4QB6A

Structure of cbm35 in complex with aldouronic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
128
Chain Sequence
b'TGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
total genus 29
structure length 128
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb6A00
1XC6A 3T0AA 4DUWA 2R7EB 2EIDA 3I3DA 3CZJA 3WSOA 1JYXA 2WQ8A 3ACHA 4MGSA 1JZ4A 3SKJE 1UXZA 2VZSA 4XVHA 3VD7A 5DQ0A 1JZ2A 1OF4A 1UY1A 2WO3A 2Y8KA 2L9LA 4RN5A 4ZZ8A 1XPWA 4ZXEA 2VCBA 5LA1A 1LNSA 1MPXA 3K4AA 2XQXA 2YB7A 4M4PA 2CDPA 3NJVA 2JKXA 1UY2A 1CX1A 3EYPA 3I2GA 2LW8A 3VD9A 4PT6A 4UI9L 3U37A 4JKKA 3LEIA 3IAPA 3OB8A 1UY0A 4CUCA 4XUPA 2ZEXA 3NRUA 4DUVA 1PMJX 5J1XA 3I2JA 1HN1A 2QQNA 2VQUA 2J1EA 3CDZB 1H6YA 3MO4A 1K45A 4OYUA 4D0QA 3E1F1 2BZDA 1H6XA 5IYYA 2J1SA 5IJRA 3PUHA 3THDA 2DCJA 4KWUA 1K12A 3NNGA 2B4KA 1K3IA 2W1SA 4PF1A 1TVGA 2X10A 5IFPA 1UX7A 2WAAA 2W92A 2BBAA 4XZUG 2VMCA 3WEZA 2Y6HA 1JYVA 3IB3A 5FUIA 2EIBA 3OGVA 2ORZA 3WNKA 5CZKA 2VOTA 2YC4A 2JE8A 3MUZ1 3DYOA 4QX3A 4CU6A 3NQHA 2RVAA 3K46A 3T2PA 2V5DA 4QX1A 2LS6A 1DYOA 4L0PA 1CZTA 4QPWA 3LEKA 3OGRA 2VZPA 1O8PA 3IIIA 1PMHX 1EUUA 5B4NA 5C71A 3SEPA 2WAOA 1XNAA 4QX2A 1BHGA 2WO1A 1DP0A 4QX0A 1ULPA 3I2FA 2C9KA 2W1QA 4D8MA 2ZEZA 5B4XA 4DXTA 4CU8A 4PQQA 1XNTA 5JUVA 3VDBA 3W5NA 1UWWA 2VQTA 4ARXA 3MV01 1L7RA 2WZ8A 3ECQA 1EUTA 3CKHA 2XONA 3DYMA 2W47A 4DXRA 3CZUA 2E26A 4W8JA 3DYPA 3GGLA 1UZ0A 3LE0A 2VZQA 5I0DA 1OD3A 5A1AA 4UAPA 3C7OA 3T2OA 2VZ1A 1O8SA 3ACGA 3WNLA 1GOFA 2WO2A 3C7HA 2VR4A 1CZVA 1UMHA 1SG3A 3ACIA 3BGAA 5CYYA 3D3AA 3I2HA 2HYXA 4FI9A 4HG6B 3ZM8A 2E32A 2QQLA 2V72A 3NJXA 4QB2A 4TXWA 5G04L 4DXSA 4P00B 1DLCA 4XUTA 4LKSA 3HNMA 2WN3A 3PUIA 1UMIA 2Y6LA 3P1IA 4CVUA 4A42A 2BGOA 2VL4A 2W94A 3WNOA 3VD4A 2VTFA 1UXXX 3ABZA 2ORXA 3VD3A 2VCCA 2W46A 2VZOA 2WABA 2W91A 4A44A 2ZEWA 1W9WA 3JXSA 3WNPA 2YFZA 3I3EA 2VZTA 1JZ3A 3HNYM 3HJRA 3GDBA 5JMOA 2C4XA 2VZUA 2W1WA 3OEBA 1J83A 3OEAA 2DCKA 4MGQA 3IAQA 2HLEA 3A21A 3I2KA 1IQDC 4QDRA 3F2ZA 4E8CA 3UNPA 3WF1A 1OT5A 4AG4A 3LPGA 2VMEA 4DUXA 3T08A 5LA2A 4MADA 1JZ5A 5LCWL 1JHJA 2PQSA 2RV9A 3CMGA 2J1TA 3A23A 1F4AA 2W5FA 1W8NA 4LQRA 2BGPA 4LPLA 2B9VA 1TG7A 4XUOA 4GWIA 3DECA 3ETPA 1UYYA 2C26A 4QAWA 4GZ9A 4MO3M 4ARYA 4P02B 2W3JA 1UY4A 4MOAA 2E31A 4QB6A 2X05A 3T09A 3C7FA 2WYSA 4A6OA 4AAXA 3VDCA 4Z2AA 1GOGA 4JKMA 1JU3A 3K4DA 4OMDA 3ACFA 4DEVA 2OKXA 4P08A 4BXSV 2WZEA 3WQBA 5DPNA 4BJ0A 5JXHA 2Y6JA 4QDQA 4KI5M 2QQKA 3WF3A 3WNMA 4GWJA 3GXUA 2KD7A 3P6BA 3WF2A 5JXIA 3T2QA 2VMFA 4W4ZA 1UYXA 4BK5A 2VMDA 4CU9A 4A3ZA 1W8OA 1NAEA 1SHWB 2YFUA 3A22A 5G05L 4JX0A 5JXJA 1OF3A 4E8DA 3C8XA 4P5YA 3W5MA 3J7HA 2YC2A 3WF0A 2J1RA 1F4HA 2W87A 5LA0A 1I5PA 2VZ3A 3OG2A 3HEIA 4W50A 2J1VA 3UETA 1KGYA 4BK4A 4ZZ5A 2WUHA 3FHAA 3HNBM 3AC0A 1NKGA 1GNYA 4QB1A 2X09A 3UESA 1K42A 1W99A 2VC9A 1WKYA 2DDUA 2WDBA 2VZRA 3MUY1 4UOJA 2ZEYA 3T0BA 1YQ2A 3CIHA 3FHQA 3IDAA 2EIEA 1CIYA 1JU4A 4DEQA 1JZ7A 4RYDA 2WN2A 5HXMA 2ZXQA 3THCA 2Z4FA 3C7EA 1R64A 3OGSA 1GMMA 3K77A 1UY3A 2XOMA 2Y64A 3K75B 3VDAA 2J22A 2VO5A 4A4AA 2VM9A 4JKLA 2V4VA 2CDOA 5IFTA 2W9XA 2VCAA 3OBAA 4OUEA 1GU3A 5DMYA 3HN3A 2JD9A 2VZVA 2J1AA 4A41A 3C7GA 1D7PM 4LHSA 4CUBA 1PX4A 2QQJA 1W9SA 3SKVA 5DN2A 2J1UA 2E33A 3WNNA 1UYZA 4XUQA 4QDSA 1RYYA 1US3A 4A45A 5C7GA 4JHZA 1J84A 3FN9A 2W1UA 3I97A 3T0DA 4XUNA 1P8JA 1T2XA 5JR2A 5F7UA 3EB7A 2VJXA 3LEGA 3I3BA 2QQOA 2W95A 2XHNA 1W9TA 5EJ1B 1JI6A 1W0NA 2J7MA 4KMQA 1US2A 1ULOA 2Y6GA 1NUKA 3MBWA 2ID4A 1L7QA 4YPJA 4ET7A 5EJZB 1JYWA 2QBXA 1PX3A 2QQMA 3HPNA 3GM8A 1CZSA 1OH4A 3VD5A 4BDVB 3HOBA 2WBKA 4CUAA 3A7QA 4IUGA 4OZOA 2JDAA 4CU7A 1NX9A 1SDDB 3MV11 4M4RA 3BN6A 5C70A 3K4ZA 3SEEA 1GUIA 5HPOA 5JXGA 2EICA 3I2IA 3FL7A 4ZY9A 2BERA 1JZ6A 1GQPA 2YG0A 1WCQA 2RJ2A 2QQIA 4TTGA 3LQCA 5EIYB 1JZ8A 1JYNA 4OMCA 1O59A 2Y6KA 4XURA 1KEXA 1GOHA 3WF4A 3CQOA 3LPFA 5IHRA
chains in the Genus database with same CATH superfamily
4LE3A 5DAXA 2Y0IA 2QQWA 3B7MA 2ZMLA 3T0AA 3FFZA 1LEMA 3E6BA 3PHMA 4XCAA 4FPHA 3B5LB 2E63A 2X5IA 3CO2A 4J1XA 3TWIA 1UN1A 4MGSA 4YLZA 2FD8A 1GV9A 1IG0A 1UXZA 1JZ4A 2PHRA 3DN7A 2VZSA 4LLOA 3HAGA 3OSDA 1BBT1 1Y9QA 5K0UB 5E1RA 1YQ6A 3RWNA 3PL0A 1UY1A 2WO3A 3H50A 4GMP1 3RFRA 3WG4A 2L9LA 4RN5A 5APAA 4ZZ8A 1TNRA 1W8TA 3DUIA 4ZXEA 2VCBA 4L11A 1H9PA 1O4YA 2UWAA 1AL0G 2XQXA 2YB7A 5T54A 2R6QA 5FLIA 3VGIA 1ASJ3 1TEIA 2A70A 5DDJ1 5C4WA 1CAXB 1PZ8A 1ZX5A 2RR13 1H8VA 1Y3TA 4XEZA 3FJSA 4MH0E 4P14A 4XABA 3ZSJA 2P6HA 5IVVA 3JCIA 4JKKA 2FCVA 3GBFA 3RPQA 1FMD2 2ZTNA 2VUJA 2CV6A 3OB8A 5BNOC 2K9ZA 3HQRA 2B5HA 2Z2SB 4Y33A 4CP1A 1NY72 1PVC2 3PTRB 2X53S 5LEKA 4BLJA 1PMJX 1S2BA 4JRLA 1JOBA 1HN1A 2QQNA 2VQUA 4LK7A 5F5CA 3LDRA 4LITA 3ZXFA 4Y5TA 2FBEA 5IWFA 5FWEA 3SCFA 3ZFFC 1X50A 1MEC3 1GWMA 1VIWB 4XXPA 4D0QA 3H1WA 4CDXA 1H6XA 5FZ6A 5BYNA 2RM23 4QX7A 3ZYFA 3AKSA 3LDKA 1KS5A 1VBA2 5IJRA 2NPIA 1D4VB 4MGIE 4NVPA 3UK9A 2DCJA 4E2GA 4FSJA 3NNGA 1T6GC 1RUF2 2B4KA 2JDYA 3I8TA 3C3VA 2GP3A 4NOTA 2P3JA 2HWD2 3T4VA 2D40A 3GNEA 2CU5A 2XJRA 4X8PA 1HIXA 1BBT3 2WNVC 3ZX7A 3R4UA 1AYM2 3ILRA 4QX8A 4CA9A 4XOGA 2ZHLA 2JDZA 3ETQA 4DFSA 5BNOB 4D69A 4NUBA 1LB2A 3U78A 4M00A 3WNKA 1DGLA 3RNSA 4YFZA 1NZIA 4AQ2A 3O1TA 4OI4A 2YC4A 3HN1A 3LOBA 1C8M2 3ZFFB 2R0HA 3NAPA 3HVDA 4RHV1 2P3KA 4UF0B 4CUGA 2DUOA 2O1QA 4HL0A 4IV1A 4XZPA 2XMLA 1AHSA 4ZS3A 3THPA 1Y43B 5FZ0A 4A7YA 2D5HA 3H8UA 2Q4SA 4NWWA 2VNRA 2RR12 3TEWA 1QJY1 5FWJA 4AVTA 4YVSC 3LDBA 1QJFA 4D7SA 3K51A 4LKEA 4JAAA 1QKQA 4MXWA 2WNVB 5DAVA 5FY5A 4QGMA 3SITA 1AR73 1DG6A 2BNNA 4V2WA 1IS3A 1DP0A 1RUE2 3JQWA 5JAXA 4NIIA 4YGBA 2QUOA 5FP4A 4RS5A 3GCXA 1D2QA 1GZWA 2ZEZA 3N9QA 4Q4V1 3JUUA 3B93A 4NRMA 4GB31 2TBVA 5B4XA 4GJYA 1RUG1 1O5UA 3PIGA 3CU7A 3L2YA 4PQQA 3NJZA 4FT8A 1UAIA 1A78A 1XNTA 1YRZA 1ZYBA 3J4UH 4EN6B 1SLTA 3VDBA 2VQTA 4MHRA 2XGXA 2YPDA 2BPA2 2WZ8A 3ECQA 3VL9A 1LEDA 1MS9A 2EXIA 3MIGA 4NAOA 3DYMA 4DXRA 2WA4A 3FBMA 2IZWA 1I1EA 4YW6A 1FPN2 1HN0A 1PM4A 2JX9A 2QKDA 3MEPA 5F39A 2AYHA 2AUYA 3GGLA 5HCBA 4NHLA 1W2NA 1RUC3 1XE8A 2VZQA 3WG1A 4YVSB 3KCCA 1IPJA 1HJGA 4FPOB 3ZXAC 3O0XA 5K8SA 3O1MA 3K3OA 1NCRC 3O12A 1CAWA 2WO7A 3T2OA 5ISLA 2ZGMA 4YGEA 4QPGA 5A7WB 5FY4A 2D3RA 4Q4Y1 3VHNA 3KQ4B 4LT5A 4WBBA 1GOFA 3NV2A 4D6QA 5A7OA 1LENA 4FP2A 5BY5A 2E51A 5DDJ2 1HRI1 3MZHA 2NMNA 1SFPA 1W3XA 5FQ0A 1QJY3 5FZ4A 4EE2A 4EN7B 2V4AA 4F7ZA 2QZ2A 5A7SA 3LEMA 3ZYPA 1YHFA 3D3AA 4FI9A 5KC6A 1LRHA 4HG6B 5BNNC 2QQLA 4AFAA 3VBFA 3NSTA 1DQ5A 4IEZA 3OCPA 5DUVA 1UOJA 4DXSA 4P00B 1DLCA 4GWNA 4R9CA 1K5JA 1DZTA 4BMBA 1UMIA 1JOPA 1RUG3 1N1VA 1AXKA 2PAKA 3LSDA 5T5JA 5IVEA 1TMF1 2HWF3 5LB6A 4UWDA 2BGOA 2C1FA 1NCRB 1O5LA 3KV9A 3O1OA 1ND3C 5DUUA 4EV0A 3VD4A 1LESA 3N36A 4GD4A 5AVAA 5IT6A 1UCXA 4FFHA 4ATEA 3VD3A 3ES1A 2VCCA 4H55A 4AL9A 2W46A 2WABA 2W91A 2BVVA 2JXAA 2ZEWA 1W9WA 3WNPA 1NZCA 2TEPA 2HBTA 1JZ3A 3GDBA 4QM9A 4A7KA 3VBSA 5L9VA 4Y3OA 1RUOA 3AKTA 2R043 2W1WA 1SEFA 1QGLA 3W59A 1W0PA 3JD73 4QKFA 4MGQA 5I91A 1N1TA 2HLEA 1GQGA 1OI6A 1G9CA 1YLLA 3I2KA 2AENA 1IQDC 2R073 4IE5A 1RUD1 5C3SA 1J3PA 2GZWA 4GKYA 3WF1A 1OT5A 3JBG1 3ZN6A 1O6UA 5A1LA 2XQRA 4XJZA 1OQDA 4RHV2 4DUXA 3VKLA 1OC1A 3VHOA 4D7YA 2OPKA 2SBAA 4OULA 2XH6A 4HBNA 1DZQA 1HRV1 1ND2C 1FV2A 4QHZA 1RXGA 3JZVA 3CMGA 1UYPA 1UKGA 2J1TA 1WZXA 1F4AA 2WWUA 3HMYA 1QJY2 4XDPA 1BKZA 3TOJA 2YZ4A 2B9VA 3KGLA 3GF6A 4XUOA 1IQAA 1LHUA 1YFXA 1VAVA 2XVKA 3ZYHA 2ZOEB 3ETPA 4Q8KA 2C26A 4FPLA 2HJIA 2LM3A 3BVCA 4FFGA 4HSJA 1H2LA 3H42B 3EO6A 3M3EA 5J3UA 4P02B 4H7LA 3POGA 1WW6A 5D21A 2ZGPA 3N9LA 5IAXA 4BMEA 4JQTA 4XJUA 4P9JA 4K9SA 4Q4V2 2E31A 2NYYA 1W2OA 2VVEA 1VRH2 2ZKNA 4GB32 3RSJA 3C7FA 1RUG2 3OPZA 4A6OA 1CD3G 3CEWA 3IIAA 2D5FA 3KD4A 3KWVA 1QOSA 3QH7A 5H9RA 3T2TA 3WDUA 4Z2AA 1VB2A 5LY1A 3BIWE 2JG8A 4XF9A 5JIAA 4Y5SA 3VZOA 3WXPA 4E4SA 4LJHA 4P9WA 1ND2B 3B02A 3ACFA 2EAAA 4JGZB 5FP8A 3TN91 5FZ1A 3BALA 5FJKA 5IK5A 5D8AC 5DPNA 1BMV1 4KI5M 2W0XA 4XPVA 4FAGA 1X36A 1OQEA 4I09A 4M3CF 4IESA 4Q1RA 4Q4Y2 2A5ZA 5ANQA 1Z78A 3J7LA 4MGZE 5L73A 5JXIA 5FYIA 2OVUA 2RS33 5KR7A 3S7EA 1HRI2 3T1LA 4JTNA 2VG9A 5A7NA 3APBA 1W8OA 3WDWA 2YFUA 3A22A 3NV1A 4A3ZA 2ETEA 2HKXA 4K8RB 3ZR5A 2ADEA 1JODA 1OF3A 4GA9A 4PIXA 5JXJA 1FI2A 1A8DA 3CJIB 5F5IA 3J7HA 5C3OA 3WF0A 2Q1ZB 4XFCA 2JDPA 2A1XA 2PTMA 1YO8A 5JWPA 3U07A 3GJAA 3OG2A 4CCMA 1STMA 1XNBA 4WV8A 3I54A 1TMF2 5D8AB 1LOCA 4BIOA 4L9BA 5GJ6A 4RSUA 1NKGA 2WNOA 1POV1 4UYBA 5F2WA 1N3OA 1UZVA 1Q8VA 1V9U1 4B4QA 1W99A 2VMHA 1WKYA 2R061 2VPVA 1KJLA 5FYVA 3WW1A 1ALYA 4HVRA 2AACA 3TN93 4CDUC 3T0BA 3VLBB 1RITA 2GMMA 1HB1A 2YYOA 1CJPA 2NMOA 4ZU4A 3WLUA 2D3SA 4KNCA 3AP9A 5ACA1 3VKMA 1ZZBA 3CIHA 3GBWA 3N4MA 3I7DA 1Y9MA 3V64A 1CIYA 2EIEA 1JU4A 3ITQA 3P3NA 4MZUA 4Q27A 4S2FA 2CWSA 2WN2A 4JQRA 1H8TA 3C7EA 1MQTC 2ET7A 1DZRA 1MS1A 1MZ6A 2VTXJ 2Y6FA 2VUDA 1RUD2 1VB4A 4XF4A 2WRAA 1J3QA 3JBG2 2ZGTA 5CA6A 2QDRA 4CCCA 2Q1FA 1RXFA 1UF2C 4OHVA 1IS6A 5L19A 3HBZA 3U75A 3ZYJB 5C9AC 1HRV2 3VDDA 3D0JA 4ASMB 1GR3A 3MIDA 3VBOC 3H0OA 1R082 3WHTA 3OBAA 2A75A 2RHPA 5J37A 1ZZ9A 4LA3A 4CCEA 2ZAAA 4FFFA 2UURA 2VW0A 3MW3A 1VBD2 4C90A 4JC1A 3C7GA 4UFHA 2RS51 3NNMA 1QY4A 2IXKA 4X6QB 4B29A 4LHSA 5FXVA 2BP6A 3MYXA 4FPJA 4O9EA 1POV3 4QT6A 3ZFGC 4CUBA 4XMIA 5JLVA 2QVSB 3AKQA 1V9U3 4WVZA 1EPWA 2YGLA 5FLJA 2E33A 1MQTB 1W8WA 2R063 2YV8A 4TWTA 1LOBA 4CCKA 5IATA 1RYYA 2I45A 1QXPA 5E88A 3T4HB 1E5SA 3AXDA 3FN9A 5C7GA 3S7IA 1UW8A 1ST8A 4BZ4A 1UO9A 5ACA3 1UNBA 1T2XA 1HLCA 2VOWA 5FOBB 2WWJA 5D2AA 3UGGA 4RGGA 4XFFA 5FR3A 2BWCA 3KVBA 2XJSA 3EB7A 5C9AB 3LEGA 5AC91 5IAVA 1HXS3 2W95A 2J7MA 1CQ9A 3TN92 3WOGA 4YM3A 1TZOA 3MBWA 3MGUA 5CFDC 5D1IA 3USUB 2NQYA 2ZBJA 2RDNA 4ET7A 5DAPA 4IL7A 3VBUB 3RVHA 4WVWA 4IEOA 2JEMA 2JE9A 3PU8A 2QBXA 5A7PA 4DIQA 1PX3A 4IE6A 2KXLA 1J58A 5LBBA 1UZZA 1CZSA 5KXCA 3VD5A 1OVSA 5LY2A 1IG3A 4CDWB 3TEXA 2QE3A 3AJYA 2A3YA 2OW4A 3A7QA 4FAHA 5T52A 4QPIC 3QACA 1NYWA 1B35C 1WBLA 4DPNA 3BN6A 4N9HA 3TNQA 5LBFA 3V0AB 5FPAA 2ZGNA 4Q4X1 3POEA 1C5HA 4TZDA 2XJUA 4LKFA 3ZSKA 2LUWA 3FL7A 4JHTA 3DPRC 5FDBA 3O1VA 1LAJA 2B39A 3Q8FA 4DQAA 1JYCA 1Q8OA 4EN8B 2P4EA 5T5LA 5BXXA 1AZDA 3OY8B 4C1WA 1RINA 2XUEA 3RG0A 2RMU3 4ASKA 1SLIA 1V6KA 1WCQA 5CFDB 2VQAA 3LQCA 4AVCA 4TTGA 1SLCA 2NM1A 1W8FA 2JDUA 1UD1A 2UY8A 1JYNA 1WLCA 3D5OA 1QF3A 3KCXA 4XURA 1KEXA 2DFCA 5BNPA 5JOYA 4HKOA 3WF4A 4OI0A 3AM2A 5I8SA 1H2MA 1RUI1 4C0HA 4J1WA 1EAH3 2R062 2WSVA 2W08A 3AL5A 4DUWA 2R7EB 1H9WA 2HWE1 3I3DA 3OUHA 1JYTA 4IGOA 3ZFEA 4QPIB 4UW4A 3DEMA 1LKNA 4H2AA 3WSOA 2CYFA 4Z92B 1JYXA 2D44A 2GMPA 4D7TA 4KBZA 1B35B 5ACA2 2PAEA 2F17A 4GIQA 1NG0A 4I0BA 5IK4A 3AP4A 4G9SB 4XBQA 1W6PB 1ZZCA 4XVHA 3OYWA 5FK7A 5DQ0A 2JENA 