2ZAHA

X-ray structure of melon necrotic spot virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
296
structure length
296
Chain Sequence
SVKIVHREFIASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGSTSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAVDRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGSTIKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVTSSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Melon necrotic spot virus
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein
total genus 67
structure length 296
sequence length 296
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zahA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zahA01
3TN91 2MEV1 5A33A 1QJY3 3JBG1 3VBRC 1ASJ1 1VBD3 4JGZB 4YVSC 1AR91 4CDXC 1W39A 1AYM3 3NAPA 5CFDB 1PO22 2RS52 4FTSA 1EV12 5BNPA 4Q4X1 3DPRB 3VBUB 1RUH1 1BEV2 2HWF1 3VBRB 5JZGC 1WCDJ 4JGZC 4YVSB 1EAH3 1RUJ3 1PGW1 4QPIB 4YVSA 1COV2 5CFDC 5FOJB 1AR63 2WFF3 1RMU2 2RMU3 4WM8A 5BNNC 1RUI1 1ASJ3 1MEC3 3ZFFA 1PO11 1C8NA 1MQTC 3VBFC 4GMP1 1A6CA 1TMF1 5L7OC 1NY71 1RUD2 1OPOA 2BUKA 1FMD2 3VBSC 3VBHA 2RM22 4AEDC 5LK7B 1IHMA 1VBD2 5DDJ1 1Z7S3 1PIV2 4Q4Y2 1ND3C 2X5IA 3LOBA 1HRI2 3VBSB 1ZBE3 1TMF2 2RS32 1C8M1 5CFCA 1TME3 3J8F1 2HWC2 1QQP1 1PVC3 2RS11 2X5IC 1PO21 1QJX1 2ZTNA 4CDWA 4RHV3 4CDQA 1PGW2 4NWVA 1EV13 1CJDA 2HWC3 1ND2C 1K5MA 1VBC2 2HWB1 5FMOL 2WZR2 1FOD1 5BNPB 3DPRA 5BNNA 4Q4Y3 1VB4A 1B35C 1BBT1 1R091 3ZFGA 1FOD3 1ND2B 1HRV1 3VBHB 4Q4X3 1OOPC 2FZ1A 4Q4W1 1NCRA 2WS93 1HX6A 2XPJA 4Z92B 2MEV3 1B35B 3TN93 3JB4C 1OOPB 5CFCB 1TME1 4N43A 4N43B 1R092 1VBB3 1RVF1 3VBOA 4CEYC 1QJU2 3VBOB 1RMU1 1AR82 1VBE2 4IV3A 1MQTA 4PDWC 3VDDC 2R073 2PLV1 5C4WA 1FPN1 3VBOC 2R063 4GB32 4JGYA 5JZGB 1EV11 4JGZA 4PDWB 3VDDB 5CFDA 3S6PA 1RHI2 2R041 1VBA1 5BNNB 2HWD1 4N53A 4N53B 1VB2A 3VBFB 4FTEA 1GFF2 4QPIA 5A32B 2WS91 5A32A 3J8F3 4CDWB 1C8M3 2GH8A 4CDUB 4GH4B 1NG0A 1R082 1Z7S2 1RVF3 1QQP2 1RMU3 2RMU2 2RM23 1AR62 2VQ0A 1COV3 3NAPB 2R043 1RUF2 1RUC3 3VBRA 3NAPC 1RUH2 5K0UC 2BBVA 1CD3G 1PGL2 5L7OA 1QJX3 2X5IB 4WM8B 4Q4W3 2XBO2 1SMVA 1B35A 1E57A 2HWF3 1PVC1 3CJIB 4Q4Y1 5K0UB 2HWB3 2WFF1 1PO12 1RUE2 2HWE3 4WM8C 1AL0G 1ND3A 1C8M2 5ABJA 2BPA2 1PO23 1PGL1 4CDXA 2RS13 4RR3A 3ZFEB 2HWD2 5C8CB 2MEV2 1QJY2 1AL22 1OHFA 5BNPC 3M8LA 4RQPB 1AYN3 1AR71 4Q4X2 1RUC1 3ZFEC 4PDWA 3VDDA 1K5MB 4GMP0 1ASJ2 1COV1 4CEWC 1MEC1 1V9U2 4Q4W2 3VBUA 3ZFFC 2PLV2 2HWC1 1RUG3 1ND2A 1K5MC 1RUF1 4N43C 1NCRB 1AYN2 1ZBA2 4CDUA 4CEYB 1ZBE1 1RUC2 4LLFA 1DDLA 3ZFFB 1BMV2 1RUH3 5D8AC 1VBB1 1RUG2 2HWD3 1D4M2 1OOPA 3IDEA 5C9AB 1VRH2 2RR12 1NCRC 2PLV3 1VBA3 4Q4V2 4NWWA 1VBC1 4BCUA 5D8AB 2RS33 1POV0 5C9AC 4YVWB 1EAH1 1RUJ1 2R071 2WZR3 4SBVA 1R093 5J96B 1R1A3 4RS5B 4N53C 3JBG3 5J98B 5JZGA 3CJIA 3VBSA 1AUYA 2RS12 2BFUL 4RR3C 4GB31 4AEDA 1R1A2 4CDWC 1BBT2 4CDQC 1RB8G 1HRV2 4CDUC 4GH4C 1ZBA3 5ACA2 4JGYC 4WM7A 4WM7B 1X33A 4RR3B 1RUI3 1QJU1 1NY72 1HXS2 4CDQB 4IV1C 2RMU1 2RM21 4CEWA 5ACA3 1H8TA 1HRV3 2WFF2 1H8TB 3JD71 1NA1C 5A33B 5AC92 5BNOC 4FTBA 4IV1B 1NCQB 1RUD1 4RFT0 4QPGC 5DDJ3 1PIV3 1D4M1 1AL21 1FPN2 3CJIC 3ZFGB 3VBFA 1RHI3 2FZ2A 1QQP3 1V9U3 5AC93 1PVC2 4EJRA 2HWE2 1RUE3 4RS5A 3DPRC 3VBUC 2WS92 4Q4V3 2ZAHA 1PO13 2GSYA 2IZWA 1POV3 3ZFGC 2R072 5C9AA 4QPIC 5C8CC 5K0UA 1RUI2 1FPN3 2QQPA 2Y26A 1AR92 4RQPC 2TBVA 5FMOS 4Y5Z0 2RS51 5D8AA 1ZBA1 1PIV1 2HWE1 4IV3B 1MQTB 1BEV1 1R081 5C4WB 3HAGA 4CEWB 4RQPA 1AR93 5L7OB 1HXS1 4IV3C 1HXS3 2WZR1 2XBO1 1NCQA 1X36A 4AEDB 4FSJA 1AYM1 5C4WC 1M06G 1QJX2 1R083 1HRI3 1HQNA 1ND3B 1NOVA 1TME2 5ABJB 3J8F2 1BBT3 1VBA2 1F8VA 1AR81 1VBE1 1RUF3 3JBG2 4QPGA 4GH4A 5ABJC 2RS53 1AR61 1VBD1 2ZZQA 5DDJ2 1QJY1 1FMD3 1FOD2 1RUD3 1BMV1 1HRI1 4RHV1 4YVWC 4IV1A 1VAKA 2R062 1AR72 2RS31 2XBO3 3FBMA 4RS5C 1VRH1 2RR11 2HWB2 1VBC3 1POV1 1F2NA 1VRH3 2RR13 2WLPA 1D4M3 1MEC2 1V9U1 4YVWA 1AR73 1BEV3 4JGYB 4CEYA 1RHI1 2R042 4WM7C 4RHV2 1AL23 2R061 1EAH2 1RUJ2 1RUE1 2BFUS 3VBHC 3ZXAC 3TN92 4GB33 1Z7S1 2WWSA 1FMD1 1RUG1 1QJZA 1R1A1 1H8TC 1NA1B 5GKAC 1AYM2 1AYN1 3JB8A 5BNOB 1NA1A 5BNOA 3JD73 1ZBE2 1RVF2 4Q4V1 3ZFEA 4Y4YA 5ACA1 5C8CA 5CFCC 1TMF3 4CDXB 1AR83 1NCQC 1VBE3 2DF7A 4QPGB 1QJU3 2HWF2 3JD72 5AC91 4GMP3 1VBB2
chains in the Genus database with same CATH superfamily
2IGLA 2ED8A 2ZXBA 2JIGA 1M42A 1PLGH 1LK3L 3PXJA 5L0QC 2XKOA 5D1ZB 2YPVL 3QO1B 5JUVA 5HVWA 5ID1A 3MOBH 2F6AA 2AEQH 1A4JA 3CFDB 3VFVB 1GV9A 1SLTA 4M03A 3TGXA 1WGOA 4QF1A 2WXJA 3GCXA 5HI0A 4JFDA 2LU5A 4MVTA 3OJMB 1IS3A 3IE4A 4JDMA 4XGZA 3MI6A 4XDPA 4XW3A 4P4RB 4H88L 4D3CH 2J1VA 4Y3OA 4JHBA 5F7EL 4PWIA 3UTTA 5KBLA 4Y4FC 4PGCB 4IEOA 1WCDJ 1A8DA 4NZDA 4IETA 4XVTH 1RJCA 2ZS6B 2RJMA 2YJLA 1P7BA 2BWIA 2TAAA 3QJFB 4KXAA 1WLWA 5F9JB 4JFEB 4AWDA 5LCVH 1JHLH 4QRSB 5DI8B 2V2XA 4R8WH 5D2LF 5T8IA 5FV3A 1L9SA 1YECH 5LA1A 5JWPA 4DCQB 2B0SH 5IB1A 1SQMA 1U8OB 3D9AH 3V5DA 1F31A 1H4HA 3EDJA 4G8EA 5A7WB 1X5KA 3IFNL 4Z76B 4MB4A 4X6FB 5ITFB 1MVFA 4XQDA 4A2HA 1DVFC 3TTSA 1URLA 2Z35B 4FHKA 4NZRH 3O9WD 3PDGA 3SKUD 3LTVA 4UQ3B 1IC7L 3BTAA 4PJGA 3ZBMA 1HZLA 4FXTA 1E2WA 1QEWB 1PD1A 4NC1E 1K2DB 4XPAL 4NPYA 3U6XA 1OLRA 