2ZAHA

X-ray structure of melon necrotic spot virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
296
structure length
296
Chain Sequence
SVKIVHREFIASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGSTSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAVDRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGSTIKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVTSSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coat protein
publication title X-ray structure of Melon necrotic spot virus
pubmed doi rcsb
total genus 67
structure length 296
sequence length 296
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zahA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zahA01
1VBE3 1EV12 2TBVA 1QJU2 1ZBE2 2WS92 1C8NA 1QJU3 1PGW1 1ZBE3 1HRI3 4QPGA 2WS93 2HWE1 4YVSC 1RVF1 2RM21 1R082 2HWF2 1QJX2 5LK7B 1EAH1 2HWF3 1QJX3 1RUH2 2HWC1 1TMF1 3M8LA 5C8CC 2RMU1 4CDXC 1PO11 4IV3B 1RUI1 1K5MA 1HX6A 4CDUB 1ND3B 1QJZA 4IV3A 1COV1 4CDUA 1GFF2 3VBRC 1ND3A 1RHI1 4JGZC 1AYN3 1BBT2 1R092 1AR62 4JGZA 4WM7B 1AR63 1BBT3 1R093 4CEYC 1RUF2 4CEYA 2FZ1A 1RUF3 2VQ0A 2PLV2 4WM7A 3NAPC 3JB4C 1ASJ3 5BNNC 5D8AB 1RB8G 1VBA2 2XPJA 5FMOL 5CFDB 1VBA3 2XBO1 4FTEA 1HXS1 1NCRB 4N43C 4RHV2 5D8AA 1PGL1 4GMP0 1M06G 1AL22 4CDWC 1AL23 1R1A2 1NOVA 2R061 1NCRA 1MQTC 3VBUC 1R1A3 5BNPB 2HWD2 4CEWB 1RUD1 5A33B 1OOPC 4RR3C 3DPRC 3VDDC 5BNPA 3ZFEB 1AL0G 1H8TB 1POV1 5A33A 4NWVA 5AC92 3VBOB 5AC93 3ZFEA 1H8TA 4WM8B 4EJRA 3VBSC 1BEV2 3JBG1 3ZFFB 3VBSA 1BEV3 1FPN2 3VBHB 3VBOA 4Q4W3 4AEDC 1FPN3 3VBFC 4AEDA 3ZFFA 1RUC1 3VBHA 1CJDA 4GB31 2WWSA 5J98B 5CFCC 2RS12 5DDJ2 1PO21 1AYM1 4Q4Y2 2RS13 5C4WC 4Q4Y3 2HWB1 2R072 1RMU1 1VBE1 1B35C 4FSJA 5A32A 1QQP2 1QJU1 1ZBE1 4RFT0 1HRI1 4RS5B 2ZTNA 1VRH2 1QQP3 1VB2A 4JGYC 1VRH3 5L7OB 2RR12 1NY72 4JGYA 5ACA2 4RS5A 2RR13 5ACA3 2HWF1 1QJX1 1PIV2 2X5IA 1CD3G 5L7OA 1PIV3 3TN92 1ND2B 3TN93 1NA1C 2WZR3 1NA1A 3LOBA 4CDQB 1EV13 4QPGC 4YVWB 4GMP3 1AR72 2GH8A 1AR73 1VBC2 4YVWA 2WFF1 1AYN1 2BPA2 4IV1B 2BBVA 1MEC1 1R083 1AR61 1BBT1 1PVC2 1QJY2 5JZGB 1HRV2 4IV1A 1QJY3 1RUF1 1RUH3 1HRV3 1K5MC 1VBB2 5JZGA 1OHFA 1ASJ1 1VBB3 4IV3C 4Q4V2 1BMV2 5FMOS 4Q4X2 4Q4V3 4CDUC 1V9U2 4Q4X3 1ND3C 2RS32 1V9U3 4N53B 1AL21 1ZBA1 1R1A1 1VBD2 1POV0 3FBMA 1X36A 4WM7C 3CJIB 4GH4B 2PLV3 1VAKA 5K0UB 1PGW2 2MEV2 3CJIA 4GH4A 5AC91 2MEV3 5K0UA 3JB8A 2RM22 5D8AC 1TME1 1RUE2 1FMD1 4Q4W1 4RHV3 5CFDA 2HWC2 1NCRC 1RUE3 1TMF2 4QPIB 1TMF3 4Y4YA 1RUI2 1X33A 4QPIA 2HWD3 5BNPC 1FOD2 3J8F2 4CEWC 1OPOA 1FOD3 3J8F3 4CEWA 2RS11 1RUJ2 4PDWB 1COV2 3ZFEC 4Q4Y1 1AR92 1H8TC 1RUJ3 4CDWB 1COV3 1AR93 4PDWA 3VBOC 1NCQB 4WM8A 3ZFFC 3VBHC 2RS52 5BNOB 3JD71 4RR3B 1QQP1 2RS53 1VRH1 4FTBA 1AR82 5BNOA 1E57A 1D4M2 1AR83 2RR11 3ZFGB 1D4M3 5DDJ3 2Y26A 2XBO2 1HXS2 2BFUS 2XBO3 3ZFGA 2ZAHA 1HXS3 2R073 2WZR1 1Z7S2 1Z7S3 5GKAC 1EV11 1AUYA 2ZZQA 2WS91 1AR71 4RS5C 2X5IC 1R081 5L7OC 1B35B 4FTSA 1C8M2 1QJY1 1RUH1 1NG0A 2BFUL 1C8M3 5ABJB 1ND2A 1SMVA 5C9AB 4CDQC 4Q4X1 4CDQA 4YVWC 1V9U1 1AYM2 3S6PA 5C9AA 1VBC3 4RQPB 1DDLA 1AYM3 1R091 4IV1C 2R042 4RQPA 5FOJB 1PVC3 1RMU3 2R043 5JZGC 2WLPA 4QPGB 2PLV1 1HRI2 4YVSB 2MEV1 4SBVA 1F2NA 1VBA1 1RUG2 5J96B 1RUG3 4YVSA 2RS33 4RHV1 5C8CB 1RUE1 4CDXB 4N53C 1K5MB 4N53A 5C8CA 1VBD3 4CDXA 2HWD1 2QQPA 1FOD1 3J8F1 3CJIC 4GH4C 1RUJ1 3VBRB 2HWE2 3ZXAC 5K0UC 4JGZB 1AR91 1RVF2 2HWE3 1AYN2 2WFF2 4NWWA 1RVF3 2WFF3 2RM23 1MEC2 1EAH2 1BEV1 3VBRA 4CEYB 5CFDC 1MEC3 1EAH3 1FPN1 2RMU2 1WCDJ 2HWC3 4QPIC 2RMU3 2RS51 3NAPB 1PO12 3IDEA 1ASJ2 4Z92B 1PO13 5BNNB 1RUI3 2IZWA 1AR81 3NAPA 1D4M1 2GSYA 5DDJ1 5BNNA 4N43B 4BCUA 4PDWC 1RHI2 2R071 4N43A 1MQTB 1RHI3 3VBUB 4WM8C 1F8VA 1ZBA2 4CDWA 1Z7S1 1ZBA3 1OOPB 1MQTA 1NCQC 3DPRB 3VBUA 3VDDB 1NCQA 5BNOC 1OOPA 4RR3A 3DPRA 3VDDA 5ACA1 1NY71 3VBSB 1PIV1 3ZFGC 1PGL2 1TME2 4AEDB 1FMD2 1C8M1 4Q4W2 3TN91 3VBFB 1TME3 1FMD3 2DF7A 2R062 4LLFA 2R063 3VBFA 4Y5Z0 1RUD2 5CFCB 4GMP1 1RUD3 1VB4A 5C4WB 5CFCA 1VBC1 1POV3 1A6CA 5C4WA 1PVC1 3JBG2 2R041 3HAGA 1HRV1 5A32B 3JBG3 1B35A 1ND2C 2BUKA 1VBB1 3JD72 1RUC2 1IHMA 5ABJC 4JGYB 3JD73 1RUC3 5ABJA 4Q4V1 4GB32 1BMV1 2X5IB 4GB33 2FZ2A 5C9AC 1RUG1 1PO22 2RS31 1W39A 1PO23 1HQNA 2HWB2 4RQPC 1RMU2 1NA1B 2WZR2 2HWB3 1VBE2 1VBD1
chains in the Genus database with same CATH superfamily
1WW6A 1UWWA 3QQ3A 1NCJA 1NKRA 4MQ7B 3UKNA 2VYRE 3ME2A 3GKZA 4RGAA 3SDCD 5FZ3A 1JGDA 3TB0A 4LIQH 4UDUA 5TF1H 1QJU3 2OKXA 3DUUA 3QJTB 4P4KD 3TNMB 4V33A 1P7HL 3PL6C 1Q0EA 3KBHE 2DWRA 2JG9B 1SZBA 4Y5XC 1W06A 2RM21 3I54A 4JCWA 1CGSH 2PPCA 4P07A 4YAQB 4HSLA 1AQKH 3EYVA 2R0WL 4FQLL 3VFRA 3Q43A 5A1FA 3AM2A 2D7NA 4CDXC 1KGJA 2HUHA 3Q2WA 4WV1C 5F7DB 4IIQC 4W4ZA 4Z77A 4JB9H 2X6AA 3C7HA 5CIPB 4NO0B 4R90L 4NIGA 1B4JL 1U5ZA 1J9TA 1S9YA 2P5WE 3HZYB 4NQSA 4E41E 5JHBA 1UY0A 2NZ9D 2XKOA 1AYOA 4A68A 5EB9A 4NR1A 5I8YA 5E2TH 1URIA 3M1BA 4FFYA 4Q2ZB 1L0QA 4XI5D 1VGKB 3PHQB 4CL7A 2D4FA 1GGYA 4ZSOB 1JRHI 3WLBA 3LD8A 2SEBA 4WWNA 4HS6B 4KI5E 4JLRA 4NUGL 5JOWA 1J1OL 4KUZH 3WIIL 4JFEE 3AQXA 3BKCH 1S9XB 2ICES 4HHGA 4Z95L 4CVXB 5B8CB 1XH0A 1I7TA 5IVXB 3HE7C 4TF4A 4XRCB 2A3TA 4E4SA 1F1AA 1PLAA 4JFTA 4QAMB 3KLHC 