1PGSA

The three-dimensional structure of pngase f, a glycosylasparaginase from flavobacterium meningosepticum
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
311
structure length
311
Chain Sequence
b'DNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVIQYNKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)ASPARAGINE AMIDAS
molecule tags Endoglycosidase
source organism Elizabethkingia meningoseptica
publication title The three-dimensional structure of PNGase F, a glycosylasparaginase from Flavobacterium meningosepticum.
pubmed doi rcsb
total genus 75
structure length 311
sequence length 311
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 1994-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pgsA02
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pgsA01
3MIBA 3MIGA 3MIDA 3KS7A 3MIHA 3MIEA 3MIFA 4QHBA 3MLLA 1YIPA 4R4ZA 1SDWA 1PHMA 3MICA 3MLJA 3PMSA 4R4XA 1OPMA 1YI9A 1PNFA 1YJKA 1PGSA 4E4ZA 1PNGA 1YJLA 3PHMA 3MLKA
chains in the Genus database with same CATH superfamily
5F2SA 2IVIB 4DEVA 2FDIA 3MV11 1MZ6A 4LIVA 4CUCA 1AXYA 5BUVA 2ZGRA 3BI3A 4XCAA 1JHJA 1JBCA 1NX9A 1UOFA 1PIV3 5IYYA 1APNA 2Y6HA 5ERLA 1BHGA 2RG4A 3WNLA 1Y7BA 5L36A 4XTPA 5H9PA 4EWDA 2C6SA 2JICA 2WN2A 5F1RA 1DIWA 1DGLA 1ND3B 2VQUA 2XWJB 2E26A 1UOGA 1UOJA 2P3KA 2G19A 4CU9A 3AKTA 5A3TA 2YBKA 3USUA 1JOBA 3A7QA 2VO5A 1G9FA 2ZA9A 4LR4A 4FPGA 2HWD2 2W52A 1NA1C 1MS5A 3LFMA 2JE8A 1ENSA 5DXDA 5A6ZA 4XBNA 2B39A 1RUOA 1XNBA 5AVPA 1JYXA 4GH4C 5DG2A 5JDBA 3RZGA 4DNYA 1I5PA 5F5AA 4DMIA 2GN7A 5CFCC 4XQ4A 4F8AA 1GKBA 3LOBA 3HR9A 3ITQA 4AI9A 4DOUA 2PTMA 5FMOS 4R9CA 1RUD3 1FPN3 1VBC3 2ILMA 3CJXA 4NIDA 1FX5A 2W94A 1RJ7A 2RE9A 1W9WA 4J1XA 2WWSA 3HBZA 1CR7A 1J1TA 1GWMA 3E5UA 1G9AA 1MZ5A 3JBG3 1J84A 4CCDA 1K3IA 3M70A 3CJIA 5A70A 3R6SA 4D6RA 4NWWA 2XQXA 3LEMA 4RGGA 1HB4A 1RUH1 2QUOA 4Z07A 1VJ2A 4XAEA 4GWIA 2EALA 2JG9B 2R1DA 2VMDA 4QHOA 3HNMA 1QEXA 1Z0HA 2C9AA 2EVXA 4LBQD 5JR2A 3AMPA 1W8HA 1CZTA 3ZR5A 1NLRA 5A32A 2ZEYA 5AVAA 1IG3A 1PHMA 3GF6A 4WM7A 5FK8A 4N43C 2CDPA 2WZPP 3WNNA 3AXDA 1TMF1 3P6BA 2XKOA 4QXKA 3U4XA 2X8KA 5E8AA 1DYOA 1HRI1 4AVBA 5JZGC 3ZN6A 3K77A 2YDEA 1STMA 5LW9A 4AI2A 3OUHA 4GMP3 1UOBA 4HVOA 1UMHA 4AQTA 1VRH2 1UZ0A 3DCQA 4F83A 2XJQA 1YJLA 1H2LA 1KJLA 4CCKA 3HOBA 4JGYB 2ZGPA 5FY4A 4HG6B 4I30A 4NHMA 3W58A 4DIQA 4IE7A 2R32A 5H9RA 1JZ6A 5C33A 5C6CA 1VIWB 1V9U3 4XUNA 2NZ9A 1TMF2 1WCSA 3JD71 4XUQA 5LY2A 2ZBJA 5HBAA 5I0TA 2VNOA 1SLLA 3IDCB 5CNAA 5ANQA 4CVUA 5IAXA 1YYNA 4URTA 1SLBA 1E5SA 1H9PA 4CTEA 1DQ6A 5J09A 1C1LA 4IW3A 4LLOA 4RA0A 1AL23 5BNQA 4FPHA 1H6YA 4ZY9A 1MPXA 3LPGA 1ZZBA 3K51A 4A3XA 2V4AA 2D3SA 2DCYA 2R061 1AR83 2BUKA 3KCYA 5FO8B 1FOD1 1KJRA 2PHFA 2WFF3 5FP4A 5T5JA 1ACCA 5CA6A 1KRIA 3AC0A 2WIIB 3PVEA 5CAZA 2WBKA 3VZLA 1UZWA 1V9U1 4LK7A 3VBUA 2YGLA 5G04L 3MDPA 3AKSA 2Y6LA 2VG9A 4B4QA 1QNYA 3O1UA 1SDWA 3HNYM 4LA3A 2QQWA 4ES9A 3H42B 1YQCA 1DZRA 3P5BA 1XU1A 1HRI3 2GALA 3E5XA 5GM0A 4B8EA 2LS6A 2WO7A 1GOGA 2VOWA 3O5SA 2VBPA 3N7KA 3BU7A 4FPYA 2VECA 2RS33 4GH4B 4DUWA 5FIXA 5ANNA 4QKDA 4ZXKA 2ETEA 1W6NB 2V73A 3BIWE 5KXCA 4I3GA 2Q1MA 3O1VA 1CPMA 2WNUC 3P3PA 3ZM8A 5FYVA 2R042 4DZGA 4HVRA 5A3NA 3E1F1 4N7IA 4YW4A 2V5YA 3EMRA 3AFGA 4DINB 1CONA 1OVPA 1XNTA 5JVVA 5LA9A 4RD7A 2FMDA 4BIOA 1ZX5A 1U12A 1VBE1 3FLTA 2WSUA 3U37A 2JKXA 2Z2SB 1HDKA 1W8FA 1ST8A 1VBD3 1XE0A 2O8QA 2ZPXA 2GNMA 2OS2A 3DYOA 3JBG1 3K48A 3O7OA 4XFFA 3TEXA 2A6YA 2SLIA 5LA2A 4QU2A 2RJLA 3OOXA 3ZSLA 2X5IA 3NV1A 1ULFA 4ZPIA 4C1WA 4P9IA 4QX7A 3ZFFA 1LNSA 4PBPA 1FPN1 1VBC1 1J3PA 1OF3A 3MEPA 5FZ3A 1YWKA 2QJVA 2VCBA 5LK7B 3RZLA 2P2KA 4E4DX 3HEIA 1DLLA 4I3PA 3N4MA 2JWPA 1LULA 4FPKA 5DDJ1 3ZVXA 5KHKA 2VCMA 2EIEA 2P6HA 1OA4A 5F3EA 2VBBA 2PQQA 1OURA 4OLLA 4XW3A 2YPDA 1ENQA 4NE9A 3KV9A 1RHI1 5I0RA 5FY8A 2DVBA 2DYCA 2LALA 1S0IA 3ES4A 3Q8BA 4XHBA 5C3PA 3NSTA 4AI0A 2JIGA 4BMBA 2R49A 3KLSA 1NY71 4YSFA 1W3XA 1YUDA 1RMU3 4WM8C 1RUI3 1ZZCA 3UNPA 1J3RA 3KM5A 1SFNA 2GN3A 3N7LA 4UT5A 4MHUA 5A3WA 4M3CF 4YVSB 4FQ4A 4X8NA 4ZS3A 1XB9A 1XJAA 3CZJA 1FMD2 4E8CA 3C7OA 5FXZA 2XJUA 1V0AA 2WNVC 1ZRDA 3AL6A 4Q8KA 4LORA 3Q8CA 1VB2A 3LOIA 4YW2A 4FOYA 4AGVA 5A3UA 2ARAA 4L99A 4RL7A 4Y24A 5FYHA 4IE0A 1RHI3 1ENXA 3CNAA 4XMIA 4MGTA 1W2UA 1LB2A 2D3PA 2FZ1A 5GLUA 2DTYA 4QQ2A 4XC9A 1F2NA 1SZBA 1XYPA 5D2AA 1NA1A 1D0HA 2ES3A 1JU3A 1Y4WA 1WW4A 4ZU7A 5F5QA 3BU0A 3CBNA 3MHZA 2BVVA 5DDJ3 2ZGKA 1S4CA 2AREA 2D6KA 3HN1A 4FCAA 1RUJ3 3PURA 4IEWA 1I3HA 4JAAA 2FD8A 3R4SA 1KDMA 1XQNA 3POJA 5FZFA 2A1XA 1O91A 1UW8A 1GSLA 5A33B 3H1WA 2PMWB 3RZJA 3ZFEB 1ODMA 1W05A 2K2SA 2J1RA 4ARYA 2BP6A 5FY0A 1Z7S2 1LU1A 3GM8A 5FUNA 3VDDB 4CZSA 4U36A 2OA2A 4A42A 3DF0A 2PHXA 3JB8A 4HKOA 3IM0A 5F2WA 2YC2A 3ZXGA 4CUBA 1UD1A 1S2KA 2VULA 3C7FA 4FSJA 1C4RA 1CVNA 1OUXA 3PVOA 4K8FA 2RJKA 1VBE3 3LIGA 5LWBA 2GC1A 3HWJA 4R52A 5FPBA 5AFBA 3FZ3A 3K4AA 3RNSA 1ZRCA 1VMHA 1CJPA 1PK6C 4QT6A 3MIGA 3MIFA 4DEQA 1ZRIA 3K4DA 3G7DA 5IK5A 2V4VA 2VCCA 2BBVA 2B45X 5BNPA 2BGOA 1S0EA 4Y22A 1OKQA 4Y20A 5F9TA 3B7MA 3BTXA 3CLPA 3FL7A 5FOJB 1HLCA 2P3IA 4BQWA 1C57A 3LB9A 4XF3A 1Y9QA 1SLTA 2HWF2 2R043 4MYEA 4W50A 5A7WB 5A3PA 4TTGA 3I49A 