2DF7A

Crystal structure of infectious bursal disease virus vp2 subviral particle
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
420
structure length
420
Chain Sequence
IVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQSGGVTITLFSANIDAITSLSIGGELVFHTSVHGLALDATIYLIGFDGTTVITRAVASDNGLTTGIDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSASGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERERLGIKTVWPTREYTDFREYFMEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of infectious bursal disease virus VP2 subviral particle at 2.6A resolution: Implications in virion assembly and immunogenicity.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Virus like particle
molecule keywords structural polyprotein VP2
total genus 99
structure length 420
sequence length 420
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01766 Birna_VP2 Birnavirus VP2 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2df7A01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 2df7A02
4Q4V1 2X5IC 5J98B 4WM8A 4RS5B 4IV1B 3VBOB 4CDXA 1PVC2 1R081 4GH4A 1BBT1 5GKAC 1NCRC 1PGW2 4CDXB 4FTBA 1H8TA 4GMP0 4RR3A 5C8CC 2HWE3 5ACA3 5A32A 1VBC3 4GB33 4LLFA 5FOJB 1EAH1 5A33B 5BNOC 5ABJB 4RR3B 1AR81 4GMP3 1FOD2 2HWC3 3ZFFB 1DDLA 5ABJA 1QJY3 5DDJ1 1AYM1 2IZWA 2RM23 1VBD2 2ZZQA 2WLPA 1RVF3 1ZBE1 1FPN1 5C4WC 1RUH1 1R1A3 1OHFA 1RUI3 4CDWC 5C8CB 2R043 1BBT2 1HRI1 1PIV2 5BNPA 1VBE2 1E57A 3JD72 4RQPA 4Q4X3 5CFCC 2FZ2A 2R073 1RUF1 2RMU3 1QJX3 2XBO2 1AYN3 1VRH2 4Q4Y1 2R063 2WWSA 1NCQB 4RS5C 4QPIB 1FMD2 4IV1A 1M06G 1HRI2 3LOBA 4JGYA 1POV0 1VAKA 1ZBA1 1OOPC 2HWB1 3JBG3 5K0UA 1HRV2 1AR91 4PDWA 4GH4B 4N43B 1RUC3 1RUH2 1NCRB 5J96B 4IV3A 4CDXC 1IHMA 1AR93 2BBVA 4GH4C 1HXS2 2HWB3 1NCRA 3VDDC 1H8TC 3FBMA 2GH8A 4RR3C 5CFDC 3VBOC 1VBA1 3VBRB 2BFUS 1VB2A 1EAH2 1C8M2 5D8AB 1VBC2 1ASJ1 1QJY2 1VBB2 1HQNA 2R041 1VBD3 1RUI1 5JZGA 1Z7S3 1H8TB 5BNOB 4CDWA 3VBFA 3VBRC 3IDEA 1FOD1 1AR62 5BNPC 5CFDB 2WS92 4CEYC 1V9U2 5CFCA 1QJY1 1PIV3 3VBHA 3J8F2 1AL21 2VQ0A 1QQP2 1RB8G 2HWD3 1VBC1 1VBD1 1NA1B 2QQPA 1BEV2 4NWWA 1ASJ3 4CDQA 4WM8C 3JB4C 2HWF3 1AL0G 3HAGA 4IV3C 1HRV3 1RUC2 1VBA3 4AEDB 4Q4V2 1AR92 1ND2B 1D4M3 1K5MB 4YVWC 1HXS3 3VDDA 3VBUC 4QPGB 5CFDA 1NCQA 1TME1 1RUG3 4RHV3 3TN92 1W39A 5BNOA 4JGYB 1COV1 2RS12 1PO12 5L7OB 1C8M3 4JGZB 4N53B 5BNNC 1MEC1 1RMU1 1NY71 5CFCB 1B35C 1EV12 2WZR2 4YVSA 1AR82 1QJZA 1RUF2 1RUJ3 1VBB3 1AYN1 1K5MC 4Q4Y3 3CJIB 1QJX1 4CEWB 2RMU1 1X36A 1VBB1 1Z7S2 1MQTB 2BUKA 3VBRA 1F8VA 2RR13 3DPRA 3ZFGC 4CEYA 1ND3B 1TMF3 4RQPC 1QJU3 2WS93 4QPGA 1V9U3 4FTSA 1RMU2 4RHV1 1EV11 4AEDA 1FPN3 2RS11 1RVF1 2HWD2 4QPIC 4IV1C 4CDQC 5DDJ3 1D4M1 1OOPA 5K0UC 4PDWC 1HRV1 5FMOL 3ZFEA 1OOPB 2HWF1 3CJIA 1VBA2 4WM7C 1WCDJ 2TBVA 1D4M2 3VBOA 2WFF3 4IV3B 2HWD1 3M8LA 4JGZA 4N53A 1NOVA 5ACA2 1COV2 4RHV2 5BNNA 1AL23 3NAPC 4CEYB 3VBSA 1B35A 1FOD3 1GFF2 1EV13 1AUYA 2WZR3 5JZGC 5LK7B 2RS32 1VRH1 4Q4Y2 1V9U1 1QJU1 3DPRC 1RUD3 3ZFGA 1OPOA 2R042 4SBVA 2ZTNA 2HWE2 2MEV1 1NA1A 3VBFB 4Y4YA 2R072 4AEDC 1RUJ1 3NAPB 1BMV1 1RHI1 5D8AA 5AC93 4QPIA 1FPN2 5L7OA 2R062 4CDUB 2HWC2 3ZFGB 1RVF2 1R093 3ZFEC 5C9AB 1R1A2 3JBG2 1PO11 1TME3 4FTEA 2BFUL 4YVWA 1HXS1 3VBUA 1MQTC 5K0UB 1VBE3 3JD73 1NCQC 4Q4X2 1AR73 1PO22 1RUE3 2R061 4N43C 2WFF2 2RMU2 3VBSB 1BMV2 2XBO3 2R071 4WM8B 2XBO1 1CD3G 1AL22 3VBSC 2ZAHA 3ZFEB 5C9AC 1ND3A 1HRI3 1NY72 2X5IB 4CDUA 3JD71 4YVSC 3S6PA 5BNPB 2GSYA 1K5MA 1BEV1 2X5IA 1RUH3 1A6CA 3JB8A 3TN91 4PDWB 1PIV1 2RS33 1PO21 2HWB2 1RUD2 1R091 4NWVA 2RS53 1AR63 4QPGC 1NA1C 2PLV2 4GMP1 1Z7S1 1ZBE2 3ZFFA 1C8NA 3J8F3 1EAH3 4Y5Z0 4GB31 1NG0A 3DPRB 1RHI3 2Y26A 1AYM2 2HWE1 5L7OC 4CEWA 5AC92 1ASJ2 1R083 4EJRA 1CJDA 1R092 1RUD1 4YVWB 1F2NA 3CJIC 2HWF2 4RQPB 1VB4A 5A32B 1SMVA 3J8F1 2MEV2 1TME2 4Q4V3 4WM7A 1AR61 1HX6A 2RS51 4YVSB 4JGZC 4N53C 1FMD1 2DF7A 1MEC2 4Q4W2 1RUC1 4WM7B 5BNNB 4RFT0 2XPJA 1RUG2 1AR72 1PO23 1QQP3 1RUE2 2RS31 1ND2A 3JBG1 3TN93 1B35B 4Q4W1 1ZBA3 3NAPA 5C4WB 1BEV3 2WFF1 1PGW1 1POV1 5A33A 4JGYC 3VBHB 4BCUA 1RUJ2 1RUF3 4Q4X1 1PVC3 5FMOS 1AR71 1RUE1 2RR12 1VBE1 3VDDB 1TMF2 2RS52 3ZFFC 4CDQB 1QJU2 1R1A1 2PLV3 4GB32 5C8CA 1ZBE3 2RS13 1PO13 2FZ1A 1PGL2 2PLV1 5D8AC 2RM21 1RHI2 1AYM3 4CEWC 3VBUB 5JZGB 2HWC1 2WS91 4CDWB 2RM22 1X33A 5ABJC 1TMF1 1AR83 1PVC1 1R082 5AC91 2RR11 5ACA1 1RUI2 5C4WA 4FSJA 3VBFC 1MQTA 1POV3 2MEV3 1BBT3 2BPA2 4N43A 1RMU3 4Q4W3 3VBHC 1ND2C 1MEC3 1QJX2 3ZXAC 1C8M1 1PGL1 1AYN2 1VRH3 1QQP1 1COV3 1FMD3 2WZR1 1ZBA2 5C9AA 1ND3C 4Z92B 4CDUC 4RS5A 1RUG1 5DDJ2
chains in the Genus database with same CATH superfamily
