4AWDA

Crystal structure of the beta-porphyranase bpgh16b (bacple_01689) from the human gut bacterium bacteroides plebeius
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
297
structure length
297
Chain Sequence
KEYSLAEEHIKNLPEAPEGYKWVVNEDYTDEFNGKRLNAAKWHAKSPYWTNGRPPATFKAENVSVKKGCLRIINTVLSPTEGLDGKPGDKYRLAGGAVASVKNQAHYGYYETRMKASLTTMSSTFWLSNRPVMKEIMKGGKKIKTWSSQELDIIETMGIIRSVNPDNPWNKTWNMQMNSNTHYWYQEQGGKRTDNTAKRSDVVSYMTDPSAEDFHTYGCWWVDANTVKFYYDGKYMYTIKPTTKYTDTPFDRPMFIHIVTETYDWEKQVPTAEDLKDKDKSTTYYDWVRAYKLVPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacteria of the human gut microbiome catabolize red seaweed glycans with carbohydrate-active enzyme updates from extrinsic microbes.
pubmed doi rcsb
source organism Bacteroides plebeius
molecule tags Hydrolase
molecule keywords BETA-PORPHYRANASE
total genus 73
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4awdA00
2BQPA 4H55A 1QDCA 2P37A 2ZMKA 1LHVA 3FLTA 4GALA 1A8DA 3WVJA 4LBNA 4XTMA 4YZ3A 1S0CA 4W65A 1JYIA 1Q8SA 3AZYA 4XDQA 3ZXKA 1HQWA 4FPGA 3A0KA 1V00A 1UL9A 1I3HA 2WSUA 2A70A 1CPMA 1ULDA 2D6NA 1G9CA 1YI7A 4CRQA 1GZWA 1MR5A 2GMEA 1D2SA 5F9TA 5DUWA 2W39A 3NV3A 1OFSA 2EXJA 2G4IA 2ZGLA 1BKZA 2HYKA 1ULGA 5CBLA 3O5SA 4R9CA 1WW6A 5KXDA 3VKOA 5GALA 1CVNA 5KXEA 1S0JA 3D4KA 1HLCA 4FPOB 1JXNA 1WD4A 3RMYA 4Q27A 3I4IA 3H0OA 3WG4A 1IS6A 3ZSJA 3UK9A 2YMZA 3O12A 4ATFA 3SITA 2OUJA 4M3CF 3ZYRA 3O0XA 2ZGSA 1XQNA 1GANA 1DQ2A 1LCLA 2E51A 3LSEA 5GLTA 5T5JA 5T5LA 4YGBA 1IS5A 3APBA 5T50A 4YM3A 1DLLA 1SFYA 3N7KA 1GYKA 2ZHKA 2E7QA 3NV1A 4ITCA 3ILFA 5CNAA 1DFQA 1EPWA 2AENA 5F5QA 2GNMA 3GNEA 1AJKA 3ZPYA 1V6LA 1IKQA 2CWSA 1N1YA 1PZ7A 1ENQA 1WLDA 2VXRA 1LECA 3WHUA 3W58A 1SLAA 1S1AA 4R9DA 3JU9A 4XJ8A 4HL0A 3V64A 3WZ1A 1G9AA 1LJ7A 3PVEA 3R05A 2P34A 2ZABA 1AXZA 1W6PB 3FBYA 3B00A 3AZWA 1LEMA 4Y1ZA 3U4XA 2PHRA 4BM8A 1RITA 1G86A 1WW5A 3AZZA 2D3PA 3AX4A 3OYWB 4UW4A 2CNAA 1VLNA 1W6NA 5SV8A 2YROA 3VKLA 2DVAA 4TYSA 2GMMA 3R4SA 2E53A 1QU0A 2B7YA 5L73A 1LGCA 5JVVA 3WDYA 3HR9A 1OQ1A 5IUQA 1DHKB 2E6VA 1ZM1A 3ZXFA 4YFZA 4K1YA 3WDVA 1N47A 4ZKTB 3TAYA 2JE9A 3AP4A 1LULA 3WV6A 2A6VA 4FP2A 2VUAA 4R9BA 3T2TA 1A3KA 2ZGTA 5AVAA 3ZXEA 4OZXA 4YW1A 1YIFA 2AR6A 2A3WA 1V6IA 2R49A 2JE7A 3PJQA 5DUXA 2ZHMA 5T5OA 1CESA 1N3OA 1FYUA 1MS9A 2W68A 4IQPA 1WUVA 1CJPA 1G9BA 2DUQA 2FMDA 4F83A 1FNZA 5T54A 1MVQA 2DU0A 4FPJA 3OJBA 1PZ8A 5IK4A 4LBMA 1IS4A 1S0FA 4YW3A 5GLVA 4GWNA 4HANA 1G7YA 4XHXA 5FREA 2ZGRA 3WLUA 2Q5TA 1APNA 5IK7A 1UZYA 2GDFA 1CPNA 1O4ZA 1CR7A 2ZMNA 2PHFA 3DGTA 5JDBA 2DTYA 4CZSA 3JUUA 3M3QA 2AYHA 1W0OA 3VKMA 4P14A 5GZDA 1ONAA 2ZGMA 3UL2A 4CTEA 2NM1A 5GLWA 4YZ2A 2OW4A 1N3QA 1MS3A 1UZZA 2KM2A 3SH4A 4FPLA 5H9SA 4DRRA 4BLJA 1LTEA 4SLIA 1ULFA 3IKWA 1SCRA 3M3CA 2WLQA 4LBLA 3R4UA 1TEIA 3ZSLA 2EIGA 3AP5A 4DFSA 4FPHA 1AVBA 1UKGA 3M3OA 3N7JA 1IKPA 4FPYA 4YM1A 3RQ0A 3AYCA 4Y22B 3WG2A 5CB7A 4FPCA 4FPFA 4Y20B 1W6OB 2DTWA 3POWA 1GSLA 4YGDA 4L8QA 1Y7BA 3IM0A 2GMPA 1LOCA 1F5FA 1DYKA 1W6MA 4XJ9A 4Q26A 5JMCA 1WLCA 4Q8LA 1W6OA 3AYDA 4M3CA 3OGGA 5DXDA 5DUVA 4ZXKA 2YZ4A 3A0NA 3B69A 5GM0A 3DUIA 2A3YA 1GZWB 3FUOA 3LSDA 2GNDA 4FPEA 4LBQB 4XHBA 3T1MA 1MZ6A 4P9XA 1WCSA 1N1SA 3MW3A 4FQZA 3A4UA 4M01A 1GZ9A 2GNTA 1LHOA 2JJ6A 5FRAA 3L2YA 1JOJA 2V5YA 3AP9A 4Q8KA 4UW3A 2P3KA 2DV9A 1OKQA 1W0PA 3RG0A 4YG0A 4XBLA 1VAVA 3BTAA 3ZXJA 1QOTA 1X50A 4YM0A 1MACA 2R16A 3V0BB 3PVOA 1LOEA 4BPZA 5EYXA 4Q1PA 4D69A 3OY8A 1ULEA 4YGEA 2WNEA 3AP6A 1UAIA 2E7TA 3D6EA 4YM2A 2D44A 1S0BA 1N1TA 1Q8PA 1QOSA 5JLVA 3IPVA 4FOVA 1BZWA 5KXBA 2D6MA 2NYYA 4GWMA 4LBKA 2NP0A 4FPKA 1JYCA 3TB0A 4FVVA 2VU9A 1QMJA 2OVUA 3WDWA 2PHUA 1FX5A 3OBTA 3MEPA 2A7AA 4PCRA 3N7LA 3WUCA 2A6ZA 3SNMA 3ILRA 3ATGA 2FHRA 4Y1VA 2ARBA 4GKXA 4WV8A 1UN1A 2EALA 1F9KA 2GALA 4DRVA 5E88A 2WQZC 3RMXA 1C1FA 1VALA 1QDOA 4XJZA 1I1EA 5GZGA 4BLIA 3BIWE 1HKDA 1JUIA 2OUHA 2VY0A 2A3XA 3KM5A 3WNXA 1FV2A 1MS4A 4Q1RA 3B01A 4Q2FA 3OPZA 5HCAA 1CONA 1U0AA 1KQRA 1YRZA 1WBFA 1DZQA 3WUDA 3PMEA 4XOGA 1VAMA 3SH3A 2DVGA 4P9YA 5EWSA 2JD4A 3B3QE 2DURA 1LHNA 1NXD1 4AWDA 1QKQA 3SISA 3AZXA 4XYXA 2ZHNA 5T52A 1SACA 1AJOA 2UURA 3WG1A 4DS0A 1AXKA 2WT1A 4MYEA 3NV2A 4YG3A 3VKFC 4Z8BA 4LBJA 4PF5A 1CN1A 1CQ9A 3UJQA 1VIWB 2EXIA 1GNHA 1QOOA 2WJSA 1AF9A 1LOBA 5DG2A 5HCFA 3MW2A 4RL7A 5KXCA 5IK5A 1F31A 3RSJA 2JKBA 3FLRA 3WDTA 4M00A 2DUPA 3USUB 4DQAA 1G9FA 1JHNA 4YW4A 2D6OX 3INAA 2UWBA 1G9DA 2VH9A 4XJUA 4XBQA 2A5ZA 2PHWA 1FNYA 1KITA 1LU2A 3ZSMA 2WT0A 5DUUA 1KRIA 2ZGQA 1SLTA 3KQRA 1V6NA 3M3EA 2WKKA 2ZGKA 2ZHLA 4ISQA 4K20A 2GN7A 4R9AA 1JW6A 3O0WA 3ZSKA 2AH2A 1LESA 1GLHA 2C9AA 2DVDA 1UMZA 2A75A 4AGVA 4BQ1A 1FATA 3POSA 4AYUA 4K21A 1IS3A 4Y1XA 2A6WA 1S0DA 1KDMA 1PZ9A 1QF3A 4LBQA 1HDKA 1LOGA 3IPVB 4AGRA 4FP3A 4YW5A 2DYCA 3V0AB 1W6QA 5LK5A 4XIOA 4BMBA 2ZMLA 2P2KA 4AVVA 2EF6A 1Q8VA 1Q8OA 3SLIA 3V65A 1W6QB 2ARXA 3IN9A 4YZ5A 4U36A 1C4RA 4FQ4A 2R1DA 4XMIA 2R0HA 3LCPA 2DU1A 3SH5A 4WVWA 4XJWA 3HN1A 3V0BA 2H0BA 3AJZA 1KJLA 1DYPA 3AZVA 4XILA 3FUQA 1DQ6A 1WW7A 3POYA 4WVVA 4XMAA 1GICA 1WLWA 1QGLA 3C2UA 5E89A 3VUOA 4XJAA 2A6XA 3QCWA 3N35A 1C57A 2WSVA 3WOGA 2DVFA 2DUOA 2JECA 2ZZJA 3QLQA 3BOPA 4ISRA 1R1ZA 2GN3A 2D6KA 4C1WA 