1JOPA

Yhch protein (hi0227)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
140
Chain Sequence
MIISSLTNPNFKVGLPKVIAEVCDYLNTLDLNALENGRHDINDQIYMNVMEPKAELHHEYLDVQVLIRGTENIEVGATYPNLSKYEDYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCCVIKKLVVKVPVKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Yhch protein
publication title Crystal structure of the bacterial YhcH protein indicates a role in sialic acid catabolism.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 35
structure length 140
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04074 DUF386 YhcH/YjgK/YiaL
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.370 Mainly Beta Sandwich Jelly Rolls YhcH/YjgK/YiaL 1jopA00
1S4CA 1JOPA
chains in the Genus database with same CATH superfamily
1DCSA 1J3RA 1UOBA 2HWD1 1EAH2 3CBNA 1D2QA 1OA3A 3MV01 4LULA 1W05A 1ZBE3 4B7KA 4QB2A 2GH2A 5H9RA 3VBRB 4NWVA 4LKDA 4EV0A 5C5TA 2PTMA 1JBCA 2PA7A 1HLCA 2WNVB 1UX6A 5C8WA 4NVPA 5JI9A 2BPA2 2DTWA 5F5AA 3M4FA 5HXMA 3A4UA 1HRV2 2GMPA 2E63A 5JZGC 4CU9A 1QXRA 2QTWB 1OBNA 2ET7A 2QKDA 4JC1A 4NOTA 1WZXA 2XQRA 1FXZA 1HRI2 2ORXA 3JD71 4Q2FA 5FPBA 1UD1A 1NCQC 3GZUC 4V2VA 5FYCA 3WP3A 4YVWC 4CU8A 2OW4A 5J48A 5FO9B 3KV9A 1OURA 1D0GA 1Y9GA 2VUJA 4BU2A 3ELNA 1GZ9A 3P3NA 4AVCA 2O8QA 1C4RA 5HV4A 2Y6JA 4YZ1A 1W2AX 3OTFA 4QAWA 2P34A 4LO8A 1H6YA 1BXHA 1U5ZA 1X9PA 2EA7A 4UFKA 1HX6A 2AR6A 1NQJA 3ITQA 1KRIA 4XDOA 4LBQD 3IPVA 1GUIA 2ES3A 3FC0A 3FX3A 2RMU1 3M3EA 2DUPA 1NA1A 5E16A 3POYA 5EQUA 5FFOC 2W1SA 2FZ2A 3VD4A 5DABA 2IC1A 2VZ3A 2R041 1A3KA 4O65A 4XFGA 3D8CA 2NQYA 4B7EA 2X09A 5D1IA 2QVSB 4YGBA 2W92A 3GGLA 1HQWA 2W2IA 1US3A 5FXZA 4W4ZA 5K8SA 2BNNA 1UOJA 3MHZA 4A44A 1LRHA 1VBC1 5CADA 3UNPA 4MG2A 3VBSA 5ANNA 3JZVA 1XSRA 3KGZA 2D3SA 1L7RA 5C3SA 2J1TA 4JAAA 4IUGA 2YZ4A 1XRUA 1TE1B 4RHV2 5FUNA 3WNOA 3ALQA 1MR5A 2UWAA 2XL7A 5A7QA 4E8CA 2Y60A 3ZXKA 5I8TA 4Y22A 3UGHA 2WFPA 4FTSA 4HSJA 4M3CF 4XXAA 2WT0A 2VUAA 3WHUA 1SLBA 4XXPA 2VVEA 2XONA 2ZMLA 4WM8B 2HWF2 1W2TA 5FYVA 3ZN4A 4LHLA 1ND3B 4AVBA 3FLPA 2JD4A 2BU9A 1HB3A 1V00A 3B02A 4ASLA 2JJ6A 3FWEA 3E5XA 3N9MA 1O8SA 4IV3A 3PUQA 4JKMA 1KFUL 2PQSA 5CBLA 4AE2A 4ET7A 4P9WA 3OG2A 5DMYA 1UWWA 4Y33A 3IAPA 2FCVA 2BP6A 2BEOA 1UOFA 4B3NA 3MW2A 5F2WA 4HVRA 3LIHA 4GAZA 5FIXA 3V64A 5JMOA 4CZSA 4H14A 1T2XA 2W39A 1WD4A 3KQ4B 3DL3A 1AR81 1YJLA 1O3SA 1BYHA 3FL7A 3VBRA 3K4DA 5IATA 4UWDA 3KV6A 2VMCA 4OI4A 2EXHA 2WSUA 3USUB 5C4WC 1GOGA 2WNVA 2ID4A 3GBFA 5HBAA 1GWKA 3PVNA 1H1MA 2PLV2 2AEYA 2A6ZA 1FNYA 1V6JA 3POIA 3ACHA 4KWKA 1BHGA 3TOJA 3W58A 4YARA 1CZSA 3AYAA 4FTEA 1J83A 1PO22 2YROA 4XF1A 4KL1A 2IXHA 4G4FA 3GBWA 4PHZA 1ZVFA 1QMJA 4E4HA 4Y5SA 1AL21 3JU9A 3T08A 2BZDA 1YQ2A 1HN1A 4Q29A 1QOSA 5ERLA 1EV11 1JS9A 1T6BX 2A6WA 2AACA 4O61A 4UI9L 5FP7A 2CHHA 4UT5A 2LALA 2ZGLA 2DFBA 3ZX7A 2P3YA 5FPUA 3RQ0A 1LOAA 4R52A 1AR71 2ORZA 5GZGA 1S0CA 2WKKA 4HKOA 2WIIB 3BOWA 3OYWB 4ISQA 2XHNA 2R1BA 4HOOA 5E6HA 4LBQB 5LASA 3N7MA 1KEXA 4XE9A 5DQ0A 4P9GA 5F7UA 1LODA 4OVEA 3NJZA 1Y9QA 3FFQA 2DCTA 2HWB1 4TZDA 4FPCA 1I6XA 2ZOEB 3MW3A 4Q27A 2ZABA 3H1YA 3OGSA 1C3HA 1UIJA 2EIBA 2WO2A 3HNMA 3NKTA 2DVDA 3LZZA 4N53C 3BIEA 1SZBA 3NNMA 1WMXA 4MGIE 4IE5A 1LHNA 4XACA 1WUVA 2DCZA 2HH9A 1QNWA 4NAOA 3L2YA 4COWA 4R9CA 5I0DA 1POV1 1WCUA 2VNVA 4BQ1A 2ZS6B 3ZYHA 5FZHA 3SCGA 5IVEA 3WW4A 1GLHA 1HB4A 1GZWA 4P5HA 1WD3A 2R16A 2R043 5FYBA 1DLCA 1AVBA 1NZCA 4XJ9A 2XBO3 4A3XA 2QQKA 3AXDA 3R4UA 1NXD1 5FZAA 1GMMA 3MLKA 3RPQA 4FVVA 2EICA 1CAVB 3K77A 5IJRA 2CY6A 3ETQA 4C90A 2VVFA 4AHYA 1DP0A 1ND3A 3T2OA 1AYM2 3DN7A 4YGDA 5BYNA 2GMMA 2PXJA 4IEZA 3ENRA 2D98A 4XTMA 1COV3 1GFF2 4KQ7A 4HKLA 4CXXA 1VRH2 2UYAA 3IT8A 4NRQA 3IDBB 4UBGA 3WW1A 1OA2A 1C8M2 4XZPA 5A7WB 1W3VA 4UXAA 3AP6A 3HVDA 5C9AB 3OGJA 2W1WA 3UESA 1E57A 2JG8C 1UY2A 2RM22 4W6XA 3ZLIA 2E26A 3HN3A 3PUIA 5A7OA 3U1XA 2ZGMA 2BBAA 4WM7B 5GLVA 3WR0A 5JOWA 2NM1A 2VQAA 4XABA 1RB8G 3I2GA 5D2AA 4K9SA 4LJHA 3T2PA 4AQ6A 4DXRA 2K46A 4R4XA 1VBB2 4S2GA 4TWTA 1UKRA 1WW4A 3HR9A 3ZIWA 1K5MC 3RJ2X 4YFZA 3S0MA 4ZKTB 3USUA 2GNTA 4YVSA 4AQ2A 3PL0A 4CEWC 2ZPXA 5CFDA 3VLBB 5GLWA 2WA3A 4HANA 5JPMB 3UYJA 1ALYA 1MEC1 4N43A 4Y24A 5F6KA 3CJIA 1RUI1 3ZFFC 1UMHA 1XYNA 4CUBA 2VTXA 3H50A 3WDTA 4D69A 2GP5A 1C5HA 1JOJA 1H4GA 1W6NB 4DXZA 1RUH3 1GNYA 3KT1A 5C70A 2VG9A 4HMZA 4BH9A 5FWJA 3ZFGC 4OQ8A 4N90A 2YY1A 1SLCA 3NJYA 5HI0A 2VMIA 2W46A 1DBNA 1JUIA 1OKOA 3SH4A 4CUGA 1KDMA 5BNQA 4NIHA 4CP2A 1QQP1 1XJAA 2VU9A 3HPNA 5LA2A 1BVP1 1BBT3 2YBSA 3JBG3 4FO9A 3OYWA 4D7TA 3E6DA 5EV7A 2VOXA 5IK5A 3AZWA 5JPNB 4FTBA 1AL23 2K2SA 2FCUA 4OUMA 3AP9A 3WUDA 4CDUC 3L9JT 2B7YA 2G9FA 2XJTA 3BTAA 1QH6A 2WT1A 2XLAA 3CKHA 1H1AA 2QQLA 3QCWA 2JXAA 5FYSA 1AR93 2HYXA 4ATFA 5JSOA 4P02B 2RHPA 4NIAA 5F3CA 1DF0A 5DUVA 4B4QA 2RDNA 3KWVA 4PI2A 4EZHA 1Q8PA 3OPZA 1OHFA 3PJYA 1HRI1 4HVQA 4ISRA 1W6MA 1CPNA 3V0BA 1O3TA 1PO13 4AK3A 3TEYA 5F9TA 1UYYA 1PGL1 4XJZA 3OPWA 2QQPA 3DKWA 3UJQA 2IWGB 2HWB3 4LKEA 5ISLA 2PAEA 1SFYA 3AFKA 1DZQA 1UY1A 2PMWB 4Q1PA 3PURA 4U36A 1LGBA 4K40A 4PLNA 3TNQA 5FY8A 5FK8A 2GAUA 2ZMNA 4A42A 1U12A 5CKQA 4Y1VA 3CZUA 1JZ8A 1NE4A 1L7LA 2X5IC 2FDFA 2ZEZA 5D21A 2HEWF 4NHYA 1ENXA 2E7AA 3EMRA 4RQPC 3KQRA 2QQWA 3D0JA 1DFQA 3MIEA 5KHJA 4Y1ZA 4CCDA 1PMHX 1VIWB 3DYOA 3DYMA 4H55A 3RYRA 2R1DA 3BI3A 2VZQA 2ZAAA 5JR2A 2MEV3 5LCWL 1EUTA 1XNKA 2AEZA 2YC2A 3I2OA 5T50A 1JUHA 1UZZA 2AUYA 2ATFA 2IFWA 1RHI1 3D82A 3I3EA 1NKGA 4WM7A 5FYUA 3ZSKA 5DPNA 1ZM1A 4L8QA 5I0TA 3ZSMA 3S5AA 4FFFA 1KJRA 2HYKA 2ARCA 3H1WA 2VR4A 1S0JA 2WINB 4LUKA 4NROA 1SLTA 4FBFA 2GU9A 1GWMA 1VLNA 2XWBB 3HN1A 1CAXA 1YHFA 1JMUB 4G9SB 5CFCB 5ABJB 2DFCA 4OHVA 1R64A 2L9LA 1D0HA 4FP2A 3SQOA 4XQDA 1ENQA 3C7EA 3GDBA 4UW6A 4XILA 5F5QA 4P9LA 3SH3A 2IZWA 4NHXA 1G9FA 2K0GA 1LU1A 4YZ5A 3ZPYA 1I5PA 4AHWA 1A6CA 1TEIA 4FFGA 5J96B 3HQXA 5A6XA 4CCLA 4EN0A 3M8LA 3I8TA 3RGBA 1LULA 2BGOA 2GDFA 5AC91 5LRRA 5IYYA 3EQEA 2XDVA 2ZGKA 4M4PA 3CHXA 4XDQA 5I0UA 3PHMA 4M3CA 1TVGA 3ETPA 5A3MA 1LEDA 1RUD3 1W8TA 4IGOA 4KU8A 4BIOA 5IVVA 1KXGA 4OYUA 3V65A 4RR3C 2RR11 2JDPA 3GM8A 1W90A 5I0RA 1WA4A 2JIJA 3N9QA 2D5FA 3NJVA 3WQ7A 2TNFA 1AYN3 2EXJA 2XG3A 1X36A 2NYYA 3I97A 2P17A 2A6XA 4LE4A 3AZXA 2WQ8A 3RWNA 3H9AA 5KXEA 3LEKA 4PDWB 4KWUA 4ZHNA 2C26A 1XYOA 4L9BA 2I07B 4CDXA 1WMDA 5A6QA 4W65A 3A0KA 4P14A 1U5XA 4E8DA 3MYXA 5BXXA 5B4NA 2C5DA 3LFMA 3FBMA 1XXNA 4IL7A 3AKRA 1DZRA 4YW1A 5J98B 4ZS3A 1PK6B 3FJSA 4BK4A 2PHUA 2YU2A 4ARXA 1CIYA 1W2OA 3QH7A 2ZX3A 5IVYA 4ZXKA 4FPOB 3ZSJA 4QDQA 3VN4A 3WF2A 4QHOA 3BYWA 2GC2A 1TMF2 5ACA1 2J1VA 5EJZB 2GC0A 2E32A 4L92A 1ZRFA 1XU2A 1QXJA 1W9YA 4QT6A 1ULCA 3U4XA 4COUA 2IXJA 1V6OA 4GB33 4FOYA 5LB6A 5C8CC 3MDPA 3T4VA 5A7SA 4F83A 2E7QA 1XC6A 1NA1C 1ULFA 1YRZA 3VDDA 5IK7A 3AMMA 4FPEA 1QJU1 5LA9A 4RL7A 1RXGA 1UKGA 2RS51 1LOFA 3LFIA 4Q0SA 4BMBA 5BNOB 5JOYA 5K0UA 2BGPA 2VGDA 1OT5A 2EF6A 3VBSC 1BEV1 3AMQA 4LKFA 2IUWA 3VBUB 1XBFA 1JH5A 1R091 5J37A 3HIFA 5DAXA 4COZA 5BNNB 3MBWA 2EXKA 2VMGA 3AJZA 3J7LA 4KGQA 4CXWA 5HV0A 1AR61 4F8AA 5CFCA 5ABJA 2W47A 2X10A 3TEZA 4C1XA 3OBRA 2XLFA 2JDKA 3VL8A 2VQUA 2YC0A 4V2WA 4B4RA 2QZ2A 1DDLA 1RHI3 1YWKA 2DTYA 4A4AA 2A71A 4JKLA 4MGQA 3AC0A 3C7HA 3F2ZA 3AP4A 4XIKA 3PDQA 1NZIA 2BQPA 2B39A 1QF3A 4LO7A 3AMNA 3U0ZA 2V4VA 2P3IA 1YQ8A 2WFF1 1FPN1 1ND2B 2B9VA 4Q4W3 4BQWA 5CEHA 4M01A 3QBQA 3SLIA 4Y3OA 3CQOA 2E51A 1RUH2 3OEBA 3R4SA 4DEVA 5D8AA 3I7DA 1OH4A 1G9BA 1QJY3 3LDRA 1W99A 4PCRA 2QQNA 4ONUA 1UY4A 1XNTA 4RFT0 4YW2A 1PHMA 3IDCB 3J7NA 3O12A 1WCDJ 3LDKA 1BBT2 1DGLA 1KJLA 3JBG2 4XFAA 5HCFA 4DUVA 2WNVC 3ON7A 4EQVA 4FPJA 5FUIA 4E4DX 4JQRA 4PDWA 4YW6A 2ZGPA 3Q8AA 4ASKA 4LOSA 2V5YA 4YM2A 3MF6A 4XUTA 4JGYB 4FAHA 2ZXQA 1PGW2 1SCSA 4E2QA 2E9QA 2W52A 1MS9A 1UYPA 2XQXA 2BERA 2Q1MA 2B8MA 3B93A 5KHHA 1QJEA 2R6QA 1CONA 4N9HA 5DAPA 1ULPA 3LD8A 1NX9A 3M70A 3B3QE 5LW9A 1AR92 3S5QA 1XPWA 2D6PA 1PK6A 1K3IA 2PELA 4CP9B 4LT5A 1Q8OA 1W2NA 1UNBA 2BUKA 2CGOA 2V73A 3BIWE 1RVF1 5E1RA 5T52A 4NIDA 5LBCA 5BNPB 5JR7B 3PTYA 4QX2A 1QEXA 4QB1A 3PUHA 1RUOA 3TAYA 4J25A 4RS5B 5CAZA 3BPSA 4LBOA 1W8OA 2ZGOA 3WP4A 5A1AA 3SHRA 5LEJA 4URAA 4TLFA 1IPSA 4Z2WA 2OS2A 2PHTA 3N9OA 3ZR6A 1XNDA 3KF3A 3AYDA 3O14A 1J1TA 1JZ4A 3X29B 1JZ2A 4NRMA 2R071 1VBD3 3LCPA 4BQ2A 1OPOA 1OSGA 3ZFEA 4XBNA 4ZPIA 1HV0A 1UPSA 1X82A 2JDUA 3I54A 1C28A 4LBMA 4DB5A 4XCAA 1DQ4A 2BNMA 2JE9A 3OUHA 4DY3A 2WZ8A 5A32B 1GP4A 3V0AA 2J1SA 3NKGA 5BNOA 5GZCA 3ZN6A 1R1A3 5A7NA 