3QH7A

2.5 a resolution structure of se-met labeled ct296 from chlamydia trachomatis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
141
Chain Sequence
SRMRAVLHLEHKRYFQNHGHILFEGLAPVSDCKQLEAELKLFLKRWRENVHRTLPGVQMIVKRVRLDHLAAELTHRSRVALVRDLWVQKQEEILFDDCDCSVLLCLSGEKAGWGLFFSGEYPQDVFDWGAGDTAIILRFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CT296
publication title Ab initio structural modeling of and experimental validation for Chlamydia trachomatis protein CT296 reveal structural similarity to Fe(II) 2-oxoglutarate-dependent enzymes.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Unknown function
total genus 37
structure length 141
sequence length 152
ec nomenclature
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16802 DUF5070 Domain of unknown function (DUF5070)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1590 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qh7A00
3QH6A 3QH7A
chains in the Genus database with same CATH superfamily
4X8PA 1JYCA 5FFOC 1DHKB 3BVCA 1YWKA 4Q0UA 3N4MA 3MICA 3ZDVA 3OBTA 4H3WA 4JDNA 2VM9A 2GAUA 1DFQA 1NYWA 3POBA 1DLLA 1YIPA 2W39A 1X36A 2B7YA 4Z07A 5IJRA 4YVWC 5A3TA 3I4IA 1ZA7A 2I45A 4RS5A 3N7MA 3N9NA 1GOFA 2WO7A 1LEDA 1N47A 1XNDA 4PQ9A 5IWFA 3TOJA 5IVCA 4LHLA 1W6PA 3SH3A 2XLAA 3RFRA 4XETA 2WFF1 2ZMKA 2WFF2 3VZLA 3GCXA 4QPGC 3THCA 5FP8A 1WMEA 4D8MA 1WGPA 2B46X 4QX0A 4RS5B 3TYJA 2XJUA 3GJBA 4UWDA 3NNFA 3R4DB 3WQ1A 1AXKA 3ETPA 1YHFA 1W6PB 3CLPA 2RM21 3JB4C 4Q5OA 2RM22 2JECA 2XONA 1XOYA 3B69A 1BBT3 1DG6A 2JDAA 3ILFA 3PJQA 1RUC3 3ZFEC 2G9FA 2R073 2QQIA 3I3DA 2YB7A 4A3XA 2PHXA 4P9YA 3OSDA 4AI3A 4O65A 4FBFA 4XBNA 4ARYA 3V64A 3DXTA 3FC0A 1ASJ3 3L2HA 4S2FA 2WN3A 2FDHA 3PUIA 4DXRA 1RUOA 1FXZA 5FO7B 5A7SA 1SLBA 4QXHA 4AL9A 5L7OC 3FHQA 5FPBA 4DB5A 4LPLA 2WQ4A 4M0NA 1O8PA 4JGYA 3KWVA 4IEOA 4COZA 3KT1A 2OVUA 2VZRA 1SBEA 3B94A 1K5JA 2HEVF 3RZKA 2HEWF 2EVXA 1CAUA 3U10A 3O1RA 1H1AA 3KT4A 3M2MA 4OMDA 1OH4A 2PLV3 4HVRA 4QQOA 3MLJA 5EIYB 1PMHX 4KWLA 4UW5A 3AVSA 1AXYA 4BM8A 4EWDA 4LKSA 1GZCA 1G86A 3O5SA 4D6SA 4M3CA 3MW3A 3M3IA 4JGYB 4LOTA 3WOGA 3U11A 1AYN1 4BPZA 1FV3A 1QJX1 4CP0A 4AEDB 4AYUA 3R4UA 5JIUA 3DEMA 1HJGA 1PO21 2BJSA 1OF3A 1CAUB 1PO22 4YGCA 3QOPA 4J25A 1HXS3 1NY71 1NY72 1QH7A 2QQWA 3OJBA 2RS31 1MS8A 5FZEA 2RS32 4XAAA 2ZA9A 3AL5A 3IM0A 4M3CB 1VLNA 5C33A 1L7RA 1V9U3 2VNVA 2VW0A 3HWJA 2EXIA 1VBE3 4HPKB 1JYNA 1U5ZA 4L97A 4GALA 5T5JA 4NE9A 3J7HA 4QPYA 5FP3A 2OXBA 4RGAA 4CP2A 5FOJB 3C7EA 2CWSA 2VUDA 2PAEA 1W04A 4LT5A 3CJXA 3OBZA 1W3VA 1XE0A 1SLIA 5A6XA 1HQNA 1OLME 2GU9A 1RUI1 2Q1ZB 3AXEA 4GXLA 1RUI2 4QPIC 2GMEA 4RR3C 3I2GA 4WZCA 3PUAA 5FLHA 1V6LA 2EICA 2OT7A 3BPZA 3SKJE 3DKWA 1C8NA 4WM8C 4Y4YA 1J84A 4AAPA 3O1MA 1ZRIA 4X6RB 2XH6A 4QDSA 4E8CA 4CZSA 1Q5OA 1TME3 3EO6A 3J9SA 5LA2A 5FZ4A 3OGRA 4XUNA 1QGLA 5FPXA 2OPWA 5I8YA 5ISLA 2ETEA 3J7MA 4IV1C 3LE0A 1SACA 3VD5A 3BTZA 4I2OA 3FX3A 1RVF1 4EE2A 4BMBA 1OBNA 1I6XA 4QKNA 3VZMA 3E97A 1RHI2 4L0PA 1AX1A 1WBFA 2YBPA 4MADA 5AC91 5AC92 4JX0A 2P1BA 5FMOS 5CG8A 3CEWA 4KQ7A 3DUIA 4MV2A 3H3LA 4RSUA 1UPSA 2HWB3 2P17A 2VXJA 3TN91 2UWBA 3GDBA 4HT1T 3WW2A 4COYA 3PUSA 5C3OA 2JB4A 5IK8A 2PHUA 1ALYA 1C8M1 3T1LA 3OGVA 4IESA 1C8M2 5G04L 2C1FA 2NQYA 1HKDA 4V2VA 1X82A 1XU1A 1F31A 5E8AA 1VB2A 2YDEA 4AZZA 4CDQC 1X9TA 3EXUA 1VMFA 2A7AA 4UAPA 4PF5A 4WM7C 5F6LB 2P3IA 2P37A 1XXNA 4CU9A 1YEWA 4W8JA 1PVC1 2W5FA 4MH0E 1PVC2 3FMGA 3CO2A 1VAVA 3IPVA 4I30A 2ZMLA 2NYYA 4OI1A 5JMOA 4MGSA 3GXUA 2JJ6A 2OIIA 3E5UA 5A1AA 1GQGA 1N3QA 4XF0A 4LO4B 4CA9A 5FZGA 4N9HA 1S0EA 2HWF1 2W2IA 5FXXA 2RVAA 3IPVB 1XE8A 4Q26A 4GWIA 2VCMA 2DVAA 2RE9A 1RTVA 2ES3A 2MNGA 2RDNA 3AZXA 3HN1A 2XWBB 1W8HA 3NJXA 4PI2A 1P8JA 1ULPA 1K5MA 2P34A 4Y3OA 3TBDA 1YQ8A 2VBBA 1VAKA 3OGSA 4CCEA 1QNWA 3WW4A 4KG0A 3WDTA 2ADEA 5BNOC 1QJEA 2C26A 2WWSA 2ZZJA 2Y6GA 1ODNA 3KVAA 2R063 3P3NA 4QGLA 4AEKA 1I5PA 3N3HA 3WINE 2VXRA 2QFEA 3ETQA 3M3OA 2JE7A 3NV2A 4LMFA 3RZLA 4FO9A 4LA3A 2Q8EA 3IB3A 1U5XA 1K5MB 1VMHA 2GH2A 4FFIA 4PDWB 3VDAA 2TBVA 4DUVA 4AGGA 5L9VA 4LO8A 4ZXEA 1XU2A 1W2NA 2GDFA 2W1QA 5FKCA 5FZ3A 5C3RA 5FQ0A 5FOBB 4ES9A 2B5HA 1HRV3 4I3PA 1VBD1 3KGLA 3ZYGA 1VBD2 3LDRA 2VULA 4BLJA 5F7UA 2HWE3 3ZPOA 4X8NA 4D69A 3UJQA 1CAXA 1RUE3 1ZBE3 1PVXA 3E6DA 4XVHA 5DDJ1 5DDJ2 2GSYA 2OZ6A 2WDBA 2D6PA 3GGLA 4YPJA 5ERLA 1CD3G 1OFSA 2J22A 1J59A 3AZVA 1ND2A 3IDBB 5FQ0B 1SBDA 4P02B 5FYIA 3I59A 5BXXA 2XG3A 1KITA 4BE3A 2DTWA 1MZ5A 4P00B 1NXMA 4CCOA 4LKDA 5DUWA 3VD9A 1GP5A 1XYOA 2EXJA 1UQXA 2IXLA 3WNOA 4PIZA 1CAXB 1OA4A 1OUSA 4DUWA 4XJZA 1KS4A 1H4GA 2ZHMA 5TSWA 1PGW1 3FUQA 4GB33 2D44A 4IW3A 4LOSA 1O5LA 3B9CA 3RI8A 1ND2B 4PHZA 3H50A 4MGIE 2XXZA 3I59B 3H7YA 2J1UA 4Q4V1 3J26N 1SQ4A 4Q4V2 4OHYA 2XWJB 3WUDA 4YW3A 5FZ7A 2I74A 4QKDA 3IMNA 5A7PA 2W91A 3HMYA 3K3OA 3NW4A 5FY8A 3ZDSA 1HRI3 5FYUA 4FAGA 1AR63 2BERA 1IS5A 5A1FA 1F35A 5ACA1 2LALA 3ZXFA 5ACA2 2VCBA 1NXD1 3AKPA 3HQRA 4OVEA 3MGUA 1ZRCA 4IEWA 3J8F1 4QGMA 3AMHA 3J8F2 2PA7A 5FWEA 3BUCA 4H2AA 4KWUA 5IW0A 3VBRC 5JOZA 4I01A 2RHPA 1C3HA 2GN3A 1EV11 4GWMA 1X8EA 1EV12 1MS1A 4Q2FA 4TZDA 4Q4Y3 5FY1A 1R1A1 1VBB3 1R1A2 2VMGA 4RA0A 4CCDA 5HXMA 2C0ZA 2K0GA 1DYKA 2DU1A 