5ABJA

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
296
structure length
286
Chain Sequence
DPIADMISLTALQVLPTAANTEASSHRLGTGVVPALQAAETGASSNASDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGTEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
molecule tags Virus
molecule keywords VP1
total genus 47
structure length 286
sequence length 296
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjA00
5BNOA 2FZ1A 4QPIB 1MEC2 1NY72 4JGYC 1VRH3 1ND3C 1COV2 2WLPA 5BNOB 4IV1B 1NCRA 1POV1 4AEDC 4GH4A 4Q4X2 4YVSA 4N43A 2DF7A 2FZ2A 1B35C 4GB31 4FTSA 4QPIA 1AR72 1OOPB 4RHV1 1VRH1 1EAH1 4WM8A 4CDQA 1HRI1 3ZFFB 2BBVA 2HWE2 1RUI1 5C4WA 1FOD1 1FOD2 1AR63 1POV3 1RHI3 3VBHC 2RS51 3ZFEC 1COV3 1H8TA 1HQNA 1HXS2 1RMU3 1QJX2 3JBG1 5ACA2 1QQP3 1VB2A 1VBB1 5ACA1 3JD73 4SBVA 2HWC3 3CJIA 1TME2 2ZAHA 4Z92B 1W39A 1QJZA 1AYN1 1F8VA 1H8TC 3J8F1 1QJU2 3J8F2 1H8TB 1QJU1 3JBG3 4IV3C 1AR82 1VBC2 4RFT0 1AR62 2HWB2 4GMP1 4YVSB 3LOBA 1AR73 4JGZB 2R072 5JZGC 4QPGA 1D4M2 1OOPA 1HRV3 1AYM3 1TMF1 1ASJ1 4RR3C 4WM7C 3VBRC 1PO21 1VBA1 1COV1 1PO22 5C9AC 4GH4B 1AR93 5BNNA 4CDXB 4Q4X1 1RUF3 1FMD1 2X5IC 3IDEA 2WZR2 1AR71 1RUF1 2MEV3 4YVWB 5AC91 4NWWA 1RUI2 1SMVA 1OPOA 4IV1C 1HRV2 4N43C 1VBE2 2RM21 1PGW1 1C8M1 2BUKA 2PLV1 4N53C 1BMV2 1PIV3 1AYM2 2RS32 1RUD2 4YVWA 1TME3 5L7OB 4Q4Y3 1HXS3 2X5IB 1ND2A 1DDLA 1RUC3 1PVC1 1QQP2 5FMOS 1X33A 4RQPB 1ND3A 4CDXC 1PGL2 2RR11 5BNNB 1ND2B 5CFDB 1NA1A 2RS13 2VQ0A 4GH4C 1RUJ3 2R071 1K5MA 1E57A 1VBD2 1AL22 5A33A 3VBFA 4AEDB 4CEWB 1BBT1 1GFF2 5K0UA 2HWF2 4QPGB 2WS91 3CJIC 4Q4V2 5A33B 5BNPC 1EAH3 1F2NA 1VBA2 4GMP0 1R1A3 4Q4W2 4CDWB 5K0UB 3VBFC 1BEV2 2WFF1 3JB4C 3ZFGB 1BEV1 1RUD3 2WFF2 4Y4YA 3VBUC 4WM8B 3VDDC 4NWVA 1R1A1 1RMU1 1ZBA2 1V9U2 3VBSC 2WZR1 1RHI1 1PO12 5ABJC 2MEV2 1RUH3 2GSYA 1FPN1 2R063 1NCRB 4CDUC 1IHMA 2BPA2 1RUJ2 3DPRC 2HWF3 2HWD2 3VBUA 1RUJ1 1WCDJ 5C4WB 1QJY3 1TMF3 2XBO2 1CJDA 1BMV1 4CDWC 1PIV1 1EV11 1VBE3 1MEC3 3ZFFC 2RS33 5C8CA 1OOPC 1ZBA3 5BNPB 5JZGB 5D8AC 1RB8G 1A6CA 4QPGC 1RUG3 1C8NA 1B35B 2R042 3J8F3 4RS5A 3TN93 5AC93 1AR83 1RUG1 2RMU3 1AR91 1RVF3 3DPRB 4GMP3 1VBD1 2BFUS 1MEC1 1NY71 4BCUA 1ASJ3 5BNNC 4RQPC 4RS5B 5D8AA 2HWE3 4FSJA 1VAKA 1PVC3 2GH8A 2RS12 3NAPC 3TN91 1VBA3 4LLFA 1TME1 5FMOL 5J98B 3VBOA 5ACA3 1AYN2 4RHV2 1HRI3 1ZBA1 1RVF2 1RVF1 4N43B 1QJX3 5CFDA 1RUE2 1BBT3 4GB33 2RM23 2HWB1 2TBVA 1BEV3 4EJRA 1ZBE2 2MEV1 1QJU3 3ZFFA 1QJX1 3JBG2 1D4M1 2WZR3 5D8AB 2WS93 1PO13 1TMF2 4CEYC 3NAPA 5C9AA 1NA1B 1PIV2 1RUC1 2QQPA 1VBB3 2HWB3 3VBHA 4RHV3 1QJY1 1R081 3NAPB 4GB32 1VBC1 3VBSA 1AR61 5L7OA 1VRH2 5CFCC 1HRI2 4PDWA 4RS5C 4Q4Y2 4CDUA 4Q4Y1 4YVSC 2RMU2 2ZTNA 3VBOC 1HRV1 3FBMA 1ASJ2 4Q4X3 2XPJA 5BNPA 5K0UC 1VBB2 2RS11 4AEDA 4CEYA 5DDJ3 2RS31 1FPN3 1FMD2 1K5MB 1Z7S2 1FOD3 4FTEA 3JD72 3DPRA 3JD71 1HX6A 1EAH2 4PDWC 1AR81 5C4WC 2RR12 5CFDC 1NG0A 1ND2C 1RUE3 2WFF3 1VBE1 1K5MC 1ZBE1 5C8CB 1AL21 5ABJB 1C8M2 1NCQC 1PGW2 4JGZC 1BBT2 1AYM1 4IV3B 1AL23 4Q4V1 2R062 3VBUB 3M8LA 2R061 1Z7S3 3ZFGC 4IV1A 4Q4W1 2R073 1QJY2 5DDJ2 1R082 5DDJ1 2RS53 4RQPA 1FMD3 2BFUL 4JGYB 2RR13 3S6PA 5CFCB 3CJIB 2X5IA 1RMU2 4Q4W3 4CEWC 1VB4A 1RUF2 1RHI2 4Q4V3 4YVWC 5AC92 1PO23 3HAGA 2RMU1 3ZXAC 4Y5Z0 5A32A 1V9U3 1MQTC 1NOVA 2HWC1 1C8M3 2PLV2 2ZZQA 1MQTB 5A32B 4PDWB 4RR3B 4WM7B 3VBRB 1RUH2 1Z7S1 1VBC3 1PVC2 1QQP1 1AYN3 1V9U1 2WWSA 4N53B 5CFCA 1X36A 1PO11 1ND3B 2XBO3 1FPN2 2IZWA 1D4M3 1R091 1AR92 2RM22 1R092 5JZGA 4CDQB 4RR3A 4WM7A 2XBO1 3VBRA 1CD3G 4IV3A 4CDWA 2HWF1 2WS92 2R043 1AUYA 1NCRC 1RUD1 1EV12 1NCQB 4N53A 1ZBE3 5C8CC 3TN92 3VBSB 4JGYA 2R041 1VBD3 5FOJB 5C9AB 4WM8C 3VDDB 1PGL1 1R1A2 4FTBA 3VBHB 5GKAC 1RUI3 3VBFB 2HWE1 1NA1C 1R093 1AL0G 4CEYB 3VDDA 1R083 2RS52 2Y26A 1HXS1 2HWD1 5LK7B 1EV13 2HWC2 5J96B 3ZFGA 2PLV3 3VBOB 5BNOC 1RUC2 3JB8A 4CDUB 1MQTA 1M06G 3ZFEA 4JGZA 1RUH1 1NCQA 4QPIC 1B35A 2HWD3 1POV0 1RUE1 5L7OC 4CDXA 1OHFA 4CEWA 3ZFEB 4CDQC 1RUG2 5ABJA
chains in the Genus database with same CATH superfamily
2VNRA 3KF3A 5BNOA 4R9CA 4IEQA 4ES9A 4EQVA 4QPIB 1DZQA 1LJ7A 1MEC2 3NV2A 5L9BA 5FAXA 3DGTA 3RZJA 2AZ5A 2PFWA 1ND3C 5IAXA 2PHTA 2QQWA 1I3HA 1BQPA 1J83A 2PA7A 2ZEWA 3Q8CA 4FPJA 4NN0A 5GZDA 2NMNA 3E1F1 3LSEA 5A3MA 1WW7A 4W6XA 3IIAA 4Y5SA 2JECA 4GH4A 2CY6A 2TEPA 4LITA 4Q4X2 4S2FA 3ZYHA 4JC1A 3U0ZA 4LBQD 2LUWA 2YC0A 2DF7A 2FZ2A 2QVSB 4BYYA 4FTSA 4E27A 3LSDA 4MYEA 2AGSA 4Q8KA 2VCAA 3CL1A 1TE1B 4LO5B 4QKNA 4Y20B 4EZHA 4AHXA 3KT1A 4XBLA 4NRQA 1SHWB 1J3RA 4BE3A 4A45A 3O0XA 2BBVA 2HWE2 3J7MA 4GKXA 4P9YA 3BYWA 4AVCA 3VGIA 2DVBA 3H3ZA 4DNYA 3AX4A 1RHI3 2JDYA 2K2SA 4Q0UA 1QEXA 3BUCA 2RS51 1BXHA 4XZPA 2Y6KA 1ZZ9A 1F4AA 4MGZE 5A3UA 2YXSA 2YPDA 3ACHA 4GWIA 3W58A 1VB2A 3DV8A 5ACA1 2VVEA 5I8TA 3H8XA 1REEA 5L9VA 4B1LA 3ZM8A 1DGRN 4XHBA 3T1LA 1RUOA 1IPJA 2B9VA 3MIHA 2WA4A 1W0OA 1PZ9A 1ULDA 2XUMA 5FREA 1HQLA 5A3WA 3MPPG 3SEEA 3S57A 3DL3A 5FJKA 1AYN1 1HB4A 3QOPA 4LT5A 1DIWA 4Y5TA 3J8F1 3J8F2 1WCQA 3OBZA 1GZWB 1QJU1 4LO8A 3RZLA 3I2JA 3LPGA 5F3GA 4IV3C 1PK6A 3HNBM 3HQRA 5I8YA 4WZFA 5IVEA 2ZJCA 2D5FA 2HWB2 3NMBA 1AR73 3I54A 1O3RA 1GQPA 4EROA 1IG3A 4QPGA 1D4M2 