2DF7A

Crystal structure of infectious bursal disease virus vp2 subviral particle
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
420
structure length
420
Chain Sequence
IVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQSGGVTITLFSANIDAITSLSIGGELVFHTSVHGLALDATIYLIGFDGTTVITRAVASDNGLTTGIDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSASGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERERLGIKTVWPTREYTDFREYFMEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords structural polyprotein VP2
publication title Crystal structure of infectious bursal disease virus VP2 subviral particle at 2.6A resolution: Implications in virion assembly and immunogenicity.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Virus like particle
total genus 99
structure length 420
sequence length 420
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01766 Birna_VP2 Birnavirus VP2 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2df7A01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 2df7A02
1ZBE1 1NG0A 2R071 4FTBA 2XPJA 2R043 4N43A 4PDWB 2MEV3 2PLV1 4RHV1 2BBVA 5ABJB 4QPIA 4Q4V1 4IV3C 4GH4C 1RUJ1 1VBA3 4N53A 4WM8A 2WZR2 3VDDA 4YVWA 5CFDB 5JZGA 2RMU3 1NCQC 1AR83 1PO21 4CEWA 2RM23 5FMOL 1RMU2 2R061 1AL23 2WFF3 4YVSA 2RS12 3TN93 3J8F1 1VBE2 4IV3B 3VBOB 1Z7S3 4AEDA 4RFT0 2WS92 3VBFA 2RR12 5ABJA 4RQPA 5DDJ1 4FTSA 1VBD1 4QPGC 1R092 1NCQB 1HXS3 1QQP1 1AYN1 3JD72 4CDWC 5ACA3 2HWF1 5CFDA 2R042 1AR73 1NA1A 1NOVA 4GH4A 4EJRA 2HWC1 1RUG1 1RUC3 2ZAHA 3ZFFB 1EV11 1RVF2 4CDWB 5BNPC 2RMU2 1FPN3 1AR82 1FMD1 2RM22 1C8M3 3JB4C 1MQTC 2WFF2 5C4WC 4GMP1 5BNNB 2RS33 1FOD3 5GKAC 2BPA2 2XBO3 1ASJ3 1RUI3 4CEYC 1Z7S2 1RUE1 5CFCC 1RUF2 1PGL2 3VBHC 3VBUC 1V9U1 5LK7B 5C8CC 1VBB3 5BNOC 1A6CA 4QPGA 1HXS2 5ACA2 2BFUL 4CDWA 1MQTB 1COV1 4CDXC 1ZBA1 3VBSA 1NY72 1BBT1 1E57A 1PO13 2QQPA 4CEYB 4Q4X2 1AR72 5CFCB 1AL0G 1PIV2 5C8CB 5A33B 1HRV2 1R1A3 1BEV1 5D8AC 2RS53 1EAH1 5BNPA 1TMF3 4Q4Y1 1FPN2 1RUD2 5AC93 1C8M2 1ZBE3 2R073 2RS32 5C4WA 1FOD2 3VBRB 1M06G 2XBO2 1ASJ2 1RUI2 1HRI1 2PLV3 4RHV3 4CEYA 2WWSA 5CFCA 4Q4V3 3VBHA 3VBUA 2X5IC 5D8AB 5BNOA 3JBG1 3DPRC 5L7OB 4CDXA 2HWE2 4IV1C 3VBOC 1PO12 1QJY1 1RMU1 1BMV1 1DDLA 1B35C 1GFF2 1K5MC 2R063 5FMOS 1W39A 3CJIC 3J8F3 4NWVA 2GSYA 1CD3G 1QJU2 1ND2B 1QJX1 2X5IB 1POV1 3ZFEC 1MEC1 1H8TA 1POV0 1R081 5DDJ3 3DPRB 4JGYB 2RS52 1SMVA 5D8AA 1TMF2 1R091 4RR3B 1QQP3 4PDWA 1AYN3 4IV1B 1PGW2 5AC92 2HWF3 1B35B 1K5MB 1ZBE2 3CJIB 3LOBA 2PLV2 4RHV2 3ZFFC 3ZFEB 4GB31 4Q4V2 1ND3B 4BCUA 2X5IA 2HWC3 1RUG3 1TME1 2MEV2 3HAGA 1RVF1 4SBVA 5BNNC 3DPRA 2RMU1 4IV3A 1VBA2 2HWB3 3VBOA 1K5MA 3J8F2 1RUE3 1RUF1 1NCRC 1RUH1 1NCQA 3M8LA 4CDQB 2TBVA 1PVC1 3ZFEA 5DDJ2 1AL22 1V9U3 3FBMA 1D4M3 3TN92 4Y4YA 4GMP0 2GH8A 1QQP2 1AYN2 2HWF2 4Q4W1 1COV3 2BFUS 1NY71 1ZBA3 1AR91 4RS5C 4Q4X1 1F2NA 1AR71 1X33A 1NCRB 1PIV1 3ZFFA 1AYM3 4WM7C 1VBC1 2FZ1A 2HWC2 1HRV1 2HWD1 1AR61 1OOPB 1BEV3 1X36A 1EAH3 5BNNA 3VBRC 1FPN1 1RUD1 4Q4Y3 3S6PA 2HWB2 4RS5B 1F8VA 1RUC2 2XBO1 1RUI1 1HQNA 1CJDA 1HRI3 1RHI3 4WM7B 1RUE2 1NCRA 5L7OC 1VRH1 1D4M2 1MQTA 4JGZC 3VDDC 5CFDC 3JBG3 5JZGC 2FZ2A 5J98B 1COV2 1ZBA2 4N43B 2HWE1 1ND2C 1RUJ3 1QJY3 3ZFGC 1VBB2 4YVSC 2WZR1 5C8CA 4RS5A 4QPIB 5A33A 4JGYC 1AYM2 1QJU1 3ZXAC 1QJX3 4WM7A 4JGZB 1POV3 1PO23 4RQPC 4RR3C 3VDDB 1MEC3 4FTEA 4YVWB 1R083 5JZGB 2RS11 1EAH2 5A32B 1VBE1 3VBRA 1AUYA 1PGW1 3ZFGB 2WS91 4YVSB 2RR11 1VB4A 1ND3C 1R1A2 1VBD3 1NA1C 4AEDB 1HRI2 1RHI2 3VBFB 4RQPB 3JD71 4NWWA 4GB33 5L7OA 2R072 2R041 3NAPC 4JGZA 3JBG2 1TME3 2MEV1 1RVF3 2DF7A 1QJZA 3JB8A 5A32A 1OPOA 2WLPA 1VBA1 1RUJ2 1QJY2 1ND2A 5C9AC 1BMV2 1NA1B 3ZFGA 4CDQC 1EV13 4GH4B 4JGYA 1QJX2 1AR81 1RUF3 1RUH3 1PO22 1FMD3 2RM21 3NAPB 1MEC2 4RR3A 1PVC3 4IV1A 1AL21 1R082 2R062 2WFF1 1HX6A 2ZTNA 4LLFA 1B35A 4GMP3 3TN91 3CJIA 1C8NA 1Z7S1 4FSJA 5C9AB 1PGL1 3VBSC 4Q4W3 1OHFA 1ND3A 1AR93 1VBD2 4Q4X3 1HXS1 1PIV3 1OOPC 4GB32 5ACA1 5FOJB 1VBC3 4QPGB 1HRV3 1TME2 3NAPA 1BBT3 2HWD3 1AR63 3VBSB 1RUD3 2HWB1 4CDUC 5C9AA 2IZWA 1RUC1 1RUG2 4CDQA 5K0UC 1EV12 1RUH2 1FMD2 1C8M1 1VRH3 1PVC2 2ZZQA 2VQ0A 1WCDJ 1D4M1 5BNPB 2RS31 4Z92B 1FOD1 4N43C 3IDEA 1ASJ1 2Y26A 4QPIC 4CDUB 5C4WB 4Q4W2 5J96B 2HWE3 4N53C 4WM8C 1AR92 5K0UB 1V9U2 1VBB1 2WZR3 4YVWC 3VBHB 1VB2A 1AYM1 1VAKA 3VBUB 1OOPA 1QJU3 4CEWC 1VBC2 2BUKA 5BNOB 1RB8G 1H8TC 1PO11 1IHMA 1BBT2 2HWD2 1RMU3 1AR62 2RS13 4PDWC 1VBE3 4CDXB 4AEDC 4N53B 4WM8B 3VBFC 2WS93 5ABJC 2RR13 4CDUA 1R1A1 1BEV2 2RS51 5K0UA 1RHI1 1TMF1 1R093 4CEWB 4Q4Y2 1H8TB 3JD73 5AC91 4Y5Z0 1VRH2
chains in the Genus database with same CATH superfamily