1DIWA 4AVTA 1AX1A 1MS8A 4RA0A 1GBGA 1JBCA 4KBBA 4JCKA 4Y1YA 3FFZA 3VKNA 2XB6C 1ENSA 4XXAA 2DVBA 2R0FA 2YV8A 1AX0A 2NZ9A 4K1ZA 5JOZA 1A78A 1MS1A 2I2SA 2XG3A 4XBNA 5DZGA 5GJ6A 1V6OA 5H9PA 2VW1A 1DQ5A 3WDXA 2D7FA 3OYWA 2R1BA 3NV4A 3WHTA 3Q9OA 4XIKA 4YW2A 3ZYPA 4GXLA 2D3RA 3NWKA 3UJOA 3N3HA 3WG3A 5H9QA 3VV1A 3ZXLA 5GZCA 3WCRA 1ENRA 4GA9A 1KJRA 2D6PA 1SLLA 4YFWA 5H9RA 3RS6A 2PELA 5IT6A 3T1LA 4XZPA 5BYNA 1H9PA 3CNAA 1LHWA 4AGGA 4FOYA 5GZFA 2CY6A 3W59A 1LU1A 2LALA 2LTNA 3WDUA 4LBOA 4Y1UA 3AXDA 5GZEA 5HCBA 1MZ5A 1O4YA 5CAZA 1URXA 1WW4A 1V6JA 4YGCA 3ENRA 2D3SA 4YZ4A 2JDZA 1ZA4A 1QNYA 1LOAA 1Q56A 1DGLA 2CYFA 2ZACA 3GALA 3M2MA 1DQ0A 4WZFA 5JOXA 3BODA 1DQ4A 1RINA 1GKBA 3FLPA 2W08A 2YY1A 5DZFA 2ZGNA 1GNZA 3D5OA 5GLUA 2NMOA 4BMEA 2ENRA 1H30A 1MS0A 3ILNA 4Y22A 4PBOA 5E8AA 3WCSA 3MPPG 4UW6A 1LGNA 1LEDA 3AYAA 1UX6A 5CA6A 3USUA 1YXWA 4BOWA 1GV9A 4M3CB 2ZAAA 2ZBJA 4GKYA 5EYYA 1JN2P 3IMNA 2A71A 4UW5A 1SBEA 1DQ1A 4C1XA 3ASIA 2P3JA 2YXSA 2ZA9A 2Z42A 5EXOA 2NN8A 3N36A 1ULCA 2D6LX 3AXEA 2AREA 1CIWA 2UWCA 2D43A 3O0VA 2CL2A 1Z0HA 1GZCA 4P9WA 4XTPA 1H9WA 1J1TA 2P3IA 3PVNA 1V6MA 2C5DA 2SBAA 4I30A 1AZDA 4Y20A 4ATEA 1B09A 1LENA 4LBQD 4YG6A 2NMNA 2W52A 3AJYA 3HMYA 1DBNA 2ZGUA 1SLBA 5T5PA 2ZKNA 3AYEA 4Y26A 3OBRA 1FV3A 1W6NB 5DZEA 1W6PA 2EAKA 1HQLA 2AUYA 1WBLA 1UPSA 2PHTA 2ZGOA 3OY8B 3V0AA 4M3CE 4XE9A 4TZDA 4YLZA 1AXYA 5T55A 1V6KA 1MS5A 5JOWA 2EXHA 1D0HA 1G8WA 4ASMB 1W6MB 3MW4A 4NO4A 5DG1A 4JC1A 3AP7A 4XXPA 3RRDA 1LODA 1SBDA 1KDKA 1LOFC 2ERFA 5GLZA 1LHUA 4NOTA 1WD3A 1YO8A 1BJQA 3AFKA 1LGBA 2ZGPA 1RIRA 5IK8A 2CWMA 3I8TA 5JOYA 1QNWA 2A6YA 2CTVA 1YYNA 1SLIA 2ES3A 1C1LA 3B9CA 3N7MA 3ZVXA 4DPNA 1AX2A 1LOFA 1S0IA 1N3PA 4AVSA 1NLSA 3AK0A 4JRAA 4PBPA 4Y24A 2DWRA 2PHXA 4U2AA 2EXKA 1BQPA 1BYHA 1Q8QA 2VW2A 1S0GA 1SLCA 3M1HA 4FOQA 2AGSA 1S0EA 1IOAA 2VW0A 1Z78A 1MVEA 2V73A 1N1VA 2RHPA 1FAYA 4PQ9A 2WT2A 2GNBA 1BXHA 1SBFA 1SCSA 2UU8A 2TEPA 2SLIA 4YZ1A 4FOWA 2UWAA
chains in the Genus database with same CATH superfamily
4H55A 1WCUA 4RS5A 2WO1A 4CP9B 3CLPA 1NQDA 3H8XA 3Q8CA 1SDDB 4CU8A 2VZ1A 4LBNA 2PAEA 3VDCA 5BNNC 4YZ3A 3DN7A 2VNRA 4PLNA 3ZYFA 1VRH2 2MPFA 1Q8SA 4MUVA 3ZXKA 3RZKA 5AFBA 2RVAA 3WNOA 3ZR5A 3IT8A 1UL9A 1BMV2 2A70A 1CPMA 5EHDA 5FY8A 1G9CA 1WLTA 4OHWA 4PLOA 3FHAA 1NYWA 3AMMA 1TNFA 1EAH1 2EXJA 4CPBD 4FAHA 1BKZA 4F3JA 3J26N 2IZWA 4JGYA 5TSWA 1W3XA 1FMD1 4HOOA 2D97A 3MF6A 3RZZA 5KXDA 4LMFA 2RS31 1TMF2 2J42A 3TN93 5KXEA 2VPVA 5FMCA 5J3UA 2VTXJ 1HLCA 1RXFA 1W06A 4X8PA 1WD4A 3I3BA 5JXJA 4Q27A 5FK8A 2VMEA 3RYPA 3UK9A 1UYYA 2VVFA 3WP3A 3WNLA 4M3CF 4WVZA 3ZYRA 3O0XA 1HJFA 1XQNA 5I0TA 1AYM2 3LIHA 4LJHA 3LSEA 2E51A 4ZONA 5FXWA 3WQ1A 5T50A 2R6QA 4AFAA 3IB3A 1SFYA 3LEGA 2HYXA 4JKMA 1GYKA 2ZHKA 4KG0A 3S5AA 3SKJE 4ITCA 4Q4Y1 3TN91 4F7ZA 5FWEA 4QX7A 4OI1A 3GNEA 4IV3B 2CWSA 1PZ7A 4IEQA 3GF6A 3C3VA 3ZFGB 2XH6A 2VZTA 4JKKA 3W58A 4P00B 4S2GA 1S1AA 2YU1A 3WZ1A 1NCQA 1LJ7A 3RFRA 3ZO0B 3R05A 4FBFA 2VMDA 2P34A 3J7LA 5FZOA 5HXVA 1DGWX 1VJ2A 3B00A 1LEMA 2ZX0A 3U4XA 2PHRA 5FLHA 4BM8A 3T0DA 3ZKYA 1XYOA 1VPHA 3AX4A 3OYWB 3CEWA 3I2DA 4XAAA 1RUH3 4EWDA 4NUBA 4FAGA 4LO5B 3GZEA 3CJIB 1YQ5A 3WF1A 3ACIA 1PMJX 1JS9A 3DEMA 4CCJA 2RDRA 5L73A 2VG9A 5F3EA 4W4ZA 1BEV1 5IUQA 5HV0A 2EVXA 1I5ZA 1YQ2A 3KSCA 4DB5A 1COV2 4LOSA 3ST7A 3MIEA 2PFWA 1N47A 4ZKTB 1JYXA 2LUWA 1NE6A 1MEC2 5DMYA 5BNNB 1WA4A 2A6VA 5A33A 4E8DA 4IV1A 5FQ0A 4FP2A 1A3KA 1D0GA 2C4XA 4OZXA 4NRQA 1W9FA 2E7AA 4FXGB 2AR6A 3PUHA 3VBUC 3PJQA 5HCHA 1KFUL 2JE7A 4ZS3A 3U07A 4DUWA 5T5OA 4RR3A 1CESA 2VBDA 1A8MA 4XF4A 3MIFA 4OLLA 1BEV3 1EUUA 2O8QA 2WO3A 1ZVFA 4AHYA 1MVQA 1VBD3 3RGBA 3OJBA 4FFGA 3AMNA 4RR3C 5LRRA 1XNKA 2XQXA 1AR61 1CZSA 1ODMA 1PO21 1ND3B 1AR71 2G19A 3T2OA 4XHXA 5FP9A 2F6BA 3WLUA 3ZYIB 3TWIA 3DF0A 1HJGA 1UW8A 4Q4W2 5C7GA 1XJAA 5I8YA 1W28A 1R083 4HSLA 2Z79A 4QPIB 4AF9A 1XE7A 3ZFEB 1US2A 2JDAA 3RVHA 1W0OA 3VKMA 5FR3A 3ZYHA 1U12A 5KC5A 2ZGMA 2Y6LA 4DY3A 1NCQC 2NM1A 3NNMA 2HBUA 3H8OA 2EIDA 1UZZA 1K12A 1PIV1 4CCCA 1H1MA 3I2KA 3M3CA 4CE8A 2Q0AA 5FOBB 2BWCA 1POV0 3V56A 5I91A 2VM9A 1AVBA 1X7NA 2RM23 1IKPA 1AL22 4FPYA 4NHKA 3CDZB 1DF0A 4ORFA 1POV1 3FL7A 3PJYA 4PT6A 4Y22B 5FP7A 2W91A 4N90A 5I0DA 4S2DA 4Y20B 1OBNA 1W6OB 1GSLA 5IVCA 1Y7BA 1UYXA 1UZWA 2W3JA 3W5MA 1J59A 1F5FA 1YCIA 4A7ZA 2NPIA 4XJ9A 3HVDA 4AW7A 3OGGA 3ZOIA 5A6YA 2YZ4A 5I0SA 4YW7A 3B69A 1OLRA 5FWJA 3PURA 5I0RA 1GZWB 1JZ7A 4XFIA 4OYUA 4RS5C 1LB2A 4BJ0A 1ZRDA 3NMBA 1POV3 1WCSA 5FO8B 2YGLA 3S0MA 2VQUA 5J36A 4NIAA 1UCXA 1A6CA 2JJ6A 5FRAA 5I0UA 2V5YA 4D6RA 4CXYA 3RZJA 2P3KA 3IBMA 3RG0A 4N53C 4QAWA 2WNUC 1UIKA 1VBE2 3DPRB 4JVAA 1VAVA 3CKHA 3E97A 2PHDA 1V9U1 2OA2A 3GCXA 3V0BB 4GULA 5BNNA 2VMIA 3NNJA 4NAOA 2R042 4MV2A 5EYXA 2XJSA 1X33A 1ULEA 4NRMA 1S4CA 3AP6A 1YFYA 5JUVA 3D6EA 5FZ7A 2WAOA 5FMOL 1N1TA 1Q8PA 1S0BA 4E2GA 5JLVA 5FBZA 5A3TA 5BNQA 4OCTA 4GWMA 4N9HA 2UY9A 1ZX5A 3TBDA 5DDJ2 4GZ9A 3TB0A 4UF0B 2WR9A 2OVUA 1STMA 5LCWL 4GH4B 1W99A 5CIRA 4DXRA 3DKQA 3ETPA 5IVBA 3UESA 2A6ZA 3LKJA 3ILRA 1BLZA 1LRHA 2XUEA 3ATGA 3I3QA 1UU6A 1NUKA 1QJY3 1WKYA 3ZYJB 4WV8A 3E5XA 5E88A 2WQZC 5GZGA 1PVXA 2VTXA 4DO0A 3KV6A 1DCSA 3HWJA 3QD6A 4CCNA 4N8MA 2YC4A 1IHMA 