2ZAHA

X-ray structure of melon necrotic spot virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
296
structure length
296
Chain Sequence
SVKIVHREFIASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGSTSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAVDRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGSTIKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVTSSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Melon necrotic spot virus
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein
total genus 67
structure length 296
sequence length 296
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zahA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zahA01
3JB4C 1R1A3 1C8M3 2HWE1 1FOD2 2XBO2 5A33A 1AYN1 3S6PA 2X5IB 1H8TA 4JGYA 1ND3C 2WZR1 1MQTA 4YVSA 1ZBA2 2R062 4Q4Y3 4IV1C 1ZBE3 4Q4V1 5FMOS 4CDWA 1HRV1 3TN91 4N53C 1B35A 4CDXC 1BEV1 2RS51 1EAH1 4FTBA 3ZFEA 1K5MA 1R093 1AL21 2R071 4RHV2 5L7OB 4CDUA 2BPA2 1QJU1 1PGL1 1RUD3 3VBRB 4YVWA 5D8AA 2PLV3 1D4M1 1FPN3 1RHI2 5K0UB 3CJIC 1ASJ2 3DPRC 1RUH2 2IZWA 1RVF3 2WFF1 3JBG2 4QPIC 1ZBE1 4GH4C 3VBSC 1QQP1 1HRV3 3TN93 2WWSA 2HWD3 1AYM3 1QJY2 4N43A 3VBOA 1Z7S2 4Q4Y2 3ZFFA 1PVC3 1RUG2 4WM7C 1VAKA 5CFDB 1QJZA 5FMOL 2BFUL 1NG0A 2FZ2A 1QJU3 2MEV3 1R1A1 1R091 4RR3B 1AL23 3VBOB 4RQPA 2R063 4Q4W2 1HXS2 2VQ0A 1ND2C 1HRI3 1FMD2 3NAPB 4Q4W1 3LOBA 4N53A 4CDXA 1PO11 2Y26A 1F2NA 4LLFA 4WM8C 3DPRB 1HQNA 3VBRC 3ZFGA 1TME2 1NA1B 3IDEA 2RM23 2WS93 3J8F2 1RUD1 1VBB2 4CDUC 1BMV1 3VBSB 5BNPB 1M06G 4JGZC 2RS11 2MEV1 4QPGC 1RUD2 1VBB1 4CDQA 5CFCC 5BNOB 3VDDA 5BNNC 4PDWC 1E57A 1RVF2 4GH4A 1AL22 2HWD2 1CD3G 3VBSA 1QJX2 1C8NA 1ND3B 1QQP3 1RUG3 2XBO1 1PGL2 1VBA2 3JD71 4BCUA 2HWC1 1R082 4CEYA 4WM7A 2WS91 5C4WA 5K0UA 1ZBA1 3VBHB 3VBFA 2RR11 1QJU2 5C9AC 1PO21 4RHV1 2RM22 5ABJB 2GH8A 3VBHA 1RUC2 1VRH1 5J98B 1FMD3 1X33A 2ZAHA 4CEWA 1R083 3VBFB 1AR92 1PGW1 5A33B 2WFF2 1HRI1 1ASJ1 1COV3 4YVSC 4AEDC 1TMF2 1OPOA 2WZR3 4IV1A 1POV1 1AUYA 1RMU1 4Q4X3 2RS33 1AR63 4NWWA 1Z7S1 1C8M1 2HWE3 4RR3A 2RM21 4PDWB 2X5IA 4JGZA 4QPGA 5GKAC 1K5MC 3JBG3 4FTEA 1R1A2 1VBC1 1B35B 2ZZQA 5CFDC 4CDQB 4PDWA 1HXS1 5L7OA 5JZGA 4Q4Y1 1QJX3 1VB2A 1MQTB 3FBMA 4GB31 1NCQA 1FPN2 1AR72 1RHI3 1NY71 3CJIA 1D4M3 2RS12 4CEYC 4QPIA 2TBVA 1VBD2 4RS5A 1RB8G 1PIV3 1RUE1 5C4WC 5K0UC 1VBE1 5AC91 4YVSB 1BMV2 1POV3 1RUJ2 2HWD1 4GH4B 4Q4X1 4RS5B 1AR62 1VB4A 2R073 4IV3A 2RMU2 1AR82 4Y4YA 4CEWC 1V9U3 1NCRB 5DDJ3 1ASJ3 1R081 2PLV1 1F8VA 4GMP1 4NWVA 3J8F1 1AYN2 1HRV2 2RS31 3TN92 5C8CA 1ND2A 2RR12 5ABJA 1GFF2 1Z7S3 2WZR2 1EAH2 1AYM2 1RMU3 4RR3C 1AR61 4N53B 4CDXB 2HWC2 2XPJA 1PVC1 4WM8A 2BBVA 4CEYB 1FOD1 1VBD3 1QJX1 1OOPA 1PIV2 1PO22 3VBUA 1VRH2 5L7OC 5JZGC 1NA1A 4SBVA 5JZGB 3JD72 4Q4W3 3VBUB 1HXS3 1AR91 1PGW2 4WM8B 2RS13 4JGZB 5BNNA 1EV11 3CJIB 5LK7B 1NCRC 5ACA1 1QJY1 1RHI1 1VBE3 5AC93 1VBC2 4RS5C 2DF7A 1DDLA 5BNPC 1ZBE2 1QQP2 1VBA3 1V9U1 4IV3C 5BNOC 1C8M2 1RUF3 1WCDJ 5DDJ1 2QQPA 3M8LA 1AR83 2RMU3 1COV2 3VDDB 3HAGA 2WLPA 1V9U2 1NCQB 5D8AB 1EV12 1VBD1 4JGYC 1ND3A 2RR13 3VBHC 1MQTC 1RUC3 5ABJC 3JD73 1CJDA 4GB32 3ZFEB 5C4WB 1RUG1 2XBO3 4GMP0 4AEDA 2HWC3 3ZFEC 4EJRA 5ACA3 1COV1 1RUI1 1OOPC 1MEC3 1POV0 4Q4X2 1RUF1 3VBUC 1AR81 2RMU1 1NY72 1NA1C 2X5IC 1HX6A 2HWF3 5CFCB 5A32B 4Q4V2 4QPGB 2R041 1FMD1 4WM7B 1RVF1 2WFF3 2HWB3 4FTSA 2MEV2 5CFDA 5BNNB 1VBC3 1BBT3 3NAPA 1MEC2 1PO12 1TMF3 1EV13 1RUJ3 4IV1B 5J96B 4CDWB 1OHFA 4N43B 2R072 1QJY3 2RS32 1NCQC 1TME1 4N43C 3VBOC 3ZFFC 1RUF2 1AYM1 2HWB2 2PLV2 4JGYB 5BNOA 5FOJB 2GSYA 1VBA1 2BFUS 1RUH3 2R061 5ACA2 5C9AB 1SMVA 3JBG1 4RQPB 4FSJA 2WS92 1VBB3 4RQPC 1MEC1 1OOPB 1HRI2 2ZTNA 1IHMA 1AR73 1PVC2 4QPIB 1D4M2 1RUC1 1H8TC 1TMF1 4GB33 2R043 1AL0G 1PIV1 1RUE3 2HWB1 4Z92B 1X36A 5C8CC 1BBT2 4GMP3 4RFT0 3VBRA 3ZFGC 1PO13 4CDUB 5C8CB 2FZ1A 4CDWC 1A6CA 2HWF1 4AEDB 1B35C 3JB8A 1FOD3 1RUI3 4Q4V3 1RMU2 1K5MB 1RUH1 4CDQC 4Y5Z0 1RUE2 2HWF2 5DDJ2 2BUKA 5CFCA 1VBE2 5AC92 3VDDC 4RHV3 4YVWB 4IV3B 5A32A 1ZBA3 1RUJ1 1AYN3 3ZFFB 3NAPC 1FPN1 1AR71 1ND2B 1TME3 4YVWC 3ZXAC 5D8AC 1BBT1 1RUI2 3J8F3 1BEV3 2RS53 1EAH3 1AR93 3DPRA 1NCRA 1R092 2R042 1W39A 1PO23 5BNPA 1NOVA 3VBFC 4CEWB 1VRH3 2HWE2 5C9AA 1H8TB 1BEV2 2RS52 3ZFGB
chains in the Genus database with same CATH superfamily
5C2BL 2JI1A 2AK4D 1IL1B 1ULCA 3UDWA 4E4HA 2DLFL 4DP7X 5J1XA 3MMEB 2VR4A 1MS1A 3HKZA 5L8LB 5BRZE 1K45A 3HUJA 5DQ0A 1DYPA 2CLZA 2QFPA 1TNNA 4OSUL 1NIFA 4PCKA 1Z9SA 4HISA 4EI5D 2C9KA 3WXVH 2YGMA 3O2VH 4HAKA 3V0WL 1A1MA 2ZKYA 2ODIA 4KNCA 5AKSA 2WLLB 1HZHH 4JO4H 4MNHB 1FUNA 2PUQT 1KCUH 4H0HB 3D5OF 5T1LA 1AS8A 3U0TA 4LCWA 4BH7A 4IGPA 3LEGA 5ETUA 3LH2L 2KLRA 3ZE1F 2RB8A 3B7UX 5D5MA 3VD0A 2RS51 1S9KC 1WICA 3I6LE 3V6FB 3WFEL 3LA7A 1N10A 4Y5TA 2VTXJ 4KX9A 1OAQL 3MBEB 3QJHA 3TWCL 5F9TA 3M8OL 1F6LL 3K8KA 3EDKA 4QRPB 1GNZA 1FORL 4N8MA 4BZ4A 4AQZA 4MBRA 4EZMA 4XFIA 5K7PA 1WWAX 4PTTA 4ASLA 1NUNB 1QFUH 2YD2A 4UF0B 1CXFA 3PGDA 3FMGA 4GXUM 4PGCA 3OG6B 1T6GC 4YVWA 5T3ZE 5ILTH 2CKNA 4GRLA 1J9RA 5D8AA 4UTBL 3TZVA 3F95A 1I4FA 4CAGA 2E7QA 3CSBA 2G4IA 5B39A 2JXMA 3ZDYE 2AV7A 3C6LA 3DPRC 5JA9A 3T04D 4HIXH 4XNAA 