA 4QXHA 1UMHA 4A45A 5FZBA 3UJOA 1CAUB 2OIIA 5DAXA 2ZGUA 5DABA 4LKSA 2MEV2 2WA3A 4OUEA 4PDWB 2A7AA 3KHCA 2VCBA 4X6RB 3UESA 4R52A 4AG4A 1YEWA 2ZXQA 1DG6A 2EICA 2VPVA 3FE5A 5FWEA 5H9RA 3CO2A 4AI8A 3DEMA 4K1ZA 1H9PA 2BRTA 1DQ0A 1NE4A 1UY4A 3SCGA 5B2GB 2RV9A 2ZTNA 2IXIA 1AL22 5KXBA 4QQPA 1W06A 3V56A 1E5HA 3O1RA 3HWJA 3IWZA 1QJU2 3T08A 1JZ5A 2YMZA 3LFMA 4P14A 3QACA 5A7OA 5JSPA 3K4AA 1OSGA 1CJPA 1YFWA 3D4KA 4L11A 1OQDA 4XEZA 5LA0A 1ST8A 1YQ2A 2WBKA 3KGZA 2DCYA 4IEXA 1ZBA1 1JOBA 1O6UA 2XQRA 2ZEYA 1ENXA 1PIV1 1JOJA 2R062 4BQ3A 1WMXA 4ZXEA 3CDZB 1AYN1 4GMP1 3WW1A 1VBE3 5JIAA 4OQ9A 1XBFA 2PQQA 1YRZA 2YPDA 3CQOA 3R0RA 4UFLA 2HWE3 4CU6A 1O91A 3LDKA 4HK8A 5LEKA 1YIFA 1OMIA 2WNVB 4IV3A 4XAAA 1CAWA 3J8F1 3D3AA 3Q8FA 3O0VA 5GZEA 5A3WA 4ASMB 1T6GC 2K46A 3BU7A 3LEKA 3ZXJA 1A3KA 5HXVA 4IE0A 5I93A 5CFCA 1JYTA 1L7RA 1W6NA 5L9VA 1W0NA 1RHI1 4GJZA 5JAXA 3RZMA 2F4PA 5BNNC 2XG3A 2YBPA 3IIIA 2GH8A 3IDAA 3OBTA 2R0HA 1UIJA 2JE8A 3Q8EA 4ISRA 4LMFA 2CGNA 2P6CA 4DFSA 1A34A 1K42A 4X8PA 3U0ZA 5HV0A 4OI0A 3RFRA 4MH0E 5FKCA 4OI4A 4RGAA 3IIAA 5FZGA 2YU1A 3CU7A 2Q1ZB 4I01A 1S2BA 1UWWA 2GMEA 5JXIA 2FD8A 4YVWC 1QH7A 5KXCA 1QF3A 1PZ9A 4CP9B 1RC6A 3O0WA 1ND2B 4NRQA 1O4TA 3THCA 5JDBA 1VRBA 4Q26A 4IGPA 1IS4A 3N7LA 2IXHA 5C3RA 3VHOA 1Q56A 3LAGA 4JGZB 1CX1A 1WCQA 1ZBA2 2R071 5ISLA 1FOD1 1PIV2 4XURA 2VOKA 4FPHA 1AYN2 2E6VA 2J42A 2P34A 3B00A 3ZMNA 2XLFA 5FP8A 5F3CA 2IVIB 2RDQA 4UXAA 2ZGMA 5FLHA 4RQPB 5F39A 2GP3A 4YRDA 3F95A 4DS0A 3J8F2 2W46A 2NZ9A 5FZ6A 5A3PA 4LLOA 1O7FA 4HKOA 4WVMB 4CDWA 4QPGB 2RHPA 1H30A 2QUOA 1AYM3 1AR83 5FOBB 1HX6A 3POBA 2DVAA 2J1UA 2VCAA 1OC1A 2DUOA 1RHI2 4YVWA 3USUB 3BU0A 4CXXA 5FCCA 1JMUB 2VMIA 5FPAA 4UW6A 1CAXA 5FYIA 4EN0A 1HB2A 3B7MA 2OXBA 1RUJ2 2K9ZA 3B02A 4HANA 3VDCA 4ASKA 4N9IA 1SFYA 2WWJA 3ZXLA 1WLDA 4FP2A 4K3UA 5FY5A 1ZRFA 3ZXGA 4Z2WA 1AR93 3LD8A 5FREA 3SKVA 2DBIA 2PYTA 1GP5A 3WINE 2NYYA 2BGCA 2D7FA 2KM2A 3NJVA 2W94A 4LA2A 4YZ3A 3HIFA 3LA3A 2ZCWA 1YFUA 3JXSA 1F9KA 4UF0B 4MGIE 4DXTA 2X53S 3WNXA 4KNCA 4CDUC 4UW3A 1HXS1 1XSRA 1U5IA 3D5OA 2D3SA 5A1AA 3OBRA 1BVVA 2VOVA 2R072 3OUHA 5BV6A 5CVRA 4IUGA 2BQPA 1KITA 1FOD2 2PTMA 1AR73 4NR1A 1Q8SA 2D40A 5FZAA 3KQ4B 1OFSA 4PI0A 2ZX4A 4QHOA 5T55A 4C1WA 1RINA 4XDQA 1R093 3D82A 5DAWA 2XJUA 4YSFA 1S55A 4QHZA 3WG4A 4DY3A 1ENQA 2OX0A 1PO13 2WAAA 3NVCA 4YVSC 1ZVFA 1HQLA 2AREA 1AJKA 3VV1A 4CCCA 2JKXA 3S5QA 3ACGA 4P00B 5E6HA 3CZJA 2BPA2 2C5DA 1W04A 4KG0A 2ZZQA 4BU2A 4COUA 4NMIA 2VUDA 4QXBA 1AJOA 5JZGC 1W2UA 4KWJA 2DVGA 2PAEA 4KWUA 1TZOA 3MIDA 4R9AA 4KU8A 2FDJA 4ZXKA 1PGSA 3NW4A 1NA1B 4G4FA 2Y6HA 4TSVA 3O7OA 1F15A 3S7EA 4BQ2A 1IS3A 1Z7S1 4LBMA 2QQLA 4LBJA 4BMEA 4EROA 3WNNA 3V0BB 4HXCA 2NLRA 3M3OA 4D7YA 4MGZE 1SHWB 4CTEA 1NE6A 5JLVA 3AL5A 2GZWA 1W9TA 4EZHA 3BALA 5FXVA 2VZVA 1BBT1 4JV4A 2VC9A 4YVSA 4ZU4A 3SCHA 4E4SA 1TVGA 1VB4A 1VBC3 2OZJA 3H9AA 5DQ0A 2YG0A 3FJSA 1FPN3 1HXS2 2CYFA 1VRH1 3H1MA 3Q8CA 4XABA 1XPWA 1DGRA 1GQGA 1W9FA 3AJYA 5JI7A 2QNKA 3M3IA 4UFMA 2VZ3A 2IXLA 3RYPA 1XNAA 4JHZA 5KBFA 4S2FA 1ZRCA 3ACLA 5EHDA 5IYYA 3ZYFA 1YWKA 2SLIA 1SBEA 4P02B 4AHZA 5BNPB 3VDDB 5IFPA 4R8HA 3AYCA 3WP6A 3ZDVA 1N3PA 4MV2A 4W65A 1Q3EA 4R4XA 4Y22B 4GALA 1D4M1 4AQTA 3OY8A 3ZSJA 2WFF3 3L2HA 3NV3A 4Y5Z0 4ZY9A 2WNUB 2WFPA 1NCRC 1KJRA 2FCVA 1PX4A 4GB33 2TNFA 1D4VB 4NHKA 4AEMA 4L8QA 3VBOA 4XF9A 4KL1A 4PBPA 3VB9A 3I2OA 4WM7C 1K5MB 1HKDA 4K9SA 1COV3 3HQUA 1TQ5A 3ILFA 4D7TA 4EV0A 1XE7A 4K8RB 2B9UA 2GP5A 3POFA 2JB8A 5FYHA 1JOPA 1DYKA 5GZGA 1VBD3 2IXJA 2Q8OA 4URAA 3BB6A 4XF1A 3VL8A 5JI9A 2WO3A 1ULFA 2VZUA 5E8AA 2A75A 2XBO1 2R1BA 5A3MA 4OHYA 1Y9GA 1IG0A 1Z7S2 3RMYA 4BIFA 2GSYA 1UY0A 1YFYA 1D2QA 2XMLA 4AF9A 2VG9A 3KM5A 4Q27A 3TEYA 1CX4A 3WF2A 3ZDSA 5DZEA 4O9GA 