2GMPA

Metal-free (apo) p. angolensis seed lectin in complex with glcnac-beta(1-2)man
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
228
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPNQVIAVEFDTFYSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin
publication title Interplay Between Metal Binding and cis/trans Isomerization in Legume Lectins: Structural and Thermodynamic Study of P. angolensis Lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 228
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gmpA00
1I3HA 3ZXKA 1LGNA 1RINA 4H55A 3RQ0A 2AENA 3VKNA 3WVJA 4AGRA 3V0AA 4Y1YA 2A70A 4NOTA 1QDOA 2JDZA 2ZMLA 1Q8OA 1CESA 2ZGKA 4M01A 3WCSA 2ZZJA 5E8AA 1HKDA 5GLUA 1GSLA 2WT1A 3OPZA 4FOVA 2ZGQA 4W65A 4XXAA 4YW3A 5CBLA 3POYA 1VALA 1A78A 1SLCA 1JUIA 1S0EA 4ASMB 3HR9A 1KRIA 1SFYA 2ZGMA 3MW2A 3O5SA 3OYWA 5F5QA 3UK9A 4D69A 1WW4A 3A0KA 1F31A 3OBRA 4XMIA 3ZSJA 1PZ8A 2NYYA 4PF5A 5HCAA 1CPMA 2A6YA 3N7LA 4YGEA 1W6QA 2ZACA 4MYEA 3OY8A 2A71A 4LBKA 2R0FA 5KXCA 4Y20A 3AYDA 3NV4A 5GZCA 2EXJA 1LGCA 1YYNA 3O0VA 2JECA 2CY6A 2P37A 1N3QA 3OY8B 5T55A 1SCRA 1LHUA 1WD4A 2VUAA 4Y20B 1AVBA 1OFSA 3KM5A 3D5OA 4K1ZA 3TB0A 3ZXJA 4XE9A 3SNMA 3R05A 4WVWA 1OKQA 2GN7A 4YZ3A 1MS9A 5IK5A 3M3OA 2ZHMA 1WW7A 4Y1XA 4YZ2A 1GNHA 4YLZA 3IM0A 3ASIA 2A3XA 4F83A 4M3CE 1QOTA 3GNEA 4ISRA 1FV2A 1W6MA 2YZ4A 1UL9A 3SH4A 1LTEA 3NV2A 1DFQA 3NWKA 3OGGA 3BOPA 1G9FA 2PHXA 2WJSA 4Y22A 4LBQA 3SISA 4BLIA 4XJ8A 3PVNA 3LSEA 3T2TA 5GZEA 1SLLA 1APNA 1ZA4A 2GALA 4BM8A 3LCPA 1A8DA 4Q1PA 3WUDA 4PCRA 4YM0A 2ZBJA 2ZGSA 4M00A 1JXNA 1IS5A 1VLNA 1W6NA 2DUPA 1ULDA 1AXYA 1MACA 2GN3A 3BTAA 3AP6A 3VKLA 1CR7A 3AYAA 2FMDA 2VW1A 1LHVA 5JOYA 2WT0A 2P3KA 1V6OA 1N3OA 1W6NB 2D3PA 2DYCA 2RHPA 2ERFA 5T5OA 3AZVA 2FHRA 3FLTA 2OVUA 1ONAA 4ITCA 2GMMA 2OUJA 4LBLA 1G86A 2GDFA 2YMZA 1DQ5A 4YM1A 4C1XA 3ILFA 1N1YA 2GNBA 3WG1A 3AXDA 1C4RA 2E53A 2HYKA 2EIGA 4XHXA 3PVOA 4P9XA 2C9AA 2EXKA 1DQ0A 4Y26A 4AVTA 2W52A 1QNWA 3WHUA 1WD3A 3T1MA 4GA9A 3AP9A 3N36A 4LBJA 3ZYPA 3IPVA 4WV8A 2CL2A 1S0BA 3V0BA 3JU9A 1ULEA 5CNAA 2DVFA 2PELA 5L73A 2AH2A 4XMAA 2DVBA 3WG2A 3IPVB 4Z8BA 1GICA 1S0DA 4Q2FA 1KQRA 2AUYA 5KXBA 1ULFA 1LODA 2WQZC 1PZ9A 1LOCA 4FPHA 5EYXA 1AX1A 1Q56A 4XTPA 4M3CA 4Y24A 1HLCA 1MS5A 1V6NA 4NO4A 3ZPYA 3ZYRA 2CWSA 2WKKA 3WDTA 2P3IA 3PVEA 4YW4A 3NV1A 3U4XA 5GM0A 2A6ZA 3POSA 3VKMA 4YG3A 1BKZA 1DQ6A 3MW3A 1N3PA 1SLIA 5F9TA 4AWDA 5DUXA 1N47A 3ZSMA 2ZMKA 1SBDA 4XJZA 3T1LA 2EXIA 4K20A 1O4YA 1WW6A 3FLRA 2R1BA 5T5PA 1WBLA 2ARXA 5LK5A 2V73A 4XILA 1HQLA 1SCSA 3B69A 4FPCA 4BLJA 1QF3A 3WDXA 4FPKA 2DV9A 3AZYA 1GZWA 3W59A 1BYHA 1QNYA 3N7KA 1D2SA 4FPLA 2ENRA 2A75A 2PHTA 1A3KA 1GZWB 4XDQA 5KXDA 2OUHA 3ZVXA 2PHUA 2DUQA 3LSDA 4XZPA 2XB6C 1JYCA 2AREA 3QLQA 1W0PA 1Z0HA 5GLWA 5JOWA 1SACA 4FQ4A 1GKBA 3MW4A 3AZWA 2A5ZA 1FATA 5H9RA 2NP0A 4GKYA 2VW0A 5T54A 1UAIA 1J1TA 1LOAA 2YROA 4PQ9A 4RA0A 2JE7A 1AJKA 1W6PB 3SITA 1YRZA 3W58A 2GNMA 1LOFC 3HN1A 1UMZA 2ZAAA 3AFKA 4BPZA 1QMJA 2WSUA 2ES3A 3DUIA 1DQ4A 3AX4A 1SBEA 3I4IA 4XJ9A 2DURA 2VH9A 4FPYA 2E7TA 2ZGUA 5EYYA 3N7JA 3ZXEA 1FX5A 2D3SA 4FOYA 2NN8A 3ILNA 4YGDA 1YIFA 4BMEA 4FOQA 5AVAA 2C5DA 4CZSA 4C1WA 2ZKNA 3HMYA 4Q26A 1LOBA 1W6OB 3VUOA 1DYPA 2EALA 1LHNA 3USUB 2WNEA 2Q5TA 4KBBA 5T5LA 3AK0A 5GLVA 3SH5A 4CTEA 4BQ1A 1S0GA 1LHWA 3D4KA 5H9SA 3AP4A 5T50A 1MVQA 4PBPA 2DUOA 3IN9A 4YZ5A 3KQRA 1MS1A 2D3RA 3UL2A 4L8QA 1ZM1A 2Z42A 3ILRA 4YFWA 1VAVA 4GALA 1QKQA 2DTYA 1GBGA 4XXPA 5DZGA 5IUQA 1G9DA 2VY0A 2ARBA 1Y7BA 4U2AA 5DG2A 1F9KA 3WG3A 3C2UA 3FFZA 1KITA 1WUVA 4XHBA 4YW5A 1S0JA 5IK8A 2DU1A 2WSVA 3POWA 4TYSA 4XOGA 2D6PA 4ZKTB 4R9AA 2JJ6A 2GMPA 1AZDA 5GZDA 2ZGLA 1UPSA 3WDUA 4GKXA 4AYUA 1RIRA 5KXEA 4BOWA 1SLTA 1ENRA 4DRRA 2ZHKA 4OZXA 1MS3A 4K1YA 4AGGA 1VAMA 1G7YA 4DRVA 1N1SA 2KM2A 1QOOA 4WZFA 1W0OA 2WT2A 1BQPA 1GZCA 1WLDA 1IOAA 1DBNA 2CYFA 2JD4A 3ZXLA 5E89A 2TEPA 2ZGOA 3N7MA 1MR5A 2NMOA 4AVSA 3WNXA 4XBLA 1WCSA 5GLZA 5IT6A 3PJQA 1G9BA 4K21A 4XYXA 1AF9A 2A6VA 2A3YA 1IKQA 1EPWA 2ZGPA 3A0NA 4P14A 5HCBA 1BJQA 2D6MA 2VU9A 1V00A 3WDVA 3M3QA 3IMNA 3AXEA 3AP7A 1R1ZA 3VKOA 4R9BA 5GLTA 1LHOA 2DVAA 1C1FA 1MS8A 4AGVA 2D6OX 1GYKA 1DHKB 1ULGA 3D6EA 2GNTA 1TEIA 3FUQA 4JCKA 4BMBA 1S0IA 4Q8LA 1BZWA 4XIOA 1LJ7A 2W39A 3MEPA 1LOGA 1QGLA 1LGBA 3JUUA 1DQ1A 4LBQD 3AZZA 1B09A 1URXA 2NMNA 2UURA 4UW4A 2DVGA 1FNZA 2A3WA 2P34A 3M2MA 2PHWA 1DGLA 1WLWA 2LALA 1V6JA 5JLVA 3R4SA 4FPEA 4YG6A 1WLCA 3AJYA 4ATEA 1SLAA 4IQPA 3WHTA 3VKFC 1LULA 1KDKA 1Q8SA 1DLLA 2AGSA 1FYUA 5CB7A 3WDWA 3M3CA 3GALA 2R1DA 1LENA 1ULCA 3O0XA 4FP3A 1G9AA 3WUCA 2P3JA 5T5JA 3RS6A 3SLIA 4UW3A 3I8TA 1C57A 4LBMA 4XJAA 1YXWA 4JRAA 1GNZA 3O12A 1D0HA 2ZGNA 4P9WA 4HANA 2E7QA 2SLIA 1G8WA 1W6PA 5IK7A 4YGBA 4YZ4A 1V6MA 5DZEA 5CAZA 2YV8A 4FQZA 4JC1A 5DG1A 1JBCA 2UWAA 3N3HA 4FP2A 4TZDA 4RL7A 2A6XA 4Y1ZA 1H9WA 3B3QE 2JE9A 4PBOA 2E51A 1AX2A 1QOSA 2CWMA 1JW6A 3AP5A 2UU8A 3H0OA 3V0AB 1H9PA 4FOWA 1AJOA 4UW5A 4HL0A 2DVDA 4GWMA 2W68A 2ZA9A 4FPGA 1N1VA 1X50A 2D6NA 1DQ2A 1W6OA 4UW6A 5GALA 1LECA 2R49A 2XG3A 5CA6A 2NM1A 1VIWB 3SH3A 3USUA 3INAA 4P9YA 1GLHA 3QCWA 2DU0A 3AJZA 3AYEA 1MVEA 2ZGTA 5FRAA 