2ZAHA

X-ray structure of melon necrotic spot virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
296
structure length
296
Chain Sequence
b'SVKIVHREFIASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGSTSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAVDRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGSTIKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVTSSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein
publication title X-ray structure of Melon necrotic spot virus
pubmed doi rcsb
molecule tags Virus
total genus 67
structure length 296
sequence length 296
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zahA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zahA01
1HRV2 1CD3G 1NCQB 1R1A1 4YVWB 3VBOA 5JZGC 2WFF2 5L7OC 1VBA1 2WFF3 3VBOB 1RUH3 1NOVA 4Y5Z0 1POV1 4RS5A 1RUI1 1NCRC 1R081 1ZBA3 1PGW2 2HWB3 4Q4X3 4RS5B 2XPJA 1COV2 1Z7S1 5GKAC 5D8AB 5C9AC 2WZR2 1COV3 5L7OA 1AUYA 1X33A 1FOD3 4AEDA 1QJU2 5L7OB 1D4M2 1QJU3 1NCRA 1QJX2 2R043 1RUG1 1OHFA 4WM8A 4AEDB 1W39A 1K5MC 1BBT2 2RS33 2X5IC 5ABJC 5A32A 1PIV1 4IV3A 3ZFEA 4GMP0 4WM8B 1GFF2 1VBE3 1AR72 1M06G 1EAH1 4IV3B 3ZFEB 4JGZA 4Q4Y2 1AR93 3JBG1 2RS51 1ASJ2 3IDEA 1RUC1 2R063 1RUJ2 2PLV2 4JGZB 3ZFGC 4CDQB 1RUJ3 1R092 1RUE2 3J8F3 1PO21 1HXS3 1RUE3 1FMD1 2RR11 5CFCB 1OPOA 2RS13 4RHV1 1H8TB 5BNOC 2RM22 4WM7C 5CFDC 1VBB1 2RMU2 1ZBA1 3VBHA 2HWB1 4Q4W2 1TME2 2RMU3 4Q4W3 2HWE2 1TME3 2HWF1 4BCUA 1RUF3 3VBHB 2HWE3 1QQP3 5C8CC 1BMV2 1PVC1 1RVF3 2MEV2 2HWD2 4JGYC 1BEV1 1FOD1 1HRI1 1RUI2 2MEV3 2HWD3 3VBUC 1RMU3 2ZTNA 3M8LA 5C4WA 1DDLA 2WLPA 1ND2C 1Z7S2 4RFT0 4YVSC 2RS31 5C4WB 4RQPC 4N43C 2WS91 1V9U1 5C8CA 2QQPA 2HWC2 3JD72 4N53C 1EV13 2R073 4CDWC 1AYM2 1MQTC 5AC92 1AYM3 4FTBA 5ACA2 5AC93 3VBRA 4CDXA 3J8F1 1HRV3 1TMF1 3VBFA 1VBC1 4LLFA 3VBRB 3VDDA 3FBMA 3VBSA 4CDXB 1E57A 3NAPA 1PGL2 3JBG2 3VBFB 4GH4A 1NA1C 1PO11 2ZZQA 1C8NA 4CDWA 5K0UC 1VB2A 3VBSB 3VDDB 3CJIC 3NAPB 1MQTA 2WWSA 1PO22 1RUD2 4GH4B 1FMD2 2RR12 1SMVA 1B35C 1RUD3 1MQTB 2XBO1 4Q4V2 5JZGA 5DDJ1 1RUF1 1AR61 2WZR3 4RHV2 5J96B 3TN92 1AR81 1AL22 4GB32 5JZGB 4Z92B 1RMU1 1VBB2 5K0UA 1VRH2 4GB33 1QJY1 1D4M3 3DPRC 1QJX3 5K0UB 2HWF2 1RHI2 2Y26A 1C8M1 1NCRB 1BBT3 1AYN2 1PVC2 5C9AA 1HX6A 4CDUC 5A32B 1FPN1 5C9AB 1AR73 1ZBE1 1EV11 2R071 4QPIC 5BNNC 4Q4Y3 5A33A 3DPRA 1ASJ3 1K5MA 5LK7B 1WCDJ 2X5IA 5ABJA 1V9U2 1A6CA 2PLV3 2VQ0A 5A33B 2FZ1A 1HRV1 1R093 1K5MB 1VBD2 1MEC2 2X5IB 5ABJB 1VBD3 3HAGA 2WFF1 4GMP3 5BNPC 1RUH1 5BNNA 3S6PA 4RR3C 2RM23 3ZFGA 4CEWC 1R1A2 4Q4X1 1VBC2 1PGW1 4NWWA 5FOJB 1VBA2 1NY71 3ZFGB 1COV1 4QPGC 1VBA3 1POV3 5BNOA 1R082 1RUI3 4WM7A 1QJU1 3ZFFC 1R083 5CFDA 2R041 1QJZA 2XBO2 5BNOB 1QJX1 4WM7B 1Z7S3 1CJDA 1F8VA 5CFDB 4PDWC 1OOPC 4CEYC 1RB8G 1VBE1 4JGYA 2HWC3 1QJY2 3JD73 3VBUA 1AR71 1RUG2 5C8CB 3ZFFA 1AR91 4JGYB 1NCQC 1C8M2 1ND2A 4YVWC 3VBUB 2R061 1PIV2 1ASJ1 4YVSA 3ZFFB 1RUJ1 5ACA3 2PLV1 1PIV3 4RQPA 4N43A 1IHMA 1ND2B 3VBOC 1HXS1 1R091 1RUE1 1EAH2 1FPN2 4YVSB 1VB4A 4N53A 1EAH3 4RQPB 4N43B 2RS52 2RS11 1RUC2 3JBG3 2BPA2 2ZAHA 4N53B 4RS5C 1RUC3 2FZ2A 5D8AC 2RM21 1AL0G 1VAKA 4CDWB 1PO23 2RMU1 2BFUS 3JB8A 4IV1C 1FMD3 4Q4W1 2RR13 1TME1 1NG0A 4SBVA 4Q4V3 2HWE1 1QQP1 1RUH2 1RVF1 5FMOS 4RHV3 1BMV1 4AEDC 2MEV1 3TN93 1NA1A 2HWD1 1AL23 1ZBA2 3CJIA 4EJRA 2HWB2 1VBB3 4Q4X2 1VRH3 5D8AA 4WM8C 1NA1B 4NWVA 1NY72 1B35A 3CJIB 4IV1A 2HWF3 1RHI3 2GSYA 4IV3C 3ZFEC 4FTEA 3ZXAC 1BEV2 1FOD2 1AYN3 1PVC3 1HRI2 1B35B 2BBVA 1BEV3 4IV1B 1HRI3 2HWC1 3JD71 4JGZC 2R042 4CDQC 2RS32 2DF7A 1AYM1 5CFCC 2WS92 5AC91 2TBVA 5ACA1 2WS93 1V9U3 1VBE2 3DPRB 4CDUA 1H8TC 1ND3C 4FTSA 1MEC3 1AR92 4QPIA 4CDQA 4CDUB 1PGL1 2R062 2BUKA 4FSJA 2BFUL 1X36A 3J8F2 5CFCA 4QPIB 3VBHC 5BNNB 1TMF2 1HXS2 1R1A3 1RUD1 1TMF3 1VBC3 5FMOL 1POV0 3LOBA 1H8TA 4Q4V1 5J98B 1ND3A 2GH8A 2RS12 2WZR1 1PO12 5BNPA 1PO13 3TN91 1AL21 4GB31 1ND3B 5C4WC 4RR3A 1D4M1 5BNPB 4CEWA 1VRH1 1F2NA 5DDJ2 1RUF2 2XBO3 4RR3B 1AR62 1QQP2 5DDJ3 1BBT1 1RHI1 1RVF2 4CEWB 4QPGA 1AR63 1AR82 1AYN1 1AR83 1RMU2 4QPGB 1QJY3 1RUG3 4Q4Y1 3JB4C 1C8M3 3VBRC 4CDXC 4PDWA 1OOPA 1HQNA 4CEYA 3VBFC 1ZBE2 4Y4YA 2R072 1EV12 1FPN3 3VBSC 3VDDC 3NAPC 1VBD1 4PDWB 1OOPB 4CEYB 1MEC1 1ZBE3 4GMP1 4GH4C 2RS53 1NCQA 4YVWA 2IZWA
chains in the Genus database with same CATH superfamily
2HLAB 3BD3A 3LQMA 4LLWB 4X7DC 2XVBA 2VZRA 1EX0A 3FHQA 5FO9A 4H8QA 4IGBD 4YVWB 3VBOA 4HJUA 2P43B 1JWMA 1Q9LB 3O6MH 3KZ8A 2PQSA 3GZEA 3PFUA 5L7OC 1S8DA 3L13A 1CLOL 1Q0XH 4QTHA 1E5SA 4JVAA 5I74B 1U93A 4Y16A 3VI4B 5B4MC 4YG0A 1DVQA 2D0HA 2GBUA 3H1ZA 4YSDA 1AQDA 4WEUD 1NCGA 4Y5XB 1POV1 4UBHA 1LNUA 2VL4A 1CE6B 2LOEA 5BUAA 4X99B 4TSVA 2Z92A 1ULVA 3IKCB 1RZIA 4DO6A 5HBBA 5IHBA 2NUTA 3U9PH 1A14H 4Q14A 3SYCA 2D7TH 5AZ2H 5KVFE 4A39A 3O1OA 4W1TA 3TPKA 5H9QA 1CT8A 5L7OA 3PU3A 4QX7A 5EFIB 4KK9C 5FYLD 3LH2L 3KL0A 1POQA 2IMNA 4JDZA 5J7CC 1XYNA 3D0LB 2MIZA 3WXVH 4RRPG 1N5YL 1RTVA 4UCFA 2GP5A 1WBXB 1N59B 2G5BB 3D8MA 2WNVB 5CSZB 3BT2L 1A4JB 3MR9A 2DM4A 3PGCA 4G42A 4MHRA 4WGVB 4MJIA 2HUHA 3F5WA 5CUSL 4QIRA 1BAFL 4B4QA 4UYQA 1ZHBA 2YUWA 2ENYA 2VLKB 5FK8A 1HAWA 2Z9TA 1SJHA 3W0WE 1BBT2 1S0EA 