4QB6A

Structure of cbm35 in complex with aldouronic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
128
Chain Sequence
TGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
total genus 29
structure length 128
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb6A00
5A1AA 4GWIA 5IJRA 4MGQA 4QX3A 3VDAA 1K3IA 3U37A 2V5DA 1RYYA 3T0BA 2WN3A 3THCA 2BGOA 1J83A 1JZ8A 1CZVA 2RVAA 1F4HA 3BGAA 1JZ5A 4XZUG 1JU3A 4XUOA 2VZSA 4PT6A 5C70A 4IUGA 2V4VA 3WSOA 2XHNA 2J1EA 3A7QA 1US2A 4ARYA 2WZ8A 3HNYM 3T2QA 3K4AA 4HG6B 2YC4A 1UWWA 3I3DA 3T0AA 2W95A 2DCKA 2OKXA 2WO2A 3WF3A 4A44A 2BBAA 2R7EB 2YG0A 3WQBA 1LNSA 2WUHA 4W8JA 2EIEA 3VDBA 3I2KA 3C7OA 4ZXEA 3WNNA 4BXSV 3I2IA 3WNKA 1W9WA 3C7EA 2RV9A 3T2PA 2ORXA 5EIYB 2L9LA 3PUHA 1HN1A 1GOGA 1OT5A 5FUIA 1O59A 2JDAA 2WQ8A 2QQKA 5JXHA 2EIBA 4DUVA 1P8JA 3MO4A 1UMIA 1UY1A 3I2JA 2CDPA 4LQRA 3C8XA 3IAQA 1JI6A 1JYWA 1MPXA 3DYPA 2PQSA 2WAOA 3NQHA 4RYDA 3T08A 2DCJA 3P1IA 4Z2AA 4MO3M 3WNOA 5IYYA 3THDA 2J1TA 1GU3A 1US3A 2W1QA 2ZEXA 4BK4A 1W8OA 3IAPA 1CX1A 3CZJA 1JYVA 2JD9A 5J1XA 4OMDA 3I97A 3LPGA 1L7QA 3LEKA 3OGRA 5JMOA 5B4XA 3A23A 1PX3A 3VDCA 4LPLA 4QX0A 4QDQA 1WCQA 1UMHA 3C7HA 2XONA 1KGYA 4W50A 3K75B 1SDDB 1OD3A 3CMGA 4OUEA 1UY3A 1UY2A 3MUZ1 2HLEA 3I2FA 2J1SA 2W92A 4ZY9A 4XVHA 3W5NA 4ET7A 4CVUA 4LHSA 5DMYA 1O8SA 3WNPA 2VQUA 2QBXA 2Y6HA 1BHGA 2X09A 1UYZA 2Y8KA 4XUTA 2LW8A 5DN2A 5LCWL 3ACHA 1CIYA 5I0DA 3NRUA 3DECA 2X10A 1K12A 4CU7A 2W91A 2VM9A 2VZ3A 3K46A 2J1VA 1UY0A 4A4AA 3ACFA 3WF1A 3I3EA 1K45A 5DPNA 5JXJA 3VD4A 1JZ3A 3FHAA 3MV11 3EYPA 2WN2A 1W0NA 1OF4A 1JHJA 1NKGA 2YFUA 2WZEA 1OF3A 2ZEYA 2QQLA 2W9XA 3IDAA 3OGSA 1GOHA 4OZOA 5LA2A 4YPJA 3SKJE 3OB8A 3FL7A 3HPNA 3SEPA 2E32A 5F7UA 4DUXA 1JZ2A 3W5MA 2C4XA 2J22A 3HOBA 4KWUA 2VO5A 2WO1A 4CUAA 3MUY1 3MV01 3OG2A 3OBAA 4D8MA 5EJZB 1F4AA 2QQJA 2DDUA 2E31A 2W1SA 3NJXA 4A3ZA 3JXSA 1JU4A 2VMFA 2B4KA 4E8CA 2ZXQA 3I2HA 2Z4FA 2J1RA 3VD5A 5HXMA 1T2XA 3LEIA 3BN6A 2ZEWA 4JKLA 1UYXA 2VZVA 2VMDA 4A41A 3D3AA 4A42A 4TXWA 2C26A 4CU8A 1SHWB 3ACGA 2E33A 3C7FA 3HN3A 5JXIA 4JKKA 4W4ZA 4DXRA 3CIHA 3OGVA 4DXTA 3P6BA 4UI9L 2BZDA 2VCCA 3OEAA 1YQ2A 3WNMA 1PX4A 1ULOA 5EJ1B 1UXZA 2WAAA 3MBWA 2HYXA 2W1UA 5C7GA 2ZEZA 1UY4A 2W1WA 1XNTA 4PQQA 1XNAA 2B9VA 4P02B 2WYSA 2W46A 1JZ4A 4D0QA 2VZ1A 2VZUA 3E1F1 4MGSA 1J84A 1GMMA 2YB7A 2VZQA 4BJ0A 5IFPA 3A21A 3DYOA 4GWJA 1GUIA 1L7RA 5HPOA 4ZZ5A 4CUBA 2VC9A 2VCBA 4M4RA 3GDBA 5LA0A 4BK5A 1CZSA 4XUPA 3CZUA 2Y6KA 1NAEA 2C9KA 1KEXA 4CU9A 1TG7A 4QX2A 4XUNA 1EUUA 1CZTA 2VR4A 4MOAA 5C71A 1W8NA 1K42A 2LS6A 2EICA 2E26A 3VD7A 3FN9A 4JX0A 3WNLA 2VCAA 4DUWA 1WKYA 2QQOA 4P00B 1W99A 1R64A 4TTGA 2WABA 4CUCA 1NX9A 3WF0A 1H6YA 3LE0A 3OEBA 4A6OA 2RJ2A 4JHZA 5G05L 1JZ7A 2JKXA 4XUQA 2W5FA 2V72A 1I5PA 4KMQA 4ZZ8A 3LQCA 2WDBA 3UNPA 2YFZA 3K77A 1UZ0A 4DEVA 3CDZB 3GXUA 2Y6GA 5JXGA 3UESA 2WBKA 4UOJA 1SG3A 2W47A 3ACIA 3ABZA 1ULPA 3A22A 2VZPA 3K4DA 4KI5M 5DQ0A 3NJVA 4GZ9A 4BDVB 5LA1A 4JKMA 2Y6JA 1UXXX 2CDOA 1O8PA 1TVGA 2W94A 2VZRA 1NUKA 2VQTA 1UX7A 3DYMA 3T2OA 2Y6LA 2ORZA 1DYOA 5CYYA 3SKVA 4ARXA 4A45A 2VMEA 4E8DA 3SEEA 2JE8A 1GNYA 2VTFA 4QX1A 1DLCA 4M4PA 4QB6A 3CQOA 5G04L 2KD7A 3GGLA 3J7HA 3HNMA 3VD3A 2WO3A 2VJXA 1JYXA 2QQNA 2X05A 4P08A 4OYUA 5B4NA 4QPWA 4QAWA 3LEGA 3WF2A 3HJRA 2W3JA 2VZTA 4LKSA 2XQXA 2XOMA 2Y64A 4RN5A 1XC6A 3I3BA 3C7GA 4AG4A 2EIDA 3EB7A 1H6XA 3T09A 1PMJX 1PMHX 1GOFA 1EUTA 1XPWA 4DEQA 3K4ZA 1DP0A 2W87A 3WEZA 4AAXA 2J1AA 4P5YA 3NNGA 2BGPA 3LPFA 3T0DA 1W9TA 2YC2A 5JR2A 4QDRA 3FHQA 3IIIA 3IB3A 4PF1A 4QB1A 3WF4A 1JZ6A 1OH4A 2VOTA 4CU6A 3F2ZA 3I2GA 1GQPA 1D7PM 1W9SA 2J1UA 1UYYA 3HNBM 4QB2A 5IHRA 4MADA 4FI9A 2VMCA 2QQMA 2VZOA 4XURA 3HEIA 4QDSA 4OMCA 3ZM8A 4UAPA 4DXSA 3ETPA 3AC0A 2ID4A 2J7MA 3ECQA 5CZKA 2BERA 1IQDC 3CKHA 3GM8A 5JUVA 5IFTA 1JYNA 3UETA 3PUIA 2VL4A 3VD9A 4L0PA 2QQIA
chains in the Genus database with same CATH superfamily
2WSUA 2JEMA 4GWIA 5E16A 4MGQA 1DHKB 1VRH3 1K3IA 1PGSA 2WS91 3ZFEB 1HB2A 1MS4A 1OXCA 4M0NA 2D5FA 4XQ4A 5IK4A 2XBO3 2BFUL 2BGOA 4UFIA 5BNPC 4ONUA 5BNNB 3KGZA 5FZHA 5A3WA 4QQPA 4DFSA 1F4HA 3TEZA 4CP2A 4MYEA 2OZJA 2R16A 1GWMA 1RXFA 2GDFA 2GC3A 5CKMA 4ATEA 4AYUA 4D7YA 4YGBA 1S0BA 4EZHA 1DDLA 2NMOA 2IXIA 2Z5WA 4PF5A 4YVWC 1ULEA 2VZSA 4QMAA 4EV0A 2JICA 5C70A 1YXWA 2ZGLA 3ZMOA 2MNGA 2D40A 3WXPA 1KJLA 1ZBA1 2PHUA 2V4VA 1X9TA 1LHOA 3WSOA 4GALA 3T4VA 4GB31 2WNUA 4LBLA 4EYUA 3CJIB 4Z1VA 3WW2A 2W0XA 4R9CA 5BYNA 2I2SA 1VBC2 1RUG1 3VZMA 2WZ8A 3MFAA 3T2QA 1GQGA 1R091 4L9BA 4NPRA 2YC4A 4I01A 4Q4W1 1UMZA 1VMFA 4ZS3A 2DCKA 3PNAA 4LBMA 5JZGB 2FDGA 1RUC3 2CWMA 1TNFA 2QCSB 4AI9A 5CFDB 2I74A 5T5PA 2BBAA 1H8TC 1D2QA 1W3VA 1Z7S2 1HQNA 2PFWA 4K6BA 5JSRA 4PLMA 1TQ5A 2FMDA 5A1LA 5DAQA 2BNNA 3I2KA 4PDWB 3C7OA 3WLUA 3WUDA 2OA2A 4BXSV 3S57A 2HWC2 3C7EA 4LBOA 4S2FA 3RRDA 3T2PA 1LJ7A 2E9QA 1OKQA 1AR93 5IK8A 3PUHA 1HN1A 1WCUA 4HLTA 2HH9A 3KVBA 2PMWB 4HK9A 1OT5A 2VQ0A 3SCFA 1IPSA 4A7KA 5JXHA 4FOVA 1UQXA 4NPMA 1ZZBA 1P8JA 1SPPA 2PXJA 3O1TA 1QDCA 2WYFA 1WMFA 1E57A 1HB4A 5LBEA 1W6OB 3HN1A 1C1FA 4LQRA 2QKDA 4CE8A 1CAUA 4M3CB 2XUEA 4K1ZA 5K4LA 2PQSA 3U78A 5L7OC 4PLNA 1H8TA 4YW7A 1O7FA 3AXEA 4AE2A 4QPYA 2DCJA 3ME2A 4HVQA 5JDBA 2ZX0A 4Q29A 1DQ6A 1IPJA 4AFCA 2Q0AA 4IV1B 1LOEA 1GU3A 1WWYA 5B2GB 1DGRA 1DQ0A 3KVAA 4JVAA 3WP6A 1SFPA 4FXKB 2WZR1 3D5OA 5DXDA 2IXLA 1YWKA 2Y0IA 4HFSA 2QJVA 1JYVA 2XMLA 4OMDA 4CEWA 2A70A 2ZMKA 3JBG2 4YFZA 2A6ZA 4Q27A 1NA1C 5FPUA 4GQ7A 4GB33 1UKRA 4KQ7A 4BWOA 3ZFGC 3ZXLA 4LPLA 3HT1A 1UPSA 3ZYJB 1RUG3 2BU9A 4YM2A 3UT0A 3W20A 4W50A 3PUAA 3ZSKA 3K75B 3BCWA 3PIJA 1R093 1SDDB 3HBKA 1CD3G 3DF0A 4Q4W3 1UY3A 4IEYA 3MUZ1 1ZVFA 3I2FA 2N7GA 2VMHA 4ZY9A 2IWGB 4XVHA 1JHNA 3W5NA 5FO7B 4S2GA 2CSGA 4CYDA 3FHIB 3BPZA 5FYBA 4CDQC 2ZGSA 1REEA 3AYEA 5FPVA 4D6SA 3U4SA 4FSJA 2QTWB 1COV1 2PLV1 4XUTA 1OOPB 2P17A 2UYAA 1V70A 1YQ8A 1NOVA 1RHI2 2NQYA 3AP6A 1CIYA 1J3QA 1WMEA 3GCXA 5FZ8A 3K48A 3NRUA 3VLBB 5GZCA 3LB9A 1B35B 4LNVA 4AI3A 1UZWA 4CU7A 5A7NA 5JOXA 2VZ3A 3K46A 3NKTA 3Q8CA 3OPTA 1UY0A 4QGMA 1RUF2 2SBAA 3ACFA 3WF1A 4AL9A 3VBRC 1GSLA 1RUJ2 3I3EA 3T1MA 4IE5A 2XL7A 1BK0A 4B4QA 4CP9A 2BEOA 4Q4V2 4LR4A 4XFGA 3AMHA 4NAOA 1JZ3A 1F8VA 3R4UA 2ZCWA 1RL3A 2XLFA 1A6CA 1W8WA 1RUE2 2JX9A 5F3GA 3EQEA 1NKGA 1SMVA 4YFWA 3AKPA 1K5MC 1IOAA 4E9KA 4HANA 2ZEYA 2QQLA 1NY71 2W9XA 3KV6A 5LA2A 2P4EA 4CTEA 4Y22A 3SKJE 3IDCB 5KXEA 3OB8A 5LEKA 4O61A 2HEWF 1HXS1 1F15A 2E32A 2QDNA 3SEPA 5F7UA 3W5MA 4Z07A 2UWBA 2ZX4A 3MIHA 2WZR3 2VO5A 1XNDA 3NV3A 4CUAA 1QNWA 3OBAA 2DU0A 2ZMLA 3M2MA 3MDPA 1YCIA 2DDUA 5FJKA 4JHTA 2OUJA 3ZYGA 4A3ZA 4CDXA 4NWVA 2VMFA 1W8TA 4OZXA 2ZXQA 3FFQA 1FI2A 2VNGA 2RDNA 1GZWA 1MEC1 3VL8A 1GNZA 1Q5OA 5FYVA 3VD5A 3KD4A 3PMSA 4DOUA 3D0SA 4FP3A 3N35A 3BN6A 3KCCA 1J3PA 1WUVA 5T5JA 3ZYFA 2VMDA 1UF2C 2Q5TA 5FOJB 5D8AA 2C26A 2G1MA 2D6PA 4FO9A 1N47A 2VOVA 4GJYA 5FYMA 3ACGA 4K20A 4L97A 4AEJA 2K46A 4YSFA 3OUIA 2A73B 1QJU1 4W4ZA 3RZJA 4ZS2A 5FKBA 1WLTA 3LZZA 3OGVA 3AZVA 3LF7A 5GLVA 1WCSA 2MHFA 2MPFA 2IFRA 2XVGA 5FQ0A 1COV3 4PHZA 4UI9L 2BZDA 2VCCA 4BYYA 3DXTA 1IS3A 3OEAA 1YQ2A 2GP3A 4TYSA 3WNMA 1CJDA 1YC61 3BVCA 4LHLA 4HT1T 4YW3A 3PVNA 2ARAA 1VBB1 1SLLA 2P3IA 4YZ1A 5L9RA 2RS52 2AGSA 2WKKA 1MACA 3AP4A 3PURA 5T54A 4BB3A 4GH4B 3MBWA 4EN8B 2HYXA 4CRQA 1AJOA 3R0RA 1UY4A 1ZNPA 4JGYC 2A6WA 5E88A 1WD4A 2B9VA 2RJKA 1XBFA 3QH7A 4I02A 1FXZA 1QH7A 2DTYA 3KF5A 3PU3A 4W6XA 2WYSA 2B9UA 5FLJA 5LBFA 3D8CA 1POQA 1AL21 1QIQA 3BOPA 3APBA 2VZUA 3ZXDA 4D0QA 1Q8OA 3E1F1 4QKFA 3CEWA 4FPFA 5IATA 1DQ2A 4MVTA 5JLVA 4HMZA 2VNOA 3AZZA 5FWEA 4BCUA 5J3UA 1BQPA 1RUD2 3WOGA 5IK5A 2HWF2 4W6WA 4YLZA 1HXS3 3QOPA 1KQRA 1JBCA 1MZFA 5IFPA 2R6QA 1D4M2 3AXDA 2ETEA 5FZMA 3B9IA 5FK8A 4X6RB 3VBOC 2O8QA 3H0OA 3OUJA 1Y9GA 3AVSA 2X53S 3LDRA 2FCUA 5BPXA 5CVRA 4C90A 5C4WC 2VCBA 4LHKA 3FUQA 2XUMA 3LOIA 4AQTA 5A32A 1POV0 3PJYA 5GLWA 3THTA 4FTEA 3ZO0B 4QKDA 2PHWA 1ZRCA 3R6SA 1OD5A 3MIEA 4NRPA 4BK5A 3L2HA 4URTA 3UJOA 4BOWA 1MEC3 4O65A 1KD7A 5L73A 2ZKNA 4SBVA 5EWSA 1H4GA 4RA0A 2Y6KA 2GAUA 4RS5B 4LOTA 5A3MA 2CTVA 1LOFC 5D2AA 1CZTA 4XCAA 1WGPA 2D6MA 3NSTA 3RYKA 5EYXA 3U14A 2E26A 4UT5A 3VD7A 3FN9A 3TB0A 2A3XA 4AQSA 3ZN5A 5E6HA 2RR12 2XLAA 1WBFA 5CAZA 4RR3B 1LEDA 2YZ4A 3T3YA 1QJU3 2A1XA 2AC1A 4M3CE 3CO2A 2BNMA 1W99A 4Y1VA 3RDIA 4FFGA 2HBUA 2HYKA 4TTGA 1WCDJ 5FZ3A 2HEVF 5IVVA 2C6SA 4DNYA 1GICA 2RJ2A 4D69A 4KWLA 4TZDA 5GJ6A 4DMIA 1NZIA 3OYWB 2YGMA 2FMYA 4FQ4A 4YVSC 1VRBA 2YU2A 3QH6A 3SH3A 4AXOA 1SLIA 2Q8EA 1QJX1 2A3WA 2V72A 4KMQA 4XF1A 5IVYA 4IEVA 3BTAA 5A7QA 5KXBA 1H9PA 3OSDA 2EIGA 2WDBA 3D0JA 4LBNA 3RG0A 5FZ4A 1H30A 2YFZA 3KCYA 4Y1XA 1VBB3 4CUGA 4DEVA 3VHOA 3TNPB 3WP3A 1AX2A 3GXUA 2Y6GA 3ZFEA 3ILRA 4CDUC 5HI0A 1LOFA 3EO6A 2GH2A 4O7XA 3V0AA 2PHLA 4IGPA 2E6VA 1FMD3 5BNNA 2DCZA 3ABZA 3RNSA 4N43C 2JE9A 2VZPA 3K4DA 1FPN2 4K8RB 4IGOA 3QLQA 2RG4A 5DQ0A 4HETA 3AYCA 2Y26A 3SLIA 2ATFA 4YZ2A 1AL23 4Q26A 4FOQA 3O1PA 3M3CA 3VBFB 5LA1A 5A6XA 2RJLA 1D2SA 1S0EA 5LA9A 1YHFA 3MF6A 1Q43A 1DQ5A 1ENXA 2EAKA 4UW6A 1KDKA 2JDPA 4K7JA 1A8DA 1UX7A 4P9JA 4RL7A 3N9NA 4XDQA 5FYCA 3WUCA 5JSOA 1DGWX 4WBBA 4COUA 2Y6LA 1LEMA 4P9XA 4UBGA 3ZFFC 3RZGA 3ES1A 5BNPB 4G9SB 1N1TA 4Q0QA 5FZGA 1VB2A 2VMEA 4ARXA 1LGBA 1LESA 3ZXFA 2Y33A 1ZRRA 1AZDA 5GZEA 4CDUA 4AHZA 4CCMA 4EN9B 2MEV1 4QB6A 5I0TA 2VULA 4F8AA 4YVWB 3SH5A 1U5XA 3GGLA 1BEV2 4FPGA 4XXPA 4WM8C 1GR3A 4RGKA 1JUHA 1LU2A 5AVPA 3AB0A 4UXAA 4NIDA 4XXAA 2QQNA 3GNEA 3M3EA 3B3QE 1C57A 4KG0A 1DYKA 4LKFA 4ZPIA 3SMHA 3WDUA 3WHTA 4QKBA 3VDDB 4QPWA 4QAWA 5KR7A 1NLSA 3WF2A 2ZBJA 4N9HA 2Q1MA 3FBYA 2JDYA 1BBT2 3USUA 2XOMA 2Y64A 4RN5A 3RSJA 1WMXA 3U1XA 4CCKA 5LB6A 3WG2A 1ZZ7A 3ZFFA 4OI1A 3I3BA 1NCRB 1APNA 2ZZQA 3C7GA 4P9GA 3VL9A 3O1RA 3HD8B 2EIDA 3EB7A 1BJQA 2WA3A 1MQTC 1OQDA 1QJX3 2XPJA 1W6OA 4NHMA 2GH8A 1PMHX 4YM3A 3BI3A 1CX4A 4C1XA 1GOFA 2AACA 5DDJ2 1WD3A 3K4ZA 5JI7A 1DP0A 2JD4A 1YQ5A 2W87A 1LOGA 5BNOC 2YDEA 3QBQA 5DAXA 4RD7A 4LA2A 3JQXA 2QVSB 3NNGA 5FMOS 3LPFA 3MGUA 2YC2A 3HT2A 1G9DA 4LBQB 1OFSA 1CESA 1Z7S1 5FXWA 3I2OA 2EAAA 3W59A 4IV1A 2ZX3A 5ABJC 2VGDA 3ELNA 1Q8VA 3GYDA 3KV4A 2QDRA 4QDRA 5KC6A 4UFLA 3FHQA 4I30A 4Y5Z0 4S2HA 1S0CA 4Z82A 3SQOA 2NPIA 2UYBA 3FC0A 4QB1A 5CU1A 4XFIA 4FPHA 3WF4A 4QXCA 1OH4A 3RJ2X 2HWC1 3VHPA 2ZZJA 3ZKYA 1Y9MA 1YFWA 3O7OA 5FREA 1D7PM 5JPNB 1Y9QA 2DVGA 1AR82 2J1UA 1F31A 3HNBM 4RQPB 1W28A 1MQTA 1LAJA 1RUI2 3VGIA 5F32A 3BB6A 4ASLA 1A3KA 4PLOA 3P3NA 1RC6A 4Q4X2 3WDYA 1ND3B 1DZQA 3ZM8A 4NROA 1SLCA 1IQAA 2C24A 1IZ3A 4EJRA 3ETPA 2ADEA 4K8FA 2ENRA 4H14A 4BM8A 2MEV3 3PJQA 1VR3A 1XRUA 4R4XA 1QJY2 1UU5A 1IS6A 3MPBA 1HV1A 3DUIA 2BW8A 