1S2KA 3SH3A 1JZ2A 5CKQA 3OD4A 2WQZC 1QMJA 4LO5B 5A3LA 4OQ8A 3DPRB 2C9AA 4MLOA 4S2GA 1LNSA 4YYOA 1WCKA 1WD4A 3K4AA 5TSWA 1QJX1 4FOYA 4PJYA 5JZGC 1GFF2 2JKXA 1ENRA 4KQ7A 3O0WA 3VB9A 4LIVA 3I2GA 4HPKB 4LXLA 2XWJB 5JOWA 1MS5A 4Q0VA 4Y24A 3WD5A 1GBGA 1VBC3 2B46X 2QCSB 3LKJA 2PYTA 4YVWA 2YXSA 4AGVA 3PIJA 4PLMA 4PBOA 1GZCA 5CFCA 2VBBA 1RHI2 3AB0A 4JGYC 4CUCA 2ZS6B 3BYWA 3N7LA 4FTBA 3BU7A 3NRUA 4XW3A 4DUVA 1YC61 1OUSA 2JICA 4Q4W3 3AMQA 3GBGA 4HXCA 4Y5Z0 2RS52 3CDZB 5DG2A 1PGW1 3MO4A 2PHTA 1K45A 5FV3A 5FXZA 3UJOA 3ZXLA 1TME1 3IDBB 3E1F1 2CY6A 4GWMA 4O65A 3S5AA 2H6CA 2OS2A 1YFWA 1W6OA 2P3YA 4LHNA 1RUI3 1PK6B 1GP4A 1S0GA 4M3CB 4NMIA 4WM8A 5GLVA 4YARA 1ZRIA 3PUHA 1UIKA 2HWE3 4KWUA 4LBJA 2VVDA 1G6NA 1RUH3 1U12A 2PHDA 3NKGA 5JZGB 3I2OA 2YGMA 4LO6B 1K3IA 3CNAA 3AMHA 4RD7A 1S0CA 4QGLA 1PGSA 5FBJA 1X9TA 1UX7A 1ODNA 4QU1A 1OA4A 1CX4A 2BBAA 4XZUG 2FMYA 2YDEA 2LROA 4Y1ZA 4IDZA 3WEZA 3B69A 3ZDSA 5AC92 3RJ2X 3H8RA 1JYVA 2A73B 4MYEA 4JGYB 5FK8A 5FZEA 3ILNA 1B09A 1OXCA 4XYXA 3OGVA 1NXMA 3I3MA 4JDMA 2I74A 2JB8A 5A3UA 4CEWC 1XNCA 1W8ZA 4INDA 3UV9A 4QX3A 5LBCA 3KB5A 4JDNA 1FT9A 1W6QA 1WA6X 2A3XA 2JDNA 1WBFA 4XJ9A 3RDIA 1QQP1 2NN8A 4AEDC 4LUKA 2V5DA 1GSLA 2BFUS 5CB7A 2HWB2 4CZSA 3R4DB 4K7JA 3ZR6A 1FXZA 4XTPA 2Y38A 2ARBA 1DYOA 1F15A 2BOIA 3V65A 1BEV1 1Q43A 3UT0A 5K0UA 4DS0A 3LEKA 4LORA 5JPNB 1W28A 1O8PA 3IIIA 4EN9B 2BJSA 2E6VA 4Q4X2 3VN4A 1F35A 2F4LA 1PMHX 2X8KA 3VBHA 1W39A 4DRVA 4LBQB 1JBCA 1AJOA 1PVC3 1VR3A 1PNFA 5C71A 4CXXA 2XJTA 1BHGA 1DGWX 4NHMA 4OUMA 2IUWA 3ZIWA 5C8CC 3AJZA 4GXLA 4LBOA 3VUOA 3LAGA 4AF9A 4CEWB 5A6QA 3FUQA 1YEWA 2WFF1 1Z0HA 5F9TA 1OFNA 1SPPB 5JUVA 2VNOA 1RUE1 4IE7A 1UWWA 4NPRA 5EP9A 3ZVXA 4AEDB 4NIAA 4NN0A 1EUTA 4E9KA 1RUF3 1TNFA 2GAUA 3CKHA 5JIUA 3AK0A 4EZHA 3O1UA 4KWLA 2HWD3 2HWE2 3CZUA 2E26A 3FFQA 4OUSA 4PIYA 1APNA 1KFUL 3ZSEA 2JJ6A 2Y0OA 4QXHA 5FLHA 2BGCA 1IHMA 1UZ0A 2DF7A 2IVJA 4NIHA 3EHKA 1AYM3 3J7MA 4Y22B 4M0NA 2NLRA 5EPAA 1OD3A 2FMDA 2WS91 3QOPA 4AZZA 5A1AA 4JZRA 3LFIA 3NV4A 1O8SA 3S6PA 3VZJA 1FPN1 4WM7C 1H4GA 3K3NA 4K1YA 4Q29A 1DFQA 1SLAA 2BVBA 2YPJA 4EWAA 3C7HA 2VR4A 3IDEA 3PVEA 1QJX2 2ZPXA 3KV5A 3L2HA 3IN9A 1C8M3 4Z82A 1BEV3 5EJ3A 4FPCA 5F3GA 5C8CB 1FAYA 1UMHA 4NRPA 3QLQA 3WDYA 2BOJA 1SG3A 3AKPA 2WLQA 3OPTA 5GLTA 3BGAA 1S0IA 3VBRC 1SQ4A 2KR2A 5FYYA 4LULA 5BNOA 5HBAA 3I2HA 2WT2A 2HYXA 3WDTA 1HV1A 1XSRA 2C24A 1R1ZA 4BB3A 4YG0A 5FYMA 3HQUA 3WHUA 2OIIA 1ZRCA 3NJXA 4MX3A 1O4ZA 2OUHA 1PO22 5F37A 4XUTA 3ZFFA 3HNMA 3S57A 1M06G 2WN3A 4LBNA 3ZSLA 1EV12 1GNHA 1PGW2 4UF0A 1TME2 5DZEA 3P1IA 2BBVA 2PFWA 1SFYA 3AZXA 1RUE3 2VL4A 3PDQA 5M0TA 4FTSA 4AW7A 4WM7B 1H1MA 5JCTA 3BPSA 3A4UA 5F3CA 2ORXA 3THTA 1SACA 5A1FA 2VZOA 4ZXKA 1HDKA 2K2SA 4LR4A 3ZXDA 3E6DA 3MIBA 4XQDA 3J7NA 5SV5A 4CSWA 3JXSA 2YFZA 2DVGA 2WNVA 4ES9A 5HI0A 2ILMA 4R52A 3KT1A 3RQ0A 3VBRB 4YZ1A 1UMZA 4META 4K40A 4QXBA 5JMOA 2G4IA 1RIRA 4HMZA 3OEAA 1WA4A 3SISA 1FPN3 1OPOA 3I4IA 5FYTA 4C91A 1H1AA 2IXHA 1PIV1 2DCKA 1CAVA 2Z79A 4COUA 2GNTA 2VMGA 1SCSA 2W52A 1ENXA 3A21A 3IM0A 3OF1A 4LOTA 5I0SA 4UFKA 3F2ZA 4E8CA 1SBDA 4GMP3 1OOPC 1UIJA 4AAPA 4I02A 3FLPA 2ZGQA 2BEOA 4V1PA 3WP3A 2YY1A 2JDHA 1QQP2 4FOWA 5FY8A 3T08A 4XDOA 4MADA 4H7MA 2IXLA 4IE4A 1N47A 3LA3A 1UOBA 4N53C 3WDVA 5DDJ3 3M3QA 5DUXA 3WP6A 5C33A 4YZ5A 3EBRA 3ZYRA 1JHJA 3BCWA 1AUYA 4H3WA 1BEV2 4ZKTB 4AFMA 3IKWA 5FZIA 4BPZA 4RA0A 4YVSA 3RI8A 1A3KA 1W8NA 3IPVB 3GALA 3TEYA 1U5YA 5A7WA 5FCCA 4GWIA 1KDMA 5C3RA 1FNZA 2D6NA 1LODA 5FP3A 4QQ2A 2ENRA 2R30A 5J7MA 2VD7A 1DF0A 2ZHKA 1XBFA 1LU2A 1VJ2A 3POYA 3BIEA 4CP2A 4URTA 4BH9A 2BRTA 2WFF2 2WYSA 3O1PA 1OOPB 1YCIA 2TNFA 1DQ1A 3AP7A 4YWAA 2A71A 3VDCA 1LOFC 1VALA 3O1SA 1OH3A 4Q0PA 5F5AA 4JKMA 1H30A 2K0GA 4N53B 3ZMNA 5KC5A 5JR7B 5FZFA 1VRH1 2BQPA 4LE4A 3BPZA 4XBLA 2CGPA 2Q8OA 4OI1A 4DEVA 5F3EA 2BNOA 2RDQA 2DVAA 5T55A 4XQ4A 5FY1A 3ZKUA 4CDXB 1NCRA 2FDHA 4BQ1A 5FXXA 4IEXA 3ZN5A 1JTZX 2WS92 3WQBA 4AQSA 4B1LA 1XYPA 4QU2A 4BJ0A 3UKTA 5JXHA 5HCFA 1FATA 1PMIA 1WLWA 1ENQA 1OKOA 1ULFA 3MW2A 4W6YA 4A3XA 1V6IA 3P6BA 3BTAA 4UW5A 1ZNPA 2EXJA 3N9OA 4W4ZA 4XMAA 2LALA 5FMDA 4BISA 5LW9A 1W03A 3M1HA 4S2DA 2Z5WA 4CU9A 2NZ9A 1BJQA 4XQWA 2F4PA 4NHYA 4RHV3 2XXZA 5KXDA 4H14A 3U0ZA 5FP7A 4AEMA 4E8DA 3UL2A 4M3CE 3OPWA 4Q0SA 4AHYA 3C8XA 1HJFA 4LA2A 5BNNA 3RZJA 2WINB 1ULCA 1Q8QA 2GC0A 2NP0A 1WMDA 5A3MA 3U4SA 2R1DA 1LHWA 5EHDA 3RZZA 1O3QA 2W87A 1LULA 4ES8A 4RR3C 3HT1A 2VZ3A 2WT0A 3HEIA 1OLRA 2J1VA 2WL1A 2FCTA 4OVEA 3HWJA 1U5ZA 4E27A 1AVBA 1ND3A 1W6NB 4HN1A 4EWDA 4BWOA 4BQ5A 4HVQA 2ES3A 4I3GA 2PHLA 3SCHA 2X09A 5CISA 1FOD1 4Q4V3 1K42A 4CDQC 4M0HA 1VRH3 3MIHA 4FQZA 4GB33 2VC9A 5CKNA 4BQYA 1OD5A 3IZOA 2DDUA 4HFSA 4PI2A 1JN2P 3J8F1 3WCRA 3HIFA 3MUY1 1S2EA 2D6LX 4PLNA 4UOJA 4AFBA 1IS5A 3RRDA 4P9LA 5FTTC 1Q5OA 5CKMA 2R1BA 2YU2A 3D4KA 1MZFA 5HV4A 3NJYA 3FHQA 1GLHA 4XXAA 2ATFA 1C1FA 1YNAA 5H9PA 3UKNA 2ARCA 1PIV2 4DEQA 2MEV1 1GZWB 2GDFA 4A7ZA 3EMRA 2ZX2A 4RR3B 3MICA 4XF1A 5T3NA 4CXYA 1GMMA 4OHZA 4UFMA 5FO8B 4PDWC 2XOMA 2Y64A 4KG0A 5KXEA 4N90A 1G9DA 1PO12 2DBIA 4Q4Y3 5FP9A 1G9FA 1L7LA 1VMFA 2GH8A 2VUCA 4A4AA 4E2QA 3TAYA 4E4HA 1ND2A 1O91A 1W8UA 2DVFA 3KHBA 1HRI3 4FPKA 5FXWA 5T50A 2V4VA 2YC0A 3H1YA 3AVSA 4CDQB 1BYHA 2JG9C 5IFTA 2ZGLA 3AMMA 2P5BA 1XRUA 4Y26A 4U2AA 5IVBA 3MF6A 3RMYA 3MPPG 2VZVA 3WVJA 2RJLA 1D4M1 1D0HA 1WLDA 2J1AA 3I59B 2GC3A 5A3WA 1IZ3A 2WT1A 1GANA 1D7PM 1G86A 2YUEA 5FMBA 5EWSA 5E6HA 3WZ1A 3Q8BA 4BCUA 4JGZC 5K4LA 5A3TA 1HB4A 1R081 2Z69A 2WZR2 3H1MA 5IUQA 1W9SA 1L3JA 2FDGA 1COV2 3SKVA 3H8XA 1X8MA 4K21A 5FQ0B 3CL1A 4ASLA 2J1UA 1VBD1 5FPXA 1DU3D 1O4TA 2DYCA 1TMF3 4NPLA 3J8F3 5BUVA 2VECA 4YGDA 1SDWA 4LNVA 4PDWB 1YI7A 4WVMB 5JI9A 2GSYA 2O8OA 1OMIA 3FLRA 3I97A 2C5DA 4XUNA 2CWMA 2QJVA 4KU8A 2Y60A 3RZGA 1N3PA 4IXLA 3H7JA 2R49A 4HZFA 3NW4A 1ULEA 5F7UA 3VKFC 4XHBA 1IS4A 1KS4A 1SLBA 2VJXA 3KSCA 3O14A 5B2GB 3I3BA 1VAMA 3WW4A 4FPYA 2QQOA 2JG9B 5I8YA 1W0NA 3H7YA 5D8AA 4KMQA 1US2A 1ULOA 3CJIC 3RI9A 3AL6A 1Z7S1 1VP6A 4MGKE 2ID4A 4FVVA 1LHOA 4IEPA 4YPJA 5EJZB 2DTWA 3KV6A 2BTVC 2QNKA 3U14A 3UKVA 3O0VA 3U4XA 1RUD3 2BYVE 4ZS2A 4AFDA 4SBVA 3JBG3 2DWRA 2WNEA 1DYKA 1V6MA 4LUMA 5A32B 4OZOA 1QEXA 3BI3A 1ZBE1 2FHRA 1NX9A 5JSOA 1UPIA 3KZ4C 3ZO0B 2UYAA 3DCQA 4M4RA 1OLME 4AK3A 1H2NA 2KM2A 3ON7A 2JIGA 3NNJA 1HRV3 1GUIA 3WP4A 2D7FA 3M8LA 2EICA 1R083 3FWEA 3KVAA 1MS3A 3M4FA 2XJPA 1JXNA 1ULGA 5FY9A 1JUHA 2D43A 3WW3A 5KHKA 2IXCA 4AXOA 2UWCA 1VBD3 5DAWA 5E89A 5H9SA 1NLQA 3URFA 4YW5A 1JZ6A 2HEYF 2LRPA 4CPBA 1YFYA 2YG0A 2K46A 1A34A 2X29A 2MNGA 3H8OA 1J1TA 2ARAA 3J26N 4OMCA 3ROUA 1O59A 3LD8A 1LGNA 3NNFA 4GAZA 3MLKA 3C2UA 4GQ7A 2ZMKA 1GOHA 3AZWA 3CQOA 4QWNA 1V70A 1FOD2 1MS8A 2WWSA 3LPFA 4LMFA 3B01A 5F8PA 1XC6A 1BMV2 4IEVA 1EP0A 3AMNA 4TLGA 4CDUA 1D2SA 3J8F2 1DHKB 3B94A 2DBNA 3ZYBA 1S0EA 3CZJA 1DBNA 2ZGRA 1W05A 3ACHA 5FO7B 1LECA 4LEJA 4AR2A 5IVJA 3BTXA 2P3IA 2C0ZA 1SMVA 3ZSMA 2FDKA 3EXUA 3PJQA 1OF4A 4Y1YA 3KF3A 1MQTA 1XOYA 5LRSA 1YXWA 1HV0A 1REFA 1XPWA 2FZ1A 2MEV2 3POIA 3NKTA 1VPHA 4N43C 2A3WA 2JDKA 3R4SA 1SZBA 3B00A 3W9AA 2CDPA 4MGTA 1UY2A 1VBB1 1CX1A 3EYPA 3BTYA 4Q0QA 4FTEA 3UYJA 2BDRA 5C9AA 3N3HA 4UI9L 3I49A 1NE6A 2WQ4A 4HK9A 4RFT0 2Q5TA 3VBOA 4UBGA 3VZKA 5K9YA 1BZWA 2VBPA 3G7DA 3USUA 2JDMA 1WMFA 4Y20B 4ISRA 2GU9A 3MLJA 3M3OA 3I2JA 4NHXA 1D4M2 4PCRA 4UFLA 1AL22 3ZFGA 3TRSB 1RHI1 2AH2A 2BZDA 5CU1A 4DY3A 4EROA 1F8VA 5IYYA 4XFGA 2J1SA 2N7GA 4TSVA 2WA3A 1MVEA 4PHZA 3WINE 2VE1A 1EPZA 3MFAA 1RMU1 4WZFA 5FKCA 3VBUC 4N43B 4FCAA 3THDA 4B8EA 1G9AA 1CGPA 2FZ2A 1HQWA 3V0AA 5FPUA 2F6BA 2W1SA 2ARXA 2B9UA 5FYHA 5EYXA 4B4RA 4BXFA 4CDWC 2X10A 2P34A 1BK1A 4XJ8A 1AXYA 5A80A 2W92A 4HANA 2O14A 2VMCA 3J9SA 1H1IA 3OY8A 4P5HA 3HT2A 1A6CA 4C8DA 2PXJA 3GZTB 3IB3A 4G3YC 5CFDA 5FUIA 1NLRA 2J42A 3LFMA 1REDA 2EIBA 1W2AX 5GZDA 1OHFA 1Z7S2 5CZKA 5CADA 3PU3A 5FOJB 5J96B 1R091 4ISQA 4YZ4A 3MUZ1 2JE8A 1VBB3 5GM0A 5L7OC 4CU6A 1POV0 3NQHA 4XC9A 3K46A 2RE9A 3T3YA 4X8NA 3T2PA 2RG4A 4RQPC 3ZXKA 4AI1A 4CTEA 4QX1A 3H3UA 4QPIA 2XKOA 5LASA 4IEYA 4NROA 3FBYA 2JWPA 4ZONA 2HYKA 1B35A 3UGFA 1VAKA 1ZBE2 1CZTA 2FDIA 1W6PA 4QPWA 1V6JA 3TEZA 3IT8A 3O1RA 2HWB1 4CXWA 1QJU2 4CEYC 2ZHNA 1RHI3 3DPRA 4XFIA 3FUOA 2QFEA 2PN5A 1X9PA 4IV3C 1QJZA 1EUUA 1KITA 5GZEA 1MS0A 2AGSA 5B4NA 4NPMA 2WAOA 3SEPA 4QX2A 5L9RA 4A6SA 3KT7A 2ERFA 2RS53 1MVQA 2G19A 3I2FA 3FMGA 4NO4A 1W90A 2C9KA 4HPKA 1UX6A 4LO4B 4V2VA 5EQUA 2WNUC 2XLGA 3I2DA 3VHPA 4DXTA 3AYCA 5C5TA 2XBO1 4AWDA 1BVP1 2RS11 5L7OB 1WLTA 2G9ZA 4LBLA 2PA7A 3MIEA 3IDCB 1V6OA 3VDDB 1I9RA 1YFUA 4IQPA 4FQ4A 1NE4A 4RQPB 3WT3A 5T5OA 2VU9A 5HCHA 4X6RB 2XONA 1RUNA 2W47A 2EIGA 4CP9B 3LA7A 2DCYA 4W8JA 4BYYA 3OD0A 2D6PA 2CHHA 3LCPA 1MACA 1Q3EA 1WWYA 3AFGA 1NLSA 4HK8A 5AC93 2GN3A 2D98A 3AKRA 2AEYA 3LGRA 4CEYB 4UAPA 4I2OA 3C7OA 4IE0A 4MG2A 3ACGA 4IV3B 4D94A 4DZGA 3CBNA 2WO2A 1HKDA 4UBHA 4RFRB 5JZGA 3BUCA 3V0BB 1CZVA 2GN7A 4YM2A 5GZCA 3RMXA 3GHMA 5J36A 5K7PA 4QQOA 1HB2A 1VBB2 2WNUB 3E5QA 5LK7B 1PM7A 5GLUA 1PK6C 3ZYIB 4O9GA 2IC1A 2PLV1 2HWB3 1PVXA 3FHIB 5F1RA 5A33B 1QXRA 4Z07A 1DQ6A 4JGYA 5FPZA 3LF7A 3OOXA 1XU2A 5JI7A 2IVIB 2E32A 1H0BA 1CAUB 2V72A 3NVCA 3OJBA 4OQ9A 3ZIXA 4FXGB 4QB2A 4XFBA 5G04L 2XDVA 4Q4X3 1HB3A 3GZUC 3M3CA 4ZU7A 2HH9A 2WR9A 3PUIA 3SH4A 3QBQA 3MF9A 1CPNA 2Y6LA 3RJRA 3OBRA 2UY9A 3A0NA 4A42A 2EAKA 2O0OA 4CVUA 5FYUA 2W94A 3WNOA 1PO21 5LA2A 4ZU5A 2PHXA 2VW2A 3SHRA 1TQ5A 1RMU2 2VAUA 1EV11 4AHZA 1K5MC 4HLTA 1R1A1 3TB0A 1FX5A 1OA2A 3PLQA 1U5IA 2YBKA 4A44A 5FZOB 3AYDA 4P9XA 5EFUA 1Q8PA 3HJRA 5LBEA 3MI8A 1RC6A 2BWAA 3WG2A 4F3JA 3WX5A 1C57A 3N9PA 1J83A 4XFHA 3OTFA 4LOSA 1IKPA 1S0FA 4B3NA 5EZWA 4GH4C 1V6NA 4K20A 2HBUA 2RJKA 1RVF1 4MHUA 4HOOA 4ATFA 4CEWA 1BLZA 4YSFA 1QWRA 1CWPA 4QDRA 1OFSA 1R092 1ULDA 2SLIA 1UKRA 5ABJA 1SPPA 1WW7A 4CPBD 2VOKA 4AEDA 3AYEA 4AG4A 2W39A 4COVA 4E4DX 3VHRA 3AYAA 3UGHA 1GZTA 1W9YA 1OURA 2XR4A 1S0DA 4FOQA 4RL7A 1W8HA 1Y4WA 1QJX3 3FLTA 4JVAA 5FREA 1JZ5A 1CN1A 1VBE1 4F83A 1ONAA 4W6XA 5LCWL 3AP6A 4YZ3A 1I6XA 2GNMA 1X82A 5C8WA 1XNDA 1K5MB 4ITCA 3A23A 2W5FA 3IBMA 5FZ9A 4XF0A 3HD8B 1PZ9A 2ADDA 2AC1A 3BODA 5FPBA 5FZCA 1AXZA 4R9BA 2OT7A 3SNMA 2Q0AA 4YFWA 1XXNA 4N9IA 4BA6A 4LBKA 3DECA 2C6SA 4ZPIA 4FPFA 1KJRA 5CBLA 4QAWA 2Q8CA 3JB8A 1PO23 5FJHA 2JECA 4HN0A 2HWC1 4MO3M 5FYSA 2RDSA 3AFKA 5C8CA 1ZRFA 4GH4B 1YUDA 5A6YA 3S0MA 1TE1B 1EV13 5FZLA 2IFRA 4L97A 1UY4A 5E16A 4BQWA 2ZX3A 3NMBA 3E6CC 4Q1PA 1TME3 2G1MA 2XL7A 4QB6A 2AREA 5E8AA 3T09A 3WUDA 4ZHNA 2XBO2 2RS12 4AAXA 4MV2A 3BU0A 4XAEA 2D3PA 1CAXA 1JHNA 1NQDA 4HT1T 5KHIA 1UQXA 1E5RA 3JB4C 1JU3A 4YZ2A 4NIGA 1LOGA 1QIQA 