4AWDA

Crystal structure of the beta-porphyranase bpgh16b (bacple_01689) from the human gut bacterium bacteroides plebeius
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
297
structure length
297
Chain Sequence
KEYSLAEEHIKNLPEAPEGYKWVVNEDYTDEFNGKRLNAAKWHAKSPYWTNGRPPATFKAENVSVKKGCLRIINTVLSPTEGLDGKPGDKYRLAGGAVASVKNQAHYGYYETRMKASLTTMSSTFWLSNRPVMKEIMKGGKKIKTWSSQELDIIETMGIIRSVNPDNPWNKTWNMQMNSNTHYWYQEQGGKRTDNTAKRSDVVSYMTDPSAEDFHTYGCWWVDANTVKFYYDGKYMYTIKPTTKYTDTPFDRPMFIHIVTETYDWEKQVPTAEDLKDKDKSTTYYDWVRAYKLVPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-PORPHYRANASE
publication title Bacteria of the human gut microbiome catabolize red seaweed glycans with carbohydrate-active enzyme updates from extrinsic microbes.
pubmed doi rcsb
source organism Bacteroides plebeius
total genus 73
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4awdA00
1UX6A 1AXZA 4HANA 2Q5TA 3NV1A 2JDZA 3ZSKA 2AYHA 1LOBA 1TEIA 1V6LA 1UPSA 3ATGA 3USUB 2R1BA 2ZZJA 3BTAA 2DTWA 4UW4A 3SISA 5GLZA 1LCLA 1LOFC 5IUQA 4YG3A 5BYNA 1S0IA 5DZGA 1IS3A 2JE7A 3O0WA 1LEMA 4BM8A 4CRQA 4U2AA 3WHTA 4Y20B 2PHWA 5T55A 3INAA 1V6NA 4R9CA 4GKXA 1GBGA 1SBEA 4U36A 3V0BB 2ZGQA 1LHWA 2ZA9A 3WDUA 3GNEA 1DYKA 2D6OX 1QF3A 2D44A 1LOAA 1QNYA 1W6QB 4LBQA 5HCBA 4DRVA 1I1EA 3UK9A 4XDQA 2XB6C 3C2UA 1JYCA 2D43A 3ZYRA 1CR7A 3CNAA 5F5QA 5DUVA 1O4ZA 1WBFA 1VAVA 3APBA 5FRAA 2UWAA 4PBOA 1SLAA 1SFYA 4Y22A 1S0BA 3D5OA 4XJUA 2GNMA 1H9WA 3N35A 5IK8A 3MW4A 1JYIA 2AH2A 2ZGMA 3JUUA 4R9AA 2DURA 4Q8KA 3B9CA 1AX0A 1JUIA 2P2KA 4YG0A 1BKZA 3KM5A 4BOWA 3MPPG 2AGSA 3M1HA 3ZPYA 1G9DA 1LESA 4FPOB 3WG3A 5JLVA 2D3RA 2WT1A 2HYKA 1IKQA 1HLCA 1QDOA 5T54A 4FVVA 4TYSA 4D69A 3JU9A 4YW3A 3WUCA 1W6NA 2CTVA 3FLTA 1GKBA 4PF5A 5GZFA 2W52A 4DRRA 2YZ4A 2ERFA 3Q9OA 2D7FA 1QDCA 3VKFC 1DIWA 1IOAA 1F5FA 4M00A 5IT6A 1JXNA 4Z8BA 5H9QA 2ZABA 5GM0A 4AVSA 3ASIA 1LGBA 3WDYA 5GZGA 1NXD1 1U0AA 4AGGA 3O5SA 4FOVA 2NMNA 2EXKA 3NV3A 3NV4A 4HL0A 4XTPA 3RG0A 5F9TA 3FLRA 3SITA 2C9AA 2A6ZA 1G86A 1PZ7A 3AZYA 4PQ9A 2RHPA 2SLIA 1S0CA 1MZ5A 4XJAA 3WHUA 4DPNA 2DTYA 3B69A 3I4IA 1J1TA 2KM2A 4FQ4A 5GLUA 1W6PB 1S0EA 4P9XA 3KQRA 5GZDA 1UL9A 1BJQA 3AP5A 2EXHA 3AZWA 3ILFA 4Q2FA 3USUA 3OBTA 1YYNA 2R16A 2OW4A 5JOZA 3LSDA 1ULFA 4GXLA 4NOTA 3SH3A 2ARBA 2D3SA 2AUYA 2FMDA 1LOCA 2A5ZA 3UL2A 1LHUA 3IN9A 1DQ5A 5L73A 2P37A 3M2MA 1GV9A 3AP7A 4Y20A 5CB7A 4AVVA 1JOJA 1KDKA 2BQPA 3V0BA 1ULGA 2WT2A 2WSUA 3WDXA 1ONAA 4SLIA 4LBKA 4LBNA 4BMEA 1Q8SA 3RQ0A 3N7MA 3AK0A 5T5OA 4ITCA 1W6QA 2ZHNA 1PZ8A 4TZDA 4OZXA 1GZ9A 2CL2A 4WVVA 3H0OA 5CBLA 4YFWA 1AF9A 5H9SA 4YW1A 3ZVXA 2YY1A 3O0XA 1BQPA 4BLIA 2R0FA 1G9FA 4Q26A 1LU2A 1AXKA 1RINA 4YM1A 4R9BA 1CN1A 1WW5A 1DLLA 1FAYA 1FNYA 1YXWA 2C5DA 4FPEA 1N3PA 5DUWA 1CPMA 5FREA 1HQWA 4AGRA 1HDKA 5IK4A 4YGCA 1AZDA 4PBPA 5KXEA 1VLNA 5T52A 1AX2A 1LHVA 1ULCA 2DU0A 3ZXJA 2E7TA 1O4YA 2ZKNA 1SBDA 5E89A 1GNZA 2ZGSA 4LBMA 3SNMA 1V6MA 4W65A 2GMMA 1FYUA 2A6WA 2LTNA 2ZGTA 1GLHA 1D0HA 2D3PA 1N3OA 2VY0A 3WG4A 3ZYPA 1S0FA 4CZSA 3MEPA 1MACA 1PZ9A 2NP0A 2ZACA 1Q8QA 4GA9A 4WVWA 2A6YA 1ULEA 2PHFA 4GWMA 1YO8A 4ZXKA 1LGNA 5E8AA 1KITA 3OJBA 2ZGRA 3RMYA 4XJWA 1QNWA 1G8WA 4YZ3A 3VKMA 1WLWA 4Y1XA 3AYEA 4FP2A 4ATFA 5HCAA 1WLDA 4BLJA 5IK5A 1QU0A 2A75A 3AP4A 3WLUA 3WDTA 4YM0A 2GN3A 1W6OA 2A3YA 3FUOA 1W6PA 5T5PA 2W68A 3UJOA 1QGLA 1CESA 4RL7A 1GZCA 3LCPA 3UJQA 1IS5A 3OGGA 3WUDA 2DV9A 5JDBA 2ZGKA 4FPFA 1VALA 2AENA 1LTEA 4IQPA 3AZVA 1A3KA 1S1AA 1ZM1A 2DVDA 1WBLA 2EXJA 4UW5A 2LALA 1V00A 1DGLA 1X50A 2W08A 5DZEA 3AYDA 2E6VA 1LULA 1R1ZA 1SLTA 1H9PA 2SBAA 1W0PA 3AP6A 4KBBA 1LOGA 3MW3A 2R1DA 4Y1UA 1YIFA 4GALA 1N1YA 5EYYA 3WCRA 4NO4A 1MS1A 2GNDA 2DVAA 5CA6A 1S0JA 1FNZA 2YXSA 3WDVA 1MS5A 4I30A 1RITA 3IM0A 5CNAA 1HQLA 3WG1A 4AVTA 1UMZA 1WCSA 2P3JA 3HR9A 3OBRA 2NMOA 4CTEA 1MVQA 3PVEA 1N1SA 1VAMA 2OUHA 1SBFA 3ZSJA 1G9AA 1A78A 3AFKA 4XIOA 2EAKA 1ENQA 2UWBA 2NN8A 2ENRA 3AYCA 2Z42A 4GWNA 5T5JA 4H55A 2ZMNA 2A6XA 3ZXEA 3BOPA 1S0GA 1W0OA 3WG2A 3M3EA 4YGEA 3WOGA 1W6OB 1LOEA 2DU1A 1V6JA 2ZGNA 3DUIA 3I8TA 4XHBA 5DUUA 2JJ6A 1H30A 1XQNA 3T1LA 1MS0A 2GNTA 1QOOA 3O12A 4YW2A 4YFZA 4YZ5A 5EWSA 3AP9A 4XBQA 4YW4A 3ZXKA 3U4XA 3BODA 2E7QA 3OYWB 2XG3A 3HN1A 2VW1A 2YROA 4XTMA 1AJKA 2D6NA 3O0VA 1DQ2A 3N3HA 1LHOA 1SLLA 1Y7BA 1KJLA 2WSVA 2ZGOA 2DVGA 1Q8VA 5H9RA 2OVUA 3RSJA 3WV6A 5JMCA 3N7LA 1G9BA 2DUOA 1CQ9A 3VKOA 1Q8PA 4ASMB 4AWDA 1DBNA 1N47A 1RIRA 2TEPA 3ILNA 4K21A 4DQAA 4YZ2A 2B7YA 1VIWB 2DYCA 4Y1YA 2ZGLA 1FATA 4YW5A 4YGDA 1A8DA 2D6LX 1KJRA 2E53A 3ZSLA 3T1MA 3B3QE 2WLQA 3L2YA 2ZHMA 4FP3A 4FOWA 2EALA 1BXHA 4K20A 1UZYA 3IPVB 1SCSA 1QOTA 2DWRA 2VUAA 3AX4A 1LHNA 1NLSA 2GALA 1LGCA 4YZ4A 5JVVA 3WCSA 4F83A 1Q56A 1DHKB 1C4RA 2D6KA 1N1TA 2AREA 4XE9A 5KXCA 2V73A 1MS9A 2G4IA 3NV2A 3PVNA 5DG2A 3FLPA 1C57A 1W6MB 3ZSMA 1DZQA 1ENSA 4K1ZA 1CJPA 4XZPA 1MVEA 2JD4A 5GZEA 2CWMA 3SLIA 2WKKA 2A6VA 2VH9A 4K1YA 1MZ6A 4ZKTB 1Z78A 2P34A 4YM2A 2H0BA 5KXDA 3POWA 2CWSA 3OY8B 4Q8LA 4XHXA 5AVAA 1QMJA 1SLIA 4ISRA 1BYHA 1JW6A 2EIGA 1F9KA 1WLCA 1LJ7A 3A0NA 2E51A 1SCRA 5DUXA 2PHTA 2A70A 1QOSA 1GNHA 3VKLA 1FX5A 4FOQA 2EF6A 2PELA 1S0DA 2ZMLA 3M3QA 3V0AB 4FPJA 3AJZA 4UW6A 1MR5A 1LOFA 