4AWDA

Crystal structure of the beta-porphyranase bpgh16b (bacple_01689) from the human gut bacterium bacteroides plebeius
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
297
structure length
297
Chain Sequence
KEYSLAEEHIKNLPEAPEGYKWVVNEDYTDEFNGKRLNAAKWHAKSPYWTNGRPPATFKAENVSVKKGCLRIINTVLSPTEGLDGKPGDKYRLAGGAVASVKNQAHYGYYETRMKASLTTMSSTFWLSNRPVMKEIMKGGKKIKTWSSQELDIIETMGIIRSVNPDNPWNKTWNMQMNSNTHYWYQEQGGKRTDNTAKRSDVVSYMTDPSAEDFHTYGCWWVDANTVKFYYDGKYMYTIKPTTKYTDTPFDRPMFIHIVTETYDWEKQVPTAEDLKDKDKSTTYYDWVRAYKLVPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PORPHYRANASE
publication title Bacteria of the human gut microbiome catabolize red seaweed glycans with carbohydrate-active enzyme updates from extrinsic microbes.
pubmed doi rcsb
source organism Bacteroides plebeius
molecule tags Hydrolase
total genus 73
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4awdA00
4PCRA 1CVNA 1MR5A 3AZVA 1N1YA 3QCWA 4M3CA 2B7YA 3JUUA 3W58A 5IT6A 2E7TA 1QOSA 3A4UA 1O4YA 3WG2A 2JE7A 3RQ0A 3ZXEA 1JXNA 1VIWB 3WDVA 2UWAA 4FQZA 1LU2A 1PZ9A 1UN1A 4FPEA 4FOQA 4XJWA 3GNEA 3ILRA 3N3HA 1QKQA 1C57A 2WKKA 1JUIA 5DUXA 5JOXA 3B01A 4LBMA 1LHNA 1MZ6A 1UPSA 3I4IA 1W6NA 2WJSA 3WNXA 3ZYRA 3AP5A 3MW3A 1AZDA 1W6OA 4WV8A 4WVWA 4YZ2A 3FLRA 5GM0A 4YGEA 4XMIA 3V64A 4LBNA 1WBFA 2Q5TA 3POWA 3ZSJA 2OUHA 4D69A 5KXBA 2A70A 4LBOA 2DU1A 4NO4A 1WD4A 2ZGPA 1DGLA 4ISQA 3ZXKA 3VKOA 1O4ZA 1UMZA 3AK0A 3U4XA 1S0EA 2CYFA 1KQRA 4XJUA 3V65A 3SNMA 1S0GA 1HQLA 1ZA4A 1QDOA 3ILNA 4FVVA 3R4UA 5E88A 4XILA 4P14A 2EF6A 3OBTA 5JDBA 1SCSA 1X50A 1PZ7A 4GXLA 5IK5A 5FREA 2ZHKA 2C9AA 4P9YA 2PHFA 2ARBA 4BMBA 4YM2A 3ZSKA 3M3OA 4DRVA 1KDKA 1FV3A 1YI7A 5E89A 4MYEA 5KXEA 1Q8OA 1JYIA 1ZM1A 2PHRA 2ZGNA 1UL9A 4Q1RA 5F5QA 1WW7A 4ZXKA 3SITA 2TEPA 1WLWA 1HLCA 2PHTA 2D6NA 3FUQA 1MS1A 2NZ9A 5GZGA 5IK8A 4ATEA 2NYYA 1QF3A 3AYAA 1WCSA 2DTYA 4AWDA 2ZGUA 3AFKA 3T1MA 1QNYA 1GZWB 2H0BA 3USUB 2P3JA 1QMJA 3ZVXA 4AVVA 4C1XA 5CA6A 1PZ8A 3AX4A 3T1LA 2ZZJA 4Y1YA 2ZHMA 1VAMA 1UAIA 4UW6A 1N1SA 3INAA 4WZFA 2WT1A 3AZWA 5EWSA 3VKFC 2ZHLA 1S0IA 1MS9A 1AX0A 1CONA 3AJYA 4AGVA 1JOJA 1N3PA 5L73A 2VW1A 2YXSA 2A71A 4U36A 2R16A 4PBOA 2WSUA 2GNDA 2GN7A 1IS6A 2UU8A 4FPYA 4YW1A 3AP6A 4M3CB 2W68A 3V0AA 4TZDA 4FPOB 4DRRA 1FNZA 3L2YA 5EYYA 1LODA 3M1HA 4ITCA 4FPJA 1QNWA 4Y1VA 1C4RA 3VKLA 3ZXJA 1G8WA 3AP7A 4GALA 4Y22A 1AXKA 3I8TA 1N47A 1IS4A 1W6PA 4FQ4A 1WBLA 5HCAA 2ES3A 5DUVA 4ATFA 4P9WA 2CNAA 4L8QA 5GLTA 3O0VA 3WV6A 5HCBA 1LGCA 1MVQA 1W6NB 1OQ1A 2E51A 1GNHA 1GLHA 1W6QB 2ARXA 4GKYA 1W6OB 1SLIA 4R9AA 1CN1A 1AVBA 1Q56A 1QGLA 4XJAA 5BYNA 2A7AA 1VALA 1WUVA 1F9KA 2E7QA 1LESA 1IS3A 2A6YA 5DG1A 4XMAA 5DXDA 3OBRA 2I2SA 4BM8A 3HN1A 1AJKA 1SLAA 5SV8A 4AYUA 4RL7A 4XHXA 4DQAA 3ZXFA 1GANA 3PVEA 3UK9A 3WOGA 4Q8LA 3FLPA 4Y26A 3MW2A 1FX5A 2DWRA 1ULEA 3DGTA 1G9AA 4YFZA 3NV2A 1LOFC 1S0DA 1N1VA 1S0BA 3SISA 1YO8A 3N7KA 3PVNA 4KBBA 5T5PA 3AYCA 1GYKA 2XB6C 4HL0A 4P9XA 2ZMLA 5GZDA 1SFYA 2VH9A 5KXCA 1F31A 2WT2A 3FLTA 4BPZA 1GV9A 5IK4A 2D3PA 4YW4A 1YRZA 2NP0A 1A3KA 1QU0A 4FOYA 3ZSMA 2A3YA 2V5YA 3NV1A 1DZQA 2SLIA 2A6VA 5AVAA 3FUOA 3POSA 3WDUA 1LTEA 3WUDA 1KJLA 2UWCA 1FAYA 4BLIA 4XYXA 1G9BA 5FRAA 3C2UA 1KITA 2D6OX 3OY8A 4NOTA 1SBDA 4HANA 5DUUA 3TB0A 2DTWA 1Q8SA 1V6IA 1Q8QA 1AXZA 1JBCA 2WNEA 2DVAA 4LBLA 1I1EA 1DQ0A 1G7YA 4JRAA 2OUJA 2DVGA 2GALA 1U0AA 2VUAA 3AP4A 4Y1UA 1RIRA 3FBYA 4PF5A 2NN8A 2ZHNA 3A0NA 3RS6A 3HMYA 5CNAA 3IN9A 3SH4A 4YGBA 1R1ZA 3UJOA 2WLQA 3OYWA 4U2AA 4CTEA 4K1YA 2YY1A 1GICA 1LU1A 2AENA 2PHXA 4Y20A 1KJRA 1DQ1A 2A75A 4LBKA 1RINA 1A8DA 2R0FA 3N35A 5GALA 4TYSA 1OFSA 3ATGA 1IOAA 3IPVA 4Q2FA 3AP9A 1V6NA 3VV1A 5IUQA 1QDCA 3AZYA 4XTPA 3V0BA 5JLVA 4FPKA 3D5OA 5KXDA 2EIGA 1MS5A 1FYUA 2YZ4A 3N7LA 4YW5A 4XOGA 1W6PB 3M3EA 2R49A 1V6KA 1W6MA 3WHTA 2OVUA 2D3SA 5GZFA 5EYXA 1FNYA 1FATA 2E6VA 4FPHA 1WLDA 3RRDA 3WCSA 2FHRA 1MS3A 3KQRA 1ENRA 1V6OA 3SH3A 2CL2A 3W59A 2DVDA 2JECA 1DQ2A 1HDKA 2EXKA 1NXD1 2GNMA 3PVOA 3NV4A 4R9CA 3H0OA 3AYDA 2R1DA 1NLSA 5GLZA 1D0HA 1AX1A 1VAVA 3WG1A 4XIKA 4Q26A 1SACA 4K21A 1W0OA 4F83A 1VLNA 3LSDA 1MS8A 5T52A 2DURA 1S1AA 2NM1A 2ZGOA 5DG2A 1CR7A 3M3CA 3SLIA 2D44A 5JOZA 4BQ1A 4GA9A 4Q8KA 2DUQA 2ZGSA 3SH5A 4Q27A 4XIOA 1MS0A 3WDTA 2NMNA 5DZGA 2EALA 3AXDA 4LBQD 1LHOA 3B00A 1S0CA 5GLUA 1OKQA 2ZGKA 1V6JA 2G4IA 1DYPA 1LHVA 4XTMA 3WG4A 1V6LA 2JD4A 3T2TA 1APNA 4M00A 1A78A 4YG0A 3WLUA 2ZGLA 2YV8A 1LHWA 1Z78A 1N3OA 2ZGRA 4FPCA 3PMEA 4Z8BA 3WDXA 1C1FA 3IMNA 4Y1XA 4Y1ZA 1DQ5A 1MVEA 2AR6A 2UURA 2ZKNA 3OY8B 4YG6A 3NWKA 1BKZA 3AYEA 1CPMA 1GBGA 1KDMA 2AYHA 5GZCA 1BJQA 2VW2A 1S0FA 1J1TA 2D6LX 2OW4A 1SCRA 1IKPA 2DU0A 3O12A 1CQ9A 3M2MA 1JHNA 3PJQA 3GALA 4GWNA 4R9BA 1DHKB 1H30A 1MS4A 5T54A 2P34A 1LOBA 3N7JA 5JOYA 3OYWB 4SLIA 2GMEA 1GZWA 2A6ZA 1UKGA 3OGGA 4FOVA 1JYCA 2DVFA 3LCPA 1BQPA 4FOWA 2DUPA 2CTVA 5H9SA 4DS0A 5JOWA 3ZXLA 4UW4A 4XZPA 5T50A 3HR9A 1LCLA 4GWMA 4BMEA 2ZAAA 3BTAA 3N36A 5T55A 5GJ6A 4XJ9A 1Z0HA 2WT0A 5GLVA 1SLBA 2AH2A 4BOWA 3V0BB 1V00A 2JE9A 1JN2P 1H9WA 1CESA 3KM5A 4XDQA 3VKMA 3QLQA 4YW2A 1XQNA 1UZYA 2EXIA 2EXJA 1WLCA 1LJ7A 2V73A 4FP3A 2ZABA 3TAYA 3VUOA 1IKQA 4JCKA 4H55A 1GZ9A 1ULDA 1BZWA 1QOOA 1DYKA 