1C5HA

Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGDFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen bonding and catalysis: a novel explanation for how a single amino acid substitution can change the pH optimum of a glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1999-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c5hA00
1IGOA 1YNAA 4XQDA 1H0BA 3VL9A 2DFCA 1M4WA 2QZ3A 3WT3A 1REFA 3AKRA 3WP3A 1AXKA 1UKRA 2B42B 3AKSA 1C5IA 3WXPA 3WR0A 2DCZA 3HD8B 2BWAA 4XQ4A 1ENXA 1OLRA 3MFAA 3AMNA 4HKWA 2B46X 3AMMA 3AMPA 3AKPA 4NPRA 3WX5A 4HKOA 1OA4A 4S2GA 3VGIA 1HIXA 3WP5A 1OA3A 3VZKA 1XNCA 5HXVA 1F5JA 3LGRA 3M4FA 4HKLA 4S2HA 1H4HA 1XNKA 4XQWA 2NLRA 3MF6A 1XYNA 5EJ3A 3EXUA 5K7PA 4IXLA 4H7MA 3WQ0A 2D98A 1QH7A 3AKQA 2JICA 3AMQA 1BK1A 3VZOA 2DCKA 2VGDA 3WP6A 5K9YA 1PVXA 4HK8A 2F6BA 2QZ2A 1HV1A 3ZSEA 3VLBB 3RI8A 3VZMA 1XYPA 2VULA 3MF9A 3B5LB 1T6GC 1TE1B 1XYOA 3RI9A 3LB9A 2D97A 3AKTA 2JEMA 3MFCA 3VHPA 1C5HA 2B45X 1REEA 3VZLA 2VG9A 3WQ7A 3VHNA 2DFBA 1UU4A 1REDA 2C1FA 2JENA 3VZJA 1NLRA 3WQ1A 2VUJA 1KS5A 1QH6A 1UU5A 3VL8A 1XNDA 4S2FA 4HK9A 1OA2A 3AMHA 1KS4A 2DCYA 3O7OA 2BW8A 4S2DA 1XNBA 1BCXA 4XPVA 1XXNA 1OLQA 3VZNA 3WP4A 1H1AA 1BVVA 1H8VA 2BVVA 2NQYA 3B7MA 3VHOA 3WY6A 1H4GA 1W2UA 2Z79A 2DCJA 2BWCA 1UU6A 1HV0A
chains in the Genus database with same CATH superfamily
2R061 1WW4A 5DDJ2 3SITA 5JCTA 2IXJA 3VL9A 5A3UA 1RUD2 3WT3A 3JD72 5CFDC 3LEKA 1Y9GA 5FZLA 1GYKA 3TN92 3ZFGC 3O0WA 3AKSA 4LEJA 5KWRA 1H6XA 2XQRA 1VLNA 1R1A3 1HRV2 1ENXA 3CEWA 5E8AA 5FZGA 1L7RA 2BJSA 3ILNA 4UFKA 3AMPA 2W0XA 2VZ3A 4FPYA 3WHTA 4E8DA 2BZDA 1YFWA 4AHYA 1H8TC 4NPRA 3T0AA 3LOBA 4LBLA 1Q56A 5FRAA 4GA9A 4IE5A 3KM5A 4URAA 1H1MA 2A73B 3AB0A 4W4ZA 1NG0A 5FZDA 4MGIE 4FOWA 3DYMA 3MV11 1PNGA 5BNPA 1JOJA 2JDUA 4QGLA 3ZN6A 3M3CA 3IDEA 1QGLA 4XQWA 1HB3A 1W6NA 3H9AA 2XJQA 1SDWA 2GSYA 1QJU2 1QH7A 3APBA 5CYYA 2VOWA 2BNMA 1WMFA 3SEEA 3J26N 2VM9A 4NHMA 4QXCA 4R4ZA 2VZOA 1V6KA 4D7YA 2ZX1A 1I5ZA 4DY5A 2D3PA 2ETEA 4CVUA 1PK6C 2XJUA 1BEV1 3AK0A 3JBG3 5DAXA 2BUKA 1SCSA 1PK6B 1GP5A 1RJ8A 1SCRA 2D3RA 1X7NA 4QD2A 4QX7A 4E8CA 3QLQA 1RVF3 2ZHMA 3RI8A 5JMOA 2ADDA 3FHAA 3MW4A 1JYTA 1JHNA 2C26A 4AEDB 3ZDVA 3B5LB 1QNWA 1EPZA 1LOEA 3H3UA 1BK0A 4Q4V3 2QQMA 1VBD3 4Q4Y1 5C4WA 2R6QA 1TG7A 4AL9A 2R32A 4CCJA 4ARYA 1CJPA 1LEDA 5FK8A 2DUPA 2DVBA 2Q8CA 1H2MA 1Z78A 4GB32 4XOGA 4RGKA 1FMD3 3EHKA 3HT2A 5ABJB 2ID4A 5LA0A 1UZWA 3K4DA 4L92A 2OUJA 3LA3A 5FY8A 2RDNA 2VO5A 2NMOA 3HNYM 3PDQA 4RN5A 4AQ2A 1JYWA 1C57A 2ENRA 1SFNA 1H30A 1IKQA 1LHUA 5J98B 2WFPA 3FHIB 2JD9A 2V73A 2J1TA 2ZX2A 3MHZA 2VXJA 3VBHB 1QH6A 1WD3A 5KXCA 4UF0A 3OJBA 1PVC2 3TRSB 5A6ZA 5JUVA 5FMBA 3ZSJA 5IHRA 3SCFA 3FX3A 3IDBB 3KVAA 3LEMA 3PVNA 2RV9A 3R4DB 3VDDA 4TLFA 2YC0A 3N9NA 4B1LA 5FZ8A 4J6GA 3VBSC 4HG6B 4P9GA 4EE2A 5AC91 4OUEA 2SLIA 3TWIA 1H1AA 1ULOA 3FFQA 1H8VA 4QXHA 2P37A 5BNNB 1N47A 3SEPA 1QIQA 3KCCA 4NROA 1WCUA 1W2UA 2R071 2RJ2A 2GP3A 1L7QA 4H3WA 4QKBA 2Z79A 2DVAA 4CYDA 3N9QA 1O3QA 3M3EA 1SMVA 3ZYBA 2JJ6A 4AE2A 5A70A 3K2OA 3TOJA 3AJZA 1MS3A 1RUE1 1A8MA 4FOYA 4ITCA 4W6XA 1HX6A 3FLTA 4NHKA 3TYJA 3JXSA 2BTVC 1DQ5A 1WLDA 4IV1A 4NVPA 1TME3 2XVLA 4BQYA 1UKRA 2PQSA 4YSFA 1VRH3 5J37A 3O14A 3BIEA 3NAPB 3U75A 5AC93 4LNVA 1ULDA 2VOXA 2ZJCA 1CPNA 1NAEA 3SH5A 1OLRA 4AVVA 3KB5A 1MS9A 2Z5WA 4MG2A 3H50A 4JDMA 1MS8A 2XJPA 3BKZA 4UI9L 1UNBA 2VU9A 3CJIB 2R30A 3N9LA 5GJ6A 3RJ2X 4BLJA 4CEYC 4Q27A 1PM4A 1ZBE3 3RDIA 3WP5A 5C9AA 2VECA 5CU1A 4MGKE 1SLTA 3M4FA 3VD4A 4D7TA 3C3VA 4G4FA 4M3CA 2NLRA 2P5BA 2XJTA 3P5BA 5SV5A 1GZ9A 2ZBJA 3VBFA 4QMAA 4LORA 4LMFA 2HWD2 4LA2A 3SH4A 1UKGA 1W6MA 1OUXA 5FMOL 3LE0A 1GWMA 3H3LA 4INDA 2JDKA 4KWUA 4BPZA 3VUOA 2Y60A 2FCUA 2XBO2 2X5IA 4WVMA 1KJLA 4Y5Z0 2H6BA 1WMEA 3WP6A 4BQ3A 1PVXA 3CBNA 4HK8A 5FPAA 3BU0A 4HXCA 1GANA 1G9FA 2V5YA 1OOPA 4AF9A 1S2BA 4YNIA 1RIRA 2EXIA 3CKHA 3I2GA 4KG8A 2XR4A 4D8MA 3UETA 1F15A 1LOCA 2RS53 1XE7A 4XDOA 1B09A 3ZSKA 1LHNA 2WZR2 2VMEA 3GCXA 3POWA 4FPEA 3EB7A 1SFPA 2WZPP 5L7OC 1W6QB 2EICA 2Q8DA 3BN6A 3CU7A 4BDVB 2D6NA 4LKEA 3IM0A 3GJAA 3JQWA 2N7GA 5IFTA 4BWOA 2JG8C 2BDRA 3DYOA 1LKNA 4PBOA 4URTA 4GKYA 4L97A 1AR92 4QQOA 3WF1A 2Q1MA 5LRSA 3O1MA 5C8CB 5FP9A 3B93A 4YM3A 5IW0A 1AX0A 3N36A 1DLLA 1MQTC 3LKJA 2GNMA 5APAA 5ISLA 4FPOB 3U10A 1F31A 4YFWA 2A6WA 2JB8A 3V0BA 4FAHA 1QU0A 3RG0A 4CXXA 5HCBA 1Q5OA 4YVWA 4XF3A 2MEV3 1UZ0A 1UOGA 4HVOA 5BPXA 3ZOIA 2C4XA 3BPZA 4LO7A 4XAEA 3BOPA 4AI1A 4YVSC 1RUNA 3INAA 1SQ4A 2ZKLA 4RYDA 4HPKA 3D4KA 1W3VA 2J22A 3ZPOA 2HWC3 2RS11 3IBMA 5C33A 4Z82A 3ZIXA 5FOJB 2BVVA 4GMP1 2Q5TA 5L36A 1NCQB 3ZSMA 4LLFA 5JSPA 4CP9A 3I49A 1BXHA 2YV8A 1HXS1 3POEA 2BRTA 3AVRA 1BBT2 2ADEA 3A0KA 1EPWA 4BMBA 2IC1A 3NMBA 1I6XA 3IDAA 5BXXA 3K4ZA 1QJFA 1PMJX 1FATA 4N7UA 2WRAA 1CONA 1E5RA 4KMQA 4JV4A 3WNNA 2QQKA 3N7KA 4YVWC 5A6XA 4LULA 1F4HA 4AI9A 2W1SA 4HPKB 4MGYE 4Q26A 4AVTA 2UWAA 2GC1A 4KU7A 2JD4A 4A7KA 3ZYJB 2KA3A 4R52A 2QDNA 2B4KA 1QJU3 1ST8A 2JE9A 1H2NA 4CDWA 2QQOA 4W6WA 4JGZA 1AYN2 1ZRDA 1NY71 4CCOA 3FL7A 3NNLA 4GZ9A 3WG3A 4AHWA 4J1XA 4PT6A 4Q4V2 4FFHA 5C3SA 4QAWA 1POV0 4BQ5A 2ZMKA 