1AYM1 4HN0A 4HZFA 1AYM2 1CONA 4XE9A 2D6MA 3AVRA 4BQYA 2KXLA 1XJAA 3GF6A 1D2SA 2JXAA 1KJRA 1L3JA 5FPLA 2DVDA 2ZEZA 1REEA 2EXKA 3AL6A 2ZKLA 3DKQA 4LO5B 4F83A 5LEJA 1GFF2 3TNPB 1O91A 5ANQA 2CL2A 4C1XA 3NRUA 4IQPA 4EV0A 5I0RA 1RUG3 3VKOA 4EZ4A 2B45X 5L9BA 2Y6KA 3HVDA 3N7JA 4LQRA 4FOWA 2WL1A 3M3EA 5AVAA 3T0BA 3TNQA 4AEDC 4AEJA 4FCAA 2VW1A 3LF7A 5C6CA 3FHAA 3LOBA 1OLRA 4FP3A 1O5UA 3OGJA 5I0UA 3U1XA 3MI8A 5FBJA 5FKBA 1VBC3 3D3AA 3WG3A 1FMD3 1O8SA 4CDUA 1A78A 1GU3A 1EUTA 1ULGA 2WA3A 1SFNA 1PM7A 2ARCA 1ZZ7A 5F3EA 3PURA 1NX9A 1OI6A 2RV9A 1ST8A 3U0ZA 2C9AA 2R043 2YFZA 3KVBA 4QDRA 3ZMOA 1J3PA 4AGRA 1ENSA 1S0GA 2A3XA 2DU0A 1IG0A 1D4M1 2ZGOA 4ATEA 5BV6A 1JS9A 4P9IA 4CDUB 4META 1OUXA 2X10A 4IERA 4QXBA 1JZ6A 4AEMA 4RHV1 1S2EA 2D5HA 3OBAA 4XYXA 2QBXA 3ZN6A 4Y1ZA 4AVSA 2FDJA 2WT2A 1Y9MA 3BOPA 4CSWA 4EYUA 4R4ZA 1SG3A 1J1LA 1E5RA 1ZRFA 5FZ0A 3PUQA 1EAH1 1O4YA 4MO3M 1EAH2 3ATGA 1W28A 4D6QA 4LTAA 2C9KA 5IUQA 4CU7A 1VALA 3POWA 4JQRA 4B3NA 3ZN6B 1OXCA 5HCAA 4LKFA 5CKQA 1DDLA 3MV01 1LAJA 4N9IA 2VOTA 1N1TA 3POYA 3DYOA 1GNHA 4JKMA 1WA6X 1XNBA 4LBJA 2BNNA 4CCKA 1F9KA 5BUVA 4Z92B 3D0JA 5A3MA 5F2SA 1D2QA 1R64A 1UU6A 1IKPA 3EMRA 4MXWA 4QHZA 3ZXAC 1LODA 4AFMA 2RS53 2YYOA 3PMEA 3BCWA 3JQXA 1J58A 3M8LA 5GZDA 1VBA3 2AEYA 3PIGA 3QLQA 2D43A 2GH8A 3QH6A 2RDRA 3S5AA 4QX1A 2WYSA 1JI6A 4ZKTB 3NO8A 5F3CA 2Z2SB 3OUHA 4MUVA 3VV1A 1C28A 1SBFA 1TQ5A 4MXWB 3ZIWA 1RUD1 1RUD2 1W9FA 3KT7A 4PIXA 1HW5A 1FPN1 4UF0A 3ILRA 4N90A 5LW9A 1VRH1 1JH5A 4IEVA 2YROA 3G6JB 4GJYA 1GWKA 4K40A 1IS4A 5FY9A 1QJY1 2RR11 4YARA 5L36A 2RR12 2GC1A 5D21A 1SEFA 4EQVA 5IVFA 3TEZA 4Q4W3 4ZU4A 5F5AA 3OB8A 4K8FA 5FZFA 2Q8CA 2R6QA 2RG4A 4BYYA 3Q9OA 3I7DA 2CAVA 1E5SA 4XF9A 4UF0B 5IAXA 2ARAA 1YFWA 3GBGA 1H8TC 2A6WA 4BJ0A 3JD71 2BPA2 1O4ZA 5DG1A 3S5QA 4OUEA 4YVWA 3VL9A 4UT5A 5FY5A 1F5JA 2YG0A 3UKNA 3GHMA 2XPJA 1E57A 3KCYA 2VW2A 2J1AA 4LO6B 4E2QA 1TG7A 2LW8A 4XOGA 2XL7A 2JDZA 3W21A 3GZAA 2WWJA 4XZUG 1LECA 2G1MA 4YRDA 1NT0A 3RDIA 3ZR6A 3S7EA 2UWAA 2VZUA 4NAMA 4MGKE 3T1MA 2YXSA 4NWVA 3IBMA 4HMZA 2ZGPA 3THPA 3ZX7A 4AI0A 5FDBA 1RC6A 4LO7A 3VD4A 1OA3A 4QQPA 3EJKA 2P2KA 5IT6A 1K5MC 1SFPA 4PDWC 2HYXA 4CTEA 3ZFEA 2DUPA 3K3NA 2D6NA 4N7UA 4Q4X3 2W9XA 2FHRA 1ZRDA 5DXDA 4GULA 1QJU3 3B5LB 4XFCA 4B1MA 1AR91 5I0SA 1AR92 3ACHA 1N3OA 1VPHA 2J1RA 3R0RA 2VMCA 4GKXA 4P5YA 2XUEA 3H42B 5EV7A 2HWC3 3VZJA 4D7SA 2V72A 1TNFA 3MF6A 4DIQA 3AMNA 4U36A 1ENQA 1XSQA 1ZZ8A 5IFPA 1NCQA 4XFFA 4DXSA 4JGZC 5LB6A 4K9SA 3VZNA 4YYOA 2VMIA 4BXFA 3AB0A 4P9JA 4RGGA 3N35A 2NZ9A 4R8HA 1UL9A 1W9YA 2ZZQA 3AYCA 5C3PA 5LRRA 5BNOA 2FZ2A 1QOOA 1GWLA 1AR72 4LBMA 5FMCA 4ASMB 1YQ2A 2Y34A 3AZYA 3NSTA 4LK7A 4S2GA 3NJZA 5K7PA 1AR82 3EBRA 5ANNA 4PJYA 4BIOA 1NCQB 2XOMA 4GMP1 4W6WA 4ASKA 1JHJA 3LKJA 2H0BA 3B01A 5FZOA 4R9BA 3AFGA 4QGNA 4W50A 5CFDC 3O12A 2BRTA 3A0NA 2VMFA 2A5ZA 1ND3A 1AZDA 2NMNA 3I2KA 3THTA 1GOHA 1R091 4MHUA 1PGL2 1R092 1WZXA 1DIWA 4FOVA 3UYJA 2KR2A 3WHTA 4CU8A 4NMIA 1S2KA 2AR6A 2WR9A 4QU2A 2W46A 5FZOB 1G9AA 1S2BA 3VKLA 2EIBA 1OF4A 2WZR1 3K77A 4XEZA 4AI1A 1ND3B 5FK7A 3POGA 3BTYA 3S30A 4XMIA 4BISA 4DUXA 5F37A 4UYBA 5LWBA 1V6OA 2OQ6A 3BODA 1QDCA 4GD4A 5FZKA 4QPIA 1A8MA 1HLCA 2PMWB 1Z7S1 3C3VA 3PU3A 4QD2A 1Z7S2 4XBLA 3NV1A 4QKFA 4FAHA 2DF7A 4WM8A 3FWEA 1IKQA 2FDGA 5JSOA 4BCUA 3L9JT 1UPIA 1CAWA 1Q8OA 3ZR5A 1UXXX 4DO0A 3P1IA 4LITA 1RUJ1 3ZYPA 1RUJ2 4IV1A 4QPIB 3TEXA 4M4RA 3IDEA 2EA7A 3RJ2X 4LLFA 3VBSC 5KHGA 3KSCA 1CAVA 1WCSA 1ULDA 4PBOA 1QXRA 1ENXA 4WM8B 4YZ5A 3RZMA 2VZPA 5LK5A 2B39A 4XCAA 1CAWB 5T5OA 3PLQA 5EP9A 2WSVA 3CQOA 2D7FA 3W5MA 4RN5A 4QB6A 4TTGA 2BUKA 3MHZA 1JYTA 1OLQA 4IV1B 1X50A 5FUPA 5F3IA 4ITCA 1HV0A 1W6NA 5EJ3A 2HH9A 3LA7A 1CAVB 5F32A 5D1IA 5G05L 1PO13 1HB3A 5I0TA 2W1SA 3JUUA 4AQ6A 1W05A 3FN9A 2HWD2 1FI2A 2MHFA 5CAZA 4OHZA 2QDRA 1YFYA 5LBFA 4BK5A 3NL1A 3TRSB 1RUF3 4CDQA 1FYUA 3LB9A 1JZ4A 1W6NB 2QNKA 4WM7A 3WNXA 4AW7A 3AXDA 1QOTA 2WJSA 2PHTA 3Q8CA 2PQSA 1J3RA 4YM0A 4IV3C 4MHRA 4E4HA 1UYPA 4DXTA 1SCSA 1OURA 4NRPA 1V0AA 1UYYA 2IFRA 4NPRA 2WUHA 1JHNA 2YBSA 4XJAA 1BEV2 3ZYRA 2XBO1 4LBQA 2XBO2 2VBPA 4AF9A 4WM7B 1TMF3 2EAAA 2XHKA 4UI9L 1Q56A 4Y5TA 3KQRA 4NOTA 4Q0PA 3B00A 3WT3A 2P4EA 1CESA 1Q8PA 1QQP3 3ZFGA 2YZ4A 5C3SA 4OQ8A 5FK8A 3U75A 1G9FA 3KV5A 4A7YA 2O0OA 3KF5A 4QT6A 1S0BA 2HYKA 4L92A 4AQTA 2VOXA 3OCPA 2JD9A 3LGRA 5JOXA 1W9WA 5GZGA 2WS93 3PMSA 1STMA 4FXGB 3ZFGB 1AL23 1HQLA 3JCIA 4YVSA 1MS9A 3I49A 3M7AA 2HLEA 1G6NA 4YW1A 2MEV2 4GWNA 2DUQA 3GNEA 5FTTC 2XJQA 3HT1A 4WV8A 2FMYA 2Q0AA 2JD4A 3WP6A 3AC0A 4YZ1A 2GNDA 2JENA 2RS11 1OVPA 2YFUA 4DXZA 2RS12 4XURA 3FZ3A 4YVSB 1POV1 3RYRA 1JYVA 2RMU2 3KD4A 2ZX1A 4MLOA 5IVJA 3B93A 2R1BA 2IVJA 3UKTA 2JDUA 5IFTA 5KC6A 3OGGA 1YI9A 4QKBA 2P6HA 1LOCA 4YW5A 1L7QA 4XJ8A 4K21A 1KFUL 2FZ1A 4A44A 4EWEA 1UOFA 1RMU3 4UOJA 4CYDA 4HG6B 1I9RA 3MUZ1 1MQTC 2GC3A 3T4HB 5AFBA 5E88A 5CZKA 2ZGMA 1VP6A 1VR3A 2UY8A 2OQ7A 2VQ0A 1WW7A 5GALA 2WO2A 4KGQA 1CIYA 1SFYA 4B7EA 1US3A 3SEEA 2ZHLA 2PHLA 4IETA 4HBNA 4JDOA 3I3EA 2QTWB 3DF0A 5F3GA 3U4SA 1PIV1 1PIV2 4UBGA 4S2DA 2ORXA 1U5IA 3FLRA 2WSUA 1RXFA 4LR4A 4RFT0 3AJZA 3VGIA 3MFAA 3WSOA 4AAXA 1XB9A 2W0XA 3K4ZA 5IK5A 4CPBD 1RINA 1NLRA 4YW6A 2BEOA 4OZXA 