1GSLA 2W52A 3WCRA 4YZ1A 3WDWA 2VU9A 3MW4A 5EXOA 4Q1PA 3AZXA 1AJOA 2D3RA 4DFSA 4CRQA 3ASIA 2A6XA 1LULA 3ILFA 4YGCA 2JDZA 2JKBA 1FV2A 1DBNA 1GKBA 5CBLA 5HCFA 2ZBJA 4YM1A 2CY6A 4YM3A 1ENQA 1W0PA 1LGBA 1SLLA 2ERFA 3WHUA 2ZGMA 2AGSA 4LBQA 4WVVA 1S0JA 3B9CA 5H9PA 4FPFA 1W6QA 2ZMKA 3JU9A 5JMCA 1H9PA 4I30A 3FFZA 3RMXA 2W39A 1ONAA 5GLWA 2VW0A 4XJ8A 3WUCA 5CB7A 3V0AB 1TEIA 1YIFA 2Z42A 3VKNA 1Y7BA 4PQ9A 1Q8PA 1SBFA 4Y22B 2PHUA 2D7FA 2WSVA 2PELA 2BQPA 3MPPG 1JW6A 4YLZA 1HQWA 2D43A 1LEMA 1CPNA 4FPLA 1GNZA 1CJPA 1LEDA 4M3CE 4AGGA 3DUIA 2YROA 4AVTA 4UW5A 3BIWE 1DQ4A 5T5JA 4YZ3A 2ZGQA 5DZEA 5H9QA 2W08A 3BODA 1LOEA 2C5DA 2VXRA 3O0XA 2FMDA 2GMMA 5T5LA 5GZEA 1IS5A 5F9TA 4LBJA 2A3WA 4UW3A 2EXHA 4PBPA 4XJZA 2XG3A 3CNAA 1MACA 3UL2A 4YW3A 4XBLA 4JC1A 4IQPA 5T5OA 1LOFA 2R1BA 3O0WA 4M3CF 2LTNA 1BYHA 4GKXA 3ZYPA 1WW5A 2E53A 1QOTA 1LGNA 2HYKA 1SLCA 2PHWA 1AX2A 1ENSA 2R0HA 2ZA9A 5E8AA 4CZSA 2CWSA 2AUYA 1URXA 1ULCA 1EPWA 5IK7A 1BXHA 1HKDA 2A3XA 2DVBA 3APBA 3D6EA 3IKWA 3R05A 2UWBA 4M01A 4R9DA 4Y24A 2SBAA 4BLJA 4YZ4A 1I3HA 1CIWA 3NV3A 3Q9OA 1WW6A 3WDYA 1F5FA 1UX6A 2DV9A 1Q8VA 4AVSA 2P3KA 1RITA 2RHPA 2CWMA 4YM0A 4AGRA 4K20A 4OZXA 3R4SA 4YZ5A 4XBNA 1AXYA 4C1WA 2D6PA 5H9RA 1V6MA 1LOCA 2ENRA 4ISRA 1LENA 3IM0A 5JVVA 3WVJA 2KM2A 1GZCA 5LK5A 1ULFA 4XXAA 3ZSLA 1SBEA 5CAZA 2GMPA 2ZMNA 4XBQA 2D6KA 1N1TA 3OPZA 4FP2A 3D4KA 3ZPYA 3A0KA 3O5SA 1DFQA 1G86A 1DIWA 2ZGTA 2DYCA 1N3QA 2YMZA 4RA0A 3B3QE 3MEPA 3RG0A 3RMYA 3RSJA 2A5ZA 3WG3A 3LSEA 2NMOA 1ULGA 2P37A 1LOAA 3N7MA 3M3QA 1G9CA 1G9DA 4XXPA 2JJ6A 2P2KA 5DZFA 1KRIA 2VY0A 1LECA 2EAKA 2GN3A 4LBQB 3AJZA 2LALA 3USUA 1B09A 1LOGA 3WZ1A 3BOPA 1DLLA 1DQ6A 1WD3A 4Y20B 2ZACA 1YXWA 1AF9A 4FPGA 4YG3A 5DUWA 3IPVB 2DUOA 1YYNA 1MZ5A 1WW4A 2A6WA 3AZZA 4ASMB 3ENRA 1G9FA 2AREA 1UZZA 3UJQA 3OJBA 2GNTA 3AXEA 3POYA 4W65A 4YGDA 2P3IA 3B69A 1D2SA 4K1ZA 4XE9A 2GNBA 4DPNA 1LHUA 1C1LA 1SLTA 2GDFA 2WQZC 4XHBA 4ZKTB 1W6MB 4YFWA 2D6MA
chains in the Genus database with same CATH superfamily
1FPN1 1YEWA 1MR5A 1XOYA 1ZBA3 3QCWA 5IT6A 2B7YA 2B9UA 1YFXA 1RUG2 3LA2A 4CCEA 4LXLA 4LE3A 1AR81 1RUF3 4IETA 5FPAA 3GCXA 1NCQB 4QPGB 3ZXEA 5FWJA 1JXNA 1VBC1 1VBA3 4FQZA 1O4TA 1UN1A 2IXCA 4FPEA 4CCNA 2JB4A 1NZCA 3N3HA 3ILRA 1QKQA 5C71A 1W8TA 1JUIA 5FV3A 2VOWA 3B01A 4LHNA 2XL9A 2YDEA 3SCHA 4CDWB 3AKSA 3WR0A 1W6NA 2OPKA 3H1MA 4ZHNA 2WJSA 3WNXA 3J8F2 2YBSA 3MW3A 1AZDA 1W6OA 2WNUC 5BNPA 3VD4A 3OUHA 1CAWB 2C4XA 2WRAA 3POJA 4XMIA 4UOJA 4LBNA 4RR3A 2VO5A 5CFCC 2OUHA 5I93A 2XLAA 3OEBA 2DU1A 4NO4A 2ZGPA 3WNPA 1DGLA 3RWNA 4DZGA 3ZXKA 1YFYA 4XEZA 2OZJA 4YRDA 3U4XA 4MXWB 4PLMA 5AFBA 1EY2A 2EIBA 2CYFA 4DMIA 4E4HA 4V2WA 3IMMA 3JCIA 4CEYB 1ZX5A 4EZ4A 2C9KA 3W58A 1HQLA 3CLPA 1QDOA 3R4UA 1X50A 1C8NA 1EAH1 1XSQA 2ARBA 4J6GA 3RWKX 3S57A 4S2DA 4LNVA 3WQ7A 1AR93 1DGWA 4BZ4A 4LHLA 2FDJA 1YI7A 5E89A 5KXEA 1QIQA 4CXWA 4OI1A 1YWKA 1WCUA 3CJXA 3DV8A 5F5QA 5FYHA 1WW7A 5FYUA 1OA3A 4FBFA 1S2BA 2QQUA 2Z2SB 1OKOA 1WLWA 3ZFFB 2VOVA 4QU2A 1DDLA 4OVEA 1TMF2 4IV3A 4UXAA 3FUQA 2X09A 2BUKA 4JQTA 5GZGA 1RUH1 4QPIA 3QH6A 1VBB3 4I2OA 1PHMA 1W2AX 1ALYA 3OTFA 2P3JA 4Z2AA 4YW6A 5CA6A 2ZTNA 1XYOA 2VQ0A 2D40A 4NVPA 4XF0A 2ZZJA 1D4VB 2GSYA 3WEZA 2E33A 2XJRA 5C3QA 1EYBA 1JYXA 1OF4A 1RJ8A 3INAA 2DFBA 4WZFA 2FDFA 1IPJA 4M4PA 2WWUA 1VB2A 5EJZB 1AX0A 2X5IC 1GNYA 3Q8AA 1PO13 4AVBA 1QJY2 2Y6LA 5DABA 5DPNA 2VW1A 2YXSA 1ZRCA 4U36A 5KHIA 2UU8A 1U5ZA 1W99A 3H3LA 4TTGA 3AP6A 2VQTA 4BXSV 1BK1A 4FPOB 2QQKA 1LODA 3VKLA 3WD5A 1AXKA 1M4WA 2C0ZA 3OUIA 3WP4A 1W6PA 3C7FA 2VZTA 2C26A 4F3JA 5JSPA 1HRI3 5D8AC 3AKQA 4IE0A 1H8VA 1XPWA 2Z79A 3O0VA 3HNMA 5IVBA 5JZGC 3TYJA 1W6NB 2YBPA 3BGAA 3O1SA 1OQ1A 2JXAA 4PLOA 1GNHA 1W6QB 2ARXA 3E5UA 4GKYA 1W6OB 4X6RB 5BNPB 3M4FA 1CN1A 4UFIA 5F5AA 3CKHA 4QQOA 5F5IA 4XJAA 2R061 4D94A 1ZRRA 2WWSA 1RUE1 4CE8A 5A1FA 4RR3B 3OUJA 4HOOA 4CCDA 1LESA 1IS3A 3CZJA 3E1F1 4AL9A 4XMAA 5C9AA 3IT8A 3JB4C 1EV11 2VTFA 4XHXA 2R042 3PVEA 4HVOA 4RFRB 4ASKA 3WOGA 2RJLA 4LO8A 1FX5A 4DXZA 2C6SA 3B94A 4LIUA 4QX5A 3ZIWA 4A3ZA 1G9AA 4CCJA 1ZZBA 1LOFC 2VULA 1S0DA 1S0BA 3ZMNA 2B4KA 1YO8A 3NAPC 5T5PA 5A6QA 3AYCA 3TN92 2HEWF 2EVXA 4LUMA 4K3UA 2WAOA 2VH9A 3UGHA 1F31A 4TSVA 2W9XA 5IK4A 2HKXA 5BUVA 4P9IA 5C3SA 1YRZA 3VD5A 1A3KA 2NP0A 1H6XA 3HEIA 1MEC2 2A3YA 2V5YA 4DXSA 2HWE2 4D6SA 2RVAA 3RZJA 2OZ6A 4IEVA 2Z69A 1KJLA 3WUDA 4IV3B 2AACA 1J1LA 1QH7A 4BLIA 4Q4V1 4P5HA 4N53C 1KITA 4K8FA 4LLOA 4NOTA 4HANA 1OPMA 3DN7A 4QPIB 4LUKA 2WL1A 1Q8SA 1REEA 5J7MA 4RS5B 1YC61 3LGRA 5ANQA 2DVAA 2X53S 1ZA7A 3H9AA 4LBLA 4GJZA 4LA2A 4JRAA 1I1EA 1O3RA 2OUJA 3ITQA 4DXRA 3A0NA 3IAPA 4AI3A 3LDKA 3NRUA 5FYIA 4PIYA 2HEYF 1RUD3 4U2AA 3UKVA 5FXWA 4CTEA 5J98B 4BQ4A 4AFBA 2AENA 1LU1A 3M3IA 3G7DA 3VZNA 3AKPA 3DXTA 3KV5A 3ZYBA 1RINA 4CDQA 1W9WA 3PUHA 2YFZA 4COUA 5GALA 3VBUC 2HWB3 3IPVA 4L0PA 5GKAC 3ORJA 1QDCA 5CISA 1Y9MA 4DINB 2J42A 2QZ3A 4FPKA 4QPYA 4C0HA 5JR2A 1VPHA 1V0AA 2RM22 2JDMA 3NSTA 3U78A 4E2GA 4YW5A 2H0VA 1W6PB 4IESA 3UESA 1IPKA 1AR91 1V6KA 2HWC3 4R4XA 4V2VA 4OUMA 5FP8A 1DGWX 5EYXA 1FATA 4HFSA 4IEPA 4MG2A 2K0GA 3GJBA 1X82A 1F2NA 3J7LA 1YUDA 1CZSA 4ES9A 1CWPA 1XB9A 2VZQA 1HDKA 3AC0A 4TWTA 2WZR2 1IQAA 1PK6A 