1VBC2 4MLOA 3MYXA 1F35A 5B2GB 4D7TA 5BNPA 3ZYGA 2RS12 2K9ZA 2IXCA 2V4AA 4GIQA 4AI9A 3JD71 4YVSB 4UFMA 5EWSA 2JENA 1D2QA 4Q0QA 4AWDA 1RB8G 4UFJA 5DQ0A 5IYYA 3AZXA 1CAUA 5T52A 1JZ8A 2EAAA 1J1LA 1S2KA 2WABA 4Q4V3 2KD7A 2UURA 2HWB2 2XVLA 4MYEA 4B7KA 3CF6E 4OI4A 3ZFEA 1H2MA 5FZ8A 5CFCC 1Y9QA 2EXIA 3NSTA 1CAVB 2XONA 5JZGC 1XU1A 1S2BA 1GWLA 2BPA2 2QDNA 3LEKA 1NQJA 3EO6A 4DMIA 5FZCA 3IMMA 3BGAA 4FFHA 5KXCA 5IK5A 2QQJA 2VMCA 3FLRA 1SMVA 4XF9A 2PLV1 1G9FA 1JHNA 1QJEA 2UWBA 3HIFA 2J1SA 3K3NA 2Y6JA 4CCLA 1ZZBA 5JZGB 1UMIA 3LFMA 1XOYA 2BW8A 1HB4A 2PHWA 5KC6A 1TZOA 1ZZ6A 4M4PA 3VZKA 5KHKA 2HWF2 1KRIA 2ZGQA 4XDOA 4JDNA 1HV1A 1V6NA 2B4KA 2ZGKA 4ISQA 4K20A 2GN7A 4AXOA 1ZZ8A 2WFF2 4EN8B 4IV3A 5FAXA 3BU0A 4H7LA 1IPKA 3NKTA 2DVDA 3JB8A 1EAH3 4N53A 1AYM1 4I0AA 4H14A 3UYJA 2WFPA 4AGVA 4BQ1A 3I2JA 4AYUA 4K21A 1F5JA 2C26A 2A6WA 4LBQA 1QF3A 3AFGA 4G3YC 5A7WA 3TEXA 3MZHA 3D3AA 1OD3A 4CEYC 2VCCA 2DYCA 3I7DA 4EN7B 3BTYA 2FBEA 2WS92 1ND2B 2I45A 5A7QA 1V0AA 5D2AA 1QWRA 2YB7A 2EF6A 2WA4A 3PTRB 4R4XA 4Y5Z0 3SLIA 1RVF2 3V65A 2XOMA 3KWVA 1ZZ9A 3IN9A 3AVRA 4XF1A 2YPDA 3U14A 3VBHC 3W9AA 3LDKA 4XMIA 3N9MA 2DDUA 3VDAA 3GBWA 3NO8A 3AJZA 1KJLA 4JTNA 1NG0A 2PTMA 1GICA 1DGRA 1NZCA 1BK0A 1OPMA 3SEPA 1GQPA 1OLQA 2HEVF 4CA9A 2B8MA 4NHYA 4BU2A 1QHDA 2A1XA 2JECA 4CDUA 3B02A 3QLQA 1H0BA 3OD4A 1W2NA 2GN3A 1VBA1 4P9IA 4LKFA 1UOGA 3OG2A 3THCA 1XNBA 1GBGA 1EYBA 4QB6A 2GC0A 4JCKA 4Y1YA 4EYUA 1ENXA 5IVJA 3EMRA 1OFNA 3UV9A 3J7MA 4GAZA 1A78A 2I2SA 2VOXA 3J8F3 5GJ6A 1PGL2 3VHNA 3IIAA 5FP8A 1DQ5A 2MEV1 1XNCA 3OGSA 2ILMA 3Q9OA 3H8RA 4NHMA 3ZDVA 4E4ZA 2G9GA 4HSJA 3UJOA 3CHXA 5H9QA 3ZXLA 3A23A 5C8CB 1VBA3 5FXVA 2VNGA 1LKNA 4Q0PA 3AL6A 4XQWA 2RV9A 5FP4A 5H9RA 5DDJ3 1CX4A 3EYPA 5C3RA 3FBMA 1XNTA 5BYNA 2QBXA 1LHWA 4AGGA 4FOYA 1J83A 5GZFA 3WNKA 3OOXA 1NCRB 4Y1UA 4CDWA 2DFCA 3AMHA 5GZEA 3UETA 1VRH3 3SCGA 1KEXA 1PO22 1AR62 1DZRA 1S2EA 1WW4A 4W6XA 2QE3A 4YGCA 4BQ3A 5FYHA 1IQAA 3E6DA 2D3SA 5J48A 2BNOA 1OQEA 4GD4A 5IHRA 1DGRN 3BODA 4LTAA 2VXJA 2Q8OA 1VBC3 1KS4A 2W08A 2JG8C 4OMDA 4XURA 2GC1A 4UOJA 5FY0A 2P1BA 3N9PA 1QEXA 2Z69A 1GOFA 2VOWA 4XQ4A 2ENRA 1MS0A 1W8WA 4Y22A 4FO9A 2PXJA 4PBOA 4B4RA 3MPPG 4A4AA 3MLKA 5M0TA 1LEDA 1VBB3 1OI6A 2HJIA 3DXTA 1EV11 3HNYM 3ZXAC 5K0UC 4A45A 2XJTA 3USUA 5HBAA 3CIHA 2XJUA 1JH5A 3LGRA 2PN5A 1GV9A 3OGRA 2FD8A 4GJYA 2ZAAA 2ZBJA 4GKYA 1O3RA 1JN2P 3IMNA 4KNCA 1JYVA 1RUC3 1SBEA 5ABJC 1AR92 2WAAA 3D82A 3KV9A 4L11A 3ASIA 2JEMA 4C1XA 2PMWB 2Z42A 4TN7A 1SFPA 1OC1A 1POQA 1IGOA 2AREA 3MUY1 3OGVA 2D43A 2L9LA 2JWPA 4AEKA 2HEYF 2CL2A 4QWNA 1UIJA 3GJBA 4QPGB 2YYOA 5IWFA 1H9WA 1J1TA 2D5HA 2W94A 5FDBA 4BE3A 3BCWA 4ATEA 1AZDA 1M4WA 3HAGA 4BIFA 2FQPA 4QPGA 3AJYA 4K8RB 1DBNA 5T5PA 4CUGA 4CU6A 1O59A 3AYEA 4B29A 1W6NB 4RSUA 1W6PA 4QQHA 5ANQA 3VBUB 2ZGOA 1YJKA 4HKOA 3OUIA 2R072 1KD7A 2QQKA 1MS5A 3RI9A 4N7IA 4ASMB 5K8SA 5DG1A 3AM2A 4XXPA 5FY7A 4DIQA 1SBDA 2ERFA 4CDQB 4XUOA 1LHUA 1FI2A 1YO8A 3GJAA 1BJQA 4HPKA 1LGBA 2BUKA 2ZGPA 1V9U2 3ZLIA 4O7XA 3ZN4A 5IK8A 3ZN5A 1QNWA 2CTVA 4ASKA 1YYNA 2R041 4W8JA 4QDSA 3DPRA 2BYVE 4R4ZA 3B9CA 2BZDA 4CP1A 1EAH2 2CGNA 2XR4A 3AK0A 1RUI1 3HEIA 5FPZA 4XVHA 5IAVA 4Y24A 2VGDA 1H6XA 2JD9A 1FMD2 4AI1A 3TYJA 1QIQA 2Q4SA 5I8TA 1XSRA 3C8XA 1S0EA 2VW0A 1H8VA 1Z78A 2E26A 5JXGA 1YIPA 5DAQA 2ET1A 1W04A 1MVEA 4IEZA 1TME2 4JKLA 3J4UH 3VBRB 1FAYA 3T08A 5A70A 5FZ3A 1DG6A 2XHKA 4XZUG 5L19A 2J1AA 4HZFA 1ZRIA 2RDQA 2SLIA 1CAVA 4KGQA 2UWAA 2P37A 1TMF3 2ZMKA 1H1AA 1IG3A 3FLTA 5A80A 1A8DA 4HT1T 4CDWB 2WZR1 1UZVA 4NHXA 3IZOA 1RUNA 1BBT2 1O91A 5K7PA 4XDQA 2H6BA 5FPXA 4UFLA 3KT1A 4FPGA 2JG9B 3A0KA 5LBBA 3VDDB 2WSUA 1I3HA 4QGMA 1ULDA 2RS11 4E4SA 4AI0A 1MR5A 4LHSA 2GMEA 5F9TA 3NV3A 2G4IA 5FZEA 1EP0A 3H3UA 1Z7S3 3KCXA 1ZBE2 1ULGA 3JXSA 1UYPA 5CBLA 3O5SA 1YFWA 1RUE2 4QHZA 5GALA 1BHGA 1XE8A 1ZZ7A 3HD8B 1S0JA 3D4KA 1JXNA 4HVQA 2QQLA 4O61A 3RMYA 1VRBA 3WG4A 3ZSJA 2JG8B 3ZFFC 1IS6A 4E8CA 5IVFA 1QJX3 4LO4B 1MZEA 2CDPA 3LB9A 3MHZA 2CSGA 4UFKA 3SITA 2B42B 1HRI1 1W9TA 3TEWA 1DQ2A 5GLTA 3BALA 5T5JA 2Y64A 2F17A 2WFF3 3LEIA 5FKCA 4JX0A 5A1LA 1Y9MA 2RG4A 2HEWF 5KWRA 5HPOA 2OQ6A 3KGZA 2E7QA 2X05A 2Z5WA 4MO3M 1AYN2 1GP5A 4QKDA 5CG8A 5CNAA 5F5IA 2LRPA 2AENA 1WMFA 1IKQA 3LDBA 1H8TC 4QX3A 1SLAA 2EIEA 4DXSA 1G9AA 2WZEA 4HKWA 3PVEA 1RUOA 4V2WA 4JDMA 2V4VA 1AXZA 2VL4A 4JGZB 4YYOA 1UXZA 3DECA 4FTEA 1ZRRA 3C7FA 2VQAA 4UW4A 5K4LA 4BH9A 1W8FA 1MQTC 1T6BX 1CD3G 4AR2A 5SV8A 2VBBA 5FZKA 1HXS2 3Q8BA 5CKMA 2WQ8A 4QGLA 2DVAA 5FJHA 4LO7A 2GMMA 2RR11 1QJY1 3R4SA 5F39A 2B7YA 2EICA 2IXJA 3AB0A 4XF0A 1OQ1A 2CV6A 4YFZA 1VBD1 4YWAA 2ZX3A 4K1YA 4EN0A 3BVCA 4DY5A 5C71A 4EV0A 2JE9A 1XB9A 1LULA 4KG8A 2TBVA 2VCAA 4P5YA 2YFZA 2YBPA 3NKGA 5CKQA 3ZXEA 3NRUA 2JDMA 1J58A 1YIFA 4BK5A 4CUBA 2A3WA 1V6IA 5DUXA 1C3HA 2FDJA 4CU9A 4L99A 2BNNA 5ERLA 2OPWA 3K48A 1N3OA 2DBNA 2RMU1 3KB5A 2DUQA 1UKRA 2LM3A 5DN2A 4QDQA 2ORZA 1G9BA 5T54A 2W46A 3A7QA 2DU0A 4Q4X3 2V72A 5BUVA 1PZ8A 3M3IA 1NXMA 4LORA 1RMU2 3WF3A 5JI9A 3UKNA 5LB6A 1PNFA 1G7YA 4XPVA 1PO11 5BNOA 3GCWA 3VLBB 1UZYA 2KR2A 3WP6A 4OUEA 1YWKA 1CR7A 3S7IA 3DKWA 4BB3A 2IVJA 1HRV2 2DTYA 1O7FA 2AYHA 4MHUA 4AFBA 3BOWA 3RYRA 3EXUA 4A7YA 4XEZA 1ONAA 