3OYWB 1NXD1 1ENSA 2CTVA 2DTWA 1UZZA 2WLQA 2YY1A 1LCLA 5E88A 3VV1A 2W08A 3RRDA 3FBYA 1F5FA 4DS0A 3AYCA 1W6QB 3TAYA 2D44A 5IK4A 4U36A 2I2SA 1YI7A 3BODA 1LEDA 1IS3A 4I30A 4FPOB 1XQNA 2PHRA 2CNAA 2EXHA 2ZMNA 5EWSA 3WG4A 1CPNA 5GJ6A 1LESA 2AR6A 1CQ9A 2VW2A 4GWNA 3O0WA 5T52A 1C1LA 1AX0A 1CONA 2ZHNA 2ZABA 2BQPA 1S1AA 3FUOA 4FPJA 1Q8VA 2PHFA 1QU0A 3OJBA 4FVVA 4M3CF 1AXKA 3V64A 3WZ1A 2GMEA 4YM2A 1S0CA 2A6WA 1U0AA 2R0HA 3N35A 4ISQA 5DUWA 5JVVA 3WDYA 3IKWA 3RMXA 4DQAA 4XTMA 1W6MB 4R9DA 4YW1A 4YW2A 3WLUA 1Q8QA 2D7FA 1AXZA 2SBAA 4XBNA 1LOFA 1FNYA 4Y22B 3M1HA 4LBQB 3B01A 4XIKA 5HCFA 1JHNA 1FAYA 1JN2P 1UN1A 3WOGA 5H9PA 3UJQA 3APBA 3PMEA 3Q9OA 4YM3A 1Z78A 2R16A 1GANA 1CIWA 1V6KA 3RSJA 4DFSA 4Q8KA 4Q27A 2AYHA 4LBOA 2B7YA 1DIWA 5JOZA 3ENRA 3A4UA 1KDMA 1CVNA 1MS0A 3AZXA 4YG0A 1CN1A 1UX6A 4XBQA 1N1TA 3M3EA 5DUUA 2ZGRA 4GXLA 2EAKA 1O4ZA 1SBFA 5JDBA 4XJUA 2P2KA 2NZ9A 1CJPA 1UKGA 1S0FA 5JOXA 2OW4A 1DZQA 1WW5A 4Y1VA 3ZXFA 1LU1A 5GZGA 1BXHA 4LBNA 4WVVA 3BIWE 4XJWA 1DYKA 2UWCA 3ATGA 1UZYA 3WCRA 5BYNA 1HQWA 4CRQA 1LOEA 1Q8PA 4AVVA 1V6IA 1WBFA 2UWBA 5DXDA 1PZ7A 3WV6A 3FLPA 2D6LX 1H30A 2ZHLA 1MZ5A 2DWRA 3OBTA 4Y1UA 5DZFA 1FV3A 5JMCA 2GNDA 1LEMA 1MS4A 5H9QA 4YFZA 1OQ1A 3V0BB 1LU2A 1GV9A 4R9CA 1KJLA 3CNAA 3ZSKA 1GZ9A 3R4UA 3MPPG 3V65A 1I1EA 3UJOA 1IKPA 1YO8A 3RMYA 1KJRA 1HDKA 1V6LA 3DGTA 1JOJA 4M3CB 2A7AA 2E6VA 1IS4A 2JKBA 3L2YA 2VXRA 3NV3A 2D43A 1G9CA 2V5YA 5FREA 4SLIA 5DUVA 1MZ6A 3ZSLA 2G4IA 2LTNA 3B00A 4ZXKA 1QDCA 4Q1RA 1SLBA 5SV8A 1ENQA 2EF6A 1IS6A 2H0BA 4YZ1A 1RITA 4FPFA 2YXSA 5EXOA 4YGCA 2D6KA 3RG0A 4ATFA 5GZFA 3B9CA 4DPNA 1NLSA 1JYIA
chains in the Genus database with same CATH superfamily
3H50A 1IPSA 2ATFA 3ZXDA 3ZYHA 4Q4Y2 3W21A 3WVJA 1SQ4A 4E2GA 5BNNA 4HVRA 4ZU5A 2ZX2A 3I59A 5FK8A 4G9SB 2J1VA 2ZMLA 5I8TA 1CESA 2RM22 3VZMA 3HQUA 2A1XA 1UZ0A 5GLUA 1YIPA 2PLV2 1H4HA 3OPZA 3RYRA 2ZGQA 4XXAA 2G1MA 3I2OA 1E5IA 3OPWA 4NPLA 2O1QA 1JU4A 1S2KA 4CEYC 4BYYA 1DDLA 4I3PA 2DBNA 3FE5A 3E6CC 1LKNA 2D98A 1FMD1 3OBRA 1Y9QA 1F31A 1H8VA 4W50A 3ZSJA 4KG0A 4LOSA 4QPIC 5HCAA 4UFMA 3QH7A 4YGEA 4A6OA 2ZACA 2QQPA 3H7JA 4LBKA 2R0FA 3AYDA 2O0OA 4QPGA 3VBOA 3K4ZA 2VZVA 1OUXA 4IE5A 2Q8DA 3MIFA 4E2QA 1GWMA 1W8ZA 3IDCB 5CU1A 1BMV2 3HNYM 1W8OA 1NZCA 5FMOS 1JI6A 1K42A 2XQXA 1AVBA 2YGMA 2VR4A 4ZXEA 3O1UA 3D5OA 1OVPA 2ZCWA 4XE9A 5JXHA 5FLHA 4WVWA 3TBDA 3ACIA 1YNAA 2RR11 5IWFA 4Q0QA 3O1SA 5IK5A 3HPNA 4Y1XA 4YZ2A 3G7DA 4AI1A 3IM0A 4R8HA 4F83A 5M0TA 4M3CE 2W92A 1NQJA 4ISRA 5F37A 1TME3 4BDVB 2W0XA 4A7KA 1RUJ3 4JX0A 2HWD1 3WSOA 3NV2A 4B3NA 1NLQA 1G9FA 2PHXA 2XLAA 2Y6FA 2KR2A 3LSEA 5GZEA 4CXYA 4H2AA 1PO22 3LCPA 1YLLA 1O59A 5AFBA 2ZGSA 2RS51 3HJRA 3KVBA 3NNGA 1VLNA 3CBNA 1VBC3 1W6NA 2DUPA 4ZPIA 2RDQA 3DXTA 1AXYA 1PK6A 1VMFA 3ES4A 3HIFA 4D3WA 2B9VA 1OSGA 1RVF1 3VKLA 2FMDA 1VBA2 2J1UA 2P1BA 3N9MA 4BK4A 4BQXA 4AVAA 4EV0A 1V6OA 2D3PA 2DYCA 3OUIA 1QXPA 2P3YA 4NRQA 2B4KA 5FYVA 4EQVA 1AYN1 2RS12 1OPMA 2OUJA 5JR7B 4AEDA 1G86A 1UY3A 3VD3A 1U12A 4QKFA 5A7WB 3ILFA 1N1YA 2Y34A 5JIAA 5DDJ3 1NCRC 2E53A 2HYKA 5F5CA 1IGOA 4NJ4A 3CO2A 3ACFA 4ES8A 3PVOA 3TEYA 4UF0A 3NL1A 4AVTA 5CFCA 5JCTA 5JPNB 2X29A 2P6CA 2W91A 1GQPA 3AP9A 3CZJA 4XPVA 1OBNA 3ZR5A 5JZGB 4AGRA 4WV8A 5FJHA 3KGZA 1U5YA 2WQ8A 2EIBA 3RDIA 1S0BA 2VUCA 1RUI1 4TSVA 3V0BA 2DVFA 1YWKA 2I07B 2PELA 2FCUA 2HEVF 2AH2A 2JG9A 4QHZA 4OZOA 4RQPB 2V09A 4XMAA 4XACA 1GICA 4XUOA 4Z8BA 1KQRA 5G05L 2PN5A 3DF0A 2R063 4AHYA 4DUXA 2Y6HA 1AR93 1LOCA 5FYBA 4BISA 4DY5A 2BPA2 1AX1A 3MUY1 5E1RA 4M3CA 4GULA 5A7SA 3ZYRA 2P3IA 4QB6A 3MV11 3ECQA 3O1MA 2A6ZA 2BOJA 1VJ2A 4YG3A 1BKZA 2EVXA 1NY72 3OD0A 4XUTA 1GQGA 3VKMA 4WM7B 5AC91 1IG0A 2FCVA 2RVAA 4UWDA 4CDUC 2ZMKA 1SBDA 3RZJA 2WO3A 1R081 4K20A 4CDXA 1O4YA 1WW6A 2QQNA 2R1BA 1OA3A 3T2OA 1V9U3 3WF0A 1NT0A 1EUTA 3B69A 5FLJA 1QF3A 1R092 2QVSB 4RFRB 2QQJA 4FPKA 3AZYA 4IV1A 4J1WA 4WM8C 2VOKA 1D2SA 1DCSA 2C24A 2R071 2VQAA 2ADEA 3I3QA 1RUG1 2A75A 2ZXQA 1A3KA 3OUHA 4LO5B 4LJHA 3ZDVA 1ZRIA 5IVEA 1SDWA 2W1UA 2XB6C 1JYCA 3J7NA 1Z0HA 1AR72 3A22A 5GLWA 3ON7A 5JOWA 4FQ4A 4W6YA 4BJ0A 1MPXA 3AZWA 5JI9A 4JDNA 5H9RA 5FY7A 4DOUA 2NP0A 5FMDA 2YFZA 1LOAA 4RA0A 4OMCA 1WA6X 3U75A 2PXJA 1DG6A 4Y4YA 5FZ0A 1YRZA 5ERLA 4AL9A 4BH9A 4QXHA 1HRI1 4PT6A 4N9HA 1LOFC 3PTRB 4MSVA 1UMZA 1ND2A 2WBKA 4BPZA 2H6CA 3DUIA 4J25A 5FUIA 3UKNA 4CCKA 3AX4A 2WDBA 4ZZ5A 4EN0A 4PDWB 3JB4C 1ZZCA 5FQ0A 2VH9A 2E7TA 4Z1VA 4KMQA 3ZXEA 3POBA 1VBE2 4KBZA 4FOYA 2NN8A 3ILNA 1RUF2 2Y6GA 5A3UA 2JDMA 5G04L 3R4DB 4FOQA 4KL1A 4YPJA 1JTZX 1XU2A 2C5DA 3MPBA 2IUWA 4C1WA 5J7MA 1NLRA 2WO7A 5FXWA 3PIGA 3CF6E 1BBT2 5F6LB 4CDWC 1VAKA 1L7LA 2EALA 2J42A 3LWCA 3USUB 4FTEA 4LMFA 5A33A 4LNVA 3SH5A 4BQ1A 1S0GA 4CTEA 5L7OA 1TNRA 5I0RA 4N53B 1HXS3 3M70A 2WUHA 4XFBA 2EIEA 4AEJA 1NYWA 3WX5A 3FJSA 2CDOA 2RS31 2VPVA 2VNRA 2X53S 3BKZA 2WA3A 4XETA 3UL2A 3I2HA 4DUWA 4RHV2 3B7MA 5FZKA 3ILRA 1IQAA 1AR82 1QKQA 2DTYA 1GBGA 2VQUA 4INDA 2TBVA 1RJ8A 5IUQA 3ZMNA 4E4ZA 5FZIA 1F9KA 2XMLA 3PVBB 2WNUC 4AQTA 1WUVA 2VGDA 1QQP2 2UY9A 3POWA 4XOGA 5EPAA 1YHFA 1GP5A 2JJ6A 1AZDA 3DXUA 5GZDA 3LDRA 4BIFA 1VBD3 4XFFA 3ZN6B 1PVC3 2BU9A 2XJUA 1AYM1 