3S35X 4DK3A 1H2KA 5I8TA 1MFAH 1W72A 3RPKA 2HX8A 3FTWA 3BD4A 3H3KA 3Q6FA 1SQ2N 4H8VA 3BE1L 4NPRA 3FT9A 3MLYL 1AHWA 2FE0A 5EOTB 3ZRSA 2XQXA 4JY5H 4KDWA 2WWKT 3MRRA 2PAMA 3MV8E 4XN5A 3POIA 1LJ7A 1TQSA 4P2QD 4NQEA 4Q26A 2PWEA 1PLBA 4AK2A 4AI2A 1PFCA 1U2YA 2JCCA 1AR1C 1GMIA 1XGZA 3NFSH 3QJTB 4HUUB 4JM0A 4XC3L 5SWZB 5J7CC 2HBTA 4XFGA 1WCBB 3GD1C 1A0QL 1VF5C 3TOPA 1OT1A 3INAA 4RR3B 4WRLA 2H6CA 2IWKA 4UU9B 3T3MB 2A5UA 4P2OB 4PHXA 3KQRA 4R52A 3CQOA 1E9QB 2Y6KA 3US9A 2ZCLL 5FFOC 4G9FE 3CVHL 4NWTL 3FQTB 2H6OA 3C2AH 4DTGH 2L9LA 3NCXA 1YEKL 4XXDA 2B1HH 2J6EL 4P2QB 5FFLA 5KSVA 2VW2A 4L18A 5GZDA 3VLBB 1F4XL 1ODAA 1U92B 4YK4B 1J0JA 3WE6B 3PDDA 1Q9KA 1BF2A 4XOEA 1G9NC 1LGVA 1N2RB 3LE0A 4XABA 2N7GA 3HB3D 3D82A 3C60A 3QUXB 3L2YA 4PJYA 5IF0B 1DBBL 3C8DA 2EUVA 3DF0A 4M5SA 4P2RD 1BZWA 4KMTH 2ZAGA 3TO4C 4LRNL 2VUOA 3WFDH 4J23A 4KZEH 5D7IB 2DWRA 3OKYA 5BNOB 4PB0H 1UZVA 2CMRL 5AZEL 5T3XH 3F5WB 3OGJA 1DBMH 4G8EA 2XQRA 5DUBB 1IV8A 3OHXC 2CDFA 4X9YA 3CU7A 2VMDA 2OFQA 1CD3G 2VW6A 1AG6A 4G70B 5D7JC 2NMOA 3NIFF 2OIIA 2YAQA 3QUML 2W92A 1ND3B 5I0WA 3ZT7A 1HESA 1OSPL 3ZDXE 2D73A 1VBA2 2PTVA 1E4XH 5SV3A 4CEYA 1RVFH 4QIRA 4JO1L 3AZUA 1P2CB 3FB7B 1AJ7H 3GSRB 3OM3B 3WN5B 2WNUA 5FFGA 2V17H 5ITFA 1O7FA 2DB8A 1UT9A 3VU1A 1WUNT 1W3VA 4OFDA 1DSFL 3QI9C 1KIUA 3VBHB 3BAYA 2IFWA 4ZAKA 2X70B 4JHAH 1HQ4A 3WIFA 4HKJB 5BJTB 1WF5A 3LN9A 5DA4A 1V3JA 4BINA 2XIBA 4DP1X 1AZRA 4P04A 1O8PA 3B7YA 3EGXA 4RHV1 4EF3A 2GH8A 4XQ4A 5JSOA 3L9RB 2DJUA 3RWHB 4M6NH 1MRCH 5AW0B 2ROYA 1PZ3A 3PU7A 4G6JL 1JPEA 1HVXA 5FF6A 5FPVA 4A7VA 5GZFA 2ZEWA 4MX3A 1KENL 5BY5A 5DG2A 4LSUH 4LBNA 1M4KA 4OCNC 4WW2A 1JNJA 4IGOA 1FC2D 3GEFA 3N1PC 4ISRA 4E4SA 3THMH 5C86A 1RUNA 5A7QA 3P3YA 1POV1 1UIKA 1CFTB 3TX4A 4I77L 4WQOA 2ZGPA 4RRPG 3U48A 3EO9H 2VR8A 3HRZB 2NMNA 2B4CC 1SJXA 4Z7VA 2FDGA 1NL0H 2C4XA 2EQDA 1MHEA 1U8NA 2AV1A 4QXTB 5DGRA 3ROLA 1C1LA 1KTBA 4QPGA 1JE6A 4PW4A 2MJWA 4MB3A 2G9GA 2WYHA 3SY6A 3OBZA 3QCWA 4Y2NA 2Q5BA 1QNIA 1U9KA 4HAGA 4L4VD 4XVUC 4PYHA 4PIBA 5JR1L 5F1IB 3L4ZA 1ETB1 2J1XA 4H26A 4N2NA 4LBJA 1L9RA 3M3EA 2ZSVA 1S8DA 2NYYC 4ZD3L 1ZRCA 2X29A 5DCCA 1WBZB 4EWEA 4M1CD 3G5VA 2BSRB 1POQA 5EFUA 3GXUA 3A5VA 4GKZA 5C3SA 3MYXA 3LKOB 3FYEB 4LIQH 3D1MC 1X7NA 1FA4A 2UY6A 2Y22A 4KY1L 1MY7A 4A66A 4CL7A 4YNIA 4GB9A 4F7CA 1OB1A 4QJ3B 1PM7A 2J1RA 1I7UB 25C8L 1XGQA 1W15A 4HOMA 2UY9A 2FSDA 5C4WC 1W2TA 2F58L 1XH1A 4GQQA 4PREB 1E2ZA 1I3HA 2W94A 4LSQL 2GMMA 3JWNE 1S2BA 1RUQH 4H8HA 5JMCA 3IKCB 3QK0A 1PZ7A 5DQJA 3PP4L 2VDML 1UOGA 2DQGH 1NAMA 2FJHA 2PHRA 4GZ9A 5AB0A 3O3EA 5IB1B 4J25A 2CNAA 2VQTA 3Q1EA 1PMIA 4XDPA 1JWMB 4CVXB 3KYOA 4PW3A 1V9U3 4BQ2A 4D3CL 1AFVH 5GGQH 4J7RA 1RAMA 3BN3B 3D18A 1APNA 1GMEA 5GRVK 4H88H 5EU5A 4NWVA 4N8VG 4R7DB 4MJIB 4U3XA 4ZUSA 1HCZA 4L29B 4E41B 3P77A 2A38A 3QFDB 1X82A 2WLHA 3MA7A 1XGPB 3A3YB 5H8DA 2OW4A 2AEQL 4KROB 4HJTA 3T6VA 5DJ0B 1OA2A 4KK8D 3JQOB 5CKGA 2PPCA 2E7TA 3BPLC 1GS8A 3X14B 3OD0A 5DRXA 1U5XA 1A02N 1UH3A 3N35A 5I1JH 4I88A 4U1KB 2XPJA 1XR8A 4JFSA 4QX1A 2Y7LA 4KWKA 4MLOA 1QKZL 5F5AA 1JVKA 4JL1A 2CL2A 4YGBA 1D6EB 1E42A 4PRNB 3RY6A 3VG0H 3ZKXC 3D0AA 1T0PB 2D6PA 2ORXA 1LOEA 1H0DA 3FU6A 3H53A 1B09A 3UROR 5JIHA 2E76C 3LXAA 4LE8A 4FFTA 5C0BD 1F9KA 1Z0MA 2IPTH 3DARA 1MUJB 1OE2A 3L3DA 4GW1A 4LK4A 3ZHNA 3U2SA 3VBUB 1J0YA 3U37A 1PGW2 1X5FA 3T0AA 4MHRA 4WM8B 2ERFA 2VDRB 1X7TA 1F8TL 2HJKB 4PBDA 2APBA 1MQKH 5FZOB 4DW2H 1EV11 4EJ1C 5FPAA 3MLUL 3F6IA 4JGMA 2IBZX 3GXPA 4NRXA 2EDQA 5CHNA 5T1LB 3NCMA 2YBRB 2PW2B 1UM4H 1V27A 1GU3A 1NCBL 4UT5A 4TPRL 3G6DH 4OF3A 4FQCH 3SBPA 1FYTA 1BK0A 3B37A 3IMSA 3V9FA 5E70A 1REFA 1WSST 3IPVB 4JMXA 5K9KA 1QQP2 2UVEA 4HWBL 1WW6A 2Z7UA 4F24A 3CX5J 1BBJA 1DO6A 2WUCH 5JIAA 5DUML 3NGBC 4Y20B 3T4YA 4AQ8A 3MLSH 2OBGA 3T71A 2CK0H 4BSWA 1SCSA 2W60B 3RB7A 1A6WH 3KPQB 3E38A 4G8GD 4QNPF 3QI9A 5TE4L 2HPTA 2WYSA 4O51A 3BOPA 4L8DB 3I02B 3U36B 3GI8H 5EPAA 4UQ2A 4OF5A 1DZQA 2R4SL 1IGJB 2Y1ZA 4FDWA 3S34L 1PSKH 3QDGA 1WAPA 2V2XB 5EMYA 4A7UA 1LO2L 1XGTA 5CP7A 3NP4A 4XJUA 2JTDA 5DEJA 1RZFL 1UUNA 4NWUH 3TPUA 5KVDE 1BXHA 1T2QL 2DQEL 1AI1H 1MHPL 5D96B 5EU5B 3WIAA 5IMMA 4DFSA 5DU7A 3Q2NA 3X11B 2VXSH 2B20A 4Q0XH 2VIRA 5LEJA 1P5UC 5C4WB 1DL7L 1L0PA 3RJOA 4HJGB 3VYOA 3FQRA 2H0PA 3FXIC 3HMWL 4ZK8A 5L0QB 4LO6B 5B2GB 2FB4H 4HSCX 4QT6A 2PYEE 4JJOA 1QHDA 4TQIA 1OFNA 1KY6A 2QUOA 2R1YA 2XA3A 3RWHA 3UZVB 4G83A 2X40A 1P84J 1DQ0A 3HCVB 3ME0A 5EUKB 4N2BA 2ESVA 1I82A 4ZUWB 3JWOH 4NNYA 3N42B 5CP3A 5FA4A 1SHXA 2GQHA 4C47A 3L3JB 1IG0A 3TH3T 4AFBA 1U8IB 2NZIA 4GMTL 3THTA 4NN5C 5CG8A 1ZYBA 3DUIA 1QLRB 4AEKA 1HZLA 3Q0HA 3PFUA 4TULH 4YUEH 5BOPA 1RFDH 2JF1A 3C6LB 5IFHL 3MV7E 1CD9B 4FTSA 3ILEA 4PLJC 3DJRA 1RZPA 4QO1A 4QQPA 1KB5B 2E6JA 1JYIA 4U6YA 1EV13 1FG9C 5EC1B 2JKSA 2Z65C 3IDMA 2DQJH 4AUUA 3ACGA 1SBFA 1KMGA 1Z78A 1UB6B 3H2PA 4BFKA 2PW2A 1BZ7B 3FSAA 2Y07L 3MCG1 2Q76A 5GZOD 1RUF2 4X8PA 4ARYA 4MNGE 1AYM1 4YQXL 5F39A 3V7AE 2HWB2 3BI9X 5H35B 5AQ0A 1U2CA 4UFLA 2CO2A 1CESA 3KMDA 4LLDB 3U1QA 4DP0X 5MEND 2L7EA 3TLRA 4HC1A 4BRJA 1CYWA 4JPKL 1NDGB 2FWLB 1PD0A 3DI2B 2NQ3A 4JJ5B 5DZFA 1FP5A 1GY2A 4MS6A 3AX4A 1B9KA 3V0BA 5DD1L 3RL2A 2FH6A 3SGEH 5IHBA 