2FCTA 2RMU3 1JYNA 4LKFA 2GNMA 4R9CA 3P5BA 4O61A 2VE1A 4PDWA 5EP9A 5GLZA 3PNAA 1RTVA 3CU7A 3VBHC 4A6SA 1DYOA 2ZXQA 4GWJA 1VAVA 5DAVA 4LOSA 4Q26A 2W1UA 4E27A 3PHMA 3NAPA 1RUI1 2I74A 1XRUA 3Q8EA 5L7OA 3J7MA 1W0OA 2VTXA 3L9JT 1VLNA 4CDUC 3DECA 2WABA 3M3CA 4NROA 4CDXA 1U5XA 4GA9A 3KWVA 2RR12 2ZGSA 3U37A 3MV11 4Q27A 4ZZ8A 2DDUA 5FY0A 5FFOC 3WNLA 3AXDA 5FZ6A 3VLBB 5ABJB 3DYOA 3PLQA 4D3WA 1S0CA 1QJX1 2HWD3 2ZGKA 1I9RA 3B5LB 2BVVA 4GB31 4CUBA 5KR7A 4XTMA 3PURA 4CCLA 2VD7A 3RFRA 3T2TA 4GQ7A 1OHFA 2C24A 2CDOA 4A45A 2OQ6A 3VHRA 1W06A 4WM8A 1JH5A 1N3OA 5FYVA 4FPCA 4X8PA 2BOJA 5DAWA 3WDXA 3VDBA 2DCKA 2WIIB 4JVAA 1DQ5A 1RVF2 1HRI1 2AR6A 3JBG2 5A7NA 5D1IA 5LW9A 4UFJA 3QD6A 2Q1FA 5ACA3 3WF0A 3NWKA 1BKZA 2WDBA 2BP6A 1GBGA 2CGOA 1KDMA 2YG0A 4I0AA 5F3EA 3FFQA 1OQDA 1S0FA 4J25A 1J1TA 4JDNA 5FZ9A 4IGOA 3O12A 2QCSB 4R9BA 2WA4A 4GWNA 5A3MA 1DHKB 5T54A 5FZ8A 1LOBA 4L92A 5KBFA 2GMEA 1ZZ9A 1C8M2 3H8RA 4FOVA 1PVC2 1VRH1 4L99A 4MGZE 2Q8OA 4FOWA 1X7NA 1C5HA 2CTVA 2WNVA 3ZXLA 1UOGA 1YI9A 3C8XA 2B8MA 4L2NA 4NUBA 2G19A 3TNQA 4B29A 2ZAAA 3J9SA 2Y8KA 4CP1A 1LB2A 1RHI1 1KS5A 1SLBA 3VKMA 2JB8A 4UBGA 4YW2A 1TME1 3LFIA 2ID4A 3MICA 1XQNA 4YWAA 1RUC2 3WW4A 4UFHA 3PU8A 3WNNA 2V73A 1BEV2 4N43A 4UAPA 2ZABA 2VZOA 2YGMA 3VUOA 1NE4A 5LBFA 2QQWA 5LK7B 1ULDA 2O0OA 4TN7A 1UU6A 1OD5A 2JIJA 1CX4A 2PAMA 1X8MA 2WFF2 3P3NA 4EQVA 4AI9A 4QB1A 1R093 3VBFC 2D3RA 2WZEA 4DFSA 1YQ6A 3IDCB 4YGCA 2JDZA 2JKBA 3WW2A 3PUQA 2CAUA 4HVQA 3I7DA 4NIAA 2ET1A 1GKBA 4P9LA 2ZBJA 4YM1A 4NAMA 1SLLA 2VMCA 2VMEA 4PDWB 2Q8DA 2XJPA 1LRHA 4KWUA 4K40A 4PI2A 2VCBA 2W91A 2RDNA 5H9PA 2J1AA 3WP3A 2HWF2 2ZMKA 1SDDB 3DCQA 1H9PA 4MVTA 4B4PA 3UV9A 5L7OB 2W39A 1ONAA 4XFIA 5GLWA 1U5IA 2VXJA 4XJ8A 3WUCA 4BDVB 4BQ5A 2RE9A 3ELNA 2JDHA 3H3UA 4FFIA 4CDXB 3V0AB 3KVAA 4HLTA 4XFCA 3RI8A 3TEWA 2PHUA 1UNBA 2PELA 1W3XA 5L9VA 2NPIA 4CP9A 1ND3A 2QKDA 2BQPA 4QKDA 4UT5A 1JW6A 4YLZA 2D43A 4FPLA 1GP4A 1LEMA 4M4RA 1GNZA 4W6YA 3VBRB 4AGGA 4ARXA 5CZKA 5FXXA 1DQ4A 5T5JA 1D4M1 1JZ5A 3OOXA 4JV4A 3VHNA 3AVSA 3CDZB 4KU8A 4P08A 5J36A 3KB5A 1ZBA2 3BODA 1LOEA 2C5DA 4GH4C 1OUSA 1SMVA 3OD4A 3T09A 1I5ZA 4CSWA 1O5UA 4PBPA 1RUF2 5IAXA 3I2JA 1H8TC 4I3PA 5CYYA 4PJYA 4CXYA 3UL2A 1W8UA 4B4QA 2RV9A 3VDDB 1VBA2 4HMZA 4JC1A 4IQPA 5F37A 2R073 3E5QA 5A80A 3ZPOA 1PX4A 2XONA 1OOPC 4LKDA 3O0WA 5FMCA 4GKXA 3ZYPA 2O8QA 1V9U1 4BK5A 2R6QA 4QX8A 4XC9A 2O8OA 1AX2A 1BBT3 4QT6A 1NLQA 2O1QA 1URXA 2CGNA 2UYBA 1NCRA 4JQRA 2BRTA 2UWBA 4NRQA 4BLJA 4PI0A 1XNDA 4ZS2A 4YZ4A 1I3HA 1UX7A 4D7YA 3NV3A 2WNVB 3WDYA 3PL0A 5LY1A 2VNRA 4AFMA 1RUG1 1WCQA 1MEC3 4CEWA 2RHPA 3FE5A 3NVCA 2XGXA 4OZXA 1W3VA 2QQIA 3T4HB 3HT2A 4XBNA 4YZ5A 1AXYA 1W2OA 2IXJA 2YC0A 4MGIE 4FO9A 4AFDA 4A7KA 5FUIA 2XVGA 4N43B 1GZCA 4XXAA 1XNKA 3ZSLA 2CDPA 1KGYA 2GMPA 4Z82A 1K5MC 2QZ2A 1X9PA 1QY4A 2D6KA 2D97A 2VMIA 2XL7A 3J8F1 3ZDSA 4N9HA 2ZEWA 3O5SA 3PDQA 1PMJX 1HV1A 3MEPA 3RMYA 3RSJA 5C70A 3SHRA 1JU4A 5JXJA 1Y9QA 4OUEA 3MIEA 5ACA1 3ACFA 2NMOA 3LIHA 4KG8A 3N7MA 3M3QA 1OLMA 2XVLA 5C33A 4LMFA 2JJ6A 1KRIA 4LOTA 5FYZA 1OD3A 5F1RA 2ZEYA 2XKPA 4OHWA 2D5HA 4IE5A 3USUA 4RQPC 3KCXA 4MXVA 1DQ6A 5B4NA 1RJ7A 2BZDA 5LCWL 4META 1VBB2 5A7WB 4RGAA 4FPGA 4Q0UA 3KVBA 3SC7X 3VBOA 2DUOA 2ZX2A 1MZ5A 1U5YA 2OIIA 1ND2C 1UY0A 2VZSA 3NQHA 3S7IA 5KHJA 1UZZA 1YIPA 3F2ZA 2FDKA 2GNTA 3POYA 1GUIA 3LPGA 4BA6A 1W0NA 4ZS3A 4BQYA 3ACIA 4QM9A 3SCFA 4XE9A 2W2IA 3OF1A 1SHWB 3FN9A 1ND3B 4CP9B 1SLTA 3ZYJB 3BTXA 1H2KA 2W1QA 1ZRFA 1AUYA 1QJU3 1F5JA 2J22A 2Q8EA 4PCRA 1PO12 3AZVA 4M3CA 4OHVA 1TMF1 2V5DA 2Y6JA 3PUSA 4NPRA 4FXGB 2E7TA 2FZ2A 4ES8A 1QOSA 2WZR3 1PGW2 4LO6B 3DEMA 1GQHA 1O4YA 3WG2A 1PGL2 5IVJA 1VIWB 1EPZA 2GC0A 4FFFA 2ARAA 5FYMA 2YU2A 2VVEA 4OHXA 4YVWB 2ORXA 1OLQA 3T0BA 4MADA 1UPSA 1ZZCA 1VE0A 2P6CA 5L36A 5HCHA 5JIUA 2VUCA 4E4SA 4QDRA 1F4HA 4H7LA 3ZYRA 5FO8B 2VG9A 1SEFA 3AP5A 4CEYC 4WVWA 3ME2A 2JDYA 3FLRA 5LATA 1PMHX 5CFDC 2F4PA 3RPQA 1K42A 1I5PA 1QJY1 1NCRB 4W8JA 1WBFA 1S2KA 1HX6A 3U07A 2A70A 3VHPA 4LBOA 5D2AA 2Y6HA 1WD4A 3ZYFA 2XUEA 2G9GA 4DUVA 1HN1A 1UMZA 3OGVA 1S0EA 2PTMA 5C4WA 1H6YA 4AAXA 4GMP1 1B35C 4XDOA 3UGGA 3QOPA 2N7GA 4XJUA 4YVSB 1R1A3 4FAGA 2HH9A 4FVVA 2P5BA 4XILA 1VMFA 1RVF3 1T6GC 3JBG3 4Y5Z0 5C5TA 4P9YA 1JHJA 1ULPA 4YM2A 1NKGA 2BGOA 3M3OA 4UYBA 5FY5A 4DRVA 1FV3A 1JOPA 1QWRA 1JYIA 4K9SA 1Q8OA 1GQPA 1ZM1A 2PHRA 4OI4A 3IDAA 1UL9A 3JD73 1CGPA 4PT6A 1AYM2 4XF4A 1IHMA 2XQXA 5J3UA 4LULA 4BU2A 4GAZA 4QKBA 2D6NA 1HIXA 1AL0G 3VHOA 4ZZ5A 2XWJB 1C8M3 3AKTA 2BPA2 2VL4A 5FPVA 4JX0A 2WFPA 1WCSA 2DTYA 2R041 3OGSA 4YW7A 4AWDA 4BK4A 1VBD3 2ZGUA 4AXOA 1WCKA 2XLFA 5FYBA 3AFKA 5G05L 3T1MA 2PQSA 5FYYA 2LUWA 3USUB 1PIV3 3ST7A 4KWJA 1PZ8A 3T1LA 4OMDA 2VVDA 4B1LA 1US3A 1XE7A 5FK8A 1R083 5FPLA 3K46A 4EN0A 2W0XA 1QJZA 1ST8A 1ASJ3 1ULOA 1W8FA 3TN91 3ZYGA 5EWSA 3L2HA 5CKNA 1BMV2 2DCJA 5C8CA 3AJYA 3TEZA 3HQXA 2JG8A 3B93A 2QBXA 2W1WA 5T3NA 1RUD2 1MEC1 1N3PA 1YQCA 2A71A 2HWE1 2VOXA 1WA6X 4HONA 1CAXB 4PBOA 2WSUA 2CGPA 5LEJA 4M3CB 2XPJA 2W68A 3GZUC 1IG3A 3L2YA 5EYYA 2GU9A 4WM7C 4BIFA 3LKJA 3LE0A 3NW4A 2HWB2 5FPXA 3DPRC 4MV2A 4Y22A 2Q1MA 3KV9A 3T0AA 2OQ7A 1IS4A 1WBLA 4B8EA 3ZXAC 3BUCA 4EE2A 2D5FA 5DUVA 3POGA 1O3TA 2CNAA 