5CYYA 4AI0A 3WW2A 3VBUC 1K12A 1B35C 4CCCA 2JD9A 4DXTA 3CIHA 1QOOA 1ZBE2 2JD4A 1DBNA 2OX0A 3HWJA 2TEPA 2ZGOA 5E89A 1MR5A 1ZRCA 2HWC2 1D7PM 4AVSA 3PUSA 2XWJB 1WCSA 4IL7A 5IT6A 4K21A 3DYPA 1YQ2A 1IKQA 2JENA 4Q4Y3 1US2A 2VZRA 2DCTA 4C8DA 3AP7A 1LHOA 2DVAA 3MIGA 4MADA 2D6OX 2LUWA 1GYKA 1FOD2 1DHKB 5J37A 2ZZQA 3LPGA 1ULGA 2LW8A 2VBDA 2ZEWA 5C3OA 2XLFA 2ILMA 5A3MA 4BMBA 4Z2WA 1LJ7A 4LBQD 1LOGA 1OVSA 1QGLA 4Q0UA 5TSWA 3VZOA 4A3XA 4NIIA 1HQNA 3AZZA 4O9GA 5EQUA 2NMNA 2BVBA 4Q0PA 5F32A 4XZUG 2DVGA 4OFGA 2BJSA 1WLWA 1IPKA 2LALA 2W2IA 4HBNA 2WC2A 2BNOA 1EV11 4IE7A 5JLVA 3R4SA 4YG6A 1T2XA 2VZSA 2WZR1 4C0BA 3AJYA 1XBFA 1PGL2 4ATEA 1SLAA 1OLME 1EAH1 1KDKA 1PHMA 4ZS2A 3SMHA 3U1XA 1NG0A 5C8CC 4V1PA 3M8LA 1FYUA 5CB7A 3WDWA 2VZQA 1D2QA 2D93A 4O9EA 2R1DA 4XF4A 1LENA 3X29B 3ZFEC 1ULCA 4ARXA 3DPRC 4K8FA 1NCRA 1WCQA 5I8YA 3SLIA 1BVP1 1GMMA 2ADDA 3CLPA 3CJXA 3I8TA 2VNVA 5FZCA 5FZ3A 1GNZA 3MDPA 3P1IA 5DMYA 4XQWA 3MF6A 2SLIA 5FO8B 1W6PA 4XEZA 1HRV1 4YZ4A 1V6MA 1GWKA 3IDEA 4FQZA 4JC1A 5FZ8A 1H6YA 1Y9MA 2UWAA 1PO23 4D94A 5JR2A 3N3HA 1DGWX 1TNFA 4QB1A 2A6XA 2VVFA 3AVRA 3HAGA 2E51A 2IXKA 1J3PA 1EPZA 1RUE3 1JW6A 4O7XA 2JICA 1H9PA 1EUUA 4LE3A 4QAWA 4QX8A 5FPZA 5BNNB 1VBA3 1UY2A 3I59B 5FBJA 4GH4C 2ZA9A 5LEJA 2B45X 1N1VA 3NAPC 4UW6A 3OSDA 5GALA 2NM1A 5A6YA 1VIWB 4NPMA 2EICA 3W9AA 1RYYA 1RTVA 4OVEA 1GLHA 2BFUS 1POV0 2DU0A 2BBAA 5IFPA 1XNTA 2ZGTA 5FRAA 4UYBA 1ENSA 2YFUA 2YY1A 2RDRA 5A6XA 3VDBA 2W08A 3FBYA 5F3IA 4D7SA 4JRLA 2ARAA 3AYCA 3GYDA 2D44A 4U36A 1D0GA 1OH4A 3VBOB 3BODA 3D0JA 4WM8A 4OI1A 3NVCA 2CNAA 2ZMNA 5EWSA 2CV6A 4AVCA 1JOPA 1LESA 1CQ9A 2AR6A 2XJSA 3O1PA 5C3SA 3O0WA 3LD8A 4ASKA 3VBHA 4PIXA 4IEUA 1ODNA 4HK9A 2FCTA 5FP7A 1JS9A 2VM9A 3FUOA 2L9LA 4HKWA 1TG7A 3RGBA 3SKJE 3W5MA 3OJBA 4FVVA 3V64A 3HNMA 2GMEA 2QQMA 4YM2A 1VBB1 1S0CA 1U0AA 4TN7A 3H7YA 5FMOL 1XYNA 1DU3D 3BALA 5FZOA 2Q8CA 3WNKA 2PFWA 2KD7A 2IVIB 1LOFA 3WP6A 4A44A 3M1HA 1PO12 4WVMA 2VZPA 3FZ3A 2GP5A 2BOIA 1FAYA 1JN2P 1UMIA 1UN1A 1W9FA 1ZZ9A 2IVJA 3CHXA 3Q9OA 4KH9A 1AL21 3AL6A 2R16A 5IVCA 3VZLA 1BK0A 4K3UA 1ASJ1 1DGRN 4CU6A 3K75B 5L9BA 1R093 1BVVA 2B7YA 1DIWA 5FYIA 1PK6B 1SFPA 2FDHA 4QWNA 4C90A 3TRSB 4JTNA 1XNAA 1NE6A 2ZGRA 4GXLA 5FY1A 2NZ9A 2XDVA 3DKWA 3S7IA 3VL9A 5FBZA 2RJKA 4QHOA 2OPKA 4AEDB 2HWE1 1UU5A 1DZQA 1F15A 4B29A 3ZXFA 4OQ9A 1AR73 4AI2A 3GJAA 2HLEA 1M4WA 2GC1A 1X8EA 2QQIA 1UZYA 3RZKA 1LOEA 2LROA 3LIHA 4UF0B 5LY1A 5CFCB 2FBEA 4HK8A 2RDSA 3ME2A 5BNPC 4FFIA 5C70A 3RJRA 1C8M1 4YNIA 5DAXA 5JPMB 2D6LX 1MZ5A 2WNUA 4MXWA 1Z7S1 2C6SA 5I91A 5JMCA 2MEV2 1GUIA 3DEMA 1MS4A 4RSUA 3V0BB 1OQ1A 1QJY1 3ZFGA 3MLKA 1GV9A 2XVGA 1ENXA 5C9AA 1GZ9A 2JG9B 1OFNA 3GJBA 4CP9A 3E97A 1VBE3 3K3OA 5FZLA 1IKPA 1YO8A 3RMYA 3D0SA 2FDFA 4PQQA 3J8F1 4M3CB 5FXVA 2A7AA 3NV3A 3L2YA 3PL0A 4D6RA 2VXRA 2D43A 4CCOA 2V5YA 1ZZBA 2HWF3 2N7GA 2ZEZA 2TUNA 3ZSLA 1PGW1 2LTNA 4OYUA 3OBAA 4L92A 1RUD2 2JB4A 5EIYB 5BV6A 5JXIA 3KLSA 3UGFA 2H0BA 1NQDA 1PGSA 4YZ1A 4OHVA 2BNNA 4CDXB 2W3JA 1W2NA 4QX2A 4BQ4A 3GGLA 1I3HA 1LGNA 4EZ4A 3V0AA 1JU3A 2VMIA 2D5HA 3DCQA 4RHV3 4AQ2A 5C5TA 3URFA 1QDOA 3BB6A 1AR83 2ZGKA 5CZKA 2CAUA 4KU8A 3ZPOA 2ZZJA 2GSYA 2HH9A 4IV1B 4P9GA 3ZX7A 4X8PA 3BTXA 1HB4A 4JZRA 2ARCA 3ZFFB 4CEWB 2WT1A 1QQP3 2EAAA 4LIVA 4OLLA 1XE8A 2RV9A 4YVWC 4YW3A 5HV0A 1H8TA 1VALA 5FXXA 1S0EA 3HR9A 1QWRA 3BU0A 5F3EA 1I6XA 1J1LA 3A0KA 1P8JA 2A73B 2WYSA 4YWAA 5FY0A 4CXWA 1PZ8A 2NYYA 1NZIA 4IDZA 1TQ5A 3N7LA 2X5IC 3W20A 4MYEA 3ZIXA 2A71A 1ND3C 5KXCA 4Y20A 5KC5A 1DZRA 1ZBE3 4AEKA 5GZCA 1LB2A 1VPHA 1EY2A 2CHHA 1O3RA 4S2GA 4Y33A 2JECA 2CY6A 2P37A 1PNGA 1BLZA 3OY8B 5FPBA 5T55A 2HWC3 2VUAA 1VE0A 1POV1 1ND2B 4AAXA 3KT4A 3LEGA 4QDRA 5LATA 3SCFA 3BVCA 3JQWA 3ZXJA 3R05A 1WA4A 2Y60A 1O3TA 5FQ0B 2GN7A 4YZ3A 2XWBB 3U37A 1WW7A 1QH6A 4LO4B 1GNHA 4J1XA 2XBO1 1QJX2 1YQCA 3QD6A 4N9IA 1A8MA 2R32A 3GNEA 2Q8OA 1FOD3 3AKPA 2OZJA 4EN6B 1UL9A 3I3EA 4AXOA 2VMDA 3SH4A 1SHWB 1LTEA 2YBKA 3AVSA 1DFQA 2IXLA 3MV01 3ZDSA 3BOPA 3N9LA 3ZLIA 4QXBA 3SISA 3USSA 4XJ8A 3I54A 4X6QB 1QJU1 4L2NA 5A33B 1APNA 1ZA4A 4KWKA 1A8DA 4B8EA 1WCUA 1CGPA 5IJRA 4QT6A 4EROA 1OI6A 3LEIA 1MACA 4PLMA 1H0BA 5IATA 3AP6A 1CR7A 1RC6A 3AYAA 2VW1A 3WY6A 2I45A 3GCWA 2WT0A 4H3WA 5T5OA 3FC0A 1N3OA 2ERFA 3AZVA 2K9ZA 4FI9A 1GFF2 2FHRA 4FTSA 3FLTA 3MIHA 2OVUA 1ONAA 1T6BX 4YRDA 5LBCA 2ORZA 3O7OA 4L97A 4YM1A 4I09A 2OYZA 4CU8A 3A23A 2GNBA 3WP4A 4IERA 4CUBA 3LGRA 3GXUA 3MI8A 3T09A 4JGZC 4CE8A 3GBGA 2C9AA 2EXKA 3IB3A 1DQ0A 3NQHA 5IVJA 1RUOA 3WHUA 4Z92B 2XJQA 3I2JA 3N36A 4HONA 4NVPA 1OXCA 1FPN3 2XLGA 2X09A 3IPVA 4NHLA 5I0DA 1YCIA 5APAA 3NW4A 2CL2A 1TME1 3JU9A 1ULEA 1RUJ1 2XKPA 4A6SA 4XF1A 2DVBA 3OTFA 3D3AA 3H8XA 2OA2A 5C33A 4Q2FA 2V72A 2AUYA 5CFDC 5KXBA 5FYSA 1ZYBA 1R64A 2QBXA 2AEYA 1RUI2 3OPTA 3VHPA 2BNMA 2O8QA 4KGQA 1OOPC 1Q56A 1UKRA 3DYOA 5FMCA 3WR0A 4TLGA 4IW3A 2WKKA 2EIDA 2Z69A 3U4XA 4P08A 4AK3A 2X8KA 1VBC1 3WNMA 2W1SA 1DQ6A 3MW3A 3KMHA 5F7UA 4AAPA 1SLIA 5FWEA 2HKXA 1N47A 1MZEA 3T1LA 2EXIA 2WIIB 4PLNA 1QXJA 4CYDA 4CPBD 5T5PA 2WO1A 4OUMA 4Z07A 3LFIA 2XKOA 5LK5A 4HZFA 2JDNA 3E5XA 1U5XA 1HQLA 1KXGA 5FPLA 5FJKA 4KG8A 4HVOA 4IV3A 4MX3A 