1A1OB 3IU4H 3KPQB 4H88L 5CZXC 4K7FA 3TS8A 1H4GA 1PQZB 1HV0A 4QRPB 2XZCL 1PLCA 3U0TA 3WF1A 1C5DA 4UT7L 1HJFA 3FONA 1NQJA 3C09C 1K4DB 1P6AB 2AJSH 4C57C 4QLRA 2WUBH 3VH8A 1JUFA 1AXSB 4ZUWB 2I9TA 2ATPA 4MNGA 5LBFA 1GHFH 3HRPA 5T33H 4U1MA 4HCIA 5G05L 4QHPA 4MZ2A 5GS1B 1TEYA 3D30A 2J43A 2EEDA 5IJVB 4XXCC 2JSFA 2V9UA 2ZPKH 4FYSA 5C07E 3IDAA 2DAVA 3UO1L 1AKPA 4Y2OB 3PAYA 3D69B 3POFA 3L4VA 1H4HA 3TA3D 3FO9B 4V2CB 4DZ8A 3EGDA 4HIHB 5F7EL 5F3GA 1JNJA 1FZMA 2MNWA 3K48A 2HSIA 4PS8A 5TQ0L 4F27A 1LKNA 4LBJA 1HINL 1DN0B 1J1PL 3PFQA 4WK2B 3U4EB 4XMPL 1PZ9A 1QFWI 1U6AL 3FU3A 4TTDD 3QWOA 2JB8A 1EFXA 3F62A 4RGOL 4JRLA 3BW9A 2K45A 5ICYA 3B02A 4RHV1 3C6EA 3QQ3B 5EU6D 3MV7B 4IBLT 3UPRB 5EU7E 4NQSA 3QRGL 2LLGA 4Y9EA 4NUMA 2RMU2 3WX5A 4C1XA 1CWPA 3OR6B 3CXDH 5IVZB 1AGEB 2HWB1 2WNOA 4FJYA 1A47A 1LP9E 1WAAF 3O3BB 1PVHA 2VLRD 4BXFA 1UWEL 3CFBA 5ABDE 3LA3A 3VI3A 4YRDA 1OLMA 3TXAA 2B46X 1A2YB 3MUJA 3VD2A 4JK0D 2VTFA 2Z7YA 2X1QA 2VQAA 3GK8L 5F9DC 2WP3T 3MRHA 4C54A 5T1LA 4YJZL 1LGCA 3WFHA 4C8XA 4HC1L 1RK1A 4HT1T 1MG3C 2UV3A 1PGSA 5EIQA 3Q8AA 4QD2E 1EMTL 2OMNA 5L8KB 4O2FB 1I53A 3A23A 4D8MA 5JQHC 4V33A 3I2CH 2WQUA 1IKNC 1XIWA 2EEAA 4B3VA 4MJ6B 5HHPA 3NQKA 5I9QC 4S0SD 2LW3A 2UWEB 4GAJH 5TDPA 4Y1ZA 1MWAA 1V7NL 5FGCE 1OLQA 3N7MA 3CQFA 2L0DA 3L7EB 3WINE 2YUXA 1ONQA 2DD8H 2QQPA 2X3CA 2BS8A 1G7PA 2J8UA 4N2EA 5JHLL 2HWZL 5B38B 3NJNA 3DV6A 5JNYA 1J58A 4M02A 1KGIA 5D96C 4YN3A 4EN8B 3AB0C 5DA0B 4K1YA 1MUJA 2IIJA 1B0RB 1UATA 4PJBE 3EH4B 1XD0A 3MREA 4WUUE 5D1XD 4B0MM 4B9GA 3RDIA 4JFYA 3HA0A 1BBJB 5FWQA 3WD5H 3ZR5A 3WU1A 3TYFB 3SCFA 1NBYA 1DDHB 3LKSA 1THCA 3CSFA 3IU3B 3J8F1 1JSYA 4W65A 4AF9A 1DFBH 2SEBB 3AROA 3P4LA 4QRUA 3RB5A 5KZCB 4O9EA 3OLDA 1VBC1 1OF3A 1UF2C 1H6FA 4JO1H 1F3JB 5HPMA 1CLZL 5ICXB 4Z7WB 3NAPA 2E7QA 5E99L 3AB0A 2VERN 4PJ7A 5KSVA 3RL1A 3NEXA 1GYVA 1IAMA 5E4IA 1BM7A 3DI2B 1TJHH 5CSBA 2KPWA 1YNAA 4XBMA 5K39A 1VB2A 4GSDH 5ANME 4E42B 2AJ3B 1NGYB 2WBJD 3R4DA 1LO5A 1P2CA 2MOGA 4IEFA 3ZHFA 1J8KA 1RUD2 4X8PA 5I0TA 1J8RA 3EYUH 3GMMA 2OT7A 2OMYA 1DEDA 3FUMA 1MNUL 1J9SA 2PAMA 1NGPH 5I18H 5F2SA 1IC1A 2FD6H 3KV4A 3HC2A 3B7UX 2VSDA 5DZAA 2EXTA 5C8JA 4QNPF 3FFQA 3TN92 5D1IA 3SCGA 1YYLL 2VDQH 3FUOA 3T4AB 2YSTA 1QFWL 1XGTA 3D48R 2XJVA 2VC2B 4K23L 1RMU1 5HI3D 4TWTA 4G9SB 4OVEA 2VAJA 7TAAA 4NGHH 3KLDA 4PMEA 3P3RA 1UB5B 1I5PA 3VGAC 5J3HC 2NY2B 1YECH 3NZHH 4Q4IA 1AKJB 5E5MA 4QCIA 4R3SA 5K0UB 2CHZA 3CDCA 3M8OL 3CVBA 4M8UA 4PJFE 3RA7L 3SCMC 2V37A 3PPSA 4WEBL 3VFTB 2W80C 1LESA 2ID4A 3I9IA 3RTQC 2EUVA 5J0BA 5E2WH 4G3YC 4XHJD 2FGWH 4KHXL 4YG6A 4P3DA 3ARGB 3SO3C 3QIUC 3J07A 4A7VA 2ZYHA 3FOLB 3I6GB 2LU4A 2Y7MA 5JHDB 3NSTA 5CEZD 1HCZA 3IN2A 2QGDA 1HSBB 4LU5L 3MUY1 2NDFA 2D3SA 1CGSH 3ZXEA 3NFNA 2BC4B 1CI5A 3ZTCC 4DGVL 3LE0A 3D18A 2ADDA 1JZEA 4CCMA 3B34A 4LMQE 1NM4A 1EK3A 3ARBD 4KVPA 1JHKH 2Q4SA 1NEZB 1KIRA 3ZHNA 4G43B 1YUHA 2GNMA 4G8GA 1X5LA 2XPYA 2YD7A 2K4AA 1XV8A 3CHRA 4KROC 3MRLA 4NQXA 4P5MA 5DCCA 5MP6H 2Z0UA 1EHLH 2PELA 2VIRA 3DVGB 4ZUTA 4DTGL 4AH2B 5AG8A 4M93C 4U6YB 3ZTDC 2IWKA 1DBAH 4C0HA 2IVFC 4JZOB 3B9VA 2R9HD 4Q0VA 1BLIA 4TNWK 4QTFA 1U8QB 1QSFB 2OZ6A 1WIOA 1L9RA 5ESAB 2EUXA 2ZJSL 2A70A 2J88H 1R3LB 3V2AR 4IEQA 5TK4A 3H6AA 3SITA 1W16A 4KFZC 1PGW1 3H1WA 5DO8A 4KJWC 3P9WB 3T1MA 5FOJB 2OFQA 4PGZA 3V0FA 3WOVA 2PCFA 3EJRA 2CLRA 3LPGA 1KTDB 4AM0A 4XP5H 1KEMH 3VZOA 4TNVF 5JXEA 1VGEH 2EEFA 4R84A 4GXFA 1VACA 2GSIA 5BNOA 5CZVH 4AXOA 5GGVY 3B3IA 1R083 5FZ8A 4G9FA 4PJDE 1E4KC 3S8GB 1QJX1 1OT4A 3LV3B 1VFBB 2D5FA 4YDJB 1W2AX 3PGDB 3KLQA 1LWHA 1CWVA 3MXVH 4OZFA 5FCSH 5CFDB 4QQPA 1T04B 4UDUA 1ZV5A 3WENA 4AVKA 5D9SA 4KQ0A 3DOIA 3LJ3A 4ZXKA 1LVEA 4UM9D 2WZ0A 2XYBA 2CBTA 3ECBA 4HXAH 4KKRA 3W2DH 1P9MA 2X4SA 2YGQA 2YD0A 3WMQA 2Z2SB 3O12A 4COVA 1DVZA 1LULA 1HXMB 5CG8A 2P1BA 2PW2A 3ARTA 3M7AA 4JFWA 2FSDA 4PB9L 2DZEA 4QXCA 4JO4L 2ED8A 2WLHA 4QGMA 3W9AA 1FE8L 1Q0EA 5TTRA 1KF9B 4EXPX 1ORQA 2MNJB 2VWEC 4G3YH 3O2WL 3QFDB 4FXGC 5HHOD 2AC1A 1P84K 1MCJA 1N70A 2QQUA 4PBXA 4DN4L 4PJIB 1FVDB 1JHJA 2FX9L 3IGKA 4GUCA 3ESNA 3L5XH 4WEEA 1WLCA 3G5ZB 4N53A 1DQMH 5IK4A 5AB0A 4ZOBA 3K8KA 1HEHC 4MUVA 5T50A 2A6KA 3MBED 3VFSA 2QNKA 3MICA 1Q8MA 3O6ML 4JO8A 4PJ7F 1YFYA 3MLSL 2J21A 1VCAA 2AJUH 5B8CC 1T4KA 2FYYB 4V11A 3BN3B 1SACA 3KV5A 2D98A 5K9OA 2WCGA 1VAKA 4YSEA 2CKBA 3DVNB 1WCQA 2IXQA 4JKWA 3THMH 4K21A 2HMIC 2DEYX 3GZOA 4Q4W1 2BFVL 2EDOA 2IDTA 5AB2A 4KNTA 5KXEA 2AMUA 4IRSB 4JZRA 4DUWA 4LKFA 3SEEA 3B9EA 2UYLA 2NY0C 2EXYD 3GSQA 3J7MA 4K8RB 3G04B 4FNLH 2D7TL 5KN5B 4MGIE 4ELKB 3MLPA 4QTIH 2DWSA 3ABGA 3DO4A 3GMOA 4OMCA 4C91A 4F57H 2J5LC 4S2HA 2J1YA 3L4YA 1DJIA 5B8CA 4BQ1A 4WNQB 2CALA 3OHXC 3QJFB 1XMEB 3OX8A 4BFJA 1CFTB 2SODB 3LDBC 1XF5B 1A6AB 2W0KA 4EN3B 3EO0A 2XNAB 4LBKA 2P8LB 3T0WA 4F7CB 2UY6A 4FEMA 1NFAA 2D97A 1YDPB 3EADA 3HJRA 4ZPVB 4IV3C 5DGRA 3SOBH 1U3ZA 4JDNA 1FOD2 1PVC3 5LA0A 1HRI2 2R2BA 3AG2B 1OP3H 2OMXA 3S3PA 1B35B 1Z9LA 4GEJA 1XGUB 1AZRA 2G9HA 5IMMA 4B29A 4ZDHA 2WLYA 2YHGA 1AH1A 2WT2A 2XXMB 4ODHH 1DZRA 1HL5A 3NT0A 4WI3A 1U8IA 2ESVB 4GI8A 2AJSL 5IJBC 5B38G 3LDBA 2WUBL 4OI2A 4AK3A 5T5NF 4G8IB 4XJ9A 3NJMA 4BFKA 3MACH 5JLZB 1FXZA 4M7ZB 5T33L 