2ZAHA

X-ray structure of melon necrotic spot virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
296
structure length
296
Chain Sequence
SVKIVHREFIASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGSTSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAVDRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGSTIKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVTSSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Melon necrotic spot virus
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein
total genus 67
structure length 296
sequence length 296
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zahA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zahA01
1VBD2 1POV1 4WM8A 1RUG3 5FOJB 2HWC1 4Q4Y2 5BNPC 1M06G 1Z7S2 1AR93 1PO21 3CJIB 1H8TA 1HQNA 5C8CC 1FMD1 3VBHB 3FBMA 2HWF2 3VBOC 3J8F1 5BNOC 4YVSB 3JB8A 1RUG1 1VBE2 2ZAHA 3ZFFB 3M8LA 1AR92 4CDUB 4GMP0 4Q4V2 1VBC2 1VBE1 1QJY1 4RR3A 1MEC2 3VBHC 3VBUC 4CDXB 4IV1C 1PIV2 5ABJB 1OOPA 3VBSC 1QJX2 2GH8A 4WM8B 1C8NA 1HRI2 1K5MB 1W39A 3ZFGB 2RM22 1H8TC 1RUH3 1ND2C 1PVC3 4NWVA 1DDLA 1NOVA 5K0UB 4LLFA 1RUI3 4CDUA 2HWE3 1BBT1 1F2NA 4QPIA 2WLPA 2QQPA 5A32A 1C8M2 4CEYB 4CDUC 4N53A 3LOBA 2HWD3 3J8F2 3VBOB 1R082 1VBB1 1AR91 5C8CB 4FTBA 1RMU3 1MQTC 1QJU1 1COV1 1ZBE2 3TN92 1CJDA 2MEV1 3ZFGA 1RUE1 1HX6A 1VBE3 1R092 4GMP1 3VBSB 1AR71 4JGYC 1RUD1 1RVF3 4RHV2 1BBT3 1AR61 1NCQA 1X33A 3JBG2 5K0UA 1MEC3 4IV1B 4CDXC 2RR11 1R093 1VBD3 4RHV1 1VBB3 2WS92 1PGL2 3ZFEB 4QPIB 2XBO2 1NA1B 5ACA1 2RM21 5C9AB 4CEYA 1NCRB 2R042 3VBFC 2RS11 2R062 4GB33 1RUG2 2R071 5ACA2 1EV12 3VBRA 5C4WB 5CFDB 5BNNB 5BNNC 5C8CA 1AUYA 1EAH1 1BBT2 1MEC1 1VB2A 5A33A 1RUF1 4FTSA 2X5IB 1VBC3 1NCRC 3CJIA 4CDQC 4FTEA 1OHFA 2HWB3 1ND3A 1R1A1 4WM7A 1V9U3 2ZTNA 4YVSA 4PDWB 5LK7B 1TME3 1C8M1 5K0UC 5ACA3 4RQPB 1RUJ1 3NAPA 1NA1A 1PGW1 1RUC3 1IHMA 4RR3B 2PLV3 5C9AA 1AR63 1D4M1 2DF7A 1NY71 2RS52 4FSJA 2HWC3 1RUD2 4YVWA 1EAH3 1B35B 4RS5A 1TMF1 3VBRB 2HWB2 1AL0G 5JZGB 5BNNA 1NY72 2RS51 1RUH2 4Z92B 1OPOA 1VBA1 1RUI2 1COV3 2RS31 1FPN1 3DPRC 1K5MA 5ABJC 1QJY2 1RHI1 2Y26A 3JD73 1ND3B 2RMU3 1BEV1 2RR12 1R081 1VBB2 2WS93 5DDJ2 2HWD1 4GH4C 5AC91 1RUJ3 4GB31 1COV2 1POV0 2RS33 1ZBE1 2FZ2A 2MEV2 1QJZA 4PDWA 1EAH2 4RQPA 1PO11 4JGZC 2HWD2 3NAPC 3JD71 3NAPB 5L7OA 1RMU2 1ND2B 1EV11 4CDWC 1FPN3 1FOD1 5BNOA 4N53B 5GKAC 3ZFGC 2GSYA 4YVWB 1RMU1 1AR73 4Q4X2 4GMP3 4CDQB 4RS5C 5JZGA 1ASJ2 5CFCA 3DPRB 1TME1 1AYN3 1RUJ2 2BBVA 1D4M3 4Q4X1 4Q4Y3 4Q4W1 1AYN1 5D8AC 3TN91 5JZGC 3VBRC 2IZWA 1TME2 1PO22 1AR83 1OOPC 1C8M3 3VBSA 4CEWA 1AYN2 1TMF2 3VBFA 4RR3C 1NCQB 1VAKA 3S6PA 1BMV1 1AR62 1EV13 4IV1A 3ZFFC 2BPA2 2RS53 2WFF3 5J96B 1RUD3 1RVF1 3ZFEA 1ND2A 2WFF1 1TMF3 1HRV1 1RHI2 3HAGA 4N43C 5D8AA 2RS12 2PLV1 5AC92 5BNPB 2WFF2 2RMU1 1QQP2 1VRH3 1AR82 1PO23 2X5IC 5C4WA 5CFDA 4AEDA 1VRH1 2HWF3 4N53C 2VQ0A 1VBA3 5A33B 4CDWA 2X5IA 4IV3A 5C4WC 5CFDC 4Q4V1 4JGZB 1E57A 1VBD1 2HWB1 2R072 3VBUA 4WM7B 1NCQC 2WZR3 3VBFB 1VBA2 2HWC2 1RUI1 1FPN2 2WZR1 2BUKA 1HXS3 4Q4V3 4GH4A 2WZR2 1V9U1 3TN93 1QJU3 4BCUA 1D4M2 1HXS2 1R1A2 4N43A 5BNPA 1B35A 4RS5B 2ZZQA 1BEV3 1VBC1 4AEDC 2HWE1 4AEDB 4RHV3 1PVC2 2XPJA 2RR13 1MQTB 3JBG3 1QJU2 4CDWB 2R061 2RS32 4IV3B 2HWE2 1AYM1 4RQPC 2PLV2 1ZBA2 3VBUB 1RVF2 1AL23 2FZ1A 2R063 4GB32 4JGYA 4Q4W2 1HRV2 3JBG1 1RUH1 3J8F3 2HWF1 5L7OB 5AC93 1PO12 4WM7C 1R083 2TBVA 2WS91 5CFCC 1PGL1 4YVSC 3IDEA 4Q4Y1 5BNOB 1Z7S1 2R043 4QPGA 1AL21 5FMOS 1POV3 1H8TB 3CJIC 4CDQA 5DDJ3 1B35C 4EJRA 5CFCB 1ZBA3 3DPRA 2MEV3 5L7OC 1QJX3 5C9AC 3ZXAC 4YVWC 3ZFFA 1QJX1 1GFF2 2XBO1 3ZFEC 2BFUS 1PO13 1AR81 4CEWB 2RS13 4IV3C 4JGYB 1QQP3 5ABJA 1BMV2 1R1A3 1ASJ3 2XBO3 1BEV2 1OOPB 1VB4A 1AYM2 1PIV3 1WCDJ 1RB8G 4QPGB 1RUF3 1PVC1 5D8AB 1ZBA1 3JB4C 1QJY3 3JD72 2RMU2 1AYM3 1RUE3 5FMOL 4CEYC 1Z7S3 2R073 1V9U2 2R041 4NWWA 1PIV1 1SMVA 1FMD2 4QPIC 5J98B 4JGZA 1PGW2 3VDDC 5A32B 1RUE2 1QQP1 1R091 2BFUL 1HRI1 1RUF2 1VRH2 3VDDA 1AR72 4Q4X3 3VBOA 4GH4B 4Y5Z0 1K5MC 1RUC2 1ND3C 2WWSA 4WM8C 4RFT0 1FOD2 4Y4YA 4N43B 1FMD3 1RUC1 5DDJ1 3VBHA 4QPGC 1HRI3 4Q4W3 1MQTA 1A6CA 2RM23 1AL22 1ZBE3 1X36A 1HRV3 1HXS1 1NA1C 1RHI3 1F8VA 1NCRA 4CEWC 1FOD3 4PDWC 1NG0A 4CDXA 3VDDB 1CD3G 4SBVA 1ASJ1
chains in the Genus database with same CATH superfamily
2BOLA 5J1AA 3TFBA 3M45A 4PLNA 2APFA 1GYKA 1EEQA 3TX4A 1HJGA 1SOQA 4WM8A 2O61A 3EYFB 3UYOD 2J5LB 2FJHB 2QV2A 2UZXA 3EIFA 4TNFA 2XKPA 4NROA 5TK2A 5I9QC 5C1MB 3GSXA 3QOPA 3UJOA 1F86A 4I2XB 2FIKA 4NHCH 3RFZA 3MSPA 3LNDA 3WGVB 4IIQB 2VO5A 3ZVVA 3ZE1B 1CWPA 3UO1L 1GANA 1G1OA 1SBSL 1XH3B 4AE2A 3BP6A 5DUPH 3SKOB 2CE6A 4M6ML 4MQSB 3K2OA 1NFDA 3CHRA 3LPFA 4R8HA 4KMQA 4Q4V2 4J3XA 2X87A 3N1QC 4DN3H 1VBC2 4PJIE 3WDYA 4Y4HC 4YR6A 2DI9A 3NW4A 4JANB 2BBAA 4RR3A 2BY0A 2QLYA 4NENB 5IJKA 2EADA 4HWUA 4BFFA 3T1FB 3FOLB 1F58H 2ZGQA 5DJCA 1NLRA 5L2JB 2QBWA 3DX2A 4NHUA 1N5AB 5EIVA 2ZUYA 5J11B 1TVHA 2OZ4L 4Y1AD 2QHRL 4XUTA 3SD2A 3V6FB 1YJKA 2EIKB 5FO9B 5F2WA 2OQ7A 4MQTB 3CPLB 4KI5D 2P24A 3PL6C 3ARQA 1B2WL 1UY0A 1Z5LA 5FF6B 1K5WA 3MIGA 3L8QA 2JG8C 3VFNA 2Y6LA 3O0XA 4FQ4A 4NHMA 4G5AA 5HGAA 5I0UA 3QO1B 1VIWA 3KPPB 