3BU0A 1GP5A 4JV4A 2W52A 3AMQA 1ZRFA 2X5IC 3WY6A 2WL1A 4WM8A 4XBQA 3FC0A 4OUMA 3GYDA 1PMJX 1VE0A 3LOIA 1NT0A 4GXLA 2TNFA 4LPLA 1VMFA 3AYAA 4OHYA 4H55A 4ZZ5A 3OPWA 1CAUB 2BQPA 2PAEA 3HJRA 4MLOA 1GP4A 4M4PA 1PVC2 3TB0A 3WEZA 2WQ4A 2ZGSA 2C26A 4Q1PA 4XF4A 1QXPA 3QLQA 5A70A 4AVTA 2K2SA 2ZA9A 4DY3A 4FTBA 3WHUA 2VMCA 3V0BB 3ZXGA 2GNDA 4MYEA 1UYZA 4XF0A 2HYXA 5FY7A 2V5YA 2ETEA 4GB33 1V00A 1CN1A 1YQ5A 4XFBA 4ORFA 4ISRA 2VUJA 3DYOA 4AVSA 3MPBA 2P3YA 4RGAA 2C4XA 4UF0A 4COVA 2DUQA 4WBBA 3THCA 4R4ZA 4LT5A 1DDLA 5DDJ1 3ZMNA 2LROA 5I0UA 1GP6A 2WNUB 3ACHA 2BNNA 2RM23 3T3YA 2ZZQA 4B7EA 2BV4A 1EYBA 1U5ZA 2ZEXA 1XPWA 1ZBE1 2LRPA 3A22A 5C4WC 1MVEA 5FYYA 1US2A 3ZSKA 2A75A 3N9MA 4QX8A 1UQXA 4QX1A 1QOOA 2CGNA 2Z5WA 5DAQA 5APAA 3FUQA 1HRI1 1PIV2 4AOCA 2XJRA 3ZKYA 4Z8BA 1E57A 2ZEYA 5CFCC 1NE4A 2FZ2A 5HV4A 4MVTA 2PMWB 2R073 1XU1A 3AMNA 1RUF1 2ES3A 2RJ2A 3W5MA 1W90A 1LULA 5DPNA 2V4VA 1AYN3 1O4TA 4A3ZA 3ACFA 1G7YA 2WWSA 4KWUA 3ZX7A 5I8YA 1GZCA 1J58A 3IAQA 3RZKA 3WD5A 1O3QA 1O6UA 3KV6A 5F6LB 3MF9A 4JGYA 1QNYA 1POV0 4CVUA 4G4FA 4WZFA 4ATEA 3O1UA 4HSLA 1WCSA 3GBGA 4GH4B 2B46X 3A4UA 1HB3A 4XFCA 4IV3A 3LAGA 2BBVA 4LUKA 2ZEWA 1BYHA 1MR5A 4TSVA 5IVYA 4PHZA 4JKMA 5HCAA 1OA2A 2EAAA 4LBQB 2GH8A 4RR3C 4AYUA 5KWRA 2ZGMA 1BK1A 2YFUA 1VBA1 1AX0A 4ZU5A 5FUNA 1EAH2 1O5UA 5D8AB 1DU3D 4R9CA 4NPRA 3RJ2X 5JMOA 3U4SA 2JE9A 4OHZA 5LRRA 4B29A 4Y4RA 5J48A 2ZXQA 2E31A 4DINB 3R0RA 2WYSA 3HOBA 5LWBA 3V0AB 2QQWA 4B7KA 1RYYA 4Z82A 5F5IA 4UI9L 3JCIA 1POQA 1D0GA 4BK5A 3PU8A 1XOYA 3RQ0A 1H8TB 4HKWA 5BNOB 2QQIA 3VBFA 1DYKA 4Y1VA 1S2KA 4Y22A 4GJYA 1W9SA 5L73A 2SLIA 4URTA 1GMMA 4XDQA 2Y64A 3IDEA 1N3PA 3O12A 5CKQA 3MLLA 4BQ1A 5CFDB 2DV9A 3AVRA 3WDTA 2WS92 1V9U2 2Y6GA 3QD6A 5CFCA 1FAYA 3NKGA 3RDIA 5IFPA 1WW4A 5A3LA 1RL3A 1W2UA 5FV3A 4IEVA 1W9TA 1PK6A 1CPNA 1MS0A 1FI2A 4K8RB 1RB8G 3B93A 5C7GA 2HWD3 2K0GA 4WVWA 1LJ7A 1CAWA 1BEV2 1GZWB 1W28A 1GOFA 2VZOA 3O7OA 4AAPA 4DFSA 3O1SA 2IXHA 4CDQA 2K9ZA 1T6GC 2G4IA 3K51A 4QD2A 3JB4C 4YGEA 2VJXA 5FZKA 2NZ9A 3SQOA 1VPHA 3D0JA 2VW2A 1HRV3 3IBMA 1YYNA 1MS8A 4P08A 1OFNA 4DO0A 5CADA 4CCOA 2RVAA 1LHWA 2WNVB 2P3IA 1YXWA 4YVWC 4DPNA 5JOYA 1HXS3 4BE3A 3VBUC 2P3KA 3FLPA 3AKRA 3JZVA 3OD0A 1TME1 2Y60A 2C5DA 1HB1A 4RHV3 2VG9A 2GP3A 4UFJA 4YW2A 2Q8DA 3D6EA 3USUA 4FAGA 2JIGA 5CAZA 5GLTA 1G6NA 2B42B 4TTGA 3UT0A 5JPNB 1W3XA 1MEC1 3O1VA 3OCPA 1YEWA 4OI4A 1QU0A 4ASLA 2G9FA 1GZWA 5A1FA 5CFCB 3OYWB 1N3OA 1B35C 1ULDA 1SDWA 1UKGA 3HIFA 1XNBA 4YW5A 1AR82 4MADA 1RUF2 1VBB3 2RG4A 3K4ZA 4K1YA 1JZ5A 2XXZA 1K5MC 4X6QB 2FDGA 3NVCA 4COWA 1EPWA 3PJYA 1XXNA 4RD7A 2HEYF 3UGHA 2C6SA 2GC1A 3PTYA 4M3CF 2ZABA 4MSVA 1AX1A 4WV8A 3SH3A 2XJSA 4PQ9A 3GNEA 3I3DA 1KQRA 1ND3B 2ZAAA 4Q1RA 4Y1YA 4RQPC 3K48A 5L9BA 2ZBJA 2WS93 3C8XA 4QPGA 2JB8A 5KHIA 2H0BA 4JTOA 4OMDA 2RDRA 2Y34A 1RMU2 3D5OA 2P17A 5FZ4A 3C7FA 4UW4A 1UIJA 4YGDA 2ET7A 1QH7A 2BNOA 1PNFA 4E2SA 4CCNA 1RVF1 3KVAA 4MOAA 4QGLA 1UY1A 1LEMA 1JOJA 1UX6A 2BYVE 2W2IA 4I0WB 4C0BA 1WLTA 1XNDA 1C3HA 4KU8A 3THTA 3B9IA 4C90A 2ZACA 1IKQA 1LHUA 4LBQA 4CDQC 1GQGA 3HR9A 2WO7A 3QBQA 1UPIA 5JR2A 4D69A 1SQ4A 3OB8A 1XYOA 5FYUA 4QXBA 2HWF1 1X8EA 4UYBA 1F31A 3MW4A 3H1MA 1KGYA 1Q8VA 2JG8B 4BOWA 3O1TA 3ZSJA 1D4M2 5DUVA 3F95A 3I49A 1E5HA 2BGCA 2P5BA 5EPAA 4IV3B 3AX4A 2JG8A 1YHFA 2JENA 3M8LA 2CL2A 4N53A 5C3OA 1JZ4A 2VH9A 2EICA 1I6XA 3RI9A 1MZ5A 4GQ7A 5JSRA 2XWJB 1N1TA 1UD1A 3PTRB 4MHRA 3A0NA 3N7JA 4RHV2 5BNNA 1ULGA 2VCCA 4Q0VA 1DP0A 4XIKA 1MZFA 3PUIA 3PUQA 1HN1A 4I01A 4OVEA 3HD8B 2VTXJ 1FOD3 4BMEA 1JYWA 1CONA 4IEZA 5T5JA 2D6LX 2KD7A 5EJZB 3WNPA 1RITA 3NQHA 5DMYA 3NV4A 4IXLA 2DTYA 5JZGC 4LHLA 3AMMA 2YYOA 2RS32 4Q4Y2 3HNMA 4FT8A 5HBAA 3PMSA 3NRUA 3ME2A 1PM4A 2Z69A 3N9OA 4UAPA 3IDCB 4E4DX 4AGRA 1LU1A 2EALA 2R042 3LEKA 3WP4A 4AEJA 3U11A 4A42A 1J3PA 2HWE2 3EXUA 1WMFA 4S2FA 4ARYA 1S4CA 4EWDA 3LWCA 2QQKA 4GJZA 3OYWA 5FPZA 3ZSLA 1C28A 5LATA 4O9EA 4EN0A 1O7FA 1AHSA 1GWLA 4QX2A 1W2AX 4QPIA 1FPN2 3N9QA 3MIEA 3VD7A 4QKDA 5DUXA 3CZUA 5J1XA 3E5XA 1W6PA 3RYRA 3MLJA 4X8PA 3H3ZA 4E4SA 3NJVA 5DAXA 1Y43B 2XJVA 4BDVB 4OI2A 4GWIA 4WVMB 2FQPA 2LW8A 1WA6X 4XFHA 5A3MA 3ABZA 1S0CA 2VVEA 4BQ2A 2PHXA 5CZKA 1TME3 4XF3A 3H8OA 1O3SA 2BJSA 2QNKA 2P2KA 2Y6JA 5T55A 1HXS1 2WNVC 1EUTA 3JQXA 1MQTC 1NLQA 3WG2A 5K0UB 1VBE3 2WABA 1NCQC 1CR7A 4HN1A 1AR73 2PFWA 2VMHA 4NMIA 3WF1A 1UZYA 3W58A 4IE6A 1LOFC 2XBO3 3IPVB 4YFWA 4Q8KA 5IK5A 1Y7BA 4WM8B 4KG0A 3VZMA 3O1OA 5F8PA 2OX0A 1JW6A 1OKQA 2XJQA 2WN3A 3ZFEB 3CHXA 4DUXA 1K12A 2X5IB 1FATA 2HLEA 4COUA 2D6NA 3AJZA 1WCQA 2WINB 3JD71 3OGVA 1ZRRA 3KWVA 1ZRIA 3ZYFA 1NQDA 3HWJA 1K5MA 1BEV1 4MG2A 2CAUA 3LQCA 4A45A 4AFBA 1HIXA 1WMEA 1C57A 2V72A 2VVFA 1W2OA 4B4PA 4YG0A 1S0DA 4YFZA 2XB6C 2HWB2 1E5SA 1W6OB 4W4ZA 3U14A 2HBUA 1HDKA 1UOBA 2RS53 2VZSA 5E6HA 4OQ8A 4QPGC 4AFMA 4AQ2A 1VALA 5LEKA 1J1LA 5FAXA 2JD4A 4AW7A 5F5QA 3ZFFA 4MZUA 1OA4A 3EMRA 1EAH3 3GALA 3J8F3 2LALA 2CGPA 2EIBA 3OTFA 5FZ0A 5L7OC 4P00B 3NV3A 1SBDA 4OHWA 2W47A 1RGSA 3ZXJA 2ZOEB 5LCWL 1UWWA 4XOGA 1LTEA 1W6NB 1O3RA 4EN9B 1ASJ2 2VGDA 1R083 1URXA 2FD8A 3RGBA 4AXOA 4EJRA 1XE0A 2AEYA 5FY8A 4QX5A 5FQ0B 1WW7A 4UFHA 1VB4A 4GD4A 3H1WA 3U1XA 2OYZA 2O0OA 2VTFA 4LO5B 1MVQA 5HV0A 4MXWA 2BNMA 3A23A 2ZGNA 3HT2A 4Q4V3 1AJKA 4WM7A 4Y20A 4L0PA 4FAHA 5GZEA 3OSDA 2D6PA 3RRDA 1UZVA 4JGZC 1W04A 4WM7B 2H0VA 3DV8A 4Y20B 3PUAA 1PGSA 5FZOB 4I2OA 1QQP3 2RS31 2XVKA 4XFFA 5LZ6A 1ND2A 2PXJA 3DYMA 4E8DA 5FTTC 2VO5A 3O14A 4Q4W1 3VD5A 4IE7A 4P5YA 5E88A 5IVBA 2AC1A 2ZGQA 4XF1A 1O8SA 1E5IA 5JSOA 4LTAA 2XHNA 1UYPA 1AXKA 1X50A 3ZPOA 4PLOA 2OIIA 4XXAA 5F7UA 5A33A 3BIWE 5IK8A 2E7TA 3WW2A 2BTVC 4XCBA 1RUF3 3WZ1A 2NYYA 4H7LA 2ILMA 4EV0A 4YZ1A 2ARCA 3KV4A 2D97A 3RS6A 1C1LA 2HH9A 2PAKA 4MGZE 4C1WA 2GAUA 3TRSB 4D7YA 2ZMLA 2ZGOA 2VAUA 4YM1A 