3QH7A

2.5 a resolution structure of se-met labeled ct296 from chlamydia trachomatis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
141
Chain Sequence
SRMRAVLHLEHKRYFQNHGHILFEGLAPVSDCKQLEAELKLFLKRWRENVHRTLPGVQMIVKRVRLDHLAAELTHRSRVALVRDLWVQKQEEILFDDCDCSVLLCLSGEKAGWGLFFSGEYPQDVFDWGAGDTAIILRFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords CT296
publication title Ab initio structural modeling of and experimental validation for Chlamydia trachomatis protein CT296 reveal structural similarity to Fe(II) 2-oxoglutarate-dependent enzymes.
pubmed doi rcsb
source organism Chlamydia trachomatis
total genus 37
structure length 141
sequence length 152
ec nomenclature
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16802 DUF5070 Domain of unknown function (DUF5070)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1590 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qh7A00
3QH7A 3QH6A
chains in the Genus database with same CATH superfamily
3HNBM 1VIWB 3LB9A 1GQHA 5B2GB 2LTNA 3UGFA 1OLQA 2Y6KA 2OT7A 2P3KA 3CZJA 2PHWA 1ND2C 3M8LA 4JHTA 1XNBA 2XHNA 4FP3A 4H14A 4OYUA 5CFDA 5I0RA 1UKGA 3H7JA 2BOJA 3FHIB 3GALA 5KHIA 3FHQA 2KA3A 1RGSA 2O0OA 4DMIA 4LE3A 3VBHA 4JQRA 4MO3M 3AZZA 4M0HA 4IL7A 3RNSA 4M4RA 1AX1A 2EXKA 3R6SA 2RM23 3U10A 3JD72 1F5JA 1WCSA 1QWRA 2RDSA 5BNOB 1R083 1AXZA 5F7UA 4QGMA 2WQ4A 4MX3A 4BLJA 2VCAA 3VDDC 5GLTA 3UESA 4AG4A 1LHVA 5IK8A 2ADEA 1D4M3 3KV4A 1EUUA 2W94A 1W28A 1RUC2 1UYPA 4BH9A 4AR2A 1J84A 3H9AA 4CDQC 5HCAA 3CQOA 3AKPA 5DDJ2 3RI9A 3HN3A 4IQPA 2XBO3 4O65A 4WVWA 4XBNA 3JXSA 5J36A 4O61A 1S0EA 3OUHA 1AYM1 1O5LA 5FZ7A 1F5FA 3ZDVA 1QJEA 4IV1C 4NHLA 4QGNA 1WW5A 3LD8A 4TTGA 3VBSB 1WWYA 4NOTA 3VDBA 3I2JA 1WUVA 4QDSA 5FPBA 2W39A 4ES9A 4ZU4A 2E63A 4C90A 4UFMA 2BRTA 4WM8A 3Q8BA 4IEOA 2D3SA 2X10A 5BYNA 4E2QA 1UPIA 3M3EA 3UKVA 3MHZA 4UOJA 5FO9B 2VBPA 3CIHA 4R9AA 3C8XA 2ZGQA 1H8VA 3B94A 2IFRA 4BQWA 5BNOA 2R1BA 4V2VA 3SH3A 1H6XA 4ZKTB 2PQQA 1TME3 4MH0E 3WNOA 5HCHA 2E32A 3K4DA 1RUJ3 2NPIA 3B69A 4MYEA 3ZFFB 4YZ5A 5GALA 1AL23 1BEV2 1DGWX 1MZ5A 5FPAA 4FFHA 1UOJA 1HQLA 1PO21 2GNBA 3QCWA 4K7JA 2E31A 3VBUB 4CEYB 2A3XA 4Q4W2 5CFCC 5F37A 5FZAA 5L7OA 3B01A 2WFF2 5GLVA 2GN7A 1X82A 4TZDA 1K5JA 1VBC2 5F5IA 2ZGUA 5GZEA 4HBNA 5EP9A 1WLDA 3USSA 4Q8KA 2QCSB 1RUE1 1RUF3 1QY4A 1SMVA 1QHDA 3OD0A 2GMPA 2JICA 1OA3A 2Q4SA 1J1LA 1NZCA 2UY9A 2I07B 1ZZ9A 1NXMA 4A7KA 2WWUA 4UW5A 1W04A 5EIYB 2EALA 3ZSEA 5C3SA 4YGCA 5F5QA 1AYN3 3WHTA 1QXPA 3OGGA 3FE5A 3LDBA 4UFJA 4JGYB 5F3GA 2EXIA 2DCTA 5DUVA 1XB9A 1ENXA 1E5HA 1RUI1 3B9IA 4Y1XA 2W08A 5FZ0A 5IHRA 4CEYA 4XFAA 1RVF2 4YW6A 2VNOA 3DGTA 2ZX2A 3I2DA 1GP5A 2C26A 5HV4A 2X8KA 2QVSB 1UZWA 1Y3TA 3BN6A 4YLZA 3O1TA 1JYCA 2A6YA 1URXA 4PI0A 1DLCA 4AGGA 4IE5A 5T5LA 2Q30A 4IE6A 3B9CA 4A44A 4UF0B 1RL3A 2E26A 3GYDA 2YZ4A 3INAA 4YG3A 4CA9A 1O3RA 4OHYA 3N7JA 1IG0A 2EXHA 5AC91 1QDCA 4KMQA 1PM7A 2VOTA 3IN9A 2YMZA 3I3BA 1Q43A 4M4PA 4N7IA 4BQ3A 3TNPB 1BYHA 1REDA 1VBB2 1QNYA 3JD73 1LECA 4XUTA 5G04L 3RWNA 3THDA 3S5AA 1L7LA 1KITA 1SCSA 3C7GA 1RUG2 4AVCA 2WSVA 2EAAA 1V6NA 4E4SA 4JGYA 3IWZA 4NIIA 3WW4A 1X8EA 4AOCA 1BBT1 3USUB 4JDNA 4XEZA 5FZ6A 1PX3A 1OOPB 2E7TA 1RUC3 3TEYA 4MOAA 5F8PA 3I49A 3AM2A 5DDJ3 1K42A 1JXNA 3GNEA 2V73A 2A75A 5FMCA 4BQ2A 1EP0A 3N35A 5D2AA 4B7EA 2BVVA 4DEVA 5AFBA 3DCQA 2JJ6A 1JYNA 1W03A 3E5XA 3JB4C 4OHVA 4RN5A 4UFKA 2ZHKA 4XTPA 3UT0A 4AGRA 2RR12 4HMZA 5EJ1B 5FYHA 4H55A 5BNQA 3HQXA 2VQ0A 5DAQA 1IHMA 2DV9A 1IOAA 2AUYA 4MGZE 3V0AA 4FTEA 1W9FA 2WQZC 5DUWA 3IAQA 1NE6A 1R1ZA 3WQ7A 4AHYA 2BNOA 2WZ8A 2C9AA 5BNNB 1ND3B 2PHDA 4A7ZA 1UZVA 1A3KA 2L9LA 3MV11 1BEV3 1A8DA 3USUA 2AYHA 5JXGA 1VE0A 4OULA 2FCTA 4QX3A 4M01A 1CAXB 1LU2A 2A6XA 2QTWB 5FLIA 5FZGA 4KGGA 3SXWA 2DFCA 2PHXA 3BOPA 4AAPA 4Q4W3 5DMYA 1XU2A 3B93A 2WFF3 4Z2AA 5C3PA 2GMMA 3JB8A 3JBG2 3NJXA 2CV6A 1O3TA 1VBC3 3GZEA 4AEDC 2HLEA 3JUUA 4XZUG 3LWCA 1WZXA 2OPWA 3O1UA 1J59A 1XNKA 3FHAA 3RQ0A 2XWBB 3KGLA 4IW3A 2BGCA 3NL1A 3VZNA 4ASMB 2VAUA 2WNOA 1W0OA 1PGW2 3LPFA 2QDNA 3PVEA 1W8OA 4HANA 5FZ3A 4XF0A 3MIFA 5F6LB 4CU9A 4E4DX 3NAPB 1RJ8A 1DLLA 1M4WA 1XNDA 4MLOA 4PQ9A 5FCCA 3H1MA 2YU2A 2AR6A 3HWJA 2BTVC 2DWRA 4IXLA 3UGHA 2VULA 3CU7A 4FPJA 3O7OA 1ND3A 1CAWB 3BTAA 3IDEA 2JB8A 2VC9A 1OPMA 5LBEA 3VD3A 1HRV2 4XVHA 1CAXA 3S5QA 3N4MA 2A3WA 1PHMA 2BU9A 1RVF3 1WCQA 2V5DA 3VDCA 4CVUA 1OD3A 3Q8AA 4QDQA 1LOBA 1UY1A 2XR4A 1ONAA 4QGLA 1UX6A 2TEPA 2DVBA 4KU8A 3EBRA 2ARCA 2A1XA 1DGRN 2BUKA 5T5JA 4KU7A 1V6MA 1Y7BA 4YW4A 4O7XA 4ARXA 4OLLA 2V72A 4WM7A 3UYJA 4BQ1A 1Q56A 4FT8A 5A3NA 4LEJA 1PM4A 3M1HA 1VBB3 4CCJA 2NZ9A 2WNUB 3FBMA 1FPN1 2VXJA 3DXUA 3UGGA 3NAPA 4CZSA 1RUG3 4A41A 1LOAA 1UQXA 2FHRA 2WNVC 5D8AC 1FYUA 1CAWA 4S2FA 5FZLA 1UXXX 2AC1A 1EY2A 1HQNA 3I2FA 1EPWA 4HPKA 4XTMA 5FOBB 1PMIA 4NVPA 1ASJ2 3RZZA 5FP4A 3SISA 2VMGA 3KM5A 4AW7A 1UL9A 1NT0A 2JWPA 2RS32 1COV2 1PGL2 3KWVA 4XUQA 3CLPA 2WL1A 3SEPA 4QX1A 5T5PA 3HR9A 2AEZA 2VR4A 2XH6A 3THTA 1KEXA 3LGRA 2RR13 1KRIA 1V9U2 2DVFA 2X29A 4FO9A 1EAH1 1PMJX 3OEBA 3R4SA 1OVPA 2QJVA 4XC9A 2D6LX 2BQPA 1IZ3A 1HXS2 4HKOA 5FYIA 4MUVA 2WNUA 1UU4A 2VW1A 1N1VA 3BGAA 3PVNA 3WZ1A 1F31A 3RI8A 5FYTA 4HT1T 4ZZ5A 