4QB6A

Structure of cbm35 in complex with aldouronic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
128
Chain Sequence
TGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
molecule keywords Xyn30D
total genus 29
structure length 128
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb6A00
2W3JA 3BGAA 3CIHA 1UWWA 4M4PA 1UX7A 1UY1A 2W94A 5JXIA 3A23A 2Y6HA 5C71A 3ETPA 2VZUA 2WBKA 3MV11 2YB7A 3P6BA 2EIBA 4D0QA 5LCWL 2W9XA 1W8OA 3SEPA 3WF2A 3I2HA 5F7UA 2WUHA 2J1RA 1NUKA 1GUIA 3WSOA 4W8JA 1OF3A 1F4HA 2EIDA 3UESA 4A6OA 4QB2A 3T2OA 1JZ3A 2ZEXA 2E33A 4XUTA 3C7OA 3OG2A 1JU3A 3MO4A 2WAOA 1D7PM 1ULOA 2X10A 1UYYA 3A7QA 3I3DA 1US3A 3WNKA 2R7EB 2VQTA 1SHWB 5JR2A 4JX0A 3OGRA 4BXSV 3OB8A 3OBAA 3W5MA 2VZSA 1UMHA 2DCJA 4LPLA 2ORXA 5IFPA 2LW8A 3AC0A 2WO1A 4QDQA 3HPNA 4A42A 2BZDA 3VD5A 2B4KA 1HN1A 3BN6A 1UXZA 5B4NA 3CDZB 4OMCA 3ZM8A 2YFUA 2DDUA 2HLEA 3D3AA 2QQLA 1JYVA 4CUBA 1CX1A 2BGPA 3OEBA 3HNYM 3OGSA 3CKHA 3LQCA 4XUOA 1UY0A 2Y6JA 2RV9A 2V4VA 4PQQA 1JU4A 4CVUA 2EIEA 1JYWA 4OUEA 4UAPA 4IUGA 3NJVA 2VCAA 3GGLA 1IQDC 1I5PA 3DECA 3K4DA 4JHZA 4QB6A 4BDVB 1PMHX 4LQRA 3I2GA 2J1UA 4DUXA 2WO2A 4PF1A 2VZ3A 1TG7A 1K3IA 4LHSA 1PMJX 4RN5A 2WYSA 1GNYA 2W87A 2X05A 2VMCA 2J22A 4AG4A 2VMDA 3MBWA 2CDPA 4A44A 5LA1A 4MOAA 2VZVA 2OKXA 4YPJA 3U37A 3WNNA 1O8SA 1GQPA 2VL4A 2ZEYA 3VDAA 3ACIA 4OZOA 4ZZ8A 1UY3A 5G04L 1K45A 5LA2A 2Y6KA 4A4AA 4MO3M 1NAEA 1KEXA 5B4XA 1OT5A 2L9LA 4QAWA 3HN3A 1NKGA 2WQ8A 5DQ0A 3ACGA 2C26A 2WZ8A 2J1TA 4M4RA 1OF4A 4DUVA 4CU9A 1W99A 4Z2AA 4UI9L 2VZRA 5HPOA 4MGQA 3T0DA 3GDBA 3WF4A 4P5YA 4OYUA 3I2FA 3UNPA 4GWJA 1J83A 1L7RA 4XURA 3NQHA 4GWIA 2W46A 4XVHA 1JZ8A 1H6YA 3EYPA 3WNPA 2W95A 2VZTA 4ZZ5A 1LNSA 2CDOA 3NJXA 3K4AA 1RYYA 3C7FA 2B9VA 4TTGA 5DPNA 1O8PA 5G05L 1W9TA 2YC4A 1W0NA 3OGVA 4E8CA 3CZJA 3EB7A 2Y64A 2WZEA 2ZEZA 3THCA 1JYXA 5DN2A 2V5DA 2YC2A 4E8DA 3MV01 3HNMA 4DEQA 3E1F1 1DYOA 2Y6LA 2W1UA 3MUY1 5JMOA 2W1SA 1JZ6A 1H6XA 3P1IA 1K12A 4XUQA 3GM8A 1XPWA 4W50A 5IHRA 2ORZA 1JYNA 3JXSA 1US2A 2BBAA 1KGYA 1JZ7A 4CU6A 2XOMA 3ACFA 1J84A 3K75B 1SDDB 2YFZA 2J1EA 4DXTA 1YQ2A 4KI5M 3K46A 4P00B 1MPXA 2W92A 2EICA 3FHAA 3SEEA 4LKSA 1T2XA 5JXJA 1P8JA 1CZTA 5A1AA 2XHNA 3DYMA 2QQMA 4QPWA 1PX4A 2BERA 3VDBA 4ARXA 3F2ZA 3T09A 1NX9A 2QQIA 3T0AA 3DYOA 4PT6A 4P02B 2DCKA 2KD7A 2RJ2A 3I2IA 3I3BA 3WF3A 1K42A 3CQOA 3HEIA 1UMIA 4CU7A 2J7MA 3THDA 5DMYA 4DUWA 1XNTA 5J1XA 3WNLA 2WO3A 1EUTA 4ET7A 3I3EA 3SKJE 1L7QA 3SKVA 3W5NA 2VZPA 3NNGA 1CZSA 1JHJA 4ZXEA 1JZ5A 2WDBA 3IIIA 2E31A 2JKXA 3VD3A 2QBXA 2WABA 4QX1A 1GOGA 4XZUG 3A22A 1OD3A 4BK5A 2J1VA 1JZ2A 3HOBA 2W1QA 2VCBA 2ZEWA 2Z4FA 4QDSA 5EJ1B 3DYPA 3LEKA 2C9KA 3T2PA 1F4AA 5IYYA 3FL7A 2VQUA 2ID4A 3NRUA 4OMDA 3IAPA 4KMQA 4QB1A 3WNOA 2VM9A 3T08A 3A21A 3WNMA 2VC9A 3FN9A 1PX3A 4D8MA 4JKKA 1R64A 3ECQA 2VO5A 2J1AA 3PUIA 3VD9A 3T2QA 3C8XA 5EJZB 1GOHA 2VMFA 3OEAA 5JXHA 3LEGA 2JE8A 4QX0A 4L0PA 1W9WA 4XUNA 2PQSA 2XONA 1XNAA 2JDAA 2VZQA 4CUAA 4BJ0A 4CUCA 2RVAA 1GU3A 1DP0A 3K4ZA 2VMEA 3FHQA 4HG6B 2VOTA 3J7HA 4CU8A 4JKMA 4XUPA 4ZY9A 1W9SA 4ARYA 1GOFA 3WEZA 5IJRA 3WQBA 3GXUA 2BGOA 1UY4A 3C7HA 3WF0A 4DEVA 3VD4A 5JXGA 3K77A 5CZKA 1GMMA 1XC6A 3IAQA 3IB3A 4AAXA 5I0DA 1BHGA 1SG3A 3IDAA 1W8NA 5FUIA 1JZ4A 3I97A 4FI9A 2VZOA 2QQOA 2W47A 3MUZ1 2XQXA 2VCCA 2E32A 3ACHA 2J1SA 5C70A 1CZVA 1CIYA 1TVGA 3I2KA 1JI6A 2W5FA 2QQKA 4BK4A 3LE0A 5CYYA 2WN2A 2WN3A 3C7EA 3CMGA 2W1WA 4MGSA 3I2JA 3PUHA 3HNBM 4DXRA 2W91A 4TXWA 3T0BA 3LEIA 1O59A 5C7GA 1ULPA 2HYXA 4A3ZA 1UXXX 2X09A 1OH4A 2V72A 4QX2A 5HXMA 1WCQA 3VD7A 3LPFA 4W4ZA 4JKLA 4MADA 3UETA 4DXSA 4KWUA 2Y8KA 2ZXQA 2JD9A 2VZ1A 3C7GA 4P08A 4A41A 2QQNA 5LA0A 2VTFA 1WKYA 4QX3A 2YG0A 1UZ0A 1UY2A 4RYDA 1UYZA 2VR4A 5EIYB 3CZUA 4QDRA 5IFTA 1UYXA 1DLCA 2LS6A 4A45A 4UOJA 3HJRA 3LPGA 4GZ9A 5JUVA 1EUUA 2VJXA 2QQJA 2WAAA 3WF1A 3VDCA 2E26A 3ABZA 2Y6GA 2C4XA
chains in the Genus database with same CATH superfamily
2W3JA 3BGAA 2XH6A 2VBDA 4GJZA 4HPKB 2ZCWA 3L2YA 4NAOA 1PK6A 5FZ3A 1YQ8A 5FZLA 3G7DA 3H0OA 3H8UA 2JB4A 2DVFA 4BQ4A 4QMAA 1OPMA 2WWUA 3JBG3 3POEA 5FY4A 5C71A 3FLRA 1SBFA 1OQEA 3CO2A 3FUOA 4FFFA 4Q26A 2E53A 4YGDA 4LOTA 4D0QA 5LCWL 1FYUA 2W9XA 3GBFA 3ZPOA 2RMU2 2ZGTA 3WSOA 1QWRA 5IVYA 1ZYBA 4W8JA 5T5JA 5BNPA 3ON7A 2R30A 2JB8A 4MUVA 1F4HA 3WINE 3LA3A 4DMIA 5CFCA 4MG2A 2EIDA 3USSA 1OSGA 3K3NA 1JZ3A 2MHFA 4AEDB 4IW3A 1FOD2 1RUH1 5H9RA 2PXJA 3C7OA 3OY8B 3SH5A 5H9SA 2G9FA 1REEA 4NMIA 1JU3A 3ZXAC 3MO4A 2ZZJA 2PQQA 1D7PM 4IEPA 5L9VA 3RWNA 1RUC3 1UNBA 3TNPB 4IEWA 1ULOA 4N43A 2WFPA 4LHNA 1CAUA 3I3DA 4QM8A 1VAVA 1H4HA 2VQTA 1E5SA 3WNKA 4B4RA 3ZN4A 2GSYA 3AP5A 5DZFA 4H14A 3DEMA 1UW8A 3OBAA 3RG0A 4UT5A 3ATGA 2VZSA 3KS7A 1KJRA 1UMHA 4HT1T 3NNMA 5DG1A 3C2UA 4LE3A 4XOGA 4GIQA 2DBIA 2ZGMA 1JYIA 5FZ6A 3PTRB 1QDOA 3WX5A 4ONUA 3AC0A 4K20A 3NV2A 5FK8A 3WG3A 4E4SA 1PGL2 1YNAA 1WW6A 1IS3A 3V0AA 1Q43A 2B4KA 5A6ZA 2GC2A 2YXSA 5FJHA 4QPGC 4HSJA 1UU6A 3M3IA 1BKZA 5T52A 3ZM8A 4CYDA 3B94A 1BBT2 4H2AA 4IEYA 3D3AA 1LEDA 4IE4A 3KGLA 1JYVA 1TME2 4TLGA 1AXKA 1K5MB 1REDA 2YBKA 3USUA 1ULGA 1BXHA 4IE7A 3GZTB 4QX5A 3M3EA 3IBMA 1GWMA 1JU4A 1OUSA 4LLFA 1JYWA 4ZHNA 3M3QA 1UQXA 4OUEA 4Y4RA 2XJTA 3ZXDA 4IUGA 3NJVA 5JVVA 1JHNA 1OPOA 2VCAA 5IK8A 2P3KA 2CV6A 1D2SA 5IUQA 4M00A 3O0VA 1Y43B 2HWC2 4URTA 4XFHA 2C5DA 3LF7A 3RZZA 1AR73 4HANA 4JC1A 4QB6A 1PMHX 2EALA 4WVMB 3TAYA 4B7EA 3HBKA 2WZR2 2BDRA 3POFA 2ZKNA 2A3WA 2J1UA 3WW3A 5F6KA 2HWE1 3H3UA 4DUXA 1M4WA 1EV13 4GA9A 1TG7A 5I0RA 1PVC2 3K48A 5F37A 3BUCA 1HJFA 3TRSB 2AENA 3AP9A 5CFCC 2QVSB 3CL1A 2X05A 2VMCA 2J22A 4AG4A 2CDPA 5CKMA 4QQ2A 4A44A 3WCSA 2FD8A 4MSVA 2VZVA 2DUQA 3VBUA 4Q4X3 5C8CB 2E51A 4XQDA 1QQP1 4YG0A 1UZVA 2D98A 1QKQA 2ZEYA 3VDAA 4QPGA 4CCNA 5B2GB 4LMFA 2RM22 4IV3C 4XC9A 1CJPA 1UY3A 5G04L 4LITA 1H1AA 1ND3A 3IWZA 4PJYA 2UU8A 4Q0PA 4MO3M 1MS1A 4D6QA 1BMV2 5B4XA 1W6MA 5K7PA 2HWF2 4WM7A 3EO6A 3TN93 3AB0A 1S0JA 3Q8BA 2G19A 3HN3A 5I0TA 4KL1A 3ZYBA 1UMZA 1UF2C 4C91A 5A3PA 3O1MA 4QQPA 4CCMA 3O1VA 3HIFA 4NHXA 4HSLA 2Q0AA 2VNGA 2YGMA 2ETEA 4FPOB 4CU9A 4UI9L 3WDVA 4OQ9A 2VVFA 3SITA 3GDBA 3WF4A 5A33B 4Q4W3 5CG8A 4MLOA 4WM8B 3T2TA 4JZRA 4IV1B 1GR3A 4JGYA 5DXDA 1QJY3 5FQ0B 1Y7BA 3ASIA 3NQHA 4IETA 4YYOA 4UBHA 4LOSA 3AMMA 2VZTA 4MXWA 2B39A 3N7KA 1HRV2 4Y22B 3S5AA 1CAWB 2LALA 3RI8A 1HRI3 5FAXA 3BI3A 1OA4A 2PLV1 4UFKA 1WLWA 2B9VA 4JRLA 3VV1A 1O8PA 5AVPA 1W9TA 2JICA 5FYUA 1MR5A 4A7ZA 2CNAA 2YC4A 3LDRA 1W0NA 1W9FA 3OGVA 3WP6A 1ULFA 5IT6A 1MQTA 1JYXA 5DN2A 1DIWA 3AZZA 4XJWA 4JQRA 2A70A 2FDJA 3CBNA 3E6BA 3I3QA 4KU8A 3OGGA 1ND2A 4YVWC 4OCTA 4AK3A 2A6YA 2Y6LA 5A7NA 5JZGA 1GP6A 2W1SA 3AKQA 1D4VB 5KR7A 5I93A 1H30A 2ZGKA 3MEPA 4AR2A 4FQ4A 3DN7A 3OJBA 1E5HA 5GLWA 1YEWA 1ENSA 3AYAA 5GLTA 3LOBA 5IW0A 2D6NA 3KV9A 1YFUA 2MNGA 3INAA 3PVOA 3QCWA 3UYJA 2OS2A 2MEV2 4S2GA 2XOMA 3ACFA 5CB7A 3AKRA 5IATA 3TEZA 2XJQA 2NP0A 2YFZA 2J1EA 3DXUA 3AZYA 3SCFA 1G7YA 4FTEA 1NZIA 4WM7C 5FPUA 1YFWA 2WZR3 3PVBB 4NIIA 3VKLA 3SEEA 4FPLA 1T2XA 3BTZA 1X9PA 5BNNB 2YROA 3H1YA 1NLRA 3E6DA 2VH9A 1H2LA 2HEVF 2XBO3 4F7ZA 5D2AA 2CTVA 1PX4A 4I01A 4Y20B 2FBEA 5I8YA 4A6SA 3FMGA 4HL0A 4OHYA 1QMJA 2FQPA 4PI0A 4Y5Z0 4LBOA 4ZKTB 4BLJA 3I4IA 4DINB 3O14A 5JSRA 5JR7B 1R081 2VQ0A 2WT0A 4XFBA 5A7WB 2FDHA 1A8DA 5FYHA 2XVKA 3WW1A 5FP3A 1GKBA 3DYOA 4LXLA 2WNVB 4QPIC 2R16A 4QT6A 4AHWA 1RB8G 2GH8A 4CXXA 1YHFA 2RJ2A 2NYYA 5FPXA 2CAUA 3FFQA 1F15A 5FP9A 2AYHA 3U07A 3RJ2X 1AYN2 2VOWA 5DAQA 4E4ZA 5ABJA 3SCHA 1XNTA 5F39A 3WD5A 3NJZA 2WSUA 1EUTA 4PF5A 4ET7A 5F5QA 1X8EA 3SKJE 5LEKA 4Y5SA 5L73A 1L7QA 4CA9A 3E5UA 5FYVA 1G86A 2YMZA 1Z7S2 2JDPA 1JZ5A 1CPNA 1VBB1 1AXZA 2E31A 3RZHA 1NA1A 2D43A 4XEZA 2P37A 1VR3A 4RHV2 3VHPA 4RR3B 1NE6A 1LHWA 1LOFA 3ALQA 1PZ7A 5J09A 2XVGA 1WZXA 4Q4W2 1FAYA 4Q4Y3 1JZ2A 2WNVC 3ZFGB 5IVCA 1IHMA 1W8TA 3OYWB 2FCVA 5LBEA 5M0TA 1OURA 2NPIA 2O14A 3GHNA 3TN92 3I59B 1J1TA 4DRRA 1Q56A 4XACA 3ZFFC 1HRV3 2VQUA 4BQ2A 1I5ZA 1FPN1 4QPYA 5APAA 2KR2A 2XVLA 5FYMA 2H6BA 4UBGA 4QXBA 4K1ZA 2JDZA 5EP9A 1QJX3 1QJY1 3CEWA 3OUIA 2PHDA 5C3OA 5IVJA 3A4UA 1QJU3 2XGXA 4P9WA 5EZWA 3A21A 2W39A 2IC1A 1NLSA 4PIXA 3FN9A 1DZRA 4C8DA 5I8TA 1NCQC 1AHSA 4O65A 1R64A 1PK6B 5LEJA 3JD71 4E2SA 3DGTA 3PUIA 2HYKA 2ERFA 3GJBA 3J8F1 1RUG3 3VD9A 5BYNA 3RZLA 4GALA 5CFDA 3P3PA 1WW5A 4UF0A 3BOWA 2PHRA 5A7SA 3S7EA 2HWF3 1ZNPA 3NAPA 3E97A 4Q0VA 4Y24A 4Z07A 4AFBA 2VMFA 4AWDA 3LA2A 4QKNA 4INDA 1W04A 1COV3 1YCIA 4XCAA 1C5IA 3D5OA 4LK7A 1DQ0A 4HK9A 4XF4A 1W9WA 1VB4A 4AVSA 1D0GA 5JIAA 2X29A 3AJZA 1KS4A 2ET1A 5ACA2 1XNAA 2JDAA 4M0NA 3NNJA 4BJ0A 3KV4A 5FKCA 2QFEA 5CFDC 2Q8CA 1DP0A 4NRQA 3U4XA 4V1PA 2VMEA 1LODA 3EBRA 4HG6B 3NAPC 4YW5A 5FREA 3TYJA 4CCJA 4XUPA 3JCIA 1CAVA 1ONAA 2JEMA 4ARYA 1YQCA 1LHVA 4YM1A 1RUNA 2BGOA 3C7HA 1MS0A 2A73B 5D8AA 2E7AA 2VMGA 5GM0A 5HI0A 3ZYJB 4CXWA 2GC0A 1VBE2 3AMNA 3VD4A 1XYOA 4LUKA 1GMMA 1NZCA 1XC6A 4YVWB 5GZFA 4YZ2A 1AR81 1AYM2 1S55A 4LT5A 3IDAA 3POYA 5FY1A 2PHFA 1HXS1 5FZFA 2GAUA 5JPNB 4CEWA 1FATA 3MUZ1 3DCQA 3ZFFA 5A32A 4Q4X1 2ARCA 1CONA 1ZM1A 1QQP3 4AHYA 1LGBA 1TVGA 5BNOB 2W5FA 1DBNA 4KGGA 4LBQA 4MGKE 4RGKA 4AHZA 4FAGA 1EV11 3ZXEA 1AYN3 1OH3A 2GALA 4HKLA 3MW2A 5CYYA 5FLJA 2DVBA 3U1XA 4M01A 1L3JA 2R6QA 5H9QA 4MGSA 3I2JA 4OI2A 2R0FA 1AL23 3HT1A 1AZDA 4XYXA 4TXWA 4UFHA 5CADA 3HAGA 3LEIA 3N4MA 1B35B 2P2KA 4I30A 5KHKA 1HB3A 3KB5A 4P9YA 5C7GA 4BZ4A 4KWKA 1FI2A 3HMYA 3VBFC 3ZKYA 4A3ZA 4S2HA 2V72A 3BB6A 4AAPA 1K5JA 1HKDA 2JE7A 2XWJB 3AKPA 4WVMA 2E7QA 4YWAA 1W03A 3LPFA 1O5UA 3ZDSA 1SPPB 4JKLA 3FUQA 2BFUL 4DXSA 4KWUA 4BU2A 5JOYA 4YGCA 4COWA 4F83A 3BODA 4FXGB 1UIKA 2D93A 1N3QA 2PHLA 4XIOA 5FFOC 2Q8DA 2ZXQA 2JD9A 2VZ1A 5FXWA 4DXZA 2HWB1 3ROUA 3K51A 5C4WA 1HV1A 4AI3A 4A41A 2CAVA 1POV0 1AF9A 1KDMA 3R4UA 4L97A 3IZOA 2D40A 1U5IA 2VTFA 4V2WA 2YG0A 1BK0A 5FY0A 1YIPA 1UZ0A 4LO8A 3B7MA 4CDUB 1CQ9A 1UY2A 4MV2A 3MIDA 4RYDA 5IK7A 5FZDA 1NG0A 1UYZA 3BVCA 4RHV3 2WT2A 4CDXB 4CEYC 1SFPA 4UW4A 3AFGA 3WZ1A 1FMD3 3QBQA 1JYCA 2Z69A 1V70A 3ZIWA 4BIOA 4BIFA 4I0WB 5C8CC 4YZ1A 1EPZA 3VHRA 1DLCA 1HLCA 1R1A2 5CNAA 1W2TA 4M0HA 1ZZ7A 2Z79A 2VVDA 4RGGA 5D1IA 1RXGA 1YO8A 3LPGA 4GZ9A 5LATA 3VBRC 4ZXKA 2CGOA 1LR5A 2BFUS 5F8PA 1JODA 1YWKA 2VJXA 3KMHA 1POV3 1QEXA 1UD1A 2BOJA 3WV6A 3VDCA 3VBOA 2E26A 1VBD1 2IWGB 4Y26A 2ET7A 1UOBA 3ABZA 1YUDA 1HRI1 4NAMA 4UW3A 3VLBB 4DY5A 2JG9A 2ES3A 3LZZA 2F4LA 1H2NA 1UX7A 4JTOA 2QCSB 1UY1A 2W94A 3JQXA 2WNOA 3N7MA 5JXIA 2YHJA 4XJAA 1PIV2 4QGLA 5FZ1A 5IWFA 4CDXC 1EPWA 2F6BA 3ME2A 2BWAA 4NHYA 3ETPA 4WZCA 2R043 3MV11 4ISRA 4W65A 3NW4A 1NY71 4BCUA 5CISA 2SBAA 2WQZC 3OSDA 3SISA 3I2HA 4FAHA 3N9NA 1OF3A 2VPVA 