1CQ9A 2A5ZA 4DS0A 4G3YC 5FPVA 3SQOA 5GALA 1HRV3 2D43A 2XGXA 2IXJA 1ASJ1 2Y6JA 3M1HA 4QQ2A 4XQDA 5F3IA 5FLJA 3WR0A 2IXIA 3R4DB 1VBA1 1COV1 4N9IA 2QDNA 1MR5A 2GH2A 5C9AC 1I6XA 1AR93 1IS3A 2G9FA 2W87A 4M3CF 1LHNA 4LKEA 3UK9A 5BNNA 4I02A 4CDXB 5FY4A 4B4PA 4AEJA 1U5ZA 2XDVA 5FZFA 5EJ1B 4DUXA 4EN9B 1VJ2A 4JKLA 1MZ6A 5B2GB 2VL4A 2DCKA 1OURA 2XWJB 2A6ZA 1AR71 2D3RA 2P3YA 3B01A 3NJVA 4LQRA 4QGNA 1RUF1 2OUHA 4XDQA 5AC91 4LO6B 4A7ZA 4NWWA 1JZ8A 4GD4A 1SMVA 1Q43A 2JDUA 3SLIA 3VD5A 1GNYA 1FAYA 5C3OA 1YQ6A 3CLPA 1JYWA 3ORJA 4J25A 2DCZA 4IDZA 3WP5A 1C8M1 1PGW1 1CPNA 1GOGA 3AJZA 4ZKTB 2WAOA 5FZIA 4KWLA 2JEMA 4BHPA 4V2WA 3JQXA 5KXEA 4YVWA 4MZUA 4J6GA 4PLMA 5HCFA 3RZKA 2BWAA 1XXNA 1YLLA 2OZ6A 3I2DA 5A7QA 4HVOA 2GC0A 1RUC3 2SLIA 2R6QA 3ZIWA 1UYXA 1QQP2 5FMOS 2ZHNA 5HV0A 1W2TA 4I3GA 5DAWA 1HB3A 4CDXC 4FAHA 1K42A 4Y33A 2VOWA 4QWNA 3MFAA 4P5YA 2WO3A 1Y3TA 3OBAA 1US3A 1WW5A 2QQVA 4JAAA 3VZNA 1RUJ3 2R071 5CU1A 5CA6A 1CAVA 1ODMA 5A33A 3RGBA 3VBFA 2XQRA 3LIGA 2P3KA 3FC0A 2N7GA 3WHUA 2NMOA 4UFKA 2DCYA 4YFWA 4KQ7A 1VIWB 2VCBA 1BBT1 2VH9A 3WDXA 4XF1A 3WCRA 4Y1YA 5FZ4A 2WS91 5BNPC 3FFQA 3C7HA 2WN3A 1UXZA 1UF2C 4Q4W2 1JUHA 1Q8SA 1FV3A 2H0VA 3DCQA 3U07A 5K0UB 1ZZBA 2D3SA 2I07B 4YGDA 1BEV1 1O6UA 3CKHA 4HBNA 3U11A 3MF9A 4NWVA 1C57A 4P02B 5E6HA 4DB5A 3AP5A 1CONA 1UY1A 2WZR1 4FBFA 2VOTA 4PIYA 3NV1A 4MGQA 5IWFA 4NIIA 1FNYA 1W3VA 4AVVA 3DYPA 4WVMB 5GLTA 1HJFA 4AHWA 2XVKA 1WCUA 1W2OA 1NCRB 1O5UA 2R063 4K21A 4CDUC 2YROA 5LA1A 2BNMA 2NYYA 4XFIA 4IXLA 4YYOA 4OCTA 1WCDJ 5C4WB 1CR7A 2RVAA 1NLSA 2VY0A 4CA9A 3ZR5A 3PJQA 2L9LA 5FJHA 4B7KA 2YZ4A 1PIV1 1E5SA 4CCMA 5FR3A 1EV11 1PM4A 3MGUA 5GLZA 1ENQA 1OA2A 1OOPC 1ZBA3 2B7YA 5BNPB 4A44A 5JIUA 4QMAA 3RQ0A 4KH9A 5FCCA 2R042 1HN0A 2ZKLA 3NV4A 1TNFA 4YM0A 3V65A 4BZ4A 4XFBA 4DRVA 1O59A 4CCNA 1S0JA 2JDPA 3CBNA 1Q8OA 1PK6C 2J1VA 3O0VA 3T4VA 3ZSJA 1RUG1 2DV9A 3CZJA 2WC2A 1SDDB 3MIBA 2WINB 1BCXA 2Y8KA 5FK7A 3OEAA 4ZZ8A 4KU8A 5J36A 1LEDA 3FHAA 1WWYA 1APNA 5A6YA 2KXLA 3ZOIA 5A3OA 1ZRIA 1MS3A 1YQ5A 5FZDA 1PVC3 3BN6A 3WDWA 3ZXGA 5ABJA 3BOPA 5CNAA 3NAPC 1YRZA 1Q5OA 1B09A 3ZXEA 1OSGA 3T30A 3LDKA 1AJKA 5J98B 1G9BA 4KBBA 4XHXA 3GGLA 2AREA 5ACA3 2DBIA 1W8WA 1AYN2 3PIGA 1UD1A 3QH7A 4RHV2 5FZMA 1DZRA 1PX4A 2WWUA 2R1DA 4C1WA 3N9MA 1A3KA 2E7TA 1W90A 1ZVFA 5FMDA 5C71A 1BBT3 1LOEA 3WDYA 2HWB1 4P08A 4UBHA 2XG3A 1ZBE2 2MEV1 1UZYA 2DVGA 3MYXA 4LBJA 4XXPA 1OQ1A 4DXSA 1QJX1 3JBG2 1D4M1 5E8AA 2VZPA 4E4DX 1QY4A 3HN3A 4BJ0A 4IW3A 4FOVA 1YI7A 2YBPA 2D6PA 1PO13 3VZKA 1TMF2 1F9KA 4CEYC 4K1YA 3OY8A 4NPRA 4GKYA 5C9AA 4P00B 3SMHA 3BKZA 4K40A 4NIHA 1RUC1 5ANNA 2VECA 3KCXA 4GXLA 3T1MA 4AFBA 1GWMA 4QGLA 3PUHA 1G9CA 2W3JA 4K9SA 5FO7B 3NAPB 5FZOB 3S0MA 1Q8VA 1GP5A 2E32A 1X9PA 4XXAA 2DCJA 3O1VA 3IMNA 1ZZCA 3K2OA 1UY4A 4QHOA 1AR61 4NE9A 4F83A 1WGPA 3IZOA 2VXJA 2IC1A 5L7OA 5JWPA 3ZO0B 1UY0A 2HEVF 4Y20A 1W05A 1L7LA 2GALA 4RS5C 5DQ0A 3THDA 1IS6A 4IGQA 4MSVA 4CDUA 5EIYB 1V6IA 3GZAA 3WW4A 5FWJA 4AI0A 5IVYA 1T2XA 2X09A 4M0NA 1WKYA 1C5IA 1J58A 5BNPA 5FBJA 3SITA 1WA6X 3PUSA 1UZWA 2P37A 4QB1A 1FT9A 3HR9A 1VBB2 4M4RA 3RFRA 4YZ5A 3OY8B 4IEXA 5AVPA 1G9AA 2A1XA 5ERLA 5CBLA 4YM2A 4MUVA 2PHFA 2RS31 3N9NA 3HNMA 1CVNA 1K5MB 2VQUA 4JQRA 5CEHA 4OZOA 2WO2A 5CG8A 5FMBA 2D6LX 3J7LA 5J1XA 3JD71 2D44A 2XLFA 1Q3EA 5FFOC 4HT1T 4XUTA 1HB2A 3ACLA 2V5DA 5F5QA 1N47A 1JHJA 2BERA 4ZY9A 4ITCA 3ZKYA 3MHZA 2VNGA 2WZEA 4OUSA 1BYHA 4UFHA 2RJLA 3WQ1A 1S55A 2ATFA 1DLCA 2WFF3 3ES4A 2CNAA 4JKMA 5L73A 5JLVA 4BB3A 4YFZA 2CU5A 1W2AX 1OH4A 1LHWA 1AX2A 5JCTA 1RTVA 1BBT2 5JXGA 4DQAA 4AFMA 2FHRA 2G19A 1LHOA 4UXAA 3S7EA 3NSTA 3R05A 4LNVA 3BCWA 5FYBA 3SCFA 4XACA 1KDMA 3AYCA 2PHUA 2YC2A 2EXHA 3N9PA 4Q4W1 1K5JA 3NL1A 1QJY2 4D7YA 3I49A 3OEBA 1R082 3PUAA 3LE0A 4RQPA 4XAEA 2ADDA 4GJZA 1FMD3 4QDQA 1UPSA 2DURA 1WMXA 2ZMLA 4IETA 4LO7A 1O91A 4IE0A 2ILMA 2X5IA 2EXIA 5DAPA 3TEXA 4OMCA 5FPUA 1J1TA 4AQ2A 3DECA 4CUBA 1XE7A 2ZHLA 1VB4A 4ZZ5A 3ELNA 1ZM1A 1RUF2 3O14A 4CSWA 4Q4V3 3TRSB 1W6MB 3KZ4C 3ILFA 5AFBA 2O8OA 2JX9A 3IBMA 4U2AA 4NPLA 3ITQA 1ENRA 3BU7A 4R52A 2NZ9A 5A32A 2PAEA 1NOVA 1UAIA 1SLBA 3OB8A 5KXDA 1X8MA 4QXCA 3HQXA 5B4XA 3I2HA 3N9QA 3SCGA 3ZXJA 4BQ3A 1MQTB 4YLZA 4C91A 5FYUA 2D6OX 5FWEA 2WUHA 1JN2P 4QKDA 3THPA 2PHDA 1YXWA 4ASMB 3DKWA 4UYBA 1YHFA 4AE2A 3LFMA 3AZWA 4FXKB 1E5HA 3SISA 4XUOA 1V0AA 5BV6A 1SLTA 4LBLA 2BYVE 1DP0A 1VBC3 1QQP1 2WQ8A 4QB6A 2BTVC 2YV8A 3J7NA 5IW0A 3AMHA 4A42A 2ERFA 1PO11 3D4KA 2DUOA 3ETPA 5JAXA 1ND3B 4M01A 4IQPA 1REFA 3RS6A 4R4ZA 1H4GA 1D4M3 1AR92 1UMIA 3A4UA 1W6OA 1Y9QA 1QDOA 3LOIA 4FOQA 3T09A 2DUQA 4RR3A 1NZIA 1PVXA 4BQ5A 4IV3A 5A7NA 2LW8A 4XJWA 3AP9A 4CDWA 3CF6E 3JQWA 3DF0A 3LQCA 3MLLA 4RL7A 2WS92 5GLUA 5T50A 3UGFA 2ZACA 4NAOA 2FBEA 1MZ5A 2VZOA 4KWJA 3V0AB 5J37A 3IPVB 4UW4A 3ZKUA 3VBSB 3IDBB 3OYWB 1V6NA 3WF2A 4JGYA 3V0BA 1VBD3 1AZDA 1CZVA 3KVAA 2VAUA 5CIRA 1E5IA 1GOHA 3TYJA 2R49A 4D3WA 1S4CA 3CDZB 1NA1C 2NN8A 4JHZA 2IXHA 1AL0G 1XYPA 4E4ZA 3BB6A 4XTMA 3B7MA 1PGSA 4COUA 5LBBA 5KHIA 3BPSA 3J4UH 1HXS1 2GU9A 3KM5A 4LKDA 2HWD1 5BUVA 3EB7A 3URFA 2DUPA 5EFUA 2W0XA 1EP0A 4H7LA 1OA3A 4FFFA 5DZGA 2PLV3 3ZLIA 