2ZAHA

X-ray structure of melon necrotic spot virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
296
structure length
296
Chain Sequence
SVKIVHREFIASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGSTSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAVDRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGSTIKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVTSSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein
publication title X-ray structure of Melon necrotic spot virus
pubmed doi rcsb
molecule tags Virus
total genus 67
structure length 296
sequence length 296
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zahA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zahA01
2RS53 3TN91 4RHV1 1POV1 1QQP2 1AR91 1AYN2 1NOVA 3JB4C 3CJIC 1EAH2 2WZR2 1TME2 1K5MC 2HWF2 1NCRA 5DDJ3 1HXS2 1NCRB 1R093 5ACA2 1QJY2 4QPGA 3VBSA 1F2NA 3VBRC 2WFF1 3VDDA 1RVF3 4CDXA 2R071 1ASJ3 1VAKA 4RR3C 3CJIB 3FBMA 4CDWC 1K5MB 4Q4V1 1PO23 1V9U3 1VBA2 5A32B 1FOD1 1VBB3 2ZZQA 3VBHA 4GMP0 2HWD3 3VBRB 1QJU3 2GH8A 5K0UA 3TN93 2BBVA 2PLV1 1BEV1 1OOPC 4RR3B 1F8VA 1RUE2 4CDWB 4GH4C 1ZBA3 5GKAC 1RUD3 3M8LA 1RHI2 1QQP1 1AYN1 3ZXAC 1HRI3 1AR72 1Z7S2 1OOPB 2WZR1 1TME1 2HWF1 2DF7A 1HXS1 1R1A3 2WFF3 4Q4X2 1PIV1 4N43A 1RUI2 4GH4A 4EJRA 4GMP1 5ACA1 4GH4B 1QJY1 1PO22 1V9U2 5JZGA 5CFDC 2HWD2 1QJU2 1FOD3 1MQTC 4BCUA 3VBFA 4QPIA 5ABJA 1PVC2 2R063 1SMVA 1BBT3 1RUJ1 1VBA1 5A33A 5D8AC 2PLV3 4Q4Y3 1BEV3 1ZBA2 5CFDA 1RUD2 5CFDB 4JGZA 2BUKA 1X33A 1MQTB 1ND3C 1QQP3 5LK7B 3ZFGA 1AYN3 1RUE1 3VBOA 3ZFFA 4CDQC 1R1A2 5D8AA 5D8AB 1RHI1 1EAH3 2WZR3 1TME3 2HWF3 2RR12 1HXS3 5ACA3 5FOJB 1D4M2 1Z7S1 1QJY3 5CFCC 2HWB3 1ND3B 1QJX3 3VBUC 4CDQB 1PO21 1V9U1 3NAPC 2WWSA 1BBT2 2VQ0A 1VBB1 1FMD2 1VBA3 2HWD1 1QJU1 1RUF3 1NY71 1PVC1 5CFCB 1B35C 5BNNC 3VBUB 2HWC2 4AEDC 1ZBA1 1RUD1 1ZBE2 3NAPB 1AL23 1RUE3 1HRI1 2RMU2 2X5IC 1R082 1RHI3 1B35A 1FPN2 1AR73 1COV2 1B35B 2HWB2 4GB32 1H8TC 1R1A1 1QJX2 5BNNB 2GSYA 4AEDB 1Z7S3 5AC93 4IV1C 1VRH3 4RFT0 2RR11 3IDEA 3CJIA 4Q4X3 1RUH2 4N53C 3J8F2 1RUI3 1K5MA 1PGL2 4Y4YA 1D4M1 1PGW2 1HRV3 1AR83 5A32A 2FZ2A 2X5IB 3HAGA 1RUF2 3VBRA 2R061 1H8TB 4WM7C 1BBT1 2R043 4Q4Y1 4IV1B 1PVC3 4N53A 4RR3A 2RS12 4N53B 4CDWA 4WM8C 1AL22 2HWE3 4Q4W3 1HX6A 4FSJA 2HWC1 1OPOA 3JD73 2WS93 1ZBE1 4WM7B 1OOPA 1EV13 1EAH1 1HQNA 5AC92 1VRH2 4WM8A 4FTBA 4WM8B 4IV3C 1E57A 2RMU1 3S6PA 2MEV3 2RR13 1HRV2 1AR82 1COV1 2HWB1 4PDWC 1RMU2 1QJX1 1AYM3 4RQPC 4CEYC 5C8CC 1D4M3 4CDUC 4Y5Z0 2RM22 3J8F1 1QJZA 2R042 1PGL1 1ND2C 1PGW1 4IV3B 5L7OC 1WCDJ 2HWE2 4Q4W2 5C4WC 1RUF1 4PDWB 1FMD3 2BFUL 1VBC2 4Z92B 5C8CB 4RQPB 4CEYB 4CDUB 1PO12 1BMV2 3JD72 1MQTA 2WS92 2RS11 1AL21 1VB4A 1EV12 2HWC3 1AUYA 1ND2B 4CEWC 1ZBE3 5L7OB 3DPRC 1MEC2 2BFUS 4JGYC 2MEV2 1AR92 5C4WB 1AR71 1AYM2 2RMU3 1R083 1AL0G 2XBO2 1FPN3 5AC91 1RUG3 1COV3 1ND3A 1VRH1 4GB33 4Q4X1 1AR62 1RUI1 4CDQA 4CEWB 2RS32 3DPRA 1HRV1 1AR81 3DPRB 1RUH3 4YVWC 3J8F3 4JGYA 1A6CA 4JGYB 2RM21 5CFCA 2R041 1RB8G 3VBUA 2HWE1 3NAPA 4Q4W1 2RS13 4YVWB 1GFF2 1VBC1 2TBVA 1C8M3 5C9AC 1PO11 1BMV1 3JD71 2FZ1A 2WS91 1EV11 1NG0A 1RUG2 5BNNA 3JBG3 4AEDA 1MEC1 1VBD3 4QPGC 3VBSC 2ZTNA 2MEV1 5FMOS 3VDDC 5C9AA 1RUC3 5C9AB 1AYM1 4CDXC 1TMF2 2XBO1 2X5IA 1W39A 1AR61 1RMU3 1VBE3 1PIV2 1H8TA 2RM23 2RS31 1DDLA 4LLFA 3VBHC 4IV1A 4QPGB 3VBSB 5J98B 3VDDB 1FMD1 5K0UC 4CDXB 1C8M2 2Y26A 1M06G 1VBC3 1PO13 1RUJ2 4WM7A 2RS52 1C8NA 1CD3G 3JBG2 3VBHB 1VBD2 5K0UB 1MEC3 1RUC2 4RHV3 1POV3 1R081 2BPA2 1AR93 1FPN1 1RUG1 4GB31 4N43C 5DDJ2 2WLPA 1VBE2 2XBO3 5JZGC 1R092 2XPJA 1AR63 1RUH1 1VB2A 1TMF1 2RS33 4IV3A 4NWWA 1RVF2 3VBFC 4QPIC 4YVSC 1ASJ2 5ABJC 2ZAHA 1IHMA 5BNPC 4PDWA 4N43B 5C8CA 4RQPA 4CEYA 2R073 4FTEA 4CDUA 5JZGB 3ZFEC 4JGZC 1VBB2 4Q4V3 1ND2A 1C8M1 5L7OA 1NCQC 4YVSA 3TN92 3VBFB 4QPIB 1NY72 4YVSB 3ZFGC 5BNPA 4RHV2 5ABJB 3VBOC 4RS5C 5C4WA 3ZFFC 5BNPB 3LOBA 5A33B 2RS51 2QQPA 3JBG1 1VBD1 3ZFEA 3ZFEB 4JGZB 1HRI2 3JB8A 1RUC1 1OHFA 4CEWA 1NCQA 1NA1C 1NCQB 5J96B 3ZFGB 4RS5A 1RMU1 4RS5B 5DDJ1 1TMF3 1VBE1 2WFF2 3VBOB 3ZFFB 1POV0 1R091 2R072 5BNOC 1PIV3 4GMP3 4Q4V2 1RVF1 1ASJ1 4NWVA 1NA1A 1X36A 1FOD2 1NA1B 4YVWA 2R062 5FMOL 2IZWA 4SBVA 5BNOA 2PLV2 4Q4Y2 4FTSA 1BEV2 1CJDA 5BNOB 1NCRC 1RUJ3
chains in the Genus database with same CATH superfamily
1D3CA 3LKRB 4JRFA 4LUMA 4J1UA 3KCCA 3LKOA 3FT9A 1JGVL 1IT9L 5HTSA 1UG9A 5AOLA 1CQYA 5CGMA 1ZT1B 3BPNC 2ZKHL 2FQDA 5DCCA 2WZ8A 4PJBB 3U83A 3HUJF 2H32A 2WBXA 3R8BB 1IMHC 5FPVA 1DBJH 4X50A 4M6ML 4M29A 5EFIA 1CF1A 5DJAA 1U8CA 4G80B 5KSBA 1LO4L 3EYVB 4XPHL 2VRAA 4ELDA 3I9GL 2G9GA 4QRPE 4BFIB 1QJY2 1Y0LB 3ZT6A 3P4OB 1T6VN 4IGQA 1RJ8A 2XRAH 3BIKA 5J3UA 2LABA 3LPFA 4QX0A 5KYYA 3VDDA 3LEMA 5F6KA 2A9AA 4Y22B 1BK0A 4DO5A 5EFUA 4GP5B 3EBAA 1MN4A 4FAHA 5KSBF 2YQ3A 3A6BH 3BMWA 4RZCA 2ET1A 2VABA 5EO9A 3QEUA 5DD6A 2NY7L 2DQHH 4IOIB 4O9GA 1UCTA 2VDOH 4TRPL 5HPMB 4COVA 3ULVH 4GQ7A 2XT1B 1SPPB 1PEWA 4GB9A 1OAJA 5E8OB 4RX4A 5GJ6A 1XB8A 3EYSL 3QDJD 2GSGA 3D6EA 3UAFA 1WBXA 2WKGA 2A5ZA 4PLOA 5I9QC 2X4SA 5FZAA 5KVGE 3KGRA 5JXAL 3AVEA 5KZCD 4EDXA 3KLAB 3RFRA 1MJ7H 2RHPA 4BINA 2B5HA 5BCAA 1QQP1 