4JY5L 1HQ4B 3LSEA 4TNVK 4B8EA 4XMLH 4B53A 4QQ2A 1LE5B 1WWWX 4FG2A 1BFVL 1HN1A 2D2OA 3WF4A 3U1SL 4Y1AE 1WWAX 5T54A 3VM7A 1ND3C 4R7NB 4QTFA 1TJMA 3KPLA 5T3ZD 3N35A 4XFAA 2FJFB 1JOBA 1CJPA 4OZHB 2PAMA 2HT4C 5IVJA 4KWUA 3WD5H 3ESOA 4DXSA 1MHCB 1QLRB 3Q6GH 3I74A 1EUTA 5LASA 5CG9A 4JFFB 3MX0B 4MA3A 4G7SB 3TWCH 1MJJB 4YG6A 2HKAA 4UWQB 3W9EB 3A0KA 3AKRA 4V1DD 4OLUH 5JXJA 4JFPA 4WI6A 4PJDA 3RVXD 5DJYB 2XX0A 2YPDA 3FCBA 4ANKA 2X44D 4ZUWB 4ONUA 4NZTH 4JZJA 2ENRA 4XMKL 4MB3A 1XMEB 2XZAL 2OSWA 5JHLL 1IGML 1A64A 2ADJB 4A55A 3QW9A 4CDQA 1DQML 4WWID 1BIHA 1N68A 4HBCH 2BP0A 4W6YB 5B3JE 2J1KA 2X4RA 4MQXD 2Z8VC 4JRYB 2WWOA 3NEXA 4QHOA 1MCNA 2M1KA 3POHA 2FJSA 3S5LB 4P2OD 1K5MA 2IG2L 4CADA 5I8CA 2VLRD 5I82A 2XVKA 3INUL 4PHZA 5KVGL 3KZ8A 3AGVA 4ZMLA 3AKPA 4QX7A 3UK9A 3USUB 5BNNA 1HJCA 3QDJE 3R05A 5DF0A 4OYUA 4AUYA 4N0CD 1XNAA 2JKLA 2BFGA 2Q8BL 4XAWH 4GG6F 4O9HH 4XCCL 4XAKE 1JE6A 3LXAA 1A7RL 1CFQA 2QQLA 5CLZA 1QRND 5FUZH 2QV4A 4BWTA 2NR6D 2YPKB 3BWAB 4KJWC 3F7YB 1IQDA 4XR8C 2WNWA 5JIIA 3U2SB 3D33A 3EMRA 3H2PA 5FZHA 3SGKA 1LO2L 1FN4A 2YJQA 3LQAL 1EFXB 3QFJA 4LAQL 2GJPA 4E2GA 2GN7A 3BWSA 3ATDA 2R2EB 4HH8A 5D8JL 2QZ5A 3PDDA 5FWQA 5ISZD 1HVXA 3EXUA 5AVPA 4S2DA 2GFBA 2DM7A 4UZGA 2G19A 5IVCA 1K9TA 1NCTA 3OJDB 3H85A 4NRXB 1UM5L 1MLCA 2HLAA 2A77L 4MZRA 1XQNA 1DL7L 3CFJA 4QRPB 1OTTC 1XO8A 3HI1B 1D0GA 1N4XL 3HI5L 4ZS6C 3WIHA 2D3NA 4XPBH 4R7DA 4TVUA 5ITBH 1HKLH 3VW3H 1SPDA 1HYSD 4EF3A 2GG1A 2WTRB 1XSRA 4LIQH 1H5BB 1I4FA 4PJEA 3SEEA 3BALA 4JFED 4UFIA 1FDLH 5ID1B 1MZZA 1A6TB 5SV4A 5DD5H 1UZVA 3D0JA 4FOVA 1JGDB 2Y7LA 3VO0A 4F57L 1RK1A 1SDWA 2ZMKA 3EYFA 3TASA 3ZTEA 4WDIB 1EEZA 4H8WC 1E4WL 5JR1L 1U2HA 4RFEB 2BVQA 3O9WB 5TDPA 3WG1A 4JFOB 3GMRB 3X12A 5C9JA 2YA2A 1W0VA 4Y4HA 1UZYA 2O6PA 1FWXA 3LDRA 5EQUA 4P2QE 1R5IA 3LSOB 4PWHA 1IAOB 5IBLC 3SDCC 4JO3L 4ZS3A 5FZMA 3CFCH 2XOMA 4CUAA 3QCVL 1JYXA 1ENSA 5J11C 4ONHA 4F93B 4URTA 2X6CA 2LLNA 2Z93A 1QP1A 3AS2A 3AACA 5D6DC 2YC2A 5AVVB 4XWGH 1R082 1RVF3 2F08A 3IAQA 3P30L 3P2DA 2PO6A 4HETA 5F1NA 1XBFA 5F7DB 1EHKB 5IV2A 5FA3B 2R2CA 3NAPB 5TE4L 5FM5O 2DVAA 2K3HA 5C3TA 3RWJB 4F8TA 4UQ3A 2AJ3B 3IDMB 5AVWB 3TEXA 3U9PH 4XPGH 4PTUB 1NXD1 1XSIA 2WKOF 3ZE2E 2X0UA 1IM3D 5K1JA 4AK3A 1B9ZA 4PJ7B 2AEYA 5FYKL 3FFDA 3AYCA 1G7PB 4OHYA 3V4PH 5D1XA 3EO9H 5CEXB 4F8PA 2NSXA 3VGGA 2YMZA 3B00A 3Q8CA 4QHPA 2BQPA 4XUQA 5IFPA 1Y07A 2BNQA 1ZT1B 3EJYC 4CVWA 2GP5A 1G87A 4TVPL 4XOAA 2XWTA 5E8PB 2B4CL 3FQ1A 5CGYC 4BWUA 1LOGA 4OF8A 1MREL 1W6MB 1S78D 1CGTA 3M7AA 4JRXA 4JFFA 1JWSB 4JCWA 5BYNA 3KH3A 4PJHB 4WM8C 5IMLA 5KSUA 1I3RB 3PY9A 3MIHA 3ZMOA 2R8SH 4PJDB 2W60A 1OAXL 2VDMB 4FKEA 4L29A 4MWFA 4PRID 5H2BA 3T6WA 4P8QA 5JORA 2X4TA 5EEVA 3HW7A 3U10A 2X4UA 1T1WB 3KYMB 3MV9B 1UZ6F 1WYJA 3WIIL 3L1GA 2X70A 4HD5A 1XCWA 1N8ZB 3PCYA 3WZ1A 2GNBA 3UZEC 4DERA 3UCQA 1NCDH 5TDNB 4KNQA 2XCMC 4LP8A 4CW1B 3D2UD 1W04A 5ALCH 4P9ML 1YYLL 1C28A 4QXVA 3WHE0 1KCVL 2OKXA 1YLBB 1U0QA 1CICA 4WFGE 2E33A 1BX2A 4YNYA 3ARQA 4K3JL 5CGYD 3T4HB 3RTQC 1UM4L 5FYZA 5HHPA 4JM2F 3S6CA 3KYKL 4D0BA 1S1AA 4KZEL 3F83A 1LP9E 4Y9BA 5LBSA 2CTVA 1DQ0A 2PCFB 3FB6A 3MRCA 2P5WB 3MRNA 1HHGA 3NJHA 1JNJA 4H44C 4OF7A 3VXTB 4LA3A 2WNGA 4C4UA 3MDJA 2ZOLA 3OWRA 3BLBA 2X4PB 1FZOB 1W0NA 4LIUA 4Y1VA 1BMV2 5CP7B 4BLJA 2WWNA 1RUG2 5H35B 3V0DA 2HPTA 2QHLA 4BZYA 1M1XA 4M5TA 1A4CA 3IKKA 4PPTA 4JTNA 2MOVA 2FSEA 3QXAB 4PJ5B 5JHDD 4F9PA 1W9YA 2QQJA 4NIIA 3L13A 1M7DA 1M56B 5C2BH 2OL3H 4I18A 4NWWA 1PMYA 1JNLH 2XUWA 5H4YA 3K6SA 1WITA 2R23B 2G30A 4EXKA 4RIRA 3MBEA 1GQHA 1HQLA 3IBMA 1XR8B 3NMEA 3FQTB 2FRGP 3FUMA 3WL9A 3USSA 2COVD 3ASIA 4YHLL 2D7FA 4LL4A 4Z23A 2X41A 5E70A 5MHSE 1QHQA 2X12A 3ESVF 1SXAA 4FYRA 4U0QB 5ANQA 3JZ7A 2PCPA 3DVGB 3I75B 3JWNG 4BKLB 4MDJB 4DKFL 4XWGL 4N53C 1KFXL 4L3CB 3C75A 4J3OH 1YAZA 3OXRB 1UB6B 5EBLB 3BXNB 4KDVA 2ZOUA 3PU3A 5FYJD 2Y36H 4KNUA 4PFEA 1MAJA 1I7ZA 4MAZA 5F5AA 3B7MA 4EN9B 1OALA 4HUKB 1ZBA3 5TQ2H 5I0ZA 5GSVB 2WXGA 3FSAA 4WSKA 5JR1H 2PTUA 4PJGE 1O7VA 2QEJA 2K8QA 2YLKA 4BK8A 2AF2A 2XN1A 1QJU1 1TJIH 1IM3B 2WNEA 4WVZA 3RWIB 4EN6B 2RGSA 1XIWD 4HKBB 1I1EA 1KIUA 4P59L 4Y9GA 3TT3H 5ABJC 4I3GA 3SCMC 2IVFC 4WGWB 4L1HA 3UTOA 1IEBB 1MHHA 2UWEB 3B9KA 1NGZA 3QEHA 5I24A 3LFMA 1ULVA 1DN2A 3RNSA 3J26N 4U3SA 4XFHA 2XR4A 1WAAE 3FO9B 1INDL 1E4KA 3LQZB 4IMLB 3KJ6L 1INQA 5IEHB 4P5SA 5I1CH 1A4AA 4MGSA 1D4M1 1KV3A 3UJJL 3X3GH 1G9FA 4E0RB 5CISA 2YMXH 4LNVA 1FFQA 1S8DB 3G6JF 4Z7VB 3CJIC 2VW6A 2R16A 1NANH 4ORGB 1MI5E 1KBBA 4MCNA 4JGNA 1OF2B 1QQP3 1XGRB 1CU4H 3LYRA 5DS8A 5B7EA 5D8JH 1VRBA 5LWBA 3S7EA 2VWEC 3VKOA 4RS5A 4H4NA 4UANA 3NEEA 2ZAHA 3B69A 1I1AC 3TN0B 3AL6A 5EU5B 5F8QC 2X87A 4YSSA 1GZHC 4I0PC 5K0UA 3K8MA 1PLBA 5DQDH 3QLQA 4I3RL 4GRLD 4XMXA 1PL3A 3T0EE 4BFEA 3REWA 2GJZA 1XGYH 3QRGL 1OUXA 2F5BL 3ZHFA 3WEMA 3SGKC 1X7QB 2HLEA 3BP7A 4MJIE 4KZEH 1L6PA 2G9HB 1JHTA 3RX8A 4OZFA 3US1A 1ZBA1 1DN0A 3GXDA 4N85A 1A2YA 1NZCA 4NXSA 3W0WE 5KS9A 1R081 3LEIA 3MV8A 4IGBA 2BDNL 2DI9A 1BXUA 4LKDA 4I3PA 4RQPA 5AOZA 5AB9A 3SD2A 2WCSA 3A6CL 4M1DL 3U36A 5KS9F 2ENSA 2XWDA 3BVVA 2EYSA 5L4MA 2ZUVA 4HWBA 5G55A 5FY5A 1DE4B 3I2GA 3JUZA 3BCFA 3BEVB 4NZTL 5CGTA 4P2QA 5ANMA 