1H1AA 2DV9A 1UQXA 2BGOA 3VBFC 3W59A 4XW3A 5FO9B 3P3NA 5DDJ1 4MGIE 1V70A 2WFF2 1QNYA 3N7KA 4G3YC 3IT8A 3L2HA 3O14A 2ENRA 4MGKE 1GZWB 2R041 2OUHA 2WNVC 4HVQA 2PHUA 4IEPA 4LO8A 3U10A 2DUQA 5HXMA 1W90A 1HV1A 4NHKA 2AREA 3QLQA 1W99A 3JZVA 2JG8C 1RUG2 4JGYC 1NCRB 3I3BA 4YVSC 5DAWA 1JHJA 3VZJA 4JAAA 1XB9A 1QJFA 4UBHA 5JSPA 2YU2A 1XC6A 4GKYA 4BCUA 5BNPA 1UAIA 1J1TA 2YC0A 4PQ9A 2BWAA 2R061 2JE7A 3IZOA 1W6PB 2B5HA 3ZN5A 1AR91 4UOJA 1JZ8A 3SCHA 4IETA 3W58A 4LR4A 2GNMA 1PO13 2E32A 2W5FA 3AFKA 4JHTA 2WSUA 3MLLA 5J09A 5B2GB 1O4TA 5A3PA 2HJIA 1SBEA 4XJ9A 5IVYA 2FDGA 5EYYA 1J3QA 4LK7A 3QACA 2JDHA 1MZFA 5A7QA 5K4LA 1J58A 4FBFA 1VB2A 2IWGB 4COYA 4OHWA 5CVRA 4QM8A 3RVHA 1V9U1 4Q26A 3T2PA 1FT9A 1LOBA 2XVKA 4C91A 3N4MA 1DYPA 1E57A 5ACA2 3I2DA 3WF3A 4UFHA 3CJIC 4Q4V2 1CAWA 3OGJA 4MHUA 4BZ4A 4M4PA 1LHWA 1UZWA 4GWJA 4S2DA 1DP0A 1ZZ6A 4NRMA 4XC9A 5K0UC 4UFJA 4IUGA 5FPVA 5C4WC 2JIGA 2DUOA 5FYCA 3T2QA 3IN9A 4RFT0 3KHCA 5KHGA 4HPKA 3QOPA 3VDDC 2XJPA 1ZM1A 2JXAA 4YFWA 2MHFA 4DXRA 4WM8B 4XXPA 1G9DA 2BFUL 1RUE2 3D82A 4D0QA 4U2AA 2K46A 5FYYA 3C2UA 2MEV3 2ZX4A 3K4DA 4JTOA 4TWTA 5IK8A 2P5BA 2WSVA 2YDEA 2D6PA 3JB8A 4RS5A 4AG4A 4OCTA 3SEEA 3WNPA 3VBHB 4AVBA 4KU7A 4EWDA 2ZGLA 4P9IA 4NHYA 3MICA 2ZJCA 4LKEA 4AYUA 1X36A 4AHWA 5KXEA 4MH0E 4EN9B 2VC9A 2X5IA 5D2AA 1SLTA 4L11A 3OBZA 4DRVA 1VAMA 1G7YA 2ETEA 2KM2A 1UOBA 1W0OA 5FZOB 1RUD3 2CYFA 1ZRRA 2Y8KA 2XUMA 3N7MA 3T4VA 4AF9A 2NMOA 1NCQA 4WVMB 4AZZA 1G9BA 2CGNA 3OD4A 3PJQA 4GB32 4XYXA 1AF9A 2F4LA 3E6DA 3AMPA 2WYFA 1WKYA 1UXZA 2IZWA 4P14A 1V00A 1WLTA 1XNKA 4LE4A 2BDRA 2Z5WA 2QQKA 3ABZA 4XAAA 1W9YA 3AXEA 3VDCA 2F6BA 4LUMA 5GLTA 2OZ6A 1HXS1 1X7NA 4XUQA 5D8AC 5JWPA 2I74A 5I0TA 3U0ZA 2GNTA 1GNYA 3JD71 5GKAC 3CEWA 4XIOA 1HJGA 3K51A 1E5SA 3MEPA 1D4M2 1LGBA 2WRAA 1DQ1A 3KCYA 4NE9A 1NAEA 4K7JA 5IAVA 4COUA 4QU1A 4CVUA 4GJZA 5KBFA 4UW4A 1RUC1 2QE3A 2YB7A 3UKVA 3M2MA 1DYOA 2P34A 3GM8A 4Z2AA 4IEZA 1V6JA 2BERA 4PIZA 1VBD1 2XGXA 1PVC1 1WLCA 5AVPA 2VUJA 5FP9A 3F95A 3HBZA 3HNBM 4MXWB 4LKSA 1GZTA 3VKFC 4TLFA 1DLLA 3ZFGB 1UIKA 5C9AB 4R52A 3ZXAC 1ZX5A 3NJYA 5FYZA 3FMGA 4CSWA 4CUCA 3S57A 4QPYA 4HLTA 2YC2A 4FP3A 1G9AA 1YI9A 2P3JA 3LIGA 4PJYA 3RS6A 3VD5A 5HBAA 1QJX3 5FP3A 2VVEA 4JRAA 4QXKA 2V5DA 2JDYA 3TWIA 3A7QA 4HANA 1XNCA 4Y4RA 3M4FA 4GZ9A 4Q4Y1 5IK7A 4LULA 5FKCA 4YGBA 1RJ7A 1JZ7A 5CAZA 1RXGA 2BVVA 2RM21 5K8SA 2HYXA 4LUKA 5DG1A 2DF7A 4I0WB 3RWKX 1RHI2 2F17A 2YPDA 3LEKA 3G6JB 4TZDA 2PLV1 1JYXA 1H9WA 1MEC1 1ZBA2 4EN7B 3B3QE 1PM7A 1R1A2 5CFDA 5LA9A 2CDPA 3PDQA 4E4DX 4XURA 5LY2A 1COV2 1HJFA 3VN4A 3V0AB 2K0GA 1JYTA 4W4ZA 1W06A 1RGSA 2G9ZA 2QZ3A 1W6OA 1W3VA 3VBRC 1OT5A 1PMIA 2XG3A 4X8NA 4FFHA 5CA6A 3RPQA 4GMP3 3VL8A 3INAA 4LHLA 1RXFA 1H8TB 5FZHA 4P9YA 4UAPA 5FP4A 2HWF2 3QCWA 2C0ZA 1MQTA 3AJZA 4WVZA 3U14A 1BMV1 4EJRA 1MVEA 2AZ5A 5A7OA 4H7MA 3NJZA 5BUVA 4B4RA 5E88A 3VV1A 1XXNA 1F5FA 2VMFA 2XUEA 2PHLA 5JZGC 3J26N 1LEDA 4MLOA 5EJZB 4E2SA 2PHRA 3OF1A 4QX3A 4RQPC 3WG4A 4QQLA 2VW2A 1W03A 3OUJA 4UFLA 5F2WA 5FOJB 3WW4A 1C1LA 2OKXA 3LDBA 1CONA 5K7PA 3EXUA 2DCYA 3JBG2 5FZ4A 4DIQA 2QCSB 3OCPA 3KF5A 4CEYA 4LK6A 3VBSC 1RUI3 3GDBA 2QDNA 4YVSA 3ORJA 5BXXA 4UBGA 1BCXA 1PO21 4RGGA 1WMEA 3RZLA 2A6WA 3LOBA 4WM7C 2R0HA 2Q1FA 3N35A 4ISQA 5F39A 5JVVA 4TTGA 1PIV2 1G6NA 4NRPA 3WDYA 3LA7A 1F2NA 4QPIA 5FFOC 4YW2A 1STMA 4CA9A 5LWBA 2X05A 4C0HA 1Q8QA 2D7FA 2WWSA 3LAGA 4E8CA 2AC1A 1AXZA 2ZX1A 3NKGA 2UYAA 4XBNA 2CU5A 1FNYA 1VBA1 1M06G 3ITQA 3ETQA 4MGZE 2XOMA 4N43B 4XVHA 2E26A 3GHNA 1UU4A 1QIQA 4MGQA 3VHNA 3N9NA 2YG0A 3T30A 4AHXA 4E4SA 5BNQA 5JSRA 2JB8A 1CIWA 1X33A 1ACCA 2PAEA 2V4AA 2RS11 3GZUC 3R0RA 3RSJA 4FSJA 2AYHA 3B9IA 2HBTA 4QGLA 1R083 2Y0IA 1O8PA 4DINB 5JOZA 3ENRA 5A1AA 3A4UA 4OUSA 3HN3A 1ALYA 1SDDB 1N1TA 5DUUA 2WFF3 2O8OA 2EAKA 1O4ZA 1US3A 2DCKA 5JDBA 4OHZA 1XE7A 1GP4A 4ASLA 3B02A 2OW4A 3EB7A 3WP5A 4LQRA 5JOXA 1TMF2 2DFCA 3NKTA 4QDQA 4Y1VA 3T0AA 1XNBA 4LKFA 1RUG3 4AFBA 1XE0A 2RJ2A 3UKTA 5KC6A 5FZAA 5GZGA 1BXHA 4LBNA 5FPUA 2HWB2 4GAZA 3KF3A 4HOOA 4WVVA 1YFUA 2NQYA 3CKHA 4XJWA 4ZONA 4CCLA 3VDDA 3BTZA 4FT8A 2ID4A 4CRQA 1Q8PA 3NO8A 4AVVA 4IGOA 5FR3A 3RZHA 1VRH2 1WBFA 2UWBA 3BTYA 3WV6A 3FLPA 2VECA 3BI3A 1UY1A 1H30A 4PDWC 4Y1UA 5DZFA 5BNOA 2J1EA 2WN3A 2CGPA 2AEZA 3WW3A 2BEOA 3WQ0A 2GNDA 1LEMA 3GBFA 4P9LA 4S2HA 5H9QA 3SKVA 1NY71 3CNAA 1OF4A 3ZSKA 3FX3A 1OC1A 5FMBA 4BXSV 1UCXA 3BUCA 2XJTA 1IPJA 2LRPA 1SPPA 5FWJA 3DGTA 3DL3A 2FDJA 3ZXGA 2E6VA 2Q0AA 2OQ7A 3FWEA 1H2MA 2BWCA 2RMU2 1G9CA 2OPWA 5FREA 5DUVA 3THDA 2Y38A 3KV6A 3B00A 4ZS3A 4ZXKA 5ACA3 1R091 1J83A 3H3LA 4D7TA 3LA3A 4N53C 4Q1RA 4Q4V3 5SV8A 3MUZ1 4QGMA 4AFMA 2H6BA 1RITA 2XXZA 2YXSA 1AR62 1BK1A 4YGCA 4FXGB 3TEXA 3EQEA 2FMYA 2QQLA 1FPN2 2VTXA 3B94A 4URAA 3VUOA 2BP6A 2IXIA 4V2WA 1J3RA 2Y0OA 4H55A 4YW7A 3B5LB 3RQ0A 3VKNA 1RMU2 1RUH2 4N90A 4IV3B 1K45A 1KGYA 2A70A 4I02A 2JDZA 4QKNA 3RYKA 1AR71 5FZEA 1Q8OA 3WCSA 1OPOA 4DZGA 2RS33 3ELNA 5D8AA 2NPIA 1O7FA 1VR3A 4FOVA 2VZTA 3FHAA 4W65A 4XF9A 4A41A 5CBLA 4ET7A 3M3IA 5A3LA 1SLCA 3MLJA 1FI2A 1SFYA 3MW2A 2YUEA 3O5SA 3OYWA 4HXCA 4QKBA 4AOCA 5SV5A 2Q4SA 1WW4A 2ZTNA 4D69A 4UFIA 4XMIA 4CDUA 5C3QA 