2GMPA

Metal-free (apo) p. angolensis seed lectin in complex with glcnac-beta(1-2)man
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
228
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPNQVIAVEFDTFYSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin
publication title Interplay Between Metal Binding and cis/trans Isomerization in Legume Lectins: Structural and Thermodynamic Study of P. angolensis Lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 228
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gmpA00
1JYIA 2CY6A 1GNZA 1Q8PA 1JUIA 3MW3A 2EXKA 2ZGRA 1SBDA 2AENA 2UWCA 3L2YA 4YFWA 2R0HA 3A0NA 2GNDA 1AX2A 4XZPA 4Y22B 4YGCA 1FV3A 3B01A 3USUA 3JU9A 2A6WA 4WVWA 3AXDA 4Y20B 2ZGPA 3A4UA 3AP6A 1GZCA 1WD3A 1KDKA 2E51A 2R0FA 3AP9A 3OGGA 4LBKA 3AJYA 2VW1A 1N1VA 1UKGA 4UW3A 2W52A 5T54A 1GNHA 2ZA9A 1QU0A 1S0DA 4PQ9A 2A6VA 2CYFA 3WV6A 1WUVA 4U2AA 2V73A 1YYNA 1DZQA 5T52A 5CAZA 4TZDA 3ZXKA 1LODA 2ZGLA 3UJOA 4BLJA 4BLIA 2ZGMA 1AX0A 5IK7A 1LESA 3R4UA 1D0HA 5F9TA 2VW2A 4BPZA 3UJQA 1H9PA 2A6ZA 5H9QA 1WLDA 1W6QA 1ULGA 2D3PA 1IS4A 2D6KA 4LBLA 4RA0A 2OVUA 3AZYA 3KM5A 1LHUA 1ONAA 3ZYPA 4GWNA 4K21A 1WBFA 1GZWA 2ZHLA 1XQNA 2ZZJA 3ILNA 1JHNA 1CIWA 1LOBA 2AUYA 1FYUA 4XILA 1DQ4A 2DUPA 2JD4A 1MS8A 4FPOB 3NV4A 2R1DA 2ZGQA 1JOJA 1QF3A 1WD4A 1PZ8A 3ZXFA 1LHOA 1ULCA 4HL0A 4YW5A 5IUQA 3OBTA 1G8WA 1Z0HA 4GALA 2DU0A 1LCLA 3NV1A 3OBRA 3POSA 4GXLA 4K1YA 3WHUA 1LOCA 3WZ1A 3MEPA 1QKQA 5T50A 4Y1YA 3UL2A 5IK4A 3ZXJA 1C1LA 1KDMA 3AYCA 1WLCA 5GZGA 3VUOA 1N3PA 1BYHA 1A8DA 1BJQA 1MS4A 2W08A 1N47A 2ZHMA 3RQ0A 1KJLA 1LOGA 1UAIA 4Y22A 3ZXEA 1YIFA 2A6XA 3ZPYA 3B3QE 1LOFA 5EYXA 1V6LA 1DQ0A 1W6OB 1WW4A 4YFZA 1QOSA 3GNEA 1IS3A 1MVEA 3AX4A 1AVBA 1LGBA 2P34A 2WT2A 1V6MA 4XMAA 3OY8B 2LALA 2VY0A 2PHXA 3AFKA 3LSDA 3O0VA 4XXPA 4XOGA 5T5LA 1J1TA 4XJUA 4FOWA 4AVSA 3NV2A 4AYUA 2E6VA 3FUQA 4XXAA 1ENSA 2D3SA 4XHXA 2CWSA 3WCRA 5AVAA 4FPLA 1W0OA 4YZ5A 4M3CF 1PZ9A 3O5SA 1X50A 4Q27A 2EXIA 2EALA 3ATGA 3ASIA 3T1LA 2RHPA 3AZWA 2WJSA 4YZ2A 1IKPA 4LBOA 3IM0A 1QDCA 4FQ4A 2NM1A 3SH3A 2D6LX 3SH5A 2P3IA 1DBNA 2HYKA 3I8TA 3ZSKA 4M3CE 2NN8A 1CONA 3FLRA 1GKBA 5DUXA 1UZYA 4F83A 3POYA 1GBGA 1VAMA 2AR6A 4R9BA 4ZXKA 1OQ1A 4CZSA 4YM1A 3M1HA 3WG4A 5JOYA 3DUIA 1G7YA 3VKMA 5JLVA 2A6YA 4ITCA 2DTWA 4LBMA 4MYEA 5DZGA 1NLSA 1SBFA 5DG2A 3ZSMA 3N7LA 1RIRA 1ULFA 4DRVA 4XBQA 1Y7BA 3SH4A 4R9AA 5GLTA 4NOTA 1LGNA 1TEIA 1O4ZA 4FOVA 4Y26A 4ISRA 1DIWA 1R1ZA 4WZFA 2UWAA 1OKQA 4GA9A 3AYEA 5JOZA 2FHRA 2ZAAA 1VALA 3OYWB 1QOTA 3WCSA 5KXEA 1CVNA 2A5ZA 2SBAA 3AP4A 3M3QA 5GLWA 1MS5A 3T2TA 1S0GA 4M3CB 5JVVA 1MS0A 1GLHA 4WVVA 5E8AA 4DQAA 2DUQA 3FLPA 5DG1A 3HMYA 3IN9A 1O4YA 5GLUA 4Y1XA 1DHKB 1GSLA 1RITA 2GMMA 3AYDA 4P9WA 2R16A 3W58A 1AJOA 2CWMA 3WG1A 1ENRA 1W6MB 3WNXA 1W6NB 4SLIA 2D43A 3QCWA 2YY1A 1G9AA 3WVJA 3OY8A 5GZEA 2WNEA 5T5OA 2VXRA 1V00A 2EF6A 4DRRA 2AYHA 1VAVA 1QNYA 1V6OA 1CR7A 4FQZA 4XTPA 3U4XA 2VW0A 4XYXA 2I2SA 3AJZA 1BQPA 2CNAA 3HR9A 2JJ6A 4Q26A 2JE7A 4YW3A 4YW2A 4ZKTB 3WUCA 4BOWA 2D3RA 2EXHA 2PHUA 3A0KA 5CNAA 1OFSA 4YG3A 3V0AA 1CPNA 1GYKA 1UL9A 2OUJA 3PVNA 1DLLA 4JRAA 4YM2A 1CN1A 3VKFC 4WV8A 5GJ6A 2ZGOA 4FVVA 2DWRA 4GKXA 2OUHA 4FOQA 4K1ZA 3FUOA 3ZYRA 3ZSJA 5CA6A 1MS9A 4LBJA 1DGLA 5GLZA 1FX5A 3OPZA 1A3KA 2DURA 2D6NA 2GN7A 4BQ1A 1KRIA 1LECA 5L73A 3MW2A 3V0BB 2ZGUA 3NWKA 3BTAA 4JCKA 4PF5A 2BQPA 4YG0A 1EPWA 1W6PB 2P2KA 2A7AA 4KBBA 3SISA 1UMZA 1V6NA 1RINA 2B7YA 1G9DA 2P3KA 3LSEA 5T5JA 1CJPA 1H30A 3R05A 1D2SA 3FFZA 1BKZA 1LHWA 1SLLA 4LBNA 1NXD1 1AXZA 3OJBA 1FNZA 3ILFA 3PVOA 4P9YA 5FRAA 5GZFA 1N1YA 1ZM1A 4H55A 4LBQB 4L8QA 5GLVA 1S0IA 2GMEA 1JW6A 2W39A 3PVEA 2WT1A 4AGRA 1DYKA 2A3XA 1IOAA 4GWMA 3B9CA 1BXHA 3WHTA 4K20A 1G86A 2D44A 2NP0A 1MVQA 1SFYA 1AJKA 2WT0A 4Y20A 2NYYA 3IMNA 4YGDA 1CESA 3R4SA 1W6MA 4FPGA 1S0EA 1G9FA 1YXWA 3C2UA 4FPKA 5DUUA 3ILRA 1SLCA 1W6NA 2DTYA 3FBYA 5KXCA 5IK5A 4UW4A 5GM0A 4BM8A 2NMOA 3QLQA 3UK9A 5DZEA 4BMEA 3ZSLA 3AP5A 2ZBJA 1LJ7A 1DQ6A 3SLIA 1JBCA 3SITA 1LOAA 2ZGTA 4FPEA 2UU8A 1IS6A 4YG6A 4FPHA 1N1SA 4XDQA 4PBPA 3M3OA 1HLCA 4M00A 1WW5A 4NO4A 3USUB 2D6PA 1S0CA 2DVAA 2V5YA 1F9KA 2GDFA 3BOPA 1AXKA 3WG2A 2C9AA 5JOXA 1QGLA 4ISQA 5EYYA 1LU1A 2NMNA 3ZXLA 2VUAA 4R9CA 5FREA 4YZ4A 1GANA 1S1AA 1S0BA 2W68A 1KQRA 1KITA 2A75A 2AREA 4FPCA 1W0PA 5HCFA 4Z8BA 2DV9A 4XMIA 3BIWE 1AF9A 1IS5A 1W6PA 2C5DA 2P37A 1SLIA 1U0AA 3O0WA 3WLUA 2PHRA 4UW5A 1W6QB 2OW4A 2YV8A 4Q8KA 4Q8LA 4YZ3A 2GALA 1KJRA 5KXBA 1WCSA 2A70A 1S0JA 3ZVXA 2KM2A 2WSUA 4LBQA 1GZWB 4UW6A 4Y1UA 5SV8A 2YROA 3W59A 5EXOA 2JE9A 2NZ9A 1GV9A 3MPPG 3NV3A 3IKWA 4OZXA 5JMCA 3RMXA 4FOYA 3SNMA 2XB6C 4P14A 3LCPA 1W6OA 2SLIA 1GZ9A 1LOEA 2GNMA 3M3CA 4YGBA 4LBQD 2D6OX 3I4IA 3TAYA 1N3OA 2DU1A 2ZKNA 1Q8QA 1LOFC 3AZZA 2A3YA 1UN1A 5JOWA 4YM3A 3RSJA 4AWDA 3VKOA 1MR5A 1HKDA 1CQ9A 4XBLA 4DPNA 2ZMKA 3AP7A 4AVTA 3VKNA 1WW7A 2A3WA 3T1MA 2TEPA 2ZHKA 5EWSA 2VH9A 3POWA 4CRQA 2XG3A 4C1XA 3WDVA 1ULDA 1SLBA 2JKBA 2ZACA 3O0XA 3N7JA 1H9WA 1UZZA 2R1BA 5HCBA 3INAA 3JUUA 1F5FA 1SCRA 1LGCA 3V64A 1LU2A 1MZ5A 5H9PA 2P3JA 2UURA 3BODA 1ZA4A 4Y1VA 4P9XA 5F5QA 1UPSA 1DFQA 1MS1A 2A71A 1C1FA 1SCSA 