1C5HA

Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGDFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Hydrogen bonding and catalysis: a novel explanation for how a single amino acid substitution can change the pH optimum of a glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1999-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c5hA00
2JENA 4H7MA 2BVVA 3AMHA 1NLRA 1C5IA 3AKRA 4NPRA 5HXVA 1QH6A 2QZ2A 1M4WA 3RI8A 2D98A 4S2GA 1UU4A 3EXUA 2NQYA 3VHPA 1XXNA 3WT3A 1OA4A 1H4GA 3ZSEA 2VUJA 4IXLA 3WQ1A 3VZNA 1H8VA 3WP4A 3LB9A 2DFBA 1F5JA 3M4FA 1T6GC 3VL9A 4HK8A 2JEMA 1H1AA 1XNDA 3VZMA 1YNAA 1REDA 2BWCA 3B5LB 3HD8B 3WP6A 1XYOA 3VZJA 1OLRA 1BK1A 5K7PA 1ENXA 3WY6A 3AKTA 2QZ3A 3AMPA 2DCZA 1XYNA 2DCKA 3WP3A 2Z79A 2DFCA 1OA3A 1UU6A 1HV1A 1REFA 1KS4A 3MF6A 1XNBA 4XQ4A 3VLBB 1KS5A 3AKQA 5EJ3A 1AXKA 4S2DA 2NLRA 1BCXA 1XYPA 3VZOA 1BVVA 3VZKA 1XNKA 3AMQA 4HKOA 4S2FA 2JICA 1H0BA 3VGIA 3VZLA 1QH7A 2DCYA 2VULA 1W2UA 1OA2A 3B7MA 3VHNA 3WR0A 3WQ0A 4HK9A 1C5HA 1OLQA 3AKSA 3RI9A 3WX5A 1UKRA 3AMMA 3WP5A 1PVXA 1TE1B 2B46X 4HKLA 2DCJA 2VGDA 3AMNA 3LGRA 3WQ7A 3MFAA 4XPVA 2B45X 2B42B 4S2HA 1HV0A 3VHOA 4HKWA 3WXPA 2C1FA 2VG9A 4XQDA 3O7OA 2D97A 5K9YA 1IGOA 3MF9A 1HIXA 2BW8A 2BWAA 1UU5A 1REEA 3AKPA 3MFCA 3VL8A 1H4HA 1XNCA 4XQWA 2F6BA
chains in the Genus database with same CATH superfamily
1VLNA 2JENA 2XJQA 1VAVA 4XJUA 1VMHA 4Q29A 1NZCA 2PHWA 2VL4A 4XJ8A 1OSGA 1KQRA 4JRLA 3WW1A 3E1F1 2FDJA 3ZYRA 3SCFA 1C8M2 2QCSB 4JCKA 2A73B 2VOKA 5KHGA 2NQYA 3RFRA 5JMCA 3JBG2 3WT3A 2IXIA 1DZTA 4K21A 4CP2A 1HRV3 4C90A 2QNKA 5CFCA 1Q56A 4JGYB 1F9KA 2PMWB 4RQPA 3S30A 3ZN6A 4XFHA 3VZNA 2VMDA 4YGBA 1KJRA 4OHYA 2JB4A 4XC9A 2ZHNA 3AYAA 2ZZQA 3H50A 2JDNA 4YGCA 4AQTA 1YUDA 3M4FA 2GC0A 2FZ1A 1NCQC 3I3EA 1MEC3 1W2NA 2E63A 1FATA 3TB0A 3L9JT 3ZLIA 1Y4WA 2XKOA 1E5SA 3TRSB 1IS6A 1S0CA 4NHKA 4LE3A 1IQDC 1VBE2 2VH9A 3MIHA 5C4WA 3WW3A 5BNOB 1RUG1 5IK7A 2ZHMA 3ZIWA 1UMZA 2P5BA 2DVBA 3U1XA 2GH2A 2W46A 2QJVA 3N7KA 3GZUC 4N53C 1MQTC 1LGNA 1JH5A 2BVBA 4QX3A 4XEZA 2Q4SA 4QXCA 5C5TA 4MGTA 3I3DA 2XB6C 1WD4A 1GWKA 1ZZCA 2WAAA 3W58A 1AR83 1F35A 1H8TA 2B5HA 1IQAA 1MS5A 2RVAA 2YYOA 1H2KA 1CQ9A 4KBZA 3H8UA 3POBA 2HKXA 4KG0A 3UJOA 5HPOA 1JUHA 2R0FA 3MHZA 4XIOA 2P1BA 1HN1A 3PVBB 4UBHA 1YO8A 1TME2 4FTEA 1Q8QA 5APAA 1QEXA 3AKQA 1YFUA 5ACA3 4K8RB 4I02A 3UKVA 1TQ5A 4HANA 1CIYA 3UKNA 4FPHA 4B7KA 2X10A 5A3LA 3H9AA 1BCXA 1RIRA 2C6SA 1OBNA 1WBLA 2HWC2 1UYZA 3GJBA 1NCQB 4KU8A 3CO2A 1C8NA 3NAPC 4HOOA 1FT9A 1JODA 1W9SA 3ILNA 2A5ZA 3WCSA 3ETQA 4CA9A 2XJPA 3JQXA 4DQAA 5A7SA 2GDFA 4CRQA 1IPKA 2ZACA 5FZ4A 3N7JA 2WT2A 4A42A 3JXSA 4Q0VA 2VW1A 4JGYA 1QJEA 4DINB 1MQTB 3B3QE 5IW0A 4DXRA 1U5YA 1UCXA 2CDPA 5FZ3A 1S2BA 2E51A 2Y64A 4GKYA 1XE8A 3RZHA 1PVXA 3GALA 5C8CC 3M70A 1DGWA 3F95A 3P5BA 5L73A 1US2A 2UURA 1R083 2GH8A 2W0XA 4AVBA 1GQPA 2KXLA 1N47A 1NOVA 2RM22 4AHZA 1NT0A 4B4QA 3BTAA 2B39A 3RDIA 1HQWA 4H3WA 3HT2A 5BNOA 4Y4RA 2RDRA 2QKDA 3N9MA 3BN6A 5DPNA 2CY6A 3VDAA 4QPYA 2BNMA 4KWJA 4PIXA 4AI9A 4R4XA 4JHZA 5K9YA 1GV9A 3NNJA 3URFA 5CFDB 5ISLA 3T0BA 1LECA 3ACGA 1MZ6A 4Y26A 1K42A 1HIXA 1VRBA 2P6HA 2PFWA 1YWKA 3HPNA 3LPGA 3M3IA 4I0BA 4OHVA 1UKGA 5A7WB 3H8XA 1LNSA 1FOD2 1FMD2 1UY0A 2YU1A 3HJRA 3NSTA 3E5QA 1V6KA 3OF1A 2LUWA 1VPHA 4RGGA 2QQLA 1MS8A 4QPIC 2D98A 4OLLA 3I2JA 3K3NA 4IE7A 4GB31 1NA1B 4CDXC 4ITCA 1UY3A 5C3SA 5A1FA 1SG3A 2XUMA 5EYXA 4UFKA 3RQ0A 1FV3A 4CUAA 2ZGNA 5LA1A 4YFWA 4YW6A 1AL23 1Y43B 3GCWA 4AEDB 3BI3A 4ORFA 1KDMA 1ZRRA 2O0OA 4QX0A 3ZXDA 3AP9A 3AZWA 5FUPA 1REDA 3W20A 5L19A 5BNNA 1CAUB 3B5LB 5DUUA 2J1VA 5JR2A 3POSA 2YV8A 1MQTA 3VV1A 3JZVA 4ISQA 1VBB2 3ZMOA 1YXWA 5FYMA 3PJYA 3HWJA 4PLNA 4UFLA 5FZCA 5EP9A 1NLSA 4UFHA 3BU7A 5DAWA 3KM5A 3ABZA 5K4LA 5CISA 5EYYA 5A32B 1ENSA 1PHMA 1AR73 1QJY1 1XYNA 4COUA 5FPXA 4AHWA 2O14A 1OA3A 3T2TA 1LKNA 4BYYA 1IS4A 2NPIA 5EJ1B 1PMIA 5A7OA 5E16A 4QPGC 1PVC1 4Q4V2 4KQ7A 3ZYHA 3ZR5A 2GALA 4A7KA 5CFDA 3AP5A 1JYXA 2FDKA 1SACA 3CF6E 3J7HA 1RHI3 5EHDA 2ZGSA 4CEYC 5BXXA 3VHRA 5A7WA 3WDUA 4EJRA 1C3HA 3R6SA 4D0QA 1VE0A 3LQCA 2YHJA 4MXVA 3N9PA 4NPMA 1WCSA 4ZZ5A 1I3HA 4DUXA 1BVVA 1MS1A 1W8UA 2W47A 3CJIB 4DNYA 1EUUA 4Y5Z0 5F3GA 1D4M2 1O5LA 2GC1A 4ARYA 3E6DA 3LSEA 4Z1VA 1O5UA 1BVP1 2XUEA 2XJTA 1HXS2 3HBKA 3OUIA 1NA1A 1OD3A 1X7NA 2XOMA 2ZX2A 4IEQA 5ABJB 3U4XA 3FHQA 4CDWC 4SBVA 5DAXA 3UK9A 4IGQA 1C5HA 1RUE1 2JD9A 3ES4A 2O1QA 3DPRC 3OEAA 1UOJA 1GFF2 2WRAA 4W50A 3WX5A 1CAXB 1COV1 1QOTA 2OVUA 4JC1A 4K9SA 3S0MA 4PCRA 2CWSA 2ILMA 2VZ1A 3AB0A 5DMYA 3R4DB 4P02B 2WA3A 4AEDA 4QXBA 3KT1A 4UW5A 1O8PA 4LHLA 5FP7A 2LRPA 2Y33A 5JR7B 3CQOA 5FZOB 1HV0A 4B1MA 1GNZA 1O4ZA 1R1A2 3I8TA 2N7GA 2DVFA 1CAUA 2JECA 2MHFA 4O7XA 3BPSA 3FWEA 4GZ9A 2PAKA 3FC0A 3SCHA 4QQHA 5GZDA 2VBDA 2ES3A 5FYTA 4CEYB 1UYPA 5FZEA 1X9PA 2WWSA 1R092 3IDCB 3AXDA 3KS7A 5L36A 1W05A 2ZJCA 4H7MA 3AMHA 2RJ2A 3IDBB 3HBZA 4IEYA 1O3TA 3B01A 3UV9A 4JKMA 3V0BB 1S2EA 3OUHA 4XF1A 5BPXA 4H14A 5A32A 2ZPXA 4NWVA 4URAA 1F4AA 5FPAA 2DBIA 1PGW2 1RUE3 4OULA 4AVTA 5LZ6A 1NQDA 4N43C 4UFJA 4YZ1A 1FPN2 4NJ4A 3VHPA 5FP8A 1UD1A 4XDPA 4QB6A 4UW6A 