4QB6A

Structure of cbm35 in complex with aldouronic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
128
Chain Sequence
TGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
molecule keywords Xyn30D
total genus 29
structure length 128
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb6A00
1OF4A 4OZOA 2X09A 2W92A 1W8OA 3CKHA 4BK4A 3LE0A 3WF3A 2L9LA 1DYOA 2QQNA 2B4KA 3GDBA 3LEIA 4HG6B 3K4AA 4QB2A 2E33A 4LQRA 1O8PA 4UAPA 3CDZB 3T0AA 4QX1A 5CZKA 4XUTA 4GZ9A 3HOBA 5G04L 2JE8A 1O59A 1XC6A 1LNSA 2WBKA 3VD3A 5JMOA 2RJ2A 2VMFA 3MV11 4JKKA 4YPJA 1K3IA 3FHAA 2E31A 4JX0A 2XONA 2ZEWA 3I97A 2WAOA 1ULOA 2BZDA 5IJRA 3W5NA 4ZXEA 3VD9A 2VZRA 2ZEXA 2WO3A 1DLCA 4ARXA 5J1XA 3ZM8A 2XOMA 4PT6A 4JKLA 2QQKA 4CU7A 1MPXA 2YB7A 2Y6LA 1GMMA 2VMEA 3VDAA 2PQSA 2J1VA 3T0DA 1UY1A 2WABA 4A4AA 4A3ZA 3ACGA 3P1IA 3I2KA 3ACIA 2WN3A 4ZZ5A 1JZ7A 3NRUA 1SDDB 2JD9A 2W5FA 5FUIA 2W91A 1NAEA 5G05L 3MBWA 2YG0A 1PMJX 1I5PA 3OG2A 1O8SA 3WSOA 1UY3A 4AAXA 1T2XA 4IUGA 3IB3A 4DEVA 4OYUA 3LPGA 1K45A 4W8JA 2QBXA 3WNNA 1UMIA 4DUXA 1OD3A 2VM9A 1TVGA 2VZOA 3WF4A 4A45A 2V5DA 3WF2A 3CQOA 5JXJA 4LHSA 1CZSA 2J1EA 2ORXA 3IDAA 3NJVA 1CZTA 2YFUA 4ZZ8A 3I2GA 3THDA 3DYMA 4A42A 4OMCA 1XNAA 3T0BA 4QX2A 3VD5A 2J22A 4KMQA 3SKVA 3C7OA 2QQLA 2DCJA 5DQ0A 1UYXA 4DUWA 3LEGA 3WEZA 3OBAA 3CIHA 4KWUA 4M4RA 2VCAA 4QB1A 3GGLA 1DP0A 3LPFA 2R7EB 4MO3M 3ETPA 3NNGA 4DUVA 3BGAA 3WNPA 5LA0A 4MOAA 2YFZA 1JZ4A 5JXIA 1GU3A 4DXSA 4XUQA 4QDRA 2Y8KA 2X05A 1JZ2A 2C4XA 3VD7A 5LA1A 1OT5A 2RVAA 2VTFA 3LQCA 1L7RA 3HNBM 1H6XA 3C7HA 4CUCA 4QX0A 2LW8A 3A7QA 2WQ8A 3DYOA 3T09A 2OKXA 3I2HA 3AC0A 5JR2A 1JYVA 4P00B 2W1SA 4MADA 4JHZA 2ORZA 5B4XA 1UXXX 3K75B 3T2QA 1J84A 5IFTA 2V72A 2QQMA 2Y6GA 1KEXA 4Z2AA 2Y64A 4AG4A 3P6BA 3GXUA 1PX4A 1R64A 2W1WA 1JYWA 1JHJA 3SEEA 2J1AA 4FI9A 5DN2A 5B4NA 3A23A 3E1F1 2W47A 2VR4A 3I3DA 1OF3A 3ECQA 4CU9A 1JU3A 3ACHA 5JUVA 4TXWA 2WZ8A 3I2IA 4JKMA 5DMYA 4QX3A 2EICA 4BJ0A 2VCCA 1EUUA 3D3AA 2BGPA 2VJXA 4XVHA 2Y6HA 1K42A 2E26A 5F7UA 3GM8A 3J7HA 1UMHA 2LS6A 4E8CA 2VZVA 3EYPA 2EIDA 2J1TA 5JXHA 4ZY9A 4ARYA 5IHRA 3LEKA 1W9TA 4MGSA 5EJ1B 1EUTA 3C7FA 3MO4A 3SEPA 2B9VA 2VMDA 5IYYA 3I2FA 3PUIA 2VZQA 3FL7A 2VCBA 2C26A 5A1AA 1P8JA 4QAWA 4GWIA 4QPWA 2ZEYA 3HNYM 1CX1A 2VQUA 4XURA 2VO5A 1F4AA 1UWWA 3C7GA 4DXRA 3FHQA 4MGQA 3BN6A 3I3BA 2WDBA 3WNKA 4BDVB 3K4DA 3I2JA 2EIBA 2V4VA 1H6YA 3ABZA 2WN2A 2E32A 3PUHA 2Z4FA 3CMGA 2VC9A 2J7MA 1NKGA 2VQTA 1SG3A 4M4PA 3WNMA 2BGOA 2W1UA 1K12A 2WO1A 5IFPA 1GOGA 3T2OA 4L0PA 1GOHA 4XUOA 2J1SA 1D7PM 1UX7A 1GUIA 1GNYA 1IQDC 3MUY1 3UESA 2W9XA 2ZEZA 1JYNA 1F4HA 3HN3A 3OEBA 3THCA 3EB7A 3HEIA 3A22A 4A41A 3NQHA 2BERA 2J1RA 4GWJA 3F2ZA 5LA2A 4QDSA 3WF1A 3SKJE 3U37A 3VD4A 4D8MA 1W8NA 1BHGA 4W4ZA 3DECA 4RN5A 3T2PA 2WUHA 2RV9A 2WYSA 4CVUA 4P5YA 1JU4A 4D0QA 1UYYA 2DCKA 4CUAA 1ULPA 2WZEA 4BXSV 2VZUA 5DPNA 4P08A 4LKSA 2W94A 3OGVA 2WAAA 5I0DA 2EIEA 4RYDA 4XZUG 3OGRA 1OH4A 1RYYA 4OMDA 4XUPA 4CUBA 1HN1A 1UY2A 5C70A 3WNLA 1WCQA 2VOTA 4TTGA 3C7EA 5C7GA 1UZ0A 3IAQA 5CYYA 2CDOA 3I3EA 2XQXA 3A21A 1L7QA 2ID4A 2VZ3A 1W9WA 2VZPA 3HPNA 2VZSA 4A44A 3FN9A 3K4ZA 3K77A 2KD7A 2X10A 3JXSA 5LCWL 2ZXQA 3IAPA 2W87A 3T08A 2QQOA 1JZ8A 4XUNA 3WQBA 2C9KA 2JKXA 1US2A 1NX9A 2W46A 4QDQA 3ACFA 3CZUA 3MUZ1 3NJXA 1JZ6A 3MV01 4W50A 1TG7A 3VDCA 1W9SA 5EJZB 5HXMA 4DXTA 1CZVA 1PMHX 5C71A 1JI6A 2W95A 1W0NA 4CU6A 1UYZA 3OEAA 1UY4A 2VZTA 3C8XA 4PF1A 1W99A 4A6OA 1GQPA 4LPLA 2W3JA 2J1UA 4QB6A 2DDUA 2VMCA 2YC2A 4ET7A 1JZ3A 3OGSA 4BK5A 4KI5M 3CZJA 1XPWA 5EIYB 4DEQA 1UXZA 4P02B 2BBAA 1US3A 2HLEA 3IIIA 2VL4A 5JXGA 3WF0A 5HPOA 1KGYA 2W1QA 4CU8A 1PX3A 3WNOA 1J83A 2Y6JA 3UNPA 2CDPA 3K46A 1WKYA 3VDBA 1NUKA 1XNTA 1UY0A 3OB8A 4OUEA 2XHNA 2YC4A 2Y6KA 3W5MA 2VZ1A 4UOJA 4E8DA 1SHWB 3UETA 2QQIA 4PQQA 1JZ5A 4UI9L 2QQJA 1JYXA 2HYXA 2JDAA 1GOFA 1CIYA 1YQ2A 3HJRA 3DYPA 3HNMA 2WO2A
chains in the Genus database with same CATH superfamily
4IGOA 1WCUA 2ZMNA 4HZFA 4LBKA 4Y4RA 1Y9GA 4I2OA 1AX0A 3KZ4C 1TQ5A 5BNQA 3SITA 1V6KA 1HXS3 2WR9A 3OY8A 2PMWB 5BNOC 1HRI1 2VXRA 1XNDA 3DL3A 3DKWA 5JLVA 4JV4A 2A1XA 1W8UA 2CAUA 1WD3A 3KF3A 3QBQA 1KJRA 3USUB 3WDXA 4JDMA 4LQRA 3T0AA 2D3PA 4X6QB 4FPKA 4ZPIA 2A71A 2R1BA 2RM23 2VNOA 5A3TA 1LU1A 5IVYA 1NCQA 3WLUA 2JE8A 3K48A 1MS3A 1DGWX 4QXCA 4NHKA 3ES1A 1Y9QA 2QKDA 1QXRA 2IVIB 3NVCA 2DTWA 4I09A 4YW3A 2X5IC 4QQ2A 1PGSA 3MLJA 3I2OA 4UXAA 2F4LA 3RMYA 2FZ2A 4JKKA 2ET1A 5FJHA 1L7LA 1PGW1 4Y22B 4YPJA 3OGGA 5FZ1A 1S0JA 1N3QA 3ZXDA 3FHAA 1J3QA 2VUJA 4NE9A 4P14A 5DAXA 2XONA 1MS1A 1EAH1 2ZKLA 5A3OA 3UJQA 2BZDA 1YFYA 2VU9A 1A78A 2ZS6B 5IJRA 2JENA 3IBMA 4NHMA 1DLCA 4YW4A 5FWEA 4YWAA 3DN7A 1RUH1 2P3YA 5FY8A 2ARBA 1VBE3 4QQLA 2D5FA 2GNBA 2XOMA 1GZTA 4PT6A 1NA1A 3CO2A 2ETEA 4Y5Z0 1QOOA 2RDNA 4YG3A 3VKOA 1PVC1 2ZX0A 1CR7A 1I3HA 3KCCA 4KNCA 1Q8QA 2VMEA 2Y38A 3C2UA 2YMZA 5FZ0A 5A7WA 5JIUA 1ULDA 4WM8A 5DZEA 3E6BA 3IMMA 4R9CA 1MACA 1S2EA 3WXPA 1DGLA 1NE6A 2EXIA 4FQ4A 4MZUA 4URAA 3ZPYA 2HBUA 4CCNA 4UFLA 1QGLA 2EXJA 3ACIA 1ZBE2 2SLIA 2WO7A 3E5XA 3ZN6B 4RHV2 2D7FA 2YU2A 4XFCA 4MG2A 2YG0A 5K0UA 4AYUA 1I5PA 2LROA 1QY4A 3PUSA 2F17A 4WZFA 1YQ6A 3WSOA 1UY3A 5F5AA 1UU5A 2C9AA 1IPJA 4KBBA 1JUIA 2VE1A 1WLTA 3J26N 5F3IA 4IEOA 4W6YA 1E5IA 5A7QA 4CDQA 1S0DA 2PHXA 4DEVA 1RUC3 4OYUA 3LPGA 3WV6A 4EYUA 3TOJA 4H14A 3PLQA 1C8M1 1QEXA 3VL9A 4QPGB 4QPIA 2CV6A 1WW5A 4NRQA 4YM2A 4A45A 4CDWB 5A70A 4HPKA 3WF2A 5FMDA 1M06G 2HEVF 3MIGA 2WZR3 3B9IA 3B93A 3H1YA 3OTFA 2HWB2 2ORXA 5FZGA 2A73B 1LHUA 2YFUA 5JSPA 4QX7A 4AFAA 3OBTA 1PIV2 3VLBB 4OFGA 5EJ3A 4IV1A 5C3SA 1MQTC 1G8WA 4KU8A 3FLTA 1G86A 2VTXJ 4QX2A 3WHTA 1PM7A 2BP6A 1V9U1 3MPBA 1UCXA 2ZBJA 4KMQA 3LF7A 3KD4A 3QD6A 3SKVA 1UF2C 5J98B 3VGIA 4Q0QA 1QJU1 1H9WA 2QQLA 5A7NA 4N53B 2AGSA 5DDJ2 2BTVC 5LRSA 5CFDA 1BBT3 1ASJ3 1OKQA 4M4RA 2JD4A 1QXJA 2VCAA 4EN8B 1DG6A 1ZM1A 4QHBA 3KHCA 4XABA 1NQDA 2HJIA 2XH6A 3AYAA 1N1VA 3KVBA 3S5AA 2JB4A 3P5BA 2QDRA 4XMIA 4LE4A 2JG8A 1GSLA 1D4M2 2DCTA 3VBOB 2BWAA 2G9ZA 4EZ4A 3HMYA 1YCIA 3J7LA 3KSCA 3TBDA 4HN0A 1RHI2 4XQ4A 1TME2 5JXIA 3AXDA 2X8KA 4Z8BA 4HPKB 4XUQA 3OJBA 4NO4A 3WW2A 2E7AA 3A0NA 3KCYA 1W6OB 1QJZA 4ZU7A 1N1SA 4I0BA 1OT5A 1EV12 4LBNA 4Y1VA 3N7LA 1RUF2 4RS5A 1BCXA 5T5LA 3LQCA 1AYM2 4CXXA 1S0CA 3AVRA 5FV3A 1N1TA 1IOAA 4XW3A 3SH3A 3NSTA 4DY3A 3SC7X 3T09A 1O4YA 2IXHA 5FO9B 4B4RA 5HBAA 3FUQA 2JIJA 1F5JA 2OKXA 3I2HA 2DVBA 1C1FA 3AC0A 4ASMB 3V0AB 5GLZA 5FPZA 1XSQA 4JHZA 1AR82 4NMIA 1W6MA 5JI9A 1COV1 3PVEA 2UY8A 5B4XA 3CEWA 1COV2 2VULA 3MEPA 3FBMA 1RUJ2 3AMPA 4YGCA 5BY5A 2RMU2 1V6LA 4Q26A 3T2TA 2D6OX 2XR4A 2ZZQA 5CEHA 4HN1A 5IK8A 2Y6GA 3NKTA 3UT0A 3NAPA 3K2OA 2GDFA 3JCIA 3FJSA 3P6BA 4ONUA 4PBOA 1R64A 3ZR5A 1JYWA 4XQDA 3ZYRA 1QHDA 4EN0A 3GZEA 2RJLA 1EPZA 1H0BA 1UOFA 2YBSA 4DZGA 3Q9OA 3RZHA 1PVC2 2I2SA 2PAMA 2VR4A 5L36A 1RUD1 2XUMA 1VAKA 4XJUA 1HX6A 1JU3A 5A6QA 5JUVA 5A3WA 3BPZA 3I2IA 4JKMA 1LEDA 1VP6A 1PZ7A 1RL3A 3URFA 2BEOA 4D7YA 5L7OB 3O1TA 1LB2A 4DQAA 4QX3A 1DQ0A 1H2NA 1LHVA 4WM7A 4BJ0A 2ERFA 2XGXA 3O1PA 1O3QA 1AZDA 4AHXA 1RGSA 2VJXA 1AHSA 1AVBA 4K7JA 1W6NB 1Z7S3 3POSA 3ZSMA 4FOQA 2BVVA 4CDQC 3LFIA 2JDYA 3DPRB 4MLOA 4IDZA 3BALA 2GN7A 1QDOA 2LS6A 4YW1A 4NAOA 5FP7A 3DEMA 2Q5TA 1AXKA 1MZFA 1SLCA 5JXHA 2ZAAA 4WM7C 4LITA 3ME2A 1NOVA 5LA9A 3ZPOA 1JXNA 3JUUA 5AC92 3BTAA 1BMV1 3C7FA 3VBHB 3H1MA 3U4XA 4JQRA 1UZYA 5GZEA 2Q1FA 5IUQA 4LBJA 1N3PA 3WOGA 2BGCA 1F15A 2ZGSA 1BQPA 4RR3A 1DQ4A 5A1AA 1S55A 3LAGA 3I3QA 4QAWA 1BK0A 1YJLA 1CX4A 4C90A 2WT2A 1VB2A 2VOWA 1UZWA 3LFMA 3DV8A 1SCSA 3RSJA 5C9AC 2O14A 3MYXA 1R082 4UFMA 5DG2A 3MIBA 4D6RA 2VO5A 2JJ6A 2V4AA 3C7GA 4QPIB 4I30A 4IETA 5FYIA 5LK5A 5C8CA 4XTPA 4Z92B 5DXDA 4OI0A 4EWAA 4MYEA 1DBNA 4LMFA 1R1A3 1PO12 2JXAA 2IXJA 2JG9C 4ZS2A 3WNKA 1V70A 3K4DA 1OFNA 3I2JA 4RQPC 5JZGA 1POV3 1RVF2 2V4VA 1H6YA 4U2AA 5EQUA 1OKOA 5C3OA 2BBVA 3ILRA 5FZOB 3PL0A 4Y20A 2XL9A 5DAQA 5L9RA 5FMCA 2FMDA 2VC9A 4Z82A 1NY71 5FJKA 1WD4A 3U0ZA 4YVSA 4CCDA 4BQXA 1RUD2 4M4PA 5HCBA 4IW3A 3WNMA 3UGGA 5BNPB 5IVCA 2W1UA 1GNZA 5GZGA 4G9SB 1XYNA 2VCMA 1OURA 3NW4A 2YZ4A 2J1SA 2ZHLA 1UX7A 1GNYA 5JVVA 1ODNA 2PAEA 1FNYA 2ZEZA 2DF7A 3MIFA 1UNBA 1F4HA 1Q8OA 3HN3A 5L7OC 4FFIA 4LIVA 4P9XA 3HEIA 5JR7B 2UY9A 2JIGA 2HWE3 3NQHA 5IVFA 3VKNA 5D21A 4K8RB 4HVOA 1YFWA 5LA2A 1A3KA 3U14A 4D8MA 1AR81 1UAIA 1W8NA 2H0BA 5DUUA 4EV0A 3POWA 4XBNA 1D2QA 2WL1A 3DECA 4S2DA 1C8NA 1HXS1 1XRUA 1ZA4A 2RV9A 2XVKA 5FZEA 2WYSA 4ASLA 5HV4A 5L7OA 4FPHA 2WC2A 1WCDJ 1LODA 2WNVC 4PIXA 3VL8A 1ULPA 2NLRA 5C4WC 1W8TA 1RUF1 2VZUA 5DPNA 5J3UA 4E4DX 2UWAA 3OGVA 1H9PA 2EIEA 4YVWA 2K0GA 3RS6A 1ULCA 3HVDA 4XUPA 1APNA 1HN1A 5A3MA 4O9GA 4MSVA 4GB33 4GJYA 2MEV3 1D4M1 1W2UA 5HCFA 4PHZA 4YSFA 1LESA 1AX2A 4NIDA 1UZ0A 2NYYA 3IAQA 3ZFFB 3BI3A 2CDOA 4GAZA 4OUSA 3S7EA 5A3NA 4F3JA 4E2QA 5FCCA 4MGKE 1AF9A 4FXKB 1O91A 4P9IA 3J8F2 1H2LA 2C0ZA 1GFF2 4BXFA 3HR9A 1W6MB 2WQZC 4ZS3A 3WP4A 4PBPA 2XXZA 1CAXA 2PQQA 1ENSA 1Q5OA 1Q8SA 1H1AA 3K77A 1W2TA 5FZOA 5LK7B 4L2NA 4XFBA 1VBE2 2ZGNA 1HRV2 4XACA 3KGZA 2W87A 1W9YA 4XJ8A 1ZZ7A 4QXHA 2ET7A 3VBOC 4AQTA 4ATEA 4BMEA 1YQ5A 2ZGMA 1L3JA 2C9KA 1F2NA 4XXAA 2W46A 3B7MA 1VMHA 3CZUA 2GP3A 4QD2A 2D5HA 3MUZ1 2ZCWA 4HFSA 2ZACA 5FK7A 3B01A 2JB8A 3N9NA 4W50A 1Q8PA 1TG7A 1X8EA 4OI2A 2OXBA 5FLJA 1DU3D 4IEWA 3VDCA 4AEDA 2OA2A 4N53C 2OW4A 2I74A 5HXMA 3RZGA 4DXTA 1CZVA 1SLLA 2A6ZA 4CE8A 1GZ9A 1GV9A 3TRSB 4CDUB 2CYFA 1XU1A 3UK9A 3WX5A 5FIXA 3QCWA 4IGQA 4BE3A 4LO8A 3P3NA 1UY4A 3C8XA 5FLHA 4E4ZA 1SFPA 4UYBA 3N9MA 4A6OA 5K4LA 5CFDB 4LPLA 1FV2A 4QB6A 4EE2A 1RUC2 4GALA 2Q8DA 1QWRA 2SBAA 4AL9A 3AP4A 3M4FA 5EWSA 2JDKA 1MVQA 4EROA 5BUVA 4XYXA 2GNDA 4AQ2A 2X29A 3AZWA 2P5BA 1VAMA 4QPGC 3D5OA 3BB6A 3IPVB 1BEV3 4BPZA 4N9IA 1V6JA 5L19A 5HCAA 3KT7A 1UXZA 1MS8A 2E63A 4OHVA 2BBAA 4P02B 1PO23 4PIYA 5FXWA 4AI2A 5F5QA 1PIV3 3IIIA 2QUOA 1FYUA 1XE0A 5JXGA 1LOCA 4BB3A 3AKSA 3JB8A 3H7YA 5EZWA 1PIV1 5C3PA 1XNKA 2KA3A 5FYVA 3RPQA 1OFSA 3KLSA 3TEXA 2VOXA 1OXCA 1PX3A 1J83A 5KC5A 3UNPA 2EALA 4PLNA 3K51A 4EN7B 4D94A 4IEYA 3VDBA 5DZFA 1OLRA 3KV4A 1UY0A 3OB8A 4IL7A 1WW4A 2GZWA 2YC4A 4N43C 4C1WA 4QHZA 4Q4X2 3CHXA 3W5MA 4PLMA 5FAXA 1C8M2 1ZX5A 2GU9A 1WW7A 1W03A 3WY6A 1FPN1 1W2AX 3SXWA 2R30A 2VPVA 2CWMA 2OIIA 2OS2A 4Q4W3 3ZR6A 2R32A 2R1DA 3LCPA 1VBB1 1YEWA 1QJX2 3N9LA 1QJFA 1G9AA 5EJ1B 2PA7A 3WNXA 3H50A 3S57A 1KDKA 1O7FA 2X09A 4GIQA 3ETQA 1X33A 4XILA 3CKHA 3LE0A 4COUA 1RMU3 1DYOA 3OUHA 4R8HA 3N7JA 4A6SA 1CAWA 2B4KA 3GDBA 3LEIA 3RVHA 1XSRA 3T4HB 4QKNA 4OI4A 2FBEA 2YBPA 4YRDA 4OI1A 4BA6A 2QZ3A 4L97A 1QJEA 3KCXA 2HBTA 1FNZA 2WFPA 4PDWC 4QB2A 1B35A 1EY2A 3LDBA 4P9JA 3CDZB 