3K4DA 3VKOA 3DGTA 4OMDA 1JOJA 4OHXA 5A3OA 1NA1C 3KQRA 4QD2A 4XILA 4P08A 3BTZA 2E9QA 3M70A 4CCLA 5C6CA 1W6OB 3WQ7A 1OLMA 5FMOL 4WM7A 3WF3A 4OZXA 4LIUA 4PLOA 4WM8B 2E7AA 5FZGA 4GWJA 3KGZA 4DB5A 1IKQA 3OBTA 3V56A 3G6JB 3WF2A 3T2QA 5ERLA 3LIHA 2MPFA 2JD4A 2AZ5A 2VGDA 1NQJA 3LSEA 4HETA 4PBPA 4NE9A 2PAMA 1QQP3 3VBRA 4EWEA 1Q56A 2PLV2 4JX0A 4R4ZA 4KG8A 4RGKA 1SCRA 4A2UA 4GKXA 1SBFA 1NCQC 3IMMA 4P5YA 3W5MA 1Q8SA 2CGOA 1S0BA 4K6BA 2HWC3 5JVVA 2OX0A 2YC2A 1W6MB 4XETA 2J1RA 4IEUA 1O7FA 4K3UA 2EA7A 1NA1B 5LA0A 1I5PA 2VY0A 2XB6C 4W50A 2YHJA 2RM21 2VCMA 4MXVA 3WV6A 1KGYA 2JB4A 5FKBA 1XYOA 2OYZA 3FHAA 3VV1A 4AVVA 2VW1A 2ZCWA 4Q5OA 5FMOS 4UW3A 1J59A 3KM5A 2XVGA 5DZGA 4DXZA 4O61A 3E5XA 3IPVA 3DF0A 2WFF3 2WDBA 2GALA 3MFCA 4I3PA 1R1A2 4FPGA 2VZRA 4AQ6A 4C1XA 1FV3A 1RUJ1 3WP5A 1GQHA 2IWGB 4BQ3A 1CJDA 3VBHB 3FC0A 2X5IC 1G8WA 4EJRA 1GZ9A 1X33A 2A6WA 3LZZA 1NCQB 3IDAA 1GNZA 4D6RA 1MZ5A 2P6CA 5GKAC 3AZVA 1JZ7A 4RYDA 2A6YA 1RVF2 2OQ7A 3THCA 4DRRA 5T5PA 2OUJA 5CNAA 1E5IA 5FFOC 3RGBA 2WS93 1OOPA 3K77A 2XJVA 4OCTA 4YW3A 2XPJA 3ZPOA 1UY3A 4YW4A 3K75B 3VDAA 5FBZA 5IK8A 3DV8A 4IW3A 2J22A 5C4WC 4N53A 2DVDA 2VO5A 3SXWA 4UFIA 5FZHA 4JRAA 4LBMA 4MSVA 4COWA 1PHMA 1OQ1A 1VBE2 1ZA7A 2VM9A 3GHNA 4P9GA 5FYZA 5EYYA 2FQPA 3LA2A 3LOIA 1PO11 1NXD1 2VCAA 4XACA 3KHCA 5F6KA 3PVOA 2W68A 4OUEA 2QQPA 1AR71 1GU3A 4Q0UA 3LIGA 5FZAA 5A6XA 1S1AA 5DMYA 3SQOA 2E7QA 3NO8A 1QDCA 2GNDA 2X5IB 4Y1XA 3RYPA 3TBDA 4CP0A 5CG8A 1V00A 2WSUA 4K1ZA 1XNKA 2QQJA 2HWC2 2GH2A 1GKBA 2VTXA 4NR1A 5FZ8A 4CDXC 5F32A 1MS4A 4FO9A 5FZKA 2V5YA 3RYRA 1VE0A 4GMP0 4P9YA 1IGOA 3MIFA 1XQNA 4QDSA 1RUJ3 4TN7A 3MPBA 1LOFA 2CTVA 2QTWB 2W1UA 2WZR1 1W0OA 4XIOA 3OGGA 1COV1 1P8JA 5AFBA 3H3ZA 5C4WB 3T0DA 3ZXEA 4AI9A 4FOVA 3ZXJA 1OKQA 2AEZA 5KHGA 1QDOA 1RUC1 4QQLA 4AI0A 2PQQA 4UT5A 4BM8A 5FPLA 4WVVA 2XHNA 1W9TA 1W6NA 3DKWA 2Y6GA 2OXBA 3AX4A 3PTYA 5A70A 3UJQA 4ONUA 1ENSA 4CYDA 1L7QA 2AR6A 1PIV3 1ASJ2 1ZM1A 1W3VA 2ZZQA 4BE3A 4FXKB 3JQXA 4BQXA 1W04A 1RJ7A 1RTVA 4XE9A 1ZZ7A 2QQMA 4J25A 1SBEA 3ZMOA 3NAPC 1OH4A 2WBKA 2DU1A 1I5ZA 1PO13 4IUGA 4LTAA 5GLWA 1AX1A 4R4XA 2XLFA 4W6WA 1JS9A 3ENRA 4IV1C 3WY6A 3MV11 3TNPB 1G7YA 3WG3A 2B7YA 5C70A 3NNLA 5KWRA 1PNGA 4LBQD 4I0AA 1CAVB 1V6LA 3K2OA 3I2IA 3HQXA 2OA2A 5GZGA 1QXJA 4S2HA 4RR3A 4AGGA 1MEC2 2PHWA 2BERA 4GJZA 2HWF1 1LHNA 5BNQA 4OFGA 4D8MA 4W65A 2RM22 1GQPA 4IGQA 2VUAA 5JSPA 3PVBB 4Y4YA 5EIYB 2WZR3 5FY0A 4RS5C 1COV3 1N1YA 4QGNA 4PI0A 5BPXA 1O3SA 3H3LA 4CDQA 3POBA 4M01A 4FPEA 2H0BA 3ST7A 3WUCA 4OLLA 1C1LA 3K48A 4JCKA 3NAPB 4UFJA 5FYCA 3EQEA 2ZAHA 4NJ4A 2BW8A 4EN0A 1BBT2 1XYNA 2H0VA 4QQPA 2WZPP 2ZJCA 2ZA9A 1JMUB 3S5QA 1G9BA 2FDFA 2P2KA 3I59A 2EIDA 2R041 2Y34A 1RUJ2 2YROA 3KS7A 3JD71 1LGCA 4IV1B 2ZACA 1XU1A 2WQ8A 1OLQA 2DFBA 3B3QE 3Q8AA 2D6MA 3SKJE 3PUSA 2ET1A 2R071 3VD7A 1FYUA 1CPMA 3ZFEC 1OA3A 3Q8EA 2PELA 2Y8KA 3BOPA 5J48A 3KT4A 2DTYA 4I30A 1N3QA 4MXWB 5LA1A 1MPXA 4PDWA 4QPGC 4WVMA 4Y1VA 4M4PA 5LK5A 1X8EA 4L8QA 5DXDA 3NJVA 4CCJA 4DNYA 4FP3A 4IEQA 1OBNA 4RS5B 2LW8A 3W58A 4PT6A 3VD9A 2WIIB 4Y1UA 3T30A 3U37A 2VULA 2ZX0A 3LEIA 1YQ8A 2GP5A 4F8AA 2JG9A 3IAPA 2B8MA 1JW6A 5CAZA 1UY0A 4XUPA 2CAVA 5GZFA 4TYSA 1GP6A 4AVAA 2ZEXA 1AR72 4QX5A 1QNYA 1QH7A 5IVCA 1YJKA 3ALQA 5J1XA 1ZRRA 3VBFC 2FDJA 4JGZA 2PHFA 2PMWB 4YW7A 3RYKA 2DUPA 2J1EA 3BKZA 1H6YA 4HKLA 1LHVA 4XFAA 4OYUA 4PF5A 5FZ7A 2IXIA 4E4ZA 2VBDA 1AF9A 2VNGA 1JUIA 2QZ3A 5A32A 4YNIA 1CAWB 2E7TA 2EVXA 4QPGB 1AL21 5L9BA 4AE2A 1K12A 5EV7A 5BNNB 1FOD3 3R0RA 2ZX1A 4PF1A 4BLIA 1TVGA 2QDNA 1N1SA 3FZ3A 5IFPA 1J1LA 2WAAA 1UU4A 1RUC2 1F2NA 2XG3A 4JDOA 4GALA 3VBSC 2Y6HA 3CHXA 2ZX4A 2XVLA 3CJIA 4R8HA 5GALA 2VQ0A 1ND3B 4SLIA 2ORZA 5A3NA 5J09A 2VOTA 2A6XA 4AVSA 5JOZA 3VBFB 3Q9OA 1F5FA 2QQVA 2RS31 1VRBA 3DYOA 2QQUA 1F5JA 2MEV3 4XCBA 2RVAA 5JOXA 2Y33A 4KU7A 5A6ZA 2DCZA 3WQ0A 3H9AA 5FUNA 1WW5A 2BNMA 4OHWA 3U10A 2ZKLA 2VXJA 5JMCA 1UOGA 1KQRA 2DV9A 2LS6A 1X7NA 5HV0A 1DQ0A 1GICA 4J6GA 4L0PA 4NWVA 1UL9A 1KDKA 2HEVF 4XHXA 2R32A 4LO7A 1O3TA 2Q8EA 5F2SA 1WGPA 3OGRA 2VZPA 3A0KA 3RZKA 3DXTA 2YBSA 1XE0A 3SH5A 4COZA 5HXVA 5I0UA 3E5UA 4K8FA 2GNBA 4QKDA 3DKQA 3ES4A 4NAMA 4AOCA 5FO9B 4IETA 4XF3A 1XB9A 2HWF2 2LTNA 1XNAA 3Q8CA 3VBSB 1D4M3 3W20A 2WO1A 3E97A 4CCNA 4QX0A 4XIKA 1AL23 1PZ7A 1ULPA 3VZMA 1QJU1 2A7AA 2W1QA 1EYBA 4CRQA 4OHYA 2YBPA 2BUKA 1AR91 5C5UA 1DIWA 4CU8A 1YQ5A 5EXOA 3ZDVA 4C0BA 3POJA 3W5NA 3NWKA 5LATA 1LOEA 3MV01 3M3IA 3ZN6B 1L7RA 4ARXA 1LGBA 5DAQA 1RB8G 4Y20A 1BQPA 1U0AA 3ME2A 5FZDA 4DINB 2JG8C 1T6BX 2R042 4LHLA 2D6OX 3JD72 4DY5A 3DYPA 3AMPA 3B9CA 1BVVA 1DLLA 3LE0A 1ZREA 5ANNA 5I0DA 2EXKA 2R072 4O7XA 5BV6A 4CCOA 2FCUA 3ZOIA 1CESA 2VZ1A 4LLFA 2EXHA 4KWKA 1VMJA 3DXUA 4N43A 2JIJA 1Z7S3 2GMEA 3WNLA 1AR61 2WC2A 2DCTA 1A8MA 3D8CA 3ACIA 4AEJA 3QCWA 3ILFA 3HR9A 2VH9A 1S55A 4YRDA 5CYYA 4YW1A 3D0SA 4XTMA 3KV4A 1ZBE3 3PJYA 5CEHA 4YM0A 1WMXA 3GCWA 3ZM8A 1KFXL 2XUMA 4NRQA 1HQLA 2JG8B 2OPWA 4TXWA 1QJU3 3PMEA 3CF6E 4LKSA 1IOAA 3VL8A 1OVPA 1UU6A 4EQVA 1AR93 1OPMA 5F3IA 1JH5A 2P1BA 1UZWA 4EYUA 1ZZ6A 2XHKA 2D6KA 5J98B 1QHDA 2VTFA 5FZMA 1UXXX 1MR5A 3ABZA 3JU9A 3VBUA 5AFEA 1C4RA 5KXBA 1LCLA 3KMHA 2CNAA 3POSA 5GLZA 4N7UA 1ZRDA 1W2TA 1DCSA 1DYPA 2IXJA 3M7AA 4LHKA 4MGYE 2A6VA 4Y4RA 3W21A 4CDWA 4BOWA 3I3EA 2VZTA 2IFWA 1HXS1 3HNYM 5JSRA 1BK0A 4MVTA 1QH6A 1KRIA 3PVNA 1HQNA 2VNVA 4QXKA 2C4XA 2VZUA 2BV4A 3POFA 3OEBA 5F6LB 4P9IA 4B7KA 1AR63 1YWKA 2JE7A 3IAQA 3KCYA 2UWBA 1AR81 3ORJA 4G4FA 4AYUA 4NIDA 1RL3A 3ZKYA 4E2SA 4AI8A 1H8TC 2YU1A 5L7OA 5FRAA 4EZ4A 4HKWA 5IW0A 2Z42A 3UNPA 1C8NA 2RS32 1AJKA 2EF6A 4RQPA 3LPGA 2VMEA 1POQA 4BU2A 4NHKA 4CDUB 1DGRA 1E57A 3D6EA 4CP9A 4QQHA 2ZMNA 3PNAA 1Y9GA 2Q1MA 3HBKA 4YM1A 2PQSA 3LWCA 4N8MA 1AYN1 2RV9A 1OUXA 5CIRA 4BHPA 2B45X 3VDDC 4B4PA 4D6SA 3ZPYA 4CEYA 1QOOA 4LQRA 2BGPA 4LPLA 3T1MA 3B9IA 1TG7A 1J3RA 1REEA 2WFPA 3GZEA 4IV3A 1PGL1 2RMU1 1UOFA 5I0TA 5A7QA 1UYYA 5DABA 5SV8A 2E53A 4GZ9A 4JV4A 4YG3A 3V0BA 4ARYA 1AX2A 4Z8BA 2I2SA 2TUNA 2W3JA 2WNUA 4QPYA 1RGSA 4AHWA 4Z1VA 3F95A 4MOAA 3PUQA 3OUIA 1H8TB 5A33A 3RWKX 2X05A 1AR92 1GWLA 3QH6A 4L99A 3ZXGA 1EAH1 5LWBA 2ZABA 1XJAA 3O7OA 1WW4A 3SCGA 3VBOB 3ZLIA 1RMU3 5KHJA 4AQTA 3WDXA 2CL2A 1WCDJ 1CAUA 5CG9A 1GOGA 1ZBA1 3N9MA 3IWZA 2P17A 4FBFA 3U1XA 4B1MA 2MHFA 3R6SA 1AR83 5LZ6A 2VOVA 5FPVA 2ZGSA 3ZYGA 3ZFGB 3RZMA 1GWKA 3X29B 2OKXA 4D3WA 5DG1A 3M2MA 4BXSV 4YG6A 3MHZA 2WZEA 3SC7X 2Y6JA 4QDQA 3D82A 4QKNA 2QQKA 3WNMA 3WQ1A 1AX0A 4QXCA 5DZFA 2WLPA 2D97A 4DOUA 1H4HA 2EALA 4COYA 3GJBA 3GXUA 2KD7A 4ORFA 1R093 1AR62 3R05A 2VMFA 5FMCA 1UYXA 2RDRA 2B42B 5FZOA 2VMDA 1AYN3 1VBC1 4AHXA 4BK5A 5ABJC 1YYNA 2CSGA 1PK6A 4I01A 4Q26A 1ZZ8A 2UU8A 1NAEA 1SHWB 3ATGA 4M3CA 5G05L 3RZHA 2JKBA 3CLPA 3MLLA 3OUJA 2G9FA 4N7IA 5FZBA 1EY2A 4GULA 3VZLA 3KLSA 5IK7A 3BOWA 1QOTA 1WUVA 2ZGKA 4XJAA 1UZYA 3SLIA 1QU0A 3OBZA 4HONA 2OQ6A 4Q4W1 5AVPA 5HCAA 4AI3A 4KGGA 2DUQA 4KWJA 1LTEA 3RZLA 5CVRA 4KBBA 1F4HA 3ZN4A 5IVFA 2DVBA 3N9NA 1SFNA 1ODMA 1SLLA 1E5HA 1V9U2 2XKPA 2ZGUA 4YGCA 3UETA 2V73A 4BK4A 2DURA 4ZZ5A 2VMIA 2WUHA 5JPMB 3AZZA 1DGRN 3HNBM 4R9AA 3AC0A 1WMEA 1FNYA 1GNYA 1RUH1 1CVNA 4QB1A 1W2UA 1URXA 1WCSA 1ZBA3 4QMAA 1K5MA 3UESA 3DL3A 3OGJA 2A6ZA 5BNPC 5FUPA 2XL9A 4QM8A 2XBO3 3PURA 4PQ9A 2RS13 3AZYA 2Y26A 4PIZA 3VKNA 1WD3A 3N35A 2ZEYA 1LR5A 4DMIA 1HXS2 1YQ2A 3NL1A 4UXAA 2ZZJA 2W2IA 2ZHMA 1V0AA 1VLNA 1VMHA 2BU9A 3U11A 1UPSA 1UU5A 4AGRA 2VVFA 4GH4A 2D93A 4RGAA 3O5SA 5KBFA 3S30A 4Q8LA 5JDBA 2PHUA 1YIPA 4AI2A 5HXMA 1IPSA 1W06A 2ZXQA 1HW5A 4HSLA 2Z4FA 1AR82 1R64A 4LBQA 3OGSA 1QNWA 3N7MA 2OZ6A 1DQ4A 1S4CA 5FAXA 3WNXA 3AXEA 1C28A 1LOAA 4LK6A 3USSA 1YIFA 4R9DA 4JKLA 4DO0A 4I0WB 2I07B 2VOXA 1MZEA 1FMD1 1F31A 1YJLA 3PUAA 3NV3A 3IMNA 1AYN2 4YVWC 5BNPB 2BFUL 2CDOA 2PLV3 2W9XA 2ZGOA 1O3RA 3ASIA 2H6BA 4CCDA 4HVOA 5CFCC 3MW4A 3L9JT 1NY71 1PVC1 4WZCA 4MUVA 1BXHA 2XLAA 3HN3A 3TYJA 2JD9A 3WCSA 4A41A 1LJ7A 4TLFA 5FY7A 3ZFEB 1PGL2 2RMU2 2WYFA 3GYDA 2CGNA 5A3PA 1C5IA 4Y22A 3WR0A 2R0FA 4URAA 1PX4A 1BCXA 3ELNA 2O8QA 3EJKA 3P3PA 4CE8A 1DQ2A 2GC2A 3OYWB 5DN2A 5DUWA 2XJQA 1JYIA 4YW2A 1D0GA 1WCUA 4U36A 5I8TA 1VBA1 5H9QA 3WNNA 1UYZA 4UW6A 4WM8C 4XUQA 1RUF1 1US3A 4A45A 1EAH2 2V09A 4AFCA 4BIFA 4JHZA 1J84A 1KD7A 1CIWA 2HWD1 4KGQA 5C3QA 1IPKA 3N7JA 1U5XA 1Y7BA 5LEJA 1DDLA 1NT0A 3LB9A 2KA3A 3BB6A 5JR2A 3AVRA 1W6MA 3VZNA 1ZBA2 5FZ3A 1AYM1 3FX3A 1R1A3 1NA1A 3GZAA 1F9KA 1KXGA 1LU1A 5C3PA 3POWA 4YVWB 3RS6A 1ZVFA 4AEKA 5EJ1B 4BQ4A 1JI6A 2WKKA 4AVBA 5CFCB 4XBNA 1C3HA 2P37A 4B7EA 1NUKA 1S0JA 5LA9A 5I93A 4Q2FA 4QKBA 3MDPA 1NOVA 2G9GA 2XWBB 4IGPA 1GYKA 1C8M1 5IVYA 1JYWA 1RVF3 2WJSA 5I0RA 3HPNA 3GM8A 3PMSA 4XJWA 1CR7A 1GP5A 1YI9A 4KL1A 1FMD3 4BDVB 3HOBA 1XE7A 4CUAA 2VXRA 3N7KA 1VBC2 3AP5A 3CJXA 4FFIA 1ASJ1 2YMZA 2JDAA 3I3QA 4CU7A 1SDDB 4L2NA 2RR11 2Q8DA 4LKDA 1VBE3 1XSQA 3FE5A 1NCQA 3K4ZA 3QD6A 3SEEA 5K0UC 5HPOA 1M4WA 4Q4W2 5JXGA 4JTOA 1RJ8A 4XDQA 3SMHA 4KH9A 2GC1A 4ZY9A 2CAUA 4OI2A 3WW2A 4IEWA 4QHBA 3VBHC 4Z2WA 3ACLA 5ABJB 3KF5A 5LRRA 1VBA3 1I3HA 1CONA 1YQCA 1QJEA 2DU0A 2UYBA 4IERA 1RUI2 2R16A 5F5QA 1W9FA 2RJ2A 2QQIA 4L92A 1OSGA 2Q30A 4QHOA 5FYBA 1JZ8A 1DGWA 2OZJA 1ZA4A 1MEC1 4BQ2A 2Y6KA 4XAAA 5KHHA 3P5BA 1RUH2 1ACCA 1HX6A 3INAA 4LO8A 1H2KA 2HEWF 5L36A 5IHRA 5FIXA 1W6QB
chains in the Genus database with same CATH topology
