4AWDA

Crystal structure of the beta-porphyranase bpgh16b (bacple_01689) from the human gut bacterium bacteroides plebeius
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
297
structure length
297
Chain Sequence
KEYSLAEEHIKNLPEAPEGYKWVVNEDYTDEFNGKRLNAAKWHAKSPYWTNGRPPATFKAENVSVKKGCLRIINTVLSPTEGLDGKPGDKYRLAGGAVASVKNQAHYGYYETRMKASLTTMSSTFWLSNRPVMKEIMKGGKKIKTWSSQELDIIETMGIIRSVNPDNPWNKTWNMQMNSNTHYWYQEQGGKRTDNTAKRSDVVSYMTDPSAEDFHTYGCWWVDANTVKFYYDGKYMYTIKPTTKYTDTPFDRPMFIHIVTETYDWEKQVPTAEDLKDKDKSTTYYDWVRAYKLVPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacteria of the human gut microbiome catabolize red seaweed glycans with carbohydrate-active enzyme updates from extrinsic microbes.
pubmed doi rcsb
source organism Bacteroides plebeius
molecule tags Hydrolase
molecule keywords BETA-PORPHYRANASE
total genus 73
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4awdA00
3OPZA 3WDTA 1CQ9A 2E53A 1LGNA 1DGLA 3D4KA 3I8TA 3IMNA 5IK7A 1S0DA 1MR5A 5E88A 5JDBA 1LHNA 4M3CA 3FFZA 5T5OA 2D3PA 1WD3A 1RIRA 3QLQA 5GZEA 5T5PA 2ARXA 3PVNA 2D7FA 3SH4A 1A3KA 1V6OA 2PHXA 3DGTA 4UW4A 3V0AA 3CNAA 2DYCA 3JU9A 3AYAA 1ULFA 3D6EA 4KBBA 5E89A 4FOVA 3IPVB 4K1ZA 1S1AA 2VW1A 4PQ9A 2A70A 3ZVXA 1LEMA 1MVEA 1MZ5A 3UJOA 1SBFA 3ZSMA 4BMBA 1G9AA 1R1ZA 3AK0A 5JOWA 3OY8B 1SACA 3AZYA 2CYFA 2R49A 4BM8A 2WSVA 2FHRA 3M2MA 2WKKA 1SLAA 2P3IA 1HQLA 2GNMA 1KJRA 3ZPYA 3PJQA 1G9DA 4R9BA 4AVVA 2WLQA 1CONA 1F31A 1B09A 1UAIA 2CTVA 2UU8A 3ZXJA 1YO8A 1GZCA 4UW3A 1VLNA 1WLWA 3RMXA 1LOCA 1A8DA 5KXEA 3V65A 1IS3A 3AYEA 1V6KA 1VAVA 5H9RA 2EXHA 1J1TA 3IKWA 4YM1A 4D69A 2AUYA 1LHWA 3GNEA 4F83A 5CAZA 2UWBA 1ZM1A 1GANA 4ZKTB 3WDXA 4C1WA 3A0NA 1WW6A 1URXA 2DU1A 4XZPA 3R05A 1BKZA 1JW6A 2ZGMA 2A6ZA 3ATGA 5DZFA 3MPPG 4YG0A 3WG1A 3WLUA 3D5OA 3T2TA 3ZXFA 2W08A 1G9BA 3N7JA 1BQPA 4XBQA 2ZGSA 1XQNA 1Q56A 4GXLA 3OGGA 3FLTA 1ENRA 1Q8SA 1APNA 2ZGTA 4YW2A 5LK5A 4AVTA 1LOGA 1QOSA 2A6VA 2PHTA 2D6NA 4YW3A 1W6OB 5DUUA 2LALA 1SFYA 4YGBA 1DFQA 4Y1XA 2CY6A 1KRIA 1KQRA 1W0PA 5HCBA 4XXAA 3O12A 1W6NA 3W59A 2AENA 1UZYA 1WBFA 2ZGPA 2ZMKA 5JOXA 4FPFA 4Y1UA 3BOPA 3V0AB 1H9PA 2DU0A 2WSUA 3WHTA 3R4SA 2A71A 2A75A 4Y20B 3B69A 1W6OA 5GZDA 1FYUA 1WUVA 4XHBA 4TYSA 1LGCA 2DVFA 4U2AA 4XE9A 3B9CA 3ZSKA 4FOQA 1VAMA 3HMYA 2SLIA 3M3OA 5GLWA 2Q5TA 3OYWB 1PZ9A 1UPSA 3AXEA 3FLRA 1IOAA 2D3RA 3HR9A 2B7YA 3RMYA 5IUQA 1AJKA 2ZGKA 3AZZA 1YIFA 3RRDA 4AWDA 2P3JA 4M00A 3POSA 4FP3A 1SLIA 2ZACA 2VW2A 3V0BA 1IKPA 1LTEA 1FAYA 4Y26A 3RS6A 3AZWA 2AYHA 5AVAA 3B3QE 2FMDA 5SV8A 2DV9A 1ZA4A 2DWRA 2ENRA 4YW1A 3WUDA 2D6KA 1FV3A 2ZABA 3ZYPA 4GKYA 3WHUA 1QNWA 3SLIA 4RL7A 2P37A 2NP0A 4XJWA 2DURA 3USUA 4K20A 1LU1A 3I4IA 3N7MA 1QDCA 3KQRA 3BTAA 4YGEA 1DHKB 1JBCA 3PVOA 5JLVA 3AZXA 2LTNA 4YLZA 2P3KA 2A3XA 5GZCA 1CR7A 2ZMLA 1C1LA 4NO4A 4UW6A 4ZXKA 5F9TA 3B01A 3POYA 4XXPA 2ZGLA 4AGRA 2PHWA 1C57A 3ILNA 1AX0A 1HLCA 1LGBA 5GJ6A 1HQWA 2GMPA 1AXZA 2E7TA 3V64A 1A78A 5EYYA 1QU0A 2I2SA 4Y22A 4YZ5A 4XJ8A 1AXYA 4LBOA 1UZZA 3N3HA 2WQZC 3BIWE 2ARBA 4FPEA 5KXBA 4Q26A 3WG4A 2D44A 1G86A 1JN2P 1V6IA 3B00A 1NXD1 1AJOA 2W52A 2H0BA 1GBGA 3L2YA 5GALA 5GZGA 1DQ6A 2YV8A 4FPJA 2GALA 1LOBA 1LOEA 1V00A 3LSEA 3VV1A 1F9KA 1H9WA 4YGCA 3WCRA 2ZA9A 1PZ7A 2WT0A 2ZMNA 4ASMB 3VKMA 3M3QA 4YFWA 1UKGA 1YRZA 4YM2A 3WCSA 3ENRA 1S0IA 3IN9A 3M1HA 3N7LA 2YY1A 2ZAAA 1C1FA 2D6OX 3MEPA 1QOTA 1V6JA 3LCPA 5DG1A 5H9QA 1FNYA 4PCRA 4WVWA 4XJAA 3AP5A 1W6MB 3NWKA 1SLBA 1GZWA 1S0CA 1ONAA 1RINA 2E7QA 1IS5A 3NV3A 1V6NA 3O0WA 2OVUA 1C4RA 4WZFA 2R16A 2TEPA 4FPCA 3INAA 1I1EA 1MS0A 1MS9A 2V73A 3AXDA 3MW2A 2ZGUA 3R4UA 1W0OA 1Q8PA 1GV9A 4TZDA 1GZ9A 1KDMA 3FUOA 1W6PA 4FP2A 4XMAA 4P9YA 4FPLA 2HYKA 1N1TA 1V6LA 4YW5A 1W6QA 2YXSA 4HL0A 2VU9A 4JCKA 4YG3A 1PZ8A 5T5JA 1BJQA 2GMEA 1N1VA 1IS6A 1LEDA 2JD4A 1DQ2A 2P34A 2D6LX 3VKLA 1GLHA 4P9WA 2XG3A 3WDUA 2DUPA 4XJ9A 3RSJA 2DVBA 2PHUA 4GWMA 4SLIA 1CESA 4WV8A 4XJUA 4BLIA 3QCWA 4Z8BA 1FNZA 1FX5A 2SBAA 2VW0A 5JVVA 4M3CF 3ILFA 1VIWB 1GICA 2ZHKA 1AX1A 1DQ4A 1EPWA 1Z0HA 4XTMA 1OQ1A 4YM3A 1QMJA 2A5ZA 1V6MA 3O0XA 1LCLA 3WDVA 1D0HA 4LBQA 4XOGA 3PMEA 3OJBA 1BXHA 2DTYA 4OZXA 4ISQA 4FQ4A 3ZXKA 4XIOA 4Q2FA 4YZ4A 1QNYA 3VUOA 1MS3A 4LBJA 2DUOA 1LENA 3FBYA 3SH5A 3WOGA 5GLVA 3O5SA 4XBNA 1CPMA 3Q9OA 4PBOA 4LBQD 2YMZA 2EALA 1W6PB 2EXIA 2R0HA 2CL2A 2GNTA 4UW5A 1BYHA 1GYKA 2ZGNA 3MW4A 3U4XA 2A6YA 1WW7A 4CRQA 1YXWA 4M3CE 5DG2A 3ASIA 1DZQA 1GKBA 2VH9A 3POWA 1QDOA 3AJZA 2AR6A 1MS8A 2A6WA 3WG3A 4FPKA 2EXKA 4FOWA 4GALA 4LBNA 1Q8OA 1LULA 4FPOB 4M01A 4ATFA 2GN7A 2ZZJA 2DUQA 3ZXEA 3GALA 1WW5A 3M3EA 1LHOA 1ULDA 3OBRA 5GM0A 5IK8A 1W6NB 3ZSJA 3O0VA 4Y1VA 3NV4A 5GLUA 3VKNA 5FRAA 4DRRA 2GN3A 3MW3A 1SCRA 1H30A 4L8QA 2E6VA 1Q8VA 1MACA 1MVQA 1LOAA 2JJ6A 3C2UA 1DIWA 3H0OA 5DUVA 4LBMA 4YFZA 1ENSA 1VALA 3UJQA 2DVGA 4LBKA 2JKBA 3PVEA 2D43A 1HKDA 5EXOA 4XHXA 1S0GA 4XMIA 2JE9A 2WT1A 1G9CA 1GNHA 2VXRA 2EXJA 3DUIA 1SLCA 1N3QA 3N36A 4K1YA 1DYPA 2R1DA 5T55A 1QF3A 2D6MA 2A6XA 2VY0A 2W68A 4DRVA 2ZHNA 4AGVA 1LODA 1UMZA 1LOFA 3SNMA 3WV6A 4C1XA 3A4UA 4U36A 3FUQA 1S0BA 4YZ3A 4Q8LA 4WVVA 1Y7BA 1ULEA 2RHPA 4PF5A 3APBA 2GDFA 2A3YA 1WW4A 2AREA 2YZ4A 4JRAA 5E8AA 4BLJA 2AH2A 1UN1A 