2DV9A 1XSKA 3DV4B 3O3BB 4CVXA 3M1HA 1NCGA 1BIIB 5GGUB 3LRSB 1PLAA 3GGWA 1X9PA 1IC5H 1YEGH 2NW3B 5IWLC 3BSZA 3V64A 3V0IA 1J8HA 1CXLA 5DZ9A 1UOKA 1XF5A 3KPSA 3KL3A 1A1MB 4F3FA 2WZR1 4GSQA 1LOGA 3NAAL 2DOCA 4PJ9B 3U6RA 3HEIA 5DUWA 3VXUA 5D7SL 3BO8A 3L3DB 1S0EA 4LITA 5JORB 4NJAH 3KPNB 4AYMC 4PJ6A 1GZQB 4PRHE 4MOAA 3GJAA 1DBAL 1FFRA 4EMZA 5LRRA 2VN6A 2KC0A 4KZCA 3ZYRA 2RCSH 1NLDL 4GSXA 3RY6A 5A6IA 1IAMA 1QJU2 4YHZH 2WOBA 3KPRA 1X5AA 2DWEB 5D55A 5ES4B 5GS1A 2HBUA 2K46A 4UMSA 1QWUA 1XNTA 2FEEL 1T6GC 2OA9A 4K7PH 3RVXC 4JM4L 4RISH 4N26A 3OG6B 4A2FA 1E8XA 4J3OG 3S0PA 3ZVVA 1ZVHA 4ANVA 4FQXC 1AQDA 5ISZB 1DQVA 2Y1ZA 1CG9B 5DEGA 4GRWH 4C0BA 1G43A 2B59B 4U3CA 4GALA 4AI7A 1E40A 4PUBL 5E2TH 5E2UH 4OLXH 3HRZB 4P4RB 3ESUF 5D8AA 2C1OB 3T2PA 3TT3L 5EU7E 2AI0H 3R4DA 2LLLA 4N87A 1HDMA 3DVGB 2ZOWA 1JXKA 2XA8H 4JY5L 1OZUA 2KS0A 4FI6A 4OQTL 1P53A 1DVSA 3LKPB 4WSJA 5EDSA 1FL5B 2PPAA 4N6RA 1QJFA 3MXWL 4WO4B 4RBPK 1XQNA 4QQPA 1N6QL 3GYDA 4OLEA 4FHJA 4NPMA 4HUUA 5HVHC 3GF6A 3VBUC 1XGRB 5TK2A 1PZ2A 3EJSA 5LXVA 4DEPC 3QT2A 3O2WH 3NTCL 4JGUA 3HAEA 2DQTL 4LHLA 4Z7VA 5DQDL 3QAZC 3I75A 3RWNA 3OBAA 3I50H 2WBJD 3MNMA 2HLAB 3K2KA 3FTVA 1IM3B 1RHFA 3FO0H 2P8MA 4N0UE 1R0AH 4C56A 1F00I 1XGUB 3TBWB 3UL4A 1W9WA 2W1QA 4JR9H 4PCKA 3Q2WA 3HBZA 3QE5A 4Z7VF 4LBNA 5IAVA 3MNDA 5HGAB 4JUTA 3VHRA 3IN9A 4EBQL 4L0PB 1L9QA 3EJUA 5C0JA 4P2OB 5FUOL 5JPNA 3T3PB 3VH8B 4HBNA 3FB7A 4JO1L 3ZE2E 2NUPB 4NZTL 4LBJA 4ZAKD 2HJKA 1JFQH 5K1VA 5E1RA 3DUHA 1UJ3B 2ZX5A 5DK0A 3VRJB 5IMMB 3G7DA 2Q7YA 1ZXQA 5B8CA 3CO2A 3NNJA 2JELL 4NC1C 3KQRA 4PLJC 2WNVC 2ZWYA 4MD5A 3VGFA 3GXUA 4OIAA 5JCTA 3D50A 1B6DA 3C09C 1X9UA 4MASA 4BH7B 4N53C 3A6OA 3GHPA 1CD1B 1PGL2 2G0KA 1AIFA 4NHXA 3RZCC 4LU5L 4PJHB 3HQXA 3DO4A 3ZDXB 4YEFA 1OL0A 4M1GH 4U6HB 2Y5QA 3LQAC 5I73B 3JUZA 4HH9A 2CDPA 2OM5A 3MV7E 4BFGA 4H8UA 5BV7B 3JTSA 2DQIL 4DUVA 4XO3A 1B9KA 1AKPA 3QUXC 4UYQA 3IDXH 4F7EB 4ZJ9A 1V6IA 1AL22 3ULVF 1IE5A 4LORA 2B7DT 2C1PA 2B39A 2HEWF 1YY9C 3R0NA 5GS2D 4P4KC 2X29A 3CZSA 5HYSG 3ME0B 3ULUE 1WMFA 4JJ5A 2GDFA 5FF6A 3POHA 3OKMA 3QA3A 2B7YA 2OJEB 1G1OA 5T1LB 2YGPA 1SN2A 2PCXA 3LZNA 3QWRD 2ZP0T 2YLKA 2J5WA 4U6YB 3HHSB 2P37A 2W46A 3HPJA 3NKGA 4NVPA 3KHOA 3U9UB 2JKBA 2OSLB 3S5ZA 4RSVA 4P3DA 1T22B 5LCVL 4F8AA 4JFQA 2IJ0C 3T65A 3S6PA 2XVLA 2Q76B 3QQ3B 1KN4L 1T6WA 3WF4A 4JN2B 5C0BD 1KN2H 5HHVH 3JYBA 4LSUH 5E5UB 4YVNA 3PJLA 2RM22 1FDLL 1LOAA 4FOYA 2ADJA 3UGHA 4OZ4A 5JTWA 5MI0B 2HKXA 1LEKB 1GGUA 4PJ5A 1ND2C 5IBUG 3ENRA 3ASWA 1K8IB 4LNVA 1IGJB 1EWHA 5E1IA 3U7WL 4P57B 1OT4A 1Q8SA 3ZXDA 1HWWA 1XSIA 2D9QB 1YNTB 1UWGL 2D0FA 2XWTA 2P26A 4X4ME 4URKA 2WYSA 4RD7A 3KWUA 4ZQTA 4R8HA 2Q8EA 4XJZA 1UKSA 2EDNA 3WCRA 3W56A 1VBC2 5JA9A 4FKEA 4R96A 1SM3L 2EUWA 2OMXA 5HI4D 2BW8A 3VWKB 1R5IB 4EOWL 4GULA 2FL5B 2LRPA 4HKOA 3IFPB 4QY8B 5H35B 3FCUB 1D5XA 4OM1L 2OT7A 4I0WB 4J1WA 4WZFA 3HZVA 1WRFA 3OB0H 1AR1C 4NQQA 1KG0B 1D2SA 4CEWC 2C9QA 3SDYL 3SDAA 2A1WL 3WEXB 4ZFGH 2WO2A 3ZPYA 4GRWF 4EIGB 1I7TA 2G0LA 1RAMA 4XBGB 2E47A 1MR5A 1N64H 2XOMA 5C4WB 4V1PA 2OR8A 5EWSA 4PU2A 3X1NA 2PCYA 1F3DJ 1XFPA 2BRRH 2OCJA 3CC1A 5FOJA 1BG1A 1AL0G 4Y2DA 3DHJA 2WZEA 1SEQH 1AGDA 1AHWC 2O5YH 3DDGA 1RHHA 1H2LA 2IDTA 3IKCA 4Q4X1 3TYGH 1U8IA 5DJXB 1CFNB 4QRRB 3HB3D 2MPAH 3LPOA 4GKSA 3HG3A 1KFXL 4DAGH 3QCTH 4PJEE 2YFNA 3AB0A 2K70A 4HKBA 2DBLL 3EAKA 1SHXA 1UOJA 5G4MA 4PJ8A 3PL0A 1WA6X 1WTGT 3K6OA 3G5WA 4TLKA 3O4OB 1KXQE 4XDOA 4M7KL 1KV7A 4KKAD 3T6VA 4NZJA 4FQCL 3U6XA 1O5LA 4YG3A 4OF0A 1HN1A 4PV1C 4UT6A 3VE0B 1VKXA 4FFFA 1C16A 3TBSB 2ITFA 5I16B 3REWA 1F97A 4NZUH 2IXJA 4LRIC 3I59A 1G7HA 4CU8A 3FFCB 2C7FA 5HBAA 1ZM1A 1DANU 3US9A 2DJMA 2D3RA 3WG3A 3QH3A 3TIEB 4AGNA 4CN6A 2B5IB 1D5MB 4MA8L 5KAQG 1BMV1 1EA9C 3OKEB 3QPQD 3CH1A 1E4WL 5DZLA 1CAWB 4GFXA 3VDCA 4OB5H 1IVLA 4PWGA 4XVJL 3ZTJH 2V72A 2CUHA 1VBD3 3CVDA 2ZG2A 4QB1A 1B9ZA 3ZT7A 3F95A 3MR9A 1V27A 3H2PA 3MPBA 4K1ZA 3V4UH 1BAGA 4JTNA 4FNSA 2WXJA 1SFDA 3B34A 3E6CC 3QRLA 1OKEA 1C5DB 2CGRH 1NFAA 2BVQB 3MLYH 4X0NA 5TE4H 4KOCA 1UQXA 2ZF9A 5GS0D 4TOYH 2NXYC 5LY2A 1KLUA 3IF1B 1ZGLA 3QUZA 2VR5A 3VXMD 2W52A 4K9EL 3TBTB 3DSFH 1T7YA 3EGXB 2P47B 3MBEA 3ZKYA 2A6WA 1T2QL 3SJVA 5FUZL 3G6AA 4HS8L 3SNMA 2Q4SA 2H0EA 4NQCB 3X3FL 4YO0B 3NMBA 4Z6AT 4BOWA 1NUGA 4JRWA 4XNYL 5KOVC 2HTKD 3UOAB 4F2FA 5HGHB 3WSOA 3DX3A 5EA0H 4HQQL 2Z92A 2CDFB 2HFFA 3DX7A 4K71C 5CZXC 4MA1C 3IIIA 2IEPA 5FO9B 3A0KA 3ZKUA 3KYNA 2ZXBA 5KG9B 4WJ5B 3U14A 4WM7A 3DJRA 4PWJA 5I6KA 3O2DA 1EEZB 1QHQA 1S9WB 5FJHA 2MNWA 2Q7AA 1DQJA 2HX9A 4R97B 4OZFH 5K0UB 2VZ1A 2ARWA 4DP5X 3IRZA 4HN1A 5KHGA 4S1SH 4K8RH 3QR1A 3F12A 5FPAA 4K94L 1CICA 5GGRA 5DQ9A 3LXAA 43CAB 1LULA 3F7LA 4DIXA 3N9PA 3ZXGA 2VW4A 3DYOA 5DTFA 2X1WL 1E4XL 4Y1AD 5DA0B 2Y07L 4A68A 4ZFOB 2CK0H 3ARRA 3D2UA 4JK0D 1QQDB 1DVXA 5DRXA 1S9VA 3L5WB 1UYPA 4UB0L 1OQ1A 2RS33 3L54A 3DWTA 3PWVB 2Q6WA 4D0DB 5DJ0B 3BQUC 3M17A 3ARZA 3V7AG 2DYPD 4NC1E 1WPCA 2GNMA 4FC3E 3AABA 4KZ0A 1XX9C 5IHZA 4Y89A 3TV8A 3MI8A 1MHEA 3ZTNL 5E16A 4O00A 1MJ8H 1QTSA 3FJTA 5J06A 4JC1A 4LBMA 1JPGA 1OAQH 1U33A 2NZ1A 5IB4B 5FZDA 4WV1A 2VCMA 2N7AA 5C08D 2G75A 3B7TA 5T1KB 3KF3A 4UFIA 2X4TB 3FLTA 3TYFB 2Z69A 1OWRM 