3PHMA 3UESA 4A6OA 3T2OA 4Q5OA 2ZEXA 1VBE3 2WZR1 3U4SA 2E33A 2PN5A 5CA6A 1W6PA 5FUPA 3LSEA 4QX7A 3RVHA 5C3PA 1QNYA 2K2SA 1H2MA 2GC3A 4NRPA 1W06A 2ZMLA 4QPIB 4D7SA 1EAH1 2WNUA 4Q1RA 1VMFA 1OUXA 3D82A 4QXHA 3B00A 5AC92 1G9FA 3A7QA 5KWRA 3WUDA 2I45A 2YPDA 1SHWB 1NA1C 4JX0A 1W6QA 2R073 4XJ8A 1XOYA 2E63A 2H0VA 3VKMA 4JRAA 1RUC2 1QF3A 1PO23 2D3RA 2AREA 4OHXA 3RZKA 1H0BA 3TWIA 1WW4A 2Y6FA 4LKEA 3PL0A 4R4ZA 5KXEA 4EV0A 3SH4A 2VXJA 4RS5C 4NIGA 1LCLA 2P3YA 3BTXA 1GV9A 4QDQA 4A42A 3B3QE 4N43B 3PUQA 4RQPA 1UPSA 2QTWB 2VBPA 1BMV1 4LA3A 5B4NA 3UGGA 5FY8A 4BHPA 1YC61 2HLEA 2RS13 3HQUA 2IXLA 2QQLA 2GZWA 1YXWA 3PU8A 1CX1A 2AC1A 2UY8A 3OEBA 1REFA 4Q4V2 3OGSA 5AVAA 4HKWA 1NOVA 4XUOA 2RV9A 2V4VA 3H42B 4PQQA 1BBT3 1HB4A 1Q8QA 2W68A 2WLPA 1UKGA 2HWD1 3X29B 3DKQA 2WC2A 5L9RA 1EY2A 4GMP1 1C28A 4P14A 1MEC2 2CHHA 3GGLA 4Y20A 4HK8A 1RITA 1N3OA 3MLKA 1RMU3 1MVQA 3K4DA 2W08A 4R9AA 1XNBA 1LAJA 3WP5A 1UZWA 5HV4A 3THTA 3NMBA 4FTSA 5GZDA 4P9GA 3OBZA 1F9KA 5ISLA 3ZXGA 5L36A 1DYPA 1AR92 5FUNA 1HRV1 4QU2A 2VZ3A 4LHSA 4HVQA 4FCAA 4J25A 3S57A 3BTYA 3I54A 2VG9A 2R1BA 2ADDA 2WYSA 1NCRB 2W87A 2C9AA 2NMOA 3AXEA 1Q8SA 4Y1YA 3VBSB 4EWAA 4PI2A 3ZPYA 3ILFA 4XFAA 5FO8B 1XU2A 5LA1A 1NT0A 4MOAA 2O8QA 5F1RA 3WNNA 2LUWA 1PVC3 1SEFA 1QOTA 2Q1MA 3ZFEC 4NHLA 2BNMA 2WS91 1ENRA 4ZZ8A 3ZN5A 1TNRA 1NCQA 3R6SA 5FZOA 3AFKA 1LOGA 4N43C 4FP3A 1VRBA 4RR3A 1PGW1 1CVNA 1S0EA 1FMD2 1NAEA 2IVIB 4BH9A 1LECA 1MQTC 1QJU1 1W8WA 1V6KA 3ZMOA 5A3UA 3AZXA 5DUWA 4CP0A 1CGPA 2BPA2 2BTVC 1DQ4A 2BV4A 2RS32 4MX3A 3ZXJA 1X7NA 2WQ8A 3ACGA 2C26A 4RR3C 2MEV1 4NPRA 4BE3A 4AGVA 2ZGOA 2A71A 1OOPC 1OA2A 1OF4A 1RUG1 3H3ZA 3J8F3 2XB6C 4IDZA 5I0SA 1UZZA 1WLCA 2CGNA 4DUVA 1W99A 1ENQA 4Z2AA 4LBNA 4LO5B 4LO7A 1UYPA 5FK7A 3UV9A 1LEMA 1RUD1 2A7AA 1ULDA 2VZRA 3AKSA 3QD6A 4ORFA 4OHZA 3UKTA 3VZLA 4AXOA 2ZGPA 1G9CA 1DYKA 1LU1A 2UWBA 2TEPA 3WY6A 4P5YA 2D7FA 4OYUA 4S2DA 4IEVA 3IKWA 4PLNA 1J83A 1L7RA 3LD8A 4XURA 4D3WA 2JDKA 2DURA 1A34A 2W46A 3MPPG 3WNXA 4XVHA 1H6YA 3WNPA 5HCAA 2R042 1LNSA 4KWJA 4UW6A 2IXJA 3K4AA 1RYYA 2KXLA 4OI1A 5JOWA 3VBRB 2JDUA 3NNLA 5GLUA 1OVSA 1AR83 1PO22 4BLIA 1SLBA 4IEUA 4UFIA 1VRH2 2WYFA 2HH9A 3CHXA 3CZJA 3EB7A 4HFSA 3BPSA 5A1LA 2AACA 1QXRA 1PGSA 3THCA 1MZ6A 1S2EA 4Z8BA 1JTZX 4AYUA 1KS5A 1OC1A 2N7GA 5LRRA 3M3OA 3HNMA 4QGNA 3KHBA 4LK6A 1DGWA 1O7FA 1AYN1 1DYOA 4Y1VA 4EN8B 1CWPA 2ZGSA 1QJEA 3WQ7A 1RUI3 5A6QA 2XBO1 2C24A 3MUY1 5FYTA 1JZ6A 2ZABA 5LY2A 4CP9B 1QOSA 1K12A 4NR1A 4B3NA 5A3NA 4XUQA 1WMFA 3RQ0A 2ZTNA 1XPWA 1VMHA 3RWKX 5J96B 2ORZA 1APNA 1OLMA 3JXSA 4WV8A 2Y33A 1ULEA 4C1XA 1YRZA 4CU6A 2DTWA 2RS11 3K75B 1SQ4A 4KH9A 4L99A 5L9BA 3ZOIA 4D7YA 3OOXA 1X33A 1N1YA 4KI5M 2EF6A 4P00B 1PO11 5GZEA 5JZGB 1DQ1A 1Z0HA 5K0UA 1H8TB 3O0XA 1Q5OA 1LHOA 2W92A 2O8OA 4HVRA 3WDYA 4DB5A 2HWB3 3FHAA 3H8OA 2WRAA 5JXJA 4LKFA 3B02A 5FZEA 1EP0A 1AR93 1O4ZA 4OULA 3FLTA 5FYBA 5FV3A 4AI0A 3RZJA 2WIIB 1G6NA 1CZTA 2YPJA 3Q8CA 1HQWA 1SMVA 3DYMA 1Y4WA 2IVJA 1QNWA 5LASA 1LRHA 5FLIA 4M3CA 4JDMA 4MGZE 1T6GC 3HN1A 4NUBA 1DLLA 1O6UA 4HETA 1MZEA 2JIJA 1AR62 2ILMA 3E6CC 4LLOA 1O3QA 2YGLA 3NJYA 4XMAA 3VBUC 1XE7A 4E2GA 3IM0A 1S2KA 2VNVA 4P5HA 3T09A 5IK4A 4AHXA 5FOJB 2WL1A 5BXXA 1NX9A 1CD3G 3LIGA 5FYIA 3NKGA 2BOIA 3T0AA 1O3SA 3ZFGC 3S7IA 4LO4B 1KXGA 2DCKA 2KD7A 2PAEA 4JTNA 2BNOA 2NM1A 2TUNA 4UFJA 2R062 5LBFA 1KQRA 1UMIA 2Q4SA 3BU7A 4KWLA 4R9CA 2J7MA 5DMYA 3FC0A 1ZX5A 5IK5A 3PU3A 4QQLA 2EXIA 3WNLA 1WMXA 2WO3A 1E5IA 2Q8EA 5D8AC 5F5IA 4XAAA 3IPVA 1JOPA 3SKVA 4A3XA 1S0GA 3BYWA 5E1RA 4AFAA 4ATEA 4X8NA 5A7WA 5FZIA 5FZMA 4ZXEA 2LM3A 3CJIA 2QQUA 3ORJA 1GP5A 4FPFA 1N1SA 3PLQA 3EJKA 5F5CA 3VD3A 3OD4A 4GH4A 2OPKA 5FDBA 3A22A 4HBNA 4RS5A 4AVVA 2DWRA 3GBWA 4O7XA 1V6NA 2QQVA 3QACA 3N35A 5A3LA 4I2OA 3KF5A 1CAXB 4UFMA 1TZOA 2JJ6A 4OHVA 4QDSA 3VGIA 3DYPA 2VBBA 2C9KA 4R8HA 1UOGA 4LHKA 4B7KA 5FOBB 5I91A 1RXFA 4LBJA 1HV0A 4FQZA 4UFLA 3DUIA 3FL7A 4K6BA 5IYYA 1QDCA 3TEWA 1GFF2 3MDPA 3ZSLA 2P3JA 3VZNA 4AEDA 4HN1A 1ZBA3 1JUHA 4EE2A 3SLIA 3ZFEB 4H7MA 1AYM1 3GZEA 3O5SA 2KA3A 3M2MA 1YIFA 3W21A 4NHMA 3WNOA 3AM2A 2E7TA 4NROA 4EYUA 4E2QA 3ACLA 2VC9A 3TNQA 5CEHA 5LZ6A 3MIBA 2JENA 4BMEA 3KM5A 1D4M2 4GQ7A 4JKKA 4D8MA 2ENRA 5C8CA 4Q0SA 1MQTB 2YBPA 1D2QA 3HVDA 2DVGA 4OUMA 2J1AA 4PDWC 4HMZA 1EV12 3M8LA 3OTFA 2CWMA 4KBZA 4XF3A 2YU1A 4AI1A 4B29A 2ZZQA 3Q8EA 1K5MC 3NL1A 3T2QA 3T4HB 5EV7A 1W0PA 5EJZB 1GOHA 2R071 2VECA 3B9CA 4Y33A 5LRSA 3OEAA 3UGFA 3RMXA 3WW2A 3ST7A 5BV6A 3ZVXA 4D94A 2IFWA 2P4EA 4Y1UA 2B45X 3PNAA 4L0PA 5LA9A 4OQ8A 5FJKA 3WXPA 1XBFA 2PQSA 5AFEA 2DVDA 3ZO0B 4GKYA 4CEYA 3OPTA 4I0BA 4ZU4A 5FZ7A 1BBT1 1XE0A 2YBSA 3PTYA 1COV2 2ZPXA 5GZCA 1AVBA 1QOOA 3MFCA 1C8M1 3HT2A 1RUJ1 4CCEA 1ZZCA 3J7HA 4XBQA 4TYSA 3H8XA 2A5ZA 1W9SA 4XF9A 1GOFA 1TQ5A 4QX8A 3WEZA 5FWJA 2BW8A 1V0AA 3POSA 4COYA 4XW3A 2HBTA 4K40A 3KLSA 2RHPA 3KCYA 4DFSA 1GP4A 5BNPC 5JXGA 1H9WA 1UO9A 3K77A 2UY9A 3E5XA 4Y1ZA 1AR63 2C1FA 4G9SB 3FX3A 2R32A 4HZFA 2XWBB 4MHUA 4QU1A 1OHFA 4AAXA 3I7DA 3WOGA 5BPXA 1RC6A 1SG3A 2VTXJ 2YDEA 4PLOA 5C33A 4R9BA 1JH5A 5J37A 2RG4A 3TOJA 4L2NA 2HWE2 4Q0UA 2ZHMA 5FMOL 3HQRA 1BVP1 2Q1FA 4FPHA 2XQXA 4XDPA 1GZWA 3KD4A 2E32A 1PVC1 2J1SA 5C70A 1CZVA 1BLZA 1U5ZA 1RJ7A 1W90A 4FOYA 5A3TA 1TMF3 2RS51 3I2KA 3ZIXA 4D6RA 3MIHA 2QQKA 3PJYA 1OOPB 3O12A 4ES8A 4BK4A 1W2NA 1HRI2 4JGZA 1URXA 1NQDA 2WN3A 3C7EA 3CMGA 2XMLA 1LU2A 4KBBA 5DAXA 1QQP2 5E88A 4RQPC 3PUHA 4ZS3A 3HNBM 2VGDA 1SBDA 2W91A 2RE9A 3H1WA 3T0BA 4AVTA 4AZZA 4N53A 4YVSA 2RM21 5T3NA 5IAXA 3LSDA 4RD7A 4BQ5A 3U11A 2WKKA 5DUVA 3DXTA 3W58A 2JWPA 2HYXA 3ZYRA 5HXMA 3FE5A 5DDJ2 5FZGA 4CDWC 5BNQA 2C0ZA 1ASJ2 2ZGQA 4GULA 4G3YC 1CAUB 4ZU7A 1ZRIA 4K3UA 3OPZA 1FNYA 1QJFA 3AYCA 4MADA 1C8NA 1S0IA 4CDWB 3VUOA 4KQ7A 3POGA 4AI8A 1U0AA 2UYAA 1DQ6A 2Y8KA 3AYDA 1OLQA 2JDMA 3R4SA 1V00A 5C3QA 4QM9A 1RUD3 1J3QA 4P08A 1RUE1 1IPSA 1ODMA 1UX6A 1WCDJ 2QQNA 2QZ3A 3ILNA 3IT8A 3N7LA 3T4VA 3RI9A 2YV8A 3AP7A 2E9QA 3JD73 1DGRA 2A3YA 5FY5A 4XFGA 4HKOA 2MEV3 1TME3 2X8KA 3IDEA 5JZGC 1SACA 4RGAA 1UAIA 5JPMB 5FPVA 2VE1A 4XHBA 4IV3B 2DF7A 3RGBA 5EPAA 3MHZA 4MXWB 1GZCA 1VE0A 3K3OA 4IV1C 1RUC1 4Q0QA 1WUVA 4QDRA 2D6PA 2ZX1A 1UYXA 1XE8A 2XUEA 1UZYA 3ELNA 4WM8C 4RL7A 3USUB 5FWEA 4XFIA 4A45A 3LFMA 4QWNA 4UOJA 4BOWA 2BVVA 4XBLA 3MF6A 3HJRA 5FPBA 3ILRA 1ALYA 3WT3A 2R063 1EUUA 1SFYA 3VBFA 2B42B 3ZYHA 4H3WA 2WAAA 3WF1A 4EN7B 2PTMA 4EWDA 3O1OA 1R091 1KD7A 4GB32 2Y6GA 2C4XA 5C3RA 3V64A 5FYYA 4M4PA 3OD0A 1SCSA 3VKOA 4Y1XA 4FPKA 4A7YA 4WM8A 1UU5A 3KCCA 3A23A 1SFNA 4BMBA 4COVA 1IGOA 4Q4V1 4QKFA 1WLDA 3POIA 1QH6A 2RR11 1W05A 2WBKA 3OY8A 4Z2WA 3PMSA 2YB7A 5L7OA 2EIBA 5KHIA 3VDDB 5CBLA 1W8OA 3WF2A 3J7MA 4NPMA 5FXXA 1DZQA 2J1RA 1NUKA 2DTYA 2AR6A 2WUHA 3AK0A 4P9LA 3WDWA 5E89A 2BJSA 4LIUA 1YJKA 4I3GA 1HXS3 3ZYPA 4N53C 4QB2A 4YVSC 1U12A 4G4FA 4N7IA 1ZBA2 3GZUC 2MPFA 5JIUA 3I59A 1Y9QA 5A80A 3WR0A 1ZBE3 2WAOA 3RYKA 1OLME 4ZPIA 3M4FA 1EYBA 4DIQA 1ZRFA 1S4CA 2BYVE 3LDBA 5FBJA 1LHNA 2R7EB 1ST8A 4FP2A 5A1FA 5JR2A 5A3MA 5KC6A 4Q4Y2 4CXYA 5FZKA 2AGSA 2HWE3 3VB9A 5T5PA 1FV3A 1BCXA 2ZMKA 3AMHA 2JXAA 4YM0A 5C5UA 2XXZA 4IERA 3W5MA 2DCJA 2I74A 4IE6A 1CN1A 2GN7A 4LPLA 1W28A 4SBVA 2AEYA 2JG8B 2YY1A 3MGUA 2X5IA 4AQSA 2VOVA 2DFBA 3FJSA 3MIGA 4E4HA 2RMU3 1R1A3 5JI7A 3NNFA 2BZDA 4EWEA 5I8SA 4XDOA 1XYPA 4W6XA 5FZ9A 3JBG1 1FMD1 3AX4A 4DS0A 1LOEA 1W8ZA 3O1PA 3ZSJA 1RVF3 4XTPA 1AX0A 1CIWA 2DDUA 1XJAA 5DZEA 2RS31 2ZX4A 1WGPA 4CUBA 4DQAA 2D5FA 3JB8A 1GYKA 1DGWX 1QGLA 1IG0A 2P34A 2CSGA 1UY0A 2GMEA 3CKHA 4Q27A 5FCCA 4D69A 1X9TA 2BGCA 2EIEA 4CVUA 1VBA1 1LULA 2ZHLA 3AZVA 1VBD3 4PDWA 1H8TC 1RUD2 4WBBA 1AUYA 5ERLA 1GQGA 1QY4A 1LOAA 3ZSKA 2JDYA 3DECA 4JHZA 4NHKA 2WLQA 4AF9A 2XJUA 3MZHA 1DF0A 1X82A 4BDVB 2ARBA 4HPKA 4Y3OA 1LGNA 4IEXA 2ZX2A 4RHV1 4LQRA 4FPEA 1DHKB 1ND2B 4GAZA 4Q4W1 2R041 4HVOA 2YYOA 4YGEA 1LB2A 1PNGA 4PF1A 5JOXA 4DNYA 3VL8A 2WFF2 4CRQA 4RN5A 3O1RA 5FY7A 3SNMA 4ASMB 3GYDA 5AC93 2FDIA 1A78A 5BNPB 2BQPA 4XXAA 2KM2A 2PA7A 3MBWA 1H8VA 1STMA 1TMF2 5KXCA 1POV1 3L2HA 2OKXA 5DAWA 1FPN2 2NN8A 1I1EA 1GQPA 2VL4A 2OUJA 3LAGA 4Y5TA 3ACIA 1FX5A 1EAH3 2VVEA 2ZAAA 4XJ9A 1QJY2 5FP7A 4OZOA 4AEJA 4GB33 4GH4C 3I2OA 3GALA 1K45A 5LA2A 1WD4A 1GANA 3R0RA 2XBO2 4Z1VA 3DL3A 4A4AA 2I07B 3VBOB 3KSCA 5FLHA 3S30A 4GH4B 4UYBA 4AGRA 1GWLA 2JDHA 3QOPA 4RS5B 2G1MA 3KVBA 1XNDA 2OZJA 1V6JA 2V4AA 1ASJ3 4IGOA 1OI6A 1MS4A 2DUOA 1JBCA 1JYTA 5FXZA 1NKGA 3UL2A 1BZWA 4JGYB 1FNZA 2RS12 1HJGA 2RDSA 4QHZA 2J1TA 1LHUA 4M4RA 5FXVA 2OPWA 4GD4A 3UK9A 2PHTA 1KDKA 5FR3A 1PO12 2PMWB 3AKTA 3PDQA 3SCGA 5CAZA 2VUCA 1W6MB 2GN3A 2FCTA 3LOIA 4JGZC 1D0HA 3FBMA 5ACA1 1SCRA 3T30A 3I2FA 3UNPA 5EFUA 4LIVA 1UCXA 5I0UA 5CG9A 1RMU2 2WSVA 4LKDA 2XKPA 3I2DA 5GALA 4QPIA 5JI9A 1DDLA 3EYPA 5C9AB 1PK6C 2W95A 2XL7A 5D21A 1SLCA 1IPJA 2CDOA 1RGSA 5FMBA 1NQJA 5EXOA 1HDKA 4PHZA 1RUF1 4XILA 4XFCA 5DPNA 4Q29A 5G05L 5CFCB 1NXMA 3RZGA 1UOFA 5K8SA 4CP2A 5K9YA 2Y64A 4GXLA 4IESA 5JLVA 1U5YA 2RDRA 2V5DA 4JCKA 3I3MA 1TEIA 1GZ9A 1AR82 2QJVA 3KT1A 4E8DA 3S0MA 4DEQA 2ZACA 1W6NA 1CAWA 1XNCA 3J7NA 1YLLA 4CCOA 5FPLA 3WP3A 3ZN6B 1XRUA 4CEYB 3H9AA 2W1UA 2UWAA 4AI9A 4CCCA 3BU0A 1S0DA 4X8PA 1SZBA 3RYPA 2DCTA 5H9PA 3VDDC 1DQ5A 1H6XA 5E6HA 1J3PA 2LTNA 2RMU1 2VW0A 3P1IA 4AEMA 2HKXA 1O4TA 2EIGA 5ABJC 3D0SA 1F31A 1MS9A 1VAMA 1I3HA 2IXIA 3OUHA 3VBUB 3FHIB 3N9LA 1BK1A 1US2A 1JYNA 5JSPA 2A6WA 4LBKA 4XXPA 2ZKLA 4BQXA 5FZBA 1FOD1 1RUH2 1YI7A 2VMIA 5FMCA 4NIAA 1J84A 4XTMA 2QDNA 2RS33 1SDDB 2DYCA 2JDNA 4YW1A 3UT0A 4SLIA 1BJQA 2DUPA 5GLZA 1YQ2A 3U75A 2DV9A 3K46A 2DCYA 1HX6A 4BQWA 4CDUC 2VQAA 3EMRA 3R05A 4AOCA 4HN0A 2WT1A 4BQ3A 2WWJA 2BNNA 1LENA 2OVUA 1RHI1 1RUE3 1W6PB 1P8JA 1W2AX 1OFNA 4XDQA 5DUUA 4CE8A 5C3SA 1Z7S3 1QU0A 1VBC3 2B5HA 2VUDA 2WNUB 2WS93 2QQMA 3CNAA 3J26N 3LWCA 4CTEA 4QHOA 4XE9A 1GNHA 2HWB2 4Z92B 3F95A 3IDCB 2QNKA 4ZU5A 1ZA4A 1PGL1 3B9IA 3KQRA 4IEOA 4LULA 5LY1A 4CDXA 4YARA 1FPN3 3NKTA 4ARXA 1HW5A 3F2ZA 1ZZ9A 3GHMA 1S2BA 1MS5A 1UKRA 1VB2A 3AXDA 1MZ5A 1NCRC 3VBSC 3UKVA 4K1YA 3UGHA 2AZ5A 1G9DA 4LBLA 2RJKA 4IEZA 4IGPA 4P02B 4PBPA 5FQ0A 3VBHB 3DKWA 2RDQA 1TME1 4YZ4A 3CQOA 4CU7A 4COZA 2GP5A 4QHBA 2HEWF 4Y22A 3THDA 4P9XA 4DUWA 5J1XA 3H50A 4YRDA 3TB0A 3VZKA 1QJX2 1K5MA 3THPA 5FO7B 1VAKA 1AYM3 3WUCA 2TNFA 5LBBA 3O0WA 2VZPA 3NNGA 1CZSA 3IIIA 1VBD2 3H7JA 2EXJA 5FZ8A 5HCFA 2DU1A 3S5QA 4YVWA 4N9IA 1BEV3 4O61A 1COV1 4FOWA 4KG8A 2XKOA 4LE4A 2P3IA 2WABA 1GOGA 3PMEA 3WDXA 1RUJ2 1XNKA 1ND3B 4FT8A 1GICA 4IQPA 1SLLA 2GNDA 1PIV1 4BK5A 2J1VA 1UOJA 1KITA 3HOBA 4MGIE 1F2NA 2VCBA 1ZZ8A 2Z4FA 1C4RA 2YC0A 2PHWA 1NY72 4WM7B 2FZ2A 5C5TA 2SLIA 