1PGSA

The three-dimensional structure of pngase f, a glycosylasparaginase from flavobacterium meningosepticum
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
311
structure length
311
Chain Sequence
DNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVIQYNKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoglycosidase
molecule keywords PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)ASPARAGINE AMIDAS
publication title The three-dimensional structure of PNGase F, a glycosylasparaginase from Flavobacterium meningosepticum.
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
total genus 75
structure length 311
sequence length 311
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 1994-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pgsA02
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pgsA01
1YJKA 3KS7A 3MLLA 4R4ZA 3PHMA 3MICA 4QHBA 3MLJA 1YI9A 3MLKA 1PHMA 3PMSA 1PNGA 1YIPA 1YJLA 3MIEA 3MIFA 1SDWA 3MIBA 1PGSA 1OPMA 3MIHA 4R4XA 3MIDA 1PNFA 4E4ZA 3MIGA
chains in the Genus database with same CATH superfamily
2WWJA 4QGNA 2J1SA 4AVSA 3O1RA 3J7MA 1MS1A 3A7QA 4SLIA 2VQUA 3C7HA 2H6BA 4FO9A 1AVBA 4N90A 4OUSA 4OFGA 4R9DA 1IQDC 1V9U1 1AYN3 1VR3A 3BODA 2R072 4JGZC 2GNDA 3KZ4C 1RJ7A 1WMFA 3WF0A 5BNNC 3LOBA 4QMAA 3AP5A 1TME3 3CHXA 1H8TA 1JZ4A 1J1TA 4Y1VA 5JZGC 5C9AC 2IUWA 5SV8A 3I59B 1HJGA 1W04A 1RUC3 4E4ZA 2C9KA 1UX7A 2ZGRA 3H1YA 1BLZA 3IPVB 1AR82 2EIGA 2W1QA 1WLCA 4FOQA 4XJ9A 1OURA 1GNZA 2XGXA 3ZFGC 4FTEA 4IEOA 4RS5B 1UAIA 1QGLA 1COV1 1WCQA 2QQMA 2VMDA 2ZGQA 4XFAA 5FYIA 3LPGA 3HBKA 1KEXA 1O4TA 5KXBA 4Q0VA 5EIYB 1WD4A 4NWVA 3N4MA 1Q8SA 3VKFC 5HCFA 1J84A 2B9UA 1CPNA 4LKDA 4XBNA 1AL22 1BBT3 1QU0A 4D69A 2FZ1A 2OXBA 3VBUB 2WS92 3KT7A 4FFFA 1V6IA 4Z1VA 3ILFA 5IT6A 3QLQA 5J98B 3H1MA 2JD9A 4LLFA 3QOPA 2BZDA 5C3PA 3P3NA 3UGGA 1VBD1 2BWCA 1X82A 1DP0A 1PMJX 2XVGA 3KM5A 1WBFA 1VAMA 2V09A 4R52A 2DUPA 1C5HA 1GNYA 1EAH2 2OIIA 5DABA 1V6KA 4BDVB 1NYWA 1OD3A 4XDOA 5F9TA 4ORFA 4YLZA 4NPRA 4OUMA 2FDHA 4B4PA 4NPLA 4EE2A 2RJLA 4FQZA 1FV2A 2IXKA 3ZX7A 1NQDA 1VBE3 2I45A 1DQ5A 3A0KA 3JXSA 1R092 5F5QA 3ZYIB 4CXXA 5BNOC 1Z7S2 4MGKE 5FZLA 3RSJA 2CY6A 2C24A 2JWPA 4P9GA 3MIDA 4MLOA 2EF6A 1NCQA 4FPCA 4M3CF 3MW3A 3VB9A 5JOWA 2Y6LA 1SCSA 2X5IA 1N1SA 1ZBA1 4QQ2A 1G86A 4QGMA 2EICA 5L9VA 3B00A 4E2SA 1W6NB 5IK5A 3AP9A 4NWWA 2DCKA 3KD4A 5FZCA 1JOBA 3KV4A 3DCQA 4EN6B 4HVQA 5IK7A 2WN2A 3ES4A 4LHSA 4MGQA 4XDPA 1XNBA 1Y9QA 2E51A 2K2SA 2X8KA 4Q4X1 3THPA 3VD7A 3AX4A 3T0DA 2EVXA 5L7OC 4KBZA 4XBLA 2W87A 2VPVA 4L0PA 4XMAA 3H9AA 3WDYA 3K77A 4J1XA 2B7YA 2CYFA 5EP9A 3SCHA 1KGYA 1G9CA 1POV1 2ETEA 4HG6B 2XJRA 5F3GA 1SLLA 1FNZA 4K21A 1HRI1 2NP0A 2YGMA 3RQ0A 4CCKA 3C2UA 5CA6A 3NJYA 3IDEA 3NAPC 3V0BB 2YPJA 3AB0A 1C4RA 1HV0A 1BK1A 3GXUA 3RYKA 1RYYA 1O5UA 1F9KA 4GJYA 5KC5A 5J37A 4NIHA 1MZ5A 1XNCA 2R073 3H3LA 3VDDA 3U10A 4QPIC 1CIYA 3MLKA 2OS2A 4KGQA 1C1LA 1LOFA 2Y34A 3I2DA 4C1WA 4LK7A 1W8WA 4A44A 2WZR2 4IEYA 4IV1C 4BIOA 1RUJ2 4KG0A 3TN91 3MV11 5KBFA 5FQ0A 1X8MA 3VBHA 3N9QA 2J7MA 3K2OA 4YYOA 5FO7B 1G9DA 3AYEA 4XUTA 4F3JA 2WT1A 2EALA 3UKTA 1AR83 1UYYA 2FDIA 1RVF1 1QOSA 3APBA 5F2SA 1B35C 1W39A 3W9AA 1GFF2 5FZOA 1Q5OA 1DIWA 3VBOB 4BU2A 1NUKA 3HT2A 4CDUA 1Y9MA 1VRH3 1VJ2A 2VUJA 4KWLA 5AC93 4JZRA 1EV12 2WAOA 5FO8B 1FT9A 4Y4YA 3PVNA 5C8CA 4YVSA 1PZ7A 2D97A 2KR2A 1IGOA 4LBKA 3S0MA 2BPA2 2V4VA 5A32B 1Q8VA 3B5LB 3I3QA 1WCDJ 4QDQA 2WS93 4FXKB 5JR2A 3KHBA 1SFPA 2QQIA 3EQEA 5DDJ2 4E8DA 2RMU2 2P3JA 3JD72 3ZIXA 1HB1A 5FMOL 2YY1A 1SLTA 4YM0A 3KSCA 3EMRA 3MPPG 4LOTA 3OGJA 3V0AB 4NPMA 5FAXA 2ERFA 3HIFA 2OQ6A 5F8PA 2A7AA 3RI8A 1MS5A 4FPHA 1EAH3 3GF6A 4AVBA 2R0HA 4FQ4A 3DYMA 4DXTA 4LKFA 2JX9A 3BU0A 3MFAA 4PLNA 2R7EB 2GMEA 3D6EA 1V00A 2ZAAA 3EYPA 3N9LA 2XJSA 3NSTA 4MUVA 4UT5A 5FP3A 5FPLA 1ND2C 3ZR6A 3SCGA 1GSLA 1D0GA 4XETA 4PI0A 1HQLA 4RQPA 5FBJA 1V6LA 1UY2A 1POV0 1R093 2VZUA 1UKGA 3A0NA 4LHKA 4R8HA 4YZ3A 1LOGA 5GALA 3ZLIA 5L19A 1X9PA 4PJYA 1Z7S3 3DKQA 1QOTA 2VCMA 3AMNA 2K9ZA 5FP4A 3DPRA 2ZAHA 1AR61 1HB2A 4J1WA 2DFCA 5FRAA 1TMF1 3HNBM 2XLAA 3VD4A 1AJKA 4IE4A 5E1RA 4CEYA 2WJSA 1LOAA 2IZWA 3ORJA 4LBNA 4A45A 4GXLA 3TNPB 4CCCA 5JMOA 1BEV3 3SH3A 1G9AA 5A6YA 1CWPA 2XG3A 3QBQA 1RUH1 1GZWB 1QNYA 3LWCA 2Q1ZB 3USSA 4QHOA 1C1FA 5KXCA 4QM9A 1O3QA 3LIHA 2ZX0A 1AX1A 3WF3A 5CISA 1EUUA 4GMP1 5LK5A 1Z78A 1F15A 2PHUA 4P9WA 1AXZA 1WW5A 2D40A 5DUUA 4EWEA 1OPMA 3B9IA 4LBQB 3WVJA 1C5IA 5A70A 5FO9B 4AWDA 4Q0QA 5A80A 2QQKA 3OEBA 1LRHA 3C7EA 1AHSA 4PT6A 3BYWA 4I30A 1A8MA 2E31A 4P9JA 4M4PA 4XCAA 2D6OX 2ZHKA 1OC1A 3ZDSA 3ZYRA 4YM3A 5K9YA 4UAPA 3HQUA 4CU7A 2Y6KA 1XYOA 4OYUA 4HT1T 2BW8A 1FPN1 2XVKA 3AZWA 4K8FA 4NN0A 4Y5Z0 5G04L 1MEC3 2YB7A 5CBLA 1NA1B 1O7FA 2WFPA 3VGIA 1SFNA 1SPPB 4YW1A 2W92A 1FI2A 1TE1B 3POWA 2QNKA 2DVGA 4Q0PA 1QJX3 4CDWB 3UL2A 2ZEWA 1JN2P 3NNLA 5FY1A 3LOIA 3BIEA 4CUAA 2A3XA 2OPKA 4J6GA 2B9VA 2J1RA 3JQWA 4LXLA 2OKXA 2DCJA 3VV1A 2I2SA 2WSVA 4HPKB 1WUVA 4INDA 4LIVA 1QF3A 5F32A 3CF6E 5K0UC 4YFWA 4ZZ8A 2JICA 4NHXA 3ZFEB 3VHPA 1LHWA 2QBXA 2ARXA 3H8XA 5FZDA 4MH0E 3IB3A 3MIFA 3RPQA 2XHKA 3CU7A 3RWNA 4A3ZA 2X10A 4N53C 1JOPA 3WG4A 2UURA 1XQNA 