4AL9A

Crystal structure of the lectin pa-il from pseudomonas aeruginoas in complex with melibiose
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Secondary Sugar Binding Site Identified for Leca Lectin from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4al9A00
5D21A 3F95A 2KR2A 4BQ3A 3ZYHA 4LK6A 3ZYFA 4CPBA 1WCUA 1GWLA 4BQ4A 4LKDA 2Q1FA 1L7LA 1HN0A 1OKOA 4CP9B 1WMXA 1W90A 1GWMA 4YW7A 4BQ5A 3UT0A 4CP9A 2LROA 1W8TA 2C24A 4LJHA 1W8ZA 4LKFA 1OH3A 2LRPA 1GWKA 4YW6A 1V0AA 1W8WA 3ORJA 1W9FA 2WYFA 2O14A 3ZYBA 4LK7A 1W8UA 4AL9A 4CPBD 2K46A 2JWPA 2VXJA 1UOJA 4BQ2A 4LKEA 4YWAA 1WZXA 4A6SA
chains in the Genus database with same CATH superfamily
4AFDA 5A3MA 1Y9GA 4RQPA 2RDQA 1TG7A 3SNMA 2W91A 4QU1A 3LSDA 1QDCA 3OPTA 2VUCA 4QU2A 3AC0A 5JZGA 1G9AA 1LU2A 1RXFA 3FX3A 3FN9A 3ATGA 3BVCA 4ZZ8A 1D4M1 3MICA 2D5HA 1QXRA 2WNUC 3AKTA 1S0CA 4JKMA 5EFUA 3T1LA 3WQ1A 4Z2WA 4FOWA 3NKGA 4JCKA 2NP0A 5A6XA 2X10A 5JUVA 5BPXA 3KT1A 3S5QA 1UZYA 1G9BA 1DCSA 1ULOA 1RVF2 2D97A 5FK7A 3M3OA 3RWKX 3IMMA 1UOJA 1GZWB 1TME2 1LECA 3NKTA 4LORA 1REEA 4Q26A 4X6QB 2WWSA 4NIHA 5GALA 1JHNA 1FV2A 1PK6A 1CZSA 2Y34A 2TUNA 4MZUA 5CVRA 4YM1A 2CDOA 2D98A 2Y6HA 3HT1A 3MIEA 4HL0A 3WNLA 1MS8A 4QX7A 1D4M2 1GZ9A 3URFA 2FCVA 4XOGA 4E4ZA 2HJIA 1AHSA 3CZUA 3I7DA 2CGOA 1WCDJ 3RYRA 2DDUA 5I8SA 1UNBA 4ZHNA 3RZKA 1SEFA 1YCIA 2ARBA 3FFQA 5FREA 1W6OB 5DPNA 3CNAA 2C5DA 4N43B 5FZFA 5JSOA 1NUKA 1RJ8A 4RR3C 1D0HA 2BW8A 2JWPA 3FLTA 4QQ2A 2X09A 3FBYA 3WDYA 1C5HA 2DBNA 4JQTA 1ONAA 4A42A 1YUDA 1CPMA 1XRUA 2WZR2 1F35A 3AK0A 5A7NA 1APNA 4QPIC 1FOD1 5D2AA 3VL8A 1YQ5A 2W9XA 1XC6A 2PA7A 3ZOIA 1VBB3 5JSPA 1NT0A 3UYJA 5D8AB 3VDAA 3ZFFB 1VBD3 5FMDA 4AQ6A 4EQVA 2YUEA 1OF3A 3C7HA 4P9WA 4EN7B 2GALA 4IESA 2AEYA 1ND3C 5EP9A 4A3ZA 1XQNA 4UFJA 1W9YA 2OPKA 2YYOA 4IEWA 2V4AA 4JRAA 4XJZA 1EAH1 2QQOA 4GMP0 5C71A 4E2GA 4QGNA 1G9DA 1H9WA 2PHWA 2NM1A 2BFUS 2Y8KA 3WDTA 4AYUA 2RG4A 3HAGA 2WT0A 5ANNA 1JZ7A 4IUGA 2WUHA 5LK5A 1AX0A 2RE9A 2VCBA 3CJIC 4LO5B 4X8PA 5A6ZA 1ST8A 5C9AA 1KFXL 5L7OB 2ARCA 1ULDA 2ZZJA 2QZ3A 3V65A 2HBTA 3ZO0B 3RWNA 2B8MA 2WO3A 4AI8A 4CCLA 3I2FA 4H7MA 3OBZA 4HPKB 1NXD1 3U37A 5C8CB 4FPCA 1QJY1 3O5SA 2VXRA 1OT5A 3ZSLA 4ORFA 5EIYB 4Q2FA 4R4XA 4YZ3A 4D94A 1EAH2 1JZ2A 3AB0A 4LOSA 1UCXA 1YWKA 4XC9A 1AXKA 1OXCA 2RJ2A 4Y5TA 5LBEA 4MUVA 1DQ1A 2V4VA 4E9KA 2X29A 2OUHA 1ZRDA 1LNSA 1XNTA 4TXWA 1JOPA 4DINB 4CU7A 4BQ3A 3WW2A 3MO4A 1ULGA 1UYPA 2P3YA 1W9SA 2H0VA 2JJ6A 2VD7A 1I1EA 1EP0A 4GH4B 4MHUA 5DUVA 1GZTA 1WMXA 1QEXA 1JXNA 4LTAA 4RGGA 4QQOA 2Q8CA 4LBNA 1QJY2 1SDWA 4TN7A 5A33B 1G86A 2VZOA 3OY8B 5ACA1 2FDGA 4E2SA 1WWYA 3NJVA 3IPVB 4CUGA 4YVWB 3U11A 4M0HA 2EXHA 3SC7X 2VMIA 1WA6X 4EROA 2XWJB 1OLMA 2ZZQA 1TME3 3BOPA 1GP4A 2IXLA 3ZYBA 3O1OA 1LEDA 2VXJA 5L9VA 4Q0QA 3GXUA 4ZXKA 3I3MA 2ZX4A 3VBHA 4Y1ZA 2V5YA 3KD4A 3WNNA 2XMLA 5CEHA 4BH9A 2IWGB 4F83A 1SMVA 2P34A 5JOWA 5BXXA 4TTGA 1RUC3 3INAA 1H1MA 5HCFA 4EN9B 1EV13 3S7IA 2VVEA 3QD6A 3VHRA 2R1DA 4AZZA 4W4ZA 3RZJA 2RHPA 3ZFGB 3LDKA 2CWMA 4HKOA 3B69A 3LE0A 1HLCA 1JU4A 2GN7A 3WY6A 5IVCA 3SHRA 3GGLA 1C8NA 1WCQA 2XUMA 3PDQA 4OMDA 5JOXA 3LAGA 2P3IA 1WBLA 1ASJ1 3OUHA 3TAYA 4YW1A 1W6OA 2BJSA 1H2KA 3AYCA 2WZR3 4D6QA 1DU3D 3KM5A 4PCRA 2JENA 3PTRB 4FPGA 3VBSC 3OG2A 1XE8A 4X8NA 4B3NA 4OUMA 2ADEA 2XQXA 2B42B 4AR2A 1ZA7A 1ZBA1 4BMBA 2H6CA 2WNUA 2G4IA 3RZLA 1KFUL 2DYCA 2BNMA 4LO8A 3RDIA 3SCHA 4AHYA 1JI6A 1L7LA 2R30A 4MH0E 3BYWA 3AMMA 1IGOA 4QD2A 3AP9A 1MQTB 1VBA3 2ZXQA 4J25A 3VBUC 4URAA 3M7AA 2QQNA 5T52A 1QGLA 5JOYA 1AL23 1W28A 2D3RA 4INDA 1JU3A 4MYEA 2VAUA 2V5DA 4Z82A 3HIFA 3CIHA 3SH4A 2R073 1S55A 1BVVA 5I0SA 3ABZA 2HWC1 3AYEA 3UJOA 3V0AB 5J36A 1HV0A 3GJAA 3PUIA 1X9PA 5IK5A 1VBC1 2ZGMA 5IAVA 3J7LA 3OUJA 2ZTNA 4KU7A 2PQSA 4AI2A 4WVWA 5L7OA 5C7GA 2AGSA 1RUH1 3KWVA 3OGJA 4RR3A 3OBAA 2HEWF 4A4AA 4OMCA 1YHFA 3DKWA 2Y26A 4GQ7A 3WEZA 4B4PA 4E4DX 1YQ8A 4HPKA 4F3JA 1W8WA 2Y6LA 2YG0A 3JD72 4QPIA 4E4SA 1GV9A 1QQP1 5IHRA 4AF9A 5FZDA 1REFA 4NJ4A 4AVSA 2VMHA 4YLZA 5AVPA 4GZ9A 2HH9A 2AH2A 5EYXA 5FPAA 3TBDA 1KD7A 4YARA 5CISA 4ET7A 2ZGTA 1WZXA 2VQUA 2Q8DA 1H8TB 1RUD1 3MIDA 3N9MA 5I91A 3MHZA 3OB8A 5T5JA 3K4DA 3NJZA 4LO4B 3IWZA 1UXXX 2A6VA 1YFWA 1POQA 1HN0A 2VZ1A 3LD8A 2EA7A 4UFMA 4DPNA 2AEZA 1CR7A 1E5RA 3M2MA 4GH4A 4RA0A 4IEZA 3SKJE 1BQPA 1Q8QA 2ZOEB 3IIAA 1YEWA 1WW6A 5A33A 3MZHA 4F8AA 5FO9B 2BDRA 3OY8A 4MVTA 1OUXA 3NNLA 1UY0A 3PUSA 4YVWA 2HBUA 4FO9A 4LBLA 2RV9A 3JQXA 4AI1A 1GMMA 3KHCA 2GDFA 1UPSA 2GMEA 3PJQA 1D7PM 4LK7A 5L73A 5L9RA 4Q4V1 3WQ0A 1RUD2 3WZ1A 4LKEA 1NZIA 2IUWA 3AKQA 1RUE1 2WBKA 4COWA 5K9YA 3MGUA 1VB2A 2ZS6B 4GD4A 1XYPA 4DRRA 3WDWA 5E16A 3WW3A 5K0UB 2IXCA 4X6RB 1AYN1 4NRMA 4QPGC 4M3CF 4CP9B 3E5XA 4Q29A 2RS11 4QX2A 1AVBA 1UZWA 3ZFGA 3ZXAC 2CYFA 4CEWB 3SEEA 5C3RA 2VTXA 3HEIA 5GLUA 4TLGA 1OQ1A 3DYMA 1WMDA 3FHAA 3ZXEA 1IS3A 1QNYA 4MG2A 1UU4A 4OUEA 1B35B 4Y24A 3JBG1 2JDYA 4YW3A 2YBSA 1H6YA 5CIRA 3I2OA 5FTTC 2VVFA 1FAYA 1IPSA 3JUUA 2O8OA 4IERA 3ZYRA 3EBRA 3SLIA 1HQWA 3PMSA 5BNOC 3OTFA 5H9QA 1QNWA 4B7KA 3A7QA 5AFEA 4P00B 5HBAA 4XQWA 2WKKA 2GZWA 2RS12 5EHDA 3TYJA 3ZYIB 1V6NA 2AYHA 2D6PA 3GYDA 4LMFA 2W2IA 4XAEA 4CP1A 2B46X 2V73A 3J7MA 5C8WA 1OD5A 2A6XA 1MQTA 5FUIA 5JCTA 1ALYA 1YXWA 2AC1A 1S4CA 3O0XA 4LEJA 1OVPA 4N53B 3GALA 2BTVC 1W8NA 5FQ0B 1AYM3 1C28A 3UK9A 1RUJ2 3WNKA 3CHXA 4DO0A 1I5ZA 2R062 3R4DB 5C4WC 4KGQA 4LBKA 4Z8BA 1H8VA 1R083 1PO21 3OEAA 3V0AA 4MGTA 2QDNA 1CIWA 2Q5TA 2C6SA 2JIGA 1DLCA 1VR3A 2JG9C 4QPYA 1CAVB 2ZHKA 5A3UA 1UWWA 4FXGB 1GWMA 3QBQA 4Q4Y2 2JECA 2KM2A 2WSVA 4FP3A 3VBSA 1PGSA 5LCWL 4XMAA 3F2ZA 3S30A 2IVIB 2CSGA 2W3JA 1U12A 2ZEXA 5JPMB 1CQ9A 5FZOA 1LOAA 1TMF1 1UN1A 2VQ0A 3MFAA 1UX6A 4J1WA 3TEYA 2FHRA 2UU8A 3POBA 5K8SA 2J22A 2QQKA 2PHRA 4Q4X2 3USUB 2N7GA 2VOKA 3VKFC 1FT9A 4CCDA 4KWKA 2MEV1 4S2DA 1OVSA 3ETQA 4M00A 4Q4W1 3T2OA 1IG0A 4OZXA 5JIUA 5LZ6A 1SLAA 2D5FA 1BK1A 1MACA 3AX4A 2XBO1 4HETA 1YQCA 4QMAA 1LGNA 1WGPA 1ZZCA 1POV1 1RITA 4YGDA 3L2HA 1DLLA 5FY1A 2ZMKA 3RRDA 1GSLA 1QIQA 2DURA 3U07A 1PMHX 3HN3A 4DXTA 1TMF2 3NAPC 4MLOA 3TRSB 1MR5A 1QU0A 2WAAA 3D0JA 2RR12 3ASIA 4YVSB 4CCMA 1RB8G 1A8DA 4B8EA 1EUUA 5LRRA 4BB3A 5G04L 1OA4A 3MF9A 4CCCA 1CAXB 5IWFA 2VBPA 3USSA 3H8UA 4XABA 4AEDC 5JXIA 1UPIA 2MEV2 2VW2A 4NR1A 3HWJA 4Q4W2 3IDBB 4KI5M 3O7OA 3VHPA 5K0UA 1EPWA 4MSVA 4L8QA 2XBO2 5K7PA 4N7UA 4XBNA 4IV1B 4CP9A 4KNCA 4ZS2A 4ASMB 2QBXA 3UETA 3AL6A 3MLJA 1I5PA 2LRPA 4HONA 4W6XA 5CAZA 3ACFA 4XTPA 4YG6A 4JDMA 1YYNA 3CLPA 4FPFA 4NVPA 2GH8A 1V9U2 1R091 2E7TA 1OA2A 3AZVA 3R4UA 2Y64A 4OHZA 2DVGA 1H1AA 2XLAA 1NCRC 5BNPC 1N1VA 1FPN1 2GC0A 1U5IA 1WW7A 4B1MA 1LOEA 5DZEA 4JTOA 1YC61 3GCXA 4UFHA 1H6XA 1GKBA 1SCRA 3SMHA 3KV5A 3THTA 2HWD3 1QOOA 2Z79A 4XUQA 4EN8B 5EJ1B 4FP2A 4P5HA 4JDOA 2Y6GA 2YC2A 2RM23 3B7MA 3EO6A 4MGSA 4RN5A 1SFNA 1QKQA 1HQLA 2A6ZA 3E6DA 1R092 4EZHA 2HWE2 5A1LA 2ID4A 2R063 3IAPA 3POGA 2XH6A 1F31A 4N53A 4A2UA 3WNXA 1FPN2 5JIAA 4XCBA 2EIEA 2QNKA 1NQJA 3S7EA 5FQ0A 3DKQA 4PT6A 2YC0A 4Y5Z0 4E8CA 2CHHA 2JG8B 5LA9A 5FXZA 3R05A 2JB8A 4NO4A 3AXEA 2F6BA 5GM0A 4COYA 3DYOA 2JIJA 2CV6A 3PVNA 1AR61 3N7JA 4PLOA 1AR93 2JDKA 3K2OA 3PUAA 1JOJA 4QKDA 1CAVA 2D3SA 2HWF3 1W3VA 4Z07A 5KWRA 3WT3A 1GU3A 1LEMA 2YB7A 4LT5A 1L7QA 4E8DA 4RGAA 3O1TA 4CTEA 1HIXA 1LGCA 2WFPA 4GMP3 3RG0A 3SQOA 3MV01 3QLQA 5KHHA 5LA0A 5L36A 2WT1A 2VZ3A 4G4FA 4JVAA 3WF3A 1HXS1 1YI9A 1UX7A 4Q4X3 4FFIA 4WVZA 1JYNA 2IXKA 4PLMA 4YW4A 2QCSB 4CPBD 2PAMA 3KCXA 1VE0A 1PX4A 3H7YA 3OGRA 1S0JA 4PF1A 5A3PA 2VW1A 4KBZA 1JYWA 3P6BA 2BOJA 4FBFA 1D2QA 3USUA 1IS6A 1KXGA 2DVBA 1JZ4A 4F7ZA 5A3TA 2RJLA 4BE3A 5DABA 1TEIA 4XFGA 5CU1A 5LASA 4OI1A 2PHTA 4DS0A 3I2JA 2BPA2 4QX1A 1W39A 1W2OA 3CDZB 3R0RA 4D0QA 4YNIA 1OH3A 1LHVA 1S0FA 4RSUA 5LY1A 2RR13 5FPXA 5E6HA 1PZ8A 1H2MA 4NWVA 2E9QA 1QJU2 1F8VA 4W8JA 5FRAA 1BJQA 1YIPA 3C7FA 3GZUC 5JMCA 3WLUA 4FVVA 1O5LA 4YVSA 3VDDC 1BBT3 4FQ4A 2PHLA 1YLLA 3H1MA 4KMQA 2DV9A 3MEPA 2XKOA 4YGBA 1CAXA 4DY3A 2XB6C 1CZTA 3ST7A 4AK3A 1JUHA 1OFSA 4P9LA 2L9LA 4HVOA 5F6KA 5EPAA 1MVEA 4R9DA 3VL9A 3RVHA 1JZ6A 3MW2A 1K5MB 1US3A 4IV1A 2XHNA 1DGWX 3N9PA 4XQDA 1TZOA 2P3JA 5GLTA 2MNGA 3DXUA 2E32A 1LOFA 5CYYA 5JVVA 5I93A 2P5BA 2AACA 4JTNA 5FY7A 2DU0A 3ZN4A 2DTYA 4IEYA 2YHJA 1DDLA 4W50A 3C7GA 5B2GB 3LFIA 3VGIA 4E2QA 3FE5A 5GZFA 4R9CA 1GQHA 1HRI1 1VIWB 2E53A 4HLTA 3AKRA 1UIJA 3D82A 3OOXA 2XJUA 1PK6B 3ZYFA 3I49A 1NCQB 1FI2A 1MVQA 3DYPA 4YGCA 1MEC3 1HB3A 3LDBA 5GZDA 2HWE3 3S6PA 2IFWA 1UIKA 3LA3A 4AEDA 3NQHA 1HRV2 3BN6A 1J1TA 4ATEA 3THPA 3PUQA 3IBMA 1K3IA 2C1FA 2JDMA 2W95A 4IEQA 5JOZA 2VJXA 3OPWA 2VZRA 