5LWYH 1EAOA 4UW5A 2JDNA 4KGLA 5T3XL 5KSAA 1IG3A 1X8EA 5BNPA 5FO2A 2G5RA 2XJQA 4RS5C 3VI3E 2D9CA 4CMMA 1SCSA 1JVLA 4LHUG 3FSOA 1Z2KA 4FI9A 5FYTA 4DGWC 3WDXA 1URXA 2H6CA 3SEPA 2JKTM 5T33L 5ID1A 1ZKAA 4G82A 3ZFEB 3DSNB 3FTGB 1RZ8B 1ZHKA 3VJ6B 3QDGB 3HWJA 3MRCA 3PWJB 1NPNA 3OAYK 5EG6C 1P7KA 5FYKH 3FJSA 3WKQA 4IEWA 3ZYFA 5EEYA 1AYRA 1A6VH 2CU9A 4AJYV 4E0RB 1KCUH 1NMCC 3ZFFB 5FK9B 2Z34A 4AFAA 2ZA9A 2ZHLA 3Q6FA 4NNPL 4F2EA 4NQSA 4DFIA 4LCIH 2GY7B 2FK9A 1NZIA 2VDNB 1NUFA 3QJQB 3S36L 4I1RA 1WFIA 1HINH 5DJ6B 4YAQA 3RJQB 3I6LE 5F7DA 1PMHX 4LBQA 4HT1T 3AQDA 5IVXE 3HG0A 4CSPA 1IQWL 3B3IB 4D6QA 3ML8A 2BNUB 3L3JA 5BZZA 2BSRB 4AQAA 4QRTB 5E51A 3V4PL 1W3VA 3BPCA 2Y60A 5IQ9B 1BJ1J 1HXYA 4SBVA 5FY0A 3BCWA 1PPIA 2VG9A 4U49A 2F0CA 2QQKA 3L9EA 5A6ZA 2UY6A 2J1YA 1R1CA 2UZPA 3FQRB 4AQ6A 2E27L 3KYMB 4JEGB 4NHUB 3TFKC 2BERA 2XTJC 2OZ4H 5GM0A 4P5TA 3O6KL 4NKOB 4DXTA 3T4VA 3T0EB 2Y7SA 5ITFB 2WWOA 1EZUA 1QKZH 3W9EA 1LESA 1SEFA 4RWHA 4U31A 1VP6A 5HHQA 4NO0B 4V2VA 2MNJB 4FXGA 3CHSA 4N90E 2H26B 3CJIC 4XHBA 4K23L 4XVSL 1DQ4A 5FYKU 4ZOAA 3ARFC 4HLTA 5DDJ3 3CD4A 4PJ7B 4C4KO 2EH7H 1CGTA 2OMWB 2EUXA 2BQPA 2D6MA 1RJZB 2HRGA 4ZW8A 4A7VA 1YZZA 2FHCA 1TEYA 4NN6C 1FSKC 5FP9A 1K5NA 1KGYA 3QWRA 5D7IA 5DD1L 1YNKH 2N1KA 4JZJA 4Y4FA 2BNMA 1I9RH 4NWUL 5HHOB 1ASJ3 1D2PA 1XSQA 4L11A 3TVMA 5D1XA 4AQOA 4YSTA 5E89A 2CLRB 4B9FA 4L99A 2VR6A 3FUIA 1KXVC 1XL6A 1Y18A 1LEGA 3KH3A 1OVPA 4XZPA 4Y24A 3WKYA 1PZAA 2KLTA 3T8XB 3APFA 2EXJA 3NIFF 1J1PH 4KKBD 5D7IF 2J7MA 4LSVL 1KV3A 4OZFA 5BQ7A 4UAPA 2HWD3 3S5AA 5FFGA 3P3RA 4BUHA 2DIAA 2CXGA 3C8XA 4P04A 3I2FA 4DZ8A 4KO5A 4KBBA 2XR4A 2EEXA 5J1SC 5BUGA 4ZUWA 3DVNA 3SGJC 1J12A 3MBXL 4I0PD 1X4XA 2R7EA 1H0DB 4IOSD 4GUOA 4QXCA 1XHHA 4Y16C 2IWKA 1CDYA 1CR9H 3T2NH 2GJ6D 2YXSA 1IAII 5F7NC 5D7JB 2CDEB 3DVFA 4K0OA 1F4YH 2UX6A 4DP6X 1GBGA 4L37B 5BUVA 4PJFB 1J0JA 2XZQL 4AIZA 4FO9A 2ZJSL 1DCSA 2MIZA 2YXWA 3VFNA 2E7TA 4HF5L 5LNEA 1MFVA 3QUKB 4OV6F 4HEMA 1Y7BA 2YU1A 4Q29A 1JZHA 1KFAL 3V52H 3MDPA 1KT2B 3IFOB 4IBLT 3SDCB 3UGXA 5ICUA 2F1EA 4HJUA 2BP0B 3VZNA 2ERJC 1SLAA 3L1FA 4RFEB 2FJUB 1BOGB 3I6GB 5FDYA 4HUMB 1W6QA 1Y9MA 1H6FA 1SBSL 2J8UB 1HHKA 3QXUA 1UHVA 3BKYL 1PIFA 2G4EA 4ODUA 3QNYA 1UWEL 1K3IA 1SMVA 4EZLA 1LHUA 4ZX3A 5FJKA 2P43B 4FP2A 1G84A 1DU3D 2NY2C 4FEMA 2D31A 3UCRA 4Z3FA 1DDHB 2ZIDA 3T1FA 2WNEA 3QI9B 4RIRB 5TQ2H 1SNRA 1P69B 5DHEA 2YSTA 3CN1A 2WC7A 5JNYA 3B8YA 4JHUA 5CZVH 3U0TA 4YZ5A 4NSKB 3RWJA 2IQ9L 4NN0A 3ZFGA 3IT8A 1EDQA 1IC7H 1GC1H 2WIIA 1T0OA 4F7PB 3BEWB 4OU3A 2OBGA 3MOBH 3UYRL 4E4SA 5JZ7D 1QA9A 2WPGA 1FGVL 2J71A 1RZIB 2ZOLA 3LQMA 4NP9A 3WFDH 1WGPA 1E43A 1ENXA 2A74C 2GC7C 3QDMA 1VIWB 5J36A 3GC3A 1PX4A 5CSZB 1IGCL 3HG1B 2NN8A 3CFJA 3JWDH 1G7JB 5INCA 4GWNA 1CZTA 2VNRA 3BGFC 1IRAY 5CCGE 2J42A 3M1CA 3DGTA 2X53S 5FM5M 2F58H 3FAXA 3PYCA 1AO7A 3CXHK 4E68A 5KXBA 2XNAA 3OZ9H 1A2YB 3PRZA 3QW9A 4KRPC 4PJXA 4W9IC 3WDIA 1PD1A 5DFVC 1FRGL 3MOAL 4MB4A 1D5BA 1U2CA 4KY2A 2H41A 3U37A 1NEPA 4UANA 1MNUL 4QXBA 1N4XH 1QSFD 4AC2A 1KACB 2J56A 1LNUA 4LSPH 2AEPL 5IMLA 2NY3D 1DHKA 1XOYA 3VMNA 3DIFA 1I8LA 1VGKA 3APDA 4Q56A 4PY7B 4HKLA 3LZFH 3FO2B 1KTDA 5E8DL 4FBFA 4PJXF 5M94B 2YN5A 4JPVL 2HT3C 1NKOA 1O7DC 4KY1L 4Z7IA 5I1JH 5LNGA 1S7XA 3UJTL 1RUD1 1I7ZA 4AF9A 4OZGA 1RUE3 2ZNXA 1G7QA 4FMVA 1QWHA 3R18A 4FYTA 1S9YA 4G9FD 1KUMA 3OMAB 5KS9A 4JPIA 1GSKA 1F90L 1TQBC 3IAQA 3JV5A 1QBLH 4MRCA 4BSVB 2VOWA 3K3QA 5C0AE 3WFEL 1PL3A 1I9RA 2VNCA 4NQDB 4XQDA 2ZWZA 4HIXH 4LEJA 1YEDB 4J4PD 2ZX6A 2G3MA 1BYPA 4OZGF 4WU7A 3WSQH 4RFT0 1UQSA 3TZVD 2FYYB 1HNYA 1RUAL 1LDPH 5K9KA 3AT0A 3EYQC 1FG2A 4I18C 5GRXG 4B97A 5KS9F 4K7PX 4Z7OB 1E9PA 2EYSB 2V17H 1KEGL 1MW0A 1WQVT 2D8KA 1HRV3 1EZSA 3PABB 3P3TA 4Y4KC 2DFCA 2X5IB 4Z7QE 1B4JH 5G04L 1P4BH 5FV3A 3IWVA 3DARA 4XWGL 1RUF2 3LEXA 3SQOH 1U6AH 4Z7WE 4ZMVA 1UZVA 3V0AA 4NPKA 3MQIA 5CWSA 1F0LA 2IOOA 2D7MA 3CZFB 4E2GA 4TZDA 2JG8C 1COBA 5I6OA 2PHUA 4ZUTB 4PCSA 4K3EL 5DMIH 3SQBA 2PHTA 4ATEA 4FP8L 2JCCE 4FSJA 4NAQA 2I60L 1HIMH 5L6YH 2VO8A 4RGNB 3TV3H 2CBPA 2K6YA 5J1TC 2MHFA 2GC1A 4ASMB 4COZA 2I24N 3IDBB 1YO8A 2HWC1 3ON7A 3JD73 1DEEA 3GQFA 4AXWB 3ZU8A 3U7YH 1ULDA 4X6EA 2D43A 4PBPA 3BVXA 1ZBE1 5IVZB 1CF8H 3GT6A 1F56A 2X6MA 3GHBL 4MYWB 3UPCA 1BW8A 4QHUA 1IAIM 1LYQA 1PZ3A 3IK2A 2KR2A 2BH0A 2WSKA 2D5FA 2DIEA 2XCMC 4KJQC 1IBBA 3NJIA 4P9ML 4P5YA 1G7MB 4G6JH 2O61A 3ZHFA 4GUPB 5IQOA 1GGIL 2AEYA 1T5XB 2WINA 4FYQA 4X9FA 1QXPA 3GMOB 4G43B 5LCWL 2B1AH 1EAPB 2LFEA 4ZPVB 4BQ4A 1BZWA 4LO6B 1SGKA 3OAUL 2J57A 1N59A 4XQ4A 1OLQA 4JPQA 4LLQB 2QVMA 1QJZA 4J27A 4L92A 3FB6A 1L9SA 4F5CA 1MPAH 3PIJA 2DQFA 5L8JB 3IGAB 4YE4H 5FOBA 4IBUA 1HQRB 1GZWB 4JTOA 4R9CA 4MD4B 3OD0A 1FZMA 4IDJH 2AR6A 3UNPA 1GW0A 4GQRA 4P3CL 2DKUA 2DN7A 2BFUL 4AI0A 4EIUA 5AKSA 4YLCA 4YBQC 1H8LA 4KUCF 3ZHDA 3O8XA 1G7LA 5D8JL 3HFFA 5ICZB 3DEMA 4CCCA 1EV12 2XPZA 1AUYA 3LV3B 2MTAA 4KZDL 4ZTPL 4RFNB 2ZUUA 1WCKA 2HLEA 2YMOA 4JGYC 3CVIH 4GQQA 4JFDD 1YEJL 3VI4E 4U1IA 2AEQL 2YPKB 5KVDH 5J09A 1SZBA 1A7RL 1H6UA 2BVBA 4CILA 3QWNA 4O58L 3BXNB 4DVBB 4K20A 1E4JA 3HRPA 3DXAD 1B4RA 1DCLA 3C5ZB 5LAPA 5F3GA 3CDZB 1CR7A 4W6YB 4GRLA 3VXSA 1QW8A 1SXBA 3KYOB 4P2QE 