2ZHLA 2ZGPA 2DVFA 1YI7A 1ZA4A 4YLZA 3VUOA 3N7JA 1UN1A 3AZXA 1Z0HA 1N3QA 4XJ9A 5T5LA 3LSEA 4BQ1A 1SLCA 5JOWA 1DFQA 2V5YA 4Q1RA 1LODA 1JHNA 4XJZA 1GSLA 3WNXA 1KRIA 3OYWA 2GDFA 1CVNA 3R4SA 5GZCA 2A3WA 2GMPA 1HKDA 3PJQA 4ISQA 4LBOA 3SH5A 4C1XA 2D6MA 3FBYA 1UAIA 1CIWA 3AXDA 2GNBA 3IMNA 4Y1ZA 2JECA 5EXOA 1DYPA 1ULDA 3N36A 4JRAA 1B09A 2A71A 4M3CB 4M3CF 4FPHA 3V65A 5GLTA 1GZWB 3FFZA 4MYEA 3PMEA 4XJ8A 3VKNA 4JC1A 5JOYA 3WZ1A 3ENRA 5DXDA 1OFSA 4WZFA 2A7AA 4FPKA 1Q8OA 4Y26A 5IK7A 4M3CE 3RS6A 3D6EA 4FQZA 1ENRA 2AR6A 3IPVA 3NWKA 1JBCA 3MW2A 1AVBA 1URXA 2UU8A 3D4KA 1GYKA 1FV2A 4LBLA 4YG6A 3GALA 3QCWA 5KXBA 2W39A 3RMXA 4XBLA 4DFSA 4DS0A 1SLBA 1C1LA 1GICA 1AJOA 4XBNA 2ZHKA 2NYYA 3DGTA 4XMAA 1W6MA 5GLWA 4GKYA 3AJYA 4PCRA 2I2SA 2ZGUA 2YV8A 2GN7A 1AXYA 1KDMA 5E88A 1N1VA 2JE9A 4XYXA 1YRZA 4YGBA 3QLQA 4LBQD 3OY8A 4XIKA 4P9WA 1MS8A 1FV3A 5GLVA 3BIWE 2VXRA 1MS3A 2PHXA 3FUQA 1WW4A 4UW3A 3POSA 5HCFA 3TB0A 1OQ1A 2R0HA 1BZWA 3V0AA 4FPYA 1G7YA 2P3KA 2DUPA 2D6PA 3TAYA 2FHRA 3AZZA 3PVOA 4Y24A 2CY6A 3B01A 1IS4A 1GANA 1SACA 1LU1A 1CONA 2WJSA 1KQRA 2DVBA 1UKGA 1V6IA 2R49A 4M01A 4L8QA 4AYUA 3AXEA 4LBJA 2NM1A 4XILA 2WNEA 4XXAA 4FOYA 1I3HA 3W59A 1EPWA 1QKQA 3VV1A 2P3IA 4FPGA 3OPZA 4R9DA 3R4UA 1WW7A 3V64A 3B00A 1WD3A 2PHUA 1D2SA 1V6KA 1LECA 2WT0A 3AYAA 2ARXA 4LBQB 3T2TA 1WUVA 1G9CA 4FPLA 3A4UA 3WDWA 1C1FA 3IKWA 2ZMKA 1DQ4A 1JN2P 2WQZC 4FPCA 2OUJA 3ILRA 5EYXA 2VW2A 2VU9A 3M3OA 2DUQA 5DG1A 4M3CA 4BMBA 4Y22B 3W58A 2UWCA 2NZ9A 2YMZA 3POYA 4XOGA 1DQ1A 2VW0A 1GZWA 1WW6A 4AGVA 5JOXA 4C1WA 5GALA 1LEDA 1DQ0A 5GJ6A 1DQ6A 4YM3A 1CPNA 3N7KA 2JKBA 5SV8A 4XMIA 4BPZA 3HMYA 2ZBJA 4Q1PA 3WVJA 3SH4A 4XXPA 5T50A 3A0KA 4P9YA 1W6NB 1IKPA 1AX1A 4P14A 4ATEA 1APNA 3M3CA 2CNAA 2CYFA 5H9PA 4WV8A 3ZXLA 2EXIA 3ZXFA 4Y1VA 1F31A 3R05A 2UURA 1LENA 5DZFA 4YZ1A 4RA0A 5LK5A 1V6OA 1WD4A 2ZAAA 5CAZA 1IS6A 2GMEA 1OKQA 1UZZA 2PHRA 2ES3A 4Q27A 3RRDA 4JCKA 2A3XA 1MS4A
chains in the Genus database with same CATH superfamily
5DABA 5FYIA 5JXJA 2AYHA 1LOBA 1VMFA 2Y33A 2Y6GA 2VM9A 2YU2A 1V6LA 3ATGA 4I2OA 4IEZA 3TN93 4AFCA 4OUSA 2ZZJA 3S5QA 4AAXA 4CUAA 2DTWA 4UW4A 5CVRA 3SISA 1LCLA 4N43B 5CFCC 3SCFA 5IUQA 4D7YA 2BNNA 1IS3A 1LEMA 2CGPA 2QZ2A 2FDJA 5FY9A 1OH4A 4LR4A 4CRQA 2W1QA 3GZAA 4UI9L 4YPJA 4Y20B 1PX3A 4BCUA 4CXXA 4GKXA 4NRMA 2WNUC 4A7ZA 1LHWA 1CAWA 2ZA9A 3RI9A 1DYKA 1VBD1 3MO4A 1BMV1 2D44A 3BN6A 1QNYA 2JG9C 5HCBA 1UIJA 4SBVA 4A7YA 2PAEA 5JXIA 3APBA 4LLFA 2UWAA 1SLAA 2WN3A 1S0BA 2RJ2A 3GGLA 4MGSA 5IK8A 3MW4A 1GOFA 1HW5A 1P8JA 1SDDB 2MPFA 4R9AA 3M3IA 1O5UA 2ZKLA 5C8CC 4OI2A 4NHMA 1RJ8A 4P9GA 5AFBA 2QQLA 1D2QA 4EN6B 1LESA 4YRDA 1R093 3WG3A 3AC0A 4WM8C 2OZ6A 3LOIA 4MLOA 1I1EA 2W95A 3QOPA 4TYSA 3WUCA 3VDDB 3AB0A 3D0JA 2CTVA 2DDUA 5JPMB 3LFMA 2W52A 3DKWA 3Q9OA 1ZRFA 3GBFA 4OFGA 2D7FA 2EIEA 5JUVA 4ARYA 5IFPA 3UKTA 3R6SA 1A8MA 2OPWA 5GM0A 4OQ8A 3KV5A 4X8PA 4UF0A 5FAXA 3ZMNA 3NV4A 3NV3A 3RG0A 3T2PA 2VMIA 4XCBA 1RVF1 3FLRA 2RE9A 3SITA 3F95A 5C4WC 5K4LA 3AZYA 2FBEA 4IV3B 4PQ9A 4EN8B 2SLIA 3VD4A 1S0CA 4UWDA 1UKRA 3WHUA 3VBUC 4IGQA 1VRH1 2AZ5A 2TBVA 4R4XA 4DPNA 2KM2A 1CGPA 4P9XA 3KQRA 1J1LA 1UL9A 3USUA 3AZWA 4Q2FA 1ODMA 4B4QA 2J1UA 1POQA 4NWVA 2ARBA 3NJXA 4E4DX 1OSGA 4ARXA 1US3A 2PYTA 1LHUA 2IFWA 1GP6A 4FFFA 4OMCA 2PAKA 1OC1A 1G6NA 1WWYA 4AVBA 5CKMA 3Q8FA 5FLIA 2VXJA 5DMYA 3BU7A 4FI9A 4UXAA 3O1OA 4LBKA 4BMEA 4N43C 5LBBA 1QJU2 5FUPA 1ZX5A 1OH3A 2W91A 1RGSA 5AC93 5KHKA 2ZHNA 4WVVA 3H0OA 1QJX3 4CP0A 5CBLA 1JZ3A 4LTAA 5H9SA 4AOCA 2YY1A 4AE2A 4B1LA 1BQPA 3ZFEC 2QE3A 2R0FA 4Q26A 3UESA 1ULPA 5IATA 5DUWA 2C5DA 1FAYA 1YXWA 2QCSB 4FPEA 4S2DA 3RZZA 5IK4A 1HRV2 2WNOA 1HDKA 3WF3A 2P3YA 3JB8A 1MQTA 1W9TA 3J4UH 3KS7A 3POFA 1AX2A 2QQJA 2DU0A 4LHLA 5EJ3A 2E7TA 1O4YA 3SKVA 2YDEA 3VBHA 1TVGA 1GNZA 2FCVA 2ZGSA 5JR7B 4E8DA 5LCWL 4P02B 3K51A 2B4KA 3S7IA 3BIEA 4KG8A 4AFBA 4LKSA 1XOYA 2A6WA 1GOGA 1GLHA 3OUIA 2D3PA 1N3OA 2VY0A 4P9JA 2YFUA 4Y4YA 4I3GA 1O59A 4QB1A 2W5FA 2VGDA 3NJZA 4LULA 4CU8A 2WFPA 4MZUA 4JRLA 3ZIWA 2NP0A 4MGTA 1Q8QA 3NAPB 4GA9A 2A6YA 1NA1A 4F3JA 2WO7A 1SMVA 3VDDC 4RFRB 4ZXKA 4FAHA 5FYSA 1VBB3 1WMFA 1YIPA 1TNFA 2ZX2A 3TEXA 5J09A 1CAUB 1PX4A 3VBOA 1LR5A 3ABZA 3DXUA 4MO3M 4GB31 3VBSB 4E27A 1DGRA 5FO7B 5HCAA 4OVEA 4BLJA 3I3EA 1NCRB 1EV11 3MGUA 5D8AA 1H4HA 2XMLA 4YM0A 1RUG1 1W6OA 2A3YA 3FUOA 3HIFA 5T5PA 3ZPOA 4PLMA 5DDJ1 1QGLA 4UFHA 1CESA 4NAOA 1GZCA 3ACLA 1W03A 1IS5A 3I2OA 3WUDA 3ELNA 1W8WA 5J3UA 2RS11 5F1RA 1VALA 5CZKA 5FFOC 1PGSA 3AKQA 3QACA 3AZVA 5EJ1B 5KC6A 1UQXA 5EJZB 4UW5A 5A1LA 2LALA 2J1RA 2PHLA 4W6XA 2JG8A 4CDWA 2W08A 3OD4A 2KXLA 1PIV2 4QXHA 1NUKA 3OD0A 1LULA 1SLTA 2XGXA 3I3BA 5C9AA 3AP6A 4Y1UA 2WZR2 2WFF1 1N1YA 4AHZA 5EYYA 3WCRA 1T6GC 4ES8A 5LRRA 1ALYA 3KV4A 1UPIA 4YW6A 2HWC3 3NNMA 4I30A 1W8TA 3FHQA 3A23A 5A7WB 3B02A 5HV0A 5A3OA 2Y6FA 5SV5A 3WG1A 1OF4A 4QPGB 1NY71 1WMXA 5C70A 4L2NA 1Y4WA 2NMOA 3ZSEA 1RUE1 2Q0AA 4K40A 4N7IA 5FZFA 2OUHA 2QTWB 4Z1VA 2CV6A 3C7GA 3HNMA 3OUHA 2VBBA 4L11A 4A42A 4XZUG 1G9AA 2ENRA 4M0NA 2Z42A 4I0BA 4S2HA 5BY5A 5KHGA 2ZMNA 5LRSA 2A6XA 3ZXEA 3BOPA 4QXCA 1H2MA 1XNTA 1WGPA 3TN92 2QQMA 1YQ8A 5F3EA 3WG2A 1X33A 2ORZA 5HI0A 3QD6A 2VVEA 2WWSA 4YGEA 