3RJRA 1N1VA 1NA1B 1Z78A 4EROA 5T50A 2ID4A 4CP1A 3J7LA 3RFRA 2BP6A 5FIXA 3POJA 4JDNA 2GNTA 2QDRA 1MEC3 1PM7A 2ZGLA 3GCXA 1RL3A 1RUI1 4OMDA 4BWOA 2JG9B 2OT7A 1H1IA 1PO13 1W2OA 2GMPA 2VM9A 3PJQA 1KRIA 2ZGUA 3DPRC 5F9TA 5HCHA 5A33A 1PHMA 2NQYA 1S0FA 1YQ6A 1EAH2 1NLQA 1GQHA 5A6YA 1V9U2 1F8VA 3JUUA 1HN0A 3V0BA 5GKAC 3U10A 1W0OA 1SDWA 2ARXA 2VU9A 1Y9MA 3MW3A 4JHTA 4MGYE 4AFDA 4BPZA 5AFBA 1WCSA 1D4M3 5L7OB 2G9ZA 2OQ7A 2ZA9A 3C8XA 3P5BA 1AJOA 3VDDA 4OI0A 5SV5A 5JXHA 2HWC3 4MXVA 4AQ2A 3LEGA 2GMMA 1RINA 2XG3A 1S0BA 2JE8A 2WO7A 5C4WC 2WJSA 2NZ9A 2XL9A 3FWEA 5DDJ1 4D7TA 5FRAA 1Y9GA 4TZDA 2ZGNA 4FOQA 2DBNA 3PIJA 4YFZA 1XSQA 3DPRB 2VZQA 4CUAA 4F3JA 5LB6A 1GU3A 1YI9A 5K0UC 2PELA 1YFYA 1IKQA 2P6HA 3FHQA 3SQOA 2Q1ZB 2VOTA 4FO9A 5T5OA 4CU8A 1X50A 4JKMA 3U14A 4ZY9A 1C1LA 3WHUA 3AL5A 3GNEA 5IJRA 1OVPA 3WQBA 4GKXA 4AL9A 5K0UB 3PVEA 3GXUA 1AL22 4X6QB 4AQTA 3WP4A 4NWWA 2H6CA 3WF0A 3OUJA 2A6XA 3LCPA 2Y34A 5A32B 1DQ2A 2FHRA 4LUMA 1NXD1 4FVVA 2HBUA 5FPAA 1JS9A 4OZXA 4R52A 3IB3A 3Q8FA 3ZSMA 5I0DA 1BHGA 5A6XA 5F2SA 1CAVB 4H7LA 1W8NA 3N7JA 4Q8LA 4AFMA 2JG9C 1JZ4A 5E8AA 3I97A 5ANNA 1Q3EA 1QHDA 1NCRA 2QQOA 2VZOA 1BVVA 2W47A 4JVAA 3VBSA 1OQ1A 3WDTA 2VCCA 4ITCA 3HWJA 1CIYA 2JKBA 1JI6A 2I2SA 3V0AB 4DZGA 2ZMNA 1JUIA 1R092 2P1BA 4GB31 4OFGA 3S6PA 2F4PA 1H9PA 3LE0A 3A0KA 4NN0A 3ZR6A 3HQXA 2W1WA 4KU7A 3NO8A 1W3XA 1OQDA 4GWNA 4U2AA 3HBZA 3FFZA 4YW6A 4PDWB 2UWCA 5F3CA 5FZ4A 4U36A 4ISQA 5LBCA 3J9SA 4XJUA 3MF9A 2R49A 3D6EA 1RUH3 4YW3A 1CR7A 2X09A 1OH4A 2WNVA 4PQ9A 2R0HA 1V6MA 1AX2A 4PLMA 2A75A 3PUAA 1PGW2 3M70A 3WLUA 1YQ5A 4W4ZA 1QJU2 2AH2A 5HXVA 3UETA 4F8AA 3VZMA 2Y0OA 1LGCA 2ADEA 1PZ8A 5ABJB 4YM2A 5JOZA 3NV1A 3GBGA 4MZUA 4FPYA 1S0CA 3NAPB 5SV8A 1H8TA 2QQWA 3KWVA 1ZBA1 1VBC2 3M1HA 2YUEA 4P9IA 2WQ4A 4Y4YA 1Y3TA 1RUG2 1W6OA 2DU0A 2OZ6A 4IV1A 4B1LA 4FXKB 4OI4A 5HBAA 2VW2A 2IZWA 3N9OA 1JW6A 1VJ2A 2OUHA 1TNFA 1IS5A 3U78A 1KJLA 1JOBA 3H1MA 4RQPB 3SC7X 2EXKA 3E5QA 1WBFA 1Q8PA 3WQ1A 3N9QA 2WR9A 3AYEA 1RUJ3 3CZUA 4AVCA 1DFQA 3I8TA 3ZFGA 1V9U3 3L9JT 4NO4A 5CIRA 2A1XA 5IFTA 1HQNA 4YW4A 4QKDA 1WBLA 3ENRA 5ACA3 2VXRA 4N7UA 4AEKA 2VY0A 4ZONA 3EHKA 1V6LA 4QPGB 4ATFA 2P6CA 1IS4A 1PO21 3ETQA 2DFCA 3ZKUA 1W2UA 2QQJA 3O7OA 2TBVA 3H7YA 1XB9A 1VBB2 2V09A 3JBG2 4DO0A 1J59A 2WA3A 2XR4A 2QE3A 3CIHA 1UWWA 2VUJA 2ZHKA 3VKNA 1ND3C 4V2VA 4YZ3A 2O0OA 3IN9A 1C1FA 4TWTA 4LHLA 3KV5A 2W2IA 3DF0A 1BEV2 4OVEA 2Y6HA 2XLAA 3VHNA 4YFWA 1N3PA 4R9DA 3JB4C 3ZFFB 1ZZ6A 2VZUA 1J1LA 1VBA2 2RS53 3P6BA 5KXDA 5A3OA 3D0JA 4LNVA 4NJ4A 3SEPA 3LDKA 3TN91 5F7UA 3IDBB 1B09A 1AR72 1GUIA 2D3SA 4UF0B 1H4GA 3BIWE 3M7AA 5DDJ3 4E27A 5C9AA 4H55A 2Y26A 4ES9A 3B93A 3HR9A 5FZAA 2ZS6B 2EAKA 2QKDA 1JN2P 2BEOA 1WW7A 3WG1A 1OKOA 5FY9A 1MS8A 4GMP3 2XLGA 1HB1A 3QH7A 5FBZA 5A7OA 4XUTA 3BKZA 3MLLA 3O1TA 1B35A 2VNOA 3MYXA 1E5RA 1RVF1 3OG2A 5KHHA 1J3RA 4RFT0 4LA2A 4EN9B 3BALA 4RSUA 2X10A 2IXCA 4D6SA 1UYYA 1US3A 3NSTA 1GZTA 3JD72 3ZYGA 5FP4A 5KXBA 3OGRA 1ZVFA 2VD7A 1N1TA 3J8F2 4IE0A 1ZBE2 2Y0IA 3EQEA 4BXSV 3OB8A 1TMF1 2VOKA 2AEZA 5DG2A 3ZMNA 1OMIA 3LEMA 4K9SA 1GWKA 1W39A 2CY6A 4YG6A 3MICA 2ORXA 2PLV3 2GNMA 2GNBA 4L8QA 1SLIA 5IFPA 1A6CA 4FSJA 1IKPA 2LROA 4UW5A 2LW8A 4LO6B 4RFRB 2WO1A 5A70A 3HPNA 4DRVA 3R4DB 3VD5A 1AJKA 1OOPA 5CKQA 4CSWA 1HN1A 1ND2C 3B01A 2VAUA 2ZOEB 4O9GA 3BN6A 4GMP0 4NIHA 1UXZA 3CDZB 3NV3A 4OMCA 4S2FA 2YFUA 2WZPP 1LKNA 1MS3A 5FYZA 2K46A 2D6OX 2YU2A 1OKQA 5L7OC 2QQPA 3OBTA 1YYNA 1LOCA 1ODNA 3BPZA 2BGPA 3HNYM 4NOTA 1RIRA 2R061 3LQCA 5J7MA 1ZA7A 1F35A 2XUMA 2Y6JA 1SLAA 3AL6A 1C57A 3APBA 5FZ0A 3RRDA 2Z42A 5IVVA 4TLFA 1G9AA 4OUSA 4UAPA 2G4IA 1Q8OA 4FFIA 4DOUA 1K42A 1VBE1 1H1MA 4EN0A 1IQDC 1I5PA 2JG8C 1DU3D 4IL7A 1QXJA 3IIAA 4LEJA 4C0HA 3MPBA 2EXHA 4P9JA 5D8AB 1L7LA 1ULCA 2UURA 4KG0A 4AE2A 1YFXA 3BTAA 2DVAA 2ZGRA 3CF6E 5BUVA 5IVEA 4Z82A 3NWKA 1JMUB 1IPKA 3I2GA 2RDNA 4HONA 3KCXA 5CKNA 1GBGA 4GWMA 3AVRA 4A7KA 4BA6A 2WO2A 3I49A 1K3IA 1ZREA 1ACCA 1SPPA 1OLRA 1XXNA 2B7YA 4YGBA 1PMJX 3KZ4C 3AVSA 3PUSA 2BRTA 2XJPA 1GNYA 3PURA 5J48A 2BU9A 1O91A 2VMDA 2XDVA 4B1MA 2Y60A 1W3VA 3BIEA 4Q4V3 4N90A 3JZVA 4YPJA 2WFF3 3RYRA 1O8SA 3U37A 1WA6X 3IMMA 3H8RA 3CJIB 1FXZA 4LBQD 1X8MA 4I02A 4CCLA 1WLTA 4AI2A 2WA4A 3CJXA 5CVRA 1PNFA 4MHRA 5CFDB 1UL9A 3U0ZA 1M06G 2Y6KA 4XF1A 3GF6A 1Q8VA 2XHKA 1D4M1 1OXCA 4CDQB 3WHTA 5FMDA 2RR13 1W9YA 1AL0G 1KEXA 1R1ZA 1VALA 2BUKA 1OT5A 4UWDA 2O1QA 3D4KA 4XAEA 3ZR5A 2OQ6A 3GJAA 4N53B 4YVSB 1JXNA 1VLNA 3T3YA 1H2KA 2L9LA 4QAWA 2D44A 4K8RB 1PZ9A 4YNIA 4BB3A 3MIFA 3WG4A 2OYZA 5DQ0A 1AXYA 3ZX7A 5FZHA 1W8FA 2K9ZA 2R072 2WZ8A 5FZOB 1OBNA 2W52A 1OFSA 2Q30A 4XQWA 1G8WA 1PVXA 5JCTA 2C6SA 2D5HA 5HPOA 2Q5TA 4MGQA 3T0DA 2PHXA 4MYEA 1RHI2 1WWYA 2B9UA 4EZHA 2HWC1 5JMCA 2FCUA 2ZX3A 5EQUA 3UJQA 2ZBJA 4CDUA 2B46X 4GWJA 3UJOA 5LW9A 3VZOA 1WCKA 3LFIA 3N3HA 4GWIA 1VIWB 4HOOA 1C8M2 4XMIA 1JZ8A 1IOAA 1R1A1 4XCBA 1VP6A 3HD8B 5F2WA 4ZZ5A 3GZAA 2D3PA 3AP4A 3NJXA 1WMDA 2G9GA 3C7FA 3TBDA 2CGPA 4IV3A 1I9RA 2Z2SB 3OPWA 4TN7A 4TTGA 2BWCA 4CPBA 2BBVA 5F32A 3ES4A 4JQTA 1ZRCA 2B8MA 1XU1A 4E8CA 2A6VA 5FMOS 2WZEA 2ZEZA 3WVJA 4WVVA 1VBB3 3Q9OA 4A2UA 3QH6A 2YC2A 1LOFC 2DCZA 3MV01 4B4PA 2FMYA 2A3XA 2PHUA 3G6JB 4IE5A 4LBQB 1RUOA 4WVWA 2D6MA 3E1F1 2FDKA 4YM3A 5BNNC 1A3KA 3CU7A 2HEYF 3GCWA 3T1MA 4AGGA 1F5FA 3MW4A 3LKJA 4QQOA 1SLTA 4OHWA 4BYYA 1QJX1 5JMOA 3SHRA 3KT7A 4HXCA 4FFHA 2Z5WA 3ZSEA 1VBA3 2OX0A 2RS52 3GM8A 5BNNA 4B4QA 4W50A 2HWF1 3O1SA 1S1AA 5IHRA 2CL2A 2PAMA 5F6LB 4L9BA 5EYYA 1FT9A 5DAVA 2EAAA 2BBAA 3AZWA 1KGYA 3BCWA 5FYCA 1VPHA 3WCRA 1XYNA 3KGZA 3N9PA 3DV8A 5A3WA 3ZN6A 4W6WA 4DXTA 2JIGA 5AC91 5EYXA 5F3IA 2GP3A 4NPLA 1VRH3 1MPXA 3URFA 5TSWA 3RZMA 5C4WB 1ASJ1 1IQAA 2EICA 4LKSA 4XIKA 5FPZA 4YZ5A 3J4UH 4NWVA 2FMDA 5IAVA 4X6RB 4EN6B 3KQ4B 1LTEA 2XHNA 3M3CA 1JZ7A 4QPWA 1HIXA 2JE9A 1YJLA 4AVAA 4AW7A 1RUI2 3POWA 3OF1A 4NVPA 2K0GA 1RUE2 5KHGA 1FV2A 2BERA 3VDBA 4XBNA 2PLV2 4URAA 1UU4A 2CYFA 4DPNA 2H0BA 2QUOA 1QJZA 3D8CA 4TSVA 1V9U1 3W20A 2D6LX 2OIIA 4XZPA 3K2OA 3ZXKA 1PIV3 5J98B 2QQIA 3N9MA 4PT6A 4FFGA 4CCDA 5FO9B 2V5YA 4IEQA 4M3CB 5JWPA 1TE1B 1WCUA 2VULA 1GSLA 3I2IA 4PIYA 2VOXA 3I3BA 3N36A 4J1WA 4UXAA 3WF3A 5IVFA 1OA3A 2J42A 2D97A 1QXPA 2VUAA 3HEIA 4JV4A 1V6OA 2CWSA 5F5AA 3SH3A 1UN1A 2V73A 3RSJA 5T55A 2JX9A 4ZS2A 2HWD2 3NVCA 3I3EA 2GC1A 2VMHA 2XLFA 3W9AA 1U5XA 3EXUA 1MEC1 5LK7B 3W5NA 4MH0E 2XJRA 5L19A 3VN4A 1JHJA 2WDBA 1OD5A 5HCBA 4PCRA 1MVEA 1T6BX 2JKXA 3ZYIB 3AMQA 4O9EA 4I3PA 5FKBA 4COUA 5J3UA 1I6XA 1UPIA 3SXWA 3TEXA 5E16A 1LJ7A 2QBXA 1O3RA 3H3LA 4YW7A 5GZGA 4QX1A 1POQA 3P3NA 4XZUG 2GDFA 3MIEA 1OD3A 1WA4A 3ZFEA 5A7QA 1IZ3A 1AR91 4K21A 3IPVB 2W1QA 2ZEWA 5DZGA 4EQVA 3RPQA 5EJ1B 2RR12 5JSOA 1G9BA 1AL21 3LEKA 3O1UA 3T2PA 3A0NA 1F4AA 4C90A 1C8M3 3ZYFA 4XETA 4FTBA 2IXKA 2XJVA 4CZSA 1RUF3 2WNEA 3PVNA 4KNCA 4QGMA 2CU5A 3VBFB 4B8EA 5JDBA 3NRUA 4ASLA 4QQHA 5KBFA 1VMJA 2EA7A 4QKBA 1CAXA 3IAPA 5DUXA 3UKNA 2WS92 4KMQA 2Y38A 3JQWA 2W0XA 4QB1A 4C1WA 1NYWA 3T08A 4AEDC 3ES1A 2IXHA 4OLLA 3IMNA 4WVZA 4XABA 3V56A 3WNMA 5DAPA 2ZJCA 3OBRA 4YLZA 3BOPA 4YSFA 4AVBA 1ZRRA 2BVBA 1PX3A 1ENXA 3AJYA 4M3CE 4BXFA 4CDQC 1R082 3ECQA 3VHOA 1HQLA 2R1DA 2X53S 4NRMA 5FTTC 2A6ZA 2VO5A 3PIGA 4JAAA 1O4YA 4Q4Y1 2GU9A 1DGLA 2NMNA 5GJ6A 4XFFA 4CEWC 3C3VA 3ZXLA 4MGTA 1LESA 1GNZA 2PYTA 2XQRA 3B5LB 1PMIA 4J1XA 5A7PA 5JAXA 4E4DX 5K4LA 2XJSA 4FPCA 4YG3A 3CJIC 4M3CF 5A1AA 5IVBA 3NV4A 4FBFA 5EHDA 3FLPA 5EJ3A 1FOD3 4QD2A 4DY3A 5C8WA 1GLHA 1KFUL 1LOBA 2UYBA 4QX0A 1BQPA 4L92A 2PFWA 4LR4A 4XUNA 2ATFA 1CJDA 2F17A 1Z7S1 2VTXA 3WW4A 2VW1A 2XONA 3VKFC 2AUYA 4MVTA 2ZX0A 1XSRA 4CUCA 2RVAA 4IXLA 1RHI3 3K4ZA 4EZ4A 4J6GA 3AP6A 5F3EA 5BNOC 4BISA 2P17A 1BYHA 1O3TA 1VBC1 1C5HA 1CESA 4CEWB 4N8MA 4Q1PA 3ZLIA 2D6KA 2JECA 4K7JA 4KGQA 4JDOA 4WZFA 2JG8A 3KV6A 1UY4A 4RA0A 4BM8A 5BY5A 2X5IB 3WG2A 4DEVA 3OGJA 4CCKA 4LJHA 5BNOA 1VRH1 2LRPA 4JGYC 3SMHA 5CZKA 1UIJA 1B35C 1CPMA 2FZ1A 3VBHC 3IAQA 3RNSA 3DPRA 1W6QB 2WNUC 1N47A 2FDFA 4LORA 3RMYA 1RTVA 4AFCA 4N9HA 2QZ2A 5FUIA 3KHCA 4QXKA 4XJZA 4CPBD 5F3GA 4FI9A 1QIQA 2XPJA 4CUGA 3JU9A 5GLVA 4W6YA 3WQ0A 3ACHA 2WFF1 3T1LA 3ITQA 1J58A 2IUWA 5EWSA 5KC5A 2WINB 1W6NB 3POBA 2VNRA 4NIDA 3W59A 3VBHA 4IGQA 5J36A 5CU1A 4CP9A 1MZFA 5FZCA 2WN2A 3Q8AA 3KF3A 4CDWA 1DG6A 3MLJA 3CLPA 4K8FA 1DZTA 1ZRDA 1DCSA 1V6IA 2JD4A 3VL9A 1WMEA 1BEV1 3LB9A 4DXRA 5HV0A 1GZWB 1R093 4FPJA 1O59A 3FBYA 3LGRA 2ZAHA 4BQYA 5C6CA 1ULPA 1IG3A 1UXXX 4QX2A 3KVAA 2FDGA 1W8UA 1WCQA 4FOVA 3VD7A 2ZHNA 3VBOC 3LA7A 2E6VA 4I09A 4JGZB 4C0BA 3TEYA 1AR71 3MFAA 1MACA 1W8HA 1SBEA 3KT4A 2NLRA 1RJ8A 2WWSA 4I0AA 1E57A 3VZJA 2YZ4A 3ZDVA 4BQ1A 4E9KA 1O5LA 1PM4A 2PAKA 1JOJA 4LTAA 4XQ4A 5FP8A 2HWD3 2GH2A 3RS6A 5C9AC 3C7GA 3ZXFA 2VCMA 5FYSA 1AR61 1DGRN 5LA0A 5DABA 1RVF2 1WKYA 2ARAA 4QX3A 4QXCA 1X36A 2HJIA 4EJRA 2X5IC 1KFXL 5T54A 1AX1A 5ANQA 1ZZBA 4ASKA 2EVXA 2VR4A 2Q8OA 3VBRA 4LBMA 5EIYB 1ZBE1 1HB2A 2OW4A 3OYWA 4Q8KA 3V65A 3MI8A 3AMPA 5LK5A 2P5BA 1RMU1 4META 1R083 4GJYA 4R4XA 3FZ3A 3OCPA 3RDIA 3LIHA 4CDQA 2OXBA 1HXS2 1F5JA 2LS6A 4NE9A 4XPVA 2RJLA 3QLQA 4XF0A 4FPGA 1WD3A 1C3HA 1W6OB 3B69A 3V0BB 4HLTA 1RUF2 1NCQB 4Q4X2 1NE4A 4YW2A 4AQ6A 4XHXA 4PBOA 5JUVA 4Q2FA 2OA2A 5T5LA 1QH7A 1A8MA 1CX4A 4L11A 5KHJA 1IS6A 2RM23 2IFRA 5LWBA 3WDUA 1XQNA 4PIZA
chains in the Genus database with same CATH topology
