3I54A

Crystal structure of mtbcrp in complex with camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
224
Chain Sequence
LYFQSHMDEILARAGIFQGVEPSAIAAQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 66
structure length 224
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i54A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i54A01
2MNGA 4BH9A 4HBNA 2LNBA 2ZCWA 1O5LA 1YLLA 5L3DA 4MGYE 2EV5A 3L2HA 5K1YA 2VBYA 2IXHA 2DPUA 3H50A 1ZHFA 1IN5A 2E7WA 4M71A 4PGGA 3IWZA 4IVNA 3SCFA 1PMIA 4CHUA 4FBFA 3ECHA 1OYIA 3IRRA 4UV9A 4XF9A 4FX0A 4Q4ZF 2HJIA 5D8LB 5BQTA 4Z07A 2VODA 2QQBA 2LF7A 2FNPA 3H7JA 2UYAA 1FT9A 5FGMA 3KP7A 1V4RA 5LHGA 3VFZA 3ZN0A 2K9ZA 3BALA 3ZPLA 3SHRA 1O57A 1DPRA 4META 5LGUA 3K0LA 4N9HA 4ZYHA 1TQPA 3O14A 4ENMA 4KWJA 4QM8A 4UVAA 2OYZA 4IESA 1TNSA 2P5LC 1J58A 2FEZA 2FU4A 1WGPA 3VODA 3WGIA 5FPZA 1OYYA 2K86A 1RUOA 3G73A 2PAKA 2P8TA 1K6OA 2XL9A 2LKPA 5I0TA 2J5OA 3GW2A 4ENNA 3CLOA 1P2FA 3LA3A 3CDHA 2Y0OA 3LQRA 2VONA 4B8XA 5KBFA 4I0BA 1ZAOA 2EV6A 5K5OA 4RD7A 5FCCA 1HW1A 5HOOA 3WW1A 5FPXA 1FP2A 5I8YA 5JSRA 1UD1A 2Z2SB 2M5WA 1R36A 1IF1A 1GQHA 2O6GE 1KQ9A 3GXOA 4G9YA 3WW3A 4OINF 3WTSC 4MGIE 1JGSA 4KA4A 3PNAA 4P9GA 2OBPA 1ZLJA 5D5XB 2X4HA 4PGHA 3ES4A 4F7ZA 2IT0A 2P5KA 4WXDA 4KFCA 4LG0B 1WSUA 2CFXA 1U12A 2B8MA 4XFBA 4KNYA 4XF3A 1IXCA 1AWCA 3IKTA 4MNUA 1IN6A 2DK5A 5CVUA 3K2ZA 4B29A 2A6HF 2VOPA 3H1WA 2V1DA 4O3MA 2VOOA 3LOIA 2X0LA 3D5LA 1Z6TA 4GGGA 3TDZC 4UNOA 1B6AA 2XHKA 3BWGA 2XAFA 3REOA 1CAWA 2GC1A 1XGNA 3VHRA 3KGZA 2OA4A 1O3TA 2DAOA 5A2QZ 4JTOA 4PIYA 2HTSA 2EVXA 4JTNA 3PQKA 2MPFA 4LUMA 4ORFA 5I93A 2DI3A 1LEBA 1O3SA 3TNPB 3E5UA 4Y17A 4PDKA 2W84A 1YFUA 1YFYA 3ABTA 3TOAA 4NHJA 4NB5A 2ZJ2A 2O61A 3FXQA 1H1MA 4M9ZA 2STWA 1CX4A 1FYLA 1CF7A 4RGXA 3J7AO 4YG2F 5AIQA 5FQ0B 1FSHA 2MLKA 2IXKA 3CO6C 1B9MA 2ZKLA 3I58A 4XRFA 4RGSA 3D82A 2FRHA 3BROA 3EQLF 3Q9VA 1DP7P 1P4XA 2RDPA 2PQ8A 1G3SA 4RB2C 1RTVA 4LTAA 2OAZA 1YG2A 5HLIA 2STTA 2V1XA 5HS9A 1WA4A 4AQ2A 4IRIA 4LK0F 5HDGA 1S7OA 1BIAA 2Y0MA 2PN6A 4AIHA 2VXZA 4XFCA 4IJAA 2Q4SA 1ONVA 4RAZA 1P4AA 1KA8A 4AQ6A 2EA2A 2PMUA 1S6LA 2QQAA 4HBLA 1IXSB 4OFGA 1PM7A 3CUQC 4UHTA 4IF4A 2OZ6A 4EM1A 1MJ9A 1MGTA 2IA1A 2IW5A 5JSOA 1YS6A 1G3WA 2OD5A 1MJAA 4WVZA 1NHAA 2E7XA 2G9WA 5HS8A 1R1UA 2ZNZA 4IHSA 4G7ZF 5E20A 3WW4A 3HHGA 2IXCA 4L9TA 4ZYDA 2F5FA 4U88A 3BB6A 2EK5A 2LF8A 3DXJF 2EB7A 1QWRA 1SEFA 1P92A 2HQNA 4I0AA 3WTTC 2RQPA 5LHIA 1USSA 4HF2A 4ASNA 3RPUA 2PLYA 1TQIA 2E1NA 2VT2A 2PI0A 4MHGA 4P9UA 4WX9A 3V8KA 2WWYA 1QQIA 5DD8A 3HSFA 3E6DA 1QXJA 4ZU4A 5BXXA 3H8UA 4YARA 2RNJA 1XCVA 3U10A 2DU9A 3T1BA 5BOXA 4YNIA 2ZBKA 4AVBA 4MGZE 4Q5SF 3M9AA 1K7AA 1HSTA 2PG4A 3MCZA 1J0RA 5LLQA 3FMQA 5JSPA 3E3VA 3WW2A 4JK1X 3KP2A 5E1WA 