1XC6A 3T0AA 4DUWA 2R7EB 2EIDA 3I3DA 3CZJA 3WSOA 1JYXA 2WQ8A 3ACHA 4MGSA 1JZ4A 3SKJE 1UXZA 2VZSA 4XVHA 3VD7A 5DQ0A 1JZ2A 1OF4A 1UY1A 2WO3A 2Y8KA 2L9LA 4RN5A 4ZZ8A 1XPWA 4ZXEA 2VCBA 5LA1A 1LNSA 1MPXA 3K4AA 2XQXA 2YB7A 4M4PA 2CDPA 3NJVA 2JKXA 1UY2A 1CX1A 3EYPA 3I2GA 2LW8A 3VD9A 4PT6A 4UI9L 3U37A 4JKKA 3LEIA 3IAPA 3OB8A 1UY0A 4CUCA 4XUPA 2ZEXA 3NRUA 4DUVA 1PMJX 5J1XA 3I2JA 1HN1A 2QQNA 2VQUA 2J1EA 3CDZB 1H6YA 3MO4A 1K45A 4OYUA 4D0QA 3E1F1 2BZDA 1H6XA 5IYYA 2J1SA 5IJRA 3PUHA 3THDA 2DCJA 4KWUA 1K12A 3NNGA 2B4KA 1K3IA 2W1SA 4PF1A 1TVGA 2X10A 5IFPA 1UX7A 2WAAA 2W92A 2BBAA 4XZUG 2VMCA 3WEZA 2Y6HA 1JYVA 3IB3A 5FUIA 2EIBA 3OGVA 2ORZA 3WNKA 5CZKA 2VOTA 2YC4A 2JE8A 3MUZ1 3DYOA 4QX3A 4CU6A 3NQHA 2RVAA 3K46A 3T2PA 2V5DA 4QX1A 2LS6A 1DYOA 4L0PA 1CZTA 4QPWA 3LEKA 3OGRA 2VZPA 1O8PA 3IIIA 1PMHX 1EUUA 5B4NA 5C71A 3SEPA 2WAOA 1XNAA 4QX2A 1BHGA 2WO1A 1DP0A 4QX0A 1ULPA 3I2FA 2C9KA 2W1QA 4D8MA 2ZEZA 5B4XA 4DXTA 4CU8A 4PQQA 1XNTA 5JUVA 3VDBA 3W5NA 1UWWA 2VQTA 4ARXA 3MV01 1L7RA 2WZ8A 3ECQA 1EUTA 3CKHA 2XONA 3DYMA 2W47A 4DXRA 3CZUA 2E26A 4W8JA 3DYPA 3GGLA 1UZ0A 3LE0A 2VZQA 5I0DA 1OD3A 5A1AA 4UAPA 3C7OA 3T2OA 2VZ1A 1O8SA 3ACGA 3WNLA 1GOFA 2WO2A 3C7HA 2VR4A 1CZVA 1UMHA 1SG3A 3ACIA 3BGAA 5CYYA 3D3AA 3I2HA 2HYXA 4FI9A 4HG6B 3ZM8A 2E32A 2QQLA 2V72A 3NJXA 4QB2A 4TXWA 5G04L 4DXSA 4P00B 1DLCA 4XUTA 4LKSA 3HNMA 2WN3A 3PUIA 1UMIA 2Y6LA 3P1IA 4CVUA 4A42A 2BGOA 2VL4A 2W94A 3WNOA 3VD4A 2VTFA 1UXXX 3ABZA 2ORXA 3VD3A 2VCCA 2W46A 2VZOA 2WABA 2W91A 4A44A 2ZEWA 1W9WA 3JXSA 3WNPA 2YFZA 3I3EA 2VZTA 1JZ3A 3HNYM 3HJRA 3GDBA 5JMOA 2C4XA 2VZUA 2W1WA 3OEBA 1J83A 3OEAA 2DCKA 4MGQA 3IAQA 2HLEA 3A21A 3I2KA 1IQDC 4QDRA 3F2ZA 4E8CA 3UNPA 3WF1A 1OT5A 4AG4A 3LPGA 2VMEA 4DUXA 3T08A 5LA2A 4MADA 1JZ5A 5LCWL 1JHJA 2PQSA 2RV9A 3CMGA 2J1TA 3A23A 1F4AA 2W5FA 1W8NA 4LQRA 2BGPA 4LPLA 2B9VA 1TG7A 4XUOA 4GWIA 3DECA 3ETPA 1UYYA 2C26A 4QAWA 4GZ9A 4MO3M 4ARYA 4P02B 2W3JA 1UY4A 4MOAA 2E31A 4QB6A 2X05A 3T09A 3C7FA 2WYSA 4A6OA 4AAXA 3VDCA 4Z2AA 1GOGA 4JKMA 1JU3A 3K4DA 4OMDA 3ACFA 4DEVA 2OKXA 4P08A 4BXSV 2WZEA 3WQBA 5DPNA 4BJ0A 5JXHA 2Y6JA 4QDQA 4KI5M 2QQKA 3WF3A 3WNMA 4GWJA 3GXUA 2KD7A 3P6BA 3WF2A 5JXIA 3T2QA 2VMFA 4W4ZA 1UYXA 4BK5A 2VMDA 4CU9A 4A3ZA 1W8OA 1NAEA 1SHWB 2YFUA 3A22A 5G05L 4JX0A 5JXJA 1OF3A 4E8DA 3C8XA 4P5YA 3W5MA 3J7HA 2YC2A 3WF0A 2J1RA 1F4HA 2W87A 5LA0A 1I5PA 2VZ3A 3OG2A 3HEIA 4W50A 2J1VA 3UETA 1KGYA 4BK4A 4ZZ5A 2WUHA 3FHAA 3HNBM 3AC0A 1NKGA 1GNYA 4QB1A 2X09A 3UESA 1K42A 1W99A 2VC9A 1WKYA 2DDUA 2WDBA 2VZRA 3MUY1 4UOJA 2ZEYA 3T0BA 1YQ2A 3CIHA 3FHQA 3IDAA 2EIEA 1CIYA 1JU4A 4DEQA 1JZ7A 4RYDA 2WN2A 5HXMA 2ZXQA 3THCA 2Z4FA 3C7EA 1R64A 3OGSA 1GMMA 3K77A 1UY3A 2XOMA 2Y64A 3K75B 3VDAA 2J22A 2VO5A 4A4AA 2VM9A 4JKLA 2V4VA 2CDOA 5IFTA 2W9XA 2VCAA 3OBAA 4OUEA 1GU3A 5DMYA 3HN3A 2JD9A 2VZVA 2J1AA 4A41A 3C7GA 1D7PM 4LHSA 4CUBA 1PX4A 2QQJA 1W9SA 3SKVA 5DN2A 2J1UA 2E33A 3WNNA 1UYZA 4XUQA 4QDSA 1RYYA 1US3A 4A45A 5C7GA 4JHZA 1J84A 3FN9A 2W1UA 3I97A 3T0DA 4XUNA 1P8JA 1T2XA 5JR2A 5F7UA 3EB7A 2VJXA 3LEGA 3I3BA 2QQOA 2W95A 2XHNA 1W9TA 5EJ1B 1JI6A 1W0NA 2J7MA 4KMQA 1US2A 1ULOA 2Y6GA 1NUKA 3MBWA 2ID4A 1L7QA 4YPJA 4ET7A 5EJZB 1JYWA 2QBXA 1PX3A 2QQMA 3HPNA 3GM8A 1CZSA 1OH4A 3VD5A 4BDVB 3HOBA 2WBKA 4CUAA 3A7QA 4IUGA 4OZOA 2JDAA 4CU7A 1NX9A 1SDDB 3MV11 4M4RA 3BN6A 5C70A 3K4ZA 3SEEA 1GUIA 5HPOA 5JXGA 2EICA 3I2IA 3FL7A 4ZY9A 2BERA 1JZ6A 1GQPA 2YG0A 1WCQA 2RJ2A 2QQIA 4TTGA 3LQCA 5EIYB 1JZ8A 1JYNA 4OMCA 1O59A 2Y6KA 4XURA 1KEXA 1GOHA 3WF4A 3CQOA 3LPFA 5IHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC6 A;  3T0A A;  4DUW A;  2R7E B;  2EID A;  3I3D A;  3CZJ A;  3WSO A;  1JYX A;  2WQ8 A;  3ACH A;  4MGS A;  1JZ4 A;  3SKJ E;  1UXZ A;  2VZS A;  4XVH A;  3VD7 A;  5DQ0 A;  1JZ2 A;  1OF4 A;  1UY1 A;  2WO3 A;  2Y8K A;  2L9L A;  4RN5 A;  4ZZ8 A;  1XPW A;  4ZXE A;  2VCB A;  5LA1 A;  1LNS A;  1MPX A;  3K4A A;  2XQX A;  2YB7 A;  4M4P A;  2CDP A;  3NJV A;  2JKX A;  1UY2 A;  1CX1 A;  3EYP A;  3I2G A;  2LW8 A;  3VD9 A;  4PT6 A;  4UI9 L;  3U37 A;  4JKK A;  3LEI A;  3IAP A;  3OB8 A;  1UY0 A;  4CUC A;  4XUP A;  2ZEX A;  3NRU A;  4DUV A;  1PMJ X;  5J1X A;  3I2J A;  1HN1 A;  2QQN A;  2VQU A;  2J1E A;  3CDZ B;  1H6Y A;  3MO4 A;  1K45 A;  4OYU A;  4D0Q A;  3E1F 1;  2BZD A;  1H6X A;  5IYY A;  2J1S A;  5IJR A;  3PUH A;  3THD A;  2DCJ A;  4KWU A;  1K12 A;  3NNG A;  2B4K A;  1K3I A;  2W1S A;  4PF1 A;  1TVG A;  2X10 A;  5IFP A;  1UX7 A;  2WAA A;  2W92 A;  2BBA A;  4XZU G;  2VMC A;  3WEZ A;  2Y6H A;  1JYV A;  3IB3 A;  5FUI A;  2EIB A;  3OGV A;  2ORZ A;  3WNK A;  5CZK A;  2VOT A;  2YC4 A;  2JE8 A;  3MUZ 1;  3DYO A;  4QX3 A;  4CU6 A;  3NQH A;  2RVA A;  3K46 A;  3T2P A;  2V5D A;  4QX1 A;  2LS6 A;  1DYO A;  4L0P A;  1CZT A;  4QPW A;  3LEK A;  3OGR A;  2VZP A;  1O8P A;  3III A;  1PMH X;  1EUU A;  5B4N A;  5C71 A;  3SEP A;  2WAO A;  1XNA A;  4QX2 A;  1BHG A;  2WO1 A;  1DP0 A;  4QX0 A;  1ULP A;  3I2F A;  2C9K A;  2W1Q A;  4D8M A;  2ZEZ A;  5B4X A;  4DXT A;  4CU8 A;  4PQQ A;  1XNT A;  5JUV A;  3VDB A;  3W5N A;  1UWW A;  2VQT A;  4ARX A;  3MV0 1;  1L7R A;  2WZ8 A;  3ECQ A;  1EUT A;  3CKH A;  2XON A;  3DYM A;  2W47 A;  4DXR A;  3CZU A;  2E26 A;  4W8J A;  3DYP A;  3GGL A;  1UZ0 A;  3LE0 A;  2VZQ A;  5I0D A;  1OD3 A;  5A1A A;  4UAP A;  3C7O A;  3T2O A;  2VZ1 A;  1O8S A;  3ACG A;  3WNL A;  1GOF A;  2WO2 A;  3C7H A;  2VR4 A;  1CZV A;  1UMH A;  1SG3 A;  3ACI A;  3BGA A;  5CYY A;  3D3A A;  3I2H A;  2HYX A;  4FI9 A;  4HG6 B;  3ZM8 A;  2E32 A;  2QQL A;  2V72 A;  3NJX A;  4QB2 A;  4TXW A;  5G04 L;  4DXS A;  4P00 B;  1DLC A;  4XUT A;  4LKS A;  3HNM A;  2WN3 A;  3PUI A;  1UMI A;  2Y6L A;  3P1I A;  4CVU A;  4A42 A;  2BGO A;  2VL4 A;  2W94 A;  3WNO A;  3VD4 A;  2VTF A;  1UXX X;  3ABZ A;  2ORX A;  3VD3 A;  2VCC A;  2W46 A;  2VZO A;  2WAB A;  2W91 A;  4A44 A;  2ZEW A;  1W9W A;  3JXS A;  3WNP A;  2YFZ A;  3I3E A;  2VZT A;  1JZ3 A;  3HNY M;  3HJR A;  3GDB A;  5JMO A;  2C4X A;  2VZU A;  2W1W A;  3OEB A;  1J83 A;  3OEA A;  2DCK A;  4MGQ A;  3IAQ A;  2HLE A;  3A21 A;  3I2K A;  1IQD C;  4QDR A;  3F2Z A;  4E8C A;  3UNP A;  3WF1 A;  1OT5 A;  4AG4 A;  3LPG A;  2VME A;  4DUX A;  3T08 A;  5LA2 A;  4MAD A;  1JZ5 A;  5LCW L;  1JHJ A;  2PQS A;  2RV9 A;  3CMG A;  2J1T A;  3A23 A;  1F4A A;  2W5F A;  1W8N A;  4LQR A;  2BGP A;  4LPL A;  2B9V A;  1TG7 A;  4XUO A;  4GWI A;  3DEC A;  3ETP A;  1UYY A;  2C26 A;  4QAW A;  4GZ9 A;  4MO3 M;  4ARY A;  4P02 B;  2W3J A;  1UY4 A;  4MOA A;  2E31 A;  4QB6 A;  2X05 A;  3T09 A;  3C7F A;  2WYS A;  4A6O A;  4AAX A;  3VDC A;  4Z2A A;  1GOG A;  4JKM A;  1JU3 A;  3K4D A;  4OMD A;  3ACF A;  4DEV A;  2OKX A;  4P08 A;  4BXS V;  2WZE A;  3WQB A;  5DPN A;  4BJ0 A;  5JXH A;  2Y6J A;  4QDQ A;  4KI5 M;  2QQK A;  3WF3 A;  3WNM A;  4GWJ A;  3GXU A;  2KD7 A;  3P6B A;  3WF2 A;  5JXI A;  3T2Q A;  2VMF A;  4W4Z A;  1UYX A;  4BK5 A;  2VMD A;  4CU9 A;  4A3Z A;  1W8O A;  1NAE A;  1SHW B;  2YFU A;  3A22 A;  5G05 L;  4JX0 A;  5JXJ A;  1OF3 A;  4E8D A;  3C8X A;  4P5Y A;  3W5M A;  3J7H A;  2YC2 A;  3WF0 A;  2J1R A;  1F4H A;  2W87 A;  5LA0 A;  1I5P A;  2VZ3 A;  3OG2 A;  3HEI A;  4W50 A;  2J1V A;  3UET A;  1KGY A;  4BK4 A;  4ZZ5 A;  2WUH A;  3FHA A;  3HNB M;  3AC0 A;  1NKG A;  1GNY A;  4QB1 A;  2X09 A;  3UES A;  1K42 A;  1W99 A;  2VC9 A;  1WKY A;  2DDU A;  2WDB A;  2VZR A;  3MUY 1;  4UOJ A;  2ZEY A;  3T0B A;  1YQ2 A;  3CIH A;  3FHQ A;  3IDA A;  2EIE A;  1CIY A;  1JU4 A;  4DEQ A;  1JZ7 A;  4RYD A;  2WN2 A;  5HXM A;  2ZXQ A;  3THC A;  2Z4F A;  3C7E A;  1R64 A;  3OGS A;  1GMM A;  3K77 A;  1UY3 A;  2XOM A;  2Y64 A;  3K75 B;  3VDA A;  2J22 A;  2VO5 A;  4A4A A;  2VM9 A;  4JKL A;  2V4V A;  2CDO A;  5IFT A;  2W9X A;  2VCA A;  3OBA A;  4OUE A;  1GU3 A;  5DMY A;  3HN3 A;  2JD9 A;  2VZV A;  2J1A A;  4A41 A;  3C7G A;  1D7P M;  4LHS A;  4CUB A;  1PX4 A;  2QQJ A;  1W9S A;  3SKV A;  5DN2 A;  2J1U A;  2E33 A;  3WNN A;  1UYZ A;  4XUQ A;  4QDS A;  1RYY A;  1US3 A;  4A45 A;  5C7G A;  4JHZ A;  1J84 A;  3FN9 A;  2W1U A;  3I97 A;  3T0D A;  4XUN A;  1P8J A;  1T2X A;  5JR2 A;  5F7U A;  3EB7 A;  2VJX A;  3LEG A;  3I3B A;  2QQO A;  2W95 A;  2XHN A;  1W9T A;  5EJ1 B;  1JI6 A;  1W0N A;  2J7M A;  4KMQ A;  1US2 A;  1ULO A;  2Y6G A;  1NUK A;  3MBW A;  2ID4 A;  1L7Q A;  4YPJ A;  4ET7 A;  5EJZ B;  1JYW A;  2QBX A;  1PX3 A;  2QQM A;  3HPN A;  3GM8 A;  1CZS A;  1OH4 A;  3VD5 A;  4BDV B;  3HOB A;  2WBK A;  4CUA A;  3A7Q A;  4IUG A;  4OZO A;  2JDA A;  4CU7 A;  1NX9 A;  1SDD B;  3MV1 1;  4M4R A;  3BN6 A;  5C70 A;  3K4Z A;  3SEE A;  1GUI A;  5HPO A;  5JXG A;  2EIC A;  3I2I A;  3FL7 A;  4ZY9 A;  2BER A;  1JZ6 A;  1GQP A;  2YG0 A;  1WCQ A;  2RJ2 A;  2QQI A;  4TTG A;  3LQC A;  5EIY B;  1JZ8 A;  1JYN A;  4OMC A;  1O59 A;  2Y6K A;  4XUR A;  1KEX A;  1GOH A;  3WF4 A;  3CQO A;  3LPF A;  5IHR A; 
#chains in the Genus database with same CATH topology
 4LE3 A;  5DAX A;  2Y0I A;  2QQW A;  3B7M A;  2ZML A;  3T0A A;  3FFZ A;  1LEM A;  3E6B A;  3PHM A;  4XCA A;  4FPH A;  3B5L B;  2E63 A;  2X5I A;  3CO2 A;  4J1X A;  3TWI A;  1UN1 A;  4MGS A;  4YLZ A;  2FD8 A;  1GV9 A;  1IG0 A;  1UXZ A;  1JZ4 A;  2PHR A;  3DN7 A;  2VZS A;  4LLO A;  3HAG A;  3OSD A;  1BBT 1;  1Y9Q A;  5K0U B;  5E1R A;  1YQ6 A;  3RWN A;  3PL0 A;  1UY1 A;  2WO3 A;  3H50 A;  4GMP 1;  3RFR A;  3WG4 A;  2L9L A;  4RN5 A;  5APA A;  4ZZ8 A;  1TNR A;  1W8T A;  3DUI A;  4ZXE A;  2VCB A;  4L11 A;  1H9P A;  1O4Y A;  2UWA A;  1AL0 G;  2XQX A;  2YB7 A;  5T54 A;  2R6Q A;  5FLI A;  3VGI A;  1ASJ 3;  1TEI A;  2A70 A;  5DDJ 1;  5C4W A;  1CAX B;  1PZ8 A;  1ZX5 A;  2RR1 3;  1H8V A;  1Y3T A;  4XEZ A;  3FJS A;  4MH0 E;  4P14 A;  4XAB A;  3ZSJ A;  2P6H A;  5IVV A;  3JCI A;  4JKK A;  2FCV A;  3GBF A;  3RPQ A;  1FMD 2;  2ZTN A;  2VUJ A;  2CV6 A;  3OB8 A;  5BNO C;  2K9Z A;  3HQR A;  2B5H A;  2Z2S B;  4Y33 A;  4CP1 A;  1NY7 2;  1PVC 2;  3PTR B;  2X53 S;  5LEK A;  4BLJ A;  1PMJ X;  1S2B A;  4JRL A;  1JOB A;  1HN1 A;  2QQN A;  2VQU A;  4LK7 A;  5F5C A;  3LDR A;  4LIT A;  3ZXF A;  4Y5T A;  2FBE A;  5IWF A;  5FWE A;  3SCF A;  3ZFF C;  1X50 A;  1MEC 3;  1GWM A;  1VIW B;  4XXP A;  4D0Q A;  3H1W A;  4CDX A;  1H6X A;  5FZ6 A;  5BYN A;  2RM2 3;  4QX7 A;  3ZYF A;  3AKS A;  3LDK A;  1KS5 A;  1VBA 2;  5IJR A;  2NPI A;  1D4V B;  4MGI E;  4NVP A;  3UK9 A;  2DCJ A;  4E2G A;  4FSJ A;  3NNG A;  1T6G C;  1RUF 2;  2B4K A;  2JDY A;  3I8T A;  3C3V A;  2GP3 A;  4NOT A;  2P3J A;  2HWD 2;  3T4V A;  2D40 A;  3GNE A;  2CU5 A;  2XJR A;  4X8P A;  1HIX A;  1BBT 3;  2WNV C;  3ZX7 A;  3R4U A;  1AYM 2;  3ILR A;  4QX8 A;  4CA9 A;  4XOG A;  2ZHL A;  2JDZ A;  3ETQ A;  4DFS A;  5BNO B;  4D69 A;  4NUB A;  1LB2 A;  3U78 A;  4M00 A;  3WNK A;  1DGL A;  3RNS A;  4YFZ A;  1NZI A;  4AQ2 A;  3O1T A;  4OI4 A;  2YC4 A;  3HN1 A;  3LOB A;  1C8M 2;  3ZFF B;  2R0H A;  3NAP A;  3HVD A;  4RHV 1;  2P3K A;  4UF0 B;  4CUG A;  2DUO A;  2O1Q A;  4HL0 A;  4IV1 A;  4XZP A;  2XML A;  1AHS A;  4ZS3 A;  3THP A;  1Y43 B;  5FZ0 A;  4A7Y A;  2D5H A;  3H8U A;  2Q4S A;  4NWW A;  2VNR A;  2RR1 2;  3TEW A;  1QJY 1;  5FWJ A;  4AVT A;  4YVS C;  3LDB A;  1QJF A;  4D7S A;  3K51 A;  4LKE A;  4JAA A;  1QKQ A;  4MXW A;  2WNV B;  5DAV A;  5FY5 A;  4QGM A;  3SIT A;  1AR7 3;  1DG6 A;  2BNN A;  4V2W A;  1IS3 A;  1DP0 A;  1RUE 2;  3JQW A;  5JAX A;  4NII A;  4YGB A;  2QUO A;  5FP4 A;  4RS5 A;  3GCX A;  1D2Q A;  1GZW A;  2ZEZ A;  3N9Q A;  4Q4V 1;  3JUU A;  3B93 A;  4NRM A;  4GB3 1;  2TBV A;  5B4X A;  4GJY A;  1RUG 1;  1O5U A;  3PIG A;  3CU7 A;  3L2Y A;  4PQQ A;  3NJZ A;  4FT8 A;  1UAI A;  1A78 A;  1XNT A;  1YRZ A;  1ZYB A;  3J4U H;  4EN6 B;  1SLT A;  3VDB A;  2VQT A;  4MHR A;  2XGX A;  2YPD A;  2BPA 2;  2WZ8 A;  3ECQ A;  3VL9 A;  1LED