2D7FA 3PJQA 4I30A 1V6KA 2ES3A 4Q1RA 1Z78A 5IT6A 4YZ1A 5GZCA 4PCRA 1JXNA 2GN3A 2DVGA 1CPMA 4AGGA 2G4IA 5LK5A 4DFSA 5IK8A 5H9RA 3WUDA 3M3EA 3VV1A 3APBA 2GNBA 3Q9OA 3RG0A 5T55A 1G9BA 3D6EA 3DGTA 3RRDA 1ULEA 2FMDA 5BYNA 1DQ1A 1PZ7A 1YO8A 1BZWA 5E89A 1AXYA 2Q5TA 3IPVB 4FPJA 3OYWA 4XJZA 4Y24A 5HCAA 1FNYA 1A78A 2ZGSA 1N1TA 3AYAA 4M3CA 3WDYA 2DVDA 3HN1A 3B69A 1JYCA 1WW6A 1MS3A 2JECA 2YZ4A 1QMJA 5DUWA 3H0OA 4XIKA 2LTNA 1JN2P 3AK0A 3AZVA 4XE9A 1G9CA 1I1EA 3VKLA 4YW4A 4YM0A 1YI7A 2E53A 2AGSA 5CB7A 1SLTA 3WDUA 4U36A 1Q56A 2GMPA 4XJAA 3PMEA 3TB0A 2PELA 1HQWA 1FATA 4YGEA 4AGVA 2DVBA 4FPYA 1SACA 2ZMNA 4ATEA 2DVFA 2D6MA 3O12A 3N36A 2ARBA 4TYSA 4XIOA 1Q8SA 4XJ9A 1FV2A 5JDBA 3V65A 1AX1A 1LENA 4AVVA 1SBEA 4D69A 2DYCA 3CNAA 4YLZA 4DS0A 2PHFA 1FAYA 3D5OA 4W65A 2ERFA 5CBLA 1HQLA 1QNWA 4Y1ZA 2H0BA 2R49A 3AXEA 1LEDA 2E7TA 2ZGNA 4CTEA 2WSVA 2PHWA 1Q8VA 2ARXA 1QDOA 2EIGA 4M01A 3FLTA 2WKKA 5DZFA 5T5PA 1MACA 1C4RA 4ATFA 4IQPA 1VIWB 5GALA 2AH2A 4BMBA 1VLNA 3V0BA 1IKQA 5DXDA 3N7MA 3MW4A 4XTMA 4XJWA 1DYPA 3M2MA 2DUOA 3RS6A 2WQZC 1C57A 1AZDA 3WOGA 5H9SA 4XJ8A 1S0FA 1LULA 1N3QA 2PHTA 3KQRA 3N7KA 4RL7A 4XHBA 3V0AB 4PBOA 1I3HA 3RMYA 4FP3A 1WBLA 2ENRA 1LHVA 4Q2FA 3IPVA 2YMZA 1GICA 2ZHNA 1V6IA 3ENRA 4FPFA 4YW1A 1F31A 3WDXA 2CTVA 2UWBA 2VU9A 4ASMB 3B00A 4Q1PA 2E7QA 1V6JA 2YXSA 2Z42A 1URXA 1WLWA 3N3HA 2CL2A 1LTEA 1YRZA 4GKYA 3WG3A 4JC1A 2EAKA 2ZGKA 2EXJA 4XBNA 2JDZA 1LEMA 2ZABA 3D4KA 4C1WA 4HANA 1SLAA 1B09A 4R9DA 2ZMLA 4FP2A 1DQ5A 1UX6A 2WLQA 3WDTA 1Q8OA 1LHNA 5E88A 3WDWA 5KXDA 3AZXA 1QOOA 3N35A 5GZDA 1DQ2A 1MZ6A 3GALA 1APNA 1ENQA 5DUVA 1HDKA 2GNTA
chains in the Genus database with same CATH superfamily
1OOPC 1Q8PA 5FXXA 2JXAA 2UY9A 2UWCA 1RVF2 3VD5A 2QQOA 2RM22 3WNLA 4YNIA 1XJAA 3A0NA 1AL22 2GNDA 3M8LA 3BTXA 2RS51 3U78A 3O7OA 4Y22B 4YGCA 3USUA 2A6WA 5E6HA 3A4UA 4MGYE 1GZCA 4DIQA 3NNGA 2R0FA 2LROA 4MHRA 3OGGA 3AJYA 3FHAA 4KQ7A 3JD73 4W4ZA 1N1VA 1VMHA 4UW3A 3RYPA 4B4RA 4NIDA 2Q8DA 4KWKA 1JOPA 2K9ZA 1JI6A 4LLOA 2XBO2 3VHOA 5LWBA 4FFGA 2XJRA 3ETPA 3WV6A 4BWOA 1I5ZA 3D0JA 3VDAA 4NIHA 1YYNA 4IV1C 2R062 5T52A 5CAZA 1MZFA 3NJVA 3ZXKA 1LODA 4BLIA 4TZDA 1W06A 2VZRA 1REFA 2VW2A 4NWWA 4LO5B 3ST7A 3UJQA 1H9PA 2A6ZA 5H9QA 4BPZA 5F37A 1S2BA 1RYYA 3VD4A 4LBLA 5LA2A 2DCZA 4XUQA 4CDWB 3DEMA 3A21A 3VBHB 4XFGA 4XUNA 4I3GA 1SPPA 3F2ZA 3ZYPA 2BZDA 1XNCA 5L36A 4K21A 3WQ7A 3VBUA 3PHMA 2ZHLA 3RFRA 2P17A 1MEC1 3ZYJB 2R072 2ZAHA 2W5FA 4LJHA 4ORFA 3MHZA 5AC92 3ZKUA 2AUYA 4Y3OA 1DQ4A 4JKLA 3N9NA 1DP0A 3I3MA 1C8NA 2JD4A 2PAKA 3LEMA 2F6BA 1AUYA 1R081 4LA3A 4W50A 4NR1A 1PZ8A 3ZXFA 4LK7A 4L2NA 3R0RA 2DU0A 2YC4A 3MGUA 3OBRA 1QQP2 4GXLA 3WZ1A 4L0PA 3ZFEA 5FPXA 1QJX3 1GP5A 5JR7B 4TSVA 1V70A 3N4MA 2BVBA 1BVP1 3L2HA 5FBZA 2ZOEB 3ZXJA 2HWD1 4OMCA 4CU9A 1ZRFA 5K9YA 1N3PA 4HK8A 1Y3TA 1O3SA 2BBAA 2FZ2A 2W08A 3GF6A 5FQ0B 2ZHMA 2DCTA 3RQ0A 1D0GA 4Y22A 1EAH2 2A6XA 2FCVA 3ZPYA 3EXUA 3LQCA 3R6SA 1ODNA 4B1MA 4EWDA 5F2SA 1WW4A 3SKJE 5FOBB 1QOSA 3FHQA 3JQWA 3GNEA 4HT1T 4XCAA 2Y6FA 1IS3A 5LBBA 5C4WB 4KGQA 4XDPA 3FHIB 2YB7A 1LNSA 5T5LA 3P5BA 4A45A 1R091 3AFKA 3N9QA 5EHDA 5J7MA 4FOWA 5AVPA 3QH6A 4QX0A 3RPQA 2WZR3 2JDPA 1X9PA 1PVC1 2W1WA 3MFAA 5FCCA 2D3SA 4AW7A 2CWSA 2R7EB 1RUF1 3K2OA 5LCWL 4YZ5A 4EROA 3UNPA 1PZ9A 1E5SA 5FZOB 3VZNA 3BPZA 5IVJA 4BB3A 5A32A 3ATGA 1VBE1 2BGCA 4FXKB 1T2XA 4CDWA 4XUTA 3THTA 4AAXA 3U0ZA 3SCGA 3WX5A 3EQEA 3IM0A 4XFFA 3ZFGC 4BIOA 2DFCA 2HWF3 2NM1A 1NZIA 1W04A 1AR73 1DBNA 3I8TA 2NN8A 1YJKA 4RGAA 1VBA3 1GKBA 5DUXA 1UZYA 1XNAA 4LNVA 2QE3A 1VAMA 2FQPA 3OB8A 2OPKA 4XF4A 2VCBA 5EPAA 5EZWA 3SEEA 1L7LA 3DUIA 4NMIA 3P3NA 4ITCA 5JLVA 5FZ1A 2CHHA 2BNNA 2XONA 2QZ3A 5DG2A 3I7DA 5FR3A 4DRVA 1F15A 3RI8A 1RHI3 3SH4A 4AI0A 4RS5A 4NOTA 2Y8KA 1TEIA 1O4ZA 1PMHX 4Y26A 2QQUA 3HD8B 4NHKA 1RXFA 3DV8A 4BU2A 1OKQA 4GA9A 4I0AA 4A42A 2FHRA 1HB2A 3OYWB 3WCSA 5KXEA 2YC2A 2W3JA 2LUWA 4CUCA 1YCIA 3AP4A 5A1FA 3LWCA 2JG8B 4NVPA 5FQ0A 5JVVA 1WMXA 1DGWX 3VBOB 3NAPA 4WVVA 5E8AA 1ASJ2 3HMYA 1RMU1 3IN9A 4XACA 5GLUA 3WF0A 3AYDA 1C28A 1OA4A 4NRPA 3W58A 3RZJA 2CWMA 3LE0A 1FPN3 1OOPB 4E2GA 4JGZA 1W6NB 1QY4A 1UXXX 3D8CA 2D43A 2YY1A 1AR63 4QX3A 2VAUA 1G9AA 3WVJA 2WWSA 5GZEA 2IZWA 4FFHA 3HNBM 4H2AA 1IQAA 2EF6A 4DRRA 3EJKA 4AI8A 2E63A 1MEC2 4XTPA 1C8M1 2XJVA 4IERA 2VW0A 3MFCA 2QZ2A 4MHUA 5JR2A 3AJZA 2CNAA 4Y5SA 4YW2A 2JJ6A 4INDA 4K3UA 4ZKTB 2AZ5A 4A3ZA 2EXHA 2RS13 1X36A 5CNAA 4V2VA 4OHYA 2HWE3 5FZOA 2YC0A 1CIYA 3PVNA 3V0AA 1R082 4LHKA 1TQ5A 3B02A 2XLGA 2DWRA 4GKXA 5DAVA 2GZWA 4BXFA 5C3PA 1DLCA 1YUDA 4LORA 1OUSA 4XQWA 5CA6A 1MS9A 3WW1A 4LBJA 4CCDA 5CU1A 4HN1A 5GLZA 2HWD2 4UOJA 1FX5A 4ARXA 1COV1 1H4HA 3CQOA 4I0WB 4Q0UA 4XC9A 4FTEA 1LECA 3RYRA 4D6SA 3NWKA 3CHXA 3ACGA 2A7AA 3HNMA 2J22A 3IDCB 1RUE3 4B1LA 1V6NA 5JSOA 2B5HA 2N7GA 1H2MA 3KCYA 3HBZA 2P3KA 3WNPA 4MGKE 4H7MA 1GWMA 4AVAA 4D69A 1AL23 1R092 1SLLA 4LBNA 1AXZA 2QJVA 5FRAA 3GHNA 3OBZA 4P9GA 1N1YA 1ZM1A 5CB7A 5GLVA 2G9FA 4OUEA 1JW6A 2W39A 2WT1A 4D7SA 1PVC2 5J09A 4JVAA 1IOAA 2JDMA 1UOGA 3WHTA 1WGPA 1RC6A 1OXCA 2NP0A 3PURA 4DMIA 5CFCA 1AJKA 3WXPA 2WT0A 2IXHA 2XBO3 4YGDA 2QQKA 5EP9A 4A6OA 1VBE2 1DGWA 