1DUXC 3SXYA 4AVPA 2XAJA 3FHZA 2H0VA 1RC6A 1W5TA 1YW7A 5TRDA 4Y15A 4UVCA 3WTWC 1O7LA 1ZN2A 3WE2A 5AIPA 4DINB 5DCMB 2NAZA 4HSJA 2HTJA 4R52A 2FXAA 3I59A 4MTDA 1RZ4A 5DUKA 1K79A 1EY2A 3HTSB 1H9TA 3BJ6A 1SQ4A 1XE7A 4O6JA 1WKMA 2OQRA 1ZREA 2BBYA 4ONUA 4R1HA 3U1DA 3BY6A 2FNAA 2DT5A 3ZMDA 5F64A 4MH0E 5BPDA 2K7LA 2QZ8A 3NEUA 3UKNA 2DCTA 2L4AA 3L7WA 1NYWA 4A0YA 1OMIA 3GX4X 1C0WA 4L0ZB 4RGRA 3K9TA 1RI7A 4YYOA 3V7RA 2EA4A 1YHFA 4I98B 3E6CC 1B9NA 3K1PA 2JZYA 2MC3A 3VEPA 4A12A 3KFWX 3R4KA 4IEYA 1G3YA 2D1VA 3NKTA 4OLLA 5ICCA 3QACA 2WFPA 1WRJA 2HR3A 3TKYA 1XRUA 2XAHA 1SAXA 3I5UA 1USTA 4KU8A 2LDUA 3F8FA 3MZYA 3U11A 3F3XA 4HX4A 3ABUA 2ISZA 2YU3A 3Q5FA 2FMLA 5CVRA 5H20A 3JSPA 3SFZA 1J3QA 2EFNA 2XIGA 4E2SA 4F8AA 4KWLA 2BGCA 3KMHA 2CGPA 1T6SA 1VP6A 5AONA 3KP4A 1TBXA 4IPAA 3ROUA 1FYMA 1ON2A 3SZPA 2VQAA 4YFNF 1Y3TA 2NYXA 5EZWA 3C18A 3SCHA 2EWNA 3LAJA 4EWAA 1FWZA 2VE8A 2HZTA 3P7NA 3KZZA 2DLLA 2DQRA 4LG0A 4D7SA 5HLGA 1W5SA 1W7PD 2QVOA 2VE9A 3WE3A 2XROA 1BI3A 2BYVE 2BV6A 3E5XA 1D8JA 2H6CA 4BYYA 1YIOA 5ICGA 4PIXA 1X8MA 3H9AA 5T3NA 2P6TA 4FAGA 3EYIA 1ZGJA 3P9CA 3T8RA 5FLXK 2O03A 4QLCU 1HW2A 2OQGA 1K78B 1KU7A 4KMUX 4HV5A 1XGSA 2L02A 2DPDA 4QWQA 2XLGA 3NQOA 2A68F 3GYHX 4KU7A 3IC7A 3WGHA 1ZGAA 1LEAA 2GWRA 3SHFA 3HT1A 1ZRCA 4MUVA 1Z05A 2ZKZA 1Y0UA 2QENA 4L5JA 2QJVA 1J9IA 5I8TA 4A6DA 1V3FA 5H6QA 4BIFA 4RB0A 4N9IA 3FM5A 3ISPA 4LFUA 1OKRA 4ENJA 1LQ1A 5FQ0A 1EH6A 3NL1A 2BNMA 4EVIA 3N4MA 1D3YA 4UV8A 1OPCA 1BC7C 4YIFA 4MEXF 2GZWA 1ZZBA 3BCWA 4R8HA 3IBMA 4HQEA 1X3UA 2ET7A 2GC3A 5D8KB 1FP1D 2RGVA 1R1VA 2VC0A 1LNWA 2M45A 2PJPA 3DL3A 3HRMA 3AAFA 3MEXA 3MQ0A 4J1XA 3ZMSA 1LDKB 2Y75A 4ESBA 5KHJA 2IPQX 2OU2A 1R58A 1OFNA 3V7CA 4LB5A 3OCPA 3ULQB 1TW3A 1KU2A 1SMTA 4ZU5A 3CJNA 2Z5UA 4HAMA 3FE5A 5J3UA 4IERA 3VOEA 2QDRA 1PDNC 4G6DA 1DZTA 1YS7A 1FBSA 4E2GA 1U8RA 1R22A 5K5QA 1CGPA 1SD7A 3ZP5A 4HVOA 1XCBA 1XMAA 5KK1A 1EH7A 1V70A 3CL1A 1J3PA 2KIMA 1H1IA 4JVAA 3GF2A 5E18F 2XUBA 3OGJA 1UIJA 3O6BB 3FHIB 4D7TA 1G6NA 4MTEA 2A3SA 5BV6A 3NRVA 2DQLA 4UXAA 1ZG5A 1HQCA 2UY8A 1XDSA 1GXPA 2M1BA 3D0SA 4AD9A 5F6FA 1MJBA 4LA3A 2CG4A 4U0WA 1Z91A 2GA1A 3BPXA 1FY7A 2OZJA 1TLHB 4Q48A 1RIOH 1LR5A 3DPTA 3TO7A 1UCXA 3ECOA 1QO0D 3F22A 4O9GA 3FMSA 3EQEA 3USSA 1ZG1A 5E16A 5BPIA 2UY9A 1MKMA 1QZZA 3H92A 4GULA 3CLPA 5HDKA 2FOKA 3H1YA 1FC3A 3VB2A 1F9NA 3HSRA 3FWEA 3I71A 5DV5A 5E17F 3OF1A 4YIIA 2KRFA 1REPC 5ICEA 1UHWA 3K1NA 3QP6A 2VN2A 3W6KB 1YFHA 3KLNA 3F8CA 3J81K 4HF1A 1T38A 2ISYA 4NQWA 4KDPA 1YYVA 5BUVA 4IETA 5LHHA 4MQVA 1YQAA 5DCMA 3T5XA 5CLSA 3WU1B 3ACLA 3ZN1A 3TGNA 1ZZ9A 2UXXA 4I09A 2H94A 3HSEA 4RB1A 2PFWA 3GYDA 4HMZA 3F72A 3QOPA 4Y13A 3GFLA 3EDPA 3IWFA 4KUMA 3JAMK 2ETEA 5BMZA 2QBYB 1B59A 1R7JA 5HS7A 5KHGA 2QCSB 