4PIYA 3KMHA 1UMIA 3PHMA 5JUVA 3ST7A 1EPWA 2O8OA 1V00A 1DGWA 1TVGA 2WAAA 3QBQA 3VDDC 2VO5A 1V6NA 1ACCA 4NIIA 5FYCA 5JXGA 2XL9A 3VBRA 1LHWA 2KA3A 4XZPA 4Z8BA 1R081 5LZ6A 4CXYA 1ZRRA 1R082 3BIEA 4Y5SA 2ZXQA 3U37A 3LA3A 4NVPA 2XKPA 1QIQA 2KM2A 4XQDA 4HETA 2IXKA 3VBOA 2DVGA 5F6KA 3WY6A 2VOVA 1O59A 3CKHA 4AFBA 3I8TA 3VBRB 1XPWA 1JOPA 2EF6A 5FMBA 5A3UA 5KC5A 3MZHA 1LHUA 1GR3A 2XKOA 2ZGSA 5FPZA 1GBGA 4NIAA 4OI4A 1NCQC 4KWKA 1REFA 4K8RB 2GN7A 3VBOB 4P5HA 2A6YA 3UL2A 1K12A 4AEDA 3O1OA 1CWPA 3VL8A 3RWKX 2A70A 5T3NA 1B35C 3D4KA 3H8UA 2VVEA 5CFCA 3JBG3 2BWCA 3BKZA 1IZ3A 1BBT1 3R4SA 4QU1A 1RUC1 1UY4A 2R071 4FT8A 4PF1A 4NWWA 4BK4A 4KI5M 1UNBA 3LAGA 3MYXA 2Z79A 3WX5A 4HPKA 1HN1A 1AYN2 1PZ9A 1QJX2 1PK6A 3A23A 1S0CA 3CBNA 3MIHA 1ASJ1 4JHZA 2G19A 4URTA 5A7WA 3WP3A 3VN4A 4C0BA 2VG9A 1ND3C 4HSJA 5CFCB 2ZTNA 2O8QA 3CJIC 3KCXA 3OF1A 3OUJA 1U12A 1XRUA 5F39A 3P6BA 1GQPA 4LEJA 2VZTA 1O3QA 1QXJA 5FAXA 3WW1A 4GWJA 3WF4A 3LEMA 4B8EA 1PK6B 4NUBA 1WW4A 4KU7A 5JLVA 3HBZA 1DQ6A 1DP0A 2PHRA 3IT8A 2PLV1 1CZVA 4HSLA 5CIRA 1YUDA 2PLV2 3BGAA 4LBNA 2ZGRA 3WVJA 1RB8G 1RUI3 2PAKA 5A7OA 4MVTA 5F2WA 3ME2A 1GQHA 2WYFA 3T08A 3VHPA 5C8CC 5CA6A 5J98B 1C57A 4HKWA 4LBOA 5FUIA 4AFCA 1BJQA 4R9DA 3IN9A 1ODMA 1UYXA 3QH7A 2IXJA 1JN2P 2ZX3A 3P5BA 4YM1A 5FZHA 1OMIA 1HXS1 4UBHA 3O1SA 4LHNA 4XDOA 5LA1A 5C71A 2GC0A 2VOKA 3ALQA 5D8AA 1KQRA 4YNIA 2YGLA 3O0XA 2BOJA 3MF9A 1UX6A 1UZYA 1V9U1 4R9CA 1RHI3 1VBE1 5FYVA 3UGGA 1JYIA 3WP4A 3POFA 1GNZA 3T4VA 3LA2A 4Y5Z0 4AQ2A 2NM1A 1W8FA 3OD4A 1RVF2 2VUCA 3DXUA 2CNAA 1I3HA 5A3OA 5JCTA 5CU1A 1CZTA 4AHXA 4IE5A 1JOJA 2LM3A 2SBAA 2ZEWA 3MV11 3ZIXA 1DGLA 5D8AB 3ES4A 3LQCA 2OKXA 3NV4A 4NRQA 5AVPA 1TE1B 1XBFA 2GNBA 3SH4A 2G9ZA 4XQWA 4YFWA 1YI7A 4ASLA 1OVSA 3TN92 2LRPA 1PNGA 5IK4A 2YY1A 3POJA 3MO4A 4W6XA 4DINB 3Q8EA 5GZFA 4F3JA 3BU0A 4YG6A 1W6OA 1O7FA 4Y26A 1TME1 4D7TA 2UU8A 1JMUB 4RD7A 1WD4A 3T2OA 4FQ4A 2QZ2A 5A3NA 2YUEA 1G9BA 3NJVA 1H1IA 2JDKA 2JKXA 2D97A 2ZGNA 3K2OA 4HVQA 2E7AA 2NP0A 5KWRA 2JIJA 1H8TA 4IDZA 2PN5A 3CDZB 1W6OB 3ES1A 2QQVA 3KV4A 3VDBA 1CR7A 2V73A 1LHNA 1OPMA 2AGSA 4HKOA 4XF4A 2CDPA 2OYZA 2HWB1 4I02A 4BMEA 2HWB2 1QMJA 4A45A 4XABA 3JZVA 1A3KA 2Y8KA 1CGPA 1QKQA 1H8TB 1NAEA 1Q43A 1QWRA 1VB4A 1VIWB 2WLPA 3TB0A 3ZFGC 4BQ5A 1XQNA 5IVVA 1QJZA 4AHZA 2HWF2 2WFPA 3C7HA 4XFGA 3VB9A 1GLHA 1PZ8A 3ZYJB 5GM0A 3F95A 1YC61 3I2HA 2DYCA 4JVAA 4FTEA 2R0FA 2WZEA 4MGQA 3DPRA 4CCCA 4E27A 4BQXA 3M4FA 4Q8KA 1I5ZA 3KLSA 4PDWA 4JKKA 2QQNA 3H3ZA 3NJYA 4JZRA 4NIHA 3JB8A 4GMP0 4COVA 2FDIA 4JRAA 1F15A 3FUOA 3A7QA 4YVSC 3PTRB 2LTNA 5LBBA 4AHWA 4D6RA 1CX1A 4YWAA 3MIDA 1W99A 5FYTA 3GHNA 3M70A 2XJTA 1LOAA 4QB2A 1H9WA 3DPRB 4AGVA 2IUWA 4XPVA 4URAA 1WLWA 3KHBA 3NV3A 1H2NA 3ZXGA 4XIKA 3H1YA 2OUHA 4ISRA 4JGZA 4A41A 5I0DA 1F4AA 2HBTA 3CIHA 4QPWA 1KGYA 4A4AA 5DPNA 2ILMA 4OUMA 2QUOA 5DDJ3 4Z2AA 4CCJA 2X5IC 3KB5A 4FPYA 5IHRA 4I09A 3D6EA 4O9GA 2V4VA 3K4DA 3QD6A 5T5PA 5C7GA 2VCAA 2BWAA 3IIAA 4E4ZA 4Y24A 2J1SA 2Y0IA 3FLTA 4JGZB 1SDDB 4BA6A 3BTXA 1V6IA 3SXWA 2BOIA 2O1QA 2BQPA 1YJLA 1NLSA 1H0BA 2R061 3CHXA 4XQ4A 1VMJA 5CFDA 1O3TA 2P5BA 1BYHA 1GSLA 1JZ8A 1ZREA 4BU2A 2ZX2A 1OPOA 2Z42A 1Y4WA 3WDYA 1X9PA 1JXNA 4EZHA 1NQDA 1HQWA 2XDVA 1UU5A 3LDKA 3T09A 5I8TA 5EWSA 5HCBA 1DBNA 1PGW2 1UOBA 2BBAA 4H14A 4OZOA 2VC9A 3LWCA 4TLGA 5FYYA 3H8RA 1JTZX 4BQ1A 5CFDB 1MEC1 2LS6A 2ZGTA 1MEC2 3FFZA 4CP1A 1HRV1 1ZBA3 3GALA 3I3BA 2CGPA 3NAPA 2HWE1 2VZSA 2HWE2 1UZ0A 1RUE1 1ZBE1 5ACA3 1ZBE2 3WP5A 1PMJX 3IMMA 5A33A 1BK0A 2AH2A 2OS2A 1RIRA 5GLVA 4RQPA 1H6XA 1LKNA 2BGPA 3WF3A 2CWMA 2J1VA 3O0WA 4Q0QA 1SCRA 4ZU7A 3NAPB 3ZXEA 3VHOA 3HNYM 4P9GA 1R1A3 2ET7A 4CUAA 2X29A 5DAPA 1AYM3 4OULA 4CCLA 5A33B 3LEGA 2ARXA 3HAGA 3VBSA 1DF0A 4RQPB 3B02A 1OLMA 3VBOC 4JTOA 3W59A 3SC7X 1W2UA 3S57A 3RPQA 1JZ3A 3ZYIB 3MLKA 1Y9GA 1HRI1 5DUUA 2QZ3A 1AR61 2E7TA 1A34A 1IQAA 1D7PM 1T6GC 1AR62 3VBSB 5KXEA 3HEIA 3KQ4B 5LATA 1OD3A 4YM3A 2PFWA 4XBQA 4I0BA 4Q0VA 3OY8A 2HEYF 3WNNA 2WN2A 3LDBA 5LASA 4FFHA 5FXVA 5CFCC 1ULFA 4AFAA 3DCQA 2WC2A 4Q4Y1 3NWKA 4Q4Y2 1BKZA 1VBB1 2Y6JA 4IV3A 3BN6A 1PK6C 2FCVA 1XNKA 4BIFA 3U07A 3N36A 3OY8B 4IXLA 4K6BA 4IE7A 1GV9A 5A6ZA 1D4M2 4QB1A 3AKQA 3WCSA 2XUMA 5GJ6A 3N7KA 3OPWA 4QX2A 4RHV2 4CPBA 2WNUB 4IV3B 1WUVA 5DZGA 1M06G 1DGRN 1EAH3 1POV0 4Q1RA 5C9AC 5A80A 4Y1UA 5JOYA 4GQ7A 2E32A 3IIIA 2D6OX 1OQ1A 2QCSB 4CEYC 1GMMA 1VBC1 5FREA 2YGMA 3T2TA 2WNOA 4YGEA 3T2PA 4M3CF 1WA4A 1PMIA 2DUOA 3E5QA 1K45A 3AFKA 3PIJA 4CCMA 5JXJA 1L7LA 1G9DA 2NLRA 3ZN4A 3ZKUA 2BNMA 2DBIA 1GICA 2R041 3HN3A 2R042 3JXSA 4QQHA 4UFLA 4YZ3A 1UOGA 1GOGA 1U0AA 2Q5TA 2QQOA 2FD8A 2PHWA 2JG9A 4ZZ5A 5D8AC 5JPNB 1G7YA 1BQPA 1YFUA 2E7QA 3SH5A 3WCRA 3VBHB 5FZMA 2CHHA 3WHUA 2VVFA 4JAAA 5FZ9A 5JPMB 5L19A 3VBFA 1CZSA 3MUY1 2W1UA 1WCQA 2XMLA 2JG9B 4IEQA 4Y33A 4YG3A 2VU9A 3LFIA 4G4FA 2R16A 2XLFA 4K1ZA 3MEPA 4HXCA 2JICA 4KBBA 5EQUA 3NVCA 5CEHA 1RJ8A 5JR2A 5ABJC 1OKOA 1FATA 3FFQA 1POQA 3A22A 3TWIA 3VBFB 2RDQA 1KJLA 1FPN2 4CU6A 1MQTA 2E63A 4Q0SA 3PDQA 2Q8DA 1VRH2 3ZPYA 2Q30A 2E53A 1H4HA 1QJY2 5FMDA 4A7ZA 1GP6A 4EWAA 1H2KA 4UFMA 5IK7A 2E51A 2ZEYA 2RS51 1UY3A 2RS52 4OHXA 2D98A 4NPLA 1LB2A 2ZAAA 1GUIA 4XHBA 1VE0A 1VBA1 4JV4A 3S6PA 