2WO7A 4KU8A 5AVAA 1SBFA 2KXLA 1ZA7A 4P14A 1UN1A 1WW7A 2PAEA 4XJ8A 2JDNA 4XAEA 4AW7A 5A1AA 3O1MA 3LIGA 4PQ9A 1OOPA 1TME2 4NPLA 5FIXA 1NCQC 3VDAA 4K3UA 1V6LA 2FD8A 1X7NA 3PDQA 4AI2A 5C9AB 1RYYA 5C8WA 3JBG1 3ZYIB 2F6BA 1B35A 3N7KA 2G19A 4XJAA 1J83A 1CJPA 3ZYBA 5FY1A 4CP1A 1C8NA 4COWA 3ZSMA 1QOOA 1CZVA 2RVAA 1ASJ2 3U07A 3TEYA 2JENA 4Q0PA 4XZUG 3ZYRA 1JU3A 2X5IB 3H7JA 1D0HA 1MZ6A 3NAPC 5FBZA 5SV8A 1CIWA 4LLOA 4E4DX 1JS9A 1XB9A 1GP4A 5F1RA 1OC1A 5HBAA 3ZXGA 2VCMA 5IVBA 2D3PA 1UU4A 4TN7A 3VBUB 4ZHNA 2A75A 4DY5A 5T52A 4Y20B 2VOWA 1HRV2 4CXXA 1V6IA 3A7QA 3E5UA 1Z7S3 4NRQA 4XJUA 2OYZA 4FOWA 4CP0A 5HCHA 4GULA 4K1YA 4AK3A 3IIAA 3ATGA 3K4AA 4E4ZA 1NCQA 4LULA 3E97A 4E27A 1LRHA 1W2UA 2JG9C 1W3XA 2W95A 1RHI1 4HVOA 4LIUA 1H0BA 4QX5A 2HWC3 3ASIA 4QPIC 2WO2A 1OLRA 2K0GA 1OMIA 2BOIA 2P2KA 4N7IA 4QPGB 4XBLA 4JGZC 1LNSA 4U36A 5F3IA 3RWNA 3URFA 1T6BX 4PJYA 4DZGA 1RUF1 2WJSA 2EIEA 2V5YA 4LEJA 3RI9A 5ACA2 4FFIA 1RUJ1 2B46X 1A34A 1ZM1A 5KHIA 1G86A 3MICA 4Y4RA 3WNNA 4R52A 1S0DA 4Q4V1 2VW1A 1JODA 1ND2B 1RUE1 4MSVA 1R082 1GOGA 4HVRA 2PN5A 2TEPA 3IBMA 3OBTA 4L11A 1O59A 4LOSA 4BHPA 3DPRB 4CDWB 4MGKE 1OLQA 4DUVA 4MXWA 4QXHA 2GC2A 3TWIA 3LFMA 2LALA 4CPBD 2B5HA 2DWRA 3I2JA 2C1FA 5FY4A 3C8XA 3RZHA 5FZ6A 3ZSEA 3N9QA 4JQTA 5DUWA 1H1AA 3MW4A 4XBNA 2VUCA 3T08A 2WLQA 2XKOA 5A33B 3JBG3 3A4UA 4MO3M 4AVBA 3WNOA 1AXZA 4HZFA 4LK7A 4FFHA 3THDA 3H1MA 4HKLA 1XU1A 1ZBE2 3PUQA 4OI2A 4C8DA 4HPKB 1GWKA 2D97A 3WCSA 2ZHMA 4XMIA 4WM7C 1R1A2 2XJPA 1XOYA 1W8OA 1OPMA 2XG3A 4JDOA 3RZZA 1RUH2 4I3PA 1ZRFA 4KBZA 5C8CB 3CZJA 5FZAA 1AUYA 2JD9A 4Y26A 1UZVA 2HWE2 3WG4A 1L7QA 1O4YA 3LEKA 4NN0A 5IWFA 1TNRA 1W6QA 5LK7B 1LULA 4UF0A 3A23A 4FPEA 3VDCA 4Q0UA 5I0SA 1OFNA 2K2SA 1WCQA 5DABA 3ZDSA 4ATFA 3GZUC 1PZ7A 3VHRA 3LDBA 5A3PA 4OUEA 1C5IA 2WA4A 4YW5A 4JRLA 2VBPA 5CISA 1RHI3 2XQRA 1NXD1 3FJSA 1YO8A 4LMFA 3KM5A 1WBLA 2F4PA 1EY2A 3FZ3A 4PI2A 4XTPA 3I59B 4DO0A 1NLRA 2OVUA 1HW5A 5FCCA 1SQ4A 3KCXA 2WNUC 3WNPA 3ZPOA 3BTXA 1RUF3 4F83A 1HRI2 2RS51 4QKNA 1RUJ3 2VBBA 2B8MA 2OX0A 3PVBB 3QACA 3HQXA 3VN4A 3O1UA 2JG8B 4XF4A 3P5BA 1C28A 4B1LA 1OQ1A 3CLPA 3ACHA 4KU7A 4Q4V3 4B1MA 4B8EA 1A78A 2OZ6A 5LCWL 1NE4A 4UW3A 3DECA 5F5QA 4DIQA 3HR9A 1RUE3 4UYBA 4YRDA 1GV9A 3WP5A 3WW1A 1N1SA 2BRTA 2DYCA 2W91A 5FY7A 2FDIA 1MZEA 2VM9A 1QXRA 2IXJA 2VUAA 4RR3A 3PVEA 4I2OA 2C9AA 1RUD1 2CWSA 2HEYF 4OUSA 1XXNA 5DPNA 2HWF1 3AYDA 4XAAA 5KHHA 1OA4A 3Q9OA 4Q8KA 1D4M1 1LR5A 1O6UA 2OXBA 3JZVA 1W0NA 1JHJA 2D6LX 3OYWA 4JC1A 2DTWA 1YJKA 3ZXEA 4YARA 1YI7A 2GN3A 2R49A 4FPKA 5DAVA 1G9BA 1OF3A 1J1LA 1OH3A 3OGSA 1GOHA 1H2LA 4I3GA 2FHRA 4OZOA 5K0UB 4CEYC 4B4PA 2VUDA 1G8WA 1OUXA 2YMZA 3FL7A 4L92A 3HPNA 2AREA 3SC7X 1R1ZA 1VJ2A 1KDMA 4DUXA 4M00A 1DGRN 3LA7A 1MR5A 4WVZA 2ET1A 1W39A 4KWUA 4AFBA 4E2SA 4CXWA 1UZZA 3KGLA 1QHDA 3EHKA 1GZ9A 3ZMNA 4LIVA 4D7TA 3MUY1 3MV01 1W6MB 5F5AA 4D8MA 3VBSC 5EJZB 2E31A 4EN7B 5FXXA 2W1SA 1NXMA 4QM9A 2VY0A 2JE7A 3GBWA 4H3WA 1C8M2 2P3YA 2ZX1A 3I2HA 1UOBA 2NM1A 3H42B 2RR11 4ISRA 5I91A 3VUOA 2VTXJ 1CAVB 2J1RA 3VBFA 3RGBA 5FZIA 2XJQA 3NNLA 5HXMA 1T2XA 4EWDA 3WVJA 5J7MA 3N4MA 2WFF2 2JXAA 5GLUA 4MUVA 4HSLA 1WLCA 3AMQA 4JKLA 1IHMA 1B09A 1VBE2 2BPA2 4EN6B 1PK6B 1DQ1A 2WRAA 3D3AA 4Y5SA 4A42A 4AWDA 2ZGQA 2DFBA 1LHNA 1SHWB 3FFZA 2DBNA 4CEYA 5ANQA 3R4SA 3C7FA 3HN3A 5JXIA 2P6CA 4CEWC 1N3PA 5J36A 4AEDB 1G9FA 2AH2A 4BIFA 3BALA 1CWPA 2B45X 3OBRA 4Y24A 4YW4A 2RS53 3J7NA 5DAWA 1XNBA 3VBSA 2PTMA 1H1MA 5DUXA 3AKTA 4LTAA 1SACA 3TNQA 3BOWA 3B9CA 5FZCA 1W6NB 5LWBA 4TLFA 1BZWA 1LOBA 3BPSA 1KXGA 1JOJA 2WT0A 1PX4A 3AP9A 5HCFA 5KHGA 5L9VA 2CY6A 4R9AA 1DG6A 2WWUA 3VDDA 4BQ3A 5FLIA 4XF3A 4Y1ZA 2G9GA 1UXZA 4XW3A 4UBHA 1GANA 1HIXA 3VZNA 1RUD3 1YQ6A 4BQ1A 3O1SA 3POEA 2HWF3 2ZEZA 4WZFA 2VE1A 4AHWA 1FOD2 1AR62 1W2OA 1XNAA 2WR9A 2RDSA 1D4M3 2A6VA 4P02B 1F9KA 2IXCA 5DG1A 3M3IA 1NCRA 4B4RA 3AL5A 1S4CA 4QX7A 4F7ZA 3MZHA 2VW0A 3ENRA 5IUQA 1DF0A 1LOAA 2P34A 2FZ1A 2XR4A 3WV6A 2DVAA 5BNQA 5JWPA 1UOFA 2VZQA 4A3XA 5A1FA 2DVBA 2V4AA 4J1XA 5J98B 4O9GA 2D6NA 4BQWA 2QNKA 3WNXA 3B94A 2FCTA 3DYOA 4GWJA 1BEV1 4LBQA 4GXLA 1EV12 5T3NA 2I45A 2JB4A 1W9YA 4ZZ5A 3TAYA 4CUBA 4MGIE 4UFKA 1LB2A 5FY8A 3RZLA 3AK0A 1O5LA 3OBZA 1KRIA 2A6XA 4IE4A 2JDZA 4IV3B 5IT6A 5LA0A 2RR13 3E5QA 1ST8A 2R0HA 1DGWA 1YYNA 1ENQA 1NAEA 4FPCA 1BBT1 4CCNA 4CU9A 1KEXA 3RQ0A 2BBVA 1NQJA 3KQ4B 4K21A 1EUUA 1PGW2 1QQP1 2DCTA 3PTYA 4MOAA 4N90A 4RQPA 4XMAA 1BMV2 2BJSA 5GLTA 3RYPA 2EICA 3OOXA 5FZDA 1UO9A 1N3QA 2XKPA 3ZXKA 1H1IA 4FAHA 4NR1A 4MXVA 5DDJ1 1Y43B 2OQ7A 3OGGA 4CDXC 4YW2A 1UD1A 4EWEA 5ABJB 4OHZA 1R64A 1UAIA 2Q4SA 2VECA 4LO8A 4SLIA 3ZKUA 1NX9A 3AKRA 4HXCA 1H6YA 3OD0A 3OEBA 5FY5A 4LJHA 1SFYA 1VMHA 1VLNA 2BVBA 2EXKA 2WT1A 4MLOA 4NHXA 4PBOA 5G05L 5FP4A 3ZN6B 4CCLA 1BVP1 2UURA 4XUQA 3OPZA 4JTOA 3J7MA 2W5FA 5FMOL 4AF9A 1MS0A 1I5PA 5FTTC 3RFRA 4YNIA 2GZWA 5D8AC 5A7WB 2WQZC 4ZZ8A 5J48A 3LQCA 4FFFA 4WVVA 3UNPA 3PU8A 3K77A 3GHNA 1SLAA 2LRPA 3CBNA 3FE5A 1UZ0A 1VAVA 4XABA 2R062 1UCXA 1O5UA 4QXBA 5C9AA 1HN0A 2ERFA 2TNFA 1SG3A 5F6LB 3WINE 2G9FA 3HQRA 2R041 3JB4C 3ACIA 5A70A 5T5LA 1XSQA 2WLPA 4LLFA 1GZCA 4BZ4A 4KI5M 1I5ZA 2NYYA 1RUI1 1MS9A 1D0GA 2X5IA 2R072 3PVOA 3PLQA 1BXHA 1JW6A 1YI9A 2UY8A 4Q4X1 5BV6A 2FDHA 2XBO2 1VAKA 3GZTB 2FQPA 3ZSJA 3ETQA 4AVVA 4AI0A 1SBEA 2YBSA 4XCBA 3VBHB 5C3PA 1IPKA 1UXXX 2ARXA 2A5ZA 1CPNA 2CDOA 5GM0A 3VBUA 3KT7A 1W9FA 2H6BA 2W94A 2D43A 4H7MA 4HOOA 1QJY1 4Y20A 2VQTA 1HQWA 3OGJA 5FY0A 4AQ2A 1PHMA 5IVFA 1BEV3 1Y7BA 3BODA 1UKGA 4AOCA 4Y4YA 1GFF2 1LECA 3D82A 1Y3TA 1DYOA 1QXJA 4HN0A 5F3CA 3NKGA 4A45A 4E8DA 3OUHA 1PZ9A 4HKWA 1AX0A 2VOKA 1DLCA 3RPQA 4M4PA 3LCPA 4XFFA 2YY1A 2D6KA 4M0HA 3U10A 1ZREA 3AMPA 4QPGA 2KD7A 4IEOA 2GNMA 1M06G 1BBT3 2HKXA 3NV2A 1ASJ1 3AKSA 5I8YA 1QQP3 1W8ZA 2KA3A 3ON7A 4NHKA 4A6SA 2JWPA 3OY8B 1RUC2 5JVVA 5B4NA 1I6XA 3LEGA 3GJAA 2VZTA 1ND2A 1S0FA 2IUWA 4YG0A 2ZGRA 2ZOEB 4FQZA 4J1WA 5DDJ3 5E89A 3WQ0A 4LKSA 5CA6A 5H9PA 2DVFA 4AEKA 4E2QA 2BYVE 2XQXA 4YM1A 2PAMA 3DPRA 1XC6A 2WNVB 1FMD1 2VOXA 1ZZCA 2JG9B 5EPAA 1HRV1 4DXZA 5FPBA 1HB3A 3EJKA 1QOTA 2VMGA 4QPIB 1H6XA 3T09A 2ZMNA 5FYTA 2WC2A 3CU7A 3HMYA 1AHSA 4XHBA 1RVF2 2Y6FA 4A7ZA 5M0TA 2ZGTA 5A6QA 3J26N 2ES3A 2J1AA 5GLZA 5A33A 1CAXB 4JCKA 5TSWA 3MIBA 3JU9A 2R043 1YQCA 2E63A 1AR83 4N53B 5CG8A 1PO22 1EAH2 2WNEA 3NV4A 2WL1A 4FBFA 3BIWE 4XF0A 4Z2WA 5CFCA 1RUI3 4OHWA 2KM2A 1Z0HA 1PGL2 1VPHA 4PF1A 3V0BA 1JYTA 2WS92 4Q4X3 3FUOA 2ZGUA 2VOTA 4JTNA 4C91A 5C8CA 1JZ6A 2QQPA 1HDKA 3BU0A 5CEHA 5FPLA 2LROA 2XJTA 2GP5A 4AGVA 1R081 2DUOA 1F35A 5LY1A 3S0MA 2VTXA 3NNFA 3QD6A 5IHRA 4MADA 3ZFEC 1QJY3 5LBCA 4AR2A 2VMCA 3HVDA 1O3RA 2JDKA 2QQMA 2LUWA 4D6QA 5BNNC 3HIFA 4AGRA 1ZBA2 4UAPA 1W0PA 2TBVA 3SCHA 5APAA 2ID4A 1TME3 3ECQA 1S1AA 2CGOA 3DL3A 1X8MA 4AI1A 4Q5OA 5EYYA 5CZKA 3UKTA 3AYAA 1XQNA 1QGLA 4R8HA 1IQDC 2WZPP 3CJXA 1LHUA 2G9ZA 1J59A 4UW5A 4DB5A 3I59A 4FP2A 4OQ8A 3UETA 2VL4A 1ASJ3 2YHJA 5K9YA 4RFT0 2E53A 3LAGA 4H2AA 2YV8A 1ENSA 3HAGA 1AYN2 3JUUA 5F6KA 1R1A1 5FYHA 4CSWA 4QT6A 2C0ZA 4IETA 4NUBA 4MGZE 4QX3A 4RHV2 5FYIA 4EROA 3B02A 3UL2A 1H4HA 4XILA 5FYZA 3T0BA 2HWE1 3E6BA 1GNHA 3RS6A 1FAYA 1XYNA 4IGQA 4P9YA 3L2YA 2ARCA 5JZGC 4PI0A 4UFMA 2Q30A 3TOJA 5CFDC 1JZ5A 2FDKA 1HRV3 3N36A 3VZLA 4IE6A 2GSYA 1WLWA 1WLDA 3POBA 4MHUA 4QQ2A 4XUOA 3ZR6A 1GQHA 3H3LA 3VKOA 2CAVA 1ZYBA 4AZZA 1JMUB 1VBD2 1D4VB 2A7AA 2BGCA 2I07B 4D7SA 3TN92 2YBPA 3B00A 5E1RA 5IAVA 1QY4A 1JYIA 5I8TA 1JTZX 2GNTA 2J1EA 3RJRA 3UKNA 5K0UA 3ZYPA 2PQQA 2FDFA 1TMF2 3CJIA 2EA7A 4P9WA 3K2OA 2BP6A 3HNYM 1FT9A 3ZN4A 5T50A 3O14A 3K3OA 1HRI1 1VIWB 2ZGNA 4RGGA 2AEYA 5CBLA 1H9WA 1UWWA 2DVDA 2IVIB 1ULDA 1PO12 3I3DA 4Q0VA 2P1BA 4NIAA 3T0AA 4ASKA 5ACA1 1W6MA 2PHXA 2OKXA 4XE9A 2ZHNA 1BYHA 5JZGA 3WF3A 4A44A 2YG0A 3O0VA 3WQBA 5CFDA 5JOWA 1R083 3I54A 2WUHA 1CAVA 1T6GC 2VVFA 2Q8OA 4XJZA 1UIKA 2GMPA 3I2IA 4IV1C 4PDWA 3FLRA 1CAWB 1WZXA 1IG3A 4AI8A 5EIYB 1NQDA 1PK6A 1AL0G 3DKQA 3KHBA 3E6CC 1SDWA 3LFIA 5FUIA 4MH0E 3WT3A 4LT5A 3T30A 2EIBA 2PHDA 3HWJA 3NNMA 2FDJA 1A8MA 2AYHA 5FP7A 4AEDA 3C2UA 5EV7A 4AVCA 1IKPA 1J1TA 3W58A 3KT1A 1VBC1 2X29A 3S6PA 1CAUB 2WWSA 2CDPA 1FNYA 4NVPA 5LATA 1JUIA 2AEZA 1G6NA 5LASA 2PELA 1UZYA 3Q8AA 1R1A3 1H8TB 4XBQA 1DIWA 1MPXA 2CGNA 3DYPA 1W6NA 2WAOA 4M3CA 3AMMA 1G9CA 5EXOA 4NIGA 3P1IA 4Z2AA 5BUVA 2HWE3 4E2GA 3SITA 5IYYA 4XPVA 2VUJA 4KH9A 3HBZA 2J1TA 4YW6A 5A7OA 2IVJA 1WW5A 3KT4A 4LO4B 2IZWA 4COZA 2PLV2 3ZX7A 3Q8EA 3IN9A 1UOJA 1QU0A 1HX6A 1XE0A 1U5ZA 1YFXA 4BK4A 1QNYA 1UW8A 2WFF1 3IAPA 3MIFA 3SCGA 5IK7A 4ITCA 2Z2SB 1VBE1 1V6OA 5J1XA 3UKVA 1V9U2 4WV8A 1OOPC 4XIKA 3T4HB 4LK6A 3OGRA 5JMOA 4D94A 2XLGA 5B4XA 1YNAA 3AM2A 2EXHA 3N9PA 2RMU2 3LA3A 2VU9A 5JI9A 5FZOB 1B35C 2VAUA 1AXKA 4ISQA 5KBFA 4QDQA 4ES9A 3C7HA 1UMHA 2YPDA 4GMP1 3S7IA 5L7OB 4YGEA 1HRI3 2ZAAA 1ENRA 4D3WA 3ZIWA 4PIXA 1UY2A 5ACA3 2XH6A 1OPOA 2J1SA 2W92A 4XFBA 1AF9A 4ET7A 3WG1A 3WCRA 1C4RA 1WA6X 1O8SA 4GWNA 5AC92 4IV3A 2VQUA 4GWMA 1LTEA 2Y0OA 2Y6HA 3DN7A 1BHGA 3MLJA 2ZA9A 4QX8A 1UYZA 4GJZA 1OLME 1NA1B 3WW3A 5DN2A 4INDA 1FOD1 4J6GA 3N9LA 1AR61 1CQ9A 3SXWA 3ZFGB 4I0BA 2E7QA 4V2WA 2X10A 3B5LB 4NJ4A 4BQ4A 1K12A 3M70A 4YZ4A 1TE1B 1AYM2 1O91A 3WDWA 4A4AA 2ZGPA 4XFCA 3T1LA 5IVCA 4F3JA 3BIEA 2NMNA 5JXJA 1AXYA 2GALA 2V73A 3VD4A 4QGNA 1VP6A 1VBC3 3FX3A 5DG2A 5FZFA 1ULFA 4XACA 3EYPA 4KWJA 1HJFA 1OF4A 4QGLA 4CDQB 5FK7A 3H9AA 4QU2A 1H2MA 4LORA 1EV11 2OPKA 5T5OA 4OHYA 2ILMA 3IDAA 4MV2A 4YPJA 1YIFA 3JD72 2VXRA 3AP5A 2EF6A 4KGGA 5A7WA 2K9ZA 3MI8A 3EMRA 5A80A 1OKOA 1QJFA 1KITA 1JZ2A 3M3OA 5D21A 2J22A 3HOBA 3ALQA 1VBA2 5H9QA 2GC1A 4YW1A 2WFF3 3J7LA 3VZJA 3POFA 2VW2A 1F5FA 4NOTA 3WHUA 1PGW1 1U5IA 1VBE3 2E51A 2VH9A 3JB8A 4QHBA 4XJ9A 5FZKA 2RS12 3VBRB 3NJXA 4CCOA 5JOZA 3AZYA 3CL1A 5DZGA 3JXSA 1NE6A 4E8CA 3ILNA 1MS8A 2OUHA 1LODA 3M1HA 1FV3A 1QJZA 3AZWA 4JV4A 3VBHA 2XXZA 1UOGA 5A3UA 1UX6A 4GMP3 5C3RA 1DU3D 2P37A 4P9IA 1K5MB 4FPYA 4QQLA 1DGLA 5FR3A 2Q1ZB 2NZ9A 4BPZA 2VZVA 3R05A 2ZACA 4FPLA 4TXWA 4CCEA 1W90A 4GH4C 5KHJA 2J42A 4CU8A 2RHPA 3ILFA 4MGYE 3IMMA 3ZPYA 2E33A 4IEQA 1RINA 2BWAA 3VZKA 1E5IA 4JKKA 4BA6A 3SHRA 2YU1A 4DXRA 4XHXA 1Q8SA 2H6CA 3CIHA 3PL0A 5F39A 5FQ0B 5JPMB 3N7JA 5LEJA 1JOBA 4DXTA 2F17A 3LIHA 1UIJA 3E6DA 3P6BA 5FPAA 5A3NA 4QU1A 3P3PA 3A0KA 1WA4A 2H0BA 1FOD3 1AR63 4IE0A 4EN0A 4NAMA 3FLTA 3H50A 4B29A 4QHZA 4PIZA 1JH5A 2R071 3I49A 3OY8A 1CN1A 1ACCA 5LK5A 4FXGB 3J4UH 5FMBA 4A7YA 5FZBA 3IZOA 3KLSA 1WW6A 3UJQA 5A3TA 1AVBA 4OHVA 1AJKA 3MF9A 2CU5A 2W1UA 1EYBA 1QDOA 1QEXA 2W1WA 4GH4A 4NIIA 4PQQA 2WNVA 1DZTA 1QJEA 2W46A 2VZ1A 3U11A 3V65A 1SEFA 3J8F2 1EV13 