2IXIA 4IEUA 4NVPA 1SD6A 1P4WA 2IC1A 4I01A 3B73A 3LA7A 1QBJA 3ZMVA 5BPXA 3R0AA 2CAVA 2HS5A 3GBFA 1RGSA 2Z3YA 3F8BA 4OU0A 1CAUB 1TNTA 2PFBA 1ZZ6A 4MQ9F 3TOBA 5CVIA 2YX7A 2GQQA 2XAQA 1R5GA 2D45A 2Q0AA 2GAUA 4Q0PA 3KE2A 2BE5F 4AWXB 3FXRA 4UUVA 3DQVC 5J48A 1PUEE 3T8TA 1HBXG 1XSDA 4OIPF 3V8LA 4EM2A 3RI4A 2EFPA 5DUIA 5KHKA 4XF0A 3WTUC 4K2EA 3EJKA 1HW5A 3S7EA 4KIGA 1YLFA 3QRFF 3RYPA 4KL1A 2FSWA 3V8JA 4QM9A 1XMKA 5LBQA 5JR3A 1AOYA 4CXFA 1J2XA 4I2OA 5E8GA 5D5VB 1QZYA 4BXUA 4GYIA 2MHFA 3F8NA 3C3WA 1KQ8A 2HGCA 4LLNA 2XGXA 3IHUA 2KIFA 2Q0OA 2QYOA 3RPQA 4ZZLA 3RKXA 3TDUC 4UXNA 3ZMZA 2KIUA 2RKHA 3R6SA 4B09A 2MH9A 3E6MA 3KZYA 3QAHA 4PZJA 4CICA 4LEJA 3MAJA 1O7FA 2YR2A 4HVQA 1UIKA 5J8FA 4L5IA 4M73A 4U7DA 1IN8A 2OZUA 4EWDA 3O3KA 2XASA 4CYDA 2WC2A 3KSCA 1G4DA 5FFXA 4K8FA 2CWEA 3FF5A 2GIVA 3FXUA 2V09A 1IPKA 1YTYA 3QU6A 1Z6RA 2PMHA 3JZVA 1KYZA 2XAGA 2R3SA 3GFIA 2Q30A 2AXLA 2KJBA 3RZZA 3HOSA 5HLHA 3ELNA 4H7LA 4N0BA 4L9NA 4S05A 1BIBA 1K78A 3M3IA 1MD0A 5JAXA 3FZVA 4G7HF 4MZUA 4KYWA 1SD4A 5EFUA 2CYYA 1ZZCA 5L3EA 3WTXC 2YPRA 1SD5A 4HA8A 4P9FA 3HRUA 1G3TA 2EFQA 1W7PB 3EHKA 4XFGA 3I53A 5JFRA 3N97A 1KGSA 4QX5A 3R60A 4ON0A 2P4WA 4U7BA 3KETA 2F4PA 3TO6A 4A2UA 2NNNA 4Q29A 3MFKA 2D93A 2P7CB 1GXQA 4LD5A 2D40A 3FM3A 3WU0A 4HDVA 1S7AA 2FQPA 4ZU7A 2HDCA 1XGMA 3LAPA 4HX7A 2D1HA 2HYFA 4GCVA 5FD6A 3MZHA 3MWMA 2TDXA 4TLFA 2KKOA 4HSLA 2F5CA 1UHMA 1H9GA 2YSRA 5FLXZ 1WLTA 1HKSA 2CQKA 4ZZDA 5I0RA 3TQNA 2VT3A 4TV7A 5E1RA 2FBIA 2ACJA 1FZPB 4BHBA 2PTMA 2L4MA 4ENKA 1F1ZA 5HI0A 4KMFA 4ZYEA 1DGWA 4HF0A 4HYEA 3G3ZA 2HQRA 5KVRA 4HN1A 2P7VB 2V79A 3HT2A 4FX4A 2G7UA 1JHFA 3KP3A 4RGUA 2Z99A 4HN0A 3R61A 4G8XA 1L3JA 2VBXA 1R1TA 4CZZA 1RL3A 4L11A 1U2WA 1VTNC 3GZ6A 1L3LA 1CAVB 3SMHA 1I6XA 2IXJA 3LAGA 3WG9A 2D2WA 3GUDA 4YFKF 2DTRA 2PHDA 5DD4A 1RUNA 4WF2A 4XF1A 1J7KA 2QNKA 4IEZA 4EM0B 5ED4A 3HIFA 3K1MA 1FYKA 1I5ZA 1JXSA 2L01A 4RB3C 2ATFA 1XN7A 4BNCA 2R7DA 3NSTA 4FT8A 2UZKA 4XFFA 1DZRA 4IHTA 1XE8A 4YSFA 2W25A 1U5TB 4IRGA 3EBRA 4J1WA 2RVCA 4A6EA 1U3EM 4MGKE 4UBHA 2L3DA 2Z69A 5LRSA 4Q0SA 3QPTA 4EV0A 3J80K 2JPCA 3M8EA 4EWEA 3LA2A 5FO5A 2ETHA 4KT5C 2XL7A 3ST7A 4WXHA 1XB4A 3EO6A 5DYMA 2EAAA 3BJOA 2GXGA 4IEOA 3D0JA 1BOAA 1MDMB 2G7HA 1WQ2A 1I1GA 3BDDA 4A0ZA 4OIQF 3M8FA 1FNNA 4EJUA 1T0FA 2F5DA 1OI6A 3BOQA 1DDNA 4OMYA 3PLQA 2Z9OA 1LJ9A 3HQXA 4EGZA 4P5OA 1IPJA 2PBIA 1SFEA 3BP8A 2L54A 3HYIA 2B9UA 3KLOA 1LDJA 3FZ3A 2A07F 2GC0A 2QBYA 2IXLA 1YUDA 3GWZA 3CO7C 2VC1A 3S0MA 1Z7UA 3M1EA 4XBFA 1NE6A 5CU1A 4M72A 3ZMTA 1O5UA 4QMAA 5K5RA 1NXMA 1QPMA 5LGTA 2M30A 5LEKA 2MBFA 3PQJA 1CAUA 5L3FA 4L0YB 3DPLC 5KHIA 2ELHA 3C7JA 1ZX5A 3IIAA 3OOPA 4HQMA 3K69A 3CJXA 3I0TA 3IDCB 4AVCA 1R00A 1SFXA 1ZZ8A 3J81Z 2HWVA 2QQ9A 2B5HA 4RS8A 