3WF3A 3D39E 4ZZ5A 1A2YA 3QDAA 3EYVB 3WUZA 3CVIL 1VAHA 4F7TB 4UNVA 1FL5A 2J71A 5CCGE 1NA8A 5IB2A 2VDQL 3FQYA 3GXTA 4LUKA 4JPWL 2W5FA 3V0AA 1CDCA 4A37A 4CDUA 4LVHB 2VUCA 1S9VB 4KK9D 2WM0A 3CCHB 1BXXA 1JV5A 1X5GA 3AITA 2Y7QA 3EHBC 3KPQA 3QIBB 3SGEH 3TVMD 5A32A 2BP0A 3L2MA 3TZVD 2CHHA 4KITB 2V9QA 2GJJA 4PGDA 2XL9A 3HPJA 3S57A 4UOQA 3JVGC 1EBAA 4CL7A 5KBLA 2NX5A 1CR7A 3V65A 4D0QA 4FNSA 1RJLA 1GCFA 4FQXD 3MC0A 1U91A 1CE1H 1E5AA 2YN5A 3IJHB 1X8MA 2B42B 4LBAA 2ERFA 4UNIA 3PCYA 2NZ9A 3OXSA 2JJVA 2KZBA 3O8XA 5BRZA 2X3AA 2VNOA 3D69A 4G72B 3QDGB 4ODWB 4NO5B 4OF7A 4Z7OE 3DO4A 5MEOA 4JFXA 4XQWA 2P5EA 3D6GA 4UTBL 4ZO7A 3ZIXA 4A2EA 4XPGL 3VBSB 4KUZL 4JGYC 1XX9C 3MCLH 4GIAA 1RUD1 2J2ZA 4DT2A 1K45A 4N8VA 1E2WA 1NCQA 4EXPX 1CAVA 1A4AA 1XSJA 2FNBA 3E2HB 1X4YA 3GM0A 4N5UA 5CGMA 3HQXA 1DVXA 1K4DA 1CLZH 1UXSA 3KLQA 5I0RA 4BPZA 4UIMA 1SLVA 4RNRB 3DX7A 2N01B 3T77A 2YS4A 3THPA 4AXOA 3IAPA 3JYBA 4P2CG 3ZE2F 1ULDA 4RIRA 2ZKHL 1QQDB 2WNUB 1E8YA 3N85H 4K73A 3ZDXE 5I74C 1J5DA 3FTGB 3JWNH 3LIZL 3WO4C 5GZOA 3I49A 4AIOA 1A6UL 1HDMA 3CFTA 4HJ0C 2GJ6D 4KX8A 2WWKO 5KVEH 5IR1B 5BXFA 1A1MA 4L2LA 4XFIA 4E4ZA 2IVJA 1QSFE 1ZT4B 1U41A 3LH8A 2YBKA 1BD2A 3IMWA 4YDKL 1FO0L 3NACL 1R3IH 2WMPB 3MLSH 5FGRA 3RWGB 3WLWD 2PYEB 4F5CE 3EJKA 5KWRA 4R3SB 1S8DA 3BPOC 2UWEE 1MDTA 4XFCA 2CR6A 4PJ5E 2HZHA 2FWSA 1MAML 4C59B 1RULH 4CVZB 3CSTA 1BMGA 1NBVH 1JCKA 3BOVA 2OLDA 3KWVA 1J1TA 4HLJA 5FYJD 2PP8A 2UWEB 2WWOA 1WG3A 4FLHA 4M7KL 3ILQD 3STLB 1SEBA 5MENA 3FUIA 4ZQTA 3IM1A 2X4RA 3P40A 2P7TA 4X6CF 5ABZA 4KJYA 3X1NA 1JUHA 3ZL1A 1CDYA 1I7UB 4XMAA 3CFCH 3MV9D 3S5LA 4H0HB 5C7XL 1CYXA 3FFCA 1FDLL 4Z95L 3WE6A 1OAXL 3ZMOA 3ZE2E 4JTNA 5A1AA 4B9YA 1TMF1 4PCSA 4D7YA 3V4PA 4M3KB 3CVCA 2X6VA 3MV9B 2QPSA 2BVQA 2WLIA 4J5VA 5JZGB 3EYQC 4PW3A 5L88L 1CPMA 2DIAA 1SQ2N 4WQOA 2W0LA 3D34A 2VR6A 3CQQA 4WKZA 4E9SA 1HZLA 5CADA 4HUVA 1V7ML 4O02L 3QH7A 1LEKA 4AL8C 3VRLF 3IDJB 1M9SA 3OAUL 1SBDA 2R0KL 2WZ0A 1OF2B 3L3IB 3OKOA 3KGSA 5C3TA 1JGEA 1W6MA 1GW6A 3EMRA 5HV4A 3MLJA 4XNAA 3V0EA 1TQCC 4ONFL 2A9DA 3TIEB 5JA8B 3U1QA 2HWD1 3S8GB 2JKJA 1A6AA 4K94C 2V4VA 5JA9A 2RS33 5FY7A 1W9YA 1W0WA 5B4NA 3ZJAA 1ZDQA 2OMTA 1JOPA 5J12B 3BPSA 4L8SC 1QA9B 2JI2A 3BCWA 5EC1A 1H5BB 3D2UA 2I32A 3QDJE 3MV11 2NNAA 4BXVA 5FUZH 3KPMA 4NQXB 2XXMB 2EYSA 2VCMA 1JYWA 3T0EC 2B4KA 2CBOA 4HSCX 4MA8L 3II3A 3LB6C 1AHMA 4UU9B 4WU5A 4XMLL 2OSYA 3H1YA 2DY2A 2EIDA 4YVWB 4XMPL 3OF1A 1Q9OA 3ON7A 4P2RB 1LEGA 1TZIA 1XO8A 3BFQG 3TURA 5AVSB 3B3IB 4FC3E 1ASJ2 2HPOA 1GZQA 4XHQA 3EXJA 3O6FC 3SQBA 5F3IA 1PZ5A 3GKWL 2NX5E 1PCSA 2BP8A 4QRUA 4DO4A 2OJ1A 5HVHB 1IEHA 3NH7H 1NGPH 1LE9A 4KGGA 2EDYA 2ZG3A 3FSZA 4W4NA 4Y16A 1E5BA 4YWGL 1AOHA 1OTUD 4UAPA 3KW7A 1P1ZB 1MIMH 3FO1A 3KPLA 1AGBB 3R8QA 1MZ6A 3VXPB 3RYPA 5HHQB 2AVGA 3QZWA 3ZDYB 1CGWA 4AKPA 4IK6A 2CLVB 3EUDA 2HB0A 1OP3K 2V9RA 4M02A 4QJ5B 4CXYA 3QCUH 3PHSA 1SLLA 3PU3A 2W9EH 5E5RB 4JO3L 3LN5A 1F3RB 2D3LA 1Q43A 2YEVB 5FYKH 4TOYL 5KN5B 3B7RL 3BZEB 2FWUA 4N85A 5IQ7L 3ZFEA 3D18A 2VAAB 1FGNL 5I1LA 4JY5H 2J88L 2OW4A 4UQ3B 4UW6A 1F18A 3MO1A 2WWJA 4GQ9L 3V6ZB 1NAKL 5LZ6A 3L48A 3WKPA 2ZGPA 3AX4A 2DH3A 2YWYA 2YPVL 4XMZA 4GA9A 5BNPB 4XACA 1O6SB 1QQP2 4MJ6A 1A3KA 4Q4EA 2AABL 2XZCL 3WTSA 4NN7B 5FZKA 2KZWA 4UOW1 4C56B 1OF3A 5C3IA 1PNCA 4NPMA 5FFOC 4NB7A 3KVAA 1J7VR 3MRMB 3V10A 3IMVA 2AQSA 3ASWA 4WI4A 4M62H 5IFAL 2EVFA 3O0WA 3U75A 5DD6B 3USUB 3FZUC 2COQA 1CIDA 2DMHA 1TQBB 4KKLD 2QQKL 1MWAB 2B1HH 1G6RH 4X4XA 1PM7A 4W4OA 1ZZCA 4WM7B 4ALAL 4X6FA 2ZZUT 4PJ5A 2PQQA 4FFHA 4X7CC 3PJSA 2PETA 2YRLA 3HD8B 4BSVA 1A78A 3RB7A 2DQTL 1TU2A 3H7BA 1DEEB 4ZMLA 6PAZA 4LE8A 1UY3A 4CSWA 3K77A 1JSYA 3TT3L 3B1TA 4PRAA 1UIJA 3AG4B 3KLKA 4FPEA 4L29B 4AYBA 4BQ4A 1XT5A 2YEZB 4K7PY 4P2QE 5E89A 3B2VH 1XBRA 2C6SA 1UWGH 4JDEA 1YAZA 3MNZB 4Y4KA 5DJ6A 4BCUA 4DXRA 1HXS2 2XQXA 4NE9A 3LD8B 1SHWB 1ILSA 2XYCA 3PL0A 4QHUA 3M3OA 1ZXKA 5KJ7E 5CU1A 1P2CB 2VL4A 4N0RA 5LBEA 1S7UB 1JMZA 3BP5A 3VB9A 4Y24A 5CHNB 4DGVH 1I1AD 5CEZE 1ZM1A 4HJJL 2RR13 5J48A 1MI5B 1OB0A 4JCLA 3GS0A 3IN0A 4ZS6D 1X7NA 2ICEB 1PZ8A 1CVNA 2WP3T 1DJWA 4HKJA 4XP5H 3E7JA 5HYSG 3JTBA 4EBQH 4ZMOA 3EB7A 2IC2A 2DYRB 4HT1H 1OZUA 3C8HA 4NKOA 2Z2SB 2NTFA 2CO6A 2GKIA 4NZRH 2G5BA 1ZLSH 1RC6A 4OV6F 1EGJA 3ULSA 1I3GL 1DIWA 4JQXC 4V1DA 1D5BB 4ELKB 1RJCA 1UW8A 2YXVA 3OGSA 1MQ8A 5F5QA 1M56B 1CTOA 3IJEA 3MJ7B 3NCMA 5I93A 1RL1A 5AC93 4HIPA 5DGRA 5KYYA 2O5YH 4S1RH 3WEXA 2ADGB 4XMXA 1R083 1KXQA 5FBZA 3RGVA 3GHEH 4JY6A 4KUCD 3DIFA 1LO2L 1V6IA 1AO7A 4HK0B 3RZCB 2E56A 5FOJA 3VH8A 1Z7S1 3MXVL 1UXXX 4LOSA 2NSQA 5E2TH 3E80A 3Q2VA 5D7EA 4G43A 3O9WA 3CNAA 3SE9H 3V4PL 5C2BH 3AKSA 4PIZA 5A6QA 2C8NA 4NQEB 5GS0L 3N9NA 1I8IA 3X3FH 7PCYA 5HYJA 1MH5B 2YHGA 3MBEB 1RZQA 2XHNA 4NC0B 4A7QA 5B39B 5GS1A 4RESB 3WI9A 5I0DA 3U6XS 3DPRA 1EJ8A 3I9AA 4M1CC 3BRDA 4GG8B 4U1KA 1WK0A 3WJMA 4Z78A 3UJQA 2BHFA 3CLPA 4YW1A 4Q74A 4BFIB 1QY4A 2WSDA 2Q6WB 3NFNB 4LKSA 3KXFB 4GYBA 3LA3A 5IK4A 2WO3A 1UZ6E 3PLYA 2Y3AA 1S55A 1S6NA 4XWGL 1SY6L 2EDHA 2L7JA 3HUJF 2VMDA 4J3SA 4OZHF 5F9DC 2GALA 4IOFD 4YW6A 1QQP3 1NL0H 4OUEA 4YHOH 1PMJX 4XI5C 1IEAA 4H20H 1UB5A 1ASJ3 3ZE1F 1TZOA 4P57A 4LSPH 3S3BB 