4ZU5A 4PI2A 1W6NA 5IHRA 2DTYA 5KXCA 4N53A 2R063 3DL3A 3PUAA 3MICA 4EZHA 2YG0A 4OCTA 3HQRA 5F5CA 4BMEA 3BOWA 4AI1A 1HB3A 2J42A 2P1BA 4BDVB 3SLIA 1JBCA 3KVBA 4J6GA 1LOAA 2ZGTA 2UU8A 3TBDA 5LRSA 2Z5WA 4R52A 1QJU2 2UY8A 2Z69A 3VZLA 5ISLA 1BBT1 4PBPA 1AL0G 1Y9QA 3NKGA 2YU1A 5A1AA 2BUKA 1Y9MA 4OI4A 4EJRA 1F9KA 1NZCA 2GDFA 2R073 4IV1A 3ZYBA 1H1AA 3O1VA 5EYYA 3G7DA 4W6YA 5FXZA 1XE8A 4AL9A 2HBTA 2VUAA 3TEYA 1AYM3 3GBWA 4I09A 1YQ5A 5FZMA 3TEWA 1KITA 4QXCA 4XCBA 1RUC3 3UV9A 4HPKB 4XDOA 4RR3C 2OA2A 1QXRA 2DV9A 4Q4X1 2WINB 1RMU2 3ZFGB 1IS5A 2VNVA 3RZMA 2PQQA 3GZTB 3O0WA 3OBAA 3Q8EA 2PHRA 5JSPA 5KHGA 4UW5A 1W6QB 2ORXA 4AFCA 2DF7A 1NE4A 1UQXA 2WBKA 1J84A 5JZGB 1KJRA 3ROUA 2Y0OA 1WLTA 4MGQA 2E33A 1BMV2 4CDQC 1GZWB 4CYDA 2FDJA 5SV8A 5IVFA 2D40A 1FI2A 1HV0A 4N7UA 4PDWA 3DN7A 4QQLA 1QXPA 3JD71 3E6DA 5FMCA 5G04L 2WNOA 3GHMA 3OUIA 3IKWA 4K6BA 4OZXA 1D4M3 2XVGA 4NROA 3RMXA 2JG9B 4KMQA 4P14A 5I0SA 2Y64A 5FYZA 3O1SA 3M3CA 3VBRC 2VQAA 2D98A 1L7QA 4Z92B 2O1QA 2QKDA 2RJ2A 1SG3A 1H6XA 3SXWA 1O3QA 1CAUB 2HH9A 2Z2SB 1LOFC 1VE0A 2RVAA 3MDPA 4H3WA 2A3YA 5JOWA 1HB1A 1UF2C 1UU4A 3A22A 3RSJA 4YM3A 1COV2 4DPNA 4D8MA 1ZA7A 2ZMKA 2V4AA 2WS92 4CP9B 1ODMA 3T08A 1I5PA 1NQDA 5EWSA 5J36A 4MUVA 4Z2AA 3WDVA 4B3NA 5E1RA 2CDPA 1W8ZA 4IGQA 2VTXA 3H1MA 5DN2A 5HCBA 3C7OA 3INAA 3JUUA 2XJSA 4TLGA 1JU4A 1LGCA 1WMFA 2CSGA 2ZTNA 1LU2A 1W8FA 3PMSA 2BWCA 3GBFA 2B9UA 4XFAA 1DG6A 4P9XA 2P6HA 1W9WA 2C9KA 1LKNA 1SCSA 4KWUA 1MQTC 3AC0A 1V6KA 3KQ4B 4Q1RA 2Q1MA 4YZ1A 5GZCA 4COYA 4A44A 4AGGA 1QJX1 5LK5A 1RUG2 3RDIA 1KEXA 3ZFGA 3LOBA 5H9RA 5C33A 4MVTA 4N8MA 2GNBA 2F4LA 3RG0A 1RUD3 4NWVA 3D6EA 3NW4A 5T3NA 4NHLA 5FMOL 1LR5A 1ULEA 2FMDA 3RRDA 3ZYHA 1BZWA 3KCXA 4YYOA 3BTYA 3IPVB 3H9AA 1ASJ3 2O8QA 2WNVC 4C0BA 1QHDA 2JIJA 2WZ8A 3FN9A 1PNFA 4MO3M 3LPGA 3K77A 5HI0A 5LATA 2JIGA 4XIKA 3U1XA 3BALA 4CXYA 1JN2P 3AK0A 1NQJA 4XQDA 1T6BX 5F3EA 1H8TB 3VB9A 1I1EA 1RUI2 2K2SA 2WZR1 3WF4A 4C0HA 1K42A 3UKVA 4PIYA 1YI7A 4YM0A 2PA7A 5BNOC 3AVRA 4QDSA 4U36A 3ALQA 5JI7A 2OZJA 4AGVA 3VZOA 2VECA 5FZKA 5LBCA 4O61A 1OQEA 4TYSA 4UF0B 4XJ9A 1Q8SA 4MV2A 4BISA 2HWF1 5A1LA 1E5RA 4Q4X2 5FPLA 1AR71 2HEYF 3IDAA 5LEKA 1SBEA 1VBA1 2VUJA 4HZFA 3CNAA 4LO4B 4YLZA 4QPIC 1GWLA 4QU1A 2EA7A 1FAYA 1POV3 2PHFA 3PUQA 5FV3A 3T2QA 1HQLA 5C3QA 1QNWA 5JMOA 3WINE 2H0BA 4AQ6A 1LEDA 5C8WA 2JDAA 3NL1A 4AFBA 1UD1A 3MIFA 4WBBA 4XW3A 4CA9A 1SHWB 3FLTA 2WKKA 4Q0QA 4ATFA 1C4RA 1RHI1 1RUJ2 3UGHA 2QQLA 3JD72 2AH2A 1PMJX 3V0BA 5B2GB 2ZX2A 1YIPA 3EB7A 4XTMA 3I2OA 2Z79A 3PUHA 1K5MC 4K8FA 1CAWB 2DUOA 3K4ZA 2WQZC 4NHMA 4RL7A 3N7KA 5KHKA 5ANQA 1QIQA 5FZDA 1TVGA 4GAZA 4CPBA 4WVMB 4ES9A 5A3WA 1J58A 2LW8A 1LHVA 4HSLA 4MLOA 4RYDA 3IPVA 2XHNA 2YMZA 4KG8A 3W5NA 2WFF3 4RR3B 3CDZB 3GGLA 3OGJA 4YW6A 3I3BA 3CF6E 1TZOA 1FPN1 2VVDA 3GDBA 3I59B 5JCTA 2DCJA 3HQUA 1AR61 5C9AA 4QM8A 1CWPA 1WLWA 3N3HA 2CL2A 4CPBD 1LTEA 3HVDA 4BCUA 4EN0A 2A73B 2BRTA 4JC1A 2ZGKA 4XBNA 4IEWA 2BP6A 2ZABA 3D4KA 1KXGA 2K46A 1XC6A 3CJIC 1B09A 1AR83 3H1WA 4CDQB 1UX6A 1W0NA 2RS11 2WN2A 1B35B 5E88A 1QOOA 4FI9A 4NIIA 3N35A 2HWE1 2PFWA 3ELNA 3GALA 1C5HA 3M3IA 1ENQA 2Y38A 1OURA 2WRAA 4LTAA 5LA1A 1RGSA 5LZ6A 1LB2A 2GNTA 2VZQA 4CCMA 1V0AA 1VBC3 1ZZBA 1KFXL 1QJU3 3B93A 3MW3A 4QMAA 2EXKA 3OEAA 3VGIA 1OD5A 2R0HA 3VBRB 3N9PA 1VBD2 1W2AX 3VD9A 5CG8A 3LFMA 1FV3A 3B01A 3T2OA 1REDA 2O8OA 3K46A 4QKFA 4Y20B 2OPWA 2ZGPA 1ACCA 2L9LA 3AP6A 2XVLA 4CP1A 2E9QA 4MXWB 3I2KA 4JV4A 3H8RA 2XL7A 2YGMA 4XPVA 1NCRC 5AFBA 1UKGA 4XFCA 5T54A 1GNHA 3H3UA 3ZXDA 2ZA9A 4NN0A 1QU0A 3VBSB 2ADEA 4LULA 3S30A 5CKMA 1HRV2 1RUE1 1UYPA 1JYVA 3V56A 1WUVA 4U2AA 3T0AA 4O65A 1RTVA 2VXJA 4FSJA 1RVF1 2VMFA 4PT6A 2ZGLA 5IK7A 1AX0A 1CAWA 2WWUA 3I2JA 4JAAA 4NIAA 1AL21 5C70A 5CFDC 2WLPA 1OLRA 3VLBB 2W1UA 2D3PA 2WZR2 5FY1A 2D6KA 4JHTA 4PI0A 4G9SB 1OLME 1MQTB 3J7MA 4OUMA 2VD7A 4QM9A 4RA0A 1OSGA 1Y43B 4RR3A 1LHUA 3PTRB 4GWNA 4BIFA 1WBFA 2LM3A 1H0BA 2XBO1 2J1SA 1PGSA 4COZA 1UY4A 2F17A 2UYBA 4QXBA 5CZKA 3KF3A 5D8AC 2R061 2W1SA 1LOBA 4DO0A 3KV9A 1FYUA 5D21A 5K4LA 5A7WB 5BNQA 2DUPA 1MS8A 5C8CB 3WD5A 1GOFA 1Q43A 1RJ8A 2VL4A 1W05A 1CJDA 2Q0AA 5FO7B 1QF3A 3QBQA 4X6RB 1OA3A 1YWKA 3JBG2 4YW5A 5G05L 4D6RA 3MLJA 3OGRA 1G8WA 2WNVB 2ZX4A 4JGYA 3POSA 4K1YA 2DBIA 3WNOA 2WS93 1QKQA 3LDRA 4Y1YA 1BK0A 3UL2A 5IK4A 1RHI2 2BW8A 1KDMA 2Y6HA 1WLCA 5GZGA 2QQWA 2R071 1BYHA 5C4WC 1A8DA 1W2UA 4RN5A 5FY7A 5HV4A 3LFIA 1KJLA 1UAIA 3EYPA 3ZXEA 4BQ5A 3E6CC 1YIFA 4QB2A 2X05A 1XYOA 3B3QE 2ZEYA 2WAOA 5C6CA 1AYM1 2AEYA 2VZVA 1H1MA 1LOFA 5A6YA 1W90A 1V6LA 5F5IA 4OI0A 4MXWA 1RUC1 4A4AA 1DQ0A 1W6OB 5DQ0A 1ZRIA 2NLRA 3ES1A 4BQWA 5J48A 3NJXA 2O14A 2P34A 2WT2A 5A7SA 1BVVA 4A7YA 1RUG3 4WM8C 3SKVA 1O8PA 5BUVA 2VY0A 3LSDA 4XOGA 1FPN2 2DCYA 2VC9A 3NV2A 1OVPA 4AYUA 4EN8B 1GP6A 1AR62 2GC0A 1WCUA 2WABA 4XXAA 1ENSA 2WO7A 3KV5A 1R64A 4JDMA 2GP3A 4M3CF 1X50A 1PGW2 5L9BA 2RHPA 4XFBA 1MQTA 5FZ6A 4B29A 3THDA 4IEUA 3Q8BA 2RS12 5FLJA 4X8NA 1XE7A 2HWE2 1D4M1 2D6LX 4A7ZA 5FPZA 2R043 2X09A 3ZSKA 2ZKLA 1K5MB 1CONA 4IW3A 1YHFA 4JZRA 1X8MA 3CMGA 5BNPB 3POYA 4JX0A 2WQ4A 4GJYA 4ZXKA 1RUI3 4CXWA 5HCHA 1OQ1A 4CZSA 3HIFA 4YM1A 1NE6A 