4AWDA

Crystal structure of the beta-porphyranase bpgh16b (bacple_01689) from the human gut bacterium bacteroides plebeius
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
297
structure length
297
Chain Sequence
b'KEYSLAEEHIKNLPEAPEGYKWVVNEDYTDEFNGKRLNAAKWHAKSPYWTNGRPPATFKAENVSVKKGCLRIINTVLSPTEGLDGKPGDKYRLAGGAVASVKNQAHYGYYETRMKASLTTMSSTFWLSNRPVMKEIMKGGKKIKTWSSQELDIIETMGIIRSVNPDNPWNKTWNMQMNSNTHYWYQEQGGKRTDNTAKRSDVVSYMTDPSAEDFHTYGCWWVDANTVKFYYDGKYMYTIKPTTKYTDTPFDRPMFIHIVTETYDWEKQVPTAEDLKDKDKSTTYYDWVRAYKLVPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PORPHYRANASE
publication title Bacteria of the human gut microbiome catabolize red seaweed glycans with carbohydrate-active enzyme updates from extrinsic microbes.
pubmed doi rcsb
source organism Bacteroides plebeius
molecule tags Hydrolase
total genus 73
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4awdA00
1JUIA 1UX6A 1V6NA 1LU2A 1CONA 4U36A 1VLNA 4L8QA 3GNEA 1AJOA 2UWAA 5H9RA 2DVFA 2AENA 3WG4A 3WZ1A 1W6OB 3AZYA 3USUA 4FPEA 1S0CA 1DZQA 5FRAA 3DGTA 1DYPA 1S0FA 2JE9A 1CQ9A 1DQ0A 1ENSA 3IPVA 1HQLA 3B3QE 3FBYA 1GANA 2D3RA 2VH9A 1F9KA 5IT6A 3USUB 1UPSA 2ES3A 4XBNA 2GNBA 1D0HA 1MVEA 1YO8A 2NMOA 1JBCA 1RINA 4NOTA 4Y24A 1X50A 2EXKA 1H30A 2ZAAA 3IPVB 2ZMKA 1N47A 1SACA 2NP0A 3N36A 1SBFA 1FV3A 3SH3A 2E6VA 3VKMA 1N1TA 4DFSA 1DQ5A 4ITCA 1CN1A 3B01A 3AYEA 3OPZA 4BMEA 2YZ4A 3W59A 1JN2P 3AP7A 3M2MA 1C1FA 5T50A 3SH4A 5DZEA 2ZZJA 1LEDA 3BOPA 4YZ3A 3KQRA 4ASMB 3MPPG 4XOGA 5F9TA 3PVOA 2H0BA 4Y26A 1UMZA 5FREA 5GLUA 1UZYA 1MS1A 4LBJA 5T5PA 2VU9A 1LULA 4PBOA 3NV4A 3POWA 3AP4A 5DXDA 1CESA 4LBQA 2PELA 4XJ9A 1ULCA 2ZGSA 4HANA 3WDWA 1BYHA 1KJRA 2GMMA 4FOYA 2A6YA 2DVDA 3AJYA 5T5LA 3ZVXA 4BLIA 1JOJA 1LENA 2V5YA 1DQ6A 4PQ9A 4Y22A 4FPGA 1HLCA 3AFKA 4LBQB 3NV1A 4BQ1A 1QOSA 2A71A 5F5QA 1AX1A 1DQ2A 2YROA 2ZKNA 1UKGA 3ILNA 3R4SA 4AVVA 5CNAA 1IKQA 2DUQA 3OYWA 4Y22B 4YG3A 5EYYA 3WUCA 2NN8A 2DURA 3ENRA 2D6MA 1QDOA 5H9SA 1Y7BA 5H9PA 3AJZA 3WVJA 4LBNA 1GZ9A 2R1DA 3NV3A 3MW3A 4XMIA 4YW5A 1Q8OA 4Q8LA 5GLVA 3W58A 4LBQD 5EWSA 3WDTA 2EXJA 5CB7A 4ATEA 4ISQA 1DFQA 5HCBA 3OYWB 4XDQA 4YW1A 3N35A 1VALA 5DG2A 3SH5A 3WCSA 1W0PA 4ZKTB 3AYDA 4XBQA 1CIWA 4FP2A 3AP6A 3VKLA 5GALA 2Z42A 3AX4A 2TEPA 3UK9A 1V6KA 1IKPA 1J1TA 3UJOA 2P3JA 2DV9A 2WT1A 4YGDA 1YYNA 4GKXA 2D6KA 4C1WA 4YM3A 1ULGA 3WDYA 2WSVA 4AGVA 3WCRA 2PHUA 2RHPA 3WG2A 2YV8A 4AGRA 1S0EA 3D4KA 1UAIA 1WUVA 5DG1A 2VW1A 2GMEA 2PHFA 1ZM1A 3OGGA 1CJPA 4WVVA 2AH2A 5JOZA 4P9WA 4XTPA 4DPNA 2VY0A 3M3QA 1G9BA 1BZWA 1LESA 3KM5A 4XIOA 4XXAA 3T2TA 2E7QA 3N3HA 5DUXA 4Q26A 2D6PA 4K1ZA 4XE9A 2FMDA 5GJ6A 4PF5A 4XJAA 1SLAA 4Y1UA 4DQAA 1MS8A 2WNEA 2CTVA 1LGNA 4WZFA 2LTNA 1WW4A 4MYEA 3WDVA 3ILRA 4UW3A 4YG0A 5AVAA 2NMNA 1BKZA 1QF3A 1SLIA 1GZWB 1QKQA 4FQZA 3I8TA 5GM0A 1IOAA 3VKNA 1OFSA 1DHKB 2WKKA 5E88A 1SFYA 3O0VA 1LGBA 1S0GA 2EXHA 1AJKA 1LHUA 1RIRA 2AYHA 5SV8A 1C4RA 3CNAA 4YM1A 2WJSA 1FAYA 1MS0A 4DS0A 1LHNA 1HDKA 3HR9A 4JCKA 4XHBA 2P34A 2JECA 4XBLA 4C1XA 1QU0A 4Z8BA 2YMZA 5IK8A 1Q56A 3TB0A 1ULFA 2WT2A 5BYNA 3APBA 1AXZA 1LOCA 1MS3A 2OUHA 3MW2A 4XILA 5JLVA 3V0BA 4F83A 1FYUA 1W6QA 1S0IA 1SLCA 3U4XA 1IS6A 1N1YA 4PCRA 4Q2FA 4YW2A 1AX0A 4NO4A 1WD4A 1YRZA 5T5JA 4W65A 2C9AA 2VW2A 3V0AA 2GMPA 1V6OA 1CVNA 1WCSA 4FVVA 3OY8A 2VW0A 2ZHKA 3FFZA 3V0BB 4HL0A 1GLHA 1Q8VA 1W6MA 4FOQA 1LHWA 5KXEA 1TEIA 1G9DA 1KRIA 3WOGA 1W6QB 4K20A 1H9WA 2Q5TA 4XHXA 5EYXA 4OZXA 4YZ5A 2A6ZA 2EF6A 1CPMA 5IK7A 1N1VA 2PHRA 2YXSA 3FUQA 3V0AB 3LSDA 3L2YA 1GNZA 2EXIA 3OY8B 4K21A 4M3CF 2WSUA 1QOOA 4K1YA 1W6MB 2I2SA 2ZGPA 2UU8A 2CNAA 3V64A 3VUOA 1V6MA 2VXRA 1LOFA 3ATGA 1O4ZA 2ZHMA 4R9BA 4TZDA 1XQNA 3T1MA 3LSEA 1LEMA 2OW4A 2GNMA 1FATA 2A6VA 3A4UA 4Y1ZA 1WW6A 2E53A 1DBNA 3RSJA 1AXYA 1SBEA 1V00A 1W6PA 1RITA 1DLLA 2AR6A 4LBKA 2D6NA 2WT0A 2ZGNA 3LCPA 1LTEA 3ZPYA 1AVBA 1YI7A 1O4YA 1F5FA 4LBLA 2CWMA 4BM8A 2D43A 3AYAA 3MEPA 1G9FA 3POSA 3RMXA 2P37A 3V65A 1W6PB 4RL7A 4XJ8A 1UZZA 2SBAA 2ZGOA 4U2AA 4YGCA 1WW7A 4YM0A 1DGLA 1IS5A 1Z0HA 5JVVA 4Q1RA 2C5DA 4XYXA 3WNXA 4M3CA 2R0FA 3SISA 1PZ7A 1SLTA 1BQPA 5JOXA 2WQZC 4GA9A 2GNTA 4XXPA 5DUVA 4UW4A 3UL2A 3ILFA 5KXBA 1JXNA 2ZGRA 1V6JA 2GDFA 1LOAA 2D3SA 1Q8PA 3AK0A 3BODA 1LGCA 1MVQA 3SLIA 5T52A 2ZGLA 2ZGMA 4GKYA 2ZGKA 3B00A 2ZA9A 1IS3A 4AVSA 3WUDA 1EPWA 1DYKA 3B9CA 1N1SA 2ZMNA 3RG0A 1JYIA 2R49A 2CWSA 4YFWA 1PZ8A 1N3QA 4XMAA 1V6IA 5T5OA 1AF9A 1FV2A 4BLJA 1GKBA 1DIWA 3IM0A 1UN1A 1H9PA 3RS6A 1AXKA 5H9QA 3N7KA 3O0WA 2EAKA 2A75A 1ZA4A 2D44A 3IN9A 4Y20A 4YW4A 3O12A 4IQPA 2LALA 1ENRA 1GBGA 1S0BA 5HCAA 1LU1A 2DYCA 1LCLA 1S1AA 4YW3A 3RQ0A 5CAZA 1JYCA 2V73A 3M3EA 4Q1PA 5IUQA 4FOVA 3SNMA 5JDBA 1QOTA 4FOWA 3POYA 3FLTA 4PBPA 3R05A 4Y20B 5GZEA 2A6XA 5GZGA 3O5SA 3ZYPA 3B69A 1KDMA 3WDXA 1OQ1A 2ZHLA 1WBLA 4LBMA 1C57A 1KJLA 1WD3A 4P9YA 4XJUA 3M3OA 5L73A 2DU1A 2UWBA 3BIWE 3NWKA 4AGGA 2ERFA 5T54A 3NV2A 2AREA 2CL2A 5KXDA 5IK4A 4YM2A 2DVBA 3N7LA 4I30A 1IS4A 3ZXJA 4XZPA 3RRDA 5DZGA 1BXHA 1MZ5A 3T1LA 1VAVA 1LOGA 2DWRA 2ENRA 2R1BA 1SLLA 4Y1VA 1SCSA 3AZZA 4FP3A 1I3HA 3PVEA 2ZGQA 1A78A 1N3OA 1LOEA 2D6LX 3WDUA 1UL9A 2EALA 1N3PA 5E89A 1MACA 1U0AA 2ARXA 1A8DA 1R1ZA 2UWCA 