3I2HA 1HRV3 3MIBA 5GLTA 4FTSA 1YJLA 2HWF3 2HWC2 1ZZ6A 1LGCA 1DP0A 3UT0A 1E5HA 3LEGA 3FX3A 4KH9A 2E51A 3HOBA 4QQPA 1GLHA 4RFT0 3RDIA 3POFA 2PFWA 3RZMA 3O1UA 1AR63 1VALA 4QGLA 1RUJ2 1M06G 3NJVA 1AR73 1F9KA 5LA1A 1UO9A 5DXDA 2RMU2 4AI2A 4BM8A 5DMYA 3HN1A 1AJKA 1SLAA 2IFRA 5SV8A 4RL7A 5FMOS 4AYUA 4DQAA 3ZXFA 3GJAA 1GANA 2QNKA 1AHSA 3FHAA 3VB9A 4BWOA 2RS32 2L9LA 3FLPA 1FOD3 4H7MA 4LO4B 4DXTA 5C4WB 5K0UA 2RM21 3B7MA 5G04L 5K8SA 5A6XA 2E31A 2PHLA 2ATFA 4JGYA 4AOCA 1N1VA 3RVHA 1FXZA 1FMD3 4KQ7A 4HN1A 4Z92B 2KXLA 5GZDA 1SG3A 1QEXA 3TBDA 1ZYBA 2PLV3 5A3TA 2VMHA 3M70A 4URAA 5KXCA 4RS5C 5LBBA 2D3PA 3ETQA 3ZFGA 1KS4A 2FCUA 3SMHA 4FOYA 5DN2A 3OB8A 3ZSMA 2H6CA 4BHPA 2ETEA 2WZR1 4QM8A 5LBCA 2HWD2 2LRPA 4WZCA 1XYNA 4IEQA 3NJZA 5EZWA 3WDUA 4XUNA 2UWCA 2WQ4A 1GP6A 3T3YA 4JTNA 5BPXA 1G9BA 5FRAA 4NJ4A 3C2UA 3OY8A 1YJKA 2W1SA 3K75B 3RI9A 4CVUA 3WX5A 2DTWA 3MIHA 1H2MA 5FZGA 1Q8QA 3I2FA 3ZYIB 2Y6KA 3J4UH 4IDZA 1G7YA 5ACA2 3KV4A 1L7QA 3FHIB 2GALA 3AP4A 2RR11 3FBYA 4X8NA 3RS6A 5BY5A 3K3NA 1FI2A 2GP3A 2G9ZA 4H14A 5CNAA 5FZ1A 1TZOA 4XFAA 3WY6A 1A6CA 3EB7A 4MOAA 5C8CB 2YY1A 3KF5A 2JG8B 5I0TA 4Y20A 1KJRA 2A75A 1A8DA 1O8PA 3LF7A 3R0RA 4IEWA 4XQDA 1NZIA 3DL3A 4TYSA 4AFAA 2R7EB 1IOAA 3N4MA 5EIYB 4Q4Y2 3AP9A 1X8EA 2WYSA 5IUQA 3AMHA 3AZYA 5FZ0A 1RVF1 1KXGA 3JBG1 1OURA 4NIHA 3D5OA 5IVYA 3PIGA 2EIGA 2IFWA 1FT9A 2G1MA 1NA1C 5F2WA 3EXUA 3N7LA 2X05A 1XNTA 5B4XA 1W6MA 2JDUA 3WHTA 1NAEA 2Q30A 2OVUA 2QQJA 2VZRA 3AMNA 3NNJA 2D3SA 5FY7A 5GZFA 2E6VA 1YFWA 1WLDA 4FPHA 3GBGA 2HLEA 1UZ0A 2WR9A 2BFUS 4IEUA 3Q8BA 3TEYA 2AEYA 3MPBA 4Q4W3 3W59A 2CL2A 5F7UA 4FXKB 1XJAA 4LORA 5LB6A 1OSGA 1C8M1 2ET7A 2XQRA 1PVC1 4FCAA 1F15A 1R092 3N9MA 2V4VA 3OG2A 1O7FA 1NLSA 4Y33A 5ABJC 3U11A 1D0HA 5FZHA 4C0BA 3RYPA 2JG9B 2V09A 3BYWA 3CQOA 1SACA 4K21A 1UY1A 3BU7A 3LSDA 3BI3A 4LK6A 2OKXA 1CIYA 2ZGOA 2NM1A 1RUC1 3KT7A 5FY1A 3BKZA 1CR7A 2DBIA 3SLIA 5JOZA 4BQ1A 1BEV1 1JTZX 1RL3A 4JGYB 3ZKUA 4AR2A 3BTZA 4JKKA 4MGQA 4XIOA 4P5YA 4PLNA 1K5JA 3VL9A 2IZWA 3P3PA 3MLKA 2W87A 4Q0SA 2HYXA 2MNGA 2WFF1 4UBHA 1OKQA 5FPUA 1V6JA 2Z4FA 3GXUA 4JAAA 4LTAA 4R4ZA 1LHVA 1W2NA 2XJSA 3CBNA 4PIZA 2WNUA 4XETA 3WG4A 3ZFGB 4M00A 2XUMA 4YG0A 1O3QA 5L9RA 5CFCA 2YV8A 1LHWA 4RGKA 1Z78A 4FFGA 5FZOA 5LBEA 3IMNA 4Y1XA 2XVKA 2DF7A 3I54A 5FZAA 2ZKNA 3OY8B 5IYYA 1OLRA 2HWF1 2BOIA 4NE9A 3ZN5A 3AYEA 1CPMA 4G4FA 3FZ3A 4S2HA 1WZXA 2DCTA 4HT1T 2OW4A 1SCRA 1UMIA 3H8UA 1PO22 3VD9A 3PJQA 1JHNA 1ZRIA 3GALA 4I09A 4RD7A 2R072 2BBVA 1H30A 4GULA 1Y9GA 4B3NA 3E5XA 5I8SA 2P34A 4O7XA 5CG9A 5FYTA 4IEZA 3ZR5A 1GZWA 5AVPA 4CYDA 4O9EA 3MV01 1BBT2 1JYCA 1UOJA 1BQPA 1IPSA 3CZUA 5EHDA 5F3GA 4DS0A 4IXLA 5JOWA 1J59A 1LNSA 1DLCA 3HVDA 2Y64A 1NE6A 4I3GA 4LK7A 3H8OA 4GWMA 1LCLA 4BMEA 3BTAA 1AYM3 5GJ6A 5IWFA 1ZBA1 5EJ1B 2YFUA 1XE0A 1V00A 4C90A 1H9WA 3KM5A 4XDQA 4CPBD 3BALA 3KS7A 5FKCA 1QJFA 1RUF1 5FUPA 1UZYA 2EXIA 4GJYA 3RJ2X 3GHNA 1JS9A 3LOBA 3K4DA 1VBA1 2ORZA 2QQOA 1IKQA 2C1FA 2JKXA 1XNAA 1GZ9A 4H55A 4JCKA 4IGQA 1BZWA 3NNLA 2QDRA 2R30A 3WDWA 2VU9A 5C3PA 1STMA 1OH3A 4S2GA 3AZXA 3KT4A 3BTYA 4CRQA 3ASIA 2A6XA 4A2UA 3ILFA 4KNCA 2IXKA 1FV2A 2X5IA 1DBNA 1HXS3 2BWCA 5HCFA 2WS92 2CY6A 1C3HA 1ENQA 5DAPA 3ZM8A 2ERFA 3AMPA 3IZOA 5AC93 3N9NA 2EAAA 5IVCA 1PMIA 1JOBA 3BN6A 4LLFA 4WVVA 4FSJA 3VBRC 2TUNA 2UY9A 3HNBM 2JD9A 5JMCA 1RUOA 3JQXA 1K12A 4Q0QA 2I45A 2UYAA 5CB7A 5BNNC 1TEIA 3GF6A 1O91A 3RGBA 3VKNA 3VDCA 3POIA 4AEMA 5D8AA 3LEMA 5DAXA 4HKWA 3IDEA 2J1EA 1SBFA 4QXKA 2WSVA 1K3IA 5JZGA 1X36A 5IJRA 3MPPG 4QX3A 1ZVFA 1HQWA 4FT8A 3VDDC 1E57A 3BB6A 3HNYM 4Q4X3 2WNUB 5JPMB 2VAUA 4AZZA 4AVTA 2YROA 3BIWE 1OA4A 4AK3A 1D2QA 1QJU2 5CFCB 1OH4A 1MQTC 5FZOB 2CHHA 1RUJ3 3MUY1 1W9TA 1OUXA 5ERLA 1RYYA 4XJZA 5EJ3A 5FZMA 5EFUA 5HV0A 3ZFEC 1VBB1 3J7HA 4EV0A 4YW3A 4XBLA 2RS33 5T5OA 3WNOA 5C9AB 4IGPA 1LOFA 5KC5A 4IV1C 4KGQA 3OCPA 3U1XA 2LTNA 3GHMA 4XQ4A 2E53A 2R0HA 1SLCA 3HBZA 4KWLA 4UF0A 3O1RA 2CWSA 3HJRA 2AUYA 1KD7A 2LROA 1HKDA 4I01A 3VDAA 4CCKA 4CPBA 2IUWA 4EWAA 2SBAA 5A3OA 2B42B 2VNVA 5LA9A 1TE1B 1CIWA 2PMWB 1PO11 5C8WA 3O1PA 2DV9A 4QGNA 4QQLA 4AVSA 1YFUA 1NQDA 1JZ2A 4HPKA 2E26A 2TNFA 1U12A 1Q5OA 1PGW1 2CWMA 4YM0A 4IW3A 1QQP3 2Q0AA 3R4SA 3A21A 1PGL1 4N53A 2D6PA 1CAVA 4I0WB 3U14A 1JZ6A 2VC9A 2BNMA 1LENA 3IM0A 1NY72 5FR3A 2W47A 1R1A2 4QHOA 4E9KA 4COZA 5CAZA 4WVMA 1POV3 3HQRA 4XBQA 4B7EA 1W2UA 4FP2A 2DBNA 3J26N 2RDRA 4NHKA 2DYCA 1SQ4A 4UI9L 3O1MA 1NOVA 2YMZA 4RA0A 3THCA 3B3QE 3RG0A 5I91A 4OI0A 1CAUA 4FI9A 3JD72 2X5IB 3C7HA 3WG3A 1GOFA 5EQUA 2GC3A 3LSEA 3TWIA 1DGRA 1ULGA 5FMOL 1SZBA 4A44A 4XXPA 1YCIA 5DZFA 3VBUA 1GQGA 4XQWA 1LECA 1COV3 2LALA 3HWJA 3BOPA 4W6XA 1DLLA 5JCTA 1OF3A 1VBD2 1WKYA 4MZUA 4Q4Y3 1RXFA 2V4AA 3C7EA 3D0SA 4QDQA 4YPJA 4CDQB 4CP0A 1YXWA 5J37A 1ZREA 1PIV2 4BCUA 3IPVB 4JGZC 4NHXA 1JYTA 1YYNA 3ZXDA 3FC0A 4FFHA 4ASMB 3O1VA 1G9FA 1OXCA 1QJEA 1R082 3FHQA 1WWYA 3LFMA 3OJBA 4W65A 1ASJ2 3UGFA 3SEPA 3HD8B 5EPAA 5JZGB 2GNBA 4YVWC 1LHUA 1C1LA 1VBE3 1AYM1 2DFCA 3I2GA 5A33A 5E1RA 3AFGA 4EN8B 2D6MA 4HBNA 4CXXA 5J09A 2QFEA 2VZPA 1CVNA 5DDJ3 3PMSA 5A7SA 2VZVA 5F8PA 1LR5A 4AQ6A 2Y60A 3A4UA 4IEXA 3RQ0A 3VBHA 4XFBA 3WDVA 1UYPA 3K4ZA 4D0QA 4NMIA 