4B27A 2Q1EA 4FLOA 1C3HA 5FLJA 5C0BE 3ROOB 5ACA1 4Q1RA 1UEYA 1AGFB 2DH3A 3LIHA 2XDVA 2IANE 1XU2A 1W15A 2ZPKL 5EO1A 3RS6A 2JKSA 4A2DA 4LPCA 2V4AA 5DZLA 4U1SB 1J05A 1TG8A 1NC2D 3BVVA 1PGL1 2OBGA 2DWEA 5KEZA 3I9PA 4DF9A 5BO1H 4DFSA 1HCVA 3S30A 2GC2A 3RY6C 3HS0B 2VUYA 3DPDA 5DAQA 1ZVYA 4KV5E 5I6KA 1U5XA 5DFWH 2DIEA 2NX5B 4D8PA 3VXRE 5IWFA 1C16A 2AEQL 3IPVA 2E6PA 4MQXC 4HVOA 4OCLC 4BOWA 3CXDL 2GH8A 1JV2B 1HNGA 3VV1A 3ZX1A 3PHQA 4LBEA 4XO3A 4N90A 5CB7A 5D71H 4U4IA 4CMMA 2NY3D 4KC3B 4L2YA 4JZJB 4LSTH 5J9PA 4ZKTB 3FB5B 1N6UA 3HIFA 3V7MA 2LFEA 3RI8A 5AW7B 1F1GA 1JWSA 2PYEE 3MBWA 1VZIA 1S0JA 4TSBH 1IZ3A 2AQNA 4J1UA 3WO3B 1RZ7H 5FYJH 4C1WA 1FSKB 3FTYA 3OCPA 2PA7A 5CGTA 3BAEH 3CBJB 4F33B 5LBBA 4J8QA 5E4EB 1LHVA 4QQ2A 2PTUA 3QJQB 5EUOB 3CNKA 1KPRA 2VGLM 1YEGH 4PJHE 3WCRA 2HLEA 1XXDC 4F8PA 4Z7VE 4MDIA 3BSZA 5ACZB 2A74B 3LEKA 1V54B 3HG1B 4JPIB 5JOEA 5D2LE 4EROA 2DD8L 2RH0A 4IEUA 1MHHA 1NUDA 5FGBA 4F7EB 5KSBE 1AGCB 3WEXA 1K8DA 2LVEA 5B4MD 4TUJA 3V9FA 1P6WA 4DCQA 5T1DL 2LW8A 1OGAD 1H3GA 1Z1WA 2NMSA 2AEZA 3ZYIA 1CXFA 1XHHA 4F93B 1DLHA 3L16A 3WJJA 5CBEB 2FR4A 4CEYA 3WAJA 2ROXA 1BFTA 1U42A 3PF2A 3WD5L 5FCCA 3CJJA 3MV9B 1R24B 1XNDA 2RAMA 4AVAA 2JE7A 1T6WA 3EJTA 5BNQA 4OZOA 1AZZC 2WUCH 4QF1B 4KK9D 1D6EB 4HCRA 4UMSA 5CXPA 1MFNA 5DUBA 43CAB 2DLHA 4M5ZH 5BO0D 3BPNB 5D93B 4HOWA 3W20A 4IERA 3AG1B 4HPKA 1L0XA 1E7VA 3QAZB 4NCC1 4CUGA 4NZRH 5B1CA 1T66C 2X0UA 5HPOA 2X2UA 1MY5A 2X10A 3FQUA 2RV9A 3R4SA 3RRQA 1TJHL 1R1A1 4GSDL 3DVIA 4Y9FA 1SDAB 2K7PA 4KKQA 3QULA 1BQSA 5F7KC 3S36H 5FECA 1G6NA 3GHMA 4Z2AA 1NDMA 5E8DH 3HBKA 4UFLA 4E4SA 4OZGB 2UZXA 4N9OB 4Y5VC 1LEKA 3OAZK 4QJ3B 5I18L 2YY1A 4Y2DA 3EYPA 2FVNA 1TQBC 2NTSP 5BRZD 5FPVA 2YXVA 3WDWA 1TU2B 1VSCA 2FLRT 2K6YA 2VL5A 1W0YT 3LPFA 1W6NA 5EWSA 1WA6X 4XQ4A 4GW1A 4Q4X3 4F2MB 3O41A 4RS5B 3T6QC 1SFDA 1Z7S1 3CMOH 1CGUA 2J1TA 3CIAA 5A1LA 4YFDB 2Z7WA 4NGHL 1COV3 1ND0B 1EO8H 3NZHL 1WUZA 3C5ZA 4JEGB 4ATWA 5KXDA 4FPCA 3DX3A 1X7TA 1MWAL 5ALCH 5DHXB 4Y5VA 3DJSA 1RPUA 2JJWA 1G9ML 2WP3O 1W6LA 3SKJE 3ZN4A 4IE5A 5E2WL 4L4VD 1BJ1J 3ZLIA 5CEXB 2NXYC 2V3FA 5D7IF 1A1MA 4WM8A 1J5DA 3DIVA 5F1NA 3RNQA 1CZSA 2P80D 1FFPB 4AQEA 2P5EB 2FHFA 1BA9A 2NY4C 5I91A 2ADIA 1G6VK 5KS9B 4B60A 1G7IA 1QEXA 2WLKA 2JXMB 1T7WA 1CGSL 2XDHA 3DHJA 4PLOB 2XQYK 3RHWK 3USUB 1A1NB 2XIDA 4V1DD 4S2GA 1JTTA 5PCYA 1YO8A 1WYJA 3HZKB 3MJ7B 5C09A 1JHKL 3KHCA 5HP5A 2FB4H 5HHMD 1S0IA 5I5JA 2VE1A 3LRKA 1W6QA 1M7DA 2EDBA 4M61A 1AR93 4WJKB 4DUVA 3FQXA 4YFZA 5MP6L 1EHLL 3B8YA 1LOBA 4Y4HC 1CAXB 5HGBB 4D69A 1ZSDA 2VRAA 4LCWA 4XPFH 3WMPA 3GHEH 1GYWA 5GS3A 4QJ5B 4OF0A 1DBAL 1MFVA 4MKTA 1AQ8A 2WWUA 3ZO0B 1I6XA 1QWHA 4KWJA 3AS1A 4PBDA 2RR11 3A4UA 5CFCB 4FQIH 1U2YA 3O3DA 3NIGB 2DIJA 2X88A 2ZUVA 3FKUS 5B3SB 1GU3A 1I9RA 1QXRA 4JN2B 5L9DH 1G7MA 5CLZA 2MKWA 2O5ZL 3V4PA 1T6VN 4PRNB 5F8QC 4UQ2B 4YX2H 1C1LA 4IESA 4YS4A 4RRPM 4Y1XA 2BLFA 1V10A 2WXRA 1W8NA 4AE0A 4XP5L 2WINA 5KXBA 3GXPA 4ODXB 5EU5B 3UL4A 1T83C 4DUXA 4A7KA 1JUIA 4RBPK 1VGEL 2XZAH 2NNAA 3ALQA 4Z7QF 3JV4A 3QXAA 1JU4A 5CZVL 3FTGA 1ZZ8A 4KRPC 4TULH 1SYVB 3SPVA 1RUF3 3K4AA 4RQQA 5JDJA 2HWE3 2E5EA 4XP6L 2DRUA 2DQTH 4NQCB 4LE3A 5BZWA 1O9VA 2X9XA 2VXJA 2DMGA 5INDB 1LEIB 1Z9NA 2EH8L 4X6CF 5LHDA 2OQJB 2MWCA 1AO7E 3T1FB 5A3LA 1T83A 4X50A 1GC1L 4HXAL 3W2DL 4AI0A 1V55B 5EULV 1VRBA 1XNCA 3AL5A 2R7EA 1ETJA 4OMDA 4ZD3H 4LDOB 1TNMA 3QG6A 4R6UA 3GTNA 4P02B 1CFMA 3TF7C 2GN3A 3LWCA 4LTAA 1TFPA 2DYPA 2OYZA 3WG2A 3E9TA 5DVLA 3WIFB 3EJYC 4CXXA 3NGBB 3KPRD 4KX7A 1P84J 5FZOB 3GS0A 5FO7A 1GS7A 3V4VA 4Y5TA 4W9IC 4CDWC 2ZABA 1BX2B 3L5XL 4F91B 3NN8B 1X82A 1DQML 3F7LA 2F5BH 3ZDZB 4Z0XA 1U8PA 2PMZA 1BLNB 4ZW3A 4LJHA 1U9KA 2DFBA 5A7EA 3GBDA 4Y19A 4D9LH 4J4PA 5J3HD 4GOSA 1NM9A 1SDYA 3PDOB 4LLOA 1JGDB 3V4PH 3SCMD 5KAQF 3THML 1LWJA 1G4MA 3BPSA 3RTQD 1NWPA 5F3BA 3CZEA 3PP3H 5CR8A 4G8GD 3SB3A 4GH4A 2RJKA 4CDWA 3MJ8A 2M2DA 4E9TA 5I1CH 1EHKB 3QIUD 2VLME 4L3FA 3L9JT 4AYID 4LSUH 1PO22 5I26A 3KPTA 4QTIL 2IC2A 3T8XA 3WKMH 1CLYH 1KLUA 3STLB 4F57L 1P8JA 1KJMA 1CXEA 3LX9A 4FDWA 3FUQA 1B0WA 4JJ5A 2J4WH 1O5DT 1DQQB 3LS4H 4FABL 1HSAA 5FZBA 1UXLA 4UAOC 2QPFA 4KROD 2QVFB 4QRSB 3ZKXB 3ZYJB 3G7DA 4PJEB 1NIBA 3GXUB 5A43C 1P1ZB 3POHA 2AUYA 4LO8A 3B6SA 4U3HA 3TURA 4XQWA 5SV4A 4G1EB 3NPSB 1BQPA 1FNLA 4WJG3 2Y26A 5JMCA 1OE1A 4K07A 2DOCA 1AXKA 2ENSA 1NC4D 4G7YL 4K71C 4H25B 1BMWA 5EN2B 3IMRA 2FIKB 1CUOA 4KJWD 2WM0A 3MACL 5A2JH 3T0EB 1DQDH 1INQA 4W6YA 1CDBA 1FL3B 3DBXB 3I3DA 3TO4A 3VSTA 4FA6A 2NLRA 5IFHH 3VGFA 4CNIB 2X2JA 1F90H 1PKQB 3VWKC 2H8PA 2J20A 4E9YA 3GUTA 3MF9A 3V64A 2AAVA 1M6OB 4HAKA 3CPLA 2IALB 1RJYA 1FPTH 1A6CA 1Z9OA 4BU2A 2DIBA 5GGRB 4NN5B 3PUUA 4W9KC 4Z3TA 4YZWA 3H9SB 4XAKD 3KLSA 3U48A 3GEFA 4OZIF 5BO1L 4ZMOA 3GF8A 1Q72L 4GQZA 4PJAA 5D4IA 3QRLA 4ZXBB 3POGA 3H7LA 2JG8B 2F5AH 1A34A 3NACH 2GALA 3ZVXA 2WGNB 3TN0C 5HJDA 4MX7B 4XBEH 5EEXA 2BHFA 4MMXB 2IH9A 3RB7A 1DQ0A 1YFWA 3KV9A 3KYOB 4HMEA 4RR3C 4PG9B 1TQTA 1Z9MA 2CBQA 2RM23 3ZFGA 1KV3A 3BO8B 3QI9A 3BDXA 4YSFA 4XVOA 4YNYB 4PQXA 3KCYA 2WQ4A 5AL8A 1ZLSH 1PFCA 5B4NA 2EVIA 3ISYA 2E51A 1GTNA 1IS4A 5HCFA 5ALBH 3PQYA 2K46A 3K3NA 1P7QB 2J7LA 2VISB 4ODVH 2R0LH 