5DDJ3 1BMV2 2AEZA 1OQ1A 2AEYA 1W90A 1KD7A 4LIUA 1UY4A 4FBFA 4LKEA 1VAVA 1H2MA 2QZ3A 3D0SA 1RUC1 2XUEA 2RS33 2DV9A 1KXGA 5FY7A 2IXHA 1RHI2 4K8RB 4Q1PA 5BUVA 3LEKA 4Q1RA 1ZYBA 3GCXA 1W03A 2MEV1 2FCTA 4GMP0 1QDCA 1UPSA 2OUHA 5CFDC 2A6WA 3VN4A 2ZEZA 1RUF1 3OGRA 5FZFA 4XF3A 4KWJA 3P3PA 5IFTA 4NO4A 4OHYA 3NNFA 4XXAA 1PVC2 4CP9A 4GAZA 2FDJA 3S30A 3POYA 2WO3A 3GJBA 3RI9A 4Y20A 4QQOA 1XXNA 3ACGA 5LEJA 5CG8A 4QU1A 4Q4Y3 1SMVA 5IAVA 1ENRA 2JDPA 2ZA9A 5FYUA 4O7XA 5JVVA 3SQOA 1ACCA 5A1FA 2Q8CA 4RFT0 3M2MA 2W08A 4IV3A 2A5ZA 5BNNA 4EWAA 2GMPA 3PTYA 3AM2A 3O1UA 2RS12 4F7ZA 1ZZ8A 2PHTA 1LHVA 4GWMA 4MGSA 3SKVA 1M06G 1H8TC 5C4WB 5HI0A 5JZGA 5C9AA 1LHNA 3KLSA 4UFJA 1PO11 3S5QA 3GZTB 3R4DB 5A3MA 5I8TA 1IS6A 1W2OA 1QJY1 4A42A 4CCNA 5HXMA 5APAA 2F4LA 3FUOA 1LU1A 2JDZA 3BU7A 4DEVA 4FPEA 1I5ZA 3A23A 3H3UA 1A78A 5FZ7A 3CJIB 1GKBA 4XBQA 5F6LB 1JYTA 3O7OA 1PGSA 1UZWA 1BJQA 3N35A 1PVXA 1UY3A 3H0OA 3U1XA 3HQXA 5J36A 5TSWA 4MG2A 1IOAA 3OG2A 3AYCA 3H8UA 2QDNA 2YC0A 2VH9A 1XNTA 4CXWA 2WAAA 4FXGB 4QWNA 1C28A 2VMIA 2ZHMA 1G7YA 1JYVA 5T5PA 1U0AA 4XQWA 3H8RA 4BMEA 2XMLA 3LD8A 3VUOA 3T1MA 1UWWA 1JUIA 1XYPA 3N9PA 2J22A 4QKBA 1W8HA 4YPJA 4XILA 3FHIB 2YDEA 4IEQA 1RUI2 1CAUB 4XTPA 1VMJA 3ME2A 4Y33A 2PHRA 3CQOA 2PLV2 2K0GA 2I74A 4JDMA 2RM22 1K5MA 1W6MB 3WCSA 3R05A 2ZX2A 4AF9A 1OBNA 2Q0AA 2VOXA 3CMGA 1QJU1 2BGPA 2RDNA 4QPGC 4YW3A 1DQ2A 4ATFA 5A6ZA 4XFBA 2RDSA 2O0OA 4LOSA 1CVNA 1RMU2 3PIJA 2QFEA 2VVDA 4QXKA 1CAWA 1DYKA 1LGCA 2ZX3A 3IM0A 4AEDC 1ZZ6A 4Q4W1 2GN7A 1S0FA 3Q8BA 4CCDA 3RZMA 5JI9A 2FZ2A 1S0BA 5C6CA 2EAKA 2H0BA 2KM2A 3ZXEA 3ZYHA 4CDXB 5FPZA 5BNOA 4BXSV 2VUDA 5FUNA 3WDWA 4LUKA 2VW2A 2HYKA 2Y6FA 1ULGA 1SHWB 4EYUA 2AREA 4XVHA 5L36A 2FCUA 2G1MA 5LASA 3IT8A 2X5IC 4UF0B 1VP6A 1VIWB 2EXIA 2V5DA 1PZ9A 3W20A 4AI2A 1YLLA 3NWKA 5KR7A 2WYSA 1LU2A 2QCSB 4NOTA 3VBRB 3CJXA 4NHLA 5FZ4A 1NXD1 3WW4A 2HWD3 1GOHA 1FOD2 5L7OA 3O0VA 5FZ6A 2WQ4A 2PFWA 2Q8OA 1H2NA 2HEVF 2NZ9A 1AR81 1ND3B 5CVRA 3MICA 4QX1A 3B7MA 1JXNA 3PURA 4B7EA 1OT5A 4RHV2 1JZ8A 1WGPA 1LNSA 5FBZA 5AVAA 3I2GA 5FDBA 1PVC3 4K20A 5GJ6A 3PUHA 4TN7A 4IESA 3UESA 2Q30A 4HETA 1VBA2 3BIWE 3O0WA 4HONA 2DTYA 4JRLA 5FXZA 3E97A 1AL21 3LGRA 1HIXA 2EIEA 2FDFA 2CNAA 2FD8A 5A7PA 1GZCA 2VOTA 4QQPA 1ZBE3 4Z2AA 1T6BX 4A7YA 2RS13 3T2PA 5EQUA 3VKNA 3LFIA 2PELA 3WNOA 3D3AA 4Y5SA 1JTZX 4FOYA 2Z42A 2QQJA 2ZOEB 4CP0A 4A4AA 1V6JA 1QMJA 5AFBA 2CSGA 2WNUB 3JB4C 2BBVA 2FBEA 4Q2FA 1W9FA 1VBC2 2YBPA 5B4NA 1DQ6A 3O14A 3U14A 4JX0A 1QJZA 2HWC1 3UGHA 1D4M2 5KHHA 3MIHA 4EWDA 4ISRA 4NJ4A 1IS3A 5K7PA 3A4UA 1MR5A 1S0CA 3POGA 5FREA 4ITCA 1MZFA 2VZ1A 1Z7S1 4ES8A 5CFCC 2WL1A 4X8PA 5FMOS 5AFEA 4YVSC 3MV01 1AYM2 4BMBA 4JGZB 4OHXA 1HW5A 2ZKNA 4COYA 4AFDA 3NV2A 5JSRA 4JKKA 4O9GA 1CZTA 2R32A 3RVHA 3T30A 1OA2A 1OVPA 3ZOIA 1OOPC 1RUI3 1BVVA 2XUMA 3RWKX 3E6DA 1UZYA 1GZ9A 2PLV3 5C3OA 5T5JA 2RM23 3ZN6A 4JDOA 5J1XA 5H9SA 4ZXEA 3W58A 2RV9A 1XRUA 1VPHA 3FLPA 3UKNA 2VR4A 5FYBA 3WQ0A 3B01A 1QXJA 2VM9A 3RFRA 4E8CA 2FDGA 5FZ0A 3RMYA 3ETQA 2PAKA 4BJ0A 4RQPC 2AR6A 1KDMA 3AYAA 3DXUA 4XFHA 2P17A 4P9IA 3POFA 5A3WA 3NV3A 1YUDA 4FFGA 2WSUA 3NV1A 4UFIA 5C5UA 5FYVA 4JGYC 4JRAA 1WA6X 3I2FA 2KXLA 2P3IA 1G9BA 4FTSA 4LHNA 2D6MA 2BBAA 5GZDA 1RINA 1SACA 2JXAA 4YM1A 5T50A 4PIYA 2YUEA 5FY0A 3WNXA 4D6QA 1H6XA 4GH4C 4PIZA 2Z5WA 3MIBA 4QDRA 5DAPA 2JG8A 2JDHA 1W8OA 3AZVA 3WF2A 5FZ3A 4META 4OCTA 2WZR1 1RUJ1 4YW2A 4JTOA 4YGCA 1CGPA 1JZ2A 2UY8A 4AI9A 4B1LA 2H6CA 2TBVA 2JKXA 2JKBA 3OTFA 1V6OA 3RZHA 2IXJA 1VB2A 1GUIA 1BKZA 3I3DA 1IKPA 3IKWA 1PGW2 4K1ZA 3N7KA 3TEXA 4RHV3 2X05A 1MS4A 2WFF2 4Z07A 4IGQA 5JUVA 2CTVA 5ABJC 3LQCA 3ACIA 1PM4A 4LO5B 4MXWA 3JCIA 3MBWA 1W6QA 2GN3A 4OMDA 1REFA 3WDVA 2QQPA 1EV11 4YVWC 1DZQA 1VBA3 4XJWA 1S2EA 4Q8KA 2A71A 2JG9B 2K46A 2L9LA 2WNVB 1HB4A 4K6BA 4S2DA 5F7UA 1MVQA 5G05L 2BGCA 1VAKA 1XYNA 1R081 4DQAA 1TNRA 4UXAA 2RMU1 3JD71 4QX2A 4AG4A 2R061 3T09A 1Q8QA 3WX5A 5FY5A 2BERA 3RG0A 2WO2A 4UOJA 1ONAA 3ZN4A 1OVSA 2JIJA 2GALA 4FPFA 1LJ7A 4RD7A 4E27A 1A34A 1CX1A 4WV8A 2WYFA 2G19A 4PDWB 1BCXA 1UL9A 4PHZA 5LCWL 2D5FA 3URFA 1AR91 1D7PM 4XFCA 5T54A 4FAGA 3WHUA 4XC9A 2IC1A 5L9BA 4YFZA 4OVEA 1D4M3 2C4XA 4NVPA 3SMHA 4LE4A 1STMA 3VDBA 1W6OB 4N43B 4BH9A 2WT2A 5CU1A 2NMNA 3NAPB 1PO22 1YQCA 3AL6A 4GALA 4XJAA 1W6NA 4K7JA 3RJRA 4ZU4A 2XJUA 3JQXA 2D98A 2XONA 1NZIA 3ABZA 1OA3A 1KJRA 3POJA 2OVUA 5FUPA 4CUGA 4YZ5A 5GZGA 2CV6A 1JYWA 4QPYA 1V70A 1HRV3 2VNVA 3G7DA 3AZZA 1QIQA 2XL9A 3OGSA 4N53A 2XQRA 2A75A 4Q4V1 5FY8A 2EXJA 3VBSC 4AHWA 5A6XA 2WZ8A 5IVFA 2J1UA 3AP6A 4IV1B 4CVUA 4XF4A 1UMHA 4D7SA 3POEA 1X7NA 2BDRA 3AXDA 1OSGA 4DIQA 1GWLA 1W05A 2GP5A 2GH2A 1ZRRA 1WMDA 2H0VA 4LR4A 4TZDA 3PVEA 4FFIA 4XUNA 3HAGA 4QX0A 4EN9B 1B35B 5I8SA 2IVIB 3DV8A 4FPJA 1UZ0A 2WKKA 2N7GA 5LATA 3ILRA 1REEA 5FR3A 4ZHNA 4A7KA 3D0JA 2YMZA 3OY8A 4EN0A 5CAZA 3POBA 1VE0A 5ACA2 1KRIA 2ZMLA 3I49A 4MYEA 3ZYBA 1PM7A 5DN2A 3T0AA 5I93A 2B46X 1AUYA 4UI9L 3LA7A 4IV3C 4XQ4A 1XU1A 1UXXX 3MIEA 3OD4A 1KITA 4AHXA 4I0WB 1W0NA 3KVBA 3PU8A 2EA7A 2ENRA 3IAPA 2NQYA 3GZEA 3N7JA 5FZHA 3OUHA 1BHGA 1ND2B 1DLLA 1F8VA 3ZDVA 2OQ7A 4Q8LA 3PHMA 1GP4A 4BHPA 2BVVA 2WFF3 2DWRA 5KHGA 3VZMA 2XJQA 1YC61 