1TME3 2VQ0A 3B93A 5GLWA 1YFXA 3WF2A 5BV6A 5FZLA 3OUHA 4AEDC 4B1LA 1YI9A 5H9SA 4DRRA 4TWTA 2YG0A 4BLJA 5F8PA 4AEJA 4KH9A 2XVGA 1ZA7A 2WO2A 5K9YA 3BTZA 3RZMA 2EIGA 2OS2A 2W2IA 4DFSA 4FPHA 1HN0A 3G6JB 3M3OA 3N7JA 4XFGA 3WNPA 5JR2A 5AC93 3M4FA 3GZAA 1AYM3 3H42B 3T0AA 1X36A 2JDNA 3I2GA 4NVPA 1XC6A 3KVAA 2DTWA 3H1YA 2H0VA 4AAPA 5BY5A 1NY71 1LOCA 1TMF1 3ZSEA 1DYKA 1W6MA 1OHFA 4Q26A 2XWBB 4LA2A 1MQTB 4M3CA 4ZXKA 4OUSA 1HN1A 2WNOA 4MG2A 2A3YA 3HQRA 1TNRA 3FUOA 4AK3A 1XYNA 1PX3A 3USSA 5FYCA 4CEYA 4P9XA 3VBSA 1N1SA 1BK1A 3MW3A 3IDBB 1SQ4A 1UYZA 2OX0A 2IFRA 4KWLA 2GNTA 4M01A 3ZMOA 4A42A 3BI3A 1AR91 1JHJA 2DV9A 1OKQA 3ZFGA 4E4HA 1H8TB 3OPTA 4YG0A 1JUHA 2PAKA 2RJLA 2XLGA 1QOTA 5FYMA 3TEYA 2O1QA 4QMAA 3NQHA 1MACA 2R16A 1UY4A 5FPUA 3OB8A 4D7SA 3OD0A 2G9FA 5CFDA 4UT5A 2X53S 4D69A 2XBO1 4OQ9A 1IZ3A 4FT8A 2WNEA 1RXGA 4P02B 5FYIA 2D44A 2WNVC 1SDWA 3JZVA 2VNVA 3IPVA 3P5BA 4FOVA 4OHZA 4IE6A 5JIAA 2D6MA 2NYYA 4LBKA 2GAUA 4PLMA 1JYCA 2J1VA 1U5YA 2VU9A 1JU3A 2TUNA 5FPAA 3WDWA 3BTXA 4LKDA 3C7HA 3MEPA 4R52A 5IAXA 2W1QA 5ACA1 1IPSA 3SNMA 1JYNA 4P08A 1K5JA 2PAMA 2FHRA 5E1RA 2ARBA 1HQNA 1BEV2 2P5BA 2XUMA 2JB8A 3I97A 3RMXA 1XPWA 3RDIA 1I1EA 2GP3A 1JUIA 2DCTA 4ONUA 4IV1C 5EFUA 3KM5A 1CAWA 3TNPB 1PM4A 2C1FA 2Y26A 4B8EA 4TLFA 5FYTA 3B01A 4Q2FA 3OPZA 4CSWA 1AUYA 1KQRA 4NROA 3HNMA 1DZQA 1WBFA 4XACA 3VHRA 3PMEA 1VAMA 3AVSA 2Y0OA 5JXIA 5IVYA 2DVGA 2R043 4IL7A 5BPXA 2IVIB 2HLEA 2VZRA 2WFF1 3W21A 3B3QE 2R073 4RS5B 1ZBE3 1OLMA 2A73B 1LHNA 3SEEA 4K6BA 4NIGA 4W6WA 5FZGA 3URFA 4LQRA 2WNUB 3SISA 3ZN6B 4PHZA 2ZHNA 1Y3TA 2WWJA 3N4MA 1NCRA 4FTSA 3WG1A 3J7HA 2HWC1 2WT1A 1Y9GA 3O1VA 2PYTA 4LBJA 1SFNA 2R062 2DF7A 4QX2A 2WZR2 4GMP0 2WJSA 1P8JA 1BBT1 4RL7A 3T4HB 2BBVA 4AEMA 4NN0A 5C4WA 1RUC1 4I0WB 4M00A 1MEC3 2JG8A 5LASA 3USUB 3RZGA 1C5HA 1CZVA 4DQAA 4HXCA 2FDIA 2DBIA 5IVVA 2A5ZA 2YPJA 1U5ZA 1EY2A 1IQDC 2JE8A 1V70A 5EZWA 1LU2A 3PIGA 2V5DA 3MGUA 4OUMA 1PO13 1SLTA 3KQRA 3J7NA 2FCUA 4R9AA 4JQTA 1CGPA 2B46X 5JCTA 5L9RA 5C33A 2AH2A 1LESA 3MPBA 4KU7A 1RUD2 1E5SA 3ROUA 3O1OA 5FMOS 3KV4A 2P6CA 3O1TA 1OVPA 5F5CA 1NCQB 1CX1A 3H50A 5A7OA 1S0DA 3U37A 2J1EA 1HDKA 3IPVB 4AGRA 2KA3A 4COYA 2BRTA 5FY5A 4FP3A 4YW5A 4IESA 5F37A 3PIJA 4WVMB 2JDKA 2XMLA 3OGJA 1M06G 1D4M3 1Q8VA 1Q8OA 3NL1A 5KR7A 1JU4A 3JBG3 2ARXA 5EPAA 4CDXB 4K9SA 4YZ5A 3KZ4C 1C4RA 3POGA 2YC0A 3VBRA 4A6OA 5ABJB 3ON7A 4QM8A 2P3YA 1PHMA 4XJWA 3V0BA 4ZHNA 3ZPOA 1S55A 2VZUA 3WD5A 4LKSA 4EWEA 3RZLA 2BNMA 4XMAA 3HBZA 1QGLA 4Q4X2 1ODNA 4NWWA 3WOGA 3POEA 1ZBA1 2XJQA 4LLFA 5EJ1B 4LOTA 2PLV3 2JXAA 4LA3A 3KS7A 1XE0A 4JHZA 1C8M3 4IETA 1DIWA 4IEUA 3ZMNA 2VD7A 4AQSA 4CDUB 4KBBA 4HETA 5CYYA 3B5LB 3AKRA 1ENSA 1PNGA 1RHI3 1FPN2 1Q3EA 2DVBA 2R0FA 1AX0A 3PLQA 4K1ZA 5JOZA 5L9VA 3FC0A 5DZGA 5IW0A 4NWVA 1UY1A 2HWC3 5C9AA 1KS5A 2R1BA 4ES8A 1GP6A 3KF5A 4XIKA 3IDCB 4YW2A 4COVA 5I93A 4GXLA 3LE0A 3NWKA 3WG3A 5FZ9A 1LNSA 4CEWC 4XF3A 2ZX4A 3ZFGC 1UXXX 2JX9A 1WCDJ 1QQP2 3T1LA 3VD5A 4URTA 1H9PA 3CNAA 3ZN6A 3VBOA 5HV4A 2CY6A 3W59A 2LALA 2LTNA 1MZFA 2CAUA 4CCEA 4R8HA 4Q29A 4I01A 2QQMA 3AXDA 4O65A 3WW3A 5FXZA 5HCBA 1O4YA 4CPBA 5CAZA 3AMPA 1VBC1 1V6JA 3AC0A 2RS53 3ENRA 3ACFA 4YZ4A 4CCDA 1X8EA 3WQ7A 2CYFA 1DGLA 2ZACA 2JG9C 1UY3A 2WC2A 3JD72 2GH2A 2RJ2A 4OVEA 4WZFA 1DQ4A 3FLPA 3NNFA 4AQTA 4LO8A 2QJVA 2XKOA 5LA0A 3LIGA 1GNZA 1RUD3 2CDOA 3D5OA 3BIEA 2NMOA 5FV3A 4BMEA 1H30A 4Q5OA 4B4QA 1QJU1 1OA3A 3WCSA 4ARYA 3THPA 5JZGA 5FO7B 4FCAA 2HWF3 4CYDA 1NA1C 3WXPA 5FOJB 4IEPA 3AYAA 3LDRA 4D0QA 4XFAA 5CADA 5LWBA 4BQYA 1AL0G 1UX6A 3LQCA 4AVCA 3ZFFA 2XJRA 4L97A 5EYYA 1F4HA 1I6XA 2PLV2 1ASJ2 3E5UA 1W9YA 3CJXA 2WUHA 2XPJA 5C3SA 3LAGA 3KVBA 2ZS6B 5J1XA 2ZA9A 4BXSV 1JZ4A 5DAXA 4CDUC 3N36A 2XXZA 3O0VA 2FDGA 1PK6B 1Z0HA 2HWF1 2R063 4XTPA 2DCYA 5FMBA 3O1MA 3VD9A 3UNPA 4E2QA 3C7GA 4OHXA 1LENA 5FYYA 4KQ7A 2HWB3 3N9OA 1H8TA 4RFRB 3HMYA 4Q4V2 5JSPA 2WN3A 4CDQC 2HBTA 1FV3A 4CDXA 4P9LA 4G9SB 2Q30A 2PHTA 5L9BA 3V0AA 2E32A 3SQOA 4M3CE 2VR4A 4XE9A 4YLZA 5F3CA 1WMDA 2RM21 2Y33A 1D0HA 4IGQA 4Q4W1 1W6MB 2VOTA 2XQRA 4QXHA 2JIJA 3TNQA 2WS91 5C9AC 3HOBA 1LODA 2XLFA 1KDKA 2DFBA 2WRAA 5FBJA 4ZU4A 5GLZA 3LF7A 4NOTA 3AFKA 4QQLA 2YUEA 1GFF2 1RIRA 5JPNB 1UY2A 4RFT0 2CWMA 2WWUA 3I8TA 2A6YA 5JOYA 4YVSA 1SLIA 1SPPB 4E27A 3NJZA 1YQ6A 1OA4A 3ZVXA 3S30A 1LOFA 4JQRA 3MO4A 3NVCA 4Z82A 1NLSA 4H2AA 3OUJA 4JRAA 3K75B 1FOD3 1BQPA 3CBNA 1Q8QA 2VW2A 1RUE1 3M1HA 4FOQA 2AGSA 4I09A 1SEFA 1W9SA 1K42A 1AL21 2RHPA 4H7MA 4LE4A 4N7UA 4XC9A 2W9XA 3KGLA 2GNBA 1D4M1 5EJ3A 3WW4A 3VBHA 4AI2A 1SBFA 2GC3A 2VZQA 1GOHA 1XNAA 3ZR6A 2WZR3 4XUNA 3POFA 1WCQA 4YZ1A 4YM1A 3UGGA 4P9GA 4ZXEA 1QDCA 4D6QA 3VBHB 3WVJA 5FZDA 5LZ6A 2ID4A 4MXVA 5FUPA 3VDDA 3BU7A 1S0CA 2HH9A 1NZIA 4W65A 5A3NA 1HRV3 4EZ4A 5A3PA 1JYIA 3FFQA 3ZDSA 1US3A 4ZZ5A 4OHYA 1GUIA 1PGW2 1V00A 4RQPB 4ES9A 4ET7A 5KHGA 1NLRA 2CGOA 1C8M1 3WINE 1YI7A 1GZWA 2VOKA 1CAXB 2B5HA 2W39A 4FTBA 1REEA 1OFSA 1UD1A 4HK9A 3A21A 1VBE1 2HYKA 3DYOA 5FZBA 2Q8EA 5BNOB 5C3OA 2WYFA 3MFAA 3O1PA 2K2SA 5LY1A 5A7SA 2DCZA 4FPOB 1W0NA 1RUJ2 1JZ6A 1R091 3I4IA 2Y6FA 3H0OA 3K4AA 4LR4A 3O12A 1E57A 2ZPXA 2ZGSA 2D98A 1TG7A 3NNGA 4DXZA 5T5LA 3MF9A 1IG0A 3LPFA 1IS5A 3U75A 