3WG4A 4CCCA 3ME2A 2BTVC 2JDYA 5F3GA 1HXS3 2DTWA 3FWEA 1SEFA 4LBMA 5DZGA 3SEPA 4B7KA 4I2OA 1VJ2A 4N90A 2JG8C 4GWIA 5FZGA 4META 2B46X 2X5IC 3VBOC 2WA3A 5GLTA 4ISRA 3OGSA 4IE6A 3DYPA 3QH7A 3AFGA 1UIJA 2HBUA 2QFEA 3HOBA 3ZLIA 2YFZA 3AYEA 5JOZA 1EV13 1RUE2 4GQ7A 2I07B 2KA3A 2CGPA 3PDQA 4BH9A 3OD4A 5K8SA 3O14A 2A5ZA 4C8DA 5GLWA 2VPVA 2ILMA 3MBWA 2QQNA 2JDUA 2JE8A 4AEKA 4E8CA 2X53S 1XNTA 2CU5A 4DXRA 3CJIB 2DDUA 5BNOA 4KH9A 3FLPA 5DG1A 1ZBA3 1O4YA 5DDJ3 4Y1XA 1RITA 2GMMA 4JTOA 4Q0PA 1ENRA 1RUJ3 1XB9A 2VM9A 2OS2A 4G3YC 5FZIA 5ABJB 3QCWA 3C8XA 4M4RA 2WNEA 1ZRRA 5KC5A 4IE0A 3VDDC 3PUSA 2AYHA 1VAVA 1PM7A 1QNYA 3POEA 4MXVA 3NSTA 1RUD1 1RL3A 4QPIA 5A7PA 2IXLA 2TNFA 2JE7A 1GOGA 4BOWA 5FYYA 2X29A 2ETEA 2W46A 3A0KA 4BZ4A 2VQ0A 4YG3A 1ASJ1 1NCRB 1UL9A 2IVJA 1W39A 3VKFC 5L19A 1CN1A 2VMEA 4BA6A 1CX1A 3P1IA 3UKNA 4MGTA 2OUHA 4FOQA 3UGGA 4IV3B 4MGZE 3NO8A 5A7OA 4S2FA 3L9JT 1D7PM 1ZZ9A 4YVSB 3IZOA 5FZFA 3ZSJA 1K5MA 1W03A 4OMDA 5CFDB 4HLTA 1X9TA 1IZ3A 2D6NA 3U10A 5LA9A 4I0BA 5L73A 1VRH3 4DNYA 1TME2 2VJXA 4IGOA 1W28A 1AYM2 2WL1A 4JCKA 1W8WA 2BQPA 2W9XA 4EN7B 1EPWA 3SISA 5I0TA 1RUC2 5FKCA 4M4PA 1MPXA 1BHGA 2FDGA 1ND3C 1ZBE2 2B7YA 2KXLA 3T30A 2IFRA 1G9DA 4HMZA 5T5JA 5D8AB 2BPA2 1VBD3 4YM2A 3PVBB 1D2SA 5DZEA 3K4AA 1POV1 1NXD1 4P9YA 4HK9A 4JQRA 4LBQB 4H55A 1KS4A 3BN6A 2JD9A 2GMEA 4D7TA 3GZEA 3PVEA 3RGBA 3WNMA 4CCNA 5A7QA 1UKRA 1UY3A 1BXHA 3B9CA 1G86A 1HJGA 2D44A 5A70A 3UESA 2NYYA 3IMNA 3NQHA 4FPKA 4J25A 1S0EA 1G9FA 1HRV3 1UX7A 3FBYA 3A23A 4GULA 5E16A 4UW4A 5FZ4A 5KR7A 4BM8A 1D4M2 4KG0A 4LO8A 4Q0SA 2ZEZA 4HKWA 2J1EA 2XJTA 3UK9A 1SQ4A 3LEIA 1YEWA 2VNOA 2VMCA 3THCA 3W20A 1DQ6A 4Q4W2 2WFF1 4WM7B 5F2WA 1DU3D 1NCRA 1QJEA 1IS6A 4OHXA 4YG6A 4DY5A 4EZ4A 2XOMA 4XDQA 5SV5A 2ORZA 1AR93 1WW5A 2D6PA 4RFT0 2RG4A 3FZ3A 1S0CA 2DVAA 2FBEA 4WM8B 3VBHA 5FYMA 4IXLA 3PLQA 1H8VA 4L92A 4NHYA 4TN7A 1AXKA 5JOXA 4QQ2A 4FFFA 1LU1A 1PIV2 4HVRA 3ZX7A 2HJIA 3I3EA 5A3NA 5FREA 4YZ4A 1S0BA 1AR81 1OMIA 1WA6X 5JZGC 1VR3A 2ZPXA 3LKJA 5BNNC 4GWJA 3JBG3 1PGL1 2XDVA 4ZPIA 1VBC1 1UO9A 1QJU1 1SLIA 1U0AA 2J7MA 4JQTA 4UFJA 2DCKA 5FZAA 5B4NA 1HB4A 2OW4A 4I3PA 4K40A 3X29B 4Q8LA 1W8HA 2CDOA 2GALA 5D8AA 2JG9C 1WCSA 4GH4B 1S0JA 5KXBA 1OLMA 2FMYA 1W9TA 1RJ7A 2RE9A 1DYOA 2YPDA 2KM2A 2WSUA 4LBQA 2EIBA 1RUD2 2YROA 3J9SA 3W59A 1HQNA 1GNYA 4AOCA 3IBMA 1IHMA 2X5IB 4AFMA 2EICA 4XF1A 5JMCA 4YSFA 2G19A 3PTYA 2XB6C 1QXJA 4YGBA 4EWAA 5EFUA 1LOEA 2FCTA 4MGIE 2YGLA 2W94A 5A6QA 1XNKA 3DKQA 4LBQD 5C3SA 1U5XA 1CAXB 1Y4WA 2D6OX 2PTMA 1UU6A 3I4IA 3WP3A 1D2QA 3TAYA 5C4WA 3FFQA 1N3OA 2DU1A 3WP4A 4DINB 1BK1A 3GXUA 4XUPA 1Q8QA 1NA1C 3C7EA 3WQ1A 4OUSA 5BPXA 1JZ6A 1JYNA 1UN1A 3HT2A 4HVQA 1BMV1 4AWDA 3MIHA 4HKOA 1J3PA 2RV9A 2C0ZA 3NNJA 4JDNA 4E8DA 1NUKA 1WW7A 2V4VA 2A3WA 2AEZA 4LPLA 5CIRA 3LAGA 1R1A3 2PAMA 4P9IA 1ULDA 3VDDB 1SLBA 3KVAA 5FIXA 3O0XA 2W92A 2HLEA 1ND2C 2D5HA 5FP7A 1SCRA 1OVSA 3H1YA 3MUZ1 2XUMA 2VE1A 1MZ5A 1U5ZA 5APAA 2RMU3 2P3JA 2RR12 2UURA 5FZCA 4Y1VA 3I97A 1UPSA 1DFQA 2D7FA 1TNFA 3E5UA 1Z78A 2QQVA 2IFWA 2JDNA 4LKDA 4PCRA 4MGSA 3M7AA 3FL7A 4IEPA 2EIDA 3HN3A 2WS91 2G4IA 2VULA 4NHXA 2TUNA 1PHMA 1O59A 1RXGA 1UCXA 2FCUA 2H6BA 1VAKA 3OUJA 1VBB2 1I9RA 1M4WA 4OI1A 4RGKA 1K5JA 5DABA 5A6ZA 4CUBA 2BGPA 2VOWA 3E5QA 2CGOA 3MYXA 4HSJA 4UYBA 4FPJA 1H8TC 4QHOA 3OYWA 5K0UB 3WW2A 3NMBA 5BV6A 4GMP0 4CDXB 2FDKA 1A78A 2ZGSA 2VMDA 2JG8A 5IAVA 1JZ7A 4R8HA 2X5IA 2DVDA 2W0XA 3VBOA 1JYCA 1WW6A 1MS3A 2WFF2 2YZ4A 1QMJA 5IJRA 4C90A 1BLZA 1RUG1 1W9FA 1ND3B 5J1XA 1PO23 2PHDA 1W3VA 5FPVA 2C24A 2W91A 3BCWA 1OOPA 1CAXA 3DYMA 3VKLA 2BU9A 4PJYA 3WDUA 1Q56A 2GMPA 3PMEA 3LDBA 4LLFA 3ZFFC 1WWYA 4M0NA 4XETA 4YGEA 4DUXA 4LHLA 4FPYA 4LIVA 2XLAA 2ZMNA 1UMIA 4HETA 4IEZA 4ATEA 1AR82 1WCKA 2ARBA 1ZZCA 2MPFA 3AM2A 1PK6B 1Y9GA 1O6UA 4XIOA 3CL1A 3VL9A 1FV2A 2QQJA 1KGYA 2X10A 2HYXA 5JDBA 4KU8A 2R041 3R4DB 3PU3A 4KL1A 4AVVA 1DGRA 1PGL2 5KHHA 3DPRB 1VBC2 5FMDA 3H8UA 3VBFC 2C4XA 4FAHA 3VDDA 3T2PA 4J1WA 2ERFA 3P6BA 1PVXA 5CBLA 1RUI1 2YUEA 2R49A 3AXEA 3RZHA 4CTEA 3B94A 2WSVA 1JODA 4AQTA 3H50A 1HXS1 1Q8VA 2ARXA 3PUIA 1QDOA 3JQXA 3BGAA 1ZNPA 1TME3 3D0SA 3GCWA 4IQPA 1HX6A 3C7FA 3GJBA 5GALA 2PQSA 2VBPA 3LOIA 4FAGA 1CZSA 3Q8AA 4FBFA 1ZBE3 5I0UA 5A33B 1DYPA 2Q8CA 3RS6A 2VVFA 3TNQA 3WOGA 4XJ8A 1S0FA 1N3QA 2ZEWA 5A3PA 1I3HA 5FLIA 1GUIA 1S4CA 3RMYA 1JHJA 2QQMA 5IW0A 1WBLA 2ENRA 4Q2FA 1O3RA 2ZHNA 2OYZA 5L7OC 1ZBA1 2WFPA 5DDJ1 5BNNB 3LF7A 4YPJA 1D4VB 2UWBA 3WQBA 4ASMB 2WNUC 4BHPA 3ZR6A 1RUJ1 1B35C 4HG6B 1V6JA 1OH3A 4BQ2A 4FFIA 5FUIA 3J7HA 5I93A 3OPWA 4CCJA 1YRZA 2XQXA 4CEWC 1ST8A 4Q4V3 4C1WA 4HANA 1SLAA 1ULPA 1C5IA 2WIIB 4R9DA 2VNRA 3WDTA 4PLOA 3WDWA 1VPHA 5GZDA 4Q4W3 1VP6A 1DQ2A 4UFHA 3U14A 3OEBA 3ZR5A 3NNFA 4TLFA 1HDKA 1JZ8A 2GSYA 1GNZA 1CAVB 1JUIA 1OD3A 3RZZA 2AENA 5FYHA 3VBSC 5J96B 2ARCA 4YFWA 1S55A 4V2WA 3GM8A 4Y4YA 1AX2A 4DXSA 3KGZA 2PLV3 3J4UH 4PIZA 3JU9A 3E1F1 3AXDA 1PIV3 2VO5A 2XWBB 4B8EA 1NA1B 1KDKA 5FZLA 1UOFA 4LBKA 4RHV3 1SZBA 1VRH1 2VW1A 5J3UA 1UNBA 2W52A 1UIKA 3GBGA 1S2KA 3MF9A 1S0DA 1JOBA 1SFPA 3RJ2X 4O9EA 3HWJA 2XJUA 5IFTA 4HPKA 3TWIA 1OHFA 2V73A 1GP4A 3HT1A 4JKKA 2HEWF 