1NZCA 3GVAA 2HKOA 1XD7A 2GH2A 3PVBB 1ZG3A 3EETA 1ZNPA 4MGRA 2VBWA 1UB9A 4LMYA 5FD5A 4PCQA 1X82A 3C3VA 1D8KA 4YFXF 1IN7A 2A5YB 2F2EA 3V4GA 3PFIA 4I7HA 3QPHA 4X6QB 3V7SA 1TQMA 1GVJA 2VPVA 1FX7A 2MH2A 4OMZA 3JAMZ 4IXAA 2Q8KA 1ON1A 5D1IA 3F21A 3RIRA 1BI1A 5FLIA 2RV8A 3HOTA 2FBKA 2A69F 5IT9K 4LA2A 2FE3A 4E2QA 1IN4A 1J75A 4X6RB 2A6EF 4OOIA 2CO5A 2CV6A 4BAYA 3ML6A 2NNYA 5D5WB 1YWKA 3M70A 4Q47A 3GEZA 1IRGA 1D5VA 5I0SA 5H6RA 4KN4X 4M9XA 4KWKA 1LKNA 4KICA 1DPUA 3I59B 2QM3A 2MD5A 5J8CA 3O2PE 4L9VA 4LJZF 3ERED 2GA2A 1E17A 3H1MA 1UW8A 3MYXA 3WTZA 3I7DA 4MV2A 4D0PA 3CF6E 4WBBA 1R5HA 2RC4A 2JRTA 1TQ5A 3CO2A 4EJWA 5L3GA 2I45A 4HLYA 1CAXB 2IA0A 2P6SA 3HHHA 2Q1ZB 1IW7F 2K0GA 1LVAA 1OR7A 1SMYF 5FB2A 3OV8A 1ZRDA 3EYYA 1JUHA 2FMYA 4I3PA 2K27A 5K8SA 2HOEA 1O4TA 4FAHA 1Z9CA 5ERIA 5FLJA 3ELKA 1J59A 2V1UA 1TTYA 2Z33A 3JTHA 4WWCA 5C6CA 2VECA 5DCFA 4Q0VA 3WTYC 2ESNA 3ETQA 4M6XA 4P55A 4AIJA 2KXLA 5I8SA 1W7PA 4XSZF 4XFHA 4Q0UA 2AS5F 3BZ6A 2O8XA 2N7GA 5TJJA 4IEVA 3NVCA 1I27A 4WXCA 2EJRA 3WGGA 2BEOA 2DO7A 3KEOA 2EFWA 2IRFG 1DGRA 1FXZA 3HUGA 2EFOA 3FX3A 2PYTA 3OD0A 5F1RA 5JHUA 3Q9SA 4R79A 3HRTA 1OYWA 1YFXA 4GXOA 1B1BA 2QWWA 2RN7A 4U0YA 3COAC 1KYWA 3LWFA 4LLOA 3KCCA 4GO1A 1Y9QA 1T98A 3CUQB 4M6YA 3L2CA 2M8EA 1KQ0A 2K02A 1FBQA 1RNLA 3RNSA 1B4AA 2ZFWA 3GLXA 2FF4A 4QGMA 3DEUA 4XLPF 1GQGA 3RJPA 1IUYA 3TNQA 2W24A 4S04A 4EJVA 5ILVA 2HKXA 3E97A 2GC2A 4HVRA 4CDGA 2D5FA 5CVVA 1QGPA 5DDGA 4MX3A 4PJYA 4CO8A 4HX8A 4GYGA 1CAVA 1BJAA 2J5PA 3DN7A 5HDNA 4G94A 2H27A 1WWXA 3F6OA 2XV4S 2PAEA 1EPZA 1Q43A 1ZLKA 1HKTA 1YW9A 1ZZ7A 1KU3A 4XSXF 1ZYRF 5LGNA 2UWMA 4UVBA 4AVAA 2JSCA 2UXNA 4XEZA 2O3FA 1BI2A 1EYBA 2UYBA 2HFHA 5FDBA 4YRDA 2ZMEB 2ET1A 1FSEA 4HOBA 1VR3A 3KP6A 1FI2A 5I0UA 2QLZA 5L3CA 2VBZA 2MLGA 1U5TA 2GU9A 4A5NA 1UFMA 4EMSA 2PHLA 4LLGF 5JVTA 1FBUA 3LFKA 1O3QA 4IEQA 3L9FA 1U78A 3MPBA 2PAMA 2W85A 3LQQA 1MDMA 3IKVA 4H0EA 5ICFA 5D4SA 1IAWA 3G7DA 1ULYA 2F5EA 1P6RA 4JV4A 1S3JA 3B02A 1OD5A 3BU7A 4Z2YA 4O9EA 2O1QA 4IEXA 5ILUA 2PQQA 1J1LA 2CSOA 1ZVFA 2OA2A 1Z1DA 4HDUA 5J7MA 3RKYA 1ZRRA 1WI9A 2ESHA 2XKPA 4IEPA 2C6YA 1ODDA 3KP5A 5CVJA 1TW2A 4U0VA 3SZTA 1W4MA 2FBHA 4CGZA 4M74A 3ES1A 2ZNYA 2FA5A 3C1DA 4HZFA 3KGLA 2EV0A 2W57A 1Q1HA 1IRFA 4G7OF 3NW4A 4KIBA 6PAXA 2LSOA 5E1ZB 4EGYA 4BHPA 4KN7X 4WCGA 1XSVA 2WTEA 5EEHA 3J80Z 4LGWA 1F4KA 4IEWA 4MEYF 4O5VA 1VJ2A 4JBAA 2K4BA 5A2QK 2P5VA 4Q0QA 4DNCA 3WODF 4XFIA 3WTVC 5E1XA 1YO5C 5DEQA 1A04A 2DW4A 3E6BA 1ZH5A 2PA7A 3UKTA 3HRSA 2PEXA 4G6QA 3DP7A 3E5QA 3L00A 2V9VA 2A61A 1MZBA 5CJ9A 3GFJA 2E1CA 3R0JA 2XLAA 3MDPA 3S7IA 3TO9A 2JT1A 5L3BA 3DV8A 3T0YA 2DK8A 5BS6A 4WK8F 2Y48A 3L09A 1PP8F 1S8NA 1JHHA 4FHTA 5CADA 1T39A 5FLHA 2XRNA 1YW8A 4EJOA 4XLNF 1O3RA 1QNTA 2IP2A 