2PA7A 4HMZA 3APBA 3VZLA 4RGAA 2Y0IA 5F6LB 3N7KA 4HFSA 1T6GC 3H1WA 4TLGA 4EQVA 3UT0A 2OT7A 1AHSA 2QCSB 3ILFA 2X5IB 1PMHX 3I49A 5F5QA 3ZXGA 4V2VA 3KHCA 1PVC3 2GNMA 3ITQA 1AJKA 3ZPYA 3SHRA 1BBT3 3T2PA 2QQNA 1WLDA 1W8ZA 3LOBA 3WHUA 1VB4A 1X9TA 4R9DA 1A34A 4XJ8A 4HL0A 1RUH2 2FCTA 3IDAA 3K51A 2ZABA 3ME2A 3VBFB 1XRUA 1W6PB 1W8UA 3FBYA 3MDPA 4NRPA 5FZ0A 2BFUS 5CFDC 2BVVA 1R081 3VZNA 3VBOC 4C0BA 3E6CC 5FZOB 1WW5A 3NAPA 5ABJA 1EV13 2D3PA 4GJZA 3OCPA 3WR0A 4UFIA 1VLNA 3IAQA 4YVSC 1W6NA 4LK7A 5C5TA 4L92A 4AHXA 2YROA 3VKLA 3U78A 3OBAA 4L0PA 1DYOA 5FYBA 3IIIA 1RUG3 3ZM8A 1QU0A 3HJRA 1U5XA 3K77A 5JVVA 4EE2A 4YSFA 5BNPB 5BNPC 2QUOA 4LITA 3OEBA 1HB3A 3I2IA 3RWKX 4BQWA 4XCBA 2BVBA 4WVMA 3WDVA 5A1AA 2VUJA 3TAYA 4MHRA 1FPN3 3WV6A 1YUDA 4YNIA 1OURA 1VB2A 3LD8A 4R9BA 2ZGTA 4MSVA 5AVAA 4IERA 3WEZA 1K3IA 4CUCA 4FSJA 4WM8C 2ZHMA 3ORJA 2WNVA 4IW3A 1MS9A 1RUJ3 5DPNA 3W20A 1WUVA 4AHZA 2FMDA 2QQIA 2CGPA 1AR83 2IXHA 4FPJA 4LE3A 1JYWA 1RUI2 5FZIA 4LBMA 4WZCA 2W47A 3KMHA 1IS4A 1OPOA 3MICA 2BWAA 3ZFEC 4AQ6A 3JQXA 4YW3A 4GWNA 3JD73 5FREA 3GZUC 1QJFA 2Q5TA 5IK7A 4QU1A 1CPNA 1O4ZA 4D8MA 4IEYA 1OOPB 4YVWC 3JUUA 3M3QA 4COUA 5FZ1A 2RE9A 4LUKA 3U4SA 4P14A 2O0OA 3BKZA 4A44A 5GZDA 4K8FA 4COZA 3UL2A 2C6SA 5CEHA 1Q43A 4RGKA 5J98B 4YZ2A 1N3QA 4SBVA 2F4PA 2VMGA 3WP5A 1MS3A 2KM2A 4G4FA 4IGOA 3SH4A 1FOD1 2YGMA 4FPLA 4UAPA 3Q8EA 2W1WA 3MI8A 1LTEA 3NAPC 1ULFA 4QT6A 1SCRA 4SLIA 2IXKA 2WLQA 3D0JA 3R4UA 1TEIA 2Y60A 4OMCA 5LY2A 3AP5A 2YBSA 2XBO2 3GHMA 2VCMA 2WIIB 3RQ0A 1UZ0A 4OZOA 5KHJA 4A3XA 5F6KA 2FDHA 5LA9A 3WG2A 1RMU3 2GH8A 4FPCA 5JPMB 4FPFA 1REFA 2JDHA 3VD3A 2BV4A 2QQPA 1JZ2A 4PIYA 4L8QA 2OKXA 3IWZA 5KHIA 1ACCA 2WINB 2GMPA 5A1FA 3H8UA 3I3DA 5JMCA 4BYYA 5LEKA 3ZFFB 3PHMA 1WLCA 1W6OA 4CXWA 5DUVA 2W5FA 4JV4A 1UF2C 5GM0A 4BQ5A 5ACA2 5GZCA 1PK6A 3WW1A 2GNDA 1HRI2 4FPEA 2VZOA 1VRH1 5A3MA 4XHBA 3T1MA 3M70A 3H9AA 4KU8A 3VD4A 5DABA 2Y34A 2J1RA 1SG3A 5FIXA 4FQZA 1ASJ1 3E1F1 3KT7A 1O8PA 2VQTA 1DDLA 2JKXA 2BJSA 5I8SA 2VO5A 2WO7A 1QH6A 3CQOA 1AYN1 4NAMA 4UW3A 4Q8KA 5FYSA 1W0PA 3S7EA 4INDA 4QHBA 1K45A 1W05A 3LPGA 4NR1A 3U0ZA 4IEXA 1I9RA 3ZXJA 3D8CA 4QX5A 5FTTC 2AACA 3PVOA 1J3PA 2X10A 1LOEA 5FPVA 4BPZA 4PDWB 1UO9A 1R093 4Q1PA 1YHFA 5KHHA 2LS6A 4YGEA 4B4PA 1UAIA 1YC61 4YM2A 2H6CA 1W03A 4RR3B 1OF3A 1QOSA 1AR81 3ZXDA 3VL9A 1OMIA 1QJX1 4QM9A 5KXBA 3LZZA 4BQXA 3NW4A 2J1UA 3LWCA 2NP0A 4MXWA 4RD7A 4A2UA 1VP6A 4FVVA 2XDVA 4ARXA 1QMJA 2R30A 5FQ0B 5C5UA 2PHUA 1FX5A 1GQGA 3OBTA 4WM7A 3THDA 3P3PA 1NX9A 1O5UA 2A7AA 5CISA 2HWE1 2J22A 3N9NA 3D0SA 3FWEA 3WUCA 1QJY2 4DXTA 3AKTA 4GQ7A 5LATA 1R1A2 4WM7C 2MEV3 4DRVA 5L7OC 1PM7A 1QDOA 3WF4A 4CEWB 1OA2A 3AMQA 3F2ZA 5C6CA 5C8CA 2VY0A 2A3XA 5IVEA 1G6NA 1GNYA 4QKNA 1EV12 4QD2A 5DAPA 1O4TA 4Q1RA 3FHQA 4JHTA 5HCAA 4MGKE 1U0AA 3CJIA 2QQWA 1DU3D 1YRZA 1WA6X 2WA3A 3NNLA 5IFTA 3N9QA 4JDOA 2VOVA 4XOGA 3SH3A 4PIZA 4W50A 1XXNA 5JSRA 3GHNA 2ZX2A 4COWA 1YNAA 2JDYA 4KGGA 2YHJA 1QKQA 4QHOA 1RUD1 2IXIA 1RMU1 1KFXL 3P6BA 4M0NA 5A3WA 4LT5A 5FY4A 3BPSA 3M7AA 1AJOA 1XSQA 1D4VB 2BERA 3MV01 5D8AA 4DS0A 1YQ8A 4UI9L 2QQOA 4YG3A 5K0UA 3E5QA 3UGHA 1CN1A 1CQ9A 3PUIA 4QQ2A 3VBSC 4CP2A 1VIWB 2BGCA 2BOJA 2GZWA 1GNHA 3VHPA 3B9IA 3KCYA 1LOBA 1REDA 2IWGB 2B9VA 2RDNA 5DG2A 5HCFA 5A7NA 4JAAA 4LPLA 4E4DX 4PDWC 1HIXA 2VMFA 5A32B 3ABZA 2DUPA 1QXJA 3MFCA 1JTZX 1VMHA 2VAUA 4KWKA 4XJUA 3VBSB 3DYPA 4HN0A 4RQPA 1B35A 1UMHA 1FT9A 1KITA 3ZSMA 2WT0A 5DUUA 3PUQA 4Q4X1 2WBKA 5F5AA 1VMJA 1WZXA 4V1PA 1ST8A 2RDSA 3A22A 5DAWA 4N9IA 5FUNA 1RGSA 1JW6A 3J9SA 2W0XA 5C3QA 4UXAA 2A75A 3JB4C 2HWD2 4QXBA 5A7PA 1FPN1 3POSA 3ACGA 1QXPA 1YEWA 2O8OA 1H1IA 3ZKUA 2DCJA 2VVDA 1TME1 5LK5A 4BMBA 2BTVC 5EJZB 4BZ4A 2HKXA 2P2KA 3CJIC 4Y4YA 5FZ4A 4WM7B 5CFCA 1W6QB 2IFWA 4I3GA 5L7OB 3FE5A 4U36A 4FQ4A 5J37A 1QQP1 2X5IA 4HVRA 4AQ2A 5A6XA 1RUH1 2R0HA 3LCPA 4A7KA 2DU1A 2OZJA 4WVWA 4LK6A 2H0BA 3AZVA 3FMGA 1DYPA 4XILA 3RPQA 3FUQA 3TEZA 4GWJA 1DQ6A 1HRI3 1WW7A 4CEWA 4I3PA 5E89A 3VUOA 4CP9A 4XJAA 2A6XA 1CJDA 1CAWB 4M4RA 1C57A 3RYKA 4AI3A 2DVFA 3J8F1 4HPKB 5APAA 1ZRCA 2ZZJA 1L7QA 4LLOA 4ISRA 5A6ZA 2AC1A 2D6KA 4AVTA 5JMOA 4XDPA 4RA0A 5F32A 4Y5SA 1NAEA 1AR93 5L36A 2XB6C 4NPRA 1BCXA 2YV8A 1CIYA 3FZ3A 1MS1A 1OVSA 4QDRA 4GB31 2WL1A 3VGIA 3KD4A 1V6OA 2VW1A 3WDXA 3OYWA 1HV0A 4JZRA 1OKOA 3HN3A 4X8NA 5F3GA 4AG4A 3NV4A 4HLTA 3R6SA 3WHTA 4BXFA 1F8VA 2ZEXA 3I2FA 2WQ4A 5EQUA 3VL8A 4DUXA 2P6HA 2VE1A 1GWKA 3N3HA 5LW9A 5J09A 3WCRA 4GA9A 1J3RA 1Y4WA 1J3QA 2Y6KA 4YFWA 3RS6A 3LA7A 3PMSA 5IATA 5IT6A 1BMV1 1WMXA 4XZPA 2PQQA 2K0GA 2JG9A 1LU1A 4MGQA 4Y4RA 4ZU7A 4YARA 3FJSA 1MZ5A 1W2AX 1XNDA 1URXA 2ARAA 3F95A 3HT2A 4OI2A 4E9KA 5ACA3 3DXUA 2JDZA 3DCQA 5SV5A 1LOAA 4DEQA 3M2MA 3NJVA 4J1WA 5JOXA 5KBFA 3O1SA 3EQEA 1PIV3 2D93A 2J7MA 1NCRC 2PQSA 1R1A3 5LBEA 2XLAA 5FUIA 1H2LA 1ZREA 4Z2AA 1O3QA 2C0ZA 2XVKA 4KMQA 1AYN3 4I2OA 4P9JA 2VUCA 4IE7A 3ILNA 3QH6A 1YFUA 2XJPA 2HWC2 5G04L 2OXBA 4FFIA 1VE0A 4NHLA 4UW6A 1OUSA 2RM22 4BISA 5JSOA 4CEYB 1LGNA 2R061 1HXS1 3KCCA 2Y6HA 5FZAA 1UOFA 3VBFC 1PGSA 2Z2SB 2RR12 5CA6A 4JRLA 4HKLA 2OPKA 5JI7A 2QDRA 1JOBA 4AEDA 1MQTA 2K46A 1RUC2 1OOPC 1W2OA 2X29A 4M3CB 4YVWB 3VZOA 2ET7A 4LHLA 4C91A 2A71A 