3B93A 1G9DA 2W59A 5CJXA 4KQ3L 4QHKI 3H9SA 1AYM2 1WISA 3W2DH 2IOIA 2ZCKH 3DURA 3ZTEA 2YC4A 4PJEE 1S9YB 3MFFA 2C1PB 3BMWA 5C0RH 3AJZA 4OMDA 1FAKT 3WF0A 3TL5A 1YO4A 4X4MA 1RTVA 5ANQA 3FB7B 2ZTBA 3O6FD 5D2NB 3EGSB 3WN6A 1OH4A 4XCCL 4QX8A 4QXUH 1J8RA 3QFJA 3SY0A 5HHNB 2J1RA 3B7MA 3I9GH 5LBSA 3C5SB 1C1LA 4UDTB 4WDIA 3CLEL 5BO1L 5FMOL 3OGJA 4F80A 4YNYB 1THAA 2F7OA 2BRRH 4FFIA 4ZX3A 4OFGA 5JPMC 2B08A 3QSKB 4PWEA 3L2NA 2I9TB 2WNVC 4COWA 2J8OA 1WEJL 1IU1A 5B7MA 2PELA 4M3JA 3HE6C 1Q8SA 5GRVK 4CC4C 2G9FA 1RUE2 3RU8L 5FR3A 5EORL 2C9QA 2VMHA 4ZFFA 3UP1A 2XN1A 1T6VN 1Y1UA 1P9MC 2MHAA 3INUH 2HEVF 1F6AB 1FDLH 1RIHH 4N8CL 2WLNA 4ZOCA 5KYWA 4RA0A 4AKOA 4LVNC 1Y07A 3FSVA 4NXSA 3TA3D 2HT3C 4JREB 1RUC2 3W9DA 2IFFH 2CNAA 1J9RA 5IBLD 1LP9F 4PIYA 4XBEH 3O1TA 4DVRL 1NE4A 5KR7A 2BNRB 2RCSH 3QAQA 2IWKA 1HKDA 4QHBA 5AZEL 2ETWA 4FT8A 1IC5L 3OR6A 3MUJA 1QLRA 1P0SE 4WO4A 3B9VA 4XNZB 3WFBL 2CHNA 3OAUH 1WT5C 1U8QA 2VWEC 1UH4A 2VMCA 2VOTA 4U3HA 2NR6C 4U1LB 3U0WH 2XONA 1LK2A 2GP3A 4HFSA 4NERA 3ZN6B 2DM3A 2CA4A 4A2HA 1V3LA 4OF3A 2AJSH 3F58L 4B53A 2AV7A 2ZXWB 1UFGA 2A83A 4AYDC 3GF8A 1X7SA 3OZ9H 2X0VA 1N2RA 1UD5A 2ROXA 3TO2A 5H35A 4W68A 1YSOA 4HUWB 4KRPB 1CBJA 2I74A 3SPVB 5C08D 1TQWA 3HBPA 3HAEH 2WZ5A 3IDGA 4EN6B 1KLUB 3HC0A 4KRLB 5DG2A 3OXRB 3TBCA 4YLQT 2NRDA 4JFZH 3LOIA 3NK4A 3ROLA 3MOAH 2I07A 4U4BA 1SF5A 2CXKA 4OJFL 1I3UA 5DJ2B 2EDJA 5AZUA 2WO7A 4P5YA 4UAHA 5FZGA 3AKRA 2F2HA 4HVRA 4QRRA 2NY0B 2HWC1 3EJYD 3T4AA 5BNPC 1E27A 1Z7S2 1ANUA 2ZUQB 4R8WL 4XT1C 5D96C 4DN3L 3RGHA 5LBSH 3WIFB 3S88L 3AVRA 4N5ED 3C3VA 4ZFQA 5KVFL 1MAKA 2VKWA 3HC3L 1IKPA 1TCRB 4W9DC 3SKMB 1FMD1 2OZJA 3D50A 1XF2B 3R4DB 4QHNB 2HWF2 3ACFA 2QZ5A 2VQ1A 3BKJL 1MIEH 3CGTA 2IH3A 4KDTC 2HLAA 1ULCA 1JGVH 2OMYA 1RUG1 4CVXB 2PR9A 4P14A 4S1SH 5GGQH 3ZYJA 3FUEA 4BKLB 4JO3H 4DGWC 3KHBA 5CP3A 5GGTL 2RD0A 4IGOA 2RB8A 1VBE1 1NUGA 1I4FB 1OC1A 1QJY1 3PQYA 4HWBA 4I4WA 3D4ZA 4ZSOA 4KVNH 3BN6A 4YM0A 1OV8A 2HRPL 3OHXA 2F7PA 4U6XA 1IKFH 3HEIB 2HXAA 3K6FA 4HIEA 4HUXB 3CVIH 3WNJA 4Z7NE 6PCYA 4B5EA 2Q7NA 4JRFA 2FE0A 4OLWH 2DD8L 3IDYB 4JFFA 1F9KA 1PDKA 2ZGLA 4MV2A 5FZCA 1J8HB 4LNVA 1Q94B 1QSFB 4LK4A 1XCXA 1F31A 3QXVA 3GJBA 4N28A 1HYSC 4GMSH 4MJ2A 3MV8E 5FZ6A 2VCOA 2EXIA 1S2BA 2VNRA 4Y1UA 1U3HA 1CE6B 3S2CA 4JPQA 4AVTA 2I60L 1JK8B 3UBXI 3VSQA 3ILPB 1D2PA 4HUNB 3HT1A 1B0RA 3FQ1A 3X3GH 2KPWA 5FA3A 4JDZB 4OM0L 1F56A 1FFPA 2HKFH 2J73A 5DJYA 3JZVA 2Q0ZX 4PY7A 1IS6A 4PIRF 3WNMA 4OIIH 4G71B 2ZX0A 4IOFC 2V4AA 2F58L 3H42B 3ARSA 3HRPA 4IEVA 4F3FB 4OFYD 4JHBA 5TH2A 2R8SH 2XFXB 2XQ0A 3RWCB 3ZSTA 4O2CB 4OU3A 1DGRA 2D03H 3UG4A 1QDOA 1OE1A 4X99B 2JELL 2X29A 4P08A 1DL7H 4YRDA 1CX1A 4UYBA 4DP2X 4R83A 5FZ9A 4YDIL 3CAFA 5JPMA 2VW4A 1JMUB 1XNDA 1XIWB 5D2AA 4I0BA 2YJLA 3QWRA 3CPUA 3SSGA 4ELMA 5T55A 4FQXB 4GMP1 4M3CE 3K6SA 3MV7D 1WCKA 2ZUQC 4PJ7A 5D96B 3IDUA 2Y6TE 4FEMA 4AE1A 3ARTA 5D4IA 4BM7A 3N0AA 4C1XA 2EH8L 2AYHA 4JGJA 4KKZA 5HGBA 3TT1L 1XWVA 3MLWH 5E51A 1NFIA 2R4RL 3MRGA 1KB5A 3IF1A 3S35H 4XNQA 1SJVA 1IT9L 5IHZB 1DYPA 1FNLA 3P4MB 5G05L 3FQUA 3RI8A 2CGRL 5D71L 2IXLA 4NO0B 4Q0XH 2ZF9A 3GMOB 4LSRL 5FP7A 4LCCA 4FQPA 5GALA 1VERA 1FZMA 2ENSA 2WXPA 3NIDB 4HWNA 4FL4B 4MAUL 2R042 1U8IA 4LAJH 3DJZA 3VXMB 2YZ4A 3ARRA 5BV7B 4O61A 5ISZE 1M53A 2NCMA 2MWCA 4WV8A 2WN2A 4HOOA 3IDIA 3EFFA 4E41A 2GMMA 3MFGB 3KYKL 4QXGH 1XBFA 4KK9C 3IN9A 5D1QA 1GY2A 3PWPD 1P69B 1OP5K 3ZKMD 4Z2AA 1AXSB 2QSTA 4HIIB 1AOZA 2F1EA 3TH2T 1ACYL 1UFUA 4PG2A 2D6PA 5FLVA 1EFQA 1MJJB 3LMJL 4NLAA 4XVUD 2B45X 5IESL 5EYYA 3ECWA 4Y5TA 3MJ8A 4X98B 4Y26A 1BG9A 5DAWA 1R3KA 2WHVA 2B15A 1UGKA 5AVUB 4K3EL 2P52A 3U7WL 4NUJB 3PWPB 3I85A 4IMLA 1NPUA 1JGUH 4J3VA 1DGRN 3FK3A 2ZTNA 1I1FB 1W72B 2XWJB 1SEQL 4QU1A 5F5CA 4Q2ZA 1TJXA 1LP9A 1JV2B 1X9TA 3R6SA 1JNNL 5E2TL 4UFHA 3VKNA 1VFMA 1F45A 3DMMA 3L7FA 4RSUA 4L5FL 1D4M1 3RWEA 4FFVC 2G9ZA 4KKNA 4P3WA 4RSYA 5BV7L 2W1SA 5AFBA 4I0PD 4U1HA 2E3VA 4ZSOE 3UYPB 5DHYB 2B59B 4XXDB 3P3UA 4ELME 3ILEA 4B3EA 4K3JL 2X7LA 3N40F 3UJIL 5IFJA 3QIWA 3AVSA 3SQRA 1RUH2 1TFHA 1D5MA 4FF9A 5DK0B 3SGKA 1S3RA 4BZ2L 4LCVA 5FYZA 3EBHA 4N2OA 5IJCC 1ZVFA 4HS8L 5EHFA 2EXYC 3CE1A 3KLAA 5SWQB 4YYOA 4AFBA 4CMMB 2R2BB 3BDXA 2KC0A 2OXGB 1BEV1 4LIUA 1WFUA 4YFEA 5DDJ2 4Y7MA 4Y1ZA 1X3DA 2PP7A 2R2CA 4YAQA 4M56A 2Y7OA 4FQHA 4EQ3A 5BUPA 4GB31 3IU3B 2R15A 4Y2DD 1OSPL 2BP3A 5CS7A 3KVBA 3RZZA 4ASKA 2G3MA 1B3JA 4LSPL 3RZWA 1A3RH 1LK3H 3AMLA 3TWCH 5FLHA 3DUSA 3WLUA 3NAPC 3S0MA 5EJ1B 4FQQB 2X4NB 4EN3D 3CO2A 4AJVA 2W0XA 3O4LE 5I66A 1HILB 2KM2A 2L3BA 3ESNA 2L7UA 5CXPA 4GO6B 3Q5YA 4P59H 5IJBC 1J3QA 2BXYA 2QR0B 3L81A 4I2OA 5FFLA 4FPKA 3FH5A 4BA6A 1T1XA 4HC1H 2A9MH 5EUOF 1E6JL 3VXRE 2ALWA 2ZUUA 3AYEA 3OUIA 3EZ8A 3QULA 4OCSH 4RFNB 1ZLDA 2NCEA 4QAMB 4JPIB 5B22A 1HYRC 5EG6C 3VXNA 3ILQC 5T3XE 3O4LA 4HPKA 4QXWA 2ZOEB 4OLZL 4META 1FZOA 4AH2A 2FHRA 1AH1A 1GZTA 4FXGA 4I3RH 4Q7DA 3UTSD 1J87A 4WGWB 4L97A 1XR9A 2VZRA 3A5VA 4JY5L 1NIFA 1E65A 2IZWA 4K7PH 4LULA 4Q27A 1P7HL 3P5BA 5PCYA 4Z77B 1AR83 5D1IA 1OOPC 1T2JA 1W6NA 4LCCC 3R05A 4IEWA 4E2SA 4MDRA 3BZFA 5DRNB 2EIGA 3I75B 1MFDL 4K7PX 3FH7A 3CFKB 4IS6B 1YN7A 3PAYA 5LA9A 3WIAA 2Q2EB 1FNZA 1JVKA 