1MACA 2KC0A 5I74B 4MVTA 4HU2A 1HWWA 1RUC1 4U05A 5ESQB 1CS6A 2ZXDA 1NIBA 4G3YC 3VXUD 3N9GL 2Z8SA 5CZVH 4JRXA 3VXSB 1A21A 5IMMB 4GAZA 2AQNA 1X36A 4H0IA 4HBCL 4HSLA 3K4ZA 4MDJA 5FZ4A 3KCPA 1Q94B 3AWGA 2XSKA 4HGMA 4AEHH 4FQXA 2WVUA 3CPLB 4R9BA 2ZX6A 4G6AD 2BCMA 1TPXB 4XBPB 3V9EA 1P7BA 5ADPH 1BJQA 1YNAA 4E5XG 3ETQA 4PIYA 5FYVA 1FOD3 4HSJA 3OSVA 4JO3L 1T4KA 1ITBB 2EJ1A 4JM2D 1SVZA 5C9JB 2VDRH 3GSXA 4G71B 2I85A 4P5KA 1A9VA 4BSJA 5FUOH 4I02A 1I1EA 4BE5A 3VDDC 2EKSB 3MROA 1V00A 5AW3B 3Q9OA 2VZTA 4Y4KD 1MCOL 4A6YB 3GMPB 1LQSR 2AXGA 3DBSA 4LBQA 2XH6A 4M9PA 2KYIA 2J8UB 1TME3 2A6DB 1AAJA 1D5BB 1TTCA 4JFQB 2I9LB 2XVBA 3H7BB 4LEOB 4F3FA 4UTAH 3ILPB 5H9SA 2W9XA 2I69A 2D0FA 5DDHB 4AK1A 5CWSB 3VXUA 1OSEA 3ACLA 2RS53 1OVPA 3V4LA 3WF3A 3DETD 1KJ3H 3P3SA 4JKLA 3RG0A 4QD2E 1SLCA 3MX0B 2LAAA 4F7MB 3KVPA 1Q0XL 4J12A 3QYMA 3CFTA 2CO6B 3REWB 1AP2B 4WO4C 1UOWA 2P8PB 4XP1L 4GJZA 1RUPL 4HPYH 5JQIB 1A9BA 2EC9U 5IKCA 1BQHG 3GJEB 1JPTH 3FTGA 4QDQA 2X6AA 3HS0C 4NO0A 3PTRB 4XJZA 1G0YR 3TT3L 2ZUTA 4H26B 4M61B 2D5FA 3CZLA 5H37A 4FXLA 4EI6A 2LAGB 1SEBA 4DEUA 3MLJA 1BG9A 2Y36L 5B4MD 2R9HD 4HH8A 3QIBC 4PMEA 1HE7A 1OE3A 1HL8A 5BUGA 3UGFA 2QVSB 5CFHA 2YDEA 4LRIC 3LIHA 1IGIL 2IEPA 5EDXA 4PLNC 1SZBA 3CVIH 1MCSA 2IWEA 1CFTA 4IRSB 2ENYA 1C7SA 5JPNA 1ZBE3 5M0TA 1D5XA 2OKMA 5EF0A 3F3HA 1CBJA 4B9JA 4CDWA 3N6YA 1ZRDA 4LASH 4POUB 2ES3A 3BUYB 1ZREA 5AB2A 3AB0A 4JR9H 4X7SH 1PY0A 4KROD 3LY6A 2AK1H 4N0YL 4BJLA 2NX5E 1DVFB 2YMTA 1BVOA 1ODMA 3N9PA 3DKWA 4Y33A 5I16B 5A3TA 1C5DA 2F9BT 3VKMA 1R5WB 4F2ME 2WSDA 2ESVD 4FQZA 5HVGB 2PCYA 3MXVH 1GYVA 3MO4A 1VJSA 4GRWB 4RA0C 3CN2A 3Q1SH 2K70A 5EU4A 3O0XA 2N56A 2BGCA 3ARPA 3G5YB 4JQIH 4TL5A 2DBNA 5IK8A 4BE6A 3JT0A 2WQ8A 3N04A 3QNZA 4U1MB 1BZ9B 2MKWA 4WV1C 5D2AA 8FABB 2BY3A 5T1KD 1IS5A 2UWEA 1F58H 1RJZB 2A6KA 1CIDA 1BD2D 2XQBL 3HE6C 4L37A 2RACA 5INDA 1EVTC 4HJGA 1IGML 1OGTA 1V7MH 2KZKA 2WXOA 3KS7A 3VBSC 2D03H 2NY2B 5LJYH 4MS8D 4QU1A 2R0HA 2A83A 2B77A 4OGYH 5DGQA 4RMWA 3DIDA 4EROA 5KVFE 3QFJA 5GPRA 1LDSA 1W2OA 1BQLH 2IVJA 4YBQC 1EFXD 3QI9D 5D6DA 5K1JA 4GIAA 4G8GA 1R4XA 4HVOA 1J7VR 4D7TA 3LHAA 4I2XA 4FP8H 1PDKB 1VB9A 2J7LA 3E3QC 2HRPL 4U1GC 1AX2A 3DXAD 4LCYA 2NN8A 4YWAA 5J6SA 3UAAA 1W6MB 2NPIA 3B7RL 3IBMA 5B4XA 4EUPA 2CU9A 1R0AL 5IBLD 2YEVB 4UBDC 3OF1A 1R091 1UA3A 2FHFA 2IFFL 2HFEB 4DGYL 5LKNA 2HMIC 4IHBA 4HL0A 5I8YA 3PWJA 4I48A 4FLSA 3HR5A 1UX7A 1QWNA 2Y34A 3S3SA 1ACYL 2KR2A 5CU9A 3ZE0B 4U6YB 4X50A 5DVPA 2XQ0A 1CDIA 2YG0A 4GXLA 3POJA 4A6YH 5KSAD 3DX8B 3QHFL 4BZ2H 4PRBB 3MV7D 1BFTA 5IMOB 2Y7QB 3U1SH 5T33H 1NE4A 1T5XA 1VMJA 2JQZA 3MF9A 5E5RB 3WEXA 5F8PA 1U8KA 1WFMA 4JPQA 2F17A 2VXVH 2LR4A 5EN2A 2JECA 2HTLD 4IBSA 2OMNA 1F97A 2Y06L 5TFSL 3RU8L 3VD2A 4A3XA 3T6WA 1J1XL 4Z95H 1AE6H 3IDEA 4NUJA 4KTEH 1TJXA 1CJPA 2GK0B 4PJ7B 2X4OB 5C92A 3IRPX 4XUPA 3RSJA 2GC4C 5EP9A 2JFCA 3MUHL 5C3IA 5CADA 4WHYH 5ERWB 2XFGB 4V1DD 1MS9A 4H1LH 3O5SA 4EWAA 2W59A 3VDDA 4NHYA 2B59A 4ZFZB 1OD3A 1UXSA 3ML8A 3MCLH 1EEYA 4JFDE 4YHYB 3S5ZA 4ZMAT 3E6CC 1QIQA 5EOQH 1HB3A 2ZG3A 4BMEA 4XQDA 3I2CL 2Y6SD 4GBXC 2ZX8A 2AHIA 2J43A 5FYKD 1N0LA 4QHNB 1DHKA 3NH7L 4HMDA 4OV5B 4FGMA 4HQQL 4ZX4A 3HG2A 1CXHA 3T0EB 4M7JH 4P4KD 3UIZA 3HTLX 1KYFA 3AT8A 5HYJE 3WF1A 1UOKA 3WW1A 3GLAA 4KK6C 4NZJA 2H0FA 3CVCA 4GKOA 1TQTA 2VITA 4IU2A 1ZGLP 1AVBA 4JRWA 2J8HA 4HUUA 4TUKL 2XN9B 1YLLA 2VZ3A 2XWJB 2OL3H 4GXVL 1XQNA 5EF1A 2FDFA 2RR11 5A2BA 3WW2A 4C55A 4YDLC 3FQYA 3JVGA 3ZIXA 1D3CA 1S7QA 3QRGH 5DO2D 4EIBA 1RURH 3MV8A 3C09B 2N1KA 1IFRA 4J3XA 1KS5A 3RFZC 4Z8BA 5AAWC 1VZIA 4U6VL 5BV6A 1QWUA 2PXYD 1KTKE 5D2LA 1SYSB 2OQ7A 4JDNA 2WQ4A 2Z5WA 4XMTA 3OY8B 2DFBA 3BLPX 1DBKL 4WFGE 5J13B 1TZOA 5F8RC 5CR1A 5C3LD 1WZ1L 1IGYA 3PWUB 1U8MB 4LAQL 2DL9A 2WWOA 2UWCA 3HQUA 4XNXH 2QQQA 1W8NA 1PKQB 1VGEH 2BX5A 3U82B 3H6JA 2XGXA 3VQ2C 3UK9A 5MP6H 1JHKL 2ZG2A 1UD3A 4PSRA 1KGIA 2B8MA 5TE6H 3BUIA 1OPOA 2KERA 3JTSB 3QIWC 1ZE3H 3MPPG 3HCVA 3JVFC 1BA9A 3DOHA 1OP5H 3HN3A 3WE6A 4XZUB 3C6SA 4G7YL 2HWE3 2I60H 3APBA 4F9PA 3IDAA 2JE7A 4PDWB 3NQHA 4Q74A 4I1PA 2IWFA 1WQVT 4NT6B 2B4CL 2FX8H 3FQWB 4OCWH 4JQVA 1ZA3B 2DH2A 1ENXA 1HEZA 1GZPB 5E9DD 1NAKH 2A6JA 1YPZA 2RFXB 4GQ7A 4BPZA 3OAZK 2NY1D 5E2UL 2A1XA 1O3QA 3LX9A 3I84A 1HEJC 2A6VA 4W9EC 5ANQA 2P3KA 3VFMA 4BKTC 2VECA 4HJJH 3T2PA 5KXEA 1I9RL 1NIAA 1PKQE 5D1IA 4Z7OF 4XVJH 3QFJE 3S37H 4NR1A 4JRXB 2YPVA 2CSGA 3H0TB 2X0VA 4CVUA 3IXTA 2NY3B 2V33A 3CX5K 5D5MB 3VFSA 3GJFH 2RS12 3BN9C 4URTB 3BAEH 1F4WL 5G5DB 4K2UH 3TBYB 2TBVA 1FLTX 3IRCA 3OX8B 2XY1A 1FVDB 3AU0A 4ODVH 4RAUB 2HUEA 1IAIL 1G7PB 5EWIL 4S0HA 4HJ0C 4DO4A 4IS6A 4PP2B 4IRSD 5AC91 1TQCB 5GS3A 4AYFA 4DEPB 5CD5C 5D72L 3QEGH 1WBXB 2EIDA 1BF8A 3KGSA 3Q9QA 4R4ZA 3RY5A 2ZUUA 3UFIA 3ZKMC 1AR62 1REDA 2WL1A 3FU9A 2P80A 3B7MA 4NN6C 1HSAB 2XJLA 4W4ZA 3DUUB 3HNSH 2Y1VA 4LCUB 4OFIA 4QXUH 3RVUD 3O3AB 2HKHL 4M48H 3WJMB 5J37A 1G6RH 2V4AA 1JGEA 4XMUA 2Q6WB 2CHDA 2OMUB 3UH8A 2Y6GA 5HVHB 1IG3A 1VERA 3ZYJA 4JDOA 1AS7A 4P46A 1NC4D 1G9CA 1PM4A 1J1TA 1M7IA 1EO7A 3N1FC 2OK0L 2YXVA 4NUMA 2NLRA 5DJCA 1W6QA 4MJID 1QBLL 2MNUA 4ODUA 3ZKSD 3P3TA 4C56E 1KGXA 4FTVB 4NMIA 3M07A 2QQMA 2OYLA 3WNPA 3N5AA 