1BBT2 2QBXA 2HWB1 3QBQA 4NIGA 1V9U3 3WNLA 2Y26A 1OKQA 2OUHA 5DUVA 2XQXA 1OOPC 3KV5A 3OD4A 3RYRA 1VRH2 3WG3A 3WQ0A 4BIOA 5C8CB 1PVXA 1O8SA 1RUC1 3DYOA 3RGBA 3C7FA 2D3RA 1BYHA 1WCSA 4DXSA 4A7KA 4FI9A 2QKDA 3AC0A 2VZOA 1DF0A 1DBNA 5LY1A 2ATFA 1G9CA 2ZX0A 5A3UA 1Y9QA 1NY71 1JHJA 2WC2A 3V64A 3VBHA 4FTBA 2Q5TA 2ZZJA 1NZIA 1D4M2 2OUJA 1QXJA 1QJEA 3GZAA 1PNFA 1PO21 4PBOA 3RZJA 2VMDA 5L9BA 4XUNA 2OZ6A 1JI6A 1NLSA 2JKBA 2DCTA 3GJAA 1PVC1 1F2NA 3VKNA 3WXPA 5BNOA 4XFAA 3KV4A 1QNWA 1SFNA 4JDOA 4D3WA 3H8XA 4NIIA 3ZR6A 3MZHA 4B29A 1DIWA 1VIWB 3L2YA 1RMU3 5G05L 3JB8A 4CU7A 1GMMA 5KC5A 1UMIA 5APAA 4LHNA 3U37A 5IAVA 2WZPP 3WDVA 2XBO2 3ETQA 4M3CE 1SLAA 2XWBB 3PMSA 3ZYHA 5FP9A 3IDEA 4PLOA 4HVOA 4GA9A 1LOBA 3ME2A 4IERA 4JKKA 5BUVA 1CZTA 1GBGA 2WT1A 3AVSA 4C8DA 2E31A 3OEAA 2WLQA 1WWYA 1JUHA 4TYSA 3AP6A 3JQWA 2HWB2 3P1IA 4B4RA 4LITA 3X29B 4NRMA 1S2EA 3S7IA 1S1AA 2XL9A 3DYMA 3B94A 4QX7A 3AXEA 2P37A 1RUC2 4FOYA 3AKQA 2P3JA 5FPXA 3VZKA 4P08A 4EN8B 4CEWB 1FMD3 1DZQA 3WW2A 1H6YA 1PK6B 4HKWA 3VBSA 4LHLA 2Z42A 5K0UC 3DUIA 5T5PA 4QPIA 3DPRC 2QQMA 1EV13 4AFBA 1BVP1 1S2KA 2VQ0A 5BPXA 1QJX3 3N9OA 1D7PM 2Q1FA 3ZXKA 1PO22 5ANQA 1G8WA 2XDVA 3MV11 3OPWA 4QM9A 4TLGA 3WUCA 4XHBA 2JG8B 3D6EA 1S0IA 1TMF3 2RS13 1PVC2 4SLIA 1UAIA 1NCQB 2WT2A 3MLLA 4V2VA 3NKGA 4LBQB 3WCSA 1VBE1 1EY2A 1IQDC 2ZMKA 3WHUA 5A6YA 2CTVA 1HRV2 4I09A 5C3SA 4XFFA 2EIGA 2C24A 4TTGA 3GM8A 3M2MA 1GKBA 3VLBB 4ZPIA 3KMHA 4IEQA 4LHSA 3UYJA 1UYZA 2PHLA 4IV1A 2W91A 4A4AA 2VL4A 2VULA 1X9TA 1YIPA 3BN6A 5FRAA 1ODMA 1VBB3 3VD3A 4FPFA 2VTXA 2E63A 1BZWA 5T50A 1POV1 1OURA 2PHWA 2DTYA 5DXDA 5K0UA 1SPPA 3GBGA 1PM4A 3WSOA 2CGPA 1ZBE1 1A78A 2ZJCA 2WS91 3ON7A 4L99A 4M0HA 3MO4A 5AVAA 3TRSB 5IFTA 1OQ1A 5C8WA 5E88A 4AEDA 5EYXA 5IVYA 2EXHA 2IWGB 1IKQA 5GKAC 3MYXA 3UV9A 3W5NA 3FBYA 2WN2A 4C90A 3BTXA 4NAMA 1LNSA 3USSA 1W99A 1EUUA 1T6BX 2PFWA 1UQXA 2WWUA 4HVQA 5A32A 4ZHNA 1FX5A 2P2KA 3ZN6A 1PZ7A 3AX4A 3C8XA 2PXJA 2D97A 3BYWA 2GC3A 1KXGA 3JBG1 4NPMA 5A33A 5LY2A 5C5TA 3RWNA 1BK1A 5JCTA 2ZGLA 1RXFA 4UYBA 3SH4A 5CFDC 1QHDA 1ZM1A 3D0JA 4YLZA 4J1WA 4YM0A 5IJRA 2JECA 4N9HA 4Y20A 3ABZA 3H1WA 1K12A 4A41A 1WW6A 3M8LA 1VBE2 3H7JA 1QDOA 3RZKA 3LIHA 4PQ9A 3N7KA 1CR7A 1X36A 1CQ9A 2VU9A 2V4VA 2W0XA 4FPEA 3ZSKA 5C4WB 2V72A 4HPKA 1S4CA 4H14A 4MLOA 2C4XA 5A70A 4KWKA 1I1EA 2DCJA 4N53B 4AOCA 1UY1A 2XB6C 4CP2A 1AYM1 1F31A 4FAHA 1HB1A 5CZKA 1U12A 5FYMA 3AKPA 3WF4A 3SXWA 3TEZA 3RWKX 1PM7A 3H3UA 3NO8A 1I9RA 1OKOA 2E26A 3O5SA 5FYBA 4L9BA 1GZCA 4I30A 4L0PA 1ZBE2 2RG4A 4IE5A 1LENA 4PQQA 1ALYA 1FV3A 4WBBA 3PUAA 5FZOB 3I2GA 4PJYA 3OF1A 5LEJA 3CJIC 4DQAA 2WT0A 3EHKA 2W1WA 3WQ1A 2ZMLA 3AYAA 3AMMA 5J96B 5EQUA 1AR91 3MUY1 3APBA 5A6XA 4IESA 3POGA 5DN2A 2OPWA 1HRI3 1KFXL 4RHV3 1YI9A 2A6XA 4AQ2A 1SFPA 1JYCA 1OA2A 4AI3A 5DUWA 5LB6A 2W39A 3JBG2 3WDYA 4CEYC 5FPUA 1HJFA 1WZXA 4LA3A 2A3WA 1DQ2A 4BQ5A 1RITA 1X82A 2OPKA 3ROUA 3EB7A 5I0UA 2MPFA 3B93A 1O4YA 1UKGA 2ET1A 4QB6A 3ZPOA 2EIDA 4DEVA 5C3OA 1MZ5A 2RDSA 3R4SA 5I0RA 2ARBA 5JOWA 2BNMA 2JG9B 1LHUA 4YW5A 1HQWA 4AYUA 5JOZA 4XMAA 3T2PA 1NT0A 4L2NA 5FLIA 3GNEA 2WRAA 2VE1A 1R091 5FZ0A 5FQ0B 1LOFC 3DYPA 3PIJA 1XC6A 1WUVA 5SV5A 4I0AA 4J25A 3BIWE 2VXJA 1RTVA 1MEC3 4ZS3A 3N3HA 4FVVA 3VKMA 2CV6A 5FWJA 2B42B 3I2JA 2VMFA 3VBFC 5KR7A 1AYM2 1C1FA 3T1LA 2ETEA 1AR82 4Q4Y1 4QQOA 5HCFA 1UXZA 4GXLA 4UWDA 2VW2A 1H8TC 1K5JA 4IGQA 4XILA 5CISA 3FHAA 4ASLA 4KWLA 1OF3A 3I3QA 1VMFA 1W9YA 2ARXA 3O12A 3MIGA 2AYHA 1QJFA 2PHTA 2WJSA 4LIUA 4M3CA 5IK8A 1Q5OA 4LK6A 1N1TA 1JZ8A 3ZKYA 1H6XA 4E2SA 5JXJA 4XC9A 1DZTA 4I3PA 3VBUB 2WO1A 2WO2A 1VAVA 4RS5C 2WA4A 2OW4A 2VM9A 2N7GA 1RUD1 5J7MA 2NMOA 4N43B 2V5DA 4Y24A 4HKLA 1AR92 3GBFA 3P5BA 2J1AA 3UK9A 1NZCA 1JZ7A 2GC2A 1TME1 