1I5ZA 4PF5A 1CPMA 5FY5A 2GAUA 1KFXL 2WFPA 3ZIWA 1WZXA 2WS92 1VBE1 3NV4A 4UT5A 2EXJA 3U07A 5BNPB 1RUF1 4NIHA 5BNOC 2VL4A 3KV5A 1LHUA 4Q4X2 1A6CA 4CP0A 4QPGB 1OFSA 4GB33 1DZTA 3TB0A 1BBT1 1E5HA 4K1ZA 3T0BA 1TVGA 1OKQA 3FBMA 1UZVA 2YPJA 1PX4A 1OQEA 1YFWA 2BUKA 2VZOA 2ZHMA 3M3OA 1POQA 5LA0A 3VB9A 2A3XA 2K2SA 4LHKA 5FOBB 1CX4A 2BGPA 2XONA 3KB5A 3VD4A 1WCKA 1LAJA 5B4XA 3PUIA 4P9JA 3RWNA 4D7YA 3IBMA 5EFUA 3GF6A 4RHV1 5D21A 2WJSA 1D4M3 1PNFA 2BZDA 2WQ4A 1CAWB 4JKMA 1QEXA 4Y22A 1AR81 3PVNA 3SQOA 3TN92 1SLLA 5KHIA 2GH2A 2GALA 4FXKB 4PI0A 4BM8A 4CCNA 3U11A 3WUDA 4Q1PA 4XQDA 4D6SA 4YM0A 2ZBJA 1QQP1 5FZ7A 2VOWA 4M00A 4DXSA 1IS5A 3EYPA 2GN3A 3O1TA 3BTAA 4HPKB 3WP3A 3O1OA 3WQBA 3NJXA 2B39A 1OH3A 1W6NB 1W2UA 2RHPA 3VBRA 3ZOIA 5FIXA 4NHMA 4ITCA 4E27A 4A7ZA 1XRUA 2WZR3 2GMMA 1ZBE1 4LBLA 4RS5B 1CZTA 2E33A 1DQ5A 2GDFA 4K40A 4CDWA 4C1XA 3Q8FA 5FKBA 1BEV2 4ZU7A 1W8FA 3BOWA 3WG1A 2HWC1 3AXDA 4XUPA 1HB2A 1C4RA 2RDNA 2EIGA 2X5IB 4XHXA 4HKLA 5LK7B 4R4XA 5FY9A 2H0VA 1CZSA 4KWLA 4MGSA 1QNWA 2PQQA 1WD3A 2Y64A 3AM2A 1AUYA 4NIAA 4LBJA 5J98B 4IGPA 3ZYPA 1TE1B 1UY4A 1RHI3 1SEFA 1YFXA 1NLSA 4SBVA 1NCQB 1ULOA 4UXAA 1FOD1 2XQRA 5CNAA 2C9KA 5FY8A 5DPNA 1UWWA 1ZBA3 1XJAA 5L73A 5C3RA 1R1A3 3QH6A 2Q1MA 1S0DA 5BNNC 4MG2A 4FFGA 1ULFA 4JDOA 4LEJA 5LB6A 3VBSA 2WQZC 1O6UA 1COV3 4GWIA 3ZYBA 1Q3EA 3IDBB 1NX9A 2DCJA 1ZA7A 5EYXA 4XTPA 3S6PA 3T08A 3FL7A 1HV0A 1HLCA 5JSOA 3UNPA 4XFGA 3SC7X 3WDTA 3C3VA 3PVEA 2J1AA 1KS4A 3NV1A 1W2TA 3H1MA 2JDPA 4N7UA 5GM0A 3ZKYA 3FN9A 3TNPB 3BYWA 4OQ8A 3VBUA 2J22A 1B35A 2C26A 1N3PA 3HT2A 1VMJA 4AWDA 3K48A 5DUXA 1HW5A 3ZSMA 1ZRFA 1PGL1 1PMJX 5A80A 4MVTA 1WBLA 2LM3A 3HOBA 2ARXA 3DV8A 3VBOC 1W3XA 2Y6KA 1SCSA 2C1FA 4FPCA 4BLJA 2R7EB 3NMBA 4CCJA 4CXXA 5KHJA 4LORA 3N9QA 3HQXA 1CAUA 1UOGA 4NWWA 1SFNA 5A7PA 2PHTA 4Q4W2 2RE9A 3NNFA 3WNLA 3ZVXA 3ZM8A 3JBG3 5EZWA 4B7KA 3LSDA 2YBPA 4XZPA 5L9RA 1WWYA 4FAGA 3IAPA 4QQ2A 5A6ZA 1W0PA 4W6WA 1GKBA 2R042 5FYTA 3PU8A 1VRBA 4Y3OA 2VJXA 3HEIA 3SEPA 4UFKA 4A4AA 1PIV3 4NAMA 4DEVA 3EBRA 5T54A 4JKKA 1ST8A 3LDKA 5DQ0A 1AJKA 1VBB3 5IW0A 2VNOA 1AHSA 1IG3A 1FMD2 3J7HA 4COVA 2ES3A 4FAHA 1W9TA 2FZ1A 2VOXA 4JVAA 3KHBA 3I4IA 1FXZA 1PK6C 2DURA 4FPYA 3PUHA 4XDOA 1F8VA 5CFDB 4QDSA 4BB3A 5C8CA 4P00B 5FUNA 3WQ1A 1QY4A 1U5IA 4BMEA 1W04A 3ZFEA 2O14A 3UETA 5AVAA 1W05A 3DPRA 4CZSA 2NLRA 2ZKNA 3HMYA 4HSLA 1C5IA 4B4PA 1W6OB 4AEDC 1JZ5A 3AC0A 5FYHA 1LHNA 2RR12 1JYVA 5T5LA 5GLVA 1W2AX 3AFGA 1TMF3 1MQTB 1OKOA 1RB8G 2PMWB 4KNCA 2XVLA 2JE8A 4XCBA 5H9SA 2VXJA 3AP4A 2HWB3 5CFCC 4PBPA 4BWOA 5L7OB 2FZ2A 4DXZA 2HWD2 3EO6A 1MS1A 5CG8A 5FPXA 4L8QA 1VRH3 4LLFA 3RJ2X 2VMHA 3TOJA 2VVDA 2B46X 3OB8A 4YSFA 2ARBA 3AMMA 5DG2A 4PLOA 2JG9C 4GH4A 3FFZA 3MFAA 4XHBA 5LBBA 3WG3A 1S0JA 1U5ZA 3NAPA 4LKDA 4TYSA 3R6SA 2D5FA 2RS52 3AKSA 4ZKTB 5FDBA 1PM4A 4L9BA 4ZHNA 2GMPA 3LPFA 4MUVA 1HX6A 1UPSA 4MO3M 1PO11 1RVF2 4CEYB 3NNMA 4YVSB 4GMP0 2QZ2A 4HG6B 4XFHA 4JV4A 4BOWA 1ENRA 2J1RA 2RMU3 5FYUA 2ZHKA 3H42B 3ZKUA 1MS3A 4K1YA 2UYBA 1AYN2 4QPIB 4HETA 2VMEA 4P02B 1BQPA 5EP9A 1GZCA 1IOAA 4NWVA 4PIYA 3KT1A 4LA2A 3UESA 1AR63 4FTBA 3KS7A 3PURA 3VLBB 5A7NA 2PQSA 1EPWA 3WEZA 3RZMA 5HCBA 1BJQA 2XL7A 2D6MA 2FQPA 1RMU3 1RUH3 2VU9A 3AMHA 4IV1C 3ZR6A 4CU7A 3M3QA 3IMNA 3ZFFC 1R1ZA 4CEWC 1C1FA 1MS8A 1OMIA 2D97A 2IXHA 2Z79A 2OS2A 3IIIA 3J7MA 2VOVA 2XR4A 1HN1A 2VO5A 3MIDA 3D6EA 4JDMA 4YW6A 3SXWA 4JCKA 1S0IA 4Q8LA 1JOBA 4YG0A 3JUUA 4D6QA 1F4HA 4IE4A 2W94A 1B09A 5A1FA 3JD72 3HQRA 2MEV1 3H3ZA 5ANNA 1ZREA 1GQHA 1CWPA 4BK5A 4LO6B 2PHWA 4QB2A 1DGLA 3VDDB 5AC92 2WS93 3AKQA 3FHQA 2Q30A 4FPEA 1ND2C 2VBPA 2CGOA 3MZHA 1R082 4Q4X3 4E8DA 4Y5SA 5BNOB 5FZ1A 1LULA 4K9SA 1Q8SA 1F5JA 2AGSA 2VOTA 1HB3A 2E9QA 2P4EA 3M3CA 4I0BA 4DEQA 1RUD1 4LTAA 4NR1A 4QHBA 4ORFA 1S4CA 4LPLA 3O0XA 3WUCA 5FZDA 5T5JA 1UIJA 3LOIA 1SPPB 4UW3A 2XHKA 4O65A 4LBMA 4XJAA 3AB0A 3WNOA 1HIXA 2QDRA 2R072 1D0HA 2RG4A 5F5AA 5LASA 4P9WA 4AQ6A 2VUDA 4NAOA 4QQOA 1G8WA 1CD3G 4XF3A 1K5MC 5C8WA 5DZEA 1W0NA 1NA1C 5LBFA 3TN93 3J7LA 1UMHA 3IDAA 3POJA 5L19A 4FP2A 4RL7A 2JDUA 2QQUA 2VCBA 4CU9A 4EN8B 4IEVA 4M0NA 4PBOA 1QJU3 3GHMA 4I3GA 1QOSA 3AP5A 2UU8A 5LCWL 3AL5A 4FOWA 5BPXA 1AJOA 4UW5A 1MEC2 4HL0A 1HRI2 2DVDA 2W68A 1Q5OA 4FPGA 2D6NA 4RR3C 5D8AB 3WOGA 3MHZA 3FFQA 3ES1A 4CDQC 3OGVA 1SG3A 3ALQA 2QFEA 3LEMA 5FPAA 3RI9A 1OHFA 5FLIA 3U4SA 3S0MA 1BEV3 3AYEA 1D4VB 3GZAA 3OYWB 2DTWA 5ABJC 1OA2A 1UO9A 1UZZA 2VZ3A 2WLQA 4CDUB 1EYBA 4UI9L 1OUSA 1CX1A 4MOAA 4NROA 3TAYA 4PF1A 4ARYA 3ZYGA 1YI7A 3VHRA 1YQ8A 3P5BA 1Q43A 4BIOA 2XL9A 3KWVA 3I97A 4FPOB 1QJX1 2IXJA 1W2OA 2EXHA 5GJ6A 4KWJA 1Y43B 4B4QA 4LITA 3KQ4B 4HN0A 5T52A 4MGTA 3CL1A 1AX0A 1W39A 2RS32 3JQXA 4MGYE 4YVWA 5A3WA 2ZABA 3DKQA 1S1AA 1NE4A 3UGHA 2XJRA 1AXKA 3ZSEA 3WZ1A 4AQSA 5J36A 4IEXA 1Y4WA 5DUWA 4Q0VA 3ZN4A 2WLPA 3IKWA 4X6RB 4DQAA 4YW1A 3WLUA 4R9DA 4META 2VNGA 4OUEA 4TXWA 4LHNA 1ND3A 1XYOA 2SBAA 5FZGA 1ODMA 1JYNA 2GU9A 4Y22B 3JXSA 3B01A 1JHNA 1XPWA 4DB5A 5H9PA 3UJQA 1AYM2 3KSCA 3PMEA 4IE0A 3WT3A 1L3JA 1Z78A 4YM3A 1UU6A 1GANA 3NSTA 4GMP1 3C7EA 1RUNA 4Q5OA 4QX0A 1VP6A 2JDKA 4LBOA 3ROUA 2JWPA 1XYPA 1KDMA 1CVNA 1MS0A 3AZXA 