2OVUA 4XIKA 1LJ7A 4SLIA 3VKFC 2ZGTA 2ZACA 2EIGA 3AZVA 2JE7A 1WLDA 1WW5A 1WLWA 3M1HA 2W08A 1F31A 1Q8SA 4TYSA 3PJQA 4YFZA 4JRAA 5GLZA 4CRQA 2PHWA 4YZ2A 4FQ4A 5EXOA 2DTWA 1JW6A 1WLCA 2DVGA 2A3XA 1Z78A 3AP5A 2BQPA 4Q27A 2HYKA 4AYUA 4BOWA 5CBLA 2SLIA 2ZGUA 4FPHA 4R9AA 3WG3A 1ULEA 3R4UA 1QNYA 3UJQA 4CZSA 4M01A 5IK5A 1G9CA 3WHTA 1MS9A 2KM2A 2CY6A 1JHNA 2E7TA 4DRVA 1CPNA 2JJ6A 1G8WA 2DTYA 4BMBA 3WHUA 1BJQA 2A7AA 3AYCA 4D69A 3M3CA 1I1EA 4XJZA 3HMYA 3O0XA 4Y1YA 1FX5A 1ENQA 1YXWA 3AP9A 4YGEA 5GLTA 1PZ9A 4YZ4A 1SBDA 5DZFA 1QMJA 2DVAA 4H55A 3ZYRA 4P9XA 3ZSMA 3ZSJA 2XB6C 1MR5A 1MS5A 4AWDA 1D2SA 1QGLA 1GNHA 3AZWA 3D6EA 3WV6A 5JOYA 5LK5A 3MW4A 3ZXFA 2D7FA 1DQ1A 4YLZA 2NM1A 3D5OA 5GZDA 3FLRA 3OBTA 2E51A 4AVTA 2VUAA 1YIFA 4ATFA 1VAMA 4UW5A 1LECA 2P2KA 4XTMA 1SCRA 1AX2A 1DQ4A 2WLQA 3PVNA 1LOBA 3VKOA 1VIWB 1B09A 3QLQA 2PHXA 1AZDA 4FPFA 3HN1A 2ZBJA 1MZ6A 2P3IA 4Y1XA 2GALA 2A6WA 4FPKA 1QDCA 2W39A 3DUIA 2W52A 4DRRA 2GN7A 3VV1A 2R0HA 2XG3A 1LODA 1S0JA 4LBOA 1GICA 2GN3A 3Q9OA 1ULDA 2A3WA 2D3PA 1V6LA 1W0OA 4M3CB 3GALA 4YZ1A 2UURA 1LHOA 1SLBA 4XJWA 2OUJA 4FPLA 1CR7A 2A5ZA 3FLPA 4FPOB 4YGBA 4Q8KA 2JDZA 3ASIA 5JOWA 2G4IA 4WV8A 1LOFC 3OJBA 4FPYA 3AZXA 1GYKA 3INAA 3BTAA 1MS4A 2D6OX 5DUWA 4GALA 3OBRA 1G7YA 1FNYA 2AGSA 2P3KA 3QCWA 4JC1A 2JKBA 3IKWA 4R9DA 5DUUA 3JU9A 3JUUA 3RMYA 4BPZA 1NXD1 3ZSLA 1KITA 4GWNA 1GZCA 3A0NA 4P14A 1GV9A 2YY1A 1ONAA 2PHTA 5GZFA 3N7MA 3AXEA 2DUPA 4GWMA 5JMCA 3N7JA 1A3KA 5T55A 1G9AA 3FUOA 5GZCA 1APNA 2CYFA 3ZXEA 4M3CE 3AXDA 1HKDA 4CTEA 1NLSA 3WG1A 3WLUA 3A0KA 4UW6A 5GLWA 3ZXKA 2ZABA 1HQWA 1C1LA 4WVWA 4GXLA 5KXCA 2B7YA 1G86A 2ZHNA 3ZSKA 1OKQA 2A70A 1W6NA 3H0OA 3IMNA 2GNDA 4FPCA 1FNZA 2ZMLA 4ZXKA 2NZ9A 2AUYA 2R16A 4R9CA 2JD4A 2NYYA 3I4IA 4YG6A 4M00A 4RA0A 1LHVA 4KBBA 2A3YA 1GZWA 1S0DA 1W6NB 4ISRA 4FPJA 3PMEA 2ARBA 5E8AA 3SITA 3ZXLA 1Q8QA 1QNWA 3TAYA 1GSLA 2FHRA 1WBFA 5CA6A 2DUOA 3C2UA 1W6OA 1KDKA 2W68A 5HCFA 1KQRA 2DU0A 1URXA
chains in the Genus database with same CATH superfamily
3E5XA 4OHXA 4DUWA 4AI1A 4MOAA 2B46X 4L2NA 5A80A 3WF1A 3WG4A 3BB6A 5D1IA 1W6OB 5K0UA 5LEKA 2RG4A 3O1SA 3HNMA 1WMFA 2K46A 2JE9A 3AMHA 4YSFA 5FTTC 5C5UA 1UYZA 4OMCA 4NN0A 2WQ4A 3DECA 3IPVA 2HEYF 4C0HA 1W2TA 3VHNA 2VH9A 2NPIA 4MGQA 2V09A 3USUB 1JYXA 5FZ6A 4XBNA 1YFYA 1CAUA 4O65A 4Q4Y3 3KF3A 1JBCA 1RINA 2W1UA 3SCGA 2ZAAA 5LWBA 4FTEA 2J1VA 3DPRB 3NAPA 2YB7A 5J96B 1RUC2 2D5HA 4AG4A 4CCJA 1WKYA 3I2GA 2A73B 4DFSA 4RFT0 3B01A 4BMEA 4LE4A 3I2IA 2YZ4A 5BPXA 3W59A 2E32A 4C90A 1JN2P 4F3JA 1C1FA 4V2WA 4HVQA 5DZEA 2ZZJA 1YLLA 1HB3A 3GZEA 3KQRA 4Y5SA 4ASMB 4DO0A 2LM3A 3PVOA 3DCQA 3VZLA 3ZYJB 3ZN4A 1UZYA 1MS1A 2WO2A 4NPLA 4D7SA 5T5PA 2R071 3K75B 1H4HA 1LULA 1XE8A 2R7EB 1XRUA 1FPN2 3ZN6A 3NV4A 4IDZA 1XNKA 3PVBB 4RS5C 5FLJA 2VUDA 5IJRA 5C5TA 4ZU7A 4XZUG 3WDWA 2PELA 2ZGSA 1UD1A 4J25A 1DZTA 2RS12 1YI9A 2VG9A 3LFMA 4M0HA 1T6BX 2EICA 4FOYA 4HOOA 2ZCWA 4I0WB 3CIHA 1LENA 2V5YA 5F3IA 3AFKA 5D8AA 1WA6X 1HJGA 2V72A 5C7GA 4FTSA 3ZFFC 1QOSA 3NJXA 1V0AA 1J83A 2OKXA 2YU1A 3WNOA 3BPZA 1AX1A 2V5DA 1XE0A 1COV3 1RUI2 1UYXA 2ZEZA 3KWVA 4AVVA 5CNAA 5EYYA 4L97A 1VBD3 4JKMA 4RR3B 3MLJA 1Y7BA 3N9QA 3AJZA 1SMVA 5H9PA 5JSRA 3H42B 5C3PA 1ND2B 5GLVA 4DXSA 3WDTA 4Q4X2 3CU7A 1DFQA 2W91A 3H3ZA 1EYBA 3OYWB 4NJ4A 5FYUA 3LOBA 4NIGA 2RR12 4YW1A 1XU1A 2BOJA 5E16A 2GH2A 4XBQA 5FZFA 4ZKTB 3MDPA 5L9BA 1UMIA 1OFNA 1PO23 2QTWB 5L9RA 2G9ZA 3AX4A 2TEPA 3ME2A 4PHZA 4ZU5A 4A7KA 2WRAA 2UY9A 1YYNA 3SEPA 1QXRA 3TRSB 4FXGB 4PDWB 4IEPA 3AVSA 2GC0A 3OEAA 3WCRA 1PVC1 1U5IA 2ADDA 4L0PA 1VB4A 4E8CA 4FFGA 3WG2A 1GWMA 4PIXA 1H4GA 5I0TA 2AC1A 2B8MA 4B7EA 3HEIA 1UAIA 1CX4A 4NAMA 4HPKA 5EZWA 1UKRA 3TN91 5J09A 3PU8A 2Y6KA 1AYM1 5EFUA 5C4WC 2QQLA 4NPMA 1Q43A 2PN5A 3MUZ1 4WVMA 2OA2A 2YHJA 1W8ZA 4PF5A 1SLAA 4Y1UA 1MS8A 2JG9C 2MEV3 2YDEA 1HW5A 5A3LA 2CTVA 4CEWA 2LTNA 3ILRA 1SFNA 4GZ9A 2F4LA 3BTYA 4NIDA 5KWRA 3LZZA 1QF3A 3ZXGA 5C3SA 1SLIA 5GM0A 3S5AA 1IOAA 3VKNA 1OFSA 1IG0A 2C24A 2VVDA 4CYDA 4AVCA 4XPVA 3O0VA 4CDQB 2EXHA 1LHUA 1RIRA 1HQNA 2AYHA 2IXHA 5SV8A 2ARCA 1XNAA 4YM1A 1O3SA 1RUE1 1MS0A 4GH4C 2Y26A 3CQOA 3ZFEA 4B8EA 1O7FA 4I09A 4JCKA 4DEQA 3VBFB 5JSOA 2GAUA 1IPSA 3THTA 3TB0A 4KI5M 3APBA 1FMD2 1BVP1 1UIKA 3MW2A 1LOCA 4CCKA 2OUHA 3ITQA 1D2QA 4FFFA 4XVHA 3VDAA 1FYUA 1S0IA 5CKQA 1S2BA 2VZRA 4IGOA 1IS6A 1N1YA 3DKWA 5HXMA 5T5JA 1NAEA 1FOD1 2C9AA 2VW2A 1WGPA 3V0AA 4FVVA 1V6OA 4QXHA 3OY8A 5J3UA 2VW0A 1GWKA 4HL0A 1B35B 1W6MA 4GMP1 1LRHA 2HWC2 1W6QB 5JZGB 1H9WA 5FXZA 4YZ5A 1CAVA 2A6ZA 3OGVA 1REDA 5IW0A 5JXGA 4QD2A 1AR62 1F4AA 1R64A 2QDRA 1OURA 3I3EA 3AL6A 4MZUA 1QOOA 5F32A 2FDGA 1ZBA3 3THCA 1WCDJ 2QQIA 1SG3A 3VBRB 1QXPA 2VBDA 4QPGB 1V6MA 2OQ7A 3ATGA 4R9BA 2VBPA 5EHDA 2VVEA 1VRBA 4FTBA 4BQ2A 3OG2A 4RGAA 2HWD3 1QJY2 2H6BA 3NMBA 1PIV1 4UF0B 3VDDB 1OUSA 2A6VA 2WNVB 2JDYA 2WINB 4KU7A 5FLHA 1DBNA 5FZEA 1HJFA 3T3YA 1AXYA 2O1QA 1W6PA 4NRPA 1RITA 4YPJA 3OTFA 1EUUA 1JTZX 1DCSA 3PDQA 4LBKA 3TEZA 4OHVA 2WT0A 2ZGNA 2P17A 4XACA 1O4YA 1F5FA 1YJKA 2HKXA 3RFRA 4BM8A 4OZOA 3MEPA 3RMXA 3PUQA 2P37A 3V65A 2VM9A 1W04A 4XJ8A 4EN7B 2GC3A 5HI0A 2ZGOA 3URFA 1QJX2 1MEC1 3IBMA 4CCCA 1PHMA 4Q1RA 4XYXA 5C9AB 1IGOA 2RDNA 3WNXA 