2R071 1NUKA 4BH9A 4LO7A 4BK5A 2BUKA 3C7EA 4G3YC 2VO5A 5CU1A 2E7TA 2ZKNA 3LDBA 1UZWA 2PYTA 4LHSA 3C7GA 1JTZX 1DZQA 3CJIA 1SPPB 1NKGA 3H1MA 4AVSA 4AFBA 2VVDA 1IKQA 4AVVA 4PF1A 4W4ZA 4XFIA 5A6ZA 3WDXA 4GALA 1UYXA 5A33A 2FBEA 1QF3A 5E89A 5B2GB 2EIEA 2XHNA 4CDQB 2DUPA 3NO8A 4KWLA 5ABJA 1SLAA 2TEPA 2HWE3 4DIQA 1GP6A 3QLQA 1HQNA 3U10A 3MUY1 1MZ5A 2D3SA 5IVYA 4YW5A 1UOGA 5FMOL 1CAXA 2Q0AA 4L97A 3FN9A 4Q1PA 1BZWA 3PL0A 3MEPA 2J1TA 4R8HA 1J59A 2QZ3A 2GN7A 1YLLA 2W52A 2X05A 2R073 2WR9A 4IESA 5FZOA 5T54A 4PIZA 1OMIA 1W03A 2JKBA 2PHDA 3S7EA 4LBQB 1GUIA 1HV1A 3L2YA 3MF6A 1EAH2 3VUOA 3TEZA 4CXWA 3RZMA 3KVBA 4NWWA 1AVBA 5EJ3A 4XTMA 1GLHA 4HSJA 5FOJB 3GF6A 4QB2A 4Z82A 5H9PA 4XUQA 1OVPA 5FFOC 3P1IA 3V0BA 1AYM1 1ZM1A 1LOFC 1N3PA 3B02A 1OFNA 4Q4Y1 1H0BA 3JU9A 3U14A 4LE4A 2QUOA 3T0DA 4OHZA 3ZFEC 1W8NA 1LOCA 2YMZA 3M3QA 5F2SA 4Y1YA 3VHNA 2WWJA 1VMFA 3AX4A 1Q8OA 3WNLA 3EHKA 1LOEA 4BA6A 4ZZ8A 3QBQA 3LSDA 5BNPB 5JZGB 1LJ7A 1NCRB 1U0AA 3WDYA 1U5ZA 5I0TA 4BXSV 1OXCA 1S0FA 2V09A 2WS93 4ZS2A 4DUWA 1JYIA 1ZBE2 1WCKA 3LEMA 5CADA 3DL3A 3UT0A 1SPPA 4PLMA 1IG0A 4ZXKA 4B7EA 4EZHA 1MZFA 1S0IA 3WINE 2OW4A 3CU7A 3RZGA 1UOBA 3OCPA 2P3IA 2JG9B 3MGUA 4S2HA 4D7SA 4XXPA 2WL1A 1SBDA 3BCWA 4CP9B 1BEV3 4CDQA 4JDMA 3MPPG 1YFXA 4MGKE 4AQSA 1V6MA 4J1XA 1LOGA 1VAKA 1AYM3 3TNQA 3HNYM 3ILFA 2WC2A 3H3LA 1N3QA 1RUD2 2GAUA 5KBFA 4Q4Y3 5T3NA 1XPWA 1OH3A 3AP7A 4HPKB 2HWB1 4P5HA 4RGAA 4AEJA 2A71A 2BPA2 1J1LA 2G9ZA 4BOWA 1VMJA 1G6NA 4QWNA 1W90A 4V2VA 1OF3A 1AXZA 2V72A 4LBQA 3ZSJA 2YC0A 1JXNA 2XBO1 3LA7A 3LOBA 3WHTA 2QVSB 4EN9B 2ARCA 4DPNA 3R4UA 2JXAA 5LK7B 4CYDA 4CUCA 3KGZA 4JQTA 3THTA 1IPSA 1EV11 2W5FA 2A6YA 4I3PA 2VMCA 4AWDA 4D6SA 1I5PA 1MVEA 1QJX2 2PHXA 4FI9A 1ULDA 4ASLA 3LB9A 1MVQA 1V6IA 2J1RA 4N9HA 4Q5OA 2DBNA 3LD8A 1E5IA 4LHNA 1LCLA 5D21A 5GALA 5KHHA 2Y6GA 5CG9A 4FXGB 4NE9A 4LIUA 2VOXA 3NV3A 3JB8A 3PUQA 5A3OA 3UGGA 4M0HA 3VKMA 3ZM8A 1TZOA 3FUOA 4FOQA 3PTYA 2VZ3A 5DDJ1 2CGOA 3RJRA 2JX9A 3J4UH 2Q1FA 4A2UA 4DEVA 3CMGA 2JG8C 2A6XA 4OUEA 5FREA 2WJSA 3WP6A 2HWB3 1G9BA 1PM4A 1J3QA 3LIHA 2LALA 1NCRA 5FYCA 4Z2AA 5BNPA 5JZGA 3WQBA 3VBFC 4GKXA 5FPZA 1OLRA 2QQOA 3I7DA 5H9RA 5FKCA 1A6CA 4P14A 1RUJ1 2ORXA 3Q8FA 4I2OA 4Q4W3 3KCXA 4KNCA 4LKSA 1NX9A 2JG9A 1VRH3 4CP9A 1EV13 1JI6A 4R4ZA 3AVRA 1XNTA 1W6PB 2KM2A 5F32A 3WDTA 3ZFFC 3GJAA 3FX3A 3PU8A 1RUF3 5FO7B 1GNYA 1WMXA 4XJZA 1J84A 2W9XA 2NLRA 4HPKA 1JOBA 4ZU4A 5JOYA 3KMHA 1V6NA 1HRV2 4NPLA 2WZ8A 4ZS3A 1VR3A 4MADA 4EN0A 2WFPA 2VW0A 3D3AA 2JICA 3MI8A 2XWJB 3POJA 4LO8A 1GZCA 4GWNA 2ZXQA 1KRIA 3SNMA 3LEGA 5KC6A 1KD7A 1SMVA 1UQXA 1GNHA 1OA2A 2X53S 5FBJA 1MEC2 2GMEA 3O1PA 1O7FA 5I8TA 2ADDA 4QDRA 4RYDA 1RUJ3 4LEJA 1JZ2A 2V5DA 3JD71 2VECA 5JXJA 1F15A 2FQPA 2YC4A 4L2NA 5LEKA 5E6HA 1KXGA 3K4ZA 1PX3A 4XAAA 3OPWA 2IXCA 1AX1A 3CZUA 3LPFA 5FQ0B 3LGRA 4HXCA 5FY1A 4AXOA 2IUWA 4YW3A 1S1AA 3NKGA 3S7IA 1DU3D 4QKFA 5J7MA 1G9CA 3GZAA 5C3RA 1WGPA 2EXJA 1POV1 3KT4A 4JDNA 3QH7A 2UU8A 2D97A 3KVAA 2QE3A 1AR82 3LA2A 5CB7A 4XE9A 5T52A 1IGOA 3ZFFB 4BCUA 2HWF3 1VBA3 4Y22B 5GLWA 1QKQA 3ZXLA 2F17A 4QKNA 1ZBA3 3VBOC 4B4PA 4SLIA 4YWAA 5FZHA 5HCBA 4EE2A 3OG2A 1TNFA 5F6KA 3MBWA 1NY72 1O4YA 2WFF2 4ET7A 3RZKA 3O1MA 4FBFA 5ACA2 4IEVA 5GZGA 2R16A 5KXBA 2GP3A 4YVSB 4XFCA 5C5UA 1W6PA 3JD73 2YXSA 2RDSA 5LWBA 1YQ6A 2XWBB 3GXUA 1OA4A 2O8QA 3JQWA 4E4ZA 3ZDVA 1H4GA 3ST7A 2CAUA 1AYN1 2RS32 1ZRIA 2RS51 1AL0G 1DQ1A 1MS3A 2ATFA 2RMU2 3Q8AA 4X8NA 4L92A 2W39A 3WHUA 4BQWA 1YQ5A 5IVEA 3JB4C 3RYKA 5HCFA 4LBLA 1W6NB 2QFEA 5JXHA 4GULA 5F39A 4BIFA 3PMEA 4CCJA 5C70A 2YY1A 5F5AA 3RJ2X 4QM8A 4RA0A 2A6VA 5LA0A 4UI9L 2YC2A 2E33A 2WZPP 1AF9A 2AH2A 4LK6A 1WCQA 1R082 1UY4A 2EIDA 5H9SA 3WCRA 4QXKA 4XZUG 2WO3A 3WDWA 4COYA 5FMCA 5FYYA 4FXKB 4YG6A 3WNKA 2D6PA 1W04A 4J25A 4W6YA 4WM8B 5CFCC 2HH9A 3RZLA 1US3A 4RQPC 1UMIA 4KMQA 1SBEA 2OUHA 4CXYA 2DCZA 2HBTA 2MEV1 1WW4A 3UJQA 4F83A 1ZNPA 2CDOA 1AYN3 2RS53 3EB7A 3TYJA 2W95A 4YFZA 1G9AA 1RUOA 4PHZA 1TG7A 3KLSA 3CKHA 3ZFFA 4AFCA 5FZ7A 4BK4A 3BKZA 2VU9A 2ZMLA 3HQRA 3VDCA 1GYKA 1CAWB 3EJKA 4Y22A 1JUIA 4Y4YA 3ZSMA 1K12A 5C4WC 4IGPA 4EN8B 4IETA 3X29B 1DHKB 4FPFA 2QQJA 1X33A 4D7YA 2VQAA 4K8FA 3I3QA 3IIAA 5LCWL 1O3RA 4FPEA 3KT7A 3T09A 3ZXFA 4UXAA 2SLIA 4YVSA 5GLUA 1OQ1A 5CYYA 4DOUA 1ENRA 3E97A 2UY9A 2WWUA 1PMJX 2CU5A 2ZS6B 4CXXA 5IVFA 1OOPB 1H8TC 1W2UA 2XGXA 1OURA 1AL22 4XILA 2YBKA 4JGZA 3U4SA 1Q3EA 3HQXA 1OLQA 1U12A 3VBHB 1Z7S1 3AMMA 4PBOA 1EP0A 2VZQA 2B9VA 2HWD1 1H6YA 2RS11 2MEV3 2ZEZA 4QU1A 4Z8BA 4K1ZA 1AXYA 2D6KA 1BXHA 3NV4A 5A3TA 1W6NA 3VD5A 3VBUB 2VTFA 3SEEA 3WG3A 4QHZA 2QQPA 4BMEA 3TBDA 2CL2A 2WABA 3KD4A 3HR9A 3T4HB 2IXKA 2JDYA 5FY8A 4BU2A 5JWPA 2JJ6A 3AL5A 5DABA 1DG6A 2CGNA 4XQDA 1UAIA 3O7OA 1QJU3 2ZTNA 3LFMA 3O1UA 2VNRA 1AR72 2HYKA 2OIIA 3NJXA 2AEZA 3P6BA 5GLVA 3PUIA 3AXEA 1VBC1 1VIWB 3MFCA 3R05A 4W6XA 4BQ2A 2VZSA 4WM8A 2PHUA 4YM0A 2DTWA 1GBGA 3C7FA 4JGYC 2QQMA 2Q30A 3O5SA 4CCMA 4NPRA 1RHI2 4R9CA 1CJDA 1H9WA 5IYYA 4AFDA 1C57A 2PELA 4S2GA 3I54A 3GBWA 1H2NA 1Z7S3 2WNUB 4P00B 5IHRA 4PF5A 3T1LA 3J8F2 4L99A 3MIFA 1W06A 3NNFA 5FKBA 1CAWA 1SFYA 4AGVA 2WN2A 2VR4A 