3BSGA 3TJPA 2QVIA 3SCMC 3WJJC 2NY3D 3ZDVA 2QKIA 4WEBH 3IM0A 5E08L 3GEFA 1BQUA 3RVTD 4XUOA 3PIQA 5D7JA 3BVTA 2EINB 4F7CA 1UX6A 3RVHA 1SBFA 3NZ8B 4BQCA 4XO3A 1U8JB 1UJ3B 2RHEA 3CBRA 4H1LB 3WFBH 1KYUA 1BBDL 5KVDL 2PTTA 4RA3A 4ZMPA 1T22A 4P00B 2VNCA 2WYFA 5CFDA 3BEVA 3OD4A 1ZMYA 1W9XA 2XJRA 1MFBL 2X9YA 4OHZA 1NSNL 2UY6A 3Q48A 2NYKA 4NHLA 2D7FA 4EI5D 4F7EA 2QUOA 3DX9A 4GSQA 2FRGP 3GPEA 3NQIA 3BQVA 1B0GB 3IJYB 3DC0A 4Q4V1 4Z07A 4C91A 1I31A 5D1QE 1CO1A 1FYHB 4NZTL 1TOXA 2VABA 2QLVB 2R9HD 4PJEA 4W9LC 4F8OA 3B2UC 1RZKC 3CDZB 1BREA 4HSLA 5FZ0A 3WG4A 4EI5B 4E9RA 2P8PB 2HWC2 1DVFA 1G9NC 4LBMA 1GZPA 2VTXA 2AVFA 4JGMA 4Y1SA 3IPVB 3MRQA 1S9XA 2WNVA 3OKDA 2HRPH 2HTLD 2Z31A 1FNAA 3MLUH 4MB5A 4UYPA 1PPIA 3TU6A 4KXZH 5K59E 3ARBD 1ZT1B 4LDLB 5TE6H 4GJZA 1W6OA 5FQ0B 4UT9H 2J43A 3DK0A 2AZUA 5JIQA 1P4BL 3DGTA 2L4OA 3N91A 1QH7A 3F84A 4LPLA 2VDMB 2JNZA 1QXRA 2GJZA 4NZRL 3MZGB 3EBIA 2JI1A 4OIFA 5CGYD 5HHOB 1I53A 1I3GH 4XPTL 1XH0A 3NCWA 1YI9A 1WAAF 4AEDB 4BV1A 1JGVL 3OR7A 1DQ6A 5AOZA 5ADOH 4PQQA 1RUNA 2VTFA 4KKCC 3MRPA 4OFKA 1QJU2 3AP9A 4DP0X 3VCLA 4YGEA 4UT6A 1YDPA 3C60D 5FUIA 1FH2A 1TZHB 2C9PA 1YEKL 2E9GA 3D25A 3V79C 4FQCH 3V7MA 3GBWA 1RXGA 3ZL4H 2LE9A 4DK3A 3I2FA 3EADA 1L7RA 4UV7L 3CBNA 4XVJH 3T2NH 3MNVA 4PJ9A 4QRPB 4N2GA 1IKFL 4Z0BL 2J72A 4OZHB 5DAVA 5ALCL 4EWAA 4WWOA 4Q4W2 2QPDB 4F83A 3NBNA 1KIPB 3RIAF 4OZFH 3L1OH 4WBBA 5JOPE 4N90D 4XXWA 4XJ9A 1N59B 3QPXL 1UOGA 3IDEA 1GGIL 2Y1AA 3IFPB 3K6DA 1NJ9B 3RAJL 4QPGA 3O3BB 3EJTA 2GU9A 2YAHA 3C8KA 1CU4L 2VR5A 3PHQB 2ARCA 4XB7A 5FFOA 1BX2A 1AI1L 3EOTL 4PGBA 3UZQB 4LF3A 5BS0E 1DQ0A 2F4LA 1JHTB 1NEUA 4LCYA 3W0WB 2A6ZA 4HVOA 2CDEA 3ECUA 3QEQD 4BH8A 1IC0A 2V5RA 5I75B 3M6DA 4Z7OF 3OG6B 4BFOA 4IU3A 2IBZY 1QAWA 3NIGE 1FN4A 5CEHA 5C3RA 4HGWB 4QRRE 5IROA 2CKBH 1H3XA 3ESVF 3OEBA 1JUFB 4Q0XL 1L3NA 4HKXA 4ZAKA 1NC4A 2Y7MA 5FPXA 5I82A 1TYRA 5FKAA 5HHPA 4JQXA 4O58H 5I8KH 1FL6A 3GMRA 3WW4A 3A24A 3U1SH 3ME0A 1IQDB 4XDOA 4P99A 1E28B 3D85B 5J6HA 4DP6X 4K5MA 3WFZA 5F3BB 1EX0A 1YEJH 5JQ6H 4D3WA 1A0QH 3O1OA 1RJZA 2AKRA 3KJ6H 3NABL 1PVXA 2ZGKA 3RDTC 2P1BA 1GAFL 2JB5H 5FPZA 4FQXC 5LNEA 3K72A 1K5NA 1YNLL 3MLTB 4XE0A 3X11B 3ZQWA 3LB9A 1P7BA 3EH3B 3P69A 2WTRA 4OCMC 4XO8A 4CADB 5JAXA 1GC1H 5I1CL 1QNZH 4G7VH 3U30B 5EUOB 5FLJA 3BUCA 4MS8C 1IAII 2DZEA 5T1LA 4HJIA 4NZDA 4FFFA 4DO5A 5LEJA 1E0OB 2OM5A 3F7RA 3FTXA 2R0WL 1UOFA 2R30A 3U9UA 5LGKA 4RX4A 3OHMB 2VMJA 5LO7A 4BFGA 5HI4C 4PV9A 3NJVA 3FB5B 2JQZA 2ZKXA 4YO0B 1O7FA 1QO3B 1PGW2 4MBRA 2R0FA 2XZZA 2SODB 1GKBA 2EDKA 1Y9QA 2R59A 4HG6B 5L8KB 4PB9L 3VD1A 2VDPL 2VLKA 5FRAA 2XJSA 2R0ZH 1I8UA 1MW2A 3DJTA 5HJBA 3GJAA 3NSYA 3QEQB 2VDKB 3B3QE 4S1QL 1KS5A 2VR9A 1QPPA 3ZE0F 1SFHA 3I6KB 3GHNA 4FOWA 3I54A 5DABA 1CK0L 5A40E 4P5TA 4WUKL 4K6BA 4X5XB 1GNHA 5E8EA 2BNQE 2ZX1A 3T2PA 2OJEA 4ACPA 5EIIB 3VD5A 1EVUA 1NZRA 1V8HA 5FA4A 2R29L 1T3FB 5IMOB 5FZOA 3V4UL 4XI5D 3FLPA 4QTIH 3ASIA 3LEKA 5HGGS 3WY3A 2HT2C 3FN9A 1OARL 5AQ0A 4CPBD 2Q76A 3KLDA 4Q4W3 3DDGA 4UTAA 2H2PC 4AQ1A 2XB6C 3B00A 1DBKH 1P53A 4P9LA 3BTXA 1ZBE3 5J13B 5GSVB 3W37A 4OMCA 5HDLA 3FQWB 4DO0A 4RA0C 5C0CE 4CGUB 5CP3H 1OXYA 3N35A 1HXMA 2V3FA 2O5XH 3BWAA 4EZMA 1CB4A 3E6BA 4NO2B 4RZCA 3KXFE 4ABWA 2KLTA 5JPNC 1JBJA 4MMYA 2BVOB 2Y06L 4LRNH 4I1PA 4L18A 1QKQA 1I3RA 3S88H 3W38A 2H32H 2LW3A 1KGJA 3HUJA 5D9SB 2P5BA 1KXVA 3EW3B 5FUOL 3V7AE 1QU0A 3HS0A 4LSVL 3WFEH 4FQLL 4AE0A 4BA0A 1W28A 2Z91B 1ASJ1 4XN9A 5IB3A 2OL3A 4WNSA 3EFDH 4IRJA 1ADWA 3OPZH 3HFFA 4ZFGL 5FHBH 1VCBC 3VMOA 1J5IA 1FYUA 4Q4Y2 4JPVL 2P8LA 5D6CA 5F3HB 1JI1A 2XPZA 4ILDA 5D1XB 1I8MB 1J8SA 2JJSA 1I9RL 2X88A 1A7PH 4G7RB 3GZAA 4I18A 3DARA 4WEUD 1HQNA 2AXFB 1ZTXH 5F9OH 4JW3A 4LVEA 1WW5A 1KJMB 4IRZH 2ZUSA 5BQ7A 3BAJA 5JXGA 4YVSB 2FH6A 4HYTB 2W1QA 4LLWB 4RFEA 1HQ4B 5H4YA 3VI4E 2AI0H 4TPRH 2Z34A 4OZHE 3ULUC 2ZPKH 4JFOB 4N22A 2WZ8A 4JMXA 4OLLA 3VZLA 1TJIL 3MRJA 1TVBA 4NJAL 4OQ9A 1WAAE 4B9CA 1DSFL 1WSST 1G9MH 3QZBA 1MF2H 4XZUG 1MZZA 2FHFA 2JCWA 2AJYL 2YA1A 4GRMB 4W70A 5BZZA 5JSOA 1MEC2 4PJGE 3JWOL 2DBLL 3W56A 2DUPA 3VBHC 4BYHA 2ZOKB 4MA7L 4MA1B 1HHHA 5D21A 4EVNB 4JO8A 4Y5VA 1USZA 3OKEB 2YMTA 3SBWA 3P4NA 3NFSH 3CZUA 4IEZA 1LO5B 4JFQB 1HCYA 4FG6D 4OI7A 1KNOA 4NNPH 3VXSD 3NQHA 4IV1B 1GICA 4RGAA 2HKFL 3L3KA 2BMKA 4NWUH 5JIIA 1DE4B 4WNQA 1SCRA 5C8JB 1S7XA 3MICA 1YMMD 3I9IA 3MREA 2OXHA 3NJFA 3MV01 1JYNA 4OGYL 2YQGA 3IMBA 2NY7H 1TMQA 4KZDH 4PJFA 4OCYH 4MMXA 2WAHA 1RGSA 2FDIA 1I3HA 2FZ3B 3MN8A 4FMVA 4HVQA 1IQAA 5K0UB 5L9VA 1C9SA 3VKFC 4H8WL 3QBTB 2GN3A 1BAFH 1RERA 3FT9A 2PHLA 1EJFA 2B20A 2EC9T 3GSNL 1EY2A 4GBXC 1GJWA 3V0BA 4AQ8C 5DMJB 3MLUL 1FLRH 5SV3A 1RZJH 3MIEA 1S0FA 3GDCA 4KFMA 1KTRL 3MLXH 5EZLB 1ADQL 4HBCL 5GRXG 1AHKA 3GSUA 1A6ZA 2ESVA 2GUOA 2YUVA 3MLWL 1XBDA 1W99A 4COYA 4GFTB 3H0OA 1QBMH 4RDBA 1KCSL 4DIQA 5GRUL 3QCVH 3UBFA 4OSUL 1ZHKB 3FBKA 2NPLX 2DQHL 4X4YB 2FYYB 5F0JB 4MDJA 4DW2L 2Y36H 1KPUA 3FXIC 3TA3B 1AJOA 2XN9B 1US2A 2D31B 2OR8A 3HA0A 3TEZA 2XQYG 3KCPA 3SGKC 5F7KC 5ANME 4XVSH 4ZJ9A 4H8PA 4JG0L 4WWNA 3UOAB 1JE6A 2G30A 3FNKA 3KGRA 4HU2A 4M01A 1ST8A 5FZMA 1RVF3 1HZHH 4N2DA 1B2WH 1QNYA 1S78C 4R4FL 5HBAA 4AV4A 4NM4L 2K8MA 4APQD 