1AF9A 1OKQA 4K21A 1N47A 5FREA 2ZKNA 3WVJA 2OUJA 4Y24A 3RG0A 4DQAA 5GZFA 2PHFA 1G7YA 2DVAA 2KM2A 5KXDA 2JE7A 1UX6A 1S0JA 1IS4A 5EWSA 3ZSLA 2C9AA 4I30A 1KJLA 3A0KA 2ZHLA 2ZGOA 3LSDA 2PHRA 1WBLA 3FLPA 3SH3A 1CJPA 4CZSA 2C5DA 5HCAA 2JECA 2WJSA 4MYEA 5T5LA 1JYCA 1JUIA 1LECA 1N1SA 3VKFC 3IM0A 4DFSA 4P9XA 1QOOA 5IT6A 3TAYA 4LBQB 2V5YA 2DTWA 4Q1PA 1CIWA 1JOJA 5T52A 3ZYRA 2JDZA 4YG6A 1CVNA 1NLSA 3WZ1A 4HANA 4M3CB 1SBEA 3M3CA 4XBLA 4ITCA 5EYXA 2WT2A 2NYYA 2PELA 2ZBJA 4BMEA 5T50A 3BODA 3RQ0A 4FPYA 4GKXA 3HN1A 5H9SA 3OYWA 4Y1YA 1HDKA 5DUXA 4YW4A 2CWSA 2CWMA 1FV2A 5F5QA 3W58A 4R9CA 1X50A 1F5FA 1SLLA 2EAKA 2ERFA 1LHVA 4JC1A 1MS1A 2EF6A 4YGDA 3TB0A 3UK9A 1LOFC 5CBLA 3AP4A 4YZ2A 5JOYA 2CNAA 1AVBA 2ZGRA 2UWAA 3SITA 1O4YA 2WNEA 1N3PA 2NZ9A 3AFKA 5HCFA 4ISRA 1S0EA 3AP6A 1JYIA 1AZDA 1FATA 1ULCA 2BQPA 1WLCA 3AX4A 3UL2A 2NMNA 1U0AA 3OBTA 2R0FA 2YROA 1KITA 1JHNA 1TEIA 1N1YA 3WDYA 1DLLA 2NM1A 4R9DA 5JMCA 1G9FA 2AGSA 3OY8A 2E51A 2Z42A 5GLTA 2OUHA 1YI7A 4ATEA 5CA6A 1QGLA 1D2SA 1I3HA 1WCSA 2XB6C 3NV2A 1LESA 1S0FA 4W65A 2ZGQA 1RITA 1LU2A 3JUUA 5GLZA 3WG2A 5IK5A 4XTPA 2GMMA 2OW4A 3AP7A 3AZVA 5CNAA 4H55A 5JOZA 4BPZA 1SLTA 1ULGA 3KM5A 1O4ZA 1SBDA 4BQ1A 4YZ1A 3SISA 5H9PA 2UURA 2NMOA 2DVDA 3NV1A 4XILA 2NN8A 4LBLA 4P14A 1LHUA 3V0BB 4DPNA 3N7KA 1AX2A 4Q1RA 4XYXA 2UWCA 2P2KA 2GNDA 1WLDA 2A3WA 1JXNA 5DZEA 2D6PA 1BZWA 1KDKA 3AYCA 3AJYA 4XDQA 3T1LA 3WDWA 4Y1ZA 1DQ0A 2D3SA 4R9AA 4IQPA 1MZ6A 4AVSA 1ENQA 2ES3A 4XIKA 1YYNA 4Y20A 5KXCA 3IPVA 4YM0A 4BOWA 2ZHMA 5DZGA 1CN1A 4Y22B 4DS0A 1Z78A 3ZXLA 4PBPA 1GZWB 4Q8KA 1W6MA 5IK4A 1GNZA 1GSLA 1DQ1A 2G4IA 1AXKA 2GNBA 3VKOA 4GWNA 2VUAA 5CB7A 1DBNA 5DUWA 5L73A 4FPHA 5BYNA 1UL9A 4NOTA 4Q27A 3AYDA 4AYUA 4XJZA 4CTEA 4FPGA 2R1BA 3WNXA 1IKQA 1Q8QA 1DQ5A 1QKQA 3WUCA 1N3OA 1MS5A 5T54A 1DYKA 3N35A 3AP9A 1LJ7A 2EIGA 4RA0A 1CPNA 1MS4A 5DXDA 2A7AA 1G8WA 3ILRA 4FOYA 4FVVA 4GA9A 3USUB 4AGGA 4FQZA 1OFSA 1W6QB 3T1MA 1WD4A 2W39A 1SCSA
chains in the Genus database with same CATH superfamily
4LJHA 3NNLA 1CQ9A 3WDTA 1AR62 2WNVA 3I8TA 1WA4A 3LEIA 5CFDC 2D98A 2J1EA 4NPLA 1VBC3 4EN7B 5JDBA 1PK6C 1LHNA 1RUI2 1IZ3A 3FFZA 4NIGA 2D3PA 2DBIA 3MIGA 2Q8OA 4O65A 4WBBA 5T5PA 3CQOA 3VZNA 3KT4A 1CAUA 1GP4A 3TEZA 1CWPA 3V0AA 3IWZA 2DYCA 3GZTB 3TN93 1SPPA 3D6EA 3WNNA 1VE0A 5DDJ3 1XBFA 1TQ5A 4HZFA 2CAUA 1S1AA 2E26A 4PQ9A 4MGZE 4V1PA 4CDXA 1QH7A 4E2GA 1LEMA 3MPBA 3OPWA 1UMHA 2LS6A 1WCDJ 1SBFA 2Y6LA 2R7EB 2R49A 1H6YA 2FHRA 3M2MA 4QB1A 2VZPA 2RMU1 4WVMA 4DEVA 1YJLA 3TNPB 2ZEXA 1KJRA 3KGLA 3PUHA 3BPSA 3P1IA 3UGFA 5FYCA 1PMJX 1K12A 4Q0UA 3T4VA 1WCUA 1ZRCA 1UAIA 5IAVA 3ZPOA 4KWJA 1TE1B 1WLWA 1W05A 1NE4A 1NYWA 4FAGA 3H8UA 3T0AA 3ZFFB 2BERA 5KXEA 3CKHA 1V6KA 1VAVA 4XFAA 5H9RA 1X7NA 4YM1A 3IKWA 1AR72 3OBZA 1K45A 3GNEA 4JX0A 4OULA 2UWBA 5IVFA 2Y64A 5LZ6A 3J8F1 3FFQA 1URXA 5FLIA 1L3JA 3U0ZA 4LA2A 4WM8B 3AKPA 4DY3A 2WR9A 3VHRA 3ZFFA 2YPDA 3D5OA 4B7EA 2BPA2 1VAKA 4B4RA 5KWRA 1MPXA 4XBQA 1UU6A 3S6PA 3KHCA 3OGGA 1QWRA 3F2ZA 3K4ZA 4C8DA 2QCSB 1APNA 4IW3A 4YW2A 4MGYE 1JODA 2VNGA 2N7GA 3ITQA 3GJAA 1RGSA 5DUUA 1AR91 1ULPA 3HT2A 5ABJC 4OI0A 1UY0A 2CY6A 3VZKA 5JUVA 1MQTB 4KWKA 1TNRA 2OQ7A 3O12A 1RUOA 4IDZA 1KGYA 1UZYA 2XWBB 1DLCA 2DF7A 1RVF1 3NRUA 3LQCA 1RC6A 5CFDB 1NG0A 1ODMA 4EN6B 2BU9A 1W3VA 2BGOA 3OEAA 3N9OA 3WHTA 2A71A 1W8TA 3BVCA 4HVRA 3LA3A 1R1A1 4JTOA 1QJU3 3RZHA 4XHBA 1NQJA 1HV1A 4XE9A 1V9U1 2DVFA 4I01A 1NUKA 3K4DA 4FOQA 2SLIA 2Q5TA 2VQAA 2WNVB 4OYUA 5K8SA 5F6LB 2VZVA 5FOJB 5JPMB 3NVCA 1J59A 2FDKA 2WNVC 2JG9B 3UETA 4JGYB 4OZOA 4N7IA 4N53C 3POSA 4IL7A 3V0BA 5JWPA 1S2BA 4IETA 1REEA 2HWD1 4N8MA 2AYHA 4NPRA 5FYHA 1WGPA 4FFIA 1RUF2 1W2NA 5FZIA 3FBMA 4IE0A 4NN0A 5I91A 4CDXC 5M0TA 1BEV3 1RHI1 4N53A 2WO2A 2VZQA 5FBZA 2ZEWA 5C6CA 1RUI1 4LHKA 2HKXA 2Q30A 1ZZ6A 1XNDA 1W8ZA 2TNFA 2ZOEB 4LLOA 1NY71 2NP0A 1FMD1 3GXUA 3JQXA 3VBHB 3K3NA 3QACA 5C4WB 3I4IA 2XUMA 1HXS2 2YYOA 3PNAA 5E1RA 4BQ2A 1GNYA 4OCTA 1UQXA 5FXXA 1NCQC 4NMIA 1BVVA 5JLVA 3AZXA 4YVWC 2A3XA 1D7PM 4Q5OA 3THCA 2ZMLA 2YC0A 3VGIA 4QQPA 5FIXA 1W2AX 2EICA 2WRAA 1ULOA 1AX0A 3PUIA 1HLCA 4IEPA 1HQWA 1AXZA 3F95A 4EJRA 3C7OA 4Q4Y2 3V64A 1A78A 5EYYA 4HN0A 4C91A 2B45X 3WG4A 3H1MA 1G86A 1JS9A 1U5YA 2IC1A 2JE8A 1NXD1 5F8PA 1ASJ3 2H0BA 2I74A 2W52A 1AL0G 2VZ3A 3S5QA 4QAWA 4FPJA 4YW7A 2WS93 2GALA 1LOEA 1V00A 1VRH1 3H7YA 3LSEA 3VV1A 5JZGC 4YGCA 3WCRA 1NXMA 2ZX2A 1PZ7A 1RUF1 2FDJA 3I2OA 3M3QA 1UKGA 1YRZA 3CDZB 4YM2A 3OOXA 2WWUA 3WCSA 1UX7A 3QOPA 5CKQA 2VMFA 3IN9A 4COWA 1R093 2ADEA 5JXJA 1JZ3A 3AMQA 3ZLIA 2FDHA 2J42A 2CSGA 2HLEA 5FYTA 3VBOA 4WVWA 3BPZA 2B9VA 3KV5A 4RGKA 1SLBA 4NR1A 1JZ8A 2D40A 1W8NA 1S0CA 1XSQA 1ONAA 1ZX5A 3VD7A 1H1MA 3NV3A 4UAPA 3I3BA 1C4RA 3IT8A 1HN1A 2ZAHA 3HNYM 5CFDA 3S0MA 2WUHA 4FPCA 3INAA 1TNFA 1I1EA 1MS0A 2VUDA 1QXJA 2W92A 3JZVA 4LUMA 4ORFA 4MHUA 2G9GA 2ZGUA 1Q8PA 5BNNC 4AAPA 3TNQA 2W47A 2OS2A 1RTVA 3RWKX 4JRLA 4FPLA 2HYKA 3SEPA 1YHFA 3A22A 2YXSA 4KMQA 4YG3A 1Z7S1 1STMA 1BJQA 2GMEA 4GAZA 1N1VA 4FFHA 2JD4A 1AR71 2C0ZA 1MEC3 3NAPB 3X29B 1V9U2 1J58A 1C5HA 5D2AA 5DAPA 3UYJA 3O14A 4XF0A 3LPGA 2DUPA 2VVEA 5A3LA 1HV0A 4XAEA 4SLIA 2IXIA 2XJRA 4Z07A 3MLKA 4Q4V2 3VDDB 3JD73 1R081 