4AGVA 1G7JA 3ZXJA 3V4VL 2G0LA 1BF5A 4R83A 1TYJA 1NCRB 2VD7A 2X3BA 2OXGA 4XFFA 3DYMA 2OJZH 3RKDD 4XPAL 1JTOA 1N6UA 4XX1G 1NOVA 2VDRH 1C7TA 3LNGA 1GZQA 2ZZJA 4DH2A 2FIKB 1RL1A 1XEDA 2MMXA 5FKBA 3WEZA 2B4CL 3ARGA 2GZWA 4QHBA 1WEJH 1KIPA 4N90E 4LPVA 2WJSA 2TSBA 1TNRA 2YC4A 1HI6B 4XT1C 1LB2A 4MA7H 2NY6D 3FQTA 4UB0L 3MROA 1WA2X 2QHLA 3BVUA 4NQUA 2WHVA 3VBOB 5L19A 1ES0A 2A74C 5AAMC 5DUBA 3C3VA 4BQ3A 2HCZX 3BW9A 3K91A 3ZKMC 1FVDA 1SN5A 1KXHA 2XTJE 3O4OB 5DZJA 3SYOA 5I8OH 2YU2A 3TBYB 4RGKA 3IAGC 3VBFC 1SHMA 4AEDA 4L11A 3CN3A 4JFWA 2O6DA 3DIFA 5D7KE 4CU9A 4MJJA 2BNQA 3RAJH 3GJFA 1LOCA 4Q8LA 2HKAA 3BUIA 2GNDA 2NLRA 1JYIA 2I69A 3D18A 4N8MA 3U0PA 4NBYB 3MIHA 1KGYE 5DDJ2 1NLRA 5F3HB 2RS13 3ZTCC 3TF4A 3ZE1F 3TO4A 1GAFL 4PS4H 3AP6A 3L9JT 1U8PA 4ZS3A 3GKWL 5D7JD 4CMMB 3B43A 4G43A 4HXBL 5FAAA 5LBVA 4ABUA 2EXIA 2QSCL 4B5ZA 1ULDA 3B02A 2CLVB 1TTCA 5F3FA 3CBNA 5DUPH 2FVNA 5KUMA 1U8LA 2CUMA 3SCMA 1TO5A 4LFHG 3FB7A 1B88A 1NIDA 1SZNA 4HJJL 4QTFA 5JNYB 5C5UA 5LY1A 2Q8EA 4L2NA 5FDBA 1RZKL 5IVZA 2GJ6B 5E70A 3C7OA 1VB2A 5T55A 2P5EB 1XGZA 2BOLA 4KXZI 4BQBA 5FA4B 3SKNB 5EUOE 5LG1A 3IJYB 3WTWA 4RS5A 4C1WA 1GC1H 1DBBL 3SDDD 3DTXA 4I0KA 4WUUE 1KACB 4NHKA 5F9WB 2JDUA 1NC4A 4DNLA 3W9EA 3T6WA 3FFQA 5FBJA 4YHLH 1U8JA 4YW3A 4LA2A 1ND2B 3W11C 3QHFH 2DWDB 3N41B 4JFED 3TZVA 1UXWA 4XJ9A 3MRIB 4JFOA 1JN6B 1OW0A 1BVLB 5C0NC 4HLTA 4OLZH 1CC3A 1CGUA 5EOCH 4G7VH 3JUZA 2YUZA 1RUH1 4XQWA 2DYPD 1MCWM 1JPFA 3D07A 5CFHA 3W81A 4KX9A 1D9KD 1M1XB 1NLBL 4FS0A 5HHMB 5GZNC 1QHDA 1EFXA 2DUOA 4ZXBD 3UTTE 5D5MA 3GXDA 1JI6A 1MEXH 4QRPB 1T89C 4AFAA 3U46B 1WZLA 1QI3A 5I16B 2BSRA 1SQ4A 1QJY3 1UAIA 3E6FB 3WL9B 1HEJC 4HOOA 1F6LL 4N85A 4IHOB 3ZHFA 2DVAA 4PJHF 3SXWA 3GLDA 4F3FA 3QZBA 4DP8X 1VBB2 3S96B 1NGXA 2HT3C 3Q0HA 4DVBA 1MNNA 5AW0B 1ASJ1 4LHNA 4DGIL 2K1MA 1N0LA 4JO4L 4JZJC 2ZCHL 2V5DA 4PBDA 1LILA 1S7WB 2D9QB 3BAWA 1ZLUK 3ZN6B 1C5DB 4AFCA 5DFVC 1R24A 5DMJB 4FADA 1BFOA 2OIIA 5EOTB 1J84A 2RS32 3EXUA 4LR4A 2A1WL 3Q2CA 1V9U3 4JAAA 4X5LA 4N0CD 5BPXA 2APSA 3MV8A 2JKBA 5IY5B 3CNKA 5H35A 2R4RL 4L8CA 1FA4A 2XTJD 5EU6B 1R1A1 4R52A 5J6GA 3LMJL 1BXHA 2XIBA 4BZ2H 5T3XE 1F5WA 4NQDB 2Q7NA 3IDXL 1OIOA 4FN0A 3LQAC 5D7KD 5D2NB 1EDQA 3T6XA 1XB9A 4HFWB 4W6YB 1CZVA 4O2CA 5HYEA 4IRJB 5HV4A 5K0UB 1HJGA 1E9PB 2WKKA 5IB3B 4H26A 5FY1A 2BOBA 4PWEA 5AL0A 3QEHA 5EULV 4JDNA 2VL4A 2GJJA 5DMGC 3SQBB 3TJPA 3MLUL 3WIHL 4DP5X 3OAZH 3K0YA 5FZLA 3LXAA 1IJ9A 4FFZL 3DETD 3CDZB 1FI8C 1JNLH 1RUE2 4BMBA 1S9VA 1S78D 2WVVB 2BSBA 5GQBA 4ZO8A 1O6UA 3BDXA 5T1DL 4BBWA 4LK4A 4DERA 3HS8A 1Z0NA 1A25A 5FP9A 3CLWA 3VSTA 3WUZA 5SX5H 2OJEB 4ZS7H 3MYJB 1UKQA 5I23A 2VNOA 5GGQH 3GMRB 5B39G 3QULA 3VO0A 5AEAA 2BVYA 5HPOA 4CNIB 1X44A 3B3BA 3DMMA 2D4DA 4ODTH 4LSRH 3VU2A 1KTLA 5IHLB 1HZLA 1KBBA 1AR92 3UX9B 3IKWA 4PLOA 4WUUD 5BQ7A 2ZWYA 1D5XA 1P4LA 3DOHA 4RGNC 1H8VA 3RVWC 2D2CC 2B42B 1AS6A 3CZFB 1XB6A 4DO5A 3MUHL 5J11B 4JG0H 3U2JA 1KB3A 3SE6A 1LHWA 3CLFH 5A6XA 3L95B 2VZTA 1R47A 4JFDB 4PI2A 2BWAA 3E5QA 3LS4H 1J12A 1QTSA 4DRVA 2FNBA 2EUXA 4ZAKC 4U2YA 2XOMA 4ZSOE 2ZWNA 1E5BA 3CFJB 3F58H 5DR5L 4XAWH 1DJIA 2EDTA 5D93B 5JOFB 3LKJA 4ONUA 5IQ9B 4X4ME 3UTTD 4ABWA 2WK2A 1T1XB 4KZCA 3DL3A 5EXOA 3BUCA 1JZGA 2HKFH 4NPYB 4WJG3 2Q0ZX 2VDQL 4BFJA 4QTIH 2QZ2A 4I85A 5FB8A 2VJXA 3MJWA 4XVJH 3ZTJH 2WZR1 5IVXE 2R16A 1F11A 3GSRA 5CFAA 2F18A 2MCAA 5JMCA 5FZEA 5HGBB 2YG0A 3EBAA 4GWNA 1IT9L 4AQAB 4G1EB 3TRSB 3U0TA 4JPIB 4Y5VA 4LFHD 4PJ9D 3OAYH 4L4VA 4MO3M 2AGJL 5IGXL 4ZX3A 1QSED 1TMCB 5D1XE 1H8OA 1OHZA 1NKOA 4FHBD 4YDZA 4Y2DA 2ETWA 4GI9A 3FN0H 1Y07A 1K85A 3OSDA 1NL0L 4HLJA 3RGBA 5M7QA 3EG9B 4AQTA 3RZKA 4HK0B 4X4XA 1KLFB 5H9QA 1WD8A 4K3DL 3BPCB 2XN1A 4NN5B 1DQJA 1K45A 2WUHA 2V4VA 2BHFA 3CMGA 4K7FB 4NENB 3NGBB 4KZDL 1JBCA 4ONFH 4JQVA 1DVFA 4OUUB 3QE5A 4ES9A 1CLOH 3QNYA 1F2XK 3DVNB 4GQ7A 3FSAA 3ZYGA 5M0TA 4KUCD 2V4LA 4U3SA 3WO4B 2AQPA 3VI4F 3H8OA 4OULA 5IBTL 4HJEA 1CGXA 2EXYD 2AJVH 2BVUA 4LSUL 3UPCA 4F8PA 3L7FA 3B5GA 1EFQA 2J6EL 5CKGA 4INDA 5A7PA 4DPRA 5I5JA 3LKOA 2QQIA 2AQNA 1WS7A 4L8BA 2IWKA 1G7PA 1Y1UA 1LQBC 2Q7YB 7CGTA 4HW6A 5A40E 4QXCA 3S4SA 5LCWL 3VG0L 1OCRB 2K8MA 4UIKL 5I30L 1EWHA 2HSIA 3HHRB 1RP9A 3KYAA 5DGQA 5F1OB 4MQTB 4W6XA 3DURB 1HEZB 1MVUB 2VDMH 5T33H 1U91A 5JR2A 5CJXC 1EJOH 5B1JC 2QCSB 3M17B 2EE9A 2WWKT 3WTUA 3VQLA 3D3VD 3OKMA 5AW9B 3MEPA 3QW9A 4LIUA 4F83A 1VFAB 1ZA3A 2E27H 1K72A 5E9DD 4TOYL 5EORH 4K40A 1JPGB 5ABDE 1N59B 1VAHA 2GJ6E 4QRTB 1AE6H 2AERT 3RU8L 1KIRB 2X2UA 5B1KA 4PGEA 1ZRUA 1ZX5A 2P5EE 2OJ1A 5AG9A 3O9WB 1XAKA 5BOPA 1UOLA 2OZ4A 3D5OA 3F95A 1ACYH 4F9LC 3C6EA 4DZBB 4F8OA 1XRUA 2ZSVA 3K4DA 5IB1B 4OV5A 2W87A 3MNZB 1ZK5A 3WNMA 1M7IB 4LIQE 5KYYA 1SLVA 1S7SA 3MLYH 3PF2A 1D5BB 1RSFA 4QJ4B 4L37B 5JW4R 2GK0A 2OZ6A 1DBKL 5E6UB 4OM1H 1GV9A 5FO9B 2CSPA 3QUZA 4MZ3A 2DFCA 4ELDA 4YLZA 3RE0A 3NO8A 4F33B 3B7SA 3O3BB 3PG2A 4M7LT 3OV6A 3NNMA 2ZTBA 1PY4A 2XWTA 4MA3B 4FX5A 3EJRA 4YPJA 1SN2A 2X2YA 1CQ9A 4LAJH 2CHDA 2ZKNA 4QPIC 1N2RA 3CZGA 4MNHA 1UWEH 5K8SA 5HHME 5D2LF 3GEFA 5FO8A 1OE3A 4XFIA 4JPWL 4JNXA 1SBEA 1XNTA 1FG9C 2EF6A 1HN0A 1EANA 3OB0K 3LZPA 3PWLB 4QRPE 1MS4A 5D1XD 2YPLB 1BFTA 5DDJ1 1VADB 