4AWDA

Crystal structure of the beta-porphyranase bpgh16b (bacple_01689) from the human gut bacterium bacteroides plebeius
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
297
structure length
297
Chain Sequence
KEYSLAEEHIKNLPEAPEGYKWVVNEDYTDEFNGKRLNAAKWHAKSPYWTNGRPPATFKAENVSVKKGCLRIINTVLSPTEGLDGKPGDKYRLAGGAVASVKNQAHYGYYETRMKASLTTMSSTFWLSNRPVMKEIMKGGKKIKTWSSQELDIIETMGIIRSVNPDNPWNKTWNMQMNSNTHYWYQEQGGKRTDNTAKRSDVVSYMTDPSAEDFHTYGCWWVDANTVKFYYDGKYMYTIKPTTKYTDTPFDRPMFIHIVTETYDWEKQVPTAEDLKDKDKSTTYYDWVRAYKLVPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PORPHYRANASE
publication title Bacteria of the human gut microbiome catabolize red seaweed glycans with carbohydrate-active enzyme updates from extrinsic microbes.
pubmed doi rcsb
source organism Bacteroides plebeius
molecule tags Hydrolase
total genus 73
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4awdA00
5GJ6A 4R9DA 1KJRA 1S0BA 2E7TA 3WG4A 5KXDA 4FOVA 4Y1XA 4XTPA 3AJZA 1UZYA 5KXBA 1LULA 2Z42A 4YW4A 2DVFA 3SH4A 3RSJA 5GZEA 4XMIA 4XXAA 4LBQA 3IMNA 1J1TA 3POSA 5GLZA 1MS8A 3RS6A 1YXWA 2ZMNA 1X50A 3AZVA 4P9WA 1GYKA 4BMBA 3AZYA 1YRZA 4BPZA 5IT6A 3O0VA 4FPKA 2ZMKA 4XDQA 1QOOA 3WZ1A 4YFWA 5FREA 1ENSA 2VW1A 2VY0A 3LSEA 3NWKA 5JMCA 1Z0HA 3OYWA 1SLCA 3PVNA 5T54A 2R16A 3SISA 4WZFA 4K20A 3AXEA 4LBQB 4FPJA 4XJZA 2AUYA 1OKQA 2NMNA 5DUXA 4AWDA 2EIGA 2NZ9A 1LTEA 3I8TA 2ZGUA 4WVVA 1FATA 1W0OA 3AYAA 2DVGA 2E6VA 2DUQA 4PCRA 4Q26A 1D0HA 4ISQA 3WDXA 1MVQA 5IK8A 1YYNA 4XE9A 5FRAA 2YMZA 1G9FA 1XQNA 2ZBJA 5KXEA 3VKMA 3IPVB 3OYWB 2BQPA 1JXNA 1YI7A 2PHFA 2A6XA 3SH3A 1SBDA 4PBOA 1LHWA 2VH9A 4PBPA 4R9BA 5DG1A 1G9BA 1O4YA 4GKXA 3ZYPA 4YZ1A 4YW5A 1MACA 3GALA 5DZEA 5GZFA 3UJQA 1LU2A 2ZHNA 2NP0A 4XHXA 1Q8PA 2WLQA 4Y26A 3W58A 3V0AA 3O0WA 4M00A 1CVNA 1ENRA 5JOXA 2CTVA 1FAYA 3APBA 1WLWA 5GLWA 1WW4A 1S0FA 1F9KA 2YY1A 5E8AA 3WG3A 4AGRA 1G9CA 1SLIA 1V00A 3MW4A 1N3PA 4DS0A 2UWCA 1UL9A 3WV6A 1LEDA 4LBOA 2GMEA 1LOBA 5GZGA 1BQPA 1A8DA 1MS9A 1DYPA 3R05A 4F83A 3V0AB 4ZKTB 1YO8A 2Q5TA 3A0NA 2A71A 5H9QA 5CAZA 2D3PA 3ILRA 5T5OA 3OJBA 1FV2A 2XB6C 3A4UA 4FPGA 1AXYA 1S0IA 2C5DA 2LTNA 1UMZA 1WLDA 2AENA 1ULCA 4TYSA 2GMPA 1WUVA 1HKDA 4FPYA 4JRAA 1Y7BA 4XJWA 4H55A 1FNYA 4LBKA 4Q27A 2SLIA 3WDYA 4CRQA 1ULEA 3N7KA 5F5QA 1WBLA 2YV8A 1APNA 1C57A 3IM0A 4FP3A 2D6NA 2JJ6A 1FYUA 3ZYRA 3WNXA 4DRVA 4ATFA 3BIWE 1LHVA 4SLIA 2A6YA 2CWMA 1AXZA 1LEMA 1AZDA 1OQ1A 4K21A 3QLQA 3VUOA 1AVBA 3V65A 3AFKA 4BLIA 3OGGA 1VAMA 1GZWB 2EXIA 2P3KA 2JKBA 1LENA 2ZHMA 3B69A 2WQZC 3SLIA 1AX1A 2W52A 3MW2A 3ZXJA 3ILNA 3ZXEA 4AVSA 1KQRA 2EXKA 2I2SA 1LU1A 2ZZJA 3HMYA 2VW0A 2A5ZA 3O12A 3OBTA 2OUHA 1WD3A 1MS1A 1IS4A 2ZGRA 4YG0A 1V6LA 2ES3A 4C1XA 1MS4A 2ZGNA 1S0CA 1JUIA 4XBLA 5CA6A 5CNAA 1W6MA 4P9XA 4Y1UA 1G86A 2E7QA 3JUUA 5DG2A 1GZ9A 4FOWA 4ITCA 1SBEA 3N7LA 2WJSA 2ZGSA 2D3SA 3CNAA 3ZXFA 4Q1RA 4C1WA 4XTMA 4M3CE 2A3WA 3FUQA 4YGBA 2DTYA 1GLHA 1PZ7A 3N36A 2P34A 4UW5A 2ZHLA 1ZM1A 2PHUA 5SV8A 1W6MB 3FLRA 2GNMA 3UK9A 3ZSKA 4AGVA 1QGLA 3AP4A 3SITA 3WVJA 1DBNA 4ISRA 3KQRA 4IQPA 2GNTA 2ERFA 1FNZA 1F31A 2A3YA 2A70A 3FFZA 3AXDA 1SCSA 3SNMA 5T55A 3LSDA 3B9CA 5DUUA 2NN8A 4GWMA 1SACA 4XYXA 3WCSA 2DTWA 3HR9A 1DQ4A 1VLNA 4XMAA 4YZ5A 2UURA 1MR5A 3IPVA 3ZSMA 2DVBA 3T1LA 5DUWA 3O5SA 5AVAA 4XXPA 2WT0A 1LOFC 1LHOA 4AVVA 4Q2FA 1A78A 1LGNA 5GLUA 3VKLA 2DUOA 3R4SA 3WDVA 1N1SA 2VUAA 3ATGA 5LK5A 1DZQA 2ZGLA 3NV3A 1UN1A 1GSLA 5T52A 3PVOA 5JVVA 2GDFA 4UW4A 2PHRA 3RG0A 1O4ZA 1I1EA 2A75A 1KDKA 2A6WA 1DQ0A 2YROA 1MZ6A 2D6KA 3M3OA 4WVWA 2ZGQA 3L2YA 1WW5A 1GBGA 2HYKA 1DQ6A 1BZWA 1IS5A 2JE7A 3POYA 1KITA 1QOTA 2WT1A 1AF9A 3RQ0A 1FV3A 1IKPA 2OW4A 1QNWA 5GLVA 3TAYA 3BOPA 3ZSLA 1VAVA 4YGDA 4YG6A 2NYYA 4GKYA 4U36A 1LODA 1IS3A 5HCAA 2DV9A 3JU9A 3VKNA 1N1TA 4LBQD 3KM5A 1NXD1 4YZ3A 2V73A 5JOYA 4M3CF 3IKWA 1H30A 1HLCA 5IK4A 5JOWA 2DYCA 1BYHA 1N1YA 3WLUA 1C1FA 4Y1VA 1QNYA 1CPNA 1MS3A 4XJ8A 4ASMB 3C2UA 1LGCA 3RRDA 4FPEA 4YG3A 4YGCA 2A3XA 2R1BA 1Q8QA 4MYEA 1LECA 2CL2A 4YFZA 1GKBA 4Q1PA 4PF5A 3WUDA 1V6JA 3BTAA 2ZGMA 1H9PA 1CONA 4XIOA 1VALA 1LOFA 2DVDA 2W39A 5DZFA 4Z8BA 4YLZA 1WD4A 2R0FA 3RMYA 1GZWA 2DWRA 1FX5A 4XJAA 1CIWA 1C1LA 1RINA 1UKGA 4GXLA 1DLLA 1JW6A 2JECA 5BYNA 1ULDA 1URXA 2WSVA 2D7FA 1RITA 3PVEA 4LBLA 1BKZA 5T5JA 3AK0A 1W0PA 2GALA 2DUPA 1F5FA 2ZKNA 3N7MA 1QMJA 1LOEA 1G9DA 3ASIA 2NM1A 1V6OA 3ZVXA 1S0DA 2PHXA 2TEPA 5JDBA 1JYIA 1LOGA 1AJKA 3DGTA 4HL0A 2OVUA 3ZXKA 3V0BA 3T2TA 2JDZA 4XILA 3AZXA 5IK5A 1W6QA 3U4XA 1W6OB 1DHKB 2KM2A 2WNEA 3M3CA 4R9AA 5T5LA 3WCRA 2VXRA 1AXKA 3O0XA 1U0AA 1LJ7A 3ZPYA 4DQAA 2NMOA 3UL2A 1HQWA 2P3IA 3SH5A 3D4KA 5HCFA 3LCPA 1V6MA 2EF6A 2LALA 2ZABA 1SBFA 4FPOB 1JN2P 2A6VA 3ZXLA 3V0BB 3OY8B 3AP7A 1W6QB 1W6NA 4ZXKA 2VW2A 3T1MA 2AH2A 2B7YA 2D43A 4K1YA 5T50A 3WHTA 4UW6A 1AJOA 1Q8VA 2D6MA 2DVAA 4FP2A 5E88A 1N1VA 5GZDA 4GWNA 2FMDA 3POWA 2CNAA 2DU0A 1N3OA 4M3CA 2VU9A 1LCLA 4XJUA 1QOSA 1LOAA 3AYCA 1W6NB 1OFSA 1ULFA 3ILFA 4KBBA 4YGEA 5DUVA 1Q8OA 5GZCA 1WBFA 2JD4A 1JBCA 3M2MA 3BODA 2GNDA 3WDUA 4BMEA 4FPLA 2DURA 3M1HA 1PZ8A 3R4UA 4M3CB 3M3QA 2W68A 3B01A 4XZPA 5H9SA 1D2SA 4YW3A 3H0OA 1UPSA 3WDWA 2GMMA 3ENRA 1RIRA 1EPWA 2R49A 2WSUA 4WV8A 