1MQTB 1C5HA 3OG2A 3UT0A 2VZ3A 3JD72 5GLUA 1DGRA 3J4UH 1LOEA 5CYYA 5EZWA 3ITQA 4LE3A 3R05A 2VZ1A 2XGXA 4NJ4A 3SCGA 1LOFC 1W8NA 2QVSB 2VNRA 2AENA 4QHOA 5LY2A 1Y9QA 3N9OA 3H3UA 3P3PA 3AP6A 5F5CA 2KD7A 3BOWA 1NUKA 1OSGA 2ZGUA 1GYKA 2XLGA 3K51A 1BVP1 1GZTA 4FFFA 3AX4A 1UIJA 2D5FA 3FL7A 3DGTA 3VDDA 4C8DA 1OC1A 1FT9A 5CNAA 4Q4W1 3UGFA 5F1RA 4Q4W2 2YC4A 2R30A 3DPRC 1YFXA 4BLIA 3WLUA 4BZ4A 3HOBA 2Y6FA 4MG2A 3VDDB 2VZOA 1YRZA 2OX0A 1CIWA 3CZUA 1HDKA 5F8PA 1Z78A 2QE3A 2W92A 2GMPA 3VKFC 1QH6A 5LK7B 4DS0A 5JZGA 1AR73 1XNAA 2Y60A 1G9CA 3RWNA 4L2NA 3RZZA 1IS3A 1SLCA 4DY3A 1AR83 3ACLA 1HN0A 4DRRA 3MDPA 4KBZA 3WF0A 2W95A 5T54A 2F4LA 1B35A 2CU5A 2PQQA 3N7LA 4Z2WA 5HBAA 4GMP3 2ZS6B 3C2UA 4QQ2A 3T2QA 3OUIA 4JCKA 2IVIB 5T50A 1O6UA 4E2SA 3E6BA 5JZGB 4KGGA 5J09A 5DAWA 4DRVA 4Q4X1 3SHRA 5DUXA 4LKEA 2YMZA 4WBBA 2ZOEB 1QJU1 2VTFA 2GC2A 1QJU2 5FUNA 1W06A 3SLIA 2Q4SA 4OQ9A 2W87A 4CXXA 4COUA 1AX0A 4XDQA 2H0VA 4M00A 1B35B 4XFBA 3IKWA 4XJWA 3GCWA 5J7MA 5A32B 2HWC1 3SCFA 2DCTA 4HKLA 3CJIA 1O4TA 1EY2A 4XUPA 1W90A 2ZPXA 1V6KA 5FZDA 1AXZA 2BZDA 4FTSA 1KD7A 3HNBM 4FPHA 3T0DA 1DCSA 3AMQA 5J37A 2XB6C 4BWOA 3R6SA 3AYAA 3I2DA 2VOWA 1YCIA 2LUWA 2RDSA 2D40A 1QJFA 2WZR2 3NAPC 5C70A 5JWPA 3CJIB 2WLQA 1XC6A 4HN1A 3OPZA 5FZ8A 3LCPA 4UXAA 4A6SA 5C8CA 2J42A 3CU7A 4NHKA 5FYMA 2WNVC 1J3QA 2GMMA 2NPIA 3IDCB 5FPUA 4RQPC 3AMPA 4GKYA 4PLNA 5L9RA 1B09A 3B7MA 1NG0A 4LIUA 3NNLA 5T5LA 4CDXA 3AJYA 1ZM1A 5C8CB 2GALA 1XYPA 5DABA 3H8OA 4W6YA 1WWYA 4QX8A 2PXJA 5A1LA 4M01A 1MPXA 3CMGA 5LEKA 2FQPA 1LGBA 3AKRA 3OEAA 1UKGA 4KNCA 3L2YA 1FNYA 3RZJA 1WCUA 5FRAA 2ERFA 3RVHA 4AVVA 1UOJA 4CDXB 5A70A 1J83A 3KS7A 3X29B 3FLPA 1UU4A 2SLIA 2VAUA 3FBYA 4DEQA 1KEXA 4J1XA 2CGOA 2HWD3 3WEZA 4EN7B 4L8QA 4UFKA 4BQ4A 1RITA 5HV4A 3I3QA 4MSVA 2P3JA 1K3IA 4AWDA 5GKAC 2VMEA 4WZFA 5CKNA 2AUYA 2WQ8A 1VAMA 4WVVA 3N9MA 2YU1A 1FOD3 3NKTA 3LIHA 2Y0OA 1WCKA 3ILNA 4ZONA 5KXBA 1YNAA 4KMQA 1MZEA 2D3RA 2WNUC 3NKGA 4XUTA 5FCCA 1BEV3 1DGWX 4XFIA 3ZO0B 1QXPA 1YO8A 4NR1A 2YBKA 3ZLIA 1A8DA 2HKXA 2JE8A 3RMXA 3O1UA 4FP2A 2W52A 2UURA 4G9SB 1YLLA 4HFSA 4LK6A 2MPFA 1LULA 3FHIB 1PO11 3PVOA 4DQAA 4V2WA 5FBZA 4CEWC 5J96B 3MIGA 5EJ1B 4D3WA 4GJZA 1O3RA 4B29A 1QU0A 2CDOA 1UAIA 4ET7A 2OA2A 2XVLA 5HV0A 5SV5A 1RUF1 1GKBA 1UN1A 3H0OA 1RUF2 2EXHA 2PTMA 1S0FA 3HQUA 3IWZA 3D5OA 2JKBA 3VBHC 2MEV3 4QXCA 3A4UA 4FFGA 4YM2A 3HIFA 5DMYA 1IGOA 2ZJCA 5A7QA 3S0MA 3ENRA 3CNAA 4XHXA 2WBKA 3OOXA 1DQ1A 3ZSJA 4GH4C 1X8MA 1S0IA 2JG9C 4U2AA 4D7YA 4EN0A 5GLTA 5FLIA 1W2TA 2RMU3 1TMF1 4LA2A 3D8CA 5CG9A 1TMF2 5FZIA 3KZ4C 2YC0A 3ROUA 1RUH3 2WABA 1D0HA 3NQHA 3VBFC 2A6ZA 3ZFFC 1UY0A 5HCHA 2QQPA 1QEXA 1COV3 4YGDA 2GZWA 2R1DA 2ZKNA 1S0JA 2B9UA 1WW5A 2X5IA 5I93A 5IATA 2J1TA 3LOIA 1LESA 4YSFA 4KH9A 5FIXA 2WS91 1G8WA 3AP5A 3LIGA 3LZZA 4FPLA 4W4ZA 5JSRA 1AL21 4MGZE 3VBUC 1BVVA 2DCJA 2OPKA 1LU1A 1H2LA 3MBWA 2Q1MA 3N9PA 3F2ZA 1HV1A 3BALA 3MPBA 1QY4A 2IZWA 3LSEA 4N43B 2X5IB 2EIEA 1XE7A 4FPOB 5K0UA 1JZ7A 2AC1A 3I54A 3ORJA 3I2OA 3A0KA 2DTYA 4C1WA 1PIV3 3AKSA 4L99A 2VCCA 1ZYBA 3APBA 2ZHKA 3MIEA 3ON7A 3I2JA 5LA0A 1RJ7A 3K4AA 4AE2A 1DQ2A 4B4PA 2VUAA 1NA1B 3U78A 2DDUA 4DY5A 3HNMA 4YZ4A 4ATFA 5K0UB 1K42A 2GNTA 2WFF3 4R52A 1W8UA 4LUKA 2ADDA 1FX5A 3POIA 3PVEA 4UW6A 4UW4A 4FPKA 3FJSA 3KCCA 5JAXA 1RMU1 2W3JA 3AYEA 3M3CA 1V6JA 3POSA 1DYOA 5F5QA 3O1TA 3OEBA 4CVUA 1BZWA 5F5IA 2J7MA 5LBEA 1R083 2RM23 2VQTA 2ZX0A 4L11A 2PHDA 2Y33A 3J7NA 4EROA 3GZEA 4SLIA 4ZPIA 2GNMA 3WNLA 2CTVA 1DLCA 1W0OA 1W03A 3HT2A 3WV6A 4B7KA 5J36A 4AFDA 3UESA 1UCXA 2QDNA 5A3LA 5CADA 1JYWA 4ZXKA 5DAXA 3ZSLA 4XMAA 1BHGA 3SNMA 4PCRA 3WDUA 4N8MA 1S4CA 1XNTA 4HANA 4OLLA 2G4IA 4DOUA 2JX9A 1WKYA 2AEZA 4FPEA 4AVAA 2UY9A 1EYBA 5JZGC 5F9TA 1N1SA 4TN7A 3LPFA 4Y1YA 5H9RA 3RJRA 3T30A 2WAOA 3USUA 1NCRC 5C8WA 1IHMA 1N1VA 2V4AA 1BLZA 1XYNA 1YJKA 5FY7A 4C0HA 1MZFA 3WG1A 2OUJA 4QMAA 2R32A 1NE4A 1ULCA 3SEPA 3WZ1A 1AYN3 4MZUA 1QJX3 1BBT2 1PO23 5DUVA 5M0TA 1RUC2 4EN9B 2P3KA 2R072 3OPTA 3ZYFA 3HD8B 2W94A 3H9AA 3USUB 1D0GA 5LY1A 1LNSA 2JDHA 2UYBA 1UO9A 2RS33 3PVNA 4NO4A 5EYYA 4N7IA 5FYSA 4Y1VA 1ASJ2 2QQJA 4HVOA 5IVBA 2RJLA 2YV8A 2TUNA 2VBDA 3OD0A 3O7OA 4I0WB 2ZCWA 4TSVA 5LCWL 5FJKA 3W20A 3JU9A 1UX7A 5FXZA 1H6YA 1UZVA 1NOVA 3EHKA 4Q27A 2FBEA 4V1PA 3BB6A 5FPAA 4PBPA 2ENRA 2QJVA 2YPJA 4BB3A 3UNPA 2OW4A 2DCZA 1W8ZA 2D3SA 1W8TA 5C9AA 3WG2A 1AF9A 5B4NA 1LENA 5FZCA 1I1EA 4CEYA 5K9YA 2OZJA 1WMFA 1XNCA 3E1F1 3GJAA 3JBG1 2QQMA 3JBG2 3K48A 1LR5A 1KDKA 1ZNPA 1IQDC 3CL1A 3GBWA 4IEZA 1AHSA 1IPJA 2K2SA 2VPVA 1KFXL 1RL3A 1MR5A 2TEPA 3FE5A 3AP7A 2H6BA 2WKKA 2D3PA 4OCTA 3WD5A 3ZSEA 2IC1A 4INDA 4B4QA 5C9AB 1PZ7A 1HXS2 1SDWA 4ES8A 1C4RA 4QAWA 4PQQA 1WD3A 4CEYB 4IGOA 1VRBA 5A6QA 4CDXC 5FLJA 5JIAA 4AI8A 2R0HA 1CVNA 1RVF3 2L9LA 5LRSA 1NE6A 2E9QA 1V9U2 2VGDA 4QM9A 4XC9A 5FY0A 1VBE2 1UIKA 4N53C 5I8SA 5AC93 2QQKA 1MACA 4PT6A 1AUYA 4ZU5A 1SPPA 2VECA 2DBNA 2ORZA 1S1AA 2DV9A 1LEMA 4JTNA 4BDVB 4GIQA 3BU7A 4GA9A 3Q8FA 3WW3A 3TN93 1HX6A 2JIGA 3B3QE 1OQEA 5ABJA 1C8M3 4BHPA 5IYYA 2B9VA 5LA9A 4XDPA 4ZY9A 3LFMA 4BQ2A 3BI3A 1OKQA 4QQLA 3HR9A 3WQ7A 1SPPB 3RZGA 1H1MA 3AZWA 2A3WA 3H7JA 1DU3D 4A7KA 2D6KA 1CN1A 5FP9A 4I0AA 4P14A 1TME2 3VZKA 