2E53A 2G9FA 4Q27A 1D4VB 2E26A 2ZX1A 2R49A 1VRH2 1PMHX 5FMBA 3ZXJA 4M3CB 5AC92 1XE0A 4K1YA 1S2KA 1NCRB 1MZ6A 5LBCA 3NNMA 4DB5A 1WMXA 1KS4A 1W99A 2VL4A 4I02A 4IUGA 4EV0A 2JIGA 3WP6A 4H3WA 3I2OA 3OYWB 5F6KA 1IS5A 1EPWA 1R1A2 1ENSA 1EYBA 4XYXA 1BMV1 3ENRA 4M0NA 4UFHA 5IVBA 1W2NA 3MIGA 3ZVXA 3RYPA 1UOGA 2WA4A 1K5MC 5EJ3A 2QTWB 4QPGA 1I9RA 2ORXA 1G8WA 5A1LA 1OFNA 3HWJA 2UYAA 1RHI1 2BV4A 3FLTA 3GHMA 4Y1UA 5IWFA 3DXTA 2DU0A 4YGBA 4QB1A 4WM8C 5I0TA 4QQHA 5C71A 1F5FA 2OPWA 3AMPA 4AEDA 3WQ1A 5JPNB 1HLCA 2PHLA 4CCEA 2DCZA 4XZUG 1FX5A 4AVCA 4C0BA 1PVC1 4LTAA 1RC6A 5JOYA 1PO23 3N9NA 5EXOA 2VOKA 2ZGLA 1RUD1 2W52A 3AZXA 2ZZQA 3JBG3 3N7LA 3M3EA 3CZJA 4IE6A 4UW6A 1XU2A 2GAUA 3WNPA 4BK4A 2Z69A 3J7HA 2BFUS 3KV5A 4RR3C 3N3HA 1JBCA 1NG0A 2YPDA 3G6JB 4GWIA 5EJ1B 5CG9A 5DZEA 2W0XA 2E32A 4JQTA 3WG2A 1PK6C 4BQ4A 3ES1A 4DO0A 1QNWA 2HWF2 1CAVA 1BEV2 1QH7A 3AKTA 5EWSA 4BQ1A 3J7LA 3INAA 1XNAA 1DDLA 1NY72 5AVPA 5FYSA 4AL9A 4XUQA 5T5OA 4FI9A 1FNYA 1Q8PA 3HJRA 2P2KA 2DVBA 3CNAA 1Q43A 1ULEA 1WKYA 1Y3TA 2B45X 2HWE2 3J7NA 1C8M1 2Y64A 2VNOA 3EO6A 5FMCA 3VHRA 4AGRA 1SDDB 3H3ZA 1TQ5A 3LDKA 1UZZA 2YV8A 1QQP1 3QH6A 4ZS2A 2GNTA 4N9IA 4X8NA 3FLRA 1LGBA 3VZKA 5I0UA 4EZHA 5K0UB 1HDKA 1NZCA 2VZQA 3CL1A 4YG6A 1RUG1 4YW5A 3GJAA 3LZZA 4COUA 5A7SA 5ACA3 1UYPA 1JHNA 4QM8A 3AL5A 5JSOA 2E6VA 2O14A 2XR4A 4A41A 4AFMA 1ASJ3 2LROA 2P6HA 3LEGA 4LO4B 3AZYA 4V2WA 1LESA 1HQWA 3V56A 1CAXA 2LUWA 1FYUA 2ZGTA 4BISA 2BNNA 3PMEA 2ATFA 2BQPA 2ZGNA 5JOXA 3W21A 1AX0A 4IE0A 1MEC2 2IXLA 3AJZA 2PLV1 4IE7A 4XIKA 3GHNA 3LSEA 3M7AA 5J09A 1J3QA 4XACA 4YARA 1UOJA 3AVRA 4TLFA 4XQDA 4AEMA 4D7YA 1QJX2 4HPKA 4P9YA 3TEWA 2DTWA 4AE2A 1IS4A 2VZTA 5IW0A 1RMU1 2JDKA 3K4DA 3BTZA 4NIDA 5CFDB 3IWZA 1CZVA 3GZAA 4K40A 2D6LX 3WZ1A 4Y24A 4HKWA 2XVLA 4WZFA 2ZMKA 1MQTB 3QD6A 2AZ5A 2XHNA 2G9GA 1NQJA 4MXVA 4OMCA 5CFCA 1PIV2 5C3RA 5BNPC 2QQLA 3ILNA 4P5HA 3J8F2 4XABA 1S0JA 2QQUA 1R1A3 3RMXA 1UMZA 3ZSKA 1H8TB 1OOPA 4JDNA 1YIFA 4NUBA 1MVEA 1OLQA 4XIOA 4AI1A 4BQ5A 4UBGA 1LKNA 3HMYA 2NPIA 1HXS2 3AC0A 5A3UA 1FOD1 1LEDA 1YYNA 2W9XA 2R043 1NXMA 2WLQA 1K12A 4IEWA 3RNSA 3ZSJA 4BQ3A 2XLGA 3KGLA 5IHRA 3LEIA 2RS32 5EYYA 5F2WA 4IETA 4LO6B 3TB0A 3ZXKA 4C91A 2CWSA 3WW2A 4C1XA 3M4FA 2XBO1 1JW6A 5FY9A 4PBPA 1DLCA 1E5HA 3DECA 4LNVA 5FTTC 1ZVFA 3I2HA 4OLLA 3ZPYA 3MFCA 2WWUA 5F1RA 1OF3A 2A1XA 5I8YA 3AJYA 4PIXA 1YFUA 1UYZA 2ARCA 3LE0A 4KWUA 4Q4Y2 3O1SA 4JGYA 1RTVA 4V1PA 4TWTA 5EJZB 4NHMA 3TAYA 5BY5A 3POSA 5FP8A 4JCKA 3LFMA 1AR72 1DZTA 2NN8A 3JZVA 5I91A 3WQ7A 5KHJA 4OI1A 4A6OA 1YRZA 4GH4A 3LA2A 2RS52 2HWF3 5EYXA 1DG6A 2HWB1 2JG8C 5T52A 3T08A 2XKOA 5KXEA 3OPWA 3UNPA 3M70A 3EB7A 5FJHA 2RG4A 1VALA 4IEZA 1W3VA 5FYCA 4H55A 3LDRA 2DUQA 4RS5C 1IHMA 1W8ZA 2HWE3 4M4RA 3THCA 4HMZA 4FPKA 3I2KA 2RR12 4CSWA 1VBC1 3WP3A 2JDAA 5BV6A 2ZGKA 5ABJA 1JU4A 3CIHA 4N7IA 3KF5A 1X50A 2HJIA 2P37A 3EJKA 3VBUC 1FMD2 2PHXA 4YVWA 2BNMA 1GICA 1NCQB 3AMHA 5F3EA 5BYNA 1YXWA 2VULA 2X5IB 2EXHA 3BB6A 3UV9A 1AYM1 2R6QA 1TZOA 2ZJCA 2ILMA 3ITQA 4YW4A 4WBBA 3ZYGA 4JKMA 4Q0SA 3DYPA 2CL2A 3NKGA 3FFQA 2W1SA 3MUZ1 2OW4A 2WNEA 4MGZE 4DOUA 5C70A 5JSPA 3LA3A 1VMHA 5CKQA 4H7LA 3DKWA 4WVMA 3RZZA 3FMGA 3S7IA 2XH6A 2BNOA 4CCJA 5FCCA 2R1DA 2D43A 4OHWA 3HBZA 4U36A 4ASLA 1V9U2 3RS6A 3H1WA 5FZ1A 3WDUA 3IDCB 4QX5A 5I0DA 3UT0A 4S2HA 3TYJA 1EP0A 1PIV3 4I09A 1GOGA 3R4UA 2ORZA 3EXUA 4HN0A 2A6XA 2WUHA 2TUNA 1AYN1 1TVGA 3J8F3 3VDDB 2GC2A 4TLGA 3VBSA 3ZYPA 2RJKA 5F3IA 2XWBB 5GZEA 4JHZA 1YCIA 4UW5A 5JMCA 1UY0A 4Z82A 1TME1 3BKZA 4CZSA 4W65A 1HXS3 5FQ0B 1RIRA 2PHWA 3VBHB 4AGVA 2HWD2 1YFWA 5D8AB 3WW1A 3TEZA 4AZZA 2XKPA 2YHJA 3GALA 5DPNA 5BPXA 3HQRA 2VOWA 3Q9OA 1GOFA 1QXPA 4GZ9A 1YFXA 5HV0A 3I3BA 5EPAA 3I54A 4QKNA 2RHPA 5FZOB 1KDKA 2MHFA 4IE5A 2WFF1 4URTA 4CDUB 1VBB3 5C3SA 4XJZA 1ZA7A 1HN0A 4BLJA 3ZXLA 2ZZJA 1BYHA 1SCRA 4WZCA 1SEFA 5DZGA 5HBAA 1YHFA 4BB3A 1NOVA 4ZONA 5C8CB 5IVVA 4FP3A 4YVSB 4F83A 1JUHA 2KA3A 1HJFA 3WUDA 3MO4A 4DXSA 3M3IA 2ADDA 5HCBA 1AR73 1BBT1 5KHKA 3O5SA 5GZCA 2FDKA 1PMIA 2J1AA 3AK0A 1ZZ9A 5A7QA 1JYCA 1NLRA 1ZBE2 2RS53 1FATA 5FIXA 3ZKYA 5A6QA 1VLNA 4I3PA 3S5AA 2ZHNA 2GNBA 5JCTA 2WQZC 4JAAA 1IQAA 5FPAA 5LY1A 3WNLA 3OGVA 2VZPA 4AHZA 4P14A 4XE9A 3VBOC 4XHBA 3HD8B 2UWBA 1JHJA 2WO1A 3AKPA 3PJYA 3GYDA 2RR13 1IG3A 3A21A 4XDQA 4X6RB 1TNFA 3WY6A 3X29B 2VW1A 3OPZA 4RQPB 3ZR5A 4E2QA 3VKLA 1W28A 1VBE1 2QQNA 3EBRA 3ZN5A 5FK8A 2BEOA 1FMD3 3DPRB 4L9BA 4W6WA 1WLWA 1DYPA 3MHZA 1U5YA 4QPWA 4MOAA 1HV1A 4JVAA 4D3WA 1IZ3A 4Q4X2 1NE6A 1OXCA 4BK5A 1W2UA 1FXZA 4CEYB 3SXWA 5IVEA 2UY9A 5FMDA 2VMEA 3VZLA 4B4QA 3DGTA 5FV3A 3WOGA 4RN5A 4CYDA 2SBAA 4LITA 1V6NA 1DGWX 1CQ9A 3CLPA 4HSLA 4MX3A 3T1LA 4QD2A 4P5YA 3KV9A 3WNKA 2C26A 3N36A 1SFYA 2YBSA 4HXCA 3C7OA 5IAXA 4BE3A 4WM8A 2W94A 4ZXKA 4KI5M 3VBFA 3ZFFA 2LALA 4XF1A 3MEPA 4HN1A 4H7MA 2ZABA 3ZIWA 5A1AA 1V9U3 1BK0A 3UKVA 3P1IA 4M01A 2VNRA 1XBFA 2DYCA 3BCWA 3K48A 5A3TA 2CWMA 5ACA1 4GKXA 5E16A 4DPNA 4NE9A 4GULA 2B4KA 4YG0A 4ZZ5A 2VJXA 3ZO0B 2PAMA 5A7WA 3DN7A 5FZ8A 4URAA 5FLIA 3V65A 4RR3A 5JR7B 1GANA 2RJ2A 3CBNA 3NQHA 4QX8A 3TN92 3LDBA 2JEMA 2R071 5HCAA 1PK6A 5FLHA 2VMCA 3HT1A 3KQRA 1HX6A 1ZZBA 2WC2A 4I01A 1ZA4A 2O1QA 