3RMXA 3FLTA 1JHNA 4XOGA 1MS5A 4PQ9A 4YW1A 2UWAA 3AZZA 1JYCA 1MZ5A 1QU0A 1GNHA 4Y20A 4YW2A 4XBNA 1WW7A 1DYKA 2A6ZA 5EWSA 3GNEA 4RA0A 4Y1ZA 1WCSA 1QKQA 2EAKA 4K1ZA 1S0GA 2SBAA 3N35A 5H9RA 1S1AA 3OPZA 1ZA4A 3D5OA 1BXHA 4FOQA 1UZZA 2YZ4A 2OUJA 1UAIA 4GALA 4DFSA 2WKKA 4U2AA 2D6OX 4Y20B 1N3QA 4LBNA 3AX4A 4FPHA 2ZHKA 1DQ1A 1LESA 1N47A 5F9TA 1HDKA 4LBJA 5HCBA 1Z78A 2AR6A 5JLVA 5KXCA 1CPMA 5GM0A 3WOGA 5EYXA 1MS0A 1B09A 3IN9A 4TZDA 1A3KA 2ARXA 3ZSJA 4OZXA 3B3QE 1IOAA 1QDOA 4AYUA 4ATEA 1DQ5A 1UX6A 2PELA 3MPPG 1CN1A 1V6KA 4Q8LA 3M3EA 4XIKA 4DPNA 4YM0A 3WG2A 1TEIA 4FQZA 2GN3A 1LOCA 2ZGOA 2ARBA 2P37A 5E89A 2PHTA 2D44A 1QDCA 4YZ4A 3MEPA 4LBMA 1R1ZA 2YXSA 1GNZA 2ZMLA 1G8WA 1MVEA 4YM2A 1IS6A 3MW3A 2D6PA 2R1DA 2RHPA 3USUA 2WT2A 3FUOA 1JOJA 3WG1A 1DGLA 1WW6A 1VIWB 2E53A 3PMEA 4Y22A 3N3HA 1I3HA 2A7AA 3NV1A 4XHBA 1IKQA 3I4IA 2ZGPA 2P2KA 5H9PA 1CESA 3WDTA 3AP5A 1Q8SA 2JE9A 2V5YA 5DZGA 3AJYA 1G7YA 1V6NA 3HN1A 4UW3A 3VKFC 3WUCA 2PHWA 1GICA 2FHRA 4NO4A 1AX0A 2H0BA 2W08A 4I30A 1W6PA 3FLPA 3USUB 1W6OA 4JC1A 1KJLA 5EXOA 4D69A 2CYFA 2CY6A 4CTEA 4Y22B 4BOWA 3AYDA 1HQLA 5CBLA 1GV9A 3WHUA 4RL7A 2CWSA 3N7JA 1NLSA 4FQ4A 2C9AA 1S0JA 2XG3A 1H9WA 2ZGKA 4CZSA 4XBQA 4BM8A 1BJQA 1DFQA 1LGBA 3B00A 3OY8A 1W6PB 4AVTA 1CR7A 2G4IA 3W59A 3VKOA 4BLJA 1LHNA 2AGSA 3Q9OA 4R9CA 4DRRA 3INAA 3NV2A 3QCWA 4FVVA 5JOZA 1GZCA 2P3JA 4Q8KA 4FOYA 3OBRA 5IK7A 2EXHA 1C4RA 2GN7A 1SLTA 4L8QA 4YZ2A 1Q56A 1S0EA 5EYYA 4JCKA 2AREA 2D6LX 4AGGA 2EXJA 1KRIA 1GANA 1SFYA 4XJ9A 1ULGA 3AP9A 4GA9A 4NOTA 2R0HA 5IUQA 2DU1A 2ZACA 1SLAA 1YIFA 3PJQA 2GNBA 2D3RA 2UWBA 5GALA 3VV1A 1LHUA 2EALA 4P14A 1CJPA 3AP6A 4FPFA 1KDMA 1AX2A 4HANA 4Y1YA 4BQ1A 4Y24A 1CQ9A 3FBYA 1DQ2A 2ENRA 1DIWA 3A0KA 4W65A 1SLBA 5CB7A 3AZWA 5DXDA 3DUIA 1WLCA 2ZA9A 4P9YA 4YM3A 1SLLA 3UJOA 4YM1A 1V6IA 3D6EA 5GLTA 1SCRA 2E51A 2ZGTA 4M01A 3NV4A 1PZ9A 5T5PA 2AYHA 1ONAA 3V64A 2UU8A 1G9AA 1ENQA 1QF3A 3AYEA 3TB0A 2ZAAA 4FPCA 5L73A
chains in the Genus database with same CATH superfamily
4HKLA 4K40A 3K4ZA 4IEOA 2HBUA 5GJ6A 3RGBA 1HV1A 3WG4A 1DU3D 4QGLA 5C9AC 3QH7A 5LBBA 1FMD2 4A42A 5KXBA 2Z42A 3VBUC 2IZWA 3RSJA 1UU4A 4NWWA 3SQOA 4LBQA 1ND2A 2BNNA 3POSA 3RS6A 5J7MA 3DYMA 3K2OA 3ZFFC 1NCQA 3O0VA 4FPKA 1WCUA 4EZ4A 3UT0A 5A33A 2VMDA 4CXWA 4OZOA 1POQA 2LROA 2XL9A 3NWKA 1C3HA 3A7QA 3SCHA 4CCMA 5K8SA 5FXWA 1K42A 2R16A 4WZFA 2BFUL 2PA7A 1VBE1 3CZJA 5JZGA 4K20A 3AXEA 1ND2B 4LBQB 2XJTA 2VAUA 4IESA 4XJZA 5I0UA 4AI0A 1UYXA 2BPA2 2NZ9A 3TYJA 1VBB3 3I8TA 4CU6A 1NCQB 5F3EA 4Q26A 2DVGA 1LAJA 2ZX0A 1NZCA 3WEZA 4E9KA 3LF7A 1JYTA 3O7OA 1YYNA 4HKWA 1AR73 2I74A 2YMZA 5FOBB 3OEAA 1YI7A 2FDFA 1HB3A 2Q1ZB 3H3ZA 5JZGB 4PBOA 5DG1A 3TWIA 4HPKA 1O4YA 1H2KA 4GKXA 1IPKA 4IE5A 1OBNA 1RUE2 4YW5A 4Q4W1 5A7QA 3VDBA 1VMFA 4UFHA 3DPRA 5FPBA 4JDOA 3ZN5A 5E1RA 1XXNA 2X10A 4Y26A 2DCJA 2QZ2A 1UOBA 3U0ZA 4LA3A 4M00A 1EPZA 2PFWA 1NZIA 2CTVA 4NROA 1FAYA 5GLWA 2PHDA 4BJ0A 4SBVA 1JH5A 3VBHA 2JG8B 1S0FA 5E8AA 3WG3A 4Q4V2 1J3RA 4DXSA 3EXUA 4HPKB 1SLIA 4XC9A 3BB6A 4ET7A 1SPPA 3NKGA 5J3UA 1V00A 1N3PA 2UWCA 1UL9A 4JHZA 3DPRB 1LOBA 3N9NA 4AI9A 1RUD3 2IXIA 4CCNA 3UETA 1PO11 1KS4A 2C0ZA 3A21A 1YO8A 3QACA 3UKTA 5H9QA 1PX3A 5F6KA 5C3RA 3VBHB 4XF9A 4E4HA 5CAZA 2ARAA 2D3PA 5IATA 5T5OA 4HN0A 5FQ0A 1SPPB 4MH0E 5IVVA 1FV2A 3A4UA 2J22A 5DDJ3 2CV6A 1S0IA 3C8XA 2MPFA 2NQYA 2OYZA 1O3TA 2ZZQA 1WLDA 1H2NA 5FPXA 3I2IA 1GWLA 4FPYA 2B5HA 5JPNB 1ND2C 3WSOA 4XJWA 1D4M2 4LBKA 4Q27A 5F5QA 1J58A 2QQIA 1NCQC 1KS5A 4GJYA 1VB2A 4FP3A 5FQ0B 3VD5A 4KGGA 1JYVA 1DYOA 1FYUA 5IYYA 3ZX7A 4FAHA 3I2OA 1PIV1 3P3PA 4IE4A 4ATFA 4WM8A 3SEPA 1X8EA 3HNBM 5FZDA 1L7RA 3IDEA 1AXZA 3PUIA 4N8MA 1OQ1A 5JZGC 1QQP2 3MIFA 5FP4A 5FWEA 3NJXA 4DOUA 4Y5Z0 3ORJA 3V65A 1W2OA 1LB2A 1GZWB 2P3KA 1LENA 3ZXJA 1RUF3 2E7AA 4YRDA 2HWB2 3MW2A 4ZONA 3C3VA 2VVFA 4OCTA 1KQRA 4CDWB 2WA3A 1LU1A 3AVSA 3OEBA 4CP2A 2A5ZA 4BQYA 3LFMA 1DG6A 4HXCA 2VMHA 3LAGA 2JG8C 4D0QA 5J36A 3NNGA 3TNPB 5CEHA 4N7UA 1JUIA 3O1SA 1EAH3 3DPRC 4O61A 3CQOA 5CNAA 3RYKA 3E1F1 5C3QA 3MICA 4P9XA 1Y9GA 3VLBB 3J9SA 3TN92 1W3XA 5LBEA 3MYXA 4ITCA 4R8HA 3UV9A 4XETA 5F1RA 2ZEWA 4K8FA 3RNSA 3VBHC 5I0SA 1C8M1 4Q1RA 4UFLA 4AHZA 4QMAA 3SXWA 2XVLA 1W39A 2A3WA 2Q8OA 3FUQA 3KV5A 1GLHA 2RDSA 2P34A 2VD7A 3EO6A 1H2LA 4LUKA 2WS93 1ZM1A 1OF3A 2BVBA 1PGW2 4EYUA 3NAPA 3FLRA 2GNMA 3E97A 1LKNA 5JSPA 1RUNA 4IETA 4ISRA 3KQRA 4Q4Y1 3ZLIA 3FFZA 2A3YA 4QX3A 4FTEA 4L11A 4AFDA 3B9CA 2JDUA 2XHKA 4QX1A 4XQ4A 1SACA 5KWRA 1U5IA 2DTWA 1W8HA 2H6BA 3NAPB 1UU6A 1VP6A 5JWPA 4EN0A 1VLNA 4KBZA 4XMAA 3JBG1 2JDKA 5FZ0A 3IPVA 3ZSMA 1J59A 4JGZB 3VD4A 3T1LA 2W2IA 2BV4A 1W8ZA 4XXPA 4QB2A 4X6QB 5F32A 1Y43B 5GLUA 2DUOA 3R4SA 4RFRB 2VZ3A 1JZ5A 2VUAA 4CDWC 3ATGA 1DZQA 4XFAA 5A6ZA 3GDBA 1UN1A 4JHTA 2ZKLA 1RUF2 2GDFA 1OD3A 2ETEA 1VRH1 2X29A 3AMQA 3IMMA 4EROA 1V9U3 2P3YA 4BZ4A 2PHRA 4IEVA 1ALYA 2HBTA 4JKMA 1AYN2 3POJA 1DGWX 2YROA 3EQEA 2WWUA 4OHWA 5KHHA 5BPXA 4IGQA 4M0HA 4K6BA 1ULPA 1I5PA 5FUPA 5FJKA 3ES4A 1BZWA 5FMCA 4JDNA 2JKXA 3DL3A 1EAH2 4QD2A 1FV3A 1IKPA 3RQ0A 1US2A 2DCYA 3H8RA 1YQ2A 2JENA 1RMU3 4HK9A 1XYOA 5I0RA 4I02A 4R4ZA 1QIQA 3AC0A 4QXKA 4E2SA 4C0BA 5L19A 4H7LA 5A7SA 3F2ZA 3PUSA 3ST7A 