1LENA 2ES3A 5CZKA 3VKFC 1E5RA 2W0XA 4Q0SA 1HRI2 3THPA 4GZ9A 3SH4A 2X5IB 4V2WA 1ZRCA 1ONAA 2E9QA 1PMIA 3L2YA 4LHLA 5A32B 4DINB 4XPVA 2VW1A 1O59A 5GZFA 2ZGPA 3S5QA 3KT1A 2RS12 3E6DA 3ZYHA 3ALQA 1FT9A 2FD8A 3HD8B 5JMOA 5FKCA 4MHUA 1NLQA 3POBA 5GKAC 1GKBA 2VMFA 4JGZB 3KWVA 3HQXA 1JOPA 2BOJA 3IWZA 5FY0A 1EAH2 1UL9A 3E5UA 3O0VA 2JKBA 2YV8A 1A8DA 1YIPA 1VLNA 4UF0A 5E88A 1S0EA 1AR71 2JG8B 2WNEA 4QT6A 2ZEWA 2LALA 2P6CA 3I97A 2WAOA 5CBLA 3O1VA 4NIHA 5BNOB 5CU1A 1SLBA 1VB4A 2R041 2AREA 2VZRA 2R062 2HWF2 4LULA 4OQ8A 2DBIA 4Q4Y2 1PVC3 5KXDA 1VALA 4JKLA 2QQKA 1R091 2G9GA 2WZPP 4AI1A 1OLQA 2IFRA 3SH5A 4CU7A 2B42B 4HVQA 2AZ5A 3USUA 1UIKA 2OPWA 1BLZA 2PQSA 4OHYA 3T0DA 1WA6X 3LDKA 2CAVA 2FCVA 3R05A 1UY1A 1CPMA 4Q1RA 5A7PA 4CA9A 1G9CA 3LIHA 3LWCA 3I2KA 4AWDA 4I0AA 2WN3A 1IHMA 1CN1A 3W58A 4PLOA 1CIWA 4DB5A 3BTZA 1HDKA 3NRUA 5KC6A 5FUIA 1H8TC 3AMNA 3PU8A 1YI9A 5LBFA 4FOVA 4LO5B 4ASKA 1OQDA 1UW8A 1ZZCA 2RJKA 2Y6FA 2YY1A 4YYOA 1I6XA 3OG2A 1K5MC 4Q4V2 2TEPA 5TSWA 2P4EA 4DFSA 3HN1A 1PGL2 1ND2B 4AAXA 5T3NA 4IUGA 3VHRA 4KH9A 4QU2A 3IB3A 1UQXA 3VBUC 2DVGA 4QM8A 4S2HA 2DVDA 4BIOA 3GBFA 4PIZA 4SBVA 2F6BA 2ZHKA 4F7ZA 4KQ7A 5FPLA 3O1UA 3GHNA 4YZ1A 2RDRA 4PJYA 2VZOA 3WF4A 2R072 1S4CA 2V5DA 4MH0E 4AHYA 2W68A 4WVMB 3PIJA 4Z07A 1SLTA 2JDMA 4LO7A 3O1OA 3Q8AA 4RGAA 5DAWA 5FZKA 4UF0B 3WDTA 1QQP2 1JS9A 3DYMA 1XNAA 3I59B 4TN7A 2IUWA 4G4FA 4BCUA 4GKXA 1OA4A 1KD7A 3D82A 4P9LA 1ZZ6A 3Q8CA 4XFHA 1DGWA 3EMRA 3TYJA 5IATA 1UN1A 2VG9A 3C7OA 1PHMA 1PK6C 3ZXJA 3J7MA 2Z5WA 1MZEA 4DUWA 3JBG3 1XB9A 2A6WA 3WEZA 1AR93 1KS5A 1YFUA 2ZHMA 3CIHA 4KWUA 2OQ6A 3KVAA 4CEYC 3S7IA 3ROUA 1DP0A 4YM3A 3FFZA 4LBLA 1RB8G 2R7EB 4MO3M 1FPN2 5T50A 1U5XA 3HT1A 1XE7A 3RI9A 2NN8A 4DUVA 2VUAA 3BGAA 5KXEA 1NA1C 1Q8VA 1W90A 3WNPA 2PHDA 4MOAA 3RYRA 1QJY1 3B3QE 5E16A 1OC1A 2JE9A 1QH6A 3BCWA 1ZRDA 4AW7A 2UWCA 1GU3A 4BQ5A 4DXSA 1N47A 3T1MA 1LR5A 2FQPA 4QDRA 4QXKA 4FPCA 4X6RB 2X05A 1JZ2A 3V64A 2C4XA 3VD7A 2VTFA 2RVAA 4CP1A 2A5ZA 2DVFA 4B3NA 1X8MA 3FUOA 1Z7S2 3AKTA 3APBA 1MS5A 3C7HA 1WGPA 2MNGA 3HNBM 4MGYE 4UW3A 1C3HA 1WCSA 2E7QA 2D6PA 1QJU3 1QOTA 1X50A 3POJA 3W9AA 3A7QA 3CJIB 3NAPB 4XF1A 1J1TA 2WLQA 4FPEA 3MDPA 2XJTA 1CAWB 3AL5A 1B35C 1AX1A 4FPOB 5FUNA 3FWEA 2ORZA 1ZBA3 4IEVA 4DXZA 3U10A 2D40A 3K75B 3T2QA 3BPSA 1JOBA 3RWKX 1BYHA 3U11A 5FRAA 1BEV2 4YM0A 5DDJ1 2ARCA 2V72A 3H3ZA 1F9KA 3H8UA 4KWJA 1E5HA 2QQMA 5DDJ3 1XYOA 3I8TA 4OZXA 2KM2A 3IDEA 5FKBA 1HQNA 1JHJA 3ZYBA 4CZSA 5FREA 4XFAA 2FHRA 4FAGA 3RYPA 3A23A 3MI8A 4GB32 5IVJA 2GMEA 3RFRA 3W20A 5FZAA 4YM1A 5FPBA 1D4M3 4IEPA 3ECQA 4CU9A 1YNAA 3JZVA 1H30A 4XDPA 3ZKYA 2DFCA 5F3GA 4AVAA 4NIAA 3ILFA 3VZMA 5BNNA 3FX3A 3ZN5A 5DMYA 1QIQA 4LT5A 5LZ6A 1QJY2 5KXCA 2AH2A 5GLWA 2VCCA 3QLQA 1K5MA 1XOYA 2VBPA 2W52A 1JMUB 2BV4A 5IVBA 2X53S 5KBFA 1STMA 4QKDA 4WVMA 1Y7BA 1K42A 5LBBA 4QHOA 5F7UA 1CPNA 1AL21 3AP7A 5IK4A 5CNAA 4R4ZA 4GKYA 2BUKA 1ZREA 3TNQA 4XCBA 1YI7A 3OGJA 1UMHA 4C8DA 2KXLA 4AFDA 5E1RA 2CGOA 5I93A 4GH4C 4NR1A 2ZABA 3IT8A 1YHFA 1LOBA 2XBO3 4W65A 2VQAA 5F2WA 3T4VA 2OUHA 3KS7A 1O5LA 2FMYA 3LEKA 4RFRB 3ZFGC 3WT3A 5BPXA 3IZOA 2N7GA 3WD5A 4RD7A 2W39A 3H1WA 3LOBA 1EUTA 1UIJA 4Q2FA 2EXKA 3SEPA 3OUJA 1POV1 3SHRA 2B9VA 2VMDA 2RMU3 3ZYPA 1W6NA 3MLLA 3Q8FA 3Q8EA 3KQ4B 2C26A 1P8JA 2GH2A 2WS91 5BNNB 3JB4C 4GWIA 3O1MA 4MGTA 2WWSA 2ZEYA 1D2SA 4AI9A 4CYDA 1LOEA 4XHBA 2VGDA 2XJSA 4JRAA 5L9BA 1UWWA 5EFUA 1SBDA 1HQLA 1RUI2 5T52A 3AZYA 3AZVA 2QFEA 4JGYC 1PVXA 5F9TA 1DZQA 4YW7A 5IVEA 1KFUL 2HWD2 4K1ZA 1UPIA 1ND3B 2K9ZA 5SV5A 4A7YA 4HOOA 1CAXB 3BIEA 1BBT1 2E32A 2QE3A 3MIEA 3WZ1A 1SEFA 5A3LA 2BQPA 2CHHA 3BIWE 5A7OA 3O12A 2C24A 5LBCA 3ZN6A 4J1XA 1HV1A 1O3RA 3L9JT 5CVRA 4CDXB 2ZMKA 4AVTA 3NV4A 5F3CA 1PZ8A 1SLAA 1CONA 4XFIA 2HEWF 2QQWA 2D6KA 3PVNA 4FOWA 4FBFA 1PNGA 3GNEA 5EXOA 3HQRA 4JGZA 5ERLA 4Y5SA 1R1A2 4IEQA 1GOGA 2IXCA 1SZBA 4AVVA 3CJIA 2GH8A 1GOHA 5D8AA 5ABJC 1OA3A 1GUIA 5ANQA 1IQDC 1XXNA 3GALA 4XZPA 5FBZA 2ARAA 4CP0A 1JYNA 1QNWA 4COZA 5IAXA 2IXKA 1W8ZA 1BEV1 3EB7A 4I3PA 1AYM3 1UKRA 1V0AA 3A22A 3ZFEA 3PJQA 5CFCC 4A41A 4PCRA 1VRBA 2WQ4A 1DYPA 4H7MA 3AB0A 2Q4SA 1W3XA 3SCHA 1GBGA 3WF1A 3D0JA 3SKJE 4BQ1A 3WDUA 2P3KA 2HYKA 1OHFA 4O61A 2WSVA 3O0WA 4RN5A 1NCRB 2WUHA 3T2PA 1RUOA 3RNSA 1S0FA 2GAUA 4CVUA 4P5YA 1JU4A 1F35A 2JDHA 2XUEA 1W04A 2YHJA 2IXIA 1OA2A 4L92A 3VDDB 2D43A 4YVSB 2R073 3N4MA 5ISLA 3AFKA 3VBSC 5IK7A 4BXSV 1JODA 1G6NA 1M4WA 1I5ZA 3K3OA 4CCEA 4YFZA 5L9VA 4CEWA 1UPSA 4RFT0 1DQ2A 1G7YA 4H3WA 2WAAA 5FMOL 3OGRA 4OMDA 1NLRA 1SACA 3OF1A 4B7EA 3RGBA 4CXWA 5JZGB 1VMJA 4GB31 4L99A 4YW5A 1QXPA 1OH3A 1UY2A 1FOD3 3I59A 1ND2A 3IM0A 1WCQA 3PUAA 3JD71 1RUD3 2WT0A 3R4UA 1OPOA 1WBFA 3C7EA 2DTYA 5C7GA 5C8CB 2ZGUA 2EIGA 1TEIA 1VMFA 4LJHA 1QU0A 3LSDA 3B69A 1L7QA 2B8MA 4RQPA 2ID4A 2RR12 1QJX1 1W9WA 1XNBA 2A6VA 2TUNA 2VZ3A 5F37A 3BU0A 1REDA 1PO22 1YC61 2HWF3 2Z69A 2Y26A 3AX4A 4RR3B 4IE5A 5EYXA 1IKQA 4NRMA 1W0OA 2PYTA 3LDRA 2KD7A 1E5SA 1JYIA 5LCWL 2ZXQA 2YROA 2YYOA 1IZ3A 5FYHA 4AFMA 1GP5A 3U4SA 1MQTA 4BZ4A 4Q4X1 3VB9A 4JCKA 4XUNA 5A6YA 3FZ3A 2Q8EA 1VBC2 2XPJA 2JKXA 5J48A 4FP2A 1BK1A 5JSOA 3J8F3 1SLIA 3NJXA 3EHKA 5FOJB 4IE7A 1GP6A 1GZCA 2GMPA 2YGLA 5ACA3 4IV3B 5AFEA 4Y1XA 1UMZA 4DPNA 3WQ7A 5FXZA 1IS6A 1QH7A 1UZVA 2VMGA 5C71A 5BV6A 4BM8A 2R16A 3ON7A 1FMD2 2W95A 2ZGQA 3VBUA 1DZRA 2GALA 3MF6A 4CEYA 4IE4A 2W2IA 3ZSLA 2C5DA 2VVDA 4PF1A 2JICA 1R1ZA 3ZYIB 4MVTA 2AEZA 3WP3A 1CQ9A 4OHXA 3R4DB 1G9FA 1GQPA 4YW6A 4UWDA 2W3JA 3IIAA 4MGZE 3ZXAC 5FO7B 1XNCA 4BQ4A 3LA3A 3PMSA 4AGVA 4KBZA 2ZGRA 1J58A 4ET7A 5HXVA 2X5IA 1JZ3A 3POYA 2WNUC 4M3CA 4QKFA 3FHIB 3JD72 4FP3A 4BK5A 1PO13 2GNMA 4KGGA 3OCPA 2VMIA 1XPWA 4L11A 2Q30A 2PELA 4MXVA 2WZR1 2A3WA 4MHRA 2V5YA 2YBKA 4Q4W2 1C5IA 2JDUA 1OVPA 3KF5A 5FR3A 2HWC1 1OD5A 4AXOA 4Y22A 3UKVA 4D6SA 3M7AA 5JPNB 2WA4A 3EBRA 2RS52 1F5FA 5T54A 2W1QA 1V9U3 3WNOA 2Q0AA 2VBDA 4AFBA 3M3OA 4R9BA 4YVWC 2D6MA 3K46A 3ZFEC 4GULA 4DO0A 1NY72 3PIGA 5FFOC 3BVCA 2P6HA 2Q1MA 1W0PA 2R071 2P1BA 2R042 1W3VA 3MW4A 1AR92 4XETA 2IFWA 5F6KA 5FUPA 3ZSKA 5LY1A 3V0AA 4UOJA 4E8DA 1CAUB 1SHWB 4ES9A 4FXGB 3MIDA 3POIA 4M0HA 5A3PA 1HJGA 3UETA 2QQIA 4PQQA 5FY7A 4UI9L 2R063 3H3UA 5K0UC 3AZXA 5D8AC 2VOKA 2JDAA 3ZXEA 3WUDA 4IEZA 3ZDSA 1LTEA 3CF6E 2D44A 1JHNA 4E4HA 3KM5A 4IEUA 2OUJA 5FMBA 5DUWA 4XF9A 3J8F1 4RS5B 4YLZA 1XE8A 1OF4A 4AOCA 1R081 2Z2SB 2BW8A 3B94A 1TNRA 5LWBA 2A70A 3AVSA 1BJQA 1W8OA 4XDQA 4M3CF 4UW4A 1AYN1 1DZTA 1W2NA 4WM8C 5C6CA 3I3MA 3MFCA 2ZMLA 5FZ6A 1SPPA 3LZZA 4HG6B 3K4AA 1EAH3 4LTAA 1HB1A 1HW5A 4FTSA 4Y24A 4GWMA 2E33A 2WWJA 1O8PA 3ZIWA 3FLPA 1YIFA 2EXHA 4LORA 1S2KA 5GLVA 3MLKA 2GSYA 5LASA 3ORJA 3HOBA 4NAMA 5FZHA 3VBRC 3VZLA 1BZWA 1UX6A 2CSGA 1O6UA 1LNSA 1XC6A 2WBKA 4M0NA 4QGNA 4RGGA 1HB3A 3VD3A 2Y0OA 2HWD1 1U12A 4AI0A 2ENRA 1SMVA 1OVSA 1XBFA 2RJ2A 3SQOA 2XLFA 5IT6A 4XF4A 3VKMA 2YC0A 4AEJA 2PHFA 4XQWA 3UYJA 4EN6B 3RZJA 5FPVA 1WCKA 4JX0A 4LR4A 2BNMA 2WNOA 3TWIA 3RZKA 5C5UA 4AEDB 1KQRA 3NMBA 1ULOA 1RUI1 4ISRA 4Y20B 4XAAA 3V65A 3VD9A 5CKNA 5F8PA 4ARXA 1RJ8A 5KHHA 1ULFA 3HBZA 2XHKA 2RS13 4YZ3A 3ATGA 1MPXA 3D6EA 3WG2A 3M3CA 4H7LA 3I54A 3WDYA 4BU2A 2WS92 2Y6LA 4R9DA 3BYWA 2OYZA 2EAAA 2J1VA 5JIAA 4BHPA 1J3RA 3ZSJA 4BOWA 2WABA 3CL1A 4C0BA 2I07B 4FFFA 1C57A 3IKWA 4GD4A 2ARXA 2D3RA 4A4AA 1OOPB 2VQ0A 4A3ZA 5HI0A 1LOFA 3VBFC 1RUH2 5FLIA 1GWMA 2CTVA 3P1IA 5JOYA 3H8RA 1VE0A 4LBQA 3VBRB 4ZZ5A 2P34A 3PDQA 3OSDA 4CDWA 1W6QB 3RZMA 2W5FA 3HT2A 3NJZA 5FQ0B 1AL22 1IPSA 2DWRA 3NV2A 2JDZA 1ENRA 4UW6A 5G05L 3VZKA 3MBWA 1B09A 3BKZA 4AQSA 5L73A 4NUBA 5DABA 5C5TA 2YU1A 2XDVA 1O8SA 1VBB2 1MS0A 1PGW2 2FDKA 2XKPA 4JTNA 1F8VA 4WM8B 3ES4A 1T2XA 2VW2A 1KRIA 1OUXA 4LUKA 4W8JA 1MS9A 2A3YA 1NXMA 5A7SA 3WDVA 5AFBA 3AJZA 1TZOA 5ABJA 1TVGA 2LTNA 2BNNA 3JBG2 2XLAA 4RS5C 3DGTA 4D7TA 1NCQC 2XJRA 3SCFA 4PQ9A 2LUWA 3CQOA 3ZSEA 2XG3A 3G7DA 5JXJA 4N7IA 1TMF3 4LHSA 2J1EA 2ATFA 2G4IA 1LRHA 3ZYFA 3VHNA 4ZZ8A 4COVA 3AP9A 4Q4V3 3I2GA 4LIUA 5FBJA 3THDA 5JPMB 4A42A 4OMCA 3FE5A 1ZZBA 4KG8A 3VD5A 3R0RA 2DFBA 5GALA 3H7JA 1DLLA 4GWNA 5FYYA 2E6VA 1Z0HA 2IC1A 4UBHA 3V0BA 1REEA 3ZFEB 2DCJA 4YVWB 1BVP1 5HV0A 1HV0A 2BOIA 1MS4A 3BU7A 4LE3A 1LHNA 1RTVA 5I0TA 4Q4X3 3OBAA 4M00A 1V6MA 1AXYA 3PU3A 4RSUA 1GYKA 1HB4A 1T6BX 2WINB 3R6SA 3PJYA 1GP4A 1QOSA 1HKDA 4H55A 4MX3A 4QB1A 5LATA 1RUC1 3GGLA 4FOYA 1MEC2 1QJU2 4CEWC 1UYPA 4XFFA 2UYBA 2XJPA 3LB9A 5LA0A 4XC9A 1HRV3 1AR73 1QJX3 1JW6A 1Z7S1 2WNUB 2R0FA 4GQ7A 4J25A 2W08A 1JZ4A 3ZMNA 3ITQA 1JUHA 1ZBA2 4BQ3A 4JC1A 2RS33 3D4KA 2Y8KA 2XLGA 4IESA 4AHWA 2Y60A 5LA1A 3VN4A 1ND3A 1L7RA 3CNAA 4I01A 1H6XA 1T6GC 4LKFA 1H4HA 1XQNA 1RJ7A 2B7YA 4JVAA 2VNRA 3DYOA 1YJKA 4LNVA 4XJ9A 5FTTC 3TN93 4XHXA 4FPFA 4FQZA 4IV1C 5GZDA 4XTMA 5JR2A 1JYVA 1C1LA 3GJAA 4FPLA 4AF9A 2W1SA 4IV3C 1HRV1 1NZIA 4MADA 1RUE3 1CJDA 1PM4A 1QQP3 5CA6A 1W6QA 5C3RA 5FMOS 2ZX4A 1UXXX 1BXHA 5I91A 1YRZA 1H8VA 3P3PA 1LCLA 5JSRA 3T1LA 2PFWA 1VIWB 3N7MA 2AACA 4NROA 4ZONA 1YQCA 1J84A 1ENQA 5IFTA 1OLME 4ORFA 4UFKA 1FATA 4NPMA 4XXPA 3WG4A 2GC3A 4UFHA 1GANA 4QPGA 5H9QA 4B29A 4QMAA 5FO8B 4ZHNA 4FPYA 2Y64A 1CAVA 2D6NA 4MUVA 4YW2A 3GXUA 4E2GA 1PX4A 2W1WA 5T55A 1LHWA 2GC1A 3EQEA 1URXA 3VBHA 1AYM1 4Y4YA 4Y33A 5F5CA 5JAXA 1FOD2 2Y33A 2BFUS 4XF3A 1D4VB 1KDMA 2ZGLA 4P9GA 1VRH3 1O4TA 4DIQA 1OF3A 4E27A 4TWTA 1ZBA1 3ACHA 3M8LA 3UGFA 2PHWA 1HN0A 4QGLA 4LBMA 3DF0A 2WZ8A 3GCWA 4R4XA 1PK6A 5C8CC 4AVSA 3NWKA 1UKGA 3GYDA 3RDIA 5F39A 2EICA 3PHMA 2A6XA 3VDDA 1PGL1 3ST7A 1RVF1 2BGPA 2AEYA 4QQHA 2I45A 2WNUA 3NV3A 5FP9A 3NKGA 2Y6HA 2EAKA 3WDWA 2WT1A 4EWEA 1KJLA 2QNKA 5JWPA 4OHWA 1WBLA 3GM8A 4LLOA 4EN9B 3N9QA 3VBSB 2VZVA 4YVSC 2J1TA 1LOAA 5GM0A 5FZFA 1ASJ1 1DGRN 2P3JA 5H9SA 3VDDC 3GBWA 3S6PA 1RXGA 5IHRA 3CLPA 1W9TA 3GJBA 4MGSA 4CTEA 1NCRC 2OVUA 3OD0A 1LULA 3B5LB 4B1LA 1R1A1 1ULGA 4LHNA 3WW3A 5K7PA 3V0BB 3MO4A 2PHRA 4CXYA 3AKQA 3GZUC 5GZCA 2Y34A 2QQUA 2ZTNA 1UOJA 5DG1A 5I0RA 3MGUA 5IYYA 1FAYA 3TEZA 1R092 2FDJA 2VECA 1ALYA 2HWD3 3AKPA 5APAA 2VCBA 5I8SA 1QDCA 1ZA7A 4Q4Y1 4KGQA 4AQ6A 1BMV2 3IDCB 5H9RA 2HWF1 4BLJA 5FZ4A 1AYN2 1HRI3 2Z79A 2HH9A 4B1MA 4QPWA 4HKWA 1TNFA 5FYTA 3HNYM 4CDXA 3AMMA 4KU7A 4LO6B 1CX1A 3DXTA 2NPIA 5J7MA 5ABJB 1F4AA 2XBO1 4LA3A 3MHZA 3RG0A 1H4GA 4DXRA 5A7WB 3RMXA 3FHQA 4MGQA 4ZXKA 4OHZA 3ZXFA 4BQWA 4AVBA 3UV9A 4D6QA 2P37A 1HB2A 1OBNA 3BN6A 3I3BA 4RA0A 2XJQA 2WDBA 1ZRFA 4O9EA 3MIHA 1ZRIA 2H0VA 3SMHA 4BMBA 2BYVE 2NMNA 3QH6A 4RHV1 1Q56A 4CDXC 4Q8KA 1EP0A 2VBBA 4ISQA 1W06A 4MV2A 2HEYF 3I2DA 5FPAA 5KHKA 2VNVA 5FQ0A 1NKGA 2RS53 1SBFA 2VQTA 1ND3C 1BKZA 1SDWA 2BPA2 3B02A 2RS51 5FYBA 2J42A 4WZCA 