5J96B 1CN1A 3VHOA 3C7HA 2PAMA 3VBRB 1JODA 1UOJA 4BU2A 1SBFA 2LS6A 4MXVA 4XJUA 1ZRDA 4XDPA 1KS5A 4Q4W3 5FK7A 3VD7A 5HXVA 4LXLA 1X9TA 1S0FA 4CDWB 1WW5A 1L7QA 4IEWA 2QKDA 3BCWA 3P6BA 2OQ6A 2R043 2E7AA 2GC0A 1L7RA 3BIWE 1DYKA 2UWCA 4ES9A 1XNDA 2ORXA 2Z2SB 5BYNA 1HQWA 1NXMA 2YBSA 2VMCA 2PTMA 5DAVA 5FAXA 3OGRA 4HT1T 5DXDA 1PZ7A 3VDAA 3OBTA 4Y5Z0 1FMD3 4DMIA 4GQ7A 1FV3A 2W1QA 4YFZA 1O5LA 1LU2A 1CIYA 4PI2A 3VZNA 4CCEA 2WNUB 3R4UA 2R6QA 1EV12 3VBSB 4QD2A 3T3YA 3UJOA 1UY0A 5EHDA 4AFDA 1QHDA 2W47A 5JI7A 1KJRA 2WZR2 2WABA 4IESA 1JOJA 3ACHA 2JKBA 4CP9B 3WINE 2JEMA 3RZGA 1WMXA 4NMIA 4QXCA 5FUPA 3U78A 1EAH2 4SLIA 1MZ6A 2WL1A 4IXLA 4JGZA 3H3UA 2JIJA 4PHZA 4XQ4A 2WZEA 4Q29A 2RR13 1QDCA 2EA7A 3VBUB 2V4VA 1B35B 3EMRA 1ENQA 4A42A 1IS6A 2YHJA 1NKGA 2WFF1 1IZ3A 4FPFA 3UT0A 5EXOA 3TEZA 4QX7A 5GZFA 2BGCA 1JYIA 1OURA 3HBKA 3ZXKA 2HWD3 4YARA 1RINA 2AENA 1HRV2 3KCCA 3ZFFA 4CEWA 4Y1YA 2P6HA 3QBQA 3D8CA 4NOTA 4QX1A 4M01A 1UW8A 3UV9A 4XUNA 3I2KA 4F8AA 5E8AA 3T0DA 3PUQA 1UX7A 1I9RA 1OOPA 4QPWA 1HKDA 5DABA 1CAUB 3VBHC 2QNKA 4F3JA 5BY5A 1GSLA 1GOGA 2RS53 3PLQA 3POYA 3CU7A 5I0UA 1J84A 1A78A 5LZ6A 5E6HA 4CUAA 1JUIA 2VCAA 3E5QA 4ASMB 1KRIA 1OLQA 4NUBA 2ZGMA 5A3OA 5F5QA 3UK9A 1RVF3 5KR7A 1JZ4A 3MFCA 2QUOA 3WQ7A 3PIJA 4P5YA 3Q8AA 5FP8A 2A6YA 1W6QA 2ET1A 3LF7A 3K4AA 3OY8A 4BQ5A 1AYN3 1QXRA 4OHXA 2DFBA 4AFAA 1LGCA 1YYNA 3O0VA 1DGWA 3C7FA 1N3QA 1Y9GA 4CP2A 1SCRA 1WD4A 4Y20B 3VBFA 4O61A 1UF2C 4G4FA 3KM5A 1GOFA 1X82A 1CAVA 3SNMA 5ACA1 2WZ8A 1A34A 1C28A 4Q4V1 2WNVA 1MS9A 1HB1A 2HEWF 5C8CB 4YLZA 1RL3A 2YC4A 1W8UA 3ASIA 3ZFEB 3FHIB 5JUVA 4JGYA 1QOTA 2JG8A 3DPRB 4CCDA 5A32A 1FV2A 2F4PA 1W6MA 2WO2A 2YZ4A 4HSJA 1I5PA 3ZYIB 5E16A 1E5RA 1EP0A 1W8WA 3MGUA 1K5MA 4DO0A 4E4HA 1NA1A 3NWKA 3OGGA 4BLIA 3I2FA 5LA2A 4LBQA 4W6XA 2PA7A 3ETPA 3RI8A 2DCZA 5FZFA 3T2TA 1VB4A 1RUE1 3MYXA 3JD73 2VG9A 4PCRA 1VBB2 4AI3A 2XH6A 1CAXA 3W5NA 1JXNA 3BU7A 1ULDA 5AC93 4EYUA 2ZEYA 1RUC3 5L36A 4RR3A 1LHVA 4Q0SA 1LR5A 5JOYA 2BBVA 2P3KA 3VD9A 2ZAHA 3ZFGC 5C9AC 4CDQA 1AL22 4GH4B 2Q1ZB 3KD4A 4OHYA 3NAPB 2HBUA 1ASJ2 4JKLA 3BPZA 2YMZA 3ACLA 3THPA 5F3CA 3S5AA 2IXCA 5JMOA 3CJIA 1PX3A 2B9UA 5ABJA 2W87A 5ANQA 3J9SA 1WGPA 2ZS6B 3BGAA 4GB31 5K0UA 2R073 3AKTA 4P9XA 1UXXX 3HD8B 3KV4A 1CZVA 5C4WA 4Y26A 4BHPA 5FZ9A 2W52A 3T1MA 4AI9A 2FDIA 4GA9A 4FFFA 1F4AA 2HWE2 4QQPA 4DPNA 2XHNA 1ZNPA 4JQRA 5FCCA 4AR2A 1GOHA 2Y6JA 3E5UA 5IVFA 4KWUA 3WG2A 2IFRA 3IPVB 2RM23 3H8UA 3NJVA 1LODA 4RGAA 1D4M1 1PMHX 2W95A 3MIBA 1PZ9A 1W8TA 4FPHA 2PLV3 1C8M2 1MEC3 1HRI3 4Y24A 1MS5A 1V6NA 3EJKA 4KGGA 4NO4A 3ZPYA 2CWSA 4BXFA 1GR3A 1Z7S2 4IEOA 4YW4A 4L99A 1H8TC 3POSA 1QJY2 1X9PA 2MPFA 5D1IA 5F9TA 4I0AA 4IGQA 2DBIA 1C5HA 4XJZA 3H1WA 3OGSA 4I01A 1H6XA 5CKMA 3FLRA 3J8F2 5A70A 3CDZB 4ONUA 2V73A 3S5QA 3ST7A 2XPJA 2G19A 4XILA 3PNAA 4N7IA 1PGW2 4A2UA 1YC61 1ZZ8A 3WDXA 3MIEA 1HN0A 1GZWA 4QU2A 1BYHA 1QH7A 1S2BA 4HN1A 4BE3A 4NPRA 5I0SA 4AHZA 2J1TA 3P3PA 4QX5A 4FPLA 4LT5A 2KXLA 3PMSA 4XDQA 2VTXJ 4ZU4A 4LHSA 5KXDA 2B8MA 2J1SA 4F7ZA 5HV4A 3OEAA 1SACA 3WD5A 1RHI1 3MW4A 4IEYA 2Q8EA 3WNNA 4E9KA 2A5ZA 2BRTA 3RFRA 1ZBA1 1AL0G 1JMUB 4K8RB 1FATA 1R1A1 4A7YA 5EJ1B 4A3ZA 4MHRA 2VW0A 3CMGA 4XF0A 1UD1A 5FYMA 2YROA 1COV1 4N43C 3SITA 4EWAA 3POEA 3HN1A 2ZAAA 3O1RA 5T3NA 1QMJA 1K5JA 3LZZA 4IEQA 1AYM3 5KWRA 1DQ4A 2X10A 3KCXA 4V2VA 5JAXA 4KQ7A 2ZGUA 1WMDA 3N7JA 2RJLA 1FX5A 4XCAA 2P17A 2D3SA 2HWF1 4YGDA 4ZZ8A 2HEYF 2XJVA 3TNQA 1YIFA 1O3SA 5F5IA 2RS13 3RNSA 1OD3A 3GCXA 4MV2A 2WNEA 3I3DA 2Q5TA 4KBBA 4XFAA 5F3GA 3AK0A 4HMZA 1JH5A 2OIIA 3D4KA 3POIA 2XBO2 3NNJA 2PYTA 4B7EA 5T50A 1MVQA 1JZ6A 3I7DA 1W9SA 3BPSA 4Y5TA 5FZBA 3JBG1 4R4ZA 5F6KA 1YJLA 2VQTA 3KQRA 4H7LA 2D3RA 3HVDA 1OLMA 4YZ5A 1REFA 2Z42A 3PTYA 1VAVA 4GALA 2E63A 4N8MA 1QJU2 5CIRA 3HT1A 1XU1A 5DZGA 2VY0A 5IVBA 1Y7BA 1V0AA 4YW5A 1KITA 5J1XA 1PIV1 5I8SA 1H1IA 2DU1A 2WNOA 5IFTA 5HPOA 4I2OA 4R9AA 1XSRA 2WWJA 5HI0A 1YFYA 4YVWB 5A7WA 1O8SA 1EV13 1H2KA 4NHXA 3S7EA 5ISLA 3WDUA 1T6GC 2WR9A 4GKXA 2PHDA 1RIRA 3AMNA 3ZMOA 2GZWA 4DRRA 4OZXA 2VZUA 4OULA 1H1MA 1EAH3 5DN2A 1F35A 2JKXA 4AGGA 1DF0A 1N1SA 4BQYA 1W28A 4WZFA 3TYJA 2WT2A 4QGNA 1WLDA 3ACGA 5LRRA 1YUDA 1ND3B 3LB9A 3ZXLA 4AEMA 4KI5M 5JZGA 4BQ3A 5HCHA 3EHKA 2VQ0A 3K46A 5IYYA 4BQWA 4CCMA 3WNXA 4XBLA 5GLZA 4RQPA 2A6VA 2A3YA 4IV3C 2ZGPA 1YEWA 3A0NA 5EJ3A 1HRV3 1Y3TA 4P5HA 1TMF1 4RGKA 2BTVC 3WDVA 3O1VA 3GBWA 2AACA 3L9JT 5FO7B 3VKOA 4R9BA 4AW7A 5LA1A 2VBBA 4AGVA 2HWB1 1TME2 2MNGA 1RUJ2 5C7GA 4WM7A 2Y33A 1TEIA 2WINB 3FUQA 3IAQA 1BZWA 2W39A 1VRH1 1OQDA 4WZCA 1URXA 3SCGA 2IC1A 2UURA 5LRSA 2WAAA 4DNYA 1JYWA 2W46A 1FNZA 2A3WA 4NN0A 3WF4A 2QJVA 1VBC2 3K77A 1YJKA 2TNFA 4D8MA 2G9FA 3SHRA 3E1F1 4QPGC 2YU1A 1ZVFA 5CEHA 4RD7A 5C71A 3BN6A 4COWA 3H9AA 1XSQA 4IQPA 1UPIA 2RMU1 3WHTA 5CISA 1LRHA 3WW1A 1RUF3 2Y6LA 2VE1A 3C7OA 4JQTA 4MZUA 4OI4A 1S2EA 2ZKLA 3GALA 1GWLA 3K3NA 4LLOA 1LNSA 3Q8EA 5C6CA 3PHMA 4QQHA 1H4GA 1BBT3 3POFA 1AR61 5AFEA 5DDJ2 5A3NA 3DYMA 2YYOA 1C57A 2GC2A 1C8NA 1YXWA 1NOVA 4WBBA 1REEA 1FPN1 4XABA 3O12A 2ZGNA 5FXZA 3UGGA 5L9VA 2GC3A 5A3TA 2E7QA 1C3HA 3KGLA 2B42B 4JGZB 4LOTA 1RMU1 1RUH1 3ZYJB 3OEBA 