1PK6B 4CDUA 4M0HA 1Y3TA 4INDA 3NJXA 4H2AA 3W20A 2P6HA 2XBO3 1C57A 5JMOA 5JOXA 4OUSA 3KHBA 1MZ6A 4N9IA 4LIVA 4AQ2A 3E6BA 4AI1A 5HBAA 1HRV2 3NAPB 4COWA 4E8DA 3X29B 2J1TA 2JIGA 3LA7A 4YVSC 4YZ2A 1J3RA 4QKNA 4UF0B 1VB4A 4HN0A 3LPFA 4Y5SA 3VZOA 1RUD1 2MPFA 3VBSC 2VGDA 3KGZA 1VRBA 3POWA 4LQRA 4R8HA 5FY8A 3ZSJA 2E32A 4D69A 4CA9A 5KXBA 4MO3M 1AR62 3N9OA 4XCAA 2QQLA 2DCYA 3ES4A 1H1MA 1AR72 1HJFA 2PAEA 4JRLA 2W5FA 4HPKB 3ZSEA 2RS53 4RHV3 2HWB1 5FKBA 4MH0E 1TNRA 2JDKA 4Q5OA 4N53B 1KQRA 5LA2A 3V65A 3E6CC 1S0GA 1ZA4A 1CAVB 3ILNA 5E88A 5BNOC 1FOD2 5JDBA 4AG4A 3DXUA 1PZ7A 3ALQA 4GXLA 5IK5A 2ZHKA 1POV0 4WM8B 2RS13 1W03A 1HN0A 2HWC1 2JDNA 5FZEA 3P6BA 4BMBA 2BFUL 4CCOA 1AYN3 4WVMB 2JWPA 1FMD2 3JZVA 1S4CA 4MYEA 4N7UA 2ZGNA 2BVBA 2EICA 2FCVA 4Q1RA 4XUTA 2PLV2 1PO23 1UXXX 2JX9A 2TEPA 4XFFA 3ZN6A 1UWWA 3K2OA 1RUJ1 1HLCA 1CAUB 3ETPA 3JQWA 3C3VA 3SXWA 2RMU1 2NZ9A 3V56A 4ATEA 4AHXA 1GR3A 1QF3A 3AYAA 2CAVA 4QB6A 3CEWA 2D98A 3VBUB 2RS31 2WZ8A 4A6OA 2H0BA 4AVCA 2I07B 3LOIA 4ZY9A 3CJIC 1QMJA 5FP3A 4C1XA 5A70A 2BGPA 2GP5A 4TLFA 2J1RA 5A7OA 3FL7A 4NWVA 1VAMA 1UAIA 4NAOA 4Q0PA 4UW6A 5BXXA 1N1SA 3VKFC 2ZHLA 4XF1A 1S0IA 5CKQA 2BYVE 2VZ3A 1CONA 5A1LA 4AEDC 1Y43B 2B5HA 5A33B 3VBFA 2HWD1 1UIJA 3MIDA 1QQP1 1OVSA 2GNDA 1IS6A 4YW1A 4HG6B 3TNPB 1FNZA 4S2FA 4XURA 3M1HA 4ITCA 4Y1VA 5FMBA 1QNWA 1Y4WA 1C4RA 3ZXJA 4A7ZA 1H1AA 4XVHA 5C7GA 3AP7A 3I8TA 3VBHB 1REFA 1KFXL 2WN3A 2WS93 4BJ0A 2PXJA 4FQ4A 1BCXA 5HCAA 3R6SA 1POV1 2ES3A 1C28A 1UY2A 5M0TA 4CDUB 5EV7A 5FYSA 4ATFA 4L8QA 2A73B 3NJYA 3RZKA 4XF3A 4LHKA 1A8MA 5FXZA 3WV6A 1RMU3 3KV6A 2FDIA 2XR4A 2VM9A 1H2NA 2XXZA 4R9AA 1GWLA 1Q56A 4SBVA 4XUOA 2VOTA 3EO6A 4Q4W2 1Z7S3 3D3AA 2A7AA 3LIGA 4IEOA 1NLRA 4P9JA 2E7QA 1OC1A 2GC1A 4XDPA 2A6YA 4QPGC 1NCQC 3OBRA 5IFTA 4D7SA 4Q4Y1 1W04A 4LHSA 3VZLA 3AM2A 3UK9A 3KZ4C 5FXVA 3S7EA 3A7QA 4Q8LA 4E8CA 4GH4A 2DWRA 1QHDA 4K7JA 4CDWC 2GH2A 4KWKA 4OLLA 4YFZA 2RDQA 3NV2A 2F4LA 3H42B 4Q29A 3CMGA 2OXBA 1H8TA 2VZ1A 3N7KA 3PVNA 3UETA 4AEKA 1GYKA 5FY4A 2VBBA 4N90A 4O9GA 2GH8A 1HV0A 1SFYA 5HPOA 1OOPA 4BPZA 1QH6A 4NHYA 1GV9A 2IXLA 4D6QA 4BQ2A 2P3YA 5FY9A 2NLRA 1FPN3 4JDOA 3SQOA 4Z2WA 3BIEA 1XXNA 1W05A 1ODNA 1DZQA 3JXSA 2A6VA 1SPPA 2WQ8A 1R091 3FUOA 3GM8A 4MGTA 1AR83 5FAXA 4BYYA 5TSWA 4ZONA 1W2TA 1VBC3 4XYXA 5FCCA 5FP9A 4DB5A 4IERA 1T6BX 3K51A 2CU5A 2XOMA 4O65A 5DUUA 3TB0A 1OT5A 2AZ5A 3WSOA 4QMAA 4YARA 3KF3A 1JBCA 3BCWA 1DQ0A 1I6XA 1HB3A 2KR2A 2DVGA 1U0AA 2NQYA 4RN5A 3ACLA 2ZHNA 5FZKA 1OLME 3HMYA 4HETA 4K6BA 3NKTA 4CEWB 3SH4A 3OBZA 5FYCA 1NQJA 1R1ZA 2YYOA 3EQEA 2RJ2A 3OYWA 5A3WA 1K5MA 3ZFFC 3VZJA 4F7ZA 3K4AA 2PHXA 2ZEXA 2XMLA 1OA2A 4LBKA 5JAXA 2R0FA 3VBFB 3N35A 2BEOA 4AHZA 2ILMA 3ATGA 5HV4A 1OMIA 4AFCA 5J96B 1V6NA 4OCTA 3RZLA 3VV1A 3T08A 3V0BA 4XTPA 1ZNPA 2D93A 5KXDA 3WW1A 1EAH3 5K7PA 3M3EA 2R49A 5A7QA 3RJRA 4RQPA 2WBKA 1WMFA 2JG9C 4L11A 2QQNA 3U4SA 5FTTC 5A7PA 4ARYA 1PO21 3PU3A 3RRDA 1XC6A 1VJ2A 3IWZA 1MS3A 2R071 4CU9A 1ND2A 1V6OA 5FPZA 3SH3A 1GZTA 5D21A 5A3PA 2DVDA 1DQ2A 3EHKA 2OYZA 3GYDA 1BBT1 1UYZA 1ENXA 3THDA 2GC2A 1NXD1 1RUH3 3ACHA 3PVOA 3Q8FA 3NV4A 4RYDA 3VBOB 3WP6A 4AAPA 4DOUA 2R1DA 2XJUA 1HXS2 4CCMA 1AX1A 2XHNA 3GZAA 2ZCWA 4EZHA 5AC92 2W92A 5A3UA 4KG0A 4F83A 4XACA 5LASA 2DURA 4GH4B 5DG2A 5T52A 4AEJA 5FZCA 3DKQA 2ZAHA 4JKLA 3POBA 4EWDA 5I0RA 1XSRA 2OX0A 1J84A 3CL1A 1H8TB 1MS0A 2X10A 3LDRA 5BNPC 5FQ0A 2NMNA 1WA4A 3BPZA 5DZGA 1DZTA 4ET7A 4MSVA 3W5NA 1LHOA 3UNPA 1JMUB 1O59A 4RR3C 1OVPA 4CEYA 1V6LA 2GZWA 2JD4A 1SFPA 2X29A 5FBJA 3ROUA 1APNA 5IFPA 4A41A 3O1TA 5CFDA 1E5SA 2YPDA 4OFGA 3RZHA 1SPPB 2ZGLA 5APAA 2WS91 4Q4X2 2ADEA 1UQXA 2WA3A 2BDRA 4Z8BA 1C1FA 3FJSA 1WMEA 1MVEA 3M7AA 4BE3A 2QE3A 3FMGA 4XZUG 4PQQA 2HBUA 3IB3A 5ANNA 4EN7B 4XUPA 1B35A 2AYHA 5CADA 1BJQA 2VW2A 3ZLIA 2D6LX 4PHZA 1K45A 1UYXA 2WWJA 1IKPA 4QGMA 3O1OA 1CQ9A 4KBZA 5CKMA 4M0NA 2VUDA 5LZ6A 1MS4A 3J7NA 3KCYA 2PAKA 5JOYA 4L9BA 3OYWB 4SLIA 1K5MB 2OT7A 2DVFA 4IV3C 2DUPA 3KMHA 1YNAA 1EV13 2JEMA 1Q3EA 2YBKA 1UKRA 4UW4A 3M8LA 3HAGA 2MHFA 1QJU1 4QPIC 3N36A 1O6UA 3T4VA 1Z0HA 4A3XA 2KA3A 4D8MA 1HQNA 2WT0A 3C7GA 3V0BB 4OHYA 4H3WA 1JN2P 5BNQA 2WC2A 1H0BA 1YLLA 4GD4A 1BHGA 1QQP2 4NIIA 4HXCA 2EXJA 1WLCA 2G9FA 4DUXA 5FO9B 1LJ7A 4UWDA 5FZ4A 2FDHA 4RQPB 4OYUA 3W5MA 2VCMA 4FTEA 2LM3A 1LKNA 1S55A 2W52A 4YZ1A 4QDSA 3WT3A 1TVGA 1PX3A 2W46A 1ND2B 2ZX1A 4Q1PA 5EXOA 1AJOA 3UKNA 4EN9B 4GWIA 2CSGA 1W8ZA 5B2GB 1SFNA 2VPVA 4JHZA 3DYPA 2Y33A 4Q4V3 1HB2A 1QXRA 4YM3A 4AF9A 4G3YC 1W0PA 1LGBA 3MLJA 4BQ3A 4HK8A 2AGSA 5CVRA 4XAAA 3WP5A 1S0JA 1UY3A 4QHZA 4FPFA 1W6QA 4WM7A 1EP0A 4I30A 3DPRA 3FFZA 1UZVA 2ZEZA 4MHUA 1COV2 2Y26A 4QX0A 1O5LA 4OMCA 2ZJCA 2MEV2 1GP5A 1GMMA 1NY71 3HN3A 5E16A 2AC1A 5L19A 1R1A1 1YIFA 2ZX0A 5IVFA 2RJKA 5FQ0B 1Q8PA 1JYWA 5JXGA 4Y22B 5A6YA 4UFKA 4E2QA 2B45X 1LEDA 4PF1A 4W4ZA 5C9AC 4LEJA 3DUIA 5JPNB 1SDWA 3OSDA 3JD71 1CD3G 5FO7B 1KFUL 1VBE2 4AE2A 5CFDB 5DZEA 1IGOA 3Q8CA 4QKFA 4XCBA 2OA2A 3O0XA 5DDJ2 4GIQA 2VXRA 3W21A 2BJSA 2GMMA 4CCCA 5F9TA 1IS5A 1ZBE2 3OPWA 3SEEA 4LBJA 5K4LA 2PN5A 4UW3A 2EXHA 4BIOA 4UFLA 3CNAA 3VL8A 4E4ZA 4Y4YA 1L3JA 1VBD1 4N8MA 1B35B 5IVEA 1E5RA 5HXMA 1UOBA 1PIV1 2QTWB 2JDAA 3U75A 4M3CF 