4QB6A

Structure of cbm35 in complex with aldouronic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
128
Chain Sequence
TGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
total genus 29
structure length 128
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb6A00
2WO3A 1JU4A 1BHGA 4OYUA 3HNMA 2W92A 5JUVA 2XQXA 1ULPA 5DN2A 2W91A 2J22A 3OEBA 1CZTA 1NKGA 3K4AA 4A45A 4QX0A 2J1AA 2KD7A 4L0PA 3CMGA 4ARXA 3NNGA 3LQCA 5LCWL 1R64A 3WF0A 1PX3A 4QDRA 3VD5A 2VZOA 3SKVA 3C8XA 3GDBA 3THDA 2ZEZA 4MOAA 4QAWA 1F4HA 4RYDA 3NQHA 1J84A 4A3ZA 4CU7A 5B4NA 5JMOA 5I0DA 4BXSV 2E26A 4AAXA 4ZZ5A 3FHAA 3ETPA 3WQBA 5C71A 1JZ8A 3I97A 3P1IA 2R7EB 3CDZB 4DUWA 1XC6A 4GWJA 4UI9L 1OF4A 1L7QA 4PT6A 3I3BA 2J1EA 5EJ1B 1TVGA 4GWIA 2X09A 3T2PA 2C9KA 3K4ZA 3T2OA 3CKHA 2VOTA 5IYYA 3C7EA 4ZXEA 4DXSA 2WO2A 3IDAA 4OMCA 4QDSA 3ZM8A 1RYYA 5HPOA 3T0BA 1O8SA 5G05L 1US3A 2E31A 1EUTA 1OT5A 4UOJA 3P6BA 1SDDB 3JXSA 4ET7A 3IAQA 2WN3A 2X10A 3ACHA 3T08A 4CUCA 3ABZA 3WNNA 3DYMA 3MO4A 4RN5A 2XOMA 2J1RA 4JHZA 1JYXA 2L9LA 2W1UA 1UXXX 2VCAA 1JYWA 2QQKA 2WAAA 2WUHA 4BK5A 2J1TA 2DCKA 3I3DA 3UESA 2JE8A 2YB7A 3IAPA 3A22A 1LNSA 2ZEXA 3PUIA 4CU6A 3IIIA 1O8PA 2WQ8A 2WZ8A 3WNKA 1NX9A 4JKLA 2VC9A 2J7MA 2W94A 3NRUA 4HG6B 1K45A 3I2GA 3LEKA 3OBAA 1CZSA 2Y6JA 4CUAA 2W87A 1UYXA 5IHRA 3OGSA 4XURA 1I5PA 3OG2A 5JR2A 1JI6A 2VZ3A 1UY3A 2BBAA 2EIEA 5IJRA 4MGQA 3C7FA 1O59A 4DUVA 1OD3A 3MV01 4W50A 3EB7A 1JYVA 3VDCA 3HOBA 5CZKA 3ACGA 2VL4A 1TG7A 3OB8A 4QB2A 4PF1A 5FUIA 2DDUA 2QQNA 3I3EA 1P8JA 3WNPA 2RV9A 3FHQA 3T09A 1T2XA 2J1VA 2RJ2A 3DYPA 4XUOA 1L7RA 4CVUA 5B4XA 1GUIA 1OF3A 2VZTA 3J7HA 2VMEA 2QQMA 2ZXQA 2QBXA 1W0NA 2XONA 3SEPA 1GU3A 5JXHA 4YPJA 2X05A 3LPFA 2J1UA 4LHSA 3T0AA 4A42A 1K12A 3PUHA 3BGAA 3THCA 4XUTA 5JXIA 4ZZ8A 3NJXA 5LA1A 2VZPA 3I2HA 3K4DA 4GZ9A 1KEXA 1JZ5A 3A21A 1F4AA 3LEIA 2XHNA 5EJZB 5HXMA 3WNMA 3I2FA 1W9SA 3UNPA 2W1SA 3A23A 4XUQA 5J1XA 2C4XA 3I2JA 2ID4A 2QQIA 2WBKA 1HN1A 1K3IA 1XPWA 1NAEA 1UY2A 3MV11 3E1F1 2QQJA 1UWWA 4QPWA 4CU9A 1SG3A 3HPNA 3K75B 4A6OA 4D0QA 2E33A 1PMHX 2CDPA 4A41A 3HNYM 4AG4A 3OEAA 4KWUA 5DPNA 1H6XA 2YG0A 2VM9A 3GM8A 3UETA 4ZY9A 1UY4A 2V72A 4BK4A 2V5DA 1DLCA 1YQ2A 1GMMA 1KGYA 5DMYA 2J1SA 3AC0A 3FN9A 3VD3A 2HLEA 5IFPA 1JZ4A 2WAOA 2JKXA 4DEQA 4IUGA 4MO3M 2V4VA 1UX7A 3NJVA 4QX3A 3VDBA 2ZEYA 4OZOA 2EIBA 1NUKA 2B4KA 4DXRA 2WN2A 1JZ3A 2WZEA 2EICA 2W1QA 3LE0A 2BGOA 5C7GA 1UXZA 1JZ7A 1CIYA 2W46A 4XUNA 2VZQA 2BERA 1IQDC 2QQLA 2WO1A 1PX4A 3VD7A 2Y8KA 3OGVA 2WDBA 1UZ0A 1CX1A 2JD9A 4CU8A 2Y6KA 4ARYA 2RVAA 3LPGA 3SEEA 2VMFA 3T2QA 5LA0A 3DYOA 1SHWB 3K46A 4W8JA 3U37A 2VQTA 4CUBA 1GOHA 4QB1A 2W5FA 2Z4FA 2BGPA 3LEGA 2VMCA 4LPLA 4E8DA 4JKMA 3WSOA 3HNBM 1GOFA 2E32A 2CDOA 4M4RA 5JXJA 2PQSA 3GXUA 4LQRA 3OGRA 2Y6HA 4KI5M 4OUEA 1JYNA 2WYSA 3CZUA 1DP0A 2ORXA 3ACIA 5F7UA 2YFUA 2JDAA 2W3JA 3MUZ1 1H6YA 2WABA 4QX2A 4D8MA 5C70A 1K42A 4MADA 3WF3A 2EIDA 3I2KA 4FI9A 1UYYA 2VZSA 1MPXA 2BZDA 4KMQA 5DQ0A 1ULOA 1UY1A 4MGSA 2LW8A 3VD4A 2VJXA 4DXTA 4XVHA 3MBWA 1W9WA 1UYZA 3WF1A 4E8CA 3WF2A 2Y6GA 5A1AA 1GNYA 1OH4A 1W99A 2C26A 5EIYB 2VZUA 2W95A 3GGLA 1WKYA 2YC4A 2HYXA 2VMDA 3SKJE 1WCQA 2ZEWA 3BN6A 3C7GA 4DUXA 2OKXA 2VR4A 2W9XA 2VZVA 1PMJX 1UMHA 1GOGA 1W9TA 4P5YA 4P02B 2Y64A 4QX1A 4JX0A 2YC2A 1UY0A 5IFTA 4Z2AA 4W4ZA 3HEIA 2VQUA 3CIHA 4PQQA 4A4AA 3ACFA 5CYYA 2YFZA 1DYOA 5LA2A 3VDAA 1JZ6A 1W8OA 3VD9A 2Y6LA 4OMDA 3WF4A 1J83A 1JHJA 4JKKA 4QB6A 3HN3A 1EUUA 1D7PM 3W5MA 1W8NA 3C7OA 3DECA 4LKSA 3IB3A 4XUPA 3W5NA 4P08A 3WNOA 2QQOA 4DEVA 2VZRA 2ORZA 1JU3A 2VCCA 1US2A 4BJ0A 4M4PA 2LS6A 3K77A 1UMIA 4UAPA 2VZ1A 1JZ2A 3FL7A 3F2ZA 1XNAA 3D3AA 4TXWA 4BDVB 3C7HA 3I2IA 2VCBA 3ECQA 5JXGA 1CZVA 2VTFA 4TTGA 3EYPA 2VO5A 4A44A 1GQPA 3CZJA 1XNTA 3MUY1 2W47A 2B9VA 5G04L 3WNLA 2W1WA 3CQOA 4QDQA 4P00B 3WEZA 3T0DA 3HJRA 4XZUG 3A7QA 2DCJA
chains in the Genus database with same CATH superfamily
3KT4A 2WT2A 1ASJ1 2QFEA 1GYKA 4EYUA 4FPJA 1CONA 4CEYB 5ABJA 2YU2A 4CDQA 1V6JA 5FREA 1H1MA 2BUKA 4A2UA 1HV0A 4CDQB 3GJBA 1BXHA 1RVF3 3K4AA 4A45A 2VD7A 2Q1FA 4YVSC 4EZHA 1RUC3 4F3JA 1QNWA 4ARXA 4LE3A 3AMQA 1Q43A 5C3QA 3LQCA 2GU9A 4B1LA 1A78A 2A3YA 4Q4Y1 3RZJA 3AP7A 2GMPA 4QDRA 4OQ9A 2VZOA 2SLIA 3SCHA 1BCXA 5CIRA 5JPMB 1Y9MA 1GP4A 1H0BA 1VAKA 1LB2A 1YCIA 2ZEZA 1ND2C 1F4HA 1JYCA 1LOEA 3ZN6A 4HVRA 4LA3A 5JR7B 2D6KA 4BIFA 3VZJA 2B46X 3OSDA 3ZN6B 1LESA 1HB2A 3N7KA 4PIZA 4Q4X2 1UU5A 5C8CA 3MIFA 2P3YA 4GB32 5CNAA 4N43B 3WQ0A 3O7OA 4HETA 5GZFA 4LIUA 1XE7A 4AAXA 4Y4YA 1HKDA 4ZHNA 5T5OA 3ETPA 1HQWA 4XMIA 1SDWA 3K3NA 1SFPA 2G1MA 2HWB1 4DUWA 5IT6A 1UU6A 5LK5A 4UW3A 3BTYA 3PVOA 1EP0A 1L7QA 1AR81 3OD4A 4YARA 1OOPC 4KG8A 5C33A 4AHYA 4MGIE 3T2PA 3WDTA 5LATA 1POV3 3K4ZA 3CKHA 4LORA 3WLUA 4WVWA 1UU4A 2VOTA 3UGGA 3C7EA 5C9AB 1RUE3 1RYYA 2O0OA 2Y33A 4XOGA 5IVFA 5G05L 1US3A 4AFCA 3D8CA 1WBFA 1ZZCA 1S0IA 3ORJA 3P6BA 4M3CE 4IEUA 2XB6C 3WUCA 2WN3A 1RUF2 1BZWA 2ADDA 2PHUA 3KT1A 4IDZA 4BQ3A 5J36A 1JYTA 2WFPA 5A7SA 1H8TC 3L2HA 5ERLA 3T08A 3I4IA 5C3RA 5I0TA 4BA6A 3H3UA 1I5ZA 1STMA 5IVYA 3TYJA 3DYMA 3L9JT 3AK0A 2Q5TA 3MO4A 2XOMA 1IG0A 4TN7A 3VV1A 1NCQB 3N35A 4MHUA 2ARAA 1CQ9A 2ARXA 2CAVA 2J1RA 4JHZA 2VW0A 4F83A 5ACA1 2L9LA 4IEPA 2CGPA 2VOVA 1S0FA 1PM7A 4D94A 2YBKA 1PO11 1UXXX 2VCAA 4FPFA 4M3CF 1PO21 4PBOA 5K7PA 2HWD1 1U5IA 2WAAA 3MICA 5FZ3A 3WHUA 2YGMA 1H2LA 5LK7B 4V2VA 3ZXDA 3H50A 3NL1A 1ZRCA 3O0WA 5FUNA 1W6MB 2P34A 4QX8A 3P3NA 1WA4A 1F5JA 1WLDA 2D40A 3PUIA 3ZXFA 4LTAA 4HL0A 3IIIA 5IAXA 4JDNA 2WQ8A 3WNKA 4EV0A 3ZIWA 3CEWA 3AYDA 2D93A 3O1OA 1DQ0A 4IGPA 2P1BA 4E2SA 4EWAA 3NRUA 5LEKA 5JIUA 5FY1A 1K45A 4M0NA 1XSQA 5FZ1A 3U78A 1R1A1 5A7QA 1Q8VA 4CUAA 4FPLA 1ZNPA 2GNBA 1UYXA 4I30A 2JB8A 1W8UA 2JJ6A 4MH0E 3RJ2X 4BLIA 2MNGA 3J7NA 3OTFA 3OUIA 1GQHA 3HVDA 4QGLA 5AC93 2DV9A 3OG2A 3MDPA 1PHMA 4GH4A 5JR2A 2CYFA 4XHBA 4YGEA 2VZ3A 2VW2A 3VKLA 2HJIA 1POV0 5C5TA 4M01A 5HBAA 1FMD3 1G9FA 1VRH3 3R05A 2JDUA 2WS91 5HCBA 2JXAA 4UW6A 4W50A 4CA9A 1JYVA 3O1UA 1DQ5A 4KQ7A 1LECA 1HW5A 1R083 2R042 1W2AX 3HOBA 4XBLA 2VL4A 5H9QA 3ZXKA 3WW2A 5JOXA 3JU9A 5CG9A 4CSWA 1C1FA 3OBTA 4QB2A 2GH2A 2B42B 1AL23 3I3EA 4J1XA 5B2GB 1D2QA 4LT5A 3WNPA 2MEV1 1RUD1 3LAGA 2Y0IA 3P3PA 2WQ4A 4PJYA 5BYNA 2BEOA 4Z1VA 4BB3A 3VBFC 2HBUA 4AOCA 5F3EA 2J1VA 4UFIA 4B7KA 1WLWA 1VMHA 2IC1A 4NMIA 4QKNA 4J1WA 2JB4A 1Q8OA 4BU2A 5B4XA 1GUIA 5FZ8A 2VMGA 4QQLA 3GZUC 3ZYJB 4QGNA 4AVVA 2QBXA 3PMSA 4FP2A 1W8FA 4FQ4A 1OQDA 3SLIA 2OUJA 1Y3TA 3ON7A 4Q27A 4Q4V2 3ENRA 1XYPA 4QMAA 3RYPA 2W0XA 4P9IA 1A3KA 4PI0A 1MZ6A 1UKGA 1DG6A 1SACA 4ATFA 1ALYA 1AYM2 2QDNA 2XBO2 3LPFA 2IXJA 2X05A 2J1UA 3BU7A 1KDKA 4LNVA 3ZYFA 1C3HA 4WVMB 5FO7B 1Y9QA 4QM9A 5K0UA 3VBSA 3PUHA 5FYYA 1BLZA 3BIWE 1IS5A 2BFUL 2HEYF 4XW3A 3THCA 3WG2A 4CEYC 5HV0A 1RXGA 5FXZA 4MXVA 1ODMA 5KHIA 3A0KA 4CDQC 3VN4A 5CISA 5KR7A 1GQGA 3UKNA 3NJXA 3ZYGA 3RI8A 4CRQA 4AL9A 5JSRA 5FZOA 5LA1A 4LJHA 3ILFA 2HWC2 3WOGA 4BQXA 5FLHA 1Z0HA 2A7AA 4XIOA 5FZOB 3ZSKA 1QJU1 1HV1A 2OT7A 3J8F2 2CSGA 3WCSA 3D5OA 3AJYA 4QQHA 3H0OA 4M3CB 1B35B 4WM8B 3OD0A 5T55A 2LTNA 2RS11 2WNUA 4AFDA 1FV2A 3ZR6A 4YNIA 2OZJA 4CCEA 1ZRIA 4Q4X3 2W52A 4EROA 5EJZB 1ZRFA 5HXMA 3WNMA 4QPGA 5L7OA 2ETEA 1HDKA 4GB33 4HSJA 5BXXA 3UNPA 3A23A 2AACA 1V6LA 3AKPA 4XUQA 5J1XA 3QBQA 1PK6B 1W6QA 3I2JA 2ID4A 1UN1A 1E5HA 4N43C 5C8CC 2WBKA 1HN1A 1XSRA 2ZKNA 2WYFA 5DUWA 5E16A 3V64A 2JKBA 1FX5A 1DQ1A 3URFA 1QKQA 1LHVA 3I59B 1GV9A 1UD1A 1ZBA2 1JOPA 1JXNA 1UKRA 1SBDA 1W6NA 2Y38A 1NA1A 2QQJA 1RC6A 4HLTA 3AL5A 4IQPA 3N9OA 3M3IA 2PQQA 4FT8A 4QD2A 4DRRA 4A6OA 2D3SA 4D0QA 4F8AA 3B9IA 4JGZA 2YY1A 2RMU2 4JGZB 4HZFA 3GYDA 3WR0A 1V6MA 2IVJA 4Z2WA 2ZACA 3RZGA 1AYN1 1OMIA 3HNYM 2WSVA 4KWUA 5C9AC 1YIFA 2D6OX 2UWBA 3E5XA 4KGGA 4LUMA 1XU1A 4GMP1 1S0BA 1H6XA 1WWYA 4NWVA 4YW1A 5FYMA 3WW1A 2RM21 1A6CA 1RUF3 4JTOA 3HBZA 1D4VB 1LJ7A 5KBFA 4QPIA 5FBZA 1RINA 1HRI1 2NZ9A 1FI2A 2YGLA 2DU1A 2JDKA 5F6LB 2VQAA 1LR5A 1U5XA 3UETA 4IEZA 1VB4A 2VXJA 3GCXA 4FFGA 5LY1A 2Y34A 3H8RA 1GANA 4NRPA 2V72A 4E4HA 4H7LA 2JICA 2Q8OA 5TSWA 3S7IA 1UZYA 2ZGTA 4P9YA 1IS6A 2BP6A 4LK7A 1OFNA 3RMXA 2DVGA 2W39A 3RFRA 1UPSA 4IW3A 3FN9A 2VECA 2CWMA 5GLZA 3M3CA 2A73B 3U4SA 3BALA 2YPDA 4R52A 1NCQC 1V9U1 3BUCA 4XAEA 1W6OA 2VU9A 3FBMA 5C3SA 1BQPA 1RMU2 3FC0A 4YRDA 1W6OB 4MO3M 5FZDA 3ZYHA 1ZZ6A 3NJVA 4GJZA 3VKOA 3O1MA 4CE8A 2NPIA 2WN2A 5LEJA 4QXCA 2EICA 1SLTA 3LE0A 2K9ZA 5FZGA 3KV5A 5C7GA 3OGJA 3WX5A 3KF5A 3ZR5A 1PGW2 3RNSA 1CVNA 3LFIA 5FCCA 3U10A 1XNDA 3T1MA 2H6CA 2H0BA 2FZ2A 4XXAA 3IZOA 2R062 2WINB 1V00A 1LOFC 3OY8A 4OUSA 4XJAA 3WV6A 2TBVA 2XJRA 2AH2A 1CX1A 3OY8B 4CU8A 2DVDA 2D3PA 4BYYA 2RVAA 3SEEA 2O14A 2VMFA 3LA3A 5LA0A 5FYZA 1RGSA 4JC1A 2JECA 4YZ2A 1T6GC 1FNZA 4Q1RA 1V70A 4DNYA 4LPLA 4OZXA 4BIOA 5KXEA 3ITQA 3S0MA 4NWWA 1UQXA 3ILRA 3ETQA 4FVVA 2PQSA 5D2AA 3BOWA 1F2NA 2EXIA 3NVCA 4LEJA 4LQRA 3SISA 4GH4C 3WCRA 2B5HA 1W03A 3DXUA 4Z82A 4OUEA 4F7ZA 4UFKA 1JYNA 2R043 2HWF2 4X6QB 3NV2A 3BTAA 2JDAA 3MUZ1 2VTXJ 2GMEA 3EHKA 5LY2A 4JCKA 4KG0A 1YUDA 2JE7A 5H9RA 2PLV1 2ES3A 4N53B 4LOSA 4OQ8A 1K42A 2YZ4A 4GKXA 3C2UA 1EAH2 4IEWA 3LCPA 3VBHA 3WNXA 2C1FA 5KXDA 3WF3A 3VBHB 3M1HA 3MHZA 1S0JA 3I2KA 4FI9A 4AQ6A 2OPKA 1ZZ7A 2BNOA 4IV1B 4ZPIA 3MYXA 5FPZA 1RUJ2 3AXEA 1IS3A 3DN7A 4NAMA 1UY1A 1LGNA 1X33A 2I07B 1VBD2 2LW8A 3VD4A 1RXFA 3BTXA 2OQ7A 3RRDA 4HBNA 1UYZA 3WF1A 4DZGA 2Y6GA 3WDVA 3NKTA 1DF0A 2FZ1A 1WZXA 5BNPB 3N4MA 3P5BA 3I2OA 3KZ4C 1OC1A 1W99A 2C26A 4Q4V3 1WD4A 5EIYB 2AGSA 3GGLA 5L73A 1L3JA 5CFDB 1AYM3 1E5IA 2OA2A 2XBO3 1WCQA 3BN6A 4OHXA 2JDMA 1BK0A 4IESA 4JZRA 3ZYRA 2EF6A 3USSA 4MG2A 4CPBA 5IVBA 4RL7A 1HXS2 3MIGA 3OOXA 1OXCA 4KWJA 2VZVA 4Q1PA 3RDIA 2RR11 3RMYA 2AUYA 1MEC1 3WY6A 4QHOA 4L2NA 4B4PA 2Y64A 5FZCA 1DGWA 2BDRA 2Z69A 4MX3A 4GXLA 1OBNA 1Y43B 3RYRA 5FPXA 1ND3A 1HQNA 3Q8CA 2XJQA 5K0UC 2XL7A 1E5SA 2HWC3 3ACFA 1NE4A 2YFZA 1DYOA 5LA2A 1H4HA 3PMEA 1W8OA 2BGCA 2JEMA 3J8F3 4LBQB 1AZDA 3BVCA 4Q0PA 2XL9A 4YFWA 3W59A 1CAVA 1JHJA 4RR3A 2ZGMA 1RHI1 2VVEA 5FTTC 5CBLA 1CAVB 5FZMA 1NCRA 3ZN5A 5IVVA 3W5MA 4LKSA 5SV5A 1B35C 2HWB2 3IB3A 4WM8C 1PNFA 4YM2A 1VMFA 3DEMA 4XUPA 5APAA 4Q0UA 1AR82 5T52A 4P14A 4YWAA 4PLNA 5F8PA 1JU3A 3MW2A 5FZ6A 1MS0A 1PVXA 1QOSA 1MZEA 2HYKA 4OI4A 3MPPG 2FCUA 4Y33A 4YVWB 2RDNA 2JG8A 3AZXA 1PK6C 3LD8A 1ZRDA 3FL7A 1XNAA 4KBZA 3T4VA 5JSPA 3D3AA 4TXWA 1ZBA3 2GC2A 4IGQA 4WM7A 1MS5A 3I2IA 2A70A 4FOYA 4QU2A 2B45X 1QH6A 4TTGA 5JWPA 5T3NA 3EYPA 1OA3A 4A44A 2RS51 5FY7A 4WVZA 3BB6A 4Q8KA 2QQVA 4CDXA 5FOJB 5LW9A 2RMU3 2BPA2 5G04L 3WNLA 4CDWA 4D6RA 1C8M2 4HFSA 4FBFA 2KXLA 2VAUA 3B5LB 2XR4A 4QDQA 3SHRA 4CCLA 5GZCA 