3OZLA 1RUKL 1RZKL 1YIPA 4M8RA 1ASOA 3POSA 1B09A 2BCMA 2UWAA 3IMNA 4AFDA 1DLCA 4PGEA 1MCCA 4AG4H 2BH0A 2PW2A 1MN4A 3FO2B 2C9RA 4ZU5A 3LPOA 3MROB 5JDJA 5DK2A 4DOHE 2GCYB 2BK8A 4GJTB 1AR81 3AXLA 1IS6A 4OGYL 2DUPA 4MKMA 1K3IA 1JTZX 3MV8D 3UKNA 2FWUA 4LVHB 1L9PA 1PK6C 3UBFA 5CP7A 1ZVHA 3R06B 1S0CA 5HD8D 2GEEA 3ILPA 5A1LA 3QDGD 1NLDL 3QOPA 1BBDH 1SCRA 3B2VL 1V6LA 2CMRH 2FWOB 5JQHC 1USZA 5I8TA 5K69A 1U42A 2C9PA 3ETBJ 4NSKB 4KQ3L 5DJ0B 4FOQA 2VW4A 2BSBA 5DD5L 1JI6A 2PYFA 4NBYB 5SWZA 2Z0UA 3F05A 4HV8B 4RQQA 4GALA 1G6RB 4RFNB 4WJ5A 4GS7C 4UTBH 1GANA 3QCWA 1U3ZA 3RWDA 3LZZA 2TNFA 5IUQA 3PUSA 4QB1A 4DS0A 1SJEB 4L1DA 3RB7A 1OVZA 3FCSB 1F4WL 5KAQG 3H0OA 4LFHD 4QY8B 5BZXA 1N4XH 1OKOA 1VLXA 2PXJA 4YHNA 4EE2A 1AL23 4UWDA 1AJ7H 1ZHNA 1RUJ2 2R061 1C1FA 3NNGA 5KYUA 2E7CA 2Y7OA 2GY5A 3ZTJG 1A6UL 2VLKA 4BZ1A 1YEFL 2AV1B 2Y34A 1AZRA 3HPLA 4O4YH 1XJAA 4DO5A 1UWEH 1CAWA 5JIAA 5I8KH 1TTGA 3OSKA 4K8RH 4N0FB 4WSJA 4E9SA 3AUWB 1GQPA 3ZFEA 2UY8A 1NCIA 4O58H 5EU7C 4F57H 3CH1B 2JF1A 5ICYA 2NMOA 4K40A 1P6FA 5F0LB 3ZKSD 1W80A 1A1OB 2WXFA 4CC1A 3TN91 2MEV1 3E6DA 5E08H 1P7QA 5L73A 2IGTA 4K8RD 5TK4A 2I9TB 4J6RL 4LSSL 4Z9KB 1SPPA 2LROA 1YEHL 4Y33A 3MR9A 1IZ3A 4ODHH 1IT9L 2KH2B 2F7QA 4QHNA 4Q4X1 3MCLH 1EYBA 1OLME 1CFTA 2WLIB 2FBOJ 2WWKT 1IGYB 1JXJA 2ZG1A 3HVNA 3OHXC 2VDLL 4JANB 2AXHA 1EAH3 4DN3L 2AV7B 5GRVL 2E32A 5DJDB 4L11A 2WXOA 3QG7H 4LU5H 4B9ZA 4F2MA 4OD3L 4HIEA 4QEGA 3RNKB 1P4LB 2DF3A 1CX4A 2PPFA 4AMKH 5B38A 4RFOH 2X40A 4JVWA 1H2MA 2VB5A 3KGTA 3X14B 1RUI1 2H32A 1X5ZA 2Q5BA 2FX8H 5FDYA 5TQ0L 3K2IA 4F58L 2HT3C 2GUOA 1V3KA 2W0FB 1TQCC 1G43A 3I59A 2Q1EA 1C8NA 2QQLL 3EIFA 1DZQA 2Y3AA 2HT2C 2AK4A 5EU6E 1ZVSB 5D1QA 43C9B 5EZOL 5LGJB 2EH8L 3FMGH 2VDOH 3B2XA 3U30B 1TMF1 3HBQA 4KH9A 1DQJB 5CJOL 3PVBB 2HFGL 4UT9A 1AR1C 3HC3L 3DO7B 1P84K 1LP9F 3NH7L 1JTTA 4I30A 4FQXB 2OTUB 4E9QA 2BVTA 2WQ8A 4PY7A 5CU1A 3T1MA 4PW9A 4JG0L 2NY3B 4HDIB 5EU6B 2W68A 1SLUA 4XMUA 2VH5L 3WIHL 2X5IA 2B3IA 4F8QA 4ORFA 4BUGA 1K4CB 4X5LA 4XZUG 4NS0A 1HC1A 1KXTA 3ZTDC 4UUJA 2I60L 3F6JA 2CH8A 2NSQA 2VW2A 3ML9A 2OW7A 4YLBA 1AQ8A 1TME3 1GSKA 1E7VA 1LMKA 1WGPA 2W47A 5EIIA 1NMBH 3NK4A 3R8BB 1GWMA 5CM1A 3WTTA 4Z3FA 1PO21 1J84A 2PW2B 4WHDA 2R4SL 3CQQA 3VD1A 4XYXA 1CD1B 1HCFX 1DQ4A 5C3LD 4ZU4A 3VFPA 4Y1SA 1CFSA 3DX7B 4HFSA 1T5WB 2CR0A 3T08A 2B1OA 5ILTH 1G7JB 2ZOOA 5EJ1B 4Z5RB 2M26A 3RPIB 5JA9A 4R4ND 3AL5A 1UXSA 4YK4C 2JJSC 3UZVB 5FECA 3LEVH 4MMZB 1CJDA 5IJDC 1GOHA 2YBGA 3MLTA 4QHMA 4BFFA 3VQ1C 3ZDZF 1VCAA 5EA0H 4AEKA 5F7NC 4ODTH 3OL2A 3CSPA 2G1MA 5D7KD 2DBNA 2WZAA 4XXCA 3M07A 1F1DA 4X9BA 4JQVA 2Z31A 4NSKA 1RUPH 5DMGC 2VOWA 4AAXA 1VKXB 2E7DA 2WQWA 3KB5A 3ZDVA 1TENA 3KLAB 1R091 5C07A 1KYAA 1FOD3 4OHXA 3O1PA 4PGCA 3T2LA 1NPJA 1H3GA 4PU2A 3ZE2F 1OVPA 3SSGA 1AGFB 4M6OL 4RAVA 4C83A 3UDWC 4ZS7H 4FQCL 2G5BB 3VB8A 2H45A 2OXGA 3SDDC 1JYWA 4YM2A 2WXKA 4DW2L 3UAEA 3QZBA 1AGEB 1YNTB 1CAUA 2V2XB 4Y2DC 1WBZB 2ENPA 4G7VL 4H26B 3I3MA 1W6OB 4P2YA 3POJA 3QQ4A 4AEHH 3D0SA 5DJXA 2VUCA 2Y07H 3IDGA 4R83A 4Z76A 1QFHA 3KVPA 4NLHA 1LOFC 2D3RA 3GRWL 4G1MA 5J7CC 3NP4A 5HHOA 5C1MB 1YN6A 1NX9A 3TZVD 2FCUA 4H8WH 2WUBL 3N85H 1BXXA 3CVBA 1H9VA 3DBSA 1C9SA 2ISDA 4QLWA 2ALAA 2GSMB 1GZHA 1I8MB 4WUKL 4PDWC 5DQ0A 2NW2B 1S7VB 4IU3B 4OB5H 4OV5B 5IVZB 2V72A 1K5NB 5FAAA 5GLZA 5ADOL 3KNBA 1QUNB 2Q76B 1UD3A 2DM4A 4N90D 4FOYA 5JZGB 3TBTA 1OA3A 3D2TA 1ZIAA 2CIIA 3VDDB 1S7XA 1CL7H 3RL1B 3U6RA 3EYPA 3I2DA 1FZJB 2YD4A 4NQCA 1FNSH 3KLDA 3APCA 1MHCA 2CO7B 2GYSA 1K3ZA 1I1FA 1N10A 2BSED 4DXTA 4RA0C 3BH4A 3WO4B 2XL9A 3PWPA 1D5MA 2QQNH 1WFIA 1RIVH 1BJQA 1O4YA 4LPUA 1DVSA 3I50H 4JO2H 4KNCA 1D7BA 1RJ8A 2A9NH 2OV0A 4YUEH 2ZP8A 5D5ME 4BSWB 2Q8DA 3SH5A 3ZN6A 2NY0C 3FH7A 5DABA 1SHWA 5EBWA 2NYYC 1T89A 5CZRA 2J88H 4X6CB 3K5RA 5I5JA 5LBSL 1MWOA 1GCFA 5HCAA 1BXVA 3M8OH 3RWGB 3AZWA 2WZ5A 3VD3A 1KTBA 1Z3RA 2BHUA 3E1F1 4P9LA 4JRXD 4XBEH 1FCCA 2AK4B 5LRSA 3BZFA 3D2UA 3QIBB 2VQ0A 3BIKB 3FH8A 2I24N 5E4AA 5IFAH 2JDUA 4KGLA 5T5FH 1S5HB 3EFDH 2YBSA 1Y1DA 4IKIA 4WRLA 3PVEA 3GZPA 4OBSA 3NYKA 3ZKQD 1R3IH 5CNHA 1OHZA 1KJVB 4R0LC 1H15B 3GSWA 3LKNB 1XHHA 1ZEAH 1AI1H 3B1TA 4HCFA 2V2WB 1BQHG 3H3PL 4AQEB 2P24B 1T0NA 3GMNB 5ANHA 5L88H 2VVFA 3UGXA 3HT1A 1DEEA 4IRSC 5GGVY 5DUWA 1MI5D 3CFMA 3IJEB 1IKNC 3E97A 5FK7A 3C09B 4KDTA 5GSRA 1WE5A 2VC9A 3QJHA 1SEQL 1ZLDA 1PVC1 1BD2B 1B0RB 1XGYL 3QRGH 4U05A 4B9YA 1OTUD 2A6IA 3FQ4A 5A7EA 4IL7A 1C5CL 3ZO0A 4GFXA 3QDMB 2HWE3 2JG9C 4C58B 4ZMWA 1QX1A 2WBJB 1BVLA 3HE6C 5IAVA 2OCFD 3HG1D 3BO8B 3WU1A 1OVSA 2XLAA 4DPNA 2JDYA 1TZOA 1C1EL 5BZDB 2W1NA 1OP9A 1OBNA 2DCJA 2CG9X 1PMHX 2NY5H 5KWYC 1QJY2 4ICXA 2BNRD 1ACZA 1BQPA 1QFUH 3T09A 2W9EL 2JCWA 2ZP9A 5F9WC 4HN1A 4LMQI 3MLTB 4QHMB 4BIKA 3NN8B 3P3YA 4HLJA 4NKOA 3SBWA 3WJLA 5I1LB 1AYN3 2OW4A 4HULB 1MEXL 3ZFEC 3MRJA 4TTGA 4M1CC 3K46A 4P4KD 4B95C 5ALBH 2OX5A 4BXVA 3A24A 5CUSL 1MF2L 1JGDA 1KRIA 2D2CC 2G2RA 2BNUA 2PPEA 4YFZA 1ROCA 1TCRB 5F97E 2DFCA 3V2AR 2YY1A 2HWC1 5EWIH 2W5PA 2IDUA 3MV7A 1OM3H 1Z5LA 3KE0A 3FYIB 5BO1L 3TOPA 4KQ4H 3WS6A 4Z7AA 3V0HA 2FJHB 2UUDK 4ES9A 1JW6A 1P8JA 3GDCA 5IYYA 1WMEA 2CO6B 2C7UA 3OMNB 1SBDA 3IDIA 5CJ8A 4YHPA 3K2KA 