2XBO2 1JUHA 1NXMA 1WW5A 1R081 3KCCA 1LGNA 4CZSA 1ASJ1 3KSCA 5K0UB 5FBZA 1ULCA 5IK7A 5FOBB 1BXHA 3R05A 3D6EA 4R9DA 4YNIA 4RS5A 4MHRA 1F4AA 1X33A 5FZBA 3T30A 2GAUA 1O3SA 1WW6A 3I2KA 3WNMA 2B39A 1UX6A 1DU3D 1RUI3 1H2LA 2Y0OA 2P3KA 1WGPA 1RITA 4OZOA 2HJIA 4AGRA 1DF0A 4XABA 4C1WA 5H9RA 2BGCA 1V6MA 2RS52 1LOCA 2VBDA 2WAAA 1CJDA 4RHV2 4Z1VA 4N7IA 2Q8CA 2Z5WA 3O14A 5JVVA 3WVJA 5A3LA 2QDNA 5LK5A 1QJX3 1SBEA 4GB33 5A1AA 4V1PA 4JKMA 1MZFA 1HRV1 1N1TA 2RS12 3OPZA 1L7RA 3D4KA 3ZPYA 3A0KA 1AYN2 1PM7A 4CDQC 2VNGA 1N3QA 4IL7A 3USSA 5HI0A 5I0UA 4KI5M 1UPIA 4QQHA 4QX1A 2P37A 1AR61 1P8JA 1G9DA 1BVVA 2ZS6B 2AEZA 2QJVA 1AR71 4NN0A 1REDA 3B02A 2YUEA 2VY0A 5KWRA 4LKEA 2VJXA 2GN3A 3LB9A 3AJZA 1XNBA 2BNNA 3SCGA 2W95A 4HKOA 4WM7B 1E5IA 3A22A 1WD3A 4Y20B 2ZACA 3DPRB 1RUNA 1ZZ7A 1FOD1 1NA1A 5DUWA 3MF6A 2BERA 4QXHA 3K77A 5F32A 3IAQA 3ENRA 3IBMA 1IZ3A 2VVFA 3UJQA 3BU0A 3T2QA 1FMD1 1VRH3 2RDSA 1PK6C 1D2SA 5DAQA 4J1XA 2GDFA 2PLV1 2WQZC 4XHBA 3NMBA 1W6MB 3H7JA 3HIFA 4PDWC 3MBWA 4PIXA 4YFWA 3I3EA 4ZU7A 1RHI3 3WF4A 1N1YA 2VUJA 1DZRA 4A4AA 1PVXA 3JUUA 5LY2A 4CU7A 5CEHA 5L7OC 1TME3 4LT5A 3ZMOA 5JUVA 2R32A 5ABJA 2JE7A 2PHDA 4HVRA 2YU1A 2UWAA 4YYOA 4DNYA 4CDXC 1LU2A 1PZ9A 3AKRA 3D8CA 4EWEA 1AL22 3I2DA 4K8RB 5J1XA 4FOQA 2HEVF 1H4GA 1H4HA 4XJWA 2B9VA 3GNEA 4KU7A 2WKKA 3OD0A 4EYUA 5DUXA 2WO3A 4LBMA 1LHNA 3ZX7A 2BTVC 2BU9A 3I4IA 4BQWA 1HJGA 1KEXA 4WV8A 5FLIA 1RMU2 2WINB 5GM0A 4CU8A 3E6DA 4YGEA 3V64A 3MLLA 3MFAA 1BK0A 2Q5TA 4WM8C 4NIDA 1NYWA 4DY5A 1Z7S2 4F8AA 1NX9A 3CO2A 4ISQA 5J48A 4AI0A 3VKOA 3BVCA 3VZKA 1O4ZA 4OQ8A 3AK0A 1YQ5A 4QXCA 1GOGA 2XJTA 3IIIA 4P00B 5LRRA 4NWWA 4AI8A 1R64A 5AFEA 5I0SA 4CU6A 3WQBA 5A3NA 3SNMA 3ZXGA 1RGSA 4P14A 2EF6A 3OBTA 4ORFA 1SCSA 4NHMA 4E2SA 5FREA 2C9AA 3OGJA 2PHFA 2IWGB 2XDVA 3NNFA 4A7YA 5I0DA 5ISLA 3ZSKA 3HQUA 3I59A 1KDKA 1RXGA 1UU5A 4W6WA 2BBAA 5JWPA 2WNVC 5LEKA 5KHGA 4ZXKA 1D4M3 3SITA 4Q4W1 3ZR6A 3KHCA 3THPA 4LO5B 3WNKA 3GCWA 1FPN2 2PHTA 3PUAA 5DQ0A 1MS1A 5IK8A 3AMMA 1Q43A 2NYYA 2VZUA 3LQCA 1AR82 3RYRA 2ARCA 1CZVA 2VMDA 1VBC2 4NPLA 1QNYA 1GZWB 1CX1A 1WMXA 4N43C 3RZZA 4UFMA 3ZVXA 4X6QB 4AVVA 1DCSA 5FDBA 4FAHA 3AX4A 2XJQA 1HW5A 1J58A 2W94A 1V9U3 4QU1A 1NA1B 2ZHMA 3JB8A 4Y1YA 5CIRA 1W9SA 4ZU4A 3ZIXA 2WT1A 3AZWA 4QQ2A 3R4DB 5I8YA 2HBTA 2E63A 1MS9A 3GGLA 3NNGA 4C91A 3PUIA 4OQ9A 1XU2A 4AGVA 1JOJA 5L73A 2P1BA 2R16A 1RUG3 4Z07A 4JDMA 2GN7A 3MYXA 4FPYA 4MX3A 3V0AA 2YC4A 4TZDA 2YC2A 4DRRA 1TG7A 2DCZA 3WXPA 3K48A 4FPJA 4CUAA 2VECA 5F3CA 1G8WA 2Y34A 4GALA 1POQA 2IXHA 3VZMA 1N47A 5F6LB 2WNOA 3VBRA 1VMJA 5A32A 3IDBB 4P9WA 1W39A 2QVSB 1EAH2 4NR1A 3J8F3 1W8OA 2OS2A 1US2A 3MI8A 5HCBA 4BB3A 1PNFA 2Q1ZB 1MVQA 4W50A 5BNNA 1ND3C 4OULA 4YSFA 3WW3A 3NL1A 2MEV3 1JYVA 3PTYA 4CUCA 1VR3A 3F95A 1SLIA 3NO8A 3BPSA 1AVBA 3D82A 1QGLA 3HT1A 4JTOA 3QBQA 5BYNA 2J1VA 3S0MA 3LZZA 3MIGA 1WUVA 5FZLA 3VDDA 5LRSA 5CU1A 5DG1A 1UOFA 2I2SA 4P02B 5D8AB 1RUH2 5SV5A 3UYJA 2E7AA 2XLGA 3I97A 4RGGA 1MQTA 2J1SA 3N9QA 3BOWA 4URTA 3H1WA 3MW2A 4Y26A 1JZ8A 4XUQA 1ULEA 1YQ8A 3DGTA 3GZTB 3H3ZA 2WLPA 2XWBB 5JI7A 3VGIA 1W9YA 3SISA 4G9SB 1JZ3A 1ZBE3 4KBBA 4IUGA 4Y4RA 3ZFEA 2XB6C 5JI9A 4HL0A 1JU3A 2ZMLA 4P9XA 5F3IA 2JE8A 1JZ7A 4J1WA 5FJKA 2EIDA 1NCRC 2WT2A 3FLTA 4HSJA 4IV1A 3GBFA 3I59B 1W8HA 2ZOEB 2VTXJ 3ZKYA 4I02A 4YW4A 1QU0A 1TMF3 3MF9A 4BH9A 2IVJA 3NV1A 2WZPP 2SLIA 5AVAA 4I0BA 3ZO0B 2EA7A 3VN4A 3CIHA 3POSA 4CEWC 1LTEA 3KGLA 1FAYA 1HXS1 1PM4A 4QWNA 2H6BA 5HXVA 1J83A 4QAWA 4ONUA 2D6OX 3MGUA 1SBDA 1OI6A 3PVBB 1ZZ8A 4KMQA 5AC91 3U0ZA 1EUTA 3URFA 3S5AA 1V6IA 1AXZA 2PA7A 2WNEA 2ADDA 2VNOA 1XU1A 5C3OA 3EJKA 4P9GA 3SKVA 2VUAA 4Y1UA 5E6HA 3TOJA 3ON7A 2B46X 1RIRA 4PF5A 1OPOA 2NN8A 5L9BA 4EN6B 4MGYE 3I49A 4IE4A 1HB4A 3IN9A 3T2PA 4YGBA 3WINE 1NT0A 1QJY3 3UJOA 2WLQA 2YB7A 2PYTA 4KL1A 1HB1A 4K1YA 3I3DA 1GICA 2R062 3PJYA 1RUE2 2TBVA 1DQ1A 4QPWA 5A7WA 4XFGA 1OFSA 4Q4X1 1UW8A 4GMP3 4Q2FA 5IVVA 1EV12 1OFNA 1S2EA 1WLTA 1GWMA 5JLVA 2K2SA 3EBRA 1MS5A 1FYUA 1GWKA 2YZ4A 4XOGA 3VBOC 1A34A 1LAJA 3U10A 1NG0A 1QXJA 5I8TA 3E97A 4Y3OA 2YGLA 5A32B 3VD3A 1GFF2 1W90A 3T0DA 1FNYA 1O8SA 2WO2A 2FDGA 3IIAA 4L97A 2QUOA 2JENA 2FHRA 3WCSA 5A6ZA 4JGZA 5BNNB 3KQRA 3I2OA 1ENRA 1F35A 4HZFA 4EJRA 4NIGA 1UU4A 4MLOA 4DY3A 2JECA 2VCCA 1YHFA 2EXKA 1OBNA 2Y0IA 4IEYA 4NPMA 4YVWA 2JDPA 3OPTA 3H0OA 2R043 3AYDA 5FUNA 2KD7A 2IC1A 4XAEA 1W8WA 4Q4V2 1D0GA 4LR4A 4XIKA 3WG1A 3C7OA 1W8NA 2K46A 3S5QA 4Q0VA 3I2IA 1MQTB 2FQPA 3G6JB 1MS8A 1S1AA 3MZHA 4IE6A 3TN93 4BQXA 2ZKLA 3AMQA 2D44A 4Q8KA 2OPWA 2DUQA 2O14A 3SH5A 4D6RA 2LW8A 3N9LA 1ODMA 3WDTA 3ZFEB 4LKSA 4MGSA 1AL23 2EALA 3ZN4A 4LBQD 4DIQA 1WMDA 4DO0A 1WCDJ 1UZWA 4DUWA 1TNFA 2HWE3 3B00A 1J3PA 4IV1B 5GLUA 2G4IA 1DYPA 3NKGA 3LEKA 3H50A 4YVSA 5FP4A 1A78A 5JXIA 4QX2A 2UY8A 3WLUA 3VBSA 1RB8G 1MZEA 5IATA 2Q4SA 2Y38A 5KHKA 2ZGRA 5C4WC 3PMEA 5C5UA 5FIXA 4Y1ZA 4TLGA 2UURA 1C5IA 3O7OA 2WO7A 4D7TA 2WUHA 2BW8A 4YG6A 3LAGA 3UKTA 1AR92 5GZCA 1COV1 1XYPA 3H1YA 4COYA 1XNCA 5FLJA 4FTBA 4NRPA 2A1XA 2MEV1 3ABZA 1T2XA 3S30A 5FPBA 5FOJB 2DU0A 5BNOA 3NNMA 3M2MA 2BV4A 5IHRA 1TQ5A 2WN2A 4LO7A 2RG4A 3N7JA 5JSRA 1D7PM 1W28A 3I3BA 2A6ZA 1UKGA 2IXIA 3OGGA 2IVIB 4NHLA 3ES1A 