4D6RA 3AZWA 4UBHA 1H9PA 1RUG2 2D93A 2NQYA 2ZAHA 3ZN5A 4YW2A 3ZXDA 5A3OA 3IT8A 2ZEWA 3HR9A 4NRPA 4XUTA 5A80A 1HRI2 3KQ4B 4JC1A 3KF5A 4A6SA 3RYPA 1EY2A 3N36A 4GWIA 2Q8EA 3KT4A 2ILMA 3N3HA 1J58A 2WJSA 3R4SA 4MADA 5LBFA 4FAGA 1S1AA 1WKYA 2GSYA 4FOQA 5A7OA 3WF2A 4U2AA 1YIFA 2C26A 3Q8BA 2X05A 1G9CA 3B94A 3IDAA 3WXPA 5LATA 2D40A 3BOWA 1ND2C 1PO11 5FZ0A 1ULEA 1VBD1 4GB31 1C1LA 1C4RA 2WFF3 2XPJA 1COV2 2VCAA 3ORJA 4HG6B 2OYZA 4A41A 4TZDA 1BMV1 1REDA 2VQTA 1Y43B 2GC2A 1DGRN 2WDBA 1VBE3 2XJQA 2ZKNA 2VOTA 1N3QA 3RZHA 5SV5A 1N47A 3H0OA 3MLKA 2NMOA 2WA4A 3MUY1 3WNPA 3ME2A 1WCSA 2E51A 3M3IA 3PL0A 2NYYA 2Y6JA 3FHIB 2FD8A 3J8F1 1IS5A 4XF9A 3VD5A 5GZCA 4HK9A 2Z5WA 4SLIA 1QJX2 1DQ0A 1QJU3 1JYVA 2VZSA 1WLTA 2AZ5A 5KXBA 3QH6A 1OQEA 2R0HA 2W52A 4GB32 3VD7A 5F1RA 1UMZA 1GP5A 4YFZA 3P1IA 2ZX2A 4DY5A 1LKNA 3LKJA 1X36A 5CA6A 2QFEA 5E1RA 1O91A 1HKDA 2ATFA 5IK7A 3WQBA 4Y3OA 4OQ9A 4COUA 4FT8A 4LIUA 2RS33 3J7HA 1LENA 2CDPA 2J1SA 2OT7A 3ALQA 4BDVB 1K45A 4HBNA 4PJYA 1AJOA 2CWSA 2RS51 1UY4A 4M3CE 1BEV1 3ZVXA 1RHI2 3J8F2 4EYUA 4IL7A 2OXBA 1AR71 3PLQA 4UWDA 2BQPA 3WDXA 1LGBA 1VRH1 2OS2A 4JGYB 1K5MA 4N8MA 5FXWA 5F2WA 2EXJA 1NLSA 4BZ4A 1DP0A 3NNGA 1X8EA 2P4EA 4BQYA 3T0DA 3TOJA 2XL7A 3FUOA 1BLZA 2VH9A 1UU5A 3NMBA 3ACGA 4K6BA 5JXGA 5FAXA 2CY6A 4PQQA 1PVC3 3M8LA 1Z7S3 1DG6A 3VBHB 3RI8A 2IZWA 2RS52 3NNFA 2OQ7A 1D4VB 4TLFA 1BEV2 4L11A 1AF9A 1W6QA 4DUXA 1AR72 2W47A 2ES3A 1NCQA 5FLJA 3N7KA 5T5LA 4IEOA 4J6GA 4H3WA 2VMDA 4OLLA 3WP6A 5DUXA 1ODMA 2ZACA 5FZHA 4LKFA 4IE7A 3LDRA 1WCKA 4QDQA 2BEOA 2HYXA 2BU9A 2P2KA 1H1IA 3BU0A 3AP5A 1GOGA 1CAWB 2D6KA 3POSA 4LQRA 2VCMA 4AQTA 1CAUA 4DOUA 2R1BA 3VZJA 3CL1A 4RHV1 3VKMA 2QQMA 2F4PA 1CJPA 5F37A 2R041 2VNGA 4NUBA 4IETA 4EN0A 2WNUB 2VOXA 3AP7A 3K46A 3HQUA 1OHFA 2YFUA 1U5ZA 4DFSA 4EZ4A 2PHDA 3MIHA 2DCZA 4LBQD 1DYPA 3PIGA 2IXJA 4QQHA 1OKOA 4Y1YA 4HVQA 3EHKA 2QUOA 1NYWA 4IW3A 1JW6A 4AW7A 3VKNA 2ET1A 1JZ5A 4XXAA 1SHWB 1COV3 4YG0A 3MPBA 4HKLA 2V72A 4QXHA 5FZAA 2K2SA 1ENRA 1XU1A 2WC2A 5AC93 3FBMA 4ZPIA 3ZDSA 2UURA 3IDEA 4NHYA 1RUI1 4RHV2 3VBFC 3Q9OA 4RFT0 4AFBA 3KVAA 2R042 2DF7A 3LPGA 1ZRRA 3U4XA 4ZY9A 2ZGOA 4JGZC 1LOGA 4XF0A 1SFYA 4S2GA 5FZKA 2E7QA 2KR2A 5A1FA 1FOD2 1YFXA 2A71A 1QJX3 2OUJA 2E33A 1GWLA 4K8FA 4XILA 4YRDA 2G9FA 2W08A 4RR3B 3TNPB 3CBNA 4XFAA 1WLWA 4XFCA 5DMYA 5LEJA 3AMQA 1CX4A 3U1XA 4R9AA 1DZTA 4AVAA 5FYTA 3VZMA 1UW8A 4AVBA 3PURA 3I2KA 4QPIB 3Q8EA 4LHKA 5HV4A 4COZA 2WNVC 1RUI2 2VUAA 3N9NA 1WMEA 3B00A 4OI0A 2PFWA 4GALA 5LBBA 3AKSA 2VC9A 3HOBA 3L9JT 3IMNA 1RHI3 1LODA 3EXUA 2BYVE 3PNAA 2R32A 5L9BA 5IAXA 5KHJA 1ND3B 4WM8C 2GNMA 4URTA 4PF5A 2WZPP 4PIZA 5A7QA 2ZGQA 1DZRA 4PQ9A 1X8MA 1UXZA 1O6UA 5FYBA 5A7WB 4ES8A 1VAKA 1HW5A 3I3DA 4JGYA 1POV0 4UW6A 3RZMA 4FPJA 4P5YA 2JD4A 4CU6A 5KBFA 4HXCA 2AENA 3CJIB 5F7UA 2YPDA 2YROA 1S2EA 1RVF3 2J1AA 2B5HA 4SBVA 4A6OA 2OZ6A 3E1F1 3O14A 1RMU1 3ZMNA 2BRTA 3T2TA 5FZGA 4I09A 2VE1A 1OF4A 1RUF1 1QXPA 4LE3A 1ZVFA 1DZQA 4K7JA 4Y4RA 4ISQA 1D4M3 2JDNA 4O9GA 4HANA 5KR7A 2ARAA 4QHOA 2YGMA 4KGGA 4RS5C 3CZJA 3VV1A 1J1LA 4KG8A 1WA4A 1AR81 5IUQA 2BP6A 2JDPA 3LB9A 5DAWA 3RS6A 3WSOA 5ACA2 4IGOA 2P37A 2DWRA 3ZR5A 1BVP1 1X7NA 5IVVA 2FMDA 4BQ1A 2A6WA 2LM3A 3ACLA 1CAWA 3N9OA 2EVXA 4NIDA 3UJQA 4D7TA 5FPLA 2VZPA 2JE8A 3POFA 4Q5OA 4DQAA 1RUF2 4BQWA 3VHNA 3U10A 3U75A 2KXLA 3N9QA 5T3NA 4L0PA 4LBJA 2ZBJA 4L9BA 3B02A 5FKBA 4BQXA 1ACCA 2Q1ZB 3ITQA 4PI2A 5I0UA 3WHTA 5I0DA 4LBMA 4Y22B 1CWPA 1CX1A 2C9AA 2QQUA 5FBZA 1Y9MA 1TE1B 1P8JA 4WZFA 4WM7C 4AOCA 4NWWA 1X82A 1Q8OA 2VU9A 3JB4C 5ANQA 2SBAA 5DDJ1 1RINA 5F3IA 5A7SA 4BLJA 3WDVA 5GJ6A 3NO8A 1O7FA 1ASJ2 5FZ7A 3B9CA 4JV4A 3WG3A 5F9TA 2XHKA 3OD0A 4I0WB 5IFPA 2B4KA 2IFRA 5BY5A 2VZTA 4LR4A 1FOD3 3U78A 1MS0A 2RJKA 2WQZC 2ZJCA 5HCAA 4D7YA 1ZBA2 1UF2C 2YPJA 5J09A 1V6KA 1ZRCA 1FXZA 2Y60A 4FCAA 4QX0A 1CIYA 2JKBA 2DBIA 5L19A 3W20A 4LULA 3POIA 4UT5A 5DXDA 3W58A 1PGL1 4BM8A 1K12A 3K51A 1UZZA 3VBSB 2ZPXA 1NA1C 4TWTA 2BBVA 3VKLA 2DTWA 5DDJ2 3M70A 3N7MA 1Q43A 1GNHA 4NAMA 1EAH3 5CKMA 3RMXA 2GNDA 4DIQA 3O1PA 1F15A 3THCA 3K3OA 1OI6A 1UYZA 3JCIA 4U36A 1ZX5A 5FZOB 1SLIA 2D3PA 1NE4A 1H0BA 1N3OA 1ZZ8A 1LHNA 3IZOA 3BTYA 1FMD1 4KQ7A 2HWC2 4CE8A 3KF3A 3OEBA 4Q0UA 1HJGA 3ELNA 1VBC2 5JR2A 5IVFA 4QQPA 1IOAA 2WS91 4L92A 3GZTB 2QKDA 1ND3A 4AGGA 4OHWA 1S2KA 4KBBA 2Q1FA 1QJY3 1ZM1A 4NIIA 1BHGA 5IK4A 1RUH2 3ZFEC 3LWCA 2FDIA 5FMOS 1JODA 2D7FA 4XURA 2C24A 5D1IA 2E6VA 2QTWB 3C8XA 3KGZA 5FY9A 3E5QA 4NPRA 5A7WA 4JGZA 1H2LA 1PM4A 1RUOA 3LQCA 2BBAA 5FJHA 1QQP2 3OGVA 4COVA 2XR4A 3CJIA 1LESA 2D44A 3MIBA 4NAOA 4EWDA 4FOYA 3MPPG 3ZIWA 3ZN6B 4YZ5A 1WUVA 3BIEA 2VPVA 1PNFA 3AJZA 2X8KA 5KHGA 4XDQA 3CF6E 1QJFA 1VMFA 5CFDC 2RMU1 5FOJB 2CL2A 4IV3C 3ZSMA 5F39A 4V2WA 3ZX7A 2AREA 1S0DA 4UF0B 3TN91 4JQRA 5ACA3 1T6GC 1YJLA 3LA2A 5FYUA 4YW7A 1UMIA 1JTZX 3I2GA 4A7YA 1JBCA 1PM7A 1SDDB 4RGKA 2JB4A 5FP7A 3WOGA 4WM8A 2BWAA 4XVHA 1GQGA 1E5HA 3K77A 3PTYA 4OI2A 4H55A 1UD1A 2DCYA 1KGYA 4Q4V2 4XIOA 4FPYA 2K9ZA 2PTMA 4AFMA 2RMU2 1Q8PA 1RUE2 5AVAA 4XFHA 3RGBA 3BI3A 1IPKA 4RL7A 1TQ5A 5HXVA 5LRSA 2HEVF 1AYN2 1UY1A 2X5IC 3A4UA 5F5CA 4R9BA 3AZXA 3VBRC 2GMMA 5DAPA 4BQ5A 4Y22A 2CTVA 1N3PA 2HWD1 5LBCA 3T0BA 4UXAA 3W59A 3EYPA 2I07B 3NNJA 5F5QA 3WP5A 1VMJA 3GBGA 1DQ5A 1SLTA 5F5IA 2F17A 2VZVA 1BKZA 4QPGB 1ZBA3 3JBG2 4AI9A 4AQSA 4CU8A 1SACA 4J1XA 1IG3A 1ULCA 2EALA 1O3SA 5FWEA 2XL9A 1OQDA 3CKHA 3IIIA 4UW4A 5GLVA 3W9AA 4NRQA 4OI4A 4KWLA 5E8AA 4ZS3A 1ZBE1 1YJKA 5FZMA 5ABJC 1JH5A 4IXLA 3J4UH 2GC1A 2PLV1 4R52A 3X29B 3N9LA 2CGPA 1W6PB 4OHXA 4HVRA 2UYBA 3I2HA 1US2A 3IN9A 3JD73 4EWAA 1VRBA 2YMZA 4FFGA 1AR91 1W8OA 5BNNC 5BNOB 3I2DA 2XGXA 3LCPA 3N7LA 2KD7A 2PYTA 4CDUC 3MF6A 2IXHA 2XXZA 4FPEA 1SPPB 1VBC3 4IGQA 4JX0A 5FUNA 5FZ9A 4CYDA 2JXAA 5ERLA 4AL9A 3BIWE 4FAHA 4WVVA 1O8SA 4WM7A 1CESA 2LW8A 3PJYA 3WCSA 1PO22 3DUIA 1L3JA 3VBUA 1ZBE2 4BMEA 5HCHA 1KRIA 4PIYA 4LK6A 5EXOA 3AL5A 5J3UA 3AFKA 4LA2A 2PLV2 2JX9A 4YM2A 3VDCA 4UOJA 1PZ9A 4LITA 1QQP3 1WW5A 4IE4A 5C4WB 3OCPA 5JLVA 4QM8A 2JDAA 2BFUL 3EMRA 3OBTA 5FR3A 3ZXKA 1DGWA 5FXXA 1GR3A 5FMCA 4NIAA 3VBOC 1NLRA 5A6QA 2A75A 2JG9B 1RUD3 4K3UA 3IM0A 1OLRA 1OLME 2WYFA 3VD4A 2VOVA 1AXYA 4Y1VA 3ZN6A 1GQPA 3FUQA 1C1FA 4JHZA 1X33A 4LOTA 1K5JA 4TYSA 4GXLA 3VN4A 4DXSA 4P9GA 5FYCA 4K8RB 2XG3A 4B4RA 2WLPA 4A7KA 4K1YA 4UF0A 1OA3A 4NHMA 2VMFA 2RDSA 2ZCWA 3ILFA 4K20A 2VMEA 4AXOA 5LEKA 1A34A 3ZXLA 5CKQA 5J96B 3U14A 2EIBA 1NY71 3M3CA 1O4TA 3LEKA 3MIGA 4GWNA 5LA2A 1YQ6A 2XQRA 4ARXA 1RUE3 1Y4WA 4PDWC 4XYXA 4LHNA 3ZPOA 3LZZA 4L97A 2WN3A 1MZ6A 3HBZA 2BNOA 1IQDC 2CNAA 1FX5A 1AYN3 1UOFA 4JKLA 2GMPA 4V2VA 1F9KA 2BNNA 4CDXC 5SV8A 5DUWA 1W2AX 2RS13 4CCKA 3PVBB 2XVLA 2LTNA 1NE6A 3NAPB 2VMCA 1C8M1 2TNFA 3P3PA 4YYOA 4CXXA 5FFOC 3K3NA 5C70A 2J1UA 1XSRA 3ZXFA 4YSFA 2CGNA 1QDOA 4BU2A 4FTBA 4Q8LA 4OFGA 4LNVA 5T50A 3V56A 1DYKA 4AEDB 1MS4A 2VM9A 5CFDA 2VOWA 3PU3A 1O3QA 3J9SA 1O8PA 2HWB1 4XF1A 5F5AA 2QQVA 1V6MA 1PIV1 1RUJ3 4XFIA 2WZ8A 3NNMA 2DVFA 4CCJA 4QPGA 5A70A 2J42A 4AHWA 3LGRA 5FZ1A 1FV3A 1YRZA 2Z42A 3KV9A 5DG2A 4ZU4A 1W8HA 3A21A 4CDQC 1G9FA 4NE9A 2UWCA 1OKQA 1CN1A 2D6LX 4CDWC 3LOIA 4LBOA 2B9UA 2YZ4A 4Q0SA 3SEPA 3PVEA 2RDRA 1XYNA 1QWRA 1O4YA 4Q4Y3 5CZKA 3SH3A 4WZCA 3T2QA 3ZDVA 4AWDA 2RDNA 1NCRB 1S0GA 3MYXA 5BNPB 1O3RA 1R1A1 5A3WA 1ZA4A 4D7SA 2W0XA 2QE3A 4ISRA 1W6PA 5FP9A 1F5FA 2XJRA 1RJ7A 1SLBA 2OIIA 3ILRA 1SBEA 2DFBA 1PIV2 4GJYA 1WD4A 1J84A 3ES1A 5DZFA 5BNOA 4AHZA 2P6CA 2I2SA 1PO23 3D3AA 5FZBA 4IQPA 1SPPA 2VNVA 4BCUA 2WFF1 1UYYA 1J3QA 3DPRC 3PMEA 3SCFA 4XFBA 4AEKA 3FJSA 1SFPA 1UKGA 2P1BA 1UU6A 5FIXA 2WZEA 4GAZA 2OX0A 2PAKA 1AR62 3GDBA 2SLIA 3LEMA 1XE7A 3ZSKA 2J1RA 1F4HA 2R6QA 1F4AA 3ECQA 5FXVA 1NOVA 3TEWA 2BERA 3BTXA 4WBBA 2ZEYA 1TMF3 5C4WA 1VAMA 3ZSEA 3V0BB 4RQPC 5T5OA 1OUSA 2LALA 3C7OA 1MZFA 1HXS2 1XU2A 2WRAA 1IHMA 4LHLA 5C3QA 4CEYC 5JZGC 4Y20B 1ZREA 2JG9A 1F5JA 5DAVA 5EWSA 5EZWA 2MEV3 1W0OA 2DU1A 2GP5A 2BGOA 5TSWA 3RPQA 3T2PA 2VBDA 4MHRA 4Q4W3 3DL3A 3B93A 3F95A 1CGPA 5GZGA 1YFUA 2RS31 2A7AA 2XBO3 1PZ7A 5FYZA 1RL3A 5GKAC 1RIRA 3UV9A 1POV3 1KITA 4XPVA 2WNEA 1OH4A 1SLCA 4YZ2A 4EN6B 4W6YA 2FZ1A 3A23A 2PAEA 2WO2A 4LJHA 1M4WA 5I0RA 1V9U3 3UGGA 1KJLA 1XNKA 3CO2A 3BU7A 3J7NA 4IGPA 3ACHA 2A6YA 4LUKA 4I30A 5FO8B 3L2YA 3O0VA 5EV7A 5EQUA 1QOTA 1RTVA 1X50A 3DF0A 1VP6A 1X9TA 5FMOL 2H6BA 5FJKA 3HD8B 1HB4A 3QH7A 5F3GA 3NW4A 2JICA 5LWBA 3HBKA 1LHOA 2XWBB 4GWJA 1OOPC 1QJZA 1Q8SA 3ZXGA 4AEMA 1W2TA 2BGCA 1PVC1 1W6QB 3GBWA 2LS6A 3ROUA 4RD7A 4XQ4A 2FBEA 3NAPA 5I8TA 4DUVA 3AM2A 5KXEA 2FDJA 5HPOA 2LROA 3VDDB 1R093 4QDRA 1W8ZA 1R1ZA 4XW3A 