3IIIA 3J7MA 4WVZA 5FOBB 4A6OA 5FXWA 4CDXA 2I74A 2Q8OA 4XVHA 1NZCA 1I5ZA 3HQUA 3IIAA 4XJUA 4QQHA 3PLQA 1H2KA 1SHWB 2E31A 4Q0QA 1J58A 3TWIA 1CIWA 2OQ7A 4RS5C 4OI4A 1TVGA 4JGZB 3EO6A 2QQOA 1VBD2 1EPWA 2VMEA 5JXGA 1C8M1 2XHNA 4YFWA 3I97A 4YM0A 4KWJA 3VD9A 4X6QB 3PJYA 5BPXA 2DBNA 1LHNA 1UYPA 2CAUA 2J22A 4RGAA 1LEDA 2VZTA 2JDZA 4AVTA 3WR0A 1S2EA 1HXS3 2Z79A 1B35A 2BEOA 3U1XA 1WW7A 4MGIE 1BXHA 3D0JA 3U10A 1N3QA 4BOWA 1JW6A 1ZBE3 1WCDJ 2XWBB 1HQWA 5DUUA 1VAKA 3VBOC 1LENA 2F6BA 2HH9A 1CAWB 2R30A 3MLKA 2CWMA 3FJSA 4A7KA 1AYM3 2UU8A 1SPPB 4W65A 5BNNA 1MQTC 3T30A 1SBFA 1PX4A 1A6CA 2ZEZA 3EJKA 3SEPA 1KFUL 5BNNB 2QKDA 3AMHA 4PI0A 3ZPYA 3SCGA 5KWRA 2WZR3 5F5CA 5DABA 4YWAA 3POBA 5FO9B 4GB33 4K21A 4IUGA 1YJKA 3DYPA 5FCCA 2J1VA 3OUIA 5CVRA 1VR3A 4IV1C 1NKGA 4R9DA 4YGCA 1D0GA 3HBKA 4M00A 5F6KA 1ASJ1 4UFHA 3F2ZA 4NIIA 5LRSA 1H1MA 1TZOA 4FAGA 5B4XA 3VBUB 4CP1A 4XZPA 3KF3A 2PAMA 1G8WA 2D7FA 2BWCA 3C8XA 5FTTC 3UGGA 2RR12 1SCRA 4Q0VA 3ZIWA 3WNPA 4FP3A 5GLWA 1Q8PA 4CDUB 5IHRA 1E5HA 2ZOEB 3WSOA 5IK7A 1YRZA 1WZXA 3T0AA 3WOGA 4AYUA 4BDVB 1LTEA 5EHDA 4D3WA 2PA7A 3PVBB 4RSUA 3IB3A 1AHSA 4XDPA 4AXOA 5IATA 2WNUA 3LDKA 1XYNA 1LECA 4FPOB 1QJX3 5ACA1 4C91A 1S0DA 1XNCA 5G05L 5DZFA 2IVJA 1VBB1 2WN3A 1AYN3 2PQSA 3ROUA 1YNAA 2R073 2VXJA 2HWE2 4XUTA 4PF5A 4YGBA 2Q5TA 1N47A 3N9MA 3T1LA 2MNGA 1RUF3 1W6NA 3IWZA 3VBFC 3T2QA 2OX0A 1UY4A 2WO1A 5DZEA 5LBFA 5BYNA 4GH4A 1DLCA 3OYWB 1AYN1 3VBRA 3H7YA 3I2KA 2RS12 4IDZA 4TYSA 4I01A 3BTZA 4Q4W1 2HYKA 4LNVA 4BLJA 1W2OA 3VKMA 1NQJA 2DUQA 1MS0A 1W8NA 4NVPA 2GP5A 3ZIXA 2WA4A 5FZOA 3KHBA 5BNOB 5FR3A 4WVWA 4PIYA 2G9FA 3MF6A 1AXZA 1GICA 3K46A 3E5QA 3S6PA 4FPEA 1RUG2 3IDEA 3WDYA 5FQ0A 3KQ4B 1WMDA 4JKLA 1UPSA 4Y3OA 4CP0A 4S2DA 4IGQA 3T4HB 2WFPA 4A7YA 1RUE3 2A3WA 4Q2FA 1ZBA1 1DQ2A 1R1A1 5GZDA 1IS6A 2AUYA 5JAXA 1NLQA 1PM4A 2QE3A 1GOHA 4LHLA 3WEZA 5SV5A 4EZHA 3ASIA 4DY5A 1CAXB 3SH5A 3AZZA 4D7TA 2RDSA 1LOGA 3NNMA 1GNZA 1T6BX 4FFGA 3A21A 5DN2A 1Y43B 1V6LA 5D8AB 3WCRA 1W2NA 2A7AA 3ZPOA 3HPNA 3OF1A 1S0FA 3FUQA 2WNVA 2W1WA 2IXJA 4MLOA 2AACA 4FTBA 4QPIC 1DGWA 4UW5A 5FYYA 3NV3A 2R0FA 1JYVA 3NVCA 1E5RA 1UKRA 4KG0A 5C4WB 2FZ2A 3AB0A 1GQPA 2A73B 3LEIA 1AYM1 3NAPA 3OEAA 4L9BA 4N7UA 1N1SA 1QJZA 4K8RB 5FYUA 4PF1A 1TME3 1W6PB 1W9SA 1I9RA 4LKSA 3MZHA 1S0BA 1EP0A 4QPYA 5FYIA 5JXHA 5JI7A 5KHHA 1C8M2 3BKZA 3VD4A 2HWC3 3IMNA 1GV9A 3IPVA 5KR7A 4KBZA 5DQ0A 2Y0IA 1REFA 2RR11 1KDKA 2UURA 1U5YA 1OQEA 1GQGA 5ABJB 2BOIA 1C5HA 3AP5A 2LW8A 3ZYRA 2WZR2 1YHFA 1S1AA 3TB0A 2B8MA 1ZBA3 2YU1A 4AQ2A 1LGNA 1BEV3 5J37A 4XILA 1RUNA 4P9YA 4LITA 4CPBA 2BV4A 2O8OA 1JZ3A 4HT1T 1PK6B 3L9JT 4HXCA 1YFYA 2Y38A 2E7AA 4BQ2A 3RZMA 2XGXA 1QIQA 2E7QA 2VUCA 3MW2A 4CUGA 3IAPA 2RM23 2KD7A 2DDUA 2HWB1 1WGPA 4LO7A 4UXAA 3VBSC 4OHWA 4NRMA 3HNBM 4LBJA 3PDQA 4GJZA 4CP9B 5A3MA 4YVSA 5I8YA 3RZKA 5K0UC 2N7GA 2ERFA 3X29B 4YM2A 3LA2A 5K7PA 3V0AB 3TEWA 4DPNA 4MH0E 4OMCA 2WZEA 1QJY2 4AVCA 3APBA 2VUDA 2GP3A 2YFUA 4HVQA 2R0HA 4XFBA 1JYNA 4QX2A 5BNPB 5C5UA 3MI8A 2YFZA 4LBKA 3UKTA 3WX5A 1EV12 4YZ1A 2IXCA 4XAAA 1QJX2 3B5LB 3H1YA 2ARBA 3DPRB 3WDTA 5IFPA 1QQP2 1A8MA 4RHV3 5JXJA 2VZRA 5HXVA 1ULPA 3LSEA 1ND2B 3A4UA 1PO13 1CX4A 3BODA 4YW6A 3WCSA 1AR63 3WDUA 1ZREA 3I2GA 2HWE3 4TLGA 4IE5A 4AVSA 4PCRA 2KM2A 4OI1A 2QQKA 3KT1A 1V6NA 2HEVF 1ONAA 3D82A 4DQAA 4AEDC 1AL22 1ZZ8A 3M8LA 2VOTA 4BM8A 1WCUA 5A3OA 2VD7A 5IVVA 5CZKA 4L0PA 5FWEA 1D4M1 2ZX0A 1LJ7A 3I3QA 3DPRC 4BXFA 3D4KA 3MIHA 4RQPC 5FZ0A 1W8TA 4IEPA 1XBFA 5FJKA 4MVTA 3FHAA 1X8EA 3U75A 3S7EA 1WMXA 1LOBA 4E4HA 4MSVA 1ASJ3 4Y1UA 2RS52 4FPLA 1BZWA 2MEV2 4XDOA 4AQ6A 3NNJA 3I4IA 2YUEA 5FKCA 5GZEA 1CAVB 2ADEA 3ZXLA 4CCEA 3OY8A 5ABJA 3T4VA 1RVF3 1JTZX 4S2HA 4N53C 2D5FA 4Y22B 3GZTB 4IV1B 3RRDA 1FYUA 2D97A 1H6XA 4LJHA 1XOYA 1QQP3 1RUD2 3N7JA 4R9AA 4C8DA 1I1EA 4D8MA 1NCQA 5F7UA 4BE3A 2PHWA 3VL9A 2ZEXA 3BYWA 3CO2A 1PX3A 3PJQA 1LHOA 4W8JA 3AZWA 3IDBB 4Q5OA 4XF1A 3ZO0B 2VCAA 4C0BA 1FNYA 2LROA 1O8PA 4QD2A 1T6GC 4CCJA 2QZ3A 3KB5A 2BERA 4HANA 1NAEA 2WWUA 4XETA 4NPMA 2PYTA 2ZKNA 3VV1A 1D4M2 2FDJA 1ULOA 2ARCA 1HV1A 1PMJX 2ZTNA 4PHZA 4XFCA 5IAVA 5C8CA 4XPVA 1PZ7A 3ZSMA 4C1XA 1M06G 1POV0 2VZOA 3IZOA 1H2MA 3PIGA 3RDIA 4A4AA 4CCNA 2UWAA 2DCTA 4L92A 4QGNA 2WDBA 2BJSA 3MV01 1UZZA 1IS5A 1W2AX 2O14A 3ILRA 2VVEA 2VW2A 4OQ8A 1AR73 4TN7A 2P3JA 1C8M3 1Q8VA 2MEV3 2W9XA 4QGMA 4AVVA 4ZKTB 1YCIA 3RPQA 4OUMA 4MGQA 1H8TA 2HKXA 4FFIA 2FMYA 3UL2A 2A6VA 4HK8A 5CFDA 4CDUA 1VPHA 2HEWF 2X10A 4DS0A 4FAHA 4UW3A 4YM3A 3EYPA 5FLHA 2ZAHA 1BLZA 2W0XA 2R041 3AZYA 4NJ4A 3M7AA 3WNXA 3URFA 1UNBA 4GAZA 3RYRA 1XNAA 2VMIA 5EFUA 2J1AA 3IKWA 3ETPA 4Y20B 3ZSEA 5FDBA 4AR2A 2F4LA 5KHGA 3I59B 2BPA2 4XACA 2XJSA 5B2GB 4GMP0 1XNDA 3ZYGA 1NCRC 2JXAA 4ZONA 4NHXA 4OHVA 3KD4A 1Q43A 1OH3A 1V6MA 5FYTA 3I2IA 4XUPA 4FTEA 3BN6A 1L7RA 4HN1A 4LE4A 4UFIA 4LBMA 3CQOA 3I54A 4YM1A 3VBHC 4JTNA 1AR82 1SLCA 4FVVA 1PGW2 1PO21 4Q4Y1 2HWD3 4XF4A 4ZU5A 3LEKA 5I0SA 4FTSA 2JDNA 2PN5A 2WFF2 4HMZA 2OPKA 4NN0A 2QBXA 5IWFA 2GMEA 2A71A 1LAJA 4XABA 1O4ZA 2B9UA 1CAWA 3O1MA 1UN1A 4BH9A 3U14A 5CKNA 4LOSA 4I0BA 4FBFA 2Q1FA 3ZKUA 2CTVA 5FMCA 5EQUA 2KXLA 2FQPA 1REDA 2NPIA 3LCPA 5LB6A 1U5XA 1B35B 4P9LA 