3BYTA 4Z7WE 1PZDA 5EOQH 3TCLA 3PVBB 4NNXB 2AZ5A 5ID0A 3O4LB 4D3CH 1KENL 3ETQA 1HFUA 4XXDB 1KOAA 1CAUB 4S1RH 1XR9A 4O9HL 1GWKA 2LS6A 1HTYA 1XSKA 2CQVA 2VCOA 2VMJA 3P73A 3LH2H 1EERB 3P3UA 4NRMA 2HLFC 1Q0XL 1ZBA3 1D6VH 4DVRH 2R1YB 2P5BA 1JOPA 1MJUL 2K9FB 4ONHA 1MZFA 2ADEA 5CZVH 5CMAB 4M62L 5BXXA 1UZ6E 1VIWB 1F5FA 1OLLA 4XVHA 3AS3A 2BWQA 4HXAH 3AU1A 2HWZL 4KY1L 4XWGH 5EU6E 3BLBA 1REEA 1ZZ6A 2GMPA 2MHAA 3QJZA 5KJ4A 1CXEA 1INQB 2PPFA 3RWKX 1BF2A 1KDMA 4NQDE 5DD5H 5HBAA 1UOWA 3DSFL 4OUOA 1RIVL 4WCYH 4Y1SA 5D2NE 4YDKH 3FT0A 1AX2A 1SJHA 5E1GA 5JLZA 2EDFA 4QDRA 1UB6A 2DBNA 5KVGL 3POCA 5MEOB 1UACL 4UQIM 5AZEH 3UYOD 1R64A 5BS0A 1SFDA 5IHRA 1LL1A 5FYYA 4P2RA 5CFCB 1XE0A 3EQEA 4LHKA 3OCPA 1IAOB 1K4CB 5F7LB 2XKNA 4FXLA 3ABZA 3ZKSD 4U1LA 5HYJB 1C8QA 1PZBA 1X5GA 5FV3A 5C08A 3RJ2X 1C1EH 4TULL 1KPVA 2ZX0A 5LN8A 3SCGA 2Z1PA 3KJ4B 3O3AB 4XMKH 4LRIA 1ID5I 2XFXA 3B2MA 4P46C 4MCYB 3QR0A 1CVNA 4HZFA 3RZGA 3B2UD 1JYXA 2FWSA 4D0DA 4QT5B 3LAGA 4OB5H 4E42B 1CPMA 3CFBB 2AQ3A 3TNNA 1MRFL 3GSWA 4R97C 5HDWA 5DZGA 1VBB1 3HAEH 1QR4A 4WY7L 2W0FB 4JN1L 3K48A 4M6NH 3KEDA 3UKTA 2VZSA 1YNKL 3FN3A 3KV6A 1W0YT 4CKVX 3USSA 5HYIA 4CCDA 2EKSB 1AO7B 5GZOC 4BB3A 3OPUA 2WNVA 5J06A 1IEHA 1W39A 2RS31 3B9CA 5FZMA 3DIVA 1NGPH 1PO23 1UIJA 3GZOA 3NABL 4R0LC 1ZIAA 4JFDE 3O0VA 3TNPB 1FFQA 4OFGA 4UM9A 3ARSA 3E8VA 2HWB3 3RZWA 3UXFA 1SEBB 2Y5TA 1JWSA 3DJRA 3UYRL 3V4PH 4PD4K 3ZDZF 4E9WA 4Y8AA 1OAUH 5EA0H 5DRZB 4NN7B 1FGNL 1EV12 1OC1A 1LWHA 1MFEH 1P4BL 3P6BA 1MIML 5BXFB 5C1MB 1JSYA 3MJ7B 5F3EA 2RQ8A 3DROB 5TDNA 1XV8A 1T4WA 4JS7A 4MFHA 7FABH 2A99A 1RVF1 1G7HB 4ONGH 3HA0A 3BP7A 1UCBH 1XF4B 5KVEL 3SKMB 5MEPA 1AY1H 1TSHA 4APQB 1RIRA 4Y1AB 2K7PA 2MQGA 3HG1D 3DBXB 1UKSA 2R2HA 2A6KB 3EFFB 1L9PA 1YO8A 3FRUA 2C9SA 4NQCB 5C0DB 4H0LC 5J4MA 4B4PA 2GCYA 3BE1H 5ECGA 1EXUA 1DF0A 2NX5B 2OS7A 1OB1B 3NNJA 3HE6A 1M2OA 1AD9A 4DPCX 4JDEB 1T66C 3P3PA 1H8SA 4H8WH 1YEKL 2PW2A 5I24A 2GIXA 2JKNA 1SVZA 1W0NA 3BD4A 4TQ8A 5D1QD 4IV3A 1L7TL 4LARH 1MWOA 1DGWA 5I19H 4JFHD 1HCZA 3MO1A 3Q5TA 2J88L 3FTGB 1J0KA 1DQKA 3UABA 4KBBA 2NTFA 1XNDA 4NS0A 4NYLB 5EIVA 5IBUG 1RUF2 3RHWK 4AVTA 3JWOL 5AWNH 3KJ6H 5DLMH 3R8BB 1K3ZA 2W94A 1A7PH 1XHHA 1DCEA 4HVBA 1CDJA 4S2FA 4URTB 1GGIL 1KCRL 4X9HA 4W4OA 4OQ9A 2AC0A 3WNXA 4X6DB 1WZ1L 1ACZA 5KWYC 1BJQA 4S2DA 3VXQB 1WFTA 1SJEB 3F6LA 5C9JB 2CA3A 3IAQA 2APTA 3KF3A 3HC4L 3D8CA 1EUUA 4MAYB 1KMGA 3QAZC 5JO5A 3HMXH 5FK9A 2LLNA 3PWNA 2WLYA 3O8XC 4RRPM 3VNZA 4PJHA 4W9FC 3X1FA 4I77L 2O8QA 4GWMA 5KHJA 2DLHA 4NHYA 3ARVA 1U4EA 1YAIA 3NZUA 1G9NC 5EBWB 2VH9A 4RDQF 4P9HH 4WI7A 4QKXB 4JZNA 2JG8A 5D6DA 1H8TA 5EEZA 1GHFH 3ZTJG 2VERA 3TA3A 4PIRF 1QH7A 4OQTA 5CEYA 1KT2B 5BVPH 1T4KB 4YXLH 4AEJA 4PJDF 3BSZL 3G5VA 1E67A 3TV3H 1D2SA 5JXAH 1S0JA 3ZSKA 4ASMB 3NZ8B 3QD6A 4LASL 1DBJL 2YAOA 1CE1L 2YC1B 2R69A 3RI8A 1WAAE 1OSYA 2X70A 4DP1X 3CFEB 4BXVA 1S8DB 4HF5L 2X38A 2VLJB 3PJNA 1JUFB 3HAEB 1F42A 2IH3A 4QRSB 4FQQA 4ZONA 1KZYA 5FHBH 3GSOB 4HUUB 2QL1A 1ENXA 1T5XB 1Z5LA 4GAAA 4P2OB 5CIRA 2ZP8A 4HLEA 1GJUA 2X53S 4O02A 3NJKA 3VA6A 1DVSA 4M29A 3POYA 4ZUTA 4FQZA 3BTZA 5I6KA 2WLLA 4PVLA 3IU3A 2YPLE 2CY6A 3RIFF 1D0HA 1ZVYA 4XF0A 5T5FL 3BKYL 1R3IH 4FRWA 5C0FA 2EXHA 3MF6A 3N7LA 4JO8A 2VZ1A 1ORSB 4HS3B 4ZFOB 4AYFA 4J6RL 5BO1H 1NFAA 2ICWB 4G72B 2BNUA 4LF3B 5CKAA 1QJX1 1WS8A 2OFQA 1RK0B 4UQ3A 3MRGB 4GAJH 3V10A 3NT0A 1FZJA 1YN7B 3L4XA 1KLGB 3RVTD 5A3NA 1KCLA 5AVSB 4XBNA 1CICA 3PPEA 4DO0A 5DJCA 4DW2L 1XNCA 2VXJA 3LY6A 4MLSA 2AEZA 4HN1A 3QUGA 2XWCA 4Y4FB 5FY0A 5FY4A 5CADA 1O75A 4A2UA 2AAAA 5DS8B 1JAEA 4GQRA 4X7DC 4AAPA 4L1SA 5DEJA 7TAAA 5F5AA 1AQDB 1KCKA 5FM5O 4S1QH 5FYLL 1Q5OA 2PCFB 4U1SB 3X3GH 2MQCA 3IDMA 1OV8A 4P5MA 1UTDA 1HJBC 2O1QA 4KMTL 3WY3A 1BOGB 3NCJL 1UWXH 3T4AA 5IHZB 2D3PA 3M4FA 3NEOA 4E9VA 4HMZA 2WUCL 5FGBA 3WW3A 3T4HB 5HYJE 5CF3A 3R0RA 3ZMOA 3V4UH 4K8RB 3HT1A 2ZKLA 2WO7A 2Q1EA 3GSQB 1CWVA 3QPQD 4GKYA 4UFHA 3OX8A 4AQ1A 5ADPL 5CZXD 3GLEA 3UJTL 1I3VA 4MS8D 5EZJB 5I18H 2LRPA 4IEPA 4EF3A 4CSWA 3EJTA 4R4FH 2Y07H 4XC1L 2OLDA 5JSRA 2VGLM 3HKFA 3MODH 3QUKA 3FO1B 1XE8A 1B3IA 1H5BA 1KJ3H 4A3ZA 3FRPG 4LQFL 3ZT7A 3SPGA 4ANUA 4MUVA 4LESA 1AO7E 4M48H 1QASA 2AEQL 2EYRA 4MMYB 3JWOC 2OTWB 4WHYH 3VMPA 2BP8B 5JHDA 2AGSA 4HK8A 1KDJA 4FC3E 2NMSA 4JQRA 2MOGA 4X7SH 3LFMA 4OFVA 1T03L 1NUFA 3IFNL 2B9BA 3L3OC 4YHNA 2GPZA 2QVMA 3VI4A 5C2BH 5CAYB 1JWUA 1QEWA 1AGCB 1S7RB 1CK0L 4IEFA 4M43H 4META 5CG8A 4OZ4B 5K9KA 1Q0YL 5IATA 1MIEL 1UJ3C 4M8VA 4EBQH 1MPXA 1GS7A 1MCKA 5TH2B 5E51A 3TNQA 4NPKA 4YLCA 3J7MA 3QZWB 4CN4A 3BKMH 5FZHA 5EPMA 4HPYH 1FG2A 1FOD3 3K8LA 1CF8L 4Y1AE 3MLRH 2FBJL 4PS7A 1W2OA 4Q4Y1 4Q8BA 4NQCE 4BZ1H 3BDBA 1XMWA 1NFIB 4EN3B 2NX5E 1KEXA 3CZKA 2UU8A 5CCJA 1DHKA 4POYA 1I1CA 1DEEB 1Y18A 3AM8A 4YSPA 1VFUA 4YGBA 4WM8A 4A6SA 2AITA 1C12B 3DVFA 3VXMA 4JM0A 4ISVB 2Z34A 3B5HA 4GY4A 4J25A 4M1GL 4R4NC 2FT8A 5IQ7L 2DL9A 5K33A 1SDAB 5JUEH 1YEIL 3L4YA 3N0AA 5HVWA 1DSFL 1RZFH 3A6BL 4N5EC 4UQ2B 5CILL 4BYYA 5BNOA 1ZLVK 2LU3A 4RWYL 1AKPA 1IEAA 4LZKA 4X80H 5FBZA 4OGAD 3G6DH 2W60A 5E2WH 1YA5A 1EUTA 1XGUA 2LTQC 4BFIA 2FGWL 5IW3A 4BKLB 1P8JA 4AUYA 3QPKA 2BFUS 2XBO3 1R33A 2P24A 4P5RA 