3PNAA 2BGPA 1I5ZA 2Q1FA 3ZO0B 1UL9A 3IM0A 1QJU2 1YQ6A 2PLV3 5FPVA 4GB32 2YU1A 3HQRA 2RDQA 1U5XA 1ZBE3 2QDRA 3WOGA 5KXDA 1CZSA 4UF0B 1PGL2 1YJLA 2B5HA 2RM21 3FMGA 3I2IA 4YLZA 1LEDA 4XQWA 3LPFA 2VZRA 1SPPA 5B4NA 2I74A 2D6OX 1BKZA 1VJ2A 1GICA 3MO4A 1SLLA 1YLLA 3LCPA 2R1DA 4XC9A 5KXCA 1R082 2OQ7A 5AC91 1OUXA 5FY5A 4RA0A 4XYXA 2R49A 3IT8A 1KDMA 4H3WA 3TAYA 3ZVXA 4XJ9A 4DXZA 2WNUC 4Y1UA 1S2EA 4XAEA 2VOKA 4DXTA 1QXJA 3UL2A 1G9DA 1MQTA 1POV3 2MEV3 4W6WA 2BWCA 2YBSA 4IEYA 2DU0A 3HBKA 4AGVA 3VL9A 1YFWA 4N43A 1XJAA 2ADDA 3VHNA 1UOFA 1W9FA 4EN8B 1QJX2 1OQEA 1AYN2 1CAUA 2WUHA 5LBFA 3LA7A 2PN5A 4A6OA 4P9LA 3EQEA 4S2DA 4DZGA 2VNOA 4CDUC 1OVPA 4AHXA 1RUG1 4XZPA 5F2WA 1CX1A 1O59A 5A7SA 4AFDA 5T52A 3N7LA 5GLWA 3RPQA 3MHZA 3ZR6A 4C8DA 1ZM1A 4XDOA 4QMAA 5FMBA 4IV1B 4W8JA 4E9KA 3BPZA 3VBOB 4EQVA 4KWLA 2CY6A 4YG6A 2V5DA 4UXAA 4RN5A 3SLIA 4CDXA 2WZEA 2QZ2A 1N1YA 4XQ4A 3M3CA 4DY5A 2JB4A 1CX4A 5HI0A 4FPHA 4XUNA 1BBT1 1WCUA 5C71A 3B01A 1TNFA 2R7EB 1IS4A 1PGW2 5K8SA 3ATGA 1H8TA 1EPZA 4XUPA 1EY2A 2HWE3 2JE7A 4XAAA 2DVFA 1LGBA 5ACA3 2DCKA 4LQRA 4RYDA 4KWJA 4LLFA 4ET7A 4ZS3A 5A33B 5ABJB 4RR3B 1AR81 4C1XA 4RFRB 5A7OA 5G05L 3CL1A 3MIDA 4HBNA 3AFGA 4M0NA 2HWC3 1H1IA 4WZCA 2WRAA 4B1LA 4FFFA 1AYM1 1XNTA 1W8WA 2VVDA 3AKPA 4PF1A 2IZWA 3J7MA 1VBD2 2VCMA 4AAXA 2WLPA 4YM0A 3N7MA 1FPN1 1LGNA 3NV1A 1GANA 1RUH1 2ATFA 4GULA 4LK7A 2E63A 2RV9A 3ALQA 4JTNA 1RUI3 1H6YA 2Q1MA 4W65A 4XIOA 1JN2P 4MGSA 5FMDA 1JZ8A 1GUIA 2VZUA 1B09A 2ZGTA 3OGSA 3UKTA 1K3IA 2YC4A 4G9SB 5JXJA 4E2QA 5FLIA 3VGIA 1RC6A 4KH9A 1H6XA 5CEHA 4N9HA 2UWAA 4MH0E 4Q4X3 3SNMA 1XYPA 1UW8A 1F15A 1DQ6A 1FNYA 3VLBB 1YNAA 2JG9A 1VRH2 2R063 3WNXA 4QB6A 1NCQB 4RS5C 2DBIA 2CV6A 3ENRA 4FPKA 3ZMOA 3RZJA 3AXEA 4IL7A 5HXMA 3WNKA 2QTWB 4XUQA 1ZBA1 1DQ1A 3E6DA 4JKLA 4UBHA 5F32A 3RZMA 4LULA 1AR91 4XDPA 4JDOA 4AHYA 1NCRB 5L9VA 4OFGA 1W8FA 4GH4C 3WDUA 1A8MA 2HWB3 1SLCA 1S0IA 2UY9A 3HPNA 3LE0A 3H50A 5LA1A 4F3JA 5C3RA 1W0NA 5FP4A 3FBMA 3ASIA 2VQAA 3T0AA 1V6MA 2G1MA 3PVOA 4BWOA 1LOBA 2CYFA 2JKXA 4RSUA 3OGGA 2Z4FA 2AEZA 4FFGA 1HKDA 4MGYE 5FYHA 5IJRA 5BYNA 5GLZA 2QQVA 2XONA 4TWTA 1C5HA 3VKLA 4XBLA 4OHVA 4I30A 4U2AA 1ZYBA 1WLDA 2JJ6A 4AQTA 4L11A 1K42A 1WW6A 4NPLA 2CWSA 2WWJA 1VBB2 1UMIA 1HQNA 5T3NA 3VKMA 1TZOA 4DEQA 2R041 1VBD3 3GHNA 3NJXA 1JYTA 3C7HA 4HN0A 1W6MA 4AI2A 3KF3A 5EIYB 2W68A 1BMV2 2HJIA 2WT0A 1SCRA 1S0FA 5FYMA 5M0TA 1FYUA 2WZPP 3T2PA 4BZ4A 1U5YA 3GZEA 2A6ZA 3WX5A 1AR62 2XWBB 3OUJA 1BXHA 1O91A 4XILA 2VMEA 3WT3A 1QJY1 4HVQA 1PIV3 2D7FA 4R9BA 1IGOA 1U5IA 2A71A 4NPMA 3HN1A 2VQ0A 4LKDA 4NUBA 4CXYA 3FHIB 3DXUA 1KFXL 2VUCA 1AF9A 4PF5A 1WKYA 2QDNA 1QQP2 2W1SA 3U37A 2F6BA 4AQSA 5JI9A 3I3MA 3MV01 2D98A 1VBC1 2EIEA 1VBD1 2Y6HA 2OPKA 4K6BA 4M3CA 3V56A 5FOBB 3NKTA 4L97A 3WXPA 4E4ZA 4CP1A 1OI6A 1T6BX 4WM8C 2QKDA 3PVEA 3CNAA 5GZGA 5KXBA 3MI8A 3U0ZA 3NJYA 2N7GA 1AL0G 4IQPA 4DIQA 4MHUA 2ZPXA 3HAGA 5FLJA 1DF0A 2NLRA 2TUNA 4OLLA 2EXJA 5FBJA 4FOVA 3PHMA 4Q4V2 1KFUL 1KJRA 5JR7B 4OHXA 1D4M3 2WIIB 3NSTA 2H6CA 5CFDA 1AXZA 1NCQA 4IE5A 5FZDA 2Q0AA 4HOOA 1UX7A 5JXIA 4PT6A 3OY8A 3H42B 1DCSA 4HXCA 5BNOA 5KHGA 1COV1 2VULA 2Y0OA 1OT5A 4IE4A 4B8EA 4N53B 2HEVF 2RJLA 4MGQA 3BTXA 3JQWA 4KU7A 1CQ9A 3OEAA 3V0AA 1RMU1 2ZHMA 1QDCA 3F2ZA 5A3NA 4ONUA 3B5LB 1YRZA 1PZ7A 1IG3A 3EB7A 4JDNA 5FYZA 1RUJ3 1DG6A 2JD9A 3MIGA 4B1MA 4XFIA 4QM8A 2GH2A 2DVDA 3LFMA 1ZNPA 3D8CA 2I07B 1W6NA 1W8TA 3IWZA 1V6NA 3DN7A 1AJOA 5C3QA 1GBGA 2W3JA 1F8VA 4YW6A 1WMXA 2RR13 3EJKA 3AZZA 3LF7A 4LITA 4META 3ZFGC 4CE8A 1QY4A 4CEYA 3LEGA 3LEIA 1TMF3 3WQ7A 4DUWA 4D3WA 3MDPA 2X10A 1HN0A 1UY2A 3AM2A 3B69A 3PIJA 3PUHA 2G9ZA 5FZ8A 5A7PA 4F83A 3CQOA 4GZ9A 2ZKLA 2ENRA 4GWMA 3MFCA 4M01A 4AEDA 1FPN3 3ZYGA 2GN7A 4XJ8A 3THPA 2PELA 3WP6A 2BRTA 4DRRA 2W87A 4A44A 5FZGA 1W6OA 2W94A 4QKBA 2ZGPA 1D4M1 3NW4A 5GJ6A 3B9CA 1F5JA 1C1FA 3RFRA 5FUPA 4HL0A 2VZ3A 1KDKA 4Y26A 3HMYA 4LBNA 1DFQA 1OD5A 4PDWC 2E53A 4FP3A 3CEWA 1WCKA 4ZXKA 2WQZC 4H2AA 1EP0A 1S0EA 4UBGA 3W5NA 3POGA 3ETQA 2FCUA 1DQ2A 2A3XA 1Q5OA 2CNAA 1L7QA 4KI5M 5A3OA 4D6SA 5FY1A 3M3EA 4WM7C 1UMZA 1WCDJ 2TBVA 5CKMA 1N47A 3ZN6A 1TE1B 1W2TA 1W8OA 3VBOA 4U36A 4Y33A 1GNYA 1STMA 1QOTA 2XLGA 5A7WB 4KNCA 5J37A 3SXWA 1H30A 2R30A 1SLAA 5IHRA 1ULEA 4PI0A 1T2XA 1XBFA 2D93A 1HV0A 3WP5A 4DRVA 1LOEA 3T4HB 1FT9A 2YXSA 3DGTA 2AH2A 5F6KA 4IEOA 3ZN5A 1AUYA 4NN0A 2A73B 3TBDA 2J1EA 1UU4A 2YUEA 2IFRA 3K4DA 1U12A 3I2JA 2ZHLA 1OLRA 1QJU1 2DCZA 5JVVA 4OULA 1DQ5A 2JDUA 3DPRC 4IW3A 4Q27A 5C33A 1OPOA 4COZA 1ZRCA 5EZWA 1PX3A 3SISA 2VZ1A 3UETA 1SPPB 1ULCA 2ZTNA 2MEV1 3THDA 3M7AA 4FPEA 2XLFA 2CSGA 3DEMA 4Y4YA 3WF4A 4YSFA 2NP0A 5A7WA 1BMV1 4G3YC 1GOHA 2AYHA 3T30A 3WF2A 3H0OA 3O5SA 4I0AA 5AC93 5JUVA 4S2HA 2ZZJA 4BYYA 2R062 5IUQA 1APNA 5L7OA 3BU7A 2J42A 4F8AA 1UNBA 3KCYA 4HLTA 4NHLA 3ZN6B 2E51A 1LODA 3OBTA 3RZLA 3E97A 1RVF2 3AP7A 4A7YA 3MZHA 2XKOA 4XE9A 3MIBA 5C9AB 2Z79A 5FR3A 2B9UA 2V4AA 4BQWA 4MGKE 1ENQA 5FJKA 4BA6A 4LA3A 2YMZA 3W9AA 3ACGA 1DQ4A 4YVWA 2AUYA 2Y0IA 1JOBA 1ZZ9A 1LCLA 1SLIA 2O1QA 3CZJA 1W6QB 4HPKB 4BIOA 4J1WA 1ZZBA 3KHCA 2R061 3L9JT 3ILNA 1BHGA 3PL0A 2CWMA 4ISQA 1SACA 4L92A 4E27A 4LBQD 1TNRA 4XUOA 2HKXA 3UGGA 3W59A 1CD3G 1UZ0A 5FZOA 5C8WA 