1W6OB 1OF3A 3OEBA 1V6JA 4MX3A 4XHBA 2GNTA 2HWE2 3POBA 4FCAA 2XKOA 4XAAA 1VBD3 3ZXKA 3MLJA 4JZRA 3U4XA 3BODA 3BVCA 2E7QA 2Z4FA 4RHV1 3A22A 2XJVA 2D6NA 3O0VA 1AR61 3PL0A 1SLLA 2ZGOA 2PTMA 1IPKA 2DVGA 3IB3A 4CVUA 1S2EA 2OVUA 3AKRA 4QB2A 5JMCA 5IVFA 3T08A 1CQ9A 4QX2A 5J96B 1DBNA 1N47A 2QZ3A 2TEPA 1YQ6A 4K21A 2HWD3 2I74A 5FLHA 4XACA 3VBSC 2B7YA 1UIKA 5IVEA 1YCIA 1ZZCA 4IEWA 5F5CA 5FYZA 4QKNA 1FATA 4BYYA 2HLEA 1A8DA 1OURA 2E53A 5FYYA 3QH7A 3ZSLA 3K4AA 1UY3A 2Y6HA 2ADEA 3IDBB 1BLZA 4AVAA 2WLQA 2Y26A 4QT6A 4K20A 2BYVE 2HYXA 2DWRA 1POV0 3WCSA 4YZ4A 4F83A 1ENXA 4BIFA 2ZS6B 3OSDA 4AHXA 3SC7X 3BKZA 4Y3OA 5KXCA 3D82A 1MS9A 4D3WA 5LY2A 3AVRA 2PMWB 1X9TA 3FLPA 4RS5B 5F5IA 3DYMA 2W2IA 1GWLA 3ME2A 4K1ZA 3H8XA 4XZPA 2QUOA 1HB4A 4O9EA 2VH9A 1RVF3 1Z7S1 3D8CA 1JU3A 3POWA 1W9YA 3VBHC 4B29A 3OY8B 3HBKA 2K2SA 4XHXA 1QMJA 4ISRA 1ZBA1 1OPMA 2EIGA 1VRH3 3CZJA 1SQ4A 4AL9A 1LJ7A 2W9XA 5K0UB 1GNHA 1LKNA 2EF6A 3M3QA 4RQPB 2WYFA 2BRTA 1I9RA 3V0AB 1UY2A 1OPOA 1K12A 1VMJA 1W9SA 4IEVA 4JHTA 4UW6A 3MFAA 1REEA 2JIJA 2VAUA 4AHWA 4IGPA 1OOPA 1BEV1 2V4VA 4DOUA 5FZGA 4YLZA 1DCSA 4CCDA 4NHXA 1N3QA 2C4XA 1H2LA 3VZJA 3FMGA 4BQ1A 3MIEA 1O4TA 2CHHA 2V5YA 2XHNA 5FP9A 4XJZA 1POV1 1YJKA 4H14A 3RWNA 3VBOC 1KRIA 2JDYA 2RJKA 1CVNA 3OG2A 3JB4C 2RDRA 2ZX3A 4MVTA 4NUBA 5AC92 2ZEXA 3AL5A 3GZTB 1OHFA 1HKDA 3PJQA 4LBOA 2P5BA 3EXUA 1PVXA 2DFCA 1QJX2 1PM4A 1CIWA 5F6KA 5EXOA 1JYNA 2LM3A 4Q4Y1 3GCWA 4DMIA 3SCGA 2Q8OA 1ND3A 3UGFA 4LA2A 4M3CF 2G9GA 4UYBA 2ZEWA 5IHRA 4Q4V1 2F17A 4PDWA 1GZWB 4MYEA 4XJ8A 3WT3A 4IERA 1XB9A 3ZKYA 2JG8C 3WZ1A 1C3HA 3MYXA 1JH5A 4Y33A 1VPHA 2OQ6A 4Y26A 2VMEA 3MIHA 4N53B 4E2GA 3KWVA 2Y0OA 3CL1A 2JENA 2YBKA 3KHBA 1OLMA 1JBCA 3MW2A 3N9OA 1AVBA 2JB4A 2C26A 2UU8A 4AI3A 4QKFA 2YB7A 4LHKA 4PF1A 3QCWA 5KXBA 3RMXA 5LW9A 4XBLA 4DFSA 4DS0A 5JR2A 4UFKA 1C1LA 1GICA 1AJOA 3E5QA 2ZHKA 4XBNA 1AL0G 3KMHA 4HK9A 3UKVA 4AK3A 4XMAA 3NKGA 5A3NA 2HKXA 4A6SA 4W4ZA 2I2SA 1CAXA 2LROA 2YV8A 1R1A1 1UOBA 3HPNA 2VTXJ 3P3NA 1GZTA 2JE9A 5CIRA 2H6CA 4G4FA 4LK6A 4MXWB 4GB33 1Q3EA 1Y9QA 3DCQA 4JQTA 4L92A 3MZHA 1MEC3 3GHMA 4RS5C 1ND2B 1MS8A 2BERA 4AQSA 1EV13 5FZ7A 1Y9GA 3WQBA 2VXRA 2PHXA 1RUG3 2IXIA 1E57A 1WW4A 2XVLA 2VTFA 3BPSA 3FUQA 3PDQA 4L97A 4UW3A 5DDJ3 5C5UA 2C24A 5EPAA 1UXZA 1OQ1A 3UETA 1TG7A 2JB8A 5FTTC 1BZWA 1ASJ1 4FPYA 5IVBA 2P3KA 5DQ0A 4NIAA 1SFNA 2D6PA 2RS13 4ORFA 4BDVB 3MIGA 5FY5A 2RMU1 2NLRA 3OB8A 3PVOA 4JAAA 3B01A 4ZS2A 4BQ2A 5L7OB 3I2DA 2Q8CA 4BQ3A 1KQRA 3MIDA 3E6BA 4NN0A 3AXEA 5K0UC 2NM1A 4BQWA 1AR81 2XL9A 4XXAA 3PNAA 4FOYA 4UFMA 1QKQA 4NVPA 4FPGA 4WVMA 3U0ZA 4QHOA 3DYOA 4R9DA 4EQVA 5CG8A 2BGPA 3LPGA 2PHUA 2WFF3 3NNLA 5FDBA 1OMIA 1ZNPA 1LECA 1PK6B 2IZWA 2WT0A 4PHZA 3T2TA 1XNKA 1WUVA 2VZQA 4X6QB 4FPLA 3A4UA 5FOJB 2V5DA 3NNFA 2WQZC 4HPKA 3PVBB 5EYXA 2VW2A 2VU9A 3M3OA 5DG1A 4CUBA 4M3CA 2HWC2 3CHXA 2NZ9A 1AR72 3EHKA 4KQ7A 5IJRA 3ZXGA 5APAA 2FDGA 4XCAA 4IV1A 3ES4A 3T0AA 4CEWB 3B93A 1RUE3 3VHNA 1DQ6A 4TLFA 3JQXA 4IE5A 1WCUA 3AMPA 3LEMA 3N7KA 3N9NA 4GMP0 3VBRB 4BPZA 3HMYA 1CAXB 3JD71 4AVCA 1FMD1 4XUTA 3ECQA 4MGIE 1W6NB 1ULOA 1WMDA 3OGSA 1AX1A 4HVOA 3LPFA 4TLGA 4XDPA 2BOIA 3B94A 1CZTA 3ZXLA 1AUYA 4N53C 4QAWA 5C33A 5FUIA 3OPWA 5IVCA 5I8SA 1YWKA 4YW7A 4BE3A 3HD8B 4GWJA 1H4GA 2ZAAA 2WABA 3EBRA 4HETA 5BNPA 5CAZA 4AQTA 1RUD2 4OHWA 3KT1A 1BMV2 5ANNA 2F4PA 4RHV3 1YC61 4XF3A 2RS51 3RRDA 2VCCA 4XUOA 4MG2A 2ZXQA 4Q4X1 1AR63 4X6RB 1QHDA 3NV1A 3ZSKA 3NNGA 2VUJA 1ACCA 4YARA 5FO9B 2D98A 4C0BA 2XH6A 3J8F1 4PI2A 5CFDB 2VNGA 3WQ0A 2QKDA 1ND2C 1C28A 2V4AA 4JVAA 4YG3A 1S0IA 1AYN1 2JG9A 3O0WA 3ZLIA 5IVVA 2VMHA 4GMP1 5D2AA 2PN5A 3WHTA 2CGNA 4CYDA 5LZ6A 5T55A 3INAA 1V6NA 1WMEA 4R9CA 1GBGA 3ZYBA 3BPZA 1SEFA 5B4XA 5F6LB 2CAUA 3GNEA 2D6OX 3WDUA 2Y8KA 2X8KA 3PUHA 5C3SA 2QQOA 1QF3A 4DRVA 3W5MA 1Q43A 4NROA 4XDQA 3UK9A 3ZN4A 4CDXB 2XB6C 2WS92 3PIJA 5C8CA 3CNAA 4NE9A 1ND3C 4A3XA 3URFA 3ETPA 1VAVA 4Z2WA 2ZZQA 4PBOA 4H3WA 1XU1A 4AEKA 4JKKA 4Y22A 3D5OA 4WM8A 3ACGA 2H0VA 4PDWC 2BGCA 3QH6A 3WW3A 4CP9A 1PK6C 1Z7S3 5TSWA 3NL1A 2AH2A 2ZGMA 3H7YA 3JUUA 4LEJA 1HV1A 3K46A 5FXVA 3B9CA 3WX5A 1YQ2A 4JQRA 2VOWA 3WP6A 4AW7A 2BWAA 1ZBA3 2WIIB 3MPPG 2AGSA 4RGGA 3ZPYA 3UV9A 3FN9A 3VBFC 2B42B 4ZS3A 1JYXA 2WT1A 3HN3A 2ZTNA 5JZGA 4D69A 3JU9A 4B1MA 1MZEA 4AAPA 1KXGA 2GH2A 2WA4A 2E26A 4DB5A 4XFHA 5C4WA 4DRRA 2DCKA 5A33A 3VBRC 1QDCA 3G7DA 3VKFC 3VBUA 5IT6A 3D0SA 1JXNA 1ZBE1 5FK7A 4QD2A 4CP2A 1LGBA 3KT4A 4DEVA 4NRQA 1PMHX 3O5SA 1K5MA 4Q4W1 1POV3 2EXKA 2OA2A 4XTPA 5F9TA 4BU2A 2R042 4ZZ5A 2A6ZA 1G86A 1CZVA 1WCQA 5EHDA 5LA1A 2NPIA 4QGMA 2YUEA 3C7EA 3ZM8A 3ZYGA 2GZWA 1OA4A 5A6ZA 4FQ4A 5LASA 5GLUA 1S0EA 4Q4Y3 4UBHA 1BJQA 4NPLA 4D6SA 2OW4A 3BYWA 3LSDA 1RTVA 4NOTA 1ZZ9A 1F4AA 4N43A 2D3SA 3NQHA 4Q4V3 1W28A 2RJLA 4IDZA 1LOCA 2QJVA 5FMOS 4QDQA 2R30A 3UL2A 1DQ5A 5DAXA 4Q0QA 2WQ4A 4XFAA 3M2MA 1GP5A 4WVZA 4XQWA 4Y20A 5CB7A 5GKAC 1JOJA 4OHVA 1ULGA 2WT2A 4NHYA 5F8PA 1ONAA 1BVVA 1BBT2 4QDSA 3LDKA 5CFDC 4FFHA 4IUGA 5KHIA 5FZOB 5T5OA 4FTEA 5A1AA 4CXYA 4OHYA 1PZ8A 4TZDA 4CCCA 2HBTA 5FLJA 4JV4A 5HBAA 1E5SA 4YFWA 3AFGA 1SDWA 4YW1A 3E97A 2BVBA 1PNFA 3O0XA 4BIOA 4BLIA 1TZOA 1LU2A 3VZMA 5L9RA 5I8YA 2VNRA 1WW5A 