4TSBL 5F3HB 1RUAH 4I48A 5HDBF 1QDOA 3TRSB 4HMDA 3M17A 1O8SA 1WMEA 3TN0A 1RZ7L 4HETA 5AKRA 2WVVB 4I0KA 4L0ZA 1POV3 3BAEL 4ASLA 5TDNB 1R082 2WKOA 3PDDA 5FUZH 5C3SA 3BPLB 4H2AA 5DJCA 5E1GA 5H94B 3TBDA 4HH8A 1I8MB 1YEGL 2R041 3T6XA 4Y1SA 5FUNA 3T0AA 2WA3A 1WLDA 2V7HA 4WUKL 4AYFA 3OL2A 2AABH 3U7WH 1AP2A 1JPSL 5IB3A 5K8SA 3VFVB 2PHTA 2CKNA 3N1FC 4BBWA 5SWZE 3WN6A 3CN2A 1IL1A 4XNZC 5EZJA 4BM8A 2J55A 1R34A 3EDKA 2KHAA 3TBYA 4RYDA 2PTTA 2Q6WB 4ZYKA 2HMID 4J1WA 2VH5H 4JREB 3D3VD 2VNOA 2YAFA 1CG9B 2QPEB 4HIQA 5DZNA 2D3JA 5DJ0A 5FYJD 1XU1A 5T5NG 4CUAA 4A2EA 3UETA 4UTBA 2XKOA 2NY0D 1F86A 2QQJA 2WXGA 1QI3A 4QHLB 4A44A 3BWSA 4R4NC 4JMXA 4NT6B 2XBDA 1I1YA 2ERFA 3POCA 5D7LB 3V0WH 4YW7A 5D7KD 3CLPA 1HC1A 2G60H 2WUCL 4O00A 4AQ8C 5IJCC 3LFMA 3AP7A 3ZFFB 5C9KA 4HONA 2AJZB 3MC0A 2Z4QA 4IJTA 4M5ZL 1ND2B 4JCLA 5F96H 3WTUA 5FP3A 4X9GA 4NZRL 2BVVA 1QOKA 5BY5A 1IRAY 1MLBB 5C0IB 1VDGA 3NUKA 3LIGA 4OUEA 1YNTB 1M4WA 1J8HA 4I2OA 3O3EA 1ZV9A 3KG5A 4YDZA 3PL0A 3P3SA 5FAXA 4HA1A 3S36L 3ZL2A 3H8OA 2R69A 5F71A 3JWDC 3L3JB 2F1EA 1RHHA 3SGDI 4E2QA 5E8DL 3RVVC 3GLDA 1F11A 2HG0A 3D51A 3FJSA 1OP5H 3IE9A 2IAMA 5AFBA 4XMKH 5SWSE 3D06A 4L5FE 5HXMA 4ATEA 2XV0A 4HIJA 1T0NB 3PHSA 1YQ2A 5GZCA 1F4YH 3JTBA 2ZOKB 3OAUH 4FFYA 4MA3A 4JRAA 3GJFB 4LSVH 5KYUA 3DBSA 4JKKA 4KWUA 2VUCA 1MHCA 1ASPA 5C0CE 3OJBA 1S7UB 2EDYA 4WDIB 1FBIH 3E6DA 5FMOS 1DHKB 5JYMA 4RHV3 3RDTC 3QNYB 1ALYA 4DOUA 4DEPB 3T6VA 4EE2A 5HY9B 4KI5M 1DQ1A 2YZ1A 5ALCL 5T55A 4X8NA 4XR8C 5GZNC 3EDJA 5DJ6A 3KPMB 4AEJA 5JXJA 1SPPB 1CAXA 1UKRA 4MNQE 3VO0A 3D4CA 3U7YH 4FTEA 2NY1C 3KHBA 2BBVA 5FCUH 4B7IA 3UABA 3VFRB 4JR9L 1S9YA 2ZGQA 1AANA 2EIDA 4G71B 4UTBH 3QUXA 2XVKA 4MQXD 3ZTJG 1KGYA 4KNCA 3LHAA 4LOSA 3GSUB 4M7LH 4LHUA 2AC0A 1OT2A 3LN4B 3HN1A 4P14A 5IF0B 3ZYZA 3APDA 4PBWD 4IEZA 2OX5A 4FPHA 3ARUA 2FB4L 5FZMA 2HYKA 4GSQA 2IJ0C 1AE6L 5FOBB 5CILH 2IQAB 4XPFL 1YCIA 3GHEL 3CFIC 4MJHA 2JMRA 3LH9A 1ACCA 4A7GF 4E27A 2LT9A 1YEIL 5FY8A 5C3OA 4ZHNA 3QYMA 2R69H 2ZWSA 5HSFA 1XCQA 1GGUA 4NJ9L 4Y5YA 4LLMA 3IDYB 3MFFB 4FQIL 5AVRB 2OQ7A 5ETUA 2BFUL 2XQRA 1MH5A 1DQ6A 3NJLA 3TBTA 3Q3GB 1JZ2A 5I28A 1BREA 2P8MA 4YSCA 3LAFA 3NSJA 1H9WA 2BGOA 4RMWA 2BVOA 2ZQKA 4L29A 1N6QL 4EUPB 1E9QA 1VBC3 5A7SA 4BQXA 3OJ2C 2A5UA 2NT0A 5ANMB 3S9DB 4Q4V1 4BE6A 3ZY7A 3O11A 5K9YA 1BXXA 3UYJA 5KVDE 4L8BB 4DO0A 3LKNA 3JWDH 5A2IH 1DP0A 4XUPA 4GBXB 2N7SA 3DRTB 1S9WA 4BDVB 1QHPA 3V7AE 3B2DC 1AL21 1HHGB 3CVIH 2W0FA 2ETEA 1SLAA 4NI6A 1ZS8A 4XMLH 2DQTL 3U1SH 3KPNB 4BQBA 4NZJA 3ULVC 1ST8A 1H19A 5EU4B 3NMBA 2QHLA 5FXVA 4HIPA 3QIWA 1R5VB 3QRBA 4MD5A 3GXFA 2LS6A 4OZ4A 3QZWB 1VADA 2ZE0A 5FBZA 3FRPG 3RWIA 4CVZA 4M3CA 2CGPA 3T3MB 4IE0A 4JRXE 5FZKA 3MRJA 4PV8B 2I07B 1BQHA 1T66D 1OAYH 1SBFA 3B7TA 1INDH 5AOIA 3D50A 1VZGA 3EJQA 2YPLA 4FNTA 5EUKA 1I4FA 2VMDA 2VXSH 4ZOEA 1E4JA 4NHKA 4BA6A 1KDKA 2JTDA 2X12A 4N8VB 3EOBB 5IVFA 2EDRA 2BVBA 2CZNA 1OV8A 1LE5B 5AW4B 5BZZA 3OKEB 5CZRA 3LZFH 1WV7T 4FMKA 4F3FB 2LTNA 5PAZA 4AIXA 2WTRA 3CLWA 4WJ5B 1JDDA 1J5OH 3PWNB 4Y1YA 5BS0B 4KU1A 3I2HA 2CTVA 2X4NB 3B5HA 1XEDA 3O6FB 3V6BR 2F5BL 5F7BA 2CNYA 4Y5XC 1EV12 3VDDC 5IQ9B 2CO6B 3KBHE 1CF8H 4CSTA 1KLFB 1VEMA 4TNEA 5D1ZA 1VP6A 3OHMB 3IDGB 1MEC1 1FYTB 4D9LL 4PREB 4KU8A 1WFJA 1I9RL 3NNLA 4LLWA 5LA1A 3TZVC 3QJHB 2DVBA 3F7VB 3V4PL 4PHZA 3BUIA 2OK0H 1U36A 1M3JA 6FABH 4YVWA 5E1RA 2K4WA 1Q9LA 4RWHA 1SEQH 1HH9B 5H8DA 2L4OA 2UZIL 5FWEA 2NXYD 3L17A 1GGYA 4MD4B 1T3FB 4MV2A 4OKVA 2BVPB 3VI4A 5I1CL 1AJ7L 4CN1A 1FL6B 4JRYB 4LCWD 3KGZA 4LSUL 4Y5XA 2VG9A 5JDBA 4AQAA 1CE6A 5BCAA 2FEEI 2NY4D 4X99A 1C9SA 4YDKL 3WKML 3AG3B 3IKCA 3AMPA 2VZUA 3VXNB 1LGVA 4AC4A 5DVOA 4AX3A 1KS4A 4XF1A 4Q97A 3HB3C 2MEJB 5FBJA 4RMUA 2Z3FA 3U4SA 1QOOA 1OSPH 2J4WL 3LS4L 3VX1A 1TUPA 5C5TA 3PP4H 1U8OB 2GAZB 4OUUB 5IB4B 5EFIA 1L9PA 3E1F1 4ODUB 2D6MA 4B9PA 1GL4B 3D0LA 4F2FA 1COV2 4Y4HD 3ERXA 1DYOA 1PNFA 3DO3A 4BIOA 2G5BA 3L1FA 4LBQB 5CSZA 1J5HA 1PCSA 4QXUL 2VNCA 4RA0A 1G7JB 1OLZA 3EFOB 4MHUA 1OARH 4W6WB 3NKTA 5DZFA 1G6RH 2VLKA 3UKVA 1H15B 3PWPD 3ULVH 5CD5C 4F8AA 1A1OA 1F4WH 1OP4A 3KPQA 3KYNB 4QXVA 4XPGH 1PQZA 2N7GA 2NPIA 4QRPA 4K2UH 4NKDB 2HFFB 4DXSA 3O1PA 2OMTB 1DQDL 4NC1E 4E68A 2VBDA 3Q8EA 1K4DA 3QDGA 5IFHL 1Z0MA 1F90L 4Y1UA 1AXSA 4ZUWA 2JE8A 4KI1A 1GFF2 4X6DE 3X1EA 5GS1A 3UZEC 2EVJA 3DJRA 1FPTL 4KRPD 3TT3H 1FC1A 3AS3A 4RISH 2F15A 1X5AA 4DT2A 4G6JH 4Y2OA 3CE1A 4Y1TA 3D69A 3X3GH 4IKLA 4RGNB 1YG9A 3QEQA 4YGDA 3LEYH 3D1MC 3FO9A 2VUKA 3CXHK 4BV1A 4HIHA 2F5AL 2EXSA 5D5MF 2CNAA 2PLV2 1UKGA 3WE6B 2WFPA 1DN0A 2XTSA 3U4EA 4HIIB 1TJXA 4A4AA 5KAQG 2OQ6A 2YBKA 5HCAA 2VMCA 4JG5A 4P2AA 1J0HA 5DEGA 5FLIA 3QQ3A 1C1EH 4OBRA 1G0DA 3FTWA 4YGAB 5DD6B 3RPKA 3IBOA 3UPRA 5H4YA 3IFPB 3ZE2E 4R96B 2DQJH 2ZP8A 4Y19D 1CXLA 1GGCH 3UKNA 3OR6A 4Y20B 5IVZA 1AGEA 5ALBL 2PO6B 3D39B 3EJYD 4PJXB 2BGCA 3O3BA 2R0LL 4ODVL 1RUAL 3NP3A 3IN9A 4PGDA 2X4UB 2JICA 1JYIA 5A1FA 1A2YA 2CHWA 4UT9H 2FWLB 2L3BA 4R0LC 4BSJA 4EDXB 4UXAA 1WITA 4X0KA 5FUZL 2HWE2 4Q4W3 4H7MA 1W06A 4BUQA 4N20A 2JENA 1EUUA 3N40F 1RV6X 2V7NB 2Z4TA 2OTPA 1XGRB 3R06B 3L9RB 3MV8E 1N3OA 1JXKA 2AABL 4I3GA 3REVB 3U7WL 4O2FA 2DVFA 4HFUH 1KD7A 2FEEL 4AYDC 