2GZWA 2R0FA 3PVNA 2ZAHA 1IS5A 1OKOA 5FZ6A 1NY72 4HVRA 4CDUA 4XCAA 4HZFA 3SH5A 3WDXA 3URFA 1NZCA 3IN9A 3HEIA 2GU9A 2QQLA 2GC3A 3S6PA 2OKXA 4LOSA 5H9PA 1RUH3 1A6CA 1UYXA 2Y6KA 5FJHA 3INAA 2RS33 1S0BA 2VMIA 2XL7A 3RI8A 4XFGA 3T1LA 1SG3A 2ERFA 2UY8A 5A6YA 3MBWA 4CUAA 1VAVA 2D40A 1R091 1RJ7A 5A6ZA 3U4XA 2EXHA 3LIHA 2PYTA 2UWCA 2VMGA 3ORJA 1IQDC 3Q8AA 4CXXA 3EO6A 4XETA 2VBBA 2B8MA 2C9KA 5IAXA 1Z7S1 4FOWA 4L8QA 1C8NA 1WWYA 1ZA4A 3OD4A 4UFLA 1YQ8A 4P02B 1NG0A 3D0SA 1RHI3 3POJA 4R52A 3IKWA 1CAXA 4LORA 5FXZA 2HWE1 1HV1A 3ZYHA 2PHDA 3AB0A 3HQXA 2A3WA 3MV11 4YZ4A 1Y9MA 3E6BA 3BOPA 4YZ2A 3BTAA 3QOPA 2BWAA 4O61A 5FO7B 2DFCA 4IEXA 2O14A 3DUIA 3KQRA 3ZYIB 3UV9A 3MF6A 4NIAA 2YBKA 1R092 1JI6A 1K5JA 1RUD1 1IOAA 1X82A 2IUWA 2WYFA 3LDKA 4YVWB 5JLVA 1OF4A 1PM7A 1F5FA 1S0JA 4EN6B 3J7LA 1SDDB 3R4SA 3J8F1 2MEV2 4QX7A 4ZPIA 1MPXA 2E9QA 1ENRA 1LENA 2VZQA 5FPLA 1H9WA 2MHFA 1HX6A 5EJ1B 2WSUA 2J1RA 3OOXA 2RS51 5FLHA 3VHOA 1JODA 4XQDA 4D6QA 2GALA 1JYVA 4JZRA 4QHBA 1ZZ7A 1RUG2 1AR72 1W3VA 2VUAA 1DQ0A 3MW2A 1W8ZA 1B35B 1OQ1A 2WNEA 2XVGA 2FDKA 2WQ8A 1YFUA 1BEV3 3G7DA 5FPUA 2FMDA 3MLKA 4UT5A 4W50A 3H3UA 2VW0A 2WFF1 2JDZA 4QB2A 3SITA 1PGW1 4Z2AA 1H9PA 1POV1 3BN6A 4CXWA 3RMXA 1QHDA 3JUUA 2WR9A 4B4QA 4BM8A 3GJAA 3UNPA 4BCUA 2PQSA 3GDBA 3KD4A 3KV5A 2UURA 4W6XA 2XHKA 2XJTA 4M4RA 5JSPA 1C4RA 1AR71 3T0DA 3H8UA 2FHRA 1G9FA 2VCBA 3DECA 3N9NA 1VBE1 3NMBA 3U75A 3T1MA 2RS52 3S7IA 4EN7B 5I8TA 4NIGA 1CIYA 5FMCA 4CDQB 4AVCA 5B2GB 3LA2A 2HBTA 2QQUA 3IMMA 4P9JA 5C8CA 2A7AA 2RS13 3U78A 5GZCA 3ZKUA 2PLV1 4TXWA 1JZ6A 2C1FA 1UMHA 2BEOA 2UWBA 4JHTA 3BVCA 5EYYA 2QQJA 3FHAA 4FOYA 4YWAA 3EYPA 5KHJA 1NQJA 5FO9B 2RM22 4XTPA 4CPBA 1X33A 4D94A 1OQDA 5ABJC 1UY4A 5LY1A 1I3HA 2WBKA 2XUMA 5BY5A 4LKFA 3LEMA 3DL3A 2JDMA 1H4GA 5CVRA 3OBRA 2IVJA 3ZXFA 1JYIA 1H1AA 3ZOIA 4A7KA 1LRHA 3KCXA 5IK7A 4FSJA 3VBFC 1ZZ8A 2RE9A 4PIXA 4UW6A 1UXXX 3NWKA 4EROA 4EZHA 2BPA2 4CUBA 1LGCA 5JMCA 5EYXA 3B3QE 2D5FA 4Q4W3 3HVDA 1DGRA 3HBZA 1C8M1 1QEXA 2YPDA 4XW3A 4GKYA 1QQP1 2WT1A 3LDRA 1YUDA 2Y8KA 2R0HA 5BPXA 1KRIA 4SLIA 3P1IA 4LOTA 3BPSA 1MS1A 1GZTA 4QPYA 4O7XA 4Q4V1 5F3CA 1UKRA 1FNZA 1DZQA 2VNVA 3PU3A 3BALA 4LBOA 4RS5B 5FWJA 2ZX3A 5IT6A 1ULPA 1TEIA 5KHHA 4LKEA 5FZ7A 4HANA 2ADEA 3KCCA 5TSWA 1NX9A 4BK4A 3N3HA 2JG9B 4F7ZA 5CNAA 1V6JA 4I09A 5F39A 2BOJA 1LKNA 1R081 2A5ZA 5IYYA 4GH4A 4ARXA 4AQ6A 2ZEZA 4QQ2A 1N1SA 1NCRC 3FN9A 1WBLA 2P6HA 4IGPA 1NXD1 5GKAC 1WW5A 3AYEA 5EHDA 3SCGA 1F35A 1UIKA 1X9PA 3Q8BA 4GMP0 4NHYA 2KR2A 4RR3A 5C8CC 4OCTA 1DGRN 4LIVA 3LDBA 1XYNA 5FOJB 1EAH1 4CUGA 2EA7A 4DNYA 4UW5A 5BNOC 3ROUA 2GC0A 4IDZA 4OMCA 4KWKA 5FIXA 3Q8CA 2JDHA 3ZFFB 5ABJA 4FPLA 4Z07A 4LHNA 5ANNA 4AI1A 1GWKA 3X29B 4CCDA 1LOCA 1KJLA 4BQ5A 4NRMA 1RVF3 3BGAA 1BJQA 5IFTA 1D7PM 2J1UA 2WNUA 1R1A3 2WDBA 3IDBB 3OY8B 5F2SA 2ZGRA 4AVVA 2NMOA 2YV8A 4CDWC 1IG0A 3KGLA 4BU2A 3GCWA 1GV9A 3RYPA 3OGJA 4ZU7A 2WAAA 1NZIA 4JRLA 4FPFA 3MICA 2X53S 1QJFA 4RQPA 2R16A 3GZUC 4XXPA 4AEMA 4QWNA 5GZFA 4EWAA 1SEFA 5LBCA 3USUB 4ZKTB 1I5PA 2HYKA 1S1AA 5J36A 3N7KA 2XMLA 2XBO2 3BCWA 4I3PA 1LNSA 4JDMA 3VZOA 1UZWA 2JDAA 5H9RA 2YZ4A 4NR1A 3ZSMA 4IV1A 1M06G 2YDEA 2PAMA 4AFAA 3LOBA 2W1QA 1QJEA 3J7HA 3FJSA 3JBG3 1XNKA 4WVVA 5K0UA 1FXZA 1OLMA 1QH6A 3H1YA 3TWIA 1YCIA 4LBLA 5HCFA 4DUVA 1NLRA 3I2HA 1IPJA 1RUC3 4N43B 4AR2A 4BB3A 1IKPA 5J96B 3O1MA 4V2WA 3I3BA 1IHMA 4UOJA 4CDXC 5BV6A 3AYCA 1JU3A 1W0OA 3WDVA 3VUOA 1HXS2 1Y4WA 4TN7A 5D21A 1IS3A 3KB5A 4IE0A 5CB7A 5T50A 5FY4A 3ZYJB 5FYCA 5AFBA 3IDAA 4AL9A 3POIA 5DABA 5A3UA 3VBRB 1OF3A 1GWMA 1QF3A 4I02A 4AI0A 3USSA 4FP2A 2W1UA 1J3RA 3FE5A 4Z2WA 3RVHA 2VM9A 3G6JB 3ST7A 4NJ4A 5IVCA 1VLNA 2ZS6B 4LBMA 5C70A 4YARA 4BQ3A 4YW1A 1QJY2 3K3OA 1LU2A 2J1AA 2VR4A 1LR5A 3FHQA 3TEWA 1GSLA 1H4HA 1S2BA 1H2NA 4NOTA 1RTVA 1MZEA 4BXSV 5JOZA 3MIHA 3C7EA 4CDWA 1NYWA 4N90A 4FXKB 3K46A 3L2HA 5GLUA 3S30A 2CAVA 4IESA 4CZSA 5JXGA 2E6VA 5ANQA 1FOD1 2AENA 5BNPC 2PTMA 2XJUA 2ZJCA 1FV3A 2XH6A 1ENSA 4Q8LA 5LBBA 3J8F2 1H2MA 4CCKA 4K20A 4OI1A 4YNIA 3WQ1A 4PQQA 2JG9C 3PIGA 4NRQA 2UYBA 3CJXA 3KT1A 4K7JA 2FDFA 1NA1B 1P8JA 4FCAA 2QQPA 1JHNA 3Q8EA 5KBFA 3P5BA 2F4PA 1NAEA 4FOQA 2D3SA 1L7RA 2IVIB 3ZDSA 5IVEA 3OPZA 5CISA 4C91A 1I1EA 1OUSA 1QOSA 1SBEA 4MXWB 3S5AA 3ACIA 4CCEA 4Q26A 2HWF3 2VMDA 4AK3A 2ORXA 2P4EA 4Y5SA 4IV3C 1D2SA 3VHRA 1UOJA 1RUC2 1VBA3 4AEDB 4IETA 2PHFA 5FK8A 4PBPA 1ND2B 3PLQA 4KG8A 5C3PA 1NKGA 4PIZA 1W05A 2P34A 4XUTA 3VDBA 2VOXA 5JI7A 1GQHA 4GIQA 5F3IA 2Q30A 4YYOA 5IWFA 3RWKX 3O1RA 3AMPA 3AVSA 3DKQA 3NNLA 3TN92 3WP3A 4QQLA 4HK9A 4JGYB 3H8RA 1R64A 2RS12 2VC9A 1D4VB 4XACA 2X09A 3NNJA 1C8M3 5BNNC 2WLQA 3KSCA 5AVAA 3WQBA 1LECA 3GHMA 1NY71 3E5UA 1UAIA 1EV12 1W6QA 4HPKA 3R4DB 4P9GA 2CGOA 4EYUA 4YVSA 3A21A 1QJZA 1DHKB 1AYN1 2Q5TA 3DKWA 3IAPA 3CJIB 5FZFA 4GKXA 1S0GA 3BIEA 3JU9A 5FDBA 2VQTA 5AVPA 3KHBA 1VBB1 2D43A 5KHKA 1Z7S2 1G9CA 1XQNA 2A6WA 2BUKA 3ZYBA 2OA2A 1RXGA 1W8UA 2DTWA 4HG6B 2Q1ZB 4OUEA 2DFBA 4BLJA 2WJSA 4LO4B 2XKPA 1V9U3 3CBNA 4FTSA 1PK6C 5T5PA 3WW4A 3OPTA 4RHV1 4HKLA 4QDSA 1EV11 1UF2C 2Z2SB 2RS11 4R9DA 5E8AA 4O65A 3BOWA 5T54A 5B4XA 4IV1C 3N35A 1L7LA 1WUVA 1ODMA 2WT2A 2P37A 4K8FA 1CAVB 4QHOA 4TYSA 2JE8A 5DDJ3 5F9TA 1OOPA 