5A6XA 4QKNA 1WA6X 3CJIB 4QPIB 4CSWA 1AR91 2LROA 3TNQA 5JMOA 4YZ2A 3KVBA 4M0NA 2OKXA 4LO7A 4FPFA 5F9TA 1B35B 4I3PA 5C8CB 3ETPA 2YPJA 1CR7A 4HVOA 3ZMOA 1RUH2 2ADDA 4RFT0 4Y20B 3TRSB 2JXAA 4NIGA 3TOJA 3SCHA 4DUVA 2G9ZA 3HVDA 3JBG3 4GH4C 4SLIA 4W8JA 1XU1A 4HVQA 1F4AA 4BK5A 1DIWA 3I3EA 1DYPA 1HQWA 1W05A 5LW9A 4MXWA 5T3NA 3I59A 2C6SA 4AVVA 3B02A 5CKQA 1K45A 4PI2A 3BPZA 2YU1A 4YZ3A 2EIGA 3IIAA 2MPFA 3CJIA 4JHZA 4I3GA 4QPIA 4RQPB 3VKFC 1B09A 3ZM8A 4A45A 1ODNA 1TQ5A 5FTTC 4EZHA 4GWJA 1Z78A 4NAOA 1B35A 1LJ7A 2VVDA 4PDWC 5FUNA 5C3OA 4I09A 5BNPB 5C8CA 1HRV3 2XPJA 1APNA 2UWCA 3IB3A 4LLFA 5LWBA 2H6BA 3L9JT 3AZYA 3M4FA 2OXBA 4HK8A 5A80A 2P4EA 2TUNA 3GHMA 2JDMA 4IV3B 4JKMA 1VB4A 5LA9A 3I2IA 1PVXA 3SMHA 1US2A 5APAA 1UZZA 5LK5A 3ZLIA 2YGLA 4ZONA 5LY1A 2QQKA 4MG2A 3WF3A 5JMCA 1POV3 4JRLA 2QQVA 3LEGA 4XUPA 1QNWA 4CXYA 1C8M1 4J1WA 3VHOA 3MYXA 4Q29A 4N90A 2BNMA 4RS5B 1KGYA 2A7AA 2PN5A 3DKQA 1QJFA 3KHCA 4HONA 1S2EA 4UFIA 5JIUA 1WBLA 2ARXA 3MFCA 1ULGA 5B4NA 5BXXA 1XQNA 4LA3A 3VB9A 1LAJA 5LBBA 3A4UA 4BM8A 1G7YA 2VUDA 2IC1A 1ASJ3 3JZVA 2ILMA 5FYZA 1NG0A 3KVAA 4DS0A 4IV3A 2RS33 1H2MA 1COV3 4KWKA 3MF6A 3N7MA 1UPSA 2Q8CA 2ZGMA 4HKWA 5FYVA 2NMOA 1XBFA 1QJY1 1V9U3 2MEV2 3FJSA 3OGRA 4DY5A 3O1MA 1XPWA 2DFBA 4RR3B 3AP9A 3WCRA 4WVVA 1HXS3 1ZBA1 2VW2A 5FY1A 4RS5A 3AYEA 2DCKA 1X9TA 5KXDA 4AFCA 5FZ9A 1OMIA 2LUWA 3WNPA 4P00B 1YNAA 1Y9QA 4XJZA 2YFZA 3LQCA 2DURA 1S0IA 2JE8A 2RS51 3MUZ1 4MGKE 1XRUA 1R091 4META 1HW5A 4NPLA 4XMAA 2EIEA 2VG9A 5A7SA 1OHFA 3K3OA 4MGIE 2R071 2PMWB 2XKPA 4BE3A 4CEWB 2VVEA 1PZ9A 4OHWA 1RXGA 3AYDA 3OUIA 2JDUA 2PLV2 3OBRA 3NV1A 3PHMA 1UAIA 2DBNA 3ZKUA 1S0JA 4YZ4A 2ZACA 1VRH1 5E6HA 3WQ1A 3MI8A 5FMOS 3OPTA 3OY8B 2RG4A 3C2UA 2ZHNA 2EIBA 3WNXA 2J1UA 4HVRA 4XIOA 1NY72 2X5IB 1NOVA 2WT0A 4COUA 2YGMA 4CCMA 4XUNA 1TVGA 4UFLA 5JSRA 3A7QA 4YM2A 3WINE 1D0GA 4Y5Z0 4CRQA 1ZBE2 4DRVA 2DUQA 3I8TA 4CPBA 3HN1A 3L2YA 1GYKA 1FT9A 3NMBA 4CEWA 3PVOA 2QQMA 1UU6A 1DFQA 2ZS6B 4CCKA 4BLIA 3DV8A 2VZVA 5HXVA 1C3HA 1NAEA 1H1AA 2IWGB 1JYVA 1AF9A 2ZEXA 3NJYA 2ZHLA 3N36A 4EN7B 2F17A 3R0RA 3NV4A 1XE8A 3KCXA 1IPSA 1WW4A 2VCCA 1S4CA 4FCAA 1RIRA 2GALA 2RDNA 4OUMA 5FPUA 5FZKA 4ZS2A 1CZVA 1WCDJ 2WN2A 3HT1A 4FXGB 1IPKA 2JIJA 1UW8A 2ZGTA 3NSTA 1TNRA 2DVGA 2X5IA 2VE1A 1IS5A 3RSJA 5LB6A 2PHTA 4OI2A 2VZ3A 2RHPA 1WMFA 1ULEA 4YYOA 5IK7A 4KWLA 1HN1A 1OKQA 3I7DA 4F7ZA 3TBDA 5JZGC 1IS6A 3TN91 4BXSV 3VBHC 2D5HA 3FUQA 5FZDA 4LHNA 2BFUS 2WUHA 4Y24A 4P9GA 1SLBA 1YCIA 1T6BX 2WC2A 3E5QA 5JR7B 3MPPG 5T5OA 4CU8A 1VBE2 2W52A 4A3ZA 4AFBA 1FATA 4COZA 3WNMA 3B7MA 3AVRA 1VJ2A 1VAVA 2WWSA 3GBGA 2MEV3 5GJ6A 4LOSA 1GZ9A 3SC7X 1XC6A 4INDA 4OUEA 4W50A 4NROA 2ES3A 2IVIB 4YSFA 5K0UB 2DYCA 1C5HA 4IUGA 1MS8A 2WA3A 2VH9A 4WVMA 1BJQA 1JHNA 1XJAA 3DN7A 4QPGA 3T4HB 2C1FA 1SFNA 4LBOA 1MS5A 5FP9A 1SCRA 5K7PA 1VBD1 5C4WB 4AFAA 5I0SA 1UY0A 2FDFA 1POQA 3RS6A 1Z7S2 2DCYA 1C5IA 3D4KA 4XABA 1QOOA 1WD3A 2GAUA 2WAOA 1OUSA 3M3QA 5T55A 1JOBA 1AJOA 4B29A 4CDUC 1V6KA 1KQRA 1Y9MA 4Q0VA 4WM8C 4AWDA 4RA0A 3AJYA 4N9HA 2ZGKA 1H8TB 1J3QA 2PLV3 3HD8B 3RWKX 1JN2P 1GICA 2WIIB 2D44A 5C71A 4AEMA 1EV12 2VM9A 2DVAA 3OB8A 3PL0A 1V00A 5FJHA 3K2OA 3RJ2X 3J8F2 1I5PA 4OHZA 5EJ3A 4RL7A 5K0UA 1CX4A 3KCYA 5JIAA 3WG4A 2YBSA 1ULCA 4LR4A 5ACA1 4OZXA 3M3OA 1W2AX 2QBXA 3N9OA 5C4WA 1SBEA 4PBPA 3WW1A 4F83A 3V0BB 5LRSA 4DRRA 3ACHA 3GDBA 1GQGA 1ZBE3 1ZZ6A 4V2WA 5DG1A 5F3EA 4CCOA 3O14A 3EHKA 4ZZ8A 4XQ4A 4XE9A 2RS12 3WQ0A 3DUIA 3ZXLA 2P3JA 4KWJA 2JG9C 2Q8DA 4ZU7A 5K8SA 3A0NA 3NQHA 4QPYA 5IAVA 5A3WA 3WDTA 1W8WA 3OPZA 4WBBA 3ZOIA 4FFIA 1IS4A 3DKWA 4Q4V2 4P9LA 3PUSA 4B4RA 2KXLA 5ABJC 4UI9L 1HKDA 5IFTA 4Z1VA 2XBO2 3MW4A 2X53S 5LY2A 1JS9A 3HQUA 3J9SA 4GB31 3O1OA 3OGVA 1BHGA 1W6OB 2VZQA 3M3CA 3AYAA 4U2AA 3AKQA 4XJWA 3LDKA 3PTYA 3O1PA 2GNTA 5FQ0B 3MW3A 1NQJA 3K48A 2B7YA 2JG8B 3NKTA 4LOTA 4LBMA 3UJQA 5EQUA 5IW0A 5EV7A 5EZWA 5IVCA 3TWIA 5IVFA 3QOPA 2I2SA 3UJOA 4DQAA 3FL7A 3LSEA 1LHNA 3O0WA 1LOEA 5GKAC 3PLQA 3ZYJB 1ZRFA 1DBNA 1G9AA 3P1IA 3EO6A 4WZFA 2HYKA 1VBE3 3ZFGC 1DGRA 1DGWA 1NCRB 2HWE2 1JU3A 1SDDB 1BMV2 4GWNA 4LBLA 2WJSA 4PBOA 4YVSC 3SITA 4C1WA 4Y22B 3J4UH 4K20A 3S0MA 5GLWA 1XE7A 2ZTNA 1XXNA 3ZKYA 1MEC2 2R30A 2R32A 4Q0SA 1Y9GA 4NHMA 3D3AA 3WF2A 2Y60A 3KF5A 4XZPA 4IDZA 2JG8A 1DQ4A 2ZGRA 1SFYA 2Q1ZB 1Z7S3 1HV1A 4FVVA 1J1TA 3WX5A 1YFYA 4Y4YA 5DAVA 5DUUA 4DOUA 1LHOA 3OD4A 5A1LA 3LE0A 1GFF2 4W4ZA 5GZCA 4DB5A 5FY7A 4ZS3A 3VBRB 1CONA 1UYZA 3KT1A 4QM8A 3IAPA 3O12A 3RZMA 3AP5A 4C1XA 1GOGA 1K5MA 5JR2A 4J1XA 1CGPA 1NCRA 2W1UA 2Y0IA 3UETA 2J1RA 3VBOB 4D0QA 1EV13 4BQ4A 1DQ5A 1VBA2 2GP5A 1UWWA 2ETEA 3J8F3 2UU8A 2DUPA 1LODA 2ZX0A 4LE4A 4QMAA 3OF1A 2DCZA 4YM0A 2HBUA 4BK4A 1XNAA 1W9SA 3I3DA 1NX9A 3VZKA 3POSA 4BXFA 2FBEA 1QXRA 3T30A 2ARBA 3LZZA 2QQNA 3ZN6B 4N43B 4UXAA 3J7NA 4IERA 5FDBA 1CQ9A 2RS13 3AFKA 4C8DA 5A3MA 1J83A 2N7GA 4M3CB 2QZ3A 3WEZA 3LAGA 2W92A 3VBRA 5A32B 4IEQA 2DF7A 1DYKA 1SFPA 4Q4V3 2WS91 2A73B 1O8PA 4I0BA 1K3IA 4XFGA 4XOGA 3VBOA 2VZOA 2FZ2A 5JSOA 3JQXA 4DEQA 1G6NA 2EAKA 2IXIA 2ID4A 2ZZJA 3ETQA 1CX1A 5FUPA 1GP4A 4IE4A 2VUJA 5LBFA 5J96B 1O5UA 4MGYE 1H1IA 2CGOA 2QQIA 1RJ7A 3KLSA 3IMNA 5F2WA 2P1BA 1FNYA 2OIIA 3S6PA 4LLOA 