1VBC1 1QY4A 4JGZC 3UKTA 4AFAA 2VNGA 3FX3A 1Q8PA 2J42A 5F9TA 1NY72 3R6SA 4CEWB 4YM0A 2W2IA 4GWMA 5A7WB 4OYUA 3ZX7A 3HNMA 5ACA2 1J1LA 3U75A 1PO12 3EBRA 1ULPA 1PO22 2HWD2 3OEBA 2YYOA 2EXHA 1W0PA 3GCWA 3HMYA 2ZHMA 2WNVA 4QPIC 1QNYA 2GH8A 1XYNA 2J1AA 2KD7A 5EJ3A 4AI3A 1KS5A 2QZ2A 2VNOA 2XUEA 3VHPA 2CU5A 4YYOA 4CDUA 2XLAA 3ZFFB 5IK5A 2OX0A 3NJZA 4K6BA 3ZYPA 2VBDA 4C91A 3WF0A 5L19A 1XNKA 1VBA1 2XGXA 1X8MA 4QXKA 5D8AA 4COWA 1RMU3 4E2GA 1KDMA 1REFA 4IEYA 5D8AB 3GDBA 5FP9A 4QAWA 2Q4SA 3AKSA 2YBPA 4MGKE 1MS4A 4LHLA 5CU1A 1J84A 1R1A2 1ENRA 3DUIA 3B02A 3PURA 2VTXA 3POJA 4C90A 5I0DA 1I6XA 1EV12 4IV3B 1F15A 4BXSV 3WP6A 1OHFA 3IKWA 4ZZ5A 3INAA 3WQBA 1FOD1 2NN8A 2JG9A 2E63A 1GFF2 4RA0A 3FFZA 4M00A 3U4XA 2DCZA 2R063 1AR61 4PHZA 2JG9B 1F8VA 2D97A 5JZGA 1MQTB 1XC6A 3LFMA 1SCRA 2WS92 1HJGA 2JDPA 2R49A 4PT6A 4BISA 1V0AA 4EE2A 2AENA 2ZGOA 2OZ6A 2ZGRA 4BCUA 2X09A 2XG3A 1KJRA 3HR9A 4LLOA 4UF0B 4IE7A 3VBRB 3R4SA 1DZRA 4ZXEA 4DB5A 5T54A 2WO2A 2ZX3A 4LBKA 2ZGSA 2VH9A 3M3EA 5HPOA 2IVIB 2MEV2 1O8SA 2BVVA 1NQDA 1F5FA 1KXGA 1UL9A 2Q8CA 4XTPA 3KS7A 3PVBB 2HWF3 4L97A 4UOJA 3ZSJA 2BWCA 1PZ9A 1GZWA 2HWE1 4K3UA 4QX5A 5F3GA 4K40A 5CB7A 4L99A 5E8AA 4EN9B 5BV6A 1EAH3 4AI9A 3OBZA 5A33B 4AVTA 4CUCA 1SLLA 5DAPA 5F39A 3ABZA 5DUXA 3SQOA 4XQWA 4GAZA 3Q8EA 3PTRB 2DVBA 4N53C 2NLRA 1RUJ3 1GNZA 3BPSA 3MW3A 3N9LA 3VBHC 5A3MA 4LBLA 5FMDA 4AR2A 4BH9A 1VBD3 2XKPA 4U36A 5DAQA 5A1FA 3CLPA 4IEXA 2W1UA 4IV1C 1N47A 4AYUA 2ZGLA 4NHMA 4FQZA 3CJIA 1OI6A 1ENSA 1HJFA 4Y26A 2WUHA 4Q5OA 4BK5A 3BCWA 2J1TA 5D1IA 5E88A 3UESA 5J37A 3VBOB 2JE8A 2YB7A 3IAPA 4QQOA 1X9TA 2ZEXA 5KC5A 3I54A 2A6XA 2Q1ZB 3HQUA 5F3IA 2XMLA 5BNPC 2FDKA 1DGLA 3MIHA 4NIHA 3IN9A 2IUWA 3CJXA 2YBSA 4W6WA 1COV2 1WMEA 5C5UA 3E5UA 2PTMA 4O65A 5CFDC 3LSEA 1HXS3 2QQUA 2ZAAA 3V0BA 2C5DA 1QJU2 3I2GA 2E51A 3LEKA 3N9MA 1MS9A 1CZSA 3CHXA 2ADEA 3OYWA 2E7QA 2Y6JA 2OIIA 3WINE 1VLNA 2W87A 1LHUA 2RS12 3RPQA 1H2KA 5GJ6A 3LIHA 4E4SA 5I8TA 5LB6A 1JS9A 5FXVA 4XURA 3JBG2 1OA2A 1XNBA 1JI6A 3KCYA 4FPHA 3I49A 1UY3A 1F31A 4DXZA 1LHWA 3KB5A 1R1ZA 3C7FA 1CJPA 4DUVA 2YDEA 1OD3A 3K48A 5DAXA 4X6RB 2TUNA 1FPN1 3MV01 3U07A 3EB7A 4Z2AA 1MS1A 3VDCA 1PVC1 2HWB3 2QKDA 4EZ4A 3LZZA 2ZMNA 3J26N 1BVP1 1QJX1 3FZ3A 3LSDA 4BMBA 1AR83 1X9PA 4RD7A 5ABJB 5IVJA 1POQA 3OB8A 4FPCA 3ZVXA 1X8EA 3LF7A 1BMV1 5FUIA 1WA6X 1S0GA 3UL2A 1NCRC 3IIAA 2DDUA 4MHRA 2QQNA 3LEMA 4J6GA 5FZLA 4DPNA 4OI1A 3WQ1A 1OH3A 1U5ZA 2CGOA 4P9WA 4YZ5A 1AL0G 5FRAA 5FP7A 3BIEA 3T09A 4QX7A 1T2XA 1GSLA 4D6QA 1DLLA 2QVSB 2XVLA 1NLSA 2ARCA 3ZPYA 1L7RA 4CVUA 1OUSA 3FE5A 4YVWC 3UJOA 2WKKA 3PJQA 1OPMA 1E5RA 2VOKA 5A3WA 2VZTA 4XFCA 2D3RA 2RM22 5K9YA 1W2TA 2XDVA 2VXRA 4LMFA 1HRI2 1S0DA 4C8DA 2A6ZA 4XTMA 4AHWA 1G9DA 2JDZA 3SEPA 5DG1A 1C8M3 4B4QA 4GIQA 1GU3A 5C8CB 1IHMA 3TEWA 5A3LA 3MZHA 4YW3A 4Z92B 4EQVA 2P5BA 4CDXC 4YPJA 1BBT1 3H1YA 4LKEA 1A8MA 5ACA3 1OVPA 3WZ1A 1K5MA 1Y9GA 4OFGA 1PO13 3VLBB 1PO23 1V9U2 1M4WA 2HWD3 4CEWC 1LOGA 1YQ6A 1DQ4A 1YFXA 5DZEA 1NG0A 3L2YA 1D4M1 2G19A 4XUTA 4RQPA 2G4IA 1OQ1A 4ES9A 1ZZ8A 3PU3A 4XQ4A 5FYBA 3RSJA 1JMUB 4NIIA 4R4XA 3SITA 2FDHA 5KHJA 1AX0A 5FZ0A 2VZPA 3I2HA 1QWRA 4P9GA 2WA3A 3K4DA 4GZ9A 1BVVA 5IW0A 2IFRA 3O1VA 4AEDA 3O1SA 2WNEA 1NLRA 1QQP1 2DUPA 2WA4A 1H1AA 2WWUA 3A0NA 5E1RA 4AEDB 2GN7A 3GZEA 4YM1A 3ZXLA 2GP3A 4BPZA 1Z7S2 3LEIA 1N3QA 2P3JA 5J98B 4LXLA 4QT6A 5D8AC 1R1A3 1DYPA 4JDMA 3ZXGA 4NIDA 2IXLA 1HQLA 4FP3A 1W90A 4A7YA 1EV13 1ZA4A 3ILNA 5A7PA 2P6HA 1LGCA 1D2SA 3DXTA 2XH6A 2C4XA 5CG8A 1AUYA 4JRAA 4IV3C 3U1XA 1C28A 3GZTB 4CP0A 1XPWA 1AX2A 3N9NA 3Q8AA 2IFWA 4YGBA 3WD5A 2FMYA 2WS93 1G6NA 4OCTA 4BWOA 1UY2A 1EPZA 2JWPA 5L36A 1O3TA 5FO8B 1IGOA 2JG9C 4KWLA 1MQTC 2RS31 4QPWA 5F5AA 3ZMNA 1ENQA 3O1PA 4O9GA 3K75B 4HVQA 1Q5OA 2PELA 5EP9A 5DUUA 1PMHX 1AR91 2MEV3 1RUD3 4MV2A 3VBRC 2OYZA 1JW6A 2YV8A 4YW2A 3VHRA 4D7TA 3GBGA 3ZDVA 1BK1A 3BYWA 2YG0A 3POYA 1G9BA 4NRMA 2VM9A 3GM8A 3Q8FA 5FWEA 5FY0A 1UW8A 4IE4A 5FWJA 1J58A 2ET1A 4ZY9A 3LOBA 4Y1VA 4A7ZA 2BNMA 1UY4A 2NM1A 2WNOA 2GNTA 3TAYA 4BQYA 2V5DA 3TWIA 2OPWA 4NHKA 4HSLA 1O6UA 1WLTA 1QJY1 2HEVF 4GH4B 4JTNA 1VR3A 1VBE2 2FCVA 3LOIA 3H1WA 2YXSA 1OURA 1CAWA 4ISQA 5IFPA 4FTBA 2LM3A 4QQ2A 1JZ4A 5CFCA 2ZHKA 1CJDA 1MVQA 4B1MA 5FXXA 2UU8A 4DEQA 4TZDA 2P4EA 1VIWB 5CFCB 4MSVA 3ALQA 1YXWA 5IVEA 4HKOA 3ZDSA 5IAVA 4OZOA 1VAMA 3KHBA 5CEHA 1Q3EA 3KGLA 3POEA 4MGZE 4OULA 4YGDA 2EIBA 2RR12 1H8VA 1FATA 1NUKA 1UIJA 2B4KA 2QTWB 4UW4A 4AK3A 2E9QA 4UFHA 2WZEA 4Q0VA 5GLTA 3LA2A 1W06A 1J1TA 3VBOC 1IPSA 2PHTA 1JZ7A 4L8QA 1CIYA 1VALA 2HH9A 4BZ4A 1COV3 5FPUA 3NV3A 1VE0A 3UK9A 2Y0OA 1M06G 1IQDC 5M0TA 3RZHA 4BLJA 2ZZJA 3VD7A 4U2AA 1QJU3 2XPJA 1CAUA 1XB9A 3DKQA 1QU0A 1UZ0A 3UGHA 1C57A 5L9BA 4M0HA 1UCXA 2RS13 4B7EA 1RHI2 1RL3A 3JB4C 1KFXL 1H2NA 1SHWB 2NQYA 3JBG3 2VQTA 4XBNA 2W68A 1GWKA 1H1IA 2DUQA 3BKZA 2BGPA 3FWEA 4E8DA 2OUHA 3WSOA 5F3CA 2LALA 5C6CA 5JCTA 1GOFA 5F32A 3U0ZA 4M4RA 1AXYA 2DTWA 4FSJA 2WIIB 3ES1A 3GXUA 4R9AA 5FAXA 4LBOA 4AEJA 1DCSA 2Y6HA 1JOJA 2E6VA 1WW6A 1RIRA 4KI5M 1PGSA 2VUDA 2A6WA 3TN92 2ORXA 2Z2SB 5DZFA 5F7UA 3AVRA 1FV3A 1NYWA 1VP6A 3IMNA 3WDWA 1H6YA 1ZRRA 3UV9A 1TNRA 4D8MA 5K0UB 1PIV1 3VBSB 1N1SA 3N9PA 5ABJC 5A3PA 2RS52 2D5FA 5FY5A 4NJ4A 1VBB1 4W6XA 1MPXA 2BZDA 4KMQA 4DO0A 5DQ0A 2VOXA 1ULOA 4L11A 4N9HA 5FY9A 4AQTA 1HX6A 4GMP3 1VBC2 2VJXA 1GWLA 4COVA 3B00A 2RM23 3ST7A 1W2UA 4RS5A 1HRI3 4YZ1A 2A75A 1QJFA 2WNUB 4CTEA 3VL9A 2VCMA 2VVDA 3HQRA 3LWCA 2DF7A 3KM5A 5A1AA 2X53S 4XHXA 1GNYA 2EAAA 4Y1XA 4QPGB 5L7OB 3RS6A 2AC1A 3KF3A 1CIWA 2D6MA 3I8TA 4NHXA 1BEV1 5I93A 4LO8A 2HYXA 1H2MA 1QMJA 2ZX0A 5T5JA 2BQPA 1W6QB 2VMDA 3SKJE 4XDQA 4B29A 3C7GA 1OA4A 4V2WA 4NO4A 3AYEA 4NRQA 2OKXA 5A80A 2VR4A 4DFSA 1V9U3 2H0VA 2W9XA 2Y60A 3LB9A 5KHKA 3D6EA 1VBA2 2MHFA 5I8SA 1W9TA 4QX1A 3NKGA 1W6NB 1XJAA 5CVRA 2YC2A 1NA1B 4ZONA 3O0XA 5A3OA 4CXYA 1J3PA 4PQQA 1YNAA 1DBNA 2F6BA 2XUMA 3S5QA 4AAPA 2Y6LA 1S1AA 4XQDA 4Z8BA 3WF4A 2LROA 4Y20A 4Q4W1 1J83A 3N7MA 1FOD2 1Z7S3 3M3QA 2JDYA 2E7AA 4QB6A 1BJQA 1HLCA 4XCAA 2B39A 5FPLA 3LKJA 5CKNA 1AR62 1QGLA 1OSGA 4QPIB 4AEDC 4MXWA 5F5IA 1S4CA 2D6LX 3LDRA 4P08A 3WNOA 3SH3A 2JENA 1IKPA 2VZRA 3ATGA 2VCCA 1US2A 3VHOA 1J59A 1IG3A 4NR1A 4R8HA 2GN3A 5IK7A 4PIXA 4CCDA 2FDJA 1FT9A 2VZ1A 3D0JA 3LGRA 5J09A 3F2ZA 2UY9A 4FOWA 4C1WA 1YO8A 2D44A 1LAJA 1AR72 5FMCA 1RUNA 4YGCA 3C7HA 5A7NA 1TMF1 2VW1A 2VCBA 3ECQA 2WO7A 5C4WA 1I9RA 4MYEA 5F5QA 5C4WB 3MFAA 3G6JB 1VRBA 2HWE2 5CKQA 5EPAA 1G7YA 2VE1A 2VMHA 3AJZA 3CZJA 4RHV2 2ZGNA 3RWKX 1B09A 2ATFA 2W47A 2W1WA 1F9KA 4NPRA 1CR7A 3KD4A 4Q0SA 5FJHA 1OQEA 5JMCA 4P00B 4YW6A 4ZS2A 2XWBB 3HJRA 3PUSA 4XZUG 3K2OA 1W39A 2XVKA 3FLPA 4AE2A 2WO3A 5EWSA 5FPBA 2DFBA 2RDSA 2BRTA 4XJUA 3SH5A 2W92A 4AGRA 5JUVA 4TYSA 5GZEA 1R092 4XJZA 2CAUA 3ZSLA 5DN2A 1ST8A 1ULCA 1NKGA 3KHCA 5FLJA 1KJLA 2JIJA 1W05A 3RG0A 1SMVA 3CMGA 4YG6A 4GJYA 2A3WA 1VBE3 3M7AA 3VDDA 1ULGA 5LWBA 4XACA 4ZU7A 1Z78A 1TNFA 3POIA 1R64A 4JQTA 2JIGA 3VL8A 4UBGA 1SZBA 5A32A 5DDJ2 3VD5A 3WG3A 4K9SA 1YYNA 2WLQA 3AP6A 4LBMA 1U5YA 3THDA 5E89A 2C9AA 3AZYA 2XHKA 1QOTA 4AW7A 5BNQA 4RYDA 1V6KA 1RUH1 1WD3A 3E6CC 2RR13 5FPVA 1SLBA 3DF0A 3NQHA 5CFCC 1CWPA 4A3ZA 4LKDA 3MIEA 3AB0A 1WCDJ 4INDA 5JMOA 1O5UA 1U12A 1GLHA 3HD8B 4Y1YA 3ZFGA 1V6NA 1GP5A 2DTYA 2E26A 2ZX1A 1WLCA 4JHTA 1S2BA 4PDWA 2F4LA 3ZFEA 4W6YA 4PI2A 3IPVA 2I45A 1XQNA 1SFYA 3POGA 4HXCA 4GA9A 4RGGA 5J3UA 3CDZB 3TB0A 4LBNA 4UI9L 1WW7A 4GWJA 4K8RB 3RZMA 2OVUA 3VHNA 3I3BA 1RHI3 1ASJ2 4G3YC 1E57A 3DPRA 3OGGA 1O5LA 4HK9A 4CCNA 2V5YA 1PVC2 4IXLA 2UYBA 2NP0A 3DPRB 3K3OA 3QD6A 4GWIA 4AVAA 1QJX2 4NE9A 4XFAA 4TSVA 2C9KA 3T2OA 1YQCA 1UZWA 4BE3A 5IYYA 1BMV2 5FKBA 5FQ0A 4FFHA 3O0VA 2JE9A 4QDSA 4OMCA 3H7JA 3AMPA 4DXSA 3WHTA 2VBPA 2DVFA 4HKLA 3T0BA 3MI8A 1W8ZA 1YFUA 3OPWA 2Y6FA 3FBYA 5FYIA 4EN8B 4KWKA 4WZCA 1OT5A 4Q4Y2 3TN93 3KT7A 5FZAA 4ET7A 5FPAA 4XF0A 4Q8LA 2X10A 2WZR1 3ACHA 3NSTA 4JGYA 1LULA 1O4TA 2R0HA 3NAPA 4COYA 2X5IA 2EXJA 4NROA 3NAPB 2RS53 4SBVA 2BWAA 1TE1B 4MLOA 1ND3B 3VBSC 3U11A 5A3NA 3FUQA 4HN0A 4MZUA 3M3OA 5I91A 1WCKA 4XC9A 1JYXA 1VBC3 1VMJA 3CBNA 3PVNA 4S2HA 4PCRA 3D4KA 2WT1A 2IXKA 1BBT2 4KH9A 3ZSEA 1YI7A 2QQWA 2XJVA 4Q2FA 3DKWA 1PM4A 1YWKA 4RR3B 1FAYA 4EN7B 5BPXA 1NCRB 4OI0A 1C8NA 2PHXA 1JUHA 1MS8A 3IM0A 4DINB 3I3DA 3M70A 5DG2A 1PGL1 1W6PA 2PAEA 2WNUC 4C1XA 3A22A 4RS5C 3I3QA 1Y4WA 1W6PB 2BOJA 3Q9OA 1D4M2 1JH5A 3ELNA 1KQRA 4GQ7A 3SMHA 3H8XA 4ORFA 4QPGC 2WRAA 4QU1A 4CU6A 5L7OC 1YHFA 4JV4A 1YFYA 4Y3OA 1GWMA 5T5PA 1W2NA 3E6DA 2ZGUA 3IDBB 1NX9A 5FK7A 2JG8B 5HCHA 2J7MA 2W94A 1KRIA 4HG6B 1VBA3 3ZO0B 3WUDA 4NIAA 5BNOA 1AX1A 2XVGA 5GLVA 4WBBA 1QQP2 3HT2A 4WM7B 4YVSA 5BNOB 5KXCA 1O4ZA 1LU2A 5FKCA 4NIGA 3F95A 3AMMA 4FO9A 2RDRA 3HIFA 5H9SA 3OGSA 3KCCA 4AZZA 1URXA 1NA1C 1DZQA 5H9PA 3H9AA 5T5LA 3HAGA 3MEPA 2E7TA 1DFQA 1O91A 3IMMA 3MF6A 4FFFA 1AYM1 4CDWB 2BBAA 2DVAA 2EIEA 2IZWA 1W9YA 4MGQA 4XDPA 5JPNB 4Q26A 1FOD3 5IWFA 3GF6A 3JZVA 5FMBA 4CDXB 1AR63 2UWAA 1DGWX 1AF9A 2V09A 2D7FA 5L9VA 3N7JA 2YMZA 3ACGA 1TG7A 1YRZA 3H7YA 3N7LA 2Z5WA 4FTSA 4GKYA 2PHDA 4PF1A 2RS32 2KA3A 1JOBA 1LHOA 2WNVB 1P8JA 4S2GA 3PU8A 2BTVC 3NNJA 1FYUA 1DU3D 4HOOA 1D0HA 2ZX4A 3OCPA 4HT1T 3NWKA 4GWNA 1MZFA 4P5HA 4CDUB 5KXBA 2GZWA 3FHQA 3VB9A 4CXXA 4E9KA 1KITA 1AR92 1OOPA 2RJ2A 2WC2A 2G9FA 2Z79A 3E5QA 1AR73 3DYPA 4PBPA 4LHKA 4ZS3A 2RE9A 4FXGB 1X36A 4K1ZA 4YFZA 1VJ2A 2P3KA 2VMEA 3CNAA 2HWE3 3J7HA 3POWA 1YLLA 4XF1A 1VAVA 2ZXQA 3KMHA 1CPNA 4RHV3 4TLGA 3RVHA 4B8EA 2WR9A 1NZIA 5C4WC 2WFF1 2A71A 4Y5TA 1N1VA 1ULDA 1ULEA 2R30A 5HCFA 5JXHA 2MPFA 4CCCA 1UZZA 2ERFA 3ACLA 2Q8EA 3V0AA 1CX4A 1QJY2 3V0AB 5BY5A 1H8TA 4LHSA 5FZEA 2VMIA 4QKDA 1R093 3T0AA 1DIWA 4AVBA 1NT0A 1YQ5A 1WCSA 3MLKA 5JZGB 2PHLA 1NOVA 1WMXA 1K12A 2PMWB 3AVSA 3PTYA 4HONA 4MGTA 2ZAHA 5F5CA 3NV1A 2RMU1 1CAXA 2ZJCA 4YZ3A 3EMRA 5JXIA 4AF9A 5LRSA 3W58A 1TME1 1F35A 3QACA 5EV7A 4OLLA 1QIQA 4DQAA 1RUD2 1GZCA 3UGFA 5DDJ3 3O14A 5GLWA 5LZ6A 3G7DA 2VNVA 4IE6A 1RUG1 3R0RA 1OFSA 3W21A 1JZ5A 1RUI1 4XCBA 2P37A 2XJPA 1X7NA 2QE3A 1C4RA 3PUQA 2FD8A 1IPJA 1GZWB 3ZSMA 1HRV1 2VBBA 3I2FA 1W9SA 4IETA 1H4GA 2ZPXA 3J7MA 2C6SA 3O5SA 1IPKA 3VBUA 3WDXA 1LOBA 1UYPA 2QQIA 2RDQA 3EQEA 5FXWA 4KNCA 4FOVA 3V56A 1RMU1 4UYBA 3T2TA 2ZKLA 5FP3A 3ZOIA 2Q30A 3EJKA 4OHZA 3NNFA 4ASMB 5FYVA 1NAEA 5GALA 3ZKUA 1ASJ3 2G9ZA 3MV11 4EWEA 3CJIB 1GNHA 3KLSA 4XBQA 1PVC3 3E1F1 5J7MA 1G9AA 1UWWA 1QJX3 1SG3A 1YI9A 3HPNA 3KSCA 4N7IA 4IL7A 1RITA 2LRPA 1FNYA 3B93A 1PIV2 3DPRC 5JLVA 5I8YA 2CV6A 1GICA 3OEAA 4Y22A 3MIDA 5BNNA 3M8LA 2BOIA 2R061 1O3QA 3AMNA 5DPNA 2K0GA 4Q4Y3 5BNNB 1VBB2 5GLUA 