2UYBA 1PK6A 2IXKA 3OTFA 3CMGA 3ZMNA 4A7ZA 3NNLA 4XF0A 3J8F1 1AR71 4IV3B 2VMGA 5FMBA 3EXUA 1F15A 2VH9A 3JBG2 4HL0A 2PFWA 4OHXA 2YMZA 4BPZA 2WUHA 3FHQA 3K3NA 1AYM2 1DYKA 2RS32 2JD9A 4XXPA 4BXSV 1JODA 1OPMA 1OC1A 1C1FA 3SKVA 3POFA 4JGZA 3UJQA 4A2UA 5C5TA 1MEC2 1HRV1 4IGOA 1PGL2 1JI6A 1MVEA 5CFDC 3W9AA 1YFWA 4KWUA 1F4HA 4K20A 3VKOA 1R092 2G9ZA 5FY1A 1W6PA 3LFIA 3WG4A 1OA3A 1R1ZA 3D8CA 3D6EA 5FZ1A 3SHRA 5C8WA 4XHXA 5FZBA 3MIDA 1IQAA 1SG3A 4IETA 4OYUA 4MXVA 5BNOA 1OH4A 2WQ4A 4IEYA 4QXHA 1RVF2 5KC6A 3LWCA 4X6RB 3B9IA 3N9QA 4ASMB 1LHVA 2Q8DA 2Z4FA 5FUIA 3ZXDA 1XPWA 4QMAA 4MO3M 4FT8A 5I8TA 3SMHA 4ASLA 4COWA 3FLRA 5T5LA 1SLAA 2JIJA 2XJVA 3C7GA 4Y4YA 3POGA 3EHKA 2XMLA 1W06A 1ODNA 1AF9A 4GIQA 1K42A 1W8ZA 4EROA 2E51A 5FZ4A 5JCTA 1LOFA 2FBEA 4BQYA 2DUPA 4GULA 1UZYA 1GLHA 2XG3A 5A7OA 1MEC3 1L7QA 1N1YA 1C3HA 1OA2A 1C8NA 1P8JA 2PAEA 3WHTA 5JIUA 1TNFA 3ABZA 3VDAA 4W6YA 2X05A 3RS6A 5EIYB 2X5IB 5FZKA 2K46A 2E6VA 5FZ7A 1R081 2EA7A 4P9JA 1RMU2 4QX8A 4Y1YA 5LBEA 3ZDSA 4DXZA 2HWE1 4NAOA 3CJIC 1RVF1 1BYHA 3CHXA 4AAXA 1BVVA 2OZJA 5K4LA 3WZ1A 1LOAA 2Y8KA 4XUOA 3B69A 2YC0A 3K75B 3I3EA 3MPPG 3NJYA 5CEHA 1V6JA 1XC6A 4GZ9A 3AM2A 3S57A 5K8SA 4AW7A 4A3ZA 5A3LA 4OCTA 1H1IA 3BIEA 1HN0A 2DVFA 4N9IA 1ND3C 1QJU2 2C26A 3POIA 5FXVA 3RI9A 3H8RA 1PGL1 2JENA 4YW7A 2HLEA 2JEMA 1RUG3 1OOPA 3KMHA 2IFRA 2RS31 1PMIA 2C24A 4QXCA 2NN8A 3VKNA 3ZMOA 2J1UA 2W47A 5BNOC 4LA2A 4BK5A 1H8VA 4CDQA 2QQMA 1GZWB 3KV5A 4JRLA 4E2QA 1O5UA 1W9TA 5APAA 3O1PA 1GFF2 1F8VA 3KF5A 1AXKA 2HWB3 1UIJA 2RM21 3PU3A 5A32B 4RHV1 2WZ8A 3AVRA 3RFRA 1QF3A 1NZIA 4AFAA 3W21A 2XPJA 5H9QA 4Z1VA 3INAA 3V0BA 2ATFA 4L11A 4QHZA 1JU4A 3VLBB 5D8AA 2B9VA 2UWBA 4INDA 1YEWA 4NHYA 1AX1A 2WFF1 3MUZ1 3AZVA 2WA3A 2FDGA 3TN91 4LBQB 1ZRRA 3FHIB 1PGW1 1PO22 2DVAA 3GZAA 4Q4Y2 5IVBA 1REEA 2RR13 4Y5SA 3NWKA 5IVEA 3D5OA 3U78A 3WT3A 3NMBA 3E6BA 5EWSA 3ME2A 4JCKA 4P9XA 5FLJA 1GZCA 4HBNA 3ETQA 3KT4A 3O0VA 4JC1A 3UGFA 1QJU3 1HQLA 2MPFA 4DXRA 1TME1 2IC1A 1HX6A 3I8TA 3TOJA 5FFOC 4EV0A 4H2AA 1XE7A 2VQ0A 4YRDA 4JGYA 1S0CA 2LUWA 3NV2A 2A6XA 5F3GA 2VNVA 5FYMA 4AEJA 3OBTA 4GWJA 2W1QA 3E6CC 1W28A 3AK0A 4L2NA 1K5MC 1BBT1 3ZKYA 1OOPB 2W1SA 4N53B 4AEMA 1RUF2 4W6WA 4RR3B 3GALA 3OUJA 2DF7A 4FFHA 1W9FA 4WVVA 3HN3A 3WG3A 3W59A 1RB8G 5T54A 2DFBA 4WM7B 3VN4A 1WCKA 2IUWA 4XIOA 4YZ5A 2WR9A 5CG8A 2Z42A 1X9TA 1Z78A 5F3IA 2E32A 5GZCA 4GQ7A 3G6JB 2UY9A 3WNOA 2HEYF 2GH8A 3LDRA 3ZYFA 1IPJA 1OBNA 1CX1A 1J59A 3PUHA 3MW4A 3B01A 4WVMA 5F32A 5HV4A 2YZ4A 1K5JA 1AZDA 2TUNA 3PL0A 3LQCA 4XYXA 1RUC2 1WKYA 4YG0A 4AFDA 4DFSA 3JU9A 1IZ3A 1ZBE2 3BALA 4K40A 4UOJA 5K0UB 2LRPA 5CIRA 4QB1A 2BOJA 3SCHA 1XRUA 4HPKB 5FKBA 1IQDC 3ZYHA 3POSA 2FDFA 1BMV2 4MXWA 4CCMA 3D0SA 1NUKA 2WLPA 5LEKA 2BRTA 2GNBA 1RUD1 2JDUA 5K0UA 4YW3A 2X29A 3NNGA 5IJRA 3NJZA 5K9YA 1JZ5A 1G7YA 3HVDA 3SNMA 4Y4RA 2YYOA 4R8HA 2JD4A 2EXKA 5I93A 4EN7B 3VKFC 2VJXA 2R071 5JZGA 4R4ZA 3WINE 2IZWA 2D98A 2QFEA 2VNGA 4FI9A 3RVHA 5KXBA 1WW6A 5IVFA 3N9LA 3FC0A 1IS4A 4BMEA 2PAKA 4IEZA 1PZ8A 5EZWA 1O3RA 1PVC3 5SV8A 3RJRA 4AZZA 2GC3A 1OLQA 5FZCA 2JKBA 3I2HA 2VZ3A 1NLSA 1YIFA 1K5MB 1GP6A 4FOVA 1IPSA 4Q0PA 4WM8A 4NRQA 5IFTA 2JG8A 3I2JA 2FCTA 1DGWX 1RUC3 2V5DA 1HJGA 5FZDA 4DUVA 2HWC2 4ATEA 3VBFA 1YQ8A 4JX0A 4LOTA 3FFQA 2YGMA 4XE9A 1RUF1 2BGCA 2GDFA 4AEDA 1W99A 4DUXA 1QH6A 1YFUA 4LTAA 5J7MA 4J1WA 1SACA 5FUPA 2HWF3 4OFGA 1ZRFA 1YQ2A 5AC93 4AWDA 1VBB3 3GZUC 4YZ4A 5GALA 5ISLA 1OPOA 2WSVA 4OZXA 2B42B 4LO8A 1DFQA 2XJRA 1YO8A 2W5FA 1LKNA 4NHKA 5FPXA 1G9BA 1W3VA 1MACA 3BOWA 2FCUA 4UAPA 2NP0A 3PUQA 2P34A 3FWEA 4D7YA 1YQ6A 2YBPA 2WS93 4BQ4A 2A75A 3ZYJB 5FZ9A 2XJTA 2BU9A 2W3JA 4GB31 1W90A 4PT6A 1NY72 3MUY1 2VZUA 5BNPC 3E97A 2ZKLA 1XXNA 3AKRA 2ZACA 1QJY1 5J96B 4FQZA 1SCSA 4W6XA 2A3YA 1MS4A 3I2DA 5EP9A 3AYEA 4NIAA 5FV3A 2Q8CA 5FMDA 1PVC2 1UKGA 2R1BA 2IXIA 3PU8A 4AHZA 2VPVA 3TN92 3I7DA 3V0BB 1GNYA 1T2XA 1ZBE1 2ZX2A 1GWKA 2JDPA 2ZGLA 3ILNA 2A6WA 2OUJA 4IEVA 4UBGA 3H7JA 1XSRA 1JH5A 4CEYA 4M3CA 4UF0A 4CDXC 4P5HA 1UQXA 1WD4A 3QOPA 2WZR1 2Q8EA 1OQDA 2ID4A 4B1LA 5EV7A 4QPGB 2EICA 5JOZA 5L7OB 5CU1A 5FP9A 3I3BA 2JDYA 3OCPA 4BWOA 1RTVA 2QQIA 3OPWA 1NG0A 1DZQA 4YYOA 1QDCA 1DQ1A 3UT0A 4D7SA 1LHWA 4CP9A 2ZGSA 4FXGB 1POQA 3JB4C 3WQ1A 3T3YA 1FNZA 4EZ4A 2GSYA 5E89A 4A44A 4CP2A 2L9LA 4I09A 1SDDB 4I02A 4V1PA 3SCFA 4F3JA 5HPOA 1ULCA 1RL3A 3BUCA 1CGPA 1GYKA 1JHNA 1K45A 1OFSA 3Q8EA 4Q1RA 3WP3A 5T55A 3B9CA 4QDRA 4UFMA 4NIHA 2NMNA 2W87A 3UV9A 2HBTA 3J8F3 1J83A 1XE8A 4ISRA 4QQPA 2OVUA 1D2SA 4EN0A 2XR4A 3RSJA 3PUIA 1GU3A 2ORXA 2VR4A 3HQRA 5FQ0B 5T5OA 1DHKB 2IFWA 3OSDA 4IL7A 2GC0A 2NLRA 4M0HA 3T08A 4XJAA 3A22A 5JMCA 4XTMA 3ATGA 1M4WA 4HN0A 4H55A 5EXOA 2ZGOA 3J7LA 2DV9A 1QNWA 2PLV1 3MO4A 4XOGA 1WMFA 3VL8A 5BV6A 4KU8A 1FOD2 1AL0G 5JZGB 5LA0A 5EJ1B 4EQVA 1AR93 2DVGA 2RM22 2Y26A 3NQHA 2WT1A 5A6XA 4BZ4A 2Z69A 4AI1A 2FDKA 2WNEA 5E6HA 2XBO2 4JTOA 1I6XA 3LA7A 2CHHA 3ON7A 1J1LA 1OLMA 1IOAA 1G6NA 4HLTA 1YIPA 4O9EA 3ZFGC 4YGEA 5LK5A 5AFEA 3WW4A 2YBSA 1WLDA 2RS11 3AYCA 4R9BA 1GWLA 4JDOA 3DXUA 1U5ZA 4YZ2A 5C9AC 4DRVA 1KD7A 4YLZA 3U11A 4CEWA 3NNFA 4CPBD 4LULA 4AL9A 1W8WA 3M3QA 2VMFA 5FP8A 2VUAA 4DO0A 1QXPA 2BNOA 