4J1WA 1XSRA 1QEXA 4GMP0 3T3YA 5JOYA 4M3CF 5FY4A 5L36A 4MZUA 1TME2 1N1YA 1I5ZA 5HXVA 3WLUA 4Y1VA 1YWKA 1CPNA 1UY1A 2RDRA 4DUWA 1ND3A 3C2UA 1XNBA 4FPEA 5DMYA 1OH3A 3NAPC 4WBBA 2R1BA 4QT6A 4LK6A 1RUC2 5FYTA 5FMDA 4Q1PA 4GAZA 4JGZC 3S7IA 5A6QA 3BTAA 1GQGA 4RHV2 2VOKA 2OPKA 1R083 1LOFA 2R072 3NNFA 2ARCA 2VVDA 4R52A 2OPWA 1CIYA 3RMYA 1FX5A 3CLPA 1ND3B 4MGZE 2JECA 1JW6A 1ULDA 1DF0A 1KFXL 1RYYA 4LBLA 3ZMNA 2FZ2A 5JR7B 4LEJA 3PHMA 2DUPA 4WM7B 4CXXA 2VMCA 2RE9A 4PLOA 3N9QA 4BU2A 1HB1A 1QJX2 3ASIA 3DF0A 1A34A 4QQOA 2Q30A 3ZYFA 2OZ6A 4AHWA 4XACA 3ZVXA 1S0DA 2PHXA 5FFOC 4ZU4A 1PVC3 1F4HA 5JMOA 4JTOA 3H3LA 3ZFEA 3V0BA 4H14A 5EPAA 3T2TA 3U14A 5IK5A 3U4XA 4L99A 3I2GA 1DHKB 2BWCA 4R9AA 3WCRA 3HJRA 1OVSA 2PXJA 5FWJA 3KCYA 1AXKA 3LIHA 3O0XA 4I0WB 1ZZCA 1RVF2 5C8WA 3HOBA 1OD5A 3FMGA 2P3IA 4H3WA 2VMIA 3LWCA 4MGYE 5CFDA 4FTSA 2BNOA 2CDOA 5HCFA 4FCAA 5CFCB 3R0RA 2X53S 1FPN3 3V0BB 3OY8B 3AP7A 3MF6A 1NLQA 1VBB1 4LULA 1X9PA 1AL23 1Q3EA 1YI9A 2VW2A 5T50A 4EWDA 5FYSA 1AJOA 1Q8VA 5E88A 1N1VA 1UYYA 1NE4A 3B02A 2CGOA 2CNAA 4M3CA 3O1PA 1O8PA 2RS53 1H1AA 1JYXA 1RUG3 4XJUA 2Z5WA 1YQ8A 4ZXEA 3AYCA 4YWAA 1TNFA 2YYOA 5AVPA 4NMIA 5L7OB 2XKOA 2DCKA 1XU2A 5GZCA 2MEV2 1WBFA 2JD4A 4M4RA 3EB7A 1ASJ2 4BMEA 2PHLA 1ND3C 4LK7A 1XNKA 2WZR3 1UY3A 3CEWA 2W68A 3KB5A 3M3QA 4M3CB 4RYDA 3VHOA 4QPGA 5KHJA 4YW3A 3TN91 2ZAHA 3DV8A 1PK6A 4PDWA 3WDWA 4WM7C 3M70A 2WSUA 1EPWA 2WZPP 4Y5SA 2R30A 5FOJB 1RUD1 3BVCA 5FYZA 3POIA 5C3SA 1JHNA 1UYZA 4XOGA 2Y38A 4URTA 4DINB 2ATFA 4AZZA 1MZ5A 1GNHA 3GJBA 3QH6A 1PGW1 4QX2A 4YW2A 5LW9A 4QPGB 5FTTC 3RI8A 4HVRA 1H4GA 1QHDA 1PK6B 3S30A 1WCSA 5ISLA 1S0GA 2WNVA 2BVVA 3N35A 5H9RA 1S1AA 2X05A 2K0GA 3D5OA 3ETQA 1BXHA 2W46A 1TMF3 2VZOA 2WZ8A 4U2AA 4GWIA 5CFCC 4LBNA 1UPIA 3AB0A 2ZHKA 4KG0A 4DMIA 1PGSA 3SEEA 2IXCA 5D2AA 1OI6A 2AR6A 3U07A 2WNVB 2Y26A 3I2DA 3K46A 3LEMA 4E8CA 5CYYA 1CPMA 5EHDA 4OHZA 1B09A 4CCLA 1AL22 2VOWA 3KCXA 2GZWA 3ZN4A 3ZSJA 3K4AA 4AYUA 2W1SA 3IIAA 2PELA 4WVMB 2CGPA 4Q8LA 4UOJA 1V6KA 5L7OC 3M3EA 3WG2A 1RUF1 2W1WA 4PI0A 4AOCA 1VBD3 2FDIA 2P6HA 4A41A 3IIIA 2VZVA 5FCCA 1AYN1 4YZ4A 3MEPA 2R042 1R1ZA 4QPYA 2ZMLA 5LRSA 1MVEA 1G6NA 3MW3A 2R1DA 3IT8A 4HMZA 4S2HA 3SKJE 4BIOA 1BEV3 1LRHA 1HJGA 2E53A 2TBVA 3SKVA 1EAH1 4Y22A 5CIRA 3N3HA 1I3HA 5C5TA 3N9OA 4AI3A 2ZGPA 2P2KA 4P02B 4P9GA 2VTXJ 4BQ5A 5K7PA 2IXKA 5C4WA 1VBE3 3WDTA 4B8EA 3WF2A 5E6HA 1V6NA 4MADA 4UW3A 3D82A 1W0NA 5JI7A 4QPGC 3WR0A 2H0BA 4CP9A 4I30A 1PK6C 1W6PA 1ZBE3 3KCCA 1W6OA 5C5UA 5EXOA 4D69A 2HWD2 2CY6A 4NRMA 2WS91 4NAMA 4Y22B 1EP0A 5A3NA 5CBLA 4LIVA 1GV9A 5DAXA 4AXOA 5C4WB 3KT7A 2CWSA 1NLSA 1S0JA 4IEWA 1H9WA 2J1EA 4OQ8A 1BHGA 4OHXA 5CVRA 3T2OA 2VJXA 3VBRB 1LGBA 3B00A 4YZ1A 1BVP1 2YU2A 4CP9B 1RUC1 1W6PB 5F5CA 3THTA 4XDOA 2WNVC 2F17A 4R9CA 3RZJA 4FVVA 4RHV1 3PUHA 2R071 5EZWA 4QQPA 3O1RA 4Q8KA 4URAA 3G7DA 2EXHA 5DQ0A 1RXFA 2GN7A 3J26N 5FP8A 1H8TA 1Q56A 1VE0A 4QHZA 1REFA 4ZU7A 5HI0A 2LRPA 2AREA 4AGGA 2EXJA 4Z1VA 1KRIA 1SFYA 2BYVE 4LMFA 3ZFGA 2W91A 4ASKA 4NHYA 3M8LA 1U5YA 3BOWA 1K5MB 5FYVA 1QJX1 2VBPA 1RUH3 2ZACA 3B5LB 3PJQA 1UCXA 1W8OA 2D3RA 5GALA 3VV1A 4MGTA 3HT2A 4L97A 4P14A 1JZ7A 3AP6A 2XQXA 1H8TB 4Y1YA 1AX2A 4HANA 2YGMA 5A7WA 5A1FA 3I3EA 3OCPA 4Y24A 1CQ9A 4E27A 1DIWA 5DAVA 3N9MA 5F5IA 3AZWA 4QKFA 5FZ3A 3WXPA 3JD72 4ZZ8A 3A23A 3DUIA 1WLCA 4XFHA 4ONUA 2HWF2 1K5JA 3WP6A 4YM3A 1BEV2 4YM1A 2X09A 1V6IA 1SCRA 4BQ4A 1ZRFA 4BYYA 2IFRA 4M01A 3U4SA 2XQRA 3NV4A 5T5PA 1G9AA 2QQUA 3V64A 5FZ4A 1QF3A 1ZZ7A 1R092 2XH6A 3TB0A 3PNAA 5HBAA 5D1IA 1CZVA 3NVCA 5HV0A 1C5HA 5E16A 2KD7A 3OGVA 4R9DA 4D6QA 4EJRA 3LA7A 1S0BA 2E7TA 2BERA 3LOIA 4XFCA 2EAAA 3LZZA 2IXHA 4Y4YA 5C4WC 5FDBA 3HEIA 1R1A3 3KHBA 1UZYA 3O1OA 4YW4A 3VBRC 2DVFA 2R7EB 1HQNA 1OSGA 4XMIA 5GZEA 3DKQA 4GIQA 3VHNA 1YXWA 4P9WA 1X50A 4QQ2A 3GYDA 5IT6A 4BPZA 5BUVA 4COUA 4FXGB 4EWEA 3M3IA 5FZ7A 2BU9A 4YFWA 5APAA 3LA2A 3SCFA 4EE2A 1ASJ1 3U10A 3BIEA 2XOMA 5JMCA 4OUSA 1NQDA 2JIJA 1PGL2 2Y0OA 1U12A 1STMA 3LPFA 4FPJA 5IVYA 2AUYA 1OKQA 3ZXDA 3KF3A 2VO5A 1K5MC 2ZGUA 1COV3 2W3JA 4E2GA 3AYAA 4XCAA 1C8M3 1H1MA 2G19A 5FRAA 1XQNA 1VJ2A 5KXEA 1H8TC 3VKMA 2P17A 1YJLA 2PHFA 2ZCWA 2HJIA 3SH3A 4L9BA 2VH9A 2PQSA 1PM4A 3NO8A 2FZ1A 5IAXA 3ZO0B 1SFPA 3VB9A 1PVC1 2ORZA 3GALA 1AR62 4TTGA 2IXLA 1LU2A 3MIBA 4XF1A 2ZHNA 2NP0A 4XHXA 1Q8PA 1UD1A 2WLQA 4X8NA 4Z07A 5JOXA 4BK4A 1YHFA 3APBA 1WLWA 1TQ5A 2J1SA 4QXCA 1WW4A 2BGCA 2J1TA 1G9CA 3FFQA 1QXRA 3ACFA 3HWJA 1REEA 2B45X 3C7OA 1JI6A 2VULA 3JBG3 4DS0A 2FDKA 1LEDA 4FSJA 2GMEA 2WQ4A 2WFPA 2WLPA 4B4PA 1OLMA 4ZPIA 5GZGA 1A8DA 1AL21 1DYPA 2RR12 3WT3A 4ZKTB 5FYBA 2O1QA 2G9FA 1P8JA 1R1A2 1VRBA 3ZXGA 1EY2A 2IVJA 3DYPA 1FMD3 1OA2A 3ILRA 1ZZ8A 3OJBA 3ZFFA 1I9RA 2RS51 2XB6C 3IDAA 1ULOA 4FPGA 1DGRA 4UFIA 3UESA 1AXYA 2C4XA 2H0VA 4BIFA 5FMOL 2W9XA 1UMZA 2R041 4W6XA 2AENA 1DDLA 2VQ0A 3WP5A 2RDNA 3FE5A 4CDXB 4FAGA 3IDCB 1FNYA 3WDYA 1ULEA 3TOJA 1JZ4A 2WZR1 1PO22 4IUGA 2J7MA 3IM0A 1IG0A 2D6NA 2Y60A 2JX9A 3ZYRA 3PU3A 4LE3A 4DRVA 1W9YA 1U5ZA 2XWBB 3BIWE 2ID4A 3VDCA 4GH4A 2GC3A 4JAAA 1COV2 2CWMA 5KC6A 1H4HA 1LEMA 5CADA 3LOBA 5A6YA 2C24A 3QLQA 4LT5A 1BBT2 3VUOA 1WMXA 5ACA2 1D2QA 2R6QA 2RM22 1O8SA 3KZ4C 3OGGA 