1W8FA 1ODNA 4I0WB 2HWB1 3MF9A 4NHMA 4ZY9A 4MV2A 1VIWB 1EPWA 1Z0HA 4XTMA 3VHNA 1NCRA 1JU3A 1QMJA 1V6MA 1ACCA 1F2NA 5FPXA 3H3ZA 4XOGA 2Y0OA 3BALA 1BXHA 1RUH2 4A2UA 5FAXA 1W2UA 2HEWF 4HT1T 4L11A 3POBA 4Q2FA 5KHIA 3VDDA 4FFFA 3VUOA 4HPKA 4RQPA 4YVSC 4IV1A 3HBKA 5GKAC 3UGGA 3WOGA 5C8WA 5CEHA 4XBNA 3H1WA 2OPWA 4CVUA 2X10A 3DPRB 2XLGA 1W6PB 2CL2A 3LA7A 4XQWA 4UW5A 4XQ4A 1BYHA 1RMU3 3U4XA 1DGRN 2A6YA 1WW7A 3G7DA 5FO7B 5FZEA 1DZQA 2VMHA 3POWA 4AI8A 3VBRA 2AR6A 3WY6A 2DCTA 1MS8A 3AVRA 1EUUA 3MDPA 4FPKA 3WG3A 4IEXA 3WF3A 2JB8A 3E5QA 4LBNA 1Q8OA 1LULA 4M01A 1WKYA 3Q8BA 5KHJA 2DUQA 3VBRB 3ZYIB 4UOJA 3M3EA 1ULDA 2XL9A 3ZSJA 3O0VA 1KS5A 3FMGA 2VR4A 5C4WC 2GN3A 4Q0QA 1SCRA 4M4PA 2WYFA 3VBFC 3NSTA 5LRRA 1LOAA 5FBJA 4YFZA 1VR3A 3KT1A 2HWF3 2DVGA 4LBKA 2VGDA 3T08A 1HB2A 4P9LA 1K5MC 2FDGA 4XHXA 1S0GA 2RS12 1GNHA 1BBT1 2AC1A 3N36A 4BWOA 1DYPA 1UZVA 2OIIA 5A3TA 2D6MA 2WNUA 2A6XA 4XUPA 2W68A 4DRVA 3ROUA 1NA1C 4AGVA 4CDQC 3VD4A 2VECA 3SNMA 4TWTA 3I2DA 4ZONA 1V0AA 3A4UA 3E6BA 5A7OA 2JG8C 3LEKA 3CEWA 1OXCA 4RR3C 4S2HA 5ACA1 2RR11 4UFJA 4XW3A 2A3YA 3K4AA 4NIIA 2ET1A 1WW4A 4AW7A 3IZOA 1VBC2 5C3QA 1UN1A 1AF9A 4HKOA 5HI0A 1OKQA 4W6XA 3IDAA 4BQ4A 3WVJA 3MF6A 1XNAA 2OUJA 3HEIA 4IE6A 5FY9A 5KXDA 5J98B 2HBTA 5FZGA 4ZZ8A 3URFA 3RZKA 4JV4A 1S4CA 3J26N 4CU6A 5BV6A 2Y8KA 2ZS6B 4I30A 2PTMA 5BNQA 1IQDC 2QQOA 2ZHLA 1UY4A 2R043 1F15A 1LR5A 1E5SA 1WBLA 4O9GA 4GJZA 5KHKA 5ERLA 2IXCA 4PJYA 2HWC3 1QQP2 1OFNA 3VL9A 5KBFA 3VKFC 3IM0A 5G04L 4K3UA 4QGMA 1NE6A 2VPVA 4LBQB 3WQBA 3J4UH 2OZ6A 2RS11 4E4DX 1GFF2 3WQ7A 2GC3A 5C5TA 4QT6A 2FBEA 2RJLA 3LFMA 4HVQA 1SBEA 3M3CA 1CAXB 2DFCA 5FJHA 5EYXA 5BUVA 4E27A 1JMUB 1US3A 3WF0A 3BODA 2XLFA 3MHZA 3RQ0A 3QD6A 2CHHA 5A3NA 3O1SA 4PQQA 3LFIA 4CEYB 4Y1YA 4AHWA 3ZKYA 3WXPA 3ACFA 3LZZA 2NPIA 2UY8A 4IERA 4YW4A 5J36A 3W58A 3DV8A 2VVDA 2WQ4A 2BBVA 1JUHA 1R1A3 1TMF3 3BTYA 4LT5A 1F5FA 1FMD2 2EAKA 4AI1A 1U12A 2ERFA 4TSVA 4CU9A 1HXS1 4D6RA 2EF6A 4IV3A 3TB0A 1LOFC 1ND3B 1RMU2 3AP4A 2IXKA 2W87A 3LPFA 4CP9B 1RYYA 4IEUA 3VBFB 5JOYA 2JG8A 3B9IA 5J48A 1ZA7A 4KL1A 1UZ0A 3SITA 2VAUA 3HOBA 5IWFA 1H1IA 2VXJA 5FMOS 3PUQA 4CCDA 1OLMA 3RZGA 4OFGA 5A3OA 5KC6A 1C8M1 1W2TA 5FZ6A 1YQ6A 2R0FA 4QX2A 2JDUA 1JHNA 5FY5A 3OD4A 3WDYA 2LM3A 3I3QA 1R082 4YWAA 3LDKA 2C1FA 4AFCA 5JMCA 2AGSA 2Z42A 3DPRC 4PI0A 5FZ1A 2Q8DA 1I3HA 1WCSA 3NV2A 5CYYA 2Q8EA 2JDMA 1S0FA 1YFYA 1EAH2 3WQ1A 3ZIWA 4AZZA 3J8F3 1AR63 1CJDA 2GMMA 3H50A 3KD4A 3I7DA 5FZLA 4LULA 3U78A 2WA3A 1SLTA 4RFT0 1NZCA 3KM5A 2ATFA 1C8NA 4E4ZA 3ZXAC 3IDBB 4C0HA 1IPJA 4YVSB 2BGPA 1DG6A 3NNJA 3ZFEA 3ZYHA 5H9PA 4KQ7A 4ASLA 1PGL2 4J25A 2R061 1NCQA 1PK6B 2LROA 2WC2A 3OGSA 2R041 3R0RA 4OMCA 1JTZX 3NKTA 2RDSA 2W9XA 4UBHA 4CCMA 5DZEA 2VQ0A 2ZEYA 5FK8A 1U5XA 2YG0A 3AYCA 3WDWA 2EIDA 2WINB 2EA7A 2BJSA 2W1SA 5BNPB 4OUMA 2ES3A 4I0BA 4XIKA 2FCTA 1H6XA 3BI3A 1QJEA 3FHIB 5DDJ1 5D1IA 1XC6A 3POFA 3ZYJB 5JXGA 1LKNA 3MBWA 3TEXA 4L9BA 1KFXL 5I0TA 4CCKA 4Q8KA 1E5RA 3AMPA 3DYMA 4Z92B 1DQ1A 4M0HA 1HQNA 1AXKA 2VD7A 5JSOA 1MQTA 5K9YA 2VVFA 5LWBA 1DBNA 4KH9A 5L73A 5BYNA 4NOTA 3RDIA 3GCXA 1CX4A 4QGNA 3ZFFC 5C8CB 4PDWC 2FDIA 1W9WA 2BWCA 1QJY2 2HWD2 2HWB2 3O1MA 2PAEA 3POJA 5DAWA 2QQLA 1JH5A 4LQRA 4BLIA 4FOYA 5CKNA 3SCGA 1WMFA 4NRPA 1JOBA 1RHI2 1DF0A 3T1MA 1WD4A 2W39A 4PDWA 3WP6A 3NO8A 1AR73 3ES1A 4XCBA 5IK7A 5J3UA 3ABZA 5E88A 1E5IA 2VCBA 1W8OA 5BNOC 1RIRA 5F37A 3QLQA 1AR92 2BUKA 2ARXA 3SH4A 1V6OA 3DYOA 3N9LA 3JU9A 4GH4B 1O3SA 3VLBB 3AYAA 1ULFA 1OUSA 3CL1A 4RD7A 2VO5A 4V2VA 3T4HB 5F3EA 4FSJA 1RMU1 2A70A 4NWWA 3ZVXA 1MZ5A 1RVF2 5FP4A 2YGMA 1DZTA 4DY5A 4XUNA 1R1ZA 3AK0A 1W3XA 4CEYC 5JOWA 1OF4A 2CYFA 4QU2A 4EV0A 5CADA 1AYN3 3MFAA 2ETEA 3VD3A 3PIJA 1WMDA 2F4PA 1SLAA 2P3IA 4HN1A 4AR2A 2GNMA 2JDYA 1TME3 3K77A 3ZPYA 1H2KA 2QUOA 2XXZA 1D2QA 3D82A 2DCZA 1AYM3 2J22A 1G9DA 3RGBA 1QJU1 2R32A 4AVVA 1F31A 3NJXA 3PMSA 3TOJA 3BKZA 4GMP3 4JDNA 1PGSA 4XEZA 3VD5A 5LEJA 3PL0A 1O7FA 3USSA 1R083 4QB6A 1C28A 3M3IA 3ECQA 1IPSA 3H1YA 2FDFA 4A6OA 2BDRA 3MZHA 1J1TA 5HPOA 5L9VA 1ENXA 1NOVA 4AHXA 5L7OA 2O8OA 1ZM1A 2VZTA 4ZKTB 2VOVA 5FYMA 4A3XA 3TYJA 1WW6A 1OT5A 1EAH1 2DU1A 3IBMA 2ZGMA 5L7OB 3O1PA 3I49A 2A6ZA 5DZFA 1R64A 4X8NA 2XQXA 2Z69A 4EWAA 3P3NA 3ZXFA 1ZREA 1G9BA 1IG0A 2GSYA 3M7AA 5CFCA 3N7JA 3RVHA 4Q4W3 4DNYA 1Y9MA 2RR12 1XQNA 3OCPA 2WWSA 2VOWA 3FLTA 3U11A 1ENRA 1HJFA 1DGWX 1Q8SA 4A44A 1O5UA 4XABA 4G3YC 4AVTA 5A6XA 3AL6A 4YW3A 5FY7A 2QQMA 1VBA1 5FXWA 2E7AA 2ZJCA 1VMHA 4Y1XA 3OUHA 5HCBA 4LHSA 1UXZA 2A73B 2XLAA 1AR83 1U5IA 4BOWA 2ZMKA 1GP6A 3KCXA 4CXYA 4FPFA 1OSGA 4E8DA 4P02B 2RJKA 2XJTA 3BOPA 1ZRFA 1C5IA 1H9PA 3HT1A 3R4SA 4OQ9A 5A3MA 1KXGA 1GOHA 3SC7X 3B69A 5J7MA 4OHVA 5GZDA 4QQOA 4NVPA 1FYUA 1WUVA 4F3JA 1IGOA 4TYSA 3HWJA 3TWIA 2WN2A 4PIXA 1OQEA 1VAMA 3M3OA 4WM7B 4AQ6A 5GLWA 5AC91 2GP5A 4HFSA 3BTZA 4H7LA 4XF3A 3OYWB 3ZXDA 3N9NA 1PZ9A 2XR4A 1IOAA 3HR9A 3PUSA 5C9AB 1CGPA 1D4M1 1H0BA 2XJUA 2Y6JA 2V5DA 4Q0PA 3RMYA 1YIFA 4GWJA 4CYDA 5FWEA 3DL3A 5TSWA 1OA2A 4RR3A 3IAQA 3MIDA 4M00A 1SLIA 1RUE1 2BTVC 2JIGA 2P5BA 3GZAA 4QGLA 1PNFA 3AZWA 3I59A 2WFPA 4HLTA 5IVBA 3BB6A 2FMDA 5JAXA 4MGTA 5SV8A 3E1F1 1ZA4A 5FY0A 4YW1A 5A1AA 3WNPA 5F2WA 3PLQA 