A;  1MS9 A;  2EXI A;  3MIG A;  4NAO A;  3DYM A;  4DXR A;  2WA4 A;  3FBM A;  2IZW A;  1I1E A;  4YW6 A;  1FPN 2;  1HN0 A;  1PM4 A;  2JX9 A;  2QKD A;  3MEP A;  5F39 A;  2AYH A;  2AUY A;  3GGL A;  5HCB A;  4NHL A;  1W2N A;  1RUC 3;  1XE8 A;  2VZQ A;  3WG1 A;  4YVS B;  3KCC A;  1IPJ A;  1HJG A;  4FPO B;  3ZXA C;  3O0X A;  5K8S A;  3O1M A;  3K3O A;  1NCR C;  3O12 A;  1CAW A;  2WO7 A;  3T2O A;  5ISL A;  2ZGM A;  4YGE A;  4QPG A;  5A7W B;  5FY4 A;  2D3R A;  4Q4Y 1;  3VHN A;  3KQ4 B;  4LT5 A;  4WBB A;  1GOF A;  3NV2 A;  4D6Q A;  5A7O A;  1LEN A;  4FP2 A;  5BY5 A;  2E51 A;  5DDJ 2;  1HRI 1;  3MZH A;  2NMN A;  1SFP A;  1W3X A;  5FQ0 A;  1QJY 3;  5FZ4 A;  4EE2 A;  4EN7 B;  2V4A A;  4F7Z A;  2QZ2 A;  5A7S A;  3LEM A;  3ZYP A;  1YHF A;  3D3A A;  4FI9 A;  5KC6 A;  1LRH A;  4HG6 B;  5BNN C;  2QQL A;  4AFA A;  3VBF A;  3NST A;  1DQ5 A;  4IEZ A;  3OCP A;  5DUV A;  1UOJ A;  4DXS A;  4P00 B;  1DLC A;  4GWN A;  4R9C A;  1K5J A;  1DZT A;  4BMB A;  1UMI A;  1JOP A;  1RUG 3;  1N1V A;  1AXK A;  2PAK A;  3LSD A;  5T5J A;  5IVE A;  1TMF 1;  2HWF 3;  5LB6 A;  4UWD A;  2BGO A;  2C1F A;  1NCR B;  1O5L A;  3KV9 A;  3O1O A;  1ND3 C;  5DUU A;  4EV0 A;  3VD4 A;  1LES A;  3N36 A;  4GD4 A;  5AVA A;  5IT6 A;  1UCX A;  4FFH A;  4ATE A;  3VD3 A;  3ES1 A;  2VCC A;  4H55 A;  4AL9 A;  2W46 A;  2WAB A;  2W91 A;  2BVV A;  2JXA A;  2ZEW A;  1W9W A;  3WNP A;  1NZC A;  2TEP A;  2HBT A;  1JZ3 A;  3GDB A;  4QM9 A;  4A7K A;  3VBS A;  5L9V A;  4Y3O A;  1RUO A;  3AKT A;  2R04 3;  2W1W A;  1SEF A;  1QGL A;  3W59 A;  1W0P A;  3JD7 3;  4QKF A;  4MGQ A;  5I91 A;  1N1T A;  2HLE A;  1GQG A;  1OI6 A;  1G9C A;  1YLL A;  3I2K A;  2AEN A;  1IQD C;  2R07 3;  4IE5 A;  1RUD 1;  5C3S A;  1J3P A;  2GZW A;  4GKY A;  3WF1 A;  1OT5 A;  3JBG 1;  3ZN6 A;  1O6U A;  5A1L A;  2XQR A;  4XJZ A;  1OQD A;  4RHV 2;  4DUX A;  3VKL A;  1OC1 A;  3VHO A;  4D7Y A;  2OPK A;  2SBA A;  4OUL A;  2XH6 A;  4HBN A;  1DZQ A;  1HRV 1;  1ND2 C;  1FV2 A;  4QHZ A;  1RXG A;  3JZV A;  3CMG A;  1UYP A;  1UKG A;  2J1T A;  1WZX A;  1F4A A;  2WWU A;  3HMY A;  1QJY 2;  4XDP A;  1BKZ A;  3TOJ A;  2YZ4 A;  2B9V A;  3KGL A;  3GF6 A;  4XUO A;  1IQA A;  1LHU A;  1YFX A;  1VAV A;  2XVK A;  3ZYH A;  2ZOE B;  3ETP A;  4Q8K A;  2C26 A;  4FPL A;  2HJI A;  2LM3 A;  3BVC A;  4FFG A;  4HSJ A;  1H2L A;  3H42 B;  3EO6 A;  3M3E A;  5J3U A;  4P02 B;  4H7L A;  3POG A;  1WW6 A;  5D21 A;  2ZGP A;  3N9L A;  5IAX A;  4BME A;  4JQT A;  4XJU A;  4P9J A;  4K9S A;  4Q4V 2;  2E31 A;  2NYY A;  1W2O A;  2VVE A;  1VRH 2;  2ZKN A;  4GB3 2;  3RSJ A;  3C7F A;  1RUG 2;  3OPZ A;  4A6O A;  1CD3 G;  3CEW A;  3IIA A;  2D5F A;  3KD4 A;  3KWV A;  1QOS A;  3QH7 A;  5H9R A;  3T2T A;  3WDU A;  4Z2A A;  1VB2 A;  5LY1 A;  3BIW E;  2JG8 A;  4XF9 A;  5JIA A;  4Y5S A;  3VZO A;  3WXP A;  4E4S A;  4LJH A;  4P9W A;  1ND2 B;  3B02 A;  3ACF A;  2EAA A;  4JGZ B;  5FP8 A;  3TN9 1;  5FZ1 A;  3BAL A;  5FJK A;  5IK5 A;  5D8A C;  5DPN A;  1BMV 1;  4KI5 M;  2W0X A;  4XPV A;  4FAG A;  1X36 A;  1OQE A;  4I09 A;  4M3C F;  4IES A;  4Q1R A;  4Q4Y 2;  2A5Z A;  5ANQ A;  1Z78 A;  3J7L A;  4MGZ E;  5L73 A;  5JXI A;  5FYI A;  2OVU A;  2RS3 3;  5KR7 A;  3S7E A;  1HRI 2;  3T1L A;  4JTN A;  2VG9 A;  5A7N A;  3APB A;  1W8O A;  3WDW A;  2YFU A;  3A22 A;  3NV1 A;  4A3Z A;  2ETE A;  2HKX A;  4K8R B;  3ZR5 A;  2ADE A;  1JOD A;  1OF3 A;  4GA9 A;  4PIX A;  5JXJ A;  1FI2 A;  1A8D A;  3CJI B;  5F5I A;  3J7H A;  5C3O A;  3WF0 A;  2Q1Z B;  4XFC A;  2JDP A;  2A1X A;  2PTM A;  1YO8 A;  5JWP A;  3U07 A;  3GJA A;  3OG2 A;  4CCM A;  1STM A;  1XNB A;  4WV8 A;  3I54 A;  1TMF 2;  5D8A B;  1LOC A;  4BIO A;  4L9B A;  5GJ6 A;  4RSU A;  1NKG A;  2WNO A;  1POV 1;  4UYB A;  5F2W A;  1N3O A;  1UZV A;  1Q8V A;  1V9U 1;  4B4Q A;  1W99 A;  2VMH A;  1WKY A;  2R06 1;  2VPV A;  1KJL A;  5FYV A;  3WW1 A;  1ALY A;  4HVR A;  2AAC A;  3TN9 3;  4CDU C;  3T0B A;  3VLB B;  1RIT A;  2GMM A;  1HB1 A;  2YYO A;  1CJP A;  2NMO A;  4ZU4 A;  3WLU A;  2D3S A;  4KNC A;  3AP9 A;  5ACA 1;  3VKM A;  1ZZB A;  3CIH A;  3GBW A;  3N4M A;  3I7D A;  1Y9M A;  3V64 A;  1CIY A;  2EIE A;  1JU4 A;  3ITQ A;  3P3N A;  4MZU A;  4Q27 A;  4S2F A;  2CWS A;  2WN2 A;  4JQR A;  1H8T A;  3C7E A;  1MQT C;  2ET7 A;  1DZR A;  1MS1 A;  1MZ6 A;  2VTX J;  2Y6F A;  2VUD A;  1RUD 2;  1VB4 A;  4XF4 A;  2WRA A;  1J3Q A;  3JBG 2;  2ZGT A;  5CA6 A;  2QDR A;  4CCC A;  2Q1F A;  1RXF A;  1UF2 C;  4OHV A;  1IS6 A;  5L19 A;  3HBZ A;  3U75 A;  3ZYJ B;  5C9A C;  1HRV 2;  3VDD A;  3D0J A;  4ASM B;  1GR3 A;  3MID A;  3VBO C;  3H0O A;  1R08 2;  3WHT A;  3OBA A;  2A75 A;  2RHP A;  5J37 A;  1ZZ9 A;  4LA3 A;  4CCE A;  2ZAA A;  4FFF A;  2UUR A;  2VW0 A;  3MW3 A;  1VBD 2;  4C90 A;  4JC1 A;  3C7G A;  4UFH A;  2RS5 1;  3NNM A;  1QY4 A;  2IXK A;  4X6Q B;  4B29 A;  4LHS A;  5FXV A;  2BP6 A;  3MYX A;  4FPJ A;  4O9E A;  1POV 3;  4QT6 A;  3ZFG C;  4CUB A;  4XMI A;  5JLV A;  2QVS B;  3AKQ A;  1V9U 3;  4WVZ A;  1EPW A;  2YGL A;  5FLJ A;  2E33 A;  1MQT B;  1W8W A;  2R06 3;  2YV8 A;  4TWT A;  1LOB A;  4CCK A;  5IAT A;  1RYY A;  2I45 A;  1QXP A;  5E88 A;  3T4H B;  1E5S A;  3AXD A;  3FN9 A;  5C7G A;  3S7I A;  1UW8 A;  1ST8 A;  4BZ4 A;  1UO9 A;  5ACA 3;  1UNB A;  1T2X A;  1HLC A;  2VOW A;  5FOB B;  2WWJ A;  5D2A A;  3UGG A;  4RGG A;  4XFF A;  5FR3 A;  2BWC A;  3KVB A;  2XJS A;  3EB7 A;  5C9A B;  3LEG A;  5AC9 1;  5IAV A;  1HXS 3;  2W95 A;  2J7M A;  1CQ9 A;  3TN9 2;  3WOG A;  4YM3 A;  1TZO A;  3MBW A;  3MGU A;  5CFD C;  5D1I A;  3USU B;  2NQY A;  2ZBJ A;  2RDN A;  4ET7 A;  5DAP A;  4IL7 A;  3VBU B;  3RVH A;  4WVW A;  4IEO A;  2JEM A;  2JE9 A;  3PU8 A;  2QBX A;  5A7P A;  4DIQ A;  1PX3 A;  4IE6 A;  2KXL A;  1J58 A;  5LBB A;  1UZZ A;  1CZS A;  5KXC A;  3VD5 A;  1OVS A;  5LY2 A;  1IG3 A;  4CDW B;  3TEX A;  2QE3 A;  3AJY A;  2A3Y A;  2OW4 A;  3A7Q A;  4FAH A;  5T52 A;  4QPI C;  3QAC A;  1NYW A;  1B35 C;  1WBL A;  4DPN A;  3BN6 A;  4N9H A;  3TNQ A;  5LBF A;  3V0A B;  5FPA A;  2ZGN A;  4Q4X 1;  3POE A;  1C5H A;  4TZD A;  2XJU A;  4LKF A;  3ZSK A;  2LUW A;  3FL7 A;  4JHT A;  3DPR C;  5FDB A;  3O1V A;  1LAJ A;  2B39 A;  3Q8F A;  4DQA A;  1JYC A;  1Q8O A;  4EN8 B;  2P4E A;  5T5L A;  5BXX A;  1AZD A;  3OY8 B;  4C1W A;  1RIN A;  2XUE A;  3RG0 A;  2RMU 3;  4ASK A;  1SLI A;  1V6K A;  1WCQ A;  5CFD B;  2VQA A;  3LQC A;  4AVC A;  4TTG A;  1SLC A;  2NM1 A;  1W8F A;  2JDU A;  1UD1 A;  2UY8 A;  1JYN A;  1WLC A;  3D5O A;  1QF3 A;  3KCX A;  4XUR A;  1KEX A;  2DFC A;  5BNP A;  5JOY A;  4HKO A;  3WF4 A;  4OI0 A;  3AM2 A;  5I8S A;  1H2M A;  1RUI 1;  4C0H A;  4J1W A;  1EAH 3;  2R06 2;  2WSV A;  2W08 A;  3AL5 A;  4DUW A;  2R7E B;  1H9W A;  2HWE 1;  3I3D A;  3OUH A;  1JYT A;  4IGO A;  3ZFE A;  4QPI B;  4UW4 A;  3DEM A;  1LKN A;  4H2A A;  3WSO A;  2CYF A;  4Z92 B;  1JYX A;  2D44 A;  2GMP A;  4D7T A;  4KBZ A;  1B35 B;  5ACA 2;  2PAE A;  2F17 A;  4GIQ A;  1NG0 A;  4I0B A;  5IK4 A;  3AP4 A;  4G9S B;  4XBQ A;  1W6P B;  1ZZC A;  4XVH A;  3OYW A;  5FK7 A;  5DQ0 A;  2JEN A;  1S2K A;  3SH3 A;  1JZ2 A;  5CKQ A;  3OD4 A;  2WQZ C;  1QMJ A;  4LO5 B;  5A3L A;  4OQ8 A;  3DPR B;  2C9A A;  4MLO A;  4S2G A;  1LNS A;  4YYO A;  1WCK A;  1WD4 A;  3K4A A;  5TSW A;  1QJX 1;  4FOY A;  4PJY A;  5JZG C;  1GFF 2;  2JKX A;  1ENR A;  4KQ7 A;  3O0W A;  3VB9 A;  4LIV A;  3I2G A;  4HPK B;  4LXL A;  2XWJ B;  5JOW A;  1MS5 A;  4Q0V A;  4Y24 A;  3WD5 A;  1GBG A;  1VBC 3;  2B46 X;  2QCS B;  3LKJ A;  2PYT A;  4YVW A;  2YXS A;  4AGV A;  3PIJ A;  4PLM A;  4PBO A;  1GZC A;  5CFC A;  2VBB A;  1RHI 2;  3AB0 A;  4JGY C;  4CUC A;  2ZS6 B;  3BYW A;  3N7L A;  4FTB A;  3BU7 A;  3NRU A;  4XW3 A;  4DUV A;  1YC6 1;  1OUS A;  2JIC A;  4Q4W 3;  3AMQ A;  3GBG A;  4HXC A;  4Y5Z 0;  2RS5 2;  3CDZ B;  5DG2 A;  1PGW 1;  3MO4 A;  2PHT A;  1K45 A;  5FV3 A;  5FXZ A;  3UJO A;  3ZXL A;  1TME 1;  3IDB B;  3E1F 1;  2CY6 A;  4GWM A;  4O65 A;  3S5A A;  2H6C A;  2OS2 A;  1YFW A;  1W6O A;  2P3Y A;  4LHN A;  1RUI 3;  1PK6 B;  1GP4 A;  1S0G A;  4M3C B;  4NMI A;  4WM8 A;  5GLV A;  4YAR A;  1ZRI A;  3PUH A;  1UIK A;  2HWE 3;  4KWU A;  4LBJ A;  2VVD A;  1G6N A;  1RUH 3;  1U12 A;  2PHD A;  3NKG A;  5JZG B;  3I2O A;  2YGM A;  4LO6 B;  1K3I A;  3CNA A;  3AMH A;  4RD7 A;  1S0C A;  4QGL A;  1PGS A;  5FBJ A;  1X9T A;  1UX7 A;  1ODN A;  4QU1 A;  1OA4 A;  1CX4 A;  2BBA A;  4XZU G;  2FMY A;  2YDE A;  2LRO A;  4Y1Z A;  4IDZ A;  3WEZ A;  3B69 A;  3ZDS A;  5AC9 2;  3RJ2 X;  3H8R A;  1JYV A;  2A73 B;  4MYE A;  4JGY B;  5FK8 A;  5FZE A;  3ILN A;  1B09 A;  1OXC A;  4XYX A;  3OGV A;  1NXM A;  3I3M A;  4JDM A;  2I74 A;  2JB8 A;  5A3U A;  4CEW C;  1XNC A;  1W8Z A;  4IND A;  3UV9 A;  4QX3 A;  5LBC A;  3KB5 A;  4JDN A;  1FT9 A;  1W6Q A;  1WA6 X;  2A3X A;  2JDN A;  1WBF A;  4XJ9 A;  3RDI A;  1QQP 1;  2NN8 A;  4AED C;  4LUK A;  2V5D A;  1GSL A;  2BFU S;  5CB7 A;  2HWB 2;  4CZS A;  3R4D B;  4K7J A;  3ZR6 A;  1FXZ A;  4XTP A;  2Y38 A;  2ARB A;  1DYO A;  1F15 A;  2BOI A;  3V65 A;  1BEV 1;  1Q43 A;  3UT0 A;  5K0U A;  4DS0 A;  3LEK A;  4LOR A;  5JPN B;  1W28 A;  1O8P A;  3III A;  4EN9 B;  2BJS A;  2E6V A;  4Q4X 2;  3VN4 A;  1F35 A;  2F4L A;  1PMH X;  2X8K A;  3VBH A;  1W39 A;  4DRV A;  4LBQ B;  1JBC A;  1AJO A;  1PVC 3;  1VR3 A;  1PNF A;  5C71 A;  4CXX A;  2XJT A;  1BHG A;  1DGW X;  4NHM A;  4OUM A;  2IUW A;  3ZIW A;  5C8C C;  3AJZ A;  4GXL A;  4LBO A;  3VUO A;  3LAG A;  4AF9 A;  4CEW B;  5A6Q A;  3FUQ A;  1YEW A;  2WFF 1;  1Z0H A;  5F9T A;  1OFN A;  1SPP B;  5JUV A;  2VNO A;  1RUE 1;  4IE7 A;  1UWW A;  4NPR A;  5EP9 A;  3ZVX A;  4AED B;  4NIA A;  4NN0 A;  1EUT A;  4E9K A;  1RUF 3;  1TNF A;  2GAU A;  3CKH A;  5JIU A;  3AK0 A;  4EZH A;  3O1U A;  4KWL A;  2HWD 3;  2HWE 2;  3CZU A;  2E26 A;  3FFQ A;  4OUS A;  4PIY A;  1APN A;  1KFU L;  3ZSE A;  2JJ6 A;  2Y0O A;  4QXH A;  5FLH A;  2BGC A;  1IHM A;  1UZ0 A;  2DF7 A;  2IVJ A;  4NIH A;  3EHK A;  1AYM 3;  3J7M A;  4Y22 B;  4M0N A;  2NLR A;  5EPA A;  1OD3 A;  2FMD A;  2WS9 1;  3QOP A;  4AZZ A;  5A1A A;  4JZR A;  3LFI A;  3NV4 A;  1O8S A;  3S6P A;  3VZJ A;  1FPN 1;  4WM7 C;  1H4G A;  3K3N A;  4K1Y A;  4Q29 A;  1DFQ A;  1SLA A;  2BVB A;  2YPJ A;  4EWA A;  3C7H A;  2VR4 A;  3IDE A;  3PVE A;  1QJX 2;  2ZPX A;  3KV5 A;  3L2H A;  3IN9 A;  1C8M 3;  4Z82 A;  1BEV 3;  5EJ3 A;  4FPC A;  5F3G A;  5C8C B;  1FAY A;  1UMH A;  4NRP A;  3QLQ A;  3WDY A;  2BOJ A;  1SG3 A;  3AKP A;  2WLQ A;  3OPT A;  