2RS32 4IDZA 1MEXL 3DPRB 1FVDA 1LGVA 4CA4A 2UUDH 2PYEE 2X38A 3HS0B 3M86A 1AHSA 4L9BA 2GNDA 1CT8A 2CK2A 1ENSA 1T1WA 1MS1A 3T4AA 3QXWA 1ZLUH 4F8QA 1I31A 2OX0A 3ZSEA 3IGFA 3DMMA 1ULFA 1ZLSH 5CFCA 3RHWF 3IXTA 4FPLA 2WGXA 4CXXA 1W0NA 5IGXH 4R90H 4L4TA 4HWBL 1X9LA 2YEZB 1NBYB 1OALA 2AK4E 2XFXA 4Y4HC 4K5NA 2GT9B 3KQ4B 1WSST 1XB3A 2VZUA 3CFQA 3LWCA 1CLZL 2KQNA 2AFNA 4XEZA 1MCQA 3R7QA 3NZ8A 1XGQA 1RYYA 4Y20B 2XI9A 3SO3C 5JPMA 2D3VA 3EJQA 1R3IH 5FW6A 4O2FB 4PJIE 4ZZ8A 5GRUH 1J8KA 4W6XB 1JMXA 3AFKA 5EIYB 1W0YT 3K80A 3OC5A 3T8MA 5CEXA 2F54D 2ZKLA 4BPZA 4UFJA 3DX6B 2GY5A 4J1UB 3DUUA 3LKOB 1EY2A 2Q30A 1OE2A 1RP9A 4YZ1A 2E4TA 1UKRA 4M7JL 1BXVA 2C4FT 3KMDA 3WG2A 4NJ9L 1XGYH 1FPTH 2H32B 4O65A 4R7NA 1OCOB 2HBTA 5EFIB 3C6EA 3Q44A 1KGCD 5DJAB 3V0VA 3VG0H 1U8CB 5KSBB 4BFJA 3QUYA 4UIMA 3WDUA 1I1AA 2XN9E 1A6UH 1S4CA 2D44A 4YDIH 4HWEH 1HL9A 1D9KD 2VR8A 4XMZA 5TF1L 3BIKB 1BIHA 2ET7A 5KYYB 3VDDB 2IAND 3S96A 1AJOA 5J1XA 1UA6H 1CFQB 3DX9A 3JVFC 1XE8A 4RZCB 3K2OA 1SLTA 3NZSA 5EO9B 1OM9A 4XI5C 1NQDA 3QEUB 5DD6B 3AKQA 3L48A 3GS0A 5CJQL 4ZS2A 1CLOL 1IC0A 2YS4A 2CU5A 2YGOA 5BZXA 1BD2E 4QD2E 3WFCH 2Q8AH 4BK5C 1UB5A 3R4RA 5FAAA 1N3OA 2GSGB 1W9YA 4MJHA 2VXQL 4HCRA 5EZIH 3SGKA 2X4SB 5ERWA 3DPDA 5K39A 3Q8AA 2ODIA 4H44C 5DDJ2 4EDXB 3BPLC 2Z8RA 5CGYC 3MRIB 5KC6A 1KGWA 3U4KA 4DPAX 2D7PA 1NM9A 3JZ7A 3W0WD 2RS12 1CL7H 1SEBB 2N0KA 4I8DA 2H1XA 3GGWB 4IV3A 2Q7NA 3VG9C 3BI9X 1LENA 4NFBA 3U25A 3VBFC 4OI7A 1J8HB 2GBTA 4RWYH 5EUKA 1XF5B 4F3FB 1ASJ2 2O0OA 5GZFA 3G6JA 1CFSA 2R32A 5EP9A 4APQC 1OH3A 3D3VE 3U6RB 2R1XA 3BFOA 3HEIB 4M0HA 3AZZA 4FTEA 4K07A 3BO8B 4UWDA 3P9WB 3FMGL 4KKLC 4IS6A 1P4LA 1P4IL 2BNRE 4NBZB 3QYNA 3KBHE 2OPWA 1AD9B 3LKNA 4Q9RL 1RIVH 2LHAA 2GITA 2WQUA 1C8M1 3BKML 1LR5A 3G6JF 4CYDA 2VD7A 2ZSWA 3VWJA 1V54B 2Y7LA 5GS1B 1JU4A 5T5LA 2C9UA 2V6HA 1S0JA 2ED8A 3ZZLA 3K46A 3VBOC 3GJFH 4YX2H 4IRJD 4KROB 2VUCA 4XXCC 2DVDA 4W9KC 4FQLL 1M56B 3M3IA 3PVOA 4FG6D 5AB9A 1AQDB 4Z5RA 4BCZA 5C0EA 2W8CA 5DVMA 3GTTA 3QIUD 4EKXA 3OHXC 5DEGB 4C4BA 1W06A 4OF7A 2WDBA 1A66A 3T4HB 3MV8E 4Y19B 1M2VA 1UUSA 3SCMD 4KAQH 1CD8A 3EFDH 1P1ZB 4YDJA 5H37H 3UKVA 4XB7A 4ZMLA 4C90A 2ICES 3AXLA 2IVFC 1TVHA 4FTVA 4HUCA 1REFA 4DKEL 3BE1L 1KCSL 4MNHA 3NV1A 3TX4A 2GJPA 3R4DB 3RZLA 3T4YB 3CDGA 3TEZA 1AC6A 3PAZA 3B9KA 1HJFA 5FX3A 1WD4A 3EO6A 4LNRA 4ONGL 2YUWA 3DO3A 4U6XA 2R69A 1J0YA 1UH4A 4N6RB 3KPLB 1M4KA 1CXFA 1NA1B 2KA3A 2K0RA 5D2LA 4HUUB 1JNNL 4JDTH 1GP4A 3GSXA 4ABQA 3PPSA 5FMOL 3H8NA 5A70A 2QPDB 1NCWL 3HAEB 2Q0AA 4LUKA 3D06A 4Z7VB 5BNOB 4MZRA 3ATFA 3H2QA 1HLCA 4N3UA 4AKPA 2WSDA 5F44A 2CBTA 2V5TA 5DUPH 3I75B 2VXUL 5DK3A 3MLPA 2RS53 1QY4A 4X80H 5E9DD 5D2LF 4CC4C 3VFOA 4ELMA 4YARA 5GGVH 4FLHA 3OL2A 4LCWD 3NCMA 1SJHA 1W2TA 3LQAL 3KMHA 2XBDA 3TBYA 2HRLA 3CLWA 4QKBA 4D7YA 1G6RL 5C0JB 2XDVA 3BOPA 5KANI 1CU4L 5JPNB 2CJUH 3FB7B 5AZ2L 4AYEC 4H8WH 1BK1A 1FVEA 1N0XL 2R56H 1GCFA 4ZT1A 4XXDA 1MXDA 3WEOA 2HJKB 2X42A 4HKXA 1D0HA 3BD5A 3RAJL 4YW3A 5F7KC 3VBSA 5DK0B 1F2NA 3J7HA 3QXAA 5B8CB 3CTTA 4Y3OA 1WV7T 5F96H 5TTRA 1JOJA 1IM9D 4D7TA 1FJ1A 3HAEG 3I02A 4HVOA 4MD5B 3GXUB 5DS1A 1NC2D 1NCNA 4XJUA 4LKDA 2CALA 2QTEA 4F37F 1U5YA 5KJRH 3QPKA 4OTXL 5I8OL 1AIFB 5IJDC 1CBVL 3CN3A 5CIRA 5FZ9A 4P14A 4PMFA 3S57A 3E97A 1ZANH 2H47C 3MCKA 2ZXAA 3L3OC 4HMZA 3EYOA 4M5TA 4YSOA 2FH8A 3VXRB 4RL7A 4HH9B 3OPUA 4N2BA 3JTSB 1IV8A 2G9HA 4Q4IA 4LASH 5LBEA 1RUE2 4Z07A 5KUKA 1ES0B 3CG8A 1ZRIA 2ZACA 3MNWB 1J5DA 2C1PB 2VGDA 1ZZ8A 2W88A 5JOEA 3HBQA 3F58L 32C2A 4RGGA 5DXDA 4EQVA 3LZQA 4PRIE 1XF1A 3OKMB 3QA3B 4LK4A 3V0WH 3JV6A 3ATGA 2CH8A 4CSSA 3TJEL 1MCJA 3HMXL 1JTOA 1DQ1A 2BV4A 3GYRA 3FO9A 4MZ3A 3V6OA 3LH2H 4NHLA 3ABMB 3EJZD 3VU2A 3KLKA 2R30A 3HPJB 4JFDA 2OA2A 4H2CA 4KTDH 4U1HA 5F3BA 3LH9A 4P3DB 3PDGA 4JFQB 3T65B 4YEEA 2VNGA 5CFDC 1BZ9A 1LU1A 3UESA 4NROA 1U12A 3VSTA 5CF3A 1VDGA 2DU0A 1YEHH 2E6VA 2BWAA 1Q72L 4UOW1 5IFHL 2ADJB 1U8NA 4KX7A 1FE8H 1YJLA 3KBPA 5KHHA 4KGGA 5ABJA 5JMOA 1GGBL 2AQQA 1BQPA 5KC5A 4B3NA 1OLLA 1KF9B 2ALAA 2D7TH 4R4NC 5LLIC 4WDIB 4I09A 1H8VA 1NAMB 4X7SH 2KLRA 3HI6H 1XXNA 5LB1A 4RN5A 5FZEA 2XWTB 4O4YH 4YM2A 1NBVL 5IQ7H 4GRWB 3KPTA 3ARGD 3GTVA 2B8OT 1JRHI 4J3TA 3ZDYF 1FH5H 2OMXB 2JDKA 1CZ8H 1DZ0A 2JXMA 3IGUA 3VZJA 2WC2A 3M45A 1BBDL 3P77B 1LE9A 1WVZA 3C5SB 5TH2A 3CSPA 1YJDC 4QNPF 1JTPA 3DOHA 3SDAB 4UAOC 2WO2B 1BLNB 1I7TB 1EGJA 4BV1A 1S7VB 2NYZA 2WLYA 3B01A 3GSQA 3L08A 4LSSL 5LNDA 1ZV9A 3KPPA 4X4XA 5IHLB 3L5JA 5FGCB 4N25A 5FUNA 5DZAA 5BO0D 1TQ5A 5FOJB 5KANG 1Z7S1 3W9AA 3UGGA 1JGLL 1OLZA 4WVMB 1AGDB 4JQIH 1CGSL 1RHHB 3IKCB 4R4FH 4ODXA 3AYCA 4CUGA 1QMUA 1FUNA 1F3RB 4GKSB 3WV0A 1BBT2 5DZPA 2VQ0A 4A7UA 4HKBB 4P9HC 3BP6A 4G3YC 2CLZA 3IM0A 1JV5A 4PJ8B 2ZWNA 3ETBJ 4NM4L 4PRNA 4TUKH 5AOIA 1OGAE 3MIDA 4MGZE 3U48A 2WXQA 4MKMA 4K3HA 3IKWA 2OJ1A 1SPDA 2A77H 1B35C 5L4FA 4R4ZA 5BNNC 4ZONA 1CDGA 3TWCL 4RSUA 4P23A 1C16B 1JV2A 2Y2WA 4RGOL 3REWB 2PWFA 4I3GA 3ZBMA 3QNXA 4YXKL 2CM6A 1C8PA 1G7HB 2A1XA 1W80A 2MCPL 4L3CA 5E2VL 3D0VA 3ILNA 4HONA 2J73A 3OLDA 1OAZH 4K9SA 3FSWA 3RDTC 1KB5L 3CH1B 3ZSSA 1GP6A 3UZEA 1US3A 3K3NA 3MGAA 2N56A 2V9RA 4D3WA 3I2OA 4LLYA 3WOGA 5T3XE 1WEJH 3DKQA 2VUYA 