3ON7A 4AAPA 4CCMA 4MADA 3PIGA 1TG7A 2BFUL 3BTAA 3KCXA 4XTMA 5FKCA 3WP5A 2A3YA 3AMQA 3DF0A 4CE8A 3FBMA 3MPBA 4IGPA 1WCUA 5JDBA 3PUIA 2ES3A 4Y22A 1KFXL 5EV7A 3KF3A 3NRUA 5JOZA 1UCXA 4S2GA 1VRH1 5L9RA 2XB6C 5AC91 1LULA 3AMMA 4O61A 4XUOA 1YQ2A 2VTXA 1VBD3 4QKDA 4XJ8A 5GZFA 1H0BA 5DUVA 3K75B 4D94A 4NAOA 1Q3EA 1AX2A 1MS0A 5DAQA 3THDA 5IFPA 4DRVA 2C0ZA 1J59A 4BXFA 4AAXA 2WS91 3GBWA 3ZXGA 4CDWC 3KS7A 5I0RA 1H1IA 5GLZA 2IFRA 2PQSA 1NE4A 4LJHA 4AI0A 3C8XA 5FYZA 5EHDA 1I5PA 1VRBA 2IXIA 2D6KA 5FKBA 1S2BA 4M0HA 1YI7A 2ZX4A 4CDQA 2J1VA 1EAH1 4HFSA 3TBDA 4D8MA 1LTEA 2D7FA 5GLUA 2ZCWA 1V6MA 4Y3OA 4NRQA 4AGGA 4O9EA 3VL9A 5J96B 4J25A 1MACA 3RRDA 4O65A 2V4AA 3DL3A 3IIIA 3VL8A 4MO3M 3WNNA 3ZKUA 2BTVC 3K51A 2JB4A 4FOWA 5A33A 3P6BA 1OHFA 4CEWB 1ZBA3 3LKJA 2YFUA 1R091 4XAEA 3RZGA 3VZNA 1U5IA 4JTNA 4LT5A 4Y20B 1WD3A 1W6PA 3C3VA 4IL7A 3IMNA 3PTRB 4YRDA 5BNPA 2ZGPA 1W8FA 5CB7A 1URXA 1GR3A 4Q4X3 4WM7A 1RUOA 4HZFA 1HRV2 1UU5A 3I4IA 4IV3B 4B3NA 1GWKA 2PXJA 1OA4A 4UWDA 4LBLA 5LBBA 5CYYA 2WZPP 5BNNB 2DVAA 4B7KA 2HWF1 2W1UA 1BEV1 3CZUA 4TSVA 4MHRA 2GMMA 5JZGB 5C9AB 2ZTNA 1LCLA 2AUYA 2DFBA 1POV3 4IGOA 3BOWA 1ZREA 1HRI3 3D8CA 2Q5TA 2Q8EA 3USUA 1A8DA 3PVOA 5FZGA 5JXHA 1GBGA 4CXYA 2NMOA 4P02B 3WDXA 1A6CA 4XFFA 2RDRA 4W50A 1L7QA 1B09A 2X53S 4X6QB 2CGPA 3ZFGB 2E9QA 4DNYA 2PAEA 3FL7A 1W2AX 1JMUB 4IDZA 2Z4FA 3MLLA 3H8OA 3ST7A 4KWKA 3J4UH 4Y5TA 5FPVA 2VU9A 2AH2A 2CGOA 2X09A 3GM8A 2TEPA 2X29A 4NHYA 5T55A 1MS9A 4XAAA 3TN93 5C4WC 1AF9A 2VD7A 3I59A 4NHKA 5D21A 3T2QA 4GIQA 4JV4A 2XL7A 3IPVA 5SV5A 4BLIA 3OBTA 1UPIA 1OUSA 1RVF3 1MEC1 3NJXA 4GB32 3CJIC 1UOFA 4ASKA 2XWJB 2Q4SA 1JI6A 1OMIA 3J26N 1S0GA 4AQSA 1QEXA 1LOBA 1QJX1 4PF1A 4RS5A 3VD3A 4DRRA 1UW8A 4GQ7A 4RGAA 3VZOA 1CAWB 1UNBA 3NW4A 3L2YA 1IKQA 1O91A 3AP4A 4LE3A 1CD3G 2A6ZA 4KQ7A 4N9HA 1N1TA 3MLJA 5BNOB 3WF4A 4GJZA 4KGGA 2Y38A 2EIBA 1JYXA 5IVYA 1WW7A 2GNMA 3VBUA 4BOWA 3O1MA 1XNKA 4JC1A 3ZPOA 1ULOA 5A7NA 2EIDA 3VDAA 4KMQA 2HBUA 4DUXA 5LWBA 3OOXA 1RGSA 3LIGA 2FMYA 3ELNA 4KL1A 4PQ9A 3WV6A 5FOBB 5DDJ1 1N1YA 2MEV2 5A3NA 1HXS1 4TYSA 4W6YA 3WEZA 1PZ8A 3O1PA 2V73A 5L7OB 3BOPA 3H50A 4Y1ZA 4XJUA 3ATGA 2CAVA 1D2QA 2P34A 1L7RA 2Q1MA 2YC4A 2RS31 3VKOA 4CCLA 4ET7A 1U5ZA 4CDXC 5LK7B 1XPWA 5IK8A 1OKOA 2O8OA 2E7QA 4MGYE 3L2HA 4HL0A 3WUCA 2Y26A 2YBKA 1SDWA 1TMF3 1Q56A 2A73B 4OHZA 3RZKA 2WO7A 4P9LA 1H30A 2GZWA 1US2A 5CIRA 5D2AA 3D82A 1ENXA 5ANNA 3UJOA 1WZXA 4HLTA 4Q4Y1 3JBG2 5FYMA 4NIAA 4LA3A 3I2JA 2DUOA 4FTBA 1ZRFA 3MF6A 1WLTA 2CU5A 3ROUA 4QPIB 1V0AA 3NJZA 4RSUA 4F8AA 5T3NA 1O6UA 5FPUA 1HN1A 1Y43B 4GMP3 1QWRA 3ZM8A 4YZ2A 2NLRA 4JKLA 4Y1YA 2ZGUA 3W5NA 4MVTA 5LY2A 4A7ZA 4ZU7A 3KQ4B 3N9MA 4AK3A 1LHUA 4DFSA 2VO5A 4BQ2A 1YJLA 2D6NA 4KU8A 4UFKA 1NX9A 3WQBA 1UQXA 4CU9A 4NMIA 2WZEA 3H7YA 3LEMA 4NR1A 3U0ZA 1UZVA 5LBEA 1ODNA 4XF0A 4PLMA 4NIGA 5JIAA 3V0BA 5E6HA 2VOVA 2ZEXA 4QGLA 1WW4A 2DCYA 4A2UA 3FWEA 2LM3A 3WNMA 4KBBA 4K3UA 5JI7A 3QCWA 3FHAA 3J9SA 3SITA 3U11A 1YJKA 5KHIA 2VMFA 1ULDA 2E7TA 2I07B 1C8NA 1CR7A 1GMMA 3WXPA 1K42A 1G6NA 1OUXA 4QB2A 1UIJA 3AP7A 4YG3A 5CKNA 1ASJ2 1CJPA 2XOMA 4RA0A 1SBEA 3BI3A 1QJU2 2FCVA 3FHQA 4FPYA 2VQAA 1YIPA 1WA4A 2WNUC 2WT0A 3WINE 4AHYA 3GZUC 3ZN6B 3OD0A 3IIAA 3O0XA 4FOVA 4GB33 4Q4W2 1RUNA 2VZOA 1PNFA 4FSJA 3VBOA 4Z8BA 2YU1A 2ZACA 2AYHA 3HN1A 2VBDA 1XSQA 3KVAA 4L8QA 1H2LA 5CZKA 1SLIA 3K46A 5HCHA 3PL0A 2HKXA 1W0OA 5J7MA 2DVDA 4MZUA 2WQ8A 4C8DA 3AFKA 2VTXJ 4XEZA 4JQRA 5ANQA 4WVZA 5A32A 3FX3A 4B29A 1LODA 2JB8A 3A22A 5F5CA 5M0TA 2JE8A 4PI2A 5JPMB 2Y33A 5LRRA 3ZSLA 4FVVA 1K45A 1DFQA 2GU9A 1QKQA 2P4EA 2Y6HA 2BUKA 3MGUA 4YWAA 2VGDA 5FZBA 4K9SA 1F4HA 4CCOA 3V0AA 1DQ1A 4IEXA 1C57A 2JENA 3GDBA 3HVDA 2KD7A 4HKOA 5FXWA 2JG8B 4W6XA 1GU3A 2C1FA 2EAAA 4G4FA 3IAQA 4D0QA 4XURA 2FMDA 4LBQD 1X8EA 1NLSA 2QQVA 4UW4A 2MEV3 3E6BA 1S1AA 5KC6A 3U75A 2V72A 1RUF3 1Y9GA 2HWD1 2VC9A 5DZFA 1O3SA 5DAWA 1JOJA 2UWAA 1F5JA 2R042 1E5SA 2VW0A 1JS9A 1UXZA 2F17A 3R0RA 4UBHA 1YFYA 1E57A 4AFBA 4RL7A 1JYIA 4ZS3A 1KQRA 3PMSA 1N3QA 1S0DA 3VBFC 3ZFFC 1S4CA 3NNJA 3AVSA 4GWNA 4MXWB 4AI3A 1W6QB 3IMMA 4L2NA 5LZ6A 4BQXA 1O4YA 3CO2A 3OF1A 4CPBD 3ZXDA 2JDNA 1I1EA 1D2SA 3LSDA 1XSRA 4E4DX 4YZ1A 4RGGA 1YQ8A 3VHNA 1UU4A 1GZWA 1PO13 2Y6GA 1DF0A 1GQPA 2DU1A 3E1F1 5EZWA 5K4LA 4BQYA 5K8SA 2WINB 1QJY3 3SEPA 4HANA 4RYDA 1ZBE1 1ULCA 3SKJE 3E6CC 3QH7A 1EUTA 2W47A 2BOJA 2RS11 2P5BA 3OJBA 3B94A 4I3GA 4LHLA 4XPVA 5LRSA 3KHCA 3GBGA 2NM1A 3SCFA 1J3PA 2HWC2 3ALQA 4LBQA 4NROA 4CP2A 1L7LA 2XXZA 5DXDA 5FWJA 2F4PA 1KFUL 4BCUA 1L3JA 1FAYA 3E5QA 5KWRA 3H42B 1LECA 5IK4A 2JG9C 2WNVC 4LBJA 4IXLA 2VBPA 5LA2A 2QJVA 4DZGA 2QUOA 4YZ4A 5I0SA 1MS8A 1CONA 2PN5A 3I3EA 2QQWA 3H7JA 4R9AA 3AKQA 1AJOA 4G3YC 1NA1A 4OZXA 4CPBA 1DGWA 5JXIA 1SPPA 1UD1A 2ARBA 5E88A 5FZMA 3S6PA 1QJU3 4N53B 1REDA 1ZZCA 2Y0OA 3WW3A 1UYXA 4CDWA 4PDWC 2B8MA 1DGRN 1Z0HA 1RUI1 5IYYA 1OI6A 5FXXA 3WG1A 4Q4W3 4S2FA 2RM21 2PYTA 3NO8A 3UETA 3WP4A 1SG3A 4FAHA 4LORA 4XF9A 4CDQC 2W95A 2RE9A 4N43C 2GSYA 5BXXA 1JZ6A 2ZEYA 4UFLA 2YG0A 2UYBA 1LENA 3ZFEA 2CGNA 4HK8A 2E33A 4GWJA 1W9WA 1UKRA 4MSVA 3B93A 3JU9A 4H2AA 5FFOC 3OY8B 3T0BA 3OB8A 4R9BA 2YC2A 4Y26A 4DS0A 5CNAA 4I0AA 4QHZA 5FP9A 4B1MA 