1W39A 3VZJA 5A6QA 1ND3A 2IWGB 2K2SA 1L7RA 1NE4A 1PMIA 1BQPA 4XCBA 2VGDA 1O3TA 1POV1 3AKRA 1H1MA 3M8LA 4GA9A 1C5IA 4XXPA 5SV5A 4UW4A 2GC2A 4BK5A 1H8TA 5KXBA 2BERA 2WS93 4ZZ8A 3IAPA 4I0AA 2ATFA 1QJEA 2WC2A 4EYUA 5K8SA 3AK0A 3OGSA 4A42A 2DF7A 4WM8C 4BJ0A 4KMQA 5T52A 4GKYA 4DOUA 4DZGA 5HBAA 5BV6A 3TOJA 3NSTA 1NXMA 1UU5A 4AVSA 1EPWA 2B39A 3B9CA 1O5LA 5DAPA 1NCRB 4ASLA 3FBMA 2XHNA 3H9AA 3JCIA 4KNCA 4BH9A 3BUCA 1GP4A 1PZ8A 1RVF3 1TE1B 1Y9QA 4XMAA 1V6IA 5ACA1 4AFAA 3CEWA 4BLJA 2BEOA 3IM0A 3RS6A 2BWAA 5JI9A 1GMMA 2UY8A 5H9QA 2XJVA 3O0WA 4MLOA 2A75A 3IN9A 4KG8A 4IE7A 4B1MA 4URTA 2JICA 4XAEA 4YW6A 4AHZA 3O12A 3ST7A 5A7OA 4MXWB 1GBGA 5JSPA 4NIHA 4LO8A 1BMV1 1S1AA 4OQ9A 3AKQA 3E97A 5FY7A 1XPWA 5IUQA 5A7QA 5JDBA 2BFUS 5D8AC 4CCNA 1WZXA 5C6CA 5IAXA 4PBPA 3N9LA 4WM7A 5FZGA 2FMYA 1Y4WA 3ZYPA 1UNBA 5ABJC 5CZKA 4LBMA 3SH5A 4XJUA 2PHDA 2VXJA 2RM21 2UWBA 3NWKA 3MIHA 2ERFA 1XNDA 3NV2A 4HKLA 1NG0A 2AREA 5CEHA 3X29B 3ABZA 1ZZ9A 4I30A 3KV5A 4IV3C 1PX4A 3RRDA 1RUJ1 1MZ5A 2J42A 2P4EA 2VMFA 2Y34A 3VKFC 4AR2A 1KFXL 4FP3A 1JZ5A 2LRPA 3VDBA 2ZGQA 2PQSA 5G04L 4B4RA 1N3PA 1OBNA 2PTMA 4Z07A 3KCXA 1U0AA 5FY9A 3KZ4C 4Q4Y2 5C33A 1LJ7A 1J84A 4Q4W1 3MF6A 4XUOA 3T2OA 2ZGTA 2JDMA 1REEA 1ZRIA 2JE7A 2W92A 2ZACA 3GYDA 3PLQA 4C0BA 2QDNA 4JQRA 3N9MA 5A6YA 5L9VA 3BKZA 3IIAA 2C26A 1JZ6A 3M1HA 1C5HA 1PGSA 2WNUB 3LDRA 4TYSA 1PM7A 5BNPB 4JRAA 4D6RA 3I3BA 4FQ4A 2JB8A 4YVSA 3UETA 5EXOA 1WLCA 3NO8A 2FDIA 4I02A 3R6SA 3LWCA 3CHXA 4SBVA 4KGGA 2JDAA 4JKLA 2ZX0A 3DYPA 1J1LA 5LY2A 2WFPA 2SLIA 2XWBB 3ACGA 3Q8BA 4JGYA 2VCCA 3TNPB 4CEWC 5IVFA 3OEBA 1MS9A 1UIJA 1JHNA 2E7TA 1FT9A 1VMJA 2JJ6A 4RN5A 4HVRA 3CZUA 4KWUA 1HRI1 4BMBA 1AL0G 3P3NA 4KL1A 3PL0A 3T0AA 2JIGA 1VP6A 2OIIA 4BE3A 1ENQA 5IFPA 3LEMA 4LKEA 2WZR3 4R52A 1D4VB 3TYJA 4UXAA 3T4HB 2HBTA 3ZSMA 3O14A 3ZSJA 2XJUA 3ZFEC 2R041 1GNHA 5A3PA 3WV6A 5FQ0B 2QQOA 5LK5A 1DQ1A 4HVOA 2NM1A 5FY8A 2W94A 3E5QA 3OBTA 4CPBD 2VUAA 4CXXA 1XOYA 5CKMA 2YG0A 1COV2 1DP0A 1JZ8A 1VAMA 1LECA 4XTMA 4JV4A 1WMDA 1RHI1 5JPNB 1AX2A 2X5IC 1VBD2 2VUJA 3VKOA 2WBKA 4TSVA 1SPPB 1BK0A 1AZDA 1CGPA 1R081 2FCTA 1W0NA 3HN1A 2ZBJA 3LGRA 1MZ6A 3I2OA 5A7SA 2PQQA 2A6WA 4BHPA 4FPKA 1LR5A 5F2SA 4XQWA 4X8NA 4GWIA 5F5IA 2R0HA 1O5UA 3SC7X 3Q9OA 2Q1MA 3G6JB 2YYOA 3J4UH 1UY0A 2Y0OA 2RDSA 3HNYM 2IXKA 1PO22 5FPAA 5FZHA 3WXPA 1CD3G 3WNMA 4CXWA 2XHKA 4RR3A 5IHRA 4FPLA 1CR7A 2A5ZA 4TN7A 1UXXX 4YGBA 2JX9A 2JDZA 2HWE3 3JBG3 5FXWA 2G4IA 4Q8KA 2EIDA 4FPYA 1QQP1 3RGBA 3U14A 5FJHA 3OUJA 2FCUA 3KS7A 4E4ZA 1MS4A 3OBRA 1KS5A 2ZJCA 5DUUA 3WW2A 4NVPA 1OC1A 5A33B 1C28A 2Y60A 1O91A 4LUMA 3GDBA 4GWNA 3A0NA 3NVCA 4IEYA 4LA3A 1ZBE1 1GV9A 2YY1A 3VD4A 5ANNA 2WO7A 2ZEWA 5FXVA 1BLZA 3N7MA 3WW3A 3AL5A 2DUPA 2QQJA 3IWZA 1SQ4A 4GWMA 4EZ4A 5JMCA 4HSLA 3FUOA 1APNA 1OF3A 4D0QA 2MEV2 2CV6A 3HT2A 3AXDA 3OD0A 2XJRA 3J8F1 5FJKA 4CTEA 1UU6A 1NCQA 1RMU3 1NLSA 3HQUA 3KMHA 4AVAA 4B4QA 2HEVF 4S2HA 1E5HA 5A6XA 3KQ4B 3Q8CA 4KQ7A 2FZ1A 2E9QA 4YWAA 3VBSA 3NNMA 4BQ4A 4GXLA 4BYYA 2B7YA 2OZ6A 1ND3C 3IMNA 4N7UA 3IMMA 3POIA 3T4VA 2BRTA 1NA1B 1US3A 2WA3A 3SCFA 1H8TC 1JI6A 1OA4A 4RHV1 5I0DA 2R32A 1W6NB 4AQTA 2VAUA 3HAGA 2ARBA 4DUXA 3SITA 3CL1A 4RSUA 1QNWA 2WN3A 2ZPXA 5KC6A 3CZJA 1CAXB 4KWJA 5FZ7A 4QXCA 3CKHA 3AMQA 1WBFA 1A8MA 4Q4V1 4MUVA 1EAH1 1AR73 4FT8A 2RS31 2WFF3 1OPMA 3VBOA 4CE8A 1JUIA 2G9FA 4ARXA 2FDKA 3FMGA 3OBZA 3WNLA 4CA9A 5I0RA 3GNEA 1R1A1 1C8M3 5FXXA 2OX0A 2DVFA 2AENA 3WZ1A 4BZ4A 2HJIA 4Y5Z0 3Q8FA 2L9LA 4FPEA 2ZXQA 1DZQA 4QGMA 4DXTA 1ZBA2 3DGTA 5FWEA 2QJVA 4YARA 3D82A 2R061 5IVJA 3U0ZA 4IUGA 4EQVA 5CIRA 5A7NA 2P6CA 1RUOA 1IPKA 3G7DA 2HWD2 1S2EA 3E6DA 3OUHA 4P02B 1F9KA 4NRMA 5IT6A 2VECA 3VBHA 5A3NA 2Z79A 1MVEA 1YO8A 2AEYA 1WLTA 3HBKA 3RZLA 4R8HA 4XUQA 1YNAA 1RXGA 2CGNA 2D97A 1GQHA 2EXKA 3S30A 3ZDSA 5IWFA 1VRH3 1SFPA 1SACA 2BWCA 1DGRN 1Z7S3 3N36A 4W6YA 1FV3A 4CDUB 3ECQA 2E33A 3SH3A 3RZMA 4LULA 4ITCA 1GP5A 3LPFA 5FPXA 5CKNA 3CDZB 1Y3TA 3O7OA 4R4ZA 4AI9A 4BQXA 2WO1A 2WZEA 5JXJA 2BP6A 2WNOA 4QB6A 4AQ6A 2H0BA 4XABA 4LE3A 4BQWA 4QDRA 5GLUA 5FYCA 4CVUA 4LBJA 4LA2A 3DYMA 2IXLA 3LDBA 1VBB3 2ADEA 2BBVA 1XNBA 4CP0A 3BTXA 4OHZA 1GU3A 4PBOA 2PHLA 3JB8A 3VBUB 3SKJE 2QQKA 2XQRA 2ZX3A 4CEYB 1AUYA 3NRUA 4WZCA 1W8FA 1U5XA 2Y6HA 4YVSC 4COZA 5DXDA 5BUVA 2WS92 1CESA 4LBQA 4CXYA 4UFHA 5LBEA 4A6OA 1UY4A 4HBNA 4AZZA 3ZVXA 4BLIA 3AJYA 5FDBA 4C91A 1U5YA 5FY4A 5LW9A 3KT1A 5BNOA 4Y22A 4UAPA 1GOHA 3I49A 4LKSA 4JGYC 2VOTA 4COVA 2B9VA 3KF5A 1RUD3 2HYXA 2VR4A 4OI2A 5F5QA 1RVF2 4IE0A 4OMDA 1QJU1 2ZKNA 1AR83 3ILNA 3I2JA 3R4SA 3WR0A 3C7EA 2RS51 3GCXA 1PO13 4HONA 4YG3A 2NN8A 3A23A 2Q1ZB 5DAWA 1R093 3P3PA 4LBNA 3NV3A 1CJDA 1HXS1 1UXZA 4XMIA 1Q8OA 3W58A 1W9SA 4LBQD 3UGFA 5CB7A 4ISQA 1S2KA 1VBA1 2G9GA 5DG2A 4ZPIA 3AYDA 2Q4SA 1CIWA 1XNCA 4FP2A 4COWA 4D8MA 4FCAA 1PK6B 1V6KA 3H8RA 1BBT3 2P3JA 4P9LA 3T30A 4UFJA 5DAXA 2WT1A 4EZHA 2F6BA 4HK9A 3KLSA 3GM8A 3EB7A 4C1WA 1ULGA 5FP7A 3WDYA 5C3RA 1AR93 1OVSA 1VJ2A 1X8EA 1S0EA 3PUHA 3D4KA 3WNNA 3MIDA 4IV1B 1YFWA 3L2HA 1CJPA 3D3AA 2AH2A 4WVVA 3RZZA 1JZ3A 1ZRCA 4GB31 3KCCA 4ZONA 2BJSA 4OVEA 4XQDA 1RUG3 1W3VA 3N4MA 1LESA 5CFCA 3RVHA 1QH7A 3C7GA 5DUXA 4Q26A 2D6PA 3MV11 4N53B 