4UW5A 4Z1VA 5A3UA 4O9EA 5D1IA 1DQ1A 5JR7B 2WDBA 4MOAA 2YXSA 5L7OA 5EXOA 2WYSA 2NN8A 5FLJA 2JDUA 4QPYA 1ULCA 2D6LX 2UYBA 4META 1GQHA 1CIWA 4AVBA 3WQBA 4C0HA 1XYPA 3DYMA 3OEAA 5JWPA 1HXS3 1GZCA 4P9WA 2P3IA 3PVNA 2E9QA 2C5DA 2SBAA 4X6RB 3NJYA 4LBQD 1ZNPA 3ACLA 1L7LA 4JTOA 4EWAA 3GM8A 2NMNA 2ZKNA 4Y26A 5A6QA 2ZX1A 2JB4A 2BDRA 5DZEA 2IUWA 1HQLA 2AUYA 2QFEA 1UPSA 3OY8B 4QPWA 2C9KA 4WM8B 4EZHA 3OPWA 5T55A 1ULPA 1WWYA 2EXHA 4MGSA 1G8WA 3U11A 4QQPA 5JOWA 1AR63 1PO23 4MGTA 1MEC1 5D21A 3AP7A 4XFHA 1AR73 3PNAA 5LBCA 1LOFC 1RHI2 4IE4A 2TNFA 3WT3A 1YLLA 5FCCA 2FDFA 4BA6A 2JDPA 1PGW1 1BVVA 1ZRFA 2I07B 4S2HA 1C8M2 1ASJ3 3N7MA 4W6YA 4DPNA 4M0HA 5EIYB 3MIDA 1S0IA 3I59A 4OULA 4CCMA 4NE9A 5E16A 4AVSA 1W2TA 4HN1A 2ZAHA 4DINB 4PBPA 1ZZCA 2PHXA 1ND2A 1QJX2 2EXKA 1BYHA 3VBOB 1VBB2 2VMHA 1S0GA 1SLCA 5C3PA 1ZBA2 2F4LA 3UKVA 4QGNA 1IOAA 4GH4C 1K5MA 3SXWA 2E33A 3RZHA 4PJYA 1N1VA 5D8AB 1JODA 5JIUA 4PQ9A 2J1TA 1RC6A 3QBQA 5G05L 1SCSA 3ES1A 5JAXA 5EP9A 1RVF1 2TEPA 5DAVA 2WZ8A 3GBGA 4DNYA 1NY72 4FOWA 2BQPA 3HPNA 3LEMA 1Q5OA 2I74A 1JZ3A 1EPZA 5LEJA 3JBG1 1LHVA 4GALA 4IGPA 5K0UB 1OD5A 3OTFA 4XTMA 5CKNA 1OSGA 1EUTA 5LA2A 3VD7A 1JYTA 3AZYA 4RHV1 1HQWA 4UBHA 4BQ2A 4EN9B 4P5HA 4B1MA 3TOJA 4IE0A 2W92A 4XFFA 2ZEWA 3MLLA 2D6NA 2QZ3A 3FN9A 4CRQA 2BEOA 1D2SA 2QKDA 4MX3A 2ARCA 5DUWA 4AHWA 3EJKA 5C9AB 2B39A 4BIOA 2ZGLA 2OIIA 2W1UA 4URAA 5IFPA 1CAXA 4GMP1 1GMMA 1WW6A 4R9CA 3VKOA 3GYDA 3H3ZA 5AC91 1CVNA 1PGL1 4Q0SA 1OOPA 4FFFA 4QX1A 2MEV2 2AZ5A 4ATFA 2YMZA 4RN5A 5C8WA 3K2OA 2OUJA 2XGXA 4L9BA 3ES4A 1GANA 2RJKA 1LCLA 2BU9A 1UX7A 4YGBA 2CU5A 4QKFA 3M8LA 4YM3A 1DLLA 1PK6C 1NOVA 4MGZE 3NV1A 4CCOA 4GMP3 1FMD3 1OF4A 3L9JT 1O5LA 3WQ0A 2N7GA 2RS33 3EHKA 1DFQA 2BFUL 4YRDA 1EPWA 4MGIE 4ZY9A 4A6SA 4D3WA 1HB1A 3BYWA 1V6LA 1N1YA 2JICA 1ENQA 2VXRA 1LECA 4TXWA 4CUAA 4GH4A 4CP0A 3JU9A 3O1UA 3V64A 2RS52 3KV5A 5A3LA 1Y43B 1UWWA 2XJVA 3AZWA 3L2HA 1OT5A 4WM8A 4Y1ZA 1X9PA 4AL9A 3I3MA 4IDZA 4ZU5A 3ZX7A 1RITA 1G86A 3AZZA 4QPIC 4LKEA 1ALYA 2C24A 3ACHA 4TSVA 5DDJ1 2CNAA 2FCVA 3SKVA 1W8OA 2B45X 2D5FA 3Q8AA 4Q4V1 4CU7A 4TYSA 2E53A 4UF0A 1PVC2 5JXHA 1LGCA 1VAKA 2Y6GA 1DP0A 3VDDC 3B94A 3PL0A 3WDYA 4O9GA 3HR9A 4LUMA 3MIBA 4IXLA 1DHKB 2E6VA 1KXGA 1ZM1A 4QX8A 4XUPA 3ZXFA 3CL1A 5BXXA 4AAXA 2VZVA 2RMU3 4LEJA 1L3JA 2ORXA 2GU9A 3AP4A 4NJ4A 4CDWC 2NQYA 3T3YA 1H2NA 1LR5A 1SPPA 4XABA 2VUAA 2FZ1A 3T2TA 1ND3C 2QNKA 3K4ZA 3OBZA 4YW1A 3I54A 4XUQA 1W3VA 2R49A 1X82A 4MVTA 4EROA 4YW6A 1OLME 2VCBA 1FYUA 2W68A 4IQPA 1CJPA 3PTYA 4D7YA 4QXKA 1RUF1 4F83A 1FNZA 4CCKA 4XW3A 5IK4A 2YDEA 3WP4A 1JMUB 1RUG2 4J6GA 4MXWB 4XFBA 1XBFA 5FYUA 1OXCA 1O6UA 2YFUA 1H4HA 1S0FA 1W9WA 5GLVA 4CDQA 4EJRA 3O1RA 4B3NA 3AKPA 3AL5A 4HANA 2R7EB 2ZGRA 2WNUA 4QB2A 1APNA 3FX3A 5FP3A 2GDFA 2ZEYA 3PUSA 2ZMNA 2PHFA 2X09A 3DGTA 5JDBA 4CZSA 5HXMA 5CG9A 1GOGA 2WS93 2G9ZA 3RI8A 4BCUA 1RUF3 3PU3A 1MPXA 4CTEA 2OW4A 2Z4FA 4QQOA 2VBPA 4Z2WA 3X29B 1H2KA 2P4EA 3SMHA 1RJ7A 1W8TA 3EB7A 4IV3C 4PI0A 5EV7A 5AFEA 4FI9A 2VNOA 3IKWA 2LROA 1C28A 5J7MA 4LBLA 2KXLA 3ZSLA 1F2NA 5AVPA 2Y8KA 1CAUB 1SHWB 1QJU3 1UKGA 5CU1A 3AYCA 3KT4A 2OQ7A 4LHNA 5FKBA 4J25A 5CB7A 2ZXQA 1AR82 3H7YA 2VZ3A 3POWA 4YGDA 4UFHA 4TTGA 2ZZQA 3CZJA 3IM0A 1TQ5A 1AR72 4QPGC 2W87A 3RJRA 1DGWA 4Q8LA 1RUJ1 1R64A 3AYDA 5DXDA 1R092 2YU2A 4KI5M 3PVBB 4BDVB 3A0NA 5F7UA 1YQCA 3DUIA 2HWE2 4LIVA 4CXXA 3LSDA 4RHV3 5FYZA 3DV8A 4LBQB 1MZ6A 1NA1A 3TRSB 1R1A1 4XCAA 2CHHA 4KWUA 1U5IA 3A4UA 4XAEA 1GZ9A 4PI2A 1LHOA 3KF3A 1E5HA 4JGZA 3L2YA 1JOJA 1QXRA 3GGLA 3AP9A 5FO9B 2MHFA 4DZGA 2FDKA 1JI6A 2LW8A 1PIV2 5HI0A 2AEZA 4XBLA 3BTAA 1ZBE1 4QX0A 1GP4A 1X50A 3JQWA 4YM0A 1GZTA 2QVSB 3ECQA 4OFGA 3U10A 2W95A 2VVEA 3MIGA 3K46A 1CZTA 3OY8A 5FJKA 1RVF3 5LK7B 3MUZ1 2E7TA 4ZS2A 5B4XA 1TE1B 1HX6A 2ZCWA 4UYBA 5CVRA 2Q1ZB 5IJRA 3W5NA 2ETEA 1BZWA 2BBAA 4D6SA 4OQ8A 3P3NA 4BHPA 4GB33 1VR3A 4I0BA 3BUCA 4FPKA 4C8DA 1JZ5A 2G1MA 1VMFA 2XL9A 3WSOA 1WMEA 2CAVA 4PCRA 3N7LA 1RUI3 1L7RA 1RHI1 4CVUA 5F2WA 1Z7S1 4ZZ8A 4UWDA 4Y1VA 4GKXA 4KBZA 1RTVA 1UN1A 4Q4Y2 2EALA 1F9KA 2GALA 2VULA 3BPZA 4CDXC 3MBWA 4IEOA 1C1FA 2VUDA 2XHNA 1VALA 3HT1A 4XJZA 5ANNA 4LNVA 2WZPP 5J96B 1H4GA 1QJU2 3BIWE 4BLIA 1HKDA 4Z07A 3LFIA 2OUHA 3C7EA 3GXUA 1E5IA 2ZTNA 3GBFA 3WNXA 1FV2A 1MS4A 3QACA 2WWSA 1CONA 3AKSA 4HK8A 4FXKB 4F8AA 1VBB1 3GDBA 3WUDA 3VZJA 4N43A 4Q4W3 4P9YA 2JD4A 2DURA 1DZTA 3ALQA 2QZ2A 1NXD1 1ZYBA 2VC9A 3POBA 2DCKA 5ISLA 3SCFA 4XYXA 3ZIXA 1NE4A 2B9UA 1SACA 3K4DA 2HWD1 3I3EA 4A41A 3WF0A 2RS32 1DLCA 1AXKA 1E5RA 3NV2A 5E6HA 5LBFA 3VKFC 4Z8BA 1NKGA 1OH4A 3JBG2 3O14A 1OH3A 2WNVB 4PF5A 3UJQA 3CZUA 3BN6A 5A32A 1QOOA 3CO2A 4K40A 3RJ2X 2Q8DA 2X8KA 1AF9A 4LO6B 1LAJA 2WLPA 3PU8A 4QU2A 3ELNA 3MW2A 4RHV2 5FPBA 1W8HA 3THTA 2EIBA 1F31A 2EA7A 2JKBA 2ZOEB 3RSJA 3WDTA 5FK7A 5T3NA 1O3TA 1UNBA 1ND3A 4YW4A 2D6OX 2HWD3 3INAA 4AZZA 1G9DA 2VH9A 4BK4A 4LXLA 5C4WB 3POIA 3TN92 4DEVA 4XBQA 5FY1A 3HQUA 2AEYA 2RR13 2BOIA 2VJXA 1FNYA 4XQDA 1UPIA 2P17A 1UY0A 3WNNA 1I5PA 1OUXA 3VBFA 3M3EA 3S5QA 2WKKA 1PO12 2O14A 2ZHLA 1O8SA 4KL1A 3WNMA 1JOPA 4YVWA 3LA2A 4S2FA 5B4NA 4YPJA 3NAPB 3O0WA 3ZSKA 2E63A 2ADEA 1SZBA 3BB6A 2C9AA 1GLHA 3HNBM 3MLJA 5LRSA 5FZMA 