3S5AA 1UMIA 1UY3A 2CV6A 2ORXA 4MGSA 3T0BA 3MLJA 4LO4B 2BZDA 1FOD2 2TBVA 3CLPA 3IAPA 3ZYPA 4LMFA 5HBAA 2P37A 4RS5C 4DEQA 3KMHA 3USUA 2IUWA 4K20A 1J3PA 1QDCA 5DDJ2 3BTAA 4CDWA 4QHZA 2Q4SA 1JBCA 4QPIB 2Q1ZB 2LTNA 1O5LA 2VCCA 1CR7A 3KVBA 3PURA 1W8UA 3G6JB 2W0XA 4DMIA 5A32A 1I5PA 1FI2A 5F7UA 4AGRA 5FQ0A 1Z7S2 3LB9A 4MXWB 2GMPA 5C5UA 3ACLA 3VBUB 4H14A 1QU0A 4ZS2A 3TRSB 3ZFEB 1VB4A 4YZ5A 4EQVA 1W9YA 1AXYA 1VBD3 2Z4FA 4LBOA 4A4AA 2Y6HA 4FPEA 3BIWE 2ARBA 1DZRA 4Q26A 3WSOA 1NCRB 2D44A 1VBE3 4Q4V1 4AFDA 1JN2P 5JOXA 3B00A 1W0NA 5F5IA 3NW4A 3PU3A 4IGQA 3M4FA 1DQ6A 3C7FA 5JMOA 1WMXA 2ADDA 4P00B 4YRDA 4QB2A 4LHLA 2ZMNA 2J7MA 5ACA2 3VKMA 3CZJA 4YFWA 2WAOA 1XB9A 4NIAA 5DN2A 5LA2A 3ENRA 1RUJ1 2XH6A 2R062 4TTGA 2YY1A 2RJ2A 2D6OX 5J37A 1GP5A 1QOTA 1V6JA 2WN3A 5H9QA 4JVAA 1FNYA 4A3ZA 4HK8A 1OHFA 1H1AA 4OI4A 1PNGA 3NWKA 1ND2A 4PHZA 1GZWA 5CZKA 3FHAA 1RINA 3AKSA 1IS5A 3OGRA 1V6NA 5C8CC 2OVUA 3GHNA 3HVDA 2TEPA 5FPUA 4URTA 3LD8A 2V73A 3AXDA 5FYIA 4INDA 3ZMOA 4UWDA 4UXAA 3SMHA 4E4SA 1ND3A 1GV9A 2VBBA 3CZUA 3PTYA 1EPZA 3Q8EA 3FUOA 5FYZA 4XMAA 5CVRA 4P9YA 3DPRA 1GOGA 4YW5A 1W6QA 4JCKA 1PZ8A 4MVTA 4P9GA 2TUNA 5FMOL 3J7NA 4P5YA 4CEYA 4OI2A 1GWLA 2D6LX 1WWYA 3IDCB 4META 5A7WA 2FQPA 2R073 3MUZ1 2QTWB 2XG3A 5AC92 3O1UA 3MIFA 2BVBA 4XJ9A 4WV8A 4Y4YA 4Z8BA 4B29A 1PIV1 4ASKA 3LDRA 3WNOA 5EQUA 2VW0A 2QFEA 5JVVA 4M3CF 3ILFA 1W99A 3ACGA 4AI3A 1PGW2 2HBUA 1PX4A 3FZ3A 1DQ4A 4UFMA 5T3NA 1UPIA 1OLRA 1XYPA 4IUGA 3UGHA 1PIV3 3O0XA 1LCLA 4KU7A 4M0NA 4MADA 4LBQA 3WDVA 4CDQB 1BVP1 2AEZA 2DTYA 2HWF2 2R30A 2XVKA 4I09A 4OZXA 4WM7C 4FQ4A 4K40A 4XIOA 1O3RA 5FPAA 1MS3A 4O61A 4S2GA 4LBJA 4LK7A 1OPOA 5FKCA 2VC9A 2GAUA 3SH5A 4CU8A 3TBDA 3ZO0B 3DF0A 3O5SA 1CPMA 3Q9OA 2E31A 4PBOA 4LBQD 2D5HA 2YMZA 3MW4A 1HRI3 1UWWA 2ZGNA 4QU1A 4ZU7A 4FXGB 4Q0VA 3WW2A 4CRQA 1YXWA 2YFUA 2VH9A 4QWNA 1H2NA 1US2A 4FCAA 2WIIB 3VBFA 3MFCA 1YFWA 2EXKA 3PVBB 1KFUL 4COUA 1EAH3 4ATFA 2VNRA 3S7EA 2VQUA 3T2QA 3GALA 3RZJA 5IK8A 1A8MA 4NHXA 1VMFA 4TXWA 3JD71 3UKTA 4DRRA 3MW3A 1H30A 3VBSC 2E6VA 2LW8A 1REFA 4XFIA 1PMHX 1MVQA 3BTXA 4TN7A 3H8XA 4LBMA 3I2GA 2PHLA 2RS53 3RJ2X 5LCWL 1VALA 5FCCA 1T2XA 2C26A 4QPWA 3RI9A 2ARAA 2CGPA 2BOIA 3THPA 2FCUA 1B35C 2JE9A 2WNOA 4QHOA 2VXRA 2EXJA 5DPNA 2WA4A 4X6RB 5FYVA 1RUH1 3WW3A 4EN9B 2WFF3 1WZXA 4S2DA 3ORJA 1AL23 4LORA 4Y3OA 3E5XA 3HPNA 1EV12 1RUD1 5BY5A 1LODA 1NAEA 1O8PA 2ILMA 3OG2A 4BB3A 1POV3 4LO8A 4C1XA 5C70A 4U36A 2HH9A 2V72A 2VMIA 3EMRA 3L2HA 1XNCA 3FUQA 4Q4X3 4QX7A 1XJAA 4Q8LA 4W8JA 4WVVA 5FPBA 4XFBA 2RHPA 2ZXQA 1Q3EA 1OD3A 4XF9A 4BLJA 2AH2A 2VZOA 3IIIA 1QEXA 2XBO2 3KSCA 5AVPA 4YPJA 4QX3A 4K21A 4LR4A 1ZZ7A 3UT0A 3VDBA 4EYUA 2JDHA 1XNTA 4Y24A 3RG0A 2AZ5A 3LIGA 3ZXGA 4DQAA 3LGRA 2KM2A 2MEV3 1BLZA 2RM22 1EUTA 2ZPXA 5I93A 5B4XA 2QZ2A 1S0JA 1R1A2 1F4AA 1T6GC 5AFEA 4MLOA 2D93A 2VM9A 3A0KA 1PX3A 3PU8A 2UYAA 2ZGOA 1UNBA 5JZGB 4XCAA 4NHLA 2E32A 3H8OA 1UD1A 3SH3A 2J1VA 4KG0A 1QIQA 5HCAA 4MYEA 2JWPA 2RMU3 1LECA 1BMV1 1UO9A 1H8TC 2XJSA 4CA9A 4P9XA 4A7KA 4E2QA 3ZDVA 3TAYA 2VTFA 1CZSA 2V5YA 3FE5A 2DTWA 3I2KA 1CIWA 1JOJA 2JDZA 4YG6A 2C24A 1CVNA 5CFCC 1NLSA 1JYVA 1OH4A 5IVJA 3VDDC 2ZX1A 5FLHA 2BNNA 4MH0E 5FPZA 1RUJ2 2RDNA 4XBLA 4ITCA 1X9PA 2NYYA 4JGYA 1L7LA 4E9KA 4BMEA 2VCMA 1JI6A 3WNLA 2V4VA 1NA1B 2W3JA 4IV3C 4FPYA 4KBZA 1ZNPA 2ORZA 4IE4A 1VBC1 5AC93 5JPNB 1IPKA 1YCIA 5I0SA 1WLTA 4FO9A 5I8YA 5FZCA 4JDMA 1JYNA 1CIYA 1O4TA 2P6CA 5FYBA 3VBHC 2E63A 3UESA 3CMGA 4CCLA 1SLLA 1LHVA 4WM8A 4JC1A 1HRI2 2B39A 1VBB3 4ZPIA 2CNAA 2RM21 4NHYA 1IHMA 4UBGA 2FMYA 1AVBA 3HD8B 3RWNA 2JD9A 1MQTC 1I6XA 5FYYA 1O4YA 3U10A 4L99A 3VB9A 1OH3A 4HVOA 5J96B 3WF2A 2VL4A 3RZMA 2G9ZA 4ISRA 4XUTA 2VBDA 3KB5A 5FMBA 4L97A 1QQP1 1S0EA 2X8KA 5A7SA 4OHZA 2GH8A 5IVEA 3AVSA 4FFGA 3AX4A 3ETQA 1ASJ1 3FJSA 1U0AA 3KGZA 4D7TA 1G9CA 5ANQA 2I07B 1E5HA 1CZVA 3K48A 5FYUA 4AEDB 5IFPA 1DLLA 3D3AA 4YARA 1QJY1 4B1MA 4ATEA 1LESA 1PVXA 1S2KA 1PK6A 3Q8CA 3WINE 4CDUA 1VPHA 5CISA 5IATA 5BNOA 5IK5A 1NQDA 3N9MA 5IW0A 3RPQA 3U1XA 1YLLA 2K2SA 1ZRRA 2OKXA 2PAMA 1F4HA 3POEA 2DCJA 1ZRIA 1WCKA 5I8TA 1O4ZA 4BQ1A 4YZ1A 3T0DA 1CAWB 2OA2A 1BBT3 1O91A 1HXS3 4GZ9A 4JKLA 3EBRA 2UURA 2HWB3 2XVLA 2F6BA 3NV1A 2CAVA 1OOPB 1UYXA 3KCYA 1LHUA 3THTA 1YI9A 5FKBA 4DPNA 3N7KA 5G05L 4Q1RA 3SQOA 2ZX0A 2UWCA 1NKGA 2UYBA 4CSWA 3MUY1 4BU2A 4XQDA 5ABJB 2D6PA 2HWE1 4L2NA 1UZWA 1AYN1 2FZ1A 4WM7A 5FP8A 3C7HA 4R4XA 4FTSA 4Y1ZA 1DQ0A 2QZ3A 2H0VA 4NAOA 2XDVA 1B35B 2BWAA 5A7NA 3ETPA 2FD8A 1YYNA 3I3EA 2OX0A 2P6HA 2ZHMA 2P3YA 5LBEA 4JKMA 3ST7A 2H6CA 5FR3A 1YEWA 3AKRA 1QJU2 1YFUA 1ASJ2 1W6MA 5EV7A 1GSLA 5C3RA 3ZR5A 2GNBA 2BOJA 4GWNA 1OA3A 3M8LA 3HNMA 5DUWA 3LE0A 5LA0A 1UL9A 2RM23 1YWKA 4RFRB 4IEWA 2XWJB 4DXTA 3AYDA 3P5BA 1BMV2 1SHWB 4QX8A 4QPGA 2HWC1 3FHQA 3WNXA 3JB8A 1N3OA 1EV11 1MS5A 1DYKA 1RUD2 1LJ7A 2CGNA 4KU8A 2EIGA 4RA0A 2A7AA 3H3LA 3VBHA 3KV9A 1XU1A 2JB4A 1OFSA 2PQQA 4D7SA 1MZEA 3WF4A 4XDOA 4MUVA 1W8WA 3OPZA 3CJIB 4DUXA 1H8VA 2E53A 5C3OA 1LGNA 1DGLA 2WL1A 3D4KA 1FOD1 1K5MA 1VRH3 1UYYA 3DN7A 1S0DA 5LB6A 1MR5A 5LBCA 3VDAA 4M3CA 5T5OA 2HEYF 1WD3A 4GULA 1OI6A 2OT7A 3OSDA 3O1VA 1T6BX 1Y3TA 2D7FA 2PHXA 5A1LA 3T3YA 2PLV3 3CNAA 5E89A 5LK7B 