5EP9A 1XJAA 1LOFA 2WZEA 3PVBB 4PF5A 3WDUA 4RR3A 2BUKA 5F5IA 2Y6LA 2H0BA 2JICA 3G7DA 4HK9A 1UX6A 3ZKUA 1FPN1 1JXNA 3U4SA 5DAVA 5A7SA 4H7MA 3VN4A 3AZXA 2D43A 2XLAA 5LBBA 4GJYA 4BQXA 2VBBA 3T1MA 4RD7A 1BLZA 1RUI3 4D6RA 4D7SA 4OHWA 3ZO0B 1AHSA 2QVSB 4WM8C 4GAZA 5GZDA 4FFHA 1MS5A 3LPFA 2W2IA 5JOXA 1R092 3GCXA 1SDWA 2HWC3 3HN3A 4EYUA 1LEMA 5A3NA 3UNPA 4IEVA 4AI9A 5FP3A 4BMBA 5EJ1B 2OQ7A 4ET7A 2JEMA 2B9VA 3AZVA 1VALA 4GB31 2PAKA 2GH2A 2EXKA 4FAGA 1BKZA 4Q4Y2 4Y1UA 1FYUA 1WBLA 4LKFA 4KBBA 3E1F1 2PLV3 1COV1 2VQUA 4JGYB 1AXYA 2ZGTA 3CZUA 2JIGA 4Q0PA 5TSWA 3DXUA 3KVAA 3FMGA 1XU1A 4AGGA 3U4XA 4FPGA 4E8CA 2PMWB 4QU2A 5LK7B 4RL7A 4LOTA 4PIZA 4Q0SA 5IW0A 1X50A 2WUHA 3RNSA 4BCUA 1VE0A 1TG7A 5JSOA 1SBFA 2PAMA 2VUCA 2R30A 3AP7A 3LZZA 3O1SA 4KGGA 4WM8A 4CYDA 1W6MB 2WIIB 3H3ZA 1TME2 1OF4A 4FBFA 3ELNA 1QJY1 4COVA 1GQPA 1HB4A 1URXA 1UXXX 2RE9A 1QEXA 3PVEA 4Y26A 1W6QB 5A7WB 3TYJA 3ZIWA 5ABJB 5T5OA 5FZ8A 5FUPA 1FPN2 4BXSV 1DCSA 1UL9A 4PDWA 5FZEA 3VBRB 2P3IA 1SCSA 1TNFA 2ID4A 4AVCA 5C9AB 4NO4A 3UETA 2P5BA 5C33A 4OLLA 1V6JA 2WZR1 1KDMA 4CCLA 1OUXA 1WMEA 5KHKA 1UY3A 1QQP3 4BB3A 1DZRA 5FO7B 5EPAA 1DFQA 3GCWA 2VGDA 3F2ZA 4AGVA 1RUE3 2C1FA 2RDNA 3A4UA 1JH5A 4HG6B 3AB0A 2XLGA 2YV8A 2ADDA 4YG3A 2IVJA 1GANA 1MACA 1WCDJ 1GNHA 1V6NA 2VVDA 4GB32 2XR4A 1LCLA 4IV3C 4IDZA 1RUF3 1UNBA 3OGRA 2YU2A 1COV2 2VD7A 4QDRA 3WY6A 4P9IA 1SMVA 4CA9A 4W50A 5KHGA 2R7EB 1S0JA 1W90A 2A5ZA 2LM3A 4W6WA 3UGHA 2BJSA 3WOGA 5BY5A 5CFCC 1PMJX 1ND2C 2YY1A 3LDBA 2JE7A 5FYUA 1IPKA 2GNMA 3T0BA 2WNVA 1H2MA 2LTNA 4NJ4A 2X29A 4FCAA 4MXWB 4JZRA 2AEZA 2X09A 2VZQA 1IS6A 4HSJA 2Y6KA 1Q8QA 2W1UA 5C70A 2FDHA 2XJPA 2KR2A 4OCTA 5LA9A 4B4PA 2D3PA 1Y9MA 2XJTA 2QQJA 3IDCB 1IOAA 1V70A 1QJY2 3NAPC 3WDWA 3HNMA 4IE4A 5G04L 3ZN4A 4CDQB 5I0SA 1XYPA 2XGXA 4ISQA 5FY1A 1WD3A 1LGNA 1GZWB 1UMZA 4KI5M 5EV7A 1NXD1 3RJ2X 1YNAA 4EN7B 1O4ZA 4WV8A 3PDQA 3PTYA 4QGLA 4OI1A 3BPZA 2HEWF 3IN9A 3MIHA 2D6KA 5FIXA 2VMEA 2WZR2 4QPGC 3VDAA 4COWA 1W9WA 1IPSA 2HWF3 4CE8A 2WSUA 2ZHNA 3KT1A 2E51A 3K3OA 4UW5A 3FFQA 4JX0A 4RGKA 3VZLA 1A8MA 1QJZA 3VKOA 4CP9A 1DQ6A 4Z2AA 4ZZ8A 3S57A 1ND2A 4OHXA 1LR5A 2QQWA 3ECQA 4XFIA 4XJ8A 4OZXA 4AQSA 4DEQA 5FZ7A 4LT5A 4MGSA 1KDKA 2VUAA 4BXFA 1RUJ1 1TMF1 4WVWA 3I3DA 3P6BA 3VUOA 3NNFA 1G6NA 4S2DA 3AMPA 4CDWC 3H8RA 3MF6A 5LWBA 2R041 1ZRRA 3NAPA 3AVRA 5FR3A 1W8HA 1BEV3 3K4ZA 2DWRA 4RQPA 5E16A 5FY8A 3SH3A 3ZYRA 5IHRA 2VR4A 1OLRA 2ZA9A 3AL6A 1NXMA 1HV0A 4WVMA 3NJZA 2Q0AA 3BOPA 3P3PA 4QPGA 3B5LB 2O1QA 2UY8A 4HL0A 3OSDA 3NWKA 3OCPA 1YJKA 2ILMA 1H1AA 1QY4A 3FBMA 2QQUA 2WO7A 2YBKA 4IL7A 5CKQA 2YROA 4LBNA 2VQAA 5AFEA 2Y6GA 3AZZA 1ND3B 2XHKA 5FMBA 1I6XA 2RM21 5ACA3 2VH9A 2WKKA 3POJA 1GZTA 3U75A 4DZGA 1LU1A 1HLCA 1CIYA 4Y3OA 2VMCA 2JDKA 4XCBA 3LEGA 5J37A 2O8OA 5K7PA 2QZ2A 1H9WA 3RQ0A 1SLBA 1UZZA 3IPVB 4AVSA 5CKMA 4EZ4A 4INDA 2UURA 2EXIA 4FO9A 3LDRA 3VZNA 3ES1A 1E5RA 2E7AA 3MPPG 4LHKA 1VAKA 1V00A 1RGSA 4UF0A 3ZSLA 1C5HA 1UX7A 2G9ZA 4XUPA 1JYVA 2E7QA 3NSTA 1VP6A 4HZFA 2YDEA 4NPRA 4UFKA 1XYNA 5FOJB 1R1ZA 1ZZ8A 1GOHA 3I97A 1R083 3I49A 1TMF2 2RS12 2B8MA 2OKXA 3AP4A 5EJZB 1LOAA 5CAZA 3OYWB 4Z92B 2GAUA 1ACCA 4XJWA 2R042 2CHHA 1UZVA 4M01A 1WW4A 1AX0A 4DB5A 2CDOA 3BI3A 4A2UA 4P9WA 3RZGA 2ARAA 1AR63 1BQPA 4D69A 4FOWA 1JZ6A 1LHVA 4QQ2A 5JR2A 3B9CA 1C28A 2WINB 5DZFA 4YW4A 4GZ9A 5BNNB 2VJXA 3BCWA 1QMJA 3M3CA 1ASJ3 4A6SA 1HN0A 1L7LA 3EO6A 3NV1A 3WNKA 1R64A 4AHWA 2XOMA 3UJQA 4XOGA 3S0MA 1R1A3 5FZHA 5BNPC 2DV9A 2GMMA 2RM22 3AZYA 2VNRA 1NA1A 2RJKA 3BGAA 3LFIA 2B4KA 1F5JA 1US2A 4Q4W3 1O3TA 1EPZA 3CKHA 4Q5OA 2RR11 2F4LA 2Y38A 5GALA 1PNGA 3V0BA 2RVAA 5F7UA 2CGOA 3HR9A 1HRI1 4FXGB 4FPLA 4BK4A 4YGCA 3AYDA 4NVPA 4J1XA 5CB7A 4D94A 3JUUA 4NWWA 3RZHA 5FPZA 2CSGA 