4QHZA 3AL6A 2ZHLA 1DGRA 5FV3A 3GALA 1JODA 1H9WA 3AMHA 3QH7A 4Y1ZA 4XZPA 5EHDA 5LRRA 3V0BB 3B94A 5HV4A 4FFIA 1Y7BA 3OYWB 3TBDA 2R071 4BK4A 4E27A 3VBFA 4DY3A 2YUEA 4URTA 1NZCA 1DLCA 1UPIA 1YQ2A 3RWNA 5SV8A 3TOJA 4XFBA 1KGYA 3NAPC 2XXZA 5DMYA 2OS2A 3USUA 5DUVA 3EXUA 1ND3C 3AC0A 5FZ9A 5K4LA 3USUB 3KQ4B 5EYXA 3J7LA 2HLEA 2HWF1 1BEV2 1SCSA 3MFCA 1BBT3 5C3PA 5A6XA 2XLGA 1ULFA 1YQ8A 4COZA 2GC0A 1ZREA 1NE6A 4PIYA 1NXMA 3VDBA 2ZEYA 1V6OA 1XBFA 1ZVFA 1A34A 4RR3C 2DBIA 1V6IA 3AM2A 2Q8DA 1D4M3 1DHKB 2B8MA 3OUHA 1AXZA 3R4UA 4H7MA 4Y1UA 5AVAA 1CN1A 4PQ9A 4XFGA 1UXZA 1EPWA 2IXCA 2JX9A 1XE8A 2W46A 1UF2C 3CU7A 4MVTA 4XUNA 1VBD1 3H8UA 4Y5Z0 1AJKA 5FYSA 4LA2A 1YFWA 2YPJA 4H3WA 2BYVE 2WO1A 4HK8A 1AYN2 2V4AA 1GZ9A 2A5ZA 4CEYA 2Y8KA 3OGVA 4OVEA 2WDBA 1ZBE1 1YEWA 4RGKA 1QQP3 2JG8C 1IS4A 4Q4W2 4ARYA 3LPGA 3T2QA 4P9XA 3DYOA 3FJSA 5BNOC 4WM7C 2YROA 4W8JA 3U37A 4CUBA 1GOHA 4CP1A 5LBBA 2W5FA 3LEGA 4LKFA 2VMCA 5DABA 4FPGA 2KM2A 3JD71 4JKMA 4ASLA 5JSOA 4D69A 2EALA 4BMEA 2E32A 1LCLA 4A6SA 1OLQA 5KC6A 3ZLIA 1XOYA 4B4RA 1HXS1 2X29A 4CDWC 3OGRA 1OLRA 2EXKA 2WYSA 3CZUA 4BQWA 4FTEA 2HBTA 1MACA 3ACIA 3UT0A 2PN5A 1K5MB 1NQJA 4N9IA 5FOBB 3HQXA 2WABA 2Q0AA 4ITCA 3VKMA 4AI0A 3S6PA 5C70A 2RS33 1TMF2 1ZYBA 1A8DA 1W8TA 4N43A 3NMBA 3RZZA 2XQRA 4MADA 4AI2A 4RQPB 2EIDA 1Q8QA 4H2AA 4AVSA 2WNVC 4LHNA 1S0CA 1AR93 2YC0A 1N3OA 4IEOA 2FMDA 2FCTA 3ZXEA 2AR6A 4CDUC 2GSYA 4MGSA 4D7YA 1DGRN 2C24A 3HN1A 4XVHA 2ZMKA 2DBNA 3NNMA 2ZX2A 4E8CA 1RVF1 3WF2A 4QHBA 2JDNA 1XU2A 1ONAA 5FDBA 1U0AA 2P2KA 1TZOA 1RUC1 2XKOA 2VVFA 5FY4A 5C9AA 2XJUA 4FXKB 4BHPA 5K8SA 3E6BA 2VZUA 4LITA 4A7KA 4BQ5A 2W95A 3AKQA 1WKYA 4QXHA 1QJY3 1W8WA 3BOPA 1HB1A 3POFA 4FPEA 5AVPA 5CAZA 2ZEWA 3WP4A 3T1LA 4CCOA 4BQ1A 4DUXA 1J3QA 1TEIA 2YHJA 3QCWA 4ATEA 4QQPA 4ZU5A 1UMHA 1QXPA 1GOGA 2EA7A 5FYHA 5IATA 4Y24A 5FBJA 1C5HA 3ZPOA 5FZBA 5JZGC 4PLOA 1UMZA 3N3HA 5IFTA 1C8M1 3PUAA 3J4UH 3QLQA 1RUH2 2ILMA 1IKQA 4COUA 3HEIA 2R16A 3HT1A 4LO5B 2H6BA 2CNAA 2PLV2 2VQUA 3CIHA 4AQ2A 4K20A 4OHWA 3LDKA 1NCQA 2O1QA 2D6NA 3JQWA 3VDAA 5I0UA 2ZHNA 1NY71 5A3TA 4E2QA 2VQ0A 3R4DB 3FLTA 1SBEA 5F37A 3BODA 3TEXA 4BQ2A 4JKKA 3HN3A 4YLZA 3I3MA 4XIKA 4D3WA 1DQ2A 4I3GA 3C7OA 3DECA 4HPKA 5F6KA 4DS0A 2TEPA 4KL1A 2AREA 1W6MA 4HPKB 3DL3A 4JVAA 4Y4RA 3W5NA 1POV1 2QQOA 1W8HA 4DEVA 2VPVA 4BJ0A 1RUE1 4M4PA 4XJ8A 4K1YA 3NNLA 5FYCA 2LS6A 3VZNA 1CGPA 2ZABA 3K77A 1LOFA 1UMIA 4UAPA 1KS4A 1JZ2A 3UJQA 4CZSA 5F2SA 5A6ZA 4IE0A 5HXVA 1CAWB 1OUXA 3VBUC 4BDVB 4JAAA 1VPHA 2GDFA 4IERA 5JXGA 5JOWA 1CZVA 4OI2A 1YJLA 1APNA 3MW4A 2N7GA 2VO5A 3CJIC 3RGBA 1EV11 1GQPA 1N1TA 1MEC2 2WZR2 3OF1A 1XNTA 1PIV3 5A70A 4XXPA 2QNKA 2TNFA 1T6BX 3T30A 1XRUA 3CQOA 1IZ3A 5LBFA 5FZ7A 1QDCA 3T0DA 1VBB3 4J25A 2B9UA 2VUJA 2AEZA 2VUAA 1JU4A 1NLQA 1W3VA 1BHGA 5BNNC 2QCSB 2PHFA 1CAUB 4G4FA 4B3NA 4ZU4A 2XQXA 1OPOA 3O1RA 2W91A 3BI3A 2J22A 1CZTA 2I74A 4QX0A 1OLME 2VULA 4L0PA 4NUBA 3MGUA 3TRSB 1X82A 2XJTA 4AI8A 3NNGA 3ZYIB 1PGL2 5FYUA 2D5HA 2XLFA 4MGYE 4UFMA 1GP6A 3AZWA 3IDEA 1BEV3 1OD5A 2R1BA 4YW4A 3S30A 4FAGA 1K5JA 1PX3A 3KVAA 5LCWL 2UWCA 3GHMA 3RJRA 4XPVA 1YJKA 3C8XA 4P9JA 3SKVA 3WP3A 4QKBA 4IE5A 4MOAA 3UKVA 5JVVA 5EYYA 5DZGA 1RUOA 1QJZA 3X29B 5AC91 2VGDA 1UIKA 3KV6A 1S2KA 4CU7A 5B4NA 3H42B 3LDBA 4NPMA 4KGQA 5A6QA 1OVSA 2QDRA 1FMD1 1VRH1 1ENXA 3FHAA 5C71A 2OQ6A 4R4ZA 1JBCA 2PYTA 5E6HA 4CCKA 1AYN3 1JZ8A 4W65A 5CADA 4XF4A 3I97A 3P1IA 2R7EB 3N36A 3KWVA 4WVMA 3MIBA 1R081 1OF4A 4YSFA 4HANA 4Q4W3 1LEDA 5FP8A 4ONUA 2GC1A 4L9BA 2J1EA 4LLFA 3FFQA 5J96B 4RS5B 1TQ5A 2ZA9A 3MF9A 1TVGA 1AL21 2IXIA 2PHRA 4O9EA 5EJ1B 5ANNA 5IK8A 1QHDA 4IEVA 1PZ7A 1LHNA 3ZFFC 1XNCA 2UURA 1COV1 1AXKA 2O8QA 3IDAA 4LK6A 5FZ4A 3ZM8A 2AZ5A 1N3PA 4NAOA 3AP4A 2E31A 2NYYA 1EUTA 4M3CA 1B35A 4LR4A 4WM8A 2A3XA 4XYXA 3H3ZA 1SDDB 3JXSA 3W20A 1UOJA 3IAQA 5LBEA 2B7YA 5L9RA 2GNMA 3H1MA 4FOQA 2ZGKA 2CGNA 1UZVA 5JIAA 1TMF3 3WDUA 3JBG1 2K46A 1DDLA 1K5MC 5HCAA 4MUVA 4N90A 4LOTA 4UWDA 3IDCB 3JQXA 4N7UA 4YM3A 2RG4A 5DAVA 1PK6A 1QXJA 4XDOA 3WNNA 3AFKA 3FUOA 4LE4A 4RN5A 2CY6A 4RQPC 3FLRA 5LBCA 2EVXA 1BKZA 2WFF2 2CTVA 4D7SA 4YG0A 4DY5A 3I59A 4TWTA 2BW8A 2GMMA 4CPBD 1WMDA 1JYWA 4I09A 1SQ4A 3LIGA 1CPMA 2QQKA 1MZ5A 4Y20B 4LULA 3JB8A 2PFWA 4QGMA 2FBEA 2DU0A 1UOFA 4PF5A 1SBFA 2A6YA 2DCKA 2WLPA 3GBFA 5FLIA 4MXWB 3W9AA 3ZYBA 1O3SA 2AYHA 2P6CA 1WW4A 4LO6B 4I3PA 2X8KA 1LNSA 3AKTA 5LA9A 1S55A 2NMOA 2BBVA 2BJSA 5JI7A 3B7MA 4LBQD 3SCFA 4OUMA 3S5AA 3IT8A 5FMOS 2AEYA 1TME2 1O8PA 2WZ8A 4JKLA 1UOGA 5F2WA 2VC9A 4HVOA 3AP5A 4FPKA 1LU1A 3RZLA 4SLIA 1NXD1 3OUJA 1KD7A 1UAIA 1ZX5A 1RUG2 3HBKA 3OBAA 4Q4X1 5GZDA 4HMZA 2PAKA 4GMP0 1RUI2 3NJYA 2ZOEB 4META 4XMAA 3BPZA 4GB31 4S2FA 1RUH3 3PJYA 4QM8A 2RJLA 3NW4A 4EJRA 2PLV3 4V1PA 5IHRA 1I5PA 1AVBA 1HRV2 1JTZX 2D6PA 4X8PA 1UOBA 3AFGA 4X8NA 4OHYA 5HI0A 2O8OA 3AXDA 4D6SA 1BYHA 1RTVA 5IJRA 4CUGA 4DIQA 1O59A 3ME2A 4BQ4A 2PXJA 5ISLA 5FR3A 1EY2A 4ZKTB 3PDQA 3BU0A 3S57A 4C0HA 3KV9A 5FIXA 2WZPP 2K2SA 3V65A 2VG9A 2XWJB 2PAMA 5CZKA 1ZZBA 4O7XA 3AYCA 3FMGA 3THPA 1OLMA 3B01A 1O3RA 2BV4A 4I02A 3ZIXA 4C0BA 3JUUA 2Z42A 3AYAA 3PIGA 3OBRA 5GKAC 2WSUA 2VNRA 3WG4A 1ZZ9A 3N9QA 3PLQA 4GD4A 4UT5A 3WP5A 3BTZA 1QF3A 2RV9A 2VOWA 5AFEA 2WQZC 4XAAA 1REDA 1MR5A 1H30A 4XF3A 3KQRA 4K7JA 3VDDB 5FO9B 1PZ8A 4XJ9A 1RUF1 1SEFA 1Z7S1 2V73A 4XUOA 2KR2A 1QOOA 5F1RA 2ET7A 4AQSA 5A32B 3WT3A 3GBWA 2OW4A 1CESA 1OF3A 4QWNA 5EQUA 1O4YA 4XEZA 4RFT0 3I7DA 3POSA 1QJEA 1G8WA 2QQMA 1W2OA 2IXHA 1MEC3 2WZR3 4YZ4A 4CXWA 5C3OA 1W0NA 2DUOA 2Q1MA 1JUIA 2XONA 1KFUL 4QPYA 1WBLA 2R32A 3WDYA 2R072 2G9GA 2DURA 4UFJA 3ZFGB 1LGBA 2JDHA 2I2SA 1SLIA 1WMFA 4PDWB 5JOZA 1ZM1A 3CL1A 4I2OA 3ZFEB 3MLJA 4AXOA 3IPVB 1LRHA 5FZFA 4A42A 3S7EA 1FPN2 2FDGA 4N53A 3O12A 3ZN4A 4I0AA 5JI9A 3BGAA 3J9SA 4LO7A 5IVCA 2DYCA 4HN1A 4XF9A 3U14A 2WWJA 3B69A 2WWSA 3M4FA 3OPZA 4BM8A 1W04A 4ZZ8A 4IV1A 1ODNA 4XETA 4NHLA 4RGAA 5FQ0B 3DV8A 4UFLA 1RB8G 1C1LA 4ES8A 5FZHA 4DMIA 2R0FA 1KEXA 4E4ZA 3I2DA 3CO2A 3A21A 3SH4A 1F4AA 4LIVA 3SCGA 1Q8SA 5FFOC 2XHNA 1UX6A 1ZBE2 5BNPA 5KWRA 1W28A 4FAHA 5JDBA 3PNAA 4JGYB 3POBA 4UXAA 4NHYA 3O1TA 2X5IB 1G86A 2W1SA 1VBE1 1HB3A 2UY8A 5CFDA 2BVBA 3LA7A 1ACCA 2ZS6B 3JCIA 3WW4A 3WXPA 1IQAA 4RFRB 2BNNA 3FHIB 3JD72 3WW3A 3ZXJA 3SXWA 4BOWA 1K3IA 4S2DA 3ASIA 2R041 1UO9A 2ZZQA 2ENRA 1LOAA 1WGPA 4NOTA 1JHNA 2E53A 3ES4A 5ANQA 4AI1A 1PMIA 1W0OA 3WQ7A 4AHZA 5A1LA 4H14A 4XFHA 4KU7A 4XILA 4G9SB 4CU9A 2QQPA 3ROUA 2EAKA 2P3IA 1QH7A 5LASA 5FK8A 1SPPA 2ZCWA 4BXFA 2E33A 5FUPA 1SPPB 2R6QA 3OJBA 2CDPA 4LBQA 4A41A 1QXRA 4AG4A 3PHMA 3B9CA 1LOCA 1HN0A 2HEWF 4HKWA 2A6VA 3VKFC 5FYTA 3WG1A 3H8OA 4YG3A 4YW7A 5FJKA 4CP9A 4N8MA 3AZVA 5BUVA 4CP9B 3IWZA 4EN0A 4Z07A 4CP2A 4RSUA 4YVSB 5IUQA 4Y5SA 4Q4V1 1RVF2 2CHHA 1DYKA 1GMMA 4R9CA 2XJSA 4WV8A 1QEXA 4I0WB 5EZWA 1RUC2 4URAA 2J1SA 4YVWA 1FXZA 2A1XA 2WFF3 2XBO1 5KHHA 2R1DA 4EWDA 1ND2A 1C5IA 5GM0A 3SC7X 2SBAA 2ZTNA 2PHWA 3TN91 3VD3A 4H55A 2F4PA 2DWRA 2CWSA 4R9DA 1ND2B 3AZZA 3T4HB 3TEZA 5DAWA 2WAOA 2JKXA 4IUGA 1JN2P 1L7LA 4XJWA 3Q8BA 1W9FA 2IWGB 2V4VA 1UX7A 2BU9A 4QX3A 4QKFA 2GAUA 4XABA 2VUCA 3M2MA 3KVBA 4JQRA 3KGZA 3MPBA 5T50A 4R9BA 4TLFA 1XYOA 2LUWA 4DXRA 1JZ3A 1EYBA 1RJ8A 2HWC1 2VY0A 2P17A 2W1QA 3ZKYA 3ZMOA 5I0RA 2DFCA 2BGOA 1TME3 1OKOA 2WJSA 3J8F1 5JAXA 2VZQA 1RJ7A 1SLAA 4CCJA 2BERA 4YW5A 4CEWA 2CL2A 2QQLA 3KCXA 5A7WA 1PX4A 4AEKA 4ASKA 4FPOB 2FQPA 5CKMA 1OOPB 1O7FA 5A6YA 1RUG3 2JD9A 1RUI3 2Y6KA 3H3LA 4WZFA 4E4DX 1MS3A 2DCYA 4NVPA 4AEMA 2ARBA 1Q56A 4WVVA 2YU1A 3K46A 4K8FA 1HRV3 5C8WA 4QB1A 2C0ZA 3ZFFA 2Z4FA 3RQ0A 1JYIA 5CA6A 3A4UA 4ISRA 4P9LA 2RJKA 1VB2A 5FZKA 2QUOA 3VZKA 1PNGA 3HNBM 1WCUA 2W08A 4JRLA 4LBJA 4O61A 3VZOA 2CDOA 3WVJA 5JXJA 1RUE2 3VUOA 1GZTA 5FMOL 2QZ3A 1W3XA 4L92A 1LODA 1ZBA1 2WL1A 4IEQA 2JD4A 3DGTA 3KV4A 1DP0A 2FDIA 4AVCA 1REEA 1H8TB 1YIPA 2YFUA 2W3JA 4LO4B 2GALA 1MVEA 3GNEA 1D0GA 4QX2A 3T3YA 5J48A 1H9PA 1WW5A 3D0SA 4JDOA 4AGVA 5GZGA 3APBA 1XXNA 2HKXA 4IV3A 3THTA 1CD3G 1CAXB 1WUVA 4AGGA 1IOAA 4PLMA 1UYYA 2VZSA 3QH6A 3RYKA 3C3VA 1DZTA 1HB4A 4K21A 4Q0QA 1MQTA 1LENA 2F17A 2ZGPA 5FY8A 3VDDC 3NV4A 1SFNA 4DXTA 3MBWA 1W9WA 2GP5A 3RZKA 3B3QE 4UW5A 3GZAA 4DOUA 4EN6B 2ZGQA 4UF0A 4KBBA 3VBRA 2R073 3DCQA 1OH4A 3AX4A 3VKNA 4A3XA 1HIXA 4XFIA 2PA7A 4I01A 2YC4A 3MLLA 5JOYA 2RHPA 2D98A 1GKBA 1AR71 1YC61 2OXBA 1S0EA 5D21A 3PVEA 5EFUA 3VBUB 4OHVA 3ZFGC 3SNMA 4QXBA 4KU8A 4PDWC 1N1YA 1FPN3 3ZFEC 1PMJX 1LTEA 4P5YA 5A33A 1LEMA 4LUKA 4P02B 4RHV1 5IK4A 4JX0A 4NN0A 1UY0A 1ZA7A 1I3HA 3GHNA 2QJVA 4CYDA 2GC3A 4W4ZA 4AFBA 4XFFA 1PGW1 3CF6E 5AC92 4A4AA 1I1EA 2DCTA 5CYYA 4CCMA 1JZ6A 2ZBJA 3VD9A 3TNPB 4OMDA 1S2EA 3VZLA 4Q29A 4Y22B 1FMD2 1J3RA 1VRH2 1R091 3PIJA 3TNQA 1D7PM 1EUUA 2EIGA 3D82A 1UNBA 1W8NA 1ZBE3 3GJAA 1R082 3VBOA 5KHGA 5AFBA 4NPLA 3NO8A 4AHXA 2ORZA 1G9CA 2Y26A 3VBFB 4UBHA 5I0SA 4JGYC 1AL22 2GNDA 3PL0A 4GALA 4I0BA 1GBGA 2X5IC 5DDJ1 3JD73 5DXDA 1XE0A 3EO6A 5EXOA 1QDOA 3RI9A 3K51A 3UYJA 1OKQA 4GULA 1AJOA 3TEYA 1SLCA 3E97A 2FHRA 3VZMA 5A7OA 4AFMA 2BFUS 4XE9A 1DQ6A 1EAH1 1GR3A 2D43A 2VTFA 4FPYA 2FDFA 3ZXAC 3IBMA 4DRVA 5A3UA 3OPTA 3AKRA 1LKNA 3MUY1 4ZXKA 2B9VA 1X50A 2UYAA 3AP9A 3QOPA 4FCAA 5FZIA 1RUJ1 2ZMLA 4AWDA 3HWJA 1AHSA 5FP4A 4IGOA 3VGIA 3WEZA 2WT0A 3A7QA 2NMNA 2DCJA
chains in the Genus database with same CATH topology