1S0GA 2OZ6A 5I8YA 5IVVA 1RUI3 2GN3A 1YLLA 4JGYB 1K12A 2WO1A 2K2SA 2R043 2VTXA 5IFPA 2ZZJA 3AL6A 4L0PA 4D69A 2V09A 2BVBA 1RUH3 1VPHA 2CGNA 3N9OA 4XOGA 3DKQA 4E4SA 1CWPA 1DIWA 3WG1A 2O8QA 3IPVA 5E89A 3UESA 3ACLA 1UU4A 1QNYA 2W9XA 5FYUA 3MICA 4LK6A 2ZA9A 2LM3A 3OEBA 4RHV3 3THCA 2IZWA 1GICA 1SFYA 1W6OA 4I02A 3N3HA 1WLDA 2J1RA 4HKOA 4XBLA 4N53A 3F95A 4FAHA 2OX0A 3F2ZA 5C8WA 1ODMA 1Q3EA 2JECA 1VR3A 4RGKA 2LRPA 1UU6A 2OPKA 2FCTA 4XFGA 4OQ9A 4CP2A 5JCTA 1ACCA 1BHGA 5DZGA 2VH9A 4W4ZA 5BNPA 3E6CC 3M3EA 4Y26A 1NG0A 1SQ4A 2PTMA 4YZ4A 2IVJA 5FYSA 3WR0A 4TLGA 2JDNA 2DUOA 1LGCA 3VHPA 1V00A 1FMD1 4IQPA 3POEA 3AFGA 4CP9A 4D0QA 1GQHA 5J09A 1UYYA 4CUAA 4GH4B 4N7UA 1RUG2 1A6CA 2WZEA 4Q1PA 3ZKUA 2DYCA 4Y3OA 2O1QA 1D0GA 1S0BA 4P08A 4LKSA 1XU2A 5ACA2 4JZRA 2W94A 2H6CA 3OBZA 5FY5A 2WKKA 4AHZA 4RYDA 3UJOA 4XZUG 4YG0A 2VOVA 4Z2WA 4HANA 4M3CE 1XJAA 2ZHNA 4CUBA 3UGHA 5FPXA 4TLFA 5C70A 1AJKA 4IXLA 4IV1B 5GJ6A 3POFA 4N43A 1H8TA 3OYWA 2VOTA 2HWE1 3V56A 2CNAA 2G1MA 2ILMA 1JYTA 2GC2A 3NJYA 1W28A 2VUDA 5CYYA 4FT8A 4HMZA 5EYYA 3W59A 2NMOA 4A7KA 3A21A 1DHKB 2FZ1A 1QJY3 2VZPA 3HPNA 4AEKA 2BFUL 2RR11 1ZNPA 3FN9A 2D97A 3K4ZA 4QPYA 2AC1A 3NNMA 4QX8A 3H8OA 2X10A 4CCMA 4AI3A 1GZWA 4XMAA 1VBD3 2QQOA 1U5ZA 1UOGA 1V9U2 3VBFA 3Q8BA 1AR91 1WA4A 2VXJA 4ZKTB 4LKEA 3EO6A 5GLTA 3RJ2X 3WQBA 1J3PA 3KQRA 3C3VA 4CEWB 1EYBA 2JE7A 4IE6A 4CCCA 5JOXA 3AXEA 1G9DA 4MGIE 3ZDVA 1W2OA 3KV5A 2VMHA 1NYWA 3IN9A 1WMEA 1U5YA 2P17A 1EPWA 1ZYBA 4O7XA 5F1RA 1O3SA 3MV01 2HWC2 3U75A 5DAVA 3GZAA 1QKQA 1W9SA 3WCSA 1NCRA 1RIRA 2EF6A 2R49A 1W0NA 1UYZA 4IERA 1DDLA 4U36A 4AK3A 1RUE2 3GF6A 1DFQA 4Y1ZA 1UOBA 4FTBA 2B9UA 1CJPA 4INDA 5FZDA 5CAZA 1KITA 2WWUA 2IWGB 1H2MA 1MEC1 3GBGA 2J1UA 4K1YA 1ZRRA 2VMCA 1HJFA 3OPWA 4N9HA 3BODA 5F2SA 4TYSA 1NCQB 2WFF2 4IEXA 4AEMA 4NHYA 3OGSA 3R4SA 1WWYA 4XBQA 3VBSA 2PLV1 3AJYA 3WW4A 3H9AA 3CZJA 5CG9A 1LAJA 4A3XA 1QQP1 2RM22 2C1FA 2BNOA 5EIYB 5KR7A 1W05A 2HWB3 3W21A 1UO9A 4DNYA 4IGPA 4W6WA 1IG0A 2QTWB 4XE9A 1YWKA 4CEYB 3WP5A 2BU9A 3O1SA 2VL4A 3PMEA 4XEZA 3EJKA 4R9AA 4LUMA 4X8PA 5IW0A 1IKPA 3WF0A 1CD3G 1KGYA 4LXLA 4QU1A 1RUG1 4CU8A 4COYA 3AMQA 4OULA 2D93A 3KV9A 1OQEA 2C6SA 1G9BA 3PTYA 3U78A 2CDPA 1PK6B 2YGMA 4JAAA 5J96B 2DUQA 4N90A 5D1IA 1NUKA 2XB6C 3JQXA 1OUSA 5FP4A 1WMDA 2WJSA 4HSLA 1MVEA 1HXS2 4HBNA 2VZ1A 3E5QA 3WP6A 5BNOA 4GMP3 3S0MA 1BBT2 1RINA 2GMMA 2KR2A 3VBFB 3CBNA 4A7ZA 1OOPC 1ST8A 4Q8LA 2D6LX 1JZ5A 2A75A 3O14A 4EQVA 1JYXA 5JMCA 5FXXA 4EZHA 2DCZA 5ANNA 3RYKA 4A2UA 3AKRA 3ENRA 2WYFA 1O3TA 5HCHA 4HKLA 4OZOA 1AR62 3AMHA 2W92A 1HIXA 5BXXA 4COWA 4WVWA 3N35A 4BK4A 4WBBA 3GHMA 3WF3A 2L9LA 3I4IA 5FOBB 2EVXA 1LOGA 2QQNA 4HONA 4AEDC 4CCOA 3JU9A 2G9FA 1J59A 3ELNA 3I7DA 4C0HA 4FPJA 5A6ZA 4UAPA 3D0SA 4YGBA 5A33B 3M3QA 4QX1A 3MZHA 1DQ6A 4XUTA 2VW0A 1UZZA 1V6IA 3NNJA 1WW6A 5KHIA 4SLIA 2HKXA 3IMNA 1YQ8A 5LBEA 5G04L 5FY4A 1VBB3 4AI8A 5C33A 3VZNA 3AZZA 2VVFA 5A6XA 1ULEA 3QH7A 1LU2A 2MEV1 2QQVA 5DAPA 1YFXA 1LECA 1WUVA 3MV11 1LGNA 4Q0UA 2WS93 4Y5TA 1RMU1 4CDUA 4DRRA 2EA7A 3O7OA 5AVPA 4Q4V1 4K40A 3H42B 1O5UA 1K3IA 3OD4A 4LK7A 4XIKA 5DUVA 2E31A 2E7TA 2VUCA 1WLWA 3WUCA 4QM9A 2V73A 3PTRB 4XIOA 1HQWA 2CGPA 2RR13 5DUXA 3W5NA 2WA3A 4ZXEA 3RQ0A 1IGOA 1S0IA 1E57A 1V6NA 3AYDA 3LKJA 2ZEXA 2P2KA 3HBKA 4HK9A 2WO3A 1VBA2 2XWJB 5M0TA 5J1XA 3ZM8A 4B7KA 4MXWA 5A32A 1VRH2 3PVBB 4BH9A 4I0WB 2JG8C 2YPDA 4F8AA 2YB7A 2ZAHA 3LOIA 2BDRA 2VY0A 4JTOA 4W6XA 1GMMA 1YO8A 3VDAA 5FYZA 5LEKA 1POQA 2Q8OA 2FDHA 4Q4W1 4JGZC 1N3OA 5D8AB 5K0UB 5T5JA 4S2GA 3RZLA 3TN91 2GNTA 3BTXA 2RHPA 2A7AA 4PF5A 2ZX1A 4Q0VA 4DRVA 3H8XA 1ASJ2 4RL7A 1SBEA 3ACGA 4AZZA 3KMHA 1JZ7A 1WLCA 1SDDB 3DUIA 2JD9A 3ZFFA 1X82A 2W91A 1NAEA 4LBOA 4NHXA 3DXUA 4FPGA 1FMD3 1AR72 2OQ7A 1DF0A 3AP6A 5FZCA 4PDWB 5FY1A 1PMJX 3WQ0A 3WCRA 5CISA 4R52A 3PNAA 3LGRA 3ZYJB 2O0OA 5FZLA 3SCGA 3OOXA 1NZCA 4Q27A 1W8HA 3LD8A 3T3YA 4CPBD 5A80A 1IPKA 1K45A 2RS11 3KGLA 1W8WA 2QBXA 4AE2A 1R093 1KXGA 1ZBE3 2UWBA 1UMIA 4GMP0 3WNNA 4DUXA 1OD3A 2VM9A 4PI2A 3PUQA 1SFNA 1U0AA 5FY9A 4LHKA 4L9BA 3M2MA 3JD73 4K9SA 4LBQD 5CKMA 5FDBA 1JBCA 4NPLA 3NV1A 1AYN3 2DURA 3NO8A 5KHGA 3M1HA 1CZSA 4OCTA 4BQ2A 3IDAA 5EV7A 3NJVA 1CZTA 4NIIA 3G6JB 4WVVA 3OBRA 1K5JA 1VBC1 1IS5A 1R083 2VNGA 3ZIXA 3MFAA 4FVVA 1OOPA 3T0BA 5IAVA 4XJWA 1C5HA 5I8TA 4N43B 4K21A 4NVPA 2J22A 2WFF1 2P3IA 5FP8A 1RUJ3 1CESA 5DQ0A 3PURA 4S2FA 4Q29A 5LY2A 4MXWB 5JI7A 1UYXA 4QQOA 3TAYA 3MW3A 3LEGA 1RUJ1 3QOPA 3FLRA 4DMIA 5LB6A 1OPMA 1RUE1 4BYYA 5I0UA 3OPTA 5LW9A 2JEMA 1I1EA 3O1RA 1KS4A 3LPFA 2ZGTA 4ITCA 4L8QA 5CB7A 3ETPA 3NNGA 3BOPA 4IE0A 5T5PA 3PVOA 4FFGA 4NHLA 2YFZA 4Z1VA 3TNPB 2JG9A 3RJRA 1TMF1 5CADA 4JHTA 4RR3C 1VBC3 2XWBB 5CFDC 2ZOEB 3AYCA 4LO4B 4D7SA 2DUPA 3WQ1A 4CUCA 2CY6A 1WZXA 1MEC3 3FMGA 4QX0A 5A33A 3RWNA 4CDUC 1MZ6A 2LW8A 2WQ8A 1TME1 2RM21 1VBE1 2D3SA 4GXLA 3ZXKA 2YDEA 4O65A 3VKLA 3WG3A 4KL1A 1CGPA 2ZX3A 5F32A 4P00B 1RHI3 2JDPA 5E6HA 2PLV3 1SPPB 3K3NA 3OUIA 3VHOA 5JZGC 4P9WA 1X36A 1W6PB 4JGYA 1FV3A 2RS32 4Y1UA 1GQGA 2XVLA 3RRDA 3ILNA 4Y1YA 1PO21 3WW1A 5A3UA 4NJ4A 5F3EA 1FX5A 3ZO0B 4HETA 4NIGA 1RXFA 5LRRA 1JN2P 2Z42A 2RDQA 4Z2AA 1KEXA 5JOZA 5K9YA 4KWLA 1Y9MA 4AG4A 5FK8A 3TN92 5D2AA 3LSEA 3U1XA 3SEEA 4EWDA 2J1AA 2BRTA 1DYKA 2JX9A 3KT4A 4FI9A 5DN2A 5FZIA 3ZXGA 5B4NA 2BWCA 3E1F1 3J4UH 3AP5A 2W47A 3JBG1 3HQUA 1JOJA 3I3DA 2YUEA 2YXSA 3GZTB 3J9SA 1REFA 4NPRA 1X9PA 1COV3 1NXD1 1VRH1 2XQRA 3WHUA 3ZFFC 4TXWA 3RI8A 5A1FA 2WIIB 3DPRA 4UFJA 4V2VA 1C8M3 5C4WA 4LOTA 5CFCB 3BUCA 4LOSA 1RVF3 2DCYA 1EUUA 2QDNA 3D3AA 4HL0A 4NWWA 4XVHA 2QCSB 1C28A 2R0HA 4GA9A 4GJZA 4TSVA 3TB0A 3MF9A 2E26A 1DQ1A 3FBYA 2A6YA 3J7HA 2DU0A 5C4WB 2DBNA 2WRAA 5CFCA 1AL23 1AJOA 2ZGKA 4HLTA 2F4PA 5CKQA 1Z78A 4E8CA 1Y3TA 2NM1A 3EYPA 2AENA 2UURA 2EIDA 2WNVA 2WNVB 3M70A 4M3CB 1SCRA 1OMIA 4JQTA 5EPAA 4ZY9A 4BLIA 4ARYA 2AYHA 1BVVA 2DVAA 2XVGA 3ZYGA 2RG4A 2B39A 2RE9A 5FZMA 4C1XA 4UBGA 3FFQA 4PDWA 4OLLA 1LEMA 5JDBA 3TEWA 3HWJA 3QACA 3KB5A 3I2FA 3JQWA 2OZJA 3PUIA 2UYAA 4NN0A 3ZLIA 3ASIA 2VZQA 3FL7A 3KV6A 3SLIA 4XDOA 3LA2A 1DGRA 4CPBA 3NNLA 2NP0A 3N7KA 4CCJA 3OPZA 4DS0A 2VQUA 4NOTA 5FYCA 2VD7A 2K46A 4CCLA 4CRQA 2QJVA 4XURA 3LIGA 4YGEA 4K20A 5BNNC 5AC93 3USSA 1ZZ8A 4AVCA 2WFF3 3CU7A 5BNPC 1W39A 4BDVB 1UD1A 4CCKA 1QMJA 2EIBA 3T30A 2A3XA 1H2KA 2E53A 2R6QA 3ABZA 3AYEA 2WN2A 5FYMA 3VZOA 3H0OA 4E9KA 5KXBA 1AXZA 2WLPA 4FTEA 3PUHA 3IDBB 1NLSA 2Z4FA 4Q4Y3 3CMGA 3A4UA 3ZFGB 2G19A 3N9PA 2J7MA 2TBVA 2B46X 1HLCA 1SG3A 5EP9A 4RQPB 3E97A 1RC6A 4G3YC 2JG9B 3WVJA 1PZ9A 3ZOIA 2BGOA 1YUDA 1AUYA 2FDFA 1MR5A 1GLHA 2WSUA 1PNFA 1IQAA 3NNFA 4META 2XMLA 5AC91 1JH5A 1YXWA 3T2OA 4KG0A 4DOUA 4XUOA 4C91A 4QPIC 1D7PM 3VUOA 4LEJA 5C9AB 2XL7A 1OLMA 3MUY1 4ZU4A 3NL1A 5J37A 1LKNA 5JOWA 2PXJA 1RUF3 2PHUA 2NQYA 2R061 4JRLA 3DCQA 5F6LB 2IXLA 2RDSA 5AVAA 2XJVA 3S30A 4E2SA 2QQPA 3EXUA 1NQJA 2BERA 4K8FA 4XJAA 5FZBA 4CP9B 4YFWA 4GWJA 4HSJA 1AR63 4QDSA 4XF0A 4HT1T 4QGMA 4N8MA 4K3UA 1PO11 4YG6A 3U37A 3X29B 3VD4A 4FO9A 3VBHC 1RMU2 4LKDA 3SNMA 2DU1A 1AR83 5FZ3A 4H2AA 2VVEA 4QXBA 2Q8CA 2B5HA 2MEV2 2FCUA 3N36A 5IK5A 2B45X 1FI2A 4B4QA 3UL2A 3ZXLA 3UKNA 1VAVA 2FDGA 1H1MA 2ZPXA 2HWC3 4WM7B 4P5HA 3WINE 2PHTA 1LOFC 4OVEA 1FXZA 2DCKA 2CU5A 5FZ7A 1VBD1 1YYNA 1DQ5A 4QQPA 4I3GA 5KWRA 2MHFA 3DPRC 4FSJA 5I0DA 1V6OA 5FZ8A 4CDQB 1OH4A 2FDIA 3FC0A 5F5IA 1RYYA 4BQYA 2WZR2 1TMF2 4HXCA 4QWNA 4XAEA 4BIFA 1B35B 1X7NA 3WNLA 2QZ2A 2RMU1 3AM2A 4UT5A 1IS4A 1LJ7A 4HVRA 1GNHA 1TE1B 4OUMA 4BISA 4TTGA 1DCSA 3NAPC 3CJIC 3H3LA 3THTA 4HK8A 4YZ2A 1H1IA 1AR61 3I3EA 2XQXA 1GWKA 2CWSA 5FWJA 1OQ1A 2VAUA 5J36A 2QVSB 1LGBA 4ZU5A 5H9PA 2UU8A 2VZSA 1KFXL 4LLFA 1QF3A 5E8AA 3A0KA 5IWFA 4A44A 5FXVA 4D3WA 4YARA 1XYPA 3I49A 1POV0 3B00A 1VBA3 3GCXA 4JDOA 2RS31 2PHLA 4K6BA 1WMXA 4AFCA 3J7NA 1Q43A 2ADEA 3JXSA 3KHBA 4GMP1 2ZKNA 2HWE2 3IAPA 4KWKA 3T08A 4V1PA 3LEMA 3VZJA 3ZN4A 1CAUA 2GC0A 4PI0A 1ZVFA 4ATFA 1JZ8A 1JYCA 1NA1B 1VJ2A 2E51A 2TNFA 1IG3A 1NE4A 4UW5A 2H6BA 3O5SA 1JTZX 1CVNA 1US2A 1NX9A 1U5IA 2MPFA 4QDQA 1TME3 1W8FA 3ACFA 2DV9A 1F31A 4JDNA 1O4ZA 3HIFA 3ZX7A 5ACA1 1ENXA 5KHJA 1JZ6A 1FOD1 1RHI1 4YGDA 3LA7A 3ZMOA 2ZX2A 3U07A 1EV13 2Q1ZB 4ES8A 5EJZB 4WV8A 1RUG3 4LBQB 3VBRA 1PMHX 4TZDA 2AR6A 2D98A 5GLUA 1JI6A 3M3IA 4Q0PA 3SISA 4CU6A 3OEAA 4J1WA 1Y4WA 1RITA 4URTA 3MPPG 5T5OA 2PLV2 3VBOA 2GP5A 3CJXA 5FPUA 1C4RA 1N1YA 1ZZ9A 2ADDA 2VZTA 2YPJA 2ZJCA 4EJRA 1W99A 4AGGA 4J6GA 1OI6A 2PAKA 3AK0A 4B4PA 5K8SA 1S2BA 5A1LA 5CIRA 2DDUA 1OSGA 2YC2A 4M01A 4DY5A 3D8CA 4UFIA 3ZVXA 4P9YA 3POGA 4BWOA 4WVZA 1GZWB 2XJUA 4NRPA 1J1LA 4KI5M 5C9AA 2Y0IA 4XJZA 4GH4A 2O8OA 1A8MA 2AUYA 4DEQA 2XKOA 2ZGOA 1S1AA 3VBUB 3OY8B 1CAVB 3HAGA 1US3A 4FCAA 2HWB1 4B8EA 2HLEA 3INAA 5FP3A 4AAPA 1ND2C 1A34A 1RUNA 4CSWA 5EHDA 3MW2A 4Q5OA 1K5MB 1EV11 4IV3A 1X9TA 5HPOA 3L2HA 3O0XA 4FFHA 5FZ9A 5BYNA 1VBD2 1WMFA 3RZZA 4AR2A 1W6PA 2PN5A 2BJSA 1LHOA 2CL2A 4QKBA 4X8NA 2Y6JA 1Y43B 2NZ9A 1NT0A 3VV1A 1H8TB 1WKYA 2JWPA 3OYWB 1XNTA 1VBA1 4OUEA 4YNIA 3ZFGA 3BOWA 4YZ5A 5LEJA 2XHNA 3BTYA 4XCAA 4LA2A 1D0HA 1GR3A 2Y6KA 1AL0G 4AGRA 1MQTB 4CUGA 1I9RA 4F83A 5B2GB 5C3QA 5CG8A 1FPN3 2QQJA 2HYXA 3UKTA 1GOFA 5I0SA 4NWVA 3TEYA 1GWLA 1CIYA 1MZ5A 1YQ2A 3HJRA 4QX5A 3DYPA 4CDWC 3HNMA 1IS3A 3B9CA 5SV8A 2XBO2 1ZBE1 2WO2A 2OT7A 1W9FA
chains in the Genus database with same CATH topology