1VMFA 5DAWA 1W99A 5HXVA 1LESA 1VBD1 1D0HA 3R4UA 5IATA 1F8VA 3JB4C 1ND2B 2BJSA 4OI2A 1W6QA 4IEYA 1GR3A 1ULGA 1UOBA 3VHPA 4L97A 5FUPA 3RNSA 1XPWA 1UY0A 5DMYA 5JZGA 2Y34A 4DOUA 5C8CC 2OVUA 4GIQA 1O3TA 4ARYA 4URTA 1ONAA 2J1TA 1NG0A 2VOXA 4QHZA 4BYYA 1GZWA 5EJ1B 1XQNA 1HRV1 1VB2A 3JZVA 2RDQA 2MEV2 1NKGA 1QJFA 3ILNA 3TEXA 3VDCA 4KU7A 5IVEA 4XQ4A 2VCAA 1CIWA 2VCCA 2R042 3H7YA 2Y26A 1AHSA 2JG9A 2BOIA 1DGRN 1HJFA 3NV4A 2ZGQA 3U11A 1JOJA 2G9ZA 1UZVA 1WD4A 3WSOA 3LEKA 1ULCA 4HL0A 5C71A 3OBTA 5FYUA 1CAUA 1Z0HA 2C1FA 2V5DA 3OD0A 1G9BA 1HXS2 3NV1A 1H2LA 2I45A 4QGMA 3RZGA 1H6YA 1LOCA 2VOKA 2ZX3A 4FO9A 4K8RB 5T50A 2IXKA 4ES8A 1AR91 4CCKA 1UOJA 1DCSA 1DZTA 1X8EA 1XYNA 3PL0A 4XABA 1C1LA 2P5BA 1OQDA 3KF5A 3VUOA 4E9KA 4P9JA 3AMPA 5LY1A 1BJQA 1MS4A 4CP9A 4QQOA 1OPOA 3WF2A 4N43B 2JDHA 3KHCA 2FDFA 3OCPA 5LA0A 1EV12 1C3HA 2E26A 4TXWA 2BOJA 1CZVA 3QD6A 1NA1A 2RR13 3ZOIA 4F3JA 3ZFFB 1J59A 1L7RA 2EVXA 3JBG1 4YFZA 2QUOA 5HXMA 4QDRA 1NX9A 5I0RA 1ZBA2 3AX4A 4N9HA 1LGBA 2QDRA 3M70A 4NAMA 1V6MA 4XMAA 1AYN3 5DDJ2 5F39A 2LALA 2PHXA 5CVRA 1J1TA 2JEMA 2P6CA 1VBB3 4ASKA 4EE2A 3VBFB 4BQYA 5FZ0A 4M0HA 2QCSB 2E6VA 5CYYA 4CCEA 3H7JA 5JSRA 1TMF3 5FUNA 1XNBA 2OQ7A 2OX0A 5BNPC 1PX4A 2QQIA 2XHKA 4Q27A 2EXIA 2EALA 4UFKA 4GZ9A 4QPWA 2BEOA 3I2HA 2A1XA 3OSDA 1IKPA 4LEJA 4OYUA 3VL8A 4D7YA 4YZ2A 4LBOA 4FQ4A 1QDCA 3ZXAC 1ZRCA 3BPSA 5FYSA 3SH5A 3BU7A 3UYJA 2P3IA 4G4FA 1GZTA 2HYKA 4XAAA 3O1UA 2HKXA 3FLRA 4QX1A 4F83A 4PLMA 1GBGA 1JYXA 2AR6A 4R9BA 2CAUA 4ET7A 3O1PA 5FPAA 1JYTA 3M1HA 3ZMOA 4EQVA 3AVSA 5JOYA 2BVVA 3ON7A 3VKMA 3RZLA 3H3LA 2A6YA 4COWA 3IAQA 1NLSA 4FT8A 2O0OA 2VNGA 1H8TA 3N7LA 5L7OB 1ULFA 2Y0IA 4YVWB 2PMWB 4QWNA 1PGW1 1Y7BA 4Y5TA 5FYCA 2BV4A 1OA2A 1VRH2 2WNUB 1EUUA 1JZ5A 3PIJA 4FTBA 1DIWA 2J1RA 5M0TA 4WZFA 4NPRA 4CUAA 2UWAA 2Y6LA 1RUF3 1R1A1 2ZAAA 4LUMA 1VALA 2PAEA 1QOTA 5FY0A 4EN9B 5KHIA 3BIEA 4CEWB 1CVNA 2VGDA 4UF0A 3IIAA 5ABJC 2SBAA 4J1XA 3T2TA 1MS5A 2CGNA 4M3CB 5FFOC 1EP0A 3LD8A 1MS0A 1IPKA 1GLHA 2GP5A 4DQAA 2BNMA 3S7EA 4IGPA 3ZFFA 3WP5A 4AI2A 3OOXA 1OT5A 4B4PA 1AJOA 4RD7A 4D6QA 3ES4A 3ITQA 1RUH3 1W6MB 3DCQA 4QT6A 5FAXA 3WNXA 4X6QB 4IEQA 2Y6KA 2BGOA 3ZKYA 5FYBA 3CEWA 5FZBA 2FDHA 4KI5M 5JXJA 3EBRA 2VXRA 4MADA 5FP4A 2Q8OA 2B45X 1CR7A 4IV3C 3AMMA 4DZGA 4XYXA 4Z07A 2I2SA 3HAGA 1BQPA 4YVSC 4YW3A 2D93A 1PO12 2D3RA 1UY2A 3DXUA 1OFSA 4IEOA 4OFGA 1SDWA 1CPNA 2VTXJ 1WMEA 2OUJA 2XLFA 3AKQA 3KWVA 4WV8A 5GJ6A 5CISA 2Q1ZB 2WDBA 1YQCA 2JKXA 4E4ZA 1OBNA 4WVMA 4Y33A 4K1ZA 1H1IA 1VB4A 3AMNA 4LKFA 5IVVA 2FZ1A 5LEJA 5GKAC 3IWZA 5IYYA 4NJ4A 5DAXA 1PO21 2YBSA 4LR4A 1POV0 3CIHA 1AR92 3G6JB 3I59A 2RDNA 3N9LA 1A34A 1W8NA 3OPZA 4EYUA 2DURA 4LKEA 2RS32 1KRIA 5AFEA 3MW2A 3USSA 2ZGUA 2WO1A 2JWPA 2VOTA 4QX7A 1KFUL 4PF5A 4YWAA 4YG0A 1DF0A 4KBBA 2WN3A 3U37A 4CDQA 1RINA 4QPGB 4KWJA 1B35A 5HPOA 3WNNA 3KGLA 5ACA3 1GFF2 5FK8A 3CU7A 3THPA 1CJPA 1MZEA 1H30A 4PQ9A 1S2EA 3KS7A 1BKZA 3SMHA 3VD7A 4CEWA 1FNZA 5GZFA 4QU2A 3H42B 5F3CA 4RS5C 1OPMA 2MHFA 1W9SA 4KBZA 3VBRA 1WKYA 4AGRA 1DYKA 2A3XA 4GWMA 4RQPC 4K20A 1TME1 5A3TA 1MVQA 1SFYA 4Y20A 2MNGA 2Y33A 3FBMA 3CLPA 2HWB2 2PHLA 3FC0A 1W6MA 1NCQC 1YXWA 4FPGA 4I01A 3C2UA 4QPYA 5HBAA 1SLCA 4RGGA 1QJY3 2J1VA 4WM7C 5IK5A 1W9YA 3K51A 3UETA 1ZBE1 2WYFA 5GM0A 5C3OA 1XYPA 2NMOA 3MIBA 2XUEA 3AL6A 3VBSA 5F5AA 3S0MA 4F8AA 1YFUA 4PF1A 1QH6A 3QLQA 4HVOA 1OKOA 1GMMA 3ZSLA 1G6NA 4JGZC 5FY8A 4AFDA 2ZBJA 5D2AA 4AHZA 4Y5Z0 3HNYM 2XPJA 2R30A 2OT7A 4FPHA 1N1SA 4AEMA 4M00A 1HLCA 4NPLA 4NO4A 5F8PA 3USUB 4OQ8A 3IAPA 3WY6A 4AFAA 2V5YA 4Q4Y3 2MEV3 5KC6A 1F2NA 2VZPA 3WG2A 4B4QA 1QEXA 4ISQA 5FP3A 3UT0A 4AAPA 4CCLA 1R1A2 1U5IA 4Q4V1 5JXGA 1GANA 1BEV3 4GH4C 3ECQA 4HONA 2QVSB 4FPCA 4Q4W1 5A7WA 2RMU2 5FMOS 5C8CA 3E5XA 5FP9A 4XMIA 1K12A 2C5DA 2P37A 3W21A 3WLUA 2YV8A 2WNVA 2HWC2 4JKMA 4Z1VA 4UT5A 2DBNA 4YZ3A 1UW8A 3HQXA 1STMA 3URFA 3IDEA 4S2DA 5FY5A 5K7PA 1RUOA 3ZVXA 2PLV1 1YJLA 5F6LB 4E4DX 4D94A 3FMGA 2WUHA 4UFMA 1PIV1 4O7XA 2ET7A 1BBT3 1CD3G 3MV11 4ZHNA 4HFSA 2BYVE 4RHV1 3A7QA 3KT1A 2NZ9A 1GV9A 4XF9A 1U5YA 5FMBA 3H8OA 3TRSB 4IL7A 1KS5A 2YFUA 4GB32 5JUVA 1SMVA 4YW7A 1Z7S3 2NPIA 4LA2A 1EPZA 3RVHA 1W6OA 1FOD3 2SLIA 2GNMA 4LIUA 4DEQA 1F4AA 1TE1B 3POIA 1PO22 3ZFEB 2Z4FA 4AQ2A 3AZZA 4AXOA 2OXBA 1UYZA 3I2FA 4OHVA 3VKOA 1MR5A 1HKDA 4PHZA 1UMHA 3JB8A 4N53C 4XBLA 3SC7X 4PLNA 4LQRA 3LB9A 3VKNA 1UPIA 3S5QA 2ADDA 5LY2A 3POWA 3C7HA 2VUCA 3OF1A 4R4ZA 4CRQA 2XG3A 1UYYA 5JXHA 2ZACA 3J7LA 5JPMB 1UZZA 2R1BA 5FJHA 3V64A 2B39A 4ZZ8A 3POFA 5H9PA 4DEVA 4ONUA 1X33A 1MS1A 4I30A 1C1FA 2A71A 5BNPA 2GH2A 3DF0A 3J7NA 1ZZ8A 2GN3A 3LA7A 2DVGA 3AKPA 5K0UC 5LBEA 2JICA 2YBKA 2J1UA 4CDXC 1OF4A 2ATFA 3K75B 3M3EA 2IC1A 4P02B 4QDQA 3GZUC 1UWWA 2VBDA 1F5JA 5A32B 5T55A 2XKPA 2GC1A 3T3YA 4S2HA 3DGTA 4AEDC 1DQ1A 5IVCA 1L3JA 5CEHA 5DPNA 2RR11 3MLLA 5FYIA 5FZ7A 4Y24A 4UFIA 5FZ9A 4BK4A 5HCAA 3AYAA 1N1TA 4A2UA 3WDYA 1GOHA 4C91A 4Z2WA 3HN1A 3CJIA 4OZOA 1P8JA 5EQUA 5DUWA 1AYN1 1J83A 3H0OA 3NVCA 3OG2A 4MG2A 5CG9A 1PK6C 4MX3A 1VBB1 3AZVA 1G9CA 4PDWC 3S5AA 3GJAA 5ABJA 3ZN6B 4AG4A 2AGSA 1JS9A 1JTZX 1SLTA 1TMF1 2WQ8A 3DPRC 3H3ZA 1NLQA 4H7LA 1QH7A 4RS5B 