2W3JA 3BGAA 3CIHA 1UWWA 4M4PA 1UX7A 1UY1A 2W94A 5JXIA 3A23A 2Y6HA 5C71A 3ETPA 2VZUA 2WBKA 3MV11 2YB7A 3P6BA 2EIBA 4D0QA 5LCWL 2W9XA 1W8OA 3SEPA 3WF2A 3I2HA 5F7UA 2WUHA 2J1RA 1NUKA 1GUIA 3WSOA 4W8JA 1OF3A 1F4HA 2EIDA 3UESA 4A6OA 4QB2A 3T2OA 1JZ3A 2ZEXA 2E33A 4XUTA 3C7OA 3OG2A 1JU3A 3MO4A 2WAOA 1D7PM 1ULOA 2X10A 1UYYA 3A7QA 3I3DA 1US3A 3WNKA 2R7EB 2VQTA 1SHWB 5JR2A 4JX0A 3OGRA 4BXSV 3OB8A 3OBAA 3W5MA 2VZSA 1UMHA 2DCJA 4LPLA 2ORXA 5IFPA 2LW8A 3AC0A 2WO1A 4QDQA 3HPNA 4A42A 2BZDA 3VD5A 2B4KA 1HN1A 3BN6A 1UXZA 5B4NA 3CDZB 4OMCA 3ZM8A 2YFUA 2DDUA 2HLEA 3D3AA 2QQLA 1JYVA 4CUBA 1CX1A 2BGPA 3OEBA 3HNYM 3OGSA 3CKHA 3LQCA 4XUOA 1UY0A 2Y6JA 2RV9A 2V4VA 4PQQA 1JU4A 4CVUA 2EIEA 1JYWA 4OUEA 4UAPA 4IUGA 3NJVA 2VCAA 3GGLA 1IQDC 1I5PA 3DECA 3K4DA 4JHZA 4QB6A 4BDVB 1PMHX 4LQRA 3I2GA 2J1UA 4DUXA 2WO2A 4PF1A 2VZ3A 1TG7A 1K3IA 4LHSA 1PMJX 4RN5A 2WYSA 1GNYA 2W87A 2X05A 2VMCA 2J22A 4AG4A 2VMDA 3MBWA 2CDPA 4A44A 5LA1A 4MOAA 2VZVA 2OKXA 4YPJA 3U37A 3WNNA 1O8SA 1GQPA 2VL4A 2ZEYA 3VDAA 3ACIA 4OZOA 4ZZ8A 1UY3A 5G04L 1K45A 5LA2A 2Y6KA 4A4AA 4MO3M 1NAEA 1KEXA 5B4XA 1OT5A 2L9LA 4QAWA 3HN3A 1NKGA 2WQ8A 5DQ0A 3ACGA 2C26A 2WZ8A 2J1TA 4M4RA 1OF4A 4DUVA 4CU9A 1W99A 4Z2AA 4UI9L 2VZRA 5HPOA 4MGQA 3T0DA 3GDBA 3WF4A 4P5YA 4OYUA 3I2FA 3UNPA 4GWJA 1J83A 1L7RA 4XURA 3NQHA 4GWIA 2W46A 4XVHA 1JZ8A 1H6YA 3EYPA 3WNPA 2W95A 2VZTA 4ZZ5A 1LNSA 2CDOA 3NJXA 3K4AA 1RYYA 3C7FA 2B9VA 4TTGA 5DPNA 1O8PA 5G05L 1W9TA 2YC4A 1W0NA 3OGVA 4E8CA 3CZJA 3EB7A 2Y64A 2WZEA 2ZEZA 3THCA 1JYXA 5DN2A 2V5DA 2YC2A 4E8DA 3MV01 3HNMA 4DEQA 3E1F1 1DYOA 2Y6LA 2W1UA 3MUY1 5JMOA 2W1SA 1JZ6A 1H6XA 3P1IA 1K12A 4XUQA 3GM8A 1XPWA 4W50A 5IHRA 2ORZA 1JYNA 3JXSA 1US2A 2BBAA 1KGYA 1JZ7A 4CU6A 2XOMA 3ACFA 1J84A 3K75B 1SDDB 2YFZA 2J1EA 4DXTA 1YQ2A 4KI5M 3K46A 4P00B 1MPXA 2W92A 2EICA 3FHAA 3SEEA 4LKSA 1T2XA 5JXJA 1P8JA 1CZTA 5A1AA 2XHNA 3DYMA 2QQMA 4QPWA 1PX4A 2BERA 3VDBA 4ARXA 3F2ZA 3T09A 1NX9A 2QQIA 3T0AA 3DYOA 4PT6A 4P02B 2DCKA 2KD7A 2RJ2A 3I2IA 3I3BA 3WF3A 1K42A 3CQOA 3HEIA 1UMIA 4CU7A 2J7MA 3THDA 5DMYA 4DUWA 1XNTA 5J1XA 3WNLA 2WO3A 1EUTA 4ET7A 3I3EA 3SKJE 1L7QA 3SKVA 3W5NA 2VZPA 3NNGA 1CZSA 1JHJA 4ZXEA 1JZ5A 2WDBA 3IIIA 2E31A 2JKXA 3VD3A 2QBXA 2WABA 4QX1A 1GOGA 4XZUG 3A22A 1OD3A 4BK5A 2J1VA 1JZ2A 3HOBA 2W1QA 2VCBA 2ZEWA 2Z4FA 4QDSA 5EJ1B 3DYPA 3LEKA 2C9KA 3T2PA 1F4AA 5IYYA 3FL7A 2VQUA 2ID4A 3NRUA 4OMDA 3IAPA 4KMQA 4QB1A 3WNOA 2VM9A 3T08A 3A21A 3WNMA 2VC9A 3FN9A 1PX3A 4D8MA 4JKKA 1R64A 3ECQA 2VO5A 2J1AA 3PUIA 3VD9A 3T2QA 3C8XA 5EJZB 1GOHA 2VMFA 3OEAA 5JXHA 3LEGA 2JE8A 4QX0A 4L0PA 1W9WA 4XUNA 2PQSA 2XONA 1XNAA 2JDAA 2VZQA 4CUAA 4BJ0A 4CUCA 2RVAA 1GU3A 1DP0A 3K4ZA 2VMEA 3FHQA 4HG6B 2VOTA 3J7HA 4CU8A 4JKMA 4XUPA 4ZY9A 1W9SA 4ARYA 1GOFA 3WEZA 5IJRA 3WQBA 3GXUA 2BGOA 1UY4A 3C7HA 3WF0A 4DEVA 3VD4A 5JXGA 3K77A 5CZKA 1GMMA 1XC6A 3IAQA 3IB3A 4AAXA 5I0DA 1BHGA 1SG3A 3IDAA 1W8NA 5FUIA 1JZ4A 3I97A 4FI9A 2VZOA 2QQOA 2W47A 3MUZ1 2XQXA 2VCCA 2E32A 3ACHA 2J1SA 5C70A 1CZVA 1CIYA 1TVGA 3I2KA 1JI6A 2W5FA 2QQKA 4BK4A 3LE0A 5CYYA 2WN2A 2WN3A 3C7EA 3CMGA 2W1WA 4MGSA 3I2JA 3PUHA 3HNBM 4DXRA 2W91A 4TXWA 3T0BA 3LEIA 1O59A 5C7GA 1ULPA 2HYXA 4A3ZA 1UXXX 2X09A 1OH4A 2V72A 4QX2A 5HXMA 1WCQA 3VD7A 3LPFA 4W4ZA 4JKLA 4MADA 3UETA 4DXSA 4KWUA 2Y8KA 2ZXQA 2JD9A 2VZ1A 3C7GA 4P08A 4A41A 2QQNA 5LA0A 2VTFA 1WKYA 4QX3A 2YG0A 1UZ0A 1UY2A 4RYDA 1UYZA 2VR4A 5EIYB 3CZUA 4QDRA 5IFTA 1UYXA 1DLCA 2LS6A 4A45A 4UOJA 3HJRA 3LPGA 4GZ9A 5JUVA 1EUUA 2VJXA 2QQJA 2WAAA 3WF1A 3VDCA 2E26A 3ABZA 2Y6GA 2C4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3J A;  3BGA A;  3CIH A;  1UWW A;  4M4P A;  1UX7 A;  1UY1 A;  2W94 A;  5JXI A;  3A23 A;  2Y6H A;  5C71 A;  3ETP A;  2VZU A;  2WBK A;  3MV1 1;  2YB7 A;  3P6B A;  2EIB A;  4D0Q A;  5LCW L;  2W9X A;  1W8O A;  3SEP A;  3WF2 A;  3I2H A;  5F7U A;  2WUH A;  2J1R A;  1NUK A;  1GUI A;  3WSO A;  4W8J A;  1OF3 A;  1F4H A;  2EID A;  3UES A;  4A6O A;  4QB2 A;  3T2O A;  1JZ3 A;  2ZEX A;  2E33 A;  4XUT A;  3C7O A;  3OG2 A;  1JU3 A;  3MO4 A;  2WAO A;  1D7P M;  1ULO A;  2X10 A;  1UYY A;  3A7Q A;  3I3D A;  1US3 A;  3WNK A;  2R7E B;  2VQT A;  1SHW B;  5JR2 A;  4JX0 A;  3OGR A;  4BXS V;  3OB8 A;  3OBA A;  3W5M A;  2VZS A;  1UMH A;  2DCJ A;  4LPL A;  2ORX A;  5IFP A;  2LW8 A;  3AC0 A;  2WO1 A;  4QDQ A;  3HPN A;  4A42 A;  2BZD A;  3VD5 A;  2B4K A;  1HN1 A;  3BN6 A;  1UXZ A;  5B4N A;  3CDZ B;  4OMC A;  3ZM8 A;  2YFU A;  2DDU A;  2HLE A;  3D3A A;  2QQL A;  1JYV A;  4CUB A;  1CX1 A;  2BGP A;  3OEB A;  3HNY M;  3OGS A;  3CKH A;  3LQC A;  4XUO A;  1UY0 A;  2Y6J A;  2RV9 A;  2V4V A;  4PQQ A;  1JU4 A;  4CVU A;  2EIE A;  1JYW A;  4OUE A;  4UAP A;  4IUG A;  3NJV A;  2VCA A;  3GGL A;  1IQD C;  1I5P A;  3DEC A;  3K4D A;  4JHZ A;  4QB6 A;  4BDV B;  1PMH X;  4LQR A;  3I2G A;  2J1U A;  4DUX A;  2WO2 A;  4PF1 A;  2VZ3 A;  1TG7 A;  1K3I A;  4LHS A;  1PMJ X;  4RN5 A;  2WYS A;  1GNY A;  2W87 A;  2X05 A;  2VMC A;  2J22 A;  4AG4 A;  2VMD A;  3MBW A;  2CDP A;  4A44 A;  5LA1 A;  4MOA A;  2VZV A;  2OKX A;  4YPJ A;  3U37 A;  3WNN A;  1O8S A;  1GQP A;  2VL4 A;  2ZEY A;  3VDA A;  3ACI A;  4OZO A;  4ZZ8 A;  1UY3 A;  5G04 L;  1K45 A;  5LA2 A;  2Y6K A;  4A4A A;  4MO3 M;  1NAE A;  1KEX A;  5B4X A;  1OT5 A;  2L9L A;  4QAW A;  3HN3 A;  1NKG A;  2WQ8 A;  5DQ0 A;  3ACG A;  2C26 A;  2WZ8 A;  2J1T A;  4M4R A;  1OF4 A;  4DUV A;  4CU9 A;  1W99 A;  4Z2A A;  4UI9 L;  2VZR A;  5HPO A;  4MGQ A;  3T0D A;  3GDB A;  3WF4 A;  4P5Y A;  4OYU A;  3I2F A;  3UNP A;  4GWJ A;  1J83 A;  1L7R A;  4XUR A;  3NQH A;  4GWI A;  2W46 A;  4XVH A;  1JZ8 A;  1H6Y A;  3EYP A;  3WNP A;  2W95 A;  2VZT A;  4ZZ5 A;  1LNS A;  2CDO A;  3NJX A;  3K4A A;  1RYY A;  3C7F A;  2B9V A;  4TTG A;  5DPN A;  1O8P A;  5G05 L;  1W9T A;  2YC4 A;  1W0N A;  3OGV A;  4E8C A;  3CZJ A;  3EB7 A;  2Y64 A;  2WZE A;  2ZEZ A;  3THC A;  1JYX A;  5DN2 A;  2V5D A;  2YC2 A;  4E8D A;  3MV0 1;  3HNM A;  4DEQ A;  3E1F 1;  1DYO A;  2Y6L A;  2W1U A;  3MUY 1;  5JMO A;  2W1S A;  1JZ6 A;  1H6X A;  3P1I A;  1K12 A;  4XUQ A;  3GM8 A;  1XPW A;  4W50 A;  5IHR A;  2ORZ A;  1JYN A;  3JXS A;  1US2 A;  2BBA A;  1KGY A;  1JZ7 A;  4CU6 A;  2XOM A;  3ACF A;  1J84 A;  3K75 B;  1SDD B;  2YFZ A;  2J1E A;  4DXT A;  1YQ2 A;  4KI5 M;  3K46 A;  4P00 B;  1MPX A;  2W92 A;  2EIC A;  3FHA A;  3SEE A;  4LKS A;  1T2X A;  5JXJ A;  1P8J A;  1CZT A;  5A1A A;  2XHN A;  3DYM A;  2QQM A;  4QPW A;  1PX4 A;  2BER A;  3VDB A;  4ARX A;  3F2Z A;  3T09 A;  1NX9 A;  2QQI A;  3T0A A;  3DYO A;  4PT6 A;  4P02 B;  2DCK A;  2KD7 A;  2RJ2 A;  3I2I A;  3I3B A;  3WF3 A;  1K42 A;  3CQO A;  3HEI A;  1UMI A;  4CU7 A;  2J7M A;  3THD A;  5DMY A;  4DUW A;  1XNT A;  5J1X A;  3WNL A;  2WO3 A;  1EUT A;  4ET7 A;  3I3E A;  3SKJ E;  1L7Q A;  3SKV A;  3W5N A;  2VZP A;  3NNG A;  1CZS A;  1JHJ A;  4ZXE A;  1JZ5 A;  2WDB A;  3III A;  2E31 A;  2JKX A;  3VD3 A;  2QBX A;  2WAB A;  4QX1 A;  1GOG A;  4XZU G;  3A22 A;  1OD3 A;  4BK5 A;  2J1V A;  1JZ2 A;  3HOB A;  2W1Q A;  2VCB A;  2ZEW A;  2Z4F A;  4QDS A;  5EJ1 B;  3DYP A;  3LEK A;  2C9K A;  3T2P A;  1F4A A;  5IYY A;  3FL7 A;  2VQU A;  2ID4 A;  3NRU A;  4OMD A;  3IAP A;  4KMQ A;  4QB1 A;  3WNO A;  2VM9 A;  3T08 A;  3A21 A;  3WNM A;  2VC9 A;  3FN9 A;  1PX3 A;  4D8M A;  4JKK A;  1R64 A;  3ECQ A;  2VO5 A;  2J1A A;  3PUI A;  3VD9 A;  3T2Q A;  3C8X A;  5EJZ B;  1GOH A;  2VMF A;  3OEA A;  5JXH A;  3LEG A;  2JE8 A;  4QX0 A;  4L0P A;  1W9W A;  4XUN A;  2PQS A;  2XON A;  1XNA A;  2JDA A;  2VZQ A;  4CUA A;  4BJ0 A;  4CUC A;  2RVA A;  1GU3 A;  1DP0 A;  3K4Z A;  2VME A;  3FHQ A;  4HG6 B;  2VOT A;  3J7H A;  4CU8 A;  4JKM A;  4XUP A;  4ZY9 A;  1W9S A;  4ARY A;  1GOF A;  3WEZ A;  5IJR A;  3WQB A;  3GXU A;  2BGO A;  1UY4 A;  3C7H A;  3WF0 A;  4DEV A;  3VD4 A;  5JXG A;  3K77 A;  5CZK A;  1GMM A;  1XC6 A;  3IAQ A;  3IB3 A;  4AAX A;  5I0D A;  1BHG A;  1SG3 A;  3IDA A;  1W8N A;  5FUI A;  1JZ4 A;  3I97 A;  4FI9 A;  2VZO A;  2QQO A;  2W47 A;  3MUZ 1;  2XQX A;  2VCC A;  2E32 A;  3ACH A;  2J1S A;  5C70 A;  1CZV A;  1CIY A;  1TVG A;  3I2K A;  1JI6 A;  2W5F A;  2QQK A;  4BK4 A;  3LE0 A;  5CYY A;  2WN2 A;  2WN3 A;  3C7E A;  3CMG A;  2W1W A;  4MGS A;  3I2J A;  3PUH A;  3HNB M;  4DXR A;  2W91 A;  4TXW A;  3T0B A;  3LEI A;  1O59 A;  5C7G A;  1ULP A;  2HYX A;  4A3Z A;  1UXX X;  2X09 A;  1OH4 A;  2V72 A;  4QX2 A;  5HXM A;  1WCQ A;  3VD7 A;  3LPF A;  4W4Z A;  4JKL A;  4MAD A;  3UET A;  4DXS A;  4KWU A;  2Y8K A;  2ZXQ A;  2JD9 A;  2VZ1 A;  3C7G A;  4P08 A;  4A41 A;  2QQN A;  5LA0 A;  2VTF A;  1WKY A;  4QX3 A;  2YG0 A;  1UZ0 A;  1UY2 A;  4RYD A;  1UYZ A;  2VR4 A;  5EIY B;  3CZU A;  4QDR A;  5IFT A;  1UYX A;  1DLC A;  2LS6 A;  4A45 A;  4UOJ A;  3HJR A;  3LPG A;  4GZ9 A;  5JUV A;  1EUU A;  2VJX A;  2QQJ A;  2WAA A;  3WF1 A;  3VDC A;  2E26 A;  3ABZ A;  2Y6G A;  2C4X A; 
#chains in the Genus database with same CATH topology
 2W3J A;  3BGA A;  2XH6 A;  2VBD A;  4GJZ A;  4HPK B;  2ZCW A;  3L2Y A;  4NAO A;  1PK6 A;  5FZ3 A;  1YQ8 A;  5FZL A;  3G7D A;  3H0O A;  3H8U A;  2JB4 A;  2DVF A;  4BQ4 A;  4QMA A;  1OPM A;  2WWU A;  3JBG 3;  3POE A;  5FY4 A;  5C71 A;  3FLR A;  1SBF A;  1OQE A;  3CO2 A;  3FUO A;  4FFF A;  4Q26 A;  2E53 A;  4YGD A;  4LOT A;  4D0Q A;  5LCW L;  1FYU A;  2W9X A;  3GBF A;  3ZPO A;  2RMU 2;  2ZGT A;  3WSO A;  1QWR A;  5IVY A;  1ZYB A;  4W8J A;  5T5J A;  5BNP A;  3ON7 A;  2R30 A;  2JB8 A;  4MUV A;  1F4H A;  3WIN E;  3LA3 A;  4DMI A;  5CFC A;  4MG2 A;  2EID A;  3USS A;  1OSG A;  3K3N A;  1JZ3 A;  2MHF A;  4AED B;  4IW3 A;  1FOD 2;  1RUH 1;  5H9R A;  2PXJ A;  3C7O A;  3OY8 B;  3SH5 A;  5H9S A;  2G9F A;  1REE A;  4NMI A;  1JU3 A;  3ZXA C;  3MO4 A;  2ZZJ A;  2PQQ A;  1D7P M;  4IEP A;  5L9V A;  3RWN A;  1RUC 3;  1UNB A;  3TNP B;  4IEW A;  1ULO A;  4N43 A;  2WFP A;  4LHN A;  1CAU A;  3I3D A;  4QM8 A;  1VAV A;  1H4H A;  2VQT A;  1E5S A;  3WNK A;  4B4R A;  3ZN4 A;  2GSY A;  3AP5 A;  5DZF A;  4H14 A;  3DEM A;  1UW8 A;  3OBA A;  3RG0 A;  4UT5 A;  3ATG A;  2VZS A;  3KS7 A;  1KJR A;  1UMH A;  4HT1 T;  3NNM A;  5DG1 A;  3C2U A;  4LE3 A;  4XOG A;  4GIQ A;  2DBI A;  2ZGM A;  1JYI A;  5FZ6 A;  3PTR B;  1QDO A;  3WX5 A;  4ONU A;  3AC0 A;  4K20 A;  3NV2 A;  5FK8 A;  3WG3 A;  4E4S A;  1PGL 2;  1YNA A;  1WW6 A;  1IS3 A;  3V0A A;  1Q43 A;  2B4K A;  5A6Z A;  2GC2 A;  2YXS A;  5FJH A;  4QPG C;  4HSJ A;  1UU6 A;  3M3I A;  1BKZ A;  5T52 A;  3ZM8 A;  4CYD A;  3B94 A;  1BBT 2;  4H2A A;  4IEY A;  3D3A A;  1LED A;  4IE4 A;  3KGL A;  1JYV A;  1TME 2;  4TLG A;  1AXK A;  1K5M B;  1RED A;  2YBK A;  3USU A;  1ULG A;  1BXH A;  4IE7 A;  3GZT B;  4QX5 A;  3M3E A;  3IBM A;  1GWM A;  1JU4 A;  1OUS A;  4LLF A;  1JYW A;  4ZHN A;  3M3Q A;  1UQX A;  4OUE A;  4Y4R A;  2XJT A;  3ZXD A;  4IUG A;  3NJV A;  5JVV A;  1JHN A;  1OPO A;  2VCA A;  5IK8 A;  2P3K A;  2CV6 A;  1D2S A;  5IUQ A;  4M00 A;  3O0V A;  1Y43 B;  2HWC 2;  4URT A;  4XFH A;  2C5D A;  3LF7 A;  3RZZ A;  1AR7 3;  4HAN A;  4JC1 A;  4QB6 A;  1PMH X;  2EAL A;  4WVM B;  3TAY A;  4B7E A;  3HBK A;  2WZR 2;  2BDR A;  3POF A;  2ZKN A;  2A3W A;  2J1U A;  3WW3 A;  5F6K A;  2HWE 1;  3H3U A;  4DUX A;  1M4W A;  1EV1 3;  4GA9 A;  1TG7 A;  5I0R A;  1PVC 2;  3K48 A;  5F37 A;  3BUC A;  1HJF A;  3TRS B;  2AEN A;  3AP9 A;  5CFC C;  2QVS B;  3CL1 A;  2X05 A;  2VMC A;  2J22 A;  4AG4 A;  2CDP A;  5CKM A;  4QQ2 A;  4A44 A;  3WCS A;  2FD8 A;  4MSV A;  2VZV A;  2DUQ A;  3VBU A;  4Q4X 3;  5C8C B;  2E51 A;  4XQD A;  1QQP 1;  4YG0 A;  1UZV A;  2D98 A;  1QKQ A;  2ZEY A;  3VDA A;  4QPG A;  4CCN A;  5B2G B;  4LMF A;  2RM2 2;  4IV3 C;  4XC9 A;  1CJP A;  1UY3 A;  5G04 L;  4LIT A;  1H1A A;  1ND3 A;  3IWZ A;  4PJY A;  2UU8 A;  4Q0P A;  4MO3 M;  1MS1 A;  