3POYA 3ZLIA 1REDA 3V0AB 1XYNA 3H3LA 2XPJA 2VNVA 5FWEA 2O8OA 1IPKA 2PXJA 4N43A 3JCIA 4PDWB 1G9FA 1F35A 3NNFA 5FY8A 1WCQA 4CUCA 2BBVA 5ABJB 2BVBA 2ZGKA 4Q4V1 3NJVA 4XFIA 4Q0UA 4FBFA 4N53A 4WM8A 1LECA 1VJ2A 1OD5A 4XFHA 2QKDA 3ZDSA 2HEVF 1GWKA 3DUIA 4AQ2A 2WINB 2PQQA 4IEUA 2H6CA 3U4SA 1NCQC 1LCLA 1PO21 5G04L 4GQ7A 3IPVB 3M3IA 3GBWA 2R061 5F39A 2J1EA 5LEKA 1V6JA 4DMIA 4YZ5A 3V0AA 5C3RA 5I0SA 4ZHNA 4IV3B 5BXXA 2YXSA 5C8WA 4AEDA 2ZBJA 5IFPA 1WA6X 1O3QA 4XXPA 3AKSA 2PHLA 3SCHA 2RR12 5ABJA 1JYIA 4RQPA 3RZGA 1BVP1 2W9XA 1VBD1 3DEMA 4AEKA 3KGLA 2VL4A 2E7TA 2XJQA 4MHRA 4HONA 3S5QA 3VB9A 5FUIA 3KLSA 1UAIA 1ZREA 2JEMA 3WV6A 1NA1A 1TNFA 4LOSA 4PLOA 5JAXA 4UBHA 1UZWA 2JDYA 1BXHA 1XRUA 4GH4A 1JS9A 1HN0A 2G19A 2PHXA 1VAMA 1IPSA 1CAUB 1XNAA 3VD3A 1RUG1 4C91A 4DO0A 3KT7A 3S57A 5D21A 3NV3A 4CDWB 5FUPA 4H55A 3VHOA 4OHXA 1LGBA 4HXCA 5DZFA 1AR82 2A1XA 1FMD1 5JI7A 1LOEA 2RM22 3C7HA 3D0JA 3EO6A 3ZIWA 5F7UA 3UGHA 3ACGA 1MQTC 3ASIA 2WFF2 4YW1A 4GMP1 5GZCA 1QOOA 1MS9A 1AJKA 1E5HA 4Y20A 3THCA 3I3MA 2XBO3 4ZZ8A 1ASJ3 2BV4A 5FYUA 4GKYA 2W1QA 4CEYC 4E4ZA 4UWDA 3KCCA 3L9JT 1SCRA 5KHHA 4OHYA 4CCCA 3APBA 3VBHC 5I8YA 1IQAA 1PGL2 2Q1ZB 2A6XA 3KCXA 3BN6A 2YGLA 2UWAA 4IXLA 1CAUA 4XUOA 2WQ4A 4BISA 4IEOA 4JTOA 1OMIA 3FFZA 2XJTA 3NWKA 4NIGA 1S0JA 2BFUL 4CDWA 1O3SA 4CDXC 4DRVA 1ZBA1 3VBSA 1DGWA 1YFXA 2VXRA 1SLTA 1BVVA 1BBT1 1GICA 2WO3A 3N7KA 2Q8OA 2BRTA 3B9CA 4JDOA 1NLSA 3WF4A 1GMMA 4X6QB 4TZDA 1OFSA 2B7YA 3W9AA 4META 3Q8BA 5CFCB 2QTWB 4DXSA 2BGPA 4RL7A 3PIJA 3SQOA 1J59A 2JICA 4MXVA 2DWRA 1X9TA 5LBFA 3VV1A 2F6BA 4F3JA 1HRV2 4LPLA 2Q1MA 5IK8A 1Q8QA 1V6NA 1GP5A 1Y9QA 2HJIA 3PHMA 1D0GA 3MLLA 4Q4Y1 5L73A 1FPN2 1RUD2 1S2BA 2R30A 3MUZ1 4PCRA 3WF1A 2D6NA 2JDUA 2R073 2W1SA 1CJPA 3WQ7A 3AK0A 4AI9A 2YMZA 5J7MA 2WN3A 4E8CA 2ERFA 2LRPA 2PLV3 3EYPA 3I2HA 2X29A 4M0HA 4RHV3 3W5MA 3Q8FA 2WWSA 1W0NA 3LPFA 4C8DA 1VAVA 3DV8A 4D0QA 2BNOA 5CFCA 3G6JB 3KWVA 2X5IC 2EIBA 1GKBA 2LROA 1OA3A 1KS5A 4UOJA 3E5UA 4IESA 1CIWA 5FDBA 4FXKB 4KG8A 1BQPA 2X10A 2EIDA 4JKMA 5DZEA 3HR9A 2VECA 2H6BA 2P1BA 1PMHX 4B29A 5AFEA 4MGZE 4MXWB 1JZ3A 1ZRCA 2HWE2 3C8XA 3N9NA 3VBOC 3JXSA 4TYSA 1RMU1 2ARCA 3ZKYA 1W05A 1GFF2 1HB4A 1UZYA 1WKYA 3CBNA 5CZKA 5FMOS 4BIOA 4C0BA 4CVUA 2EIEA 2EXHA 1U5XA 4O7XA 3NNMA 4L9BA 4OUEA 4PLNA 1PM7A 4UW6A 4AF9A 2CU5A 3MF9A 2VUAA 1ND2B 1QJX1 3CIHA 2HBTA 2ZX2A 5FZLA 5ERLA 5JIAA 4E4SA 3ZFEC 3T2TA 1F31A 4KL1A 1DQ4A 1YFWA 5DDJ3 4XF4A 3DPRB 3ZM8A 4JGYB 4A2UA 5FXXA 1ULCA 2ZGOA 4PF1A 2GN7A 3OBAA 1W06A 3AZYA 4FAGA 3T2OA 3C7EA 1AYN3 1Y4WA 4IV1B 4BB3A 2ZX0A 4QB1A 2ZEZA 3VKMA 2FDIA 1FYUA 3P3PA 4UFKA 1JZ2A 2VW1A 2HLEA 2RHPA 3Q8EA 4XF3A 5IJRA 1OT5A 5E8AA 3NV1A 4MG2A 3I7DA 4Z07A 5DUUA 3ZPYA 4LKFA 3KQRA 3PTRB 5EV7A 3VN4A 5IW0A 1QH7A 4Q4V2 3A0KA 4XQDA 1Q8OA 2Y8KA 4QB2A 4Q0VA 3O7OA 2FDFA 2F4LA 3ME2A 3U0ZA 4QX8A 1AX0A 3R4DB 5K7PA 1SBDA 4LBMA 2TUNA 4MYEA 1TME1 1JXNA 4QU1A 3TNQA 3DN7A 2XWJB 4OFGA 2PHUA 3AX4A 3ZYRA 1RVF1 5I0DA 1EP0A 5BNNC 3DPRA 4MOAA 5DXDA 2WNVB 4XDPA 5K9YA 5LA0A 3W20A 1PK6C 1S0FA 1TQ5A 2BGOA 3O1VA 1YIFA 1IGOA 2VOTA 3T0DA 3CU7A 4PI2A 1K3IA 2Z4FA 3GCXA 1DQ5A 3IZOA 5FZOB 1O3RA 2YBSA 1FATA 1IPJA 4BQ3A 1UOGA 1V00A 3ZXKA 4Z82A 1RUF1 1NCRC 4BJ0A 5F3CA 3RRDA 1W6MA 2DCZA 3FUOA 4D6RA 2TBVA 1VPHA 4XZUG 1V9U3 2JG8A 3FBMA 3N7JA 1D4M3 1YNAA 2YBKA 4Y4YA 4L11A 4HSJA 2KM2A 1QOSA 2XJVA 3MIGA 2ZX1A 2XUEA 3QH6A 5L19A 5FZGA 3LD8A 4EE2A 5IVBA 3MW2A 4XTMA 3B7MA 4CCJA 1NY71 2J7MA 1F5JA 3UKVA 4LA3A 1J84A 4LO8A 3O1MA 2CGOA 3E5XA 1LEMA 1AR71 5FP4A 5GLZA 4YNIA 5KC5A 1UPSA 4PJYA 3AC0A 1AYM3 2O1QA 2GC1A 3NNJA 2FZ1A 5T5LA 3EJKA 3WNLA 2VTFA 2CGPA 4D94A 4W6YA 4B8EA 1IS4A 3LOIA 3N3HA 3LCPA 2V09A 1WWYA 1EAH3 2YROA 3BALA 3POGA 3ITQA 5LATA 3S6PA 2J1RA 5BY5A 2HWB2 4H7MA 2R0FA 1F8VA 1RITA 1HJGA 1XE7A 3OSDA 5FZ9A 3TAYA 1C4RA 3JU9A 1HQNA 1HB2A 3QACA 1K45A 1OI6A 3I59A 1C1LA 5CB7A 3WQ0A 2XDVA 5FZ6A 2JECA 2YV8A 2JE7A 3ZOIA 4U2AA 1VRH1 1Y9MA 4E27A 4Z2AA 3WW2A 1MVEA 1JOBA 2PHDA 4K1YA 2YZ4A 4JGZC 2J1UA 4QGLA 3SHRA 2Y6KA 5JOYA 1IQDC 2ZHKA 4BH9A 4QU2A 1WCUA 4NMIA 1GOHA 4OHWA 1DLLA 4FFIA 4BE3A 1ZBA2 1OA4A 1QJY3 1XBFA 1VBB2 3ZFGC 5DAXA 3SKVA 5C8CA 3WG4A 3BUCA 3N9QA 2VZOA 3WQ1A 3LFMA 3I4IA 3NJYA 2G9GA 3ZXAC 1GLHA 4NIAA 5FLHA 2ATFA 1ZZ6A 3NNLA 4EZ4A 4C90A 1JU3A 1C1FA 1D7PM 1PO23 4RQPC 4RR3C 3VDDB 1N1SA 1US3A 2VM9A 3CJXA 4YVWB 2IXHA 5JZGB 1LU1A 2RS11 3AP7A 1NYWA 5FZ3A 2XONA 5BNQA 2CY6A 4QXKA 1VBE1 3OPZA 3VBRA 5FPUA 4IEWA 3O0WA 1WCSA 3MLKA 5DG1A 1XYPA 2WS91 4YVSB 5FZ8A 1LB2A 3J7LA 2QDNA 2R49A 1GZCA 1ND3C 2VZRA 1Q3EA 4LXLA 4Q29A 4UXAA 1QY4A 4XFCA 3PLQA 5AVAA 5FXVA 1KJRA 2ETEA 3BTXA 1VBD3 1NA1C 2ZOEB 4QKFA 3ENRA 1UO9A 4CP9A 3SNMA 4FI9A 3NMBA 1NZCA 2BWAA 3RYKA 1RIRA 2AENA 1X50A 3GALA 4IEVA 1YRZA 4NWWA 4Z8BA 3WNPA 5L7OA 1Q8PA 3KGZA 4K1ZA 1OLQA 1WW5A 1YYNA 2Z69A 1KD7A 4AQSA 1XNDA 4WVVA 2JX9A 4D6QA 2E9QA 1QJZA 5L9BA 5KC6A 4JDMA 4URTA 4LUMA 3WUDA 1RUJ2 2QQKA 2EXJA 3LKJA 4XABA 4YPJA 3H0OA 3RFRA 3UYJA 4AZZA 2DVDA 4LBLA 4HKLA 5CVRA 2W46A 2ZHMA 2Y6LA 1IKPA 5EJZB 4URAA 2PHRA 2XMLA 2QUOA 1QJX2 1WBLA 4C1WA 3HPNA 1FMD3 4ISRA 5GLTA 3MW3A 2GAUA 2W3JA 3DXTA 3SEPA 3WD5A 2JENA 3PNAA 1S0CA 4LLFA 4GMP3 2C9KA 4UF0B 4UFJA 1X9PA 4W6WA 4AAXA 1DYPA 3AYDA 3CJIA 2W68A 3O5SA 5E1RA 4XILA 5FK8A 2W1WA 1KFXL 2B46X 2ET1A 3WVJA 4FSJA 5C9AB 1GNHA 1W6NB 3VBSC 1CZSA 2ET7A 5LBCA 2R1BA 2QQLA 4R9BA 3MPPG 4BQWA 4HOOA 4YGEA 4S2GA 5FZ7A 1I5ZA 4UW5A 1U5IA 1C3HA 5JR7B 3ZSEA 1W8OA 1SBEA 1A8MA 3AM2A 1ZZBA 4IE7A 4KGQA 5CEHA 3LPGA 2GC2A 4NHMA 4LOTA 2GDFA 2YUEA 2W52A 1TME2 4UT5A 1BBT3 3K51A 5FP3A 5BPXA 2WABA 5C6CA 1CAWA 2AEZA 5A3NA 3AYAA 4J1WA 4R8HA 2HEYF 4OLLA 1TVGA 1W6PB 1W99A 2LM3A 4OZXA 4UF0A 2IFRA 4C1XA 4LKDA 5AFBA 1OLMA 1PZ7A 5F5IA 1OLRA 5F5QA 5C9AA 2IC1A 5FPBA 2XLFA 