1RUF1 2WZ8A 4DY3A 4DQAA 5BNNB 3BU0A 2GP5A 4BISA 4I01A 1WW4A 3CBNA 4FI9A 3WDVA 3MBWA 5AC91 5AVAA 1BKZA 4AEMA 1NKGA 4FO9A 1GZWB 3M70A 4FQZA 1YWKA 5IATA 4RQPA 5E88A 2BTVC 1SFYA 1ULOA 2OT7A 1AJKA 1PM4A 2YBPA 4S2FA 3U75A 1I5ZA 2BW8A 2WA4A 4HK8A 4XUTA 3OUIA 4UFLA 1LHNA 4DS0A 4DMIA 2JECA 4XBLA 1UF2C 1NT0A 1Q56A 1JOBA 5BYNA 1XJAA 1NCQC 3VD3A 5JLVA 2Y0IA 2Z4FA 1RUH3 2O8QA 3U4XA 3ACLA 3VBSC 4PCRA 4AW7A 4ONUA 1E5SA 4P5YA 1AX0A 5FPBA 4W65A 2WZR2 4AI0A 4YVWA 1Y9GA 1CVNA 4JGZB 3E1F1 1K12A 5F3GA 4N7IA 2ZHKA 3ZFGA 3V0BB 1CAWA 1I5PA 2NQYA 1G9DA 3S0MA 4E2SA 4K40A 3WOGA 2KD7A 1UQXA 2XVKA 5GKAC 4CDXB 1VPHA 4FSJA 3FHQA 3AFGA 4OZXA 2G19A 1KGYA 1RJ8A 2EF6A 1CPMA 2VULA 1N1VA 1ZX5A 3KVAA 2YXSA 2X09A 5IK7A 3L2YA 1GNZA 2EXIA 1WWYA 4M3CF 4D6SA 2Q0AA 2WSUA 4HXCA 4K1YA 1I9RA 4A45A 4AVBA 1H2MA 2ZGPA 2IXJA 4JTOA 5C8CB 2CNAA 1J3RA 1HRV1 4LK7A 3K4AA 3AB0A 2ZHMA 4GQ7A 2B45X 3UYJA 3W9AA 3UNPA 3KHBA 2VNRA 1DGWA 5EQUA 5LBCA 2IVJA 4MSVA 1GP6A 1AYN1 4RD7A 1LEMA 3VBOC 1OOPA 2DCTA 4QMAA 4PI2A 5A1FA 1ALYA 3GJBA 5L19A 2LS6A 1IHMA 2HLEA 2E53A 2XBO3 3SKVA 1DLLA 2AR6A 5AFEA 4CUGA 2D6NA 4QPYA 1RJ7A 1NUKA 1LTEA 2RMU3 3LCPA 3ZPYA 4LT5A 1YI7A 1CZSA 4QPIB 1C3HA 3KSCA 1DG6A 3QH6A 3JBG2 2HWE2 3POSA 4AI8A 1PNFA 1E5RA 1W06A 1M4WA 5LEJA 4WBBA 3VBHC 1K5JA 2YPDA 3LA7A 5FLIA 2VZSA 3CJIA 2J1SA 4IL7A 4P9JA 4A7YA 1PZ7A 2QQMA 1SLTA 5LA2A 4QB2A 3BGAA 2VMEA 3UL2A 3WP4A 4YNIA 2Q8OA 1PGL2 3ILFA 2ETEA 1JXNA 2GH8A 4MGSA 2JIJA 1ZREA 5FYYA 4EV0A 1RMU2 2D3SA 1Q8PA 4E4HA 5CFDB 3BODA 5A33A 4ES8A 1LGCA 2ZGLA 2CGOA 4AEDB 4XETA 1K5MA 5FMCA 1IS3A 2VOVA 3K48A 4LMFA 1UOGA 1DYKA 1TNRA 2O8OA 2PLV3 2WN2A 4CSWA 3J7LA 2R49A 4YFWA 1RUC1 4AI3A 4BDVB 3NQHA 2VTXJ 2QZ2A 1X36A 5L7OB 1EV13 2AEZA 2XDVA 4PLNA 4DIQA 3BALA 1V9U3 4JHTA 4LOTA 3BYWA 4KBZA 4YW4A 3KCYA 4IQPA 1NLRA 1ENRA 1UOJA 1T6GC 1HIXA 2BU9A 1S0BA 5HCAA 1C8NA 3HQXA 4YW3A 1EUTA 5BNOC 3N9OA 4QX8A 5JR7B 4BIOA 3RWNA 4Z82A 3DEMA 1BHGA 3FLTA 4Y20B 4A41A 5GZEA 1AR72 4K8RB 5F37A 5GZGA 1TME3 1FPN1 2WFF2 3MHZA 5LCWL 4QDSA 1JODA 3WDXA 1OQ1A 4B4PA 1WBLA 4P9YA 1KJLA 1QEXA 5JAXA 5L73A 4QHOA 3GGLA 5LA9A 5T54A 2IZWA 1EPZA 4YRDA 2CL2A 2RS11 1HB1A 1C8M2 4YM2A 5KXDA 1RUNA 2DCYA 1CAXA 1TMF3 3PNAA 3WINE 4MG2A 3KD4A 4HKWA 4KH9A 3O1OA 4XFIA 3WNKA 1LAJA 1XSRA 2DWRA 5F3EA 4IE6A 3T0DA 4JAAA 4Y1VA 1SCSA 3T0BA 1I3HA 3SQOA 1A78A 1LOEA 4G4FA 1VBE3 1UL9A 2EALA 2VUCA 3ZIWA 3ON7A 2X10A 2Y64A 1RUI1 3ZOIA 1A8DA 2E7AA 1OI6A 4ZXEA 2HWF3 2UWCA 3SHRA 4DXZA 4URAA 3IDEA 1UCXA 2HWB1 1NQJA 2EIGA 4UBGA 4Q0UA 4D3WA 5FR3A 1VRH2 1WLWA 1XE7A 3C3VA 1F5JA 5D21A 1M06G 1Z7S2 2W08A 1Q8SA 4YFZA 4YZ2A 4Q4X1 4XF9A 1O59A 2DTWA 2RR11 4N9HA 5AVPA 2QE3A 4K6BA 4XF0A 4Y4RA 2VZOA 2DVGA 2A3XA 2H0VA 2MNGA 4J1XA 4QDQA 5CFCC 4RS5B 3UT0A 4AYUA 5CBLA 1HB4A 1XXNA 5DAQA 1OKOA 4I0BA 5IAVA 1QNYA 4CZSA 2K9ZA 4CDUA 5IK5A 1VBB2 3ZR6A 5J48A 2CY6A 3H1MA 3K3OA 4ZHNA 2DTYA 3RJRA 5DDJ3 1BJQA 1H6YA 1NYWA 2GC1A 3AKTA 4K8FA 4XJZA 3O0XA 4RQPC 4MGZE 4B3NA 3TEXA 1PZ9A 3ZFFB 5IVCA 4O61A 5LRRA 1W90A 4L11A 3ZYRA 5DZFA 1QMJA 2DVAA 1PMHX 2RS53 2JB4A 5I8TA 2F4PA 3T2QA 2XH6A 3EJKA 3BCWA 2Y6LA 5JOYA 5K0UC 1D2SA 3AZWA 3D6EA 4JDNA 4QAWA 1ASJ3 2VCBA 1UY1A 2ZZQA 3LPGA 2J1AA 5ANQA 2QQWA 1RUD2 3P5BA 5FZCA 3RWKX 3D5OA 5FZLA 5GZDA 1MZEA 3FLRA 4Z92B 1DLCA 3P1IA 4MGYE 2FZ2A 1YIFA 4N43A 4ET7A 1AL23 1AR82 4UW5A 1DF0A 3RYPA 2OXBA 2P1BA 3PJYA 1D4M3 1PO12 4QM8A 2ORXA 2WLQA 2OYZA 4BA6A 1MQTA 2JG8A 4I2OA 2RDQA 1B09A 4YVWC 2PHXA 4PIYA 2XR4A 4ARYA 1R092 1SZBA 1TNFA 3ZFGC 2D93A 4LHSA 3NAPC 2MPFA 3RZJA 3JB4C 1JH5A 4MHUA 4J1WA 1QDCA 2W39A 1W2AX 3DUIA 2XJTA 3FC0A 4S2GA 1O8SA 2XG3A 1W8WA 3KT4A 3H7JA 2PFWA 1GICA 3NKTA 5FIXA 2WZPP 1FMD1 4CDWA 5LZ6A 1V6LA 1F15A 1W0OA 3K4DA 5FKBA 2ZX4A 3RYKA 2UURA 1SLBA 5EV7A 1REFA 1XYPA 3NNGA 3FLPA 5KHJA 3VN4A 1BBT2 5B4NA 3O1UA 2QQNA 3DYOA 2JE8A 5M0TA 1GYKA 5I91A 1QH6A 3ACIA 2D6OX 5C4WB 1AR92 5LB6A 2P3KA 1KS4A 1OOPC 2AGSA 4JC1A 2HWC1 2JKBA 2KR2A 2QQVA 2YC2A 4R9DA 4FAGA 4Q29A 3JUUA 4N8MA 2JG9B 3GXUA 5ISLA 3UV9A 3ZSLA 3JD73 3USSA 4JKKA 2YC4A 4P14A 1AR61 1RUG2 1BEV3 3VB9A 4B7KA 2BDRA 3VHPA 3N7JA 2V4VA 3THPA 1G9AA 4MADA 1U12A 2VZ3A 3RI9A 4KGQA 1HKDA 4UFIA 1S4CA 1QJY1 4H7LA 1RC6A 1HN0A 3A0KA 4OUEA 4UW6A 5GLWA 2VZUA 3ZXKA 4GH4B 2VVFA 2ZABA 1NE6A 1C1LA 2JDPA 3VLBB 3CJIC 1WCUA 2ZHNA 3I59A 3N9PA 3ZSKA 3H0OA 2GNDA 5KC5A 4ORFA 3HVDA 5BNNA 4ZXKA 2NZ9A 2AUYA 2JDHA 2R16A 2JD4A 4AE2A 5IYYA 1JYTA 3WQ1A 2V4AA 1KEXA 3E5UA 4QQ2A 3W5NA 1UX7A 4M00A 4KBBA 4QQOA 3WW1A 2A3YA 1GZWA 1S0DA 2JENA 2Y6JA 4INDA 1RUH2 1LKNA 3U07A 1Q8QA 1K5MC 2IC1A 2O0OA 3ZYIB 2GSYA 2F17A 2FHRA 5CA6A 5JIUA 4P9IA 1W6OA 1KDKA 3K51A 3GHMA 4NRQA 1JYVA 1XYOA 1URXA 1UX6A 4OHWA 3ZXAC 1CWPA 1Y9MA 5FFOC 2BFUL 1CONA 1VLNA 1NY72 2R073 2UWAA 2LW8A 5H9RA 2WDBA 5FO8B 3LA3A 2IFRA 3AZYA 4MV2A 3USUA 5F1RA 3W5MA 1S0CA 2Z69A 3LAGA 5FRAA 2WWJA 3I2KA 3MV01 2VZTA 5HCHA 1UPIA 1DQ0A 4JGZA 4CPBA 1JU3A 4LO5B 3DPRA 1W28A 1S55A 4NWVA 2VNGA 5FPVA 1GOFA 4A3ZA 5LASA 1GANA 4JZRA 2D3RA 2E63A 5FWJA 1UPSA 1NLQA 2NMOA 3H7YA 2CAUA 1VE0A 4TXWA 1OLME 2VPVA 4QHBA 4NOTA 1IZ3A 1GWLA 2XBO2 4Y24A 1H30A 3IPVB 5LBBA 4MVTA 1N47A 3D0SA 5HV4A 5A3TA 1SBFA 1ACCA 2ORZA 2RMU2 4P00B 2E6VA 3VKMA 