4D6Q A;  1BMV 2;  5B4X A;  1W6M A;  5K7P A;  2HWF 2;  4WM7 A;  3EO6 A;  3TN9 3;  3AB0 A;  1S0J A;  3Q8B A;  2G19 A;  3HN3 A;  5I0T A;  4KL1 A;  3ZYB A;  1UMZ A;  1UF2 C;  4C91 A;  5A3P A;  3O1M A;  4QQP A;  4CCM A;  3O1V A;  3HIF A;  4NHX A;  4HSL A;  2Q0A A;  2VNG A;  2YGM A;  2ETE A;  4FPO B;  4CU9 A;  4UI9 L;  3WDV A;  4OQ9 A;  2VVF A;  3SIT A;  3GDB A;  3WF4 A;  5A33 B;  4Q4W 3;  5CG8 A;  4MLO A;  4WM8 B;  3T2T A;  4JZR A;  4IV1 B;  1GR3 A;  4JGY A;  5DXD A;  1QJY 3;  5FQ0 B;  1Y7B A;  3ASI A;  3NQH A;  4IET A;  4YYO A;  4UBH A;  4LOS A;  3AMM A;  2VZT A;  4MXW A;  2B39 A;  3N7K A;  1HRV 2;  4Y22 B;  3S5A A;  1CAW B;  2LAL A;  3RI8 A;  1HRI 3;  5FAX A;  3BI3 A;  1OA4 A;  2PLV 1;  4UFK A;  1WLW A;  2B9V A;  4JRL A;  3VV1 A;  1O8P A;  5AVP A;  1W9T A;  2JIC A;  5FYU A;  1MR5 A;  4A7Z A;  2CNA A;  2YC4 A;  3LDR A;  1W0N A;  1W9F A;  3OGV A;  3WP6 A;  1ULF A;  5IT6 A;  1MQT A;  1JYX A;  5DN2 A;  1DIW A;  3AZZ A;  4XJW A;  4JQR A;  2A70 A;  2FDJ A;  3CBN A;  3E6B A;  3I3Q A;  4KU8 A;  3OGG A;  1ND2 A;  4YVW C;  4OCT A;  4AK3 A;  2A6Y A;  2Y6L A;  5A7N A;  5JZG A;  1GP6 A;  2W1S A;  3AKQ A;  1D4V B;  5KR7 A;  5I93 A;  1H30 A;  2ZGK A;  3MEP A;  4AR2 A;  4FQ4 A;  3DN7 A;  3OJB A;  1E5H A;  5GLW A;  1YEW A;  1ENS A;  3AYA A;  5GLT A;  3LOB A;  5IW0 A;  2D6N A;  3KV9 A;  1YFU A;  2MNG A;  3INA A;  3PVO A;  3QCW A;  3UYJ A;  2OS2 A;  2MEV 2;  4S2G A;  2XOM A;  3ACF A;  5CB7 A;  3AKR A;  5IAT A;  3TEZ A;  2XJQ A;  2NP0 A;  2YFZ A;  2J1E A;  3DXU A;  3AZY A;  3SCF A;  1G7Y A;  4FTE A;  1NZI A;  4WM7 C;  5FPU A;  1YFW A;  2WZR 3;  3PVB B;  4NII A;  3VKL A;  3SEE A;  4FPL A;  1T2X A;  3BTZ A;  1X9P A;  5BNN B;  2YRO A;  3H1Y A;  1NLR A;  3E6D A;  2VH9 A;  1H2L A;  2HEV F;  2XBO 3;  4F7Z A;  5D2A A;  2CTV A;  1PX4 A;  4I01 A;  4Y20 B;  2FBE A;  5I8Y A;  4A6S A;  3FMG A;  4HL0 A;  4OHY A;  1QMJ A;  2FQP A;  4PI0 A;  4Y5Z 0;  4LBO A;  4ZKT B;  4BLJ A;  3I4I A;  4DIN B;  3O14 A;  5JSR A;  5JR7 B;  1R08 1;  2VQ0 A;  2WT0 A;  4XFB A;  5A7W B;  2FDH A;  1A8D A;  5FYH A;  2XVK A;  3WW1 A;  5FP3 A;  1GKB A;  3DYO A;  4LXL A;  2WNV B;  4QPI C;  2R16 A;  4QT6 A;  4AHW A;  1RB8 G;  2GH8 A;  4CXX A;  1YHF A;  2RJ2 A;  2NYY A;  5FPX A;  2CAU A;  3FFQ A;  1F15 A;  5FP9 A;  2AYH A;  3U07 A;  3RJ2 X;  1AYN 2;  2VOW A;  5DAQ A;  4E4Z A;  5ABJ A;  3SCH A;  1XNT A;  5F39 A;  3WD5 A;  3NJZ A;  2WSU A;  1EUT A;  4PF5 A;  4ET7 A;  5F5Q A;  1X8E A;  3SKJ E;  5LEK A;  4Y5S A;  5L73 A;  1L7Q A;  4CA9 A;  3E5U A;  5FYV A;  1G86 A;  2YMZ A;  1Z7S 2;  2JDP A;  1JZ5 A;  1CPN A;  1VBB 1;  1AXZ A;  2E31 A;  3RZH A;  1NA1 A;  2D43 A;  4XEZ A;  2P37 A;  1VR3 A;  4RHV 2;  3VHP A;  4RR3 B;  1NE6 A;  1LHW A;  1LOF A;  3ALQ A;  1PZ7 A;  5J09 A;  2XVG A;  1WZX A;  4Q4W 2;  1FAY A;  4Q4Y 3;  1JZ2 A;  2WNV C;  3ZFG B;  5IVC A;  1IHM A;  1W8T A;  3OYW B;  2FCV A;  5LBE A;  5M0T A;  1OUR A;  2NPI A;  2O14 A;  3GHN A;  3TN9 2;  3I59 B;  1J1T A;  4DRR A;  1Q56 A;  4XAC A;  3ZFF C;  1HRV 3;  2VQU A;  4BQ2 A;  1I5Z A;  1FPN 1;  4QPY A;  5APA A;  2KR2 A;  2XVL A;  5FYM A;  2H6B A;  4UBG A;  4QXB A;  4K1Z A;  2JDZ A;  5EP9 A;  1QJX 3;  1QJY 1;  3CEW A;  3OUI A;  2PHD A;  5C3O A;  5IVJ A;  3A4U A;  1QJU 3;  2XGX A;  4P9W A;  5EZW A;  3A21 A;  2W39 A;  2IC1 A;  1NLS A;  4PIX A;  3FN9 A;  1DZR A;  4C8D A;  5I8T A;  1NCQ C;  1AHS A;  4O65 A;  1R64 A;  1PK6 B;  5LEJ A;  3JD7 1;  4E2S A;  3DGT A;  3PUI A;  2HYK A;  2ERF A;  3GJB A;  3J8F 1;  1RUG 3;  3VD9 A;  5BYN A;  3RZL A;  4GAL A;  5CFD A;  3P3P A;  1WW5 A;  4UF0 A;  3BOW A;  2PHR A;  5A7S A;  3S7E A;  2HWF 3;  1ZNP A;  3NAP A;  3E97 A;  4Q0V A;  4Y24 A;  4Z07 A;  4AFB A;  2VMF A;  4AWD A;  3LA2 A;  4QKN A;  4IND A;  1W04 A;  1COV 3;  1YCI A;  4XCA A;  1C5I A;  3D5O A;  4LK7 A;  1DQ0 A;  4HK9 A;  4XF4 A;  1W9W A;  1VB4 A;  4AVS A;  1D0G A;  5JIA A;  2X29 A;  3AJZ A;  1KS4 A;  2ET1 A;  5ACA 2;  1XNA A;  2JDA A;  4M0N A;  3NNJ A;  4BJ0 A;  3KV4 A;  5FKC A;  2QFE A;  5CFD C;  2Q8C A;  1DP0 A;  4NRQ A;  3U4X A;  4V1P A;  2VME A;  1LOD A;  3EBR A;  4HG6 B;  3NAP C;  4YW5 A;  5FRE A;  3TYJ A;  4CCJ A;  4XUP A;  3JCI A;  1CAV A;  1ONA A;  2JEM A;  4ARY A;  1YQC A;  1LHV A;  4YM1 A;  1RUN A;  2BGO A;  3C7H A;  1MS0 A;  2A73 B;  5D8A A;  2E7A A;  2VMG A;  5GM0 A;  5HI0 A;  3ZYJ B;  4CXW A;  2GC0 A;  1VBE 2;  3AMN A;  3VD4 A;  1XYO A;  4LUK A;  1GMM A;  1NZC A;  1XC6 A;  4YVW B;  5GZF A;  4YZ2 A;  1AR8 1;  1AYM 2;  1S55 A;  4LT5 A;  3IDA A;  3POY A;  5FY1 A;  2PHF A;  1HXS 1;  5FZF A;  2GAU A;  5JPN B;  4CEW A;  1FAT A;  3MUZ 1;  3DCQ A;  3ZFF A;  5A32 A;  4Q4X 1;  2ARC A;  1CON A;  1ZM1 A;  1QQP 3;  4AHY A;  1LGB A;  1TVG A;  5BNO B;  2W5F A;  1DBN A;  4KGG A;  4LBQ A;  4MGK E;  4RGK A;  4AHZ A;  4FAG A;  1EV1 1;  3ZXE A;  1AYN 3;  1OH3 A;  2GAL A;  4HKL A;  3MW2 A;  5CYY A;  5FLJ A;  2DVB A;  3U1X A;  4M01 A;  1L3J A;  2R6Q A;  5H9Q A;  4MGS A;  3I2J A;  4OI2 A;  2R0F A;  1AL2 3;  3HT1 A;  1AZD A;  4XYX A;  4TXW A;  4UFH A;  5CAD A;  3HAG A;  3LEI A;  3N4M A;  1B35 B;  2P2K A;  4I30 A;  5KHK A;  1HB3 A;  3KB5 A;  4P9Y A;  5C7G A;  4BZ4 A;  4KWK A;  1FI2 A;  3HMY A;  3VBF C;  3ZKY A;  4A3Z A;  4S2H A;  2V72 A;  3BB6 A;  4AAP A;  1K5J A;  1HKD A;  2JE7 A;  2XWJ B;  3AKP A;  4WVM A;  2E7Q A;  4YWA A;  1W03 A;  3LPF A;  1O5U A;  3ZDS A;  1SPP B;  4JKL A;  3FUQ A;  2BFU L;  4DXS A;  4KWU A;  4BU2 A;  5JOY A;  4YGC A;  4COW A;  4F83 A;  3BOD A;  4FXG B;  1UIK A;  2D93 A;  1N3Q A;  2PHL A;  4XIO A;  5FFO C;  2Q8D A;  2ZXQ A;  2JD9 A;  2VZ1 A;  5FXW A;  4DXZ A;  2HWB 1;  3ROU A;  3K51 A;  5C4W A;  1HV1 A;  4AI3 A;  4A41 A;  2CAV A;  1POV 0;  1AF9 A;  1KDM A;  3R4U A;  4L97 A;  3IZO A;  2D40 A;  1U5I A;  2VTF A;  4V2W A;  2YG0 A;  1BK0 A;  5FY0 A;  1YIP A;  1UZ0 A;  4LO8 A;  3B7M A;  4CDU B;  1CQ9 A;  1UY2 A;  4MV2 A;  3MID A;  4RYD A;  5IK7 A;  5FZD A;  1NG0 A;  1UYZ A;  3BVC A;  4RHV 3;  2WT2 A;  4CDX B;  4CEY C;  1SFP A;  4UW4 A;  3AFG A;  3WZ1 A;  1FMD 3;  3QBQ A;  1JYC A;  2Z69 A;  1V70 A;  3ZIW A;  4BIO A;  4BIF A;  4I0W B;  5C8C C;  4YZ1 A;  1EPZ A;  3VHR A;  1DLC A;  1HLC A;  1R1A 2;  5CNA A;  1W2T A;  4M0H A;  1ZZ7 A;  2Z79 A;  2VVD A;  4RGG A;  5D1I A;  1RXG A;  1YO8 A;  3LPG A;  4GZ9 A;  5LAT A;  3VBR C;  4ZXK A;  2CGO A;  1LR5 A;  2BFU S;  5F8P A;  1JOD A;  1YWK A;  2VJX A;  3KMH A;  1POV 3;  1QEX A;  1UD1 A;  2BOJ A;  3WV6 A;  3VDC A;  3VBO A;  2E26 A;  1VBD 1;  2IWG B;  4Y26 A;  2ET7 A;  1UOB A;  3ABZ A;  1YUD A;  1HRI 1;  4NAM A;  4UW3 A;  3VLB B;  4DY5 A;  2JG9 A;  2ES3 A;  3LZZ A;  2F4L A;  1H2N A;  1UX7 A;  4JTO A;  2QCS B;  1UY1 A;  2W94 A;  3JQX A;  2WNO A;  3N7M A;  5JXI A;  2YHJ A;  4XJA A;  1PIV 2;  4QGL A;  5FZ1 A;  5IWF A;  4CDX C;  1EPW A;  2F6B A;  3ME2 A;  2BWA A;  4NHY A;  3ETP A;  4WZC A;  2R04 3;  3MV1 1;  4ISR A;  4W65 A;  3NW4 A;  1NY7 1;  4BCU A;  5CIS A;  2SBA A;  2WQZ C;  3OSD A;  3SIS A;  3I2H A;  4FAH A;  3N9N A;  1OF3 A;  2VPV A;  3PHM A;  3UES A;  4A6O A;  3T2O A;  4Q5O A;  2ZEX A;  1VBE 3;  2WZR 1;  3U4S A;  2E33 A;  2PN5 A;  5CA6 A;  1W6P A;  5FUP A;  3LSE A;  4QX7 A;  3RVH A;  5C3P A;  1QNY A;  2K2S A;  1H2M A;  2GC3 A;  4NRP A;  1W06 A;  2ZML A;  4QPI B;  4D7S A;  1EAH 1;  2WNU A;  4Q1R A;  1VMF A;  1OUX A;  3D82 A;  4QXH A;  3B00 A;  5AC9 2;  1G9F A;  3A7Q A;  5KWR A;  3WUD A;  2I45 A;  2YPD A;  1SHW B;  1NA1 C;  4JX0 A;  1W6Q A;  2R07 3;  4XJ8 A;  1XOY A;  2E63 A;  2H0V A;  3VKM A;  4JRA A;  1RUC 2;  1QF3 A;  1PO2 3;  2D3R A;  2ARE A;  4OHX A;  3RZK A;  1H0B A;  3TWI A;  1WW4 A;  2Y6F A;  4LKE A;  3PL0 A;  4R4Z A;  5KXE A;  4EV0 A;  3SH4 A;  2VXJ A;  4RS5 C;  4NIG A;  1LCL A;  2P3Y A;  3BTX A;  1GV9 A;  4QDQ A;  4A42 A;  3B3Q E;  4N43 B;  3PUQ A;  4RQP A;  1UPS A;  2QTW B;  2VBP A;  1BMV 1;  4LA3 A;  5B4N A;  3UGG A;  5FY8 A;  4BHP A;  1YC6 1;  2HLE A;  2RS1 3;  3HQU A;  2IXL A;  2QQL A;  2GZW A;  1YXW A;  3PU8 A;  1CX1 A;  2AC1 A;  2UY8 A;  3OEB A;  1REF A;  4Q4V 2;  3OGS A;  5AVA A;  4HKW A;  1NOV A;  4XUO A;  2RV9 A;  2V4V A;  3H42 B;  4PQQ A;  1BBT 3;  1HB4 A;  1Q8Q A;  2W68 A;  2WLP A;  1UKG A;  2HWD 1;  3X29 B;  3DKQ A;  2WC2 A;  5L9R A;  1EY2 A;  4GMP 1;  1C28 A;  4P14 A;  1MEC 2;  2CHH A;  3GGL A;  4Y20 A;  4HK8 A;  1RIT A;  1N3O A;  3MLK A;  1RMU 3;  1MVQ A;  3K4D A;  2W08 A;  4R9A A;  1XNB A;  1LAJ A;  3WP5 A;  1UZW A;  5HV4 A;  3THT A;  3NMB A;  4FTS A;  5GZD A;  4P9G A;  3OBZ A;  1F9K A;  5ISL A;  3ZXG A;  5L36 A;  1DYP A;  1AR9 2;  5FUN A;  1HRV 1;  4QU2 A;  2VZ3 A;  4LHS A;  4HVQ A;  4FCA A;  4J25 A;  3S57 A;  3BTY A;  3I54 A;  2VG9 A;  2R1B A;  2ADD A;  2WYS A;  1NCR B;  2W87 A;  2C9A A;  2NMO A;  3AXE A;  1Q8S A;  4Y1Y A;  3VBS B;  4EWA A;  4PI2 A;  3ZPY A;  3ILF A;  4XFA A;  5FO8 B;  1XU2 A;  5LA1 A;  1NT0 A;  4MOA A;  2O8Q A;  5F1R A;  3WNN A;  2LUW A;  1PVC 3;  1SEF A;  1QOT A;  2Q1M A;  3ZFE C;  4NHL A;  2BNM A;  2WS9 1;  1ENR A;  4ZZ8 A;  3ZN5 A;  1TNR A;  1NCQ A;  3R6S A;  5FZO A;  3AFK A;  1LOG A;  4N43 C;  4FP3 A;  1VRB A;  4RR3 A;  1PGW 1;  1CVN A;  1S0E A;  1FMD 2;  1NAE A;  2IVI B;  4BH9 A;  1LEC A;  1MQT C;  1QJU 1;  1W8W A;  1V6K A;  3ZMO A;  5A3U A;  3AZX A;  5DUW A;  4CP0 A;  1CGP A;  2BPA 2;  2BTV C;  1DQ4 A;  2BV4 A;  2RS3 2;  4MX3 A;  3ZXJ A;  1X7N A;  2WQ8 A;  3ACG A;  2C26 A;  4RR3 C;  2MEV 1;  4NPR A;  4BE3 A;  4AGV A;  2ZGO A;  2A71 A;  1OOP C;  1OA2 A;  1OF4 A;  1RUG 1;  3H3Z A;  3J8F 3;  2XB6 C;  4IDZ A;  5I0S A;  1UZZ A;  1WLC A;  2CGN A;  4DUV A;  1W99 A;  1ENQ A;  4Z2A A;  4LBN A;  4LO5 B;  4LO7 A;  1UYP A;  5FK7 A;  3UV9 A;  1LEM A;  1RUD 1;  2A7A A;  1ULD A;  2VZR A;  3AKS A;  3QD6 A;  4ORF A;  4OHZ A;  3UKT A;  3VZL A;  4AXO A;  2ZGP A;  1G9C A;  1DYK A;  1LU1 A;  2UWB A;  2TEP A;  3WY6 A;  4P5Y A;  2D7F A;  4OYU A;  4S2D A;  4IEV A;  3IKW A;  4PLN A;  1J83 A;  1L7R A;  3LD8 A;  4XUR A;  4D3W A;  2JDK A;  2DUR A;  1A34 A;  2W46 A;  3MPP G;  3WNX A;  4XVH A;  1H6Y A;  3WNP A;  5HCA A;  2R04 2;  1LNS A;  4KWJ A;  4UW6 A;  2IXJ A;  3K4A A;  1RYY A;  2KXL A;  4OI1 A;  5JOW A;  3VBR B;  2JDU A;  3NNL A;  5GLU A;  1OVS A;  1AR8 3;  1PO2 2;  4BLI A;  1SLB A;  4IEU A;  4UFI A;  1VRH 2;  2WYF A;  2HH9 A;  3CHX A;  3CZJ A;  3EB7 A;  4HFS A;  3BPS A;  5A1L A;  2AAC A;  1QXR A;  1PGS A;  3THC A;  1MZ6 A;  1S2E A;  4Z8B A;  1JTZ X;  4AYU A;  1KS5 A;  1OC1 A;  2N7G A;  