5FO8B 1N1SA 5FYTA 5JI7A 4AYUA 5C5UA 3N3HA 4L0PA 1W39A 1RUF2 2MEV2 3MIGA 4A2UA 2IXLA 4MHRA 3GALA 5FMCA 1TME2 4D7SA 5F1RA 2BDRA 1RYYA 1GZCA 2ADEA 4XVHA 5JVVA 1BMV1 2UYBA 4ITCA 4CXYA 5FY9A 1QJU3 1Z0HA 2DCKA 1VAMA 1ZX5A 3SKVA 4WVWA 5C3PA 2HLEA 3KLSA 2RS53 1LEMA 5EPAA 2VJXA 3LE0A 4D0QA 3I59B 1UZYA 3WDUA 1UPIA 3NV3A 3H3LA 2EIDA 3K3NA 5JIAA 4D7YA 1D7PM 4XUPA 3LA7A 4MX3A 4A6SA 3CEWA 3APBA 4XF9A 1UYXA 4BPZA 1LB2A 1ND2A 1BJQA 1OUSA 3WDXA 4KG8A 4MO3M 5T5PA 3URFA 2HWE3 1DGRA 2Y6GA 2KXLA 4LO6B 1J3QA 1SG3A 1PVC3 3R0RA 4NE9A 5SV5A 4DMIA 3RZKA 1NT0A 4QB6A 3PMEA 5GLUA 2WRAA 3JUUA 2HWC1 1DQ5A 1YJKA 4XHBA 4HT1T 1E5RA 3IN9A 3I49A 2VH9A 1RUD2 3UT0A 2JD9A 1O4YA 2WFF3 3VZNA 5FR3A 5JXJA 4YVSC 1JYCA 4AOCA 4B4PA 1OVPA 4MGSA 3PTRB 2SBAA 1LJ7A 3MIFA 4Q26A 4AGVA 2DUOA 3ZYPA 5CFDC 5IAXA 1AYN2 2O14A 1YEWA 3KM5A 3S57A 2XB6C 2Q8DA 5L7OA 1W6PA 2IVIB 1H8TB 5FZEA 1F4HA 5FCCA 3H8RA 4N43C 3CJIC 1HB1A 3H0OA 3IMMA 1HQLA 1UMIA 3KCXA 1ZA7A 1ZZ7A 4IV1A 2R061 4MXWA 3WNNA 1DIWA 4LNVA 1UXXX 3NJXA 4XAEA 2OIIA 3HOBA 1VR3A 3A23A 3DPRA 2RS11 4BQ3A 2AZ5A 5BNPA 4QPIB 4CDQB 4BMEA 1ASJ3 3C2UA 1RXFA 2A5ZA 2R49A 4SBVA 2ENRA 3IIAA 5JIUA 2JWPA 4GWJA 2AYHA 3FHIB 2LRPA 4XUOA 1RMU1 5FY4A 4BCUA 4IEXA 2V72A 4FCAA 4JGZB 4RA0A 5JWPA 3JB8A 1BQPA 2VBBA 3AP7A 4EROA 2JB4A 4XFCA 4GJYA 4AVSA 2J1UA 1W6OB 5CKMA 1RUG1 3KHBA 4XJWA 3VKFC 3OBZA 2DURA 4AHXA 2VQTA 1NCRB 2RVAA 3WLUA 1UY0A 4QQOA 2D3RA 5KXBA 5KWRA 3VKMA 5L19A 5FZ0A 2J1RA 3PU8A 4MZUA 4DEQA 1RINA 1EPZA 1ZRCA 3MV11 4GB32 1UQXA 4JHZA 2VO5A 1JW6A 2YBPA 5A32A 5LA1A 4Q4V3 4R9BA 2RJKA 2XL9A 3RI8A 2ZGTA 1IPJA 4LKSA 4N8MA 4OZXA 4MSVA 3WV6A 3RS6A 4AEDB 4IETA 2R073 5A3PA 4Y5TA 5F39A 3GCXA 3PNAA 3ZXJA 1RJ8A 2BTVC 3N9PA 4HPKA 3HWJA 3POEA 3U37A 3K4AA 2PHXA 1PM4A 3ZYBA 2D6NA 2KA3A 1G9AA 3GZEA 1J3PA 1O3QA 1RUJ3 4UFHA 1W8FA 5C71A 1XQNA 4QGNA 1IKQA 2WT2A 5A33A 4OZOA 1W8WA 4LHKA 1UO9A 1HKDA 1K42A 5LWBA 2WR9A 2ZHKA 1JU4A 4XBQA 1VBE3 4WVMA 2WLPA 4CDWA 1DYPA 3OCPA 5FZOA 1HQNA 1ULGA 3AZYA 2LW8A 4E9KA 2AENA 2YHJA 1VE0A 2WO1A 3B7MA 4Q0UA 4BQ5A 3LA2A 4XFBA 2Y0IA 1SLLA 1E5IA 1IG3A 2JG9B 1ENRA 2WC2A 1GSLA 4JRAA 3GCWA 4QPGB 4I30A 1O4ZA 1WLCA 5IAVA 4MXVA 3U78A 2VZOA 1HXS1 3RMXA 3NAPB 2BOIA 5A70A 2CU5A 5A3TA 1U0AA 3AKQA 3Q8FA 4Q4W2 3ZKUA 2NN8A 3DECA 3Q8CA 1XSQA 2RJ2A 1YFWA 4WM7C 4YW7A 4AG4A 1G7YA 4Z8BA 3N36A 5FZ1A 1F5FA 3OF1A 4FT8A 4PJYA 5DAVA 4AI8A 1QDCA 2OT7A 2CAUA 4YG0A 4I3GA 1M06G 3AJYA 1O6UA 2UU8A 4NUBA 1ZZBA 5K9YA 1US2A 2XKPA 1QJY2 5JLVA 3EYPA 4XCBA 3WT3A 3J8F1 1UY3A 2XJPA 1ZBA2 4FP3A 1X8MA 5FYMA 3BGAA 5J7MA 1H8TA 4QQ2A 4I0AA 1PIV1 2VXRA 2W9XA 2Z5WA 3B69A 3LKJA 2F17A 1BCXA 5DZGA 2HWC3 4CVUA 4Z2AA 3OBAA 1NYWA 1JI6A 3ASIA 5FXWA 2Y0OA 4MADA 5IVFA 2O8OA 5FXXA 1DQ1A 2CTVA 2JDYA 3JQWA 4UFLA 3NMBA 3KZ4C 4K21A 2HWD3 1FATA 2LROA 1WCQA 2D5HA 3HBKA 1DYKA 1NG0A 5JSPA 1HN0A 1D4M1 5EJ1B 4XUQA 4AVVA 2YG0A 4GMP1 1NOVA 2VW2A 5A1LA 1H9WA 1MS0A 2WZR1 3DCQA 2VL4A 2OQ6A 4OCTA 4OHYA 4JGZA 5DZFA 1EPWA 2P3KA 1VMJA 1OC1A 3DF0A 3NV2A 2WL1A 2R063 2JE7A 3VHOA 3KHCA 2WS91 1N3PA 3LPFA 3TN92 4QX1A 2CYFA 3B00A 4FOWA 4Q8KA 3LEIA 4OFGA 4ZU5A 1FOD1 1O5LA 5FKBA 1NCRA 2YB7A 5FLHA 1F9KA 1NE6A 3JD73 2VUCA 1OOPB 4AFBA 2QQOA 4D6QA 4HBNA 1JXNA 1V9U1 3KVBA 1PNGA 3SXWA 1RMU3 2Q1ZB 2VNOA 3AL5A 3OBTA 5JZGB 2FDHA 4YW5A 4CDXC 1LHWA 5DG2A 5GZDA 1HW5A 4S2FA 3WCSA 1NQDA 4INDA 3CO2A 2VZ1A 1VBD2 1JU3A 2VD7A 1ODMA 4QX3A 4U2AA 3OD4A 1J84A 1O91A 2ZEXA 1NCQB 4LOTA 4YW4A 3VBOB 3Q8BA 5DG1A 1TZOA 4AQTA 3BTYA 1MQTB 4YVWB 4XBLA 1DQ2A 1MS8A 1YFUA 2MNGA 2WWSA 1DHKB 3ZYGA 4AEDA 2TUNA 1UAIA 1ULEA 2IXKA 2Y6FA 2W1UA 5L9VA 5IWFA 3WHTA 1LECA 2P6CA 4PLMA 1QWRA 4AXOA 4YRDA 4DRRA 3HAGA 4GD4A 1HJGA 1CAWB 1R1A2 2P3JA 2Q4SA 3DXUA 4CCKA 1CESA 2VY0A 3W21A 1RUE1 4Y5Z0 4BJ0A 5LBFA 3VZKA 2CV6A 4Q4X1 2RMU3 4O7XA 5EFUA 5FZKA 4AI3A 4BA6A 2DDUA 1H9PA 5JXGA 1RUC1 4AW7A 5A7PA 4IXLA 3RG0A 4DPNA 4W6YA 5DDJ1 3POWA 2ZCWA 1DLLA 1FV3A 1S0DA 4YG6A 1O5UA 3ECQA 3MW4A 3O1OA 2CWSA 2ZX1A 2WZPP 4WM8A 5FZDA 2X05A 1R082 3H1MA 3G7DA 1VBC3 1LR5A 2JG9A 4BQ4A 5A6YA 4P08A 4IE4A 3D5OA 2V4AA 3VDDC 5GALA 5FPVA 4QPGA 5CIRA 2A3WA 5H9SA 1E5HA 4E4SA 4YM1A 3OSDA 5DN2A 5DXDA 1IS4A 1LOFC 1GOFA 1QKQA 1FMD1 1OH3A 1POV0 5K0UC 2XVLA 4Q0PA 5FY0A 1QJX1 1G9CA 1WW5A 2DU1A 2P5BA 2DCYA 2CWMA 2HWE2 4P5YA 3KD4A 1JTZX 3I2JA 5IVJA 5K4LA 2C24A 3U75A 1S0FA 1PVC2 5JDBA 1AZDA 1QNYA 1YIFA 1TME1 1Z7S1 2FCTA 2RE9A 2C6SA 4Q4Y1 3RI9A 4A7ZA 5ABJC 5CFCC 4JRLA 4OI0A 2YYOA 4RGAA 4X8PA 5IK8A 3LOBA 1WMEA 4QKFA 5E89A 4CYDA 3C7GA 4LHSA 1W9SA 2GC3A 3H42B 1YIPA 1LOGA 4Q5OA 4AWDA 1ZBE2 2WDBA 4FPKA 5HCHA 2RS31 1WLWA 2BV4A 3LA3A 2F4LA 1FYUA 4NPRA 1AR83 2W94A 5EJ3A 4ZU4A 5FK7A 1QOTA 5JMCA 2D93A 3WINE 4NHKA 1CX4A 3LQCA 1V70A 5L36A 1UU4A 1PGSA 4JTOA 5D8AC 2OPWA 2BBVA 2I74A 4IE6A 3QLQA 5GJ6A 1PZ7A 1ASJ2 1AX1A 5HXVA 3ZKYA 4OHWA 4ES9A 1OI6A 1VBA1 5I8SA 1Y7BA 1R1ZA 4PQ9A 1WLDA 3VKOA 2VQ0A 5C4WB 1JZ6A 2VOWA 1CAUB 4NIGA 4L11A 1OOPA 4Z92B 2DVFA 4LBQA 4PDWC 1EAH1 4K1YA 1B35B 2WZR3 4GA9A 1EV13 2JKXA 1LOBA 3LAGA 3OY8B 1IKPA 2NMNA 3JXSA 2Y34A 3BOPA 4LR4A 3VBOA 2W91A 3W59A 3FZ3A 1YQ6A 4COVA 4UFIA 1MQTA 1AR73 4CU7A 1HRV1 1XOYA 1H1IA 1F35A 1KITA 2UWCA 5FYZA 1PK6C 2ADDA 2DWRA 2ILMA 4Q4V2 3LSEA 4QU2A 2FBEA 4LA2A 4KG0A 4JHTA 2JIGA 1QU0A 2PHRA 3B9IA 3JB4C 3HJRA 2VMEA 5FYIA 4R9DA 4W6WA 2BRTA 4CPBD 1UX7A 3IB3A 4XZUG 2QQVA 2WAAA 1VP6A 2VXJA 4URTA 4NHLA 4GWIA 5CYYA 1RUJ2 2A3XA 1STMA 4AGRA 3A21A 2JEMA 2MHFA 4Q0VA 1CAVA 2BNOA 3WXPA 3ZFEC 5CG9A 1F2NA 4BK5A 1MPXA 4NRPA 2QDRA 1POV3 1RUE3 1VBE2 5EXOA 1DQ0A 3AMHA 5SV8A 3VZLA 2DBNA 2YV8A 1RUC3 4N53B 1SFNA 5AVAA 4IGPA 5JUVA 5BNOC 1P8JA 4LK7A 1C57A 5A7WA 4BHPA 4EZ4A 5KHIA 3ZSEA 1D4VB 5C9AA 1W0NA 4FPLA 3QOPA 1GQHA 1WCSA 3VZMA 3O1UA 3GHMA 4YNIA 2QBXA 5T5LA 3SEPA 1O8PA 1VB4A 5FYYA 1FNZA 3UGGA 5FXVA 3VBFC 4FI9A 2PHWA 5LK7B 4UF0B 5A3UA 2C9AA 3NNJA 4GKYA 1VMFA 3LB9A 1YQ5A 2EIGA 3BUCA 1CZTA 4META 4RHV1 1DQ6A 4BLJA 4R9AA 2B5HA 4IEWA 3EBRA 2Y8KA 1OLMA 1PZ9A 1UU6A 3ME2A 1C1FA 5EIYB 1AJOA 5TSWA 4AL9A 3POJA 4LLFA 2XJQA 4BXSV 4OQ9A 3NNFA 2H0BA 1Z7S3 2HWF1 4Q4Y3 3ZVXA 1ND2C 3RMYA 4OI2A 3E6BA 3O0WA 1W6NA 4GKXA 3RSJA 3NSTA 2DBIA 4AFMA 2X29A 2JG8B 2XHKA 2Y6KA 3T1LA 2BJSA 3WF0A 3EHKA 3N9LA 4MGKE 2IFRA 1JYNA 2HWD2 3OUIA 2P6HA 4EWEA 1GWLA 2ZAHA 4M4RA 3ZDVA 1POQA 2WQZC 3J7HA 1IHMA 3NNGA 4CCJA 3LEMA 4GWMA 1MEC3 3MI8A 3UGFA 1RITA 1RUI3 2WNUB 4DFSA 1OA4A 3B94A 4LE3A 1A78A 1AX0A 3R05A 1B35A 2YFZA 2WSVA 3AX4A 1KS4A 2YMZA 3NW4A 1OXCA 3POSA 5FO7B 5FUPA 5HCBA 5J3UA 5L7OC 3OY8A 3ZFFB 2OXBA 3JD72 4H2AA 4QQPA 4P9IA 3OB8A 4IV1C 4QXCA 2PLV1 1QQP3 1LHOA 2VCBA 4M0HA 3MEPA 5FJHA 5CISA 1RIRA 3ZXEA 2GH8A 3M2MA 3ZFGB 1RGSA 3DPRC 1PO21 1REDA 3SKJE 3WQBA 2FDIA 2XH6A 2W87A 4QX8A 2BVVA 4CP1A 3VDBA 5FPZA 3H8XA 2KR2A 4LIUA 3U07A 4QX0A 2DUQA 1W6QB 2QQMA 3PMSA 4HN1A 4KBZA 5F3GA 3H8OA 3LSDA 3RZLA 4IEYA 5FWEA 4UFJA 4HK8A 4MOAA 1H0BA 5DUXA 1I5ZA 1GOHA 4CDUB 1Y43B 2LS6A 1X8EA 1N3OA 3WG3A 5LRSA 1CQ9A 2NPIA 4K6BA 1HRI3 4LO4B 3AYEA 3W5NA 1D2SA 4MGTA 2R042 2ZZQA 4Y4YA 4IQPA 2XBO2 4LITA 4E4ZA 1U5YA 2FMDA 3I3QA 2N7GA 5J36A 4BOWA 4FXKB 3GBGA 3K46A 2WBKA 4UAPA 1VBC2 4ATEA 1N1YA 3HT2A 5B4XA 3R4DB 1WGPA 5FP9A 4I2OA 5IK4A 1OMIA 1COV2 1N1VA 1SPPB 2B4KA 2DVGA 2VBDA 1YQCA 4B8EA 2DU0A 3J26N 3TB0A 4DOUA 3GNEA 1S0BA 2OZ6A 3TWIA 1N1TA 3VGIA 4CEYB 4JDMA 2K9ZA 1VALA 4CTEA 2CGNA 2X5IB 2HEVF 4UBHA 4WZCA 5T5JA 3U4SA 3PIJA 3ZMNA 3A7QA 3IKWA 4RQPB 4CDWC 2DYCA 5KBFA 4BQXA 3IZOA 1LU2A 1ZRRA 2DF7A 4MUVA 2Z69A 4MGZE 4XIOA 2BVBA 1UZWA 1ULOA 5LBEA 4XMIA 5J1XA 4NWWA 1AYM1 2EVXA 2XJUA 4Y20B 4E2GA 2FHRA 2RDQA 4IV3C 1S55A 5DAWA 3E6CC 2Q8OA 1QJFA 3FHAA 1W9FA 3NV1A 4XW3A 3D0SA 4CRQA 1VRH1 2EIEA 1OUXA 1AR82 3BTZA 2R7EB 3EJKA 4MYEA 4C8DA 1C8M1 3M3IA 3ABZA 4J6GA 3C8XA 3ES1A 3LDBA 2BFUL 2C0ZA 2BYVE 1YFYA 3AL6A 3E97A 3IBMA 4L97A 1EUUA 1JHJA 3RYKA 2RM21 4NO4A 4HETA 4WV8A 1NY72 2WNUA 2VW1A 5L9BA 4YG3A 3UKTA 1OVSA 3ST7A 4BQYA 1ACCA 3CDZB 5FPLA 3VBRC 5AC93 4QDRA 1YXWA 2EAKA 3TRSB 1VBB1 5HCAA 4L2NA 1H8TC 2GP3A 5DZEA 1H4HA 4Y4RA 1W9TA 3MF9A 4Z07A 5LEKA 4QQHA 1AL22 2ET1A 5FV3A 1FX5A 4RD7A 1ZBE1 1EV12 2UY9A 2WN2A 4KWJA 4AFAA 2RR13 3AKPA 2ZX0A 5LY1A 5FPAA 1BK1A 3BU0A 4MGYE 3TEWA 1DGWA 1CD3G 1YLLA 2CDPA 4C91A 3BPZA 2C9KA 3K51A 1OQEA 2Z42A 2GMEA 2O1QA 4S2DA 5A3WA 1W6QA 4JGZC 3AK0A 3D4KA 1W04A 4CPBA 4HSLA 1T6GC 1SACA 4HONA 2WO7A 5FZIA 4NIIA 2DV9A 3ZDSA 5FZ7A 2VVDA 2XUMA 4OULA 1PO12 4QPYA 5FPXA 3VZJA 4GH4B 1OLRA 3T4HB 