2BFUL 3DXUA 1LJ7A 2XHNA 4HANA 2YU2A 4K8FA 5FBJA 5FY9A 1AL22 3VBUB 1XRUA 1PGL2 3HQUA 3AL6A 1XYNA 4Q4Y2 1I1EA 1OKQA 3KLSA 4NO4A 5FCCA 3CJXA 5BY5A 4EN7B 1QKQA 2UU8A 2PXJA 1EV12 1PGL1 1WW7A 1Z7S1 4PIYA 5F5AA 2HEWF 4ES8A 5BNQA 4UAPA 1GOGA 5C6CA 1URXA 2HWF1 2WNVA 3KT4A 1SACA 1WD4A 4P9XA 4M4RA 1NYWA 3OUJA 3JD73 5EYYA 4OFGA 1COV3 4XFHA 4F3JA 3G6JB 2WYFA 3QOPA 2JG9B 2R49A 2P6HA 5LBCA 3VLBB 3VZMA 4EWEA 2A6ZA 5GZCA 2XHKA 4ZS2A 3VB9A 2VCAA 3ZX7A 1PNFA 3MF9A 3UKTA 2V4VA 1T6GC 1ONAA 2P2KA 5FP8A 4QU1A 3KQRA 1ULGA 4XCBA 5H9PA 4MGSA 5FZ9A 3V64A 5I0DA 3K75B 2E7AA 4CP2A 2CHHA 1ULFA 1OSGA 1ODMA 3CL1A 2HWF3 1WUVA 1UD1A 2PFWA 3WF0A 3A21A 3WSOA 1OQEA 3IAQA 4FPHA 1GP6A 1PVC1 1DIWA 1Q8OA 2GNDA 3CMGA 1LOGA 4Y24A 5FPVA 3ZYFA 5A1AA 2ZX3A 1W8ZA 1NT0A 1VP6A 1RUD3 1ZYBA 2R063 2TEPA 4WBBA 3FMGA 2WQ4A 4GALA 1UWWA 4LBQB 3GHMA 3ROUA 4FBFA 1COV2 1V6LA 2V5DA 3BALA 4YZ3A 3NSTA 2CWMA 1R1ZA 2IFWA 5HBAA 2P6CA 1ZNPA 1CX1A 1V6JA 4BHPA 1VRBA 4UXAA 3USUB 4QQLA 3RS6A 1EV13 3OB8A 4HN1A 3ACGA 4TXWA 1YXWA 4NAMA 1BVVA 1UW8A 1K5MA 3HJRA 1V9U2 1JU4A 3B7MA 3EO6A 3PUAA 4E27A 1CZTA 1IHMA 2VZ1A 2FHRA 2VBBA 2WFF2 4YGCA 5LA1A 2FDHA 5HCAA 4DEVA 5FPBA 4YW4A 3LA2A 4JRAA 5LA2A 4OHWA 1DQ2A 4KGQA 5GZDA 2RG4A 1AR63 1S4CA 1N1YA 2ZCWA 2QQUA 2VQAA 4I3PA 1AR72 5FFOC 3SCGA 5C5TA 4KI5M 5F1RA 3D8CA 3GCWA 5EJZB 1RITA 3PU8A 3AYDA 3M1HA 5DAPA 5JIAA 1HXS2 2OT7A 1FOD2 1O4YA 3M2MA 4BIOA 4CUAA 1ZBA3 2BWAA 4XFGA 5A7OA 1OUSA 3NV2A 3B01A 4DIQA 1KITA 4X6QB 5FYYA 3DYPA 4YPJA 2WNUA 5JOWA 2FCTA 1WBFA 3U14A 4CEWC 1BMV1 1E5IA 3ZFFC 1WBLA 5J7MA 4A45A 2X05A 4NUBA 3AYCA 4EN8B 4LQRA 1OQDA 2TUNA 2JG8A 2WAOA 1UY2A 4GMP3 3ZFFA 5FMOS 3OY8B 4I0WB 1BBT3 4NPMA 4FCAA 5EHDA 5T55A 3B94A 4EN0A 2XVGA 3NV1A 4V1PA 1D2SA 3NJYA 1NZCA 4OHYA 3WG1A 1RUG3 1ZX5A 4HSJA 1KGYA 4GULA 2J7MA 1HW5A 4UFJA 4NIHA 4XUQA 4Q8LA 1RUE3 3P1IA 4AR2A 1BEV2 2X53S 2WBKA 3BTAA 3BIWE 2VGDA 4LA3A 5FZCA 1CX4A 1RUJ1 3U07A 5BNNC 1RUF3 1ZZ9A 3AZZA 5ACA3 5BNPB 1JU3A 2GZWA 3GGLA 5DZGA 3ZYIB 3LEGA 5F2SA 2Q4SA 2ZXQA 4GJZA 1QJU1 4LUMA 4PDWB 2VVDA 4P02B 4WVVA 4CCLA 1OT5A 1DGRA 2XJVA 2GALA 3HR9A 5TSWA 4BQ1A 4UF0B 3FUOA 4LHKA 4Z2WA 4IE0A 3UV9A 3NO8A 3PUIA 2CY6A 3OYWB 2WS91 2IXLA 4OMDA 2VCMA 4XUTA 5K4LA 2RR11 2J1UA 2ZKNA 2D97A 3AKTA 3O1RA 1XSQA 1Q43A 4K20A 4Y1YA 1D4VB 5I0UA 3VZLA 1X82A 4CDQB 5BV6A 1MEC3 5FZ3A 1YFUA 2KXLA 3PTRB 4QXKA 4R4XA 2JENA 3WW4A 5SV8A 1IQAA 3WQ1A 2WL1A 4WV8A 4MGTA 2VOKA 3HAGA 3LZZA 1W39A 1PO22 5JOZA 1LESA 2UY8A 4AI2A 2QNKA 1W8OA 1DQ4A 2ZZJA 3JD71 5J09A 4LBQD 3RSJA 3WUDA 2DCYA 1JOPA 1NQJA 1X9TA 3OCPA 4XPVA 3VZNA 3K3NA 1LHWA 4IV1C 3T1LA 2VZRA 3IAPA 4XTMA 5CVRA 2VNRA 1H4GA 3FBYA 2ZAHA 2VZSA 4M4PA 4NHXA 3WDWA 1G8WA 3WLUA 4ET7A 2VUDA 3Q8FA 5IYYA 2MPFA 4E2QA 4MXVA 1XNTA 1JW6A 2CSGA 3C7FA 2RDSA 1W04A 2BNNA 1KJRA 5C9AB 5FYTA 4HSLA 4L11A 4YM0A 3MYXA 4QT6A 2HWB3 4IW3A 2WNOA 4YYOA 3UYJA 3WP3A 4FOVA 4JAAA 5GLTA 1Z0HA 1IG0A 4TLGA 3WXPA 5C5UA 2R072 1ZRIA 1UF2C 5JDBA 5FDBA 1HQLA 1S0DA 1LGBA 4DXSA 4EYUA 1W9YA 2CU5A 2YROA 4K40A 1QJX2 4IGQA 3SXWA 1DP0A 2XLFA 4K1ZA 1TME2 1FI2A 4XFCA 1PGSA 2UYBA 5F8PA 1H8TB 1QY4A 3VGIA 1ND3C 4FQ4A 1JH5A 2XLGA 2WUHA 5DDJ1 4CP1A 4MO3M 1A6CA 3EBRA 5FXVA 4ZHNA 2IXHA 3ZN6B 4ATEA 2CV6A 3T0DA 5IWFA 3K3OA 5JZGA 3Q8EA 2XUMA 4JGZC 4MVTA 1UYPA 2AGSA 2Y33A 2I74A 5DG2A 2VZQA 3ALQA 1BKZA 5LK7B 5JXHA 2IVJA 3CJIA 4NE9A 4BISA 1UOBA 4OCTA 3T3YA 3VZOA 4RR3B 4OVEA 5IK4A 1S0FA 5LZ6A 1NCRA 2VNVA 1IG3A 1JUIA 1FPN2 2QZ2A 4ZONA 4MGQA 3WDXA 1PK6A 1VBA3 2GC0A 2VULA 4V2WA 2EXHA 2ZABA 3RZLA 2E6VA 5A3WA 1QQP1 1OOPC 3F2ZA 3FLRA 5LASA 2W1UA 2EXJA 1W05A 2CYFA 1SLCA 4EWDA 1W9SA 1MQTA 1W6QA 3THDA 1OVSA 4JX0A 3WW3A 1VBE1 4C91A 1GZCA 2CGNA 2FBEA 2V72A 3J7MA 4YM1A 4LXLA 5E88A 4AEKA 3VDAA 4CE8A 4KBZA 1WCSA 3QH7A 3O1OA 2ZMNA 3KCYA 3I2FA 2Q0AA 5KC6A 4AEJA 1VBD2 2P34A 5IT6A 1F8VA 1POQA 2CGOA 1JS9A 4ES9A 3NKTA 2EF6A 4EJRA 3DCQA 4I01A 3IZOA 3KT7A 3O1SA 2RE9A 4XFBA 3DPRC 5D21A 2WYSA 2OZ6A 1NX9A 1W0PA 2YG0A 4X8PA 4N53C 2D5HA 2LW8A 4OI0A 1YIFA 2ORZA 4GIQA 4H14A 3BUCA 1IPKA 2WINB 1OQ1A 4JGYA 2PHRA 3WW2A 1AR91 4RR3C 5FPUA 1MVEA 1BCXA 1QNYA 3H8RA 1XXNA 4FXGB 2ZGRA 4COWA 3LPFA 4M0HA 4ASKA 3VBOC 5J96B 3DUIA 5LK5A 5BUVA 3HNBM 1WCKA 1VB2A 1BBT1 3THTA 3J8F2 3S7EA 4JGZB 3ZR5A 2VE1A 2HBUA 4CDUB 5JAXA 1IS5A 5FQ0A 5F3GA 3H7YA 4JTNA 4CUCA 3V0BB 2G9FA 3T08A 1U12A 2LRPA 3OGRA 1CQ9A 1UX7A 2OQ6A 1AJKA 4XZUG 2QZ3A 1VB4A 3SKJE 4W65A 2ZEXA 3VBUA 4AK3A 2VR4A 1ND3B 3RNSA 1FXZA 3GHNA 1YQ5A 3GZUC 3WW1A 4AHXA 3L2HA 2Y0IA 1MEC2 3VD3A 3WF3A 1D2QA 2CTVA 3NAPA 2QE3A 3MFAA 1YJLA 2ERFA 1RC6A 3MPBA 2AZ5A 5FY4A 2DYCA 3J7HA 3WNMA 4CDUA 5DAQA 5F37A 3E1F1 4RL7A 1IS4A 4MH0E 4A44A 1QJEA 1RUJ2 4O65A 4N43C 5CNAA 2AH2A 1GOHA 1C8M3 4A2UA 5C9AC 2VL4A 2WJSA 3I7DA 4QX8A 1NE4A 2HWB1 5F3CA 5FXZA 4CEYA 5GKAC 4Y20A 1YUDA 3DL3A 3EXUA 3UK9A 4XIOA 3CLPA 5K7PA 1PMIA 1YIPA 4IXLA 1JZ6A 1YI9A 1CD3G 2JE7A 3GYDA 4EZ4A 3UESA 3MLKA 4M3CF 1JZ2A 2HYXA 1DGRN 1YFYA 2QTWB 5GLWA 4R9BA 1UYZA 3LA7A 3DECA 4JTOA 4XIKA 1BK1A 1BLZA 3H3ZA 3I3MA 1CVNA 4AYUA 1RHI1 1N1VA 5EJ1B 1T6BX 4CU8A 5K0UC 5LEKA 2JDZA 3KS7A 3NQHA 3MLJA 4W6YA 4JQTA 3ZSEA 