1HRV1 1UMZA 1BVP1 1J84A 4H3WA 3U1XA 5C8CC 5FZHA 1FATA 4UBGA 2HWB1 4Y1XA 1IS3A 2R071 2VTFA 1F15A 1KDMA 1PZ9A 4GB32 4L2NA 1LOGA 5FYVA 3SCHA 4A3ZA 2FMYA 4IV1B 4JGYC 4DUVA 3LA3A 4D94A 4QB1A 4Q0VA 3V0AB 1W6QA 4XIOA 2ZMLA 3SC7X 4NIHA 1VBE3 1D4M2 4AVVA 2ZEZA 1GU3A 4IE5A 1D7PM 4MZUA 4PQQA 4ASLA 1KGYA 2GP5A 4LIUA 5FY9A 4IEVA 1F4AA 5F2SA 1COV1 1W39A 2R1DA 3E6BA 3VBUA 1RYYA 2RS51 3SH5A 2JIGA 5CFCB 3HN1A 3VN4A 2BP6A 4MADA 4LULA 1W8NA 2WN2A 3POYA 4NMIA 4RGGA 4WVVA 1QY4A 1WLWA 3C2UA 2BGOA 4B7EA 3QCWA 3EBRA 3N35A 2WSVA 4N43C 5FMDA 2DUOA 1CWPA 3CMGA 5FZFA 3BOPA 1UOJA 1R1ZA 2OZ6A 4C1WA 2OYZA 4HG6B 3R4DB 1AX1A 1MS8A 1RUE3 2XKPA 2Q8CA 3ZIWA 4PIXA 1C8NA 1JBCA 1PVC1 1UQXA 1K5MB 1K5MC 3FFZA 4Y5TA 3IDEA 3VKNA 5BNOC 4XXAA 1AL23 2IC1A 2NZ9A 3ZYBA 1C5IA 2XG3A 4XBNA 1ZBA3 4BWOA 4HONA 1ND2C 5H9PA 3HQXA 4DOUA 3NJXA 2D7FA 1O3SA 1OQDA 5CFDB 2UYAA 3ZYPA 2D3RA 1W2UA 3KQ4B 3ETQA 3KLSA 3VV1A 1ENRA 1B35C 3T09A 1KJRA 2D6PA 1SLLA 4IUGA 3RWNA 2PELA 4NPLA 5F3IA 3CU7A 1RL3A 4PF1A 1RUF2 2VZPA 5CZKA 3FHIB 4LBOA 2Q1FA 3UGFA 3WDUA 1RUG1 4N43B 2YBKA 4XUTA 1YJLA 5C70A 2Q1MA 1XU2A 3P1IA 2VZSA 3WW2A 2HWE3 4OI0A 3R0RA 3RNSA 1QQP3 2QQVA 1ZA4A 1QNYA 1Q56A 3GALA 4JGYB 1UOBA 1DQ0A 2IXLA 3LOIA 1VBA2 1GWMA 1GKBA 1RINA 4MGYE 2X5IC 4QKBA 2YY1A 4HBNA 3O7OA 5DZFA 2ZGNA 3GZTB 3S6PA 1R082 5GLUA 3B7MA 3Q8FA 3WX5A 2E31A 4QXCA 4Y33A 3UKTA 2GC2A 2UY8A 4Q0UA 3VDBA 4N53B 5E8AA 4K7JA 1B35B 2XBO3 2GSYA 4Z92B 4AFCA 4AEDB 1FXZA 5FLIA 1V9U3 1YXWA 2PHLA 5D8AC 3C7OA 3VB9A 2XWJB 4WBBA 4BOWA 3G7DA 4AFDA 3POJA 3QOPA 4AFMA 3PUAA 1COV3 2R32A 3I2OA 2BGPA 2NLRA 4XETA 2P3JA 1GR3A 4RYDA 4PDWA 3AXEA 3JCIA 2ZKLA 2UWCA 4I02A 2QQUA 1H6YA 5LA1A 4X6QB 4ZPIA 3MIHA 2W1SA 4GWIA 1QH7A 1V6MA 4XFCA 4I30A 4Y20A 3T0BA 4RQPC 3VHOA 1B09A 3WY6A 4YG6A 2VECA 5GKAC 5A3OA 2V09A 2W52A 4AE2A 2ZGUA 3MV11 1SLBA 4BQ4A 1WCKA 1X8MA 4E2SA 5A7WB 3OBRA 4K3UA 3N9LA 3AKQA 3QH7A 2EAKA 1WBLA 5FXXA 1VBD2 1WGPA 5FPLA 2RS13 4AOCA 1AXYA 4TZDA 1V6KA 4NO4A 3MW4A 3H7JA 1IPJA 4JC1A 3RRDA 1UU5A 3VZMA 2ATFA 3T2QA 4HVOA 5FZ6A 1WD3A 3H3LA 3I2HA 3PDQA 1RJ8A 3I59B 4LHKA 4Y3OA 4KWJA 3IAPA 1NA1B 3DL3A 4OHVA 4AI8A 4MH0E 4NIDA 1NT0A 2ZJCA 2ES3A 4EN6B 1C1LA 1HW5A 2RMU2 4QPIA 1AX2A 4Q4Y3 1TVGA 4NIIA 1N3PA 2D40A 4J1XA 1FOD2 1NLQA 3HBKA 3S57A 2DWRA 3KHBA 4U2AA 2YC2A 3T4VA 5A33B 1HB2A 3H1MA 5FFOC 4IEWA 4C90A 1T2XA 3DPRC 5AC92 3J8F2 5F1RA 4AVAA 3K3OA 3T30A 2V73A 4NPMA 1ULOA 4JGZC 3VBRC 2XL7A 2Y38A 2WT2A 3OF1A 1PMIA 2ADDA 1Z7S2 1BXHA 2QTWB 2FZ2A 5C4WC 1QJZA 1UU4A 2UU8A 3OSDA 2MNGA 1W90A 1PX4A
chains in the Genus database with same CATH topology
4H55A 4RS5A 3CLPA 1NQDA 4LBNA 2PAEA 5BNNC 4YZ3A 3DN7A 2VNRA 4PLNA 1VRH2 2MPFA 1Q8SA 4MUVA 3ZXKA 5AFBA 3IT8A 1UL9A 1BMV2 2A70A 1CPMA 1G9CA 1WLTA 4OHWA 4PLOA 1NYWA 3AMMA 1TNFA 1EAH1 2EXJA 4FAHA 1BKZA 4F3JA 3J26N 2IZWA 4JGYA 5TSWA 1FMD1 3RZZA 2D97A 3MF6A 5KXDA 2RS31 1TMF2 3TN93 5KXEA 2VPVA 5J3UA 4X8PA 1HLCA 1WD4A 4Q27A 3RYPA 3UK9A 3WP3A 2VVFA 4M3CF 4WVZA 3ZYRA 3O0XA 1XQNA 5I0TA 1AYM2 3WQ1A 3LSEA 2E51A 5T50A 2R6QA 4AFAA 1SFYA 4KG0A 1GYKA 2ZHKA 4ITCA 3TN91 4F7ZA 4OI1A 3GNEA 4IV3B 2CWSA 1PZ7A 4IEQA 3GF6A 3C3VA 3ZFGB 2XH6A 3W58A 4S2GA 1S1AA 3WZ1A 1NCQA 1LJ7A 3ZO0B 4FBFA 3R05A 2P34A 5HXVA 1DGWX 1VJ2A 3B00A 1LEMA 2ZX0A 3U4XA 2PHRA 5FLHA 4BM8A 1XYOA 3AX4A 3OYWB 3CEWA 3I2DA 1RUH3 4EWDA 4FAGA 4LO5B 3CJIB 5L73A 2VG9A 1BEV1 5IUQA 2EVXA 1I5ZA 3KSCA 4DB5A 1COV2 3ST7A 3MIEA 2PFWA 1N47A 4ZKTB 2LUWA 1NE6A 1MEC2 5BNNB 1WA4A 2A6VA 5A33A 5FQ0A 4IV1A 4FP2A 1A3KA 1D0GA 4OZXA 2E7AA 4FXGB 3VBUC 2AR6A 3PJQA 1KFUL 2JE7A 3U07A 5T5OA 4RR3A 1CESA 1A8MA 4XF4A 3MIFA 4OLLA 1BEV3 2O8QA 1ZVFA 4AHYA 1MVQA 1VBD3 3OJBA 4RR3C 3AMNA 5LRRA 1XNKA 1AR61 1PO21 1ND3B 1AR71 4XHXA 2F6BA 3WLUA 3ZYIB 3TWIA 3DF0A 1UW8A 4Q4W2 5I8YA 1R083 4HSLA 2Z79A 4QPIB 4AF9A 1XE7A 3ZFEB 1W0OA 3VKMA 1U12A 5KC5A 2ZGMA 4DY3A 1NCQC 2NM1A 1UZZA 1PIV1 1H1MA 3M3CA 2Q0AA 5FOBB 2BWCA 1POV0 3V56A 5I91A 1AVBA 1X7NA 2RM23 1IKPA 1AL22 4FPYA 4NHKA 4YM1A 1DF0A 4ORFA 1POV1 3PJYA 4Y22B 3S0MA 4N90A 4S2DA 4Y20B 1W6OB 1GSLA 1Y7BA 1J59A 1F5FA 1YCIA 4A7ZA 2NPIA 4XJ9A 4AW7A 3OGGA 5I0SA 2YZ4A 3B69A 1OLRA 5I0RA 1GZWB 4XFIA 4RS5C 1LB2A 1ZRDA 1POV3 1WCSA 5FO8B 2YGLA 5J36A 1UCXA 1A6CA 2JJ6A 5FRAA 5I0UA 2V5YA 2P3KA 3IBMA 3RG0A 4N53C 2WNUC 1UIKA 1VBE2 3DPRB 4JVAA 1VAVA 3E97A 2PHDA 1V9U1 2OA2A 3V0BB 4GULA 5BNNA 2VMIA 2R042 4MV2A 5EYXA 2XJSA 1X33A 1ULEA 3AP6A 1YFYA 3D6EA 5FMOL 1N1TA 1Q8PA 1S0BA 4E2GA 5JLVA 5FBZA 5BNQA 4GWMA 4N9HA 2UY9A 1ZX5A 3TBDA 5DDJ2 3TB0A 2OVUA 4GH4B 5CIRA 2A6ZA 3LKJA 3ILRA 3ATGA 1LRHA 1UU6A 1QJY3 3ZYJB 4WV8A 3E5XA 5E88A 2WQZC 5GZGA 1PVXA 3HWJA 3QD6A 1IHMA 1VBC2 4MLOA 3MYXA 5B2GB 4D7TA 5BNPA 3ZYGA 2RS12 2K9ZA 2IXCA 4GIQA 3JD71 4YVSB 5EWSA 2JENA 1D2QA 4Q0QA 4AWDA 1RB8G 3AZXA 1CAUA 5T52A 2EAAA 1J1LA 1S2KA 4Q4V3 2UURA 2HWB2 2XVLA 4MYEA 4B7KA 3CF6E 4OI4A 3ZFEA 1H2MA 5CFCC 1Y9QA 2EXIA 3NSTA 1CAVB 5JZGC 2BPA2 1XU1A 1S2BA 2QDNA 1NQJA 3EO6A 4DMIA 5KXCA 5IK5A 3FLRA 1SMVA 4XF9A 2PLV1 1G9FA 1JHNA 3HIFA 2UWBA 1ZZBA 5JZGB 2BW8A 2PHWA 5KC6A 1ZZ6A 5KHKA 3VZKA 2HWF2 1KRIA 2ZGQA 4JDNA 1HV1A 1V6NA 2ZGKA 4ISQA 4K20A 2GN7A 4AXOA 1ZZ8A 2WFF2 4EN8B 4IV3A 5FAXA 4H7LA 1IPKA 