5LRR A;  3M3O A;  3HNM A;  4QGN A;  3KHB A;  4LK6 A;  1DGW A;  1O7F A;  1AYN 1;  1DYO A;  4Y1V A;  4EN8 B;  1CWP A;  2ZGS A;  1QJE A;  3WQ7 A;  1RUI 3;  5A6Q A;  2XBO 1;  2C24 A;  3MUY 1;  5FYT A;  1JZ6 A;  2ZAB A;  5LY2 A;  4CP9 B;  1QOS A;  1K12 A;  4NR1 A;  4B3N A;  5A3N A;  4XUQ A;  1WMF A;  3RQ0 A;  2ZTN A;  1XPW A;  1VMH A;  3RWK X;  5J96 B;  2ORZ A;  1APN A;  1OLM A;  3JXS A;  4WV8 A;  2Y33 A;  1ULE A;  4C1X A;  1YRZ A;  4CU6 A;  2DTW A;  2RS1 1;  3K75 B;  1SQ4 A;  4KH9 A;  4L99 A;  5L9B A;  3ZOI A;  4D7Y A;  3OOX A;  1X33 A;  1N1Y A;  4KI5 M;  2EF6 A;  4P00 B;  1PO1 1;  5GZE A;  5JZG B;  1DQ1 A;  1Z0H A;  5K0U A;  1H8T B;  3O0X A;  1Q5O A;  1LHO A;  2W92 A;  2O8O A;  4HVR A;  3WDY A;  4DB5 A;  2HWB 3;  3FHA A;  3H8O A;  2WRA A;  5JXJ A;  4LKF A;  3B02 A;  5FZE A;  1EP0 A;  1AR9 3;  1O4Z A;  4OUL A;  3FLT A;  5FYB A;  5FV3 A;  4AI0 A;  3RZJ A;  2WII B;  1G6N A;  1CZT A;  2YPJ A;  3Q8C A;  1HQW A;  1SMV A;  3DYM A;  1Y4W A;  2IVJ A;  1QNW A;  5LAS A;  1LRH A;  5FLI A;  4M3C A;  4JDM A;  4MGZ E;  1T6G C;  3HN1 A;  4NUB A;  1DLL A;  1O6U A;  4HET A;  1MZE A;  2JIJ A;  1AR6 2;  2ILM A;  3E6C C;  4LLO A;  1O3Q A;  2YGL A;  3NJY A;  4XMA A;  3VBU C;  1XE7 A;  4E2G A;  3IM0 A;  1S2K A;  2VNV A;  4P5H A;  3T09 A;  5IK4 A;  4AHX A;  5FOJ B;  2WL1 A;  5BXX A;  1NX9 A;  1CD3 G;  3LIG A;  5FYI A;  3NKG A;  2BOI A;  3T0A A;  1O3S A;  3ZFG C;  3S7I A;  4LO4 B;  1KXG A;  2DCK A;  2KD7 A;  2PAE A;  4JTN A;  2BNO A;  2NM1 A;  2TUN A;  4UFJ A;  2R06 2;  5LBF A;  1KQR A;  1UMI A;  2Q4S A;  3BU7 A;  4KWL A;  4R9C A;  2J7M A;  5DMY A;  3FC0 A;  1ZX5 A;  5IK5 A;  3PU3 A;  4QQL A;  2EXI A;  3WNL A;  1WMX A;  2WO3 A;  1E5I A;  2Q8E A;  5D8A C;  5F5I A;  4XAA A;  3IPV A;  1JOP A;  3SKV A;  4A3X A;  1S0G A;  3BYW A;  5E1R A;  4AFA A;  4ATE A;  4X8N A;  5A7W A;  5FZI A;  5FZM A;  4ZXE A;  2LM3 A;  3CJI A;  2QQU A;  3ORJ A;  1GP5 A;  4FPF A;  1N1S A;  3PLQ A;  3EJK A;  5F5C A;  3VD3 A;  3OD4 A;  4GH4 A;  2OPK A;  5FDB A;  3A22 A;  4HBN A;  4RS5 A;  4AVV A;  2DWR A;  3GBW A;  4O7X A;  1V6N A;  2QQV A;  3QAC A;  3N35 A;  5A3L A;  4I2O A;  3KF5 A;  1CAX B;  4UFM A;  1TZO A;  2JJ6 A;  4OHV A;  4QDS A;  3VGI A;  3DYP A;  2VBB A;  2C9K A;  4R8H A;  1UOG A;  4LHK A;  4B7K A;  5FOB B;  5I91 A;  1RXF A;  4LBJ A;  1HV0 A;  4FQZ A;  4UFL A;  3DUI A;  3FL7 A;  4K6B A;  5IYY A;  1QDC A;  3TEW A;  1GFF 2;  3MDP A;  3ZSL A;  2P3J A;  3VZN A;  4AED A;  4HN1 A;  1ZBA 3;  1JUH A;  4EE2 A;  3SLI A;  3ZFE B;  4H7M A;  1AYM 1;  3GZE A;  3O5S A;  2KA3 A;  3M2M A;  1YIF A;  3W21 A;  4NHM A;  3WNO A;  3AM2 A;  2E7T A;  4NRO A;  4EYU A;  4E2Q A;  3ACL A;  2VC9 A;  3TNQ A;  5CEH A;  5LZ6 A;  3MIB A;  2JEN A;  4BME A;  3KM5 A;  1D4M 2;  4GQ7 A;  4JKK A;  4D8M A;  2ENR A;  5C8C A;  4Q0S A;  1MQT B;  2YBP A;  1D2Q A;  3HVD A;  2DVG A;  4OUM A;  2J1A A;  4PDW C;  4HMZ A;  1EV1 2;  3M8L A;  3OTF A;  2CWM A;  4KBZ A;  4XF3 A;  2YU1 A;  4AI1 A;  4B29 A;  2ZZQ A;  3Q8E A;  1K5M C;  3NL1 A;  3T2Q A;  3T4H B;  5EV7 A;  1W0P A;  5EJZ B;  1GOH A;  2R07 1;  2VEC A;  3B9C A;  4Y33 A;  5LRS A;  3OEA A;  3UGF A;  3RMX A;  3WW2 A;  3ST7 A;  5BV6 A;  3ZVX A;  4D94 A;  2IFW A;  2P4E A;  4Y1U A;  2B45 X;  3PNA A;  4L0P A;  5LA9 A;  4OQ8 A;  5FJK A;  3WXP A;  1XBF A;  2PQS A;  5AFE A;  2DVD A;  3ZO0 B;  4GKY A;  4CEY A;  3OPT A;  4I0B A;  4ZU4 A;  5FZ7 A;  1BBT 1;  1XE0 A;  2YBS A;  3PTY A;  1COV 2;  2ZPX A;  5GZC A;  1AVB A;  1QOO A;  3MFC A;  1C8M 1;  3HT2 A;  1RUJ 1;  4CCE A;  1ZZC A;  3J7H A;  4XBQ A;  4TYS A;  3H8X A;  2A5Z A;  1W9S A;  4XF9 A;  1GOF A;  1TQ5 A;  4QX8 A;  3WEZ A;  5FWJ A;  2BW8 A;  1V0A A;  3POS A;  4COY A;  4XW3 A;  2HBT A;  4K40 A;  3KLS A;  2RHP A;  3KCY A;  4DFS A;  1GP4 A;  5BNP C;  5JXG A;  1H9W A;  1UO9 A;  3K77 A;  2UY9 A;  3E5X A;  4Y1Z A;  1AR6 3;  2C1F A;  4G9S B;  3FX3 A;  2R32 A;  4HZF A;  2XWB B;  4MHU A;  4QU1 A;  1OHF A;  4AAX A;  3I7D A;  3WOG A;  5BPX A;  1RC6 A;  1SG3 A;  2VTX J;  2YDE A;  4PLO A;  5C33 A;  4R9B A;  1JH5 A;  5J37 A;  2RG4 A;  3TOJ A;  4L2N A;  2HWE 2;  4Q0U A;  2ZHM A;  5FMO L;  3HQR A;  1BVP 1;  2Q1F A;  4FPH A;  2XQX A;  4XDP A;  1GZW A;  3KD4 A;  2E32 A;  1PVC 1;  2J1S A;  5C70 A;  1CZV A;  1BLZ A;  1U5Z A;  1RJ7 A;  1W90 A;  4FOY A;  5A3T A;  1TMF 3;  2RS5 1;  3I2K A;  3ZIX A;  4D6R A;  3MIH A;  2QQK A;  3PJY A;  1OOP B;  3O12 A;  4ES8 A;  4BK4 A;  1W2N A;  1HRI 2;  4JGZ A;  1URX A;  1NQD A;  2WN3 A;  3C7E A;  3CMG A;  2XML A;  1LU2 A;  4KBB A;  5DAX A;  1QQP 2;  5E88 A;  4RQP C;  3PUH A;  4ZS3 A;  3HNB M;  2VGD A;  1SBD A;  2W91 A;  2RE9 A;  3H1W A;  3T0B A;  4AVT A;  4AZZ A;  4N53 A;  4YVS A;  2RM2 1;  5T3N A;  5IAX A;  3LSD A;  4RD7 A;  4BQ5 A;  3U11 A;  2WKK A;  5DUV A;  3DXT A;  3W58 A;  2JWP A;  2HYX A;  3ZYR A;  5HXM A;  3FE5 A;  5DDJ 2;  5FZG A;  4CDW C;  5BNQ A;  2C0Z A;  1ASJ 2;  2ZGQ A;  4GUL A;  4G3Y C;  1CAU B;  4ZU7 A;  1ZRI A;  4K3U A;  3OPZ A;  1FNY A;  1QJF A;  3AYC A;  4MAD A;  1C8N A;  1S0I A;  4CDW B;  3VUO A;  4KQ7 A;  3POG A;  4AI8 A;  1U0A A;  2UYA A;  1DQ6 A;  2Y8K A;  3AYD A;  1OLQ A;  2JDM A;  3R4S A;  1V00 A;  5C3Q A;  4QM9 A;  1RUD 3;  1J3Q A;  4P08 A;  1RUE 1;  1IPS A;  1ODM A;  1UX6 A;  1WCD J;  2QQN A;  2QZ3 A;  3ILN A;  3IT8 A;  3N7L A;  3T4V A;  3RI9 A;  2YV8 A;  3AP7 A;  2E9Q A;  3JD7 3;  1DGR A;  2A3Y A;  5FY5 A;  4XFG A;  4HKO A;  2MEV 3;  1TME 3;  2X8K A;  3IDE A;  5JZG C;  1SAC A;  4RGA A;  1UAI A;  5JPM B;  5FPV A;  2VE1 A;  4XHB A;  4IV3 B;  2DF7 A;  3RGB A;  5EPA A;  3MHZ A;  4MXW B;  1GZC A;  1VE0 A;  3K3O A;  4IV1 C;  1RUC 1;  4Q0Q A;  1WUV A;  4QDR A;  2D6P A;  2ZX1 A;  1UYX A;  1XE8 A;  2XUE A;  1UZY A;  3ELN A;  4WM8 C;  4RL7 A;  3USU B;  5FWE A;  4XFI A;  4A45 A;  3LFM A;  4QWN A;  4UOJ A;  4BOW A;  2BVV A;  4XBL A;  3MF6 A;  3HJR A;  5FPB A;  3ILR A;  1ALY A;  3WT3 A;  2R06 3;  1EUU A;  1SFY A;  3VBF A;  2B42 B;  3ZYH A;  4H3W A;  2WAA A;  3WF1 A;  4EN7 B;  2PTM A;  4EWD A;  3O1O A;  1R09 1;  1KD7 A;  4GB3 2;  2Y6G A;  2C4X A;  5C3R A;  3V64 A;  5FYY A;  4M4P A;  3OD0 A;  1SCS A;  3VKO A;  4Y1X A;  4FPK A;  4A7Y A;  4WM8 A;  1UU5 A;  3KCC A;  3A23 A;  1SFN A;  4BMB A;  4COV A;  1IGO A;  4Q4V 1;  4QKF A;  1WLD A;  3POI A;  1QH6 A;  2RR1 1;  1W05 A;  2WBK A;  3OY8 A;  4Z2W A;  3PMS A;  2YB7 A;  5L7O A;  2EIB A;  5KHI A;  3VDD B;  5CBL A;  1W8O A;  3WF2 A;  3J7M A;  4NPM A;  5FXX A;  1DZQ A;  2J1R A;  1NUK A;  2DTY A;  2AR6 A;  2WUH A;  3AK0 A;  4P9L A;  3WDW A;  5E89 A;  2BJS A;  4LIU A;  1YJK A;  4I3G A;  1HXS 3;  3ZYP A;  4N53 C;  4QB2 A;  4YVS C;  1U12 A;  4G4F A;  4N7I A;  1ZBA 2;  3GZU C;  2MPF A;  5JIU A;  3I59 A;  1Y9Q A;  5A80 A;  3WR0 A;  1ZBE 3;  2WAO A;  3RYK A;  1OLM E;  4ZPI A;  3M4F A;  1EYB A;  4DIQ A;  1ZRF A;  1S4C A;  2BYV E;  3LDB A;  5FBJ A;  1LHN A;  2R7E B;  1ST8 A;  4FP2 A;  5A1F A;  5JR2 A;  5A3M A;  5KC6 A;  4Q4Y 2;  4CXY A;  5FZK A;  2AGS A;  2HWE 3;  3VB9 A;  5T5P A;  1FV3 A;  1BCX A;  2ZMK A;  3AMH A;  2JXA A;  4YM0 A;  5C5U A;  2XXZ A;  4IER A;  3W5M A;  2DCJ A;  2I74 A;  4IE6 A;  1CN1 A;  2GN7 A;  4LPL A;  1W28 A;  4SBV A;  2AEY A;  2JG8 B;  2YY1 A;  3MGU A;  2X5I A;  4AQS A;  2VOV A;  2DFB A;  3FJS A;  3MIG A;  4E4H A;  2RMU 3;  1R1A 3;  5JI7 A;  3NNF A;  2BZD A;  4EWE A;  5I8S A;  4XDO A;  1XYP A;  4W6X A;  5FZ9 A;  3JBG 1;  1FMD 1;  3AX4 A;  4DS0 A;  1LOE A;  1W8Z A;  3O1P A;  3ZSJ A;  1RVF 3;  4XTP A;  1AX0 A;  1CIW A;  2DDU A;  1XJA A;  5DZE A;  2RS3 1;  2ZX4 A;  1WGP A;  4CUB A;  4DQA A;  2D5F A;  3JB8 A;  1GYK A;  1DGW X;  1QGL A;  1IG0 A;  2P34 A;  2CSG A;  1UY0 A;  2GME A;  3CKH A;  4Q27 A;  5FCC A;  4D69 A;  1X9T A;  2BGC A;  2EIE A;  4CVU A;  1VBA 1;  1LUL A;  2ZHL A;  3AZV A;  1VBD 3;  4PDW A;  1H8T C;  1RUD 2;  4WBB A;  1AUY A;  5ERL A;  1GQG A;  1QY4 A;  1LOA A;  3ZSK A;  2JDY A;  3DEC A;  4JHZ A;  4NHK A;  2WLQ A;  4AF9 A;  2XJU A;  3MZH A;  1DF0 A;  1X82 A;  4BDV B;  2ARB A;  4HPK A;  4Y3O A;  1LGN A;  4IEX A;  2ZX2 A;  4RHV 1;  4LQR A;  4FPE A;  1DHK B;  1ND2 B;  4GAZ A;  4Q4W 1;  2R04 1;  4HVO A;  2YYO A;  4YGE A;  1LB2 A;  1PNG A;  4PF1 A;  5JOX A;  4DNY A;  3VL8 A;  2WFF 2;  4CRQ A;  4RN5 A;  3O1R A;  5FY7 A;  3SNM A;  4ASM B;  3GYD A;  5AC9 3;  2FDI A;  1A78 A;  5BNP B;  2BQP A;  4XXA A;  2KM2 A;  2PA7 A;  3MBW A;  1H8V A;  1STM A;  1TMF 2;  5KXC A;  1POV 1;  3L2H A;  2OKX A;  5DAW A;  1FPN 2;  2NN8 A;  1I1E A;  1GQP A;  2VL4 A;  2OUJ A;  3LAG A;  4Y5T A;  3ACI A;  1FX5 A;  1EAH 3;  2VVE A;  2ZAA A;  4XJ9 A;  1QJY 2;  5FP7 A;  4OZO A;  4AEJ A;  4GB3 3;  4GH4 C;  3I2O A;  3GAL A;  1K45 A;  5LA2 A;  1WD4 A;  1GAN A;  3R0R A;  2XBO 2;  4Z1V A;  3DL3 A;  4A4A A;  2I07 B;  3VBO B;  3KSC A;  5FLH A;  3S30 A;  4GH4 B;  4UYB A;  4AGR A;  1GWL A;  2JDH A;  3QOP A;  4RS5 B;  2G1M A;  3KVB A;  1XND A;  2OZJ A;  1V6J A;  2V4A A;  1ASJ 3;  4IGO A;  1OI6 A;  1MS4 A;  2DUO A;  1JBC A;  1JYT A;  5FXZ A;  1NKG A;  3UL2 A;  1BZW A;  4JGY B;  1FNZ A;  2RS1 2;  1HJG A;  2RDS A;  4QHZ A;  2J1T A;  1LHU A;  4M4R A;  5FXV A;  2OPW A;  4GD4 A;  3UK9 A;  2PHT A;  1KDK A;  5FR3 A;  1PO1 2;  2PMW B;  3AKT A;  3PDQ A;  3SCG A;  5CAZ A;  2VUC A;  1W6M B;  2GN3 A;  2FCT A;  3LOI A;  4JGZ C;  1D0H A;  3FBM A;  5ACA 1;  1SCR A;  3T30 A;  3I2F A;  3UNP A;  5EFU A;  4LIV A;  1UCX A;  5I0U A;  5CG9 A;  1RMU 2;  2WSV A;  4LKD A;  2XKP A;  3I2D A;  5GAL A;  4QPI A;  5JI9 A;  1DDL A;  3EYP A;  5C9A B;  1PK6 C;  2W95 A;  2XL7 A;  5D21 A;  1SLC A;  1IPJ A;  2CDO A;  1RGS A;  5FMB A;  1NQJ A;  5EXO A;  1HDK A;  4PHZ A;  1RUF 1;  4XIL A;  4XFC A;  5DPN A;  4Q29 A;  5G05 L;  5CFC B;  1NXM A;  3RZG A;  1UOF A;  5K8S A;  4CP2 A;  5K9Y A;  2Y64 A;  4GXL A;  4IES A;  5JLV A;  1U5Y A;  2RDR A;  2V5D A;  4JCK A;  3I3M A;  1TEI A;  1GZ9 A;  1AR8 2;  2QJV A;  3KT1 A;  4E8D A;  3S0M A;  4DEQ A;  2ZAC A;  1W6N A;  1CAW A;  1XNC A;  3J7N A;  1YLL A;  4CCO A;  5FPL A;  3WP3 A;  3ZN6 B;  1XRU A;  4CEY B;  3H9A A;  2W1U A;  2UWA A;  4AI9 A;  4CCC A;  3BU0 A;  1S0D A;  4X8P A;  1SZB A;  3RYP A;  2DCT A;  5H9P A;  3VDD C;  1DQ5 A;  1H6X A;  5E6H A;  1J3P A;  2LTN A;  2RMU 1;  2VW0 A;  3P1I A;  4AEM A;  2HKX A;  1O4T A;  2EIG A;  5ABJ C;  3D0S A;  1F31 A;  1MS9 A;  1VAM A;  1I3H A;  2IXI A;  3OUH A;  3VBU B;  3FHI B;  3N9L A;  1BK1 A;  1US2 A;  1JYN A;  5JSP A;  2A6W A;  4LBK A;  4XXP A;  