1R1A3 1VJ2A 1XC6A 3WOGA 1B35B 3KGLA 3LA3A 5BNOB 1CPMA 4AEMA 3CO2A 1YFWA 4RSUA 1YFUA 2Y64A 3IMMA 4YGCA 2BBAA 3RZKA 4PBPA 3WW4A 5T52A 4XQ4A 2GC2A 1LHVA 1ULCA 3WP5A 5FQ0B 4AEDB 4QQOA 1CJDA 1W90A 2WL1A 4GQ7A 4LBMA 1LAJA 3RZJA 1JZ6A 1DU3D 2B5HA 2XVGA 1ASJ3 1HIXA 2ET7A 4IGOA 4AFMA 3VDDA 2ZGTA 1D0HA 1SHWB 1HXS1 2D93A 2ID4A 3WXPA 5I0SA 1EP0A 4JHZA 5J48A 1QEXA 2RMU3 2RS12 1ST8A 1QIQA 3E6DA 1HN1A 5IVJA 1QJY1 3I97A 2IXHA 1DGWA 1AR83 4ZU7A 5BNPC 4GWMA 4CPBA 2FD8A 3OJBA 3RMYA 4YZ3A 1QNWA 1G8WA 4IV3A 1RUNA 2XBO1 4ATFA 3AYEA 2WFF2 5IK5A 3PMSA 3AP4A 4LUMA 3LFIA 1VR3A 2G9ZA 2GN3A 4MXVA 5FZDA 4O65A 1O3QA 4QPYA 5IW0A 1GU3A 1UYYA 3CJIB 4ZONA 5FMOL 3UJQA 1REDA 5JDBA 2DV9A 3K77A 1BHGA 2ZGKA 4HSJA 4Y5Z0 5FWEA 4FPFA 1TME1 2AENA 5HCHA 2EAAA 1NY72 2Q1ZB 2W0XA 2DVDA 2Q8DA 1UMIA 1WBLA 1RUE2 3GHNA 1JZ2A 3U75A 1X50A 4IL7A 3SHRA 3AYDA 3JD73 3SKJE 1FMD3 2HWD1 4A2UA 1XNAA 1W0PA 2JEMA 1LOGA 2QNKA 3P6BA 1WZXA 5EFUA 1COV1 4URAA 4ZHNA 3POEA 1UCXA 2DF7A 5FYMA 5FPXA 4COZA 1FNZA 2WA3A 5FXXA 3WNKA 5FV3A 3FFQA 1MS5A 4MHRA 3J9SA 2EA7A 5J98B 4RYDA 4LKDA 4MSVA 4DY3A 4K8FA 1HQLA 1W2UA 1PVC2 2XL7A 3BALA 3FZ3A 2WINB 3IDCB 4FT8A 1UMZA 1F2NA 1JOBA 4LXLA 2RS53 1R081 1KEXA 1MVQA 2JD9A 1N1SA 3GZUC 4LPLA 4RHV2 4Y5TA 4Q4X3 1A78A 3M7AA 4XIOA 5A32B 2EAKA 1ENQA 2UWBA 1O91A 1T6BX 5A3UA 5JZGC 2NN8A 3AYCA 4NHLA 2HEWF 4H55A 3THDA 2XLAA 5BNOC 1S0GA 1WCKA 3CKHA 3J8F3 1W0OA 2PAMA 3M3EA 3H1YA 1AYN3 5CEHA 4AEDC 1QXJA 4E2QA 2GC0A 3ZYFA 4GMP3 3NAPA 2X5IB 2XLFA 4UOJA 5A6XA 3I8TA 5DUUA 4COYA 2FDFA 1XQNA 1K5MC 4BK4A 3GXUA 4HG6B 1QH6A 1QOOA 2MEV2 1U5YA 1ZRIA 4KU8A 1F8VA 4FBFA 2JDKA 4YFZA 1O3RA 4YW4A 3AVSA 4XBQA 3ZIXA 1AHSA 5G04L 1CAUA 2VQAA 3VBSA 2W47A 5FYUA 2QQNA 2X09A 2XG3A 1W2TA 3T3YA 1NCRA 2YROA 4TXWA 2QQUA 1XYPA 3N3HA 4NIIA 3RSJA 2WN2A 5G05L 1Q8VA 3KCCA 4PIZA 2VQ0A 3WV6A 4QQPA 3I59B 4B7KA 4IE6A 5A80A 1L3JA 3DN7A 4NPRA 4DQAA 1Z7S2 2G19A 5JSPA 2IC1A 1FI2A 3A7QA 4BQ5A 1VBA1 2VNVA 1ZBA2 1JZ7A 3B3QE 3L2YA 3MV11 3VL9A 4FFGA 2ZHMA 1C5HA 4FP3A 3RFRA 4FOWA 2EALA 1BXHA 2Y6LA 3X29B 3I2IA 1NLSA 2ZEYA 2E33A 5B4NA 5JVVA 3MBWA 4EWEA 2HWF1 2Q30A 5ACA1 1UD1A 2BNOA 2AREA 2YC4A 4QMAA 4XE9A 2BBVA 2V73A 3PVNA 5DG2A 1I6XA 1BEV2 1W6MB 3ZSMA 1DZQA 1ZBE3 2VC9A 1CJPA 5A7WA 3GYDA 1MVEA 1NX9A 1UU4A 4Q4W3 2IFRA 1RUC1 2CWMA 2J1VA 5FR3A 2WKKA 2A6VA 1DG6A 1H6XA 2VMCA 4K1YA 1QY4A 4QPGA 3VZOA 2PQSA 2FQPA 1W06A 2ZJCA 3RZMA 5AVAA 3JCIA 1JW6A 4YVWB 3GBGA 4GIQA 1F9KA 1OUSA 1WLCA 2GP5A 2K0GA 5FKBA 1W8NA 1SCRA 2A70A 4Q4Y2 4FOQA 2PELA 4IE0A 3ACFA 4FPJA 2E63A 5LATA 4LOTA 3AJZA 3LE0A 4UAPA 1MEC1 4Q4V2 3VDBA 4MGYE 4XEZA 1MR5A 3T30A 2J1EA 3O1PA 3AMHA 5LWBA 2ZGPA 3DEMA 3MF9A 2DVFA 2O8QA 3G6JB 3OUJA 1ZA4A 4I0WB 1GMMA 2YBSA 3N7JA 4CEYB 3VUOA 2E32A 5LK7B 4PIXA 4XJ9A 4EE2A 1SLCA 3IIIA 1DFQA 4IV3C 4Q1RA 1LODA 1JHNA 4E4SA 2WAAA 1ZA7A 1GSLA 3WNXA 2GDFA 3NJYA 1W8UA 1JUHA 2GMPA 5BNNB 1KFXL 5FY4A 2WQ8A 2YHJA 4FXGB 5FBJA 3FBYA 3W5NA 4A4AA 1UAIA 1EY2A 2GNBA 2XWBB 3AXDA 2QFEA 3IMNA 4J6GA 1ULDA 3LEKA 5BUVA 3K48A 3OCPA 1B09A 2A71A 3FHIB 4QX8A 4FPHA 3L9JT 2FCUA 3IDEA 5FZ9A 4RN5A 1NOVA 3V65A 1R1A2 4AXOA 3FFZA 2EICA 4YSFA 1NKGA 5C7GA 2D97A 3AMQA 5LBEA 4PLOA 3HT1A 1R64A 4P9IA 5BNQA 5DXDA 1OFSA 4WZFA 2A7AA 4GWIA 4FPKA 5C8WA 1WA4A 3D6EA 4FQZA 5FY0A 1CAVB 3TBDA 4GULA 3NWKA 1S55A 3AM2A 4NRPA 2IWGB 1URXA 1HXS3 1ASJ2 4YG6A 4LIUA 2JDMA 4COWA 3VN4A 2W39A 1ODNA 2DFBA 5E6HA 3ZXDA 3NMBA 4NMIA 2RMU2 2NYYA 1O8PA 1QXRA 1Y3TA 4RS5A 5GLWA 3PUAA 2D5HA 1QJY3 1VMHA 1W05A 1K42A 4LOSA 5L9BA 2A1XA 3RYRA 1DZRA 2FDKA 4LA3A 2GN7A 3MPBA 1OXCA 1UYZA 1TNRA 4E9KA 3GZEA 4XYXA 2XBO3 4FFIA 3OY8A 5J1XA 4DXSA 4BXSV 3JXSA 2C9KA 4BXFA 3LIHA 1E5RA 1RMU1 3HBZA 5A7QA 5GLVA 1TMF1 4B3NA 3QBQA 5K0UA 5HCFA 2R0HA 4PJYA 2YG0A 3F2ZA 4RQPA 3V0AA 1NG0A 3H7JA 2Y34A 4YNIA 2WWUA 1TME3 3HWJA 4OCTA 4FTBA 2XDVA 1GR3A 1NCQB 3NAPC 4Y24A 3VBFB 4CCNA 2CY6A 2YYOA 4YVWC 3O1TA 1NAEA 1GANA 5LEKA 1LU1A 1E5HA 2DCTA 1UKGA 3I49A 4LBJA 3THCA 1U5XA 1SFPA 4PLNA 3DECA 1UZWA 4LO8A 3JD72 3RVHA 3B5LB 5C3PA 1FMD2 3V64A 3R4UA 1CX4A 1WW7A 3WNOA 1NCRC 3B00A 4EYUA 3BB6A 1COV3 3T2OA 1YQ5A 4LBQB 3HAGA 1JTZX 1SG3A 4KMQA 4CEYC 4LMFA 1G9CA 3WDWA 3BU0A 1DP0A 1C1FA 4LIVA 4K9SA 2ZX4A 1JN2P 2CDPA 1R092 3ILRA 1M4WA 2RDSA 2Z2SB 4QKDA 4DXRA 2DUQA 2RM23 2UWCA 2YMZA 5KC5A 1JODA 2VW0A 1GZWA 4CDQB 2YBPA 1UNBA 5BNNC 3OEAA 2LS6A 3HNYM 1OFNA 1R083 1ZZ8A 1DQ0A 2UYAA 2VPVA 4YM3A 2RS52 3AMMA 3KV6A 4CSWA 3K3OA 4N53A 1OD3A 3KD4A 4Q1PA 2RDNA 2QVSB 4OI0A 2W1SA 3SEEA 1C8NA 1F35A 2A73B 5I93A 1UY1A 4E2SA 4CCJA 1IKPA 4W6WA 1UZ0A 3J8F2 5JAXA 3J7HA 2C0ZA 2VG9A 3E5UA 3GJBA 5H9PA 1AYN2 1VBC1 4BH9A 2EXIA 2VE1A 1X8MA 2GAUA 1M06G 1FPN1 4YZ1A 3OF1A 4RA0A 1H2KA 4QPGC 5IWFA 1WD4A 1UU6A 4JKLA 3VHRA 3NRUA 4MXWA 1UZZA 5FK8A 1RUF1 2PHRA 3ZR5A 1IHMA 1ND2A 4JCKA 5FPUA 3MDPA 4YVSB 1UX6A 3LF7A 1AXZA 4HANA 4PQQA 2XJPA 1DZTA 1SPPA 1TEIA 3OTFA 1YQCA 5HXVA 4F8AA 5C3OA 5FMDA 3L2HA 1RL3A 2WAOA 2R1BA 5BPXA 5FP7A 2VZVA 5GLZA 3DYPA 3LQCA 3RJ2X 3LZZA 4MGZE 5L7OA 2JE7A 1D0GA 3KVAA 3U4SA 1J84A 2IUWA 4U2AA 1BK1A 1VBA3 4AI9A 2YGLA 2XLGA 4S2GA 4XPVA 3BTZA 1OUXA 3ZYHA 5L36A 3VD9A 4K8RB 1SBEA 3V0BB 4HN0A 1QJEA 5EQUA 3OOXA 3VB9A 3VLBB 4DIQA 