4B29A 1JHNA 2ARAA 2HWB2 3K75B 2Z4FA 1MS3A 3LWCA 2ARBA 2GSYA 2W5FA 4XPVA 3WG1A 3WZ1A 3WW2A 2BWCA 4DINB 3PIGA 3U14A 2EALA 2YBKA 3ZYFA 2ZGQA 3I2DA 3POBA 3VBHB 3I3MA 2WO3A 3RYPA 3PUAA 4LBNA 2ARXA 1IQAA 3ORJA 3T1MA 2RDSA 2WNOA 2ZTNA 2F6BA 1MZFA 1ZZ8A 5ACA3 1LOEA 2D3PA 3ILFA 3AMPA 5A3OA 4AEDC 5CG8A 4LA3A 2YGMA 4ARYA 4EE2A 3FUQA 3TBDA 5T54A 5GLZA 1I3HA 2VNRA 1M4WA 2UY8A 2YFUA 1AHSA 4I0BA 2VZSA 4KU7A 4C0HA 2VW0A 3VBUA 2RG4A 2ZACA 2DVBA 2YC4A 4CEYA 2Q1FA 2X8KA 4DXTA 5BNNA 1MZ5A 5BPXA 2VUDA 4BWOA 5H9PA 4CCCA 1KGYA 1S0EA 2D7FA 3FE5A 1YO8A 4X8NA 3WQ0A 2QFEA 1GV9A 1WA6X 5C8CB 2VCAA 2VTFA 4O9EA 1Q8SA 3K4ZA 1O4TA 4WM8C 4XYXA 2JB8A 1NA1B 5FP3A 2JG9C 3BU7A 1BEV3 1ND3C 1SLAA 2HEYF 1AXKA 1X9TA 2LUWA 1R093 4FFHA 4QPGC 4Y20A 3VZOA 2VZUA 4GULA 1AL0G 3AXEA 5GLTA 5FY7A 2QQIA 1N3QA 2Y6HA 1AR63 4OHXA 4Y1YA 5FYHA 1W3XA 2VPVA 3T0BA 1MS4A 5FZGA 3CL1A 2A6YA 2DVAA 2J1AA 3UJOA 2IXIA 3VBSB 5E8AA 2YGLA 4JZRA 3SCFA 3HNBM 2AC1A 4JX0A 1Q43A 3LF7A 1C5IA 4XQ4A 3WCRA 2R0HA 5F32A 3THDA 4GQ7A 2EAAA 1C8NA 1YYNA 1QXPA 4Y22B 3UETA 3ZO0B 3FN9A 1ZREA 2OPKA 3A22A 3HMYA 1DG6A 1MEC2 1FPN3 2XMLA 3MIBA 1OF4A 1RUI2 3RWKX 4MVTA 1HB2A 4JVAA 4TTGA 5FZ9A 4TLGA 5APAA 4PF1A 1K5JA 2Q0AA 5A80A 5JAXA 3EB7A 3AVSA 4JGYA 5FQ0B 1W2UA 4XFHA 4FAGA 1MVQA 5C6CA 3ILRA 5F8PA 5CVRA 4TSVA 4CCNA 5JOXA 5FLJA 1GANA 2FZ1A 1LENA 2B42B 2EXIA 2A6VA 4QQLA 4BISA 5CU1A 2W1QA 1QQP2 1JZ7A 1WW6A 4XTPA 4C0BA 1PMJX 2G9GA 4CP9A 3T0AA 1Y9MA 2ZBJA 3ACGA 4D6RA 4LQRA 2OVUA 3FHQA 1SDWA 1TNRA 2O0OA 4A7KA 1N47A 1S4CA 4JKKA 3NV4A 2G4IA 2P1BA 2FMYA 1G9DA 4XC9A 4ZS2A 1YI7A 2ZX2A 3EO6A 4LTAA 4RS5A 4GH4A 3U11A 4AF9A 3WF3A 2ZJCA 2Z79A 3O0VA 1QGLA 1REFA 3HEIA 4RYDA 2GNMA 3GXUA 1XNCA 1OOPC 3DUIA 1SHWB 3SCHA 4BYYA 5F37A 5KC6A 1PZ8A 1ZYBA 3P5BA 4AFCA 1RVF3 2XUEA 2NZ9A 5F6LB 5BV6A 5KHGA 4AGGA 3VBHA 3P6BA 3VBOC 2UWBA 1CX1A 3SNMA 3D3AA 1PGL2 2E31A 1MQTC 5C3RA 4IEOA 2ZGSA 2D6KA 4QXKA 5FTTC 3TYJA 1SBFA 4AAXA 4PBPA 3Q9OA 1W0OA 5K7PA 1GNHA 1NXMA 1BLZA 2JDMA 4D94A 4KMQA 3DXTA 1SFPA 2WABA 3I3DA 3K3OA 4GZ9A 4HXCA 2QJVA 3WDWA 3H3UA 3BVCA 3SEEA 5T5OA 4LLOA 4DO0A 3T0DA 1EYBA 2A70A 3AB0A 2KM2A 4AEMA 4QD2A 1RTVA 5JXIA 4IGQA 1YNAA 2D43A 5A6ZA 4AAPA 3OEAA 4I01A 5C8CA 2GALA 1I1EA 1TMF1 2YDEA 1CN1A 3I59A 2E33A 1O7FA 5FZLA 2LTNA 3O5SA 2WWUA 4NAMA 1NLQA 2D44A 2F4PA 3BKZA 3ZXAC 4ASMB 4P9JA 4XJ8A 2XBO1 4NPLA 4AQSA 3F95A 3KS7A 1RHI2 3EXUA 4P00B 1GICA 4K1ZA 2WUHA 3WNPA 1UN1A 5ANQA 3J7MA 4HLTA 4K20A 2QDNA 5FRAA 5CB7A 4QKNA 3MZHA 4PI0A 3RNSA 5C9AC 5F5IA 1FI2A 3H8UA 1UZ0A 3FBYA 1COV1 4NMIA 4QMAA 3B5LB 1ZA4A 1GZWB 3VV1A 1GKBA 2BWAA 2RV9A 3O1SA 2WA4A 3ZXDA 2H6CA 1PMIA 3WUCA 3LGRA 1WWYA 2OYZA 1HV1A 1UOGA 3MICA 4J1WA 4K8RB 1GZTA 1GNZA 2ZHLA 3SISA 1ONAA 4OMCA 2ZGNA 2H0VA 4JDNA 3KV4A 3FUOA 2E53A 5FQ0A 5AC92 5L9RA 1ST8A 3KGLA 1SDDB 1H2NA 1TQ5A 2PHFA 4UYBA 1AX2A 3VHRA 1UU5A 4DUWA 2W68A 2ZMKA 4BDVB 3KCYA 5IHRA 3O1RA 2ZKNA 3O1VA 2CGPA 2JE8A 3MPBA 2RR12 4QHBA 1JN2P 3N35A 4MV2A 3VHPA 1HIXA 4QPIA 4CDQA 3ZR5A 4XF4A 1AXYA 4M0NA 2C1FA 2X53S 4PIYA 1LGCA 5FAXA 5FMBA 4CUAA 5FZ8A 3POFA 4KGGA 4D3WA 2XVKA 1VMHA 1QY4A 2RJLA 2XJSA 1RUH1 3DEMA 1IOAA 3PLQA 4UW4A 5F5CA 1ZRDA 5FP4A 3PU3A 4YVSB 3I4IA 2J22A 4QDSA 2A7AA 3VL9A 3RZHA 1NY71 1W6OA 4LEJA 5LZ6A 1WCKA 5FKCA 1RC6A 2W95A 4RGKA 3BALA 1B35C 1LNSA 1W28A 2G19A 2RS13 1GP5A 3H7JA 1MS1A 4N43B 4DXSA 1JYXA 3CJIB 1BBT1 4PQQA 3JBG1 3NRUA 4EN6B 1ZZ6A 4LUMA 1DU3D 4LORA 1W03A 2HBUA 1J59A 4BIFA 2XLGA 4W8JA 1PGW1 1OPMA 2JENA 1PNFA 3P1IA 4NN0A 4GMP0 2NP0A 3THPA 4FQZA 1KS5A 3S7IA 1L7QA 4QWNA 1K12A 1RUG3 4I02A 4YSFA 1F4AA 1OKQA 2NLRA 1AR91 2VOKA 1JYTA 1LTEA 2VMFA 2HBTA 3M7AA 3UK9A 5ACA2 1Y3TA 5LBBA 3LEGA 1YI9A 3RZZA 3WNMA 1QH7A 2PN5A 2YXSA 2WN3A 1IS6A 2VZTA 4DS0A 4A3ZA 4DNYA 3K48A 2IVJA 5GM0A 1PO11 1W0PA 5IT6A 4XFIA 4L99A 4XAAA 4YZ4A 3NWKA 4LBKA 4RN5A 4IEQA 1KDKA 5EHDA 4LMFA 3KMHA 1QJU2 4WVZA 3VDCA 3VHNA 3VKNA 2RS52 2ERFA 2OUJA 4EJRA 1LGNA 4WVVA 5IVCA 1W6MB 1BEV2 1CZVA 3DV8A 3TNPB 4NPMA 4JQTA 3I3BA 1Q3EA 1ZZCA 3W9AA 4EN8B 1R092 5KR7A 3WW3A 3V0BB 5LY2A 1TMF3 3NAPA 1CR7A 2JICA 3O0XA 2PQQA 2PHDA 1IGOA 4JTNA 4D6SA 4GWNA 1AUYA 4CUCA 1AR62 2WJSA 2YPDA 3HT1A 4OHZA 1QHDA 5A3NA 5FMOS 4QHZA 5L73A 5T55A 2JX9A 2VOTA 1Z78A 3AKSA 2R30A 3THTA 1F15A 1O59A 1RUF1 2MEV1 1W8ZA 1LESA 3IWZA 1RL3A 4EYUA 1CWPA 1W8HA 3SMHA 1A8MA 4HG6B 4NHMA 3R6SA 3CLPA 3I2HA 4UOJA 1HXS3 4AFDA 3H7YA 3WVJA 5I91A 4YGCA 2WFF2 1FPN2 3N7JA 4HN0A 5FOBB 4DY5A 1QIQA 3ATGA 4NJ4A 4UW5A 1UW8A 2ZHNA 5AFEA 2B45X 2VECA 1EP0A 2CSGA 3WDYA 4KBBA 5IVBA 4Q0QA 3WY6A 2A75A 1V6KA 4BXFA 3O1TA 1NLSA 4SLIA 4PLOA 3T2TA 3KB5A 4DRVA 2AREA 4UFMA 5I0SA 1KFXL 4FPFA 5FZ6A 2Y6LA 3J8F3 4XF3A 3I2IA 3THCA 1Q8VA 3T09A 3PVOA 3M1HA 1FAYA 3B01A 4QPWA 4EN7B 1W9WA 3OD0A 1MACA 1PIV3 4LPLA 3CU7A 3CIHA 1CAXB 2WNUC 3GYDA 2WQ4A 1S0IA 5E88A 1LHUA 4LK6A 5FZBA 1APNA 2GNBA 3MO4A 2OKXA 1V6LA 1RUD1 3ZMOA 1IG0A 1D4M3 3MLJA 2HKXA 3O1MA 4O9GA 4GMP3 4CCEA 1NUKA 5IFPA 4J1XA 2ZGRA 4FFIA 5JZGA 1AYN1 1A8DA 2XOMA 4MLOA 1XE0A 1RVF2 3KF5A 3A0NA 5FOJB 2ZA9A 4LXLA 1WKYA 2J42A 2WS93 4AEJA 3VUOA 1NCQA 3LIGA 1S2BA 4F7ZA 1GBGA 4YVWA 3WEZA 1FOD3 2XVGA 4M3CB 4OLLA 4QKDA 3ZOIA 4A41A 2Q8CA 2G9ZA 5FJKA 5FY5A 4B1LA 3J4UH 3NL1A 4IE0A 4WZFA 1V9U3 2P2KA 1CAWA 4N9IA 5JXHA 1HJFA 4FXGB 2YPJA 1OLQA 3BTXA 1OD5A 2R072 1KD7A 4XETA 3UKNA 4KNCA 2BGCA 3WP6A 5LA0A 3LPGA 1UF2C 4ORFA 4X6RB 3T2QA 2B46X 3T30A 4CDXB 2Y26A 3QACA 4HZFA 5C7GA 5IW0A 1G8WA 5KXCA 1AXZA 1KQRA 4JDOA 3OPTA 3PVEA 5FLIA 5DUWA 5A1FA 1L3JA 2ZX4A 5LK5A 5FDBA 3H3ZA 3MUZ1 4Q4X3 4PF5A 4I0WB 3KCCA 3OJBA 2XJRA 1HDKA 4GB31 5EYYA 1OF3A 5G05L 1BMV2 2Y33A 5DDJ3 3CMGA 2GZWA 4HFSA 3N4MA 5F3EA 4FQ4A 5IFTA 1S2KA 1VAVA 2PYTA 2VAUA 4LIVA 2BFUS 3S30A 3VBUC 4ZZ5A 5CNAA 5EP9A 3WDVA 4BE3A 1A34A 4GJZA 4CEYC 5BNNC 5BY5A 3NVCA 3DKQA 1IS3A 2VZRA 3RJRA 3PJQA 3LOIA 1OD3A 1DYOA 3SC7X 2SLIA 4DZGA 2ZHMA 2FQPA 3WF1A 5A3LA 4ES8A 2RDRA 3WP5A 1CGPA 1G6NA 1H2KA 1V0AA 1X7NA 2JDZA 4KI5M 1FMD3 5F2SA 1JOBA 1QJX3 2PAKA 3HNYM 2OZJA 3AYCA 2MPFA 3W20A 4QGLA 4LO5B 3VDDB 1LCLA 2PAMA 3VDAA 1OQDA 2BOJA 5GZFA 1RUF3 2VULA 3SITA 3BODA 4COYA 1CIWA 2VZPA 1TME3 4LBJA 4YWAA 2BW8A 3WG4A 4FOVA 5K0UB 3KT7A 2HWC2 4A6OA 2D6LX 2Z2SB 1UYZA 4XDPA 4OUEA 3MGUA 3CNAA 2TBVA 2Q5TA 2A73B 1SLIA 2CDOA 3ACIA 3IMNA 4LBLA 3ILNA 4XF0A 4Q4W1 1H2MA 4XURA 1H6XA 4TN7A 1G86A 5FMOL 3ZYRA 4QGMA 5HPOA 2V5DA 1F31A 1GU3A 2JDHA 3GF6A 3P3PA 4K8FA 4WBBA 2XWJB 3RDIA 4Z1VA 2RS33 1UZVA 1H30A 1K5MB 2R32A 1JYWA 2VZVA 4GALA 2TEPA 4IEVA 4NR1A 5C4WA 1CAUA 2WYFA 4H7MA 3WNKA 3N9NA 4CEWB 2OA2A 2R062 3KT4A 3L2HA 5FMDA 5LATA 3ZYIB 1QJY1 2XGXA 4PIXA 4XHXA 5B2GB 5CA6A 1X50A 1C1LA 3AZZA 4JGYC 2YUEA 4RGGA 4TXWA 1ZBA1 2RS12 4Q1RA 4MH0E 5EYXA 4ZY9A 4B1MA 2QQUA 4PIZA 2VM9A 4LHNA 3ZIXA 1MVEA 2Y64A 2VC9A 4Z82A 1GQGA 1LHVA 1V6IA 4C1WA 1VBA3 4Y1XA 2AH2A 1RMU2 1ENSA 2I45A 2FDJA 4IE7A 2A1XA 3MIDA 5D8AB 4JCKA 3WSOA 4FSJA 1TNFA 1GYKA 2JDNA 1SEFA 2QUOA 3MIHA 3IAQA 4W50A 5BNPC 1EAH3 3HBZA 1RUG2 2ZEWA 2GNDA 3CZJA 5GKAC 4RS5C 3TEXA 4GH4C 1VB2A 1IZ3A 3VB9A 3E1F1 3PUSA 1IQDC 4V1PA 3GJBA 4FPYA 4N7IA 3U10A 1JYVA 1UMZA 1W8UA 5DAQA 3TN91 1HRV3 2PHLA 2D6OX 5DUUA 4YZ3A 1YUDA 1QJZA 4YGEA 3Q8EA 4AZZA 2RMU2 1DZTA 2VMHA 4QX5A 3C3VA 5CZKA 4R8HA 4X6QB 1GP6A 5FZCA 4D8MA 3VBHC 3M3OA 4XUNA 4FOQA 1Q8QA 4S2HA 1YFXA 2WNEA 4R4ZA 4G3YC 2OX0A 4XQWA 4ZZ8A 1UCXA 4N53A 2R0FA 1QOOA 2W0XA 3RFRA 1UIKA 3RZJA 1VBD1 1PVXA 1BK0A 1J1LA 1DGWX 1SBDA 4K3UA 2A3YA 3RZGA 4BZ4A 3OGVA 1B09A 4PT6A 2IXCA 2FDKA 2GN3A 3O7OA 1BZWA 1JZ3A 2WYSA 3ACFA 4QM9A 3AP5A 5FZMA 4HK9A 4BLIA 1NAEA 1S1AA 1ZNPA 2QQJA 2ZEYA 2JECA 3E5QA 3RRDA 1R1A1 4CU6A 3I2FA 3I2KA 4UF0A 4CP0A 3OUJA 2JKBA 1Q5OA 3GZAA 3WX5A 3ZYJB 4QXBA 3ZFEB 1TG7A 3N7LA 5JCTA 4CA9A 4QKBA 4CE8A 2QNKA 1HXS2 2J1EA 2KD7A 2VMDA 3CF6E 3BN6A 1GQPA 4OUSA 1F5JA 2D97A 2E6VA 3JQXA 2VCCA 3USSA 4YM3A 2GC1A 3V0AB 2DCJA 1QDOA 1R081 4OMDA 3ZN6B 1U5IA 3NNLA 5AFBA 1GR3A 2WLQA 2JG8A 3RVHA 2CAVA 4RHV3 3IDAA 1UL9A 4EWAA 3ES4A 1RUNA 2FDGA 3VBFB 3J8F2 2UURA 5M0TA 3T3YA 2B9UA 4IESA 4AI2A 1OFSA 1IS5A 2QCSB 2QE3A 4E2SA 5I8YA 1CJPA 2HWE1 3HQRA 1K5MA 1WBLA 2HWF3 1PIV2 3BCWA 4N7UA 2XKOA 1PVC1 4YFWA 4CEWA 1EY2A 3NO8A 3OGGA 4QXHA 1RJ7A 3FLRA 3VKLA 1BVVA 1K45A 2C4XA 3ZPOA 4AVAA 4IDZA 2XXZA 1JYIA 4XFFA 4YM0A 2OQ7A 1WW7A 4UW3A 3ZFFA 3N7KA 1ODNA 3D6EA 2H6BA 4F3JA 2XJVA 1D4M2 1SQ4A 5FP8A 3IIIA 1ZZ9A 1NLRA 2GN7A 3AM2A 3AVRA 1FV2A 2WZR2 2QZ3A 5KHKA 1VJ2A 3GHNA 3UKVA 5H9QA 