3IDBB 2YXSA 1PGL2 3ZYFA 4WM7C 3RGBA 2TNFA 3ACFA 3S57A 4FPGA 1US3A 3MF9A 3POIA 5D8AA 1BXHA 1SZBA 4M3CE 4MGTA 2WRAA 2C6SA 4L99A 5FOJB 3IDAA 2ZGSA 4MV2A 1RUE2 1UMIA 2LRPA 3PVBB 3WR0A 3E5XA 4TXWA 1H1AA 3NJVA 1CN1A 1OLME 1OQEA 1LEMA 1QJFA 1W9YA 4KNCA 1W8UA 1ZRDA 4L97A 2HH9A 2V5YA 4AQTA 4RHV1 3WHTA 2QQOA 4DY5A 4AR2A 1ZRIA 1AL23 2DBNA 3CDZB 1DYOA 1VBB2 2E63A 5GLVA 3S7EA 2A6VA 1ALYA 1R082 4AVVA 3VLBB 5IUQA 2FHRA 3WLUA 3IBMA 2Q8DA 1VBA1 2R062 1DGLA 1CIWA 1U5XA 2VMGA 4HVOA 1S0IA 1O3RA 4I0BA 2ZHLA 5C4WA 3M1HA 3LCPA 4COVA 4EQVA 2GH8A 5IATA 1QHDA 4DUWA 1AR92 4ZY9A 5CADA 1F4AA 1J83A 3CJIA 1GQHA 1PX3A 4EZ4A 1OQDA 2HWC3 1UX6A 4QPGB 4U2AA 2VTFA 3MW4A 3FUQA 4NAMA 2QKDA 1ZRCA 2JDUA 3AXEA 3FFZA 3Q8EA 4AEDB 2VAUA 1XB9A 1NCRC 4FT8A 3W59A 4B4RA 3AFGA 3NVCA 4XXPA 4LBOA 4AI8A 4COZA 1Q8OA 2SLIA 1D4M1 3HR9A 4LK6A 5FZAA 4XMIA 1ENQA 4Q4V2 4PQQA 4BQWA 1NKGA 1WBLA 3AYDA 3MYXA 1UIKA 4P08A 5GKAC 3RDIA 3ZSMA 1CAUA 1WW6A 3CKHA 4AFCA 2XPJA 3WSOA 3U37A 1HRV1 1W6MA 4QXBA 4ARXA 1XOYA 1H2KA 1SBFA 3VKMA 3D4KA 5F3CA 4LMFA 1CAVB 1H6YA 4LPLA 5C7GA 3I2IA 5FUIA 1YO8A 4ZKTB 4SBVA 2VZVA 5EFUA 3B3QE 3PNAA 2XDVA 1PX4A 1BVP1 5FXVA 4EJRA 2BP6A 1K5JA 3PU3A 1JZ3A 5FYHA 4AQ2A 4CDXA 3AKSA 5GLTA 4NRPA 2YYOA 1IG0A 1NAEA 3TRSB 1O4ZA 4DINB 4Q5OA 1BZWA 2UU8A 3ZSEA 3SH5A 2VVEA 4UF0A 4LQRA 3T4VA 5JLVA 1LAJA 3JUUA 4E2GA 4OULA 3F95A 4QX7A 2R0FA 3DYOA 2F6BA 1N1VA 1W3XA 2WZR3 1RUJ3 1DZRA 5FK7A 5A3OA 2VZRA 3VBRA 4TTGA 1CAXB 4B8EA 2D3RA 2CDOA 5B4XA 5A7OA 1WCSA 4QAWA 3WF1A 4CTEA 1X9TA 2XLFA 1O3TA 2JD4A 1CESA 1JODA 1ND3A 2CAUA 2YGLA 1SBDA 1AZDA 1RUE3 2WR9A 4GB31 5H9QA 5DMYA 3M8LA 3PUAA 5LBFA 1XE7A 3SH4A 1COV2 3N9OA 3CEWA 4ASMB 1YWKA 2ET1A 5T5LA 1EV13 1DQ0A 4NRMA 2OZ6A 3BPSA 4FPLA 1JZ5A 1PGW1 3IN9A 3O1VA 4GA9A 5CKMA 2VMHA 4DMIA 4EN8B 2VXRA 2J1EA 2DBIA 1R083 5CFCB 2ZGOA 2G4IA 2RMU3 1X33A 1OH4A 1IPKA 1EY2A 1F31A 2AC1A 3JD73 4HOOA 5F39A 2R063 2W5FA 2ARAA 1VBD2 2ZKLA 4QU2A 2J1TA 1H9PA 3R6SA 3C7FA 3BTYA 5KXDA 3HEIA 2QVSB 3O1TA 5JAXA 1T2XA 3HPNA 3FBYA 1OOPB 2VVFA 2HBTA 1AR93 2GC0A 2WNUA 5FZ9A 4E4HA 3VZJA 1KJLA 4UW3A 5FJKA 4I2OA 3HNYM 3WT3A 4H14A 1LGNA 3VD9A 2Q1FA 3DUIA 4C0HA 2YZ4A 4CEWA 1XC6A 2CDPA 3E5UA 2WDBA 4XZPA 4YNIA 2FQPA 1MQTC 3WG3A 2RDQA 1SLAA 4PCRA 3ACLA 2IWGB 2JDMA 1H4HA 4D6RA 1RUD2 1M4WA 4M00A 5H9PA 1DCSA 4MHUA 1HKDA 5DAXA 2PTMA 1ULPA 5FLJA 3SLIA 2JE9A 5ISLA 1OLRA 1WMEA 2QE3A 4LO8A 1ZBA2 4AXOA 4JGZA 3KMHA 2BVBA 3ZXAC 3T3YA 4MGIE 4Q4V3 1PO21 3NL1A 4QXCA 2VQTA 4JGYB 2UWCA 4Y4RA 4D6SA 3JBG1 2OX0A 1K3IA 4Q29A 3U07A 4AEKA 2DURA 1YQ6A 1QDOA 4GH4B 2Y6JA 3KV6A 5DG1A 5C8WA 2D5HA 4QX3A 3MUY1 1C8M2 2OT7A 3B69A 3OBRA 3ASIA 5LW9A 4FFHA 3PDQA 1CX4A 1DU3D 1QQP2 1SLCA 4QXHA 4DY3A 3T2TA 4Y1XA 4IEPA 3ZFGA 5FYTA 1HRI2 2ZPXA 1RUG2 2VNGA 4IERA 5FWEA 1W2TA 3NMBA 1W8NA 1J58A 1QJEA 3WDTA 1WLDA 2AGSA 1GYKA 4P00B 3BPZA 4AYUA 3SNMA 2B5HA 5ABJB 2R1BA 4QKFA 4XFGA 3LF7A 4YVWB 2Y60A 2GC1A 5IJRA 1J3RA 2W1WA 5GLWA 1UOBA 2ADEA 3MDPA 2J42A 4C90A 1S0EA 1TEIA 2GDFA 4OUEA 1UN1A 2CHHA 5L73A 1GQGA 5E89A 1ASJ1 3OGGA 2LTNA 3RZLA 4E4SA 3N7MA 4N7UA 1POQA 2W91A 5J3UA 1GWMA 3OUIA 5HXVA 3OEAA 4UYBA 1ZZ7A 4CUCA 4OI2A 2MNGA 5LA0A 1AXYA 2PHFA 2W2IA 1RVF2 3T2OA 1JZ7A 3RZJA 1DHKB 1MZEA 3BALA 3O1OA 4N8MA 1E5RA 5DUXA 1NLQA 3KT4A 2AENA 3KCYA 1COV3 1IPSA 2WABA 4YM2A 3NKTA 1XE8A 5IVCA 1DGRA 2D93A 4WVMB 1ULFA 3UJQA 4A6SA 3TEYA 2JJ6A 3UK9A 2WA3A 2BJSA 3VDCA 1QH6A 2NYYA 4KG8A 3MZHA 1NCQC 5FZIA 3THTA 2ET7A 4AVAA 2JG9A 2WNVA 2VQ0A 3PLQA 1F35A 2XJPA 4HK9A 3BVCA 4R9CA 5LA9A 5J48A 5JIUA 3O12A 4YW6A 2P3KA 2VZSA 4V2VA 1EPZA 2ZXQA 1C3HA 2VE1A 4NIIA 2XQXA 1RL3A 3OBAA 4YSFA 1W9TA 1W9SA 2WNOA 1NA1C 3HNMA 3KCCA 4QT6A 5DUWA 5ERLA 1N3OA 4IQPA 3T4HB 3VBSB 4DUVA 2A3WA 5FY4A 1R1A1 3ZMNA 4PDWA 1RHI3 4YW7A 1APNA 2O8QA 2XBO2 1N3PA 1ZNPA 1W8TA 2PA7A 2XJVA 4CRQA 4OI4A 2OUJA 3FJSA 3SC7X 5FPXA 2R041 3HN3A 1T6GC 3ZMOA 1RB8G 1W6OA 1H4GA 4N43A 4KU7A 1OH3A 1RUD3 3NAPA 5JXJA 3ZFEC 4PBOA 3TOJA 5LA1A 2C9AA 1AR62 2HEWF 4W4ZA 2ZMNA 4WVWA 3I97A 3WD5A 1TMF2 2BOIA 4CP1A 5IVJA 2C5DA 4CP9B 2VUAA 1FV3A 3VDDC 5CEHA 2Y8KA 4QPIA 4CUBA 4CU8A 2HWB2 1LOFC 3ZYJB 1G9FA 2RVAA 3RYRA 1RUH2 3FE5A 1CJDA 4IV1A 2GC3A 1O8PA 2R30A 5C33A 1I6XA 2LW8A 3GCWA 3VBHC 2VG9A 2QDRA 5D8AC 3IZOA 3BUCA 2W3JA 3EHKA 4AEJA 3NV4A 4HSJA 1O5LA 4AQ6A 1C8M3 2HEYF 1YI9A 4UFMA 4OZOA 5B2GB 4CA9A 4XUPA 2JECA 4AW7A 1B35A 1QQP3 1WWYA 2D3PA 2WN3A 4QB6A 1NY71 1HB3A 1W06A 2VECA 2WBKA 3F2ZA 3L9JT 3I8TA 4BYYA 4CDUC 1SQ4A 1RUG3 4DXRA 1I3HA 2D3SA 2Z79A 2HWE1 4BA6A 3ECQA 5BNQA 1IPJA 3RJ2X 5C8CC 2BRTA 2VCAA 3VD5A 3SEEA 5FP7A 4BPZA 1R1ZA 1GP5A 4ISQA 1LOEA 4BIFA 3P5BA 2JDYA 4OQ9A 3SHRA 3ACHA 4OQ8A 1FPN2 3TWIA 2DDUA 2D44A 1OF4A 1DQ4A 2BYVE 5JWPA 1ST8A 1XJAA 2AACA 5D1IA 1N47A 1ZX5A 1PHMA 1QY4A 1RJ8A 3GBFA 4FCAA 4Q26A 3SISA 1JYNA 2IXCA 4G9SB 1PNGA 1DBNA 2OZJA 3I3MA 3M3QA 4XCBA 3MW2A 3Q8FA 1RXFA 1GP6A 3M3CA 1RMU3 3I7DA 4FP2A 4RFRB 4ZPIA 2BU9A 3V64A 5C3QA 4EN7B 3OPTA 4R4XA 5FZEA 1ND2A 5JXGA 1K5MB 3DEMA 1UF2C 3FZ3A 3U4SA 4ONUA 1H8VA 1VMFA 2HYXA 1UY1A 1XNDA 3R4SA 2YU2A 4R4ZA 4WM8B 2PQQA 4M3CA 2VUCA 2W46A 2Y0IA 3KWVA 3VBFB 2XJTA 3DPRC 1O8SA 4YGEA 1NCRA 3ZFFB 4E9KA 3AKRA 1BQPA 4L92A 2WWSA 