3K46A 2QQUA 5SV8A 3ZSMA 5JR7B 4LXLA 5FYHA 5ABJB 1RHI1 4AI9A 2X09A 3UKVA 5FZ1A 2WZ8A 1PVC3 4FSJA 2BP6A 3RSJA 4B1LA 2BVBA 2VH9A 2EIDA 4MX3A 3ACGA 1RUNA 3VUOA 3OBRA 4RL7A 4J6GA 4QDQA 3DECA 4WVWA 4FPGA 2BV4A 4XJ9A 1SLTA 1LOFA 1T6BX 2LROA 1NQJA 1SLAA 4IEXA 1JZ2A 3Q8AA 2V5YA 2HWF3 4CCNA 5JXIA 5BPXA 4EN8B 1DZTA 4FPJA 1BMV1 1BMV2 4FXKB 5EPAA 5IAVA 5IVEA 1W0NA 5EFUA 3GZTB 1Q8QA 1BCXA 3GZUC 4LULA 3M1HA 5BNNA 3INAA 3B9IA 3EQEA 4OFGA 1GNYA 3ZYHA 4I3GA 5FXWA 2R7EB 2X8KA 4IUGA 1WMDA 1AL0G 2BW8A 2BBVA 1JU4A 1UXZA 1EUUA 3DN7A 3N9QA 4Y20A 4XXAA 3TAYA 1Q3EA 3RI9A 1GP4A 4IL7A 1W2OA 1UZWA 1GANA 2W47A 3BYWA 4CUBA 4LIVA 5B4XA 5GLWA 4CXWA 2EAKA 3VZOA 1URXA 4HK9A 5BNNB 1XSRA 2ATFA 1WW6A 3TEWA 2ZMNA 1UW8A 3KGZA 2IXHA 3I97A 3V65A 1ZZ9A 5A3PA 3NNJA 5I91A 1NZIA 3UJOA 4ARXA 3ZSKA 4QM8A 4EJRA 2W68A 2XJVA 1HB2A 2VZVA 4Y20B 5T55A 2YPDA 3UK9A 4DZGA 4AG4A 1Y7BA 3KM5A 3WNMA 5FZ6A 4ZZ8A 2VE1A 1VBD3 1W39A 2XQRA 1TNRA 4MGTA 2XVKA 4J1WA 3VD3A 1DQ0A 2WRAA 5CBLA 4OYUA 1OOPC 2C5DA 4N43C 5FP4A 1C1LA 1PNFA 2EIGA 2YU2A 3EYPA 1SMVA 4KWJA 4Q29A 2J1EA 2VNGA 1YIFA 3T0AA 5C3QA 2ZGQA 2IWGB 2E31A 3DYPA 3WNPA 1W0PA 3MIFA 2VD7A 3C7GA 1NA1C 2R062 5FYBA 3CZJA 5FZLA 2JE9A 4E9KA 4F8AA 5K0UC 2X05A 2X53S 3D0SA 4B4RA 1DQ5A 2ZGKA 4JHTA 2JB8A 5DZFA 3PVBB 1MEC3 3PJYA 4NROA 4Q4V3 1W9SA 5LBCA 2BFUL 1LHVA 4PI0A 5JXHA 1UKRA 3DYMA 3SISA 5BNPA 1SLLA 4NN0A 1HRV2 2JG8A 2UYAA 3MIBA 2VZQA 1W8OA 3POEA 4D94A 1SHWB 1TEIA 1RUE2 5GZCA 2WNEA 3H1MA 4TWTA 4YW4A 4CDWA 4QXKA 2WT0A 2WNVA 3WUCA 2CAUA 4C91A 4XF1A 3J8F3 1ULEA 4MGYE 3E6CC 3WR0A 1KRIA 5BNPB 5J48A 3MPPG 2A6VA 2JG8B 1IPKA 4NAOA 1EV13 3TEYA 2GP3A 1D4VB 3H8XA 2W08A 3W58A 1OD5A 4AVTA 4CDWB 4GB31 1BK1A 2WNVB 2Z5WA 1UMZA 4GB32 4LBQD 4RS5C 1ZZCA 4UFHA 1JU3A 2A71A 4NHYA 2FDKA 3GBFA 1W6MA 2Z4FA 2VQAA 3LD8A 1MVEA 1MS5A 2E26A 1ZBA1 1QOSA 3ZXLA 1ZBA2 1ZVFA 1OT5A 3IAPA 3USSA 2A1XA 2VJXA 3G7DA 4FOYA 2XQXA 2XVGA 1KXGA 3NNMA 1HRI2 2JDNA 1PM4A 4XTMA 2R49A 4IEPA 4O9EA 5DG2A 2CSGA 1W6MB 1UD1A 3ACFA 4AR2A 4AVCA 5H9QA 2BTVC 1LOBA 2A75A 5A3WA 3V56A 4JQTA 5E6HA 3UV9A 3ZKYA 4BQ3A 1OQDA 3U4XA 3KF3A 3ASIA 1OA2A 4M4PA 3IDAA 3M3QA 1VBB2 4LBKA 5DQ0A 2WNUA 3I2FA 3MFCA 1PGSA 3LPGA 4OHWA 1D4M3 1AJOA 2DWRA 2WQZC 5FO8B 1PX4A 4SBVA 3VHNA 3K75B 4CE8A 4RHV3 4JGYC 2B4KA 3MW4A 4H7MA 3KV9A 4XACA 4Z82A 1W8WA 2ZBJA 4TYSA 1RUG1 4P9LA 1JW6A 4A42A 1F4HA 1RUG2 5CKMA 4AI2A 2P6CA 4D0QA 4Y1XA 2WINB 5E1RA 4A2UA 2DFCA 1LJ7A 4CEWA 4CUGA 2JDPA 4AHYA 1WMXA 2BDRA 2EALA 2NN8A 4YLZA 2DVBA 1US2A 3QCWA 4BQWA 1Y3TA 3SITA 1EPZA 3PUHA 4Y4RA 3OYWA 4IEUA 1FMD1 1VBC2 2VMDA 2QQLA 1FMD2 3ZM8A 3HPNA 4MOAA 1LOGA 4BH9A 1QNYA 1X33A 3VBHA 4ZHNA 2V5DA 5HXVA 4JRLA 4CEWB 2DCKA 4L9BA 4AQSA 1W2AX 4IGPA 1M4WA 1VJ2A 4GH4A 2XJPA 3VLBB 3OYWB 3DV8A 1DYPA 5HI0A 4HK8A 1PX3A 4XJUA 4M0HA 5KXCA 2JDYA 1IG3A 4PLOA 1YQ5A 5C5TA 2V09A 4UFIA 3ZFFA 1CJPA 4YGBA 4GH4B 1WLDA 3PNAA 2ZACA 4G3YC 1RUD3 2E33A 2N7GA 5GZEA 2ZEXA 5EJZB 1FPN3 3ZMNA 2Z69A 3NNGA 1VRH3 3C7OA 3ECQA 5KHJA 2WWUA 1X7NA 3AM2A 1QJY3 2A73B 2RR13 2BVVA 2WO3A 4XILA 4RYDA 2BNOA 4WVZA 3SMHA 3VBUA 1OHFA 4MXVA 3ZFFB 1OH3A 1V6MA 1WLCA 1YYNA 3I3MA 5HPOA 4JDMA 1LGCA 2FCUA 2C6SA 1PHMA 4XW3A 3ZXDA 5EYXA 4A6OA 1CX4A 2ET1A 5FP7A 3CF6E 1HJFA 3JD73 4K7JA 4Y22A 3H1WA 2HJIA 5JMCA 2ZGLA 4YW2A 1Z0HA 3VBUB 4XXPA 4NIGA 3RNSA 1VBA2 4FQZA 4OI2A 5KHKA 5K4LA 4XTPA 5H9SA 5C4WA 1JYXA 2C4XA 1Q8VA 1W3XA 2XJRA 1QHDA 4HONA 3ABZA 4Y22B 1Y43B 3OTFA 3ZOIA 2RJKA 3DL3A 4BOWA 2YC2A 1MZ6A 3WXPA 1C5IA 4NHMA 4AK3A 1S55A 1APNA 1UF2C 2D6LX 4LLOA 2FCTA 4P9XA 5FV3A 5C4WB 1JZ5A 4LNVA 5BNNC 4RFRB 5A7NA 3S7IA 4OHVA 1NZCA 4Q8LA 4XF3A 4GZ9A 4QX7A 1LRHA 1UZZA 1HB1A 3AMMA 3AYDA 2Y26A 3FBMA 1AR93 4TLFA 1IPSA 2VNOA 2WO1A 2W1WA 5FZAA 4UW3A 3W9AA 4LBLA 4UFJA 5APAA 1MVQA 1YQ6A 4KG8A 1SZBA 5CB7A 3ACIA 2VY0A 1U5YA 4LE4A 4QPGA 5C5UA 2AZ5A 1OFNA 2HBUA 3BTAA 1FNZA 4YVWB 4P9WA 4CUCA 3V0AA 1WBLA 3RYKA 3KHCA 2H6CA 2XJSA 1GZWA 4DNYA 3PL0A 3U14A 4YFZA 1NCRA 3SKVA 3O1PA 3UETA 5J3UA 5D2AA 5DAVA 1REDA 5JI7A 4FPCA 4IE0A 4QPGB 5L73A 1HIXA 3THDA 2CY6A 2DFBA 5A32A 2AYHA 5JI9A 5GLZA 3E5XA 5FO9B 1V70A 2BGOA 2G9GA 4COWA 3V0AB 2VL4A 3IAQA 4LHKA 4W65A 2ID4A 4NIDA 1ULOA 2CYFA 1QDOA 3ELNA 4E4DX 1GZWB 4Q4X2 1DZRA 1N3PA 2F17A 4E4SA 4LHSA 1NCRB 1ZZBA 3WQBA 3Q8BA 3ZFEB 5L7OA 4LUMA 1R093 5KBFA 2AREA 4ORFA 4E8DA 2K9ZA 2GP5A 4Q1PA 3WF1A 5KHIA 4FTBA 5CISA 2HWC2 5HCFA 3WDWA 2Y64A 3AP9A 4NHLA 4WVMA 1AR71 3LSDA 4FPFA 2WZR3 2A6XA 2PAMA 2Y6HA 4JC1A 1IOAA 1AR81 5B2GB 4ZS3A 1JOBA 5BNPC 3BPSA 5L7OB 2VMHA 5A7WB 5JSPA 1H30A 4OUSA 5J1XA 5KR7A 2JG8C 2PYTA 2FMDA 3RZHA 4PLMA 3VHRA 1Z7S3 2VVDA 1ND2C 1AVBA 2FDFA 3RQ0A 4WVMB 2BFUS 2ARBA 1NLQA 1J1TA 2B8MA 3HBKA 5E89A 4ZS2A 4CDWC 3NMBA 4NRMA 5JDBA 2JEMA 1PGL1 4DFSA 5H9PA 1RUJ3 2JWPA 3KV6A 4GAZA 2BU9A 3SQOA 3J7LA 2Q8OA 3O1VA 1JUHA 2TNFA 4TXWA 3WQ0A 3V0BA 2DCYA 1F2NA 2A3YA 4QWNA 3WG4A 4N53A 1AJKA 3QACA 1JUIA 4IE6A 3RG0A 5FWJA 2YHJA 3C7FA 1ZA4A 1UY2A 2VTXJ 3I2IA 2AACA 3T3YA 5K8SA 2O14A 4O7XA 2VR4A 3IZOA 3MW2A 2NMOA 3RS6A 2IFWA 4RR3A 3RGBA 3SCHA 4KU8A 3VKMA 2DVFA 3HQXA 5DZEA 3V0BB 2Y6LA 4YG0A 1GWMA 1Q8SA 1UMHA 4N53B 5BNQA 3AKTA 1RGSA 5E16A 1TZOA 1R1ZA 5FMOL 3RYPA 2P3YA 2WT1A 2Q1FA 4YW7A 2UWCA 