5GLT A;  3BGA A;  1S0I A;  3VBR C;  1SQ4 A;  2KR2 A;  5FYY A;  4LUL A;  5BNO A;  5HBA A;  3I2H A;  2WT2 A;  2HYX A;  3WDT A;  1HV1 A;  1XSR A;  2C24 A;  1R1Z A;  4BB3 A;  4YG0 A;  5FYM A;  3HQU A;  3WHU A;  2OII A;  1ZRC A;  3NJX A;  4MX3 A;  1O4Z A;  2OUH A;  1PO2 2;  5F37 A;  4XUT A;  3ZFF A;  3HNM A;  3S57 A;  1M06 G;  2WN3 A;  4LBN A;  3ZSL A;  1EV1 2;  1GNH A;  1PGW 2;  4UF0 A;  1TME 2;  5DZE A;  3P1I A;  2BBV A;  2PFW A;  1SFY A;  3AZX A;  1RUE 3;  2VL4 A;  3PDQ A;  5M0T A;  4FTS A;  4AW7 A;  4WM7 B;  1H1M A;  5JCT A;  3BPS A;  3A4U A;  5F3C A;  2ORX A;  3THT A;  1SAC A;  5A1F A;  2VZO A;  4ZXK A;  1HDK A;  2K2S A;  4LR4 A;  3ZXD A;  3E6D A;  3MIB A;  4XQD A;  3J7N A;  5SV5 A;  4CSW A;  3JXS A;  2YFZ A;  2DVG A;  2WNV A;  4ES9 A;  5HI0 A;  2ILM A;  4R52 A;  3KT1 A;  3RQ0 A;  3VBR B;  4YZ1 A;  1UMZ A;  4MET A;  4K40 A;  4QXB A;  5JMO A;  2G4I A;  1RIR A;  4HMZ A;  3OEA A;  1WA4 A;  3SIS A;  1FPN 3;  1OPO A;  3I4I A;  5FYT A;  4C91 A;  1H1A A;  2IXH A;  1PIV 1;  2DCK A;  1CAV A;  2Z79 A;  4COU A;  2GNT A;  2VMG A;  1SCS A;  2W52 A;  1ENX A;  3A21 A;  3IM0 A;  3OF1 A;  4LOT A;  5I0S A;  4UFK A;  3F2Z A;  4E8C A;  1SBD A;  4GMP 3;  1OOP C;  1UIJ A;  4AAP A;  4I02 A;  3FLP A;  2ZGQ A;  2BEO A;  4V1P A;  3WP3 A;  2YY1 A;  2JDH A;  1QQP 2;  4FOW A;  5FY8 A;  3T08 A;  4XDO A;  4MAD A;  4H7M A;  2IXL A;  4IE4 A;  1N47 A;  3LA3 A;  1UOB A;  4N53 C;  3WDV A;  5DDJ 3;  3M3Q A;  5DUX A;  3WP6 A;  5C33 A;  4YZ5 A;  3EBR A;  3ZYR A;  1JHJ A;  3BCW A;  1AUY A;  4H3W A;  1BEV 2;  4ZKT B;  4AFM A;  3IKW A;  5FZI A;  4BPZ A;  4RA0 A;  4YVS A;  3RI8 A;  1A3K A;  1W8N A;  3IPV B;  3GAL A;  3TEY A;  1U5Y A;  5A7W A;  5FCC A;  4GWI A;  1KDM A;  5C3R A;  1FNZ A;  2D6N A;  1LOD A;  5FP3 A;  4QQ2 A;  2ENR A;  2R30 A;  5J7M A;  2VD7 A;  1DF0 A;  2ZHK A;  1XBF A;  1LU2 A;  1VJ2 A;  3POY A;  3BIE A;  4CP2 A;  4URT A;  4BH9 A;  2BRT A;  2WFF 2;  2WYS A;  3O1P A;  1OOP B;  1YCI A;  2TNF A;  1DQ1 A;  3AP7 A;  4YWA A;  2A71 A;  3VDC A;  1LOF C;  1VAL A;  3O1S A;  1OH3 A;  4Q0P A;  5F5A A;  4JKM A;  1H30 A;  2K0G A;  4N53 B;  3ZMN A;  5KC5 A;  5JR7 B;  5FZF A;  1VRH 1;  2BQP A;  4LE4 A;  3BPZ A;  4XBL A;  2CGP A;  2Q8O A;  4OI1 A;  4DEV A;  5F3E A;  2BNO A;  2RDQ A;  2DVA A;  5T55 A;  4XQ4 A;  5FY1 A;  3ZKU A;  4CDX B;  1NCR A;  2FDH A;  4BQ1 A;  5FXX A;  4IEX A;  3ZN5 A;  1JTZ X;  2WS9 2;  3WQB A;  4AQS A;  4B1L A;  1XYP A;  4QU2 A;  4BJ0 A;  3UKT A;  5JXH A;  5HCF A;  1FAT A;  1PMI A;  1WLW A;  1ENQ A;  1OKO A;  1ULF A;  3MW2 A;  4W6Y A;  4A3X A;  1V6I A;  3P6B A;  3BTA A;  4UW5 A;  1ZNP A;  2EXJ A;  3N9O A;  4W4Z A;  4XMA A;  2LAL A;  5FMD A;  4BIS A;  5LW9 A;  1W03 A;  3M1H A;  4S2D A;  2Z5W A;  4CU9 A;  2NZ9 A;  1BJQ A;  4XQW A;  2F4P A;  4NHY A;  4RHV 3;  2XXZ A;  5KXD A;  4H14 A;  3U0Z A;  5FP7 A;  4AEM A;  4E8D A;  3UL2 A;  4M3C E;  3OPW A;  4Q0S A;  4AHY A;  3C8X A;  1HJF A;  4LA2 A;  5BNN A;  3RZJ A;  2WIN B;  1ULC A;  1Q8Q A;  2GC0 A;  2NP0 A;  1WMD A;  5A3M A;  3U4S A;  2R1D A;  1LHW A;  5EHD A;  3RZZ A;  1O3Q A;  2W87 A;  1LUL A;  4ES8 A;  4RR3 C;  3HT1 A;  2VZ3 A;  2WT0 A;  3HEI A;  1OLR A;  2J1V A;  2WL1 A;  2FCT A;  4OVE A;  3HWJ A;  1U5Z A;  4E27 A;  1AVB A;  1ND3 A;  1W6N B;  4HN1 A;  4EWD A;  4BWO A;  4BQ5 A;  4HVQ A;  2ES3 A;  4I3G A;  2PHL A;  3SCH A;  2X09 A;  5CIS A;  1FOD 1;  4Q4V 3;  1K42 A;  4CDQ C;  4M0H A;  1VRH 3;  3MIH A;  4FQZ A;  4GB3 3;  2VC9 A;  5CKN A;  4BQY A;  1OD5 A;  3IZO A;  2DDU A;  4HFS A;  4PI2 A;  1JN2 P;  3J8F 1;  3WCR A;  3HIF A;  3MUY 1;  1S2E A;  2D6L X;  4PLN A;  4UOJ A;  4AFB A;  1IS5 A;  3RRD A;  4P9L A;  5FTT C;  1Q5O A;  5CKM A;  2R1B A;  2YU2 A;  3D4K A;  1MZF A;  5HV4 A;  3NJY A;  3FHQ A;  1GLH A;  4XXA A;  2ATF A;  1C1F A;  1YNA A;  5H9P A;  3UKN A;  2ARC A;  1PIV 2;  4DEQ A;  2MEV 1;  1GZW B;  2GDF A;  4A7Z A;  3EMR A;  2ZX2 A;  4RR3 B;  3MIC A;  4XF1 A;  5T3N A;  4CXY A;  1GMM A;  4OHZ A;  4UFM A;  5FO8 B;  4PDW C;  2XOM A;  2Y64 A;  4KG0 A;  5KXE A;  4N90 A;  1G9D A;  1PO1 2;  2DBI A;  4Q4Y 3;  5FP9 A;  1G9F A;  1L7L A;  1VMF A;  2GH8 A;  2VUC A;  4A4A A;  4E2Q A;  3TAY A;  4E4H A;  1ND2 A;  1O91 A;  1W8U A;  2DVF A;  3KHB A;  1HRI 3;  4FPK A;  5FXW A;  5T50 A;  2V4V A;  2YC0 A;  3H1Y A;  3AVS A;  4CDQ B;  1BYH A;  2JG9 C;  5IFT A;  2ZGL A;  3AMM A;  2P5B A;  1XRU A;  4Y26 A;  4U2A A;  5IVB A;  3MF6 A;  3RMY A;  3MPP G;  2VZV A;  3WVJ A;  2RJL A;  1D4M 1;  1D0H A;  1WLD A;  2J1A A;  3I59 B;  2GC3 A;  5A3W A;  1IZ3 A;  2WT1 A;  1GAN A;  1D7P M;  1G86 A;  2YUE A;  5FMB A;  5EWS A;  5E6H A;  3WZ1 A;  3Q8B A;  4BCU A;  4JGZ C;  5K4L A;  5A3T A;  1HB4 A;  1R08 1;  2Z69 A;  2WZR 2;  3H1M A;  5IUQ A;  1W9S A;  1L3J A;  2FDG A;  1COV 2;  3SKV A;  3H8X A;  1X8M A;  4K21 A;  5FQ0 B;  3CL1 A;  4ASL A;  2J1U A;  1VBD 1;  5FPX A;  1DU3 D;  1O4T A;  2DYC A;  1TMF 3;  4NPL A;  3J8F 3;  5BUV A;  2VEC A;  4YGD A;  1SDW A;  4LNV A;  4PDW B;  1YI7 A;  4WVM B;  5JI9 A;  2GSY A;  2O8O A;  1OMI A;  3FLR A;  3I97 A;  2C5D A;  4XUN A;  2CWM A;  2QJV A;  4KU8 A;  2Y60 A;  3RZG A;  1N3P A;  4IXL A;  3H7J A;  2R49 A;  4HZF A;  3NW4 A;  1ULE A;  5F7U A;  3VKF C;  4XHB A;  1IS4 A;  1KS4 A;  1SLB A;  2VJX A;  3KSC A;  3O14 A;  5B2G B;  3I3B A;  1VAM A;  3WW4 A;  4FPY A;  2QQO A;  2JG9 B;  5I8Y A;  1W0N A;  3H7Y A;  5D8A A;  4KMQ A;  1US2 A;  1ULO A;  3CJI C;  3RI9 A;  3AL6 A;  1Z7S 1;  1VP6 A;  4MGK E;  2ID4 A;  4FVV A;  1LHO A;  4IEP A;  4YPJ A;  5EJZ B;  2DTW A;  3KV6 A;  2BTV C;  2QNK A;  3U14 A;  3UKV A;  3O0V A;  3U4X A;  1RUD 3;  2BYV E;  4ZS2 A;  4AFD A;  4SBV A;  3JBG 3;  2DWR A;  2WNE A;  1DYK A;  1V6M A;  4LUM A;  5A32 B;  4OZO A;  1QEX A;  3BI3 A;  1ZBE 1;  2FHR A;  1NX9 A;  5JSO A;  1UPI A;  3KZ4 C;  3ZO0 B;  2UYA A;  3DCQ A;  4M4R A;  1OLM E;  4AK3 A;  1H2N A;  2KM2 A;  3ON7 A;  2JIG A;  3NNJ A;  1HRV 3;  1GUI A;  3WP4 A;  2D7F A;  3M8L A;  2EIC A;  1R08 3;  3FWE A;  3KVA A;  1MS3 A;  3M4F A;  2XJP A;  1JXN A;  1ULG A;  5FY9 A;  1JUH A;  2D43 A;  3WW3 A;  5KHK A;  2IXC A;  4AXO A;  2UWC A;  1VBD 3;  5DAW A;  5E89 A;  5H9S A;  1NLQ A;  3URF A;  4YW5 A;  1JZ6 A;  2HEY F;  2LRP A;  4CPB A;  1YFY A;  2YG0 A;  2K46 A;  1A34 A;  2X29 A;  2MNG A;  3H8O A;  1J1T A;  2ARA A;  3J26 N;  4OMC A;  3ROU A;  1O59 A;  3LD8 A;  1LGN A;  3NNF A;  4GAZ A;  3MLK A;  3C2U A;  4GQ7 A;  2ZMK A;  1GOH A;  3AZW A;  3CQO A;  4QWN A;  1V70 A;  1FOD 2;  1MS8 A;  2WWS A;  3LPF A;  4LMF A;  3B01 A;  5F8P A;  1XC6 A;  1BMV 2;  4IEV A;  1EP0 A;  3AMN A;  4TLG A;  4CDU A;  1D2S A;  3J8F 2;  1DHK B;  3B94 A;  2DBN A;  3ZYB A;  1S0E A;  3CZJ A;  1DBN A;  2ZGR A;  1W05 A;  3ACH A;  5FO7 B;  1LEC A;  4LEJ A;  4AR2 A;  5IVJ A;  3BTX A;  2P3I A;  2C0Z A;  1SMV A;  3ZSM A;  2FDK A;  3EXU A;  3PJQ A;  1OF4 A;  4Y1Y A;  3KF3 A;  1MQT A;  1XOY A;  5LRS A;  1YXW A;  1HV0 A;  1REF A;  1XPW A;  2FZ1 A;  2MEV 2;  3POI A;  3NKT A;  1VPH A;  4N43 C;  2A3W A;  2JDK A;  3R4S A;  1SZB A;  3B00 A;  3W9A A;  2CDP A;  4MGT A;  1UY2 A;  1VBB 1;  1CX1 A;  3EYP A;  3BTY A;  4Q0Q A;  4FTE A;  3UYJ A;  2BDR A;  5C9A A;  3N3H A;  4UI9 L;  3I49 A;  1NE6 A;  2WQ4 A;  4HK9 A;  4RFT 0;  2Q5T A;  3VBO A;  4UBG A;  3VZK A;  5K9Y A;  1BZW A;  2VBP A;  3G7D A;  3USU A;  2JDM A;  1WMF A;  4Y20 B;  4ISR A;  2GU9 A;  3MLJ A;  3M3O A;  3I2J A;  4NHX A;  1D4M 2;  4PCR A;  4UFL A;  1AL2 2;  3ZFG A;  3TRS B;  1RHI 1;  2AH2 A;  2BZD A;  5CU1 A;  4DY3 A;  4ERO A;  1F8V A;  5IYY A;  4XFG A;  2J1S A;  2N7G A;  4TSV A;  2WA3 A;  1MVE A;  4PHZ A;  3WIN E;  2VE1 A;  1EPZ A;  3MFA A;  1RMU 1;  4WZF A;  5FKC A;  3VBU C;  4N43 B;  4FCA A;  3THD A;  4B8E A;  1G9A A;  1CGP A;  2FZ2 A;  1HQW A;  3V0A A;  5FPU A;  2F6B A;  2W1S A;  2ARX A;  2B9U A;  5FYH A;  5EYX A;  4B4R A;  4BXF A;  4CDW C;  2X10 A;  2P34 A;  1BK1 A;  4XJ8 A;  1AXY A;  5A80 A;  2W92 A;  4HAN A;  2O14 A;  2VMC A;  3J9S A;  1H1I A;  3OY8 A;  4P5H A;  3HT2 A;  1A6C A;  4C8D A;  2PXJ A;  3GZT B;  3IB3 A;  4G3Y C;  5CFD A;  5FUI A;  1NLR A;  2J42 A;  3LFM A;  1RED A;  2EIB A;  1W2A X;  5GZD A;  1OHF A;  1Z7S 2;  5CZK A;  5CAD A;  3PU3 A;  5FOJ B;  5J96 B;  1R09 1;  4ISQ A;  4YZ4 A;  3MUZ 1;  2JE8 A;  1VBB 3;  5GM0 A;  5L7O C;  4CU6 A;  1POV 0;  3NQH A;  4XC9 A;  3K46 A;  2RE9 A;  3T3Y A;  4X8N A;  3T2P A;  2RG4 A;  4RQP C;  3ZXK A;  4AI1 A;  4CTE A;  4QX1 A;  3H3U A;  4QPI A;  2XKO A;  5LAS A;  4IEY A;  4NRO A;  3FBY A;  2JWP A;  4ZON A;  2HYK A;  1B35 A;  3UGF A;  1VAK A;  1ZBE 2;  1CZT A;  2FDI A;  1W6P A;  4QPW A;  1V6J A;  3TEZ A;  3IT8 A;  3O1R A;  2HWB 1;  4CXW A;  1QJU 2;  4CEY C;  2ZHN A;  1RHI 3;  3DPR A;  4XFI A;  3FUO A;  2QFE A;  2PN5 A;  1X9P A;  4IV3 C;  1QJZ A;  1EUU A;  1KIT A;  5GZE A;  1MS0 A;  2AGS A;  5B4N A;  4NPM A;  2WAO A;  3SEP A;  4QX2 A;  5L9R A;  4A6S A;  3KT7 A;  2ERF A;  2RS5 3;  1MVQ A;  2G19 A;  3I2F A;  3FMG A;  4NO4 A;  1W90 A;  2C9K A;  4HPK A;  1UX6 A;  4LO4 B;  4V2V A;  5EQU A;  2WNU C;  2XLG A;  3I2D A;  3VHP A;  4DXT A;  3AYC A;  5C5T A;  2XBO 1;  4AWD A;  1BVP 1;  2RS1 1;  5L7O B;  1WLT A;  2G9Z A;  4LBL A;  2PA7 A;  3MIE A;  3IDC B;  1V6O A;  3VDD B;  1I9R A;  1YFU A;  4IQP A;  4FQ4 A;  1NE4 A;  4RQP B;  3WT3 A;  5T5O A;  2VU9 A;  5HCH A;  4X6R B;  2XON A;  1RUN A;  2W47 A;  2EIG A;  4CP9 B;  3LA7 A;  2DCY A;  4W8J A;  4BYY A;  3OD0 A;  2D6P A;  2CHH A;  3LCP A;  1MAC A;  1Q3E A;  1WWY A;  3AFG A;  1NLS A;  4HK8 A;  5AC9 3;  2GN3 A;  2D98 A;  3AKR A;  2AEY A;  3LGR A;  4CEY B;  4UAP A;  4I2O A;  3C7O A;  4IE0 A;  4MG2 A;  3ACG A;  4IV3 B;  4D94 A;  4DZG A;  3CBN A;  2WO2 A;  1HKD A;  4UBH A;  4RFR B;  5JZG A;  3BUC A;  3V0B B;  1CZV A;  2GN7 A;  4YM2 A;  5GZC A;  3RMX A;  3GHM A;  5J36 A;  5K7P A;  4QQO A;  1HB2 A;  1VBB 2;  2WNU B;  3E5Q A;  5LK7 B;  1PM7 A;  5GLU A;  1PK6 C;  3ZYI B;  4O9G A;  2IC1 A;  2PLV 1;  2HWB 3;  1PVX A;  3FHI B;  5F1R A;  5A33 B;  1QXR A;  4Z07 A;  1DQ6 A;  4JGY A;  5FPZ A;  3LF7 A;  3OOX A;  1XU2 A;  5JI7 A;  2IVI B;  2E32 A;  1H0B A;  1CAU B;  2V72 A;  3NVC A;  3OJB A;  4OQ9 A;  3ZIX A;  4FXG B;  4QB2 A;  4XFB A;  5G04 L;  2XDV A;  4Q4X 3;  1HB3 A;  3GZU C;  3M3C A;  4ZU7 A;  2HH9 A;  2WR9 A;  3PUI A;  3SH4 A;  3QBQ A;  3MF9 A;  1CPN A;  2Y6L A;  3RJR A;  3OBR A;  2UY9 A;  3A0N A;  4A42 A;  2EAK A;  2O0O A;  4CVU A;  5FYU A;  2W94 A;  3WNO A;  1PO2 1;  5LA2 