3PU3A 5A3TA 4YLZA 2DURA 3HBZA 1QIQA 3FC0A 4D69A 5IAVA 2BBAA 4YW6A 3AZXA 4V2VA 1J3PA 1UCXA 5FZKA 2CDOA 2VXJA 2ZZQA 2B9VA 4CA9A 2R0HA 4FPEA 1WCDJ 2WWJA 2V5DA 3DYMA 4IGQA 4A45A 4E8DA 2VC9A 3LGRA 3OD4A 5IHRA 5JPNB 1CZVA 1FNZA 1ASJ1 4Y1XA 1S0IA 1KFUL 1OQEA 3C3VA 4Y1YA 2W2IA 3O1TA 2V72A 4KWLA 4LK7A 2GNTA 4O65A 1W6PA 2DDUA 5EXOA 1JZ6A 4QQ2A 3HT2A 5K0UB 3KM5A 5F2WA 3I8TA 1VR3A 2VCCA 3B69A 2WZR3 4AVCA 3VDAA 3ZO0B 2XL7A 3VBHB 4KWKA 1VB2A 3IMNA 1VALA 1OOPA 1QJU3 2Z42A 2QVSB 3VL9A 4CEWC 1ULEA 3MFCA 2ZX4A 4COVA 2UWBA 3HD8B 1QDCA 1UZZA 2DBNA 1RMU3 2C4XA 1WCKA 2DCYA 2IVIB 2XJRA 3ATGA 4GULA 2AYHA 3WEZA 1GSLA 1MACA 2BOJA 2LS6A 4CDXB 4XMAA 5FJKA 5LA1A 3S5AA 4OHVA 2P6CA 3VBFC 4FO9A 3ZSLA 1LAJA 4G9SB 5GM0A 5JLVA 2A71A 5KWRA 1VE0A 1BEV2 5K0UA 5HV4A 3IBMA 2PHWA 2KXLA 4P9YA 1EYBA 5T5JA 2ORXA 1VRH2 4QM8A 2CHHA 1NG0A 2R071 3BYWA 2NMNA 2Y64A 3IKWA 4RGAA 3UGFA 1OKOA 2VBPA 5JXHA 1X82A 1SZBA 1H6XA 3C7GA 3GXUA 4ZPIA 1YQCA 3LA2A 2PLV1 4RHV1 3RJRA 3UJOA 1GBGA 1KITA 1W2TA 5H9PA 4QPIA 4AFCA 5LBEA 3ZSMA 1VBA3 5I0UA 3UETA 1LHNA 2G1MA 3PU8A 3OGJA 5L9RA 3I3QA 2CNAA 5T5PA 5FPZA 5EPAA 4MO3M 5FPLA 2QE3A 3T1LA 2V5YA 1JW6A 3WNNA 3BTYA 1GWMA 1MZ5A 3BPSA 2CL2A 3M1HA 3QH7A 3CHXA 4B1LA 2ID4A 3D0SA 4AGRA 1W8WA 2JG8C 1DBNA 4Q0PA 2RS12 3MDPA 2XQRA 3MI8A 4ARYA 1YWKA 1VBE2 3T3YA 3VBOB 2UYAA 4KU7A 3ZYFA 3OUHA 1SDDB 2WS92 5F2SA 1ZZ7A 4DFSA 4JV4A 2BGCA 1GQPA 1XNKA 2VZ1A 3GDBA 4QXCA 5FJHA 1UYZA 5DDJ1 4FTSA 4QPGC 3RG0A 3I2KA 4EN9B 4KGGA 4NROA 2MPFA 3IWZA 3AMHA 1FNYA 1HXS3 3C2UA 4ONUA 1AYN1 4FPYA 2QQMA 2YYOA 4OQ8A 3VKOA 3BI3A 3M7AA 2CYFA 3F95A 3R05A 4LTAA 3LDRA 5C3QA 1L7RA 2ILMA 4YGBA 1OFNA 4CCDA 4MLOA 1AR73 1CWPA 1YFUA 4LJHA 4I0WB 4W8JA 4DS0A 1S2KA 1JN2P 2VJXA 2ZKLA 1VP6A 2ZJCA 2RDSA 4QB6A 3KVAA 4QX0A 5CYYA 2O14A 4EJRA 3FHIB 1RUC3 2VPVA 3RPQA 5EQUA 2ES3A 1XU2A 4CCNA 1QH6A 5BNPC 2EVXA 3VGIA 3UV9A 5FV3A 1W28A 2Y33A 5CNAA 4YZ1A 4PQQA 3PTYA 5A7WB 4XUNA 1W2OA 1C8M3 2EIGA 3JB4C 2WT0A 2JDMA 2X05A 2AR6A 5DAQA 5BNNB 1FOD3 2W39A 2BPA2 5JOWA 3AZWA 4CXXA 4GXLA 1PK6B 1ZA4A 2Y6JA 4XBLA 5HCFA 3POSA 2YPJA 2ZAAA 4K9SA 4LEJA 3MV11 3VBUC 2ZMKA 2LTNA 1V9U1 3BGAA 5C8CC 4MGKE 1A6CA 3SH5A 3ILRA 2A6ZA 2FDGA 1SCSA 2EICA 3AFKA 3CKHA 4J25A 4B7KA 4WV8A 5GZEA 2EF6A 2ZGMA 3P6BA 5CG9A 1DGRA 1LULA 4JQTA 4TXWA 4ASKA 4Q4X2 4BU2A 2VVFA 1AHSA 3RZHA 2PQSA 1AL0G 1KQRA 1YQ2A 2ARAA 1PIV2 4XF0A 3SH3A 4AVVA 4W4ZA 1ZVFA 1D4VB 1JYVA 1WW6A 2VULA 3H1YA 4HVQA 3M2MA 4GZ9A 5F5CA 5A33B 5KBFA 1TG7A 2NLRA 3PVOA 2VNGA 3ETQA 1HDKA 1R1A3 4GALA 4Y4RA 5IFTA 1UMZA 2RS53 1EAH1 3H8XA 1TEIA 1Z0HA 4GA9A 4HVRA 1AXKA 2SLIA 5A3OA 4Y22B 3J26N 1A3KA 5FYBA 1ULPA 1UXXX 4KWJA 3R4SA 5AC93 5C5UA 3H42B 1WZXA 4F83A 1ZZCA 5J09A 5C4WA 3SISA 1L7LA 2FBEA 1M06G 2XBO2 1ASJ2 1QXPA 5A3MA 2I45A 1GU3A 2OKXA 1ZRFA 3HQUA 3WP3A 3U4XA 2C26A 2WQZC 1W03A 4Q1PA 3MF6A 3VZJA 1CX1A 4F8AA 4IQPA 5D8AB 2NYYA 1PX3A 1ZYBA 5BNOA 3PMEA 4AL9A 3T1MA 5HCHA 3RZJA 3D82A 5D2AA 5FYHA 5LA9A 4XE9A 3W21A 2QCSB 2OPKA 4OI0A 4YG0A 2Q8DA 3AMNA 1VMJA 5EJ3A 3R6SA 1T2XA 1KGYA 5CKMA 3WCRA 1LHWA 2VU9A 1QJY1 3AJYA 4AHZA 1BMV1 1S0GA 1Q8VA 3UESA 5FYTA 1US2A 1DZRA 3NL1A 2ZACA 3CJIC 3ES4A 1OUSA 4P9GA 4QQHA 3IN9A 3J8F3 1O4ZA 3NW4A 4ATFA 4IUGA 3VZLA 2GSYA 1CD3G 3LA3A 4K21A 5KHJA 1CONA 1Y43B 1Y3TA 3MO4A 3VZKA 3K48A 4XZPA 2K9ZA 2FCVA 2PHFA 4CUAA 4XIOA 3HNBM 3KT4A 1H8TA 1POV0 4AYUA 3RZLA 4FFFA 1YQ6A 1UW8A 3AP5A 1EY2A 5D8AA 1R091 1UPIA 1QWRA 3AP9A 4GJYA 1HKDA 4BA6A 4RR3B 1QQP3 4PDWA 4HT1T 2E31A 4COZA 4TN7A 4E2QA 3ZR6A 4NRQA 2HWF3 1B35B 1K5MB 4YYOA 3N9LA 5A7SA 3MBWA 3O1OA 2D6KA 4UW3A 4ZU7A 1HIXA 5BYNA 2JD4A 2PLV2 4RHV2 5LB6A 5T3NA 2ZGPA 1DGLA 3GYDA 3ZFFC 3ACLA 1NT0A 5F1RA 1ND3B 4HETA 1XE8A 4AWDA 1DHKB 5A6QA 3HQXA 2HWC3 3GF6A 4PLMA 4JZRA 4FAHA 1D0HA 1MZ6A 1OC1A 2UWCA 4XCBA 3SXWA 3IPVA 2ZMLA 2MEV2 4AEJA 1FV2A 3OY8B 3WDTA 4AHWA 5DUVA 2RMU1 2Z79A 5DMYA 4ZONA 3WW4A 4Q0QA 5HBAA 1JOJA 5A3LA 3ZYGA 3RNSA 4IV3A 2RV9A 3I54A 5JOZA 4B3NA 1PGSA 4W50A 1K5MA 1UYPA 2OXBA 3LAGA 5EP9A 2C24A 4AVBA 1J58A 4D7TA 3WHUA 4A3XA 1JZ4A 5C3SA 2BVVA 2IXIA 3ZXGA 2CDPA 3M8LA 3I97A 4COUA 3TRSB 4DNYA 2ADDA 3ALQA 4GIQA 4LO4B 3N9OA 1AL22 4FOVA 1S1AA 4M3CE 5DDJ2 4R9DA 2YHJA 3TN92 5FWJA 2ZA9A 2GH8A 3WDVA 1AYN2 2Z2SB 1UD1A 2D3RA 3OY8A 4P00B 3T0BA 4M3CF 2BFUS 4R52A 3ZYHA 4BLIA 2QQUA 3A4UA 3ZYIB 1UU6A 3FLPA 3PUIA 2HKXA 2RVAA 3POIA 4LBQD 3USUB 4O9GA 1CQ9A 3ILNA 1AVBA 3OOXA 1I5PA 4L99A 3SCFA 1WW4A 1NXMA 1G7YA 4XHBA 2P3KA 4BM8A 1OBNA 4IERA 1Q8SA 4XAEA 1G9CA 3WR0A 4AVTA 4QMAA 1HW5A 2R16A 1N3QA 4HFSA 5IYYA 1AF9A 4RS5B 4B4QA 3R0RA 2FHRA 1UOJA 2WNUC 1NXD1 4X6RB 1AXZA 2VUJA 4LA2A 2W08A 3GZAA 3D5OA 1RUI1 2XB6C 3D4KA 5I91A 1HRI3 4K6BA 2HYKA 2K2SA 4WM7B 2W92A 3VHRA 1Q43A 4LORA 4X8NA 2Y6HA 1UOBA 3LEGA 4MHUA 5LASA 1R1ZA 1D4M2 1DP0A 1ZRIA 3CMGA 3OJBA 3E6CC 3IT8A 2ZGQA 2BJSA 3JBG3 2FZ2A 2GNBA 3BIEA 1PMJX 1RINA 2W91A 2D97A 3H8OA 3QLQA 2IFWA 3TEXA 1S55A 1W9SA 2D43A 3QD6A 3NVCA 4CXWA 5I93A 1DZTA 2ZEXA 5E16A 3VD9A 1QEXA 2WZR1 5I8TA 2AREA 4XOGA 2EXKA 1ONAA 2VMCA 1MZEA 4RS5A 4YFZA 5LK5A 1XSQA 2Q8EA 1SDWA 1AYM2 1QJU1 1UMIA 4WZCA 4WM7A 1N1VA 3FL7A 4AE2A 5IUQA 4UFMA 4YM0A 1MEC3 1ZNPA 5FREA 4ATEA 2VOKA 4A4AA 2DYCA 2W94A 3WDYA 3MUY1 1W0PA 