3ZN6A 2CSGA 4UYBA 4N43A 1PZ8A 1W3VA 2VUCA 3ZIXA 4BB3A 4A4AA 4NWWA 1AYM2 1DG6A 2B4KA 2P6HA 4WM7C 3ILRA 4N53C 4P9IA 2DBIA 4X8PA 2J1AA 1GBGA 4B4PA 2OA2A 2KD7A 5A32A 4P02B 3EQEA 1DQ2A 3AMNA 3GZUC 5F6KA 2HWE3 5L7OB 2CAUA 3E6BA 2R041 4P9JA 1DYOA 3ZX7A 3PMSA 2E53A 1LU1A 3MF9A 1QJZA 2Z5WA 1EPZA 2D6OX 3POBA 4AXOA 1GNYA 5FP7A 1VMHA 3AMHA 4H7MA 1KFXL 3H0OA 1Q3EA 4WVZA 1IS3A 1EUTA 3VBSA 3VHPA 5IYYA 1MEC3 4CDXC 3BU0A 1KJLA 5L36A 1GP6A 4FI9A 1JZ8A 2XLAA 2DU0A 3V56A 1PO22 4NO4A 5A1AA 3AB0A 1YQ6A 4BDVB 2YG0A 5JCTA 3ZFEC 5LA2A 3ENRA 3POWA 2PAMA 4CCCA 2VNVA 3MDPA 3NKGA 3KV9A 3OJBA 4K3UA 3ROUA 1LHUA 3VZMA 3ZFFA 1UD1A 1GZCA 4Q4X1 5I0TA 1LESA 2VTFA 1NCQB 1AZDA 2W68A 3ACLA 5BPXA 5CYYA 1RUE2 2WN3A 4KGQA 4XFBA 5I8TA 2ZCWA 2BGOA 2AZ5A 2EA7A 2OW4A 3DYPA 1WLTA 1BK0A 4U36A 1H4HA 2BWAA 3KV6A 4W6WA 3T08A 5CAZA 3W5MA 4MVTA 3VUOA 1ZX5A 1VBA3 4TXWA 4QQLA 1NLRA 2Y38A 4GD4A 2G4IA 2D6NA 2QZ2A 3LEIA 4K1ZA 5A33B 5C8WA 4FOWA 3J7MA 1SEFA 3M2MA 3X29B 1OUXA 4BYYA 1Q5OA 1WA4A 3WQBA 1W3XA 1D2SA 2DU1A 2CDPA 1CAVB 1RUI2 2C5DA 3LPGA 2DDUA 1OSGA 4GALA 1NUKA 5F5CA 1LOFA 3KCCA 1DZRA 1OLMA 3N9PA 3H7YA 1WW6A 4X8NA 2LRPA 1ZRDA 3T2OA 3O0XA 4GJYA 3I97A 4Q2FA 5LA0A 3AC0A 4IEZA 3C7OA 4URTA 2TBVA 3EB7A 5DZGA 1ZA7A 3ZXJA 1GOFA 2OZJA 1NCQA 1XSQA 5I8SA 4AFMA 2CWSA 1YYNA 4TLFA 3S30A 4OHXA 3I3QA 5AC92 3MBWA 2ERFA 2VOXA 2HEWF 3DYMA 2WO7A 1AR61 2WNEA 4AF9A 5C9AC 1MS0A 5IT6A 3CJXA 3FX3A 3GJAA 1YJLA 4TN7A 5IVJA 1JZ5A 3KMHA 2Y33A 1TG7A 2R16A 5SV5A 1E5IA 1CPNA 4UF0A 1W8HA 1UO9A 5A33A 3SCFA 4CU6A 2CGNA 4QM9A 4QU1A 1BBT2 3O5SA 2OPKA 2XHKA 3W20A 3HOBA 2P3YA 3K3NA 4E4ZA 2E7AA 4KBBA 4NUBA 2F4PA 4XFCA 5FMBA 2NMNA 4ZXKA 1UOFA 4OMDA 3KD4A 4IE7A 1HJFA 1STMA 1KS4A 1MVQA 1W2UA 2GC1A 4N9IA 3RRDA 2ZGOA 4AI1A 4Z92B 1JYTA 1AYM3 1ND2B 3WP3A 3ZSKA 4XPVA 5EXOA 2VMFA 5BUVA 3HPNA 1JZ7A 5J7MA 5LRRA 4Z07A 3ZXGA 1W6QB 5CBLA 1GNHA 4D8MA 1LGNA 1JOJA 1CPMA 1GR3A 1WMDA 2GZWA 1OOPA 2J42A 3BPSA 4XW3A 1IG3A 2AREA 5IK5A 4I02A 1TEIA 3OUJA 2QQUA 3D5OA 1JBCA 1L3JA 3SKJE 4XBLA 2YY1A 1ZZ8A 1ZRCA 1I9RA 3E6DA 1MQTC 2FDGA 2C9KA 5FXZA 2W0XA 1PGSA 4XJ9A 4LKDA 3VDDB 2SBAA 1QH7A 1R1A1 2VZ1A 3FWEA 2Z79A 4ZU5A 4NPRA 2E33A 1CJPA 2CHHA 4DINB 3LF7A 4CDQB 3AZXA 3WG1A 1UMZA 2JB4A 2V5YA 5H9PA 1LULA 5CIRA 1KDKA 4DXZA 1PO23 1QGLA 1KD7A 4YRDA 3BOWA 4NRMA 3WNNA 3ZPOA 2XONA 5FXVA 3ZXAC 1ND2A 2WR9A 2YUEA 4IV1B 4L8QA 2VJXA 4YW2A 3GF6A 5FJKA 1LCLA 4BIOA 3WW3A 5BNNA 1NA1C 1WD4A 3WP5A 5FY4A 4LIUA 5FYUA 4Q0UA 1W6QA 2JKBA 2FDHA 3U4SA 1OKOA 3LIGA 3WV6A 1RUE3 1DU3D 2ET7A 3BU7A 3CKHA 4EJRA 4OMCA 1AR81 1MACA 2XXZA 3LEMA 5FXWA 4LK6A 5IJRA 1F15A 5I91A 3T09A 5JXJA 3GBWA 2A6ZA 2J7MA 4NHYA 1I3HA 2DTWA 4NJ4A 5A6ZA 4XETA 4UW6A 2CNAA 2IZWA 2RMU1 3ACFA 4LO6B 3PJYA 4E27A 3VDDA 1O3SA 1KS5A 2B39A 4CP9B 2YBKA 1BLZA 5KHJA 1TNFA 1GUIA 1NLSA 2XMLA 3AKTA 1IKPA 4CDQA 2GH8A 1A8MA 4XMIA 2HWC1 5CFCB 1D4VB 1O59A 1RUI3 2BWCA 2PA7A 5LZ6A 2AH2A 1X8MA 4YNIA 2AACA 4JGZC 2V4VA 4GMP1 3WSOA 4BZ4A 4BPZA 1JUHA 3C3VA 5A6QA 5K9YA 1W0NA 4IV1A 3CHXA 2VW0A 1V70A 1W2NA 4BHPA 3I3MA 4LBQD 2XLFA 4GA9A 2FDIA 4D3WA 1RMU1 4BA6A 4JTNA 4AQTA 5I93A 4PLNA 1QJX1 5KXBA 2QNKA 2YBPA 5JPNB 3A23A 4FTSA 1V0AA 4EV0A 5AC93 3BUCA 2CY6A 3THPA 2OQ7A 4UW4A 2YHJA 5LBCA 4JQTA 3ZR5A 1JYXA 1FPN2 3AKRA 4PIXA 2CAVA 4YFZA 4YZ1A 2JD9A 2GH2A 1SHWB 5JWPA 5IWFA 5FWJA 1ULDA 2HEVF 3FC0A 1DQ6A 1LRHA 2W1SA 1TE1B 1PNFA 1UY4A 1BBT3 2LS6A 2R1DA 4WZCA 4RGAA 4A42A 3DECA 2CL2A 3GZTB 4GXLA 4JDMA 3Q8FA 1PO11 3VKNA 4AHWA 1QKQA 5HI0A 3OBTA 2XB6C 3BB6A 4QQPA 1Q8VA 5CKNA 1KDMA 2OS2A 4NIDA 1VALA 2PHLA 1OF4A 4Q27A 5JI9A 3C7EA 2KM2A 2UWAA 3NJVA 2P6CA 1EAH2 2W46A 3VL9A 2Q1FA 3KV5A 3ECQA 4IGPA 1MZEA 5CKMA 1JU4A 2A71A 1HB1A 1N47A 1X7NA 4I0WB 5LCWL 3BALA 1V6JA 2BPA2 4QX8A 4YGBA 4FPKA 4L11A 5EWSA 4CDWC 2VZTA 1EYBA 4CP2A 1AR92 4D7TA 4V1PA 5KXCA 4B3NA 5JDBA 1W8FA 3AX4A 2B42B 2ZX3A 3MIHA 1QJU1 4IEYA 5FY0A 2P5BA 1UIJA 2Z2SB 5F3CA 5KBFA 3ST7A 3N9LA 3VV1A 1QQP1 2XVGA 3LA2A 5JVVA 5C9AB 4J6GA 1PK6C 5JOXA 2QDRA 4AAXA 1I1EA 1MS3A 4NMIA 1YFWA 4LUMA 4PF5A 2PHUA 4Q4Y1 4XF9A 4Q5OA 4XHBA 1YC61 2H6CA 2NYYA 4JRAA 3H3UA 2A6WA 3FBYA 4ZY9A 2ZMLA 5T52A 3WY6A 2PQSA 1PIV1 2OVUA 1Y4WA 2ZJCA 3QH7A 1YXWA 3ZIWA 2IXCA 4FAGA 4LBKA 5IAXA 2XJQA 4HZFA 4CP0A 3HIFA 1H2LA 2XJUA 4Y20A 4X6QB 5FZ8A 3UV9A 4NRPA 4BCUA 4AZZA 4K6BA 3RGBA 4RHV1 1RUD1 2HWD1 3K75B 3EXUA 3D6EA 2J1SA 2XKOA 3SLIA 2GC0A 4Q0QA 5JPMB 4DUXA 2IVJA 3HNMA 4PT6A 1PVC1 1YUDA 4D7SA 3RZJA 1G9DA 1X50A 2H0VA 5DAWA 4AQSA 1UZYA 4DUWA 2EF6A 5KHGA 2D7FA 3VBUA 1FX5A 1S2KA 2Q8OA 4C0BA 5IFPA 1YI9A 4EYUA 1ZZCA 1W6NB 2E7QA 2JD4A 2HEYF 5JOWA 1IPJA 4COVA 4GAZA 2VUAA 1XYOA 3VHNA 4LJHA 4RQPA 5JXHA 4AEDB 2Y64A 1RTVA 2WDBA 1PZ7A 4EZ4A 5IVEA 3VKLA 1BXHA 3ELNA 4EE2A 1W99A 5BNPA 4Q26A 5FZEA 5KHKA 1GSLA 1REFA 1UIKA 3MICA 1C8M2 4GULA 2XUMA 5FKCA 5GZFA 1C28A 3TEWA 1CJDA 1ZNPA 3U1XA 4CXXA 1FPN3 3PDQA 1SLLA 4UAPA 1SG3A 5CA6A 1O91A 3VBFB 3LEKA 1H4GA 4FXKB 2WAAA 4KI5M 5FZ4A 2IXJA 1YRZA 4ISQA 4XF3A 5FZOB 3WP6A 1I6XA 1MVEA 5LEJA 1QJX3 1F4HA 4GWIA 5FMOL 3MIDA 3ZXEA 1OFNA 2YC0A 3M70A 5FRAA 2EICA 1H0BA 4LITA 1UCXA 1HRI1 2A3YA 4MSVA 1MZFA 1UKRA 2ZGSA 4AEDA 4QXBA 1KXGA 2NLRA 1Q8SA 5FFOC 1OURA 5H9QA 1MS4A 1WMXA 1YI7A 