4Q0VA 4QQPA 2PELA 2H0VA 1HQWA 1PO13 1FATA 4LMFA 5JAXA 1NXMA 4Q4V2 1SACA 4RQPB 2DVFA 3O12A 1UU5A 3Q8FA 3ZYFA 2YHJA 1NT0A 3LIHA 1IG0A 1V9U2 5A3MA 5FTTC 3TN93 1NCQB 1JYWA 1LRHA 3V65A 1AX1A 1IGOA 3DXTA 3NAPB 2ARAA 2XWJB 2BNOA 2DYCA 5FBJA 4DS0A 4RSUA 2YBPA 1W3XA 4Y1ZA 4IV3A 1YI9A 1YQ2A 1UXZA 5FP8A 2E7TA 4AF9A 4DXTA 3VDBA 4JGZB 4YVSA 5B4XA 2Q8EA 2PLV2 2RS33 3M4FA 5A6XA 4M01A 2G9GA 5CFDA 3GYDA 5DZFA 3T4VA 1MACA 4QX8A 3RI9A 3TYJA 4RHV2 3ZDSA 2BERA 4BMBA 1HRI3 1VLNA 1W2OA 3PIGA 2IXCA 4IESA 2HEVF 3CO2A 3CZJA 4IE5A 1YFWA 3M2MA 3PU8A 5FOJB 1AZDA 2P4EA 1US2A 5H9SA 4XHBA 2JX9A 4BXSV 3V0AB 3AL5A 2VQUA 1W2NA 4PBOA 2RDRA 1GQHA 4CXXA 4CEYC 4GMP3 3OTFA 2Q1FA 1V6IA 3ENRA 1F31A 3IDBB 3WDXA 2BDRA 2CTVA 1XOYA 1E5HA 1RUH1 3B00A 2HWB3 3J8F3 4LK6A 2JB8A 1JZ3A 5FYVA 4QKNA 3K3OA 2WYSA 4K9SA 2RS52 3WG3A 3S6PA 5J37A 1K3IA 2EAKA 2BFUS 2JDZA 5TSWA 3ZYGA 1LEMA 4XVHA 5CKNA 3ZN6A 5FZ3A 3AKTA 3T09A 2ZMLA 4FP2A 1Q8OA 1LHNA 3S57A 3AZXA 2XGXA 5KWRA 1APNA 1O7FA 4RQPA 1U12A 5IVYA 3B9IA 1JYIA 2CY6A 3WT3A 4JTNA 3WW4A 5FPUA 3OUHA 3LA3A 2ZGRA 1SBDA 1NCQA 3I49A 1Q3EA 3L2YA 5C5UA 2QDNA 4WM7A 4COUA 2W2IA 3NJYA 2PN5A 1ZRDA 2IXIA 4HN0A 1HV1A 1XRUA 1NAEA 2XXZA 4XZPA 5EJ3A 4UXAA 3U4SA 5CFCB 3T0DA 4WVWA 4WM8A 2OZ6A 4W6XA 5KBFA 1JZ2A 1WD3A 2RJKA 3NJZA 2E51A 3AP9A 4XZUG 1X82A 2B9VA 2VVEA 1OF3A 2IUWA 3EO6A 1XSRA 4LXLA 4N53B 4ZS3A 2VG9A 1FMD3 2WA4A 1TNRA 2A6VA 5A3UA 4IE4A 2ZCWA 1F35A 2CYFA 3TOJA 4BQ4A 5F6KA 1YLLA 1IQDC 3I2DA 4LT5A 1DZQA 5ACA1 1H2KA 2K0GA 2JDKA 2V09A 2IWGB 3AMHA 2HWC3 3UJOA 2ZGMA 3POJA 4BLJA 5F9TA 1AYN2 2ZZQA 2XL9A 2Y6JA 2GC3A 1WLDA 1IS4A 3WP6A 2ZJCA 3BUCA 1TMF2 4GH4A 4QXKA 1ZX5A 3LZZA 2ZX0A 2XH6A 2DFBA 3AZYA 3KM5A 4IV1B 4AQSA 1K45A 5EJZB 1IPJA 3MZHA 4OHZA 4LITA 4IDZA 3ZIXA 4D3WA 3I54A 2VBBA 4E2SA 3KV4A 4GB33 3W9AA 5A3OA 4UBHA 1QJY1 4W6WA 4XUOA 2ZZJA 5I8YA 2VMGA 4O9GA 1JHNA 4XILA 2OKXA 1EYBA 2D97A 4AEDB 5FXWA 4FPOB 4L9BA 4AHXA 2R1DA 4AHYA 3EHKA 5A7NA 3VZJA 4N43C 3SHRA 5C9AC 1LHOA 5IUQA 4GALA 2NQYA 1LCLA 1RVF3 4TTGA 3WHUA 4QXHA 2RM23 3MEPA 1YC61 1IPSA 2YU2A 4Q5OA 4UAPA 4CU6A 1ZVFA 1O91A 3AYCA 3KD4A 1QJZA 3MI8A 4Q4Y1 2MEV1 3K3NA 3LA2A 4PDWB 1N47A 5L9VA 3BU0A 5CKQA 1LOGA 1Q5OA 1RUF2 1IG3A 4OVEA 2B42B 1NLRA 1JU3A 3Q8CA 1OC1A 3HJRA 4RFRB 2W47A 5EYXA 1BEV1 5C3RA 5C7GA 4JHZA 4BK5A 4XF0A 3GZAA 3CJXA 3AMQA 1MVEA 1AVBA 3JCIA 3ACLA 2JENA 3OY8B 4AVBA 3O0VA 4XXPA 4E2QA 1RUH2 1W8UA 4XJUA 5JIUA 3JXSA 4IE7A 3SCFA 4AVSA 3S7IA 3HBKA 4S2GA 2VUDA 1W8TA 3FUQA 2UYAA 4XHXA 3KT4A 4GJZA 3BVCA 1EV11 1GQGA 4FPLA 5AVAA 1W0OA 3U07A 3WCRA 1NY71 3O5SA 3ZO0B 4QGNA 1WZXA 3ASIA 3B5LB 3T1LA 3BI3A 3K48A 3AZWA 3ABZA 2WJSA 2P3YA 2LRPA 3FJSA 5EIYB 4LOSA 5K0UA 3SH3A 5AC93 4YVWC 1O8SA 1Z7S1 4CP2A 2VZOA 4DB5A 4OQ9A 4CDXA 4M3CE 1FOD1 3LEGA 1ENXA 2B8MA 2EIEA 4E4SA 5IVBA 5LB6A 3VZMA 3WNKA 2TBVA 4LHNA 4CDUC 4PIXA 4AI3A 3IMMA 4NPMA 1ND3A 3DYOA 1G7YA 4AEDA 4CEYB 3P3PA 4MYEA 4QKBA 2C6SA 1QQP3 3ZSMA 1SBFA 1RIRA 1SFNA 3SQOA 4XBQA 3E6BA 3E97A 4R9AA 1O5LA 1FXZA 2F4PA 1LGNA 2VCMA 1V9U3 3MO4A 4FOVA 4QX2A 4CU7A 1YQ8A 1R1ZA 3OPTA 4EV0A 4LE4A 3MV01 1BCXA 4HOOA 5LASA 1J3QA 1W8OA 1PMIA 2CV6A 1EAH3 4SBVA 4QB6A 1H4GA 1C8M2 1PK6A 2ID4A 2XR4A 5FDBA 2ZS6B 2R6QA 5C5TA 1HN1A 3M3QA 4JGYC 1SDDB 4EWEA 1S0GA 3ZSEA 5ACA2 3ACHA 3J26N 5J98B 3DPRA 2DUQA 4HKLA 1YFYA 5L9RA 1DHKB 1GSLA 3I2GA 3N9MA 4P9WA 4DY3A 2R16A 4QGLA 5F3IA 5FYTA 3WG1A 4AEJA 5LK7B 2XJQA 3WF3A 4SLIA 4LOTA 3KB5A 4A6SA 5JI9A 4XURA 3OY8A 5T5OA 2WZPP 4XFIA 1V00A 3KLSA 3RJRA 1OUXA 1YNAA 3U4XA 1V6OA 1QJY2 4FQZA 4A41A 2W87A 1F4HA 1EY2A 1JH5A 3HR9A 4Q26A 3ORJA 5A33A 2FDIA 4N9IA 3WUCA 2WAAA 2PHUA 1E57A 3KV6A 1GYKA 4B7EA 4JRAA 3FE5A 1DLLA 1US3A 4JRLA 4NUBA 2ZGOA 4FVVA 2Y60A 3ZYRA 2AC1A 3FUOA 4TWTA 1T6GC 3I2IA 5BNNA 3QACA 3ACIA 3BYWA 4QHBA 2ZEXA 2RS53 4QPGC 1DGLA 4LKSA 4N7IA 3VN4A 4AI9A 3ZN5A 4Q4Y2 3NNLA 5JWPA 3UGFA 1A3KA 3ZIWA 1NYWA 2GN7A 3H8XA 4BQ1A 2GC2A 4XFHA 1OFNA 4CEYA 1PO11 3V0BB 1OH4A 4PQQA 2KD7A 1M06G 3BTAA 2JB4A 3IIIA 1TG7A 4AR2A 1BEV2 1O4TA 1W6PB 2P2KA 2YYOA 1UMZA 2Q30A 4UWDA 3K4DA 5A80A 3TN91 3O1MA 1UZ0A 2KR2A 3NRUA 3LSEA 2WZEA 4QB1A 5FZEA 3R05A 4CE8A 3FFZA 1LHWA 1CAVA 1RB8G 3OJBA 3PVOA 3ILFA 5JIAA 5BXXA 1WCDJ 2PYTA 4A7KA 4AHWA 4L8QA 1S0IA 1ULOA 4CU8A 4DXZA 3IT8A 2ZXQA 4A3XA 3MIEA 2RS31 3MIDA 3WW3A 5C9AB 3DKWA 5EV7A 1VRBA 1NY72 1BBT2 3POGA 4DUWA 4OLLA 1CESA 3R4SA 5DUUA 2XJPA 4ZY9A 1HRI1 3ILRA 1ALYA 5ERLA 1MEC3 1GWKA 2IVIB 2GAUA 1PM4A 4CCOA 1UZWA 1Z7S2 3LIGA 3T0BA 3C3VA 1UY1A 1FOD2 4XEZA 1GQPA 3FX3A 4CSWA 3AP5A 1R083 4E4HA 4GMP1 4ZU7A 1LJ7A 4ASLA 5FKBA 4BQ3A 4P5HA 1ND2A 1HW5A 1XBFA 2ZX1A 3POBA 4FPEA 1CZTA 3OGVA 3ZYIB 1KD7A 4MZUA 1J1LA 2I74A 1W2TA 3M3OA 2HWB1 3J8F1 4L11A 2WWJA 4H14A 2PXJA 3VHNA 2HWD3 2VTFA 4LO7A 1ZYBA 2XQRA 4L99A 1ZZ6A 2GH8A 2VZ1A 3BOPA 2C9AA 4NRQA 1QGLA 2RDSA 1JUHA 2NMNA 3ZXLA 3O1RA 2QNKA 4EN6B 3KT7A 4R9CA 4LUKA 1XU1A 1S1AA 2W68A 4ZS2A 1KQRA 2A75A 2AREA 4HBNA 4YARA 3WR0A 1W0PA 2IXJA 5HCFA 3ZXGA 4Z8BA 3VBUC 4Q29A 1EUTA 3BIWE 1AF9A 1W6PA 2Q4SA 2R32A 1R093 4MH0E 4Q8KA 1WCQA 1DZRA 5IAXA 4P5YA 4UBGA 5ANNA 1REEA 2A70A 4QKDA 1PVC3 4CDUB 5D1IA 3BKZA 5F32A 3U75A 4AZZA 3CZUA 