2GMPA

Metal-free (apo) p. angolensis seed lectin in complex with glcnac-beta(1-2)man
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
228
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPNQVIAVEFDTFYSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interplay Between Metal Binding and cis/trans Isomerization in Legume Lectins: Structural and Thermodynamic Study of P. angolensis Lectin.
pubmed doi rcsb
molecule keywords lectin
molecule tags Sugar binding protein
total genus 50
structure length 228
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gmpA00
2CWSA 1ULFA 2SLIA 3M3CA 1LESA 2WT0A 2ZGTA 3FLPA 4RL7A 1UPSA 1W0OA 3NV3A 1V6KA 3V0BB 3IN9A 2A3XA 1W6QB 4YZ4A 1MR5A 1QNWA 1QU0A 5H9RA 3AX4A 1BKZA 5GJ6A 3SNMA 1S0BA 5E8AA 4AGVA 4XILA 5DG1A 1OKQA 5JDBA 3AZYA 4XJ8A 1W6MB 4GKYA 2W39A 1UZZA 5HCFA 1N1VA 1QDCA 2GNTA 1KDKA 4DPNA 3UJOA 2WT1A 3OBTA 2ZBJA 2ZGLA 1LOFC 4YGBA 2ES3A 1IS5A 4CRQA 3OGGA 1LOCA 5IUQA 1WD4A 2A75A 5KXCA 2UU8A 4ZKTB 1DQ0A 1S0EA 2C5DA 2ENRA 1LHNA 2YXSA 3L2YA 3WDTA 3AP9A 5IK7A 4Y1YA 3BODA 3O0VA 4K1YA 2WSUA 5CB7A 3V0BA 2B7YA 1V6MA 3KM5A 2ZA9A 1W6QA 2GMEA 3V64A 2AUYA 4XHXA 1AVBA 5CBLA 1GKBA 3RMXA 2PHTA 3B3QE 1V6LA 4XJUA 5BYNA 1WW4A 1WLDA 4RA0A 2A70A 2GMMA 1HDKA 4XXAA 1DQ1A 2WLQA 3IPVA 1OFSA 1QNYA 1CONA 4GKXA 2ZHLA 4YZ3A 1I1EA 4BM8A 1SBDA 1IS6A 2A6XA 3OYWA 1LECA 1Q8VA 3RRDA 2YY1A 3PMEA 1H9WA 3QCWA 4XXPA 5LK5A 5SV8A 4D69A 1CPNA 2GN7A 5T54A 3SLIA 4AVTA 4JRAA 2DURA 4ZXKA 1LJ7A 2DUQA 5CA6A 2ZGRA 4Y26A 2YROA 4AWDA 4LBKA 4PCRA 3N7KA 3LSEA 5CNAA 1MZ5A 4IQPA 2ZGKA 3CNAA 3LCPA 4H55A 1NXD1 2JE9A 4GALA 1RITA 1QOTA 2GDFA 3JU9A 4SLIA 5T5LA 4BLJA 4Q1PA 3GNEA 4FQ4A 2DYCA 1S0JA 2JKBA 5T52A 1WBLA 5EYYA 3RMYA 3N7LA 2EIGA 2R0FA 2KM2A 3ATGA 5IT6A 3AK0A 1W0PA 5DUWA 2UWAA 4YW3A 3W58A 4BMEA 1A78A 1SACA 2G4IA 3PJQA 3UJQA 3WUCA 1GYKA 1LHVA 1ENSA 3WVJA 3POSA 4BOWA 3POWA 2A7AA 2AYHA 1C4RA 4L8QA 5JOZA 5JOXA 3WNXA 4PF5A 4BPZA 5HCBA 2ZGQA 2E7TA 4C1XA 1LU1A 1KRIA 1IS4A 2EXKA 2WJSA 2A6YA 2ZHKA 3ZXLA 1MS8A 1YIFA 2D3RA 4MYEA 4UW3A 1SBFA 4PBPA 2D7FA 1CN1A 3OY8B 1SFYA 4YM0A 4ATEA 1GZCA 4XDQA 1AJKA 4XTPA 5GM0A 3RG0A 1R1ZA 1U0AA 2D6KA 2ZAAA 4PBOA 1W6OB 3SH4A 2WKKA 1DQ6A 2CL2A 2Z42A 2TEPA 2DUOA 1AZDA 5AVAA 4LBOA 2D6NA 2EXHA 1SCRA 3FBYA 4YG6A 1PZ8A 3B01A 3HN1A 5JOWA 4LBQB 2JECA 5DZGA 4CTEA 1AJOA 4LBNA 2VH9A 4FOQA 3A4UA 5T5JA 1DLLA 1KJRA 2D44A 4XZPA 4XOGA 1QF3A 5JMCA 3OY8A 1VAMA 4BMBA 3WG1A 5F9TA 3AP7A 1LEMA 1W6OA 1WUVA 1FNYA 1GZWB 2DV9A 2NYYA 3RS6A 2VXRA 4XJ9A 3IM0A 4R9BA 1WLCA 2ZMNA 4YW2A 4XHBA 1MVQA 1MZ6A 1PZ9A 3VKMA 1YXWA 4YFZA 1UAIA 4UW4A 4XBNA 4Q27A 1Q8QA 4WZFA 1BJQA 5T5PA 3WDXA 4YZ1A 3BIWE 4LBJA 2GMPA 2FHRA 3U4XA 2CY6A 1LTEA 2EXJA 4LBQA 4DFSA 5GLZA 5E88A 3FFZA 3ZSKA 2D3SA 2D3PA 1J1TA 1G9FA 4ITCA 1BYHA 1GSLA 1WW7A 4LBMA 1JXNA 1GLHA 4UW5A 2NM1A 2NMOA 4FQZA 4Q1RA 2I2SA 1JYCA 1RINA 3O5SA 5IK4A 3ENRA 2NN8A 3PVNA 3IPVB 2NP0A 3BOPA 1GANA 3IMNA 2P3JA 3OYWB 5H9SA 2R1DA 3AYAA 1C1FA 1GZWA 5JVVA 1LCLA 1ZM1A 4ASMB 4BLIA 2D6PA 2DWRA 3H0OA 4WVWA 4XJAA 5IK5A 1V00A 4NOTA 5CAZA 2DVAA 3ZXEA 2OUHA 3IKWA 1SLTA 5GLUA 1VAVA 3FLRA 3D6EA 3ZSMA 2XG3A 1AX0A 4FOYA 1DYKA 4XJWA 3RSJA 1VLNA 4ISRA 1WBFA 3WDWA 5DXDA 4FPJA 1BZWA 5GZEA 2VY0A 3GALA 3UL2A 5EYXA 5HCAA 1VIWB 2VW1A 2A3YA 4YM2A 1Z78A 5EWSA 4Z8BA 2JDZA 1VALA 2VU9A 4DS0A 3BTAA 5GZGA 1B09A 3MPPG 3I4IA 1D2SA 2EF6A 1WW5A 3B9CA 1YYNA 2ERFA 4FPFA 3AJYA 4W65A 5JOYA 1XQNA 4AVSA 1G9DA 1WLWA 1H30A 4XIKA 5GALA 1LOAA 5FRAA 1TEIA 2UWCA 3M3QA 1ENRA 1WW6A 1DBNA 4U36A 3KQRA 1DYPA 3A0NA 3N3HA 4FPKA 4GWNA 1H9PA 4FP3A 3USUB 1ZA4A 3I8TA 3RQ0A 4YG0A 2R1BA 5E89A 3OJBA 3D5OA 3SISA 1QOOA 1UL9A 1MS4A 5T5OA 4M3CE 1N3PA 4FOVA 1S0FA 2W68A 2WQZC 1WCSA 2LTNA 4R9AA 1LGBA 3QLQA 1UKGA 1QGLA 4FP2A 4XJZA 3D4KA 1Q8SA 1EPWA 1WD3A 2ZGPA 4Q8KA 1S0GA 2PHUA 1ENQA 1I3HA 2DTYA 1HKDA 1W6NA 2DTWA 1SCSA 1KJLA 3N7JA 3NV1A 3FUOA 1N3QA 1CJPA 2VUAA 3AP5A 4K20A 5DG2A 3AZXA 3T1LA 4Y1XA 3USUA 1DQ2A 1IKPA 2VW2A 1SBEA 4Q26A 3ZPYA 4AYUA 3AXDA 4XYXA 2PHWA 1AXYA 3AFKA 3R4UA 4HL0A 3W59A 3N36A 3WHTA 1IS3A 3ZXFA 3WG4A 1C57A 4XBQA 1YRZA 4F83A 5IK8A 3O12A 1AXZA 1G86A 2JE7A 2E53A 3POYA 1LHUA 2D6MA 1MS5A 4YGDA 3VV1A 3VKLA 2GNMA 2A5ZA 1O4ZA 1JW6A 2ZZJA 4BQ1A 5FREA 5EXOA 3WCSA 1SLIA 1BXHA 2A6ZA 4GXLA 2GNDA 1LHOA 1N47A 1IOAA 4P9WA 1FV2A 3ILRA 4UW6A 3WG3A 3AJZA 2E7QA 4Q8LA 5KXEA 4Y24A 2P37A 3ZXJA 3R05A 2AENA 4U2AA 1DQ5A 3WZ1A 2ZHMA 4AGGA 1ULCA 1G7YA 2XB6C 3HMYA 3ZSJA 3FLTA 1HQLA 3WDYA 4YZ5A 1DQ4A 1LGNA 2PELA 1UN1A 5GZCA 3INAA 2OW4A 2ZKNA 2P2KA 3MW4A 4GWMA 4M01A 3VKOA 3ZXKA 3HR9A 1G8WA 2CWMA 2GN3A 1ONAA 1F31A 3NWKA 1GNZA 4Q2FA 1N1YA 1CR7A 1Q8OA 1V6IA 2AH2A 1W6PA 4YLZA 3R4SA 1N3OA 1N1SA 3O0WA 1UX6A 2AREA 1QOSA 2EAKA 3LSDA 5DZFA 1LOBA 4K21A 1MS1A 1HLCA 5T50A 5GLTA 1LHWA 1CQ9A 2R49A 3ILFA 2R16A 4DRRA 1ULDA 1GV9A 2ZGOA 2DVDA 1SLCA 1APNA 1S0CA 3VKFC 2ARXA 1SLAA 1LOFA 3AP4A 3JUUA 3MW3A 3WDVA 5L73A 4YW4A 1AXKA 2UWBA 2ZMKA 5DZEA 3AYDA 1NLSA 1AX1A 3TAYA 1YO8A 2BQPA 3N35A 1URXA 5DUVA 1S0IA 1X50A 2EXIA 3SITA 4CZSA 4Y1ZA 3AXEA 2WT2A 4NO4A 4Y1VA 4AGRA 4OZXA 4YZ2A 4YFWA 4XMIA 2C9AA 4XIOA 3C2UA 2W08A 4Y22B 2UURA 