2FZ1A 2ZAHA 2WZR1 2WSUA 1QJY2 2O8OA 1LEDA 2ZA9A 3FN9A 1ULPA 2Y6FA 4LQRA 4CYDA 1FOD1 1EAH3 5IUQA 1CZTA 2VD7A 3BYWA 4P9XA 1HLCA 1RHI1 1ZBA2 3AVSA 1FMD1 1GU3A 1QH6A 4LIVA 4XIKA 3SH5A 4EQVA 1PNGA 2BNNA 2WNVB 5D8AB 4AL9A 5KWRA 1AHSA 2A5ZA 1AR93 4XDQA 1VR3A 1NQDA 2GN3A 3QACA 4FPLA 4LHKA 2RS52 1R092 5FZOA 2WZEA 1H9WA 5IVBA 5A3OA 2ZGLA 2JDYA 1W06A 2ZGNA 3T4VA 3FFQA 3WDXA 4RR3A 2R072 5FXXA 2ZX4A 4O9EA 4YVWC 3ORJA 2FCVA 2W3JA 2V4AA 5C3QA 1POV0 3SHRA 1G86A 4GMP0 4LXLA 4UBGA 1GZWB 4EN9B 5ERLA 1S0BA 1U5XA 2IUWA 3GCXA 3FZ3A 3PIGA 4LO5B 4R9DA 1YLLA 3LA3A 5CADA 3OCPA 1VRH2 4JC1A 2K0GA 2HJIA 1UYXA 2FCUA 3WCSA 4R4ZA 4DO0A 2B45X 4Z8BA 3IKWA 3DPRC 3NNLA 4HN0A 1H9PA 1YQ2A 5LATA 1F8VA 5FY8A 4QT6A 2R061 4LT5A 5HPOA 2BFUL 3IDCB 3ALQA 2WNVA 5D8AA 1FV2A 4AK3A 1HDKA 3MEPA 4YGEA 2QUOA 5FZIA 1PIV3 5LK7B 2FD8A 3OY8A 1K5MC 2ZXQA 4H3WA 4FQZA 1LGCA 3ITQA 5FZMA 3KQ4B 4OUSA 4XCAA 3ZYPA 3ZXDA 5HXMA 1X36A 5FZBA 4PHZA 4K1YA 4OI0A 1GZWA 4GH4B 4BWOA 3C7HA 1CAUB 3D0SA 5G05L 4XXPA 4BMEA 2ZMNA 3T0AA 4W65A 5CFDC 2C4XA 1PVC3 3VD4A 5DN2A 1CESA 3CNAA 3J7HA 5FY5A 4AFDA 4AE2A 1C8M3 2JKXA 4XJ8A 2D40A 3JU9A 3ZXFA 3BIEA 4KWUA 1JW6A 2EXJA 3H8UA 3TYJA 3VBFC 3W21A 1HB3A 5FO7B 5K4LA 4PDWB 1SLIA 1S0CA 2BYVE 1P8JA 2VCBA 3TN92 2HWF1 4QB1A 2BBVA 2YPDA 2GDFA 2R6QA 4C91A 1N3OA 1NXD1 1RINA 2HWB1 4UWDA 4F3JA 5FR3A 3BODA 3E1F1 2HYXA 4GH4A 1ENRA 1ZVFA 4LORA 5SV8A 4MGTA 5DZFA 1O8SA 1Y43B 4P5YA 4XYXA 4A6OA 3AP6A 1AR71 2VU9A 2DTYA 3FFZA 2F6BA 1YFUA 1WLCA 1SQ4A 4K21A 1QJY3 4AHXA 1JZ4A 3KT4A 3U0ZA 4XACA 2ZKLA 1DQ1A 2G19A 3NW4A 3OBZA 2PAEA 1ZBA3 2QQLA 3OGJA 3UL2A 4A7YA 2VPVA 3T2TA 5BNOC 5HBAA 5J48A 3ATGA 2A70A 4E8DA 2E51A 1VBD2 1AVBA 2XVLA 4FOYA 2K9ZA 3ZSLA 1J3RA 2RS53 1R093 2J1EA 1L7QA 4Q0PA 3WXPA 4KNCA 1UX7A 3ZYHA 2JENA 2R073 1HIXA 4B8EA 3RZKA 4FQ4A 2F4LA 3GHNA 4TSVA 4UBHA 1QIQA 3T0BA 3RPQA 1J3PA 2WWJA 4L2NA 1VLNA 5FMDA 3VBSC 5BY5A 3H50A 1VRH3 4RGGA 2PTMA 3KB5A 2Y26A 2B9VA 2RDRA 3ZYIB 1DDLA 1UOGA 1W0PA 4PCRA 5EYXA 5A3LA 2RM21 3ILFA 2QQPA 3THCA 5FO8B 2UYBA 4D6QA 3O1VA 1H8TA 5AFEA 1W8UA 3MW2A 1R081 1G9CA 1GWKA 4XDOA 3AL5A 5ACA2 3D8CA 1YIFA 2VMDA 1D4M1 1JMUB 3ZFFC 1LHWA 1W9WA 4DPNA 3GXUA 3V65A 1YHFA 4CEYC 1OH3A 2YXSA 3VBUC 1MPXA 4EWEA 1GZTA 4KBZA 3U78A 2GMEA 4HETA 4YM1A 2QKDA 4DY3A 2GU9A 1WW7A 1C8NA 3AMQA 2YFUA 3VZOA 2QE3A 1XNCA 4QKBA 4FPOB 3V0BA 2QQWA 4EN8B 5A7NA 4AQ6A 2PAKA 3U37A 1IGOA 2WO2A 4QQ2A 3ME2A 1ZRRA 1NZIA 2FMYA 4GB32 2WA4A 4YGDA 2X05A 2P37A 4Y1YA 3VHRA 4QD2A 5AVAA 4YW3A 3H1WA 4YG6A 1TME1 1WKYA 3EMRA 3V64A 4S2DA 4PIYA 1RUJ1 4D6SA 1A34A 2VMHA 4LKFA 4XQDA 1AL21 4AI0A 2VQTA 4R8HA 4JGYC 3ZXKA 1R64A 1IQDC 1AXYA 5FBZA 4L97A 2WYSA 1WLWA 3MLJA 3WDYA 5E89A 2VL4A 3K77A 3TN93 4YM3A 1U0AA 2VMCA 1W6OA 1TMF1 1QMJA 2I74A 4CCLA 2O14A 3ES1A 2JIGA 4NHKA 5FQ0A 4JCKA 4FFFA 4ARYA 1W8ZA 1XYPA 2OUJA 1UNBA 1HX6A 1ZM1A 1QOTA 2WT1A 1D7PM 5EPAA 4COWA 5J09A 1T6GC 1RUF1 3WNLA 1GMMA 1BVP1 4MADA 2ORXA 4OFGA 2QFEA 4PF1A 3PU8A 5FYCA 5C7GA 4R9BA 3WF4A 3AMPA 5D1IA 1YO8A 4QB6A 3CDZB 1IQAA 1UXZA 1AYN1 2V09A 3HBZA 2HH9A 5I8YA 5EYYA 3OBAA 3BTYA 1VBD3 2C24A 4EWAA 2VVFA 3NRUA 1SZBA 2JDZA 2PHRA 3NV3A 5JZGB 1BZWA 3VBHB 4CUBA 4XDPA 1OOPC 2XJTA 1SLTA 3U4XA 1ULOA 4Y22A 4LMFA 4ASLA 5A7PA 3QD6A 3ZDSA 2SLIA 3DYOA 3HMYA 5DXDA 3KT7A 4UFHA 4DZGA 5CG9A 3SQOA 3GBFA 3RYRA 1DCSA 3N7LA 4BU2A 2Y6HA 5JOZA 1J58A 3RMYA 3RJRA 4IE0A 3ZVXA 3K46A 4FFGA 1WCKA 2TNFA 1H1MA 2XUEA 4MGSA 3ZYGA 2Z42A 3JD71 4I01A 5DQ0A 4MHUA 3E6CC 3DF0A 4YFWA 1VAKA 2KR2A 3R4DB 1S1AA 5ACA3 3M3IA 3PTRB 4DXTA 3S7EA 5E1RA 3KF3A 1LKNA 5BNNC 4MHRA 1UY3A 3K4AA 1ND3C 4RYDA 1GKBA 5JZGA 2R49A 4YW5A 3RFRA 1RUC1 4CDUB 4WM8B 3DXTA 2RDQA 5DDJ1 3WG2A 4BISA 4HOOA 5FK7A 3U14A 5FYBA 4CUAA 5A1FA 5FPXA 5GM0A 3O1SA 1O3QA 3GM8A 2VECA 2IXKA 1C1LA 4K40A 1LNSA 2OX0A 4NIAA 3ZN5A 4FSJA 2XL9A 4JX0A 2WS92 2W91A 2B5HA 1WCUA 2K46A 5FIXA 5HCFA 1YIPA 2LW8A 3HNYM 3LFIA 1BQPA 1QXJA 1OLRA 1UF2C 5FV3A 5J37A 3MUY1 1FNZA 1VB2A 4ET7A 4GB33 4M3CA 4OCTA 2B8MA 4Q1RA 4E2GA 2RJ2A 2AEYA 4YARA 4FP2A 5CNAA 3NAPC 4AYUA 3POFA 2Y0OA 2P2KA 3BVCA 5FZFA 1BEV1 4KH9A 1LOGA 2B46X 4LHLA 2ET1A 1WMEA 1JUIA 4ONUA 5EHDA 4L9BA 4CDUA 4AVSA 1LEMA 3ZO0B 4Q4W1 2JG9B 1X9PA 3ACGA 3KGZA 4OZOA 4QU2A 3CZUA 1JYIA 1JH5A 1OC1A 2FMDA 3T0DA 2WFF1 5I0DA 4M3CE 5FZHA 1YFXA 1VBC1 2O1QA 1ACCA 4ES8A 2WABA 5ANQA 4Y26A 5ABJB 4K8FA 1US3A 3P5BA 1X33A 2R042 4D69A 4LUKA 2RVAA 3RZHA 2DVDA 2VNGA 4Y1ZA 3W58A 3AMMA 2WNUC 1TMF3 2AGSA 1ZA4A 3MFAA 4XQWA 5CZKA 3W5NA 4AVBA 4LBQB 5KXEA 4GKXA 2RJKA 3UK9A 2P34A 5FY9A 2XQXA 4DXRA 1RVF1 2W5FA 3T1LA 1O4YA 2JG9A 3U07A 1MR5A 1QEXA 3E5UA 4IETA 4MZUA 4QXKA 1AJKA 1LB2A 2XDVA 4KQ7A 4Q4X2 3PUHA 1ENSA 3ZFGB 1SPPB 5ABJA 2G9GA 5M0TA 3WW2A 3OGSA 1HB4A 5FPVA 5IATA 4YVSB 3DL3A 3B3QE 2AENA 3CMGA 5L9BA 2VBBA 1VBB1 4FPGA 2HKXA 3BI3A 3AP7A 3BIWE 2R7EB 1RUG1 5E88A 2VZRA 2FQPA 2NM1A 1CVNA 3CJIC 4QPIC 3BTZA 1MZ6A 4FTBA 1ALYA 1LTEA 2Q5TA 5DG2A 2VQUA 4LBQA 1V6LA 4KG8A 1B35C 2J22A 5ANNA 5C8CC 1ZYBA 1N1SA 4DXSA 1OLME 2K2SA 3FUOA 3OEAA 1RB8G 5JUVA 1CWPA 3QH6A 4KL1A 3V0AB 2W2IA 5A7QA 3T2QA 1YQ5A 4CCNA 5EFUA 5L9VA 4QAWA 5FBJA 1ZRIA 5EJZB 1OI6A 3ZFGA 1SPPA 1CAVA 2RR11 2WS93 2MHFA 4ORFA 1E5SA 4SBVA 4AVTA 3GCWA 