1I1EA 4WY7L 1S0IA 2MCPL 2BY2A 4X8JB 5CSGA 5JQIB 2VISB 4UQEA 3OMZA 4G1EA 3H3ZA 3KYKH 1G6VK 3TGXA 2Z4QA 2GFBA 4KHXH 3BD3A 4Q56A 3MLVL 3Q8AA 4AGRA 1TKWB 2GIXA 3S6CA 2F19H 2G2RA 4ODXB 4PCTA 4LU5L 4PJXE 5I1JH 5IESH 4JM0A 1RUG2 3GMLA 1X5LA 3O3DA 4V2WA 4GKNB 1S46A 1BZOA 4G70B 2JDUA 5KHJA 3KGTA 1G7HB 5BNNB 1I75A 3D3VD 1E50A 1LM8V 4W1TA 1KPVA 5A2JH 1KGYA 1VB2A 4Y2LA 1D0GA 2YYOA 3GZUC 5FP4A 4BQ8A 4FBFA 3OC5A 2X6AA 4RWHA 3SY6A 1KIUA 4CN6A 5J9PB 5H9RA 4QHMB 1JNNH 4J2QA 1FNGA 4NAMA 1NBZA 5JXEA 2VDPB 3NRUA 2EXTA 5F7NC 3JT2A 4X7DC 3ZXLA 5BV7H 2FQGA 1XGRB 2A73A 4A3XA 4OCLC 3QLQA 4EN7B 4OD1L 2A6IB 1TME3 5A70A 1BZEA 2ZX9A 4N6RA 3GZPA 2HLEA 3SB3A 1SG3A 1QR1A 1T1ZB 3QUKB 1BDYA 3QNFA 3OG2A 3RVUD 1OHQA 3MUUA 3QGVA 4JFVA 2J6EH 3WEMA 1OCOB 3ABKB 4HG4J 2QZ2A 3GSWA 1WAEA 3NJIA 4K5PA 3BP7A 2DBIA 2EDMA 1NMAH 3DX0A 3LRHA 1U3HC 4OUOA 2ZKHH 1BXAA 2IG2H 3FQ2A 4PM1A 1KYDA 2VDML 5D1XE 4NR1A 3DVNA 3VFTA 4I9WE 3I02B 1KOAA 2VXUL 4YHNB 1BXHA 2NYYA 3M7AA 1NZCA 2PUQT 3AWFA 5AKVA 1NLBL 4BZYA 5ESVA 3THML 2YMZA 4G8FB 3SPGA 4NAOA 5FJKA 4PS3A 4RFNC 4QY8B 3N41F 5IMLB 2CIIA 4WI5A 4YL9A 32C2B 1CAWB 1D5XB 2XL7A 3GHBH 4HSQA 1IBGL 3MBWB 4NI6A 4LT5A 1UU4A 1IZKA 3DX6B 2BZ7A 4PJFE 4CUBA 4F57H 3G6JA 2A9ML 5LHDA 2O1QA 4IE5A 3NJZA 2HKXA 1A0QL 1Z1WA 2K6ZA 3HCVA 4X9BA 5IQ9A 2VDPH 4NIDA 1WTLA 4DZGA 2EC9U 1KS4A 5D2LF 1AKJB 1PKOA 1SY6A 3CFEB 3T8VA 1TYJA 5I15L 4YSRA 2GUYA 2LLGA 3IE4A 2AS5M 4Z7VA 2WAOA 1Q9LB 4GXVL 1H9VA 1LNUA 4V2BA 4E2GA 1BW8A 4NIKB 3SJVD 4P4KC 4N0FA 1DCLA 3FRPB 3ZMEA 3LX9A 4E8DA 5K1JA 2E0PA 3J7LA 5D7SH 2Z35A 4MDIB 1CR9H 3QNXA 5ID1B 1EHAA 1JRHI 4RLDA 1Y0LB 4GRWE 1V0AA 2D4DA 3U0PB 1YY8A 2NUPA 3Q6GL 3NA9L 3T8XA 1TIUA 2RAMA 1E5CA 2IPUK 2O1AA 2W0FA 1G9MC 4RH4A 4ZTPL 4I0PB 4CW1A 4X6DA 1ZA3B 4TF4A 4F1SA 2Y2TA 2A74C 1KJ2L 5IKCB 2YPJA 3DKHA 1PFOA 2JK5B 1J9SA 2IAMA 4WJG3 4JRXD 1RPUA 5GGSY 2HCZX 4HS3B 3UP6A 4GG6B 4GBXD 4I13B 2H41A 1AQHA 3MFCA 1EO8L 3Q2WA 1FV3A 3T6WA 2DTWA 2A77H 1E3FA 2FLMA 3PABB 5A3TA 3VXTB 2DOCA 4GAYA 1D5ZB 2EXWC 2XCMC 3TNNA 3QUYA 2QQJA 2L0DA 1TETL 2WFF1 3ZL2A 5EZJB 1T6WA 3GSOB 4FOYA 4GAGH 4JM4H 1OH3A 4UT5A 1S7SA 2IXIA 4FGMA 2ZXEB 3OPZL 4ZFGH 5FAXA 2DQJH 3VGHA 1IG3A 3U4XA 2ZXGA 4NS0A 4LE3A 4NIHA 4PP2B 3OB8A 4EN3B 1ZK9A 4F9LC 4HC1A 3HFML 3DIVA 2HWF3 3BKCL 4OIBA 2KA3A 3W0WE 1QYGH 2JJTC 3MRFA 3O2WL 4R4NC 3VXUA 1U8PB 4F5CA 4NN0A 4OUSA 4JDTH 2J22A 5FYBA 2ITDA 4X9GA 3FCTA 3UTTA 3BW9B 4ANXA 5KHHA 2C3VB 1ZHBA 1RK0A 4WZCA 3VUOA 2JKNA 1E6OH 2VIRB 5D4HA 2L7QA 1D4VB 1ZT7B 1OE2A 1N3OA 1NLDL 4YVUA 3DI3B 3LH2L 3MRNB 4AIEA 3TBWA 5F9JA 5T3ZL 4ZFZB 1SPPB 5AOIA 3LZQA 3FT3B 1KPRB 2R23B 3NCFB 5T3XL 3EXLA 1D7PM 3PJQA 2CJSA 4XBPA 5IW3A 3H56A 2Y07L 3TN93 1L5GB 1T20A 5EO9B 4AQ6A 4AVJA 3V9CA 1NANH 3ZL4L 4QYOB 3FQXB 5ID0A 4NN5C 2HN7A 3E97A 1N3NA 2IXHA 3MLZH 2BK8A 1NGYA 4LMQE 4UV7H 4B9FA 1FT9A 4TWTA 1G0YR 4OGYH 1EEYB 3KBEA 3GJEB 5C0IB 4LO4B 1R75A 2NY7L 3H54A 5F7AA 1QFHA 3L08A 4ZTOL 3ZX7A 2R1YB 5FGCE 3MX0A 3OZKA 2UUDK 3DECA 3V0WH 1BJ1J 2EIJB 2DV6A 1CAXA 1U33A 5DF0A 3HRZA 2HWE2 1F4WL 4NP4H 4L05A 4N90E 1OAZH 4PLKC 4QLRA 1AR2A 3QXTA 2DBLH 2H26B 1CMOA 3SDAB 3FQRB 4JB9L 2XU9A 1I7TA 1VADA 3LZNA 3VXOA 3S5QA 2YGQA 2Q20A 2ZAAA 3O9WD 2KZ1B 5KJRL 4X7TB 4YHYC 5HYJD 1ZPLA 3GMPB 2B1HL 3FS9A 3RWHA 2YLHA 3TCLA 3TN0B 2HJLB 1LULA 1O59A 4PSRA 4AYFA 1S4IA 2WN3A 2ZIDA 2P5WA 3NRFA 4E4HA 4WUUD 3PXLA 4RRPM 3AKTA 3QQ4B 3LA2A 1TEYA 4GPVA 2PKDA 4DPRA 1CN1A 3K8MA 3GRWA 1QSVA 5CD3B 2DMBA 4CDQA 2AERT 4I3GA 1CFSA 1Z9OA 5E9AA 5C0DB 4XVHA 3ZGHA 2VE6B 3J9SA 4E5XA 2Z3FA 5DWUH 4IGQA 4U7KA 5DS1A 5GZDA 4H0IA 4Y2OB 1PK6A 4YBQD 2H32B 3HAEB 3DV6A 1D3CA 2WC7A 4LMQI 3RA7L 3MRDA 4WZ9A 1JRHL 2MTPA 4AM0B 4PWKA 3W21A 3BSHA 4WJ5B 1PKQA 4LCWA 5F89A 4AI9A 2Q8CA 1XSQA 4AGVA 4KHTH 5C9JA 1YUKB 5EC2A 4FI7A 1P7KB 3WP3A 5EF0A 3UK9A 2ZYSA 4YM3A 5TGBB 1YFUA 3SYAA 4HT1L 3AROA 4HMZA 5EZOH 1DQTA 2VC2L 3M7FB 3LDBA 3N9MA 2BCKA 4L3CA 2AGJH 3T0ED 2DQHH 3TS8A 1YCSA 1R1A3 5KXCA 2JWPA 3EO1B 4L1DA 3UBGA 5F5IA 4QGYA 5B38B 3A0NA 1Q90A 5BCAA 3GHPA 3UCQA 4AQZA 1M1XA 3EJJX 4LK6A 1PIV3 2J44A 2G9KA 1J1OH 1DF0A 3QUXA 3JCIA 1FV1B 3CSYB 4IRJC 4PTUA 2F53B 3LRLA 1D9KA 4QT5A 5DRZB 2P80A 1J0IA 4FE9A 3W5NA 4YSFA 5JMCA 2DCJA 1KTLA 2YQ2A 4MJIB 4WO4C 4YEEA 4U1IA 5C6TL 1OCZB 1KG0B 3MRIA 2AXGB 3QUXC 2NQCA 2BVTA 5BY5A 3FF7A 5JOZA 2VXTH 2H0JA 2Y23A 4AG4L 2R073 2N1KA 4UBHA 4NWWA 4Q0QA 2NTSP 1SMVA 1ZS2A 2P28B 3T09A 2WYIA 2ZUXA 1UWXH 4I7ZC 5HHXH 2W39A 1HH9A 1IC1A 4K94L 1BA9A 3ES1A 3VM5A 4JGZA 2ICWJ 5FK7A 5KSBB 3KPNB 1REDA 2F6BA 4AG4A 5JW3H 3SGEI 1J0ZA 1JWSB 4URTB 1CFQB 4G9FB 2W87A 3B4NA 5T33H 2YKLH 1SJMA 5IVXB 5ECJE 1XYOA 1OAYH 2OP4L 3E3QC 3OLGA 2UZIL 4KRPC 3KYOB 3FU9A 1GGTA 4MKMA 2J1VA 4DZBB 1VRH2 3PP3K 3NO8A 2BS9A 5EF3A 4PCRA 2JB6A 4CVWA 3GTNA 2PTVA 3WDVA 5F96L 1OUXA 2Y7LA 4ZUUB 3IDXH 3C6LB 3LEGA 1G7JB 4PJAF 4Y5Z0 1ZWIB 3C5ZD 3GGLA 1RZIB 1ZV2A 2D9QB 1M7IA 3NZSA 1TLMA 3RI5F 5ABDE 5KW9L 4L3ED 2K2SA 1YJDC 5LW9A 1MCJA 2CO4A 4CP0A 5IK8A 3TP4A 1RXLA 4GNKB 4UINL 4Y4HD 5LUMA 1RUC1 3LKPB 3MA9L 2GHWB 2E8YA 5F72S 1JXNA 4UT6L 4GW5B 5C08A 1L9MA 3R06B 4NVPA 4LLVA 3LKNA 1ENSA 1R6VA 1O5PA 1R5VB 2ZUTA 3RWDA 3FFDA 1DQ4A 5EJZB 