1SLBA 1CVNA 1A3KA 2V5YA 4JC1A 1DZQA 1AX2A 3SH3A 1Z0HA 2V73A 4FPHA 4P9YA 2P34A 4LBQD 2E51A 2CTVA 2PHXA 1GZ9A 4FVVA 4YG3A 3M1HA 1QMJA 1MS0A 2ZHNA 3B00A 2DUPA 3ZYPA 3WG2A 1FAYA 4JCKA 1N1TA 4FOWA 5JLVA 2PHRA 3TB0A 1W6NB 3WOGA 1DFQA 1MVEA 3V0AB 1V6OA 1DHKB 1DGLA 1CPMA 1JN2P 3FUQA 1F9KA 3ASIA 3AYEA 3AZWA 3NV4A 1LENA 4DQAA 3AZVA 1V6NA 4WV8A 1PZ7A 3V65A 5H9PA 2H0BA 2NMNA 2RHPA 3ILNA 4R9CA 2HYKA 1LOEA 2A71A 1G9CA 1Q56A 1W6MA 4Y22A 2ZABA 3DUIA 1D0HA 1FATA 3PVEA 1CESA 2VW0A 3T1MA 1RIRA 1JHNA 1LOGA 1JOJA 2R0HA 4XE9A 4FPLA 2YV8A 1OQ1A 1Y7BA 4Y1UA 1QKQA 2OUJA 4TZDA 3A0KA 1JBCA 3Q9OA 2AGSA 5DUUA 3M3EA 4FPGA 1MACA 1ULGA 4YM1A 1FNZA 2DU0A 3B69A 3MW2A 4XTMA 2LALA 1F5FA 4P14A 3V0AA 2ARBA 4M00A 1HQWA 2DVBA 3VKNA 3AZZA 1LODA 2DU1A 1MS9A 1BQPA 2WNEA 4XMAA 4YGEA 2PHFA 4YW5A 4ATFA 4ISQA 4C1WA 1AF9A 5KXDA 2JJ6A 1Q8PA 1YI7A 2ZGUA 1DIWA 2D6OX 3O0XA 1GBGA 4FPYA 1V6JA 1LULA 2ZGMA 2A6WA 3WLUA 1FX5A 1C1LA 5F5QA 3N7MA 3WDUA 3PVOA 5GLVA 1CIWA 1QDOA 2WSVA 3M3OA 2DVFA 4TYSA 3VUOA 2A6VA 2D43A 2E6VA 2YZ4A 2SBAA 5KXBA 3ZYRA 3ZVXA 2ZGSA 2D6LX 1W6PB 4P9XA 5GZDA 4YM3A 1KQRA 1GICA 2EALA 2NZ9A 3OBRA 3WUDA 4KBBA 1LEDA 1KDMA 2Q5TA 2OVUA 3T2TA 3ZSLA 1O4YA 1A8DA 1KITA 1S0DA 2ZGNA 3WV6A 3DGTA 1G9AA 4M3CB 3M2MA 1FV3A 2JD4A 1IKQA 4FPEA 4Y20B 3UK9A 3MEPA 4FPCA 4I30A 1LU2A 1S1AA 4PQ9A 1JYIA 2CNAA 2AR6A 2ZACA 2W52A 1SLLA 2CYFA 2P3IA 3NV2A 5DUXA 3WCRA 4WVVA 4FPOB 4YW1A 1FYUA 4HANA 1UMZA 2A3WA 5H9QA 4M3CF 2ZMLA 4K1ZA 4R9DA 2P3KA 2DVGA 4LBLA 1GNHA 2YMZA 3AYCA 1G9BA 1ULEA 3APBA 4XBLA 4DRVA 3OPZA 5GZFA 5T55A 4M3CA 4GA9A 4YGCA 3SH5A 4AVVA 1LGCA 1JUIA 1UZYA 1MS3A 3AP6A 2GNBA 4Y20A 5GLWA 2FMDA 3WHUA 2GALA
chains in the Genus database with same CATH superfamily
2D5FA 3O1UA 3HN3A 1NCQB 4NUBA 4YW7A 2SLIA 1WA4A 3KT1A 1KS5A 2VCMA 2PLV3 3IIIA 5LA2A 3WW2A 1W0OA 2JB8A 3NV3A 4HZFA 3WSOA 3FE5A 3JQXA 3KV5A 3J8F1 1QU0A 3SCFA 1W39A 2RS12 5A3UA 1CZVA 5A1FA 4MSVA 4GH4B 4XILA 5DG1A 2QQMA 1OKQA 5JDBA 4QQHA 5FZ4A 1LB2A 1Z7S3 3JBG2 3TEXA 2WNUA 1SDDB 2J1EA 4YVSB 5A7OA 1W6MB 1UIKA 2W39A 2WZ8A 3N9NA 5HCFA 2GNTA 3UGFA 1BEV3 2CGNA 3WINE 3UJOA 2WT1A 1KFXL 1BMV1 2ZGLA 3GZUC 2E63A 2JG8C 4UOJA 1IS5A 4BK5A 3OGGA 3LEKA 1WD4A 1ZZBA 5C9AC 2UU8A 3MICA 2ENRA 2YXSA 4KL1A 5A7QA 1UU6A 1NCQA 1VMJA 3AP9A 1C5IA 4OUEA 4QX7A 2BW8A 4QXKA 5C3PA 5HXMA 5FP9A 1R091 2HWD2 3U75A 1O4TA 3KM5A 4IE5A 4MZUA 4XHXA 1GKBA 1RUJ2 2PHTA 1PM7A 2R073 4XC9A 4UBHA 3PUHA 5ERLA 4RA0A 1F2NA 2JD9A 4QQ2A 1RUI2 1AYN3 2RM23 4G3YC 4YVSA 4YZ3A 4ZS2A 4LO7A 4GKXA 3VLBB 1VBA1 1I1EA 1ZZ6A 1SBDA 1IS6A 2W95A 5ACA1 2W9XA 4LT5A 3RRDA 5FP8A 3QCWA 5LK5A 4XXPA 2WAOA 3BI3A 1IPJA 4AVTA 1G6NA 1LJ7A 1YEWA 4RQPC 3T2OA 5EIYB 5LRRA 4E4SA 1A6CA 3WNKA 4GB32 1RUG1 4PDWB 1NXD1 4KI5M 2YGLA 4LA3A 4AQ2A 1QOTA 1PIV2 3JU9A 4CYDA 3ACGA 3ZXAC 3K48A 3MUY1 3GNEA 5FUNA 1REEA 2QQOA 5A7PA 2JKBA 1UZVA 5T52A 3ZYGA 4CP2A 5FIXA 4EZ4A 3GCWA 5KHGA 3KB5A 3KZ4C 3N7LA 3EJKA 5D21A 1JZ6A 5LASA 3B7MA 5ANQA 2EVXA 4GMP1 4DEVA 1ENSA 4AHZA 3WVJA 1RYYA 1C3HA 1AUYA 5JOZA 5IVFA 3B9IA 5JOXA 5F39A 1NT0A 3WNXA 3RZLA 2BOJA 2Y34A 4NWWA 4FFGA 4QT6A 2FDIA 1OD5A 4C1XA 1KRIA 3OGVA 1IHMA 4FTEA 2A6YA 4LKSA 2HWC1 4NR1A 3T09A 1YHFA 1YIFA 3N4MA 1ND2C 1SBFA 4PBPA 2D7FA 1SPPA 1C8M2 1GZCA 2J1TA 1RUOA 1AJKA 4EN7B 4PDWA 2JG9C 4LHKA 3KHBA 2YGMA 1H1AA 3LZZA 2WKKA 5F3CA 2CL2A 1RJ8A 3NAPC 1AR91 2QQWA 2WO3A 4QU2A 2ATFA 1AZDA 3E5QA 3X29B 4LORA 4H3WA 2XVKA 3AMPA 2EXHA 1SCRA 2VZRA 3FBYA 4YG6A 4DUVA 1V9U1 2JDKA 1H4GA 3C7HA 4RS5B 3T4HB 4CSWA 1RUC1 2HKXA 1BBT3 4MH0E 3K3NA 4E8CA 4NE9A 3ECQA 3LB9A 2QQPA 5DZGA 2XKPA 2D40A 4QQPA 3OPTA 4CPBD 4OYUA 3K46A 5DAVA 4CDXC 1QF3A 3Q8CA 4QPIC 1COV2 1HXS1 4QGLA 1JZ2A 1UQXA 4E2SA 5HBAA 1I6XA 2YBKA 4JGZB 1OH4A 3PNAA 1LEMA 4QU1A 4ZU4A 4GD4A 2WA4A 3HOBA 5LA1A 1WCKA 4RSUA 2DV9A 1ODNA 1W8HA 2LM3A 3RS6A 4CCCA 5A3PA 1TMF3 2QUOA 3IM0A 4IE0A 4QB2A 1W04A 4BXSV 4KMQA 4XF3A 4BJ0A 4YFZA 5I0SA 3VKMA 4FCAA 3T0BA 2ZPXA 4Q27A 1A34A 4Z2AA 5BY5A 1RHI3 2ZKLA 4RS5A 1BJQA 4RR3B 5T5PA 2BWCA 3FJSA 4LBJA 1F4HA 2FHRA 3U4XA 1ZBA1 2EXJA 1LTEA 4L2NA 4S2GA 3V56A 4DFSA 5AFBA 1L7RA 1OA3A 3FFZA 3ZSKA 2QBXA 5FZ8A 3WD5A 2XLGA 4ITCA 1HN1A 5IVYA 4CVUA 2GC0A 4YPJA 4NRPA 4QQLA 3I2IA 4Q1RA 3IB3A 5LATA 5IK4A 3ENRA 3PVNA 2GH2A 2XQRA 4JGZA 2R063 3KLSA 3KT7A 1NE6A 5AC91 3OYWB 1D4VB 2R1DA 2GSYA 4CU6A 4IGQA 1NE4A 3EB7A 3JB8A 5DDJ2 2DWRA 4HKWA 5FPZA 5IK5A 2V09A 3THDA 5CAZA 5J96B 3ZXEA 2ZXQA 4GWIA 3H8RA 1U5IA 3D6EA 4RR3A 1OKOA 1H2LA 2LUWA 2FDGA 4ISRA 5FBJA 5DXDA 4J6GA 4FPJA 4L99A 2CU5A 2VY0A 3ALQA 2BGOA 5JI9A 4B4QA 4IEZA 1VIWB 2BGCA 2FZ1A 5E6HA 4BH9A 4YM2A 1Z78A 2WO2A 4ZZ8A 1CAWB 4DS0A 4BK4A 5GZGA 4PIZA 1H4HA 3I4IA 5A3MA 1C28A 5KC6A 3B9CA 3BB6A 1KD7A 4KU8A 3AJYA 4W65A 1CAXB 1VB2A 1XQNA 2BPA2 1U5YA 1WLWA 5GALA 3OUJA 5JIUA 3VHNA 1LOAA 5FRAA 2OZ6A 2W2IA 4B4RA 4Q4W2 2XVLA 1UW8A 4MLOA 1WW6A 3IT8A 1DBNA 3IDCB 1VBB1 2PQQA 1DYPA 1FOD3 3N3HA 3PUIA 2XJRA 3OD0A 4LUKA 3ST7A 3DKQA 4QPGB 3O1RA 1W99A 3BUCA 1ZA4A 5FPLA 4KG0A 3FZ3A 4E9KA 3RQ0A 4KU7A 3ACHA 2ZEZA 4EWEA 2R1BA 2IZWA 4HKOA 3D5OA 3SISA 4AR2A 1BK1A 2GAUA 5T5OA 5CADA 1CAWA 4M3CE 4LKDA 3DF0A 4CCEA 1N3PA 2VVEA 1S0FA 2ET1A 