4JHZA 3JT0A 1J87A 3QS3A 1DVFC 3MR9B 1MCEA 5F9OH 2NR6A 2W68A 4D0BA 1HKFA 4N2HA 5I18H 3S7IA 3VYPA 2X4PB 4XYXA 1PGW2 1QPPA 2WWJA 1WCUA 5KZCB 1MWAA 1YEEL 4PR5A 5EJZB 5CEZE 4UI2A 5FXCH 1KLUB 4YHLH 1ZGLB 3QUZB 3C87A 3BI3A 1XH0A 3FKUS 1NKGA 3VRIA 1A3LH 3VFUB 4CDHA 4AVSA 3GMLB 2LLNA 4HETA 3MBEB 4NN5B 4YZFE 3LY6A 4FNQA 5IW3A 3SJVB 3VD3A 3U0WH 5DMKA 2BIMA 3G6AB 3X3GL 5IJCC 4XBEL 4EN3C 2O8OA 3GZEA 4NHMA 4PCRA 4JPKL 5A43C 5SWSE 3SMHA 1E2WA 2WVSA 1Y6NR 4UBDC 3FZ3A 4XDQA 4S10A 4U0RB 2F8OA 4JFHD 3UBXA 2A3WA 1JGVH 1IT9H 1QP1A 3HBKA 3RY5A 2HP4A 2Z31C 5JHLL 3DX7B 3ECWA 2A9ML 1PJWA 2ZKHH 4Z7UF 4WEUD 3KYNB 4OHYA 2JLLA 1ZVFA 4WM7B 5F5IA 1ERNA 1MNNA 4M6MH 5GLZA 4CPBA 5LEKA 3ESPA 3P3YA 1W0VA 1KCRL 2XKOA 4PJCB 2HMIC 1DQJB 1LO4H 3VW3L 1LGNA 2ITDB 2XKSA 3HR5B 1TIUA 2K2SA 5M0TA 3WNMA 3OB0K 4HLJA 2VLRA 5GGRB 5DQ9B 4PDWC 3ZKXB 1OMIA 2PETA 1Y9GA 4KX9A 1X8MA 1OURA 1UOFA 3UAJD 3LDBA 4XC3L 4NHYA 3VGDA 1V3LA 5DTFB 5GQBA 4J25A 5IVVA 2DF3A 1NGPL 3D2UB 5JSPA 5DRXB 1S9VB 3BT0A 5CKAA 1XNBA 2NY7H 4ALAC 1HXMA 2Q6WB 4HT1L 4HOWA 4HK0A 4K73A 4TRPH 5D5ME 3M17B 1OC1A 3OF1A 3PNAA 3O9WD 5C0CE 1E7UA 5IHZB 4UMGA 3IJ9A 3C2AL 3EYSH 1U5IA 3AFGA 3TLRA 1MHEB 1WHPA 5F70A 2QLYA 1OM3H 4MFHA 3NFNA 1JPGB 1F9KA 1UN1A 1U95A 2BY0A 4GBXD 4WV1B 1LK3L 3KLDA 5JXAH 4GXUM 1GHFL 3ZL4L 1OP5H 3V7MA 4DMIA 5K7PA 5E08L 2E9BA 2PO6D 3D5OF 5CILL 2YBSA 2J1EA 3D0SA 3EB7A 2Y23A 3DRQA 3MACL 4O51A 4OJDH 3K5SA 4GWJA 3GIVA 1BA9A 4CMMB 5E56A 4FFWC 1BAWA 2Y0SA 2Q3ZA 2IH3B 2ZONA 4JQIA 4LAJH 3RWCB 3WN5A 2V73A 3GJBA 3NAAH 3LN5A 1ZHKB 1AXTL 3MLZL 1Q94A 5D7SH 1TTBA 1A14L 3PQYD 4P02B 1BQUA 3GBLA 5E24E 1P7KB 2EADA 5AAMA 1S78D 3EIFA 2N3JA 5TD4A 4UZSA 4YVWC 1DBAH 3H1YA 3V2AR 4EIBA 1OKOA 2E75C 4JFEE 4QO1A 4PRPD 1NLDH 4JDVA 4WTWA 2YQ2A 1WD8A 1KENL 3QJFA 1G9MC 4IGBC 2XQ0A 1ASOA 3DETD 3Q6FB 1ZHLB 4JO8A 2VW0A 4NQSB 1O5PA 3CMGA 4HXBL 2CGZA 1JPFA 2X41A 3N0PB 4ZAKB 1AH1A 3OYWA 5AOMA 5JAXA 5A7EA 5AW6B 5IW1A 1PG7L 1JK9A 2R0ZL 3TEYA 4LBQB 5F7DB 4JM4H 5TGBA 4L9LC 4H7LA 4NQTA 2ZX9A 1CQKA 3U2IA 4B9JA 1UM6L 3HLAA 1MRDL 2VLKE 2Y64A 3D48R 3L3JB 3QUHA 4AQAB 1A7NL 1IBGL 4X5XA 3IXAA 3S37L 4YW5A 4N0YL 3E8VA 2H1LM 3BPCB 4KK9C 3QJSB 1QSEA 1A4JA 4AQ1B 2HEYF 2DMKA 4MQ7A 4M00A 4PUBH 1F4XL 5BV7L 1ODNA 2DTWA 3ACGA 4HC1A 2UY6B 2WLQA 4P2YA 4B9KC 4TSCL 3AAZA 4Y9GA 3TT3H 4P5TB 5DMGC 4HZFA 1Z9PA 1E3ZA 4MV2A 1GMEA 2EXWD 4JY5H 3AU1A 5FMOS 4OQTH 3KYAA 1UEYA 2BRTA 1T83C 3N85L 2BZCA 2F9BT 3W9EB 4YS4A 3R0RA 3NP4A 1U8PB 4GIAA 5HHQB 5KYXA 5T52A 4DCQA 3MXWH 2XWRA 4FXGB 3CN4A 5GHWL 1N6QH 2EDKA 2ADIA 3HPLA 1E42A 5C09D 4LDCA 5BS0E 4WWPA 2L7UA 3NTCH 3PAVA 2DQTH 3C7FA 3DROA 5DQDH 3VBHC 5FHAL 2VVFA 5BV6A 3TNNA 1HSAA 1K5NB 1JHKL 3NIFB 2D3JA 4OZHB 4PWEA 4PP2A 5CINL 4Y4FB 4JZJB 4FI8A 5D7IB 4UNVA 1ZREA 4FQJL 1NFDE 1XAUA 3BGAA 2IQAA 4JQVA 3TVMB 3VLBB 5IFPA 2VOTA 4GQZA 3UTSA 4XAKD 1IZKA 4DK6A 2I2SA 2ICWA 4B60A 4ZZ5A 3ZTJG 4EEEA 1Y18B 1LEGB 2CM5A 4AGLA 4YSRA 4GJYA 2UXFA 1FHNA 3WP6A 4EBQH 2ESVE 2RS52 1C8NA 4ITCA 1E4HA 5CGTA 5FUOH 4OHXA 1QBBA 5C7ZA 2Q2LA 3TPKA 4OZFB 4DEWA 5BQ7B 4JO1H 4YDLB 4NZTH 3OJMB 4DZ8B 1M3IA 1HEHC 1LHZA 2H7WA 3QIWD 2PXJA 3MEPA 1SHWB 3CFDA 1VMFA 1DE4B 4ZUWB 5IHWA 4R2GD 3QDHA 3K6SA 2XBO3 3WD5A 1FYTE 4UQ3B 3TJHC 3B7SA 3R05A 4QYOA 2FATL 2D6LX 5J13C 4JFSA 1FATA 3O0WA 4AIZB 4WEBL 3VFNB 1H2NA 1QI4A 2LE9A 2HYMA 4I2XB 5GLWA 1U8MA 3TO4A 2IV9A 1U42A 3MRBA 1N5AA 4HZLA 5I8SA 2R073 2P80A 1Q8MA 1EJ6A 3B56A 2DQIH 4BGDA 1DBKH 1WS8A 1LOEA 4PRBB 3RUGE 1Y1UA 4GS7C 1HWGB 3POFA 3AM8A 3P3PA 1CDUA 4OZFG 5FLVA 3VXNA 2VL5A 2K45A 1LO3L 1GA2A 1WF5A 3C8KA 2ENQA 4I85A 1ZSDA 1DFQA 2DCYA 2YD2A 1HZHL 4WFHD 1HHKB 4TVSa 1YEFL 5MEPA 1TYRA 5HGBA 5IEKA 4ODUB 2WBKA 3QNYB 3RGVA 1NEZA 5KVFL 5L2JA 4I48A 3AZWA 2BNQA 4IOFC 2OL3L 2W92A 1TSHA 3ARTA 3VV1A 4FG4A 2D31B 1VBD1 5CHNA 5C1MB 5HGGS 3H3ZA 4NO3B 3LA2A 2E76C 1MI5E 2JJSA 3T1FB 4P9GA 1Z9MA 1ZRUA 5DPNA 1BYOA 4I87A 5LCVH 1YPZE 3VKOA 2COVD 4XUNA 3U0TB 4XP4L 1KN4H 2QGEA 2UYAA 4X0KA 4AAXA 5I1KL 2JVUA 3ZFGB 2YD3A 3IDJA 5IVEA 2HKFL 3GD1C 3F6JA 2WIIB 3SH4A 3PWLA 3BT2L 1FDLH 4JO2L 4ZTEA 4X6CA 2WT2A 5FYLE 5DRWA 3BUBA 3N40F 4CU6A 2EVXA 2YC1A 3B9IA 2IXHA 2FO8A 3IPBA 2WANA 2EVJA 2ZEXA 3QDMB 4PJGE 3U7WH 3RWGA 2ARJQ 1CE1L 5D2AA 3CFJB 3SBQA 1UWGH 4XN5A 1JI6A 1Z0HA 4NWVA 1TFHA 1N5YL 2F8VA 4OZXA 5HI3D 4X6CF 2VT0A 1M7DA 4X6FB 3RWDA 3VFSA 2IH9A 3HE6C 5CEYA 1YMMA 5BYNA 1CAXA 2XNAB 4WVRA 1CN4A 4OM1H 5T5NF 1FNGA 4PJXB 2FIKA 2FWSA 3N35A 9PCYA 1D5BB 4HAFA 1RUJ3 3P11L 3V6FA 3ATBA 3MNVA 3SDYH 5DJ8A 2A1WH 2FWUA 4NO5A 1LNUB 4OQTA 3BDYL 4JJOA 1DHKB 3MX0B 1T4WA 3DIFB 1VGKB 3VFPA 1P6WA 3ZYGA 4JGJA 2K0GA 4PY8I 3GBEA 4U33A 1JS9A 5IROD 1MACA 1L9NA 1I7ZB 1LTXA 3D39E 4OZGB 1PZ7A 4AEFA 1UATA 2G3ZA 3U46A 1SQ2N 1R082 1S9YB 2CHZA 5DFAA 4LSRL 3IN0A 4XWOD 1F42A 4JPIB 4LMQE 3ZT5A 4AYSA 2XQYA 4A6YL 1S0DA 4M3CE 3NA9L 3AFLA 1F3DH 4QPGA 2DBLH 2CE6A 3B2UD 3BWUC 4LL4A 2J1SA 1DLHA 4ZUVA 3V55A 3LNIA 4MNGA 4X5PA 3TASA 2R0HA 4WU7B 1H4HA 1VAKA 5ISLA 1UQSB 1AFVL 3AWFA 1UM4L 2Z65C 4M7KH 2C9PA 3H0OA 4FQCH 1OTUD 5K9KB 5FWEA 1TVBA 1FG2B 1M2OA 4P46C 4ZFOL 4CCDA 1LVEA 1E9PB 4HGMA 5E23A 3WKML 2YPJA 4N1CA 5I1EL 4CA9A 3MDJA 4G9SB 