1V6NA 4IERA 3VD7A 1XE7A 3ZFGA 2CL2A 4JV4A 3ZXLA 3WNXA 2FD8A 4ZONA 2WS92 4HKWA 2PFWA 2P37A 4QPIC 4A45A 3INAA 4CDQC 4EWDA 4Q8LA 2VOVA 1Y4WA 1AR72 1FOD2 1ZBA3 2CNAA 2P4EA 4E27A 4AHZA 5JOZA 4CCMA 4RR3B 4BB3A 3VD9A 4P9XA 1DGRN 2HJIA 4GIQA 3ZXFA 3MFAA 4BM8A 4QM8A 2PLV3 1WLTA 2VCMA 2WZEA 1V9U2 3NQHA 4H7LA 3WD5A 3IM0A 2D6MA 1ASJ1 1W8NA 4QX7A 3JCIA 5L7OB 4CDUA 1S0GA 3OOXA 1W6PB 1LAJA 1PO23 1AJKA 1NCRC 5FZFA 1JODA 1SMVA 3ROUA 3WG2A 4AEKA 1XE8A 4I3PA 4KWLA 4XOGA 3WOGA 2LM3A 4IV1B 4MXWB 4XJUA 5KXDA 1REEA 4ZU7A 4IEPA 2AGSA 3K2OA 2XPJA 1I9RA 3KV5A 1E5SA 3DPRB 4RSUA 2OUHA 3MUY1 4EN9B 2VNGA 1UXZA 3BB6A 4RFRB 1H8VA 4IW3A 2I2SA 3TN93 2YU1A 1CJDA 1WMFA 4CSWA 1OQ1A 1RUE2 4Q4X2 1OLME 1LOCA 3SH5A 2J7MA 1SPPA 3WNLA 4AI1A 1RUC2 3QD6A 4I09A 5GZEA 1SCRA 2Y38A 1H2LA 1MS5A 2W3JA 5DDJ2 3O1PA 4Q4V1 3MFCA 1OFNA 5J09A 3G6JB 1S2EA 5I93A 2NMOA 2ZZJA 3VD5A 4CCOA 1CVNA 2ETEA 4QU1A 1XYPA 1VAKA 2X5IA 1VRBA 1O3RA 4A7YA 2D40A 5C3QA 3VD3A 3RZMA 3W5MA 1JOPA 3HD8B 5BUVA 4RQPA 1VPHA 4KH9A 5C3OA 3IPVB 1XB9A 4M3CE 2Q30A 1XU1A 5EWSA 1RUJ1 4Y1UA 4MHUA 5IUQA 2VBPA 1XNAA 2VE1A 1FMD2 3ZSLA 2WAOA 3S6PA 4IEUA 2XR4A 1QJX2 4Y26A 5FZ4A 3AKTA 3CJXA 1URXA 4ZXEA 3KSCA 3QH6A 3M3QA 1VBE1 5FREA 1ULDA 4FPGA 1PX4A 3NAPC 2JDAA 3WF4A 4AVTA 4AR2A 3GZTB 1J58A 1Z7S2 5FBJA 1LKNA 4HPKB 1WBFA 4Q4Y2 5JSRA 3AZVA 3VBFA 1CPMA 4AI0A 3ACLA 3S7EA 4PBOA 2V09A 3FFZA 4P9YA 5A33B 1AF9A 1X33A 3GJAA 5G04L 5EZWA 1R083 3C7FA 5T3NA 3E5UA 4FPHA 3KVAA 4XEZA 1IPKA 2G1MA 4XMAA 2Q8EA 1YCIA 2WWJA 5FY1A 4YPJA 1AYM3 4WVMB 4YZ2A 3V56A 4CDWB 3WQ1A 5FZOB 3ZXGA 4K7JA 4TYSA 2RS32 5F3IA 1ZRIA 2ZGUA 1SBEA 3OGRA 3C7OA 3ZN5A 4DUXA 1VRH3 4YYOA 1MZ6A 2W08A 4OI1A 5KC5A 2E7TA 1V6MA 4GXLA 3DGTA 1C8M3 1XNBA 4HL0A 5FZ3A 3B9CA 4YLZA 4H3WA 1PM7A 3ZM8A 5C33A 3J9SA 4IV3B 3POGA 4HVOA 4DIQA 1W06A 2RM23 3FLTA 3AFGA 4M00A 3DYPA 1YC61 3IDEA 1MZEA 4XJAA 4AI9A 4DQAA 3FMGA 5FBZA 1PX3A 3M3CA 3UV9A 1F8VA 5CFDB 3MPPG 5CKNA 1BKZA 1VBA2 1Q56A 3PVBB 3UL2A 1JZ5A 3MLLA 4YW3A 1VBB3 2VTXJ 2ZKLA 1FT9A 3HQUA 5AVPA 4RR3A
chains in the Genus database with same CATH topology
1S4CA 1JOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4C A;  1JOP A; 
#chains in the Genus database with same CATH topology
 1DCS A;  1J3R A;  1UOB A;  2HWD 1;  1EAH 2;  3CBN A;  1D2Q A;  1OA3 A;  3MV0 1;  4LUL A;  1W05 A;  1ZBE 3;  4B7K A;  4QB2 A;  2GH2 A;  5H9R A;  3VBR B;  4NWV A;  4LKD A;  4EV0 A;  5C5T A;  2PTM A;  1JBC A;  2PA7 A;  1HLC A;  2WNV B;  1UX6 A;  5C8W A;  4NVP A;  5JI9 A;  2BPA 2;  2DTW A;  5F5A A;  3M4F A;  5HXM A;  3A4U A;  1HRV 2;  2GMP A;  2E63 A;  5JZG C;  4CU9 A;  1QXR A;  2QTW B;  1OBN A;  2ET7 A;  2QKD A;  4JC1 A;  4NOT A;  1WZX A;  2XQR A;  1FXZ A;  1HRI 2;  2ORX A;  3JD7 1;  4Q2F A;  5FPB A;  1UD1 A;  1NCQ C;  3GZU C;  4V2V A;  5FYC A;  3WP3 A;  4YVW C;  4CU8 A;  2OW4 A;  5J48 A;  5FO9 B;  3KV9 A;  1OUR A;  1D0G A;  1Y9G A;  2VUJ A;  4BU2 A;  3ELN A;  1GZ9 A;  3P3N A;  4AVC A;  2O8Q A;  1C4R A;  5HV4 A;  2Y6J A;  4YZ1 A;  1W2A X;  3OTF A;  4QAW A;  2P34 A;  4LO8 A;  1H6Y A;  1BXH A;  1U5Z A;  1X9P A;  2EA7 A;  4UFK A;  1HX6 A;  2AR6 A;  1NQJ A;  3ITQ A;  1KRI A;  4XDO A;  4LBQ D;  3IPV A;  1GUI A;  2ES3 A;  3FC0 A;  3FX3 A;  2RMU 1;  3M3E A;  2DUP A;  1NA1 A;  5E16 A;  3POY A;  5EQU A;  5FFO C;  2W1S A;  2FZ2 A;  3VD4 A;  5DAB A;  2IC1 A;  2VZ3 A;  2R04 1;  1A3K A;  4O65 A;  4XFG A;  3D8C A;  2NQY A;  4B7E A;  2X09 A;  5D1I A;  2QVS B;  4YGB A;  2W92 A;  3GGL A;  1HQW A;  2W2I A;  1US3 A;  5FXZ A;  4W4Z A;  5K8S A;  2BNN A;  1UOJ A;  3MHZ A;  4A44 A;  1LRH A;  1VBC 1;  5CAD A;  3UNP A;  4MG2 A;  3VBS A;  5ANN A;  3JZV A;  1XSR A;  3KGZ A;  2D3S A;  1L7R A;  5C3S A;  2J1T A;  4JAA A;  4IUG A;  2YZ4 A;  1XRU A;  1TE1 B;  4RHV 2;  5FUN A;  3WNO A;  3ALQ A;  1MR5 A;  2UWA A;  2XL7 A;  5A7Q A;  4E8C A;  2Y60 A;  3ZXK A;  5I8T A;  4Y22 A;  3UGH A;  2WFP A;  4FTS A;  4HSJ A;  4M3C F;  4XXA A;  2WT0 A;  2VUA A;  3WHU A;  1SLB A;  4XXP A;  2VVE A;  2XON A;  2ZML A;  4WM8 B;  2HWF 2;  1W2T A;  5FYV A;  3ZN4 A;  4LHL A;  1ND3 B;  4AVB A;  3FLP A;  2JD4 A;  2BU9 A;  1HB3 A;  1V00 A;  3B02 A;  4ASL A;  2JJ6 A;  3FWE A;  3E5X A;  3N9M A;  1O8S A;  4IV3 A;  3PUQ A;  4JKM A;  1KFU L;  2PQS A;  5CBL A;  4AE2 A;  4ET7 A;  4P9W A;  3OG2 A;  5DMY A;  1UWW A;  4Y33 A;  3IAP A;  2FCV A;  2BP6 A;  2BEO A;  1UOF A;  4B3N A;  3MW2 A;  5F2W A;  4HVR A;  3LIH A;  4GAZ A;  5FIX A;  3V64 A;  5JMO A;  4CZS A;  4H14 A;  1T2X A;  2W39 A;  1WD4 A;  3KQ4 B;  3DL3 A;  1AR8 1;  1YJL A;  1O3S A;  1BYH A;  3FL7 A;  3VBR A;  3K4D A;  5IAT A;  4UWD A;  3KV6 A;  2VMC A;  4OI4 A;  2EXH A;  2WSU A;  3USU B;  5C4W C;  1GOG A;  2WNV A;  2ID4 A;  3GBF A;  5HBA A;  1GWK A;  3PVN A;  1H1M A;  2PLV 2;  2AEY A;  2A6Z A;  1FNY A;  1V6J A;  3POI A;  3ACH A;  4KWK A;  1BHG A;  3TOJ A;  3W58 A;  4YAR A;  1CZS A;  3AYA A;  4FTE A;  1J83 A;  1PO2 2;  2YRO A;  4XF1 A;  4KL1 A;  2IXH A;  4G4F A;  3GBW A;  4PHZ A;  1ZVF A;  1QMJ A;  4E4H A;  4Y5S A;  1AL2 1;  3JU9 A;  3T08 A;  2BZD A;  1YQ2 A;  1HN1 A;  4Q29 A;  1QOS A;  5ERL A;  1EV1 1;  1JS9 A;  1T6B X;  2A6W A;  2AAC A;  4O61 A;  4UI9 L;  5FP7 A;  2CHH A;  4UT5 A;  2LAL A;  2ZGL A;  2DFB A;  3ZX7 A;  2P3Y A;  5FPU A;  3RQ0 A;  1LOA A;  4R52 A;  1AR7 1;  2ORZ A;  5GZG A;  1S0C A;  2WKK A;  4HKO A;  2WII B;  3BOW A;  3OYW B;  4ISQ A;  2XHN A;  2R1B A;  4HOO A;  5E6H A;  4LBQ B;  5LAS A;  3N7M A;  1KEX A;  4XE9 A;  5DQ0 A;  4P9G A;  5F7U A;  1LOD A;  4OVE A;  3NJZ A;  1Y9Q A;  3FFQ A;  2DCT A;  2HWB 1;  4TZD A;  4FPC A;  1I6X A;  2ZOE B;  3MW3 A;  4Q27 A;  2ZAB A;  3H1Y A;  3OGS A;  1C3H A;  1UIJ A;  2EIB A;  2WO2 A;  3HNM A;  3NKT A;  2DVD A;  3LZZ A;  4N53 C;  3BIE A;  1SZB A;  3NNM A;  1WMX A;  4MGI E;  4IE5 A;  1LHN A;  4XAC A;  1WUV A;  2DCZ A;  2HH9 A;  1QNW A;  4NAO A;  3L2Y A;  4COW A;  4R9C A;  5I0D A;  1POV 1;  1WCU A;  2VNV A;  4BQ1 A;  2ZS6 B;  3ZYH A;  5FZH A;  3SCG A;  5IVE A;  3WW4 A;  1GLH A;  1HB4 A;  1GZW A;  4P5H A;  1WD3 A;  2R16 A;  2R04 3;  5FYB A;  1DLC A;  1AVB A;  1NZC A;  4XJ9 A;  2XBO 3;  4A3X A;  2QQK A;  3AXD A;  3R4U A;  1NXD 1;  5FZA A;  1GMM A;  3MLK A;  3RPQ A;  4FVV A;  2EIC A;  1CAV B;  3K77 A;  5IJR A;  2CY6 A;  3ETQ A;  4C90 A;  2VVF A;  4AHY A;  1DP0 A;  1ND3 A;  3T2O A;  1AYM 2;  3DN7 A;  4YGD A;  5BYN A;  2GMM A;  2PXJ A;  4IEZ A;  3ENR A;  2D98 A;  4XTM A;  1COV 3;  1GFF 2;  4KQ7 A;  4HKL A;  4CXX A;  1VRH 2;  2UYA A;  3IT8 A;  4NRQ A;  3IDB B;  4UBG A;  3WW1 A;  1OA2 A;  1C8M 2;  4XZP A;  5A7W B;  1W3V A;  4UXA A;  3AP6 A;  3HVD A;  5C9A B;  3OGJ A;  2W1W A;  3UES A;  1E57 A;  2JG8 C;  1UY2 A;  2RM2 2;  4W6X A;  3ZLI A;  2E26 A;  3HN3 A;  3PUI A;  5A7O A;  3U1X A;  2ZGM A;  2BBA A;  4WM7 B;  5GLV A;  3WR0 A;  5JOW A;  2NM1 A;  2VQA A;  4XAB A;  1RB8 G;  3I2G A;  5D2A A;  4K9S A;  4LJH A;  3T2P A;  4AQ6 A;  4DXR A;  2K46 A;  4R4X A;  1VBB 2;  4S2G A;  4TWT A;  1UKR A;  1WW4 A;  3HR9 A;  3ZIW A;  1K5M C;  3RJ2 X;  4YFZ A;  3S0M A;  4ZKT B;  3USU A;  2GNT A;  4YVS A;  4AQ2 A;  3PL0 A;  4CEW C;  2ZPX A;  5CFD A;  3VLB B;  5GLW A;  2WA3 A;  4HAN A;  5JPM B;  3UYJ A;  1ALY A;  1MEC 1;  4N43 A;  4Y24 A;  5F6K A;  3CJI A;  1RUI 1;  3ZFF C;  1UMH A;  1XYN A;  4CUB A;  2VTX A;  3H50 A;  3WDT A;  4D69 A;  2GP5 A;  1C5H A;  1JOJ A;  1H4G A;  1W6N B;  4DXZ A;  1RUH 3;  1GNY A;  3KT1 A;  5C70 A;  2VG9 A;  4HMZ A;  4BH9 A;  5FWJ A;  3ZFG C;  4OQ8 A;  4N90 A;  2YY1 A;  1SLC A;  3NJY A;  5HI0 A;  2VMI A;  2W46 A;  1DBN A;  1JUI A;  1OKO A;  3SH4 A;  4CUG A;  1KDM A;  5BNQ A;  4NIH A;  4CP2 A;  1QQP 1;  1XJA A;  2VU9 A;  3HPN A;  5LA2 A;  1BVP 1;  1BBT 3;  2YBS A;  3JBG 3;  4FO9 A;  3OYW A;  4D7T A;  3E6D A;  5EV7 A;  2VOX A;  5IK5 A;  3AZW A;  5JPN B;  4FTB A;  1AL2 3;  2K2S A;  2FCU A;  4OUM A;  3AP9 A;  3WUD A;  4CDU C;  3L9J T;  2B7Y A;  2G9F A;  2XJT A;  3BTA A;  1QH6 A;  2WT1 A;  2XLA A;  3CKH A;  1H1A A;  2QQL A;  3QCW A;  2JXA A;  5FYS A;  1AR9 3;  2HYX A;  4ATF A;  5JSO A;  4P02 B;  2RHP A;  4NIA A;  5F3C A;  1DF0 A;  5DUV A;  4B4Q A;  2RDN A;  3KWV A;  4PI2 A;  4EZH A;  1Q8P A;  3OPZ A;  1OHF A;  3PJY A;  1HRI 1;  4HVQ A;  4ISR A;  1W6M A;  1CPN A;  3V0B A;  1O3T A;  1PO1 3;  4AK3 A;  3TEY A;  5F9T A;  1UYY A;  1PGL 1;  4XJZ A;  3OPW A;  2QQP