4YPJA 5KEZA 2XN9D 2GW5A 2B46X 2HWC2 2ATPB 2CCVA 3TBWB 1KLUB 1T04A 4WU5A 2J88H 3FZUC 5T3XE 2UXGA 4OQTA 4K8RB 1W0WA 2DM7A 1YSOA 1JCKA 1JOBA 1CU4H 2QQNH 4Y1VA 2CE6A 4GQ9H 2FJGB 4HEPG 3MICA 3KLAB 2WQXA 3CBNA 3B2VH 5I8OL 3QUMA 2W9DL 1AGCB 6FABL 1JNHA 1GGCH 1DE4B 2R7EA 1BMGA 2XBDA 4FG4A 3VFUB 5FUNA 5IESL 4OVUA 4UQCA 3GZAA 2YZ1A 3L6FA 3MNZA 4K9EL 3ES4A 2X9ZA 1NEUA 3T77A 4FCHA 4XTRD 4ABWA 1QJY1 1MI5A 4L3CB 1O5DT 4IU3A 2YXSA 4EN7B 3DV4B 1FV1B 4HC1H 9PCYA 1B9ZA 5JIIA 1IPKA 3P5BA 4GA9A 5F1KC 2BJMH 4BQ9A 1DQIA 4GKSB 4UM8B 4Y5XC 5C07D 1X5JA 4UT6H 3BUDA 1G7PA 2KZWA 4BK8A 1LOFA 3G5ZB 3B9IA 3MZHA 5T50A 4CNIA 3IFLH 4PG2A 5FA3B 3IAPA 5CINL 2VTFA 4CVZA 4EI6B 3NMBA 4P9GA 5DJDA 1YMHA 3PQYD 3E5XA 5LW9A 3ZXKA 4AWDA 4X5WB 3MBXL 3V4VH 4MQSB 4KKRA 1R3KA 4BQXA 2O6EA 1GKEA 4JFHE 2XWXA 1PX8A 3HQRA 2VOVA 1FH5L 4OLXH 4MCMA 3LRKA 1KZYA 5F7WC 2ED8A 4ZUUA 3HE7C 3RWJA 1TCMA 4I09A 3ETBJ 1CYXA 1SFDA 4XBEL 2BNRE 2CK2A 4JHVA 4M01A 4NKIH 3LDBB 1B4TA 3NP3A 4FPEA 4GMP0 2G9KA 4HX1A 4MSWA 4OI7A 3GHNA 2EO7A 5LHDA 2WLJA 4LMFA 1BHGA 2WT0A 3NJMA 3SYQA 4DOHE 1ZHKA 2SEBB 4V33A 2CD0A 2GNBA 2WQWA 2NW3A 3B2PA 3QB7C 4P3CL 5AVRB 5EEVA 1Q8VA 2IJ0C 3WLBA 1W03A 2XZZA 3QJQB 1JNNH 2N0KA 3L3HB 1AY1L 1WTGT 2CKBH 2EH8L 3DXAB 4UT9L 5FWQA 1O7SA 3G6AA 5F88B 1T1WB 3SN6N 1OCRB 3QHZH 1PY4A 5T3NA 3OPTA 2EDOA 3APMA 2FIKA 5D1ZI 4M1DH 2UX6A 3QACA 3ZMEA 2R69A 1O4YA 3URFA 2R23B 3IWZA 3OKEA 1NLDL 1GJWA 2GJZA 2ICWJ 1QJY3 3H54A 3T8MA 5BQ7A 1A3QA 4MJ4A 5IFAH 1OUSA 1U3ZA 4R83A 1MI5B 5FBZA 5DJAB 4WI4A 1WLDA 3HC3L 3BIEA 3TPKA 3WYRA 5I18L 4KJQD 4O5LL 4K3DL 4SLIA 1OD9A 4B96A 1OTSD 2P45B 3HMXH 1PJWA 5CMAB 1BBJB 2CWSA 4KZDH 3GIVB 4ZSOA 2VE1A 5SV5A 1DVFC 1MF2L 5EIIA 2A7AA 2EE2A 1BQHB 2QVFB 1BK1A 1OANA 1JYXA 3EJZD 4LLQB 5DLLA 4OZHF 2WS92 3ZX7A 4R4ND 4Y4FC 5I75B 5T3ZH 4O65A 1UWGL 3CJJA 5KVEL 3PG2A 1JZHA 4YW7A 3VXMA 4LUMA 4HUCA 2NUTB 5DSCA 5ANMB 3WXPA 2BRTA 1ZRIA 3GPEA 4PJFA 2ZTNA 3O3UN 2B9VA 2HAZA 1MCBA 3MRHA 1I3RA 2QFEA 1VGKA 2DEYX 1KTDB 2XFXA 4PJXA 2Y7QA 3N43B 2BLFA 5D71L 1DGLA 4WKZA 1KPRB 1Q0YL 4JCLA 4N2KA 2ZXAA 1JDAA 1IZ3A 5J1AA 2HWB1 5FM4A 1DZTA 3FT2A 3M3QA 2WIIB 3BAXA 4IEWA 4RFT0 3VBRA 3WP5A 1KJMA 3ESOA 4L0YA 2YMXH 5C3TA 3NZUA 1O5PA 3S35H 3N50A 5KSUB 1A7OH 1YPZF 3VKLA 4AQ6A 2X0UA 4N0FB 4Y4HD 2A4EA 1VEMA 1LAJA 4TMPA 4XMLH 3WF4A 3DTXA 2XKSA 1IILE 1INQA 5HVHC 1DJIA 1RUH1 2GSMB 1LO4L 1GNHA 2O5YH 2PELA 1X7QB 2QTEA 1FFNA 4Z78A 3FCSA 1P4BH 5ANME 3M1CA 4S1DC 3HZVA 4LR4A 3O6KH 3EXUA 4JN2A 3D8MA 5TE7L 2QL1A 2IALA 3WLBB 1PFOA 3VGAC 4KHXH 43C9A 4G4FA 4TSBH 3CZKA 4XHBA 3J2PA 4UOQA 2FJSA 3JZ7A 3LKPA 3TV3H 2XQYK 3AP5A 4Q4IA 4Q5OA 1XRUA 1W0NA 1A66A 5LRSA 2WP3O 1F2QA 3O7OA 2NCMA 5E5LA 4CCOA 5B1JA 3RL1B 1TG8A 2GJ6E 2X5PA 4PJHE 4DPAX 2Y64A 2UZIH 4BA0A 1J84A 1CLZL 2OJZH 1DJZA 1CTMA 1QUNB 3RZKA 4QTIH 3S88H 3VWKA 3VD9A 2IXJA 2ZX4A 1YQ5A 1U33A 1TTUA 2WDBA 3FT3A 4PF5A 3RKPA 2VUJA 4MO3M 1LE9B 5FECB 3RIFK 3TOJA 2DY2A 3NA9L 4JDZA 1A6TB 1L6ZA 4LPVA 1EFQA 3WSQL 1DCLA 4PRHD 3F6LA 3BH8B 3USSA 3DEMA 5HSFA 1BQHA 3SDCA 1MJJA 4AVVA 2FDBP 1C8M3 4K07A 5FYZA 2QFRA 4KRNA 2NUPB 5BZZA 3RNKB 3V4VA 5A33A 4JM2B 1BSIA 2HRGA 2YUXA 1OW0A 1E8YA 1QP1A 2AEPL 2NR6A 2ORBL 2X6MA 1FN4A 3W11C 3U4BL 4ADJA 4LMQI 4ECNA 1NBZA 4EN3B 1ZBA2 1T22B 2H1PL 4FNRA 1SOSA 2WABA 5FFOA 2W5FA 3PJSA 2DQDL 3DV4A 4M1GL 3B8SA 5I6MA 4FLRA 1Y6KR 2EACA 5GRJL 3FONB 2KKQA 3PHSA 2J20A 2V0AA 4UNTA 2BYVE 1YEFH 3EJYD 3QLQA 4N7IA 3F7KA 4WI7A 4CXWA 3D34A 1EAH1 3FQWA 4WI0A 2ETEA 1G7MB 2DDQH 3G9VA 3MOBH 1T4KB 1TTAA 1KXQE 2CNZA 4N8CL 4HXAH 3MYJB 4PTUB 1RI8A 1TOXA 2EC9T 1KEMH 5DWUH 1MPAH 3UTSD 5ABAA 3BB6A 4YAQA 3G5VB 3BWUF 2AJVH 4C0HA 4YSQA 1A34A 1YEDB 4MJ6A 1AQDA 1FLRH 1KLGB 4KUCD 5LCVH 2ICES 4QYOB 3SDXA 4PIXA 3BPNC 2Q6WA 1ADQH 4JDVA 2E7LA 2IALB 3DI3B 1MFDL 3IU3B 4RBPH 5FPXA 1VA9A 5A6MA 1L7IH 2E47A 2IXQA 3DSFL 3OVUB 4MAZA 4X2UA 3VXTB 1HV1A 3PHOA 1A3ZA 4KTYA 4XFBA 3O45A 4ELKA 2DYRB 3MJ7B 2UVFA 2UZYB 4PWHA 4BHUA 5IVCA 2ILLA 2K3HA 5DJCB 1U2HA 3B9VA 4LU5L 3RL1A 1UG9A 1N5YL 1ZBE1 1C16A 1HJCA 4W6YA 2PP9A 1QSFE 5DFAA 5J6HA 1OH4A 2XWZA 3SDAD 4NEHB 4LDCA 1N68A 4FLHA 4XHJC 2CUIA 1H6FA 3AL6A 3KNBA 2F7RA 4L05A 3ZFFA 1B2WH 4R8WH 4BA6A 3PWPA 1DVFD 1EA9C 4ZY9A 4QRSB 3H1ZA 4AEIL 3V64A 4IEFB 1AIZA 2A77H 4FLOA 3M6DA 2GSGB 1X9LA 2LOEA 1W8WA 3TTYA 3OYWB 3A4EA 3MLLA 2NY0B 2OMYB 2WXHA 3KDPB 1IQDB 3DCQA 1A7RH 1OARH 2NTSP 4KKCC 3B5GA 5MENE 4AQ2A 5ECGA 4GW5B 1KDJA 1QFPA 3X12B 3GHBH 3O3DB 5FZIA 4NPYA 2C9AA 2WZAA 3AMNA 3MV8D 2DLEA 1EJ6A 1URXA 2Q5TA 2VMHA 4LOEA 4Z5RB 3DK0A 4LSPH 5F9JB 1N67A 3LOBA 1BJMA 1G43A 4TLUA 3WUWB 32C2B 5CR8A 2H0EA 4G8FA 4QKDA 3MOQA 4NM4L 4WW2C 2WO4A 3ITQA 2YQGA 2Y26A 5D1QD 1F2NA 1YYLL 1MZEA 3NZHL 2ZQKA 1T3FB 2DLIA 4N0UA 2Z0BA 4UIMB 2IXCA 4EQVA 3SHRA 1N3NB 1E4WH 1TU2A 4MQ7A 4A55A 2DVFA 3PVBB 3INUL 1DFQA 4XUTA 4LLQA 1CG9B 4ZW7A 1F5FA 1U12A 3NIFE 1WWYA 2P6CA 1BMV1 2WXMA 4X42A 5EU4B 3KGRA 2Z31A 2DWTA 1MFEL 4B7KA 1FVCB 3P4OA 1F1DA 1AZDA 1GPOL 1OAXH 2VC2H 4JPVL 5HGHA 3S98A 2QQKL 4MXWB 4Y19B 3IIAA 3GSUB 1KCLA 3P0VH 3U0TB 4DO0A 1B0IA 3Q01A 3FF7A 2H26A 1HXKA 3HNTH 2WZPD 3M7AA 4PWKA 5K9KB 2W07A 3E6DA 4P08A 2ZGLA 1YJDH 4YW2A 4FHBD 