2HYXA 2Q1MA 3VBOB 1T6GC 4Y3OA 1RUC2 1GWKA 2ZEXA 3JB8A 3I8TA 4HMZA 3AJYA 3O1SA 1IPKA 1M06G 5FPXA 3ZFEA 4XOGA 2V5YA 3RRDA 3UT0A 1SBEA 4XUQA 1UKRA 2VPVA 2NM1A 1RUE1 4FPHA 2XONA 5FY9A 5A7OA 1W6QA 4P9XA 1G9DA 1Y7BA 2WIIB 3OGJA 4KL1A 2WNUC 2DFBA 3R6SA 4LBNA 4E8CA 3ASIA 4Y22B 1JS9A 3WQBA 2FZ1A 3H42B 4K7JA 2B4KA 2GN3A 3NWKA 2ZOEB 4IEPA 4A3ZA 4LHLA 4JGYC 5LY2A 1VRH3 2XHKA 3H8RA 1HKDA 1WW4A 1RXGA 2XXZA 3LZZA 4XPVA 4B8EA 2P6CA 4XFHA 1QXRA 1AX0A 3E5XA 2QCSB 4IV1B 1H1MA 3IM0A 2GC1A 4Z1VA 3VHOA 4WVVA 4AEDC 4AK3A 2PAKA 4LEJA 5H9SA 1QIQA 4NPMA 1L3JA 3WF3A 4AG4A 2GDFA 5KHHA 1ONAA 2JDNA 4EWEA 3FHIB 3MBWA 4GB31 4PIXA 4BQXA 4QPIA 1CPMA 1TG7A 1W6NB 3H1WA 4WM8A 4E2GA 1BZWA 2EAAA 5K9YA 1RUI1 1G9FA 1FOD1 2UY9A 3POSA 2JE7A 1FOD2 4PLOA 1H1IA 3POGA 1SLCA 4MADA 2YU1A 4CU6A 5GZEA 5A3LA 1COV3 1H8TA 1YJLA 1RMU3 3FX3A 3C7GA 5J48A 2EIGA 4HETA 4PBOA 4OQ9A 1JOPA 3JD73 2WSVA 5FV3A 4ARXA 3NRUA 4CXYA 1YCIA 4XYXA 4AQ6A 4FPGA 5LW9A 5I0UA 2ZAHA 4TTGA 3W5MA 3FWEA 1W39A 1QJZA 2XOMA 4FFIA 2Q8OA 4BOWA 1D0HA 2BU9A 5HCBA 3U4SA 4LJHA 5KWRA 3M7AA 1RYYA 2WNEA 3FZ3A 3N9LA 5CVRA 3OUIA 5JI7A 3JZVA 2W46A 1OUSA 2VUDA 4A2UA 1JZ5A 3VD9A 4PQ9A 2GNBA 1AR62 4DY5A 2PN5A 4Y24A 4XJ8A 3Q9OA 1JBCA 4QDSA 4UF0A 1QOTA 5F5IA 4E9KA 4UAPA 5LA9A 5JMOA 1XNTA 2WBKA 5LEJA 3U14A 4AVSA 4A4AA 3N4MA 2J7MA 4MV2A 2Z5WA 4YW4A 3VN4A 1LB2A 1PNFA 5FZ0A 1TMF1 2PELA 4RR3C 1H4HA 2CWMA 4AI1A 5A1FA 2IVIB 3ST7A 4MGYE 3OBTA 2J42A 3FFZA 3FUOA 3K46A 4AFAA 3LDRA 4LA3A 1CZSA 2DU0A 5IVCA 1O4TA 3LA3A 4P9WA 1F15A 2WT0A 1YIPA 4Q4X1 4CP0A 2IXLA 5FQ0B 5FZEA 4A3XA 2E7QA 3VD7A 4P5HA 3WF4A 3N7LA 5FXWA 1BLZA 4E4SA 3ZR6A 2HYKA 5LY1A 3O1PA 1DGLA 2QQIA 4ET7A 2J1TA 1SBDA 4HK8A 3TNQA 1U5IA 5A7PA 3CIHA 3I59A 4META 5GLVA 3ZSMA 4IEWA 2MEV3 1WD4A 1FI2A 3PVOA 4Y1VA 1D7PM 1OQDA 1OPOA 3AYDA 2HEYF 1W9TA 4GULA 3BTYA 3U75A 1Q56A 4ZU7A 2OS2A 2C5DA 2GMEA 1W0NA 3E6BA 4F3JA 2W1SA 5F37A 3NV3A 1AVBA 3B3QE 4LHKA 3GYDA 4M0HA 1MS8A 3BPZA 1MS4A 3SCHA 1Q8QA 2D40A 4FQZA 1NLQA 3W20A 3H3UA 3LD8A 3PUQA 2V73A 5HXVA 1BMV2 2J1RA 3H9AA 4OZXA 4YARA 2RS32 1GUIA 4ZXKA 5JI9A 2P17A 5DUVA 2IWGB 2DU1A 1NXMA 5GZGA 5L7OB 1UIKA 5A7SA 3MLKA 1WD3A 3USUB 2Q8DA 1DDLA 1PVC1 2JIGA 1MS0A 1X33A 2A3WA 2A3XA 2Y64A 3A21A 3LIHA 1DQ0A 1H0BA 1CAWB 3WW3A 4FPYA 4KI5M 3B5LB 5FP9A 4OI1A 5F5CA 2PHLA 3FLPA 4QPYA 4EWAA 2ARCA 1N1TA 5CFDB 2RS13 2VQ0A 4GH4C 4AGVA 4D7SA 3UETA 1K5MA 3RMYA 5FLIA 2QJVA 4XMAA 4DXTA 3Q8FA 1XE0A 1SPPB 2XMLA 4BH9A 2LRPA 3GZUC 3J9SA 3ZXLA 2NQYA 4C0HA 1PHMA 5K0UA 5I0SA 3UKVA 1A8MA 1MS5A 2HWF2 3I2OA 3CJIC 3WNMA 4BMBA 3OPWA 2UU8A 4GMP0 1XBFA 5FUIA 5C33A 4CDWB 3OPTA 1GANA 3MI8A 1D0GA 4FCAA 3ZFGB 4CVUA 1RUD3 3DUIA 2YFUA 3CMGA 4V2VA 4QX2A 4Y4YA 4YGCA 2FDFA 2D6NA 2B45X 2LALA 1R1A1 4AEMA 1ZBA2 4W6YA 4CU7A 5A1AA 3ATGA 3ZDVA 1LOBA 4S2HA 3F2ZA 4LUMA 4LE3A 4AVBA 3NKTA 2VMFA 4MGTA 3U78A 3HT1A 4XC9A 3WOGA 5ABJC 4OFGA 5JXIA 3PJYA 4DIQA 4HN0A 1FPN1 1VRBA 4YW1A 1XC6A 3JU9A 4WVWA 2WT1A 4YM3A 5C7GA 2GP5A 2BPA2 1UOGA 3RWNA 1QKQA 4AF9A 1UCXA 1MACA 4I0WB 4K1ZA 5JSPA 2WNVA 1KS4A 1QJY3 2VVDA 1Y9GA 3BTAA 3IMMA 4FPLA 4BLJA 5IVVA 1W9WA 1S1AA 2E63A 4LORA 4FFHA 1UPIA 2P3IA 2XKPA 4NMIA 4O65A 5HXMA 4Q0SA 1VE0A 4IERA 4CDWC 1U5XA 2JXAA 2ARAA 1SPPA 2PAMA 2VMDA 4FXGB 5JIAA 3ZFFC 3KB5A 5C8CA 3B02A 3WCSA 3AM2A 3L9JT 1PNGA 1VR3A 4XUNA 3S7IA 5IT6A 4UFMA 1JZ3A 1JZ7A 1RB8G 1RUG3 4NHMA 1C8NA 1IQAA 1S2KA 3KV9A 4IEZA 3W9AA 3VZJA 3KQRA 1NXD1 2QBXA 3I7DA 3NW4A 5FYTA 5T3NA 1LULA 4HVRA 2E31A 5AVAA 2ETEA 1WUVA 2DVFA 4XCAA 4FPCA 1JHNA 2VTXJ 4XABA 5KR7A 4EZ4A 1AR91 1ZZ6A 2QFEA 5LA0A 2EIDA 2GNTA 2IXKA 2HBUA 2K0GA 5T55A 2BFUS 1NY71 2ENRA 1SFYA 1ASJ3 5BNNC 3A0NA 3WP4A 3I97A 2DBNA 1N1SA 2KR2A 4Q0PA 2OKXA 2XR4A 5A3PA 1OUXA 3DEMA 4O9GA 4FSJA 3USUA 5DAXA 3WDVA 3LB9A 4I3PA 1YFUA 4CCDA 3D82A 1KITA 2GH8A 2Y6FA 2RS12 2BGOA 3K3OA 2XJRA 2YUEA 4AYUA 1ZRRA 3ZX7A 3POYA 1VPHA 2GC3A 3QH6A 5A3TA 1SFNA 2D93A 2W95A 4UOJA 3TN91 1D2SA 2YGLA 2OIIA 4XF0A 5FMOL 5G05L 5FY1A 1EUTA 3PNAA 4TSVA 4C1XA 3VBOA 3WG1A 5BY5A 1JZ6A 2CAVA 3O0WA 4KWKA 1V00A 2BBAA 3GNEA 4X6RB 2GZWA 3QACA 5EXOA 4CPBD 1HRI3 4HG6B 1UOJA 5DABA 1DCSA 1RVF2 2QDRA 4M00A 5T5PA 3FE5A 4R9AA 5CFDA 1RUE2 1POQA 5IAVA 4YSFA 2TBVA 1BEV3 1SEFA 1PK6B 4JCKA 3T08A 5FPBA 4ATEA 2P4EA 1W3XA 4Z8BA 2W08A 2ZABA 3VKLA 2QKDA 2B8MA 1GQHA 3E6DA 3PVEA 1UW8A 5E89A 2ZHMA 5D8AB 4ZHNA 2WS93 5F3CA 4H3WA 3B93A 1SACA 3MEPA 4YZ2A 2ZGUA 1CIYA 4INDA 2WZPP 2UYBA 3ENRA 2Y6HA 1PIV2 1XPWA 5D1IA 3H7YA 4COVA 4D6SA 3K77A 4ORFA 1JZ2A 1AF9A 3NJXA 2QQPA 4BQ4A 4YWAA 1CN1A 1V6OA 5FZBA 1UX6A 3ZXKA 3KVBA 1W9SA 1O8SA 5JDBA 2VCCA 3VL8A 1OLRA 2C6SA 1VBC1 1WCKA 4GB32 4Y4RA 1UWWA 1G8WA 3CNAA 1XU2A 4JRLA 4L11A 5C3QA 1N3PA 1YYNA 5CADA 5FY0A 4DY3A 2Z79A 2Z42A 1K45A 3THCA 4B4QA 4XAAA 1NYWA 2CL2A 3C3VA 5EYXA 1W04A 3J26N 2WR9A 4W50A 2BVBA 2ZTNA 1XNKA 2VUJA 1LODA 3P6BA 1Z0HA 5C5TA 2O14A 3U4XA 3ROUA 2P6HA 2HBTA 3N36A 2XPJA 3MPBA 3L2YA 5SV8A 3M3IA 3CZUA 3VZOA 3HD8B 2BOIA 2VZ1A 4I09A 1CESA 3I3DA 3D6EA 4Z82A 5DDJ3 4AFDA 5ANQA 2RDSA 4GJYA 3KLSA 5BYNA 4CE8A 1FPN3 4CPBA 3S5AA 3QBQA 2YFZA 4N7IA 4YG0A 3C7OA 1Z7S2 1XQNA 5IK4A 1OFSA 3KD4A 4UW3A 