5JI9A 1PNGA 1NCQC 3KV9A 3MLLA 3CDZB 4M4RA 1PK6A 1AYM1 1LOAA 4M0HA 1W6QB 2HWF3 3CU7A 4XC9A 1HB3A 2GC3A 3RI8A 5ACA3 4DXTA 2VR4A 1JYCA 1YFXA 2D43A 3DV8A 3LA7A 5A7NA 1STMA 3OGVA 5DUVA 1O4ZA 1HN0A 5FRAA 2WBKA 3CIHA 2IXKA 4XJUA 4CUGA 4LHSA 5FYCA 4V1PA 4AI8A 1RUC3 2K46A 3KQ4B 3TNQA 3CZUA 2Q4SA 5BV6A 5M0TA 4CEWA 5JWPA 4IEPA 1AX0A 5A3LA 1JUIA 2P2KA 4DNYA 2Y6JA 3WR0A 2OQ7A 4KNCA 4S2FA 3LWCA 3NVCA 3VBRA 1JYTA 3M1HA 4KGQA 2DBNA 2VMGA 4FPOB 2TUNA 4NIGA 5FZ4A 2HYKA 3JBG1 2VVDA 2BFUS 1VBB2 4E8CA 2KA3A 4YW3A 1W6NA 5CADA 3FLTA 4PF5A 4QXKA 5GZFA 1XNCA 1L7LA 3O1UA 2YZ4A 2ERFA 3NKTA 2HWB3 3TRSB 3RYPA 1DIWA 1IOAA 3TEZA 1SPPB 5K9YA 5H9QA 3PUSA 4HONA 4AVSA 4D6RA 4Z92B 2BZDA 1NXD1 4PT6A 4JTOA 4AGGA 2W46A 2BU9A 4FOVA 2NMNA 5FYTA 3Q8BA 1QQP1 1WKYA 4WBBA 5FZIA 2WYSA 4KWLA 2PLV1 3W20A 4TWTA 4MOAA 3B69A 3K4ZA 1J1TA 1VP6A 1VBE1 4RQPC 1W6PB 5FO8B 1RB8G 3NW4A 3AP5A 3KGZA 4XUPA 2R16A 3ZFFB 1ULFA 4GXLA 5CFDA 4HKOA 5B2GB 2AUYA 4ZU5A 2FMDA 3S7EA 4XF0A 2A5ZA 3LD8A 5J7MA 5L73A 1OVSA 2P37A 5I0RA 2L9LA 1W3VA 5FBZA 2DCZA 1H2NA 3AP7A 3N9QA 4GH4B 4AVVA 2XJTA 3DF0A 5I0TA 1GWKA 3ZN6B 3MI8A 1KDKA 2BQPA 4WM7B 5C71A 4LLOA 1H1MA 4JDMA 4SLIA 3H8UA 1Q8SA 3Q8EA 3N7MA 4G3YC 4N90A 1C5IA 3DPRB 4CCOA 1HXS2 4CDXA 4OZXA 1GZ9A 4DEQA 3ZYJB 1DGRN 2QQWA 3SMHA 3S5AA 4BISA 3ZVXA 4R52A 3E6CC 3S57A 5KR7A 2HWE1 1AXKA 1QJY2 1RINA 2WR9A 2YGMA 4YM1A 1US2A 1PGL1 2OYZA 2KD7A 1DLLA 4BM8A 5FREA 4AGRA 4JKMA 4CU6A 5FPZA 1XJAA 3I2KA 4CP1A 5KXEA 3FBMA 2XBO2 1RMU3 2Z79A 4CE8A 2BFUL 1SBDA 2VULA 1TMF3 1W8OA 4I09A 3SNMA 1X82A 1FOD1 1XSRA 2GMMA 4MHUA 5FZ6A 1FYUA 1IZ3A 4HVRA 2HEYF 1RUI1 2RV9A 3WINE 3WQ1A 4ASLA 2BVVA 2LTNA 4H2AA 1VBD2 3ZYPA 4CZSA 4EZ4A 3MEPA 3R4DB 1GP4A 3KCYA 4AI1A 1TME2 3K4DA 1MACA 3ZFGB 4L99A 1O3SA 2J1TA 5FZKA 4LNVA 4CCEA 2ZACA 4WVWA 4OULA 1LNSA 2PHFA 2RS31 5FYVA 1YO8A 1LGNA 4E4HA 1NLQA 1KITA 2HWD2 2ZGRA 5IYYA 4XJWA 3PTYA 3VKMA 1WLWA 3PURA 4LORA 4FP2A 4Y1XA 2WO2A 5A7SA 1COV2 2QQPA 3WW1A 3E1F1 3WLUA 3WDTA 1RHI1 4MGKE 4RR3B 3ON7A 2W68A 5A6QA 2XUMA 3LOBA 3O1VA 3O7OA 3KLSA 3I3MA 2VOVA 2WNVB 3H8OA 5L7OC 4LE3A 1XE8A 3J26N 4JGZB 1KGYA 4IQPA 5F3GA 5CYYA 2IVIB 3PU8A 4XF4A 1A3KA 1S1AA 4XFGA 3WF1A 5CU1A 4V2WA 3SQOA 2EXJA 1R082 1V00A 1U5IA 1UX7A 5CISA 5FZAA 1DGLA 2HJIA 4CCKA 2BJSA 1C8M1 3ZFFC 3M4FA 1QWRA 4ZXEA 4B4RA 5FZOA 4FXKB 5T3NA 2P1BA 1RVF2 4KBBA 1YIFA 4GJZA 3ZSJA 2C6SA 3K3NA 5HV4A 4NO4A 2RR11 4GH4C 1MS1A 2B39A 2WRAA 4JTNA 5F3IA 1VBC3 4RFT0 4XUNA 3N4MA 1VRH2 2YXSA 4BHPA 1AR91 4KBZA 1FPN3 1ZREA 4Q29A 1ZYBA 4RD7A 3WDVA 3KHCA 1RITA 2VTXA 2V09A 2JICA 5F39A 4CEWC 1B35A 3DPRC 3HJRA 2AEYA 3IM0A 5BNOA 5JIAA 4QPIB 3LAGA 5DN2A 1RUF3 2P3JA 3OBRA 1PO21 2ZX1A 2VBDA 4CTEA 2VCAA 5FYHA 2BWCA 4AEDA 5FQ0A 3AFKA 3LEIA 1X36A 4QB6A 4FTSA 3C3VA 2R071 3CBNA 1W99A 2ATFA 2OXBA 4GWNA 4NHKA 1K45A 2FZ1A 4M4PA 2WLPA 4IEXA 1IQAA 1W0NA 2ZAHA 4I3PA 2GC1A 1HQNA 1REFA 3MICA 4LQRA 3UKNA 5F7UA 1OQDA 4CXWA 2YFZA 5CFCB 2BTVC 1QJFA 1LOEA 1OBNA 1GQHA 3H50A 2DU1A 2ZGNA 3DUIA 4C8DA 5A70A 3T1LA 1H30A 1HV0A 3RZGA 1MS0A 2WZPP 4D94A 3O12A 4CUCA 2DBIA 2R061 1AYM3 2XJQA 2FCTA 2WNUB 3AMNA 3HNBM 2WDBA 3OYWB 3ZFGC 4QHZA 4AG4A 2VW1A 1D4M1 4XTMA 5K7PA 5ACA2 1AJKA 4R8HA 5FZEA 1DQ2A 2V72A 4HBNA 3ZKUA 1KJLA 1S2KA 2WSVA 3CJIA 4JDNA 3AKSA 3VKOA 1Q8PA 4AWDA 5E1RA 3ILNA 4B4PA 4Q0SA 1ZVFA 4TSVA 1W2AX 5CKNA 4COUA 1RUC2 3T09A 3U11A 4YZ2A 1VIWB 4Y1YA 4AF9A 5A3TA 2ZGLA 4JGYB 4Q0UA 3K2OA 4YGDA 3T4VA 2D6LX 2I07B 1KJRA 2VZTA 2ZCWA 2MNGA 3BGAA 4RR3C 5FY8A 2VECA 3T1MA 2OZJA 2HEVF 2ILMA 4A7KA 5A1FA 3BCWA 3JBG3 4UT5A 3KT7A 4DZGA 1RC6A 2WNVC 5AVPA 1X9PA 4CDXC 5ABJB 1RUJ1 3IPVB 3OGRA 2QBXA 4AI2A 2VUAA 2W87A 5F32A 4KU7A 2EIDA 1QXPA 2GALA 4OYUA 1GOHA 1Q56A 4GB32 1C4RA 1MEC2 4DUVA 3NV2A 1EV12 1GUIA 1OKOA 1RUG2 3WNNA 3IZOA 3DKQA 5DDJ2 1ENSA 1IG3A 1GQGA 2FDHA 2JD4A 5GZEA 3U37A 4QQLA 4NPMA 5D1IA 5KBFA 2RDQA 1MZ6A 4ZKTB 1QQP3 2P17A 2P34A 2R32A 2RG4A 3E5XA 1RUOA 3MUY1 5FPLA 1NYWA 2PLV3 4XF9A 4BQ4A 4DXZA 5A32A 4QQHA 3EB7A 4IE4A 1VBE3 1W8HA 2XJRA 3TOJA 2Q1FA 3A0NA 1MZFA 2PHTA 4E4ZA 2JE8A 3VKLA 1FX5A 4QPIC 1AR71 2ZMLA 4LO6B 1OA3A 1JHJA 4LK7A 4P00B 2BDRA 1YFYA 4XURA 3MHZA 5L19A 3ACHA 1O5LA 2Y60A 1LOFA 2ZHLA 4QPWA 5I8TA 4KWJA 2X5IA 3UT0A 4OZOA 1FT9A 1ZRDA 3FC0A 5DAPA 4OLLA 1Z0HA 4I0AA 2WO3A 2R6QA 3LSEA 5JOWA 1YLLA 5HXMA 5FPVA 1WA6X 5DAWA 4Z2AA 3O14A 2FDIA 2JDHA 2JDAA 1AL21 1GFF2 5DPNA 2JWPA 3DL3A 5GZCA 2A3WA 1UYXA 4R4ZA 4ISQA 3SH5A 4AQ6A 1J59A 1QJZA 2VZRA 3GBWA 4UBGA 1DYPA 2HWE3 1BVP1 1UW8A 3N36A 4JDOA 3I59A 1PMIA 4JRAA 4WZCA 1CZSA 1PGW1 1UOFA 3ZFEB 2X29A 5DAQA 2P6CA 5GLTA 1UMHA 1RUD1 3PMEA 4IEUA 3VKNA 4CU7A 4JC1A 2OKXA 3ENRA 3UNPA 5A6YA 3M70A 4XETA 4CDUB 1RMU2 2O14A 1Q8OA 1FOD3 2RM21 3RS6A 4ES9A 4ZY9A 1TMF2 1RUI3 1ENRA 2AR6A 4XVHA 2VO5A 1UOJA 4LBLA 1FXZA 1F15A 3GALA 4GD4A 3MUZ1 2YU1A 4JGYC 1VB4A 1DF0A 1JI6A 3NSTA 4ZZ8A 3DGTA 4EZHA 5F3CA 2FMYA 1DLCA 1W6MA 2ETEA 1AR62 3IT8A 4ZPIA 3PHMA 3AJYA 1B35C 1RUH1 2P4EA 4PCRA 2RS33 2F4LA 3J7LA 4NJ4A 5JI7A 4O9GA 1H6YA 5ABJC 1JZ5A 3PUQA 2J1SA 4XF1A 2EIBA 1VAKA 5E88A 1KDMA 1N1VA 4J1WA 1YRZA 3QLQA 3W21A 2JX9A 1A6CA 4XIKA 4Q0PA 4P9WA 2WS91 1FV3A 4YVWA 1XNBA 4I02A 3KZ4C 1JS9A 4UFLA 1RHI3 1W9FA 