4ZPIA 5H9SA 2WYFA 2Y6FA 3LCPA 4TXWA 4AW7A 4GZ9A 3PIJA 4XZPA 5T50A 3LEIA 4GMP0 3SKJE 1VP6A 1VBE1 4HKLA 3HR9A 1XE8A 5K9YA 3RZGA 5T55A 2RM23 4XJ9A 4BISA 5BV6A 5DDJ1 2V72A 1RUI2 5GLVA 3DYMA 4BXFA 2AH2A 2XH6A 5FZ7A 4BOWA 1ZBE1 2JE9A 3MUZ1 1BVP1 1CESA 5FK7A 5FZDA 3QLQA 3B9IA 1UF2C 3ZN6B 3MFCA 1EUUA 4FP3A 1F8VA 3GZEA 3CJIA 1CAXA 3TAYA 5JXHA 2FMYA 4QHBA 3K3OA 3MIFA 4AVAA 2QQMA 4LA3A 1QOOA 3KLSA 1DYKA 1GSLA 3WCRA 2XBO1 5C8CC 1XBFA 4CUGA 2JG8C 3T2OA 4JGZB 3MW4A 5C6CA 1QJX2 4GB32 2BNOA 1PNGA 4COVA 1LULA 5LWBA 3HBKA 2F6BA 5FWEA 2CV6A 4JHTA 4QX7A 1UD1A 5CBLA 5CG8A 4AEDA 3LWCA 1DG6A 2EIEA 4XPVA 3ZOIA 3D0JA 3KD4A 3WHUA 2ZGMA 3AL6A 3CHXA 4KGGA 3WQ1A 1HRI2 1VAKA 4LBQA 4B1MA 3GDBA 3B9CA 3RYKA 3JU9A 1L7LA 3H7YA 2RR13 3PTRB 2RS51 3RMXA 4RHV1 2WO1A 1GOHA 1PGSA 2VW0A 4QD2A 2QQVA 1UYYA 2E9QA 4B4RA 2Z42A 3A23A 1IQDC 1Y7BA 5FP7A 2VCAA 3FBMA 4PQ9A 3FWEA 3POEA 2RS11 2D7FA 1YQ2A 3WF3A 1AYN1 1VRH2 4Y5TA 1CPNA 4IE7A 1CJPA 4M3CE 3WF1A 2YPJA 1GU3A 4UW5A 4XW3A 3THTA 4ZU5A 3S6PA 4YZ3A 2ZGQA 3EYPA 5H9QA 3VBSB 3I3QA 2ZPXA 2W08A 3W9AA 1RHI2 1UY4A 1NCQA 4QPGA 2XKOA 3N9PA 2FMDA 5K0UC 4HK9A 3KQ4B 5GZEA 5JR7B 5T5LA 2XHKA 2A3WA 1JZ4A 1TME2 4JGYC 4XFHA 4A42A 2XG3A 5C3RA 1MACA 4R52A 4AQSA 3AB0A 1VMHA 5FMDA 3AL5A 4CDWA 2XJVA 1CZTA 2P4EA 2Y6GA 4MUVA 4DEQA 4CP2A 2VBPA 2R1BA 4OHZA 5BNOB 3P1IA 1BYHA 3ZFGC 1QOTA 2PHWA 2HYKA 3ZYHA 1PVC3 1ENSA 2BWAA 2YHJA 2K9ZA 2ZA9A 5E8AA 4AQTA 1CAWA 4ASLA 2P17A 1UXZA 1EPWA 4AHWA 3APBA 2A3XA 2DVBA 1BMV1 1JODA 2FZ1A 3IKWA 2LS6A 3LA3A 4M01A 4Y24A 1DGRN 5LA0A 4NRMA 3CF6E 3MO4A 1G6NA 3GBWA 3Q9OA 1X9TA 1W9FA 4OI2A 1F5FA 1Q8VA 5KC6A 4MXWA 4MGKE 1OOPB 2VOKA 1RC6A 4LPLA 1RUC3 4K20A 4WBBA 2VR4A 1BEV3 2W3JA 1AL21 2ENRA 5JSOA 2J1UA 4ISRA 1UCXA 4DEVA 3ACGA 1BLZA 5FJHA 3H8XA 5KHHA 3CJIB 2KM2A 3OGRA 1ULFA 3LDBA 2WFF3 2VQAA 3OBAA 3MDPA 2F17A 2VMFA 2ZMNA 5FZIA 5JIAA 4EROA 1NUKA 4E4DX 4ZXEA 4C8DA 3VD7A 1RMU1 5F6KA 3TRSB 3EMRA 1DFQA 1G86A 1DIWA 1H1IA 2VMGA 2ZGTA 3ECQA 4HSLA 1UIKA 4RSUA 3ZDVA 5FZFA 1V70A 2ZX4A 3ZFFA 3TEXA 2A5ZA 2JICA 3OEAA 5FZ3A 3MHZA 1D4M2 3DKWA 3QACA 1Z7S1 4QB2A 1LOAA 4AEDB 1G9CA 3WF2A 2R063 1RUE3 2P2KA 4LE4A 3LD8A 3QH7A 2ZZQA 2EAKA 4LBQB 1MPXA 1B09A 1LOGA 3DF0A 4LITA 4WVZA 2VQUA 2X8KA 3WZ1A 1JI6A 4XF9A 3AVRA 1IG0A 4B7KA 4AHYA 5F39A 1OQEA 2ZX3A 3WQ0A 2FBEA 4YG3A 1AF9A 1UMHA 3KT1A 5F2SA 3RNSA 2QQPA 5IAVA 3I3MA 1WW4A 2A6WA 3AZZA 2AREA 1V9U2 5FLHA 2JG9A 4JZRA 4LJHA 2PQQA 3AXEA 4YGDA 5IW0A 2P3IA 1ZRDA 3B69A 4K1ZA 4QXBA 1J3QA 4DPNA 1ACCA 2J7MA 3HPNA 4ZKTB 2FD8A 1QXPA 5F5CA
chains in the Genus database with same CATH topology
1FPN1 1MR5A 1ZBA3 3QCWA 5IT6A 2B7YA 2B9UA 1YFXA 1RUG2 3LA2A 4LE3A 1AR81 1RUF3 4IETA 4QPGB 1NCQB 3ZXEA 1JXNA 1VBC1 1VBA3 4FQZA 1O4TA 1UN1A 2IXCA 4FPEA 1NZCA 3N3HA 3ILRA 1QKQA 3SCHA 1JUIA 2VOWA 3B01A 4LHNA 2XL9A 2YDEA 4CDWB 3AKSA 3WR0A 1W6NA 2OPKA 3H1MA 2WJSA 3WNXA 3J8F2 3MW3A 1AZDA 1W6OA 2WNUC 5BNPA 1CAWB 4XMIA 4LBNA 4RR3A 5CFCC 2OUHA 5I93A 2XLAA 2DU1A 4NO4A 2ZGPA 4DZGA 1DGLA 3RWNA 3ZXKA 1YFYA 4XEZA 2OZJA 4YRDA 3U4XA 4MXWB 4PLMA 5AFBA 1EY2A 2CYFA 4DMIA 3JCIA 4CEYB 1ZX5A 3W58A 1HQLA 3CLPA 1QDOA 3R4UA 1X50A 1C8NA 1EAH1 4J6GA 2ARBA 4S2DA 4LNVA 3WQ7A 1AR93 1DGWA 4BZ4A 4LHLA 1YI7A 5E89A 5KXEA 4OI1A 1YWKA 3CJXA 5F5QA 3DV8A 1WW7A 1OA3A 4FBFA 1S2BA 2Z2SB 1WLWA 3ZFFB 2VOVA 4QU2A 1DDLA 4OVEA 1TMF2 4IV3A 4UXAA 3FUQA 2BUKA 5GZGA 1RUH1 4QPIA 3QH6A 1VBB3 4I2OA 1PHMA 1ALYA 3OTFA 2P3JA 5CA6A 2ZTNA 1XYOA 2VQ0A 2D40A 4NVPA 4XF0A 2ZZJA 1D4VB 2GSYA 2XJRA 1EYBA 1RJ8A 3INAA 2DFBA 4WZFA 1IPJA 1VB2A 1AX0A 2X5IC 1PO13 4AVBA 1QJY2 2VW1A 2YXSA 1ZRCA 4U36A 5KHIA 2UU8A 1U5ZA 3AP6A 1BK1A 4FPOB 1LODA 3VKLA 3WD5A 1AXKA 1M4WA 2C0ZA 3WP4A 1W6PA 4F3JA 5JSPA 1HRI3 5D8AC 3AKQA 1H8VA 2Z79A 3O0VA 5JZGC 3TYJA 1W6NB 1OQ1A 2JXAA 4PLOA 1GNHA 1W6QB 2ARXA 3E5UA 4GKYA 1W6OB 4X6RB 5BNPB 3M4FA 1CN1A 4QQOA 4XJAA 2R061 4D94A 1ZRRA 2WWSA 1RUE1 4RR3B 1LESA 1IS3A 5C9AA 4XMAA 3IT8A 3JB4C 1EV11 4XHXA 2R042 3PVEA 4HVOA 3WOGA 2RJLA 4LO8A 1FX5A 4DXZA 3B94A 4QX5A 3ZIWA 1G9AA 1ZZBA 1LOFC 2VULA 1S0DA 1S0BA 3ZMNA 1YO8A 3NAPC 5T5PA 3AYCA 3TN92 2HEWF 2EVXA 4LUMA 4K3UA 2VH9A 1F31A 4TSVA 5IK4A 2HKXA 5BUVA 4P9IA 1YRZA 2NP0A 1A3KA 1MEC2 2A3YA 2V5YA 2HWE2 2OZ6A 4IEVA 2Z69A 1KJLA 3WUDA 4IV3B 1J1LA 1QH7A 4BLIA 4Q4V1 4P5HA 4N53C 1KITA 4K8FA 4LLOA 4NOTA 4HANA 1OPMA 3DN7A 4QPIB 4LUKA 2WL1A 1Q8SA 1REEA 5J7MA 4RS5B 3LGRA 2DVAA 2X53S 4LBLA 3H9AA 4LA2A 1I1EA 1O3RA 4JRAA 2OUJA 3A0NA 4AI3A 4PIYA 2HEYF 1RUD3 4U2AA 3UKVA 4CTEA 5J98B 4AFBA 2AENA 1LU1A 3M3IA 3G7DA 3VZNA 3AKPA 1RINA 4CDQA 4COUA 5GALA 3VBUC 2HWB3 3IPVA 5GKAC 1QDCA 4DINB 2QZ3A 4FPKA 4QPYA 4C0HA 2RM22 3NSTA 4E2GA 4YW5A 2H0VA 1W6PB 4IESA 1IPKA 1AR91 1V6KA 2HWC3 4R4XA 4OUMA 1DGWX 5EYXA 1FATA 4HFSA 4IEPA 2K0GA 1X82A 1F2NA 1YUDA 4ES9A 1HDKA 4TWTA 2WZR2 1IQAA 1PK6A 2RMU3 2GNMA 4R9CA 4PDWA 5GLZA 3PNAA 1RTVA 3CU7A 3VBHC 1VAVA 4Q26A 4E27A 3PHMA 3NAPA 1RUI1 2I74A 1XRUA 5L7OA 4CDUC 1W0OA 3L9JT 1VLNA 3M3CA 4CDXA 1U5XA 4GA9A 2RR12 2ZGSA 4Q27A 5FFOC 3AXDA 3VLBB 5ABJB 3PLQA 4D3WA 1S0CA 1QJX1 2HWD3 2ZGKA 1I9RA 3B5LB 2BVVA 4GB31 4XTMA 3T2TA 4GQ7A 1OHFA 3VHRA 4WM8A 1JH5A 1N3OA 4FPCA 4X8PA 3WDXA 2DCKA 2WIIB 4JVAA 