4AL9A

Crystal structure of the lectin pa-il from pseudomonas aeruginoas in complex with melibiose
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Secondary Sugar Binding Site Identified for Leca Lectin from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4al9A00
1HN0A 1OH3A 3F95A 3UT0A 4A6SA 4BQ3A 1W8WA 1UOJA 4LJHA 5D21A 1GWMA 1WMXA 1OKOA 1W9FA 2KR2A 4CPBD 1WZXA 4LK6A 4CP9A 4BQ4A 4BQ5A 4YW6A 2O14A 1W8TA 2WYFA 3ORJA 1GWLA 2LROA 4LKDA 4LKFA 4YW7A 4CPBA 2K46A 1L7LA 4LKEA 2C24A 2LRPA 1W8ZA 3ZYHA 1WCUA 2JWPA 3ZYBA 2VXJA 3ZYFA 2Q1FA 4AL9A 1W8UA 4CP9B 1GWKA 4BQ2A 4YWAA 1W90A 1V0AA 4LK7A
chains in the Genus database with same CATH superfamily
4OULA 3ZMNA 3ECQA 1DGRA 3KGZA 4UI9L 3ZFEB 1W2OA 4ATFA 3N7MA 2JIJA 4P9WA 2P3YA 2WAOA 2QNKA 1W6OA 3T0BA 4JV4A 5FOJB 3HBKA 3SH3A 2VQTA 5KHGA 4HVOA 3PUAA 4AI0A 1V6JA 5FWJA 1R083 4MH0E 2W52A 3FUOA 4K21A 3GHMA 2ZGRA 3C7EA 2JDNA 1MEC1 3MDPA 1JU4A 3SQOA 1SMVA 1GOFA 4XXPA 5F8PA 3AP7A 3N9PA 2Y33A 1HQNA 1PHMA 1S2EA 1VBE2 2WS92 1XB9A 1GOHA 5I8YA 2VZ1A 3T1MA 5E16A 1QU0A 3KV5A 1PGW1 3SH5A 5C7GA 1YIFA 3GZEA 3POBA 5J09A 1KS4A 2RR11 2WNVA 4BJ0A 4MUVA 3ILNA 1ZRFA 2GC3A 4YZ1A 2JKBA 1GV9A 4F8AA 4Q2FA 1C8M1 2F4PA 2BDRA 3ZXAC 1GP6A 1RL3A 3JD73 4TSVA 4LBNA 2XL9A 2YHJA 3TOJA 1BMV2 2JB4A 4RD7A 4JGYB 3ZLIA 1SQ4A 2VQ0A 3BOWA 4CDUC 5FK8A 2IWGB 2E31A 4PJYA 4LO6B 1OH4A 4MGYE 1YIPA 3K46A 2PYTA 2OQ7A 3ACLA 2HBUA 5CYYA 2OX0A 3RPQA 1XPWA 2BQPA 4WVVA 5E1RA 2F17A 4IE6A 3RVHA 1GP4A 2WUHA 3NV3A 4HOOA 3H8RA 5FZMA 4YYOA 3WVJA 4XUQA 3AMPA 4BQ1A 4JHTA 2RMU3 5E8AA 3VHNA 4XABA 4Q4W1 3S30A 1F9KA 1JMUB 2PA7A 2Q8DA 1IHMA 4NIIA 1BVP1 2BWCA 1SBFA 3SEPA 4AEDA 5LEKA 2RS11 4XETA 1HB2A 5FR3A 3N35A 4YW3A 4L9BA 4E2GA 5IVYA 2XGXA 1Y9GA 1S0GA 4Q4Y3 3J7LA 3NAPA 4O65A 3ME2A 4MGKE 3AVRA 4Q0QA 3ZR5A 1W6MB 2TNFA 1AR72 4XQWA 3U4SA 3EBRA 5FZOB 4B8EA 2ARAA 3V64A 3POSA 3WXPA 2PXJA 2QKDA 2QDNA 1K5MC 1RMU1 3I2JA 3K4DA 4MO3M 3VUOA 3VBUC 2EA7A 4V2VA 3TEXA 3VBFA 2ZGPA 5M0TA 2RE9A 3ZSKA 1QDCA 1XNDA 2W39A 1V70A 1QOOA 5A32A 1GZWA 4HONA 1AXKA 1SPPA 2ZGSA 3CJIA 3ENRA 3LOIA 1OLMA 3OYWA 4M00A 4QGLA 1JYXA 5CFDB 2ILMA 4QPIC 5JUVA 1SFPA 3V65A 2DTWA 2IUWA 3VDAA 3BTZA 4IEOA 2JG9C 3OD0A 2J1SA 1QJU3 1ZRRA 4R52A 2KXLA 4PDWC 3VD5A 4MOAA 2JECA 1XNKA 1S55A 3GYDA 4HXCA 1MS9A 2Q1MA 3AP9A 2RM22 5A7PA 2OT7A 3H1YA 1FT9A 4FPKA 2JDZA 2WZR1 1E5IA 2WFPA 4ORFA 1S0BA 2P6CA 3ZSJA 1QXJA 4HSJA 4YVSA 1COV2 3LEGA 4P5HA 4QQLA 5CFCA 2R073 4KWUA 1A6CA 3E6CC 3DPRC 2K9ZA 2VXJA 5D2AA 4Y1UA 1NZIA 3WUCA 4AFMA 1DHKB 3GZTB 4X8PA 4E4SA 1WA6X 5FDBA 1WWYA 2A1XA 4Y20B 3N7KA 3C3VA 3MFCA 1ND2B 4TN7A 4J1WA 1UIJA 4UXAA 3V0BA 5LW9A 3OEAA 2EICA 4BQ3A 3B7MA 1QOTA 1CVNA 1I5ZA 3HQRA 5TSWA 5EFUA 1AHSA 3U07A 4AQ6A 1OD5A 3GZAA 3WX5A 2R7EB 5JPNB 1O3TA 5FWEA 2DDUA 2CGNA 5L73A 5A6ZA 5EYYA 3NNGA 2ADDA 2XKOA 3ACHA 4OMCA 2WNUA 3I97A 3AYCA 3E5QA 2BPA2 1Z7S1 3MIFA 4BDVB 1RUD1 5H9SA 1C8M2 1LHOA 4XJAA 2P3KA 4GD4A 5I0RA 2PHLA 3J8F1 3H42B 4AHYA 1PK6B 3BODA 2F4LA 3KS7A 4URTA 1IGOA 3D8CA 2BGOA 2A6WA 4QPYA 3KZ4C 1PO21 5LEJA 5FY8A 1RUJ1 4W65A 3U11A 3LEMA 1PMIA 3IAPA 4S2FA 4Q4V2 3R4SA 4LNVA 1R1A1 3JQWA 4RFT0 1V9U3 1WMEA 3ZO0B 2WS93 1RXGA 3RMXA 2G9GA 2VNRA 2WAAA 4Z82A 4Y1VA 2RDQA 4Y33A 4MXWA 5C70A 3MPBA 4WM8B 3O1VA 3LPFA 1G86A 4X8NA 3SH4A 2Y6FA 1XC6A 4XAEA 1XYOA 2E53A 3OD4A 1POV1 1BJQA 2WO1A 3ABZA 2G1MA 1AXZA 1B35C 3KCYA 3ZXJA 4A6OA 1LOAA 2RS12 4LIUA 2EAKA 4G9SB 4D3WA 1C4RA 3I59A 4QXBA 1S2KA 4XF1A 5CKNA 1NLSA 1FI2A 1SCSA 2ARBA 1APNA 3C2UA 3GALA 4XF4A 2I45A 3ZM8A 4E9KA 2FZ2A 5D8AB 3GXUA 4HANA 2JDAA 4JGZC 4NHXA 4CA9A 3LIGA 3UT0A 3POYA 4AHZA 5FY4A 3ZFGC 1CAXA 1UOJA 5IHRA 1VALA 4XQDA 3DXTA 4R9DA 1NXD1 1TZOA 4IE0A 2V4VA 2D3PA 3NVCA 3UJQA 1LHVA 5EXOA 3JZVA 4XF9A 2YC4A 2XL7A 1VBC2 2NZ9A 1W2NA 4WVZA 1YXWA 4TLGA 1U5XA 4PI0A 2VTFA 4IV3C 5FZIA 3RGBA 1EPWA 2ZKNA 4MXVA 4YW1A 3RYKA 3UV9A 2DCTA 2DUOA 3B94A 3WNLA 1AYM2 2DBIA 1DBNA 5FZBA 5JOYA 5J36A 4UFMA 5LY2A 4D6RA 2BGPA 3PIJA 2DU0A 1NXMA 2YPJA 4YG0A 5FZKA 2O0OA 2PHUA 3MIBA 4YPJA 3T2OA 2FQPA 3MGUA 2WL1A 2XR4A 1VBB1 3P5BA 4JVAA 1C28A 1OOPA 4A7YA 1BBT2 5KXEA 4CUBA 3GBWA 2WZR2 2N7GA 1BZWA 2WNOA 1JUIA 2XUEA 1YQ8A 4M4PA 3AFGA 5F9TA 2QQWA 4RN5A 5BYNA 4NAOA 5A6XA 1O5UA 2PHRA 5L9RA 3E1F1 2KD7A 4JAAA 3HNYM 1XNTA 3ZDSA 1GWKA 1XNBA 1OQDA 2CWMA 2XQXA 3ZSEA 1YRZA 4FBFA 3J9SA 4RFRB 4LO8A 5FZ6A 5FYBA 2XVGA 3RFRA 3TBDA 3T0AA 3THCA 4NIDA 2V5DA 4CDXC 4EN9B 3AP6A 3PUHA 2DCJA 2XMLA 3HR9A 3E5UA 3MHZA 4BCUA 2RM23 1MVEA 1OKQA 4CDUA 2WNEA 5DXDA 1RIRA 3N9LA 1BEV1 1Z7S2 5JCTA 3ZXKA 2NYYA 5FAXA 1UOGA 4CPBA 1TMF1 1MQTC 2FMYA 3J8F2 2HLEA 1COV3 3D5OA 4KBZA 4IE4A 1MPXA 3ZXLA 1MS4A 5FO9B 3JB8A 3VKFC 4CU7A 1RUJ2 4IEPA 4GWNA 1LAJA 1OA2A 2OUHA 3WZ1A 2ORZA 3WQ7A 3K3OA 3F95A 1EAH2 3AKRA 1AYN2 2XWBB 5C5TA 4Q0UA 3MUZ1 1W9WA 3I54A 3ZFFB 4LO7A 3G6JB 1N1VA 1NCQC 3RRDA 3HMYA 5LA1A 2O14A 4I0BA 5I0TA 4CDQC 4E4HA 2CNAA 5L7OB 1L7LA 4XTMA 3RZLA 4OHYA 5DUVA 1LGBA 3IDCB 4K8RB 5APAA 1A3KA 1AJKA 1W8OA 4AAXA 4PF5A 4JKKA 3VKMA 2AGSA 2P1BA 4Y1ZA 5FP4A 4QPGA 4E4DX 1K5MA 1UKGA 2PFWA 3M4FA 1FX5A 3VBUA 1OMIA 1AR62 2DTYA 3I4IA 3VBHC 4P14A 2C1FA 1UKRA 4CCCA 4WM7C 5HCBA 5F5IA 4GXLA 4Q4V3 1IKPA 5FJHA 2J1TA 4WVMB 5EP9A 2WT2A 4KGQA 4I01A 3OBAA 2HWD2 3INAA 4Y26A 1ND3B 1HB3A 5GZCA 4GJZA 4QPIA 5JMOA 1CAWA 5ABJB 3F2ZA 1VPHA 3LDRA 2JG9A 5A3OA 2DU1A 3AYEA 4JCKA 1OT5A 4YW5A 4FSJA 4PDWA 2WQ8A 2AR6A 3LCPA 5DUUA 3ZIWA 3A22A 1ENXA 3NV2A 3LWCA 1AZDA 2R1DA 4Y5SA 2R042 2P2KA 1GUIA 2TUNA 3AKPA 5GLZA 3I8TA 5J98B 5JOWA 1UIKA 4HG6B 1FNZA 5EJ3A 4IGQA 2X10A 2WZ8A 5FY1A 1BLZA 1AL21 1VB2A 1ZBE1 3HD8B 1VBB2 2VCBA 1IOAA 1O4YA 4IEZA 1JHNA 1GNYA 3IWZA 5B2GB 4YVWA 5A3WA 5F3CA 1OSGA 2QQJA 2XVKA 1OD3A 1YFUA 3DPRA 1JYTA 1QH7A 3ORJA 3PLQA 4BZ4A 3T09A 1GBGA 4MLOA 1FMD3 1CPNA 3W9AA 1ODNA 4AW7A 5FXVA 3RZKA 2Q8EA 3EJKA 1ZRIA 3H7YA 1F2NA 5GALA 1VBC3 1HXS2 2P3IA 1UD1A 5T5LA 5IVVA 3GCWA 2ZGNA 3D0SA 1J3PA 5FYHA 3O1PA 1AYM3 1RHI1 4GAZA 3RS6A 3VHOA 2HYXA 2E9QA 3BALA 1V6IA 1YYNA 1AR92 4YM3A 2BNNA 4IESA 4QDRA 2ZX1A 5A1FA 1CAVA 5K4LA 3WF2A 4U36A 3VB9A 1SFYA 1ST8A 4QGMA 3BU7A 1V6MA 1BBT3 1V6LA 4IGOA 1J1TA 3UGFA 4DIQA 5A6YA 3WLUA 1VR3A 3AX4A 1HRI1 2AENA 2PQSA 4HSLA 5FYTA 3WF3A 3VBSB 1NQJA 1DCSA 1PMJX 1ZZ8A 1UZVA 2V72A 4NE9A 4OCTA 4QX2A 3WNKA 4FOWA 2NM1A 5L19A 4NUBA 4K1ZA 2BRTA 2QQVA 1ULPA 2GP5A 2PHWA 1S0IA 2PLV1 5IAXA 2CAVA 1W6PA 2CL2A 1F5JA 1I3HA 1H8TB 4N43B 2A71A 3P1IA 1RUE1 4QD2A 4KH9A 3KF3A 2B9VA 2XJQA 2HBTA 1B35A 1YQ5A 4CP2A 2VCAA 4LO5B 3PTYA 4JGYC 4XFIA 2CV6A 3H8UA 3OBZA 5FPZA 3V0AB 4PT6A 1P8JA 3ZKYA 2ZTNA 5BNQA 1W05A 1JODA 5DG1A 4H3WA 4XQ4A 4UFHA 3Q8FA 4UT5A 3I7DA 4JGZA 2RJLA 5SV8A 1JZ7A 4UOJA 5GLWA 1VAMA 3ZFGA 3RYPA 2RDRA 4FP3A 2VXRA 5K7PA 2GP3A 1RJ8A 4FVVA 3AVSA 4XJ8A 4DY5A 2Y0OA 2JG8B 4UW5A 1KRIA 2JD9A 4YFZA 3I3BA 3ZPOA 3KWVA 4Y1XA 1BK1A 4XFAA 2WQ4A 3VL8A 1EAH3 1AYN3 4RR3B 1OA4A 1WW4A 5FO7B 5CG8A 3GBFA 4Y5Z0 1NA1B 2XVLA 5HPOA 4IV3A 1D7PM 3ACGA 4D7TA 2VECA 2B4KA 2FDHA 5CU1A 4P5YA 5JAXA 1CN1A 1UX6A 5CKMA 2NN8A 1UU6A 4ZXEA 1CAUA 3SNMA 4C1WA 4DRVA 4TZDA 3TRSB 5C4WA 5JOZA 1WBLA 3LZZA 1RUI1 4XUNA 4CYDA 1XSQA 3VBOC 3ALQA 5JPMB 5FY9A 1S4CA 5DZEA 4XJUA 2UWAA 2RVAA 3KB5A 2Z69A 3K48A 3LFIA 2VW2A 3AXEA 4JDOA 5CADA 5KXBA 3A4UA 4XUOA 1AR63 3WDWA 4CP0A 3C7HA 4LHNA 3DN7A 2QQPA 3KVAA 2ZPXA 4HBNA 4IV1B 2GMMA 1SLIA 2VMHA 3LA7A 4UW3A 2E33A 1S0EA 3HIFA 4KWLA 1W06A 3UETA 1DYKA 2WA4A 2HWD3 2AEYA 3C8XA 2UU8A 4Y3OA 5FZ7A 1G9FA 2Z42A 5A33A 4BQYA 4ZZ5A 2WDBA 2D5FA 3NRUA 4NOTA 1ASJ2 2FDIA 1DYOA 2R062 3AKQA 2VJXA 1FOD1 4GWMA 4LR4A 4IGPA 4CDXA 4EN7B 4BU2A 3CJIC 5FBJA 1HB4A 1W90A 3WY6A 5FYCA 1YQ2A 4AYUA 3OSDA 5C6CA 3NWKA 1W6QA 1RVF1 2YY1A 4F7ZA 1LECA 2R043 4L99A 1RHI2 5LA2A 2WLPA 2XKPA 1B09A 3VLBB 1WMXA 2BVVA 2RG4A 3AM2A 3VZJA 3T0DA 2PHTA 2DWRA 1ODMA 1MQTA 2VY0A 4P9GA 3AL5A 2HWC1 4P08A 1LODA 3AXDA 2D6LX 1NCRB 2ENRA 4I3GA 1HQWA 4JQRA 5T5OA 1IPKA 1VLNA 4COVA 1C5IA 2VMEA 4FTEA 2EIBA 3KT7A 1ND2C 4LOTA 1LOBA 5FP9A 1OHFA 3BVCA 1UOBA 5FZAA 3RNSA 2BJSA 3LFMA 4JRLA 5CFCC 3FLPA 1JYVA 1W9SA 4AFCA 1NZCA 4OUMA 1HXS3 5FZHA 1J1LA 4OHXA 4Y4YA 3LDKA 3CNAA 2B42B 1NCQA 5DZFA 4BYYA 1ZBA2 2W94A 2XBO1 2XG3A 4LORA 5FYMA 3RJ2X 4HKOA 4X6QB 3UKNA 1O4TA 2IXKA 4PIXA 1SG3A 1UYPA 4LTAA 4P00B 1AR93 2G19A 4IEVA 1XYPA 1M06G 2C24A 1EYBA 3OB8A 5ACA1 3L2YA 1HW5A 1PIV1 4AFDA 1UN1A 5JR2A 3PL0A 2CTVA 3TEWA 4N7UA 1SLCA 4LLOA 3POFA 5FMDA 5FK7A 4AL9A 4DINB 5FREA 4JRAA 2W95A 3VBHA 4IL7A 3SC7X 2JE8A 3MV01 4KNCA 1GQPA 2LW8A 2MPFA 4WM7A 5FZ3A 1FNYA 2VZPA 1WCSA 4I0AA 2AUYA 3GZUC 4XIOA 2P3JA 5FMOS 1OF4A 4WM8C 2ZA9A 4CRQA 