3VBUC 1WMFA 1X5GA 1U8NB 2CGZA 5C0RL 5JORB 4MJ6A 3PWUB 2IBZY 2UWEA 4ZS6C 2X3AA 1S5HB 3G5YB 4XTRC 4PRPE 1JFQL 5FYUA 1TJGH 3L7EA 2IDSA 2BIPA 3ESOA 3QJUB 2WZ8A 3OPZA 3VXUD 5BXFB 1KY7A 2H1LM 4PWGA 4GO8A 5B38A 4URAA 3U79A 2XTJB 3E3QC 4YAQB 5AAMA 3DIFB 1K42A 3DGCR 3AKQA 4OF7A 2WWMD 3ZQXA 1B0RA 3V0WL 4CMHC 4NC0B 1JD7A 3QZOA 2G60L 4JCWA 5D1QE 1VE0A 4LHLA 1BBJA 3KYMB 5J13B 4YNIA 4JFDB 1GSKA 3MCKA 3TYFA 4GAAA 4DP9X 2R073 3FOMA 1DDHA 1CZTA 1SXSA 5F96L 3SQRA 1B3JA 1F97A 3IU3A 4JY6B 1REEA 2V5DA 4COYA 1QSEB 2SEBA 2YPDA 3UXFA 1S7WB 2I26N 1XO8A 1CYXA 5EIIG 1F3JA 5ICXA 4Z7WA 3POEA 2B42B 1BZ7B 4FC3E 2QZ3A 1XSOA 3ZKQD 1XBFA 3X1NA 1CI3M 1QP1A 1TOXA 2GBVA 4DOHE 1CD1B 1QAWA 4CDXB 1E57A 4E42A 4XMKL 1NGYA 2YAOA 2QKIC 4H0LC 4B9YA 5JIDA 3EB7A 3JBG2 2J1WA 2NY2C 1HYSC 3NDYE 3PJQA 1F4YL 4MXQC 5K0UC 4ONFL 2XYCA 1NL0H 4C55A 4NQUA 3SKNB 3N43F 5A2KH 3D2TA 3CBRA 5EEYA 1R1ZA 2OZJA 1FBIL 3BI9X 3PAZA 4NAJA 4OFQA 2GMPA 4MBOA 3MNZB 1MLCB 2Y5TB 4F92B 2P3IA 3VWKD 4QXHA 3QUYB 3T4AA 4J2QA 3A6CH 4OCYH 5GRVL 3ECVA 4PRHE 1H6UA 1ZLWH 5FPUA 4MRCA 5E6HA 5JZGB 1YPZB 2IFGA 4LEXH 1S9KC 4NHXA 3QZWG 1AKJA 3RWEA 5K0UA 1PJWA 3MQIA 5JSOA 3U7YL 3HAEB 1ZLVH 3VFTA 2Z34A 4I9WE 4LITA 5FCUL 4Q89A 3ML9A 4UTBL 5EBGA 1ZVSB 4UWDA 1STMA 3ARGA 4M7LL 1QACA 2G0KA 1SF3A 3HUJF 3I6GA 3Q2NA 3SYAA 1LHUA 5D2LB 5IB5B 1RUMH 2X6VA 1HSBA 1Q1JL 3K2UH 2XZZA 4YFLF 4Y4KC 4HXCA 4C56E 2WQAA 4E8CA 2BC4A 4LCUB 1I3GL 1G9NL 2ZPXA 3WTWA 4EJ1C 3OAYK 2JD9A 1DO5A 2ATAA 1DCSA 4JFZL 2V0AA 4CRQA 1NEZA 3B2MA 1J12A 3L45A 4G43A 1RIHH 5AWNH 1ZLUK 2GUYA 3IFNL 4G5ZH 1KGUA 2R69L 2VKWA 3FQNB 2BZDA 3DVGA 4L3EE 5F8RC 4AH2A 3VD0A 4FQQB 2ORZA 4U6YA 1MCWM 4EBQL 3EUDA 5DFAA 5CO1A 3VG9C 4BQYA 1HJGA 5IVYA 1F8TL 4AXWB 1B4TA 1U8QA 3IM1A 1HILB 1QSFA 2AK4B 4KXDA 5HYJB 4AUYA 5ESAA 4NN7B 4FFYL 1AVAA 3NESA 1R3LA 5EOTB 4WFFE 4YSPA 1WHOA 1ZV2A 5L2KE 3N9OA 5FOJA 3RFZB 1E6JH 2EEBA 3Q9QA 4GJTB 4LF3B 3VE0B 3F05A 1C57A 2R0WH 4FMFA 1C7SA 4FXKB 2ZHLA 4L2LA 4I8DA 2DWDB 2OR8A 2BBAA 3A67H 5T1KB 4R4ND 4NZTH 4BUHA 3WKPA 3VZLA 2OPCA 1DZTA 4X7FC 3U1SL 4J8RB 4BH7B 4L1SA 4P49A 4ZAKB 5GJSH 4XF9A 2DLFH 4JFQB 2ICWJ 4YLZA 3N9NA 2YQGA 5D1ZI 3ET9F 3LV3A 1VFBA 3H7JA 4YDJA 1UL9A 3PGDA 5EYXA 4P9IA 1OAYL 4OLXH 4WIQA 5CFDA 1T04A 4RZCB 1KCRL 1BYOA 3D2UB 3WQBA 3BKCH 3PXHA 3MCG1 4L4TB 1KCLA 4XMZA 1Z7S3 3ARWA 3BODA 1KCVL 5FY5A 4E2SA 2BNRE 2P52A 4QO1B 3RVVD 1S7VB 1WHPA 1OOPC 1VALA 4X6FB 5J11C 1IILE 4R7DB 1QDCA 1WKYA 4JFED 1UHVA 5CN1A 2DQFB 2W0XA 1NBZB 5CJ5A 4N8MA 1VBE1 1GR3A 3PWVA 4UBGA 4XX1G 3LZFL 3SQBB 1JZ8A 1JGLH 4KKBC 1J5OL 2HWC3 3B9IA 4XCBA 5FZ4A 4OYUA 2Y7LA 4N28A 4EWEA 3VB9A 3D82A 1HZHH 3QFDA 2UWBA 4IOSD 1NCQC 3RDTD 1C8M2 1B88A 1CF8L 4NQEA 1FVDA 4PJIA 4AWJC 1CJYA 1S2KA 4BQ9A 1MN4A 5HYEA 2QQLA 3KV6A 3G5ZA 4WO4C 3PWJB 4H8UA 1U30A 4NWUL 1J3QA 4LNVA 2EDMA 1IHMA 1WFNA 2QMKA 1FPN2 4M4RB 3II3A 3RIAK 5GZND 5C0FB 5BPPA 2X9ZA 3AW5A 2NYYC 2VOWA 1QYGH 2FYYA 1LENA 2P17A 4PWKA 2OJEA 1UQXA 5H9RA 5HV0A 1XFPA 3PLQA 3DVNA 2NY1D 1I3VA 5JXAH 1DBNA 1O8PA 1GKBA 2QQWA 2IWGB 3B2PA 3OR7B 4L97A 1M56B 4XOAA 3WHXB 2H26B 3S34H 3V0IA 4AENB 4XPBL 2VNVA 4IRSA 3QBQA 1QRKA 4LKEA 5IK3B 2HG5B 3ILRA 3G04A 4L99A 5KN5A 2G1MA 3A3YB 4ELKA 1X7QB 2RR13 1OSPL 4YZ4A 2C4FT 1EAQA 3PP4L 3WCYA 3F00A 2NYYA 4P2RD 4WNQA 3QJFA 4ERSH 1N7MH 4S2DA 1UURA 1XF5A 1A6AA 2J2ZB 2JIXD 4TUOB 3ZZQA 1IPKA 2PHUA 2XNAA 1C8PA 5DZGA 1IC4H 2XPZA 4YHPB 5FAAA 2P8LA 3EJZC 3NZ8B 5IQLA 5IVXE 4F7CA 2UYBA 4GKXA 2HWB2 3TAYA 1YDPA 1OARL 4ZPVA 4L23A 3DX9A 1Y9MA 1WCKA 2GNTA 3JZ7A 4NHLA 1B35A 5F7LB 4IMKC 3ULVL 2Q8OA 2KR2A 2D7PA 4CN6A 1XGUA 1XD1A 4ZMTA 1F4WL 1RHI3 2H3XC 1OD7A 2WVUA 4O4YH 4XPGL 2X4RB 5AVXB 4CA4A 1MFEH 3KS0H 2BWIA 2IBZX 4JRWA 2CHXA 3AZYA 5EWIH 3KJ4C 4XNAA 3E7JA 2ESVA 3T8VA 1YEJH 4JGZC 4G8IA 3H54A 4JHTA 3K80A 5JLZA 1OAZH 4F7ZA 1QVOA 4HLEA 1KGXA 5LY2A 1NCWL 2BXYA 3PUIA 1AGFA 2YGPA 1CS6A 2VZOA 2QQLH 1H3WM 3N50A 3NIFF 3BGMB 3RVTC 2P37A 2DTMH 1KCSL 3T0XA 2D93A 2YGNA 4R9AA 1MF2L 3ULVD 3I6SA 4U1SA 3CXHJ 3LEYL 2CAVA 2Y1VA 2QQOA 1I8AA 4Z7UE 3DX6B 1SXCA 3JWOC 4WTXA 3CHPA 3NJFA 1XXNA 1HX0A 3QHZL 1FGNH 5E9DD 3LXBA 4WKZB 1IAIM 3HS0A 5DT1L 3HQRA 4RMSA 1IC0A 3DEMA 5EEWA 4LORA 2VXTH 2NX5A 2Y2TA 4GMTL 4QLWA 4PJ5E 1P5UC 3J8F2 1GH7A 1UXSA 2DQJL 3CHXA 3OKDB 4CC4C 1W0VB 3AREB 1KN4H 1JYCA 1A9BB 3OQRA 4YE4L 4U7KA 4ZMVA 1D7CA 3PL6C 2AHIA 3FB5A 4NENA 3SH3A 4UT9L 3K6SB 1MHEB 3FUDA 3G6JB 2G3ZA 4FLHA 3ATAA 1PX8A 4CDGC 1JOJA 2X6AA 1LO4H 3CFJB 4Y4FC 5IW6B 3TO2B 4U6XB 1BPVA 5A6YA 5K4LA 5JOFB 1X6NA 1MCDA 3S88H 4F33A 4ASKA 1XPWA 3APMA 3RX9A 4N1HB 1A5FL 2YGVA 4OIAA 4RDBA 5EUOA 1JOBA 4WHTB 1RI8A 3TZVD 3T2NH 3QQNA 3FB8B 4WLCA 4ELMF 3EYQC 1DFQA 5TE7H 5F2WA 4CEWB 2HEYF 1LO3H 2A74A 1TJGL 3HG1A 4XB7A 5AAWA 2PHXA 1U5IA 5FYBA 3EJUA 4XCYB 3RJRA 4F7EA 3WDYA 4X6EB 4WTQA 1Z2KA 2OXGB 1AGCA 1ES0B 4G8EB 1RMU2 3N7KA 4URTA 4G59C 1F1AA 5I1JH 2KMWA 3BN9C 1GIGH 1MCHA 3LKQA 4FLQA 4M7KL 3L3IB 5CBEA 3ZL1A 3RZKA 4KUCF 5IFPA 2P49B 1AD9B 3GI8H 4JQXC 1E8ZA 1R6VA 3HB3D 1MNNA 4AK1A 2WAAA 2ID5A 3MV9A 4J5VA 4XOGA 1R24A 5KVMC 2B9BA 4XN5A 2ZXQA 4MGZE 1ESOA 1CGWA 1CFVH 4IQHA 3FCSB 1D6EA 43CAA 2DKUA 5EZOH 4LIUA 3QDGD 3A22A 1AI1H 1MS0A 