1RUH3 3HT1A 4XW3A 4LUMA 2PTMA 2RR12 3B9IA 2WBKA 4M0NA 2P3JA 3RZZA 3I2GA 5DUWA 4CUBA 1ULFA 3WNXA 3N35A 2VBBA 2R042 4JVAA 4MO3M 4AQ6A 3GHNA 1XNDA 3K48A 3PUAA 3VZMA 2DVAA 3I2FA 1VBC3 1WUVA 5FZ1A 2EALA 4MVTA 2VNVA 1OOPA 4DRVA 1W39A 2BGCA 4NHLA 3WUCA 1JBCA 3I3MA 1IOAA 4Q4X3 3POYA 4FPGA 2JDMA 3U11A 2VMGA 3VBHA 1XOYA 4M4RA 1H2MA 2R0HA 5IK4A 2BERA 4XACA 5EZWA 2P6CA 5DG1A 4DUVA 3VBUA 4NRPA 3OUJA 4YLZA 5DZEA 1O3QA 2DCTA 5FJHA 4PIYA 4TYSA 5FP4A 3WP3A 4TTGA 5FZAA 1UF2C 2Z79A 4OUMA 4IQPA 3FLRA 3OPTA 2FD8A 1REFA 3POEA 1T6BX 2VTXJ 1K5JA 3TWIA 3POWA 1V00A 1M06G 1YFYA 2OX0A 2D3RA 3SITA 1W6QA 4WZFA 2W68A 5BNNC 2PLV1 1OPOA 4YW1A 4HFSA 3H7JA 4XF3A 4NRMA 3WEZA 2Y6LA 1DDLA 2ZX0A 1JYNA 4HKOA 1V6OA 3RVHA 1VAMA 2ZX1A 2ZZJA 2VZTA 4I30A 2W1WA 4L9BA 5DQ0A 3B94A 3HNMA 2WNUA 3PUSA 5DZFA 3AVSA 4XABA 3NV1A 1BMV1 2UWBA 3B7MA 4M3CA 2AACA 5FZGA 3BTZA 2VQ0A 4J6GA 5FYUA 4Z2WA 3WP5A 1LULA 4Y5TA 5CFDC 5GZCA 3T2PA 2HWE2 4HKLA 3BIWE 2WUHA 3M3OA 3D0SA 2OZ6A 4BQXA 1RVF2 4DXTA 2C9KA 3MW3A 2CNAA 4P9JA 1PGL1 2AENA 3OGRA 4K3UA 3OGVA 4FPJA 1RUG3 4P5YA 4CSWA 5JSRA 4CE8A 2ZOEB 2PLV3 3NNMA 3IM0A 3N9OA 3ZYIB 5G05L 4FPKA 5FWEA 2XJSA 4QX1A 3ZX7A 3FLPA 2BZDA 4AW7A 3WD5A 4HZFA 5EFUA 1NA1C 5BNNB 1LRHA 1VBD2 3OGJA 3CZJA 4ZONA 4FOYA 4XJWA 3ZPYA 1PIV1 3UYJA 2BVVA 4MXWB 5FY7A 3JCIA 4URTA 3H8OA 1H1IA 4OZOA 3NNLA 4NIDA 1QH6A 1M4WA 4UFIA 5JXIA 3O1TA 4BXFA 2JDPA 3MIEA 5T55A 5AFBA 1DQ6A 2DYCA 4KL1A 3LEKA 3ETPA 3B00A 4AEDC 3U0ZA 1KITA 4NAOA 2ORZA 5C33A 4LTAA 5FY4A 4LK7A 4IE4A 1L7LA 2IXLA 4IXLA 2AUYA 1LB2A 4AHXA 1YIFA 1QHDA 3T08A 1G8WA 3UGFA 2QQNA 5IFTA 4CVUA 4XDOA 5CKMA 5I8SA 4LXLA 5A1AA 3IB3A 2W3JA 3NVCA 4LNVA 2P37A 1V9U1 3PURA 4QKDA 4CCDA 3MW4A 4FOVA 2QQWA 5LB6A 3MV01 4KWKA 2WS92 3I2KA 3WF3A 2XXZA 1OKOA 1V6LA 1LHVA 3AZZA 1OUXA 3C2UA 3N9QA 5ANNA 3VD3A 2D40A 4AEMA 3D8CA 2ZHKA 1GZWB 1PIV3 2XJVA 1RMU1 2EIGA 3TN91 2IC1A 1ASJ2 1VJ2A 2Q1ZB 1BLZA 2TNFA 1PGSA 2KR2A 2VUAA 3K3OA 4HETA 1BEV2 1ULPA 2A1XA 3ILRA 5FYVA 1YYNA 4AAXA 5A1LA 1SLCA 5I93A 3LIGA 1HLCA 2VJXA 4OMDA 2DF7A 2X5IC 3USSA 5JDBA 1DP0A 1GP4A 3CJIC 1W0OA 2CTVA 2OQ6A 4JHTA 1LEDA 1UIJA 2VNGA 2ZKLA 4YYOA 4PBPA 4OI0A 1QNYA 1QQP2 3OTFA 1V9U3 3LE0A 2K2SA 1KS5A 2BTVC 5IVVA 2XLFA 4BQ1A 5ABJC 4S2DA 4XIKA 1XRUA 3A22A 4MXWA 4QHOA 5BY5A 2EXKA 4AG4A 2ZGLA 2QQVA 4LA3A 3LA3A 1K45A 4S2FA 3BGAA 3TN93 4GAZA 5FXXA 3ZXGA 2DCYA 2VQUA 3IAPA 4AR2A 4TZDA 4LBQD 2VULA 1D0GA 4GB33 3UL2A 1RUC2 2BJSA 2XVGA 2WN3A 1WLCA 3MLKA 3ZN5A 3J7LA 2VPVA 5IFPA 4A3XA 3OGGA 4GH4A 2UY8A 1APNA 3ITQA 1CZTA 1WMEA 3MDPA 3SLIA 1UZZA 2Y6KA 1JN2P 1DZRA 3W59A 3MW2A 4A7ZA 3FLTA 1A34A 3AZXA 4FAHA 1YIPA 1W9WA 2DTYA 4IEPA 1KDKA 4RHV1 3MFAA 1ND2B 1W2OA 2G1MA 4YGEA 1NXMA 2X5IB 4HKWA 1PX4A 3PVEA 4Q4W2 3PJQA 1GZWA 3E5UA 1IZ3A 3LWCA 3Q8EA 3OGSA 4Y1UA 5A33B 1J1TA 1VRH2 1EYBA 1FYUA 2R062 3I59B 1QMJA 4IERA 3ZSKA 1ZX5A 3V0AB 3U78A 3GNEA 1C8M1 5FZKA 2FCTA 3NJVA 1AX2A 1HRI2 1RUF2 2IFRA 3JBG1 5FR3A 1QJY3 1ODMA 2VCAA 4LKDA 4LOTA 3FL7A 2JWPA 5J1XA 1PVC3 5IUQA 3LKJA 4P9LA 1QWRA 1QXJA 1XXNA 5EWSA 1WBFA 4E9KA 1JZ3A 3TEWA 1LU2A 4IV3B 5FP3A 1OH4A 3ZSEA 3WG2A 1VB4A 3OOXA 1V0AA 4CDQC 4UT5A 3K51A 4YZ3A 3WP4A 3R4SA 4I0WB 1VBE1 3ZKYA 2ADEA 4CEWB 2Z42A 3MICA 2UYAA 2MNGA 4A7YA 1PM7A 1L7QA 2Q1MA 3RS6A 1H1AA 1PO22 2OQ7A 2BWCA 5FOBB 1UY1A 3VKFC 3IPVB 2ZGUA 2JE7A 3DYMA 3NV2A 4COWA 3VBSA 3CIHA 3N7LA 2VZRA 3JBG3 1COV3 3THCA 5HI0A 3K4DA 4A6OA 1PNGA 4KBBA 2HWF2 2YB7A 1VBA2 4XFBA 5CBLA 1I9RA 1ND2A 1ZBA2 2IXJA 1W6MB 1TME1 2X5IA 4QGNA 3TNPB 2WA4A 5J96B 5C71A 2HBUA 4XAEA 2ZGPA 1LGCA 1KS4A 4QM9A 1XNBA 1VBE3 1UN1A 3FFQA 2HWC1 3I59A 4E4DX 2A70A 1XBFA 2E53A 3ECQA 3Q9OA 4Q27A 4ASMB 5KXDA 2J1EA 3V0AA 4NO4A 2XJUA 3GBGA 2PN5A 5BNPC 2UYBA 1NCRC 4QKBA 3PVOA 1LENA 5JZGC 4FSJA 5JOXA 4BISA 1GQHA 1I5ZA 5H9QA 1FX5A 1SLBA 1IG3A 1POV0 3WV6A 2VZPA 1GOFA 4PT6A 3J7NA 5CIRA 4AF9A 2A3WA 4TN7A 5LRRA 3ZYGA 2Y38A 4XBNA 3ZYJB 4B4RA 3OBAA 4IV3A 2JG9C 1MPXA 2OZJA 3G7DA 4NUBA 5HV4A 2P4EA 4XZPA 5DG2A 2PHFA 4V1PA 3K77A 3ENRA 1WMFA 3IWZA 2UWAA 2RM21 4O61A 1Y3TA 2JKXA 3H0OA 5A6QA 1H1MA 1RGSA 2VAUA 5JOZA 5FV3A 4MH0E 3NJZA 2VGDA 1QIQA 2ZGQA 1TMF2 3RWKX 1XC6A 4CEWA 1SEFA 2OUJA 3NMBA 3Q8BA 1XNAA 2R49A 1POQA 3AYDA 3ES1A 2HWC3 3IPVA 5KXEA 4RR3B 5JSOA 1XB9A 3M3EA 1FOD1 1FMD1 3D5OA 4KGGA 4D6QA 4CP1A 1REEA 2PA7A 1H4HA 1JOPA 1ZZ9A 2F6BA 5AC92 1SDDB 2GU9A 4QX8A 3AKRA 3QD6A 4WZCA 4NVPA 3A7QA 2C5DA 3PDQA 1F5FA 4M01A 1W6MA 3ZYFA 4AHYA 1RUI2 4HSLA 3WG1A 2WYFA 4Q0UA 4QX2A 4WBBA 5JI9A 2VC9A 2WZR2 3BB6A 1BHGA 1PO12 1ZYBA 2B9UA 2RM23 4P08A 3POFA 2AYHA 3WLUA 4NAMA 5GJ6A 1Y7BA 2FCVA 1SFPA 4Q8LA 1X36A 4YG3A 1W3VA 5FUNA 1B35B 1Y9GA 4Z92B 1N1YA 3I49A 4AEKA 1F4HA 2ID4A 4WVWA 2NYYA 2BYVE 4LLFA 2E7QA 4WVVA 2I07B 4NMIA 4CDUB 4NROA 2Y6JA 3K75B 1FOD3 1P8JA 1FMD3 3ORJA 5IAVA 3FHIB 4Q8KA 3OEBA 2H0VA 1VBB1 3QOPA 4OI1A 1ZA7A 3ROUA 2FZ2A 4AVAA 2GMMA 4XYXA 3HD8B 1AR92 2W1SA 4ZXEA 4AOCA 1DGLA 4CPBA 3EO6A 4GMP1 4OI2A 3M3CA 2NZ9A 2W2IA 4FQ4A 1W28A 3VD7A 4NR1A 4QX7A 4R52A 5GKAC 3RWNA 1K5MB 2OXBA 2RJKA 1BK1A 1GP5A 4H55A 1QJU2 1SLTA 2D43A 3DXTA 5CKNA 2W87A 5DZGA 2CV6A 2EA7A 4Q4V1 2VXJA 1CPNA 