1OF4A 4OZOA 2X09A 2W92A 1W8OA 3CKHA 4BK4A 3LE0A 3WF3A 2L9LA 1DYOA 2QQNA 2B4KA 3GDBA 3LEIA 4HG6B 3K4AA 4QB2A 2E33A 4LQRA 1O8PA 4UAPA 3CDZB 3T0AA 4QX1A 5CZKA 4XUTA 4GZ9A 3HOBA 5G04L 2JE8A 1O59A 1XC6A 1LNSA 2WBKA 3VD3A 5JMOA 2RJ2A 2VMFA 3MV11 4JKKA 4YPJA 1K3IA 3FHAA 2E31A 4JX0A 2XONA 2ZEWA 3I97A 2WAOA 1ULOA 2BZDA 5IJRA 3W5NA 4ZXEA 3VD9A 2VZRA 2ZEXA 2WO3A 1DLCA 4ARXA 5J1XA 3ZM8A 2XOMA 4PT6A 4JKLA 2QQKA 4CU7A 1MPXA 2YB7A 2Y6LA 1GMMA 2VMEA 3VDAA 2PQSA 2J1VA 3T0DA 1UY1A 2WABA 4A4AA 4A3ZA 3ACGA 3P1IA 3I2KA 3ACIA 2WN3A 4ZZ5A 1JZ7A 3NRUA 1SDDB 2JD9A 2W5FA 5FUIA 2W91A 1NAEA 5G05L 3MBWA 2YG0A 1PMJX 1I5PA 3OG2A 1O8SA 3WSOA 1UY3A 4AAXA 1T2XA 4IUGA 3IB3A 4DEVA 4OYUA 3LPGA 1K45A 4W8JA 2QBXA 3WNNA 1UMIA 4DUXA 1OD3A 2VM9A 1TVGA 2VZOA 3WF4A 4A45A 2V5DA 3WF2A 3CQOA 5JXJA 4LHSA 1CZSA 2J1EA 2ORXA 3IDAA 3NJVA 1CZTA 2YFUA 4ZZ8A 3I2GA 3THDA 3DYMA 4A42A 4OMCA 1XNAA 3T0BA 4QX2A 3VD5A 2J22A 4KMQA 3SKVA 3C7OA 2QQLA 2DCJA 5DQ0A 1UYXA 4DUWA 3LEGA 3WEZA 3OBAA 3CIHA 4KWUA 4M4RA 2VCAA 4QB1A 3GGLA 1DP0A 3LPFA 2R7EB 4MO3M 3ETPA 3NNGA 4DUVA 3BGAA 3WNPA 5LA0A 4MOAA 2YFZA 1JZ4A 5JXIA 1GU3A 4DXSA 4XUQA 4QDRA 2Y8KA 2X05A 1JZ2A 2C4XA 3VD7A 5LA1A 1OT5A 2RVAA 2VTFA 3LQCA 1L7RA 3HNBM 1H6XA 3C7HA 4CUCA 4QX0A 2LW8A 3A7QA 2WQ8A 3DYOA 3T09A 2OKXA 3I2HA 3AC0A 5JR2A 1JYVA 4P00B 2W1SA 4MADA 4JHZA 2ORZA 5B4XA 1UXXX 3K75B 3T2QA 1J84A 5IFTA 2V72A 2QQMA 2Y6GA 1KEXA 4Z2AA 2Y64A 4AG4A 3P6BA 3GXUA 1PX4A 1R64A 2W1WA 1JYWA 1JHJA 3SEEA 2J1AA 4FI9A 5DN2A 5B4NA 3A23A 3E1F1 2W47A 2VR4A 3I3DA 1OF3A 3ECQA 4CU9A 1JU3A 3ACHA 5JUVA 4TXWA 2WZ8A 3I2IA 4JKMA 5DMYA 4QX3A 2EICA 4BJ0A 2VCCA 1EUUA 3D3AA 2BGPA 2VJXA 4XVHA 2Y6HA 1K42A 2E26A 5F7UA 3GM8A 3J7HA 1UMHA 2LS6A 4E8CA 2VZVA 3EYPA 2EIDA 2J1TA 5JXHA 4ZY9A 4ARYA 5IHRA 3LEKA 1W9TA 4MGSA 5EJ1B 1EUTA 3C7FA 3MO4A 3SEPA 2B9VA 2VMDA 5IYYA 3I2FA 3PUIA 2VZQA 3FL7A 2VCBA 2C26A 5A1AA 1P8JA 4QAWA 4GWIA 4QPWA 2ZEYA 3HNYM 1CX1A 2VQUA 4XURA 2VO5A 1F4AA 1UWWA 3C7GA 4DXRA 3FHQA 4MGQA 3BN6A 3I3BA 2WDBA 3WNKA 4BDVB 3K4DA 3I2JA 2EIBA 2V4VA 1H6YA 3ABZA 2WN2A 2E32A 3PUHA 2Z4FA 3CMGA 2VC9A 2J7MA 1NKGA 2VQTA 1SG3A 4M4PA 3WNMA 2BGOA 2W1UA 1K12A 2WO1A 5IFPA 1GOGA 3T2OA 4L0PA 1GOHA 4XUOA 2J1SA 1D7PM 1UX7A 1GUIA 1GNYA 1IQDC 3MUY1 3UESA 2W9XA 2ZEZA 1JYNA 1F4HA 3HN3A 3OEBA 3THCA 3EB7A 3HEIA 3A22A 4A41A 3NQHA 2BERA 2J1RA 4GWJA 3F2ZA 5LA2A 4QDSA 3WF1A 3SKJE 3U37A 3VD4A 4D8MA 1W8NA 1BHGA 4W4ZA 3DECA 4RN5A 3T2PA 2WUHA 2RV9A 2WYSA 4CVUA 4P5YA 1JU4A 4D0QA 1UYYA 2DCKA 4CUAA 1ULPA 2WZEA 4BXSV 2VZUA 5DPNA 4P08A 4LKSA 2W94A 3OGVA 2WAAA 5I0DA 2EIEA 4RYDA 4XZUG 3OGRA 1OH4A 1RYYA 4OMDA 4XUPA 4CUBA 1HN1A 1UY2A 5C70A 3WNLA 1WCQA 2VOTA 4TTGA 3C7EA 5C7GA 1UZ0A 3IAQA 5CYYA 2CDOA 3I3EA 2XQXA 3A21A 1L7QA 2ID4A 2VZ3A 1W9WA 2VZPA 3HPNA 2VZSA 4A44A 3FN9A 3K4ZA 3K77A 2KD7A 2X10A 3JXSA 5LCWL 2ZXQA 3IAPA 2W87A 3T08A 2QQOA 1JZ8A 4XUNA 3WQBA 2C9KA 2JKXA 1US2A 1NX9A 2W46A 4QDQA 3ACFA 3CZUA 3MUZ1 3NJXA 1JZ6A 3MV01 4W50A 1TG7A 3VDCA 1W9SA 5EJZB 5HXMA 4DXTA 1CZVA 1PMHX 5C71A 1JI6A 2W95A 1W0NA 4CU6A 1UYZA 3OEAA 1UY4A 2VZTA 3C8XA 4PF1A 1W99A 4A6OA 1GQPA 4LPLA 2W3JA 2J1UA 4QB6A 2DDUA 2VMCA 2YC2A 4ET7A 1JZ3A 3OGSA 4BK5A 4KI5M 3CZJA 1XPWA 5EIYB 4DEQA 1UXZA 4P02B 2BBAA 1US3A 2HLEA 3IIIA 2VL4A 5JXGA 3WF0A 5HPOA 1KGYA 2W1QA 4CU8A 1PX3A 3WNOA 1J83A 2Y6JA 3UNPA 2CDPA 3K46A 1WKYA 3VDBA 1NUKA 1XNTA 1UY0A 3OB8A 4OUEA 2XHNA 2YC4A 2Y6KA 3W5MA 2VZ1A 4UOJA 4E8DA 1SHWB 3UETA 2QQIA 4PQQA 1JZ5A 4UI9L 2QQJA 1JYXA 2HYXA 2JDAA 1GOFA 1CIYA 1YQ2A 3HJRA 3DYPA 3HNMA 2WO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OF4 A;  4OZO A;  2X09 A;  2W92 A;  1W8O A;  3CKH A;  4BK4 A;  3LE0 A;  3WF3 A;  2L9L A;  1DYO A;  2QQN A;  2B4K A;  3GDB A;  3LEI A;  4HG6 B;  3K4A A;  4QB2 A;  2E33 A;  4LQR A;  1O8P A;  4UAP A;  3CDZ B;  3T0A A;  4QX1 A;  5CZK A;  4XUT A;  4GZ9 A;  3HOB A;  5G04 L;  2JE8 A;  1O59 A;  1XC6 A;  1LNS A;  2WBK A;  3VD3 A;  5JMO A;  2RJ2 A;  2VMF A;  3MV1 1;  4JKK A;  4YPJ A;  1K3I A;  3FHA A;  2E31 A;  4JX0 A;  2XON A;  2ZEW A;  3I97 A;  2WAO A;  1ULO A;  2BZD A;  5IJR A;  3W5N A;  4ZXE A;  3VD9 A;  2VZR A;  2ZEX A;  2WO3 A;  1DLC A;  4ARX A;  5J1X A;  3ZM8 A;  2XOM A;  4PT6 A;  4JKL A;  2QQK A;  4CU7 A;  1MPX A;  2YB7 A;  2Y6L A;  1GMM A;  2VME A;  3VDA A;  2PQS A;  2J1V A;  3T0D A;  1UY1 A;  2WAB A;  4A4A A;  4A3Z A;  3ACG A;  3P1I A;  3I2K A;  3ACI A;  2WN3 A;  4ZZ5 A;  1JZ7 A;  3NRU A;  1SDD B;  2JD9 A;  2W5F A;  5FUI A;  2W91 A;  1NAE A;  5G05 L;  3MBW A;  2YG0 A;  1PMJ X;  1I5P A;  3OG2 A;  1O8S A;  3WSO A;  1UY3 A;  4AAX A;  1T2X A;  4IUG A;  3IB3 A;  4DEV A;  4OYU A;  3LPG A;  1K45 A;  4W8J A;  2QBX A;  3WNN A;  1UMI A;  4DUX A;  1OD3 A;  2VM9 A;  1TVG A;  2VZO A;  3WF4 A;  4A45 A;  2V5D A;  3WF2 A;  3CQO A;  5JXJ A;  4LHS A;  1CZS A;  2J1E A;  2ORX A;  3IDA A;  3NJV A;  1CZT A;  2YFU A;  4ZZ8 A;  3I2G A;  3THD A;  3DYM A;  4A42 A;  4OMC A;  1XNA A;  3T0B A;  4QX2 A;  3VD5 A;  2J22 A;  4KMQ A;  3SKV A;  3C7O A;  2QQL A;  2DCJ A;  5DQ0 A;  1UYX A;  4DUW A;  3LEG A;  3WEZ A;  3OBA A;  3CIH A;  4KWU A;  4M4R A;  2VCA A;  4QB1 A;  3GGL A;  1DP0 A;  3LPF A;  2R7E B;  4MO3 M;  3ETP A;  3NNG A;  4DUV A;  3BGA A;  3WNP A;  5LA0 A;  4MOA A;  2YFZ A;  1JZ4 A;  5JXI A;  1GU3 A;  4DXS A;  4XUQ A;  4QDR A;  2Y8K A;  2X05 A;  1JZ2 A;  2C4X A;  3VD7 A;  5LA1 A;  1OT5 A;  2RVA A;  2VTF A;  3LQC A;  1L7R A;  3HNB M;  1H6X A;  3C7H A;  4CUC A;  4QX0 A;  2LW8 A;  3A7Q A;  2WQ8 A;  3DYO A;  3T09 A;  2OKX A;  3I2H A;  3AC0 A;  5JR2 A;  1JYV A;  4P00 B;  2W1S A;  4MAD A;  4JHZ A;  2ORZ A;  5B4X A;  1UXX X;  3K75 B;  3T2Q A;  1J84 A;  5IFT A;  2V72 A;  2QQM A;  2Y6G A;  1KEX A;  4Z2A A;  2Y64 A;  4AG4 A;  3P6B A;  3GXU A;  1PX4 A;  1R64 A;  2W1W A;  1JYW A;  1JHJ A;  3SEE A;  2J1A A;  4FI9 A;  5DN2 A;  5B4N A;  3A23 A;  3E1F 1;  2W47 A;  2VR4 A;  3I3D A;  1OF3 A;  3ECQ A;  4CU9 A;  1JU3 A;  3ACH A;  5JUV A;  4TXW A;  2WZ8 A;  3I2I A;  4JKM A;  5DMY A;  4QX3 A;  2EIC A;  4BJ0 A;  2VCC A;  1EUU A;  3D3A A;  2BGP A;  2VJX A;  4XVH A;  2Y6H A;  1K42 A;  2E26 A;  5F7U A;  3GM8 A;  3J7H A;  1UMH A;  2LS6 A;  4E8C A;  2VZV A;  3EYP A;  2EID A;  2J1T A;  5JXH A;  4ZY9 A;  4ARY A;  5IHR A;  3LEK A;  1W9T A;  4MGS A;  5EJ1 B;  1EUT A;  3C7F A;  3MO4 A;  3SEP A;  2B9V A;  2VMD A;  5IYY A;  3I2F A;  3PUI A;  2VZQ A;  3FL7 A;  2VCB A;  2C26 A;  5A1A A;  1P8J A;  4QAW A;  4GWI A;  4QPW A;  2ZEY A;  3HNY M;  1CX1 A;  2VQU A;  4XUR A;  2VO5 A;  1F4A A;  1UWW A;  3C7G A;  4DXR A;  3FHQ A;  4MGQ A;  3BN6 A;  3I3B A;  2WDB A;  3WNK A;  4BDV B;  3K4D A;  3I2J A;  2EIB A;  2V4V A;  1H6Y A;  3ABZ A;  2WN2 A;  2E32 A;  3PUH A;  2Z4F A;  3CMG A;  2VC9 A;  2J7M A;  1NKG A;  2VQT A;  1SG3 A;  4M4P A;  3WNM A;  2BGO A;  2W1U A;  1K12 A;  2WO1 A;  5IFP A;  1GOG A;  3T2O A;  4L0P A;  1GOH A;  4XUO A;  2J1S A;  1D7P M;  1UX7 A;  1GUI A;  1GNY A;  1IQD C;  3MUY 1;  3UES A;  2W9X A;  2ZEZ A;  1JYN A;  1F4H A;  3HN3 A;  3OEB A;  3THC A;  3EB7 A;  3HEI A;  3A22 A;  4A41 A;  3NQH A;  2BER A;  2J1R A;  4GWJ A;  3F2Z A;  5LA2 A;  4QDS A;  3WF1 A;  3SKJ E;  3U37 A;  3VD4 A;  4D8M A;  1W8N A;  1BHG A;  4W4Z A;  3DEC A;  4RN5 A;  3T2P A;  2WUH A;  2RV9 A;  2WYS A;  4CVU A;  4P5Y A;  1JU4 A;  4D0Q A;  1UYY A;  2DCK A;  4CUA A;  1ULP A;  2WZE A;  4BXS V;  2VZU A;  5DPN A;  4P08 A;  4LKS A;  2W94 A;  3OGV A;  2WAA A;  5I0D A;  2EIE A;  4RYD A;  4XZU G;  3OGR A;  1OH4 A;  1RYY A;  4OMD A;  4XUP A;  4CUB A;  1HN1 A;  1UY2 A;  5C70 A;  3WNL A;  1WCQ A;  2VOT A;  4TTG A;  3C7E A;  5C7G A;  1UZ0 A;  3IAQ A;  5CYY A;  2CDO A;  3I3E A;  2XQX A;  3A21 A;  1L7Q A;  2ID4 A;  2VZ3 A;  1W9W A;  2VZP A;  3HPN A;  2VZS A;  4A44 A;  3FN9 A;  3K4Z A;  3K77 A;  2KD7 A;  2X10 A;  3JXS A;  5LCW L;  2ZXQ A;  3IAP A;  2W87 A;  3T08 A;  2QQO A;  1JZ8 A;  4XUN A;  3WQB A;  2C9K A;  2JKX A;  1US2 A;  1NX9 A;  2W46 A;  4QDQ A;  3ACF A;  3CZU A;  3MUZ 1;  3NJX A;  1JZ6 A;  3MV0 1;  4W50 A;  1TG7 A;  3VDC A;  1W9S A;  5EJZ B;  5HXM A;  4DXT A;  1CZV A;  1PMH X;  5C71 A;  1JI6 A;  2W95 A;  1W0N A;  4CU6 A;  1UYZ A;  3OEA A;  1UY4 A;  2VZT A;  3C8X A;  4PF1 A;  1W99 A;  4A6O A;  1GQP A;  4LPL A;  2W3J A;  2J1U A;  4QB6 A;  2DDU A;  2VMC A;  2YC2 A;  4ET7 A;  1JZ3 A;  3OGS A;  4BK5 A;  4KI5 M;  3CZJ A;  1XPW A;  5EIY B;  4DEQ A;  1UXZ A;  4P02 B;  2BBA A;  1US3 A;  2HLE A;  3III A;  2VL4 A;  5JXG A;  3WF0 A;  5HPO A;  1KGY A;  2W1Q A;  4CU8 A;  1PX3 A;  3WNO A;  1J83 A;  2Y6J A;  3UNP A;  2CDP A;  3K46 A;  1WKY A;  3VDB A;  1NUK A;  1XNT A;  1UY0 A;  3OB8 A;  4OUE A;  2XHN A;  2YC4 A;  2Y6K A;  3W5M A;  2VZ1 A;  4UOJ A;  4E8D A;  1SHW B;  3UET A;  2QQI A;  4PQQ A;  1JZ5 A;  4UI9 L;  2QQJ A;  1JYX A;  2HYX A;  2JDA A;  1GOF A;  1CIY A;  1YQ2 A;  3HJR A;  3DYP A;  3HNM A;  2WO2 A; 
#chains in the Genus database with same CATH topology
 4IGO A;  1WCU A;  2ZMN A;  4HZF A;  4LBK A;  4Y4R A;  1Y9G A;  4I2O A;  1AX0 A;  3KZ4 C;  1TQ5 A;  5BNQ A;  3SIT A;  1V6K A;  1HXS 3;  2WR9 A;  3OY8 A;  2PMW B;  5BNO C;  1HRI 1;  2VXR A;  1XND A;  3DL3 A;  3DKW A;  5JLV A;  4JV4 A;  2A1X A;  1W8U A;  2CAU A;  1WD3 A;  3KF3 A;  3QBQ A;  1KJR A;  3USU B;  3WDX A;  4JDM A;  4LQR A;  3T0A A;  2D3P A;  4X6Q B;  4FPK A;  4ZPI A;  2A71 A;  2R1B A;  2RM2 3;  2VNO A;  5A3T A;  1LU1 A;  5IVY A;  1NCQ A;  3WLU A;  2JE8 A;  3K48 A;  1MS3 A;  1DGW X;  4QXC A;  4NHK A;  3ES1 A;  1Y9Q A;  2QKD A;  1QXR A;  2IVI B;  3NVC A;  2DTW A;  4I09 A;  4YW3 A;  2X5I C;  4QQ2 A;  1PGS A;  3MLJ A;  3I2O A;  4UXA A;  2F4L A;  3RMY A;  2FZ2 A;  4JKK A;  2ET1 A;  5FJH A;  1L7L A;  1PGW 1;  4Y22 B;  4YPJ A;  3OGG A;  5FZ1 A;  1S0J A;  1N3Q A;  3ZXD A;  3FHA A;  1J3Q A;  2VUJ A;  4NE9 A;  4P14 A;  5DAX A;  2XON A;  1MS1 A;  1EAH 1;  2ZKL A;  5A3O A;  3UJQ A;  2BZD A;  1YFY A;  2VU9 A;  1A78 A;  2ZS6 B;  5IJR A;  2JEN A;  3IBM A;  4NHM A;  1DLC A;  4YW4 A;  5FWE A;  4YWA A;  3DN7 A;  1RUH 1;  2P3Y A;  5FY8 A;  2ARB A;  1VBE 3;  4QQL A;  2D5F A;  2GNB A;  2XOM A;  1GZT A;  4PT6 A;  1NA1 A;  3CO2 A;  2ETE A;  4Y5Z 0;  1QOO A;  2RDN A;  4YG3 A;  3VKO A;  1PVC 1;  2ZX0 A;  1CR7 A;  1I3H A;  3KCC A;  4KNC A;  1Q8Q A;  2VME A;  2Y38 A;  3C2U A;  2YMZ A;  5FZ0 A;  5A7W A;  5JIU A;  1ULD A;  4WM8 A;  5DZE A;  3E6B A;  3IMM A;  4R9C A;  1MAC A;  1S2E A;  3WXP A;  1DGL A;  1NE6 A;  2EXI A;  4FQ4 A;  4MZU A;  4URA A;  3ZPY A;  2HBU A;  4CCN A;  4UFL A;  1QGL A;  2EXJ A;  3ACI A;  1ZBE 2;  2SLI A;  2WO7 A;  3E5X A;  3ZN6 B;  4RHV 2;  2D7F A;  2YU2 A;  4XFC A;  4MG2 A;  2YG0 A;  5K0U A;  4AYU A;  1I5P A;  2LRO A;  1QY4 A;  3PUS A;  2F17 A;  4WZF A;  1YQ6 A;  3WSO A;  1UY3 A;  5F5A A;  1UU5 A;  2C9A A;  1IPJ A;  4KBB A;  1JUI A;  2VE1 A;  1WLT A;  3J26 N;  5F3I A;  4IEO A;  4W6Y A;  1E5I A;  5A7Q A;  4CDQ A;  1S0D A;  2PHX A;  4DEV A;  1RUC 3;  4OYU A;  3LPG A;  3WV6 A;  4EYU A;  3TOJ A;  4H14 A;  3PLQ A;  1C8M 1;  1QEX A;  3VL9 A;  4QPG B;  4QPI A;  2CV6 A;  1WW5 A;  4NRQ A;  4YM2 A;  4A45 A;  4CDW B;  5A70 A;  4HPK A;  3WF2 A;  5FMD A;  1M06 G;  2HEV F;  3MIG A;  2WZR 3;  3B9I A;  3B93 A;  3H1Y A;  3OTF A;  2HWB 2;  2ORX A;  5FZG A;  2A73 B;  1LHU A;  2YFU A;  5JSP A;  4QX7 A;  4AFA A;  3OBT A;  1PIV 2;  3VLB B;  4OFG A;  5EJ3 A;  4IV1 A;  5C3S A;  1MQT C;  1G8W A;  4KU8 A;  3FLT A;  1G86 A;  2VTX J;  4QX2 A;  3WHT A;  1PM7 A;  2BP6 A;  1V9U 1;  3MPB A;  1UCX A;  2ZBJ A;  4KMQ A;  3LF7 A;  3KD4 A;  3QD6 A;  3SKV A;  1UF2 C;  5J98 B;  3VGI A;  4Q0Q A;  1QJU 1;  1H9W A;  2QQL A;  5A7N A;  4N53 B;  2AGS A;  5DDJ 2;  2BTV C;  5LRS A;  5CFD A;  1BBT 3;  1ASJ 3;  1OKQ A;  4M4R A;  2JD4 A;  1QXJ A;  2VCA A;  4EN8 B;  1DG6 A;  