4Q27A 3PJYA 2F6BA 1JZ8A 5A1LA 5L9BA 2PAMA 4WZFA 4GZ9A 5T3NA 3MF6A 1WBFA 2OIIA 3VV1A 2JICA 3JXSA 2D3RA 1US3A 4LBQB 1ZVFA 1X36A 2VVFA 4RHV1 3SCFA 3A7QA 4AEJA 3S7EA 1CX1A 3DGTA 3M7AA 4COWA 3FN9A 4MGQA 5DAQA 4LHLA 1MZ5A 1V6OA 2W2IA 1UZYA 2XPJA 1C1LA 1TME1 1R091 4ZPIA 3ZYIB 1UOFA 3FLTA 4MX3A 4CP9B 1VRH2 3VKLA 3MEPA 2VE1A 4NRQA 4ET7A 5KXDA 4HN1A 1J84A 1W28A 5K0UC 1GR3A 4ISQA 2GMEA 2VPVA 2TEPA 1D4M2 2ET1A 1CPMA 2C5DA 2UY9A 4FT8A 1H6XA 4HT1T 2WLQA 5F5CA 1EV11 2DUPA 1ZZ6A 1MZ6A 4XF0A 3MW3A 4B7EA 3GBGA 1POV0 1ZREA 5KWRA 4COUA 4D8MA 1UPSA 5GZDA 2BERA 2H6BA 2HH9A 3DF0A 1G6NA 4YW6A 5CAZA 5AFEA 5DDJ2 3S5AA 3P3NA 1OPMA 3ZFEA 4IEQA 3AZZA 5GLVA 3B00A 3ATGA 4AHXA 5FKCA 5F6LB 2VZOA 3OUHA 4S2DA 2ES3A 2HWE1 3FL7A 1UMZA 5FP3A 3WF4A 4QDQA 2RS51 1DDLA 5T54A 1K42A 3USUB 1LKNA 1UCXA 1RVF2 3BGAA 1K45A 2HWF1 4IEXA 1IKQA 3G7DA 5AC91 2XDVA 2A7AA 3O1MA 4GB32 4A7KA 3RZHA 3DECA 1OUSA 4XJZA 2OW4A 4CU8A 1H9PA 1UY3A 2RDNA 4K1YA 2ZX4A 3W21A 2WWUA 4M3CA 4JHZA 1REFA 2VG9A 3CU7A 2XJPA 1OOPC 1YNAA 4XTPA 2D44A 2VOVA 4QT6A 3HWJA 3FZ3A 2BEOA 1UWWA 3I2HA 4PLNA 4E8DA 4OUSA 1W2UA 3VZKA 1ASJ3 1VP6A 2X5IB 5A3PA 2R063 1L7QA 3WP5A 5EWSA 1OI6A 2VZTA 3WW4A 4AZZA 2P37A 4Y22B 4LULA 4YNIA 4QU1A 3SCGA 2AZ5A 3VDDB 2YYOA 2E7QA 4B3NA 1UL9A 2VMIA 2WRAA 5F32A 2OKXA 4JGYA 4UWDA 4AFAA 4YZ2A 2XBO2 4IDZA 3ZOIA 5B4NA 2ATFA 3JBG1 1WA4A 1ZA4A 4XHXA 5F3GA 5FZ0A 1QJY2 2D7FA 5FZ8A 3BTXA 1J58A 1ZRCA 2QFEA 4AG4A 4FFHA 3MBWA 3EB7A 2WWSA 3RQ0A 1W6OB 1WD4A 4AR2A 5JXJA 4DXTA 1FPN3 2WT1A 5A3MA 2VMGA 1AR83 3SEEA 1WLDA 1QJX3 2D43A 2EXKA 1U12A 2OUJA 4GQ7A 1D4VB 2A75A 2X53S 4J25A 3R6SA 3WNXA 4BISA 2Z79A 2JJ6A 3NV4A 5EJZB 4OI1A 3IDAA 1GP5A 2PMWB 2VL4A 1MVQA 4Q4X1 5CEHA 4R9AA 4FTSA 2W92A 2HKXA 4P02B 1Y43B 4BK5A 3RZGA 1EY2A 2C9AA 1YEWA 5L7OC 2V4AA 1ZBA3 1QXPA 1UU4A 3ZYPA 1FXZA 2GNBA 1W03A 3N9MA 1QMJA 5JDBA 5FY5A 4GMP1 2B39A 1KJRA 1W6MA 5IT6A 3ZXFA 1DQ1A 4RGAA 2WNVB 3KVBA 3VBOA 1PVC2 3ZR6A 1UYYA 3WHTA 1YFXA 1WCDJ 3T2PA 4QPWA 4IW3A 4NVPA 3PU3A 2ZHLA 5ANQA 5FUNA 2AACA 2XJVA 2VUDA 1LOFC 1WW6A 4TXWA 4XOGA 4BB3A 1ULGA 2IXIA 1AVBA 1VBA1 3AL6A 3HN3A 3FMGA 2ZOEB 1BQPA 1YI7A 4OI0A 1JN2P 1E5SA 1GOGA 1ULFA 3LEIA 3LSEA 3ZYGA 4DNYA 4L97A 1AL0G 4QPGC 4AEMA 4COZA 1HJFA 4NO4A 3WDUA 3NNFA 3KQRA 4QQHA 4AEKA 2ZABA 5GKAC 4CPBD 4XVHA 3QLQA 2VBPA 1GKBA 4IETA 4RS5C 3RZJA 1O59A 1W8ZA 4D7YA 4CEWC 2X09A 2ZHKA 4I02A 3ZYBA 3ZYFA 1V6KA 3WUDA 2ZGUA 1Z78A 3O1RA 4GALA 4Z92B 3AZVA 2P5BA 2O1QA 1PX4A 1V0AA 2HWE2 2JD4A 3EMRA 4M0HA 4NHYA 4CU9A 4AEDB 1VRH3 5A7QA 3N9OA 4EV0A 3B01A 2GC0A 1PMHX 4PBOA 3FJSA 1AUYA 2VW0A 4BE3A 1RUH3 1D4M3 1R1ZA 2BZDA 2WO2A 4CUAA 4F3JA 3NAPB 4FPFA 5A7SA 5DG2A 5LRSA 1JU3A 5CKQA 3W5MA 3T2QA 1Q56A 1REEA 3WW1A 4OYUA 3WCSA 1ENQA 1ND2A 4YZ4A 3C7GA 2Y60A 1HRV1 3VBRB 1T2XA 4YVWC 2UYAA 3IN9A 4BWOA 5A6QA 2NMOA 1O8SA 2QZ3A 4KMQA 4RYDA 5DDJ3 3VBFB 2GC2A 4M3CF 1UQXA 1MEC2 5HXVA 3U0ZA 4Y4RA 1X8MA 2ORXA 5FMBA 5I8TA 4MYEA 1GZWB 1SPPB 1WKYA 5DUWA 1PM4A 5IK4A 1KFXL 3BI3A 4P9XA 3UESA 2C4XA 1W8NA 2CY6A 3QH7A 2XXZA 5GLTA 1PK6A 3VDBA 1PGW2 1AX1A 1US2A 3JU9A 4B4PA 3IAQA 4IEYA 1ENSA 5FMOL 4AI1A 1Z0HA 2DFBA 2RR12 3HEIA 4GB33 3HBZA 3SKVA 4S2HA 1S0FA 2WYFA 4FFGA 4AGVA 1QQP1 2W3JA 3MW4A 5C3PA 5LA0A 2CGOA 4M0NA 4W50A 4ZY9A 2VZSA 1NOVA 4BIOA 3DYMA 3PMEA 1ZZBA 1CZSA 1RUG1 4YVSB 4WM8A 2LRPA 4GH4B 1H8TC 2ZGMA 3FC0A 4IUGA 2DVDA 5GJ6A 5BNOB 1SLLA 3K4AA 2YMZA 4QX5A 4DXZA 1VBE3 4UAPA 4TWTA 5FZFA 4I30A 1TQ5A 1QHDA 1MACA 4K8FA 4MADA 3BPSA 4OZOA 5DABA 4LE4A 4Q4W2 4AVSA 2ZCWA 3GJBA 1IS5A 5T5PA 1BKZA 2SLIA 2ZGTA 1CIYA 1QJY3 5K0UA 1DF0A 3M8LA 4AVCA 2IFRA 2BTVC 5BNNB 2VGDA 1H9WA 3PU8A 1Q5OA 5LATA 2GNMA 2WNUB 4XYXA 1IG3A 3SXWA 5C9AC 4OZXA 3WG1A 3QBQA 5BY5A 5CA6A 4LBKA 4EWAA 3PVNA 5FQ0A 1W8HA 4EJRA 1ULOA 1IG0A 3E5XA 1YCIA 3U78A 4RR3C 4XBLA 4BOWA 3B02A 4QX3A 4G3YC 4LOSA 1XJAA 4Q29A 4FPHA 5CNAA 2Q30A 1RMU2 2A3YA 1D0GA 3KD4A 5BNPB 2EXJA 1BVVA 2Z5WA 5AFBA 1NY71 1RUNA 3PMSA 1VB4A 4Q8LA 1UYXA 5CIRA 2WBKA 3VN4A 1UZ0A 1E57A 4MXWB 2H0BA 2Q1FA 1Y3TA 2J7MA 2WFF1 1VJ2A 3FWEA 2PQQA 4N90A 4QXCA 1CX4A 1PVC3 2OVUA 1NT0A 1PO11 4CEYB 4RGGA 2ZEYA 1EUTA 5FO8B 4GKXA 1LB2A 5BXXA 5CG9A 2Y6GA 2VZUA 1NE4A 4BQWA 4ZS3A 1H2MA 4ITCA 1OKOA 1AR73 2ZS6B 5HCFA 3TN91 2DVBA 4MZUA 3VD3A 5C5UA 2VNOA 3E97A 1MS3A 4HL0A 5F3IA 1JZ4A 2RS31 1KDMA 1HRV2 1QOSA 2A3XA 4FQ4A 1VBD1 3IPVB 4NMIA 1TE1B 3PVOA 4QM9A 1VAVA 1SBEA 3H0OA 3PNAA 2R30A 4KL1A 3O7OA 1QGLA 2AREA 3W5NA 4I09A 1XYNA 1F15A 4BQ2A 1WUVA 5A3TA 2JXAA 3OBTA 3AKTA 3FHIB 1UO9A 1JHJA 5FLJA 4CP1A 3IMNA 4R4XA 4ATEA 4NROA 3D0JA 4EWDA 1ONAA 5I91A 1Y9QA 3H9AA 1O3QA 5D21A 5IVCA 2BOIA 1JOBA 4MGZE 3WQ1A 1JZ6A 2WR9A 2DYCA 4K40A 2UY8A 3CDZB 3OJBA 2VZ3A 5FPBA 1BCXA 2VVDA 3AJZA 2VOKA 3HPNA 4B29A 5C3OA 2DVAA 3ETQA 5A3LA 1QWRA 3LA2A 1O8PA 1RUD2 3OBRA 4NAMA 5JI9A 4URAA 3O12A 1MS0A 2ZMLA 4HETA 1TG7A 4ASKA 5IATA 3S6PA 2YV8A 5IWFA 1I9RA 3ES1A 1PO22 4CCEA 1MEC3 4N53C 4RQPC 3NW4A 5EJ1B 3CO2A 1C3HA 3O1TA 4DXSA 2B46X 5L7OA 5FJKA 2AH2A 2C9KA 3KT1A 5GM0A 2XONA 1R1A2 5F5QA 5FMCA 2UWCA 1GWMA 4BH9A 2RHPA 2A73B 5BPXA 1KQRA 3M3IA 3AZWA 2BP6A 3KMHA 5FP8A 2LS6A 3IT8A 4QU2A 5T50A 1LR5A 4QWNA 2A6VA 2FHRA 2RDSA 3IMMA 4LIVA 5LK5A 2RR13 4Z8BA 2Z4FA 4H55A 1OQ1A 4KG8A 3T4VA 3L9JT 4PHZA 1LOFA 1WMDA 3AMQA 1RUC1 2OZ6A 1C8M3 2ZMNA 4AAPA 1H1IA 5KHIA 2W46A 1A8DA 2DCKA 4INDA 4CDUB 2CGPA 4EZ4A 2ZMKA 1N3QA 4E4ZA 3VHRA 3UNPA 2WT0A 3DV8A 4HFSA 4LITA 5JSOA 1G9AA 1PGL1 2DUQA 2GH8A 5IVBA 2YU2A 1DU3D 1F8VA 3B5LB 3J7MA 4RS5A 5C8WA 3J7NA 1G9BA 4DFSA 4CEWA 3SMHA 2ARCA 4IEUA 4BHPA 4CUGA 2VUAA 4LKDA 3H8OA 2BOJA 1VRBA 3H1WA 4XMIA 3BYWA 3ZXEA 2XH6A 2MHFA 3AYDA 3UJOA 5L36A 4P9LA 4M01A 4Q4W3 4QX8A 5E88A 2FDGA 4LUKA 1ENRA 3RSJA 3K3NA 1UY4A 4AK3A 5JR7B 5KHHA 3PDQA 3ZIXA 5BUVA 2RS13 1NKGA 2MEV1 4NHKA 1OA3A 1G7YA 2HWB1 3Q8CA 5I0UA 1JYNA 3N7JA 1W0NA 4KGGA 1RUF1 1TNRA 4R4ZA 3BB6A 1T6BX 2EF6A 3RZMA 2GNTA 3TN92 1LEMA 4L0PA 2W47A 5JIAA 2XWJB 1MS1A 4GWJA 4I3PA 2A3WA 1RMU3 2YG0A 3KCXA 3WR0A 2X8KA 1DZQA 4LBJA 1ZX5A 4RSUA 1LEDA 5C3QA 4D7SA 1VBD2 2LM3A 4LA2A 2HEVF 4XCAA 1N3PA 4UBHA 1Q8PA 1CAWB 2R0HA 3S5QA 4NHMA 1K5JA 1HLCA 3FE5A 4QB6A 1W0OA 4R8HA 4YGEA 1PNGA 4A3XA 3LOBA 3WQ0A 2JG9B 3OY8B 3MV11 2GN3A 1X9TA 5FYSA 4XPVA 2V73A 2VTXJ 3VGIA 5FRAA 2EXHA 4PDWB 1R081 4SBVA 2FBEA 2D6NA 5LY1A 1URXA 2Y6HA 2QE3A 3CJXA 1XE0A 4UFKA 4DOUA 5DAVA 1SEFA 1OLRA 3O1SA 4LBOA 1SLBA 3OPWA 2Y6KA 4LA3A 2WZEA 5C4WC 2WZR3 1BEV2 4CE8A 4PQ9A 4XFGA 4QKNA 5DQ0A 1H8TA 4N43A 1TMF2 5DAWA 4CCMA 1CZVA 1DZRA 4Z2AA 4HVQA 3RI8A 3NO8A 2ZKLA 2E51A 2BW8A 4YW4A 4OI2A 1ZRDA 4TTGA 1O3RA 5F39A 2A6YA 1WGPA 3WEZA 3I3MA 2KM2A 1O3SA 4AVVA 5FZ1A 2V09A 3JD71 3WDYA 4Q1RA 1KDKA 2XUMA 3MIEA 1XBFA 3VKOA 2QCSB 3KQ4B 1C1FA 1LULA 1NAEA 3FUQA 4HLTA 4A7ZA 3CLPA 3PIGA 2DCZA 3ZKUA 5AVAA 4QQPA 3FHQA 1N1TA 5C9AA 3AKSA 1JS9A 2JG8A 4H7MA 4DRRA 5IYYA 1CAVB 1Z7S3 2FCVA 4MSVA 2WKKA 3WG4A 5CISA 1RUD3 3BTAA 5JVVA 1JXNA 1U5ZA 1H1AA 2QBXA 4RR3A 3J8F3 1W04A 4RL7A 4CDWB 1REDA 1UY2A 2YFZA 5EHDA 5JZGB 5FLHA 3ZXDA 5HBAA 2RMU1 2O8OA 1OH3A 3BN6A 4AQ2A 1CJPA 4BPZA 1PO23 3ES4A 4LPLA 2A5ZA 4Q0PA 1RUJ3 3GDBA 4QX1A 1J59A 4NR1A 1ULCA 1NE6A 1KGYA 1XXNA 3UYJA 1W9YA 1R1A3 2ET7A 1W2TA 5CB7A 1S0JA 3ZSLA 2UYBA 2XJSA 3Q8AA 4Q4Y1 1UZWA 5LBCA 3U75A 1O6UA 1SZBA 3WP4A 2O8QA 4JX0A 1Q3EA 3OGSA 4QDSA 2B45X 4QB2A 3TNPB 1LENA 4FPJA 3SHRA 1OLME 4DZGA 3PUSA 2BFUS 4QX7A 1HV1A 2I2SA 4XDPA 1B35B 5SV5A 1LNSA 3GGLA 2XJUA 2VZRA 3NQHA 5FYVA 3M2MA 1POV3 3OG2A 4YRDA 3SISA 5GLUA 1ULEA 4W6XA 3H3ZA 1Y4WA 2MEV2 3PVEA 4AGGA 4EZHA 5JXIA 3JUUA 1O91A 2QQLA 2BNOA 2ZHMA 4R9CA 4GMP0 2BBAA 1UXXX 1AL22 5IW0A 1ZBE2 2NQYA 3ZFGB 4OQ9A 4AVBA 2ID4A 4XCBA 4CUCA 3AMNA 2WQZC 2KA3A 2D3SA 3O0XA 2QVSB 1ZYBA 2E6VA 2VH9A 5CFDC 3ZYJB 3KCCA 3O0WA 3O1OA 4TYSA 1LU1A 1D2SA 1K3IA 1NX9A 2D93A 2EIGA 2MNGA 2VMDA 1QJU1 2GU9A 3OPTA 4H7LA 4UYBA 2CDPA 2VBDA 1WW5A 3X29B 4RGKA 5FPAA 2YFUA 4FOQA 2WIIB 2H0VA 4XC9A 3TEYA 2ZGOA 4RA0A 5A7OA 2VNGA 1QNYA 2B7YA 4A41A 4LO4B 1CAUB 3LE0A 3UL2A 3WDTA 3CF6E 4UFIA 5C4WB 2QQIA 5G05L 5A7WB 1VMFA 3BCWA 1W9FA 2R071 1GQHA 4UFLA 4WZCA 2WSUA 5EYXA 4K6BA 4META 5HCAA 1J3RA 4QXHA 3VBRC 4S2GA 3ZN6B 1KD7A 2P17A 4BQ5A 3GNEA 3APBA 1VBB3 4JKMA 2ZBJA 4AI9A 5IVJA 2K46A 1W6NA 2AEZA 2ZGKA 4A4AA 5GZGA 5JOXA 4D69A 2ZX0A 4FP2A 3FLRA 1SCRA 2GC1A 1FV2A 1HRI2 2VC9A 2Y26A 4N53A 4NPMA 4RQPA 2Q8CA 1LOEA 2VR4A 1SLTA 2QQNA 4ES9A 3D82A 3TNQA 1NLRA 3ACIA 1CZTA 4H2AA 3GJAA 1ALYA 4AI8A 1JZ3A 5A33B 4XE9A 3QACA 4WVWA 2PLV2 5LK7B 3CBNA 4WBBA 2YBKA 4XEZA 5JMCA 2DF7A 1SDDB 5I0SA 2W87A 1RUE2 2ZGLA 4OUEA 5KR7A 4HPKB 5IK7A 2ZJCA 2EVXA 2XJTA 4HKWA 