2VW1A 1HRI1 4QDSA 4AK3A 2NQYA 1X9TA 1MVEA 5A6YA 1XPWA 4CUBA 3AZYA 4RHV3 5EJZB 3ZIXA 1QXRA 2WSVA 2IFWA 4CP1A 2WKKA 4N43B 4HOOA 4GWIA 3I97A 4XAAA 2WLQA 1CONA 3J7MA 4JHTA 4KI5M 1E57A 4XFGA 2CTVA 5CKMA 4NUBA 1GZCA 3RMXA 1VRBA 1ZVFA 3AM2A 4QKDA 1LOCA 1TVGA 2ZCWA 4LIVA 2B9UA 1IS3A 3AYEA 3V65A 2EXHA 5BPXA 4IEVA 1D4VB 1LHWA 2AUYA 4C90A 5CAZA 2R072 3I2FA 5KHHA 3MI8A 3BCWA 4HSJA 2BEOA 2ZTNA 3VBUA 4J1WA 1YQ5A 4DXRA 4AE2A 3ATGA 3MPPG 1OQDA 1IG3A 4YG0A 1Y4WA 3MV11 4FTBA 2W08A 3ALQA 4PLMA 4UT5A 1BQPA 4AEDA 1QY4A 4GXLA 5JXIA 4IEZA 3OUJA 1ZYBA 2ZGTA 3K51A 4K8RB 3U14A 5JSRA 2CU5A 3RYRA 3WX5A 5JZGA 1QOSA 2A6VA 1PVC1 1UF2C 1W03A 2D6NA 1W6OB 2ZEZA 2LALA 5FFOC 5LA1A 1H8TB 1SFYA 4YGBA 1DFQA 1PO11 1KQRA 1W0PA 4O9EA 2HWE2 4EWEA 2GU9A 1BCXA 2Q0AA 2XJVA 3WQ0A 4OHXA 5SV5A 1W6NA 3NNFA 2AENA 3GZEA 2ZGPA 4BIOA 4IXLA 5FZHA 5LBFA 4Y1UA 3VBSA 1SQ4A 3NMBA 4D8MA 2BVVA 4LE4A 3V0AB 3EHKA 2WSUA 4I2OA 3IIAA 2PA7A 2A75A 4R4ZA 5F5AA 1G6NA 1W6OA 3MO4A 4OMDA 3UKNA 2W46A 1LGCA 1PIV2 1MEC2 3WW1A 3ZSKA 3KLSA 4WVMB 4AF9A 5C33A 5IYYA 2WLPA 3TEWA 1UIJA 3GZUC 3NQHA 1UPSA 4IEYA 3AXEA 1RUI3 2D3RA 1PGW1 3PIGA 1OKOA 2B7YA 4AVBA 5IUQA 1Z7S3 5CIRA 2J1AA 5EPAA 3ZFGC 1RUG2 4FP3A 1POQA 2ZACA 3P6BA 2VW2A 1NCQB 2BFUL 3ZYBA 5CFCB 3GHMA 2WZEA 4QDRA 1M4WA 4K6BA 4LLFA 4AI0A 4BIFA 2RS13 2DV9A 3W21A 2RS33 3GF6A 2XKPA 4LO6B 1XE0A 3WUDA 3JB4C 1VBA2 4MHRA 1O6UA 1SFPA 1AYN2 4AL9A 4NIDA 4DZGA 1FV3A 1QNWA 3SLIA 1R091 4JDOA 5FOBB 1H4HA 2DURA 4XJWA 4Z82A 1LU1A 3BN6A 4ZU4A 2QQVA 4P9IA 2XONA 4XURA 2XGXA 4F7ZA 4X8PA 1GUIA 4N9HA 4RHV2 2P3KA 3POIA 5GZCA 3K3OA 2QDNA 2QQWA 4NO4A 3POGA 4UW6A 5FY1A 4ZXKA 4GB33 2VBPA 2QQIA 4XXPA 5ABJA 5F9TA 2ZGLA 3CU7A 1HB1A 2PHWA 3ILNA 5LRSA 4PT6A 1GOFA 1LGBA 1C3HA 1X8MA 5FZKA 5E16A 5GJ6A 4XUOA 5HXMA 4MG2A 4NHKA 2VNOA 4BCUA 1VB2A 1V70A 1SDWA 1XSRA 3LA2A 4BA6A 4BISA 4Y22A 3O7OA 4UF0A 1XE8A 3HIFA 3VD9A 2Q1FA 4CCCA 1RUE2 4A7ZA 3CJIA 4RGAA 3GGLA 4JZRA 3GCWA 5A70A 1AJOA 3BU0A 5GZGA 4DXZA 3L2YA 5KC5A 2CDOA 2YV8A 2VOTA 4RQPC 1LOBA 4CCNA 1SMVA 2ZA9A 3T30A 4QQLA 4N90A 5ANNA 2HWF1 3UV9A 1RUJ3 1WA6X 1XNBA 3ZYGA 5A3PA 1QJFA 2W5FA 2RG4A 3M1HA 1Q43A 2ZAAA 5FZFA 2VZ1A 1CAXA 1YFXA 3LCPA 5DG1A 3VZLA 4Q0SA 4A42A 2Y6KA 2MEV1 1OVPA 2X53S 3Q8AA 3VBRC 5DAQA 1W6MB 4QXBA 3GBWA 3U4SA 3QH7A 2OPKA 1PVC2 2B46X 3OTFA 4GH4C 3B02A 3OUIA 1J3RA 3O0WA 2FCVA 5A7QA 2VZRA 2W1QA 1MS9A 3D0SA 3MW2A 3N4MA 5L36A 1COV3 2Z79A 4KWUA 1GZ9A 3WP3A 4CUGA 3B94A 4Z2WA 4FP2A 4JGZA 4QPYA 2GZWA 4ARYA 1V6LA 3I54A 4CDWC 2HEVF 1RL3A 2VU9A 3RZLA 3SCFA 2VZSA 3TN91 1DQ2A 2P34A 4Y5SA 1YQCA 1NLRA 3IDEA 4GIQA 3C8XA 2ID4A 1CAWA 1BEV2 2PHUA 2XJPA 2QNKA 1CESA 4GWMA 2WZPP 4CDQA 1LNSA 3QCWA 4IEQA 5A80A 4B8EA 3GJBA 1FNZA 1DP0A 1FX5A 2SBAA 4LOSA 4N9IA 1AL22 3T2PA 1F5JA 1FOD3 4N53B 5C7GA 4CP2A 4YVSA 5A1FA 4XC9A 1RUG1 2P1BA 3OEBA 4YM3A 2QQKA 5L19A 3OGVA 1OVSA 3KF5A 3PMEA 3OJBA 1YC61 4FTEA 4XFCA 4YVWB 4ISQA 1K5JA 4D6SA 4AFAA 4YZ4A 1QNYA 4HONA 5FTTC 2XBO3 2C4XA 2VTXA 2PQSA 3KV6A 2JG9A 2QQPA 2DUOA 2Y38A 1LENA 5FQ0B 3THDA 2JDKA 4CP0A 5KR7A 2XPJA 2WO7A 5FZMA 2Y6FA 4GJYA 1BHGA 2R0HA 5FO8B 3MIHA 4Q4Y3 5EZWA 4AQSA 5JI9A 4HSLA 5FP7A 1OA4A 5J09A 5JR2A 1PO23 1UY1A 3LKJA 4M3CE 5DG2A 3ASIA 3MV01 1GKBA 4AQ2A 1QDOA 4IV1C 2Q8CA 5CG8A 3AKQA 3HNBM 4NWVA 4GALA 4EZHA 5FDBA 5JXHA 2XJQA 2GN7A 2ZZJA 4AG4A 4J6GA 3OGJA 3ZXEA 1CAUB 1LHOA 3MYXA 4NROA 1W6NB 4Y1VA 3NV4A 3VKNA 5FRAA 5HXVA 2RE9A 2X05A 5IVCA 4WZCA 4TLGA 1QXPA 5FV3A 1BEV1 1RHI3 5D8AB 2JJ6A 1DIWA 4YYOA 3ZN6B 1ZBE3 1NT0A 1ENSA 1CD3G 3AMHA 3UJQA 3VBOB 4AI9A 1LB2A 3PVEA 2D43A 5LEKA 1HKDA 5EXOA 4K9SA 4XMIA 2K46A 2WT1A 4JTNA 3ZMNA 1SLCA 1N3QA 5DABA 1QJX2 4K1YA 2R1DA 4BE3A 5FLJA 1QF3A 1X8EA 5D21A 2Z2SB 3PUAA 2G19A 1KS4A 2WQ8A 1NZIA 2VY0A 5FPLA 4B3NA 2BRTA 2ZHNA 5HCHA 2A1XA 1UMZA 1LOFA 4XFFA 2JICA 3WV6A 5ISLA 1R092 5K4LA 1S0BA 1RUE3 4LKSA 2IVIB 4YZ3A 4JQTA 3ACHA 3Q8FA 5A3WA 1ULEA 3P3PA 3RFRA 3APBA 1GMMA 2GDFA 4NAMA 2JG8B 5EHDA 2AREA 5FZ8A 1HW5A 1ND3C 2WNUC 2YB7A 3CF6E 1FPN3 3N9QA 2PN5A 3VZMA 3NNGA 5FREA 3O1RA 4LUKA 4DINB 5F39A 3S57A 2ZKNA 3ZFEC 3I3MA 4DXSA 1W9SA 2EAAA 5GZFA 2PHFA 2DVAA 2QDRA 3KHBA 3HN3A 2JE7A 4BQWA 3ZDSA 3MLLA 4Y5Z0 1ZBA2 2DCYA 1IS4A 1EY2A 2X29A 3ZSLA 4AFBA 2L9LA 2BNOA 1GZTA 3JD72 4LXLA 1RUNA 3LSDA 4BQYA 1Q5OA 4MO3M 2PHRA 2G9FA 3FLPA 3ACIA 3L9JT 1CJPA 1PVC3 3QH6A 2C5DA 2VZUA 4H3WA 1CX1A 2JECA 2RV9A 4CDXB 2F17A 3VBUC 3QBQA 1JYCA 1JUIA 2BNMA 1Y9QA 5C3SA 5FP9A 4DFSA 5F3CA 1QOOA 2VUJA 2WABA 2IXHA 2JKXA 5IT6A 5EJ3A 4AEKA 4JAAA 4Q1PA 3ZYRA 5F3GA 4OI1A 1HIXA 2HWD3 2OXBA 5DAVA 3WZ1A 4M3CB 1UW8A 1W90A 3VZOA 4Q4X1 4EN0A 2JG9C 1OLME 1U5ZA 3NL1A 2BFUS 2WT2A 5J1XA 2OYZA 2PELA 5L9RA 5T50A 3H9AA 1JZ6A 5FZ0A 1RJ8A 5C9AA 3KWVA 4GKXA 1H2LA 2HWE3 5H9SA 3OYWA 1RUH3 3A23A 5CU1A 5DUXA 4BXSV 1OLQA 2XBO1 3D0JA 4MOAA 2QQUA 1FV2A 3W5NA 4R9CA 5FZBA 1ZRDA 1ZBA3 1X50A 3H42B 2W1UA 3BU7A 1S55A 2R6QA 2LRPA 4YGDA 1YNAA 3ON7A 2YHJA 5DMYA 4YZ2A 1J83A 5BNPC 1JYWA 1ZBA1 2UWAA 4FT8A 3RYKA 2YC2A 2WNEA 4MX3A 1POV0 5LBBA 3VBOC 2NZ9A 4HETA 3R6SA 3KT7A 3PTRB 4IEOA 5HCFA 4CXWA 1DDLA 4QM9A 5A7WB 4HKWA 4COVA 4PF1A 5A3UA 2XKOA 2WNUB 4HK9A 1FATA 1ULCA 3UL2A 3WP4A 4NIHA 3OBTA 1W28A 1KITA 4KGGA 5LY2A 