1ZM1 A;  4QHB A;  3KHC A;  4XAB A;  1NQD A;  2HJI A;  2XH6 A;  3AYA A;  1N1V A;  3KVB A;  3S5A A;  2JB4 A;  3P5B A;  2QDR A;  4XMI A;  4LE4 A;  2JG8 A;  1GSL A;  1D4M 2;  2DCT A;  3VBO B;  2BWA A;  2G9Z A;  4EZ4 A;  3HMY A;  1YCI A;  3J7L A;  3KSC A;  3TBD A;  4HN0 A;  1RHI 2;  4XQ4 A;  1TME 2;  5JXI A;  3AXD A;  2X8K A;  4Z8B A;  4HPK B;  4XUQ A;  3OJB A;  4NO4 A;  3WW2 A;  2E7A A;  3A0N A;  3KCY A;  1W6O B;  1QJZ A;  4ZU7 A;  1N1S A;  4I0B A;  1OT5 A;  1EV1 2;  4LBN A;  4Y1V A;  3N7L A;  1RUF 2;  4RS5 A;  1BCX A;  5T5L A;  3LQC A;  1AYM 2;  4CXX A;  1S0C A;  3AVR A;  5FV3 A;  1N1T A;  1IOA A;  4XW3 A;  3SH3 A;  3NST A;  4DY3 A;  3SC7 X;  3T09 A;  1O4Y A;  2IXH A;  5FO9 B;  4B4R A;  5HBA A;  3FUQ A;  2JIJ A;  1F5J A;  2OKX A;  3I2H A;  2DVB A;  1C1F A;  3AC0 A;  4ASM B;  3V0A B;  5GLZ A;  5FPZ A;  1XSQ A;  4JHZ A;  1AR8 2;  4NMI A;  1W6M A;  5JI9 A;  1COV 1;  3PVE A;  2UY8 A;  5B4X A;  3CEW A;  1COV 2;  2VUL A;  3MEP A;  3FBM A;  1RUJ 2;  3AMP A;  4YGC A;  5BY5 A;  2RMU 2;  1V6L A;  4Q26 A;  3T2T A;  2D6O X;  2XR4 A;  2ZZQ A;  5CEH A;  4HN1 A;  5IK8 A;  2Y6G A;  3NKT A;  3UT0 A;  3NAP A;  3K2O A;  2GDF A;  3JCI A;  3FJS A;  3P6B A;  4ONU A;  4PBO A;  1R64 A;  3ZR5 A;  1JYW A;  4XQD A;  3ZYR A;  1QHD A;  4EN0 A;  3GZE A;  2RJL A;  1EPZ A;  1H0B A;  1UOF A;  2YBS A;  4DZG A;  3Q9O A;  3RZH A;  1PVC 2;  2I2S A;  2PAM A;  2VR4 A;  5L36 A;  1RUD 1;  2XUM A;  1VAK A;  4XJU A;  1HX6 A;  1JU3 A;  5A6Q A;  5JUV A;  5A3W A;  3BPZ A;  3I2I A;  4JKM A;  1LED A;  1VP6 A;  1PZ7 A;  1RL3 A;  3URF A;  2BEO A;  4D7Y A;  5L7O B;  3O1T A;  1LB2 A;  4DQA A;  4QX3 A;  1DQ0 A;  1H2N A;  1LHV A;  4WM7 A;  4BJ0 A;  2ERF A;  2XGX A;  3O1P A;  1O3Q A;  1AZD A;  4AHX A;  1RGS A;  2VJX A;  1AHS A;  1AVB A;  4K7J A;  1W6N B;  1Z7S 3;  3POS A;  3ZSM A;  4FOQ A;  2BVV A;  4CDQ C;  3LFI A;  2JDY A;  3DPR B;  4MLO A;  4IDZ A;  3BAL A;  2GN7 A;  1QDO A;  2LS6 A;  4YW1 A;  4NAO A;  5FP7 A;  3DEM A;  2Q5T A;  1AXK A;  1MZF A;  1SLC A;  5JXH A;  2ZAA A;  4WM7 C;  4LIT A;  3ME2 A;  1NOV A;  5LA9 A;  3ZPO A;  1JXN A;  3JUU A;  5AC9 2;  3BTA A;  1BMV 1;  3C7F A;  3VBH B;  3H1M A;  3U4X A;  4JQR A;  1UZY A;  5GZE A;  2Q1F A;  5IUQ A;  4LBJ A;  1N3P A;  3WOG A;  2BGC A;  1F15 A;  2ZGS A;  1BQP A;  4RR3 A;  1DQ4 A;  5A1A A;  1S55 A;  3LAG A;  3I3Q A;  4QAW A;  1BK0 A;  1YJL A;  1CX4 A;  4C90 A;  2WT2 A;  1VB2 A;  2VOW A;  1UZW A;  3LFM A;  3DV8 A;  1SCS A;  3RSJ A;  5C9A C;  2O14 A;  3MYX A;  1R08 2;  4UFM A;  5DG2 A;  3MIB A;  4D6R A;  2VO5 A;  2JJ6 A;  2V4A A;  3C7G A;  4QPI B;  4I30 A;  4IET A;  5FYI A;  5LK5 A;  5C8C A;  4XTP A;  4Z92 B;  5DXD A;  4OI0 A;  4EWA A;  4MYE A;  1DBN A;  4LMF A;  1R1A 3;  1PO1 2;  2JXA A;  2IXJ A;  2JG9 C;  4ZS2 A;  3WNK A;  1V70 A;  3K4D A;  1OFN A;  3I2J A;  4RQP C;  5JZG A;  1POV 3;  1RVF 2;  2V4V A;  1H6Y A;  4U2A A;  5EQU A;  1OKO A;  5C3O A;  2BBV A;  3ILR A;  5FZO B;  3PL0 A;  4Y20 A;  2XL9 A;  5DAQ A;  5L9R A;  5FMC A;  2FMD A;  2VC9 A;  4Z82 A;  1NY7 1;  5FJK A;  1WD4 A;  3U0Z A;  4YVS A;  4CCD A;  4BQX A;  1RUD 2;  4M4P A;  5HCB A;  4IW3 A;  3WNM A;  3UGG A;  5BNP B;  5IVC A;  2W1U A;  1GNZ A;  5GZG A;  4G9S B;  1XYN A;  2VCM A;  1OUR A;  3NW4 A;  2YZ4 A;  2J1S A;  2ZHL A;  1UX7 A;  1GNY A;  5JVV A;  1ODN A;  2PAE A;  1FNY A;  2ZEZ A;  2DF7 A;  3MIF A;  1UNB A;  1F4H A;  1Q8O A;  3HN3 A;  5L7O C;  4FFI A;  4LIV A;  4P9X A;  3HEI A;  5JR7 B;  2UY9 A;  2JIG A;  2HWE 3;  3NQH A;  5IVF A;  3VKN A;  5D21 A;  4K8R B;  4HVO A;  1YFW A;  5LA2 A;  1A3K A;  3U14 A;  4D8M A;  1AR8 1;  1UAI A;  1W8N A;  2H0B A;  5DUU A;  4EV0 A;  3POW A;  4XBN A;  1D2Q A;  2WL1 A;  3DEC A;  4S2D A;  1C8N A;  1HXS 1;  1XRU A;  1ZA4 A;  2RV9 A;  2XVK A;  5FZE A;  2WYS A;  4ASL A;  5HV4 A;  5L7O A;  4FPH A;  2WC2 A;  1WCD J;  1LOD A;  2WNV C;  4PIX A;  3VL8 A;  1ULP A;  2NLR A;  5C4W C;  1W8T A;  1RUF 1;  2VZU A;  5DPN A;  5J3U A;  4E4D X;  2UWA A;  3OGV A;  1H9P A;  2EIE A;  4YVW A;  2K0G A;  3RS6 A;  1ULC A;  3HVD A;  4XUP A;  1APN A;  1HN1 A;  5A3M A;  4O9G A;  4MSV A;  4GB3 3;  4GJY A;  2MEV 3;  1D4M 1;  1W2U A;  5HCF A;  4PHZ A;  4YSF A;  1LES A;  1AX2 A;  4NID A;  1UZ0 A;  2NYY A;  3IAQ A;  3ZFF B;  3BI3 A;  2CDO A;  4GAZ A;  4OUS A;  3S7E A;  5A3N A;  4F3J A;  4E2Q A;  5FCC A;  4MGK E;  1AF9 A;  4FXK B;  1O91 A;  4P9I A;  3J8F 2;  1H2L A;  2C0Z A;  1GFF 2;  4BXF A;  3HR9 A;  1W6M B;  2WQZ C;  4ZS3 A;  3WP4 A;  4PBP A;  2XXZ A;  1CAX A;  2PQQ A;  1ENS A;  1Q5O A;  1Q8S A;  1H1A A;  3K77 A;  1W2T A;  5FZO A;  5LK7 B;  4L2N A;  4XFB A;  1VBE 2;  2ZGN A;  1HRV 2;  4XAC A;  3KGZ A;  2W87 A;  1W9Y A;  4XJ8 A;  1ZZ7 A;  4QXH A;  2ET7 A;  3VBO C;  4AQT A;  4ATE A;  4BME A;  1YQ5 A;  2ZGM A;  1L3J A;  2C9K A;  1F2N A;  4XXA A;  2W46 A;  3B7M A;  1VMH A;  3CZU A;  2GP3 A;  4QD2 A;  2D5H A;  3MUZ 1;  2ZCW A;  4HFS A;  2ZAC A;  5FK7 A;  3B01 A;  2JB8 A;  3N9N A;  4W50 A;  1Q8P A;  1TG7 A;  1X8E A;  4OI2 A;  2OXB A;  5FLJ A;  1DU3 D;  4IEW A;  3VDC A;  4AED A;  2OA2 A;  4N53 C;  2OW4 A;  2I74 A;  5HXM A;  3RZG A;  4DXT A;  1CZV A;  1SLL A;  2A6Z A;  4CE8 A;  1GZ9 A;  1GV9 A;  3TRS B;  4CDU B;  2CYF A;  1XU1 A;  3UK9 A;  3WX5 A;  5FIX A;  3QCW A;  4IGQ A;  4BE3 A;  4LO8 A;  3P3N A;  1UY4 A;  3C8X A;  5FLH A;  4E4Z A;  1SFP A;  4UYB A;  3N9M A;  4A6O A;  5K4L A;  5CFD B;  4LPL A;  1FV2 A;  4QB6 A;  4EE2 A;  1RUC 2;  4GAL A;  2Q8D A;  1QWR A;  2SBA A;  4AL9 A;  3AP4 A;  3M4F A;  5EWS A;  2JDK A;  1MVQ A;  4ERO A;  5BUV A;  4XYX A;  2GND A;  4AQ2 A;  2X29 A;  3AZW A;  2P5B A;  1VAM A;  4QPG C;  3D5O A;  3BB6 A;  3IPV B;  1BEV 3;  4BPZ A;  4N9I A;  1V6J A;  5L19 A;  5HCA A;  3KT7 A;  1UXZ A;  1MS8 A;  2E63 A;  4OHV A;  2BBA A;  4P02 B;  1PO2 3;  4PIY A;  5FXW A;  4AI2 A;  5F5Q A;  1PIV 3;  3III A;  2QUO A;  1FYU A;  1XE0 A;  5JXG A;  1LOC A;  4BB3 A;  3AKS A;  3JB8 A;  3H7Y A;  5EZW A;  1PIV 1;  5C3P A;  1XNK A;  2KA3 A;  5FYV A;  3RPQ A;  1OFS A;  3KLS A;  3TEX A;  2VOX A;  1OXC A;  1PX3 A;  1J83 A;  5KC5 A;  3UNP A;  2EAL A;  4PLN A;  3K51 A;  4EN7 B;  4D94 A;  4IEY A;  3VDB A;  5DZF A;  1OLR A;  3KV4 A;  1UY0 A;  3OB8 A;  4IL7 A;  1WW4 A;  2GZW A;  2YC4 A;  4N43 C;  4C1W A;  4QHZ A;  4Q4X 2;  3CHX A;  3W5M A;  4PLM A;  5FAX A;  1C8M 2;  1ZX5 A;  2GU9 A;  1WW7 A;  1W03 A;  3WY6 A;  1FPN 1;  1W2A X;  3SXW A;  2R30 A;  2VPV A;  2CWM A;  2OII A;  2OS2 A;  4Q4W 3;  3ZR6 A;  2R32 A;  2R1D A;  3LCP A;  1VBB 1;  1YEW A;  1QJX 2;  3N9L A;  1QJF A;  1G9A A;  5EJ1 B;  2PA7 A;  3WNX A;  3H50 A;  3S57 A;  1KDK A;  1O7F A;  2X09 A;  4GIQ A;  3ETQ A;  1X33 A;  4XIL A;  3CKH A;  3LE0 A;  4COU A;  1RMU 3;  1DYO A;  3OUH A;  4R8H A;  3N7J A;  4A6S A;  1CAW A;  2B4K A;  3GDB A;  3LEI A;  3RVH A;  1XSR A;  3T4H B;  4QKN A;  4OI4 A;  2FBE A;  2YBP A;  4YRD A;  4OI1 A;  4BA6 A;  2QZ3 A;  4L97 A;  1QJE A;  3KCX A;  2HBT A;  1FNZ A;  2WFP A;  4PDW C;  4QB2 A;  1B35 A;  1EY2 A;  3LDB A;  4P9J A;  3CDZ B;  1LEN A;  2ES3 A;  5CZK A;  3VKF C;  1E5R A;  2W0X A;  4Q0S A;  1HRI 2;  3THP A;  4GZ9 A;  3SH4 A;  2X5I B;  4V2W A;  1ZRC A;  1ONA A;  2E9Q A;  1PMI A;  3L2Y A;  4LHL A;  5A32 B;  4DIN B;  4XPV A;  2VW1 A;  1O59 A;  5GZF A;  2ZGP A;  3S5Q A;  3KT1 A;  2RS1 2;  3E6D A;  3ZYH A;  3ALQ A;  1FT9 A;  2FD8 A;  3HD8 B;  5JMO A;  5FKC A;  4MHU A;  1NLQ A;  3POB A;  5GKA C;  1GKB A;  2VMF A;  4JGZ B;  3KWV A;  3HQX A;  1JOP A;  2BOJ A;  3IWZ A;  5FY0 A;  1EAH 2;  1UL9 A;  3E5U A;  3O0V A;  2JKB A;  2YV8 A;  1A8D A;  1YIP A;  1VLN A;  4UF0 A;  5E88 A;  1S0E A;  1AR7 1;  2JG8 B;  2WNE A;  4QT6 A;  2ZEW A;  2LAL A;  2P6C A;  3I97 A;  2WAO A;  5CBL A;  3O1V A;  4NIH A;  5BNO B;  5CU1 A;  1SLB A;  1VB4 A;  2R04 1;  2ARE A;  2VZR A;  2R06 2;  2HWF 2;  4LUL A;  4OQ8 A;  2DBI A;  4Q4Y 2;  1PVC 3;  5KXD A;  1VAL A;  4JKL A;  2QQK A;  1R09 1;  2G9G A;  2WZP P;  4AI1 A;  1OLQ A;  2IFR A;  3SH5 A;  4CU7 A;  2B42 B;  4HVQ A;  2AZ5 A;  3USU A;  1UIK A;  2OPW A;  1BLZ A;  2PQS A;  4OHY A;  3T0D A;  1WA6 X;  3LDK A;  2CAV A;  2FCV A;  3R05 A;  1UY1 A;  1CPM A;  4Q1R A;  5A7P A;  4CA9 A;  1G9C A;  3LIH A;  3LWC A;  3I2K A;  4AWD A;  4I0A A;  2WN3 A;  1IHM A;  1CN1 A;  3W58 A;  4PLO A;  1CIW A;  4DB5 A;  3BTZ A;  1HDK A;  3NRU A;  5KC6 A;  5FUI A;  1H8T C;  3AMN A;  3PU8 A;  1YI9 A;  5LBF A;  4FOV A;  4LO5 B;  4ASK A;  1OQD A;  1UW8 A;  1ZZC A;  2RJK A;  2Y6F A;  2YY1 A;  4YYO A;  1I6X A;  3OG2 A;  1K5M C;  4Q4V 2;  2TEP A;  5TSW A;  2P4E A;  4DFS A;  3HN1 A;  1PGL 2;  1ND2 B;  4AAX A;  5T3N A;  4IUG A;  3VHR A;  4KH9 A;  4QU2 A;  3IB3 A;  1UQX A;  3VBU C;  2DVG A;  4QM8 A;  4S2H A;  2DVD A;  4BIO A;  3GBF A;  4PIZ A;  4SBV A;  2F6B A;  2ZHK A;  4F7Z A;  4KQ7 A;  5FPL A;  3O1U A;  3GHN A;  4YZ1 A;  2RDR A;  4PJY A;  2VZO A;  3WF4 A;  2R07 2;  1S4C A;  2V5D A;  4MH0 E;  4AHY A;  2W68 A;  4WVM B;  3PIJ A;  4Z07 A;  1SLT A;  2JDM A;  4LO7 A;  3O1O A;  3Q8A A;  4RGA A;  5DAW A;  5FZK A;  4UF0 B;  3WDT A;  1QQP 2;  1JS9 A;  3DYM A;  1XNA A;  3I59 B;  4TN7 A;  2IUW A;  4G4F A;  4BCU A;  4GKX A;  1OA4 A;  1KD7 A;  3D82 A;  4P9L A;  1ZZ6 A;  3Q8C A;  4XFH A;  1DGW A;  3EMR A;  3TYJ A;  5IAT A;  1UN1 A;  2VG9 A;  3C7O A;  1PHM A;  1PK6 C;  3ZXJ A;  3J7M A;  2Z5W A;  1MZE A;  4DUW A;  3JBG 3;  1XB9 A;  2A6W A;  3WEZ A;  1AR9 3;  1KS5 A;  1YFU A;  2ZHM A;  3CIH A;  4KWU A;  2OQ6 A;  3KVA A;  4CEY C;  3S7I A;  3ROU A;  1DP0 A;  4YM3 A;  3FFZ A;  4LBL A;  1RB8 G;  2R7E B;  4MO3 M;  1FPN 2;  5T50 A;  1U5X A;  3HT1 A;  1XE7 A;  3RI9 A;  2NN8 A;  4DUV A;  2VUA A;  3BGA A;  5KXE A;  1NA1 C;  1Q8V A;  1W90 A;  3WNP A;  2PHD A;  4MOA A;  3RYR A;  1QJY 1;  3B3Q E;  5E16 A;  1OC1 A;  2JE9 A;  1QH6 A;  3BCW A;  1ZRD A;  4AW7 A;  2UWC A;  1GU3 A;  4BQ5 A;  4DXS A;  1N47 A;  3T1M A;  1LR5 A;  2FQP A;  4QDR A;  4QXK A;  4FPC A;  4X6R B;  2X05 A;  1JZ2 A;  3V64 A;  2C4X A;  3VD7 A;  2VTF A;  2RVA A;  4CP1 A;  2A5Z A;  2DVF A;  4B3N A;  1X8M A;  3FUO A;  1Z7S 2;  3AKT A;  3APB A;  1MS5 A;  3C7H A;  1WGP A;  2MNG A;  3HNB M;  4MGY E;  4UW3 A;  1C3H A;  1WCS A;  2E7Q A;  2D6P A;  1QJU 3;  1QOT A;  1X50 A;  3POJ A;  3W9A A;  3A7Q A;  3CJI B;  3NAP B;  4XF1 A;  1J1T A;  2WLQ A;  4FPE A;  3MDP A;  2XJT A;  1CAW B;  3AL5 A;  1B35 C;  1AX1 A;  4FPO B;  5FUN A;  3FWE A;  2ORZ A;  1ZBA 3;  4IEV A;  4DXZ A;  3U10 A;  2D40 A;  3K75 B;  3T2Q A;  