4AQTA 1PK6C 4NWWA 2J1UA 5T5JA 3VD7A 2ZEZA 3CZJA 5J96B 5FIXA 3K4ZA 2D6MA 2VMFA 4W4ZA 4GH4C 2E26A 3D6EA 5BNOC 1WLWA 1MQTB 1BEV3 1V9U1 2WN3A 4Y24A 2VM9A 2WS91 1LHUA 2VCMA 2RJ2A 4L2NA 4YM1A 5HXMA 2FDKA 2QQOA 1TMF3 3C7OA 4N9HA 2H6CA 4QXKA 5F2WA 4LBQA 3UGHA 3UKTA 1MS5A 1GMMA 3URFA 4FO9A 3KGLA 1RC6A 5A7NA 1E5HA 2E7AA 4YGDA 4XBNA 4LMFA 1GLHA 2OQ6A 4OVEA 4XBQA 2GZWA 3M3EA 3KF5A 2GMPA 4CP9A 1IPJA 4FFFA 2WO7A 3U10A 5BNNC 4LBLA 2W1WA 2XLFA 4NJ4A 3WDVA 2W1UA 4OHZA 1DP0A 4CXXA 5DUXA 2Y8KA 2WO3A 1WMFA 2B9UA 4CDQB 1LGNA 4XILA 5FYZA 3WG2A 2JDHA 5LBEA 4ZXKA 2XQRA 3ZMOA 3OF1A 4E2SA 5D8AC 2JEMA 2VCCA 1RUI2 1YI9A 5F2SA 4B4RA 3CIHA 4J6GA 4MV2A 4CVUA 1G9CA 4LBMA 1CR7A 2YC0A 1H1MA 3AFKA 5BNPC 4OLLA 1DYPA 2FZ1A 1N47A 5C3RA 1S0DA 3VBHB 1WCKA 5A80A 1WZXA 4WM7B 3HT2A 4BQ4A 3NV1A 1IS6A 4BXFA 3OGJA 1AJOA 4YZ5A 4GIQA 4QM8A 5C8CB 5HCHA 4AVAA 1PX3A 3OGGA 3USUA 1CJDA 2VD7A 1QKQA 1QJU2 1VE0A 3MUY1 1S0CA 1WW7A 3H7JA 3RYRA 4CEYC 3DKQA 2D97A 4JC1A 2VOTA 2ZGQA 3H50A 3R4UA 1FOD2 3CL1A 2W0XA 4BXSV 1DQ2A 4NN0A 3AMMA 1SBDA 5IAVA 2RJKA 4XXAA 4PLMA 4X6RB 1AX0A 3WP3A 3I2GA 3OUJA 4HVRA 4KU7A 4ZKTB 1W99A 5FP7A 1IS3A 1GZTA 1IQDC 2R072 4FPOB 5FXZA 4CTEA 2J42A 2NPIA 3ZX7A 5E6HA 2X5IA 1AL23 4IERA 1ZBE3 1KXGA 1J3QA 4TLFA 3U14A 2W91A 3POWA 4Y22A 4BQXA 1AXYA 2HWC2 3MIGA 1OLQA 2VZVA 5H9RA 5J1XA 5FY0A 3FHAA 4LEJA 5K9YA 4MG2A 2QDRA 3J4UH 1DFQA 3POGA 4GA9A 4FCAA 4W6WA 3HAGA 1N3OA 3OCPA 3B9IA 1UNBA 4JTOA 2RM21 3POIA 1IQAA 2QQMA 1C5HA 1D0HA 5I0DA 3M3CA 1LOGA 4Z2WA 4ARYA 4UBGA 4OQ8A 4UF0B 2D5HA 2WZPP 4YG6A 3VZMA 2E63A 2W5FA 1COV1 1RHI3 1NG0A 2JB8A 2QQKA 3WHUA 4FFIA 1GNZA 1XE8A 1UF2C 3RMYA 2ZX3A 3EXUA 3NL1A 1HKDA 2CSGA 1W2AX 2Q8OA 1H2KA 2FDJA 3MIHA 3RDIA 5ACA2 2IXJA 3N9QA 4DS0A 1H4HA 1PIV2 2VVEA 1J83A 2UURA 1V9U2 3LQCA 3M1HA 4M3CB 3UKVA 2XHKA 4XFHA 5BV6A 1QF3A 1HRI3 3LF7A 2BFUL 2VUJA 3AP4A 2PAKA 5FUPA 3ZSMA 4XIKA 2ZACA 1O5LA 4HN0A 4ARXA 4NIGA 4FTBA 2I07B 1W8FA 3ZFFC 1ZZ9A 1JH5A 5KXCA 3RWNA 3SCHA 4YFWA 3CMGA 2ZEWA 1BK0A 3CZUA 2BYVE 2PLV3 1Q8SA 4JQTA 5HV0A 1W8TA 2Y34A 3ZFEC 1JZ2A 4UW4A 1L7RA 1RUE3 2VMCA 4N9IA 5IJRA 4RHV2 1ZZCA 1XE7A 2P6HA 3ASIA 1TEIA 4AOCA 4XUPA 4CCNA 3ACFA 4C91A 2JDUA 1OXCA 4Y5TA 5FZOA 5JXGA 3BU0A 4LLFA 1CQ9A 2JE9A 5C71A 3B9CA 1TME2 1R092 1DQ6A 1PGSA 4Q4V1 2A6ZA 1X8EA 3H1MA 1CWPA 3M3QA 1XNAA 2Y38A 2XOMA 4D94A 3QCWA 1ND3C 2VAUA 2EIDA 4XUTA 1EV12 5EV7A 5CFDA 1ZZ7A 3THPA 1KEXA 4DUWA 2R49A 1ZM1A 2W1QA 4XW3A 5ABJC 4LK6A 4FXKB 1GYKA 5EZWA 5LBFA 4L11A 4AI3A 3PTRB 1I1EA 3B69A 5AVPA 2C26A 2C0ZA 3V56A 2YZ4A 2VZQA 5C3SA 3MPPG 1YQCA 3WT3A 2G9FA 2GALA 3O14A 1VAKA 1FV3A 5IFPA 2CYFA 3WSOA 3WW3A 2PN5A 5FPLA 1H2NA 1PZ9A 3N7LA 2WABA 4QAWA 3KHBA 3ZYRA 3VBOB 2GH2A 2W68A 2RS52 1RUI3 3VBRA 1NYWA 4FPCA 3GM8A 5FYUA 2ADEA 2HWF2 4FAGA 5AC92 3AZXA 1FMD1 4XZUG 3HN1A 3VD4A 1QH6A 1OVSA 3MLKA 3IDBB 4LT5A 4L8QA 2XLGA 3UGGA 2BUKA 4DUXA 1VBC1 2DBNA 3Q8EA 4Y20A 5IFTA 2Y0IA 3NKGA 4YZ3A 1WCUA 5J7MA 4XJ9A 3I3EA 1F4AA 1DGRN 2AYHA 2XHNA 3A23A 3EYPA 4MHRA 2NP0A 1AYM1 4COYA 2TBVA 5FZCA 1OVPA 1RXFA 2QJVA 2VU9A 5A32B 3N4MA 2YROA 1HN0A 3CJIB 3U37A 3OYWB 5FPUA 3NJXA 1BXHA 2VQAA 1FOD3 3NKTA 4GWIA 3B3QE 3VL9A 1UU5A 2BGCA 1BBT1 1OFNA 5FZLA 5A3NA 2WA3A 3T1LA 2NMNA 1RVF3 3USSA 4C90A 2GSYA 3JBG2 3LA3A 1QXRA 4GH4A 3IIAA 1ZNPA 3POEA 5FY7A 3VBSC 4AVTA 4P9IA 3NMBA 5BNOA 3KM5A 3TEZA 1Y7BA 4AE2A 1GFF2 2K0GA 2Q1ZB 3VHPA 4DEVA 4XFFA 1O7FA 3U4XA 1UY1A 4LKSA 2HWC3 2W08A 3H3UA 1G8WA 3OEBA 4MGSA 1I5PA 3MLJA 5F1RA 3BOPA 1LESA 4AXOA 4JZRA 4N43C 5CFCB 4EN8B 2G4IA 3OTFA 3JQXA 4EWEA 1CIWA 3HT1A 5EIYB 4Q4X2 5BNNA 3NJZA 3FFQA 2DFCA 1SHWB 4NIHA 3HVDA 1GQGA 3V0BB 4IXLA 3QD6A 4IE7A 1STMA 2XBO3 4YW7A 5HI0A 3MO4A 2FCUA 5FV3A 2VO5A 4CCDA 4NHLA 2IXLA 5D8AA 1LCLA 5IK5A 1GZ9A 2GDFA 4C8DA 1HIXA 4JTNA 4CDWC 3VD9A 5JZGC 1F5FA 4JKLA 5IUQA 1HB1A 1GU3A 2WSVA 2FMDA 5BNPA 3J26N 4D0QA 4WV8A 5ACA3 4K9SA 1PIV3 3A0KA 2JG8C 1ULDA 2ZXQA 1EAH1 2P34A 1AYN1 5FZ4A 4CU6A 4YLZA 3SLIA 1VBA2 2EXIA 4Q1PA 4CCKA 1WLCA 1VIWB 1NA1C 3HNMA 3CHXA 4W8JA 1AX2A 1T6GC 3WOGA 3POJA 1RTVA 2XLAA 4MGIE 1X82A 3MI8A 4IE5A 3ZN4A 4CEYA 2OZJA 3MLLA 1NQDA 1Y9MA 4I0WB 1RYYA 2PELA 3MF9A 1FYUA 3KT4A 4ASMB 4RHV3 3AK0A 3DYPA 3BUCA 1FATA 5F37A 1RITA 2BVBA 4FAHA 1AR61 2Z2SB 3I2IA 1XU2A 4ISRA 4JDNA 3AYAA 4QKBA 5FZEA 3DXUA 2Y6JA 5F7UA 1TME3 1R093 5K0UB 1CGPA 3L2HA 2HEYF 4ZU4A 5F6KA 3IB3A 3IPVA 2IFWA 4IV1C 5FLIA 5G04L 5H9QA 2HWD1 4AGRA 5JLVA 4OHWA 3I59B 4OI4A 5KHJA 1FMD2 1JZ5A 2VOWA 5FQ0B 1YHFA 3ROUA 4E8CA 1EV13 4M4RA 3KV9A 2B8MA 4H14A 5ISLA 2JDPA 3ZDVA 1CAXB 2UWBA 3FX3A 5FXWA 2OYZA 4DB5A 5CBLA 4KG0A 2QZ2A 2YGMA 1EPZA 4E2QA 3QH6A 2HJIA 2DVFA 3WF1A 2R041 5J48A 1XRUA 5HV4A 4KI5M 2VUCA 3T08A 4FXGB 4ES8A 1LTEA 2WWJA 1C8NA 5CVRA 4F83A 2D6KA 2YDEA 1BMV1 2WC2A 3AP5A 5GZFA 2HWE3 3DEMA 2RS53 2OA2A 3OOXA 3E6DA 2D6PA 1HJGA 1UY0A 1X33A 3H8XA 2HWF3 2YUEA 1HQLA 1YC61 2GNDA 4PBPA 4UFJA 1NCRC 3T2TA 1K12A 5AC93 4CCJA 5I8SA 3R0RA 1QJEA 2ETEA 4XZPA 3T3YA 1L3JA 1X50A 4QKFA 4XMAA 1QQP2 1GSLA 4Z1VA 1OOPB 1OPOA 3AZYA 1HXS1 3C7FA 1CONA 4FPEA 4BA6A 3W20A 4CCOA 2GAUA 4KWKA 3VKNA 4BK4A 3K75B 3LSDA 4DO0A 1RGSA 3ZFFA 3UK9A 1RUG2 5FUIA 2XB6C 4AHWA 1TVGA 1DG6A 1IZ3A 1AR91 2BNMA 1W3XA 3N9NA 4FOVA 3LKJA 3ST7A 2D40A 5IVFA 2WYSA 3AJYA 4CDWA 1YUDA 3PUIA 4LHSA 1C57A 3FBMA 3PJQA 1UPIA 1LHNA 2JX9A 2YB7A 2J1VA 3GCXA 1H30A 3JBG3 2NLRA 5J3UA 4ZU7A 4FPGA 1DLLA 5JSRA 1DLCA 4WVMA 1S1AA 2C6SA 1YWKA 1DQ4A 2VNVA 4E27A 1QY4A 2EALA 1ND3A 1KFUL 5T55A 1RUOA 4LHKA 5ABJA 5FYYA 3HJRA 2JDMA 5F3EA 2IZWA 2J1RA 4LQRA 5FZGA 3CQOA 3I2OA 1JBCA 3MW2A 3EO6A 2KR2A 4ZS2A 3K51A 3RG0A 3WNNA 4AQSA 4OHVA 2BV4A 2W1SA 1SLAA 3KLSA 5B4XA 1H4GA 4Q4X3 1WLTA 4P9YA 4YW2A 2DCYA 2IVIB 4O61A 1W0PA 3RJRA 3WV6A 1NY72 2EIEA 5A70A 4EROA 2HEWF 1NUKA 2V5YA 3DYOA 3P3PA 4HZFA 4ZU5A 4YG3A 4XF3A 4BLIA 2OPWA 5LRRA 3IKWA 3ZVXA 4U2AA 4PI2A 4GMP3 2JIGA 3TAYA 2LALA 2WFF2 4FQZA 2IC1A 4NPLA 4G4FA 4B7KA 2E7TA 3WCRA 1U5IA 3NNJA 2J22A 5FBZA 5A1AA 2PHDA 1PO12 2VQUA 2JDKA 1FAYA 4V1PA 3THDA 1HDKA 1PZ8A 1R64A 4QMAA 5C8CC 3S0MA 2ZAAA 1VBA3 1F31A 2IVJA 4QPGB 1K5MB 1MZFA 5JWPA 3MZHA 3EQEA 3VBUB 2AC1A 4HK8A 1A34A 3AMHA 1A78A 4M3CE 3OY8A 3ILRA 5DPNA 2RS32 4LUMA 4L92A 4GKYA 4Q0VA 4XDOA 1H6YA 3J7HA 1CESA 4RS5B 5FOBB 5KC6A 2VTXA 3O5SA 3LD8A 4K7JA 4CEWB 4AI2A 4AWDA 1Q43A 2R16A 4NRPA 4QPIB 5KHKA 3P6BA 4LBQD 1BYHA 1RJ7A 1UW8A 2CHHA 2VBBA 3ZN5A 2XJRA 1PNFA 4QHOA 3VZOA 2E32A 3E6BA 2Y64A 1KJLA 3NSTA 3VBSA 1M4WA 1LJ7A 1A8MA 2R6QA 3MFAA 5FPVA 4XHBA 5DMYA 1OFSA 4AF9A 3Q8BA 3S7IA 5J37A 4YARA 4N7IA 1ASJ1 3A21A 4PIYA 2R061 4XDQA 4EN6B 1CD3G 2L9LA 2VW1A 3MICA 2X5IC 4YVWB 2YGLA 3O0VA 3SKJE 5LA9A 4NWVA 1HRV3 3DPRB 4OMDA 3VDDC 4Q8KA 5FCCA 1F4HA 1RINA 1S2BA 5FXXA 4IQPA 1Q8QA 2JDYA 1DGLA 2Q0AA 2R32A 3KSCA 3OPZA 4GULA 5C33A 4I2OA 5FPXA 3BKZA 5FYIA 2OS2A 2ZAHA 2K2SA 3NJVA 4YM2A 4DPNA 2QUOA 5JSPA 3V0AA 1JW6A 2YC2A 3PVBB 4P9JA 1WCQA 1UX7A 3D3AA 1KITA 2PTMA 3DCQA 1QEXA 2Y6LA 2PHXA 3I2FA 4QHBA 5EQUA 3THTA 3I2DA 1FPN1 1YLLA 1HN1A 3KV4A 1VMHA 1AR81 1IPSA 1DGWA 3U1XA 1MZEA 1QJX1 2OPKA 4AFBA 5JZGA 2VULA 3M70A 4YM0A 5DZGA 1JYCA 4DXRA 3I2KA 2R0FA 1YJKA 1OURA 1QQP3 1RUC2 2PAEA 1JI6A 2Q4SA 3MYXA 1QJZA 3IDEA 3LAGA 2CWSA 3WDXA 4EYUA 1NA1A 1ZBA1 4DY3A 4ZZ8A 2Q5TA 3CKHA 1JTZX 1U5YA 1RUG3 4CXYA 3OGVA 4LJHA 1PGL2 3D4KA 3BIWE 1UZZA 5F5AA 4EE2A 4DEQA 2P4EA 2ARXA 1GICA 3K77A 4GJYA 3DUIA 4B1MA 4C1XA 2WJSA 4LKFA 3NNLA 2IXHA 2WNVC 2LROA 3HNBM 1W6PB 1XSRA 2LUWA 3MIDA 3PUQA 4PLOA 3WW2A 4QX0A 1YFYA 3QOPA 4XACA 3JCIA 2JWPA 4PIZA 2VOXA 3S57A 1V00A 4QGNA 1OC1A 1AF9A 1MS8A 2DV9A 2CAUA 4UW6A 1Q8VA 1E5RA 3CEWA 4IV1A 4KWJA 5C9AB 3R4DB 4A2UA 3N36A 4NIAA 1JUHA 2HWB2 1SACA 1UXZA 1W8WA 2YU1A 4Q26A 4JGZB 4FOYA 4LE3A 1RUF2 1X7NA 1QDOA 5KC5A 1ACCA 1YO8A 1D2QA 3M3OA 1H0BA 3WNOA 5E89A 2DURA 4BM8A 1XOYA 1O4ZA 3PHMA 4YSFA 1VRH1 5A7WA 4AEDC 1UMHA 4FI9A 3WNPA 4JDMA 4YGCA 4LK7A 1QJFA 1D4M1 1RUH1 2A70A 2J1EA 2R1BA 2LTNA 2SBAA 4IV3B 3ZN6A 1YQ6A 3LIHA 4XFCA 4BLJA 1XNCA 5LASA 4O9GA 4PQQA 5D1IA 5LZ6A 1JYIA 1X9PA 2WFF3 2YPDA 3NAPC 5A3UA 4MGTA 1JOJA 2ERFA 3GHNA 3NJYA 1NCRA 5L9VA 1GZCA 5T52A 1PO13 1R082 1BHGA 2JENA 4DQAA 4QQ2A 5DDJ1 3PURA 4ZONA 1DIWA 5GZEA 2BWAA 4O7XA 3BTYA 1I6XA 1QIQA 3FFZA 3RWKX 1DZTA 4B1LA 3I49A 3VBFC 1XU1A 4LKEA 1SFNA 3ZYHA 3TN93 3LPGA 3W58A 4V2WA 4EN0A 4KBBA 1LU2A 3KV6A 1W3VA 5JXHA 3BIEA 3TYJA 3ITQA 5JIUA 2RS33 3ZPYA 4HMZA 1JOPA 4HPKA 3JB4C 1N1SA 1Q8OA 1VBD3 4CCLA 2ZZQA 4Z07A 4A44A 2BBVA 3WP6A 2FD8A 2RV9A 1LRHA 3OUIA 4SLIA 3W59A 4GB31 1RB8G 4Y1YA 1GANA 4ZHNA 3TWIA 1HX6A 3DKWA 2BU9A 1POQA 1PVXA 1VMJA 2W9XA 2ZEXA 4CDXB 