2WO3A 1JU4A 1BHGA 4OYUA 3HNMA 2W92A 5JUVA 2XQXA 1ULPA 5DN2A 2W91A 2J22A 3OEBA 1CZTA 1NKGA 3K4AA 4A45A 4QX0A 2J1AA 2KD7A 4L0PA 3CMGA 4ARXA 3NNGA 3LQCA 5LCWL 1R64A 3WF0A 1PX3A 4QDRA 3VD5A 2VZOA 3SKVA 3C8XA 3GDBA 3THDA 2ZEZA 4MOAA 4QAWA 1F4HA 4RYDA 3NQHA 1J84A 4A3ZA 4CU7A 5B4NA 5JMOA 5I0DA 4BXSV 2E26A 4AAXA 4ZZ5A 3FHAA 3ETPA 3WQBA 5C71A 1JZ8A 3I97A 3P1IA 2R7EB 3CDZB 4DUWA 1XC6A 4GWJA 4UI9L 1OF4A 1L7QA 4PT6A 3I3BA 2J1EA 5EJ1B 1TVGA 4GWIA 2X09A 3T2PA 2C9KA 3K4ZA 3T2OA 3CKHA 2VOTA 5IYYA 3C7EA 4ZXEA 4DXSA 2WO2A 3IDAA 4OMCA 4QDSA 3ZM8A 1RYYA 5HPOA 3T0BA 1O8SA 5G05L 1US3A 2E31A 1EUTA 1OT5A 4UOJA 3P6BA 1SDDB 3JXSA 4ET7A 3IAQA 2WN3A 2X10A 3ACHA 3T08A 4CUCA 3ABZA 3WNNA 3DYMA 3MO4A 4RN5A 2XOMA 2J1RA 4JHZA 1JYXA 2L9LA 2W1UA 1UXXX 2VCAA 1JYWA 2QQKA 2WAAA 2WUHA 4BK5A 2J1TA 2DCKA 3I3DA 3UESA 2JE8A 2YB7A 3IAPA 3A22A 1LNSA 2ZEXA 3PUIA 4CU6A 3IIIA 1O8PA 2WQ8A 2WZ8A 3WNKA 1NX9A 4JKLA 2VC9A 2J7MA 2W94A 3NRUA 4HG6B 1K45A 3I2GA 3LEKA 3OBAA 1CZSA 2Y6JA 4CUAA 2W87A 1UYXA 5IHRA 3OGSA 4XURA 1I5PA 3OG2A 5JR2A 1JI6A 2VZ3A 1UY3A 2BBAA 2EIEA 5IJRA 4MGQA 3C7FA 1O59A 4DUVA 1OD3A 3MV01 4W50A 3EB7A 1JYVA 3VDCA 3HOBA 5CZKA 3ACGA 2VL4A 1TG7A 3OB8A 4QB2A 4PF1A 5FUIA 2DDUA 2QQNA 3I3EA 1P8JA 3WNPA 2RV9A 3FHQA 3T09A 1T2XA 2J1VA 2RJ2A 3DYPA 4XUOA 1L7RA 4CVUA 5B4XA 1GUIA 1OF3A 2VZTA 3J7HA 2VMEA 2QQMA 2ZXQA 2QBXA 1W0NA 2XONA 3SEPA 1GU3A 5JXHA 4YPJA 2X05A 3LPFA 2J1UA 4LHSA 3T0AA 4A42A 1K12A 3PUHA 3BGAA 3THCA 4XUTA 5JXIA 4ZZ8A 3NJXA 5LA1A 2VZPA 3I2HA 3K4DA 4GZ9A 1KEXA 1JZ5A 3A21A 1F4AA 3LEIA 2XHNA 5EJZB 5HXMA 3WNMA 3I2FA 1W9SA 3UNPA 2W1SA 3A23A 4XUQA 5J1XA 2C4XA 3I2JA 2ID4A 2QQIA 2WBKA 1HN1A 1K3IA 1XPWA 1NAEA 1UY2A 3MV11 3E1F1 2QQJA 1UWWA 4QPWA 4CU9A 1SG3A 3HPNA 3K75B 4A6OA 4D0QA 2E33A 1PMHX 2CDPA 4A41A 3HNYM 4AG4A 3OEAA 4KWUA 5DPNA 1H6XA 2YG0A 2VM9A 3GM8A 3UETA 4ZY9A 1UY4A 2V72A 4BK4A 2V5DA 1DLCA 1YQ2A 1GMMA 1KGYA 5DMYA 2J1SA 3AC0A 3FN9A 3VD3A 2HLEA 5IFPA 1JZ4A 2WAOA 2JKXA 4DEQA 4IUGA 4MO3M 2V4VA 1UX7A 3NJVA 4QX3A 3VDBA 2ZEYA 4OZOA 2EIBA 1NUKA 2B4KA 4DXRA 2WN2A 1JZ3A 2WZEA 2EICA 2W1QA 3LE0A 2BGOA 5C7GA 1UXZA 1JZ7A 1CIYA 2W46A 4XUNA 2VZQA 2BERA 1IQDC 2QQLA 2WO1A 1PX4A 3VD7A 2Y8KA 3OGVA 2WDBA 1UZ0A 1CX1A 2JD9A 4CU8A 2Y6KA 4ARYA 2RVAA 3LPGA 3SEEA 2VMFA 3T2QA 5LA0A 3DYOA 1SHWB 3K46A 4W8JA 3U37A 2VQTA 4CUBA 1GOHA 4QB1A 2W5FA 2Z4FA 2BGPA 3LEGA 2VMCA 4LPLA 4E8DA 4JKMA 3WSOA 3HNBM 1GOFA 2E32A 2CDOA 4M4RA 5JXJA 2PQSA 3GXUA 4LQRA 3OGRA 2Y6HA 4KI5M 4OUEA 1JYNA 2WYSA 3CZUA 1DP0A 2ORXA 3ACIA 5F7UA 2YFUA 2JDAA 2W3JA 3MUZ1 1H6YA 2WABA 4QX2A 4D8MA 5C70A 1K42A 4MADA 3WF3A 2EIDA 3I2KA 4FI9A 1UYYA 2VZSA 1MPXA 2BZDA 4KMQA 5DQ0A 1ULOA 1UY1A 4MGSA 2LW8A 3VD4A 2VJXA 4DXTA 4XVHA 3MBWA 1W9WA 1UYZA 3WF1A 4E8CA 3WF2A 2Y6GA 5A1AA 1GNYA 1OH4A 1W99A 2C26A 5EIYB 2VZUA 2W95A 3GGLA 1WKYA 2YC4A 2HYXA 2VMDA 3SKJE 1WCQA 2ZEWA 3BN6A 3C7GA 4DUXA 2OKXA 2VR4A 2W9XA 2VZVA 1PMJX 1UMHA 1GOGA 1W9TA 4P5YA 4P02B 2Y64A 4QX1A 4JX0A 2YC2A 1UY0A 5IFTA 4Z2AA 4W4ZA 3HEIA 2VQUA 3CIHA 4PQQA 4A4AA 3ACFA 5CYYA 2YFZA 1DYOA 5LA2A 3VDAA 1JZ6A 1W8OA 3VD9A 2Y6LA 4OMDA 3WF4A 1J83A 1JHJA 4JKKA 4QB6A 3HN3A 1EUUA 1D7PM 3W5MA 1W8NA 3C7OA 3DECA 4LKSA 3IB3A 4XUPA 3W5NA 4P08A 3WNOA 2QQOA 4DEVA 2VZRA 2ORZA 1JU3A 2VCCA 1US2A 4BJ0A 4M4PA 2LS6A 3K77A 1UMIA 4UAPA 2VZ1A 1JZ2A 3FL7A 3F2ZA 1XNAA 3D3AA 4TXWA 4BDVB 3C7HA 3I2IA 2VCBA 3ECQA 5JXGA 1CZVA 2VTFA 4TTGA 3EYPA 2VO5A 4A44A 1GQPA 3CZJA 1XNTA 3MUY1 2W47A 2B9VA 5G04L 3WNLA 2W1WA 3CQOA 4QDQA 4P00B 3WEZA 3T0DA 3HJRA 4XZUG 3A7QA 2DCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WO3 A;  1JU4 A;  1BHG A;  4OYU A;  3HNM A;  2W92 A;  5JUV A;  2XQX A;  1ULP A;  5DN2 A;  2W91 A;  2J22 A;  3OEB A;  1CZT A;  1NKG A;  3K4A A;  4A45 A;  4QX0 A;  2J1A A;  2KD7 A;  4L0P A;  3CMG A;  4ARX A;  3NNG A;  3LQC A;  5LCW L;  1R64 A;  3WF0 A;  1PX3 A;  4QDR A;  3VD5 A;  2VZO A;  3SKV A;  3C8X A;  3GDB A;  3THD A;  2ZEZ A;  4MOA A;  4QAW A;  1F4H A;  4RYD A;  3NQH A;  1J84 A;  4A3Z A;  4CU7 A;  5B4N A;  5JMO A;  5I0D A;  4BXS V;  2E26 A;  4AAX A;  4ZZ5 A;  3FHA A;  3ETP A;  3WQB A;  5C71 A;  1JZ8 A;  3I97 A;  3P1I A;  2R7E B;  3CDZ B;  4DUW A;  1XC6 A;  4GWJ A;  4UI9 L;  1OF4 A;  1L7Q A;  4PT6 A;  3I3B A;  2J1E A;  5EJ1 B;  1TVG A;  4GWI A;  2X09 A;  3T2P A;  2C9K A;  3K4Z A;  3T2O A;  3CKH A;  2VOT A;  5IYY A;  3C7E A;  4ZXE A;  4DXS A;  2WO2 A;  3IDA A;  4OMC A;  4QDS A;  3ZM8 A;  1RYY A;  5HPO A;  3T0B A;  1O8S A;  5G05 L;  1US3 A;  2E31 A;  1EUT A;  1OT5 A;  4UOJ A;  3P6B A;  1SDD B;  3JXS A;  4ET7 A;  3IAQ A;  2WN3 A;  2X10 A;  3ACH A;  3T08 A;  4CUC A;  3ABZ A;  3WNN A;  3DYM A;  3MO4 A;  4RN5 A;  2XOM A;  2J1R A;  4JHZ A;  1JYX A;  2L9L A;  2W1U A;  1UXX X;  2VCA A;  1JYW A;  2QQK A;  2WAA A;  2WUH A;  4BK5 A;  2J1T A;  2DCK A;  3I3D A;  3UES A;  2JE8 A;  2YB7 A;  3IAP A;  3A22 A;  1LNS A;  2ZEX A;  3PUI A;  4CU6 A;  3III A;  1O8P A;  2WQ8 A;  2WZ8 A;  3WNK A;  1NX9 A;  4JKL A;  2VC9 A;  2J7M A;  2W94 A;  3NRU A;  4HG6 B;  1K45 A;  3I2G A;  3LEK A;  3OBA A;  1CZS A;  2Y6J A;  4CUA A;  2W87 A;  1UYX A;  5IHR A;  3OGS A;  4XUR A;  1I5P A;  3OG2 A;  5JR2 A;  1JI6 A;  2VZ3 A;  1UY3 A;  2BBA A;  2EIE A;  5IJR A;  4MGQ A;  3C7F A;  1O59 A;  4DUV A;  1OD3 A;  3MV0 1;  4W50 A;  3EB7 A;  1JYV A;  3VDC A;  3HOB A;  5CZK A;  3ACG A;  2VL4 A;  1TG7 A;  3OB8 A;  4QB2 A;  4PF1 A;  5FUI A;  2DDU A;  2QQN A;  3I3E A;  1P8J A;  3WNP A;  2RV9 A;  3FHQ A;  3T09 A;  1T2X A;  2J1V A;  2RJ2 A;  3DYP A;  4XUO A;  1L7R A;  4CVU A;  5B4X A;  1GUI A;  1OF3 A;  2VZT A;  3J7H A;  2VME A;  2QQM A;  2ZXQ A;  2QBX A;  1W0N A;  2XON A;  3SEP A;  1GU3 A;  5JXH A;  4YPJ A;  2X05 A;  3LPF A;  2J1U A;  4LHS A;  3T0A A;  4A42 A;  1K12 A;  3PUH A;  3BGA A;  3THC A;  4XUT A;  5JXI A;  4ZZ8 A;  3NJX A;  5LA1 A;  2VZP A;  3I2H A;  3K4D A;  4GZ9 A;  1KEX A;  1JZ5 A;  3A21 A;  1F4A A;  3LEI A;  2XHN A;  5EJZ B;  5HXM A;  3WNM A;  3I2F A;  1W9S A;  3UNP A;  2W1S A;  3A23 A;  4XUQ A;  5J1X A;  2C4X A;  3I2J A;  2ID4 A;  2QQI A;  2WBK A;  1HN1 A;  1K3I A;  1XPW A;  1NAE A;  1UY2 A;  3MV1 1;  3E1F 1;  2QQJ A;  1UWW A;  4QPW A;  4CU9 A;  1SG3 A;  3HPN A;  3K75 B;  4A6O A;  4D0Q A;  2E33 A;  1PMH X;  2CDP A;  4A41 A;  3HNY M;  4AG4 A;  3OEA A;  4KWU A;  5DPN A;  1H6X A;  2YG0 A;  2VM9 A;  3GM8 A;  3UET A;  4ZY9 A;  1UY4 A;  2V72 A;  4BK4 A;  2V5D A;  1DLC A;  1YQ2 A;  1GMM A;  1KGY A;  5DMY A;  2J1S A;  3AC0 A;  3FN9 A;  3VD3 A;  2HLE A;  5IFP A;  1JZ4 A;  2WAO A;  2JKX A;  4DEQ A;  4IUG A;  4MO3 M;  2V4V A;  1UX7 A;  3NJV A;  4QX3 A;  3VDB A;  2ZEY A;  4OZO A;  2EIB A;  1NUK A;  2B4K A;  4DXR A;  2WN2 A;  1JZ3 A;  2WZE A;  2EIC A;  2W1Q A;  3LE0 A;  2BGO A;  5C7G A;  1UXZ A;  1JZ7 A;  1CIY A;  2W46 A;  4XUN A;  2VZQ A;  2BER A;  1IQD C;  2QQL A;  2WO1 A;  1PX4 A;  3VD7 A;  2Y8K A;  3OGV A;  2WDB A;  1UZ0 A;  1CX1 A;  2JD9 A;  4CU8 A;  2Y6K A;  4ARY A;  2RVA A;  3LPG A;  3SEE A;  2VMF A;  3T2Q A;  5LA0 A;  3DYO A;  1SHW B;  3K46 A;  4W8J A;  3U37 A;  2VQT A;  4CUB A;  1GOH A;  4QB1 A;  2W5F A;  2Z4F A;  2BGP A;  3LEG A;  2VMC A;  4LPL A;  4E8D A;  4JKM A;  3WSO A;  3HNB M;  1GOF A;  2E32 A;  2CDO A;  4M4R A;  5JXJ A;  2PQS A;  3GXU A;  4LQR A;  3OGR A;  2Y6H A;  4KI5 M;  4OUE A;  1JYN A;  2WYS A;  3CZU A;  1DP0 A;  2ORX A;  3ACI A;  5F7U A;  2YFU A;  2JDA A;  2W3J A;  3MUZ 1;  1H6Y A;  2WAB A;  4QX2 A;  4D8M A;  5C70 A;  1K42 A;  4MAD A;  3WF3 A;  2EID A;  3I2K A;  4FI9 A;  1UYY A;  2VZS A;  1MPX A;  2BZD A;  4KMQ A;  5DQ0 A;  1ULO A;  1UY1 A;  4MGS A;  2LW8 A;  3VD4 A;  2VJX A;  4DXT A;  4XVH A;  3MBW A;  1W9W A;  1UYZ A;  3WF1 A;  4E8C A;  3WF2 A;  2Y6G A;  5A1A A;  1GNY A;  1OH4 A;  1W99 A;  2C26 A;  5EIY B;  2VZU A;  2W95 A;  3GGL A;  1WKY A;  2YC4 A;  2HYX A;  2VMD A;  3SKJ E;  1WCQ A;  2ZEW A;  3BN6 A;  3C7G A;  4DUX A;  2OKX A;  2VR4 A;  2W9X A;  2VZV A;  1PMJ X;  1UMH A;  1GOG A;  1W9T A;  4P5Y A;  4P02 B;  2Y64 A;  4QX1 A;  4JX0 A;  2YC2 A;  1UY0 A;  5IFT A;  4Z2A A;  4W4Z A;  3HEI A;  2VQU A;  3CIH A;  4PQQ A;  4A4A A;  3ACF A;  5CYY A;  2YFZ A;  1DYO A;  5LA2 A;  3VDA A;  1JZ6 A;  1W8O A;  3VD9 A;  2Y6L A;  4OMD A;  3WF4 A;  1J83 A;  1JHJ A;  4JKK A;  4QB6 A;  3HN3 A;  1EUU A;  1D7P M;  3W5M A;  1W8N A;  3C7O A;  3DEC A;  4LKS A;  3IB3 A;  4XUP A;  3W5N A;  4P08 A;  3WNO A;  2QQO A;  4DEV A;  2VZR A;  2ORZ A;  1JU3 A;  2VCC A;  1US2 A;  4BJ0 A;  4M4P A;  2LS6 A;  3K77 A;  1UMI A;  4UAP A;  2VZ1 A;  1JZ2 A;  3FL7 A;  3F2Z A;  1XNA A;  3D3A A;  4TXW A;  4BDV B;  3C7H A;  3I2I A;  2VCB A;  3ECQ A;  5JXG A;  1CZV A;  2VTF A;  4TTG A;  3EYP A;  2VO5 A;  4A44 A;  1GQP A;  3CZJ A;  1XNT A;  3MUY 1;  2W47 A;  2B9V A;  5G04 L;  3WNL A;  2W1W A;  3CQO A;  4QDQ A;  4P00 B;  3WEZ A;  3T0D A;  3HJR A;  4XZU G;  3A7Q A;  2DCJ A; 
#chains in the Genus database with same CATH topology
 3KT4 A;  2WT2 A;  1ASJ 1;  2QFE A;  1GYK A;  4EYU A;  4FPJ A;  1CON A;  4CEY B;  5ABJ A;  2YU2 A;  4CDQ A;  1V6J A;  5FRE A;  1H1M A;  2BUK A;  4A2U A;  1HV0 A;  4CDQ B;  3GJB A;  1BXH A;  1RVF 3;  3K4A A;  4A45 A;  2VD7 A;  2Q1F A;  4YVS C;  4EZH A;  1RUC 3;  4F3J A;  1QNW A;  4ARX A;  4LE3 A;  3AMQ A;  1Q43 A;  5C3Q A;  3LQC A;  2GU9 A;  4B1L A;  1A78 A;  2A3Y A;  4Q4Y 1;  3RZJ A;  3AP7 A;  2GMP A;  4QDR A;  4OQ9 A;  2VZO A;  2SLI A;  3SCH A;  1BCX A;  5CIR A;  5JPM B;  1Y9M A;  1GP4 A;  1H0B A;  1VAK A;  1LB2 A;  1YCI A;  2ZEZ A;  1ND2 C;  1F4H A;  1JYC A;  1LOE A;  3ZN6 A;  4HVR A;  4LA3 A;  5JR7 B;  2D6K A;  4BIF A;  3VZJ A;  2B46 X;  3OSD A;  3ZN6 B;  1LES A;  1HB2 A;  3N7K A;  4PIZ A;  4Q4X 2;  1UU5 A;  5C8C A;  3MIF A;  2P3Y A;  4GB3 2;  5CNA A;  4N43 B;  3WQ0 A;  3O7O A;  4HET A;  5GZF A;  4LIU A;  1XE7 A;  4AAX A;  4Y4Y A;  1HKD A;  4ZHN A;  5T5O A;  3ETP A;  1HQW A;  4XMI A;  1SDW A;  3K3N A;  1SFP A;  2G1M A;  2HWB 1;  4DUW A;  5IT6 A;  1UU6 A;  5LK5 A;  4UW3 A;  3BTY A;  3PVO A;  1EP0 A;  1L7Q A;  1AR8 1;  3OD4 A;  4YAR A;  1OOP C;  4KG8 A;  5C33 A;  4AHY A;  4MGI E;  3T2P A;  3WDT A;  5LAT A;  1POV 3;  3K4Z A;  3CKH A;  4LOR A;  3WLU A;  4WVW A;  1UU4 A;  2VOT A;  3UGG A;  3C7E A;  5C9A B;  1RUE 3;  1RYY A;  2O0O A;  2Y33 A;  4XOG A;  5IVF A;  5G05 L;  1US3 A;  4AFC A;  3D8C A;  1WBF A;  1ZZC A;  1S0I A;  3ORJ A;  3P6B A;  4M3C E;  4IEU A;  2XB6 C;  3WUC A;  2WN3 A;  1RUF 2;  1BZW A;  2ADD A;  2PHU A;  3KT1 A;  4IDZ A;  4BQ3 A;  5J36 A;  1JYT A;  2WFP A;  5A7S A;  1H8T C;  3L2H A;  5ERL A;  3T08 A;  3I4I A;  5C3R A;  5I0T A;  4BA6 A;  3H3U A;  1I5Z A;  1STM A;  5IVY A;  3TYJ A;  3DYM A;  3L9J T;  3AK0 A;  2Q5T A;  3MO4 A;  2XOM A;  1IG0 A;  4TN7 A;  3VV1 A;  1NCQ B;  3N35 A;  4MHU A;  2ARA A;  1CQ9 A;  2ARX A;  2CAV A;  2J1R A;  4JHZ A;  2VW0 A;  4F83 A;  5ACA 1;  2L9L A;  4IEP A;  2CGP A;  2VOV A;  1S0F A;  1PM7 A;  4D94 A;  2YBK A;  1PO1 1;  1UXX X;  2VCA A;  4FPF A;  4M3C F;  1PO2 1;  4PBO A;  5K7P A;  2HWD 1;  1U5I A;  2WAA A;  3MIC A;  5FZ3 A;  3WHU A;  2YGM A;  1H2L A;  5LK7 B;  4V2V A;  3ZXD A;  3H50 A;  3NL1 A;  1ZRC A;  3O0W A;  5FUN A;  1W6M B;  2P34 A;  4QX8 A;  3P3N A;  1WA4 A;  1F5J A;  1WLD A;  2D40 A;  3PUI A;  3ZXF A;  4LTA A;  4HL0 A;  3III A;  5IAX A;  4JDN A;  2WQ8 A;  3WNK A;  4EV0 A;  3ZIW A;  3CEW A;  3AYD A;  2D93 A;  3O1O A;  1DQ0 A;  4IGP A;  2P1B A;  4E2S A;  4EWA A;  3NRU A;  5LEK A;  5JIU A;  5FY1 A;  1K45 A;  4M0N A;  1XSQ A;  5FZ1 A;  3U78 A;  1R1A 1;  5A7Q A;  1Q8V A;  4CUA A;  4FPL A;  1ZNP A;  2GNB A;  1UYX A;  4I30 A;  2JB8 A;  1W8U A;  2JJ6 A;  4MH0 E;  3RJ2 X;  4BLI A;  2MNG A;  3J7N A;  3OTF A;  3OUI A;  1GQH A;  3HVD A;  4QGL A;  5AC9 3;  2DV9 A;  3OG2 A;  3MDP A;  1PHM A;  4GH4 A;  5JR2 