3TB0A 3U07A 2N7GA 3EQEA 2DUPA 5J36A 2BUKA 2I45A 1I5PA 2MHFA 2FHRA 2VZSA 3WP4A 1W2OA 3U1XA 1H0BA 1VB2A 1SACA 4CEYA 4M01A 1V6IA 1W39A 3HOBA 4EROA 1F5JA 2NQYA 3N9MA 3I7DA 2VZPA 4XILA 1C8M3 1EUUA 2JKXA 1T2XA 1I3HA 1O6UA 3VV1A 3WW2A 3OPZA 1ZRCA 1L7QA 4O7XA 4N9IA 1CAWB 2D5FA 4IEOA 4UFIA 4Q5OA 3OPTA 2GH8A 3H1WA 1D2SA 1V6KA 1WCDJ 5BNNA 2JDUA 2ARXA 2RR13 5JOZA 4HKWA 2WUHA 1YEWA 3CJIC 3GM8A 2X05A 3ZXAC 4A6OA 3ALQA 3IKWA 1AR93 2KR2A 1VBC2 4TN7A 5FPBA 4HVQA 4MADA 3ZDSA 1FPN2 2QDNA 3OGJA 2RVAA 5DAVA 3W58A 3ZOIA 3POYA 3S0MA 3C7FA 3KVBA 4XOGA 5JOXA 2R041 3S30A 4CCMA 1XPWA 4F7ZA 1PO23 3DXTA 2TNFA 1LEDA 2O8OA 1BCXA 1RUF2 5ANQA 1S2BA 3KB5A 5GJ6A 1CPNA 2K9ZA 4UFJA 2R073 5SV8A 5HPOA 1XXNA 5IFTA 1CAVA 1HB1A 1W8ZA 3U78A 3AKTA 3WVJA 5FZLA 5LA9A 3I2GA 2PQQA 3IAQA 4OMDA 5T50A 2GU9A 4P9YA 3RDIA 1XNDA 2QDRA 4CU9A 4ATEA 3K75B 4OI1A 2WZEA 4YYOA 4MH0E 4CDUC 2CYFA 2WZ8A 4WV8A 1NZIA 1V9U1 2YPJA 1ZZBA 5K8SA 5FIXA 1F31A 2IXCA 3R05A 3WY6A 2UURA 1LENA 1PMJX 5DZFA 3FX3A 2W94A 4GZ9A 3UYJA 4QKBA 2VOTA 4UF0B 1BBT1 3LGRA 4HK8A 2OT7A 3ZMOA 2ZPXA 1D4VB 2R063 1HRI1 1OKQA 2XWJB 2BEOA 2ES3A 2CDOA 2HWB1 5C3QA 1AYM2 1D4M3 4DUXA 3SXWA 1MS4A 1NZCA 3MFCA 2Q5TA 5A7PA 1JYVA 2JDZA 1W04A 5A3MA 4B8EA 1F4HA 1UPSA 3H3LA 3USUB 3H9AA 4L9BA 1HB2A 3BTAA 3U14A 4A3ZA 2GSYA 1LOFC 1NCQA 1EAH1 1GNYA 2X5IC 4OUMA 3VBFA 4DO0A 5DZGA 5BYNA 4MUVA 5C3RA 3RZLA 2PHWA 3MIBA 5FY7A 1PO11 5JCTA 1CIYA 4U36A 4IESA 2ZGQA 4K6BA 3JBG2 1RUJ3 3RPQA 4HOOA 2X10A 4HFSA 3JQWA 4LBQA 5F2WA 5JXHA 2Y6KA 3J7NA 3GCXA 3C2UA 5EV7A 4EN0A 3ZYRA 4FSJA 1CR7A 3RWKX 5F5QA 1WBFA 2QQKA 4PI0A 4QM9A 1SFYA 2VOKA 3RJRA 1YJLA 4LUKA 4KWUA 2GNMA 5LB6A 1H9WA 4CDQA 3N35A 1NLRA 2BP6A 3NNJA 5AFEA 3BUCA 3H1MA 3R0RA 1JYIA 3PUIA 5E16A 3RGBA 2DURA 2XQRA 5FZ3A 4DY5A 1OVPA 4Q8KA 1QQP2 4XDOA 2XPJA 4YG0A 1BKZA 3POGA 1MQTB 1GWMA 3KM5A 2F6BA 2PLV2 4BOWA 1G9DA 3VBHB 4NR1A 1J3PA 5JLVA 2D3RA 2G9FA 1AR82 1VBE2 2XJUA 1IKQA 1HLCA 1QDOA 5T54A 3VZKA 4FVVA 1AR73 3WF2A 4OI4A 3C7OA 4N9HA 2XQXA 3USSA 4L0PA 1GKBA 4C90A 4TTGA 2B9VA 5JPNB 1JYWA 1IG0A 2LUWA 1E5IA 2IXLA 4OUEA 3ST7A 1UWWA 2W1WA 5C6CA 1TE1B 5F5AA 1F5FA 4M00A 2AACA 1IGOA 4BQYA 4Z8BA 2ZABA 5C5TA 2IXJA 1NA1B 3ASIA 4QHBA 4XABA 3WDYA 5GZGA 1U0AA 2CU5A 2OIIA 2VUCA 3KSCA 3CF6E 4AI0A 4HL0A 1VE0A 4RGAA 1AL23 2C9AA 1NXMA 2VCBA 5FPAA 3Q8CA 1PZ7A 3VBOB 2RHPA 4YVSA 1XSQA 1MZ5A 2CSGA 4XJAA 2VD7A 1TQ5A 2DTYA 5D8AB 3I4IA 1DDLA 2B8MA 4KG0A 5GZDA 2VMFA 3ILFA 2EXHA 2VZOA 2AEZA 3H3ZA 1DYOA 1RXGA 1YYNA 3FHAA 3OBTA 4LITA 4HT1T 3SH3A 5IAXA 1PGL2 3RYKA 4BK5A 1KS5A 1PVC1 2ZX0A 1KD7A 1RUD3 4CA9A 1UOGA 1XE7A 5I0UA 2O0OA 3IN9A 4O61A 3WNLA 1S4CA 5KWRA 3T0DA 2R7EB 1GV9A 4KI5M 4CDWB 2JG8B 1V0AA 3V0BA 2WSUA 4COVA 3WDXA 1FOD2 2PHDA 4LBNA 4XUQA 3RQ0A 1RUI2 2E9QA 5C9AB 3AK0A 4ITCA 1NQDA 1W6QA 4OHZA 2CL2A 4QX1A 2W92A 1ZZ6A 4HKLA 3VL8A 1AF9A 1XYOA 4N7UA 4Q4X2 3I3DA 1H8VA 1RUH3 1G9FA 2BNMA 1UYPA 2XKPA 3BI3A 2JDPA 1H8TA 2MEV1 3MIFA 4LT5A 2VNOA 5FZCA 4R9BA 2RS32 1CN1A 2Y38A 1FNYA 3PU3A 1N3PA 1HQWA 3I2HA 3MLKA 4MGQA 4KWKA 1AZDA 2O1QA 1VLNA 2WS93 1W2NA 2WC2A 4OQ9A 1XYNA 2WO1A 2ZKNA 2IVJA 5E89A 1JOPA 3ZXJA 4XW3A 1V6MA 3J7MA 1RHI2 4W65A 4EN7B 1QJU1 4QX7A 5FMCA 3VD3A 3CJXA 3WG4A 4QU1A 5FXWA 1RYYA 1S0FA 1YI9A 2D40A 2BPA2 3EO6A 1MQTC 3PTRB 1PZ9A 4EV0A 2XHKA 3AKPA 1ULEA 2VVFA 4KH9A 2XONA 3P3PA 3ES1A 4Z82A 1C8M2 1HRV1 2BOJA 5E8AA 2XOMA 3EYPA 4HZFA 5JIUA 2JDNA 3LDBA 3A21A 3NJVA 1WLDA 3TEWA 2B9UA 1QU0A 2A75A 2OPKA 2RR12 3BTYA 2X53S 1NA1C 1W6PA 4H7LA 3UJOA 1J58A 1AR92 1I5ZA 4RL7A 1SZBA 3LCPA 2E7AA 3ZFFA 2P6HA 3OGGA 4IXLA 2R043 1LTEA 2CGOA 1JZ4A 3WSOA 3CLPA 1UXXX 1ZM1A 5D8AC 1X7NA 1PO22 4GH4A 5FUNA 5A3WA 3ZN6A 3T0BA 3ROUA 2HBUA 3ZDVA 4WM7A 3H8RA 5DZEA 1ZBE2 4LO5B 1H8TB 1W3XA 4AFDA 2W1UA 1L7RA 5FXZA 2E6VA 2R072 3HEIA 4CPBD 1R1ZA 1H9PA 4Q4W2 4C91A 5FZHA 4K7JA 2SBAA 3DPRA 3MW3A 2R1DA 3ITQA 4GALA 2VMDA 3HQXA 3POJA 2Q8EA 2GNDA 2DVAA 5CA6A 1S0JA 4CDWC 1V9U3 3TNPB 2WWJA 2VCMA 3VGIA 3LDRA 2JXAA 5IAVA 4CDQC 4LHNA 2QQIA 4LJHA 1Y9MA 1UU5A 4EWAA 5C9AC 1BBT3 4HMZA 3O1MA 5CNAA 3LB9A 1J3RA 2PXJA 1HRI3 5D21A 5KHHA 4AVTA 1WCSA 3HR9A 5F2SA 2R062 3VDAA 3ZYIB 2B46X 2BW8A 4I01A 3PVEA 3I2JA 1U5ZA 1VAMA 4W6YA 1SBFA 3SEPA 1D4M2 2EVXA 3LKJA 5FJKA 3VDCA 1PIV1 5F37A 1ZRRA 3WF4A 3VHPA 5T5JA 4URTA 2HH9A 3ORJA 3THPA 4QX0A 3I2FA 1IPJA 2WZR1 1RJ7A 5LA2A 3T4HB 1JU4A 1EAH3 2VBPA 4XFIA 3TYJA 3VZNA 3ZFGA 4N8MA 2LW8A 4MV2A 4ONUA 4Y5SA 5IVYA 2BV4A 1OOPB 3FWEA 3HQRA 2JJ6A 3UGGA 3MV01 1PO13 1XU2A 2AC1A 4BB3A 4ET7A 5EIYB 4D7SA 3RZHA 2YC2A 4IW3A 4YW2A 4YZ5A 1YUDA 3AP9A 5EWSA 4IEYA 1RUJ2 4YVSC 3GF6A 4QXBA 1BK0A 3HN1A 1IQDC 4IETA 4RR3A 1V70A 1LHOA 2VL4A 4XFFA 1Y7BA 3WP3A 3GJAA 4INDA 5H9RA 4AHYA 4IEQA 1XBFA 3N7LA 2DUOA 3PLQA 1G9BA 5FMBA 1QH7A 1ND3B 4ASMB 4HN1A 3TN91 1RIRA 5ISLA 2WNVA 3IWZA 5LEJA 4JGZA 3M8LA 3C7HA 4DUWA 2DYCA 3IAPA 4PDWB 1U12A 3AL6A 4W8JA 2ET1A 1UY4A 2XVKA 5FJHA 5FWJA 1CWPA 4YW5A 4P08A 1WLTA 4QDRA 4A44A 2VJXA 1VRBA 3W9AA 5FP8A 2ZOEB 3LA2A 5FCCA 5LBCA 2PFWA 1UZYA 1SCSA 1QOTA 3AX4A 1LHNA 2ARCA 3VD5A 1LGCA 1LRHA 4EN9B 1DHKB 2D6KA 1EYBA 1N1TA 1OLRA 2G4IA 1OT5A 1CD3G 1H8TC 1C57A 4P5HA 4Y4RA 3RNSA 4NWWA 1OLME 1D7PM 1UF2C 1XRUA 2VQUA 