5GLUA 1AR62 4YVSA 2WRAA 3POGA 1RUNA 4P14A 3WF0A 1ZZ7A 2DUOA 3AK0A 4B7KA 5E16A 4WV8A 4B4QA 2XJRA 4RQPC 2FDKA 4HN1A 3P3PA 4QQOA 4AGVA 3PUQA 1YWKA 2Y8KA 3ZR6A 4KG0A 5FKBA 1SBDA 4RD7A 4XFFA 4JKLA 4LBNA 5BNPC 4LTAA 4OQ8A 5IK4A 3SEEA 2WT2A 3HBKA 1U5YA 2D3PA 2ZEWA 4Y4RA 4GIQA 2VMEA 4OVEA 1IKQA 2ZABA 3JBG1 4IV3C 2I45A 4MV2A 5CU1A 3H3ZA 3MO4A 3TB0A 5B4XA 5KHHA 3EYPA 4XJAA 2PELA 4LULA 2WINB 2LALA 2X09A 4ATFA 2R043 3VGIA 1O4ZA 4ZPIA 1E5RA 3FLPA 4L99A 4LKSA 1PGW1 3I2OA 1CN1A 3T2PA 2BJSA 4RS5C 1PMHX 4HSLA 1R1A2 4XUOA 5F1RA 3SH4A 2G9FA 3PUAA 4IESA 2G1MA 2ZOEB 4GZ9A 1HRV1 2BW8A 4YW7A 2ORZA 3QLQA 3OSDA 1ULFA 3C7FA 4WM7B 5DAPA 4N53B 5CB7A 5KC5A 1GWLA 2GSYA 3WUCA 3AL6A 2ARAA 2BZDA 3R05A 2D97A 3N3HA 3PMEA 1G9FA 4Q4X3 3AKSA 3CBNA 4EWDA 3H8RA 2B9UA 5DPNA 3M7AA 3RYKA 2GP3A 3U75A 3WDVA 4PJYA 1POV1 4CU7A 4NN0A 1AR82 3IM0A 4XXAA 1NYWA 1W6PB 4QKDA 2JE9A 4HPKB 3KS7A 4MGQA 5FYMA 3SCGA 2JEMA 4JZRA 4R9CA 3LA7A 3MPBA 4RR3C 3RDIA 3WVJA 1A6CA 1JI6A 5JSPA 4QHZA 2VOWA 3ILNA 2RMU2 2GNDA 3OTFA 4CDXB 3ON7A 1T2XA 4LHSA 4IEXA 2ZGPA 3OPWA 1KFUL 4N7UA 2VZSA 1F9KA 1BK1A 3CF6E 3WG3A 3I2GA 1BKZA 3APBA 2HWC2 4QX0A 5CG8A 2WO3A 4RGKA 2A6VA 4M3CF 1N3QA 5T50A 3ZFEB 2XLGA 1OT5A 4H2AA 3RZLA 4CEWC 3BCWA 5J98B 4N53A 3IZOA 5T54A 1ASJ1 1CIYA 1E57A 4P9YA 5FOJB 5J3UA 3HT2A 2RS31 1COV1 1GNZA 2VOKA 3NV2A 4YG0A 1PGL1 1RMU2 2CGPA 2LM3A 2RJLA 3W9AA 1QJX2 5L9RA 2YC2A 3K4ZA 5CFCA 3SKVA 1QF3A 2ZEZA 5ISLA 1C1FA 1V9U1 3IBMA 1RITA 1F2NA 1W9TA 2Y6GA 3D82A 1AR63 1OH4A 3NVCA 5FPZA 3S57A 1L7RA 1CD3G 1W6PA 4AI3A 4CP9A 1HXS1 1C57A 1S0DA 4MXVA 2D98A 4QWNA 1QOSA 4TWTA 2H0BA 4LK7A 5KC6A 2BV4A 1WGPA 5C70A 4IEUA 4QX2A 3N9QA 1GV9A 1OPOA 2CU5A 4CDXA 2X5IC 1RUOA 2JDKA 3RMXA 4J25A 3JQWA 4X6RB 2JDAA 2BOIA 4FOQA 4NIHA 5F39A 2VZUA 3VKMA 1VMJA 1FV3A 3ASIA 2VOVA 4LBJA 4Z82A 1VP6A 1JOPA 4MXWB 1GQPA 1Q8QA 2ZHMA 3I59B 1BVVA 3ZFEA 2P17A 4M00A 4AI2A 1PO12 1RUH1 3NNFA 1XSRA 3AFGA 5CISA 3H8XA 2Q1MA 1O6UA 5C3RA 3GGLA 4GWMA 1UMIA 4OI4A 1W8NA 2JX9A 3IDBB 5GLZA 5GZDA 5DUXA 4CTEA 5FWEA 1GANA 2CWMA 1XOYA 2YC4A 3HEIA 5IVVA 3HAGA 4L92A 2ZZQA 1KJRA 3PUIA 3R4UA 4FPEA 3TAYA 2Z4FA 5JXIA 2XGXA 1QDOA 3GJBA 3WNKA 2XJSA 4D94A 2W1WA 1G9BA 1RYYA 4W6YA 2VO5A 4L0PA 3PVBB 1AL0G 4G3YC 4QPGC 4F8AA 1OQ1A 5JAXA 1R1A3 3J26N 1W6MB 2VTXJ 4GKYA 1QJU2 5AVPA 4XAAA 3VKOA 1FXZA 2VGDA 4IEWA 4R4XA 4QDRA 1QQP2 2R0FA 3AJZA 3AYCA 4GJZA 4Q4Y2 3DEMA 4UT5A 1QU0A 2CDOA 3QBQA 4FPHA 4HSJA 4K9SA 3WDWA 5JLVA 5FAXA 1PIV2 1DZTA 2XG3A 3N9NA 5FP3A 4XFIA 1BCXA 1W8TA 4NAMA 1C4RA 4CXWA 4P5HA 1SDWA 2GC2A 2Y6LA 3H1YA 3PNAA 3VDAA 1DF0A 5C9AA 3UNPA 4URAA 3LDRA 2ZBJA 5A3TA 4LNVA 5FZ1A 1AR83 1OVSA 3VL8A 1MQTB 4TLGA 2E9QA 4HG6B 2OQ6A 3LOBA 4RHV2 1RUD2 1YJKA 2HWD2 5K0UC 5C5TA 2RMU3 2W95A 4XCBA 3B5LB 4W6XA 1NKGA 2WQ8A 2ZMKA 4AI8A 1PVC2 3MIBA 2JECA 3RYPA 1SACA 1W6MA 1A78A 1XYNA 2NP0A 5C4WC 2J1VA 3IT8A 4QX5A 1VMFA 1N1TA 2HWC3 4CCEA 1OBNA 3URFA 2Q0AA 1S55A 1HN0A 4BQ5A 1JTZX 4GMP3 1H6YA 5A7OA 4FAHA 4BMBA 1LGBA 5FYSA 3IPVB 2BDRA 1NA1B 1H8TC 3NO8A 5HV0A 1S0GA 4R52A 3VD7A 1Z0HA 3MIEA 4O9GA 1TZOA 1RMU3 1UOBA 2D43A 5DABA 3FMGA 3OG2A 1I5ZA 2NQYA 4AQ2A 2MEV1 1W6NA 1VRBA 4QKFA 5FZCA 4P08A 4PLOA 1MQTA 3WD5A 3PJQA 3HJRA 1VAMA 1FAYA 2WFPA 5HCBA 4PLMA 1JZ3A 5BV6A 1LENA 2XJPA 1OQDA 1WBFA 5C6CA 4YW1A 3A0KA 2D6PA 3WP4A 3AZWA 3LSDA 3P6BA 3I54A 1NLQA 4JGZB 3MZHA 4IGQA 4RFRB 4A6SA 1PO13 1G8WA 3S7IA 2GC3A 4S2GA 3VBFA 1DP0A 1HRI2 2EIDA 2VY0A 1D2QA 3IPVA 4G4FA 4ZXEA 1NA1A 4Y1VA 5FYYA 2PLV1 4CCDA 2BP6A 2D3RA 1XNTA 4XFHA 5H9SA 4A2UA 5TSWA 4HL0A 4HKLA 2Y34A 4I0AA 2WO1A 2WZR2 2JE7A 3LFMA 3POYA 2ATFA 4ISRA 2VBDA 3Q8EA 4JV4A 1FOD2 1V6OA 1GLHA 2ZAAA 3NJZA 1W9YA 2WZPP 5A70A 4CP1A 1Q8OA 3BKZA 4CUGA 1RHI2 4LPLA 1FMD2 2WBKA 3I2HA 3WUDA 1RUH3 1UMHA 1NY71 1JZ6A 2XL7A 3W59A 1OXCA 3I4IA 3NNJA 2YDEA 2Q8EA 1QJU3 1ZBE1 2JG8C 2XJVA 1FI2A 2W9XA 1JODA 1QQP3 3KSCA 4JGZA 4S2HA 4Q4Y3 1MS9A 1YEWA 4TYSA 2OYZA 4E4HA 4PIZA 5DAXA 4QX7A 3VZJA 4XF1A 4Y5TA 3T3YA 3IIIA 4N8MA 1UY2A 1XE0A 1AUYA 1U5IA 4NE9A 4P9WA 5C33A 2QQOA 3WDUA 1NCRC 4AEJA 2BEOA 1HV0A 1H30A 2CYFA 1DHKB 3AXEA 5KR7A 2D5FA 2BBAA 2R062 3E97A 3MGUA 4LO4B 4NWVA 5IVYA 3ZPYA 1DQ0A 1M06G 4RHV3 1RUD3 2HWD3 1W90A 4CDWB 1LR5A 3POJA 3WOGA 4NRQA 2XQRA 4E8CA 4EN6B 4Q1PA 3CL1A 2WYFA 5C5UA 2PXJA 2Z69A 1K12A 3F95A 3VD5A 1UYYA 2ENRA 5LASA 3F2ZA 4FBFA 1PK6B 1DGLA 1YQ8A 5FLJA 2BVBA 5FK8A 3MLKA 1JZ2A 4E2SA 4EROA 3H8OA 1HJGA 1UN1A 4JAAA 3SNMA 4WVMB 3UKTA 4QPGB 2DCJA 3VBRC 4D7YA 3RG0A 5CVRA 3LIHA 1VBE1 1DZQA 5GZGA 5A7WB 5F3IA 2RV9A 2P3IA 5CEHA 5A3PA 4FPYA 4CE8A 3VBOC 2UURA 3ZYBA 1N1YA 4Y1UA 3ZSMA 3ZMNA 3ZSJA 4B1LA 3LOIA 2YROA 1CAUA 2J1TA 4Z2WA 4CDWA 3KZ4C 4Q8LA 2O8QA 3ZYRA 5FLHA 4NPMA 4BQYA 5LEKA 4AHZA 3OOXA 3FLRA 3A21A 2NN8A 4YWAA 1Z7S1 3Q8CA 4IGOA 4PQQA 2ZPXA 5A6YA 3IMMA 2WLQA 4QQHA 1N3PA 2HWF2 1V6IA 1PK6A 3AXDA 4Y33A 3PU3A 4N43C 2HWB2 4HK9A 1CIWA 2UY8A 3LKJA 5H9RA 4DFSA 3G7DA 2PHFA 1LOCA 4B1MA 1RC6A 1HRI3 2OUHA 3J7LA 3O0VA 5LA1A 2WLPA 1SBFA 5FP8A 2VQAA 4JVAA 3K51A 4NR1A 4AVAA 3VZLA 4EN0A 1AR72 4PDWA 2VTXA 2D6MA 2JDNA 4FOVA 2QQJA 5A7WA 2WZR3 4HXCA 1F35A 1Q8PA 3EJKA 1OD5A 4JDOA 1EV11 4ASKA 1FOD3 2BERA 2GNMA 4LO8A 1GOHA 1UZ0A 1OF3A 1UU5A 2ZKNA 