4HSQA 1IM9B 5LW9A 3LZNA 4HN1A 4G70B 2HEVF 2KLSA 4A2GA 2Y6TE 4WSJA 1TVDA 2QJDA 2YD4A 4ALAC 5EBMB 1SCRA 1TFHA 4RGAA 3T2OA 1UNBA 1OH4A 2HVKB 2VZQA 3QWQB 4E41D 2HXAA 2GU9A 5CD5D 1UM4H 3S37H 3ZRFC 5K7PA 2C3XA 2WVSA 3QEQD 4OZGA 3JWOH 4A7SA 1NL0L 4X9HA 2CM5A 1YLLA 4LLYB 4BYHA 4P5KB 1TF4A 5AUMB 4WI4A 1RPQA 1OGSA 1CN4A 3GIVB 2W46A 3E1ZA 2JJSC 1TU2A 1N18A 2B20A 2JLLA 1ZLEA 5JOPE 5C2BL 2K9ZA 5LGKA 4K20A 1HI6B 3MW4A 2NW3A 4F2MA 3A6CL 2C9UA 4OCYL 4RS5A 3AS0A 1CR7A 4LAQH 4BA0A 3NCBB 3DX8B 1E5YA 1PGW2 4BFRA 5A6MA 3IM0A 1WGOA 3D5OF 5DURD 1ZPUA 3ARDB 1Y3TA 1MW0A 3BIKB 5TDOB 5JPNC 4Y88A 4NRPA 1KFGA 2Y0SA 4JQVC 5AZUA 4AKQA 3SXWA 4ZFOB 1S0BA 2ENQA 1UH3A 2ZYSA 5IT2H 3U30C 1GGBH 4QT5B 4KOCA 2F8OA 2ITFA 4QAWA 2G4GA 1LEDA 2XLFA 5ENWA 2X9YA 2VR3A 1CONA 2DLEA 3P30H 4HIXH 1XB3A 1FFPA 4KXCA 1AF9A 2P5EA 3MAWA 4GRWB 2Y7QA 3FTVA 1GWKA 3B7MA 3N1GC 1YC8A 5FYSA 1RUML 1QJX2 2R043 3TEYA 3DA0A 4OCNC 3K2UL 2GZWA 1MZEA 2ITEA 4I2XE 3KSCA 3USUA 2FDHA 1K5MC 4PLOA 1TQUA 1F4XL 1A1NA 3KW7A 1W8WA 5JSRA 3OGVA 5JIPA 3FSZA 3D25B 3HZKA 3MJ7A 4JFVA 5FHBH 1DYZA 5GSRB 1A7NL 1COBA 1Q3EA 2XUEA 4P9GA 4DETA 4KGQA 5AWNL 2ODHA 1HU8A 5AVYB 2ZF9A 4Q2ZB 4QOKB 5IBUB 1UZZA 4G5ZL 4GWMA 4BLJA 2O6FA 3CFTA 2YOCA 1RZQA 3QJTB 3JVFC 4J3TA 3ZDYF 4GXVL 1MCCA 3VXMA 4HHAB 2FCUA 1D9KC 3FUIA 2CCVA 3ZFEB 3VXOB 2F8VA 4Y1AD 3H3BC 1I1RA 2RS51 3QH3B 2OL3H 2RE9A 1RMFL 5FW6A 3ZO0A 2YC2A 4WNJA 4DEQA 1GA2A 3GDCA 2OSXA 4IUGA 2RD0A 3ATGA 1BVNT 3S7IA 4ZS6D 4YXKH 3VXPB 4XTRD 2CO7B 4JN2A 4QPYA 1M7IB 4KJPD 4IRZH 1T0OA 1K5WA 4PRNA 3MRRB 3WLBB 3DOSB 1NMAH 2KZKA 4MMZB 2FWOB 2R0WL 3PNAA 5ERLA 3BPCB 1HNFA 1MCIA 2VC9A 1NLDH 3GZQA 4E0RA 1BXUA 1HFUA 1RLWA 4D7SA 4ODXA 5EU5A 4G6KL 3WJLA 1O0VA 4ALAH 3MDPA 1OQEA 4A42A 2ZCZA 2EE6A 2F54D 2I24N 4YHOH 1H8TB 4NOBA 5T5PA 4WM7C 5H9SA 4FJZA 5A1AA 5JMOC 3LIZH 5KYXB 2FMYA 2VNGA 4M43H 1SYVA 2DJUA 2DLFL 5FGSA 5BMFH 4Q4W2 1MJ7L 2H3NA 2BSCA 4MJ4A 4HJ0C 4K5MA 4QYOB 1C7TA 5KVEE 2WKKA 3VLBB 3AYAA 4OLXL 2WLMA 5INDA 5BVJB 3VAEA 1BF5A 3TNNB 2FO4B 3OD3A 3FSVA 5DK3A 4UNTA 1XQ4A 3BAXA 2OQJA 3T1FA 4WKXA 3MIBA 2VDNH 3P77B 1LO0H 2BZ7A 2IAAC 4MLOA 1X5YA 4GXUN 5SX5H 1ZMYA 1FGVH 3MV01 2WNUB 2OPKA 1OPGH 1T5XB 2UY7B 2HRLA 3FFCD 1CPNA 2VOXA 1EAPB 5GRUL 1HYSD 3HC3L 1JGLL 2XL9A 4MXQD 4JFOB 4QXTB 4Q27A 3RE0A 4B3NA 2YBGA 3AC0A 4EIBA 5HDLA 1MIEH 5GZFA 1HESA 5KJRH 3BALA 1E9PB 4FTVB 3DSNB 2ARJQ 2GK0B 4N68A 4HKBB 1FI8C 1BX2A 3NN8A 4MJIE 4OQ1A 4QRBA 2ZOEB 3AUWB 1QI4A 3N5AA 1OD9A 2WZPP 1M7XA 3GINA 4Z1VA 1UTDA 1O5LA 2XIIA 2D6LX 1Q9WB 3MGUA 5ACA2 3BAWA 3PDOA 4OF3A 2XQXA 1JGDA 3RZGA 4ECNA 2HVBA 5C1MB 5JXAL 5ITBL 2FDGA 2UXGA 4WZCA 3FW6A 5DEZA 5LCVH 3ARXA 4MNGE 3S34L 4IL7A 3VSUA 1PD6A 1WRFA 2JJTA 4JM2C 4MA1C 1IAIH 4BQWA 4F1ZA 1AXYA 1PGL2 2LLNA 1XDTT 4ZO9A 3QXUA 3HOBA 1REIA 2ZZQA 3STLA 2OMUB 2OMWB 4YDNA 4Y4KD 3HR9A 2GIMA 2IBGA 2WLJA 4HHWA 4XBQA 3EH3B 9PCYA 4ERSL 1YNKH 5FW8A 1BMV2 1A3ZA 2WXQA 3ECQA 1DQQA 1CFQB 2VRKA 1IC4L 3LN9A 2EE2A 2VQ4A 4F37F 5BUGA 1VAHA 2QFRA 4QRSA 1I8LA 4IKJA 3IGUA 5E00B 4COZA 2AJYH 4AHWA 5IHUH 4PJEA 4FKEA 3L95B 1AR61 4JM2A 1M2OA 2D03H 3NEEA 4NFBA 3GXUA 1P1ZA 2UWAA 1AR81 3II2A 1WMDA 3RZCC 1ZY9A 4G1EA 5DJ8B 3FUJA 1AQHA 3O0WA 1ETB1 4O4YL 5JSPA 2NW2B 1YNLH 1QXJA 1MFEL 2FT6A 3C2AH 3ZT6A 3THDA 2QQKA 3CHOA 4H25A 4X7TB 4XMWA 2J1ZA 4MA8L 5EN2A 3DPRC 1WAPA 1YEJL 4PCYA 4O7XA 1V3LA 3VI3E 1EZLA 3IKKA 4B9JA 5E6YA 1T2XA 2FIKA 3QNZB 4JQIA 2AP2A 2JLPA 4J3BA 4NRYB 3T0EA 1FL3A 3DBXA 5F9JB 2BOLA 4NFCA 5CP3H 2X0WA 4W9HC 2DB8A 2QQLL 2WSPA 4PD4K 4CP9B 1PKQA 3RFRA 2XKNB 1CGYA 2ET7A 2F7IA 1AR73 1GNYA 1ZBE1 1M6OA 4Q0XH 2IALA 4HT1H 4GW4A 1JWUB 2PNDA 3EJSA 4U1GC 4P2OC 5GGRA 3ZL4H 3AZVA 4MX3A 3H9SA 3DPRA 2O6PA 1OB1A 3UACA 3IVKB 1HKLL 1VGKB 4KUCD 5L7XH 1V9U2 2ZNXA 2VDKH 4ZXBA 3OGRA 2J8UE 3GD1C 2JG8A 5A33B 3IJYB 1X8EA 4B9ZA 4R4ZA 4NQED 3BYWA 4MX7A 4AOFA 4Z7NB 2IG2H 4MMXA 4K8RL 4P5TC 2QTWB 3KYOA 4XI5C 2VN4A 3HAGA 2DIAA 4PG9A 2ILMA 1KN4L 2H6PB 2IPUG 3BO8A 2BCMA 4WGWB 3A6BH 1RUH1 4AVVA 3FU7B 4YNYA 1YIPA 1MZFA 1EJ8A 2ARJB 5K59E 3VWJC 3KXFB 1UACH 4KKBD 4JHWH 5EF0A 5B3JE 3WTXA 1BYNA 3DPBB 2YBSA 1TSRA 1G84A 1R1A2 1BM3H 1P7QA 2VISA 2YEQA 2O5YH 4P8QA 2DBLH 4OV5A 4PF5A 1LO4L 2F7OA 3DVFA 4XVSH 4LCCC 3WV0A 4PLNC 4JREC 1NY71 3AGVA 2WVVA 3S88L 2DQHH 2HFEA 4R9DA 4WO4D 5H94A 4XE5B 4MD0B 5BOJA 3HCVB 1I8MA 1WWYA 1RUPH 3T2NL 2IF7A 3C60B 1IAKA 3SY0B 3GZUC 1BZ9B 2CUIA 5TE7L 1HVXA 1AX1A 4FOQA 4OCWH 1LO3L 2ZMKA 1QJU1 2NYYD 5TPWL 5I1AB 3ZFFC 3VFVA 3UTSB 1OD3A 1XGPB 2JKRM 2DUQA 1QMUA 1WZLA 1SN5A 4OHZA 3WL9B 1ADWA 4DEUA 2Q6WA 5I1JL 5I0WA 4PLNA 3HMWH 4QRRB 4AYGA 1GIGL 1NFDF 4QKTA 5I1GH 1CG9A 1ENRA 2YFZA 1SHSA 3U83A 4PDWC 3VZKA 2PPFA 1QUNB 1MVQA 3MOAH 3T30A 2WWKT 1REDA 2PTMA 4ZU4A 1AG0A 1BHGA 4OCXH 1GQPA 1UVQB 4NT6A 3AMMA 5D7LA 1L5GB 1JL8A 3TPUB 4JE4B 4ANVA 5KTEH 1NX9A 5FJKA 1JTOA 1S7QA 3OGCB 3ZFFA 1J7VR 2AJZA 5I1HH 3B3QE 2CJTA 4G7RB 5JDSB 1ND2A 3VKNA 1AI1L 4XN2A 3OPWA 3HN5A 3X2QB 4HSAC 3EJZD 4C59B 3BQUB 3UGGA 1MLBA 5C0IA 5EU7C 1HCFX 1QPKA 3VXSE 1HHJB 2H6OA 5C07A 3MRIB 1YNTA 5ABZA 3OKYA 3P4OB 4DK5A 1AJKA 3SPGA 3KGLA 1ODNA 3V9EA 1D2QA 4XIKA 3L3JA 4Y24A 1UM4L 1WSST 3S37L 2GJ6B 4D0CB 