2WWJA 4RQPC 2E31A 2GDFA 2Y8KA 1W0OA 3R4UA 4EZHA 1XJAA 3IT8A 4ASLA 5I0RA 1E5SA 4A3ZA 4FPJA 4PI2A 5HV0A 4LK7A 4MV2A 1FPN3 3IPVB 4ZKTB 2BP6A 3THCA 2FCVA 1C8NA 4UW6A 1ULPA 3TBDA 5AFEA 2E9QA 3IN9A 2WT2A 2K2SA 2RM21 2VTFA 2WNVB 3M3OA 1IZ3A 4XXAA 4ISQA 4BQ2A 3MUY1 3BYWA 2PHFA 3CZUA 4XILA 3VKNA 2WSUA 1MZ6A 1HXS3 2YZ4A 5DMYA 5F39A 3VHNA 2JKBA 2HJIA 1R081 2C1FA 2QBXA 2Y6FA 4TZDA 3POBA 5LEJA 4HZFA 3K77A 5FUPA 4QX2A 2VBDA 4LOTA 3KVBA 3GBWA 4HK9A 5F32A 2GU9A 3RZKA 1DGWA 3RWKX 3QBQA 1BJQA 1N3QA 1YRZA 2ZX0A 4OHXA 3DXTA 3ST7A 4XHXA 1XNBA 1GICA 1J3QA 4QDRA 3FN9A 1ZA4A 1UY4A 3JZVA 4PCRA 1V9U3 1LENA 3ACIA 4YZ2A 2F4LA 1JMUB 2EIEA 4JZRA 3VDBA 3WNLA 5CFCB 2ARCA 4AFMA 1ZRCA 3ME2A 4IEUA 4M00A 1F35A 4AAXA 5KHIA 5KR7A 2MNGA 1QXRA 2VMFA 4YGEA 5FKBA 1C8M2 5JR2A 3O1PA 3PMEA 3IDCB 1GP4A 2W39A 4I0BA 4PI0A 3QCWA 4B7KA 3QACA 3KF5A 3UL2A 3ZSLA 5H9RA 1C1LA 2R062 5IVEA 1Y9QA 1REFA 1Y4WA 5C7GA 2BGOA 3USUA 1O5LA 1C5IA 1DHKB 1G9AA 2ZS6B 3D0SA 3ENRA 2JB4A 4NOTA 1W9FA 4RS5C 5C3RA 1NA1A 3I59A 4FQZA 4A4AA 1JZ3A 2W9XA 4RFT0 1MR5A 1LCLA 2AEYA 4WVWA 2HBTA 2P3KA 1YQCA 2R1DA 4ZZ8A 2E51A 2GC3A 2OPWA 1AZDA 1IQDC 4RGGA 1GZTA 1W8FA 2YBPA 3A0NA 5GLVA 4AZZA 2NP0A 4ZU5A 1UZZA 3HEIA 4P9LA 4DS0A 2XPJA 3EJKA 4QHZA 3WD5A 5IK8A 5GLUA 4P9WA 1AXYA 3MPPG 2YB7A 1QDOA 4XBNA 2BFUS 4MZUA 2WNVC 2F4PA 2Q8OA 5CFCC 1OI6A 4BXFA 2A6YA 2ZACA 1CAVB 5LY1A 2ZA9A 1UYYA 5FY1A 4YZ1A 3PTYA 5GLZA 3POFA 3WDYA 1AYM1 1GQGA 2VW2A 1NY72 4HT1T 1WCQA 2R7EB 2XOMA 3T2OA 2K0GA 4NPLA 4UW5A 3JQXA 4YM2A 2OXBA 1HDKA 3POJA 3OSDA 4RQPB 1CESA 3ZDSA 5L73A 4O9GA 2JG9C 4AQSA 4DPNA 4DXTA 1WA4A 4UFHA 1S0JA 2C9AA 4CDXB 2PLV3 2A3YA 2WZR1 2W91A 1QJY2 3A4UA 2WZEA 3A23A 3MW3A 1XBFA 1CJDA 4DFSA 5KXDA 4LO5B 2X29A 2W08A 5JXIA 1UAIA 2D7FA 5GALA 1EV11 4KWLA 2YU1A 4FTSA 4WM8A 1TMF1 5CKMA 3RRDA 1VMHA 2IWGB 1JI6A 4COZA 1W2OA 2WKKA 3BOWA 3ZXLA 4BCUA 4E4SA 2PHLA 3J8F1 2LTNA 1ZM1A 2ZOEB 4AQ6A 2QQWA 2G4IA 2Z2SB 3WNPA 3TEWA 2PA7A 5DXDA 2RS12 2AEZA 1KS5A 1W6OA 4MXWB 2PN5A 4AFAA 4ORFA 1XNDA 4O7XA 4LBQA 5IK5A 2WO3A 3AZVA 4XJWA 3RYRA 3S5QA 2ZGSA 4LIUA 4Q2FA 5E1RA 1A8DA 2QUOA 1GLHA 1VBB3 5K0UB 1S0IA 2WWSA 2ARAA 4AEDC 5AFBA 1WLWA 3O1VA 3Q8AA 1F2NA 2QQVA 1ND2B 1JZ8A 2PAEA 3WINE 4ZY9A 2PHXA 4BK5A 2F17A 1ZBA2 1RB8G 4XURA 1FOD3 2ZGUA 5FMDA 5L9RA 1HQWA 2IXKA 4P14A 1MS4A 3SKVA 3NWKA 2FMYA 1EYBA 5HV4A 1U5IA 1WLCA 2WNUC 1HB1A 5FP4A 3WUCA 3VDCA 3IWZA 2RJKA 4ATFA 3C7GA 5L19A 2O8QA 2BEOA 4A3XA 3AC0A 5FYCA 3CIHA 3WNOA 1RUC3 5KC5A 5K0UA 1PGW2 2YC2A 3LIHA 3GBFA 2UYAA 4PLNA 1AXKA 4IGOA 4XETA 4RFRB 3SCHA 1AR93 1YJKA 4ASMB 5A7NA 2WFF3 3EMRA 1Q8QA 2JDYA 2C24A 3ACHA 4XMIA 4XEZA 4HKWA 4YVSB 3AMMA 3H8OA 3V56A 2EIGA 5FYUA 2J1EA 2IVIB 3WF2A 1HB4A 1US2A 1J1LA 4HKOA 2VQTA 5I0TA 4WVMB 3I3BA 4N53B 3DN7A 3LOIA 2LM3A 3OBRA 5LBFA 2VXRA 4X8NA 4BA6A 3ES4A 2J1VA 5F2WA 4A41A 2XL9A 1RXFA 5LB6A 2WQ8A 3VD5A 5C8CC 3VBFB 4D69A 2Z69A 4RD7A 4PIZA 3N4MA 1X8MA 2UURA 1Q3EA 2BVBA 2C0ZA 1W6MB 1NUKA 2W1QA 2ZGTA 5DUVA 1E5HA 2VC9A 4OHZA 1LOFA 1NCQC 4NWWA 2HWF2 3RVHA 1STMA 4Q0PA 3ACFA 3VBOB 3T2QA 4CCCA 3C7HA 4E2GA 1TZOA 3NJVA 3I3DA 4LO4B 2AACA 5DG1A 5K9YA 2OS2A 1G86A 2FMDA 1PO23 2D6LX 1OOPB 1R083 1IKPA 5IVBA 2PQQA 5JXJA 2GMPA 1QJZA 2GN7A 4Y5TA 1JXNA 1XYPA 4XUNA 4BLIA 2G1MA 4B3NA 1AL0G 2W52A 5KXEA 2GP5A 3J8F3 3PL0A 4Q0VA 1RYYA 2E7TA 5D8AA 1MACA 1W8TA 4L9BA 3B69A 5A33B 3GXUA 2UWBA 3J7NA 3WCRA 4B8EA 3ORJA 1KQRA 2DVDA 1CAUA 5HCFA 1G6NA 4QQ2A 1AVBA 1CIYA 5L9BA 5GZFA 2VZTA 2JEMA 1XPWA 5FZIA 2Y6KA 4IEYA 2B45X 2L9LA 5FKCA 2B9UA 2ILMA 2OZJA 3FC0A 4XAAA 2VG9A 4IERA 4PHZA 1NCQA 3C7OA 1HJFA 3LF7A 3OEBA 5DAVA 3ZKUA 3N9MA 4IE7A 4AQTA 5FQ0B 1PIV3 1U5ZA 3POYA 1AL23 1WMXA 2DDUA 5JVVA 4CCNA 5FBZA 2RS51 4IQPA 3LSEA 1W8WA 1N3PA 1UIKA 3CJIC 5DZFA 1H9WA 2IFRA 3W5NA 4YG3A 3LWCA 4HETA 4MYEA 5T3NA 4PLMA 1CAUB 5FZ4A 4P5HA 1KEXA 2OX0A 3DV8A 3LEIA 2PELA 4S2DA 3VDDB 3W58A 5DQ0A 4GXLA 3GZEA 5CB7A 2R0FA 3ABZA 1OVPA 1PIV1 2CL2A 2VJXA 3WDUA 4Z2AA 4BJ0A 5F9TA 5J1XA 4KL1A 2NQYA 5EIYB 3PUHA 2VMGA 3GM8A 3IKWA 3IB3A 3P3PA 4AVAA 3U37A 2GMMA 1ENQA 3PJQA 3PNAA 2VVEA 5CKNA 2BWCA 1OMIA 1A3KA 4E4ZA 4HOOA 2ATFA 1VBA2 4QB6A 4Q29A 4QQHA 3U11A 2PHWA 3X29B 5KHGA 4B4PA 1YCIA 2FDFA 1UIJA 2W5FA 4MGZE 3KT1A 1VPHA 3S7IA 5C3QA 1KDMA 2HKXA 2DCTA 3I2KA 3N7JA 4K1YA 4Q8KA 3E6CC 1OH3A 1PX3A 3GJBA 3R05A 4D94A 5FPLA 3ZM8A 1SBEA 3K46A 1P8JA 2CDOA 3AKPA 4QB1A 2XVKA 2AUYA 4QM9A 4XJ8A 1YQ6A 1MZ5A 3ZXEA 4CTEA 3WEZA 2V09A 3J7LA 5I93A 2E32A 2QKDA 2ZGPA 3IMMA 5E89A 5F3EA 1GWKA 3MI8A 4OI4A 2EIBA 4M3CE 3ECQA 1DQ0A 1DYKA 2LUWA 2LALA 2NM1A 2DTYA 3FHQA 1VBC3 5I8TA 4Y20B 3PMSA 5JOYA 3OBTA 4DRVA 2RDQA 5T5OA 1JOBA 4Q4V1 3I54A 1RVF2 3PU3A 4NIIA 2VCCA 3WVJA 5AVAA 4CUBA 1QJX3 4NRQA 4GH4A 3O0VA 3ATGA 1V6MA 1ZZ8A 5ABJC 2ZZQA 4CU9A 1POV3 1ZVFA 5CEHA 5IVYA 3AMQA 4HVQA 5K8SA 4Y26A 3WG2A 5FLIA 5HCHA 1E57A 1UMZA 1RUC1 1A78A 1CZVA 3VBSB 1TME1 2DCKA 2ZMLA 1CIWA 4LKFA 4FP2A 1C4RA 1R092 5FUNA 2HWB2 2DV9A 1V6OA 4LE4A 1AJOA 2Q8EA 1VE0A 2BV4A 4PQQA 1WWYA 1J58A 2D40A 1SBFA 4YW6A 2ZGLA 2G9GA 4KWJA 1O4ZA 2RS32 5JMCA 3U4XA 2A70A 1Q8SA 1GWLA 3RI9A 3ZMOA 1F4AA 4FPKA 3E6DA 5KBFA 4DUVA 