1AYRA 1ETZA 1UD6A 4NPMA 1Z7S2 2BRQA 4HLZH 2P17A 5AENA 5FOBB 1NMBL 1T2QL 1EV11 3X12B 2QKSA 3FT4B 2WAOA 4X6DE 3MV01 1EYBA 2XZAL 1JPSL 3BQUB 3M6DA 3S57A 1H15A 3N3HA 3WNJA 5B7FA 4J1UA 5D2LA 1B09A 2NY1B 4QHUA 1I8KB 1O7DE 4JFQA 2PXYD 2B5IB 1YMHB 3K72B 4LBEB 5I74B 3LOIA 4MYEA 4LOFA 4FFIA 1CXLA 2Q3ZA 3B37A 3LNEA 3PP4L 3AKQA 1OTTC 2Z35A 4PG2A 2J20A 3NV1A 3UGEA 3WTVA 5FHAL 1RTVA 2ZUUA 4IDJH 5DJAB 3WHXB 2ITDA 4JZOB 5C7XL 4HCRA 4I01A 4XNMA 2JDMA 3VD9A 5H2BA 2EXWD 4P57B 4CDQC 1J3PA 1N64L 1NTDA 1OAYL 3PNWA 4IGBC 2I60H 4OD3H 4P5TB 3ZTNL 1O8PA 1BQ5A 3WUWG 2ITFA 3HNVL 4ODVL 1N5YL 3ULVL 1HVXA 3RZCA 4DP7X 4BJLA 4TRPL 3LHAA 3S36H 5FYMA 4LSDA 1E4XH 4FYTA 4PWJA 1T21B 4A2FA 4JRYA 4OZHB 3NMEA 3SGJA 1W6QA 4L0ZA 3HR9A 3BMWA 4CSSA 3I2CL 1R1ZA 4L1TA 1JHJA 2HXAA 4LCVA 4N2KA 1PHMA 5JZGC 5DWUL 3MOAL 2AMGA 2R83A 1ZHBA 2RQEA 3NN8B 2EXJA 3F12B 3PLYA 4U3CA 3APFA 4ZPTA 4UFIA 3CN4A 3FH7A 4BFBD 1I7ZB 2IXKA 1NCAL 3MLZL 4IBTA 2CGYA 4ELME 5E5MB 3VXRB 3JV6B 1O7FA 2I9TA 3PL6A 2LHAA 2VDOB 4O2FB 5LCVL 4BZ4A 4Y5XA 5EU4B 4NJ9L 3WMQA 1WYJA 2V72A 4NP4H 3M1OA 4CMHB 1YEGH 3EYQC 3LV3A 1IM9B 4TKWA 4ENED 3EBRA 3P4OA 4JCMA 2G60H 1T1ZB 4JFYA 4LL4A 4MLOA 3W9DA 4CDXA 2RHEA 3DTUB 3GQFA 2ATPB 4WV1A 1P7QA 2BVOB 4IIQA 5AVQB 5FXCH 1OKOA 1JTPA 4QHMA 3J8F1 1W9WA 1MJ7L 1X50A 1UOFA 3VVVA 5DJZB 1NC2B 5FF6B 1XDTT 3V0VA 2W2IA 3IMWA 1TKWA 2HVJA 4WI3A 1INEH 4A67A 1ZS8B 4HPOL 3MFGB 2HLEA 1NKGA 1T2JA 2BH0A 4G6FD 2Y7QB 4MNGB 1RZPA 1ADQA 3DX7A 3H0TA 4KROB 3GBWA 5CFDC 4MMZA 5KS9B 4Y4KD 1N7ML 1PD0A 4LGSB 4BIFA 2BC4B 5GRUH 2HWC3 5ACZB 4UYQA 5C0EA 1H3PL 1Z9MA 1UYXA 2RMU3 4Y19B 3TO2B 4PW3A 2B39A 5I1HL 2W46A 5CA6A 3C08L 3VI3F 1KFUL 3KV4A 1IBBA 2IXQB 3GSNH 3SEPA 3HE7A 1XF2A 5DO2D 3UGHA 3ECWA 1Q8OA 2GTZB 4MNQE 3QWQB 2JIXD 1NLSA 1NANH 1QW8A 4M03A 4Z07A 3QDHA 3MSPA 2RMNA 4LSTL 5A6IA 1WKYA 3FU7A 1HHIA 1IC5H 2ADJB 2PR4L 1UXSA 2D7MA 2Q76A 3FUMA 3MV9A 3WT3A 2EO7A 3H56A 1ECZA 4TNEA 3ZSJA 5EN2A 1A7OL 1U9KA 3G5ZB 4JN2B 4WHCA 4CP9B 4NPLA 1JYVA 3MDJA 2NW3B 2CNAA 3AZVA 2DMGA 3ZYFA 1AHWC 2WYIA 1FV1A 3UG3A 3O1MA 5ALBL 5IHHA 3ZT5A 1W9FA 1HZHL 2E47A 2EP6A 2VW4A 4RMUA 5C09A 4NLHA 2QELA 2XMLA 1FO0H 1UOBA 3ZFGC 4KXAA 2MPFA 3DHUA 2EILB 1IZKA 3EGDB 2H6UA 2G5UA 3BD3A 5L9VA 2A74A 4QF1B 5AAMA 5ICXA 1EEQA 3ZGIA 1NZIA 2XONA 4QRQB 2WCGA 2X6CA 3AREC 1GYCA 1N9PA 3VBFA 4JPKH 4AM0A 1XTLA 1RIUL 4YHPB 2OYZA 4X4YA 4Y8DC 4A1RA 1TJGL 2WFPA 4DIXA 5AFBA 1UM4L 2K2SA 4LOSA 2J25A 4JFXB 1A7NL 1B3JA 4COVA 3IU4H 4QOKA 5B1BB 4ETQA 5FM4A 1EH9A 1QFPA 1XH2A 1Z3RA 1I4FA 3BAXA 2JF1A 3ES6A 3L3KB 1JMUB 5A3IC 2P3YA 3KE0A 5HDBB 1OKQA 4MGQA 1W0OA 2PHXA 5LA2A 4XDOA 3CPUA 4LVHB 1TVBA 4I0PB 1XYNA 1NBZB 4L9BA 2P8MA 1SVCP 1BXXA 4ZPIA 2NZ1A 5JXIA 1MZEA 3GBEA 1SCSA 4RA3A 2BTVC 3FFOA 4LBLA 4X6FB 1IHMA 5DC9B 2QQKA 2B45X 1KUMA 3UAEA 5ABJA 1A6VH 3FFZA 3QFDA 4M1DL 1RD6A 2WO3A 4G7RB 1RZGA 1NPJA 3IE9A 1FFTB 1S6NA 1T0NA 4YO0B 3UTQA 4GB33 4GNKB 1F45A 3B9EA 2W9LA 2BVPA 4KJQD 1TQ5A 1KULA 1QGLA 2VZRA 1QVOA 5HBBA 3QA3A 5BOZG 2V73A 1DN0B 2RDSA 4U49A 5ISZD 3S35L 5I9QC 2YUWA 3ULVC 5C6TH 3CAFA 5INDA 5G04L 4KDVA 2RTTA 1FE8L 1N3QA 2WL1A 3AZXA 4PEEA 4R4ZA 4PCKA 3MVSA 4PJDA 1WICA 1J0YA 5IK7A 3IJSA 5MENB 1PQZB 1RHHB 3S3BB 2EVHA 4UYPA 2UWAA 2L4OA 2WAQA 3QCUL 4NNYA 3QCVH 3KWTA 1ZT7B 4AVSA 2HWE1 3MUGA 1QYGL 3LSOB 1J1PH 4MHHG 4MNQD 4PJCF 4NQVB 4RISL 1O59A 3ENRA 4LBQA 4TS6A 3DCQA 3ZHLA 1OAJA 5TQ2H 4ACTA 5JIDA 3MO4A 2G9HB 2OT7A 4J4PC 5DZEA 1ZXQA 2XETA 4WO4B 4KU7A 3GYDA 1I9IH 1T89A 2ATAA 1NA8A 3QOPA 5FZFA 1LOGA 1NT0A 1SDDA 4WHYG 1EPWA 2ROYA 5K1JA 4AFDA 3TWCL 2ZYSA 4QRAA 4H8UA 4PRBA 1R5VB 2COVD 1BQHB 2CK2A 4IYKA 4BWUA 4HQQH 4QKFA 4JZJA 2IBBA 4ANWA 4HVQA 5A6ZA 3THML 5H8DA 4KAQL 2E9JA 3V0AB 4JVWA 1GFF2 3SD5A 2CK0L 4S2SB 5E4AA 5FLHA 4AEMA 4JKPH 1WUNT 5CKMA 1RZ7L 1WVZA 3DSNA 4NZUL 3L4WA 4RMBA 4WK2B 4E2OA 2DQCH 1UZVA 2E32A 4PRIB 1KFXL 1BQPA 1E4KC 3TVMB 2QQLH 4PJBF 1IFHL 2R1XA 4FFWC 5CEZH 1VPHA 4IW3A 1OQOA 4WKZA 1ONQB 3SCHA 4AEEA 1KDIA 2VTXJ 4JUTA 4XFHA 4M8RA 4S1DC 3DRQA 3H7LA 3IFLH 2JXMA 2I27N 5I0WA 3U4XA 4OZHE 2WZAA 4KJPC 1YI9A 2ENQA 2FUTA 1XSQA 3GMMA 2MIZA 4DEVA 1F3RB 5H94B 4PJ7B 4KHTH 5L88L 2A73B 3NJXA 5MI0B 3O1TA 2D73A 4BSJA 2J12B 5BRZA 5KW9H 2KDGA 2WWOA 1JZDC 1A2YA 1TZIB 1HT6A 1YLBB 4I4WB 4YGCA 3N44B 3VXRE 1W8NA 5C2UB 4AL8C 2JVUA 2E6JA 2J1YA 3O6ML 1I8AA 2WVUA 5E03A 1DFQA 1MCPL 3EDKA 2ICEB 4M7ZB 1IKFL 3JUYA 4KKCD 3N36A 4LCWA 2FGZA 4OZIE 1U3HA 1KNOB 3NACH 3RVXD 1UCXA 1CL7H 2J22A 4U1GC 2ALWA 3ARGD 4KK8D 1YLLA 2QQOA 3B94A 1RMFL 3LPWA 4WW1B 5CUSL 4X5RA 4Q4W3 4XJZA 4HXCA 4JKWA 4L9LB 3L1OH 1AJ7H 3FW6A 3SGEH 5HHPA 3D0JA 2ZMLA 1UL9A 3TCXA 2XUWA 1OE2A 1PZ3A 5B3SB 4OAWA 3RG1C 3TIDB 4ABQA 3P5BA 5FKCA 1YCIA 4MNGE 4U0QB 4MJIB 1H1AA 4JM2D 3FC8A 3MJ9H 4ZAKA 5LNGA 1KSRA 5KS9E 5T5PA 2AK1L 3ITQA 3PWJA 3D0SA 1E40A 5HV0A 2X4OB 4EEEA 4NKIL 4PJXF 2NUTA 3KWXA 2F53B 4Y19E 1NDGB 2D43A 3ZR6A 3K2UL 2V2XA 3JYBA 1FZMB 1MJ8L 4UI2A 5CHNA 2H32A 4XMIA 2EIGA 4XF1A 2ID5A 4WHTB 4PRDB 1A3QA 1MF2L 1OSPL 2BP3A 1ZLSH 5D7SL 2F58L 3GXUB 4GAYA 4V2WA 4OF8A 2W81C 3DVGB 2YJQA 3I9PA 3N5AA 3NRPA 4WDIB 3IMBA 1VRH2 1G7LA 5IF0A 4UOQA 1HV0A 2VBDA 4JGYC 1MUJA 2JTYA 2A5ZA 