3BPZA 4OLLA 1ZVFA 1WWYA 1AX1A 3ZXEA 1BMV1 4LNVA 2VTFA 2EXKA 4GQ7A 5LB6A 5C71A 2ZZJA 3OBTA 3HMYA 2VW0A 4GB32 4GH4B 5A7PA 1RUE3 2BWAA 4OUEA 4QX8A 1WD3A 5I93A 1MS1A 1IS4A 1O7FA 2ZGRA 4YG0A 1FOD2 1W8WA 1TMF1 2ES3A 4C1XA 4GD4A 5FP7A 5A3LA 2ZGNA 2XBO3 5FY0A 1XPWA 5B2GB 2JIGA 4Y1UA 3U1XA 2E7QA 5F39A 2YC0A 2WNUA 3SMHA 4Q4V3 3S57A 2DFBA 2GAUA 1ZRCA 4FOWA 3N7LA 1IQDC 1QJU2 2FD8A 2GC1A 2XJRA 2ZGSA 1WMEA 3ZXFA 1OXCA 2Q0AA 2RG4A 3CNAA 1W8TA 4C1WA 2AEZA 3KS7A 4XTMA 4RQPA 4M3CE 5KHIA 4FFFA 2CAUA 2DTYA 5I8SA 4E4SA 2JDAA 3N36A 4BCUA 2K2SA 1XU1A 3UK9A 4A2UA 5FR3A 1EV12 1HN1A 2WNUB 1VBD1 2W87A 1UIJA 1GP4A 4DB5A 1NA1B 4CDXC 1UZVA 2XLGA 1F31A 1SG3A 1US3A 4A45A 3BTZA 1O6UA 3AXDA 4P5HA 1HXS2 1UOGA 4RQPB 4AW7A 3WF4A 3JD71 1D7PM 4AI8A 2VUCA 5DUUA 4NIAA 2HWF1 2Z4FA 1BEV1 4XYXA 4FT8A 2HEWF 1D4M3 3UGGA 1UZ0A 4YZ5A 3A22A 2EICA 5DUWA 3O5SA 5I8YA 5IWFA 2VQTA 4D6RA 1MZEA 5J09A 5F3IA 4Q2FA 4KGQA 1A78A 3HT1A 3DKWA 3OBZA 1W9FA 3C7EA 1ZBE1 2WR9A 1QQP3 1XE7A 4GH4C 4FFGA 5T52A 1YFWA 4YVWA 1CJDA 4RFT0 5FIXA 4UW4A 3FJSA 2HWB3 1W2TA 4MHRA 1VBA2 2JG8A 5F2WA 3RG0A 3WF1A 5DAQA 4B1LA 4MGKE 1DQ0A 3M3OA 4WVWA 4AI2A 5FY1A 4CE8A 2ZGQA 2XHNA 2XLAA 4JX0A 1VMJA 1GBGA 2VNRA 4FXKB 3MV11 1HB2A 3H8XA 3H3UA 1DP0A 2XBO2 3POYA 4QPIB 4UBGA 4YVWB 5FY7A 5FZOA 2WT1A 1AF9A 1NY71 4QPWA 3JXSA 2O8OA 5GLVA 5FZ8A 2FQPA 5KHGA 2IVIB 3BOPA 4YG6A 3TN93 3WW2A 4BQ2A 3BYWA 3D0JA 1ZZ6A 3VDAA 4G9SB 3UGFA 3RI9A 2WNUC 3VKNA 5T3NA 3BPSA 4DEQA 1NA1C 3VD9A 5FZOB 1RUH1 5F2SA 3IKWA 1VB4A 5JOWA 5DAWA 3I2JA 4RQPC 2WYFA 3PIJA 3MHZA 4LE4A 3OBAA 3EYPA 1GOGA 1C1FA 1RC6A 4CCDA 2VCBA 2JICA 2VZSA 2Y33A 3PTRB 4XJ8A 4V2VA 4O9GA 4TLFA 1CZTA 2PAMA 4YGCA 4MYEA 3ME2A 1Q8QA 2E9QA 1H0BA 3WUDA 3WNNA 3BTYA 2ZGMA 1H9PA 2BOJA 4XUOA 1CONA 4UXAA 4XIOA 1AR83 2DVDA 3GHNA 4LQRA 5DZFA 1W03A 4WVZA 2R0FA 4QU2A 1GZWA 4PI2A 4XJAA 4K3UA 1U5XA 1UKGA 4GXLA 4XAEA 1URXA 3KWVA 3VN4A 1RITA 4C8DA 2RR11 2ZX2A 4BDVB 4CDWA 3GBFA 3GCWA 1BKZA 4UT5A 5JR2A 3ZYJB 3MBWA 4D7TA 1XE0A 1JODA 2ZKNA 1R1A1 1OVPA 2VZUA 5LA1A 1G9DA 3NSTA 3LB9A 4COWA 4D7SA 2NM1A 2HWC2 3T08A 1H2MA 3N4MA 1JYIA 4I01A 2OQ7A 3Q8BA 1AJKA 2IUWA 4J6GA 3DGTA 5FY8A 5FKCA 5JIAA 4G4FA 1SHWB 3AZXA 1W6QA 4QPIC 3ACGA 2KM2A 1AYN3 2WNEA 4YVWC 5T5LA 1R64A 4AEMA 2QQPA 4A44A 4FTBA 4BB3A 4MO3M 1HRI2 1U0AA 1LJ7A 3K3OA 3ZPYA 2NMOA 4PIYA 2O14A 1HQWA 4Q4X2 3UL2A 4KWKA 2RDQA 2XJUA 3MDPA 2Y6FA 3POFA 3CU7A 1T6BX 1NQJA 1V6MA 4COVA 5CU1A 1GNYA 2EF6A 3POGA 2ZABA 4FPOB 3ZYHA 1JN2P 3ZXLA 3ZKUA 1W6QB 1COV1 2OT7A 2AACA 5FBJA 3K77A 5I0DA 1W90A 2WZEA 3T1MA 2AH2A 2D43A 1BBT1 4UW6A 2D6MA 2W47A 1UZWA 3H50A 2RM21 3H1WA 4LKSA 4I3GA 3WNLA 3SCGA 3T0DA 3PTYA 4GWNA 1XE8A 5ANNA 4BQWA 3AMMA 3NKTA 1QOSA 1YUDA 2EIBA 2QZ3A 3RYPA 3PLQA 1TME3 1Y9MA 5L9VA 4GB31 1QH7A 2NLRA 1ULFA 4KBBA 2YC4A 4JGZA 4Q0PA 4YGEA 4HG6B 5FO9B 4Z92B 1O3QA 1YCIA 1Q8OA 2Y6LA 3AM2A 1J83A 3AL6A 4YW6A 4COZA 1RB8G 4B1MA 3BODA 1RUC3 4JTNA 4LIUA 1PZ8A 3R4UA 3U11A 3FWEA 4DXTA 5EFUA 4BQ3A 1AR82 4RHV3 5A80A 1D0GA 2E31A 1JZ2A 2R073 5J37A 1IPSA 4NRQA 1QJU1 2ZX1A 4RGAA 2R49A 3NNMA 1B35A 3W20A 4PQ9A 2IXJA 3TNQA 3AZZA 1IQAA 3ZDVA 4QGMA 3LFIA 1QJX3 4NAOA 4RA0A 1FMD1 1XOYA 5K9YA 1X36A 3FZ3A 4QDRA 3ZIXA 4XURA 4P9IA 2BZDA 1KFUL 1B35B 5HPOA 1ZA4A 4AR2A 1HXS1 1UAIA 2V4AA 4IEXA 3VDDB 1SEFA 3AMPA 4NPRA 1N3QA 3U37A 5LCWL 1RVF3 5F9TA 1HDKA 3T30A 2VZRA 3AKTA 5SV5A 1RJ8A 4PHZA 2W94A 5JLVA 4NE9A 2HWE2 5AFEA 5EYXA 4HOOA 1FXZA 3HBKA 3M7AA 2ARXA 3TEXA 5FZBA 4OZXA 2WN2A 2JDPA 3GGLA 4QHOA 1IOAA 1DQ5A 1UX6A 3AKPA 1CN1A 1XC6A 2BJSA 4XIKA 4NIIA 4FQZA 4LKFA 2V4VA 5KR7A 1LOCA 1ST8A 3I49A 4OHVA 2ZGOA 2P37A 4CPBA 1VBA1 1W8NA 2D44A 3BGAA 3THPA 3FHAA 2BRTA 4DUXA 1RUE1 2YXSA 1GQHA 3AVRA 1GNZA 3P1IA 4KG8A 4ASLA 1F8VA 3P5BA 1IS6A 2RS13 4S2FA 3USUA 4I3PA 3I7DA 1XYPA 3S5AA 2MEV3 3CHXA 1UKRA 3WG1A 1VIWB 3GZEA 1NCRA 2LS6A 2XBO1 3GJAA 1ASJ3 4WM7A 1OLME 1UMIA 5EJ3A 3BALA 3LKJA 4Q4V1 4OHYA 1Q8SA 2JE9A 4G3YC 4ARYA 3EMRA 2WO1A 2MHFA 3AJYA 3CBNA 3PDQA 4IEPA 1G7YA 3HN1A 5FYYA 4A7YA 1OHFA 5A3TA 4LO7A 2FHRA 4NO4A 4LJHA 3USUB 2WRAA 5LWBA 1A6CA 3FLPA 3I3DA 3HD8B 5FMBA 4JC1A 1KJLA 4NJ4A 1NCRB 4CTEA 3N9PA 4BOWA 3AYDA 1B35C 1SDWA 1RUJ2 5F5AA 2OS2A 3AKSA 3IAQA 3VDDC 5A1LA 5G04L 3WQBA 4AL9A 2XG3A 2ZGKA 2XDVA 4IW3A 2YBSA 4CZSA 5CFCA 1DFQA 4TSVA 4NVPA 1RUI2 1ZBA2 1GOFA 2E63A 2XXZA 3OY8A 4I2OA 4BLJA 4AQSA 1POV3 1VPHA 1GFF2 1CAXA 3I3QA 4QQLA 3VBOA 4AVBA 1D4M1 4UFMA 2P3JA 4FOYA 4K9SA 3OBRA 1QH6A 4LHLA 5FPVA 3PUAA 1L7QA 3L9JT 3WW3A 4DEVA 1SLTA 2Y64A 4JCKA 2OZJA 2A73B 4GA9A 2VXJA 5L7OA 4NOTA 1CAXB 4NHLA 1KGYA 1QQP1 4OULA 3VBOB 4RSUA 4XABA 4LOTA 1SLAA 1YIFA 4FFHA 3VZNA 2UWBA 2VPVA 1WGPA 3HNYM 2KXLA 4BQ1A 2HWB1 3KV9A 4QM9A 5A3OA 3FBMA 1QY4A 3TRSB 4C90A 1HRV2 2RJ2A 3UKNA 3KQ4B 4X8PA 1QXJA 2WIIB 1WZXA 3C7FA 4KU7A 4BXFA 4XAAA 2R043 5BNNB 1X9TA 2CDPA 2RS12 2ZA9A 4JGYB 4OI4A 1GZTA 1AUYA 4P9YA 4W6WA 4MXWB 5F3GA 4NIDA 1Q5OA 2PLV2 1PZ9A 3WNOA 2UU8A 4A3XA 3EHKA 2JDNA 1KXGA 4MGIE 2ZAAA 4W4ZA 1NCRC 3H42B 4N9HA 5F3CA 1CD3G 1S4CA 4Y1XA 5FO7B 4XTPA 1LULA 2F4PA 2HWD3 3SH4A 1K12A 4TWTA 4XXAA 1YIPA 5J1XA 2FDJA 2PTMA 3WNXA 1MS8A 1W9TA 3JCIA 3TEWA 3CF6E 4FI9A 3TBDA 3T4HB 4CUCA 1XNTA 2ZTNA 1AYM2 