2CSGA 2A73B 4L97A 2OW6A 2DFBA 3O12A 4BQ5A 2D40A 1T0MA 2NY1D 3OJDB 4MA8H 5T3ZL 3UDWC 3UADA 3V0AB 1X9RA 3MLXL 1S2BA 4S2SA 5CWSB 1E4WH 3W39A 1OOPC 4K7JA 4I0CC 3CDCA 4MCYA 1PLCA 3W38A 3S3SA 5JIMA 2YHJA 2DYPB 2NXZD 2EDXA 3CFCL 4OJFL 4XVJH 2JJ6A 2F17A 5IK7A 1ZBA3 4EYUA 2XN2A 2EUVA 1IQDA 2GI0A 1AOZA 3BVUA 3PWPE 3I3QA 4N9GA 1R4XA 5F21B 4ZX5A 3ENEA 1AYN1 1JAEA 1UXSB 2WO4A 2N01B 1DEEB 5LBVA 4N2FA 1IILE 4X6EB 4KV5E 4K8RD 5HYIA 4JQTA 1Q0YL 5TSWA 4CCOA 2LU3A 1OCWL 2EIMB 3K6IA 2WAOA 2P5EA 4K9EH 4QHUB 4LO7A 2WYZA 4B9YA 1NOLA 2D2OA 4JMXA 3GJEA 2EKJA 5FUZH 5E2WL 3LKJA 1F8TL 4HS8H 1PO22 2O61B 1M7XA 2WINB 2OQJB 2OZNA 1T0NA 3U0PA 4XNYH 3FH5A 3A47A 4J6RL 2BOCA 4HPOL 4HQQH 3U4BL 1GTNA 3FT4A 1V0AA 1N59B 1LHNA 4YHML 2IG2L 3FB6B 1XIWA 1DQ0A 2DQFB 2VDNL 1N3PA 4OV5A 5FOBB 4ISRA 3NQKA 2YFUA 3PUCA 3V0FA 4TVUA 1AG6A 3UXFA 1EFXD 5KTEL 4JL1A 2DU1A 4Q8LA 4OIIL 3RHWK 2WBJC 4XAWL 4XO4A 1J3PA 3RIKA 4BH9A 4K94H 3O8XB 3KYKL 4HV8A 1FORL 2RQ8A 4XPAL 3W5MA 4JO4L 1E4XH 2Y07H 2HLEB 1ILUA 4FXLA 5I6PA 2EC9U 2WNOA 2VZPA 4DXRA 1KWGA 4UDUA 1HXS3 1J05A 4UB0H 4U1IB 2MQGA 4XETA 3IIAA 4UBHA 4NN7C 2B9BA 4YHNA 5E6HA 3VL9A 1K9TA 1SVBA 2VSCA 3KXFD 2ETEA 4QI3A 3FHAA 4ZZFA 2XV2A 2HWB3 2N7GA 3FLPA 2AV7A 3J9SA 1ZJAA 5L4MA 3VXSB 1GL4B 3ZTNH 2Y6GA 4MXQD 1EK3A 2ZWSA 1WFTA 5D93B 2MQ0A 1FVDB 3U1QA 1KIUA 4A6OA 4ZUUA 3WT3A 1CT8B 3FN0L 4HUVA 5C6TL 2Y6LA 1T1WB 4N7IA 3T4AB 1BREA 4L4VE 2X53A 2R2CA 1E5AA 2HWD1 5T3XH 1NE6A 5DGQA 3FK3A 5CFCB 4BH8A 1H0BA 2LW8A 3IXTB 3TEUA 3EO9L 2J1RA 5B38B 2QBXA 3ZZSA 5T33H 5IV2A 4RQQA 4F58L 2GB2A 1PZDA 2KT6A 4XMAA 4QRPD 2Y9RT 5E4EB 1FZKA 1W6NA 3MUGB 2GNBA 2R2BB 3RTQA 5FXWA 3J7LA 3NZ8B 1XGQB 1R3KA 1HE8A 2V5YA 2Y24A 4QXWA 1Y1DA 5ICYA 4N0FA 2O1AA 5JPMB 3DO7A 1BVLA 1JMUB 1ETZA 1SF3A 3GSUA 5J6HB 1MFNA 2DQUL 2NX5E 4NRMA 3FO1A 5JQHC 1X9TA 1QO3A 1QJX2 2A6DB 2GSYA 3VZMA 4NNPH 2WQRA 4O5LL 4YJZL 1KMGA 3DUUB 1A8MA 3LRLA 3J8F7 3S36H 4PGDA 4WHYH 5ALBL 1X50A 1RUI3 4UTAA 1W3XA 4KPHL 3DGCR 4ODWA 3BFWA 4GLRH 4XIOA 3V5KA 1F6AB 2V4LA 5CD5C 1IQWH 1DCEA 2X3AA 4FERA 3AXHA 4LLMB 3B1UA 1CLYL 4G6FD 4K9JA 2GJ6B 4YW7A 2XWDA 3T3ME 3KCWA 4IK7A 1JNHA 3TT1L 3D51A 1XSOA 4YUEH 2HJIA 3V0VB 1VENA 5F6HI 3V4PH 5AVQB 5EEWA 3VBRA 1AZDA 1R64A 3QUYB 4BSWA 5F0PB 4UIMB 2ZBJA 1I1AB 1PKQE 2AMUA 3Q48A 4IL7A 3OKLB 4MYEA 5EEZA 3O6FA 3UEZA 5MENA 3FUMA 3MXVL 4AXOA 4FLSA 5L36A 2HJFA 3H1WA 1ZDQA 2E27H 1GMMA 3S96B 4FMFA 4L3ED 2J43A 4X9GA 1ZV5A 5LN4A 3O6KH 4FULA 2WUHA 2XA3A 5A16B 1BZ8A 3DX9B 4KVCL 4U1KB 3BU0A 1BJ1H 2I7OA 2CHNA 2D5HA 4LLWA 4S0HA 3DL3A 1EFQA 3OZLA 5FRAA 4UM9A 2WS93 5JO5A 1FNAA 1L6ZA 4DP8X 3Q8FA 4XVSH 3FULA 3FTXA 2XBZA 2CIKB 4TLSA 2VKXA 4DP2X 2UX7A 2GTWA 3FUHA 4DK3A 4PRHD 4JQRA 1AIZA 4JM2D 2BZ7A 5KHKA 3X13A 4ZPTA 3BAIA 1UH2A 1JF5A 2PPDA 1AQKH 2WXIA 1UX7A 1I8IA 3H3KA 1COV1 4OLLA 1C1EL 5DD1H 5ERWB 2K8QA 2IVIB 5I1HL 1E5ZA 4NWUH 1FZOB 1D4M3 2VZOA 4ZMXA 1DJGA 4OF3A 3RYRA 4K1YA 2CNZA 2ZCKL 4WK4B 1DVQA 2C9XA 4CKQA 4IV3B 4CSWA 2NYYA 5L7OC 2F19L 3UC0L 2MHAA 3HB3C 4PG2C 4BA0A 4N3TA 4U1SA 2DL2A 5AVUB 2VCAA 3I2DA 3AQZA 3MPCA 4PBOA 3G6JB 3A3YB 4LKXA 2JJTC 2R1XB 3TNMB 1IAIL 3FBYA 3HS9A 3ZKNC 1I3HA 2BYVE 3PVEA 5FREA 2V7NB 3FL7A 2UUDK 3BW9B 4G8GA 1P4LB 4IS6B 2UURA 5GALA 3RQ0A 3MBXH 3QARA 4KKAC 2R2HB 1ZLUK 2VVDA 3LKNB 4Y9BA 1VB4A 3R4UA 4AI9A 2V09A 3ELAT 2DYRB 5ACLA 1KELL 4XCFL 4IHOA 3WHE1 4DVRL 3MMEA 1GXEA 5HGDA 2QQIA 1H5BC 3S4SB 4FA7B 1T2XA 2ZSWB 3VWJB 5I19L 4ECNA 1FNYA 5CNHA 1XAKA 3HD8B 4BCYA 2XZQH 1L7QA 3OPTA 2ZJSH 2I85A 3QPQC 4YXHH 3OC8A 3SBWC 2XBO2 4GMP3 4HF5H 2IWFA 3I9PA 2E9QA 4NZDA 4WBBA 1KC5L 1ND3A 3INUH 4ZU4A 2EACA 2NY3B 3II2A 5C0EB 1KFAH 4B0MM 3EBHA 2A2QT 2B1OA 3VQ1C 1K8DA 1HRV1 3C7HA 3RZHA 1UIKA 3UTTE 1M2VB 2V3DA 3SDXA 1ZV2A 1I3GL 2JTYA 2FDJA 1SBFA 1WWBX 3P2TA 1SBSH 3GRGA 1LK2A 1L5GA 1TVHB 3AXLB 4FTVB 2B1HL 4G9FB 1W91A 3BKYH 4MNHB 4QGYA 5GIRA 5GS0C 2H6BA 4DEQA 3CDGB 4JE0A 1UWEH 3B9KB 1A5FL 1QTPA 1VFAA 1HC1A 3LNHA 1NXD1 3ZM8A 3B5HA 3HJRA 3TIDA 1OAKL 1X5HA 5D1QE 3SDXF 2DWSA 2QFEA 2VDML 2EYRB 2QQNA 4O61A 2IDSA 5GLVA 4WUUE 3SZKC 1EO8L 5KYNA 1DL7L 2YIHA 5D2LB 2KKQA 4GQPH 3GSXB 4G8IA 1G9FA 5LDUA 3B1TA 2F7PA 1CL7I 1UMZA 2DMCA 3JD71 3O7OA 1BMZA 2IQ9H 4IGOA 2YROA 1NOAA 3UTQA 1Q43A 5I6LA 4XFBA 3U75A 2O72A 1GSMA 4AYID 4Y2NA 5HSFA 1RUG2 1MAKA 4R7DA 4JAMA 3WY4A 3UYRH 1HOEA 5L2KE 3JBG3 2F4LA 5J11C 1DVZA 4ZD3L 3OJ2C 3WS3A 2LW3A 1YC8A 3VFOB 1V55B 5DVOA 1GZPB 2ZZUT 2BGPA 2SBAA 3ISRA 1YN6B 4GP8B 2QZ2A 2ZXEB 4MJ2A 4W9LC 1IGCH 1SJHB 4FFIA 4BLIA 3IJSA 2XWEA 3TBYB 2P5WE 3MV7D 3CHPA 4AL8C 4FS0A 5H9QA 2AHIA 3MJ9L 5T1DL 1QYGL 3ZXLA 1MFBL 1TOXA 1RMU3 4NAJA 5BNQA 4F8LA 5JWPA 3S88L 1WE5A 4UFKA 1PW3A 1RUML 3D0LA 2XBTA 3ZUCA 3B7RL 5HV0A 4XXDB 4HKXB 5B3JE 2HCZX 3VBSB 1FRGH 1QRNE 3LRMA 3MOAH 4ZFZA 3QXAB 3WAJA 5D7EA 3ULUD 3QO0A 1J0KA 5I15L 4HWZA 3ARPA 4E41E 2IGLA 3HN5A 1FJ1B 4XNXL 5A2JH 2AEPH 3I02B 4HJEA 1EANA 1OARL 3TH4T 2EJ1A 3SDDC 3V8OA 2WP3O 4U7MA 4YGAB 3ME2A 5I6NA 4AH2A 4PJBE 5E8DH 4ABWA 1I85C 1XNKA 1RUJ2 1YXWA 3WJLC 4KY1H 3UJJL 3CL1A 4Q6IA 1XU1A 3MCKB 4Y5YC 4D9RD 3UJTH 5I28A 3FQXB 3T2QA 3EYOB 3G04A 1DQKA 3D18B 5A2AA 2GBAA 3AG1B 3FUFA 3H6JA 1JODA 1N9PA 3THML 1P7HL 