1YUDA 1F42A 2Z4QB 3TONA 4PIRF 1KB5H 3EH5B 2LRPA 4GO6B 4HK0B 1RZPA 1G7MA 1N26A 2JK5A 3D4ZA 4LCCC 5TQ2L 1VRH2 1FE8H 2ORBH 2Z34A 5I8EB 1S0GA 3ES4A 4PJXB 5C86A 2CUHA 2E3VA 2EO7A 2K8MA 1WIUA 1CX1A 3RX9A 3VXUD 2PWDA 1RJLB 3LXBA 2J8UB 4KOCA 4Z0BL 1PQZB 1A3QA 1T0PB 4AYFB 4QX3A 2JJTA 4ZT1A 3GB7A 4OJCA 1H19A 5LB1A 3T0AA 4MAUL 5DYOB 1CYXA 5FOBB 3QH6A 3BUIA 4RA3A 4CA9A 4J12A 2JTDA 1PLCA 4UAOC 3UTPE 2YEZA 4SBVA 5FYJH 1BF2A 1VMFA 1HCYA 1FRGH 1XRUA 2VCMA 1GWKA 2AXFA 4WVMB 1JMZA 3UL2A 3UROR 1CGWA 3UPCA 4I09A 4U1IB 2V9QA 2XN0A 2BFUL 4XF0A 3IGFA 4QO1A 3CZFA 5E8OB 5FC9A 1ST8A 4I4WA 2J21A 2R6QA 2J1ZA 1BHGA 3ZKND 2VMHA 2KR2A 4KO5A 3PWPB 4YE4H 4X8JB 3P4MB 4WFHD 2OMYB 3V52H 1G7YA 3EO1A 1BLZA 3QCUL 3OPTA 3AMKA 2FT6A 2P8PA 2RDRA 4HL0A 2JQMA 3VNZA 1T1WA 2XDVA 4FPJA 4QRAA 4XN5A 2O5ZH 2XWRA 2VKWA 3EJZD 3O6FB 3BUTA 2FIKB 5GS1B 4KK9D 4JFQA 1RHHB 4MCZA 1N8ZA 1A8ZA 1TQBB 2ADGA 2WO2B 2XWXA 4WTZA 4C4KO 4AIOA 4CCNA 2QJVA 4WW2F 1AXKA 1YJLA 5C0EA 3Q13A 3GTVA 1J1OL 4ZD3L 3BDYL 2HFFB 1TF4A 3C6LC 1H8TB 3BSZA 5CHNA 5B1JC 4N9GA 1NA1C 3F3HA 5G4OA 1JXGA 2V5YA 1LU2A 1CICB 2CBOA 1NDGB 1EHAA 2B9VA 2NLRA 2VLJD 1GLHA 2OSYA 4N8VB 1JGEA 1XSKA 2HKFH 4XBGA 1MPXA 1W99A 1QMUA 1X5XA 1W72L 5AB2A 3HPNA 3QEQA 2ZUXA 4G5ZH 4OFQA 3RVWC 3MJ7A 3S3SA 2VOTA 4O02H 4POZC 5T1MB 1GSMA 2X53S 3GMNA 2P52A 5IK4A 4N8UA 3M1HA 1M1SA 2BS9A 2VQAA 4X6RB 1YHPA 2Z92A 4AVCA 2DLEA 3QUMB 4K3DH 4QAWA 1ZLEA 2UXGA 5F5IA 2XB6C 1D5BA 1MELA 4L5FH 4PJEE 1CC3A 4PJ6A 3FFZA 4HUMB 3B43A 2QQNL 4JJHA 2Y6JA 4XHJC 3QIWC 2WQ4A 3O41A 4Y4FB 1UF2C 1W8UA 1XF4B 2F7OA 2KI6A 3TBVB 3I2OA 4XCNB 1ULFA 3VFMA 1JUFB 2WIIB 2JELL 1HB1A 2WBJA 3W39A 4DEUA 2X4OB 1R3JA 1LEIA 4AQ8C 1CBJA 3HRZC 4Y2DA 1IL1B 3OAUL 3ZDWA 4Y5YB 3CHRA 5FB8B 4FFFA 1BMWA 2V7HB 4Y5Z0 4XHXA 5HYJE 1S2EA 4U1HB 2HH9A 3RI8A 1UCXA 4A2DA 1DSWA 1G7QA 2D4DA 2DS4A 3ARGC 2XG5B 2H2PC 3T2NL 2P34A 3HE7B 4GKLA 1ZT7A 3W9DA 2FQPA 5D7JB 5JQIB 4XPHL 4K3UA 2EEXA 3GBWA 4KI5M 5A7OA 3V64A 2E7BA 5FHAL 3D82A 2EIMB 5IHUH 3EO6A 1C16A 1F15A 2ZA9A 3PMEA 2ICWB 5A32A 3BXNA 3LPWA 1K8DB 2SEBB 3KEHA 2UZYA 2X88A 4XHQA 5DDHB 4TSAH 3VM5A 4Z77A 4OQTH 1QJX2 5E8EB 1UU4A 1GYKA 1A3ZA 3B94A 1J87A 1E4HA 5GZOD 2DCYA 2PTTB 4RISL 1KN2H 1FGVL 3FBQA 1ND3B 1KS5A 3IF1A 2WYIA 3P0YH 2JENA 1JMUB 2OULB 5GZDA 1YJDH 1KG0B 4JR9H 3S88L 1VBE1 2NXZC 1FV1B 1QLEL 1LMIA 2VR6A 5F0JB 4YQXL 4L4TB 2QHRH 1W9TA 4KRPB 1VBD1 1NGYA 4KJYA 3CQFA 2YDEA 5DQJB 1DTUA 4ZMXA 4FN0A 3L7FB 3CX5K 5D7EA 2ARJA 5IHBA 3ARDD 4F24A 1KJMB 5I8EA 5KOVC 2VDKL 2A6VA 1DQVA 2YK1L 1JZ4A 1HL5A 1MUJA 3LKPB 2PPDA 3MUGA 4AQTA 1JMXA 4I1PA 3RGVA 1UM6H 3JWOH 4KH2A 1AAJA 5BZWB 1VBC3 2AQRA 1WKYA 2YMTA 1K8IA 1VFOA 3BQUC 2E59A 4QRRB 3BP4B 5EN3A 3HE7D 1VRH3 4BQWA 2WLZA 3HR5A 5EZPA 1MEC2 4CRQA 4I77H 5DMGD 3CLEH 3VMPA 3EAKA 4Y4HD 4FPGA 3VGEA 3AS0A 4X6DE 3KM2A 3BFOA 5CEZH 2WVUA 2YFNA 3ILDA 3M7FB 4FDWA 4FFWC 3R8QA 3WNMA 3CFKA 3HTLX 5C6WH 3ELNA 1OAZH 2IXCA 3TN0A 2H8PB 5DHDA 2VN4A 5BW7A 1J5OH 5E2WH 4QJ4B 2D0HA 1NJ9A 1MW1A 4KO6A 2VDLB 4DGWC 3ZYRA 2FHRA 2TUNA 2VZQA 5E16A 3F7RA 4C91A 4JQRA 1AYN1 4JFYB 4LBQA 2HLEB 1OSEA 2I07A 5MENB 1FZKA 3C7EA 4XUNA 2VKXA 3C8HA 5F1NB 4I5BA 5I0VA 1OXCA 2V0AA 3DURA 5TH2B 2CM5A 5FBJA 5BRZE 5FYTA 2XBZA 1KQRA 4B41A 4JW3A 1UU6A 1RMFL 3FLTA 3SCHA 2LW3A 5HHNA 1L7QA 5HGGS 2IQAB 4Y19D 2YAEA 2ID4A 2R0KL 2HFFA 5CJOH 4GW1B 5BOZG 3T6QC 4BQCA 3WAKA 5E5MA 2ADYA 1PNFA 1UWWA 3HHSA 3AP9A 4ACPA 4HK8A 2VZPA 2UY7A 3ARZA 4MMYB 3AKTA 2J57A 1DGRN 2RAMA 1AYM3 2ZWYA 3V6FA 1TSHA 1PJ9A 3ZJAA 3EBGA 4TN7A 5CFDB 3AADB 4M02A 2P2KA 1A6VL 3C12A 3VI3A 2VIRA 4YSOA 3MJGX 1FAKT 5ANMB 3L54A 4C56E 3ARFC 2C24A 2F17A 4YG0A 2YXVA 3VDAA 3AC0A 4GJYA 4L18A 1Q1JL 3GNML 2W2IA 3T8XB 3DXTA 3OD0A 2OPCA 4GXVL 3NVQA 4HUUA 3QUXA 4FG6D 3K71A 3KVAA 3AK0A 1D5IL 3P4NB 4HZAA 3SBPA 1CDJA 4IE6A 3OXSB 4YSDA 4NKIL 1ODUA 1GC1H 3D39D 2XNAB 4WM8A 3TESA 4I02A 4GUPB 2A74A 5DJAB 1OK0A 3LMJL 3RZGA 1DVTA 3DHMA 2RQ8A 2KA3A 2NY0D 5A3TA 4X6FA 2R0ZL 4MDRA 2A75A 3FUJA 3CEWA 2Y5QA 2P5EA 2QPUA 3CLEL 4IKJA 4PLJD 3VXRB 5CXPA 2V73A 2XKSA 5CP3H 4YW3A 2IXLA 2H9GB 2CE6A 5T3ZL 4IBZA 4FS0A 5FUPA 5DJ0A 4Y5YA 4XCEB 4CUCA 3WW2A 4D6SA 4WTWA 3UG3A 4NO2A 3LDBA 4JRWA 4G9FB 5EZIL 2RM22 2BP8A 2BNRA 2ODHA 4F33A 5HSFA 1TETH 2XXCB 2WKOA 1G1CA 5HHMB 1QYGH 3WLWC 1S7UB 2WFPA 5DLML 3M45A 4JG5A 4M8QA 5I0SA 1NPNA 4LBOA 4G42A 2XVBA 4AVAA 1F4HA 2JJTC 5D1IA 4ZNEA 2DWDA 1ZHNB 5F7AA 4LKFA 1I3UA 2CLVA 5FYHA 1I7UB 3IJSA 4MA8L 1H30A 4ANWA 4P5TC 4UU9A 3RVHA 2I5YL 4RRPG 5HDLA 5FPAA 1LEKB 1XTLA 1LNUA 1RL1A 4PRAA 1KD7A 3S35L 3T65B 2Y60A 4NPMA 3TZVA 3ZE1B 3V4LA 4OBRA 1G6RH 3UTPD 1IFHH 3DMMB 4N2BA 1A34A 4ZZ8A 1MCHA 5E9DB 1PYWA 3DECA 3L1EA 5FXXA 4U2AA 4B9KC 2DM3A 2WKKA 2K7QA 1PGW2 1YHFA 3R7RA 3LA7A 5LQBL 2UWCA 4PS3A 3PJQA 3N3EA 4JUSA 1G0XA 4DO0A 1BLNA 2AKRB 2YGNA 3E38A 3MNVA 1IC0A 4L2YA 3VXRD 4QB2A 2O5XH 3D30A 3LKRB 3EF7A 2I9TA 3IKWA 1W8EA 1HNYA 3AZZA 5LGYA 4B7EA 3ASOB 4PBWD 1FO0B 3G6JE 3MUGB 3VXNB 4XFGA 5BXXA 5BOPA 1G9NL 5I1JL 3WTXA 4YIQA 3RL2A 1BQLL 1H2LA 3W59A 4UDTB 3HJRA 4E42A 5GLTA 3QA3B 3HR5B 4W70A 4N22A 1A65A 4GA9A 5BV6A 1NKRA 4PJ8C 3UTZB 1DANT 3E9UA 4HEMA 2H41A 2TRHA 4KHTL 4JKMA 4MLOA 