5K0UC 2A6YA 3KM5A 4H14A 1Z0HA 1HRV1 1PNGA 2TEPA 4J6GA 5FMOL 3ZFEA 2A1XA 1OOPB 4MXVA 2B7YA 3I3EA 3KMHA 3POSA 4R4XA 1O3TA 5BXXA 3CMGA 1K45A 1VBA2 2OZ6A 5G04L 2W39A 3VD3A 2QBXA 5DZGA 4TLGA 3RNSA 1SLTA 2WFF3 2DVAA 1XC6A 2HWD1 3SKVA 4JGZA 3OBAA 3Q8FA 3T0BA 1VIWB 1H0BA 2OT7A 1QXRA 5CBLA 3I2KA 5IK4A 3A7QA 3FL7A 3E5QA 2JDNA 5E89A 2DWRA 4FQZA 1UZZA 1DLCA 2D3RA 3KT4A 2G9GA 3NAPC 1BCXA 3PUSA 3O0VA 5JAXA 1B35A 3S7EA 1GOGA 1CJPA 3UK9A 1O8PA 1W06A 2DDUA 4HT1T 4COYA 1A78A 1EV13 2P3JA 1ZZCA 2ZX2A 3N9PA 3WDWA 5EP9A 1G9AA 2CDOA 5LK7B 2KM2A 1VRH1 3HQUA 2QQMA 1V9U1 2A3YA 1CVNA 3WG1A 4O9GA 5EQUA 1RUD3 3ZFGA 1Q43A 2DBNA 3M3QA 4UFMA 2W0XA 2J1SA 5DG1A 2VNGA 2ARBA 2VMFA 5DAPA 4QAWA 5JOWA 1ALYA 5A7QA 4D8MA 3SMHA 5BNNB 4CCCA 3POBA 3VBFB 3TEYA 5GALA 5FYIA 2EXIA 3POEA 3SEEA 3BTYA 1F4HA 2R072 4JVAA 4LUMA 4AEDC 4NIHA 1SFPA 1RHI1 3CU7A 4BXFA 1ZZ6A 3I59B 5D8AA 3WUDA 2BOIA 4X6RB 4BIFA 4DXSA 5JPMB 5A80A 2HWC2 4LLOA 4FPCA 1SLBA 5LB6A 1TVGA 2LUWA 5JWPA 1R093 3AJYA 3QCWA 3VB9A 3WG4A 3WINE 3VKOA 4CU8A 4QPWA 2YC2A 1Q56A 1R1A2 2O8QA 4RGKA 2XUEA 5LA0A 1NE6A 1OBNA 5FZBA 5EJ3A 4FTEA 1PVXA 5FQ0A 3LPGA 4B3NA 3VBUA 4PBOA 3KGZA 2W46A 3NL1A 4NO4A 1CPMA 5E16A 4AG4A 5F5AA 4GWJA 2ZMNA 5H9QA 2ZCWA 4I3GA 1LOAA 1RUE3 4N43C 4Q0SA 1PZ9A 4PLMA 2PA7A 5EWSA 4YPJA 3VL8A 2WFF2 1KS5A 5FP9A 3UJQA 3VBSB 2K46A 2WO1A 3ON7A 2BVBA 2R071 5DQ0A 3WCRA 1V6LA 2AZ5A 4YGBA 5FP3A 4L9BA 1LESA 5C9AC 1ND3A 4FI9A 1HRI3 2WZ8A 4LA2A 3S5QA 4ASKA 1WD3A 5HPOA 1UOGA 3DCQA 1YO8A 3ELNA 3OJBA 3M3IA 3RSJA 2DVGA 2DVBA 4Q0QA 4XVHA 1BVP1 3VV1A 2GSYA 2BERA 1YIFA 5FXWA 3M70A 1OFSA 4CYDA 4K3UA 3TN91 4AI9A 1JOPA 4ZONA 3IMNA 4PDWB 4UFIA 4AHZA 4YG3A 4YRDA 1RUD2 2IXLA 5T5OA 4NWVA 4PJYA 3VN4A 4IEPA 4CTEA 2ORZA 1QMJA 5FP8A 5FZCA 5LY2A 2OS2A 1AZDA 5CYYA 3T09A 5IVVA 4AEKA 3AKSA 1YWKA 2PHUA 4I0BA 1UCXA 3ITQA 4GB31 3QH7A 3W21A 3W20A 1JU4A 3UYJA 5HCBA 2Y26A 2W08A 1A8DA 3MW3A 5FYSA 5FZ1A 1AYM2 4OZXA 3IPVA 2IXIA 5IVJA 5CG9A 1O4ZA 3N36A 4QX0A 1MS5A 4GWNA 3ZM8A 2Q4SA 3AC0A 3DXTA 4Y5TA 3A0KA 2FDHA 2KA3A 1CJDA 2GC2A 2O8OA 1ULFA 1BQPA 1JBCA 2BU9A 4HETA 4ES9A 2VOWA 2B39A 1TQ5A 4LHKA 4NRPA 1SMVA 2IC1A 1GZ9A 1TME2 2WNVA 4HSJA 1UN1A 5EFUA 3GF6A 1IQAA 5L36A 2VNRA 2J22A 1AR61 2XOMA 4IEUA 4L99A 5FKCA 3FLTA 5CU1A 3GM8A 4N53C 1IZ3A 2DF7A 3OEBA 1RUC1 3VZKA 3WF0A 3MIFA 1PO23 4YGCA 1CGPA 1Q3EA 2QFEA 1JYXA 3BI3A 1F4AA 3D82A 3JBG1 3UKVA 3ZYRA 4QU2A 2IXKA 4AVBA 4NAOA 4L2NA 5F1RA 2E26A 2NPIA 1OMIA 1ZA7A 1NUKA 1NXMA 2VL4A 3OBZA 3T2QA 3LZZA 5CKNA 4MGTA 4CSWA 4ASMB 1OH4A 2X29A 2B45X 5JIAA 4JGYC 4BMBA 1V6KA 4QKNA 4LBJA 4KBZA 3PDQA 2DCTA 3T2OA 1G8WA 1UY3A 3WNLA 3B02A 5FP7A 5FMOS 4A6SA 4CU9A 5FZEA 1GYKA 2RR12 1JTZX 5F37A 4GAZA 2EIDA 4CRQA 4ZZ8A 1JZ7A 3VDDB 4BH9A 1G86A 2JIJA 4NHXA 2ZX0A 4R8HA 2XJPA 1OA3A 1R1A1 4M00A 3J4UH 4NIIA 4K9SA 4BISA 3I2GA 1W9WA 4YZ3A 1PO13 2FZ1A 2QUOA 2Y6LA 3WR0A 1SBFA 3E1F1 4KL1A 4IUGA 4P5HA 3FWEA 2EVXA 1C5IA 3AP5A 4QKFA 5JOXA 4CEWC 3VBUB 2KXLA 4W6YA 1XNAA 3AFKA 1KD7A 2FCTA 3LD8A 5FPXA 2W9XA 1SFNA 4LNVA 1TMF1 4JCKA 1QIQA 1W2NA 4P9WA 3C3VA 1PVC1 3ECQA 2RR11 3VDCA 5FYBA 3ZN4A 2WNOA 1SCSA 1RINA 3GCXA 3O0XA 5LK5A 4DB5A 1IS6A 1ULOA 4QQHA 4KGGA 1JH5A 1VP6A 4OYUA 1W8NA 2Y6FA 3AP9A 5FRAA 2OZJA 5LRSA 4Y1XA 1RMU3 4AGGA 4CP0A 3N4MA 2MNGA 4DS0A 4M0HA 1ND2C 2BVVA 3ZXAC 2UYAA 3EHKA 3D3AA 3O0WA 4XPVA 5A3WA 1COV3 2DYCA 2YFZA 5F3EA 4YM3A 4QXCA 1FMD3 2WZR1 3RYKA 1ND3C 2R1BA 1W0PA 1WLCA 4P9IA 1UYYA 4XMAA 4RS5A 2OQ6A 1CESA 1UU5A 5FREA 1S55A 3KLSA 5LEJA 1V6IA 5J98B 3UKNA 3H3LA 1Z78A 3RWNA 2MPFA 4XHBA 4AHWA 3QACA 1N1VA 3S57A 2D6KA 4OZOA 4D6RA 2NQYA 4H7MA 2VZVA 3WDYA 1UXZA 3VKFC 5KR7A 1DIWA 4B4RA 3IZOA 2XGXA 1O5LA 3WW3A 3HN3A 2EXKA 3K77A 3KT7A 1VMHA 3M1HA 4JX0A 2E7AA 4NVPA 2Q8OA 5C5TA 1DYOA 4CDXB 4HONA 4V2VA 2WO3A 4XABA 3UJOA 2OUHA 4KBBA 2PQQA 5J3UA 5A32A 3WVJA 1VBC3 4MGIE 3H7YA 4TLFA 4DMIA 4Y3OA 2PHLA 3HNYM 1V70A 4JAAA 4D0QA 4LXLA 2RDSA 2A6VA 4GMP3 1YI7A 4GALA 3T2TA 3AZVA 4X8NA 5DZEA 5IVFA 1FOD2 3RJRA 2X8KA 1PHMA 1QJY3 1OPMA 3H8XA 3WUCA 2VOTA 4YW3A 2ZX4A 3APBA 3Q9OA 3VD4A 4KGQA 1JMUB 4QHZA 4P14A 2AGSA 2C9AA 3FLRA 4PIYA 3AL5A 1M4WA 4JQTA 4M3CB 2XL9A 4AF9A 3AXDA 3S0MA 2QJVA 4OQ9A 4ES8A 1GU3A 1OHFA 1WLWA 3SEPA 2RJKA 5C8CB 2R043 1DZRA 2YPJA 1DYPA 1Q8QA 3I3QA 1ONAA 1BBT2 5BNPA 1VBE2 4E2GA 3JD72 3RZGA 3SCFA 3GBFA 2BDRA 2QQOA 2ZGKA 4CCLA 5IATA 1CAVA 4ZS2A 1CAWB 2UU8A 4CCMA 3V0BA 2VD7A 2RMU3 1VR3A 1O4YA 1QJX3 4Q0UA 4Q4Y1 4JQRA 1JYCA 1YJKA 5FUIA 4QPIB 1FMD2 3AZWA 4QQPA 2WKKA 4XJZA 5FFOC 1PZ8A 1YFXA 3GJBA 1HRI2 5A1AA 5DXDA 4FO9A 5DUWA 2LM3A 1VAKA 3ZDVA 1QNWA 1AVBA 1OOPC 2HWB1 2LS6A 1HRV2 4PDWA 4XHXA 2ZHKA 3U07A 4XTMA 1REEA 1RUH2 4Y22B 5T5LA 1LHVA 1AR93 1HB4A 3VD9A 3TYJA 2BZDA 4QX3A 2JDPA 2EIGA 2VE1A 5J7MA 1NCRA 4NIDA 2DUPA 2C24A 1H8TC 3J7NA 2JICA 3VDDC 5C6CA 2XPJA 2ZMKA 3HNBM 5CFDC 3VBOC 4FXGB 4FPJA 4QDQA 3UGFA 2GDFA 2OVUA 4LO7A 4Y24A 4AE2A 2BFUS 1VB2A 3BODA 5I93A 4GA9A 5EV7A 1JZ3A 4XEZA 1C8M2 2GNMA 5H9SA 4CP9A 4CCJA 1VBC2 1LAJA 3ZPYA 4AI3A 5ISLA 2W5FA 3ZSEA 3NV2A 1RUOA 3AYDA 1QKQA 5FZ3A 2AREA 1E5RA 1ZX5A 1HJFA 4LBKA 2I2SA 1ASJ1 2XVLA 4N8MA 3B00A 3CKHA 2VQUA 1Q8OA 3MFAA 1V0AA 2GN3A 1A34A 2LTNA 3EBRA 3B7MA 1RUI1 4URAA 5JZGA 4AWDA 