4UM8A 4IOFC 3WL9A 5JIUA 3IT8D 4W6XB 1XGRB 1I53A 3SISA 1YO4A 3I50H 3OSKA 4ONFL 1C16B 1RIUH 2LV4A 5BVPL 2RCSH 4W9IC 2BW4A 4L2YA 4N6RA 4LHLA 2VQ1B 2WZ6A 5EUOB 4D0QA 5GGTH 1BIIA 3KGLA 4K3JH 1H5BB 2OAAA 1W0VA 3BCFA 4UV4L 3QDHA 1ZBA1 1IAII 1XGTB 3I6GA 3E8UH 5HBAA 3MFGB 1EERB 4XT1C 2L7QA 3IGFA 1LHNA 4B8EA 4LPXA 4JJHA 1GSMA 5EU7C 2GSGA 2FQPA 2HTKD 1N5AA 1QA9A 1U3NA 4OF8A 4OZGA 4DAGH 4G9FA 2N59A 4C56D 4KNQA 1AXSB 1YNTF 1D7FA 3FZ3A 2P5WE 2ZUVA 3V79C 3ACIA 1ML0A 2A74C 2J6WA 2X4PA 4IBZA 2B4KA 2J55A 4FPHA 4L99A 4V2VA 1YHFA 3O14A 1KFAH 1V3KA 4ZJ9A 2PQSA 1EAPA 3J27A 4DEPC 1CLCA 3TYGL 4ZUWA 2XQYG 1E9PB 4MHUA 1A78A 2RBLA 4YSPA 5EF2A 1NPUA 2UURA 1AR63 2WWUA 1LE9A 3NTCH 3QFJD 3MJ9L 1JGIA 3V0EA 3FN0H 4EDXB 3GJBA 4JREB 3TF7C 4N5EC 5T5FA 1S4IA 4HPOH 1HDKA 1UA6H 4X6DB 4HN1A 1HQWA 3LZZA 5F0LB 1GCYA 1L3WA 1X4ZA 5GSRB 3NACL 1R1A2 1MJJB 3IMVA 1EIBA 1B35B 1FNGB 4FS0A 2FGWL 1E5BA 4G8AC 4YR6B 5L4MA 4U1GB 4JZOA 3S4SB 4ELDA 5LY1A 2QADC 4M5ZH 4PJFB 4OGZA 4QHBA 1A7PH 4MNHA 4X4ME 5AOKA 2WUHA 1VFMA 5EJ1B 4OHYA 3TNMB 3KV9A 3SDDA 4IBUA 4RGAA 3DL3A 5CEYB 2ENSA 1PX3A 3NSDA 2JG8C 3CC1A 3RPIB 4B3NA 1ZLUK 1QHPA 5D55A 1OUXA 5SWSE 3U6RB 3ULUD 4WK0B 4DWHA 3DIFB 4LLVB 5CILH 1VBD2 2WAOA 3UGGA 3LZQA 4Q27A 3NCEB 2GC3A 4C4BA 1U4FA 2DYPA 2O6CA 2ZGUA 2EIZB 2OVUA 3SEPA 3V0BB 5DQJB 4XN8A 4PY8J 2VSCA 3CU1A 2C26A 3RL2B 1PF3A 1A4JA 1BFOA 2ZAIA 2BP0A 4ZS7H 4BZYA 4YSUA 3BZEB 2G4EA 1R64A 2H2SC 1SDDA 2APVA 5I8EB 2P2KA 2GI7A 2R073 1O7DC 3VQMA 3GC3A 1J1LA 4JGJA 3H9YA 4PRID 3KWWA 4PJXB 3LEVL 2G30A 3HMXA 5DMJB 5E51A 1EO8L 2YD1A 5TH2A 1SJHA 3H9SA 1JXKA 4ZNEE 2FCVA 3KVAA 3O6FA 4KV5E 2WNKA 3S96B 4ASMB 3QQ3A 4DP6X 4PBXA 4XRCA 4I13B 2HTKC 4H55A 1UXMA 4AVKA 3RWNA 3VSQA 5CGYD 2CHXA 4WNQA 5DJYA 1HYRC 1SN0A 4NO0D 4JFEB 1I8LA 5LNEA 3EXLA 1IBZA 3FOLB 5T1KB 1DBJH 5LLIC 1SLLA 3OCPA 2VDKH 5LGKA 1R46A 4PJXF 3MCKA 2VH9A 1P5UA 3DOIA 5CBLA 4P5KB 4S1DD 5AAPA 4X8XA 2JB6B 1FFNB 1WZLA 4Z78B 3OB0K 3VZOA 5B4NA 3MIDA 4FNSA 1FIEA 1IBGL 2FATL 5E2WH 2R0ZL 4AEEA 1QXRA 2K3TA 3PQYB 5IVXF 2Z35B 4PRPD 3B7SA 1IKFH 3IFNL 1PIGA 1XTLA 3P30H 4NIHA 3OWRA 3RWCA 1W8HA 1LEIA 1Y18A 1KJ2L 4OLEA 3JD72 3R0RA 4LF3B 4WHYG 4JQIA 2Z31C 3V4UH 2JD4A 5JQHC 4FQ2L 1ZTXL 3FULA 4F2EA 1UAIA 3FCTB 4JM4L 3VI3B 1YEIH 3OD4A 3MXWH 4HSQA 1ENRA 4V2BA 4G8FB 3Q8BA 3EH2A 1VBE3 1XU1A 2BV4A 2UWBA 3FJSA 2PF6A 3UABA 5IF0A 4Q2ZA 1Q1JH 2OUHA 4CADB 2B7YA 3UNPA 2WTPA 1NX9A 4FQJL 4DVBB 7TAAA 2ZG1A 2Q86A 4ZTOL 1ODUA 1Q8MA 5DHDA 4KQ0A 2IGFH 2P5ED 2ALAA 3PGCA 4QYAA 5CCGE 1DJHA 1S1AA 5EU7E 1BGXH 1PNFA 1V9U1 4HANA 5BNOC 1LK2B 1HXMA 3EBIA 5FYLD 4L8DA 2HBUA 4O61A 2QQPA 4Y1TA 5HYJD 5I1KL 3VDDB 3V6OC 1YIFA 3ESVF 2X2YA 4BQ1A 4HUVB 4A2HA 3Q48A 1EXUA 1XF5B 1XXFC 2AEWA 3KYAA 4JDVB 5D93C 5CCJA 4R90L 1T0MB 3T3MF 1YAZA 1ND3A 1DBAH 1U8CA 5GHWH 1V55B 1SBBA 3DURB 1ZZ8A 3VBHC 1MQTC 3R06A 1IGOA 3E3QE 4ODXA 2R1BA 4XVTH 1P6AB 3QH3A 2W91A 3W37A 4G82A 3M4FA 4CA4A 2WNUB 1LLAA 1LWJA 2OJEB 3E1F1 5F3GA 3A22A 1OGSA 2GTWA 3IDXL 3ARDD 3MFFA 3TJEH 5E2TL 4KTDH 3O8XD 4ZMOA 1XNTA 2HEWF 4I1RA 3WR0A 3WU1A 3QPXL 4P5YA 4GKNB 1RULH 2FT6A 3EKCA 3MBWA 4NNPH 4Q8BA 1NKGA 4HD9A 4UUJA 2F5BL 1OE1A 4QRTB 4CMHC 2BRRH 3RWDA 5IM7A 2YJLA 4G6KL 3VGGA 2PCFA 1D2QA 2NM1A 4TOYH 3MCYA 1J3QA 3AKTA 1AIFB 4CKVX 1OOPC 1RUI1 1BOYA 1JYWA 1E65A 1AG0A 2W3JA 1AQDB 2WYIA 4PVNA 4KVCH 2QQNA 1SFPA 3HEIA 4LPLA 2WTRB 4NRYA 1OAZL 4R26L 5CFCB 3PL6A 4S2SB 1BAFL 3Q2CA 1JXDA 3AG3B 3JTBA 5DS8B 4ZMNA 1SEQL 3UAFA 3ARUA 2WA3A 4XMPH 2DQHL 2HWB3 5HVWA 2WFF3 2EE0A 5IP4A 3KXFA 1ZD6A 5DD0L 1DEEB 3KVQA 2QDRA 3ZDYF 4IETA 5CFDA 1QBBA 2BP6A 2BU9A 1JGVH 4PVLA 4JN1H 1UD8A 3AG1B 1H9WA 3OEAA 4XN7A 5JIPA 1HFUA 4MKTA 5C0CE 4RDBA 2H6UA 5I1EL 4PB9H 1NCQC 1ZMYA 2P5EA 3O9WA 2YU1A 2XV6B 3VFVB 4HWEH 4Z7NB 3IFPA 4OW6A 2W1UA 3C2UA 4NRQA 4J28A 2L7UA 5D4JA 5DVLA 4IBVA 2H8PB 2EVXA 3FFDB 4F7PB 2VQUA 1WG3A 1SN2A 2AXHA 3OC5A 4KXDA 2G75B 3BT2H 3QW9A 5D1XC 3D4ZA 3FRUB 3NCJL 4YHML 3VXOB 4AHWA 3V4PA 2EVGA 3PGCB 1CDYA 1R19A 1EXHA 4URAA 2DMCA 4Z7QE 4GSXA 3HC4L 5F3HA 5KWRA 2A2QT 3EHBB 3ZDWA 4O2CB 5F3IA 2C9UA 5DK2B 1TQ5A 4N90A 1R3KB 2HT3D 3EYVA 3WI9A 5F6LB 3P1VA 2PXYC 3UBHA 4P2CG 5JW4Q 3ULVD 4NP9A 5A3NA 2BY2A 2DQUH 4KX8A 2AQ1A 2XACC 2W95A 3HC4H 1DGWA 3B9AA 3NCFB 3EG9B 2JIXD 4DKFH 3K5SA 3PP3H 2VLKB 1XGRA 3BT2L 4JY6A 5B39G 5T1MA 3PPEA 5FP4A 5D1QC 4G6MH 4HS6A 5DRNB 3I9GL 4GUCA 1ZSDA 4U1IB 1F90H 4NKQB 1G7QB 2YB7A 3FUNA 5KN5B 1ZZ6A 3ZYHA 3KF3A 4CDWC 3GMOB 4KRPD 3P2BA 1AGEB 3ESMA 1MWAL 1KB5H 1WIUA 4FCAA 3MRBB 1RUI3 2CTVA 4B5EA 4WSJA 4JN1L 1J0HA 4Q4EA 4TNVK 2E8YA 4Q58C 2OA9A 4QXVA 4P3DA 3WJMA 2VN5A 4L3EA 2B9AA 5KVGE 4APQD 2WTRA 5KYWA 1RJLA 2ZF9A 4GKXA 2Q9OA 1I3GH 1ZBA3 4RA0A 2VAAA 5ECJE 4QR7A 1LO3L 2XG3A 3FB6B 3SPGA 3DOSA 2BW8A 4KO7A 4WVMB 3RI9A 2HLEA 2OMTB 4J6GA 4TV3A 4E9LA 1CFSB 5FLUA 1T89A 1W6OA 5JLZA 2R1YB 1XSOA 2CAKA 1IM9A 3PP3K 3ARBB 3OJDB 4H5SB 2X09A 4MCYA 1AR93 1ZM1A 4G6KH 1SHSA 1P5UB 1NGQH 4NNPL 4OGAC 3I2IA 1UD5A 3HIFA 1C5CL 1QSFA 4KTDL 4ODTL 4JFED 1UB5B 3RIKA 4CBZA 2F54D 3QR0A 4FXGA 4IERA 2GAZA 4H3WA 4AI0A 3WDXA 4R2GB 2PHTA 3MLXL 3CFIC 1IGTA 2AS5M 1CLOL 5L9DH 3DGCR 3MZGB 4XNQA 1XF1A 4BHUI 3REVB 1MFBH 3II2A 