2YROA 1AYN2 1P8JA 1J1LA 2IFWA 4LKSA 2MPFA 4LO7A 2W68A 3OYWA 2DF7A 4BWOA 3OUJA 1OLMA 4OHVA 4IEUA 4CEYC 1O59A 4CU6A 1HQNA 5E8AA 1LHOA 1TME2 5FZKA 1PIV1 5A7WB 3U78A 5F37A 2P6CA 4RR3B 1RXGA 3GNEA 1JH5A 2JE7A 1YQ5A 2HLEA 3BN6A 4KH9A 1FOD3 2WIIB 3ETPA 3J8F1 1OFSA 3LB9A 1PK6B 4BM8A 1OD5A 1RUC2 2LS6A 2VZ3A 5F5AA 1A3KA 4Q0UA 4LUMA 2IVJA 5LB6A 2XBO3 1F2NA 1CPMA 1RUE1 3VHOA 2G9ZA 1YNAA 2P3YA 2ID4A 1RUF2 1WCKA 5GM0A 4ATEA 4ARYA 5LEKA 1UO9A 4AVTA 3LAGA 2GP3A 1GV9A 5C5TA 4AOCA 2B42B 1GLHA 4PF5A 1OKQA 5FPBA 2ZGMA 1U12A 3B02A 3K4ZA 3WCRA 3JB8A 1LR5A 4Y22B 1AR63 2YFZA 1ODMA 4YGDA 3TNQA 2P1BA 1GZTA 1BBT2 1VBB1 1MPXA 2D6PA 2PMWB 1SLBA 3W5MA 4D7TA 2BWAA 4GKYA 4QDSA 4JHTA 4W8JA 3PJQA 2B39A 2HWB3 2OA2A 3B9CA 3FC0A 5DQ0A 5H9RA 5HPOA 3Q8AA 3NNGA 1RUH3 5DG2A 5A3PA 4Z92B 1H1MA 1MS3A 3UGFA 4QQLA 2VY0A 1PO12 3VBRC 4LULA 1AR71 4FPOB 1QJY2 1RITA 2E7AA 3OCPA 2VBBA 4QHBA 4DXZA 4Z2WA 3FN9A 2ZBJA 1YEWA 4IW3A 4PLOA 2RS51 2ZS6B 1LB2A 4AFAA 1PGL1 1CZSA 5FYYA 1VBC3 1ND3C 2BGOA 1LOCA 3D5OA 1NT0A 2OYZA 4CDQB 1H9WA 4DEQA 5F5IA 1VBE2 4LA2A 4HKLA 4P9XA 3ZXFA 2DVFA 5K0UA 4HBNA 4RGKA 1GNHA 4GD4A 4IEVA 3PUSA 4ES9A 2RR11 2EXKA 4WVVA 4ZU5A 1D0HA 3BGAA 5A33B 3QACA 2WLPA 4LBMA 3U4XA 1AYM3 1VB4A 2VCBA 4LLOA 4LEJA 1QOOA 2DCTA 1AL0G 3OBZA 3MI8A 1W6PB 3PUQA 4XOGA 4A3XA 1R64A 1FPN3 2Z2SB 4XHXA 1AXKA 3Q8CA 1FMD1 4BZ4A 2VXJA 1S55A 5BNPB 2VCCA 5HV4A 3KB5A 3BTXA 1UU6A 3KT1A 3LPFA 4WM7B 1Y4WA 3K3NA 2QZ2A 2PHDA 2R16A 4HVRA 1W0PA 1KS5A 3K3OA 4OI0A 2A70A 3K4AA 3M3OA 3GGLA 2W39A 1QXRA 1Y7BA 3C7GA 3KGZA 1ZM1A 4COWA 1OPOA 4XFIA 3UYJA 5CFDA 4XW3A 2A6YA 5A3LA 1X36A 4L11A 3USUB 3HOBA 4CEWC 1E5IA 1JU3A 4EROA 3OSDA 5DAVA 1MQTA
chains in the Genus database with same CATH topology
4QGNA 4AVSA 1MS1A 4SLIA 2H6BA 4FO9A 1AVBA 4N90A 4OUSA 4OFGA 4R9DA 1V9U1 1AYN3 1VR3A 3BODA 2R072 4JGZC 2GNDA 3KZ4C 1RJ7A 1WMFA 5BNNC 3LOBA 4QMAA 3AP5A 1TME3 1H8TA 1J1TA 4Y1VA 5JZGC 5C9AC 5SV8A 3I59B 4E4ZA 1RUC3 3H1YA 2ZGRA 3IPVB 1AR82 2EIGA 4FOQA 1WLCA 4XJ9A 1GNZA 2XGXA 3ZFGC 4FTEA 4IEOA 4RS5B 1UAIA 1QGLA 1COV1 4XFAA 2ZGQA 1O4TA 5KXBA 4Q0VA 1WD4A 4NWVA 3N4MA 1Q8SA 3VKFC 5HCFA 2B9UA 1CPNA 4XBNA 1AL22 1BBT3 1QU0A 4D69A 2FZ1A 3VBUB 2WS92 3KT7A 5IT6A 1V6IA 4Z1VA 3ILFA 3QLQA 5J98B 3H1MA 4LLFA 3QOPA 3P3NA 1VBD1 2BWCA 1X82A 2XVGA 3KM5A 1WBFA 1VAMA 2V09A 4R52A 2DUPA 1C5HA 2OIIA 1EAH2 5F9TA 1V6KA 1NYWA 4ORFA 4YLZA 4NPRA 4OUMA 4B4PA 2RJLA 4FQZA 1FV2A 2IXKA 3ZX7A 1NQDA 1VBE3 2I45A 1DQ5A 3A0KA 5F5QA 1R092 3ZYIB 5BNOC 1Z7S2 4MGKE 3RSJA 2CY6A 4P9GA 3MIDA 4MLOA 2EF6A 1NCQA 4FPCA 4M3CF 3MW3A 5JOWA 1SCSA 2X5IA 1N1SA 1ZBA1 4QQ2A 1G86A 4QGMA 3B00A 4E2SA 1W6NB 5IK5A 3AP9A 4NWWA 2DCKA 3KD4A 4EN6B 5IK7A 4HVQA 3ES4A 1XNBA 1Y9QA 2E51A 2K2SA 2X8KA 4Q4X1 3THPA 3AX4A 2EVXA 5L7OC 4XBLA 2VPVA 4XMAA 3H9AA 3WDYA 4J1XA 2B7YA 2CYFA 3SCHA 1G9CA 1POV1 2ETEA 2XJRA 1SLLA 1FNZA 4K21A 1HRI1 2NP0A 2YGMA 3RQ0A 3C2UA 5CA6A 3IDEA 3NAPC 3V0BB 2YPJA 3AB0A 1C4RA 1HV0A 1BK1A 3RYKA 1O5UA 1F9KA 5KC5A 5J37A 1MZ5A 1XNCA 2R073 3VDDA 3U10A 4QPIC 3MLKA 4KGQA 1C1LA 1LOFA 3I2DA 4C1WA 2WZR2 4IEYA 4IV1C 4BIOA 1RUJ2 4KG0A 3TN91 5KBFA 5FQ0A 1X8MA 3VBHA 4YYOA 5FO7B 1G9DA 3AYEA 4F3JA 2WT1A 2EALA 3UKTA 1AR83 1RVF1 1QOSA 3APBA 3W9AA 1B35C 1W39A 1GFF2 1Q5OA 1DIWA 3VBOB 4CDUA 3HT2A 1VRH3 1VJ2A 2VUJA 4KWLA 5AC93 1EV12 5FO8B 1FT9A 4Y4YA 3PVNA 5C8CA 4YVSA 1PZ7A 2D97A 1IGOA 4LBKA 3S0MA 2BPA2 5A32B 1Q8VA 3B5LB 1WCDJ 2WS93 4FXKB 3EQEA 5DDJ2 2RMU2 2P3JA 3JD72 3ZIXA 5FMOL 2YY1A 1SLTA 4YM0A 3KSCA 3MPPG 3OGJA 3V0AB 5FAXA 2ERFA 3HIFA 2A7AA 3RI8A 1MS5A 4FPHA 1EAH3 3GF6A 4AVBA 2R0HA 4FQ4A 2JX9A 3MFAA 4PLNA 3D6EA 2GMEA 1V00A 2ZAAA 3NSTA 2XJSA 4MUVA 1ND2C 3SCGA 1GSLA 1D0GA 4XETA 1HQLA 4RQPA 1V6LA 1POV0 1R093 4BA6A 1UKGA 3A0NA 4LHKA 4R8HA 4YZ3A 1LOGA 5GALA 5L19A 4PJYA 1Z7S3 1QOTA 3AMNA 2K9ZA 3DPRA 2ZAHA 1AR61 4J1WA 2DFCA 5FRAA 1TMF1 2XLAA 1AJKA 5E1RA 4CEYA 2WJSA 1LOAA 2IZWA 4LBNA 1G9AA 2BBVA 4GXLA 3TNPB 1BEV3 3SH3A 2XG3A 3QBQA 1RUH1 1GZWB 1QNYA 3LWCA 2Q1ZB 3USSA 1C1FA 5KXCA 4QM9A 1O3QA 2ZX0A 1AX1A 4GMP1 5LK5A 1Z78A 2PHUA 4P9WA 1AXZA 1WW5A 2D40A 5DUUA 4EWEA 1OPMA 3B9IA 4LBQB 3WVJA 1C5IA 5FO9B 4AWDA 4Q0QA 1LRHA 1AHSA 4I30A 1A8MA 4P9JA 2D6OX 2ZHKA 3ZDSA 3ZYRA 4YM3A 5K9YA 1XYOA 4HT1T 2BW8A 1FPN1 2XVKA 3AZWA 4K8FA 4NN0A 4Y5Z0 1MEC3 5CBLA 1NA1B 1O7FA 2WFPA 3VGIA 1SFNA 4YW1A 1FI2A 1TE1B 3POWA 2QNKA 2DVGA 4Q0PA 1QJX3 4CDWB 3UL2A 1JN2P 3LOIA 2A3XA 2OPKA 4J6GA 3JQWA 2DCJA 3VV1A 2I2SA 2WSVA 4HPKB 1WUVA 4INDA 1QF3A 3CF6E 5K0UC 4YFWA 2JICA 3ZFEB 3VHPA 1LHWA 2ARXA 4MH0E 3MIFA 3RPQA 2XHKA 3CU7A 3RWNA 4N53C 3WG4A 2UURA 1XQNA 5DDJ3 1BMV2 1OQ1A 1KD7A 4FBFA 1VAVA 1H2MA 2QZ3A 3D0SA 1RUC1 2RS33 2DV9A 1KXGA 2IXHA 1RHI2 4Q1PA 5BUVA 4Q1RA 1ZYBA 4GMP0 2MEV1 1QDCA 1UPSA 2OUHA 5CFDC 2A6WA 3VN4A 1RUF1 4XF3A 4KWJA 3P3PA 4NO4A 4OHYA 4XXAA 1PVC2 3S30A 3POYA 3RI9A 4Y20A 4QQOA 1XXNA 5LEJA 5CG8A 4Q4Y3 1SMVA 1ENRA 2ZA9A 5JVVA 4RFT0 3M2MA 2W08A 4IV3A 2A5ZA 5BNNA 4EWAA 2GMPA 3PTYA 3AM2A 2RS12 4F7ZA 1ZZ8A 2PHTA 1LHVA 4GWMA 1M06G 1H8TC 5C4WB 5HI0A 5JZGA 5C9AA 1LHNA 3KLSA 1PO11 3GZTB 3R4DB 5A3MA 5I8TA 1IS6A 1QJY1 3FUOA 1LU1A 2JDZA 3BU7A 4FPEA 1I5ZA 3H3UA 1A78A 3CJIB 1GKBA 4XBQA 5F6LB 