3DGTA 1FX5A 4YG3A 4PIYA 1LU1A 1PNGA 1GMMA 4QQHA 4ZU7A 2NLRA 5FZ1A 5F5CA 2XWJB 4XZPA 2YB7A 1GP6A 4JRAA 4LKDA 5HXVA 3O1VA 4Q1RA 4FAGA 5KWRA 4XJWA 4RR3C 2UWCA 1CAXA 1PMIA 3A21A 5FZ9A 4X6QB 1QJX2 1U12A 2YROA 1ALYA 4ZU5A 2Z69A 3AFKA 1DYPA 1W05A 4B3NA 4UWDA 5E8AA 5EFUA 4IESA 3DXUA 3U75A 4AVSA 2UY9A 2ZGKA 3UGHA 4MG2A 3VZOA 5AFBA 2SLIA 1MZ5A 1LHWA 1HJGA 4J25A 4JGYB 3VKMA 1SZBA 2D3RA 1CZSA 3AFGA 3ROUA 2ET7A 4FCAA 4P5HA 3POYA 2ZABA 4YGCA 1TG7A 4QX2A 4XUNA 3AZXA 2B39A 1VB4A 1TEIA 4RS5A 1FYUA 4UFHA 1W8NA 4M3CF 4BMBA 4KBBA 4IEWA 5HV0A 2VQAA 2ZTNA 2E7TA 5FDBA 4I0AA 3ORJA 5FBJA 2RM22 3WNLA 4LO7A 4ORFA 4HK8A 4LHNA 5AFEA 4JZRA 1RVF1 5J37A 4G4FA 1WKYA 2ZHLA 1RIRA 2YBKA 4GMP0 4P00B 3ZYHA 5K7PA 1Q8QA 4FPOB 3VBOB 1RB8G 3H3ZA 4CUCA 2R063 5C4WB 1YFUA 2OQ6A 1RMU2 3LE0A 3VBFC 4A6OA 2JECA 5H9SA 3H8RA 2D98A 4IEZA 4R9BA 3I2DA 5I93A 1JZ7A 5FZLA 1PO21 1EAH1 4CCDA 5FO8B 1NYWA 3VKNA 3NW4A 5JCTA 1UU6A 2FZ2A 5DUVA 4EE2A 2R073 5F8PA 3BTZA 2MEV2 4GIQA 1PGL1 3MFCA 1Q56A 2PHFA 4ASMB 2XVKA 5FLHA 1VALA 2Z42A 3CDZB 3V0AB 5JXGA 3UESA 3OJBA 1KFXL 2WBKA 4UOJA 4L99A 4Z92B 3CNAA 1K5JA 5L9BA 3Q8BA 2DF7A 2W47A 4YYOA 3V0BB 4C0HA 1XNKA 3A22A 5FJHA 5FZ7A 1VAMA 5ISLA 1DQ4A 4HN1A 3GHMA 3WR0A 1RITA 4GZ9A 4ES8A 5FPZA 1HV0A 1PM4A 4N7UA 4QXKA 4S2DA 4BQXA 3MHZA 2Y6JA 2XVLA 4YVSB 4DINB 4XQWA 3VKLA 2CNAA 2XDVA 3VDDC 1O8PA 1TVGA 1YFYA 2VZRA 1XE8A 1HQLA 1LGNA 1LENA 1YUDA 2RDRA 2XJUA 3OD4A 4IXLA 5JAXA 3B7MA 3H7YA 3WDVA 1BK1A 3K3NA 3T2OA 5C3SA 3PUSA 2WWJA 1PZ8A 4IERA 4CDUB 5CYYA 3SKVA 4LBJA 1AYN1 5A3LA 1NCRC 4XDPA 3ITQA 4XQDA 3SEEA 2VTFA 1GNYA 3N9OA 4QX1A 5BNPA 1S0IA 5GZGA 4RHV1 4N43B 3S30A 1MVQA 4OUMA 4OI0A 1W03A 2O8OA 1OUSA 5FUPA 3GCWA 3H1WA 3J7HA 4QD2A 3VD3A 3X29B 4PCRA 4YVWA 3UV9A 2AUYA 2P5BA 1S2KA 1JYXA 1QOSA 3NJZA 1EPWA 4Y3OA 2X05A 4P08A 2A71A 1FPN1 4OYUA 5C3OA 3O12A 3NO8A 2BTVC 1PM7A 1CAWA 3HJRA 2W3JA 1URXA 3USUB 1PVXA 1RVF3 1VBD1 2VPVA 2DURA 5EP9A 1GYKA 3LA2A 3J9SA 4O9EA 2RS32 2WSVA 1OBNA 3KF3A 4BH9A 3TN91 4AFAA 4E4SA 3ZFFB 3I4IA 2D6OX 5FMDA 2Q8DA 1E5HA 1TMF1 2VVEA 3LWCA 4NRMA 4AG4A 3KQRA 4OLLA 1PO23 4LO6B 1PMJX 1EAH3 2OIIA 4RQPC 2RE9A 1KFUL 1EUTA 3MLLA 1XPWA 4DEQA 4DRVA 1PO11 4WM8B 3R4DB 5FUNA 4G3YC 2WS93 3O5SA 3WEZA 3RVHA 4AAXA 3U4XA 1ND3C 1W2TA 2LTNA 1POV1 2BGPA 4H7LA 1W9TA 2ZGOA 4BXFA 4CXYA 4B7KA 1OVPA 1PVC2 5JR2A 1S2BA 2HWB2 1MS3A 3PMEA 3NWKA 5FFOC 4LA3A 1C1LA 3OTFA 1RJ8A 2XJRA 1UNBA 1W8FA 5DZFA 1ZZ8A 1PIV2 2IFWA 1ZBA3 3F2ZA 3INAA 2E7AA 1X8EA 4BE3A 1GQPA 3IMNA 3V56A 4KGQA 1VE0A 1W9SA 2PAKA 1MQTB 1UYYA 2A6YA 2HWD2 2OW4A 5ERLA 2O14A 1YEWA 3WW4A 5C9AC 1V0AA 5FZOA 4XURA 4NHYA 5BNOB 4BMEA 4QDSA 1S55A 5L7OA 2R1BA 2WFPA 2X5IC 1AYN3 1MS5A 1ND3A 4DXSA 3AC0A 2AZ5A 2J7MA 2ZX2A 3KS7A 3KV5A 3CF6E 1W8UA 2OS2A 4NE9A 4RHV3 5FKCA 3CKHA 1AR72 1H8VA 3GM8A 5DUUA 5JUVA 3ZSLA 4LXLA 5D1IA 4XDOA 5HCAA 1X36A 5LZ6A 1JYNA 1X33A 2AR6A 3VBUC 3VD9A 4Q2FA 3POSA 5FOBB 5EQUA 2KR2A 4WVMB 4L0PA 2QQIA 3VV1A 5IJRA 1FPN3 3GJBA 1NA1A 1GBGA 1RXGA 2IXHA 3B93A 4QM8A 5A6YA 3WDTA 5CIRA 4OULA 5T55A 3U37A 1DFQA 4Y33A 2V5DA 4Q4Y2 3ZFGA 1VBD3 4BQYA 2D7FA 2WN3A 3THCA 1V9U1 2ZS6B 4M01A 3U0ZA 3BTYA 2YC0A 1JZ8A 3VHNA 5KXCA 2Y38A 3TN93 3BGAA 4L2NA 1WMDA 2RMU1 1AR81 3L9JT 1XYOA 3MYXA 5BXXA 2BNOA 4QPGC 4XF9A 4AAPA 1TMF3 1HB1A 1YRZA 2Z79A 4PT6A 1VRH2 5CKNA 1SLTA 4ZXKA 1X9PA 1YIPA 1HKDA 1OQEA 1PO13 4IUGA 5LY2A 4LE3A 2QZ2A 4XFHA 4CDQA 2XHNA 3IPVB 1NZCA 2D3SA 1POV3 2X8KA 4EZ4A 1ND2C 2EXIA 1ZX5A 3NNJA 4LITA 1OHFA 4AFDA 3IWZA 1XE7A 4U2AA 1US2A 3KV9A 4XETA 3LD8A 3RYRA 1W6PB 3SH4A 4ARYA 5AC91 5F37A 1NCQB 4OI4A 3DPRC 4CDWC 1FNZA 1JN2P 1CR7A 4HG6B 4BU2A 3ZDVA 2GMEA 3TBDA 4XEZA 2BVVA 3H8XA 5FRAA 1TME1 2FCVA 3I7DA 3VBRA 3NAPB 3DCQA 2R7EB 1V00A 2XGXA 4XOGA 2ZGMA 3WG3A 3GZEA 1AYM1 4ZKTB 4WVWA 1G7YA 4W65A 4W8JA 3DKWA 3VDBA 2XJSA 5FP3A 2CAUA 3WQ7A 1QH6A 4ZXEA 1CPMA 1JYCA 4Q1PA 5ANNA 4R4ZA 1KS4A 4A2UA 3WNKA 4IE7A 1K5MA 1W9WA 3GZAA 5I0UA 2RV9A 1JXNA 2ORXA 2L9LA 4ZONA 5CFCC 1ZZ9A 1UL9A 2DU1A 3IKWA 3SISA 3WX5A 1SCSA 3TYJA 3WZ1A 2JDAA 2WQ8A 2ZAHA 5IAXA 5C8CC 4MXWB 2QQKA 2GNBA 4Q0SA 3JD71 4CDWA 2DCYA 3MO4A 5A7PA 4ZU4A 1V6MA 2XL9A 3FWEA 1W04A 1UMIA 4RSUA 1UY1A 4QHOA 2PLV3 3IT8A 1CONA 4K9SA 3IAQA 1JI6A 1AR92 1VBA1 2DV9A 5F2SA 1GWLA 1JYWA 4JGZB 4BQ5A 2VBDA 2YGLA 5JMCA 1QWRA 3NQHA 2ARBA 4RYDA 1O3TA 5C5TA 1O4ZA 2RS11 3USSA 3H3UA 1V9U3 5HV4A 4CPBA 2OT7A 4LKEA 2TUNA 3F95A 1US3A 2RMU3 2W1QA 2ZEXA 3AVRA 3MEPA 4HPKA 3ZXJA 2BFUS 4OFGA 1CX1A 4IEUA 3WD5A 5KXDA 2IXKA 4XFAA 1W6QB 5CADA 5F2WA 3I97A 5LBBA 2G4IA 3LPGA 4UF0B 1RUNA 5CKQA 2JG8C 3G7DA 1REDA 5GZFA 2EVXA 5FPXA 1OVSA 5A3OA 1PX3A 1Q8PA 1VMJA 3BUCA 2BOJA 4DS0A 3KWVA 4QX0A 4Z8BA 3UYJA 5AC93 2XONA 1KGYA 3M8LA 1I1EA 3MW3A 3CMGA 1OD3A 3M4FA 3WP4A 4COVA 2JDUA 2P3KA 3NL1A 1Q3EA 2YPJA 2HLEA 4IL7A 1S0GA 4GB32 2CYFA 5EHDA 1LHVA 3B01A 4CVUA 3WDXA 3BKZA 4LHSA 4WM7B 5FWJA 5DMYA 2P6HA 3N7MA 1RUG2 5FXZA 1U0AA 4YZ3A 3PIGA 1AYM3 3JQWA 4JGYA 2QBXA 2X09A 1FV2A 1R092 1ZBE1 5FYYA 1KJRA 5K0UC 4WZCA 2Y8KA 4Q4W2 5FY9A 3CJIC 5JSPA 4BLIA 2LW8A 4N9IA 3GALA 5I0DA 2JG8A 2V09A 3LGRA 1ZZ6A 3N3HA 3VB9A 1RUH1 2JKBA 4YWAA 4IQPA 5C6CA 1ZRIA 3J8F1 3RMXA 4EQVA 1NLQA 1BLZA 3ES4A 2J1VA 4CCJA 3ZVXA 5J96B 1IGOA 2UU8A 1K45A 2BDRA 3BU7A 3JD73 3MIDA 4FPJA 5HCBA 3KHCA 3POWA 4NWWA 3EXUA 1BCXA 3VBOA 4MGTA 4JQRA 3FHAA 5A6ZA 1H2NA 1W2NA 2WIIB 2WN2A 3MV11 5C4WA 4BLJA 1VBA3 2XB6C 5GALA 1I3HA 3AL6A 2YFUA 3I8TA 2HJIA 4PDWC 1RUOA 5K8SA 2WNUB 2W39A 2VG9A 2WZEA 5A7SA 3TEWA 2RS13 1PK6C 1L3JA 2QQWA 2VMIA 4GKXA 4RFRB 3OCPA 4KL1A 4CA9A 5FYSA 2BQPA 3MLKA 2W68A 1RGSA 1QXPA 1RJ7A 3TRSB 2C4XA 2CL2A 3N7LA 3T2TA 2DBIA 2QE3A 2WO1A 3H8UA 2OPWA 3G6JB 3FMGA 4AEDC 3M7AA 3OG2A 2BUKA 3AKQA 1F4AA 1C5HA 2QQJA 1O3SA 2PHTA 5C33A 2JJ6A 1JU4A 2B4KA 1SFNA 2Z4FA 2RM21 1XSRA 3RMYA 2ADDA 1X50A 3ST7A 1LOCA 2WZR2 4OVEA 4L8QA 4YVSA 2WINB 4COYA 1IG0A 4FT8A 1XJAA 3LEIA 1E5RA 4BIOA 1DBNA 2ZEWA 2UWAA 2XJVA 2PA7A 1RMU1 1UYXA 3ZLIA 4A41A 3S5AA 4V2VA 4CEYB 2QQUA 5FO9B 2PHRA 3B69A 4KNCA 2W08A 1SPPB 2DUQA 1YJLA 4Q8LA 2YYOA 1C3HA 3NMBA 1XU2A 2BWCA 4GA9A 4NO4A 3VBSB 4N43A 4FTSA 4HSJA 5FMCA 1ZBE3 1SBDA 5LW9A 2D44A 2CGPA 1LKNA 2ZHKA 4N8MA 2PYTA 4C0BA 4NHLA 1F5JA 3AX4A 1OA2A 2QUOA 1RUH3 3ZIXA 5LRSA 4TWTA 4MHRA 3RWKX 2VVDA 1YLLA 1FATA 1ULOA 3CHXA 3J8F3 4XTMA 2GU9A 1WCKA 4UFJA 2O1QA 1C8M1 5EJ1B 3IDEA 4AEMA 2WAAA 4Y1YA 1COV2 3K51A 3W21A 5JIUA 3RZKA 3E5XA 3ACLA 5C7GA 1QQP2 4NIHA 4IV3C 1WW4A 1ZRDA 1LGCA 1XNTA 2BV4A 4HKOA 4CEWB 4URAA 1IKQA 4XIOA 4AFMA 1JZ4A 3THPA 2QQVA 4LBQD 2ZJCA 2VXJA 1X82A 3LSDA 1GLHA 4MGSA 3S7EA 1J84A 1TZOA 1XYPA 3POGA 1BKZA 1BVVA 3PTRB 1W0OA 4WM8A 4R9DA 4Y1UA 4JAAA 4TLGA 4H55A 2ZPXA 4BJ0A 3D6EA 3C3VA 4HL0A 5SV5A 2QFEA 1QF3A 1GUIA 2GNDA 1L7RA 1N3OA 5HPOA 3LOBA 2DUPA 2VC9A 3MIGA 4QQOA 1MS1A 1NY72 5F9TA 4MZUA 4META 4M4RA 3GDBA 1HXS2 1DZRA 2D93A 2RM23 4IEPA 3NV1A 2DFCA 3RI8A 1L7LA 2R042 4KWKA 4XUPA 3AJYA 4DY3A 3CZUA 2R32A 2RS31 2YUEA 3IDBB 5GKAC 2C9KA 1O3QA 5EJ3A 2JB8A 3HQUA 2W2IA 2VR4A 1RMU3 3O1OA 3FBMA 5C71A 3LDKA 3EBRA 1K42A 2LS6A 1GP5A 4OQ9A 4JX0A 5FP8A 5BNOA 3DV8A 3JCIA 4YGDA 3QCWA 2O0OA 4UW4A 2FBEA 1MEC2 4TSVA 2VCAA 4CP9B 1N1YA 4DUWA 4LO5B 2QQOA 4AVTA 1CVNA 3VKFC 5ABJA 2WABA 3WF0A 5FXVA 3WY6A 2LM3A 3GF6A 4OHXA 4JHZA 3H8OA 3VBHC 3IM0A 1PVC1 2P3JA 3TEXA 2JKXA 1QKQA 2F4LA 3WQ1A 5LRRA 4W6YA 2Y60A 2HWB1 5F5IA 2B42B 3ZN6A 5I0RA 1Y4WA 1MVEA 2QZ3A 4WVMA 4Y22B 1QJU2 2Q8CA 1EP0A 2IC1A 3KB5A 1PIV1 1W8HA 1C8M3 1V6KA 4B7EA 2VD7A 4E4HA 4BISA 4OCTA 1IS4A 4IDZA 2R1DA 5FZEA 5L19A 1O4TA 4QWNA 4AHXA 3ZXAC 5KHKA 2HWD1 5FV3A 5F3EA 1ULGA 1ULPA 5I8SA 4CDXB 2HBTA 3MW2A 1CGPA 1BMV1 2YXSA 3Q8FA 1V6NA 5DZEA 2W52A 3NJVA 5H9RA 1VBB2 4I0WB 2RDQA 1GZWB 4BDVB 2EALA 4JKMA 1Z78A 1N1VA 1JOPA 1V6JA 2D5HA 3KZ4C 3O0WA 4DQAA 1FMD2 4DRRA 1ODMA 3IPVA 3NJYA 4HBNA 4PBPA 4YG6A 1NUKA 1AR71 1SLBA 5D8AB 4D6RA 4YZ5A 2NP0A 4FVVA 1AL22 3DYMA 1I9RA 1REFA 1W6PA 1NG0A 2JIJA 2JIGA 4GKYA 1W06A 3W9AA 2ORZA 2WNVC 5CNAA 2VNVA 1IS5A 1NT0A 1S2EA 2JE8A 4EWAA 1OA3A 1ULCA 4P9LA 4AGGA 3CQOA 4Q4Y1 5G04L 2R061 3NAPA 1STMA 4I09A 3ZOIA 2RS33 3HNMA 1XNCA 2WO3A 3N9MA 2VJXA 1RTVA 4JDMA 5L36A 3FLPA 5BY5A 4IEXA 4K40A 4LUKA 3V64A 3I3QA 4AHYA 3DEMA 4N53C 4JDNA 1VRH1 2NN8A 3KMHA 5IVJA 4XC9A 1KS5A 3POIA 2XBO1 3NVCA 4CZSA 1OLMA 4IW3A 5FZ0A 3ZR5A 2ZKLA 5JR7B 5FYUA 4C1WA 1ONAA 3SNMA 1W2AX 3A0NA 5CB7A 1PVC3 1ODNA 2JG9A 5FAXA 4X8PA 5IW0A 4AVAA 1J3RA 2HWB3 2JDMA 2VNRA 2WNOA 1DLLA 4RS5C 1G9AA 4QPIA 1H2KA 4FTBA 3BYWA 4LUMA 2AENA 3H1YA 4JGZA 4LBKA 1OI6A 4GD4A 2GN7A 2WT2A 1PIV3 3M3QA 1UYPA 4P5YA 3T0DA 4RGAA 2WQ4A 3LEMA 2Q1FA 1GZTA 1HLCA 3GBFA 4AQ6A 4BQ2A 2HWD3 5JOYA 3I3MA 5CFCB 5C5UA 3AJZA 2CV6A 5CG9A 3RZMA 5EZWA 3GBGA 4N53A 5FP9A 5A32B 2JDHA 3IIIA 3S5QA 3IB3A 2GC0A 4DPNA 5J09A 5IVEA 5GZDA 2B7YA 1UPIA 2A3YA 1RUC1 4CU6A 3OPWA 4MX3A 3I2GA 1E5SA 2H0VA 3UK9A 1EPZA 3POJA 3PHMA 2Y34A 4Y5TA 1OSGA 1OURA 4QB2A 1S0JA 3AMNA 3AP7A 2XWBB 2R30A 1QMJA 4FI9A 1AR73 1PNFA 5C3QA 1GKBA 3UGFA 2VZOA 4X8NA 4LE4A 3HEIA 4OMCA 4KG8A 5DAPA 2GMMA 1J58A 1AX1A 4GAZA 1AR91 3KSCA 1F2NA 1M4WA 4YM0A 1LCLA 3UGGA 4FOYA 2C5DA 5JIAA 3O0XA 3LKJA 1SCRA 4CCCA 2BERA 4V1PA 1U5YA 2R0FA 2EXJA 1ZA4A 4Q4Y3 3MPPG 5IFTA 4XYXA 4WM7A 3LSEA 3D4KA 4HONA 3PUIA 2XHKA 5KC5A 4NMIA 2CHHA 1DCSA 3OF1A
chains in the Genus database with same CATH topology