4RAYA 3NJZA 5D5UB 2XVCA 4LLLA 3DF8A 3F23A 1IZ1A 2XLFA 1FOKA 1J5YA 2QUFA 3RYKA 2M87A 2E9QA 4HLXA 3GZ5A 1CAWB 1U6GA 5FFZA 3ZMUA 4AXOA 2B0LA 2JTVA 1EP0A 1UCRA 4EROA 1CAXA 4BQAA 3U0ZA 2O0YA 1H0MA 5JR7B 4IRHA 1X8EA 3RYRA 3I4PA 1SFUA 2P17A 4UBGA 1XDUA 1NE4A 4I02A 3F8MA 5CYVA 1ZRFA 2QVSB 4HLTA 1HXDA 3FMRA 3FFQA 3RDIA 5J6XA 3JTGA 4OIOF 5JI6A 2IA2A 1BN5A 1S29A 2NRAC 1Q3EA 3ZQ7A 1GHCA 5IT9Z 1ZARA 1XGOA 2HEOA 4QGNA 3EUHA 4A0XA 1CF7B 2ADUA 3CTAA 3ZDSA 3SXWA 5LEJA 4L18B 2BNOA 3GO5A 4L2NA 5I91A 4QGLA 1L0OC 5IT3A 2NS0A 1F5TA 4M9SA 3BPZA 2Q2EA 5D6EA 3RTRA 4A5MA 1LRHA 4JQFA 4P96A 3SQNA 1EV7A 1X7NA 5EEGA 2KJCA 3IL2A 2HYGD 1BI0A 4WZCA 2ZXJA 3LWCA 3QP5A 2O8QA 5ILSA 2H09A 4BHCA 2V6CA 2ZO4A 3M7GA 3W6JB 2FQ3A 4EJTA 3RKWA 2R7FA 3GFMA 2K4JA 2OPKA 1IXRC 3HTUA 1BM9A 1J3RA 1UPIA 5LRRA 4E70A 3BPVA 4EQQA 2D5HA 3CUQA 4L9JA 3IRQA 2MA3A 5AVPA 5C8WA 4AIKA 3JSOA 2YX4A 3KEQA 4ETSA 3U9GA 1Q5OA 4KIFA 4QXKA 1SFNA 3SCGA 3U2RA 3LSTA 1HSJA 1E2XA 3QU3A 4PIZA 1PP7U 2H6BA 4LB6B 1LB2A 4ZH4F 3H3UA 3JW4A 1HKQA 3FJSA 4LK1F 1I1SA 2CW0F 4Z82A 4XFAA 3UKVA 1JE8A 5JCTA 4HW0A 1FLIA 3IDBB 1QY4A 5KHHA 2COMA 2XKOA 3OTFA 1LDDA 2IJLA 4OIRF 5E8IA 3I54A 3P9KA 4HV6A 1BC8C 4ESFA 2GXBA 1EH8A 4LULA 3H7YA 1QXRA 3LZZA 2EA7A 3DKWA 2DBBA 3CEWA 3DFGA 2C0ZA 3I64A 3F6VA 2ZMEA 2IVMA 1BBYA 3S2WA 3H3ZA 4XF4A 1STZA 2DFIA 5HVQC 4LUKA 4XETA 2WV0A 5D6FA 2JPBA 4DQ2A 1U5TC 5D4RA 1YFWA 1T2KA 5BY5A 4ESJA 1KU9A 3CUOA 2CAUA 1R23A 2BNNA 1XSXA 1FPQA 3BJAA 3P9IA 4ZYGA
chains in the Genus database with same CATH superfamily
2VM9A 4IE4A 4YW2A 2OUJA 2KIQA 1F4AA 5L3DA 4FP2A 3IP4B 5K1YA 2Y9ZA 3RMYA 3MD2A 2E7WA 4ATFA 5DMYA 4YG3A 4XIKA 5F5CA 3SCFA 3PIJA 1JI8A 4M4PA 4CHUA 1D1AA 4FBFA 1SHWB 2QQMA 1OYIA 4FI9A 5M5YJ 2O14A 4ANJA 5D8LB 4FPJA 2VODA 3VPRA 2LF7A 4DUXA 1HX6A 5FGMA 3KP7A 1W0UA 1V4RA 5LHGA 2OS2A 2K9ZA 5BNOA 3ZPLA 3SHRA 1DPRA 5LGUA 3O14A 1TQPA 3OS2A 3PMSA 2ZKNA 1IS4A 4XRSG 4ENMA 4UI9L 2EQRA 2XVGA 4UVAA 3AP6A 2P5LC 1J58A 3J7ZI 5J1RA 5A7QA 2E2HJ 3KLSA 2P8TA 2WAEA 2LKPA 2E33A 4ENNA 3MV11 3CLOA 1FATA 3CCRI 2VONA 4MGTA 3LSRA 3W2AA 2LLKA 4B4PA 1G2HA 1X1PA 5C8CA 4BCUA 5HOOA 2VMFA 3CMMA 2WBMA 4A3MJ 1XS9A 4RR3B 1AXKA 4Y1UA 2Z2SB 2DCJA 1GQHA 1IF1A 2WNVC 2ADDA 3M07A 4G9YA 1HB4A 1W06A 4CDUC 2X5IB 5IUQA 4KA4A 3GZEA 1ZLJA 3NV1A 3GJBA 1ASJ1 5K7PA 3P3PA 3L2VA 3UKGA 3OYHA 3ZOIA 4QXHA 5DZFA 4BK5A 2YZ4A 1X1CA 1NY72 3OR1C 5G05L 4ITVA 1T6GC 4LO6B 5FP9A 5ERLA 3D5LA 3TDZC 1F15A 3REOA 1CAWA 5JR2A 2WWSA 3KGZA 2E53A 2DAOA 2XXZA 3WT3A 4GH4B 1D2QA 4LUMA 4AEDA 3ZR5A 2DCZA 3ZYBA 3LD8A 4Y17A 5FYVA 1IUFA 2OTLI 2W84A 5JUVA 5E3MA 1YFUA 1BA5A 2WLPA 4CP9A 4BJTA 4V2WA 3CZ6A 1OQEA 3Q0UA 4WV8A 3TOAA 4NHJA 4JGYC 4NB5A 2ZJ2A 3FXQA 3JU9A 5FY7A 2JWPA 2STWA 2G9ZA 1XX5A 