3O7OA 1PGSA 1BJQA 3N35A 1PVXA 3H0OA 3HQXA 5J36A 5TSWA 1IOAA 3AYCA 3H8UA 2QDNA 2YC0A 2VH9A 4FXGB 1C28A 2VMIA 2ZHMA 1G7YA 5T5PA 1U0AA 4XQWA 4BMEA 3VUOA 3T1MA 1JUIA 1XYPA 4XILA 3FHIB 2YDEA 4IEQA 1RUI2 1CAUB 4XTPA 3ME2A 2PHRA 2PLV2 2K0GA 2I74A 4JDMA 2RM22 1K5MA 1W6MB 3WCSA 3R05A 2ZX2A 4AF9A 2Q0AA 2VOXA 4QPGC 1QJU1 4ATFA 4YW3A 1DQ2A 4XFBA 2O0OA 1CVNA 1RMU2 2QFEA 2VVDA 4QXKA 1CAWA 1DYKA 1LGCA 2ZX3A 3IM0A 4AEDC 1ZZ6A 4Q4W1 2GN7A 1S0FA 5JI9A 2FZ2A 1S0BA 5C6CA 2EAKA 2H0BA 2KM2A 3ZXEA 4CDXB 5BNOA 5FPZA 3WDWA 4LUKA 2VW2A 2HYKA 1ULGA 2AREA 5L36A 3IT8A 2X5IC 1VP6A 1VIWB 2EXIA 1PZ9A 4AI2A 1YLLA 3NWKA 1LU2A 2QCSB 4NOTA 3VBRB 3CJXA 4NHLA 1NXD1 3WW4A 2HWD3 1FOD2 5L7OA 3O0VA 2WQ4A 2PFWA 2Q8OA 1H2NA 2HEVF 2NZ9A 1AR81 1ND3B 5CVRA 3MICA 3B7MA 1JXNA 4B7EA 4RHV2 1WGPA 5FBZA 5AVAA 5FDBA 1PVC3 4K20A 5GJ6A 4IESA 2Q30A 4HETA 1VBA2 3BIWE 3O0WA 2DTYA 4JRLA 3E97A 1AL21 3LGRA 1HIXA 2CNAA 1GZCA 4QQPA 1ZBE3 4A7YA 2RS13 3VKNA 2PELA 1JTZX 4FOYA 2Z42A 2ZOEB 4CP0A 1V6JA 1QMJA 5AFBA 2WNUB 3JB4C 2FBEA 4Q2FA 1VBC2 1DQ6A 3O14A 1QJZA 2HWC1 1D4M2 5KHHA 3MIHA 4EWDA 4ISRA 5K7PA 1IS3A 3A4UA 1MR5A 1S0CA 5FREA 4ITCA 1MZFA 1Z7S1 4ES8A 5CFCC 2WL1A 4X8PA 5FMOS 5AFEA 4YVSC 1AYM2 4BMBA 4JGZB 4OHXA 1HW5A 2ZKNA 4COYA 4AFDA 3NV2A 5JSRA 4O9GA 2R32A 1OA2A 1OOPC 1RUI3 1BVVA 2XUMA 3E6DA 1UZYA 1GZ9A 2PLV3 5T5JA 2RM23 3ZN6A 4JDOA 5H9SA 3W58A 1XRUA 3FLPA 3UKNA 3WQ0A 3B01A 1QXJA 3RMYA 3ETQA 2PAKA 4RQPC 2AR6A 1KDMA 3AYAA 4XFHA 2P17A 4P9IA 3NV3A 1YUDA 2WSUA 3NV1A 4JGYC 4JRAA 2KXLA 2P3IA 1G9BA 4FTSA 4LHNA 2D6MA 5GZDA 1RINA 1SACA 2JXAA 4YM1A 5T50A 4PIYA 2YUEA 3WNXA 4GH4C 4PIZA 2Z5WA 3MIBA 2JG8A 3AZVA 4META 2WZR1 1RUJ1 4YW2A 4JTOA 4YGCA 1CGPA 2UY8A 2H6CA 2TBVA 2JKBA 3OTFA 1V6OA 2IXJA 1VB2A 1BKZA 1IKPA 3IKWA 1PGW2 4K1ZA 3N7KA 4RHV3 1MS4A 2WFF2 4Z07A 2CTVA 5ABJC 4MXWA 4LO5B 3JCIA 1W6QA 2GN3A 1REFA 3WDVA 2QQPA 1EV11 4YVWC 1DZQA 1VBA3 4XJWA 4Q8KA 2A71A 2JG9B 2WNVB 4K6BA 4S2DA 1MVQA 2BGCA 1VAKA 1XYNA 1R081 4DQAA 1TNRA 4UXAA 2RMU1 3JD71 4AG4A 2R061 3WX5A 1Q8QA 3RG0A 1ONAA 3ZN4A 2GALA 4FPFA 1LJ7A 4RD7A 4E27A 4WV8A 4PDWB 1BCXA 1UL9A 2D5FA 3URFA 1AR91 4XFCA 5T54A 4FAGA 3WHUA 2IC1A 4YFZA 4OVEA 1D4M3 4NVPA 3SMHA 4LE4A 1W6OB 4N43B 4BH9A 2WT2A 5CU1A 2NMNA 3NAPB 1PO22 4GALA 4XJAA 1W6NA 4K7JA 3RJRA 4ZU4A 2XJUA 3JQXA 2D98A 5GZGA 1OA3A 1KJRA 4YZ5A 2OVUA 2CV6A 4QPYA 1V70A 1HRV3 3G7DA 3AZZA 3VBSC 2XL9A 4N53A 4AHWA 2A75A 4Q4V1 2EXJA 3AP6A 4IV1B 4XF4A 4D7SA 1X7NA 3AXDA 1OSGA 2GH2A 1ZRRA 1WMDA 2H0VA 4LR4A 4TZDA 3PVEA 3HAGA 4EN9B 1B35B 5I8SA 3DV8A 4FPJA 2WKKA 2N7GA 3ILRA 1REEA 4A7KA 3D0JA 2YMZA 3OY8A 4EN0A 5CAZA 5ACA2 1KRIA 2ZMLA 4MYEA 1PM7A 5I93A 2B46X 1AUYA 3LA7A 4IV3C 4XQ4A 1XU1A 3OD4A 3MIEA 1KITA 4AHXA 4I0WB 2EA7A 2ENRA 3N7JA 2NQYA 1ND2B 1DLLA 1F8VA 4Q8LA 3PHMA 4BHPA 2BVVA 2WFF3 2DWRA 5KHGA 3VZMA 2XJQA 2E53A 2G9FA 4Q27A 1D4VB 2ZX1A 3ZXJA 2R49A 1VRH2 4M3CB 5AC92 4K1YA 1S2KA 1NCRB 1MZ6A 4DB5A 1KS4A 4I02A 4EV0A 3WP6A 4H3WA 3OYWB 5F6KA 1IS5A 1EPWA 1R1A2 1ENSA 1EYBA 4XYXA 1BMV1 3ENRA 4M0NA 3MIGA 3ZVXA 3RYPA 2WA4A 1K5MC 5EJ3A 4QPGA 1I9RA 1G8WA 1OFNA 3HWJA 2UYAA 1RHI1 3FLTA 3GHMA 4Y1UA 2DU0A 4YGBA 4WM8C 5I0TA 4QQHA 1F5FA 3AMPA 4AEDA 3WQ1A 5JPNB 1HLCA 2PHLA 2DCZA 1FX5A 4AVCA 4C0BA 1PVC1 4LTAA 1RC6A 5JOYA 1PO23 5EXOA 2VOKA 2ZGLA 1RUD1 2W52A 3AZXA 2ZZQA 3JBG3 3N7LA 3M3EA 4UW6A 4DOUA 1XU2A 2GAUA 2Z69A 2BFUS 4RR3C 3N3HA 1JBCA 1NG0A 3G6JB 5CG9A 5DZEA 2W0XA 3WG2A 1PK6C 3ES1A 1QNWA 2HWF2 1CAVA 1BEV2 1QH7A 3AKTA 5EWSA 4BQ1A 3INAA 1DDLA 1NY72 5AVPA 5T5OA 1FNYA 1Q8PA 2P2KA 2DVBA 3CNAA 1Q43A 1ULEA 2B45X 1Y3TA 2HWE2 3U0ZA 1C8M1 3EO6A 2VNOA 3VHRA 4AGRA 3H3ZA 1TQ5A 1UZZA 2YV8A 1QQP1 3QH6A 2GNTA 4N9IA 4X8NA 3FLRA 1LGBA 3VZKA 5I0UA 5K0UB 1HDKA 1NZCA 3CL1A 4YG6A 1RUG1 4YW5A 3LZZA 4COUA 5ACA3 1JHNA 4QM8A 5JSOA 2E6VA 4AFMA 1ASJ3 4LO4B 3AZYA 1LESA 1HQWA 3V56A 1CAXA 2LUWA 1FYUA 2ZGTA 2BNNA 3PMEA 2ATFA 2BQPA 2ZGNA 5JOXA 1AX0A 1MEC2 2IXLA 3AJZA 2PLV1 4XIKA 3GHNA 3LSEA 3M7AA 5J09A 1J3QA 4YARA 4TLFA 4D7YA 4XQDA 4AEMA 1QJX2 4HPKA 4P9YA 2DTWA 4AE2A 1IS4A 1RMU1 5CFDB 3IWZA 3GZAA 4K40A 2D6LX 3WZ1A 4Y24A 4HKWA 2XVLA 4WZFA 2ZMKA 1MQTB 3QD6A 2AZ5A 2G9GA 1NQJA 4MXVA 5CFCA 1PIV2 5BNPC 3ILNA 4P5HA 3J8F2 1S0JA 1R1A3 3RMXA 1UMZA 3ZSKA 1H8TB 1OOPA 4JDNA 1YIFA 1MVEA 1OLQA 4XIOA 4AI1A 4UBGA 1LKNA 3HMYA 2NPIA 1HXS2 1FOD1 1LEDA 1YYNA 2WLQA 2R043 1NXMA 4IEWA 3RNSA 3ZSJA 2XLGA 3KGLA 1I1EA 2RS32 5EYYA 3TB0A 4IETA 4LO6B 3ZXKA 4C91A 2CWSA 3WW2A 4C1XA 3M4FA 2XBO1 1JW6A 4PBPA 4LNVA 5FTTC 1ZVFA 4OLLA 3ZPYA 3MFCA 5F1RA 5I8YA 3AJYA 4PIXA 1YFUA 4Q4Y2 4JGYA 1RTVA 4V1PA 4TWTA 3TAYA 4NHMA 5BY5A 3POSA 4JCKA 1AR72 1DZTA 2NN8A 3JZVA 5I91A 3WQ7A 4OI1A 1YRZA 4GH4A 3LA2A 2RS52 2HWF3 5EYXA 1DG6A 2HWB1 2JG8C 5T52A 5KXEA 2XKOA 1PGL2 3M70A 1VALA 4IEZA 4H55A 2DUQA 4RS5C 1IHMA 2HWE3 4HMZA 4FPKA 2RR12 1VBC1 3WP3A 5BV6A 2ZGKA 5ABJA 4N7IA 1X50A 2HJIA 2P37A 3EJKA 3VBUC 1FMD2 2PHXA 4YVWA 2BNMA 1GICA 1NCQB 3AMHA 5BYNA 2VULA 1YXWA 2X5IB 2EXHA 3BB6A 3UV9A 1AYM1 2R6QA 2ZJCA 2ILMA 4YW4A 4WBBA 3ZYGA 4Q0SA 2CL2A 3NKGA 3FFQA 2OW4A 2WNEA 4MGZE 5JSPA 3LA3A 4H7LA 3DKWA 4WVMA 3RZZA 3FMGA 3S7IA 2XH6A 2BNOA 5FCCA 2R1DA 2D43A 4OHWA 3HBZA 4U36A 