1UD5A 4RISH 1TT6A 1J86A 2LU3A 3B9DA 4IDLA 2FYYA 4GH7B 3MLZL 3TWYA 1T03L 3WN5C 1UY2A 2BSEA 2Q3XA 3UTSA 4IYKA 1DDTA 4OZHF 1NFDA 4M8UA 3ATEA 3RVVD 1TQ5A 1ZD6A 4NQTA 1K5WA 3N41B 3KV5A 1DQQA 3EJRA 3SCMA 2OYKA 3H7JA 4FTVD 1ZS8A 1LODA 5A3UA 4BISA 2ZGSA 3C5JB 2GALA 3RIFF 1MQTA 3QQ3B 2FT8A 2XA3A 4F92B 3DROA 1MAMH 2AAVA 1KTJA 2QADC 4ETQA 3FHIB 1E8WA 4Z6AT 4IEVA 1M9WA 3STLA 3WMPA 5AZEL 2EIEA 3H42H 4X6QB 4PQQA 2C9KA 4PJEB 3WJJC 3O6LH 1CURA 3CWGA 3ACLA 1UL9A 1K4CA 1BQRA 2D31B 3CU1A 5DHMC 1HL8A 3MPPG 1MCWW 5E6UB 5AWNL 1IO4C 2EVGA 2VL5A 1QVOB 2I32A 4FP8H 4OI1A 3NSCA 4X7SL 3FJTA 1UYWH 1HSBB 3R1GL 4A04A 2BWDA 5L2KB 3GMRA 3X12B 3NNLA 3MRLA 2PCXA 4N53B 3NNMA 1UOFA 1DIWA 4GRMA 3VBFB 4ZQKA 2H1XA 1LEGA 2D9QB 3KS0H 4I0PA 1C5DA 1GFF2 2K7PA 4ZO6A 2GP3A 1GZTA 4MH0E 2VAJA 3FT3B 1VFMA 2F1EA 3IMUA 2XBTA 3CSBA 1W72H 4WO4A 3KGRA 2Y6LA 5CYYA 1JYTA 4WHYH 2CK2A 2VXUH 3QNXA 4ZPTA 3EJZC 2XKPA 2P5EB 4LSQL 4PJCA 4R4BB 1YPZF 3PUCA 4FJZA 1TYJA 2NTFB 1COV3 1GP4A 2BSRB 2DQUH 2VOVA 4JVAA 1U6AH 5I66B 5DWPA 3Q3GB 2O1QA 4MNHB 3ZZSA 1OSPL 1EAJA 3GIVB 3TT3L 3OPUA 2OMTB 5F3BA 3B5HA 4LLUA 4E2SA 2XHNA 1EBPA 2J1AA 3QAQA 5M95B 1ZT1A 3MLLA 3I3EA 1URXA 4JFTA 3PDQA 3T0WA 4RGAA 2IDCA 2VDRL 4GAZA 1H8LA 1BM3L 1OHQA 1SMVA 3NFNA 4GEIA 5C97A 3P0VH 2DD8H 1XZ0A 4WO4D 3MXWL 3OGGA 5DVNA 2IAMB 4GB9A 4OCMC 1XGQA 3WSQH 4AQ1C 3ZXLA 4UU9B 3C9NA 4Y5XC 3KCCA 2IAND 5DJCB 1IZJA 4PJHA 2A6DB 1OM3L 2W65B 1DVQA 2D7MA 2FX7H 1C8PA 2Q30A 2G2PA 1CVSC 2A6XA 2L7UA 4BMEA 5JORB 4N4YB 4FMKA 4K23H 4M5ZH 3VXOB 1GZQA 4Z8FH 1I1AB 3JV6B 3TN0C 1G9EA 2JCCB 2JD4A 2GPZA 2IBZY 1QH7A 4CN1A 2I45A 2RS13 3K2OA 1WZMA 4YHLH 3E8UH 3PWVA 4TSAL 4HWZB 1AL22 3OB8A 2G3NA 5I1IL 4MHUA 4Z7WB 5GGRB 2NY2C 2JCCE 3GTNA 4RAHA 4LLDB 1V8HA 4DN4H 2E7AA 3NW4A 5FJKA 2OL3L 2OXHB 3MNVB 1A7OH 4XMTA 1TE1B 1BYNA 3ZMNA 3ZQ9A 4AIXA 4Q4X2 1LEDA 2UYLA 4MNQB 2EO1A 3HFMH 4LTAA 4B7IA 2F53D 3BUYA 3V95A 3A4AA 2ORZA 1KNOB 1U8IB 3BD4A 4HQQL 1QMJA 3ZZLA 4LXLA 5L19A 4MGZE 5SWZD 4WV1A 1COV1 4RGMC 3FB8B 3GKWH 3KJ4C 4F3FB 3NV4A 3DTXB 4E42B 3QCTH 3KT7A 2JB5H 1O9VA 3AY4A 2P1BA 3F8UB 3TF4A 4Y20A 1PZ5B 2N1TE 3RG0A 4FQLH 2OPKA 3TPUB 1WGVA 1JWUA 3KBHE 4N43C 1BAGA 1NCRB 2RE9A 5HGAB 4F8LA 3DV4A 4X5XA 4E9XA 4MSWB 1SF3A 4NO5B 5E03A 3ARFA 4DO6A 2DQDH 4GG6E 3ZOIA 4IRZH 4K3GA 4AVVA 1P1ZA 4PJCE 3VHRA 4LNRB 4AFBA 1GYAA 2XV2A 1V0AA 3LRSA 3FT2B 1AZZC 5J4MA 1U8QA 1JF6A 2ZOWA 1E42A 4KI5C 4G6JH 4P5KA 5KXDA 1HDMB 3KCPB 3N5AA 3WIAA 2ADDA 5A3WA 1M05A 4WW2C 4K9SA 1E40A 5KBPA 3BZ5A 4X9IA 5ALCL 4HCRL 2VL4A 4YGDA 5MERB 2QDWA 3CHXA 4KTDH 3MIFA 4LVHC 3GINA 4NT6B 1PK6B 1HH6A 4ERSH 4FPYA 4LBNA 4ZSOB 4H0HB 1POV0 3F5WA 2AQSA 4ATEA 2PHRA 4F7EB 4DP2X 2BSTA 3FWEA 1YQVL 1EANA 3IMVA 5BV7H 4BKLA 1NSNL 5LNGA 4C59B 1NLSA 4IHOB 1TJHL 2NLJB 4AGGA 1OGAE 2NY4B 3OXRA 4P3WA 4JPWH 2FDGA 3V0EA 5JOPD 3HUJB 1LE9A 1JZ8A 1B0RA 4FPLA 1EEQA 4A2EA 3C8KA 4GS7B 3QZLA 4WO0A 4ADIA 2A6KB 1R1A2 1OT5A 1OWWA 3T3PE 5JOFB 2O6EA 4MD5A 1RB8G 4CDUC 4Q6YA 3IRCA 4IDJL 4HC1H 3FSOA 5ACA2 2RBLA 1HQWA 4J3OC 2O14A 4F15B 4PBOA 1VENA 4ZO7A 1WPCA 2EEBA 2Z79A 3BKZA 1ZDQA 3GK8H 3KYNA 5K9KA 1HWWA 2YU2A 5A7SA 1F8TH 4ADJA 1SLIA 5B4MC 5DD3H 1E6OH 1PGSA 1UJ3C 4S10A 3ESUF 2HKHL 1P6AB 5IK8A 5C0AD 5ISZA 2LS6A 5D1ZA 4P5MA 3H42L 3LQZA 1SLWA 4IMLA 3GBEA 4KK8D 4OFYD 5EZLB 1OOAA 2AEZA 5C71A 2Y6SC 4CVZB 1OOWA 1A3LL 4XMZA 1JPGB 1RUD1 2PQQA 4YGVB 2BSSB 2C9XA 2IGFH 3HLAB 2WNUB 1AOHA 5AVYB 3R6SA 4COVA 5FMDA 2FEDC 4LL9A 3HNBM 1N8OE 1KITA 1OIOA 1U8CB 2H6PA 5GJ6A 2E63A 4X4YA 3SNMA 5JMCA 3FC0A 3UYOD 4JDNA 1E4KC 4JKWA 3OX8B 5JXHA 4RSUA 4ONOA 5GGTL 4P57A 5AC93 4XB8A 2OJZH 2G2NA 3K1DA 2DU1A 1MRCL 2TSAA 2PW1A 1OT4A 3CC5A 3D3VA 4H8HA 5FYKD 4U3XA 2EYTA 3IBOA 3D6GA 4EZHA 2EXJA 3L95B 1L0QA 4G8EB 3ILQC 4AYGA 5MEQB 1RUI2 4JCKA 4QQHA 1V3MA 1XD1A 3GF8A 3QT2A 4OULA 2MKWA 3NFSL 4FQLL 1PIGA 2X53A 4DAGL 4AYSA 3BGAA 5I71B 1RPUA 1TZHB 1CQKA 1PQZA 1BV8A 4R9HA 2HRLA 3PJNA 2G3XA 4JDEB 4PW3A 1QLFA 3IWUA 1RZIA 3O2DL 4XEZA 4KJPC 4POUB 1MRFH 3NIDF 2DUOA 5L7OB 4YBQD 4NAOA 2CALA 5I16A 2ZOEB 1J0JA 3LOWA 3K4AA 4QXUL 2FJFA 3HS0A 3B9EA 4JKNA 5AVSB 1QTPA 4L37B 1OCRB 3K6FA 3WFCL 4JG1L 4X8GA 4ZMTA 3IPBA 1D7CA 1DBAH 4NN6B 1FVEA 3WNJA 4Q9CA 2EXTA 3FUKA 1UT1A 2WSDA 2VMCA 2GTZB 4Z7OE 1VBA2 4DPBX 3X11A 5DJ2A 4P9HC 1GOFA 2FX7L 5ERLA 3AROA 2EUZA 2R4RH 1BPVA 5JPNB 5CMAB 1YG9A 4YLCA 4IUGA 5GS1A 1M9SA 3FT4A 3GQFA 2J42A 3KDMB 1IC4H 1RZ7L 3FB7A 1ODNA 3ML8A 3T0BA 1J0KA 2RA1A 2D93A 4LB8A 5DVKA 5MI0B 3UTSD 3NFPA 5I19L 4JRYA 2VITA 3FQXB 2NY4D 5FLUA 1JP5A 4DUVA 4RHV1 4LZKA 2UZPA 4A68A 5FPLA 2CHHA 3HPJB 4HKXA 5I74B 3WT3A 1D5XA 4LBQD 3JT0A 1JGEB 4OTXL 1EHNA 4YK4B 3II1A 3L3OA 3AXEA 2ATKA 1OTUC 1JL8A 2JH2A 1F2NA 1TTFA 2OMNA 3GF6A 5ANME 3U9WA 4C56B 4KKAD 5I6XB 1WFNA 1ZLVH 4N0UB 4EKJA 5JW4R 2JICA 5GZOC 4KV5E 4XI5D 4XNZB 2YEVB 2W1UA 3F2ZA 2VULA 5KHIA 3BN3B 3HB3B 4U6VL 5KVDH 3IJHB 4NN0A 4QDRA 5HTSA 3D4YA 2ZKLA 4GI8A 1C5BL 1LO5B 1RY7B 3FN0L 5KBMA 4N9HA 3SODB 3TYJA 5C3PA 5K9QI 1BREA 2WZ8A 5MEOB 4ARYA 4OFKA 1F41A 4MZIA 3QG7L 1FBIH 5FKAB 3TBVA 2FR4A 2HEWF 1UKSA 1V3LA 4HP5A 4IE0A 2G4IA 3OJDA 4L23A 5CCKH 5LCVA 4XZ4A 3V8OA 1UHVA 3BMWA 4MJIA 5CR1A 2A9NL 3K74B 