2W68A 4OCTA 2WQZC 4N9HA 4QAWA 2LTNA 3U14A 1RGSA 2EICA 1PO21 4A6OA 1UWWA 3QLQA 3T0AA 1QGLA 3J26N 4ZU5A 3AL5A 3VD3A 1PNFA 4OFGA 5B4NA 5FLHA 3UT0A 3ZSEA 1ENQA 2XJVA 4LTAA 1NY72 3BKZA 2VUAA 4K20A 4XAAA 3H1WA 1JZ5A 3AZXA 5F8PA 1QH7A 2ORZA 4GULA 4IESA 2G9GA 1WGPA 1J83A 2JEMA 4L92A 4D6SA 3ZKYA 1AXYA 2VE1A 3AL6A 3TRSB 4I2OA 4HL0A 4LLOA 2WNVC 3W59A 1K5MB 2ZS6B 3FX3A 4OI4A 1C57A 1BVP1 2JDNA 1YRZA 3DXUA 1CZTA 4HONA 2XONA 1DGRA 2JE7A 3POYA 2E53A 4ET7A 3VV1A 4MX3A 4ZZ5A 4TSVA 5KHIA 2GNMA 2A5ZA 3J9SA 3URFA 2R043 5BNOB 1VBD1 1R1A3 2VXJA 3WCSA 4EWDA 4A4AA 1VBC1 3SHRA 1CZSA 1EYBA 5BUVA 4OI1A 3HEIA 4L11A 4UW6A 1SG3A 1YC61 1IQDC 3AJZA 3CEWA 2XBO2 1OOPB 2OA2A 3R4DB 4N43B 5CVRA 3S30A 3ZXJA 4U2AA 3ACIA 4X8PA 1DQ5A 1UU5A 1POQA 2RE9A 3KF5A 3WZ1A 4XFHA 4I01A 5CG9A 4ARYA 1K5MA 2N7GA 2CHHA 2O14A 4GWJA 1HQLA 4MV2A 4AAPA 2MEV2 1W8OA 3T08A 3PL0A 4COWA 5J7MA 2WN2A 4D6RA 5C9AB 4XDOA 3E97A 5GZCA 4DUWA 2OW4A 2ZKNA 4GWMA 4M01A 5IAVA 5K0UB 4RGAA 3PIJA 4YWAA 2CWMA 1VMHA 1Q8OA 1V6IA 2AH2A 2KD7A 3P3PA 4O61A 3R4SA 2RS11 3S6PA 1N1SA 2W1WA 5BNOA 2KXLA 4LIVA 1RHI2 4Z92B 4ES9A 3JBG1 5DZFA 2QCSB 4EYUA 1US3A 3ZYBA 1SFNA 1RUD2 1OOPA 3PJYA 5L7OC 2KA3A 5GLTA 4HSJA 1RUNA 2B8MA 4P9LA 1FXZA 5EZWA 2R16A 1EY2A 2J1RA 1ULDA 4Y33A 1GV9A 1SLCA 1TNFA 5FYVA 3I2KA 3LA7A 3NW4A 4LLFA 4LR4A 2HBTA 1K5JA 2JG8A 1DLCA 4LO8A 2R062 5F5AA 3NJZA 4RQPB 3AMHA 5C9AA 2RR12 2Y6LA 3ES4A 5FQ0B 4AFDA 1QJFA 1W8TA 1YQ2A 5K0UA 1YO8A 2BQPA 2RDSA 3N35A 3OBZA 1S0IA 4QPYA 3H3ZA 3UNPA 3VBHB 4XFBA 1D7PM 1RUJ1 4NO4A 5JR7B 1NZIA 5LY2A 4AGRA 1ZRRA 1XE7A 4N53C 4OMCA 1RUE3 4YFWA 3VB9A 3HT2A 4M0HA 3I3EA 5FXXA 3N9LA 3C2UA 4Y22B 1DYOA 1RUI1 2UURA 4CEWB 1SLBA 2J1VA 3RZMA 4HG6B 2NQYA 3U4SA 3ZDVA 4JC1A 1DZQA 1Y3TA 1UY1A 4CUGA 1GUIA 4QM9A 4A44A 1GZ9A 3W5MA 3M1HA 4AHYA 3DPRB 1CAVB 1N1TA 1VAKA 3HJRA 4XAEA 5JLVA 1PO13 2VBBA 4MGSA 2XWBB 4RQPA 1WMFA 4DOUA 3V0AB 2XJUA 4GB31 5A6QA 2FDHA 1F9KA 2CGPA 1PIV1 2EAAA 3NV4A 3I2DA 2UY9A 2PXJA 2V5DA 3O1PA 2JG9B 4WV8A 3V65A 5KHJA 2XWJB 4QWNA 4R9CA 2GP5A 1LOEA 2A71A 3NQHA 4HK8A 4CDWA 4Y22A 1NLRA 2ZABA 2CAVA 3JCIA 5FZMA 2VMDA 1CESA 3WF1A 1NLQA 1WMDA 2VMHA 1RIRA 1AR63 4EJRA 1PK6C 4OLLA 3E5XA 3M3IA 1PX4A 2R0HA 1ZRCA 4RYDA 2DCYA 3AVRA 4Y1UA 1QKQA 1QJY3 1QXPA 3A0KA 1JBCA 3DPRA 1CAVA 1QJEA 2Z4FA 1ND3B 1GFF2 3M3EA 4FPGA 4UF0B 5DUUA 3VHPA 1RC6A 3VZMA 3J4UH 1FMD3 4HXCA 2RG4A 4QKDA 3V0AA 4CP9A 4BA6A 1ND2A 1JU3A 4CDXB 3KCYA 1CAUB 4QGNA 4QPIB 1NAEA 2CDPA 4I02A 4UFLA 1LODA 2DU1A 1MS9A 4BXFA 1MZFA 4YGEA 2JG9A 1BLZA 2PHFA 2W87A 4HLTA 1XSRA 4Q5OA 1PGL2 2WDBA 4CPBA 1JZ8A 2GC2A 2JJ6A 1Q8PA 1YI7A 2ZGUA 1W90A 4INDA 4JRLA 2D6OX 3NAPA 4DINB 3JQWA 1V6JA 2V4AA 3ZFFB 5IVBA 4YYOA 1FX5A 3OTFA 4O7XA 2RS52 5C8CC 3QBQA 1UIJA 2VD7A 3ACLA 2BFUL 3VUOA 1T6BX 3MIGA 4QX1A 2PMWB 1DDLA 2SBAA 1LRHA 1PHMA 3ZYRA 2ZGSA 2D6LX 1AYM3 1FPN2 1F5JA 5GZDA 4YARA 3OBRA 2NZ9A 1COV1 5FPVA 5CISA 5G04L 3E1F1 3ZSLA 1A8DA 1IPSA 1LKNA 1S0DA 3OSDA 4CDXA 1RVF2 1CAUA 3CJIC 4QPIA 4LO4B 2JD4A 1KEXA 4XCBA 2VR4A 3OCPA 2VNVA 3HD8B 2G9ZA 4I30A 1LU2A 3M8LA 3RZJA 1X8EA 4LOTA 1TVGA 2XDVA 2CNAA 1ZX5A 3LD8A 1JYIA 2RDQA 1MPXA 1E5IA 1NQJA 2AR6A 2AZ5A 3WT3A 3VD5A 4AEJA 4YVWC 2C24A 4A6SA 3RNSA 3ZFFA 2CYFA 4WVVA 1FYUA 2D93A 2BJSA 2X5IC 5A1LA 2CV6A 3BPSA 3LDRA 4KWKA 5LEKA 2DVGA 4JZRA 4NHXA 3GHMA 1U5ZA 1G9BA 4NHYA 4P08A 3BGAA 4CE8A 2KR2A 5FK8A 1EV12 4A3ZA 3PTYA 1WKYA 1DP0A 3SH5A 4AZZA 2GNBA 5DDJ1 4K6BA 1XNAA 2XJSA 2FMDA 5GLWA 4E4DX 3VD7A 1TME3 1QJX3 4LOSA 1ST8A 2VTFA 3M3CA 3FMGA 3VD4A 1LESA 3R0RA 1HJFA 2XLFA 3C7OA 1UPSA 1RUF3 2A3XA 4FSJA 2VOKA 3GJAA 1W03A 1W0NA 2C26A 1QNWA 2VPVA 4LUMA 2BVBA 1UMHA 2DBNA 1REFA 3WP4A 4CXYA 2BYVE 3MV01 5GJ6A 3SNMA 1AL22 1EPZA 3PU8A 4XJ8A 1RUH3 4GKYA 4TWTA 3I2FA 5EHDA 2P17A 4F3JA 5IVEA 1TG7A 4IEOA 1KDKA 3WEZA 1PGW2 4KG8A 5J48A 2FD8A 5FFOC 3LDBA 5FMOL 1GP6A 3ZN5A 2C1FA 2ZBJA 3HT1A 1LOFC 1UD1A 2WINB 4A7KA 4D7TA 2H0VA 3UKVA 1JYWA 2HWE2 4Q4W1 2QVSB 5KXCA 4ZKTB 2C5DA 3VDDC 1LHNA 4QB6A 4R4ZA 5FO8B 2PQSA 5JPNB 3VBFC 1NA1C 3BODA 3I3DA 1EAH2 1DG6A 5JXHA 3ZLIA 2ZA9A 3TBDA 4IETA 3V64A 3O1TA 1AVBA 5A6XA 4XFCA 4FAHA 2L9LA 3B3QE 2BDRA 2Y6HA 3MLKA 4XACA 2A70A 5I8SA 3ZOIA 2YBPA 4Y3OA 1HDKA 1DQ1A 1WWYA 3MUZ1 3T30A 1F15A 4OQ8A 3IPVA 1QNYA 4M4PA 1CONA 2XUEA 4BM8A 4A2UA 2ID4A 5CKNA 2J1SA 1HB1A 5J98B 3WP5A 1H9WA 5SV8A 4Z07A 3ZYIB 4D69A 2GN7A 5T54A 5FXWA 4BQXA 4ZXKA 5C3RA 4KWJA 1GP4A 2JDHA 2ZGRA 2R6QA 3NJXA 1ASJ3 1OLMA 4Y26A 4JHZA 1NY71 5LZ6A 1AR62 2BP6A 4IQPA 2BEOA 2ZGKA 3K4ZA 4AXOA 2VGDA 1BVVA 2R32A 1F35A 3LCPA 4QKNA 4GALA 2GDFA 5T5LA 1OH3A 4GZ9A 4Q1PA 3AMQA 1OHFA 1QJY2 2D98A 5M0TA 4FQ4A 2OS2A 4YRDA 2VZPA 3WNMA 3LKJA 1FMD2 2KM2A 3ATGA 4P9IA 3RJ2X 1W0PA 2UWAA 2WZR3 2HWF3 3CQOA 1HV1A 2WNVA 4BMEA 3WUCA 1LHVA 1UY2A 4CCMA 4JQRA 3POSA 3ZFGB 3PURA 3OF1A 2A7AA 5FZOA 1J1LA 1NCRC 4PF5A 1WZXA 5HCBA 2XJQA 2QQVA 4XFAA 1IPKA 1IS4A 2EXKA 2BTVC 2WJSA 4ORFA 2RS33 3BYWA 3ZXLA 3ZPOA 4QX3A 4UW3A 4LO6B 4XDQA 2YYOA 4BQ3A 3RG0A 2VUCA 1I9RA 2PYTA 2XBO1 4COVA 1U0AA 2D6KA 2ZAAA 1V70A 2PHDA 3VL8A 1GOFA 4NPRA 2JENA 4META 1CIYA 4CA9A 4QXCA 5L7OB 3WQ0A 2CGOA 2X09A 5CYYA 2DUOA 4QKBA 4PHZA 5BXXA 3QH7A 3KGLA 