2EE0A 3JWOL 3ZBMA 3ZSKA 1M9SA 3D87B 2VCMA 3NNFA 4U31A 5C08B 4AIOA 2KA3A 3N36A 2BPA2 5FUOH 3GM8A 4O58H 1T0NA 2JD4A 2L7EA 2ZYRA 3IRZA 5E6SB 2OJZH 2ZOKA 4AGGA 3GJFA 4TL4A 3RYKA 1Q90A 1S7UA 4WDIA 1RERA 1AMXA 1DZ0A 2NX5D 1DHKA 4RMTA 3PUCA 2VW1A 2CBOA 3P2DA 3QNYA 4LAQL 3SDAB 5C2UB 2QKSA 4BWWA 4EN0A 3JVGC 3OPUA 1K5NB 1C5BH 3EUUA 1TQCC 3GMQB 5HY9A 5I6OA 5A3NA 4JM2F 3CHSA 4PG2A 4P0DA 8CGTA 5FK9B 3ARZA 2WC7A 5DLML 3O6LH 2HWD1 4U4BA 5EZPA 1ZJBA 3FH7A 3KPMA 4ZFGH 5IT2L 1GGBL 4NVPA 4L3CB 2JKXA 3POYA 1SPPA 4XB8A 4QD2A 4KNSA 5HGHA 4NWVA 4NPYB 4ANUA 3P30L 4FFTA 3VFRA 1OAKL 4OIBA 2GSYA 5CFHA 3E38A 3C2SA 3ZXAC 3JVGA 3GSUA 2BNQB 3LN4A 3BTYA 1SDDB 4MDJA 5IF0A 3IYLW 2V72A 3X12B 4ZZFA 5FK7A 1BD2E 3OLIA 4G9FE 5FHBL 5J4MA 1CYGA 3PL6D 4OLUH 1IAII 1HE8A 2DMBA 4NBZB 2K7QA 4IETA 2ZICA 5FOBA 4MBRA 3R7RA 7FABH 2E33A 3RJOA 1AYM1 4WUUA 2QV4A 4Y4FD 2IQAA 5KUKA 2X4OB 4OY9A 4XMVA 4MAYB 3ASIA 5B7MA 3H3PH 2OL3L 1SYSB 2YO3A 1TYJA 3BEVB 4TN9A 3B01A 3LY6A 1E6OH 4YLQT 4YVNA 2O5XH 2VSKB 3DETC 5IFJB 2DUPA 1QX1A 3EYQD 1AGBB 3E2HB 4YXKL 5I75C 1D7FA 3KMDA 3Q3GA 5FUCE 3VQ2C 1BVZA 3VMNA 2CHDA 5I76B 1NMAL 2D2CC 1PJ9A 2K0RA 2BUKA 2R062 1LO2H 2YFUA 5BPXA 1ZRCA 3HI5H 2P7TB 3TWYA 4D3CH 1OLLA 3APNA 1X4ZA 1WO2A 3ARYA 4DGUA 2R2HB 4OGYH 4EUPA 1JOPA 1NCDH 3BN9D 4ALAL 3LPOA 5ANMA 5AW1B 5BNNB 4XC9A 4GG6B 1XE7A 3RWFB 1VMFA 4WFED 4L8BA 2FBRA 2BZCA 4ABWA 4W4OC 1NGQL 1L7TH 1TZAA 2BP3A 4GBXA 5IJDC 3ULUL 3DRTA 4BDVA 1TMCB 4GJYA 3BP7B 5I30H 1HHGA 3TWCL 1KCUH 3KPNA 5GGTA 4OQ8A 4OQTH 3RI5K 2JE9A 1R5VA 5K33A 4H1LH 4M01A 1ND3B 2ICCA 2V5RA 2WO3B 3J4UH 2J5WA 3CFDB 4Z7OB 2WYTA 1NFIB 2I07A 1QTSA 4PV8A 4PRHB 1IB5A 1MDAA 1TVBA 2NR6A 5CKGA 4OIFA 4MJ5B 4XAEA 2DQ6A 1FGVL 4U33A 4HLJA 1OPGL 1S3KH 2ZKMX 3FB7B 3BZEB 5E2UL 3UDWC 1KTRL 4N8VA 3U1PA 4UT6A 5BRQA 1WZ1H 3G5XB 2I32A 1H9DA 4AQ1B 1WFIA 2XJUA 1H3VA 5L9RA 4MZRA 2EYTB 2KKQA 3FC8A 4FL4C 3S3SA 3OKEA 4E2OA 1LE5A 4U1NB 4F3FA 4K9SA 2HT4C 1BYHA 5FYVA 3PREA 4FNPA 4WJ5A 3SH4A 3PWNA 5BS0A 3AM8C 4M1GH 3X13B 2X4NA 3M45A 1H0DB 3QS3A 7PAZA 3RP1A 3O6FA 3K5SA 4IHBA 2AZUA 4U1IB 4M29A 4UU9B 3U2IA 1T1YB 5IQ9A 2CO6A 4C56B 4IKIA 1KLFA 3FCBA 2O1QA 3DTXB 3NFPB 5ES4B 3IDGA 2Q5BA 1LHOA 1FYTA 1TJIH 2EIZB 3KH3A 3P3UA 1EWHA 4CCKA 5IOPB 3QJHA 1YEFH 3DK0A 1IGCL 3F7VA 4E4HA 3EFDH 1HH9A 1EGJH 5KSAB 2CGRH 3IN0A 3H8UA 5LCVL 3H55A 4MD4A 4NO0B 2BSDA 1W0OA 3AM8A 2GC3A 5FY9A 1BKZA 4P4RB 1IAIL 3VXMD 2A9MH 1FL6A 1GS8A 4Z3EA 2IZWA 4HOOA 1CX1A 3BWZA 3NCMA 3SJVE 3MV11 4HXBH 2DCZA 4CGUB 2GBTA 4TRPH 3IJHB 1Q9KB 5L2KB 4BQ2A 2A77H 4KJYB 5GGTH 3JWNE 1ZKAA 1BMGA 4YSTA 1G9BA 1LP9F 1U8OA 5GZOA 2AJVH 2BPBA 4OUUA 4GMSH 5IB4A 2F6BA 5J12B 4NQDD 1KYOK 3B56A 2E27H 2Z31C 5IHUL 5CLTA 5CIPB 3H7BB 3BLPX 3RY4A 2XXZA 1FLRH 1W9SA 2BDNH 3DDFA 1ZBA3 4LBQA 1D9KD 3WGVB 3UT0A 4Z2WA 5JW4R 1V05A 4IBZA 3FBYA 4XZUG 2HVJB 1G7JA 3EFOA 3I2DA 3MW2A 3NKGA 5AYQA 2ZEZA 2PP7A 1YNLL 1DBKH 4W6WA 4CL7A 4LBAA 4NO3B 5F7AA 4P2QD 4RH4A 3DX4A 4QX2A 1H15A 4N90E 4ZG1A 1JBCA 1CXHA 2E4TA 2H32H 4Z6AT 1LEGB 2FEDC 5DLLA 3KYNA 1YQVH 1LLAA 5CSGA 4BIFA 2RB8A 4LP4A 3WO4C 4NKDA 2HFFA 4R7NB 2OMTA 5JIMA 1FZOB 4ZUVA 4MNHB 1JNNH 2Z31A 4PD4J 2G4IA 4LQ1A 1ZXQA 1RUG1 4AEDB 1AZBA 5A6ZA 3ESVF 1JFHA 3C75A 2VDRH 3GRWH 3NP4A 5CEHA 3HFMH 1J0YA 4Q0XL 4HT1L 2LR4A 4KUZH 4PJBF 5IW3A 5E1IA 3TTYA 1JTZX 5GZGA 1CICC 2LTQC 3EJJX 4LK4A 2WXFA 2JV6A 4U6VL 2OW4A 4CXYA 2WYHA 3CFKB 1VBE3 4HJ0D 4OGAC 3T8MA 4CSZA 3ACLA 3U14A 3ZYBA 4AI8A 5IK8A 2VDKL 5GLWA 4YZ2A 3AK0A 1ZT7B 2C9PA 1NIFA 1T89C 3KPSD 5IROC 5TH2B 3SE9H 3WE6A 4CW1B 3FYEB 1W2OA 1WT5C 4L8SB 2BINA 2IG2L 3IDEA 4E9LA 2QMJA 1JRHH 4JVPA 5FYJU 2YN3A 3RWDA 5FRAA 2P9RA 3A6BL 5DD6A 5DZEA 2IBBA 1QWUA 3IFPA 4R96A 4F7TB 4YZ3A 3O4OC 4NPJA 4KK5C 1UACL 3QEHB 4Y20A 3V9CA 3MGAA 1BM3L 2PO6A 3D39A 2R4SH 1KIPA 2DBLL 4FPGA 3RVXC 3T1LA 4XVSL 1F3DJ 2X4UA 4WFHE 5AKVA 1Q0YL 2O72A 1WT5A 4EDXA 1OKEA 3AFKA 3ZE1E 4BFBD 4G72B 4LAJH 1AYOA 3R8QA 1ONAA 1JPFA 4U49A 3OV6A 3UP1A 4NUBA 4UAHA 4ZODA 3R06A 2V7NA 1XGRA 3EYSH 3L9RA 3UTPD 4YFEA 5AD0B 2QQKL 4OCWL 5G2NA 2SLIA 3REVA 2YRPA 2WXLA 3WTSA 2P5PA 4O5LH 4AMKH 4E5XG 5DSCB 5J13C 2YKLH 5J6SA 1U8NA 4ZRGA 5JORA 3PWUA 4PT6A 1LHZA 4R4FH 4JGNA 1S5HA 2KZWA 3G5YA 4PJFF 5SV3A 1L7QA 3AYEA 4JGYC 3L08A 1W6OB 1SY6A 3TT1H 1NPUA 4QPWA 4RL7A 4M62H 5I1GL 5BXFA 5C0EB 2VQUA 4JM2D 1T2QH 3MOAL 4PLKC 2X4TB 1AZVA 3VGEA 3WJMB 3DIFA 3JBG7 1SRDA 2WO1A 3A4EA 3OAWA 4PIBA 1BJ1H 4OB5H 3NK4A 1W6MB 4JG0H 5KTEL 4N9IA 3GWJA 3HZVB 4XJZA 1A4BA 3KYMA 4OFYA 4HJEA 3QJXA 2XV6B 2BK8A 4A55A 5CYYA 2HTKC 3K4ZA 5TK2A 3VDBA 1S9VB 2W9LA 4KO7A 4JY6A 2JELL 2YPVH 4K7PL 1QSEA 3QWRD 3S35H 5IHWA 1S7WA 2NNRA 5FJHA 2Z1KA 3BVTA 2VAAB 4NQTA 5E24E 3BIEA 3KYKL 3UCRA 5HXVA 2WYIA 2Q7NA 1BV8A 4KHTH 4RSYA 5LGYA 3WEOA 3RZCD 3I49A 2YWZA 3MROB 4XYXA 2JCCB 4OFKA 1W03A 4FXTA 4TPRL 1I7RB 1CD1A 1MDTA 1G7LB 3LEXB 3MRDA 3QUMH 3PUHA 4CDXA 1V27A 3C87A 3MSPA 4O58L 3H9SD 4J6RH 4LOVA 2OX0A 5C09E 2DN7A 2OJZL 2HAZA 4DP0X 5JW3H 3D4ZA 3G08B 4HJGB 1UD3A 3SKNA 4Q1PA 4JFUA 2DWXA 5EOCL 3VBFB 2ZOOA 1QNWA 4N2HA 2FECI 3MNZA 3QARA 2C34A 3V56A 2XI9A 5KOMC 3QUYA 1RIUH 3STBA 4GQRA 1U4FA 5ELIA 4GZ9A 4UILH 4JCMA 1B4JH 3G7TA 