3VZNA 1UMHA 1EAH2 2VQUA 1REEA 1KXGA 1LOCA 3T2PA 3UKTA 4HKWA 1HQLA 1PGW1 3HEIA 3HIFA 5HCAA 1W9WA 1RXGA 3MICA 1JYTA 2JG9B 3DCQA 2VR4A 5JMOA 2H0BA 1LKNA 4XFAA 3PJYA 3VDCA 4P5YA 4AFMA 4AVSA 3WCSA 1D2QA 4HZFA 2GP3A 3VBFB 5A1FA 3AKPA 3A7QA 5LEJA 1W2UA 2VZQA 2VZVA 5FY7A 1O8PA 2P4EA 2WUHA 3HN3A 4LLOA 5ISLA 2QBXA 2BTVC 1H6YA 4XACA 3AZVA 1O5UA 2A5ZA 4H3WA 4MXWA 3HJRA 3ZN5A 4EROA 5LRSA 5GLUA 1EPZA 3WG2A 4WVMB 3ETPA 2Q1FA 4NHKA 4DUWA 5HI0A 2E7AA 1OPOA 2OYZA 2E26A 1WLWA 2VW0A 1VBA1 3P3NA 4HANA 4L8QA 4P9IA 1ND2A 1QJY2 4XJ9A 3V0BB 1AJOA 3SH4A 4FFHA 5JMCA 3KS7A 1BMV2 4CDQC 3MFAA 2JG9A 3LF7A 1H2MA 4HG6B 5F37A 2J1AA 1K12A 4PQ9A 4WZFA 3VKFC 4JTNA 3H8RA 4JGYA 5I8SA 2IUWA 5JUVA 2LALA 2VNRA 1PO22 3NAPB 3HQRA 1Q5OA 2OQ6A 4EN0A 2VUCA 4IV1A 2R062 2XJUA 1XU1A 1HX6A 2ZGUA 4ZXKA 3Q8AA 2OX0A 1UY0A 1ZX5A 5LW9A 2VY0A 3IMMA 2C6SA 2C5DA 1C8NA 4BMEA 2WAAA 4WVMA 1E5RA 1PVXA 3NKGA 5FBZA 5FZ4A 1OHFA 2Q4SA 2VOXA 1SHWB 2PFWA 4JCKA 4GWNA 1VBD2 3EQEA 3TBDA 1M4WA 1HXS1 1PMIA 5A6XA 2PTMA 1GP6A 4YFWA 1WBFA 3MLJA 3ZYJB 4LHNA 2E33A 5FRAA 5HPOA 4QPGB 2WNVA 1V6MA 1G9DA 2D6OX 2DVAA 3K75B 1HRV3 3NAPA 3GNEA 2WC2A 2VBDA 4UBGA 3PVBB 1AR63 4W65A 5FZEA 4ARXA 4E4DX 4QXBA 3CZUA 4DOUA 3I3DA 4RGKA 1NQDA 2Q8CA 4DUVA 5E88A 4DQAA 1RL3A 1BK0A 1RUD3 1GV9A 3VZOA 2OUHA 2VG9A 5FZOA 4BQYA 2NMOA 2OS2A 4DINB 2IZWA 1RUC1 1RUG2 2IXKA 4W6XA 3ILFA 3IAQA 4P02B 2F4PA 3N9PA 4E2GA 5B2GB 5IT6A 2WYFA 3RQ0A 1QOTA 4JAAA 3O1SA 3B94A 1HB1A 3FLTA 2OIIA 1FMD2 1ULFA 4GWJA 1C8M1 4QPWA 5H9QA 1AZDA 2LUWA 2UY8A 2F17A 5KHGA 4M00A 5BNPB 4NAOA 4JVAA 1NZIA 1FOD1 1LNSA 4N43C 1VRBA 2FCUA 4FQZA 1OA2A 5FZCA 4Z92B 1DGWX 4H2AA 2Y26A 5J36A 5G05L 1V6KA 4LR4A 4CDUB 5GJ6A 2WO2A 3JQXA 4K8RB 2HWE3 1KS4A 2VVDA 4N53C 4WM8C 5FAXA 5EYYA 3U10A 1WW7A 5FK7A 1ODMA 2JB4A 3AXDA 1UQXA 4O61A 5FYMA 3N9MA 1RGSA 1FT9A 1REFA 2VZUA 5T5OA 3VBUB 3Q9OA 4OUSA 1RB8G 2RJ2A 1H8TC 1UNBA 1CAXB 4LO7A 5GLVA 1BBT2 1UU4A 3WUCA 1XYOA 3I2JA 4JRLA 4QX3A 4PDWC 5FZ0A 3U14A 3OBTA 2E32A 2ZPXA 3EB7A 1PNGA 4AEDC 4CCOA 4WBBA 1V70A 2XOMA 5ABJC 5C71A 5FYZA 3USSA 1QMJA 3C7FA 4XUTA 4CDUA 5IK4A 3HOBA 1IG3A 1XNTA 2GH2A 1GQGA 1R1A1 4BWOA 5CAZA 2RG4A 2RS51 5JSRA 1RHI1 4UFLA 1LGNA 1R093 5JR2A 3KD4A 5FLJA 4Q4Y2 4ET7A 1LR5A 4LE4A 3JD73 4YG3A 2SBAA 4BQ2A 5AC91 4AW7A 3FMGA 2C0ZA 1T6BX 2EA7A 4M3CB 5FY9A 4AI8A 4PIZA 2R043 5BUVA 2V4AA 2CAUA 2QZ3A 4LNVA 1C5HA 1ULOA 3S7EA 1H1IA 4HL0A 1IS3A 4D7YA 4NN0A 4RA0A 3O1RA 1SPPB 3MYXA 3PIGA 4IV3C 4GH4C 4XJUA 1J1LA 3UL2A 4N7UA 2WNEA 1W9TA 1LODA 1Z78A 3RI8A 2WZR2 4JKLA 1NX9A 3DF0A 2OPWA 1JZ8A 3VDDA 1CR7A 2A70A 2WDBA 1SLCA 2P3YA 3WXPA 3NJXA 4YVWA 5CFDB 5JZGA 3VZMA 1J1TA 4LBJA 2RMU3 5GZGA 2GC0A 1SFYA 2Y6GA 4UW4A 1WGPA 1W8FA 3N36A 1URXA 3NQHA 4FVVA 1ACCA 1RMU2 4JC1A 3B3QE 4NOTA 4YVSA 3WZ1A 1QHDA 3GBGA 3LEKA 4M3CA 1ENQA 4LHLA 3ACHA 3J8F1 1B09A 4HK9A 1PNFA 5F3GA 1UXZA 5H9RA 2FQPA 2RDNA 2UU8A 1Z7S3 1O6UA 2IWGB 2VMFA 3HNMA 3KV9A 2WZEA 5DZGA 4YWAA 4AI1A 4MGTA 1PZ8A 4NR1A 4XJZA 1SPPA 3GZTB 2EXIA 4BXFA 3MV01 4TTGA 4FPHA 4XHXA 3T2QA 1O3TA 4Y5TA 1NCQB 2P5BA 3WP4A 5FY4A 4CYDA 1QQP1 5HV0A 1H4GA 2RDRA 4CDWC 2JWPA 5ACA3 4LIVA 2VNOA 2HWF1 5CFDA 3T4VA 4BOWA 4YGDA 2W1UA 4QGNA 2XLAA 3NKTA 4BYYA 4E4HA 4XQ4A 3H9AA 3W59A 1MR5A 1C5IA 1NOVA 4QKBA 2BNMA 3AP6A 1DCSA 3WNOA 2J22A 2Q5TA 3MZHA 1JUIA 2HWC1 5KXEA 3ZFFB 1UOFA 1EV11 3LDBA 1QKQA 1RVF2 4PHZA 2X09A 4IEZA 5JCTA 2DVGA 5FY0A 4BHPA 5CBLA 3A23A 3AKTA 2QQNA 2ZXQA 4I02A 3SCGA 3THPA 5T54A 2BQPA 5FQ0B 1W6NA 4XETA 1U12A 2RS33 4I3PA 4YZ3A 1BHGA 1ENRA 2CGNA 2ENRA 3TOJA 1RUI3 2WYSA 2IXJA 5JOXA 5CFCC 1RUF2 5FZFA 4UFHA 2WL1A 4OI2A 1QNWA 3KV4A 4M4RA 4L92A 4N90A 4OMCA 1ALYA 1VBB3 1F4HA 5A7NA 4Z2WA 4BPZA 4AOCA 2RE9A 1HXS2 2ADEA 1DQ2A 3NJZA 3RZMA 5FUNA 4WVWA 4AHYA 1UYYA 4CU8A 3WNMA 5FO8B 1MQTB 1GWLA 4YW4A 1RYYA 4NPRA 4KH9A 4GJZA 1NY72 2D5HA 3V56A 2LW8A 4MGQA 1PO13 1DU3D 2JKXA 4ZY9A 3KCYA 2W5FA 1UY4A 5I0TA 1MZFA 4A6OA 1FX5A 4CEYB 1S0DA 1AR72 1X7NA 2DVBA 2QQPA 3OEAA 4Q8LA 1SLBA 3F2ZA 2XHNA 2P17A 3NRUA 4MX3A 1IG0A 1U5ZA 4HLTA 3JZVA 2VO5A 1H2LA 2DTYA 2YBPA 2E53A 2YC4A 1YQ5A 1UKGA 1WMDA 1U5YA 4AEMA 1OQDA 3VD4A 3M4FA 2VGDA 1JH5A 4BLJA 1TMF3 2A6WA 4LBOA 4ZU4A 5FKBA 3I2IA 2BWCA 2DVFA 2HYXA 3J7NA 1LGCA 2OQ7A 5KXDA 4PBPA 4A7YA 1C8M2 1ZBE3 2QJVA 2KA3A 4XAAA 3P5BA 2B9UA 1FOD2 2BP6A 2ZX3A 4P5HA 4FQ4A 1CPNA 5FFOC 2WT2A 2OT7A 2HH9A 1HRI1 4Y1VA 3CO2A 2VD7A 4CEYA 3W5NA 1OF3A 2KR2A 3IIAA 4IE4A 2WNUB 1FAYA 1W6QB 2WWUA 3VBHA 3KQ4B 2NN8A 4OCTA 3FJSA 1GZWB 3V64A 5C3OA 1T6GC 3DGTA 1GUIA 2GNMA 2K0GA 3BU7A 3JBG1 4QQLA 1NAEA 2Y0OA 1KJLA 3DPRC 4Y33A 3BTZA 3GM8A 1YIPA 4PBOA 4LHKA 1UU5A 3V65A 2VZ3A 3T09A 2VCMA 4AI3A 4CDXA 4P9JA 4CCMA 4IV1C 5IK5A 4CUBA 3ACFA 3I3BA 2UURA 3AVRA 1IS5A 3RMXA 4BQXA 1W39A 4XUPA 4CRQA 1SEFA 4XTPA 3SEEA 3WINE 4NWVA 4O9EA 2GMMA 4YM1A 5KR7A 4Y26A 2X5IB 3NV4A 4JDNA 4XYXA 4XPVA 3DECA 3ES1A 1Y9GA 3DL3A 3LFIA 4S2HA 4A42A 1MEC1 5C7GA 2QQVA 3QOPA 1JBCA 2V73A 2QQJA 2XQXA 2RS52 1SMVA 3NNGA 1GZWA 3LEMA 2WBKA 2X53S 1OUXA 2Z5WA 5T50A 5AC92 1W3XA 3L2YA 5IATA 2WNVC 2BOIA 4A3ZA 3RS6A 4QKNA 3ZPOA 5TSWA 4AG4A 5CU1A 1STMA 2UY9A 3NSTA 4N8MA 1CZTA 1G9BA 3ZFEB 4JHZA 2ORZA 4QHZA 5HXVA 3AYCA 3RGBA 4BCUA 5CG8A 2FDHA 1CPMA 1H4HA 