4Z82A 1RUNA 4UW6A 4Y1UA 1O5UA 5EXOA 2JE9A 1OI6A 1VBE3 4AK3A 3MPPG 2OIIA 3NV3A 4N43A 3ZFEC 1ZREA 3RWKX 1XU2A 1CGPA 2RMU1 1FMD1 4E27A 4UI9L 3SNMA 4FOYA 2VMHA 4NE9A 3MUY1 4QX5A 2XKOA 2YDEA 2XMLA 2VMIA 3LCPA 1GZ9A 5FWEA 4V1PA 2QQPA 4WVZA 2EAAA 1I6XA 1A8MA 2HWC1 3ETQA 4QQHA 2WO2A 3MPBA 4JGYB 2B4KA 2ZKNA 3MLKA 4MSVA 3BB6A 3ZN4A 2WO3A 2AACA 2ET1A 3VBFA 3ZM8A 2VOVA 5A3LA 1CQ9A 4QAWA 5I8TA 4KGGA 3AP7A 2BBVA 1QJX2 4JDOA 4IUGA 4AVTA 3TEZA 4D0QA 5JXIA 5JPNB 4IETA 2TEPA 2ZHKA 4GB31 3T1MA 2VH9A 5CADA 4C1XA 2W95A 5DAQA 5F7UA 4XAEA 1XE0A 2JKBA 3TN92 2E31A 2YPJA 3HPNA 3N7JA 1H9WA 2E32A 4QD2A 5F1RA 5FLHA 3W5MA 1F5FA 1H2NA 4OHWA 1JZ4A 3O1TA 4FCAA 4BJ0A 2D5FA 3KCCA 3BODA 1ZA4A 1OLQA 1UYXA 5F5QA 3SITA 1XXNA 4CDWC 1RMU3 3VBHC 3PJQA 5FO9B 2ES3A 2X8KA 3KHBA 1JMUB 5IT6A 1QWRA 1JXNA 5FJKA 4DFSA 1CPMA 3B7MA 5IK8A 2RM21 3NKTA 4GD4A 5FPBA 3ZMNA 5L7OA 2VZUA 4NRMA 4YVWA 3WUDA 4LO6B 2V72A 3APBA 3VV1A 1VMJA 1PNGA 1HRI2 3Q9OA 2BWAA 2WNUA 3LGRA 1J3RA 1C8M3 5LW9A 4CDUA 5BYNA 3AB0A 1PZ7A 1YO8A 4P00B 5E89A 1AXYA 2Q5TA 2RJLA 1HN0A 4AE2A 5I91A 4I02A 5IFPA 4X8PA 4XJZA 1XNDA 3WF1A 2OQ6A 1FNYA 3RYKA 2WR9A 5IWFA 4M3CA 5KHJA 3CKHA 4BE3A 2H6CA 2HWF2 3B69A 1WMDA 1POQA 5LRRA 5FY4A 3RWNA 2JECA 3UKTA 1AR72 1WA4A 1LAJA 2LTNA 5HV0A 3D82A 1VBA2 2XVKA 5FZHA 4BQXA 3J8F2 4XE9A 4IEXA 3ZDVA 3C7GA 3KMHA 4YW4A 3BTZA 3KZ4C 1COV3 3NNMA 3NAPC 2E53A 1GU3A 3F95A 1CX4A 4COVA 4XJAA 3TB0A 2BFUL 2DVBA 5FK7A 5FWJA 2D6MA 4ZU4A 3LPFA 4NIGA 3N36A 4ZZ5A 2E7AA 1YFXA 1PX3A 1E5IA 4Y4RA 3MIGA 1A6CA 4CP0A 3KSCA 5LBFA 5AC91 1LENA 3AKSA 4OULA 5BNOB 3EMRA 4CUGA 4KNCA 4CVUA 2W1QA 2LS6A 2WC2A 4UFLA 3SCHA 5FXVA 3D5OA 4W65A 2C26A 2VZTA 4F7ZA 2ZGNA 3LDKA 1HIXA 3D3AA 2PHWA 1QQP1 2VQTA 3MF6A 2EIGA 3ACFA 1NOVA 3VD3A 3ZPOA 4NAOA 5T5PA 3PNAA 4ZXEA 1XSQA 4P08A 1VIWB 4P9LA 1V9U1 2GU9A 4URAA 4QPIB 1IKQA 5DXDA 3N7MA 3MW4A 2CAVA 1FMD2 4KWLA 4XJWA 3CBNA 3GCXA 1EAH1 4IEVA 1FT9A 1C57A 2VZSA 1LULA 2PHTA 3KQRA 4QPGA 3IB3A 2Y6GA 2VR4A 5FO8B 4FP3A 4MOAA 3AKRA 3T4HB 1ZZ7A 3HEIA 4R4XA 4WZCA 1GICA 4FPFA 4YW1A 1SPPB 5I8SA 3N9OA 3I3QA 3WEZA 3PJYA 2VU9A 3VBUB 2QBXA 5BY5A 1DDLA 4Q1PA 5DAPA 2E7QA 2G1MA 2YXSA 2Z42A 4YRDA 2VZ3A 3O1OA 3VHRA 4HXCA 1URXA 4K7JA 1YQ6A 4GKYA 4LE3A 2EXJA 4AVCA 4FXGB 4LHSA 2J1AA 5FZ8A 2FD8A 2QTWB 4ZONA 4DUVA 1DQ5A 2WLQA 3TNPB 5KXDA 5I0DA 3WQ0A 3QOPA 4W8JA 3VZKA 1X7NA 1MZ6A 5FY9A 5CFCC 4FTSA 5DUVA 4Q4X3 3I3DA 3DECA 4XF3A 3RZKA
chains in the Genus database with same CATH topology
1OOPC 1Q8PA 2JXAA 2UY9A 2UWCA 1RVF2 2RM22 4YNIA 3A0NA 1AL22 2GNDA 3M8LA 2RS51 3O7OA 4Y22B 4YGCA 3USUA 2A6WA 3A4UA 4MGYE 1GZCA 2R0FA 3OGGA 3AJYA 4KQ7A 3JD73 3RYPA 1N1VA 4B4RA 4UW3A 4KWKA 2K9ZA 4LLOA 3VHOA 2XBO2 2XJRA 3WV6A 4BWOA 1I5ZA 3D0JA 1YYNA 4IV1C 2R062 5T52A 5CAZA 1MZFA 4TZDA 3ZXKA 1LODA 4BLIA 1REFA 2VW2A 4NWWA 4LO5B 3ST7A 3UJQA 1H9PA 2A6ZA 5H9QA 4BPZA 1S2BA 4LBLA 2DCZA 4CDWB 3VBHB 4XFGA 4I3GA 5L36A 3ZYPA 1XNCA 4K21A 3WQ7A 3VBUA 3PHMA 2ZHLA 2P17A 1MEC1 3ZYJB 2R072 2ZAHA 4ORFA 5AC92 2AUYA 1DQ4A 1C8NA 2JD4A 2PAKA 2F6BA 1AUYA 1R081 4LA3A 4NR1A 1PZ8A 3ZXFA 4L2NA 3R0RA 2DU0A 3MGUA 3OBRA 1QQP2 4GXLA 3WZ1A 3ZFEA 5FPXA 1QJX3 5JR7B 4TSVA 1V70A 3N4MA 2BVBA 1BVP1 3L2HA 5FBZA 2ZOEB 3ZXJA 2HWD1 1ZRFA 5K9YA 1N3PA 4HK8A 1Y3TA 1O3SA 2FZ2A 2W08A 3GF6A 5FQ0B 2ZHMA 2DCTA 3RQ0A 1D0GA 4Y22A 1EAH2 2A6XA 3ZPYA 3EXUA 3R6SA 4EWDA 1WW4A 5FOBB 1QOSA 3JQWA 3GNEA 4HT1T 1IS3A 5C4WB 4KGQA 3FHIB 5T5LA 1R091 3AFKA 5J7MA 4FOWA 5AVPA 3QH6A 3RPQA 2WZR3 5FCCA 4AW7A 1PVC1 3MFAA 2D3SA 2CWSA 1RUF1 4YZ5A 4EROA 1PZ9A 3VZNA 3BPZA 5A32A 3ATGA 1VBE1 2BGCA 4FXKB 4CDWA 3THTA 3U0ZA 3SCGA 3WX5A 3EQEA 3IM0A 4XFFA 3ZFGC 4BIOA 2DFCA 2HWF3 2NM1A 1AR73 1DBNA 3I8TA 2NN8A 1YJKA 4RGAA 1VBA3 1GKBA 5DUXA 1UZYA 4LNVA 2QE3A 1VAMA 2FQPA 4XF4A 2OPKA 5EZWA 3DUIA 5JLVA 3P3NA 4ITCA 2BNNA 5DG2A 2QZ3A 3I7DA 4DRVA 3RI8A 1RHI3 3SH4A 4AI0A 4RS5A 4NOTA 4Y26A 1TEIA 1O4ZA 3HD8B 4NHKA 3DV8A 1OKQA 4GA9A 4I0AA 2FHRA 3OYWB 3WCSA 5KXEA 2LUWA 1YCIA 3AP4A 3LWCA 2JG8B 4NVPA 5FQ0A 5JVVA 3VBOB 1DGWX 3NAPA 4WVVA 5E8AA 1ASJ2 3HMYA 1RMU1 3IN9A 5GLUA 3AYDA 1C28A 1OA4A 3W58A 2CWMA 1FPN3 1OOPB 4E2GA 4JGZA 1W6NB 1QY4A 3D8CA 2D43A 2YY1A 1AR63 1G9AA 3WVJA 2WWSA 5GZEA 2IZWA 1IQAA 2EF6A 4DRRA 3EJKA 4AI8A 2E63A 1MEC2 4XTPA 1C8M1 2XJVA 4IERA 2VW0A 3MFCA 2QZ2A 4COYA 3AJZA 2CNAA 4YW2A 2JJ6A 4INDA 4K3UA 4ZKTB 2AZ5A 2EXHA 2RS13 1X36A 5CNAA 4OHYA 2HWE3 2YC0A 3PVNA 3V0AA 1R082 4LHKA 1TQ5A 3B02A 2XLGA 2DWRA 4GKXA 2GZWA 1YUDA 4XQWA 5CA6A 1MS9A 3WW1A 4LBJA 5CU1A 4HN1A 5GLZA 2HWD2 1FX5A 1COV1 1H4HA 4I0WB 4Q0UA 4FTEA 1LECA 3RYRA 3NWKA 2A7AA 3IDCB 1RUE3 1V6NA 5JSOA 2B5HA 2N7GA 1H2MA 3KCYA 3HBZA 2P3KA 4MGKE 4H7MA 4AVAA 4D69A 1AL23 1R092 1SLLA 4LBNA 1AXZA 2QJVA 5FRAA 3GHNA 4P9GA 1N1YA 1ZM1A 5GLVA 2G9FA 1JW6A 2W39A 2WT1A 4D7SA 1PVC2 5J09A 4JVAA 1IOAA 3WHTA 1WGPA 1RC6A 2NP0A 4DMIA 5CFCA 1AJKA 3WXPA 2WT0A 2IXHA 2XBO3 4YGDA 1VBE2 1DGWA 4ZU5A 1W6NA 2DTYA 5KXCA 4N53A 2R063 3DL3A 3MICA 4BMEA 3BOWA 4AI1A 3SLIA 1JBCA 4J6GA 1LOAA 2ZGTA 2UU8A 3TBDA 5LRSA 2Z5WA 4R52A 1QJU2 2UY8A 2Z69A 3VZLA 1BBT1 4PBPA 1AL0G 1Y9QA 3NKGA 2BUKA 4OI4A 4EJRA 1F9KA 1NZCA 2GDFA 2R073 