5LBEA 1TVGA 3I4IA 2EICA 1OVSA 2D97A 2ZX2A 4PDWC 2HLEA 4YW6A 2UY8A 2BGPA 1KDKA 4ZXEA 4DINB 4ZU4A 3FUQA 3LDBA 4QX0A 1UIJA 4PI0A 1ND2C 4E4HA 1RUE3 2J1EA 1VBE1 4KG0A 3TEWA 1ZBE1 3OUJA 3DKQA 1XB9A 3AFGA 3WP3A 4B1MA 5C8CB 1UZVA 3W5NA 4YRDA 1X9TA 5ABJB 4ZPIA 4TLFA 5EYYA 2VW2A 4UFIA 2RDNA 3KS7A 4XF3A 3GCWA 5FZ6A 4IV3B 3NNLA 2B5HA 2OW4A 1LOCA 3FMGA 3FN9A 4CCLA 3SHRA 1I5PA 1PMHX 2O8QA 3KQ4B 5I93A 3MIFA 4XIOA 2FDIA 2Q8EA 1UN1A 3OD0A 4M3CE 4MHUA 1NZCA 3HN1A 3S6PA 3D0SA 2J1SA 3WY6A 5CFCB 1W0PA 1RMU2 5F2SA 2P5BA 2J1UA 2JG9A 2I2SA 2QQUA 1W8TA 4MXWA 1TNRA 5AC92 4A41A 1PO23 1GZ9A 3JXSA 4NHLA 4OI4A 2RMU1 4QM8A 4DZGA 3ZXAC 4Y5Z0 1EPWA 2JIJA 3C7FA 1MQTC 3BTZA 1LOFA 4R9DA 2F17A 5FXXA 4H7MA 1EYBA 4OI2A 1SQ4A 2G1MA 2R0HA 2ZZQA 4HPKA 1I9RA 2VO5A 3OSDA 4LHSA 1GR3A 4R4XA 4XF4A 5A32B 5EV7A 3VD4A 4CP9B 1H2MA 2WSUA 5T5OA 2AUYA 2WABA 2X8KA 4QQLA 4ZS3A 1N3OA 1UOFA 2ZEZA 3VHNA 2AEZA 4CYDA 4WM7B 3BOWA 3VBRB 5KBFA 3AZZA 2BNOA 3HQUA 1UX7A 1M4WA 1PVC2 1V9U1 2VG9A 1DGWX 4HK9A 4N53B 4QQOA 1C5HA 4OMDA 4CCOA 5FXZA 2AACA 2ET7A 1PM7A 1OT5A 4QU1A 1XJAA 2MNGA 1J59A 2ET1A 1W2NA 2VOXA 2XBO3 4DUWA 3IPVA 3V0BB 3R4SA 2F4LA 3I3MA 4XE9A 1YFWA 5JZGA 5CISA 3INAA 3RJRA 5A6QA 1LRHA 1ULPA 4UBGA 4J1XA 1H6YA 2XBO1 5FO9B 2VMEA 4TWTA 1CD3G 2VW0A 4AOCA 3KHCA 1JYCA 5CKNA 1CAWA 3WLUA 4MH0E 3DXTA 3OYWA 4AQSA 3KGLA 2R043 1NCRC 4KWUA 1NCQB 1ZBE3 4BQ1A 1GNHA 1YQ2A 1LAJA 1ZREA 5C8CC 4Q29A 4W4ZA 3TN92 1LR5A 1FXZA 3B69A 5LASA 1DQ4A 3K4ZA 3LEGA 5FK8A 2Q1FA 1S0CA 3I3EA 2BOJA 2C4XA 5C9AB 2JB4A 4RSUA 1Z78A 4PQQA 4UT5A 2VZQA 1W99A 3ZVXA 1I1EA 2RDQA 4Z07A 5GKAC 2YPJA 1QH7A 2HWE1 2Y6GA 1ULCA 5I0TA 4EN8B 2G9GA 4RA0A 3I3QA 4D7TA 1V6KA 5BPXA 1OF3A 4CEYB 3TEYA 4L99A 2RS52 5FZ3A 1Y43B 1H9WA 3HIFA 3SH3A 3HWJA 1X8EA 3PMSA 3RNSA 1CZTA 4DMIA 5BNQA 1BVP1 2ID4A 3I3BA 5LK7B 2HWC2 1F35A 4COYA 2W68A 3FJSA 4LIVA 1CWPA 4FOYA 5F7UA 3M3EA 1ZRFA 5J96B 1XNDA 3AVRA 2WQ4A 2FDGA 1UXXX 1UYZA 4CDUB 5JPMB 4YM1A 1RUH1 1GOFA 2CAUA 2OXBA 5DXDA 1CAXA 4QPIC 1US2A 3N35A 2HWD3 2YY1A 1POV0 3MICA 2GAUA 1GP6A 3ABZA 5CKMA 3E5QA 4Q26A 5T52A 5AFEA 2NPIA 4I0BA 3GZTB 2A6WA 4A6OA 4CDXA 2H6BA 4CEWA 2XJTA 2ZS6B 3KWVA 4OHWA 4CDQC 1RUG2 3SH4A 3LCPA 3AYEA 3JUUA 5LCWL 1A8DA 3LPFA 1H2KA 2RV9A 1UY2A 4LA2A 4Q0VA 1BK0A 5EWSA 1COV2 1H2LA 1MPXA 2VE1A 2VZTA 3VKOA 1OLQA 1DQ1A 1YNAA 2BGCA 1POV1 4NO4A 1QH6A 1FATA 4Y26A 2XH6A 4AXOA 1WMFA 1P8JA 4N43A 1WMDA 1B35C 4XZUG 1AR72 5FOBB 4RHV1 1WLWA 3LWCA 1EAH1 4CDQA 1HRI1 2ZMKA 1QJFA 2OYZA 4QM9A 3AZYA 2WNVB 4ISRA 3T0BA 3FHQA 3WNXA 3W59A 1DQ6A 1J1LA 2OA2A 1AR63 4OVEA 3LEKA 1POV3 3VBHC 4CCCA 2AH2A 3UGGA 1CAXB 3T4HB 3WV6A 2C24A 3WSOA 3ZFEC 2C9AA 1HXS2 2TNFA 1QJX2 3JBG1 1YQ8A 3SH5A 1RINA 3B9IA 1QQP3 1UYYA 3WINE 2E33A 2W52A 2HWC3 1K12A 2A70A 2B42B 4XILA 3O5SA 2WYFA 1QDCA 4ASKA 4BK4A 4XJZA 4Z92B 1QHDA 1T6BX 1W03A 3WUCA 1MS9A 4B3NA 4H14A 4EWDA 4GWJA 1O5LA 2GNDA 1IOAA 1UNBA 5JSRA 5KHGA 4DUVA 2VVFA 1H30A 1H8TB 4NIDA 1W6PA 1AR82 1GKBA 1VBC2 4RFT0 2ZGLA 4OHYA 2BRTA 4RFRB 4GMP1 4JGZB 4KGQA 4C8DA 2R072 2D6KA 5JZGC 1CAUB 3RJ2X 3VDCA 4QX8A 4URTA 3AMPA 5HCAA 2VBBA 2ARXA 4COWA 1V70A 2AR6A 5E16A 1VAVA 1IS4A 5FYCA 5FZ1A 2JDKA 2DTWA 2R32A 3SXWA 1PO21 3BI3A 4HKWA 2XQXA 1HQWA 4PJYA 5FZCA 2E51A 3ZPOA 5IK7A 5IUQA 5FYVA 4AGGA 5DAVA 4FI9A 3Q8AA 1RUF3 3WX5A 4G9SB 3ZIXA 1RJ8A 1W28A 4S2GA 1JYXA 3P5BA 3HEIA 3MIGA 4LMFA 1J3PA 1F5JA 4LXLA 3WNNA 4LE4A 2VM9A 3GZEA 1JYIA 2VBDA 1WCSA 4FO9A 3AP6A 4H2AA 4BK5A 3ZYRA 4FPOB 4IV1C 3SKVA 1KJRA 2EF6A 1ULGA 1VBE2 2WDBA 2RM21 3M2MA 1LTEA 5GJ6A 3AB0A 3V0AA 4OHXA 4SLIA 1YWKA 3ON7A 4X8PA 3TOJA 3VLBB 2Q4SA 1DG6A 5I0DA 4CCJA 4PF5A 2PLV1 4N53C 1W9FA 1PIV3 3C8XA 1IKPA 4MO3M 4O9EA 5FYIA 4JV4A 1KQRA 1W8UA 1XSQA 2VZRA 1W6OB 3QLQA 4Q4Y3 5DZEA 1HXS3 2X5IB 4BIOA 2W5FA 3AK0A 5I8SA 3OGGA 1BVVA 1JODA 4Y1UA 2UWCA 2WNVC 4Y1ZA 5LB6A 5KC5A 1ND3A 5LEKA 4P9IA 4EE2A 2ZX1A 3MIDA 1AXZA 2ORZA 3O12A 3PHMA 5BNNB 3VDBA 1ND2B 2UWBA 3AC0A 2JENA 3EXUA 4WZCA 2FDHA 4KU7A 2VC9A 3KCCA 1VBD2 1E57A 3UESA 1AL22 5HV4A 3WP6A 2C9KA 2IFWA 4JHTA 4PT6A 3IB3A 3WQ7A 4TZDA 2WNOA 2E9QA 1R1ZA 1ZZ8A 3AYAA 1GZTA 1LHUA 2WN2A 1HN1A 3GJBA 3ZYIB 5E88A 4HONA 4YZ1A 4QPGB 2VOKA 3N7KA 3MUZ1 2A6VA 4AWDA 1WA4A 1VBA2 2IVJA 1KJLA 5CAZA 1R1A3 4M3CB 4QT6A 1LECA 5FLHA 3RI9A 3O1OA 4D6QA 3VBFC 2WFF1 2ORXA 3JB4C 4QGMA 3SNMA 4FVVA 3VBUC 3KMHA 1ZA4A 4LKSA 4YW7A 3VDDC 4LBKA 4NOTA 4AZZA 2ZXQA 1RMU1 2WKKA 4MXWB 4E8DA 2YG0A 3VBSC 2OUJA 5IVBA 3KF5A 1U5YA 1AX1A 1ZYBA 1PO12 5GM0A 4F8AA 1IZ3A 2A73B 5C70A 4CU9A 4CRQA 3LA7A 1RUH3 1W6QB 3RDIA 2JE8A 3UL2A 1IHMA 1RUJ2 2HWF3 3QD6A 4HANA 4W8JA 3VBUA 3ZYBA 2AEYA 2E7AA 2DTYA 1TMF3 1QNYA 2XBO2 1CJDA 1OD3A 1BMV1 1IGOA 5DAQA 3AL6A 1VBE3 1H6XA 1W8ZA 3THTA 3AP7A 3PVBB 1JOBA 5DZFA 4AI9A 3ALQA 4FPEA 2QQLA 3MF6A 2I45A 4IE4A 1U12A 5D8AC 4A7YA 1A6CA 5LBFA 3SEPA 5JZGB 1SZBA 2VTFA 3OGRA 2B9UA 4GWNA 2QQNA 1PZ7A 3GF6A 3TN93 3LGRA 1JMUB 3POWA 5AC93 1OBNA 5KXCA 1RVF3 1W8OA 3E5UA 1X7NA 3D0JA 2X05A 4WVZA 4GMP3 4BM8A 4AQTA 1W8FA 1MEC1 4P14A 2VMHA 1QOOA 4RQPC 1HDKA 4RS5B 3MW4A 3GJAA 2ZZJA 3BODA 4OI0A 3GBGA 3MV01 5LA2A 1VAKA 4A7KA 5FP4A 3DXUA 3UV9A 1PMIA 5LRRA 5A1LA 