3FN9A 1EUUA 1QXJA 4YVWB 4CU7A 5FYZA 5CFDB 4CUAA 1CZVA 2BNNA 1HRV2 1MEC1 1HRI2 1EAH1 3WW2A 3LPFA 4NPRA 1HV0A 2YHJA 1DYPA 3W20A 1RMU1 3M3IA 5FZLA 2JECA 1LRHA 4IE4A 4COUA 4R4XA 5FP7A 1YI9A 3K3OA 1W6MB 3KV4A 4JDNA 1VBA3 4PBOA 4RFRB 2VOVA 2H6CA 5KC5A 5LEJA 4GKYA 1RUH2 2Y33A 1UU6A 4AFCA 4WM7C 1JN2P 3L2YA 5FAXA 3USUB 3WVJA 2PLV2 4LKEA 4XQWA 3SISA 4XEZA 3MYXA 4OUEA 4XFGA 2E63A 3WP6A 2FDHA 4E4SA 3U07A 3AMMA 3DL3A 1O4TA 2PHLA 3LKJA 2JE7A 1D4VB 1EYBA 2W08A 3P1IA 4M3CE 4P08A 3VHRA 1POV1 3GBWA 2WQZC 2WNUB 2CGNA 1JYIA 4MOAA 4P9GA 3H8OA 3OPZA 3RMXA 4UYBA 1HRV3 4YZ3A 5FP3A 5DUXA 3F95A 1CAVA 3MGUA 2DCZA 2LM3A 2ZZJA 1C28A 1FV2A 2JB8A 1R091 4PLMA 2VGDA 1SQ4A 4EWAA 4E8DA 1RYYA 3ENRA 1FT9A 2VVFA 5HCBA 3MIEA 1CPNA 3SH4A 3WP4A 3W5NA 1Q3EA 1SBEA 4QHBA 1E5IA 2JG8C 1CD3G 2OKXA 4FO9A 5F8PA 5L9RA 4PLOA 3T1MA 1Q56A 2FHRA 1FAYA 4GA9A 3OD0A 4Q1PA 4D0QA 1A34A 2D6LX 2PLV3 4YFZA 3OG2A 1GZTA 4UF0B 3C3VA 3J8F2 1NOVA 2RJ2A 3H1MA 3CU7A 4AFMA 1LCLA 3VBRB 3WUDA 1FMD3 3LIHA 2EXHA 4V2WA 1NCRB 1PO23 2RDQA 4MGSA 4Q4Y3 1NE6A 5EYYA 5C70A 4AHYA 5FWJA 1ZM1A 1O7FA 2WYSA 5FPZA 1OFNA 1ULGA 2F17A 3H8UA 3JZVA 3AXEA 4AGGA 5KHJA 1L3JA 5A1FA 2WWJA 1UYYA 3IMMA 3RZHA 4XF9A 3A23A 1X7NA 5JOXA 5BY5A 2QTWB 3TYJA 3VD3A 4CSWA 4N43A 3CIHA 5DAVA 1AUYA 4A45A 4YARA 1AR81 3AL5A 1JUHA 2KR2A 4O9GA 1RUJ2 1GOFA 3O1RA 4Z2AA 1ZNPA 2V72A 3ZXFA 2WKKA 2XBO3 4MZUA 1BK0A 3UKNA 1QMJA 3NJXA 4HPKA 3ZFEA 4AQSA 3WDVA 4E27A 5A33A 2GMPA 3GGLA 3QBQA 3B94A 3I3DA 3OGRA 3WHUA 4E4ZA 3BGAA 2X53S 5JSPA 2V09A 4NPLA 5A80A 3THTA 1A3KA 4LHNA 1BCXA 3ZSKA 4CDXB 3THCA 1BEV1 5HCHA 5FMOL 5FZMA 4KGGA 5FY7A 4IEUA 3CL1A 3EQEA 4X8PA 2P17A 1S0GA 3WP5A 2CWSA 4JDMA 4MGYE 4URAA 1NXD1 4GMP1 4BB3A 2O0OA 4DXSA 1N1TA 3DEMA 3WF4A 2EIGA 2ZX3A 4IGPA 2WT2A 2HWC1 1AL21 3UK9A 4ZXEA 3IPVB 4HSLA 4XJ8A 2QQVA 4TZDA 1Q5OA 4Z8BA 4B4PA 1DQ0A 5C4WC 1W0OA 2P6CA 2BGPA 1JZ2A 4ISQA 4XMAA 2VVDA 3N36A 3KCXA 1UX7A 2NMOA 3EB7A 3H50A 5J98B 3T0DA 4M3CB 1GR3A 4HOOA 2AH2A 4B7EA 4PJYA 1KEXA 4NOTA 5D1IA 4ASKA 1H1AA 1V6OA 1W39A 1UY2A 1MR5A 2VTFA 1FMD1 3VD7A 4FPCA 1G86A 3M2MA 3WF0A 2G1MA 4O7XA 2JJ6A 2XH6A 3LEGA 5A6QA 2WS91 2BFUS 2AGSA 1OUSA 4XFAA 4QPGC 5L7OC 1GBGA 1FATA 2Y0OA 1GZ9A 5AC91 2OQ6A 1UAIA 2PHTA 5T5PA 3AKQA 1NCQC 4KNCA 1H9WA 3C7HA 3O12A 5FZIA 3ZN5A 1A78A 3ACGA 2W39A 2VZSA 4RS5B 3GXUA 3B3QE 3VBSB 4HKLA 5JUVA 2ZGNA 1UY1A 1UY3A 1RUC1 2AZ5A 2W91A 5A7WA 3B00A 4MGKE 2VBDA 1QJFA 1RXGA 4YW5A 1RINA 4EE2A 2VZQA 4KMQA 3H3LA 5C9AA 1DDLA 2WAOA 3NW4A 3BOPA 4Q8LA 3MBWA 1ND2A 3B93A 4K7JA 2XVKA 4N43B 4XCBA 1W03A 1PO11 3PNAA 1RJ8A 1BJQA 2ZGMA 2D43A 3EBRA 4UFKA 2EXIA 4CEYB 1VMJA 3DXTA 1MZFA 3HQXA 1POV3 4CDUC 4I2OA 2CV6A 1NXMA 4RN5A 4G4FA 3FBYA 2DCKA 2VL4A 3ALQA 3WD5A 1BBT2 1UZVA 2Q0AA 4E2SA 3MLLA 3NL1A 1V70A 3V0AA 4FP2A 5IT6A 4Q4V1 1QJEA 3AP9A 5JPNB 1N1VA 5CYYA 1W2TA 1MQTA 1VBE2 4OVEA 5ACA3 3UJOA 1QJX1 4AAPA 1H2NA 1VBA1 1ZZ7A 2XONA 5CADA 1EV11 1UU4A 2XLFA 3GBGA 3JXSA 4NROA 3VDBA 2GNDA 2TEPA 3BVCA 4J6GA 4RS5A 4JHTA 1GP5A 5DMYA 3BPSA 2WC2A 1TME2 2ZZQA 4PQQA 3SQOA 2BTVC 2CL2A 2RMU2 2J7MA 5LY1A 2XUMA 1CESA 3T0BA 3H8XA 1MVQA 3PUSA 5D21A 4CEWB 3HD8B 1PIV1 1KS5A 4UWDA 2VQTA 3IDAA 3V56A 1WLWA 4B4RA 2DBIA 4LUKA 4ZS2A 5LA1A 3C7EA 3NAPC 3POYA 1NA1B 4COYA 2I45A 4QWNA 4ES8A 2E9QA 2XLGA 5J1XA 1W0PA 2OIIA 4G3YC 3OD4A 5FJHA 5GZFA 1RC6A 5C8CB 2HWB2 5C3RA 1ZBA2 2C9KA 2UYAA 3MICA 2BDRA 2XQRA 2VE1A 1G9CA 1HJFA 1XU2A 1OVSA 3ZYPA 1NE4A 2Z5WA 3CEWA 5L73A 1X8MA 1WA6X 3J4UH 3NKGA 1BBT3 2WYFA 5DAXA 1OSGA 3AYDA 5J48A 3SITA 5JR7B 1MQTB 2Y6FA 1WD3A 3A0NA 5DPNA 2D6MA 4EN8B 2P4EA 4KH9A 1LU2A 1F5JA 1X82A 1PVXA 4E2GA 3CF6E 2ZMKA 4IV1A 3R0RA 5CBLA 1CJDA 1TNRA 1WUVA 2BW8A 2DVDA 1ZA7A 4QAWA 2D6OX 1QJU1 5GLVA 3QLQA 3VBHB 1RUE2 3R05A 3WF2A 4GD4A 1IS3A 2WABA 1OXCA 3JD72 3THPA 1LEMA 1EAH2 5LZ6A 4CU6A 1VBB2 4LKFA 5DUVA 3OB8A 4NIGA 2XVLA 2IXLA 4MADA 1JOPA 4COVA 5IVYA 1VRH1 2J1EA 2ZXQA 3WXPA 1UX6A 2DFCA 2OT7A 4AHXA 4B29A 4CA9A 5JMOA 3RYPA 5E88A 1RUE1 2G9GA 1QU0A 2VOXA 4LBNA 1LESA 1WA4A 3ZYBA 4GWNA 5DUWA 3HMYA 4JV4A 3GDBA 3AMQA 3BPZA 4ONUA 4YGDA 2A3XA 1DGRN 1IG0A 4AF9A 4SBVA 1WMEA 1FXZA 2A70A 4LLFA 3WY6A 1S2BA 4NHLA 1LOFC 1VAMA 2C1FA 5LRRA 3WF1A 1DU3D 1R1A2 1HB1A 4MG2A 2K0GA 4RGKA 4QX1A 3CKHA 2ZHLA 4AEDB 1KS4A 2GU9A 1O3QA 5LATA 1ASJ2 5FO7B 1JZ4A 4XURA 4HETA 4QB2A 1RUG1 3ZN6B 2JG8B 1F35A 1SEFA 2QDNA 1PZ9A 1U5IA 4XIKA 3UYJA 2CAVA 3KGZA 4OUSA 3ZXJA 2DURA 4AK3A 1COV2 1V6KA 2ENRA 1W04A 2WINB 1N3PA 4XQDA 2EXJA 4CDQB 1H4GA 3M4FA 4QX5A 3KVAA 4ZZ8A 1ULDA 1H30A 2QVSB 3A0KA 3I59A 3TRSB 4M0NA 4K3UA 3SC7X 1FI2A 3ELNA 1MS9A 5FYCA 1PIV2 1PMHX 2JG9A 3AKPA 3LAGA 4Y5TA 3M3CA 3R4UA 2WNVB 1OF4A 1OLME 4MV2A 3IT8A 4XDQA 5J3UA 2ZGUA 4RYDA 1US3A 3AJYA 1F31A 3ZFFC 3DGTA 3OGSA 4P5YA 3SLIA 3T09A 1VBA2 2ARXA 4YVWC 1RITA 4CDQC 1D2QA 5ACA2 4JVAA 1X9PA 3N7MA 3VDCA 3USSA 4H7LA 4MHRA 4ARXA 3SKJE 3KZ4C 1OI6A 1QJY3 1VP6A 1Y9GA 3M1HA 3Q9OA 4N9HA 3LA3A 2QQNA 5FYSA 4D69A 1AR72 2CYFA 3OBZA 3AYAA 4XJZA 2B4KA 3R4DB 3VHOA 4P00B 4B3NA 2W2IA 4KI5M 3WLUA 3ZR6A 4KBBA 1EV13 1O5LA 4Q26A 5FY9A 4Z2WA 4LIUA 2X5IC 5FPVA 3RGBA 3IN9A 4DXTA 1O3SA 5FPAA 4KQ7A 2WT0A 1W8OA 4EYUA 3MFAA 1SFYA 1IHMA 3H3ZA 1JMUB 