2ZEYA 2WL1A 3KT7A 1DQ5A 1CAUB 3IDCB 3MIFA 3C7HA 3E6BA 5T50A 3SH4A 3VZOA 3AMPA 3JQWA 2IXIA 3BOPA 4YZ3A 4L99A 3ZMOA 3MPPG 2XVLA 4X8PA 4XOGA 4CUBA 4Y26A 5FREA 2Q8CA 4NHXA 4UFMA 5FYZA 2VU9A 4UT5A 4BCUA 4PQQA 4YZ1A 4KG0A 4XFAA 3WSOA 4LEJA 5FPLA 3KHCA 3GBGA 3POWA 4WM8B 4QT6A 3Q8AA 4AFMA 2WYFA 4J6GA 4O9EA 3AP4A 2OPWA 3RZGA 5CU1A 1W9YA 3H1WA 5KHIA 4HANA 2P3YA 4PI0A 4MGKE 1VBC1 1KJRA 1PGW2 4LITA 2GMMA 3OGRA 3TBDA 2TNFA 2W1WA 1QXJA 1PVC3 2DVDA 3WP3A 4COUA 1JOJA 4Q4Y1 4CCLA 4QKNA 4QXKA 3TN93 2PLV2 1OH3A 2BZDA 2R30A 4BQ1A 3SCHA 3UGGA 1AYM3 5LBFA 3ZN5A 2JKXA 4HFSA 3BOWA 1DQ2A 1ND2A 2FCVA 2J22A 2YROA 3M7AA 4IERA 4JRLA 4K7JA 4MHRA 4BQ5A 1EV12 1IKQA 3WUCA 3OYWA 4UWDA 1V9U2 3MFAA 3ENRA 2D6MA 5F3CA 1IQDC 5D8AB 2VZVA 5H9SA 3NNFA 1J58A 1GZ9A 2XKOA 3MW3A 4YW5A 5ABJB 3OOXA 4Q8LA 5EWSA 4EN8B 2EXJA 4NMIA 5HCBA 2X53S 1ENXA 4UYBA 3H1YA 4PDWA 4XAAA 1VALA 2WYSA 3MLKA 3WCSA 1W0PA 3ROUA 1TME2 3ALQA 5FZ3A 1GOGA 1RUE3 2Q1FA 3AP6A 3I3QA 4IV3B 4N43C 2Z42A 4XUPA 5GALA 3VKLA 2QQPA 2RJKA 3UJOA 1X9TA 2XGXA 4YGDA 4GKXA 4NUBA 2W47A 3CJXA 4PJYA 1MQTC 2JG8C 2B9UA 2D6KA 3KV9A 1CZVA 4YM3A 2MHFA 4OLLA 2WSVA 4AGVA 3O1MA 1TMF2 3PIGA 2HWB3 2PHUA 1WCQA 3MIGA 5CYYA 2Q8EA 5HPOA 1WMEA 4AGRA 3D0JA 4Z2AA 1WUVA 5DG1A 3FFQA 3EMRA 3OGGA 2QUOA 1CIYA 1FOD3 4OFGA 4P9WA 5F5AA 2RV9A 3M3QA 3WT3A 3BIEA 5CG9A 2J1EA 4CDWC 1BZWA 1VBE2 2QVSB 4XIOA 3T2TA 5ERLA 3K46A 2E7QA 4PLMA 4GMP3 4Z1VA 1COV1 3OCPA 1ZRDA 4K1ZA 5KHHA 2HWF2 4JVAA 4CUCA 4ES9A 4NPRA 3CLPA 3VGIA 2WNEA 1VBD1 4HPKB 3GZTB 4O7XA 1LGNA 4WZFA 4CDQA 4CCEA 5HV0A 4G9SB 4MYEA 1TG7A 4XEZA 3B94A 1UZVA 3VD7A 3VL8A 1VAKA 2H6CA 3UKNA 5FP3A 4B29A 5AC92 3GZAA 2W1SA 1NZCA 3I8TA 3VBFA 2W2IA 1LNSA 4CEWB 1LGBA 1S0GA 3H3UA 4GMP0 5FYVA 2WJSA 1PIV3 1FAYA 1PO21 2GZWA 3IB3A 1HDKA 4UFKA 3HR9A 4XHBA 4C1XA 1QU0A 2Y33A 5IK8A 1EP0A 1OSGA 3ZM8A 4LKDA 3W21A 3GJAA 1JZ7A 3D8CA 1AXZA 2XJSA 1B35A 4IE4A 4F83A 1UYPA 4DXRA 4WM7C 5DDJ2 3DV8A 1W6QA 5FO7B 3HIFA 3U78A 3ZFEB 5JZGA 3ZR5A 1TZOA 3FJSA 3GBFA 5DN2A 4YW2A 2ILMA 4M0NA 1ZYBA 1WD4A 2BUKA 4TWTA 2GMPA 1WCSA 2W46A 5IFTA 4PT6A 3F95A 4LHKA 2RS52 3I7DA 3M4FA 3ZSEA 5BNNC 4FOQA 1Q8VA 4ZS2A 1LHWA 5KXEA 1TEIA 1MEC3 2D5FA 1K45A 2Z5WA 5JIAA 4G3YC 3VBRA 2K0GA 4QPGA 2NLRA 1W3XA 4KU8A 1ASJ2 2MEV1 2X5IB 5EYXA 2TBVA 3B5LB 4W50A 4AAXA 3V0AB 3KVBA 2EA7A 3RI8A 3LSDA 5LA1A 1POV3 1WMXA 3OY8B 3FL7A 4K21A 4UF0A 5FZDA 3VDDA 3PMSA 1AL22 1J3PA 1W6MB 3J26N 5FZ4A 2I2SA 2WNVA 2P5BA 3ZFFA 1XU2A 2UU8A 3V64A 1D4M2 3OSDA 3ZIXA 4COYA 5A32B 2B42B 4M4PA 1O4ZA 1U5ZA 3VZMA 4QQPA 2HEWF 1CAVB 2DCJA 1PX3A 4TZDA 4XURA 1XQNA 3T1MA 1E5IA 3LSEA 4AEJA 1YCIA 3BPSA 2WABA 4LNVA 5L36A 2GNMA 1FATA 1T2XA 2XONA 4EROA 5EJZB 1V00A 4AXOA 2VBBA 5J36A 1RGSA 4JX0A 5LK7B 5C8WA 3MI8A 5ACA3 1LB2A 1O3QA 4AK3A 5C9AA 5F39A 2ID4A 4LBLA 1P8JA 2CWMA 4QX2A 1OD5A 2D43A 3AYAA 5FMOS 1G9FA 4JHZA 3VDCA 3DPRC 4OCTA 4CCMA 2XPJA 1W6PB 4RL7A 4FFIA 4Q0VA 4EWEA 1UZZA 2YBKA 1DGWX 2QFEA 2WWSA 1WW7A 4EN6B 1YQ5A 4YM0A 4QKDA 5E1RA 2XWJB 1IS5A 2Y38A 2BGPA 2C5DA 1OMIA 2R0FA 5C3OA 3BVCA 3JD72 5FY1A 4D94A 3OPWA 4A3XA 5JOXA 1H2NA 1BEV2 2OS2A 2WQZC 4IEQA 2VL4A 3U11A 5A3UA 1ZBA1 3O1VA 1O4TA 4E4DX 1UZ0A 2RM23 2VNOA 5F6KA 1OHFA 5FAXA 4AAPA 3ZDVA 1W99A 4AEKA 1NCRA 1V6JA 4OUMA 5I0UA 5LY1A 1LOAA 3NJYA 5LA0A 2HWD1 1ND3B 4LHNA 2YPJA 5A7WB 1RUJ3 2JG9A 3LFIA 1HV0A 4K3UA 2ZGKA 4Y5TA 2XLGA 2ZA9A 1H8TB 3UKTA 4PF1A 3OD4A 3POFA 5CADA 1L7LA 4MH0E 4OI4A 1JYIA 2CWSA 1OXCA 3C7OA 4MXWA 1N3QA 5FMOL 2XLAA 1AF9A 1GKBA 3FHIB 5EPAA 1UN1A 5FYIA 4Q4W3 4LXLA 1AXKA 4D7YA 2EAKA 1ZA4A 2D44A 2ZEXA 3C8XA 3IDAA 3K2OA 4GH4A 1NQDA 1RYYA 5EJ1B 2LALA 5BXXA 3O1PA 5LRSA 1L7QA 2BPA2 1XNTA 3J7NA 1LCLA 3RQ0A 2D98A 3HBZA 5CAZA 1JYCA 2V73A 3M3EA 3ZLIA 4FOVA 3SNMA 4E2GA 4RR3C 1QOTA 4FOWA 4HT1T 3POYA 3POEA 3FE5A 1KXGA 3O5SA 3ACHA 2W1QA 5T3NA 1ND2C 1H1AA 1WD3A 5FZOB 2GU9A 2DBNA 2DU1A 3BIWE 4AGGA 2WS91 3DXTA 4CU6A 3HJRA 2PXJA 2R072 3I3MA 3H3LA 2DVBA 4XW3A 1O8PA 3N7LA 4NR1A 1IS4A 2X05A 5F7UA 4QPWA 5FPZA 1BXHA 2VJXA 1HRI3 3PHMA 2ET7A 5K9YA 2VNVA 3T1LA 4EN0A 1LOGA 2QQUA 2VMDA 1JOPA 1SLLA 4Q0QA 3VZNA 4DY5A 4AL9A 2C6SA 4PDWC 4CP2A 3MLLA 3EBRA 4XFBA 2WNUA 2D6LX 1QJZA 3WDUA 5BNPA 1RVF1 3IZOA 3VHRA 5C3QA 2I74A 2WWUA 2CDPA 4CP1A 5JPMB 1R1ZA 1SDWA 1UW8A 2CU5A 2OVUA 2R043 4XIKA 4AF9A 4CCDA 5DPNA 2VMIA 4S2DA 4IXLA 2AACA 2EAAA 4XDOA 3CF6E 1WW5A 5EIYB 5FZ1A 1QIQA 5FP8A 1F31A 3ORJA 1OLQA 1ZVFA 1X9PA 5EP9A 1RHI3 3M3IA 4OI0A 3WF4A 1F4HA 1JW6A 2PA7A 1CZTA 4Y33A 3MZHA 2XOMA 1R083 1HV1A 2YFUA 1I6XA 5FYTA 5J98B 3ACFA 3HQRA 1OPOA 4Q27A 2HYKA 4BOWA 1VBC3 1OT5A 2ZGUA 3HPNA 4R9AA 1ULEA 3R4UA 4YVSB 3WG3A 4CDQC 3LIHA 2JEMA 1GQGA 1QWRA 3OGJA 2QNKA 3WHTA 5JXIA 4EN9B 1CPNA 5IVYA 1DDLA 1H2LA 2JXAA 3WHUA 3AYCA 3BTZA 4BK4A 4P08A 3M3CA 5FQ0A 3VBFC 3HMYA 3ZMNA 4JGYB 4Y1YA 5IVEA 2XXZA 1QQP3 3AP9A 4RFRB 3VHOA 1W9TA 2WAOA 4H55A 1F2NA 1PVC2 4P9XA 2JDKA 5FP9A 2XB6C 2OPKA 1MR5A 1QGLA 3MGUA 3B02A 1PMJX 3MW4A 3TN92 3ZXFA 2D7FA 1SPPA 4WM8A 1V70A 4YLZA 1H1IA 1WCKA 1AYM2 1ZBE3 1ZRRA 2VZPA 4R4XA 3QOPA 2BBAA 2E51A 3MYXA 1B35C 1W2OA 1X8MA 5JMOA 3VD5A 4IETA 4AI2A 1RB8G 4HMZA 2PYTA 1HN1A 1OUXA 1X7NA 5JZGC 1SCRA 2GP3A 4LO6B 4LR4A 4XF3A 3PVNA 5FZMA 2I45A 