3MGUA 3POSA 4ZZ5A 1KRIA 3B3QE 4P5YA 4AVAA 1GLHA 2ZHMA 3WVJA 5J3UA 1JZ2A 4FTEA 5JXHA 4OULA 1XNTA 1B35B 3ASIA 4YGEA 3ZXAC 5LBEA 3B69A 5DDJ3 5FJHA 3WW3A 1CPNA 2C6SA 2ZACA 5F9TA 2KXLA 1W8FA 3OEBA 5T5LA 1SZBA 2VAUA 3NKTA 3ZXFA 5BNPA 3AP9A 3VBOC 4P9GA 3CMGA 4BZ4A 2VCCA 3C2UA 5A3TA 3WDXA 5J98B 1UPSA 4LIVA 4Y22A 4I02A 5IK4A 5FBZA 5IK7A 5BNQA 1Y7BA 3J9SA 4Q1RA 4NWVA 3LWCA 4CUCA 2WNUA 1J1LA 1GU3A 1S0FA 4Q4X3 5T54A 1CJDA 2GMPA 2ZX2A 2X05A 5EWSA 2XJRA 4S2HA 1BK0A 4GWJA 5IVBA 1K5MA 2BDRA 1Z78A 2FCUA 4IQPA 3NRUA 1TEIA 4E2QA 2G19A 1ZRDA 2J22A 2RJLA 1W2NA 2A6ZA 4P9JA 3QCWA 3PJQA 1E5SA 4XF4A 2EA7A 1J83A 3OBAA 2JWPA 4NHYA 2V09A 4BM8A 3KQRA 4YW6A 2VW1A 5FXXA 2HBUA 3R6SA 2RR12 1GNYA 4MX3A 1MVQA 4JRLA 1JW6A 3LEIA 4NIAA 1T2XA 3AZWA 1HRI2 4JTNA 4CDUB 1G9DA 1C1LA 4BLIA 3O1UA 3EQEA 3DKWA 4U2AA 2G4IA 2R1DA 2RS53 3DF0A 4UBHA 5JPNB 1ZNPA 2QQVA 4Y5SA 3EBRA 3VBHC 1F4AA 3IZOA 4P5HA 5C8CA 4Q0VA 5FPVA 4MADA 4ZU5A 1NYWA 2BZDA 5HCBA 1XQNA 4O61A 4A44A 3T4HB 4UT5A 5D21A 2GN7A 2Z4FA 3HN1A 2GNTA 2Q1MA 3DKQA 1VJ2A 4K6BA 4Q8LA 4YVSB 3AMHA 3MW3A 4OHZA 5BNOC 1WCKA 5H9QA 2HJIA 4PT6A 4DXRA 2EIBA 1J84A 3H50A 2BTVC 4AFMA 3WDTA 4DINB 1ZX5A 3FHQA 3Q8BA 3N9NA 5JZGB 1AL23 1G7YA 3I2KA 1J58A 2XVLA 4R4ZA 3QH7A 2HEYF 3W9AA 2VCMA 3K75B 3ZXDA 2PLV1 4OMDA 1QJU3 3D0SA 1DGRN 4CU9A 5C7GA 5E89A 3PL0A 3OY8B 4CEWC 2JD4A 3KD4A 3HVDA 4D6SA 1W6OA 2EF6A 4IEYA 2VOWA 3OG2A 4FPYA 4KQ7A 3RJRA 4Y4RA 3M3EA 2YYOA 4RSUA 4BOWA 4GD4A 1GQHA 5A1FA 1SLTA 2YPJA 3N35A 1C8M1 2VNGA 2BYVE 2EIEA 4XYXA 1HQNA 2QDNA 2A1XA 3LA2A 3LCPA 4XUQA 3QD6A 2ZGQA 4EE2A 2GNDA 3EMRA 2XPJA 4PLMA 3T09A 2W87A 4QHBA 2EAAA 1HRV1 1RUH1 3VBSC 2ORXA 1PMHX 2GDFA 4QPIC 1NLRA 2BOJA 4N90A 3CF6E 1MS4A 3J7HA 4Z8BA 4BQYA 3SITA 4LLFA 1QQP1 2ZGRA 2Q30A 3N7JA 1WD4A 3AFGA 2K0GA 4CEWA 4LBLA 4LBKA 2NP0A 4IE6A 2XONA 1MVEA 4BWOA 5LBCA 3H0OA 4OYUA 4FPOB 1NCRB 4DNYA 1ZZ6A 1CESA 1JUIA 2BBAA 4URTA 4QDSA 3WT3A 2DFBA 4LULA 4AHYA 1NQDA 1DDLA 4WM7B 2WYFA 4LKEA 2P3KA 4I0BA 4RA0A 3JB4C 4DOUA 4IV1C 4ARYA 2PLV2 1SQ4A 4XVHA 4LBQA 4XIOA 4QX3A 5FUIA 4UW4A 1J3PA 3E6BA 4XETA 5FY9A 3ZFFC 5K8SA 3V0AB 2AH2A 3J7LA 3KF3A 1GUIA 4QGMA 1OI6A 4AW7A 1ZBA3 2DBNA 3HBZA 4NN0A 4QDQA 5EXOA 2P1BA 2BP6A 4FT8A 5F8PA 5FKBA 1XU2A 1PIV3 3T30A 4GH4C 2ET7A 2H0VA 4HFSA 2JDHA 1REFA 2WAOA 3LIGA 4A7ZA 3JQXA 1C8M2 4QKNA 1F8VA 4AEDC 4JRAA 4CVUA 1H2NA 3UGGA 1GR3A 2P17A 3NV4A 1AF9A 5FO8B 1UZWA 4LJHA 1OOPB 1XYOA 5A7NA 1FNZA 1NKGA 3OGSA 2JXAA 3J8F3 3S5AA 3TWIA 4BE3A 4L92A 1S0GA 3SQOA 2HWE1 3PVNA 1QU0A 1RUH2 4OHVA 4BYYA 1N1VA 1OH3A 2DDUA 2VBDA 4MO3M 4NUBA 2ZAAA 4P9XA 5J1XA 1DYOA 3H42B 4DO0A 1X7NA 5J09A 4AFAA 3FLPA 4A6OA 5FYZA 5F37A 1QQP2 2HYKA 2AC1A 5DAQA 2ZX1A 2VZSA 4LE4A 2O14A 2UU8A 4BDVB 2W95A 3ZFFA 1V6MA 2PA7A 2I74A 3RDIA 1CAVB 3PMEA 5FAXA 2JDPA 3I2HA 3H1YA 3OTFA 2F17A 4GWIA 4QT6A 4YGBA 4AVBA 5JUVA 4GH4A 1XOYA 4MGQA 5A3LA 1MQTB 2IUWA 5FZIA 4QM8A 4IGOA 4HOOA 1RUF2 1OLME 2ENRA 3W5MA 1VBA3 2Q4SA 1H1MA 5FV3A 3WF1A 1ZYBA 5FP7A 3WNPA 2FHRA 2R49A 3C7EA 4MYEA 2LALA 1RXGA 2WQZC 2XXZA 1AX2A 2A6VA 2YFUA 4IEPA 4AZZA 1M06G 4I0WB 5C4WA 1LHNA 2R073 3BTAA 1OPMA 3BUCA 5T52A 4WVZA 2C9AA 2CY6A 2HLEA 2MHFA 4ES9A 4NIDA 3S30A 2J7MA 4F7ZA 4YW2A 2P3YA 1UW8A 1XNDA 4Q8KA 5A1LA 1GOFA 1RUNA 4JQTA 3TOJA 1WCUA 2E32A 1YJLA 3MF9A 4YM2A 2KD7A 3ZSMA 4B7EA 2E53A 3K48A 2Q8CA 3IB3A 3GHNA 1LJ7A 3GZUC 3HJRA 2HWE2 2UWCA 3FN9A 5EFUA 5FZOA 2H6BA 4LKDA 3RZLA 3WCRA 4BQ1A 1H2LA 1I3HA 5K0UB 2C26A 4QX5A 3DPRB 4ITCA 5FPBA 3O0XA 1ULPA 2YC4A 1AR81 3LPGA 3ACIA 4OI2A 1N3QA 4QD2A 3POYA 5FTTC 3NMBA 4YW3A 4IEUA 5HCAA 3Q9OA 2TUNA 3POEA 3E5UA 4UOJA 2UWAA 5F6KA 5A32B 4YPJA 2A6YA 2JX9A 3DGTA 5JIUA 5HCHA 3K46A 1LECA 1JBCA 2BWCA 4PF1A 5B4XA 3T2QA 3HQXA 1KJLA 4QMAA 3BODA 