1RHI3 2D6KA 3J8F1 3G6JB 1FMD3 1S2BA 4Y5SA 4XHXA 2BGPA 4K8RB 3D0JA 4HFSA 2Y6JA 4G9SB 1W2TA 4QHOA 4UW3A 1SLAA 4HLTA 3VD9A 5L19A 1JHJA 3AZVA 2W87A 2VXRA 4BIFA 4XF4A 2RS11 5L73A 1REEA 2C0ZA 1O7FA 5JI7A 4AEKA 3GZAA 3WHUA 3TEZA 3ABZA 4CPBD 1VPHA 5F5AA 1OFSA 3Q9OA 4Q4V1 3B00A 3MV01 4BQXA 2XOMA 2IXLA 4OI1A 2XBO1 3I2KA 3TEXA 3RZGA 2RM22 5L7OC 2RE9A 2HBTA 2IXHA 3KQRA 4XILA 2R063 3T1MA 3LCPA 1R082 3POEA 2YV8A 4I30A 1HB2A 3N9MA 2YYOA 1U12A 1ZZBA 5FPLA 3CEWA 3PIJA 4BOWA 4ZHNA 1MS1A 2XWJB 1D4M2 4ITCA 1H2NA 4IEPA 1GWMA 4JTOA 4NHXA 4XAEA 4YVWB 4OQ9A 4COYA 4DNYA 1LOFC 2JDPA 4E9KA 5A3UA 4LA2A 1ZREA 1H2KA 4I2OA 2EVXA 4XBQA 1SLCA 2D93A 2VMIA 3UKNA 1NE4A 1U5ZA 5D21A 5FREA 4AI9A 2XVKA 2W47A 3ZYFA 2JDHA 2ZX1A 1OA2A 2W1QA 1NCQC 4H7LA 2R0HA 1ST8A 2HWE1 2VNRA 5J1XA 3DPRB 1BMV1 5FUIA 3JCIA 5JOYA 2UWBA 3ES4A 2UYAA 2PFWA 1JYWA 3IDAA 4XJUA 3AP4A 3N7KA 3OYWB 4LKEA 5E8AA 3P3NA 3WR0A 4DIQA 1TME2 1MEC1 1ODMA 3U11A 1RUJ2 1AL22 2YB7A 1ENQA 1K5MB 1AXKA 4QB2A 5F32A 4CUCA 4Y3OA 2VCMA 2HWF3 1W39A 4QHBA 4YVWA 5DZEA 4FPCA 3A22A 3WT3A 3H42B 1AX0A 3VLBB 1D0HA 2HWB3 1PX4A 1TMF2 3PURA 3NWKA 3O1RA 2VZPA 4XURA 1W2OA 3H3LA 4QPWA 3ACIA 2PYTA 5CFDB 4GQ7A 1AR73 5F2SA 5I0UA 3HQRA 3NNGA 2FDJA 3RVHA 1RUF2 3FLTA 3WF1A 4A3XA 1O4TA 3DPRA 2ZEYA 1OA4A 4QXHA 3POIA 1OQEA 2OZ6A 3VN4A 1VBA1 2CTVA 3NNMA 4D6RA 4C0HA 2WKKA 4BJ0A 2IFWA 3OYWA 3KHBA 4ATEA 1AYN2 3CO2A 4JKKA 4YPJA 3ZN4A 1YQCA 1CZSA 2E6VA 1AX2A 3L2HA 3MLLA 4RSUA 1S0FA 2MNGA 1RXFA 3MIGA 4QXCA 3WLUA 4IEVA 3BTXA
chains in the Genus database with same CATH topology
1VIWB 3LB9A 1GQHA 5B2GB 2LTNA 1OLQA 2P3KA 2PHWA 1ND2C 3M8LA 1XNBA 4FP3A 4H14A 5CFDA 5I0RA 1UKGA 3H7JA 3FHIB 3GALA 5KHIA 4DMIA 2O0OA 1RGSA 2KA3A 4LE3A 3VBHA 4JQRA 3AZZA 4M0HA 4IL7A 3RNSA 3R6SA 1AX1A 2EXKA 2RM23 3U10A 3JD72 1F5JA 1WCSA 1QWRA 5BNOB 1R083 1AXZA 4QGMA 2WQ4A 4MX3A 4BLJA 3VDDC 4AG4A 5GLTA 1LHVA 5IK8A 1D4M3 1RUC2 4BH9A 4CDQC 5HCAA 3H9AA 3RI9A 3AKPA 5DDJ2 4IQPA 4WVWA 2XBO3 4XBNA 5J36A 1S0EA 1AYM1 1O5LA 1F5FA 4IV1C 4NHLA 4QGNA 1WW5A 3VBSB 4NOTA 1WUVA 4ES9A 2W39A 4ZU4A 2E63A 4C90A 4WM8A 4IEOA 2D3SA 5BYNA 4E2QA 1UPIA 3M3EA 3UKVA 5FO9B 4R9AA 2ZGQA 1H8VA 3B94A 2IFRA 5BNOA 2R1BA 3SH3A 4ZKTB 2PQQA 1TME3 4MH0E 4YZ5A 1RUJ3 2NPIA 3B69A 4MYEA 3ZFFB 5GALA 1AL23 1BEV2 1DGWX 1MZ5A 1HQLA 1PO21 2GNBA 3QCWA 4K7JA 4CEYB 3VBUB 5CFCC 2A3XA 4Q4W2 3B01A 2WFF2 5GLVA 2GN7A 1X82A 4TZDA 1VBC2 2ZGUA 5GZEA 4HBNA 1WLDA 3USSA 4Q8KA 2QCSB 1RUE1 1RUF3 1QY4A 1SMVA 1QHDA 3OD0A 2GMPA 2JICA 1OA3A 2Q4SA 1J1LA 1NZCA 2UY9A 2I07B 1ZZ9A 1NXMA 4A7KA 4UW5A 2EALA 3ZSEA 4YGCA 5F5QA 1AYN3 3WHTA 1QXPA 3OGGA 3FE5A 4JGYB 2EXIA 2DCTA 5DUVA 1ENXA 4Y1XA 1RUI1 3B9IA 2W08A 4CEYA 4XFAA 1RVF2 2VNOA 3DGTA 2ZX2A 3I2DA 2X8KA 2QVSB 1Y3TA 4YLZA 1JYCA 2A6YA 1URXA 4AGGA 5T5LA 2Q30A 3B9CA 1RL3A 3GYDA 2YZ4A 3INAA 4YG3A 1O3RA 4OHYA 3N7JA 2EXHA 5AC91 1QDCA 1PM7A 3IN9A 5JLVA 2YMZA 4N7IA 1Q43A 3TNPB 1BYHA 1REDA 1VBB2 1QNYA 3JD73 1LECA 3RWNA 1KITA 1SCSA 1RUG2 4AVCA 2WSVA 2EAAA 1V6NA 4E4SA 4JGYA 3IWZA 3WW4A 1X8EA 1BBT1 3USUB 4JDNA 4XEZA 1OOPB 2E7TA 1RUC3 3AM2A 5DDJ3 1JXNA 3GNEA 2V73A 2A75A 1EP0A 3N35A 4B7EA 2BVVA 5AFBA 2JJ6A 4OHVA 3E5XA 3JB4C 4XTPA 2ZHKA 4AGRA 2RR12 4HMZA 4H55A 5BNQA 3HQXA 2VQ0A 1IHMA 2DV9A 1IOAA 2AUYA 4MGZE 3V0AA 4FTEA 2WQZC 5DUWA 1NE6A 1R1ZA 3WQ7A 4AHYA 2BNOA 2C9AA 5BNNB 1ND3B 2PHDA 4A7ZA 1A3KA 1BEV3 1A8DA 3USUA 2AYHA 4OULA 4M01A 1CAXB 1LU2A 2A6XA 5FLIA 3SXWA 4KGGA 2DFCA 2PHXA 3BOPA 4Q4W3 1XU2A 3B93A 2WFF3 2GMMA 3JB8A 3JBG2 2CV6A 1O3TA 1VBC3 4AEDC 3JUUA 3LWCA 1J59A 1XNKA 3RQ0A 2XWBB 3KGLA 2BGCA 3NL1A 3VZNA 4ASMB 1W0OA 1PGW2 3PVEA 2QDNA 4HANA 4XF0A 3MIFA 5F6LB 4E4DX 3NAPB 1RJ8A 1DLLA 1M4WA 1XNDA 4MLOA 4PQ9A 5FCCA 3H1MA 3VBFC 2AR6A 3HWJA 2BTVC 2DWRA 4IXLA 2VULA 3CU7A 4FPJA 3O7OA 1ND3A 1CAWB 3BTAA 3IDEA 1OPMA 1HRV2 1CAXA 3N4MA 2A3WA 1PHMA 1RVF3 1LOBA 1ONAA 4QGLA 1UX6A 2TEPA 2DVBA 4KU8A 3EBRA 5T5JA 1DGRN 2BUKA 4KU7A 1V6MA 1Y7BA 4YW4A 4OLLA 4WM7A 4BQ1A 1Q56A 4FT8A 4LEJA 3M1HA 1VBB3 2NZ9A 2WNUB 3FBMA 1FPN1 3NAPA 4CZSA 1RUG3 1LOAA 2FHRA 2WNVC 5D8AC 1FYUA 1CAWA 4S2FA 1EY2A 1HQNA 1EPWA 4HPKA 4XTMA 5FOBB 1PMIA 4NVPA 1ASJ2 3RZZA 3SISA 2VMGA 3KM5A 4AW7A 1UL9A 2RS32 1COV2 1PGL2 3CLPA 2WL1A 5T5PA 3HR9A 2XH6A 3THTA 1KRIA 3LGRA 2RR13 1V9U2 2DVFA 2X29A 4FO9A 1EAH1 3R4SA 2QJVA 2D6LX 1IZ3A 1HXS2 2BQPA 4HKOA 4MUVA 2WNUA 1UU4A 2VW1A 1N1VA 3PVNA 3WZ1A 1F31A 3RI8A 4HT1T 3CJIB 4QPIB 1AR91 3TNQA 4YZ2A 4M0NA 4LO7A 4FPFA 5F9TA 1B35B 4I3PA 5C8CB 2YPJA 1CR7A 4HVOA 3ZMOA 1RUH2 4RFT0 4Y20B 3TRSB 2JXAA 3TOJA 3SCHA 3JBG3 4GH4C 4SLIA 4HVQA 1XU1A 1DIWA 1DYPA 1HQWA 4MXWA 5T3NA 3I59A 4AVVA 3B02A 3BPZA 4YZ3A 2EIGA 3IIAA 2MPFA 3CJIA 4QPIA 4I3GA 4RQPB 3VKFC 1B09A 1TQ5A 5FTTC 1Z78A 1B35A 1LJ7A 2VVDA 4PDWC 5C8CA 4I09A 5BNPB 1HRV3 1APNA 2UWCA 4LLFA 2H6BA 3L9JT 3AZYA 3M4FA 4HK8A 2TUNA 3GHMA 4IV3B 3SMHA 1VB4A 1PVXA 1UZZA 5LK5A 2YGLA 5JMCA 1POV3 4JRLA 1QNWA 1C8M1 4J1WA 3VHOA 3MYXA 4Q29A 4N90A 2BNMA 4RS5B 2A7AA 2PN5A 5JIUA 1WBLA 2ARXA 3MFCA 1ULGA 5BXXA 1XQNA 4LA3A 3A4UA 4BM8A 1G7YA 2IC1A 1ASJ3 3JZVA 2ILMA 4DS0A 1NG0A 4IV3A 2RS33 1H2MA 1COV3 4KWKA 3MF6A 3N7MA 1UPSA 2ZGMA 4HKWA 2NMOA 1QJY1 1V9U3 2MEV2 3FJSA 4DY5A 2DFBA 