4NMIA 2DQTL 3TT3H 4OHXA 3JTTA 1A1MA 2AKRB 2R69H 3K71A 1UGNA 5I1IH 1EAPA 1JZHA 3AACA 1TZOA 3UZVB 4WI0A 4KK6D 3NJFA 3VFUA 4DINB 2GC2A 4YHYB 2XQYK 2XHKA 4HKBA 3FX3A 3C5ZC 1FL5A 4Y16B 4IRSB 4YNIA 1T04A 3ZXAC 1FFOB 1TQCC 2FZ3B 5E4EB 5F7MC 1U92A 1Z1WA 4YK4C 2J1ZA 3M46A 5GGVY 2N1KA 2CG9X 3QIBB 4WGVB 3S36X 1OXCA 3JU9A 1MRDL 3P4MB 3C5XA 5G5DB 1BQKA 1M2VB 2K6WA 5A1AA 4XCAA 1O5UA 2BNNA 1G9EA 3Q05A 1YEEH 3V0HA 4BE6A 2E4FA 4OLVL 4EQ3A 1A4BA 2OTUB 4MZRA 5HJGA 4RRPA 4ZX5A 1AR61 4H13C 1X5LA 1PVC2 3AK0A 5DVNA 5DD0H 2B3RA 4F8QA 4K73A 3DX9A 1EFXD 2NUPB 3T5WA 1RUH3 1HRV3 1VB9A 2G9ZA 4TNVF 4H7VA 2C1OB 3S4SG 3HZVB 5A6MA 3BGFB 3CVHA 3RL1B 4OFQA 3BUQA 4XC3L 3PAZA 4N0UA 5GISL 3DGGB 5HDBE 4PJFF 5F1IB 4Q4V3 3LCYA 3VD4A 4EUPH 4CDUC 1PLGH 5T3ZD 5CJXA 2WB7A 5B1JA 4MD5B 3VX1A 1OP3K 3UGFA 2Y2YA 2HA1A 3HCVA 5IWLC 1FL3B 3KM5A 5FP8A 3CBRA 3VD5A 4FFFA 1PG7L 4R8HA 3MFCA 2TUNA 2ZGTA 5ANMB 4QMAA 5FPIA 1OD5A 3H3ZA 2ZX9A 3WE1A 1FNGA 3BSGA 5I1JL 2BP0A 4WVWA 4N0FA 3O6FC 4TSBL 4OZGB 4P99A 3DN7A 4C56A 5E8NB 4QX3A 4AH2A 4JY4A 4ESKA 3CSYB 2DQFA 4CVZB 4I02A 3KPQA 5HHQB 2FE0A 3DV4B 1UWGH 4UBDD 2HFFA 2X4SB 4PLNC 4IBUA 3MRPB 2XDVA 3T2NH 1PFOA 1U95A 4O5LH 3MBEB 4YQXL 5FYKH 3SLIA 4ASLA 3PTRB 3MX0A 4FJYA 1TVHA 3LH8A 5CSZB 2OR9H 5E6IC 2AP2A 4OIIH 4S11A 4YDJA 2Q1FA 4Y4YA 4J6IA 4QPIA 3VWKC 1IBHA 1EEYA 5FY8A 3OF6D 3KCPA 3E8UH 4EI0A 1BIIA 2W65A 1NZRA 3U79A 1OK8A 4YDVB 1BVZA 1WWWX 1SOKA 3DLQR 4ZFQA 5CCGE 4U6HB 2ZWZA 5SV5A 4ZMZA 1JYWA 1N47A 3ZFEC 2R9HD 2NDFA 2YKLH 2HVBA 4LRNH 5DA4A 4F5CA 5JR1H 3ZO0A 1KEGL 2FLMA 1KTDB 3MXWH 2HBUA 2D7TL 2IG2H 2V3DA 4IU3A 1DCSA 2X8KA 3R0MA 2CH8A 3TBTB 3QBQA 5JLVA 2OKMA 3Q7JA 2K7QA 5K59E 2V5MA 2RS53 2NXZB 4NSKA 4R3SA 1QUNA 4YSSA 4JHTA 5B38A 4P9IA 1V05A 3LZFL 1HQ4A 4NN6B 4TQIA 3TEZA 4PRIE 2OPWA 3QORB 3RX9A 3SHSA 4PLJD 3UO1H 5FA3B 2O0OA 4YDNA 1L0YA 1M9WA 5F7EL 1XB8A 3QPXH 4ITCA 3D51A 1WUZA 2EDOA 1HXMA 1CFSA 1H3XA 3MRHB 1OFSA 3GMLA 4L05A 3GPEA 4PAZA 1GGBL 5C0GB 2B8OT 4HUVA 1CFVL 4LSQH 2ZGRA 3QDJB 4E9XA 4R7DB 2JLLA 3UTSA 2CTVA 5A7EA 1JODA 3VI3A 1CVSC 3PWUA 4C4BA 3VH8A 3FLPA 5CCKH 4MWFB 3PFUA 3MJ8B 5G55A 2N1TE 4DAGH 1S7QB 4Y2DD 3W2DH 2DQGL 2XGXA 2F15A 5BJTA 3IBMA 1K5WA 4EN2A 5KBMA 3GXPA 4OI9A 3VGBA 5FLIA 1UENA 3PQYB 3R1GL 3H3PH 1M42A 4LHJB 2F9BT 4C58B 2UZXA 5DF0A 2WNUB 3UCRA 4IQPA 1N5AA 3LZNA 1FPTH 1Q90A 2AHIA 1SMVA 3S9DB 2CKBH 1JXGA 1UH4A 4HUXA 4YR6A 1ND0A 2FQFA 3WCYA 5FLVA 2DMBA 3CZUB 3FNKA 4ZFZA 4AENB 2Q10A 1XH3B 5GZOA 1JF1B 5GRWA 2PN5A 1AYM2 1JUIA 4MTMA 4UNTA 3GMPB 1O3SA 2CDGB 4GUPB 4AVVA 2WXJA 2IALA 3WENA 4IV1C 3EBIA 5F5IA 1JPTL 4B1MA 5DRXB 4MJIE 1HH6B 2ZIDA 2VXVL 1CX4A 3PUHA 2WLHA 2VN3A 3L3GB 3SGDI 3BKJL 1AX1A 4UV7H 5AW3B 2IXLA 1OTUC 4B5EA 1U8QB 4HGMA 5EC2B 4NKMA 2F53E 3ZDXB 2J1VA 1X6NA 2GFBB 4TQEH 2PCPB 3RGHA 1CD1B 2OMXB 4LOUC 1XX9C 2Y22A 4DN3H 4MA8H 3MXVL 2I74A 2EECA 1J88A 3CZLA 3KLAB 4H0IA 1IBZA 2PW1A 4LUKA 2QZQA 3G7TA 4R5XA 2YBGA 5HXMA 3I3DA 3ULAB 4M1CC 1Y0LA 1A7QH 3QFJB 1PJWA 4BA0A 1MN4A 3KPPB 3O2DH 4LU5L 1E9OB 1KXVC 1PBYA 2GB2A 1LO2H 3GMQB 3OKLB 1WWCA 4JFFB 1SEQL 5JPMA 4BXFA 1AR2A 4UIMA 1GP4A 5FPZA 3MCG1 1LO0H 2D9CA 5DJ8A 4EZMA 2B08A 1LR5A 4ODUA 2I2SA 2NY0C 1J48A 4G5ZH 4JGZB 4P9GA 5F1NB 2BGOA 4NQEB 5EEWA 3QZLA 2GDFA 4NWWA 5I0SA 1B2WL 1F4XL 3L3DB 2D3SA 1XR8A 2CMRH 1EAH3 3ARBA 3QZMA 3EGXA 4IOFC 3G6AB 4FAAB 3BP6B 1KCUH 1V7ML 1C5CL 3NAPB 3APBA 1ZE3H 4I88A 1GL4B 1DGWX 2A70A 4RIRA 4PY7A 5GIRB 3I2KA 5BNNB 4WW2F 5IM7B 5EO0A 1AFVL 3QIWC 1NWPA 4WK4B 2OMZB 5JW4Q 1A3KA 1AR81 3EJKA 4D8OA 4IE6A 4O61A 1R5IA 4YDLC 1GH7A 1LHVA 4HJSA 2TEPA 3B2VL 4NIYE 3TU6A 1YJDH 4QPWA 5FWQA 5DJYB 4HG4J 1ZA4A 3WN5C 3VFGL 3T3MB 4FQXA 4PJCA 1MHCA 1HH9B 2KLTA 2NRDA 1C08A 1M71B 3FUHA 1OM3H 2WTOA 3VWJB 2VL5A 2X4TB 3SPVB 1RHI3 3ATAA 2PQSA 2ADDA 3NIDF 1FHNA 4YPGA 4MBOA 5TQ0H 3L3IA 4YHML 3ARYA 4JJ5A 4XOAA 1F31A 4IBVA 5ADOH 1SHWA 3MRQB 3BESR 4X8JB 2VOKA 2R49A 3DPRB 4U1HA 5CEZE 3B6SA 3BGMA 3QEUA 4FP8H 3GBGA 1GZPB 3RNQA 3O8XA 3ZYZA 5FPXA 1CFNA 2HH0L 2FO1A 3MIDA 1N8OE 3WNNA 1O7VA 2ZJSL 3P3RA 1L7RA 4MGKE 4OLUH 4KG0A 5JTWA 3GZUC 4HOXA 1B6UA 4LEXL 5ANME 4DSYA 1QZ1A 3ULVF 1TME2 3FBKA 1WFNA 3JV4A 4GRMA 1KEMH 4LHUB 4WWKD 1C8M1 1WT5C 1WC7B 1MLBB 2NY2D 4E9RA 1STMA 2DURA 4JFZL 2WQ4A 4ZY9A 1NFDB 5I15L 2BJSA 4YW6A 2YU1A 4JVAA 3WLUA 9PCYA 2ZJCA 4LLYA 4NRZA 5EF1A 4EVNB 5DK0B 4Y5SA 3FSWA 2CR0A 3OGCA 3QJHA 4W81A 5DTFB 1BZ7A 4PJBA 5IROC 1WD3A 1S9WA 5BS0D 3H9SA 5EOCJ 3QEGL 3E6HB 3FO9A 1H1MA 4MXVF 1RY7B 1I8MA 4YFWA 4PYHA 3K6IA 4N2CA 3X14A 2NN8A 1PZ5A 2CKBB 4WVVA 2BSED 5DURB 1PVC1 2Y06L 1N70A 3FU5A 4IBZA 5C08D 4A2MA 3S88H 3QUHA 5FO7A 4UT7H 3EO9H 5SV8A 4PB0L 2VC2H 4LBAA 5F7KC 4AF9A 4ODWA 3HLKA 4ZMYA 4HJGB 5FYKU 1A6UL 4BK5C 1X5JA 1T80A 3OKOB 2D7QA 1WFIA 2O5NA 1GICA 5F3GA 1YYNA 2DJ4A 3RMYA 3S3CB 2FZ2A 5IFPA 2AJUH 3KGTA 1C5HA 1CU4H 4IBQA 3LNFA 4FTVB 3ZTEA 3KS7A 3MUZ1 1INDH 4B29A 2FATH 2AH2A 3S3JA 3P54A 4RAVA 2XZQL 3D85B 3MRCA 2TRYA 4G8GB 3SDCC 1RMU2 1XGPA 5LK5A 4A6YL 2IGFH 1NGYA 4K94H 2Z31B 4X2UA 2FX7H 3C7FA 1TU2B 3L4UA 2XT1B 3FO0H 1OGTB 1PGRB 3N1PC 3NIFB 4LHQB 1IFRA 4MKMA 3W37A 1IO4C 1CIWA 4LCUA 4L2LA 3LHPH 3VU1A 4EUPG 3D4YA 5A2IH 1QOSA 