5A1AA 4GWIA 5IJRA 4MGQA 4QX3A 3VDAA 1K3IA 3U37A 2V5DA 1RYYA 3T0BA 2WN3A 3THCA 2BGOA 1J83A 1JZ8A 1CZVA 2RVAA 1F4HA 3BGAA 1JZ5A 4XZUG 1JU3A 4XUOA 2VZSA 4PT6A 5C70A 4IUGA 2V4VA 3WSOA 2XHNA 2J1EA 3A7QA 1US2A 4ARYA 2WZ8A 3HNYM 3T2QA 3K4AA 4HG6B 2YC4A 1UWWA 3I3DA 3T0AA 2W95A 2DCKA 2OKXA 2WO2A 3WF3A 4A44A 2BBAA 2R7EB 2YG0A 3WQBA 1LNSA 2WUHA 4W8JA 2EIEA 3VDBA 3I2KA 3C7OA 4ZXEA 3WNNA 4BXSV 3I2IA 3WNKA 1W9WA 3C7EA 2RV9A 3T2PA 2ORXA 5EIYB 2L9LA 3PUHA 1HN1A 1GOGA 1OT5A 5FUIA 1O59A 2JDAA 2WQ8A 2QQKA 5JXHA 2EIBA 4DUVA 1P8JA 3MO4A 1UMIA 1UY1A 3I2JA 2CDPA 4LQRA 3C8XA 3IAQA 1JI6A 1JYWA 1MPXA 3DYPA 2PQSA 2WAOA 3NQHA 4RYDA 3T08A 2DCJA 3P1IA 4Z2AA 4MO3M 3WNOA 5IYYA 3THDA 2J1TA 1GU3A 1US3A 2W1QA 2ZEXA 4BK4A 1W8OA 3IAPA 1CX1A 3CZJA 1JYVA 2JD9A 5J1XA 4OMDA 3I97A 3LPGA 1L7QA 3LEKA 3OGRA 5JMOA 5B4XA 3A23A 1PX3A 3VDCA 4LPLA 4QX0A 4QDQA 1WCQA 1UMHA 3C7HA 2XONA 1KGYA 4W50A 3K75B 1SDDB 1OD3A 3CMGA 4OUEA 1UY3A 1UY2A 3MUZ1 2HLEA 3I2FA 2J1SA 2W92A 4ZY9A 4XVHA 3W5NA 4ET7A 4CVUA 4LHSA 5DMYA 1O8SA 3WNPA 2VQUA 2QBXA 2Y6HA 1BHGA 2X09A 1UYZA 2Y8KA 4XUTA 2LW8A 5DN2A 5LCWL 3ACHA 1CIYA 5I0DA 3NRUA 3DECA 2X10A 1K12A 4CU7A 2W91A 2VM9A 2VZ3A 3K46A 2J1VA 1UY0A 4A4AA 3ACFA 3WF1A 3I3EA 1K45A 5DPNA 5JXJA 3VD4A 1JZ3A 3FHAA 3MV11 3EYPA 2WN2A 1W0NA 1OF4A 1JHJA 1NKGA 2YFUA 2WZEA 1OF3A 2ZEYA 2QQLA 2W9XA 3IDAA 3OGSA 1GOHA 4OZOA 5LA2A 4YPJA 3SKJE 3OB8A 3FL7A 3HPNA 3SEPA 2E32A 5F7UA 4DUXA 1JZ2A 3W5MA 2C4XA 2J22A 3HOBA 4KWUA 2VO5A 2WO1A 4CUAA 3MUY1 3MV01 3OG2A 3OBAA 4D8MA 5EJZB 1F4AA 2QQJA 2DDUA 2E31A 2W1SA 3NJXA 4A3ZA 3JXSA 1JU4A 2VMFA 2B4KA 4E8CA 2ZXQA 3I2HA 2Z4FA 2J1RA 3VD5A 5HXMA 1T2XA 3LEIA 3BN6A 2ZEWA 4JKLA 1UYXA 2VZVA 2VMDA 4A41A 3D3AA 4A42A 4TXWA 2C26A 4CU8A 1SHWB 3ACGA 2E33A 3C7FA 3HN3A 5JXIA 4JKKA 4W4ZA 4DXRA 3CIHA 3OGVA 4DXTA 3P6BA 4UI9L 2BZDA 2VCCA 3OEAA 1YQ2A 3WNMA 1PX4A 1ULOA 5EJ1B 1UXZA 2WAAA 3MBWA 2HYXA 2W1UA 5C7GA 2ZEZA 1UY4A 2W1WA 1XNTA 4PQQA 1XNAA 2B9VA 4P02B 2WYSA 2W46A 1JZ4A 4D0QA 2VZ1A 2VZUA 3E1F1 4MGSA 1J84A 1GMMA 2YB7A 2VZQA 4BJ0A 5IFPA 3A21A 3DYOA 4GWJA 1GUIA 1L7RA 5HPOA 4ZZ5A 4CUBA 2VC9A 2VCBA 4M4RA 3GDBA 5LA0A 4BK5A 1CZSA 4XUPA 3CZUA 2Y6KA 1NAEA 2C9KA 1KEXA 4CU9A 1TG7A 4QX2A 4XUNA 1EUUA 1CZTA 2VR4A 4MOAA 5C71A 1W8NA 1K42A 2LS6A 2EICA 2E26A 3VD7A 3FN9A 4JX0A 3WNLA 2VCAA 4DUWA 1WKYA 2QQOA 4P00B 1W99A 1R64A 4TTGA 2WABA 4CUCA 1NX9A 3WF0A 1H6YA 3LE0A 3OEBA 4A6OA 2RJ2A 4JHZA 5G05L 1JZ7A 2JKXA 4XUQA 2W5FA 2V72A 1I5PA 4KMQA 4ZZ8A 3LQCA 2WDBA 3UNPA 2YFZA 3K77A 1UZ0A 4DEVA 3CDZB 3GXUA 2Y6GA 5JXGA 3UESA 2WBKA 4UOJA 1SG3A 2W47A 3ACIA 3ABZA 1ULPA 3A22A 2VZPA 3K4DA 4KI5M 5DQ0A 3NJVA 4GZ9A 4BDVB 5LA1A 4JKMA 2Y6JA 1UXXX 2CDOA 1O8PA 1TVGA 2W94A 2VZRA 1NUKA 2VQTA 1UX7A 3DYMA 3T2OA 2Y6LA 2ORZA 1DYOA 5CYYA 3SKVA 4ARXA 4A45A 2VMEA 4E8DA 3SEEA 2JE8A 1GNYA 2VTFA 4QX1A 1DLCA 4M4PA 4QB6A 3CQOA 5G04L 2KD7A 3GGLA 3J7HA 3HNMA 3VD3A 2WO3A 2VJXA 1JYXA 2QQNA 2X05A 4P08A 4OYUA 5B4NA 4QPWA 4QAWA 3LEGA 3WF2A 3HJRA 2W3JA 2VZTA 4LKSA 2XQXA 2XOMA 2Y64A 4RN5A 1XC6A 3I3BA 3C7GA 4AG4A 2EIDA 3EB7A 1H6XA 3T09A 1PMJX 1PMHX 1GOFA 1EUTA 1XPWA 4DEQA 3K4ZA 1DP0A 2W87A 3WEZA 4AAXA 2J1AA 4P5YA 3NNGA 2BGPA 3LPFA 3T0DA 1W9TA 2YC2A 5JR2A 4QDRA 3FHQA 3IIIA 3IB3A 4PF1A 4QB1A 3WF4A 1JZ6A 1OH4A 2VOTA 4CU6A 3F2ZA 3I2GA 1GQPA 1D7PM 1W9SA 2J1UA 1UYYA 3HNBM 4QB2A 5IHRA 4MADA 4FI9A 2VMCA 2QQMA 2VZOA 4XURA 3HEIA 4QDSA 4OMCA 3ZM8A 4UAPA 4DXSA 3ETPA 3AC0A 2ID4A 2J7MA 3ECQA 5CZKA 2BERA 1IQDC 3CKHA 3GM8A 5JUVA 5IFTA 1JYNA 3UETA 3PUIA 2VL4A 3VD9A 4L0PA 2QQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1A A;  4GWI A;  5IJR A;  4MGQ A;  4QX3 A;  3VDA A;  1K3I A;  3U37 A;  2V5D A;  1RYY A;  3T0B A;  2WN3 A;  3THC A;  2BGO A;  1J83 A;  1JZ8 A;  1CZV A;  2RVA A;  1F4H A;  3BGA A;  1JZ5 A;  4XZU G;  1JU3 A;  4XUO A;  2VZS A;  4PT6 A;  5C70 A;  4IUG A;  2V4V A;  3WSO A;  2XHN A;  2J1E A;  3A7Q A;  1US2 A;  4ARY A;  2WZ8 A;  3HNY M;  3T2Q A;  3K4A A;  4HG6 B;  2YC4 A;  1UWW A;  3I3D A;  3T0A A;  2W95 A;  2DCK A;  2OKX A;  2WO2 A;  3WF3 A;  4A44 A;  2BBA A;  2R7E B;  2YG0 A;  3WQB A;  1LNS A;  2WUH A;  4W8J A;  2EIE A;  3VDB A;  3I2K A;  3C7O A;  4ZXE A;  3WNN A;  4BXS V;  3I2I A;  3WNK A;  1W9W A;  3C7E A;  2RV9 A;  3T2P A;  2ORX A;  5EIY B;  2L9L A;  3PUH A;  1HN1 A;  1GOG A;  1OT5 A;  5FUI A;  1O59 A;  2JDA A;  2WQ8 A;  2QQK A;  5JXH A;  2EIB A;  4DUV A;  1P8J A;  3MO4 A;  1UMI A;  1UY1 A;  3I2J A;  2CDP A;  4LQR A;  3C8X A;  3IAQ A;  1JI6 A;  1JYW A;  1MPX A;  3DYP A;  2PQS A;  2WAO A;  3NQH A;  4RYD A;  3T08 A;  2DCJ A;  3P1I A;  4Z2A A;  4MO3 M;  3WNO A;  5IYY A;  3THD A;  2J1T A;  1GU3 A;  1US3 A;  2W1Q A;  2ZEX A;  4BK4 A;  1W8O A;  3IAP A;  1CX1 A;  3CZJ A;  1JYV A;  2JD9 A;  5J1X A;  4OMD A;  3I97 A;  3LPG A;  1L7Q A;  3LEK A;  3OGR A;  5JMO A;  5B4X A;  3A23 A;  1PX3 A;  3VDC A;  4LPL A;  4QX0 A;  4QDQ A;  1WCQ A;  1UMH A;  3C7H A;  2XON A;  1KGY A;  4W50 A;  3K75 B;  1SDD B;  1OD3 A;  3CMG A;  4OUE A;  1UY3 A;  1UY2 A;  3MUZ 1;  2HLE A;  3I2F A;  2J1S A;  2W92 A;  4ZY9 A;  4XVH A;  3W5N A;  4ET7 A;  4CVU A;  4LHS A;  5DMY A;  1O8S A;  3WNP A;  2VQU A;  2QBX A;  2Y6H A;  1BHG A;  2X09 A;  1UYZ A;  2Y8K A;  4XUT A;  2LW8 A;  5DN2 A;  5LCW L;  3ACH A;  1CIY A;  5I0D A;  3NRU A;  3DEC A;  2X10 A;  1K12 A;  4CU7 A;  2W91 A;  2VM9 A;  2VZ3 A;  3K46 A;  2J1V A;  1UY0 A;  4A4A A;  3ACF A;  3WF1 A;  3I3E A;  1K45 A;  5DPN A;  5JXJ A;  3VD4 A;  1JZ3 A;  3FHA A;  3MV1 1;  3EYP A;  2WN2 A;  1W0N A;  1OF4 A;  1JHJ A;  1NKG A;  2YFU A;  2WZE A;  1OF3 A;  2ZEY A;  2QQL A;  2W9X A;  3IDA A;  3OGS A;  1GOH A;  4OZO A;  5LA2 A;  4YPJ A;  3SKJ E;  3OB8 A;  3FL7 A;  3HPN A;  3SEP A;  2E32 A;  5F7U A;  4DUX A;  1JZ2 A;  3W5M A;  2C4X A;  2J22 A;  3HOB A;  4KWU A;  2VO5 A;  2WO1 A;  4CUA A;  3MUY 1;  3MV0 1;  3OG2 A;  3OBA A;  4D8M A;  5EJZ B;  1F4A A;  2QQJ A;  2DDU A;  2E31 A;  2W1S A;  3NJX A;  4A3Z A;  3JXS A;  1JU4 A;  2VMF A;  2B4K A;  4E8C A;  2ZXQ A;  3I2H A;  2Z4F A;  2J1R A;  3VD5 A;  5HXM A;  1T2X A;  3LEI A;  3BN6 A;  2ZEW A;  4JKL A;  1UYX A;  2VZV A;  2VMD A;  4A41 A;  3D3A A;  4A42 A;  4TXW A;  2C26 A;  4CU8 A;  1SHW B;  3ACG A;  2E33 A;  3C7F A;  3HN3 A;  5JXI A;  4JKK A;  4W4Z A;  4DXR A;  3CIH A;  3OGV A;  4DXT A;  3P6B A;  4UI9 L;  2BZD A;  2VCC A;  3OEA A;  1YQ2 A;  3WNM A;  1PX4 A;  1ULO A;  5EJ1 B;  1UXZ A;  2WAA A;  3MBW A;  2HYX A;  2W1U A;  5C7G A;  2ZEZ A;  1UY4 A;  2W1W A;  1XNT A;  4PQQ A;  1XNA A;  2B9V A;  4P02 B;  2WYS A;  2W46 A;  1JZ4 A;  4D0Q A;  2VZ1 A;  2VZU A;  3E1F 1;  4MGS A;  1J84 A;  1GMM A;  2YB7 A;  2VZQ A;  4BJ0 A;  5IFP A;  3A21 A;  3DYO A;  4GWJ A;  1GUI A;  1L7R A;  5HPO A;  4ZZ5 A;  4CUB A;  2VC9 A;  2VCB A;  4M4R A;  3GDB A;  5LA0 A;  4BK5 A;  1CZS A;  4XUP A;  3CZU A;  2Y6K A;  1NAE A;  2C9K A;  1KEX A;  4CU9 A;  1TG7 A;  4QX2 A;  4XUN A;  1EUU A;  1CZT A;  2VR4 A;  4MOA A;  5C71 A;  1W8N A;  1K42 A;  2LS6 A;  2EIC A;  2E26 A;  3VD7 A;  3FN9 A;  4JX0 A;  3WNL A;  2VCA A;  4DUW A;  1WKY A;  2QQO A;  4P00 B;  1W99 A;  1R64 A;  4TTG A;  2WAB A;  4CUC A;  1NX9 A;  3WF0 A;  1H6Y A;  3LE0 A;  3OEB A;  4A6O A;  2RJ2 A;  4JHZ A;  5G05 L;  1JZ7 A;  2JKX A;  4XUQ A;  2W5F A;  2V72 A;  1I5P A;  4KMQ A;  4ZZ8 A;  3LQC A;  2WDB A;  3UNP A;  2YFZ A;  3K77 A;  1UZ0 A;  4DEV A;  3CDZ B;  3GXU A;  2Y6G A;  5JXG A;  3UES A;  2WBK A;  4UOJ A;  1SG3 A;  2W47 A;  3ACI A;  3ABZ A;  1ULP A;  3A22 A;  2VZP A;  3K4D A;  4KI5 M;  5DQ0 A;  3NJV A;  4GZ9 A;  4BDV B;  5LA1 A;  4JKM A;  2Y6J A;  1UXX X;  2CDO A;  1O8P A;  1TVG A;  2W94 A;  2VZR A;  1NUK A;  2VQT A;  1UX7 A;  3DYM A;  3T2O A;  2Y6L A;  2ORZ A;  1DYO A;  5CYY A;  3SKV A;  4ARX A;  4A45 A;  2VME A;  4E8D A;  3SEE A;  2JE8 A;  1GNY A;  2VTF A;  4QX1 A;  1DLC A;  4M4P A;  4QB6 A;  3CQO A;  5G04 L;  2KD7 A;  3GGL A;  3J7H A;  3HNM A;  3VD3 A;  2WO3 A;  2VJX A;  1JYX A;  2QQN A;  2X05 A;  4P08 A;  4OYU A;  5B4N A;  4QPW A;  4QAW A;  3LEG A;  3WF2 A;  3HJR A;  2W3J A;  2VZT A;  4LKS A;  2XQX A;  2XOM A;  2Y64 A;  4RN5 A;  1XC6 A;  3I3B A;  3C7G A;  4AG4 A;  2EID A;  3EB7 A;  1H6X A;  3T09 A;  1PMJ X;  1PMH X;  1GOF A;  1EUT A;  1XPW A;  4DEQ A;  3K4Z A;  1DP0 A;  2W87 A;  3WEZ A;  4AAX A;  2J1A A;  4P5Y A;  3NNG A;  2BGP A;  3LPF A;  3T0D A;  1W9T A;  2YC2 A;  5JR2 A;  4QDR A;  3FHQ A;  3III A;  3IB3 A;  4PF1 A;  4QB1 A;  3WF4 A;  1JZ6 A;  1OH4 A;  2VOT A;  4CU6 A;  3F2Z A;  3I2G A;  1GQP A;  1D7P M;  1W9S A;  2J1U A;  1UYY A;  3HNB M;  4QB2 A;  5IHR A;  4MAD A;  4FI9 A;  2VMC A;  2QQM A;  2VZO A;  4XUR A;  3HEI A;  4QDS A;  4OMC A;  3ZM8 A;  4UAP A;  4DXS A;  3ETP A;  3AC0 A;  2ID4 A;  2J7M A;  3ECQ A;  5CZK A;  2BER A;  1IQD C;  3CKH A;  3GM8 A;  5JUV A;  5IFT A;  1JYN A;  3UET A;  3PUI A;  2VL4 A;  3VD9 A;  4L0P A;  2QQI A; 
#chains in the Genus database with same CATH topology
 2WSU A;  2JEM A;  4GWI A;  5E16 A;  4MGQ A;  1DHK B;  1VRH 3;  1K3I A;  1PGS A;  2WS9 1;  3ZFE B;  1HB2 A;  1MS4 A;  1OXC A;  4M0N A;  2D5F A;  4XQ4 A;  5IK4 A;  2XBO 3;  2BFU L;  2BGO A;  4UFI A;  5BNP C;  4ONU A;  5BNN B;  3KGZ A;  5FZH A;  5A3W A;  4QQP A;  4DFS A;  1F4H A;  3TEZ A;  4CP2 A;  4MYE A;  2OZJ A;  2R16 A;  1GWM A;  1RXF A;  2GDF A;  2GC3 A;  5CKM A;  4ATE A;  4AYU A;  4D7Y A;  4YGB A;  1S0B A;  4EZH A;  1DDL A;  2NMO A;  2IXI A;  2Z5W A;  4PF5 A;  4YVW C;  1ULE A;  2VZS A;  4QMA A;  4EV0 A;  2JIC A;  5C70 A;  1YXW A;  2ZGL A;  3ZMO A;  2MNG A;  2D40 A;  3WXP A;  1KJL A;  1ZBA 1;  2PHU A;  2V4V A;  1X9T A;  1LHO A;  3WSO A;  4GAL A;  3T4V A;  4GB3 1;  2WNU A;  4LBL A;  4EYU A;  3CJI B;  4Z1V A;  3WW2 A;  2W0X A;  4R9C A;  5BYN A;  2I2S A;  1VBC 2;  1RUG 1;  3VZM A;  2WZ8 A;  3MFA A;  3T2Q A;  1GQG A;  1R09 1;  4L9B A;  4NPR A;  2YC4 A;  4I01 A;  4Q4W 1;  1UMZ A;  1VMF A;  4ZS3 A;  2DCK A;  3PNA A;  4LBM A;  5JZG B;  2FDG A;  1RUC 3;  2CWM A;  1TNF A;  2QCS B;  4AI9 A;  5CFD B;  2I74 A;  5T5P A;  2BBA A;  1H8T C;  1D2Q A;  1W3V A;  1Z7S 2;  1HQN A;  2PFW A;  4K6B A;  5JSR A;  4PLM A;  1TQ5 A;  2FMD A;  5A1L A;  5DAQ A;  2BNN A;  3I2K A;  4PDW B;  3C7O A;  3WLU A;  3WUD A;  2OA2 A;  4BXS V;  3S57 A;  2HWC 2;  3C7E A;  4LBO A;  4S2F A;  3RRD A;  3T2P A;  1LJ7 A;  2E9Q A;  1OKQ A;  1AR9 3;  5IK8 A;  3PUH A;  1HN1 A;  1WCU A;  4HLT A;  2HH9 A;  3KVB A;  2PMW B;  4HK9 A;  1OT5 A;  2VQ0 A;  3SCF A;  1IPS A;  4A7K A;  5JXH A;  4FOV A;  1UQX A;  4NPM A;  1ZZB A;  1P8J A;  1SPP A;  2PXJ A;  3O1T A;  1QDC A;  2WYF A;  1WMF A;  1E57 A;  1HB4 A;  5LBE A;  1W6O B;  3HN1 A;  1C1F A;  4LQR A;  2QKD A;  4CE8 A;  1CAU A;  4M3C B;  2XUE A;  4K1Z A;  5K4L A;  2PQS A;  3U78 A;  5L7O C;  4PLN A;  1H8T A;  4YW7 A;  1O7F A;  3AXE A;  4AE2 A;  4QPY A;  2DCJ A;  3ME2 A;  4HVQ A;  5JDB A;  2ZX0 A;  4Q29 A;  1DQ6 A;  1IPJ A;  4AFC A;  2Q0A A;  4IV1 B;  1LOE A;  1GU3 A;  1WWY A;  5B2G B;  1DGR A;  1DQ0 A;  3KVA A;  4JVA A;  3WP6 A;  1SFP A;  4FXK B;  2WZR 1;  3D5O A;  5DXD A;  2IXL A;  1YWK A;  2Y0I A;  4HFS A;  2QJV A;  1JYV A;  2XML A;  4OMD A;  4CEW A;  2A70 A;  2ZMK A;  3JBG 2;  4YFZ A;  2A6Z A;  4Q27 A;  1NA1 C;  5FPU A;  4GQ7 A;  4GB3 3;  1UKR A;  4KQ7 A;  4BWO A;  3ZFG C;  3ZXL A;  4LPL A;  3HT1 A;  1UPS A;  3ZYJ B;  1RUG 3;  2BU9 A;  4YM2 A;  3UT0 A;  3W20 A;  4W50 A;  3PUA A;  3ZSK A;  3K75 B;  3BCW A;  3PIJ A;  1R09 3;  1SDD B;  3HBK A;  1CD3 G;  3DF0 A;  4Q4W 3;  1UY3 A;  4IEY A;  3MUZ 1;  1ZVF A;  3I2F A;  2N7G A;  2VMH A;  4ZY9 A;  2IWG B;  4XVH A;  1JHN A;  3W5N A;  5FO7 B;  4S2G A;  2CSG A;  4CYD A;  3FHI B;  3BPZ A;  5FYB A;  4CDQ C;  2ZGS A;  1REE A;  3AYE A;  5FPV A;  4D6S A;  3U4S A;  4FSJ A;  2QTW B;  1COV 1;  2PLV 1;  4XUT A;  1OOP