4QKNA 2ET1A 4CDQC 5KHKA 2XBO3 4UBHA 2QQIA 4LBMA 4G3YC 5JLVA 3MFCA 4XUPA 3H7JA 4FPCA 4COYA 1AX2A 4N43B 3MIFA 5FWJA 1KFXL 1UU4A 4Z07A 5FK7A 1LAJA 3BI3A 2G19A 1OPMA 1KXGA 4IEWA 2PHUA 1DCSA 2BYVE 3W59A 5C8CA 1QXJA 2BBVA 2E26A 2WA4A 3JB8A 2GNBA 4BMEA 2CWSA 3SNMA 4LTAA 4CEWB 4S2FA 5D8AC 2X10A 1VALA 3ZYGA 4CU7A 1OA2A 1W03A 3DKQA 1DGLA 3I2HA 4U2AA 1PO21 1SLIA 1HRI1 4IEVA 4XMAA 3VBRC 5FZ7A 4XTPA 2FQPA 1PO11 3RPQA 1O59A 2XMLA 1LOBA 1FMD1 3ASIA 5FJHA 4YFZA 4L8QA 3UGHA 5FXXA 1EUTA 4CSWA 2XKPA 3BTXA 1XQNA 4XJZA 4BYYA 5AC92 1VBD1 4Q4Y3 3ZYHA 5L9VA 1S2KA 3CHXA 2XL7A 4MHUA 1HV0A 2XB6C 1YNAA 1OF3A 3H1MA 4JQRA 1G9BA 1TMF3 4TSVA 1F5FA 1GQHA 4XVHA 3I3QA 5FZEA 1OURA 1S55A 2WC2A 3VDDC 4AVSA 2ZGQA 1H9PA 1XNAA 3HIFA 5EV7A 3ZFFB 3QH6A 4HBNA 4ZPIA 5B4XA 4DUXA 5IVJA 3MDPA 3GNEA 2VMIA 3OGGA 1AXZA 3UT0A 5A7WA 1RUE2 1QEXA 1GBGA 2KD7A 1ULEA 2XXZA 5EYXA 4IEZA 5FY0A 1Y43B 2PMWB 1IS6A 1C8M1 3MIGA 1EAH2 4AFDA 1CAWB 4NR1A 3E5UA 2D6PA 1VAKA 1FOD1 5T50A 4DXRA 2XWBB 3ON7A 1ZZ7A 4QPIB 3MIDA 4AFBA 3MEPA 3S5AA 1WCDJ 2YBKA 1QF3A 1VBB2 3WNKA 4BQXA 5CG8A 2A75A 1HIXA 4O61A 4AG4A 3N35A 4RHV3 2YFZA 4CA9A 4MHRA 4DINB 1C28A 4GH4C 2WA3A 5HXVA 4CDWC 1F5JA 4DMIA 3HBKA 4GKXA 4GWJA 4RQPA 5E6HA 1QQP3 1W6NB 1RUH1 3N9PA 3MF6A 4XYXA 4YW1A 5JPNB 4Q5OA 1OHFA 1FPN1 4FI9A 5JSOA 3S57A 2WLQA 2VZPA 2W47A 1ASJ3 1YQ8A 4IE6A 1EAH3 4EROA 4H7MA 2D93A 3I59B 1PZ8A 3WQ0A 4QDSA 5BNOA 5M0TA 1G9DA 3ZYRA 1CAVA 2JICA 2DBIA 3OYWA 2XQXA 3W5MA 1SBDA 3CNAA 5CG9A 2YC4A 4P08A 1X9PA 4GB33 1RUH3 4BH9A 4BZ4A 2PAKA 3U78A 3HOBA 4Y22B 4UOJA 1I3HA 3W21A 3WQBA 4IV3A 2RHPA 2YHJA 4E9KA 4DY3A 1W6PB 2D6MA 4PDWA 4RHV1 4D7SA 2XLAA 2VD7A 1V6IA 4JKLA 1I5PA 5F6LB 2ZEZA 1WW5A 1UYXA 1LU2A 4LKDA 1ALYA 4D6SA 3ZR6A 5FO9B 2O14A 1W6OB 2B39A 2OQ7A 4YZ4A 1CAXA 1V6NA 1XYOA 1D7PM 1UMHA 1ZRRA 2UWCA 4QX3A 2Q30A 3ILRA 3JBG2 3VBFC 1B35C 1GU3A 2VZVA 3T0BA 5FZ1A 4D3WA 4C8DA 3P3NA 4P9IA 4CXWA 4AGVA 3JUUA 4UFIA 3MBWA 2WZR3 4XFIA 1PX4A 2Y0OA 1W2NA 4QKFA 3K48A 4TWTA 1HQNA 1DQ6A 1K5JA 4K9SA 1FV3A 3I4IA 3VBHA 1FNYA 5A32B 3VZJA 4OQ8A 2O0OA 1V9U1 1VBA1 2EA7A 3L9JT 1UX6A 4CDXA 2DWRA 2R043 4ISRA 2KM2A 3RYPA 5F5CA 5FYZA 3PUSA 5C4WC 1TMF2 2ZTNA 3KF3A 1JYIA 4AXOA 5CADA 2BW8A 4FSJA 5FWEA 3M3QA 1R1A1 4O9EA 4ONUA 1J84A 1S0CA 1ZZ6A 3ZVXA 3LDKA 1NA1C 1SLLA 2D43A 1DYOA 1YWKA 4C1XA 4E4HA 5A1FA 5FV3A 4FTBA 5EP9A 2RS33 1JTZX 4OQ9A 2E7QA 3ETPA 3FWEA 1WLTA 3M3IA 1AX1A 2UY9A 3M7AA 3J9SA 1OC1A 1X36A 4N53A 5FZ6A 5F7UA 1ND2C 4IV1B 4NIDA 1ZBE2 3JU9A 3LFMA 2ZHNA 1HRV1 2A7AA 1SG3A 1MZFA 2B42B 3D6EA 4HVRA 4XXPA 4OUMA 3ZMNA 2D5FA 4PBPA 3PURA 3WCSA 1DZQA 3SISA 1GUIA 5EFUA 5I91A 3MIBA 4DQAA 2CAVA 3OG2A 1DLCA 1LHVA 4NWVA 3ZFEB 4I09A 1VRH2 5HPOA 2R0HA 1UOJA 2XWJB 4K3UA 4IEPA 3VBOA 2FDIA 1AYM2 1PZ7A 1R64A 2YUEA 4L0PA 2W1WA 2H6CA 3ZKYA 3MIHA 1S2EA 1VRH1 2I2SA 1ZA7A 3BODA 1GFF2 4OI2A 1RVF1 4IETA 3VZKA 1ZREA 3C2UA 3LGRA 4LBKA 3MO4A 4LUKA 1XNKA 2FDKA 2ARXA 4EN6B 1OH4A 4QGMA 4UFMA 1AYN3 2WABA 3RGBA 4NHLA 4A6OA 1DYPA 4CRQA 2EVXA 2VVFA 4BM8A 4FO9A 4PDWC 3U0ZA 2C5DA 1X8EA 4OHVA 1JYCA 3P6BA 4RR3A 5L7OB 3CO2A 4Y1XA 3H8UA 4H2AA 5FY5A 2FZ2A 3LIGA 4EWAA 1QOOA 3HWJA 1K45A 1PVC3 2B8MA 1RHI2 1GOFA 2BQPA 2JKXA 1Q8PA 2WWUA 1QDCA 2WR9A 2WIIB 2XH6A 2ARBA 1RGSA 4GQ7A 4CZSA 4DB5A 4UFLA 3NL1A 4GAZA 1MQTB 5A33A 1B35A 1H2KA 2RVAA 2YMZA 3I8TA 1AUYA 3ZXGA 4A6SA 1LGNA 1W2AX 2E53A 4AI3A 4AW7A 1J59A 3HNMA 5C4WB 2WLPA 3OOXA 1FMD2 1LODA 4LITA 4CCDA 5A3NA 1YFXA 1UY3A 1C5HA 2RM22 3T2TA 4P00B 2W87A 1A34A 3VKMA 3PVEA 2MEV2 2NPIA 1XU1A 4AGRA 1SLAA 2D44A 1NXMA 1JBCA 4WZFA 3UKNA 1O4TA 1W3XA 5JI7A 3ZIWA 4LHSA 4XACA 3O0XA 3W9AA 4DOUA 2W92A 4ARXA 1JZ4A 4Q4W1 3ZXKA 4N8MA 2PTMA 3VL8A 4IE4A 3FLPA 4LLOA 3JCIA 2WO1A 1CR7A 1ENSA 2JDAA 4XF4A 5F6KA 4DRRA 5BNOC 4MSVA 1RJ7A 2XG3A 4EQVA 1RUJ3 4W8JA 2WN3A 3AP5A 4QB2A 3UGGA 4Q4X1 2WFF1 1YHFA 2VCBA 3M70A 3GDBA 4DXZA 5IUQA 1OLME 1W8UA 3ES1A 3NJXA 1ND2A 2W68A 5KHJA 5CA6A 1SEFA 2D3SA 2CNAA 4J25A 2RS52 2K46A 3A22A 3T1MA 3KD4A 3MICA 4EN9B 3VN4A 4QGNA 3UGFA 1D4M1 4QHOA 3RMYA 1W8HA 2OKXA 2EAKA 4UWDA 4XQDA 3SMHA 1GR3A 3GF6A 2DFCA 1JZ7A 5FIXA 1KD7A 1VBC1 1DF0A 1PIV2 3TN91 4ZU7A 4XBQA 1SFYA 1AYM3 3HT1A 1K3IA 4UW4A 3BGAA 4CEYB 1EAH1 1SPPB 3GZTB 4W50A 5A3PA 1HRI3 3WR0A 2DCZA 2WDBA 4BQ4A 2VH9A 2HWE1 1BQPA 1O8SA 2HWC1 2HWD3 4GH4B 1UPIA 4KWKA 4DEQA 4MUVA 2OUHA 2C9KA 5T5LA 4QPGC 3KZ4C 4XFAA 5BYNA 4Z1VA 3AJYA 3AM2A 4LBNA 4Y1UA 2EALA 1DZTA 2PHDA 4IEOA 1H8TA 3HPNA 3NJZA 1XNCA 3U4SA 4HLTA 1Y9MA 4HL0A 4IEXA 1AR61 3T30A 1H4HA 1G7YA 3SC7X 4A7ZA 4EV0A 2AREA 4RS5A 1C3HA 3H42B 2P3JA 1BYHA 1PGW1 2J1RA 3VBRA 2WSVA 4OUSA 5LWBA 2XJSA 3B00A 5C3OA 5J48A 1SLBA 1UXZA 1OFSA 5A7PA 1JZ5A 3I2DA 2QQPA 3RZHA 4OZXA 2YPJA 4IDZA 2RR13 2TNFA 2JDHA 3B9IA 3OUIA 1NE6A 4NN0A 2NMNA 1R091 5FJKA 4YW2A 3I3EA 4FPFA 4PJYA 4R9AA 5E16A 3AYEA 1RUC2 2TBVA 4N9HA 1QMJA 2OYZA 1ACCA 1UOFA 5FP7A 1N1SA 2R042 5LBBA 4J1WA 4JGYC 3AXDA 1UN1A 3HBZA 4QXBA 1N1TA 3VBHC 1RTVA 5ERLA 1TE1B 3LDBA 2R1BA 3AZYA 1V70A 3DKWA 4MOAA 1WW6A 5C3PA 3LB9A 4XUOA 4XC9A 5D8AB 1U5YA 3OD0A 3RWNA 3WG4A 3ZLIA 4AVCA 4BQWA 4NIGA 1LECA 1GV9A 2RDRA 3URFA 3OUHA 1IPSA 