5FREA 5CISA 1ENSA 4EN6B 2D5HA 3LSEA 3WD5A 3B93A 3BUCA 2ZPXA 4PT6A 3S5QA 4CCCA 5T54A 3SISA 1AR81 2RS32 1UU5A 2B8MA 4RR3A 1GP5A 4WVMA 4AWDA 3WP3A 2ZX3A 4YSFA 3VBOC 5D8AB 1W0OA 2E6VA 3OD4A 2JXAA 2VZQA 4XFGA 4CEWA 3MF9A 2A1XA 2IC1A 4ISQA 1VMHA 1MVQA 2RJKA 3PVBB 3WDXA 5IK8A 4OI0A 1G9FA 3KF5A 2ZBJA 1UIKA 2BQPA 4A7KA 1OURA 5A3MA 4YYOA 2GH2A 1JTZX 2WWSA 3H1YA 1SBDA 4RR3B 1LHWA 2JD9A 4UI9L 3WNPA 1G9BA 5BNNC 4AQ2A 1RGSA 4N43B 1JOPA 4JGYC 1H6YA 1NKGA 5DZEA 5GZFA 3CL1A 4OMDA 4CEWB 4B29A 3DEMA 4MXVA 3W58A 2B39A 4BWOA 2XVKA 1TE1B 3O0WA 1CVNA 4LR4A 4HN1A 5FZFA 4BK5A 3JD73 2I07B 5A32B 2VE1A 4QU1A 2HWF3 2L9LA 1F9KA 2YY1A 4AGRA 3GHMA 4YARA 3THCA 3MW4A 3NJZA 5FK8A 5LBFA 3WV6A 5C3OA 2B42B 2VVEA 2XJVA 4IE6A 1R093 2BUKA 1LNSA 3BTXA 4IERA 1CWPA 1C28A 4F83A 4EWAA 5M0TA 4EN7B 4IEZA 3VBRA 1S2BA 3WY6A 1JZ3A 1ZRDA 2Q5TA 3A0NA 2Q8DA 3J7HA 3OTFA 5C7GA 2WFF2 3OSDA 4P00B 4YNIA 3ZR6A 4K7JA 1C8NA 1ZZ9A 3K51A 5IVCA 1W9WA 1M06G 3CJXA 4W50A 3KVBA 1TME1 2O8QA 2C5DA 2LTNA 4CU8A 2J1UA 4CU7A 3RVHA 1ULCA 2QFEA 3J8F2 1HKDA 4B3NA 2WYSA 1UY4A 4XUQA 4JRAA 1Y7BA 2RMU2 3WW4A 1S2EA 3MLLA 4H55A 3BI3A 5LA0A 1WBLA 4CUBA 2JB4A 1JZ8A 1APNA 1QXPA 2VECA 5D8AC 3WQ1A 5IFPA 1K5MA 2OQ6A 1W06A 1O4TA 2VQAA 3MUY1 3PL0A 5FZCA 3FHIB 2E32A 1LHVA 4SLIA 5DN2A 5FK7A 2A6YA 3T2QA 1OUSA 4RR3C 5F8PA 2BW8A 3OPWA 3EJKA 3I2FA 3ZYIB 4N43C 4A3ZA 1HB4A 1TG7A 1QJY2 4BLIA 1VAMA 2EXIA 2VCMA 1MZFA 1RUJ1 1AR92 2JKBA 3SLIA 4CEWC 2V5DA 4JQTA 4QHBA 4AVSA 3LDBA 4J1XA 3LQCA 3O12A 4XFFA 1AR63 3S0MA 1YNAA 2OUHA 1NT0A 3H9AA 1RUI1 3MV01 1O91A 2QQVA 1O5LA 1V6LA 1H6XA 1TNRA 1MS4A 3WW1A 3I59B 5JXIA 1GOHA 2VZTA 1NOVA 4XBLA 4BA6A 5CA6A 1RVF1 1OPOA 1W6MA 3RWNA 4Z2WA 4ARXA 2HEYF 4LXLA 5IHRA 1O3RA 1BVVA 5DG2A 5J96B 5L9BA 3ZKYA 1GZ9A 5LY1A 4RN5A 2Y6HA 3C7GA 3MPBA 1SBEA 3GZTB 2D3SA 1UNBA 3O1UA 4QWNA 1MPXA 4META 2D98A 3P3NA 4CDQB 4LHSA 3RZLA 2RR13 1PZ7A 2ZHLA 3LIGA 1W6MB 3HAGA 1F15A 1XYNA 2GU9A 1OC1A 4MGSA 3WVJA 2QQLA 1DBNA 2XKPA 2B9UA 4IQPA 3VZJA 4CXYA 2VG9A 5LA2A 2ERFA 1HRV1 2A70A 2Y8KA 1SCSA 3SNMA 1W05A 2RS11 2HYXA 2NN8A 1XB9A 4RD7A 1RTVA 1CAWA 2MEV1 3WCSA 5FPZA 2J1AA 3HR9A 2FMYA 1DQ4A 2C1FA 4UWDA 2TUNA 5IJRA 2B46X 2UURA 1J1LA 4I0BA 3ACHA 1PO23 1F2NA 5KBFA 3CO2A 4AK3A 4WZCA 2WC2A 1LHOA 4QB1A 4IGPA 4P9LA 5LK7B 3ALQA 4XZUG 3ELNA 3ZN6B 3HBZA 2VOVA 3VKLA 2RV9A 2CHHA 2WL1A 3WDVA 2XL7A 4EQVA 3RJRA 1CAWB 3CDZB 4KQ7A 5LK5A 3KV6A 2BFUS 1S55A 1BBT3 4HBNA 1W2NA 4ZS3A 4QDQA 2ZGLA 1I6XA 3NV3A 4NPLA 3DECA 1ACCA 2RM23 4PIXA 5ACA3 5LY2A 5FXVA 4Q4W2 3VZKA 3OUJA 2JWPA 4IEUA 2VCAA 5FP3A 1O4ZA 4R4XA 2A75A 1KDKA 2A6WA 3M4FA 2YHJA 2XUMA 2D6KA 3U78A 4D7YA 4GB33 4CYDA 2OIIA 1CX4A 4EV0A 4LKEA 3GZAA 1WW5A 3C7HA 1VAKA 3URFA 1FOD3 1OLQA 2HYKA 1DQ6A 1V70A 1POV1 2JE7A 3MUZ1 1CX1A 1AHSA 3H8UA 1QOTA 2OXBA 3QD6A 3T0AA 5LASA 4S2DA 3H1MA 2QQMA 2OW4A 3ZOIA 3NL1A 5LBCA 4CDQC 5AC93 3ZSLA 1VAVA 4YGDA 1W2UA 1X8MA 2WUHA 1PO12 1QJU3 1IS3A 5BNQA 5HCAA 1UY2A 2DV9A 2QCSB 2XPJA 3JU9A 3CKHA 1N1TA 4HVOA 2V73A 1YEWA 5CZKA 5FXZA 1RXGA 4CDXA 4DO0A 2X5IB 2DYCA 4BQXA 1EV13 5EJZB 1QNYA 2BGPA 1MS3A 4PQQA 4AF9A 4YG3A 4AEDC 4K8RB 1PVXA 2A3XA 2ZOEB 4LLOA 5J48A 3U75A 2Y6GA 2CL2A 3OUHA 4DUVA 4YFZA 4RS5B 1HXS3 4PF5A 3WQ7A 4IV1A 2J42A 2VNVA 4MG2A 2BTVC 3I2HA 4Z8BA 1PIV2 4JV4A 4YLZA 2WABA 4XEZA 3DXUA 1C1LA 1RINA 4DXZA 5JSRA 2WSVA 4IE7A 1UY0A 2PAEA 2D7FA 4Q0SA 4CDUA 2ZEYA 3PVEA 3THDA 4P5YA 1PMJX 5T5JA 2QQNA 4B7KA 2GALA 4AQ6A 4IV1B 1VBC3 3N7MA 1PMHX 2WFF1 3CMGA 1BCXA 4XDPA 4FO9A 2PAKA 4HSJA 2HWD1 3ZM8A 1V6OA 3OGSA 2YUEA 1C5IA 4F7ZA 5KC5A 4HL0A 1YFYA 1GUIA 2JDZA 3PURA 1VBA3 1PX4A 4XILA 4CDUB 1GWMA 5A7OA 5I0TA 4TLGA 1L7LA 3CIHA 4ZY9A 4AG4A 4UBHA 3G6JB 1GMMA 1NUKA 4DQAA 4LO4B 5TSWA 1XNAA 1OA3A 4NPMA 3LCPA 1W9SA 4MHUA 1SBFA 2XUEA 2HEVF 5AC92 3HQUA 4DNYA 2QE3A 3S6PA 3BKZA 1NA1A 1IG3A 4DZGA 2X5IC 4K1YA 4XVHA 2KR2A 3PUQA 1JMUB 4E8DA 1QJY1 4Z82A 1OMIA 2C6SA 2FMDA 3GF6A 3POWA 1N3OA 2VU9A 4H7MA 4Q4Y2 4IV3A 5FLHA 1LCLA 3FX3A 5FZIA 4M0NA 1LOAA 2J1RA 4RS5C 1F35A 1OFSA 3UKVA 5DUVA 1BK0A 4HVQA 2ET1A 5JAXA 4UAPA 3DYOA 3K75B 2GNDA 1OFNA 3POEA 3RWKX 1KEXA 1IGOA 1RHI2 1HV0A 4IV3B 1GR3A 5BY5A 3PJYA 3K48A 1UPSA 1Y9QA 3AKQA 4DY5A 4IV1C 2EIEA 3ENRA 4QXHA 4WV8A 1R091 5KHKA 2OA2A 2KA3A 4PLNA 4YW1A 2R062 1JYCA 3ETPA 1QU0A 1VBC2 1WW7A 1DYKA 1VRH2 2A6ZA 4QQHA 4GMP3 2P5BA 5EWSA 5A3WA 1UWWA 3VBFB 4CDUC 4IDZA 4KWJA 4MGQA 4Y1ZA 1X33A 4QPIA 1QKQA 2P1BA 2HWC3 3RPQA 4AEKA 1JUHA 1UYPA 3QBQA 3OPZA 1K45A 5FZEA 3ZYBA 3RZKA 4FOQA 4GALA 4DFSA 2OUJA 5C8CA 1PNFA 2OX0A 2D6OX 2QQOA 1D4VB 2WKKA 3J7NA 3KGZA 1PHMA 4JKKA 3K3NA 5JPMB 4FPHA 4QX5A 1HRI3 2GC0A 1LESA 1MQTA 1N47A 3GBWA 3ZXAC 4NHXA 4Q4X3 5HCBA 4Y4RA 4A6SA 1PGL1 5KXCA 2WAOA 4XUNA 5A33B 3MI8A 4LO5B 1MS0A 4XF0A 3KHCA 3IN9A 5C8CB 4MSVA 1A3KA 1Y3TA 1DZRA 1JU3A 3AMHA 1GP6A 1MQTB 4NR1A 4DXRA 3HN3A 3MPPG 2G1MA 2WO3A 4YM0A 1UXXX 3MIGA 4D8MA 3ABZA 1FT9A 4MX3A 1UO9A 3RZHA 2PHTA 2EIDA 2UYAA 1UW8A 1XBFA 4N9IA 5JI9A 4KWLA 2XMLA 4YVSA 1AR61 1ODNA 2K9ZA 1G8WA 1RJ7A 4IV3C 2Z2SB 2LUWA 3Q8CA 3GXUA 4NHKA 2TNFA 1JOJA 1DGLA 1WW6A 5C3PA 2JE8A 3BU0A 3K4DA 1S2KA 2A7AA 1IKQA 3I4IA 2CU5A 5H9PA 1WLTA 5LEKA 1CESA 2X8KA 5DZGA 2V5YA 3D0SA 4YVSB 2VMGA 1OA4A 