4KQ7A 4NRMA 3JD72 2OXBA 4BIFA 3SITA 1U0AA 1W6QB 3WF0A 4HK9A 4CXWA 4A42A 1GWLA 1FPN2 3ZXGA 1AR82 4BMEA 2J1AA 1QJX2 1W9TA 4PCRA 5H9PA 5DN2A 3VDCA 3WINE 2D98A 4YVSC 2ZHNA 1UYZA 1OUXA 5LCWL 4NPRA 1VBE1 4N8MA 3WQBA 4D6SA 3ELNA 3ON7A 5LBBA 1GNHA 1W6NB 4QQOA 1TNFA 4FPLA 4FPYA 4QB1A 4A6SA 3O1UA 1LGCA 4XURA 4N53B 2RMU2 4RQPB 3RI9A 4CDQA 3HQUA 2D6OX 3I3DA 3N3HA 5I93A 5LWBA 4MHUA 2CDOA 2FDFA 1QJY1 2FCTA 4CZSA 2EAAA 4ASLA 3BPZA 2X05A 5LB6A 5DAPA 1MR5A 4MVTA 1JYWA 1UMIA 3IIIA 1EP0A 2QTWB 1NCQB 3AC0A 2YXSA 4Q4Y2 2WNUC 4HKLA 1WD3A 2ZZJA 1LOCA 2YBPA 5FZDA 2HYKA 4DMIA 4ONUA 2JKXA 4W6YA 2I74A 4R9BA 3RZZA 1H8VA 1YJLA 1OBNA 4QHZA 3T30A 1RUC3 3A0NA 5FKBA 5C8CA 1PM7A 3R05A 5FFOC 3IBMA 5KBFA 5IK8A 1OF3A 2X29A 1UAIA 1XQNA 1EUUA 3AB0A 3K2OA 2CU5A 3I3QA 2GN7A 4XJWA 1DQ0A 3LB9A 4K3UA 3WNMA 3HQXA 4YGBA 1F35A 1PZ7A 1V6NA 4IEWA 3B93A 4O9EA 4A45A 1N1YA 3TB0A 1PVC1 1H2LA 5EPAA 3DL3A 1YFWA 3WG3A 4CSWA 4J1XA 5FZ9A 5JI7A 1DGWX 3VZLA 2IXCA 1W8UA 2A6XA 2YBSA 1KS5A 1W39A 4XAAA 4Q0SA 3ILFA 4KU8A 1HV0A 1RUH2 4EQVA 1AR71 2WN2A 3NNMA 3H3LA 3OGRA 4XFBA 1DQ5A 1IS4A 3T4HB 2ZX2A 5K8SA 4BMBA 1SDWA 2G9ZA 3GF6A 5ANNA 3IM0A 4Q5OA 2MEV3 3EHKA 3LGRA 5FTTC 1LHWA 4B4QA 5IVEA 2HWB3 4LXLA 4C0BA 3KHCA 1OQEA 3WD5A 1QNWA 3LDBA 4PF1A 1RUF3 3VZNA 1ZA7A 1NLQA 5CZKA 3FBYA 3VDDA 3IZOA 4A3ZA 4K20A 4C0HA 4D6QA 2PHFA 3ETPA 5DAXA 2WINB 3Q9OA 3HOBA 4QKDA 4UF0A 2B5HA 2QQUA 4YWAA 5ERLA 3LEKA 4DUVA 2DVGA 2JE7A 1G9DA 4OFGA
chains in the Genus database with same CATH topology
1HN0A 1OH3A 3F95A 3UT0A 4A6SA 4BQ3A 1W8WA 1UOJA 4LJHA 5D21A 1GWMA 1WMXA 1OKOA 1W9FA 2KR2A 4CPBD 1WZXA 4LK6A 4CP9A 4BQ4A 4BQ5A 4YW6A 2O14A 1W8TA 2WYFA 3ORJA 1GWLA 2LROA 4LKDA 4LKFA 4YW7A 4CPBA 2K46A 1L7LA 4LKEA 2C24A 2LRPA 1W8ZA 3ZYHA 1WCUA 2JWPA 3ZYBA 2VXJA 3ZYFA 2Q1FA 4AL9A 1W8UA 4CP9B 1GWKA 4BQ2A 4YWAA 1W90A 1V0AA 4LK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HN0 A;  1OH3 A;  3F95 A;  3UT0 A;  4A6S A;  4BQ3 A;  1W8W A;  1UOJ A;  4LJH A;  5D21 A;  1GWM A;  1WMX A;  1OKO A;  1W9F A;  2KR2 A;  4CPB D;  1WZX A;  4LK6 A;  4CP9 A;  4BQ4 A;  4BQ5 A;  4YW6 A;  2O14 A;  1W8T A;  2WYF A;  3ORJ A;  1GWL A;  2LRO A;  4LKD A;  4LKF A;  4YW7 A;  4CPB A;  2K46 A;  1L7L A;  4LKE A;  2C24 A;  2LRP A;  1W8Z A;  3ZYH A;  1WCU A;  2JWP A;  3ZYB A;  2VXJ A;  3ZYF A;  2Q1F A;  4AL9 A;  1W8U A;  4CP9 B;  1GWK A;  4BQ2 A;  4YWA A;  1W90 A;  1V0A A;  4LK7 A; 
#chains in the Genus database with same CATH topology
 4OUL A;  3ZMN A;  3ECQ A;  1DGR A;  3KGZ A;  4UI9 L;  3ZFE B;  1W2O A;  4ATF A;  3N7M A;  2JIJ A;  4P9W A;  2P3Y A;  2WAO A;  2QNK A;  1W6O A;  3T0B A;  4JV4 A;  5FOJ B;  3HBK A;  3SH3 A;  2VQT A;  5KHG A;  4HVO A;  3PUA A;  4AI0 A;  1V6J A;  5FWJ A;  1R08 3;  4MH0 E;  2W52 A;  3FUO A;  4K21 A;  3GHM A;  2ZGR A;  3C7E A;  2JDN A;  1MEC 1;  3MDP A;  1JU4 A;  3SQO A;  1SMV A;  1GOF A;  4XXP A;  5F8P A;  3AP7 A;  3N9P A;  2Y33 A;  1HQN A;  1PHM A;  1S2E A;  1VBE 2;  2WS9 2;  1XB9 A;  1GOH A;  5I8Y A;  2VZ1 A;  3T1M A;  5E16 A;  1QU0 A;  3KV5 A;  1PGW 1;  3SH5 A;  5C7G A;  1YIF A;  3GZE A;  3POB A;  5J09 A;  1KS4 A;  2RR1 1;  2WNV A;  4BJ0 A;  4MUV A;  3ILN A;  1ZRF A;  2GC3 A;  4YZ1 A;  2JKB A;  1GV9 A;  4F8A A;  4Q2F A;  1C8M 1;  2F4P A;  2BDR A;  3ZXA C;  1GP6 A;  1RL3 A;  3JD7 3;  4TSV A;  4LBN A;  2XL9 A;  2YHJ A;  3TOJ A;  1BMV 2;  2JB4 A;  4RD7 A;  4JGY B;  3ZLI A;  1SQ4 A;  2VQ0 A;  3BOW A;  4CDU C;  5FK8 A;  2IWG B;  2E31 A;  4PJY A;  4LO6 B;  1OH4 A;  4MGY E;  1YIP A;  3K46 A;  2PYT A;  2OQ7 A;  3ACL A;  2HBU A;  5CYY A;  2OX0 A;  3RPQ A;  1XPW A;  2BQP A;  4WVV A;  5E1R A;  2F17 A;  4IE6 A;  3RVH A;  1GP4 A;  2WUH A;  3NV3 A;  4HOO A;  3H8R A;  5FZM A;  4YYO A;  3WVJ A;  4XUQ A;  3AMP A;  4BQ1 A;  4JHT A;  2RMU 3;  5E8A A;  3VHN A;  4XAB A;  4Q4W 1;  3S30 A;  1F9K A;  1JMU B;  2PA7 A;  2Q8D A;  1IHM A;  4NII A;  1BVP 1;  2BWC A;  1SBF A;  3SEP A;  4AED A;  5LEK A;  2RS1 1;  4XET A;  1HB2 A;  5FR3 A;  3N35 A;  4YW3 A;  4L9B A;  4E2G A;  5IVY A;  2XGX A;  1Y9G A;  1S0G A;  4Q4Y 3;  3J7L A;  3NAP A;  4O65 A;  3ME2 A;  4MGK E;  3AVR A;  4Q0Q A;  3ZR5 A;  1W6M B;  2TNF A;  1AR7 2;  4XQW A;  3U4S A;  3EBR A;  5FZO B;  4B8E A;  2ARA A;  3V64 A;  3POS A;  3WXP A;  2PXJ A;  2QKD A;  2QDN A;  1K5M C;  1RMU 1;  3I2J A;  3K4D A;  4MO3 M;  3VUO A;  3VBU C;  2EA7 A;  4V2V A;  3TEX A;  3VBF A;  2ZGP A;  5M0T A;  2RE9 A;  3ZSK A;  1QDC A;  1XND A;  2W39 A;  1V70 A;  1QOO A;  5A32 A;  1GZW A;  4HON A;  1AXK A;  1SPP A;  2ZGS A;  3CJI A;  3ENR A;  3LOI A;  1OLM A;  3OYW A;  4M00 A;  4QGL A;  1JYX A;  5CFD B;  2ILM A;  4QPI C;  5JUV A;  1SFP A;  3V65 A;  2DTW A;  2IUW A;  3VDA A;  3BTZ A;  4IEO A;  2JG9 C;  3OD0 A;  2J1S A;  1QJU 3;  1ZRR A;  4R52 A;  2KXL A;  4PDW C;  3VD5 A;  4MOA A;  2JEC A;  1XNK A;  1S55 A;  3GYD A;  4HXC A;  1MS9 A;  2Q1M A;  3AP9 A;  2RM2 2;  5A7P A;  2OT7 A;  3H1Y A;  1FT9 A;  4FPK A;  2JDZ A;  2WZR 1;  1E5I A;  2WFP A;  4ORF A;  1S0B A;  2P6C A;  3ZSJ A;  1QXJ A;  4HSJ A;  4YVS A;  1COV 2;  3LEG A;  4P5H A;  4QQL A;  5CFC A;  2R07 3;  4KWU A;  1A6C A;  3E6C C;  3DPR C;  2K9Z A;  2VXJ A;  5D2A A;  4Y1U A;  1NZI A;  3WUC A;  4AFM A;  1DHK B;  3GZT B;  4X8P A;  4E4S A;  1WA6 X;  5FDB A;  1WWY A;  2A1X A;  4Y20 B;  3N7K A;  3C3V A;  3MFC A;  1ND2 B;  4TN7 A;  4J1W A;  1UIJ A;  4UXA A;  3V0B A;  5LW9 A;  3OEA A;  2EIC A;  4BQ3 A;  3B7M A;  1QOT A;  1CVN A;  1I5Z A;  3HQR A;  5TSW A;  5EFU A;  1AHS A;  3U07 A;  4AQ6 A;  1OD5 A;  3GZA A;  3WX5 A;  2R7E B;  5JPN B;  1O3T A;  5FWE A;  2DDU A;  2CGN A;  5L73 A;  5A6Z A;  5EYY A;  3NNG A;  2ADD A;  2XKO A;  3ACH A;  4OMC A;  2WNU A;  3I97 A;  3AYC A;  3E5Q A;  2BPA 2;  1Z7S 1;  3MIF A;  4BDV B;  1RUD 1;  5H9S A;  1C8M 2;  1LHO A;  4XJA A;  2P3K A;  4GD4 A;  5I0R A;  2PHL A;  3J8F 1;  3H42 B;  4AHY A;  1PK6 B;  3BOD A;  2F4L A;  3KS7 A;  4URT A;  1IGO A;  3D8C A;  2BGO A;  2A6W A;  4QPY A;  3KZ4 C;  1PO2 1;  5LEJ A;  5FY8 A;  1RUJ 1;  4W65 A;  3U11 A;  3LEM A;  1PMI A;  3IAP A;  4S2F A;  4Q4V 2;  3R4S A;  4LNV A;  1R1A 1;  3JQW A;  4RFT 0;  1V9U 3;  1WME A;  3ZO0 B;  2WS9 3;  1RXG A;  3RMX A;  2G9G A;  2VNR A;  2WAA A;  4Z82 A;  4Y1V A;  2RDQ A;  4Y33 A;  4MXW A;  5C70 A;  3MPB A;  4WM8 B;  3O1V A;  3LPF A;  1G86 A;  4X8N A;  3SH4 A;  2Y6F A;  1XC6 A;  4XAE A;  1XYO A;  2E53 A;  3OD4 A;  1POV 1;  1BJQ A;  2WO1 A;  3ABZ A;  2G1M A;  1AXZ A;  1B35 C;  3KCY A;  3ZXJ A;  4A6O A;  1LOA A;  2RS1 2;  4LIU A;  2EAK A;  4G9S B;  4D3W A;  1C4R A;  3I59 A;  4QXB A;  1S2K A;  4XF1 A;  5CKN A;  1NLS A;  1FI2 A;  1SCS A;  2ARB A;  1APN A;  3C2U A;  3GAL A;  4XF4 A;  2I45 A;  3ZM8 A;  4E9K A;  2FZ2 A;  5D8A B;  3GXU A;  4HAN A;  2JDA A;  4JGZ C;  4NHX A;  4CA9 A;  3LIG A;  3UT0 A;  3POY A;  4AHZ A;  5FY4 A;  3ZFG C;  1CAX A;  1UOJ A;  5IHR A;  1VAL A;  4XQD A;  3DXT A;  4R9D A;  1NXD 1;  1TZO A;  4IE0 A;  2V4V A;  2D3P A;  3NVC A;  3UJQ A;  1LHV A;  5EXO A;  3JZV A;  4XF9 A;  2YC4 A;  2XL7 A;  1VBC 2;  2NZ9 A;  1W2N A;  4WVZ A;  1YXW A;  4TLG A;  1U5X A;  4PI0 A;  2VTF A;  4IV3 C;  5FZI A;  3RGB A;  1EPW A;  2ZKN A;  4MXV A;  4YW1 A;  3RYK A;  3UV9 A;  2DCT A;  2DUO A;  3B94 A;  3WNL A;  1AYM 2;  2DBI A;  1DBN A;  5FZB A;  5JOY A;  5J36 A;  4UFM A;  5LY2 A;  4D6R A;  2BGP A;  3PIJ A;  2DU0 A;  1NXM A;  2YPJ A;  4YG0 A;  5FZK A;  2O0O A;  2PHU A;  3MIB A;  4YPJ A;  3T2O A;  2FQP A;  3MGU A;  2WL1 A;  2XR4 A;  1VBB 1;  3P5B A;  4JVA A;  1C28 A;  1OOP A;  4A7Y A;  1BBT 2;  5KXE A;  4CUB A;  3GBW A;  2WZR 2;  2N7G A;  1BZW A;  2WNO A;  1JUI A;  2XUE A;  1YQ8 A;  4M4P A;  3AFG A;  5F9T A;  2QQW A;  4RN5 A;  5BYN A;  4NAO A;  5A6X A;  1O5U A;  2PHR A;  5L9R A;  3E1F 1;  2KD7 A;  4JAA A;  3HNY M;  1XNT A;  3ZDS A;  1GWK A;  1XNB A;  1OQD A;  2CWM A;  2XQX A;  3ZSE A;  1YRZ A;  4FBF A;  3J9S A;  4RFR B;  4LO8 A;  5FZ6 A;  5FYB A;  2XVG A;  3RFR A;  3TBD A;  3T0A A;  3THC A;  4NID A;  2V5D A;  4CDX C;  4EN9 B;  3AP6 A;  3PUH A;  2DCJ A;  2XML A;  3HR9 A;  3E5U A;  3MHZ A;  4BCU A;  2RM2 3;  1MVE A;  1OKQ A;  4CDU A;  2WNE A;  5DXD A;  1RIR A;  3N9L A;  1BEV 1;  1Z7S 2;  5JCT A;  3ZXK A;  2NYY A;  5FAX A;  1UOG A;  4CPB A;  1TMF 1;  1MQT C;  2FMY A;  3J8F 2;  2HLE A;  1COV 3;  3D5O A;  4KBZ A;  4IE4 A;  1MPX A;  3ZXL A;  1MS4 A;  5FO9 B;  3JB8 A;  3VKF C;  4CU7 A;  1RUJ 2;  4IEP A;  4GWN A;  1LAJ A;  1OA2 A;  2OUH A;  3WZ1 A;  2ORZ A;  3WQ7 A;  3K3O A;  