3BTZA 1UQXA 2R16A 3VBSA 2HYKA 4Y3OA 3VHPA 1NZIA 5EWSA 3BU7A 1YYNA 2BU9A 1ENRA 3H0OA 3N3HA 2JECA 1UCXA 5F3IA 3VV1A 5C71A 2P4EA 1W9WA 4XF9A 2WZ8A 4QM8A 4AAPA 5KXBA 2A1XA 5DABA 1O3TA 3RZZA 4KGGA 3T09A 5HI0A 1DU3D 2W94A 3RZJA 1UXXX 2QQLA 3WHUA 4FFGA 5D1IA 4BU2A 4YRDA 2G9ZA 1J1TA 2RS13 5F5IA 5FYVA 3LFIA 5FZFA 4CUGA 4LT5A 1DDLA 3PLQA 3MGUA 5EPAA 4E2SA 2QCSB 2E33A 1CPMA 4JHZA 2WT0A 3ZO0B 4XCAA 3POGA 1L3JA 3OF1A 5C8WA 3RQ0A 2W3JA 1NCRC 2RMU2 3IIIA 2HWE3 3KHBA 4JGYB 4XJUA 5FO7B 3WP4A 1HB2A 4Q0QA 1QWRA 1NOVA 2EAAA 1NXD1 4N43A 4NJ4A 4D0QA 1ASJ2 3OD4A 3SH3A 3ZFGB 4OZOA 3THPA 2PAMA 3ETQA 4YGDA 5CFDB 1W8NA 1MEC1 3NVCA 4CDUC 1BVP1 1S0EA 2I07B 1ZBE1 2QJVA 3O5SA 4IL7A 4CP9B 1GNYA 2JE8A 1UU6A 2Y6LA 4JCKA 3UNPA 1IGOA 4E4DX 5JZGC 5LW9A 1V00A 1H0BA 3J4UH 2EXKA 3KGLA 1AF9A 3KWVA 2NYYA 3SQOA 3VD9A 5CIRA 4NMIA 2DVFA 2VPVA 4XFFA 2YGMA 5JPMB 1LB2A 4UW3A 3KV9A 4UYBA 1XSRA 1QJX1 1ZRFA 1VAMA 3HN1A 5IVVA 1ND3A 1W28A 1H1IA 2OIIA 5A1LA 4BB3A 4NRPA 3ZFGA 4LO8A 1DQ1A 3ZN5A 4WVZA 2B46X 2Q1ZB 5CFDA 2AYHA 2GNTA 3D5OA 5DZEA 4JKKA 3H1WA 3LAGA 4DNYA 1LULA 4YG0A 5FREA 4XF0A 1HLCA 4YWAA 2C6SA 3HQRA 1SHWB 2V4AA 3ZXAC 1QJY3 1WA6X 1OA3A 2PLV2 1D0GA 1LGCA 3OBZA 3ZPYA 4S2HA 1YI7A 4P9YA 5FY7A 1JYNA 2QVSB 5JIUA 3BB6A 2RS31 5EJ3A 1HN1A 2HEVF 3VKOA 1K42A 1CAXB 2VQUA 3S30A 2IZWA 3H8XA 4LBOA 1GSLA 1F9KA 1K5MC 2VQ0A 1WKYA 1YC61 3AKQA 1FX5A 1RUI3 2J1AA 3OBAA 1WGPA 1T2XA 4GD4A 1JYVA 5I8YA 4NAOA 2HWD1 4R8HA 4QPIA 4LJHA 3R6SA 3TN93 4GWMA 5FPXA 1CWPA 1DZRA 2MEV1 3T2PA 4ZXEA 3PVOA 3UJOA 5FZKA 4L99A 4BK4A 3BPSA 3JB4C 5DPNA 1HV1A 2E63A 1GNZA 2WQZC 4QDQA 2X8KA 5DDJ3 1Z7S3 2P17A 3MUZ1 4NHYA 2BOJA 5CKQA 3K4AA 3SHRA 5IATA 4K21A 4HN0A 1FYUA 2VUAA 1UZVA 2W46A 4IV3C 4Y4YA 1RUF2 5FYIA 3JBG1 5ACA2 3NW4A 1RL3A 5BNOB 1O3SA 3IMNA 2GC2A 3FZ3A 4WM7B 5ABJA 2J42A 3IPVA 4MX3A 1L7LA 4Q4X3 3E97A 3LD8A 1AR83 3HQXA 1FT9A 2BERA 4FTEA 4Y5SA 2A6XA 2B5HA 3IIAA 4DUWA 2BPA2 4YW7A 1VBE2 1MS0A 2VZUA 3UJQA 1RUG2 3G7DA 4LIVA 5DUWA 3WQ7A 1W6PA 2BNOA 3OGVA 1PHMA 1V0AA 2X09A 5AVPA 1LOAA 5FP3A 1VR3A 1O7FA 3ACLA 1LHOA 5ANQA 4XBLA 4CCMA 1D0HA 4I30A 4AEMA 3K51A 1US3A 2YPDA 3C7EA 4NIAA 4UT5A 4LE3A 1R093 1EUUA 3RMXA 2OVUA 4CEWA 3B3QE 4HONA 1XE8A 1PMHX 2ZEYA 4AHZA 4LHLA 1N3OA 4F8AA 3AFKA 3H1YA 4AWDA 1O8PA 4PIXA 1QOSA 3BVCA 1LNSA 3AVSA 2DUOA 4Y4RA 2H0VA 4FOQA 4FPLA 2RMU3 3KV5A 5KHHA 1YQ2A 1SDDB 2VOVA 1ZZBA 4K6BA 1RMU2 4K8RB 3TNPB 1VBC2 4LPLA 2ZAAA 5LBEA 2DCJA 2CGPA 3AZWA 1IPJA 1ZBA1 5FUIA 1VIWB 2NN8A 2QQNA 4LHNA 4MLOA 3D0JA 2ZGNA 1AR62 1TEIA 1RMU1 1M4WA 4DO0A 2VMCA 3R0RA 3CDZB 4F83A 4Z92B 3KCXA 4Q1PA 1ASJ1 3B9CA 1YLLA 2IUWA 4M01A 2W95A 5GZGA 2ZHKA 3HD8B 2O1QA 1PO12 4XQ4A 1RUI1 5A3MA 4H55A 3WV6A 4XDPA 3LPGA 3D3AA 4I0AA 4NRMA 4ZZ5A 3AP9A 4MADA 4Y1VA 1K12A 2GMEA 4V2VA 1MVQA 5GM0A 1AYN1 3Q8BA 4XDQA 3WX5A 2JDNA 4S2GA 2YYOA 3RYKA 4SLIA 5FYBA 3ZFEC 1D4M3 1KDKA 5FOBB 2VW0A 3CZJA 1HN0A 3ITQA 3TNQA 2WNEA 3AZXA 1NQDA 4HKLA 4AOCA 5JZGB 4ZU4A 5CBLA 1MS1A 5LCWL 4KBBA 4AEDA 2VMHA 1DBNA 1OXCA 4D6RA 3UKVA 1IS3A 1FV2A 1AR81 2D98A 1W2TA 3PVBB 5FXWA 1XE0A 3I2IA 3WDTA 5L7OA 2ORXA 3MV01 1PM7A 2ZGMA 5JR7B 1FAYA 5FYHA 3ZXDA 3PJYA 3SLIA 2PLV1 2WNUB 4GJYA 1U0AA 1AR82 1NCRB 1OFNA 2Y64A 5BNPC 3NNJA 3ILFA 5IAXA 2A71A 1O3RA 1BHGA 5DN2A 4F7ZA 3PUQA 1W9TA 3AP6A 2JIJA 4KNCA 4Q4W3 2WAAA 5A3LA 2VBPA 1W99A 3S6PA 4LR4A 1XU2A 1Z7S2 4JC1A 1S0BA 2Q1FA 1RUOA 2WO2A 4JVAA 4FFFA 5EXOA 2NZ9A 1JHJA 5FZOB 2DU0A 1J83A 3WDVA 3KMHA 4QPYA 4BIFA 4ZS3A 4FP3A 5FO8B 3V0AB 4JRLA 5LRRA 5CISA 4OULA 5IVCA 5T52A 1DG6A 1UPSA 2DTWA 2X5IC 3A7QA 3HVDA 4WZCA 3AP7A 5J3UA 1Y7BA 4AI0A 3E5XA 3N7MA 1NLQA 3DGTA 5EZWA 1HRI2 1LEMA 3DF0A 2DFBA 3N7LA 1OF4A 2K9ZA 3FJSA 4OYUA 4Q4W2 2WS93 1NLRA 4LOSA 1UL9A 1KFUL 2JDPA 4Q1RA 3POIA 5JXGA 5A80A 1UU5A 2VY0A 1GKBA 2GAUA 3GBGA 1B35B 1ODNA 1R082 5FZOA 3USSA 4B1MA 2RMU1 4CU6A 1KRIA 1W06A 1S1AA 4QX1A 1COV1 2ZGKA 1J3PA 2IXCA 4QU2A 5CZKA 5FPZA 3ZYPA 3RJRA 5A6YA 3O7OA 3V0AA 4Z8BA 2QDRA 4CDXC 2ZPXA 2Y38A 4IGPA 4IEQA 3KHCA 1OLQA 2P3IA 1XB9A 3ZXJA 4CDQA 3M8LA 4IESA 4QPGA 1X50A 2DU1A 2Y6JA 3AL5A 3QD6A 3VHOA 1Q8VA 2HH9A 5FYSA 3WOGA 1GNHA 4X6RB 4XJ9A 2BGPA 1QHDA 1VMFA 2DBNA 4FT8A 1EY2A 2A3XA 4GMP0 3NNMA 4META 2H0BA 5IFPA 1D4M2 1AR71 2JDMA 3BCWA 3D82A 2XUEA 4GWNA 3T4HB 2GH2A 2KR2A 2VNOA 1RINA 3CQOA 3AKRA 4M3CB 4LO6B 1G9CA 1WMDA 4QX0A 1OPOA 4I02A 2PHTA 3ZN4A 4B4RA 3I97A 4CXYA 1RUD1 4QPGB 4Y1ZA 1PO13 3EYPA 4CDWB 2QFEA 2D6OX 5BNNA 1TVGA 4N9IA 1H2LA 4YW5A 2HWC2 3NV3A 5JSRA 4YVSA 3C8XA 1GZWA 2HEYF 3ZFEA 3AFGA 4COUA 5FR3A 1BMV2 5EQUA 4CCKA 4TN7A 4AFCA 2PYTA 1Y3TA 1J3RA 5D2AA 4BOWA 3O12A 3OTFA 4Q0UA 4KQ7A 2FZ1A 2EIDA 4RS5B 5JOXA 1UZYA 3MZHA 1RMU3 3TEZA 4LKSA 4YZ5A 3WF4A 1HKDA 4JHTA 4WM8C 5T5JA 1JYXA 4QHBA 2YFUA 2DF7A 1XC6A 3FBMA 3KSCA 2GH8A 3PIGA 4KG0A 3VHRA 1JN2P 2MHFA 4C0BA 4QPWA 2FDGA 4XABA 5JI9A 4Q0SA 1OD5A 2J1SA 4RA0A 5A7SA 1GZWB 3B02A 4C0HA 1W90A 2VW1A 4RSUA 4FFIA 5A3OA 3OGSA 2XJRA 2CDPA 3O1TA 2JG9A 2SBAA 3BTYA 3E6BA 4H7LA 1CN1A 1QJY1 3F95A 2VTXA 1EP0A 2R041 4LBJA 4XE9A 5G05L 3KQ4B 3VBRB 2DVGA 4JDOA 5F5QA 1FNZA 1TNFA 4JDNA 4UBGA 5FYMA 4DZGA 4YARA 3RZGA 2RJLA 