2QQNA 2AR6A 2YB7A 4N43C 3MLJA 4ZKTB 4BLJA 2PHFA 1L7QA 2UYBA 3BKZA 3SCFA 1WLWA 2GC0A 3BPSA 2IZWA 5FQ0A 1OD5A 4MVTA 1W05A 2J1SA 4QKDA 1AR61 1JYWA 1F5FA 1F4HA 1GSLA 4AGRA 3GYDA 3IM0A 2QE3A 3WP4A 4Y20B 3MIEA 4CCKA 5KHIA 4CDXC 2FZ2A 4QGNA 4XDOA 1IPJA 1GICA 2VTXJ 1YQ6A 2BVBA 4XJUA 5D8AC 1WLTA 2B39A 4UI9L 5FYTA 4QKBA 5FYCA 4F83A 4J6GA 1AR71 1W6PB 4HPKB 3T3YA 1R1A1 4JVAA 4XTPA 1AX1A 1XNKA 5FY0A 4COYA 3VD4A 5JPMB 3LKJA 4ARXA 3MIFA 1RB8G 5I0DA 1C57A 3PLQA 4YZ1A 3WF3A 4RR3C 1PO11 2X5IC 3VBUA 2YHJA 2RMU3 3AMQA 3C7OA 5ANNA 1CGPA 1FNYA 3OJBA 3GALA 4XPVA 4N43A 1UD1A 2ZOEB 4BH9A 3VD7A 1RIRA 3PU3A 4DXZA 4Y33A 4NHMA 3T2TA 3IDBB 1BXHA 2FMYA 3LSEA 1HJGA 3GZEA 4JDMA 5H9PA 4JKMA 5CFDB 1YI7A 3TEXA 2LUWA 5CADA 3I54A 3ZFEC 5FUNA 1OFNA 3ORJA 3TN93 3NL1A 5SV8A 4CDXA 2YC2A 4DUVA 2I45A 5J36A 2AENA 4QXCA 1JYIA 3RI9A 2IXCA 5F5CA 5I8SA 2HKXA 1W03A 5FXWA 4BPZA 5D8AA 5C3QA 5JXGA 3AM2A 3QOPA 1O3SA 3B9IA 1BBT3 2R6QA 5FDBA 1LGCA 2ERFA 3T0AA 1Q43A 1N1YA 2HH9A 4O9EA 2Y6JA 3IBMA 4LK7A 4Y5TA 1VRH3 1W8TA 3VHNA 3ZXEA 3KLSA 1DGLA 5GLTA 4QU1A 1AR62 5LA1A 5GLUA 1LULA 2WNOA 2YGLA 4L97A 3TNPB 2X5IA 3ZFGB 1AXZA 1VBC1 2Y0OA 2W3JA 1G86A 4I3GA 1WW5A 5IAXA 4FPKA 4YW7A 2QQKA 2BNNA 5FK7A 3KSCA 1OD3A 3NNLA 3FWEA 1RYYA 4M4RA 4XQWA 2NN8A 2Q8DA 4JGYA 5LASA 3BIEA 1AR72 4XCAA 1R1A2 3UKVA 3CJIB 1SCRA 1UYPA 2I07B 3ST7A 3IAPA 4AI2A 3HQRA 2GNBA 1WMDA 3ZFEA 2JJ6A 3FL7A 4QQHA 4Q4W2 5LATA 3UT0A 1EPWA 1PO12 1QOSA 1GWKA 2WFF1 4GULA 3C3VA 1UOBA 4N7IA 4PDWC 3WQ7A 4CEYB 5A3OA 3MEPA 2H6CA 2WL1A 1W6MA 4LO8A 5DMYA 2NMNA 4Y1ZA 4P9LA 4RFT0 3ITQA 3N36A 2ZGOA 1ULEA 2XBO3 1W6QA 2XJSA 3OBZA 4K7JA 4LQRA 5FZ9A 5ABJA 1O5UA 4G3YC 5C3PA 3VD5A 1VBD1 5FBJA 1WMFA 1UU6A 1UN1A 5FYVA 3CEWA 2BU9A 3E6DA 4A3XA 4DRVA 4EJRA 3WP5A 3AKRA 5C9AA 2XJQA 3HAGA 4MGKE 1ULDA 1Z0HA 3GXUA 3WLUA 4F3JA 1OQEA 3FFZA 1GP6A 2WDBA 1EYBA 1NAEA 5F5AA 1QXRA 1DGWX 4AQ6A 2JDMA 2QJVA 3HNBM 3QH6A 3VBFB 1MS3A 3W20A 3ZR5A 4JHTA 5T3NA 1OLMA 4G9SB 3LF7A 1H8TB 1OXCA 1V9U1 3BTZA 1J1TA 1CAUA 2FZ1A 1UCXA 1Q8OA 2HYXA 1VBC2 2X8KA 4KBZA 4YG6A 3CJXA 2WNVC 3IT8A 4YZ5A 2D6OX 3HD8B 2XJVA 4LUMA 1HN1A 1ZREA 2RDRA 2B7YA 4OVEA 4Z82A 3NJXA 1SBDA 1LU2A 1C5IA 2XHNA 4RS5B 1PO23 1B09A 4YFZA 2VVEA 4XE9A 5IATA 2DCKA 1EUTA 3H3LA 2JDAA 3ZYGA 4IEZA 1CPMA 2ZGSA 4TN7A 3KHBA 3U14A 1PVC3 2FMDA 2XL7A 4MXWA 4FPJA 4HMZA 3O1PA 3MICA 1MS8A 3RG0A 2XUEA 1VPHA 3QLQA 4TXWA 2WFF2 2DCZA 4FOVA 2ZBJA 3SC7X 5FYYA 1W39A 2CNAA 1OVSA 3K4DA 5EYYA 3ZMOA 5KXEA 3O1TA 3KCCA 4ZS2A 1O5LA 4DIQA 2VZ1A 1UYXA 3EXUA 3POWA 4CDQA 1ULGA 3FUQA 5GM0A 2BOIA 4E27A 4GIQA 1GZWA 4A42A 4HN1A 4DPNA 1VBD2 1PHMA 1RMU1 2BFUS 4K40A 3UL2A 2B46X 4XFCA 4BK5A 1VLNA 3I59B 4TWTA 5K9YA 4NIHA 1UU5A 4AL9A 3PIGA 5CIRA 1O59A 5FY7A 4GMP0 4BISA 1I5ZA 5IVCA 4AK3A 2CU5A 1GV9A 4JGZC 4CCDA 4FSJA 1OBNA 5L7OA 2D44A 3SHRA 1W28A 1MS0A 5LK5A 5HBAA 1G9BA 3WX5A 1H4HA 1KD7A 4B7KA 1A8DA 1CZVA 1ND3C 1G9AA 4XJAA 1XE8A 3AMNA 4B1MA 5CG8A 3WEZA 1YCIA 5FO9B 2WSVA 3T4VA 1V9U2 3AFKA 3O1MA 3KCYA 3G6JB 4RQPC 3LSDA 3KB5A 3M4FA 1QOOA 4XHXA 1DQ4A 4QWNA 3ZVXA 4E9KA 2VZTA 1AL0G 1H1IA 4ZONA 4OZOA 1FMD1 4K1YA 3K2OA 3PVOA 3ZYBA 1JU4A 3ENRA 2ZKLA 4V2WA 3WQBA 3OOXA 4IEOA 1EAH3 2BNOA 1EV11 1TNRA 3ATGA 2VVFA 4FQ4A 3RS6A 3MW2A 1OH4A 1QJX1 3OPZA 3P3NA 1GNZA 3AYEA 4B1LA 2VW0A 5C71A 2E9QA 1UKRA 1WLCA 3HMYA 1AVBA 2EALA 1FATA 2VNOA 3CHXA 4Q2FA 4XJZA 1REEA 2F6BA 2RS11 4JGZA 2CDPA 3K3NA 4C1XA 3K77A 1UPIA 1GWLA 1YQCA 1C4RA 4NRPA 4XUOA 5HXMA 4V1PA 2O0OA 3J26N 5KHHA 1ND3A 3JCIA 3RVHA 4E8DA 4YARA 1O3RA 4NAOA 1EP0A 3RRDA 3ZN5A 1U0AA 4EN6B 5A6ZA 1YQ5A 5E1RA 5IVEA 1LTEA 5DUUA 1RMU2 3U07A 1GZ9A 4JTOA 3NV2A 4K8FA 5HV4A 3MLKA 3WP3A 1POV3 4PI2A 3M3QA 1Q8VA 2GALA 1VBB1 1ONAA 1W8OA 1SDDB 1ZBE3 3D8CA 2DUPA 3IPVA 