5FIXA 1QF3A 1DG6A 1YI7A 2J1SA 2X5IA 1O7FA 3GBFA 3U11A 3ZYPA 1JYCA 3HAGA 2W47A 4RN5A 3VKLA 2RDQA 2ZGTA 3FHAA 1KDMA 2EALA 3MEPA 4LKEA 2ARXA 2J1TA 4DRRA 1W6OB 3JUUA 2J1VA 1H0BA 2VMIA 4Y3OA 3VBOA 2VCBA 4I30A 2N7GA 1BYHA 5FZBA 3J8F2 1YXWA 3AB0A 3EXUA 4TWTA 4EV0A 5T55A 3J4UH 1RUE3 2AACA 1POQA 3ZXEA 4CDQB 3WSOA 3ZFEA 1UWWA 3J7MA 1MS5A 4DEVA 3OBRA 1UX6A 1WLDA 2VMEA 3WW1A 4XFBA 1S2EA 2PMWB 4FFGA 4FOYA 1QQP2 5EJ1B 2J42A 3URFA 2XWBB 3RSJA 3U37A 2HWF2 3PUHA 4XMIA 1COV3 1Y7BA 3GZEA 1W90A 3WNKA 1XSRA 3LE0A 1H30A 1W6OA 4CTEA 5FZHA 1F2NA 1WLCA 3TEYA 4L0PA 4XXAA 2FD8A 1NCRB 1QXRA 4BXSV 1LHOA 4H14A 3VDBA 3LSDA 2R7EB 2VQAA 2JDZA 2HWC2 1LU2A 5GZDA 4QX2A 1HRV1 1UIKA 4TLGA 5A7WA 4QX1A 1JYNA 3W58A 2PAEA 1AR61 2OA2A 2VZSA 1BEV3 4G4FA 2A7AA 2CV6A 4NJ4A 5F32A 3ZDVA 4N7IA 5BNNA 4XC9A 3VBRC 5DQ0A 2GMPA 1FPN1 1CN1A 1JODA 1RUD1 1W3VA 4CU7A 5CADA 4Q26A 2GN3A 1PK6A 2DCJA 5F9TA 5JXJA 5C3PA 2WA3A 4J1XA 4QM9A 1RJ7A 2AEYA 3HBKA 2XGXA 2BNNA 2ZEWA 2NP0A 4QHBA 4LK6A 3U1XA 4CDQA 1AX1A 5CKQA 1RHI3 4AGGA 4A41A 4AGVA 3QCWA 3UK9A 4IGOA 2WIIB 4CUGA 3H7JA 1NCRA 1XOYA 5FPVA 5L7OC 1MS8A 3BCWA 4R9CA 3ZX7A 2BZDA 2JDKA 3VDDC 4V1PA 1SG3A 2A75A 2WO7A 4RFRB 2XVLA 4AR2A 1LOAA 5JZGC 4MH0E 1O91A 1O4TA 1SLIA 4XURA 1LEDA 5FYYA 4CEWA 1C57A 1IOAA 2JD9A 3IDCB 5IVYA 3OUIA 2IVJA 4N43B 1GOGA 2HWE1 1W8UA 2BDRA 4TLFA 3WX5A 2IXLA 4YVSC 4CP1A 3B9IA 3B00A 5JDBA 2ARBA 5A33A 3OYWB 4UI9L 2DFBA 5FKCA 3D3AA 4COWA 2W0XA 1SLLA 4MSVA 1BZWA 1DIWA 4LITA 1H9WA 1NE4A 1YHFA 2XKPA 3KHBA 3KV5A 2VE1A 4FPJA 1POV3 4HBNA 2JDPA 4JGZB 4NVPA 3JQWA 1XE0A 1GNYA 4QQOA 4Y22A 5FYCA 4FTEA 2YDEA 3AMMA 3R4UA 1R083 4I0AA 1O4YA 2WAOA 3AMPA 5DAPA 4S2FA 3TB0A 5A32B 5JXIA 3NV2A 3O14A 3WF2A 2G9FA 1AXYA 1AUYA 4YG6A 4ZS2A 2HBUA 3HNYM 3ZFGB 4CP0A 1V0AA 1VB4A 2D5FA 2YY1A 2ZHLA 3HVDA 1A34A 1DQ6A 2AH2A 5SV8A 5IVCA 4AEDB 4D7SA 1HQWA 1HRI2 2XJSA 3S30A 3N7LA 3MIDA 4RQPB 3JD71 2MHFA 3OYWA 3MIHA 1WMFA 2A6VA 4GB33 1ZRRA 2R072 2XHKA 4QPYA 5JSPA 2R041 3K4ZA 3WP6A 4ZKTB 1O59A 4JGZA 4YW3A 3JBG2 3U75A 5IVFA 4A44A 1CVNA 2DF7A 2A3XA 3JB8A 2WZ8A 2A73B 3POBA 4P9WA 5A32A 5J48A 3C7OA 3BPZA 2DBIA 2WLPA 3WG1A 4IW3A 1XNCA 3U07A 4AFAA 5C9AC 4QDSA 1NA1B 2P3JA 3ZFGA 3ZXJA 2YC0A 3CZJA 5JXGA 1ZA7A 5KHIA 4OQ9A 1EV13 2XKOA 2YGMA 4GH4B 2OUJA 2GU9A 4E9KA 5IVJA 4MUVA 2GNDA 3OEBA 1RUH3 2XJPA 3KT1A 4QT6A 2A3YA 1MEC2 4RR3A 2CWSA 1PVC3 2ZTNA 4I0BA 5DABA 1B35A 4OUMA 3BVCA 4YZ4A 5EZWA 4EYUA 4MV2A 1V6LA 2VQTA 2Y0IA 3LDKA 3T0AA 3VUOA 1Z7S1 4PIXA 4A6SA 2ZMNA 4Q4W3 2DUQA 4Y20B 1ND3A 1AR93 2ZGSA 5E6HA 1H1MA 2WO1A 1MS4A 4G3YC 4Q4X3 2OVUA 1JOPA 2V4VA 3MGUA 1XB9A 4NE9A 4XCAA 2VMHA 1PIV3 4HKOA 4DXZA 1OOPC 5ACA1 3O1PA 4FCAA 2NQYA 5EIYB 5FOJB 1VBC3 5FLIA 1N47A 1D2SA 1VIWB 3PUAA 2HWD3 3IB3A 4QAWA 4ES9A 3INAA 1CGPA 4UYBA 4QQPA 3VBSB 4YZ2A 1W8NA 1XXNA 4R4XA 4B1MA 2HWB1 5HCBA 1W0OA 2P6HA 3M3OA 3I49A 1IKQA 2B39A 4NUBA 5IWFA 1DLCA 2YG0A 1GZ9A 3MPBA 2WFPA 5K0UC 1I3HA 3KB5A 3KV6A 4I01A 1UZ0A 2EAKA 4F7ZA 1PM4A 2JKBA 2E63A 3AKQA 2FMDA 5FZ1A 4COYA 4YM3A 3AFGA 3EBRA 2G4IA 5L36A 2RS31 3A21A 5C33A 3RZKA 3IDEA 4M01A 2RJKA 5BV6A 5I0RA 4ASMB 2G9ZA 4NHXA 3FZ3A 4QPIC 5FZAA 4AVAA 3MHZA 5J96B 3USUA 4K7JA 3K77A 2FDJA 1ST8A 1V9U2 1VBB1 2E6VA 3I2OA 1OH4A 2QDRA 2WT1A 3LSEA 1YEWA 1YFYA 4OI4A 1W9YA 2VW2A 2K46A 5T52A 4AQ6A 4HVOA 4CPBA 4DXRA 4FP2A 1S0BA 4HN0A 2NZ9A 3BOPA 5F6KA 1LOFA 3VD5A 4NRMA 4YSFA 5L9VA 1PO11 4C0HA 1DQ1A 1KDKA 4JKKA 2Y34A 4PT6A 1JUHA 4Q1RA 1G6NA 1AR62 1BLZA 2WA4A 3S7IA 3K46A 1WMEA 1RXFA 4LBKA 1OQ1A 4EZHA 1FI2A 3H7YA 1R64A 1OLME 3AKRA 3I2GA 4XF9A 3RZZA 4IETA 4K20A 2D93A 2XLGA 2RR13 4IEXA 4P9LA 4D6SA 1KRIA 4FP3A 1LENA 2GP5A 1DFQA 2R1DA 4QWNA 1DGRN 1UF2C 2JIJA 1A78A 1TMF1 1LJ7A 2P3IA 4XEZA 2TNFA 5A80A 4CEWB 4QD2A 4BK5A 2FDKA 1I9RA 3WNXA 1PX4A 2ZZJA 1F4AA 1ZBE1 4SLIA 2YU2A 4ZS3A 3Q8CA 3ZN6B 4BQ5A 2A6YA 2VH9A 3M70A 1HN1A 5FZDA 2JDAA 2L9LA 2MEV3 4CU9A 3D8CA 3J9SA 3M3CA 4YW5A 5E89A 4QKDA 1UKRA 4DB5A 4Y24A 3GJAA 2XVKA 3A0NA 1RUJ1 2GALA 5JIUA 2VTXA 3O0XA 2VVEA 1W2NA 1YC61 1YLLA 2I2SA 1QU0A 3OPTA 3E1F1 5KHKA 3THDA 3SMHA 4BDVB 3A22A 1NQJA 1AR83 2DV9A 2OZ6A 4N9HA 5LA2A 4HK8A 2JJ6A 2RM23 2B42B 4JHTA 2D7FA 5FMOL 1AL23 2P2KA 2WFF3 1GP4A 1S0EA 1HB3A 5H9SA 3TN93 1RC6A 3ROUA 4HMZA 3ZN6A 1Q56A 1W8ZA 3OG2A 4V2WA 3AP4A 3B01A 3WF3A 3ZKUA 2A3WA 2DU1A 2WSUA 1A8DA 4RFT0 1QDOA 2PHTA 2AC1A 4FPGA 3SITA 3VBFA 5LWBA 5LY1A 2QQIA 3LEIA 3ON7A 4XJ8A 4NIHA 1OURA 2VCAA 4GAZA 4CCEA 2AUYA 4LULA 4CU6A 3ECQA 1R092 1W6MB 4JRAA 1KEXA 4OULA 1OD3A 4RSUA 3JD72 1V6IA 5J3UA 1DYOA 2JG8B 3G7DA 3RVHA 3WDWA 4MGSA 4FPOB 2R042 3RDIA 3V0BA 5A1AA 2WR9A 3OUJA 3BOWA 5CKNA 1CX4A 2YU1A 5IK7A 3N4MA 1O5LA 1DDLA 1H8VA 2XXZA 3O0VA 4QDQA 3KHCA 1GZTA 5FTTC 2PN5A 4AFBA 2DCKA 1NLRA 1YI9A 3ZSKA 4XDQA 5CIRA 5F3EA 4KQ7A 2ZAHA 5B4XA 4MGIE 4NHYA 4BK4A 3O12A 3DKWA 4XFFA 3H8UA 4CCLA 4YARA 2Y38A 2RMU2 4L97A 5FP8A 2CSGA 4MZUA 1FPN3 2D3SA 2YB7A 5ANNA 2C9AA 3ZR5A 1SFNA 3PVNA 3T30A 1WD4A 4DUXA 4EWDA 2D98A 2YPDA 4EWAA 5C4WC 5J1XA 3UT0A 3BKZA 5GKAC 1W8TA 5B4NA 1GNZA 5FZMA 2JE9A 2CWMA 1UY3A 1Z7S2 2VAUA 1NLQA 1RUE1 5A6YA 1N3PA 2GZWA 1OPMA 5A7PA 4DZGA 3GHNA 4A7ZA 1SACA 5GLWA 3KZ4C 5LK7B 3HWJA 3I59B 2CTVA 1APNA 5DG2A 1LOBA 5FO7B 5BNOC 