2ZOKA 1F90H 2D4DA 4WI4A 5FA3A 3B3BA 2A70A 1FO0A 2G9HB 2O5XL 1LE5A 4LT5A 5TQ0L 2CO7B 3WFEH 1AR93 4JE4B 4HKJA 1VFMA 2Z93A 1EEUA 2Z79A 5AVYB 3PUAA 3CBKB 2J5LC 2XJPA 1O3SA 3ZGIA 1EZVX 1RUAH 1CDCA 1OZTG 2EE0A 3GJFK 3HC3L 32C2B 1N1SA 4OFYA 1VB2A 3BAKA 4PPTA 1KEGH 2WFPA 2PTTA 3JV6B 1KDMA 4JFFA 1UPIA 1BDYA 5AWNL 1I6XA 1SOKA 3EMRA 1FT9A 1IHMA 4XWGH 2WLZA 2IADB 4FEIA 4XVTL 4JFDB 2A9NL 1NINA 4H0IA 5T5FL 4RQPA 4U1HB 4W81A 5FYJE 1ZRRA 5F3BB 2Y6TE 1KYUA 4JKNA 3DI3B 3IEAA 4RRPG 5CZRA 1BZ9B 3DX0A 1MZFA 1GKEA 4Q4V3 2GMPA 1A6ZB 3EXJA 4BZ1A 1IJNA 2I60H 2AXFA 1U8NB 3ZDYB 4DY3A 4G4FA 1KLFA 5F7MC 5ABJB 2AJVL 1TPXC 5HCAA 2W87A 4OMCA 4Y26A 1XNCA 4X8XA 2C3HA 1IKQA 3GHBH 5IUSA 4AJ0A 5A3PA 1V00A 2B4CL 5FZFA 1KYFA 1D6VL 4KO9A 2BP5M 4NI3A 1UA7A 4P9MH 1FMD2 4PV8A 2Y7QB 4QXUL 3W21A 3E6HA 3RURA 1YEIL 2JXMB 3QK0A 4P9HL 1GYKA 1NCQB 4IHBA 2GEEA 1I1FB 1R46A 1LE9B 5TH2B 2AUYA 3OAUH 3CGTA 5FC9A 1POV0 1H3GA 1NCCL 4Z77B 1QFOA 2WQ4A 4IEQA 5D6CA 3SCFA 2XZCL 3GWJA 1QSVA 3GSQB 1U0QA 3B5GA 4ZXEA 4OLZL 3WQ1A 3QZNA 2ICEA 1AX2A 3B2DC 4AZUA 4M1DL 2X7LA 3AMNA 4YOKA 1XBDA 4P3CH 4YLQT 5E1HB 3S98A 1CTOA 5ISZE 2FNBA 2JKWA 3LXCA 3ABKB 1WWCA 3NZHL 4WZCA 3UBXI 3RVXD 4DKTA 1C1LA 4GKLA 1HJCA 5EU6E 4LIQH 5A6LA 5D8JH 2XJUA 3CFUA 4HIHA 3BP6B 3FLRA 2CLZB 1FNLA 1Q9WA 3M7OA 3QCWA 1JV5B 2WL1A 5EHDA 4KZDH 4PRNB 4POUB 1TJHL 5DVLA 4ZMTA 4QRBA 3C60C 3ZYHA 2BCMA 4M5YL 1G9AA 1BQLH 1YEJH 3MVSA 4XXWC 3FQ4A 2AEQH 4HLZH 3MA7A 1OT5A 1MREL 4MMXC 3OUJA 3MNZA 4HOOA 1A7RH 3UX9B 4O58H 3UK9A 2WIMA 1TR7A 2IANB 2Y33A 1JV2B 4X5LA 3RVVC 1WKYA 4NR1A 4MJJA 2W5PA 2VMDA 4P8QA 5CU5A 3POYA 3HE7D 3IDNA 3GMNA 4I0PC 4N24A 4HU8A 1HXS2 1QIQA 3D0VB 3NJZA 3BOVA 1SUHA 1VGEL 3U82B 2TEPA 5LZ6A 1DN2A 5LN8A 1MEXH 1MFMA 3P4NA 4LLVA 5C0DA 3KVAA 1U8LA 3RWIA 1BYHA 4YVUA 3OTFA 4AQEA 3KM2A 4LLYB 4LHSA 1E67A 2X88A 1R75A 3I6KB 1C28A 3GI8L 4AEKA 3H8XA 3FQ1A 3P9MA 2JICA 4LVNC 2EO7A 2X87A 1RU9L 1O91A 3KD4A 4HU2A 3THCA 4CDWC 1E2ZA 3GSWA 1O7VA 4HWBH 4J28A 3RS6A 4I13B 4N2GA 2VZSA 1MWAB 4KMTL 5F88A 4PMEA 3SKJL 4XF1A 1CLZH 4OI4A 5JXGA 4LLAA 3SBPA 3T3PE 4FLQA 4R0LA 4DXZA 5FZGA 4I89A 1NCTA 2OW4A 2FMYA 3RJOA 2HJLB 4Z0BL 1PEZA 2FX9L 4CTEA 4Z7UB 1WC7A 4QHNB 4TQEL 5JHDA 1BEV1 4Q2ZA 2VDPB 3ALPA 5E8AA 3WIHA 4NPRA 4S1QL 2ZNWA 4F80A 4GH4C 5AW7B 2E7DA 3UBXB 1NIAA 2OR7A 4K5OA 1XD1A 4XUPA 2VSKB 4JG0H 4BHUA 4E42A 3HVNA 3D6GA 4M7JH 4DZBA 5FS5A 5CJ8A 3ZDXE 4NJ9H 5BY5A 4FJZA 4PLJD 2WB7A 1ZPLA 5L7OA 1DJWA 4NUPA 4TYUA 3V9FA 3UJQA 1S3KL 4M8UA 1W0VB 2NY4C 4QQLA 1PTZA 2VM3A 1A1NA 1RZPA 4XZUA 5KYWA 1RINA 4NMIA 1YEKL 3RZCD 1RUI2 1RUNA 1U0AA 4IRJB 5HD8C 4LKCB 3O45B 4HKZA 2FSDA 5TF1H 3KNBA 4ONFL 2YAMA 4IKJA 4NKDA 2EVHA 2BJSA 2BVOA 2BVVA 3IB3A 3PDDA 4Y2LA 1ZNPA 3UBGA 1IGML 2EIDA 3QIUB 2EA7A 2BIPA 1PBYA 3QUXD 4Y1SA 1CC3A 1AZCA 1TUPA 4GAFB 4UTBA 3L3KA 4Z8BA 1A7PH 1CIDA 1L9TA 1S6NA 4KJYA 1NH6A 5A1AA 3OB8A 4RYDA 3V56A 2X9WA 1DQTA 3PU7A 5CJQH 1HXMB 1T7WA 1CLOH 3GXMA 3UBXG 1OLMA 2PWDA 1WFJA 4AI1A 4UQEA 5TDOB 2WAAA 3F8UB 1IIKA 1XCTA 3KF5A 3ARXA 2VXQH 1V8HA 2WZ6A 3C7EA 4Z1PA 3QZLA 1MUJA 2Q1FA 5F1KC 4JJHA 3MRJB 3I6LD 5DUVA 4JKKA 4ZMYA 2JD9A 3DRQB 4O51B 3KGZA 3GIVB 1TG7A 2AH2A 1O6SA 1X3DA 2A3YA 4GA9A 5FY4A 5ACA3 4WWKD 6FABL 4QOKE 1D4M2 3ZYIA 4BFOA 4HFWA 2ARBA 4YG6A 3WN5B 3WQ7A 1GYVA 5E9DB 1CFMA 1DQ6A 2GTZB 3LN5B 3FRPB 3NSXA 1Q94B 2OFQA 3LRKA 3FMGH 3OX8A 4LCWB 4XN1A 2ZAGA 5I5JA 1RD6A 3IS1X 3NAPC 2ICWI 1P4IH 3CFKA 3TZVC 1SLBA 3MV7A 4A7GA 4LR4A 3MLLA 4XVUD 4Q9RH 3NJLA 2XG5A 5GZNA 1SJEA 3BKMH 4JDVB 4XVOA 2ZYIA 3QJFB 4KK6C 5HXMA 3OTTA 3BAEL 1ZTXE 2Q86A 3HNYM 1EUTA 3KS0H 1JPFB 2QSVA 4XGZA 4N90D 1PVC1 3OYWB 3SGDH 4QKDA 5IW1B 3WCYA 1AR1D 1JK9B 3DIDA 4H40A 4JHWL 4FPHA 3N55A 1AZUA 3WLUA 1WBZA 4FQLH 4A7GF 2AQ3A 3CFEA 1IM9B 3MIFA 2ZOEB 1IPKA 1JDCA 1HVXA 3PNWA 5AW1B 1JYWA 4X5XB 1SDAB 1NC2B 1TENA 3IXAB 3TU6A 4ANXA 1CONA 5AYUL 4N9IA 4OD3H 1G94A 4UQIM 4QRRE 3FFOA 3BU7A 3MN8A 2B3RA 1QSEB 3V6ZA 3PU3A 1A4JB 4HEPA 4QTIL 4MQ7B 4ATWA 4QX7A 3I9IA 2VVEA 2Q3XA 1MRCL 2V2WA 4F1ZA 1H8TC 5AQ0A 3BKCL 2AC1A 4M62L 3AAZB 4DKEH 3BE1H 1KCSH 1YN7A 1QEXA 3QEQA 5EU4B 4IV1C 4MB5A 4ENED 1T66D 2ATPA 3AU1B 4HWBA 4ONGH 3ZHNA 2X40A 4DQAA 4Y4YA 4Y8DC 5KYXB 3US0A 1TYJA 2ENPA 1DYOA 4UWQB 4U2YA 2WT0A 1V7ML 3HPLB 4FL4C 1JNNH 2GSIA 1RKRA 2FWLB 4L5FE 4ZOEA 2DH3A 5ANHA 1FI2A 2E51A 3CHXA 4TUJB 4A39A 3CFBA 2JE8A 1NCWH 2GZWA 2X4OB 3DROB 4R6UA 4IBZA 3T0WA 1GKBA 3BVNA 3TNNB 1HSAB 3VFRA 2OXBA 4PP2B 2VXUH 4UOW0 4TF4A 5C07D 2OS7A 5GGSB 1OSEA 1B2WL 4XCNA 2IQAB 4Q4W3 4YHZL 1LDSA 3AWGA 1BF8A 2AYHA 4PIXA 3UTSB 4FD0A 2YR3A 2ICWB 3FUEA 2C4XA 1HL4A 1N7MH 3ASIA 2V4AA 3U07A 3APBA 3LQAH 4K7PL 4RGMB 3N1GC 3QBTB 2W65A 4U6TA 3LB9A 1G6RH 1NAML 4F33A 3EG9A 4OCNC 2ADGA 2QTVA 2X6AA 3HNVL 3WEMA 1KCLA 3RL2A 5AZ2H 2H9GA 4WM8B 4FOMA 4G6AC 1N0XH 1X7QA 2C3VA 1Z78A 3WDVA 4QQHA 2W07A 4NQCE 4YDVA 3RAJH 3CFDB 2MEV3 3C7OA 4AI8A 2KDGA 1OA4A 4RA3A 1OP5K 1TT6A 3AG3B 3VNYA 3WLWC 2I9TA 3TPUA 1RMU2 1TNFA 1XYOA 4KK8C 3UERA 3K6SB 1NUNB 3ARGB 4UBGA 4DXSA 5IWLA 3V7AE 3TN0C 5I5RA 4JDEA 3A21A 5F8PA 5F1RA 5JXIA 1ZHBA 2EAEA 4M4RB 1TEFA 1CBVH 4IE7A 4OTXH 5I8OH 5FM8A 3O1TA 5F9WC 2Z1KA 2ZKXA 4EE2A 4ERSL 