B;  2P17 A;  2UYA A;  1V70 A;  1YQ8 A;  1NOV A;  1RHI 2;  2NQY A;  3AP6 A;  1CIY A;  1J3Q A;  1WME A;  3GCX A;  5FZ8 A;  3K48 A;  3NRU A;  3VLB B;  5GZC A;  3LB9 A;  1B35 B;  4LNV A;  4AI3 A;  1UZW A;  4CU7 A;  5A7N A;  5JOX A;  2VZ3 A;  3K46 A;  3NKT A;  3Q8C A;  3OPT A;  1UY0 A;  4QGM A;  1RUF 2;  2SBA A;  3ACF A;  3WF1 A;  4AL9 A;  3VBR C;  1GSL A;  1RUJ 2;  3I3E A;  3T1M A;  4IE5 A;  2XL7 A;  1BK0 A;  4B4Q A;  4CP9 A;  2BEO A;  4Q4V 2;  4LR4 A;  4XFG A;  3AMH A;  4NAO A;  1JZ3 A;  1F8V A;  3R4U A;  2ZCW A;  1RL3 A;  2XLF A;  1A6C A;  1W8W A;  1RUE 2;  2JX9 A;  5F3G A;  3EQE A;  1NKG A;  1SMV A;  4YFW A;  3AKP A;  1K5M C;  1IOA A;  4E9K A;  4HAN A;  2ZEY A;  2QQL A;  1NY7 1;  2W9X A;  3KV6 A;  5LA2 A;  2P4E A;  4CTE A;  4Y22 A;  3SKJ E;  3IDC B;  5KXE A;  3OB8 A;  5LEK A;  4O61 A;  2HEW F;  1HXS 1;  1F15 A;  2E32 A;  2QDN A;  3SEP A;  5F7U A;  3W5M A;  4Z07 A;  2UWB A;  2ZX4 A;  3MIH A;  2WZR 3;  2VO5 A;  1XND A;  3NV3 A;  4CUA A;  1QNW A;  3OBA A;  2DU0 A;  2ZML A;  3M2M A;  3MDP A;  1YCI A;  2DDU A;  5FJK A;  4JHT A;  2OUJ A;  3ZYG A;  4A3Z A;  4CDX A;  4NWV A;  2VMF A;  1W8T A;  4OZX A;  2ZXQ A;  3FFQ A;  1FI2 A;  2VNG A;  2RDN A;  1GZW A;  1MEC 1;  3VL8 A;  1GNZ A;  1Q5O A;  5FYV A;  3VD5 A;  3KD4 A;  3PMS A;  4DOU A;  3D0S A;  4FP3 A;  3N35 A;  3BN6 A;  3KCC A;  1J3P A;  1WUV A;  5T5J A;  3ZYF A;  2VMD A;  1UF2 C;  2Q5T A;  5FOJ B;  5D8A A;  2C26 A;  2G1M A;  2D6P A;  4FO9 A;  1N47 A;  2VOV A;  4GJY A;  5FYM A;  3ACG A;  4K20 A;  4L97 A;  4AEJ A;  2K46 A;  4YSF A;  3OUI A;  2A73 B;  1QJU 1;  4W4Z A;  3RZJ A;  4ZS2 A;  5FKB A;  1WLT A;  3LZZ A;  3OGV A;  3AZV A;  3LF7 A;  5GLV A;  1WCS A;  2MHF A;  2MPF A;  2IFR A;  2XVG A;  5FQ0 A;  1COV 3;  4PHZ A;  4UI9 L;  2BZD A;  2VCC A;  4BYY A;  3DXT A;  1IS3 A;  3OEA A;  1YQ2 A;  2GP3 A;  4TYS A;  3WNM A;  1CJD A;  1YC6 1;  3BVC A;  4LHL A;  4HT1 T;  4YW3 A;  3PVN A;  2ARA A;  1VBB 1;  1SLL A;  2P3I A;  4YZ1 A;  5L9R A;  2RS5 2;  2AGS A;  2WKK A;  1MAC A;  3AP4 A;  3PUR A;  5T54 A;  4BB3 A;  4GH4 B;  3MBW A;  4EN8 B;  2HYX A;  4CRQ A;  1AJO A;  3R0R A;  1UY4 A;  1ZNP A;  4JGY C;  2A6W A;  5E88 A;  1WD4 A;  2B9V A;  2RJK A;  1XBF A;  3QH7 A;  4I02 A;  1FXZ A;  1QH7 A;  2DTY A;  3KF5 A;  3PU3 A;  4W6X A;  2WYS A;  2B9U A;  5FLJ A;  5LBF A;  3D8C A;  1POQ A;  1AL2 1;  1QIQ A;  3BOP A;  3APB A;  2VZU A;  3ZXD A;  4D0Q A;  1Q8O A;  3E1F 1;  4QKF A;  3CEW A;  4FPF A;  5IAT A;  1DQ2 A;  4MVT A;  5JLV A;  4HMZ A;  2VNO A;  3AZZ A;  5FWE A;  4BCU A;  5J3U A;  1BQP A;  1RUD 2;  3WOG A;  5IK5 A;  2HWF 2;  4W6W A;  4YLZ A;  1HXS 3;  3QOP A;  1KQR A;  1JBC A;  1MZF A;  5IFP A;  2R6Q A;  1D4M 2;  3AXD A;  2ETE A;  5FZM A;  3B9I A;  5FK8 A;  4X6R B;  3VBO C;  2O8Q A;  3H0O A;  3OUJ A;  1Y9G A;  3AVS A;  2X53 S;  3LDR A;  2FCU A;  5BPX A;  5CVR A;  4C90 A;  5C4W C;  2VCB A;  4LHK A;  3FUQ A;  2XUM A;  3LOI A;  4AQT A;  5A32 A;  1POV 0;  3PJY A;  5GLW A;  3THT A;  4FTE A;  3ZO0 B;  4QKD A;  2PHW A;  1ZRC A;  3R6S A;  1OD5 A;  3MIE A;  4NRP A;  4BK5 A;  3L2H A;  4URT A;  3UJO A;  4BOW A;  1MEC 3;  4O65 A;  1KD7 A;  5L73 A;  2ZKN A;  4SBV A;  5EWS A;  1H4G A;  4RA0 A;  2Y6K A;  2GAU A;  4RS5 B;  4LOT A;  5A3M A;  2CTV A;  1LOF C;  5D2A A;  1CZT A;  4XCA A;  1WGP A;  2D6M A;  3NST A;  3RYK A;  5EYX A;  3U14 A;  2E26 A;  4UT5 A;  3VD7 A;  3FN9 A;  3TB0 A;  2A3X A;  4AQS A;  3ZN5 A;  5E6H A;  2RR1 2;  2XLA A;  1WBF A;  5CAZ A;  4RR3 B;  1LED A;  2YZ4 A;  3T3Y A;  1QJU 3;  2A1X A;  2AC1 A;  4M3C E;  3CO2 A;  2BNM A;  1W99 A;  4Y1V A;  3RDI A;  4FFG A;  2HBU A;  2HYK A;  4TTG A;  1WCD J;  5FZ3 A;  2HEV F;  5IVV A;  2C6S A;  4DNY A;  1GIC A;  2RJ2 A;  4D69 A;  4KWL A;  4TZD A;  5GJ6 A;  4DMI A;  1NZI A;  3OYW B;  2YGM A;  2FMY A;  4FQ4 A;  4YVS C;  1VRB A;  2YU2 A;  3QH6 A;  3SH3 A;  4AXO A;  1SLI A;  2Q8E A;  1QJX 1;  2A3W A;  2V72 A;  4KMQ A;  4XF1 A;  5IVY A;  4IEV A;  3BTA A;  5A7Q A;  5KXB A;  1H9P A;  3OSD A;  2EIG A;  2WDB A;  3D0J A;  4LBN A;  3RG0 A;  5FZ4 A;  1H30 A;  2YFZ A;  3KCY A;  4Y1X A;  1VBB 3;  4CUG A;  4DEV A;  3VHO A;  3TNP B;  3WP3 A;  1AX2 A;  3GXU A;  2Y6G A;  3ZFE A;  3ILR A;  4CDU C;  5HI0 A;  1LOF A;  3EO6 A;  2GH2 A;  4O7X A;  3V0A A;  2PHL A;  4IGP A;  2E6V A;  1FMD 3;  5BNN A;  2DCZ A;  3ABZ A;  3RNS A;  4N43 C;  2JE9 A;  2VZP A;  3K4D A;  1FPN 2;  4K8R B;  4IGO A;  3QLQ A;  2RG4 A;  5DQ0 A;  4HET A;  3AYC A;  2Y26 A;  3SLI A;  2ATF A;  4YZ2 A;  1AL2 3;  4Q26 A;  4FOQ A;  3O1P A;  3M3C A;  3VBF B;  5LA1 A;  5A6X A;  2RJL A;  1D2S A;  1S0E A;  5LA9 A;  1YHF A;  3MF6 A;  1Q43 A;  1DQ5 A;  1ENX A;  2EAK A;  4UW6 A;  1KDK A;  2JDP A;  4K7J A;  1A8D A;  1UX7 A;  4P9J A;  4RL7 A;  3N9N A;  4XDQ A;  5FYC A;  3WUC A;  5JSO A;  1DGW X;  4WBB A;  4COU A;  2Y6L A;  1LEM A;  4P9X A;  4UBG A;  3ZFF C;  3RZG A;  3ES1 A;  5BNP B;  4G9S B;  1N1T A;  4Q0Q A;  5FZG A;  1VB2 A;  2VME A;  4ARX A;  1LGB A;  1LES A;  3ZXF A;  2Y33 A;  1ZRR A;  1AZD A;  5GZE A;  4CDU A;  4AHZ A;  4CCM A;  4EN9 B;  2MEV 1;  4QB6 A;  5I0T A;  2VUL A;  4F8A A;  4YVW B;  3SH5 A;  1U5X A;  3GGL A;  1BEV 2;  4FPG A;  4XXP A;  4WM8 C;  1GR3 A;  4RGK A;  1JUH A;  1LU2 A;  5AVP A;  3AB0 A;  4UXA A;  4NID A;  4XXA A;  2QQN A;  3GNE A;  3M3E A;  3B3Q E;  1C57 A;  4KG0 A;  1DYK A;  4LKF A;  4ZPI A;  3SMH A;  3WDU A;  3WHT A;  4QKB A;  3VDD B;  4QPW A;  4QAW A;  5KR7 A;  1NLS A;  3WF2 A;  2ZBJ A;  4N9H A;  2Q1M A;  3FBY A;  2JDY A;  1BBT 2;  3USU A;  2XOM A;  2Y64 A;  4RN5 A;  3RSJ A;  1WMX A;  3U1X A;  4CCK A;  5LB6 A;  3WG2 A;  1ZZ7 A;  3ZFF A;  4OI1 A;  3I3B A;  1NCR B;  1APN A;  2ZZQ A;  3C7G A;  4P9G A;  3VL9 A;  3O1R A;  3HD8 B;  2EID A;  3EB7 A;  1BJQ A;  2WA3 A;  1MQT C;  1OQD A;  1QJX 3;  2XPJ A;  1W6O A;  4NHM A;  2GH8 A;  1PMH X;  4YM3 A;  3BI3 A;  1CX4 A;  4C1X A;  1GOF A;  2AAC A;  5DDJ 2;  1WD3 A;  3K4Z A;  5JI7 A;  1DP0 A;  2JD4 A;  1YQ5 A;  2W87 A;  1LOG A;  5BNO C;  2YDE A;  3QBQ A;  5DAX A;  4RD7 A;  4LA2 A;  3JQX A;  2QVS B;  3NNG A;  5FMO S;  3LPF A;  3MGU A;  2YC2 A;  3HT2 A;  1G9D A;  4LBQ B;  1OFS A;  1CES A;  1Z7S 1;  5FXW A;  3I2O A;  2EAA A;  3W59 A;  4IV1 A;  2ZX3 A;  5ABJ C;  2VGD A;  3ELN A;  1Q8V A;  3GYD A;  3KV4 A;  2QDR A;  4QDR A;  5KC6 A;  4UFL A;  3FHQ A;  4I30 A;  4Y5Z 0;  4S2H A;  1S0C A;  4Z82 A;  3SQO A;  2NPI A;  2UYB A;  3FC0 A;  4QB1 A;  5CU1 A;  4XFI A;  4FPH A;  3WF4 A;  4QXC A;  1OH4 A;  3RJ2 X;  2HWC 1;  3VHP A;  2ZZJ A;  3ZKY A;  1Y9M A;  1YFW A;  3O7O A;  5FRE A;  1D7P M;  5JPN B;  1Y9Q A;  2DVG A;  1AR8 2;  2J1U A;  1F31 A;  3HNB M;  4RQP B;  1W28 A;  1MQT A;  1LAJ A;  1RUI 2;  3VGI A;  5F32 A;  3BB6 A;  4ASL A;  1A3K A;  4PLO A;  3P3N A;  1RC6 A;  4Q4X 2;  3WDY A;  1ND3 B;  1DZQ A;  3ZM8 A;  4NRO A;  1SLC A;  1IQA A;  2C24 A;  1IZ3 A;  4EJR A;  3ETP A;  2ADE A;  4K8F A;  2ENR A;  4H14 A;  4BM8 A;  2MEV 3;  3PJQ A;  1VR3 A;  1XRU A;  4R4X A;  1QJY 2;  1UU5 A;  1IS6 A;  3MPB A;  1HV1 A;  3DUI A;  2BW8 A;  2WO7 A;  4KU8 A;  5AVA A;  1SBF A;  2KXL A;  1ZA7 A;  4P14 A;  1UN1 A;  1WW7 A;  2PAE A;  4XJ8 A;  2JDN A;  4XAE A;  4AW7 A;  5A1A A;  3O1M A;  3LIG A;  4PQ9 A;  1OOP A;  1TME 2;  4NPL A;  5FIX A;  1NCQ C;  3VDA A;  4K3U A;  1V6L A;  2FD8 A;  1X7N A;  3PDQ A;  4AI2 A;  5C9A B;  1RYY A;  5C8W A;  3JBG 1;  3ZYI B;  2F6B A;  1B35 A;  3N7K A;  2G19 A;  4XJA A;  1J83 A;  1CJP A;  3ZYB A;  5FY1 A;  4CP1 A;  1C8N A;  4COW A;  3ZSM A;  1QOO A;  1CZV A;  2RVA A;  1ASJ 2;  3U07 A;  3TEY A;  2JEN A;  4Q0P A;  4XZU G;  3ZYR A;  1JU3 A;  2X5I B;  3H7J A;  1D0H A;  1MZ6 A;  3NAP C;  5FBZ A;  5SV8 A;  1CIW A;  4LLO A;  4E4D X;  1JS9 A;  1XB9 A;  1GP4 A;  5F1R A;  1OC1 A;  5HBA A;  3ZXG A;  2VCM A;  5IVB A;  2D3P A;  1UU4 A;  4TN7 A;  3VBU B;  4ZHN A;  2A75 A;  4DY5 A;  5T52 A;  4Y20 B;  2VOW A;  1HRV 2;  4CXX A;  1V6I A;  3A7Q A;  3E5U A;  1Z7S 3;  4NRQ A;  4XJU A;  2OYZ A;  4FOW A;  4CP0 A;  5HCH A;  4GUL A;  4K1Y A;  4AK3 A;  3IIA A;  3ATG A;  3K4A A;  4E4Z A;  1NCQ A;  4LUL A;  3E97 A;  4E27 A;  1LRH A;  1W2U A;  2JG9 C;  1W3X A;  2W95 A;  1RHI 1;  4HVO A;  4LIU A;  1H0B A;  4QX5 A;  2HWC 3;  3ASI A;  4QPI C;  2WO2 A;  1OLR A;  2K0G A;  1OMI A;  2BOI A;  2P2K A;  4N7I A;  4QPG B;  4XBL A;  4JGZ C;  1LNS A;  4U36 A;  5F3I A;  3RWN A;  3URF A;  1T6B X;  4PJY A;  4DZG A;  1RUF 1;  2WJS A;  2EIE A;  2V5Y A;  4LEJ A;  3RI9 A;  5ACA 2;  4FFI A;  1RUJ 1;  2B46 X;  1A34 A;  1ZM1 A;  5KHI A;  1G86 A;  3MIC A;  4Y4R A;  3WNN A;  4R52 A;  1S0D A;  4Q4V 1;  2VW1 A;  1JOD A;  1ND2 B;  1RUE 1;  4MSV A;  1R08 2;  1GOG A;  4HVR A;  2PN5 A;  2TEP A;  3IBM A;  3OBT A;  4L11 A;  1O59 A;  4LOS A;  4BHP A;  3DPR B;  4CDW B;  4MGK E;  1OLQ A;  4DUV A;  4MXW A;  4QXH A;  2GC2 A;  3TWI A;  3LFM A;  2LAL A;  4CPB D;  2B5H A;  2DWR A;  3I2J A;  2C1F A;  5FY4 A;  3C8X A;  3RZH A;  5FZ6 A;  3ZSE A;  3N9Q A;  4JQT A;  5DUW A;  1H1A A;  3MW4 A;  4XBN A;  2VUC A;  3T08 A;  2WLQ A;  2XKO A;  5A33 B;  3JBG 3;  3A4U A;  4MO3 M;  4AVB A;  3WNO A;  1AXZ A;  4HZF A;  4LK7 A;  4FFH A;  3THD A;  3H1M A;  4HKL A;  1XU1 A;  1ZBE 2;  3PUQ A;  4OI2 A;  4C8D A;  4HPK B;  1GWK A;  2D97 A;  3WCS A;  2ZHM A;  4XMI A;  4WM7 C;  1R1A 2;  2XJP A;  1XOY A;  1W8O A;  1OPM A;  2XG3 A;  4JDO A;  3RZZ A;  1RUH 2;  4I3P A;  1ZRF A;  4KBZ A;  5C8C B;  3CZJ A;  5FZA A;  1AUY A;  2JD9 A;  4Y26 A;  1UZV A;  2HWE 2;  3WG4 A;  1L7Q A;  1O4Y A;  3LEK A;  4NN0 A;  5IWF A;  1TNR A;  1W6Q A;  5LK7 B;  1LUL A;  4UF0 A;  3A23 A;  4FPE A;  3VDC A;  4Q0U A;  5I0S A;  1OFN A;  2K2S A;  1WCQ A;  5DAB A;  3ZDS A;  4ATF A;  3GZU C;  1PZ7 A;  3VHR A;  3LDB A;  5A3P A;  4OUE A;  1C5I A;  2WA4 A;  4YW5 A;  4JRL A;  2VBP A;  5CIS A;  1RHI 3;  2XQR A;  1NXD 1;  3FJS A;  1YO8 A;  4LMF A;  3KM5 A;  1WBL A;  2F4P A;  1EY2 A;  3FZ3 A;  4PI2 A;  4XTP A;  3I59 B;  4DO0 A;  1NLR A;  2OVU A;  1HW5 A;  5FCC A;  1SQ4 A;  3KCX A;  2WNU C;  3WNP A;  3ZPO A;  3BTX A;  1RUF 3;  4F83 A;  1HRI 2;  2RS5 1;  4QKN A;  1RUJ 3;  2VBB A;  2B8M A;  2OX0 A;  3PVB B;  3QAC A;  3HQX A;  3VN4 A;  3O1U A;  2JG8 B;  4XF4 A;  3P5B A;  1C28 A;  4B1L A;  1OQ1 A;  3CLP A;  3ACH A;  4KU7 A;  4Q4V 3;  4B1M A;  4B8E A;  1A78 A;  2OZ6 A;  5LCW L;  1NE4 A;  4UW3 A;  3DEC A;  5F5Q A;  4DIQ A;  3HR9 A;  1RUE 3;  4UYB A;  4YRD A;  1GV9 A;  3WP5 A;  3WW1 A;  1N1S A;  2BRT A;  2DYC A;  2W91 A;  