3PLQA 4LHNA 5GLWA 2OVUA 3QCWA 5A3NA 3PTRB 2PHRA 5BXXA 4GWMA 1VBA3 3NNMA 1TME1 2CHHA 2Y34A 2GNMA 1KGYA 1I5ZA 3OBRA 2JG8B 4YZ3A 5FZ7A 1XYOA 4BQWA 3P3NA 3N7JA 2WJSA 2XJPA 1RJ7A 1PZ8A 2NP0A 3Q8EA 1FNZA 4BISA 2VD7A 2VZVA 1RVF1 4N43B 4ZONA 4C0BA 5FYZA 2W9XA 1RGSA 4GB33 4LIUA 4K8FA 4NR1A 2VULA 4I01A 3AXEA 2TUNA 4EJRA 1QJU3 4L8QA 1OC1A 4TYSA 5FXVA 4M4PA 1O4YA 2Q5TA 2QQKA 2B46X 3KGZA 3VD3A 4FP2A 4LTAA 2WZR3 1LOFC 4ZS2A 5F6KA 1ODNA 2YC4A 3NNJA 1YO8A 2YGMA 1VALA 3GHMA 4BWOA 4TN7A 3BU0A 1MZFA 1ZX5A 3KHBA 2IUWA 5DG1A 1JYVA 2WA3A 2NLRA 4AR2A 5I0RA 4NIAA 2GN7A 4P9JA 1QWRA 1QU0A 3I2KA 2ZGKA 1W6NA 2BJSA 1O3TA 2SBAA 2FCUA 1R081 1LGBA 1JU3A 1S0BA 2FDKA 1UU5A 3HMYA 3T2TA 3VBSA 3AMQA 3AXDA 2VMCA 1KEXA 2XL9A 3TEZA 1RL3A 2J1AA 4AHYA 4QXKA 1UKGA 5FZKA 3UJOA 2ARBA 2QQMA 3B94A 3X29B 4MX3A 2WO7A 1QJEA 3KV4A 2CDPA 3D3AA 2BDRA 2VR4A 3KV5A 3T0DA 2EIBA 4FPKA 1HRV1 4AVAA 4BMEA 2WT2A 3FBMA 4Q4X3 3IT8A 5EPAA 3F95A 2VUAA 3NQHA 3OTFA 4HLTA 1R64A 2BV4A 4A6SA 4DOUA 2ADEA 2RS11 4MGSA 4AEDA 3IDCB 5K8SA 4DXZA 1GNZA 1FMD2 1O4ZA 3PVNA 4H55A 2PYTA 4V1PA 4FTEA 2CDOA 1VMJA 2ZX0A 4XFAA 5T5LA 3POBA 1EAH2 3RWKX 1O8PA 1BHGA 4UI9L 1FX5A 3LKJA 4GALA 1AR81 5C4WC 2RR12 5HCHA 5M0TA 2JWPA 4EV0A 2BEOA 1UZZA 5CFDC 4AI8A 1NG0A 4ZU5A 4TLGA 2AENA 2CWSA 2VBPA 2XJUA 2ZMNA 5FYHA 4GQ7A 1KFUL 1AL21 4I30A 1LOGA 1BKZA 1LU1A 3WHTA 1AXKA 2ZGRA 1C8M2 1NCQC 1OPMA 1PGW2 2FMDA 3AKQA 5DUUA 4YW2A 4JGZC 2Y0IA 2OQ6A 1QMJA 2Q30A 4QHZA 4DRRA 4MHRA 4AHZA 3RZGA 2VGDA 3N7MA 1AYM1 3VL9A 1RIRA 1JU4A 5EQUA 2ZX4A 2EVXA 4R8HA 1LGNA 5JXHA 1Z7S3 5CZKA 1DGRA 5IYYA 4JKKA 3ETQA 3AZXA 4IV1A 4BLIA 3ZN6A 2ZGNA 5H9RA 2R073 1QGLA 5JR2A 2Y6LA 1CJPA 2YMZA 3IIIA 4BQYA 4KMQA 5FO8B 1XRUA 1H1AA 5EZWA 1JUIA 1KXGA 2PQSA 4FPFA 1OKQA 3U1XA 4D6RA 4HFSA 4CEWC 4RN5A 4Z2WA 1UMHA 1UZ0A 2RG4A 4Q0QA 3VDAA 3Q8BA 4JZRA 1RHI2 5F3EA 2O0OA 4YVWC 3BTXA 3H8OA 4LBQB 2DDUA 3HAGA 3H0OA 3H3LA 4HPKB 2JG8A 5FZ9A 3ZYJB 4LBOA 1S2EA 4DPNA 1HV1A 1V9U3 1FV2A 2W47A 1W6PB 5ISLA 1A34A 3MO4A 5F1RA 4HKLA 2FD8A 2XJVA 1C8M3 5L36A 2PLV2 1RUNA 1OMIA 4ES8A 3PL0A 2FMYA 4QD2A 3R4UA 3HPNA 2XLGA 1KFXL 4IESA 2GMMA 3WZ1A 3OUHA 5F32A 2JKBA 5I91A 1W8HA 3H8UA 1WBFA 2JB8A 5FKCA 1SG3A 4L9BA 3TNPB 1JH5A 5IVFA 5KHJA 5J7MA 1O7FA 1OFNA 4RGAA 3TB0A 3RZHA 1GLHA 2WWSA 1YIFA 4PF1A 2DYCA 2VQTA 3OGSA 3DYMA 2HEWF 2IZWA 1R091 1HJGA 2RM22 3WDTA 2JDZA 2XVGA 2IXCA 3HT2A 4WM7A 3VBRA 1IPSA 3B9CA 5D21A 4PBPA 4OUMA 3RI8A 1DF0A 3U37A 4NRMA 1W6MA 1UYPA 2HWF1 4N53A 1AUYA 3OGVA 2ZGTA 1EV12 4NAMA 4COZA 3O1RA 4BIFA 3EHKA 4UF0B 5IHRA 2EALA 2FCVA 5JOZA 4XMIA 4OUEA 1ENSA 3IKWA 1AXYA 4PHZA 2YHJA 2HKXA 4FP3A 4LO4B 3VDDB 2ZKNA 1R1A2 1DFQA 3A23A 3VBHB 1IKQA 1Y4WA 2VNVA 3SC7X 3VBFB 4MVTA 1SDWA 1R093 2W1WA 4GAZA 5CG9A 2R30A 4DFSA 4AW7A 2EIEA 2Y60A 3E6CC 1R083 5FQ0A 2Y26A 3AMMA 2DVDA 4EYUA 5D2AA 5FPLA 2BZDA 1BJQA 2LM3A 2PXJA 4Q2FA 4CZSA 1N1YA 5CYYA 3ILNA 5FYSA 2I74A 4NRPA 2KA3A 5FP3A 4NVPA 4CTEA 4CU8A 1ST8A 4QXBA 1YQCA 1G7YA 1QOSA 3T2OA 3M3QA 1ZZ7A 3MV11 2Y38A 1MZEA 4GA9A 1IS5A 4XJUA 1MQTA 1GZCA 1NUKA 4Z2AA 5KHKA 3ZXDA 3UGHA 1NX9A 2BP6A 2QQJA 4IE7A 2VMIA 2D98A 1GP4A 3UKTA 5L7OC 2ZEYA 1XSRA 1OHFA 3O1UA 2WNUB 3M3CA 3O1MA 2VTXA 3RZMA 2B39A 1VMFA 1WMEA 1SCSA 3ACFA 4JDNA 4JRAA 4XFCA 2QUOA 3POFA 5A6ZA 1YI9A 5IVJA 3OOXA 4HSLA 4LK6A 4QKFA 1L7RA 1NY72 5F2WA 1JTZX 3K4AA 4E2QA 2PMWB 4OHVA 5J3UA 4IUGA 2Z2SB 5A7WA 5EJZB 5IFPA 4LOSA 2W1QA 2WLPA 5BNOB 5EJ3A 1JXNA 1DGWA 4WV8A 1PX3A 1NCRA 4KGGA 1SLIA 5FPZA 2EA7A 2ZAAA 4YVSA 2BQPA 3LA2A 5K7PA 3ZN5A 3HVDA 3M3OA 4NHXA 4LULA 1NLRA 2D7FA 2A6XA 4IEYA 4KG8A 3A22A 1N3QA 3PU8A 1OOPB 4O7XA 1VRH1 3V64A 3NJYA 3VZMA 3L2HA 1S0IA 1DU3D 1ACCA 2XJQA 4PIZA 1NE6A 3ZFFB 4YG3A 1J3QA 5C4WA 3I2FA 2JDAA 1NKGA 2ZX3A 4NHKA 4OQ8A 3A0KA 3PTYA 3GCXA 4IEUA 2E53A 3N3HA 1GYKA 3DYOA 5FYMA 2XJSA 1F4HA 1HQNA 4DO0A 5FUNA 3VB9A 1OH3A 1LEMA 2CTVA 1ENXA 2WZ8A 5ACA2 1VBB1 1TEIA 4SBVA 3VKFC 2K9ZA 4OYUA 1Q8PA 3CJIA 3RYKA 1TME2 4D8MA 3CJXA 2X53S 4JTNA 4XCBA 3G6JB 1SLLA 3WXPA 1JI6A 1W2UA 5J09A 3H1MA 1F5FA 1F8VA 4YW5A 1H8TC 2PTMA 3V56A 3AZVA 1QJU2 4HOOA 3WEZA 2W2IA 2XVLA 1YFXA 2D3PA 4XBQA 3JBG3 4J1WA 2DFCA 3OD4A 2WAAA 3CEWA 1DQ2A 1LGCA 4YVSB 1UU6A 3LOBA 1N1VA 4AAPA 1DLLA 1DBNA 3HJRA 3GBWA 5DPNA 3APBA 4AL9A 3RMXA 5T54A 4L92A 1REDA 1OOPA 1GSLA 2H6CA 4BQ2A 1O3QA 3UJQA 1C3HA 4KBZA 3KSCA 4ONUA 5DUXA 3NJZA 3T3YA 4AEKA 1AYM3 4WM7C 3VBRC 1KRIA 1WW6A 5F39A 1PO22 1HLCA 4GH4B 4MXVA 2XLAA 5E1RA 5FTTC 2WLQA 1HW5A 1V6MA 2AC1A 3NNGA 2ZGSA 4S2DA 1GICA 4QPWA 1UQXA 3WVJA 1WLTA 4RGGA 4BXSV 1FMD1 5JOXA 4GZ9A 3AFKA 4E2SA 2JG9C 1RXFA 3EQEA 2X29A 1OLMA 4MOAA 2X5IC 2Z4FA 2WZR2 3IDEA 4ASLA 4QQHA 3KT7A 5A80A 5GZCA 5F9TA 4YVWB 2WNUA 1GV9A 4HVQA 4R9BA 2OX0A 4QX1A 1RUI2 2BWCA 2P2KA 5IJRA 2R0FA 3AVSA 5JUVA 3P3PA 1HRV2 2MPFA 4N43C 2LTNA 2XHNA 4RYDA 1EUUA 2X10A 4ATFA 4LOTA 4CCEA 2BUKA 2FDJA 2FQPA 3EO6A 1C1FA 3LEMA 1RITA 1G86A 2VXRA 4QXHA 1AYM2 4K6BA 3CO2A 1OLME 1RUD2 2RHPA 4LK7A 1AHSA 3WG3A 1TME3 5FZ8A 4ARYA 4UFLA 5JSOA 5JXJA 3D8CA 3GM8A 2WWJA 1ND2A 1E5RA 2RDRA 3BIWE 3POIA 2JG9B 3TBDA 2LROA 4BXFA 1W9YA 4TXWA 2HH9A 3DN7A 4RQPB 1PGL2 2RR11 2A7AA 3M4FA 