5LATA 1S5IH 3RDTA 1ASQA 4YZ5A 5E16A 3S0PA 4DO6A 3FRUB 4QXUL 1FPTL 2VLRE 3THCA 4RRPG 1GBGA 2Y34A 3TFKD 4S2GA 2IH1A 2DRUA 5KSAD 2F54D 2NXZC 1DANU 4JPVH 3N3HA 1YCIA 3K2UL 5EF1A 1F8VA 3K8KA 4GRLB 3B56A 5DZJA 3IJ7A 2G3NA 3WKNA 3Q06A 1XGPA 5F21B 1BECA 3AW5A 3RY4A 4APQB 3BIAX 2YMXH 4M5TA 1SXNA 1YUHB 3IJSB 5DUVA 2GC3A 3UNPA 4CBPA 1K8IB 1A3ZA 1G9EA 4G6MH 2NY0C 2WNKA 3FULA 4LIQL 4RGNE 5FB8B 1CR9L 4PHZA 5IMKA 2K7QA 1DYZA 1ULVA 4NQSA 4PCYA 3S3CB 3SZKC 1P6AB 3D4GA 2FYVA 3ZKSD 5I1AB 3D4YA 2HG5A 3OAZK 4XFHA 1MACA 4EI0A 4HUUA 3WXVL 1KD7A 1EMTL 3QJQB 3GUFA 1KBGL 3DIDA 2UWBA 1A6WL 1NUKA 1MY7A 3KW8A 3QH3B 3QYNA 2ATKA 4XJZA 1U8OA 1MJUL 2YXFA 4JG1H 3X1GA 4GWMA 3M07A 4IEFB 5DUJA 4XP4H 2ADJB 3EGDA 1RUPL 3T6ZA 5E8DL 3TJEH 3H7LA 3QORC 1T03H 5DO8A 3NFPB 5EUKB 4JFEB 1MRFL 5F9WB 4FTVD 4HJSA 4ADJA 2HMID 1UZ8B 5AAMC 3KDMB 1IGJA 1OXCA 5F0PB 1KY6A 5A7WB 5LEKA 1I9IL 4H40A 3CDCA 3VQLA 4MGSA 1MAJA 4QEGA 3BZ4B 4OLYH 5FYJH 4DH2A 5E8PB 3MI8A 1MQKH 3L9RB 2PCPA 4WM8B 2ET1A 3CFQA 1BAFL 2NNFA 5I0TA 3FCSB 4JFZL 1W9TA 3AUVA 4U2YA 4GAAA 3GJFA 2YXSA 3FTUA 2FIKB 1L9RA 3RFZB 1C1EL 4EV0A 3WBDA 1UYXA 4IIQA 2J1KA 3U46B 3UGGA 2X2JA 5A43C 2VECA 5I30H 2B7DT 1MHHA 2G3ZA 3LHAA 4NZUH 4HBCH 4EZKA 4NPRA 5CINL 1UVQB 4QKXB 1XH3A 3NSJA 5ETUB 3SKOA 3JUYA 2CALA 5DD5L 3GGWB 2EA7A 1KCSH 1NFDB 4FKEA 3CEWA 5C70A 1TTUA 4PT6A 3QXWA 4LHKA 1NFDF 1EHLL 5HY9A 3ESMA 2F5BH 4TVPE 5A2BA 3S8WA 2E5EA 5C7ZA 5T3ZH 3FU3A 2A9NL 1YA5A 1FCCA 4U1NB 1MHEA 4YR6B 5IOKA 1OKOA 4IGBA 2SLIA 2X6CA 4PGCA 1C8M2 2AJ3B 4NENA 1NPNA 3PWVA 5T3XH 4YX2L 2YOCA 5FM8A 1IBFA 3T1FA 2HWD3 1V6NA 5GGTH 4ZD3H 3RUGB 3WS6A 4NHUB 4HJEA 2JD4A 4URTA 5IM7B 1UXWB 3RVXD 4YDMA 3FT4A 4Q8KA 4YXHL 2KT6A 5C8CB 4X5LA 43CAA 2Z92A 5FO9A 3WS6C 3O6ML 5ILTH 3Q9OA 4ONGH 2P24B 2ZOUA 1H8VA 3OJBA 2JE7A 2CO7B 2TRHA 2CH8A 4PJ7E 3L4XA 2JDKA 2ZYRA 4G6KL 1FNHA 3DYPA 3SKNA 1NOAA 4P9HC 1AGEB 3MLYH 1QF3A 3V5KB 2N7SA 3VXME 3I3QA 2PYFA 1H30A 1A2YB 4RSVA 4A2GA 2EYTA 4S1DD 3HBZA 4N6QA 5DEJA 1FL5B 1WGOA 4RAVA 1UM5H 4YK4B 5IB2B 1OLME 1RL3A 2XQBL 2PPDA 4Y4FC 5C9AC 5C08E 2MPFA 4JDNA 4A2FA 1A8MA 3WF4A 3SITA 4AEKA 2ERJB 4F9PA 2XBO2 3MU3A 2DU1A 4WJKB 2Y7QB 3AWEA 3KPQB 4Y4FA 5FUCE 2DVAA 1MVUA 4HETA 4RGGA 4D6RA 4N8PA 5LAPA 3VBFC 1FFRA 4QQHA 4LBEB 2Q3XA 3KWWB 4GAJL 1HE8A 4BELD 1F4HA 4BJLA 1J1XH 1NAEA 4AVBA 2OSWA 2NX5B 4XP9H 2CRZA 1A5FH 4MWFA 4Q6IC 1W2UA 1RJLB 2OT7A 4ZXKA 4F8AA 2AANA 1U91B 1YPZF 3U36A 3IJHA 3PPEA 3AFGA 4UAOC 4AEFA 2FX9L 3DUUB 4HLTA 4WKXA 3P30L 3QDGA 4ODWA 4OFDA 3O2VL 2D7OA 3VXSE 3DEMA 5IW0A 4JFXB 2PCFB 2P5EB 4OFQA 2Q8AH 3RVWC 2ZUVA 4PTTA 3CDFA 5J1XA 3LE0A 4DXZA 2E86A 1NMBH 3DSNB 2J2ZB 4NZ8A 5F7FA 2Y0OA 2UYAA 5AW4B 4L37A 2J8UA 1BAGA 2VXVL 4N9GA 5GZOC 2A6DB 3QR1A 3QFJE 5HVFB 1PY0A 4JQTA 3AM2A 2IG2L 1ZGLB 1YYLH 3FRPG 4NKIL 5I18H 2R4RH 5D2LA 5DUBB 4EQ2A 2GIYA 3NAPA 4RNRA 1IT9H 1PLAA 2X09A 4XTRD 4Y5YC 3FO0H 1AX1A 1P7QD 4GJTB 4PMFA 1OA4A 4RIRB 4FABL 4PVBA 3FE5A 1NM9A 1MREH 2PLV3 1KJ3H 4BZ4A 4RMVA 1A6UH 4KO5A 3FTGA 5C0JA 4LBOA 3DV4A 3QW9A 1G4MA 4L0ZA 4MFHA 5B3JF 1NBYB 2PWFA 4ZOBA 3POGA 4LUMA 1RP9A 3ULVH 3ARDD 2FQFA 4L1SA 4YC2B 1ZT4A 1WC7B 4JJOA 3RE0A 2OSLA 1R3IL 1BD2B 2IMMA 1NIBA 3IT8A 3DPRC 2F18A 3DVGB 3BD5A 5ABJC 4P9ML 2FL5B 1E9OA 2PYEA 5GGUB 4R3SA 3COOA 5JOFA 1PZCA 1YEWA 2GI7A 4BK5A 2VOWA 4JM2F 3D4CA 4EIUA 4AQ8A 1OAUH 1OAJA 2IGFL 1R081 4YE4H 4OZIA 4B3NA 1ICTA 4N2IA 2X1WL 2XRAH 4UFJA 1G7PA 4XWOD 1ZEAH 2XOMA 3UAJA 4LBLA 1Q1JL 1TEFA 4KH9A 4JX0A 2PYEE 3IMSA 2JKXA 3L9BA 3WN5C 5C0EA 1SEBB 3BUDA 2ADDA 4LPUA 3TB0A 4QIRA 5F96H 4CDWC 1OQEA 1DCEA 3L1GA 4HBQA 3FFCB 3UTSA 3WE6B 5GKAC 2ZGRA 3HPLB 2JICA 3GSNA 4ZPVA 5IVCA 3S5AA 1AR73 4KG8A 1QEWB 3F7YA 3R7RA 3I50L 1DBNA 2PA7A 5F7EL 3MV9A 3U9PL 3AG2B 1E3XA 4UOW0 4DTGH 1KT2B 5C0BA 2MMXA 3JXSA 1MI5E 5I6NA 4G7SB 4LZKA 1HYSD 3CX5K 5IK5A 5HHXL 1INDL 5DQJA 3QDMB 4QXCA 3TOJA 4PLNC 3PWUA 3RVUC 2YD6A 5K39B 1FNSL 1VEOA 1XZ0B 3IDJA 3NN8A 3KCCA 5JZGC 3MROB 3L3IA 5GRZA 1JGEB 1HDKA 4PIXA 3FFQA 4QD2A 1DBBH 4A2LA 3PUQA 4PUBL 4KVPA 5EUOE 1A6AB 2ZXAA 2MCMA 3LPGA 4R96B 2ZHLA 1W0WB 3VWJB 1VAKA 4TXWA 1GYCA 2HA1A 4FQZA 1YAIA 2QSCL 2TSAA 1G1CA 4MX7B 4JK0D 1D2QA 1BG1A 4MADA 3OPUA 3D8CA 4K7FB 3S97C 4NQXA 3ZPDA 5FC9A 3A6OA 5CVRA 2BQPA 1A7OH 4RMUA 3DGGB 2HX7A 4A66A 3ZSSA 1TEIA 4AUYA 4XN7A 2A0LD 3MPCA 3RVXC 2Z93B 3HT2A 4WTZA 3AZUA 3PFQA 4YPGB 1DDTA 1KC5H 2IDQA 4Z7UF 3ZN4A 2HRLA 1LEGB 3H6AA 5DFVC 4G59C 3TBVB 2XG3A 1XE8A 5TQ2L 1UOVA 1OQOA 4A7KA 3FZ3A 3SQBB 5KVMC 3HWJA 1MCNA 4P2QD 4FAAB 1O5LA 3C12A 1WVZA 4X4ME 4WU7B 3F95A 3NIFB 5CEZH 1CFMA 3OL2A 2ZEWA 4NO4A 1RZGB 1DZBA 4LLUB 3WDIA 2Z31D 1JH5A 1OGAD 3HG3A 3K74B 4J27A 1E57A 2WYSA 3VXPA 2P3IA 4AMXA 1B6UA 2X0WA 3QZLA 3ZDZE 5IB5A 4O2EA 1NLQA 1OKQA 4XQDA 2DJUA 4F7PA 1CFNA 2IANA 4GLRI 2D7PA 1F11B 2ITFA 3LN5B 1LODA 1P5VA 3BZEA 3O45A 4AFAA 2W91A 2VAAA 3RQ0A 4GH4A 3ARXA 3P3SA 3D39B 2MQ3A 1GIGL 1YY9C 2X8KA 3OSDA 4Q2FA 5SV8A 4M9OA 4PGJA 2GY7B 5F7DA 1Y18A 3SE4A 1XQNA 4X6CB 5A3LA 4BFEA 1B35A 1UENA 5BNPA 4JN1H 4ODVH 3KXFD 3O6LH 1HV0A 4MJ6B 3SBQA 4MD0B 4H88H 1EZVY 4XCYB 2UWEF 4RHV3 5GGTA 5T1KA 4TUOA 4KY1L 4C56A 4JHZA 2LGNA 1MRDH 5I6XC 1OP5H 3C5ZB 5ACZA 