4QPGA 3RYPA 1EUTA 2ZGLA 3M3QA 4KG0A 2PAMA 3FHQA 5ACA2 1JU4A 5FP9A 3H3UA 2D40A 3H3ZA 4NHLA 1COV1 4FPFA 1EUUA 1E57A 1S4CA 4XIKA 5DPNA 4B4RA 3BTAA 1GR3A 4JX0A 1OF4A 1H2KA 1CESA 4D8MA 3SC7X 3RJ2X 4J6GA 3OTFA 4LT5A 2DU0A 4Z1VA 2QZ2A 3GHMA 3IM0A 3FBYA 3N7MA 5C8CB 1W2AX 4IEPA 4R4ZA 1V6OA 3TNPB 4KNCA 3WLUA 3ZXDA 1JZ5A 5A6ZA 5FY1A 3CLPA 1BEV1 5D8AC 1K42A 3T4HB 4CSWA 3LIGA 5BNPA 1PZ9A 2VZPA 1N1YA 2WKKA 2I74A 3M3EA 1GYKA 2DCTA 3EMRA 4MADA 4BIFA 5HXMA 5F3IA 2WSVA 4EQVA 4OMDA 1W8HA 2RS32 1UY1A 3VBRB 1QGLA 3PMSA 3PURA 4KU8A 4MGYE 2VMGA 1RUI2 3PJQA 3IIIA 1F9KA 3OPWA 2D3PA 3HMYA 2B4KA 4XF1A 4Q4V3 5APAA 1BJQA 4LQRA 3SKJE 3VBUA 3MW4A 4AQTA 4CP9B 1LESA 2ZGNA 5EHDA 2VBBA 3AXEA 5J37A 1CAXA 4EN6B 5L7OB 4I2OA 1UL9A 3L2HA 4Q0SA 3OGRA 5F5AA 4FOWA 1XJAA 4XJAA 4ZXEA 4S2DA 3DYPA 2W87A 4IDZA 4ORFA 4XW3A 5F6LB 1PO12 1WA4A 4NIIA 3LB9A 4LE3A 1B35C 1K5MC 2R063 3THTA 1TZOA 4FPKA 4PIYA 3ELNA 2QQWA 3AL6A 3E5QA 2GMEA 3H1MA 3WDXA 1QJU2 3B5LB 1YO8A 5LZ6A 4N9IA 5CA6A 1POV1 4K8FA 5FR3A 3DXUA 2ZABA 1ENSA 4Q2FA 2D44A 4QHOA 3RI9A 1R081 2JDNA 2DTWA 5A7QA 3CL1A 3KVBA 4NPMA 2B5HA 2C1FA 1TMF2 2AZ5A 4FPLA 3WOGA 1UN1A 5FYVA 3VHPA 1K5JA 4IL7A 1PGW2 4GD4A 4Y1ZA 3K3NA 1W9FA 3FFQA 1IS6A 1ZBE2 1DF0A 5IVEA 3CJIB 3LOBA 4YW2A 1FV3A 3RWKX 2IXCA 1J83A 3OD0A 3K2OA 2WN2A 4HPKB 4AK3A 1RUOA 4GB31 3LA7A 3PVEA 1BKZA 5LRRA 2NPIA 4LMFA 2H0VA 4LBNA 4DPNA 3B02A 3ZMNA 4CCKA 2YFZA 2MNGA 3IDBB 4OVEA 1RUG3 1LTEA 2BYVE 4IE6A 5D1IA 4I09A 1G8WA 1N3OA 4SBVA 3VHNA 1ZZ8A 4QXHA 1NUKA 4DXTA 5JI9A 2EAAA 5CISA 3ZMOA 3SLIA 4CZSA 1VBA2 1WLTA 2HWB3 1MS3A 1JZ7A 3CNAA 4GWIA 1CAWB 2D6PA 3WT3A 3O1UA 2TEPA 3UKNA 4CPBD 4EN8B 1LOGA 3H50A 1G9AA 4NPLA 4XBNA 2D6MA 5AVPA 2PYTA 3LIHA 1VMHA 5ANQA 1RUH1 4LO5B 1NCQA 4HPKA 1PVC1 4BMBA 2FMYA 2BEOA 1OKQA 5KXBA 5LCWL 2Q0AA 5DAVA 4GMP0 3KMHA 1ENXA 3OGVA 2CAVA 2XG3A 1PHMA 5FBJA 1LOFC 1TNRA 4NRPA 4Q4W1 1AX2A 1ZBA3 4NIDA 2YC2A 3WHTA 2ZGRA 1AR91 5JVVA 4CXYA 3ZIXA 5DAWA 3TWIA 4RS5C 1BK1A 4QGMA 4Q4X1 1X33A 1PIV1 4X8PA 4Y5SA 1ZM1A 3WG3A 3ZFFA 4ASLA 3BU0A 2VOWA 4B7EA 1HV0A 4M4PA 1UIJA 4WM7C 2O8QA 5LY2A 1VBC1 4FTBA 1UYXA 1F5FA 4KMQA 5LBBA 4QX7A 3AVSA 4EN7B 3OB8A 4P08A 2HWD1 2JE8A 1DZQA 1OOPB 4ISQA 4BZ4A 5A3UA 1X36A 1JI6A 1ZZ9A 2VUDA 5FQ0A 2DUOA 2PAKA 5A1LA 4Q4Y3 3B93A 1LHVA 2QNKA 4RD7A 3X29B 4DEQA 4Q5OA 1YUDA 3BODA 3VKNA 1RUC2 2Q30A 4AXOA 3ZSJA 3D6EA 3PDQA 3S0MA 1BCXA 1E5SA 2XBO1 3QBQA 5DUXA 4AHXA 1CJDA 4IGPA 1ULDA 1RUE2 1XQNA 5EYXA 3MIFA 3RMYA 1X8MA 2JDHA 2OW4A 1GQHA 1OH3A 1TE1B 3FUQA 2D6LX 4YW7A 4AI2A 1XPWA 3VD7A 1OXCA 4QX5A 4XBQA 5FYSA 1MQTA 1CIYA 3PUQA 2NM1A 2WJSA 4LIUA 4Y5Z0 5CFDC 3FX3A 4K3UA 4NO4A 1FXZA 1GOFA 4OYUA 4P9XA 1YJLA 3AJZA 3WP5A 4DIQA 3LQCA 2DUPA 4LBQB 5J98B 3ZYBA 1OVSA 4BQ1A 1COV2 1CAVB 1ND2C 5FPAA 3VL8A 1RUJ3 2O0OA 5FP7A 3WQBA 5EWSA 2JG9C 4IEQA 4QPIB 4Y1UA 2QFEA 3MIBA 3LWCA 1QJFA 2VTXJ 3AYEA 1DQ0A 4JGYC 2ZHNA 4XVHA 1SLAA 1QJX3 2JXAA 2WLQA 3FN9A 3CDZB 5KXCA 3OGSA 4Q8KA 2AGSA 4BQ4A 4I3GA 1JMUB 3GGLA 5FOBB 3KSCA 5FMDA 3TEWA 3WDUA 5GZFA 3ORJA 3I2FA 5A3PA 3POWA 1WMXA 1DYKA 4LBQA 2JIGA 2RR11 2PELA 2X8KA 4E2SA 4MVTA 1YJKA 2WNUA 5FZIA 1H2NA 1W6QA 4PI0A 4IEYA 1CAVA 1O8SA 1R1A2 3BB6A 1JTZX 1XNBA 3IDAA 1RHI2 4CE8A 4HSLA 3CQOA 3T08A 3UNPA 1L3JA 1JHJA 3POEA 4TSVA 2Y6FA 3DKQA 1C28A 2BW8A 2XH6A 1IZ3A 1HLCA 3NAPC 3TYJA 3ZXFA 1TME3 2HEWF 2MEV1 2FCTA 5JWPA 1RVF3 1HJFA 2B8MA 3AL5A 1MS0A 4K40A 3P1IA 4AFDA 5SV5A 4LKSA 2R32A 4ZU5A 4FOQA 3GJBA 1H1AA 2P37A 1J3QA 2VOVA 3DYOA 4UFIA 1G86A 3K3OA 3OBZA 4KBBA 4XFGA 5C70A 4GKXA 3FWEA 1RJ8A 3HT1A 4LO6B 3ACIA 3ZXLA 3N35A 3UGGA 3VLBB 3POJA 4HN1A 1JYWA 1I1EA 2ZS6B 1AR81 1RUF3 2ZCWA 2JB8A 2RM21 3OGGA 1SFPA 1F15A 5C5TA 4DY5A 1AL21 1J3RA 1R082 2I07B 2WFF1 2WQ8A 3CF6E 5FY5A 3TN91 4D3WA 4XQWA 1MS1A 3ZVXA 5IVVA 1ULGA 3GCWA 3RWNA 2XR4A 1UZVA 1LRHA 1X8EA 3I3EA 5F8PA 4XDOA 1PGL1 3K4DA 3POFA 5FPXA 2PA7A 1LHUA 1UY2A 3AZZA 3E6BA 5A7OA 5A70A 3RYRA 3TEZA 4ZZ5A 3AMQA 5K8SA 1RTVA 5FXZA 4GB32 1YQ8A 3KF5A 2VZTA 3E6DA 2BERA 3LZZA 4A7KA 3ZN4A 4P14A 3FE5A 2ZKNA 3FLRA 2XUMA 4IE0A 3GZUC 5FO9B 3WW3A 1GANA 2E51A 5FMCA 3ABZA 4R9AA 5FXWA 3K4AA 1WD3A 1U0AA 2E7QA 4YGCA 4OHZA 4FPCA 4EWEA 4CDUC 4L2NA 4LUKA 1YCIA 4RYDA 5FCCA 1I6XA 1ODNA 2KD7A 2BU9A 4YRDA 5FYIA 1MVQA 1NKGA 1SQ4A 5DN2A 4AI0A 1EV12 2XL9A 2YFUA 4XUQA 1JYXA 1E5IA 2Y60A 5K4LA 1N1TA 2WNOA 4ITCA 4GWMA 4OZOA 2UYBA 1RUH2 1QJEA 1ZRDA 1W04A 1VRH3 1PVC2 1EPWA 2VQ0A 4M0NA 1D4M1 5DUWA 1OVPA 4XJWA 4Q27A 1NE6A 1P8JA 2XVGA 2RJLA 4AAPA 5M0TA 4H7LA 2QQOA 4WVZA 3U78A 4B4PA 3UJQA 4QDRA 1QXJA 4OI1A 3PL0A 1H9PA 1JHNA 5C4WB 4Q4W2 4NAMA 3OF1A 1AR92 1RUNA 3CEWA 4UAPA 5FMBA 1QNYA 4U36A 1L7QA 3H1WA 3ST7A 3KF3A 5EFUA 5IAXA 4YVWC 2GC3A 2WZPP 2ZEYA 1AYM1 1UX7A 1VAKA 3EHKA 3WF0A 3PUSA 1VBC2 2BUKA 4JQRA 5BNOB 5A3WA 4CP2A 1IHMA 3BIWE 1HV1A 1OSGA 4FXGB 2HWD2 3WY6A 4YM2A 4LHSA 2RS13 2VMDA 1MPXA 4IE5A 3NO8A 3E97A 2W95A 3HN1A 1VBE3 3MIEA 1VLNA 4KBZA 2DFCA 4KI5M 3IAPA 4N53B 4WM8B 2R6QA 2WS93 5JPMB 1SBFA 1XC6A 4ES8A 1VMFA 5JSOA 3J7HA 4PF5A 2B45X 2WRAA 4KWUA 3OCPA 5GALA 4FT8A 4INDA 2OZJA 4DY3A 1H8TB 2P34A 4RGGA 3I2DA 1WUVA
chains in the Genus database with same CATH topology