3BPS A;  1JOB A;  3RWK X;  1BYH A;  3U11 A;  5FRA A;  1BEV 2;  4YM0 A;  5DDJ 1;  2ARC A;  2V72 A;  3H3Z A;  1F9K A;  3H8U A;  4KWJ A;  1E5H A;  2QQM A;  5DDJ 3;  1XYO A;  3I8T A;  4OZX A;  2KM2 A;  3IDE A;  5FKB A;  1HQN A;  1JHJ A;  3ZYB A;  4CZS A;  5FRE A;  4XFA A;  2FHR A;  4FAG A;  3RYP A;  3A23 A;  3MI8 A;  4GB3 2;  5IVJ A;  2GME A;  3RFR A;  3W20 A;  5FZA A;  4YM1 A;  5FPB A;  1D4M 3;  4IEP A;  3ECQ A;  4CU9 A;  1YNA A;  3JZV A;  1H30 A;  4XDP A;  3ZKY A;  2DFC A;  5F3G A;  4AVA A;  4NIA A;  3ILF A;  3VZM A;  5BNN A;  3FX3 A;  3ZN5 A;  5DMY A;  1QIQ A;  4LT5 A;  5LZ6 A;  1QJY 2;  5KXC A;  2AH2 A;  5GLW A;  2VCC A;  3QLQ A;  1K5M A;  1XOY A;  2VBP A;  2W52 A;  1JMU B;  2BV4 A;  5IVB A;  2X53 S;  5KBF A;  1STM A;  4QKD A;  4WVM A;  1Y7B A;  1K42 A;  5LBB A;  4QHO A;  5F7U A;  1CPN A;  1AL2 1;  3AP7 A;  5IK4 A;  5CNA A;  4R4Z A;  4GKY A;  2BUK A;  1ZRE A;  3TNQ A;  4XCB A;  1YI7 A;  3OGJ A;  1UMH A;  4C8D A;  2KXL A;  4AFD A;  5E1R A;  2CGO A;  5I93 A;  4GH4 C;  4NR1 A;  2ZAB A;  3IT8 A;  1YHF A;  1LOB A;  2XBO 3;  4W65 A;  2VQA A;  5F2W A;  3T4V A;  2OUH A;  3KS7 A;  1O5L A;  2FMY A;  3LEK A;  4RFR B;  3ZFG C;  3WT3 A;  5BPX A;  3IZO A;  2N7G A;  3WD5 A;  4RD7 A;  2W39 A;  3H1W A;  3LOB A;  1EUT A;  1UIJ A;  4Q2F A;  2EXK A;  3SEP A;  3OUJ A;  1POV 1;  3SHR A;  2B9V A;  2VMD A;  2RMU 3;  3ZYP A;  1W6N A;  3MLL A;  3Q8F A;  3Q8E A;  3KQ4 B;  2C26 A;  1P8J A;  2GH2 A;  2WS9 1;  5BNN B;  3JB4 C;  4GWI A;  3O1M A;  4MGT A;  2WWS A;  2ZEY A;  1D2S A;  4AI9 A;  4CYD A;  1LOE A;  4XHB A;  2VGD A;  2XJS A;  4JRA A;  5L9B A;  1UWW A;  5EFU A;  1SBD A;  1HQL A;  1RUI 2;  5T52 A;  3AZY A;  3AZV A;  2QFE A;  4JGY C;  1PVX A;  5F9T A;  1DZQ A;  4YW7 A;  5IVE A;  1KFU L;  2HWD 2;  4K1Z A;  1UPI A;  1ND3 B;  2K9Z A;  5SV5 A;  4A7Y A;  4HOO A;  1CAX B;  3BIE A;  1BBT 1;  2E32 A;  2QE3 A;  3MIE A;  3WZ1 A;  1SEF A;  5A3L A;  2BQP A;  2CHH A;  3BIW E;  5A7O A;  3O12 A;  2C24 A;  5LBC A;  3ZN6 A;  4J1X A;  1HV1 A;  1O3R A;  3L9J T;  5CVR A;  4CDX B;  2ZMK A;  4AVT A;  3NV4 A;  5F3C A;  1PZ8 A;  1SLA A;  1CON A;  4XFI A;  2HEW F;  2QQW A;  2D6K A;  3PVN A;  4FOW A;  4FBF A;  1PNG A;  3GNE A;  5EXO A;  3HQR A;  4JGZ A;  5ERL A;  4Y5S A;  1R1A 2;  4IEQ A;  1GOG A;  2IXC A;  1SZB A;  4AVV A;  3CJI A;  2GH8 A;  1GOH A;  5D8A A;  5ABJ C;  1OA3 A;  1GUI A;  5ANQ A;  1IQD C;  1XXN A;  3GAL A;  4XZP A;  5FBZ A;  2ARA A;  4CP0 A;  1JYN A;  1QNW A;  4COZ A;  5IAX A;  2IXK A;  1W8Z A;  1BEV 1;  3EB7 A;  4I3P A;  1AYM 3;  1UKR A;  1V0A A;  3A22 A;  3ZFE A;  3PJQ A;  5CFC C;  4A41 A;  4PCR A;  1VRB A;  2WQ4 A;  1DYP A;  4H7M A;  3AB0 A;  2Q4S A;  1W3X A;  3SCH A;  1GBG A;  3WF1 A;  3D0J A;  3SKJ E;  4BQ1 A;  3WDU A;  2P3K A;  2HYK A;  1OHF A;  4O61 A;  2WSV A;  3O0W A;  4RN5 A;  1NCR B;  2WUH A;  3T2P A;  1RUO A;  3RNS A;  1S0F A;  2GAU A;  4CVU A;  4P5Y A;  1JU4 A;  1F35 A;  2JDH A;  2XUE A;  1W04 A;  2YHJ A;  2IXI A;  1OA2 A;  4L92 A;  3VDD B;  2D43 A;  4YVS B;  2R07 3;  3N4M A;  5ISL A;  3AFK A;  3VBS C;  5IK7 A;  4BXS V;  1JOD A;  1G6N A;  1M4W A;  1I5Z A;  3K3O A;  4CCE A;  4YFZ A;  5L9V A;  4CEW A;  1UPS A;  4RFT 0;  1DQ2 A;  1G7Y A;  4H3W A;  2WAA A;  5FMO L;  3OGR A;  4OMD A;  1NLR A;  1SAC A;  3OF1 A;  4B7E A;  3RGB A;  4CXW A;  5JZG B;  1VMJ A;  4GB3 1;  4L99 A;  4YW5 A;  1QXP A;  1OH3 A;  1UY2 A;  1FOD 3;  3I59 A;  1ND2 A;  3IM0 A;  1WCQ A;  3PUA A;  3JD7 1;  1RUD 3;  2WT0 A;  3R4U A;  1OPO A;  1WBF A;  3C7E A;  2DTY A;  5C7G A;  5C8C B;  2ZGU A;  2EIG A;  1TEI A;  1VMF A;  4LJH A;  1QU0 A;  3LSD A;  3B69 A;  1L7Q A;  2B8M A;  4RQP A;  2ID4 A;  2RR1 2;  1QJX 1;  1W9W A;  1XNB A;  2A6V A;  2TUN A;  2VZ3 A;  5F37 A;  3BU0 A;  1RED A;  1PO2 2;  1YC6 1;  2HWF 3;  2Z69 A;  2Y26 A;  3AX4 A;  4RR3 B;  4IE5 A;  5EYX A;  1IKQ A;  4NRM A;  1W0O A;  2PYT A;  3LDR A;  2KD7 A;  1E5S A;  1JYI A;  5LCW L;  2ZXQ A;  2YRO A;  2YYO A;  1IZ3 A;  5FYH A;  4AFM A;  1GP5 A;  3U4S A;  1MQT A;  4BZ4 A;  4Q4X 1;  3VB9 A;  4JCK A;  4XUN A;  5A6Y A;  3FZ3 A;  2Q8E A;  1VBC 2;  2XPJ A;  2JKX A;  5J48 A;  4FP2 A;  1BK1 A;  5JSO A;  3J8F 3;  1SLI A;  3NJX A;  3EHK A;  5FOJ B;  4IE7 A;  1GP6 A;  1GZC A;  2GMP A;  2YGL A;  5ACA 3;  4IV3 B;  5AFE A;  4Y1X A;  1UMZ A;  4DPN A;  3WQ7 A;  5FXZ A;  1IS6 A;  1QH7 A;  1UZV A;  2VMG A;  5C71 A;  5BV6 A;  4BM8 A;  2R16 A;  3ON7 A;  1FMD 2;  2W95 A;  2ZGQ A;  3VBU A;  1DZR A;  2GAL A;  3MF6 A;  4CEY A;  4IE4 A;  2W2I A;  3ZSL A;  2C5D A;  2VVD A;  4PF1 A;  2JIC A;  1R1Z A;  3ZYI B;  4MVT A;  2AEZ A;  3WP3 A;  1CQ9 A;  4OHX A;  3R4D B;  1G9F A;  1GQP A;  4YW6 A;  4UWD A;  2W3J A;  3IIA A;  4MGZ E;  3ZXA C;  5FO7 B;  1XNC A;  4BQ4 A;  3LA3 A;  3PMS A;  4AGV A;  4KBZ A;  2ZGR A;  1J58 A;  4ET7 A;  5HXV A;  2X5I A;  1JZ3 A;  3POY A;  2WNU C;  4M3C A;  4QKF A;  3FHI B;  3JD7 2;  4FP3 A;  4BK5 A;  1PO1 3;  2GNM A;  4KGG A;  3OCP A;  2VMI A;  1XPW A;  4L11 A;  2Q30 A;  2PEL A;  4MXV A;  2WZR 1;  2A3W A;  4MHR A;  2V5Y A;  2YBK A;  4Q4W 2;  1C5I A;  2JDU A;  1OVP A;  3KF5 A;  5FR3 A;  2HWC 1;  1OD5 A;  4AXO A;  4Y22 A;  3UKV A;  4D6S A;  3M7A A;  5JPN B;  2WA4 A;  3EBR A;  2RS5 2;  1F5F A;  5T54 A;  2W1Q A;  1V9U 3;  3WNO A;  2Q0A A;  2VBD A;  4AFB A;  3M3O A;  4R9B A;  4YVW C;  2D6M A;  3K46 A;  3ZFE C;  4GUL A;  4DO0 A;  1NY7 2;  3PIG A;  5FFO C;  3BVC A;  2P6H A;  2Q1M A;  1W0P A;  2R07 1;  2P1B A;  2R04 2;  1W3V A;  3MW4 A;  1AR9 2;  4XET A;  2IFW A;  5F6K A;  5FUP A;  3ZSK A;  5LY1 A;  3V0A A;  4UOJ A;  4E8D A;  1CAU B;  1SHW B;  4ES9 A;  4FXG B;  3MID A;  3POI A;  4M0H A;  5A3P A;  1HJG A;  3UET A;  2QQI A;  4PQQ A;  5FY7 A;  4UI9 L;  2R06 3;  3H3U A;  5K0U C;  3AZX A;  5D8A C;  2VOK A;  2JDA A;  3ZXE A;  3WUD A;  4IEZ A;  3ZDS A;  1LTE A;  3CF6 E;  2D44 A;  1JHN A;  4E4H A;  3KM5 A;  4IEU A;  2OUJ A;  5FMB A;  5DUW A;  4XF9 A;  3J8F 1;  4RS5 B;  4YLZ A;  1XE8 A;  1OF4 A;  4AOC A;  1R08 1;  2Z2S B;  2BW8 A;  3B94 A;  1TNR A;  5LWB A;  2A70 A;  3AVS A;  1BJQ A;  1W8O A;  4XDQ A;  4M3C F;  4UW4 A;  1AYN 1;  1DZT A;  1W2N A;  4WM8 C;  5C6C A;  3I3M A;  3MFC A;  2ZML A;  5FZ6 A;  1SPP A;  3LZZ A;  4HG6 B;  3K4A A;  1EAH 3;  4LTA A;  1HB1 A;  1HW5 A;  4FTS A;  4Y24 A;  4GWM A;  2E33 A;  2WWJ A;  1O8P A;  3ZIW A;  3FLP A;  1YIF A;  2EXH A;  4LOR A;  1S2K A;  5GLV A;  3MLK A;  2GSY A;  5LAS A;  3ORJ A;  3HOB A;  4NAM A;  5FZH A;  3VBR C;  3VZL A;  1BZW A;  1UX6 A;  2CSG A;  1O6U A;  1LNS A;  1XC6 A;  2WBK A;  4M0N A;  4QGN A;  4RGG A;  1HB3 A;  3VD3 A;  2Y0O A;  2HWD 1;  1U12 A;  4AI0 A;  2ENR A;  1SMV A;  1OVS A;  1XBF A;  2RJ2 A;  3SQO A;  2XLF A;  5IT6 A;  4XF4 A;  3VKM A;  2YC0 A;  4AEJ A;  2PHF A;  4XQW A;  3UYJ A;  4EN6 B;  3RZJ A;  5FPV A;  1WCK A;  4JX0 A;  4LR4 A;  2BNM A;  2WNO A;  3TWI A;  3RZK A;  5C5U A;  4AED B;  1KQR A;  3NMB A;  1ULO A;  1RUI 1;  4ISR A;  4Y20 B;  4XAA A;  3V65 A;  3VD9 A;  5CKN A;  5F8P A;  4ARX A;  1RJ8 A;  5KHH A;  1ULF A;  3HBZ A;  2XHK A;  2RS1 3;  4YZ3 A;  3ATG A;  1MPX A;  3D6E A;  3WG2 A;  3M3C A;  4H7L A;  3I54 A;  3WDY A;  4BU2 A;  2WS9 2;  2Y6L A;  4R9D A;  3BYW A;  2OYZ A;  2EAA A;  2J1V A;  5JIA A;  4BHP A;  1J3R A;  3ZSJ A;  4BOW A;  2WAB A;  3CL1 A;  4C0B A;  2I07 B;  4FFF A;  1C57 A;  3IKW A;  4GD4 A;  2ARX A;  2D3R A;  4A4A A;  1OOP B;  2VQ0 A;  4A3Z A;  5HI0 A;  1LOF A;  3VBF C;  1RUH 2;  5FLI A;  1GWM A;  2CTV A;  3P1I A;  5JOY A;  3H8R A;  1VE0 A;  4LBQ A;  3VBR B;  4ZZ5 A;  2P34 A;  3PDQ A;  3OSD A;  4CDW A;  1W6Q B;  3RZM A;  2W5F A;  3HT2 A;  3NJZ A;  5FQ0 B;  1AL2 2;  1IPS A;  2DWR A;  3NV2 A;  2JDZ A;  1ENR A;  4UW6 A;  5G05 L;  3VZK A;  3MBW A;  1B09 A;  3BKZ A;  4AQS A;  5L73 A;  4NUB A;  5DAB A;  5C5T A;  2YU1 A;  2XDV A;  1O8S A;  1VBB 2;  1MS0 A;  1PGW 2;  2FDK A;  2XKP A;  4JTN A;  1F8V A;  4WM8 B;  3ES4 A;  1T2X A;  2VW2 A;  1KRI A;  1OUX A;  4LUK A;  4W8J A;  1MS9 A;  2A3Y A;  1NXM A;  5A7S A;  3WDV A;  5AFB A;  3AJZ A;  1TZO A;  5ABJ A;  1TVG A;  2LTN A;  2BNN A;  3JBG 2;  2XLA A;  4RS5 C;  3DGT A;  4D7T A;  1NCQ C;  2XJR A;  3SCF A;  4PQ9 A;  2LUW A;  3CQO A;  3ZSE A;  2XG3 A;  3G7D A;  5JXJ A;  4N7I A;  1TMF 3;  4LHS A;  2J1E A;  2ATF A;  2G4I A;  1LRH A;  3ZYF A;  3VHN A;  4ZZ8 A;  4COV A;  3AP9 A;  4Q4V 3;  3I2G A;  4LIU A;  5FBJ A;  3THD A;  5JPM B;  4A42 A;  4OMC A;  3FE5 A;  1ZZB A;  4KG8 A;  3VD5 A;  3R0R A;  2DFB A;  5GAL A;  3H7J A;  1DLL A;  4GWN A;  5FYY A;  2E6V A;  1Z0H A;  2IC1 A;  4UBH A;  3V0B A;  1REE A;  3ZFE B;  2DCJ A;  4YVW B;  1BVP 1;  5HV0 A;  1HV0 A;  2BOI A;  1MS4 A;  3BU7 A;  4LE3 A;  1LHN A;  1RTV A;  5I0T A;  4Q4X 3;  3OBA A;  4M00 A;  1V6M A;  1AXY A;  3PU3 A;  4RSU A;  1GYK A;  1HB4 A;  1T6B X;  2WIN B;  3R6S A;  3PJY A;  1GP4 A;  1QOS A;  1HKD A;  4H55 A;  4MX3 A;  4QB1 A;  5LAT A;  1RUC 1;  3GGL A;  4FOY A;  1MEC 2;  1QJU 2;  4CEW C;  1UYP A;  4XFF A;  2UYB A;  2XJP A;  3LB9 A;  5LA0 A;  4XC9 A;  1HRV 3;  1AR7 3;  1QJX 3;  1JW6 A;  1Z7S 1;  2WNU B;  2R0F A;  4GQ7 A;  4J25 A;  2W08 A;  1JZ4 A;  3ZMN A;  3ITQ A;  1JUH A;  1ZBA 2;  4BQ3 A;  4JC1 A;  2RS3 3;  3D4K A;  2Y8K A;  2XLG A;  4IES A;  4AHW A;  2Y60 A;  5LA1 A;  3VN4 A;  1ND3 A;  1L7R A;  3CNA A;  4I01 A;  1H6X A;  1T6G C;  4LKF A;  1H4H A;  1XQN A;  1RJ7 A;  2B7Y A;  4JVA A;  2VNR A;  3DYO A;  1YJK A;  4LNV A;  4XJ9 A;  5FTT C;  3TN9 3;  4XHX A;  4FPF A;  4FQZ A;  4IV1 C;  5GZD A;  4XTM A;  5JR2 A;  1JYV A;  1C1L A;  3GJA A;  4FPL A;  4AF9 A;  2W1S A;  4IV3 C;  1HRV 1;  1NZI A;  4MAD A;  1RUE 3;  1CJD A;  1PM4 A;  1QQP 3;  5CA6 A;  1W6Q A;  5C3R A;  5FMO S;  2ZX4 A;  1UXX X;  1BXH A;  5I91 A;  1YRZ A;  1H8V A;  3P3P A;  1LCL A;  5JSR A;  3T1L A;  2PFW A;  1VIW B;  3N7M A;  2AAC A;  4NRO A;  4ZON A;  1YQC A;  1J84 A;  1ENQ A;  5IFT A;  1OLM E;  4ORF A;  4UFK A;  1FAT A;  4NPM A;  4XXP A;  3WG4 A;  2GC3 A;  4UFH A;  1GAN A;  4QPG A;  5H9Q A;  4B29 A;  4QMA A;  5FO8 B;  4ZHN A;  4FPY A;  2Y64 A;  1CAV A;  2D6N A;  4MUV A;  4YW2 A;  3GXU A;  4E2G A;  1PX4 A;  2W1W A;  5T55 A;  1LHW A;  2GC1 A;  3EQE A;  1URX A;  3VBH A;  1AYM 1;  4Y4Y A;  4Y33 A;  5F5C A;  5JAX A;  1FOD 2;  2Y33 A;  2BFU S;  4XF3 A;  1D4V B;  1KDM A;  2ZGL A;  4P9G A;  1VRH 3;  1O4T A;  4DIQ A;  1OF3 A;  4E27 A;  4TWT A;  1ZBA 1;  3ACH A;  3M8L A;  3UGF A;  2PHW A;  1HN0 A;  4QGL A;  4LBM A;  3DF0 A;  2WZ8 A;  3GCW A;  