1Z7S3 1YI9A 1HW5A 5I0SA 3I54A 3I2DA 1XSRA 3P3PA 4R9AA 5A6XA 5FZ9A 3ZXEA 2JXAA 5J09A 3VBRC 4HMZA 3VZLA 5FPBA 4BQXA 2Q8CA 4OUSA 3K3NA 5FZAA 3FX3A 4CEYC 1KEXA 3WCSA 2DCJA 3K75B 3VBHA 4MUVA 2BW8A 4N7IA 1AL21 1MZ6A 3SCHA 1ST8A 4E4HA 4WVZA 1SHWB 2VU9A 1RIRA 1OSGA 3J9SA 2HEWF 1WBFA 2W1WA 2E32A 1FV2A 3AK0A 3MUY1 4NWWA 1WGPA 3R6SA 1ASJ3 4BLIA 4XZUG 2DURA 3J26N 1PMHX 3M3OA 3RZZA 2E7QA 3WNMA 1V6OA 4C0HA 3ILFA 3K2OA 3SHRA 4PLNA 1REDA 3C2UA 3P6BA 2XR4A 4XBNA 5K7PA 2Z42A 2YY1A 5F3GA 1J84A 2ARXA 2GMEA 1AR92 4IGOA 5FXVA 1K5MB 3OUIA 4K1ZA 1JZ2A 3VDDA 2DU1A 4AVAA 3TNQA 4KQ7A 1JXNA 4QPGB 1OD3A 3LSEA 1YC61 4XFAA 4FPOB 1RUG3 2A70A 4AZZA 2YHJA 2BP6A 4J1XA 5EXOA 1W03A 1W8HA 3GBWA 4A41A 2P1BA 1W39A 3GGLA 5K4LA 2RDNA 3D4KA 4LK6A 1PO12 5ERLA 5L7OB 5KC6A 4JGZB 1RXFA 1QWRA 2ID4A 2L9LA 3MYXA 3OF1A 3POFA 4INDA 2C0ZA 3O1PA 3PURA 5A1LA 2VUDA 1X7NA 3CDZB 2WFPA 4LO8A 3TEZA 2WZR2 3WG3A 1Q8SA 5I0TA 1ZRDA 1XSQA 4Q4Y3 4DXRA 3AZYA 5JXHA 3IB3A 1Q8PA 4A2UA 1QJX1 4CEWB 5FBZA 2RMU1 4ZHNA 2JKBA 4UFKA 3CF6E 1X36A 4QGMA 3WLUA 1I9RA 2PHRA 3OUHA 4A3XA 4NROA 5GZDA 5AFEA 1MQTB 2Y33A 2GNBA 1F9KA 3VBRA 2VBDA 3ACLA 4EE2A 5CG8A 1H8VA 1HQLA 1VMJA 3DPRA 2FMYA 4WVMA 3ZXKA 4UW3A 1HJGA 5DZFA 1ACCA 1BK0A 4YW4A 5HXVA 1QJU3 1Y9GA 1EUUA 2I45A 3C7OA 2OXBA 5L19A 1Y3TA 4IEWA 5LASA 5BUVA 1D2QA 1DGLA 2ZKNA 5DG2A 4XF9A 2FBEA 4XMIA 3TEXA 3FUOA 3GZAA 3GZTB 3B94A 2VXRA 1OURA 2HWD2 5KXEA 4QPIC 5I0RA 4V1PA 1DLLA 3R05A 5FY9A 1CWPA 3LB9A 3R4UA 1A3KA 2RHPA 4DQAA 1RUNA 4IEQA 5IAVA 2H6BA 3BB6A 1HB2A 1TG7A 4NHMA 4KMQA 4DOUA 3CIHA 1J59A 2XG3A 3NNGA 1CZVA 3H9AA 3L2YA 4Q0PA 4UWDA 3ZIXA 3CJIA 3AKTA 2PHTA 3I2FA 4BJ0A 1VAMA 1IPSA 2VTXA 2D44A 2ZX1A 3BYWA 1PK6B 1X8MA 3ES4A 3POWA 3AZXA 3VKNA 2GMPA 2R32A 2J1TA 2D5HA 2VCAA 3KV9A 3RG0A 5C3SA 1QDOA 4FFHA 2F17A 3KS7A 2CDPA 3LA3A 1NOVA 4XURA 1VRBA 4Z1VA 2EAKA 1CAXB 1OLME 1COV2 3AMHA 5ACA2 1AL23 4XJWA 1HLCA 3NJZA 4CEYB 2B9VA 2E33A 3VBSA 3MEPA 4ZU4A 2WWUA 1GFF2 2AACA 1REFA 4YM2A 1GNZA 4NAMA 3AP4A 2G19A 1DGWX 1GQPA 2WZR3 4JHZA 3WV6A 4BQYA 1YIPA 1DBNA 2IXJA 2IWGB 5FYTA 5FZLA 2NMNA 3I8TA 2JX9A 3VHPA 2X05A 5D1IA 1PX4A 1XRUA 4SBVA 5C5UA 4IGQA 2CU5A 4Q29A 1U0AA 5FYVA 5GM0A 3FZ3A 4QM9A 1BVVA 1KXGA 5HCHA 1NA1A 3I97A 4LE4A 4CPBD 2WSVA 2XQRA 4QU1A 5DN2A 1BZWA 1RUJ1 1MS4A 3NAPB 5I0DA 1UY0A 3K4AA 3NNMA 2PHWA 3BUCA 3WNNA 5FK7A 3WHTA 4HVOA 2D6MA 1OC1A 2VBPA 4CDUB 4P9YA 4CU7A 3ZFGB 4E8CA 4AI8A 3AL6A 4XJAA 4XJUA 2VY0A 2JECA 4ZXEA 1DZTA 1JHJA 3HT1A 5IW0A 4ATFA 1XE8A 1XE7A 2YB7A 2XQXA 2VOVA 4QQOA 3ZFEC 1XNCA 2YBPA 3JBG2 4CP9B 3TNPB 1PO11 4M3CE 4K40A 3E6CC 2QE3A 2WN2A 2DCYA 2W92A 3LKJA 4LKSA 5FCCA 1GKBA 2BFUL 2JWPA 5DUUA 2YU2A 1N3QA 2WAOA 1J3QA 2P6CA 3FBYA 3I7DA 3JD73 4HKOA 1YQ2A 4LEJA 4Q4X2 4S2GA 5FZMA 2ARAA 2YC0A 1WD4A 3ZXLA 5I91A 1PO22 5FZHA 3U10A 3V65A 3NNFA 4FFIA 5FO8B 5SV5A 1BLZA 2RMU2 4RGGA 3ZIWA 2XBO1 2GMMA 4Y1ZA 2JDYA 1D0HA 1AL22 3VBSC 3WSOA 3AKQA 2GNTA 4CUCA 3LGRA 1OLQA 2FCVA 3PMEA 3KF5A 4BQ4A 1KITA 1JS9A 1X9TA 4YVSC 3VZJA 1ENXA 1ODNA 4FPYA 3SKJE 5DAWA 3AP6A 2ET1A 5BNPB 2X5IA 5FPAA 1W6MB 4RL7A 4FPGA 3T08A 3OGRA 2YG0A 2Y38A 3C7GA 3JB8A 3WW1A 4QDRA 5A3PA 3VZNA 5BNQA 1PIV1 3ILRA 1PO21 3RZHA 1W6PB 4P9XA 2WO2A 1ZVFA 3DYPA 4LJHA 5FKBA 3H7JA 2A6XA 2AR6A 1AR63 1US3A 4QB1A 2OUJA 1YFYA 1J83A 1NA1C 2PLV2 2YGLA 2IXCA 2QVSB 2FDJA 2J1VA 2VW1A 1ZBE2 4GMP1 5FWEA 2FDIA 4Y5Z0 1LB2A 4ITCA 3DPRB 2JEMA 2EF6A 3ES1A 4ZY9A 2VXJA 2CHHA 2ZHNA 4AFCA 4BHPA 4LO6B 1MACA 2J7MA 3GXUA 4N9IA 2QZ3A 2ZGUA 4CEWA 2WA3A 5AC92 5I8SA 1MS9A 1JUIA 3LFIA 2D3PA 1SFYA 1MS3A 4D7TA 3KVBA 3POYA 3N9LA 4YW7A 3M2MA 4Q2FA 2V09A 4PI2A 1OH3A 5A6QA 2VZTA 3JXSA 1F2NA 3CJIC 2HWF2 3WNOA 1AXYA 5A3TA 4RQPB 5A32B 2W95A 3OG2A 3FFZA 3PVBB 2XDVA 4LHSA 1XB9A 5LA2A 3WF3A 4CP2A 3UESA 5KC5A 2GP5A 1OVSA 4YVSB 1H2KA 1WMDA 2F4LA 2JG8C 3KQ4B 4Q4W2 1H1MA 1FMD1 2Q8EA 1MEC2 3MUZ1 4QXKA 3RMYA 2BGOA 4RFT0 2BBAA 3SH4A 4CU6A 1RUE2 4Q5OA 1LOFA 1CZTA 4EWEA 1KS4A 3TN93 1QGLA 1ZBA3 1FX5A 1UO9A 2JDKA 3LIGA 3NAPA 5FY0A 5C4WB 1GLHA 4QT6A 3I2OA 3FFQA 2XLAA 2DUOA 5GLVA 2ZGLA 2VECA 4EZ4A 1SZBA 3SC7X 4PCRA 1LHNA 5D2AA 1ZREA 4LIUA 5LBEA 3VBHB 1RUJ2 4HK8A 3CLPA 3ETPA 3P3NA 3ZLIA 4CA9A 4JKKA 5F5CA 1JYNA 3DF0A 1AX2A 4Q4X1 5E1RA 4D7SA 5K9YA 1PVC3 1RUE1 2CTVA 3IIAA 3VDAA 4J25A 3ZYPA 1HQWA 1LOGA 4QGNA 5L9RA 4K21A 1GR3A 1TMF2 1RJ8A 1L3JA 3QH6A 3ZFFC 2IFWA 2W91A 3I59A 3I4IA 3KZ4C 3T4VA 1NLSA 1GNHA 1WA4A 4JC1A 5LA9A 1H2LA 1W9YA 4YZ5A 1CIWA 4FQ4A 1DGWA 5D8AC 2OW4A 1RHI2 5JDBA 4MV2A 1AYM3 3MPPG 4NE9A 1LHOA 4FVVA 2HWC1 5JZGB 2VPVA 5SV8A 2WS91 4CDWB 4QXHA 5LW9A 5DAVA 1IPKA 3WQ0A 2SBAA 4NHKA 1AR83 2B4KA 2YROA 4A7ZA 5JCTA 5FZIA 4OI0A 1YQCA 1XU2A 5ACA1 4JRAA 1RUI2 5C4WA 1J1TA 3ZR5A 4HFSA 3PJQA 2R6QA 2WC2A 3MGUA 1BBT3 4LMFA 3M4FA 1R1ZA 2V73A 4MX3A 4LR4A 4N7UA 1W99A 2QQNA 3IIIA 1JUHA 2WA4A 3CO2A 3NO8A 1UPSA 1WZXA 3BKZA 3V64A 3VBHC 4BPZA 1MEC3 1Y9QA 4LE3A 5CA6A 4FBFA 4TZDA 3LSDA 1VRH3 4IERA 1PGL1 4A4AA 1PMIA 5CIRA 4MO3M 5FXXA 1UU6A 5A7NA 1ZBA2 2YGMA 5C9AA 4Z92B 3TOJA 2NM1A 5JIUA 4DEVA 3ZXDA 3BTZA 2VZPA 2NN8A 5DDJ2 1G9BA 1OXCA 2QCSB 2OPWA
chains in the Genus database with same CATH topology