2WO3A 3GCWA 1DGRA 1PO12 2VY0A 4Q0UA 4Q4V3 4BHPA 2HWF1 3HT2A 4BQ1A 5JOYA 1GZWA 3HIFA 1AR62 4CXYA 5IK8A 2ORZA 2AC1A 3K2OA 3H9AA 1MS8A 4QPGA 4BA6A 3PUAA 5L7OA 4XZUG 4NO4A 1LOEA 3VBOA 4JRAA 1Y9MA 1NCQB 4P9WA 2WL1A 2E7TA 3VGIA 5CFCA 5CG9A 2A5ZA 2RVAA 4MX3A 2VAUA 4FOQA 1VALA 3VZNA 2B5HA 3SH3A 2AEZA 1NCRA 1H0BA 4ZU4A 2W92A 1CAXA 3FUOA 1PVC1 1UXXX 3P3NA 1ND2C 1XYOA 5FREA 1HXS1 3S5QA 4CDWA 2QDRA 2E53A 4UFJA 2GMMA 1OT5A 1DF0A 2HYXA 1JYCA 2UWCA 4MGZE 2E33A 1OKOA 3GNEA 2SBAA 1NT0A 5JLVA 5D8AC 5JIAA 1DP0A 4IQPA 2I2SA 3POEA 5FYBA 3RJ2X 1H8TB 3KGLA 5JSOA 2J42A 1Z7S1 3S30A 1JYWA 4D6SA 1VRH3 4RR3C 1Q8SA 3DECA 4AI8A 2AR6A 4LHSA 1WCQA 4K1YA 5EJZB 4Y33A 4KL1A 4Q4V2 4GKXA 4LO4B 4HSJA 2Q30A 2ET7A 2BNMA 4I0AA 1O3TA 1QXRA 1O59A 2F4PA 3ACFA 3J7HA 4L8QA 4Q29A 2QCSB 5T50A 5I91A 1VBD1 1OD5A 3LD8A 4CXXA 3ECQA 1HQNA 4JKMA 4DY3A 4EN6B 2Q1ZB 3OGJA 3OYWA 5JI9A 5DG1A 4LHKA 4FOWA 2DCJA 5JWPA 3T2OA 1CIYA 1QY4A 3FMGA 1W8UA 3H3UA 4IV3C 5CFCB 1MZEA 4YW1A 3ORJA 4N53A 3TEYA 1JYTA 2PHDA 1LR5A 1QH7A 2CDOA 2VW0A 5H9SA 1WBLA 3IBMA 1ALYA 3ZXKA 3S0MA 1VRBA 3UKVA 1W9YA 4QKBA 5L9BA 3OBRA 5DAQA 3C2UA 4WZCA 2VC9A 5E16A 4W4ZA 1XNKA 4OULA 5LCWL 2C4XA 4IE6A 3VHNA 3GZEA 3I2OA 1COV3 3RI8A 1OMIA 3WQ0A 1YQ5A 3MPBA 1GANA 4V2VA 4GJYA 4LBOA 1RHI2 2ZHKA 3UESA 4DB5A 4LBLA 2ET1A 5FPLA 3J26N 4WBBA 2MEV1 4Y1VA 3ZFGA 3U0ZA 3DKWA 2D6PA 2RS51 3AZXA 2WS92 1F4AA 2J1TA 1ENRA 2TBVA 2VTXJ 5C7GA 4AFBA 4BYYA 3N35A 1WWYA 3KQRA 3RG0A 3WUCA 5EPAA 3H0OA 1FOD3 4LUMA 2EIBA 2ZCWA 4IV3A 3RWNA 1AR92 1UXZA 1LGBA 1VB4A 5DDJ2 1RIRA 1ZZ6A 1NQDA 2DU1A 3THDA 1GQHA 1IKPA 2RHPA 2JX9A 4WV8A 5DAWA 2VUJA 1B35C 1F9KA 1X33A 1BQPA 5FY5A 4Y5Z0 1RGSA 4WVMB 3TN93 1UY0A 4LT5A 4CDWB 3O1SA 3N9PA 3KSCA 5A6YA 2WAAA 1YLLA 2WLQA 4BISA 2JE9A 4ORFA 4XFHA 1GMMA 3PTRB 1YI7A 5GZGA 3QH7A 4PDWA 4MUVA 4JZRA 4D94A 4LO5B 1RUI1 1QQP1 4CE8A 5C3QA 2XHKA 2JDMA 4H3WA 2RDNA 4KWKA 3TAYA 1QOOA 1EUTA 5LASA 4M01A 5M0TA 4TXWA 2JDHA 3LF7A 4YG6A 3J7NA 2PELA 4LO6B 1OQ1A 3WG2A 1AX2A 4YPJA 1DG6A 1UPIA 1PGSA 2DUOA 3AP7A 4I0WB 1TMF3 4H7MA 4JKKA 3ZDVA 3ZXEA 2ZMNA 1AJKA 3BCWA 4NRPA 4BQ5A 2WO2A 2QQJA 3QH6A 2YC4A 4CXWA 5C3SA 3SXWA 4HKWA 3V65A 4XJWA 1BK1A 2AENA 3PHMA 1LOCA 1UCXA 1X50A 1TQ5A 1S55A 3ZN4A 2ZGTA 4B1MA 2YU2A 4UW4A 1N3OA 1E57A 1R64A 4IEOA 5FRAA 1D4M3 4Z92B 3DN7A 2CSGA 4AVAA 3OPTA 2D5HA 5A7QA 1JZ8A 5FZEA 1R093 4AEKA 5IVJA 1RUH3 2VM9A 3FFZA 3U4SA 1D7PM 4JHZA 2OUHA 5HXMA 2OW4A 5FPUA 2XL7A 4PLNA 5BNNC 4SLIA 3KVBA 3FE5A 1AR61 4LQRA 3NO8A 1OLRA 4CEYC 1KQRA 3LE0A 1R083 1ZYBA 3VUOA 2GAUA 4J25A 1J3QA 1F5FA 2W46A 2R062 3HAGA 3RMYA 3TBDA 2GNTA 1DZTA 3ST7A 3MIBA 4K1ZA 3RWKX 3VZJA 2HBUA 2VZ1A 4UFLA 5C3OA 1IPKA 1K5MA 2JG9C 3B02A 4WM8B 4A6SA 3DV8A 3QACA 4IERA 5FZGA 3VZMA 4AG4A 4LXLA 3CDZB 2DWRA 2VOKA 2KA3A 2C5DA 1UU5A 3AJZA 4XJ9A 2PXJA 3MW3A 4BIFA 2Y6GA 2ZEWA 3O14A 3VBRC 4GXLA 2D6NA 3DPRA 1KFXL 4HFSA 2J1SA 1X36A 2GZWA 3WG1A 4Q0SA 4BU2A 5FZAA 5I0UA 3WW3A 1HKDA 4HK9A 4QXBA 1SMVA 4H14A 4KWLA 5IW0A 4FXKB 2AEYA 2YV8A 4QM8A 4UI9L 3WW1A 3PVNA 2GC2A 5FZ8A 4XFIA 3WF3A 3OBAA 5ABJC 2RS53 2RV9A 2H0VA 4IEXA 1MS1A 5A1LA 2UY8A 2K9ZA 1L7LA 2Y6JA 1V6IA 2VZPA 3J9SA 5FZHA 1HB3A 3AP6A 1R082 2YPJA 5A7NA 1COV1 1HB2A 1KITA 3DKQA 4C0HA 3TNPB 2JB4A 2QNKA 1PM7A 2R063 3E6DA 4ITCA 5B4NA 1HW5A 2XBO1 4RFT0 3ZFEC 1JS9A 2VXRA 5CB7A 1QHDA 2D93A 1V9U2 5L19A 5L9VA 4FPFA 3LSDA 3Q8FA 4AE2A 1O8SA 2BYVE 4QX0A 3LDBA 1SLIA 4Y1ZA 4COZA 2W95A 2C0ZA 4S2FA 5HI0A 3JD73 3HT1A 4CDWC 4Q4W2 3S7IA 2IWGB 2XB6C 3AX4A 4S2GA 1Q8OA 2XL9A 3UETA 3OJBA 4LPLA 5FBJA 4RR3A 1AYN2 2ZAAA 5DZGA 1FV3A 1H8TC 3ZX7A 5I0DA 2YB7A 1QOSA 4CU8A 4JQTA 5CKMA 4QU1A 3VBOB 3KHCA 4FPJA 1K12A 4HONA 4XBQA 2FCVA 2DTWA 5C4WA 1W6OB 5J36A 3ZXAC 2HWD1 4OI2A 2QZ2A 2ZMLA 5HCFA 2VMHA 3NJVA 4QDQA 1RXFA 2Y6KA 1R1A3 1EPZA 4QPIA 5C8CC 1H4HA 1ZZ9A 1UF2C 2H0BA 3KS7A 3VHPA 4CCLA 2P37A 5HCAA 3JQXA 1ZVFA 4HZFA 2ZS6B 1QOTA 4BCUA 3ZFFB 3DUIA 3VDDC 1CZSA 3PIJA 1GNHA 4ATFA 3CJIB 3MLJA 1CQ9A 2CU5A 2WRAA 3RZZA 3T2PA 3ZFGB 1YC61 3N3HA 1G9DA 1CN1A 1VLNA 1TG7A 2ZHMA 4NWVA 2WQ8A 5GLTA 2VU9A 1AVBA 1WW5A 1UMIA 4N8MA 4AHWA 5IVCA 4CYDA 1UMZA 4P02B 4Q4W3 3W5MA 1YFXA 3VBHA 2OZ6A 5GKAC 2Q4SA 3BTYA 1ULEA 5IK4A 3I3MA 5A7PA 4E9KA 3AFKA 5JPMB 3WNKA 1TE1B 3AP4A 1WLTA 3ILFA 4GALA 4NUBA 3L2HA 1Z7S3 2XJPA 3VZKA 1DBNA 2D3RA 4IESA 1O6UA 2RDRA 2ZGQA 3MFCA 4Y26A 3FX3A 3GHMA 3OGGA 3VD5A 3O1TA 1VMFA 5F37A 4QKFA 2XVGA 2YY1A 2OYZA 1XSQA 5JSRA 3PMSA 3NAPB 1IKQA 1AJOA 4CCCA 3ACHA 4Q4X3 1IGOA 3D3AA 5GLZA 4N90A 4Q27A 4AOCA 1ZA4A 3BTAA 2X09A 3GBFA 4IEQA 5I8SA 3VDDA 2CGPA 5KHIA 4Z82A 3HJRA 2BFUL 2RMU1 2XLAA 2YG0A 5FBZA 4CRQA 2BZDA 3OY8B 1UYXA 3TNQA 4NMIA 1JZ7A 1O4YA 1TEIA 5GJ6A 3GHNA 1UO9A 4B7KA 2XKPA 2ZABA 1EAH3 3Q8AA 2R16A 2ZX4A 3KWVA 5F5IA 5FK7A 1WBFA 4AGRA 5FZ6A 4MXWB 1CAUA 1UIKA 3JCIA 5JOWA 4YVWA 1HIXA 2PHRA 4RQPA 4EN9B 4UBHA 4OHYA 2PHUA 3KT7A 2EF6A 1A8DA 1LGCA 2GH2A 3VZOA 4F7ZA 5CISA 2DU0A 2I07B 4K9SA 3WDWA 5EJ3A 1RUI2 4DRRA 4LE3A 1US2A 3K4ZA 2YROA 3OGVA 3O0XA 4PDWC 3WNMA 3LZZA 3S5AA 4OI0A 2BBAA 3ZLIA 2RS13 3AMNA 3KCCA 4EWEA 1DQ4A 3NRUA 1SFPA 3CZUA 1LHUA 4NAMA 4KU7A 5HV0A 2W68A 1QGLA 4M4PA 4ZHNA 1VAVA 5LBCA 5JXIA 2QQUA 2VTXA 4LBQA 5EYXA 