4IV1A 1H1AA 5EYYA 3G7DA 4W6YA 1XE8A 2VUAA 1AYM3 3GBWA 4I09A 1KITA 1RUC3 3UV9A 4HPKB 4RR3C 2OA2A 1QXRA 2DV9A 4Q4X1 2WINB 1RMU2 3ZFGB 1IS5A 2PQQA 3GZTB 3O0WA 5JSPA 2PHRA 5KHGA 4UW5A 1W6QB 4AFCA 2DF7A 1NE4A 5JZGB 1KJRA 3ROUA 2Y0OA 1WLTA 1BMV2 4CDQC 1GZWB 4CYDA 5SV8A 2D40A 1FI2A 1HV0A 4N7UA 4PDWA 3DN7A 4QQLA 1QXPA 3JD71 3E6DA 3GHMA 3IKWA 4K6BA 4OZXA 1D4M3 2XVGA 3RMXA 2JG9B 4P14A 5I0SA 3M3CA 3VBRC 2VQAA 2D98A 4Z92B 2O1QA 2QKDA 1O3QA 3SXWA 1CAUB 2Z2SB 1LOFC 3MDPA 4H3WA 2A3YA 5JOWA 1UF2C 1UU4A 4YM3A 3RSJA 1COV2 4DPNA 2ZMKA 2WS92 1NQDA 5EWSA 5J36A 4MUVA 3WDVA 4B3NA 5E1RA 3H1MA 5HCBA 3INAA 3JUUA 2XJSA 1LGCA 1WMFA 2ZTNA 1LU2A 3PMSA 2BWCA 3GBFA 2B9UA 4XFAA 1DG6A 4P9XA 1LKNA 1SCSA 1MQTC 4Q1RA 1V6KA 2Q1MA 4YZ1A 5GZCA 4AGGA 1QJX1 5LK5A 1RUG2 3RDIA 3ZFGA 3LOBA 5H9RA 5C33A 4MVTA 2GNBA 3RG0A 1RUD3 4NWVA 3D6EA 3NW4A 5T3NA 4NHLA 5FMOL 1LR5A 1ULEA 2FMDA 3RRDA 1BZWA 3KCXA 4YYOA 3IPVB 3H9AA 1ASJ3 2O8QA 2WNVC 4C0BA 1QHDA 1PNFA 5HI0A 4XIKA 3BALA 1JN2P 3AK0A 1NQJA 4XQDA 1H8TB 1I1EA 1RUI2 2K2SA 2WZR1 4C0HA 3UKVA 4PIYA 1YI7A 4YM0A 2PA7A 5BNOC 4U36A 3ALQA 5JI7A 2OZJA 4AGVA 3VZOA 2VECA 1OQEA 4TYSA 4XJ9A 1Q8SA 4MV2A 2HWF1 4Q4X2 1AR71 2HEYF 5LEKA 1SBEA 1VBA1 2VUJA 4HZFA 3CNAA 4LO4B 4YLZA 4QPIC 3WW3A 2EA7A 1FAYA 1POV3 2PHFA 1HQLA 1QNWA 3WINE 2H0BA 4AQ6A 1LEDA 5C8WA 3NL1A 4AFBA 1UD1A 3MIFA 4WBBA 4XW3A 3FLTA 2WKKA 4Q0QA 4ATFA 1C4RA 1RHI1 1RUJ2 3JD72 2AH2A 3V0BA 5B2GB 2ZX2A 1YIPA 4XTMA 2Z79A 1K5MC 4K8FA 1CAWB 2DUOA 2WQZC 4NHMA 4RL7A 3N7KA 5KHKA 4WVMB 4ES9A 1J58A 4HSLA 1LHVA 4MLOA 3IPVA 2YMZA 4KG8A 2WFF3 4RR3B 3OGJA 3CF6E 1FPN1 2VVDA 3I59B 5JCTA 2DCJA 1AR61 5C9AA 4QM8A 1WLWA 3N3HA 2CL2A 1LTEA 4BCUA 4EN0A 2A73B 4JC1A 2ZGKA 4XBNA 4IEWA 2ZABA 3D4KA 1KXGA 3CJIC 1B09A 1AR83 3H1WA 4CDQB 1UX6A 2RS11 5E88A 1B35B 1QOOA 3N35A 2HWE1 2PFWA 3ELNA 3GALA 1C5HA 3M3IA 1ENQA 2Y38A 4LTAA 1RGSA 1LB2A 2GNTA 1ZZBA 1VBC3 3B93A 1KFXL 1QJU3 3MW3A 4QMAA 2EXKA 3VGIA 1OD5A 2R0HA 3VBRB 1VBD2 5CG8A 1FV3A 3B01A 1REDA 2O8OA 4Y20B 2ZGPA 3AP6A 2XVLA 4CP1A 2E9QA 4MXWB 4JV4A 2XL7A 2YGMA 4XPVA 1NCRC 5AFBA 1UKGA 4XFCA 5T54A 1GNHA 3H3UA 3ZXDA 2ZA9A 4NN0A 1QU0A 3VBSB 4LULA 3S30A 1HRV2 1RUE1 3V56A 1WUVA 4U2AA 1RTVA 4FSJA 1RVF1 2ZGLA 5IK7A 1AX0A 1CAWA 4JAAA 5CFDC 1AL21 2WLPA 1OLRA 3VLBB 2D3PA 2WZR2 2D6KA 4G9SB 1MQTB 4QM9A 4OUMA 4RA0A 1OSGA 1Y43B 4RR3A 1LHUA 4GWNA 4BIFA 1WBFA 2LM3A 1H0BA 2XBO1 1PGSA 4COZA 2UYBA 5D8AC 2R061 1LOBA 1FYUA 5BNQA 2DUPA 1MS8A 5C8CB 3WD5A 1Q43A 1RJ8A 1CJDA 2Q0AA 5FO7B 1QF3A 3QBQA 4X6RB 1OA3A 1YWKA 3JBG2 4YW5A 3MLJA 1G8WA 2WNVB 2ZX4A 4JGYA 3POSA 4K1YA 2WS93 1QKQA 4Y1YA 3UL2A 5IK4A 1RHI2 2BW8A 1KDMA 1WLCA 5GZGA 2R071 1BYHA 5C4WC 1A8DA 1W2UA 1KJLA 1UAIA 3ZXEA 3E6CC 1YIFA 1XYOA 3B3QE 5C6CA 1AYM1 1H1MA 1LOFA 1V6LA 4OI0A 4MXWA 1RUC1 1DQ0A 1W6OB 2NLRA 3ES1A 5J48A 2P34A 2WT2A 4A7YA 1BVVA 1RUG3 4WM8C 5BUVA 2VY0A 3LSDA 4XOGA 1FPN2 2DCYA 3NV2A 4AYUA 4EN8B 1AR62 2GC0A 4XXAA 1ENSA 4JDMA 4M3CF 1X50A 1PGW2 2RHPA 4XFBA 1MQTA 4B29A 4IEUA 5FLJA 2RS12 4X8NA 1XE7A 2HWE2 1D4M1 2D6LX 4A7ZA 5FPZA 2R043 3ZSKA 2ZKLA 1K5MB 1CONA 1YHFA 1X8MA 5BNPB 3POYA 2WQ4A 4ZXKA 1RUI3 1OQ1A 4CZSA 3HIFA 4YM1A 1NE6A 3WG4A 3ME2A 2BTVC 1HXS3 2DTWA 3FWEA 1SEFA 4LBMA 5DZGA 4B7KA 4I2OA 1VJ2A 4N90A 2JG8C 4META 2B46X 2X5IC 3VBOC 2WA3A 5GLTA 4ISRA 3QH7A 3AFGA 1UIJA 2QFEA 3AYEA 5JOZA 1EV13 1RUE2 4GQ7A 2I07B 2KA3A 2CGPA 4BH9A 3OD4A 5K8SA 3O14A 2A5ZA 5GLWA 2VPVA 2ILMA 4AEKA 2X53S 3CJIB 5BNOA 4KH9A 3FLPA 5DG1A 1ZBA3 1O4YA 5DDJ3 4Y1XA 1RITA 2GMMA 4JTOA 4Q0PA 1ENRA 1RUJ3 4G3YC 5ABJB 3QCWA 2WNEA 1ZRRA 5KC5A 3VDDC 2AYHA 1VAVA 1PM7A 1QNYA 4MXVA 3NSTA 1RUD1 1RL3A 4QPIA 2IXLA 2TNFA 2JE7A 4BOWA 2X29A 2ETEA 3A0KA 4BZ4A 2VQ0A 4YG3A 1ASJ1 1NCRB 1UL9A 3VKFC 1W39A 5L19A 1CN1A 4BA6A 3UKNA 2OUHA 4FOQA 4IV3B 4MGZE 3NO8A 4S2FA 3L9JT 1ZZ9A 4YVSB 3ZSJA 1K5MA 5CFDB 4HLTA 1IZ3A 2D6NA 3U10A 4I0BA 5L73A 1VRH3 4DNYA 1TME2 1AYM2 2WL1A 4JCKA 2BQPA 4EN7B 1EPWA 3SISA 5I0TA 1RUC2 1ND3C 1ZBE2 2B7YA 2KXLA 2IFRA 1G9DA 4HMZA 5T5JA 5D8AB 2BPA2 1VBD3 4YM2A 3PVBB 1D2SA 5DZEA 1POV1 1NXD1 4P9YA 4HK9A 4JQRA 4LBQB 4H55A 1KS4A 4D7TA 2GMEA 3PVEA 1UKRA 3B9CA 1BXHA 1G86A 2D44A 2NYYA 3IMNA 4FPKA 1S0EA 1G9FA 1HRV3 3FBYA 4GULA 5E16A 4UW4A 4BM8A 1D4M2 4KG0A 4LO8A 4Q0SA 4HKWA 2XJTA 3UK9A 1SQ4A 2VNOA 1DQ6A 4Q4W2 2WFF1 4WM7B 1DU3D 1NCRA 1IS6A 4OHXA 4YG6A 4DY5A 4XDQA 5SV5A 1AR93 1WW5A 2D6PA 4RFT0 4WM8B 3FZ3A 1S0CA 2DVAA 2FBEA 3VBHA 4IXLA 3PLQA 1H8VA 4L92A 1AXKA 5JOXA 4QQ2A 1LU1A 1PIV2 4HVRA 3ZX7A 2HJIA 5FREA 4YZ4A 1S0BA 1AR81 1OMIA 5JZGC 1VR3A 2ZPXA 3LKJA 5BNNC 3JBG3 1PGL1 1VBC1 1QJU1 1SLIA 1U0AA 2DCKA 2OW4A 4I3PA 4K40A 3X29B 4Q8LA 2GALA 5D8AA 2JG9C 1WCSA 4GH4B 1S0JA 5KXBA 2FMYA 1RJ7A 2RE9A 2KM2A 2WSUA 4LBQA 1RUD2 2YROA 3J9SA 3W59A 1HQNA 3IBMA 1IHMA 2X5IB 4AFMA 4XF1A 5JMCA 4YSFA 3PTYA 2XB6C 1QXJA 4YGBA 4EWAA 5EFUA 1LOEA 4MGIE 2YGLA 1XNKA 4LBQD 1U5XA 1CAXB 2D6OX 3WP3A 2PTMA 1UU6A 3I4IA 4AK3A 1D2QA 3TAYA 5C4WA 3FFQA 1N3OA 2DU1A 3WP4A 4DINB 1BK1A 3WQ1A 1Q8QA 1NA1C 4OUSA 5BPXA 1UN1A 3HT2A 4HVQA 1BMV1 4AWDA 3MIHA 4HKOA 1J3PA 2C0ZA 4JDNA 1WW7A 2A3WA 5CIRA 3LAGA 1R1A3 2PAMA 4P9IA 1ULDA 3VDDB 1SLBA <