4JV4A 2W52A 3AMQA 1ZRFA 2X5IC 3WY6A 2WL1A 4WM8A 4XBQA 3FC0A 4OUMA 3GYDA 3LOIA 4GXLA 2TNFA 3AYAA 4OHYA 4H55A 1CAUB 2BQPA 2PAEA 4MLOA 1PVC2 3TB0A 2WQ4A 2ZGSA 4Q1PA 4XF4A 1QXPA 3QLQA 4AVTA 2K2SA 2ZA9A 4DY3A 4FTBA 3WHUA 3V0BB 3ZXGA 2GNDA 4MYEA 4XF0A 2V5YA 2ETEA 4GB33 1V00A 1CN1A 4XFBA 4ORFA 4ISRA 2VUJA 4AVSA 3MPBA 4RGAA 4COVA 2DUQA 4WBBA 4R4ZA 4LT5A 1DDLA 5DDJ1 3ZMNA 5I0UA 2WNUB 2BNNA 2RM23 2ZZQA 4B7EA 1EYBA 1U5ZA 1ZBE1 5C4WC 1MVEA 3ZSKA 2A75A 1QOOA 2CGNA 2Z5WA 3FUQA 1HRI1 1PIV2 2XJRA 4Z8BA 1E57A 5CFCC 1NE4A 2FZ2A 4MVTA 2R073 1XU1A 3AMNA 1RUF1 2ES3A 1LULA 1AYN3 1O4TA 1G7YA 2WWSA 3ZX7A 5I8YA 1GZCA 1J58A 3WD5A 1O3QA 5F6LB 3MF9A 4JGYA 1QNYA 1POV0 4G4FA 4WZFA 4ATEA 4HSLA 1WCSA 3GBGA 4GH4B 2B46X 3A4UA 4XFCA 4IV3A 3LAGA 2BBVA 4LUKA 1BYHA 1MR5A 4TSVA 5HCAA 1OA2A 2EAAA 4LBQB 2GH8A 4RR3C 4AYUA 5KWRA 2ZGMA 1BK1A 1VBA1 1AX0A 4ZU5A 1EAH2 1O5UA 5D8AB 1DU3D 4R9CA 4NPRA 3RJ2X 2JE9A 4OHZA 5LRRA 4B29A 5J48A 4DINB 3R0RA 3V0AB 4B7KA 4Z82A 3JCIA 1D0GA 3RQ0A 1H8TB 4HKWA 5BNOB 3VBFA 1DYKA 4Y1VA 1S2KA 4Y22A 5L73A 2SLIA 4URTA 4XDQA 3IDEA 1N3PA 3O12A 3MLLA 4BQ1A 5CFDB 2DV9A 3WDTA 2WS92 1V9U2 3QD6A 5CFCA 1FAYA 3NKGA 3RDIA 1WW4A 5A3LA 1RL3A 1W2UA 4IEVA 1PK6A 1CPNA 1MS0A 1FI2A 1RB8G 3B93A 2HWD3 2K0GA 4WVWA 1LJ7A 1CAWA 1BEV2 1GZWB 3O7OA 4DFSA 2IXHA 4CDQA 2K9ZA 1T6GC 2G4IA 3K51A 4QD2A 3JB4C 4YGEA 2NZ9A 3D0JA 2VW2A 1HRV3 3IBMA 1YYNA 1MS8A 5CADA 1OFNA 1LHWA 2WNVB 2P3IA 1YXWA 4YVWC 4DPNA 5JOYA 1HXS3 4BE3A 3VBUC 2P3KA 3FLPA 3AKRA 3JZVA 3OD0A 1TME1 2C5DA 4RHV3 2VG9A 4YW2A 4FAGA 3D6EA 3USUA 5CAZA 5GLTA 1G6NA 2B42B 5JPNB 1MEC1 3OCPA 4OI4A 1QU0A 4ASLA 2G9FA 1GZWA 5CFCB 3OYWB 1N3OA 1B35C 1ULDA 1SDWA 1UKGA 3HIFA 1XNBA 4YW5A 1AR82 1RUF2 1VBB3 4K1YA 1K5MC 4X6QB 3NVCA 4COWA 1EPWA 3PJYA 1XXNA 4RD7A 2HEYF 2GC1A 3PTYA 4M3CF 4MSVA 2ZABA 4WV8A 1AX1A 3SH3A 2XJSA 4PQ9A 3GNEA 1KQRA 1ND3B 2ZAAA 4Q1RA 4Y1YA 4RQPC 3K48A 2ZBJA 2WS93 4QPGA 5KHIA 2H0BA 4JTOA 1RMU2 3D5OA 2P17A 4UW4A 1UIJA 4YGDA 2ET7A 1QH7A 2BNOA 1PNFA 4E2SA 1RVF1 4QGLA 4I0WB 1LEMA 1JOJA 1UX6A 2BYVE 4C0BA 1WLTA 1XNDA 1C3HA 4KU8A 3THTA 3B9IA 4C90A 2ZACA 1IKQA 1LHUA 4LBQA 4CDQC 1GQGA 3HR9A 3QBQA 1UPIA 4D69A 1SQ4A 1XYOA 2HWF1 1X8EA 1F31A 3MW4A 3H1MA 1Q8VA 2JG8B 4BOWA 3ZSJA 1D4M2 5DUVA 2BGCA 4IV3B 3AX4A 1YHFA 2JENA 2JG8A 3M8LA 2CL2A 4N53A 2VH9A 1I6XA 3RI9A 1MZ5A 4GQ7A 5JSRA 2XWJB 1N1TA 1UD1A 3A0NA 3N7JA 4RHV2 5BNNA 1ULGA 4Q0VA 4XIKA 1MZFA 4I01A 4OVEA 3HD8B 1FOD3 4BMEA 1CONA 4IEZA 5T5JA 2D6LX 1RITA 3NV4A 4IXLA 2DTYA 5JZGC 4LHLA 3AMMA 2YYOA 2RS32 4Q4Y2 4FT8A 5HBAA 3PMSA 4E4DX 3ME2A 2Z69A 3IDCB 4AGRA 1LU1A 2EALA 2R042 3WP4A 4AEJA 3U11A 1J3PA 2HWE2 3EXUA 1WMFA 4S2FA 4EWDA 3LWCA 5FPZA 3OYWA 3ZSLA 1C28A 4O9EA 4EN0A 1O7FA 1AHSA 4QPIA 1FPN2 3MIEA 5DUXA 3E5XA 1W6PA 3RYRA 3MLJA 4X8PA 3H3ZA 4E4SA 1Y43B 2XJVA 4OI2A 4WVMB 2FQPA 4XFHA 5A3MA 1S0CA 2VVEA 2PHXA 1TME3 4XF3A 1O3SA 2QNKA 2P2KA 5T55A 1HXS1 2WNVC 3JQXA 1MQTC 3WG2A 5K0UB 1VBE3 1NCQC 1CR7A 4HN1A 1AR73 2PFWA 2VMHA 1UZYA 3W58A 4YFWA 1LOFC 2XBO3 3IPVB 4Q8KA 5IK5A 1BMV2 1Y7BA 4WM8B 4KG0A 3VZMA 1JW6A 1OKQA 2XJQA 3ZFEB 2X5IB 1FATA 4COUA 2D6NA 3AJZA 2WINB 3JD71 1ZRRA 1NQDA 3HWJA 1K5MA 1BEV1 2CAUA 4AFBA 1HIXA 1WMEA 1C57A 2VVFA 4B4PA 4YG0A 1S0DA 4YFZA 2XB6C 2HWB2 1W6OB 1HDKA 2RS53 4QPGC 4AFMA 4AQ2A 1VALA 5LEKA 1J1LA 5FAXA 2JD4A 4AW7A 5F5QA 3ZFFA 4MZUA 1OA4A 3J8F3 1EAH3 3GALA 2LALA 2CGPA 3OTFA 5L7OC 3NV3A 1SBDA 4OHWA 1RGSA 3ZXJA 2ZOEB 4XOGA 1LTEA 1W6NB 1O3RA 4EN9B 1ASJ2 2VGDA 1R083 1URXA 4AXOA 4EJRA 4QX5A 5FQ0B 1WW7A 1VB4A 3H1WA 2OYZA 2O0OA 4LO5B 1MVQA 4MXWA 2BNMA 3HT2A 2ZGNA 4Q4V3 1AJKA 4WM7A 4Y20A 4FAHA 5GZEA 2D6PA 3RRDA 4JGZC 4WM7B 2H0VA 3DV8A 4Y20B 1PGSA 4I2OA 1QQP3 2RS31 2XVKA 4XFFA 1ND2A 5FTTC 3O14A 4Q4W1 5E88A 2ZGQA 4XF1A 5JSOA 4LTAA 1X50A 1AXKA 4PLOA 2OIIA 4XXAA 5A33A 3BIWE 5IK8A 2E7TA 3WW2A 2BTVC 1RUF3 3WZ1A 2NYYA 4H7LA 2ILMA 4EV0A 4YZ1A 2D97A 3RS6A 1C1LA 2PAKA 4MGZE 4C1WA 2GAUA 3TRSB 4D7YA 2ZMLA 2ZGOA 4YM1A 3PNAA 1I5ZA 3ZO0B 1UL9A 3IM0A 1QJU2 2PLV3 4GB32 3WOGA 1U5XA 1ZBE3 2QDRA 5KXDA 1PGL2 1YJLA 2B5HA 2RM21 3FMGA 4YLZA 1LEDA 4XQWA 2I74A 2D6OX 1BKZA 1VJ2A 1GICA 1SLLA 1YLLA 3LCPA 2R1DA 5KXCA 1R082 5AC91 4RA0A 4XYXA 2R49A 3IT8A 1KDMA 4H3WA 3TAYA 3ZVXA 4XJ9A 4DXZA 2WNUC 4Y1UA 1G9DA 2VOKA 1QXJA 3UL2A 1MQTA 1POV3 2MEV3 4W6WA 2BWCA 4IEYA 2DU0A 4AGVA 3VL9A 1YFWA 4N43A 3VHNA 4EN8B 1QJX2 1OQEA 1AYN2 1CAUA 3LA7A 2PN5A 4P9LA 3EQEA 4S2DA 4DZGA 2VNOA 4CDUC 4AHXA 1RUG1 4XZPA 4AFDA 5T52A 3N7LA 5GLWA 3RPQA 1ZM1A 4QMAA 4E9KA 4IV1B 3BPZA 3VBOB 4KWLA 2CY6A 4YG6A 4UXAA 3SLIA 4CDXA 4XQ4A 2QZ2A 1N1YA 3M3CA 4DY5A 5HI0A 1CX4A 4FPHA 1BBT1 3B01A 1TNFA 1IS4A 1PGW2 3ATGA 1H8TA 1EPZA 1EY2A 2HWE3 2JE7A 2DVFA 1LGBA 5ACA3 2DCKA 4KWJA 4LLFA 5A33B 5ABJB 4RR3B 1AR81 4C1XA 3CL1A 3MIDA 4HBNA 3AFGA 4M0NA 2HWC3 1H1IA 4WZCA 1AYM1 2VVDA 3AKPA 2IZWA 1VBD2 2WLPA 4YM0A 3N7MA 1FPN1 1LGNA 3NV1A 1GANA 1RUH1 2ATFA 4GULA 2E63A 3ALQA 4JTNA 4W65A 1RUI3 2Q1MA 4XIOA 1JN2P 1B09A 2ZGTA 3UKTA 4G9SB 4E2QA 5FLIA 3VGIA 1RC6A 4KH9A 4N9HA 2UWAA 4MH0E 4Q4X3 3SNMA 1XYPA 1UW8A 1DQ6A 1FNYA 3VLBB 1YNAA 2JG9A 1VRH2 2R063 3WNXA 1NCQB 4RS5C 2CV6A 3ENRA 4FPKA 3ZMOA 3AXEA 4IL7A 1ZBA1 1DQ1A 3E6DA 4UBHA 4LULA 1AR91 4AHYA 4JDOA 1NCRB 4OFGA 4GH4C 3WDUA 1A8MA 2HWB3 1SLCA 