1FOD2 2XBO2 4NN5B 4DZBA 2CJSA 5AD0A 3NGBB 2JB5L 3RDTC 1MR5A 1DJYA 5IK4A 5IV2B 3SOBH 1NBYA 3QZPA 5I1KH 1UB6A 4JGYA 3QIUC 3GSNB 4KRPB 1CF8L 1J8HB 4L5FE 1D5XB 3VFPA 3ZOAA 2DCZA 1BXAA 5B7FA 4ODHL 2GNMA 1DCSA 4XGZA 4KDTC 5AW8B 5C9KA 1NC2B 4XCCH 3QDJE 4HBQA 4YHIA 4LLVA 4YBQD 4ZTOH 4JY6B 4Q97A 3DV6A 4IW3A 4W4OA 1VRBA 1EHNA 1ZVFA 4ZODA 1CGWA 3D4KA 5K9JL 1GZPA 4GLRI 4K7JA 1UVQA 3L4VA 2ZABA 3A0NA 4QX7A 5AZ2L 1LQBC 2AJUH 4BDVB 4PUBH 1NFKA 3WS6A 2G0LA 4AJYV 2AJXL 5KYXB 1YEIL 5SWQB 2WBWB 3WFCL 2DCKA 4MYEA 3ULAB 4A6SA 2W0XA 4YSAA 1JRHL 4URKA 1KGCE 2HJFA 4DCQB 4RHV2 2DUOA 2CNYA 2I7SA 3MLKA 1GYAA 5GS2H 4FQ2H 5K4LA 5JW3H 1H4HA 1UQSA 3NJKA 4IRZL 5DD5L 3V4UL 1E6OH 2X6UA 2HYKA 5FDWB 2JI3A 5CKNA 1J1OH 2JB4A 2OZNA 3GBNH 5I6LA 4C4UA 4WW2B 3L5XL 4IGBD 4QHZA 1ST8A 5K0UB 3VSUA 4BFEA 4AIOA 4LO7A 5MERA 2X1OA 1RUH2 4YXKL 4M03A 3VFGH 4DFIA 3UJQA 3EADA 3K2KA 1D2SA 3UC2A 4V11A 1D7BA 2ZGMA 4ZFOA 4X80H 2HVBA 4R7VA 2ADDA 4AV5A 1BPLB 1NFDE 3L3JA 4H25B 3BIAX 3KEHA 1SY6A 5E8OB 5C0DA 3S3BB 3ZDXF 4EEEA 4PVBA 3VBOA 3WKQA 1W90A 3I59B 4E8DA 2P8MA 1S7VB 1T21A 1WT5A 2GJ6A 1S6NA 3OJ2C 3OQRA 3PQYA 2R4RL 4ONHB 1S9YA 3IE9A 2YN3A 4KKZA 3L3KB 1SPDA 1MVUB 1ZHLB 3SDCB 3R8QA 1WPCA 1NLQA 4AH2B 4XAWH 1GAFH 3VFOB 4E42B 1ENQA 1EO8H 3PL6B 4S2SA 5DS8A 4ZW5A 1NG0A 1UT1A 5T5FL 4XOBA 1NCWL 3HZ3A 5ACZB 1VADA 2RDRA 1PZBA 2FGZA 5CF3A 3ARWA 4Q4W2 3UTSB 1BQUA 1MIML 2E8ZA 1Q8PA 3T4HB 1XCXA 6CGTA 3N7MA 5CCHE 4EKJA 1AKJB 5IB2A 4PLNA 3P0YH 1T22A 3MLWH 3F6JA 4GAFB 1FMD2 4FPJA 3N43F 3EZ8A 5D6CB 4ZAKD 3TT1H 4E9VA 2VKWA 2TNFA 3RVHA 1TDQA 5FXVA 1OHZA 5I0SA 1HU8A 3AP6A 5D1QA 2H2PC 5F6IB 2ZEXA 1G7IA 4KFZC 1A9EB 3GMQB 3MRDB 1LU1A 1BXUA 1YPZE 2GK0A 3M1OA 2JE8A 1LNUB 1XMEB 2RHPA 1IPSA 3KLLA 4YWGL 2H32H 4NQSA 1IFGA 2X42A 3FK3A 1LENA 2ZGNA 1NE6A 1DFXA 3THCA 2ZHLA 5T55A 3QYCA 3UP1A 2NX5A 2ITEA 2MTAA 2XFXB 4IJ3C 3EYSH 2ENJA 3LHPL 4FRWA 4D2NA 2FGWH 3ELNA 5HPMA 5I8CA 1OCCB 4X6CE 3WE1A 1TJIH 1KN4L 3T5WA 1MEXL 2WMPB 4L4TD 3UYPA 3PDQA 3HE6A 4LPYA 2J73A 2QVKA 3TP4A 1LHVA 2CUHA 1RVF2 3ZMRA 5I76A 3VRLE 4E9TA 1CI5A 3ULUC 4WZ9A 2Y72A 3FN0L 4N0FA 4ASKA 2Y69B 3THDA 2XBO1 4NGHH 2Z9TA 3QDJD 3AABA 4FOVA 4Q29A 4A7ZA 2G60H 4OFGA 4FPOB 4MXVE 3GJFB 1FSKC 1WYJA 1MRDL 4J3SA 2W0KA 3P6BA 1O6SB 4WM7A 1CI3M 1QRND 3MW2A 4K21A 3FCSB 3LRGA 3I6LD 1TLKA 3QEUB 3VA2C 1LGBA 4E8CA 1I85A 2R27A 2ZOLA 4XNYL 4J5VA 1DTUA 4F58H 2J44A 1BZ9A 4RMTA 5JA8B 4Z7OB 3H7BA 1GICA 3LKJA 3A21A 4XB7A 1QFWL 4WF7A 2RM22 3Q6FB 1CX4A 3T2TA 1CICC 3D51A 3P9MA 4AMKH 2AF2A 5D1ZA 4FEIA 5TDOA 4WUUD 2FQFA 1OGTB 5AOZA 1A47A 4H8UA 2DKMA 1VFAA 3FTZA 5AOMA 4TZDA 1U58B 4MZ2A 4HK0B 4D9LH 2WV3A 5A3UA 1YQ6A 4H5SA 2FDHA 4ISVB 4MG2A 3HAEB 3UJJH 1COV3 1UA7A 5GGTL 4Y4HB 4P46D 4DKTA 3NCYP 4Z3TA 1XTMA 3N55A 3MFCA 3FTGB 2RCSL 5L4IA 2QQOA 5A7NA 3QNXB 4DZGA 4NQED 4OGQC 3RWEB 4X6RB 2RS33 1CYGA 1FAYA 2IC2A 4ANKA 3N3HA 4RESB 1HEZB 2FDIA 4LLWB 1MRFH 1R33A 2QVMA 1DDTA 3ARGA 4YPGA 3P0VL 3WS6C 4I3RH 3FF8A 3REVA 4YEEA 3WG1A 2QQKH 1GS6X 3EFDH 5LRRA 2P26A 3GS4A 3NJHA 2HKFL 5JZGA 2GJRA 3OJMB 4LLMB 4PI0A 2I5YL 2EECA 3GSNA 3QUZB 1ORSA 2OL3B 2W0LA 3VFPB 4X83A 1DGWX 4EVNB 4OI1A 2P5EE 4D94A 4AT6B 2TRYA 4B0MM 1E4WL 3BX7C 3W81A 2CR6A 1D4M3 2E7MA 2E33A 2G75A 4PP1C 3EYFB 3NZHH 4M93B 4RMQA 3WUCA 1NAMB 1EVUA 1KB9J 1WCSA 3RBSA 1FX5A 5IW1B 3MIBA 4P8QA 1W9FA 1AO7E 3MRBA 5HGDB 4LSPL 3T09A 2WNEA 5IB4B 3LEMA 4PRDB 5DFTA 1QABA 3KJ6L 2CR3A 4NQEE 4TSAH 2DQTL 4FFWC 4K9JA 5FZKA 4GRWH 5KYWB 4NKMA 1S7WA 3RYPA 1PZ9A 3NNMA 1CAWB 5J1AB 5EQUA 4JG5A 2EIKB 2LFGA 3ECBA 3G7DA 5IAVA 4UNUA 3MODH 1AXSA 5C8JA 3O0WA 5L4JA 5DVKA 4L4VE 3B2UC 4P59H 3J8F1 3QDMB 4D69A 2X89D 3AXHA 4AQAA 4XXPA 3OPUA 2Z4TA 5HJGA 1HWGB 1VFUA 4CUBA 2PO6A 4JFUA 3KV5A 1UZ8A 5JYMA 5HHOE 1E9PA 4FKHA 1UX6A 4UW3A 1E5RA 1AYM2 15C8L 2ADGB 4DINB 3TBBA 1E7VA 2OMVA 3NV4A 3AMQA 2RJ2A 4NVPA 1T4WA 2CDOA 5F7EL 2AV7B 2NNAA 1I1AA 2BGPA 4PG9B 1S9YB 3DN7A 3U2SB 2H3NA 5I91A 5JHLH 4GD4A 4N2OA 2XN0A 1PO22 1O5LA 1HDMB 3ZDVA 1ADQL 4YDLB 2PAEA 4B60A 4OCYH 1NA1A 1CZTA 1IZJA 3QO1A 1UNBA 1LR5A 1PKQA 2VBBA 4QT5B 4ZMQA 3LN5B 4P48A 4Q9CA 5SWZE 1ULGA 3VXQA 1U8KB 3G9AB 3DVGA 2DQ6A 3W0WB 5DAQA 1X7SA 4K7PX 5KJ7E 2DFCA 3DSNA 4PS4H 1CFMA 2C3VB 2FLRT 4F9LC 4JBSA 1EH9A 2BP5M 1CZ8L 4KXBA 4P99A 3PMSA 5AC93 3GO1H 2NY7L 1EK3A 3WEMA 3V95A 1RJ7A 4LVNB 3MU3A 4A7KA 4XJAA 4DP9X 4UU9A 2JG9A 4ET7A 1SFHA 1UU4A 2IUWA 5K39B 1SXCA 3EJZC 5C0AD 4M1GH 1H4GA 3I3MA 3CDGB 1JS4A 4MASA 1VBA3 1QSEB 1O8SA 4COVA 1DQLL 2V6HA 3KAAA 4ZFZA 4UFIA 3B9EA 3HI5H 3M8LA 1OGPA 3U4BH 5I8KL 1W8UA 3CFUA 4N28A 2AEPH 3MRNA 4QOKD 4AZ8A 4RL7A 4R84A 5MHSE 1NBVH 2ZGOA 1WEJH 3MR9B 2KL6A 3F65A 4KK5D 4NYLB 4TVUA 5DA0B 5FO9A 4POZD 4HLEA 1P8JA 1VBD1 4ZUUB 3QJZA 2AJYH 2Q3ZA 4QKFA 2RQ8A 1ZJBA 4TL4A 5IVXB 3NNFA 3GTTA 3S0MA 2YSSA 3LEXB 1ENSA 1WWCA 5DFVD 2HFGH 4UTAA 5GRWA 1AGBA 5LWBA 2VMFA 2DTYA 4PV8B 4KUZH 1HNYA 3UZEC 4ODWB 3ZYIB 2FNBA 3B00A 4D3WA 4X6BB 2V5SA 5E00A 3FO1B 5ESVB 3VQ1C 2YJQA 3KW7A 1EEUA 3CSGA 3GFUA 5CBEA 1UYXA 3D0LA 2ADGA 1W72L 3US1A 4YG3A 1U8HA 1HE8A 3POFA 1G94A 4KJPC 4R7XA 1NEZB 1TQBB 3IMWA 1ILUA 3RI5F 1PZAA 1IBYA 3AXIA 4XMAA 3IMMA 5DAVA 2YBKA 4ZUSB 4RRPA 4ORFA 