4P9JA 5FAXA 1UO9A 2Y26A 3N9OA 1XOYA 1VMJA 5LY2A 1RUG1 3VBUC 3NNGA 3MW2A 4QX5A 2AC1A 2X5IB 2YXSA 3KV6A 5ANNA 5FLHA 2DURA 4C1WA 3NV4A 4YGBA 3MIEA 4GB31 2FDJA 5G04L 2R073 3L2YA 1RXGA 1VJ2A 1MS5A 2AR6A 1REDA 4Y33A 1ULCA 1NKGA 2ZEWA 4AI8A 5T5PA 4HFSA 4FVVA 3LCPA 2WS92 5C70A 5DAWA 4KH9A 5B2GB 4QKDA 4YG6A 1UMIA 2BBAA 1BZWA 1OKOA 3CF6E 3EQEA 3AMHA 3WZ1A 5FZBA 2JWPA 4A7YA 4YVWB 1JUHA 1KS4A 4BXSV 2ZHLA 5LATA 5HXMA 4XW3A 2XGXA 2VMDA 2VOTA 1RUI2 5DUUA 2ET7A 5A7WB 1C1FA 1CGPA 5I0SA 1X33A 4CP0A 2JX9A 2YY1A 2VTXJ 5FZ0A 3PIJA 3KV4A 3LDRA 4LK6A 1AHSA 3TEXA 1CAWA 3GZAA 5IJRA 4BE3A 1NLSA 1LR5A 4IUGA 2A3WA 3WY6A 4CPBD 2XDVA 4JKMA 4PF5A 3AYAA 1H6YA 2WN2A 3O1UA 3S0MA 3HMYA 3TB0A 4N7IA 4COVA 3FE5A 3HN3A 3Q9OA 2YGLA 3AX4A 4G9SB 4SBVA 4R9CA 5GZEA 1LU1A 4ZXKA 4PF1A 5H9SA 1BEV3 1VAVA 4B7EA 1NA1B 2WO7A 5FZMA 2OW4A 1SPPA 2CAUA 1WZXA 1AL21 2Z4FA 3NNFA 2Z42A 2DUQA 3E5QA 1POV1 2AENA 1LOFC 2VUCA 3AMNA 3KGZA 5I8SA 5FMCA 1O91A 3T4VA 2XONA 2JXAA 4TTGA 1JODA 1O6UA 4N90A 1OA4A 4D6QA 1UY1A 1IOAA 3TAYA 4OMCA 2B9VA 4Y22A 1DGWX 2JG8B 4B29A 2FD8A 1MPXA 1SZBA 3WNXA 3VD7A 3OY8A 3AXEA 5FZHA 2I45A 1W0NA 2O8OA 5FLJA 2JIGA 2YDEA 4K7JA 5IK7A 2IXIA 3I2JA 3U1XA 1OLMA 2BGCA 3W20A 3ELNA 4CCEA 1OBNA 4YLZA 5A3TA 1QOTA 4FXKB 1QXPA 2GN3A 2LROA 3OGJA 1PZ9A 4P5YA 1RUH2 3NRUA 3VKFC 4WM7A 2VNGA 2HWE2 4U36A 2RM23 3R4SA 5T54A 4AVBA 2VAUA 2BOIA 5DUXA 1YO8A 3DPRA 2HLEA 2ES3A 5B4NA 3TEYA 4IV3B 3RFRA 1GMMA 4OLLA 1CZSA 1VBB1 4I3GA 2F6BA 1O5UA 3OPWA 4I2OA 2XBO1 4XJAA 4TYSA 4CPBA 1QQP2 5A32A 5A7QA 4B4QA 2XKOA 5FTTC 2P1BA 4RHV2 2WT1A 1LTEA 3RZMA 1RHI3 5H9QA 4XZPA 5A6QA 5J36A 2OPKA 4WM8B 3FFZA 5FZAA 1DFQA 2Y34A 1TNRA 3DPRB 4HMZA 1S0GA 5CAZA 1APNA 5JWPA 3I2OA 3LSDA 1REEA 2OA2A 2QQJA 2ZX4A 3GALA 2YBSA 4WM7C 4XF1A 1GQPA 2Y6GA 4PQ9A 3MLLA 2W2IA 1YEWA 4QQPA 1RUF1 4L2NA 5ACA1 4MXWA 4C90A 2A5ZA 2VUJA 1AR73 3ZXFA 4FAGA 1ZZCA 2LS6A 1MZEA 3Q8CA 3AP4A 4PLOA 2B7YA 1TQ5A 4GWIA 1M06G 1OD3A 3NAPC 2ZGOA 4QPIC 2P3YA 5IVFA 3FUQA 3POSA 4KU8A 4RGAA 2D6KA 4QWNA 4AGGA 5IAVA 1VBE3 3PHMA 4M0NA 4FPGA 3LQCA 3V65A 1HJGA 2RR12 4YW3A 4A42A 4Q4X2 3OEAA 1I9RA 1UY0A 3NKGA 4XHBA 1HRV3 4OI1A 1R1A2 1K5MB 4R9DA 2A6VA 3DEMA 2Y6HA 3OPZA 3VKLA 1U5XA 5CFCA 1LRHA 3OPTA 5LA9A
chains in the Genus database with same CATH topology
2R061 1WW4A 5DDJ2 3SITA 5JCTA 2IXJA 3VL9A 1RUD2 3WT3A 3JD72 5CFDC 3TN92 1GYKA 5KWRA 3ZFGC 3O0WA 3AKSA 4LEJA 1VLNA 1R1A3 1HRV2 1ENXA 3CEWA 5E8AA 3ILNA 3AMPA 2W0XA 4FPYA 3WHTA 1YFWA 4AHYA 1H8TC 4NPRA 3LOBA 4LBLA 1Q56A 5FRAA 4GA9A 3KM5A 1H1MA 2A73B 3AB0A 1NG0A 4MGIE 4FOWA 1PNGA 5BNPA 1JOJA 3ZN6A 4QGLA 3M3CA 3IDEA 1QGLA 4XQWA 1W6NA 3H9AA 2XJQA 1SDWA 2GSYA 1QJU2 1QH7A 3APBA 2VOWA 2BNMA 1WMFA 3J26N 4NHMA 4R4ZA 1V6KA 4D7YA 2ZX1A 1I5ZA 4DY5A 2D3PA 2ETEA 1PK6C 2XJUA 1BEV1 3AK0A 3JBG3 2BUKA 1SCSA 1PK6B 1RJ8A 1SCRA 2D3RA 4QD2A 1X7NA 3QLQA 1RVF3 2ZHMA 3RI8A 3MW4A 1JHNA 4AEDB 3B5LB 1QNWA 1EPZA 1LOEA 3H3UA 4Q4V3 1VBD3 4Q4Y1 5C4WA 2R6QA 2R32A 1CJPA 1LEDA 2DUPA 2DVBA 1H2MA 1Z78A 4GB32 4XOGA 1FMD3 3EHKA 3HT2A 5ABJB 4L92A 2OUJA 3LA3A 2NMOA 4AQ2A 1C57A 2ENRA 1SFNA 1H30A 1IKQA 1LHUA 5J98B 2WFPA 3FHIB 2V73A 2ZX2A 3VBHB 1QH6A 1WD3A 5KXCA 3TRSB 3OJBA 1PVC2 3ZSJA 3SCFA 3FX3A 3IDBB 3PVNA 3R4DB 3VDDA 4TLFA 2YC0A 4J6GA 3VBSC 4P9GA 5AC91 2SLIA 3TWIA 1H1AA 3FFQA 1H8VA 2P37A 5BNNB 1N47A 3KCCA 1W2UA 2R071 4H3WA 2Z79A 2DVAA 4CYDA 1O3QA 3M3EA 1SMVA 2JJ6A 4AE2A 3TOJA 3AJZA 1MS3A 1RUE1 1A8MA 4FOYA 4ITCA 4W6XA 1HX6A 3FLTA 4NHKA 3TYJA 2BTVC 1DQ5A 1WLDA 4IV1A 4NVPA 1TME3 2XVLA 1UKRA 4YSFA 1VRH3 5J37A 3O14A 3NAPB 5AC93 4LNVA 1ULDA 2ZJCA 2VOXA 1CPNA 3SH5A 1OLRA 4AVVA 3KB5A 1MS9A 2Z5WA 3H50A 4JDMA 1MS8A 2XJPA 3CJIB 2VU9A 2R30A 5GJ6A 3RJ2X 4BLJA 4CEYC 4Q27A 1ZBE3 3RDIA 3WP5A 5C9AA 2VECA 5CU1A 4MGKE 1SLTA 3M4FA 4D7TA 3C3VA 4G4FA 4M3CA 2NLRA 2XJTA 5SV5A 1GZ9A 2ZBJA 3VBFA 4QMAA 2HWD2 4LA2A 3SH4A 1UKGA 1W6MA 5FMOL 4INDA 4BPZA 3VUOA 2XBO2 2X5IA 4WVMA 1KJLA 4Y5Z0 2H6BA 1WMEA 3WP6A 1PVXA 4HK8A 1GANA 1G9FA 2V5YA 1OOPA 4AF9A 1S2BA 4YNIA 1RIRA 2EXIA 4KG8A 1LOCA 2RS53 1XE7A 1B09A 3ZSKA 1LHNA 2WZR2 3POWA 4FPEA 2WZPP 5L7OC 1W6QB 3CU7A 2D6NA 3IM0A 3JQWA 2N7GA 4BWOA 2JG8C 1LKNA 4PBOA 4URTA 4GKYA 4L97A 1AR92 4QQOA 2Q1MA 5LRSA 5C8CB 3B93A 4YM3A 1AX0A 3N36A 1DLLA 1MQTC 3LKJA 2GNMA 4FPOB 3U10A 1F31A 4YFWA 2A6WA 3V0BA 4FAHA 1QU0A 3RG0A 5HCBA 1Q5OA 4YVWA 4XF3A 2MEV3 4HVOA 5BPXA 3BPZA 4LO7A 3BOPA 4AI1A 4YVSC 1RUNA 3INAA 1SQ4A 2ZKLA 4HPKA 3D4KA 2HWC3 2RS11 3IBMA 5C33A 4Z82A 3ZIXA 5FOJB 2BVVA 4GMP1 2Q5TA 5L36A 1NCQB 3ZSMA 4LLFA 5JSPA 1BXHA 2YV8A 1HXS1 1BBT2 3A0KA 1EPWA 4BMBA 2IC1A 1I6XA 5BXXA 4N7UA 1FATA 1CONA 4JV4A 3N7KA 4YVWC 4LULA 4HPKB 4MGYE 4Q26A 4AVTA 2UWAA 2GC1A 4KU7A 2JD4A 4A7KA 3ZYJB 2KA3A 4R52A 2QDNA 1QJU3 2JE9A 1H2NA 4CDWA 4W6WA 4JGZA 1AYN2 1ZRDA 1NY71 3WG3A 4AHWA 4J1XA 4Q4V2 1POV0 2ZMKA 2BFUL 1LJ7A 4HANA 4K8FA 1AL22 3VBUB 1XRUA 1PGL2 1XYNA 4Q4Y2 1I1EA 1OKQA 3KLSA 4NO4A 5FCCA 3CJXA 5BY5A 4EN7B 1QKQA 2UU8A 1EV12 1PGL1 1WW7A 1Z7S1 4PIYA 4ES8A 2HEWF 5BNQA 5C6CA 1URXA 2HWF1 2WNVA 3KT4A 1SACA 1WD4A 4P9XA 1NYWA 5EYYA 3JD73 4OFGA 1COV3 4XFHA 4F3JA 3G6JB 3QOPA 