2WS93 4XQDA 4YGDA 5KHJA 4XBQA 2BW8A 1H0BA 1CVNA 3MFAA 4LO5B 3USUA 3H8OA 4IV3B 4LORA 1PGW1 1CAWB 1W8NA 1RUG3 2BBVA 4QXKA 1NUKA 1SEFA 5EZWA 4M4PA 1UZ0A 2J1EA 1BCXA 5CFCB 1XRUA 4HSLA 4MHUA 1W6NB 3I2FA 1GP4A 3DL3A 1OA4A 4MGTA 1UOFA 1VBA1 1QH6A 2E7TA 3OYWA 3PUIA 1FV2A 3N7MA 1IG3A 2VO5A 3JBG3 4CU8A 4DUXA 4C0HA 1FAYA 1W9SA 1LOGA 1FMD2 2WLPA 1IQAA 5JMCA 4HN0A 4JC1A 4ONUA 4AE2A 2DVFA 2JD9A 1W8WA 4ATFA 4IE7A 5CYYA 5C5UA 3JD73 1JHNA 1EV12 3FX3A 4FPCA 3HPNA 4AVTA 1QJX2 1B35C 2D6NA 2BFUL 2KA3A 4H2AA 4JDNA 3W59A 3NAPB 4CCMA 2Y34A 2ORZA 1NA1C 3ZLIA 3KT7A 1DU3D 4LEJA 5DPNA 2D5HA 1JZ4A 3MIBA 3PURA 4FFIA 1YQ8A 4H7LA 2AEYA 1DQ5A
chains in the Genus database with same CATH topology
4DRRA 1S0EA 2D98A 2QZ3A 3ZX7A 2YUEA 4XF3A 2CWSA 2NPIA 2Z5WA 5F6LB 4N7UA 2DVBA 4X8NA 3TBDA 2QDRA 4IEWA 4LNVA 2NQYA 3J4UH 3E5QA 2BEOA 3V65A 4Y1YA 1VBB2 2VY0A 5FMOS 2HWD3 1RVF3 4OFGA 1V6OA 4FP3A 4LUKA 3WR0A 4UBGA 2QQPA 1PGW2 5IUQA 3AJZA 2Z79A 4AFDA 3VDDC 4CDWB 1B35A 5JVVA 2XKPA 2D93A 1CIWA 2D6PA 1OPOA 2RS33 3WV6A 4XFHA 4YVWB 5F1RA 2C0ZA 4CRQA 4ES8A 1VBA2 2WNUC 4KGQA 1D0HA 1ZZ9A 2ZGKA 4KH9A 1CAXB 4M00A 1PZ8A 1QXPA 4B4QA 4RHV1 1Y43B 5JR7B 4AHXA 3DN7A 1K5MC 1PMIA 3PJYA 4GWMA 1O3QA 4QQLA 4X6QB 4EWAA 2A3YA 3E5XA 2G9GA 4Z1VA 1QGLA 1RL3A 1ULCA 4CP0A 5T5JA 1PGL1 1ZZCA 3ZYIB 4HLTA 1G9FA 1QNYA 3H7YA 3MPBA 3HT2A 1X33A 1J3QA 5CBLA 4YZ2A 1WBFA 3M7AA 1U5XA 2EAKA 1MS9A 2XVKA 3VDDA 4Q4Y3 3SMHA 3ES4A 2RMU1 1MEC1 4YZ4A 1FXZA 3RPQA 3PHMA 5C8CC 4MUVA 1VR3A 3UKTA 4CDUA 4Q4V3 3TN91 5HI0A 1J59A 2WWSA 5GLVA 1RUD3 4LO4B 1MS1A 2W08A 2VUJA 2OVUA 3KS7A 3M1HA 4AWDA 2TBVA 1V6IA 1TME3 1H8VA 1N3OA 4FTEA 2ZABA 3TNQA 5AC93 2ZPXA 3H8UA 3THPA 2CL2A 2SBAA 3IKWA 3RZZA 4RHV2 1H4GA 1KS4A 3ALQA 4LR4A 1AZDA 3LB9A 5CU1A 5JZGA 1PGL2 2DURA 3URFA 3UKNA 1LEDA 2DU0A 1DGWA 1V6LA 1RUI1 3FLRA 2VXRA 1DLLA 5FMOL 2ZKNA 4META 4MZUA 4MGYE 1YYNA 2HWC1 2MEV3 4MSVA 4YNIA 1BJQA 3AP5A 3A0NA 2RMU2 3FC0A 4Z07A 2A71A 1MEC2 3WUDA 1KQRA 3RYKA 3GHMA 4R9DA 5DG2A 1IHMA 3VZOA 4Y1VA 3E97A 5KXDA 2DFCA 1OA3A 4YM1A 5IT6A 4AI1A 4XTMA 1MZFA 3TN92 1PK6C 4E4DX 3AKSA 2ZHLA 4P9YA 4WZFA 5GJ6A 4A7YA 5GLZA 3VBOB 2R063 1J3RA 1QJY3 4PCRA 3L9JT 5FFOC 2YZ4A 4M3CF 3S6PA 2JG8C 4TZDA 1S0CA 2CAVA 5GZCA 1NCQC 1LGBA 1U5YA 1NCRA 4QPYA 2XUMA 1C3HA 2WZR3 4BHPA 2PN5A 2IC1A 3CLPA 2IXKA 1LODA 3R05A 4WM7A 3KZ4C 2ZAHA 4BA6A 4AFCA 3HT1A 4C91A 4LE3A 5GZFA 4HT1T 4XZPA 4FXKB 1SLCA 1RUI2 2YC0A 5F5QA 2YXSA 3SH5A 1SACA 1OLQA 1ENSA 1W0PA 5JWPA 1LKNA 3I7DA 2B45X 3V0AA 1XNCA 1UU4A 1RUE1 1PK6A 1DQ1A 2ZMNA 3ZSEA 2HWC2 4C0BA 2GC1A 1S0BA 1L3JA 4NOTA 2IFRA 2AZ5A 3GBWA 3VKFC 1MQTC 1W6OB 5J48A 4HVRA 4OUSA 2JG8A 1RUF1 2XVGA 1W0OA 1OOPA 1NCQA 3VBHB 3N4MA 2PHXA 2BVVA 4CP1A 4I2OA 3A0KA 3E6CC 3SISA 2D6MA 4XFBA 2XKOA 5BNOB 3B01A 2MNGA 5BYNA 1AYN3 4GMP3 3MI8A 3IMNA 4HETA 3MW4A 2XWJB 1UIKA 1CAVA 3VHPA 4EN9B 1JTZX 2ZGNA 4AEJA 1MQTA 1S0DA 1APNA 1H2KA 3INAA 5C4WC 1XNBA 4W6YA 1POV0 1RHI3 1NY72 4N53C 4EWEA 4XMIA 2HWF1 2PHUA 4IXLA 3GZTB 3SLIA 1VB2A 3JZVA 4OUMA 5CA6A 4W6XA 2ZS6B 1EAH1 1RUE2 1RUJ3 3I8TA 4XF0A 2I2SA 3U11A 5FLJA 3K51A 2JENA 2R043 3VKLA 2IFWA 1NOVA 3AK0A 5EJ3A 1CONA 3VBSB 1LHOA 2OYZA 2VOXA 1A6CA 4ZU7A 4QPIB 5DG1A 1DHKB 4TLFA 2ZHKA 5L19A 1QKQA 3EJKA 1BEV1 3ZYPA 4AVVA 2JE9A 3SNMA 1KFUL 1MZ6A 5AVPA 4JAAA 4E4ZA 2NM1A 4XFGA 1FOD3 1N1SA 3DPRA 4N53A 5L36A 2PHRA 3WG1A 2R0FA 1QDCA 2RM23 4RGGA 1YFXA 2JG9C 1RJ7A 2OA2A 1BMV1 4S2GA 1RUG1 2UYAA 4IV1B 2B5HA 2CWMA 5ACA1 5D1IA 2FQPA 4B3NA 1YHFA 2W52A 5BXXA 3ZFFB 2QCSB 5KC6A 1XXNA 2GN3A 2XPJA 2HWF2 5DUXA 1LRHA 4PLNA 4F8AA 1JN2P 2UWBA 3ILRA 4GH4B 4PIXA 2ES3A 2EVXA 4M0NA 2CAUA 3JD71 4AEDB 1EAH2 2PHDA 2AUYA 2JDZA 1SLIA 3FLTA 1LOCA 3OD0A 4U36A 1OHFA 4AI0A 1R081 2ZX3A 2W68A 3LOIA 