A;  4ZU5 A;  2PHX A;  2VW2 A;  3SHR A;  1TQ5 A;  1RMU 2;  2VAU A;  1EV1 1;  4AHZ A;  1K5M C;  4HLT A;  1R1A 1;  3TB0 A;  1FX5 A;  1OA2 A;  3PLQ A;  1U5I A;  2YBK A;  4A44 A;  5FZO B;  3AYD A;  4P9X A;  5EFU A;  1Q8P A;  3HJR A;  5LBE A;  3MI8 A;  1RC6 A;  2BWA A;  3WG2 A;  4F3J A;  3WX5 A;  1C57 A;  3N9P A;  1J83 A;  4XFH A;  3OTF A;  4LOS A;  1IKP A;  1S0F A;  4B3N A;  5EZW A;  4GH4 C;  1V6N A;  4K20 A;  2HBU A;  2RJK A;  1RVF 1;  4MHU A;  4HOO A;  4ATF A;  4CEW A;  1BLZ A;  4YSF A;  1QWR A;  1CWP A;  4QDR A;  1OFS A;  1R09 2;  1ULD A;  2SLI A;  1UKR A;  5ABJ A;  1SPP A;  1WW7 A;  4CPB D;  2VOK A;  4AED A;  3AYE A;  4AG4 A;  2W39 A;  4COV A;  4E4D X;  3VHR A;  3AYA A;  3UGH A;  1GZT A;  1W9Y A;  1OUR A;  2XR4 A;  1S0D A;  4FOQ A;  4RL7 A;  1W8H A;  1Y4W A;  1QJX 3;  3FLT A;  4JVA A;  5FRE A;  1JZ5 A;  1CN1 A;  1VBE 1;  4F83 A;  1ONA A;  4W6X A;  5LCW L;  3AP6 A;  4YZ3 A;  1I6X A;  2GNM A;  1X82 A;  5C8W A;  1XND A;  1K5M B;  4ITC A;  3A23 A;  2W5F A;  3IBM A;  5FZ9 A;  4XF0 A;  3HD8 B;  1PZ9 A;  2ADD A;  2AC1 A;  3BOD A;  5FPB A;  5FZC A;  1AXZ A;  4R9B A;  2OT7 A;  3SNM A;  2Q0A A;  4YFW A;  1XXN A;  4N9I A;  4BA6 A;  4LBK A;  3DEC A;  2C6S A;  4ZPI A;  4FPF A;  1KJR A;  5CBL A;  4QAW A;  2Q8C A;  3JB8 A;  1PO2 3;  5FJH A;  2JEC A;  4HN0 A;  2HWC 1;  4MO3 M;  5FYS A;  2RDS A;  3AFK A;  5C8C A;  1ZRF A;  4GH4 B;  1YUD A;  5A6Y A;  3S0M A;  1TE1 B;  1EV1 3;  5FZL A;  2IFR A;  4L97 A;  1UY4 A;  5E16 A;  4BQW A;  2ZX3 A;  3NMB A;  3E6C C;  4Q1P A;  1TME 3;  2G1M A;  2XL7 A;  4QB6 A;  2ARE A;  5E8A A;  3T09 A;  3WUD A;  4ZHN A;  2XBO 2;  2RS1 2;  4AAX A;  4MV2 A;  3BU0 A;  4XAE A;  2D3P A;  1CAX A;  1JHN A;  1NQD A;  4HT1 T;  5KHI A;  1UQX A;  1E5R A;  3JB4 C;  1JU3 A;  4YZ2 A;  4NIG A;  1LOG A;  1QIQ A;  3K4D A;  3VKO A;  3DGT A;  4OMD A;  1JOJ A;  4OHX A;  5A3O A;  1NA1 C;  3KQR A;  4QD2 A;  4XIL A;  4P08 A;  3BTZ A;  2E9Q A;  3M70 A;  4CCL A;  5C6C A;  1W6O B;  3WQ7 A;  1OLM A;  5FMO L;  4WM7 A;  3WF3 A;  4OZX A;  4LIU A;  4PLO A;  4WM8 B;  2E7A A;  5FZG A;  4GWJ A;  3KGZ A;  4DB5 A;  1IKQ A;  3OBT A;  3V56 A;  3G6J B;  3WF2 A;  3T2Q A;  5ERL A;  3LIH A;  2MPF A;  2JD4 A;  2AZ5 A;  2VGD A;  1NQJ A;  3LSE A;  4HET A;  4PBP A;  4NE9 A;  2PAM A;  1QQP 3;  3VBR A;  4EWE A;  1Q56 A;  2PLV 2;  4JX0 A;  4R4Z A;  4KG8 A;  4RGK A;  1SCR A;  4A2U A;  4GKX A;  1SBF A;  1NCQ C;  3IMM A;  4P5Y A;  3W5M A;  1Q8S A;  2CGO A;  1S0B A;  4K6B A;  2HWC 3;  5JVV A;  2OX0 A;  2YC2 A;  1W6M B;  4XET A;  2J1R A;  4IEU A;  1O7F A;  4K3U A;  2EA7 A;  1NA1 B;  5LA0 A;  1I5P A;  2VY0 A;  2XB6 C;  4W50 A;  2YHJ A;  2RM2 1;  2VCM A;  4MXV A;  3WV6 A;  1KGY A;  2JB4 A;  5FKB A;  1XYO A;  2OYZ A;  3FHA A;  3VV1 A;  4AVV A;  2VW1 A;  2ZCW A;  4Q5O A;  5FMO S;  4UW3 A;  1J59 A;  3KM5 A;  2XVG A;  5DZG A;  4DXZ A;  4O61 A;  3E5X A;  3IPV A;  3DF0 A;  2WFF 3;  2WDB A;  2GAL A;  3MFC A;  4I3P A;  1R1A 2;  4FPG A;  2VZR A;  4AQ6 A;  4C1X A;  1FV3 A;  1RUJ 1;  3WP5 A;  1GQH A;  2IWG B;  4BQ3 A;  1CJD A;  3VBH B;  3FC0 A;  2X5I C;  1G8W A;  4EJR A;  1GZ9 A;  1X33 A;  2A6W A;  3LZZ A;  1NCQ B;  3IDA A;  1GNZ A;  4D6R A;  1MZ5 A;  2P6C A;  5GKA C;  3AZV A;  1JZ7 A;  4RYD A;  2A6Y A;  1RVF 2;  2OQ7 A;  3THC A;  4DRR A;  5T5P A;  2OUJ A;  5CNA A;  1E5I A;  5FFO C;  3RGB A;  2WS9 3;  1OOP A;  3K77 A;  2XJV A;  4OCT A;  4YW3 A;  2XPJ A;  3ZPO A;  1UY3 A;  4YW4 A;  3K75 B;  3VDA A;  5FBZ A;  5IK8 A;  3DV8 A;  4IW3 A;  2J22 A;  5C4W C;  4N53 A;  2DVD A;  2VO5 A;  3SXW A;  4UFI A;  5FZH A;  4JRA A;  4LBM A;  4MSV A;  4COW A;  1PHM A;  1OQ1 A;  1VBE 2;  1ZA7 A;  2VM9 A;  3GHN A;  4P9G A;  5FYZ A;  5EYY A;  2FQP A;  3LA2 A;  3LOI A;  1PO1 1;  1NXD 1;  2VCA A;  4XAC A;  3KHC A;  5F6K A;  3PVO A;  2W68 A;  4OUE A;  2QQP A;  1AR7 1;  1GU3 A;  4Q0U A;  3LIG A;  5FZA A;  5A6X A;  1S1A A;  5DMY A;  3SQO A;  2E7Q A;  3NO8 A;  1QDC A;  2GND A;  2X5I B;  4Y1X A;  3RYP A;  3TBD A;  4CP0 A;  5CG8 A;  1V00 A;  2WSU A;  4K1Z A;  1XNK A;  2QQJ A;  2HWC 2;  2GH2 A;  1GKB A;  2VTX A;  4NR1 A;  5FZ8 A;  4CDX C;  5F32 A;  1MS4 A;  4FO9 A;  5FZK A;  2V5Y A;  3RYR A;  1VE0 A;  4GMP 0;  4P9Y A;  1IGO A;  3MIF A;  1XQN A;  4QDS A;  1RUJ 3;  4TN7 A;  3MPB A;  1LOF A;  2CTV A;  2QTW B;  2W1U A;  2WZR 1;  1W0O A;  4XIO A;  3OGG A;  1COV 1;  1P8J A;  5AFB A;  3H3Z A;  5C4W B;  3T0D A;  3ZXE A;  4AI9 A;  4FOV A;  3ZXJ A;  1OKQ A;  2AEZ A;  5KHG A;  1QDO A;  1RUC 1;  4QQL A;  4AI0 A;  2PQQ A;  4UT5 A;  4BM8 A;  5FPL A;  4WVV A;  2XHN A;  1W9T A;  1W6N A;  3DKW A;  2Y6G A;  2OXB A;  3AX4 A;  3PTY A;  5A70 A;  3UJQ A;  4ONU A;  1ENS A;  4CYD A;  1L7Q A;  2AR6 A;  1PIV 3;  1ASJ 2;  1ZM1 A;  1W3V A;  2ZZQ A;  4BE3 A;  4FXK B;  3JQX A;  4BQX A;  1W04 A;  1RJ7 A;  1RTV A;  4XE9 A;  1ZZ7 A;  2QQM A;  4J25 A;  1SBE A;  3ZMO A;  3NAP C;  1OH4 A;  2WBK A;  2DU1 A;  1I5Z A;  1PO1 3;  4IUG A;  4LTA A;  5GLW A;  1AX1 A;  4R4X A;  2XLF A;  4W6W A;  1JS9 A;  3ENR A;  4IV1 C;  3WY6 A;  3MV1 1;  3TNP B;  1G7Y A;  3WG3 A;  2B7Y A;  5C70 A;  3NNL A;  5KWR A;  1PNG A;  4LBQ D;  4I0A A;  1CAV B;  1V6L A;  3K2O A;  3I2I A;  3HQX A;  2OA2 A;  5GZG A;  1QXJ A;  4S2H A;  4RR3 A;  4AGG A;  1MEC 2;  2PHW A;  2BER A;  4GJZ A;  2HWF 1;  1LHN A;  5BNQ A;  4OFG A;  4D8M A;  4W65 A;  2RM2 2;  1GQP A;  4IGQ A;  2VUA A;  5JSP A;  3PVB B;  4Y4Y A;  5EIY B;  2WZR 3;  5FY0 A;  4RS5 C;  1COV 3;  1N1Y A;  4QGN A;  4PI0 A;  5BPX A;  1O3S A;  3H3L A;  4CDQ A;  3POB A;  4M01 A;  4FPE A;  2H0B A;  3ST7 A;  3WUC A;  4OLL A;  1C1L A;  3K48 A;  4JCK A;  3NAP B;  4UFJ A;  5FYC A;  3EQE A;  2ZAH A;  4NJ4 A;  2BW8 A;  4EN0 A;  1BBT 2;  1XYN A;  2H0V A;  4QQP A;  2WZP P;  2ZJC A;  2ZA9 A;  1JMU B;  3S5Q A;  1G9B A;  2FDF A;  2P2K A;  3I59 A;  2EID A;  2R04 1;  2Y34 A;  1RUJ 2;  2YRO A;  3KS7 A;  3JD7 1;  1LGC A;  4IV1 B;  2ZAC A;  1XU1 A;  2WQ8 A;  1OLQ A;  2DFB A;  3B3Q E;  3Q8A A;  2D6M A;  3SKJ E;  3PUS A;  2ET1 A;  2R07 1;  3VD7 A;  1FYU A;  1CPM A;  3ZFE C;  1OA3 A;  3Q8E A;  2PEL A;  2Y8K A;  3BOP A;  5J48 A;  3KT4 A;  2DTY A;  4I30 A;  1N3Q A;  4MXW B;  5LA1 A;  1MPX A;  4PDW A;  4QPG C;  4WVM A;  4Y1V A;  4M4P A;  5LK5 A;  1X8E A;  4L8Q A;  5DXD A;  3NJV A;  4CCJ A;  4DNY A;  4FP3 A;  4IEQ A;  1OBN A;  4RS5 B;  2LW8 A;  3W58 A;  4PT6 A;  3VD9 A;  2WII B;  4Y1U A;  3T30 A;  3U37 A;  2VUL A;  2ZX0 A;  3LEI A;  1YQ8 A;  2GP5 A;  4F8A A;  2JG9 A;  3IAP A;  2B8M A;  1JW6 A;  5CAZ A;  1UY0 A;  4XUP A;  2CAV A;  5GZF A;  4TYS A;  1GP6 A;  4AVA A;  2ZEX A;  1AR7 2;  4QX5 A;  1QNY A;  1QH7 A;  5IVC A;  1YJK A;  3ALQ A;  5J1X A;  1ZRR A;  3VBF C;  2FDJ A;  4JGZ A;  2PHF A;  2PMW B;  4YW7 A;  3RYK A;  2DUP A;  2J1E A;  3BKZ A;  1H6Y A;  4HKL A;  1LHV A;  4XFA A;  4OYU A;  4PF5 A;  5FZ7 A;  2IXI A;  4E4Z A;  2VBD A;  1AF9 A;  2VNG A;  1JUI A;  2QZ3 A;  5A32 A;  4YNI A;  1CAW B;  2E7T A;  2EVX A;  4QPG B;  1AL2 1;  5L9B A;  4AE2 A;  1K12 A;  5EV7 A;  5BNN B;  1FOD 3;  3R0R A;  2ZX1 A;  4PF1 A;  4BLI A;  1TVG A;  2QDN A;  1N1S A;  3FZ3 A;  5IFP A;  1J1L A;  2WAA A;  1UU4 A;  1RUC 2;  1F2N A;  2XG3 A;  4JDO A;  4GAL A;  3VBS C;  2Y6H A;  3CHX A;  2ZX4 A;  2XVL A;  3CJI A;  4R8H A;  5GAL A;  2VQ0 A;  1ND3 B;  4SLI A;  2ORZ A;  5A3N A;  5J09 A;  2VOT A;  2A6X A;  4AVS A;  5JOZ A;  3VBF B;  3Q9O A;  1F5F A;  2QQV A;  2RS3 1;  1VRB A;  3DYO A;  2QQU A;  1F5J A;  2MEV 3;  4XCB A;  2RVA A;  5JOX A;  2Y33 A;  4KU7 A;  5A6Z A;  2DCZ A;  3WQ0 A;  3H9A A;  5FUN A;  1WW5 A;  2BNM A;  4OHW A;  3U10 A;  2ZKL A;  2VXJ A;  5JMC A;  1UOG A;  1KQR A;  2DV9 A;  2LS6 A;  1X7N A;  5HV0 A;  1DQ0 A;  1GIC A;  4J6G A;  4L0P A;  4NWV A;  1UL9 A;  1KDK A;  2HEV F;  4XHX A;  2R32 A;  4LO7 A;  1O3T A;  2Q8E A;  5F2S A;  1WGP A;  3OGR A;  2VZP A;  3A0K A;  3RZK A;  3DXT A;  2YBS A;  1XE0 A;  3SH5 A;  4COZ A;  5HXV A;  5I0U A;  3E5U A;  4K8F A;  2GNB A;  4QKD A;  3DKQ A;  3ES4 A;  4NAM A;  4AOC A;  5FO9 B;  4IET A;  4XF3 A;  1XB9 A;  2HWF 2;  2LTN A;  1XNA A;  3Q8C A;  3VBS B;  1D4M 3;  3W20 A;  2WO1 A;  3E97 A;  4CCN A;  4QX0 A;  4XIK A;  1AL2 3;  1PZ7 A;  1ULP A;  3VZM A;  1QJU 1;  2A7A A;  2W1Q A;  1EYB A;  4CRQ A;  4OHY A;  2YBP A;  2BUK A;  1AR9 1;  5C5U A;  1DIW A;  4CU8 A;  1YQ5 A;  5EXO A;  3ZDV A;  4C0B A;  3POJ A;  3W5N A;  3NWK A;  5LAT A;  1LOE A;  3MV0 1;  3M3I A;  3ZN6 B;  1L7R A;  4ARX A;  1LGB A;  5DAQ A;  1RB8 G;  4Y20 A;  1BQP A;  1U0A A;  3ME2 A;  5FZD A;  4DIN B;  2JG8 C;  1T6B X;  2R04 2;  4LHL A;  2D6O X;  3JD7 2;  4DY5 A;  3DYP A;  3AMP A;  3B9C A;  1BVV A;  1DLL A;  3LE0 A;  1ZRE A;  5ANN A;  5I0D A;  2EXK A;  2R07 2;  4O7X A;  5BV6 A;  4CCO A;  2FCU A;  3ZOI A;  1CES A;  2VZ1 A;  4LLF A;  2EXH A;  4KWK A;  1VMJ A;  3DXU A;  4N43 A;  2JIJ A;  1Z7S 3;  2GME A;  3WNL A;  1AR6 1;  2WC2 A;  2DCT A;  1A8M A;  3D8C A;  3ACI A;  4AEJ A;  3QCW A;  3ILF A;  3HR9 A;  2VH9 A;  1S55 A;  4YRD A;  5CYY A;  4YW1 A;  3D0S A;  4XTM A;  3KV4 A;  1ZBE 3;  3PJY A;  5CEH A;  4YM0 A;  1WMX A;  3GCW A;  3ZM8 A;  1KFX L;  2XUM A;  4NRQ A;  1HQL A;  2JG8 B;  2OPW A;  4TXW A;  1QJU 3;  3PME A;  3CF6 E;  4LKS A;  1IOA A;  3VL8 A;  1OVP A;  1UU6 A;  4EQV A;  1AR9 3;  1OPM A;  5F3I A;  1JH5 A;  2P1B A;  1UZW A;  4EYU A;  1ZZ6 A;  2XHK A;  2D6K A;  5J98 B;  1QHD A;  2VTF A;  5FZM A;  1UXX X;  1MR5 A;  3ABZ A;  3JU9 A;  3VBU A;  5AFE A;  1C4R A;  5KXB A;  1LCL A;  3KMH A;  2CNA A;  3POS A;  5GLZ A;  4N7U A;  1ZRD A;  1W2T A;  1DCS A;  1DYP A;  2IXJ A;  3M7A A;  4LHK A;  4MGY E;  2A6V A;  4Y4R A;  3W21 A;  4CDW A;  4BOW A;  3I3E A;  2VZT A;  2IFW A;  1HXS 1;  3HNY M;  5JSR A;  1BK0 A;  4MVT A;  1QH6 A;  1KRI A;  3PVN A;  1HQN A;  2VNV A;  4QXK A;  2C4X A;  2VZU A;  2BV4 A;  3POF A;  3OEB A;  5F6L B;  4P9I A;  4B7K A;  1AR6 3;  1YWK A;  2JE7 A;  3IAQ A;  3KCY A;  2UWB A;  1AR8 1;  3ORJ A;  4G4F A;  4AYU A;  4NID A;  1RL3 A;  3ZKY A;  4E2S A;  4AI8 A;  1H8T C;  2YU1 A;  5L7O A;  5FRA A;  4EZ4 A;  4HKW A;  5IW0 A;  2Z42 A;  3UNP A;  1C8N A;  2RS3 2;  1AJK A;  2EF6 A;  4RQP A;  3LPG A;  2VME A;  1POQ A;  4BU2 A;  4NHK A;  4CDU B;  1DGR A;  1E57 A;  3D6E A;  4CP9 A;  4QQH A;  2ZMN A;  3PNA A;  1Y9G A;  2Q1M A;  3HBK A;  4YM1 A;  2PQS A;  3LWC A;  4N8M A;  1AYN 1;  2RV9 A;  1OUX A;  5CIR A;  4BHP A;  2B45 X;  3VDD C;  4B4P A;  4D6S A;  3ZPY A;  4CEY A;  1QOO A;  4LQR A;  2BGP A;  4LPL A;  