3F95 A;  1EAH 2;  3AKR A;  1AYN 2;  2XWB B;  5C5T A;  4Q0U A;  3MUZ 1;  1W9W A;  3I54 A;  3ZFF B;  4LO7 A;  3G6J B;  1N1V A;  1NCQ C;  3RRD A;  3HMY A;  5LA1 A;  2O14 A;  4I0B A;  5I0T A;  4CDQ C;  4E4H A;  2CNA A;  5L7O B;  1L7L A;  4XTM A;  3RZL A;  4OHY A;  5DUV A;  1LGB A;  3IDC B;  4K8R B;  5APA A;  1A3K A;  1AJK A;  1W8O A;  4AAX A;  4PF5 A;  4JKK A;  3VKM A;  2AGS A;  2P1B A;  4Y1Z A;  5FP4 A;  4QPG A;  4E4D X;  1K5M A;  1UKG A;  2PFW A;  3M4F A;  1FX5 A;  3VBU A;  1OMI A;  1AR6 2;  2DTY A;  3I4I A;  3VBH C;  4P14 A;  2C1F A;  1UKR A;  4CCC A;  4WM7 C;  5HCB A;  5F5I A;  4GXL A;  4Q4V 3;  1IKP A;  5FJH A;  2J1T A;  4WVM B;  5EP9 A;  2WT2 A;  4KGQ A;  4I01 A;  3OBA A;  2HWD 2;  3INA A;  4Y26 A;  1ND3 B;  1HB3 A;  5GZC A;  4GJZ A;  4QPI A;  5JMO A;  1CAW A;  5ABJ B;  3F2Z A;  1VPH A;  3LDR A;  2JG9 A;  5A3O A;  2DU1 A;  3AYE A;  4JCK A;  1OT5 A;  4YW5 A;  4FSJ A;  4PDW A;  2WQ8 A;  2AR6 A;  3LCP A;  5DUU A;  3ZIW A;  3A22 A;  1ENX A;  3NV2 A;  3LWC A;  1AZD A;  2R1D A;  4Y5S A;  2R04 2;  2P2K A;  1GUI A;  2TUN A;  3AKP A;  5GLZ A;  3I8T A;  5J98 B;  5JOW A;  1UIK A;  4HG6 B;  1FNZ A;  5EJ3 A;  4IGQ A;  2X10 A;  2WZ8 A;  5FY1 A;  1BLZ A;  1AL2 1;  1VB2 A;  1ZBE 1;  3HD8 B;  1VBB 2;  2VCB A;  1IOA A;  1O4Y A;  4IEZ A;  1JHN A;  1GNY A;  3IWZ A;  5B2G B;  4YVW A;  5A3W A;  5F3C A;  1OSG A;  2QQJ A;  2XVK A;  1OD3 A;  1YFU A;  3DPR A;  1JYT A;  1QH7 A;  3ORJ A;  3PLQ A;  4BZ4 A;  3T09 A;  1GBG A;  4MLO A;  1FMD 3;  1CPN A;  3W9A A;  1ODN A;  4AW7 A;  5FXV A;  3RZK A;  2Q8E A;  3EJK A;  1ZRI A;  3H7Y A;  1F2N A;  5GAL A;  1VBC 3;  1HXS 2;  2P3I A;  1UD1 A;  5T5L A;  5IVV A;  3GCW A;  2ZGN A;  3D0S A;  1J3P A;  5FYH A;  3O1P A;  1AYM 3;  1RHI 1;  4GAZ A;  3RS6 A;  3VHO A;  2HYX A;  2E9Q A;  3BAL A;  1V6I A;  1YYN A;  1AR9 2;  4YM3 A;  2BNN A;  4IES A;  4QDR A;  2ZX1 A;  5A1F A;  1CAV A;  5K4L A;  3WF2 A;  4U36 A;  3VB9 A;  1SFY A;  1ST8 A;  4QGM A;  3BU7 A;  1V6M A;  1BBT 3;  1V6L A;  4IGO A;  1J1T A;  3UGF A;  4DIQ A;  5A6Y A;  3WLU A;  1VR3 A;  3AX4 A;  1HRI 1;  2AEN A;  2PQS A;  4HSL A;  5FYT A;  3WF3 A;  3VBS B;  1NQJ A;  1DCS A;  1PMJ X;  1ZZ8 A;  1UZV A;  2V72 A;  4NE9 A;  4OCT A;  4QX2 A;  3WNK A;  4FOW A;  2NM1 A;  5L19 A;  4NUB A;  4K1Z A;  2BRT A;  2QQV A;  1ULP A;  2GP5 A;  2PHW A;  1S0I A;  2PLV 1;  5IAX A;  2CAV A;  1W6P A;  2CL2 A;  1F5J A;  1I3H A;  1H8T B;  4N43 B;  2A71 A;  3P1I A;  1RUE 1;  4QD2 A;  4KH9 A;  3KF3 A;  2B9V A;  2XJQ A;  2HBT A;  1B35 A;  1YQ5 A;  4CP2 A;  2VCA A;  4LO5 B;  3PTY A;  4JGY C;  4XFI A;  2CV6 A;  3H8U A;  3OBZ A;  5FPZ A;  3V0A B;  4PT6 A;  1P8J A;  3ZKY A;  2ZTN A;  5BNQ A;  1W05 A;  1JOD A;  5DG1 A;  4H3W A;  4XQ4 A;  4UFH A;  3Q8F A;  4UT5 A;  3I7D A;  4JGZ A;  2RJL A;  5SV8 A;  1JZ7 A;  4UOJ A;  5GLW A;  1VAM A;  3ZFG A;  3RYP A;  2RDR A;  4FP3 A;  2VXR A;  5K7P A;  2GP3 A;  1RJ8 A;  4FVV A;  3AVS A;  4XJ8 A;  4DY5 A;  2Y0O A;  2JG8 B;  4UW5 A;  1KRI A;  2JD9 A;  4YFZ A;  3I3B A;  3ZPO A;  3KWV A;  4Y1X A;  1BK1 A;  4XFA A;  2WQ4 A;  3VL8 A;  1EAH 3;  1AYN 3;  4RR3 B;  1OA4 A;  1WW4 A;  5FO7 B;  5CG8 A;  3GBF A;  4Y5Z 0;  1NA1 B;  2XVL A;  5HPO A;  4IV3 A;  1D7P M;  3ACG A;  4D7T A;  2VEC A;  2B4K A;  2FDH A;  5CU1 A;  4P5Y A;  5JAX A;  1CN1 A;  1UX6 A;  5CKM A;  2NN8 A;  1UU6 A;  4ZXE A;  1CAU A;  3SNM A;  4C1W A;  4DRV A;  4TZD A;  3TRS B;  5C4W A;  5JOZ A;  1WBL A;  3LZZ A;  1RUI 1;  4XUN A;  4CYD A;  1XSQ A;  3VBO C;  3ALQ A;  5JPM B;  5FY9 A;  1S4C A;  5DZE A;  4XJU A;  2UWA A;  2RVA A;  3KB5 A;  2Z69 A;  3K48 A;  3LFI A;  2VW2 A;  3AXE A;  4JDO A;  5CAD A;  5KXB A;  3A4U A;  4XUO A;  1AR6 3;  3WDW A;  4CP0 A;  3C7H A;  4LHN A;  3DN7 A;  2QQP A;  3KVA A;  2ZPX A;  4HBN A;  4IV1 B;  2GMM A;  1SLI A;  2VMH A;  3LA7 A;  4UW3 A;  2E33 A;  1S0E A;  3HIF A;  4KWL A;  1W06 A;  3UET A;  1DYK A;  2WA4 A;  2HWD 3;  2AEY A;  3C8X A;  2UU8 A;  4Y3O A;  5FZ7 A;  1G9F A;  2Z42 A;  5A33 A;  4BQY A;  4ZZ5 A;  2WDB A;  2D5F A;  3NRU A;  4NOT A;  1ASJ 2;  2FDI A;  1DYO A;  2R06 2;  3AKQ A;  2VJX A;  1FOD 1;  4GWM A;  4LR4 A;  4IGP A;  4CDX A;  4EN7 B;  4BU2 A;  3CJI C;  5FBJ A;  1HB4 A;  1W90 A;  3WY6 A;  5FYC A;  1YQ2 A;  4AYU A;  3OSD A;  5C6C A;  3NWK A;  1W6Q A;  1RVF 1;  2YY1 A;  4F7Z A;  1LEC A;  2R04 3;  4L99 A;  1RHI 2;  5LA2 A;  2WLP A;  2XKP A;  1B09 A;  3VLB B;  1WMX A;  2BVV A;  2RG4 A;  3AM2 A;  3VZJ A;  3T0D A;  2PHT A;  2DWR A;  1ODM A;  1MQT A;  2VY0 A;  4P9G A;  3AL5 A;  2HWC 1;  4P08 A;  1LOD A;  3AXD A;  2D6L X;  1NCR B;  2ENR A;  4I3G A;  1HQW A;  4JQR A;  5T5O A;  1IPK A;  1VLN A;  4COV A;  1C5I A;  2VME A;  4FTE A;  2EIB A;  3KT7 A;  1ND2 C;  4LOT A;  1LOB A;  5FP9 A;  1OHF A;  3BVC A;  1UOB A;  5FZA A;  3RNS A;  2BJS A;  3LFM A;  4JRL A;  5CFC C;  3FLP A;  1JYV A;  1W9S A;  4AFC A;  1NZC A;  4OUM A;  1HXS 3;  5FZH A;  1J1L A;  4OHX A;  4Y4Y A;  3LDK A;  3CNA A;  2B42 B;  1NCQ A;  5DZF A;  4BYY A;  1ZBA 2;  2W94 A;  2XBO 1;  2XG3 A;  4LOR A;  5FYM A;  3RJ2 X;  4HKO A;  4X6Q B;  3UKN A;  1O4T A;  2IXK A;  4PIX A;  1SG3 A;  1UYP A;  4LTA A;  4P00 B;  1AR9 3;  2G19 A;  4IEV A;  1XYP A;  1M06 G;  2C24 A;  1EYB A;  3OB8 A;  5ACA 1;  3L2Y A;  1HW5 A;  1PIV 1;  4AFD A;  1UN1 A;  5JR2 A;  3PL0 A;  2CTV A;  3TEW A;  4N7U A;  1SLC A;  4LLO A;  3POF A;  5FMD A;  5FK7 A;  4AL9 A;  4DIN B;  5FRE A;  4JRA A;  2W95 A;  3VBH A;  4IL7 A;  3SC7 X;  2JE8 A;  3MV0 1;  4KNC A;  1GQP A;  2LW8 A;  2MPF A;  4WM7 A;  5FZ3 A;  1FNY A;  2VZP A;  1WCS A;  4I0A A;  2AUY A;  3GZU C;  4XIO A;  2P3J A;  5FMO S;  1OF4 A;  4WM8 C;  2ZA9 A;  4CRQ A;  4Q27 A;  3PJY A;  2F6B A;  1JZ8 A;  5A1L A;  5L9B A;  2PAM A;  4WZF A;  4GZ9 A;  5T3N A;  3MF6 A;  1WBF A;  2OII A;  3VV1 A;  2JIC A;  3JXS A;  2D3R A;  1US3 A;  4LBQ B;  1ZVF A;  1X36 A;  2VVF A;  4RHV 1;  3SCF A;  3A7Q A;  4AEJ A;  3S7E A;  1CX1 A;  3DGT A;  3M7A A;  4COW A;  3FN9 A;  4MGQ A;  5DAQ A;  4LHL A;  1MZ5 A;  1V6O A;  2W2I A;  1UZY A;  2XPJ A;  1C1L A;  1TME 1;  1R09 1;  4ZPI A;  3ZYI B;  1UOF A;  3FLT A;  4MX3 A;  4CP9 B;  1VRH 2;  3VKL A;  3MEP A;  2VE1 A;  4NRQ A;  4ET7 A;  5KXD A;  4HN1 A;  1J84 A;  1W28 A;  5K0U C;  1GR3 A;  4ISQ A;  2GME A;  2VPV A;  2TEP A;  1D4M 2;  2ET1 A;  1CPM A;  2C5D A;  2UY9 A;  4FT8 A;  1H6X A;  4HT1 T;  2WLQ A;  5F5C A;  1EV1 1;  2DUP A;  1ZZ6 A;  1MZ6 A;  4XF0 A;  3MW3 A;  4B7E A;  3GBG A;  1POV 0;  1ZRE A;  5KWR A;  4COU A;  4D8M A;  1UPS A;  5GZD A;  2BER A;  2H6B A;  2HH9 A;  3DF0 A;  1G6N A;  4YW6 A;  5CAZ A;  5AFE A;  5DDJ 2;  3S5A A;  3P3N A;  1OPM A;  3ZFE A;  4IEQ A;  3AZZ A;  5GLV A;  3B00 A;  3ATG A;  4AHX A;  5FKC A;  5F6L B;  2VZO A;  3OUH A;  4S2D A;  2ES3 A;  2HWE 1;  3FL7 A;  1UMZ A;  5FP3 A;  3WF4 A;  4QDQ A;  2RS5 1;  1DDL A;  5T54 A;  1K42 A;  3USU B;  1LKN A;  1UCX A;  1RVF 2;  3BGA A;  1K45 A;  2HWF 1;  4IEX A;  1IKQ A;  3G7D A;  5AC9 1;  2XDV A;  2A7A A;  3O1M A;  4GB3 2;  4A7K A;  3RZH A;  3DEC A;  1OUS A;  4XJZ A;  2OW4 A;  4CU8 A;  1H9P A;  1UY3 A;  2RDN A;  4K1Y A;  2ZX4 A;  3W21 A;  2WWU A;  4M3C A;  4JHZ A;  1REF A;  2VG9 A;  3CU7 A;  2XJP A;  1OOP C;  1YNA A;  4XTP A;  2D44 A;  2VOV A;  4QT6 A;  3HWJ A;  3FZ3 A;  2BEO A;  1UWW A;  3I2H A;  4PLN A;  4E8D A;  4OUS A;  1W2U A;  3VZK A;  1ASJ 3;  1VP6 A;  2X5I B;  5A3P A;  2R06 3;  1L7Q A;  3WP5 A;  5EWS A;  1OI6 A;  2VZT A;  3WW4 A;  4AZZ A;  2P37 A;  4Y22 B;  4LUL A;  4YNI A;  4QU1 A;  3SCG A;  2AZ5 A;  3VDD B;  2YYO A;  2E7Q A;  4B3N A;  1UL9 A;  2VMI A;  2WRA A;  5F32 A;  2OKX A;  4JGY A;  4UWD A;  4AFA A;  4YZ2 A;  2XBO 2;  4IDZ A;  3ZOI A;  5B4N A;  2ATF A;  3JBG 1;  1WA4 A;  1ZA4 A;  4XHX A;  5F3G A;  5FZ0 A;  1QJY 2;  2D7F A;  5FZ8 A;  3BTX A;  1J58 A;  1ZRC A;  2QFE A;  4AG4 A;  4FFH A;  3MBW A;  3EB7 A;  2WWS A;  3RQ0 A;  1W6O B;  1WD4 A;  4AR2 A;  5JXJ A;  4DXT A;  1FPN 3;  2WT1 A;  5A3M A;  2VMG A;  1AR8 3;  3SEE A;  1WLD A;  1QJX 3;  2D43 A;  2EXK A;  1U12 A;  2OUJ A;  4GQ7 A;  1D4V B;  2A75 A;  2X53 S;  4J25 A;  3R6S A;  3WNX A;  4BIS A;  2Z79 A;  2JJ6 A;  3NV4 A;  5EJZ B;  4OI1 A;  3IDA A;  1GP5 A;  2PMW B;  2VL4 A;  1MVQ A;  4Q4X 1;  5CEH A;  4R9A A;  4FTS A;  2W92 A;  2HKX A;  4P02 B;  1Y43 B;  4BK5 A;  3RZG A;  1EY2 A;  2C9A A;  1YEW A;  5L7O C;  2V4A A;  1ZBA 3;  1QXP A;  1UU4 A;  3ZYP A;  1FXZ A;  2GNB A;  1W03 A;  3N9M A;  1QMJ A;  5JDB A;  5FY5 A;  4GMP 1;  2B39 A;  