A;  3DKW A;  3UJQ A;  2IWG B;  2HWB 3;  4LKE A;  5ISL A;  2PAE A;  1SFY A;  3AFK A;  1DZQ A;  1UY1 A;  2PMW B;  4Q1P A;  3PUR A;  4U36 A;  1LGB A;  4K40 A;  4PLN A;  3TNQ A;  5FY8 A;  5FK8 A;  2GAU A;  2ZMN A;  4A42 A;  1U12 A;  5CKQ A;  4Y1V A;  3CZU A;  1JZ8 A;  1NE4 A;  1L7L A;  2X5I C;  2FDF A;  2ZEZ A;  5D21 A;  2HEW F;  4NHY A;  1ENX A;  2E7A A;  3EMR A;  4RQP C;  3KQR A;  2QQW A;  3D0J A;  1DFQ A;  3MIE A;  5KHJ A;  4Y1Z A;  4CCD A;  1PMH X;  1VIW B;  3DYO A;  3DYM A;  4H55 A;  3RYR A;  2R1D A;  3BI3 A;  2VZQ A;  2ZAA A;  5JR2 A;  2MEV 3;  5LCW L;  1EUT A;  1XNK A;  2AEZ A;  2YC2 A;  3I2O A;  5T50 A;  1JUH A;  1UZZ A;  2AUY A;  2ATF A;  2IFW A;  1RHI 1;  3D82 A;  3I3E A;  1NKG A;  4WM7 A;  5FYU A;  3ZSK A;  5DPN A;  1ZM1 A;  4L8Q A;  5I0T A;  3ZSM A;  3S5A A;  4FFF A;  1KJR A;  2HYK A;  2ARC A;  3H1W A;  2VR4 A;  1S0J A;  2WIN B;  4LUK A;  4NRO A;  1SLT A;  4FBF A;  2GU9 A;  1GWM A;  1VLN A;  2XWB B;  3HN1 A;  1CAX A;  1YHF A;  1JMU B;  4G9S B;  5CFC B;  5ABJ B;  2DFC A;  4OHV A;  1R64 A;  2L9L A;  1D0H A;  4FP2 A;  3SQO A;  4XQD A;  1ENQ A;  3C7E A;  3GDB A;  4UW6 A;  4XIL A;  5F5Q A;  4P9L A;  3SH3 A;  2IZW A;  4NHX A;  1G9F A;  2K0G A;  1LU1 A;  4YZ5 A;  3ZPY A;  1I5P A;  4AHW A;  1A6C A;  1TEI A;  4FFG A;  5J96 B;  3HQX A;  5A6X A;  4CCL A;  4EN0 A;  3M8L A;  3I8T A;  3RGB A;  1LUL A;  2BGO A;  2GDF A;  5AC9 1;  5LRR A;  5IYY A;  3EQE A;  2XDV A;  2ZGK A;  4M4P A;  3CHX A;  4XDQ A;  5I0U A;  3PHM A;  4M3C A;  1TVG A;  3ETP A;  5A3M A;  1LED A;  1RUD 3;  1W8T A;  4IGO A;  4KU8 A;  4BIO A;  5IVV A;  1KXG A;  4OYU A;  3V65 A;  4RR3 C;  2RR1 1;  2JDP A;  3GM8 A;  1W90 A;  5I0R A;  1WA4 A;  2JIJ A;  3N9Q A;  2D5F A;  3NJV A;  3WQ7 A;  2TNF A;  1AYN 3;  2EXJ A;  2XG3 A;  1X36 A;  2NYY A;  3I97 A;  2P17 A;  2A6X A;  4LE4 A;  3AZX A;  2WQ8 A;  3RWN A;  3H9A A;  5KXE A;  3LEK A;  4PDW B;  4KWU A;  4ZHN A;  2C26 A;  1XYO A;  4L9B A;  2I07 B;  4CDX A;  1WMD A;  5A6Q A;  4W65 A;  3A0K A;  4P14 A;  1U5X A;  4E8D A;  3MYX A;  5BXX A;  5B4N A;  2C5D A;  3LFM A;  3FBM A;  1XXN A;  4IL7 A;  3AKR A;  1DZR A;  4YW1 A;  5J98 B;  4ZS3 A;  1PK6 B;  3FJS A;  4BK4 A;  2PHU A;  2YU2 A;  4ARX A;  1CIY A;  1W2O A;  3QH7 A;  2ZX3 A;  5IVY A;  4ZXK A;  4FPO B;  3ZSJ A;  4QDQ A;  3VN4 A;  3WF2 A;  4QHO A;  3BYW A;  2GC2 A;  1TMF 2;  5ACA 1;  2J1V A;  5EJZ B;  2GC0 A;  2E32 A;  4L92 A;  1ZRF A;  1XU2 A;  1QXJ A;  1W9Y A;  4QT6 A;  1ULC A;  3U4X A;  4COU A;  2IXJ A;  1V6O A;  4GB3 3;  4FOY A;  5LB6 A;  5C8C C;  3MDP A;  3T4V A;  5A7S A;  4F83 A;  2E7Q A;  1XC6 A;  1NA1 C;  1ULF A;  1YRZ A;  3VDD A;  5IK7 A;  3AMM A;  4FPE A;  1QJU 1;  5LA9 A;  4RL7 A;  1RXG A;  1UKG A;  2RS5 1;  1LOF A;  3LFI A;  4Q0S A;  4BMB A;  5BNO B;  5JOY A;  5K0U A;  2BGP A;  2VGD A;  1OT5 A;  2EF6 A;  3VBS C;  1BEV 1;  3AMQ A;  4LKF A;  2IUW A;  3VBU B;  1XBF A;  1JH5 A;  1R09 1;  5J37 A;  3HIF A;  5DAX A;  4COZ A;  5BNN B;  3MBW A;  2EXK A;  2VMG A;  3AJZ A;  3J7L A;  4KGQ A;  4CXW A;  5HV0 A;  1AR6 1;  4F8A A;  5CFC A;  5ABJ A;  2W47 A;  2X10 A;  3TEZ A;  4C1X A;  3OBR A;  2XLF A;  2JDK A;  3VL8 A;  2VQU A;  2YC0 A;  4V2W A;  4B4R A;  2QZ2 A;  1DDL A;  1RHI 3;  1YWK A;  2DTY A;  4A4A A;  2A71 A;  4JKL A;  4MGQ A;  3AC0 A;  3C7H A;  3F2Z A;  3AP4 A;  4XIK A;  3PDQ A;  1NZI A;  2BQP A;  2B39 A;  1QF3 A;  4LO7 A;  3AMN A;  3U0Z A;  2V4V A;  2P3I A;  1YQ8 A;  2WFF 1;  1FPN 1;  1ND2 B;  2B9V A;  4Q4W 3;  4BQW A;  5CEH A;  4M01 A;  3QBQ A;  3SLI A;  4Y3O A;  3CQO A;  2E51 A;  1RUH 2;  3OEB A;  3R4S A;  4DEV A;  5D8A A;  3I7D A;  1OH4 A;  1G9B A;  1QJY 3;  3LDR A;  1W99 A;  4PCR A;  2QQN A;  4ONU A;  1UY4 A;  1XNT A;  4RFT 0;  4YW2 A;  1PHM A;  3IDC B;  3J7N A;  3O12 A;  1WCD J;  3LDK A;  1BBT 2;  1DGL A;  1KJL A;  3JBG 2;  4XFA A;  5HCF A;  4DUV A;  2WNV C;  3ON7 A;  4EQV A;  4FPJ A;  5FUI A;  4E4D X;  4JQR A;  4PDW A;  4YW6 A;  2ZGP A;  3Q8A A;  4ASK A;  4LOS A;  2V5Y A;  4YM2 A;  3MF6 A;  4XUT A;  4JGY B;  4FAH A;  2ZXQ A;  1PGW 2;  1SCS A;  4E2Q A;  2E9Q A;  2W52 A;  1MS9 A;  1UYP A;  2XQX A;  2BER A;  2Q1M A;  2B8M A;  3B93 A;  5KHH A;  1QJE A;  2R6Q A;  1CON A;  4N9H A;  5DAP A;  1ULP A;  3LD8 A;  1NX9 A;  3M70 A;  3B3Q E;  5LW9 A;  1AR9 2;  3S5Q A;  1XPW A;  2D6P A;  1PK6 A;  1K3I A;  2PEL A;  4CP9 B;  4LT5 A;  1Q8O A;  1W2N A;  1UNB A;  2BUK A;  2CGO A;  2V73 A;  3BIW E;  1RVF 1;  5E1R A;  5T52 A;  4NID A;  5LBC A;  5BNP B;  5JR7 B;  3PTY A;  4QX2 A;  1QEX A;  4QB1 A;  3PUH A;  1RUO A;  3TAY A;  4J25 A;  4RS5 B;  5CAZ A;  3BPS A;  4LBO A;  1W8O A;  2ZGO A;  3WP4 A;  5A1A A;  3SHR A;  5LEJ A;  4URA A;  4TLF A;  1IPS A;  4Z2W A;  2OS2 A;  2PHT A;  3N9O A;  3ZR6 A;  1XND A;  3KF3 A;  3AYD A;  3O14 A;  1J1T A;  1JZ4 A;  3X29 B;  1JZ2 A;  4NRM A;  2R07 1;  1VBD 3;  3LCP A;  4BQ2 A;  1OPO A;  1OSG A;  3ZFE A;  4XBN A;  4ZPI A;  1HV0 A;  1UPS A;  1X82 A;  2JDU A;  3I54 A;  1C28 A;  4LBM A;  4DB5 A;  4XCA A;  1DQ4 A;  2BNM A;  2JE9 A;  3OUH A;  4DY3 A;  2WZ8 A;  5A32 B;  1GP4 A;  3V0A A;  2J1S A;  3NKG A;  5BNO A;  5GZC A;  3ZN6 A;  1R1A 3;  5A7N A;  5FO8 B;  1N1S A;  5FYT A;  5JI7 A;  4AYU A;  5C5U A;  3N3H A;  4L0P A;  1W39 A;  1RUF 2;  2MEV 2;  3MIG A;  4A2U A;  2IXL A;  4MHR A;  3GAL A;  5FMC A;  1TME 2;  4D7S A;  5F1R A;  2BDR A;  1RYY A;  1GZC A;  2ADE A;  4XVH A;  5JVV A;  1BMV 1;  2UYB A;  4ITC A;  4CXY A;  5FY9 A;  1QJU 3;  1Z0H A;  2DCK A;  1VAM A;  1ZX5 A;  3SKV A;  4WVW A;  5C3P A;  2HLE A;  3KLS A;  2RS5 3;  1LEM A;  5EPA A;  2VJX A;  3LE0 A;  4D0Q A;  3I59 B;  1UZY A;  3WDU A;  1UPI A;  3NV3 A;  3H3L A;  2EID A;  3K3N A;  5JIA A;  4D7Y A;  1D7P M;  4XUP A;  3LA7 A;  4MX3 A;  4A6S A;  3CEW A;  3APB A;  4XF9 A;  1UYX A;  4BPZ A;  1LB2 A;  1ND2 A;  1BJQ A;  1OUS A;  3WDX A;  4KG8 A;  4MO3 M;  5T5P A;  3URF A;  2HWE 3;  1DGR A;  2Y6G A;  2KXL A;  4LO6 B;  1J3Q A;  1SG3 A;  1PVC 3;  3R0R A;  4NE9 A;  5SV5 A;  4DMI A;  3RZK A;  1NT0 A;  4QB6 A;  3PME A;  5GLU A;  2WRA A;  3JUU A;  2HWC 1;  1DQ5 A;  1YJK A;  4XHB A;  4HT1 T;  1E5R A;  3IN9 A;  3I49 A;  2VH9 A;  1RUD 2;  3UT0 A;  2JD9 A;  1O4Y A;  2WFF 3;  3VZN A;  5FR3 A;  5JXJ A;  4YVS C;  1JYC A;  4AOC A;  4B4P A;  1OVP A;  4MGS A;  3PTR B;  2SBA A;  1LJ7 A;  3MIF A;  4Q26 A;  4AGV A;  2DUO A;  3ZYP A;  5CFD C;  5IAX A;  1AYN 2;  2O14 A;  1YEW A;  3KM5 A;  3S57 A;  2XB6 C;  2Q8D A;  5L7O A;  1W6P A;  2IVI B;  1H8T B;  5FZE A;  1F4H A;  5FCC A;  3H8R A;  4N43 C;  3CJI C;  1HB1 A;  3H0O A;  3IMM A;  1HQL A;  1UMI A;  3KCX A;  1ZA7 A;  1ZZ7 A;  4IV1 A;  2R06 1;  4MXW A;  3WNN A;  1DIW A;  4LNV A;  1UXX X;  3NJX A;  4XAE A;  2OII A;  3HOB A;  1VR3 A;  3A23 A;  3DPR A;  2RS1 1;  4BQ3 A;  2AZ5 A;  5BNP A;  4QPI B;  4CDQ B;  4BME A;  1ASJ 3;  3C2U A;  1RXF A;  2A5Z A;  2R49 A;  4SBV A;  2ENR A;  3IIA A;  5JIU A;  2JWP A;  4GWJ A;  2AYH A;  3FHI B;  2LRP A;  4XUO A;  1RMU 1;  5FY4 A;  4BCU A;  4IEX A;  2V72 A;  4FCA A;  4JGZ B;  4RA0 A;  5JWP A;  3JB8 A;  1BQP A;  2VBB A;  3AP7 A;  4ERO A;  2JB4 A;  4XFC A;  4GJY A;  4AVS A;  2J1U A;  1W6O B;  5CKM A;  1RUG 1;  3KHB A;  4XJW A;  3VKF C;  3OBZ A;  2DUR A;  4AHX A;  2VQT A;  1NCR B;  2RVA A;  3WLU A;  1UY0 A;  4QQO A;  2D3R A;  5KXB A;  5KWR A;  3VKM A;  5L19 A;  5FZ0 A;  2J1R A;  3PU8 A;  4MZU A;  4DEQ A;  1RIN A;  1EPZ A;  1ZRC A;  3MV1 1;  4GB3 2;  1UQX A;  4JHZ A;  2VO5 A;  1JW6 A;  2YBP A;  5A32 A;  5LA1 A;  4Q4V 3;  4R9B A;  2RJK A;  2XL9 A;  3RI8 A;  2ZGT A;  1IPJ A;  4LKS A;  4N8M A;  4OZX A;  4MSV A;  3WV6 A;  3RS6 A;  4AED B;  4IET A;  2R07 3;  5A3P A;  4Y5T A;  5F39 A;  3GCX A;  3PNA A;  3ZXJ A;  1RJ8 A;  2BTV C;  3N9P A;  4HPK A;  3HWJ A;  3POE A;  3U37 A;  3K4A A;  2PHX A;  1PM4 A;  3ZYB A;  2D6N A;  2KA3 A;  1G9A A;  3GZE A;  1J3P A;  1O3Q A;  1RUJ 3;  4UFH A;  1W8F A;  5C71 A;  1XQN A;  4QGN A;  1IKQ A;  2WT2 A;  5A33 A;  4OZO A;  1W8W A;  4LHK A;  1UO9 A;  1HKD A;  1K42 A;  5LWB A;  2WR9 A;  2ZHK A;  1JU4 A;  4XBQ A;  1VBE 3;  4WVM A;  2WLP A;  4CDW A;  1DYP A;  3OCP A;  5FZO A;  1HQN A;  1ULG A;  3AZY A;  2LW8 A;  4E9K A;  2AEN A;  2YHJ A;  1VE0 A;  2WO1 A;  3B7M A;  4Q0U A;  4BQ5 A;  3LA2 A;  4XFB A;  2Y0I A;  1SLL A;  1E5I A;  1IG3 A;  2JG9 B;  1ENR A;  2WC2 A;  1GSL A;  