5FY7 A;  2FDI A;  1MZE A;  2VM9 A;  1QXR A;  2IXJ A;  2VUA A;  4RR3 A;  3PVE A;  4I2O A;  2C9A A;  1RUD 1;  2CWS A;  2HEY F;  4OUS A;  1XXN A;  5DPN A;  2HWF 1;  3AYD A;  4XAA A;  5KHH A;  1OA4 A;  3Q9O A;  4Q8K A;  1D4M 1;  1LR5 A;  1O6U A;  2OXB A;  3JZV A;  1W0N A;  1JHJ A;  2D6L X;  3OYW A;  4JC1 A;  2DTW A;  1YJK A;  3ZXE A;  4YAR A;  1YI7 A;  2GN3 A;  2R49 A;  4FPK A;  5DAV A;  1G9B A;  1OF3 A;  1J1L A;  1OH3 A;  3OGS A;  1GOH A;  1H2L A;  4I3G A;  2FHR A;  4OZO A;  5K0U B;  4CEY C;  4B4P A;  2VUD A;  1G8W A;  1OUX A;  2YMZ A;  3FL7 A;  4L92 A;  3HPN A;  2ARE A;  3SC7 X;  1R1Z A;  1VJ2 A;  1KDM A;  4DUX A;  4M00 A;  1DGR N;  3LA7 A;  1MR5 A;  4WVZ A;  2ET1 A;  1W39 A;  4KWU A;  4AFB A;  4E2S A;  4CXW A;  1UZZ A;  3KGL A;  1QHD A;  3EHK A;  1GZ9 A;  3ZMN A;  4LIV A;  4D7T A;  3MUY 1;  3MV0 1;  1W6M B;  5F5A A;  4D8M A;  3VBS C;  5EJZ B;  2E31 A;  4EN7 B;  5FXX A;  2W1S A;  1NXM A;  4QM9 A;  2VY0 A;  2JE7 A;  3GBW A;  4H3W A;  1C8M 2;  2P3Y A;  2ZX1 A;  3I2H A;  1UOB A;  2NM1 A;  3H42 B;  2RR1 1;  4ISR A;  5I91 A;  3VUO A;  2VTX J;  1CAV B;  2J1R A;  3VBF A;  3RGB A;  5FZI A;  2XJQ A;  3NNL A;  5HXM A;  1T2X A;  4EWD A;  3WVJ A;  5J7M A;  3N4M A;  2WFF 2;  2JXA A;  5GLU A;  4MUV A;  4HSL A;  1WLC A;  3AMQ A;  4JKL A;  1IHM A;  1B09 A;  1VBE 2;  2BPA 2;  4EN6 B;  1PK6 B;  1DQ1 A;  2WRA A;  3D3A A;  4Y5S A;  4A42 A;  4AWD A;  2ZGQ A;  2DFB A;  1LHN A;  1SHW B;  3FFZ A;  2DBN A;  4CEY A;  5ANQ A;  3R4S A;  3C7F A;  3HN3 A;  5JXI A;  2P6C A;  4CEW C;  1N3P A;  5J36 A;  4AED B;  1G9F A;  2AH2 A;  4BIF A;  3BAL A;  1CWP A;  2B45 X;  3OBR A;  4Y24 A;  4YW4 A;  2RS5 3;  3J7N A;  5DAW A;  1XNB A;  3VBS A;  2PTM A;  1H1M A;  5DUX A;  3AKT A;  4LTA A;  1SAC A;  3TNQ A;  3BOW A;  3B9C A;  5FZC A;  1W6N B;  5LWB A;  4TLF A;  1BZW A;  1LOB A;  3BPS A;  1KXG A;  1JOJ A;  2WT0 A;  1PX4 A;  3AP9 A;  5HCF A;  5KHG A;  5L9V A;  2CY6 A;  4R9A A;  1DG6 A;  2WWU A;  3VDD A;  4BQ3 A;  5FLI A;  4XF3 A;  4Y1Z A;  2G9G A;  1UXZ A;  4XW3 A;  4UBH A;  1GAN A;  1HIX A;  3VZN A;  1RUD 3;  1YQ6 A;  4BQ1 A;  3O1S A;  3POE A;  2HWF 3;  2ZEZ A;  4WZF A;  2VE1 A;  4AHW A;  1FOD 2;  1AR6 2;  1W2O A;  1XNA A;  2WR9 A;  2RDS A;  1D4M 3;  2A6V A;  4P02 B;  1F9K A;  2IXC A;  5DG1 A;  3M3I A;  1NCR A;  4B4R A;  3AL5 A;  1S4C A;  4QX7 A;  4F7Z A;  3MZH A;  2VW0 A;  3ENR A;  5IUQ A;  1DF0 A;  1LOA A;  2P34 A;  2FZ1 A;  2XR4 A;  3WV6 A;  2DVA A;  5BNQ A;  5JWP A;  1UOF A;  2VZQ A;  4A3X A;  5A1F A;  2DVB A;  2V4A A;  4J1X A;  5J98 B;  4O9G A;  2D6N A;  4BQW A;  2QNK A;  3WNX A;  3B94 A;  2FCT A;  3DYO A;  4GWJ A;  1BEV 1;  4LBQ A;  4GXL A;  1EV1 2;  5T3N A;  2I45 A;  2JB4 A;  1W9Y A;  4ZZ5 A;  3TAY A;  4CUB A;  4MGI E;  4UFK A;  1LB2 A;  5FY8 A;  3RZL A;  3AK0 A;  1O5L A;  3OBZ A;  1KRI A;  2A6X A;  4IE4 A;  2JDZ A;  4IV3 B;  5IT6 A;  5LA0 A;  2RR1 3;  3E5Q A;  1ST8 A;  2R0H A;  1DGW A;  1YYN A;  1ENQ A;  1NAE A;  4FPC A;  1BBT 1;  4CCN A;  4CU9 A;  1KEX A;  3RQ0 A;  2BBV A;  1NQJ A;  3KQ4 B;  4K21 A;  1EUU A;  1PGW 2;  1QQP 1;  2DCT A;  3PTY A;  4MOA A;  4N90 A;  4RQP A;  4XMA A;  1BMV 2;  2BJS A;  5GLT A;  3RYP A;  2EIC A;  3OOX A;  5FZD A;  1UO9 A;  1N3Q A;  2XKP A;  3ZXK A;  1H1I A;  4FAH A;  4NR1 A;  4MXV A;  5DDJ 1;  1Y43 B;  2OQ7 A;  3OGG A;  4CDX C;  4YW2 A;  1UD1 A;  4EWE A;  5ABJ B;  4OHZ A;  1R64 A;  1UAI A;  2Q4S A;  2VEC A;  4LO8 A;  4SLI A;  3ZKU A;  1NX9 A;  3AKR A;  4HXC A;  1H6Y A;  3OD0 A;  3OEB A;  5FY5 A;  4LJH A;  1SFY A;  1VMH A;  1VLN A;  2BVB A;  2EXK A;  2WT1 A;  4MLO A;  4NHX A;  4PBO A;  5G05 L;  5FP4 A;  3ZN6 B;  4CCL A;  1BVP 1;  2UUR A;  4XUQ A;  3OPZ A;  4JTO A;  3J7M A;  2W5F A;  5FMO L;  4AF9 A;  1MS0 A;  1I5P A;  5FTT C;  3RFR A;  4YNI A;  2GZW A;  5D8A C;  5A7W B;  2WQZ C;  4ZZ8 A;  5J48 A;  3LQC A;  4FFF A;  4WVV A;  3UNP A;  3PU8 A;  3K77 A;  3GHN A;  1SLA A;  2LRP A;  3CBN A;  3FE5 A;  1UZ0 A;  1VAV A;  4XAB A;  2R06 2;  1UCX A;  1O5U A;  4QXB A;  5C9A A;  1HN0 A;  2ERF A;  2TNF A;  1SG3 A;  5F6L B;  3WIN E;  2G9F A;  3HQR A;  2R04 1;  3JB4 C;  3ACI A;  5A70 A;  5T5L A;  1XSQ A;  2WLP A;  4LLF A;  1GZC A;  4BZ4 A;  4KI5 M;  1I5Z A;  2NYY A;  1RUI 1;  1MS9 A;  1D0G A;  2X5I A;  2R07 2;  3PVO A;  3PLQ A;  1BXH A;  1JW6 A;  1YI9 A;  2UY8 A;  4Q4X 1;  5BV6 A;  2FDH A;  2XBO 2;  1VAK A;  3GZT B;  2FQP A;  3ZSJ A;  3ETQ A;  4AVV A;  4AI0 A;  1SBE A;  2YBS A;  4XCB A;  3VBH B;  5C3P A;  1IPK A;  1UXX X;  2ARX A;  2A5Z A;  1CPN A;  2CDO A;  5GM0 A;  3VBU A;  3KT7 A;  1W9F A;  2H6B A;  2W94 A;  2D43 A;  4H7M A;  4HOO A;  1QJY 1;  4Y20 A;  2VQT A;  1HQW A;  3OGJ A;  5FY0 A;  4AQ2 A;  1PHM A;  5IVF A;  1BEV 3;  1Y7B A;  3BOD A;  1UKG A;  4AOC A;  4Y4Y A;  1GFF 2;  1LEC A;  3D82 A;  1Y3T A;  1DYO A;  1QXJ A;  4HN0 A;  5F3C A;  3NKG A;  4A45 A;  4E8D A;  3OUH A;  1PZ9 A;  4HKW A;  1AX0 A;  2VOK A;  1DLC A;  3RPQ A;  4M4P A;  3LCP A;  4XFF A;  2YY1 A;  2D6K A;  4M0H A;  3U10 A;  1ZRE A;  3AMP A;  4QPG A;  2KD7 A;  4IEO A;  2GNM A;  1M06 G;  1BBT 3;  2HKX A;  3NV2 A;  1ASJ 1;  3AKS A;  5I8Y A;  1QQP 3;  1W8Z A;  2KA3 A;  3ON7 A;  4NHK A;  4A6S A;  2JWP A;  3OY8 B;  1RUC 2;  5JVV A;  5B4N A;  1I6X A;  3LEG A;  3GJA A;  2VZT A;  1ND2 A;  1S0F A;  2IUW A;  4YG0 A;  2ZGR A;  2ZOE B;  4FQZ A;  4J1W A;  5DDJ 3;  5E89 A;  3WQ0 A;  4LKS A;  5CA6 A;  5H9P A;  2DVF A;  4AEK A;  4E2Q A;  2BYV E;  2XQX A;  4YM1 A;  2PAM A;  3DPR A;  1XC6 A;  2WNV B;  1FMD 1;  2VOX A;  1ZZC A;  2JG9 B;  5EPA A;  1HRV 1;  4DXZ A;  5FPB A;  1HB3 A;  3EJK A;  1QOT A;  2VMG A;  4QPI B;  1H6X A;  3T09 A;  2ZMN A;  5FYT A;  2WC2 A;  3CU7 A;  3HMY A;  1AHS A;  4XHB A;  1RVF 2;  2Y6F A;  4A7Z A;  5M0T A;  2ZGT A;  5A6Q A;  3J26 N;  2ES3 A;  2J1A A;  5GLZ A;  5A33 A;  1CAX B;  4JCK A;  5TSW A;  3MIB A;  3JU9 A;  2R04 3;  1YQC A;  2E63 A;  1AR8 3;  4N53 B;  5CG8 A;  1PO2 2;  1EAH 2;  2WNE A;  3NV4 A;  2WL1 A;  4FBF A;  3BIW E;  4XF0 A;  4Z2W A;  5CFC A;  1RUI 3;  4OHW A;  2KM2 A;  1Z0H A;  1PGL 2;  1VPH A;  4PF1 A;  3V0B A;  1JYT A;  2WS9 2;  4Q4X 3;  3FUO A;  2ZGU A;  2VOT A;  4JTN A;  4C91 A;  5C8C A;  1JZ6 A;  2QQP A;  1HDK A;  3BU0 A;  5CEH A;  5FPL A;  2LRO A;  2XJT A;  2GP5 A;  4AGV A;  1R08 1;  2DUO A;  1F35 A;  5LY1 A;  3S0M A;  2VTX A;  3NNF A;  3QD6 A;  5IHR A;  4MAD A;  3ZFE C;  1QJY 3;  5LBC A;  4AR2 A;  2VMC A;  3HVD A;  1O3R A;  2JDK A;  2QQM A;  2LUW A;  4D6Q A;  5BNN C;  3HIF A;  4AGR A;  1ZBA 2;  4UAP A;  1W0P A;  2TBV A;  3SCH A;  5APA A;  2ID4 A;  1TME 3;  3ECQ A;  1S1A A;  2CGO A;  3DL3 A;  1X8M A;  4AI1 A;  4Q5O A;  5EYY A;  5CZK A;  3UKT A;  3AYA A;  1XQN A;  1QGL A;  4R8H A;  1IQD C;  2WZP P;  3CJX A;  1LHU A;  2G9Z A;  1J59 A;  4UW5 A;  4DB5 A;  3I59 A;  4FP2 A;  4OQ8 A;  3UET A;  2VL4 A;  1ASJ 3;  2YHJ A;  5K9Y A;  4RFT 0;  2E53 A;  3LAG A;  4H2A A;  2YV8 A;  1ENS A;  3HAG A;  1AYN 2;  3JUU A;  5F6K A;  1R1A 1;  5FYH A;  4CSW A;  4QT6 A;  2C0Z A;  4IET A;  4NUB A;  4MGZ E;  4QX3 A;  4RHV 2;  5FYI A;  4ERO A;  3B02 A;  3UL2 A;  1H4H A;  4XIL A;  5FYZ A;  3T0B A;  2HWE 1;  3E6B A;  1GNH A;  3RS6 A;  1FAY A;  1XYN A;  4IGQ A;  4P9Y A;  3L2Y A;  2ARC A;  5JZG C;  4PI0 A;  4UFM A;  2Q30 A;  3TOJ A;  5CFD C;  1JZ5 A;  2FDK A;  1HRV 3;  3N36 A;  3VZL A;  4IE6 A;  2GSY A;  1WLW A;  1WLD A;  3POB A;  4MHU A;  4QQ2 A;  4XUO A;  3ZR6 A;  1GQH A;  3H3L A;  3VKO A;  2CAV A;  1ZYB A;  4AZZ A;  1JMU B;  1VBD 2;  1D4V B;  2A7A A;  2BGC A;  2I07 B;  4D7S A;  3TN9 2;  2YBP A;  3B00 A;  5E1R A;  5IAV A;  1QY4 A;  1JYI A;  5I8T A;  1JTZ X;  2GNT A;  2J1E A;  3RJR A;  3UKN A;  5K0U A;  3ZYP A;  2PQQ A;  2FDF A;  1TMF 2;  3CJI A;  2EA7 A;  4P9W A;  3K2O A;  2BP6 A;  3HNY M;  1FT9 A;  3ZN4 A;  5T50 A;  3O14 A;  3K3O A;  1HRI 1;  1VIW B;  2ZGN A;  4RGG A;  2AEY A;  5CBL A;  1H9W A;  1UWW A;  2DVD A;  2IVI B;  1ULD A;  1PO1 2;  3I3D A;  4Q0V A;  2P1B A;  4NIA A;  3T0A A;  4ASK A;  5ACA 1;  1W6M A;  2PHX A;  2OKX A;  4XE9 A;  2ZHN A;  1BYH A;  5JZG A;  3WF3 A;  4A44 A;  2YG0 A;  3O0V A;  3WQB A;  5CFD A;  5JOW A;  1R08 3;  3I54 A;  2WUH A;  1CAV A;  1T6G C;  2VVF A;  2Q8O A;  4XJZ A;  1UIK A;  2GMP A;  3I2I A;  4IV1 C;  4PDW A;  3FLR A;  1CAW B;  1WZX A;  1IG3 A;  4AI8 A;  5EIY B;  1NQD A;  1PK6 A;  1AL0 G;  3DKQ A;  3KHB A;  3E6C C;  1SDW A;  3LFI A;  5FUI A;  4MH0 E;  3WT3 A;  4LT5 A;  3T30 A;  2EIB A;  2PHD A;  3HWJ A;  3NNM A;  2FDJ A;  1A8M A;  2AYH A;  5FP7 A;  4AED A;  3C2U A;  5EV7 A;  4AVC A;  1IKP A;  1J1T A;  3W58 A;  3KT1 A;  1VBC 1;  2X29 A;  3S6P A;  1CAU B;  2WWS A;  2CDP A;  1FNY A;  4NVP A;  5LAT A;  1JUI A;  2AEZ A;  1G6N A;  5LAS A;  2PEL A;  1UZY A;  3Q8A A;  1R1A 3;  1H8T B;  4XBQ A;  1DIW A;  1MPX A;  2CGN A;  3DYP A;  1W6N A;  2WAO A;  4M3C A;  3AMM A;  1G9C A;  5EXO A;  4NIG A;  3P1I A;  4Z2A A;  5BUV A;  2HWE 3;  4E2G A;  3SIT A;  5IYY A;  4XPV A;  2VUJ A;  4KH9 A;  3HBZ A;  2J1T A;  4YW6 A;  5A7O A;  2IVJ A;  1WW5 A;  3KT4 A;  4LO4 B;  2IZW A;  4COZ A;  2PLV 2;  3ZX7 A;  3Q8E A;  3IN9 A;  1UOJ A;  1QU0 A;  1HX6 A;  1XE0 A;  1U5Z A;  1YFX A;  4BK4 A;  1QNY A;  1UW8 A;  2WFF 1;  3IAP A;  3MIF A;  3SCG A;  5IK7 A;  4ITC A;  2Z2S B;  1VBE 1;  1V6O A;  5J1X A;  3UKV A;  1V9U 2;  4WV8 A;  1OOP C;  4XIK A;  3T4H B;  4LK6 A;  3OGR A;  5JMO A;  4D94 A;  2XLG A;  5B4X A;  1YNA A;  3AM2 A;  2EXH A;  3N9P A;  2RMU 2;  3LA3 A;  2VU9 A;  5JI9 A;  5FZO B;  1B35 C;  2VAU A;  1AXK A;  4ISQ A;  5KBF A;  4QDQ A;  4ES9 A;  3C7H A;  1UMH A;  2YPD A;  4GMP 1;  3S7I A;  5L7O B;  4YGE A;  1HRI 3;  2ZAA A;  1ENR A;  4D3W A;  3ZIW A;  4PIX A;  1UY2 A;  5ACA 3;  2XH6 A;  1OPO A;  2J1S A;  2W92 A;  4XFB A;  1AF9 A;  4ET7 A;  3WG1 A;  3WCR A;  1C4R A;  1WA6 X;  1O8S A;  4GWN A;  5AC9 2;  4IV3 A;  2VQU A;  4GWM A;  1LTE A;  2Y0O A;  2Y6H A;  3DN7 A;  1BHG A;  3MLJ A;  2ZA9 A;  4QX8 A;  1UYZ A;  4GJZ A;  1OLM E;  1NA1 B;  3WW3 A;  5DN2 A;  4IND A;  1FOD 1;  4J6G A;  3N9L A;  1AR6 1;  1CQ9 A;  3SXW A;  3ZFG B;  4I0B A;  2E7Q A;  4V2W A;  2X10 A;  3B5L B;  4NJ4 A;  4BQ4 A;  1K12 A;  3M70 A;  4YZ4 A;  1TE1 B;  1AYM 2;  1O91 A;  3WDW A;  4A4A A;  2ZGP A;  4XFC A;  3T1L A;  5IVC A;  4F3J A;  3BIE A;  2NMN A;  5JXJ A;  1AXY A;  2GAL A;  2V73 A;  3VD4 A;  4QGN A;  1VP6 A;  1VBC 3;  3FX3 A;  5DG2 A;  5FZF A;  1ULF A;  4XAC A;  3EYP A;  4KWJ A;  1HJF A;  1OF4 A;  4QGL A;  4CDQ B;  5FK7 