3VD7A 4FVVA 2XR4A 4RR3B 2WA4A 4XIOA 4OI0A 4ISQA 4XUOA 1A6CA 5FPVA 4XUQA 3PTYA 2RJ2A 1MS0A 2I2SA 4FI9A 5FJHA 4XFHA 4M3CE 5JVVA 3PU8A 1ZX5A 3MLLA 2D93A 4XFAA 2B42B 2XBO3 3GYDA 2DURA 4IE4A 3ZVXA 4YZ2A 4HOOA 3AZZA 4LORA 2VUJA 4E2GA 4XCBA 1LHOA 3C8XA 4P08A 3O14A 2HWD1 1C1FA 5DN2A 1LCLA 3VDCA 2VQUA 1RXGA 1AX2A 1PO12 4RGKA 1QF3A 2ZAHA 3WF2A 3AP4A 4Z1VA 1RYYA 4FOQA 4CDUC 5KXDA 1LU2A 2BYVE 1WCDJ 2K46A 4DMIA 4H55A 1UYZA 1WLTA 4AOCA 2C24A 1E5IA 1FOD1 1GZ9A 4R9AA 1FOD2 3GM8A 4HLTA 1FV2A 5EXOA 4IGQA 1KS5A 1H9PA 5FR3A 3N9LA 2E6VA 1BEV1 3JQWA 1CQ9A 1YXWA 4CDQB 1DZQA 2PHFA 2WZPP 1CPNA 2WIIB 4C90A 5JOWA 1CJDA 1JODA 5FY4A 3HJRA 3RMYA 4CP9A 2RS13 2ZHNA 1S0DA 3ZN5A 4X6QB 1POV3 4ONUA 4XAEA 1HB4A 1QQP1 2ZABA 5BY5A 1QQP2 2CGNA 3LEKA 4LBQB 3VKNA 4CRQA 1N1YA 3WDXA 1ONAA 1DQ4A 1UY1A 3EB7A 5KHHA 1LGNA 1OOPA 1IS6A 1ZZ6A 4CP9B 4N43A 1BXHA 1UWWA 4QX5A 5CVRA 2CV6A 2JDMA 1EP0A 1MS3A 3A21A 1H2MA 3URFA 3ZXJA 4DEVA 4F7ZA 2MEV1 2XHNA 4NPMA 3WNKA 4QHBA 2WS92 2F6BA 1F8VA 4R4XA 1ENRA 1AL22 5EHDA 4BXSV 4DPNA 2Y38A 5T52A 4HL0A 4AXOA 2QKDA 5BYNA 1NA1A 3ZYBA 2IXCA 1FAYA 1OOPB 2IXIA 1F5FA 3O0VA 1JBCA 5IVYA 2RMU1 1O3SA 4AVBA 5BNOB 2BGCA 4K1YA 4K3UA 5FZBA 3ZXKA 1T2XA 4JKLA 1W9TA 2I07B 1NKGA 4OMCA 4EN6B 4MYEA 1RUH1 1W6QA 5AFEA 1RUH2 5A6YA 1LTEA 3AK0A 4A3ZA 4S2HA 1H8VA 2ZX4A 4K20A 1CPMA 1COV1 1COV2 3D82A 5FYZA 3RRDA 3UGHA 5C4WC 1RMU2 4IEYA 4NHXA 5DAQA 4LJHA 1MS4A 2PELA 3W5NA 2F4PA 1E5HA 3BIWE 2VTXA 1KDMA 3LEIA 4KL1A 4O61A 1W6QB 3WDVA 4H7LA 1YQCA 4QX3A
chains in the Genus database with same CATH topology
4X8PA 1JYCA 5FFOC 1DHKB 4Q0UA 1YWKA 3N4MA 3MICA 3OBTA 4H3WA 4JDNA 2GAUA 1DFQA 1NYWA 1DLLA 1YIPA 2W39A 1X36A 2B7YA 4Z07A 4YVWC 3I4IA 2I45A 4RS5A 3N7MA 4PQ9A 3TOJA 1LEDA 1N47A 1XNDA 4LHLA 1W6PA 3SH3A 2XLAA 4XETA 2WFF1 2ZMKA 2WFF2 3VZLA 4QPGC 1WMEA 1WGPA 2B46X 4RS5B 3TYJA 2XJUA 3R4DB 3WQ1A 1AXKA 1YHFA 1W6PB 3CLPA 2RM21 3JB4C 2RM22 2JECA 3B69A 1BBT3 1DG6A 3ILFA 3PJQA 1RUC3 3ZFEC 2G9FA 2R073 4A3XA 2PHXA 4P9YA 4AI3A 4FBFA 4XBNA 3V64A 3FC0A 1ASJ3 3L2HA 4S2FA 1RUOA 1FXZA 5FO7B 1SLBA 5L7OC 4DB5A 2WQ4A 4M0NA 4JGYA 4IEOA 4COZA 3KT1A 2OVUA 1SBEA 3B94A 2HEVF 2HEWF 2EVXA 1CAUA 3U10A 1H1AA 3KT4A 3M2MA 2PLV3 4HVRA 4QQOA 3MLJA 4KWLA 4UW5A 1AXYA 4BM8A 4EWDA 1GZCA 1G86A 3O5SA 4M3CA 3MW3A 3M3IA 4JGYB 3WOGA 3U11A 1AYN1 4BPZA 1FV3A 1QJX1 4CP0A 4AEDB 4AYUA 3R4UA 5JIUA 1PO21 1CAUB 1PO22 4YGCA 3QOPA 1HXS3 1NY71 1NY72 1QH7A 3OJBA 2RS31 1MS8A 2RS32 2ZA9A 3IM0A 4M3CB 1VLNA 5C33A 3HWJA 1V9U3 2VW0A 4HPKB 2EXIA 1VBE3 1U5ZA 4L97A 4GALA 5T5JA 4QPYA 4RGAA 4CP2A 5FOJB 2CWSA 2PAEA 4LT5A 3CJXA 1SLIA 1HQNA 2GU9A 2Q1ZB 1RUI1 3AXEA 4GXLA 4QPIC 1RUI2 4RR3C 2GMEA 4WZCA 5FLHA 1V6LA 3BPZA 3DKWA 1C8NA 4WM8C 4Y4YA 4X6RB 2XH6A 4CZSA 1Q5OA 1TME3 3EO6A 3J9SA 5FPXA 1QGLA 5I8YA 2ETEA 4IV1C 1SACA 4I2OA 3FX3A 1RVF1 4BMBA 1I6XA 3VZMA 3E97A 1RHI2 5AC91 1AX1A 1WBFA 5AC92 5FMOS 5CG8A 3CEWA 4KQ7A 3DUIA 4MV2A 4RSUA 1UPSA 2HWB3 2P17A 3TN91 4COYA 2UWBA 4HT1T 3WW2A 5IK8A 2PHUA 1ALYA 1C8M1 3T1LA 4IESA 1C8M2 2C1FA 2NQYA 1HKDA 1X82A 1XU1A 1F31A 5E8AA 1VB2A 2YDEA 4CDQC 3EXUA 2A7AA 4PF5A 4WM7C 5F6LB 2P3IA 2P37A 1XXNA 1PVC1 4MH0E 1PVC2 3FMGA 3CO2A 1VAVA 3IPVA 4I30A 2ZMLA 2NYYA 4OI1A 2JJ6A 2OIIA 3E5UA 1GQGA 1N3QA 4XF0A 4LO4B 4N9HA 1S0EA 2HWF1 3IPVB 1XE8A 4Q26A 2DVAA 2RE9A 1RTVA 2ES3A 2MNGA 3AZXA 3HN1A 2XWBB 1K5MA 2P34A 3TBDA 1VAKA 1QNWA 3WW4A 4KG0A 3WDTA 5BNOC 2WWSA 2ZZJA 4QGLA 3P3NA 4AEKA 2R063 3WINE 3N3HA 2VXRA 2QFEA 3ETQA 3M3OA 2JE7A 3NV2A 4FO9A 4LA3A 1U5XA 1K5MB 2GH2A 4PDWB 2TBVA 4AGGA 4LO8A 1XU2A 2GDFA 5FQ0A 5FOBB 4ES9A 2B5HA 1HRV3 4I3PA 1VBD1 3KGLA 3ZYGA 1VBD2 2VULA 4BLJA 2HWE3 4D69A 4X8NA 3UJQA 1CAXA 1RUE3 1ZBE3 1PVXA 3E6DA 5DDJ1 5DDJ2 2GSYA 2OZ6A 2D6PA 1J59A 1CD3G 1OFSA 3AZVA 1ND2A 3IDBB 5FQ0B 1SBDA 5BXXA 4BE3A 3I59A 2XG3A 1KITA 2DTWA 1MZ5A 1NXMA 5DUWA 1XYOA 2EXJA 2IXLA 4PIZA 1CAXB 1OA4A 4XJZA 1KS4A 1H4GA 2ZHMA 5TSWA 1PGW1 3FUQA 4GB33 2D44A 1O5LA 3B9CA 3RI8A 1ND2B 3H50A 4MGIE 3I59B 3H7YA 4Q4V1 3J26N 1SQ4A 4Q4V2 4OHYA 2XWJB 3WUDA 4YW3A 2I74A 3IMNA 3HMYA 4FAGA 3NW4A 3ZDSA 1HRI3 1AR63 1IS5A 5ACA1 2LALA 3ZXFA 5ACA2 1NXD1 3AKPA 4OVEA 3MGUA 1ZRCA 4IEWA 3J8F1 4QGMA 3AMHA 3J8F2 2PA7A 3VBRC 5JOZA 4I01A 2RHPA 1C3HA 2GN3A 1EV11 4GWMA 1X8EA 1EV12 1MS1A 4Q2FA 4TZDA 4Q4Y3 1R1A1 2VMGA 1R1A2 1VBB3 4RA0A 2C0ZA 2K0GA 1DYKA 2DU1A 1AYM1 4HN0A 4HZFA 1AYM2 1CONA 4XE9A 2D6MA 2KXLA 3GF6A 1D2SA 2JXAA 1KJRA 1L3JA 2DVDA 1REEA 2EXKA 4LO5B 2ZKLA 4F83A 5LEJA 1GFF2 3TNPB 1O91A 2CL2A 4C1XA 4IQPA 4EV0A 5I0RA 1RUG3 3VKOA 2B45X 5AVAA 3N7JA 4FOWA 2WL1A 3M3EA 4AEDC 3TNQA 4AEJA 4FCAA 2VW1A 5C6CA 3LOBA 1OLRA 4FP3A 1O5UA 3OGJA 5I0UA 3MI8A 1VBC3 3WG3A 1FMD3 4CDUA 1A78A 1ULGA 2WA3A 1SFNA 1PM7A 1ZZ7A 1OI6A 3U0ZA 2C9AA 2R043 4AGRA 1J3PA 1ENSA 1S0GA 2A3XA 2DU0A 1D4M1 2ZGOA 4ATEA 5BV6A 4P9IA 4CDUB 4META 4IERA 4AEMA 4RHV1 2D5HA 4XYXA 3ZN6A 4Y1ZA 4AVSA 2WT2A 3BOPA 4R4ZA 1J1LA 1ZRFA 1EAH1 1O4YA 1EAH2 3ATGA 4LTAA 5IUQA 1VALA 3POWA 4JQRA 4B3NA 3ZN6B 5HCAA 1DDLA 4N9IA 1N1TA 3POYA 1GNHA 1XNBA 4LBJA 2BNNA 5BUVA 1F9KA 3D0JA 5A3MA 1D2QA 1UU6A 3ZXAC 1IKPA 4MXWA 1LODA 4AFMA 2RS53 2YYOA 3PMEA 3BCWA 3JQXA 1J58A 3M8LA 5GZDA 1VBA3 3QLQA 2D43A 2GH8A 