1NA1A 2YDEA 4QHBA 4XJ9A 1NT0A 2Y33A 3AKSA 2VZUA 2EXJA 2KM2A 3UKNA 4HSJA 4AEDB 2Q1ZB 4N9HA 1ZRCA 1ALYA 4CEWB 2P34A 1G6NA 1JYNA 3NO8A 1GFF2 3ACGA 3ILRA 1J84A 2DVAA 4XDOA 3C7EA 4Q4V2 3HBZA 4YW3A 1EAH3 1QXPA 4OHZA 3JCIA 1F2NA 4QQPA 5A33B 2A75A 4XJAA 5SV5A 2XWBB 3NNFA 5H9QA 1LHVA 1LCLA 3K3NA 4HXCA 2C0ZA 3UNPA 2JDHA 1BEV2 2JG8C 1XOYA 2CYFA 2WFF2 2W39A 2ZPXA 4WM8B 5FY7A 3MW2A 2VCMA 3ECQA 3ZPYA 5C3RA 2DCTA 1XNCA 2ZA9A 4W65A 4XQWA 3OJBA 5FBZA 1V9U2 2W91A 4JVAA 4AFCA 1XNAA 1RHI1 2ZBJA 4AVTA 2JD4A 3FLRA 3AKPA 1VAMA 3KCYA 4YGBA 2MEV2 2GSYA 1EY2A 1UO9A 1YFYA 4FQ4A 2QE3A 5FPAA 5K4LA 5FUPA 1UY3A 3C2UA 3VUOA 2PHWA 3DPRC 4B7EA 4NIGA 2HWD2 2XB6C 1RUJ1 4DEVA 3MW3A 5JR7B 3RSJA 1HB1A 2R1BA 2XL7A 2J22A 4LLOA 1ZRDA 1GBGA 2Q0AA 5F5AA 1JYTA 5C6CA 2FCTA 3WF1A 3ZN4A 3GBFA 3K48A 2E6VA 2OPKA 2QZ3A 3AKRA 3KT4A 3ZMOA 5LZ6A 3CQOA 3ZDSA 1MEC3 3I59B 4LBMA 5IK8A 2RS33 5H9PA 4AI2A 2YU2A 3BALA 4QPGC 2ZHKA 4I0AA 3LEIA 1LNSA 2VOVA 5JPNB 1B35B 3H7JA 4IEVA 3J8F3 1S0EA 2G9ZA 3AKTA 4L2NA 4P9GA 4WBBA 3M70A 4RS5A 2V4AA 1SBFA 5L19A 1OF4A 1AR83 3BGAA 3ZMNA 5A70A 1HV0A 2RMU3 4JDOA 1WBLA 4HN1A 2YBKA 2BVVA 3DPRB 4JDMA 3T0AA 1VBD1 2ZGPA 2XKOA 3RYPA 4BCUA 2WFPA 2CSGA 1VLNA 4QDRA 4W6WA 4CP1A 5D8AA 1UMZA 2HWE3 1MS1A 5DN2A 4M3CA 4AI3A 4LKFA 3H1YA 4NJ4A 2VZ3A 2ZCWA 4LLFA 2KD7A 2K46A 1GMMA 4FT8A 1MVEA 4XW3A 3WG4A 3IAQA 4CP9A 4PLNA 1CX4A 1SLAA 2BNNA 4HKOA 1W8NA 1FYUA 4CCKA 4FAGA 1C1LA 2C1FA 4CXXA 2A71A 3TAYA 1OXCA 1ZBA1 4XF9A 2Q8CA 1UOBA 3HNYM 3MDPA 1H9PA 4Y1XA 1LU2A 1QJX3 4G4FA 1NE4A 1Y9MA 3O7OA 2RM23 4XURA 1MVQA 4BA6A 2Z69A 4X8NA 4XBNA 3RZZA 5JOWA 5KXBA 4L97A 3ZFFA 5EP9A 4OULA 2D6MA 1YJKA 3WNOA 5EHDA 1DHKB 1DYPA 1W06A 3I2GA 1C28A 5FMCA 5HPOA 5F6LB 3VKNA 5KC6A 3ZYGA 4U36A 5L9RA 2LS6A 4GIQA 5A7WB 1LESA 3MLJA 3NAPA 5FZOA 4XEZA 3S30A 3WW2A 2XUEA 1NA1B 2CV6A 4XVHA 4BDVB 1VBB3 3ZXFA 2HWB3 3VBHA 1OVPA 3WD5A 2ZGOA 4RHV3 1QJY1 5IATA 3J7HA 5LWBA 2VW1A 4B29A 4Q1RA 4MG2A 2OQ7A 5C8WA 2UURA 2DWRA 3G7DA 3O1TA 4QB2A 2YYOA 3PU3A 3WNPA 3POJA 5FZAA 1VRH2 2PQQA 2WQZC 3B00A 5CFCC 1HRI2 1X82A 4HL0A 4PDWA 4QX5A 4EN7B 5C5UA 1OI6A 4Q4Y2 3AP4A 4XUPA 1JZ4A 4ISQA 1LKNA 2QNKA 4NROA 3PIJA 4Q4Y1 2RMU2 4YVSC 3UYJA 5IK5A 2IFRA 3VBOC 1WZXA 4CUGA 4IEOA 3H50A 5FZHA 3WNLA 5LRSA 2RE9A 3HOBA 1ASJ2 1VP6A 2OT7A 1DZTA 3ACIA 3WG2A 4K8RB 1LOAA 3OF1A 3ZYPA 4UWDA 4DEQA 5K0UC 2EAKA 3MZHA 3N9OA 4X6QB 4I2OA 3WW1A 1V6JA 2A3YA 1KD7A 5G04L 3ZYFA 1U0AA 2RJKA 4QU2A 4KNCA 4O61A 5APAA 5GZFA 4CEYA 3WQ0A 2BW8A 2R7EB 2VJXA 3GALA 2RJ2A 4HZFA 2VZSA 2HJIA 1IQDC 3I2IA 4JTOA 5LATA 1FOD3 4C90A 4DXRA 3JD72 3DPRA 4YGEA 1XE8A 1HX6A 4Q8LA 4PI2A 1SFPA 1F31A 4Y22A 2CGNA 1QF3A 1CAUA 1YEWA 3EYPA 2JE9A 2OZJA 3IAPA 2W94A 1S0FA 4MGIE 2WRAA 1H8VA 4RD7A 1LENA 5CB7A 1L7QA 2G4IA 2QQOA 4CP2A 1S2BA 5T5JA 1WLDA 5FDBA 3IWZA 3U10A 1K5MC 4YPJA 3IN9A 2JD9A 4N7UA 3ZSKA 5FIXA 3GHNA 1UU4A 2VQAA 4YZ4A 5F8PA 4B4RA 3VV1A 1YC61 4D69A 1EPZA 5FP8A 4QX3A 3USSA 3ES1A 1AL23 1OQEA 2V4VA 3A7QA 3NKGA 4JX0A 4OLLA 2R062 1ZNPA 3EJKA 4Q4V1 3VBUB 3M8LA 4CXWA 1CAVB 2R061 3PUIA 2VU9A 1S0DA 5CKQA 1S0GA 3VHRA 1ULOA 3ZFGC 4XDPA 4LR4A 3K4DA 4QX7A 5FRAA 2EXKA 4K20A 5C3PA 4LPLA 1ZA7A 2Y0OA 3MUY1 5DDJ2 1X50A 3POEA 4LUKA 2RS53 5DDJ1 3NVCA 3VHPA 4L0PA 4LBQA 4JGYB 2BFUL 2VUCA 4QKBA 2RR13 1RC6A 1DQ5A 3CJIB 2GC2A 4P9LA 3FLTA 4Q4W3 2YBSA 3PURA 4IE6A 2WO1A 1JW6A 2D5HA 2GP3A 5FP7A 4MLOA 3AL5A 3PMEA 2WYSA 2O1QA 5A6XA 1AJOA 4FFGA 3ZN6B 5HBAA 1YUDA 3EBRA 2HWC1 1HIXA 4YG6A 1PMJX 2F4PA 4QAWA 4XFFA 4AAXA 4RGKA 1TQ5A 5DMYA 2CGPA 4NHYA 5B4NA 2JDMA 1A78A 3K51A 3WF0A 3LFIA 1CX1A 3ZSEA 2WL1A 4XFGA 3ME2A 4PDWB 1TZOA 1ULEA 1V6LA 4RR3B 2UWAA 1RUH2 1Z7S1 1GQGA 1OD5A 1KS5A 3RPQA 1D2QA 4XQ4A 2UYAA 1AYN3 1BK1A 1NAEA 1STMA 4AGRA 5IFTA 5CFCA 1X36A 5DUWA 3RYRA 1WLCA 4UW5A 2YB7A 3FL7A 1IG0A 4BU2A 1NQDA 1FPN2 3LAGA 4JQTA 1H2NA 1QXJA 3GDBA 2R16A 1R092 3CU7A 1QNWA 3OCPA 3OG2A 5JMCA 2JICA 1OA4A 4CDQB 3MFCA 5FYYA 3FBYA 4IGOA 4NUBA 5TSWA 5FY8A 2V09A 1VMHA 3WUDA 4IL7A 1RUD1 1UL9A 2ZGQA 3RVHA 1GWLA 4Q5OA 3WT3A 2P1BA 3EMRA 3LF7A 1D4VB 5JOYA 2W92A 3E97A 3CHXA 3P1IA 4IE5A 4XIKA 5FZLA 2H0BA 2JKXA 2R041 5FOJB 1DYKA 3HBKA 4Q27A 1XNBA 2ES3A 4WVMA 4WM8C 5JVVA 1PGL1 1XU1A 4K3UA 3VKMA 4FTBA 2E26A 4Q1PA 5LK5A 4N8MA 3ZSLA 1RUI3 3GXUA 3VZLA 2GMPA 4URAA 3TWIA 3T2PA 3R0RA 1DYOA 4BPZA 2VNOA 4EN0A 2QZ2A 4UFJA 3VDDA 3BIEA 1GZWA 3SKJE 2CGOA 3WNKA 5HI0A 1GU3A 4PCRA 4MGKE 2AYHA 2W1UA 4XTPA 2QTWB 1O3SA 1EV13 2MHFA 3AMNA 4D0QA 2ZGMA 4YNIA 4F7ZA 2A6YA 4D94A 4XETA 2JJ6A 1CIWA 1OKOA 2P3JA 5FKBA 1K3IA 3T2QA 4IGPA 3ZFGA 4CUCA 5C3SA 1SCRA 3D5OA 1JOJA 4FOWA 3MIEA 3WDUA 5BNOC 2OPWA 5DG2A 3PDQA 5FZGA 3K75B 2PHXA 3IDAA 3S5QA 4CUAA 4EN6B 4UW6A 1CGPA 4JGZA 1XYNA 1NCQA 3RG0A 3OPZA 2VMGA 1B35A 3KV6A 1NQJA 5LBCA 2F6BA 2C26A 1C4RA 1ULFA 5FY5A 2V72A 3ZFEB 3BVCA 1URXA 4N90A 3W21A
chains in the Genus database with same CATH topology