A;  2CYF A;  4XHB A;  4YGE A;  2VZ3 A;  2VW2 A;  3VKL A;  2HJI A;  1POV 0;  5C5T A;  4M01 A;  5HBA A;  1FMD 3;  1G9F A;  1VRH 3;  3R05 A;  2JDU A;  2WS9 1;  5HCB A;  2JXA A;  4UW6 A;  4W50 A;  4CA9 A;  1JYV A;  3O1U A;  1DQ5 A;  4KQ7 A;  1LEC A;  1HW5 A;  1R08 3;  2R04 2;  1W2A X;  3HOB A;  4XBL A;  2VL4 A;  5H9Q A;  3ZXK A;  3WW2 A;  5JOX A;  3JU9 A;  5CG9 A;  4CSW A;  1C1F A;  3OBT A;  4QB2 A;  2GH2 A;  2B42 B;  1AL2 3;  3I3E A;  4J1X A;  5B2G B;  1D2Q A;  4LT5 A;  3WNP A;  2MEV 1;  1RUD 1;  3LAG A;  2Y0I A;  3P3P A;  2WQ4 A;  4PJY A;  5BYN A;  2BEO A;  4Z1V A;  4BB3 A;  3VBF C;  2HBU A;  4AOC A;  5F3E A;  2J1V A;  4UFI A;  4B7K A;  1WLW A;  1VMH A;  2IC1 A;  4NMI A;  4QKN A;  4J1W A;  2JB4 A;  1Q8O A;  4BU2 A;  5B4X A;  1GUI A;  5FZ8 A;  2VMG A;  4QQL A;  3GZU C;  3ZYJ B;  4QGN A;  4AVV A;  2QBX A;  3PMS A;  4FP2 A;  1W8F A;  4FQ4 A;  1OQD A;  3SLI A;  2OUJ A;  1Y3T A;  3ON7 A;  4Q27 A;  4Q4V 2;  3ENR A;  1XYP A;  4QMA A;  3RYP A;  2W0X A;  4P9I A;  1A3K A;  4PI0 A;  1MZ6 A;  1UKG A;  1DG6 A;  1SAC A;  4ATF A;  1ALY A;  1AYM 2;  2QDN A;  2XBO 2;  3LPF A;  2IXJ A;  2X05 A;  2J1U A;  3BU7 A;  1KDK A;  4LNV A;  3ZYF A;  1C3H A;  4WVM B;  5FO7 B;  1Y9Q A;  4QM9 A;  5K0U A;  3VBS A;  3PUH A;  5FYY A;  1BLZ A;  3BIW E;  1IS5 A;  2BFU L;  2HEY F;  4XW3 A;  3THC A;  3WG2 A;  4CEY C;  5HV0 A;  1RXG A;  5FXZ A;  4MXV A;  1ODM A;  5KHI A;  3A0K A;  4CDQ C;  3VN4 A;  5CIS A;  5KR7 A;  1GQG A;  3UKN A;  3NJX A;  3ZYG A;  3RI8 A;  4CRQ A;  4AL9 A;  5JSR A;  5FZO A;  5LA1 A;  4LJH A;  3ILF A;  2HWC 2;  3WOG A;  4BQX A;  5FLH A;  1Z0H A;  2A7A A;  4XIO A;  5FZO B;  3ZSK A;  1QJU 1;  1HV1 A;  2OT7 A;  3J8F 2;  2CSG A;  3WCS A;  3D5O A;  3AJY A;  4QQH A;  3H0O A;  4M3C B;  1B35 B;  4WM8 B;  3OD0 A;  5T55 A;  2LTN A;  2RS1 1;  2WNU A;  4AFD A;  1FV2 A;  3ZR6 A;  4YNI A;  2OZJ A;  4CCE A;  1ZRI A;  4Q4X 3;  2W52 A;  4ERO A;  5EJZ B;  1ZRF A;  5HXM A;  3WNM A;  4QPG A;  5L7O A;  2ETE A;  1HDK A;  4GB3 3;  4HSJ A;  5BXX A;  3UNP A;  3A23 A;  2AAC A;  1V6L A;  3AKP A;  4XUQ A;  5J1X A;  3QBQ A;  1PK6 B;  1W6Q A;  3I2J A;  2ID4 A;  1UN1 A;  1E5H A;  4N43 C;  5C8C C;  2WBK A;  1HN1 A;  1XSR A;  2ZKN A;  2WYF A;  5DUW A;  5E16 A;  3V64 A;  2JKB A;  1FX5 A;  1DQ1 A;  3URF A;  1QKQ A;  1LHV A;  3I59 B;  1GV9 A;  1UD1 A;  1ZBA 2;  1JOP A;  1JXN A;  1UKR A;  1SBD A;  1W6N A;  2Y38 A;  1NA1 A;  2QQJ A;  1RC6 A;  4HLT A;  3AL5 A;  4IQP A;  3N9O A;  3M3I A;  2PQQ A;  4FT8 A;  4QD2 A;  4DRR A;  4A6O A;  2D3S A;  4D0Q A;  4F8A A;  3B9I A;  4JGZ A;  2YY1 A;  2RMU 2;  4JGZ B;  4HZF A;  3GYD A;  3WR0 A;  1V6M A;  2IVJ A;  4Z2W A;  2ZAC A;  3RZG A;  1AYN 1;  1OMI A;  3HNY M;  2WSV A;  4KWU A;  5C9A C;  1YIF A;  2D6O X;  2UWB A;  3E5X A;  4KGG A;  4LUM A;  1XU1 A;  4GMP 1;  1S0B A;  1H6X A;  1WWY A;  4NWV A;  4YW1 A;  5FYM A;  3WW1 A;  2RM2 1;  1A6C A;  1RUF 3;  4JTO A;  3HBZ A;  1D4V B;  1LJ7 A;  5KBF A;  4QPI A;  5FBZ A;  1RIN A;  1HRI 1;  2NZ9 A;  1FI2 A;  2YGL A;  2DU1 A;  2JDK A;  5F6L B;  2VQA A;  1LR5 A;  1U5X A;  3UET A;  4IEZ A;  1VB4 A;  2VXJ A;  3GCX A;  4FFG A;  5LY1 A;  2Y34 A;  3H8R A;  1GAN A;  4NRP A;  2V72 A;  4E4H A;  4H7L A;  2JIC A;  2Q8O A;  5TSW A;  3S7I A;  1UZY A;  2ZGT A;  4P9Y A;  1IS6 A;  2BP6 A;  4LK7 A;  1OFN A;  3RMX A;  2DVG A;  2W39 A;  3RFR A;  1UPS A;  4IW3 A;  3FN9 A;  2VEC A;  2CWM A;  5GLZ A;  3M3C A;  2A73 B;  3U4S A;  3BAL A;  2YPD A;  4R52 A;  1NCQ C;  1V9U 1;  3BUC A;  4XAE A;  1W6O A;  2VU9 A;  3FBM A;  5C3S A;  1BQP A;  1RMU 2;  3FC0 A;  4YRD A;  1W6O B;  4MO3 M;  5FZD A;  3ZYH A;  1ZZ6 A;  3NJV A;  4GJZ A;  3VKO A;  3O1M A;  4CE8 A;  2NPI A;  2WN2 A;  5LEJ A;  4QXC A;  2EIC A;  1SLT A;  3LE0 A;  2K9Z A;  5FZG A;  3KV5 A;  5C7G A;  3OGJ A;  3WX5 A;  3KF5 A;  3ZR5 A;  1PGW 2;  3RNS A;  1CVN A;  3LFI A;  5FCC A;  3U10 A;  1XND A;  3T1M A;  2H6C A;  2H0B A;  2FZ2 A;  4XXA A;  3IZO A;  2R06 2;  2WIN B;  1V00 A;  1LOF C;  3OY8 A;  4OUS A;  4XJA A;  3WV6 A;  2TBV A;  2XJR A;  2AH2 A;  1CX1 A;  3OY8 B;  4CU8 A;  2DVD A;  2D3P A;  4BYY A;  2RVA A;  3SEE A;  2O14 A;  2VMF A;  3LA3 A;  5LA0 A;  5FYZ A;  1RGS A;  4JC1 A;  2JEC A;  4YZ2 A;  1T6G C;  1FNZ A;  4Q1R A;  1V70 A;  4DNY A;  4LPL A;  4OZX A;  4BIO A;  5KXE A;  3ITQ A;  3S0M A;  4NWW A;  1UQX A;  3ILR A;  3ETQ A;  4FVV A;  2PQS A;  5D2A A;  3BOW A;  1F2N A;  2EXI A;  3NVC A;  4LEJ A;  4LQR A;  3SIS A;  4GH4 C;  3WCR A;  2B5H A;  1W03 A;  3DXU A;  4Z82 A;  4OUE A;  4F7Z A;  4UFK A;  1JYN A;  2R04 3;  2HWF 2;  4X6Q B;  3NV2 A;  3BTA A;  2JDA A;  3MUZ 1;  2VTX J;  2GME A;  3EHK A;  5LY2 A;  4JCK A;  4KG0 A;  1YUD A;  2JE7 A;  5H9R A;  2PLV 1;  2ES3 A;  4N53 B;  4LOS A;  4OQ8 A;  1K42 A;  2YZ4 A;  4GKX A;  3C2U A;  1EAH 2;  4IEW A;  3LCP A;  3VBH A;  3WNX A;  2C1F A;  5KXD A;  3WF3 A;  3VBH B;  3M1H A;  3MHZ A;  1S0J A;  3I2K A;  4FI9 A;  4AQ6 A;  2OPK A;  1ZZ7 A;  2BNO A;  4IV1 B;  4ZPI A;  3MYX A;  5FPZ A;  1RUJ 2;  3AXE A;  1IS3 A;  3DN7 A;  4NAM A;  1UY1 A;  1LGN A;  1X33 A;  2I07 B;  1VBD 2;  2LW8 A;  3VD4 A;  1RXF A;  3BTX A;  2OQ7 A;  3RRD A;  4HBN A;  1UYZ A;  3WF1 A;  4DZG A;  2Y6G A;  3WDV A;  3NKT A;  1DF0 A;  2FZ1 A;  1WZX A;  5BNP B;  3N4M A;  3P5B A;  3I2O A;  3KZ4 C;  1OC1 A;  1W99 A;  2C26 A;  4Q4V 3;  1WD4 A;  5EIY B;  2AGS A;  3GGL A;  5L73 A;  1L3J A;  5CFD B;  1AYM 3;  1E5I A;  2OA2 A;  2XBO 3;  1WCQ A;  3BN6 A;  4OHX A;  2JDM A;  1BK0 A;  4IES A;  4JZR A;  3ZYR A;  2EF6 A;  3USS A;  4MG2 A;  4CPB A;  5IVB A;  4RL7 A;  1HXS 2;  3MIG A;  3OOX A;  1OXC A;  4KWJ A;  2VZV A;  4Q1P A;  3RDI A;  2RR1 1;  3RMY A;  2AUY A;  1MEC 1;  3WY6 A;  4QHO A;  4L2N A;  4B4P A;  2Y64 A;  5FZC A;  1DGW A;  2BDR A;  2Z69 A;  4MX3 A;  4GXL A;  1OBN A;  1Y43 B;  3RYR A;  5FPX A;  1ND3 A;  1HQN A;  3Q8C A;  2XJQ A;  5K0U C;  2XL7 A;  1E5S A;  2HWC 3;  3ACF A;  1NE4 A;  2YFZ A;  1DYO A;  5LA2 A;  1H4H A;  3PME A;  1W8O A;  2BGC A;  2JEM A;  3J8F 3;  4LBQ B;  1AZD A;  3BVC A;  4Q0P A;  2XL9 A;  4YFW A;  3W59 A;  1CAV A;  1JHJ A;  4RR3 A;  2ZGM A;  1RHI 1;  2VVE A;  5FTT C;  5CBL A;  1CAV B;  5FZM A;  1NCR A;  3ZN5 A;  5IVV A;  3W5M A;  4LKS A;  5SV5 A;  1B35 C;  2HWB 2;  3IB3 A;  4WM8 C;  1PNF A;  4YM2 A;  1VMF A;  3DEM A;  4XUP A;  5APA A;  4Q0U A;  1AR8 2;  5T52 A;  4P14 A;  4YWA A;  4PLN A;  5F8P A;  1JU3 A;  3MW2 A;  5FZ6 A;  1MS0 A;  1PVX A;  1QOS A;  1MZE A;  2HYK A;  4OI4 A;  3MPP G;  2FCU A;  4Y33 A;  4YVW B;  2RDN A;  2JG8 A;  3AZX A;  1PK6 C;  3LD8 A;  1ZRD A;  3FL7 A;  1XNA A;  4KBZ A;  3T4V A;  5JSP A;  3D3A A;  4TXW A;  1ZBA 3;  2GC2 A;  4IGQ A;  4WM7 A;  1MS5 A;  3I2I A;  2A70 A;  4FOY A;  4QU2 A;  2B45 X;  1QH6 A;  4TTG A;  5JWP A;  5T3N A;  3EYP A;  1OA3 A;  4A44 A;  2RS5 1;  5FY7 A;  4WVZ A;  3BB6 A;  4Q8K A;  2QQV A;  4CDX A;  5FOJ B;  5LW9 A;  2RMU 3;  2BPA 2;  5G04 L;  3WNL A;  4CDW A;  4D6R A;  1C8M 2;  4HFS A;  4FBF A;  2KXL A;  2VAU A;  3B5L B;  2XR4 A;  4QDQ A;  3SHR A;  4CCL A;  5GZC A;  1VBC 1;  1QY4 A;  4JGZ C;  3UKT A;  4AFA A;  2VNG A;  3FX3 A;  1Q8P A;  2J42 A;  5F9T A;  1NY7 2;  3R6S A;  4CEW B;  4YM0 A;  2W2I A;  4GWM A;  5A7W B;  4OYU A;  3ZX7 A;  3HNM A;  5ACA 2;  1J1L A;  3U75 A;  1PO1 2;  3EBR A;  1ULP A;  1PO2 2;  2HWD 2;  3OEB A;  2YYO A;  2EXH A;  1W0P A;  3GCW A;  3HMY A;  2ZHM A;  2WNV A;  4QPI C;  1QNY A;  2GH8 A;  1XYN A;  2J1A A;  2KD7 A;  5EJ3 A;  4AI3 A;  1KS5 A;  2QZ2 A;  2VNO A;  2XUE A;  3VHP A;  2CU5 A;  4YYO A;  4CDU A;  2XLA A;  3ZFF B;  5IK5 A;  2OX0 A;  3NJZ A;  4K6B A;  3ZYP A;  2VBD A;  4C91 A;  3WF0 A;  5L19 A;  1XNK A;  1VBA 1;  2XGX A;  1X8M A;  4QXK A;  5D8A A;  4COW A;  1RMU 3;  4E2G A;  1KDM A;  1REF A;  4IEY A;  5D8A B;  3GDB A;  5FP9 A;  4QAW A;  2Q4S A;  3AKS A;  2YBP A;  4MGK E;  1MS4 A;  4LHL A;  5CU1 A;  1J84 A;  1R1A 2;  1ENR A;  3DUI A;  3B02 A;  3PUR A;  2VTX A;  3POJ A;  4C90 A;  5I0D A;  1I6X A;  1EV1 2;  4IV3 B;  1F15 A;  4BXS V;  3WP6 A;  1OHF A;  3IKW A;  4ZZ5 A;  3INA A;  3WQB A;  1FOD 1;  2NN8 A;  2JG9 A;  2E63 A;  1GFF 2;  4RA0 A;  3FFZ A;  4M00 A;  3U4X A;  2DCZ A;  2R06 3;  1AR6 1;  4PHZ A;  2JG9 B;  1F8V A;  2D97 A;  5JZG A;  1MQT B;  1XC6 A;  3LFM A;  1SCR A;  2WS9 2;  1HJG A;  2JDP A;  2R49 A;  4PT6 A;  4BIS A;  1V0A A;  4EE2 A;  2AEN A;  2ZGO A;  2OZ6 A;  2ZGR A;  4BCU A;  2X09 A;  2XG3 A;  1KJR A;  3HR9 A;  4LLO A;  4UF0 B;  4IE7 A;  3VBR B;  3R4S A;  1DZR A;  4ZXE A;  4DB5 A;  5T54 A;  2WO2 A;  2ZX3 A;  4LBK A;  2ZGS A;  2VH9 A;  3M3E A;  5HPO A;  2IVI B;  2MEV 2;  1O8S A;  2BVV A;  1NQD A;  1F5F A;  1KXG A;  1UL9 A;  2Q8C A;  4XTP A;  3KS7 A;  3PVB B;  2HWF 3;  4L97 A;  4UOJ A;  3ZSJ A;  2BWC A;  1PZ9 A;  1GZW A;  2HWE 1;  4K3U A;  4QX5 A;  5F3G A;  4K40 A;  5CB7 A;  4L99 A;  5E8A A;  4EN9 B;  5BV6 A;  1EAH 3;  4AI9 A;  3OBZ A;  5A33 B;  4AVT A;  4CUC A;  1SLL A;  5DAP A;  5F39 A;  3ABZ A;  5DUX A;  3SQO A;  4XQW A;  4GAZ A;  3Q8E A;  3PTR B;  2DVB A;  4N53 C;  2NLR A;  1RUJ 3;  1GNZ A;  3BPS A;  3MW3 A;  3N9L A;  3VBH C;  5A3M A;  4LBL A;  5FMD A;  4AR2 A;  4BH9 A;  1VBD 3;  2XKP A;  4U36 A;  5DAQ A;  5A1F A;  3CLP A;  4IEX A;  2W1U A;  4IV1 C;  1N47 A;  4AYU A;  2ZGL A;  4NHM A;  4FQZ A;  3CJI A;  1OI6 A;  1ENS A;  1HJF A;  4Y26 A;  2WUH A;  4Q5O A;  4BK5 A;  3BCW A;  2J1T A;  5D1I A;  5E88 A;  3UES A;  5J37 A;  3VBO B;  2JE8 A;  2YB7 A;  3IAP A;  4QQO A;  1X9T A;  2ZEX A;  5KC5 A;  3I54 A;  2A6X A;  2Q1Z B;  3HQU A;  5F3I A;  2XML A;  5BNP C;  2FDK A;  1DGL A;  3MIH A;  4NIH A;  3IN9 A;  2IUW A;  3CJX A;  2YBS A;  4W6W A;  1COV 2;  1WME A;  5C5U A;  3E5U A;  2PTM A;  4O65 A;  5CFD C;  3LSE A;  1HXS 3;  2QQU A;  2ZAA A;  3V0B A;  2C5D A;  1QJU 2;  3I2G A;  2E51 A;  3LEK A;  3N9M A;  1MS9 A;  1CZS A;  3CHX A;  2ADE A;  3OYW A;  2E7Q A;  2Y6J A;  2OII A;  3WIN E;  1VLN A;  2W87 A;  1LHU A;  2RS1 2;  3RPQ A;  1H2K A;  5GJ6 A;  3LIH A;  4E4S A;  5I8T A;  5LB6 A;  1JS9 A;  5FXV A;  4XUR A;  3JBG 2;  1OA2 A;  1XNB A;  1JI6 A;  3KCY A;  4FPH A;  3I49 A;  1UY3 A;  1F31 A;  4DXZ A;  1LHW A;  3KB5 A;  1R1Z A;  3C7F A;  1CJP A;  4DUV A;  2YDE A;  1OD3 A;  3K48 A;  5DAX A;  4X6R B;  2TUN A;  1FPN 1;  3MV0 1;  3U07 A;  3EB7 A;  4Z2A A;  1MS1 A;  3VDC A;  1PVC 1;  2HWB 3;  2QKD A;  4EZ4 A;  3LZZ A;  2ZMN A;  3J26 N;  1BVP 1;  1QJX 1;  3FZ3 A;  3LSD A;  4BMB A;  1AR8 3;  1X9P A;  4RD7 A;  5ABJ B;  