4BK4A 3QD6A 1W6OA 1JOJA 1BVP1 2BQPA 2P5BA 3NKTA 1HN1A 4QB6A 4U2AA 2VMCA 2ZJCA 3ACIA 4G9SB 4QX3A 4TLFA 2NM1A 3FBMA 1AR91 3VBFB 4PDWB 2RMU3 4PIXA 1OHFA 1B09A 1U0AA 3N9NA 4TSVA 2CNAA 2HJIA 4JQRA 4KGQA 4PIZA 3UGHA 4LK6A 1V00A 1PNFA 4Q4X1 3VBUC 2R7EB 4QQOA 4QQLA 1QWRA 1UWWA 5FLIA 1QKQA 5AC92 4C90A 3LGRA 3JUUA 3VKLA 1KXGA 3O0WA 4LKDA 5BXXA 2NYYA 4AI3A 5C9AB 5KXEA 1CWPA 3QCWA 2A6ZA 2VZVA 3ES1A 3WDXA 5C71A 1MS3A 1W6MA 4TWTA 2EAKA 4GB32 2VW1A 1EY2A 1ND3A 3WV6A 3ZSJA 4D6QA 4CEWC 2EAAA 2O1QA 4A41A 4O61A 4CCOA 5KXDA 4META 2XUEA 5FXXA 2XOMA 2WJSA 3DYMA 5A7SA 1AX0A 3BB6A 2B7YA 4GWMA 1GUIA 2Y60A 4OZOA 5T3NA 2CGOA 2BVBA 4M4RA 4QKNA 1W0NA 1URXA 2OXBA 2TNFA 2WNOA 5A1AA 2XXZA 2YXSA 5IUQA 3KV6A 4YG3A 1KGYA 1OOPC 1PNGA 3GJAA 4LMFA 3PMEA 4L97A 5T52A 5DAPA 3TEZA 1NYWA 3JQWA 1Q8QA 1W6QA 4QPWA 3N9OA 3MF9A 4QM9A 2EIDA 5FZOB 2R6QA 3OEBA 4LEJA 4OHZA 3NV4A 4O65A 3SEEA 3V64A 4QPIB 4Y1XA 1JUIA 5F6LB 4BQ3A 3PTYA 3WQBA 2VQAA 3O1OA 4YVSC 3FLPA 1BEV2 4ET7A 2JDAA 1SPPA 2G4IA 2R072 1S0JA 4YNIA 5CKQA 1DCSA 1LODA 1OD3A 4UW6A 1VE0A 2IXHA 3M3EA 4PQ9A 4WZFA 2P3YA 4P14A 2ADDA 4IXLA 1UL9A 2Y34A 1SBDA 4K6BA 2QQLA 2W1UA 2ZX1A 3ZOIA 2XDVA 2H6BA 2BWAA 3IAQA 5E1RA 4PI2A 1RUJ1 4KG8A 3ZYIB 1HXS2 2QQPA 2CY6A 4ZZ5A 4JGYC 5KBFA 4Q4X2 3AVSA 4XBLA 3M3OA 1BMV1 2D44A 5F3CA 5LBBA 3T2TA 4BQXA 5F39A 2Y64A 1DQ5A 2AYHA 2VNRA 3RYKA 1GP4A 1WLCA 3POWA 1BKZA 2JDKA 3GCXA 2NQYA 4QGLA 4BJ0A 1Y3TA 5TSWA 4XXAA 2ZHNA 4OQ9A 3VBSA 2LTNA 2P1BA 1W6QB 4OMDA 2D40A 3VB9A 4EJRA 3GJBA 3I2FA 1JXNA 1UYZA 2B46X 4JGZC 4RHV2 1FPN2 1VBC2 3WQ7A 1YXWA 4RQPB 3ACLA 2MHFA 4FFFA 4NR1A 4QDSA 3RQ0A 2OPWA 1CAUB 4BLIA 1QDOA 1C5IA 3GYDA
chains in the Genus database with same CATH topology
1MZ6A 1AXYA 5BUVA 2ZGRA 1JBCA 1PIV3 1APNA 1Y7BA 5L36A 4XTPA 5H9PA 4EWDA 2JICA 5F1RA 1DIWA 1DGLA 1ND3B 2XWJB 2P3KA 3AKTA 3USUA 1G9FA 2ZA9A 4LR4A 4FPGA 2HWD2 2W52A 1NA1C 1MS5A 1ENSA 5DXDA 4XBNA 2B39A 1RUOA 1XNBA 5AVPA 4GH4C 5DG2A 5JDBA 4DNYA 4DMIA 2GN7A 5CFCC 4XQ4A 4F8AA 1GKBA 3LOBA 3HR9A 4DOUA 2PTMA 5FMOS 4R9CA 1RUD3 1FPN3 1VBC3 2ILMA 3CJXA 1FX5A 1RJ7A 2RE9A 4J1XA 2WWSA 3HBZA 1CR7A 1J1TA 3E5UA 1G9AA 1MZ5A 3JBG3 3M70A 3CJIA 3R6SA 4NWWA 4Z07A 4RGGA 1RUH1 2QUOA 1VJ2A 2EALA 2JG9B 2R1DA 1Z0HA 2C9AA 2EVXA 4LBQD 3AMPA 1NLRA 5A32A 5AVAA 4WM7A 1PHMA 3GF6A 2WZPP 4N43C 3AXDA 1TMF1 2XKOA 4QXKA 3U4XA 2X8KA 5E8AA 1HRI1 4AVBA 5JZGC 3ZN6A 2YDEA 4AI2A 4GMP3 4HVOA 4AQTA 1VRH2 4F83A 2XJQA 1YJLA 1H2LA 1KJLA 3W58A 4JGYB 2ZGPA 4I30A 4NHMA 2R32A 5H9RA 5C33A 5C6CA 1VIWB 1V9U3 2NZ9A 1TMF2 1WCSA 3JD71 2ZBJA 5HBAA 5I0TA 2VNOA 1SLLA 3IDCB 5CNAA 1YYNA 4URTA 1SLBA 1H9PA 4CTEA 1DQ6A 5J09A 1C1LA 4LLOA 4RA0A 1AL23 5BNQA 4FPHA 1ZZBA 3K51A 4A3XA 2D3SA 2DCYA 2R061 1AR83 2BUKA 3KCYA 5FO8B 1FOD1 1KJRA 2PHFA 2WFF3 5T5JA 5CA6A 1KRIA 2WIIB 3PVEA 5CAZA 3VZLA 1V9U1 3VBUA 2YGLA 3MDPA 3AKSA 2VG9A 4B4QA 1QNYA 1SDWA 4LA3A 4ES9A 1DZRA 1XU1A 1HRI3 2GALA 3E5XA 5GM0A 4B8EA 2VOWA 3O5SA 3N7KA 3BU7A 4FPYA 2VECA 2RS33 4GH4B 4ZXKA 2ETEA 1W6NB 2V73A 3BIWE 5KXCA 4I3GA 2Q1MA 1CPMA 2WNUC 3P3PA 4DZGA 2R042 4HVRA 4YW4A 4N7IA 2V5YA 3AFGA 4DINB 1CONA 5JVVA 4RD7A 2FMDA 4BIOA 1ZX5A 1U12A 1VBE1 3FLTA 2WSUA 2Z2SB 1HDKA 2O8QA 1VBD3 2ZPXA 3JBG1 3K48A 2GNMA 4XFFA 3O7OA 2A6YA 2SLIA 4QU2A 2RJLA 3ZSLA 2X5IA 3NV1A 1ULFA 4C1WA 4P9IA 3ZFFA 4PBPA 1FPN1 1VBC1 1J3PA 5LK7B 3MEPA 1YWKA 2QJVA 2P2KA 4E4DX 1DLLA 4I3PA 3N4MA 5DDJ1 1LULA 4FPKA 3ZVXA 5KHKA 1OA4A 2PQQA 4OLLA 4XW3A 1ENQA 1RHI1 5I0RA 2DVBA 2DYCA 2LALA 1S0IA 3ES4A 4XHBA 3NSTA 4AI0A 4BMBA 4YSFA 2R49A 3KLSA 1NY71 1YUDA 4WM8C 1RMU3 1RUI3 1ZZCA 1J3RA 3KM5A 1SFNA 2GN3A 3N7LA 4M3CF 4YVSB 4FQ4A 4X8NA 1FMD2 2XJUA 2WNVC 1ZRDA 4Q8KA 1VB2A 3LOIA 4YW2A 4FOYA 4AGVA 4L99A 4RL7A 4Y24A 4XMIA 1RHI3 3CNAA 1ENXA 1W2UA 1LB2A 2D3PA 2FZ1A 5GLUA 2DTYA 4QQ2A 1F2NA 1XYPA 1NA1A 1D0HA 2ES3A 1WW4A 4ZU7A 5F5QA 2BVVA 5DDJ3 2ZGKA 2AREA 2D6KA 3HN1A 4FCAA 1RUJ3 4IEWA 4JAAA 1I3HA 3R4SA 1KDMA 1XQNA 5A33B 1O91A 1UW8A 1GSLA 3H1WA 3ZFEB 2K2SA 1Z7S2 1LU1A 3VDDB 4CZSA 4U36A 2OA2A 3DF0A 2PHXA 3JB8A 4HKOA 3IM0A 3ZXGA 4FSJA 1UD1A 1S2KA 2VULA 1C4RA 1CVNA 3PVOA 4K8FA 2RJKA 1VBE3 2GC1A 3HWJA 4R52A 5AFBA 3FZ3A 1ZRCA 3RNSA 1CJPA 1PK6C 4QT6A 3MIGA 3MIFA 3G7DA 5IK5A 2BBVA 2B45X 5BNPA 1S0EA 4Y22A 1OKQA 4Y20A 5F9TA 3B7MA 3CLPA 5FOJB 1HLCA 2P3IA 1C57A 3LB9A 4XF3A 1Y9QA 1SLTA 2HWF2 2R043 4MYEA 4WVZA 5FOBB 4CDXA 2I74A 2Q8OA 1NZCA 1I5ZA 3IIAA 4XJUA 4QQHA 3PLQA 1H2KA 4Q0QA 1J58A 3TWIA 1CIWA 4RS5C 4OI4A 4JGZB 3EO6A 1VBD2 1EPWA 1C8M1 4YFWA 4YM0A 4KWJA 4X6QB 3PJYA 5BPXA 1LHNA 2CAUA 4RGAA 1LEDA 2JDZA 4AVTA 3WR0A 1HXS3 2Z79A 1B35A 2BEOA 1WW7A 4MGIE 1BXHA 3D0JA 3U10A 1N3QA 4BOWA 1JW6A 1ZBE3 1WCDJ 2XWBB 1HQWA 5DUUA 1VAKA 3VBOC 1LENA 2F6BA 1CAWB 2R30A 3MLKA 2CWMA 3FJSA 4A7KA 1AYM3 2UU8A 4W65A 5BNNA 1MQTC 1SBFA 3EJKA 1A6CA 1KFUL 5BNNB 2QKDA 3AMHA 3ZPYA 3SCGA 5KWRA 2WZR3 5FO9B 4GB33 4K21A 1YJKA 5FCCA 5CVRA 1VR3A 4IV1C 4R9DA 4YGCA 1D0GA 4M00A 5F6KA 1ASJ1 5LRSA 1H1MA 4FAGA 3VBUB 4CP1A 4XZPA 1G8WA 2D7FA 2BWCA 2PAMA 5FTTC 2RR12 1SCRA 4Q0VA 3ZIWA 4FP3A 5GLWA 1Q8PA 4CDUB 2ZOEB 5IK7A 1YRZA 3WOGA 4AYUA 1LTEA 4D3WA 2PA7A 3PVBB 4RSUA 4AXOA 1AHSA 2WNUA 1XYNA 1LECA 4FPOB 