4KH9A 3W9AA 3VBFC 2PHWA 5FV3A 1AX0A 1NXMA 2QJVA 1QJZA 5CKMA 1NE6A 3POBA 4QGNA 4HK8A 1HQLA 5HV4A 4JRLA 4OMCA 4ZZ5A 4MV2A 4RL7A 4EN9B 2HLEA 5BXXA 5FPAA 3DXTA 1OF4A 4PLMA 4XBQA 4ES8A 1WKYA 1BJQA 5JXJA 2VBDA 2PMWB 3WP4A 4AVTA 1CR7A 2G4IA 3W59A 4KI5M 4AAPA 4RGKA 1LHNA 1YQCA 2AGSA 4O65A 5FXXA 3Q9OA 2V09A 4DRRA 3MZHA 3LEGA 3INAA 3LGRA 4JKLA 3OPTA 2JDMA 5FY9A 4QXBA 1C4RA 5C8CC 1W3VA 5IK7A 1PO21 1VBB2 1VR3A 1Z7S3 3HVDA 1YC61 3OB8A 1NYWA 4L8QA 1MQTC 2HWE3 3OGRA 5K4LA 2D6LX 4XPVA 5FKBA 1AR72 1GANA 4XJ9A 5A3PA 3AP9A 4EN8B 2NPIA 3RYRA 1E5HA 3W21A 2WQ8A 1J3QA 3OD0A 1ZYBA 4INDA 3VBSA 4L0PA 5ACA1 4WM8B 2FBEA 3RFRA 1CJPA 2VUJA 4FPFA 1KDMA 2RVAA 5FUIA 5I91A 4W6YA 1RL3A 3FBYA 1DQ2A 2ENRA 3A0KA 4UF0A 4W65A 3I3MA 4Y33A 5FO8B 5FP9A 5CB7A 3H7YA 3UNPA 2YBKA 2BGOA 4P9JA 2WNOA 1HW5A 1FOD1 1TVGA 4XUPA 5EP9A 5B4XA 3UJOA 3MGUA 5ERLA 3VBSB 4MUVA 4YVSC 4IEYA 3WINE 5F6LB 4EZHA 1ONAA 1OQEA 2R32A 2UYBA 3AYEA 5AC91 3LDRA 1UMHA 3WX5A 1SQ4A 1RUD2 4IGOA 4UF0B 1KJRA 2XJPA 3WQ0A 5ANQA 2WAAA 3ZYPA 4OI2A 4COYA 4QM8A 5KXDA 4FOVA 4NHMA 3I3BA 1HJFA 1X7NA 3AJZA 3VDDA 3I97A 5DDJ2 1RUJ3 3IMNA 1J1TA 1JZ6A 5GLZA 1EV11 1K3IA 2W1QA 2YFZA 2ZMNA 3AZVA 3IDBB 4MOAA 1GYKA 4BMBA 3AZYA 1YRZA 2ZMKA 4XDQA 4JQRA 2E33A 3E5QA 4Y5TA 1QOOA 1DLCA 3ZIWA 2O0OA 3WZ1A 4DY3A 4CVUA 5JSOA 1RUI3 1ZBA3 2VW1A 2PN5A 3I2KA 3O1VA 2VY0A 1Z0HA 3OYWA 1RHI1 1SLCA 3GZUC 3PVNA 4NIGA 1OOPA 2WINB 5DUXA 2NMNA 3KD4A 1PMIA 1WCKA 1Z7S2 2EIGA 3AFGA 1LTEA 4WVVA 5A70A 5F37A 4NWVA 1FATA 4CU9A 4PCRA 4IE0A 5AFBA 2DUQA 1ODMA 4WM8C 4KWUA 1D0HA 3V56A 5FZKA 2R061 2Z79A 4XE9A 1IPJA 1ZNPA 3IPVB 1VBC1 3OYWB 1JXNA 2YPJA 2A6XA 4AFCA 5HXMA 1OOPB 4YW7A 4PBPA 4R9BA 3VL9A 3J7MA 2B9VA 5D21A 3HIFA 4LORA 1WMFA 1MACA 4XFIA 5J98B 3UJQA 1H1IA 4CA9A 3CZUA 2VZ1A 2WO7A 3LEIA 3VBSC 2MNGA 3ZR5A 1ZREA 1HRV3 2VTXA 4IEQA 3ZDSA 3V0AA 4ORFA 1ENRA 3OG2A 2Y6KA 2AEYA 1WCDJ 4J25A 1V0AA 2Q1FA 4L2NA 3MLJA 1DGRN 2DF7A 3IZOA 4LA2A 2PLV3 4OI1A 2AZ5A 1IZ3A 4N90A 4GJZA 4PIZA 4BE3A 4LBOA 4F3JA 4OYUA 2BBAA 1BQPA 1MS9A 2EA7A 3R05A 4KMQA 5CG8A 3V0AB 2VOXA 5B4NA 1LR5A 2WS92 2VR4A 5CKQA 5JXHA 2QQWA 3VD3A 2A71A 3VGIA 4OUMA 1T2XA 3R4DB 3ZPOA 4BHPA 1O3SA 4M4PA 4OFGA 3N9LA 3MIDA 3WF0A 1NAEA 2VC9A 4TYSA 2GMPA 4LTAA 1WUVA 2DCZA 3FC0A 4LOSA 1ZA7A 4LLFA 2J1VA 4CRQA 2SLIA 1AYM3 2W0XA 3ACIA 2QQKA 3N7KA 2VMEA 3KVAA 4HT1T 2YV8A 1C57A 1XJAA 3MFCA 4QX7A 5FUNA 2JJ6A 3I54A 3UYJA 2RS33 3LE0A 2XLFA 4QKBA 2DBNA 2W95A 3F95A 1W04A 2Q1MA 2W5FA 4LITA 1MEC3 3X29B 4LHKA 2VUDA 3NNLA 1OOPC 2H6CA 1AZDA 4F8AA 2YU1A 1CAUA 4AFBA 1T6GC 4K21A 1ZRRA 1W8UA 5IVBA 1AVBA 3E6CC 3AFKA 4HKOA 5BNNA 3B69A 2ZHMA 4JGYA 4GMP1 2WQZC 2XJQA 4Q0VA 1V9U2 2V72A 2W52A 3ILNA 5FZLA 4MXWA 5A3UA 1XSQA 5EJ1B 2HWC1 2I2SA 4I09A 1QWRA 4ZS2A 4A7ZA 2XWJB 1CAUB 1SMVA 4S2GA 1DZTA 2ET7A 1OPMA 4D94A 2FCVA 3LA3A 4GZ9A 1YQ6A 1M4WA 2QKDA 2Y34A 3RZZA 1S0CA 4NIHA 3FHQA 5FYIA 3VHPA 1HRI1 5CKNA 4AQTA 4B7EA 3ZFEB 4Q4X1 1G86A 3JUUA 3Q8AA 1SDDB 1X82A 1RMU2 2QDNA 1AL0G 2VCCA 5IAVA 1EUUA 2WJSA 1CAVA 1OH4A 3ECQA 2Q8CA 2CAVA 1AR71 2GP5A 4YGBA 4E4ZA 5CFDB 3LD8A 4UW5A 4QB6A 5BNPA 2PHUA 5SV8A 2FDHA 3OUIA 2BNMA 2W92A 2WFF3 3ZSKA 2YDEA 4FBFA 4AGVA 1QGLA 3AP4A 3SITA 3USSA 4KNCA 4A4AA 3UGHA 1CAVB 1GU3A 2GNTA 2ZS6B 1FNZA 3ON7A 5EIYB 3KSCA 3TEYA 3KT4A 4MVTA 5T55A 3AKRA 2QDRA 3T09A 3LSDA 5FZ1A 2F4LA 3J8F3 4LUMA 4GWMA 5D8AA 2VM9A 5BNPB 1R082 3OOXA 2QQJA 2RMU3 5FBZA 4YPJA 1JYNA 4XF4A 4CUGA 1MR5A 4B4QA 2DVBA 5JXGA 5AVAA 4V1PA 2WT0A 1LOFC 4TXWA 4NUBA 4XUTA 5ABJA 4AVVA 3ITQA 3DCQA 1MEC2 4IL7A 4N43A 4HONA 1LGNA 3Q8FA 4Q5OA 5DABA 4HSLA 4LKDA 1N1SA 2YFUA 3IB3A 2QBXA 4PDWB 1GSLA 3PVOA 1QJY3 4HLTA 1PVC2 5DDJ1 5JVVA 4AE2A 3GCXA 5A32A 1AR93 2BBVA 2AC1A 2WWJA 2XONA 1HN0A 2XR4A 1I1EA 5HCHA 1PM7A 2ORXA 3RDIA 5ABJB 5GKAC 1MZ6A 1UX7A 4Z2AA 1J3PA 5FYCA 2ILMA 4BISA 3ZFEC 4GULA 3L2YA 1YJKA 2Q8EA 2LM3A 2XGXA 3ZYGA 1QJEA 1IS5A 1KITA 1XNDA 2D97A 2VL4A 2BOIA 4D6SA 1BLZA 1FPN2 1IHMA 5I8TA 1QNWA 5FZAA 3TAYA 4CCEA 1Z7S1 4LO8A 3T2PA 5C33A 5CFDC 3W5MA 4LO6B 2NYYA 4GKYA 2DFCA 4U36A 1LODA 2HWE1 3R6SA 4PJYA 3VD7A 4JDMA 1ZX5A 2JDHA 3W5NA 4LBQD 5FYUA 5JCTA 2Y6JA 1NXD1 3KM5A 4L92A 4YZ3A 5C6CA 2RS52 2YBPA 4CP1A 1RUG2 1SFNA 1Q43A 1H30A 1HLCA 3LPGA 5IK4A 1HIXA 1BYHA 5JIUA 4ASMB 5BNPC 3RRDA 1LGCA 4AHXA 5LZ6A 3KV4A 1LECA 1GKBA 2WZR2 1V6JA 3H7JA 1XRUA 5IVFA 1VALA 2W39A 3KGLA 1WD4A 1WCQA 2BDRA 2W1UA 2P4EA 1E5SA 2DWRA 5FMOS 5C70A 2VZPA 1CIWA 5BYNA 2QUOA 1DLLA 3L2HA 4JVAA 5BNOA 2F6BA 5LA9A 4ES9A 4PDWC 1W8FA 5FPUA 4ZHNA 1CGPA 3AK0A 1W0PA 3WNKA 2G9GA 4LHNA 1F5FA 1QMJA 1LOEA 3ACLA 4X6RB 5ABJC 4CP0A 1BMV2 1BK1A 1FI2A 3I59A 2JDYA 1UXZA 2ZEZA 2TEPA 3JQWA 2C9KA 5G05L 4BH9A 4XF3A 1LOGA 5JDBA 5FY5A 2OVUA 4Q4W3 3ZXKA 5BNOB 2QTWB 1YLLA 3PU8A 1TMF2 1W6OB 5FZGA 3M3CA 1REDA 2WDBA 3Q8EA 1NX9A 2VXRA 3IBMA 5FYMA 1ZBA1 2VMFA 3P6BA 4B4RA 3SH5A 2VOTA 4CDQA 4C0HA 2HKXA 4Q0QA 4RGGA 3D4KA 2PQQA 2ZJCA 1NLRA 2LALA 4XCBA 4ZU5A 2A6VA 2D40A 3NQHA 5EQUA 5FLIA 1W6NA 4Q0UA 4XFBA 2HH9A 4A6OA 4ZXKA 5FZHA 4CEYA 2QNKA 3LEKA 4O7XA 3ZMOA 1PO13 4W8JA 2B7YA 4PF1A 3EBRA 3OGJA 3WHTA 3TEZA 5FPLA 4Y3OA 2DVAA 4FP2A 1ENXA 1HX6A 3JZVA 2QVSB 3E6BA 4NRPA 4N53A 5GZDA 4AVCA 2DU0A 1VBD2 1V9U1 