2ZKL A;  4BQX A;  5FZB A;  1FOD 1;  1RUH 2;  1YI7 A;  2VMI A;  5FMC A;  4NIA A;  1J84 A;  4XTM A;  2QDN A;  2RS3 3;  1SDD B;  2DYC A;  2JDN A;  4YW1 A;  3UT0 A;  4SLI A;  1BJQ A;  2DUP A;  5GLZ A;  1YQ2 A;  3U75 A;  2DV9 A;  3K46 A;  2DCY A;  1HX6 A;  4BQW A;  4CDU C;  2VQA A;  3EMR A;  3R05 A;  4AOC A;  4HN0 A;  2WT1 A;  4BQ3 A;  2WWJ A;  2BNN A;  1LEN A;  2OVU A;  1RHI 1;  1RUE 3;  1W6P B;  1P8J A;  1W2A X;  1OFN A;  4XDQ A;  5DUU A;  4CE8 A;  5C3S A;  1Z7S 3;  1QU0 A;  1VBC 3;  2B5H A;  2VUD A;  2WNU B;  2WS9 3;  2QQM A;  3CNA A;  3J26 N;  3LWC A;  4CTE A;  4QHO A;  4XE9 A;  1GNH A;  2HWB 2;  4Z92 B;  3F95 A;  3IDC B;  2QNK A;  4ZU5 A;  1ZA4 A;  1PGL 1;  3B9I A;  3KQR A;  4IEO A;  4LUL A;  5LY1 A;  4CDX A;  4YAR A;  1FPN 3;  3NKT A;  4ARX A;  1HW5 A;  3F2Z A;  1ZZ9 A;  3GHM A;  1S2B A;  1MS5 A;  1UKR A;  1VB2 A;  3AXD A;  1MZ5 A;  1NCR C;  3VBS C;  3UKV A;  4K1Y A;  3UGH A;  2AZ5 A;  1G9D A;  4LBL A;  2RJK A;  4IEZ A;  4IGP A;  4P02 B;  4PBP A;  5FQ0 A;  3VBH B;  3DKW A;  2RDQ A;  1TME 1;  4YZ4 A;  3CQO A;  4CU7 A;  4COZ A;  2GP5 A;  4QHB A;  2HEW F;  4Y22 A;  3THD A;  4P9X A;  4DUW A;  5J1X A;  3H50 A;  4YRD A;  3TB0 A;  3VZK A;  1QJX 2;  1K5M A;  3THP A;  5FO7 B;  1VAK A;  1AYM 3;  3WUC A;  2TNF A;  5LBB A;  3O0W A;  2VZP A;  3NNG A;  1CZS A;  3III A;  1VBD 2;  3H7J A;  2EXJ A;  5FZ8 A;  5HCF A;  2DU1 A;  3S5Q A;  4YVW A;  4N9I A;  1BEV 3;  4O61 A;  1COV 1;  4FOW A;  4KG8 A;  2XKO A;  4LE4 A;  2P3I A;  2WAB A;  1GOG A;  3PME A;  3WDX A;  1RUJ 2;  1XNK A;  1ND3 B;  4FT8 A;  1GIC A;  4IQP A;  1SLL A;  2GND A;  1PIV 1;  4BK5 A;  2J1V A;  1UOJ A;  1KIT A;  3HOB A;  4MGI E;  1F2N A;  2VCB A;  1ZZ8 A;  2Z4F A;  1C4R A;  2YC0 A;  2PHW A;  1NY7 2;  4WM7 B;  2FZ2 A;  5C5T A;  2SLI A;  3RJR A;  1N1V A;  1NA1 B;  1Z78 A;  4ERO A;  5T50 A;  2ID4 A;  4CP1 A;  3J7L A;  3RFR A;  2BP6 A;  5FIX A;  3POJ A;  4JDN A;  2GNT A;  2QDR A;  1MEC 3;  1PM7 A;  2ZGL A;  3GCX A;  1RL3 A;  1RUI 1;  4OMD A;  4BWO A;  2JG9 B;  2OT7 A;  1H1I A;  1PO1 3;  1W2O A;  2GMP A;  2VM9 A;  3PJQ A;  1KRI A;  2ZGU A;  3DPR C;  5F9T A;  5HCH A;  5A33 A;  1PHM A;  2NQY A;  1S0F A;  1YQ6 A;  1EAH 2;  1NLQ A;  1GQH A;  5A6Y A;  1V9U 2;  1F8V A;  3JUU A;  1HN0 A;  3V0B A;  5GKA C;  3U10 A;  1W0O A;  1SDW A;  2ARX A;  2VU9 A;  1Y9M A;  3MW3 A;  4JHT A;  4MGY E;  4AFD A;  4BPZ A;  5AFB A;  1WCS A;  1D4M 3;  5L7O B;  2G9Z A;  2OQ7 A;  2ZA9 A;  3C8X A;  3P5B A;  1AJO A;  3VDD A;  4OI0 A;  5SV5 A;  5JXH A;  2HWC 3;  4MXV A;  4AQ2 A;  3LEG A;  2GMM A;  1RIN A;  2XG3 A;  1S0B A;  2JE8 A;  2WO7 A;  5C4W C;  2WJS A;  2NZ9 A;  2XL9 A;  3FWE A;  5DDJ 1;  4D7T A;  5FRA A;  1Y9G A;  4TZD A;  2ZGN A;  4FOQ A;  2DBN A;  3PIJ A;  4YFZ A;  1XSQ A;  3DPR B;  2VZQ A;  4CUA A;  4F3J A;  5LB6 A;  1GU3 A;  1YI9 A;  5K0U C;  2PEL A;  1YFY A;  1IKQ A;  2P6H A;  3FHQ A;  3SQO A;  2Q1Z B;  2VOT A;  4FO9 A;  5T5O A;  4CU8 A;  1X50 A;  4JKM A;  3U14 A;  4ZY9 A;  1C1L A;  3WHU A;  3AL5 A;  3GNE A;  5IJR A;  1OVP A;  3WQB A;  4GKX A;  4AL9 A;  5K0U B;  3PVE A;  3GXU A;  1AL2 2;  4X6Q B;  4AQT A;  3WP4 A;  4NWW A;  2H6C A;  3WF0 A;  3OUJ A;  2A6X A;  3LCP A;  2Y34 A;  5A32 B;  1DQ2 A;  2FHR A;  4LUM A;  1NXD 1;  4FVV A;  2HBU A;  5FPA A;  1JS9 A;  4OZX A;  4R52 A;  3IB3 A;  3Q8F A;  3ZSM A;  5I0D A;  1BHG A;  5A6X A;  5F2S A;  1CAV B;  4H7L A;  1W8N A;  3N7J A;  4Q8L A;  4AFM A;  2JG9 C;  1JZ4 A;  5E8A A;  3I97 A;  5ANN A;  1Q3E A;  1QHD A;  1NCR A;  2QQO A;  2VZO A;  1BVV A;  2W47 A;  4JVA A;  3VBS A;  1OQ1 A;  3WDT A;  2VCC A;  4ITC A;  3HWJ A;  1CIY A;  2JKB A;  1JI6 A;  2I2S A;  3V0A B;  4DZG A;  2ZMN A;  1JUI A;  1R09 2;  2P1B A;  4GB3 1;  4OFG A;  3S6P A;  2F4P A;  1H9P A;  3LE0 A;  3A0K A;  4NN0 A;  3ZR6 A;  3HQX A;  2W1W A;  4KU7 A;  3NO8 A;  1W3X A;  1OQD A;  4GWN A;  4U2A A;  3HBZ A;  3FFZ A;  4YW6 A;  4PDW B;  2UWC A;  5F3C A;  5FZ4 A;  4U36 A;  4ISQ A;  5LBC A;  3J9S A;  4XJU A;  3MF9 A;  2R49 A;  3D6E A;  1RUH 3;  4YW3 A;  1CR7 A;  2X09 A;  1OH4 A;  2WNV A;  4PQ9 A;  2R0H A;  1V6M A;  1AX2 A;  4PLM A;  2A75 A;  3PUA A;  1PGW 2;  3M70 A;  3WLU A;  1YQ5 A;  4W4Z A;  1QJU 2;  2AH2 A;  5HXV A;  3UET A;  4F8A A;  3VZM A;  2Y0O A;  1LGC A;  2ADE A;  1PZ8 A;  5ABJ B;  4YM2 A;  5JOZ A;  3NV1 A;  3GBG A;  4MZU A;  4FPY A;  1S0C A;  3NAP B;  5SV8 A;  1H8T A;  2QQW A;  3KWV A;  1ZBA 1;  1VBC 2;  3M1H A;  2YUE A;  4P9I A;  2WQ4 A;  4Y4Y A;  1Y3T A;  1RUG 2;  1W6O A;  2DU0 A;  2OZ6 A;  4IV1 A;  4B1L A;  4FXK B;  4OI4 A;  5HBA A;  2VW2 A;  2IZW A;  3N9O A;  1JW6 A;  1VJ2 A;  2OUH A;  1TNF A;  1IS5 A;  3U78 A;  1KJL A;  1JOB A;  3H1M A;  4RQP B;  3SC7 X;  2EXK A;  3E5Q A;  1WBF A;  1Q8P A;  3WQ1 A;  3N9Q A;  2WR9 A;  3AYE A;  1RUJ 3;  3CZU A;  4AVC A;  1DFQ A;  3I8T A;  3ZFG A;  1V9U 3;  3L9J T;  4NO4 A;  5CIR A;  2A1X A;  5IFT A;  1HQN A;  4YW4 A;  4QKD A;  1WBL A;  3ENR A;  5ACA 3;  2VXR A;  4N7U A;  4AEK A;  2VY0 A;  4ZON A;  3EHK A;  1V6L A;  4QPG B;  4ATF A;  2P6C A;  1IS4 A;  1PO2 1;  3ETQ A;  2DFC A;  3ZKU A;  1W2U A;  2QQJ A;  3O7O A;  2TBV A;  3H7Y A;  1XB9 A;  1VBB 2;  2V09 A;  3JBG 2;  4DO0 A;  1J59 A;  2WA3 A;  2XR4 A;  2QE3 A;  3CIH A;  1UWW A;  2VUJ A;  2ZHK A;  3VKN A;  1ND3 C;  4V2V A;  4YZ3 A;  2O0O A;  3IN9 A;  1C1F A;  4TWT A;  4LHL A;  3KV5 A;  2W2I A;  3DF0 A;  1BEV 2;  4OVE A;  2Y6H A;  2XLA A;  3VHN A;  4YFW A;  1N3P A;  4R9D A;  3JB4 C;  3ZFF B;  1ZZ6 A;  2VZU A;  1J1L A;  1VBA 2;  2RS5 3;  3P6B A;  5KXD A;  5A3O A;  3D0J A;  4LNV A;  4NJ4 A;  3SEP A;  3LDK A;  3TN9 1;  5F7U A;  3IDB B;  1B09 A;  1AR7 2;  1GUI A;  2D3S A;  4UF0 B;  1H4G A;  3BIW E;  3M7A A;  5DDJ 3;  4E27 A;  5C9A A;  4H55 A;  2Y26 A;  4ES9 A;  3B93 A;  3HR9 A;  5FZA A;  2ZS6 B;  2EAK A;  2QKD A;  1JN2 P;  2BEO A;  1WW7 A;  3WG1 A;  1OKO A;  5FY9 A;  1MS8 A;  4GMP 3;  2XLG A;  1HB1 A;  3QH7 A;  5FBZ A;  5A7O A;  4XUT A;  3BKZ A;  3MLL A;  3O1T A;  1B35 A;  2VNO A;  3MYX A;  1E5R A;  1RVF 1;  3OG2 A;  5KHH A;  1J3R A;  4RFT 0;  4LA2 A;  4EN9 B;  3BAL A;  4RSU A;  2X10 A;  2IXC A;  4D6S A;  1UYY A;  1US3 A;  3NST A;  1GZT A;  3JD7 2;  3ZYG A;  5FP4 A;  5KXB A;  3OGR A;  1ZVF A;  2VD7 A;  1N1T A;  3J8F 2;  4IE0 A;  1ZBE 2;  2Y0I A;  3EQE A;  4BXS V;  3OB8 A;  1TMF 1;  2VOK A;  2AEZ A;  5DG2 A;  3ZMN A;  1OMI A;  3LEM A;  4K9S A;  1GWK A;  1W39 A;  2CY6 A;  4YG6 A;  3MIC A;  2ORX A;  2PLV 3;  2GNM A;  2GNB A;  4L8Q A;  1SLI A;  5IFP A;  1A6C A;  4FSJ A;  1IKP A;  2LRO A;  4UW5 A;  2LW8 A;  4LO6 B;  4RFR B;  2WO1 A;  5A70 A;  3HPN A;  4DRV A;  3R4D B;  3VD5 A;  1AJK A;  1OOP A;  5CKQ A;  4CSW A;  1HN1 A;  1ND2 C;  3B01 A;  2VAU A;  2ZOE B;  4O9G A;  3BN6 A;  4GMP 0;  4NIH A;  1UXZ A;  3CDZ B;  3NV3 A;  4OMC A;  4S2F A;  2YFU A;  2WZP P;  1LKN A;  1MS3 A;  5FYZ A;  2K46 A;  2D6O X;  2YU2 A;  1OKQ A;  5L7O C;  2QQP A;  3OBT A;  1YYN A;  1LOC A;  1ODN A;  3BPZ A;  2BGP A;  3HNY M;  4NOT A;  1RIR A;  2R06 1;  3LQC A;  5J7M A;  1ZA7 A;  1F35 A;  2XUM A;  2Y6J A;  1SLA A;  3AL6 A;  1C57 A;  3APB A;  5FZ0 A;  3RRD A;  2Z42 A;  5IVV A;  4TLF A;  1G9A A;  4OUS A;  4UAP A;  2G4I A;  1Q8O A;  4FFI A;  4DOU A;  1K42 A;  1VBE 1;  1H1M A;  4EN0 A;  1IQD C;  1I5P A;  2JG8 C;  1DU3 D;  4IL7 A;  1QXJ A;  3IIA A;  4LEJ A;  4C0H A;  3MPB A;  2EXH A;  4P9J A;  5D8A B;  1L7L A;  1ULC A;  2UUR A;  4KG0 A;  4AE2 A;  1YFX A;  3BTA A;  2DVA A;  2ZGR A;  3CF6 E;  5BUV A;  5IVE A;  4Z82 A;  3NWK A;  1JMU B;  1IPK A;  3I2G A;  2RDN A;  4HON A;  3KCX A;  5CKN A;  1GBG A;  4GWM A;  3AVR A;  4A7K A;  4BA6 A;  2WO2 A;  3I49 A;  1K3I A;  1ZRE A;  1ACC A;  1SPP A;  1OLR A;  1XXN A;  2B7Y A;  4YGB A;  1PMJ X;  3KZ4 C;  3AVS A;  3PUS A;  2BRT A;  2XJP A;  1GNY A;  3PUR A;  5J48 A;  2BU9 A;  1O91 A;  2VMD A;  2XDV A;  4B1M A;  2Y60 A;  1W3V A;  3BIE A;  4Q4V 3;  4N90 A;  3JZV A;  4YPJ A;  2WFF 3;  3RYR A;  1O8S A;  3U37 A;  1WA6 X;  3IMM A;  3H8R A;  3CJI B;  1FXZ A;  4LBQ D;  1X8M A;  4I02 A;  4CCL A;  1WLT A;  4AI2 A;  2WA4 A;  3CJX A;  5CVR A;  1PNF A;  4MHR A;  5CFD B;  1UL9 A;  3U0Z A;  1M06 G;  2Y6K A;  4XF1 A;  3GF6 A;  1Q8V A;  2XHK A;  1D4M 1;  1OXC A;  4CDQ B;  3WHT A;  5FMD A;  2RR1 3;  1W9Y A;  1AL0 G;  1KEX A;  1R1Z A;  1VAL A;  2BUK A;  1OT5 A;  4UWD A;  2O1Q A;  3D4K A;  4XAE A;  3ZR5 A;  2OQ6 A;  3GJA A;  4N53 B;  4YVS B;  1JXN A;  1VLN A;  3T3Y A;  1H2K A;  2L9L A;  4QAW A;  2D44 A;  4K8R B;  1PZ9 A;  4YNI A;  4BB3 A;  3MIF A;  3WG4 A;  2OYZ A;  5DQ0 A;  1AXY A;  3ZX7 A;  5FZH A;  1W8F A;  2K9Z A;  2R07 2;  2WZ8 A;  5FZO B;  1OBN A;  2W52 A;  1OFS A;  2Q30 A;  4XQW A;  1G8W A;  1PVX A;  5JCT A;  2C6S A;  2D5H A;  5HPO A;  2Q5T A;  4MGQ A;  3T0D A;  2PHX A;  4MYE A;  1RHI 2;  1WWY A;  2B9U A;  4EZH A;  2HWC 1;  5JMC A;  2FCU A;  2ZX3 A;  5EQU A;  3UJQ A;  2ZBJ A;  4CDU A;  2B46 X;  4GWJ A;  3UJO A;  5LW9 A;  3VZO A;  1WCK A;  3LFI A;  3N3H A;  4GWI A;  1VIW B;  4HOO A;  1C8M 2;  4XMI A;  1JZ8 A;  1IOA A;  1R1A 1;  4XCB A;  1VP6 A;  3HD8 B;  5F2W A;  4ZZ5 A;  3GZA A;  2D3P A;  3AP4 A;  3NJX A;  1WMD A;  2G9G A;  3C7F A;  3TBD A;  2CGP A;  4IV3 A;  1I9R A;  2Z2S B;  3OPW A;  4TN7 A;  4TTG A;  2BWC A;  4CPB A;  2BBV A;  5F32 A;  3ES4 A;  4JQT A;  1ZRC A;  2B8M A;  1XU1 A;  4E8C A;  2A6V A;  5FMO S;  2WZE A;  2ZEZ A;  3WVJ A;  4WVV A;  1VBB 3;  3Q9O A;  4A2U A;  3QH6 A;  2YC2 A;  1LOF C;  2DCZ A;  3MV0 1;  4B4P A;  2FMY A;  2A3X A;  2PHU A;  3G6J B;  4IE5 A;  4LBQ B;  1RUO A;  4WVW A;  2D6M A;  3E1F 1;  2FDK A;  4YM3 A;  5BNN C;  1A3K A;  3CU7 A;  2HEY F;  3GCW A;  3T1M A;  4AGG A;  1F5F A;  3MW4 A;  3LKJ A;  4QQO A;  1SLT A;  4OHW A;  4BYY A;  1QJX 1;  5JMO A;  3SHR A;  3KT7 A;  4HXC A;  4FFH A;  2Z5W A;  3ZSE A;  1VBA 3;  2OX0 A;  2RS5 2;  3GM8 A;  5BNN A;  4B4Q A;  4W50 A;  2HWF 1;  3O1S A;  1S1A A;  5IHR A;  2CL2 A;  2PAM A;  5F6L B;  4L9B A;  5EYY A;  1FT9 A;  5DAV A;  2EAA A;  2BBA A;  3AZW A;  1KGY A;  3BCW A;  5FYC A;  1VPH A;  3WCR A;  1XYN A;  3KGZ A;  3N9P A;  3DV8 A;  5A3W A;  3ZN6 A;  4W6W A;  4DXT A;  2JIG A;  5AC9 1;  5EYX A;  5F3I A;  2GP3 A;  4NPL A;  1VRH 3;  1MPX A;  3URF A;  5TSW A;  3RZM A;  5C4W B;  1ASJ 1;  1IQA A;  2EIC A;  4LKS A;  4XIK A;  5FPZ A;  4YZ5 A;  3J4U H;  4NWV A;  2FMD A;  5IAV A;  4X6R B;  4EN6 B;  3KQ4 B;  1LTE A;  2XHN A;  3M3C A;  1JZ7 A;  4QPW A;  1HIX A;  2JE9 A;  1YJL A;  4AVA A;  4AW7 A;  