2VNRA 5BNOA 4R9CA 4IEQA 4ES9A 4QPIB 1DZQA 1LJ7A 1MEC2 3NV2A 5FAXA 3DGTA 2AZ5A 2PFWA 1ND3C 2PHTA 1I3HA 1BQPA 2PA7A 4FPJA 4NN0A 5GZDA 2NMNA 3LSEA 5A3MA 1WW7A 4W6XA 3IIAA 2JECA 4GH4A 2CY6A 2TEPA 4Q4X2 4S2FA 4JC1A 3U0ZA 4LBQD 2LUWA 2YC0A 2DF7A 2FZ2A 2QVSB 4BYYA 4FTSA 4E27A 3LSDA 4MYEA 2AGSA 4Q8KA 3CL1A 1TE1B 4LO5B 4Y20B 4AHXA 3KT1A 4XBLA 1J3RA 4BE3A 3O0XA 2BBVA 2HWE2 4GKXA 4P9YA 4AVCA 3VGIA 2DVBA 3H3ZA 4DNYA 3AX4A 1RHI3 2K2SA 4Q0UA 2RS51 1BXHA 4XZPA 1ZZ9A 4MGZE 2YXSA 3W58A 1VB2A 3DV8A 5ACA1 2VVEA 5I8TA 1REEA 1DGRN 4XHBA 3T1LA 1RUOA 1IPJA 3MIHA 2WA4A 1W0OA 1PZ9A 1ULDA 2XUMA 5FREA 1HQLA 3MPPG 3DL3A 1AYN1 3QOPA 4LT5A 1DIWA 3J8F1 3J8F2 1GZWB 1QJU1 4LO8A 5I8YA 4IV3C 1PK6A 4WZFA 2ZJCA 2D5FA 2HWB2 1AR73 3I54A 1O3RA 4EROA 4QPGA 1D4M2 1CQ9A 2A5ZA 4DS0A 4G3YC 5GALA 1HRV3 2D43A 2XGXA 2IXJA 1ASJ1 3M1HA 5FLJA 4QQ2A 4XQDA 3WR0A 2IXIA 3R4DB 1VBA1 1COV1 4N9IA 2QDNA 1MR5A 2GH2A 5C9AC 1I6XA 1AR93 1IS3A 2G9FA 4M3CF 1LHNA 3UK9A 5BNNA 4I02A 4CDXB 4B4PA 4AEJA 1U5ZA 1VJ2A 1MZ6A 5B2GB 2DCKA 2XWJB 2A6ZA 1AR71 2D3RA 3B01A 4QGNA 1RUF1 2OUHA 4XDQA 5AC91 4LO6B 4A7ZA 4NWWA 1SMVA 1Q43A 3SLIA 1FAYA 3CLPA 2DCZA 3WP5A 1C8M1 1PGW1 1CPNA 3AJZA 4ZKTB 4KWLA 2JEMA 4BHPA 5KXEA 3JQXA 4YVWA 4MZUA 4J6GA 4PLMA 5HCFA 2BWAA 1XXNA 1YLLA 2OZ6A 3I2DA 4HVOA 2GC0A 1RUC3 2SLIA 2R6QA 3ZIWA 1QQP2 5FMOS 2ZHNA 4I3GA 4CDXC 4FAHA 2VOWA 3MFAA 1Y3TA 1WW5A 4JAAA 5CA6A 3VZNA 1RUJ3 2R071 5CU1A 1CAVA 5A33A 3VBFA 2P3KA 3FC0A 2N7GA 3WHUA 2NMOA 2DCYA 4YFWA 4KQ7A 1VIWB 1BBT1 2VH9A 3WDXA 4XF1A 3WCRA 4Y1YA 2WS91 5BNPC 3FFQA 1UF2C 4Q4W2 1JUHA 1Q8SA 1FV3A 2H0VA 3U07A 5K0UB 1ZZBA 2D3SA 2I07B 4YGDA 1BEV1 4HBNA 3U11A 3MF9A 4NWVA 1C57A 4DB5A 3AP5A 1CONA 2WZR1 4FBFA 4PIYA 3NV1A 4AVVA 1FNYA 4WVMB 5GLTA 4AHWA 2XVKA 2R063 4K21A 1NCRB 1O5UA 4CDUC 2YROA 2BNMA 2NYYA 4XFIA 4IXLA 4YYOA 1WCDJ 5C4WB 1CR7A 1NLSA 2VY0A 3PJQA 4B7KA 2YZ4A 1PIV1 1EV11 3MGUA 5GLZA 1ENQA 1OA2A 1OOPC 1ZBA3 2B7YA 5BNPB 5JIUA 4QMAA 3RQ0A 4KH9A 5FCCA 2R042 2ZKLA 3NV4A 1TNFA 4YM0A 3V65A 4BZ4A 4XFBA 4DRVA 1S0JA 1Q8OA 1PK6C 3O0VA 3ZSJA 1RUG1 2DV9A 2WC2A 3MIBA 2WINB 1BCXA 4KU8A 5J36A 1LEDA 1APNA 2KXLA 1MS3A 3ZXGA 1PVC3 3WDWA 5ABJA 3BOPA 5CNAA 3NAPC 1YRZA 1Q5OA 1B09A 3ZXEA 1OSGA 1AJKA 5J98B 1G9BA 4KBBA 4XHXA 2AREA 5ACA3 1AYN2 1UD1A 3QH7A 4RHV2 1DZRA 2R1DA 4C1WA 1A3KA 2E7TA 1ZVFA 1BBT3 1LOEA 3WDYA 2HWB1 4UBHA 2XG3A 1ZBE2 2MEV1 1UZYA 2DVGA 3MYXA 4LBJA 4XXPA 1OQ1A 1QJX1 3JBG2 1D4M1 5E8AA 4E4DX 1QY4A 4FOVA 1YI7A 2D6PA 1PO13 3VZKA 1TMF2 1F9KA 4CEYC 4K1YA 3OY8A 4NPRA 4GKYA 5C9AA 3SMHA 4K40A 1RUC1 2VECA 3KCXA 4GXLA 3T1MA 4AFBA 4QGLA 1G9CA 4K9SA 5FO7B 3NAPB 3S0MA 1Q8VA 4XXAA 2DCJA 3IMNA 1ZZCA 1AR61 1WGPA 2IC1A 5L7OA 5JWPA 3ZO0B 2HEVF 4Y20A 2GALA 4RS5C 1IS6A 4MSVA 4CDUA 1V6IA 3GZAA 3WW4A 4AI0A 4M0NA 1C5IA 1J58A 5BNPA 3SITA 2P37A 1FT9A 3HR9A 1VBB2 4YZ5A 3OY8B 4IEXA 5AVPA 1G9AA 5CBLA 4YM2A 4MUVA 2PHFA 2RS31 1CVNA 1K5MB 4JQRA 5CG8A 2D6LX 3JD71 2D44A 2XLFA 1Q3EA 5FFOC 4HT1T 3ACLA 5F5QA 1N47A 4ITCA 2VNGA 4OUSA 1BYHA 2RJLA 3WQ1A 1S55A 2ATFA 2WFF3 3ES4A 2CNAA 5L73A 5JLVA 4YFZA 1LHWA 1AX2A 5JCTA 1RTVA 1BBT2 4DQAA 4AFMA 2FHRA 1LHOA 4UXAA 3S7EA 3NSTA 3R05A 4LNVA 3BCWA 3SCFA 1KDMA 3AYCA 2PHUA 2EXHA 4Q4W1 3NL1A 1QJY2 4D7YA 1R082 4RQPA 1FMD3 1UPSA 2DURA 2ZMLA 4IETA 4LO7A 5CVRA 1O91A 2ILMA 2X5IA 2EXIA 1J1TA 4AQ2A 1XE7A 2ZHLA 1VB4A 3ELNA 1ZM1A 1RUF2 3O14A 4Q4V3 3TRSB 1W6MB 3KZ4C 3ILFA 5AFBA 2O8OA 2JX9A 3IBMA 4U2AA 1ENRA 3BU7A 4R52A 2NZ9A 5A32A 2PAEA 1NOVA 1UAIA 1SLBA 5KXDA 1X8MA 3HQXA 3SCGA 3ZXJA 1MQTB 4YLZA 4C91A 2D6OX 1JN2P 3THPA 2PHDA 1YXWA 4ASMB 3DKWA 4AE2A 1YHFA 3AZWA 4FXKB 3SISA 5BV6A 1SLTA 4LBLA 1VBC3 2BYVE 1QQP1 2BTVC 2YV8A 3AMHA 2ERFA 1PO11 3D4KA 2DUOA 5JAXA 1ND3B 4M01A 4IQPA 1REFA 3RS6A 4R4ZA 1H4GA 1D4M3 1AR92 3A4UA 1W6OA 1Y9QA 1QDOA 3LOIA 4FOQA 2DUQA 4RR3A 1PVXA 4IV3A 4XJWA 3AP9A 4CDWA 3CF6E 3JQWA 3DF0A 5GLUA 3MLLA 4RL7A 2WS92 5T50A 2ZACA 2FBEA 1MZ5A 4KWJA 3V0AB 5J37A 3IPVB 4UW4A 3V0BA 3VBSB 3IDBB 3OYWB 1V6NA 4JGYA 1VBD3 1AZDA 5CIRA 3TYJA 2R49A 4D3WA 1NA1C 2NN8A 2IXHA 1AL0G 1XYPA 4E4ZA 3BB6A 4XTMA 3B7MA 1PGSA 4COUA 5KHIA 3J4UH 1HXS1 2GU9A 3KM5A 2HWD1 5BUVA 3URFA 2DUPA 5EFUA 2W0XA 1EP0A 4H7LA 1OA3A 5DZGA 2PLV3 2Q1MA 3VBOB 1T6GC 1RUC2 3JB8A 4HMZA 3I8TA 3AJYA 1IPKA 1M06G 5FPXA 3ZFEA 4XOGA 2V5YA 3RRDA 1SBEA 1UKRA 2VPVA 2NM1A 1RUE1 4FPHA 1W6QA 4P9XA 1G9DA 1Y7BA 2WIIB 3OGJA 4KL1A 2WNUC 2DFBA 3R6SA 4LBNA 3ASIA 4Y22B 2FZ1A 4K7JA 2GN3A 3NWKA 2ZOEB 4IEPA 4LHLA 4JGYC 1VRH3 2XHKA 1HKDA 1WW4A 3LZZA 4XPVA 4B8EA 4XFHA 1QXRA 1AX0A 3E5XA 2QCSB 4IV1B 1H1MA 3IM0A 2GC1A 4Z1VA 3VHOA 4WVVA 4AEDC 4AK3A 2PAKA 4LEJA 5H9SA 1L3JA 4AG4A 2GDFA 5KHHA 1ONAA 4EWEA 3FHIB 4GB31 4PIXA 4QPIA 1CPMA 1W6NB 3H1WA 4WM8A 4E2GA 1BZWA 2EAAA 5K9YA 1RUI1 1G9FA 1FOD1 2UY9A 3POSA 2JE7A 1FOD2 4PLOA 1H1IA 1SLCA 5GZEA 5A3LA 1COV3 1H8TA 1YJLA 1RMU3 3FX3A 5J48A 2EIGA 4HETA 4PBOA 3JD73 2WSVA 1YCIA 4XYXA 4AQ6A 4FPGA 5I0UA 2ZAHA 3FWEA 1W39A 1QJZA 2Q8OA 4BOWA 1D0HA 5HCBA 5KWRA 3M7AA 3FZ3A 2WNEA 5JI7A 3JZVA 4A2UA 4PQ9A 2GNBA 1AR62 4DY5A 2PN5A 4Y24A 4XJ8A 3Q9OA 1JBCA 1QOTA 4E9KA 5LEJA 3N4MA 4AVSA 4MV2A 2Z5WA 4YW4A 3VN4A 1LB2A 1PNFA 1TMF1 2PELA 4RR3C 1H4HA 2CWMA 4AI1A 3ST7A 4MGYE 3OBTA 3FFZA 3FUOA 4AFAA 4LA3A 2DU0A 1O4TA 3LA3A 4P9WA 2WT0A 1YIPA 4Q4X1 4CP0A 2IXLA 5FQ0B 4A3XA 2E7QA 4P5HA 3N7LA 4E4SA 2HYKA 1DGLA 1SBDA 4HK8A 3TNQA 1U5IA 3I59A 4META 