1N1YA 4GD4A 4D6QA 4RS5B 5LASA 1DU3D 4BDVB 2HWC2 1NA1A 1G9FA 3OY8A 4Y5TA 3BOWA 1HRV3 2OUHA 2RS32 2ZZQA 3HQRA 3NJZA 5CA6A 1QGLA 1D2SA 1OOPA 1LU2A 4JKKA 2WFF2 2DBNA 4QX0A 3AP7A 5HV4A 5CNAA 4H55A 2GC2A 1RXFA 5JOZA 2YU2A 2BV4A 3OD0A 3B7MA 3WNMA 3ES4A 3RZZA 2E33A 2Y60A 3HJRA 1BK0A 4Q4W2 1JYTA 1ALYA 2HJIA 4FAHA 3DXUA 3NJVA 2NMOA 3GM8A 4K7JA 1VBB1 4XILA 4Z1VA 3V0BB 2MNGA 1AX2A 2VMCA 4XYXA 2YBPA 2QVSB 4LPLA 2P2KA 2VUCA 1W04A 1YJKA 2GNDA 1WLDA 2A3WA 2YPJA 4JGYC 4OVEA 4FBFA 2VULA 4H7MA 4ZZ5A 3OPTA 4XDQA 2VMGA 3T1LA 4MGQA 4CCJA 2D3SA 1RUC3 4IV1B 4R9AA 4IQPA 1MZ6A 5I0RA 4R52A 3SXWA 4BK4A 5KXCA 3AMNA 4D3WA 2WYSA 3IPVA 4YM0A 2WBKA 2GC0A 4LK6A 1CN1A 4WM8C 2W95A 4BXFA 4OHWA 4PBPA 5BNNB 1GZWB 1XXNA 1KD7A 2VOKA 2VCAA 1GNZA 5IK4A 4XUQA 5FO9B 2RMU2 2XOMA 4HKLA 4WVZA 4OUEA 3BUCA 1DGWA 4QM8A 4FPHA 3ELNA 4AEJA 1AR82 4COZA 2QQJA 2E9QA 4GMP0 1FXZA 1UOGA 2J1UA 2VE1A 4W4ZA 4AYUA 4CTEA 5C9AC 3PJYA 3H3UA 5F3IA 4CPBA 3NNMA 1Q8QA 1DQ5A 1FT9A 2QE3A 3FX3A 3WUCA 4AEMA 1O59A 4JQRA 3N35A 3AP9A 4HPKB 4RQPB 1YQ2A 1CPNA 5DXDA 2KA3A 1A6CA 1G8WA 2YFZA 3ILRA 4FVVA 4QXHA 3USUB 1RXGA 2PHDA 1TMF1 3RNSA 1SCSA 1P8JA 4EN8B 1SZBA 3IMNA 1W39A 2IXJA 1OOPC 1JOPA 4ZHNA 4LO7A 1HB4A 4QPGB 5GZEA 1PO21 1VBE1 3HQXA 3PVNA 5FJKA 1A3KA 4UW4A 3DGTA 5JR7B 5CG9A 3UNPA 1POV1 2ZX4A 3FL7A 5A32B 4KBBA 4FOVA 3I2JA 3IPVB 3FC0A 4K1ZA 4W50A 5JCTA 1VP6A 2YBKA 3B5LB 1TG7A 4O7XA 4NJ4A 4SBVA 4XVHA 4QPIC 3PHMA 3UJOA 1O3TA 1G9AA 3ZSMA 3K46A 4BMBA 3OY8B 1SACA 4JHZA 4BM8A 3A21A 3WD5A 3WP5A 1SEFA 3BYWA 3DYPA 5B2GB 1HQLA 2RS51 1GQHA 3PJQA 1HN0A 2PMWB 2CDPA 4R9BA 3ZFGA 5C71A 3NKGA 1B09A 3ZXJA 2UU8A 1YO8A 2KXLA 4UW3A 1VLNA 5FY8A 1F8VA 4QXCA 3T09A 1A8DA 1RUG3 1HRV2 4DO0A 3SCHA 4D69A 4RYDA 3I59B 4GMP1 4UF0B 4F83A 1FPN1 1GANA 1W06A 3LDBA 1QJX1 3WDXA 4C1WA 2JDAA 3A0NA 4MGIE 4E8CA 1K5MB 4XZPA 4D0QA 3R05A 1BKZA 1JW6A 2D5FA 5F6KA 2Z5WA 4CU7A 5ACA3 4MSVA 3U75A 3WG1A 3WLUA 3C3VA 1OPMA 1BBT2 3T2TA 3AC0A 3CJXA 3EXUA 3T2OA 1DGRA 2JDNA 2ZGSA 1Q56A 2RDQA 1D0GA 1VBE2 1K3IA 2YU1A 4P9JA 1D4M3 1H2MA 5LK5A 1LOGA 4I0AA 2PHTA 5K0UB 4HBNA 4NE9A 2WS92 5FZ3A 4PLOA 4QX1A 2VNVA 3E6DA 1KRIA 2JIJA 1W2OA 4QX5A 4XXAA 5FWJA 2W91A 3J7LA 5IAXA 3W59A 3EO6A 5FUIA 4LITA 4F8AA 1WBFA 4EE2A 3N9PA 4AVCA 4N7UA 3VDCA 1FMD3 4KNCA 2K9ZA 4CP9A 1LRHA 2DU0A 4AI2A 3HAGA 1UIKA 2V4AA 5FYSA 4QPGC 3AB0A 4Y20B 3KZ4C 3C7GA 4W6YA 1UYPA 4BHPA 4U2AA 3WNKA 4ET7A 2RS31 1I9RA 3B9CA 4PLNA 3HMYA 1IQAA 4W6WA 4B4QA 5LW9A 2R071 1K42A 2PYTA 3R4DB 3WW4A 1PM4A 3FLRA 4AAXA 4PDWB 1XU2A 2JENA 4BJ0A 3MIEA 1AJKA 2ZGKA 3AZZA 1RUD3 3M70A 3RRDA 4Q4X2 4AWDA 2Y26A 2WO1A 2ET7A 4OHYA 2OQ6A 1ZBE2 2P3JA 5FUNA 1JZ5A 1DYOA 4Q4W1 1OMIA 1IKPA 1LTEA 1FAYA 2BYVE 3VZJA 3JBG2 1C8M3 4Y26A 3RI8A 1UKRA 3KS7A 3RS6A 5AVAA 3ZN6A 5A6ZA 3B3QE 1VRH2 2JDPA 2DWRA 1QH6A 2ENRA 3U37A 4GB31 4UI9L 3IMMA 1PO12 2Y33A 5BNOB 2P17A 5A33A 2NLRA 2D6KA 2ZABA 4GKYA 3WHUA 2YDEA 4RL7A 5LA9A 1AYM2 3E5UA 3EB7A 4JGZC 3N7MA 4DIQA 1UOFA 4YGEA 3KQRA 1DHKB 3PVOA 4YLZA 4QXKA 2W1WA 2QJVA 3JXSA 3KQ4B 2WZ8A 1C1LA 2XMLA 2DDUA 3B01A 3E97A 3POYA 1MEC1 2WZR3 3RJRA 2FZ2A 4N43C 3TEYA 1C57A 3PDQA 1AR81 5L7OC 1JU4A 1XE7A 3RYPA 1GQPA 3LOIA 3ZYFA 5I8SA 4DOUA 3EYPA 1COV1 2E7TA 2WWJA 3TN92 5F1RA 3GBGA 2I2SA 3LAGA 4CEWC 1HJGA 3HQUA 2VMEA 4G4FA 4XJ8A 1UZZA 1W9FA 1XYOA 2WQZC 3N3HA 3W20A 5KXBA 1SG3A 3ZN5A 2XHKA 1AL21 1V6IA 5GALA 1SFNA 1GBGA 4V2WA 3A7QA 1FPN2 1YQ8A 2XL7A 3UKVA 3JBG1 4AXOA 1PMIA 1F9KA 1H9WA 1UU4A 4IGOA 4Y33A 2B4KA 2WT0A 4L0PA 1ND2C 4ASMB 4H2AA 4A41A 4TLFA 3MGUA 3CJIC 2JEMA 1S0IA 4LKEA 1VBB2 3N7LA 5FZOB 3FN9A 1C1FA 3MEPA 4EWDA 1RUF3 2J1SA 4LIUA 2X5IA 4LTAA 4PCRA 4XJAA 4B1LA 3AP5A 2YBSA 5IVYA 2DFBA 1RVF3 2E7QA 4RHV1 3MIBA 2WS91 4BK5A 4WZFA 5IJRA 2R16A 3D8CA 1ZZBA 1J3QA 3JQWA 4MGKE 3WT3A 3ZR6A 1Y43B 5HV0A 2G1MA 2Y0IA 4A7YA 2IXLA 5FZ9A 1AR93 3AFGA 1W0OA 3I2IA 3R4UA 4M4RA 5APAA 4TZDA 1NLQA 1OURA 4UYBA 4IV3B 4RS5A 1KDMA 1W6PA 4J1XA 4YSFA 4A45A 3KCCA 1N1TA 3ME2A 4UFKA 4HL0A 5FMDA 5T5JA 3CHXA 4CDUC 4ZS3A 1IS6A 1LEDA 1QHDA 3SHRA 3VKLA 1QQP3 1RJ7A 1GLHA 2OZJA 4P9WA 4X6QB 4C0BA 5D8AC 3WDUA 2RVAA 3RSJA 2DVBA 4XJUA 1GWMA 4XACA 5B4NA 1TME2 5FUPA 4FI9A 3LEMA 2EIBA 4PI2A 1EV13 5BXXA 4AFMA 2KD7A 1CAVB 1GICA 3JBG3 3WEZA 2ZHKA 1AX1A 5FY4A 2B42B 5EFUA 4B7KA 3DKQA 1OQ1A 2O8QA 2XUEA 2A5ZA 1D0HA 1OD5A 2XHNA 4QKFA 5JIUA 2O1QA 4I3PA 2W94A 1AR61 1VBA3 4S2FA 3ZXKA 4CDUB 3K2OA 4BQXA 5L9BA 4RR3B 5C3PA 4GB32 2MHFA 3CBNA 3FBYA 4LKDA 1QJZA 4XDPA 5GLVA 1M06G 5JI7A 1AHSA 2EALA 2C9KA 2EXIA 2QBXA 2GNTA 4XF1A 1GYKA 5FZAA 2RR13 4AEDC 1UY2A 2BP6A 3VN4A 2B8MA 4AVAA 3DKWA 2PLV1 1V9U3 3AJZA 4HG6B 2A6WA 4UFLA 3SEEA 4D7YA 4FOWA 1AUYA 4MZUA 4FPOB 4GH4A 5I0DA 2AACA 3B93A 4P08A 1WW5A 4QKNA 2XQRA 3OBRA 5GM0A 3O1OA 1B35A 2LUWA 5GLUA 3ZOIA 4QMAA 4IE5A 5CBLA 3KVAA 4XF4A 3LF7A 2F4LA 4L8QA 4Y4RA 4URAA 2HYXA 1Q8VA 1MACA 2Y6GA 2YGLA 4QKBA 4BH9A 3O1TA 1ZBE1 3C2UA 1JHJA 3H0OA 5DUVA 5JSPA 1TME1 4AHYA 2MPFA 2W2IA 5K0UA 2JKBA 2X5IB 1NX9A 4I3GA 2RDRA 4QHBA 1O3QA 4DUVA 2VG9A 1YUDA 2WZR2 4DUWA 3H7JA 4PIZA 2X5IC 5E6HA 2C6SA 3DUIA 2XVGA 3J8F2 2PXJA 5T55A 4NRQA 4Q4V3 4IGPA 3HBZA 1RUC2 3CIHA 4D94A 5C8CA 1JYXA 3GYDA 4KG8A 5FP3A 3LEGA 2IWGB 1CAVA 