4R4X A;  1PK6 A;  5C8C C;  4AVS A;  3NWK A;  1UKG A;  3GYD A;  3RDI A;  5F39 A;  2EIC A;  3PHM A;  2A6X A;  3VDD A;  1PGL 1;  3ST7 A;  1RVF 1;  2BGP A;  2AEY A;  4QQH A;  2I45 A;  2WNU A;  3NV3 A;  5FP9 A;  3NKG A;  2Y6H A;  2EAK A;  3WDW A;  2WT1 A;  4EWE A;  1KJL A;  2QNK A;  5JWP A;  4OHW A;  1WBL A;  3GM8 A;  4LLO A;  4EN9 B;  3N9Q A;  3VBS B;  2VZV A;  4YVS C;  2J1T A;  1LOA A;  5GM0 A;  5FZF A;  1ASJ 1;  1DGR N;  2P3J A;  5H9S A;  3VDD C;  3GBW A;  3S6P A;  1RXG A;  5IHR A;  3CLP A;  1W9T A;  3GJB A;  4MGS A;  4CTE A;  1NCR C;  2OVU A;  3OD0 A;  1LUL A;  3B5L B;  4B1L A;  1R1A 1;  1ULG A;  4LHN A;  3WW3 A;  5K7P A;  3V0B B;  3MO4 A;  2PHR A;  4CXY A;  3AKQ A;  3GZU C;  5GZC A;  2Y34 A;  2QQU A;  2ZTN A;  1UOJ A;  5DG1 A;  5I0R A;  3MGU A;  5IYY A;  1FAY A;  3TEZ A;  1R09 2;  2FDJ A;  2VEC A;  1ALY A;  2HWD 3;  3AKP A;  5APA A;  2VCB A;  5I8S A;  1QDC A;  1ZA7 A;  4Q4Y 1;  4KGQ A;  4AQ6 A;  1BMV 2;  3IDC B;  5H9R A;  2HWF 1;  4BLJ A;  5FZ4 A;  1AYN 2;  1HRI 3;  2Z79 A;  2HH9 A;  4B1M A;  4QPW A;  4HKW A;  1TNF A;  5FYT A;  3HNY M;  4CDX A;  3AMM A;  4KU7 A;  4LO6 B;  1CX1 A;  3DXT A;  2NPI A;  5J7M A;  5ABJ B;  1F4A A;  2XBO 1;  4LA3 A;  3MHZ A;  3RG0 A;  1H4G A;  4DXR A;  5A7W B;  3RMX A;  3FHQ A;  4MGQ A;  4ZXK A;  4OHZ A;  3ZXF A;  4BQW A;  4AVB A;  3UV9 A;  4D6Q A;  2P37 A;  1HB2 A;  1OBN A;  3BN6 A;  3I3B A;  4RA0 A;  2XJQ A;  2WDB A;  1ZRF A;  4O9E A;  3MIH A;  1ZRI A;  2H0V A;  3SMH A;  4BMB A;  2BYV E;  2NMN A;  3QH6 A;  4RHV 1;  1Q56 A;  4CDX C;  4Q8K A;  1EP0 A;  2VBB A;  4ISQ A;  1W06 A;  4MV2 A;  2HEY F;  3I2D A;  5FPA A;  5KHK A;  2VNV A;  5FQ0 A;  1NKG A;  2RS5 3;  1SBF A;  2VQT A;  1ND3 C;  1BKZ A;  1SDW A;  2BPA 2;  3B02 A;  2RS5 1;  5FYB A;  2J42 A;  4WZC A;  1S0G A;  2OZ6 A;  5I8Y A;  5IVV A;  1RUI 3;  2GN3 A;  1YLL A;  4JGY B;  1K12 A;  2WO1 A;  2K2S A;  2R04 3;  2VTX A;  5IFP A;  2ZZJ A;  3AL6 A;  4L0P A;  4D69 A;  2V09 A;  2BVB A;  1RUH 3;  1VPH A;  2CGN A;  3N9O A;  4XOG A;  3DKQ A;  4E4S A;  1CWP A;  1DIW A;  3WG1 A;  2O8Q A;  3IPV A;  5E89 A;  3UES A;  3ACL A;  1UU4 A;  1QNY A;  2W9X A;  5FYU A;  3MIC A;  4LK6 A;  2ZA9 A;  2LM3 A;  3OEB A;  4RHV 3;  3THC A;  2IZW A;  1GIC A;  1SFY A;  1W6O A;  4I02 A;  3N3H A;  1WLD A;  2J1R A;  4HKO A;  4XBL A;  4N53 A;  3F95 A;  4FAH A;  2OX0 A;  3F2Z A;  5C8W A;  1ODM A;  1Q3E A;  2JEC A;  1VR3 A;  4RGK A;  2LRP A;  1UU6 A;  2OPK A;  2FCT A;  4XFG A;  4OQ9 A;  4CP2 A;  5JCT A;  1ACC A;  1BHG A;  5DZG A;  2VH9 A;  4W4Z A;  5BNP A;  3E6C C;  3M3E A;  4Y26 A;  1NG0 A;  1SQ4 A;  2PTM A;  4YZ4 A;  2IVJ A;  5FYS A;  3WR0 A;  4TLG A;  2JDN A;  2DUO A;  1LGC A;  3VHP A;  1V00 A;  1FMD 1;  4IQP A;  3POE A;  3AFG A;  4CP9 A;  4D0Q A;  1GQH A;  5J09 A;  1UYY A;  4CUA A;  4GH4 B;  4N7U A;  1RUG 2;  1A6C A;  2WZE A;  4Q1P A;  3ZKU A;  2DYC A;  4Y3O A;  2O1Q A;  1D0G A;  1S0B A;  4P08 A;  4LKS A;  1XU2 A;  5ACA 2;  4JZR A;  2W94 A;  2H6C A;  3OBZ A;  5FY5 A;  2WKK A;  4AHZ A;  4RYD A;  3UJO A;  4XZU G;  4YG0 A;  2VOV A;  4Z2W A;  4HAN A;  4M3C E;  1XJA A;  2ZHN A;  4CUB A;  3UGH A;  5FPX A;  4TLF A;  5C70 A;  1AJK A;  4IXL A;  4IV1 B;  5GJ6 A;  3POF A;  4N43 A;  1H8T A;  3OYW A;  2VOT A;  2HWE 1;  3V56 A;  2CNA A;  2G1M A;  2ILM A;  1JYT A;  2GC2 A;  3NJY A;  1W28 A;  2VUD A;  5CYY A;  4FT8 A;  4HMZ A;  5EYY A;  3W59 A;  2NMO A;  4A7K A;  3A21 A;  1DHK B;  2FZ1 A;  1QJY 3;  2VZP A;  3HPN A;  4AEK A;  2BFU L;  2RR1 1;  1ZNP A;  3FN9 A;  2D97 A;  3K4Z A;  4QPY A;  2AC1 A;  3NNM A;  4QX8 A;  3H8O A;  2X10 A;  4CCM A;  4AI3 A;  1GZW A;  4XMA A;  1VBD 3;  2QQO A;  1U5Z A;  1UOG A;  1V9U 2;  3VBF A;  3Q8B A;  1AR9 1;  1WA4 A;  2VXJ A;  4ZKT B;  4LKE A;  3EO6 A;  5GLT A;  3RJ2 X;  3WQB A;  1J3P A;  3KQR A;  3C3V A;  4CEW B;  1EYB A;  2JE7 A;  4IE6 A;  4CCC A;  5JOX A;  3AXE A;  1G9D A;  4MGI E;  3ZDV A;  1W2O A;  3KV5 A;  2VMH A;  1NYW A;  3IN9 A;  1WME A;  1U5Y A;  2P17 A;  1EPW A;  1ZYB A;  4O7X A;  5F1R A;  1O3S A;  3MV0 1;  2HWC 2;  3U75 A;  5DAV A;  3GZA A;  1QKQ A;  1W9S A;  3WCS A;  1NCR A;  1RIR A;  2EF6 A;  2R49 A;  1W0N A;  1UYZ A;  4IER A;  1DDL A;  4U36 A;  4AK3 A;  1RUE 2;  3GF6 A;  1DFQ A;  4Y1Z A;  1UOB A;  4FTB A;  2B9U A;  1CJP A;  4IND A;  5FZD A;  5CAZ A;  1KIT A;  2WWU A;  2IWG B;  1H2M A;  1MEC 1;  3GBG A;  2J1U A;  4K1Y A;  1ZRR A;  2VMC A;  1HJF A;  3OPW A;  4N9H A;  3BOD A;  5F2S A;  4TYS A;  1NCQ B;  2WFF 2;  4IEX A;  4AEM A;  4NHY A;  3OGS A;  3R4S A;  1WWY A;  4XBQ A;  3VBS A;  2PLV 1;  3AJY A;  3WW4 A;  3H9A A;  3CZJ A;  5CG9 A;  1LAJ A;  4A3X A;  1QQP 1;  2RM2 2;  2C1F A;  2BNO A;  5EIY B;  5KR7 A;  1W05 A;  2HWB 3;  3W21 A;  1UO9 A;  4DNY A;  4IGP A;  4W6W A;  1IG0 A;  2QTW B;  4XE9 A;  1YWK A;  4CEY B;  3WP5 A;  2BU9 A;  3O1S A;  2VL4 A;  3PME A;  4XEZ A;  3EJK A;  4R9A A;  4LUM A;  4X8P A;  5IW0 A;  1IKP A;  3WF0 A;  1CD3 G;  1KGY A;  4LXL A;  4QU1 A;  1RUG 1;  4CU8 A;  4COY A;  3AMQ A;  4OUL A;  2D93 A;  3KV9 A;  1OQE A;  2C6S A;  1G9B A;  3PTY A;  3U78 A;  2CDP A;  1PK6 B;  2YGM A;  4JAA A;  5J96 B;  2DUQ A;  4N90 A;  5D1I A;  1NUK A;  2XB6 C;  3JQX A;  1OUS A;  5FP4 A;  1WMD A;  2WJS A;  4HSL A;  1MVE A;  1HXS 2;  4HBN A;  2VZ1 A;  3E5Q A;  3WP6 A;  5BNO A;  4GMP 3;  3S0M A;  1BBT 2;  1RIN A;  2GMM A;  2KR2 A;  3VBF B;  3CBN A;  4A7Z A;  1OOP C;  1ST8 A;  4Q8L A;  2D6L X;  1JZ5 A;  2A75 A;  3O14 A;  4EQV A;  1JYX A;  5JMC A;  5FXX A;  4EZH A;  2DCZ A;  5ANN A;  3RYK A;  4A2U A;  3AKR A;  3ENR A;  2WYF A;  1O3T A;  5HCH A;  4HKL A;  4OZO A;  1AR6 2;  3AMH A;  2W92 A;  1HIX A;  5BXX A;  4COW A;  4WVW A;  3N35 A;  4BK4 A;  4WBB A;  3GHM A;  3WF3 A;  2L9L A;  3I4I A;  5FOB B;  2EVX A;  1LOG A;  2QQN A;  4HON A;  4AED C;  4CCO A;  3JU9 A;  2G9F A;  1J59 A;  3ELN A;  3I7D A;  4C0H A;  4FPJ A;  5A6Z A;  4UAP A;  3D0S A;  4YGB A;  5A33 B;  3M3Q A;  4QX1 A;  3MZH A;  1DQ6 A;  4XUT A;  2VW0 A;  1UZZ A;  1V6I A;  3NNJ A;  1WW6 A;  5KHI A;  4SLI A;  2HKX A;  3IMN A;  1YQ8 A;  5LBE A;  5G04 L;  5FY4 A;  1VBB 3;  4AI8 A;  5C33 A;  3VZN A;  3AZZ A;  2VVF A;  5A6X A;  1ULE A;  3QH7 A;  1LU2 A;  2MEV 1;  2QQV A;  5DAP A;  1YFX A;  1LEC A;  1WUV A;  3MV1 1;  1LGN A;  4Q0U A;  2WS9 3;  4Y5T A;  1RMU 1;  4CDU A;  4DRR A;  2EA7 A;  3O7O A;  5AVP A;  4Q4V 1;  4K40 A;  3H42 B;  1O5U A;  1K3I A;  3OD4 A;  4LK7 A;  4XIK A;  5DUV A;  2E31 A;  2E7T A;  2VUC A;  1WLW A;  3WUC A;  4QM9 A;  2V73 A;  3PTR B;  4XIO A;  1HQW A;  2CGP A;  2RR1 3;  5DUX A;  3W5N A;  2WA3 A;  4ZXE A;  3RQ0 A;  1IGO A;  1S0I A;  1E57 A;  1V6N A;  3AYD A;  3LKJ A;  2ZEX A;  2P2K A;  3HBK A;  4HK9 A;  2WO3 A;  1VBA 2;  2XWJ B;  5M0T A;  5J1X A;  3ZM8 A;  4B7K A;  4MXW A;  5A32 A;  1VRH 2;  3PVB B;  4BH9 A;  4I0W B;  2JG8 C;  2YPD A;  4F8A A;  2YB7 A;  2ZAH A;  3LOI A;  2BDR A;  2VY0 A;  4JTO A;  4W6X A;  1GMM A;  1YO8 A;  3VDA A;  5FYZ A;  5LEK A;  1POQ A;  2Q8O A;  2FDH A;  4Q4W 1;  4JGZ C;  1N3O A;  5D8A B;  5K0U B;  5T5J A;  4S2G A;  3RZL A;  3TN9 1;  2GNT A;  3BTX A;  2RHP A;  2A7A A;  4PF5 A;  2ZX1 A;  4Q0V A;  4DRV A;  3H8X A;  1ASJ 2;  4RL7 A;  1SBE A;  3ACG A;  4AZZ A;  3KMH A;  1JZ7 A;  1WLC A;  1SDD B;  3DUI A;  2JD9 A;  3ZFF A;  1X82 A;  2W91 A;  1NAE A;  4LBO A;  4NHX A;  3DXU A;  4FPG A;  1FMD 3;  1AR7 2;  2OQ7 A;  1DF0 A;  3AP6 A;  5FZC A;  4PDW B;  5FY1 A;  1PMJ X;  3WQ0 A;  3WCR A;  5CIS A;  4R52 A;  3PNA A;  3LGR A;  3ZYJ B;  2O0O A;  5FZL A;  3SCG A;  3OOX A;  1NZC A;  4Q27 A;  1W8H A;  3LD8 A;  3T3Y A;  4CPB D;  5A80 A;  1IPK A;  1K45 A;  2RS1 1;  3KGL A;  1W8W A;  2QBX A;  4AE2 A;  1R09 3;  1KXG A;  1ZBE 3;  2UWB A;  1UMI A;  4GMP 0;  3WNN A;  4DUX A;  1OD3 A;  2VM9 A;  4PI2 A;  3PUQ A;  1SFN A;  1U0A A;  5FY9 A;  4LHK A;  4L9B A;  3M2M A;  3JD7 3;  4K9S A;  4LBQ D;  5CKM A;  5FDB A;  1JBC A;  4NPL A;  3NV1 A;  1AYN 3;  2DUR A;  3NO8 A;  5KHG A;  3M1H A;  1CZS A;  4OCT A;  4BQ2 A;  3IDA A;  5EV7 A;  3NJV A;  1CZT A;  4NII A;  3G6J B;  4WVV A;  3OBR A;  1K5J A;  1VBC 1;  1IS5 A;  1R08 3;  2VNG A;  3ZIX A;  3MFA A;  4FVV A;  1OOP A;  3T0B A;  5IAV A;  4XJW A;  1C5H A;  5I8T A;  4N43 B;  4K21 A;  4NVP A;  2J22 A;  2WFF 1;  2P3I A;  5FP8 A;  1RUJ 3;  1CES A;  5DQ0 A;  3PUR A;  4S2F A;  4Q29 A;  5LY2 A;  4MXW B;  5JI7 A;  1UYX A;  4QQO A;  3TAY A;  3MW3 A;  3LEG A;  1RUJ 1;  3QOP A;  3FLR A;  4DMI A;  5LB6 A;  1OPM A;  1RUE 1;  4BYY A;  5I0U A;  3OPT A;  5LW9 A;  2JEM A;  1I1E A;  3O1R A;  1KS4 A;  3LPF A;  2ZGT A;  4ITC A;  4L8Q A;  5CB7 A;  3ETP A;  3NNG A;  3BOP A;  4IE0 A;  5T5P A;  3PVO A;  4FFG A;  4NHL A;  2YFZ A;  4Z1V A;  3TNP B;  2JG9 A;  3RJR A;  1TMF 1;  5CAD A;  4JHT A;  4RR3 C;  1VBC 3;  2XWB B;  5CFD C;  2ZOE B;  3AYC A;  4LO4 B;  4D7S A;  2DUP A;  3WQ1 A;  4CUC A;  2CY6 A;  1WZX A;  1MEC 3;  3FMG A;  4QX0 A;  5A33 A;  3RWN A;  4CDU C;  1MZ6 A;  2LW8 A;  2WQ8 A;  1TME 1;  2RM2 1;  1VBE 1;  2D3S A;  4GXL A;  3ZXK A;  2YDE A;  4O65 A;  3VKL A;  3WG3 A;  4KL1 A;  1CGP A;  2ZX3 A;  5F32 A;  4P00 B;  1RHI 3;  2JDP A;  5E6H A;  2PLV 3;  1SPP B;  3K3N A;  3OUI A;  3VHO A;  5JZG C;  4P9W A;  1X36 A;  1W6P B;  4JGY A;  1FV3 A;  2RS3 2;  4Y1U A;  1GQG A;  2XVL A;  3RRD A;  3ILN A;  4Y1Y A;  1PO2 1;  3WW1 A;  5A3U A;  4NJ4 A;  5F3E A;  1FX5 A;  3ZO0 B;  4HET A;  4NIG A;  1RXF A;  5LRR A;  1JN2 P;  2Z42 A;  2RDQ A;  4Z2A A;  1KEX A;  5JOZ A;  5K9Y A;  4KWL A;  1Y9M A;  4AG4 A;  5FK8 A;  3TN9 2;  5D2A A;  3LSE A;  3U1X A;  3SEE A;  4EWD A;  2J1A A;  2BRT A;  1DYK A;  2JX9 A;  3KT4 A;  4FI9 A;  5DN2 A;  5FZI A;  3ZXG A;  5B4N A;  2BWC A;  3E1F 1;  3J4U H;  3AP5 A;  2W47 A;  3JBG 1;  3HQU A;  1JOJ A;  3I3D A;  2YUE A;  2YXS A;  3GZT B;  3J9S A;  1REF A;  4NPR A;  1X9P A;  1COV 3;  1NXD 1;  1VRH 1;  2XQR A;  3WHU A;  3ZFF C;  4TXW A;  3RI8 A;  5A1F A;  2WII B;  3DPR A;  4UFJ A;  4V2V A;  1C8M 3;  5C4W A;  4LOT A;  5CFC B;  3BUC A;  4LOS A;  1RVF 3;  2DCY A;  1EUU A;  2QDN A;  3D3A A;  4HL0 A;  4NWW A;  4XVH A;  2QCS B;  1C28 A;  2R0H A;  4GA9 A;  4GJZ A;  4TSV A;  3TB0 A;  3MF9 A;  2E26 A;  1DQ1 A;  3FBY A;  2A6Y A;  3J7H A;  2DU0 A;  5C4W B;  2DBN A;  2WRA A;  5CFC A;  1AL2 3;  1AJO A;  2ZGK A;  4HLT A;  2F4P A;  5CKQ A;  1Z78 A;  4E8C A;  1Y3T A;  2NM1 A;  3EYP A;  2AEN A;  2UUR A;  2EID A;  2WNV A;  2WNV B;  3M70 A;  4M3C B;  1SCR A;  1OMI A;  4JQT A;  5EPA A;  4ZY9 A;  4BLI