1JHNA 1Q43A 4P9IA 3D0JA 5A3UA 2BOIA 1RITA 5TSWA 4QD2A 4ARXA 5D8AB 5FZBA 5EXOA 1RXGA 1W2TA 4RR3A 2GP5A 3E5XA 4LORA 2J22A 5F8PA 3ZYBA 4CP0A 3O1RA 2NM1A 1H30A 5C9AB 2VUDA 4EWDA 1W2AX 2ZBJA 3WVJA 2CWMA 1D4M1 1T2XA 1BBT2 1AXKA 2J1UA 4IEXA 1ONAA 1CN1A 4QX5A 5FYZA 4DMIA 1AR62 1RXFA 1VBB3 3EQEA 3VZOA 1HXS1 2C26A 4ONUA 4WVZA 4LOSA 3VZKA 1ZA4A 4BB3A 3AMQA 1RUH2 4LR4A 1F31A 4XCBA 5FCCA 2YDEA 3PLQA 3BIEA 4DO0A 1UXXX 2DWRA 1NXD1 3UKTA 4N7IA 2QDNA 2XBO3 4XUNA 2Y0IA 5JIUA 4DFSA 4FT8A 1GWMA 3D6EA 4ZU5A 3FUQA 1QOOA 2NP0A 3RMYA 5JVVA 4Q4V3 1B35A 1WA4A 1CD3G 2BV4A 4AQ2A 1O59A 1GMMA 1GANA 1QDCA 1ZZBA 3KF5A 3KHBA 1R1A1 3CEWA 4FQZA 3AMNA 4L0PA 4Q4X2 4AI1A 4ATFA 4G9SB 5FYHA 3WQ7A 4CDUA 1UOFA 4XPVA 4YW7A 3AYCA 3IKWA 1JW6A 3KQRA 5J48A 2Y8KA 1YJLA 5DDJ3 3VHOA 1D4M3 1VP6A 5AFEA 4Q1RA 4YM3A 1R091 2EXIA 4BWOA 3CLPA 3O0XA 2YGLA 4YVSC 3B69A 5FUIA 5FYIA 3RRDA 1HXS3 3WF2A 4BZ4A 3VD9A 2D44A 3PNAA 2Z69A 4NHYA 4QB1A 3AYEA 1K5MA 4KH9A 3AP4A 2FMDA 4XQWA 4FTBA 4WVMB 2BP6A 5J3UA 1PGW1 4JGZC 5KR7A 2DU0A 2W94A 4XMAA 1SHWB 1FPN1 1MS9A 3A4UA 1LAJA 3DKQA 5EV7A 1ACCA 3ZSLA 3RI8A 5B4NA 2E31A 2X09A 3HIFA 3SCGA 3USUB 1CZSA 5D8AA 1STMA 5A7PA 2WO2A 2PHRA 2QQKA 3ZXKA 1ND3B 1OKQA 3F2ZA 4MHRA 1R1A3 5C9AA 2QTWB 2YFZA 4N90A 2QBXA 2FDGA 1H8VA 2BFUS 1D4VB 2BBVA 2J1AA 3BYWA 3OBRA 5T5JA 3V64A 3PIJA 1NG0A 2DFBA 4XETA 2R6QA 5FZ8A 4DXSA 1OHFA 4M3CE 2FDFA 1JZ4A 3E6CC 2ARBA 2ET1A 3VL9A 4F3JA 4WM8C 1O4TA 3PUHA 4U2AA 2JEMA 5FK7A 5FBZA 3T1MA 1MR5A 3A21A 4IGOA 2WNOA 1PZ9A 4A3ZA 3HNBM 3RGBA 4EWEA 3BPZA 2NMNA 2P3YA 3ACFA 3POGA 2A6ZA 3NQHA 2R1DA 4XFAA 2DU1A 3PTRB 3WF1A 2WNEA 5LY1A 3MPBA 2Q8CA 1S2KA 1RUG2 3ZR6A 2XQRA 4EN6B 4JGZB 5DXDA 3O1SA 3LCPA 5SV5A 1I1EA 1EAH1 3LAGA 1Q8SA 1POV3 5T5OA 2R30A 5F5QA 2D5HA 1SBFA 1U5IA 5A3MA 4XQ4A 4GA9A 3DECA 2O8OA 4P9WA 1H6XA 4IW3A 4E4HA 1OOPC 3WW2A 1CR7A 1W8WA 1OVSA 4IV1B 4WVMA 4OQ9A 3BTXA 1EPZA 2ZGTA 1CX4A 2A3YA 3VBHC 4FO9A 1XNKA 4FPOB 3I2IA 2OS2A 1GWLA 1E5HA 1HB3A 1PZ7A 2CHHA 2P3KA 4HVRA 4N8MA 3USUA 3VBUC 1X82A 3ACHA 2W1QA 3PU3A 4F7ZA 1ZBE1 1PNFA 3H3UA 3VKLA 5JPMB 1JZ5A 1ND3A 1CX1A 5FYSA 3SC7X 4OZXA 2X29A 2FMYA 4BIOA 4AI3A 1JYTA 2AGSA 2VZUA 1U5XA 1W9TA 4ATEA 1RJ8A 2V4AA 3CBNA 1EAH3 2OKXA 4C1WA 4PLOA 4C8DA 4EN7B 4WM7B 3PIGA 3NNGA 1D7PM 3ZVXA 2LROA 4CCOA 4V2WA 4AI2A 1R1ZA 2D93A 5CNAA 3AC0A 2CYFA 1DYOA 4PDWB 1RUD1 3INAA 4OI4A 4C91A 2BNNA 4P9XA 4NIIA 1IHMA 3IMNA 2BW8A 2WNUC 3BODA 3M2MA 4Y5SA 1UU5A 4YPJA 3WDVA 4CU7A 4O9EA 2RV9A 5HV0A 1MS4A 2WQZC 5FXWA 1ENQA 1W8HA 5A7NA 3ZXEA 1W0NA 1DYPA 4ZHNA 2XONA 3RG0A 4B3NA 1O8SA 4FCAA 2D6OX 2R32A 4IEOA 2V5YA 2D3PA 5KHKA 1WCUA 2VW2A 3SH3A 1QJX1 1J3PA 1UU4A 4UFMA 3SKJE 1ZVFA 1EY2A 4MG2A 1C1LA 3AJYA 1RJ7A 1S0EA 2VM9A 2ZGOA 4JTOA 4UW4A 4D6RA 1G86A 1XU2A 1PK6B 3EYPA 4GWMA 4HG6B 4UYBA 1YCIA 3IN9A 4GB32 1CVNA 5A70A 4XFGA 2YBPA 4IV1A 2QQIA 2E26A 2B4KA 1S55A 3VBRB 1SCRA 5CZKA 4C1XA 1Q5OA 1YQCA 1W6QB 1LU1A 1RUD3 1AJKA 3DXUA 4HN0A 5FZIA 2XPJA 3N9NA 5L7OB 1ZZ6A 2JD4A 1UY2A 5DAPA 3OY8B 2DUOA 2Q8EA 3VD4A 5IAXA 3VB9A 3K4AA 3H42B 2VOWA 4TSVA 4FFHA 4XXAA 5EJZB 1LR5A 4W8JA 4BLJA 1OT5A 1HB1A 3LZZA 2EAAA 5F7UA 4YVWB 1XYOA 2HWD3 3THPA 2RS13 4U36A 4LITA 3FZ3A 1ENXA 4M3CB 4WM7A 2K9ZA 3T4VA 4RGKA 3PVNA 1QJX3 2ETEA 1UWWA 3L2HA 4AGGA 5FZMA 2ZAHA 1QJFA 5L9VA 2DCKA 2ZABA 3ACLA 3V65A 1XSRA 4XBLA 5LEJA 2DFCA 1UPSA 1V70A 1X50A 4PDWA 5FXZA 2CSGA 4C0BA 4FP2A 2VZVA 5F37A 3GZEA 1QJZA 4IDZA 2DVDA 1QJY2 1HRV1 2ZGMA 1QNWA 3H7YA 1UL9A 5GLZA 1RC6A 3O14A 4COZA 1DCSA 4MZUA 4AK3A 1KEXA 3H1YA 1PVC2 1ZRFA 2DUQA 2TUNA 2HEYF 4RFT0 4N9IA 1X8EA 5LBBA 4TLGA 3CNAA 1YQ8A 1UXZA 2B8MA 1PMHX 4OHXA 1W99A 1MEC1 3VGIA 3VZLA 1O3SA 3LEIA 1NQJA 2C0ZA 4Y1VA 3UESA 3EMRA 1UNBA 4COVA 2Y0OA 3O12A 1WW6A 2VCMA 2XLGA 3IMMA 1PK6A 1XQNA 3WQ0A 4FP3A 3I4IA 4OYUA 1YQ2A 4XJAA 1YJKA 5T5PA 2XQXA 2WO1A 2XL9A 4CCLA 4E4SA 4XVHA 4XTPA 2E9QA 2A75A 1AX0A 3DCQA 2KA3A 1DLCA 3VBRA 1F8VA 2VD7A 1RUE2 4KU7A 2FDHA 2EXHA 1H2LA 3NJYA 5FP9A 3IT8A 1AR81 2XG3A 1COV2 1EUTA 2XLAA 4K40A 4UOJA 5IATA 4CCEA 5L7OA 2P17A 4I3GA 1W8TA 3OY8A 5EQUA 1QY4A 1AJOA 5C3QA 3H8RA 4ISRA 4OUSA 3KCCA 3U75A 1NE6A 1SLIA 3FBYA 1NY71 4IEWA 4IE0A 3VKNA 1WLTA 2WFF1 2WNVB 5J37A 2EICA 4YVWA 2VOVA 3KB5A 5ACA1 5KC5A 3J7MA 3OJBA 2WQ4A 1JU4A 4E2GA 2YROA 3A0KA 2QDRA 1NLRA 2GNDA 2VY0A 4QGLA 4GH4C 4KG8A 1XSQA 3HVDA 3ZFGB 1LHUA 3NWKA 1C4RA 1WW5A 2JE8A 1F2NA 2RS31 3OD4A 5ERLA 2RMU1 2DVGA 1FI2A 2PXJA 4QT6A 3WNNA 2VMEA 5K8SA 4GQ7A 4YGDA 1AZDA 3DV8A 4QMAA 1N1VA 4LMFA 5LBEA 2YU2A 4Z07A 2VUJA 4ZPIA 5FWJA 4B8EA 3HEIA 2K0GA 3H1WA 2BNOA 4PJYA 4DB5A 3T2QA 1W9YA 1NZIA 2OPKA 4AI8A 2HYXA 4LIVA 3M1HA 2R072 2XL7A 1NAEA 3N9LA 4BPZA 5CEHA 1HDKA 2D6LX 2BEOA 1R081 1WLDA 4XOGA 1ZZ7A 4QGMA 5FIXA 2DURA 5IT6A 5A3NA 2WFF3 3UETA 3S57A 1BQPA 4ASKA 5A3PA 4QQOA 1GR3A 4RD7A 2FHRA 4EYUA 2RS33 1G9FA 5K0UC 2RMU3 2BOJA 1UX7A 2W08A 2ZMNA 3ASIA 4GWJA 1UMHA 1KFXL 3DF0A 4LQRA 1XU1A 3AKTA 2NN8A 4GH4B 4XHXA 1OPMA 5GZFA 4KGQA 4XF0A 4YW2A 3AZYA 4N53B 4HVOA 3I97A 4CZSA 1UU6A 4R9DA 1OC1A 3T2OA 2RDNA 3NW4A 3W9AA 5L9RA 1HW5A 4RSUA 2VVFA 1JMUB 1A78A 2ENRA 1OD5A 3WZ1A 2A6WA 2HJIA 2J7MA 2WNVA 