2X09A 2YC4A 1Y7BA 4PF5A 2EIEA 2ZX3A 1L7RA 4XPVA 4MXVA 4BYYA 1BK1A 2YZ4A 2Y34A 4JRAA 5E8AA 3ZN4A 5BNNA 2J1RA 3OB8A 1N47A 1XNKA 4YNIA 4CCEA 1ND2B 4KGQA 4XFHA 3GBFA 1G7YA 1GWKA 4OLLA 4MXWA 2PLV2 1EYBA 3C7EA 5K7PA 3BIEA 1REDA 1UX6A 4LA3A 5EWSA 1COV2 5D8AA 1RB8G 2C9AA 4FXKB 1KJLA 4HMZA 4XZUG 1LAJA 3OBAA 2GH2A 1GQGA 5LATA 3U07A 2GC1A 4NPMA 3W9AA 4AOCA 4LE3A 3E6CC 4CZSA 1O8SA 1VBD2 4CEWB 5LY1A 1TZOA 1GR3A 2WDBA 2WJSA 5T5LA 1UYZA 4G9SB 3VHOA 2J1TA 4YVWA 1N1SA 1NCRC 4E2SA 2DCKA 3WR0A 5FMCA 3VBSB 2I45A 5T52A 5A33B 1DCSA 1QJY3 5EIYB 4GQ7A 4OUSA 5AFBA 2H6BA 3LIHA 3GDBA 4HANA 3IB3A 1OC1A 4IE7A 2JX9A 2B5HA 5FZOA 1WMEA 1J84A 1YIPA 3J9SA 3J7HA 1D4M2 4CEWA 4QQHA 4COYA 1H8TA 1RUC1 2ZBJA 4PIYA 4RSUA 4LOTA 3H8RA 2VQTA 2V09A 3ZSEA 5FZ7A 5F5CA 1PO22 4CE8A 3HN1A 3NAPA 4EROA 2UY9A 2O0OA 3LWCA 1UOJA 4KWLA 1HDKA 1X82A 1ZZ9A 2CWSA 2IZWA 4QQ2A 2CWMA 5FXZA 5F5QA 4LEJA 1PHMA 2JXAA 1VJ2A 1MZFA 5IVVA 2GP3A 4ES9A 1AYM1 4CDWB 3FWEA 1SDDB 1PGL1 2QQNA 1HB3A 2IVJA 3SKVA 5IFTA 1MS1A 3UK9A 2R042 1NY72 4ZU5A 3ZM8A 1GU3A 3NAPC 4HXCA 2R063 3I2HA 2D97A 1OUXA 3AMMA 4QDQA 1S2EA 2ZGRA 5FPVA 2RS52 2VTXJ 1N3PA 3AFKA 1J1LA 5I0UA 5A6QA 4LHNA 4B4PA 4LO5B 1F35A 4AQTA 1W9TA 5IHRA 4BQ3A 3NJYA 3DCQA 3VL8A 5K0UC 1VBD1 3AP6A 1JZ7A 3MICA 1JYIA 5BNPA 4K8FA 1AZDA 4BQ5A 3S30A 2BQPA 1WLCA 2NMNA 1HRV1 3I3DA 4QPIA 4RN5A 1ZZCA 2CGOA 2YROA 4CXXA 1TEIA 4IESA 4Q4Y1 2VMDA 3AL5A 4ONUA 1JZ2A 1OF3A 4P5HA 2NM1A 4R9DA 1XOYA 2E51A 3KV4A 5GLTA 1UCXA 1YI7A 1PM7A 5FXVA 4R8HA 3V56A 3W5MA 4ARXA 2XB6C 4W65A 5F2SA 3WG2A 2WO3A 2ZGQA 1RITA 3EJKA 3JUUA 4QD2A 5GLZA 5FZDA 4XTPA 2EVXA 1QJX3 3AKTA 2OW4A 4DB5A 3KF3A 5F32A 1TMF2 3AZVA 1WCQA 3EQEA 5DQ0A 2BGCA 1HX6A 4LNVA 4BPZA 2AEYA 4Z2AA 1ULGA 1I5ZA 2ZKLA 2MEV2 1SBDA 1X36A 2P4EA 1X33A 4YW6A 1XYNA 1UU5A 3SISA 4CPBD 5FZ4A 2DVDA 2O14A 3LOBA 2NN8A 1L7QA 4LBLA 4P14A 2BW8A 2PAKA 2KR2A 1EP0A 2PFWA 1JXNA 4OQ8A 2WAAA 1PO13 1XRUA 4EZ4A 4JGZB 2VJXA 4N43A 1BZWA 4CCOA 1W8HA 2K0GA 1KDKA 4RGGA 3AJYA 3ZFGB 5FK7A 1Y9GA 4CUCA 4UFIA 4ES8A 1UOBA 4AVSA 1ENQA 4Y20A 2IFRA 3DXTA 3DEMA 4E4HA 3DECA 5JIAA 3BGAA 2YUEA 1ST8A 4LKFA 2BBAA 4UFHA 5DZGA 3ZKUA 4A6SA 1SPPB 4Y22B 3OF1A 4DS0A 1Z78A 3JCIA 3S7IA 3ZXLA 2ARCA 1KEXA 4BZ4A 1CZTA 2G4IA 1C8M2 4L92A 5A7PA 4Q29A 3VKOA 1UXXX 5EP9A 1H4GA 2VUAA 5CB7A 3SKJE 3K75B 5DAXA 4NRMA 1VMJA 2WZR1 4Q27A 3WF1A 5EJ1B 2WFF1 4I02A 4XJZA 4FPGA 4XETA 3VHPA 4AHZA 2R1BA 1IKQA 1QKQA 5T54A 1ZZ8A 2VOXA 2Q1MA 1OBNA 1A34A 1MS4A 5C4WA 4GA9A 4CUAA 5KHGA 4AGGA 3ZX7A 2QKDA 4FQZA 1W6QB 1JZ4A 3CO2A 4ZXEA
chains in the Genus database with same CATH topology
3WDTA 1CQ9A 1AR62 2WNVA 3I8TA 1WA4A 5CFDC 2D98A 4EN7B 1VBC3 5JDBA 1PK6C 1LHNA 1RUI2 1IZ3A 3FFZA 2D3PA 3MIGA 2Q8OA 4WBBA 5T5PA 3VZNA 3KT4A 1CAUA 3V0AA 3IWZA 2DYCA 3GZTB 3TN93 3D6EA 5DDJ3 1TQ5A 4HZFA 2CAUA 1S1AA 4V1PA 4PQ9A 4MGZE 4CDXA 4E2GA 1QH7A 1LEMA 3MPBA 1WCDJ 1SBFA 2R49A 2FHRA 3M2MA 2RMU1 4WVMA 1YJLA 3TNPB 1KJRA 3KGLA 4Q0UA 1ZRCA 1UAIA 4KWJA 1TE1B 1WLWA 1NE4A 1NYWA 4FAGA 3H8UA 3ZFFB 5KXEA 1V6KA 1VAVA 4XFAA 5H9RA 1X7NA 4YM1A 3IKWA 1AR72 3GNEA 4OULA 2UWBA 3J8F1 3FFQA 1URXA 5FLIA 1L3JA 3U0ZA 4LA2A 4WM8B 3AKPA 4DY3A 3VHRA 3ZFFA 3D5OA 4B7EA 2BPA2 1VAKA 4B4RA 5KWRA 4XBQA 1UU6A 3S6PA 3OGGA 1QWRA 2QCSB 1APNA 4YW2A 4MGYE 2VNGA 2N7GA 1RGSA 5DUUA 1AR91 3HT2A 5ABJC 4OI0A 2CY6A 3VZKA 1MQTB 4KWKA 1TNRA 3O12A 1RUOA 1UZYA 2XWBB 2DF7A 1RVF1 5CFDB 1RC6A 1NG0A 4EN6B 3WHTA 2A71A 4HVRA 3LA3A 1R1A1 4JTOA 1QJU3 4XHBA 1NQJA 1HV1A 4XE9A 1V9U1 2DVFA 4I01A 4FOQA 2SLIA 2Q5TA 2VQAA 2WNVB 5K8SA 5F6LB 5FOJB 5JPMB 3NVCA 1J59A 2WNVC 2JG9B 4JGYB 4N7IA 4N53C 3POSA 4IL7A 3V0BA 5JWPA 1S2BA 4IETA 1REEA 2HWD1 2AYHA 4NPRA 1WGPA 1RUF2 3FBMA 4NN0A 5I91A 4CDXC 1BEV3 1RHI1 4N53A 5FBZA 5C6CA 1RUI1 4LHKA 2HKXA 2Q30A 1ZZ6A 1XNDA 2TNFA 4LLOA 2ZOEB 1NY71 2NP0A 1FMD1 3JQXA 3VBHB 3QACA 5C4WB 3I4IA 2XUMA 1HXS2 2YYOA 3PNAA 5E1RA 1NCQC 1BVVA 5JLVA 3AZXA 4YVWC 2A3XA 2ZMLA 2YC0A 3VGIA 4QQPA 1AX0A 1HLCA 4IEPA 1HQWA 1AXZA 4EJRA 3V64A 4Q4Y2 1A78A 5EYYA 4HN0A 4C91A 2B45X 3WG4A 3H1MA 1G86A 1U5YA 2IC1A 1NXD1 1ASJ3 2H0BA 2I74A 2W52A 1AL0G 4FPJA 2WS93 2GALA 1LOEA 1V00A 1VRH1 3H7YA 3LSEA 3VV1A 5JZGC 4YGCA 3WCRA 1NXMA 2ZX2A 1PZ7A 1RUF1 3M3QA 1UKGA 1YRZA 4YM2A 3WCSA 3QOPA 4COWA 3IN9A 1R093 3AMQA 3VBOA 4WVWA 3BPZA 1SLBA 4NR1A 1ZX5A 2D40A 1S0CA 1ONAA 1H1MA 3NV3A 1C4RA 3IT8A 2ZAHA 5CFDA 3S0MA 4FPCA 3INAA 1TNFA 1I1EA 1MS0A 3JZVA 1QXJA 4LUMA 4ORFA 2G9GA 2ZGUA 1Q8PA 5BNNC 3TNQA 1RTVA 4FPLA 2HYKA 1YHFA 2YXSA 4YG3A 1Z7S1 1BJQA 2GMEA 1N1VA 2JD4A 1AR71 2C0ZA 1MEC3 3NAPB 3X29B 1V9U2 1J58A 1C5HA 3O14A 4XF0A 5A3LA 2DUPA 2VVEA 1HV0A 4SLIA 2IXIA 2XJRA 4Z07A 3MLKA 4Q4V2 3VDDB 3JD73 1R081 4I0WB 2HWB1 3MF9A 4NHMA 4MV2A 1VIWB 1EPWA 1Z0HA 4XTMA 3VHNA 1NCRA 1QMJA 1V6MA 1F2NA 5FPXA 3H3ZA 4XOGA 2Y0OA 3BALA 1BXHA 1RUH2 4A2UA 5FAXA 1W2UA 2HEWF 4HT1T 4L11A 4Q2FA 5KHIA 3VDDA 3VUOA 4HPKA 4RQPA 4YVSC 4IV1A 5GKAC 3WOGA 5C8WA 4XBNA 3H1WA 3DPRB 2XLGA 1W6PB 2CL2A 3LA7A 4XQWA 4UW5A 4XQ4A 1BYHA 1RMU3 3U4XA 1DGRN 2A6YA 1WW7A 3G7DA 5FO7B 1DZQA 2VMHA 3POWA 4AI8A 3VBRA 2AR6A 3WY6A 2DCTA 1MS8A 3MDPA 3WG3A 4FPKA 4IEXA 3E5QA 4LBNA 1Q8OA 1LULA 4M01A 5KHJA 2DUQA 3VBRB 3ZYIB 3M3EA 