3T1M A;  3B9I A;  1TG7 A;  1J3R A;  1REE A;  2WFP A;  3GZE A;  4IV3 A;  1PGL 1;  2RMU 1;  1UOF A;  5I0T A;  5A7Q A;  1UYY A;  5DAB A;  5SV8 A;  2E53 A;  4GZ9 A;  4JV4 A;  4YG3 A;  3V0B A;  4ARY A;  1AX2 A;  4Z8B A;  2I2S A;  2TUN A;  2W3J A;  2WNU A;  4QPY A;  1RGS A;  4AHW A;  4Z1V A;  3F95 A;  4MOA A;  3PUQ A;  3OUI A;  1H8T B;  5A33 A;  3RWK X;  2X05 A;  1AR9 2;  1GWL A;  3QH6 A;  4L99 A;  3ZXG A;  1EAH 1;  5LWB A;  2ZAB A;  1XJA A;  3O7O A;  1WW4 A;  3SCG A;  3VBO B;  3ZLI A;  1RMU 3;  5KHJ A;  4AQT A;  3WDX A;  2CL2 A;  1WCD J;  1CAU A;  5CG9 A;  1GOG A;  1ZBA 1;  3N9M A;  3IWZ A;  2P17 A;  4FBF A;  3U1X A;  4B1M A;  2MHF A;  3R6S A;  1AR8 3;  5LZ6 A;  2VOV A;  5FPV A;  2ZGS A;  3ZYG A;  3ZFG B;  3RZM A;  1GWK A;  3X29 B;  2OKX A;  4D3W A;  5DG1 A;  3M2M A;  4BXS V;  4YG6 A;  3MHZ A;  2WZE A;  3SC7 X;  2Y6J A;  4QDQ A;  3D82 A;  4QKN A;  2QQK A;  3WNM A;  3WQ1 A;  1AX0 A;  4QXC A;  5DZF A;  2WLP A;  2D97 A;  4DOU A;  1H4H A;  2EAL A;  4COY A;  3GJB A;  3GXU A;  2KD7 A;  4ORF A;  1R09 3;  1AR6 2;  3R05 A;  2VMF A;  5FMC A;  1UYX A;  2RDR A;  2B42 B;  5FZO A;  2VMD A;  1AYN 3;  1VBC 1;  4AHX A;  4BK5 A;  5ABJ C;  1YYN A;  2CSG A;  1PK6 A;  4I01 A;  4Q26 A;  1ZZ8 A;  2UU8 A;  1NAE A;  1SHW B;  3ATG A;  4M3C A;  5G05 L;  3RZH A;  2JKB A;  3CLP A;  3MLL A;  3OUJ A;  2G9F A;  4N7I A;  5FZB A;  1EY2 A;  4GUL A;  3VZL A;  3KLS A;  5IK7 A;  3BOW A;  1QOT A;  1WUV A;  2ZGK A;  4XJA A;  1UZY A;  3SLI A;  1QU0 A;  3OBZ A;  4HON A;  2OQ6 A;  4Q4W 1;  5AVP A;  5HCA A;  4AI3 A;  4KGG A;  2DUQ A;  4KWJ A;  1LTE A;  3RZL A;  5CVR A;  4KBB A;  1F4H A;  3ZN4 A;  5IVF A;  2DVB A;  3N9N A;  1SFN A;  1ODM A;  1SLL A;  1E5H A;  1V9U 2;  2XKP A;  2ZGU A;  4YGC A;  3UET A;  2V73 A;  4BK4 A;  2DUR A;  4ZZ5 A;  2VMI A;  2WUH A;  5JPM B;  3AZZ A;  1DGR N;  3HNB M;  4R9A A;  3AC0 A;  1WME A;  1FNY A;  1GNY A;  1RUH 1;  1CVN A;  4QB1 A;  1W2U A;  1URX A;  1WCS A;  1ZBA 3;  4QMA A;  1K5M A;  3UES A;  3DL3 A;  3OGJ A;  2A6Z A;  5BNP C;  5FUP A;  2XL9 A;  4QM8 A;  2XBO 3;  3PUR A;  4PQ9 A;  2RS1 3;  3AZY A;  2Y26 A;  4PIZ A;  3VKN A;  1WD3 A;  3N35 A;  2ZEY A;  1LR5 A;  4DMI A;  1HXS 2;  1YQ2 A;  3NL1 A;  4UXA A;  2ZZJ A;  2W2I A;  2ZHM A;  1V0A A;  1VLN A;  1VMH A;  2BU9 A;  3U11 A;  1UPS A;  1UU5 A;  4AGR A;  2VVF A;  4GH4 A;  2D93 A;  4RGA A;  3O5S A;  5KBF A;  3S30 A;  4Q8L A;  5JDB A;  2PHU A;  1YIP A;  4AI2 A;  5HXM A;  1IPS A;  1W06 A;  2ZXQ A;  1HW5 A;  4HSL A;  2Z4F A;  1AR8 2;  1R64 A;  4LBQ A;  3OGS A;  1QNW A;  3N7M A;  2OZ6 A;  1DQ4 A;  1S4C A;  5FAX A;  3WNX A;  3AXE A;  1C28 A;  1LOA A;  4LK6 A;  3USS A;  1YIF A;  4R9D A;  4JKL A;  4DO0 A;  4I0W B;  2I07 B;  2VOX A;  1MZE A;  1FMD 1;  1F31 A;  1YJL A;  3PUA A;  3NV3 A;  3IMN A;  1AYN 2;  4YVW C;  5BNP B;  2BFU L;  2CDO A;  2PLV 3;  2W9X A;  2ZGO A;  1O3R A;  3ASI A;  2H6B A;  4CCD A;  4HVO A;  5CFC C;  3MW4 A;  3L9J T;  1NY7 1;  1PVC 1;  4WZC A;  4MUV A;  1BXH A;  2XLA A;  3HN3 A;  3TYJ A;  2JD9 A;  3WCS A;  4A41 A;  1LJ7 A;  4TLF A;  5FY7 A;  3ZFE B;  1PGL 2;  2RMU 2;  2WYF A;  3GYD A;  2CGN A;  5A3P A;  1C5I A;  4Y22 A;  3WR0 A;  2R0F A;  4URA A;  1PX4 A;  1BCX A;  3ELN A;  2O8Q A;  3EJK A;  3P3P A;  4CE8 A;  1DQ2 A;  2GC2 A;  3OYW B;  5DN2 A;  5DUW A;  2XJQ A;  1JYI A;  4YW2 A;  1D0G A;  1WCU A;  4U36 A;  5I8T A;  1VBA 1;  5H9Q A;  3WNN A;  1UYZ A;  4UW6 A;  4WM8 C;  4XUQ A;  1RUF 1;  1US3 A;  4A45 A;  1EAH 2;  2V09 A;  4AFC A;  4BIF A;  4JHZ A;  1J84 A;  1KD7 A;  1CIW A;  2HWD 1;  4KGQ A;  5C3Q A;  1IPK A;  3N7J A;  1U5X A;  1Y7B A;  5LEJ A;  1DDL A;  1NT0 A;  3LB9 A;  2KA3 A;  3BB6 A;  5JR2 A;  3AVR A;  1W6M A;  3VZN A;  1ZBA 2;  5FZ3 A;  1AYM 1;  3FX3 A;  1R1A 3;  1NA1 A;  3GZA A;  1F9K A;  1KXG A;  1LU1 A;  5C3P A;  3POW A;  4YVW B;  3RS6 A;  1ZVF A;  4AEK A;  5EJ1 B;  4BQ4 A;  1JI6 A;  2WKK A;  4AVB A;  5CFC B;  4XBN A;  1C3H A;  2P37 A;  4B7E A;  1NUK A;  1S0J A;  5LA9 A;  5I93 A;  4Q2F A;  4QKB A;  3MDP A;  1NOV A;  2G9G A;  2XWB B;  4IGP A;  1GYK A;  1C8M 1;  5IVY A;  1JYW A;  1RVF 3;  2WJS A;  5I0R A;  3HPN A;  3GM8 A;  3PMS A;  4XJW A;  1CR7 A;  1GP5 A;  1YI9 A;  4KL1 A;  1FMD 3;  4BDV B;  3HOB A;  1XE7 A;  4CUA A;  2VXR A;  3N7K A;  1VBC 2;  3AP5 A;  3CJX A;  4FFI A;  1ASJ 1;  2YMZ A;  2JDA A;  3I3Q A;  4CU7 A;  1SDD B;  4L2N A;  2RR1 1;  2Q8D A;  4LKD A;  1VBE 3;  1XSQ A;  3FE5 A;  1NCQ A;  3K4Z A;  3QD6 A;  3SEE A;  5K0U C;  5HPO A;  1M4W A;  4Q4W 2;  5JXG A;  4JTO A;  1RJ8 A;  4XDQ A;  3SMH A;  4KH9 A;  2GC1 A;  4ZY9 A;  2CAU A;  4OI2 A;  3WW2 A;  4IEW A;  4QHB A;  3VBH C;  4Z2W A;  3ACL A;  5ABJ B;  3KF5 A;  5LRR A;  1VBA 3;  1I3H A;  1CON A;  1YQC A;  1QJE A;  2DU0 A;  2UYB A;  4IER A;  1RUI 2;  2R16 A;  5F5Q A;  1W9F A;  2RJ2 A;  2QQI A;  4L92 A;  1OSG A;  2Q30 A;  4QHO A;  5FYB A;  1JZ8 A;  1DGW A;  2OZJ A;  1ZA4 A;  1MEC 1;  4BQ2 A;  2Y6K A;  4XAA A;  5KHH A;  3P5B A;  1RUH 2;  1ACC A;  1HX6 A;  3INA A;  4LO8 A;  1H2K A;  2HEW F;  5L36 A;  5IHR A;  5FIX A;  1W6Q B; 
#chains in the Genus database with same CATH homology
 1XC6 A;  3T0A A;  4DUW A;  2R7E B;  2EID A;  3I3D A;  3CZJ A;  3WSO A;  1JYX A;  2WQ8 A;  3ACH A;  4MGS A;  1JZ4 A;  3SKJ E;  1UXZ A;  2VZS A;  4XVH A;  3VD7 A;  5DQ0 A;  1JZ2 A;  1OF4 A;  1UY1 A;  2WO3 A;  2Y8K A;  2L9L A;  4RN5 A;  4ZZ8 A;  1XPW A;  4ZXE A;  2VCB A;  5LA1 A;  1LNS A;  1MPX A;  3K4A A;  2XQX A;  2YB7 A;  4M4P A;  2CDP A;  3NJV A;  2JKX A;  1UY2 A;  1CX1 A;  3EYP A;  3I2G A;  2LW8 A;  3VD9 A;  4PT6 A;  4UI9 L;  3U37 A;  4JKK A;  3LEI A;  3IAP A;  3OB8 A;  1UY0 A;  4CUC A;  4XUP A;  2ZEX A;  3NRU A;  4DUV A;  1PMJ X;  5J1X A;  3I2J A;  1HN1 A;  2QQN A;  2VQU A;  2J1E A;  3CDZ B;  1H6Y A;  3MO4 A;  1K45 A;  4OYU A;  4D0Q A;  3E1F 1;  2BZD A;  1H6X A;  5IYY A;  2J1S A;  5IJR A;  3PUH A;  3THD A;  2DCJ A;  4KWU A;  1K12 A;  3NNG A;  2B4K A;  1K3I A;  2W1S A;  4PF1 A;  1TVG A;  2X10 A;  5IFP A;  1UX7 A;  2WAA A;  2W92 A;  2BBA A;  4XZU G;  2VMC A;  3WEZ A;  2Y6H A;  1JYV A;  3IB3 A;  5FUI A;  2EIB A;  3OGV A;  2ORZ A;  3WNK A;  5CZK A;  2VOT A;  2YC4 A;  2JE8 A;  3MUZ 1;  3DYO A;  4QX3 A;  4CU6 A;  3NQH A;  2RVA A;  3K46 A;  3T2P A;  2V5D A;  4QX1 A;  2LS6 A;  1DYO A;  4L0P A;  1CZT A;  4QPW A;  3LEK A;  3OGR A;  2VZP A;  1O8P A;  3III A;  1PMH X;  1EUU A;  5B4N A;  5C71 A;  3SEP A;  2WAO A;  1XNA A;  4QX2 A;  1BHG A;  2WO1 A;  1DP0 A;  4QX0 A;  1ULP A;  3I2F A;  2C9K A;  2W1Q A;  4D8M A;  2ZEZ A;  5B4X A;  4DXT A;  4CU8 A;  4PQQ A;  1XNT A;  5JUV A;  3VDB A;  3W5N A;  1UWW A;  2VQT A;  4ARX A;  3MV0 1;  1L7R A;  2WZ8 A;  3ECQ A;  1EUT A;  3CKH A;  2XON A;  3DYM A;  2W47 A;  4DXR A;  3CZU A;  2E26 A;  4W8J A;  3DYP A;  3GGL A;  1UZ0 A;  3LE0 A;  2VZQ A;  5I0D A;  1OD3 A;  5A1A A;  4UAP A;  3C7O A;  3T2O A;  2VZ1 A;  1O8S A;  3ACG A;  3WNL A;  1GOF A;  2WO2 A;  3C7H A;  2VR4 A;  1CZV A;  1UMH A;  1SG3 A;  3ACI A;  3BGA A;  5CYY A;  3D3A A;  3I2H A;  2HYX A;  4FI9 A;  4HG6 B;  3ZM8 A;  2E32 A;  2QQL A;  2V72 A;  3NJX A;  4QB2 A;  4TXW A;  5G04 L;  4DXS A;  4P00 B;  1DLC A;  4XUT A;  4LKS A;  3HNM A;  2WN3 A;  3PUI A;  1UMI A;  2Y6L A;  3P1I A;  4CVU A;  4A42 A;  2BGO A;  2VL4 A;  2W94 A;  3WNO A;  3VD4 A;  2VTF A;  1UXX X;  3ABZ A;  2ORX A;  3VD3 A;  2VCC A;  2W46 A;  2VZO A;  2WAB A;  2W91 A;  4A44 A;  2ZEW A;  1W9W A;  3JXS A;  3WNP A;  2YFZ A;  3I3E A;  2VZT A;  1JZ3 A;  3HNY M;  3HJR A;  3GDB A;  5JMO A;  2C4X A;  2VZU A;  2W1W A;  3OEB A;  1J83 A;  3OEA A;  2DCK A;  4MGQ A;  3IAQ A;  2HLE A;  3A21 A;  3I2K A;  1IQD C;  4QDR A;  3F2Z A;  4E8C A;  3UNP A;  3WF1 A;  1OT5 A;  4AG4 A;  3LPG A;  2VME A;  4DUX A;  3T08 A;  5LA2 A;  4MAD A;  1JZ5 A;  5LCW L;  1JHJ A;  2PQS A;  2RV9 A;  3CMG A;  2J1T A;  3A23 A;  1F4A A;  2W5F A;  1W8N A;  4LQR A;  2BGP A;  4LPL A;  2B9V A;  1TG7 A;  4XUO A;  4GWI A;  3DEC A;  3ETP A;  1UYY A;  2C26 A;  4QAW A;  4GZ9 A;  4MO3 M;  4ARY A;  4P02 B;  2W3J A;  1UY4 A;  4MOA A;  2E31 A;  4QB6 A;  2X05 A;  3T09 A;  3C7F A;  2WYS A;  4A6O A;  4AAX A;  3VDC A;  4Z2A A;  1GOG A;  4JKM A;  1JU3 A;  3K4D A;  4OMD A;  3ACF A;  4DEV A;  2OKX A;  4P08 A;  4BXS V;  2WZE A;  3WQB A;  5DPN A;  4BJ0 A;  5JXH A;  2Y6J A;  4QDQ A;  4KI5 M;  2QQK A;  3WF3 A;  3WNM A;  4GWJ A;  3GXU A;  2KD7 A;  3P6B A;  3WF2 A;  5JXI A;  3T2Q A;  2VMF A;  4W4Z A;  1UYX A;  4BK5 A;  2VMD A;  4CU9 A;  4A3Z A;  1W8O A;  1NAE A;  1SHW B;  2YFU A;  3A22 A;  5G05 L;  4JX0 A;  5JXJ A;  1OF3 A;  4E8D A;  3C8X A;  4P5Y A;  3W5M A;  3J7H A;  2YC2 A;  3WF0 A;  2J1R A;  1F4H A;  2W87 A;  5LA0 A;  1I5P A;  2VZ3 A;  3OG2 A;  3HEI A;  4W50 A;  2J1V A;  3UET A;  1KGY A;  4BK4 A;  4ZZ5 A;  2WUH A;  3FHA A;  3HNB M;  3AC0 A;  1NKG A;  1GNY A;  4QB1 A;  2X09 A;  3UES A;  1K42 A;  1W99 A;  2VC9 A;  1WKY A;  2DDU A;  2WDB A;  2VZR A;  3MUY 1;  4UOJ A;  2ZEY A;  3T0B A;  1YQ2 A;  3CIH A;  3FHQ A;  3IDA A;  2EIE A;  1CIY A;  1JU4 A;  4DEQ A;  1JZ7 A;  4RYD A;  2WN2 A;  5HXM A;  2ZXQ A;  3THC A;  2Z4F A;  3C7E A;  1R64 A;  3OGS A;  1GMM A;  3K77 A;  1UY3 A;  2XOM A;  2Y64 A;  3K75 B;  3VDA A;  2J22 A;  2VO5 A;  4A4A A;  2VM9 A;  4JKL A;  2V4V A;  2CDO A;  5IFT A;  2W9X A;  2VCA A;  3OBA A;  4OUE A;  1GU3 A;  5DMY A;  3HN3 A;  2JD9 A;  2VZV A;  2J1A A;  4A41 A;  3C7G A;  1D7P M;  4LHS A;  4CUB A;  1PX4 A;  2QQJ A;  1W9S A;  3SKV A;  5DN2 A;  2J1U A;  2E33 A;  3WNN A;  1UYZ A;  4XUQ A;  4QDS A;  1RYY A;  1US3 A;  4A45 A;  5C7G A;  4JHZ A;  1J84 A;  3FN9 A;  2W1U A;  3I97 A;  3T0D A;  4XUN A;  1P8J A;  1T2X A;  5JR2 A;  5F7U A;  3EB7 A;  2VJX A;  3LEG A;  3I3B A;  2QQO A;  2W95 A;  2XHN A;  1W9T A;  5EJ1 B;  1JI6 A;  1W0N A;  2J7M A;  4KMQ A;  1US2 A;  1ULO A;  2Y6G A;  1NUK A;  3MBW A;  2ID4 A;  1L7Q A;  4YPJ A;  4ET7 A;  5EJZ B;  1JYW A;  2QBX A;  1PX3 A;  2QQM A;  3HPN A;  3GM8 A;  1CZS A;  1OH4 A;  3VD5 A;  4BDV B;  3HOB A;  2WBK A;  4CUA A;  3A7Q A;  4IUG A;  4OZO A;  2JDA A;  4CU7 A;  1NX9 A;  1SDD B;  3MV1 1;  4M4R A;  3BN6 A;  5C70 A;  3K4Z A;  3SEE A;  1GUI A;  5HPO A;  5JXG A;  2EIC A;  3I2I A;  3FL7 A;  4ZY9 A;  2BER A;  1JZ6 A;  1GQP A;  2YG0 A;  1WCQ A;  2RJ2 A;  2QQI A;  4TTG A;  3LQC A;  5EIY B;  1JZ8 A;  1JYN A;  4OMC A;  1O59 A;  2Y6K A;  4XUR A;  1KEX A;  1GOH A;  3WF4 A;  3CQO A;  3LPF A;  5IHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...