1OD5A 4KROB 4N0FA 2Y6GA 3LKOB 4B29A 2X4SA 3OB0H 5FDWB 1G5AA 1LXMA 4UOJA 2JG8C 1ZAGA 3HMWL 3LN5A 5IFHH 1QJU3 4PRBA 1PZ8A 3AKQA 1GC1C 2YA0A 3SN6N 5E08L 3KPSB 1D4VB 3ROLB 4Q8LA 2E0PA 4OLZH 2JFCA 4X50A 4L8SA 2PYTA 1CTOA 3QFGA 5F2FA 5FZOB 3THDA 3U1XA 1I8KB 4WGVB 3JBG1 2IANE 4R0LA 2XKUA 1FJ1A 2VDQH 4LRNH 5KVFE 3IWVA 5ADOH 3N44B 1J0IA 1NAMB 3IS1X 1NWPA 3WEAA 3S8WA 4HK9A 4OZHE 1JZ5A 2BZCA 1GRWA 4EIGB 2H2SD 2O5XL 1U3HC 2P43B 3E7JA 3VBRB 1Q9KB 1WLHA 4L4VD 2CPUA 4O4YL 4M3JA 2AV7A 4AMKL 3BJLA 2ZWKA 4BYHA 3N9NA 5FOJB 5I15H 1WZXA 5E1RA 4I0BA 3C60A 2WFF3 3WW4A 1GMEA 3AITA 2RMU3 5LEKA 4Q0PA 1MZ5A 4M62H 3UJTH 3GRWH 5KJRL 5C7GA 3PWNA 1JH5A 4PJHF 1F4YH 5E2VL 1MEC3 3AP6A 2LAAA 4ZMQA 3RZCD 1W9FA 4G9SB 2V5TA 1BOGB 1CLOL 3B9KD 2B14A 4WKZA 1XC6A 1X50A 3U37A 3JTTA 4XZUA 4X8NA 2XWJA 4HH9A 4RDQG 3KW8A 1X5MA 2ZWZA 5HDBE 5I1DA 5L7XL 3T0VA 3ZUCA 4IEFA 3BAXA 1UYPA 1ZRCA 2HG5A 4YSEA 3KPSD 4MQ7B 3B2VH 5D1XB 1YEDA 3BDBA 1QYGL 1DBBH 2JIXD 3B5TA 1IAKA 1YMHB 3EGXA 4LLQB 4WFEE 2WYHA 1OP4A 4Y2OA 4U6XB 5CG8A 2DQFA 5EZIH 3MJ6A 3A3YB 2QNKA 2D7QA 4CU8A 2WTPA 3HNTH 3RWCB 2SBAA 1PZ3A 4DUXA 3L48A 2OM5A 2VE1A 1E5SA 4A45A 4Z7WE 1IUZA 4N87A 4EUPB 3OKKB 3MO1A 5E6ID 5A2BA 2ZGPA 3H1MA 2RS11 3B4NA 1K72A 4XN4A 3B9AA 5JHDB 2X5IC 2FE0A 5D7LE 1PEWA 2DFBA 4WI7A 4YM3A 4FI7A 5DWUL 1CD1A 3KGUA 1F6AB 4FI9A 3GMOB 2LAGB 2QGCA 3WNOA 4RHV3 4ZTOH 1VGKB 1U30A 4NBZB 2CLZA 3QDGE 4O9GA 1YJKA 2OK0H 5KC5A 4ADGA 1UXWA 2AK4D 4HUXA 4AL8L 1V6MA 1ND2C 2VH5H 3WIHH 3CUPB 5LWYL 3B83A 5GGUA 1MHPL 3CMGA 4BFOA 5J13B 1VBC2 2WR9A 3FX3A 1TZ8A 2WSVA 2QPSA 4OLXL 2WZR2 1FOD1 4S11A 5E6IA 5L9DH 1UJ3A 4NC0B 1W0WB 4Q4Y3 4LBAA 2Y5TA 3DO4A 3E3QC 3QE5A 1L7IL 5BS0E 4L99A 2WYSA 3NSFA 3O0WA 5E56A 3NRUA 2V7NB 3TJPA 5HJBA 3VG9B 2EIDA 4MV2A 3LEYL 2X2HA 2VN5A 4TUUA 3B93A 2N01B 3MFFB 4KKLC 2NZ9D 4ZSOE 2A74B 1NE6A 1A66A 5KW9L 1MVUB 4W9KC 5BO0D 2VO5A 1MWAH 3VX1A 4CBZA 2BC4A 2XACC 5AG9A 3OY8B 3FU7A 4HG6B 1MFEL 3UBXA 5CCKL 4ONFH 5HPMB 1JFQH 5HHOB 2A99A 1F5FA 3BI9X 3FCTA 4LXFA 4APQD 3GUTA 2VW1A 4MX3A 4CL7A 4GWIA 2ITEA 5D2NB 1ZM1A 5I1GL 3SPCA 4I18B 1UH2A 3CNAA 5E6SB 5FZCA 3CTTA 3BRFA 4GG6B 2UVFA 2W5FA 2YD1A 4O2CB 3RI5F 4ZFFB 2Y1AA 4HS8L 1O3RA 1XAKA 3VGHA 2PLV1 3ETPA 5DUVA 3K7UA 4E9WA 5BUVA 1KULA 1DBKH 3BE1L 1ASQA 3BDYH 4KU1A 5TE6L 4GIAA 1CZSA 2Q86A 3QDGA 1MI5A 2PXYA 4FQQA 1NDMB 4HIIB 4PJCF 5I2IB 1XOYA 5CD3A 1CDCA 1RHI2 2R041 5DFVD 4NJAH 1UD2A 2J8UF 4XT1C 5FZBA 2JJWA 4AZZA 5FLVA 4GWJA 1JG9A 3K72A 5GJTL 4BE6A 2EVHA 1KLUB 3OCPA 1W6QA 5B7MA 1NIAA 1IQDC 2Q5TA 4IK6A 1S9YA 4PYHA 4FTEA 1KYUA 4IRJB 4E9YA 1BQSA 4PYGA 2R1XA 2E47A 1ZHBA 4NPJA 2YQ3A 2ESVB 3DVNB 4YSUA 1W6NA 1TPXB 3IPVA 2QQWA 1D7FA 1FYTD 1W2OA 3EH2A 5FUIA 3RVUC 2A0LC 1ONAA 1DQKA 1IX2A 1OF3A 5FMCA 3CXHJ 4DCQA 4GRWF 1R17A 4EDWH 3KGSA 1C1LA 3ARGA 4N0CC 5DUPH 1VLNA 4NMIA 4IOIB 3J7MA 3KM5A 3DSNB 4WWNA 1AIFA 3I6KA 3UGUA 1HEJC 1P6WA 3QR0A 2ZP0T 4K7PL 4OR1A 1LHZA 3VXUB 1V6KA 2WZEA 4TYSA 5IESL 2WGNB 4PGJA 4TUOA 2GC4C 3FRPB 4YIQB 3RL2B 1MR5A 1UIKA 2QZ3A 3OHMB 1BVVA 3C6LB 5SX4H 4RGOH 3EOBA 3DC0A 3NZSA 3Q2WA 4GSDH 4TLTA 3KLKA 4DZBB 3IMRA 5EO0A 2J5LB 4LHUB 2IPUK 3KG5A 4LLQA 1LDPH 3RFRA 3VL8A 3ULVH 1GMIA 4NEHB 1X9PA 2CUAA 5DAWA 4DVBB 3L81A 1HJBC 1OSZA 4G6MH 4NOTA 2EC9U 1OEZW 4RGNB 3BUPA 4DAGH 1KJRA 4IDZA 1EEYA 3VWKB 4KI1A 1RJ7A 2EH7L 3P11L 1IBHA 4R26H 2D6OX 3QDMA 3JT2A 4JM4L 2YXSA 5HVGB 1D9KD 1MJ7H 5EBGA 1R33A 4PG2A 1CB4A 4AUUA 1AQMA 3BO8A 2V5MA 3BWUC 4JFPB 1AE6L 4M6NL 1YIFA 2FZ3A 1PO23 4JZRA 5FO8B 5ENWA 1F6FB 3C5JA 4MQSB 4MXWA 4U3HA 4QXCA 1OT1A 5I1HL 3E6CC 2P7TA 3DYOA 2E27H 5IW6B 3LV3A 1N9PA 2DWEA 5F2WA 1R34A 3T8MA 1RXLA 3AVEA 3D69A 1E28A 4RQPB 4KBBA 1UXWB 3IEAA 4DRRA 5IOPA 4KJPD 2OP4L 3VRJB 5D1QD 3T04D 1CIWA 2B2XH 2EYSB 5E6YA 1CZVA 4JREC 3S5LA 1K5MB 2YLHA 3WEBA 2YQGA 4CCCA 4PR5B 3D3VE 3E2HC 3IVKB 1NWOA 4EDXB 1YQ5A 1IQAA 3RZCC 1AO7B 1U8MA 1UA7A 1AQDB 3BUQA 3KL3A 5CZKA 2MSPA 1MXGA 2P4EA 4G9FD 3SBWC 1Z5LB 1PDKA 3NNJA 5C3QA 1KPUB 3GXUB 3LPFA 4YW5A 3TT1H 4BWOA 2A1WL 5KHGA 3MIDA 2C7UB 4GRWE 3H9SA 1ZBA2 3TFKC 1UWGL 5T5FA 4FEIA 2A4ZA 2Y6HA 4QMAA 1MREH 1VDGA 2RFXA 4XRCB 1KJ2B 3VWKD 1M71B 2A4EA 2X1QA 5IROD 2J56A 2GJ6D 4K3JH 4GQZA 3AFKA 3ZHDA 4W9GC 2H3NA 2WSPA 3KWUA 3V4PL 2AMUA 2OSLB 2XG3A 3FCTB 3GUTB 4A7KA 1N64H 2B5IC 5JVVA 1AQKL 1JZIA 1UT2A 1YY9D 2VRQA 4N0YL 1AG6A 3C08H 3K4DA 1EJOH 2WUCH 3N50A 3OKNB 4PRHB 5F1IB 4A2FA 4DIXA 1LHWA 1NAKL 2HYMA 2YMXL 3LB9A 5GLUA 1QD0A 5DYOA 3QXUA 3V4PB 3U0TB 4CGTA 4Y1XA 4L92A 2JMRA 1SVBA 3MRRA 3PWPE 2EIBA 4HBQA 1XV8A 3D1MC 1NIDA 1AGDB 5DK3A 2NY6C 5K39B 5F37A 1U9KA 3GIZH 3DV6A 3VWJA 3UT0A 1DGWX 4DKAA 2CDFB 1VESA 1MI5B 4QY8A 2R8SL 1CESA 4PJIF 2TEPA 4IEQA 3U25A 1J5IA 5IW1A 4P4KA 1H6UA 4P9JA 3BQUB 3VL9A 1P5VA 1R46A 3D7PA 2VLKB 3A23A 5T5LA 5J0BA 4KX7A 4XX5A 2QVFB 1W6QB 1AHWA 2FHCA 5C07D 4DB5A 2W94A 3BLPX 1SFDA 3CSYA 5LATA 3QHZH 2SODB 4TVPH 4YNIA 4WFED 1HWGB 2K6YA 1MFDH 3VTAA 1ED3A 3S35X 2F54E 3PQYB 1NBCA 1Q0YL 2ARCA 4CDQB 5IJVA 2DYPB 4D0CB 5JDSA 3L2HA 5DSCB 1CZTA 1I5ZA 1RIRA 3OGCA 1KSRA 1VPOL 3VBUC 2WDBA 2Z93B 2R1WB 3JTBA 2WVVA 4XAKD 4QRQB 3K3NA 5K9OB 2AREA 4B9JA 3OKLB 5EB9A 1FRGL 3OR7B 4Y19E 5F7DA 