1IQWH 1ZBE2 1DZ0A 1BLNB 2Y33A 4QHZA 3EYUL 5FUOL 1DLFH 3CC1A 4AXWA 5CGYD 3JSSA 5CD3B 4NHCH 1XEUA 5AKTA 3IVKA 3I6LD 2CJUL 5KSVA 2JD4A 2PPEA 4PJXA 4M8UA 3I4IA 1KFAH 2XG5A 2NZ9C 3QDJE 1BQLL 1CDIA 4MVBD 2HJIA 4A7ZA 1UQXA 3IMTA 4UOW0 5JXED 4LKSA 4N8CL 4XI5C 1PIGA 2VZVA 3UZQB 3F7KA 2UWEB 3FL7A 4LLVB 4PJEF 4CP2A 3MRMA 2FLRT 4A42A 4HGKC 1MCHA 3O6KH 5C7ZA 1E5RA 3NAAL 4JTNA 2EDMA 3BH9A 5F88A 4P59H 2GYSA 2X4PB 3HE6D 4PWKA 2B9VA 2JIJA 3MOQA 4COYA 2XOTA 4XCYB 2WGNB 3L9RA 1AYN3 3LXUX 2BHZA 3PQYE 4QXTA 1T5KA 4D8PB 1FH5L 1OAXL 1SY6L 4OW6A 4KWJA 3RJQB 4FXTA 4EQVA 3KPRE 4CC0A 2X2IA 3QDMB 5ISLA 3LCPA 2VSKB 3HPJA 4UOJA 1U58A 4XP9H 4N1CA 1D5MA 1PNFA 1IGML 3RKDC 4NIDA 1BFVL 4RAUA 1WH0A 1UMHA 2VITA 3VGEA 1WSST 5KN5B 2XPJA 1GZTA 1Q94B 4XZUB 1S2KA 2F6BA 3AUVA 5A7WB 2DQMA 1YN6A 3L3OA 5EUKB 3UO8B 1IC1A 2GBUA 2P44B 4ASKA 1A7RL 3REVB 1HCFX 3H42B 1U8NB 2CO6A 1DFBH 3SPCA 2VDKL 4H8HA 4B50A 2FSEA 2VDPH 5EF0A 3ZDXE 4LLOA 1TZHB 1HB4A 2VISA 2NY6C 3D39A 1UJ3A 5CGMA 35C8H 2Y2TA 4JQIA 5I1GH 1KC5H 1UUNA 5FIEA 1DDHB 3ZKXC 5A6YA 2XNAA 3NEXA 4YXHL 2YGNA 5KHGA 2VDLH 3KPSA 4UXAA 5FX3A 2WBKA 3VGGA 4DKEH 1GP5A 4PJFA 2GMMA 1AX0A 1WWAX 5GS0H 1WBXA 3I84A 4CA9A 3DDGA 3HR5A 3QFJE 5E7FA 1JHTA 4OCTA 1IJNA 2R1BA 2Y9RT 1PD6A 1B4TA 4HHWA 2BSDA 3U0WH 1FPN2 3FMGH 4JFFE 2PO6B 3GIZH 4GXUN 3I6KA 3TA3D 3VFNB 1CTNA 5DD6A 2KLSA 3LEVL 4XCEA 1RUC1 2C6SA 1M7DA 2CO2A 4K7PY 3HPNA 5FO2A 3BZFB 2WINB 4RESB 5D7JC 2DQHL 4NQEE 1XCQB 1QR1B 1W8WA 4ZJ9A 2P3KA 4DEPB 4BWOA 3DPBB 1EZVY 1MG3C 4UV4H 4YHOL 1HYRC 1AYM1 2OP4H 3FYEB 4K3EH 3EYFA 2ZGMA 2GTWB 3RL2B 2C9QA 4TUOA 4PJIB 4Y1TA 2ESVB 5T1KA 1OVZA 1QRND 4Q9QH 1E3ZA 1CAWB 1BD2B 4PW4A 5H9SA 2EE0A 3QUML 4GW1B 3QJVB 3UROR 4RCAA 5TF0A 5AD0A 4ORGB 4U6XB 3SDDC 2MFNA 1BSIA 1I1RA 5ENWA 1LEDA 5FZGA 2NM1A 2EINB 2WLKA 3T3ME 4CXYA 1UXLA 2JKLA 5KWRA 5LBCA 4KZ0A 5L7OB 3LEXB 5T5FA 4W8JA 5FIXA 1GKEA 2IQ9L 3VGHA 4RD7A 3HC0A 3IMMA 3F00A 1PIV2 2TRHA 3V5DA 5IW1A 1CD3G 1WBYA 3GXNA 3Q1SL 3R4DA 1TSRA 1TUPA 4D7BA 2XI9A 5JOZA 4GRWF 4F7PB 4FNPA 2AXWA 2ZOEB 1J5OL 4L3CB 3EMRA 3KPRD 3K6SB 4FQ4A 4IRZA 2YMZA 3AMMA 3KXFA 4Q74A 4HIIB 1S7UB 3WO3B 4ZXBC 1NEPA 3R8QA 2PA7A 2WT0A 5GS1A 3NA9L 3WNPA 3SH5A 3SKJL 1AR72 3ZPYA 1PZSA 2R29H 3BO8B 3P0VL 4K6BA 4IGBA 4DKFH 4KX8A 5IR1A 3UESA 3O41A 3RWEB 3N55A 3P9LA 5GS2D 4G8EA 1XD1A 1KXQA 1S7TA 4MOAA 5IUQA 3ZE0B 1N12A 1KYDA 3STLB 1R083 1BBT1 1SACA 3MKGA 3S34H 2RDNA 3PJYA 3B7MA 2RH0A 5LBSH 3RWIA 4X5WA 5AUMA 4E2GA 4H8QA 2FTAA 5A7SA 4W9KC 4GKNB 3CG8A 1K5MC 4RMWA 5JZGA 2JB6B 3ALPA 3TPUB 4YLQT 3Q3GB 4N0CC 1VBB3 5I8EB 1BBJA 1CDCA 5FMOS 4DFSA 2DLFL 4UW5A 1MWAB 1RPQA 3B9DA 3BWAA 1ENQA 2XTJC 3O3DA 3BPLB 3O5SA 3F04A 3ME0B 4L0PA 5CD5D 3WKMH 3ABKB 3FFCA 15C8H 5IKCB 2NP0A 1RJLA 3H2PA 5EBLB 1AKJB 4JVPA 4ALAC 2X12A 5FYKD 2OR7A 4YM1A 3DJZA 3N0PB 4AQEA 1USZA 1HQLA 2DEYX 2IAMB 1RKRA 1WCSA 2VDNH 2NQYA 3QBTB 4WENB 3ZTDC 3KGUA 1QKZL 1DSWA 1HE7A 2YR3A 3NJLA 4ADJA 3LKPB 1NLQA 1LU1A 3DETC 4FTVE 3IGFA 3NV2A 4LMFA 5KYXA 2JKRM 3PXHA 2NTSP 3LS5L 3OGGA 5I17A 2AXGB 4PJ5B 1I3UA 3RSJA 3EOBA 1BJ1H 1MRCL 2HG0A 3CHPA 5DHYB 3H9YA 4N6RA 1TME1 5LA0A 2WN3A 4ZKTB 1FDLL 1KCVL 1VEPA 3L5IA 4FULA 3UC0H 5CFDA 2PHLA 1RUE3 1U8KA 5EIIB 3H54A 3QZOA 4GXUM 1DQDH 5ITFA 5I1CH 2L04A 2B4KA 1EDYA 2KLRA 4TUJA 4KV5E 3WOGA 1LGVA 2ZCZA 4D0CA 1H19A 1Q38A 4NZ8A 4XO3A 1OPOA 2XXGA 1ZTMA 4HSCX 1QA9B 4ZW3A 5IFTA 2IMMA 3B56A 5IK3B 4IEQA 1DUYA 1I3RB 1COBA 1Z3GH 4O51A 1KELH 1LMIA 5IJCC 1AR93 3WX5A 2G19A 3ZE2B 3HNTL 4HIHA 2UWEE 4J3OC 4KTEH 3GZQA 4AKQA 4JHWL 5GGSA 4XDQA 1OTSD 3TEXA 3ZFFC 1MAJA 3M3OA 3QJFB 1K5JA 2CO7B 4M6MH 4L9DA 5J1SC 4NO4A 1AXTH 4KX7A 1A3LL 4QM9A 1WFOA 2LW3A 3S0MA 3ZIXA 2X4UB 1AHWA 1B4RA 1PK6C 3KLLA 4Z5RA 4CJ1A 1RUAH 4G59C 1OLQA 3LDKA 2UZYA 3QDME 4P3WA 4PJ9C 3ZFGA 1W6MA 1Y3TA 4M7LL 3KPOB 2QZ3A 3WAJA 4OZFB 1ED3A 1EGJH 1NDMB 4PJ6A 1XC6A 4ZK8A 2WQUA 4XPHL 3SSGA 4HT1T 2MQ3A 4LDEB 1A9VA 5FP3A 1RIHH 1HILB 1M3IA 4QPEA 3AREA 1AUYA 2W1QA 1AGDB 4KKLD 3ZDYF 3I2IA 4P2QA 4AYSA 1W99A 1BGXH 2ICWJ 2HPOA 3OQRA 2NY7H 2ZXCA 5SWSE 2VXSH 3BEVB 4OKVA 1DL7L 2C3VB 4WW2A 1ST8A 4GB9A 3UFIA 3VGAB 2L3BA 3UERA 4DP0X 3MZTA 3WJMB 5HVFB 1UMIA 3LRMA 4QB1A 4E8CA 1ZK9A 5TDPA 3J9SA 1YQ5A 1FATA 1C57A 1FC1A 4HK3J 5JR7B 3PNAA 2P47B 3IS1X 5G2NA 2JWPA 1U8CB 2P6HA 5IV2A 3KR3H 2EXYC 1CGSL 3LOWA 2WLIA 5A16B 1S5IH 2XLLA 4PJ8B 1B4LA 4C4UA 4M4PA 4AV4A 1IE4A 3UADA 4NRYA 3ESNA 5IEKA 1OF2A 2NNAB 4BDVB 1KPRA 3D06A 4TNWK 1GKBA 2DDQH 1EJ6A 2Y1AA 3AXIA 4HWBA 4JB9L 5HGDA 4PV8A 4XGZA 2ZG3A 3W0WA 4ZFFA 4EN7B 4MSWB 4AYEC 4GXVL 2FMDA 3FQUB 4DGVH 4BZYA 4E9YA 1NICA 1JNNH 3TF7C 4OI8A 2WWUA 3ARRA 2VOVA 1T5WB 4WWOA 4ATWA 4AI7A 5BV7H 5J37A 4QT6A 4M00A 2H6PB 2WWMD 2J3SA 3L2NA 3EYOB 1KTKE 2FO4A 4J3UA 5M95B 4BWWA 3OGSA 4DS0A 2YPVH 4CUBA 2H0BA 3QI9B 1WF5A 4EI5B 2GNMA 3WINE 2ICWI 2GALA 3OXRA 1E4HA 4PJIE 2ESVE 3S97C 1X6LA 2OMTB 1V3LA 3BKCL 3VMNA 4I0WB 4HDIA 2CIKB 4PGBA 3NJJA 5IJDC 3N9GH 3KHQA 3ARXA 1XE7A 4MXVA 2DUQA 4JJOA 3L5XH 1JPEA 3E9UA 4I89A 2WXIA 2Z42A 4J4PA 1P2CB 1V70A 5C0JA 2BEOA 2QDVA 2WMPA 2LOEA 2F17A 1EBAA 3RA7H 1CFTB 3LRHA 1SLWA 4OM0H 5E2JA 4Z78A 3HUJF 3OGJA 1XF3B 1HHGA 2M26A 3IF1A 4SLIA 2VDRL 