3NSTA 3EQEA 4QKNA 3T0AA 4QT6A 5BUVA 1FPN3 2EXKA 4QPWA 5T55A 1WW4A 5F32A 1V70A 3D5OA 2FQPA 4MO3M 4XJAA 1CAUB 5I0TA 1GNZA 2WR9A 4ASLA 3AZZA 1ZZBA 2XJSA 4QKBA 4AFAA 1LULA 1VJ2A 4V1PA 4XTMA 4IEXA 5FBJA 1RYYA 4JDNA 5FZCA 2P3KA 4CPBA 1W0NA 1AZDA 2WT2A 3MBWA 2DCKA 2VW0A 3KVBA 1IKPA 1O4ZA 5FZ6A 3BPSA 3AZYA 5FMBA 1AUYA 1NCRA 5BNPA 4Q27A 4MGIE 2WQ4A 4XJUA 5DAQA 2XVGA 3ZKYA 4MGKE 1VBB1 3WINE 5C9AC 2IXIA 4C0BA 2ZGLA 5CFCC 1J3RA 1SCSA 1PMIA 2IC1A 4C1XA 1W05A 3AFGA 5IT6A 4Y33A 2QJVA 3I3BA 3OJBA 4W6WA 5AC91 2YC4A 1Q3EA 4NHXA 4I0BA 4CUAA 4UFIA 1MPXA 5EJZB 4DZGA 1O3TA 1HN1A 4OZOA 2XONA 5FKCA 1I6XA 2E63A 2QZ2A 4Y5SA 4QXKA 1W99A 2Z69A 2ZGSA 4P9JA 1H4HA 2XVKA 3OYWA 4B7EA 5BYNA 2FDFA 4E4HA 3BALA 2BZDA 4LLFA 4MX3A 2WINB 3TB0A 1W8TA 4E27A 1RUNA 2QQJA 3WVJA 3H8RA 1PO12 1RC6A 1VBD2 2D6OX 3WW4A 2AUYA 1MS3A 1OURA 1WMFA 4GJZA 4QGLA 3THDA 3UGFA 4UW3A 3V0BA 5CKNA 1BMV2 3AXDA 2VBBA 2Y0IA 3HQXA 5FP4A 5IK8A 3PIJA 1OPMA 2O0OA 3BTAA 4ZXEA 3M4FA 2OZJA 2WYSA 2W39A 3G6JB 4Y20A 1K42A 1ZZ7A 3VB9A 1SLLA 4HSJA 2BWCA 3I54A 4M0NA 1ND2B 2ZA9A 3AKPA 3A0NA 3HVDA 4YM3A 3UKVA 1ZRIA 1PMJX 3DEMA 3LIGA 1WCUA 4QQLA 5FZEA 1VB4A 3EB7A 2ZGKA 4L2NA 3CMGA 2F4LA 2VL4A 1PGW1 3KS7A 1MZEA 5FY5A 5FDBA 5IATA 5CG8A 4K21A 2JD9A 4S2HA 1W6MA 3NV4A 2R7EB 3BCWA 4H7LA 4O7XA 4CCOA 5C3PA 1SZBA 2J7MA 4I3GA 1UOBA 5FLIA 2Y33A 1RGSA 2VUJA 4M4RA 3BKZA 1DYOA 5FY0A 2WQ8A 1IZ3A 4A7ZA 4KG0A 2PQQA 2D6MA 4R8HA 1B09A 1TME1 2ZGPA 5FYIA 2W1QA 3WG4A 1IS4A 1G7YA 3MW4A 5FCCA 3VZOA 4XETA 4ASKA 4LPLA 2Y0OA 4CEYA 3W5MA 5JI7A 4N43C 1PGW2 1VRH2 1HRV3 1YQ2A 2ZMLA 4AAXA 1YFYA 1RUC1 4LBQB 3AYAA 3DV8A 2OW4A 1EV11 2K0GA 5FP3A 3VDDA 4BWOA 4Q1RA 4HMZA 1RUG3 2UWAA 1W2NA 1N1TA 5J1XA 1HRI3 1RXGA 5DG1A 4KH9A 5FUPA 1F2NA 5D8AC 2W1WA 3ZFFC 4I2OA 5FK8A 1JMUB 5J98B 4ATFA 4FFFA 4UI9L 3IB3A 2WL1A 5DQ0A 1UZ0A 4JZRA 4EV0A 5FPUA 1AJKA 2WZR1 4L99A 1NQDA 3VD9A 1W2UA 2VCCA 4I02A 2NLRA 3HPNA 2D6NA 4NOTA 4ZONA 3W21A 5HCBA 1RUC2 2EIGA 1LR5A 4BK5A 5A3NA 1C57A 1EV12 3N4MA 1QH7A 4UYBA 1Q8VA 5FOBB 1OOPA 3NVCA 3MI8A 3BTZA 1HDKA 3OF1A 1UY2A 4Q8KA 1FNZA 3DN7A 3RYKA 5C33A 3TEZA 5FLHA 3GZEA 4LLOA 4XEZA 3SH5A 4JKKA 4UFLA 4XUNA 1VBA1 1IPJA 1OLQA 3I8TA 2ZKLA 2ZX0A 3M1HA 3RQ0A 5L7OC 4XJ8A 3KT7A 4ONUA 2E26A 2ZX1A 2ENRA 3I59B 3H1YA 5JR7B 1AL21 2J1TA 3V64A 2BUKA 3EJKA 5C8CC 4BIFA 4UAPA 2E31A 2ZEZA 4GWMA 1NAEA 4BXSV 2R071 3QACA 2QVSB 4CCNA 2JDUA 3UNPA 2PXJA 1UOGA 3IKWA 4LE4A 1PO13 4YGEA 5FPZA 4B1LA 1CJDA 2WABA 1KS4A 4GB33 3T30A 3LIHA 1FATA 2WN2A 2OA2A 3RNSA 1KJRA 3APBA 1EPZA 4XUOA 2DUOA 2I74A 4IEUA 5IVYA 1LB2A 1J83A 2IVJA 2TEPA 5F2SA 1VBA2 1W8FA 5JXJA 2O8QA 4XIKA 4CSWA 1OC1A 5EYYA 2GP3A 3KCCA 1VALA 1AL22 4GH4C 1BCXA 3ZPYA 2EICA 4K1ZA 3ZXJA 4ZU5A 1UYXA 5GLZA 4C91A 1M06G 4NN0A 4XBLA 3JXSA 3POJA 3J8F3 1W3XA 1ZZ9A 2R072 2E7AA 1ND2A 5JXHA 2XKPA 4G3YC 4YVWC 5CFCA 1GZCA 1SBFA 2EXIA 5FZIA 5C5TA 1UZVA 3VBFB 3AMNA 3T3YA 1AX1A 1W90A 1Z78A 4P9XA 1SBDA 5I8YA 1S0BA 2G19A 4AQ2A 4JGZB 3FFZA 3T08A 5ISLA 4OCTA 1ULFA 4JHTA 3K75B 4H2AA 4CUCA 5FY8A 3O1VA 4PI0A 5FYHA 2OQ6A 2JEMA 5E88A 3ES4A 2WNOA 3NV3A 2RS53 1GUIA 2GN3A 2A70A 2HYKA 3HQRA 5FY4A 5IVJA 3ZFGC 3LF7A 4OHVA 1BEV3 3HNYM 3WG2A 5KHKA 4AVTA 1AR73 1VRH3 2PHFA 2FZ2A 2WNVB 1UL9A 3E97A 4JRLA 4YG3A 5G05L 5IVBA 5DUUA 1Z0HA 5CB7A 3T09A 3WW1A 2RVAA 3LEGA 3K4ZA 3H3LA 4N7IA 3UESA 1NG0A 4LBQA 4P02B 4WM8B 3N35A 3ILNA 4NMIA 2W87A 5C5UA 2UY8A 4HT1T 4XACA 2CAVA 1VLNA 2VO5A 2YBKA 3ZIXA 3JZVA 3CQOA 3H3ZA 4MOAA 3W5NA 4CZSA 1QJEA 4HN1A 1RMU2 3O12A 2B9VA 1MQTC 3O1UA 1GFF2 1XE0A 3NJYA 1GZWA 3ZMOA 5A1AA 4Z92B 3O1RA 4QHZA 1KEXA 4M4PA 4FFHA 4XE9A 3AYDA 3SITA 3WX5A 3ZFEB 5IJRA 1AR82 4CRQA 4P14A 1CVNA 2V09A 4XMIA 4QHBA 4MV2A 3QOPA 2ADDA 3TEXA 1N1YA 3LEIA 1ENSA 1V0AA 3J26N 3KSCA 1CPNA 4RHV3 3T1MA 1E5SA 2R043 3S57A 1BK0A 1JZ8A 4BOWA 1W9FA 5B4XA 4RS5B 4XDOA 3MLLA 1V6JA 2A5ZA 4N43A 4PBPA 2GNTA 2GU9A 4AI0A 3A22A 4XBQA 3I59A 2OVUA 1NXMA 2FDHA 1C5IA 1LOBA 2ARXA 2PHUA 1AYM1 4ZZ5A 4FPKA 4AEJA 3SISA 2EAAA 4XXPA 4BQ4A 2Q1MA 2X53S 2P17A 4CXWA 5APAA 4FPLA 1R081 1GBGA 5D8AA 2W1SA 2I45A 3SXWA 2XJVA 3ZFFA 1E5IA 2C0ZA 3FHQA 3WNOA 1RUI3 1U5XA 1YNAA 5A6YA 3WUCA 1H8TC 2Y6FA 3A0KA 1QXJA 3NWKA 5LY2A 2UY9A 5IFTA 3JD71 5KC5A 3RI9A 3VUOA 1W03A 2ZHLA 3TNQA 3ZM8A 3OSDA 4WM7B 5E89A 3KGLA 4YWAA 3VBUB 1AYM2 3HN1A 3LSEA 2XLFA 3I97A 4P9IA 4CP2A 1QH6A 4C1WA 1PGL2 1R082 1XNDA 2A3YA 4CVUA 1HB1A 3LFMA 3VBFA 4C8DA 4YM0A 4GULA 2JDHA 1U0AA 2EIDA 3BUCA 2ET7A 3UL2A 1FNYA 2UYAA 3OGGA 4EWEA 5C8CA 4O61A 4A44A 4LA3A 1V6LA 3RZZA 1JS9A 2CAUA 2GC3A 1G6NA 1UKRA 5K0UC 4H14A 1BZWA 2R0FA 3ZR6A 1XNBA 1FMD2 4CA9A 4DRVA 1NA1B 2ORXA 3WG1A 3C3VA 3LPFA 4ZKTB 1ENXA 2VUDA 2WSUA 4CEWC 4IE0A 3ACIA 1KQRA 2Z2SB 2WS92 3H42B 3KLSA 4AHXA 2YV8A 5F3CA 2WNVA 4DEQA 4R4ZA 2YY1A 1B35C 3PU8A 5EJ3A 2VZQA 1BYHA 2QQLA 3DGTA 4Q1PA 4FXKB 1LRHA 2VG9A 2ZGUA 3OD4A 4O9EA 1HQNA 5GZEA 4AGRA 3IPVA 3Q8CA 4D6SA 1RMU3 1OD3A 3P5BA 4HZFA 4N90A 3I3EA 4QAWA 1V00A 1GOHA 1RUF3 2BOIA 2VY0A 2YGLA 2GH2A 3B5LB 3FMGA 3HNMA 3MW3A 4XJ9A 3O0WA 5FP8A 3WF0A 5HI0A 3H7JA 1UO9A 4QWNA 2VMGA 3OUIA 3VZLA 4D3WA 3NL1A 3KCYA 1E57A 4M3CB 3ZYPA 1AR83 1FYUA 1GP6A 4LIVA 4DNYA 4FPOB 4N53C 3TN92 2ZX3A 1WBFA 5A3LA 4LKDA 4Y1XA 4NHKA 3GF6A 3O1MA 2YBPA 1H4GA 2B45X 3H50A 1V6OA 1ASJ3 3S0MA 5F8PA 5CFDB 3FWEA 5C6CA 1NX9A 4IV3B 4YZ1A 5C3OA 3WF4A 4FQZA 3AP4A 1OMIA 4FOVA 2RM21 4GKXA 4CUBA 4DXRA 3WNMA 4RS5A 4Y4YA 5BV6A 3GZAA 2G9GA 3IAQA 3PHMA 1RUJ1 2A1XA 4GKYA 4YFWA 2R061 1TNFA 4LXLA 5LB6A 1W06A 2Q30A 1PHMA 1W9TA 4XHBA 4JAAA 4N9IA 3ZYHA 1Y9QA 2VGDA 1SQ4A 2W46A 5DDJ3 2XOMA 1CONA 4XFFA 4IDZA 2HWD2 3H8XA 3M3EA 4Q4Y1 1XJAA 3PUHA 2BV4A 5KHIA 3S5AA 4AVVA 1HV1A 3ETPA 2RM22 1DHKB 2HWF1 4LKSA 3C2UA 1KS5A 1V6IA 2X5IB 4GA9A 4QDSA 4YW5A 2HWC3 5FYSA 4FTSA 1A78A 5T54A 4GIQA 5JWPA 2A3XA 3VBRB 2YFZA 2J1VA 1D0GA 3P3NA 1W6NB 4GMP1 3NJXA 5F6LB 5JI9A 3JB8A 1H2NA 2QQIA 4BYYA 4D8MA 3E6CC 2Q4SA 4Q4X1 4BK4A 2ORZA 3I3QA 1JOBA 1RUH3 4RFRB 4BJ0A 1MS5A 4OYUA 5DN2A 5FO7B 2DVAA 1W9WA 3JU9A 2O1QA 4HSLA 3AVRA 3RJ2X 4MGQA 4YVSC 4QB6A 5JPNB 1HX6A 4MXWB 1DBNA 3K4AA 4UBGA 1S2BA 3ZKUA 5CG9A 1AR92 1JZ3A 1VMHA 3AJYA 4YW6A 2HWF2 2VNOA 1FMD3 4XF3A 5FYYA 2PELA 5ABJB 1MZ5A 4BISA 4RYDA 4AG4A 3ZYJB 3MFCA 3VHOA 1WLCA 5IW0A 4AI3A 2QQWA 2RR11 2WS93 4B29A 2DCTA 2K46A 4IV1C 3NV2A 5JDBA 2W68A 2WLQA 1NA1A 3I4IA 1KDKA 4EJRA 5BNNB 1W0PA 2Y6KA 5FZLA 3RSJA 1H8TA 2R16A 1GNYA 1LOFC 2WWUA 3GBFA 4CDUB 4OQ8A 1DQ6A 2PMWB 2DUQA 1BBT1 3BODA 3CU7A 2H0BA 3KHBA 1I3HA 3POYA 1XPWA 2YU1A 4QM9A 5A7PA 5H9SA 3LOBA 1OSGA 1URXA 4HKWA 4Y26A 3WF1A 5KXDA 2VTXJ 4C0HA 2DFCA 5LW9A 4Z1VA 5FZ3A 3ON7A 5DAXA 4O65A 1UY3A 4Q4V3 2C4XA 4B4QA 1T2XA 3GHNA 3KV6A 3NV1A 4C90A 1V9U1 4KWUA 1XOYA 3T4HB 2RMU3 4PBOA 1DFQA 1EYBA 2FCUA 4K9SA 1AL0G 4UFKA 3VD3A 3WDUA 2GAUA 3ZFEA 4MXVA 4BXFA 3UGHA 3TN93 4ITCA 4CU9A 2GNBA 3D6EA 1JUIA 1PX3A 2D43A 4BIOA 5D21A 4KL1A 5FZ4A 2YXSA 3HMYA 4M3CA 3VBOB 4A45A 1BBT2 2VZUA 1L7RA 4NPMA 1NZCA 5FPVA 3LA7A 4DB5A 1XXNA 2NN8A 4YPJA 4IE6A 4QX3A 3K48A 4LO7A 4XCAA 1IKQA 2ZAAA 4MGYE 4P08A 2Q8OA 4ARYA 2HKXA 5HXMA 1J3PA 4CEWA 1LCLA 1MEC1 2JG8C 3JBG3 1NY72 3JQWA 3MV11 1OPOA 4IV3A 3R6SA 3GCWA 2HWE1 3CEWA 2W5FA 1GYKA 4NROA 1B35A 3WP3A 1LOCA 4I01A 1EUTA 1HJFA 1XNCA 2JE9A 4CCEA 1N1SA 1ZNPA 3HT2A 2ZHMA 3SCGA 1C8M2 1TNRA 3UKTA 4PDWB 2ZABA 2LUWA 2XLGA 3B01A 1XSQA 1GLHA 3D0SA 3D8CA 3WV6A 1U5YA 4BA6A 1NKGA 1MEC2 2BVBA 4CDXB 3FL7A 2WA3A 2WO7A 2HWB2 4TSVA 2A3WA 3BB6A 1JYTA 2NMNA 4FI9A 4S2FA 3WR0A 5IVEA 3HNBM 4HK8A 3PVOA 4IEPA 4META 1WD3A 2X5IA 4EE2A 3TWIA 1ZBE3 3VBRA 1GOFA 4PIXA 1H30A 1GANA 2W94A 1STMA 1W6NA 2BGPA 2QDRA 4NPLA 4N9HA 2PLV3 1Y7BA 4M01A 1S0IA 2W92A 4AGVA 5FYVA 1AXZA 5LK7B 2PN5A 4KU8A 4CXYA 5FYMA 1VBE1 3OYWB 3RMYA 4K40A 2NZ9A 5DZGA 2VR4A 2UWBA 1R1A2 1CD3G 1KDMA 5AFBA 2W1UA 4CDQB 1OBNA 2OKXA 1ZYBA 3I2IA 3H3UA 5M0TA 3U0ZA 3D4KA 2HLEA 4MXWA 4QKFA 3GJBA 3VLBB 2B39A 2ZMNA 1DIWA 4YZ4A 4CDWB 4W65A 1SG3A 3AMHA 1QOSA 5B4NA 1QJU1 4WVMB 1JYIA 2JDZA 5ABJA 2WWJA 1MS9A 2VVDA 1DF0A 2WFF2 1K5MC 2DUPA 1VAVA 3E5UA 2JE7A 4ZU7A 1DGLA 1UQXA 4OHYA 1CZVA 5BNNA 3ZLIA 3DCQA 1VBE2 2PHXA 4QX5A 4CDUA 1Q56A 3VZKA 1XYOA 2ZHNA 3DPRB 3ENRA 3KMHA 3WP4A 2KA3A 4HN0A 1W6MB 4D69A 2XUEA 5A32B 1QF3A 2VULA 5CNAA 3KQRA 1LHUA 4BHPA 5KC6A 1PK6C 1NCQC 3OGSA 4G9SB 2A73B 1DGRA 2OPWA 2QQPA 3POWA 3C7EA 1D2SA 3WUDA 1YI7A 3Q8FA 3BGAA 5LA1A 2WO1A 5BNQA 4RQPB 2DVDA 2RS32 2YDEA 4AAPA 5JMOA 3MUZ1 2P6HA 4DUWA 1Z7S1 3AMPA 3B9IA 3CJXA 2YU2A 1G8WA 3VBOA 4CEYB 5JAXA 5JZGB 4FSJA 4OVEA 1GICA 3GHMA 3WCRA 1J59A 3UT0A 1DQ2A 2HEYF 2EAKA 4Q0VA 4XZPA 3DECA 2C9KA 4XDPA 1Q5OA 