4JRA A;  3GCW A;  4QPG B;  4I30 A;  1O4Z A;  1WLC A;  5IAV A;  4MXV A;  3U78 A;  2VZO A;  1HXS 1;  3RMX A;  3NAP B;  2BOI A;  5A70 A;  2CU5 A;  5A3T A;  1U0A A;  3AKQ A;  3Q8F A;  4Q4W 2;  3ZKU A;  2NN8 A;  3DEC A;  3Q8C A;  1XSQ A;  2RJ2 A;  1YFW A;  4WM7 C;  4YW7 A;  4AG4 A;  1G7Y A;  4Z8B A;  3N36 A;  5FZ1 A;  1F5F A;  3OF1 A;  4FT8 A;  4PJY A;  5DAV A;  4AI8 A;  1QDC A;  2OT7 A;  2CAU A;  4YG0 A;  4I3G A;  1M06 G;  3AJY A;  1O6U A;  2UU8 A;  4NUB A;  1ZZB A;  5K9Y A;  1US2 A;  2XKP A;  1QJY 2;  5JLV A;  3EYP A;  4XCB A;  3WT3 A;  3J8F 1;  1UY3 A;  2XJP A;  1ZBA 2;  4FP3 A;  1X8M A;  5FYM A;  3BGA A;  5J7M A;  1H8T A;  4QQ2 A;  4I0A A;  1PIV 1;  2VXR A;  2W9X A;  2Z5W A;  3B69 A;  3LKJ A;  2F17 A;  1BCX A;  5DZG A;  2HWC 3;  4CVU A;  4Z2A A;  3OBA A;  1NYW A;  1JI6 A;  3ASI A;  5FXW A;  2Y0O A;  4MAD A;  5IVF A;  2O8O A;  5FXX A;  1DQ1 A;  2CTV A;  2JDY A;  3JQW A;  4UFL A;  3NMB A;  3KZ4 C;  4K21 A;  2HWD 3;  1FAT A;  2LRO A;  1WCQ A;  2D5H A;  3HBK A;  1DYK A;  1NG0 A;  5JSP A;  1HN0 A;  1D4M 1;  5EJ1 B;  4XUQ A;  4AVV A;  2YG0 A;  4GMP 1;  1NOV A;  2VW2 A;  5A1L A;  1H9W A;  1MS0 A;  2WZR 1;  3DCQ A;  2VL4 A;  2OQ6 A;  4OCT A;  4OHY A;  4JGZ A;  5DZF A;  1EPW A;  2P3K A;  1VMJ A;  1OC1 A;  3DF0 A;  3NV2 A;  2WL1 A;  2R06 3;  2JE7 A;  3VHO A;  3KHC A;  2WS9 1;  1N3P A;  3LPF A;  3TN9 2;  4QX1 A;  2CYF A;  3B00 A;  4FOW A;  4Q8K A;  3LEI A;  4OFG A;  4ZU5 A;  1FOD 1;  1O5L A;  5FKB A;  1NCR A;  2YB7 A;  5FLH A;  1F9K A;  1NE6 A;  3JD7 3;  2VUC A;  1OOP B;  4AFB A;  2QQO A;  4D6Q A;  4HBN A;  1JXN A;  1V9U 1;  3KVB A;  1PNG A;  3SXW A;  1RMU 3;  2Q1Z B;  2VNO A;  3AL5 A;  3OBT A;  5JZG B;  2FDH A;  4YW5 A;  4CDX C;  1LHW A;  5DG2 A;  5GZD A;  1HW5 A;  4S2F A;  3WCS A;  1NQD A;  4IND A;  3CO2 A;  2VZ1 A;  1VBD 2;  1JU3 A;  2VD7 A;  1ODM A;  4QX3 A;  4U2A A;  3OD4 A;  1J84 A;  1O91 A;  2ZEX A;  1NCQ B;  4LOT A;  4YW4 A;  3VBO B;  3Q8B A;  5DG1 A;  1TZO A;  4AQT A;  3BTY A;  1MQT B;  4YVW B;  4XBL A;  1DQ2 A;  1MS8 A;  1YFU A;  2MNG A;  2WWS A;  1DHK B;  3ZYG A;  4AED A;  2TUN A;  1UAI A;  1ULE A;  2IXK A;  2Y6F A;  2W1U A;  5L9V A;  5IWF A;  3WHT A;  1LEC A;  2P6C A;  4PLM A;  1QWR A;  4AXO A;  4YRD A;  4DRR A;  3HAG A;  4GD4 A;  1HJG A;  1CAW B;  1R1A 2;  2P3J A;  2Q4S A;  3DXU A;  4CCK A;  1CES A;  2VY0 A;  3W21 A;  1RUE 1;  4Y5Z 0;  4BJ0 A;  5LBF A;  3VZK A;  2CV6 A;  4Q4X 1;  2RMU 3;  4O7X A;  5EFU A;  5FZK A;  4AI3 A;  4BA6 A;  2DDU A;  1H9P A;  5JXG A;  1RUC 1;  4AW7 A;  5A7P A;  4IXL A;  3RG0 A;  4DPN A;  4W6Y A;  5DDJ 1;  3POW A;  2ZCW A;  1DLL A;  1FV3 A;  1S0D A;  4YG6 A;  1O5U A;  3ECQ A;  3MW4 A;  3O1O A;  2CWS A;  2ZX1 A;  2WZP P;  4WM8 A;  5FZD A;  2X05 A;  1R08 2;  3H1M A;  3G7D A;  1VBC 3;  1LR5 A;  2JG9 A;  4BQ4 A;  5A6Y A;  4P08 A;  4IE4 A;  3D5O A;  2V4A A;  3VDD C;  5GAL A;  5FPV A;  4QPG A;  5CIR A;  2A3W A;  5H9S A;  1E5H A;  4E4S A;  4YM1 A;  3OSD A;  5DN2 A;  5DXD A;  1IS4 A;  1LOF C;  1GOF A;  1QKQ A;  1FMD 1;  1OH3 A;  1POV 0;  5K0U C;  2XVL A;  4Q0P A;  5FY0 A;  1QJX 1;  1G9C A;  1WW5 A;  2DU1 A;  2P5B A;  2DCY A;  2CWM A;  2HWE 2;  4P5Y A;  3KD4 A;  1JTZ X;  3I2J A;  5IVJ A;  5K4L A;  2C24 A;  3U75 A;  1S0F A;  1PVC 2;  5JDB A;  1AZD A;  1QNY A;  1YIF A;  1TME 1;  1Z7S 1;  2FCT A;  2RE9 A;  2C6S A;  4Q4Y 1;  3RI9 A;  4A7Z A;  5ABJ C;  5CFC C;  4JRL A;  4OI0 A;  2YYO A;  4RGA A;  4X8P A;  5IK8 A;  3LOB A;  1WME A;  4QKF A;  5E89 A;  4CYD A;  3C7G A;  4LHS A;  1W9S A;  2GC3 A;  3H42 B;  1YIP A;  1LOG A;  4Q5O A;  4AWD A;  1ZBE 2;  2WDB A;  4FPK A;  5HCH A;  2RS3 1;  1WLW A;  2BV4 A;  3LA3 A;  2F4L A;  1FYU A;  4NPR A;  1AR8 3;  2W94 A;  5EJ3 A;  4ZU4 A;  5FK7 A;  1QOT A;  5JMC A;  2D93 A;  3WIN E;  4NHK A;  1CX4 A;  3LQC A;  1V70 A;  5L36 A;  1UU4 A;  1PGS A;  4JTO A;  5D8A C;  2OPW A;  2BBV A;  2I74 A;  4IE6 A;  3QLQ A;  5GJ6 A;  1PZ7 A;  1ASJ 2;  1AX1 A;  5HXV A;  3ZKY A;  4OHW A;  4ES9 A;  1OI6 A;  1VBA 1;  5I8S A;  1Y7B A;  1R1Z A;  4PQ9 A;  1WLD A;  3VKO A;  2VQ0 A;  5C4W B;  1JZ6 A;  2VOW A;  1CAU B;  4NIG A;  4L11 A;  1OOP A;  4Z92 B;  2DVF A;  4LBQ A;  4PDW C;  1EAH 1;  4K1Y A;  1B35 B;  2WZR 3;  4GA9 A;  1EV1 3;  2JKX A;  1LOB A;  3LAG A;  3OY8 B;  1IKP A;  2NMN A;  3JXS A;  2Y34 A;  3BOP A;  4LR4 A;  3VBO A;  2W91 A;  3W59 A;  3FZ3 A;  1YQ6 A;  4COV A;  4UFI A;  1MQT A;  1AR7 3;  4CU7 A;  1HRV 1;  1XOY A;  1H1I A;  1F35 A;  1KIT A;  2UWC A;  5FYZ A;  1PK6 C;  2ADD A;  2DWR A;  2ILM A;  4Q4V 2;  3LSE A;  4QU2 A;  2FBE A;  4LA2 A;  4KG0 A;  4JHT A;  2JIG A;  1QU0 A;  2PHR A;  3B9I A;  3JB4 C;  3HJR A;  2VME A;  5FYI A;  4R9D A;  4W6W A;  2BRT A;  4CPB D;  1UX7 A;  3IB3 A;  4XZU G;  2QQV A;  2WAA A;  1VP6 A;  2VXJ A;  4URT A;  4NHL A;  4GWI A;  5CYY A;  1RUJ 2;  2A3X A;  1STM A;  4AGR A;  3A21 A;  2JEM A;  2MHF A;  4Q0V A;  1CAV A;  2BNO A;  3WXP A;  3ZFE C;  5CG9 A;  1F2N A;  4BK5 A;  1MPX A;  4NRP A;  2QDR A;  1POV 3;  1RUE 3;  1VBE 2;  5EXO A;  1DQ0 A;  3AMH A;  5SV8 A;  3VZL A;  2DBN A;  2YV8 A;  1RUC 3;  4N53 B;  1SFN A;  5AVA A;  4IGP A;  5JUV A;  5BNO C;  1P8J A;  4LK7 A;  1C57 A;  5A7W A;  4BHP A;  4EZ4 A;  5KHI A;  3ZSE A;  1D4V B;  5C9A A;  1W0N A;  4FPL A;  3QOP A;  1GQH A;  1WCS A;  3VZM A;  3O1U A;  3GHM A;  4YNI A;  2QBX A;  5T5L A;  3SEP A;  1O8P A;  1VB4 A;  5FYY A;  1FNZ A;  3UGG A;  5FXV A;  3VBF C;  4FI9 A;  2PHW A;  5LK7 B;  4UF0 B;  5A3U A;  2C9A A;  3NNJ A;  4GKY A;  1VMF A;  3LB9 A;  1YQ5 A;  2EIG A;  3BUC A;  1CZT A;  4MET A;  4RHV 1;  1DQ6 A;  4BLJ A;  4R9A A;  2B5H A;  4IEW A;  3EBR A;  2Y8K A;  1OLM A;  1PZ9 A;  1UU6 A;  3ME2 A;  1C1F A;  5EIY B;  1AJO A;  5TSW A;  4AL9 A;  3POJ A;  4LLF A;  2XJQ A;  4BXS V;  4OQ9 A;  3NNF A;  2H0B A;  1Z7S 3;  2HWF 1;  4Q4Y 3;  3ZVX A;  1ND2 C;  3RMY A;  4OI2 A;  3E6B A;  3O0W A;  1W6N A;  4GKX A;  3RSJ A;  3NST A;  2DBI A;  4AFM A;  2X29 A;  2JG8 B;  2XHK A;  2Y6K A;  3T1L A;  2BJS A;  3WF0 A;  3EHK A;  3N9L A;  4MGK E;  2IFR A;  1JYN A;  2HWD 2;  3OUI A;  2P6H A;  4EWE A;  1GWL A;  2ZAH A;  4M4R A;  3ZDV A;  1POQ A;  2WQZ C;  3J7H A;  1IHM A;  3NNG A;  4CCJ A;  3LEM A;  4GWM A;  1MEC 3;  3MI8 A;  3UGF A;  1RIT A;  1RUI 3;  2WNU B;  4DFS A;  1OA4 A;  3B94 A;  4LE3 A;  1A78 A;  1AX0 A;  3R05 A;  1B35 A;  2YFZ A;  2WSV A;  3AX4 A;  1KS4 A;  2YMZ A;  3NW4 A;  1OXC A;  3POS A;  5FO7 B;  5FUP A;  5HCB A;  5J3U A;  5L7O C;  3OY8 A;  3ZFF B;  2OXB A;  3JD7 2;  4H2A A;  4QQP A;  4P9I A;  3OB8 A;  4IV1 C;  4QXC A;  2PLV 1;  1QQP 3;  1LHO A;  2VCB A;  4M0H A;  3MEP A;  5FJH A;  5CIS A;  1RIR A;  3ZXE A;  2GH8 A;  3M2M A;  3ZFG B;  1RGS A;  3DPR C;  1PO2 1;  1RED A;  3SKJ E;  3WQB A;  2FDI A;  2XH6 A;  2W87 A;  4QX8 A;  2BVV A;  4CP1 A;  3VDB A;  5FPZ A;  3H8X A;  2KR2 A;  4LIU A;  3U07 A;  4QX0 A;  2DUQ A;  1W6Q B;  2QQM A;  3PMS A;  4HN1 A;  4KBZ A;  5F3G A;  3H8O A;  3LSD A;  3RZL A;  4IEY A;  5FWE A;  4UFJ A;  4HK8 A;  4MOA A;  1H0B A;  5DUX A;  1I5Z A;  1GOH A;  4CDU B;  1Y43 B;  2LS6 A;  1X8E A;  1N3O A;  3WG3 A;  5LRS A;  1CQ9 A;  2NPI A;  4K6B A;  1HRI 3;  4LO4 B;  3AYE A;  3W5N A;  1D2S A;  4MGT A;  2R04 2;  2ZZQ A;  4Y4Y A;  4IQP A;  2XBO 2;  4LIT A;  4E4Z A;  1U5Y A;  2FMD A;  3I3Q A;  2N7G A;  5J36 A;  4BOW A;  4FXK B;  3GBG A;  3K46 A;  2WBK A;  4UAP A;  1VBC 2;  4ATE A;  1N1Y A;  3HT2 A;  5B4X A;  3R4D B;  1WGP A;  5FP9 A;  4I2O A;  5IK4 A;  1OMI A;  1COV 2;  1N1V A;  1SPP B;  2B4K A;  2DVG A;  2VBD A;  1YQC A;  4B8E A;  2DU0 A;  3J26 N;  3TB0 A;  4DOU A;  3GNE A;  1S0B A;  2OZ6 A;  3TWI A;  1N1T A;  3VGI A;  4CEY B;  4JDM A;  2K9Z A;  1VAL A;  4CTE A;  2CGN A;  2X5I B;  2HEV F;  4UBH A;  4WZC A;  5T5J A;  3U4S A;  3PIJ A;  3ZMN A;  3A7Q A;  3IKW A;  4RQP B;  4CDW C;  2DYC A;  5KBF A;  4BQX A;  3IZO A;  1LU2 A;  1ZRR A;  2DF7 A;  4MUV A;  2Z69 A;  4MGZ E;  4XIO A;  2BVB A;  1UZW A;  1ULO A;  5LBE A;  4XMI A;  5J1X A;  4NWW A;  1AYM 1;  2EVX A;  2XJU A;  4Y20 B;  4E2G A;  2FHR A;  2RDQ A;  4IV3 C;  1S55 A;  5DAW A;  3E6C C;  2Q8O A;  1QJF A;  3FHA A;  1W9F A;  3NV1 A;  4XW3 A;  3D0S A;  4CRQ A;  1VRH 1;  2EIE A;  1OUX A;  1AR8 2;  3BTZ A;  2R7E B;  3EJK A;  4MYE A;  4C8D A;  1C8M 1;  3M3I A;  3ABZ A;  4J6G A;  3C8X A;  3ES1 A;  3LDB A;  2BFU