5HCAA 4ZU7A 1OF4A 1K3IA 2JIGA 3FHAA 5FY0A 1B09A 4CCCA 4XUPA 1LESA 1TVGA 1OFSA 5BV6A 2DV9A 2OT7A 4Y33A 3VBSC 5DN2A 5IWFA 3ZFGA 3TEYA 3GHMA 1AL21 1N1SA 2JDKA 2Y60A 3AJZA 2XR4A 3WNPA 3VN4A 2GNBA 4R9AA 5I0UA 3UGHA 1AYM2 1Q8VA 1ND2C 4Q0SA 2ZEYA 4LA2A 4Q26A 4EWAA 3N4MA 4JRAA 1ALYA 4Q4Y2 2WIIB 4CCNA 4YZ5A 3AKSA 4AAPA 5KXCA 3NAPB 4HVQA 4C0HA 4LPLA 3DKWA 5K0UB 4W6WA 1CIWA 1NE4A 3E6BA 5FPLA 4Y20B 5FAXA 1ODNA 5JUVA 1AR71 1GZTA 1O6UA 2Z4FA 2BBAA 3U37A 4EZ4A 5FLJA 1W3XA 4B29A 2VG9A 1C1FA 5JXGA 1RMU3 1CONA 5A6XA 5F9TA 5C8CB 5KWRA 3DYOA 4CPBD 2NMOA 3MF9A 3KF3A 2ZX4A 3FE5A 2BWAA 3GGLA 1RHI1 1NCQA 3HMYA 4HMZA 5E1RA 3RYPA 5LBFA 1FV2A 2SBAA 4HBNA 4IV3C 4UW3A 4XURA 3RNSA 4IEUA 4OFGA 5FJKA 5FK8A 3VBSB 5KHJA 3J8F1 5HXVA 3APBA 3WNMA 5C3PA 1HJFA 2GMPA 2Q5TA 2G9FA 2JIJA 4YG0A 1ULCA 5AVPA 2YG0A 4N53A 2HWB2 2VMFA 3TAYA 4CEWC 1XJAA 2RR11 2RG4A 4GMP0 3KHCA 2EF6A 1JU3A 1S0DA 1X9TA 4HN1A 3KCYA 4NOTA 4A4AA 5FMBA 4MGYE 4YZ4A 2Y6HA 2KD7A 5LY2A 2R041 4LO4B 4LKFA 1WD3A 2XBO2 4RFRB 1OI6A 2BGPA 5JOWA 1WWYA 4QPIB 3R0RA 1EV12 1ULOA 2BQPA 3GZTB 2VTXA 1Z78A 2EVXA 2JDZA 1GKBA 4HK8A 1FXZA 4CDXB 3WNOA 5CG8A 2WLPA 3W21A 5IK8A 3OSDA 5FTTC 5FDBA 2VZOA 3ZDSA 4NIGA 2UWCA 2V4VA 5J98B 5F5CA 3RMXA 2C24A 2XMLA 1RTVA 3S5QA 2YUEA 3I3BA 3W5MA 5DDJ2 3J8F3 2ZA9A 4H2AA 3NAPA 3W5NA 4I09A 3CJXA 3I2OA 5K0UA 4BM8A 5K7PA 2R7EB 1UO9A 2F4PA 3WY6A 1JYVA 4HONA 2ZX3A 4Y20A 2RR13 1LGBA 4RHV3 3CHXA 4L11A 5F2WA 4ES9A 5JCTA 4GJYA 1A8MA 1IS5A 3GCXA 2GZWA 5FZLA 1RUJ2 2R043 5FYBA 4AGRA 4E27A 3WUDA 2WLQA 3IAQA 5C8CA 5FLIA 5LA9A 1IPJA 1OQDA 3ZIXA 2ZAAA 5LATA 5I0RA 4IUGA 4XJ9A 5FLHA 3N7MA 1CAVB 1VB2A 2LTNA 1BK0A 1C8M3 1W9FA 1XYPA 4BJ0A 2JB8A 3S6PA 4XF9A 4FVVA 4LHKA 4PI2A 4RL7A 5I8YA 1GOHA 3BALA 3BU0A 4QPGB 3ZPOA 4IL7A 4GD4A 4OVEA 3ON7A 3FFZA 4RN5A 2TBVA 4DS0A 2VE1A 1YEWA 4M4PA 4N7UA 2D7FA 2HEVF 5C6CA 1CJPA 2HWE1 3WR0A 4UBGA 5IJRA 2CGPA 3OYWB 5D2AA 4TWTA 5I0DA 3BUCA 1RVF1 2WSUA 4RR3C 3LFIA 3OB8A 5FRAA 2Q8OA 2B46X 3O1OA 4QPIA 2F4LA 1DGRA 3T3YA 1ZREA 3JD72 1IKPA 3AK0A 3ALQA 4X8PA 4HLTA 4AZZA 2AEYA 1Y9QA 4CDXA 3N36A 4AFAA 4L8QA 4CDWB 3QH6A 4AYUA 5GZEA 3WW4A 2Y6FA 3DPRB 5HBAA 2VXRA 3A23A 1TEIA 1VBD1 3MO4A 4MV2A 2VVEA 4QQPA 3WF0A 3O1VA 4D94A 4KWUA 4QQ2A 3CL1A 3MV11 2FCUA 3NL1A 2XJRA 3KQ4B 2WT0A 4LJHA 3QCWA 1WCDJ 2PQQA 3AKPA 4X6QB 3VL8A 4MOAA 4TXWA 4BQ3A 4EROA 1UZ0A 3FMGA 2WSVA 4FFIA 4G4FA 4QPWA 3AM2A 1B35C 5DAVA 1D2QA 3C7OA 1TME3 4GWIA 2QZ2A 4DXZA 5SV8A 2PHLA 5GM0A 2W92A 3LF7A 1RVF3 4Q0PA 2IVJA 4BQ4A 2XVKA 4CDUC 3SISA 1URXA 2IFWA 2C4XA 1MZEA 2VNOA 4YNIA 3J26N 3UNPA 4DRRA 5I91A 3KWVA 3WQ1A 4CU9A 1KFUL 4QHBA 1CAVA 1UX6A 1V6JA 3ZXJA 2WS91 1RUNA 5J36A 3RSJA 1LOBA 4FFFA 2BDRA 4LLOA 1AYN2 1RINA 2RS52 4LO6B 4O65A 4N43B 4QPGA 1VBD3 1XE7A 1L3JA 5DAQA 5FZ0A 5A6YA 1K5MC 1N1TA 3LOIA 2BGOA 4YARA 1ASJ1 4NHXA 5F3CA 1YNAA 3HN3A 3M8LA 3QACA 1BEV1 1WZXA 4LULA 3SH4A 4A44A 4CEYA 2VMHA 2GNMA 2WAOA 5T5LA 3NKTA 4AFMA 3OYWA 5D8AC 3T30A 2A7AA 3BOWA 3IDEA 3VZJA 1J83A 4FPLA 2ARAA 2MPFA 1G7YA 4MYEA 5C9AC 4Y1ZA 2BU9A 5FMOS 4K1YA 2AREA 1QQP1 2HEWF 4INDA 4UF0B 1YFWA 1JYCA 1HX6A 4YM2A 4CDWA 2LM3A 2YBSA 5B4XA 2PHTA 3AL6A 5FPUA 3M7AA 3ZOIA 3DPRA 2AZ5A 1S0BA 1SCSA 4LBMA 4CUGA 5F6LB 2H6CA 3SXWA 3B9CA 2MEV2 2Y26A 5AVAA 2LW8A 1JOJA 5JIAA 4XUTA 3G6JB 3JUUA 2A3XA 1ASJ3 1E5RA 5F1RA 1RL3A 1JZ8A 4XCAA 3ZN4A 3PHMA 2FDIA 5FZDA 5IVCA 1RUC1 1DIWA 1Z0HA 1GZ9A 1SQ4A 2IZWA 3KZ4C 1OLME 2I45A 1DQ0A 3DEMA 4O9GA 5A3WA 5IK5A 3GM8A 2WYSA 2ZGRA 4D69A 1I6XA 1HQLA 2G19A 1FNZA 5HCHA 1SFNA 2EAKA 4XUOA 4I0AA 3THDA 4E2SA 3RI9A 4MGIE 2CAVA 2JDUA 1QQP3 4IE5A 3ZXAC 5D1IA 5F3EA 1LHOA 5FXVA 5EIYB 1TE1B 4LO5B 4JV4A 1NYWA 2DCJA 2W91A 4CU8A 4EQVA 2E7AA 4N43A 4Q4W1 2D5FA 1Z7S2 2GNTA 3DGTA 3ZFEB 2HWD2 4BQYA 2RS12 5J09A 1LHNA 1YI7A 2W1UA 2YZ4A 2ZEXA 3DYPA 1VRH1 1LODA 3ACIA 2R061 4Y24A 3LDRA 2BRTA 3WXPA 1TNRA 1O91A 3ZMNA 5LRSA 3ME2A 4MGQA 5BYNA 1WA6X 4GMP3 2L9LA 1WKYA 1HRI1 3AZVA 1RUF1 4P9GA 1RUC3 1QXPA 2OPWA 4YRDA 5FPBA 5JPNB 3HAGA 1N3OA 1YHFA 5LK5A 4XBQA 1XNCA 5L9BA 3EBRA 5IVJA 1ND3C 4RS5C 5F5IA 5F3IA 2VCCA 4LBKA 1H9PA 1QXRA 2RDQA 3MLJA 4P9YA 1ZZ8A 4PQQA 4Q2FA 1VBC2 4UF0A 5FO9B 2HLEA 5FZ6A 4FAGA 4I01A 4XFFA 5FO8B 5KHIA 2OA2A 4LUKA 3I2DA 3H3ZA 5JI7A 3V56A 3IIIA 2BFUL 3VDDC 5FZFA 4JAAA 4DEQA 3GYDA 1FAYA 3C8XA 1JYWA 1QGLA 3GBFA 5LA2A 3SMHA 1RYYA 2WO7A 2ZGKA 3VKOA 2C9AA 1PO21 1JS9A 1DQ4A 3ATGA 4R9BA 1A8DA 2R063 2XDVA 4QDQA 1CESA 1DLLA 1T6GC 3O0WA 4PI0A 4W65A 5DUXA 2PAEA 1AHSA 2WKKA 3MYXA 1L7RA 4A45A 3OPZA 2Z5WA 4BE3A 1HRI3 2PAMA 2VCBA 4PQ9A 5A80A 1YRZA 3J9SA 5BUVA 3TOJA 1HKDA 3AFGA 4GXLA 3MIDA 1SZBA 3B93A 4YM1A 4LBJA 1R64A 3HN1A 3RZJA 3AFKA 2HWF1 4OCTA 1HB4A 1VBA1 4QU2A 1LOFA 1ZBA1 2I2SA 3FJSA 3SH5A 1W8ZA 4E8DA 2YFUA 4Y1XA 4RS5B 4E8CA 4MGZE 1DQ5A 1NLQA 4E2QA 1GQGA 5C3OA 3DN7A 4BLIA 4LBOA 1AUYA 1GU3A 3MIGA 4MUVA 3OBZA 2J42A 3ZFEA 2IXHA 2JG8B 4A41A 3KSCA 4IV1C 3OD0A 1J58A 2YGMA 4FFGA 3SQOA 3K2OA 3ZYPA 1EPWA 2XKPA 1R093 3VBFB 1LEMA 1MACA 4OQ8A 4MGSA 3SEPA 4DZGA 4JTNA 1PO23 5T50A 3VDDB 5JAXA 2GC2A 4X6RB 2WQ8A 3O0VA 3VLBB 2Q8DA 1JHJA 1IS3A 1XE0A 2E6VA 3TEXA 2RHPA 4K6BA 4HL0A 