4RR3B 3AP9A 3WCRA 4WVVA 1HXS3 1ZBA1 2VW2A 4RS5A 3AYEA 2DCKA 5KXDA 4AFCA 1OMIA 2LUWA 1YNAA 1Y9QA 4XJZA 2DURA 1S0IA 2RS51 4MGKE 4XMAA 1XRUA 1R091 4META 1HW5A 2VG9A 1OHFA 4MGIE 2R071 2XKPA 4CEWB 4BE3A 2VVEA 1PZ9A 4OHWA 3AYDA 2PLV2 3OBRA 3NV1A 3PHMA 1UAIA 1S0JA 4YZ4A 2ZACA 1VRH1 3WQ1A 3MI8A 5FMOS 3OY8B 3C2UA 2ZHNA 3WNXA 4HVRA 4XIOA 1NY72 2X5IB 1NOVA 2WT0A 4COUA 2YGMA 5JSRA 4YM2A 3WINE 1D0GA 4Y5Z0 4CRQA 1ZBE2 4DRVA 2DUQA 3I8TA 3HN1A 3L2YA 1GYKA 1FT9A 4CEWA 3PVOA 1UU6A 1DFQA 2ZS6B 4BLIA 3DV8A 5HXVA 1C3HA 1H1AA 2IWGB 1AF9A 2ZHLA 3N36A 4EN7B 3R0RA 3NV4A 1XE8A 3KCXA 1WW4A 4FCAA 1RIRA 2GALA 4OUMA 1WCDJ 3HT1A 4FXGB 1IPKA 1UW8A 2ZGTA 3NSTA 1TNRA 2DVGA 2X5IA 3RSJA 1IS5A 2PHTA 4OI2A 2RHPA 1WMFA 1ULEA 4YYOA 5IK7A 4KWLA 1OKQA 3I7DA 4F7ZA 3TBDA 5JZGC 1IS6A 3TN91 3VBHC 2D5HA 3FUQA 4LHNA 2BFUS 4Y24A 4P9GA 1SLBA 1YCIA 5T5OA 2WC2A 3E5QA 5JR7B 3MPPG 1VBE2 2W52A 4AFBA 1FATA 4COZA 3B7MA 1VJ2A 1VAVA 2WWSA 3GBGA 2MEV3 5GJ6A 1GZ9A 4INDA 2ES3A 4YSFA 5K0UB 2DYCA 1C5HA 1MS8A 2WA3A 2VH9A 4WVMA 1BJQA 1JHNA 3DN7A 4QPGA 2C1FA 1SFNA 4LBOA 1MS5A 1SCRA 5K7PA 1VBD1 5C4WB 4AFAA 5I0SA 3RS6A 1Z7S2 2DCYA 1C5IA 3D4KA 1QOOA 1WD3A 2GAUA 5T55A 3M3QA 1AJOA 4B29A 4CDUC 1V6KA 1KQRA 4Q0VA 4WM8C 4AWDA 4RA0A 3AJYA 4N9HA 2ZGKA 1H8TB 1J3QA 2PLV3 3HD8B 1JN2P 1GICA 2WIIB 2D44A 4AEMA 1EV12 2DVAA 1V00A 3RJ2X 3J8F2 4OHZA 5EJ3A 4RL7A 5K0UA 1CX4A 3KCYA 5JIAA 3WG4A 1ULCA 4LR4A 5ACA1 4OZXA 3M3OA 5C4WA 1SBEA 4PBPA 3WW1A 4F83A 3V0BB 5LRSA 4DRRA 1GQGA 1ZBE3 1ZZ6A 5DG1A 3O14A 3EHKA 4XQ4A 4XE9A 2RS12 3WQ0A 3DUIA 3ZXLA 2P3JA 4KWJA 2JG9C 4ZU7A 5K8SA 3A0NA 4QPYA 3WDTA 4WBBA 3OPZA 1IS4A 3DKWA 4Q4V2 4P9LA 4B4RA 2KXLA 5ABJC 1HKDA 4Z1VA 2XBO2 3MW4A 2X53S 3J9SA 4GB31 1W6OB 3M3CA 3AYAA 4U2AA 3AKQA 4XJWA 3PTYA 2GNTA 5FQ0B 3MW3A 1NQJA 3K48A 2B7YA 2JG8B 3NKTA 4LBMA 3UJQA 5EV7A 5EZWA 3TWIA 3QOPA 2I2SA 3UJOA 4DQAA 3O0WA 3LSEA 1LHNA 1LOEA 5GKAC 3PLQA 3ZYJB 1ZRFA 1DBNA 1G9AA 3EO6A 4WZFA 2HYKA 1VBE3 3ZFGC 1DGRA 1DGWA 1NCRB 2HWE2 1BMV2 4GWNA 4LBLA 2WJSA 4PBOA 4YVSC 3SITA 4C1WA 4Y22B 3J4UH 4K20A 3S0MA 5GLWA 1XE7A 2ZTNA 1XXNA 1MEC2 2R30A 2R32A 4Q0SA 4NHMA 4XZPA 2JG8A 1DQ4A 2ZGRA 1SFYA 2Q1ZB 1Z7S3 1HV1A 4FVVA 1J1TA 3WX5A 1YFYA 4Y4YA 4DOUA 5DUUA 1LHOA 3OD4A 1GFF2 5GZCA 4DB5A 3VBRB 1CONA 3KT1A 4QM8A 3O12A 3AP5A 4C1XA 1K5MA 4J1XA 1CGPA 1NCRA 2Y0IA 3VBOB 1EV13 1DQ5A 1VBA2 2ETEA 3J8F3 2UU8A 2DUPA 1LODA 2ZX0A 4LE4A 4QMAA 3OF1A 2DCZA 4YM0A 3VZKA 3POSA 2FBEA 1QXRA 2ARBA 3LZZA 3ZN6B 4N43B 4UXAA 4IERA 5FDBA 1CQ9A 2RS13 3AFKA 5A3MA 2N7GA 4M3CB 2QZ3A 3LAGA 3VBRA 5A32B 4IEQA 2DF7A 1DYKA 4Q4V3 2WS91 2A73B 4I0BA 4XFGA 4XOGA 3VBOA 2FZ2A 5JSOA 3JQXA 1G6NA 2EAKA 2IXIA 2ZZJA 3ETQA 2VUJA 5J96B 1O5UA 4MGYE 1H1IA 2CGOA 1RJ7A 3KLSA 3IMNA 1FNYA 2OIIA 3S6PA 4LLOA 3ZN6A 4N43A 1PZ8A 3ZIXA 4NWWA 1AYM2 1DG6A 4WM7C 3ILRA 4N53C 4P9IA 4X8PA 1GBGA 4B4PA 2OA2A 5A32A 3EQEA 1DQ2A 3AMNA 3GZUC 5F6KA 2HWE3 5L7OB 2CAUA 3E6BA 2R041 4P9JA 3ZX7A 3PMSA 2E53A 1LU1A 3MF9A 1QJZA 2Z5WA 1EPZA 2D6OX 4AXOA 3AMHA 4H7MA 1KFXL 3H0OA 1Q3EA 4WVZA 1IS3A 3VBSA 3VHPA 1MEC3 4CDXC 1KJLA 5L36A 2XLAA 2DU0A 3V56A 1PO22 4NO4A 3AB0A 5JCTA 3ZFEC 3ENRA 3POWA 2PAMA 3MDPA 3NKGA 3OJBA 4K3UA 3ROUA 1LHUA 3VZMA 3ZFFA 1UD1A 1GZCA 4Q4X1 5I0TA 1LESA 2W68A 1NCQB 1AZDA 3ACLA 5BPXA 1RUE2 4KGQA 4XFBA 5I8TA 2ZCWA 2EA7A 2AZ5A 2OW4A 4U36A 3VBUA 1WLTA 5L7OA 4W6WA 1H4HA 2BWAA 5CAZA 4MVTA 3VUOA 1ZX5A 1VBA3 4QQLA 1NLRA 2Y38A 2G4IA 2D6NA 2QZ2A 4K1ZA 5A33B 5C8WA 4FOWA 3X29B 1SEFA 3M2MA 4BYYA 1Q5OA 1WA4A 1D2SA 2DU1A 4GALA 1CAVB 1RUI2 2C5DA 1OSGA 1LOFA 3KCCA 1DZRA 3H7YA 1WW6A 4X8NA 1ZRDA 3O0XA 4Q2FA 4IEZA 5DZGA 4URTA 2TBVA 3ZXJA 2OZJA 1NCQA 5I8SA 4AFMA 2CWSA 1YYNA 4TLFA 3S30A 4OHXA 5AC92 5KHGA 2ERFA 2VOXA 2HEWF 4AF9A 5C9AC 1AR61 2WNEA 1MS0A 5IT6A 3CJXA 3FX3A 1YJLA 3KMHA 2R16A 5SV5A 1CPNA 5A33A 3SCFA 2CGNA 4QM9A 1BBT2 3O5SA 2OPKA 2XHKA 4E4ZA 2E7AA 4KBBA 2F4PA 4XFCA 4ZXKA 2NMNA 3KD4A 3RRDA 1KS4A 1MVQA 1W2UA 2GC1A 4N9IA 4AI1A 2ZGOA 4Z92B 1AYM3 1ND2B 3WP3A 3ZSKA 4XPVA 5EXOA 5BUVA 5J7MA 5LRRA 4Z07A 3ZXGA 1W6QB 5CBLA 1GNHA 1LGNA 1JOJA 1CPMA 1GR3A 1WMDA 2GZWA 1OOPA 4XW3A 2AREA 5IK5A 4I02A 1TEIA 3D5OA 1JBCA 1L3JA 4XBLA 2YY1A 1ZZ8A 1ZRCA 1I9RA 3E6DA 1MQTC 2W0XA 1PGSA 4XJ9A 3VDDB 2SBAA 1QH7A 1R1A1 3FWEA 2Z79A 4ZU5A 4NPRA 1CJPA 4DINB 4CDQB 3AZXA 3WG1A 1UMZA 2V5YA 5H9PA 1LULA 5CIRA 1KDKA 4DXZA 1PO23 1QGLA 1KD7A 4YRDA 3BOWA 3ZXAC 1ND2A 2YUEA 4IV1B 4L8QA 4YW2A 3GF6A 1LCLA 4BIOA 3WW3A 5BNNA 1NA1C 1WD4A 3WP5A 4Q0UA 1W6QA 2JKBA 3WV6A 1RUE3 1DU3D 2ET7A 3BU7A 4EJRA 1AR81 1MACA 5I91A 3GBWA 2A6ZA 1I3HA 2DTWA 4XETA 4UW6A 2CNAA 2IZWA 2RMU1 4E27A 4LO6B 3PJYA 3VDDA 1O3SA 1KS5A 2B39A 5KHJA 1TNFA 1NLSA 3AKTA 1IKPA 4CDQA 2GH8A 1A8MA 4XMIA 2HWC1 5CFCB 1D4VB 2PA7A 1RUI3 2BWCA 2AH2A 1X8MA 4YNIA 4JGZC 4GMP1 4BZ4A 4BPZA 1JUHA 3C3VA 5K9YA 4IV1A 2VW0A 1V70A 4BHPA 4LBQD 2XLFA 4GA9A 4D3WA 1RMU1 4BA6A 4JTNA 4AQTA 5I93A 4PLNA 1QJX1 5KXBA 2QNKA 4FTSA 5JPNB 4EV0A 5AC93 2CY6A 3THPA 4UW4A 2YHJA 1FPN2 3AKRA 4PIXA 2CAVA 4YFZA 4YZ1A 2GH2A 5JWPA 1ULDA 2HEVF 3FC0A 1DQ6A 1LRHA 1TE1B 1PNFA 2R1DA 1BBT3 4WZCA 4RGAA 2CL2A 3GZTB 4GXLA 4JDMA 1PO11 3VKNA 4AHWA 1QKQA 5HI0A 3OBTA 2XB6C 3BB6A 4QQPA 1Q8VA 1KDMA 1VALA 