3K2AA 2I2SA 3AFHA 3ZRGA 3DYMA 5JWPA 5FQ0B 3DKQA 1C8M3 4GWMA 5KNLA 1W9SA 1ND2C 4XKVA 1VPHA 3BROA 1BHGA 4IGOA 1ND3A 4DXZA 5JI7A 4OUMA 1DP7P 1YIPA 1IHMA 2RDPA 4AG4A 4B1RA 4RB2C 4LTAA 3BOWA 2C9AA 1YG2A 2STTA 4AQ2A 1WA4A 1FIPA 3C7FA 4LK0F 1IGOA 4COWA 4LOCA 4KNCA 5C4XJ 4OHWA 1MS4A 4C9YA 2KR2A 1S0EA 5J4YA 2WZ8A 1FOYA 2VAUA 2Q4SA 3POIA 5EJZB 3CNAA 2XB6C 3OY8B 2D43A 3VD9A 3DKXA 4HSTA 4C2TA 2HYJA 4DRRA 3OBZA 4HBLA 1PM7A 2FDJA 3BOPA 4KH9A 4IF4A 4J6GA 1MJ9A 5LD2C 4GJYA 1ZA7A 1NHAA 2DMPA 1QJU1 5FYSA 1OOPC 5HS8A 3FUQA 4BXSV 2VULA 4L9TA 2HVQA 4I30A 3LOBA 3WOGA 2LF8A 3A02A 4HONA 3DXJF 2EB7A 3MIBA 1XJAA 1SEFA 2VW0A 3WTTC 2RQPA 4A3XA 4HF2A 1R4NB 1NLSA 3RPUA 2VZ3A 5C3SA 2PI0A 2F5VA 3C2BA 3V8KA 2J1EA 4D7NA 5DD8A 3NJYA 1MQTC 4BQYA 1ACCA 3ZM8A 2DU9A 3H9JA 5BOXA 1U5XA 2NLRA 5GAEJ 3EUKL 3VYUB 5HNHA 4IHVA 2WFF3 1HSTA 1AHDP 1ZR2A 2VD7A 4D69A 5LLQA 4GD4A 2UWAA 4RN5A 3PTRB 2CW8A 1DUXC 3FHZA 2XAJA 3OYNA 1MZ6A 4PHZA 4Y15A 1PVC3 1O7LA 4E4SA 5AIPA 4A4AA 4R52A 1NCQB 2P81A 1ZKGA 5FO9B 1K5MA 3POFA 4YELA 1D4VB 2YU9J 1XE7A 2VQUA 1RUF3 1SPPA 3T08A 1WKMA 1W8ZA 3AVRA 1DYKA 3H1CA 5GLUA 4C1XA 5GZFA 5HPOA 3ZMDA 3RG0A 4JRAA 1DBNA 2K7LA 5FYBA 3VBRA 1OMIA 4NAOA 1S72I 4PSWA 1LGCA 3LL7A 4RGRA 3K9TA 4COUA 4YYOA 3KWVA 2EINH 2PMZA 1VI0A 3USUA 1X1AA 2WWUA 4XJ8A 2ILMA 3KFWX 4IEYA 1G3YA 4K9SA 3AG1H 5C70A 3NKTA 3MIGA 5E8AA 2OXBA 3JD73 5ICCA 2ZEWA 1ITYA 3Q8FA 2WFPA 2CU7A 2CV2A 2W2IA 1WRJA 2D6PA 2HR3A 3TKYA 1XRUA 2GBYA 3I5UA 1DQ5A 2LDUA 1D0YA 3F8FA 3MZYA 4K7JA 2IS1A 5EYYA 3ABUA 4II2A 5A6QA 4CEYB 2XWJB 4RA2A 1QIQA 3OEBA 3KT7A 2YGMA 2O9LA 3ACHA 3JSPA 4P00B 3DXUA 1XNAA 4KWLA 2WAQA 1HLVA 1NLQA 3S3MA 1H89C 1VQ9I 3GCXA 3KMHA 1LKXA 2HH9A 4IPAA 4I3GA 1ON2A 3SZPA 2VQAA 2ZAAA 3M3YJ 1S2KA 3KX2A 3V56A 3GZTB 3EMRA 1QJY2 4O65A 4LMFA 2W7NA 1OA2A 3C18A 2EWNA 3VYTB 1LAJA 4QX3A 2N8GA 4IV1A 4Q4X2 1JJ6C 1FYUA 5DG1A 2VNRA 4HK9A 3TB0A 4D7SA 1W5SA 3OUJA 2XROA 1BI3A 5LA9A 2BV6A 3E5XA 1C8M1 3OUIA 2H6CA 4NIAA 1YIOA 4LHLA 5ICGA 5A1AA 4BQ5A 4ZS3A 3J7YJ 1ZGJA 2R7RA 3P9CA 1I3HA 3FHQA 1AXYA 1Z21A 1W36D 4QLCU 1OH4A 1HW2A 4LHKA 3FL7A 2DTYA 4AF9A 4KMUX 2DMNA 1XYNA 4HV5A 2OPWA 4WM7A 3O5SA 2XLGA 4CCEA 2DVFA 4CU6A 4MO7A 2BHYA 5F04A 3IC7A 3IM0A 2KP6A 2QQOA 1ZRCA 1Z05A 3VYRB 3MKYB 1CQ9A 2EIGA 4XKCA 5A70A 2QJVA 1IZ3A 3THDA 2H8WA 5TISC 1WCKA 4D1QA 2BOLA 3IPVA 1V3FA 1WPKA 3CCLI 2JE7A 1HDKA 4N9IA 4LFUA 4QPGB 5GLVA 1EH6A 5CKNA 2BNMA 1ENRA 1NA1B 1YITI 5EG0B 3D1NI 1D3YA 1FPN2 4AGVA 5FZKA 3MIFA 3O1PA 4YIFA 4Y20A 3BCWA 1CJDA 1AR82 5DUXA 3MLLA 3VKLA 1HIXA 2RGVA 3ITQA 2I5UA 3AYEA 4S2FA 1LDKB 3ILRA 4ESBA 3O0VA 3POYA 1GOGA 4G9SB 2BZDA 5K9YA 3HOUJ 4LB5A 3C8XA 3OCPA 3K4LA 3CCUI 5F2WA 4ZU5A 4CU7A 2W1UA 4IERA 2A70A 2NVXJ 5F6LB 1HQLA 1YS7A 1D0XA 