4LO4B 1KFUL 4BWOA 4QPIA 3SLIA 5CG9A 2Y0IA 2YPDA 3D3AA 4FAGA 1Z78A 4YM2A 1Y43B 2H0BA 5KXDA 1NQJA 3OBZA 2CWSA 1AL22 3S6PA 4Q8LA 5JMOA 1SLIA 3UGHA 1BYHA 1K5JA 1X8EA 4NIHA 1NT0A 2VUDA 2DCYA 2H6BA 1R091 2E51A 5DUXA 2J1AA 3V56A 3WD5A 1QOSA 1OI6A 1EPZA 1S0DA 3CQOA 3P5BA 1IPSA 1PGW2 5A7OA 1PVC3 4PIYA 1A34A 2LRPA 4X8NA 3WNMA 3BTXA 5CFCA 1PM7A 4BA6A 5FZ8A 1YI7A 1HX6A 1UN1A 4B7EA 3AZXA 4K3UA 5JSOA 3IBMA 3KF5A 5T5LA 3FL7A 4AZZA 4C0HA 4KGGA 2RM22 1K3IA 3N9PA 1ZZ7A 4D7TA 4WVMB 2WNUA 3OYWA 1XE0A 3PIGA 3R4SA 3B7MA 3H3UA 4NAMA 1OOPC 2ORXA 2UY8A 4C1XA 4QQ2A 2D6MA 4BQXA 3ZN5A 3C8XA 3OBAA 4Y1ZA 3B9IA 4AEJA 2J7MA 2JECA 4HPKB 1H1AA 5L9VA 2MEV3 1DGWX 1UY0A 1RUH2 4M3CB 4D8MA 3VZLA 1OLQA 2BGOA 5FY1A 2Q1MA 4IV1B 4JGYA 4RGKA 5JOYA 5JXGA 3O1RA 2XJSA 3Q8AA 2W3JA 4WM7C 4D0QA 4QGNA 5A3PA 4QU2A 4LKFA 4LO7A 1LB2A 3IDAA 5IK7A 1PHMA 4M3CE 1QJU3 4IE7A 1J83A 3BOWA 5LY1A 5ABJA 1W9WA 1UZVA 3IPVA 4XFBA 3U10A 5LA0A 1OA2A 4GJYA 3D4KA 1GYKA 1FV2A 3WEZA 4KL1A 3I3QA 3KCXA 5AC91 1JZ8A 5ERLA 5EP9A 2ZEZA 3PJYA 1SLBA 1H1IA 1QJX1 4V2VA 1RXFA 2OS2A 4GKYA 4HSLA 1EUTA 4AQ2A 2GP3A 5KHJA 3ZO0B 2ZGUA 1HRV3 4QM8A 3CMGA 4AR2A 5I0DA 2B45X 1AXYA 1JMUB 1W8FA 5BNPB 5FOBB 3HQUA 5EZWA 4YGBA 4LBQD 2XXZA 4ZU4A 4XAEA 2JIGA 5FP3A 1Q5OA 4G9SB 4EWDA 4Q0VA 3BIWE 1MS3A 3LEGA 1VBA2 1BEV3 3HT2A 4QGLA 2J22A 1CX1A 3POSA 5FZMA 4J1XA 4P5YA 4YWAA 2UY9A 4META 2XUEA 5FKCA 1G7YA 2VOXA 3TWIA 3WNPA 1O7FA 3VD7A 1YHFA 1OQEA 2YC0A 3NO8A 3WQ7A 3TAYA 5CKQA 2HWF2 1J3QA 3AZZA 2VZ1A 1IS4A 2JG9B 3EJKA 5FZ1A 1CONA 2WJSA 4HLTA 3HVDA 2DVBA 4LE4A 2R49A 4AYUA 5I91A 4L8QA 4QX5A 5FZ0A 2VQTA 3P1IA 2CAVA 4FO9A 3SCHA 2WNEA 4A41A 4DINB 3W59A 2XR4A 1EPWA 3ZX7A 2P3IA 2PA7A 1VBB1 5J37A 4D6QA 3THTA 1WD3A 3CEWA 3AYAA 5LBFA 1GQPA 2Z5WA 4GAZA 4QX3A 5FZBA 3FJSA 5C8CB 2ZMKA 1DQ4A 1YNAA 5FP4A 4FPCA 2OUJA 1V9U2 4LKEA 5JSRA 3GDBA 3IIAA 4JGZC 4Y22B 4WM8B 3ZFEA 3ACIA 4BMBA 1O8SA 1MPXA 4XQDA 4QWNA 1O3TA 1DQ1A 1WW6A 4AGVA 4C1WA 4CP9B 2FZ2A 2DCJA 1HRI2 3T2QA 5GALA 3TEYA 3JZVA 2HWB2 4ASKA 4BJ0A 3ZR6A 4CDUA 4JX0A 4W50A 3KF3A 1PIV3 1UO9A 4OHXA 2JKBA 2ARAA 4XFCA 4XMIA 4NIDA 3FE5A 2ZBJA 2VZ3A 4EJRA 4A45A 1KS4A 3MF6A 3SH4A 4XXPA 4CCLA 2WZR3 4BZ4A 5JZGB 3ETQA 4IV1C 3A0KA 3I54A 2G1MA 2VZUA 4P14A 1APNA 3M3CA 4P9LA 1EAH2 2CNAA 5C4WB 3N9LA 3WF0A 1NE4A 5FYBA 2QQVA 5A33B 5BXXA 3ZXFA 2UYBA 3EMRA 4H7MA 4Y1VA 1OD5A 2ADDA 4Z07A 2OX0A 2E31A 3VBUB 2HWC1 3VHOA 5LK5A 1PO12 1V6OA 2C1FA 4J25A 1NE6A 1K5MB 2J42A 1IS6A 3LIGA 2GMEA 3POIA 2Z69A 3O1SA 1HJGA 4AFAA 1HJFA 4Q27A 3H42B 2A3XA 4HXCA
chains in the Genus database with same CATH topology
2AYHA 1LOBA 1V6LA 3ATGA 4I2OA 4IEZA 3TN93 4AFCA 4OUSA 2ZZJA 2DTWA 4UW4A 5CVRA 3SISA 1LCLA 4N43B 5CFCC 3SCFA 5IUQA 4D7YA 2BNNA 1IS3A 1LEMA 2CGPA 2QZ2A 4LR4A 4CRQA 3GZAA 4BCUA 4Y20B 4GKXA 2WNUC 4A7ZA 1LHWA 1CAWA 2ZA9A 3RI9A 1DYKA 1VBD1 1BMV1 2D44A 1QNYA 2JG9C 5HCBA 1UIJA 4SBVA 4A7YA 2PAEA 3APBA 4LLFA 2UWAA 1SLAA 1S0BA 5IK8A 3MW4A 1HW5A 2MPFA 4R9AA 3M3IA 1O5UA 2ZKLA 5C8CC 4OI2A 4NHMA 1RJ8A 4P9GA 5AFBA 1D2QA 4EN6B 1LESA 4YRDA 1R093 3WG3A 4WM8C 2OZ6A 3LOIA 4MLOA 3QOPA 4TYSA 3WUCA 3VDDB 3AB0A 3D0JA 2CTVA 5JPMB 2W52A 3DKWA 3Q9OA 1ZRFA 3GBFA 4OFGA 2D7FA 3UKTA 3R6SA 1A8MA 5GM0A 4X8PA 5FAXA 3ZMNA 3NV4A 3NV3A 3RG0A 2VMIA 1RVF1 3FLRA 2RE9A 3SITA 5C4WC 3AZYA 2FBEA 4IV3B 4PQ9A 4EN8B 2SLIA 1S0CA 1UKRA 3WHUA 3VBUC 1VRH1 2AZ5A 2TBVA 4R4XA 4DPNA 2KM2A 1CGPA 4P9XA 3KQRA 1J1LA 1UL9A 3USUA 3AZWA 4Q2FA 4B4QA 4NWVA 2ARBA 4E4DX 1OSGA 2PYTA 1LHUA 2IFWA 2PAKA 1G6NA 4AVBA 5FLIA 3BU7A 4UXAA 4LBKA 4BMEA 4N43C 1QJU2 1ZX5A 5KHKA 1RGSA 5AC93 2ZHNA 4WVVA 3H0OA 1QJX3 4CP0A 5CBLA 4LTAA 5H9SA 2YY1A 4AE2A 1BQPA 3ZFEC 2QE3A 2R0FA 4Q26A 5DUWA 2C5DA 1FAYA 1YXWA 2QCSB 4FPEA 4S2DA 3RZZA 5IK4A 1HRV2 1HDKA 3JB8A 1MQTA 3J4UH 3KS7A 5EJ3A 1AX2A 2DU0A 4LHLA 3VBHA 2E7TA 1O4YA 2YDEA 1GNZA 2ZGSA 5JR7B 3K51A 3S7IA 4KG8A 4AFBA 2A6WA 1GLHA 2D3PA 1N3OA 2VY0A 4P9JA 4Y4YA 4I3GA 2VGDA 3NJZA 4LULA 2WFPA 4MZUA 4JRLA 3ZIWA 2NP0A 1Q8QA 3NAPB 4GA9A 2A6YA 1NA1A 4F3JA 1SMVA 3VDDC 4FAHA 4ZXKA 1VBB3 1WMFA 1YIPA 1TNFA 2ZX2A 5J09A 1CAUB 3VBOA 1LR5A 3VBSB 4E27A 5HCAA 4GB31 1DGRA 5FO7B 4OVEA 4BLJA 1NCRB 1EV11 3MGUA 5D8AA 1H4HA 4YM0A 1RUG1 1W6OA 2A3YA 3FUOA 3HIFA 5T5PA 4PLMA 5DDJ1 1QGLA 1CESA 1GZCA 3ACLA 1IS5A 3WUDA 3ELNA 5J3UA 2RS11 5F1RA 1VALA 5FFOC 1PGSA 3AKQA 3QACA 3AZVA 5KC6A 4UW5A 2LALA 2PHLA 4W6XA 4CDWA 2JG8A 2W08A 3OD4A 2KXLA 1PIV2 3OD0A 1LULA 1SLTA 2XGXA 5C9AA 3AP6A 4Y1UA 2WZR2 2WFF1 1N1YA 4AHZA 5EYYA 3WCRA 1T6GC 4ES8A 5LRRA 1ALYA 1UPIA 2HWC3 4I30A 3B02A 5SV5A 3WG1A 4QPGB 1NY71 4L2NA 2NMOA 3ZSEA 1RUE1 2Q0AA 4K40A 4N7IA 2OUHA 4Z1VA 1G9AA 2CV6A 4L11A 2ENRA 4M0NA 2Z42A 4I0BA 4S2HA 5BY5A 5KHGA 2ZMNA 5LRSA 2A6XA 3ZXEA 3BOPA 1H2MA 1WGPA 3TN92 3WG2A 1X33A 5HI0A 3QD6A 2VVEA 2WWSA 4YGEA 1W6OB 4MX3A 1V6JA 4XHBA 2GNTA 2HWE2 4FCAA 2XKOA 1VBD3 3ZXKA 3MLJA 3U4XA 3BODA 2E7QA 4RHV1 2XJVA 2D6NA 3O0VA 1AR61 1SLLA 2ZGOA 2PTMA 1IPKA 2DVGA 2OVUA 3AKRA 5JMCA 1CQ9A 5J96B 1DBNA 1N47A 2QZ3A 2TEPA 4K21A 2HWD3 2I74A 5FLHA 3VBSC 2B7YA 1UIKA 1YCIA 1ZZCA 4IEWA 1FATA 4BYYA 1A8DA 2E53A 3QH7A 3ZSLA 3IDBB 4AVAA 2WLQA 2Y26A 4QT6A 4K20A 2BYVE 2DWRA 1POV0 3WCSA 4YZ4A 4F83A 1ENXA 