3NKTA 2DVDA 3JB8A 1EAH3 4N53A 1AYM1 4I0AA 4H14A 4AGVA 2WFPA 4BQ1A 4AYUA 4K21A 1F5JA 2A6WA 4LBQA 1QF3A 3AFGA 4G3YC 3MZHA 4CEYC 4EN7B 3I7DA 2DYCA 2FBEA 2WS92 1ND2B 2I45A 1QWRA 2EF6A 2WA4A 4R4XA 4Y5Z0 3SLIA 1RVF2 3V65A 1ZZ9A 3IN9A 4XF1A 3VBHC 3W9AA 4XMIA 3GBWA 3NO8A 3AJZA 1KJLA 4JTNA 1NG0A 2PTMA 1GICA 1DGRA 1NZCA 1OPMA 1OLQA 2HEVF 2B8MA 1QHDA 2JECA 4CDUA 3B02A 3QLQA 1H0BA 3OD4A 2GN3A 1VBA1 4P9IA 1XNBA 1GBGA 1EYBA 2GC0A 4JCKA 4Y1YA 1ENXA 1OFNA 3UV9A 1A78A 2I2SA 2VOXA 3J8F3 5GJ6A 1PGL2 3VHNA 3IIAA 1DQ5A 2MEV1 1XNCA 2ILMA 3Q9OA 4NHMA 4E4ZA 5GZCA 2G9GA 4HSJA 3UJOA 5H9QA 3ZXLA 5C8CB 1VBA3 2VNGA 1LKNA 4Q0PA 4XQWA 5H9RA 5DDJ3 1CX4A 3FBMA 5BYNA 1LHWA 4AGGA 4FOYA 5GZFA 1NCRB 4Y1UA 4CDWA 2DFCA 3AMHA 5GZEA 1VRH3 3SCGA 1PO22 1AR62 1DZRA 1WW4A 4W6XA 2QE3A 4YGCA 1IQAA 3E6DA 2D3SA 5J48A 2BNOA 1OQEA 1DGRN 3BODA 4LTAA 2Q8OA 1VBC3 1KS4A 2W08A 2JG8C 2GC1A 2Z69A 2VOWA 4XQ4A 2ENRA 1MS0A 4Y22A 4FO9A 4PBOA 4B4RA 3MPPG 3MLKA 1LEDA 1VBB3 1OI6A 2HJIA 3ZXAC 1EV11 5K0UC 2XJTA 3USUA 5HBAA 2XJUA 1JH5A 3LGRA 2PN5A 1GV9A 2ZAAA 2ZBJA 4GKYA 1O3RA 1JN2P 3IMNA 4KNCA 1RUC3 1SBEA 5ABJC 1AR92 3D82A 4L11A 3ASIA 2JEMA 4C1XA 2Z42A 1IGOA 2AREA 2D43A 4AEKA 2HEYF 2CL2A 1UIJA 4QPGB 2YYOA 5FDBA 1H9WA 1J1TA 2D5HA 4BE3A 3BCWA 4ATEA 1AZDA 1M4WA 3HAGA 4BIFA 2FQPA 4QPGA 3AJYA 1DBNA 5T5PA 3AYEA 4B29A 1W6NB 4RSUA 1W6PA 4QQHA 3VBUB 2ZGOA 1YJKA 4HKOA 2R072 1KD7A 1MS5A 3RI9A 4N7IA 4ASMB 5K8SA 5DG1A 3AM2A 4XXPA 1SBDA 2ERFA 4CDQB 1LHUA 1FI2A 1YO8A 1BJQA 4HPKA 1LGBA 2BUKA 2ZGPA 1V9U2 3ZN4A 5IK8A 3ZN5A 1QNWA 2CTVA 1YYNA 2R041 3DPRA 2BYVE 4R4ZA 3B9CA 4CP1A 1EAH2 2CGNA 3AK0A 1RUI1 5FPZA 4Y24A 2VGDA 1FMD2 4AI1A 3TYJA 2Q4SA 5I8TA 1S0EA 2VW0A 1H8VA 1Z78A 1YIPA 2ET1A 4IEZA 1MVEA 1TME2 3J4UH 3VBRB 1FAYA 1DG6A 2XHKA 5L19A 4HZFA 2SLIA 1CAVA 4KGQA 2UWAA 2P37A 1TMF3 2ZMKA 1H1AA 3FLTA 1A8DA 4HT1T 4CDWB 2WZR1 1RUNA 1BBT2 1O91A 5K7PA 4XDQA 2H6BA 5FPXA 3KT1A 4FPGA 2JG9B 3A0KA 3VDDB 2WSUA 1I3HA 4QGMA 1ULDA 2RS11 4E4SA 4AI0A 1MR5A 5F9TA 2GMEA 3NV3A 2G4IA 1EP0A 3H3UA 1Z7S3 3KCXA 1ZBE2 1ULGA 5CBLA 3O5SA 1YFWA 1RUE2 5GALA 1XE8A 1ZZ7A 3HD8B 1S0JA 3D4KA 1JXNA 4HVQA 3RMYA 3WG4A 3ZSJA 2JG8B 3ZFFC 1IS6A 1QJX3 4LO4B 1MZEA 3SITA 3LB9A 2B42B 1HRI1 1DQ2A 5GLTA 3BALA 5T5JA 2WFF3 2HEWF 5KWRA 3KGZA 2E7QA 2Z5WA 1AYN2 5CG8A 5CNAA 2AENA 1WMFA 1IKQA 1H8TC 1SLAA 1G9AA 4HKWA 1RUOA 3PVEA 4JDMA 1AXZA 4JGZB 4YYOA 4FTEA 1ZRRA 2VQAA 4UW4A 4BH9A 1MQTC 1CD3G 5SV8A 1HXS2 4QGLA 2DVAA 4LO7A 2GMMA 2RR11 1QJY1 3R4SA 2B7YA 2IXJA 3AB0A 4XF0A 1OQ1A 2CV6A 4YFZA 1VBD1 2ZX3A 4K1YA 4EN0A 4DY5A 4EV0A 2JE9A 1LULA 4KG8A 2TBVA 3NKGA 3ZXEA 1J58A 1YIFA 2A3WA 1V6IA 5DUXA 1C3HA 4L99A 2BNNA 3K48A 1N3OA 3KB5A 2RMU1 1G9BA 2DUQA 1UKRA 2LM3A 5T54A 5BUVA 2DU0A 4Q4X3 1PZ8A 3M3IA 1NXMA 1RMU2 5JI9A 3UKNA 1PNFA 1G7YA 4XPVA 1PO11 5BNOA 3VLBB 1UZYA 3WP6A 1YWKA 1CR7A 3S7IA 3DKWA 1HRV2 2DTYA 1O7FA 2AYHA 4AFBA 3BOWA 3RYRA 3EXUA 4A7YA 4XEZA 1ONAA 1TME3 2VQ0A 3B93A 5GLWA 1YFXA 5BV6A 4AEDC 1YI9A 5H9SA 4DRRA 4TWTA 4BLJA 4AEJA 4KH9A 2XVGA 5K9YA 2EIGA 4DFSA 4FPHA 4XFGA 3G6JB 3M3OA 3N7JA 5AC93 3M4FA 3GZAA 1AYM3 1X36A 4NVPA 2DTWA 3H1YA 2H0VA 5BY5A 1NY71 1LOCA 1TMF1 3ZSEA 1DYKA 1W6MA 1OHFA 4Q26A 2XWBB 4LA2A 1MQTB 4M3CA 4ZXKA 4OUSA 2A3YA 1TNRA 3FUOA 4AK3A 1XYNA 3USSA 4CEYA 4P9XA 3VBSA 1N1SA 1BK1A 3MW3A 3IDBB 1SQ4A 2IFRA 4KWLA 2GNTA 4M01A 3ZMOA 1AR91 2DV9A 3ZFGA 1OKQA 1H8TB 4YG0A 1JUHA 2PAKA 2RJLA 2XLGA 1QOTA 2O1QA 4QMAA 1MACA 2R16A 4D7SA 3OD0A 2G9FA 5CFDA 2X53S 4D69A 2XBO1 1IZ3A 4FT8A 2WNEA 2D44A 2WNVC 1SDWA 3JZVA 3IPVA 4FOVA 4OHZA 5JIAA 2D6MA 2NYYA 4LBKA 2GAUA 4PLMA 1JYCA 1U5YA 2VU9A 2TUNA 3WDWA 4R52A 3MEPA 5ACA1 3SNMA 2FHRA 2PAMA 5E1RA 2ARBA 1HQNA 1BEV2 2XUMA 3RMXA 3RDIA 1I1EA 1JUIA 2DCTA 4ONUA 4IV1C 5EFUA 3KM5A 1CAWA 3TNPB 2C1FA 2Y26A 4B8EA 4TLFA 3B01A 4Q2FA 3OPZA 1AUYA 1KQRA 1DZQA 1WBFA 3VHRA 3PMEA 1VAMA 2Y0OA 2DVGA 2R043 4IL7A 5BPXA 2WFF1 3B3QE 2R073 4RS5B 1ZBE3 2A73B 1LHNA 4K6BA 4W6WA 3URFA 3SISA 2WNUB 3ZN6B 2ZHNA 1Y3TA 3N4MA 1NCRA 4FTSA 3WG1A 2HWC1 2WT1A 2PYTA 4LBJA 1SFNA 2R062 2DF7A 2WZR2 4GMP0 2WJSA 1BBT1 4RL7A 2BBVA 4AEMA 4NN0A 5C4WA 1RUC1 4I0WB 4M00A 1MEC3 2JG8A 3USUB 1C5HA 4DQAA 2A5ZA 2YPJA 1U5ZA 1EY2A 1V70A 5EZWA 1LU2A 3MGUA 4OUMA 1PO13 1SLTA 3KQRA 4R9AA 1CGPA 2B46X 5JCTA 5C33A 2AH2A 1LESA 3MPBA 4KU7A 1RUD2 3ROUA 5FMOS 1NCQB 3H50A 1S0DA 1HDKA 3IPVB 4AGRA 2KA3A 4COYA 4FP3A 4YW5A 4IESA 4WVMB 3OGJA 1M06G 1D4M3 1Q8VA 1Q8OA 3NL1A 3JBG3 2ARXA 4CDXB 4K9SA 4YZ5A 3KZ4C 1C4RA 2YC0A 3VBRA 5ABJB 4QM8A 1PHMA 4XJWA 3V0BA 1S55A 3WD5A 4EWEA 2BNMA 4XMAA 3HBZA 1QGLA 4Q4X2 4NWWA 3WOGA 1ZBA1 2XJQA 4LLFA 2PLV3 2JXAA 4LA3A 3KS7A 1C8M3 4IETA 1DIWA 4IEUA 3ZMNA 4AQSA 4CDUB 4KBBA 4HETA 3B5LB 3AKRA 1ENSA 1PNGA 1RHI3 2R0FA 1FPN2 1Q3EA 2DVBA 1AX0A 3PLQA 4K1ZA 5JOZA 3FC0A 5DZGA 4NWVA 2HWC3 5C9AA 1KS5A 2R1BA 4ES8A 4XIKA 3IDCB 4YW2A 4COVA 5I93A 4GXLA 3NWKA 3WG3A 4CEWC 4XF3A 2ZX4A 3ZFGC 2JX9A 1WCDJ 1QQP2 3T1LA 4URTA 1H9PA 3CNAA 3ZN6A 3VBOA 2CY6A 3W59A 2LALA 2LTNA 1MZFA 2CAUA 4R8HA 4Q29A 4I01A 3WW3A 3AXDA 5HCBA 1O4YA 5CAZA 3AMPA 1VBC1 1V6JA 2RS53 3ENRA 4YZ4A 1X8EA 3WQ7A 2CYFA 1DGLA 2ZACA 2JG9C 2WC2A 3JD72 4OVEA 2GH2A 4WZFA 1DQ4A 3FLPA 4AQTA 4LO8A