4KWJA 4WV8A 4Q0PA 1O5UA 1HRV1 2FMYA 2R49A 3GM8A 4Z2AA 3ZSJA 4DMIA 5GLWA 2JKXA 3KB5A 3DXTA 1QY4A 3KV4A 5J48A 2XDVA 3SKVA 3AVSA 4HOOA 2TBVA 4ES9A 3OPZA 1LHWA 1OFNA 1RUG1 1C8M3 3M3QA 4NHLA 4DEVA 1JYXA 1PVC2 1Z7S2 1IQAA 4AFCA 4XUPA 4A3XA 3WD5A 3MIFA 1ZRFA 4PDWA 2HWB3 2ZGNA 3E6BA 4LHSA 3O1SA 1R64A 1VPHA 3IDCB 1PIV3 3AP6A 1OOPB 2ZGRA 2B7YA 5J37A 1T6BX 4CDXA 1ZZ6A 1ULPA 1ODNA 3RZGA 1MS1A 1A3KA 4IE5A 2AR6A 2VECA 2VTFA 4OUSA 1COV1 5CADA 1NLQA 1O59A 5IYYA 3GNEA 1LU1A 1I9RA 1AX2A 1PVXA 1W04A 4XAAA 3T4VA 1W8UA 5C3SA 1TVGA 5FWJA 2Z4FA 1XBFA 3ZYGA 4FTEA 5FPBA 2EF6A 1LTEA 1AR63 1LAJA 3OBRA 2JG8A 4PLNA 1PNGA 4XZUG 4I0AA 4QXBA 3VKOA 1R1A3 2J1EA 2MPFA 3U4SA 3WQ7A 3VDBA 5JSRA 4NIGA 4P9YA 1ENQA 2G1MA 3KZ4C 2XJPA 2WIIB 4UW5A 2CU5A 4XHXA 5FZ8A 5J7MA 1Y3TA 1QJX1 4PHZA 3QCWA 2NPIA 1WLDA 4IEVA 3RFRA 4XF4A 1HXS3 1GWKA 1VBB2 2VNRA 3FZ3A 4AE2A 4BLIA 2Q0AA 4CDQA 1A6CA 4FPHA 4LUMA 3G7DA 1DQ4A 4CDWA 5CBLA 4OULA 4QXCA 1S0EA 1XNAA 3NRUA 4WVMA 1BXHA 1UAIA 2O14A 4QB2A 4Y1UA 5AC92 5HV0A 2G9ZA 2FCTA 2VQAA 4JGYC 4QX8A 2ERFA 3H8OA 4LO6B 4CP0A 5C9AB 5KXCA 2FDKA 5CFCB 5FV3A 4HFSA 1JYCA 1HB2A 3UKNA 4DXZA 1YO8A 3BPZA 1RHI1 3WHUA 2WAOA 3FLPA 1QHDA 2XJTA 1XB9A 1JHJA 3FC0A 3POEA 5K4LA 3DPRA 4MGZE 3VBHC 2MHFA 5H9PA 3H9AA 4BPZA 5A32A 1QMJA 5T5PA 2ETEA 3FLRA 4I3PA 4QB1A 3RJRA 4XJWA 3Q8AA 1JN2P 2DCJA 1LJ7A 3MDPA 4AVCA 3HJRA 4QGMA 5H9RA 3H1WA 1C3HA 1A8MA 1RVF1 2BVVA 1UMHA 2Y38A 3VZNA 4BQ2A 5F3EA 3B3QE
chains in the Genus database with same CATH topology
5D21A 3F95A 2KR2A 4BQ3A 3ZYHA 4LK6A 3ZYFA 4CPBA 1WCUA 1GWLA 4BQ4A 4LKDA 2Q1FA 1L7LA 1HN0A 1OKOA 4CP9B 1WMXA 1W90A 1GWMA 4YW7A 4BQ5A 3UT0A 4CP9A 2LROA 1W8TA 2C24A 4LJHA 1W8ZA 4LKFA 1OH3A 2LRPA 1GWKA 4YW6A 1V0AA 1W8WA 3ORJA 1W9FA 2WYFA 2O14A 3ZYBA 4LK7A 1W8UA 4AL9A 4CPBD 2K46A 2JWPA 2VXJA 1UOJA 4BQ2A 4LKEA 4YWAA 1WZXA 4A6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D21 A;  3F95 A;  2KR2 A;  4BQ3 A;  3ZYH A;  4LK6 A;  3ZYF A;  4CPB A;  1WCU A;  1GWL A;  4BQ4 A;  4LKD A;  2Q1F A;  1L7L A;  1HN0 A;  1OKO A;  4CP9 B;  1WMX A;  1W90 A;  1GWM A;  4YW7 A;  4BQ5 A;  3UT0 A;  4CP9 A;  2LRO A;  1W8T A;  2C24 A;  4LJH A;  1W8Z A;  4LKF A;  1OH3 A;  2LRP A;  1GWK A;  4YW6 A;  1V0A A;  1W8W A;  3ORJ A;  1W9F A;  2WYF A;  2O14 A;  3ZYB A;  4LK7 A;  1W8U A;  4AL9 A;  4CPB D;  2K46 A;  2JWP A;  2VXJ A;  1UOJ A;  4BQ2 A;  4LKE A;  4YWA A;  1WZX A;  4A6S A; 
#chains in the Genus database with same CATH topology
 4AFD A;  5A3M A;  1Y9G A;  4RQP A;  2RDQ A;  1TG7 A;  3SNM A;  2W91 A;  4QU1 A;  3LSD A;  1QDC A;  3OPT A;  2VUC A;  4QU2 A;  3AC0 A;  5JZG A;  1G9A A;  1LU2 A;  1RXF A;  3FX3 A;  3FN9 A;  3ATG A;  3BVC A;  4ZZ8 A;  1D4M 1;  3MIC A;  2D5H A;  1QXR A;  2WNU C;  3AKT A;  1S0C A;  4JKM A;  5EFU A;  3T1L A;  3WQ1 A;  4Z2W A;  4FOW A;  3NKG A;  4JCK A;  2NP0 A;  5A6X A;  2X10 A;  5JUV A;  5BPX A;  3KT1 A;  3S5Q A;  1UZY A;  1G9B A;  1DCS A;  1ULO A;  1RVF 2;  2D97 A;  5FK7 A;  3M3O A;  3RWK X;  3IMM A;  1UOJ A;  1GZW B;  1TME 2;  1LEC A;  3NKT A;  4LOR A;  1REE A;  4Q26 A;  4X6Q B;  2WWS A;  4NIH A;  5GAL A;  1JHN A;  1FV2 A;  1PK6 A;  1CZS A;  2Y34 A;  2TUN A;  4MZU A;  5CVR A;  4YM1 A;  2CDO A;  2D98 A;  2Y6H A;  3HT1 A;  3MIE A;  4HL0 A;  3WNL A;  1MS8 A;  4QX7 A;  1D4M 2;  1GZ9 A;  3URF A;  2FCV A;  4XOG A;  4E4Z A;  2HJI A;  1AHS A;  3CZU A;  3I7D A;  2CGO A;  1WCD J;  3RYR A;  2DDU A;  5I8S A;  1UNB A;  4ZHN A;  3RZK A;  1SEF A;  1YCI A;  2ARB A;  3FFQ A;  5FRE A;  1W6O B;  5DPN A;  3CNA A;  2C5D A;  4N43 B;  5FZF A;  5JSO A;  1NUK A;  1RJ8 A;  4RR3 C;  1D0H A;  2BW8 A;  2JWP A;  3FLT A;  4QQ2 A;  2X09 A;  3FBY A;  3WDY A;  1C5H A;  2DBN A;  4JQT A;  1ONA A;  4A42 A;  1YUD A;  1CPM A;  1XRU A;  2WZR 2;  1F35 A;  3AK0 A;  5A7N A;  1APN A;  4QPI C;  1FOD 1;  5D2A A;  3VL8 A;  1YQ5 A;  2W9X A;  1XC6 A;  2PA7 A;  3ZOI A;  1VBB 3;  5JSP A;  1NT0 A;  3UYJ A;  5D8A B;  3VDA A;  3ZFF B;  1VBD 3;  5FMD A;  4AQ6 A;  4EQV A;  2YUE A;  1OF3 A;  3C7H A;  4P9W A;  4EN7 B;  2GAL A;  4IES A;  2AEY A;  1ND3 C;  5EP9 A;  4A3Z A;  1XQN A;  4UFJ A;  1W9Y A;  2OPK A;  2YYO A;  4IEW A;  2V4A A;  4JRA A;  4XJZ A;  1EAH 1;  2QQO A;  4GMP 0;  5C71 A;  4E2G A;  4QGN A;  1G9D A;  1H9W A;  2PHW A;  2NM1 A;  2BFU S;  2Y8K A;  3WDT A;  4AYU A;  2RG4 A;  3HAG A;  2WT0 A;  5ANN A;  1JZ7 A;  4IUG A;  2WUH A;  5LK5 A;  1AX0 A;  2RE9 A;  2VCB A;  3CJI C;  4LO5 B;  4X8P A;  5A6Z A;  1ST8 A;  5C9A A;  1KFX L;  5L7O B;  2ARC A;  1ULD A;  2ZZJ A;  2QZ3 A;  3V65 A;  2HBT A;  3ZO0 B;  3RWN A;  2B8M A;  2WO3 A;  4AI8 A;  4CCL A;  3I2F A;  4H7M A;  3OBZ A;  4HPK B;  1NXD 1;  3U37 A;  5C8C B;  4FPC A;  1QJY 1;  3O5S A;  2VXR A;  1OT5 A;  3ZSL A;  4ORF A;  5EIY B;  4Q2F A;  4R4X A;  4YZ3 A;  4D94 A;  1EAH 2;  1JZ2 A;  3AB0 A;  4LOS A;  1UCX A;  1YWK A;  4XC9 A;  1AXK A;  1OXC A;  2RJ2 A;  4Y5T A;  5LBE A;  4MUV A;  1DQ1 A;  2V4V A;  4E9K A;  2X29 A;  2OUH A;  1ZRD A;  1LNS A;  1XNT A;  4TXW A;  1JOP A;  4DIN B;  4CU7 A;  4BQ3 A;  3WW2 A;  3MO4 A;  1ULG A;  1UYP A;  2P3Y A;  1W9S A;  2H0V A;  2JJ6 A;  2VD7 A;  1I1E A;  1EP0 A;  4GH4 B;  4MHU A;  5DUV A;  1GZT A;  1WMX A;  1QEX A;  1JXN A;  4LTA A;  4RGG A;  4QQO A;  2Q8C A;  4LBN A;  1QJY 2;  1SDW A;  4TN7 A;  5A33 B;  1G86 A;  2VZO A;  3OY8 B;  5ACA 1;  2FDG A;  4E2S A;  1WWY A;  3NJV A;  3IPV B;  4CUG A;  4YVW B;  3U11 A;  4M0H A;  2EXH A;  3SC7 X;  2VMI A;  1WA6 X;  4ERO A;  2XWJ B;  1OLM A;  2ZZQ A;  1TME 3;  3BOP A;  1GP4 A;  2IXL A;  3ZYB A;  3O1O A;  1LED A;  2VXJ A;  5L9V A;  4Q0Q A;  3GXU A;  4ZXK A;  3I3M A;  2ZX4 A;  3VBH A;  4Y1Z A;  2V5Y A;  3KD4 A;  3WNN A;  2XML A;  5CEH A;  4BH9 A;  2IWG B;  4F83 A;  1SMV A;  2P34 A;  5JOW A;  5BXX A;  4TTG A;  1RUC 3;  3INA A;  1H1M A;  5HCF A;  4EN9 B;  1EV1 3;  3S7I A;  2VVE A;  3QD6 A;  3VHR A;  2R1D A;  4AZZ A;  4W4Z A;  3RZJ A;  2RHP A;  3ZFG B;  3LDK A;  2CWM A;  4HKO A;  3B69 A;  3LE0 A;  1HLC A;  1JU4 A;  2GN7 A;  3WY6 A;  5IVC A;  3SHR A;  3GGL A;  1C8N A;  1WCQ A;  2XUM A;  3PDQ A;  4OMD A;  5JOX A;  3LAG A;  2P3I A;  1WBL A;  1ASJ 1;  3OUH A;  3TAY A;  4YW1 A;  1W6O A;  2BJS A;  1H2K A;  3AYC A;  2WZR 3;  4D6Q A;  1DU3 D;  3KM5 A;  4PCR A;  2JEN A;  3PTR B;  4FPG A;  3VBS C;  3OG2 A;  1XE8 A;  4X8N A;  4B3N A;  4OUM A;  2ADE A;  2XQX A;  2B42 B;  4AR2 A;  1ZA7 A;  1ZBA 1;  4BMB A;  2H6C A;  2WNU A;  2G4I A;  3RZL A;  1KFU L;  2DYC A;  2BNM A;  4LO8 A;  3RDI A;  3SCH A;  4AHY A;  1JI6 A;  1L7L A;  2R30 A;  4MH0 E;  3BYW A;  3AMM A;  1IGO A;  4QD2 A;  3AP9 A;  1MQT B;  1VBA 3;  2ZXQ A;  4J25 A;  3VBU C;  4URA A;  3M7A A;  2QQN A;  5T52 A;  1QGL A;  5JOY A;  1AL2 3;  1W28 A;  2D3R A;  4IND A;  1JU3 A;  4MYE A;  2VAU A;  2V5D A;  4Z82 A;  3HIF A;  3CIH A;  3SH4 A;  2R07 3;  1S55 A;  1BVV A;  5I0S A;  3ABZ A;  2HWC 1;  3AYE A;  3UJO A;  3V0A B;  5J36 A;  1HV0 A;  3GJA A;  3PUI A;  1X9P A;  5IK5 A;  1VBC 1;  2ZGM A;  5IAV A;  3J7L A;  3OUJ A;  2ZTN A;  4KU7 A;  2PQS A;  4AI2 A;  4WVW A;  5L7O A;  5C7G A;  2AGS A;  1RUH 1;  3KWV A;  3OGJ A;  4RR3 A;  3OBA A;  2HEW F;  4A4A A;  4OMC A;  1YHF A;  3DKW A;  2Y26 A;  4GQ7 A;  3WEZ A;  4B4P A;  4E4D X;  1YQ8 A;  4HPK A;  4F3J A;  1W8W A;  2Y6L A;  2YG0 A;  3JD7 2;  4QPI A;  4E4S A;  1GV9 A;  1QQP 1;  5IHR A;  4AF9 A;  5FZD A;  1REF A;  4NJ4 A;  4AVS A;  2VMH A;  4YLZ A;  5AVP A;  4GZ9 A;  2HH9 A;  2AH2 A;  5EYX A;  5FPA A;  3TBD A;  1KD7 A;  4YAR A;  5CIS A;  4ET7 A;  2ZGT A;  1WZX A;  2VQU A;  2Q8D A;  1H8T B;  1RUD 1;  3MID A;  3N9M A;  5I91 A;  3MHZ A;  3OB8 A;  5T5J A;  3K4D A;  3NJZ A;  4LO4 B;  3IWZ A;  1UXX X;  2A6V A;  1YFW A;  1POQ A;  1HN0 A;  2VZ1 A;  3LD8 A;  2EA7 A;  4UFM A;  4DPN A;  2AEZ A;  1CR7 A;  1E5R A;  3M2M A;  4GH4 A;  4RA0 A;  4IEZ A;  3SKJ E;  1BQP A;  1Q8Q A;  2ZOE B;  3IIA A;  1YEW A;  1WW6 A;  5A33 A;  3MZH A;  4F8A A;  5FO9 B;  2BDR A;  3OY8 A;  4MVT A;  1OUX A;  3NNL A;  1UY0 A;  3PUS A;  4YVW A;  2HBU A;  4FO9 A;  4LBL A;  2RV9 A;  3JQX A;  4AI1 A;  1GMM A;  3KHC A;  2GDF A;  1UPS A;  2GME A;  3PJQ A;  1D7P M;  4LK7 A;  5L73 A;  5L9R A;  4Q4V 1;  3WQ0 A;  1RUD 2;  3WZ1 A;  4LKE A;  1NZI A;  2IUW A;  3AKQ A;  1RUE 1;  2WBK A;  4COW A;  5K9Y A;  3MGU A;  1VB2 A;  2ZS6 B;  4GD4 A;  1XYP A;  4DRR A;  3WDW A;  5E16 A;  3WW3 A;  5K0U B;  2IXC A;  4X6R B;  1AYN 1;  4NRM A;  4QPG C;  4M3C F;  4CP9 B;  3E5X A;  4Q29 A;  2RS1 1;  4QX2 A;  1AVB A;  1UZW A;  