1OFNA 2B1HH 3ZQ9A 5GRJH 1CZ8H 4QHNA 4QKBA 4HP5A 3OAUH 3QXVA 2ES3A 2WO4A 5HCAA 4E2SA 3O3EB 3OKKA 5E1AB 2OSLB 2HT4D 3GEWB 1WEJL 3B00A 4PPTA 5DGRA 5AVTB 5C3IA 1TENA 5EEXA 2O6EA 1FPN1 4Q0SA 2YLHA 5D1XC 4EKJA 3Q5OA 1OWRM 2XY2A 3PAUA 2RFXB 4MA7L 5AZ2H 4GG8A 4Z1VA 4PRHA 3X1GA 3LVEA 4KI5M 1CE6B 4A04A 2YRBA 1E4KA 2XA8L 3EDDA 1SF3A 3P9MB 1OT4A 3ZE0E 5I8OL 2FH8A 1K8IB 5SWSD 4XHJD 5D8JL 2E7TA 1OCCB 1F4YH 1S3KH 4H1LB 2N56A 4WI5A 4YW2A 3KGZA 4PRPB 3ZSSA 4U1MA 3E80A 3RAJL 2FDHA 5D71L 5DJ0B 3UKVA 4LUMA 3IRPX 4MAUH 5C0CA 3DKHA 5GXBB 3VZLA 2WZPP 2AABH 1AXSB 3C6LB 1JP5A 4XNUL 4M8QB 1PTZA 2QDRA 1SLUA 4L97A 4RFRB 3V7MA 4AEIL 2EUVA 3O4OC 1W72H 3MV9D 1BYOA 5I82A 3AAZB 3IGKA 1RZIA 3H0OA 4AHXA 3BD5A 3QRGH 5DUPL 4P9MH 3ARPA 3AGWA 4HKWA 4PJEA 3TBSA 1X9PA 2O6FA 5C0AA 5I8CB 1LE9A 2VBBA 1KBKA 5C3LD 1UWYA 5GLVA 3VBSB 3PGDA 2H2SD 1PIV1 1MZYA 2BHYA 1LEGA 5GRVL 2FQDA 4OYUA 3AKTA 2NLJA 4OCYL 2MNJB 4KBPA 5FC9A 4K9EC 5D7LB 3WVJA 1N10A 1PLBA 2C7UB 1GC1L 2C9AA 3N43F 4KK9C 5JIMA 5I6LA 1KB5B 2IFWA 3I6GA 2QADB 1F58H 3MRNA 4K8FA 3UTZB 4UQCA 4DRRA 3NA4A 2PTTB 4EPSA 4TLTA 2NR6D 2OMBA 3ZKMD 3CX5J 1QBMH 3GHMA 1LP9E 3O6LL 2R8SH 5JXHA 2OI9B 1A6PA 2VQ1A 3G08B 1ILUA 1KB9K 3CK0H 2JTDA 5FKAA 2UY7B 3DXAB 3GRWH 4KHXH 3BIWE 5EOCL 4HIEA 3P77A 1TTFA 2VSDA 3F7YA 3NJMA 4QOKD 3QWRA 3UTPD 3WLWC 5CLWA 1R0AH 4KNQA 5A32B 4MXWA 2B9AA 5J13B 4LT5A 3MN8A 4BH7B 4F9PC 3U6RB 5KYWB 2D3VA 3RPQA 3MPPG 3HT2A 4G8IB 1ND2C 1S0EA 2KC0A 1GKOA 4LKCA 1O3RA 2GY5A 5BV7B 3NCYS 3QO0A 4YZFE 3T4YB 4GIQA 3N50A 4KMQA 4XP5H 3ZE2E 4XO9A 3UACA 2OQJB 1PVHA 4YRDA 1D2OA 3KDPB 1CPUA 2RJ2A 1GOFA 1O9WA 1J1LA 1IAKA 1JK9A 1H6TA 1S7XA 4KWLA 5GZCA 4EQ2A 4GAZA 3QQ3B 3MREB 3QAQA 4I7ZC 2BSCA 3POJA 4N1HB 5HYSG 2F74B 2R2EA 1EAJA 2BRRH 3FQNA 2CL2A 2VULA 5H9RA 1JGDB 1OCOB 4WFGD 3SE8H 3DO4A 3C5ZA 1QSFE 2VRKA 3DUUB 4J3BA 1V55B 2Z4QB 1AHKA 3IDCB 2FDBP 3P30H 1J0IA 4XNYL 5DEFB 5C3SA 1HRI3 4BZ2L 2EVFA 4BE5A 4HJIA 2OL3B 3EYVB 1NCUA 2YD6A 3VFRB 3DUSA 3WXWH 1YJLA 1WLHA 3V9CA 5IVNA 1BDYA 2XVGA 4PQ9A 4J3WA 3IDBB 3AG1B 3FT1A 2WB1A 2GN3A 2XL9A 4RRPG 1XSRA 5D1QC 3BP5A 3R05A 4YDIH 3MLVH 3LRGA 2P1YA 2NSXA 1GJWA 3P4NA 3O0LA 3MFFA 1S9KC 4NQSB 1S9YB 3MW4A 2FB4L 3SJVD 1PO11 1QXPA 4FLSA 1J9SA 4WVMA 4XBPA 4A7KA 4LPUA 1SN0A 3M1BB 3MIGA 1R3HB 5IB5B 1MFAH 3UBGA 2VUAA 5DWPA 5ESAA 4DCQA 4M5TA 3KCYA 4W6WA 1RUNA 4QRRE 5DJ2A 3LD8B 4CDUA 5FZ0A 4ZS7L 2F68X 1MREH 2SEBB 4GFTB 4JLRB 5GGQL 1JRHH 4FF9A 4XR8C 4LVNB 4H20L 4E9TA 3G5XA 1HDMB 3AS2A 3JTSA 1AGFB 2YBRA 5IK8A 1KV7A 3PHOA 4LSRL 1DJWA 5IMKA 1KY7A 3SO3B 2XQXA 5IWLA 5LW9A 2HJLA 3KDMB 4GKXA 1I7TB 3A67L 4I48B 1RUF3 4GJTB 4OFDA 3P1VA 3NBNA 4NB7A 5FUCE 4OZXA 4Y22A 1L9SA 4NUBA 1G7JB 4JG0L 5F9OH 3ORJA 4FVVA 3VGDA 4XO4A 1BQUA 1RB8G 1VBA2 1DBAH 3LS4L 2AEPH 1QWNA 5GS0D 2HTKD 4AYBA 4NUJA 1GZQB 4N2BA 5AB0A 3DF0A 4N43C 2FQEA 4UW6A 5FXVA 1R9FA 5HJDA 3OJMB 4PLNA 3F58L 4PWGA 1WGPA 4UW4A 4EI6A 1RI8A 4AI8A 1NDTA 5DMGD 1UZWA 4NO5B 5E6IA 2HKFL 1KIPB 4ODXA 2CHNA 2XL7A 5FZKA 1QFUH 1T22B 5DCCA 3L3JA 2QVSB 3VWKA 3TTSA 4G8FA 4XVJL 3FQTB 2XTSA 2ADFH 3MROB 3OKEA 4MB1A 4WO0A 4Y2LA 5CLZA 1OAZL 4KI5F 1LO4H 1ES0B 3GHPA 3QEQD 3QWNA 4HH9A 4XPBH 2NQ3A 5DUBB 5AC92 4N28A 1FVDB 4Q97A 4JL2A 3CFKA 2EAEA 1IAII 5JI7A 1OT5A 3ZFEA 3NK3A 3WKPA 3MNVB 1W0VA 5E99H 4GXLA 1BEV2 1PYWA 5J6HA 3DIFB 1U3HD 1CDBA 4Z3HA 4EZKA 2BNQB 3GJFB 3IDJA 4ELKA 1OAKH 1GWMA 3D18B 3U7WL 2FL5A 1QSFD 4LNRB 3WDHA 1GC1C 2EEAA 2UXGA 1Q9LB 4CPBA 1JYNA 5FGCE 3RVWD 3HB3B 5FZOA 2CWMA 2ZUYA 3TO4B 3CXHK 3GINA 5DO8A 1U8PB 1KJRA 2HJKB 2DY2A 1FNSL 4AK1A 1PSKH 4FT8A 1FWXA 3WU1A 2VT0A 1I5ZA 4GXFA 4WK0B 1BQRA 4G71B 4YZ5A 4YHIA 3SQOH 1U8LB 3FKUS 3HKZA 4QGYA 3SCMB 3FB7B 2ROXA 1MCEA 2V3FA 4YSRA 5HHOE 3FLRA 1OCZB 4UAPA 1Z78A 4XNQA 5IVZB 3VACA 3GJEA 4PV9A 2PWDA 3RDTD 5K1NA 3APCA 1QLEH 5BCAA 3NGBC 1QAWA 3JXAA 1QJU1 4PRPE 3CLEH 2Q3XA 3H8NA 4RS5B 2IAND 2HRGA 4KXZH 5DT1H 2R56L 3RVTC 4BGDA 3V0WH 3DTXB 4KJWD 3WMSA 1SLCA 1SBBA 2BNRE 4JW3A 1UYZA 3PIGA 1NC4B 5IK5A 3W9EB 1KJ2H 1JW6A 1L9RA 3KH4A 4QRRD 5F6KA 1U8JB 1ODUA 3LIZL 1LEIA 4PGJA 3RUGF 4EIGB 1M1SA 4U6VL 4AHZA 3TZVB 2VDML 1UXWB 3VH8G 5T33L 4JFOB 3N2JA 1EJOL 5L0QC 1V6IA 1JZEA 3ZDVA 2V7HA 2EIDA 1L4IA 2W95A 5EHDA 3WQ7A 4D6RA 1WPCA 2YV8A 2E27L 4YE0A 2JJSC 3JWNH 2OYMA 1AE6L 3BVDB 1QACA 2A5UA 2G3NA 5D5MB 4KRPB 4QD2E 4G5AA 4HUWA 5D7LE 4AQ8C 1VFOA 4KL1A 2BSRB 3NVCA 2F54A 1P9MC 3EDFA 2VNCA 3MLYL 1L7LA 1CGTA 3QPQC 1JXJA 4Q4EA 1E4XI 2JFCA 4DVBB 4AG4A 5EUOF 4IV1A 4OM1L 5CZXC 4OIFA 5LEJA 1GS6X 4KY2A 4MS8C 4N68A 4AIXA 4W4NA 4E36A 3DXAE 4QWWC 3IDAA 1BFOB 4QDSA 4AK3A 5FPUA 2JV6A 3EHBD 1C3HA 3VXTA 2APWA 3D2UD 2APVA 2C8NA 1UOKA 4I3SH 1DBMH 4JRXA 4Q4X2 4YWAA 3MV8B 5L6YH 3ZOIA 2D6OX 1UWEL 5H35B 1CGPA 1TPXC 4OJYA 1ZS2A 3ZXLA 5LWBA 3L5WB 4L8CB 1LESA 2WLMA 5J6GB 1OAQL 4JCKA 3I75A 3X3FH 4K23H 4J3OF 5F32A 4Y1XA 3RIKA 3VZKA 3ECUA 1SLTA 1DFXA 4O2CB 1POV0 3FBMA 5ETUA 4D3CL 3VXUE 4BM7A 4TLUA 3BWSA 3BISA 4DESA 4H26B 1U3ZA 2ZKHL 4S1RL 4AZ8B 2BOBB 5LRRA 2BU9A 4ACPA 4DIQA 1VAKA 1KXVA 2X1QA 1G6RA 3WZ1A 5A3UA 1D6VL 4A41A 3WNLA 1L0XA 1A21A 3D0LA 3O2WL 3IZOA 1DEDA 1S9VB 5D8AC 3SZ6A 5CZVL 4JY5H 4J3SA 3US0A 2BSTB 4OFYA 