1KJR A;  1W6M A;  5IT6 A;  3ZXF A;  1DQ1 A;  4RGA A;  2WNV B;  3KVB A;  3VBO A;  1PVC 2;  3ZR6 A;  1UYY A;  3WHT A;  1YFX A;  1WCD J;  3T2P A;  4QPW A;  4IW3 A;  4NVP A;  3PU3 A;  2ZHL A;  5ANQ A;  5FUN A;  2AAC A;  2XJV A;  2VUD A;  1LOF C;  1WW6 A;  4TXW A;  4XOG A;  4BB3 A;  1ULG A;  2IXI A;  1AVB A;  1VBA 1;  3AL6 A;  3HN3 A;  3FMG A;  2ZOE B;  1BQP A;  1YI7 A;  4OI0 A;  1JN2 P;  1E5S A;  1GOG A;  1ULF A;  3LEI A;  3LSE A;  3ZYG A;  4DNY A;  4L97 A;  1AL0 G;  4QPG C;  4AEM A;  4COZ A;  1HJF A;  4NO4 A;  3WDU A;  3NNF A;  3KQR A;  4QQH A;  4AEK A;  2ZAB A;  5GKA C;  4CPB D;  4XVH A;  3QLQ A;  2VBP A;  1GKB A;  4IET A;  4RS5 C;  3RZJ A;  1O59 A;  1W8Z A;  4D7Y A;  4CEW C;  2X09 A;  2ZHK A;  4I02 A;  3ZYB A;  3ZYF A;  1V6K A;  3WUD A;  2ZGU A;  1Z78 A;  3O1R A;  4GAL A;  4Z92 B;  3AZV A;  2P5B A;  2O1Q A;  1PX4 A;  1V0A A;  2HWE 2;  2JD4 A;  3EMR A;  4M0H A;  4NHY A;  4CU9 A;  4AED B;  1VRH 3;  5A7Q A;  3N9O A;  4EV0 A;  3B01 A;  2GC0 A;  1PMH X;  4PBO A;  3FJS A;  1AUY A;  2VW0 A;  4BE3 A;  1RUH 3;  1D4M 3;  1R1Z A;  2BZD A;  2WO2 A;  4CUA A;  4F3J A;  3NAP B;  4FPF A;  5A7S A;  5DG2 A;  5LRS A;  1JU3 A;  5CKQ A;  3W5M A;  3T2Q A;  1Q56 A;  1REE A;  3WW1 A;  4OYU A;  3WCS A;  1ENQ A;  1ND2 A;  4YZ4 A;  3C7G A;  2Y60 A;  1HRV 1;  3VBR B;  1T2X A;  4YVW C;  2UYA A;  3IN9 A;  4BWO A;  5A6Q A;  2NMO A;  1O8S A;  2QZ3 A;  4KMQ A;  4RYD A;  5DDJ 3;  3VBF B;  2GC2 A;  4M3C F;  1UQX A;  1MEC 2;  5HXV A;  3U0Z A;  4Y4R A;  1X8M A;  2ORX A;  5FMB A;  5I8T A;  4MYE A;  1GZW B;  1SPP B;  1WKY A;  5DUW A;  1PM4 A;  5IK4 A;  1KFX L;  3BI3 A;  4P9X A;  3UES A;  2C4X A;  1W8N A;  2CY6 A;  3QH7 A;  2XXZ A;  5GLT A;  1PK6 A;  3VDB A;  1PGW 2;  1AX1 A;  1US2 A;  3JU9 A;  4B4P A;  3IAQ A;  4IEY A;  1ENS A;  5FMO L;  4AI1 A;  1Z0H A;  2DFB A;  2RR1 2;  3HEI A;  4GB3 3;  3HBZ A;  3SKV A;  4S2H A;  1S0F A;  2WYF A;  4FFG A;  4AGV A;  1QQP 1;  2W3J A;  3MW4 A;  5C3P A;  5LA0 A;  2CGO A;  4M0N A;  4W50 A;  4ZY9 A;  2VZS A;  1NOV A;  4BIO A;  3DYM A;  3PME A;  1ZZB A;  1CZS A;  1RUG 1;  4YVS B;  4WM8 A;  2LRP A;  4GH4 B;  1H8T C;  2ZGM A;  3FC0 A;  4IUG A;  2DVD A;  5GJ6 A;  5BNO B;  1SLL A;  3K4A A;  2YMZ A;  4QX5 A;  4DXZ A;  1VBE 3;  4UAP A;  4TWT A;  5FZF A;  4I30 A;  1TQ5 A;  1QHD A;  1MAC A;  4K8F A;  4MAD A;  3BPS A;  4OZO A;  5DAB A;  4LE4 A;  4Q4W 2;  4AVS A;  2ZCW A;  3GJB A;  1IS5 A;  5T5P A;  1BKZ A;  2SLI A;  2ZGT A;  1CIY A;  1QJY 3;  5K0U A;  1DF0 A;  3M8L A;  4AVC A;  2IFR A;  2BTV C;  5BNN B;  2VGD A;  1H9W A;  3PU8 A;  1Q5O A;  5LAT A;  2GNM A;  2WNU B;  4XYX A;  1IG3 A;  3SXW A;  5C9A C;  4OZX A;  3WG1 A;  3QBQ A;  5BY5 A;  5CA6 A;  4LBK A;  4EWA A;  3PVN A;  5FQ0 A;  1W8H A;  4EJR A;  1ULO A;  1IG0 A;  3E5X A;  1YCI A;  3U78 A;  4RR3 C;  4XBL A;  4BOW A;  3B02 A;  4QX3 A;  4G3Y C;  4LOS A;  1XJA A;  4Q29 A;  4FPH A;  5CNA A;  2Q30 A;  1RMU 2;  2A3Y A;  1D0G A;  3KD4 A;  5BNP B;  2EXJ A;  1BVV A;  2Z5W A;  5AFB A;  1NY7 1;  1RUN A;  3PMS A;  1VB4 A;  4Q8L A;  1UYX A;  5CIR A;  2WBK A;  3VN4 A;  1UZ0 A;  1E57 A;  4MXW B;  2H0B A;  2Q1F A;  1Y3T A;  2J7M A;  2WFF 1;  1VJ2 A;  3FWE A;  2PQQ A;  4N90 A;  4QXC A;  1CX4 A;  1PVC 3;  2OVU A;  1NT0 A;  1PO1 1;  4CEY B;  4RGG A;  2ZEY A;  1EUT A;  5FO8 B;  4GKX A;  1LB2 A;  5BXX A;  5CG9 A;  2Y6G A;  2VZU A;  1NE4 A;  4BQW A;  4ZS3 A;  1H2M A;  4ITC A;  1OKO A;  1AR7 3;  2ZS6 B;  5HCF A;  3TN9 1;  2DVB A;  4MZU A;  3VD3 A;  5C5U A;  2VNO A;  3E97 A;  1MS3 A;  4HL0 A;  5F3I A;  1JZ4 A;  2RS3 1;  1KDM A;  1HRV 2;  1QOS A;  2A3X A;  4FQ4 A;  1VBD 1;  3IPV B;  4NMI A;  1TE1 B;  3PVO A;  4QM9 A;  1VAV A;  1SBE A;  3H0O A;  3PNA A;  2R30 A;  4KL1 A;  3O7O A;  1QGL A;  2ARE A;  3W5N A;  4I09 A;  1XYN A;  1F15 A;  4BQ2 A;  1WUV A;  5A3T A;  2JXA A;  3OBT A;  3AKT A;  3FHI B;  1UO9 A;  1JHJ A;  5FLJ A;  4CP1 A;  3IMN A;  4R4X A;  4ATE A;  4NRO A;  3D0J A;  4EWD A;  1ONA A;  5I91 A;  1Y9Q A;  3H9A A;  1O3Q A;  5D21 A;  5IVC A;  2BOI A;  1JOB A;  4MGZ E;  3WQ1 A;  1JZ6 A;  2WR9 A;  2DYC A;  4K40 A;  2UY8 A;  3CDZ B;  3OJB A;  2VZ3 A;  5FPB A;  1BCX A;  2VVD A;  3AJZ A;  2VOK A;  3HPN A;  4B29 A;  5C3O A;  2DVA A;  3ETQ A;  5A3L A;  1QWR A;  3LA2 A;  1O8P A;  1RUD 2;  3OBR A;  4NAM A;  5JI9 A;  4URA A;  3O12 A;  1MS0 A;  2ZML A;  4HET A;  1TG7 A;  4ASK A;  5IAT A;  3S6P A;  2YV8 A;  5IWF A;  1I9R A;  3ES1 A;  1PO2 2;  4CCE A;  1MEC 3;  4N53 C;  4RQP C;  3NW4 A;  5EJ1 B;  3CO2 A;  1C3H A;  3O1T A;  4DXS A;  2B46 X;  5L7O A;  5FJK A;  2AH2 A;  2C9K A;  3KT1 A;  5GM0 A;  2XON A;  1R1A 2;  5F5Q A;  5FMC A;  2UWC A;  1GWM A;  4BH9 A;  2RHP A;  2A73 B;  5BPX A;  1KQR A;  3M3I A;  3AZW A;  2BP6 A;  3KMH A;  5FP8 A;  2LS6 A;  3IT8 A;  4QU2 A;  5T50 A;  1LR5 A;  4QWN A;  2A6V A;  2FHR A;  2RDS A;  3IMM A;  4LIV A;  5LK5 A;  2RR1 3;  4Z8B A;  2Z4F A;  4H55 A;  1OQ1 A;  4KG8 A;  3T4V A;  3L9J T;  4PHZ A;  1LOF A;  1WMD A;  3AMQ A;  1RUC 1;  2OZ6 A;  1C8M 3;  2ZMN A;  4AAP A;  1H1I A;  5KHI A;  2W46 A;  1A8D A;  2DCK A;  4IND A;  4CDU B;  2CGP A;  4EZ4 A;  2ZMK A;  1N3Q A;  4E4Z A;  3VHR A;  3UNP A;  2WT0 A;  3DV8 A;  4HFS A;  4LIT A;  5JSO A;  1G9A A;  1PGL 1;  2DUQ A;  2GH8 A;  5IVB A;  2YU2 A;  1DU3 D;  1F8V A;  3B5L B;  3J7M A;  4RS5 A;  5C8W A;  3J7N A;  1G9B A;  4DFS A;  4CEW A;  3SMH A;  2ARC A;  4IEU A;  4BHP A;  4CUG A;  2VUA A;  4LKD A;  3H8O A;  2BOJ A;  1VRB A;  3H1W A;  4XMI A;  3BYW A;  3ZXE A;  2XH6 A;  2MHF A;  3AYD A;  3UJO A;  5L36 A;  4P9L A;  4M01 A;  4Q4W 3;  4QX8 A;  5E88 A;  2FDG A;  4LUK A;  1ENR A;  3RSJ A;  3K3N A;  1UY4 A;  4AK3 A;  5JR7 B;  5KHH A;  3PDQ A;  3ZIX A;  5BUV A;  2RS1 3;  1NKG A;  2MEV 1;  4NHK A;  1OA3 A;  1G7Y A;  2HWB 1;  3Q8C A;  5I0U A;  1JYN A;  3N7J A;  1W0N A;  4KGG A;  1RUF 1;  1TNR A;  4R4Z A;  3BB6 A;  1T6B X;  2EF6 A;  3RZM A;  2GNT A;  3TN9 2;  1LEM A;  4L0P A;  2W47 A;  5JIA A;  2XWJ B;  1MS1 A;  4GWJ A;  4I3P A;  2A3W A;  1RMU 3;  2YG0 A;  3KCX A;  3WR0 A;  2X8K A;  1DZQ A;  4LBJ A;  1ZX5 A;  4RSU A;  1LED A;  5C3Q A;  4D7S A;  1VBD 2;  2LM3 A;  4LA2 A;  2HEV F;  4XCA A;  1N3P A;  4UBH A;  1Q8P A;  1CAW B;  2R0H A;  3S5Q A;  4NHM A;  1K5J A;  1HLC A;  3FE5 A;  4QB6 A;  1W0O A;  4R8H A;  4YGE A;  1PNG A;  4A3X A;  3LOB A;  3WQ0 A;  2JG9 B;  3OY8 B;  3MV1 1;  2GN3 A;  1X9T A;  5FYS A;  4XPV A;  2V73 A;  2VTX J;  3VGI A;  5FRA A;  2EXH A;  4PDW B;  1R08 1;  4SBV A;  2FBE A;  2D6N A;  5LY1 A;  1URX A;  2Y6H A;  2QE3 A;  3CJX A;  1XE0 A;  4UFK A;  4DOU A;  5DAV A;  1SEF A;  1OLR A;  3O1S A;  4LBO A;  1SLB A;  3OPW A;  2Y6K A;  4LA3 A;  2WZE A;  5C4W C;  2WZR 3;  1BEV 2;  4CE8 A;  4PQ9 A;  4XFG A;  4QKN A;  5DQ0 A;  1H8T A;  4N43 A;  1TMF 2;  5DAW A;  4CCM A;  1CZV A;  1DZR A;  4Z2A A;  4HVQ A;  3RI8 A;  3NO8 A;  2ZKL A;  2E51 A;  2BW8 A;  4YW4 A;  4OI2 A;  1ZRD A;  4TTG A;  1O3R A;  5F39 A;  2A6Y A;  1WGP A;  3WEZ A;  3I3M A;  2KM2 A;  1O3S A;  4AVV A;  5FZ1 A;  2V09 A;  3JD7 1;  3WDY A;  4Q1R A;  1KDK A;  2XUM A;  3MIE A;  1XBF A;  3VKO A;  2QCS B;  3KQ4 B;  1C1F A;  1LUL A;  1NAE A;  3FUQ A;  4HLT A;  4A7Z A;  3CLP A;  3PIG A;  2DCZ A;  3ZKU A;  5AVA A;  4QQP A;  3FHQ A;  1N1T A;  5C9A A;  3AKS A;  1JS9 A;  2JG8 A;  4H7M A;  4DRR A;  5IYY A;  1CAV B;  1Z7S 3;  2FCV A;  4MSV A;  2WKK A;  3WG4 A;  5CIS A;  1RUD 3;  3BTA A;  5JVV A;  1JXN A;  1U5Z A;  1H1A A;  2QBX A;  4RR3 A;  3J8F 3;  1W04 A;  4RL7 A;  4CDW B;  1RED A;  1UY2 A;  2YFZ A;  5EHD A;  5JZG B;  5FLH A;  3ZXD A;  5HBA A;  2RMU 1;  2O8O A;  1OH3 A;  3BN6 A;  4AQ2 A;  1CJP A;  4BPZ A;  1PO2 3;  3ES4 A;  4LPL A;  2A5Z A;  4Q0P A;  1RUJ 3;  3GDB A;  4QX1 A;  1J59 A;  4NR1 A;  1ULC A;  1NE6 A;  1KGY A;  1XXN A;  3UYJ A;  1W9Y A;  1R1A 3;  2ET7 A;  1W2T A;  5CB7 A;  1S0J A;  3ZSL A;  2UYB A;  2XJS A;  3Q8A A;  4Q4Y 1;  1UZW A;  5LBC A;  3U75 A;  1O6U A;  1SZB A;  3WP4 A;  2O8Q A;  4JX0 A;  1Q3E A;  3OGS A;  4QDS A;  2B45 X;  4QB2 A;  3TNP B;  1LEN A;  4FPJ A;  3SHR A;  1OLM E;  4DZG A;  3PUS A;  2BFU S;  4QX7 A;  1HV1 A;  2I2S A;  4XDP A;  1B35 B;  5SV5 A;  1LNS A;  3GGL A;  2XJU A;  2VZR A;  3NQH A;  5FYV A;  3M2M A;  1POV 3;  3OG2 A;  4YRD A;  3SIS A;  5GLU A;  1ULE A;  4W6X A;  3H3Z A;  1Y4W A;  2MEV 2;  3PVE A;  4AGG A;  4EZH A;  5JXI A;  3JUU A;  1O91 A;  2QQL A;  2BNO A;  2ZHM A;  4R9C A;  4GMP 0;  2BBA A;  1UXX X;  1AL2 2;  5IW0 A;  1ZBE 2;  2NQY A;  3ZFG