3ZFG A;  3ZXA C;  2CYF A;  4CEW B;  3SEE A;  5C3R A;  2VTX A;  3HEI A;  5GLU A;  4TLG A;  1OQ1 A;  3DYM A;  1WMD A;  3FHA A;  3ZXE A;  1IS3 A;  1QNY A;  4MG2 A;  1UU4 A;  4OUE A;  1B35 B;  4Y24 A;  3JBG 1;  2JDY A;  4YW3 A;  2YBS A;  1H6Y A;  5CIR A;  3I2O A;  5FTT C;  2VVF A;  1FAY A;  1IPS A;  3JUU A;  2O8O A;  4IER A;  3ZYR A;  3EBR A;  3SLI A;  1HQW A;  3PMS A;  5BNO C;  3OTF A;  5H9Q A;  1QNW A;  4B7K A;  3A7Q A;  5AFE A;  4P00 B;  5HBA A;  4XQW A;  2WKK A;  2GZW A;  2RS1 2;  5EHD A;  3TYJ A;  3ZYI B;  1V6N A;  2AYH A;  2D6P A;  3GYD A;  4LMF A;  2W2I A;  4XAE A;  4CP1 A;  2B46 X;  2V73 A;  3J7M A;  5C8W A;  1OD5 A;  2A6X A;  1MQT A;  5FUI A;  5JCT A;  1ALY A;  1YXW A;  2AC1 A;  1S4C A;  3O0X A;  4LEJ A;  1OVP A;  4N53 B;  3GAL A;  2BTV C;  1W8N A;  5FQ0 B;  1AYM 3;  1C28 A;  3UK9 A;  1RUJ 2;  3WNK A;  3CHX A;  4DO0 A;  1I5Z A;  2R06 2;  3R4D B;  5C4W C;  4KGQ A;  4LBK A;  4Z8B A;  1H8V A;  1R08 3;  1PO2 1;  3OEA A;  3V0A A;  4MGT A;  2QDN A;  1CIW A;  2Q5T A;  2C6S A;  2JIG A;  1DLC A;  1VR3 A;  2JG9 C;  4QPY A;  1CAV B;  2ZHK A;  5A3U A;  1UWW A;  4FXG B;  1GWM A;  3QBQ A;  4Q4Y 2;  2JEC A;  2KM2 A;  2WSV A;  4FP3 A;  3VBS A;  1PGS A;  5LCW L;  4XMA A;  3F2Z A;  3S30 A;  2IVI B;  2CSG A;  2W3J A;  1U12 A;  2ZEX A;  5JPM B;  1CQ9 A;  5FZO A;  1LOA A;  1TMF 1;  1UN1 A;  2VQ0 A;  3MFA A;  1UX6 A;  4J1W A;  3TEY A;  2FHR A;  2UU8 A;  3POB A;  5K8S A;  2J22 A;  2QQK A;  2PHR A;  4Q4X 2;  3USU B;  2N7G A;  2VOK A;  3VKF C;  1FT9 A;  4CCD A;  4KWK A;  2MEV 1;  4S2D A;  1OVS A;  3ETQ A;  4M00 A;  4Q4W 1;  3T2O A;  1IG0 A;  4OZX A;  5JIU A;  5LZ6 A;  1SLA A;  2D5F A;  1BK1 A;  1MAC A;  3AX4 A;  2XBO 1;  4HET A;  1YQC A;  4QMA A;  1LGN A;  1WGP A;  1ZZC A;  1POV 1;  1RIT A;  4YGD A;  3L2H A;  1DLL A;  5FY1 A;  2ZMK A;  3RRD A;  1GSL A;  1QIQ A;  2DUR A;  3U07 A;  1PMH X;  3HN3 A;  4DXT A;  1TMF 2;  3NAP C;  4MLO A;  3TRS B;  1MR5 A;  1QU0 A;  2WAA A;  3D0J A;  2RR1 2;  3ASI A;  4YVS B;  4CCM A;  1RB8 G;  1A8D A;  4B8E A;  1EUU A;  5LRR A;  4BB3 A;  5G04 L;  1OA4 A;  3MF9 A;  4CCC A;  1CAX B;  5IWF A;  2VBP A;  3USS A;  3H8U A;  4XAB A;  4AED C;  5JXI A;  1UPI A;  2MEV 2;  2VW2 A;  4NR1 A;  3HWJ A;  4Q4W 2;  3IDB B;  4KI5 M;  3O7O A;  3VHP A;  5K0U A;  1EPW A;  4MSV A;  4L8Q A;  2XBO 2;  5K7P A;  4N7U A;  4XBN A;  4IV1 B;  4CP9 A;  4KNC A;  4ZS2 A;  4ASM B;  2QBX A;  3UET A;  3AL6 A;  3MLJ A;  1I5P A;  2LRP A;  4HON A;  4W6X A;  5CAZ A;  3ACF A;  4XTP A;  4YG6 A;  4JDM A;  1YYN A;  3CLP A;  4FPF A;  4NVP A;  2GH8 A;  1V9U 2;  1R09 1;  2E7T A;  1OA2 A;  3AZV A;  3R4U A;  2Y64 A;  4OHZ A;  2DVG A;  1H1A A;  2XLA A;  1NCR C;  5BNP C;  1N1V A;  1FPN 1;  2GC0 A;  1U5I A;  1WW7 A;  4B1M A;  1LOE A;  5DZE A;  4JTO A;  1YC6 1;  3GCX A;  4UFH A;  1H6X A;  1GKB A;  1SCR A;  3SMH A;  3KV5 A;  3THT A;  2HWD 3;  1QOO A;  2Z79 A;  4XUQ A;  4EN8 B;  5EJ1 B;  4FP2 A;  4P5H A;  4JDO A;  2Y6G A;  2YC2 A;  2RM2 3;  3B7M A;  3EO6 A;  4MGS A;  4RN5 A;  1SFN A;  1QKQ A;  1HQL A;  2A6Z A;  3E6D A;  1R09 2;  4EZH A;  2HWE 2;  5A1L A;  2ID4 A;  2R06 3;  3IAP A;  3POG A;  2XH6 A;  1F31 A;  4N53 A;  4A2U A;  3WNX A;  1FPN 2;  5JIA A;  4XCB A;  2EIE A;  2QNK A;  1NQJ A;  3S7E A;  5FQ0 A;  3DKQ A;  4PT6 A;  2YC0 A;  4Y5Z 0;  4E8C A;  2CHH A;  2JG8 B;  5LA9 A;  5FXZ A;  3R05 A;  2JB8 A;  4NO4 A;  3AXE A;  2F6B A;  5GM0 A;  4COY A;  3DYO A;  2JIJ A;  2CV6 A;  3PVN A;  1AR6 1;  3N7J A;  4PLO A;  1AR9 3;  2JDK A;  3K2O A;  3PUA A;  1JOJ A;  4QKD A;  1CAV A;  2D3S A;  2HWF 3;  1W3V A;  4Z07 A;  5KWR A;  3WT3 A;  1GU3 A;  1LEM A;  2YB7 A;  4LT5 A;  1L7Q A;  4E8D A;  4RGA A;  3O1T A;  4CTE A;  1HIX A;  1LGC A;  2WFP A;  4GMP 3;  3RG0 A;  3SQO A;  3MV0 1;  3QLQ A;  5KHH A;  5LA0 A;  5L36 A;  2WT1 A;  2VZ3 A;  4G4F A;  4JVA A;  3WF3 A;  1HXS 1;  1YI9 A;  1UX7 A;  4Q4X 3;  4FFI A;  4WVZ A;  1JYN A;  2IXK A;  4PLM A;  4YW4 A;  2QCS B;  4CPB D;  2PAM A;  3KCX A;  1VE0 A;  1PX4 A;  3H7Y A;  3OGR A;  1S0J A;  4PF1 A;  5A3P A;  2VW1 A;  4KBZ A;  1JYW A;  3P6B A;  2BOJ A;  4FBF A;  1D2Q A;  3USU A;  1IS6 A;  1KXG A;  2DVB A;  1JZ4 A;  4F7Z A;  5A3T A;  2RJL A;  4BE3 A;  5DAB A;  1TEI A;  4XFG A;  5CU1 A;  5LAS A;  4OI1 A;  2PHT A;  4DS0 A;  3I2J A;  2BPA 2;  4QX1 A;  1W39 A;  1W2O A;  3CDZ B;  3R0R A;  4D0Q A;  4YNI A;  1OH3 A;  1LHV A;  1S0F A;  4RSU A;  5LY1 A;  2RR1 3;  5FPX A;  5E6H A;  1PZ8 A;  1H2M A;  4NWV A;  2E9Q A;  1QJU 2;  1F8V A;  4W8J A;  5FRA A;  1BJQ A;  1YIP A;  3C7F A;  3GZU C;  5JMC A;  3WLU A;  4FVV A;  1O5L A;  4YVS A;  3VDD C;  1BBT 3;  4FQ4 A;  2PHL A;  1YLL A;  3H1M A;  4KMQ A;  2DV9 A;  3MEP A;  2XKO A;  4YGB A;  1CAX A;  4DY3 A;  2XB6 C;  1CZT A;  3ST7 A;  4AK3 A;  1JUH A;  1OFS A;  4P9L A;  2L9L A;  4HVO A;  5F6K A;  5EPA A;  1MVE A;  4R9D A;  3VL9 A;  3RVH A;  1JZ6 A;  3MW2 A;  1K5M B;  1US3 A;  4IV1 A;  2XHN A;  1DGW X;  3N9P A;  4XQD A;  1TZO A;  2P3J A;  5GLT A;  2MNG A;  3DXU A;  2E32 A;  1LOF A;  5CYY A;  5JVV A;  5I93 A;  2P5B A;  2AAC A;  4JTN A;  5FY7 A;  2DU0 A;  3ZN4 A;  2DTY A;  4IEY A;  2YHJ A;  1DDL A;  4W50 A;  3C7G A;  5B2G B;  3LFI A;  3VGI A;  4E2Q A;  3FE5 A;  5GZF A;  4R9C A;  1GQH A;  1HRI 1;  1VIW B;  2E53 A;  4HLT A;  3AKR A;  1UIJ A;  3D82 A;  3OOX A;  2XJU A;  1PK6 B;  3ZYF A;  3I49 A;  1NCQ B;  1FI2 A;  1MVQ A;  3DYP A;  4YGC A;  1MEC 3;  1HB3 A;  3LDB A;  5GZD A;  2HWE 3;  3S6P A;  2IFW A;  1UIK A;  3LA3 A;  4AED A;  3NQH A;  1HRV 2;  3BN6 A;  1J1T A;  4ATE A;  3THP A;  3PUQ A;  3IBM A;  1K3I A;  2C1F A;  2JDM A;  2W95 A;  4IEQ A;  5JOZ A;  2VJX A;  3OPW A;  2VZR A;  4D6R A;  3AZW A;  4UBH A;  1H9P A;  1RUG 2;  2D93 A;  2NQY A;  2ZAH A;  3ZN5 A;  4YW2 A;  3ZXD A;  5A3O A;  3IT8 A;  2ZEW A;  3HR9 A;  4NRP A;  4XUT A;  5A80 A;  1HRI 2;  3KQ4 B;  4JC1 A;  3KF5 A;  4A6S A;  3RYP A;  1EY2 A;  3N36 A;  4GWI A;  2Q8E A;  3KT4 A;  2ILM A;  3N3H A;  1J58 A;  2WJS A;  3R4S A;  4MAD A;  5LBF A;  4FAG A;  1S1A A;  1WKY A;  2GSY A;  4FOQ A;  5A7O A;  3WF2 A;  4U2A A;  1YIF A;  2C26 A;  3Q8B A;  2X05 A;  1G9C A;  3B94 A;  3IDA A;  3WXP A;  5LAT A;  2D40 A;  3BOW A;  1ND2 C;  1PO1 1;  5FZ0 A;  1ULE A;  1VBD 1;  4GB3 1;  1C1L A;  1C4R A;  2WFF 3;  2XPJ A;  1COV 2;  2VCA A;  3ORJ A;  4HG6 B;  2OYZ A;  4A41 A;  4TZD A;  1BMV 1;  1RED A;  2VQT A;  1Y43 B;  2GC2 A;  1DGR N;  2WDB A;  1VBE 3;  2XJQ A;  2ZKN A;  2VOT A;  1N3Q A;  3RZH A;  5SV5 A;  1N47 A;  3H0O A;  3MLK A;  2NMO A;  2WA4 A;  3MUY 1;  3WNP A;  3ME2 A;  1WCS A;  2E51 A;  3M3I A;  3PL0 A;  2NYY A;  2Y6J A;  3FHI B;  2FD8 A;  3J8F 1;  1IS5 A;  4XF9 A;  3VD5 A;  5GZC A;  4HK9 A;  2Z5W A;  4SLI A;  1QJX 2;  1DQ0 A;  1QJU 3;  1JYV A;  2VZS A;  1WLT A;  2AZ5 A;  5KXB A;  3QH6 A;  1OQE A;  2R0H A;  2W52 A;  4GB3 2;  3VD7 A;  5F1R A;  1UMZ A;  1GP5 A;  4YFZ A;  3P1I A;  2ZX2 A;  4DY5 A;  1LKN A;  3LKJ A;  1X36 A;  5CA6 A;  2QFE A;  5E1R A;  1O91 A;  1HKD A;  2ATF A;  5IK7 A;  3WQB A;  4Y3O A;  4OQ9 A;  4COU A;  4FT8 A;  4LIU A;  2RS3 3;  3J7H A;  1LEN A;  2CDP A;  2J1S A;  2OT7 A;  3ALQ A;  4BDV B;  1K45 A;  4HBN A;  4PJY A;  1AJO A;  2CWS A;  2RS5 1;  1UY4 A;  4M3C E;  1BEV 1;  3ZVX A;  1RHI 2;  3J8F 2;  4EYU A;  4IL7 A;  2OXB A;  1AR7 1;  3PLQ A;  4UWD A;  2BQP A;  3WDX A;  1LGB A;  1VRH 1;  2OS2 A;  4JGY B;  1K5M A;  4N8M A;  5FXW A;  5F2W A;  2EXJ A;  1NLS A;  4BZ4 A;  1DP0 A;  3NNG A;  1X8E A;  2P4E A;  4BQY A;  3T0D A;  3TOJ A;  2XL7 A;  3FUO A;  1BLZ A;  2VH9 A;  1UU5 A;  3NMB A;  3ACG A;  4K6B A;  5JXG A;  5FAX A;  2CY6 A;  4PQQ A;  1PVC 3;  3M8L A;  1Z7S 3;  1DG6 A;  3VBH B;  3RI8 A;  2IZW A;  2RS5 2;  3NNF A;  2OQ7 A;  1D4V B;  4TLF A;  1BEV 2;  4L11 A;  1AF9 A;  1W6Q A;  4DUX A;  1AR7 2;  2W47 A;  2ES3 A;  1NCQ A;  5FLJ A;  3N7K A;  5T5L A;  4IEO A;  4J6G A;  4H3W A;  2VMD A;  4OLL A;  3WP6 A;  5DUX A;  1ODM A;  2ZAC A;  5FZH A;  4LKF A;  4IE7 A;  3LDR A;  1WCK A;  4QDQ A;  2BEO A;  2HYX A;  2BU9 A;  2P2K A;  1H1I A;  3BU0 A;  3AP5 A;  1GOG A;  1CAW B;  2D6K A;  3POS A;  4LQR A;  2VCM A;  4AQT A;  1CAU A;  4DOU A;  2R1B A;  3VZJ A;  3CL1 A;  4RHV 1;  3VKM A;  2QQM A;  2F4P A;  1CJP A;  5F37 A;  2R04 1;  2VNG A;  4NUB A;  4IET A;  4EN0 A;  2WNU B;  2VOX A;  3AP7 A;  3K46 A;  3HQU A;  1OHF A;  2YFU A;  1U5Z A;  4DFS A;  4EZ4 A;  2PHD A;  3MIH A;  2DCZ A;  4LBQ D;  1DYP A;  3PIG A;  2IXJ A;  4QQH A;  1OKO A;  4Y1Y A;  4HVQ A;  