3QH6A 4ZKTB 3NO8A 2Z2SB 4MUVA 3VV1A 1C28A 1SBFA 1TQ5A 4MXWB 3ZIWA 1RUD1 1RUD2 3KT7A 4PIXA 1HW5A 1FPN1 3ILRA 4N90A 1VRH1 1JH5A 4IEVA 2YROA 3G6JB 4K40A 1IS4A 4YARA 1QJY1 2RR11 5L36A 2RR12 2GC1A 1SEFA 4Q4W3 4ZU4A 4K8FA 2R6QA 4BYYA 3Q9OA 3I7DA 2CAVA 4XF9A 1YFWA 3GBGA 1H8TC 2A6WA 2BPA2 3JD71 1O4ZA 5DG1A 4YVWA 3VL9A 1F5JA 3UKNA 3GHMA 2XPJA 1E57A 3KCYA 2VW2A 4LO6B 4E2QA 4XOGA 2XL7A 2JDZA 3GZAA 1LECA 4YRDA 3RDIA 3S7EA 2UWAA 4MGKE 3T1MA 2YXSA 4NWVA 3IBMA 4HMZA 2ZGPA 3THPA 3ZX7A 4AI0A 5FDBA 1RC6A 4LO7A 1OA3A 4QQPA 3EJKA 2P2KA 5IT6A 1K5MC 4PDWC 4CTEA 3ZFEA 2DUPA 2D6NA 4N7UA 4Q4X3 2FHRA 1ZRDA 5DXDA 4GULA 1QJU3 3B5LB 4XFCA 1AR91 5I0SA 1AR92 1N3OA 4GKXA 3R0RA 5EV7A 2HWC3 3VZJA 4D7SA 3MF6A 1TNFA 3AMNA 4U36A 1ENQA 1ZZ8A 1NCQA 4XFFA 4JGZC 4K9SA 3VZNA 4YYOA 2VMIA 3AB0A 4P9JA 4RGGA 3N35A 2NZ9A 4R8HA 1UL9A 2ZZQA 3AYCA 2FZ2A 5LRRA 1QOOA 4ASMB 1AR72 4LBMA 3AZYA 3NSTA 4S2GA 3NJZA 5K7PA 1AR82 3EBRA 4PJYA 4BIOA 1NCQB 4W6WA 4GMP1 3LKJA 2H0BA 3B01A 4R9BA 3AFGA 4QGNA 5CFDC 3O12A 3A0NA 2A5ZA 1ND3A 1AZDA 2NMNA 3THTA 1R091 1PGL2 1R092 1DIWA 4FOVA 3WHTA 1S2KA 2AR6A 4QU2A 1G9AA 1S2BA 3VKLA 2WZR1 4XEZA 4AI1A 1ND3B 3S30A 4XMIA 1V6OA 3BODA 1QDCA 4QPIA 1A8MA 1HLCA 1Z7S1 3C3VA 4QD2A 1Z7S2 4XBLA 3NV1A 4FAHA 2DF7A 4WM8A 3FWEA 1IKQA 5JSOA 4BCUA 3L9JT 1UPIA 1CAWA 1Q8OA 1RUJ1 3ZYPA 1RUJ2 4IV1A 4QPIB 3IDEA 2EA7A 3RJ2X 4LLFA 3VBSC 5KHGA 3KSCA 1CAVA 1WCSA 1ULDA 4PBOA 1QXRA 1ENXA 4WM8B 4YZ5A 5LK5A 2B39A 5T5OA 1CAWB 3PLQA 2WSVA 2D7FA 2BUKA 1OLQA 4IV1B 1X50A 4ITCA 1HV0A 1W6NA 5EJ3A 3LA7A 1CAVB 5D1IA 1PO13 5I0TA 4AQ6A 3JUUA 2HWD2 1FI2A 2MHFA 5CAZA 4OHZA 2QDRA 1YFYA 3NL1A 3TRSB 1RUF3 4CDQA 1FYUA 3LB9A 1W6NB 2QNKA 4WM7A 3WNXA 4AW7A 3AXDA 1QOTA 2WJSA 2PHTA 1J3RA 4YM0A 4IV3C 1SCSA 2IFRA 4NPRA 1JHNA 3ZYRA 4XJAA 1BEV2 2XBO1 4LBQA 2XBO2 4AF9A 4WM7B 1TMF3 2EAAA 2XHKA 1Q56A 3KQRA 4NOTA 4Q0PA 3B00A 3WT3A 1CESA 1Q8PA 1QQP3 3ZFGA 2YZ4A 1G9FA 4A7YA 2O0OA 4QT6A 1S0BA 2HYKA 4L92A 4AQTA 2VOXA 3OCPA 3LGRA 5JOXA 5GZGA 2WS93 3PMSA 4FXGB 3ZFGB 1AL23 1HQLA 3JCIA 4YVSA 1MS9A 3M7AA 1G6NA 4YW1A 2MEV2 4GWNA 2DUQA 3GNEA 5FTTC 2XJQA 3HT1A 4WV8A 2FMYA 2Q0AA 2JD4A 3WP6A 4YZ1A 2GNDA 2JENA 2RS11 4DXZA 2RS12 3FZ3A 4YVSB 1POV1 3RYRA 2RMU2 3KD4A 2ZX1A 4MLOA 3B93A 2R1BA 3UKTA 5KC6A 3OGGA 1YI9A 1LOCA 4YW5A 4XJ8A 4K21A 1KFUL 2FZ1A 4EWEA 1RMU3 1I9RA 1MQTC 2GC3A 5AFBA 5E88A 2ZGMA 1VP6A 1VR3A 2UY8A 2VQ0A 5GALA 1WW7A 4KGQA 1SFYA 4B7EA 2ZHLA 2PHLA 4IETA 4HBNA 4JDOA 3DF0A 1PIV1 1PIV2 4UBGA 4S2DA 1U5IA 3FLRA 2WSUA 4LR4A 4RFT0 3AJZA 3VGIA 3MFAA 2W0XA 5IK5A 1RINA 1NLRA 2BEOA 4OZXA 4PIYA 3KMHA 3PHMA 3ST7A 1EPWA 2O8OA 1V00A 1DGWA 3QBQA 3VDDC 1V6NA 2XL9A 3VBRA 1LHWA 2KA3A 4XZPA 4Z8BA 1R081 1ZRRA 1R082 3LA3A 4NVPA 2XKPA 4XQDA 2KM2A 3VBOA 4HETA 2IXKA 2DVGA 3WY6A 2VOVA 4AFBA 3I8TA 3VBRB 2EF6A 5KC5A 3MZHA 1LHUA 1GR3A 2XKOA 2ZGSA 5FPZA 1GBGA 4OI4A 1NCQC 4KWKA 1REFA 2GN7A 3VBOB 4P5HA 2A6YA 3UL2A 4AEDA 3VL8A 2A70A 5T3NA 1B35C 3D4KA 3H8UA 2VVEA 5CFCA 3JBG3 2BWCA 1IZ3A 1BBT1 3R4SA 1RUC1 4FT8A 2R071 4NWWA 3LAGA 3MYXA 2Z79A 3WX5A 4HPKA 1AYN2 1PZ9A 1QJX2 1PK6A 1S0CA 3MIHA 1ASJ1 4URTA 3WP3A 3VN4A 4C0BA 2VG9A 1ND3C 4HSJA 5CFCB 2ZTNA 2O8QA 3CJIC 3KCXA 3OF1A 1U12A 1XRUA 4LEJA 1O3QA 1QXJA 5FAXA 3WW1A 4B8EA 1PK6B 1WW4A 4KU7A 5JLVA 3HBZA 1DQ6A 2PHRA 3IT8A 4HSLA 2PLV1 5CIRA 3ZMOA 1YUDA 2PLV2 4LBNA 2ZGRA 3WVJA 1RB8G 1RUI3 2PAKA 4MVTA 3ME2A 1GQHA 5CA6A 3VHPA 5C8CC 5J98B 1C57A 4HKWA 4LBOA 4AFCA 1BJQA 4R9DA 3IN9A 3QH7A 2IXJA 1JN2P 2ZX3A 4YM1A 1OMIA 1HXS1 4UBHA 4LHNA 2GC0A 2VOKA 3ALQA 5D8AA 1KQRA 4YNIA 2YGLA 3O0XA 3MF9A 1UX6A 1UZYA 1V9U1 4R9CA 1RHI3 1VBE1 1JYIA 3WP4A 1GNZA 3LA2A 4Y5Z0 4AQ2A 2NM1A 3OD4A 1RVF2 2CNAA 1I3HA 5JCTA 5CU1A 4AHXA 1JOJA 2LM3A 2SBAA 3ZIXA 1DGLA 5D8AB 3ES4A 3NV4A 5AVPA 1TE1B 2GNBA 3SH4A 4XQWA 4YFWA 1YI7A 4ASLA 3TN92 1PNGA 5IK4A 2YY1A 4W6XA 4DINB 5GZFA 4F3JA 4YG6A 1W6OA 1O7FA 4Y26A 1TME1 4D7TA 2UU8A 4RD7A 1WD4A 4FQ4A 2QZ2A 1G9BA 2YUEA 4HVQA 1H1IA 2D97A 2ZGNA 2E7AA 2NP0A 5KWRA 1H8TA 2PN5A 1W6OB 3ES1A 1CR7A 2V73A 1LHNA 1OPMA 2AGSA 4HKOA 4XF4A 2OYZA 4BMEA 2HWB1 4I02A 2HWB2 1QMJA 3JZVA 1A3KA 1CGPA 1QKQA 1H8TB 1Q43A 1QWRA 1VB4A 1VIWB 2WLPA 3TB0A 3ZFGC 1XQNA 1QJZA 4AHZA 2HWF2 2WFPA 4XFGA 1GLHA 1PZ8A 3ZYJB 5GM0A 4JVAA 4FTEA 2DYCA 2R0FA 3DPRA 4E27A 3M4FA 4Q8KA 1I5ZA 3KLSA 4PDWA 3H3ZA 3JB8A 4GMP0 4COVA 4JRAA 3FUOA 4YVSC 2LTNA 4AHWA 3MIDA 3GHNA 3M70A 2XJTA 1LOAA 1H9WA 3DPRB 4AGVA 4XPVA 1WLWA 3NV3A 1H2NA 3ZXGA 4XIKA 3H1YA 2OUHA 4ISRA 4JGZA 2ILMA 4OUMA 2QUOA 5DDJ3 2X5IC 3KB5A 4FPYA 4I09A 3D6EA 4O9GA 3QD6A 5T5PA 2BWAA 3IIAA 4E4ZA 4Y24A 2Y0IA 3FLTA 4JGZB 4BA6A 1V6IA 3SXWA 2O1QA 2BQPA 1YJLA 1NLSA 1H0BA 2R061 4XQ4A 5CFDA 1O3TA 1BYHA 1GSLA 1ZREA 2ZX2A 1OPOA 2Z42A 3WDYA 1JXNA 1NQDA 1HQWA 1UU5A 5I8TA 5EWSA 5HCBA 1DBNA 1PGW2 4H14A 3LWCA 1JTZX 4BQ1A 5CFDB 1MEC1 2ZGTA 1MEC2 3FFZA 4CP1A 1HRV1 1ZBA3 3GALA 2CGPA 3NAPA 2HWE1 2HWE2 1RUE1 1ZBE1 5ACA3 1ZBE2 3WP5A 5A33A 2AH2A 1RIRA 5GLVA 4RQPA 1LKNA 2CWMA 3O0WA 4Q0QA 1SCRA 4ZU7A 3NAPB 3ZXEA 3VHOA 4P9GA 1R1A3 2ET7A 2X29A 1AYM3 4OULA 5A33B 2ARXA 3HAGA 3VBSA 1DF0A 4RQPB 3B02A 3VBOC 4JTOA 3W59A 1W2UA 3RPQA 3ZYIB 3MLKA 1HRI1 5DUUA 2QZ3A 1AR61 2E7TA 1IQAA 1T6GC 1AR62 