4BIFA 2ZS6B 4AHXA 5KXCA 3D82A 1MS9A 4D3WA 3FLPA 4RS5B 3ME2A 4K1ZA 4XZPA 2QUOA 4O9EA 2VH9A 1RVF3 1Z7S1 3D8CA 3POWA 3VBHC 4B29A 3OY8B 2K2SA 4XHXA 1QMJA 4ISRA 1ZBA1 1OPMA 1VRH3 2EIGA 1SQ4A 1LJ7A 5K0UB 1GNHA 1LKNA 2EF6A 3M3QA 4RQPB 3V0AB 1I9RA 1OPOA 4UW6A 4IEVA 3MFAA 1REEA 4AHWA 1OOPA 1BEV1 4DOUA 4YLZA 1N3QA 1H2LA 3VZJA 3FMGA 4BQ1A 3MIEA 1O4TA 2V5YA 3VBOC 3RWNA 4XJZA 1POV1 1YJKA 4H14A 1KRIA 2RJKA 1CVNA 4MVTA 3JB4C 2ZX3A 5AC92 3GZTB 1OHFA 1HKDA 3PJQA 4LBOA 3EXUA 1PVXA 2DFCA 1QJX2 1CIWA 5F6KA 5EXOA 2LM3A 4Q4Y1 4DMIA 3SCGA 2Q8OA 1ND3A 4LA2A 4M3CF 2G9GA 4Q4V1 4PDWA 1GZWB 4MYEA 4XJ8A 3WT3A 4IERA 2JG8C 3WZ1A 1C3HA 3MYXA 1JH5A 4Y26A 3MIHA 4N53B 4E2GA 2Y0OA 3CL1A 2JENA 1JBCA 3MW2A 1AVBA 2UU8A 4AI3A 4LHKA 3QCWA 5KXBA 3RMXA 4XBLA 4DFSA 4DS0A 1C1LA 1GICA 1AJOA 3E5QA 2ZHKA 4XBNA 1AL0G 3KMHA 4HK9A 3UKVA 4AK3A 4XMAA 3NKGA 2HKXA 2I2SA 1CAXA 2YV8A 1R1A1 3P3NA 2JE9A 5CIRA 2H6CA 4G4FA 4MXWB 4GB33 1Q3EA 1Y9QA 4L92A 3MZHA 1MEC3 3GHMA 4RS5C 1ND2B 1MS8A 4AQSA 1EV13 2VXRA 2PHXA 1RUG3 2IXIA 1E57A 1WW4A 2XVLA 3FUQA 4L97A 4UW3A 5DDJ3 1OQ1A 5FTTC 1BZWA 1ASJ1 4FPYA 2P3KA 1SFNA 2D6PA 2RS13 4ORFA 3MIGA 2RMU1 2NLRA 4JAAA 3PVOA 3B01A 5L7OB 3I2DA 1KQRA 3MIDA 3E6BA 4NN0A 3AXEA 5K0UC 2NM1A 1AR81 2XL9A 4XXAA 3PNAA 4FOYA 1QKQA 4NVPA 4FPGA 4WVMA 3U0ZA 4R9DA 5CG8A 2PHUA 2WFF3 5FDBA 1OMIA 1ZNPA 1LECA 1PK6B 2IZWA 2WT0A 3T2TA 1XNKA 1WUVA 4X6QB 4FPLA 3A4UA 5FOJB 2WQZC 4HPKA 3PVBB 5EYXA 2VW2A 2VU9A 3M3OA 5DG1A 4M3CA 2HWC2 3EHKA 2NZ9A 1AR72 4KQ7A 3ZXGA 4IV1A 3ES4A 4CEWB 3B93A 1RUE3 3VHNA 1DQ6A 4TLFA 3JQXA 3N7KA 3AMPA 4GMP0 3VBRB 4BPZA 3HMYA 1CAXB 3JD71 4AVCA 1FMD1 3ECQA 4MGIE 1W6NB 1WMDA 1AX1A 4HVOA 3B94A 3ZXLA 1AUYA 4N53C 5C33A 5I8SA 1YWKA 4BE3A 3HD8B 1H4GA 2ZAAA 3EBRA 4HETA 5BNPA 5CAZA 4AQTA 1RUD2 4OHWA 3KT1A 1BMV2 2F4PA 4RHV3 4XF3A 3RRDA 2RS51 4Q4X1 4X6RB 1AR63 1QHDA 3NV1A 3ZSKA 2VUJA 4YARA 5FO9B 2D98A 4C0BA 2XH6A 3J8F1 5CFDB 2VNGA 3WQ0A 2QKDA 1ND2C 1C28A 4JVAA 4YG3A 1S0IA 1AYN1 2JG9A 3O0WA 2VMHA 4GMP1 2PN5A 3WHTA 2CGNA 4CYDA 5T55A 3INAA 1V6NA 1WMEA 4R9CA 1GBGA 3BPZA 1SEFA 5F6LB 2CAUA 3GNEA 2D6OX 3WDUA 2X8KA 1QF3A 4DRVA 1Q43A 3UK9A 4XDQA 4CDXB 3ZN4A 2XB6C 2WS92 5C8CA 3CNAA 1ND3C 4A3XA 3URFA 1VAVA 4Z2WA 2ZZQA 4PBOA 4H3WA 1XU1A 4AEKA 4Y22A 3D5OA 4WM8A 2H0VA 4PDWC 2BGCA 3QH6A 3WW3A 1PK6C 1Z7S3 5TSWA 3NL1A 2AH2A 2ZGMA 3H7YA 3JUUA 4LEJA 1HV1A 3B9CA 3WX5A 4JQRA 2VOWA 3WP6A 4AW7A 2BWAA 1ZBA3 2WIIB 3MPPG 2AGSA 4RGGA 3ZPYA 3UV9A 2B42B 2WT1A 2ZTNA 5JZGA 4D69A 3JU9A 1MZEA 1KXGA 2GH2A 2WA4A 4DB5A 4XFHA 5C4WA 4DRRA 2DCKA 5A33A 3VBRC 1QDCA 3G7DA 3VKFC 3VBUA 5IT6A 3D0SA 1JXNA 1ZBE1 4CP2A 4QD2A 1LGBA 3KT4A 3O5SA 1K5MA 4Q4W1 1POV3 2EXKA 2OA2A 4XTPA 5F9TA 2R042 2A6ZA 1G86A 2NPIA 4QGMA 2YUEA 3ZYGA 2GZWA 1OA4A 4FQ4A 5GLUA 1S0EA 4Q4Y3 4UBHA 1BJQA 2OW4A 5JOZA 3LSDA 1RTVA 4NOTA 1ZZ9A 4N43A 2D3SA 4Q4V3 2RJLA 1LOCA 2QJVA 5FMOS 2R30A 3UL2A 1DQ5A 4Q0QA 2WQ4A 4XFAA 3M2MA 4WVZA 4XQWA 4Y20A 5CB7A 5GKAC 1JOJA 4OHVA 1ULGA 2WT2A 1ONAA 1BVVA 1BBT2 5CFDC 5KHIA 5T5OA 4FTEA 4OHYA 1PZ8A 4TZDA 5FLJA 4JV4A 5HBAA 4YFWA 3AFGA 1SDWA 4YW1A 3E97A 2BVBA 1PNFA 3O0XA 4BIOA 4BLIA 1LU2A 3VZMA 5I8YA 2VNRA 1WW5A 1R1A3 1VJ2A 3WOGA 1B35B 3KGLA 3LA3A 5BNOB 1CPMA 4AEMA 3CO2A 1YFWA 4RSUA 1YFUA 4YGCA 4PBPA 3WW4A 5T52A 4XQ4A 2GC2A 1LHVA 1ULCA 3WP5A 5FQ0B 4AEDB 4QQOA 1CJDA 2WL1A 4GQ7A 4LBMA 1DU3D 2B5HA 2XVGA 1ASJ3 1HIXA 2ET7A 4AFMA 3VDDA 2ZGTA 1D0HA 1HXS1 2D93A 3WXPA 5I0SA 1EP0A 5J48A 2RMU3 2RS12 3E6DA 1QJY1 2IXHA 1DGWA 1AR83 4ZU7A 5BNPC 4GWMA 3OJBA 3RMYA 4YZ3A 1QNWA 1G8WA 4IV3A 1RUNA 2XBO1 4ATFA 3AYEA 2WFF2 5IK5A 3PMSA 3AP4A 4LUMA 4MXVA 1VR3A 2GN3A 1O3QA 4QPYA 3CJIB 5FMOL 3UJQA 1REDA 5JDBA 2DV9A 2ZGKA 4HSJA 4Y5Z0 4FPFA 1TME1 2AENA 2EAAA 1NY72 2Q1ZB 2W0XA 2DVDA 1WBLA 1RUE2 3GHNA 1X50A 4IL7A 3SHRA 3AYDA 3JD73 1FMD3 2HWD1 4A2UA 1W0PA 2JEMA 1LOGA 2QNKA 5EFUA 1COV1 1UCXA 2DF7A 5FPXA 4COZA 1FNZA 2WA3A 3FFQA 1MS5A 3J9SA 2EA7A 5J98B 4MSVA 4DY3A 4K8FA 1HQLA 1W2UA 1PVC2 2XL7A 3BALA 3FZ3A 2WINB 3IDCB 4FT8A 1UMZA 1F2NA 2RS53 1R081 1MVQA 3GZUC 1N1SA 5A32B 4RHV2 4Q4X3 1A78A 3M7AA 4XIOA 2EAKA 1ENQA 2UWBA 1O91A 5JZGC 2NN8A 3AYCA 4NHLA 2HEWF 4H55A 2XLAA 5BNOC 1S0GA 1WCKA 3J8F3 1W0OA 2PAMA 3M3EA 3H1YA 1AYN3 4AEDC 1QXJA 4E2QA 2GC0A 4GMP3 3NAPA 2X5IB 2XLFA 3I8TA 5DUUA 4COYA 1XQNA 1K5MC 4KU8A 1QH6A 1QOOA 2MEV2 1U5YA 1F8VA 4FBFA 4YFZA 1O3RA 4YW4A 4XBQA 3ZIXA 1AHSA 1CAUA 2VQAA 3VBSA 2XG3A 1NCRA 2YROA 3N3HA 1XYPA 3RSJA 1Q8VA 3KCCA 4PIZA 2VQ0A 3WV6A 4QQPA 3I59B 4B7KA 1L3JA 3DN7A 4NPRA 4DQAA 1Z7S2 5JSPA 2IC1A 1FI2A 1VBA1 1ZBA2 3B3QE 3L2YA 3VL9A 2ZHMA 1C5HA 4FP3A 4FOWA 2EALA 1BXHA 3X29B 1NLSA 5JVVA 4EWEA 2HWF1 2Q30A 5ACA1 1UD1A 2BNOA 2AREA 4QMAA 4XE9A 2BBVA 2V73A 3PVNA 5DG2A 1I6XA 1BEV2 1W6MB 3ZSMA 1DZQA 1ZBE3 1CJPA 3GYDA 1MVEA 1UU4A 4Q4W3 2IFRA 1RUC1 2CWMA 2WKKA 2A6VA 1DG6A 4K1YA 1QY4A 4QPGA 3VZOA 2FQPA 2ZJCA 5AVAA 3JCIA 1JW6A 4YVWB 3GBGA 4GIQA 1F9KA 1WLCA 2K0GA 1SCRA 2A70A 4Q4Y2 4FOQA 2PELA 4FPJA 2E63A 3AJZA 1MEC1 4Q4V2 4MGYE 4XEZA 1MR5A 3AMHA 2ZGPA 3MF9A 2DVFA 2O8QA 3G6JB 1ZA4A 4I0WB 3VUOA 3N7JA 4CEYB 5LK7B 4PIXA 4XJ9A 1SLCA 1DFQA 4IV3C 4Q1RA 1LODA 1JHNA 4E4SA 1GSLA 3WNXA 2GDFA 2GMPA 1JUHA 5BNNB