1FBSA 1H0BA 4RQPA 3ZP5A 3VL8A 2QZ2A 1XCBA 1X4PA 2WFF1 5M5WJ 1V54H 3L2YA 4E7SA 1REFA 4NWVA 3W2VA 3VKNA 3O6BB 2V26A 3I4IA 1G6NA 4MTEA 2A3SA 1APNA 3ZPOA 2NS7A 1PVC1 1XDSA 1RUH2 4Q26A 4AFCA 1AHSA 1WLDA 5F6FA 4LA3A 2CG4A 1JOPA 4XW3A 4U0WA 4W97A 2GA1A 3BPXA 2W47A 2OZJA 3WHCA 1RIOH 4CDQA 3TO7A 2KD7A 3SKVA 3F22A 4O9GA 4QTRA 2BVBA 1RUF1 3BTAA 3USSA 1ZA4A 4MHUA 2Y0SN 4P02B 2WA4A 4C2UA 1IRZA 5BPIA 3H92A 1SFYA 4HNUA 3VB2A 1F9NA 3HSRA 5A7WB 3FWEA 3OF1A 1QF3A 2RS33 4YVSB 3K1NA 2LTPA 2VN2A 5FAXA 3CCYA 3OSFA 4XIOA 3POSA 2ZACA 3RZOJ 1VQOI 1ULCA 5BUVA 1LE8B 4MQVA 4P9IA 3E1SA 4XILA 1MZEA 3OJBA 3JD71 4UFHA 1OCZH 4I09A 3OYGA 3F9KA 2PFWA 3DPRC 3F72A 2PHUA 4Y13A 4DGWB 4KUMA 2IUWA 5BMZA 2ZXQA 5FZMA 3OGVA 1BMV1 2ZGPA 4EN9B 5KHGA 4LBKA 1P4WA 1K42A 3LFMA 1XPXA 3ZMVA 4BOWA 2HS5A 4R4ZA 4XNFA 3DBRB 2Z3YA 4XLFA 4XBQA 4GXLA 4MGSA 1TNTA 1QHDA 1ZZ6A 1RR7A 1LHVA 3TOBA 4JKKA 2YX7A 2J1UA 2GQQA 3N7MA 3BR2A 3T2QA 1HXS3 2GAUA 4ZYAA 4Q0PA 4FASD 1Y4WA 3FXRA 5DM6F 4QX2A 3ZXGA 1SLIA 2JDUA 5J48A 1PUEE 3H8OA 5BNNB 1XSDA 3ZQLA 2QGUA 3A23A 3V8LA 4EM2A 4KGQA 5HCAA 5DUIA 3POBA 4L97A 1DYPA 2VGDA 3WTUC 1UZYA 4K2EA 4OYUA 3EJKA 3MKLA 3S7EA 5GM0A 2TNFA 5C9AB 2JG8A 2HQ5A 1X19A 2ZBJA 2FSWA 4QM9A 4HG6B 5BNQA 4OAZA 3LSGA 1RPWA 1J1TA 3MIHA 2VQ0A 1AR62 4AWDA 1Y1WJ 3HWJA 4QQLA 3HBZA 1AX1A 2FDIA 3C3WA 3KF3A 3H35A 1KQ8A 2HGCA 3K4BA 3IHUA 2KIFA 2Q0OA 3RPQA 1S2EA 3WHTA 2RKHA 3R6SA 4B09A 2MH9A 3E6MA 4JCKA 1WLCA 4LEJA 1O7FA 2M0CA 1Q8PA 2Y60A 4L5IA 4M73A 2X29A 4U7DA 3VBUB 4R9BA 4EWDA 3PTYA 2ECCA 1TP4A 2XASA 4CYDA 1V6NA 3G1LA 2CWEA 3FF5A 1FOXA 1YTYA 1VQ7I 4P9WA 3QU6A 4Q8LA 2EXHA 5IYCJ 2VMGA 1KYZA 2R3SA 5FZ9A 4RHV1 1H4HA 3TN93 1JXNA 5KXEA 3ELNA 5B4NA 4N0BA 3N36A 5FBZA 4JC1A 4IHXA 2HWD3 2GOMA 4XUQA 2MSYA 4HETA 2ZMKA 4LHNA 1ENHA 4D6SA 1OCTC 2QQVA 3H3LA 1SD5A 1AR72 1DIWA 4JYKA 5J36A 2YGLA 2MD0A 1W2AX 2VVFA 3EHKA 4XFGA 5A3UA 5JFRA 5IFPA 3OYKA 2VC9A 4F52A 3NAPA 3NWSA 2ID3A 2NNNA 1V6LA 5FYUA 5FY0A 2D40A 3MI8A 1ZM1A 2D44A 2ZSIB 1OF4A 3LAPA 3DBLB 1AX2A 4MIMA 3R4DB 3VZJA 4GCVA 4JHTA 4Q4W3 1UQXA 3J8F3 4AI0A 4QDRA 1FMWA 3MWMA 3CCQI 3BCBA 3GTLJ 2LREA 3AMMA 1OLME 2YSRA 5CG8A 5J3LA 5A3TA 2A6TA 2WT1A 3P1IA 5E1RA 1YXWA 2FBIA 2ZXWH 4NPMA 1H2LA 3SITA 5A33B 3S93A 3M4OJ 2Y0IA 2V9KA 3VDDC 1R1ZA 4CXWA 1R093 4IHWA 3VBSB 2GP5A 2V79A 4D7YA 4FX4A 3N05A 5FO8B 1JH5A 1WBLA 1G9DA 1JHFA 1YJKA 2BY3A 2OQ6A 4RFRB 4YM0A 5A3PA 4RGUA 2WNUB 4IOAF 3VDXA 4L11A 2RS31 1V6MA 4UF0B 2XF5A 3OL4A 3GZ6A 2OCCH 1L3LA 5F37A 4E7HA 4AQTA 4JX0A 4CYCB 1MS9A 1BBT2 2DTRA 1RUNA 2QNKA 4JKLA 4FQZA 3AYDA 3ZQIA 1JXSA 1BVP1 1PK6A 3ZXJA 1UPSA 5IW0A 4YPJA 4IHTA 1APLC 1U5TB 3I55I 2LROA 4YLZA 4J1WA 2RVCA 4A6EA 2M4KA 4EZ4A 2L3DA 3OBRA 1MBKA 1FOWA 3LA2A 2GDFA 2ETHA 1ETWA 