3VBSB 5KXEA 4YM3A 2PFWA 4XBQA 4I0BA 4Q0VA 3OY8A 2HEYF 5CFCC 1ULFA 4AFAA 2WC2A 4Q4Y1 3NWKA 4Q4Y2 1BKZA 1VBB1 4IV3A 1PK6C 1XNKA 4BIFA 3U07A 3N36A 3OY8B 4IXLA 4K6BA 1GV9A 1D4M2 3AKQA 3WCSA 2XUMA 5GJ6A 3N7KA 4RHV2 2WNUB 4IV3B 1WUVA 5DZGA 1M06G 1DGRN 1EAH3 1POV0 4Q1RA 5C9AC 4Y1UA 5JOYA 4GQ7A 2D6OX 1OQ1A 2QCSB 4CEYC 1VBC1 5FREA 2YGMA 3T2TA 4YGEA 4M3CF 1WA4A 1PMIA 2DUOA 3E5QA 3AFKA 1G9DA 2NLRA 3ZN4A 4CYDA 2BNMA 2R041 1GICA 4QQHA 2R042 4YZ3A 1U0AA 2Q5TA 2PHWA 2JG9A 5D8AC 5JPNB 1G7YA 1BQPA 1YFUA 2E7QA 3SH5A 3WCRA 3VBHB 3WHUA 2VVFA 4JAAA 5JPMB 5L19A 3VBFA 2JG9B 4IEQA 4YG3A 2VU9A 4G4FA 2R16A 2XLFA 4K1ZA 3MEPA 2JICA 4KBBA 3NVCA 1RJ8A 5ABJC 1FATA 3FFQA 3TWIA 3VBFB 1KJLA 1FPN2 1MQTA 2E63A 4Q0SA 1VRH2 3ZPYA 2Q30A 2E53A 1H4HA 1QJY2 4A7ZA 4EWAA 1H2KA 5IK7A 2E51A 2RS51 2RS52 4OHXA 2D98A 1LB2A 2ZAAA 4XHBA 1VBA1 4JV4A 3S6PA 1MQTB 1C5HA 3JD72 5GLUA 1DGRA 3J4UH 1LOEA 5EZWA 4LE3A 3R05A 2XGXA 3SCGA 1LOFC 2QVSB 2VNRA 2AENA 1Y9QA 3H3UA 3P3PA 3AP6A 3BOWA 1OSGA 2ZGUA 1GYKA 2XLGA 3K51A 1BVP1 3AX4A 1UIJA 2D5FA 3DGTA 3VDDA 1FT9A 5CNAA 4Q4W1 5F1RA 4Q4W2 2R30A 3DPRC 1YFXA 4BLIA 3WLUA 4BZ4A 3VDDB 1YRZA 1CIWA 1HDKA 1Z78A 2QE3A 2GMPA 3VKFC 1QH6A 5LK7B 4DS0A 5JZGA 1AR73 1G9CA 3RWNA 4L2NA 3RZZA 1IS3A 1SLCA 4DY3A 1AR83 3ACLA 4DRRA 3MDPA 5T54A 3N7LA 1B35A 2PQQA 5HBAA 4Z2WA 4GMP3 2ZS6B 3C2UA 4QQ2A 4JCKA 5T50A 4E2SA 3E6BA 5JZGB 4KGGA 5J09A 4DRVA 4Q4X1 3SHRA 5DUXA 2YMZA 4WBBA 2ZOEB 1QJU1 2GC2A 1QJU2 3SLIA 2Q4SA 4COUA 1AX0A 4XDQA 2H0VA 4M00A 1B35B 4XFBA 3IKWA 4XJWA 5J7MA 5A32B 2HWC1 3SCFA 2DCTA 4HKLA 3CJIA 1O4TA 1EY2A 2ZPXA 1V6KA 1AXZA 4FTSA 1KD7A 4FPHA 3AMQA 5J37A 2XB6C 4BWOA 3R6SA 3AYAA 3I2DA 2VOWA 1YCIA 2LUWA 2D40A 2WZR2 3NAPC 5JWPA 3CJIB 2WLQA 4HN1A 3OPZA 5C8CA 3LCPA 4UXAA 3CU7A 4NHKA 2WNVC 1J3QA 2GMMA 2NPIA 3IDCB 4RQPC 3AMPA 4GKYA 4PLNA 1B09A 3B7MA 1NG0A 5T5LA 4CDXA 3AJYA 1ZM1A 5C8CB 2GALA 1XYPA 4W6YA 4M01A 5LEKA 2FQPA 1LGBA 3AKRA 1UKGA 4KNCA 3L2YA 1FNYA 5FRAA 2ERFA 4AVVA 4CDXB 3KS7A 3X29B 3FLPA 1UU4A 2SLIA 3FBYA 4J1XA 2CGOA 2HWD3 4EN7B 4L8QA 1RITA 4MSVA 2P3JA 4AWDA 5GKAC 4WZFA 2AUYA 1VAMA 4WVVA 1FOD3 3NKTA 2Y0OA 1WCKA 3ILNA 5KXBA 1YNAA 1MZEA 2D3RA 2WNUC 3NKGA 5FCCA 1BEV3 1DGWX 4XFIA 3ZO0B 1QXPA 1YO8A 4NR1A 1A8DA 2HKXA 3RMXA 4FP2A 2W52A 2UURA 4G9SB 1YLLA 4HFSA 2MPFA 1LULA 3FHIB 1PO11 3PVOA 4DQAA 5FBZA 4CEWC 5J96B 3MIGA 4D3WA 1O3RA 4B29A 1QU0A 1UAIA 2OA2A 2XVLA 5SV5A 1RUF1 1GKBA 1UN1A 3H0OA 1RUF2 2EXHA 2PTMA 1S0FA 3IWZA 3D5OA 2JKBA 3VBHC 2MEV3 3A4UA 4YM2A 3HIFA 1IGOA 2ZJCA 3S0MA 3ENRA 3CNAA 4XHXA 3ZSJA 1DQ1A 4GH4C 1X8MA 1S0IA 2JG9C 4U2AA 4D7YA 4EN0A 5GLTA 5FLIA 2RMU3 1TMF1 4LA2A 3D8CA 5CG9A 1TMF2 3KZ4C 2YC0A 3ROUA 1RUH3 1D0HA 3VBFC 3ZFFC 2A6ZA 2QQPA 1COV3 4YGDA 2GZWA 2R1DA 2ZKNA 1S0JA 2B9UA 1WW5A 2X5IA 5I93A 3LOIA 1LESA 4YSFA 4KH9A 2WS91 1G8WA 3AP5A 3LZZA 4FPLA 5JSRA 1AL21 4MGZE 3VBUC 1BVVA 2DCJA 2OPKA 1LU1A 1H2LA 2Q1MA 1HV1A 3BALA 3MPBA 1QY4A 2IZWA 3LSEA 4N43B 2X5IB 4FPOB 1XE7A 5K0UA 3I54A 3A0KA 2DTYA 4C1WA 1PIV3 3AKSA 4L99A 1ZYBA 3APBA 2ZHKA 3MIEA 1RJ7A 4AE2A 1DQ2A 4B4PA 2VUAA 1NA1B 4DY5A 4YZ4A 4ATFA 5K0UB 2GNTA 2WFF3 4R52A 4UW4A 4LUKA 1FX5A 4UW6A 3PVEA 4FPKA 3FJSA 3KCCA 5JAXA 1RMU1 3AYEA 3M3CA 1V6JA 3POSA 5F5QA 1BZWA 1R083 2RM23 2ZX0A 4L11A 2PHDA 4EROA 4SLIA 2GNMA 2CTVA 3WV6A 1W0OA 4B7KA 3HT2A 5J36A 4AFDA 1UCXA 2QDNA 5A3LA 5CADA 4ZXKA 3ZSLA 4XMAA 3SNMA 4PCRA 3WDUA 4HANA 4OLLA 2G4IA 4DOUA 2JX9A 4AVAA 4FPEA 2UY9A 1EYBA 5JZGC 5F9TA 1N1SA 4Y1YA 5H9RA 3USUA 3RJRA 5C8WA 1NCRC 1IHMA 1N1VA 1XYNA 1YJKA 4C0HA 1MZFA 3WG1A 2OUJA 4QMAA 2R32A 1NE4A 1ULCA 3WZ1A 1AYN3 4MZUA 1QJX3 1BBT2 1PO23 5DUVA 1RUC2 4EN9B 2P3KA 2R072 3HD8B 3USUB 3H9AA 1D0GA 3PVNA 2UYBA 2RS33 4NO4A 5EYYA 4N7IA 4Y1VA 1ASJ2 4HVOA 2RJLA 2YV8A 2TUNA 3OD0A 3O7OA 4I0WB 2ZCWA 4TSVA 3JU9A 1NOVA 3EHKA 4Q27A 2FBEA 4V1PA 3BB6A 4PBPA 2ENRA 2QJVA 2YPJA 2OW4A 2DCZA 2D3SA 5C9AA 3WG2A 1AF9A 1I1EA 1LENA 4CEYA 5K9YA 2OZJA 1WMFA 1XNCA 3JBG1 3JBG2 3K48A 1LR5A 1KDKA 1ZNPA 3CL1A 3GBWA 4IEZA 1AHSA 1IPJA 2K2SA 2VPVA 1KFXL 1RL3A 1MR5A 2TEPA 3FE5A 3AP7A 2H6BA 2WKKA 2D3PA 3WD5A 3ZSEA 4B4QA 2IC1A 4INDA 5C9AB 1PZ7A 1HXS2 1SDWA 4ES8A 1C4RA 4CEYB 1WD3A 4CDXC 5FLJA 5JIAA 4AI8A 2R0HA 1CVNA 1RVF3 5LRSA 1NE6A 2E9QA 1V9U2 2VGDA 4QM9A 5I8SA 5AC93 1VBE2 1UIKA 4N53C 1MACA 1AUYA 4ZU5A 2VECA 1S1AA 2DV9A 1LEMA 4JTNA 4GIQA 3BU7A 4GA9A 3WW3A 3TN93 1HX6A 3B3QE 1OQEA 5ABJA 1C8M3 4BHPA 1OKQA 4QQLA 3HR9A 3WQ7A 1H1MA 3AZWA 2A3WA 3H7JA 1DU3D 4A7KA 2D6KA 1CN1A 4I0AA 4P14A 1TME2 3VZKA 5SV8A 3ZSMA 5JR7B 5ABJB 1RHI1 3UKVA 1PVC3 4FSJA 3RSJA 2BVBA 2VH9A 4MX3A 1RUNA 3VUOA 3OBRA 4RL7A 4J6GA 4WVWA 4FPGA 4XJ9A 1SLTA 1LOFA 1NQJA 1SLAA 4IEXA 2V5YA 2HWF3 5BPXA 4EN8B 1DZTA 4FPJA 1BMV1 1BMV2 4FXKB 5EFUA 3GZTB 1Q8QA 1BCXA 3GZUC 4LULA 3M1HA 5BNNA 3INAA 3B9IA 3EQEA 4OFGA 4I3GA 2X8KA 1WMDA 1AL0G 2BW8A 2BBVA 3DN7A 4Y20A 4XXAA 3TAYA 1Q3EA 3RI9A 4IL7A 1GANA 5GLWA 2EAKA 3VZOA 1URXA 4HK9A 5BNNB 2ATFA 1WW6A 2ZMNA 1UW8A 3KGZA 2IXHA 3V65A 1ZZ9A 5I91A 3UJOA 3ZSKA 4QM8A 4EJRA 2W68A 2XJVA 3UK9A 4Y20B 4DZGA 5T55A 4AG4A 1Y7BA 3KM5A 1VBD3 1W39A 1TNRA 2XVKA 4J1WA 1DQ0A 5CBLA 1OOPC 2C5DA 4N43C 1C1LA 1PNFA 2EIGA 1SMVA 4KWJA 4Q29A 2VNGA 1YIFA 2ZGQA