2PHLA 4Q27A 5JI9A 2KM2A 2UWAA 1EAH2 3VL9A 3ECQA 1MZEA 4I0WB 2A71A 1N47A 1X7NA 3BALA 1V6JA 2BPA2 4YGBA 4FPKA 4L11A 5EWSA 4CDWC 1EYBA 4CP2A 1AR92 4D7TA 4V1PA 5KXCA 4B3NA 5JDBA 3AX4A 4IEYA 2B42B 2ZX3A 3MIHA 1QJU1 5KBFA 1UIJA 2Z2SB 3ST7A 3VV1A 1QQP1 2XVGA 3LA2A 5JVVA 5C9AB 4J6GA 1PK6C 5JOXA 2QDRA 1I1EA 1MS3A 4Q4Y1 1YFWA 4LUMA 4PF5A 2PHUA 4XF9A 4XHBA 2H6CA 2NYYA 4JRAA 3H3UA 2A6WA 3FBYA 2ZMLA 5T52A 3WY6A 1PIV1 2OVUA 2ZJCA 3QH7A 1YXWA 3ZIWA 2IXCA 4FAGA 4LBKA 2XJQA 4HZFA 4CP0A 3HIFA 1H2LA 2XJUA 4Y20A 4X6QB 3UV9A 4BCUA 4K6BA 4RHV1 1RUD1 2HWD1 3EXUA 3D6EA 3SLIA 2XKOA 2GC0A 4Q0QA 5JPMB 1PVC1 1YUDA 4D7SA 1G9DA 1X50A 2H0VA 4AQSA 1UZYA 2EF6A 2D7FA 1FX5A 1S2KA 2Q8OA 4C0BA 1YI9A 1ZZCA 1W6NB 2E7QA 2JD4A 2HEYF 5JOWA 1IPJA 4COVA 2VUAA 1XYOA 3VHNA 4RQPA 4AEDB 1RTVA 1PZ7A 3VKLA 1BXHA 3ELNA 5BNPA 4Q26A 5KHKA 1GSLA 1REFA 1UIKA 3MICA 1C8M2 4GULA 2XUMA 5GZFA 1C28A 1CJDA 1ZNPA 1FPN3 1SLLA 5CA6A 1O91A 3VBFB 1H4GA 4FXKB 2IXJA 1YRZA 4ISQA 4XF3A 3WP6A 1I6XA 1MVEA 5LEJA 1QJX3 5FMOL 3MIDA 3ZXEA 1OFNA 2YC0A 3M70A 5FRAA 1H0BA 1UCXA 1HRI1 2A3YA 4MSVA 1MZFA 1UKRA 2ZGSA 4AEDA 1KXGA 2NLRA 1Q8SA 5FFOC 5H9QA 1MS4A 1YI7A 2FZ1A 2ZAHA 2WZR1 2WSUA 1QJY2 2O8OA 1LEDA 2ZA9A 2XPJA 4CYDA 1FOD1 1EAH3 5IUQA 4P9XA 1HLCA 1RHI1 1ZBA2 1FMD1 4XIKA 1QH6A 3SH5A 1PNGA 2BNNA 2WNVB 5D8AB 5KWRA 1AHSA 2A5ZA 1AR93 4XDQA 1VR3A 1NQDA 2GN3A 3QACA 4FPLA 4LHKA 2RS52 1R092 1H9WA 2ZGLA 3WDXA 2ZGNA 3FFQA 4RR3A 2R072 2ZX4A 4O9EA 4YVWC 1POV0 1G86A 4GMP0 4UBGA 1GZWB 4EN9B 1S0BA 1U5XA 4R9DA 3FZ3A 4LO5B 1YLLA 3LA3A 5CADA 3OCPA 1VRH2 4JC1A 2K0GA 2HJIA 3WCSA 4R4ZA 2B45X 4Z8BA 3IKWA 3DPRC 4HN0A 1H9PA 1F8VA 4QT6A 2R061 4LT5A 2BFUL 3IDCB 3ALQA 2WNVA 5D8AA 1FV2A 4AK3A 1HDKA 3MEPA 4YGEA 2QUOA 1PIV3 5LK7B 3OY8A 1K5MC 4H3WA 4FQZA 1LGCA 4OUSA 3ZYPA 3ZXDA 1X36A 4K1YA 4OI0A 1GZWA 4GH4B 4BWOA 1CAUB 3D0SA 4XXPA 4BMEA 2ZMNA 4W65A 5CFDC 1PVC3 1CESA 3CNAA 4AFDA 4AE2A 1C8M3 4XJ8A 2D40A 3JU9A 3ZXFA 1JW6A 2EXJA 3H8UA 3TYJA 5FO7B 4PDWB 1SLIA 1S0CA 2BYVE 3TN92 2HWF1 2BBVA 2GDFA 2R6QA 4C91A 1N3OA 1NXD1 1RINA 2HWB1 4F3JA 3BODA 4GH4A 1ENRA 1ZVFA 5SV8A 5DZFA 1Y43B 4XYXA 3AP6A 1AR71 2VU9A 2DTYA 3FFZA 2F6BA 1YFUA 1WLCA 1SQ4A 4K21A 1QJY3 4AHXA 3KT4A 3U0ZA 2ZKLA 1DQ1A 3NW4A 2PAEA 1ZBA3 3OGJA 3UL2A 4A7YA 2VPVA 3T2TA 5BNOC 5HBAA 5J48A 3ATGA 2A70A 2E51A 1VBD2 1AVBA 2XVLA 4FOYA 2K9ZA 3ZSLA 1J3RA 2RS53 1R093 4Q0PA 3WXPA 4KNCA 2JENA 2R073 1HIXA 4B8EA 4FQ4A 3GHNA 4TSVA 4UBHA 3RPQA 1J3PA 4L2NA 5BY5A 1VLNA 3VBSC 3H50A 1VRH3 4RGGA 2PTMA 3KB5A 2Y26A 3ZYIB 1DDLA 1W0PA 4PCRA 5EYXA 5A3LA 2RM21 3ILFA 2QQPA 5FO8B 2UYBA 1H8TA 5AFEA 3MW2A 1R081 1G9CA 5ACA2 3D8CA 1YIFA 1D4M1 3ZFFC 1LHWA 4DPNA 3V65A 1YHFA 4CEYC 2YXSA 3VBUC 4EWEA 2GMEA 4HETA 4YM1A 2QKDA 4DY3A 2GU9A 1WW7A 1C8NA 3AMQA 3VZOA 2QE3A 1XNCA 3V0BA 4FPOB 4EN8B 4AQ6A 2PAKA 1IGOA 4QQ2A 3ME2A 1ZRRA 2FMYA 4GB32 2WA4A 4YGDA 2P37A 4Y1YA 3VHRA 4QD2A 5AVAA 4YW3A 3H1WA 4YG6A 1TME1 3V64A 4S2DA 4PIYA 1RUJ1 2VMHA 4XQDA 1AL21 4AI0A 4R8HA 4JGYC 3ZXKA 1AXYA 5FBZA 4L97A 1WLWA 3MLJA 3WDYA 5E89A 3TN93 4YM3A 1U0AA 1W6OA 1TMF1 1QMJA 2I74A 3ES1A 4NHKA 5FQ0A 4JCKA 1XYPA 2OUJA 5J09A 1ZM1A 1HX6A 2WT1A 1QOTA 4COWA 5JOZA 1T6GC 1RUF1 1BVP1 4OFGA 2QFEA 4R9BA 3AMPA 5D1IA 1YO8A 1IQAA 1AYN1 2V09A 3HBZA 5I8YA 5EYYA 1VBD3 4EWAA 2VVFA 5JZGB 2JDZA 2PHRA 3NV3A 1BZWA 3VBHB 1OOPC 2XJTA 1SLTA 3U4XA 4Y22A 4ASLA 3QD6A 3ZDSA 2SLIA 3HMYA 5DXDA 3KT7A 4DZGA 5CG9A 3GBFA 3RYRA 3N7LA 1J58A 3RMYA 3RJRA 3ZVXA 1WCKA 2TNFA 1H1MA 3ZYGA 2Z42A 3JD71 4I01A 3E6CC 3DF0A 4YFWA 1VAKA 3R4DB 1S1AA 5ACA3 3M3IA 3S7EA 5E1RA 1LKNA 5BNNC 1ND3C 1GKBA 5JZGA 2R49A 4YW5A 1RUC1 4CDUB 4WM8B 5DDJ1 3WG2A 5FPXA 1O3QA 5GM0A 2VECA 2IXKA 1C1LA 4K40A 3ZN5A 4FSJA 2XL9A 2WS92 2B5HA 5HCFA 1YIPA 1BQPA 1QXJA 1OLRA 1UF2C 5J37A 1FNZA 1VB2A 4GB33 4M3CA 4Q1RA 2B8MA 4E2GA 4YARA 4FP2A 5CNAA 3NAPC 4AYUA 2Y0OA 2P2KA 1BEV1 4KH9A 1LOGA 2B46X 4LHLA 2ET1A 1WMEA 1JUIA 4ONUA 4L9BA 4CDUA 4AVSA 1LEMA 3ZO0B 4Q4W1 2JG9B 3KGZA 1JYIA 4QU2A 1JH5A 2FMDA 2WFF1 4M3CE 1YFXA 1VBC1 2O1QA 4ES8A 4Y26A 5ABJB 4K8FA 1X33A 2R042 4D69A 4LUKA 2DVDA 2VNGA 4Y1ZA 3W58A 3AMMA 2WNUC 1TMF3 2AGSA 1ZA4A 3MFAA 4XQWA 4AVBA 4LBQB 5KXEA 4GKXA 2RJKA 3UK9A 2P34A 1RVF1 3T1LA 1O4YA 2JG9A 3U07A 1MR5A 3E5UA 4IETA 4MZUA 4QXKA 1AJKA 1LB2A 4KQ7A 4Q4X2 1ENSA 3ZFGB 5ABJA 2G9GA 3WW2A 4YVSB 3DL3A 3B3QE 2AENA 1VBB1 4FPGA 2HKXA 3AP7A 3BIWE 1RUG1 5E88A 2FQPA 2NM1A 1CVNA 3CJIC 4QPIC 1MZ6A 4FTBA 1ALYA 1LTEA 2Q5TA 5DG2A 4LBQA 1V6LA 4KG8A 1B35C 5C8CC 1ZYBA 1N1SA 3FUOA 2K2SA 1RB8G 3QH6A 4KL1A 3V0AB 5EFUA 1OI6A 3ZFGA 2RR11 1CAVA 4AVTA 2WS93 2MHFA 4ORFA 4SBVA 5GLUA 1AR62 4YVSA 1RUNA 4P14A 1ZZ7A 2DUOA 3AK0A 4B7KA 5E16A 4WV8A 4B4QA 2XJRA 4RQPC 4HN1A 3P3PA 4QQOA 4AGVA 1YWKA 4KG0A 1SBDA 4RD7A 4XFFA 4LBNA 5BNPC 4LTAA 5IK4A 2WT2A 1U5YA 2D3PA 4GIQA 4OVEA 1IKQA 2ZABA 3JBG1 4IV3C 2I45A 4MV2A 5CU1A 3H3ZA 3TB0A 5KHHA 4XJAA 2PELA 4LULA 2WINB 2LALA 4ATFA 2R043 3VGIA 1O4ZA 3FLPA 4L99A 1PGW1 1CN1A 4RS5C 4HSLA 1R1A2 5F1RA 3SH4A 2G9FA 4IESA 2ZOEB 1HRV1 2BW8A 3QLQA 4WM7B 1ULFA 4N53B 5CB7A 5KC5A 2GSYA 3WUCA 3R05A 2D97A 3N3HA 3PMEA 1G9FA 4Q4X3 3AKSA 4EWDA 2B9UA 3M7AA 3RYKA 3WDVA 4PJYA 1POV1 4NN0A 1AR82 3IM0A 4XXAA 1NYWA