5IVJ A;  1POQ A;  3OB8 A;  4FPC A;  3ZVX A;  1X8E A;  3LF7 A;  1BMV 1;  5FUI A;  1WA6 X;  1S0G A;  3UL2 A;  1NCR C;  3IIA A;  2DDU A;  4MHR A;  2QQN A;  3LEM A;  4J6G A;  5FZL A;  4DPN A;  4OI1 A;  3WQ1 A;  1OH3 A;  1U5Z A;  2CGO A;  4P9W A;  4YZ5 A;  1AL0 G;  5FRA A;  5FP7 A;  3BIE A;  3T09 A;  4QX7 A;  1T2X A;  1GSL A;  4D6Q A;  1DLL A;  2QVS B;  2XVL A;  1NLS A;  2ARC A;  3ZPY A;  1L7R A;  4CVU A;  1OUS A;  3FE5 A;  4YVW C;  3UJO A;  2WKK A;  3PJQ A;  1OPM A;  1E5R A;  2VOK A;  5A3W A;  2VZT A;  4XFC A;  2D3R A;  2RM2 2;  5K9Y A;  1W2T A;  2XDV A;  2VXR A;  4LMF A;  1HRI 2;  1S0D A;  4C8D A;  2A6Z A;  4XTM A;  4AHW A;  1G9D A;  2JDZ A;  3SEP A;  5DG1 A;  1C8M 3;  4B4Q A;  4GIQ A;  1GU3 A;  5C8C B;  1IHM A;  3TEW A;  5A3L A;  3MZH A;  4YW3 A;  4Z92 B;  4EQV A;  2P5B A;  4CDX C;  4YPJ A;  1BBT 1;  3H1Y A;  4LKE A;  1A8M A;  5ACA 3;  1OVP A;  3WZ1 A;  1K5M A;  1Y9G A;  4OFG A;  1PO1 3;  3VLB B;  1PO2 3;  1V9U 2;  1M4W A;  2HWD 3;  4CEW C;  1LOG A;  1YQ6 A;  1DQ4 A;  1YFX A;  5DZE A;  1NG0 A;  3L2Y A;  1D4M 1;  2G19 A;  4XUT A;  4RQP A;  2G4I A;  1OQ1 A;  4ES9 A;  1ZZ8 A;  3PU3 A;  4XQ4 A;  5FYB A;  3RSJ A;  1JMU B;  4NII A;  4R4X A;  3SIT A;  2FDH A;  5KHJ A;  1AX0 A;  5FZ0 A;  2VZP A;  3I2H A;  1QWR A;  4P9G A;  2WA3 A;  3K4D A;  4GZ9 A;  1BVV A;  5IW0 A;  2IFR A;  3O1V A;  4AED A;  3O1S A;  2WNE A;  1NLR A;  1QQP 1;  2DUP A;  2WA4 A;  1H1A A;  2WWU A;  3A0N A;  5E1R A;  4AED B;  2GN7 A;  3GZE A;  4YM1 A;  3ZXL A;  2GP3 A;  4BPZ A;  1Z7S 2;  3LEI A;  1N3Q A;  2P3J A;  5J98 B;  4LXL A;  4QT6 A;  5D8A C;  1R1A 3;  1DYP A;  4JDM A;  3ZXG A;  4NID A;  2IXL A;  1HQL A;  4FP3 A;  1W90 A;  4A7Y A;  1EV1 3;  1ZA4 A;  3ILN A;  5A7P A;  2P6H A;  1LGC A;  1D2S A;  3DXT A;  2XH6 A;  2C4X A;  5CG8 A;  1AUY A;  4JRA A;  4IV3 C;  3U1X A;  1C28 A;  3GZT B;  4CP0 A;  1XPW A;  1AX2 A;  3N9N A;  3Q8A A;  2IFW A;  4YGB A;  3WD5 A;  2FMY A;  2WS9 3;  1G6N A;  4OCT A;  4BWO A;  1UY2 A;  1EPZ A;  2JWP A;  5L36 A;  1O3T A;  5FO8 B;  1IGO A;  2JG9 C;  4KWL A;  1MQT C;  2RS3 1;  4QPW A;  5F5A A;  3ZMN A;  1ENQ A;  3O1P A;  4O9G A;  3K75 B;  4HVQ A;  1Q5O A;  2PEL A;  5EP9 A;  5DUU A;  1PMH X;  1AR9 1;  2MEV 3;  1RUD 3;  4MV2 A;  3VBR C;  2OYZ A;  1JW6 A;  2YV8 A;  4YW2 A;  3VHR A;  4D7T A;  3GBG A;  3ZDV A;  1BK1 A;  3BYW A;  2YG0 A;  3POY A;  1G9B A;  4NRM A;  2VM9 A;  3GM8 A;  3Q8F A;  5FWE A;  5FY0 A;  1UW8 A;  4IE4 A;  5FWJ A;  1J58 A;  2ET1 A;  4ZY9 A;  3LOB A;  4Y1V A;  4A7Z A;  2BNM A;  1UY4 A;  2NM1 A;  2WNO A;  2GNT A;  3TAY A;  4BQY A;  2V5D A;  3TWI A;  2OPW A;  4NHK A;  4HSL A;  1O6U A;  1WLT A;  1QJY 1;  2HEV F;  4GH4 B;  4JTN A;  1VR3 A;  1VBE 2;  2FCV A;  3LOI A;  3H1W A;  2YXS A;  1OUR A;  1CAW A;  4ISQ A;  5IFP A;  4FTB A;  2LM3 A;  4QQ2 A;  1JZ4 A;  5CFC A;  2ZHK A;  1CJD A;  1MVQ A;  4B1M A;  5FXX A;  2UU8 A;  4DEQ A;  4TZD A;  2P4E A;  1VIW B;  5CFC B;  4MSV A;  3ALQ A;  1YXW A;  5IVE A;  4HKO A;  3ZDS A;  5IAV A;  4OZO A;  1VAM A;  3KHB A;  5CEH A;  1Q3E A;  3KGL A;  3POE A;  4MGZ E;  4OUL A;  4YGD A;  2EIB A;  2RR1 2;  1H8V A;  1FAT A;  1NUK A;  1UIJ A;  2B4K A;  2QTW B;  4UW4 A;  4AK3 A;  2E9Q A;  4UFH A;  2WZE A;  4Q0V A;  5GLT A;  3LA2 A;  1W06 A;  1J1T A;  3VBO C;  1IPS A;  2PHT A;  1JZ7 A;  4L8Q A;  1CIY A;  1VAL A;  2HH9 A;  4BZ4 A;  1COV 3;  5FPU A;  3NV3 A;  1VE0 A;  3UK9 A;  2Y0O A;  1M06 G;  1IQD C;  5M0T A;  3RZH A;  4BLJ A;  2ZZJ A;  3VD7 A;  4U2A A;  1QJU 3;  2XPJ A;  1CAU A;  1XB9 A;  3DKQ A;  1QU0 A;  1UZ0 A;  3UGH A;  1C57 A;  5L9B A;  4M0H A;  1UCX A;  2RS1 3;  4B7E A;  1RHI 2;  1RL3 A;  3JB4 C;  1KFX L;  1H2N A;  1SHW B;  2NQY A;  3JBG 3;  2VQT A;  4XBN A;  2W68 A;  1GWK A;  1H1I A;  2DUQ A;  3BKZ A;  2BGP A;  3FWE A;  4E8D A;  2OUH A;  3WSO A;  5F3C A;  2LAL A;  5C6C A;  5JCT A;  1GOF A;  5F32 A;  3U0Z A;  4M4R A;  1AXY A;  2DTW A;  4FSJ A;  2WII B;  3ES1 A;  3GXU A;  4R9A A;  5FAX A;  4LBO A;  4AEJ A;  1DCS A;  2Y6H A;  1JOJ A;  2E6V A;  1WW6 A;  1RIR A;  4KI5 M;  1PGS A;  2VUD A;  2A6W A;  3TN9 2;  2ORX A;  2Z2S B;  5DZF A;  5F7U A;  3AVR A;  1FV3 A;  1NYW A;  1VP6 A;  3IMN A;  3WDW A;  1H6Y A;  1ZRR A;  3UV9 A;  1TNR A;  4D8M A;  5K0U B;  1PIV 1;  3VBS B;  1N1S A;  3N9P A;  5ABJ C;  5A3P A;  2RS5 2;  2D5F A;  5FY5 A;  4NJ4 A;  1VBB 1;  4W6X A;  1MPX A;  2BZD A;  4KMQ A;  4DO0 A;  5DQ0 A;  2VOX A;  1ULO A;  4L11 A;  4N9H A;  5FY9 A;  4AQT A;  1HX6 A;  4GMP 3;  1VBC 2;  2VJX A;  1GWL A;  4COV A;  3B00 A;  2RM2 3;  3ST7 A;  1W2U A;  4RS5 A;  1HRI 3;  4YZ1 A;  2A75 A;  1QJF A;  2WNU B;  4CTE A;  3VL9 A;  2VCM A;  2VVD A;  3HQR A;  3LWC A;  2DF7 A;  3KM5 A;  5A1A A;  2X53 S;  4XHX A;  1GNY A;  2EAA A;  4Y1X A;  4QPG B;  5L7O B;  3RS6 A;  2AC1 A;  3KF3 A;  1CIW A;  2D6M A;  3I8T A;  4NHX A;  1BEV 1;  5I93 A;  4LO8 A;  2HYX A;  1H2M A;  1QMJ A;  2ZX0 A;  5T5J A;  2BQP A;  1W6Q B;  2VMD A;  3SKJ E;  4XDQ A;  4B29 A;  3C7G A;  1OA4 A;  4V2W A;  4NO4 A;  3AYE A;  4NRQ A;  2OKX A;  5A80 A;  2VR4 A;  4DFS A;  1V9U 3;  2H0V A;  2W9X A;  2Y60 A;  3LB9 A;  5KHK A;  3D6E A;  1VBA 2;  2MHF A;  5I8S A;  1W9T A;  4QX1 A;  3NKG A;  1W6N B;  1XJA A;  5CVR A;  2YC2 A;  1NA1 B;  4ZON A;  3O0X A;  5A3O A;  4CXY A;  1J3P A;  4PQQ A;  1YNA A;  1DBN A;  2F6B A;  2XUM A;  3S5Q A;  4AAP A;  2Y6L A;  1S1A A;  4XQD A;  4Z8B A;  3WF4 A;  2LRO A;  4Y20 A;  4Q4W 1;  1J83 A;  3N7M A;  1FOD 2;  1Z7S 3;  3M3Q A;  2JDY A;  2E7A A;  4QB6 A;  1BJQ A;  1HLC A;  4XCA A;  2B39 A;  5FPL A;  3LKJ A;  5CKN A;  1AR6 2;  1QGL A;  1OSG A;  4QPI B;  4AED C;  4MXW A;  5F5I A;  1S4C A;  2D6L X;  3LDR A;  4P08 A;  3WNO A;  3SH3 A;  2JEN A;  1IKP A;  2VZR A;  3ATG A;  2VCC A;  1US2 A;  3VHO A;  1J59 A;  1IG3 A;  4NR1 A;  4R8H A;  2GN3 A;  5IK7 A;  4PIX A;  4CCD A;  2FDJ A;  1FT9 A;  2VZ1 A;  3D0J A;  3LGR A;  5J09 A;  3F2Z A;  2UY9 A;  4FOW A;  4C1W A;  1YO8 A;  2D44 A;  1LAJ A;  1AR7 2;  5FMC A;  1RUN A;  4YGC A;  3C7H A;  5A7N A;  1TMF 1;  2VW1 A;  2VCB A;  3ECQ A;  2WO7 A;  5C4W A;  1I9R A;  4MYE A;  5F5Q A;  5C4W B;  3MFA A;  3G6J B;  1VRB A;  2HWE 2;  5CKQ A;  5EPA A;  1G7Y A;  2VE1 A;  2VMH A;  3AJZ A;  3CZJ A;  4RHV 2;  2ZGN A;  3RWK X;  1B09 A;  2ATF A;  2W47 A;  2W1W A;  1F9K A;  4NPR A;  1CR7 A;  3KD4 A;  4Q0S A;  5FJH A;  1OQE A;  5JMC A;  4P00 B;  4YW6 A;  4ZS2 A;  2XWB B;  3HJR A;  3PUS A;  4XZU G;  3K2O A;  1W39 A;  2XVK A;  3FLP A;  4AE2 A;  2WO3 A;  5EWS A;  5FPB A;  2DFB A;  2RDS A;  2BRT A;  4XJU A;  3SH5 A;  2W92 A;  4AGR A;  5JUV A;  4TYS A;  5GZE A;  1R09 2;  4XJZ A;  2CAU A;  3ZSL A;  5DN2 A;  1ST8 A;  1ULC A;  1NKG A;  3KHC A;  5FLJ A;  1KJL A;  2JIJ A;  1W05 A;  3RG0 A;  1SMV A;  3CMG A;  4YG6 A;  4GJY A;  2A3W A;  1VBE 3;  3M7A A;  3VDD A;  1ULG A;  5LWB A;  4XAC A;  4ZU7 A;  1Z78 A;  1TNF A;  3POI A;  1R64 A;  4JQT A;  2JIG A;  3VL8 A;  4UBG A;  1SZB A;  5A32 A;  5DDJ 2;  3VD5 A;  3WG3 A;  4K9S A;  1YYN A;  2WLQ A;  3AP6 A;  4LBM A;  1U5Y A;  3THD A;  5E89 A;  2C9A A;  3AZY A;  2XHK A;  1QOT A;  4AW7 A;  5BNQ A;  4RYD A;  1V6K A;  1RUH 1;  1WD3 A;  3E6C C;  2RR1 3;  5FPV A;  1SLB A;  3DF0 A;  3NQH A;  5CFC C;  1CWP A;  4A3Z A;  4LKD A;  3MIE A;  3AB0 A;  1WCD J;  4IND A;  5JMO A;  1O5U A;  1U12 A;  1GLH A;  3HD8 B;  4Y1Y A;  3ZFG A;  1V6N A;  1GP5 A;  2DTY A;  2E26 A;  2ZX1 A;  1WLC A;  4JHT A;  1S2B A;  4PDW A;  2F4L A;  3ZFE A;  4W6Y A;  4PI2 A;  3IPV A;  2I45 A;  1XQN A;  1SFY A;  3POG A;  4HXC A;  4GA9 A;  4RGG A;  5J3U A;  3CDZ B;  3TB0 A;  4LBN A;  4UI9 L;  1WW7 A;  4GWJ A;  4K8R B;  3RZM A;  2OVU A;  3VHN A;  3I3B A;  1RHI 3;  1ASJ 2;  4G3Y C;  1E57 A;  3DPR A;  3OGG A;  1O5L A;  4HK9 A;  4CCN A;  2V5Y A;  1PVC 2;  4IXL A;  2UYB A;  2NP0 A;  3DPR B;  3K3O A;  3QD6 A;  4GWI A;  4AVA A;  1QJX 2;  4NE9 A;  4XFA A;  4TSV A;  2C9K A;  3T2O A;  1YQC A;  1UZW A;  4BE3 A;  5IYY A;  1BMV 2;  5FKB A;  5FQ0 A;  4FFH A;  3O0V A;  2JE9 A;  4QDS A;  4OMC A;  3H7J A;  3AMP A;  4DXS A;  3WHT A;  2VBP A;  2DVF A;  4HKL A;  3T0B A;  3MI8 A;  1W8Z A;  1YFU A;  3OPW A;  2Y6F A;  3FBY A;  5FYI A;  4EN8 B;  4KWK A;  4WZC A;  1OT5 A;  4Q4Y 2;  3TN9 3;  3KT7 A;  5FZA A;  4ET7 A;  5FPA A;  4XF0 A;  4Q8L A;  2X10 A;  2WZR 1;  3ACH A;  3NST A;  4JGY A;  1LUL A;  1O4T A;  2R0H A;  3NAP A;  4COY A;  2X5I A;  2EXJ A;  4NRO A;  3NAP B;  2RS5 3;  4SBV A;  2BWA A;  1TE1 B;  4MLO A;  1ND3 B;  3VBS C;  3U11 A;  5A3N A;  3FUQ A;  4HN0 A;  4MZU A;  3M3O A;  5I91 A;  1WCK A;  4XC9 A;  1JYX A;  1VBC 3;  1VMJ A;  3CBN A;  3PVN A;  4S2H A;  4PCR A;  3D4K A;  2WT1 A;  2IXK A;  1BBT 2;  4KH9 A;  3ZSE A;  1YI7 A;  2QQW A;  2XJV A;  4Q2F A;  3DKW A;  1PM4 A;  1YWK A;  4RR3 B;  1FAY A;  4EN7 B;  5BPX A;  1NCR B;  4OI0 A;  1C8N A;  2PHX A;  1JUH A;  1MS8 A;  3IM0 A;  4DIN B;  3I3D A;  3M70 A;  5DG2 A;  1PGL 1;  1W6P A;  2PAE A;  2WNU C;  4C1X A;  3A22 A;  4RS5 C;  3I3Q A;  1Y4W A;  1W6P B;  2BOJ A;  3Q9O A;  1D4M 2;  1JH5 A;  3ELN A;  1KQR A;  4GQ7 A;  3SMH A;  3H8X A;  4ORF A;  4QPG C;  2WRA A;  4QU1 A;  4CU6 A;  5L7O C;  1YHF A;  4JV4 A;  1YFY A;  4Y3O A;  1GWM A;  5T5P A;  1W2N A;  3E6D A;  2ZGU A;  3IDB B;  1NX9 A;  5FK7 A;  2JG8 B;  5HCH A;  2J7M A;  2W94 A;  1KRI A;  4HG6 B;  1VBA 3;  3ZO0 B;  3WUD A;  4NIA A;  5BNO A;  1AX1 A;  2XVG A;  5GLV A;  4WBB A;  1QQP 2;  3HT2 A;  4WM7 B;  4YVS A;  5BNO B;  5KXC A;  1O4Z A;  1LU2 A;  5FKC A;  4NIG A;  3F95 A;  3AMM A;  4FO9 A;  2RDR A;  3HIF A;  5H9S A;  3OGS A;  3KCC A;  4AZZ A;  1URX A;  1NA1 C;  1DZQ A;  5H9P A;  3H9A A;  5T5L A;  3HAG A;  3MEP A;  2E7T A;  1DFQ A;  1O91 A;  3IMM A;  3MF6 A;  4FFF A;  1AYM 1;  4CDW B;  2BBA A;  2DVA A;  2EIE A;  2IZW A;  1W9Y A;  4MGQ A;  4XDP A;  5JPN B;  4Q26 A;  1FOD 3;  5IWF A;  3GF6 A;  3JZV A;  5FMB A;  4CDX B;  1AR6 3;  2UWA A;  1DGW X;  1AF9 A;  2V09 A;  2D7F A;  5L9V A;  3N7J A;  2YMZ A;  3ACG A;  1TG7 A;  1YRZ A;  3H7Y A;  3N7L A;  2Z5W A;  4FTS A;  4GKY A;  2PHD A;  4PF1 A;  2RS3 2;  2KA3 A;  1JOB A;  1LHO A;  2WNV B;  1P8J A;  4S2G A;  3PU8 A;  2BTV C;  3NNJ A;  1FYU A;  1DU3 D;  4HOO A;  1D0H A;  2ZX4 A;  3OCP A;  4HT1 T;  3NWK A;  4GWN A;  1MZF A;  4P5H A;  4CDU B;  5KXB A;  2GZW A;  3FHQ A;  3VB9 A;  4CXX A;  4E9K A;  1KIT A;  1AR9 2;  1OOP A;  2RJ2 A;  2WC2 A;  2G9F A;  2Z79 A;  3E5Q A;  1AR7 3;  3DYP A;  4PBP A;  4LHK A;  4ZS3 A;  2RE9 A;  4FXG B;  1X36 A;  4K1Z