1JOPA 1D4M2 4URTA 1MZEA 2D6NA 1R64A 2MEV1 2H6BA 4LPLA 4RFT0 3ROUA 4AHWA 3AVSA 1PZ8A 1UYXA 3B01A 3HN1A 3WY6A 5JOWA 2ZEYA 2JECA 2X53S 4CTEA 2OKXA 2XOMA 4ZU7A 4LBNA 4N7IA 4E2GA 2BZDA 2D97A 2JKXA 3HPNA 4Q4V2 1H2KA 3A4UA 5T5JA 3UESA 4ZHNA 2D44A 3FHIB 4XZPA 4AVBA 2WN3A 1JYVA 4N53B 1C8NA 2WS92 3WG1A 4E2QA 1RUD1 5A33B 3EQEA 3MO4A 2X10A 2Y0IA 1OA4A 4IUGA 1RXFA 3NKGA 4Z2WA 2JB4A 3NNFA 4CU9A 5LEJA 4D7YA 3FBMA 2WC2A 3U10A 3H7JA 3O1OA 1STMA 1JODA 3POFA 2ZX4A 4XJ9A 3THPA 1QJU3 5L7OA 4L0PA 1YXWA 1OI6A 1UXZA 4NRQA 1W8WA 2Y6JA 5FO9B 1R082 1UO9A 4WZFA 2R061 2K46A 3I59A 2HEWF 2P4EA 1ZBE3 2RR11 1O7FA 2VZSA 3KSCA 2IVJA 3BIWE 1XNKA 4IE7A 4Q0PA 4R52A 2PA7A 4H14A 3UV9A 1HRV3 1XNDA 2DBIA 2JDMA 1O59A 3NO8A 2V72A 4XF1A 3E6DA 1W9TA 4B7KA 1BYHA 5BPXA 1AR82 2NM1A 1QY4A 4LMFA 4N53A 2I2SA 1JYCA 5A33A 3MIEA 2P3YA 3RGBA 1J3PA 1GR3A 1GANA 4V1PA 2VZOA 2VUDA 4J1WA 3BTYA 3AYAA 2OQ6A 1C1FA 1LCLA 3GDBA 1PK6B 4BLIA 3T0DA 2B45X 2AC1A 5KR7A 4NOTA 1ZRDA 3J7LA 1RUH2 2DVAA 2WFF3 2BBVA 4K3UA 5K9YA 3HNBM 3IKWA 4Q4X2 1KS4A 1SLTA 5FP3A 5GLUA 4IEUA 2FZ2A 4CU7A 1DYKA 1MEC3 2F17A 1HW5A 4Q4Y3 1WBFA 5EPAA 3WDWA 5BNQA 3GALA 1GP5A 2OT7A 4V2VA 5FYHA 2VW1A 2IUWA 5EWSA 4DUXA 3VHRA 2VU9A 1GNYA 3I97A 1JUHA 4X6QB 4NRMA 3A22A 4HKLA 4AEDB 1D2SA 2EF6A 1POV3 1WW5A 4AL9A 1PX3A 2ZAHA 1PGSA 4A45A 1JZ3A 1H30A 3AKSA 1HIXA 1PK6A 3JB4C 1VBE2 5C8CB 1KFUL 3L9JT 4BHPA 2JXAA 2UWCA 3KQRA 3A0NA 3FHQA 4JQTA 4R4XA 1HRI3 4LNVA 3RZGA 4GWNA 1SPPB 4GMP0 4MUVA 1CJDA 3MHZA 1GWMA 2XXZA 3OJBA 4LJHA 5FZ7A 2Y8KA 1PGL1 3CJIB 3VBSC 4OHVA 1QOOA 1RMU2 3VBUC 4JVAA 3P6BA 1TE1B 1UXXX 3SKVA 4LA2A 4AEDA 4TLGA 4DNYA 1JYTA 1LGBA 2XL9A 3VHOA 5IATA 2X8KA 4Q0SA 3MLJA 4RGGA 1ZRFA 1AR72 2RS51 4FP2A 4W6WA 1Q8SA 1WD3A 4YVWB 4Q8KA 2WWSA 1S0GA 5A7WA 2PHUA 5C8CA 2QQUA 2VOTA 2FCUA 2OYZA 1FPN1 2A1XA 4P9GA 4BQWA 3N7JA 3ZFEC 3B5LB 3FUOA 2TUNA 1CJPA 1RTVA 3CZUA 1VJ2A 1EUTA 5FZFA 5BNPC 2I45A 4Y1XA 1IKPA 4KWLA 3U11A 2VW2A 1RVF1 2Z5WA 1SBEA 4Q26A 3ZPYA 4AI2A 3AXDA 1W9YA 3ACFA 4XYXA 2RS32 3JD72 3R4UA 5JR2A 3U0ZA 3CJIA 3ZXFA 5FZ9A 4A42A 5A1AA 5JUVA 3NSTA 4D6QA 3K77A 3WX5A 2F4LA 2BGPA 1AXZA 2WRAA 3LFIA 1LHUA 4E4ZA 2C4XA 2VNOA 3VKLA 3ITQA 4JTOA 1V0AA 3KHCA 3Q8EA 3PIGA 4YVWA 5D1IA 4B1LA 1O4ZA 4ES8A 1JW6A 3WNNA 2QKDA 2TNFA 4GXLA 2WA3A 2VCCA 2W3JA 2WR9A 1IOAA 1VRBA 4HT1T 5BV6A 5JXIA 4NIGA 3CHXA 4CDQC 4TN7A 4XPVA 4UXAA 5KXEA 4AQSA 1EV11 5JMOA 2NPIA 2AENA 5FY0A 3A21A 2ZHMA 4AI9A 4S2FA 4OHZA 4AGGA 1W06A 2DFCA 2DCTA 2XB6C 3FLTA 1QHDA 2Y60A 4YZ5A 3LOBA 2IXLA 1DQ4A 2LROA 4B4PA 2CSGA 2PHLA 1F4AA 5FY8A 3VDDB 3POEA 5I8YA 3ZYHA 2P2KA 1UKRA 2B39A 3BU7A 3JZVA 3MW4A 1QJU2 4NAMA 3VZNA 3NWKA 5FZ3A 1GNZA 4YLZA 2EA7A 3MIDA 1XBFA 1W6PA 5K8SA 1AL21 3N9MA 1QOSA 1UZWA 3LSDA 4A3XA 2HYXA 2RMU3 2PLV2 1ZYBA 5FWEA 4CEYC 1PGW1 2WO7A 4DRRA 4Y4RA 5FPXA 2DVDA 4NHKA 2XGXA 3RYKA 3THTA 5EJ1B 2FMYA 5JSOA 2PAKA 1DU3D 3FL7A 1Z7S2 5GKAC 2HWE1 1LOFA 3JUUA 5LA9A 4PIXA 2W46A 3MW3A 5L73A 3WP6A 4YW4A 2IXIA 1OT5A 1ZVFA 1BEV2 3VDDA 1EAH1 3H9AA 3KV4A 1X50A 2VNRA 4NROA 3VBFA 4MOAA 1ULPA 4CZSA 3LOIA 4FAGA 1ZZCA 4Y1VA 3ZIXA 5FZBA 2Q4SA 5K7PA 1O5UA 4XMIA 3RYRA 2C9AA 4XIOA 1MEC2 3IIAA 1US2A 3TYJA 5FPUA 5FKBA 3E5UA 4FPHA 4JKKA 4P5YA 2P34A 2WYFA 4EZHA 3KVAA 2R072 3ABZA 3J8F3 4JHTA 5FYBA 1L7QA 2WZPP 2CTVA 2E7AA 2PHXA 4D0QA 2O0OA 2DUPA 3HIFA 1NCRB 3ZYPA 3WW1A 1AYN2 2YBSA 2RM22 3C7GA 2O8QA 2PHRA 4FOWA 4AVAA 1JZ4A 1HV0A 1MVEA 2IFWA 2IWGB 4MGQA 4R8HA 5FYCA 4D94A 3S5AA 1CPMA 2O1QA 3HAGA 2G19A 2GC1A 3FUQA 1OF4A 3ASIA 1VRH3 4A7ZA 1QJY1 1PVXA 1V6NA 2BV4A 1HX6A 3VBOC 3RPQA 1HJGA 2H0BA 3ILNA 2NLRA 1QXRA 1G9CA 4H7MA 1K42A 3KGZA 5JSRA 3GBGA 3M4FA 3S7EA 3NMBA 1JHNA 1R093 5IW0A 3BTXA 2E31A 2YV8A 2BFUS 4P02B 3THCA 2CDOA 2E26A 2OUJA 4HN1A 1NCRA 4Q0VA 3ZR6A 4AVCA 4RD7A 4CDUC 2X05A 1OVSA 5KHKA 1MACA 2DU0A 2YU1A 3BPZA 4XTMA 3GGLA 1LR5A 2XJPA 4BB3A 1VBA3 2W92A 5LA0A 3EMRA 5ACA3 5DN2A 4L9BA 3FHAA 5K4LA 2XUMA 4LHLA 3N9PA 4YW5A 4ATFA 5LRSA 5I0TA 3W21A 1JZ7A 5EJ3A 1D4M1 3I2GA 3O0XA 3U07A 4AF9A 1ZZ7A 5FLJA 1LULA 2A6WA 4XZUG 3WLUA 4CUAA 4DEQA 1RUG3 1P8JA 4FTSA 2WSVA 3B94A 5C3OA 3AKQA 4TYSA 5CEHA 4QX0A 2E6VA 2XQXA 1PM4A 3ZIWA 4D7SA 2WLPA 5KXBA 1O3RA 4Q4V1 4QDRA 3LE0A 5FZDA 2W1SA 3VBRC 3ZXGA 4BYYA 1OSGA 3MFCA 4AOCA 1WLTA 2WS91 3EHKA 1O4YA 2XKOA 1KITA 1BBT2 4IL7A 2YU2A 2VCAA 4ASKA 2YUEA 3M2MA 2VBPA 1H8VA 4QB1A 4CXXA 1JMUB 3WQ7A 4O9EA 3ELNA 4PQ9A 3CZJA 3AFGA 2HWC3 3IWZA 1NOVA 4Q0QA 2FBEA 2W5FA 2ZACA 1R081 4XFFA 1EUUA 2JG8B 2W52A 1SLLA 3NV2A 3PVBB 3WCRA 1PVC3 2A3WA 5CG8A 2OX0A 3DYPA 5H9QA 1TMF2 4CCJA 5F3IA 4K1ZA 4R9DA 2P3KA 4IDZA 1AR93 4LEJA 4ZXEA 1UU4A 4FTBA 4LBLA 4MO3M 3DECA 4C90A 1AR81 1UPIA 1V9U3 4DRVA 1DZTA 2Y38A 1RUC3 2BWAA 4J25A 5GZFA 4FFHA 5T55A 4AVVA 4GA9A 5C6CA 4W4ZA 5FMOS 2IXJA 4PF1A 3H3UA 4QX2A 3WHUA 2GALA 1RUH1 4XUOA 4WVMB 2XR4A 1ULFA 1SFPA 2QQIA 3QOPA 4Q4X1 1HXS3 2ZGTA 3FLPA 1XB9A 1PMHX 4NVPA 1V6KA 3UGHA 1XE8A 3IN9A 4YZ4A 2HWD1 2WIIB 1MR5A 4CDWB 4QXBA 5H9RA 4BWOA 4A41A 2QE3A 3PTRB 3DL3A 3SEPA 3ZM8A 2AEYA 4F8AA 1VR3A 3PMSA 4CCDA 2ARCA 4S2DA 4IEVA 3VBSB 2VVDA 3VBUB 1UZZA 1W3VA 1IGOA 1N1VA 4RGKA 1UOFA 2QQJA 4DPNA 4IEQA 3CU7A 3K3OA 4YGBA 