2K9ZA 5BUGA 1U2YA 2QSCH 4NQCE 2H47C 2ROYA 4XPBL 3VFSA 5B7FA 3ABLB 3ZT5A 1HHIB 3RWJA 3I3QA 4RL7A 3ZYHA 1WS8A 2OZ6A 3RIKA 4YLZA 2LTNA 1ID5I 3ZDYB 1J8KA 4U0RC 5I9QB 4ZONA 4OQ1A 4BH8A 4I9WE 3VD2A 5C2BL 2B9AA 4AJVA 4UBDC 2FZ2A 4DXZA 2BIMA 2Z92B 3LXCA 1DJGA 5D93B 4ZFZA 3POEA 2BHZA 3GLDA 1RZGB 4NRQA 1U2CA 3ARFB 1A7QH 4Q4V3 3ZXFA 4BJLA 4PWJA 3H4HA 3GGWB 3VE0B 3QWOB 2DTML 5LAPA 5I8OH 1LU1A 1RGSA 3LZLA 1DDHA 2Q2LA 1QIQA 4QT5B 5JDBA 1H0BA 2EXSA 4LLMB 5BY5A 3JZYA 1MS9A 3RQ3A 1YCIA 2EADA 4DPAX 2Y26A 3KPRE 5KSUB 4AF9A 4FFIA 5ENWB 5CKMA 3INUH 5AKTA 2CCVA 1A4KB 4IV3B 4PCSA 5AAWA 2XA8H 1W2AX 1I7TA 3ZDZB 4XBNA 4HS8H 5JR2A 1AKJB 1LJMA 3H0TB 5DZJA 5DJ8B 1UYYA 1X5HA 2FGWL 1CD0A 5EA0L 2P5WE 5F6IC 1T1YB 2OYLA 2X05A 3SE4A 4OJYA 4PSRA 4JB9H 3V0AC 5ISZE 1K45A 2JDNA 3KLQA 5FZGA 5ACZB 4G9DB 1CXFA 1OSPH 4J8RB 3LDKA 1YUKB 3U79A 3HUJA 4PB0H 1LE9B 1NCQA 3WY4A 5E88A 2Y06L 3SY6A 1M06G 3LS4H 4K94H 2FLMA 3VI4B 4HIHA 3ZL2A 5IIEA 1DCSA 2ZD0A 1RERA 4KK9C 1AQDA 1TME2 4GMTH 4HJ0C 1XU2A 1AANA 4Z7IA 3N9QA 2R1DA 2Z5WA 4K3HA 2XQYG 4FTVA 3ZUNC 4JVPA 2VDPB 2PCFA 3FB6B 5TF1H 2WQZC 3JBG2 5K9KB 4NPLA 3LIZH 3CBNA 4GH4A 5B22A 3H9ZA 1IM9A 1UH4A 4JL2A 2BVPB 1AR61 3VFOA 1IQWH 2WV3A 2XWBB 5F3GA 4FG6C 3EYVA 3GGLA 2A9ML 2J20A 2JDHA 1IFGA 1HILB 1E7UA 3LIGA 4N5UA 1BFVH 4TQPA 5CA6A 2OSLA 2YD6A 4WIQA 3T4YA 1X82A 2KD7A 2VQ4A 1EP0A 2YGMA 3AG4B 1GL4B 4OGXL 3H9YA 2HFGH 4ZAKC 4BM7A 3MICA 5J89A 3M3IA 3D12B 2C1PA 3MLXH 5D5MB 4PHXA 3FFDB 3VCLB 4AR2A 3IFOB 2P8LA 4P9HH 1SDYA 5AOKA 1QNZL 3BZEB 4OI8A 4PREB 4FPCA 2XICA 1KCUL 4E41B 1WISA 5FR3A 1FNFA 2ZZJA 1EAPA 4JDVB 2YPVA 3LCYA 4KZDL 1YEIL 4JGYB 3VXSA 4CEYA 3JXAA 2DQTH 3KLSA 4GRLC 4OJEH 4QPWA 1QO3A 2W81C 1HAWA 3V0IA 4P2OB 4YL4A 4XNBA 3ZDXB 5BJTB 2W52A 4MCYB 2EYTB 1GAFL 2FCBA 1ZLUK 2BFUS 2XONA 1EXUB 4JRXB 3BPLC 1BFOB 4HF5H 1B0GA 4X6BB 3N40F 3SPVA 1Y0LB 5MEQA 3QS3A 1MQKH 4YEFA 5I1AB 1FMD1 1Q0XL 3TIEA 1F45A 1CDGA 2G4EA 2V17L 2VXQL 2ZOKA 4JZNA 2JDPA 5EIIG 2GTWA 2RALA 4JQXA 2F6BA 3I50L 4JO2L 5MENA 3C60D 4J3TA 2BWAA 1IT9H 1J5CA 2Z3FA 4IBYA 3TBSB 1FNAA 3WN5B 1AJKA 3AREC 1L3JA 1JPST 1DJZA 1UFUA 4QPGB 5FYUA 5JW5B 1J3RA 1GZCA 3QZOA 4HMEA 2ZCWA 2V3EA 3VRLF 4QRQA 4WK0B 3DN7A 2WNXA 4UT9H 3BPCA 4UYBA 4BFKA 1AR91 4I0CC 4GSUA 3RL1A 3VFGH 4KAQH 4YXHH 5IEHA 3A6BH 2H7WA 3H8NA 4IEWA 3VJ6B 3W81A 1AD9A 3C2AL 3FLRA 1URZA 4QJ3B 4EN7B 3L3HB 1W6LA 2J1EA 2V4AA 4AVKA 3DCQA 4YVSB 2XWZA 4BM8A 3QUXB 3HN5A 3TIDB 1JWMB 1QW9A 4U1MA 5KC6A 5C92A 4HJSA 4AEIL 3P77B 4RMUA 2XNAA 1Z9SA 4TSBL 4MFHA 1UYXA 2OAAA 2Y07L 1Q8QA 4NIGA 2ZOLB 4LLVA 1FZOA 4D3CL 6PAZA 2GIYA 2HYKA 2K9FB 5J48A 2WC2A 3WCRA 4CP9B 4YXKH 3VBFC 2G60H 5T33H 5EV7A 3DF0A 2D3JA 3Q8FA 3QIBA 2GC1A 4GMP1 3BIKA 5DRZA 5EWSA 1XDTT 2X3CA 1CIDA 1JFHA 4G9FE 4PTTB 1AZCA 1SHMA 4F7CB 4XAWL 1MNNA 1TDQA 1REIA 3ARBB 3DGGA 3HEIB 1LK3H 1KC5L 2I60H 3MMEA 4FJYA 3MREB 2FNBA 4M9OA 4QRTB 5DUML 1JS9A 1OPOA 1JS4A 2ZX2A 2BVYA 3RJQB 3VVWA 4XUOA 1EGJH 3VBHA 1WA1X 3MTRA 4BQ5A 4MA1C 4XX1G 3CKHA 3DEMA 1IHMA 4AEDC 3OZKA 4BKSC 3UIZA 1T0NB 5DXWA 3BVTA 1NLDH 4HS3A 3GMMB 3VHNA 3HAEB 1XXNA 1T80A 2XWEA 4LCWD 1TEYA 2X1PA 4ZXBB 4RBPH 3U36B 2AUYA 1G1YA 1DQTA 1LLAA 3UFIA 4AYDC 1DJHA 1QNWA 1Q94B 5GS2H 3DX8B 4GRWH 2WN2A 3SYOA 4AZ8A 2NCEA 1YI9A 2NPIA 1JJUA 1PVC3 1O6TA 2WQAA 5EZOH 5FO2A 3SJVB 2EDWA 2CKBB 1TEFA 4DY3A 5ISLA 1AKPA 3ARXA 1U8JB 2QSVA 5E2UH 3K6DA 1KXQA 3I97A 2L9LA 3BPOB 1MOEA 4HFWB 1J8RA 1OURA 1EZUA 4AW7A 2DDUA 4OLUL 1GGCL 2XXFA 1ULOA 1S5IL 2NR6A 3IU4H 3ZYOA 1KIUB 4ZMYA 4Y5TA 5J6HB 1AXTL 3O8XC 3GBLA 3LX9A 4IGBD 4JUTA 4LOUD 4ALAH 5L9VA 5GQBA 3MLRH 3I84A 4LEEA 1C4RA 2AJUH 4D7BA 4RN5A 3ZKYA 1F02I 4YSCA 2DW5A 2PPAA 4WUUE 5FMOL 3TVMC 3I6LD 1S7QA 4LF3B 5A3LA 2FWOA 4J25A 5TPWL 2DDQH 3E3QE 2VZSA 3ET9F 3MV9D 4KHXH 4Y16C 1VB4A 1XCQA 3HC3H 2AAAA 5FW6A 5K9JH 2XJVA 1IJNA 5E94B 4B50A 4IU2A 4WJ5B 4R5XA 3BSGA 4B0MB 2DWRA 4P2RB 4D9LH 2WT0A 5CN2A 3HZMB 4XAAA 1SY6L 4JHWH 2ZABA 3E5UA 1FG2B 2UWEE 3MRHB 4FZ8L 2HLFD 4XMAA 2ZSVA 1SQ4A 1UQSA 1SN2A 1NGPH 2BFVL 3SPVB 1U3YA 3CSFA 4NRZB 4ODWB 5D1ZD 3O2DA 4N43B 5LBFA 3BAEH 3OD3A 4GP5B 2OMXA 4J3OG 1SEBA 4XODA 5DFAA 4CCKA 4CZSA 2VLJB 2QKIA 3MFAA 3EYSH 4YM1A 2I7OA 2J8UA 4W9CC 1J3QA 1YFUA 3IB3A 3RWNA 4NZ8A 4F2FA 4DTGH 1DN0B 4Q74A 4ECNA 3P54A 1U91B 2FGWH 3TNMA 3T8VA 5FPXA 2EDFA 4R7XA 5DZVA 4AI7A 3E6HB 3MRKA 3Q48A 5KN5B 1AX0A 2R073 1JOIA 1NCUA 2VXJA 4ODHL 1HJFA 1RVFH 5DUXA 1DLFL 1ETA1 1FX5A 5ABAA 3SE9L 1SN5A 2P49B 4FXGA 2BVOA 4Q1RA 5KSAD 2GIMA 5J12B 2GT9B 2P45B 4HJJH 3L4XA 2P3JA 3WFBH 2W08A 2OJ1A 3BEWA 1NEUA 4BRJA 5EUOE 2H26B 5I8OL 3WKMH 3L9RB 1AP2B 2GN3A 1OW0C 4EJ1C 4R9BA 2D8KA 2EEFA 1KCRH 4AXWB 5HBAA 5EZWA 1XNDA 3LVTA 4K8RL 3PJSA 5IP4A 1CWVA 1F2QA 3O0RL 4OLYH 3EO1B 2HBTA 4YS4A 4FCAA 4PRPA 5GGTH 4LEXH 2APVA 3NSDA 2FD8A 1AGBA 3J8F3 2BY1A 5CEYA 4BDVA 2HT2D 1C08B 1N3OA 3NCFB 1PIFA 4CDUB 1K12A 1DZTA 1LOCA 2CLZB 1G7HA 4NWUH 3LKQB 2CDGB 3CBRA 2FH6A 4NKMA 4X9HA 5JPMA 5KBDA 3HHMA 2XETA 3T3PF 3SCGA 3EDEA 3VU2A 1X5LA 1VZGA 2ILLA 4PQXA 4JFHE 4PLNA 43C9A 4GKNA 4WWPA 3ARBA 3HEIA 3ZW3A 1SYVA 4P9HL 2HTLC 2WUCL 3D0AA 5F7LB 4OFPA 1NEZA 3HKZA 2P1YA 5DMYA 4PS7A 5KYYB 1TU2A 3H6AA 2WNKA 