3EHK A;  2QUO A;  1NYW A;  4IW3 A;  1JW6 A;  4AW7 A;  3VKN A;  2ET1 A;  1JZ5 A;  4XXA A;  1SHW B;  1COV 3;  4YG0 A;  3MPB A;  4HKL A;  2V72 A;  4QXH A;  5FZA A;  2K2S A;  1ENR A;  1XU1 A;  2WC2 A;  5AC9 3;  3FBM A;  4ZPI A;  3ZDS A;  2UUR A;  3IDE A;  4NHY A;  1RUI 1;  4RHV 2;  3VBF C;  3Q9O A;  4RFT 0;  4AFB A;  3KVA A;  2R04 2;  2DF7 A;  3LPG A;  1ZRR A;  3U4X A;  4ZY9 A;  2ZGO A;  4JGZ C;  1LOG A;  4XF0 A;  1SFY A;  4S2G A;  5FZK A;  2E7Q A;  2KR2 A;  5A1F A;  1FOD 2;  1YFX A;  2A71 A;  1QJX 3;  2OUJ A;  2E33 A;  1GWL A;  4K8F A;  4XIL A;  4YRD A;  2G9F A;  2W08 A;  4RR3 B;  3TNP B;  3CBN A;  4XFA A;  1WLW A;  4XFC A;  5DMY A;  5LEJ A;  3AMQ A;  1CX4 A;  3U1X A;  4R9A A;  1DZT A;  4AVA A;  5FYT A;  3VZM A;  1UW8 A;  4AVB A;  3PUR A;  3I2K A;  4QPI B;  3Q8E A;  4LHK A;  5HV4 A;  4COZ A;  2WNV C;  1RUI 2;  2VUA A;  3N9N A;  1WME A;  3B00 A;  4OI0 A;  2PFW A;  4GAL A;  5LBB A;  3AKS A;  2VC9 A;  3HOB A;  3L9J T;  3IMN A;  1RHI 3;  1LOD A;  3EXU A;  2BYV E;  3PNA A;  2R32 A;  5L9B A;  5IAX A;  5KHJ A;  1ND3 B;  4WM8 C;  2GNM A;  4URT A;  4PF5 A;  2WZP P;  4PIZ A;  5A7Q A;  2ZGQ A;  1DZR A;  4PQ9 A;  1X8M A;  1UXZ A;  1O6U A;  5FYB A;  5A7W B;  4ES8 A;  1VAK A;  1HW5 A;  3I3D A;  4JGY A;  1POV 0;  4UW6 A;  3RZM A;  4FPJ A;  4P5Y A;  2JD4 A;  4CU6 A;  5KBF A;  4HXC A;  2AEN A;  3CJI B;  5F7U A;  2YPD A;  2YRO A;  1S2E A;  1RVF 3;  2J1A A;  2B5H A;  4SBV A;  4A6O A;  2OZ6 A;  3E1F 1;  3O14 A;  1RMU 1;  3ZMN A;  2BRT A;  3T2T A;  5FZG A;  4I09 A;  2VE1 A;  1OF4 A;  1RUF 1;  1QXP A;  4LE3 A;  1ZVF A;  1DZQ A;  4K7J A;  4Y4R A;  4ISQ A;  1D4M 3;  2JDN A;  4O9G A;  4HAN A;  5KR7 A;  2ARA A;  4QHO A;  2YGM A;  4KGG A;  4RS5 C;  3CZJ A;  3VV1 A;  1J1L A;  4KG8 A;  1WA4 A;  1AR8 1;  5IUQ A;  2BP6 A;  2JDP A;  3LB9 A;  5DAW A;  3RS6 A;  3WSO A;  5ACA 2;  4IGO A;  2P37 A;  2DWR A;  3ZR5 A;  1BVP 1;  1X7N A;  5IVV A;  2FMD A;  4BQ1 A;  2A6W A;  2LM3 A;  3ACL A;  1CAW A;  3N9O A;  2EVX A;  4NID A;  3UJQ A;  4D7T A;  5FPL A;  2VZP A;  2JE8 A;  3POF A;  4Q5O A;  4DQA A;  1RUF 2;  4BQW A;  3VHN A;  3U10 A;  3U75 A;  2KXL A;  3N9Q A;  5T3N A;  4L0P A;  4LBJ A;  2ZBJ A;  4L9B A;  3B02 A;  5FKB A;  4BQX A;  1ACC A;  2Q1Z B;  3ITQ A;  4PI2 A;  5I0U A;  3WHT A;  5I0D A;  4LBM A;  4Y22 B;  1CWP A;  1CX1 A;  2C9A A;  2QQU A;  5FBZ A;  1Y9M A;  1TE1 B;  1P8J A;  4WZF A;  4WM7 C;  4AOC A;  4NWW A;  1X82 A;  1Q8O A;  2VU9 A;  3JB4 C;  5ANQ A;  2SBA A;  5DDJ 1;  1RIN A;  5F3I A;  5A7S A;  4BLJ A;  3WDV A;  5GJ6 A;  3NO8 A;  1O7F A;  1ASJ 2;  5FZ7 A;  3B9C A;  4JV4 A;  3WG3 A;  5F9T A;  2XHK A;  3OD0 A;  4I0W B;  5IFP A;  2B4K A;  2IFR A;  5BY5 A;  2VZT A;  4LR4 A;  1FOD 3;  3U78 A;  1MS0 A;  2RJK A;  2WQZ C;  2ZJC A;  5HCA A;  4D7Y A;  1ZBA 2;  1UF2 C;  2YPJ A;  5J09 A;  1V6K A;  1ZRC A;  1FXZ A;  2Y60 A;  4FCA A;  4QX0 A;  1CIY A;  2JKB A;  2DBI A;  5L19 A;  3W20 A;  4LUL A;  3POI A;  4UT5 A;  5DXD A;  3W58 A;  1PGL 1;  4BM8 A;  1K12 A;  3K51 A;  1UZZ A;  3VBS B;  2ZPX A;  1NA1 C;  4TWT A;  2BBV A;  3VKL A;  2DTW A;  5DDJ 2;  3M70 A;  3N7M A;  1Q43 A;  1GNH A;  4NAM A;  1EAH 3;  5CKM A;  3RMX A;  2GND A;  4DIQ A;  3O1P A;  1F15 A;  3THC A;  3K3O A;  1OI6 A;  1UYZ A;  3JCI A;  4U36 A;  1ZX5 A;  5FZO B;  1SLI A;  2D3P A;  1NE4 A;  1H0B A;  1N3O A;  1ZZ8 A;  1LHN A;  3IZO A;  3BTY A;  1FMD 1;  4KQ7 A;  2HWC 2;  4CE8 A;  3KF3 A;  3OEB A;  4Q0U A;  1HJG A;  3ELN A;  1VBC 2;  5JR2 A;  5IVF A;  4QQP A;  1IOA A;  2WS9 1;  4L92 A;  3GZT B;  2QKD A;  1ND3 A;  4AGG A;  4OHW A;  1S2K A;  4KBB A;  2Q1F A;  1QJY 3;  1ZM1 A;  4NII A;  1BHG A;  5IK4 A;  1RUH 2;  3ZFE C;  3LWC A;  2FDI A;  5FMO S;  1JOD A;  2D7F A;  4XUR A;  2C24 A;  5D1I A;  2E6V A;  2QTW B;  3C8X A;  3KGZ A;  5FY9 A;  3E5Q A;  4NPR A;  5A7W A;  4JGZ A;  1H2L A;  1PM4 A;  1RUO A;  3LQC A;  2BBA A;  5FJH A;  1QQP 2;  3OGV A;  4COV A;  2XR4 A;  3CJI A;  1LES A;  2D44 A;  3MIB A;  4NAO A;  4EWD A;  4FOY A;  3MPP G;  3ZIW A;  3ZN6 B;  4YZ5 A;  1WUV A;  3BIE A;  2VPV A;  1PNF A;  3AJZ A;  2X8K A;  5KHG A;  4XDQ A;  3CF6 E;  1QJF A;  1VMF A;  5CFD C;  2RMU 1;  5FOJ B;  2CL2 A;  4IV3 C;  3ZSM A;  5F39 A;  4V2W A;  3ZX7 A;  2ARE A;  1S0D A;  4UF0 B;  3TN9 1;  4JQR A;  5ACA 3;  1T6G C;  1YJL A;  3LA2 A;  5FYU A;  4YW7 A;  1UMI A;  1JTZ X;  3I2G A;  4A7Y A;  1JBC A;  1PM7 A;  1SDD B;  4RGK A;  2JB4 A;  5FP7 A;  3WOG A;  4WM8 A;  2BWA A;  4XVH A;  1GQG A;  1E5H A;  3K77 A;  3PTY A;  4OI2 A;  4H55 A;  1UD1 A;  2DCY A;  1KGY A;  4Q4V 2;  4XIO A;  4FPY A;  2K9Z A;  2PTM A;  4AFM A;  2RMU 2;  1Q8P A;  1RUE 2;  5AVA A;  4XFH A;  3RGB A;  3BI3 A;  1IPK A;  4RL7 A;  1TQ5 A;  5HXV A;  5LRS A;  2HEV F;  1AYN 2;  1UY1 A;  2X5I C;  3A4U A;  5F5C A;  4R9B A;  3AZX A;  3VBR C;  2GMM A;  5DAP A;  4BQ5 A;  4Y22 A;  2CTV A;  1N3P A;  2HWD 1;  5LBC A;  3T0B A;  4UXA A;  3W59 A;  3EYP A;  2I07 B;  3NNJ A;  5F5Q A;  3WP5 A;  1VMJ A;  3GBG A;  1DQ5 A;  1SLT A;  5F5I A;  2F17 A;  2VZV A;  1BKZ A;  4QPG B;  1ZBA 3;  3JBG 2;  4AI9 A;  4AQS A;  4CU8 A;  1SAC A;  4J1X A;  1IG3 A;  1ULC A;  2EAL A;  1O3S A;  5FWE A;  2XL9 A;  1OQD A;  3CKH A;  3III A;  4UW4 A;  5GLV A;  3W9A A;  4NRQ A;  4OI4 A;  4KWL A;  5E8A A;  4ZS3 A;  1ZBE 1;  1YJK A;  5FZM A;  5ABJ C;  1JH5 A;  4IXL A;  3J4U H;  2GC1 A;  2PLV 1;  4R52 A;  3X29 B;  3N9L A;  2CGP A;  1W6P B;  4OHX A;  4HVR A;  2UYB A;  3I2H A;  1US2 A;  3IN9 A;  3JD7 3;  4EWA A;  1VRB A;  2YMZ A;  4FFG A;  1AR9 1;  1W8O A;  5BNN C;  5BNO B;  3I2D A;  2XGX A;  3LCP A;  3N7L A;  2KD7 A;  2PYT A;  4CDU C;  3MF6 A;  2IXH A;  2XXZ A;  4FPE A;  1SPP B;  1VBC 3;  4IGQ A;  4JX0 A;  5FUN A;  5FZ9 A;  4CYD A;  2JXA A;  5ERL A;  4AL9 A;  3BIW E;  4FAH A;  4WVV A;  1O8S A;  4WM7 A;  1CES A;  2LW8 A;  3PJY A;  3WCS A;  1PO2 2;  3DUI A;  1L3J A;  3VBU A;  1ZBE 2;  4BME A;  5HCH A;  1KRI A;  4PIY A;  4LK6 A;  5EXO A;  3AL5 A;  5J3U A;  3AFK A;  4LA2 A;  2PLV 2;  2JX9 A;  4YM2 A;  3VDC A;  4UOJ A;  1PZ9 A;  4LIT A;  1QQP 3;  1WW5 A;  4IE4 A;  5C4W B;  3OCP A;  5JLV A;  4QM8 A;  2JDA A;  2BFU L;  3EMR A;  3OBT A;  5FR3 A;  3ZXK A;  1DGW A;  5FXX A;  1GR3 A;  5FMC A;  4NIA A;  3VBO C;  1NLR A;  5A6Q A;  2A75 A;  2JG9 B;  1RUD 3;  4K3U A;  3IM0 A;  1OLR A;  1OLM E;  2WYF A;  3VD4 A;  2VOV A;  1AXY A;  4Y1V A;  3ZN6 A;  1GQP A;  3FUQ A;  1C1F A;  4JHZ A;  1X33 A;  4LOT A;  1K5J A;  4TYS A;  4GXL A;  3VN4 A;  4DXS A;  4P9G A;  5FYC A;  4K8R B;  2XG3 A;  4B4R A;  2WLP A;  4A7K A;  4K1Y A;  4UF0 A;  1OA3 A;  4NHM A;  2VMF A;  2RDS A;  2ZCW A;  3ILF A;  4K20 A;  2VME A;  4AXO A;  5LEK A;  1A34 A;  3ZXL A;  5CKQ A;  5J96 B;  3U14 A;  2EIB A;  1NY7 1;  3M3C A;  1O4T A;  3LEK A;  3MIG A;  4GWN A;  5LA2 A;  1YQ6 A;  2XQR A;  4ARX A;  1RUE 3;  1Y4W A;  4PDW C;  4XYX A;  4LHN A;  3ZPO A;  3LZZ A;  4L97 A;  2WN3 A;  1MZ6 A;  3HBZ A;  2BNO A;  1IQD C;  2CNA A;  1FX5 A;  1AYN 3;  1UOF A;  4JKL A;  2GMP A;  4V2V A;  1F9K A;  2BNN A;  4CDX C;  5SV8 A;  5DUW A;  1W2A X;  2RS1 3;  4CCK A;  3PVB B;  2XVL A;  2LTN A;  1NE6 A;  3NAP B;  2VMC A;  1C8M 1;  2TNF A;  3P3P A;  4YYO A;  4CXX A;  5FFO C;  3K3N A;  5C70 A;  2J1U A;  1XSR A;  3ZXF A;  4YSF A;  2CGN A;  1QDO A;  4BU2 A;  4FTB A;  4Q8L A;  4OFG A;  4LNV A;  5T50 A;  3V56 A;  1DYK A;  4AED B;  1MS4 A;  2VM9 A;  5CFD A;  2VOW A;  3PU3 A;  1O3Q A;  3J9S A;  1O8P A;  2HWB 1;  4XF1 A;  5F5A A;  2QQV A;  1V6M A;  1PIV 1;  1RUJ 3;  4XFI A;  2WZ8 A;  3NNM A;  2DVF A;  4CCJ A;  4QPG A;  5A70 A;  2J42 A;  4AHW A;  3LGR A;  5FZ1 A;  1FV3 A;  1YRZ A;  2Z42 A;  3KV9 A;  5DG2 A;  4ZU4 A;  1W8H A;  3A21 A;  4CDQ C;  1G9F A;  4NE9 A;  2UWC A;  1OKQ A;  1CN1 A;  2D6L X;  4CDW C;  3LOI A;  4LBO A;  2B9U A;  2YZ4 A;  4Q0S A;  3SEP A;  3PVE A;  2RDR A;  1XYN A;  1QWR A;  1O4Y A;  4Q4Y 3;  5CZK A;  3SH3 A;  4WZC A;  3T2Q A;  3ZDV A;  4AWD A;  2RDN A;  1NCR B;  1S0G A;  3MYX A;  5BNP B;  1O3R A;  1R1A 1;  5A3W A;  1ZA4 A;  4D7S A;  2W0X A;  2QE3 A;  4ISR A;  1W6P A;  5FP9 A;  1F5F A;  2XJR A;  1RJ7 A;  1SLB A;  2OII A;  3ILR A;  1SBE A;  2DFB A;  1PIV 2;  4GJY A;  1WD4 A;  1J84 A;  3ES1 A;  5DZF A;  5BNO A;  4AHZ A;  2P6C A;  2I2S A;  1PO2 3;  3D3A A;  5FZB A;  4IQP A;  1SPP A;  2VNV A;  4BCU A;  2WFF 1;  1UYY A;  1J3Q A;  3DPR C;  3PME A;  3SCF A;  4XFB A;  4AEK A;  3FJS A;  1SFP A;  1UKG A;  2P1B A;  1UU6 A;  5FIX A;  2WZE A;  4GAZ A;  2OX0 A;  2PAK A;  1AR6 