4ASLA 1V9U2 3RS6A 3H1WA 3WDUA 3IDCB 4QX5A 4S2HA 3TYJA 1EP0A 1PIV3 4I09A 3R4UA 3EXUA 4HN0A 2A6XA 2TUNA 1AYN1 3J8F3 3VDDB 2GC2A 3VBSA 3ZYPA 2RJKA 5GZEA 2XWBB 5JMCA 1YCIA 4UW5A 4Z82A 1TME1 4CZSA 4W65A 1HXS3 5FQ0B 1RIRA 2PHWA 3VBHB 4AGVA 2HWD2 1YFWA 5D8AB 3WW1A 2XKPA 2YHJA 3GALA 5BPXA 2VOWA 3Q9OA 1QXPA 1YFXA 3I54A 2RHPA 1KDKA 2MHFA 4URTA 2WFF1 4CDUB 1VBB3 4XJZA 4BLJA 3ZXLA 2ZZJA 1BYHA 1SCRA 4WZCA 1SEFA 5DZGA 5HBAA 1YHFA 1NOVA 5C8CB 4FP3A 4YVSB 4F83A 1JUHA 2KA3A 3WUDA 3M3IA 5HCBA 1AR73 1BBT1 5KHKA 3O5SA 5GZCA 1PMIA 3AK0A 1ZZ9A 1JYCA 1NLRA 1ZBE2 2RS53 1FATA 1VLNA 4I3PA 2ZHNA 2GNBA 5JCTA 2WQZC 4JAAA 1IQAA 4AHZA 4P14A 4XE9A 3VBOC 4XHBA 3HD8B 2UWBA 3AKPA 3PJYA 3GYDA 2RR13 4XDQA 4X6RB 1TNFA 3WY6A 3X29B 2VW1A 3OPZA 4RQPB 4E2QA 3VKLA 1VBE1 3EBRA 3ZN5A 2BEOA 1FMD3 3DPRB 4L9BA 4W6WA 1WLWA 1DYPA 1U5YA 1HV1A 4JVAA 4D3WA 1IZ3A 4Q4X2 1NE6A 1W2UA 1FXZA 4CEYB 3SXWA 2UY9A 3VZLA 4B4QA 3DGTA 3WOGA 4CYDA 2SBAA 1V6NA 1DGWX 1CQ9A 3CLPA 4HSLA 4MX3A 3T1LA 4QD2A 3N36A 1SFYA 4BE3A 4WM8A 4ZXKA 3VBFA 3ZFFA 2LALA 4XF1A 3MEPA 4HN1A 4H7MA 2ZABA 3ZIWA 1V9U3 3UKVA 4M01A 2VNRA 2DYCA 3BCWA 3K48A 2CWMA 5ACA1 4GKXA 5E16A 4DPNA 4GULA 4YG0A 3ZO0B 2PAMA 3DN7A 5FLIA 3V65A 4RR3A 5JR7B 1GANA 3TN92 2JEMA 2R071 5HCAA 1PK6A 5FLHA 3HT1A 3KQRA 1HX6A 1ZZBA 2WC2A 4I01A 1ZA4A 2O1QA 2BFUL 3BTAA 3KCXA 4XTMA 3WP5A 2A3YA 3AMQA 3DF0A 3FBMA 3MPBA 5JDBA 2ES3A 4Y22A 1KFXL 5EV7A 5JOZA 1UCXA 4S2GA 1VRH1 5AC91 2XB6C 1LULA 3AMMA 5GZFA 1VBD3 4XJ8A 1H0BA 5DUVA 4D94A 1Q3EA 1AX2A 1MS0A 4DRVA 2C0ZA 1J59A 2WS91 3GBWA 3ZXGA 4CDWC 3KS7A 5I0RA 1H1IA 5GLZA 2IFRA 1NE4A 4AI0A 2IXIA 2D6KA 1S2BA 4M0HA 1YI7A 2ZX4A 4CDQA 1EAH1 4HFSA 3TBDA 1LTEA 2D7FA 5GLUA 2ZCWA 1V6MA 4AGGA 5J96B 4O9EA 3VL9A 1MACA 3RRDA 3DL3A 3VL8A 2BTVC 3K51A 4FOWA 5A33A 4CEWB 1OHFA 1ZBA3 3LKJA 1R091 4LT5A 3VZNA 1U5IA 4JTNA 4Y20B 1WD3A 1W6PA 3C3VA 4IL7A 3IMNA 4YRDA 5BNPA 2ZGPA 5CB7A 1URXA 1GR3A 4Q4X3 4WM7A 1RUOA 4HZFA 1HRV2 1UU5A 3I4IA 4IV3B 4B3NA 2WZPP 5BNNB 1OA4A 4LBLA 2DVAA 4B7KA 2HWF1 1BEV1 4TSVA 2GMMA 5JZGB 5C9AB 2ZTNA 1LCLA 2AUYA 2DFBA 1POV3 3BOWA 1ZREA 1HRI3 3D8CA 2Q5TA 3USUA 1A8DA 3PVOA 1GBGA 2NMOA 3WDXA 1A6CA 4XFFA 4X6QB 2CGPA 1B09A 2X53S 3ZFGB 2E9QA 4DNYA 2PAEA 3MLLA 3ST7A 4KWKA 3J4UH 2VU9A 2AH2A 2CGOA 2TEPA 2X29A 5T55A 1MS9A 3TN93 5C4WC 1AF9A 3I59A 4NHKA 4GIQA 4JV4A 2XL7A 3IPVA 5SV5A 4BLIA 3OBTA 1UPIA 1RVF3 1MEC1 4GB32 3CJIC 2XWJB 2Q4SA 1OMIA 3J26N 1S0GA 4AQSA 1QJX1 1LOBA 4RS5A 4DRRA 1UW8A 4GQ7A 4RGAA 3VZOA 1CAWB 3NW4A 3L2YA 1IKQA 1O91A 3AP4A 4LE3A 1CD3G 2A6ZA 4KQ7A 4N9HA 1N1TA 3MLJA 5BNOB 4KGGA 2Y38A 3VBUA 1WW7A 2GNMA 4BOWA 1XNKA 4JC1A 1RGSA 2FMYA 3ELNA 4KL1A 4PQ9A 3WV6A 5FOBB 5DDJ1 1N1YA 2MEV2 1HXS1 4TYSA 4W6YA 1PZ8A 2V73A 5L7OB 3BOPA 3H50A 4Y1ZA 4XJUA 3ATGA 2CAVA 1D2QA 2P34A 2Q1MA 3VKOA 2RS31 1U5ZA 4CDXC 5LK7B 5IK8A 2O8OA 2E7QA 4MGYE 3L2HA 4HL0A 3WUCA 2Y26A 1SDWA 1TMF3 1Q56A 2A73B 4OHZA 4P9LA 1H30A 2GZWA 5CIRA 3D82A 1ENXA 3UJOA 4HLTA 4Q4Y1 3JBG2 4LA3A 2DUOA 4FTBA 1ZRFA 3MF6A 1WLTA 3ROUA 4QPIB 3NJZA 4RSUA 4F8AA 5T3NA 1Y43B 4GMP3 4YZ2A 1QWRA 2NLRA 4Y1YA 2ZGUA 4MVTA 4A7ZA 4ZU7A 4AK3A 1LHUA 4DFSA 1YJLA 2D6NA 4KU8A 3H7YA 4NR1A 4XF0A 4PLMA 5JIAA 3V0BA 2VOVA 4QGLA 1WW4A 2DCYA 4A2UA 3FWEA 2LM3A 4KBBA 4K3UA 5JI7A 3QCWA 3J9SA 3SITA 3U11A 1YJKA 5KHIA 1ULDA 2E7TA 2I07B 1C8NA 1CR7A 3WXPA 1G6NA 1UIJA 3AP7A 4YG3A 1ASJ2 1CJPA 4RA0A 1SBEA 1QJU2 4FPYA 2VQAA 1YIPA 1WA4A 2WNUC 2WT0A 3WINE 4AHYA 3GZUC 3ZN6B 3OD0A 3IIAA 3O0XA 4FOVA 4GB33 4Q4W2 1RUNA 1PNFA 4FSJA 3VBOA 4Z8BA 2ZACA 2AYHA 3HN1A 4L8QA 1H2LA 1SLIA 2HKXA 1W0OA 5J7MA 2DVDA 4MZUA 3AFKA 4XEZA 4JQRA 4WVZA 5A32A 3FX3A 4B29A 1LODA 5JPMB 5LRRA 3ZSLA 4FVVA 1DFQA 1QKQA 2GU9A 2BUKA 3MGUA 3V0AA 2VGDA 4K9SA 1DQ1A 4IEXA 1C57A 2JENA 4HKOA 2JG8B 4W6XA 2C1FA 2EAAA 4G4FA 2FMDA 4LBQD 1X8EA 1NLSA 4UW4A 2MEV3 3E6BA 1S1AA 5KC6A 1RUF3 2HWD1 5DZFA 1O3SA 1JOJA 2UWAA 1F5JA 2R042 2VW0A 3R0RA 4UBHA 1YFYA 1E57A 4AFBA 4RL7A 1JYIA 1KQRA 3PMSA 1N3QA 1S0DA 3VBFC 3ZFFC 4GWNA 4MXWB 4AI3A 1W6QB 4L2NA 1O4YA 3CO2A 3OF1A 3ZXDA 1D2SA 3LSDA 4E4DX 4YZ1A 4RGGA 3VHNA 1UU4A 1GZWA 1PO13 5EZWA 1DF0A 2DU1A 5K8SA 2WINB 1QJY3 4HANA 1ZBE1 1ULCA 3E6CC 3QH7A 2RS11 3OJBA 3B94A 4I3GA 4LHLA 4XPVA 5LRSA 3GBGA 2NM1A 3SCFA 1J3PA 2HWC2 3ALQA 4LBQA 4CP2A 5DXDA 2F4PA 1KFUL 4BCUA 1L3JA 1FAYA 3E5QA 5KWRA 1LECA 5IK4A 2JG9C 2WNVC 4LBJA 4IXLA 2QJVA 4DZGA 2QUOA 4YZ4A 5I0SA 1MS8A 1CONA 2PN5A 3H7JA 4R9AA 3AKQA 1AJOA 4G3YC 1NA1A 4OZXA 1DGWA 1UD1A 2ARBA 5E88A 3S6PA 1QJU3 4N53B 1REDA 1ZZCA 2Y0OA 3WW3A 4CDWA 4PDWC 2B8MA 1DGRN 1Z0HA 1RUI1 1OI6A 3WG1A 4Q4W3 4S2FA 2RM21 2PYTA 3NO8A 3WP4A 4FAHA 4XF9A 4CDQC 2RE9A 4N43C 2GSYA 5BXXA 2UYBA 1LENA 3ZFEA 2CGNA 4HK8A 1UKRA 4MSVA 3B93A 3JU9A 5FFOC 3OY8B 4R9BA 4Y26A 4DS0A 5CNAA 4I0AA 3IDBB 2YXSA 4WM7C 2TNFA 4FPGA 3MF9A 5D8AA 1BXHA 4M3CE 4L99A 5FOJB 2ZGSA 4MV2A 1RUE2 3PVBB 3WR0A 3E5XA 1H1AA 1CN1A 1OQEA 1LEMA 4KNCA 1ZRDA 4L97A 2V5YA 4AQTA 4RHV1 3WHTA 4DY5A 1AL23 1VBB2 2E63A 5GLVA 3S7EA 2A6VA 1ALYA 1R082 4AVVA 3VLBB 5IUQA 2FHRA 3WLUA 3IBMA 1VBA1 2R062 1DGLA 1CIWA 1U5XA 2VMGA 4HVOA 1S0IA 1O3RA 4I0BA 2ZHLA 5C4WA 3M1HA 3LCPA 4COVA 2GH8A 1QHDA 1AR92 5CADA 3CJIA 1GQHA </