B;  4OQ9 A;  4AVB A;  2ID4 A;  4XCB A;  4CUC A;  3AMN A;  2WQZ C;  2KA3 A;  2D3S A;  3O0X A;  2QVS B;  1ZYB A;  2E6V A;  2VH9 A;  5CFD C;  3ZYJ B;  3KCC A;  3O0W A;  3O1O A;  4TYS A;  1LU1 A;  1D2S A;  1K3I A;  1NX9 A;  2D93 A;  2EIG A;  2MNG A;  2VMD A;  1QJU 1;  2GU9 A;  3OPT A;  4H7L A;  4UYB A;  2CDP A;  2VBD A;  1WW5 A;  3X29 B;  4RGK A;  5FPA A;  2YFU A;  4FOQ A;  2WII B;  2H0V A;  4XC9 A;  3TEY A;  2ZGO A;  4RA0 A;  5A7O A;  2VNG A;  1QNY A;  2B7Y A;  4A41 A;  4LO4 B;  1CAU B;  3LE0 A;  3UL2 A;  3WDT A;  3CF6 E;  4UFI A;  5C4W B;  2QQI A;  5G05 L;  5A7W B;  1VMF A;  3BCW A;  1W9F A;  2R07 1;  1GQH A;  4UFL A;  4WZC A;  2WSU A;  5EYX A;  4K6B A;  4MET A;  5HCA A;  1J3R A;  4QXH A;  3VBR C;  4S2G A;  3ZN6 B;  1KD7 A;  2P17 A;  4BQ5 A;  3GNE A;  3APB A;  1VBB 3;  4JKM A;  2ZBJ A;  4AI9 A;  5IVJ A;  2K46 A;  1W6N A;  2AEZ A;  2ZGK A;  4A4A A;  5GZG A;  5JOX A;  4D69 A;  2ZX0 A;  4FP2 A;  3FLR A;  1SCR A;  2GC1 A;  1FV2 A;  1HRI 2;  2VC9 A;  2Y26 A;  4N53 A;  4NPM A;  4RQP A;  2Q8C A;  1LOE A;  2VR4 A;  1SLT A;  2QQN A;  4ES9 A;  3D82 A;  3TNQ A;  1NLR A;  3ACI A;  1CZT A;  4H2A A;  3GJA A;  1ALY A;  4AI8 A;  1JZ3 A;  5A33 B;  4XE9 A;  3QAC A;  4WVW A;  2PLV 2;  5LK7 B;  3CBN A;  4WBB A;  2YBK A;  4XEZ A;  5JMC A;  2DF7 A;  1SDD B;  5I0S A;  2W87 A;  1RUE 2;  2ZGL A;  4OUE A;  5KR7 A;  4HPK B;  5IK7 A;  2ZJC A;  2EVX A;  2XJT A;  4HKW A;  4AQT A;  1PK6 C;  4NWW A;  2J1U A;  5T5J A;  3VD7 A;  2ZEZ A;  3CZJ A;  5J96 B;  5FIX A;  3K4Z A;  2D6M A;  2VMF A;  4W4Z A;  4GH4 C;  2E26 A;  3D6E A;  5BNO C;  1WLW A;  1MQT B;  1BEV 3;  1V9U 1;  2WN3 A;  4Y24 A;  2VM9 A;  2WS9 1;  1LHU A;  2VCM A;  2RJ2 A;  4L2N A;  4YM1 A;  5HXM A;  2FDK A;  2QQO A;  1TMF 3;  3C7O A;  4N9H A;  2H6C A;  4QXK A;  5F2W A;  4LBQ A;  3UGH A;  3UKT A;  1MS5 A;  1GMM A;  3URF A;  4FO9 A;  3KGL A;  1RC6 A;  5A7N A;  1E5H A;  2E7A A;  4YGD A;  4XBN A;  4LMF A;  1GLH A;  2OQ6 A;  4OVE A;  4XBQ A;  2GZW A;  3M3E A;  3KF5 A;  2GMP A;  4CP9 A;  1IPJ A;  4FFF A;  2WO7 A;  3U10 A;  5BNN C;  4LBL A;  2W1W A;  2XLF A;  4NJ4 A;  3WDV A;  2W1U A;  4OHZ A;  1DP0 A;  4CXX A;  5DUX A;  2Y8K A;  2WO3 A;  1WMF A;  2B9U A;  4CDQ B;  1LGN A;  4XIL A;  5FYZ A;  3WG2 A;  2JDH A;  5LBE A;  4ZXK A;  2XQR A;  3ZMO A;  3OF1 A;  4E2S A;  5D8A C;  2JEM A;  2VCC A;  1RUI 2;  1YI9 A;  5F2S A;  4B4R A;  3CIH A;  4J6G A;  4MV2 A;  4CVU A;  1G9C A;  4LBM A;  1CR7 A;  2YC0 A;  1H1M A;  3AFK A;  5BNP C;  4OLL A;  1DYP A;  2FZ1 A;  1N47 A;  5C3R A;  1S0D A;  3VBH B;  1WCK A;  5A80 A;  1WZX A;  4WM7 B;  3HT2 A;  4BQ4 A;  3NV1 A;  1IS6 A;  4BXF A;  3OGJ A;  1AJO A;  4YZ5 A;  4GIQ A;  4QM8 A;  5C8C B;  5HCH A;  4AVA A;  1PX3 A;  3OGG A;  3USU A;  1CJD A;  2VD7 A;  1QKQ A;  1QJU 2;  1VE0 A;  3MUY 1;  1S0C A;  1WW7 A;  3H7J A;  3RYR A;  4CEY C;  3DKQ A;  2D97 A;  4JC1 A;  2VOT A;  2ZGQ A;  3H50 A;  3R4U A;  1FOD 2;  3CL1 A;  2W0X A;  4BXS V;  1DQ2 A;  4NN0 A;  3AMM A;  1SBD A;  5IAV A;  2RJK A;  4XXA A;  4PLM A;  4X6R B;  1AX0 A;  3WP3 A;  3I2G A;  3OUJ A;  4HVR A;  4KU7 A;  4ZKT B;  1W99 A;  5FP7 A;  1IS3 A;  1GZT A;  1IQD C;  2R07 2;  4FPO B;  5FXZ A;  4CTE A;  2J42 A;  2NPI A;  3ZX7 A;  5E6H A;  2X5I A;  1AL2 3;  4IER A;  1ZBE 3;  1KXG A;  1J3Q A;  4TLF A;  3U14 A;  2W91 A;  3POW A;  4Y22 A;  4BQX A;  1AXY A;  2HWC 2;  3MIG A;  1OLQ A;  2VZV A;  5H9R A;  5J1X A;  5FY0 A;  3FHA A;  4LEJ A;  5K9Y A;  4MG2 A;  2QDR A;  3J4U H;  1DFQ A;  3POG A;  4GA9 A;  4FCA A;  4W6W A;  3HAG A;  1N3O A;  3OCP A;  3B9I A;  1UNB A;  4JTO A;  2RM2 1;  3POI A;  1IQA A;  2QQM A;  1C5H A;  1D0H A;  5I0D A;  3M3C A;  1LOG A;  4Z2W A;  4ARY A;  4UBG A;  4OQ8 A;  4UF0 B;  2D5H A;  2WZP P;  4YG6 A;  3VZM A;  2E63 A;  2W5F A;  1COV 1;  1RHI 3;  1NG0 A;  2JB8 A;  2QQK A;  3WHU A;  4FFI A;  1GNZ A;  1XE8 A;  1UF2 C;  3RMY A;  2ZX3 A;  3EXU A;  3NL1 A;  1HKD A;  2CSG A;  1W2A X;  2Q8O A;  1H2K A;  2FDJ A;  3MIH A;  3RDI A;  5ACA 2;  2IXJ A;  3N9Q A;  4DS0 A;  1H4H A;  1PIV 2;  2VVE A;  1J83 A;  2UUR A;  1V9U 2;  3LQC A;  3M1H A;  4M3C B;  3UKV A;  2XHK A;  4XFH A;  5BV6 A;  1QF3 A;  1HRI 3;  3LF7 A;  2BFU L;  2VUJ A;  3AP4 A;  2PAK A;  5FUP A;  3ZSM A;  4XIK A;  2ZAC A;  1O5L A;  4HN0 A;  4ARX A;  4NIG A;  4FTB A;  2I07 B;  1W8F A;  3ZFF C;  1ZZ9 A;  1JH5 A;  5KXC A;  3RWN A;  3SCH A;  4YFW A;  3CMG A;  2ZEW A;  1BK0 A;  3CZU A;  2BYV E;  2PLV 3;  1Q8S A;  4JQT A;  5HV0 A;  1W8T A;  2Y34 A;  3ZFE C;  1JZ2 A;  4UW4 A;  1L7R A;  1RUE 3;  2VMC A;  4N9I A;  5IJR A;  4RHV 2;  1ZZC A;  1XE7 A;  2P6H A;  3ASI A;  1TEI A;  4AOC A;  4XUP A;  4CCN A;  3ACF A;  4C91 A;  2JDU A;  1OXC A;  4Y5T A;  5FZO A;  5JXG A;  3BU0 A;  4LLF A;  1CQ9 A;  2JE9 A;  5C71 A;  3B9C A;  1TME 2;  1R09 2;  1DQ6 A;  1PGS A;  4Q4V 1;  2A6Z A;  1X8E A;  3H1M A;  1CWP A;  3M3Q A;  1XNA A;  2Y38 A;  2XOM A;  4D94 A;  3QCW A;  1ND3 C;  2VAU A;  2EID A;  4XUT A;  1EV1 2;  5EV7 A;  5CFD A;  1ZZ7 A;  3THP A;  1KEX A;  4DUW A;  2R49 A;  1ZM1 A;  2W1Q A;  4XW3 A;  5ABJ C;  4LK6 A;  4FXK B;  1GYK A;  5EZW A;  5LBF A;  4L11 A;  4AI3 A;  3PTR B;  1I1E A;  3B69 A;  5AVP A;  2C26 A;  2C0Z A;  3V56 A;  2YZ4 A;  2VZQ A;  5C3S A;  3MPP G;  1YQC A;  3WT3 A;  2G9F A;  2GAL A;  3O14 A;  1VAK A;  1FV3 A;  5IFP A;  2CYF A;  3WSO A;  3WW3 A;  2PN5 A;  5FPL A;  1H2N A;  1PZ9 A;  3N7L A;  2WAB A;  4QAW A;  3KHB A;  3ZYR A;  3VBO B;  2GH2 A;  2W68 A;  2RS5 2;  1RUI 3;  3VBR A;  1NYW A;  4FPC A;  3GM8 A;  5FYU A;  2ADE A;  2HWF 2;  4FAG A;  5AC9 2;  3AZX A;  1FMD 1;  4XZU G;  3HN1 A;  3VD4 A;  1QH6 A;  1OVS A;  3MLK A;  3IDB B;  4LT5 A;  4L8Q A;  2XLG A;  3UGG A;  2BUK A;  4DUX A;  1VBC 1;  2DBN A;  3Q8E A;  4Y20 A;  5IFT A;  2Y0I A;  3NKG A;  4YZ3 A;  1WCU A;  5J7M A;  4XJ9 A;  3I3E A;  1F4A A;  1DGR N;  2AYH A;  2XHN A;  3A23 A;  3EYP A;  4MHR A;  2NP0 A;  1AYM 1;  4COY A;  2TBV A;  5FZC A;  1OVP A;  1RXF A;  2QJV A;  2VU9 A;  5A32 B;  3N4M A;  2YRO A;  1HN0 A;  3CJI B;  3U37 A;  3OYW B;  5FPU A;  3NJX A;  1BXH A;  2VQA A;  1FOD 3;  3NKT A;  4GWI A;  3B3Q E;  3VL9 A;  1UU5 A;  2BGC A;  1BBT 1;  1OFN A;  5FZL A;  5A3N A;  2WA3 A;  3T1L A;  2NMN A;  1RVF 3;  3USS A;  4C90 A;  2GSY A;  3JBG 2;  3LA3 A;  1QXR A;  4GH4 A;  3IIA A;  1ZNP A;  3POE A;  5FY7 A;  3VBS C;  4AVT A;  4P9I A;  3NMB A;  5BNO A;  3KM5 A;  3TEZ A;  1Y7B A;  4AE2 A;  1GFF 2;  2K0G A;  2Q1Z B;  3VHP A;  4DEV A;  4XFF A;  1O7F A;  3U4X A;  1UY1 A;  4LKS A;  2HWC 3;  2W08 A;  3H3U A;  1G8W A;  3OEB A;  4MGS A;  1I5P A;  3MLJ A;  5F1R A;  3BOP A;  1LES A;  4AXO A;  4JZR A;  4N43 C;  5CFC B;  4EN8 B;  2G4I A;  3OTF A;  3JQX A;  4EWE A;  1CIW A;  3HT1 A;  5EIY B;  4Q4X 2;  5BNN A;  3NJZ A;  3FFQ A;  2DFC A;  1SHW B;  4NIH A;  3HVD A;  1GQG A;  3V0B B;  4IXL A;  3QD6 A;  4IE7 A;  1STM A;  2XBO 3;  4YW7 A;  5HI0 A;  3MO4 A;  2FCU A;  5FV3 A;  2VO5 A;  4CCD A;  4NHL A;  2IXL A;  5D8A A;  1LCL A;  5IK5 A;  1GZ9 A;  2GDF A;  4C8D A;  1HIX A;  4JTN A;  4CDW C;  3VD9 A;  5JZG C;  1F5F A;  4JKL A;  5IUQ A;  1HB1 A;  1GU3 A;  2WSV A;  2FMD A;  5BNP A;  3J26 N;  4D0Q A;  4WV8 A;  5ACA 3;  4K9S A;  1PIV 3;  3A0K A;  2JG8 C;  1ULD A;  2ZXQ A;  1EAH 1;  2P34 A;  1AYN 1;  5FZ4 A;  4CU6 A;  4YLZ A;  3SLI A;  1VBA 2;  2EXI A;  4Q1P A;  4CCK A;  1WLC A;  1VIW B;  1NA1 C;  3HNM A;  3CHX A;  4W8J A;  1AX2 A;  1T6G C;  3WOG A;  3POJ A;  1RTV A;  2XLA A;  4MGI E;  1X82 A;  3MI8 A;  4IE5 A;  3ZN4 A;  4CEY A;  2OZJ A;  3MLL A;  1NQD A;  1Y9M A;  4I0W B;  1RYY A;  2PEL A;  3MF9 A;  1FYU A;  3KT4 A;  4ASM B;  4RHV 3;  3AK0 A;  3DYP A;  3BUC A;  1FAT A;  5F37 A;  1RIT A;  2BVB A;  4FAH A;  1AR6 1;  2Z2S B;  3I2I A;  1XU2 A;  4ISR A;  4JDN A;  3AYA A;  4QKB A;  5FZE A;  3DXU A;  2Y6J A;  5F7U A;  1TME 3;  1R09 3;  5K0U B;  1CGP A;  3L2H A;  2HEY F;  4ZU4 A;  5F6K A;  3IB3 A;  3IPV A;  2IFW A;  4IV1 C;  5FLI A;  5G04 L;  5H9Q A;  2HWD 1;  4AGR A;  5JLV A;  4OHW A;  3I59 B;  4OI4 A;  5KHJ A;  1FMD 2;  1JZ5 A;  2VOW A;  5FQ0 B;  1YHF A;  3ROU A;  4E8C A;  1EV1 3;  4M4R A;  3KV9 A;  2B8M A;  4H14 A;  5ISL A;  2JDP A;  3ZDV A;  1CAX B;  2UWB A;  3FX3 A;  5FXW A;  2OYZ A;  4DB5 A;  5CBL A;  4KG0 A;  2QZ2 A;  2YGM A;  1EPZ A;  4E2Q A;  3QH6 A;  2HJI A;  2DVF A;  3WF1 A;  2R04 1;  5J48 A;  1XRU A;  5HV4 A;  4KI5 M;  2VUC A;  3T08 A;  4FXG B;  4ES8 A;  1LTE A;  2WWJ A;  1C8N A;  5CVR A;  4F83 A;  2D6K A;  2YDE