1ULDA 2XL9A 3ZSJA 3O0VA 1KS5A 3FMGA 5C4WC 2GN3A 4Q0QA 1SCRA 3VBFC 3NSTA 5LRRA 1LOAA 4YFZA 1VR3A 3KT1A 2HWF3 2DVGA 4LBKA 2VGDA 4P9LA 1K5MC 4XHXA 1S0GA 2RS12 1GNHA 1BBT1 3N36A 4BWOA 1DYPA 2OIIA 2D6MA 2WNUA 2A6XA 2W68A 4DRVA 3ROUA 1NA1C 4AGVA 4CDQC 2VECA 3SNMA 4TWTA 3I2DA 3A4UA 3E6BA 2JG8C 3CEWA 4RR3C 5ACA1 4S2HA 2RR11 4XW3A 2A3YA 2ET1A 1WW4A 4AW7A 1VBC2 1UN1A 1AF9A 4HKOA 5HI0A 1OKQA 4W6XA 3WVJA 3MF6A 2OUJA 5KXDA 5J98B 3URFA 4JV4A 3J26N 5BV6A 2ZS6B 4I30A 2PTMA 5BNQA 2ZHLA 2R043 1LR5A 1WBLA 4O9GA 5KHKA 2IXCA 4PJYA 2HWC3 1QQP2 1OFNA 3VL9A 5KBFA 3VKFC 3IM0A 4K3UA 4QGMA 1NE6A 2VPVA 4LBQB 3J4UH 2OZ6A 2RS11 4E4DX 1GFF2 3WQ7A 2GC3A 4QT6A 2FBEA 2RJLA 4HVQA 1SBEA 3M3CA 1CAXB 2DFCA 5EYXA 5BUVA 4E27A 3BODA 2XLFA 3RQ0A 3QD6A 4CEYB 4Y1YA 4AHWA 3WXPA 3LZZA 4IERA 2NPIA 2UY8A 4YW4A 5J36A 3W58A 3DV8A 2VVDA 2WQ4A 2BBVA 1JUHA 1R1A3 1TMF3 4LT5A 1F5FA 1FMD2 2EAKA 4AI1A 1U12A 2ERFA 4TSVA 1HXS1 2EF6A 4IV3A 3TB0A 1LOFC 1ND3B 1RMU2 3AP4A 2IXKA 5CBLA 5JOYA 4IEUA 3VBFB 2JG8A 3B9IA 5J48A 4KL1A 3SITA 1H1IA 5FMOS 4OFGA 5KC6A 1C8M1 2R0FA 1JHNA 3OD4A 3WDYA 2LM3A 1R082 2C1FA 4AFCA 5JMCA 2AGSA 2Z42A 3DPRC 1I3HA 1WCSA 3NV2A 3WQ1A 3ZIWA 1S0FA 1YFYA 1EAH2 3J8F3 1AR63 1CJDA 2GMMA 3H50A 3KD4A 3I7DA 4LULA 2WA3A 1SLTA 4RFT0 1NZCA 3KM5A 1C8NA 2ATFA 4E4ZA 3ZXAC 3IDBB 4C0HA 1IPJA 4YVSB 3ZFEA 1DG6A 4ASLA 5H9PA 4KQ7A 1PGL2 2R061 2WC2A 1NCQA 1PK6B 2R041 3R0RA 1JTZX 3NKTA 4UBHA 5DZEA 2VQ0A 1U5XA 3AYCA 3WDWA 2WINB 2EA7A 5BNPB 4OUMA 2ES3A 4I0BA 4XIKA 3FHIB 5DDJ1 5D1IA 3ZYJB 1LKNA 4L9BA 1KFXL 5I0TA 4Q8KA 4Z92B 3AMPA 1DQ1A 4M0HA 1HQNA 1AXKA 5JSOA 1MQTA 5K9YA 2VVFA 1DBNA 4KH9A 5L73A 5BYNA 4NOTA 3RDIA 4QGNA 1CX4A 3ZFFC 5C8CB 4PDWC 2BWCA 1QJY2 2HWD2 2HWB2 2PAEA 1JH5A 4BLIA 4FOYA 3SCGA 1WMFA 1RHI2 3T1MA 1DF0A 1WD4A 2W39A 4PDWA 3WP6A 3NO8A 1AR73 3ES1A 5IK7A 5J3UA 5E88A 5BNOC 1RIRA 3QLQA 1AR92 2BUKA 2ARXA 3SH4A 1V6OA 3JU9A 4GH4B 1O3SA 3VLBB 3AYAA 1ULFA 4RD7A 3CL1A 4FSJA 1RMU1 2A70A 4NWWA 3ZVXA 1MZ5A 1RVF2 2YGMA 1DZTA 4DY5A 1R1ZA 3AK0A 4CEYC 5JOWA 2CYFA 4QU2A 4EV0A 5CADA 1AYN3 3MFAA 2ETEA 1WMDA 2F4PA 1SLAA 2P3IA 4HN1A 2GNMA 1TME3 3ZPYA 1H2KA 2QUOA 1D2QA 3D82A 2DCZA 1AYM3 1G9DA 1QJU1 2R32A 4AVVA 1F31A 3PMSA 3TOJA 4GMP3 4JDNA 1PGSA 4XEZA 5LEJA 1O7FA 3USSA 1R083 1C28A 3M3IA 3ECQA 3H1YA 3MZHA 1J1TA 1ENXA 1NOVA 4AHXA 5L7OA 2O8OA 1ZM1A 4ZKTB 2VOVA 4A3XA 3TYJA 1WW6A 1EAH1 2DU1A 3IBMA 2ZGMA 5L7OB 2A6ZA 5DZFA 4X8NA 2Z69A 4EWAA 3P3NA 3ZXFA 1ZREA 1G9BA 2GSYA 3M7AA 5CFCA 3N7JA 4Q4W3 4DNYA 2RR12 1XQNA 3OCPA 2WWSA 2VOWA 3FLTA 3U11A 1ENRA 1Q8SA 1DGWX 1O5UA 4G3YC 4AVTA 4YW3A 1VBA1 2E7AA 2ZJCA 4Y1XA 5HCBA 2A73B 2XLAA 1AR83 1U5IA 2ZMKA 3KCXA 4FPFA 1OSGA 2RJKA 2XJTA 3BOPA 1ZRFA 1C5IA 1H9PA 3HT1A 3R4SA 5A3MA 1KXGA 5J7MA 3B69A 4OHVA 5GZDA 4QQOA 4NVPA 1FYUA 1WUVA 4F3JA 1IGOA 4TYSA 3HWJA 3TWIA 4PIXA 1OQEA 1VAMA 3M3OA 4WM7B 4AQ6A 5GLWA 5AC91 4HFSA 4H7LA 4XF3A 3OYWB 3ZXDA 1PZ9A 5C9AB 1IOAA 3HR9A 1CGPA 1D4M1 1H0BA 2XJUA 4Q0PA 3RMYA 1YIFA 4CYDA 3DL3A 5TSWA 1OA2A 4RR3A 3MIDA 4M00A 1SLIA 1RUE1 2BTVC 3GZAA 4QGLA 1PNFA 3AZWA 3I59A 2WFPA 4HLTA 3BB6A 2FMDA 5JAXA 5SV8A 1ZA4A 4YW1A 3PLQA 2CV6A 3MLJA 4LO4B 1FOD2 3CLPA 2TBVA 3ZYPA 5HBAA 2P37A 4RS5C 3KMHA 3USUA 4K20A 1J3PA 1QDCA 5DDJ2 3BTAA 4CDWA 2Q4SA 1JBCA 4QPIB 2Q1ZB 2LTNA 1O5LA 1CR7A 3G6JB 2W0XA 4DMIA 5A32A 1FI2A 4AGRA 5FQ0A 1Z7S2 3LB9A 4MXWB 2GMPA 3ACLA 3VBUB 4H14A 1QU0A 3TRSB 3ZFEB 1VB4A 4YZ5A 1AXYA 1VBD3 4LBOA 4FPEA 3BIWE 2ARBA 1DZRA 4Q26A 1NCRB 2D44A 1VBE3 4Q4V1 4AFDA 1JN2P 5JOXA 3B00A 3NW4A 3M4FA 1DQ6A 4YRDA 4LHLA 2ZMNA 5ACA2 3VKMA 4YFWA 3ENRA 1RUJ1 2XH6A 2R062 2YY1A 2D6OX 5J37A 1QOTA 1V6JA 5H9QA 4JVAA 1FNYA 4HK8A 1OHFA 1H1AA 4OI4A 1PNGA 3NWKA 1ND2A 1GZWA 1RINA 3AKSA 1IS5A 1V6NA 5C8CC 2OVUA 3GHNA 2TEPA 4URTA 2V73A 3AXDA 4INDA 3ZMOA 4UXAA 3SMHA 4E4SA 1ND3A 1GV9A 3PTYA 1EPZA 3FUOA 4XMAA 5CVRA 4P9YA 3DPRA 4YW5A 1W6QA 4JCKA 1PZ8A 4MVTA 4P9GA 2TUNA 5FMOL 4CEYA 4OI2A 2D6LX 3IDCB 4META 2FQPA 2R073 2XG3A 5AC92 3MIFA 2BVBA 4XJ9A 4WV8A 4Y4YA 4Z8BA 1PIV1 2VW0A 2QFEA 5JVVA 4M3CF 3ILFA 4AI3A 1PGW2 3FZ3A 1DQ4A 5T3NA 1UPIA 1OLRA 1XYPA 1PIV3 3O0XA 1LCLA 4KU7A 4M0NA 3WDVA 4LBQA 4CDQB 1BVP1 2HWF2 2DTYA 2R30A 2XVKA 4I09A 4OZXA 4WM7C 4FQ4A 4K40A 4XIOA 1O3RA 1MS3A 4S2GA 4LBJA 1OPOA 2GAUA 3SH5A 3TBDA 3ZO0B 3DF0A 3O5SA 1CPMA 3Q9OA 4PBOA 4LBQD 2D5HA 2YMZA 3MW4A 1HRI3 2ZGNA 4ZU7A 4FXGB 4Q0VA 3WW2A 4CRQA 1YXWA 2VH9A 1H2NA 4FCAA 2WIIB 3VBFA 3MFCA 1YFWA 2EXKA 3PVBB 1KFUL 4COUA 1EAH3 4ATFA 2VNRA 3S7EA 3GALA 5IK8A 1A8MA 3JD71 3UKTA 4DRRA 3MW3A 1H30A 3VBSC 2E6VA 4XFIA 1REFA 1MVQA 4LBMA 2PHLA 2RS53 3RJ2X 1VALA 5FCCA 3RI9A 2CGPA 3THPA 2JE9A 1B35C 1G9CA 2VXRA 2EXJA 2WA4A 4X6RB 4EN9B 1RUH1 2WFF3 4S2DA 1AL23 3E5XA 1EV12 1RUD1 5BY5A 1LODA 2ILMA 1POV3 4LO8A 4C1XA 4U36A 4B29A 2VMIA 4Q4X3 3L2HA 1XNCA 3FUQA 4Q8LA 4WVVA 4XFBA 2RHPA 1Q3EA 4XF9A 4BLJA 2AH2A 3KSCA 5AVPA 2XBO2 4K21A 4LR4A 1ZZ7A 4Y24A 3RG0A 2AZ5A 3ZXGA 4DQAA 3LGRA 2KM2A 2MEV3 2RM22 2ZPXA 5I93A 2QZ2A 1S0JA 1R1A2 1T6GC 5AFEA 4MLOA 2D93A 3A0KA 2UYAA 2ZGOA 5JZGB 4NHLA 1UD1A 3SH3A 4KG0A 5HCAA 4MYEA 2RMU3 1LECA 1BMV1 1H8TC 2XJSA 4P9XA 4A7KA 4E2QA 3TAYA 2V5YA 3FE5A 2DTWA 1CIWA 1JOJA 2JDZA 4YG6A 1CVNA