L;  2C0Z A;  2BYV E;  1YFY A;  3AL6 A;  3E97 A;  3IBM A;  4L97 A;  1EUU A;  1JHJ A;  3RYK A;  2RM2 1;  4NO4 A;  4HET A;  4WV8 A;  1NY7 2;  2WNU A;  2VW1 A;  5L9B A;  4YG3 A;  3UKT A;  1OVS A;  3ST7 A;  4BQY A;  1ACC A;  3CDZ B;  5FPL A;  3VBR C;  5AC9 3;  4QDR A;  1YXW A;  2EAK A;  3TRS B;  1VBB 1;  5HCA A;  4L2N A;  1H8T C;  2GP3 A;  5DZE A;  1H4H A;  4Y4R A;  1W9T A;  3MF9 A;  4Z07 A;  5LEK A;  4QQH A;  1AL2 2;  2ET1 A;  5FV3 A;  1FX5 A;  4RD7 A;  1ZBE 1;  1EV1 2;  2UY9 A;  2WN2 A;  4KWJ A;  4AFA A;  2RR1 3;  3AKP A;  2ZX0 A;  5LY1 A;  5FPA A;  1BK1 A;  3BU0 A;  4MGY E;  3TEW A;  1DGW A;  1CD3 G;  1YLL A;  2CDP A;  4C91 A;  3BPZ A;  2C9K A;  3K51 A;  1OQE A;  2Z42 A;  2GME A;  2O1Q A;  4S2D A;  5A3W A;  1W6Q A;  4JGZ C;  3AK0 A;  3D4K A;  1W04 A;  4CPB A;  4HSL A;  1T6G C;  1SAC A;  4HON A;  2WO7 A;  5FZI A;  4NII A;  2DV9 A;  3ZDS A;  5FZ7 A;  2VVD A;  2XUM A;  4OUL A;  1PO1 2;  4QPY A;  5FPX A;  3VZJ A;  4GH4 B;  1OLR A;  3T4H B;  4B29 A;  1JHN A;  2ARA A;  2HWB 2;  3K75 B;  2Z4F A;  1MS3 A;  3LWC A;  2ARB A;  2GSY A;  2W5F A;  4XPV A;  3WG1 A;  3WZ1 A;  3WW2 A;  2BWC A;  4DIN B;  3PIG A;  3U14 A;  2EAL A;  2YBK A;  3ZYF A;  2ZGQ A;  3I2D A;  3POB A;  3VBH B;  3I3M A;  2WO3 A;  3RYP A;  3PUA A;  4LBN A;  2ARX A;  1IQA A;  3ORJ A;  3T1M A;  2RDS A;  2WNO A;  2ZTN A;  2F6B A;  1MZF A;  1ZZ8 A;  5ACA 3;  1LOE A;  2D3P A;  3ILF A;  3AMP A;  5A3O A;  4AED C;  5CG8 A;  4LA3 A;  2YGM A;  4ARY A;  4EE2 A;  3FUQ A;  3TBD A;  5T54 A;  5GLZ A;  1I3H A;  2VNR A;  1M4W A;  2UY8 A;  2YFU A;  1AHS A;  4I0B A;  2VZS A;  4KU7 A;  4C0H A;  2VW0 A;  3VBU A;  2RG4 A;  2ZAC A;  2DVB A;  2YC4 A;  4CEY A;  2Q1F A;  2X8K A;  4DXT A;  5BNN A;  1MZ5 A;  5BPX A;  2VUD A;  4BWO A;  5H9P A;  4CCC A;  1KGY A;  1S0E A;  2D7F A;  3FE5 A;  1YO8 A;  4X8N A;  3WQ0 A;  2QFE A;  1GV9 A;  1WA6 X;  5C8C B;  2VCA A;  2VTF A;  4O9E A;  1Q8S A;  3K4Z A;  1O4T A;  4WM8 C;  4XYX A;  2JB8 A;  1NA1 B;  5FP3 A;  2JG9 C;  3BU7 A;  1BEV 3;  1ND3 C;  1SLA A;  2HEY F;  1AXK A;  1X9T A;  2LUW A;  1R09 3;  4FFH A;  4QPG C;  4Y20 A;  3VZO A;  2VZU A;  4GUL A;  1AL0 G;  3AXE A;  5GLT A;  5FY7 A;  2QQI A;  1N3Q A;  2Y6H A;  1AR6 3;  4OHX A;  4Y1Y A;  5FYH A;  1W3X A;  2VPV A;  3T0B A;  1MS4 A;  5FZG A;  3CL1 A;  2A6Y A;  2DVA A;  2J1A A;  3UJO A;  2IXI A;  3VBS B;  5E8A A;  2YGL A;  4JZR A;  3SCF A;  3HNB M;  2AC1 A;  4JX0 A;  1Q43 A;  3LF7 A;  1C5I A;  4XQ4 A;  3WCR A;  2R0H A;  5F32 A;  3THD A;  4GQ7 A;  2EAA A;  1C8N A;  1YYN A;  1QXP A;  4Y22 B;  3UET A;  3ZO0 B;  3FN9 A;  1ZRE A;  2OPK A;  3A22 A;  3HMY A;  1DG6 A;  1MEC 2;  1FPN 3;  2XML A;  3MIB A;  1OF4 A;  1RUI 2;  3RWK X;  4MVT A;  1HB2 A;  4JVA A;  4TTG A;  5FZ9 A;  4TLG A;  5APA A;  4PF1 A;  1K5J A;  2Q0A A;  5A80 A;  5JAX A;  3EB7 A;  3AVS A;  4JGY A;  5FQ0 B;  1W2U A;  4XFH A;  4FAG A;  1MVQ A;  5C6C A;  3ILR A;  5F8P A;  5CVR A;  4TSV A;  4CCN A;  5JOX A;  5FLJ A;  1GAN A;  2FZ1 A;  1LEN A;  2B42 B;  2EXI A;  2A6V A;  4QQL A;  4BIS A;  5CU1 A;  2W1Q A;  1QQP 2;  1JZ7 A;  1WW6 A;  4XTP A;  4C0B A;  1PMJ X;  2G9G A;  4CP9 A;  3T0A A;  1Y9M A;  2ZBJ A;  3ACG A;  4D6R A;  4LQR A;  2OVU A;  3FHQ A;  1SDW A;  1TNR A;  2O0O A;  4A7K A;  1N47 A;  1S4C A;  4JKK A;  3NV4 A;  2G4I A;  2P1B A;  2FMY A;  1G9D A;  4XC9 A;  4ZS2 A;  1YI7 A;  2ZX2 A;  3EO6 A;  4LTA A;  4RS5 A;  4GH4 A;  3U11 A;  4AF9 A;  3WF3 A;  2ZJC A;  2Z79 A;  3O0V A;  1QGL A;  1REF A;  3HEI A;  4RYD A;  2GNM A;  3GXU A;  1XNC A;  1OOP C;  3DUI A;  1SHW B;  3SCH A;  4BYY A;  5F37 A;  5KC6 A;  1PZ8 A;  1ZYB A;  3P5B A;  4AFC A;  1RVF 3;  2XUE A;  2NZ9 A;  5F6L B;  5BV6 A;  5KHG A;  4AGG A;  3VBH A;  3P6B A;  3VBO C;  2UWB A;  1CX1 A;  3SNM A;  3D3A A;  1PGL 2;  2E31 A;  1MQT C;  5C3R A;  4IEO A;  2ZGS A;  2D6K A;  4QXK A;  5FTT C;  3TYJ A;  1SBF A;  4AAX A;  4PBP A;  3Q9O A;  1W0O A;  5K7P A;  1GNH A;  1NXM A;  1BLZ A;  2JDM A;  4D94 A;  4KMQ A;  3DXT A;  1SFP A;  2WAB A;  3I3D A;  3K3O A;  4GZ9 A;  4HXC A;  2QJV A;  3WDW A;  3H3U A;  3BVC A;  3SEE A;  5T5O A;  4LLO A;  4DO0 A;  3T0D A;  1EYB A;  2A70 A;  3AB0 A;  2KM2 A;  4AEM A;  4QD2 A;  1RTV A;  5JXI A;  4IGQ A;  1YNA A;  2D43 A;  5A6Z A;  4AAP A;  3OEA A;  4I01 A;  5C8C A;  2GAL A;  1I1E A;  1TMF 1;  2YDE A;  1CN1 A;  3I59 A;  2E33 A;  1O7F A;  5FZL A;  2LTN A;  3O5S A;  2WWU A;  4NAM A;  1NLQ A;  2D44 A;  2F4P A;  3BKZ A;  3ZXA C;  4ASM B;  4P9J A;  4XJ8 A;  2XBO 1;  4NPL A;  4AQS A;  3F95 A;  3KS7 A;  1RHI 2;  3EXU A;  4P00 B;  1GIC A;  4K1Z A;  2WUH A;  3WNP A;  1UN1 A;  5ANQ A;  3J7M A;  4HLT A;  4K20 A;  2QDN A;  5FRA A;  5CB7 A;  4QKN A;  3MZH A;  4PI0 A;  3RNS A;  5C9A C;  5F5I A;  1FI2 A;  3H8U A;  1UZ0 A;  3FBY A;  1COV 1;  4NMI A;  4QMA A;  3B5L B;  1ZA4 A;  1GZW B;  3VV1 A;  1GKB A;  2BWA A;  2RV9 A;  3O1S A;  2WA4 A;  3ZXD A;  2H6C A;  1PMI A;  3WUC A;  3LGR A;  1WWY A;  2OYZ A;  1HV1 A;  1UOG A;  3MIC A;  4J1W A;  4K8R B;  1GZT A;  1GNZ A;  2ZHL A;  3SIS A;  1ONA A;  4OMC A;  2ZGN A;  2H0V A;  4JDN A;  3KV4 A;  3FUO A;  2E53 A;  5FQ0 A;  5AC9 2;  5L9R A;  1ST8 A;  3KGL A;  1SDD B;  1H2N A;  1TQ5 A;  2PHF A;  4UYB A;  1AX2 A;  3VHR A;  1UU5 A;  4DUW A;  2W68 A;  2ZMK A;  4BDV B;  3KCY A;  5IHR A;  3O1R A;  2ZKN A;  3O1V A;  2CGP A;  2JE8 A;  3MPB A;  2RR1 2;  4QHB A;  1JN2 P;  3N35 A;  4MV2 A;  3VHP A;  1HIX A;  4QPI A;  4CDQ A;  3ZR5 A;  4XF4 A;  1AXY A;  4M0N A;  2C1F A;  2X53 S;  4PIY A;  1LGC A;  5FAX A;  5FMB A;  4CUA A;  5FZ8 A;  3POF A;  4KGG A;  4D3W A;  2XVK A;  1VMH A;  1QY4 A;  2RJL A;  2XJS A;  1RUH 1;  3DEM A;  1IOA A;  3PLQ A;  4UW4 A;  5F5C A;  1ZRD A;  5FP4 A;  3PU3 A;  4YVS B;  3I4I A;  2J22 A;  4QDS A;  2A7A A;  3VL9 A;  3RZH A;  1NY7 1;  1W6O A;  4LEJ A;  5LZ6 A;  1WCK A;  5FKC A;  1RC6 A;  2W95 A;  4RGK A;  3BAL A;  1B35 C;  1LNS A;  1W28 A;  2G19 A;  2RS1 3;  1GP5 A;  3H7J A;  1MS1 A;  4N43 B;  4DXS A;  1JYX A;  3CJI B;  1BBT 1;  4PQQ A;  3JBG 1;  3NRU A;  4EN6 B;  1ZZ6 A;  4LUM A;  1DU3 D;  4LOR A;  1W03 A;  2HBU A;  1J59 A;  4BIF A;  2XLG A;  4W8J A;  1PGW 1;  1OPM A;  2JEN A;  1PNF A;  3P1I A;  4NN0 A;  4GMP 0;  2NP0 A;  3THP A;  4FQZ A;  1KS5 A;  3S7I A;  1L7Q A;  4QWN A;  1K12 A;  1RUG 3;  4I02 A;  4YSF A;  1F4A A;  1OKQ A;  2NLR A;  1AR9 1;  2VOK A;  1JYT A;  1LTE A;  2VMF A;  2HBT A;  3M7A A;  3UK9 A;  5ACA 2;  1Y3T A;  5LBB A;  3LEG A;  1YI9 A;  3RZZ A;  3WNM A;  1QH7 A;  2PN5 A;  2YXS A;  2WN3 A;  1IS6 A;  2VZT A;  4DS0 A;  4A3Z A;  4DNY A;  3K48 A;  2IVJ A;  5GM0 A;  1PO1 1;  1W0P A;  5IT6 A;  4XFI A;  4L99 A;  4XAA A;  4YZ4 A;  3NWK A;  4LBK A;  4RN5 A;  4IEQ A;  1KDK A;  5EHD A;  4LMF A;  3KMH A;  1QJU 2;  4WVZ A;  3VDC A;  3VHN A;  3VKN A;  2RS5 2;  2ERF A;  2OUJ A;  4EJR A;  1LGN A;  4WVV A;  5IVC A;  1W6M B;  1BEV 2;  1CZV A;  3DV8 A;  3TNP B;  4NPM A;  4JQT A;  3I3B A;  1Q3E A;  1ZZC A;  3W9A A;  4EN8 B;  1R09 2;  5KR7 A;  3WW3 A;  3V0B B;  5LY2 A;  1TMF 3;  3NAP A;  1CR7 A;  2JIC A;  3O0X A;  2PQQ A;  2PHD A;  1IGO A;  4JTN A;  4D6S A;  4GWN A;  1AUY A;  4CUC A;  1AR6 2;  2WJS A;  2YPD A;  3HT1 A;  4OHZ A;  1QHD A;  5A3N A;  5FMO S;  4QHZ A;  5L73 A;  5T55 A;  2JX9 A;  2VOT A;  1Z78 A;  3AKS A;  2R30 A;  3THT A;  1F15 A;  1O59 A;  1RUF 1;  2MEV 1;  1W8Z A;  1LES A;  3IWZ A;  1RL3 A;  4EYU A;  1CWP A;  1W8H A;  3SMH A;  1A8M A;  4HG6 B;  4NHM A;  3R6S A;  3CLP A;  3I2H A;  4UOJ A;  1HXS 3;  4AFD A;  3H7Y A;  3WVJ A;  5I91 A;  4YGC A;  2WFF 2;  1FPN 2;  3N7J A;  4HN0 A;  5FOB B;  4DY5 A;  1QIQ A;  3ATG A;  4NJ4 A;  4UW5 A;  1UW8 A;  2ZHN A;  5AFE A;  2B45 X;  2VEC A;  1EP0 A;  2CSG A;  3WDY A;  4KBB A;  5IVB A;  4Q0Q A;  3WY6 A;  2A75 A;  1V6K A;  4BXF A;  3O1T A;  1NLS A;  4SLI A;  4PLO A;  3T2T A;  3KB5 A;  4DRV A;  2ARE A;  4UFM A;  5I0S A;  1KFX L;  4FPF A;  5FZ6 A;  2Y6L A;  3J8F 3;  4XF3 A;  3I2I A;  3THC A;  1Q8V A;  3T09 A;  3PVO A;  3M1H A;  1FAY A;  3B01 A;  4QPW A;  4EN7 B;  1W9W A;  3OD0 A;  1MAC A;  1PIV 3;  4LPL A;  3CU7 A;  3CIH A;  1CAX B;  2WNU C;  3GYD A;  2WQ4 A;  1S0I A;  5E88 A;  1LHU A;  4LK6 A;  5FZB A;  1APN A;  2GNB A;  3MO4 A;  2OKX A;  1V6L A;  1RUD 1;  3ZMO A;  1IG0 A;  1D4M 3;  3MLJ A;  2HKX A;  3O1M A;  4O9G A;  4GMP 3;  4CCE A;  1NUK A;  