3LDKA 1G9DA 1ST8A 4FTSA 1FPN3 1S0JA 5BNQA 1X8MA 1VALA 4FPYA 1UYYA 1DFQA 3P3NA 1JZ6A 2PLV2 4D3WA 5G04L 4WM7C 1QH7A 2IWGB 4BQ5A 2J1SA 2G4IA 2ZMKA 3A0NA 4D7TA 1BYHA 1ULGA 4QAWA 5FPVA 2EIBA 3FBMA 3N3HA 1TMF1 4HK9A 5CKQA 4PDWC 5JSPA 4NIHA 4ZKTB 1BMV2 1QU0A 2WINB 3KGLA 3RYRA 3BVCA 2P34A 4JX0A 5IVBA 1S4CA 5CAZA 1ULEA 1PZ8A 5DUVA 5CA6A 4OMCA 2B45X 2B42B 1WW7A 1LOAA 4MLOA 2ZHLA 2XVLA 3POIA 2AC1A 2YPJA 4QXHA 2VQTA 4AL9A 3D4KA 3MUZ1 1HJGA 2C1FA 1C28A 2D6MA 2XHKA 2Y34A 3OBTA 4FPCA 3ZO0B 4K7JA 4A6SA 5AC91 5I0SA 4H7LA 1PGL2 2XH6A 4WV8A 4CU6A 1HN0A 2H6BA 2ET7A 1RUI1 4MX3A 5C7GA 4RS5A 1Q8PA 4JZRA 4XDQA 2VMIA 1PK6C 2WZR1 4JKKA 5C8WA 1C5IA 4YZ2A 1PO11 1W0PA 3S5AA 2LS6A 3MLLA 1LTEA 2JG8A 4IE6A 4MSVA 4NN0A 5EPAA 2GC3A 2VUCA 4YW4A 1PIV2 1TMF3 3VBRC 1UZYA 3VBFA 3EXUA 2PQSA 1DQ2A 3KV5A 4NHMA 3VBOB 1W8FA 2V73A 4KI5M 3VDDA 5L7OC 2VOTA 5FY9A 1CWPA 2WZEA 3T0AA 5FQ0A 5LW9A 1BJQA 3C7HA 4TLFA 4M00A 3CDZB 3VDBA 3BOPA 2ARXA 3ELNA 4B1LA 1BKZA 1F5JA 2B7YA 1FNYA 4YVWC 1MS0A 4QQLA 2ZEWA 1AR91 4Y3OA 1WMDA 5AC93 1SLLA 1W6OB 4Q0QA 4BHPA 1RB8G 2G9GA 1JZ7A 1V9U2 1W8OA 4XF4A 1ZBE3 1RUI3 3KV9A 3PMSA 3DUIA 3I2HA 1UPIA 1QJU1 4AVCA 2R1BA 2WZR3 5LBCA 2JDHA 1PO13 4D8MA 4BMBA 4CCKA 2H0BA 1WLWA 2E32A 1E57A 4XHBA 1ZRCA 2GSYA 3KV4A 5GLTA 1CGPA 1RMU2 3MIBA 3TN92 1CPMA 2D6NA 2RE9A 3HQUA 1OLMA 2RJLA 4LT5A 3U07A 4M3CF 4K20A 2DDUA 3AMPA 3SKVA 4UWDA 3WSOA 3WOGA 4ES8A 5LASA 2JDAA 1UZVA 1BBT1 1GSLA 1D2SA 4J1WA 3D82A 1AR61 1GOGA 4HT1T 4CTEA 5CVRA 1D0HA 1SDWA 5CFCB 4OHWA 1Y9MA 3SHRA 4RQPB 3ZN6B 5FMDA 2YPDA 2ZCWA 4GJZA 1RUH1 1DF0A 1AR93 2K46A 4JQRA 4MHUA 1YC61 2GN3A 4LKEA 2QQUA 2OYZA 2WDBA 1UW8A 1DGRN 4JDOA 3ZKUA 1OUSA 5FZ9A 5ANQA 1J3RA 4LBNA 5FY5A 4NIAA 3IDAA 4JKLA 3C3VA 1ZRDA 2WT1A 4DY5A 5C4WB 3VBOA 3P3PA 4IEZA 4FOWA 4DY3A 4NRQA 4META 4GIQA 4AI0A 5HXMA 5E8AA 4Q4X1 3Q8CA 5E88A 5JLVA 5M0TA 1UIKA 4AE2A 1UKRA 4EV0A 3GDBA 4F8AA 3HOBA 1CZVA 1GICA 2IVIB 2AR6A 4UAPA 5A7QA 1DYKA 2P2KA 1BBT3 2WNVC 4XMIA 1KGYA 1AR63 2VBPA 3NRUA 1S0GA 3WG4A 1H8TB 1W6OA 2Z2SB 3IZOA 3K46A 4ZY9A 2JE9A 2I74A 1A3KA 3AP6A 1HB2A 2ERFA 4QDSA 5BNOC 1YI9A 3RPQA 3ZFGC 4BDVB 1LHWA 1QOSA 4RHV2 3MZHA 1KJLA 3WF4A 2X8KA 5JMOA 1QDOA 1DBNA 1DGWX 3IBMA 3KV6A 4YSFA 3BTYA 1OQEA
chains in the Genus database with same CATH topology
1VLNA 2JENA 2XJQA 1VAVA 4XJUA 4Q29A 1NZCA 2PHWA 4XJ8A 1OSGA 1KQRA 4JRLA 3WW1A 3ZYRA 3SCFA 1C8M2 2QCSB 4JCKA 2A73B 2VOKA 5KHGA 2NQYA 5JMCA 3JBG2 3WT3A 2IXIA 1DZTA 4K21A 4CP2A 1HRV3 4C90A 2QNKA 5CFCA 1Q56A 4JGYB 1F9KA 4RQPA 3ZN6A 3S30A 4XFHA 3VZNA 4YGBA 1KJRA 4OHYA 2ZHNA 3AYAA 2ZZQA 3H50A 4YGCA 4AQTA 1YUDA 3M4FA 2GC0A 2FZ1A 1NCQC 1MEC3 2E63A 1FATA 3TB0A 3L9JT 2XKOA 3TRSB 1IS6A 1S0CA 4NHKA 4LE3A 1VBE2 2VH9A 3MIHA 5C4WA 3WW3A 5BNOB 5IK7A 1RUG1 2ZHMA 3ZIWA 1UMZA 2DVBA 2GH2A 2QJVA 3N7KA 3GZUC 4N53C 1MQTC 1LGNA 1JH5A 2BVBA 4XEZA 2Q4SA 2XB6C 1WD4A 1ZZCA 3W58A 1AR83 1H8TA 2B5HA 2YYOA 1IQAA 1MS5A 1H2KA 1CQ9A 3H8UA 2HKXA 4KG0A 3UJOA 1JUHA 2R0FA 4XIOA 3PVBB 4UBHA 1YO8A 1TME2 4FTEA 1Q8QA 3AKQA 1YFUA 5ACA3 3UKVA 4I02A 1TQ5A 4HANA 4B7KA 3UKNA 4FPHA 5A3LA 3H9AA 1BCXA 1RIRA 1WBLA 2HWC2 1NCQB 4KU8A 3CO2A 1C8NA 3NAPC 3WCSA 1FT9A 3ILNA 2A5ZA 3ETQA 2XJPA 3JQXA 4DQAA 2GDFA 4CRQA 1IPKA 2ZACA 3N7JA 2WT2A 4Q0VA 2VW1A 4JGYA 4DINB 1MQTB 3B3QE 1U5YA 1UCXA 1S2BA 2E51A 4GKYA 1XE8A 1PVXA 3GALA 5C8CC 3M70A 1DGWA 5L73A 2UURA 1R083 2GH8A 2W0XA 4AVBA 2KXLA 1N47A 1NOVA 2RM22 4AHZA 3BTAA 2B39A 3RDIA 1HQWA 4H3WA 3HT2A 5BNOA 2QKDA 2CY6A 4QPYA 2BNMA 4KWJA 4PIXA 4R4XA 5K9YA 1GV9A 3URFA 5CFDB 1LECA 4Y26A 1MZ6A 1HIXA 2PFWA 4OHVA 1YWKA 3M3IA 4I0BA 1UKGA 1FOD2 1FMD2 3NSTA 3E5QA 1V6KA 3OF1A 2LUWA 4RGGA 1MS8A 4QPIC 2D98A 4OLLA 4GB31 1NA1B 4CDXC 4ITCA 2XUMA 5EYXA 3RQ0A 1FV3A 2ZGNA 4YFWA 1AL23 1Y43B 4AEDB 4ORFA 1KDMA 1ZRRA 2O0OA 3ZXDA 3AP9A 3AZWA 1REDA 5L19A 5BNNA 1CAUB 3B5LB 5DUUA 3POSA 2YV8A 1MQTA 3VV1A 3JZVA 4ISQA 1VBB2 3ZMOA 1YXWA 3PJYA 3HWJA 4PLNA 1NLSA 3BU7A 3KM5A 5EYYA 5A32B 1ENSA 1PHMA 1AR73 1QJY1 1XYNA 4COUA 5FPXA 4AHWA 3T2TA 1OA3A 1LKNA 4BYYA 1IS4A 2NPIA 1PMIA 5E16A 4QPGC 1PVC1 4Q4V2 4KQ7A 2GALA 4A7KA 5CFDA 3AP5A 1SACA 3CF6E 1RHI3 2ZGSA 4CEYC 5BXXA 3VHRA 3WDUA 4EJRA 1C3HA 3R6SA 2YHJA 4MXVA 1WCSA 1I3HA 1BVVA 1MS1A 3CJIB 4DNYA 4Y5Z0 1D4M2 1O5LA 2GC1A 3E6DA 3LSEA 4Z1VA 1O5UA 1BVP1 2XJTA 1HXS2 4IEQA 1NA1A 2ZX2A 1X7NA 5ABJB 3U4XA 4CDWC 4SBVA 3UK9A 1C5HA 1RUE1 3ES4A 3WX5A 2O1QA 3DPRC 4B4QA 1GFF2 1CAXB 1COV1 1QOTA 2OVUA 4JC1A 4K9SA 3S0MA 4PCRA 2CWSA 2ILMA 3AB0A 3R4DB 2WA3A 4AEDA 3KT1A 4UW5A 4LHLA 5JR7B 1HV0A 1GNZA 1O4ZA 1R1A2 3I8TA 2N7GA 2DVFA 1CAUA 2JECA 2MHFA 3FWEA 2PAKA 3FC0A 3SCHA 4QQHA 5GZDA 2ES3A 4CEYB 2WWSA 1R092 3IDCB 3AXDA 3KS7A 5L36A 2ZJCA 4H7MA 3AMHA 3IDBB 1O3TA 3HBZA 4IEYA 3B01A 3UV9A 3V0BB 4XF1A 5BPXA 4H14A 5A32A 2ZPXA 4NWVA 1PGW2 1RUE3 4OULA 4AVTA 1NQDA 4N43C 4YZ1A 1FPN2 3VHPA 1UD1A 4UW6A 2R071 4BH9A 4LO7A 2BUKA 4G3YC 5CU1A 2E7TA 2ZKNA 2PYTA 1JTZX 1DZQA 3CJIA 3H1MA 4AVSA 4AFBA 2VVDA 1IKQA 4AVVA 4XFIA 3WDXA 4GALA 5A33A 2FBEA 1QF3A 5E89A 5B2GB 4CDQB 2DUPA 3NO8A 4KWLA 5ABJA 1SLAA 2TEPA 2HWE3 3QLQA 1HQNA 3U10A 1MZ5A 2D3SA 4YW5A 5FMOL 