3FN9A 2FDGA 4AEDA 2EVXA 5JUVA 4AFAA 1W6NB 3VHRA 2JB8A 3VZOA 3ILFA 2JG9A 3ZFGB 4CEYB 1RUOA 3AMNA 2UY8A 1POV0 1JBCA 3M2MA 5BV6A 3WDUA 1JS9A 1KD7A 4FPLA 2DURA 3M1HA 3NJVA 3ZN6A 3GM8A 4N53B 5DAPA 4CCKA 5A7WB 5DPNA 2ADDA 3B01A 1OT5A 4XZPA 5H9SA 1VBE2 1D2SA 3B94A 1RMU1 3FL7A 2P6CA 2PLV1 3H0OA 4AEDB 3RZGA 1PIV3 3HNMA 1CZSA 1TZOA 2GMMA 2JG9B 3NW4A 2YPDA 5IW0A 1RIRA 5K0UA 3RMXA 1YFUA 3FLTA 1PNGA 3MLKA 3RJ2X 1YFXA 1ZBE2 1L3JA 1MS5A 3CJIA 2UWAA 4Y20A 3H8OA 2RJLA 4XW3A 4XBNA 5BNOC 1OQDA 3NMBA 1ZRIA 3HQRA 3GNEA 1W28A 2EAKA 4K1ZA 2SBAA 5K0UB 4CSWA 2PYTA 1UZZA 2YZ4A 3JB4C 3JQXA 3CJIB 4BXSV 4C91A 4O9EA 5LRRA 2DBIA 1EUTA 4Y20B 5FZ9A 3PIGA 3AX4A 1NY72 1R081 1O59A 2Y0IA 3B7MA 1UQXA 1DQ1A 1AYM1 2ADEA 3E5XA 5EV7A 1NG0A 1OUXA 2FCUA 4LBJA 2G9ZA 1Z78A 2VBBA 4QKNA 1EYBA 4KL1A 1WA6X 2RS31 5GM0A 5FZ6A 1OKOA 2X5IA 3WOGA 5A1AA 4QAWA 2D5FA 1MEC1 1E5IA 2WA4A 4TZDA 2Q4SA 5L9RA 4AFMA 3IAPA 3LDKA 4UFKA 3B3QE 2ZEXA 4UYBA 1RUH2 2CSGA 1QDOA 3O1TA 4ATEA 5FJHA 3ZFGC 4RS5A 4CEYC 4DPNA 4IXLA 2ZX4A 1TEIA 2GN3A 2OKXA 5FAXA 2ARBA 5E89A 4Q4Y3 1OLRA 1JHJA 4AVAA 4H2AA 1QDCA 2D93A 2VNOA 2WN3A 3ZSEA 2B4KA 3HQXA 4LBMA 3BN6A 4N53C 3VZLA 2VQUA 2GSYA 4AHYA 1Y4WA 2GH8A 4YM2A 2D6PA 2CGNA 2RHPA 4HZFA 2WT2A 3FUOA 4E2QA 3J4UH 2JG9C 3PMEA 3D8CA 3NNJA 3NV1A 1E5RA 3QOPA 4KU8A 4XHBA 1FPN1 1GQPA 1RHI3 5IVEA 3NRUA 3AP5A 3E5UA 5C9AA 4E4DX 4QDSA 2Z69A 3T0BA 3VBUA 3VKFC 3BU7A 1XNCA 1GICA 4HFSA 4P08A 3WUCA 2W08A 2WO2A 1E57A 4GWJA 3S7EA 2DDUA 3ROUA 4XQWA 2CYFA 4MLOA 2R063 5K0UC 4NN0A 4Q29A 3AL5A 4I0AA 4UFJA 1RUG1 3SC7X 1VRH3 3WHUA 2XVGA 3CJIC 3WNMA 3N7JA 5FLJA 4FQ4A 2C9AA 5C9AB 4JZRA 2IWGB 5FZMA 3VBUB 4BM8A 4QX0A 4CCOA 4QKDA 2XJSA 4HETA 4CCJA 2I45A 5LATA 3VKOA 2GP3A 3J8F1 2YB7A 1WMDA 1UOJA 1A8MA 1YQ5A 2YG0A 3OF1A 3ZFFB 5LEJA 3NV2A 3QCWA 4CUAA 2RMU1 3DN7A 1GZCA 4V2WA 5A6XA 5JOZA 2VNGA 1JYWA 4AI1A 1H8VA 4LPLA 3PMSA 3E6DA 3JB8A 1QJFA 2VGDA 4YZ2A 1SZBA 4D3WA 3BCWA 1S0EA 5EYYA 4OQ9A 1C8M2 5IFTA 4CPBD 3WF3A 3KLSA 1JOBA 1ULGA 2UY9A 3J7LA 2ZXQA 1W99A 3KMHA 4AAXA 4AEJA 2R0HA 4FFIA 5IUQA 1DCSA 2DU1A 2E26A 3HPNA 3O1MA 2JEMA 3NJYA 3O14A 4XQDA 1W2AX 1GWKA 3D3AA 2GNBA 1DGWA 1LHUA 3MFAA 2DCTA 2YC2A 3VL8A 1AR91 1J84A 2EALA 4N7IA 4OVEA 3RZMA 1F5JA 4DIQA 1JU4A 3B9IA 5FYHA 3T4VA 1O5UA 2N7GA 2YGLA 3MIHA 1SLBA 4TN7A 5A7NA 2FCTA 2BP6A 3KT1A 2K46A 5DXDA 5F7UA 2BEOA 1SLLA 2GC2A 3MO4A 3D6EA 5GLTA 1UF2C 2E51A 2ZGTA 1WA4A 3JBG2 3MIEA 3GBGA 1ZZBA 2AYHA 2LW8A 3ES1A 3SHRA 1F4AA 1UOFA 1ENQA 2IFWA 2WBKA 3VZMA 2C26A 3VBFA 5IVJA 4FPCA 5CG9A 3IWZA 5L73A
chains in the Genus database with same CATH topology
4HKLA 4K40A 5GJ6A 4IEOA 1HV1A 3WG4A 1DU3D 4QGLA 5C9AC 3QH7A 1FMD2 5KXBA 2Z42A 3VBUC 2IZWA 3RSJA 1UU4A 4NWWA 4LBQA 1ND2A 2BNNA 3POSA 3RS6A 5J7MA 3ZFFC 1NCQA 3O0VA 4FPKA 5A33A 2XL9A 3NWKA 1C3HA 3SCHA 5K8SA 2R16A 4WZFA 2BFUL 2PA7A 1VBE1 5JZGA 4K20A 3AXEA 1ND2B 4LBQB 2XJTA 4IESA 4XJZA 5I0UA 4AI0A 2BPA2 2NZ9A 3TYJA 1VBB3 3I8TA 1NCQB 4Q26A 2DVGA 2ZX0A 1NZCA 4E9KA 3O7OA 1YYNA 4HKWA 1AR73 2I74A 2YMZA 5FOBB 1YI7A 2Q1ZB 3H3ZA 5JZGB 4PBOA 5DG1A 3TWIA 4HPKA 1O4YA 1H2KA 4GKXA 1IPKA 4YW5A 1RUE2 4Q4W1 3DPRA 4JDOA 3ZN5A 5E1RA 1XXNA 3U0ZA 4Y26A 2DCJA 2QZ2A 4LA3A 4M00A 1EPZA 2PFWA 2CTVA 1FAYA 5GLWA 2PHDA 4SBVA 1JH5A 3VBHA 2JG8B 1S0FA 5E8AA 3WG3A 4Q4V2 1J3RA 3EXUA 4HPKB 1SLIA 3BB6A 5J3UA 3NKGA 1V00A 1N3PA 2UWCA 1UL9A 3DPRB 1LOBA 1RUD3 2IXIA 1PO11 1KS4A 2C0ZA 1YO8A 3QACA 3UKTA 5H9QA 5F6KA 3VBHB 4XF9A 5CAZA 2D3PA 5T5OA 4HN0A 5FQ0A 4MH0E 1FV2A 3A4UA 5DDJ3 2CV6A 1S0IA 2MPFA 2NQYA 2OYZA 1O3TA 2ZZQA 1WLDA 1H2NA 5FPXA 4FPYA 2B5HA 5JPNB 1ND2C 4XJWA 1D4M2 4LBKA 4Q27A 5F5QA 1J58A 1NCQC 1KS5A 1VB2A 4FP3A 5FQ0B 4KGGA 1FYUA 3ZX7A 4FAHA 1PIV1 3P3PA 4ATFA 4WM8A 1X8EA 3IDEA 1AXZA 1OQ1A 5JZGC 1QQP2 3MIFA 4DOUA 4Y5Z0 3V65A 1LB2A 1GZWB 2P3KA 1LENA 3ZXJA 1RUF3 2E7AA 4YRDA 2HWB2 3MW2A 3C3VA 2VVFA 1KQRA 4CDWB 2WA3A 1LU1A 4CP2A 2A5ZA 1DG6A 5J36A 2VMHA 3LAGA 2JG8C 3TNPB 4N7UA 1JUIA 1EAH3 3DPRC 5CNAA 3RYKA 3MICA 4P9XA 3VLBB 3J9SA 3TN92 3MYXA 4ITCA 4R8HA 3UV9A 4XETA 5F1RA 4K8FA 3RNSA 3VBHC 5I0SA 1C8M1 4Q1RA 4AHZA 4QMAA 3SXWA 2XVLA 1W39A 2A3WA 2Q8OA 3FUQA 1GLHA 2P34A 3EO6A 1H2LA 4LUKA 2WS93 1ZM1A 2BVBA 1PGW2 3NAPA 3FLRA 2GNMA 3E97A 1LKNA 5JSPA 1RUNA 4IETA 4ISRA 3KQRA 4Q4Y1 3FFZA 2A3YA 4FTEA 4L11A 4AFDA 3B9CA 2XHKA 5KWRA 4XQ4A 1SACA 1U5IA 2DTWA 2H6BA 3NAPB 1UU6A 1VP6A 5JWPA 4EN0A 1VLNA 4XMAA 1J59A 3JBG1 3IPVA 3ZSMA 4JGZB 3T1LA 4XXPA 4X6QB 1Y43B 5GLUA 2DUOA 3R4SA 2VUAA 4CDWC 3ATGA 1DZQA 4XFAA 1UN1A 2ZKLA 1RUF2 2GDFA 2ETEA 2X29A 1VRH1 3AMQA 4EROA 1V9U3 4BZ4A 2PHRA 4IEVA 1ALYA 1AYN2 1DGWX 2YROA 3EQEA 4OHWA 5KHHA 5BPXA 4M0HA 4K6BA 3ES4A 1BZWA 4JDNA 3DL3A 1EAH2 4QD2A 1FV3A 1IKPA 3RQ0A 2DCYA 2JENA 1RMU3 4HK9A 1XYOA 5I0RA 4I02A 4R4ZA 4E2SA 4QXKA 5L19A 4C0BA 4H7LA 3ST7A 4J1WA 4GMP0 5JOYA 4M3CF 5L36A 4MZUA 1TME2 1N1YA 1I5ZA 5HXVA 3WLUA 4Y1VA 1YWKA 1CPNA 1ND3A 3C2UA 1XNBA 4FPEA 3NAPC 4WBBA 2R1BA 4QT6A 1RUC2 4Q1PA 4JGZC 3S7IA 3BTAA 1GQGA 4RHV2 2VOKA 2OPKA 1R083 1LOFA 2R072 2VVDA 4R52A 3RMYA 1FX5A 3CLPA 1ND3B 4MGZE 2JECA 1JW6A 1ULDA 1DF0A 1KFXL 4LBLA 3ZMNA 2FZ2A 5JR7B 4LEJA 3PHMA 2DUPA 4WM7B 2RE9A 4PLOA 1QJX2 3DF0A 3ASIA 4QQOA 2Q30A 