3J8F3 4KWKA 1QJFA 4YW7A 4GWJA 2O14A 2XJPA 5FMDA 4Y1XA 2IUWA 3VBRC 3GHNA 4QPGC 3CO2A 2W52A 4LBOA 1LODA 1S0JA 3LB9A 4H2AA 1GUIA 1ULDA 2A3WA 4TTGA 2D3PA 2VQTA 4M3CB 3QACA 5E6HA 2JWPA 3VDDC 1RUE2 3FZ3A 3GALA 4IW3A 1STMA 4K9SA 5FBJA 4FPOB 2WNVC 5I8YA 4QX1A 3ASIA 2CAVA 1IPJA 4WV8A 4RHV3 5IVBA 5ABJA 2WO3A 3AZXA 2WZR1 3FN9A 3BTAA 5I8SA 2LROA 1W8NA 2HWB2 1G7YA 1FNYA 3I97A 3QCWA 5FZ0A 4LK6A 4TLFA 2XJQA 3JU9A 1PVXA 3RMYA 2DDUA 4BPZA 1NXD1 4IV3A 3LOIA 1GZCA 1FOD2 4Q4V3 1EAH3 3PUSA 1ONAA 2RS33 1G6NA 3AXEA 4I3GA 4QU2A 3K3NA 5LATA 3SEEA 3T2PA 2Z2SB 1VR3A 2XL7A 3WEZA 5C9AC 4IEUA 2CYFA 5FOBB 3ZXEA 1IQAA 4M3CE 4XQ4A 4D6QA 2EIBA 3U37A 1R1A3 1XB9A 3HN3A 3WG1A 1W8UA 2J1TA 1F35A 1NA1A 2W87A 2TUNA 4L9BA 1W8HA 2EIEA 3LE0A 5KBFA 2R063 4MXVA 1HQWA 3KV6A 3OF1A 4IEOA 1JUHA 4P9GA 2RJ2A 3LEKA 4WVWA 5KXCA 1UZWA 1O6UA 2QBXA 2A70A 1W6NA 1ZZ7A 3WF0A 1NCQB 1K42A 2VD7A 4EWAA 4FPCA 5APAA 1PIV2 2ZMLA 4QKFA 3TEYA 4R9CA 4QM9A 2RDRA 3VBSB 3JBG1 4H3WA 2HWE1 4AFBA 4RA0A 1LHVA 1NCRC 4CP9B 3LQCA 2QZ3A 3FHAA 4XCAA 2W3JA 4ISRA 4A7ZA 4FPJA 3PURA 3PMEA 3QH7A 5F5CA 4QU1A 1ZZCA 1ZZ6A 2XUMA 1H0BA 2X8KA 4IGPA 2KA3A 4HN1A 4A6SA 4Q5OA 1XC6A 1JMUB 2RE9A 3C2UA 5HCFA 2W68A 5A1AA 1KQRA 1YHFA 2PAMA 4M4RA 4QX3A 5FZIA 2VC9A 3WNPA 5J1XA 1MEC2 5DMYA 1V6NA 1PGL1 1LU2A 4U36A 4L8QA 5KR7A 2ZX2A 1AJOA 3LEGA 1RMU1 2VOKA 1WA4A 4IEZA 3IT8A 2FDFA 5JXHA 3PTRB 3VBOB 3RPQA 2DCKA 1DYPA 1S0FA 3SXWA 2J1RA 1ZRFA 1CQ9A 1ENSA 4LLOA 1UY2A 5J7MA 5FYSA 5FV3A 1HQLA 3AMMA 1YC61 1ZZBA 3B3QE 3FBYA 5DABA 1KFUL 2X5IA 2ES3A 2GNBA 1D0HA 4LKFA 3RNSA 2X29A 3SMHA 4DUVA 2VOWA 4BQYA 1X50A 5BNQA 2ARAA 3RJ2X 2ZMKA 3NNLA 1OQEA 5B2GB 2NP0A 5ACA2 5B4XA 4LUKA 1QJU3 5A32A 3VBHB 2BGCA 4QX0A 1JYNA 1N1TA 1CN1A 3OPZA 3AYEA 3PTYA 4XFCA 3EQEA 4NHMA 4NROA 3WQBA 3AP7A 3M2MA 1MZFA 1AR71 4Y3OA 1LEDA 2WNUC 1DGRA 2WFF1 5BNPC 1HXS3 4QB1A 3VBUA 4CEYA 5F9TA 3ES4A 4B1LA 5C70A 1BMV2 4EE2A 1UMZA 2WLPA 1VBA3 1ULPA 2BVVA 3QBQA 5FPUA 1C8M1 2C1FA 2IFWA 3VZKA 2XUEA 4UOJA 5I0SA 1MPXA 4HN0A 4IGQA 2RM22 3H8UA 4XJ9A 1ULCA 1BYHA 3POGA 4LOSA 3ZPOA 2CHHA 2A6YA 5T5LA 1OA2A 1RUJ2 2WAAA 3ES1A 5J37A 1DQ6A 4PQ9A 4BQ3A 5FMBA 4FPGA 2ZS6B 1HLCA 1RTVA 3IIIA 4W6XA 4X6QB 4LBQB 2QCSB 5FK8A 3NV1A 2Q30A 3J9SA 4GB33 1Q3EA 1J59A 3TWIA 1VRH1 4I3PA 4F8AA 2A71A 2DCZA 1Z7S1 3NL1A 5IVVA 4UI9L 1UKGA 1EY2A 1W9WA 3PUIA 4BB3A 1RUF3 3T09A 3NJZA 4Q4W2 2DUQA 4Y22B 5BNOB 4QHZA 2DURA 4OI1A 3CMGA 5A7WA 2C4XA 2ZTNA 1QDOA 2JDNA 3DF0A 3MIBA 4EJRA 5AC93 3KGZA 4IE5A 3WVJA 3DXUA 2R1DA 1PK6A 4NIIA 2DBIA 5FY0A 5A7PA 2W95A 3POJA 5FZ8A 4ATEA 1RL3A 4LIVA 2Y6FA 2HH9A 4A4AA 4RYDA 4XDQA 3W20A 2XL9A 3ELNA 1VBB1 4HZFA 3N35A 4LHLA 4XDPA 4Q0PA 4UBHA 3UK9A 2CGPA 1OLRA 2W9XA 1IKPA 1J1TA 2OZJA 2YGLA 2ZAHA 4IV1A 2DV9A 2VMHA 5C71A 1AHSA 2E31A 4BIFA 2HBUA 5A70A 1DU3D 4N53A 2RHPA 1HRI2 4XF1A 2YV8A 2IVIB 1X82A 1QY4A 1QHDA 2GMEA 2PHFA 1ZM1A 2VW1A 2W5FA 2QKDA 4NIAA 4BWOA 3LDKA 2VE1A 5JOZA 4Q0SA 1RUD1 4XTPA 2VY0A 4DPNA 1G9BA 5FZOA 2J7MA 2RJLA 1GFF2 5K4LA 1H2KA 2XKPA 3KM5A 4XXAA 1NZIA 2Y8KA 4IEVA 3N3HA 3BI3A 1AR81 3PU3A 4XE9A 2FMDA 4IEXA 5FZAA 5GJ6A 2R042 4XJAA 4QGNA 1YQ8A 1PO11 1QJX1 2VQ0A 5EJ3A 1POQA 4OYUA 4W8JA 4YYOA 3BU7A 1R091 4UW3A 4YG0A 4CCOA 5CFCB 2NMNA 4QWNA 4C8DA 1BCXA 2BOIA 1QKQA 1H8VA 2B5HA 5KHKA 4LORA 1RHI2 1DHKB 1HRV3 2WKKA 3FX3A 2PAEA 4QQLA 1JU4A 4LIUA 4BU2A 1R082 1C4RA 3CNAA 4PIZA 2Q8DA 4CU8A 1AYN3 3K77A 2YGMA 4DNYA 1VBC2 2P34A 1BBT1 3F2ZA 4Z8BA 2YMZA 1YFXA 4RQPB 3I2HA 1ULFA 2WT2A 3EHKA 4N9IA 3V0BA 1MS3A 3FWEA 4XFFA 4XILA 1AR91 1NA1C 3ZX7A 1XBFA 1SLCA 4LO7A 1D0GA 4CDXA 3VL9A 5K0UB 1JYWA 2ZKLA 4Q2FA 4NO4A 1YRZA 1QQP2 4BXFA 2N7GA 3IAQA 1RUG1 3JQXA 1Y43B 3FFZA 4GD4A 1GLHA 5C8CA 1KRIA 4V2VA 1YJLA 4K20A 3H8XA 2Q5TA 4XHXA 3OBAA 3AKPA 3LKJA 1D7PM 5CISA 2VQUA 1ZBE2 3C7FA 2PHRA 4MX3A 3FUQA 4YVWB 3S7IA 5A1LA 5A6ZA 3WP5A 3ZFGB 2C0ZA 2VTXA 4LPLA 2FQPA 1YQCA 1CAWB 3NAPB 3VD9A 2W0XA 3VUOA 2VXRA 5JR2A 1LOFA 1W9FA 5JCTA 5JUVA 3J8F2 2ZX1A 4E27A 2PMWB 1PNGA 2CDOA 1OA3A 2BNOA 2DFCA 2P6HA 2OW4A 4QPIA 3N9NA 4NWWA 2FBEA 4GULA 1W05A 4GIQA 4NAOA 3A4UA 4Y1ZA 1WW6A 3ZYFA 3RSJA 3RZHA 1SBEA 3R4DB 3S5QA 3DN7A 5HXVA 1RUC3 5TSWA 1SHWB 2WIIB 2YFZA 3WD5A 1RUH1 1JS9A 1AVBA 1OOPB 3ZN6B 2DFBA 5FYMA 2YUEA 1GQPA 4RHV2 3MIEA 2BNMA 4CDUC 2SBAA 4U2AA 4YGCA 1ODMA 5FY5A 3P6BA 5A3OA 5K7PA 3AC0A 3MUY1 3THDA 1A34A 1DGLA 1Q5OA 1Z0HA 5JVVA 2XLFA 4DINB 3LF7A 3WY6A 4X6RB 4M3CA 1NY71 5FYHA 1RXFA 3SISA 3UESA 4Q4V2 3HT1A 3A22A 1EAH2 1XYNA 5CFDA 2RS32 1FPN3 4E8DA 3TEWA 2GNTA 2C9KA 3J7MA 4AEDA 5DUVA 1GR3A 1YQ2A 4Y4YA 1OVPA 4FXKB 4DB5A 2ZGRA 3CJIB 3AVRA 1W8OA 2GDFA 4XFGA 2RS13 1R1A2 1OQDA 4LO4B 4TLGA 3B9IA 1MVQA 2PAKA 3VBUC 4CEYC 4CUAA 3SLIA 5L7OA 5FZKA 2ZGMA 3ETQA 3B00A 2R062 4HSJA 2Y6GA 5CVRA 3WUDA 2XBO1 1CX1A 1N1SA 4JDMA 3I3DA 2ZMNA 3RG0A 5A3MA 2VMGA 4GJYA 5DQ0A 1NOVA 2CSGA 2RMU1 1RUI3 4H7MA 5T5OA 5FOJB 1FV2A 1DIWA 1IG3A 4FAHA 1H9PA 1K5MB 3N7KA 4OHYA 2B4KA 4XFHA 3MFCA 4Y20A 5FUPA 2A1XA 2LUWA 1GZTA 4GJZA 1UU4A 5FZBA 3LEIA 3WP6A 5FZ9A 1SDDB 3HNBM 4HG6B 1X33A 1SEFA 4ZU4A 1LU1A 2DYCA 4ASKA 3MICA 3WQ7A 3OPTA 4Q4X3 1NX9A 5FKCA 4Q1PA 2IXCA 1OD3A 4MGIE 1W2NA 4OUSA 5CG8A 2RR13 3JXSA 3R05A 3O1TA 1UMHA 2A6XA 