1DQ5A 1RVF2 1HRI1 2AR6A 3JBG2 5D1IA 3QD6A 5ACA3 3NWKA 1BKZA 1GBGA 2CGOA 1KDMA 4I0AA 3FFQA 1OQDA 1S0FA 1J1TA 4JDNA 3O12A 2QCSB 4R9BA 2WA4A 4GWNA 5A3MA 1DHKB 5T54A 1LOBA 4L92A 5KBFA 2GMEA 1ZZ9A 1C8M2 4FOVA 1PVC2 1VRH1 4L99A 4MGZE 2Q8OA 4FOWA 1X7NA 1C5HA 2CTVA 2WNVA 3ZXLA 1YI9A 2B8MA 4L2NA 3TNQA 4B29A 2ZAAA 3J9SA 4CP1A 1LB2A 1RHI1 1KS5A 1SLBA 3VKMA 4UBGA 4YW2A 1TME1 3MICA 1XQNA 3WW4A 1RUC2 2V73A 1BEV2 4N43A 2ZABA 3VUOA 2YGMA 1NE4A 5LK7B 1ULDA 2O0OA 1UU6A 1OD5A 2PAMA 1CX4A 1X8MA 2WFF2 3P3NA 1R093 3VBFC 2D3RA 4DFSA 3IDCB 4YGCA 2JDZA 2JKBA 3WW2A 2CAUA 4HVQA 3I7DA 2ET1A 1GKBA 4P9LA 2ZBJA 4YM1A 1SLLA 4PDWB 2XJPA 1LRHA 4K40A 5H9PA 3WP3A 2HWF2 2ZMKA 4MVTA 5L7OB 1H9PA 4B4PA 3UV9A 2W39A 1ONAA 4XFIA 5GLWA 1U5IA 4XJ8A 3WUCA 4CDXB 2RE9A 3ELNA 3H3UA 3V0AB 4XFCA 4HLTA 3RI8A 2PHUA 2PELA 2NPIA 1ND3A 2QKDA 2BQPA 1JW6A 4YLZA 2D43A 4FPLA 1LEMA 3VBRB 4AGGA 1GNZA 4W6YA 1DQ4A 5T5JA 1D4M1 4JV4A 3VHNA 4KU8A 5J36A 3KB5A 1ZBA2 3BODA 1LOEA 2C5DA 4GH4C 1SMVA 3OD4A 1I5ZA 1O5UA 4PBPA 1RUF2 1H8TC 4I3PA 4PJYA 3UL2A 4B4QA 3VDDB 1VBA2 4HMZA 4JC1A 4IQPA 2R073 3E5QA 1OOPC 3O0WA 4GKXA 3ZYPA 2O8QA 1V9U1 2R6QA 2O8OA 1AX2A 1BBT3 4QT6A 2O1QA 1URXA 2CGNA 2UYBA 1NCRA 4JQRA 4BLJA 2UWBA 1XNDA 4YZ4A 1I3HA 4D7YA 3NV3A 2WNVB 3WDYA 2VNRA 4AFMA 1RUG1 1MEC3 4CEWA 2RHPA 3FE5A 3NVCA 2XGXA 4OZXA 3HT2A 4XBNA 4YZ5A 1AXYA 2IXJA 2YC0A 4MGIE 4FO9A 4AFDA 4A7KA 2XVGA 4N43B 1GZCA 4XXAA 1XNKA 3ZSLA 2GMPA 4Z82A 1K5MC 2QZ2A 2VMIA 1QY4A 2D6KA 2D97A 2XL7A 3J8F1 3ZDSA 4N9HA 3O5SA 1HV1A 3MEPA 3RMYA 3RSJA 3SHRA 1Y9QA 3MIEA 5ACA1 2NMOA 4KG8A 3N7MA 3M3QA 2XVLA 5C33A 2JJ6A 1KRIA 5F1RA 2XKPA 4OHWA 2D5HA 3USUA 4RQPC 3KCXA 4MXVA 1DQ6A 1RJ7A 4META 1VBB2 4RGAA 4FPGA 4Q0UA 3VBOA 2DUOA 2ZX2A 1MZ5A 1U5YA 2OIIA 1ND2C 3S7IA 5KHJA 1UZZA 1YIPA 2GNTA 3POYA 4BA6A 4QM9A 3SCFA 4XE9A 3OF1A 1ND3B 1SLTA 3ZYJB 1H2KA 1ZRFA 1AUYA 1QJU3 1F5JA 4PCRA 1PO12 3AZVA 4M3CA 4OHVA 1TMF1 4NPRA 4FXGB 2E7TA 2FZ2A 4ES8A 1QOSA 2WZR3 1PGW2 4LO6B 1GQHA 1O4YA 3WG2A 1PGL2 1VIWB 1EPZA 2GC0A 2VVEA 4OHXA 4YVWB 1OLQA 1UPSA 1ZZCA 5L36A 5JIUA 4H7LA 3ZYRA 5FO8B 2VG9A 1SEFA 3AP5A 4CEYC 4WVWA 3ME2A 3FLRA 5CFDC 2F4PA 3RPQA 1QJY1 1NCRB 1WBFA 1S2KA 1HX6A 3U07A 2A70A 3VHPA 4LBOA 1WD4A 2G9GA 1UMZA 1S0EA 2PTMA 5C4WA 4GMP1 1B35C 3QOPA 2N7GA 4XJUA 4YVSB 1R1A3 4FAGA 4FVVA 4XILA 1RVF3 1T6GC 3JBG3 4Y5Z0 4P9YA 4YM2A 3M3OA 4DRVA 1FV3A 1QWRA 1JYIA 4K9SA 1Q8OA 1ZM1A 2PHRA 4OI4A 1UL9A 3JD73 1CGPA 4XF4A 1AYM2 1IHMA 4LULA 2D6NA 1HIXA 1AL0G 3VHOA 2XWJB 1C8M3 3AKTA 2BPA2 2WFPA 1WCSA 2DTYA 2R041 4AWDA 1VBD3 2ZGUA 4AXOA 1WCKA 2XLFA 3AFKA 3T1MA 2LUWA 3USUB 1PIV3 3ST7A 4KWJA 1PZ8A 3T1LA 2VVDA 1XE7A 1R083 4EN0A 2W0XA 1QJZA 1ASJ3 3TN91 3ZYGA 5EWSA 3L2HA 1BMV2 2DCJA 5C8CA 3AJYA 3HQXA 2JG8A 3B93A 5T3NA 1RUD2 1MEC1 1N3PA 2HWE1 2A71A 2VOXA 4PBOA 1CAXB 2CGPA 2WSUA 5LEJA 4M3CB 2XPJA 2W68A 3GZUC 3L2YA 5EYYA 2GU9A 4WM7C 4BIFA 3LKJA 3NW4A 2HWB2 5FPXA 3DPRC 4MV2A 4Y22A 2Q1MA 1IS4A 1WBLA 4B8EA 3ZXAC 2D5FA 5DUVA 1O3TA 2CNAA 3MIBA 1HRV3 5GLTA 4FTSA 1YJLA 2HWF3 2HWC2 1ZZ6A 1LGCA 3FX3A 4KH9A 2E51A 4QQPA 4RFT0 1GLHA 3RDIA 2PFWA 1AR63 1VALA 4QGLA 1RUJ2 1M06G 1AR73 1F9KA 5DXDA 2RMU2 4AI2A 4BM8A 3HN1A 1AJKA 1SLAA 2IFRA 5SV8A 4RL7A 5FMOS 4AYUA 4DQAA 3ZXFA 1GANA 2QNKA 1AHSA 4BWOA 2RS32 3FLPA 1FOD3 4H7MA 4LO4B 5C4WB 5K0UA 2RM21 3B7MA 5K8SA 2PHLA 2ATFA 4JGYA 1N1VA 1FXZA 1FMD3 4KQ7A 4HN1A 4Z92B 2KXLA 5GZDA 3TBDA 1ZYBA 2PLV3 5KXCA 2VMHA 3M70A 4RS5C 2D3PA 3ETQA 3ZFGA 1KS4A 3SMHA 4FOYA 3ZSMA 4BHPA 2H6CA 2ETEA 2WZR1 4QM8A 2HWD2 4WZCA 1XYNA 4IEQA 3NJZA 5EZWA 3WDUA 2UWCA 2WQ4A 4JTNA 5BPXA 1G9BA 5FRAA 3C2UA 3OY8A 1YJKA 3RI9A 3WX5A 2DTWA 3MIHA 1H2MA 1Q8QA 3ZYIB 3J4UH 1G7YA 5ACA2 3FHIB 2GALA 3AP4A 2RR11 3FBYA 4X8NA 3RS6A 5BY5A 1FI2A 4H14A 5CNAA 4XFAA 3WY6A 1A6CA 5C8CB 2YY1A 2JG8B 5I0TA 4Y20A 1KJRA 2A75A 1A8DA 3R0RA 4IEWA 4XQDA 3DL3A 4TYSA 4AFAA 1IOAA 3N4MA 4Q4Y2 3AP9A 1X8EA 5IUQA 3AMHA 3AZYA 1RVF1 1KXGA 3JBG1 3D5OA 2EIGA 2IFWA 1FT9A 1NA1C 3EXUA 3N7LA 1W6MA 3WHTA 2Q30A 2OVUA 3AMNA 2D3SA 5GZFA 2E6VA 1YFWA 1WLDA 4FPHA 3GBGA 2BFUS 4IEUA 3MPBA 4Q4W3 3W59A 2CL2A 4FXKB 1OSGA 1C8M1 2ET7A 1PVC1 4FCAA 1R092 1O7FA 1NLSA 5ABJC 3U11A 1D0HA 4C0BA 3RYPA 2JG9B 2V09A 1SACA 4K21A 3BU7A 3LSDA 2ZGOA 2NM1A 1RUC1 3KT7A 1CR7A 3SLIA 5JOZA 4BQ1A 1BEV1 1JTZX 1RL3A 4JGYB 4XIOA 4PLNA 3VL9A 2IZWA 3P3PA 3MLKA 4Q0SA 2MNGA 2WFF1 4UBHA 1OKQA 1V6JA 4JAAA 4LTAA 4R4ZA 1LHVA 2XJSA 4XETA 4PIZA 3WG4A 2WNUA 3ZFGB 4M00A 2XUMA 4YG0A 1O3QA 5CFCA 2YV8A 1LHWA 1Z78A 3IMNA 4Y1XA 2XVKA 2DF7A 3I54A 2ZKNA 3OY8B 1OLRA 2HWF1 3ZN5A 3AYEA 1CPMA 4G4FA 3FZ3A 4S2HA 2DCTA 4HT1T 2OW4A 1SCRA 3H8UA 1PO22 3PJQA 1JHNA 4I09A 3GALA 4RD7A 2R072 2BBVA 1H30A 4GULA 4B3NA 3E5XA 5I8SA 2P34A 5CG9A 4IEZA 1GZWA 5AVPA 4CYDA 4O9EA 1BBT2 1JYCA 5JOWA 1BQPA 4DS0A 4IXLA 1J59A 4I3GA 1NE6A 4GWMA 1LCLA 4BMEA 3BTAA 1AYM3 5GJ6A 1ZBA1 1V00A 4C90A 1H9WA 3KM5A 4XDQA 3BALA 3KS7A 1RUF1 1UZYA 2EXIA 3RJ2X 3GHNA 3LOBA 1VBA1 1IKQA 2C1FA 4H55A 4JCKA 1GZ9A 1BZWA 2QDRA 2R30A 3WDWA 2VU9A 4S2GA 3AZXA 3KT4A 4CRQA 3ASIA 2A6XA 4A2UA 3ILFA 4KNCA 2IXKA 1FV2A 2X5IA 1DBNA 1HXS3 2BWCA 5HCFA 2WS92 2CY6A 1C3HA 1ENQA 2ERFA 3AMPA 5AC93 2EAAA 4FSJA 1PMIA 4LLFA 4WVVA