5JZ7C 4N7UA 3STZA 1CQKA 2XQYA 3QHZL 3PNRB 2DQFA 5DD6A 1NQJA 3WDXA 2LS6A 2DWDA 3GNML 5I5RA 1MWAA 4M4RA 4JRXB 1DBJL 3U11A 2OPCA 4UM8B 4ERSH 4PP1C 4AYMC 4CAGA 1A3LL 2HBUA 5BJTB 4JGYA 1QUPA 4GSXA 4X6BB 1FNYA 5HXVA 3WR0A 3UMTA 3SH3A 2HSIA 5JIKA 3H7BB 5I1GL 1Z66A 3A21A 1O7DE 4MQ7A 1G7QB 3WG1A 2Y5TB 3JTSA 5CYYA 4NI3A 2M2DA 2NW3A 3U9WA 3CJXA 3NNJA 4L29A 4Q4Y1 2G4EA 1GLHA 2EKSA 2EICA 3M3EA 2JD9A 5EOCL 4Y4KB 2ZCLL 5IVBA 1M05A 4OTXL 3VD3A 3MRLB 4G6AC 4NYLB 1UPIA 4IXLA 4GSRA 4YG0A 4NZUL 3HR5A 1RURH 3L1EA 1P4LA 5HYFA 2O14A 1RK1A 4ZAKD 4EF3A 1AQKL 1DLHA 3V55A 4BSJA 2VSMB 2XXFA 1WBZA 1T89C 1R1CA 3B2PA 1QJX3 5EZOL 1W8FA 5AD0B 2WNUC 3PVEA 5CZKA 2XWRA 2AZ5A 5A3NA 3PGDB 2R7EB 1JDAA 5EBWA 3V6OC 1UM5L 3UTQB 5E8NA 2EH7L 1C16B 4JKKA 1OGSA 3VI4A 3VU1A 2BFUS 4NKOB 2NTFB 3AXDA 1I1AA 2X9ZA 4W9FC 5D7LD 1BFVL 2FDFA 4V1DB 1ECZA 2FR4B 1YMME 4XXCC 1IPJA 3FLRA 3GDBA 5GGRB 3KAAA 3EJUA 5TDNA 1O4TA 5E0QA 5HJ3B 3HNYM 2H6BA 5KYYB 3R4UA 4F9LA 4FOMA 2PHWA 1UADC 2ZEYA 4J1WA 3P73A 5IVOA 2VQAA 3WV0A 3DIFB 3GM8A 1AO7B 4HK0A 1XEDA 3BT2L 5DFWH 3ARFC 5IHBA 2VZ3A 4IESA 3IPBA 2FEEI 3C5JA 1QJY3 4WHYG 3TJHC 1N26A 1QACA 5HYSA 5I0WA 1MH5A 1F8TH 3FN3A 1BLNB 1GA2A 3RAJH 5B39A 1IAKA 4FPLA 3M17A 3BO8A 4YNIA 1AYM3 2OYKA 1GSMA 2R041 2QVTA 1V9U2 5CJOL 5JOEA 5GS2D 4UFLA 4OULA 1ZRCA 2FT8A 3TASA 4Z0XB 1YYNA 4BFIA 4NWTH 4OUMA 1DP0A 4HEPG 5JR1H 4NUGH 4QPIC 3IDXL 2VUOA 2Q6WA 1NOFA 3LHPL 4K5OA 4APQC 2LFGA 4JQIH 4XP1H 1NFKA 2B2XH 4WVVA 1GKEA 4PVMA 4IBUA 1MJ7L 3RYRA 1UUSA 4L3EE 1HAWA 4BFBD 3B34A 3CL1A 3KCYA 5AUMB 3VWKD 4FABH 3AZWA 1BQRA 3AY4C 3U4EA 1RZJC 4UM9B 5B7FA 3LRSA 3ZXDA 2CA3A 4TMPA 3RVTC 5JNYA 2CO1A 1UL9A 1N7MH 1ITCA 3D33A 4X4KA 2HUHA 1UB5B 3IFOB 3OBAA 4KV5F 4Y5XC 3VACA 4P57B 4ZNEA 3HNSH 1IGFL 4F8TA 1ND3C 1KCLA 4TULH 2YD7A 5CZXC 5FAAA 5L9RA 1E4JA 5C0FA 3B7YA 3J27A 2B4CC 2W5PA 5DFVD 3LNEA 4MZ3A 3BMVA 4DP1X 2VXSL 1KCUH 5JLZB 4EN0A 2R2EA 3FB7A 3R1GL 4X50A 5FXCH 3TO4B 4NIAA 3H0TA 1J3RA 3LDBC 5JIMA 3L5XH 3NAAH 3SY0B 5FUNA 4U3SB 4OI1A 4N0UE 4QPGC 2JE9A 2P2KA 2WBKA 1GC1L 2OMZB 2XV6B 3GSQB 3OQRA 5I1CH 3WVJA 4GWJA 4CU7A 3QXDA 5LWYL 5BO0D 5IAVA 1L9SA 2I9TA 3PVBB 4PJHB 1AJ7H 3JVGA 4NQDA 1ZIBA 4H8UA 4POZC 1OVSA 3NIGF 2BWIA 4BE5A 1X5ZA 4B50A 4JY4A 4ASLA 3CD4A 3I6GB 3P6BA 1RIHL 4N8CH 3S4SA 5G4MA 4CDXA 5J7MA 4P9HL 1P84J 2MHAB 4KROD 1F6AA 1YEDB 1SQMA 1EAJA 2MOVA 3ARED 3G6DL 4ODHH 3KWUA 2WIIA 3SDCD 3UZVB 3WTUA 1E5SA 3QWQB 5DC9B 2VITA 1MHPL 1RSYA 1Z32X 2XJLA 3RP1A 3QACA 5FV3A 1CXKA 1MXGA 4ZUWA 2J5LC 3W9DB 5CBAA 2WXNA 1JZ6A 4XIOA 1T89A 5I5JA 4CN4A 1O7SA 2QTVA 2E32A 4WUUB 2YRZA 1BV8A 2Q87A 4WO4B 3CJIB 4XAWL 1E4XI 2HYMA 4PJGB 4QRPD 1ZV5A 5DDHB 5E8DH 5AWNL 3D07A 4U1LA 1ZA6B 4DPAX 2V09A 4ZW7A 3VX0A 2VW1A 2HFEB 4Y0GA 2YG0A 2FDJA 4XC3H 4I8DA 3BE1H 5MENE 3J07A 4LSQL 1DBBL 4H1LH 1F15A 5TSWA 4Z3IA 3N5AA 3JTTA 3T6XA 7FABH 2A83B 4WW2C 4APXB 5DEZA 2NZ1A 3HN1A 4KJQC 1N2RB 2WQXA 4JHWL 5H35B 3H2PA 1MKFA 2AACA 3DRTA 2BIQA 3IS1X 3MNDA 1RAMA 2C9AA 3SKJH 2ZMKA 1UASA 2LTNA 4F7MA 5CWSA 4P23C 5A3ID 1V7NH 3BUTA 4LARH 1KLUA 4U4IA 5F7EH 5BZWB 3U9PH 3KF5A 3ZM8A 3OXRA 1BM3H 2B9AA 1AYRA 1JS9A 1N5YH 5BVJA 4NKDA 1M6OA 5BZDA 1U4FA 2KL6A 2VJ0A 5I71C 4NJ9H 3N9LA 3N44B 3O0LA 1T2QL 1U95A 5E99H 2CBQA 4UXAA 3WFEL 3OY8B 1N70A 2WQAA 3D12B 3GBMH 4R7NA 5EN2B 3T4AB 3TYFA 1K5MB 5FK9A 5G55A 1W39A 2BDNH 2G3XA 3PDOB 4Z7QE 1O3TA 3T6VA 5DLLA 1DHKA 2YIHA 3SPIA 2ARAA 1V70A 4ADIA 3CMGA 4KO9A 1S4CA 1TCRA 1ASPA 3SKMA 4QRRD 4D9RE 3R4DA 2AJUH 1N64H 4U36A 2DJSA 5F70A 2XN0A 3MV7E 2OMYB 2WXIA 5AAMA 1W9SA 3QO0A 2EIBA 1IO4C 4HJ1A 1YWKA 3MJ9A 1O3QA 1DN0B 4L1BA 3DWTA 4AVVA 3SCMA 1F58L 4IETA 4DF9A 3RG1C 3ZE1E 1EDHA 4JR9H 4MLOA 1I4FA 4JHAL 1EPZA 1NMCB 1TJIH 4ABQA 4YPJA 4MZUA 4QGMA 2PTMA 4U6XB 4H1LG 3IFNH 4P5SA 2ZAGA 4RISH 4HUXA 1FVDB 1FYTB 3ARFD 1R082 1FORL 3CK0H 4KGJA 1BVLA 3S5ZA 3BAEL 3FPXA 3FUHA 5K9OB 1AR91 4JFFB 2H47C 4N25A 4W6YA 3ZPYA 1Q94A 4MD5A 4FLQA 4WVWA 1GR7A 3FCGA 2W07B 4E9YA 3H8RA 4YDVA 1RJYA 5A7SA 1CE6A 1U8HA 3D48R 3CDYA 3EGXA 1T1WA 4ODSL 4D0BA 1TTRA 2IWFA 1JK8A 2WLZA 3GS7A 2NM1A 1NGZB 3POCA 1Q8PA 1UD6A 1MUJB 3JZYA 1MHCA 4MG2A 2IO5A 2LTQB 2JDHA 4XAAA 1T1YB 2VLLB 3AM8C 3DPBB 4LVOC 4UT9A 1G8WA 3VHOA 2I9LB 3US9A 3EBRA 3MF6A 4Z5RA 2DMCA 5ACA1 3LWCA 1CJYA 3P4OA 4YDZA 2X4OB 3RTQA 1LQBC 4OT1L 3K8LA 1ILUA 1CE1L 3OTFA 2Q8AL 4A68A 2N0KA 3BVXA 4X4ZA 4ZTEA 5DN2A 4PWJA 4X99A 1C08A 4ZUSA 5JXED 3BH8B 3RJRA 2AK1H 3R4SA 3HS8A 1T5XA 4OLEA 1AGFB 1GMMA 3V52L 4Y2DC 4OFYA 5FYLE 3Q3GA 2XXGA 5DUPL 4OGAD 3ABMB 4ATEA 1G86A 5AB9A 2HTKC 4FG0A 3HG1B 1EO7A 1YYLL 5AAWA 3MODH 4DOHE 4F37F 1HQRB 2FJGB 5E70A 4GW1A 1N1SA 3UL4A 1OHFA 1K6QH 4H8QA 5IW6B 3WLBA 2FJFB 3U2IA 4E9XA 4OI2A 3AY2A 3WHXB 1NFIB 4J4PA 3SO5A 4WW2F 1R3JB 2H5UA 4PJ8A 1E5ZA 1Q9WB 5F6IC 5AYUH 4G82A 2RG4A 3ZTNH 5LK7B 2LU4A 5K0UC 4PBOA 2AQRA 5DPNA 3WNKA 4EKJA 4NO0A 1ED3A 2RE9A 3NSFA 5SX4H 5KUKA 4AMWA 1NFDE 1YJLA 4NQED 5C09B 1P5UC 1R4XA 3VW3H 2X12A 2B4CH 2R16A 4A42A 5E6YA 3O3AB 5JXAL 1IGYA 3CZGA 3N36A 4Z23A 3V0AC 2RS52 4X0NA 4K3UA 2HWC3 4LSDA 1AF9A 2V72A 1BJQA 3CSBA 1DZRA 1V6MA 4KXBA 1HIXA 2E7LC 2DVFA 2HG0A 4JFDA 3IDIB 1Q0XL 5C0AA 5FO7A 2PWGA 4E41B 