2;  3GDB A;  2SLI A;  3LEM A;  1XE7 A;  3ZSK A;  2J1R A;  1F4H A;  2R6Q A;  1F4A A;  3ECQ A;  5FXV A;  1NOV A;  3TEW A;  2BER A;  3BTX A;  4WBB A;  2ZEY A;  1TMF 3;  5C4W A;  1VAM A;  3ZSE A;  3V0B B;  4RQP C;  5T5O A;  1OUS A;  2LAL A;  3C7O A;  1MZF A;  1HXS 2;  1XU2 A;  2WRA A;  1IHM A;  4LHL A;  5C3Q A;  4CEY C;  5JZG C;  4Y20 B;  1ZRE A;  2JG9 A;  1F5J A;  5DAV A;  5EWS A;  5EZW A;  2MEV 3;  1W0O A;  2DU1 A;  2GP5 A;  2BGO A;  5TSW A;  3RPQ A;  3T2P A;  2VBD A;  4MHR A;  4Q4W 3;  3DL3 A;  3B93 A;  3F95 A;  1CGP A;  5GZG A;  1YFU A;  2RS3 1;  2A7A A;  2XBO 3;  1PZ7 A;  5FYZ A;  1RL3 A;  5GKA C;  1RIR A;  3UV9 A;  1POV 3;  1KIT A;  4XPV A;  2WNE A;  1OH4 A;  1SLC A;  4YZ2 A;  4EN6 B;  4W6Y A;  2FZ1 A;  3A23 A;  2PAE A;  2WO2 A;  4LJH A;  1M4W A;  5I0R A;  1V9U 3;  3UGG A;  1KJL A;  1XNK A;  3CO2 A;  3BU7 A;  3J7N A;  4IGP A;  3ACH A;  2A6Y A;  4LUK A;  4I30 A;  5FO8 B;  3L2Y A;  3O0V A;  5EV7 A;  5EQU A;  1QOT A;  1RTV A;  1X50 A;  3DF0 A;  1VP6 A;  1X9T A;  5FMO L;  2H6B A;  5FJK A;  3HD8 B;  1HB4 A;  3QH7 A;  5F3G A;  3NW4 A;  2JIC A;  5LWB A;  3HBK A;  1LHO A;  2XWB B;  4GWJ A;  1OOP C;  1QJZ A;  1Q8S A;  3ZXG A;  4AEM A;  1W2T A;  2BGC A;  1PVC 1;  1W6Q B;  3GBW A;  2LS6 A;  3ROU A;  4RD7 A;  4XQ4 A;  2FBE A;  3NAP A;  5I8T A;  4DUV A;  3AM2 A;  5KXE A;  2FDJ A;  5HPO A;  2LRO A;  3VDD B;  1R09 3;  4QDR A;  1W8Z A;  1R1Z A;  4XW3 A;  3NST A;  3EQE A;  4QKN A;  3T0A A;  4QT6 A;  5BUV A;  1FPN 3;  2EXK A;  4QPW A;  5T55 A;  1WW4 A;  5F32 A;  1V70 A;  3D5O A;  2FQP A;  4MO3 M;  4XJA A;  1CAU B;  5I0T A;  1GNZ A;  2WR9 A;  4ASL A;  3AZZ A;  1ZZB A;  2XJS A;  4QKB A;  4AFA A;  1LUL A;  1VJ2 A;  4V1P A;  4XTM A;  4IEX A;  5FBJ A;  1RYY A;  4JDN A;  5FZC A;  2P3K A;  4CPB A;  1W0N A;  1AZD A;  2WT2 A;  3MBW A;  2DCK A;  2VW0 A;  3KVB A;  1IKP A;  1O4Z A;  5FZ6 A;  3BPS A;  3AZY A;  5FMB A;  1AUY A;  1NCR A;  5BNP A;  4Q27 A;  4MGI E;  2WQ4 A;  4XJU A;  5DAQ A;  2XVG A;  3ZKY A;  4MGK E;  1VBB 1;  3WIN E;  5C9A C;  2IXI A;  4C0B A;  2ZGL A;  5CFC C;  1J3R A;  1SCS A;  1PMI A;  2IC1 A;  4C1X A;  1W05 A;  3AFG A;  5IT6 A;  4Y33 A;  2QJV A;  3I3B A;  3OJB A;  4W6W A;  5AC9 1;  2YC4 A;  1Q3E A;  4NHX A;  4I0B A;  4CUA A;  4UFI A;  1MPX A;  5EJZ B;  4DZG A;  1O3T A;  1HN1 A;  4OZO A;  2XON A;  5FKC A;  1I6X A;  2E63 A;  2QZ2 A;  4Y5S A;  4QXK A;  1W99 A;  2Z69 A;  2ZGS A;  4P9J A;  1H4H A;  2XVK A;  3OYW A;  4B7E A;  5BYN A;  2FDF A;  4E4H A;  3BAL A;  2BZD A;  4LLF A;  4MX3 A;  2WIN B;  3TB0 A;  1W8T A;  4E27 A;  1RUN A;  2QQJ A;  3WVJ A;  3H8R A;  1PO1 2;  1RC6 A;  1VBD 2;  2D6O X;  3WW4 A;  2AUY A;  1MS3 A;  1OUR A;  1WMF A;  4GJZ A;  4QGL A;  3THD A;  3UGF A;  4UW3 A;  3V0B A;  5CKN A;  1BMV 2;  3AXD A;  2VBB A;  2Y0I A;  3HQX A;  5FP4 A;  5IK8 A;  3PIJ A;  1OPM A;  2O0O A;  3BTA A;  4ZXE A;  3M4F A;  2OZJ A;  2WYS A;  2W39 A;  3G6J B;  4Y20 A;  1K42 A;  1ZZ7 A;  3VB9 A;  1SLL A;  4HSJ A;  2BWC A;  3I54 A;  4M0N A;  1ND2 B;  2ZA9 A;  3AKP A;  3A0N A;  3HVD A;  4YM3 A;  3UKV A;  1ZRI A;  1PMJ X;  3DEM A;  3LIG A;  1WCU A;  4QQL A;  5FZE A;  1VB4 A;  3EB7 A;  2ZGK A;  4L2N A;  3CMG A;  2F4L A;  2VL4 A;  1PGW 1;  3KS7 A;  1MZE A;  5FY5 A;  5FDB A;  5IAT A;  5CG8 A;  4K21 A;  2JD9 A;  4S2H A;  1W6M A;  3NV4 A;  2R7E B;  3BCW A;  4H7L A;  4O7X A;  4CCO A;  5C3P A;  1SZB A;  2J7M A;  4I3G A;  1UOB A;  5FLI A;  2Y33 A;  1RGS A;  2VUJ A;  4M4R A;  3BKZ A;  1DYO A;  5FY0 A;  2WQ8 A;  1IZ3 A;  4A7Z A;  4KG0 A;  2PQQ A;  2D6M A;  4R8H A;  1B09 A;  1TME 1;  2ZGP A;  5FYI A;  2W1Q A;  3WG4 A;  1IS4 A;  1G7Y A;  3MW4 A;  5FCC A;  3VZO A;  4XET A;  4ASK A;  4LPL A;  2Y0O A;  4CEY A;  3W5M A;  5JI7 A;  4N43 C;  1PGW 2;  1VRH 2;  1HRV 3;  1YQ2 A;  2ZML A;  4AAX A;  1YFY A;  1RUC 1;  4LBQ B;  3AYA A;  3DV8 A;  2OW4 A;  1EV1 1;  2K0G A;  5FP3 A;  3VDD A;  4BWO A;  4Q1R A;  4HMZ A;  1RUG 3;  2UWA A;  1W2N A;  1N1T A;  5J1X A;  1HRI 3;  1RXG A;  5DG1 A;  4KH9 A;  5FUP A;  1F2N A;  5D8A C;  2W1W A;  3ZFF C;  4I2O A;  5FK8 A;  1JMU B;  5J98 B;  4ATF A;  4FFF A;  4UI9 L;  3IB3 A;  2WL1 A;  5DQ0 A;  1UZ0 A;  4JZR A;  4EV0 A;  5FPU A;  1AJK A;  2WZR 1;  4L99 A;  1NQD A;  3VD9 A;  1W2U A;  2VCC A;  4I02 A;  2NLR A;  3HPN A;  2D6N A;  4NOT A;  4ZON A;  3W21 A;  5HCB A;  1RUC 2;  2EIG A;  1LR5 A;  4BK5 A;  5A3N A;  1C57 A;  1EV1 2;  3N4M A;  1QH7 A;  4UYB A;  1Q8V A;  5FOB B;  1OOP A;  3NVC A;  3MI8 A;  3BTZ A;  1HDK A;  3OF1 A;  1UY2 A;  4Q8K A;  1FNZ A;  3DN7 A;  3RYK A;  5C33 A;  3TEZ A;  5FLH A;  3GZE A;  4LLO A;  4XEZ A;  3SH5 A;  4JKK A;  4UFL A;  4XUN A;  1VBA 1;  1IPJ A;  1OLQ A;  3I8T A;  2ZKL A;  2ZX0 A;  3M1H A;  3RQ0 A;  5L7O C;  4XJ8 A;  3KT7 A;  4ONU A;  2E26 A;  2ZX1 A;  2ENR A;  3I59 B;  3H1Y A;  5JR7 B;  1AL2 1;  2J1T A;  3V64 A;  2BUK A;  3EJK A;  5C8C C;  4BIF A;  4UAP A;  2E31 A;  2ZEZ A;  4GWM A;  1NAE A;  4BXS V;  2R07 1;  3QAC A;  2QVS B;  4CCN A;  2JDU A;  3UNP A;  2PXJ A;  1UOG A;  3IKW A;  4LE4 A;  1PO1 3;  4YGE A;  5FPZ A;  4B1L A;  1CJD A;  2WAB A;  1KS4 A;  4GB3 3;  3T30 A;  3LIH A;  1FAT A;  2WN2 A;  2OA2 A;  3RNS A;  1KJR A;  3APB A;  1EPZ A;  4XUO A;  2DUO A;  2I74 A;  4IEU A;  5IVY A;  1LB2 A;  1J83 A;  2IVJ A;  2TEP A;  5F2S A;  1VBA 2;  1W8F A;  5JXJ A;  2O8Q A;  4XIK A;  4CSW A;  1OC1 A;  5EYY A;  2GP3 A;  3KCC A;  1VAL A;  1AL2 2;  4GH4 C;  1BCX A;  3ZPY A;  2EIC A;  4K1Z A;  3ZXJ A;  4ZU5 A;  1UYX A;  5GLZ A;  4C91 A;  1M06 G;  4NN0 A;  4XBL A;  3JXS A;  3POJ A;  3J8F 3;  1W3X A;  1ZZ9 A;  2R07 2;  2E7A A;  1ND2 A;  5JXH A;  2XKP A;  4G3Y C;  4YVW C;  5CFC A;  1GZC A;  1SBF A;  2EXI A;  5FZI A;  5C5T A;  1UZV A;  3VBF B;  3AMN A;  3T3Y A;  1AX1 A;  1W90 A;  1Z78 A;  4P9X A;  1SBD A;  5I8Y A;  1S0B A;  2G19 A;  4AQ2 A;  4JGZ B;  3FFZ A;  3T08 A;  5ISL A;  4OCT A;  1ULF A;  4JHT A;  3K75 B;  4H2A A;  4CUC A;  5FY8 A;  3O1V A;  4PI0 A;  5FYH A;  2OQ6 A;  2JEM A;  5E88 A;  3ES4 A;  2WNO A;  3NV3 A;  2RS5 3;  1GUI A;  2GN3 A;  2A70 A;  2HYK A;  3HQR A;  5FY4 A;  5IVJ A;  3ZFG C;  3LF7 A;  4OHV A;  1BEV 3;  3HNY M;  3WG2 A;  5KHK A;  4AVT A;  1AR7 3;  1VRH 3;  2PHF A;  2FZ2 A;  2WNV B;  1UL9 A;  3E97 A;  4JRL A;  4YG3 A;  5G05 L;  5IVB A;  5DUU A;  1Z0H A;  5CB7 A;  3T09 A;  3WW1 A;  2RVA A;  3LEG A;  3K4Z A;  3H3L A;  4N7I A;  3UES A;  1NG0 A;  4LBQ A;  4P02 B;  4WM8 B;  3N35 A;  3ILN A;  4NMI A;  2W87 A;  5C5U A;  2UY8 A;  4HT1 T;  4XAC A;  2CAV A;  1VLN A;  2VO5 A;  2YBK A;  3ZIX A;  3JZV A;  3CQO A;  3H3Z A;  4MOA A;  3W5N A;  4CZS A;  1QJE A;  4HN1 A;  1RMU 2;  3O12 A;  2B9V A;  1MQT C;  3O1U A;  1GFF 2;  1XE0 A;  3NJY A;  1GZW A;  3ZMO A;  5A1A A;  4Z92 B;  3O1R A;  4QHZ A;  1KEX A;  4M4P A;  4FFH A;  4XE9 A;  3AYD A;  3SIT A;  3WX5 A;  3ZFE B;  5IJR A;  1AR8 2;  4CRQ A;  4P14 A;  1CVN A;  2V09 A;  4XMI A;  4QHB A;  4MV2 A;  3QOP A;  2ADD A;  3TEX A;  1N1Y A;  3LEI A;  1ENS A;  1V0A A;  3J26 N;  3KSC A;  1CPN A;  4RHV 3;  3T1M A;  1E5S A;  2R04 3;  3S57 A;  1BK0 A;  1JZ8 A;  4BOW A;  1W9F A;  5B4X A;  4RS5 B;  4XDO A;  3MLL A;  1V6J A;  2A5Z A;  4N43 A;  4PBP A;  2GNT A;  2GU9 A;  4AI0 A;  3A22 A;  4XBQ A;  3I59 A;  2OVU A;  1NXM A;  2FDH A;  1C5I A;  1LOB A;  2ARX A;  2PHU A;  1AYM 1;  4ZZ5 A;  4FPK A;  4AEJ A;  3SIS A;  2EAA A;  4XXP A;  4BQ4 A;  2Q1M A;  2X53 S;  2P17 A;  4CXW A;  5APA A;  4FPL A;  1R08 1;  1GBG A;  5D8A A;  2W1S A;  2I45 A;  3SXW A;  2XJV A;  3ZFF A;  1E5I A;  2C0Z A;  3FHQ A;  3WNO A;  1RUI 3;  1U5X A;  1YNA A;  5A6Y A;  3WUC A;  1H8T C;  2Y6F A;  3A0K A;  1QXJ A;  3NWK A;  5LY2 A;  2UY9 A;  5IFT A;  3JD7 1;  5KC5 A;  3RI9 A;  3VUO A;  1W03 A;  2ZHL A;  3TNQ A;  3ZM8 A;  3OSD A;  4WM7 B;  5E89 A;  3KGL A;  4YWA A;  3VBU B;  1AYM 2;  3HN1 A;  3LSE A;  2XLF A;  3I97 A;  4P9I A;  4CP2 A;  1QH6 A;  4C1W A;  1PGL 2;  1R08 2;  1XND A;  2A3Y A;  4CVU A;  1HB1 A;  3LFM A;  3VBF A;  4C8D A;  4YM0 A;  4GUL A;  2JDH A;  1U0A A;  2EID A;  3BUC A;  2ET7 A;  3UL2 A;  1FNY A;  2UYA A;  3OGG A;  4EWE A;  5C8C A;  4O61 A;  4A44 A;  4LA3 A;  1V6L A;  3RZZ A;  1JS9 A;  2CAU A;  2GC3 A;  1G6N A;  1UKR A;  5K0U C;  4H14 A;  1BZW A;  2R0F A;  3ZR6 A;  1XNB A;  1FMD 2;  4CA9 A;  4DRV A;  1NA1 B;  2ORX A;  3WG1 A;  3C3V A;  3LPF A;  4ZKT B;  1ENX A;  2VUD A;  2WSU A;  4CEW C;  4IE0 A;  3ACI A;  1KQR A;  2Z2S B;  2WS9 2;  3H42 B;  3KLS A;  4AHX A;  2YV8 A;  5F3C A;  2WNV