1RUI 2;  3POW A;  3OF1 A;  4NVP A;  2K0G A;  1RUE 2;  5KHG A;  1FV2 A;  2BER A;  3VDB A;  4XBN A;  2PLV 2;  4URA A;  1UU4 A;  2CYF A;  4DPN A;  2H0B A;  2QUO A;  1QJZ A;  3D8C A;  4TSV A;  1V9U 1;  3W20 A;  2D6L X;  2OII A;  4XZP A;  3K2O A;  3ZXK A;  1PIV 3;  5J98 B;  2QQI A;  3N9M A;  4PT6 A;  4FFG A;  4CCD A;  5FO9 B;  2V5Y A;  4IEQ A;  4M3C B;  5JWP A;  1TE1 B;  1WCU A;  2VUL A;  1GSL A;  3I2I A;  4PIY A;  2VOX A;  3I3B A;  3N36 A;  4J1W A;  4UXA A;  3WF3 A;  5IVF A;  1OA3 A;  2J42 A;  2D97 A;  1QXP A;  2VUA A;  3HEI A;  4JV4 A;  1V6O A;  2CWS A;  5F5A A;  3SH3 A;  1UN1 A;  2V73 A;  3RSJ A;  5T55 A;  2JX9 A;  4ZS2 A;  2HWD 2;  3NVC A;  3I3E A;  2GC1 A;  2VMH A;  2XLF A;  3W9A A;  1U5X A;  3EXU A;  1MEC 1;  5LK7 B;  3W5N A;  4MH0 E;  2XJR A;  5L19 A;  3VN4 A;  1JHJ A;  2WDB A;  1OD5 A;  5HCB A;  4PCR A;  1MVE A;  1T6B X;  2JKX A;  3ZYI B;  3AMQ A;  4O9E A;  4I3P A;  5FKB A;  4COU A;  5J3U A;  1I6X A;  1UPI A;  3SXW A;  3TEX A;  5E16 A;  1LJ7 A;  2QBX A;  1O3R A;  3H3L A;  4YW7 A;  5GZG A;  4QX1 A;  1POQ A;  3P3N A;  4XZU G;  2GDF A;  3MIE A;  1OD3 A;  1WA4 A;  3ZFE A;  5A7Q A;  1IZ3 A;  1AR9 1;  4K21 A;  3IPV B;  2W1Q A;  2ZEW A;  5DZG A;  4EQV A;  3RPQ A;  5EJ1 B;  2RR1 2;  5JSO A;  1G9B A;  1AL2 1;  3LEK A;  3O1U A;  3T2P A;  3A0N A;  1F4A A;  4C90 A;  1C8M 3;  3ZYF A;  4XET A;  4FTB A;  2IXK A;  2XJV A;  4CZS A;  1RUF 3;  2WNE A;  3PVN A;  4KNC A;  4QGM A;  2CU5 A;  3VBF B;  4B8E A;  5JDB A;  3NRU A;  4ASL A;  4QQH A;  5KBF A;  1VMJ A;  2EA7 A;  4QKB A;  1CAX A;  3IAP A;  5DUX A;  3UKN A;  2WS9 2;  4KMQ A;  2Y38 A;  3JQW A;  2W0X A;  4QB1 A;  4C1W A;  1NYW A;  3T08 A;  4AED C;  3ES1 A;  2IXH A;  4OLL A;  3IMN A;  4WVZ A;  4XAB A;  3V56 A;  3WNM A;  5DAP A;  2ZJC A;  3OBR A;  4YLZ A;  3BOP A;  4YSF A;  4AVB A;  1ZRR A;  2BVB A;  1PX3 A;  1ENX A;  3AJY A;  4M3C E;  4BXF A;  4CDQ C;  1R08 2;  3ECQ A;  3VHO A;  1HQL A;  2R1D A;  2X53 S;  4NRM A;  5FTT C;  2A6Z A;  2VO5 A;  3PIG A;  4JAA A;  1O4Y A;  4Q4Y 1;  2GU9 A;  1DGL A;  2NMN A;  5GJ6 A;  4XFF A;  4CEW C;  3C3V A;  3ZXL A;  4MGT A;  1LES A;  1GNZ A;  2PYT A;  2XQR A;  3B5L B;  1PMI A;  4J1X A;  5A7P A;  5JAX A;  4E4D X;  5K4L A;  2XJS A;  4FPC A;  4YG3 A;  3CJI C;  4M3C F;  5A1A A;  5IVB A;  3NV4 A;  4FBF A;  5EHD A;  3FLP A;  5EJ3 A;  1FOD 3;  4QD2 A;  4DY3 A;  5C8W A;  1GLH A;  1KFU L;  1LOB A;  2UYB A;  4QX0 A;  1BQP A;  4L92 A;  2PFW A;  4LR4 A;  4XUN A;  2ATF A;  1CJD A;  2F17 A;  1Z7S 1;  2VTX A;  3WW4 A;  2VW1 A;  2XON A;  3VKF C;  2AUY A;  4MVT A;  2ZX0 A;  1XSR A;  4CUC A;  2RVA A;  4IXL A;  1RHI 3;  3K4Z A;  4EZ4 A;  4J6G A;  3AP6 A;  5F3E A;  5BNO C;  4BIS A;  2P17 A;  1BYH A;  1O3T A;  1VBC 1;  1C5H A;  1CES A;  4CEW B;  4N8M A;  4Q1P A;  3ZLI A;  2D6K A;  2JEC A;  4K7J A;  4KGQ A;  4JDO A;  4WZF A;  2JG8 A;  3KV6 A;  1UY4 A;  4RA0 A;  4BM8 A;  5BY5 A;  2X5I B;  3WG2 A;  4DEV A;  3OGJ A;  4CCK A;  4LJH A;  5BNO A;  1VRH 1;  2LRP A;  4JGY C;  3SMH A;  5CZK A;  1UIJ A;  1B35 C;  1CPM A;  2FZ1 A;  3VBH C;  3IAQ A;  3RNS A;  3DPR A;  1W6Q B;  2WNU C;  1N47 A;  2FDF A;  4LOR A;  3RMY A;  1RTV A;  4AFC A;  4N9H A;  2QZ2 A;  5FUI A;  3KHC A;  4QXK A;  4XJZ A;  4CPB D;  5F3G A;  4FI9 A;  1QIQ A;  2XPJ A;  4CUG A;  3JU9 A;  5GLV A;  4W6Y A;  3WQ0 A;  3ACH A;  2WFF 1;  3T1L A;  3ITQ A;  1J58 A;  2IUW A;  5EWS A;  5KC5 A;  2WIN B;  1W6N B;  3POB A;  2VNR A;  4NID A;  3W59 A;  3VBH A;  4IGQ A;  5J36 A;  5CU1 A;  4CP9 A;  1MZF A;  5FZC A;  2WN2 A;  3Q8A A;  3KF3 A;  4CDW A;  1DG6 A;  3MLJ A;  3CLP A;  4K8F A;  1DZT A;  1ZRD A;  1DCS A;  1V6I A;  2JD4 A;  3VL9 A;  1WME A;  1BEV 1;  3LB9 A;  4DXR A;  5HV0 A;  1GZW B;  1R09 3;  4FPJ A;  1O59 A;  3FBY A;  3LGR A;  2ZAH A;  4BQY A;  5C6C A;  1ULP A;  1IG3 A;  1UXX X;  4QX2 A;  3KVA A;  2FDG A;  1W8U A;  1WCQ A;  4FOV A;  3VD7 A;  2ZHN A;  3VBO C;  3LA7 A;  2E6V A;  4I09 A;  4JGZ B;  4C0B A;  3TEY A;  1AR7 1;  3MFA A;  1MAC A;  1W8H A;  1SBE A;  3KT4 A;  2NLR A;  1RJ8 A;  2WWS A;  4I0A A;  1E57 A;  3VZJ A;  2YZ4 A;  3ZDV A;  4BQ1 A;  4E9K A;  1O5L A;  1PM4 A;  2PAK A;  1JOJ A;  4LTA A;  4XQ4 A;  5FP8 A;  2HWD 3;  2GH2 A;  3RS6 A;  5C9A C;  3C7G A;  3ZXF A;  2VCM A;  5FYS A;  1AR6 1;  1DGR N;  5LA0 A;  5DAB A;  1RVF 2;  1WKY A;  2ARA A;  4QX3 A;  4QXC A;  1X36 A;  2HJI A;  4EJR A;  2X5I C;  1KFX L;  5T54 A;  1AX1 A;  5ANQ A;  1ZZB A;  4ASK A;  2EVX A;  2VR4 A;  2Q8O A;  3VBR A;  4LBM A;  5EIY B;  1ZBE 1;  1HB2 A;  2OW4 A;  3OYW A;  4Q8K A;  3V65 A;  3MI8 A;  3AMP A;  5LK5 A;  2P5B A;  1RMU 1;  4MET A;  1R08 3;  4GJY A;  4R4X A;  3FZ3 A;  3OCP A;  3RDI A;  3LIH A;  4CDQ A;  2OXB A;  1HXS 2;  1F5J A;  2LS6 A;  4NE9 A;  4XPV A;  2RJL A;  3QLQ A;  4XF0 A;  4FPG A;  1WD3 A;  1C3H A;  1W6O B;  3B69 A;  3V0B B;  4HLT A;  1RUF 2;  1NCQ B;  4Q4X 2;  1NE4 A;  4YW2 A;  4AQ6 A;  4XHX A;  4PBO A;  5JUV A;  4Q2F A;  2OA2 A;  5T5L A;  1QH7 A;  1A8M A;  1CX4 A;  4L11 A;  5KHJ A;  1IS6 A;  2RM2 3;  2IFR A;  5LWB A;  3WDU A;  1XQN A;  4PIZ A; 
#chains in the Genus database with same CATH homology
 2W3J A;  3BGA A;  3CIH A;  1UWW A;  4M4P A;  1UX7 A;  1UY1 A;  2W94 A;  5JXI A;  3A23 A;  2Y6H A;  5C71 A;  3ETP A;  2VZU A;  2WBK A;  3MV1 1;  2YB7 A;  3P6B A;  2EIB A;  4D0Q A;  5LCW L;  2W9X A;  1W8O A;  3SEP A;  3WF2 A;  3I2H A;  5F7U A;  2WUH A;  2J1R A;  1NUK A;  1GUI A;  3WSO A;  4W8J A;  1OF3 A;  1F4H A;  2EID A;  3UES A;  4A6O A;  4QB2 A;  3T2O A;  1JZ3 A;  2ZEX A;  2E33 A;  4XUT A;  3C7O A;  3OG2 A;  1JU3 A;  3MO4 A;  2WAO A;  1D7P M;  1ULO A;  2X10 A;  1UYY A;  3A7Q A;  3I3D A;  1US3 A;  3WNK A;  2R7E B;  2VQT A;  1SHW B;  5JR2 A;  4JX0 A;  3OGR A;  4BXS V;  3OB8 A;  3OBA A;  3W5M A;  2VZS A;  1UMH A;  2DCJ A;  4LPL A;  2ORX A;  5IFP A;  2LW8 A;  3AC0 A;  2WO1 A;  4QDQ A;  3HPN A;  4A42 A;  2BZD A;  3VD5 A;  2B4K A;  1HN1 A;  3BN6 A;  1UXZ A;  5B4N A;  3CDZ B;  4OMC A;  3ZM8 A;  2YFU A;  2DDU A;  2HLE A;  3D3A A;  2QQL A;  1JYV A;  4CUB A;  1CX1 A;  2BGP A;  3OEB A;  3HNY M;  3OGS A;  3CKH A;  3LQC A;  4XUO A;  1UY0 A;  2Y6J A;  2RV9 A;  2V4V A;  4PQQ A;  1JU4 A;  4CVU A;  2EIE A;  1JYW A;  4OUE A;  4UAP A;  4IUG A;  3NJV A;  2VCA A;  3GGL A;  1IQD C;  1I5P A;  3DEC A;  3K4D A;  4JHZ A;  4QB6 A;  4BDV B;  1PMH X;  4LQR A;  3I2G A;  2J1U A;  4DUX A;  2WO2 A;  4PF1 A;  2VZ3 A;  1TG7 A;  1K3I A;  4LHS A;  1PMJ X;  4RN5 A;  2WYS A;  1GNY A;  2W87 A;  2X05 A;  2VMC A;  2J22 A;  4AG4 A;  2VMD A;  3MBW A;  2CDP A;  4A44 A;  5LA1 A;  4MOA A;  2VZV A;  2OKX A;  4YPJ A;  3U37 A;  3WNN A;  1O8S A;  1GQP A;  2VL4 A;  2ZEY A;  3VDA A;  3ACI A;  4OZO A;  4ZZ8 A;  1UY3 A;  5G04 L;  1K45 A;  5LA2 A;  2Y6K A;  4A4A A;  4MO3 M;  1NAE A;  1KEX A;  5B4X A;  1OT5 A;  2L9L A;  4QAW A;  3HN3 A;  1NKG A;  2WQ8 A;  5DQ0 A;  3ACG A;  2C26 A;  2WZ8 A;  2J1T A;  4M4R A;  1OF4 A;  4DUV A;  4CU9 A;  1W99 A;  4Z2A A;  4UI9 L;  2VZR A;  5HPO A;  4MGQ A;  3T0D A;  3GDB A;  3WF4 A;  4P5Y A;  4OYU A;  3I2F A;  3UNP A;  4GWJ A;  1J83 A;  1L7R A;  4XUR A;  3NQH A;  4GWI A;  2W46 A;  4XVH A;  1JZ8 A;  1H6Y A;  3EYP A;  3WNP A;  2W95 A;  2VZT A;  4ZZ5 A;  1LNS A;  2CDO A;  3NJX A;  3K4A A;  1RYY A;  3C7F A;  2B9V A;  4TTG A;  5DPN A;  1O8P A;  5G05 L;  1W9T A;  2YC4 A;  1W0N A;  3OGV A;  4E8C A;  3CZJ A;  3EB7 A;  2Y64 A;  2WZE A;  2ZEZ A;  3THC A;  1JYX A;  5DN2 A;  2V5D A;  2YC2 A;  4E8D A;  3MV0 1;  3HNM A;  4DEQ A;  3E1F 1;  1DYO A;  2Y6L A;  2W1U A;  3MUY 1;  5JMO A;  2W1S A;  1JZ6 A;  1H6X A;  3P1I A;  1K12 A;  4XUQ A;  3GM8 A;  1XPW A;  4W50 A;  5IHR A;  2ORZ A;  1JYN A;  3JXS A;  1US2 A;  2BBA A;  1KGY A;  1JZ7 A;  4CU6 A;  2XOM A;  3ACF A;  1J84 A;  3K75 B;  1SDD B;  2YFZ A;  2J1E A;  4DXT A;  1YQ2 A;  4KI5 M;  3K46 A;  4P00 B;  1MPX A;  2W92 A;  2EIC A;  3FHA A;  3SEE A;  4LKS A;  1T2X A;  5JXJ A;  1P8J A;  1CZT A;  5A1A A;  2XHN A;  3DYM A;  2QQM A;  4QPW A;  1PX4 A;  2BER A;  3VDB A;  4ARX A;  3F2Z A;  3T09 A;  1NX9 A;  2QQI A;  3T0A A;  3DYO A;  4PT6 A;  4P02 B;  2DCK A;  2KD7 A;  2RJ2 A;  3I2I A;  3I3B A;  3WF3 A;  1K42 A;  3CQO A;  3HEI A;  1UMI A;  4CU7 A;  2J7M A;  3THD A;  5DMY A;  4DUW A;  1XNT A;  5J1X A;  3WNL A;  2WO3 A;  1EUT A;  4ET7 A;  3I3E A;  3SKJ E;  1L7Q A;  3SKV A;  3W5N A;  2VZP A;  3NNG A;  1CZS A;  1JHJ A;  4ZXE A;  1JZ5 A;  2WDB A;  3III A;  2E31 A;  2JKX A;  3VD3 A;  2QBX A;  2WAB A;  4QX1 A;  1GOG A;  4XZU G;  3A22 A;  1OD3 A;  4BK5 A;  2J1V A;  1JZ2 A;  3HOB A;  2W1Q A;  2VCB A;  2ZEW A;  2Z4F A;  4QDS A;  5EJ1 B;  3DYP A;  3LEK A;  2C9K A;  3T2P A;  1F4A A;  5IYY A;  3FL7 A;  2VQU A;  2ID4 A;  3NRU A;  4OMD A;  3IAP A;  4KMQ A;  4QB1 A;  3WNO A;  2VM9 A;  3T08 A;  3A21 A;  3WNM A;  2VC9 A;  3FN9 A;  1PX3 A;  4D8M A;  4JKK A;  1R64 A;  3ECQ A;  2VO5 A;  2J1A A;  3PUI A;  3VD9 A;  3T2Q A;  3C8X A;  5EJZ B;  1GOH A;  2VMF A;  3OEA A;  5JXH A;  3LEG A;  2JE8 A;  4QX0 A;  4L0P A;  1W9W A;  4XUN A;  2PQS A;  2XON A;  1XNA A;  2JDA A;  2VZQ A;  4CUA A;  4BJ0 A;  4CUC A;  2RVA A;  1GU3 A;  1DP0 A;  3K4Z A;  2VME A;  3FHQ A;  4HG6 B;  2VOT A;  3J7H A;  4CU8 A;  4JKM A;  4XUP A;  4ZY9 A;  1W9S A;  4ARY A;  1GOF A;  3WEZ A;  5IJR A;  3WQB A;  3GXU A;  2BGO A;  1UY4 A;  3C7H A;  3WF0 A;  4DEV A;  3VD4 A;  5JXG A;  3K77 A;  5CZK A;  1GMM A;  1XC6 A;  3IAQ A;  3IB3 A;  4AAX A;  5I0D A;  1BHG A;  1SG3 A;  3IDA A;  1W8N A;  5FUI A;  1JZ4 A;  3I97 A;  4FI9 A;  2VZO A;  2QQO A;  2W47 A;  3MUZ 1;  2XQX A;  2VCC A;  2E32 A;  3ACH A;  2J1S A;  5C70 A;  1CZV A;  1CIY A;  1TVG A;  3I2K A;  1JI6 A;  2W5F A;  2QQK A;  4BK4 A;  3LE0 A;  5CYY A;  2WN2 A;  2WN3 A;  3C7E A;  3CMG A;  2W1W A;  4MGS A;  3I2J A;  3PUH A;  3HNB M;  4DXR A;  2W91 A;  4TXW A;  3T0B A;  3LEI A;  1O59 A;  5C7G A;  1ULP A;  2HYX A;  4A3Z A;  1UXX X;  2X09 A;  1OH4 A;  2V72 A;  4QX2 A;  5HXM A;  1WCQ A;  3VD7 A;  3LPF A;  4W4Z A;  4JKL A;  4MAD A;  3UET A;  4DXS A;  4KWU A;  2Y8K A;  2ZXQ A;  2JD9 A;  2VZ1 A;  3C7G A;  4P08 A;  4A41 A;  2QQN A;  5LA0 A;  2VTF A;  1WKY A;  4QX3 A;  2YG0 A;  1UZ0 A;  1UY2 A;  4RYD A;  1UYZ A;  2VR4 A;  5EIY B;  3CZU A;  4QDR A;  5IFT A;  1UYX A;  1DLC A;  2LS6 A;  4A45 A;  4UOJ A;  3HJR A;  3LPG A;  4GZ9 A;  5JUV A;  1EUU A;  2VJX A;  2QQJ A;  2WAA A;  3WF1 A;  3VDC A;  2E26 A;  3ABZ A;  2Y6G A;  2C4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...