2DCYA 4E9SA 4KZ0A 3TV3L 1QRNE 3DXAA 2VVFA 3E2HC 4KHXL 4DQAA 5FKBA 3KPNA 2VISB 3KPSB 1ALYA 2CU5A 1AX0A 3VGDA 2XX0A 4JFFD 4NJ9H 4AIXA 1J83A 4OLYH 4U1LA 3MLVH 4XZ4A 1W6QB 3NAPA 2O5YL 3CZSA 3DVFA 3HZMA 3KJ4B 1MEC2 3PAYA 5DG1A 3BIBX 3KNBB 1R5IB 2QZ5A 2XTJE 1U3JA 5D1XD 4AEJA 1MNUL 2VUCA 4CDWB 4IIZA 1Z1WA 3ZK0A 2VC9A 1P7HL 1NFDA 5E16A 2YGPA 1Y1DA 5DF0A 5IW6A 1BD2A 2VZOA 4XW3A 4CP9B 4P4KC 2WXRA 1HV0A 4B97A 1NMBL 5CN3A 4MXWL 3RBGA 1G7IB 2NZ9C 3DV8A 4S2DA 5EZJA 2J8OA 2WB7A 1C8QA 2WO3B 1U36A 2WSPA 5F1OB 2H5UA 3UADA 1UGNA 3MRFA 5E56A 2IAMB 2N4IA 4NQUA 1CQKA 1VBA1 4IRJC 4F3JA 2W81C 4U6XB 5D71H 3I97A 1QSEA 1JNHB 5C9AB 4POYA 3POWA 2VR7A 4XDQA 4FSJA 4NQDB 1J59A 3AQYA 2D0GA 5C09E 4JPIB 3KV4A 3G08B 4KXZI 3DBXB 4QHLA 2I9TB 4N2FA 4UDTA 1Q4NX 4DGWC 1AR73 2OSWA 5HI3D 4BFRA 5INDB 3AUVA 4QHOA 3U4XA 1XOYA 2CY6A 3VNZA 1O6TA 1NWOA 3I2GA 4KITB 4ZX5A 2DLTA 4KZDL 2FBJL 3ZBMA 1BBDL 4CILA 1MNUH 4JFHD 3A0OA 3BP5B 4O5LH 3TB0A 3BMWA 3EBAA 3MNDA 2PLTA 3DROA 5C8CB 4PGEB 1G7LB 3VCLA 1AOZA 1S5HA 3MLVL 4OKVB 1OAYH 1IGJA 3NK3A 2CRZA 4OLYL 1TKWB 4L9LA 1OAKH 3D0LB 4TSVA 2K8MA 1UY4A 1UJ3A 2GTZB 5E6HA 2Z8WC 4OI0A 1YQVH 2AXGB 2YLKA 1K5MB 4XFFA 4CDQC 1JODA 2HWF2 4Y1AE 5D2NC 4B41A 4MMZC 1TTGA 4PJ9B 3WQ7A 5CFCA 4TLGA 3A4FA 2FAUA 1T7VA 3HIZA 2R8SL 1QEXA 2ZOUA 4XE5B 4DUVA 5KVGH 4K3EH 4WY7H 2OZ4L 3T4AB 4OMCA 4OQ8A 3JZYA 3Q3GB 5DJYB 4YGAB 4D0BB 2GJPA 3IEAA 5FY9A 3WIIL 4P3CH 3SGDH 1RUI2 4KK6D 2VLRE 1CR9L 1IAMA 1I9JH 1BEYL 1T5XB 2JLLA 3TCLA 3HB3C 4M3CA 2VMJA 3MUGA 4MGYE 4LQFL 1J8HE 3KH4A 4OUUA 1CWVA 1FVEA 4OD1H 4UDUA 5C0ND 2X9WA 3T0EE 3QDMD 5AKRA 1WGVA 2WNUC 3USUA 5ACMA 2AH2A 4JKKA 5D8JH 2H47C 2AJYL 2MHAB 4L23A 4C57C 2X4OA 3SC7X 4PHZA 1MS5A 4C8DA 4UAOC 4YHPA 2VBDA 5FP9A 1N5AB 5MENA 3I6KB 4YBLC 3MW4A 4AVHA 4UOW1 3GMNA 4OLXL 2C3GA 1GOHA 2FIKB 2PP8A 4B9YA 2BS8A 2YY1A 2Z42A 1AGFB 3ZFGB 2AR6A 1FHNA 1INDL 5EV7A 5C8WA 3UG5A 2F7PA 4DKEL 3MBXH 4XHXA 4IJ3B 3BU7A 1RL1A 4BXSV 3ZTJH 1H8TA 4JFFE 4AR2A 4AT6A 5DLMH 4OV5A 4CCLA 1M1XA 4FNUA 4Y5XB 4CSZA 1JXNA 4CADA 3HZYB 1O7DE 4DEVA 3C60B 2P28B 4DXTA 1CZ8H 3VD7A 2EP6A 1ZSDB 3ARDC 4GAAA 4GNKB 3NRQA 4U1IA 3X1GA 4DB5A 4YZ5A 1A4KB 1TITA 1T83C 2C9QA 3AKSA 5SX4H 3AMLA 3VTTA 1B35A 4HC1L 2XWJA 5C8CA 4K40A 1MLBA 1UFGA 3T1WA 2NY3D 3S3JA 3OOXA 4P23A 3W1ZA 1LTXA 2YC4A 3RPBA 3ZQ9A 4YHLL 1AL21 4S2FA 1TSRA 3VMNA 2R9HC 2JJUA 2O61A 1KY7A 1XSQA 4H0GA 3GMMA 3SDDB 4KXAA 1X6LA 4FEMA 2W9DH 2WQZC 2GI0A 4XPTH 4OZOA 1RYYA 2A9MH 4K7PL 1XE7A 1UEYA 1G4RA 3VMPA 3QJHB 3S36X 2Z34A 2XZQH 3EJYC 1JHLL 3VUOA 1F6AB 1K2DB 3WN5A 5JW4M 3ZLQC 2YYOA 3HMYA 5ITFB 2IGLA 2WINB 4XWOC 2J88L 3DJ9A 4JMNA 4ZMTA 4OKDA 5DZEA 3CC5B 1JZFA 1U30A 3L95B 5IMLA 4TYSA 1M3JA 1HN1A 4LCVA 1LO0H 1U8PB 2NW3B 4HT1H 4ZOCA 1J05A 4AGMA 2X87A 3O6LL 3QDGB 3UO8B 4P4KA 4JUTA 3U1PA 1FXZA 2KUTA 3MODL 2O6DA 5J9PB 1JTPA 2IANE 2FBEA 3AUWB 3AXLA 3I8TA 2A6JB 2OPCA 2GC1A 5D7LB 4YDJA 1S9XA 2BSSB 3CFQA 4JFDD 3S7EA 3SKUD 3WY3A 3ECBB 3VXNA 4JO2H 3ZTCC 3FSOA 1FL6A 2HKHH 4M48L 4K5NA 1R1A1 3LN5A 1MZ5A 3NKGA 1M6OA 3VL8A 5FUPA 5A2KH 4U1NA 3BIWE 1TG7A 3HBKA 3K6IA 4WGKA 3EJSA 5C3RA 1MFVA 3X13B 1KYOJ 4Y4FB 3WCRA 3LNIA 4F15B 4TLSA 3QEGL 3FC8A 1QI3A 3O1RA 5G5DA 1WFTA 3TBYA 4ZKTB 2VPVA 3X3FH 1BEXA 2A74A 4OMDA 5TF0A 3UGHA 1RXGA 4NZTH 5LWYL 5IHRA 3BP6A 3QXUA 1JYTA 5FJHA 3KVDD 4K2UL 1YLBB 4UYBA 4EI5C 2I5YH 4D6RA 1ZWIA 2XWBB 2RQEA 1GQGA 2ZJSL 1FNLA 3MV7A 1U95A 4RAHA 2RM23 3H1YA 2ED9A 1VBB2 3S37L 4XVJL 4HG4K 4QOKA 3E97A 1YXWA 2BWQA 1SBDA 1R17A 1M7DA 4I3RL 3WINE 1NBZB 4CC4A 2H4EA 4LVOC 3NSFA 4CDQA 1MRFL 5E2UH 1SJVA 1ETZB 3OXSB 4LO8A 5HBBA 1Z2KA 3VW3L 3OKNB 3Q2LA 3BD3A 1EANA 3K75B 5BNNC 2TEPA 4Y5VA 3WY1A 2APSA 3SE8H 3CN0A 3QORA 4YRDA 3FONA 3T0EA 2YK1L 2R29L 4QRPE 3C3VA 5AG9A 2NYZA 3D4GA 3SKMB 3GNML 2BWIA 1SY6H 3QZWB 4JL2A 4Q6IA 3GGWB 1HJGA 2HKXA 5FY7A 4XNBA 5BCAA 3GMLB 3EF7A 4G80A 5GRVL 4E2OA 3EOAB 4K15A 1C12B 4I0PA 4ZAKB 2X4UA 5HD8D 1JF1B 3CAFA 4D9LL 5HHMD 4QTFA 2JDKA 2XX1A 3AP9A 3KVBA 4UXAA 4WU5B 2QADB 5LA2A 2WC2A 3BOWA 5JZ7C 5KANG 4P3DB 3BZ4B 3BYYA 3TO2A 1K4CA 4AMKL 1ZA7A 1YNKL 4PYGA 5FZCA 1COBA 2HH0H 5D2LB 3CZUA 4LAQH 4OZHB 2C9RA 2NY1C 1CQYA 2P8LA 1WZ1H 4OFYA 5GRUL 3TCTA 3PIGA 2AKRA 4OLLA 3WNXA 1FO0B 3OR7B 4P02B 4M7LH 3T2LA 4ODXB 3SLIA 2Z7ZA 3JV4B 4F2FA 2OI9B 4LNRB 5A6YA 4F58L 3SXWA 4ZZ8A 3M70A 3SYAA 5LO7A 4X7TB 1RURL 1M6OB 2ZX0A 4FOQA 3MJ8B 2YOCA 1MRDH 5IATA 2JCCB 4MDRA 1D9KB 4YFLI 2OJ1A 4MB1A 1R3JB 4DPNA 3RVVC 2Q8AL 3ROLB 2E7DA 1JN2P 1H9DA 1OLMA 4P23D 4GP5B 1O75A 2IGTA 2IIJA 2A4CA 1CD8A 3NFPB 3NIGF 1FGVH 2FD6H 3ETBF 3EBRA 4ANWA 3WLUA 4HQQH 3MRQB 1G7JA 5C09B 3ZL1A 1KN4H 4HWUA 3ZE1B 1GWMA 2AQQA 2K8QA 4GYBA 4JAMA 3BRDA 1SLVA 4S1RL 4HCIA 4ZFFA 1XU2A 3MLTA 2LHAA 3PCYA 1WKYA 3ULUL 2RM21 4X5WA 3DDGA 1XF3A 2VLMD 1K72A 5EOQL 4AGQA 3C7OA 3NAAL 1KXTA 2BHYA 4XXDB 4L2LA 5HCAA 5F0JB 2WO1A 1KYUA 4POZC 1WO2A 5D1QE 5E1RA 1R3HA 2V4LA 3LIUA 2ZUWA 2X3CA 9CGTA 2EINB 1P5VA 4P9WA 4BOWA 4C90A 2FEEL 4P00B 2OQ6A 5HJBA 3FB8A 5J11C 3O9WB 1I3UA 3VFTA 4YNYB 3TS8A 4XGZB 3HR6A 1NFDB 3GJEA 4A7GA 4MGIE 1VB2A 1A8JH 4N8VB 4ERSH 1WGOA 5M7QA 4HK9A 1AE6L 4AMWA 1J1XH 4Z95L 4BD4A 5A2CA 5T54A 3CJIA 3TT1L 