1ODMA 1ZBA3 2ES3A 4IEXA 2Q1FA 4UFIA 1VBE1 1LOCA 2VMEA 2Y0OA 5IUQA 5J37A 1S0EA 3O1SA 4WVMA 1XYPA 3L2YA 3WDTA 2GC3A 4CU8A 4MG2A 2W0XA 4JDNA 5C7GA 3O0VA 4K1YA 5A80A 3ZFEB 2B7YA 2AUYA 4CP9B 5AC93 5CBLA 1ND2B 2VJXA 3RMXA 3ZDSA 1UNBA 4XJUA 5BYNA 1WW4A 3KMHA 5FYMA 1RMU1 2P6HA 2GMMA 3TN92 4SBVA 4URAA 1FOD2 4OULA 4EE2A 2WLQA 5FY9A 3SXWA 3KF3A 4XUPA 3VBSA 5FZIA 2G9FA 3NAPB 3VBUA 5F1RA 1VRH2 1YLLA 1YQCA 4JV4A 3GXUA 1I5ZA 1AR71 1NX9A 4XURA 3BN6A 2QDNA 1G9DA 4HVRA 4XUQA 4HETA 4JRAA 2DURA 2DUQA 1NZCA 4OI2A 1YQ8A 3CIHA 5A70A 4PCRA 5IYYA 3ME2A 5CFDC 1MZ5A 3KS7A 1XE0A 2BERA 1RL3A 2ETEA 3CNAA 3OOXA 4H55A 4DIQA 1C8M1 4GH4C 2JE9A 2YPDA 4HK9A 4SLIA 1RITA 1UYYA 1W2TA 3ZFEA 1QQP3 4IW3A 2BOIA 2VM9A 4BLJA 4CDQB 4S2HA 2DYCA 5IAXA 3MYXA 1WBLA 1H2MA 3ETPA 3JD71 3RMYA 2EIGA 4XVHA 5F6KA 5J3UA 1NUKA 1ZREA 5DUWA 1VBA2 2YFZA 4YW3A 1A78A 1SACA 1VBB3 2G4IA 1L7LA 3RI8A 4BOWA 3POWA 2H6CA 4UI9L 4C8DA 4BPZA 2BVVA 5FK7A 1Q5OA 4ONUA 4XDPA 4CCOA 1H0BA 2HEYF 2WQ4A 3BALA 1OMIA 1L3JA 5A3LA 1MS8A 3HQXA 1E5HA 3OY8B 4ATEA 1SFYA 3ZX7A 4X6RB 4ZS3A 3LIHA 4XTPA 4Y5SA 2Q8OA 1PO23 3OGSA 1R1ZA 4PBOA 1W6OB 3SH4A 4WM8C 2R042 1XOYA 5DABA 4CDQA 4CEYB 1DQ6A 5FO7B 1R1A2 4I0BA 2Z42A 4AQ6A 4ZY9A 1HB3A 5F2SA 3MIHA 2ADEA 4JTNA 3NNJA 2VQTA 1UX7A 3TEZA 2HWB3 4D8MA 3I3QA 1YUDA 2V4VA 1UY4A 3LF7A 4ZPIA 2RJ2A 2XL7A 3FC0A 1QJU1 4NHMA 3CJXA 3AKRA 1AJOA 2BUKA 2JIJA 2VH9A 2W1UA 5C4WC 3CLPA 3I3MA 1DLLA 4E27A 3OPWA 4XOGA 5JMCA 3OY8A 1PVC2 1VAMA 2PLV1 5I0UA 4BMBA 2P5BA 5F9TA 3AP7A 4Q29A 4QPWA 5FMDA 1W6OA 1WUVA 4FFIA 4CEYA 5FBZA 3OEBA 1VE0A 4WM7C 3WP3A 1WLCA 2Q0AA 2ZMNA 1VBD3 1DGRN 1Z7S1 4LKFA 1MVQA 1MZ6A 1S55A 3SQOA 5IWFA 2PAMA 5CZKA 2IFRA 4UW4A 1VBC3 2RVAA 1QXJA 1UMIA 3LA2A 1BEV1 2O8OA 4UYBA 3WDXA 4DZGA 4WVZA 1UYPA 1Y9QA 2CY6A 1DGWX 4M4RA 5E88A 1S4CA 1DF0A 3O7OA 5C8WA 2JICA 3ORJA 1G9FA 1YIPA 3D0SA 1CD3G 3OG2A 4OHYA 4Z1VA 3I2HA 4LO5B 1W9WA 3VBOB 1JXNA 1GLHA 4UW5A 4FQZA 4LIUA 4NMIA 4JDMA 4QDSA 4B29A 4J1XA 1RINA 3CKHA 3O5SA 5B2GB 2Z2SB 3IPVB 1JU4A 3USSA 4XETA 3IMNA 4PLMA 5C5UA 3GHNA 5JVVA 2R071 4ASMB 4B7EA 4RS5C 2RDRA 4IXLA 3ZN4A 1RUE2 5FR3A 2RS13 1A8MA 3E6CC 5LW9A 1AYN1 2QFEA 2RM21 3JBG3 4IERA 3FLRA 4MGZE 3ZSMA 2F6BA 4I09A 1AX0A 3RSJA 3MF9A 2BNMA 1VLNA 3ZYFA 4QKFA 4PJYA 5GZEA 3VN4A 1PMJX 2VCBA 3UL2A 1YJLA 4MHRA 4Q0UA 3GZEA 5EYXA 5E1RA 5HCAA 2A3YA 2JX9A 2VMIA 3MIFA 3AMNA 5ANNA 1PO12 3VBOA 3BU0A 1Y43B 2VVFA 3MFAA 2VECA 5FPAA 2WNVB 1EP0A 2XJTA 3F95A 1YYNA 2ERFA 1I5PA 4FPFA 1XYOA 3UGGA 5A3NA 5KC5A 5JOYA 4AVSA 5FZOB 4AHXA 1RUJ3 3LEMA 1TEIA 4PQQA 4XW3A 4FBFA 1MQTC 3M3QA 3MIBA 1ENRA 4V2WA 4U36A 4LITA 4FPKA 1RUI3 5LBCA 1E5SA 5I93A 5JPMB 1W8UA 2ZCWA 4EQVA 5IVCA 4I0WB 5HPOA 1XNBA 2QQNA 2I07B 4D3WA 2PTMA 4Y5TA 2HH9A 3DV8A 5FOJB 5BNNC 2FDKA 4MGIE 2ZX3A 1LAJA 1M4WA 1WCUA 2VZUA 4QD2A 3WQBA 1OUXA 4CCKA 3S0MA 2IXHA 1WCSA 1QQP2 3ZMOA 4I3GA 4QMAA 1CX1A 3POBA 3O1VA 1UKGA 4GB33 1UF2C 2RJKA 3NRUA 4XJZA 4YNIA 3D4KA 1PIV3 2VMCA 1F8VA 1YNAA 4HOOA 4K8RB 2LRPA 3HNYM 1GMMA 2FDFA 2WUHA 1I3HA 1VB4A 3K51A 1HKDA 2ZX2A 1W6NA 1UCXA 2DTWA 3KV9A 1SCSA 1KJLA 2IXKA 4K7JA 4NPMA 2AEZA 3TN93 1N3QA 5DG2A 1QJZA 3DYOA 5FZAA 2VTXJ 4I0AA 1E57A 3VBRA 3T1LA 4W50A 1BBT1 5A7SA 3KQ4B 3HBKA 4OHWA 4E8DA 1QH6A 3AFKA 5FMBA 1AYM2 1Y9MA 3JXSA 3N36A 1YI9A 1J58A 1DZRA 4PT6A 2DDUA 4XBQA 3WG4A 5IK8A 1ACCA 2R30A 1XJAA 2OPWA 4YGDA 2XH6A 4MGKE 2JDYA 3I59B 3S7IA 4LHSA 3FWEA 1TMF1 2XHKA 4QPGC 4BQ1A 4DXTA 4DY3A 4AFCA 1H1MA 1KXGA 5EXOA 5CKMA 2HWB2 1SLIA 2WAAA 4HFSA 4B3NA 3R6SA 1BXHA 5D8AC 5C71A 2GNDA 2VZQA 1RHI1 3RJRA 2YHJA 3ILRA 4B8EA 5EP9A 3WG3A 2Y26A 2E7QA 3BCWA 3I54A 4XQWA 4PI2A 3R05A 2ZEXA 5FAXA 3KT4A 1ULCA 1G7YA 4LULA 3B02A 3HMYA 3ZSJA 1XU1A 2VL4A 3TNQA 5FZEA 4AFBA 3P3NA 1COV3 2JDUA 1W8NA 1UN1A 1OLME 1S2EA 3VKOA 1VMFA 3HR9A 3QACA 1W2UA 1G8WA 2QQLA 2GN3A 5DQ0A 3UKTA 1N3OA 3H7YA 3O0WA 1UX6A 2AREA 2XPJA 1TME2 1QJX2 3KCXA 2EAKA 3NNMA 5C70A 4GJZA 5FZCA 5DMYA 5L9BA 1RUF2 1MS1A 1HLCA 4IEPA 5T50A 1LHWA 1CQ9A 2R49A 4M0NA 1ALYA 3ILFA 4BISA 2YC0A 2ZGOA 1APNA 3ES1A 3LEGA 4PLOA 2FDJA 4JGYC 1J3QA 1IG0A 1SLAA 1W3XA 3AP4A 5FZGA 3VKFC 4DY5A 5A6YA 1O3TA 1OLQA 3MLLA 4I3PA 3WDVA 5LB6A 1AXKA 5BNOC 2UWBA 2ZMKA 3NNLA 5DZEA 5B4XA 1AX1A 3TAYA 1OC1A 5FYUA 5CFDB 5DUVA 2EXIA 1RB8G 1SMVA 4BU2A 1WCDJ 2FCVA 5JAXA 2PN5A 2WT2A 4N43C 1W2NA 2Q1ZB 4NIHA 1OOPC 5DDJ3 3LPGA 3TN91 2VOXA 1FOD1 5DAWA 2W08A 4K40A 3WNOA 5FP7A 5JWPA 1CVNA 2V5YA 3U1XA 3KD4A 3C7FA 1VRH1 3AKPA 1LNSA 1O3QA 4LBQD 4K9SA 4DB5A 1W9FA 1H8TC 2JE8A 4XEZA 2F4PA 5K0UC 1QWRA 5A7WB 3KWVA 3TB0A 4Z82A 1UY0A 3OD4A 4F7ZA 4XQ4A 5L36A 4AK3A 3OUIA 1JN2P 5CFDA 3AYEA 4W8JA 5I0DA 3I2JA 4COUA 1XU2A 1LENA 4DQAA 3K4AA 4GH4A 5H9PA 4XF4A 3KCCA 2NMNA 1ASJ2 2RHPA 3L2HA 5FYIA 1QEXA 3G6JB 4WM8B 4COYA 4Q4W3 1W6MA 3WR0A 2GP3A 2VW0A 5LK7B 4AI0A 3OBAA 5FV3A 1JOJA 4KGGA 5F7UA 5J1XA 5AFEA 4XE9A 4FPLA 3QD6A 1C5HA 4AEMA 4BQ5A 1OQ1A 1GWKA 2EIDA 4CCLA 5LWBA 4TZDA 3Q9OA 4IGPA 5F3GA 2AGSA 5FY5A 2WZR2 2HWF2 1Y9GA 2X5IB 3FFQA 4KGQA 1ULGA 5F5CA 1FNZA 5FKCA 3VBHC 5CFCC 3B69A 5C4WB 4P14A 1D2QA 5C3SA 3VKNA 3BVCA 2GH8A 3AZZA 2OQ7A 4CEWC 3T4VA 2R041 1BQPA 2WNEA 4C1WA 1R1A1 5ABJC 1W2AX 4JKMA 