1QJX3 5ACA1 4C91A 1S0DA 1XNCA 5DZFA 1VBB1 1AYN3 3ROUA 1YNAA 2R073 2HWE2 4PF5A 4YGBA 2Q5TA 1N47A 3T1LA 2MNGA 1RUF3 1W6NA 3IWZA 3VBFC 5DZEA 5BYNA 4GH4A 3OYWB 1AYN1 3VBRA 3H7YA 2RS12 4TYSA 4I01A 4Q4W1 2HYKA 4LNVA 4BLJA 3VKMA 1NQJA 2DUQA 1MS0A 4NVPA 5BNOB 3ZIXA 2WA4A 4WVWA 4PIYA 2G9FA 3MF6A 1AXZA 1GICA 3S6PA 3E5QA 3WCSA 4FPEA 1RUG2 3IDEA 3WDYA 5FQ0A 1WMDA 1UPSA 4CP0A 4S2DA 2WFPA 4A7YA 1RUE3 2A3WA 4Q2FA 1ZBA1 1DQ2A 1R1A1 5GZDA 1IS6A 2AUYA 5JAXA 2QE3A 4LHLA 5SV5A 3ASIA 4DY5A 1CAXB 3SH5A 3AZZA 4D7TA 1LOGA 1GNZA 1Y43B 1V6LA 5D8AB 3WCRA 2A7AA 3OF1A 1S0FA 3FUQA 2WNVA 2IXJA 4MLOA 4FTBA 4QPIC 1DGWA 4UW5A 3NV3A 2R0FA 3NVCA 1UKRA 4KG0A 5C4WB 2FZ2A 3AB0A 2A73B 4L9BA 3NAPA 1AYM1 4N7UA 1N1SA 1QJZA 1TME3 1W6PB 1I9RA 3MZHA 1S0BA 1EP0A 4QPYA 5JI7A 5KHHA 1C8M2 2HWC3 3IMNA 1GV9A 3IPVA 2Y0IA 1REFA 2RR11 1KDKA 2UURA 1U5YA 1OQEA 1GQGA 5ABJB 1C5HA 3AP5A 3ZYRA 2WZR2 1YHFA 1S1AA 3TB0A 2B8MA 1ZBA3 4AQ2A 1LGNA 1BEV3 5J37A 4XILA 1RUNA 4P9YA 2O8OA 4HT1T 1PK6B 3L9JT 1YFYA 2Y38A 2E7AA 2XGXA 2E7QA 3MW2A 2RM23 4LO7A 2HWB1 1WGPA 4UXAA 3VBSC 4OHWA 4LBJA 5A3MA 4YVSA 5I8YA 5K0UC 2N7GA 2ERFA 3X29B 4YM2A 3LA2A 5K7PA 3V0AB 4DPNA 4MH0E 1QJY2 4AVCA 3APBA 4HVQA 2R0HA 4XFBA 5BNPB 3MI8A 4LBKA 3WX5A 3UKTA 1EV12 4YZ1A 2IXCA 1QJX2 3B5LB 3H1YA 2ARBA 3DPRB 3WDTA 1QQP2 1A8MA 4RHV3 5HXVA 3LSEA 1ND2B 3A4UA 1PO13 1CX4A 3BODA 1AR63 3WDUA 1ZREA 2HWE3 4AVSA 4PCRA 2KM2A 4OI1A 3KT1A 1V6NA 2HEVF 1ONAA 3D82A 4DQAA 4AEDC 1AL22 1ZZ8A 3M8LA 4BM8A 1D4M1 2ZX0A 1LJ7A 3DPRC 3D4KA 3MIHA 4RQPC 4IEPA 4MVTA 1X8EA 3S7EA 1LOBA 4MSVA 1ASJ3 4Y1UA 2RS52 4FPLA 1BZWA 2MEV2 4AQ6A 3I4IA 2YUEA 5GZEA 5ABJA 1CAVB 3ZXLA 3OY8A 1RVF3 1JTZX 4S2HA 4N53C 2D5FA 4Y22B 3GZTB 4IV1B 3RRDA 1FYUA 2D97A 1QQP3 1RUD2 3N7JA 4R9AA 1I1EA 1NCQA 4BE3A 2PHWA 3VL9A 3CO2A 3PJQA 1LHOA 3ZO0B 3AZWA 3IDBB 4XF1A 4C0BA 1FNYA 4QD2A 1T6GC 2QZ3A 3KB5A 4HANA 4XETA 2PYTA 2ZKNA 3VV1A 1D4M2 1HV1A 2ZTNA 4XFCA 5C8CA 4XPVA 1PZ7A 3ZSMA 4C1XA 1M06G 1POV0 1H2MA 3RDIA 2UWAA 2DCTA 4L92A 4QGNA 1UZZA 1IS5A 3ILRA 2VVEA 2VW2A 1AR73 2P3JA 1C8M3 1Q8VA 2MEV3 4QGMA 4AVVA 4ZKTB 1YCIA 3RPQA 4OUMA 1H8TA 2HKXA 2FMYA 3UL2A 2A6VA 4HK8A 5CFDA 4CDUA 2HEWF 4DS0A 4YM3A 4FAHA 4UW3A 5FLHA 2ZAHA 2W0XA 2R041 3AZYA 3M7AA 3WNXA 3URFA 3RYRA 2VMIA 5EFUA 3IKWA 4Y20B 3ZSEA 5FDBA 5KHGA 3I59B 2BPA2 2XJSA 5B2GB 4GMP0 1XNDA 3ZYGA 1NCRC 2JXAA 4OHVA 3KD4A 1Q43A 1V6MA 4FTEA 4LE4A 4HN1A 4LBMA 3I54A 4YM1A 3VBHC 4JTNA 1AR82 1SLCA 4FVVA 1PGW2 1PO21 4Q4Y1 2HWD3 4XF4A 4ZU5A 5I0SA 4FTSA 2PN5A 2WFF2 4HMZA 2OPKA 4NN0A 2GMEA 2A71A 1O4ZA 2B9UA 1CAWA 1UN1A 4BH9A 4I0BA 4FBFA 2CTVA 2KXLA 2FQPA 1REDA 2NPIA 3LCPA 1U5XA 1B35B 4P9LA 2UYBA 1PK6A 2IXKA 3OTFA 3ZMNA 4A7ZA 4XF0A 3J8F1 1AR71 4IV3B 2VMGA 3EXUA 2VH9A 3JBG2 4HL0A 2PFWA 4OHXA 2YMZA 4BPZA 1AYM2 1DYKA 2RS32 4XXPA 1OPMA 4A2UA 1C1FA 3UJQA 4JGZA 1MEC2 1HRV1 1PGL2 1MVEA 5CFDC 3W9AA 1YFWA 4K20A 3VKOA 1R092 1W6PA 3WG4A 1OA3A 1R1ZA 3D8CA 3D6EA 3SHRA 5C8WA 4XHXA 3MIDA 1IQAA 4IETA 4MXVA 5BNOA 2WQ4A 4IEYA 1RVF2 5KC6A 3LWCA 4X6RB 3B9IA 4ASMB 1LHVA 3ZXDA 4QMAA 4FT8A 5I8TA 3SMHA 4ASLA 4COWA 3FLRA 5T5LA 1SLAA 4Y4YA 2XJVA 3EHKA 1AF9A 4GIQA 4EROA 2E51A 5JCTA 1LOFA 2FBEA 2DUPA 4GULA 1UZYA 1GLHA 2XG3A 1MEC3 1N1YA 1C3HA 1OA2A 1C8NA 2PAEA 3WHTA 5JIUA 1TNFA 4W6YA 3RS6A 2X5IB 2E6VA 1R081 2EA7A 4P9JA 1RMU2 4Y1YA 3ZDSA 4DXZA 2HWE1 3CJIC 1RVF1 1BYHA 1BVVA 2OZJA 3WZ1A 1LOAA 3B69A 2YC0A 3MPPG 1V6JA 3AM2A 5K8SA 4AW7A 5A3LA 1H1IA 2DVFA 4N9IA 1ND3C 1QJU2 3RI9A 1PGL1 2JENA 1RUG3 2JEMA 1OOPA 3KMHA 2IFRA 2RS31 1PMIA 2NN8A 3VKNA 3ZMOA 5BNOC 4LA2A 1H8VA 4CDQA 1GZWB 4JRLA 4E2QA 1O5UA 1F8VA 1GFF2 1AXKA 2HWB3 1UIJA 2RM21 5A32B 4RHV1 1QF3A 4AFAA 2XPJA 5H9QA 4Z1VA 3INAA 3V0BA 2ATFA 4L11A 3VLBB 5D8AA 2UWBA 4INDA 1AX1A 2WFF1 3AZVA 2WA3A 3TN91 4LBQB 1ZRRA 3FHIB 1PGW1 1PO22 2DVAA 3GZAA 4Q4Y2 1REEA 2RR13 3NWKA 3D5OA 3WT3A 3E6BA 5EWSA 3ME2A 4JCKA 4P9XA 5FLJA 1GZCA 4HBNA 3ETQA 3KT4A 3O0VA 4JC1A 5J7MA 1QJU3 1HQLA 2MPFA 1TME1 2IC1A 1HX6A 3I8TA 3TOJA 5FFOC 4EV0A 1XE7A 2VQ0A 4YRDA 4JGYA 1S0CA 2LUWA 3NV2A 2A6XA 4AEJA 3OBTA 3E6CC 3AK0A 4L2NA 1BBT1 1K5MC 1OOPB 4N53B 4AEMA 1RUF2 4W6WA 4RR3B 3GALA 2DF7A 4WVVA 3WG3A 1RB8G 3W59A 5T54A 2DFBA 4WM7B 3VN4A 1WCKA 4XIOA 4YZ5A 5CG8A 2Z42A 1Z78A 5GZCA 4GQ7A 3G6JB 2UY9A 2HEYF 2GH8A 1IPJA 1J59A 3MW4A 3B01A 4WVMA 2YZ4A 1AZDA 2TUNA 4XYXA 4YG0A 4AFDA 1RUC2 4DFSA 3JU9A 1IZ3A 3BALA 1ZBE2 4K40A 5K0UB 5CIRA 3SCHA 1XRUA 4HPKB 1BMV2 3POSA 4MXWA 3D0SA 2WLPA 5LEKA 2GNBA 1RUD1 5K0UA 4YW3A 2X29A 3NJZA 5K9YA 1G7YA 3SNMA 2YYOA 4R8HA 2JD4A 2EXKA 5I93A 4EN7B 3VKFC 2R071 5JZGA 4R4ZA 3WINE 2IZWA 2D98A 2QFEA 2VNGA 5KXBA 1WW6A 4BMEA 3FC0A 1IS4A 2PAKA 4IEZA 1PZ8A 5EZWA 1O3RA 1PVC3 5SV8A 3RJRA 2GC3A 1OLQA 2JKBA 1NLSA 1YIFA 1K5MB 4Q0PA 4FOVA 4WM8A 2JG8A 1DGWX 1RUC3 2HWC2 4ATEA 3VBFA 3FFQA 2YGMA 4XE9A 1RUF1 2BGCA 2GDFA 4AEDA 1QH6A 1YFUA 4LTAA 4J1WA 1SACA 2HWF3 4OFGA 1ZRFA 5AC93 4AWDA 1VBB3 3GZUC 4YZ4A 5GALA 1OPOA 2WSVA 4OZXA 2B42B 4LO8A 1DFQA 2XJRA 1YO8A 5FPXA 1LKNA 4NHKA 1G9BA 2NP0A 1MACA 3BOWA 2P34A 3FWEA 4D7YA 2WS93 2A75A 3ZYJB 2XJTA 4GB31 1NY72 5BNPC 3E97A 2ZKLA 1XXNA 3AKRA 2ZACA 1QJY1 5J96B 4FQZA 1SCSA 4W6XA 2A3YA 1MS4A 