2OZ6A 4AHWA 3ZVXA 1S0DA 2PHXA 5FFOC 4ZU4A 1PVC3 4JTOA 3ZFEA 3V0BA 4H14A 3T2TA 5IK5A 3U4XA 4L99A 1DHKB 2BWCA 4R9AA 3WCRA 3KCYA 1AXKA 3O0XA 4I0WB 1ZZCA 1RVF2 5C8WA 1OD5A 3FMGA 2P3IA 4H3WA 2VMIA 3LWCA 4MGYE 5CFDA 4FTSA 2BNOA 5HCFA 4FCAA 5CFCB 3R0RA 2X53S 1FPN3 3V0BB 3OY8B 3AP7A 3MF6A 1VBB1 4LULA 1AL23 1Q3EA 1YI9A 2VW2A 5T50A 4EWDA 1AJOA 1Q8VA 5E88A 1N1VA 1NE4A 3B02A 2CGOA 2CNAA 4M3CA 2RS53 1H1AA 1RUG3 4XJUA 2Z5WA 3AYCA 1TNFA 2YYOA 5AVPA 5L7OB 2XKOA 2DCKA 1XU2A 5GZCA 2MEV2 1WBFA 2JD4A 1ASJ2 4BMEA 2PHLA 1ND3C 1XNKA 2WZR3 3CEWA 3KB5A 2W68A 3M3QA 4M3CB 3VHOA 5KHJA 4QPGA 4YW3A 3TN91 2ZAHA 3DV8A 1PK6A 4PDWA 3WDWA 4WM7C 3M70A 2WSUA 1EPWA 2WZPP 2R30A 5FOJB 1RUD1 1JHNA 4XOGA 2Y38A 4URTA 4DINB 2ATFA 1MZ5A 1GNHA 3QH6A 4YW2A 1PGW1 4QPGB 5FTTC 3RI8A 4HVRA 1H4GA 1QHDA 1PK6B 3S30A 1WCSA 1S0GA 2WNVA 2BVVA 3N35A 5H9RA 1S1AA 2K0GA 3D5OA 3ETQA 1BXHA 1TMF3 4U2AA 5CFCC 4LBNA 1UPIA 3AB0A 2ZHKA 4KG0A 4DMIA 1PGSA 2IXCA 1OI6A 2AR6A 3U07A 2WNVB 2Y26A 3I2DA 1CPMA 4OHZA 1B09A 1AL22 2VOWA 3KCXA 2GZWA 3ZN4A 3ZSJA 4AYUA 2CGPA 3IIAA 2PELA 4WVMB 4Q8LA 1V6KA 5L7OC 3M3EA 3WG2A 1RUF1 1VBD3 5FCCA 1AYN1 4YZ4A 3MEPA 2R042 1R1ZA 4QPYA 2ZMLA 5LRSA 1MVEA 1G6NA 3MW3A 2R1DA 3IT8A 4HMZA 4S2HA 4BIOA 1BEV3 1LRHA 2E53A 2TBVA 1EAH1 4Y22A 5CIRA 3N3HA 1I3HA 4AI3A 2ZGPA 2P2KA 4P9GA 5K7PA 2IXKA 5C4WA 1VBE3 3WDTA 4B8EA 1V6NA 4UW3A 3D82A 5JI7A 3WR0A 4QPGC 2H0BA 4I30A 1PK6C 1W6PA 1ZBE3 3KCCA 1W6OA 5EXOA 4D69A 2HWD2 2CY6A 4Y22B 2WS91 1EP0A 5CBLA 1GV9A 4AXOA 5C4WB 3KT7A 2CWSA 1NLSA 1S0JA 4IEWA 1H9WA 5CVRA 4OHXA 3VBRB 1LGBA 3B00A 1BVP1 1RUC1 1W6PB 3THTA 2WNVC 4R9CA 4FVVA 4RHV1 2R071 5EZWA 4QQPA 4Q8KA 3G7DA 2EXHA 2GN7A 3J26N 1H8TA 1Q56A 4ZU7A 1REFA 5HI0A 2AREA 4AGGA 2EXJA 4Z1VA 1KRIA 1SFYA 2BYVE 3ZFGA 3M8LA 1U5YA 3BOWA 1K5MB 1QJX1 1RUH3 2ZACA 3B5LB 3PJQA 1UCXA 2D3RA 5GALA 3VV1A 3HT2A 4L97A 4P14A 3AP6A 1H8TB 4Y1YA 1AX2A 4HANA 2YGMA 3OCPA 4Y24A 1CQ9A 4E27A 1DIWA 3AZWA 3WXPA 3JD72 3DUIA 1WLCA 4XFHA 4ONUA 2HWF2 3WP6A 4YM3A 1BEV2 4YM1A 1V6IA 1SCRA 1ZRFA 4BYYA 2IFRA 4M01A 1G9AA 3NV4A 5T5PA 3V64A 1QF3A 1ZZ7A 1R092 2XH6A 3TB0A 3PNAA 5HBAA 5D1IA 3NVCA 1C5HA 5E16A 4R9DA 4EJRA 3LA7A 1S0BA 2E7TA 3LOIA 4XFCA 2EAAA 3LZZA 2IXHA 4Y4YA 5C4WC 5FDBA 1R1A3 1UZYA 4YW4A 3VBRC 2DVFA 1HQNA 1OSGA 4XMIA 5GZEA 4GIQA 3VHNA 1YXWA 4P9WA 1X50A 4QQ2A 3GYDA 5IT6A 4BPZA 5BUVA 4COUA 4FXGB 4EWEA 3M3IA 3SCFA 4YFWA 3LA2A 1ASJ1 3U10A 5JMCA 4OUSA 1NQDA 1PGL2 2Y0OA 1U12A 4FPJA 2AUYA 1OKQA 3ZXDA 1K5MC 2ZGUA 1COV3 4E2GA 3AYAA 1C8M3 1H1MA 5FRAA 1XQNA 1VJ2A 5KXEA 1H8TC 3VKMA 2P17A 1YJLA 2PHFA 2ZCWA 2HJIA 3SH3A 4L9BA 2VH9A 3NO8A 2FZ1A 3ZO0B 1PVC1 1AR62 3GALA 2IXLA 1LU2A 3MIBA 4XF1A 2ZHNA 2NP0A 4XHXA 1Q8PA 1UD1A 2WLQA 4X8NA 4Z07A 5JOXA 1YHFA 3APBA 1WLWA 1TQ5A 1WW4A 2BGCA 1G9CA 3FFQA 1QXRA 3HWJA 1REEA 2B45X 2VULA 3JBG3 4DS0A 1LEDA 4FSJA 2GMEA 2WQ4A 2WFPA 2WLPA 4B4PA 5GZGA 1A8DA 1AL21 1DYPA 2RR12 3WT3A 4ZKTB 2O1QA 2G9FA 1R1A2 3ZXGA 1EY2A 3ILRA 1FMD3 1OA2A 1ZZ8A 3OJBA 3ZFFA 1I9RA 2RS51 2XB6C 4FPGA 1DGRA 1AXYA 2H0VA 4BIFA 5FMOL 1UMZA 2R041 4W6XA 2AENA 1DDLA 2VQ0A 3WP5A 4FAGA 3FE5A 4CDXB 3IDCB 1FNYA 3WDYA 1ULEA 3TOJA 2WZR1 1PO22 3IM0A 2D6NA 3ZYRA 2JX9A 4LE3A 4DRVA 1U5ZA 2XWBB 3BIWE 4GH4A 2GC3A 4JAAA 1COV2 2CWMA 5KC6A 1H4HA 1LEMA 5CADA 3LOBA 3QLQA 4LT5A 1BBT2 3VUOA 5ACA2 1D2QA 2R6QA 2RM22 3KZ4C 3OGGA 3BPZA 4OLLA 1ZVFA 1AX1A 3ZXEA 1BMV1 4LNVA 2EXKA 4GQ7A 2ZZJA 3OBTA 3HMYA 2VW0A 4GB32 4GH4B 1RUE3 2BWAA 5I93A 1WD3A 1MS1A 1IS4A 1O7FA 2ZGRA 4YG0A 1FOD2 1TMF1 2ES3A 4C1XA 5A3LA 2ZGNA 2XBO3 5B2GB 4Y1UA 2E7QA 2YC0A 2WNUA 3SMHA 4Q4V3 2DFBA 2GAUA 1ZRCA 4FOWA 3N7LA 1QJU2 2GC1A 2XJRA 2ZGSA 1WMEA 3ZXFA 2Q0AA 3CNAA 4C1WA 3KS7A 4XTMA 4RQPA 4M3CE 5KHIA 2CAUA 2DTYA 5I8SA 4E4SA 3N36A 4BCUA 2K2SA 1XU1A 3UK9A 4A2UA 1EV12 2WNUB 1VBD1 4DB5A 1UIJA 1NA1B 4CDXC 2XLGA 1F31A 3AXDA 4P5HA 1HXS2 4RQPB 4AW7A 3JD71 4AI8A 5DUUA 2HWF1 1BEV1 4XYXA 4FT8A 2HEWF 1D4M3 4YZ5A 5DUWA 3O5SA 5I8YA 1MZEA 5J09A 4Q2FA 4KGQA 1A78A 3HT1A 3DKWA 1ZBE1 1QQP3 1XE7A 4GH4C 5T52A 1YFWA 4YVWA 1CJDA 4RFT0 4UW4A 3FJSA 2HWB3 1VBA2 2JG8A 3RG0A 4MGKE 1DQ0A 3M3OA 4WVWA 4AI2A 2ZGQA 2XLAA 1GBGA 2VNRA 4FXKB 3H3UA 3POYA 2XBO2 4QPIB 4UBGA 4YVWB 2WT1A 1AF9A 1NY71 2O8OA 5GLVA 2FQPA 5KHGA 3BOPA 4YG6A 3TN93 3WW2A 3D0JA 1ZZ6A 4G9SB 3RI9A 2WNUC 3VKNA 5T3NA 1NA1C 1RUH1 3IKWA 1VB4A 5JOWA 4RQPC 4LE4A 1C1FA 1RC6A 2JICA 4XJ8A 4O9GA 4TLFA 2PAMA 4YGCA 4MYEA 3ME2A 1Q8QA 2E9QA 1H0BA 3WUDA 2ZGMA 1H9PA 1CONA 4UXAA 4XIOA 1AR83 2DVDA 3GHNA 5DZFA 4WVZA 2R0FA 4QU2A 1GZWA 4XJAA 4K3UA 1U5XA 1UKGA 4GXLA 1URXA 3VN4A 1RITA 4CDWA 2RR11 2ZX2A 3GBFA 1BKZA 3ZYJB 4D7TA 2ZKNA 1R1A1 1G9DA 3NSTA 3LB9A 4COWA 4D7SA 2NM1A 2HWC2 3N4MA 1H2MA 1JYIA 4I01A 4J6GA 1AJKA 3DGTA 5JIAA 4G4FA 3AZXA 4QPIC 1W6QA 2KM2A 1AYN3 2WNEA 4YVWC 5T5LA 4AEMA 2QQPA 4FTBA 1HRI2 1U0AA 1LJ7A 3ZPYA 2NMOA 4PIYA 3UL2A 1HQWA 4Q4X2 4KWKA 2XJUA 3MDPA 3CU7A 1NQJA 1V6MA 4COVA 5CU1A 2EF6A 2ZABA 4FPOB 3ZXLA 1JN2P 1W6QB 1COV1 3T1MA 2AH2A 2D43A 1BBT1 4UW6A 2D6MA 3H50A 2RM21 3H1WA 4I3GA 3SCGA 3PTYA 4GWNA 1XE8A 3AMMA 3NKTA 1QOSA 1YUDA 2QZ3A 3RYPA 3PLQA 1TME3 4GB31 1QH7A 2NLRA 1ULFA 4KBBA 4JGZA 4Q0PA 4YGEA 5FO9B 4Z92B 1O3QA 1YCIA 1Q8OA