1WW7A 3AXDA 4Q0QA 3VBUC 3ZN6B 4GQ7A 5CNAA 2Z2SB 1W6PA 1FI2A 2JG9A 1HW5A 5A33B 5GLWA 2UY9A 5I91A 5I8TA 4CZSA 1RJ8A 5CG9A 3LA7A 3AKTA 4LBOA 1AXKA 1BEV2 1HXS3 1DYPA 3ZFGC 1X8EA 2K2SA 1C8NA 2WNEA 2PELA 4DY5A 1ASJ1 3LOBA 4Y4YA 4GKXA 2WS92 2V5YA 3GF6A 2HWD1 1RVF1 4XBLA 4Q1PA 4E2GA 1MR5A 3WD5A 2VMGA 4JCKA 4K20A 5CFDA 1BMV2 1RUG2 1IKPA 2DF7A 3OGJA 4DMIA 2QFEA 2RR13 5ACA2 2GU9A 1E57A 2RS31 3RI8A 4Q4W1 4Q0UA 4IETA 1RUOA 4ATEA 4LO7A 4JGYC 5AFBA 5JOYA 3JD72 1GYKA 4SBVA 4AEKA 5C6CA 1MZEA 3ZFGA 4B8EA 1Z7S3 1ZZBA 3THTA 4KG8A 4XQ4A 5KWRA 5DDJ1 1R082 2XH6A 3TAYA 5L73A 4XIKA 3VGIA 3O14A 1YO8A 3CJIA 1LHWA 1LESA 3VHRA 3CL1A 4WZCA 2DVDA 2A73B 1WGPA 3WZ1A 4YM3A 1REDA 3WG2A 4H3WA 5ABJC 4PIYA 4YFWA 2D6LX 5H9SA 3CNAA 3OGGA 4Q4X1 2DYCA 1ASJ2 3MDPA 3VBRC 4CEYA 5C9AC 1CN1A 2HWD2 1RVF2 4JQRA 4Q4V1 3KCXA 1D4M3 3FZ3A 2DTWA 2VECA 3TB0A 2D5FA 2VMHA 1GFF2 4GWNA 4KU7A 2RS32 5I8YA 4XXAA 5AC91 2WQ4A 4ORFA 1CD3G 4FQZA 3M70A 4FTSA 2DU1A 4M3CB 1UZYA 4YG0A 4NHLA 1ENRA 4CDXB 1YUDA 5LRRA 3R4UA 3VBFA 4Q29A 5IK5A 1KS5A 4XW3A 1U5ZA 2EXJA 2RS51 2Y0IA 5D8AB 2DUQA 1HDKA 1QOTA 1WA4A 1H8TA 3MFCA 4XJ9A 1M4WA 3LGRA 3R4DB 3JU9A 4AXOA 1NG0A 3WHTA 3VBRA 2TEPA 3I4IA 3KT4A 5DDJ2 3RSJA 4H55A 1AUYA 2A6WA 3DV8A 4YZ1A 1YLLA 1FT9A 4RR3B 4AFAA 2V73A 2O8QA 2X5IB 2R32A 3ZPYA 4RS5A 2HWB3 2Z69A 2MEV1 5I0TA 2A3XA 1N47A 2G9FA 1UF2C 1V6KA 3VL9A 4GKYA 4CDQC 1ZA4A 1RUC3 4MXVA 3U10A 4XBNA 2A70A 2FBEA 4R9BA 4EWDA 1D2SA 1IGOA 1NQJA 1AL21 3KGLA 2BWAA 1X8MA 4HBNA 4K21A 2ZGPA 4Q4X2 3ZFEB 1QJU1 4COZA 4YYOA 3FUOA 4Y1XA 3VZMA 4Q4V2 1LOEA 1LB2A 5L7OC 1RUD2 3ZIXA 1C8M3 2AGSA 2HEVF 2R16A 3ZYJB 5DZGA 1IZ3A 3W58A 2R061 3I59A 4WVVA 4LBQD 1HIXA 1Q8PA 5JSRA 5AC92 3ILNA 1YXWA 3I2DA 3BOWA 1SLLA 1QWRA 1IS5A 1HRV3 1RUH3 4FOQA 1Y3TA 2RS52 5LRSA 1D0GA 3PNAA 4XXPA 3WW4A 4LTAA 2YGMA 4WM8B 3FHIB 4LO6B 3RMXA 1TE1B 4YW1A 4R9CA 1HV1A 1ZZ7A 1VAMA 3UJOA 1CAUB 2OIIA 2ZGUA 2MEV2 2WA3A 4PDWB 2A7AA 4X6RB 4R52A 4AG4A 3FE5A 5H9RA 1DG6A 2VPVA 3CO2A 4AI8A 4K1ZA 3SCGA 1H9PA 5B2GB 1DQ0A 1NE4A 2ZTNA 2IXIA 1AL22 5KXBA 4QQPA 3V56A 3HWJA 3IWZA 1QJU2 2YMZA 4P14A 3QACA 5JSPA 1OSGA 1CJPA 1YFWA 3D4KA 4L11A 1OQDA 4XEZA 3KGZA 2DCYA 4IEXA 1ZBA1 1ENXA 1PIV1 1JOJA 2R062 1AYN1 4GMP1 3WW1A 1VBE3 5JIAA 5JDBA 1I1EA 2PQQA 1YRZA 3R0RA 2HWE3 1O91A 4HK8A 5LEKA 1YIFA 1OMIA 2WNVB 4IV3A 1CAWA 3J8F1 3O0VA 5GZEA 4ASMB 1T6GC 3ZXJA 3BU7A 1A3KA 5HXVA 5I93A 5CFCA 1W6NA 1RHI1 5JAXA 2F4PA 5BNNC 2XG3A 2GH8A 3OBTA 2R0HA 1UIJA 4ISRA 2CGNA 4DFSA 4X8PA 3U0ZA 4OI0A 4MH0E 4OI4A 4RGAA 3IIAA 3CU7A 2Q1ZB 4I01A 1S2BA 2GMEA 4YVWC 1QH7A 5KXCA 1QF3A 1PZ9A 1RC6A 3O0WA 1ND2B 1O4TA 4Q26A 1IS4A 3N7LA 2IXHA 3VHOA 1Q56A 3LAGA 4JGZB 1ZBA2 2R071 1FOD1 1PIV2 2VOKA 4FPHA 1AYN2 2E6VA 3B00A 2P34A 3ZMNA 2XLFA 4UXAA 2ZGMA 5FLHA 4RQPB 4YRDA 4DS0A 3J8F2 2NZ9A 4LLOA 1O7FA 4HKOA 4WVMB 4CDWA 4QPGB 2RHPA 1H30A 2QUOA 1AYM3 1AR83 5FOBB 1HX6A 4YVWA 2DVAA 3USUB 2DUOA 1RHI2 5FCCA 2VMIA 4UW6A 1CAXA 4EN0A 3B7MA 1RUJ2 2K9ZA 3B02A 4HANA 4N9IA 1SFYA 3ZXLA 1WLDA 4FP2A 4K3UA 1ZRFA 3ZXGA 4Z2WA 1AR93 5FREA 2PYTA 3WINE 2NYYA 2BGCA 2D7FA 2KM2A 4LA2A 4YZ3A 3HIFA 3LA3A 2ZCWA 1YFUA 1F9KA 4MGIE 2X53S 3WNXA 4KNCA 4CDUC 4UW3A 1HXS1 1U5IA 3D5OA 2D3SA 3OBRA 1BVVA 2VOVA 2R072 5BV6A 5CVRA 2BQPA 1KITA 1FOD2 2PTMA 1AR73 4NR1A 1Q8SA 2D40A 1OFSA 2ZX4A 4C1WA 5T55A 1RINA 4XDQA 1R093 3D82A 2XJUA 4YSFA 1S55A 3WG4A 4DY3A 1ENQA 1PO13 3NVCA 4YVSC 1ZVFA 1HQLA 2AREA 1AJKA 3VV1A 2BPA2 2C5DA 4KG0A 2ZZQA 4COUA 1AJOA 5JZGC 1W2UA 4KWJA 2DVGA 2PAEA 3MIDA 4R9AA 4KU8A 4ZXKA 1PGSA 3NW4A 1NA1B 4G4FA 4TSVA 3O7OA 3S7EA 1IS3A 1Z7S1 4LBMA 4LBJA 4BMEA 4EROA 3V0BB 2NLRA 3M3OA 4D7YA 4MGZE 4CTEA 1NE6A 5JLVA 2GZWA 3BALA 4JV4A 1BBT1 4YVSA 4ZU4A 3SCHA 4E4SA 1VB4A 1VBC3 2OZJA 