3NAPC 5DK0B 5TDOB 2Y7QB 3ULAB 1BVNP 2VXVH 4I3SH 5EC1B 1ZSDA 1ULCA 3GHMA 4UW4A 4L4TD 4ZXBA 4DH2A 4HSLA 2A9MH 2ARWA 4Y89A 4UQEA 4H1LB 2F18A 1ADQA 2XQ0A 3KT4A 3GKZA 3LJ3A 3UBXB 4CCJA 4LCVA 4HT1H 4LKCB 4ZK8A 5I18L 1S9WA 5H9SA 1DO6A 2AHIA 4LAJH 3WAJA 2CWRA 3ZZQA 3CLFH 4L8DB 2ZXEB 4WEBL 4Y5VB 3H9AA 3W39B 1RUQH 4XNAA 1U8JA 2VLRB 5E6ZA 5KVEL 3CCHB 1WWYA 4FFZA 4OCSL 3GIZL 4QRPA 4JS7A 4NLAA 4CMMA 3ROUA 5F3CA 2WA4A 4QYOA 2JX9A 3FO0L 4YVWB 2OMVB 5ICYB 5IB3A 3C7GA 5DVMA 4CP1A 4Z0XA 3VXQB 1M2VA 3BKCH 3MODH 4N0RA 1SLLA 3JCIA 5FYIA 3I2CH 5CB7A 3FRUA 3M88A 2C3VB 4O02L 3W0WD 1AD0A 1VACA 3SKOB 4N2AA 3BU7A 5I0DA 1RUC1 3MR9B 4GQPH 2APFA 1OF0A 4IGOA 3T2QA 5CEZD 4LARH 1F11B 3DPDA 2WLMA 4PJGF 3L4CA 1G7IA 4WHYG 3WLBA 1RK1B 5C0FA 4HWEH 1FIEA 1IKNA 3D18B 1IEAA 1W8ZA 1P4BL 3EG9B 1UUNA 3UGFA 4IRZL 5IW3A 3SGJA 1SXCA 4ZX6A 1UWYA 4PLOB 3T77A 1NCCH 4BFIB 5I73B 4APXA 4AEMA 2WQUA 4BQ1A 5DTFA 1IVLA 1QFWM 4BQ6A 1RUF1 1ZLWH 4Z7QF 4AIZA 3LZQA 5FKBA 3VQLA 1T83C 1YNKL 1FL6B 3N1QC 1XIWB 1A9VA 3CK0L 3GXPA 1F97A 3L16A 4RETB 1BZWA 3I2KA 1M57B 4X98A 4PS4H 5C9AB 2JKBA 1NOLA 4MA7H 5C7ZA 2FCVA 1RFDH 1V5JA 2IJ0C 4PJFA 4H25A 4Z7NE 3VZMA 1INEH 2AJ3A 3IDMA 2P42B 5CJQH 4OZFG 4KY1L 3ZTJH 3DO7A 4TSCL 2BOBA 1MJ8L 3JWDH 3FU8A 3MRBA 1EHXA 1RP9A 1S7WA 1WMXA 1JV5B 3PUHA 4COZA 2DVDA 4EN3C 2X3BA 5J1TC 5IVOA 2DYCA 3TA3A 2J7MA 3IN0A 4X5WA 5FIEA 5C0JB 4BSVB 4CU9A 1LGCA 1U3HA 4NWUL 2QQKA 3L9EA 1ZA4A 1N0XL 4NQEE 1E50A 2FDJA 3BAIA 3QCVH 1W90A 2Y5EA 3GMQB 1U3JA 1ID2A 4JO3H 5H94B 4DO4A 5BMFH 3ZKUA 4AEDA 4EKXA 3IJ9A 3O0RH 4Y7OC 1BEXA 5CGMA 1KBVA 3UO8B 1F3RB 2N7SA 2HAZA 2WD0A 3MV7D 2QUOA 3OR6A 3GZQA 4H13C 4FQ1L 2OUJA 3QORB 4GBXB 4RR3B 2C9QA 2QTWB 1OB1B 4YSQA 4SLIA 5A6MA 1O3TA 1P69B 1JPFB 1SOKA 2IDTA 4ZFOA 4NIAA 3WVJA 5AKVA 3LV3B 3AMQA 3O12A 1QNYA 1FDLL 2RMU1 5BMFL 2C4XA 5F6HJ 2KPNA 3QYMA 2WA3A 3HWJA 3H2QA 1MY5A 1F6LL 2VN3A 4WI2A 3AMNA 2KMWA 1KDIA 3I8TA 5E5MB 5B38G 4WI0B 4LLOA 4EWEA 3DX9B 3P9MB 1OD3A 5HHOD 1WBXA 1NGXA 1Z9PA 3N1MC 3TEWA 3ZSJA 4Q8BA 3GSUA 3FU3A 1YFYA 3CLWA 1T2XA 4G3YL 1STMA 2G5RA 2MEJB 2AJZA 3O8XA 4NNYA 5DJ6B 3NIFE 5C0BE 4NYLB 5GRYA 1GKOA 2H6PB 2OTPA 3NIDB 1DGRA 4GKZA 1ZZ7A 5L0QB 3ZFGB 1ZLSH 2AGSA 1LP9B 2ZGTA 2W9EH 4C4KT 1BG1A 3V0BA 4PCYA 1OA4A 3POFA 4CSWA 1YVLA 4XMPH 1V9U3 2ET7A 1L5GB 3BDXA 4KI5E 1HCZA 4XP5L 4XXDB 5I8SA 1GYVA 4B9FA 4FZ8H 5GJSH 5L4IA 2D0FA 1N2RA 3R1GH 1W6OA 1SY6H 3C3VA 4O2FA 3WDXA 1B4LA 2M83A 4F7MA 2V5RA 3CLFL 4XI5C 4W9EC 5B4NA 1FPN3 4O9HL 4XCCH 1ZT4A 4ESKA 2KLRA 1S3RA 5JOXA 3IDAA 3ZE0F 3SDDD 1U3NA 2VUYA 1ZRFA 4RMVA 1M7DB 4PRHA 5F1IA 4L5FE 1O5LA 1JTOA 2A2QT 2YGQA 3RIAF 1J8HA 3DX1A 2ICWI 2VAAA 1DP0A 4GXLA 3KPRA 3SDYH 5C4WB 3WDVA 1EJ8A 4NE9A 5FXCH 2RDQA 5K1NA 3X1FA 1AI1L 2ZNXA 3SJVE 2ERFA 1BVNT 1IGFH 3EXJA 3M86A 2VPVA 1R1ZA 5I1LA 3I9GL 1S5IH 1P5VB 1JFQL 4W9JC 1V6JA 4FSJA 1NANI 1HV1A 3L6FA 2MPFA 3GSNH 5BQ7A 5IMKB 3U46B 3EG9A 3O3DB 5FO7A 3NCCB 4I0KA 3WF3A 4B9PA 5C7XH 3FXIC 4HIQA 1OAXH 4X9FA 2BRQA 4AH2A 1MZYA 2E7QA 1HNFA 4WEBH 5JPNA 4LJHA 5EEZA 1RL3A 4O9EA 3WQ7A 2Z64C 3IFPB 3L5WA 5DEGA 2B45X 3WSOA 1PBYA 1NFAA 2UUDH 4K20A 4BK5C 2P5BA 3KL0A 2LT9A 4UW5A 1TVBA 4Z7QB 5GHWH 3STBA 5L9DL 2K6ZA 3MN8A 3NOIA 4MJ5A 4N86A 2PYEB 1FMD3 1GGUA 1E4WH 4HS6B 5F39A 4AI2A 3BT2H 4PJIA 2ATFA 4I3SL 4DZ8A 1EUUA 2DPKA 3FO1B 4KUCF 3I6GA 4C90A 1ZVFA 2X89D 3EO9L 4NNXB 3NJIA 4ORZC 5FGCE 5LHDA 4RS5C 4CPBA 1PHMA 3O81A 1IIKA 3IFLH 3A4EA 4KBPA 3WUCA 5DC9B 5L2KD 3TEZA 5IUCA 1MFAL 1K2DA 5D96C 1MS3A 4OCXH 3H50A 1KTRL 1D4M3 4XF1A 5ECGA 4YZ4A 3ZN4A 5J13C 3DOHA 1O3QA 2HCZX 3HG1E 2EIZA 5IG7B 5BS0D 1W06A 2J43A 1VCBC 2W8CA 2WXIA 2BRRL 5J06A 1JYIA 1Q56A 3D05A 3Q8AA 2QQKH 2BNRE 5F7FA 2DMBA 2FL5B 3BLKA 2VC2H 4DTGL 1SCSA 2YV8A 4L0YA 3WR0A 5FXZA 1UOWA 4D0DA 1M53A 3JV5A 1R3KB 3ESMA 3U0ZA 4MA8H 4QGLA 4Q4IA 4ZPVA 1YC8A 3VG9C 3SO3B 4BQXA 4HHWA 1PLAA 3GZKA 1QKQA 3EYQD 3AXIA 4Y1TA 1JHJA 5C0ND 1R1A1 3O2VL 2OMYA 3CXHK 4LAQH 4Y88A 2YD5A 2UX6A 5E8NA 1CXIA 5CEZE 3BVNB 1ZZ6A 1U21A 2C3GA 3F12B 1R5VB 1JBCA 4DHLA 2Y33A 1I7TB 1VSCA 3SQOL 3JD72 4MGQA 2LE9A 4ZAKD 1ORSA 1RXFA 2E7LA 1SBEA 3HAGA 1MXDA 3S2AA 4DP4X 5BXFB 2UXVA 1ZJBA 4OZGE 3OKYA 4JMNA 2CIKB 1S3KH 3EOYG 3V4VB 4JGZB 5FP3A 2FK9A 2ZPKL 5EU3B 5KVGE 5A2CA 2VOKA 1DE4A 2VTFA 1NKOA 1NLBL 4HFUH 1AIZA 1F4YL 5E2VH 4HZFA 5KWRA 4XP4L 2AP2A 1H5BC 5L2JA 5C3IA 2LW8A 3NQKA 3O1MA 4HG4J 3ECBA 1EXHA 1JPTL 1GAFH 1V7NH 2XN9A 1PVHA 3DOSB 4LR4A 1IQDB 1L3NA 3U2SA 3QBQA 1WFUA 3KYOB 4KK5C 1X9UA 3HZ3A 4RMSA 4UI2A 4WKZB 2GI7A 4J39A 3CFEB 5LJYH 1W3VA 1I85C 4O65A 3WFEL 1B4TA 2GAUA 2EDQA 3LEYH 2VR4A 5AVXB 2XWJB 1IAIH 1KZQA 4HH9B 2MCAA 1G86A 3L17A 3T1FA 3N9PA 4E2QA 3SQBB 4M3CA 1KDJA 2R0LL 3FPXA 1VADA 1KPVA 3GM8A 1D5ZA 2YN3A 2X4NA 1TQCB 2WQSA 3ESNA 3GB7B 4OD1L 4I0AA 3BSZH 3QNYA 3VBSC 9CGTA 2CQVA 2W07A 1XE7A 4A2LA 3OLGA 4OCRH 3KGLA 5DDJ1 3QI9B 2Z8RA 3OD4A 2OR9L 3VMOA 1UOKA 2WJ5A 3WJMB 4DSYA 4PM1A 4P5HA 3CQPA 5LBCA 4WCYH 4N2DA 3ZL4H 3FSZA 4XCYA 1PKQB 1ZBE3 4HLTA 4MCYA 4HX1A 4JPIB 4I4WB 4EN3A 2NY3C 3NSXA 4ZTOL 1MIMH 2J5LC 2NNAB 3VXME 5HHQA 2HUHA 3U46A 5DJCA 3B7SA 4Z7NF 2OKMA 4Y1AB 1NM9A 1QACA 1U95B 5C0DA 1TVHA 3U9UB 4NR1A 4N1HB 1B3JA