3I2DA 3AYEA 1PVC2 1UKGA 2R1BA 2IXIA 4AHZA 2VPVA 3TN92 3I7DA 3V0BB 1ZBE1 2ZX2A 2ZGLA 3ILNA 2A6WA 2OUJA 4IEVA 4UBGA 3H7JA 1JH5A 4CEYA 4M3CA 4CDXC 4P5HA 1WD4A 3QOPA 2WZR1 1OQDA 5JOZA 5EV7A 4QPGB 5L7OB 5CU1A 3OCPA 4BWOA 1RTVA 1NG0A 1DZQA 4YYOA 1QDCA 1DQ1A 4D7SA 1LHWA 2ZGSA 4FXGB 3JB4C 3WQ1A 1FNZA 2GSYA 5E89A 4CP2A 4I02A 4I09A 4V1PA 3SCFA 4F3JA 1ULCA 1RL3A 1CGPA 1GYKA 1JHNA 1OFSA 4Q1RA 3WP3A 5T55A 3B9CA 2NMNA 3UV9A 3J8F3 4EN0A 1XE8A 4ISRA 4QQPA 2OVUA 1D2SA 3RSJA 5FQ0B 5T5OA 1DHKB 2IFWA 4IL7A 2GC0A 2NLRA 4M0HA 4XJAA 4XTMA 3ATGA 1M4WA 4HN0A 4H55A 5EXOA 2ZGOA 2DV9A 1QNWA 2PLV1 4XOGA 1WMFA 3VL8A 5BV6A 4KU8A 1FOD2 1AL0G 5JZGB 1AR93 2DVGA 2RM22 2Y26A 2WT1A 4BZ4A 2Z69A 4AI1A 2WNEA 2XBO2 4JTOA 1I6XA 3LA7A 1J1LA 4O9EA 1IOAA 1G6NA 4HLTA 1YIPA 3ZFGC 4YGEA 5LK5A 5AFEA 3WW4A 1WLDA 2RS11 3AYCA 4R9BA 4JDOA 1U5ZA 4YZ2A 5C9AC 4DRVA 1KD7A 4YLZA 3U11A 4CEWA 4LULA 3M3QA 2VUAA 1QXPA 2BNOA 1QXJA 4YVWB 5CFDB 2BNNA 1HRV2 1MEC1 1HRI2 1EAH1 3WW2A 4NPRA 1HV0A 2YHJA 1DYPA 1RMU1 3M3IA 2JECA 1LRHA 4COUA 4R4XA 1YI9A 1W6MB 4JDNA 1VBA3 4PBOA 5KC5A 2VOVA 2H6CA 5LEJA 4GKYA 1RUH2 1UU6A 4AFCA 4WM7C 1JN2P 3L2YA 5FAXA 3USUB 3WVJA 2PLV2 4XQWA 3SISA 4XEZA 3MYXA 4XFGA 2E63A 3WP6A 4E4SA 3U07A 3AMMA 3DL3A 1O4TA 2PHLA 3LKJA 2JE7A 1D4VB 1EYBA 2W08A 4M3CE 5KHJA 3VHRA 1POV1 3GBWA 2WQZC 2WNUB 2CGNA 1JYIA 4P9GA 3OPZA 3RMXA 1HRV3 4YZ3A 5DUXA 1CAVA 3MGUA 2DCZA 2LM3A 2ZZJA 1C28A 1FV2A 1R091 4PLMA 2VGDA 1SQ4A 4EWAA 3ENRA 1FT9A 2VVFA 5HCBA 3MIEA 1CPNA 3SH4A 3WP4A 1Q3EA 1SBEA 4QHBA 2JG8C 1CD3G 4FO9A 4PLOA 3T1MA 1Q56A 2FHRA 1FAYA 4GA9A 3OD0A 4Q1PA 2D6LX 2PLV3 4YFZA 3C3VA 3J8F2 1NOVA 4AFMA 3H1MA 3CU7A 1LCLA 3VBRB 3WUDA 1FMD3 2EXHA 1NCRB 1PO23 4Q4Y3 5EYYA 1NE6A 4AHYA 1ZM1A 1O7FA 5FPZA 1OFNA 1ULGA 3H8UA 3JZVA 3AXEA 4AGGA 1L3JA 4XF9A 1X7NA 5JOXA 5BY5A 3TYJA 4YARA 4N43A 1AUYA 1AR81 1JUHA 4O9GA 1RUJ2 1ZNPA 3ZXFA 2WKKA 2XBO3 4MZUA 3UKNA 1QMJA 3ZFEA 4HPKA 4AQSA 3WDVA 4E27A 5A33A 2GMPA 3QBQA 4E4ZA 3B94A 3WHUA 2X53S 5JSPA 2V09A 3THTA 1A3KA 4LHNA 1BCXA 3ZSKA 4CDXB 1BEV1 5FMOL 4KGGA 4IEUA 3CL1A 3EQEA 4X8PA 2P17A 1S0GA 3WP5A 2CWSA 4JDMA 4MGYE 1NXD1 4GMP1 2O0OA 1N1TA 2EIGA 2ZX3A 2WT2A 2HWC1 1AL21 3UK9A 3IPVB 4HSLA 4XJ8A 4TZDA 1Q5OA 4Z8BA 4B4PA 1DQ0A 5C4WC 1W0OA 4ISQA 4XMAA 2VVDA 3N36A 3KCXA 2NMOA 3H50A 5J98B 4M3CB 1GR3A 2AH2A 4B7EA 4PJYA 4NOTA 5D1IA 1H1AA 1V6OA 1W39A 1MR5A 1FMD1 4FPCA 1G86A 3M2MA 2JJ6A 2XH6A 2WS91 2BFUS 2AGSA 4XFAA 4QPGC 5L7OC 1GBGA 1FATA 2Y0OA 1GZ9A 5AC91 5T5PA 1UAIA 2PHTA 3AKQA 1NCQC 4KNCA 1H9WA 3O12A 3ZN5A 1A78A 2W39A 4RS5B 3B3QE 3VBSB 4HKLA 2ZGNA 1RUC1 2AZ5A 3B00A 4MGKE 4YW5A 1RINA 5C9AA 1DDLA 3NW4A 3BOPA 4Q8LA 3B93A 1ND2A 4K7JA 2XVKA 4N43B 1PO11 3PNAA 1RJ8A 1BJQA 2ZGMA 2D43A 3EBRA 2EXIA 4CEYB 1MZFA 3HQXA 1POV3 4CDUC 4I2OA 2CV6A 1NXMA 4G4FA 3FBYA 2DCKA 3ALQA 3WD5A 1BBT2 2Q0AA 4E2SA 3MLLA 3NL1A 1V70A 3V0AA 4FP2A 5IT6A 4Q4V1 3AP9A 5JPNB 1N1VA 1MQTA 1VBE2 4OVEA 5ACA3 3UJOA 1QJX1 1H2NA 1VBA1 1ZZ7A 5CADA 1EV11 1UU4A 2XLFA 3GBGA 2GNDA 2TEPA 4J6GA 4RS5A 2WC2A 2ZZQA 1TME2 2BTVC 2CL2A 2RMU2 2XUMA 1CESA 1MVQA 4CEWB 3HD8B 1PIV1 1KS5A 3V56A 1WLWA 4B4RA 4LUKA 3NAPC 3POYA 1NA1B 4COYA 2I45A 4ES8A 2E9QA 2XLGA 1W0PA 2OIIA 4G3YC 3OD4A 5GZFA 5C8CB 1RC6A 2HWB2 1ZBA2 2UYAA 3MICA 1G9CA 1XU2A 3ZYPA 1NE4A 2Z5WA 3CEWA 5L73A 1X8MA 3J4UH 3NKGA 1BBT3 1OSGA 3AYDA 5J48A 3SITA 5JR7B 1MQTB 3A0NA 1WD3A 2D6MA 4EN8B 4KH9A 1LU2A 1F5JA 1X82A 1PVXA 4E2GA 3CF6E 2ZMKA 4IV1A 3R0RA 5CBLA 1CJDA 1TNRA 1WUVA 2BW8A 2DVDA 2D6OX 1QJU1 5GLVA 3QLQA 3VBHB 1RUE2 3R05A 1IS3A 3THPA 3JD72 1LEMA 1EAH2 1VBB2 5DUVA 2XVLA 2IXLA 4COVA 1VRH1 3WXPA 1UX6A 2DFCA 4AHXA 4B29A 3RYPA 5E88A 1RUE1 2G9GA 1QU0A 2VOXA 4LBNA 1LESA 1WA4A 4GWNA 5DUWA 3HMYA 4JV4A 3AMQA 3BPZA 4ONUA 4YGDA 2A3XA 1DGRN 4AF9A 4SBVA 1WMEA 1FXZA 2A70A 4LLFA 3WY6A 1S2BA 4NHLA 1LOFC 1VAMA 2C1FA 5LRRA 1DU3D 1R1A2 2K0GA 2ZHLA 4AEDB 1KS4A 2GU9A 1O3QA 1ASJ2 5FO7B 4HETA 1RUG1 3ZN6B 2JG8B 1SEFA 2QDNA 1PZ9A 1U5IA 4XIKA 2CAVA 3KGZA 4OUSA 3ZXJA 2DURA 4AK3A 1COV2 1V6KA 2ENRA 2WINB 1N3PA 4XQDA 2EXJA 4CDQB 1H4GA 3M4FA 4QX5A 1ULDA 1H30A 2QVSB 3A0KA 3I59A 3TRSB 4M0NA 4K3UA 1FI2A 3ELNA 1MS9A 1PIV2 2JG9A 3AKPA 3LAGA 3M3CA 3R4UA 2WNVB 4MV2A 3IT8A 4XDQA 5J3UA 2ZGUA 3AJYA 1F31A 3ZFFC 3DGTA 3SLIA 1VBA2 2ARXA 4YVWC 1RITA 4CDQC 1D2QA 5ACA2 4JVAA 3N7MA 3USSA 4H7LA 3KZ4C 1OI6A 1QJY3 1VP6A 3M1HA 3Q9OA 4N9HA 3LA3A 4D69A 1AR72 2CYFA 4XJZA 3AYAA 3R4DB 3VHOA 4B3NA 3WLUA 4KBBA 1EV13 1O5LA 4Q26A 4Z2WA 2X5IC 3IN9A 1O3SA 4KQ7A 2WT0A 3MFAA 1SFYA 1IHMA 3H3ZA 4Q4V3 1DGRA 1PO12 2VY0A 4Q0UA 4BHPA 4BQ1A 2HWF1 3HT2A 5JOYA 1AR62 1GZWA 3HIFA 5IK8A 3H9AA 1MS8A 4QPGA 4BA6A 5L7OA 4NO4A 1LOEA 3VBOA 4JRAA 1NCQB 4P9WA 2WL1A 2E7TA 3VGIA 5CFCA 5CG9A 2A5ZA 4MX3A 4FOQA 1VALA 3VZNA 2B5HA 3SH3A 1NCRA 1H0BA 4ZU4A 1CAXA 3FUOA 1PVC1 3P3NA 4CDWA 1ND2C 1XYOA 5FREA 1HXS1 2QDRA 2E53A 2GMMA 1DF0A 1JYCA 2UWCA 4MGZE 3GNEA 2SBAA 5JLVA 5D8AC 5JIAA 4IQPA 2I2SA 3RJ2X 1H8TB 3KGLA 5JSOA 1Z7S1 3S30A 1VRH3 4RR3C 1Q8SA 4AI8A 2AR6A 4K1YA 4KL1A 4Q4V2 4GKXA 4LO4B 4HSJA 2Q30A 2ET7A 2BNMA 4I0AA 1O3TA 1QXRA 2F4PA 4Q29A 5T50A 4L8QA 2QCSB 5I91A 1VBD1 1OD5A 3ECQA 1HQNA 4DY3A 4EN6B 2Q1ZB 3OGJA 3OYWA