A;  1BMV 1;  2WC2 A;  3AP5 A;  5GZF A;  2HWE 3;  3DEM A;  2RS5 3;  2OA2 A;  3OOX A;  3E6D A;  2D6P A;  1HJG A;  1UY0 A;  1X33 A;  3H8X A;  2HWF 3;  2YUE A;  1HQL A;  1YC6 1;  2GND A;  4PBP A;  4UFJ A;  1NCR C;  3T2T A;  1K12 A;  5AC9 3;  4CCJ A;  5I8S A;  3R0R A;  1QJE A;  2ETE A;  4XZP A;  3T3Y A;  1L3J A;  1X50 A;  4QKF A;  4XMA A;  1QQP 2;  1GSL A;  4Z1V A;  1OOP B;  1OPO A;  3AZY A;  1HXS 1;  3C7F A;  1CON A;  4FPE A;  4BA6 A;  3W20 A;  4CCO A;  2GAU A;  4KWK A;  3VKN A;  4BK4 A;  3K75 B;  3LSD A;  4DO0 A;  1RGS A;  3ZFF A;  3UK9 A;  1RUG 2;  5FUI A;  2XB6 C;  4AHW A;  1TVG A;  1DG6 A;  1IZ3 A;  1AR9 1;  2BNM A;  1W3X A;  3N9N A;  4FOV A;  3LKJ A;  3ST7 A;  2D40 A;  5IVF A;  2WYS A;  3AJY A;  4CDW A;  1YUD A;  3PUI A;  4LHS A;  1C57 A;  3FBM A;  3PJQ A;  1UPI A;  1LHN A;  2JX9 A;  2YB7 A;  2J1V A;  3GCX A;  1H30 A;  3JBG 3;  2NLR A;  5J3U A;  4ZU7 A;  4FPG A;  1DLL A;  5JSR A;  1DLC A;  4WVM A;  1S1A A;  2C6S A;  1YWK A;  1DQ4 A;  2VNV A;  4E27 A;  1QY4 A;  2EAL A;  1ND3 A;  1KFU L;  5T55 A;  1RUO A;  4LHK A;  5ABJ A;  5FYY A;  3HJR A;  2JDM A;  5F3E A;  2IZW A;  2J1R A;  4LQR A;  5FZG A;  3CQO A;  3I2O A;  1JBC A;  3MW2 A;  3EO6 A;  2KR2 A;  4ZS2 A;  3K51 A;  3RG0 A;  3WNN A;  4AQS A;  4OHV A;  2BV4 A;  2W1S A;  1SLA A;  3KLS A;  5B4X A;  1H4G A;  4Q4X 3;  1WLT A;  4P9Y A;  4YW2 A;  2DCY A;  2IVI B;  4O61 A;  1W0P A;  3RJR A;  3WV6 A;  1NY7 2;  2EIE A;  5A70 A;  4ERO A;  2HEW F;  1NUK A;  2V5Y A;  3DYO A;  3P3P A;  4HZF A;  4ZU5 A;  4YG3 A;  4XF3 A;  4BLI A;  2OPW A;  5LRR A;  3IKW A;  3ZVX A;  4U2A A;  4PI2 A;  4GMP 3;  2JIG A;  3TAY A;  2LAL A;  2WFF 2;  4FQZ A;  2IC1 A;  4NPL A;  4G4F A;  4B7K A;  2E7T A;  3WCR A;  1U5I A;  3NNJ A;  2J22 A;  5FBZ A;  5A1A A;  2PHD A;  1PO1 2;  2VQU A;  2JDK A;  1FAY A;  4V1P A;  3THD A;  1HDK A;  1PZ8 A;  1R64 A;  4QMA A;  5C8C C;  3S0M A;  2ZAA A;  1VBA 3;  1F31 A;  2IVJ A;  4QPG B;  1K5M B;  1MZF A;  5JWP A;  3MZH A;  3EQE A;  3VBU B;  2AC1 A;  4HK8 A;  1A34 A;  3AMH A;  1A78 A;  4M3C E;  3OY8 A;  3ILR A;  5DPN A;  2RS3 2;  4LUM A;  4L92 A;  4GKY A;  4Q0V A;  4XDO A;  1H6Y A;  3J7H A;  1CES A;  4RS5 B;  5FOB B;  5KC6 A;  2VTX A;  3O5S A;  3LD8 A;  4K7J A;  4CEW B;  4AI2 A;  4AWD A;  1Q43 A;  2R16 A;  4NRP A;  4QPI B;  5KHK A;  3P6B A;  4LBQ D;  1BYH A;  1RJ7 A;  1UW8 A;  2CHH A;  2VBB A;  3ZN5 A;  2XJR A;  1PNF A;  4QHO A;  3VZO A;  2E32 A;  3E6B A;  2Y64 A;  1KJL A;  3NST A;  3VBS A;  1M4W A;  1LJ7 A;  1A8M A;  2R6Q A;  3MFA A;  5FPV A;  4XHB A;  5DMY A;  1OFS A;  4AF9 A;  3Q8B A;  3S7I A;  5J37 A;  4YAR A;  4N7I A;  1ASJ 1;  3A21 A;  4PIY A;  2R06 1;  4XDQ A;  4EN6 B;  1CD3 G;  2L9L A;  2VW1 A;  3MIC A;  2X5I C;  4YVW B;  2YGL A;  3O0V A;  3SKJ E;  5LA9 A;  4NWV A;  1HRV 3;  3DPR B;  4OMD A;  3VDD C;  4Q8K A;  5FCC A;  1F4H A;  1RIN A;  1S2B A;  5FXX A;  4IQP A;  1Q8Q A;  2JDY A;  1DGL A;  2Q0A A;  2R32 A;  3KSC A;  3OPZ A;  4GUL A;  5C33 A;  4I2O A;  5FPX A;  3BKZ A;  5FYI A;  2OS2 A;  2ZAH A;  2K2S A;  3NJV A;  4YM2 A;  4DPN A;  2QUO A;  5JSP A;  3V0A A;  1JW6 A;  2YC2 A;  3PVB B;  4P9J A;  1WCQ A;  1UX7 A;  3D3A A;  1KIT A;  2PTM A;  3DCQ A;  1QEX A;  2Y6L A;  2PHX A;  3I2F A;  4QHB A;  5EQU A;  3THT A;  3I2D A;  1FPN 1;  1YLL A;  1HN1 A;  3KV4 A;  1VMH A;  1AR8 1;  1IPS A;  1DGW A;  3U1X A;  1MZE A;  1QJX 1;  2OPK A;  4AFB A;  5JZG A;  2VUL A;  3M70 A;  4YM0 A;  5DZG A;  1JYC A;  4DXR A;  3I2K A;  2R0F A;  1YJK A;  1OUR A;  1QQP 3;  1RUC 2;  2PAE A;  1JI6 A;  2Q4S A;  3MYX A;  1QJZ A;  3IDE A;  3LAG A;  2CWS A;  3WDX A;  4EYU A;  1NA1 A;  1ZBA 1;  4DY3 A;  4ZZ8 A;  2Q5T A;  3CKH A;  1JTZ X;  1U5Y A;  1RUG 3;  4CXY A;  3OGV A;  4LJH A;  1PGL 2;  3D4K A;  3BIW E;  1UZZ A;  5F5A A;  4EE2 A;  4DEQ A;  2P4E A;  2ARX A;  1GIC A;  3K77 A;  4GJY A;  3DUI A;  4B1M A;  4C1X A;  2WJS A;  4LKF A;  3NNL A;  2IXH A;  2WNV C;  2LRO A;  3HNB M;  1W6P B;  1XSR A;  2LUW A;  3MID A;  3PUQ A;  4PLO A;  3WW2 A;  4QX0 A;  1YFY A;  3QOP A;  4XAC A;  3JCI A;  2JWP A;  4PIZ A;  2VOX A;  3S57 A;  1V00 A;  4QGN A;  1OC1 A;  1AF9 A;  1MS8 A;  2DV9 A;  2CAU A;  4UW6 A;  1Q8V A;  1E5R A;  3CEW A;  4IV1 A;  4KWJ A;  5C9A B;  3R4D B;  4A2U A;  3N36 A;  4NIA A;  1JUH A;  2HWB 2;  1SAC A;  1UXZ A;  1W8W A;  2YU1 A;  4Q26 A;  4JGZ B;  4FOY A;  4LE3 A;  1RUF 2;  1X7N A;  1QDO A;  5KC5 A;  1ACC A;  1YO8 A;  1D2Q A;  3M3O A;  1H0B A;  3WNO A;  5E89 A;  2DUR A;  4BM8 A;  1XOY A;  1O4Z A;  3PHM A;  4YSF A;  1VRH 1;  5A7W A;  4AED C;  1UMH A;  4FI9 A;  3WNP A;  4JDM A;  4YGC A;  4LK7 A;  1QJF A;  1D4M 1;  1RUH 1;  2A70 A;  2J1E A;  2R1B A;  2LTN A;  2SBA A;  4IV3 B;  3ZN6 A;  1YQ6 A;  3LIH A;  4XFC A;  4BLJ A;  1XNC A;  5LAS A;  4O9G A;  4PQQ A;  5D1I A;  5LZ6 A;  1JYI A;  1X9P A;  2WFF 3;  2YPD A;  3NAP C;  5A3U A;  4MGT A;  1JOJ A;  2ERF A;  3GHN A;  3NJY A;  1NCR A;  5L9V A;  1GZC A;  5T52 A;  1PO1 3;  1R08 2;  1BHG A;  2JEN A;  4DQA A;  4QQ2 A;  5DDJ 1;  3PUR A;  4ZON A;  1DIW A;  5GZE A;  2BWA A;  4O7X A;  3BTY A;  1I6X A;  1QIQ A;  3FFZ A;  3RWK X;  1DZT A;  4B1L A;  3I49 A;  3VBF C;  1XU1 A;  4LKE A;  1SFN A;  3ZYH A;  3TN9 3;  3LPG A;  3W58 A;  4V2W A;  4EN0 A;  4KBB A;  1LU2 A;  3KV6 A;  1W3V A;  5JXH A;  3BIE A;  3TYJ A;  3ITQ A;  5JIU A;  2RS3 3;  3ZPY A;  4HMZ A;  1JOP A;  4HPK A;  3JB4 C;  1N1S A;  1Q8O A;  1VBD 3;  4CCL A;  2ZZQ A;  4Z07 A;  4A44 A;  2BBV A;  3WP6 A;  2FD8 A;  2RV9 A;  1LRH A;  3OUI A;  4SLI A;  3W59 A;  4GB3 1;  1RB8 G;  4Y1Y A;  1GAN A;  4ZHN A;  3TWI A;  1HX6 A;  3DKW A;  2BU9 A;  1POQ A;  1PVX A;  1VMJ A;  2W9X A;  2ZEX A;  4CDX B;  4KQ7 A;  4NRM A;  3JD7 2;  2OXB A;  4BIF A;  3SIT A;  1U0A A;  1W6Q B;  3WF0 A;  4HK9 A;  4CXW A;  4A42 A;  1GWL A;  1FPN 2;  3ZXG A;  1AR8 2;  4BME A;  2J1A A;  1QJX 2;  1W9T A;  4PCR A;  5H9P A;  5DN2 A;  3VDC A;  3WIN E;  2D98 A;  4YVS C;  2ZHN A;  1UYZ A;  1OUX A;  5LCW L;  4NPR A;  1VBE 1;  4N8M A;  3WQB A;  4D6S A;  3ELN A;  3ON7 A;  5LBB A;  1GNH A;  1W6N B;  4QQO A;  1TNF A;  4FPL A;  4FPY A;  4QB1 A;  4A6S A;  3O1U A;  1LGC A;  4XUR A;  4N53 B;  2RMU 2;  4RQP B;  3RI9 A;  4CDQ A;  3HQU A;  2D6O X;  3I3D A;  3N3H A;  5I93 A;  5LWB A;  4MHU A;  2CDO A;  2FDF A;  1QJY 1;  2FCT A;  4CZS A;  2EAA A;  4ASL A;  3BPZ A;  2X05 A;  5LB6 A;  5DAP A;  1MR5 A;  4MVT A;  1JYW A;  1UMI A;  3III A;  1EP0 A;  2QTW B;  1NCQ B;  3AC0 A;  2YXS A;  4Q4Y 2;  2WNU C;  4HKL A;  1WD3 A;  2ZZJ A;  1LOC A;  2YBP A;  5FZD A;  2HYK A;  4DMI A;  4ONU A;  2JKX A;  4W6Y A;  2I74 A;  4R9B A;  3RZZ A;  1H8V A;  1YJL A;  1OBN A;  4QHZ A;  3T30 A;  1RUC 3;  3A0N A;  5FKB A;  5C8C A;  1PM7 A;  3R05 A;  5FFO C;  3IBM A;  5KBF A;  5IK8 A;  1OF3 A;  2X29 A;  1UAI A;  1XQN A;  1EUU A;  3AB0 A;  3K2O A;  2CU5 A;  3I3Q A;  2GN7 A;  4XJW A;  1DQ0 A;  3LB9 A;  4K3U A;  3WNM A;  3HQX A;  4YGB A;  1F35 A;  1PZ7 A;  1V6N A;  4IEW A;  3B93 A;  4O9E A;  4A45 A;  1N1Y A;  3TB0 A;  1PVC 1;  1H2L A;  5EPA A;  3DL3 A;  1YFW A;  3WG3 A;  4CSW A;  4J1X A;  5FZ9 A;  5JI7 A;  1DGW X;  3VZL A;  2IXC A;  1W8U A;  2A6X A;  2YBS A;  1KS5 A;  1W39 A;  4XAA A;  4Q0S A;  3ILF A;  4KU8 A;  1HV0 A;  1RUH 2;  4EQV A;  1AR7 1;  2WN2 A;  3NNM A;  3H3L A;  3OGR A;  4XFB A;  1DQ5 A;  1IS4 A;  3T4H B;  2ZX2 A;  5K8S A;  4BMB A;  1SDW A;  2G9Z A;  3GF6 A;  5ANN A;  3IM0 A;  4Q5O A;  2MEV 3;  3EHK A;  3LGR A;  5FTT C;  1LHW A;  4B4Q A;  5IVE A;  2HWB 3;  4LXL A;  4C0B A;  3KHC A;  1OQE A;  3WD5 A;  1QNW A;  3LDB A;  4PF1 A;  1RUF 3;  3VZN A;  1ZA7 A;  1NLQ A;  5CZK A;  3FBY A;  3VDD A;  3IZO A;  4A3Z A;  4K20 A;  4C0H A;  4D6Q A;  2PHF A;  3ETP A;  5DAX A;  2WIN B;  3Q9O A;  3HOB A;  4QKD A;  4UF0 A;  2B5H A;  2QQU A;  4YWA A;  5ERL A;  3LEK A;  4DUV A;  2DVG A;  2JE7 A;  1G9D A;  4OFG A; 
#chains in the Genus database with same CATH homology
 1HN0 A;  1OH3 A;  3F95 A;  3UT0 A;  4A6S A;  4BQ3 A;  1W8W A;  1UOJ A;  4LJH A;  5D21 A;  1GWM A;  1WMX A;  1OKO A;  1W9F A;  2KR2 A;  4CPB D;  1WZX A;  4LK6 A;  4CP9 A;  4BQ4 A;  4BQ5 A;  4YW6 A;  2O14 A;  1W8T A;  2WYF A;  3ORJ A;  1GWL A;  2LRO A;  4LKD A;  4LKF A;  4YW7 A;  4CPB A;  2K46 A;  1L7L A;  4LKE A;  2C24 A;  2LRP A;  1W8Z A;  3ZYH A;  1WCU A;  2JWP A;  3ZYB A;  2VXJ A;  3ZYF A;  2Q1F A;  4AL9 A;  1W8U A;  4CP9 B;  1GWK A;  4BQ2 A;  4YWA A;  1W90 A;  1V0A A;  4LK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...