5GLVA 3ZSMA 4IEWA 2MEV3 1WD4A 1FI2A 3PVOA 4Y1VA 1OQDA 1OPOA 3AYDA 2HEYF 4GULA 1Q56A 4ZU7A 3E6BA 2C5DA 2GMEA 4F3JA 3NV3A 1AVBA 3B3QE 4LHKA 3GYDA 4M0HA 1MS8A 3BPZA 1MS4A 3SCHA 1Q8QA 2D40A 4FQZA 3H3UA 2V73A 5HXVA 1BMV2 3H9AA 4OZXA 4YARA 2RS32 4ZXKA 5JI9A 2P17A 5DUVA 2IWGB 2DU1A 1NXMA 5GZGA 5L7OB 1UIKA 3MLKA 1WD3A 3USUB 1DDLA 1PVC1 1MS0A 1X33A 2A3WA 2A3XA 3WW3A 1DQ0A 1H0BA 1CAWB 4FPYA 3B5LB 4OI1A 2PHLA 3FLPA 4QPYA 4EWAA 1N1TA 5CFDB 2RS13 2VQ0A 4GH4C 4AGVA 4D7SA 1K5MA 3RMYA 5FLIA 2QJVA 4XMAA 4BH9A 3GZUC 3J9SA 3ZXLA 2NQYA 4C0HA 1PHMA 5K0UA 5I0SA 3UKVA 1A8MA 1MS5A 2HWF2 3CJIC 4BMBA 2UU8A 4GMP0 5C33A 4CDWB 1GANA 3MI8A 1D0GA 4FCAA 3ZFGB 1RUD3 3DUIA 4Y4YA 4YGCA 2D6NA 2B45X 2LALA 1R1A1 4AEMA 1ZBA2 4W6YA 3ATGA 1LOBA 4S2HA 4LUMA 4LE3A 4AVBA 3NKTA 3HT1A 5ABJC 3WOGA 4OFGA 3PJYA 4HN0A 1FPN1 4YM3A 4YW1A 3JU9A 4WVWA 2WT1A 2BPA2 3RWNA 1QKQA 4AF9A 1UCXA 1MACA 4I0WB 4K1ZA 5JSPA 2WNVA 1KS4A 1QJY3 2VVDA 3BTAA 4FPLA 4BLJA 1S1AA 2E63A 1UPIA 2P3IA 2XKPA 4Q0SA 4IERA 4CDWC 1U5XA 2JXAA 2PAMA 4FXGB 5JIAA 3ZFFC 3KB5A 5C8CA 3B02A 3WCSA 3AM2A 3L9JT 1PNGA 1VR3A 3S7IA 5IT6A 1RB8G 1RUG3 4NHMA 1C8NA 1IQAA 1S2KA 4IEZA 3W9AA 3VZJA 3KQRA 1NXD1 3I7DA 3NW4A 5T3NA 1LULA 4HVRA 5AVAA 2ETEA 1WUVA 2DVFA 4FPCA 1JHNA 1AR91 1ZZ6A 2QFEA 2GNTA 2IXKA 2K0GA 5T55A 2BFUS 1NY71 2ENRA 1SFYA 1ASJ3 5BNNC 3A0NA 3WP4A 1N1SA 4Q0PA 4O9GA 4FSJA 3USUA 3WDVA 4EN9B 3LB9A 4I3PA 1YFUA 3D82A 1KITA 2GH8A 4F83A 2RS12 4AYUA 2XJRA 2YUEA 1ZRRA 3ZX7A 3POYA 2GC3A 3QH6A 1SFNA 2D93A 3TN91 1D2SA 2YGLA 2OIIA 4XF0A 5FMOL 3PNAA 4TSVA 4C1XA 3VBOA 3WG1A 5BY5A 2CAVA 3O0WA 4KWKA 1V00A 3GNEA 4X6RB 2GZWA 3QACA 5EXOA 1HRI3 1RVF2 2QDRA 4M00A 5T5PA 3FE5A 4R9AA 5CFDA 1RUE2 4YSFA 2TBVA 1BEV3 1SEFA 1PK6B 4JCKA 4ATEA 4Z8BA 2W08A 2ZABA 3VKLA 2QKDA 2B8MA 1GQHA 3E6DA 3PVEA 1UW8A 5E89A 2ZHMA 5D8AB 2WS93 4H3WA 3B93A 1SACA 3MEPA 4YZ2A 2ZGUA 2WZPP 4INDA 2UYBA 3ENRA 1PIV2 5D1IA 3H7YA 4COVA 2QQPA 4ORFA 1AF9A 1CN1A 1V6OA 1UX6A 3ZXKA 5JDBA 3VL8A 1OLRA 4GB32 1VBC1 1WCKA 1G8WA 3CNAA 1XU2A 4JRLA 4L11A 5CADA 1N3PA 1YYNA 4DY3A 2Z79A 2Z42A 4B4QA 1NYWA 2CL2A 3C3VA 5EYXA 3J26N 2BVBA 2ZTNA 1XNKA 2VUJA 1LODA 1Z0HA 3U4XA 3ROUA 3N36A 2XPJA 3MPBA 3L2YA 5SV8A 3M3IA 3VZOA 3HD8B 4I09A 1CESA 4Z82A 3D6EA 5DDJ3 4AFDA 3KLSA 5BYNA 1FPN3 3QBQA 4N7IA 4YG0A 1Z7S2 1XQNA 5IK4A 1OFSA 3KD4A 4UW3A 3I4IA 2D97A 2ZX2A 4PDWC 2UY8A 4DINB 1KDKA 4ZU4A 3FUQA 1UIJA 1ND2C 1RUE3 1VBE1 4KG0A 1ZBE1 3WP3A 3AFGA 5C8CB 4YRDA 5ABJB 4TLFA 5EYYA 2VW2A 3KS7A 4XF3A 4IV3B 2B5HA 2OW4A 1LOCA 3FMGA 3SHRA 2O8QA 5I93A 3MIFA 4XIOA 1UN1A 3OD0A 4M3CE 1NZCA 3HN1A 3S6PA 3D0SA 3WY6A 5CFCB 1W0PA 1RMU2 2JG9A 2I2SA 4MXWA 1TNRA 5AC92 1PO23 1GZ9A 4NHLA 4OI4A 2RMU1 4QM8A 4DZGA 3ZXAC 4Y5Z0 1EPWA 1MQTC 1LOFA 4R9DA 4H7MA 1EYBA 4OI2A 1SQ4A 2R0HA 2ZZQA 4HPKA 1I9RA 1GR3A 4R4XA 4XF4A 5A32B 5EV7A 1H2MA 2WSUA 5T5OA 2AUYA 3VHNA 2X8KA 4QQLA 4CYDA 1N3OA 5KBFA 4WM7B 3BOWA 3VBRB 3AZZA 2BNOA 1M4WA 1PVC2 1V9U1 2VG9A 1DGWX 4HK9A 4N53B 4QQOA 1C5HA 2ET7A 1PM7A 1J59A 2MNGA 2ET1A 2VOXA 2XBO3 3IPVA 3V0BB 3R4SA 4XE9A 1YFWA 5JZGA 3INAA 3RJRA 1LRHA 4UBGA 4J1XA 2XBO1 5FO9B 4TWTA 1CD3G 2VW0A 1JYCA 1CAWA 3WLUA 4MH0E 4AQSA 3OYWA 3KGLA 2R043 1NCRC 1NCQB 1ZBE3 4BQ1A 1GNHA 1ZREA 5C8CC 4Q29A 3TN92 1LR5A 1FXZA 3B69A 1DQ4A 1S0CA 5C9AB 4RSUA 1Z78A 3ZVXA 1I1EA 5GKAC 4Z07A 2YPJA 1QH7A 2HWE1 5I0TA 1ULCA 4EN8B 2G9GA 4RA0A 4D7TA 1V6KA 5BPXA 4CEYB 4L99A 2RS52 1Y43B 1H9WA 3HIFA 3SH3A 3HWJA 1X8EA 3PMSA 3RNSA 4DMIA 5BNQA 1BVP1 5LK7B 2HWC2 4COYA 2W68A 3FJSA 4FOYA 1ZRFA 3M3EA 5J96B 1XNDA 2WQ4A 4CDUB 5JPMB 4YM1A 1RUH1 2CAUA 5DXDA 1CAXA 4QPIC 3N35A 2YY1A 2HWD3 1POV0 3MICA 2GAUA 3E5QA 4Q26A 5T52A 5AFEA 2NPIA 4I0BA 3GZTB 2A6WA 4CDXA 4CEWA 2H6BA 2XJTA 2ZS6B 4OHWA 4CDQC 1RUG2 3SH4A 3LCPA 3AYEA 3JUUA 1A8DA 1H2KA 4LA2A 4Q0VA 5EWSA 1COV2 1H2LA 3VKOA 1OLQA 1DQ1A 1YNAA 2BGCA 1POV1 4NO4A 1QH6A 1FATA 4Y26A 2XH6A 4AXOA 1WMFA 4N43A 1WMDA 1B35C 1AR72 5FOBB 4RHV1 1WLWA 3LWCA 1EAH1 4CDQA 1HRI1 2ZMKA 2OYZA 4QM9A 3AZYA 2WNVB 4ISRA 3WNXA 3W59A 1DQ6A 1J1LA 2OA2A 1AR63 4OVEA 1POV3 3VBHC 2AH2A 1CAXB 3WV6A 3ZFEC 2C9AA 1HXS2 2TNFA 1QJX2 3JBG1 3SH5A 1RINA 3B9IA 1QQP3 3WINE 2W52A 2HWC3 2A70A 2B42B 4XILA 3O5SA 4Z92B 1QDCA 4XJZA 1QHDA 3WUCA 1MS9A 4B3NA 4H14A 4EWDA 1O5LA 2GNDA 1IOAA 5JSRA 5KHGA 2VVFA 1H30A 1H8TB 1W6PA 1AR82 1GKBA 1VBC2 4RFT0 2ZGLA 4OHYA 4GMP1 4JGZB 4KGQA 2R072 2D6KA 5JZGC 1CAUB 3RJ2X 4URTA 3AMPA 5HCAA 2ARXA 4COWA 1V70A 2AR6A 5E16A 1VAVA 1IS4A 2R32A 2DTWA 3SXWA 1PO21 4HKWA 1HQWA 4PJYA 2E51A 5IK7A 5IUQA 4AGGA 1RUF3 3WX5A 4G9SB 3ZIXA 1RJ8A 4S2GA 3MIGA 1J3PA 1F5JA 4LE4A 1JYIA 4FO9A 1WCSA 3AP6A 3ZYRA 4FPOB 4IV1C 1KJRA 2EF6A 1ULGA 1VBE2 3M2MA 2RM21 1LTEA 5GJ6A 3AB0A 3V0AA 4OHXA 4SLIA 1YWKA 4X8PA 3TOJA 3VLBB 2Q4SA 1DG6A 4PF5A 2PLV1 4N53C 1PIV3 1IKPA 4O9EA 4JV4A 1KQRA 1W6OB 3QLQA 4Q4Y3 5DZEA 1HXS3 2X5IB 4BIOA 3AK0A 5I8SA 3OGGA 1BVVA 4Y1UA 2UWCA 2WNVC 4Y1ZA 5KC5A 1ND3A 5LEKA 4P9IA 2ZX1A 3MIDA 1AXZA 3O12A 3PHMA 5BNNB 1ND2B 2UWBA 2JENA 3EXUA 4WZCA 4KU7A 3KCCA 1VBD2 1E57A 1AL22 3WP6A 2IFWA 3WQ7A 4TZDA 2E9QA 1R1ZA 1ZZ8A 3AYAA 1LHUA 3ZYIB 5E88A 4YZ1A 4QPGB 2VOKA 3N7KA