3POYA 1REDA 3V0AB 1XYNA 2XPJA 2O8OA 1IPKA 4N43A 4PDWB 3JCIA 1G9FA 2BBVA 5ABJB 2BVBA 2ZGKA 4Q4V1 4XFIA 4Q0UA 4FBFA 4N53A 4WM8A 1LECA 1VJ2A 1OD5A 4XFHA 2QKDA 3ZDSA 2HEVF 3DUIA 4AQ2A 2WINB 2PQQA 4IEUA 2H6CA 1NCQC 1LCLA 1PO21 4GQ7A 3IPVB 3M3IA 3GBWA 2R061 5LEKA 1V6JA 4DMIA 4YZ5A 3V0AA 5I0SA 4IV3B 5BXXA 2YXSA 5C8WA 4AEDA 2ZBJA 1O3QA 4XXPA 3AKSA 2PHLA 3SCHA 2RR12 5ABJA 1JYIA 4RQPA 1BVP1 1VBD1 4AEKA 3KGLA 2E7TA 2XJQA 3KLSA 1UAIA 1ZREA 2JEMA 3WV6A 1NA1A 1TNFA 4PLOA 5JAXA 4UBHA 1BXHA 1XRUA 4GH4A 2PHXA 1VAMA 1CAUB 4C91A 1RUG1 3KT7A 3NV3A 4CDWB 4H55A 3VHOA 4OHXA 1LGBA 5DZFA 1AR82 1FMD1 5JI7A 1LOEA 2RM22 3EO6A 3D0JA 3ZIWA 1MQTC 3ASIA 2WFF2 4YW1A 4GMP1 5GZCA 1QOOA 1MS9A 1AJKA 4Y20A 2XBO3 1ASJ3 4GKYA 4CEYC 4E4ZA 3KCCA 3L9JT 1SCRA 5KHHA 4OHYA 3APBA 3VBHC 5I8YA 1IQAA 1PGL2 2Q1ZB 2A6XA 3KCXA 2YGLA 2UWAA 4IXLA 1CAUA 2WQ4A 4IEOA 4JTOA 1OMIA 3FFZA 2XJTA 3NWKA 1S0JA 2BFUL 4CDWA 1O3SA 4CDXC 4DRVA 1ZBA1 3VBSA 1DGWA 1YFXA 2VXRA 1SLTA 1BVVA 1BBT1 1GICA 3N7KA 2Q8OA 3B9CA 4JDOA 1NLSA 4TZDA 4X6QB 1OFSA 2B7YA 3W9AA 4META 5CFCB 4RL7A 1J59A 2JICA 4MXVA 2DWRA 3VV1A 2F6BA 4F3JA 1HRV2 5IK8A 2Q1MA 1Q8QA 1V6NA 1Y9QA 2HJIA 3PHMA 1D0GA 3MLLA 4Q4Y1 5L73A 1FPN2 1RUD2 1S2BA 2R30A 4PCRA 2D6NA 2R073 1CJPA 3WQ7A 3AK0A 2YMZA 5J7MA 2ERFA 2PLV3 4RHV3 4M0HA 2X29A 2WWSA 1VAVA 3DV8A 5CFCA 2BNOA 3G6JB 2X5IC 1GKBA 1OA3A 1KS5A 3E5UA 4IESA 1CIWA 5FDBA 4FXKB 4KG8A 1BQPA 5DZEA 3HR9A 2VECA 2H6BA 4B29A 5AFEA 4MGZE 4MXWB 1ZRCA 2HWE2 3VBOC 4TYSA 1RMU1 4BIOA 1GFF2 1UZYA 1DDLA 5FMOS 4C0BA 2EXHA 1U5XA 4PLNA 4L9BA 4UW6A 1PM7A 4AF9A 3MF9A 2VUAA 1ND2B 1QJX1 2ZX2A 5JIAA 4E4SA 3ZFEC 3T2TA 1F31A 4KL1A 1DQ4A 1YFWA 5DDJ3 4XF4A 3DPRB 4JGYB 4A2UA 1ULCA 2ZGOA 2GN7A 3AZYA 4FAGA 1AYN3 4IV1B 2ZX0A 3VKMA 1FYUA 3P3PA 2VW1A 2RHPA 4XF3A 5E8AA 3NV1A 3I7DA 4Z07A 5DUUA 3ZPYA 3VN4A 3KQRA 5EV7A 1QH7A 4Q4V2 3A0KA 4XQDA 1Q8OA 4Q0VA 3O7OA 3ME2A 3U0ZA 1AX0A 3R4DB 5K7PA 1SBDA 4LBMA 2TUNA 4MYEA 1TME1 1JXNA 3TNQA 3ZYRA 3DN7A 2XWJB 4OFGA 2PHUA 3AX4A 4AXOA 1RVF1 1EP0A 5BNNC 3DPRA 5DXDA 2WNVB 5K9YA 1PK6C 1S0FA 1TQ5A 1YIFA 1IGOA 3CU7A 1DQ5A 1O3RA 1FATA 1IPJA 1V00A 3ZXKA 4Z82A 1RUF1 1NCRC 3RRDA 1W6MA 2DCZA 3FUOA 2TBVA 1V9U3 2JG8A 3FBMA 3N7JA 1D4M3 1YNAA 4Y4YA 4L11A 4HSJA 2KM2A 1QOSA 2XJVA 3MIGA 2ZX1A 3QH6A 5L19A 3MW2A 4XTMA 3B7MA 1NY71 3UKVA 1F5JA 4LA3A 4LO8A 2CGOA 3E5XA 1LEMA 1AR71 5GLZA 4YNIA 5KC5A 1UPSA 4PJYA 1AYM3 2O1QA 2GC1A 2FZ1A 5T5LA 3EJKA 2CGPA 4D94A 4W6YA 4B8EA 1IS4A 3LOIA 3N3HA 3LCPA 2V09A 1EAH3 2YROA 3BALA 3S6PA 5BY5A 2HWB2 4H7MA 2R0FA 1F8VA 1RITA 1XE7A 3TAYA 1C4RA 3JU9A 1HQNA 3QACA 1OI6A 3I59A 1C1LA 5CB7A 3WQ0A 2JECA 2YV8A 2JE7A 4U2AA 1VRH1 4E27A 3WW2A 1MVEA 4K1YA 2PHDA 2YZ4A 4JGZC 4QGLA 3SHRA 5JOYA 2ZHKA 4BH9A 4QU2A 4OHWA 1DLLA 4BE3A 1ZBA2 1OA4A 1QJY3 3ZFGC 1VBB2 5C8CA 3WG4A 3WQ1A 3I4IA 3ZXAC 2G9GA 1GLHA 5FLHA 2ATFA 1ZZ6A 4C90A 1C1FA 4RQPC 1PO23 4RR3C 3VDDB 1N1SA 3CJXA 4YVWB 2IXHA 5JZGB 1LU1A 2RS11 3AP7A 1NYWA 5BNQA 2CY6A 4QXKA 1VBE1 3OPZA 3VBRA 4IEWA 3O0WA 1WCSA 3MLKA 5DG1A 1XYPA 2WS91 4YVSB 1LB2A 2QDNA 2R49A 1GZCA 1ND3C 4COWA 1Q3EA 4YZ2A 4Q29A 4UXAA 1QY4A 4XFCA 3PLQA 5AVAA 1KJRA 2ETEA 1VBD3 1NA1C 2ZOEB 3ENRA 3SNMA 1NZCA 2BWAA 3RYKA 1RIRA 2AENA 1X50A 3GALA 4IEVA 1YRZA 4NWWA 4Z8BA 5L7OA 1Q8PA 3KGZA 4K1ZA 1OLQA 1WW5A 1YYNA 2Z69A 1KD7A 4AQSA 1XNDA 4WVVA 2JX9A 2E9QA 1QJZA 5KC6A 4JDMA 4URTA 4LUMA 3WUDA 1RUJ2 2EXJA 3LKJA 3H0OA 2DVDA 4LBLA 4HKLA 5CVRA 2ZHMA 1IKPA 2PHRA 2QUOA 1QJX2 1WBLA 4C1WA 1FMD3 4ISRA 5GLTA 3MW3A 2GAUA 3WD5A 2JENA 3PNAA 1S0CA 4LLFA 4GMP3 4W6WA 1DYPA 3AYDA 3CJIA 2W68A 3O5SA 5E1RA 4XILA 1KFXL 2B46X 2ET1A 3WVJA 4FSJA 5C9AB 1GNHA 1W6NB 3VBSC 2ET7A 2R1BA 4R9BA 3MPPG 4YGEA 4S2GA 1I5ZA 4UW5A 1U5IA 1C3HA 5JR7B 3ZSEA 1SBEA 1A8MA 3AM2A 1ZZBA 4KGQA 2GC2A 4NHMA 2GDFA 2YUEA 2W52A 1TME2 1BBT3 3K51A 5BPXA 5C6CA 1CAWA 3AYAA 4J1WA 4R8HA 2HEYF 4OLLA 1W6PB 4OZXA 2LM3A 4C1XA 2IFRA 5AFBA 1PZ7A 1OLRA 5F5QA 5C9AA 2IC1A 2XLFA 4YLZA 2DURA 3HBZA 3FC0A 4D69A 3AZXA 1J3PA 1UCXA 2ZZQA 2R0HA 4FPEA 1WCDJ 3LGRA 3OD4A 5JPNB 1FNZA 1ASJ1 4Y1XA 1S0IA 1KFUL 1OQEA 3C3VA 4Y1YA 4KWLA 2GNTA 5EXOA 1W6PA 4QQ2A 3HT2A 5K0UB 3KM5A 3I8TA 1VR3A 3B69A 4AVCA 2WZR3 3ZO0B 2XL7A 3VBHB 4KWKA 1VB2A 3IMNA 1VALA 1OOPA 1QJU3 2Z42A 2QVSB 3VL9A 4CEWC 1ULEA 3MFCA 2ZX4A 4COVA 2UWBA 3HD8B 1QDCA 1UZZA 1RMU3 1WCKA 2DCYA 2XJRA 3ATGA 4GULA 2AYHA 1GSLA 1MACA 4CDXB 4XMAA 4OHVA 3VBFC 4FO9A 3ZSLA 4G9SB 5GM0A 5JLVA 2A71A 5KWRA 1BEV2 5K0UA 3IBMA 2PHWA 2KXLA 4P9YA 1EYBA 5T5JA 4QM8A 1VRH2 1NG0A 2R071 3IKWA 2NMNA 4FTBA 4RGAA 1X82A 3LA2A 2PLV1 4RHV1 3RJRA 3UJOA 1GBGA 1KITA 5H9PA 4QPIA 4AFCA 3ZSMA 1VBA3 5I0UA 1LHNA 3OGJA 5T5PA 2CNAA 5FPZA 2QE3A 3T1LA 2V5YA 1JW6A 1MZ5A 3QH7A 2CL2A 3M1HA 3D0SA 4AGRA 2JG8C 4Q0PA 1DBNA 2RS12 3MDPA 3MI8A 1YWKA 1VBE2 3VBOB 2UYAA 4KU7A 2WS92 1ZZ7A 4DFSA 4JV4A 2BGCA 1XNKA 5DDJ1 4FTSA 4QPGC 3RG0A 4EN9B 4KGGA 2MPFA 3IWZA 3AMHA 1FNYA 1HXS3 3C2UA 4ONUA 1AYN1 4FPYA 2YYOA 3VKOA 3M7AA 2CYFA 3R05A 4LTAA 2ILMA 4YGBA 1OFNA 4MLOA 1AR73 1YFUA 4I0WB 4DS0A 1S2KA 1JN2P 2ZKLA 1VP6A 2ZJCA 4EJRA 3FHIB 1RUC3 2VPVA 3RPQA 2ES3A 1XU2A 1QH6A 5BNPC 2EVXA 3VGIA 3UV9A 5CNAA 4YZ1A 3PTYA 1C8M3 2EIGA 3JB4C 2WT0A 2AR6A 5BNNB 1FOD3 2W39A 2BPA2 5JOWA 3AZWA 4GXLA 1PK6B 1ZA4A 4XBLA 5HCFA 3POSA 