A;  3H9A A;  4QU2 A;  1H2M A;  4LOR A;  1EV1 1;  2OPK A;  5T5O A;  4OHY A;  2ILM A;  3IDA A;  4MV2 A;  4YPJ A;  1YIF A;  3JD7 2;  2VXR A;  3AP5 A;  2EF6 A;  4KGG A;  5A7W A;  2K9Z A;  3MI8 A;  3EMR A;  5A80 A;  1OKO A;  1QJF A;  1KIT A;  1JZ2 A;  3M3O A;  5D21 A;  2J22 A;  3HOB A;  3ALQ A;  1VBA 2;  5H9Q A;  2GC1 A;  4YW1 A;  2WFF 3;  3J7L A;  3VZJ A;  3POF A;  2VW2 A;  1F5F A;  4NOT A;  3WHU A;  1PGW 1;  1U5I A;  1VBE 3;  2E51 A;  2VH9 A;  3JB8 A;  4QHB A;  4XJ9 A;  5FZK A;  2RS1 2;  3VBR B;  3NJX A;  4CCO A;  5JOZ A;  3AZY A;  3CL1 A;  5DZG A;  3JXS A;  1NE6 A;  4E8C A;  3ILN A;  1MS8 A;  2OUH A;  1LOD A;  3M1H A;  1FV3 A;  1QJZ A;  3AZW A;  4JV4 A;  3VBH A;  2XXZ A;  1UOG A;  5A3U A;  1UX6 A;  4GMP 3;  5C3R A;  1DU3 D;  2P37 A;  4P9I A;  1K5M B;  4FPY A;  4QQL A;  1DGL A;  5FR3 A;  2Q1Z B;  2NZ9 A;  4BPZ A;  2VZV A;  3R05 A;  2ZAC A;  4FPL A;  4TXW A;  4CCE A;  1W90 A;  4GH4 C;  5KHJ A;  2J42 A;  4CU8 A;  2RHP A;  3ILF A;  4MGY E;  3IMM A;  3ZPY A;  2E33 A;  4IEQ A;  1RIN A;  2BWA A;  3VZK A;  1E5I A;  4JKK A;  4BA6 A;  3SHR A;  2YU1 A;  4DXR A;  4XHX A;  1Q8S A;  2H6C A;  3CIH A;  3PL0 A;  5F39 A;  5FQ0 B;  5JPM B;  3N7J A;  5LEJ A;  1JOB A;  4DXT A;  2F17 A;  3LIH A;  1UIJ A;  3E6D A;  3P6B A;  5FPA A;  5A3N A;  4QU1 A;  3P3P A;  3A0K A;  1WA4 A;  2H0B A;  1FOD 3;  1AR6 3;  4IE0 A;  4EN0 A;  4NAM A;  3FLT A;  3H50 A;  4B29 A;  4QHZ A;  4PIZ A;  1JH5 A;  2R07 1;  3I49 A;  3OY8 A;  1CN1 A;  1ACC A;  5LK5 A;  4FXG B;  3J4U H;  5FMB A;  4A7Y A;  5FZB A;  3IZO A;  3KLS A;  1WW6 A;  3UJQ A;  5A3T A;  1AVB A;  4OHV A;  1AJK A;  3MF9 A;  2CU5 A;  2W1U A;  1EYB A;  1QDO A;  1QEX A;  2W1W A;  4GH4 A;  4NII A;  4PQQ A;  2WNV A;  1DZT A;  1QJE A;  2W46 A;  2VZ1 A;  3U11 A;  3V65 A;  1SEF A;  3J8F 2;  1EV1 3;  3DGT A;  1FX5 A;  4YG3 A;  4PIY A;  1LU1 A;  1PNG A;  1GMM A;  4QQH A;  4ZU7 A;  2NLR A;  5FZ1 A;  5F5C A;  2XWJ B;  4XZP A;  2YB7 A;  1GP6 A;  4JRA A;  4LKD A;  5HXV A;  3O1V A;  4Q1R A;  4FAG A;  5KWR A;  4XJW A;  4RR3 C;  2UWC A;  1CAX A;  1PMI A;  3A21 A;  5FZ9 A;  4X6Q B;  1QJX 2;  1U12 A;  2YRO A;  1ALY A;  4ZU5 A;  2Z69 A;  3AFK A;  1DYP A;  1W05 A;  4B3N A;  4UWD A;  5E8A A;  5EFU A;  4IES A;  3DXU A;  3U75 A;  4AVS A;  2UY9 A;  2ZGK A;  3UGH A;  4MG2 A;  3VZO A;  5AFB A;  2SLI A;  1MZ5 A;  1LHW A;  1HJG A;  4J25 A;  4JGY B;  3VKM A;  1SZB A;  2D3R A;  1CZS A;  3AFG A;  3ROU A;  2ET7 A;  4FCA A;  4P5H A;  3POY A;  2ZAB A;  4YGC A;  1TG7 A;  4QX2 A;  4XUN A;  3AZX A;  2B39 A;  1VB4 A;  1TEI A;  4RS5 A;  1FYU A;  4UFH A;  1W8N A;  4M3C F;  4BMB A;  4KBB A;  4IEW A;  5HV0 A;  2VQA A;  2ZTN A;  2E7T A;  5FDB A;  4I0A A;  3ORJ A;  5FBJ A;  2RM2 2;  3WNL A;  4LO7 A;  4ORF A;  4HK8 A;  4LHN A;  5AFE A;  4JZR A;  1RVF 1;  5J37 A;  4G4F A;  1WKY A;  2ZHL A;  1RIR A;  2YBK A;  4GMP 0;  4P00 B;  3ZYH A;  5K7P A;  1Q8Q A;  4FPO B;  3VBO B;  1RB8 G;  3H3Z A;  4CUC A;  2R06 3;  5C4W B;  1YFU A;  2OQ6 A;  1RMU 2;  3LE0 A;  3VBF C;  4A6O A;  2JEC A;  5H9S A;  3H8R A;  2D98 A;  4IEZ A;  4R9B A;  3I2D A;  5I93 A;  1JZ7 A;  5FZL A;  1PO2 1;  1EAH 1;  4CCD A;  5FO8 B;  1NYW A;  3VKN A;  3NW4 A;  5JCT A;  1UU6 A;  2FZ2 A;  5DUV A;  4EE2 A;  2R07 3;  5F8P A;  3BTZ A;  2MEV 2;  4GIQ A;  1PGL 1;  3MFC A;  1Q56 A;  2PHF A;  4ASM B;  2XVK A;  5FLH A;  1VAL A;  2Z42 A;  3CDZ B;  3V0A B;  5JXG A;  3UES A;  3OJB A;  1KFX L;  2WBK A;  4UOJ A;  4L99 A;  4Z92 B;  3CNA A;  1K5J A;  5L9B A;  3Q8B A;  2DF7 A;  2W47 A;  4YYO A;  3V0B B;  4C0H A;  1XNK A;  3A22 A;  5FJH A;  5FZ7 A;  1VAM A;  5ISL A;  1DQ4 A;  4HN1 A;  3GHM A;  3WR0 A;  1RIT A;  4GZ9 A;  4ES8 A;  5FPZ A;  1HV0 A;  1PM4 A;  4N7U A;  4QXK A;  4S2D A;  4BQX A;  3MHZ A;  2Y6J A;  2XVL A;  4YVS B;  4DIN B;  4XQW A;  3VKL A;  2CNA A;  2XDV A;  3VDD C;  1O8P A;  1TVG A;  1YFY A;  2VZR A;  1XE8 A;  1HQL A;  1LGN A;  1LEN A;  1YUD A;  2RDR A;  2XJU A;  3OD4 A;  4IXL A;  5JAX A;  3B7M A;  3H7Y A;  3WDV A;  1BK1 A;  3K3N A;  3T2O A;  5C3S A;  3PUS A;  2WWJ A;  1PZ8 A;  4IER A;  4CDU B;  5CYY A;  3SKV A;  4LBJ A;  1AYN 1;  5A3L A;  1NCR C;  4XDP A;  3ITQ A;  4XQD A;  3SEE A;  2VTF A;  1GNY A;  3N9O A;  4QX1 A;  5BNP A;  1S0I A;  5GZG A;  4RHV 1;  4N43 B;  3S30 A;  1MVQ A;  4OUM A;  4OI0 A;  1W03 A;  2O8O A;  1OUS A;  5FUP A;  3GCW A;  3H1W A;  3J7H A;  4QD2 A;  3VD3 A;  3X29 B;  4PCR A;  4YVW A;  3UV9 A;  2AUY A;  2P5B A;  1S2K A;  1JYX A;  1QOS A;  3NJZ A;  1EPW A;  4Y3O A;  2X05 A;  4P08 A;  2A71 A;  1FPN 1;  4OYU A;  5C3O A;  3O12 A;  3NO8 A;  2BTV C;  1PM7 A;  1CAW A;  3HJR A;  2W3J A;  1URX A;  3USU B;  1PVX A;  1RVF 3;  1VBD 1;  2VPV A;  2DUR A;  5EP9 A;  1GYK A;  3LA2 A;  3J9S A;  4O9E A;  2RS3 2;  2WSV A;  1OBN A;  3KF3 A;  4BH9 A;  3TN9 1;  4AFA A;  4E4S A;  3ZFF B;  3I4I A;  2D6O X;  5FMD A;  2Q8D A;  1E5H A;  1TMF 1;  2VVE A;  3LWC A;  4NRM A;  4AG4 A;  3KQR A;  4OLL A;  1PO2 3;  4LO6 B;  1PMJ X;  1EAH 3;  2OII A;  4RQP C;  2RE9 A;  1KFU L;  1EUT A;  3MLL A;  1XPW A;  4DEQ A;  4DRV A;  1PO1 1;  4WM8 B;  3R4D B;  5FUN A;  4G3Y C;  2WS9 3;  3O5S A;  3WEZ A;  3RVH A;  4AAX A;  3U4X A;  1ND3 C;  1W2T A;  2LTN A;  1POV 1;  2BGP A;  4H7L A;  1W9T A;  2ZGO A;  4BXF A;  4CXY A;  4B7K A;  1OVP A;  1PVC 2;  5JR2 A;  1S2B A;  2HWB 2;  1MS3 A;  3PME A;  3NWK A;  5FFO C;  4LA3 A;  1C1L A;  3OTF A;  1RJ8 A;  2XJR A;  1UNB A;  1W8F A;  5DZF A;  1ZZ8 A;  1PIV 2;  2IFW A;  1ZBA 3;  3F2Z A;  3INA A;  2E7A A;  1X8E A;  4BE3 A;  1GQP A;  3IMN A;  3V56 A;  4KGQ A;  1VE0 A;  1W9S A;  2PAK A;  1MQT B;  1UYY A;  2A6Y A;  2HWD 2;  2OW4 A;  5ERL A;  2O14 A;  1YEW A;  3WW4 A;  5C9A C;  1V0A A;  5FZO A;  4XUR A;  4NHY A;  5BNO B;  4BME A;  4QDS A;  1S55 A;  5L7O A;  2R1B A;  2WFP A;  2X5I C;  1AYN 3;  1MS5 A;  1ND3 A;  4DXS A;  3AC0 A;  2AZ5 A;  2J7M A;  2ZX2 A;  3KS7 A;  3KV5 A;  3CF6 E;  1W8U A;  2OS2 A;  4NE9 A;  4RHV 3;  5FKC A;  3CKH A;  1AR7 2;  1H8V A;  3GM8 A;  5DUU A;  5JUV A;  3ZSL A;  4LXL A;  5D1I A;  4XDO A;  5HCA A;  1X36 A;  5LZ6 A;  1JYN A;  1X33 A;  2AR6 A;  3VBU C;  3VD9 A;  4Q2F A;  3POS A;  5FOB B;  5EQU A;  2KR2 A;  4WVM B;  4L0P A;  2QQI A;  3VV1 A;  5IJR A;  1FPN 3;  3GJB A;  1NA1 A;  1GBG A;  1RXG A;  2IXH A;  3B93 A;  4QM8 A;  5A6Y A;  3WDT A;  5CIR A;  4OUL A;  5T55 A;  3U37 A;  1DFQ A;  4Y33 A;  2V5D A;  4Q4Y 2;  3ZFG A;  1VBD 3;  4BQY A;  2D7F A;  2WN3 A;  3THC A;  1V9U 1;  2ZS6 B;  4M01 A;  3U0Z A;  3BTY A;  2YC0 A;  1JZ8 A;  3VHN A;  5KXC A;  2Y38 A;  3TN9 3;  3BGA A;  4L2N A;  1WMD A;  2RMU 1;  1AR8 1;  3L9J T;  1XYO A;  3MYX A;  5BXX A;  2BNO A;  4QPG C;  4XF9 A;  4AAP A;  1TMF 3;  1HB1 A;  1YRZ A;  2Z79 A;  4PT6 A;  1VRH 2;  5CKN A;  1SLT A;  4ZXK A;  1X9P A;  1YIP A;  1HKD A;  1OQE A;  1PO1 3;  4IUG A;  5LY2 A;  4LE3 A;  2QZ2 A;  4XFH A;  4CDQ A;  2XHN A;  3IPV B;  1NZC A;  2D3S A;  1POV 3;  2X8K A;  4EZ4 A;  1ND2 C;  2EXI A;  1ZX5 A;  3NNJ A;  4LIT A;  1OHF A;  4AFD A;  3IWZ A;  1XE7 A;  4U2A A;  1US2 A;  3KV9 A;  4XET A;  3LD8 A;  3RYR A;  1W6P B;  3SH4 A;  4ARY A;  5AC9 1;  5F37 A;  1NCQ B;  4OI4 A;  3DPR C;  4CDW C;  1FNZ A;  1JN2 P;  1CR7 A;  4HG6 B;  4BU2 A;  3ZDV A;  2GME A;  3TBD A;  4XEZ A;  2BVV A;  3H8X A;  5FRA A;  1TME 1;  2FCV A;  3I7D A;  3VBR A;  3NAP B;  3DCQ A;  2R7E B;  1V00 A;  2XGX A;  4XOG A;  2ZGM A;  3WG3 A;  3GZE A;  1AYM 1;  4ZKT B;  4WVW A;  1G7Y A;  4W65 A;  4W8J A;  3DKW A;  3VDB A;  2XJS A;  5FP3 A;  2CAU A;  3WQ7 A;  1QH6 A;  4ZXE A;  1CPM A;  1JYC A;  4Q1P A;  5ANN A;  4R4Z A;  1KS4 A;  4A2U A;  3WNK A;  4IE7 A;  1K5M A;  1W9W A;  3GZA A;  5I0U A;  2RV9 A;  1JXN A;  2ORX A;  2L9L A;  4ZON A;  5CFC C;  1ZZ9 A;  1UL9 A;  2DU1 A;  3IKW A;  3SIS A;  3WX5 A;  1SCS A;  3TYJ A;  3WZ1 A;  2JDA A;  2WQ8 A;  2ZAH A;  5IAX A;  5C8C C;  4MXW B;  2QQK A;  2GNB A;  4Q0S A;  3JD7 1;  4CDW A;  2DCY A;  3MO4 A;  5A7P A;  4ZU4 A;  1V6M A;  2XL9 A;  3FWE A;  1W04 A;  1UMI A;  4RSU A;  1UY1 A;  4QHO A;  2PLV 3;  3IT8 A;  1CON A;  4K9S A;  3IAQ A;  1JI6 A;  1AR9 2;  1VBA 1;  2DV9 A;  5F2S A;  1GWL A;  1JYW A;  4JGZ B;  4BQ5 A;  2VBD A;  2YGL A;  5JMC A;  1QWR A;  3NQH A;  2ARB A;  4RYD A;  1O3T A;  5C5T A;  1O4Z A;  2RS1 1;  3USS A;  3H3U A;  1V9U 3;  5HV4 A;  4CPB A;  2OT7 A;  4LKE A;  2TUN A;  3F95 A;  1US3 A;  2RMU 3;  2W1Q A;  2ZEX A;  3AVR A;  3MEP A;  4HPK A;  3ZXJ A;  2BFU S;  4OFG A;  1CX1 A;  4IEU A;  3WD5 A;  5KXD A;  2IXK A;  4XFA A;  1W6Q B;  5CAD A;  5F2W A;  3I97 A;  5LBB A;  2G4I A;  3LPG A;  4UF0 B;  1RUN A;  5CKQ A;  2JG8 C;  3G7D A;  1RED A;  5GZF A;  2EVX A;  5FPX A;  1OVS A;  5A3O A;  1PX3 A;  1Q8P A;  1VMJ A;  3BUC A;  2BOJ A;  4DS0 A;  3KWV A;  4QX0 A;  4Z8B A;  3UYJ A;  5AC9 3;  2XON A;  1KGY A;  3M8L A;  1I1E A;  3MW3 A;  3CMG A;  1OD3 A;  3M4F A;  3WP4 A;  4COV A;  2JDU A;  2P3K A;  3NL1 A;  1Q3E A;  2YPJ A;  2HLE A;  4IL7 A;  1S0G A;  4GB3 2;  2CYF A;  5EHD A;  1LHV A;  3B01 A;  4CVU A;  3WDX A;  3BKZ A;  4LHS A;  4WM7 B;  5FWJ A;  5DMY A;  2P6H A;  3N7M A;  1RUG 2;  5FXZ A;  1U0A A;  4YZ3 A;  3PIG A;  1AYM 3;  3JQW A;  4JGY A;  2QBX A;  2X09 A;  1FV2 A;  1R09 2;  1ZBE 1;  5FYY A;  1KJR A;  5K0U C;  4WZC A;  2Y8K A;  4Q4W 2;  5FY9 A;  3CJI C;  5JSP A;  4BLI A;  2LW8 A;  4N9I A;  3GAL A;  5I0D A;  2JG8 A;  2V09 A;  3LGR A;  1ZZ6 A;  3N3H A;  3VB9 A;  1RUH 1;  2JKB A;  4YWA A;  4IQP A;  5C6C A;  1ZRI A;  3J8F 1;  3RMX A;  4EQV A;  1NLQ A;  1BLZ A;  3ES4 A;  2J1V A;  4CCJ A;  3ZVX A;  5J96 B;  1IGO A;  2UU8 A;  1K45 A;  2BDR A;  3BU7 A;  3JD7 3;  3MID A;  4FPJ A;  5HCB A;  3KHC A;  3POW A;  4NWW A;  3EXU A;  1BCX A;  3VBO A;  4MGT A;  4JQR A;  3FHA A;  5A6Z A;  1H2N A;  1W2N A;  2WII B;  2WN2 A;  3MV1 1;  5C4W A;  4BLJ A;  1VBA 3;  2XB6 C;  5GAL A;  1I3H A;  3AL6 A;  2YFU A;  3I8T A;  2HJI A;  4PDW C;  1RUO A;  5K8S A;  2WNU B;  2W39 A;  2VG9 A;  2WZE A;  5A7S A;  3TEW A;  2RS1 3;  1PK6 C;  1L3J A;  2QQW A;  2VMI A;  4GKX A;  4RFR B;  3OCP A;  4KL1 A;  4CA9 A;  5FYS A;  2BQP A;  3MLK A;  2W68 A;  1RGS A;  1QXP A;  1RJ7 A;  3TRS B;  2C4X A;  2CL2 A;  3N7L A;  3T2T A;  2DBI A;  2QE3 A;  2WO1 A;  3H8U A;  2OPW A;  3G6J B;  3FMG A;  4AED C;  3M7A A;  3OG2 A;  2BUK A;  3AKQ A;  1F4A A;  1C5H A;  2QQJ A;  1O3S A;  2PHT A;  5C33 A;  2JJ6 A;  1JU4 A;  2B4K A;  1SFN A;  2Z4F A;  2RM2 1;  1XSR A;  3RMY A;  2ADD A;  1X50 A;  3ST7 A;  1LOC A;  2WZR 2;  