3O6LL 1U3HC 4P2OD 1RK0B 3SBPA 3O1VA 2P4AB 2PYEA 4AEMA 2NDGA 3BVDB 4ZFGL 1YPZA 5T3XE 4Q4V2 5JZGA 5DJXB 1CX4A 3HKZA 2WW8A 4PJDF 4Z23A 4LO6B 1AHWC 3HAEA 3GZAA 4XO5A 1AL22 3P02A 1EIBA 3HNTH 2QTVA 4OM0H 2EDHA 1ZVSA 4P5TD 3HE7B 4XI5D 4W9DC 1ZZ7A 1WA0X 5IQNA 5D2LA 1FNEB 1MAKA 4B3EA 2D44A 1U3HA 4PBVC 5EO9B 3C9NB 3E5XA 4OLUL 4J3WA 3VWJD 4CUBA 3P4NB 3W9EB 4KDTC 4LCUA 5A3UA 2VM3A 3W3BA 4JPSA 7FABL 3BU7A 3PVEA 5I15L 4JPWL 5T52A 5C9AB 2DI8A 2MQCA 2RDQA 3X17A 4XUTA 1OGPA 5IQ7H 3W0WD 3H3PL 1E6OL 1S0CA 2W2IA 5JA9A 4XNXH 1KACB 1XNTA 2BNOA 2GEQA 4X4KA 2B9UA 4ZAKC 4AXWA 1LE9B 2VB5A 2QBWA 4NE9A 1HILA 2AK4A 4KDTA 4I18B 3V6FB 3A5VA 5HYJA 4NM4H 3HI5L 2XXFA 3CZFB 4D3CL 4PJGB 5EOTA 3KVDD 1MEC2 5C6PB 2XLLA 4JZNB 4OGYL 1NCDL 4GS7B 3UAAA 4W50A 3RFZA 4LF3A 3VE0A 5FS5A 5C07D 4AQZA 4FXKA 2VBPA 2CH8A 2WPGA 2BCKB 3PJLA 2DQDH 4TNWF 2DWDA 3EHBB 4UNIA 1L7TL 5T1KA 3MIEA 2B4KA 5CNAA 4CBZA 3TASA 4GAYB 1CURA 3SE4A 2P44B 4J8RA 4BH7A 4DN3H 1QFOA 5KBPA 4ZAKA 4YLBA 5DJAB 4OQTL 1DVXA 1TEGA 4H40A 4FOWA 3QQDB 4JFQA 3DUHA 2EAEA 2J1UA 3GI9H 4AEEA 2R0KL 4AVBA 3HAEH 3LIUA 2E31A 1H5BC 4LHSA 2KXLA 2Z79A 1QNZH 4JO2H 4XTPA 4OGQC 4RZCA 2X8KA 1ZTXE 3O1RA 3PY9A 2GJJA 2MQ0A 3D2UA 1S3KL 3HN3A 4L4TA 1CN1A 4RVBA 2YGOA 1JHLH 2WQVA 1YEEH 4PY7B 5DYFA 3ZRSA 5JW4Q 1UOGA 2QLYA 4QO1A 2SBAA 1S7VA 2FECL 3M07A 5B4XA 4GFTB 4R7DA 1KLGB 1JODA 1O6SB 2DQFA 1NBZA 4KO5A 4RGMB 1IZJA 5F3EA 3SQBA 2FJHB 4AYBA 2ISDA 1LEMA 3GS4A 1PM7A 2JDNA 3O9WC 3AAZB 4QX0A 4UINH 1QRNB 1SCSA 1AXTH 4GQ7A 2W59A 1NEUA 4KKPA 1CPUA 3KLAB 1A8ZA 2BHUA 2BEOA 2VDPB 3PWJA 3OWRA 3TA4D 4H3WA 2D73A 2ARAA 1YEFL 3I2KA 2C3GA 4OI8A 1RFDH 3EFDL 4M4RA 5EV7A 4PVBA 5L6YH 5FMDA 4MXVA 5FPIA 3UC2A 2FQGA 1EGJL 4MAUH 2CGRL 5B39B 2DBNA 4GWJA 4H8WL 5J6GA 4ADGA 4KY1H 2ROYA 4WUUD 4ZI8A 2A9ML 4FHKA 3NZUA 4YVSB 3MGOB 5DI8B 4KV5F 3OR7A 4HXBL 2H26A 5F5QA 4OD1H 1PM4A 5IK3A 2HG5A 2PCPB 4UQIM 4K3DH 5JHAA 1G0YR 1XF1A 4CA9A 4LIQL 5EH1A 1X7QA 5GGTL 3LZQA 1V0AA 4FN0A 3E6FB 4ZTPH 4A7ZA 2AJVL 5GJTH 2KQMA 1KYOJ 1YXWA 2LHAA 3CN0A 3ZT7A 1E8YA 4PJAE 3JB8A 4FO9A 4TUOA 2J2ZA 1FLRL 2BDNL 3UGHA 5AENA 4YHPA 3NZ8A 2J8OA 2B1OA 3MNWB 4P4KB 2NPLX 1SQ2N 5CJQH 1BMV1 1DBKL 4Z3GA 5E6RB 2MEV1 4PUBH 2R1DA 3WP3A 3DETD 4UT6L 3SKJH 1TYRA 3UAJA 3H85A 2CO1A 4N8CL 4PJHF 4XVJH 3ZR6A 4UB0H 2C4XA 4F15B 1YQVL 4Z7VF 2VN6A 1H8LA 2X4RA 1FORH 4N2GA 4DERA 5HGDB 1HXKA 1NA1B 3BWAB 3PQYE 1AO7A 4NDMA 4JTOA 1GJIA 5KSBF 3OGJA 3OWEA 1GYCA 2ZUWA 3J8F7 4E9RA 3WXPA 4Q8KA 3WE1A 4XHXA 2WJ7A 3GRWL 4IDJL 4IV1B 1FL5B 3DSFH 2RDSA 3LZZA 2F53B 1TLMA 4XPAL 4WI7A 1RD6A 2PWFA 2G9ZA 1NBQA 3CFMA 3JTTB 2BW8A 4XBLA 2BERA 2PWGA 1NAMA 3AREC 1HCYA 3GBWA 1AR1B 4LHNA 2BVQB 1OHZA 3DX6A 4BEIA 2H0PA 4TS6A 5KWYC 3H42B 2XQYA 5KHGA 4XJUA 1JRHL 4WKZA 1SZNA 1DUYA 3N0PB 5EDSA 4L0PB 5HDQH 3TIDB 4KQ3H 1DQKA 4XC1H 5JPMB 4FTSA 2Z4FA 2J71A 3OKDA 4L1BA 1ZEAH 1DVFB 1W0VA 3AREA 3GZKA 4EQ2A 4FPJA 1A9BA 4A66A 2QZ5A 1WWAX 2NY6B 1IKQA 2R4SL 3E6HB 5IUCA 5C97A 4BMEA 4DKFH 3VBHC 2CRYA 5FZEA 1UD6A 2HT4D 4GPVA 4PRID 1HXS2 5A3MA 3K6SA 1MHEA 1YFUA 1MFDL 3G6JA 4PJ8B 5FY4A 1B9ZA 3OAZH 5A16B 1J8HE 3CFJA 5IW6A 1RIVH 4DY5A 3TO2A 3V0JA 2I5YH 4U6XA 5ISZB 5JOFA 2X3BA 1W9XA 2WZR1 3EYSL 2BOBA 2ODIA 4WTZG 3W59A 4ZONA 1M53A 3N85H 2JIJA 3ETQA 4O5LL 4H1LG 4LPYA 4WHTA 3VA2C 3WYRA 2YKLL 2YU2A 1A7OH 3BKZA 3FB8A 5B21A 4K8FA 1D4M1 4ODWB 5E6UB 5B7FA 4CEWA 1VRH1 5BNPB 3IDXH 2DI9A 5HHVH 4GLRH 4AK2A 4XCYA 4M62L 2DU1A 4X6EA 1JMZA 2AAAA 4G8EA 1ES0A 5MI0C 4BZ2A 1T2QL 5FM4A 4UIKH 1KYAA 5BUVA 2IDFA 1AR63 4NOTA 4R26H 1QKQA 3WF3A 4K55A 1AD0B 3N35A 3WFDH 1AR83 4OB5L 1GMIA 4EQ3A 1AD9A 1EY2A 4JG0L 1UYPA 1KBGH 1FFTB 4DK6A 2XXCB 3FO2A 1NAMH 1ULCA 2A5ZA 3QQ4B 2BJSA 3FDWA 2ICEB 2A9NH 4DJMA 3S8WA 2D8KA 3FFOA 5F2FA 3DDGA 4IIZA 3KCWA 3BAYA 4F5CA 2YPVL 5IMLB 1J84A 1PX4A 2X4QB 3FCSA 3MLVH 3S35L 4D3WA 2Z31D 5JOPD 4XFIA 4JKPL 1DO6A 2R29A 3ESPA 3QJOA 4JFFE 1KG0A 2YRLA 1IM9A 3RLSA 1R3IH 1WGPA 2WJSA 4N25A 1W9TA 3BPOC 3QHFH 4YSRA 2N0KA 3ZKUA 5EBMA 2PMWB 2HVKA 1ZBE3 4PJCB 3GSRB 3FLRA 4X2UA 1LWRA 4J6RL 3NIDB 1ZWIB 2FEDD 3P0VH 1QSVA 5AOMA 3S96B 4Y7OC 4DO5A 5JW3L 3ABMB 4IEPA 3M1BA 3HE6B 4XP4H 4LLYA 3SDXE 3AWEA 4P5KA 5AEAA 5IEHB 5BV7C 4BE3A 2HN7B 5AUMA 1HQ4B 3ZIYA 2DY2A 4Y26A 3GIVA 1OM3H 3WW1A 3OTTA 4MCZB 1RIUL 5F72S 5FZLA 4UILL 2RJLA 1B4JL 1VEOA 2IPKB 1CICD 3DX8A 1RUH3 3PUSA 4RBPH 1CDUA 3ARDA 2GT9B 4OGAD 1J1TA 3BIKA 4DZBB 5TDOA 1ECZA 1MZZA 4EPSA 4G83A 5DD5H 5DMJB 1SY6L 3RWGB 3S5LB 4ZFOA 3WUZA 5C6TL 5IROD 1A9VA 3S6CA 1UU4A 3LCPA 4LPVA 2WZEA 2Q8CA 3HNTL 4QT5A 4BZ2H 4OM0L 3D52A 1GSMA 3TIEB 5GKAC 1A9EB 4NHMA 1JYWA 4UTAA 2QQQA 4YW4A 5SWZA 2Q8AH 4MOAA 5SV8A 2D4DA 5L36A 1J9TA 1F4HA 2J44A 1KEXA 4LT5A 3UBXG 1IIIA 2AI0H 3J9SA 1QJU3 3ARFB 3GIZH 4N0FB 2FL5B 4P9YA 3D25A 2PR4H 3TONA 3RVXD 3I59B 4ZPTB 5GSRA 5FREA 2ZWYA 1W39A 3S57A 1UWYA 2R29H 3O8XC 3QFJB 2RS33 5IQ7L 4O61A 4Q2ZA 2M83A 2X5IC 5A32A 1I85C 2E8YA 2ZUUA 4H0HB 5LUMA 3ZFEA 4I4WB 2YUEA 5CJBA 4HHAA 2YPLE 3NYKA 2H0EA 2WBWB 3PNWB 4DNLA 1IQAA 1F3RB 3VXOA 4XW3A 2FCBA 5CJOH 3QH3A 5F1OB 3IDJB 5D70L 4JAAA 4QXKA 1SVCP 3C6LC 5F7MC 1BVP1 3HI6H 3MDJA 3SDDC 1Q8SA 5F0PB 2BWAA 4XZPA 1XZWA 2LFGA 2EUWA 3JT0A