2DIEA 1P4IH 4XGZA 4F2MA 3UL2A 1AY1H 1GH7A 2RS31 1AXSA 4BE3A 4HIIA 1BIIA 2ZWSA 4HHGA 3KT1A 2BO0A 3SGJA 2QTWB 5ISZB 4KFZC 2XUEA 3ZXJA 1Z0NA 1R3KB 5D7IA 4RYDA 2RR12 5HDOA 3HS9A 4HK8A 3PWPA 5FKCA 2WNEA 8FABB 4IMLB 3JWDL 2BSRA 2E76C 2VH5L 1T83C 3FL7A 2YPKA 1G4RA 4G7YH 3IAGC 3CFCL 3HKZA 2KR2A 2QDRA 4Z95H 1H8LA 3FT0A 3ZKMC 5CBEB 2WZEA 3H7YA 3IKCA 5TF1L 3P9MA 1JV2A 1JVLA 4KZEH 4Z7WA 3FUDA 2AMGA 1H3UA 3QIUD 3L7FB 1X5XA 4H8VA 1WA2X 4M1GL 3APNA 4NSKB 2OMWA 4BE6A 3VSTA 3DOHA 1RIVH 4U1HB 3PV6A 4IRZA 3EXUA 4HANA 4NRMA 4WW1A 4FNLH 5IHUL 3N7KA 1X7TA 2WQ4A 2VZPA 4KL1A 4RS5C 3VN4A 2FGWL 2X7LB 5CF3A 1E5HA 5AW3B 3HI5L 4HIHB 2ENJA 1AYN3 1TME1 4EUPH 3H8XA 5DZOA 3FBYA 3TIDB 4X83A 3QXUA 5DHXB 4NZFA 3K75B 2RV9A 4I87A 4OBRA 4WENB 5C09D 3KLAB 3UH8A 25C8H 4QOKB 1A9BA 1ONQA 3QDMD 4FFVD 1O6VA 4JFUA 3MRRA 3MGTA 1SMOA 4DQOL 4Y89A 3PFUA 5FMCA 3JSSA 1ML0A 4N3TA 4FPGA 4KKPA 3VBFA 3PXHA 4YAQB 1IE4A 1R3LA 4O9HL 3FMGH 4DGIL 3HMXA 4C4KT 3WHE0 4Q9QH 4MGQA 1URLA 1EV13 2OZ4A 1BK1A 3TVMC 3GHBL 1GYUA 5CN2A 1OD9A 5IQOA 5C5UA 4A44A 2X4NA 3WNOA 4Q0PA 1W3VA 5FZBA 5I66B 3KYMB 4I77H 3NMEA 4XNZC 3VTTA 2RGSA 3VUAA 5CUSL 3NTCH 2ZACA 4HC1L 2QR0A 3T2QA 3IVKA 5D8AA 3MKGA 2GJ6A 2E7DA 2C34A 1ZZ8A 4R9CA 4FI9A 1UYWH 1C5IA 1EYBA 3BGFC 4WI3A 3GXPA 4NNXB 4PWFA 4WV1C 1AR82 3VXNB 1S9WA 5BYNA 1OLZA 4LVNB 3O4LB 4OJCA 3ARVA 1FZOB 1DJXA 4CDWA 1AZZC 2VBBA 1KCKA 2MOGA 4XPBH 5FDWA 3VXUE 3QUZD 3EO6A 3MR9B 5EEXA 4Z77A 3BC9A 2HWB1 4ODUB 1PX8A 4LOTA 4Z7NB 3Q6GH 2P17A 5E94B 2NY4C 2Y2YA 5DRNA 5BXXA 5C3QA 5DMKA 3QDJA 1YN7B 2F74B 3EDEA 1FPN2 4KI5M 2BUKA 4HWBH 3QQ3B 5FYIA 4GS7C 3WHE1 3U1XA 4LDCA 4OCXH 4EOWL 1FFOA 4YW3A 5ENWB 5D6DC 1WIOA 2PW1B 1TJHH 5FCCA 4O9GA 1J0HA 5K9KB 2IUWA 2PAMA 1GU3A 4BU2A 1U8JA 3NCXA 4H1LA 1LOFC 4TTDC 4HWZB 1WRFA 4GZ9A 2PTTB 4LP4A 1AS6A 3SGJC 1E4KA 5CU5A 3SGDI 4F93B 3JQXA 2HTKD 2FH8A 3RYKA 3BJLA 4AEDC 2BM3A 3QJTB 4DXSA 5JHMA 2XPJA 5GRJH 2J1SA 2UX6A 1MQTB 2JX9A 3JBG3 3KMHA 4DVBB 3V56A 2RFXA 3VRJA 1D6EA 1V00A 1B0GA 4F2ME 3BKCH 2VDLH 3QUMH 4R9HA 4EKXA 5KS9B 2BHYA 2VABB 3LDKA 1I1YB 1N8ZA 2VDOH 3CDZA 3N1FC 1OL0A 1KUMA 3O3EA 3SYPA 5J06A 4UF0A 4Y1VA 4NC1C 5E4OA 3VFOA 3K91A 4NBYB 4EI5A 2X70A 1N6UA 1GZPB 3QG6B 2UVEA 1C8PA 4KNQA 5SWSD 1RURL 1FO0B 4L4JA 5KS9E 1MS9A 1BGXL 2HWF1 3MRQB 5HJGA 4PAZA 3IPVA 1AP2B 1G7IA 4EI5C 4KG0A 1W8OA 2CKBA 2CMRH 4M61A 5CFCC 5ICXA 1Z5HA 2YUWA 1NLDH 3ZBMA 3ZYIA 1OOAA 3WY6A 1WCBA 2BSTB 2NY1C 4DEPB 3W82A 4DFSA 2AV1B 3LSOA 5DUUA 2D7TH 1RI8A 1AL21 5MEQA 2D0FA 2WXOA 4LLOA 4TUKL 2V17L 1LEDA 3LEYL 1POV3 3NNLA 5HHOA 1B35C 4NRYB 5KSVB 4P5HA 5D7KE 5A3PA 3NT0A 1ZS8B 2J1ZA 4EJRA 5CFCB 2IH8A 4YGVA 2VJ8A 3NCYP 9CGTA 1V27A 2AJZB 3O4OC 5CSZB 2XXCB 3HE7A 4ORGA 3VZOA 4R7DA 5CEYA 3VD2A 1SLTA 3D0VB 2FSEB 1TZHA 4Y5SA 3WXPA 4P5KA 4RMWA 5IAXA 4OFVA 4GRWH 2JXMA 3T2NL 4LEEA 3VFMB 3ZMNA 3H8OA 4DP9X 1M7XA 2EDNA 4E5XG 1WZ1H 5CGYC 1KELH 1B9ZA 1AAJA 2WGXA 3MNVB 2AMUA 2OYMA 3QIBD 3TVMB 2QEJA 4GALA 1SRDA 5C2UB 5EU7E 5CKGA 3LQAH 4YFLI 4XPGH 1EPWA 2MPVA 4GRWB 5ANNA 4F8NA 4CXXA 3SE9L 2OFQA 1TCMA 3HN3A 4ZONA 1OOPB 1F90H 2Y1VA 4C57C 5AVZB 1GWLA 4ATFA 3AMPA 2Y38A 4N9OB 5FPBA 4QPGB 1SJHA 5EO1A 4H26B 1CF8L 4TLUA 4QB1A 4MAYC 3G5VA 3DI2B 4NCDA 3WFCH 3PVNA 4BISA 5IBUG 2YRBA 5I19L 2XX1A 4LF3B 2P47B 1G7MB 3BPNB 4QTFA 3W0WA 2CDEB 3I2DA 4BH8B 1H8OA 1WA0X 1DQ5A 1QWNA 4IU3B 1CGPA 3MOQA 3RX8A 3QFDB 2H1LM 5FMDA 2OZ6A 2X4PA 1QLFB 4WFGD 1YYMH 5GJTH 4ELMF 1AD9B 3AJYA 2NY4B 3VVWA 5FO2A 2XWEA 2CL2A 3P1IA 4ARYA 1JUFA 3H6JA 4JDVA 4ZAKB 4BK5C 4J3UA 1JRHH 1NC4B 3L5WB 3RURA 3U1SL 3VAEA 1KB5L 1WFTA 2G60L 3HG4A 4MCNA 4UTAH 2VVDA 3GMRB 1W8HA 1XNBA 5AG8A 4LO6B 4RFRB 1O75A 3DPDA 3ME0B 2G9HA 3ARWA 1IQDA 3QRBA 2VNVA 2YAOA 2P3KA 1IG0A 4OGZA 5LCVL 3NV2A 4Y1YA 5J37A 2FMYA 4OYUA 3GBNH 4NN7C 5HHVL 1XXNA 2VCCA 5KANI 2JI3A 5E6ID 4JDMA 2BHZA 1C7SA 3TBTA 3H3PH 3CSFA 2D3PA 4B0MM 1WQVT 1T04A 3FOMB 4M7KH 3ULVD 3BVNA 3ETSA 1ULOA 3LKRA 3L95B 3P54A 4P04A 4PRBB 3ZTJG 3MO4A 3BSZA 2W0KA 4PJBE 4QX3A 1MG3C 1QHOA 3H2QA 3S5YA 2PABA 4DB5A 3H1WA 5FP9A 3IMRA 1JYTA 5FXXA 3ZO0B 2QQNH 3DK2A 5DDJ1 5FZ3A 3WP5A 4LOFA 3DX3A 2AEQH 5FYKE 2P5PA 1VMHA 4FA8A 3ARFB 4P9HH 3WAKA 1GOGA 4LKEA 2XTJD 4XNUH 5GZCA 3FZUD 2GITB 3N7MA 1LO3L 3DO7B 1JPGA 1M2VA 3GHEL 4PV9B 1BQHA 3G5ZB 2WQZC 1QO3A 4WFGE 1J0JA 5JXAH 3V64A 5CN1A 2DJMA 3JXAA 4IHOA 4NQCB 1NCRA 2OJZH 4U7SA 4DEWA 4KRMB 3M2MA 3QC6X 4XCFL 3RLSA 3RGVD 2P8MA 1I8KB 4NPYB 4OVEA 2YKLL 1MZ5A 2Y3NA 5J0BA 4AUJA 4F33A 5E8OA 4S0HA 3I6KA 5DQ9A 4U6VL 3GBGA 1FYTE 5HI4D 3JZ7A 3KV5A 4X5XA 1T7VA 3CHXA 3FW6A 4J3OD 5E8EB 3CN2A 2OJEB 2E4FA 5EOQH 5K33A 3D1MC 4KZCA 4JHWH 5FUZL 1MLCA 4Z3GA 5L0QB 3CU1A 1L7IL 3U30C 5EIIA 1YQCA 2KPNA 3TZVC 1BEXA 1KFAH 4Q0SA 4OVUA 5FZOB 1NCTA 2FNWA 1NCAH 4NPKA 4JCWA 4XBNA 4R84A 2YAMA 5EEYA 3MJ6A 4XPFL 4JRYE 5DTFA 1MNNA 5I91A 5A7BA 1VBE2 1EDYA 3BPZA 2RDNA 2A6KB 2RQEA 2YD4A 1L9OA 2GAZA 2JKTM 4BD4A 3W2DL 2VDLB 3QUMB 2W8CA 1NCCL 1U8LB 2ZX7A 4FQIL 1W72L 4NQQA 4NO2A 4RZCB 1WCQA 3VH8G 2DS4A 3U79A 4MMYB 5I0SA 1HSAB 3KYNA 2HWZL 4GD4A 4WVRA 5JDSA 2K4WA 3U6XA 1ZYBA 1JGDA 4FG2A 4LLMB 1MR5A 2V5DA 1TVDA 3GXFA 3ZDXB 3M3IA 4DUWA 2HLFC 3HI5H 3E38A 4K15A