1CAXA 2Q0AA 4L97A 4Q1PA 1BZWA 3MEPA 4R8HA 1J59A 2QZ3A 2GN7A 1YLLA 2W52A 2R073 4IESA 5T54A 4PIZA 1OMIA 2PHDA 2JKBA 3S7EA 4LBQB 1HV1A 3L2YA 3MF6A 1EAH2 3VUOA 4NWWA 1AVBA 5EJ3A 4XTMA 1GLHA 4HSJA 5FOJB 3GF6A 4Z82A 5H9PA 5FFOC 3V0BA 1AYM1 1ZM1A 1LOFC 1N3PA 3B02A 1OFNA 4Q4Y1 1H0BA 3JU9A 4LE4A 2QUOA 4OHZA 3ZFEC 1LOCA 2YMZA 3M3QA 3VHNA 4Y1YA 3AX4A 1Q8OA 3EHKA 1LOEA 4BA6A 3QBQA 3LSDA 5BNPB 5JZGB 1LJ7A 1NCRB 1U0AA 3WDYA 1U5ZA 5I0TA 1S0FA 2V09A 2WS93 1JYIA 1ZBE2 1WCKA 5CADA 3DL3A 4PLMA 4ZXKA 4B7EA 1MZFA 1S0IA 3WINE 2OW4A 3CU7A 3OCPA 2P3IA 2JG9B 3MGUA 4S2HA 4D7SA 4XXPA 2WL1A 1SBDA 3BCWA 1BEV3 4CDQA 4JDMA 3MPPG 1YFXA 4MGKE 4AQSA 1V6MA 4J1XA 1LOGA 1VAKA 1AYM3 3TNQA 3ILFA 2WC2A 1N3QA 1RUD2 2GAUA 5KBFA 4Q4Y3 5T3NA 3AP7A 4HPKB 2HWB1 4P5HA 4RGAA 4AEJA 2A71A 2BPA2 1J1LA 4BOWA 1G6NA 1AXZA 4LBQA 3ZSJA 2YC0A 1JXNA 2XBO1 3LA7A 3LOBA 3WHTA 2QVSB 4EN9B 4DPNA 5LK7B 3R4UA 2JXAA 4CYDA 3KGZA 3THTA 1EV11 2A6YA 4I3PA 4AWDA 1QJX2 1MVEA 4ASLA 2PHXA 1ULDA 3LB9A 1MVQA 1V6IA 4N9HA 4LHNA 1LCLA 5GALA 5KHHA 5CG9A 4FXGB 2VOXA 3NV3A 3JB8A 4M0HA 3VKMA 3FUOA 4FOQA 3PTYA 5DDJ1 2CGOA 3RJRA 2JX9A 3J4UH 4A2UA 2JG8C 2A6XA 5FREA 2WJSA 3WP6A 2HWB3 1G9BA 1J3QA 5BNPA 2LALA 1NCRA 5JZGA 3VBFC 4GKXA 5FPZA 1OLRA 3I7DA 5H9RA 1A6CA 4P14A 1RUJ1 4I2OA 4Q4W3 3KCXA 4KNCA 2JG9A 1VRH3 1EV13 4R4ZA 1W6PB 2KM2A 3WDTA 3ZFFC 3FX3A 1RUF3 5FO7B 4XJZA 2NLRA 4HPKA 4ZU4A 5JOYA 3KMHA 1V6NA 1HRV2 1VR3A 4EN0A 2WFPA 2VW0A 2JICA 3MI8A 2XWJB 4LO8A 1GZCA 4GWNA 1KRIA 3SNMA 5KC6A 1KD7A 1SMVA 1GNHA 1OA2A 2X53S 1MEC2 2GMEA 1O7FA 5I8TA 1RUJ3 4LEJA 3JD71 2VECA 2FQPA 4L2NA 5LEKA 1KXGA 2IXCA 1AX1A 5FQ0B 4AXOA 3LGRA 4YW3A 1S1AA 3NKGA 3S7IA 1DU3D 5J7MA 1G9CA 3GZAA 1WGPA 2EXJA 1POV1 3KT4A 4JDNA 3QH7A 2UU8A 2D97A 5CB7A 2QE3A 1AR82 3LA2A 5T52A 4XE9A 3ZFFB 1IGOA 4BCUA 2HWF3 1VBA3 4Y22B 5GLWA 1QKQA 3ZXLA 4B4PA 1ZBA3 3VBOC 4SLIA 5HCBA 1TNFA 5F6KA 1NY72 1O4YA 2WFF2 4FBFA 5ACA2 4IEVA 5GZGA 2R16A 5KXBA 4YVSB 4XFCA 1W6PA 3JD73 2YXSA 2XWBB 1OA4A 2O8QA 3JQWA 4E4ZA 1H4GA 3ST7A 2CAUA 1AYN1 2RS32 2RS51 1AL0G 1DQ1A 1MS3A 2ATFA 2RMU2 4X8NA 4L92A 2W39A 3WHUA 3JB4C 3RYKA 5HCFA 4LBLA 1W6NB 2QFEA 4GULA 4BIFA 3PMEA 2YY1A 3RJ2X 4QM8A 4RA0A 2A6VA 2WZPP 1AF9A 2AH2A 1R082 5H9SA 3WCRA 4QXKA 3WDWA 4COYA 4FXKB 4YG6A 2D6PA 4W6YA 4WM8B 5CFCC 4RQPC 1SBEA 2OUHA 2DCZA 2MEV1 1WW4A 3UJQA 4F83A 1ZNPA 1AYN3 2RS53 3TYJA 4YFZA 1G9AA 1RUOA 3ZFFA 3KLSA 4AFCA 2VU9A 2ZMLA 1GYKA 1CAWB 3EJKA 4Y22A 1JUIA 4Y4YA 3ZSMA 5C4WC 4EN8B 4IETA 3X29B 1DHKB 4FPFA 1X33A 4D7YA 2VQAA 4K8FA 3IIAA 1O3RA 4FPEA 3KT7A 3ZXFA 4UXAA 2SLIA 4YVSA 5GLUA 1OQ1A 4DOUA 1ENRA 3E97A 2UY9A 2ZS6B 1OOPB 1H8TC 1W2UA 2XGXA 1AL22 4XILA 4JGZA 1Q3EA 3HQXA 1OLQA 1U12A 3VBHB 1Z7S1 3AMMA 4PBOA 1EP0A 2HWD1 2RS11 2MEV3 4Z8BA 4K1ZA 1AXYA 2D6KA 1BXHA 3NV4A 1W6NA 3WG3A 3VBUB 2QQPA 4BMEA 3TBDA 2CL2A 3KD4A 3HR9A 2IXKA 5JWPA 2JJ6A 1DG6A 2CGNA 4XQDA 1UAIA 3O7OA 1QJU3 2ZTNA 2VNRA 1AR72 2HYKA 2OIIA 5GLVA 3AXEA 1VBC1 1VIWB 3MFCA 3R05A 4W6XA 4WM8A 2PHUA 2DTWA 1GBGA 4JGYC 2Q30A 3O5SA 4NPRA 1RHI2 4R9CA 1CJDA 1H9WA 4AFDA 1C57A 2PELA 4S2GA 3I54A 3GBWA 1H2NA 1Z7S3 2WNUB 4PF5A 3T1LA 3J8F2 4L99A 3MIFA 1CAWA 1SFYA 4AGVA 1RUH3 3HT1A 4XW3A 4LUMA 2PTMA 2RR12 3B9IA 4M0NA 2P3JA 3RZZA 5DUWA 1ULFA 3WNXA 3N35A 2R042 4JVAA 4AQ6A 3GHNA 1XNDA 3K48A 3VZMA 2DVAA 1VBC3 1WUVA 4DRVA 2EALA 4MVTA 1OOPA 1W39A 2BGCA 4NHLA 3WUCA 1JBCA 1IOAA 4Q4X3 3POYA 4FPGA 3U11A 2VMGA 3VBHA 1H2MA 2R0HA 5IK4A 5EZWA 5DG1A 3VBUA 4YLZA 5DZEA 1O3QA 2DCTA 4PIYA 4TYSA 3WP3A 1UF2C 2Z79A 4OUMA 4IQPA 3FLRA 1REFA 3TWIA 3POWA 1V00A 1M06G 1YFYA 2D3RA 3SITA 1W6QA 4WZFA 2W68A 5BNNC 2PLV1 1OPOA 4YW1A 4HFSA 3H7JA 4XF3A 1DDLA 2ZX0A 4HKOA 1V6OA 1VAMA 2ZX1A 2ZZJA 4L9BA 4I30A 3B94A 2WNUA 5DZFA 3NV1A 1BMV1 2UWBA 3B7MA 4M3CA 2VQ0A 4J6GA 4Z2WA 3WP5A 1LULA 5CFDC 5GZCA 2HWE2 4HKLA 3BIWE 3M3OA 3D0SA 2OZ6A 1RVF2 3MW3A 2CNAA 4P9JA 1PGL1 2AENA 4K3UA 4FPJA 1RUG3 5JSRA 2ZOEB 2PLV3 3IM0A 3ZYIB 4FPKA 2XJSA 3ZX7A 3FLPA 4AW7A 3WD5A 4HZFA 5EFUA 1NA1C 5BNNB 1LRHA 1VBD2 3OGJA 4FOYA 4XJWA 3ZPYA 1PIV1 2BVVA 4MXWB 3JCIA 4URTA 1H1IA 1QH6A 1M4WA 3MIEA 5T55A 5AFBA 1DQ6A 2DYCA 4KL1A 4AEDC 3U0ZA 3B00A 1KITA 5C33A 4LTAA 1LB2A 2IXLA 4IXLA 2AUYA 4AHXA 1YIFA 1QHDA 1G8WA 5I8SA 3NVCA 4LNVA 2P37A 1V9U1 3MW4A 4FOVA 4KWKA 2WS92 1V6LA 1LHVA 3AZZA 3C2UA 2D40A 4AEMA 3D8CA 2ZHKA 1GZWB 1PIV3 2XJVA 1RMU1 2EIGA 3TN91 2IC1A 1ASJ2 1VJ2A 2Q1ZB 2TNFA 2VUAA 1PGSA 4HETA 4YM0A 5J96B 1BEV2 3ILRA 1YYNA 1SLCA 5I93A 1HLCA 2DF7A 2X5IC 3USSA 3CJIC 1W0OA 2CTVA 1LEDA 1UIJA 2VNGA 2ZKLA 4YYOA 4PBPA 4OI0A 1QNYA 1QQP2 3OTFA 1V9U3 2K2SA 1KS5A 2BTVC 2XLFA 4BQ1A 5ABJC 4S2DA 4XIKA 1XRUA 4MXWA 5BY5A 2EXKA 4AG4A 2ZGLA 4LA3A 3LA3A 4S2FA 3ZXGA 3TN93 4TZDA 2DCYA 4LBQD 2VULA 1D0GA 4GB33 3UL2A 1RUC2 2XVGA 1WLCA 3MLKA 3ZN5A 2VPVA 4A3XA 3OGGA 4GH4A 2UY8A 1APNA 3SLIA 1WMEA 3MDPA 1UZZA 4A7ZA 1JN2P 1DZRA 3W59A 3MW2A 3FLTA 3AZXA 4FAHA 1YIPA 2DTYA 4IEPA 1KDKA 4RHV1 3MFAA 1ND2B 4YGEA 1NXMA 2X5IB 4HKWA 3PVEA 4Q4W2 3PJQA 1GZWA 3E5UA 1IZ3A 3LWCA 4Y1UA 5A33B 1J1TA 1VRH2 1EYBA 1FYUA 2R062 3I59B 1QMJA 4IERA 3ZSKA 1ZX5A 3V0AB 3GNEA 1C8M1 1AX2A 1HRI2 