A;  4ARY A;  2AYH A;  1BVV A;  2DVA A;  2XVG A;  3ZYG A;  2RG4 A;  2B39 A;  2RE9 A;  5FZM A;  4C1X A;  4UBG A;  3FFQ A;  4PDW A;  4OLL A;  1LEM A;  5JDB A;  3TEW A;  3HWJ A;  3QAC A;  3KB5 A;  3I2F A;  3JQW A;  2OZJ A;  3PUI A;  2UYA A;  4NN0 A;  3ZLI A;  3ASI A;  2VZQ A;  3FL7 A;  3KV6 A;  3SLI A;  4XDO A;  3LA2 A;  1DGR A;  4CPB A;  3NNL A;  2NP0 A;  3N7K A;  4CCJ A;  3OPZ A;  4DS0 A;  2VQU A;  4NOT A;  5FYC A;  2VD7 A;  2K46 A;  4CCL A;  4CRQ A;  2QJV A;  4XUR A;  3LIG A;  4YGE A;  4K20 A;  5BNN C;  5AC9 3;  3USS A;  1ZZ8 A;  4AVC A;  2WFF 3;  3CU7 A;  5BNP C;  1W39 A;  4BDV B;  1UD1 A;  4CCK A;  1QMJ A;  2EIB A;  3T30 A;  2A3X A;  1H2K A;  2E53 A;  2R6Q A;  3ABZ A;  3AYE A;  2WN2 A;  5FYM A;  3VZO A;  3H0O A;  4E9K A;  5KXB A;  1AXZ A;  2WLP A;  4FTE A;  3PUH A;  3IDB B;  1NLS A;  2Z4F A;  4Q4Y 3;  3CMG A;  3A4U A;  3ZFG B;  2G19 A;  3N9P A;  2J7M A;  2TBV A;  2B46 X;  1HLC A;  1SG3 A;  5EP9 A;  4RQP B;  3E97 A;  1RC6 A;  4G3Y C;  2JG9 B;  3WVJ A;  1PZ9 A;  3ZOI A;  2BGO A;  1YUD A;  1AUY A;  2FDF A;  1MR5 A;  1GLH A;  2WSU A;  1PNF A;  1IQA A;  3NNF A;  4MET A;  2XML A;  5AC9 1;  1JH5 A;  1YXW A;  3T2O A;  4KG0 A;  4DOU A;  4XUO A;  4C91 A;  4QPI C;  1D7P M;  3VUO A;  4LEJ A;  5C9A B;  2XL7 A;  1OLM A;  3MUY 1;  4ZU4 A;  3NL1 A;  5J37 A;  1LKN A;  5JOW A;  2PXJ A;  1RUF 3;  2PHU A;  2NQY A;  2R06 1;  4JRL A;  3DCQ A;  5F6L B;  2IXL A;  2RDS A;  5AVA A;  2XJV A;  3S30 A;  4E2S A;  2QQP A;  3EXU A;  1NQJ A;  2BER A;  4K8F A;  4XJA A;  5FZB A;  4CP9 B;  4YFW A;  4GWJ A;  4HSJ A;  1AR6 3;  4QDS A;  4XF0 A;  4HT1 T;  4QGM A;  4N8M A;  4K3U A;  1PO1 1;  4YG6 A;  3U37 A;  3X29 B;  3VD4 A;  4FO9 A;  3VBH C;  1RMU 2;  4LKD A;  3SNM A;  2DU1 A;  1AR8 3;  5FZ3 A;  4H2A A;  2VVE A;  4QXB A;  2Q8C A;  2B5H A;  2MEV 2;  2FCU A;  3N36 A;  5IK5 A;  2B45 X;  1FI2 A;  4B4Q A;  3UL2 A;  3ZXL A;  3UKN A;  1VAV A;  2FDG A;  1H1M A;  2ZPX A;  2HWC 3;  4WM7 B;  4P5H A;  3WIN E;  2PHT A;  1LOF C;  4OVE A;  1FXZ A;  2DCK A;  2CU5 A;  5FZ7 A;  1VBD 1;  1YYN A;  1DQ5 A;  4QQP A;  4I3G A;  5KWR A;  2MHF A;  3DPR C;  4FSJ A;  5I0D A;  1V6O A;  5FZ8 A;  4CDQ B;  1OH4 A;  2FDI A;  3FC0 A;  5F5I A;  1RYY A;  4BQY A;  2WZR 2;  1TMF 2;  4HXC A;  4QWN A;  4XAE A;  4BIF A;  1B35 B;  1X7N A;  3WNL A;  2QZ2 A;  2RMU 1;  3AM2 A;  4UT5 A;  1IS4 A;  1LJ7 A;  4HVR A;  1GNH A;  1TE1 B;  4OUM A;  4BIS A;  4TTG A;  1DCS A;  3NAP C;  3CJI C;  3H3L A;  3THT A;  4HK8 A;  4YZ2 A;  1H1I A;  1AR6 1;  3I3E A;  2XQX A;  1GWK A;  2CWS A;  5FWJ A;  1OQ1 A;  2VAU A;  5J36 A;  2QVS B;  1LGB A;  4ZU5 A;  5H9P A;  2UU8 A;  2VZS A;  1KFX L;  4LLF A;  1QF3 A;  5E8A A;  3A0K A;  5IWF A;  4A44 A;  5FXV A;  4D3W A;  4YAR A;  1XYP A;  3I49 A;  1POV 0;  3B00 A;  1VBA 3;  3GCX A;  4JDO A;  2RS3 1;  2PHL A;  4K6B A;  1WMX A;  4AFC A;  3J7N A;  1Q43 A;  2ADE A;  3JXS A;  3KHB A;  4GMP 1;  2ZKN A;  2HWE 2;  3IAP A;  4KWK A;  3T08 A;  4V1P A;  3LEM A;  3VZJ A;  3ZN4 A;  1CAU A;  2GC0 A;  4PI0 A;  1ZVF A;  4ATF A;  1JZ8 A;  1JYC A;  1NA1 B;  1VJ2 A;  2E51 A;  2TNF A;  1IG3 A;  1NE4 A;  4UW5 A;  2H6B A;  3O5S A;  1JTZ X;  1CVN A;  1US2 A;  1NX9 A;  1U5I A;  2MPF A;  4QDQ A;  1TME 3;  1W8F A;  3ACF A;  2DV9 A;  1F31 A;  4JDN A;  1O4Z A;  3HIF A;  3ZX7 A;  5ACA 1;  1ENX A;  5KHJ A;  1JZ6 A;  1FOD 1;  1RHI 1;  4YGD A;  3LA7 A;  3ZMO A;  2ZX2 A;  3U07 A;  1EV1 3;  2Q1Z B;  4ES8 A;  5EJZ B;  4WV8 A;  1RUG 3;  4LBQ B;  3VBR A;  1PMH X;  4TZD A;  2AR6 A;  2D98 A;  5GLU A;  1JI6 A;  3M3I A;  4Q0P A;  3SIS A;  4CU6 A;  3OEA A;  4J1W A;  1Y4W A;  1RIT A;  4URT A;  3MPP G;  5T5O A;  2PLV 2;  3VBO A;  2GP5 A;  3CJX A;  5FPU A;  1C4R A;  1N1Y A;  1ZZ9 A;  2ADD A;  2VZT A;  2YPJ A;  2ZJC A;  4EJR A;  1W99 A;  4AGG A;  4J6G A;  1OI6 A;  2PAK A;  3AK0 A;  4B4P A;  5K8S A;  1S2B A;  5A1L A;  5CIR A;  2DDU A;  1OSG A;  2YC2 A;  4M01 A;  4DY5 A;  3D8C A;  4UFI A;  3ZVX A;  4P9Y A;  3POG A;  4BWO A;  4WVZ A;  1GZW B;  2XJU A;  4NRP A;  1J1L A;  4KI5 M;  5C9A A;  2Y0I A;  4XJZ A;  4GH4 A;  2O8O A;  1A8M A;  2AUY A;  4DEQ A;  2XKO A;  2ZGO A;  1S1A A;  3VBU B;  3OY8 B;  1CAV B;  3HAG A;  1US3 A;  4FCA A;  2HWB 1;  4B8E A;  2HLE A;  3INA A;  5FP3 A;  4AAP A;  1ND2 C;  1A34 A;  1RUN A;  4CSW A;  5EHD A;  3MW2 A;  4Q5O A;  1K5M B;  1EV1 1;  4IV3 A;  1X9T A;  5HPO A;  3L2H A;  3O0X A;  4FFH A;  5FZ9 A;  5BYN A;  1VBD 2;  1WMF A;  3RZZ A;  4AR2 A;  1W6P A;  2PN5 A;  2BJS A;  1LHO A;  2CL2 A;  4QKB A;  4X8N A;  2Y6J A;  1Y43 B;  2NZ9 A;  1NT0 A;  3VV1 A;  1H8T B;  1WKY A;  2JWP A;  3OYW B;  1XNT A;  1VBA 1;  4OUE A;  4YNI A;  3ZFG A;  3BOW A;  4YZ5 A;  5LEJ A;  2XHN A;  3BTY A;  4XCA A;  4LA2 A;  1D0H A;  1GR3 A;  2Y6K A;  1AL0 G;  4AGR A;  1MQT B;  4CUG A;  1I9R A;  4F83 A;  5B2G B;  5C3Q A;  5CG8 A;  1FPN 3;  2QQJ A;  2HYX A;  3UKT A;  1GOF A;  5I0S A;  4NWV A;  3TEY A;  1GWL A;  1CIY A;  1MZ5 A;  1YQ2 A;  3HJR A;  4QX5 A;  3DYP A;  4CDW C;  3HNM A;  1IS3 A;  3B9C A;  5SV8 A;  2XBO 2;  1ZBE 1;  2WO2 A;  2OT7 A;  1W9F A; 
#chains in the Genus database with same CATH homology
 1OF4 A;  4OZO A;  2X09 A;  2W92 A;  1W8O A;  3CKH A;  4BK4 A;  3LE0 A;  3WF3 A;  2L9L A;  1DYO A;  2QQN A;  2B4K A;  3GDB A;  3LEI A;  4HG6 B;  3K4A A;  4QB2 A;  2E33 A;  4LQR A;  1O8P A;  4UAP A;  3CDZ B;  3T0A A;  4QX1 A;  5CZK A;  4XUT A;  4GZ9 A;  3HOB A;  5G04 L;  2JE8 A;  1O59 A;  1XC6 A;  1LNS A;  2WBK A;  3VD3 A;  5JMO A;  2RJ2 A;  2VMF A;  3MV1 1;  4JKK A;  4YPJ A;  1K3I A;  3FHA A;  2E31 A;  4JX0 A;  2XON A;  2ZEW A;  3I97 A;  2WAO A;  1ULO A;  2BZD A;  5IJR A;  3W5N A;  4ZXE A;  3VD9 A;  2VZR A;  2ZEX A;  2WO3 A;  1DLC A;  4ARX A;  5J1X A;  3ZM8 A;  2XOM A;  4PT6 A;  4JKL A;  2QQK A;  4CU7 A;  1MPX A;  2YB7 A;  2Y6L A;  1GMM A;  2VME A;  3VDA A;  2PQS A;  2J1V A;  3T0D A;  1UY1 A;  2WAB A;  4A4A A;  4A3Z A;  3ACG A;  3P1I A;  3I2K A;  3ACI A;  2WN3 A;  4ZZ5 A;  1JZ7 A;  3NRU A;  1SDD B;  2JD9 A;  2W5F A;  5FUI A;  2W91 A;  1NAE A;  5G05 L;  3MBW A;  2YG0 A;  1PMJ X;  1I5P A;  3OG2 A;  1O8S A;  3WSO A;  1UY3 A;  4AAX A;  1T2X A;  4IUG A;  3IB3 A;  4DEV A;  4OYU A;  3LPG A;  1K45 A;  4W8J A;  2QBX A;  3WNN A;  1UMI A;  4DUX A;  1OD3 A;  2VM9 A;  1TVG A;  2VZO A;  3WF4 A;  4A45 A;  2V5D A;  3WF2 A;  3CQO A;  5JXJ A;  4LHS A;  1CZS A;  2J1E A;  2ORX A;  3IDA A;  3NJV A;  1CZT A;  2YFU A;  4ZZ8 A;  3I2G A;  3THD A;  3DYM A;  4A42 A;  4OMC A;  1XNA A;  3T0B A;  4QX2 A;  3VD5 A;  2J22 A;  4KMQ A;  3SKV A;  3C7O A;  2QQL A;  2DCJ A;  5DQ0 A;  1UYX A;  4DUW A;  3LEG A;  3WEZ A;  3OBA A;  3CIH A;  4KWU A;  4M4R A;  2VCA A;  4QB1 A;  3GGL A;  1DP0 A;  3LPF A;  2R7E B;  4MO3 M;  3ETP A;  3NNG A;  4DUV A;  3BGA A;  3WNP A;  5LA0 A;  4MOA A;  2YFZ A;  1JZ4 A;  5JXI A;  1GU3 A;  4DXS A;  4XUQ A;  4QDR A;  2Y8K A;  2X05 A;  1JZ2 A;  2C4X A;  3VD7 A;  5LA1 A;  1OT5 A;  2RVA A;  2VTF A;  3LQC A;  1L7R A;  3HNB M;  1H6X A;  3C7H A;  4CUC A;  4QX0 A;  2LW8 A;  3A7Q A;  2WQ8 A;  3DYO A;  3T09 A;  2OKX A;  3I2H A;  3AC0 A;  5JR2 A;  1JYV A;  4P00 B;  2W1S A;  4MAD A;  4JHZ A;  2ORZ A;  5B4X A;  1UXX X;  3K75 B;  3T2Q A;  1J84 A;  5IFT A;  2V72 A;  2QQM A;  2Y6G A;  1KEX A;  4Z2A A;  2Y64 A;  4AG4 A;  3P6B A;  3GXU A;  1PX4 A;  1R64 A;  2W1W A;  1JYW A;  1JHJ A;  3SEE A;  2J1A A;  4FI9 A;  5DN2 A;  5B4N A;  3A23 A;  3E1F 1;  2W47 A;  2VR4 A;  3I3D A;  1OF3 A;  3ECQ A;  4CU9 A;  1JU3 A;  3ACH A;  5JUV A;  4TXW A;  2WZ8 A;  3I2I A;  4JKM A;  5DMY A;  4QX3 A;  2EIC A;  4BJ0 A;  2VCC A;  1EUU A;  3D3A A;  2BGP A;  2VJX A;  4XVH A;  2Y6H A;  1K42 A;  2E26 A;  5F7U A;  3GM8 A;  3J7H A;  1UMH A;  2LS6 A;  4E8C A;  2VZV A;  3EYP A;  2EID A;  2J1T A;  5JXH A;  4ZY9 A;  4ARY A;  5IHR A;  3LEK A;  1W9T A;  4MGS A;  5EJ1 B;  1EUT A;  3C7F A;  3MO4 A;  3SEP A;  2B9V A;  2VMD A;  5IYY A;  3I2F A;  3PUI A;  2VZQ A;  3FL7 A;  2VCB A;  2C26 A;  5A1A A;  1P8J A;  4QAW A;  4GWI A;  4QPW A;  2ZEY A;  3HNY M;  1CX1 A;  2VQU A;  4XUR A;  2VO5 A;  1F4A A;  1UWW A;  3C7G A;  4DXR A;  3FHQ A;  4MGQ A;  3BN6 A;  3I3B A;  2WDB A;  3WNK A;  4BDV B;  3K4D A;  3I2J A;  2EIB A;  2V4V A;  1H6Y A;  3ABZ A;  2WN2 A;  2E32 A;  3PUH A;  2Z4F A;  3CMG A;  2VC9 A;  2J7M A;  1NKG A;  2VQT A;  1SG3 A;  4M4P A;  3WNM A;  2BGO A;  2W1U A;  1K12 A;  2WO1 A;  5IFP A;  1GOG A;  3T2O A;  4L0P A;  1GOH A;  4XUO A;  2J1S A;  1D7P M;  1UX7 A;  1GUI A;  1GNY A;  1IQD C;  3MUY 1;  3UES A;  2W9X A;  2ZEZ A;  1JYN A;  1F4H A;  3HN3 A;  3OEB A;  3THC A;  3EB7 A;  3HEI A;  3A22 A;  4A41 A;  3NQH A;  2BER A;  2J1R A;  4GWJ A;  3F2Z A;  5LA2 A;  4QDS A;  3WF1 A;  3SKJ E;  3U37 A;  3VD4 A;  4D8M A;  1W8N A;  1BHG A;  4W4Z A;  3DEC A;  4RN5 A;  3T2P A;  2WUH A;  2RV9 A;  2WYS A;  4CVU A;  4P5Y A;  1JU4 A;  4D0Q A;  1UYY A;  2DCK A;  4CUA A;  1ULP A;  2WZE A;  4BXS V;  2VZU A;  5DPN A;  4P08 A;  4LKS A;  2W94 A;  3OGV A;  2WAA A;  5I0D A;  2EIE A;  4RYD A;  4XZU G;  3OGR A;  1OH4 A;  1RYY A;  4OMD A;  4XUP A;  4CUB A;  1HN1 A;  1UY2 A;  5C70 A;  3WNL A;  1WCQ A;  2VOT A;  4TTG A;  3C7E A;  5C7G A;  1UZ0 A;  3IAQ A;  5CYY A;  2CDO A;  3I3E A;  2XQX A;  3A21 A;  1L7Q A;  2ID4 A;  2VZ3 A;  1W9W A;  2VZP A;  3HPN A;  2VZS A;  4A44 A;  3FN9 A;  3K4Z A;  3K77 A;  2KD7 A;  2X10 A;  3JXS A;  5LCW L;  2ZXQ A;  3IAP A;  2W87 A;  3T08 A;  2QQO A;  1JZ8 A;  4XUN A;  3WQB A;  2C9K A;  2JKX A;  1US2 A;  1NX9 A;  2W46 A;  4QDQ A;  3ACF A;  3CZU A;  3MUZ 1;  3NJX A;  1JZ6 A;  3MV0 1;  4W50 A;  1TG7 A;  3VDC A;  1W9S A;  5EJZ B;  5HXM A;  4DXT A;  1CZV A;  1PMH X;  5C71 A;  1JI6 A;  2W95 A;  1W0N A;  4CU6 A;  1UYZ A;  3OEA A;  1UY4 A;  2VZT A;  3C8X A;  4PF1 A;  1W99 A;  4A6O A;  1GQP A;  4LPL A;  2W3J A;  2J1U A;  4QB6 A;  2DDU A;  2VMC A;  2YC2 A;  4ET7 A;  1JZ3 A;  3OGS A;  4BK5 A;  4KI5 M;  3CZJ A;  1XPW A;  5EIY B;  4DEQ A;  1UXZ A;  4P02 B;  2BBA A;  1US3 A;  2HLE A;  3III A;  2VL4 A;  5JXG A;  3WF0 A;  5HPO A;  1KGY A;  2W1Q A;  4CU8 A;  1PX3 A;  3WNO A;  1J83 A;  2Y6J A;  3UNP A;  2CDP A;  3K46 A;  1WKY A;  3VDB A;  1NUK A;  1XNT A;  1UY0 A;  3OB8 A;  4OUE A;  2XHN A;  2YC4 A;  2Y6K A;  3W5M A;  2VZ1 A;  4UOJ A;  4E8D A;  1SHW B;  3UET A;  2QQI A;  4PQQ A;  1JZ5 A;  4UI9 L;  2QQJ A;  1JYX A;  2HYX A;  2JDA A;  1GOF A;  1CIY A;  1YQ2 A;  3HJR A;  3DYP A;  3HNM A;  2WO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...