3UGEA 4CU9A 4BSWB 1JTZX 1YC8A 4F7TB 4UFJA 1H6EA 2YPJA 1LOAA 5CJBA 4NDMB 3MLWL 3KPSE 3GJFA 5IGXL 5ERWA 1JU4A 3HT1A 1MIMH 2A9BA 3FSZA 4NFBA 2YS4A 1HQRB 4META 2VXTL 4YFLF 3QHFH 1OP3H 1NCWH 3UYRL 4BZ2L 3FBKA 2X41A 4L1HA 1BXXA 1CVNA 1AZZC 4AI1A 4OZHE 1RUJ2 1L4IA 2Z4QB 2KS0A 2OS7A 4XAWL 4BFIB 1UYYA 5I15L 1J5OH 4LIUA 5I1AB 1AQ8A 3U9UA 3AADB 4Y4YA 1FO0A 3OR7A 4ELKB 1T1WA 3O6FB 4PJIA 3RP1A 1HHHB 3V6OA 5EBLA 2RH0A 3GSRA 1MJUL 3UACA 2Z93A 1JMUB 3EJJX 2CGOA 1ET5A 1YVLA 1FI2A 2HYMA 3H8RA 2I2SA 1VP6A 5FQ0B 2IQAA 2KDYA 2R2EB 4AE2A 2J1VA 2HRPH 2Z7YA 4XPFH 4X6FB 4FP8L 3D69A 3AQDA 3TN92 4PS3A 1XSJA 1FZKB 1GCFA 2PYEB 1W9XA 4YXKH 3VFGL 3S7IA 2QADD 2E46A 1BM3H 2FCBA 1LDPL 2CJUL 2CBPA 4FQXD 3BLKA 5CJQH 5KSAC 3MUUA 3I6GB 4ZPTA 2CHZA 2XPZA 3T3YA 4RR3C 1E27B 2D03L 5F9AC 3BLBA 5EIIB 35C8L 4A2MA 2DEXX 4YW5A 5L19A 2YKKA 4O02L 1I1RA 4NO5A 4WM8A 4M4RB 1E6OL 3D9AL 3B6SA 5FZBA 4XTPA 1OM9A 3KEDA 4RFOL 2YAHA 1VBD3 4ZFFB 4MYWB 4FMVA 3AU1A 5HI5C 5JW3L 5IUQA 2XY2A 4FQHA 4LLYB 5FYJD 2BHUA 3T4AA 2KH2B 4L5FL 1VLXA 2MIZA 2HLFD 4PCRA 3J9SA 2AJXH 4NC1E 1S0EA 5JZGB 4Q4W3 1QRNA 3DXAE 1XGUA 2N01B 5AZ2H 1SHWA 4GG6A 2J1SA 4DMIA 5KAQF 5EULV 3DMMB 3WV0A 2O6FA 2JICA 5TDNB 4JQXA 1FVEB 2X12A 4UDUB 5A70A 4BIOA 5C0EB 2Y6JA 2HUHA 4N2DA 4YO0A 3G5ZA 3BEVB 5I5IA 3QWNA 3K71A 4ODHH 1WCKA 5BV7H 1JOIA 1NDGA 3Q44A 4IOSD 4LASL 4AL8C 1XIWC 5HGAA 4QHKI 2O5ZH 4HPHA 3DRQB 3WP6A 4NC2B 4WHTB 3SOBL 3L45A 2XPYA 3IDJB 3VM7A 3CVIL 1IGFH 3HS0A 1T2XA 4Y7OC 4AM0B 4BIFA 4R8HA 3BVWA 1NZIA 1X9UA 5FWJA 4V1PA 1IB5A 5G55A 5D1XA 1ASPA 4FTVD 3PAVA 1AR83 4APXA 5IMOA 3PIQA 1S7WB 3U79A 4OD2B 2P52A 2DMGA 1T1YA 2NXYC 2VO8A 1CAWA 1NCQB 4JFFA 1HAWA 4NQCE 5IMKB 1SLUA 5AL0A 1ED3B 2UY7B 2NTFA 3L3IB 5EOTA 1K5WA 3TT3H 1FRGL 4LOUD 1JFQL 4O7XA 3SKMA 2A73B 2CXKA 3NJFA 5EU3A 3W20A 3JD73 5IB3B 1XNCA 3DGGB 5T52A 4HXBH 4GKNA 3QI9B 2BINA 4BDVA 4HPYL 4O51B 4E36A 4XP1H 4HKXB 4K55A 4HG4J 3QDGE 5EN3A 1RD6A 2IPKA 4QF1A 2MOGA 1JU3A 3D2UB 1H3XA 4PBOA 3ASOB 1DCEA 3UZQA 2FR4B 2FO4A 1BMWA 2ZP0T 4DGVH 2HPOA 1C4RA 5KZCD 4MJIE 1RH8A 2CRYA 1JHTA 1T66C 3QG7L 2OTPA 2MCPH 5F89A 4R3SB 1FL6B 4WVWA 2K6WA 3QXWA 4ZFGL 3IM0A 4Y1XA 1NXMA 4LLYA 5A32B 4BRVA 5FB8A 3QRBA 4QXCA 1UWEL 2R041 5CAZA 4P2QA 4XPVA 4LCWD 2JDAA 5JWPA 5MI0B 5DQ9B 3A24A 5MEPB 3VXQB 2D2CC 5FUOL 1K4DB 3VFWA 2VSDA 3ZDZE 2NW2A 3FAXA 1F90L 1XL4A 4X8NA 4Z7QF 2P5EB 4P57A 3I9GH 3OKKA 4NCDA 4Z7VE 2WT2A 3HNMA 2ZXEB 3QULA 2YXMA 2V37A 5ADPL 1UXXX 1IBDA 1FQ9C 5IVJA 4DKFL 3BVCA 4ANXA 1UFUA 1NCUA 2QV2A 2XWCA 4B27A 3R0MA 1BWMA 2CIIA 3S48A 4FMKA 2J12B 5JVVA 3VFOA 3MYJA 4B53A 4GRLD 1NAEA 2BSSA 2E3VA 3M46A 3QSKB 4N25A 2XI9A 1BOGB 2HG0A 2XVKA 4WWKC 3WNIA 5IOPB 1CE1L 1OD7A 1ZV9A 3IDJA 3N7KA 5FK7A 4PCTA 4Y88A 5AWNH 3WD5A 5C07E 3SDXB 1ZLEA 2HG5B 1ZV5A 4MNQE 4YLBA 4ZO9A 3MR9A 3V8OA 1XNDA 2D6KA 1MEC1 3FB8B 1HB4A 5TGBB 1MLCA 2B08A 1OWWA 4Y20A 3FB7A 1G5GA 5C0BA 1PKOA 4LBEA 1OGAD 4HWEL 2D9QB 2FRGP 5ALCH 1AL0G 4L0PB 4FFZL 4PB9L 4KH2A 5I1EH 5DXDA 5F37A 5HV0A 1L3NA 4AYEC 2ZBJA 3AXEA 4RQQB 2ATFA 4PGCB 2Y07H 5LN8A 2BW5A 5KUKA 4J6IA 3V56A 1BREA 1W16A 2B3RA 3MRJA 5AALA 2EO9A 4HIPA 3WFHA 2JLPA 3JQWA 2QPSA 1EXUB 1XF5A 4ES9A 4NC1C 4Z7OE 5D5ME 1JF6A 2P4EA 2IPUG 4FP3A 2HVKA 1U91A 4WEBH 3UYPB 2ZMKA 2CV6A 4YEFA 2V73A 5IQ9A 1JUIA 4BXFA 4EN0A 4N20A 1CPMA 4KVCL 4WVRA 2J2ZB 5H37H 1SLBA 4TULL 2F54A 5TK4A 3KPPA 5A32A 1E6JH 3LPOA 3TVMB 3T1FA 3WY2A 1LU2A 4TOYL 1OXCA 5GJSL 1BYPA 2ZUYA 4GMTH 2YUEA 1MJ8H 3F58H 3HZKB 2BRRL 4HPKA 1OTSC 4BJ0A 1KDKA 1RULL 4MNQD 1A9BB 3FPYA 5IK5A 3QPXH 4J1UA 2XV2A 5HYSA 5DHMC 2NW2B 5DJ6B 2PCFB 3U4KA 4TQ8A 5FUCC 3TJEL 2YHJA 1RSFA 1GR7A 4JFOB 3QGVA 1ZLVH 5IHZB 2OS2A 3GSOB 4XVTL 5EH1A 3GBEA 3B9KD 4J3OG 3AM2A 3N9LA 5FGSA 2Z91A 1AHKA 4P2OA 5GHWL 3MLTB 2I9LA 4LEOA 3ZXFA 4HMZA 5FZ1A 3WDTA 5AB1A 5IQ7H 4LNRA 2DIJA 4PJ5A 3GBFA 1BFVH 3JVGC 4JANB 1AMYA 3NPSB 5FXCH 1QTPA 3K1DA 3QR1A 2ZGQA 4AYDC 3RFZA 5MI0C 1QLEH 4HUKB 1ZGLM 2LM3A 2Y3NA 3GSUA 2CO6A 2R4SH 4ISVA 2IDCA 1BGXL 2VN7A 2XETA 4KKCD 3REWA 3GI8L 4XXWC 1D7PM 3RURA 2BTVC 2VG9A 5BZDB 4K23L 4LESA 1R3JA 4LTAA 2ZZJA 3SSGA 2DI9A 4LCWE 2IGFL 5EPMB 5J56B 3VFVA 1HNGA 1MN4A 5L88L 1HI6B 4RWYL 2H8PA 3ARGD 4P9ML 4PREA 2F4LA 1MKFA 4PJEB 4XJ8A 3E5UA 4HWBH 1XF2A 5CLWA 4QDRA 1TEFA 2QR0B 5FIXA 3NJVA 1BWWA 1GQPA 2NY0C 4QB6A 1HRV1 3G6DL 1NCBH 4L8BA 5CVRA 1ZTXH 1PMHX 1MVFA 1YYML 1ODNA 1W8FA 5T5JA 5ESQA 5C08D 4FTBA 3CL1A 4P14A 2NP0A 3ZFEA 5KBLA 1K5MA 5D1XB 1I3RB 2EIBA 3QIUD 5GRYA 5C0GA 4DW2L 4FFGA 1IE4A 1MQKL 4N2MA 2AABL 4QNPE 2AGJL 2APWA 2W46A 2AACA 3IFNH 3P30L 3T3PE 4F8OA 1V6LA 5IZ7A 1DJXA 1QJU1 3VD1A 1DEDA 1N0LB 1IBGH 2Y6SC 4Y2OA 3WKMH 4NPLA 2ERJB 5HJ3B 1NFIA 2O5XL 2JNZA 2VLKA 3IDIA 5F9WB 5FY8A 1TJMA 1QBAA 4QCIB 5T1MB 5CEXB 2PLV3 3PUQA 4PTTB 4XWGL 2P44B 2Q8CA 3SPHA 1U3HD 4BQ5A 4P5TA 1XCWA 1DLFH 5CZXC 4NCC1 4NNXB 5DK0B 1HSBA 2VDKL 3QA3A 5MEQB 1QKZH 2C3HA 3WIHL 5FTTC 1LHOA 3OGRA 3KT1A 1SLTA 1ONQB 3L4XA 4ZPTB 1Y4WA 3QUXC 1H9PA 1S7QB 4H8QA 5B7EA 2WNVB 1XL6A 4W65A 2FYVA 1QJY2 4QQ2A 4F8NA 4XOCA 1Z7S2 4MB5A 1CE6A 4XBLA 3A0KA 4GINA 4XMKL 5JW4R 1QXJA 4LKCB 5EZOH 1Z5LB 3AU1B 4RYDA 2IH1A 1FNGA 2MH4A 4L37B 4OD3L 3LAGA