A;  4DEQ A;  4R4Z A;  2YY1 A;  1B35 C;  3PU8 A;  5EJ3 A;  2VZQ A;  1BYH A;  2QQL A;  3DGT A;  4Q1P A;  4FXK B;  1LRH A;  2VG9 A;  2ZGU A;  3OD4 A;  4O9E A;  1HQN A;  5GZE A;  4AGR A;  3IPV A;  3Q8C A;  4D6S A;  1RMU 3;  1OD3 A;  3P5B A;  4HZF A;  4N90 A;  3I3E A;  4QAW A;  1V00 A;  1GOH A;  1RUF 3;  2BOI A;  2VY0 A;  2YGL A;  2GH2 A;  3B5L B;  3FMG A;  3HNM A;  3MW3 A;  4XJ9 A;  3O0W A;  5FP8 A;  3WF0 A;  5HI0 A;  3H7J A;  1UO9 A;  4QWN A;  2VMG A;  3OUI A;  3VZL A;  4D3W A;  3NL1 A;  3KCY A;  1E57 A;  4M3C B;  3ZYP A;  1AR8 3;  1FYU A;  1GP6 A;  4LIV A;  4DNY A;  4FPO B;  4N53 C;  3TN9 2;  2ZX3 A;  1WBF A;  5A3L A;  4LKD A;  4Y1X A;  4NHK A;  3GF6 A;  3O1M A;  2YBP A;  1H4G A;  2B45 X;  3H50 A;  1V6O A;  1ASJ 3;  3S0M A;  5F8P A;  5CFD B;  3FWE A;  5C6C A;  1NX9 A;  4IV3 B;  4YZ1 A;  5C3O A;  3WF4 A;  4FQZ A;  3AP4 A;  1OMI A;  4FOV A;  2RM2 1;  4GKX A;  4CUB A;  4DXR A;  3WNM A;  4RS5 A;  4Y4Y A;  5BV6 A;  3GZA A;  2G9G A;  3IAQ A;  3PHM A;  1RUJ 1;  2A1X A;  4GKY A;  4YFW A;  2R06 1;  1TNF A;  4LXL A;  5LB6 A;  1W06 A;  2Q30 A;  1PHM A;  1W9T A;  4XHB A;  4JAA A;  4N9I A;  3ZYH A;  1Y9Q A;  2VGD A;  1SQ4 A;  2W46 A;  5DDJ 3;  2XOM A;  1CON A;  4XFF A;  4IDZ A;  2HWD 2;  3H8X A;  3M3E A;  4Q4Y 1;  1XJA A;  3PUH A;  2BV4 A;  5KHI A;  3S5A A;  4AVV A;  1HV1 A;  3ETP A;  2RM2 2;  1DHK B;  2HWF 1;  4LKS A;  3C2U A;  1KS5 A;  1V6I A;  2X5I B;  4GA9 A;  4QDS A;  4YW5 A;  2HWC 3;  5FYS A;  4FTS A;  1A78 A;  5T54 A;  4GIQ A;  5JWP A;  2A3X A;  3VBR B;  2YFZ A;  2J1V A;  1D0G A;  3P3N A;  1W6N B;  4GMP 1;  3NJX A;  5F6L B;  5JI9 A;  3JB8 A;  1H2N A;  2QQI A;  4BYY A;  4D8M A;  3E6C C;  2Q4S A;  4Q4X 1;  4BK4 A;  2ORZ A;  3I3Q A;  1JOB A;  1RUH 3;  4RFR B;  4BJ0 A;  1MS5 A;  4OYU A;  5DN2 A;  5FO7 B;  2DVA A;  1W9W A;  3JU9 A;  2O1Q A;  4HSL A;  3AVR A;  3RJ2 X;  4MGQ A;  4YVS C;  4QB6 A;  5JPN B;  1HX6 A;  4MXW B;  1DBN A;  3K4A A;  4UBG A;  1S2B A;  3ZKU A;  5CG9 A;  1AR9 2;  1JZ3 A;  1VMH A;  3AJY A;  4YW6 A;  2HWF 2;  2VNO A;  1FMD 3;  4XF3 A;  5FYY A;  2PEL A;  5ABJ B;  1MZ5 A;  4BIS A;  4RYD A;  4AG4 A;  3ZYJ B;  3MFC A;  3VHO A;  1WLC A;  5IW0 A;  4AI3 A;  2QQW A;  2RR1 1;  2WS9 3;  4B29 A;  2DCT A;  2K46 A;  4IV1 C;  3NV2 A;  5JDB A;  2W68 A;  2WLQ A;  1NA1 A;  3I4I A;  1KDK A;  4EJR A;  5BNN B;  1W0P A;  2Y6K A;  5FZL A;  3RSJ A;  1H8T A;  2R16 A;  1GNY A;  1LOF C;  2WWU A;  3GBF A;  4CDU B;  4OQ8 A;  1DQ6 A;  2PMW B;  2DUQ A;  1BBT 1;  3BOD A;  3CU7 A;  2H0B A;  3KHB A;  1I3H A;  3POY A;  1XPW A;  2YU1 A;  4QM9 A;  5A7P A;  5H9S A;  3LOB A;  1OSG A;  1URX A;  4HKW A;  4Y26 A;  3WF1 A;  5KXD A;  2VTX J;  4C0H A;  2DFC A;  5LW9 A;  4Z1V A;  5FZ3 A;  3ON7 A;  5DAX A;  4O65 A;  1UY3 A;  4Q4V 3;  2C4X A;  4B4Q A;  1T2X A;  3GHN A;  3KV6 A;  3NV1 A;  4C90 A;  1V9U 1;  4KWU A;  1XOY A;  3T4H B;  2RMU 3;  4PBO A;  1DFQ A;  1EYB A;  2FCU A;  4K9S A;  1AL0 G;  4UFK A;  3VD3 A;  3WDU A;  2GAU A;  3ZFE A;  4MXV A;  4BXF A;  3UGH A;  3TN9 3;  4ITC A;  4CU9 A;  2GNB A;  3D6E A;  1JUI A;  1PX3 A;  2D43 A;  4BIO A;  5D21 A;  4KL1 A;  5FZ4 A;  2YXS A;  3HMY A;  4M3C A;  3VBO B;  4A45 A;  1BBT 2;  2VZU A;  1L7R A;  4NPM A;  1NZC A;  5FPV A;  3LA7 A;  4DB5 A;  1XXN A;  2NN8 A;  4YPJ A;  4IE6 A;  4QX3 A;  3K48 A;  4LO7 A;  4XCA A;  1IKQ A;  2ZAA A;  4MGY E;  4P08 A;  2Q8O A;  4ARY A;  2HKX A;  5HXM A;  1J3P A;  4CEW A;  1LCL A;  1MEC 1;  2JG8 C;  3JBG 3;  1NY7 2;  3JQW A;  3MV1 1;  1OPO A;  4IV3 A;  3R6S A;  3GCW A;  2HWE 1;  3CEW A;  2W5F A;  1GYK A;  4NRO A;  1B35 A;  3WP3 A;  1LOC A;  4I01 A;  1EUT A;  1HJF A;  1XNC A;  2JE9 A;  4CCE A;  1N1S A;  1ZNP A;  3HT2 A;  2ZHM A;  3SCG A;  1C8M 2;  1TNR A;  3UKT A;  4PDW B;  2ZAB A;  2LUW A;  2XLG A;  3B01 A;  1XSQ A;  1GLH A;  3D0S A;  3D8C A;  3WV6 A;  1U5Y A;  4BA6 A;  1NKG A;  1MEC 2;  2BVB A;  4CDX B;  3FL7 A;  2WA3 A;  2WO7 A;  2HWB 2;  4TSV A;  2A3W A;  3BB6 A;  1JYT A;  2NMN A;  4FI9 A;  4S2F A;  3WR0 A;  5IVE A;  3HNB M;  4HK8 A;  3PVO A;  4IEP A;  4MET A;  1WD3 A;  2X5I A;  4EE2 A;  3TWI A;  1ZBE 3;  3VBR A;  1GOF A;  4PIX A;  1H30 A;  1GAN A;  2W94 A;  1STM A;  1W6N A;  2BGP A;  2QDR A;  4NPL A;  4N9H A;  2PLV 3;  1Y7B A;  4M01 A;  1S0I A;  2W92 A;  4AGV A;  5FYV A;  1AXZ A;  5LK7 B;  2PN5 A;  4KU8 A;  4CXY A;  5FYM A;  1VBE 1;  3OYW B;  3RMY A;  4K40 A;  2NZ9 A;  5DZG A;  2VR4 A;  2UWB A;  1R1A 2;  1CD3 G;  1KDM A;  5AFB A;  2W1U A;  4CDQ B;  1OBN A;  2OKX A;  1ZYB A;  3I2I A;  3H3U A;  5M0T A;  3U0Z A;  3D4K A;  2HLE A;  4MXW A;  4QKF A;  3GJB A;  3VLB B;  2B39 A;  2ZMN A;  1DIW A;  4YZ4 A;  4CDW B;  4W65 A;  1SG3 A;  3AMH A;  1QOS A;  5B4N A;  1QJU 1;  4WVM B;  1JYI A;  2JDZ A;  5ABJ A;  2WWJ A;  1MS9 A;  2VVD A;  1DF0 A;  2WFF 2;  1K5M C;  2DUP A;  1VAV A;  3E5U A;  2JE7 A;  4ZU7 A;  1DGL A;  1UQX A;  4OHY A;  1CZV A;  5BNN A;  3ZLI A;  3DCQ A;  1VBE 2;  2PHX A;  4QX5 A;  4CDU A;  1Q56 A;  3VZK A;  1XYO A;  2ZHN A;  3DPR B;  3ENR A;  3KMH A;  3WP4 A;  2KA3 A;  4HN0 A;  1W6M B;  4D69 A;  2XUE A;  5A32 B;  1QF3 A;  2VUL A;  5CNA A;  3KQR A;  1LHU A;  4BHP A;  5KC6 A;  1PK6 C;  1NCQ C;  3OGS A;  4G9S B;  2A73 B;  1DGR A;  2OPW A;  2QQP A;  3POW A;  3C7E A;  1D2S A;  3WUD A;  1YI7 A;  3Q8F A;  3BGA A;  5LA1 A;  2WO1 A;  5BNQ A;  4RQP B;  2DVD A;  2RS3 2;  2YDE A;  4AAP A;  5JMO A;  3MUZ 1;  2P6H A;  4DUW A;  1Z7S 1;  3AMP A;  3B9I A;  3CJX A;  2YU2 A;  1G8W A;  3VBO A;  4CEY B;  5JAX A;  5JZG B;  4FSJ A;  4OVE A;  1GIC A;  3GHM A;  3WCR A;  1J59 A;  3UT0 A;  1DQ2 A;  2HEY F;  2EAK A;  4Q0V A;  4XZP A;  3DEC A;  2C9K A;  4XDP A;  1Q5O A;  4KWJ A;  4WV8 A;  4Q0P A;  1O5U A;  1HRV 1;  2FMY A;  2R49 A;  3GM8 A;  4Z2A A;  3ZSJ A;  4DMI A;  5GLW A;  2JKX A;  3KB5 A;  3DXT A;  1QY4 A;  3KV4 A;  5J48 A;  2XDV A;  3SKV A;  3AVS A;  4HOO A;  2TBV A;  4ES9 A;  3OPZ A;  1LHW A;  1OFN A;  1RUG 1;  1C8M 3;  3M3Q A;  4NHL A;  4DEV A;  1JYX A;  1PVC 2;  1Z7S 2;  1IQA A;  4AFC A;  4XUP A;  4A3X A;  3WD5 A;  3MIF A;  1ZRF A;  4PDW A;  2HWB 3;  2ZGN A;  3E6B A;  4LHS A;  3O1S A;  1R64 A;  1VPH A;  3IDC B;  1PIV 3;  3AP6 A;  1OOP B;  2ZGR A;  2B7Y A;  5J37 A;  1T6B X;  4CDX A;  1ZZ6 A;  1ULP A;  1ODN A;  3RZG A;  1MS1 A;  1A3K A;  4IE5 A;  2AR6 A;  2VEC A;  2VTF A;  4OUS A;  1COV 1;  5CAD A;  1NLQ A;  1O59 A;  5IYY A;  3GNE A;  1LU1 A;  1I9R A;  1AX2 A;  1PVX A;  1W04 A;  4XAA A;  3T4V A;  1W8U A;  5C3S A;  1TVG A;  5FWJ A;  2Z4F A;  1XBF A;  3ZYG A;  4FTE A;  5FPB A;  2EF6 A;  1LTE A;  1AR6 3;  1LAJ A;  3OBR A;  2JG8 A;  4PLN A;  1PNG A;  4XZU G;  4I0A A;  4QXB A;  3VKO A;  1R1A 3;  2J1E A;  2MPF A;  3U4S A;  3WQ7 A;  3VDB A;  5JSR A;  4NIG A;  4P9Y A;  1ENQ A;  2G1M A;  3KZ4 C;  2XJP A;  2WII B;  4UW5 A;  2CU5 A;  4XHX A;  5FZ8 A;  5J7M A;  1Y3T A;  1QJX 1;  4PHZ A;  3QCW A;  2NPI A;  1WLD A;  4IEV A;  3RFR A;  4XF4 A;  1HXS 3;  1GWK A;  1VBB 2;  2VNR A;  3FZ3 A;  4AE2 A;  4BLI A;  2Q0A A;  4CDQ A;  1A6C A;  4FPH A;  4LUM A;  3G7D A;  1DQ4 A;  4CDW A;  5CBL A;  4OUL A;  4QXC A;  1S0E A;  1XNA A;  3NRU A;  4WVM A;  1BXH A;  1UAI A;  2O14 A;  4QB2 A;  4Y1U A;  5AC9 2;  5HV0 A;  2G9Z A;  2FCT A;  2VQA A;  4JGY C;  4QX8 A;  2ERF A;  3H8O A;  4LO6 B;  4CP0 A;  5C9A B;  5KXC A;  2FDK A;  5CFC B;  5FV3 A;  4HFS A;  1JYC A;  1HB2 A;  3UKN A;  4DXZ A;  1YO8 A;  3BPZ A;  1RHI 1;  3WHU A;  2WAO A;  3FLP A;  1QHD A;  2XJT A;  1XB9 A;  1JHJ A;  3FC0 A;  3POE A;  5K4L A;  3DPR A;  4MGZ E;  3VBH C;  2MHF A;  5H9P A;  3H9A A;  4BPZ A;  5A32 A;  1QMJ A;  5T5P A;  2ETE A;  3FLR A;  4I3P A;  4QB1 A;  3RJR A;  4XJW A;  3Q8A A;  1JN2 P;  2DCJ A;  1LJ7 A;  3MDP A;  4AVC A;  3HJR A;  4QGM A;  5H9R A;  3H1W A;  1C3H A;  1A8M A;  1RVF 1;  2BVV A;  1UMH A;  2Y38 A;  3VZN A;  4BQ2 A;  5F3E A;  3B3Q E; 
#chains in the Genus database with same CATH homology
 5D21 A;  3F95 A;  2KR2 A;  4BQ3 A;  3ZYH A;  4LK6 A;  3ZYF A;  4CPB A;  1WCU A;  1GWL A;  4BQ4 A;  4LKD A;  2Q1F A;  1L7L A;  1HN0 A;  1OKO A;  4CP9 B;  1WMX A;  1W90 A;  1GWM A;  4YW7 A;  4BQ5 A;  3UT0 A;  4CP9 A;  2LRO A;  1W8T A;  2C24 A;  4LJH A;  1W8Z A;  4LKF A;  1OH3 A;  2LRP A;  1GWK A;  4YW6 A;  1V0A A;  1W8W A;  3ORJ A;  1W9F A;  2WYF A;  2O14 A;  3ZYB A;  4LK7 A;  1W8U A;  4AL9 A;  4CPB D;  2K46 A;  2JWP A;  2VXJ A;  1UOJ A;  4BQ2 A;  4LKE A;  4YWA A;  1WZX A;  4A6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...