A;  4YFZ A;  1VJ2 A;  2P3K A;  2VME A;  3CNA A;  2HWE 3;  3J7H A;  3POW A;  1YLL A;  4XF1 A;  1VAV A;  2ZXQ A;  3KMH A;  1CPN A;  4RHV 3;  4TLG A;  3RVH A;  4B8E A;  2WR9 A;  1NZI A;  5C4W C;  2WFF 1;  2A71 A;  4Y5T A;  1N1V A;  1ULD A;  1ULE A;  2R30 A;  5HCF A;  5JXH A;  2MPF A;  4CCC A;  1UZZ A;  2ERF A;  3ACL A;  2Q8E A;  3V0A A;  1CX4 A;  1QJY 2;  3V0A B;  5BY5 A;  1H8T A;  4LHS A;  5FZE A;  2VMI A;  4QKD A;  1R09 3;  3T0A A;  1DIW A;  4AVB A;  1NT0 A;  1YQ5 A;  1WCS A;  3MLK A;  5JZG B;  2PHL A;  1NOV A;  1WMX A;  1K12 A;  2PMW B;  3AVS A;  3PTY A;  4HON A;  4MGT A;  2ZAH A;  5F5C A;  3NV1 A;  2RMU 1;  1CAX A;  2ZJC A;  4YZ3 A;  3EMR A;  5JXI A;  4AF9 A;  5LRS A;  3W58 A;  1TME 1;  1F35 A;  3QAC A;  5EV7 A;  4OLL A;  1QIQ A;  4DQA A;  1RUD 2;  1GZC A;  3UGF A;  5DDJ 3;  3O14 A;  5GLW A;  5LZ6 A;  3G7D A;  2VNV A;  4IE6 A;  1RUG 1;  3R0R A;  1OFS A;  3W21 A;  1JZ5 A;  1RUI 1;  4XCB A;  2P37 A;  2XJP A;  1X7N A;  2QE3 A;  1C4R A;  3PUQ A;  2FD8 A;  1IPJ A;  1GZW B;  3ZSM A;  1HRV 1;  2VBB A;  3I2F A;  1W9S A;  4IET A;  1H4G A;  2ZPX A;  3J7M A;  2C6S A;  3O5S A;  1IPK A;  3VBU A;  3WDX A;  1LOB A;  1UYP A;  2QQI A;  2RDQ A;  3EQE A;  5FXW A;  4KNC A;  4FOV A;  3V56 A;  1RMU 1;  4UYB A;  3T2T A;  2ZKL A;  5FP3 A;  3ZOI A;  2Q30 A;  3EJK A;  4OHZ A;  3NNF A;  4ASM B;  5FYV A;  1NAE A;  5GAL A;  3ZKU A;  1ASJ 3;  2G9Z A;  3MV1 1;  4EWE A;  3CJI B;  1GNH A;  3KLS A;  4XBQ A;  1PVC 3;  3E1F 1;  5J7M A;  1G9A A;  1UWW A;  1QJX 3;  1SG3 A;  1YI9 A;  3HPN A;  3KSC A;  4N7I A;  4IL7 A;  1RIT A;  2LRP A;  1FNY A;  3B93 A;  1PIV 2;  3DPR C;  5JLV A;  5I8Y A;  2CV6 A;  1GIC A;  3OEA A;  4Y22 A;  3MID A;  5BNN A;  3M8L A;  2BOI A;  2R06 1;  1O3Q A;  3AMN A;  5DPN A;  2K0G A;  4Q4Y 3;  5BNN B;  1VBB 2;  5GLU A;  4QHZ A;  3AL6 A;  2ZHL A;  1DGR A;  5FV3 A;  3GAL A;  1JOD A;  1H9W A;  3AMH A;  3QH7 A;  4Y1Z A;  4XZP A;  5EHD A;  5LRR A;  3V0B B;  3B94 A;  5HV4 A;  4FFI A;  1Y7B A;  3OYW B;  3TBD A;  2R07 1;  4BK4 A;  4E27 A;  3VBF A;  4DY3 A;  2YUE A;  4URT A;  1NZC A;  1DLC A;  1UPI A;  1YQ2 A;  3RWN A;  5SV8 A;  3TOJ A;  4XFB A;  1KGY A;  3NAP C;  2XXZ A;  5DMY A;  2OS2 A;  3USU A;  5DUV A;  3EXU A;  1ND3 C;  3AC0 A;  5FZ9 A;  5K4L A;  3USU B;  3KQ4 B;  5EYX A;  3J7L A;  2HLE A;  2HWF 1;  1BEV 2;  1SCS A;  3MFC A;  1BBT 3;  5C3P A;  5A6X A;  2XLG A;  1ULF A;  1YQ8 A;  4COZ A;  2GC0 A;  1ZRE A;  1NE6 A;  4PIY A;  1NXM A;  3VDB A;  2ZEY A;  1V6O A;  1XBF A;  1ZVF A;  1A34 A;  4RR3 C;  2DBI A;  1V6I A;  3AM2 A;  2Q8D A;  1D4M 3;  1DHK B;  2B8M A;  3OUH A;  1AXZ A;  3R4U A;  4H7M A;  4Y1U A;  5AVA A;  1CN1 A;  4PQ9 A;  4XFG A;  1UXZ A;  1EPW A;  2IXC A;  2JX9 A;  1XE8 A;  2W46 A;  1UF2 C;  3CU7 A;  4MVT A;  4XUN A;  1VBD 1;  3H8U A;  4Y5Z 0;  1AJK A;  5FYS A;  4LA2 A;  1YFW A;  2YPJ A;  4H3W A;  2BYV E;  2WO1 A;  4HK8 A;  1AYN 2;  2V4A A;  1GZ9 A;  2A5Z A;  4CEY A;  2Y8K A;  3OGV A;  4OVE A;  2WDB A;  1ZBE 1;  1YEW A;  4RGK A;  1QQP 3;  2JG8 C;  1IS4 A;  4Q4W 2;  4ARY A;  3LPG A;  3T2Q A;  4P9X A;  3DYO A;  3FJS A;  5BNO C;  4WM7 C;  2YRO A;  4W8J A;  3U37 A;  4CUB A;  1GOH A;  4CP1 A;  5LBB A;  2W5F A;  3LEG A;  4LKF A;  2VMC A;  5DAB A;  4FPG A;  2KM2 A;  3JD7 1;  4JKM A;  4ASL A;  5JSO A;  4D69 A;  2EAL A;  4BME A;  2E32 A;  1LCL A;  4A6S A;  1OLQ A;  5KC6 A;  3ZLI A;  1XOY A;  4B4R A;  1HXS 1;  2X29 A;  4CDW C;  3OGR A;  1OLR A;  2EXK A;  2WYS A;  3CZU A;  4BQW A;  4FTE A;  2HBT A;  1MAC A;  3ACI A;  3UT0 A;  2PN5 A;  1K5M B;  1NQJ A;  4N9I A;  5FOB B;  3HQX A;  2WAB A;  2Q0A A;  4ITC A;  3VKM A;  4AI0 A;  3S6P A;  5C70 A;  2RS3 3;  1TMF 2;  1ZYB A;  1A8D A;  1W8T A;  4N43 A;  3NMB A;  3RZZ A;  2XQR A;  4MAD A;  4AI2 A;  4RQP B;  2EID A;  1Q8Q A;  4H2A A;  4AVS A;  2WNV C;  4LHN A;  1S0C A;  1AR9 3;  2YC0 A;  1N3O A;  4IEO A;  2FMD A;  2FCT A;  3ZXE A;  2AR6 A;  4CDU C;  2GSY A;  4MGS A;  4D7Y A;  1DGR N;  2C24 A;  3HN1 A;  4XVH A;  2ZMK A;  2DBN A;  3NNM A;  2ZX2 A;  4E8C A;  1RVF 1;  3WF2 A;  4QHB A;  2JDN A;  1XU2 A;  1ONA A;  5FDB A;  1U0A A;  2P2K A;  1TZO A;  1RUC 1;  2XKO A;  2VVF A;  5FY4 A;  5C9A A;  2XJU A;  4FXK B;  4BHP A;  5K8S A;  3E6B A;  2VZU A;  4LIT A;  4A7K A;  4BQ5 A;  2W95 A;  3AKQ A;  1WKY A;  4QXH A;  1QJY 3;  1W8W A;  3BOP A;  1HB1 A;  3POF A;  4FPE A;  5AVP A;  5CAZ A;  2ZEW A;  3WP4 A;  3T1L A;  4CCO A;  4BQ1 A;  4DUX A;  1J3Q A;  1TEI A;  2YHJ A;  3QCW A;  4ATE A;  4QQP A;  4ZU5 A;  1UMH A;  1QXP A;  1GOG A;  2EA7 A;  5FYH A;  5IAT A;  4Y24 A;  5FBJ A;  1C5H A;  3ZPO A;  5FZB A;  5JZG C;  4PLO A;  1UMZ A;  3N3H A;  5IFT A;  1C8M 1;  3PUA A;  3J4U H;  3QLQ A;  1RUH 2;  2ILM A;  1IKQ A;  4COU A;  3HEI A;  2R16 A;  3HT1 A;  4LO5 B;  2H6B A;  2CNA A;  2PLV 2;  2VQU A;  3CIH A;  4AQ2 A;  4K20 A;  4OHW A;  3LDK A;  1NCQ A;  2O1Q A;  2D6N A;  3JQW A;  3VDA A;  5I0U A;  2ZHN A;  1NY7 1;  5A3T A;  4E2Q A;  2VQ0 A;  3R4D B;  3FLT A;  1SBE A;  5F37 A;  3BOD A;  3TEX A;  4BQ2 A;  4JKK A;  3HN3 A;  4YLZ A;  3I3M A;  4XIK A;  4D3W A;  1DQ2 A;  4I3G A;  3C7O A;  3DEC A;  4HPK A;  5F6K A;  4DS0 A;  2TEP A;  4KL1 A;  2ARE A;  1W6M A;  4HPK B;  3DL3 A;  4JVA A;  4Y4R A;  3W5N A;  1POV 1;  2QQO A;  1W8H A;  4DEV A;  2VPV A;  4BJ0 A;  1RUE 1;  4M4P A;  4XJ8 A;  4K1Y A;  3NNL A;  5FYC A;  2LS6 A;  3VZN A;  1CGP A;  2ZAB A;  3K77 A;  1LOF A;  1UMI A;  4UAP A;  1KS4 A;  1JZ2 A;  3UJQ A;  4CZS A;  5F2S A;  5A6Z A;  4IE0 A;  5HXV A;  1CAW B;  1OUX A;  3VBU C;  4BDV B;  4JAA A;  1VPH A;  2GDF A;  4IER A;  5JXG A;  5JOW A;  1CZV A;  4OI2 A;  1YJL A;  1APN A;  3MW4 A;  2N7G A;  2VO5 A;  3CJI C;  3RGB A;  1EV1 1;  1GQP A;  1N1T A;  1MEC 2;  2WZR 2;  3OF1 A;  1XNT A;  1PIV 3;  5A70 A;  4XXP A;  2QNK A;  2TNF A;  1T6B X;  3T30 A;  1XRU A;  3CQO A;  1IZ3 A;  5LBF A;  5FZ7 A;  1QDC A;  3T0D A;  1VBB 3;  4J25 A;  2B9U A;  2VUJ A;  2AEZ A;  2VUA A;  1JU4 A;  1NLQ A;  1W3V A;  1BHG A;  5BNN C;  2QCS B;  2PHF A;  1CAU B;  4G4F A;  4B3N A;  4ZU4 A;  2XQX A;  1OPO A;  3O1R A;  2W91 A;  3BI3 A;  2J22 A;  1CZT A;  2I74 A;  4QX0 A;  1OLM E;  2VUL A;  4L0P A;  4NUB A;  3MGU A;  3TRS B;  1X82 A;  2XJT A;  4AI8 A;  3NNG A;  3ZYI B;  1PGL 2;  5FYU A;  2D5H A;  2XLF A;  4MGY E;  4UFM A;  1GP6 A;  3AZW A;  3IDE A;  1BEV 3;  1OD5 A;  2R1B A;  4YW4 A;  3S30 A;  4FAG A;  1K5J A;  1PX3 A;  3KVA A;  5LCW L;  2UWC A;  3GHM A;  3RJR A;  4XPV A;  1YJK A;  3C8X A;  4P9J A;  3SKV A;  3WP3 A;  4QKB A;  4IE5 A;  4MOA A;  3UKV A;  5JVV A;  5EYY A;  5DZG A;  1RUO A;  1QJZ A;  3X29 B;  5AC9 1;  2VGD A;  1UIK A;  3KV6 A;  1S2K A;  4CU7 A;  5B4N A;  3H42 B;  3LDB A;  4NPM A;  4KGQ A;  5A6Q A;  1OVS A;  2QDR A;  1FMD 1;  1VRH 1;  1ENX A;  3FHA A;  5C71 A;  2OQ6 A;  4R4Z A;  1JBC A;  2PYT A;  5E6H A;  4CCK A;  1AYN 3;  1JZ8 A;  4W65 A;  5CAD A;  4XF4 A;  3I97 A;  3P1I A;  2R7E B;  3N36 A;  3KWV A;  4WVM A;  3MIB A;  1R08 1;  1OF4 A;  4YSF A;  4HAN A;  4Q4W 3;  1LED A;  5FP8 A;  4ONU A;  2GC1 A;  4L9B A;  2J1E A;  4LLF A;  3FFQ A;  5J96 B;  4RS5 B;  1TQ5 A;  2ZA9 A;  3MF9 A;  1TVG A;  1AL2 1;  2IXI A;  2PHR A;  4O9E A;  5EJ1 B;  5ANN A;  5IK8 A;  1QHD A;  4IEV A;  1PZ7 A;  1LHN A;  3ZFF C;  1XNC A;  2UUR A;  1COV 1;  1AXK A;  2O8Q A;  3IDA A;  4LK6 A;  5FZ4 A;  3ZM8 A;  2AZ5 A;  1N3P A;  4NAO A;  3AP4 A;  2E31 A;  2NYY A;  1EUT A;  4M3C A;  1B35 A;  4LR4 A;  4WM8 A;  2A3X A;  4XYX A;  3H3Z A;  1SDD B;  3JXS A;  3W20 A;  1UOJ A;  3IAQ A;  5LBE A;  2B7Y A;  5L9R A;  2GNM A;  3H1M A;  4FOQ A;  2ZGK A;  2CGN A;  1UZV A;  5JIA A;  1TMF 3;  3WDU A;  3JBG 1;  2K46 A;  1DDL A;  1K5M C;  5HCA A;  4MUV A;  4N90 A;  4LOT A;  4UWD A;  3IDC B;  3JQX A;  4N7U A;  4YM3 A;  2RG4 A;  5DAV A;  1PK6 A;  1QXJ A;  4XDO A;  3WNN A;  3AFK A;  3FUO A;  4LE4 A;  4RN5 A;  2CY6 A;  4RQP C;  3FLR A;  5LBC A;  2EVX A;  1BKZ A;  2WFF 2;  2CTV A;  4D7S A;  4YG0 A;  4DY5 A;  3I59 A;  4TWT A;  2BW8 A;  2GMM A;  4CPB D;  1WMD A;  1JYW A;  4I09 A;  1SQ4 A;  3LIG A;  1CPM A;  2QQK A;  1MZ5 A;  4Y20 B;  4LUL A;  3JB8 A;  2PFW A;  4QGM A;  2FBE A;  2DU0 A;  1UOF A;  4PF5 A;  1SBF A;  2A6Y A;  2DCK A;  2WLP A;  3GBF A;  5FLI A;  4MXW B;  3W9A A;  3ZYB A;  1O3S A;  2AYH A;  2P6C A;  1WW4 A;  4LO6 B;  4I3P A;  2X8K A;  1LNS A;  3AKT A;  5LA9 A;  1S55 A;  2NMO A;  2BBV A;  2BJS A;  5JI7 A;  3B7M A;  4LBQ D;  3SCF A;  4OUM A;  3S5A A;  3IT8 A;  5FMO S;  2AEY A;  1TME 2;  1O8P A;  2WZ8 A;  4JKL A;  1UOG A;  5F2W A;  2VC9 A;  4HVO A;  3AP5 A;  4FPK A;  1LU1 A;  3RZL A;  4SLI A;  1NXD 1;  3OUJ A;  1KD7 A;  1UAI A;  1ZX5 A;  1RUG 2;  3HBK A;  3OBA A;  4Q4X 1;  5GZD A;  4HMZ A;  2PAK A;  4GMP 0;  1RUI 2;  3NJY A;  2ZOE B;  4MET A;  4XMA A;  3BPZ A;  4GB3 1;  4S2F A;  1RUH 3;  3PJY A;  4QM8 A;  2RJL A;  3NW4 A;  4EJR A;  2PLV 3;  4V1P A;  5IHR A;  1I5P A;  1AVB A;  1HRV 2;  1JTZ X;  2D6P A;  4X8P A;  1UOB A;  3AFG A;  4X8N A;  4OHY A;  5HI0 A;  2O8O A;  3AXD A;  4D6S A;  1BYH A;  1RTV A;  5IJR A;  4CUG A;  4DIQ A;  1O59 A;  3ME2 A;  4BQ4 A;  2PXJ A;  5ISL A;  5FR3 A;  1EY2 A;  4ZKT B;  3PDQ A;  3BU0 A;  3S57 A;  4C0H A;  3KV9 A;  5FIX A;  2WZP P;  2K2S A;  3V65 A;  2VG9 A;  2XWJ B;  2PAM A;  5CZK A;  1ZZB A;  4O7X A;  3AYC A;  3FMG A;  3THP A;  1OLM A;  3B01 A;  1O3R A;  2BV4 A;  4I02 A;  3ZIX A;  4C0B A;  3JUU A;  2Z42 A;  3AYA A;  3PIG A;  3OBR A;  5GKA C;  2WSU A;  2VNR A;  3WG4 A;  1ZZ9 A;  3N9Q A;  3PLQ A;  4GD4 A;  4UT5 A;  3WP5 A;  3BTZ A;  1QF3 A;  2RV9 A;  2VOW A;  5AFE A;  2WQZ C;  4XAA A;  1RED A;  1MR5 A;  1H30 A;  4XF3 A;  3KQR A;  4K7J A;  3VDD B;  5FO9 B;  1PZ8 A;  4XJ9 A;  1RUF 1;  1SEF A;  1Z7S 1;  2V73 A;  4XUO A;  2KR2 A;  1QOO A;  5F1R A;  2ET7 A;  4AQS A;  5A32 B;  3WT3 A;  3GBW A;  2OW4 A;  1CES A;  1OF3 A;  4QWN A;  5EQU A;  1O4Y A;  4XEZ A;  4RFT 0;  3I7D A;  3POS A;  1QJE A;  1G8W A;  2QQM A;  1W2O A;  2IXH A;  1MEC 3;  2WZR 3;  4YZ4 A;  4CXW A;  5C3O A;  1W0N A;  2DUO A;  2Q1M A;  1JUI A;  2XON A;  1KFU L;  4QPY A;  1WBL A;  2R32 A;  3WDY A;  2R07 2;  2G9G A;  2DUR A;  4UFJ A;  3ZFG B;  1LGB A;  2JDH A;  2I2S A;  1SLI A;  1WMF A;  4PDW B;  5JOZ A;  1ZM1 A;  3CL1 A;  4I2O A;  3ZFE B;  3MLJ A;  4AXO A;  3IPV B;  1LRH A;  5FZF A;  4A42 A;  3S7E A;  1FPN 2;  2FDG A;  4N53 A;  3O12 A;  3ZN4 A;  4I0A A;  5JI9 A;  3BGA A;  3J9S A;  4LO7 A;  5IVC A;  2DYC A;  4HN1 A;  4XF9 A;  3U14 A;  2WWJ A;  