2JG9B 2R49A 3VLBB 3VZMA 4EWEA 5GZCA 2A6ZA 2XHKA 3ZX7A 1PNFA 3MF9A 3UKTA 1T6GC 1ONAA 2P2KA 3KQRA 1ULGA 5H9PA 3V64A 2E7AA 4CP2A 1ULFA 1OSGA 3CL1A 2HWF3 1WUVA 1UD1A 2PFWA 1OQEA 4FPHA 4Y24A 1PVC1 1DIWA 1Q8OA 2GNDA 1LOGA 2ZX3A 2R063 1VP6A 1RUD3 1ZYBA 2TEPA 4WBBA 3FMGA 2WQ4A 4GALA 4LBQB 3GHMA 3ROUA 4FBFA 1COV2 1V6LA 3BALA 4YZ3A 3NSTA 2CWMA 1R1ZA 2IFWA 5HBAA 1ZNPA 1V6JA 4BHPA 4UXAA 3USUB 4QQLA 3RS6A 1EV13 4HN1A 1YXWA 1BVVA 1UW8A 1K5MA 1V9U2 3B7MA 3EO6A 4E27A 1IHMA 2FHRA 2WFF2 4YGCA 5HCAA 4YW4A 3LA2A 4JRAA 4OHWA 1DQ2A 4KGQA 5GZDA 1AR63 2ZCWA 1N1YA 4I3PA 2VQAA 5FFOC 1AR72 3SCGA 5F1RA 3D8CA 1RITA 3AYDA 3M1HA 5JIAA 1HXS2 4BIOA 1FOD2 1O4YA 3M2MA 1ZBA3 2BWAA 4XFGA 3NV2A 3B01A 1KITA 4X6QB 2WNUA 5JOWA 1WBFA 4CEWC 1BMV1 3ZFFC 1WBLA 5J7MA 4EN8B 3AYCA 1OQDA 2TUNA 2JG8A 4GMP3 3ZFFA 5FMOS 3OY8B 4I0WB 1BBT3 4FCAA 5T55A 3B94A 4EN0A 2XVGA 3NV1A 4V1PA 1D2SA 1NZCA 4OHYA 3WG1A 1RUG3 1ZX5A 4HSJA 4GULA 1HW5A 4Q8LA 1RUE3 1BEV2 2X53S 3BTAA 3BIWE 2VGDA 4LA3A 1CX4A 1RUJ1 3U07A 5BNNC 1RUF3 1ZZ9A 3AZZA 5ACA3 5BNPB 5DZGA 2GZWA 3ZYIB 2Q4SA 1QJU1 4LUMA 4PDWB 2VVDA 4WVVA 1DGRA 2XJVA 2GALA 3HR9A 5TSWA 4BQ1A 3FUOA 4LHKA 4Z2WA 3UV9A 3NO8A 2CY6A 3OYWB 2WS91 2IXLA 2RR11 2ZKNA 2D97A 3AKTA 1Q43A 4K20A 4Y1YA 1D4VB 5I0UA 3VZLA 1X82A 4CDQB 5BV6A 1MEC3 1YFUA 2KXLA 4QXKA 4R4XA 2JENA 3WW4A 5SV8A 1IQAA 3WQ1A 2WL1A 4WV8A 2VOKA 3HAGA 3LZZA 1W39A 1PO22 5JOZA 1LESA 2UY8A 4AI2A 2QNKA 3JD71 1DQ4A 2ZZJA 5J09A 4LBQD 3RSJA 3WUDA 2DCYA 1NQJA 3OCPA 4XPVA 3VZNA 1LHWA 4IV1C 3T1LA 4XTMA 5CVRA 2VNRA 1H4GA 3FBYA 2ZAHA 3WDWA 3WLUA 1G8WA 2MPFA 4E2QA 4MXVA 1JW6A 2BNNA 1KJRA 5C9AB 4HSLA 4L11A 4YM0A 3MYXA 4QT6A 2HWB3 4YYOA 3WP3A 4FOVA 4JAAA 5GLTA 1Z0HA 3WXPA 2R072 1UF2C 5JDBA 5FDBA 1HQLA 1S0DA 1LGBA 2YROA 4K40A 1QJX2 3SXWA 2XLFA 4K1ZA 1TME2 1FI2A 4XFCA 1PGSA 2UYBA 1H8TB 1QY4A 3VGIA 1ND3C 4FQ4A 1JH5A 2XLGA 5DDJ1 4CP1A 1A6CA 3EBRA 2IXHA 3ZN6B 4ATEA 2CV6A 5JZGA 2XUMA 4JGZC 4MVTA 2AGSA 2I74A 5DG2A 3ALQA 1BKZA 5LK7B 3CJIA 3VZOA 4RR3B 4OVEA 5IK4A 1S0FA 1NCRA 1JUIA 1FPN2 2QZ2A 3WDXA 1PK6A 1VBA3 2GC0A 2VULA 2EXHA 2ZABA 2E6VA 1QQP1 1OOPC 3FLRA 2EXJA 2CYFA 1SLCA 4EWDA 1MQTA 1W6QA 3WW3A 4C91A 1VBE1 1GZCA 2CGNA 2FBEA 4YM1A 5E88A 4AEKA 1WCSA 3QH7A 2ZMNA 3KCYA 2Q0AA 5KC6A 4AEJA 1VBD2 2P34A 5IT6A 1F8VA 2CGOA 4ES9A 3NKTA 2EF6A 4EJRA 4I01A 3KT7A 2RE9A 4XFBA 3DPRC 2OZ6A 1W0PA 4X8PA 4N53C 2D5HA 4OI0A 1YIFA 4GIQA 4H14A 1IPKA 2WINB 1OQ1A 4JGYA 2PHRA 3WW2A 1AR91 4RR3C 1MVEA 1BCXA 1QNYA 1XXNA 4FXGB 2ZGRA 4COWA 4M0HA 5J96B 3VBOC 3DUIA 5LK5A 5BUVA 1WCKA 1VB2A 1BBT1 3THTA 3J8F2 3S7EA 4JGZB 4CDUB 5JAXA 1IS5A 5FQ0A 3H7YA 4JTNA 3V0BB 2G9FA 1U12A 1CQ9A 1AJKA 2QZ3A 1VB4A 4W65A 3VBUA 4AK3A 1ND3B 3RNSA 1FXZA 3GHNA 3GZUC 3WW1A 4AHXA 3L2HA 2Y0IA 1MEC2 1D2QA 2CTVA 3NAPA 2QE3A 3MFAA 1YJLA 2ERFA 1RC6A 3MPBA 2AZ5A 2DYCA 4CDUA 4RL7A 1IS4A 4MH0E 1RUJ2 4N43C 5CNAA 2AH2A 1C8M3 4A2UA 5C9AC 3I7DA 2WJSA 1NE4A 2HWB1 4CEYA 5GKAC 4Y20A 1YUDA 3DL3A 3EXUA 3UK9A 4XIOA 3CLPA 5K7PA 1PMIA 1YIPA 4IXLA 1YI9A 1CD3G 2JE7A 3GYDA 3MLKA 4M3CF 1DGRN 1YFYA 5GLWA 4R9BA 3LA7A 4JTOA 4XIKA 1BK1A 3H3ZA 1CVNA 4AYUA 1RHI1 1N1VA 5K0UC 5LEKA 2JDZA 3KS7A 3MLJA 4W6YA 3ZSEA 4RQPC 2GDFA 3R4UA 1W0OA 4ASLA 3IT8A 5I0RA 4FPJA 4MV2A 1FPN3 3IPVB 4ZKTB 1C8NA 4UW6A 3TBDA 5AFEA 2E9QA 3IN9A 2WT2A 2K2SA 2RM21 2WNVB 3M3OA 1IZ3A 4XXAA 4ISQA 2PHFA 4XILA 3VKNA 2WSUA 1MZ6A 1HXS3 2YZ4A 3VHNA 2JKBA 2HJIA 1R081 2C1FA 4TZDA 5LEJA 4HZFA 3GBWA 4HK9A 2GU9A 1DGWA 3QBQA 1BJQA 1N3QA 1YRZA 2ZX0A 4OHXA 3ST7A 4XHXA 1XNBA 1GICA 1J3QA 3JZVA 1ZA4A 4PCRA 1V9U3 1LENA 4YZ2A 5CFCB 4AFMA 1ZRCA 3ME2A 4IEUA 4M00A 5KHIA 2MNGA 1QXRA 4YGEA 1C8M2 3PMEA 3IDCB 2W39A 4I0BA 4B7KA 3QCWA 3QACA 3UL2A 3ZSLA 5H9RA 1C1LA 2R062 1Y9QA 1REFA 3USUA 1O5LA 1C5IA 1DHKB 1G9AA 2ZS6B 3D0SA 3ENRA 4NOTA 4RS5C 1NA1A 3I59A 4FQZA 4RFT0 1MR5A 1LCLA 4WVWA 2P3KA 2R1DA 2E51A 2GC3A 1AZDA 4RGGA 3A0NA 5GLVA 2NP0A 4ZU5A 1UZZA 4P9LA 4DS0A 2XPJA 3EJKA 3WD5A 5IK8A 5GLUA 4P9WA 1AXYA 3MPPG 1QDOA 4XBNA 2BFUS 4MZUA 2WNVC 2F4PA 2Q8OA 5CFCC 1OI6A 2A6YA 2ZACA 1CAVB 2ZA9A 4YZ1A 3PTYA 5GLZA 3WDYA 1AYM1 1GQGA 2VW2A 1NY72 4HT1T 2K0GA 4UW5A 3JQXA 4YM2A 1HDKA 4RQPB 1CESA 3ZDSA 5L73A 4O9GA 2JG9C 4AQSA 4DPNA 1WA4A 1S0JA 2C9AA 4CDXB 2PLV3 2A3YA 2WZR1 1QJY2 3A4UA 5KXDA 3MW3A 4DFSA 1CJDA 4LO5B 2X29A 2W08A 1UAIA 2D7FA 5GALA 1EV11 4KWLA 4FTSA 4WM8A 1TMF1 3RRDA 2IWGB 4COZA 2WKKA 3BOWA 3ZXLA 4BCUA 4E4SA 2PHLA 3J8F1 2LTNA 1ZM1A 2ZOEB 4AQ6A 2G4IA 2Z2SB 2PA7A 5DXDA 2RS12 1KS5A 1W6OA 4MXWB 2PN5A 4AFAA 4ORFA 1XNDA 4LBQA 5IK5A 3AZVA 4XJWA 3RYRA 2ZGSA 4Q2FA 5E1RA 1A8DA 2QUOA 1GLHA 1VBB3 5K0UB 1S0IA 2WWSA 4AEDC 5AFBA 1WLWA 1F2NA 1ND2B 2PAEA 3WINE 2PHXA 1ZBA2 1RB8G 2ZGUA 1FOD3 1HQWA 2IXKA 4P14A 1MS4A 3NWKA 2FMYA 1EYBA 1U5IA 1WLCA 2WNUC 3WUCA 3IWZA 2RJKA 4ATFA 5L19A 2O8QA 2BEOA 4A3XA 1RUC3 5KC5A 5K0UA 1PGW2 3GBFA 2UYAA 4PLNA 1AXKA 4XETA 3SCHA 1AR93 1YJKA 4ASMB 2WFF3 1Q8QA 4XMIA 4XEZA 4HKWA 4YVSB 3AMMA 3V56A 2EIGA 1J1LA 4HKOA 5I0TA 4WVMB 4N53B 3DN7A 3LOIA 2LM3A 3OBRA 2VXRA 4X8NA 4BA6A 3ES4A 2XL9A 5C8CC 3VBFB 4D69A 2Z69A 4RD7A 4PIZA 3N4MA 1X8MA 2UURA 1Q3EA 2BVBA 2C0ZA 1W6MB 