1RUF2 2IFRA 3JBG1 1QJY3 1PVC3 5IUQA 3LKJA 4P9LA 1QWRA 1QXJA 1XXNA 5EWSA 1WBFA 4E9KA 1LU2A 4IV3B 3ZSEA 3WG2A 1VB4A 4CDQC 3K51A 4YZ3A 3WP4A 3R4SA 4I0WB 1VBE1 4CEWB 2Z42A 3MICA 2UYAA 2MNGA 4A7YA 1PM7A 2Q1MA 3RS6A 1H1AA 1PO22 2BWCA 5FOBB 3VKFC 3IPVB 2ZGUA 2JE7A 3NV2A 4COWA 3VBSA 3N7LA 3JBG3 1COV3 5HI0A 1PNGA 4KBBA 2HWF2 1VBA2 4XFBA 5CBLA 1I9RA 1ND2A 1ZBA2 2IXJA 1W6MB 1TME1 2X5IA 4QGNA 3TNPB 2WA4A 2ZGPA 1LGCA 1KS4A 4QM9A 1XNBA 1VBE3 1UN1A 3FFQA 2HWC1 3I59A 4E4DX 2A70A 4Q27A 2E53A 3ECQA 3Q9OA 4ASMB 5KXDA 3V0AA 4NO4A 2XJUA 3GBGA 2PN5A 5BNPC 2UYBA 1NCRC 5JZGC 3PVOA 1LENA 4FSJA 5JOXA 1GQHA 1I5ZA 5H9QA 1FX5A 1SLBA 1POV0 3WV6A 4AF9A 5CIRA 4D7TA 2A3WA 5LRRA 3ZYGA 4B4RA 2Y38A 4XBNA 3ZYJB 4IV3A 2JG9C 2OZJA 3G7DA 4XZPA 5DG2A 2PHFA 4V1PA 3ENRA 1WMFA 3IWZA 2UWAA 2RM21 1Y3TA 3H0OA 1H1MA 1RGSA 5JOZA 4MH0E 3NJZA 2VGDA 2ZGQA 1TMF2 4CEWA 1SEFA 2OUJA 2R49A 3AYDA 3ES1A 2HWC3 3IPVA 5KXEA 4RR3B 5JSOA 3M3EA 1FOD1 1FMD1 3D5OA 4KGGA 4CP1A 1REEA 2PA7A 1H4HA 1ZZ9A 2F6BA 5AC92 2GU9A 3AKRA 3QD6A 4WZCA 4NVPA 2C5DA 4AHYA 1F5FA 4M01A 1W6MA 1RUI2 4HSLA 3WG1A 4Q0UA 4WBBA 5JI9A 2WZR2 3BB6A 1ZYBA 1PO12 2B9UA 2RM23 2AYHA 3WLUA 5GJ6A 1Y7BA 4Q8LA 1X36A 4YG3A 1B35B 4Z92B 1N1YA 4AEKA 4WVWA 2NYYA 2BYVE 4LLFA 2E7QA 4WVVA 2I07B 4CDUB 4Q8KA 1FOD3 1FMD3 3FHIB 2H0VA 1VBB1 3QOPA 4OI1A 3ROUA 2FZ2A 4AVAA 2GMMA 4XYXA 3HD8B 1AR92 1DGLA 3EO6A 4GMP1 4OI2A 3M3CA 2NZ9A 4FQ4A 4NR1A 4R52A 5GKAC 3RWNA 1K5MB 2RJKA 1BK1A 4H55A 1QJU2 1SLTA 2D43A 5DZGA 2CV6A 2EA7A 4Q4V1 1CPNA 1JHNA 1Q43A 4P9IA 3D0JA 5TSWA 1RITA 4QD2A 5D8AB 5EXOA 4RR3A 3E5XA 4CP0A 2NM1A 1H30A 5C9AB 4EWDA 2ZBJA 3WVJA 2CWMA 1D4M1 1BBT2 1AXKA 4IEXA 1ONAA 1CN1A 4QX5A 4DMIA 1AR62 3EQEA 1VBB3 3VZOA 1HXS1 4ONUA 4WVZA 3VZKA 1ZA4A 3AMQA 1RUH2 4LR4A 1F31A 5FCCA 2YDEA 3PLQA 2DWRA 1NXD1 3UKTA 4N7IA 2QDNA 2XBO3 2Y0IA 5JIUA 4DFSA 4FT8A 3D6EA 4ZU5A 3FUQA 1QOOA 2NP0A 3RMYA 5JVVA 4Q4V3 1B35A 1WA4A 1CD3G 4AQ2A 1GANA 1QDCA 1ZZBA 4AI1A 1R1A1 3CEWA 4FQZA 3AMNA 4Q4X2 4ATFA 4G9SB 3WQ7A 4CDUA 4XPVA 3AYCA 3IKWA 1JW6A 3KQRA 5J48A 1YJLA 5DDJ3 3VHOA 1D4M3 1VP6A 5AFEA 4Q1RA 4YM3A 1R091 2EXIA 4BWOA 3CLPA 3O0XA 2YGLA 4YVSC 3B69A 3RRDA 1HXS3 4BZ4A 2D44A 3PNAA 2Z69A 3AYEA 1K5MA 4KH9A 3AP4A 2FMDA 4XQWA 4FTBA 4WVMB 5J3UA 1PGW1 4JGZC 2DU0A 4XMAA 1FPN1 1MS9A 3A4UA 5EV7A 3ZSLA 3RI8A 3HIFA 3SCGA 3USUB 5D8AA 2PHRA 3ZXKA 1ND3B 1OKQA 5C9AA 1R1A3 4N90A 1H8VA 2BFUS 1D4VB 2BBVA 5T5JA 3OBRA 3V64A 1NG0A 2DFBA 4XETA 2R6QA 1OHFA 4M3CE 3E6CC 2ARBA 2ET1A 3VL9A 4F3JA 4WM8C 1O4TA 4U2AA 2JEMA 5FBZA 3T1MA 1MR5A 1PZ9A 4EWEA 3BPZA 2NMNA 2A6ZA 4XFAA 2R1DA 2DU1A 2WNEA 3MPBA 1S2KA 1RUG2 4EN6B 4JGZB 5DXDA 3LCPA 5SV5A 1I1EA 1EAH1 3LAGA 1Q8SA 1POV3 5T5OA 2R30A 5F5QA 2D5HA 1SBFA 1U5IA 5A3MA 4XQ4A 4GA9A 2O8OA 4P9WA 1OOPC 3WW2A 1CR7A 4WVMA 4IV1B 1EPZA 2ZGTA 1CX4A 2A3YA 3VBHC 4FO9A 1XNKA 4FPOB 4HVRA 2P3KA 3USUA 1PZ7A 3VBUC 1X82A 4F7ZA 1ZBE1 1PNFA 3H3UA 3VKLA 5JPMB 1ND3A 4OZXA 2X29A 2FMYA 4BIOA 4AI3A 2AGSA 1U5XA 4ATEA 1RJ8A 1EAH3 4C1WA 4PLOA 4EN7B 4WM7B 3ZVXA 4AI2A 1R1ZA 2D93A 5CNAA 2CYFA 4PDWB 1RUD1 3INAA 4OI4A 4C91A 2BNNA 4P9XA 1IHMA 3IMNA 2BW8A 2WNUC 3BODA 3M2MA 1UU5A 3WDVA 4O9EA 1MS4A 2WQZC 1ENQA 3ZXEA 1DYPA 3RG0A 4B3NA 4FCAA 2D6OX 2R32A 4IEOA 2V5YA 2D3PA 5KHKA 2VW2A 3SH3A 1QJX1 1J3PA 1UU4A 1ZVFA 1EY2A 1C1LA 3AJYA 1RJ7A 1S0EA 2ZGOA 4UW4A 4JTOA 1G86A 1XU2A 1PK6B 4GWMA 1YCIA 3IN9A 4GB32 1CVNA 4XFGA 4IV1A 1S55A 3VBRB 1SCRA 4C1XA 1Q5OA 2XPJA 1W6QB 1LU1A 1RUD3 1AJKA 4HN0A 5L7OB 1ZZ6A 2JD4A 3OY8B 2DUOA 2VOWA 4TSVA 4XXAA 1LR5A 4BLJA 3LZZA 2EAAA 4YVWB 1XYOA 2HWD3 3THPA 2RS13 4U36A 3FZ3A 1ENXA 4M3CB 4WM7A 2K9ZA 3PVNA 1QJX3 2ETEA 3L2HA 4AGGA 2ZAHA 2DCKA 2ZABA 3ACLA 3V65A 5LEJA 4XBLA 2DFCA 1UPSA 1V70A 1X50A 4PDWA 4FP2A 1QJZA 2DVDA 1QJY2 1HRV1 2ZGMA 1QNWA 3H7YA 1UL9A 5GLZA 1RC6A 3O14A 4COZA 4MZUA 4AK3A 3H1YA 1PVC2 1ZRFA 2DUQA 2TUNA 2HEYF 4RFT0 4N9IA 1X8EA 3CNAA 2B8MA 4OHXA 1MEC1 3VGIA 3VZLA 1O3SA 1NQJA 2C0ZA 4Y1VA 4COVA 2Y0OA 3O12A 1WW6A 2XLGA 1PK6A 1XQNA 3WQ0A 4FP3A 3I4IA 4XJAA 1YJKA 5T5PA 2XL9A 4E4SA 4XTPA 2E9QA 2A75A 1AX0A 2KA3A 3VBRA 1F8VA 1RUE2 4KU7A 2EXHA 1H2LA 3IT8A 2XLAA 1AR81 2XG3A 1COV2 4K40A 5L7OA 2P17A 4I3GA 3OY8A 1QY4A 1AJOA 4ISRA 4OUSA 3KCCA 1NE6A 1SLIA 3FBYA 1NY71 4IEWA 3VKNA 1WLTA 2WFF1 2WNVB 5J37A 4YVWA 2VOVA 3KB5A 5ACA1 5KC5A 3OJBA 2WQ4A 4E2GA 2YROA 3A0KA 2QDRA 1NLRA 2GNDA 2VY0A 4QGLA 4GH4C 4KG8A 3ZFGB 1LHUA 3NWKA 1C4RA 1WW5A 3OD4A 1F2NA 2RS31 2RMU1 2DVGA 1FI2A 4QT6A 5K8SA 4GQ7A 4YGDA 1AZDA 3DV8A 4QMAA 1N1VA 4Z07A 2VUJA 4B8EA 2K0GA 3H1WA 2BNOA 4PJYA 4DB5A 2OPKA 4AI8A 3M1HA 2R072 2XL7A 4BPZA 1HDKA 2D6LX 2BEOA 1R081 1WLDA 4XOGA 1ZZ7A 4QGMA 5IT6A 2DURA 2WFF3 1BQPA 4QQOA 1GR3A 4RD7A 2FHRA 2RS33 1G9FA 5K0UC 2RMU3 2W08A 2ZMNA 3ASIA 5JDBA 4C0BA 1KFXL 3DF0A 5GZFA 1XU1A 3AKTA 2NN8A 4GH4B 4XHXA 1OPMA 4KGQA 4XF0A 4YW2A 3AZYA 4N53B 4HVOA 4CZSA 1UU6A 4R9DA 3NW4A 3W9AA 1HW5A 4RSUA 2VVFA 1A78A 2ENRA 1OD5A 3WZ1A 2A6WA 2HJIA 2WNVA 5HCAA 4ZU7A 1B09A 1LESA 1OFSA 5BV6A 2DV9A 3VBSC 3ZFGA 3GHMA 1AL21 1N1SA 3AJZA 3VN4A 2GNBA 4R9AA 5I0UA 1AYM2 1Q8VA 1ND2C 4Q0SA 4Q26A 4LA2A 4EWAA 3N4MA 4JRAA