3LIZA 4F9PC 2VUKA 4OCMC 3B4NA 4PBWD 1OI6A 1WCDJ 4FPJA 1N1TA 2CO2A 1AOHA 2PPCA 2ZXDA 1NWPA 3MRBB 4Z92B 1N5AB 2VY0A 3IMUA 1SDWA 3E6BA 3PMSA 1NICA 5FGBC 1IGOA 4P9XA 3ZE1F 2APXA 2VL5B 1WICA 3C8KB 2Z8SA 3APNA 4H25A 4CADA 4ZNEA 3AS0A 2NNRA 2DM4A 3CUPA 4LK6A 2QADC 4K2UL 2MCAA 3S36X 4Z78A 1R0AL 1U93B 3AQYA 1A21A 3F58H 5MEPB 4GAYA 5HGBB 1MVUB 2V2XA 1OAXL 4FQXA 4WCYH 1NEZB 3RGVB 1AR92 3ELNA 3GALA 4I48B 3LKSA 4FI7A 3HMXH 3TJEH 3T6WA 2BNQB 1AYM2 1ONAA 4UT6L 3R19A 3SPIA 5CHNB 1INDL 1MH5A 3FQTA 3BLBA 2WO7A 4AM0A 3FMGA 1L3WA 1DO6A 3BIBX 4AOCA 2I9LA 2YBRA 3L3HA 4PGEB 4LESA 4U3HA 4X0KB 4YC2B 3ZYOA 1OF0A 4I02A 4OHVA 3IDJB 2ZMKA 1DJSA 2YEVB 4JB9L 2SEBA 4S2DA 1Q72H 5IFHH 4X6CB 4ENZA 4UFLA 5DRWB 3QJOA 2WLNA 2YC1B 4ZY9A 3I2KA 1JRHL 4RMBA 3H3UA 5TE7L 3VBUA 2HVBA 3RWGB 1U91A 4ZFFA 1ZY9A 1XQ4A 4TV3A 5SX5H 1EP0A 4KWLA 4ZO6A 1NBVH 3K4ZA 2RS13 1D9KC 3JSSA 4HK9A 1NEZG 1M7DB 5C0AD 4M8RA 1NGXA 4HA1A 4KL1A 3RX7A 4E9LA 5CEYB 5E8NA 1BBDH 2XQYK 4S1RL 1RZGB 4IEFA 4UNIA 4XUTA 1FNGB 1B0RA 4BJLA 5IESL 1NG0A 3ILQD 3V6FB 2YA2A 3MNVB 5HY9A 4AV5A 1KPUB 2GK0A 3FU5A 4K40A 4NO5B 1USQA 4RMQA 4QDRA 1RZJC 1BXHA 3H3PH 4LSSH 3ERXA 4ANKA 3VFPB 4HOZA 5F97E 2QZ3A 3GBWA 4R7XA 3DJ9A 4W9ZA 4AMXA 2NUTA 3ILDA 1T04A 4CDXC 1JGLH 5JOPE 4HYTB 4IKNA 1W2AX 4RDQF 1CGSH 3O2DL 1OSZA 1VBE3 1FNEA 5CU1A 5T5NG 3U46B 4Z3EA 1PVXA 2KH2B 2C24A 3GBMH 4HJ1A 2E26A 5BRZE 1SFHA 4ZS7L 1VZIA 1V6OA 2WNVA 4KWKA 4NQUA 4LLFA 2CGOA 5DUXA 4QPGB 3WP3A 4C8DA 4ZFQA 4GO6B 1MHHA 4ZUVB 4Y1XA 3HCVA 3Q2NA 4MNGB 2FDGA 3HZMB 3L8QA 4PFEA 4IYKA 1BLZA 1KDIA 2XX1A 2DTYA 3GLZA 1TVBB 4MSVA 1M3JA 4G1EB 3TWCH 4CJ1A 2UY9A 4RGOH 1AYOA 4YXKH 3BVDB 4AX3A 3JZYA 3EJCA 4WQOA 2XUEA 5CADA 5ABZA 2MCPH 4E8DA 1Q0XL 1WZLA 2MH4A 3N9GL 3OSVA 5D9SA 5E2VH 2VUDA 4ODVL 1ULVA 4M6OL 5A3MA 3SD5A 2X1XR 4YHYB 1RUC2 3P5BA 1KB5H 2HFTA 2H6UA 4S2SB 3W39B 3IN2A 2X4QA 4MCYB 4J3VA 4P4KA 3ARFD 4CSZA 3VRLE 1I7RA 1WUVA 5HHOE 2ZX1A 2WLPA 2VISA 4KX8A 4X4YA 3AMHA 4KG0A 1IQDB 1YHPA 4IRZA 4ZFGL 2XQYG 2YY1A 4GIQA 3ESNA 5I1LB 2Y2TA 4N9GB 2DH2A 4AGMA 5I6XB 4X6DA 3WIFA 4HLEA 4XO9A 1SFPA 3NA4A 1I3VA 2QJDA 1U3HD 1YEEH 2AV1A 2PHLA 1NAKL 3VVVA 6CGTA 4GWMA 4JDMA 4PD4J 3SCMC 4C54A 1Z5YD 2P5EB 4GQ9L 4GXLA 3UJIL 1ENQA 4OGXL 1Q3EA 3GJEB 3TYGL 5HVFB 1I1YA 4MDIB 2V9TA 1BMGA 5EU3A 3X3GH 4FAAB 2Z2SB 1L9MA 3OPWA 3BX7C 1J0IA 4N8UA 4XBEH 4IMLA 3E2HB 4JGZC 4JPKH 3FS9A 3Q1SH 4BIOA 1KPRA 2EEBA 5E6ID 3U0PB 1ND2A 4MQTB 2FD8A 5JW4N 1FC2D 1WT5A 1IL1A 5BVJA 4ZXKA 3FT4B 3WHXA 2VNVA 2A9MH 4QHZA 2IOIA 1KB3A 1X5IA 1XIWB 2GJZB 1NGYB 4PJFE 3KCPA 4TSBL 3LIUA 5JW4M 4OV5B 3EJYC 4PRPB 2QQPA 4BXSV 1JGUH 4P2QD 3EO0A 1KCRH 3WKPA 4XMPL 5KBMA 3VW3H 2PYED 1CIWA 1UOBA 1Z5LA 3A23A 5KSUA 4CEWA 2JCWA 2CPCA 4CN4A 4XMUA 1J3RA 2B9VA 5IUQA 4CMHC 1UY4A 3L3IB 5J96B 2JWYA 3QQDA 4NQEA 4V2WA 2GUYA 4HV8B 1DZRA 4MH0E 2QQKL 2UWBA 1JGEA 2J8UE 2P3YA 3O3AA 3BB6A 4XC3H 4PQ9A 1R5WA 1DYZA 2AK4D 1NGPH 3HHRB 3T6QC 1J05B 3SKUD 4G83A 4UFMA 4A2LA 1RVF1 1LMKA 2K78A 4HT1H 1FI8C 4KI5C 1IU1A 4ZZKA 1O59A 5KHIA 2MCMA 2IH1A 1DEDA 5LBSA 1FH2A 1WZ1L 4FMKA 3PCYA 3C2AH 1MZ6A 5BXXA 3Q9OA 3MPPG 2VZ3A 3S9DB 1MWOA 3P73B 4UV7H 3KT4A 1KIUB 2I27N 4ZUUB 1AS7A 4UINL 1GHFH 4PJAB 5C09B 1OY3B 2BWQA 4HUVB 4A3ZA 3LKRA 5E08H 1GV9A 4KHXL 5CILH 2XWBA 1JZIA 3MREA 3MACH 4PHXA 2NNAB 4LRIA 4BH8B 5JI7A 1KJ2A 3AG2B 4R4BA 4AQ8C 4A3XA 4MG2A 4JM0A 2BSSA 3ZDZF 2I7SA 3FT3B 5IV2B 4RQQB 4HGKC 2XN9D 5FW7A 8CGTA 3MC0A 1RXFA 1W6NB 1FZKB 4KJPC 3MLZH 1AXTH 1WWWX 4G80A 4KKCD 4OBRA 1K5MC 1A14H 1NCRB 1R3KB 4NS0A 1UKGA 3CIHA 5ICYB 4N0FB 5KN5B 3RPKA 1BVLB 5I74C 3DO7B 1ETZB 1Y0LA 2HEVF 4J8QA 4S1SL 5ACA2 5JXHA 3II1A 3WUCA 3GSUB 3OLGA 2RAMA 3GSVB 4AGVA 2G60L 1QO3B 1WA4A 5FB8A 2R071 3U1PA 1OH4A 2G5UA 2QSQA 4KRPD 2W9EL 4WI2A 3AT9A 3EJZC 2ZKYA 2MCG1 4PGDB 1PG7H 5IIEB 4P48A 4IRSD 4TL5A 5J89A 5FY8A 4F83A 1V9U3 4R2GB 1BD2D 3IDYB 4GRMA 3V5KB 1S7SB 1UM6H 2GQHA 1MRDH 2NY0D 3VFGL 3VNZA 3P3SA 3IPFA 5HPMA 5IW6A 3AZYA 1A7NH 1IBGH 3R7RA 3S37H 3KSCA 2YLHA 1JNHB 1WO2A 4GMP0 5FYBA 3U4XA 3MLUL 3Q2CA 3VBRB 1KB5A 1OHZA 1D2OA 4BSWB 2HT3D 2YA0A 3EH3B 1F4XH 3O6FB 5BV7H 5MENB 2CBOA 4AT6B 1OAQL 3NCCB 4NQDE 2HJFB 3PLYA 5JIIA 4M8VA 4TSCH 4BCXA 4QAMB 3TA3C 3W57A 1MIEL 3THPA 1RCYA 4C1XA 4MA3A 1F86A 4M7ZC 1VJ2A 2P49B 5DYOA 4KTYA 3DV4A 4NWTL 4Z7OE 1XCWA 3N85H 5FY7A 5GGUA 2YPLE 4LLWB 5EN3A 3EJKA 4TS6A 1JBCA 5IEHB 4R52A 4OJYA 3D3VD 4UM9B 4CSTA 5J0BA 3IGLA 1WMEA 5JO5B 4DTGL 3C75A 2HT2D 3LOIA 4K5MA 1AMXA 3EYQD 2GTWB 2BNRD 1PLGL 2WXNA 4PJ9A 5GGQL 1R1A3 2DF7A 2WFF3 2BSTB 3VGGA 1SN5A 4KH9A 4D8OA 4Y4KD 4BWWA 3AP5A 5FHAH 2NNCA 3NFPB 1QOSA 4QB6A 1I8IB 1BFTA 1UENA 1JHKH 3AYAA 5CINH 1VERA 5CYYA 4FQJH 4AYGA 5GSVA 3GXNA 1P7QD 3MLTA 2AZAA 2ZWKA 4RGNE 2DWEA 1A8DA 1D6EA 2DLEA 2X2HA 3C9NA 3ZSJA 4FXTA 4PEEA 3BQUA 1SLUA 4PIZA 5C3PA 4OJCA 3ARBD 2F08A 2R063 1W03A 4WTZA 1RUJ1 1VBA1 3ZK0A 2WRAA 5D8AC 2PLV3 2MHAB 2C1FA 4U1SB 3WNKA 4F8NA 4W6WA 3N3EA 4ET7A 3MV8D 4QWWD 4HHGA 2AQPA 3FSAA 5JDSB 3TURA 1KBWA 3S6CA 1DGRA 2A3XA 2QELA 2B59A 3B93A 3I3MA 2XACC 2EXSA 4G8GB 2W0KA 4G7YH 1S3RA 4PWIA 4KQ3L 1BWWA 2Z9TA 4YDKL 3EHBD 4E9VA 4MRBA 5KVEL 4R5VA 1BMWA 1KITA 2NMOA 4KJQD 4OI2A 1CB4<