1S0IA 2UY9A 3H50A 4F3JA 3FBMA 3ASIA 2VQAA 1V6MA 3PVOA 4BWOA 1LOBA 2CYFA 4RSUA 3OGGA 1HKDA 4MGYE 5BYNA 5GLZA 4TWTA 1C5HA 3VKLA 4XBLA 4OHVA 4I30A 4U2AA 1ZYBA 1WLDA 2JJ6A 4AQTA 4L11A 1WW6A 2CWSA 5T3NA 1VBB2 3VKMA 1HQNA 2R041 1VBD3 3GHNA 4AI2A 4HN0A 1W6MA 2W68A 2HJIA 2WT0A 1SCRA 1S0FA 1FYUA 2WZPP 4BZ4A 1U5YA 2A6ZA 3WX5A 1AR62 2XWBB 1BXHA 1O91A 4XILA 3WT3A 4HVQA 1QJY1 1PIV3 2D7FA 4R9BA 1IGOA 1U5IA 2A71A 3HN1A 2VQ0A 3FHIB 1KFXL 4PF5A 1AF9A 4CYDA 2QDNA 1QQP2 5JI9A 4AQSA 2F6BA 2D98A 1VBC1 1VBD1 2OPKA 4K6BA 4M3CA 3V56A 5FOBB 3NKTA 4L97A 3WXPA 4E4ZA 4CP1A 1OI6A 4WM8C 2QKDA 3PVEA 3CNAA 5GZGA 5KXBA 3MI8A 3U0ZA 2N7GA 1AL0G 4IQPA 5FLJA 2ZPXA 3HAGA 1DF0A 2NLRA 2TUNA 4OLLA 2EXJA 4FOVA 3PHMA 4Q4V2 1KFUL 1KJRA 5JR7B 4OHXA 1D4M3 2WIIB 3NSTA 2H6CA 5CFDA 1AXZA 1NCQA 2Q0AA 3OY8A 5BNOA 5KHGA 1COV1 2VULA 2Y0OA 4B8EA 4N53B 2HEVF 2RJLA 3JQWA 4KU7A 1CQ9A 3V0AA 1RMU1 2ZHMA 1QDCA 4ONUA 3B5LB 1YRZA 1PZ7A 4JDNA 1RUJ3 1DG6A 3MIGA 4XFIA 4QM8A 2GH2A 2DVDA 1ZNPA 3D8CA 2I07B 1W6NA 3IWZA 1V6NA 3DN7A 1AJOA 1GBGA 1F8VA 2RR13 3EJKA 4META 3AZZA 3ZFGC 1QY4A 4CEYA 1TMF3 3WQ7A 4D3WA 3MDPA 3AM2A 3B69A 4F83A 2ZKLA 2ENRA 4GWMA 3MFCA 4M01A 4AEDA 1FPN3 3ZYGA 2GN7A 4XJ8A 3THPA 2PELA 3WP6A 4DRRA 1W6OA 2ZGPA 1D4M1 3NW4A 5GJ6A 3B9CA 1F5JA 1C1FA 4HL0A 1KDKA 4Y26A 3HMYA 4LBNA 1DFQA 1OD5A 4PDWC 2E53A 4FP3A 3CEWA 1WCKA 4ZXKA 2WQZC 1EP0A 1S0EA 4UBGA 3ETQA 1DQ2A 2A3XA 1Q5OA 2CNAA 3M3EA 4WM7C 1UMZA 1WCDJ 2TBVA 3ZN6A 1N47A 1TE1B 3VBOA 4U36A 1QOTA 2XLGA 4KNCA 5J37A 3SXWA 1H30A 2R30A 1SLAA 1ULEA 2D93A 1HV0A 3WP5A 4DRVA 1LOEA 1FT9A 2YXSA 3DGTA 2AH2A 5F6KA 4IEOA 3ZN5A 1AUYA 4NN0A 2A73B 3TBDA 1UU4A 2YUEA 2IFRA 1U12A 2ZHLA 1OLRA 1QJU1 2DCZA 5JVVA 4OULA 1DQ5A 3DPRC 5C33A 4Q27A 1OPOA 4COZA 1ZRCA 5EZWA 3SISA 1ULCA 2ZTNA 2MEV1 3M7AA 4FPEA 2XLFA 4Y4YA 4YSFA 2NP0A 1BMV1 4G3YC 2AYHA 3H0OA 3O5SA 4I0AA 5AC93 4S2HA 2ZZJA 4BYYA 2R062 5IUQA 1APNA 5L7OA 3BU7A 4F8AA 4NHLA 3KCYA 4HLTA 3ZN6B 2E51A 1LODA 3OBTA 3E97A 1RVF2 3AP7A 4A7YA 3MZHA 2XKOA 4XE9A 3MIBA 5C9AB 2Z79A 2B9UA 4MGKE 1ENQA 4BA6A 4LA3A 2YMZA 3W9AA 1DQ4A 4YVWA 2AUYA 2Y0IA 1ZZ9A 1LCLA 1SLIA 2O1QA 1W6QB 4HPKB 4BIOA 4J1WA 1ZZBA 2R061 3L9JT 3ILNA 2CWMA 4ISQA 1SACA 4L92A 4E27A 4LBQD 1TNRA 2HKXA 3W59A 5C8WA 1CD3G 2GZWA 2R0FA 3PVNA 2ZAHA 1IS5A 1NY72 4HVRA 4CDUA 4HZFA 3SH5A 3WDXA 3URFA 1NZCA 3IN9A 2GU9A 2GC3A 3S6PA 5H9PA 1RUH3 1A6CA 3INAA 2RS33 1S0BA 2VMIA 2XL7A 3RI8A 4XFGA 3T1LA 2ERFA 2UY8A 1VAVA 2D40A 1R091 1RJ7A 3U4XA 2EXHA 2PYTA 2UWCA 2VMGA 3EO6A 4XETA 2B8MA 1Z7S1 4FOWA 4L8QA 1C8NA 1ZA4A 3OD4A 1NG0A 3D0SA 1RHI3 4R52A 3IKWA 1CAXA 2HWE1 1HV1A 2PHDA 3AB0A 3HQXA 2A3WA 4YZ4A 3E6BA 3BOPA 4YZ2A 3BTAA 3QOPA 2BWAA 5FO7B 2DFCA 4IEXA 3DUIA 3KQRA 3ZYIB 3UV9A 3MF6A 1R092 1RUD1 1IOAA 1X82A 4YVWB 5JLVA 1S0JA 1PM7A 1F5FA 4EN6B 3R4SA 3J8F1 2MEV2 2E9QA 1ENRA 1LENA 1H9WA 2MHFA 1HX6A 2WSUA 5FLHA 2RS51 3VHOA 4XQDA 2GALA 4QHBA 1ZZ7A 1RUG2 1AR72 2VUAA 1DQ0A 3MW2A 1B35B 1OQ1A 2WNEA 2XVGA 1YFUA 1BEV3 3G7DA 2FMDA 3MLKA 3H3UA 2VW0A 2WFF1 2JDZA 3SITA 1PGW1 1H9PA 1POV1 3RMXA 1QHDA 3JUUA 4BM8A 4B4QA 4BCUA 3KD4A 2UURA 4W6XA 2XHKA 2XJTA 5JSPA 1C4RA 1AR71 3H8UA 2FHRA 1G9FA 1VBE1 3T1MA 2RS52 3S7IA 4EN7B 5I8TA 4CDQB 4AVCA 5B2GB 3LA2A 4P9JA 5C8CA 2A7AA 2RS13 5GZCA 2PLV1 2C1FA 2BEOA 2UWBA 5EYYA 4FOYA 5KHJA 1NQJA 5FO9B 2RM22 4XTPA 4D94A 1X33A 1OQDA 5ABJC 1I3HA 2XUMA 5BY5A 3DL3A 1H4GA 5CVRA 3OBRA 3ZXFA 1JYIA 1H1AA 4A7KA 1LRHA 3KCXA 5IK7A 4FSJA 3VBFC 1ZZ8A 2RE9A 4PIXA 4UW6A 3NWKA 4EROA 2BPA2 1LGCA 5JMCA 5EYXA 3B3QE 2D5FA 4Q4W3 1DGRA 3HBZA 1C8M1 4XW3A 4GKYA 1QQP1 2WT1A 1YUDA 2R0HA 5BPXA 1KRIA 4SLIA 1MS1A 4QPYA 4Q4V1 1UKRA 1FNZA 1DZQA 4RS5B 3BALA 4LBOA 2ZX3A 5IT6A 1TEIA 5KHHA 4HANA 3KCCA 5TSWA 3N3HA 2JG9B 4F7ZA 5CNAA 1V6JA 4I09A 1LKNA 1R081 2A5ZA 4GH4A 4AQ6A 4QQ2A 1N1SA 1NCRC 5GKAC 1WBLA 3V0BA 1NXD1 3SCGA 1WW5A 3AYEA 1UIKA 5K8SA 4GMP0 4RR3A 5C8CC 1DGRN 1XYNA 5FOJB 1EAH1 4DNYA 2EA7A 4UW5A 5BNOC 3ROUA 2GC0A 4KWKA 3ZFFB 5ABJA 4FPLA 4Z07A 4LHNA 4AI1A 3X29B 1LOCA 1KJLA 1RVF3 1BJQA 2WNUA 1R1A3 4AVVA 3IDBB 3OY8B 2ZGRA 2NMOA 2YV8A 4CDWC 3KGLA 1GV9A 3RYPA 3OGJA 4ZU7A 4JRLA 4FPFA 3MICA 2X53S 4RQPA 2R16A 3GZUC 4XXPA 4AEMA 5GZFA 4EWAA 1SEFA 3USUB 4ZKTB 2HYKA 1S1AA 5J36A 3N7KA 2XBO2 3BCWA 4I3PA 4JDMA 3VZOA 5H9RA 2YZ4A 4NR1A 3ZSMA 4IV1A 1M06G 2YDEA 2PAMA 4AFAA 3LOBA 3FJSA 3JBG3 1XNKA 4WVVA 5K0UA 1FXZA 3TWIA 1QH6A 3H1YA 1YCIA 4LBLA 5HCFA 1NLRA 4N43B 1IPJA 1RUC3 5J96B 1IKPA 4CDXC 1IHMA 5BV6A 3VUOA 3AYCA 1W0OA 3WDVA 1HXS2 1IS3A 3KB5A 5CB7A 5T50A 3ZYJB 5AFBA 3VBRB 1QF3A 4I02A 4AI0A 3USSA 4FP2A 1J3RA 3FE5A 4Z2WA 3G6JB 3ST7A 1VLNA 2ZS6B 4LBMA 4YARA 4YW1A 1QJY2 1LU2A 1LR5A 1GSLA 1H4HA 1S2BA 1H2NA 4NOTA 1RTVA 1MZEA 5JOZA 3MIHA 4CDWA 1NYWA 4N90A 4FXKB 5GLUA 3L2HA 3S30A 2CAVA 4IESA 4CZSA 2E6VA 1FOD1 2AENA 5BNPC 2PTMA 2XJUA 2ZJCA 1FV3A 2XH6A 1ENSA 4Q8LA 3J8F2 1H2MA 4K20A 4OI1A 4YNIA 3WQ1A 2JG9C 2UYBA 3CJXA 3KT1A 4K7JA 1NA1B 4FCAA 2QQPA 1JHNA 5KBFA 2F4PA 3ZDSA 4FOQA 2D3SA 3OPZA 1I1EA 4C91A 1QOSA 1SBEA 4MXWB 4Q26A 2HWF3 4AK3A 4IV3C 1D2SA 3VHRA 1RUC2 1VBA3 4AEDB 4IETA 2PHFA 4PBPA 1ND2B 3PLQA 4KG8A 4PIZA 2P34A 2VOXA 5JI7A 1GQHA 4GIQA 2Q30A 4YYOA 3AMPA 3TN92 3WP3A 4QQLA 4HK9A 4JGYB