4OVE A;  4L8Q A;  4YVS A;  2WIN B;  4COY A;  1IG0 A;  4FT8 A;  1XJA A;  3LEI A;  1E5R A;  4BIO A;  1DBN A;  2ZEW A;  2UWA A;  2XJV A;  2PA7 A;  1RMU 1;  1UYX A;  3ZLI A;  4A41 A;  3S5A A;  4V2V A;  4CEY B;  2QQU A;  5FO9 B;  2PHR A;  3B69 A;  4KNC A;  2W08 A;  1SPP B;  2DUQ A;  1YJL A;  4Q8L A;  2YYO A;  1C3H A;  3NMB A;  1XU2 A;  2BWC A;  4GA9 A;  4NO4 A;  3VBS B;  4N43 A;  4FTS A;  4HSJ A;  5FMC A;  1ZBE 3;  1SBD A;  5LW9 A;  2D44 A;  2CGP A;  1LKN A;  2ZHK A;  4N8M A;  2PYT A;  4C0B A;  4NHL A;  1F5J A;  3AX4 A;  1OA2 A;  2QUO A;  1RUH 3;  3ZIX A;  5LRS A;  4TWT A;  4MHR A;  3RWK X;  2VVD A;  1YLL A;  1FAT A;  1ULO A;  3CHX A;  3J8F 3;  4XTM A;  2GU9 A;  1WCK A;  4UFJ A;  2O1Q A;  1C8M 1;  5EJ1 B;  3IDE A;  4AEM A;  2WAA A;  4Y1Y A;  1COV 2;  3K51 A;  3W21 A;  5JIU A;  3RZK A;  3E5X A;  3ACL A;  5C7G A;  1QQP 2;  4NIH A;  4IV3 C;  1WW4 A;  1ZRD A;  1LGC A;  1XNT A;  2BV4 A;  4HKO A;  4CEW B;  4URA A;  1IKQ A;  4XIO A;  4AFM A;  1JZ4 A;  3THP A;  2QQV A;  4LBQ D;  2ZJC A;  2VXJ A;  1X82 A;  3LSD A;  1GLH A;  4MGS A;  3S7E A;  1J84 A;  1TZO A;  1XYP A;  3POG A;  1BKZ A;  1BVV A;  3PTR B;  1W0O A;  4WM8 A;  4R9D A;  4Y1U A;  4JAA A;  4TLG A;  4H55 A;  2ZPX A;  4BJ0 A;  3D6E A;  3C3V A;  4HL0 A;  5SV5 A;  2QFE A;  1QF3 A;  1GUI A;  2GND A;  1L7R A;  1N3O A;  5HPO A;  3LOB A;  2DUP A;  2VC9 A;  3MIG A;  4QQO A;  1MS1 A;  1NY7 2;  5F9T A;  4MZU A;  4MET A;  4M4R A;  3GDB A;  1HXS 2;  1DZR A;  2D93 A;  2RM2 3;  4IEP A;  3NV1 A;  2DFC A;  3RI8 A;  1L7L A;  2R04 2;  4KWK A;  4XUP A;  3AJY A;  4DY3 A;  3CZU A;  2R32 A;  2RS3 1;  2YUE A;  3IDB B;  5GKA C;  2C9K A;  1O3Q A;  5EJ3 A;  2JB8 A;  3HQU A;  2W2I A;  2VR4 A;  1RMU 3;  3O1O A;  3FBM A;  5C71 A;  3LDK A;  3EBR A;  1K42 A;  2LS6 A;  1GP5 A;  4OQ9 A;  4JX0 A;  5FP8 A;  5BNO A;  3DV8 A;  3JCI A;  4YGD A;  3QCW A;  2O0O A;  4UW4 A;  2FBE A;  1MEC 2;  4TSV A;  2VCA A;  4CP9 B;  1N1Y A;  4DUW A;  4LO5 B;  2QQO A;  4AVT A;  1CVN A;  3VKF C;  5ABJ A;  2WAB A;  3WF0 A;  5FXV A;  3WY6 A;  2LM3 A;  3GF6 A;  4OHX A;  4JHZ A;  3H8O A;  3VBH C;  3IM0 A;  1PVC 1;  2P3J A;  3TEX A;  2JKX A;  1QKQ A;  2F4L A;  3WQ1 A;  5LRR A;  4W6Y A;  2Y60 A;  2HWB 1;  5F5I A;  2B42 B;  3ZN6 A;  5I0R A;  1Y4W A;  1MVE A;  2QZ3 A;  4WVM A;  4Y22 B;  1QJU 2;  2Q8C A;  1EP0 A;  2IC1 A;  3KB5 A;  1PIV 1;  1W8H A;  1C8M 3;  1V6K A;  4B7E A;  2VD7 A;  4E4H A;  4BIS A;  4OCT A;  1IS4 A;  4IDZ A;  2R1D A;  5FZE A;  5L19 A;  1O4T A;  4QWN A;  4AHX A;  3ZXA C;  5KHK A;  2HWD 1;  5FV3 A;  5F3E A;  1ULG A;  1ULP A;  5I8S A;  4CDX B;  2HBT A;  3MW2 A;  1CGP A;  1BMV 1;  2YXS A;  3Q8F A;  1V6N A;  5DZE A;  2W52 A;  3NJV A;  5H9R A;  1VBB 2;  4I0W B;  2RDQ A;  1GZW B;  4BDV B;  2EAL A;  4JKM A;  1Z78 A;  1N1V A;  1JOP A;  1V6J A;  2D5H A;  3KZ4 C;  3O0W A;  4DQA A;  1FMD 2;  4DRR A;  1ODM A;  3IPV A;  3NJY A;  4HBN A;  4PBP A;  4YG6 A;  1NUK A;  1AR7 1;  1SLB A;  5D8A B;  4D6R A;  4YZ5 A;  2NP0 A;  4FVV A;  1AL2 2;  3DYM A;  1I9R A;  1REF A;  1W6P A;  1NG0 A;  2JIJ A;  2JIG A;  4GKY A;  1W06 A;  3W9A A;  2ORZ A;  2WNV C;  5CNA A;  2VNV A;  1IS5 A;  1NT0 A;  1S2E A;  2JE8 A;  4EWA A;  1OA3 A;  1ULC A;  4P9L A;  4AGG A;  3CQO A;  4Q4Y 1;  5G04 L;  2R06 1;  3NAP A;  1STM A;  4I09 A;  3ZOI A;  2RS3 3;  3HNM A;  1XNC A;  2WO3 A;  3N9M A;  2VJX A;  1RTV A;  4JDM A;  5L36 A;  3FLP A;  5BY5 A;  4IEX A;  4K40 A;  4LUK A;  3V64 A;  3I3Q A;  4AHY A;  3DEM A;  4N53 C;  4JDN A;  1VRH 1;  2NN8 A;  3KMH A;  5IVJ A;  4XC9 A;  1KS5 A;  3POI A;  2XBO 1;  3NVC A;  4CZS A;  1OLM A;  4IW3 A;  5FZ0 A;  3ZR5 A;  2ZKL A;  5JR7 B;  5FYU A;  4C1W A;  1ONA A;  3SNM A;  1W2A X;  3A0N A;  5CB7 A;  1PVC 3;  1ODN A;  2JG9 A;  5FAX A;  4X8P A;  5IW0 A;  4AVA A;  1J3R A;  2HWB 3;  2JDM A;  2VNR A;  2WNO A;  1DLL A;  4RS5 C;  1G9A A;  4QPI A;  1H2K A;  4FTB A;  3BYW A;  4LUM A;  2AEN A;  3H1Y A;  4JGZ A;  4LBK A;  1OI6 A;  4GD4 A;  2GN7 A;  2WT2 A;  1PIV 3;  3M3Q A;  1UYP A;  4P5Y A;  3T0D A;  4RGA A;  2WQ4 A;  3LEM A;  2Q1F A;  1GZT A;  1HLC A;  3GBF A;  4AQ6 A;  4BQ2 A;  2HWD 3;  5JOY A;  3I3M A;  5CFC B;  5C5U A;  3AJZ A;  2CV6 A;  5CG9 A;  3RZM A;  5EZW A;  3GBG A;  4N53 A;  5FP9 A;  5A32 B;  2JDH A;  3III A;  3S5Q A;  3IB3 A;  2GC0 A;  4DPN A;  5J09 A;  5IVE A;  5GZD A;  2B7Y A;  1UPI A;  2A3Y A;  1RUC 1;  4CU6 A;  3OPW A;  4MX3 A;  3I2G A;  1E5S A;  2H0V A;  3UK9 A;  1EPZ A;  3POJ A;  3PHM A;  2Y34 A;  4Y5T A;  1OSG A;  1OUR A;  4QB2 A;  1S0J A;  3AMN A;  3AP7 A;  2XWB B;  2R30 A;  1QMJ A;  4FI9 A;  1AR7 3;  1PNF A;  5C3Q A;  1GKB A;  3UGF A;  2VZO A;  4X8N A;  4LE4 A;  3HEI A;  4OMC A;  4KG8 A;  5DAP A;  2GMM A;  1J58 A;  1AX1 A;  4GAZ A;  1AR9 1;  3KSC A;  1F2N A;  1M4W A;  4YM0 A;  1LCL A;  3UGG A;  4FOY A;  2C5D A;  5JIA A;  3O0X A;  3LKJ A;  1SCR A;  4CCC A;  2BER A;  4V1P A;  1U5Y A;  2R0F A;  2EXJ A;  1ZA4 A;  4Q4Y 3;  3MPP G;  5IFT A;  4XYX A;  4WM7 A;  3LSE A;  3D4K A;  4HON A;  3PUI A;  2XHK A;  5KC5 A;  4NMI A;  2CHH A;  1DCS A;  3OF1 A; 
#chains in the Genus database with same CATH homology
 5A1A A;  4GWI A;  5IJR A;  4MGQ A;  4QX3 A;  3VDA A;  1K3I A;  3U37 A;  2V5D A;  1RYY A;  3T0B A;  2WN3 A;  3THC A;  2BGO A;  1J83 A;  1JZ8 A;  1CZV A;  2RVA A;  1F4H A;  3BGA A;  1JZ5 A;  4XZU G;  1JU3 A;  4XUO A;  2VZS A;  4PT6 A;  5C70 A;  4IUG A;  2V4V A;  3WSO A;  2XHN A;  2J1E A;  3A7Q A;  1US2 A;  4ARY A;  2WZ8 A;  3HNY M;  3T2Q A;  3K4A A;  4HG6 B;  2YC4 A;  1UWW A;  3I3D A;  3T0A A;  2W95 A;  2DCK A;  2OKX A;  2WO2 A;  3WF3 A;  4A44 A;  2BBA A;  2R7E B;  2YG0 A;  3WQB A;  1LNS A;  2WUH A;  4W8J A;  2EIE A;  3VDB A;  3I2K A;  3C7O A;  4ZXE A;  3WNN A;  4BXS V;  3I2I A;  3WNK A;  1W9W A;  3C7E A;  2RV9 A;  3T2P A;  2ORX A;  5EIY B;  2L9L A;  3PUH A;  1HN1 A;  1GOG A;  1OT5 A;  5FUI A;  1O59 A;  2JDA A;  2WQ8 A;  2QQK A;  5JXH A;  2EIB A;  4DUV A;  1P8J A;  3MO4 A;  1UMI A;  1UY1 A;  3I2J A;  2CDP A;  4LQR A;  3C8X A;  3IAQ A;  1JI6 A;  1JYW A;  1MPX A;  3DYP A;  2PQS A;  2WAO A;  3NQH A;  4RYD A;  3T08 A;  2DCJ A;  3P1I A;  4Z2A A;  4MO3 M;  3WNO A;  5IYY A;  3THD A;  2J1T A;  1GU3 A;  1US3 A;  2W1Q A;  2ZEX A;  4BK4 A;  1W8O A;  3IAP A;  1CX1 A;  3CZJ A;  1JYV A;  2JD9 A;  5J1X A;  4OMD A;  3I97 A;  3LPG A;  1L7Q A;  3LEK A;  3OGR A;  5JMO A;  5B4X A;  3A23 A;  1PX3 A;  3VDC A;  4LPL A;  4QX0 A;  4QDQ A;  1WCQ A;  1UMH A;  3C7H A;  2XON A;  1KGY A;  4W50 A;  3K75 B;  1SDD B;  1OD3 A;  3CMG A;  4OUE A;  1UY3 A;  1UY2 A;  3MUZ 1;  2HLE A;  3I2F A;  2J1S A;  2W92 A;  4ZY9 A;  4XVH A;  3W5N A;  4ET7 A;  4CVU A;  4LHS A;  5DMY A;  1O8S A;  3WNP A;  2VQU A;  2QBX A;  2Y6H A;  1BHG A;  2X09 A;  1UYZ A;  2Y8K A;  4XUT A;  2LW8 A;  5DN2 A;  5LCW L;  3ACH A;  1CIY A;  5I0D A;  3NRU A;  3DEC A;  2X10 A;  1K12 A;  4CU7 A;  2W91 A;  2VM9 A;  2VZ3 A;  3K46 A;  2J1V A;  1UY0 A;  4A4A A;  3ACF A;  3WF1 A;  3I3E A;  1K45 A;  5DPN A;  5JXJ A;  3VD4 A;  1JZ3 A;  3FHA A;  3MV1 1;  3EYP A;  2WN2 A;  1W0N A;  1OF4 A;  1JHJ A;  1NKG A;  2YFU A;  2WZE A;  1OF3 A;  2ZEY A;  2QQL A;  2W9X A;  3IDA A;  3OGS A;  1GOH A;  4OZO A;  5LA2 A;  4YPJ A;  3SKJ E;  3OB8 A;  3FL7 A;  3HPN A;  3SEP A;  2E32 A;  5F7U A;  4DUX A;  1JZ2 A;  3W5M A;  2C4X A;  2J22 A;  3HOB A;  4KWU A;  2VO5 A;  2WO1 A;  4CUA A;  3MUY 1;  3MV0 1;  3OG2 A;  3OBA A;  4D8M A;  5EJZ B;  1F4A A;  2QQJ A;  2DDU A;  2E31 A;  2W1S A;  3NJX A;  4A3Z A;  3JXS A;  1JU4 A;  2VMF A;  2B4K A;  4E8C A;  2ZXQ A;  3I2H A;  2Z4F A;  2J1R A;  3VD5 A;  5HXM A;  1T2X A;  3LEI A;  3BN6 A;  2ZEW A;  4JKL A;  1UYX A;  2VZV A;  2VMD A;  4A41 A;  3D3A A;  4A42 A;  4TXW A;  2C26 A;  4CU8 A;  1SHW B;  3ACG A;  2E33 A;  3C7F A;  3HN3 A;  5JXI A;  4JKK A;  4W4Z A;  4DXR A;  3CIH A;  3OGV A;  4DXT A;  3P6B A;  4UI9 L;  2BZD A;  2VCC A;  3OEA A;  1YQ2 A;  3WNM A;  1PX4 A;  1ULO A;  5EJ1 B;  1UXZ A;  2WAA A;  3MBW A;  2HYX A;  2W1U A;  5C7G A;  2ZEZ A;  1UY4 A;  2W1W A;  1XNT A;  4PQQ A;  1XNA A;  2B9V A;  4P02 B;  2WYS A;  2W46 A;  1JZ4 A;  4D0Q A;  2VZ1 A;  2VZU A;  3E1F 1;  4MGS A;  1J84 A;  1GMM A;  2YB7 A;  2VZQ A;  4BJ0 A;  5IFP A;  3A21 A;  3DYO A;  4GWJ A;  1GUI A;  1L7R A;  5HPO A;  4ZZ5 A;  4CUB A;  2VC9 A;  2VCB A;  4M4R A;  3GDB A;  5LA0 A;  4BK5 A;  1CZS A;  4XUP A;  3CZU A;  2Y6K A;  1NAE A;  2C9K A;  1KEX A;  4CU9 A;  1TG7 A;  4QX2 A;  4XUN A;  1EUU A;  1CZT A;  2VR4 A;  4MOA A;  5C71 A;  1W8N A;  1K42 A;  2LS6 A;  2EIC A;  2E26 A;  3VD7 A;  3FN9 A;  4JX0 A;  3WNL A;  2VCA A;  4DUW A;  1WKY A;  2QQO A;  4P00 B;  1W99 A;  1R64 A;  4TTG A;  2WAB A;  4CUC A;  1NX9 A;  3WF0 A;  1H6Y A;  3LE0 A;  3OEB A;  4A6O A;  2RJ2 A;  4JHZ A;  5G05 L;  1JZ7 A;  2JKX A;  4XUQ A;  2W5F A;  2V72 A;  1I5P A;  4KMQ A;  4ZZ8 A;  3LQC A;  2WDB A;  3UNP A;  2YFZ A;  3K77 A;  1UZ0 A;  4DEV A;  3CDZ B;  3GXU A;  2Y6G A;  5JXG A;  3UES A;  2WBK A;  4UOJ A;  1SG3 A;  2W47 A;  3ACI A;  3ABZ A;  1ULP A;  3A22 A;  2VZP A;  3K4D A;  4KI5 M;  5DQ0 A;  3NJV A;  4GZ9 A;  4BDV B;  5LA1 A;  4JKM A;  2Y6J A;  1UXX X;  2CDO A;  1O8P A;  1TVG A;  2W94 A;  2VZR A;  1NUK A;  2VQT A;  1UX7 A;  3DYM A;  3T2O A;  2Y6L A;  2ORZ A;  1DYO A;  5CYY A;  3SKV A;  4ARX A;  4A45 A;  2VME A;  4E8D A;  3SEE A;  2JE8 A;  1GNY A;  2VTF A;  4QX1 A;  1DLC A;  4M4P A;  4QB6 A;  3CQO A;  5G04 L;  2KD7 A;  3GGL A;  3J7H A;  3HNM A;  3VD3 A;  2WO3 A;  2VJX A;  1JYX A;  2QQN A;  2X05 A;  4P08 A;  4OYU A;  5B4N A;  4QPW A;  4QAW A;  3LEG A;  3WF2 A;  3HJR A;  2W3J A;  2VZT A;  4LKS A;  2XQX A;  2XOM A;  2Y64 A;  4RN5 A;  1XC6 A;  3I3B A;  3C7G A;  4AG4 A;  2EID A;  3EB7 A;  1H6X A;  3T09 A;  1PMJ X;  1PMH X;  1GOF A;  1EUT A;  1XPW A;  4DEQ A;  3K4Z A;  1DP0 A;  2W87 A;  3WEZ A;  4AAX A;  2J1A A;  4P5Y A;  3NNG A;  2BGP A;  3LPF A;  3T0D A;  1W9T A;  2YC2 A;  5JR2 A;  4QDR A;  3FHQ A;  3III A;  3IB3 A;  4PF1 A;  4QB1 A;  3WF4 A;  1JZ6 A;  1OH4 A;  2VOT A;  4CU6 A;  3F2Z A;  3I2G A;  1GQP A;  1D7P M;  1W9S A;  2J1U A;  1UYY A;  3HNB M;  4QB2 A;  5IHR A;  4MAD A;  4FI9 A;  2VMC A;  2QQM A;  2VZO A;  4XUR A;  3HEI A;  4QDS A;  4OMC A;  3ZM8 A;  4UAP A;  4DXS A;  3ETP A;  3AC0 A;  2ID4 A;  2J7M A;  3ECQ A;  5CZK A;  2BER A;  1IQD C;  3CKH A;  3GM8 A;  5JUV A;  5IFT A;  1JYN A;  3UET A;  3PUI A;  2VL4 A;  3VD9 A;  4L0P A;  2QQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...