3H9AA 3FJSA 1FPN3 1HXS2 2CYFA 1VRH1 3H1MA 1DGRA 1GQGA 3AJYA 5JI7A 2QNKA 3M3IA 2IXLA 3RYPA 5KBFA 1ZRCA 4S2FA 3ACLA 1YWKA 2SLIA 1SBEA 4AHZA 5BNPB 3VDDB 4R8HA 3AYCA 3WP6A 1N3PA 4MV2A 4W65A 1Q3EA 4R4XA 4Y22B 4GALA 1D4M1 4AQTA 3OY8A 3ZSJA 2WFF3 3L2HA 3NV3A 4Y5Z0 2WNUB 2WFPA 1NCRC 1KJRA 4GB33 2TNFA 1D4VB 4NHKA 4AEMA 4L8QA 3VBOA 4XF9A 4KL1A 4PBPA 4WM7C 1K5MB 1HKDA 4K9SA 1COV3 1TQ5A 3ILFA 4D7TA 4EV0A 1XE7A 2B9UA 5GZGA 1DYKA 1VBD3 2IXJA 2Q8OA 3BB6A 4XF1A 3VL8A 5JI9A 1ULFA 5E8AA 2A75A 2XBO1 2R1BA 5A3MA 4OHYA 3RMYA 1Z7S2 4BIFA 2GSYA 1YFYA 1D2QA 4AF9A 2VG9A 3KM5A 4Q27A 1CX4A 3ZDSA 5DZEA 4O9GA 1BBT2 2HWB1 3QBQA 1V9U3 2Y26A 1OKQA 2OUHA 5DUVA 1OOPC 3WG3A 3OD4A 3RYRA 1VRH2 3WQ0A 4BIOA 5C8CB 1PVXA 1RUC1 2D3RA 1BYHA 1WCSA 4A7KA 2QKDA 1DF0A 1DBNA 2ATFA 1G9CA 2ZX0A 1Y9QA 1NY71 2WC2A 3V64A 3VBHA 4FTBA 2Q5TA 2ZZJA 2OUJA 1D4M2 1QXJA 3GZAA 1PNFA 1PO21 4PBOA 2OZ6A 1NLSA 2JKBA 2DCTA 1PVC1 1F2NA 3VKNA 3WXPA 5BNOA 4XFAA 1QNWA 1SFNA 4JDOA 4D3WA 3MZHA 4B29A 1DIWA 1VIWB 3L2YA 1RMU3 3JB8A 5KC5A 3WDVA 4LHNA 2WZPP 2XBO2 3ETQA 4M3CE 1SLAA 2XWBB 3PMSA 3IDEA 4PLOA 4HVOA 4GA9A 1LOBA 3ME2A 4IERA 5BUVA 1GBGA 2WT1A 2WLQA 1JUHA 4TYSA 3AP6A 3JQWA 2HWB2 4B4RA 3X29B 3S7IA 1S1AA 2XL9A 3B94A 3AXEA 2P37A 1RUC2 4FOYA 3AKQA 2P3JA 5FPXA 3VZKA 4EN8B 4CEWB 1FMD3 1DZQA 3WW2A 1PK6B 4HKWA 3VBSA 4LHLA 2Z42A 5K0UC 3DUIA 5T5PA 4QPIA 3DPRC 1EV13 4AFBA 1BVP1 1S2KA 2VQ0A 5BPXA 1QJX3 3ZXKA 1PO22 1G8WA 4QM9A 3WUCA 4XHBA 2JG8B 3D6EA 1S0IA 1TMF3 2RS13 1PVC2 4SLIA 1UAIA 1NCQB 2WT2A 3MLLA 3NKGA 4LBQB 3WCSA 1VBE1 1EY2A 2ZMKA 3WHUA 2CTVA 1HRV2 4I09A 4XFFA 2EIGA 3M2MA 1GKBA 3VLBB 3KMHA 4IEQA 2PHLA 4IV1A 2VULA 1YIPA 5FRAA 1VBB3 4FPFA 2E63A 1BZWA 5T50A 1POV1 2PHWA 2DTYA 5DXDA 5K0UA 3GBGA 2CGPA 1ZBE1 1A78A 2ZJCA 2WS91 4L99A 5AVAA 4M0HA 3TRSB 1OQ1A 5C8WA 5E88A 4AEDA 5EYXA 2EXHA 2IWGB 1IKQA 5GKAC 3MYXA 3UV9A 3FBYA 4C90A 3USSA 2PFWA 5A32A 4HVQA 1FX5A 2P2KA 3ZN6A 1PZ7A 3AX4A 5A33A 3JBG1 2D97A 2GC3A 1KXGA 3RWNA 1BK1A 5JCTA 2ZGLA 3SH4A 5CFDC 1QHDA 1ZM1A 3D0JA 4YLZA 4J1WA 4YM0A 2JECA 4N9HA 4Y20A 3H1WA 1WW6A 3M8LA 1VBE2 3H7JA 1QDOA 4PQ9A 3N7KA 1CR7A 1X36A 1CQ9A 2VU9A 2W0XA 4FPEA 3ZSKA 5C4WB 4HPKA 4H14A 4MLOA 4KWKA 2DCJA 4N53B 2XB6C 4CP2A 1AYM1 1F31A 4FAHA 1U12A 3AKPA 3SXWA 1PM7A 3H3UA 3NO8A 1I9RA 3O5SA 4L9BA 1GZCA 4I30A 1ZBE2 1LENA 1ALYA 1FV3A 4WBBA 4PJYA 3OF1A 5LEJA 3CJIC 4DQAA 2WT0A 3EHKA 3WQ1A 2ZMLA 3AYAA 3AMMA 5J96B 1AR91 3APBA 4IESA 1HRI3 1KFXL 4RHV3 1YI9A 2A6XA 4AQ2A 1JYCA 1OA2A 4AI3A 5DUWA 4LT5A 2W39A 3JBG2 3WDYA 4CEYC 4LA3A 2A3WA 1DQ2A 1RITA 1X82A 2OPKA 3ROUA 5I0UA 2MPFA 3B93A 1O4YA 1UKGA 2ET1A 1MZ5A 3R4SA 5I0RA 2ARBA 5JOWA 2BNMA 2JG9B 1LHUA 4YW5A 1HQWA 4AYUA 5JOZA 4XMAA 4L2NA 5FLIA 3GNEA 1R091 5FQ0B 1LOFC 1WUVA 5SV5A 4I0AA 3BIWE 1RTVA 1MEC3 3N3HA 4FVVA 3VKMA 2CV6A 2B42B 3VBFC 1AYM2 1C1FA 3T1LA 2ETEA 1AR82 4Q4Y1 4QQOA 5HCFA 4GXLA 2VW2A 1H8TC 4XILA 4ASLA 4KWLA 2ARXA 3O12A 3MIGA 2AYHA 2PHTA 2WJSA 4M3CA 5IK8A 1Q5OA 1N1TA 4E2SA 1DZTA 4I3PA 3VBUB 1VAVA 4RS5C 2WA4A 2OW4A 2N7GA 1RUD1 5J7MA 2NMOA 4N43B 4Y24A 4HKLA 1AR92 3GBFA 3UK9A 1NZCA 2GC2A 1TME1 3WDUA 1LOFA 3PVBB 4PF5A 4RR3A 2BUKA 2H0BA 2JICA 3G7DA 4HK9A 1UX6A 1FPN1 1JXNA 4H7MA 3VN4A 3AZXA 2D43A 2XLAA 3T1MA 4RD7A 1RUI3 4D7SA 4OHWA 3ZO0B 1AHSA 2QVSB 4WM8C 5GZDA 1MS5A 5JOXA 1R092 1SDWA 2HWC3 1LEMA 4IEVA 4BMBA 2JEMA 3AZVA 1VALA 4GB31 2PAKA 2GH2A 2EXKA 4FAGA 1BKZA 4Q4Y2 4Y1UA 1FYUA 1WBLA 4KBBA 2PLV3 1COV1 4JGYB 1AXYA 2ZGTA 4Q0PA 5TSWA 3FMGA 1XU1A 4AGGA 3U4XA 4FPGA 4QU2A 5LK7B 4RL7A 4PIZA 4Q0SA 3RNSA 1X50A 4BCUA 5JSOA 1SBFA 2PAMA 2R30A 3AP7A 3LZZA 4KGGA 4WM8A 4CYDA 1W6MB 2WIIB 3H3ZA 1TME2 4FBFA 3ELNA 1QJY1 4COVA 1URXA 4Y26A 2RE9A 3PVEA 3TYJA 3ZIWA 1W6QB 5ABJB 5T5OA 1FPN2 1UL9A