5IFP A;  4J1X A;  2ZGR A;  4FFI A;  5JZG A;  1AYN 1;  1A8D A;  2XOM A;  4MLO A;  1XE0 A;  1RVF 2;  3KF5 A;  3A0N A;  5FOJ B;  2ZA9 A;  4LXL A;  1WKY A;  2J42 A;  2WS9 3;  4AEJ A;  3VUO A;  1NCQ A;  3LIG A;  1S2B A;  4F7Z A;  1GBG A;  4YVW A;  3WEZ A;  1FOD 3;  2XVG A;  4M3C B;  4OLL A;  4QKD A;  3ZOI A;  4A41 A;  2Q8C A;  2G9Z A;  5FJK A;  5FY5 A;  4B1L A;  3J4U H;  3NL1 A;  4IE0 A;  4WZF A;  1V9U 3;  2P2K A;  1CAW A;  4N9I A;  5JXH A;  1HJF A;  4FXG B;  2YPJ A;  1OLQ A;  3BTX A;  1OD5 A;  2R07 2;  1KD7 A;  4XET A;  3UKN A;  4KNC A;  2BGC A;  3WP6 A;  5LA0 A;  3LPG A;  1UF2 C;  4ORF A;  4X6R B;  3T2Q A;  2B46 X;  3T30 A;  4CDX B;  2Y26 A;  3QAC A;  4HZF A;  5C7G A;  5IW0 A;  1G8W A;  5KXC A;  1AXZ A;  1KQR A;  4JDO A;  3OPT A;  3PVE A;  5FLI A;  5DUW A;  5A1F A;  1L3J A;  2ZX4 A;  5LK5 A;  5FDB A;  3H3Z A;  3MUZ 1;  4Q4X 3;  4PF5 A;  4I0W B;  3KCC A;  3OJB A;  2XJR A;  1HDK A;  4GB3 1;  5EYY A;  1OF3 A;  5G05 L;  1BMV 2;  2Y33 A;  5DDJ 3;  3CMG A;  2GZW A;  4HFS A;  3N4M A;  5F3E A;  4FQ4 A;  5IFT A;  1S2K A;  1VAV A;  2PYT A;  2VAU A;  4LIV A;  2BFU S;  3S30 A;  3VBU C;  4ZZ5 A;  5CNA A;  5EP9 A;  3WDV A;  4BE3 A;  1A34 A;  4GJZ A;  4CEY C;  5BNN C;  5BY5 A;  3NVC A;  3DKQ A;  1IS3 A;  2VZR A;  3RJR A;  3PJQ A;  3LOI A;  1OD3 A;  1DYO A;  3SC7 X;  2SLI A;  4DZG A;  2ZHM A;  2FQP A;  3WF1 A;  5A3L A;  4ES8 A;  2RDR A;  3WP5 A;  1CGP A;  1G6N A;  1H2K A;  1V0A A;  1X7N A;  2JDZ A;  4KI5 M;  1FMD 3;  5F2S A;  1JOB A;  1QJX 3;  2PAK A;  3HNY M;  2OZJ A;  3AYC A;  2MPF A;  3W20 A;  4QGL A;  4LO5 B;  3VDD B;  1LCL A;  2PAM A;  3VDA A;  1OQD A;  2BOJ A;  5GZF A;  1RUF 3;  2VUL A;  3SIT A;  3BOD A;  4COY A;  1CIW A;  2VZP A;  1TME 3;  4LBJ A;  4YWA A;  2BW8 A;  3WG4 A;  4FOV A;  5K0U B;  3KT7 A;  2HWC 2;  4A6O A;  2D6L X;  2Z2S B;  1UYZ A;  4XDP A;  4OUE A;  3MGU A;  3CNA A;  2TBV A;  2Q5T A;  2A73 B;  1SLI A;  2CDO A;  3ACI A;  3IMN A;  4LBL A;  3ILN A;  4XF0 A;  4Q4W 1;  1H2M A;  4XUR A;  1H6X A;  4TN7 A;  1G86 A;  5FMO L;  3ZYR A;  4QGM A;  5HPO A;  2V5D A;  1F31 A;  1GU3 A;  2JDH A;  3GF6 A;  3P3P A;  4K8F A;  4WBB A;  2XWJ B;  3RDI A;  4Z1V A;  2RS3 3;  1UZV A;  1H30 A;  1K5M B;  2R32 A;  1JYW A;  2VZV A;  4GAL A;  2TEP A;  4IEV A;  4NR1 A;  5C4W A;  1CAU A;  2WYF A;  4H7M A;  3WNK A;  3N9N A;  4CEW B;  2OA2 A;  2R06 2;  3KT4 A;  3L2H A;  5FMD A;  5LAT A;  3ZYI B;  1QJY 1;  2XGX A;  4PIX A;  4XHX A;  5B2G B;  5CA6 A;  1X50 A;  1C1L A;  3AZZ A;  4JGY C;  2YUE A;  4RGG A;  4TXW A;  1ZBA 1;  2RS1 2;  4Q1R A;  4MH0 E;  5EYX A;  4ZY9 A;  4B1M A;  2QQU A;  4PIZ A;  2VM9 A;  4LHN A;  3ZIX A;  1MVE A;  2Y64 A;  2VC9 A;  4Z82 A;  1GQG A;  1LHV A;  1V6I A;  4C1W A;  1VBA 3;  4Y1X A;  2AH2 A;  1RMU 2;  1ENS A;  2I45 A;  2FDJ A;  4IE7 A;  2A1X A;  3MID A;  5D8A B;  4JCK A;  3WSO A;  4FSJ A;  1TNF A;  1GYK A;  2JDN A;  1SEF A;  2QUO A;  3MIH A;  3IAQ A;  4W50 A;  5BNP C;  1EAH 3;  3HBZ A;  1RUG 2;  2ZEW A;  2GND A;  3CZJ A;  5GKA C;  4RS5 C;  3TEX A;  4GH4 C;  1VB2 A;  1IZ3 A;  3VB9 A;  3E1F 1;  3PUS A;  1IQD C;  4V1P A;  3GJB A;  4FPY A;  4N7I A;  3U10 A;  1JYV A;  1UMZ A;  1W8U A;  5DAQ A;  3TN9 1;  1HRV 3;  2PHL A;  2D6O X;  5DUU A;  4YZ3 A;  1YUD A;  1QJZ A;  4YGE A;  3Q8E A;  4AZZ A;  2RMU 2;  1DZT A;  2VMH A;  4QX5 A;  3C3V A;  5CZK A;  4R8H A;  4X6Q B;  1GP6 A;  5FZC A;  4D8M A;  3VBH C;  3M3O A;  4XUN A;  4FOQ A;  1Q8Q A;  4S2H A;  1YFX A;  2WNE A;  4R4Z A;  4G3Y C;  2OX0 A;  4XQW A;  4ZZ8 A;  1UCX A;  4N53 A;  2R0F A;  1QOO A;  2W0X A;  3RFR A;  1UIK A;  3RZJ A;  1VBD 1;  1PVX A;  1BK0 A;  1J1L A;  1DGW X;  1SBD A;  4K3U A;  2A3Y A;  3RZG A;  4BZ4 A;  3OGV A;  1B09 A;  4PT6 A;  2IXC A;  2FDK A;  2GN3 A;  3O7O A;  1BZW A;  1JZ3 A;  2WYS A;  3ACF A;  4QM9 A;  3AP5 A;  5FZM A;  4HK9 A;  4BLI A;  1NAE A;  1S1A A;  1ZNP A;  2QQJ A;  2ZEY A;  2JEC A;  3E5Q A;  3RRD A;  1R1A 1;  4CU6 A;  3I2F A;  3I2K A;  4UF0 A;  4CP0 A;  3OUJ A;  2JKB A;  1Q5O A;  3GZA A;  3WX5 A;  3ZYJ B;  4QXB A;  3ZFE B;  1TG7 A;  3N7L A;  5JCT A;  4CA9 A;  4QKB A;  4CE8 A;  2QNK A;  1HXS 2;  2J1E A;  2KD7 A;  2VMD A;  3CF6 E;  3BN6 A;  1GQP A;  4OUS A;  1F5J A;  2D97 A;  2E6V A;  3JQX A;  2VCC A;  3USS A;  4YM3 A;  2GC1 A;  3V0A B;  2DCJ A;  1QDO A;  1R08 1;  4OMD A;  3ZN6 B;  1U5I A;  3NNL A;  5AFB A;  1GR3 A;  2WLQ A;  2JG8 A;  3RVH A;  2CAV A;  4RHV 3;  3IDA A;  1UL9 A;  4EWA A;  3ES4 A;  1RUN A;  2FDG A;  3VBF B;  3J8F 2;  2UUR A;  5M0T A;  3T3Y A;  2B9U A;  4IES A;  4AI2 A;  1OFS A;  1IS5 A;  2QCS B;  2QE3 A;  4E2S A;  5I8Y A;  1CJP A;  2HWE 1;  3HQR A;  1K5M A;  1WBL A;  2HWF 3;  1PIV 2;  3BCW A;  4N7U A;  2XKO A;  1PVC 1;  4YFW A;  4CEW A;  1EY2 A;  3NO8 A;  3OGG A;  4QXH A;  1RJ7 A;  3FLR A;  3VKL A;  1BVV A;  1K45 A;  2C4X A;  3ZPO A;  4AVA A;  4IDZ A;  2XXZ A;  1JYI A;  4XFF A;  4YM0 A;  2OQ7 A;  1WW7 A;  4UW3 A;  3ZFF A;  3N7K A;  1ODN A;  3D6E A;  2H6B A;  4F3J A;  2XJV A;  1D4M 2;  1SQ4 A;  5FP8 A;  3III A;  1ZZ9 A;  1NLR A;  2GN7 A;  3AM2 A;  3AVR A;  1FV2 A;  2WZR 2;  2QZ3 A;  5KHK A;  1VJ2 A;  3GHN A;  3UKV A;  5H9Q A;  1V6N A;  4IER A;  3VD7 A;  1XE7 A;  3ZFG A;  2CL2 A;  4JV4 A;  3ZXL A;  3WNX A;  2FD8 A;  4ZON A;  2WS9 2;  4HKW A;  2PFW A;  2P37 A;  4QPI C;  4A45 A;  3INA A;  4CDQ C;  4EWD A;  4Q8L A;  2VOV A;  1Y4W A;  1AR7 2;  1FOD 2;  1ZBA 3;  2CNA A;  2P4E A;  4E27 A;  4AHZ A;  5JOZ A;  4CCM A;  4RR3 B;  4BB3 A;  3VD9 A;  4P9X A;  1DGR N;  2HJI A;  4GIQ A;  3ZXF A;  3MFA A;  4BM8 A;  4QM8 A;  2PLV 3;  1WLT A;  2VCM A;  2WZE A;  1V9U 2;  3NQH A;  4H7L A;  3WD5 A;  3IM0 A;  2D6M A;  1ASJ 1;  1W8N A;  4QX7 A;  3JCI A;  5L7O B;  4CDU A;  1S0G A;  3OOX A;  1W6P B;  1LAJ A;  1PO2 3;  1AJK A;  1NCR C;  5FZF A;  1JOD A;  1SMV A;  3ROU A;  3WG2 A;  4AEK A;  1XE8 A;  4I3P A;  4KWL A;  4XOG A;  3WOG A;  2LM3 A;  4IV1 B;  4MXW B;  4XJU A;  5KXD A;  1REE A;  4ZU7 A;  4IEP A;  2AGS A;  3K2O A;  2XPJ A;  1I9R A;  3KV5 A;  1E5S A;  3DPR B;  4RSU A;  2OUH A;  3MUY 1;  4EN9 B;  2VNG A;  1UXZ A;  3BB6 A;  4RFR B;  1H8V A;  4IW3 A;  2I2S A;  3TN9 3;  2YU1 A;  1CJD A;  1WMF A;  4CSW A;  1OQ1 A;  1RUE 2;  4Q4X 2;  1OLM E;  1LOC A;  3SH5 A;  2J7M A;  1SPP A;  3WNL A;  4AI1 A;  1RUC 2;  3QD6 A;  4I09 A;  5GZE A;  1SCR A;  2Y38 A;  1H2L A;  1MS5 A;  2W3J A;  5DDJ 2;  3O1P A;  4Q4V 1;  3MFC A;  1OFN A;  5J09 A;  3G6J B;  1S2E A;  5I93 A;  2NMO A;  2ZZJ A;  3VD5 A;  4CCO A;  1CVN A;  2ETE A;  4QU1 A;  1XYP A;  1VAK A;  2X5I A;  1VRB A;  1O3R A;  4A7Y A;  2D40 A;  5C3Q A;  3VD3 A;  3RZM A;  3W5M A;  1JOP A;  3HD8 B;  5BUV A;  4RQP A;  1VPH A;  4KH9 A;  5C3O A;  3IPV B;  1XB9 A;  4M3C E;  2Q30 A;  1XU1 A;  5EWS A;  1RUJ 1;  4Y1U A;  4MHU A;  5IUQ A;  2VBP A;  1XNA A;  2VE1 A;  1FMD 2;  3ZSL A;  2WAO A;  3S6P A;  4IEU A;  2XR4 A;  1QJX 2;  4Y26 A;  5FZ4 A;  3AKT A;  3CJX A;  1URX A;  4ZXE A;  3KSC A;  3QH6 A;  3M3Q A;  1VBE 1;  5FRE A;  1ULD A;  4FPG A;  1PX4 A;  3NAP C;  2JDA A;  3WF4 A;  4AVT A;  4AR2 A;  3GZT B;  1J58 A;  1Z7S 2;  5FBJ A;  1LKN A;  4HPK B;  1WBF A;  4Q4Y 2;  5JSR A;  3AZV A;  3VBF A;  1CPM A;  4AI0 A;  3ACL A;  3S7E A;  4PBO A;  2V09 A;  3FFZ A;  4P9Y A;  5A33 B;  1AF9 A;  1X33 A;  3GJA A;  5G04 L;  5EZW A;  1R08 3;  3C7F A;  5T3N A;  3E5U A;  4FPH A;  3KVA A;  4XEZ A;  1IPK A;  2G1M A;  4XMA A;  2Q8E A;  1YCI A;  2WWJ A;  5FY1 A;  4YPJ A;  1AYM 3;  4WVM B;  4YZ2 A;  3V56 A;  4CDW B;  3WQ1 A;  5FZO B;  3ZXG A;  4K7J A;  4TYS A;  2RS3 2;  5F3I A;  1ZRI A;  2ZGU A;  1SBE A;  3OGR A;  3C7O A;  3ZN5 A;  4DUX A;  1VRH 3;  4YYO A;  1MZ6 A;  2W08 A;  4OI1 A;  5KC5 A;  2E7T A;  1V6M A;  4GXL A;  3DGT A;  1C8M 3;  1XNB A;  4HL0 A;  5FZ3 A;  3B9C A;  4YLZ A;  4H3W A;  1PM7 A;  3ZM8 A;  5C33 A;  3J9S A;  4IV3 B;  3POG A;  4HVO A;  4DIQ A;  1W06 A;  2RM2 3;  3FLT A;  3AFG A;  4M00 A;  3DYP A;  1YC6 1;  3IDE A;  1MZE A;  4XJA A;  4AI9 A;  4DQA A;  3FMG A;  5FBZ A;  1PX3 A;  3M3C A;  3UV9 A;  1F8V A;  5CFD B;  3MPP G;  5CKN A;  1BKZ A;  1VBA 2;  1Q56 A;  3PVB B;  3UL2 A;  1JZ5 A;  3MLL A;  4YW3 A;  1VBB 3;  2VTX J;  2ZKL A;  1FT9 A;  3HQU A;  5AVP A;  4RR3 A; 
#chains in the Genus database with same CATH homology
 1S4C A;  1JOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...