2G30A 4HXAL 3D52A 1GIGH 3FB5B 3QVAA 5HHOD 3X2QB 1XQ4A 2XUEA 4HSJA 1YMMA 4BFGA 2OTPA 4WFEE 4XWGL 3BPNC 5TDOA 3KYMA 1HINH 4F24A 2PHUA 2OCFD 2Y34A 3W39A 2YQGA 4LCCB 3DMMB 1X33A 2HWD3 5BNPC 4XODA 5DAQA 5I0DA 4CEWC 4N0YH 4PLOB 1B0RA 3T0VA 4KKPA 3BAJA 3RWFB 3SKOA 1ZZ9A 3ROLA 2ITEA 3QIWA 1D5XB 4HKZB 5BQ7B 1GNZA 1K6QH 2RS11 5A2KH 3HNMA 2CAVA 1M56B 1KJVA 2J1XA 2WNXA 1NANI 3OD3A 2W91A 5ID1A 3GRBA 3WN5A 1AG0A 3GHBH 1OGAA 4JE4B 3L4TA 1T7ZA 2APBA 5KSBE 4XXDA 3I9IA 5SWQA 1C1EL 3THTA 4LLMA 1ZHKA 1NM4A 2ZUQC 4OT1H 3I9GH 3QDGD 1RPKA 1NAEA 4OGAC 1MCBA 2DYSB 2RA1A 4OB5L 3W21A 3KW8A 1G8WA 3DGCR 4IU2A 3HUJA 1OD3A 2O5ZL 4M3JA 1QLEB 2ZUVA 1P7KA 4NXSA 5FB8B 3WY1A 3QXDA 4NHUB 3PFQA 4M6NL 3BVTA 1F11B 3GSRB 5GGVH 3QS3A 1BCXA 1JF6A 1UFGA 2DTMH 2NYYC 5CO1A 4FP2A 3NFPA 4GEJA 5E0QA 1IL1A 3U0TB 4N7IA 2JELH 4Y5VB 1WT5A 3K81A 3BRFA 5JMRA 4A38A 2PXYC 4L4VB 3A6CH 5J1AA 2I5YH 2WAHA 1Z7S3 2BOJA 1NCBH 2EIMB 3MC0A 5SWZE 2JNZA 4HZLA 2Y7SA 3V4PL 4LGPB 1DG6A 3N9QA 1ZEAH 5EA0L 1OAUL 4X4XB 5FWRA 2JK5A 2X89A 4FFVC 1QWRA 2M2DA 4P48A 1MFEL 4JO1H 1DQJB 5KAQG 5T3NA 3P3YA 2K4WA 5LNDA 4QXGL 1KS4A 3UTSD 2NY3D 1QJY1 1J8HE 1DVFB 1X3DA 2EXWC 3L81A 4PCSA 3QNYB 7FABL 5D7HA 3MYXA 3OEAA 2ZGSA 4ONGL 3VXUD 1C1FA 1UT2A 2BHUA 2FDFA 3RKPA 3R4SA 4RBPK 1XU1A 2A1XA 2CIIA 4NP9A 4ZMPA 3L7FB 2OUJA 3O0WA 4BK5A 3TJHD 4G9DB 3FHQA 1NAML 3BE1L 3LKOB 3ILFA 3RZMA 3QCTH 1UD2A 4GAGL 3MRDA 4HC1H 4K71B 1V9U1 3KT1A 2C7FA 1G7PB 2BNQE 2VZ3A 2JENA 3ZKUA 4H8WL 1QWHA 3VFVA 3IAPA 4FMFA 3B8YA 5HCFA 4H2CA 4LARL 4BUQA 2K0GA 4QR7A 2YXMA 3SDCA 2P5PA 3DUHA 1QO3A 4HS8H 4WV8A 4W6XB 2WLPA 2BFVH 4FA8A 3P4LA 2BK8A 1U91B 2PMZA 1U5YA 3OBTA 3VD1A 1QOOA 4XAAA 3ML8A 3TFBA 2H26B 5J5EA 1AHMA 4XF3A 3WF2A 4Y1ZA 4MD0A 3OKMB 4ENEC 4COWA 5DLML 1VBA1 1JV5B 1A7PL 3WSOA 2ED6A 3WS6C 3WQ0A 4UILH 5MEQA 4HWBH 1L5GB 2Z0UA 4Y4HD 4XWOC 4FPOB 4N53A 5AFAA 4OV5B 5KYYB 3WW2A 1PEZA 1ASPA 3IKCB 1S7SB 5F1SA 3CFNA 2NZ9A 1JYTA 3NYKA 1NCDH 2Q8OA 3MZHA 2GK0B 4M3HA 4LULA 3H9HA 3CJIC 1FFRA 4RZKA 4U6YA 3QUZB 3A4DA 4X8GA 3REWA 1GGCH 1LDSA 4Y4KC 5JQ6L 2XR4A 1PKQA 5D1ZB 5I76A 3ULSB 1ECYA 1UY2A 4EKXA 2WFF2 2Y69B 2KKQA 2XWTB 4IBSA 1TF4A 1AANA 4G6AD 4KJYB 5DRNA 4AM0Q 1BEV1 5DVPA 1N2RB 4MNHB 1RJ7A 5DPNA 1CBVH 3EJCA 1RUMH 4P9HL 4YEEA 2LU4A 1N6QH 2Y6LA 3TONA 1O7DC 4X99A 5DO2C 4ZD3H 2FJFB 4PGDA 1GHFL 4DZGA 2ZGKA 4CGTA 4HWEH 5BVPL 5SWZD 4MAYC 3ARBD 4YXLL 4JGUA 2IVJA 3NNLA 3GHNA 5ID0B 3HI6H 1NQBA 2VR4A 4ZZFA 3N6YA 3TV3L 4UT9H 5JXAL 1UXZA 25C8H 4W50A 3MRRA 3D2TA 3P73B 4DZ8A 3OMAB 3M07A 1IMHC 3C09B 2VXQH 4PJGF 1ZXKA 1QPKA 1KD7A 3WFEH 2ZPKH 4ONHB 2DIBA 1RGSA 4Y89A 4FQXD 5FHBL 5FMBA 3KWVA 2IXJA 3N41F 1HHHA 3AU1B 3S2CA 3VUOA 2CJTA 1QOTA 1NCQA 1M7UA 4LPYA 4LBKA 4J1WA 4M5SA 3U4BH 2MHAB 1FIGH 5EU5A 4A55A 2ERFA 3T08A 4A44A 5KJ7E 1OARL 1YNTF 4F3JA 2PFWA 4LQRA 1SBDA 3EJSA 3FSVA 1SJHB 3RY4A 4BA8A 3Q8CA 1UB6B 5HJ3A 4LLQA 1PGL2 4C91A 3VD2A 4JJHA 4BM8A 4P2RB 3WUCA 5GZFA 4NZFA 2DF7A 4ET7A 2F5AH 4Z7WF 4KU1A 1I9RA 3IPBA 3ML9A 4GAJL 1IU1A 3SGEI 1OURA 1PCSA 2A9CA 4GKSA 1XGQA 4U1LB 1CB4A 2BX5A 2CLZA 4XP1H 4H88H 2Q30A 5DHXB 1KPVB 1FAYA 4X42A 2FQGA 2XFXB 4G83A 3FZUD 1NWOA 3HN1A 5GGTA 4U3XA 5AKVA 3AFKA 4KGQA 5KC5A 4YMPA 4D0DB 4B7KA 2FDGA 4X7EC 2XKPA 3IB4A 3TNNB 2E6VA 3V9FA 1UVQA 3H9SD 1YRKA 2CUIA 4GPVA 1UZ6F 3QWOA 5DHEA 4B9FA 4BEIA 4S1QL 2DD8L 3HHMA 2W52A 1UA6L 2P5WA 4E41A 3F8UB 3QS2A 4UINH 4KJQC 3JWNG 4S1SH 4F93B 2ZXBA 1H6XA 1GOGA 2K9ZA 3ZIWA 2AC1A 1F41A 4QQPA 4CC4C 2VOXA 3ZSMA 2WNVB 3SDDA 3W82A 4BHUI 1DQLH 2R23B 2X5IB 3GSVA 5I1AA 3NPSB 3PGFH 1JGLH 5B3JF 2PHFA 3ALQA 3IXAA 2IPUG 5J9PB 2HVKA 4UM9B 3V4UL 2R51A 3ASOB 1ZVHA 5FYJU 1JWSB 1R19A 5JOPD 4JFEA 2AEWA 1F90H 3GLAA 4H8WC 4LL1A 1S4IA 4YN3A 1NA1B 4G6KH 1QTPA 5DUUA 1BAFL 4HJTA 1AJOA 4JFUA 1G87A 3H1YA 2DYPA 5TDNB 4R4FL 5APAA 2Y07L 5FUNA 1QDOA 2PWHA 1S0DA 3MODL 1CR9L 5FOJA 5C3TA 1OSGA 2AJZB 4GSDH 4JK0D 4LCYA 4F58L 1C8NA 4CSTA 1KJ3L 5F5CA 5MEPB 3BZ5A 3WE6A 4M48L 1GU3A 3ZE1B 3N40F 2FDIA 2R2HB 4HV8B 2HWF2 5LK7B 2WNWA 3FRUB 2GCYB 1EXUB 2WXLA 4HPHA 1RUQH 3SBWA 4X7SL 1H0DB 1AD9B 5AVZB 5T3ZL 1KB9J 3M8LA 1OCWL 1ZWIA 1BW8A 3ABGA 3B7RL 3MJGX 1ACCA 5DQ9A 3PWVA 5CU1A 5C2BL 1XSOA 5I73B 4IV3B 1K5MA 3RTLA 3LIGA 3PU8A 2WXOA 2WXMA 3HI5L 4DO4A 1W2NA 3QISA 5DUMH 4CTEA 1A64A 4HFSA 1OXYA 1N18A 3MO1B 2FCVA 4AVCA 5K9JL 4EBQL 2UY9A 4IERA 3N7KA 2LLLA 2NTFB 2VY0A 1HL5A 4Q0QA 3BKML 4U0RC 4MJ2A 5CU5A 5C3RA 1KCWA 3V6ZA 1R092 4RX4A 1E5YA 3RUGA 5D7IF 1HESA 3OB8A 5I1LA 4X98B 2RB8A 4YFLI 3US1A 4BZ1L 4CEYA 4H44C 2AF2A 4P9HC 2VLLB 2ZX7A 1E5UI 4X6EA 1SY6A 3R6SA 1D3CA 1UT9A 4APXA 1J8RA 1BBDL 1SHXA 1TQBB 2X0VA 4YSAA 1UU6A 1AOHA 3T3PF 4LBOA 5FWEA 2Q20A 4AE2A 1NX9A 3WFDL 4I2OA 4XQ4A 4IBLT 3PUCA 1J9RA 5KZCD 3KSCA 1AL22 2VTXA 4PTTA 2HYMA 1E28A 4WNJA 5JO5B 3U30C 2G5BB 4F8AA 1A5FL 5EO9A 1BP3B 1ZT4A 4KKCC 4PJHB 3MUY1 3G6DL 3DNKA 5E2WL 3T4VA 2XYBA 5EUOA 3RVXC 3E2HC 5DZ9A 3LZZA 2N01B 3I2DA 3MOBH 3ARGC 4KK8C 1JGVL 4M93C 2I85A 4XTPA 5L73A 5F2WA 4WUUA 1W6PA 4HUKB 4ZHNA 1H8TB 4WNQA 1WIUA 4NWVA 5F2FA 5CEYB 1MVFA 4J3VA 2BVQA 3POIA 1I7UA 4FNRA 4KQ3H 3G5VB 5DD1H 4QXKA 3BN6A 3MTXA 1RJYA 4QHLA 3WP3A 1DZQA 4IOSD 1I1FA 1NEZG