3VGIA 2YV8A 3H8RA 3ZO0B 2W9XA 1JUHA 4H14A 5LEKA 2WAOA 5FV3A 2QTWB 1JBCA 1W8NA 4PDWA 2ZEXA 4Y1ZA 1WMFA 2R30A 4J6GA 3I2IA 2JE9A 3PUAA 3K2OA 2VAUA 4GIQA 3WXPA 1AX2A 2CWMA 4B1MA 2R062 3H0OA 4URTA 1AR92 1GP6A 4QKDA 1O3QA 5IHRA 3NNLA 2C4XA 4GWMA 4COZA 3THTA 2Y26A 1X50A 3AKRA 1DQ2A 5LW9A 4M4RA 1LECA 1OOPB 2R49A 4RS5C 1AL23 2WN2A 4LA3A 3VZKA 3H8OA 3USUA 2ZOEB 3KV9A 1UYXA 2ZX3A 3SH3A 2WS91 1ASJ3 2ZPXA 5KHHA 2VCCA 2PAKA 3NRUA 1PVXA 4M0HA 1DLCA 2DDUA 1SMVA 3IMMA 4K6BA 1IHMA 3N9OA 4N53A 4XFIA 3WF2A 4Q4X1 1NXD1 2CTVA 2VULA 3UYJA 3I2GA 4OI0A 1LCLA 1UYYA 3LFMA 1V9U2 3RRDA 3F2ZA 4EWEA 3KT7A 2VMGA 4DS0A 3I3MA 1W6QB 3M7AA 5IK4A 2WWUA 2I2SA 4HKOA 1O5UA 1OA4A 2HWE3 1IS3A 2W1WA 3KZ4C 1NCQC 4I30A 4CP1A 3OG2A 1XQNA 5A6QA 3ZYFA 3KVAA 1JZ2A 3OOXA 1CPNA 4L0PA 2GH8A 4GWNA 3Q8BA 3VBFB 1NUKA 1K3IA 4OI2A 4JHZA 2UY8A 5EV7A 1CAVB 1DGRA 1W9WA 1ZZ7A 2E31A 2ZHNA 5CG9A 2BQPA 4B1LA 3ZN6A 4DY3A 2WNVB 3AMQA 3IWZA 3TN91 2QQVA 3CZUA 3J4UH 3MBWA 1Q8VA 1C8M3 1QU0A 2PHFA 1X8MA 2IFWA 4FPJA 1IQDC 4HFSA 4M3CF 4S2FA 5F2SA 4AE2A 2CAVA 1Z7S3 2VCMA 3PU3A 4QM9A 4JGYB 2JG8B 5FZMA 5A32B 3DN7A 1J59A 1QJY3 4RYDA 3RMXA 4XTMA 1W6MB 4N43A 4EZHA 2YGLA 4AI8A 1KFUL 4QMAA 1UNBA 5LBEA 3DECA 1K5MB 2FD8A 4XFCA 1GU3A 1NA1B 1O91A 1REDA 4LBQB 2BW8A 2J7MA 2OT7A 3A21A 3GZEA 4XIKA 2GP3A 5HCFA 3I49A 3J8F3 4AFCA 1OF3A 3APBA 4CDXC 4CPBA 1KEXA 1V6KA 4DFSA 1YQ5A 4Q8KA 1CAXB 4Q27A 1H2NA 5J3UA 5JXGA 5F1RA 1KD7A 2D40A 3LE0A 2VD7A 1BEV1 4W8JA 2JDAA 1UX6A 4XBQA 5I93A 3M3EA 4RR3B 1UYZA 3E6BA 3CQOA 2JX9A 2P2KA 3RZZA 4CDQB 3C7GA 5C3PA 4YYOA 3LKJA 1CJPA 1UKGA 1UYPA 1WCDJ 3GZTB 2BV4A 1OLRA 2CSGA 2ET7A 5IVVA 2VTFA 4ZY9A 3WF1A 2QQWA 3CJIB 4A45A 1LU1A 2OXBA 5ABJB 1TZOA 5C5UA 1HXS2 2G9GA 2FDKA 5J48A 1S55A 3ATGA 2ZX0A 5CKNA 5IAXA 3PJYA 3WCRA 5K0UB 1JZ3A 1OD5A 2VZ1A 5F8PA 1UOFA 5C4WB 3C8XA 5DAPA 5CADA 5JIUA 2KA3A 1V6IA 3RYPA 4XAEA 4CUGA 5FY4A 3IIAA 1SZBA 2ZHLA 4DUVA 2WZPP 2DWRA 5CKQA 3BIEA 2Z4FA 5B4NA 4FO9A 1RUC2 2BYVE 5FZ6A 4NIDA 4OMDA 4R9CA 1BHGA 3LQCA 1KJLA 4Z82A 4BQ2A 1QJEA 2QQOA 5K9YA 3MPPG 3V65A 1I1EA 1VBD2 4NIGA 1PVC2 1XOYA 1HDKA 1V6LA 4FCAA 3JCIA 4LIUA 5A1LA 1IS4A 5JXJA 1POV3 3B93A 1CJDA 3TEWA 3LA2A 5FTTC 1QJZA 4EE2A 5DAQA 1YQ6A 2G4IA 4RN5A 2WA4A 3N9PA 1MQTC 3MO4A 5KHKA 3MF9A 1SLBA 4BA6A 3H1YA 3THCA 2EF6A 3S30A 1VMHA 3POGA 1W8HA 5L7OC 1H2LA 2XBO3 3Q8CA 4GJYA 3RG0A 3T4HB 2D6KA 3V56A 4ATFA 4LO7A 4Q4W1 3B9CA 4IE6A 1ULPA 4GD4A
chains in the Genus database with same CATH topology
3H50A 3ZXDA 2ATFA 4Q4Y2 3WVJA 1SQ4A 4E2GA 5BNNA 4HVRA 4ZU5A 2ZX2A 3I59A 5I8TA 4G9SB 2ZMLA 1CESA 2RM22 3VZMA 5GLUA 1YIPA 2PLV2 1H4HA 3OPZA 3RYRA 2ZGQA 4XXAA 2O1QA 4CEYC 1S2KA 4BYYA 1DDLA 4I3PA 3FE5A 3E6CC 1LKNA 2D98A 1FMD1 3OBRA 1Y9QA 1F31A 1H8VA 3ZSJA 4KG0A 4QPIC 5HCAA 3QH7A 4YGEA 2ZACA 2QQPA 3H7JA 4LBKA 2R0FA 3AYDA 2O0OA 4QPGA 3VBOA 4E2QA 3MIFA 3IDCB 5CU1A 1BMV2 1NZCA 5FMOS 1AVBA 2YGMA 3D5OA 2ZCWA 4XE9A 5FLHA 4WVWA 3TBDA 1YNAA 2RR11 4Q0QA 5IK5A 4Y1XA 4YZ2A 3G7DA 4AI1A 3IM0A 4R8HA 4F83A 4M3CE 1NQJA 4ISRA 1TME3 2W0XA 4A7KA 1RUJ3 2HWD1 3NV2A 4B3NA 1G9FA 2PHXA 2XLAA 3LSEA 5GZEA 1PO22 3LCPA 1YLLA 5AFBA 2ZGSA 2RS51 1VLNA 1VBC3 1W6NA 2DUPA 1AXYA 1PK6A 3HIFA 3ES4A 4D3WA 1OSGA 1RVF1 3VKLA 2FMDA 1VBA2 5BNOC 4AVAA 4EV0A 1V6OA 2D3PA 2DYCA 1QXPA 1AYN1 2RS12 1OPMA 2OUJA 5JR7B 4AEDA 1G86A 1U12A 3ILFA 1N1YA 5JIAA 5DDJ3 1NCRC 2E53A 2HYKA 1IGOA 3CO2A 4ES8A 3PVOA 3NL1A 4AVTA 5CFCA 5JCTA 5JPNB 2X29A 3AP9A 4XPVA 5JZGB 4WV8A 3KGZA 1U5YA 3RDIA 1S0BA 4TSVA 1RUI1 3V0BA 2DVFA 1YWKA 2I07B 2PELA 2HEVF 4RQPB 2AH2A 2JG9A 4XMAA 2V09A 4Z8BA 1GICA 1KQRA 2PN5A 3DF0A 2R063 4AHYA 1AR93 1LOCA 4DY5A 2BPA2 1AX1A 5E1RA 4M3CA 4GULA 3ZYRA 2P3IA 3ECQA 2A6ZA 1VJ2A 4YG3A 1BKZA 2EVXA 1NY72 3OD0A 3VKMA 1GQGA 4WM7B 5AC91 4CDUC 2ZMKA 1SBDA 1R081 4K20A 4CDXA 1O4YA 1WW6A 2R1BA 1OA3A 1V9U3 3B69A 5FLJA 1QF3A 1R092 2QVSB 4FPKA 3AZYA 4IV1A 4J1WA 4WM8C 2VOKA 1D2SA 2R071 2VQAA 1RUG1 2A75A 4LO5B 1A3KA 1SDWA 2XB6C 1JYCA 1Z0HA 1AR72 5GLWA 5JOWA 4FQ4A 4W6YA 3AZWA 5JI9A 4JDNA 5H9RA 4DOUA 2NP0A 1LOAA 4RA0A 4Y4YA 1DG6A 1YRZA 4BH9A 1HRI1 4N9HA 1LOFC 4MSVA 1UMZA 1ND2A 4BPZA 2H6CA 3DUIA 3UKNA 3AX4A 4EN0A 4PDWB 3JB4C 1ZZCA 5FQ0A 2VH9A 2E7TA 4Z1VA 3ZXEA 1VBE2 4FOYA 2NN8A 3ILNA 1RUF2 3R4DB 4FOQA 4KL1A 1JTZX 1XU2A 2C5DA 3MPBA 4C1WA 5J7MA 1NLRA 3CF6E 1BBT2 5F6LB 4CDWC 1VAKA 2EALA 3LWCA 3USUB 4FTEA 5A33A 4LNVA 3SH5A 4BQ1A 1S0GA 4CTEA 5L7OA 1TNRA 5I0RA 4N53B 1HXS3 3M70A 4XFBA 4AEJA 1NYWA 3WX5A 3FJSA 2VPVA 2RS31 2X53S 2VNRA 2WA3A 4XETA 3UL2A 4RHV2 3B7MA 3ILRA 1IQAA 1AR82 1QKQA 2DTYA 1GBGA 4INDA 5IUQA 2TBVA 1RJ8A 3ZMNA 4E4ZA 1F9KA 4AQTA 3PVBB 2WNUC 1WUVA 2VGDA 1QQP2 2UY9A 3POWA 4XOGA 1YHFA 2JJ6A 1AZDA 5GZDA 4BIFA 1VBD3 4XFFA 3ZN6B 1PVC3 2XJUA 1AYM1 4AI0A 3WW2A 3VBUC 1B35C 1QOOA 1ZBE2 2JD4A 1DBNA 3HWJA 2TEPA 2ZGOA 5E89A 1MR5A 1ZRCA 2HWC2 4AVSA 2XWJB 1WCSA 4IL7A 5IT6A 4K21A 2JENA 1IKQA 4Q4Y3 2DCTA 3AP7A 1LHOA 2DVAA 3MIGA 2D6OX 2LUWA 1GYKA 1FOD2 1DHKB 5J37A 2ZZQA 3MZHA 1ULGA 2XLFA 2ILMA 5A3MA 4BMBA 4Z2WA 1LJ7A 4LBQD 1LOGA 1QGLA 5TSWA 4Q0UA 4A3XA 3VZOA 1HQNA 3AZZA 4O9GA 2NMNA 2BVBA 4Q0PA 2DVGA 4OFGA 1WLWA 1IPKA 2LALA 4HBNA 