3B69 A;  2WWS A;  3M4F A;  3OPZ A;  4BM8 A;  1W04 A;  4ZZ8 A;  4IV1 A;  1ODN A;  4XET A;  4NHL A;  4RGA A;  5FQ0 B;  3DV8 A;  4UFL A;  1RB8 G;  1C1L A;  4ES8 A;  5FZH A;  4DMI A;  2R0F A;  1KEX A;  4E4Z A;  3I2D A;  3CO2 A;  3A21 A;  3SH4 A;  1F4A A;  4LIV A;  3SCG A;  1Q8S A;  5FFO C;  2XHN A;  1UX6 A;  1ZBE 2;  5BNP A;  5KWR A;  1W28 A;  4FAH A;  5JDB A;  3PNA A;  4JGY B;  3POB A;  4UXA A;  4NHY A;  3O1T A;  2X5I B;  1G86 A;  2W1S A;  1VBE 1;  1HB3 A;  2UY8 A;  5CFD A;  2BVB A;  3LA7 A;  1ACC A;  2ZS6 B;  3JCI A;  3WW4 A;  3WXP A;  1IQA A;  4RFR B;  2BNN A;  3FHI B;  3JD7 2;  3WW3 A;  3ZXJ A;  3SXW A;  4BOW A;  1K3I A;  4S2D A;  3ASI A;  2R04 1;  1UO9 A;  2ZZQ A;  2ENR A;  1LOA A;  1WGP A;  4NOT A;  1JHN A;  2E53 A;  3ES4 A;  5ANQ A;  4AI1 A;  1PMI A;  1W0O A;  3WQ7 A;  4AHZ A;  5A1L A;  4H14 A;  4XFH A;  4KU7 A;  4XIL A;  4G9S B;  4CU9 A;  2QQP A;  3ROU A;  2EAK A;  2P3I A;  1QH7 A;  5LAS A;  5FK8 A;  1SPP A;  2ZCW A;  4BXF A;  2E33 A;  5FUP A;  1SPP B;  2R6Q A;  3OJB A;  2CDP A;  4LBQ A;  4A41 A;  1QXR A;  4AG4 A;  3PHM A;  3B9C A;  1LOC A;  1HN0 A;  2HEW F;  4HKW A;  2A6V A;  3VKF C;  5FYT A;  3WG1 A;  3H8O A;  4YG3 A;  4YW7 A;  5FJK A;  4CP9 A;  4N8M A;  3AZV A;  5BUV A;  4CP9 B;  3IWZ A;  4EN0 A;  4Z07 A;  4CP2 A;  4RSU A;  4YVS B;  5IUQ A;  4Y5S A;  4Q4V 1;  1RVF 2;  2CHH A;  1DYK A;  1GMM A;  4R9C A;  2XJS A;  4WV8 A;  1QEX A;  4I0W B;  5EZW A;  1RUC 2;  4URA A;  2J1S A;  4YVW A;  1FXZ A;  2A1X A;  2WFF 3;  2XBO 1;  5KHH A;  2R1D A;  4EWD A;  1ND2 A;  1C5I A;  5GM0 A;  3SC7 X;  2SBA A;  2ZTN A;  2PHW A;  3TN9 1;  3VD3 A;  4H55 A;  2F4P A;  2DWR A;  2CWS A;  4R9D A;  1ND2 B;  3AZZ A;  3T4H B;  3TEZ A;  5DAW A;  2WAO A;  2JKX A;  4IUG A;  1JN2 P;  1L7L A;  4XJW A;  3Q8B A;  1W9F A;  2IWG B;  2V4V A;  1UX7 A;  2BU9 A;  4QX3 A;  4QKF A;  2GAU A;  4XAB A;  2VUC A;  3M2M A;  3KVB A;  4JQR A;  3KGZ A;  3MPB A;  5T50 A;  4R9B A;  4TLF A;  1XYO A;  2LUW A;  4DXR A;  1JZ3 A;  1EYB A;  1RJ8 A;  2HWC 1;  2VY0 A;  2P17 A;  2W1Q A;  3ZKY A;  3ZMO A;  5I0R A;  2DFC A;  2BGO A;  1TME 3;  1OKO A;  2WJS A;  3J8F 1;  5JAX A;  2VZQ A;  1RJ7 A;  1SLA A;  4CCJ A;  2BER A;  4YW5 A;  4CEW A;  2CL2 A;  2QQL A;  3KCX A;  5A7W A;  1PX4 A;  4AEK A;  4ASK A;  4FPO B;  2FQP A;  5CKM A;  1OOP B;  1O7F A;  5A6Y A;  1RUG 3;  2JD9 A;  1RUI 3;  2Y6K A;  3H3L A;  4WZF A;  4E4D X;  1MS3 A;  2DCY A;  4NVP A;  4AEM A;  2ARB A;  1Q56 A;  4WVV A;  2YU1 A;  3K46 A;  4K8F A;  1HRV 3;  5C8W A;  4QB1 A;  2C0Z A;  3ZFF A;  2Z4F A;  3RQ0 A;  1JYI A;  5CA6 A;  3A4U A;  4ISR A;  4P9L A;  2RJK A;  1VB2 A;  5FZK A;  2QUO A;  3VZK A;  1PNG A;  3HNB M;  1WCU A;  2W08 A;  4JRL A;  4LBJ A;  4O61 A;  3VZO A;  2CDO A;  3WVJ A;  5JXJ A;  1RUE 2;  3VUO A;  1GZT A;  5FMO L;  2QZ3 A;  1W3X A;  4L92 A;  1LOD A;  1ZBA 1;  2WL1 A;  4IEQ A;  2JD4 A;  3DGT A;  3KV4 A;  1DP0 A;  2FDI A;  4AVC A;  1REE A;  1H8T B;  1YIP A;  2YFU A;  2W3J A;  4LO4 B;  2GAL A;  1MVE A;  3GNE A;  1D0G A;  4QX2 A;  3T3Y A;  5J48 A;  1H9P A;  1WW5 A;  3D0S A;  4JDO A;  4AGV A;  5GZG A;  3APB A;  1XXN A;  2HKX A;  4IV3 A;  3THT A;  1CD3 G;  1CAX B;  1WUV A;  4AGG A;  1IOA A;  4PLM A;  1UYY A;  2VZS A;  3QH6 A;  3RYK A;  3C3V A;  1DZT A;  1HB4 A;  4K21 A;  4Q0Q A;  1MQT A;  1LEN A;  2F17 A;  2ZGP A;  5FY8 A;  3VDD C;  3NV4 A;  1SFN A;  4DXT A;  3MBW A;  1W9W A;  2GP5 A;  3RZK A;  3B3Q E;  4UW5 A;  3GZA A;  4DOU A;  4EN6 B;  2ZGQ A;  4UF0 A;  4KBB A;  3VBR A;  2R07 3;  3DCQ A;  1OH4 A;  3AX4 A;  3VKN A;  4A3X A;  1HIX A;  4XFI A;  2PA7 A;  4I01 A;  2YC4 A;  3MLL A;  5JOY A;  2RHP A;  2D98 A;  1GKB A;  1AR7 1;  1YC6 1;  2OXB A;  1S0E A;  5D21 A;  3PVE A;  5EFU A;  3VBU B;  4OHV A;  3ZFG C;  3SNM A;  4QXB A;  4KU8 A;  4PDW C;  1N1Y A;  1FPN 3;  3ZFE C;  1PMJ X;  1LTE A;  4P5Y A;  5A33 A;  1LEM A;  4LUK A;  4P02 B;  4RHV 1;  5IK4 A;  4JX0 A;  4NN0 A;  1UY0 A;  1ZA7 A;  1I3H A;  3GHN A;  2QJV A;  4CYD A;  2GC3 A;  4W4Z A;  4AFB A;  4XFF A;  1PGW 1;  3CF6 E;  5AC9 2;  4A4A A;  1I1E A;  2DCT A;  5CYY A;  4CCM A;  1JZ6 A;  2ZBJ A;  3VD9 A;  3TNP B;  4OMD A;  1S2E A;  3VZL A;  4Q29 A;  4Y22 B;  1FMD 2;  1J3R A;  1VRH 2;  1R09 1;  3PIJ A;  3TNQ A;  1D7P M;  1EUU A;  2EIG A;  3D82 A;  1UNB A;  1W8N A;  1ZBE 3;  3GJA A;  1R08 2;  3VBO A;  5KHG A;  5AFB A;  4NPL A;  3NO8 A;  4AHX A;  2ORZ A;  1G9C A;  2Y26 A;  3VBF B;  4UBH A;  5I0S A;  4JGY C;  1AL2 2;  2GND A;  3PL0 A;  4GAL A;  4I0B A;  1GBG A;  2X5I C;  5DDJ 1;  3JD7 3;  5DXD A;  1XE0 A;  3EO6 A;  5EXO A;  1QDO A;  3RI9 A;  3K51 A;  3UYJ A;  1OKQ A;  4GUL A;  1AJO A;  3TEY A;  1SLC A;  3E97 A;  2FHR A;  3VZM A;  5A7O A;  4AFM A;  2BFU S;  4XE9 A;  1DQ6 A;  1EAH 1;  1GR3 A;  2D43 A;  2VTF A;  4FPY A;  2FDF A;  3ZXA C;  3IBM A;  4DRV A;  5A3U A;  3OPT A;  3AKR A;  1LKN A;  3MUY 1;  4ZXK A;  2B9V A;  1X50 A;  2UYA A;  3AP9 A;  3QOP A;  4FCA A;  5FZI A;  1RUJ 1;  2ZML A;  4AWD A;  3HWJ A;  1AHS A;  5FP4 A;  4IGO A;  3VGI A;  3WEZ A;  2WT0 A;  3A7Q A;  2NMN A;  2DCJ A; 
#chains in the Genus database with same CATH homology
 2WO3 A;  1JU4 A;  1BHG A;  4OYU A;  3HNM A;  2W92 A;  5JUV A;  2XQX A;  1ULP A;  5DN2 A;  2W91 A;  2J22 A;  3OEB A;  1CZT A;  1NKG A;  3K4A A;  4A45 A;  4QX0 A;  2J1A A;  2KD7 A;  4L0P A;  3CMG A;  4ARX A;  3NNG A;  3LQC A;  5LCW L;  1R64 A;  3WF0 A;  1PX3 A;  4QDR A;  3VD5 A;  2VZO A;  3SKV A;  3C8X A;  3GDB A;  3THD A;  2ZEZ A;  4MOA A;  4QAW A;  1F4H A;  4RYD A;  3NQH A;  1J84 A;  4A3Z A;  4CU7 A;  5B4N A;  5JMO A;  5I0D A;  4BXS V;  2E26 A;  4AAX A;  4ZZ5 A;  3FHA A;  3ETP A;  3WQB A;  5C71 A;  1JZ8 A;  3I97 A;  3P1I A;  2R7E B;  3CDZ B;  4DUW A;  1XC6 A;  4GWJ A;  4UI9 L;  1OF4 A;  1L7Q A;  4PT6 A;  3I3B A;  2J1E A;  5EJ1 B;  1TVG A;  4GWI A;  2X09 A;  3T2P A;  2C9K A;  3K4Z A;  3T2O A;  3CKH A;  2VOT A;  5IYY A;  3C7E A;  4ZXE A;  4DXS A;  2WO2 A;  3IDA A;  4OMC A;  4QDS A;  3ZM8 A;  1RYY A;  5HPO A;  3T0B A;  1O8S A;  5G05 L;  1US3 A;  2E31 A;  1EUT A;  1OT5 A;  4UOJ A;  3P6B A;  1SDD B;  3JXS A;  4ET7 A;  3IAQ A;  2WN3 A;  2X10 A;  3ACH A;  3T08 A;  4CUC A;  3ABZ A;  3WNN A;  3DYM A;  3MO4 A;  4RN5 A;  2XOM A;  2J1R A;  4JHZ A;  1JYX A;  2L9L A;  2W1U A;  1UXX X;  2VCA A;  1JYW A;  2QQK A;  2WAA A;  2WUH A;  4BK5 A;  2J1T A;  2DCK A;  3I3D A;  3UES A;  2JE8 A;  2YB7 A;  3IAP A;  3A22 A;  1LNS A;  2ZEX A;  3PUI A;  4CU6 A;  3III A;  1O8P A;  2WQ8 A;  2WZ8 A;  3WNK A;  1NX9 A;  4JKL A;  2VC9 A;  2J7M A;  2W94 A;  3NRU A;  4HG6 B;  1K45 A;  3I2G A;  3LEK A;  3OBA A;  1CZS A;  2Y6J A;  4CUA A;  2W87 A;  1UYX A;  5IHR A;  3OGS A;  4XUR A;  1I5P A;  3OG2 A;  5JR2 A;  1JI6 A;  2VZ3 A;  1UY3 A;  2BBA A;  2EIE A;  5IJR A;  4MGQ A;  3C7F A;  1O59 A;  4DUV A;  1OD3 A;  3MV0 1;  4W50 A;  3EB7 A;  1JYV A;  3VDC A;  3HOB A;  5CZK A;  3ACG A;  2VL4 A;  1TG7 A;  3OB8 A;  4QB2 A;  4PF1 A;  5FUI A;  2DDU A;  2QQN A;  3I3E A;  1P8J A;  3WNP A;  2RV9 A;  3FHQ A;  3T09 A;  1T2X A;  2J1V A;  2RJ2 A;  3DYP A;  4XUO A;  1L7R A;  4CVU A;  5B4X A;  1GUI A;  1OF3 A;  2VZT A;  3J7H A;  2VME A;  2QQM A;  2ZXQ A;  2QBX A;  1W0N A;  2XON A;  3SEP A;  1GU3 A;  5JXH A;  4YPJ A;  2X05 A;  3LPF A;  2J1U A;  4LHS A;  3T0A A;  4A42 A;  1K12 A;  3PUH A;  3BGA A;  3THC A;  4XUT A;  5JXI A;  4ZZ8 A;  3NJX A;  5LA1 A;  2VZP A;  3I2H A;  3K4D A;  4GZ9 A;  1KEX A;  1JZ5 A;  3A21 A;  1F4A A;  3LEI A;  2XHN A;  5EJZ B;  5HXM A;  3WNM A;  3I2F A;  1W9S A;  3UNP A;  2W1S A;  3A23 A;  4XUQ A;  5J1X A;  2C4X A;  3I2J A;  2ID4 A;  2QQI A;  2WBK A;  1HN1 A;  1K3I A;  1XPW A;  1NAE A;  1UY2 A;  3MV1 1;  3E1F 1;  2QQJ A;  1UWW A;  4QPW A;  4CU9 A;  1SG3 A;  3HPN A;  3K75 B;  4A6O A;  4D0Q A;  2E33 A;  1PMH X;  2CDP A;  4A41 A;  3HNY M;  4AG4 A;  3OEA A;  4KWU A;  5DPN A;  1H6X A;  2YG0 A;  2VM9 A;  3GM8 A;  3UET A;  4ZY9 A;  1UY4 A;  2V72 A;  4BK4 A;  2V5D A;  1DLC A;  1YQ2 A;  1GMM A;  1KGY A;  5DMY A;  2J1S A;  3AC0 A;  3FN9 A;  3VD3 A;  2HLE A;  5IFP A;  1JZ4 A;  2WAO A;  2JKX A;  4DEQ A;  4IUG A;  4MO3 M;  2V4V A;  1UX7 A;  3NJV A;  4QX3 A;  3VDB A;  2ZEY A;  4OZO A;  2EIB A;  1NUK A;  2B4K A;  4DXR A;  2WN2 A;  1JZ3 A;  2WZE A;  2EIC A;  2W1Q A;  3LE0 A;  2BGO A;  5C7G A;  1UXZ A;  1JZ7 A;  1CIY A;  2W46 A;  4XUN A;  2VZQ A;  2BER A;  1IQD C;  2QQL A;  2WO1 A;  1PX4 A;  3VD7 A;  2Y8K A;  3OGV A;  2WDB A;  1UZ0 A;  1CX1 A;  2JD9 A;  4CU8 A;  2Y6K A;  4ARY A;  2RVA A;  3LPG A;  3SEE A;  2VMF A;  3T2Q A;  5LA0 A;  3DYO A;  1SHW B;  3K46 A;  4W8J A;  3U37 A;  2VQT A;  4CUB A;  1GOH A;  4QB1 A;  2W5F A;  2Z4F A;  2BGP A;  3LEG A;  2VMC A;  4LPL A;  4E8D A;  4JKM A;  3WSO A;  3HNB M;  1GOF A;  2E32 A;  2CDO A;  4M4R A;  5JXJ A;  2PQS A;  3GXU A;  4LQR A;  3OGR A;  2Y6H A;  4KI5 M;  4OUE A;  1JYN A;  2WYS A;  3CZU A;  1DP0 A;  2ORX A;  3ACI A;  5F7U A;  2YFU A;  2JDA A;  2W3J A;  3MUZ 1;  1H6Y A;  2WAB A;  4QX2 A;  4D8M A;  5C70 A;  1K42 A;  4MAD A;  3WF3 A;  2EID A;  3I2K A;  4FI9 A;  1UYY A;  2VZS A;  1MPX A;  2BZD A;  4KMQ A;  5DQ0 A;  1ULO A;  1UY1 A;  4MGS A;  2LW8 A;  3VD4 A;  2VJX A;  4DXT A;  4XVH A;  3MBW A;  1W9W A;  1UYZ A;  3WF1 A;  4E8C A;  3WF2 A;  2Y6G A;  5A1A A;  1GNY A;  1OH4 A;  1W99 A;  2C26 A;  5EIY B;  2VZU A;  2W95 A;  3GGL A;  1WKY A;  2YC4 A;  2HYX A;  2VMD A;  3SKJ E;  1WCQ A;  2ZEW A;  3BN6 A;  3C7G A;  4DUX A;  2OKX A;  2VR4 A;  2W9X A;  2VZV A;  1PMJ X;  1UMH A;  1GOG A;  1W9T A;  4P5Y A;  4P02 B;  2Y64 A;  4QX1 A;  4JX0 A;  2YC2 A;  1UY0 A;  5IFT A;  4Z2A A;  4W4Z A;  3HEI A;  2VQU A;  3CIH A;  4PQQ A;  4A4A A;  3ACF A;  5CYY A;  2YFZ A;  1DYO A;  5LA2 A;  3VDA A;  1JZ6 A;  1W8O A;  3VD9 A;  2Y6L A;  4OMD A;  3WF4 A;  1J83 A;  1JHJ A;  4JKK A;  4QB6 A;  3HN3 A;  1EUU A;  1D7P M;  3W5M A;  1W8N A;  3C7O A;  3DEC A;  4LKS A;  3IB3 A;  4XUP A;  3W5N A;  4P08 A;  3WNO A;  2QQO A;  4DEV A;  2VZR A;  2ORZ A;  1JU3 A;  2VCC A;  1US2 A;  4BJ0 A;  4M4P A;  2LS6 A;  3K77 A;  1UMI A;  4UAP A;  2VZ1 A;  1JZ2 A;  3FL7 A;  3F2Z A;  1XNA A;  3D3A A;  4TXW A;  4BDV B;  3C7H A;  3I2I A;  2VCB A;  3ECQ A;  5JXG A;  1CZV A;  2VTF A;  4TTG A;  3EYP A;  2VO5 A;  4A44 A;  1GQP A;  3CZJ A;  1XNT A;  3MUY 1;  2W47 A;  2B9V A;  5G04 L;  3WNL A;  2W1W A;  3CQO A;  4QDQ A;  4P00 B;  3WEZ A;  3T0D A;  3HJR A;  4XZU G;  3A7Q A;  2DCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...