4NJ4A 3NL1A 4WM8A 5D2AA 3HQUA 1S2BA 3O14A 4WM7B 4UBGA 5FXVA 5EJZB 5FZ6A 5F5QA 1C1LA 3WDUA 3DPRC 3PVOA 5GLVA 3GM8A 3WNLA 1QDOA 1W8FA 2VBDA 4QHOA 4MXVA 1X8MA 5FCCA 5G05L 5FYTA 2A6VA 2D43A 3ZXDA 5FYYA 2YZ4A 3MPBA 1X9TA 2VQUA 3KVBA 5A3OA 1W6PB 2X5IA 5FYSA 4LHNA 2EALA 4KNCA 3GBFA 1PVC1 4XFGA 5C4WA 3WUDA 5J09A 2Q5TA 2OVUA 3IZOA 5EFUA 3T2TA 2HBUA 3VZLA 3GCXA 2B9VA 3WV6A 5FZHA 1G9AA 4M3CB 4MGTA 1FV3A 2RV9A 5KHHA 1ZA7A 4FPEA 4Y20B 2G1MA 3MEPA 2VMFA 4N9IA 1S1AA 1BK0A 2J42A 3VD9A 3RZZA 3P5BA 4WM7A 1XPWA 1OURA 5A3WA 4B1MA 1KGYA 2P3IA 5DUXA 5FJKA 3O1MA 1UY3A 3IDBB 1QIQA 4W6XA 4YW1A 1D0GA 4HANA 1UOBA 2XBO3 1ND3C 4P9JA 4CCNA 5T3NA 3J7NA 1H6YA 4RN5A 3RVHA 5FZKA 3GF6A 2ZMLA 5F32A 1NA1B 3VBFB 4QDQA 2VMGA 5FDBA 2VUJA 2C6SA 1GNHA 4LK6A 2YMZA 3AYCA 4G9SB 4OZOA 5FJHA 5A3TA 2MEV3 3APBA 1ZBE2 4EROA 2FCTA 2W94A 1J3RA 1SDWA 3OPZA 4JKLA 1GQPA 4M3CA 4YGCA 2E9QA 1HRV2 3OEAA 1LGCA 4KH9A 4RHV3 3ZFFC 1X7NA 4Y20A 4W6YA 1RUE1 1O5LA 2B46X 4CXWA 3GZTB 2CWSA 4FT8A 1B35C 4GQ7A 2Q8EA 2WT0A 5JZGC 4RL7A 2ZX1A 1MQTB 1RUD3 3QH6A 4IE4A 3V0BB 3AM2A 1W6QB 4UAPA 2CAUA 1W8ZA 4TLFA 2WQ8A 4AI3A 1IG3A 3AX4A 1BKZA 4AEKA 2WL1A 1NA1A 1SZBA 1S0BA 3DEMA 5E8AA 1ZNPA 4AGVA 2WFF2 1PO11 1X36A 3AZYA 2R7EB 2WBKA 1YFXA 5BNNB 1ULOA 1Y4WA 1QDCA 4Q4Y2 1YFUA 2RR13 5JI7A 3VZKA 3OBTA 3POIA 4OQ9A 5HV4A 2IXCA 4CRQA 3WQ1A 5DAPA 4IV3C 3GYDA 2A75A 1OBNA 4NHLA 5FZ0A 1O8PA 1DQ0A 3IMMA 3K75B 3RDIA 2B4KA 4EN9B 2J1UA 5IK7A 3K2OA 1OUSA 5JIAA 3IAQA 4Y1YA 1AR61 3RYPA 4NIIA 1AHSA 1MQTA 2WSUA 1YFYA 5CIRA 5CB7A 3V0BA 1V6MA 1OQDA 1W6QA 2GMEA 4QXHA 2VO5A 2K9ZA 1V6LA 3FN9A 1WLDA 3HNMA 1YQ5A 3PUSA 4XXAA 4GAZA 1FMD1 1IQAA 1HRI2 1OFSA 5BNNA 1YQ6A 5LCWL 1QQP1 2ZHLA 3OYWA 2A6XA 4IGOA 4IV1C 1LECA 1Q8VA 4EWAA 2YY1A 3PMEA 1GZTA 4UFMA 4UFKA 4LXLA 1CPNA 2LW8A 4XF0A 2QNKA 3SLIA 5F37A 2UYBA 3SEEA 5CA6A 1X82A 2OXBA 2YROA 5JXGA 4AWDA 4LBKA 2P1BA 2C0ZA 3LSEA 3EXUA 3N7KA 2VOVA 4XQDA 5CNAA 5FP4A 4HN0A 1J84A 3AMMA 4WZCA 3RI9A 3LWCA 4OUMA 2TBVA 5D8AB 5IJRA 4DXSA 2VC9A 1OD3A 4N8MA 5FZ1A 5A32B 3WNPA 1S0JA 3GBWA 5EYYA 2Z69A 4XFIA 1AYM1 5EV7A 4AAXA 4QX8A 2FQPA 2R0FA 1CWPA 4HSLA 2W91A 2J22A 4QHBA 3AK0A 5A7NA 5IT6A 1JYXA 3W58A 2K2SA 1GQGA 3UJQA 3PJQA 2K0GA 1GYKA 4CDWC 4KBZA 4L97A 1CAXA 4L8QA 2AYHA 1C4RA 2J1AA 2QZ2A 4MXWB 4TXWA 2QQKA 2ZGQA 2DCZA 2E7TA 1LU1A 3PU3A 3WW3A 1E5RA 4EN0A 2ZHKA 2HWB1 2D3RA 4MYEA 4QPGA 3LAGA 1CN1A 2WO1A 4YM0A 4P5HA 1O8SA 5JSPA 1GOGA 5D8AA 5GM0A 4CP1A 4GMP3 3DKWA 2RS53 3UKNA 4NIAA 3TOJA 3U37A 5A32A 5L9VA 1VP6A 3D0JA 1HQNA 2VG9A 2TEPA 4HBNA 4NPLA 4N7UA 2A73B 3ZYJB 1FPN3 5AVAA 1YCIA 2LS6A 3D8CA 4LBOA 4NN0A 3LIGA 5HXVA 3VGIA 3M70A 4JGYB 1JH5A 1UYZA 2WABA 3TEYA 3EYPA 4MXWA 1RVF3 4LE3A 4LBQB 4C91A 2ORXA 3I2OA 1T2XA 4FOQA 1GOHA 5IHRA 4XABA 5KWRA 1H6XA 1OPMA 3SC7X 4KQ7A 3VDBA 1KJRA 1QJX1 1TME1 1X33A 2BNOA 3IAPA 1UOGA 5IFPA 2XHNA 2DCJA 1RUF1 5FUIA 4AG4A 2VNGA 2MPFA 3T3YA 2PFWA 1NYWA 2Q1MA 1H2NA 1FNYA 1GZWB 2BRTA 2NYYA 4QGMA 2VXRA 4R9BA 4HVQA 2JDPA 2B9UA 4YW2A 4XHBA 3TNPB 3ZFGC 1PZ9A 1AL0G 5KBFA 2RMU2 2BBAA 1UAIA 3H8OA 3OGRA 1H8TB 4XBNA 3MF6A 1Q8QA 4H7LA 4IEYA 2JDAA 1HB4A 4JGYA 1DGWA 3EO6A 1SHWB 2P6CA 4YZ1A 4RHV2 1EV13 1OF3A 2GMPA 1W9SA 2ZTNA 1YFWA 3IDEA 4LBQA 5GLZA 2BU9A 4FFFA 3BTZA 2D3SA 2D3PA 1J1TA 4K8FA 2EIEA 5TSWA 4AQTA 2YG0A 3AB0A 1GSLA 4NIDA 2E33A 1WW7A 4LBMA 4N43A 3AC0A 2NMOA 5DAXA 4AI8A 2NP0A 1K3IA 2NN8A 3BOPA 1ENXA 2OZJA 5C5TA 2P3JA 5H9SA 3A23A 1GZWA 4H2AA 1ZM1A 2D6PA 3H0OA 1HB2A 2YB7A 4WVWA 4XJAA 4HMZA 3WW4A 1AL23 1V00A 2I74A 2Y6KA 4DO0A 2XMLA 1REDA 4NAOA 1K45A 1H8TA 2OUHA 5APAA 1YJKA 1VAVA 4OUSA 2XG3A 4FOYA 4XJWA 1S2KA 4CP0A 2ARAA 5CFCB 4AW7A 3J8F2 4GIQA 4COZA 1BZWA 2DCKA 1O3SA 3WF3A 2WNUC 3ZR5A 5BNPB 3VDCA 5JCTA 1ASJ1 4Z8BA 2JDZA 2QDRA 1VALA 3B93A 2HWE3 3D82A 3BTAA 4MADA 4QQOA 4BIOA 5IVJA 3HWJA 4Y5Z0 1B09A 5ABJB 3MPPG 2VZ1A 4X8NA 4XCAA 5FMCA 4BIFA 3GZAA 1EAH3 2WZEA 1BMV2 4LK7A 4XIKA 3TWIA 1XNCA 1NCQC 4OMDA 1JI6A 2HLEA 2OPKA 4JAAA 1TZOA 2WZR1 2HWF1 1UZ0A 2YPJA 3Q8FA 4XUTA 5FQ0A 2X29A 1R092 3BIEA 1H9PA 4FP3A 3USUB 4FXKB 4NWVA 3K4DA 1UOJA 3I8TA 3J7HA 3VBHA 4BDVB 4YSFA 5CFCA 3WF4A 3SCHA 4YG0A 5E89A 3MI8A 1WA6X 5FPBA 5FY4A 4IE6A 5BNPA 2Y64A 2B42B 3M7AA 4JDOA 3DYMA 4YVSC 2RS31 1UL9A 1OLRA 1MS4A 1XNTA 4CEWA 4BQ2A 1O6UA 4EN8B 4Y4YA 4FOVA 4OI0A 2VZVA 3WF2A 5ABJA 2QZ3A 5IFTA 4R9AA 3GJBA 5ACA2 4HPKB 3N9QA 4LE4A 4AE2A 2VZ3A 2EIBA 2ET7A 1EPWA 2ZGPA 3WXPA 2B5HA 4G4FA 2DTYA 1DCSA 3LQCA 1JYNA 5L9RA 3NV1A 2QJVA 3A7QA 2IVIB 3AP5A 2J7MA 2VQ0A 3HQRA 5FY7A 5CU1A 1RUG2 1JHJA 3USUA 1DQ2A 3RWKX 4AYUA 1CX4A 3OB8A 2PHWA 4AEDC 1XC6A 3G7DA 3WHTA 1IS3A 2VTXA 3Q8AA 2YDEA 4F83A 2ADDA 4AFMA 2Y6FA 3O12A 1O91A 1G86A 1VPHA 3ZKUA 2C9KA 2MNGA 4AI1A 5J36A 2D6MA 1MS5A 4HPKA 3ZO0B 4KWUA 4UWDA 1U5XA 4N90A 1B35B 3HVDA 3PLQA 5FUPA 2YFUA 3IBMA 5JZGB 2ZZJA 1ZZ8A 2GZWA 1ND3A 5FREA 3E6BA 2Z79A 3CBNA 2HWC2 3BOWA 3DXTA 3H8UA 4PDWC 3C7EA 4UF0A 2A6ZA 1ZRIA 2MHFA 1LHOA 1N47A 1D4M3 2GU9A 1FV2A 4P9WA 2YC2A 1ZBE1 5F3EA 5FYZA 4Q8LA 4BCUA 1H1IA 4Y24A 2P37A 2VOWA 3S5QA 2ILMA 3I49A 3AKTA 1HRV1 1RJ7A 4WBBA 2JWPA 3POGA 3H1YA 1AR92 4PI0A 3T2PA 1SEFA 5L19A 3CDZB 3WDYA 4Q4V3 4ZONA 4DMIA 