2WC2A 2BNOA 1EV11 5JLVA 3R4SA 4YG6A 2WZR1 4C0BA 3AJYA 1PGL2 4ATEA 1SLAA 1EAH1 1KDKA 1PHMA 3SMHA 5C8CC 1NG0A 4V1PA 3M8LA 1FYUA 5CB7A 3WDWA 1D2QA 2D93A 4O9EA 2R1DA 4XF4A 1LENA 3X29B 3ZFEC 1ULCA 5HI0A 3DPRC 4K8FA 1NCRA 5I8YA 3SLIA 1BVP1 3CLPA 3I8TA 3CJXA 1GNZA 3MDPA 4XQWA 3MF6A 2SLIA 5FO8B 1W6PA 4XEZA 1HRV1 4YZ4A 1V6MA 3IDEA 4FQZA 4JC1A 2UWAA 1PO23 4D94A 3N3HA 1DGWX 1TNFA 2A6XA 2VVFA 3HAGA 2E51A 2IXKA 1J3PA 1EPZA 1RUE3 1JW6A 2JICA 1H9PA 4LE3A 5FPZA 5BNNB 1VBA3 3I59B 4GH4C 2ZA9A 5LEJA 2B45X 1N1VA 3NAPC 4UW6A 5GALA 2NM1A 1VIWB 3W9AA 1RTVA 4OVEA 1GLHA 2BFUS 1POV0 2DU0A 2ZGTA 5FRAA 1ENSA 2YY1A 2W08A 3FBYA 4D7SA 4JRLA 3AYCA 3GYDA 2D44A 4U36A 1D0GA 3VBOB 3BODA 3D0JA 4WM8A 4OI1A 3NVCA 2CNAA 2ZMNA 5EWSA 2CV6A 4AVCA 1LESA 2AR6A 1CQ9A 2XJSA 3O0WA 3VBHA 4PIXA 4IEUA 4HK9A 3FUOA 4HKWA 3OJBA 4FVVA 3V64A 2GMEA 4YM2A 1VBB1 1S0CA 1U0AA 3H7YA 5FMOL 1XYNA 1DU3D 3BALA 2PFWA 1LOFA 3WP6A 3M1HA 1PO12 4WVMA 3FZ3A 1FAYA 1JN2P 1UN1A 1ZZ9A 3WOGA 3Q9OA 4KH9A 1AL21 2R16A 3VZLA 4K3UA 1ASJ1 1DGRN 1R093 1BVVA 2B7YA 1DIWA 1PK6B 4C90A 3TRSB 4JTNA 1NE6A 2ZGRA 4GXLA 2NZ9A 3DKWA 3S7IA 3VL9A 5FBZA 2RJKA 2OPKA 4AEDB 2HWE1 1UU5A 1DZQA 4B29A 3ZXFA 4AI2A 1AR73 1M4WA 2GC1A 1X8EA 1UZYA 1LOEA 5CFCB 2FBEA 4HK8A 3ME2A 5BNPC 3RJRA 1C8M1 4YNIA 5JPMB 2D6LX 1MZ5A 2WNUA 4MXWA 1Z7S1 5I91A 5JMCA 2MEV2 4RSUA 1MS4A 3V0BB 1OQ1A 1QJY1 3ZFGA 3MLKA 1GV9A 2XVGA 1ENXA 5C9AA 1GZ9A 2JG9B 1OFNA 3E97A 1VBE3 1IKPA 1YO8A 3RMYA 3D0SA 3J8F1 4M3CB 2A7AA 3NV3A 3L2YA 2VXRA 2D43A 2V5YA 1ZZBA 2HWF3 2N7GA 3ZSLA 2TUNA 1PGW1 2LTNA 4L92A 1RUD2 5BV6A 3KLSA 2H0BA 1NQDA 1PGSA 4YZ1A 4OHVA 2BNNA 4CDXB 1I3HA 1LGNA 3V0AA 2VMIA 2D5HA 4RHV3 4AQ2A 3URFA 1QDOA 3BB6A 1AR83 2ZGKA 2CAUA 4KU8A 2ZZJA 2GSYA 4IV1B 4P9GA 3ZX7A 4X8PA 3ZFFB 4CEWB 2WT1A 1QQP3 2EAAA 4YVWC 4OLLA 1XE8A 4YW3A 1H8TA 1VALA 1S0EA 3HR9A 1QWRA 1I6XA 1J1LA 3A0KA 2A73B 1PZ8A 2NYYA 1TQ5A 3N7LA 2X5IC 4MYEA 3ZIXA 2A71A 1ND3C 5KXCA 4Y20A 5KC5A 1DZRA 1ZBE3 4AEKA 5GZCA 1LB2A 1EY2A 1O3RA 4S2GA 2JECA 2CY6A 2P37A 1PNGA 3OY8B 5T55A 2HWC3 2VUAA 1POV1 1ND2B 3KT4A 3SCFA 3JQWA 3ZXJA 3R05A 1WA4A 1O3TA 5FQ0B 2GN7A 4YZ3A 2XWBB 1WW7A 1QH6A 4LO4B 1GNHA 4J1XA 2XBO1 1QJX2 3QD6A 4N9IA 1A8MA 2R32A 3GNEA 2Q8OA 1FOD3 3AKPA 2OZJA 4EN6B 1UL9A 4AXOA 3SH4A 1LTEA 1DFQA 2IXLA 3ZDSA 3BOPA 3SISA 3USSA 4XJ8A 3I54A 4X6QB 1QJU1 4L2NA 5A33B 1APNA 1ZA4A 4KWKA 1A8DA 4B8EA 1CGPA 4QT6A 4EROA 1OI6A 1MACA 4PLMA 1H0BA 3AP6A 1CR7A 1RC6A 3AYAA 2VW1A 3WY6A 2I45A 2WT0A 4H3WA 5T5OA 3FC0A 1N3OA 2ERFA 3AZVA 2K9ZA 1GFF2 2FHRA 4FTSA 3FLTA 3MIHA 2OVUA 1ONAA 4YRDA 3O7OA 4L97A 4YM1A 4I09A 2OYZA 2GNBA 3WP4A 4IERA 3LGRA 3MI8A 4JGZC 3GBGA 2C9AA 2EXKA 1DQ0A 1RUOA 3WHUA 4Z92B 2XJQA 3N36A 4NVPA 1FPN3 2XLGA 3IPVA 4NHLA 1YCIA 3NW4A 2CL2A 1TME1 3JU9A 1ULEA 1RUJ1 2XKPA 4XF1A 2DVBA 3OTFA 2OA2A 5C33A 4Q2FA 2AUYA 5CFDC 5KXBA 1ZYBA 1RUI2 3VHPA 2BNMA 2O8QA 4KGQA 1OOPC 1Q56A 1UKRA 3WR0A 2WKKA 2Z69A 3U4XA 4AK3A 2X8KA 1VBC1 1DQ6A 3MW3A 3KMHA 1SLIA 2HKXA 1N47A 1MZEA 3T1LA 2EXIA 2WIIB 4PLNA 1QXJA 4CYDA 5T5PA 4OUMA 4Z07A 5LK5A 2XKOA 4HZFA 3E5XA 1U5XA 1HQLA 1KXGA 4KG8A 4HVOA 4IV3A 4MX3A 1H1AA 2DV9A 3W59A 3VBFC 5FO9B 4XW3A 3P3NA 5DDJ1 4MGIE 1V70A 2WFF2 1QNYA 3N7KA 4G3YC 3IT8A 3L2HA 3O14A 2ENRA 4MGKE 1GZWB 2R041 2OUHA 2WNVC 4HVQA 2PHUA 4IEPA 4LO8A 3U10A 2DUQA 1HV1A 4NHKA 2AREA 3QLQA 3JZVA 2JG8C 1RUG2 4JGYC 1NCRB 4YVSC 3VZJA 4JAAA 4UBHA 5JSPA 4GKYA 4BCUA 5BNPA 2YC0A 1UAIA 1J1TA 4PQ9A 2BWAA 2R061 2JE7A 3ZN5A 1W6PB 2B5HA 1AR91 3SCHA 4IETA 3W58A 4LR4A 2GNMA 1PO13 3AFKA 2WSUA 3MLLA 5J09A 5B2GB 1O4TA 2HJIA 1SBEA 4XJ9A 5EYYA 1J3QA 3QACA 1MZFA 1J58A 4FBFA 1VB2A 2IWGB 4COYA 4OHWA 5CVRA 4QM8A 1V9U1 4Q26A 1FT9A 1LOBA 2XVKA 4C91A 3N4MA 1DYPA 1E57A 5ACA2 3I2DA 3CJIC 4Q4V2 1CAWA 3OGJA 4BZ4A 1LHWA 4S2DA 5K0UC 1ZZ6A 5C4WC 2DUOA 3IN9A 4RFT0 5KHGA 4HPKA 3QOPA 3VDDC 2XJPA 1ZM1A 2JXAA 4YFWA 2MHFA 4WM8B 4XXPA 1G9DA 2BFUL 1RUE2 3D82A 4U2AA 3C2UA 2MEV3 2ZX4A 4JTOA 4TWTA 5IK8A 2WSVA 2YDEA 2D6PA 3JB8A 4RS5A 4AG4A 3VBHB 4AVBA 4KU7A 4EWDA 2ZGLA 4P9IA 3MICA 2ZJCA 4AYUA 1X36A 4AHWA 5KXEA 4MH0E 4EN9B 2X5IA 1SLTA 4L11A 4DRVA 1VAMA 1G7YA 2ETEA 2KM2A 1W0OA 1RUD3 2CYFA 1ZRRA 2XUMA 3N7MA 4AF9A 2NMOA 1NCQA 4WVMB 1G9BA 2CGNA 3OD4A 3PJQA 4GB32 4XYXA 1AF9A 3E6DA 3AMPA 2IZWA 4P14A 1V00A 1WLTA 1XNKA 4LE4A 2Z5WA 3AXEA 2F6BA 4LUMA 5GLTA 2OZ6A 1HXS1 1X7NA 5D8AC 5JWPA 2I74A 5I0TA 3U0ZA 2GNTA 3JD71 5GKAC 3CEWA 4XIOA 3K51A 3MEPA 1D4M2 1LGBA 3KCYA 1DQ1A 4COUA 4K7JA 5KBFA 4UW4A 1RUC1 2QE3A 3UKVA 3M2MA 2P34A 4IEZA 1V6JA 4PIZA 1VBD1 2XGXA 1PVC1 1WLCA 5AVPA 2VUJA 3HBZA 4MXWB 3VKFC 4TLFA 1DLLA 3ZFGB 1UIKA 5C9AB 4R52A 3ZXAC 1ZX5A 3FMGA 4QPYA 4HLTA 4FP3A 1G9AA 1YI9A 2P3JA 4PJYA 3RS6A 5HBAA 1QJX3 2VVEA 4JRAA 4QXKA 3TWIA 4HANA 1XNCA 3M4FA 4Q4Y1 5IK7A 4LULA 4YGBA 1RJ7A 5CAZA 2BVVA 2RM21 5K8SA 4LUKA 5DG1A 2DF7A 4I0WB 1RHI2 3G6JB 4TZDA 2PLV1 1H9WA 1MEC1 1ZBA2 4EN7B 3B3QE 1PM7A 1R1A2 5CFDA 4E4DX 1COV2 3V0AB 3VN4A 2K0GA 1RGSA 2QZ3A 1W6OA 3VBRC 1PMIA 4X8NA 2XG3A 5CA6A 3RPQA 4GMP3 3VL8A 3INAA 4LHLA 1H8TB 4P9YA 2HWF2 3QCWA 2C0ZA 1MQTA 3AJZA 4WVZA 1BMV1 4EJRA 1MVEA 2AZ5A 4H7MA 3NJZA 5BUVA 4B4RA 5E88A 3VV1A <