2YPJA 2ZAAA 4K9SA 4LEJA 3VBUC 2ZMKA 2LTNA 1V9U1 5C8CC 4MGKE 1A6CA 3SH5A 3ILRA 2A6ZA 1SCSA 4B7KA 3AFKA 4WV8A 5GZEA 2EF6A 2ZGMA 5CG9A 1DGRA 1LULA 4Q4X2 2VVFA 1AHSA 1AL0G 1KQRA 4XF0A 3SH3A 1PIV2 4AVVA 1ZVFA 1D4VB 1WW6A 2VULA 3H1YA 4HVQA 3M2MA 5A33B 5KBFA 2NLRA 3PVOA 2VNGA 3ETQA 1HDKA 1R1A3 4GALA 1UMZA 2RS53 1EAH1 1TEIA 1Z0HA 4GA9A 4HVRA 1AXKA 2SLIA 4Y22B 3J26N 1A3KA 4KWJA 5AC93 3R4SA 4F83A 1ZZCA 5J09A 5C4WA 3SISA 2FBEA 1M06G 2XBO2 1ASJ2 1QXPA 5A3MA 2I45A 1ZRFA 3WP3A 3U4XA 2WQZC 4Q1PA 3MF6A 3VZJA 4F8AA 4IQPA 5D8AB 2NYYA 1ZYBA 5BNOA 3PMEA 3T1MA 3D82A 4XE9A 2QCSB 2OPKA 4OI0A 4YG0A 3AMNA 5EJ3A 3R6SA 3WCRA 1LHWA 2VU9A 1QJY1 3AJYA 4AHZA 1BMV1 1S0GA 1Q8VA 3NL1A 1DZRA 2ZACA 3CJIC 3ES4A 4P9GA 4QQHA 3IN9A 3J8F3 1O4ZA 3NW4A 4ATFA 3VZLA 5KHJA 2GSYA 1CD3G 3LA3A 4K21A 1CONA 1Y43B 1Y3TA 3VZKA 3K48A 4XZPA 2K9ZA 2PHFA 4XIOA 3KT4A 1H8TA 1POV0 4AYUA 1UW8A 3AP5A 1EY2A 5D8AA 1R091 1UPIA 1QWRA 3AP9A 1HKDA 4BA6A 4RR3B 1QQP3 4PDWA 4HT1T 4COZA 4E2QA 2HWF3 1B35B 1K5MB 4YYOA 2D6KA 4UW3A 4ZU7A 1HIXA 5BYNA 2JD4A 2PLV2 4RHV2 5T3NA 2ZGPA 1DGLA 3GYDA 3ZFFC 3ACLA 5F1RA 1ND3B 4HETA 1XE8A 4AWDA 1DHKB 3HQXA 2HWC3 3GF6A 4PLMA 4FAHA 1D0HA 1MZ6A 2UWCA 3SXWA 4AEJA 3IPVA 2ZMLA 2MEV2 1FV2A 3OY8B 3WDTA 4AHWA 5DUVA 2RMU1 2Z79A 3WW4A 4Q0QA 5HBAA 1JOJA 5A3LA 3ZYGA 3RNSA 4IV3A 5JOZA 3I54A 4B3NA 1PGSA 1K5MA 3LAGA 4AVBA 1J58A 4D7TA 3WHUA 4A3XA 2BVVA 2IXIA 3ZXGA 3M8LA 4COUA 3TRSB 4DNYA 3ALQA 4GIQA 4LO4B 4FOVA 1AL22 5DDJ2 1S1AA 4M3CE 4R9DA 2YHJA 3TN92 2ZA9A 2GH8A 3WDVA 1AYN2 2Z2SB 1UD1A 2D3RA 3OY8A 4M3CF 2BFUS 4R52A 4BLIA 3A4UA 3ZYIB 1UU6A 3FLPA 2HKXA 3USUB 4LBQD 4O9GA 1CQ9A 3ILNA 1AVBA 4L99A 3SCFA 1WW4A 1NXMA 1G7YA 4XHBA 2P3KA 4BM8A 4IERA 1Q8SA 1G9CA 3WR0A 4AVTA 4QMAA 1HW5A 2R16A 1N3QA 4HFSA 1AF9A 4RS5B 4B4QA 3R0RA 2FHRA 2WNUC 1NXD1 4X6RB 1AXZA 2VUJA 4LA2A 2W08A 3GZAA 3D5OA 1RUI1 2XB6C 3D4KA 5I91A 1HRI3 4K6BA 2HYKA 2K2SA 4WM7B 3VHRA 1Q43A 4X8NA 1R1ZA 1D4M2 3OJBA 3E6CC 3IT8A 2ZGQA 3JBG3 2FZ2A 2GNBA 1RINA 2D97A 3QLQA 2IFWA 1S55A 2D43A 3QD6A 3NVCA 5I93A 1DZTA 5E16A 2WZR1 5I8TA 2AREA 4XOGA 2EXKA 1ONAA 4RS5A 1MZEA 4YFZA 5LK5A 1SDWA 1AYM2 1QJU1 4WZCA 4WM7A 1N1VA 4AE2A 5IUQA 4YM0A 1MEC3 1ZNPA 5FREA 4ATEA 2VOKA 2DYCA 3WDYA 1W0PA 3VZNA 1EAH2 1REEA 1KXGA 1LOCA 3UKTA 4HKWA 1HQLA 1PGW1 3HIFA 5HCAA 3MICA 2JG9B 1LKNA 2H0BA 4XFAA 3PJYA 4AFMA 4AVSA 3WCSA 1D2QA 4HZFA 3VBFB 3AKPA 5LEJA 1W2UA 4LLOA 2BTVC 3AZVA 1O5UA 2A5ZA 4H3WA 4MXWA 3ZN5A 4EROA 5LRSA 5GLUA 1EPZA 3WG2A 4WVMB 4NHKA 5HI0A 2E7AA 1OPOA 2OYZA 4HANA 1WLWA 2VW0A 1VBA1 3P3NA 4P9IA 4L8QA 4XJ9A 1ND2A 1QJY2 3V0BB 1BMV2 1AJOA 3SH4A 5JMCA 3KS7A 4CDQC 3MFAA 2JG9A 1H2MA 4PQ9A 4WZFA 3VKFC 4JTNA 4JGYA 5I8SA 2LALA 2VNRA 1PO22 3NAPB 1Q5OA 4EN0A 4IV1A 2R062 2XJUA 1XU1A 1HX6A 2ZGUA 4ZXKA 1ZX5A 2VY0A 2C5DA 1C8NA 4BMEA 4WVMA 1PVXA 3NKGA 5FBZA 1OHFA 2Q4SA 2VOXA 2PFWA 4JCKA 4GWNA 1VBD2 3EQEA 3TBDA 1M4WA 1HXS1 1PMIA 2PTMA 4YFWA 1WBFA 3MLJA 3ZYJB 4LHNA 5FRAA 4QPGB 2WNVA 1V6MA 1G9DA 2D6OX 2DVAA 1HRV3 3NAPA 3GNEA 2WC2A 4W65A 4UBGA 3PVBB 1AR63 4E4DX 4DOUA 1NQDA 5E88A 4DQAA 1RL3A 1RUD3 1GV9A 3VZOA 2OUHA 2VG9A 2NMOA 4DINB 2IZWA 1RUC1 1RUG2 2IXKA 4W6XA 3ILFA 4E2GA 5B2GB 2F4PA 5IT6A 3RQ0A 1QOTA 4JAAA 3B94A 3FLTA 2OIIA 1FMD2 1ULFA 1C8M1 5H9QA 1AZDA 2LUWA 2UY8A 5KHGA 4M00A 5BNPB 4JVAA 4Z92B 1FOD1 4N43C 4FQZA 1OA2A 1DGWX 2Y26A 5J36A 1V6KA 4LR4A 4CDUB 5GJ6A 3JQXA 2HWE3 1KS4A 2VVDA 4N53C 4WM8C 5FAXA 5EYYA 3U10A 1WW7A 3AXDA 1RGSA 1FT9A 1REFA 5T5OA 3VBUB 3Q9OA 4OUSA 1RB8G 1H8TC 1CAXB 4LO7A 5GLVA 1BBT2 1UU4A 3WUCA 1XYOA 4JRLA 4PDWC 3OBTA 2ZPXA 1PNGA 4AEDC 4WBBA 1V70A 5ABJC 3USSA 1QMJA 4CDUA 5IK4A 2GH2A 4BWOA 1GQGA 1R1A1 5CAZA 5JSRA 2RS51 1RHI1 1LGNA 1R093 3KD4A 5FLJA 4Q4Y2 1LR5A 4LE4A 3JD73 4YG3A 2SBAA 5AC91 4AW7A 3FMGA 2C0ZA 2EA7A 4M3CB 4AI8A 4PIZA 2R043 5BUVA 2CAUA 2QZ3A 4LNVA 1C5HA 3S7EA 1H1IA 4HL0A 1IS3A 4D7YA 4NN0A 4RA0A 3MYXA 4IV3C 4XJUA 4GH4C 1J1LA 3UL2A 4N7UA 2WNEA 3RI8A 1LODA 1Z78A 2WZR2 3DF0A 3VDDA 1CR7A 2A70A 1SLCA 3WXPA 4YVWA 5CFDB 5JZGA 3VZMA 1J1TA 4LBJA 2RMU3 5GZGA 2GC0A 1SFYA 4UW4A 1WGPA 3N36A 1URXA 4FVVA 1RMU2 4JC1A 3B3QE 4NOTA 4YVSA 3WZ1A 1QHDA 3GBGA 4M3CA 1ENQA 4LHLA 3J8F1 1B09A 4HK9A 1PNFA 5H9RA 2FQPA 2UU8A 1Z7S3 2IWGB 5DZGA 4AI1A 1PZ8A 4NR1A 4XJZA 3GZTB 2EXIA 4FPHA 4XHXA 1O3TA 1NCQB 4CYDA 3WP4A 1QQP1 1H4GA 4CDWC 5ACA3 2VNOA 2HWF1 5CFDA 4BOWA 4YGDA 4QGNA 2XLAA 3NKTA 4BYYA 4XQ4A 3H9AA 3W59A 1MR5A 1C5IA 1NOVA 2BNMA 3AP6A 2Q5TA 3MZHA 1JUIA 2HWC1 5KXEA 3ZFFB 1EV11 1QKQA 1RVF2 4IEZA 5JCTA 2DVGA 5CBLA 4BHPA 3AKTA 4I02A 3SCGA 3THPA 5T54A 2BQPA 5FQ0B 1W6NA 4XETA 1U12A 2RS33 4I3PA 4YZ3A 1ENRA 2CGNA 2ENRA 3TOJA 1RUI3 2IXJA 5JOXA 5CFCC 1RUF2 2WL1A 4OI2A 1QNWA 4L92A 4N90A 1ALYA 1VBB3 4Z2WA 4BPZA 2RE9A 1HXS2 1DQ2A 3NJZA 4WVWA 4AHYA 5FO8B 1MQTB 4YW4A 4NPRA 4KH9A 3V56A 1NY72 2D5HA 1PO13 1DU3D 4Z1VA 3KCYA 5I0TA 2QQPA 1MZFA 1FX5A 4CEYB 1S0DA 1AR72 1X7NA 2DVBA 4Q8LA 1SLBA 2P17A 4MX3A 1U5ZA 4HLTA 3JZVA 1H2LA 2DTYA 2E53A 1UKGA 1WMDA 1U5YA 4AEMA 1OQDA 3M4FA 2VGDA 1JH5A 4BLJA 1TMF3 2A6WA 4LBOA 4ZU4A 2BWCA 2DVFA 5KXDA 1LGCA 4PBPA 4A7YA 1C8M2 1ZBE3 2QJVA 2KA3A 2B9UA 1FOD2 2ZX3A 4P5HA 4FQ4A 1CPNA 5FFOC 2WT2A 1HRI1 4Y1VA 3CO2A 4CEYA 3IIAA