1NKGA 1V9U2 4QM8A 2AACA 1LGNA 4IV3B 2PELA 2IC1A 1RUC2 2WS93 1BHGA 5E16A 3INAA 1B35A 3H3LA 5FY1A 3ZXKA 4Q2FA 1ONAA 1F31A 3EBRA 3J7MA 5JZGA 1N1YA 1CR7A 2VZTA 3RZKA 3MZHA 1W2OA 3RWNA 2WFF1 1XRUA 4LKEA 4ARXA 2WWJA 3NNGA 1HXS2 3LPFA 1LOBA 1POV0 2VQAA 3I7DA 4BZ4A 2Q8CA 1R083 5A6ZA 4K21A 1MEC1 4Q4Y1 3LFMA 3VL9A 4XUNA 3ZN6B 2RJLA 4IEWA 3CF6E 2YC4A 5AVPA 4IV1B 5F6LB 5HI0A 1SQ4A 1S0CA 3DCQA 4P00B 1OXCA 2ARXA 4LQRA 2JIGA 5FLIA 1FI2A 2ZEWA 1AR83 4IV3A 1POV1 1T6GC 4OHXA 3U78A 3VZOA 1X9PA 3AYDA 1NLSA 5ISLA 3SITA 1URXA 5FTTC 5F2WA 1ZBA2 4CDUB 4Y1ZA 1XSQA 3AXEA 4TTGA 2WNOA 3LEIA 4OZXA 4YZ2A 4UT5A 3W9AA 2UYAA 1Q3EA 1Q43A 4JGZC 4JX0A 1HRI1 3UETA 1A3KA 4Q4X3 4QHZA 1AX2A 1PNGA 1WMXA 2Q30A 1Z0HA 2V73A 3SH3A 1GU3A 5AC92 1ZZ9A 3PHMA 4P9YA 3ZN6A 1OVPA 3F2ZA 2E51A 2HWD3 4GJYA 1XXNA 2UY8A 4IV1A 4DXZA 4FVVA 4YG3A 1QMJA 1MS0A 2ZHNA 3B00A 3ON7A 4RR3C 3WG2A 1FAYA 4JCKA 5FZLA 3SCGA 1W6NB 2D5HA 1DFQA 2ZZQA 3WOGA 1OPOA 5HV0A 4FI9A 2ZJCA 2E32A 1V6OA 4HVOA 1DHKB 4MHUA 1DGLA 4PLNA 4YW6A 3VBRB 4CDUA 3AZWA 3RZHA 5FXZA 4UFJA 4CUCA 5DPNA 2PAEA 3AZVA 4O9GA 4QX5A 1PZ7A 2RDNA 1VBE3 2HYKA 3TEWA 2ZX0A 1NQDA 1Q56A 1WMEA 3OGJA 3DUIA 2W47A 5C3QA 1D0HA 1FATA 3PVEA 3LDKA 4MGYE 3T1MA 1BCXA 5I8TA 1LOGA 3PUAA 3LGRA 1YWKA 1JS9A 2HJIA 3UYJA 3H42B 3CL1A 4UFHA 3NJVA 1Y7BA 1NXMA 4BQ4A 1RMU3 3CO2A 1VBB2 3W20A 4YM1A 2OIIA 3POJA 3MW2A 2LALA 1F5FA 3H50A 3D3AA 2ARBA 5FWJA 4FXGB 4M00A 1HQWA 2DVBA 1HN0A 4PIYA 1AR73 3MDPA 1OA2A 2ZOEB 3DN7A 4XMAA 4ISQA 1JTZX 1AF9A 5KXDA 4CUBA 4O65A 1OFNA 3S57A 3MV11 5I0RA 3H8XA 1DIWA 3NKTA 3N9OA 1GBGA 4FPYA 5DAQA 2ZGMA 1PO22 3NJYA 3SMHA 3N7MA 1C8M3 4XF9A 1CIWA 3M3OA 2DVFA 3C8XA 3W5NA 5HCHA 2VULA 2HEVF 4OVEA 1K12A 3VZJA 4BE3A 3IDAA 3JD73 3ZVXA 3MGUA 4P9XA 2W1QA 4BQYA 4FO9A 3ZMNA 4YM3A 1KQRA 1GICA 5CKQA 1RXGA 2WYSA 1LEDA 4KBBA 1KDMA 4EN6B 1J59A 1IZ3A 2ZGNA 3P1IA 1W28A 1WCQA 3DGTA 3LA3A 3OUHA 5LY1A 4ASLA 1IKQA 1TQ5A 2XVGA 3UK9A 3MBWA 4FPCA 3PUQA 5JXJA 5LBFA 2QTWB 2DF7A 2RMU1 4MVTA 2VAUA 2Y6GA 5LBEA 3PDQA 4C0BA 5I91A 3ZFGA 3RFRA 5F5IA 4FPOB 1GWLA 4RHV1 1UMZA 1GQHA 1OQEA 1JOBA 4E4HA 4EV0A 3HBZA 1FT9A 2Q8DA 3NVCA 4M3CF 1VBD2 5SV5A 3Q8BA 1PMIA 2DFBA 2Y33A 3CMGA 5EQUA 1VBC2 1M06G 2WNUB 4RFRB 1ULEA 3SKJE 1XYNA 2WWUA 4XBLA 5LBBA 4C0HA 3T2QA 5IVVA 1TNRA 4A7YA 1W05A 2BNNA 1NG0A 3C3VA 4DXRA 1K5MC 3ETQA 5FOBB 1JUIA 1UZYA 1MS3A 3AP6A 3I3BA 3VDAA 3WF0A 5C33A 2WFPA 1CGPA 1U12A 4AFAA 3KV6A 3H1MA 2XLAA
chains in the Genus database with same CATH topology
2D5FA 1NCQB 2SLIA 1WA4A 3KT1A 1KS5A 2PLV3 3WW2A 1W0OA 3NV3A 4HZFA 3FE5A 3JQXA 3J8F1 1QU0A 3SCFA 1W39A 2RS12 4MSVA 4GH4B 4XILA 5DG1A 1LB2A 1OKQA 5JDBA 4QQHA 1Z7S3 3JBG2 2WNUA 4YVSB 1W6MB 1UIKA 2W39A 5HCFA 2GNTA 1BEV3 2CGNA 3WINE 3UJOA 2WT1A 1KFXL 1BMV1 2ZGLA 3GZUC 2E63A 2JG8C 1IS5A 3OGGA 1WD4A 1ZZBA 5C9AC 2UU8A 3MICA 2ENRA 2YXSA 4KL1A 1UU6A 1NCQA 3AP9A 4QXKA 1C5IA 2BW8A 1R091 2HWD2 1O4TA 3KM5A 4MZUA 4XHXA 1GKBA 1RUJ2 2PHTA 1PM7A 2R073 4UBHA 4RA0A 1F2NA 4QQ2A 1RUI2 1AYN3 2RM23 4G3YC 4YVSA 4YZ3A 3VLBB 4LO7A 4GKXA 1VBA1 1I1EA 1ZZ6A 1SBDA 1IS6A 5ACA1 4LT5A 3RRDA 3QCWA 5LK5A 4XXPA 1IPJA 4AVTA 1G6NA 1LJ7A 4RQPC 5LRRA 4E4SA 1A6CA 4GB32 1RUG1 4PDWB 1NXD1 4LA3A 2YGLA 4AQ2A 1QOTA 1PIV2 3JU9A 4CYDA 3ZXAC 3K48A 4CDWC 3GNEA 1REEA 4CP2A 2JKBA 5T52A 3ZYGA 5KHGA 3KB5A 3KZ4C 3N7LA 3EJKA 3B7MA 2EVXA 4GMP1 1ENSA 4AHZA 3WVJA 1C3HA 1AUYA 5JOZA 3B9IA 5JOXA 3WNXA 4NWWA 4QT6A 1OD5A 4C1XA 1KRIA 1IHMA 4FTEA 2A6YA 4NR1A 2HWC1 1YHFA 1YIFA 3N4MA 1ND2C 1SBFA 4PBPA 2D7FA 1C8M2 1GZCA 1RUOA 1AJKA 4EN7B 4PDWA 2JG9C 4LHKA 2YGMA 1H1AA 3LZZA 2WKKA 2CL2A 1RJ8A 3NAPC 1AR91 4QU2A 2ATFA 1AZDA 3E5QA 3X29B 4H3WA 2XVKA 3AMPA 2EXHA 1SCRA 3FBYA 4YG6A 1V9U1 1H4GA 4RS5B 1RUC1 2HKXA 1BBT3 4MH0E 2QQPA 3ECQA 3LB9A 5DZGA 2XKPA 2D40A 4QQPA 4CDXC 1QF3A 4QPIC 1COV2 1HXS1 4QGLA 4E2SA 5HBAA 1I6XA 4JGZB 3PNAA 4ZU4A 1LEMA 2WA4A 1WCKA 4RSUA 2DV9A 3RS6A 2LM3A 1TMF3 2QUOA 3IM0A 4XF3A 4YFZA 5I0SA 3VKMA 4FCAA 2ZPXA 4Q27A 5BY5A 1RHI3 2ZKLA 4RS5A 1BJQA 4RR3B 5T5PA 2BWCA 3FJSA 4LBJA 2FHRA 3U4XA 1ZBA1 2EXJA 1LTEA 4L2NA 4S2GA 3V56A 4DFSA 5AFBA 3FFZA 1OA3A 3ZSKA 3WD5A 2XLGA 4ITCA 2GC0A 4QQLA 4Q1RA 5IK4A 3ENRA 3PVNA 2GH2A 4JGZA 2R063 3KLSA 3KT7A 1NE6A 5AC91 3OYWB 1D4VB 2R1DA 2GSYA 1NE4A 3JB8A 5DDJ2 2DWRA 4HKWA 5FPZA 5IK5A 2V09A 5CAZA 5J96B 3ZXEA 1U5IA 3D6EA 4RR3A 1H2LA 2LUWA 4ISRA 5DXDA 4J6GA 4FPJA 4L99A 2VY0A 3ALQA 4B4QA 4IEZA 1VIWB 2BGCA 2FZ1A 4BH9A 4YM2A 1Z78A 1CAWB 4DS0A 5GZGA 4PIZA 1H4HA 3I4IA 5A3MA 1C28A 5KC6A 3B9CA 3BB6A 1KD7A 4KU8A 3AJYA 4W65A 1CAXB 1VB2A 1XQNA 2BPA2 1U5YA 1WLWA 5GALA 5JIUA 3VHNA 1LOAA 5FRAA 2OZ6A 4B4RA 4Q4W2 2XVLA 1UW8A 4MLOA 1WW6A 3IT8A 1DBNA 3IDCB 1VBB1 2PQQA 1DYPA 1FOD3 3N3HA 3ST7A 2XJRA 3OD0A 4LUKA 4QPGB 1ZA4A 4KG0A 3FZ3A 4E9KA 3RQ0A 4KU7A 4EWEA 2R1BA 2IZWA 4HKOA 3D5OA 3SISA 1BK1A 2GAUA 5T5OA 5CADA 1CAWA 4M3CE 3DF0A 1N3PA 2VVEA 1S0FA 2ET1A 2W68A 2WQZC 4N9HA 2LTNA 1RGSA 1PO21 3QLQA 1QGLA 3J26N 4ZU5A 1PNFA 4OFGA 5FLHA 3ZSEA 1ENQA 2XJVA 4LTAA 1NY72 2VUAA 4K20A 3H1WA 3AZXA 1QH7A 4GULA 4IESA 2G9GA 1WGPA 4L92A 2JEMA 1AXYA 3TRSB 4I2OA 4HL0A 4LLOA 2WNVC 3W59A 1K5MB 2ZS6B 3FX3A 4OI4A 1C57A 