3DKQA 3B69A 1KDMA 3ZYBA 2BNNA 2ZHLA 5A3WA 1C57A 3QD6A 4CU9A 3H50A 4CP9A 3M3OA 3T08A 5FO9B 4WVMB 2ET1A 2KXLA 3ETPA 5IK4A 1PGW1 5FBZA 4META 2VQAA 2XQXA 3ZXJA 4BXSV 4F7ZA 1W2UA 1GNYA 4XZPA 5DZGA 3RDIA 1PK6C 4HETA 4O9GA 1VAVA 2E26A 2ENRA 2R1BA 3S6PA 2I07B 3S7EA 2PLV1 3AZZA 3PVEA 3EO6A 2VTFA 1N3OA 3A7QA 4MGTA 1HB2A 1UWWA 3GZUC 5E89A 5AFBA 3AMNA 2ARXA 1MACA 1TQ5A 2R6QA 5FUIA 2VMCA 4MO3M 1EV11 3PUAA 4SLIA 4IV1C 4AFDA 3AZVA 1V9U1 3L9JT 3WF3A 1WLDA 1OH4A 3LIGA 4H14A 5DAVA 3UGHA 4RS5A 1QJU2 3PJQA 4N53C 1J3QA 2RVAA 5GLZA 4CRQA 2PHWA 3A21A 4P5HA 4FBFA 4RGGA 1YFUA 2WR9A 3UKVA 1JZ4A 2AZ5A 1TME1 2XVGA 1Z78A 1HXS2 3AP5A 4A44A 3EXUA 3E6CC 4XUNA 4WVZA 2BQPA 5G05L 3RZKA 1FXZA 1KD7A 5FCCA 3NJVA 3I2FA 1VBA2 3AKSA 4FPHA 4HKOA 4DEVA 3UJQA 4M01A 5FYBA 1G9CA 4L92A 2KM2A 1FMD3 4DRVA 3TNQA 1G8WA 3RYRA 4AOCA 1TMF1 3OB8A 2A7AA 1A6CA 4D69A 4ZZ5A 1I1EA 2UYAA 4QQHA 2EVXA 3I54A 3KB5A 1ZA7A 1FX5A 1YXWA 4YGEA 1ZNPA 5GLTA 4Z2WA 5I93A 4YZ4A 3B93A 1SBDA 3HWJA 1VBE1 4AQ2A 1POV0 2HWC3 2HWF1 1MS5A 4AWDA 3B7MA 3LA2A 3WQ0A 2JDUA 4IEWA 4AHXA 4D7TA 5FUNA 4GB32 3LD8A 1AR63 4JGZC 1VB2A 4AVTA 3ZO0B 1DYOA 4ATFA 3V56A 4E2QA 1RUF2 2P2KA 3DL3A 3WF2A 4LTAA 4CDXC 3MPBA 4GAZA 4ZS3A 1DQ4A 1LOBA 2UYBA 1K3IA 1US2A 3KV4A 1ZZ8A 1VIWB 2VCAA 3MF9A 1UOFA 3IDBB 1QJY3 3QLQA 2VZQA 2YBSA 4FPFA 4RGKA 1UO9A 4XF4A 3ZXDA 3ZYHA 4LLFA 1W8TA 2P3IA 2GALA 4N43B 4NE9A 1JZ2A 5C8CC 4EWDA 3O1RA 2G1MA 1YQ6A 1DZRA 3AM2A 2GN7A 3GF6A 4OULA 3VV1A 3WX5A 4DRRA 1F8VA 1MQTB 2JG8B 2GN3A 4QXBA 4JTNA 3U1XA 4E4SA 2D40A 5C4WA 1YIPA 3J7HA 4AHWA 4W6WA 4XJWA 1LHOA 2BYVE 5DDJ1 1TVGA 3ZKYA 2OUJA 3POBA 5JOWA 1O3RA 4PLOA 2BGOA 1LOFC 3OJBA 4W4ZA 1UY3A 3EYPA 1UYYA 3INAA 3NKGA 3NNJA 4HLTA 4QGLA 3PIJA 4AQSA 4CDWB 4OQ8A 4QKBA 1H6XA 4GALA 5DUWA 4CU7A 5F2WA 1QJX3 4NHYA 4E9KA 3BN6A 4QPIC 3IKWA 1XSQA 3H8OA 2BVBA 1ASJ1 3U10A 2ZOEB 4JQTA 2OQ6A 1KITA 3HD8B 1ODNA 1FI2A 4ZY9A 2PHTA 2XMLA 5GZFA 1JHJA 1AL21 2YU2A 2VCMA 1A3KA 1ST8A 5T55A 4QX7A 1E57A 4V1PA 5GZCA 3S57A 1D4M1 2FDHA 1W03A 2VOXA 1L3JA 1YEWA 5JWPA 2WQ8A 5FP4A 3WLUA 2WUHA 3GCWA 3NW4A 2JD9A 5F6LB 3R0RA 4JDOA 3HOBA 3MO4A 4AHYA 1BVVA 1HRV2 1G86A 4LJHA 4NHKA 5F8PA 1OKQA 4NHLA 1BK1A 4AFCA 5FK7A 5CFDC 4A2UA 4IESA 1FNZA 1AYN2 3JZVA 4AEDC 2BV4A 4XC9A 4WM7B 1YUDA 2VO5A 1VMHA 4KWLA 4N90A 5D2AA 2NYYA 3I4IA 4YG6A 3ZKUA 1OF4A 3KGLA 3WW4A 1HX6A 3GBWA 2YC0A 1OLMA 3I59B 4FFHA 2FDJA 2FD8A 1VMFA 2VZ1A 5E8AA 3U4SA 3ZXLA 5L7OC 4QX5A 5JI7A 3I2DA 2J1UA 3K4ZA 3TAYA 3Q8EA 1GSLA 3JD71 2DUOA 5KHGA 5BY5A 2DU0A 1BEV1 1UOBA 3ZYGA 4LQRA
chains in the Genus database with same CATH topology
3E5XA 4OHXA 4AI1A 2B46X 4L2NA 3WG4A 3BB6A 5D1IA 1W6OB 5K0UA 5LEKA 1WMFA 2JE9A 3AMHA 4YSFA 5FTTC 4NN0A 2WQ4A 3IPVA 2HEYF 4C0HA 3VHNA 2VH9A 2NPIA 2V09A 3USUB 4XBNA 1YFYA 1CAUA 4Q4Y3 1JBCA 1RINA 3SCGA 2ZAAA 4FTEA 3DPRB 3NAPA 5J96B 1RUC2 2D5HA 4AG4A 2A73B 4DFSA 4RFT0 3B01A 4BMEA 4LE4A 2YZ4A 5BPXA 3W59A 4C90A 1JN2P 4F3JA 1C1FA 4HVQA 5DZEA 2ZZJA 1YLLA 3KQRA 4ASMB 2LM3A 3PVOA 3ZYJB 3VZLA 3ZN4A 1UZYA 1MS1A 4D7SA 5T5PA 2R071 1H4HA 1LULA 1XE8A 1XRUA 1FPN2 3ZN6A 3NV4A 1XNKA 3PVBB 4RS5C 5FLJA 4ZU7A 3WDWA 2PELA 2ZGSA 1UD1A 1DZTA 2RS12 1YI9A 2VG9A 4M0HA 4FOYA 2ZCWA 4I0WB 1LENA 2V5YA 3AFKA 5D8AA 4FTSA 3ZFFC 1QOSA 3BPZA 1AX1A 1COV3 1RUI2 4AVVA 5CNAA 5EYYA 4L97A 1VBD3 4RR3B 3MLJA 1Y7BA 5H9PA 3AJZA 1SMVA 5JSRA 1ND2B 5GLVA 3WDTA 4Q4X2 3CU7A 1DFQA 3H3ZA 1EYBA 3OYWB 3LOBA 2RR12 4YW1A 1XU1A 5E16A 2GH2A 4XBQA 4ZKTB 3MDPA 1OFNA 1PO23 4A7KA 3AX4A 2TEPA 3ME2A 4ZU5A 2UY9A 1YYNA 1QXRA 3TRSB 4FXGB 4PDWB 4IEPA 2GC0A 3WCRA 1PVC1 1U5IA 1VB4A 3WG2A 4PIXA 1H4GA 5I0TA 2B8MA 4B7EA 1UAIA 1CX4A 4HPKA 5EZWA 1UKRA 3TN91 5J09A 1AYM1 5EFUA 5C4WC 1Q43A 2PN5A 4WVMA 2OA2A 2YHJA 4PF5A 1SLAA 4Y1UA 1MS8A 2JG9C 2MEV3 2YDEA 1HW5A 5A3LA 2CTVA 4CEWA 2LTNA 3ILRA 1SFNA 5KWRA 3LZZA 1QF3A 3ZXGA 1SLIA 5GM0A 1IOAA 3VKNA 1OFSA 2VVDA 4CYDA 4AVCA 4XPVA 3O0VA 4CDQB 2EXHA 1LHUA 1RIRA 1HQNA 2AYHA 2IXHA 5SV8A 1O3SA 4YM1A 1RUE1 1MS0A 4GH4C 2Y26A 3ZFEA 4B8EA 1O7FA 4I09A 4JCKA 3VBFB 5JSOA 2GAUA 3THTA 3TB0A 3APBA 1FMD2 1BVP1 1UIKA 3MW2A 1LOCA 2OUHA 1D2QA 1FYUA 1S0IA 1S2BA 1IS6A 1N1YA 3DKWA 5T5JA 1FOD1 2C9AA 2VW2A 1WGPA 3V0AA 4FVVA 1V6OA 3OY8A 5J3UA 2VW0A 4HL0A 1B35B 1W6MA 4GMP1 1LRHA 2HWC2 1W6QB 5JZGB 1H9WA 4YZ5A 1CAVA 2A6ZA 1REDA 4QD2A 1AR62 2QDRA 4MZUA 1QOOA 1ZBA3 1WCDJ 3VBRB 1QXPA 4QPGB 1V6MA 3ATGA 4R9BA 2VVEA 4FTBA 4RGAA 2HWD3 1QJY2 2H6BA 1PIV1 3VDDB 2A6VA 2WINB 2WNVB 4KU7A 5I91A 5FLHA 1DBNA 1AXYA 2O1QA 1W6PA 1RITA 3OTFA 1JTZX 4LBKA 4OHVA 2WT0A 2ZGNA 2P17A 1O4YA 1F5FA 1YJKA 2HKXA 4BM8A 3MEPA 3RMXA 2P37A 3V65A 4XJ8A 4EN7B 2GC3A 5HI0A 2ZGOA 3URFA 1QJX2 1MEC1 3IBMA 1PHMA 4Q1RA 4XYXA 5C9AB 1IGOA 3WNXA 1W39A 3VZJA 1ND3A 2IWGB 2K2SA 1NE4A 1PMIA 1O3TA 1BQPA 2VGDA 1POV1 3AKRA 1H1MA 3M8LA 4GA9A 1C5IA 4XXPA 5SV5A 4UW4A 2GC2A 1H8TA 5KXBA 2WS93 4I0AA 2ATFA 2WC2A 5K8SA 3AK0A 2DF7A 4WM8C 5T52A 4GKYA 4DOUA 4DZGA 5HBAA 5BV6A 3TOJA 3NSTA 1NXMA 1UU5A 4AVSA 1EPWA 2B39A 3B9CA 1O5LA 4ASLA 1NCRB 3FBMA 3H9AA 3JCIA 4KNCA 4BH9A 1PZ8A 1RVF3 1TE1B 1Y9QA 4XMAA 5ACA1 1V6IA 4AFAA 3CEWA 4BLJA 2BEOA 3IM0A 3RS6A 2BWAA 5JI9A 2UY8A 5H9QA 2XJVA 3O0WA 4MLOA 2A75A 3IN9A 4KG8A 