5DUVA 2ZGTA 4OHZA 1LOFA 1NCQC 4NWWA 2HWF2 4Q0PA 3VBOB 4E2GA 4LO4B 5DG1A 5K9YA 1G86A 1PO23 2FMDA 2D6LX 1OOPB 1R083 1IKPA 2PQQA 2GMPA 1QJZA 2GN7A 1JXNA 1XYPA 4BLIA 4B3NA 1AL0G 2W52A 5KXEA 3J8F3 4Q0VA 2E7TA 5D8AA 1MACA 4L9BA 3B69A 5A33B 2UWBA 4B8EA 3WCRA 1KQRA 2DVDA 1CAUA 5HCFA 1G6NA 4QQ2A 1AVBA 5GZFA 2JEMA 4IEYA 2B45X 2B9UA 2ILMA 2OZJA 3FC0A 2VG9A 4IERA 1NCQA 4AQTA 5FQ0B 1PIV3 1U5ZA 3POYA 1AL23 5JVVA 5FBZA 2RS51 4IQPA 3LSEA 1N3PA 1UIKA 3CJIC 5DZFA 1H9WA 2IFRA 4YG3A 3LWCA 4HETA 4MYEA 5T3NA 4PLMA 1CAUB 4P5HA 3DV8A 4S2DA 2PELA 3VDDB 3W58A 4GXLA 5CB7A 2R0FA 3WDUA 1PIV1 2CL2A 5F9TA 4KL1A 2NQYA 2VMGA 3IKWA 3P3PA 4AVAA 2GMMA 1ENQA 3PJQA 3PNAA 2VVEA 2BWCA 1OMIA 1A3KA 4E4ZA 2ATFA 1VBA2 4Q29A 4QQHA 3U11A 2PHWA 3X29B 5KHGA 4B4PA 1YCIA 1UIJA 4MGZE 3KT1A 3S7IA 1KDMA 2HKXA 2DCTA 3N7JA 4K1YA 4Q8KA 3E6CC 3R05A 4D94A 1SBEA 3AKPA 2XVKA 2AUYA 4QM9A 4XJ8A 3ZXEA 1MZ5A 4CTEA 2V09A 5I93A 2QKDA 2ZGPA 5E89A 3MI8A 4OI4A 4M3CE 3ECQA 1DQ0A 1DYKA 2LUWA 2LALA 2NM1A 2DTYA 1VBC3 5I8TA 4Y20B 3PMSA 5JOYA 3OBTA 4DRVA 5T5OA 4Q4V1 3I54A 1RVF2 3WVJA 5AVAA 1QJX3 4GH4A 3O0VA 3ATGA 1V6MA 1ZZ8A 5ABJC 2ZZQA 1POV3 1ZVFA 3AMQA 4HVQA 5K8SA 4Y26A 3WG2A 5FLIA 1E57A 1UMZA 1RUC1 1A78A 3VBSB 1TME1 2DCKA 2ZMLA 1CIWA 4FP2A 1C4RA 1R092 2HWB2 2DV9A 1V6OA 4LE4A 1AJOA 1J58A 2D40A 1SBFA 2ZGLA 2G9GA 4KWJA 1O4ZA 2RS32 5JMCA 3U4XA 2A70A 1Q8SA 3RI9A 3ZMOA 4FPKA 3E6DA 5KBFA 2ET1A 4CDQC 5KHKA 2XBO3 4UBHA 4LBMA 4G3YC 5JLVA 3MFCA 3H7JA 4FPCA 4COYA 1AX2A 4N43B 3MIFA 1KFXL 1UU4A 4Z07A 1OPMA 1KXGA 4IEWA 2PHUA 2BYVE 3W59A 5C8CA 1QXJA 2BBVA 3JB8A 2WA4A 4BMEA 2GNBA 2CWSA 3SNMA 4LTAA 4CEWB 4S2FA 5D8AC 1VALA 3ZYGA 1OA2A 1DGLA 4U2AA 1PO21 1SLIA 1HRI1 4IEVA 4XMAA 3VBRC 4XTPA 2FQPA 1PO11 3RPQA 3ASIA 1LOBA 1FMD1 4YFZA 4L8QA 2XKPA 1XQNA 4XJZA 4BYYA 5AC92 1VBD1 4Q4Y3 1S2KA 2XL7A 1HV0A 2XB6C 1YNAA 3H1MA 4JQRA 1G9BA 1TMF3 4TSVA 1F5FA 1GQHA 1S55A 2WC2A 3VDDC 4AVSA 2ZGQA 1H9PA 3HIFA 5EV7A 3ZFFB 3QH6A 4HBNA 3MDPA 3GNEA 2VMIA 3OGGA 1AXZA 1RUE2 1GBGA 1ULEA 5EYXA 4IEZA 1Y43B 1IS6A 1C8M1 3MIGA 1EAH2 4AFDA 1CAWB 4NR1A 3E5UA 2D6PA 1VAKA 1FOD1 5T50A 2XWBB 1ZZ7A 4QPIB 3MIDA 4AFBA 3MEPA 1WCDJ 1QF3A 1VBB2 5CG8A 2A75A 1HIXA 4AG4A 3N35A 4RHV3 4DINB 1C28A 4GH4C 2WA3A 5HXVA 4CDWC 1F5JA 4DMIA 4GKXA 4RQPA 1QQP3 1W6NB 1RUH1 5JPNB 3MF6A 4XYXA 4YW1A 1OHFA 1FPN1 5JSOA 2WLQA 1ASJ3 1EAH3 4EROA 4H7MA 2D93A 3I59B 1PZ8A 3WQ0A 5BNOA 1G9DA 3ZYRA 1CAVA 2JICA 3OYWA 1SBDA 3CNAA 5CG9A 4GB33 1RUH3 4BH9A 4BZ4A 2PAKA 4Y22B 1I3HA 4IV3A 2RHPA 2YHJA 4E9KA 4DY3A 1W6PB 2D6MA 4PDWA 4RHV1 4D7SA 2XLAA 1V6IA 5F6LB 1WW5A 1LU2A 1ALYA 5FO9B 1W6OB 2B39A 4YZ4A 1CAXA 1V6NA 1XYOA 1ZRRA 2UWCA 2Q30A 3ILRA 3JBG2 3VBFC 1B35C 4D3WA 3P3NA 4P9IA 4AGVA 3JUUA 2WZR3 4XFIA 2Y0OA 3K48A 4TWTA 1HQNA 1DQ6A 4K9SA 3VBHA 1FV3A 3I4IA 1FNYA 5A32B 3VZJA 2O0OA 1V9U1 1VBA1 2EA7A 3L9JT 1UX6A 4CDXA 2DWRA 2R043 4ISRA 2KM2A 3RYPA 5C4WC 1TMF2 2ZTNA 1JYIA 4AXOA 5CADA 2BW8A 4FSJA 3M3QA 1R1A1 4O9EA 4ONUA 1S0CA 1ZZ6A 3ZVXA 1NA1C 1SLLA 2D43A 4C1XA 1YWKA 4FTBA 2RS33 1JTZX 2E7QA 3FWEA 1WLTA 3M3IA 1AX1A 2UY9A 3M7AA 3J9SA 1X36A 4N53A 1ND2C 4IV1B 1ZBE2 3JU9A 2ZHNA 1HRV1 2A7AA 1MZFA 2B42B 3D6EA 4HVRA 4XXPA 4OUMA 3ZMNA 2D5FA 4PBPA 3WCSA 1DZQA 3SISA 5I91A 5EFUA 3MIBA 4DQAA 2CAVA 1LHVA 4NWVA 3ZFEB 4I09A 1VRH2 2R0HA 2XWJB 4K3UA 4IEPA 3VBOA 1AYM2 1PZ7A 2YUEA 2H6CA 3MIHA 1VRH1 2I2SA 4OI2A 3BODA 1GFF2 1RVF1 4IETA 3VZKA 1ZREA 3C2UA 3LGRA 4LBKA 4LUKA 1XNKA 2ARXA 4EN6B 4QGMA 1AYN3 4NHLA 1DYPA 4CRQA 2EVXA 2VVFA 4BM8A 4FO9A 4PDWC 3U0ZA 2C5DA 1X8EA 4OHVA 1JYCA 4RR3A 5L7OB 3CO2A 4Y1XA 3H8UA 2FZ2A 4EWAA 1QOOA 3HWJA 1PVC3 2B8MA 1RHI2 2BQPA 1Q8PA 2WIIB 1QDCA 2XH6A 2ARBA 1RGSA 4GQ7A 4CZSA 4DB5A 3NL1A 1MQTB 5A33A 1B35A 1H2KA 2YMZA 3ZXGA 3I8TA 1AUYA 1LGNA 2E53A 4AI3A 4AW7A 1J59A 5C4WB 2WLPA 1FMD2 1LODA 1YFXA 1C5HA 2RM22 3T2TA 3VKMA 3PVEA 2MEV2 2NPIA 1XU1A 4AGRA 1SLAA 1NXMA 2D44A 1JBCA 4WZFA 3UKNA 1O4TA 5JI7A 3ZIWA 3O0XA 3W9AA 4DOUA 4Q4W1 3ZXKA 2PTMA 3VL8A 3FLPA 4LLOA 3JCIA 1CR7A 1ENSA 5F6KA 4XF4A 4DRRA 5BNOC 4MSVA 1RJ7A 2XG3A 1RUJ3 3AP5A 4Q4X1 2WFF1 1YHFA 3M70A 4DXZA 5IUQA 3ES1A 1ND2A 2W68A 5KHJA 5CA6A 1SEFA 2D3SA 2CNAA 2RS52 3T1MA 3KD4A 3MICA 4EN9B 3VN4A 4QGNA 1D4M1 3RMYA 2EAKA 3SMHA 4XQDA 1GR3A 3GF6A 2DFCA 1KD7A 1VBC1 1DF0A 1PIV2 3TN91 4ZU7A 4XBQA 1SFYA 1AYM3 3HT1A 4UW4A 4CEYB 1EAH1 3GZTB 1HRI3 3WR0A 2DCZA 2VH9A 2HWE1 1BQPA 2HWC1 4GH4B 2HWD3 1UPIA 4KWKA 4MUVA 2OUHA 5BYNA 5T5LA 4QPGC 3KZ4C 4XFAA 4Z1VA 3AJYA 3AM2A 4LBNA 4Y1UA 2EALA 1DZTA 2PHDA 4IEOA 1H8TA 3NJZA 1XNCA 4HLTA 4HL0A 4IEXA 1AR61 1H4HA 1G7YA 4A7ZA 4EV0A 2AREA 4RS5A 1C3HA 2P3JA 1BYHA 1PGW1 3VBRA 2WSVA 4OUSA 2XJSA 3B00A 5J48A 1SLBA 1OFSA 3I2DA 2QQPA 4OZXA 2YPJA 2RR13 2TNFA 3B9IA 1NE6A 4NN0A 2NMNA 1R091 4YW2A 4FPFA 4PJYA 4R9AA 5E16A 3AYEA 1RUC2 2TBVA 4N9HA 1QMJA 2OYZA 1N1SA 2R042 4J1WA 4JGYC 3AXDA 1UN1A 3HBZA 1N1TA 3VBHC 1RTVA 1TE1B 2R1BA 3AZYA 1V70A 3DKWA 1WW6A 3LB9A 5D8AB 3RWNA 1U5YA 3OD0A 3WG4A 4AVCA 1GV9A 1LECA 3URFA 2R16A 3VBSA 2HYKA 3VHPA 5EWSA 3BU7A 1YYNA 3N3HA 1ENRA 3H0OA 3VV1A 2JECA 1UCXA 4XF9A 4QM8A 5KXBA 1O3TA 3RZZA 4KGGA 5HI0A 1DU3