1BVP1 1YRZA 1DGRA 2JE7A 3POYA 2E53A 3VV1A 4MX3A 4TSVA 5KHIA 2GNMA 2A5ZA 3J9SA 3URFA 2R043 5BNOB 1VBD1 1R1A3 3WCSA 4EWDA 1VBC1 3SHRA 1EYBA 5BUVA 4OI1A 4UW6A 4L11A 4N43B 3AJZA 3CEWA 3R4DB 2XBO2 1OOPB 2OA2A 5CVRA 3S30A 3ZXJA 4U2AA 4X8PA 1DQ5A 1UU5A 2RE9A 3WZ1A 4XFHA 4I01A 5CG9A 1K5MA 2N7GA 1HQLA 4MV2A 2MEV2 4COWA 5J7MA 5C9AB 3E97A 5GZCA 2OW4A 2ZKNA 4GWMA 4M01A 5K0UB 4RGAA 2CWMA 1Q8OA 1V6IA 2AH2A 3P3PA 5BNOA 3R4SA 2RS11 1N1SA 2KXLA 1RHI2 4Z92B 4ES9A 3JBG1 5DZFA 2QCSB 1SFNA 1RUD2 1OOPA 3PJYA 5L7OC 2KA3A 5GLTA 4HSJA 1RUNA 2B8MA 4P9LA 1FXZA 5EZWA 2R16A 1EY2A 1ULDA 1GV9A 1SLCA 1TNFA 3LA7A 3NW4A 4LLFA 4LR4A 2JG8A 4LO8A 2R062 3NJZA 4RQPB 3AMHA 5C9AA 2RR12 3ES4A 4AFDA 5FQ0B 5K0UA 1YO8A 2BQPA 3N35A 4QPYA 1S0IA 3H3ZA 3VBHB 4XFBA 1RUJ1 4NO4A 5JR7B 4AGRA 1ZRRA 1XE7A 4N53C 1RUE3 4YFWA 3HT2A 4M0HA 3S6PA 4CDWB 2CGPA 3C2UA 4Y22B 1RUI1 2UURA 4CEWB 1SLBA 2NQYA 4JC1A 1DZQA 1Y3TA 4QM9A 1GZ9A 3M1HA 4AHYA 3DPRB 1CAVB 1N1TA 1VAKA 5JLVA 1PO13 2XWBB 4RQPA 1WMFA 4DOUA 3V0AB 2XJUA 4GB31 1F9KA 1PIV1 2EAAA 3NV4A 3I2DA 2UY9A 2JG9B 4WV8A 3V65A 5KHJA 2XWJB 4R9CA 4HK8A 1LOEA 2A71A 4CDWA 4Y22A 1NLRA 2ZABA 2CAVA 3JCIA 1CESA 1WMDA 2VMHA 1RIRA 1AR63 4EJRA 1PK6C 4OLLA 3E5XA 3M3IA 2R0HA 1ZRCA 2DCYA 4Y1UA 1QKQA 1QJY3 1QXPA 3A0KA 1JBCA 3DPRA 1CAVA 1ND3B 1GFF2 3M3EA 4FPGA 5DUUA 3VHPA 3VZMA 1RC6A 3J4UH 1FMD3 3V0AA 4BA6A 1ND2A 4CDXB 3KCYA 1CAUB 4QGNA 4QPIB 4I02A 1LODA 2DU1A 1MS9A 1MZFA 4YGEA 2JG9A 2PHFA 4HLTA 1PGL2 2GC2A 2JJ6A 1Q8PA 1YI7A 2ZGUA 4INDA 4JRLA 2D6OX 3NAPA 4DINB 3JQWA 1V6JA 3ZFFB 4YYOA 1FX5A 3OTFA 2RS52 5C8CC 3QBQA 1UIJA 3ACLA 2BFUL 3VUOA 3MIGA 1DDLA 2SBAA 1LRHA 1PHMA 3ZYRA 2ZGSA 2D6LX 1AYM3 1FPN2 1F5JA 5GZDA 4YARA 3OBRA 2NZ9A 1COV1 3ZSLA 1A8DA 1LKNA 1S0DA 4CDXA 1RVF2 1CAUA 3CJIC 4QPIA 4LO4B 2JD4A 3OCPA 3HD8B 4I30A 1LU2A 3M8LA 1JYIA 1X8EA 2CNAA 1ZX5A 1NQJA 2AZ5A 3WT3A 2AR6A 4AEJA 4YVWC 3RNSA 3ZFFA 2CYFA 4WVVA 1FYUA 2D93A 2X5IC 2CV6A 4KWKA 5LEKA 2DVGA 3GHMA 1U5ZA 1G9BA 1EV12 3PTYA 3SH5A 2GNBA 5DDJ1 4K6BA 4E4DX 2XJSA 2FMDA 5GLWA 1TME3 1QJX3 3M3CA 3FMGA 1LESA 3R0RA 2XLFA 1UPSA 1RUF3 2A3XA 4FSJA 2VOKA 4LUMA 2VPVA 1QNWA 2BVBA 1REFA 3WP4A 2BYVE 5GJ6A 3SNMA 1AL22 1EPZA 4XJ8A 1RUH3 4GKYA 4TWTA 2P17A 4F3JA 4IEOA 5J48A 1KDKA 1PGW2 4KG8A 5FFOC 5FMOL 3ZN5A 2C1FA 2ZBJA 3HT1A 1LOFC 1UD1A 2WINB 4A7KA 4D7TA 2H0VA 3UKVA 2HWE2 4Q4W1 2QVSB 5KXCA 4ZKTB 2C5DA 3VDDC 1LHNA 4R4ZA 5FO8B 5JPNB 3VBFC 1NA1C 3BODA 1EAH2 1DG6A 2ZA9A 3TBDA 4IETA 3V64A 1AVBA 4XFCA 4FAHA 3B3QE 3MLKA 2A70A 5I8SA 1HDKA 1DQ1A 3IPVA 1QNYA 1CONA 4BM8A 4A2UA 3WP5A 5J98B 1H9WA 5SV8A 4Z07A 3ZYIB 4D69A 2GN7A 5T54A 4ZXKA 4KWJA 2ZGRA 2R6QA 1ASJ3 4Y26A 1NY71 1AR62 4IQPA 2BEOA 2ZGKA 4AXOA 2VGDA 1BVVA 2R32A 3LCPA 4GALA 2GDFA 5T5LA 4Q1PA 3AMQA 1OHFA 1QJY2 2D98A 4FQ4A 4YRDA 3LKJA 1FMD2 2KM2A 3ATGA 4P9IA 3RJ2X 1W0PA 2UWAA 2WZR3 2HWF3 4BMEA 1HV1A 2WNVA 3WUCA 1LHVA 4JQRA 3POSA 3ZFGB 3OF1A 2A7AA 1J1LA 1NCRC 4PF5A 5HCBA 2XJQA 4XFAA 1IPKA 1IS4A 2EXKA 2BTVC 2WJSA 4ORFA 2RS33 3ZXLA 4UW3A 4LO6B 4XDQA 2YYOA 3RG0A 2XBO1 1I9RA 2PYTA 4COVA 1U0AA 2D6KA 2ZAAA 1V70A 2PHDA 3VL8A 4NPRA 2JENA 4META 5L7OB 3WQ0A 2CGOA 2DUOA 5BXXA 3QH7A 3KGLA 1D4M2 4URTA 1MZEA 2D6NA 2MEV1 3ROUA 2H6BA 4AHWA 4RFT0 1PZ8A 3B01A 3HN1A 3WY6A 5JOWA 2JECA 2X53S 4CTEA 4ZU7A 4LBNA 4N7IA 4E2GA 2D97A 4Q4V2 1H2KA 3A4UA 5T5JA 2D44A 3FHIB 4XZPA 4AVBA 4N53B 1C8NA 2WS92 3WG1A 4E2QA 1RUD1 5A33B 3EQEA 2Y0IA 1OA4A 3NKGA 4Z2WA 5LEJA 4D7YA 3FBMA 2WC2A 3U10A 3H7JA 5L7OA 4XJ9A 2ZX4A 3THPA 1QJU3 1YXWA 1OI6A 5FO9B 1R082 4WZFA 2R061 3I59A 2HEWF 1ZBE3 2RR11 1O7FA 3KSCA 3BIWE 1XNKA 4Q0PA 4R52A 2PA7A 4H14A 3UV9A 1HRV3 1XNDA 3NO8A 4XF1A 3E6DA 4B7KA 1BYHA 5BPXA 1AR82 2NM1A 1QY4A 4N53A 2I2SA 1JYCA 5A33A 3MIEA 1J3PA 1GR3A 1GANA 4V1PA 4J1WA 3AYAA 1C1FA 1LCLA 1PK6B 4BLIA 2B45X 4NOTA 1ZRDA 1RUH2 2DVAA 2WFF3 2BBVA 4K3UA 5K9YA 3IKWA 4Q4X2 1KS4A 1SLTA 5GLUA 2FZ2A 4IEUA 1DYKA 1MEC3 1HW5A 4Q4Y3 1WBFA 3WDWA 5BNQA 3GALA 2VW1A 5EWSA 3VHRA 2VU9A 1JUHA 4X6QB 4HKLA 4AEDB 1D2SA 2EF6A 1POV3 1WW5A 2ZAHA 1PGSA 1H30A 3AKSA 1HIXA 1PK6A 3JB4C 1VBE2 5C8CB 1KFUL 3L9JT 4BHPA 2JXAA 2UWCA 3KQRA 3A0NA 4R4XA 1HRI3 4LNVA 4GWNA 4GMP0 4MUVA 1CJDA 3OJBA 1PGL1 3CJIB 3VBSC 4OHVA 1QOOA 1RMU2 3VBUC 4JVAA 1TE1B 4LA2A 4AEDA 4DNYA 1LGBA 2XL9A 3VHOA 2X8KA 4Q0SA 3MLJA 4RGGA 1ZRFA 1AR72 2RS51 4FP2A 4W6WA 1Q8SA 1WD3A 4YVWB 4Q8KA 2WWSA 1S0GA 5C8CA 2PHUA 2OYZA 1FPN1 4P9GA 3N7JA 3ZFEC 3B5LB 3FUOA 2TUNA 1CJPA 1RTVA 1VJ2A 5BNPC 2I45A 4Y1XA 1IKPA 4KWLA 3U11A 2VW2A 1RVF1 2Z5WA 1SBEA 4Q26A 3ZPYA 4AI2A 3AXDA 4XYXA 2RS32 3JD72 3R4UA 3U0ZA 3CJIA 3ZXFA 3NSTA 3WX5A 1AXZA 1LHUA 4E4ZA 2VNOA 3VKLA 4JTOA 4YVWA 5D1IA 1O4ZA 4ES8A 1JW6A 2QKDA 2TNFA 4GXLA 2WA3A 5BV6A 4HT1T 1IOAA 4CDQC 4XPVA 4UXAA 5KXEA 4AQSA 1EV11 2NPIA 2AENA 2ZHMA 4S2FA 4OHZA 4AGGA 2DFCA 2DCTA 2XB6C 3FLTA 1QHDA 4YZ5A 3LOBA 2IXLA 1DQ4A 4B4PA 2PHLA 3VDDB 5I8YA 2P2KA 1UKRA 2B39A 3BU7A 3JZVA 3MW4A 1QJU2 3VZNA 3NWKA 1GNZA 4YLZA 2EA7A 3MIDA 1W6PA 5K8SA 1AL21 1QOSA 3LSDA 2RMU3 2PLV2 1ZYBA 4CEYC 1PGW1 4DRRA 5FPXA 2DVDA 4NHKA 2XGXA 3RYKA 3THTA 5JSOA 2FMYA 4OHYA 2PAKA 1DU3D 5GKAC 1Z7S2 2HWE1 1LOFA 3JUUA 4PIXA 3MW3A