4URTA 2JICA 4AHZA 3O12A 3ST7A 4MXWB 1GBGA 5JSPA 4LO8A 1BMV1 1S1AA 3AKQA 3E97A 5IUQA 5JDBA 2BFUS 5D8AC 5C6CA 4PBPA 4WM7A 2FMYA 3ZYPA 5ABJC 4LBMA 3SH5A 4XJUA 2PHDA 2RM21 2UWBA 3NWKA 3MIHA 2ERFA 1XNDA 3NV2A 4HKLA 1NG0A 2AREA 3X29B 1ZZ9A 4I30A 4IV3C 3RRDA 1RUJ1 1MZ5A 1KFXL 4FP3A 2ZGQA 4B4RA 1N3PA 2PTMA 4Z07A 3KCXA 1U0AA 3KZ4C 4Q4Y2 5C33A 1LJ7A 4Q4W1 3MF6A 3VKFC 2ZGTA 2ZACA 1REEA 3GYDA 2JE7A 3PLQA 4C0BA 2QDNA 4JQRA 3IIAA 3M1HA 1C5HA 1PGSA 2WNUB 5BNPB 4TYSA 1PM7A 4JRAA 4FQ4A 4YVSA 5EXOA 1WLCA 3NO8A 4I02A 3R6SA 3LWCA 4SBVA 4KGGA 2ZX0A 1J1LA 2WFPA 2SLIA 2XWBB 4JGYA 3TNPB 4CEWC 1MS9A 1UIJA 1JHNA 2E7TA 1FT9A 2JJ6A 4HVRA 1HRI1 4BMBA 1AL0G 3P3NA 4KL1A 1VP6A 2OIIA 4BE3A 1ENQA 2WZR3 4R52A 1D4VB 3TYJA 4UXAA 3ZSMA 3O14A 3ZSJA 2XJUA 3ZFEC 2R041 1GNHA 3WV6A 5FQ0B 5LK5A 1DQ1A 4HVOA 2NM1A 3E5QA 3OBTA 2VUAA 1COV2 1VAMA 1LECA 4XTMA 4JV4A 1WMDA 1RHI1 5JPNB 1AX2A 2X5IC 1VBD2 2VUJA 3VKOA 4TSVA 1AZDA 1CGPA 1R081 3HN1A 2ZBJA 3LGRA 1MZ6A 2PQQA 2A6WA 4BHPA 4FPKA 1LR5A 4XQWA 4X8NA 2R0HA 1O5UA 3Q9OA 2Q1MA 3G6JB 2YYOA 3J4UH 2Y0OA 4YZ1A 2IXKA 1PO22 3WXPA 1CD3G 2XHKA 4RR3A 4FPLA 1CR7A 2A5ZA 4YGBA 4Q8KA 3U0ZA 2JX9A 2JDZA 2HWE3 3JBG3 2G4IA 4FPYA 1QQP1 3KS7A 4E4ZA 1MS4A 3OBRA 1KS5A 2ZJCA 5DUUA 3WW2A 4NVPA 5A33B 1C28A 1O91A 4LUMA 4GWNA 3A0NA 3NVCA 4IEYA 4LA3A 1ZBE1 1GV9A 2YY1A 3N7MA 3WW3A 2DUPA 4GWMA 3IWZA 1SQ4A 5JMCA 4HSLA 3FUOA 1APNA 2MEV2 2CV6A 3HT2A 3AXDA 3OD0A 2XJRA 3J8F1 4CTEA 1UU6A 1NCQA 1RMU3 1NLSA 3KMHA 4AVAA 4B4QA 2HEVF 4S2HA 4KQ7A 2FZ1A 2E9QA 3VBSA 4GXLA 4BYYA 2B7YA 2OZ6A 1ND3C 3IMNA 4N7UA 1NA1B 2WA3A 3SCFA 1H8TC 1OA4A 4RHV1 2R32A 1W6NB 4AQTA 3HAGA 2ARBA 3SITA 3CL1A 4RSUA 1QNWA 2ZPXA 5KC6A 1CAXB 4KWJA 3AMQA 1WBFA 1A8MA 4Q4V1 4MUVA 1EAH1 1AR73 4FT8A 2RS31 2WFF3 1OPMA 3VBOA 1JUIA 2G9FA 3FMGA 5I0RA 3GNEA 1R1A1 1C8M3 2DVFA 2AENA 3WZ1A 4BZ4A 2HJIA 4Y5Z0 4FPEA 1DZQA 4QGMA 1ZBA2 3DGTA 4YARA 2QJVA 3D82A 2R061 5CIRA 1RUOA 1IPKA 3G7DA 2HWD2 3E6DA 5IT6A 1F9KA 2VECA 3VBHA 2Z79A 1MVEA 1YO8A 1WLTA 4R8HA 1YNAA 2CGNA 2D97A 1GQHA 2EXKA 3S30A 3ZDSA 1VRH3 1SACA 2BWCA 1DGRN 1Z7S3 3N36A 4W6YA 1FV3A 4CDUB 3ECQA 3SH3A 4LULA 4ITCA 5FPXA 1Y3TA 3O7OA 4R4ZA 4AQ6A 2H0BA 4LE3A 5GLUA 4LBJA 4LA2A 2IXLA 1VBB3 2BBVA 1XNBA 4CP0A 4OHZA 4PBOA 2PHLA 3JB8A 3VBUB 2ZX3A 4CEYB 1AUYA 4WZCA 1U5XA 4YVSC 4COZA 5DXDA 5BUVA 2WS92 1CESA 4LBQA 4HBNA 3ZVXA 4BLIA 3AJYA 5FDBA 4C91A 1U5YA 3KT1A 5BNOA 4Y22A 4JGYC 4COVA 1RUD3 4OI2A 5F5QA 1RVF2 1QJU1 2ZKNA 1AR83 3ILNA 3R4SA 3WR0A 2RS51 1PO13 4YG3A 2NN8A 2Q1ZB 1R093 3P3PA 4LBNA 3NV3A 1CJDA 1HXS1 4XMIA 1Q8OA 3W58A 4LBQD 5CB7A 4ISQA 1S2KA 1VBA1 2G9GA 5DG2A 3AYDA 2Q4SA 1CIWA 1XNCA 4FP2A 4COWA 4FCAA 1PK6B 1V6KA 1BBT3 2P3JA 4P9LA 2WT1A 2F6BA 4HK9A 3KLSA 4C1WA 1ULGA 3WDYA 1AR93 1VJ2A 1X8EA 1S0EA 3D4KA 3MIDA 4IV1B 1YFWA 3L2HA 1CJPA 4WVVA 2AH2A 3RZZA 1ZRCA 4GB31 3KCCA 3N4MA 4OVEA 4XQDA 1RUG3 1LESA 5CFCA 1QH7A 5DUXA 4Q26A 2D6PA 4N53B 1RUF1 4DY3A 4DQAA 5BNNB 4I01A 1WW4A 3WDVA 5AC91 5AVAA 1BKZA 4AEMA 4FO9A 1GZWB 3M70A 4FQZA 1YWKA 4RQPA 5E88A 2BTVC 1SFYA 1AJKA 4S2FA 1I5ZA 2BW8A 2WA4A 4HK8A 4DS0A 1LHNA 4DMIA 2JECA 4XBLA 1UF2C 1Q56A 5BYNA 1NCQC 5JLVA 2Y0IA 1RUH3 2O8QA 3U4XA 3ACLA 3VBSC 4PCRA 4AW7A 4ONUA 1AX0A 4W65A 2WZR2 4AI0A 4YVWA 1CVNA 4JGZB 4N7IA 2ZHKA 3ZFGA 3V0BB 1CAWA 2NQYA 1G9DA 3S0MA 4E2SA 4K40A 3WOGA 2XVKA 5GKAC 4CDXB 4FSJA 3AFGA 4OZXA 1RJ8A 2EF6A 1CPMA 2VULA 1N1VA 1ZX5A 5IK7A 2YXSA 3L2YA 1GNZA 2EXIA 4M3CF 2Q0AA 2WSUA 4K1YA 1I9RA 4AVBA 1H2MA 2ZGPA 2IXJA 4JTOA 5C8CB 2CNAA 1J3RA 1HRV1 3AB0A 2ZHMA 4GQ7A 2B45X 3W9AA 2VNRA 1DGWA 4MSVA 1AYN1 4RD7A 1LEMA 3VBOC 1OOPA 2DCTA 4QMAA 1ALYA 5L19A 1IHMA 2E53A 2XBO3 1DLLA 2AR6A 5AFEA 2D6NA 4QPYA 1RJ7A 2RMU3 1LTEA 3LCPA 4LT5A 3ZPYA 1YI7A 4QPIB 1C3HA 3KSCA 1DG6A 3QH6A 3JBG2 2HWE2 3POSA 4AI8A 1PNFA 1M4WA 5LEJA 4WBBA 3VBHC 3LA7A 5FLIA 3CJIA 4A7YA 4IL7A 4P9JA 1PZ7A 1SLTA 3UL2A 3WP4A 4YNIA 2Q8OA 1PGL2 3ILFA 2ETEA 1JXNA 2GH8A 1ZREA 4EV0A 1RMU2 2D3SA 1Q8PA 5CFDB 3BODA 5A33A 4ES8A 1LGCA 2ZGLA 2CGOA 4AEDB 4XETA 1K5MA 1IS3A 2VOVA 3K48A 1DYKA 1TNRA 2O8OA 2PLV3 2R49A 4YFWA 1RUC1 4AI3A 2QZ2A 1X36A 5L7OB 1EV13 4PLNA 3BALA 1V9U3 4YW4A 3KCYA 4IQPA 1NLRA 1ENRA 1T6GC 1HIXA 1S0BA 5HCAA 1C8NA 3HQXA 4YW3A 5BNOC 5JR7B 4BIOA 3RWNA 4Z82A 3FLTA 4Y20B 5GZEA 1AR72 5GZGA 1TME3 1FPN1 2WFF2 3WDXA 1OQ1A 4B4PA 1WBLA 4P9YA 1KJLA 5JAXA 5L73A 5T54A 2IZWA 1EPZA 4YRDA 2CL2A 2RS11 5KXDA 1C8M2 4YM2A 1RUNA 2DCYA 1CAXA 1TMF3 3PNAA 3WINE 3KD4A 4HKWA 4KH9A 4XFIA 2DWRA 4JAAA 4Y1VA 1SCSA 1I3HA 1A78A 1LOEA 4G4FA 1VBE3 1UL9A 2EALA 3ZIWA 1RUI1 1A8DA 1OI6A 2E7AA 4DXZA 2UWCA 2HWF3 3SHRA 3IDEA 1UCXA 2HWB1 1NQJA 2EIGA 4UBGA 4Q0UA 4D3WA 1VRH2 1WLWA 1XE7A 3C3VA 1F5JA 1Z7S2 2W08A 1Q8SA 4YFZA 4YZ2A 4Q4X1 4XF9A 2DTWA 2RR11 4N9HA 5AVPA 2QE3A 4K6BA 4XF0A 2DVGA 2A3XA 2H0VA 2MNGA 4J1XA 5CFCC 4RS5B 4AYUA 5CBLA 1XXNA 4I0BA 1QNYA 4CZSA 2K9ZA 4CDUA 5IK5A 1VBB2 5J48A 2CY6A 3H1MA 2DTYA 3RJRA 5DDJ3 1BJQA 2GC1A 1NYWA 3AKTA 4K8FA 4XJZA 3O0XA 4RQPC 4MGZE 4B3NA 1PZ9A 3ZFFB 5LRRA 4L11A 3ZYRA 5DZFA 1QMJA 2DVAA 2RS53 5I8TA 2F4PA 2XH6A 3EJKA 3BCWA 5JOYA 5K0UC 1D2SA 3AZWA 3D6EA 4JDNA 1ASJ3 2ZZQA 1RUD2 3D5OA 5GZDA 4Z92B 1MZEA 3FLRA 4MGYE 2FZ2A 1YIFA 4N43A