1RHI3 5ABJA 1NUKA 3EO6A 2IWGB 3POJA 2QSGX 1GBGA 4ZZ5A 2EAAA 4LQRA 5B1AH 2QUOA 5DDJ2 1OT5A 2DFFA 1HXS1 1BOAA 1MDMB 1FOD2 2EIEA 4K20A 1FNNA 4CZCA 1DDNA 3PLQA 5FZAA 4FE7A 3T2PA 2R1DA 2O0OA 2ERFA 3MLKA 5IT6A 1SFPA 2PBIA 2G9GA 1JUMA 2IXLA 1IPSA 2QQIA 2VC1A 4DUWA 3JRAA 1DZQA 1Z7UA 4UOJA 1R9TJ 1NE6A 4XKBA 3ZMTA 1VE0A 5K5RA 1Z7S3 1D5YA 5T5PA 2M30A 3PQJA 2HPMA 2CQQA 3ZMNA 1WJEA 5L3FA 2ELHA 1QNYA 4BEHA 2DA5A 2R7XA 3ZXKA 3IIAA 2A71A 3OOPA 4HQMA 1WCQA 3NV4A 2TCTA 3A01B 1C4RA 1JHNA 3I3DA 3CZJA 2HKOA 3TBDA 1X1DA 1XD7A 1LHNA 4B3XA 1ZG3A 1ZNPA 3ZFEC 5GLWA 3ZQHA 3PMEA 1SZBA 3V0AB 1EUUA 3V65A 3AZZA 4YFXF 2F2EA 4I7HA 4CDXC 2JRMA 3QPHA 2BRTA 4X6QB 3TN91 3S2HJ 4OMZA 4IXAA 2AUYA 4IV3C 4ISRA 1ON1A 4DBRA 1MEC3 5D1IA 3RIRA 2WY7Q 2HWD1 2RV8A 2VZ1A 2A69F 2VPRA 4LA2A 2FE3A 4X6RB 4DZJA 3G1OA 4BAYA 3ASNH 2NNYA 2ZGKA 5D5WB 5LBFA 5JI9A 2PX9A 4YG0A 1IRGA 3RSJA 2XF7A 3S57A 1V5EA 5GTHC 2WO3A 5GAHJ 1NZIA 3ERED 2E5ZA 2E32A 1AR92 2HYXA 4MV2A 2F4LA 1R5HA 5JLXA 4MHRA 2RC4A 2I45A 3LOCA 3FKJA 2IA0A 2P6SA 4Q4W1 1WCMJ 3HHHA 3J8F1 1KONA 4PF1A 1OR7A 3IAM2 5FB2A 1NXD1 2D6OX 3WDWA 1JUHA 2FMYA 5K8SA 2R6QA 1C5IA 4BE1A 1DLCA 1RVF3 1Z9CA 1KS4A 2RMU2 4AVZA 4F92B 5C6CA 5EZGA 3BKZA 2WO7A 1SBFA 3ETQA 4AIJA 2CFOA 1NOVA 2HWF3 2JA8J 3INAA 2AS5F 4XFHA 5CFDB 2N7GA 4PDWB 3O1VA 1KD7A 3OYWB 3ILNA 2MG4A 1R091 5JZGB 1RUJ2 2MYSA 3TW6A 4EEFG 1PIV2 2EJRA 3MO4A 3T0DA 2RS12 2HLEA 1XQNA 5FZGA 1DGRA 4A45A 1WW6A 3M3CA 3VWBA 2PYTA 3OD0A 3J7MA 1H8TC 3H0OA 2R32A 2AXTC 1H30A 1JGGA 2VNVA 2YU1A 4GXOA 1B1BA 2QWWA 2DT6A 2RN7A 4HFSA 3AMNA 1U9OA 2KRHA 4AHXA 4LLOA 1UF2C 4GO1A 3CUQB 4A3FJ 5FR3A 5E88A 2LY1A 2HVSA 2A7AA 1RNLA 2ZFWA 2FF4A 3GLXA 1B35C 4XLPF 3FC0A 4IX7A 3TNQA 3E0JB 2R073 3WU2C 3PUQA 3RQIA 5FYMA 1XC5A 1W8OA 3CU7A 5ILVA 3H9QA 2HKXA 4NIDA 1RHI1 1QGPA 2AQFA 2EIBA 1U9NA 4HX8A 1BW6A 5GADJ 2GOXB 2Y26A 3DN7A 3M1CA 2H27A 5F8PA 2PAEA 4DJAA 3NWKA 1HKTA 1WMFA 2AZ5A 2QQUA 3O1UA 4RS5A 1ZYRF 5LGNA 3CJTB 1CQTA 5FPBA 2VXJA 1UOBA 1ZBE2 2HFHA 3DKYA 3PO3J 4YRDA 1F9KA 3VKOA 1FSEA 3AL5A 3JQWA 4HOBA 1PGW2 5I0UA 5GZDA 2VBZA 4XJUA 2JVGA 2MLGA 3LSMA 2HWC2 3EUHC 4FCYA 5FZ6A 1GUIA 4XL9A 3TYJA 3AKTA 4Y7NJ 1X33A 4YFZA 4LLGF 2JDMA 3I3BA 3LFKA 1Z7S1 1O3QA 2HZDA 5FJ8J 1U5IA 4RSUA 3W21A 4BXFA 2WDBA 2ZSHB 3CBNA 3ZFFB 1MS8A 1MS0A 5FKOA 3WX5A 2ES3A 3VBFC 1N3OA 4YWAA 2V4AA 1FTTA 4H0EA 1BZWA 1IAWA 4AC0A 1COV2 1WH5A 1S3JA 3ALQA 1TC3C 1GZCA 2Y30A 2ZJPF 3AG3H 5ILUA 1T0FC 1FMD2 3AMQA 4Q4Y2 2HWE3 1Y56A 4P9LA 1W5CC 2XONA 2XKPA 4IEPA 1IDYA 2VZOA 3JUUA 2QQ8A 4JAAA 3FHNA 2R062 2WQ8A 4BM8A 1W4MA 4TWTA 4M00A 1MEC1 1SBEA 3PVEA 3B9CA 4IQ4A 2W57A 2W1SA 6PAXA 1RMU3 4MSVA 1LENA 4IE7A 4K1ZA 5J98B 2LSOA 4BHPA 2SLIA 1BQPA 4KN7X 2DA4A 2P6CA 4KBBA 5A7PA 2WQZC 1ZYBA 3LSDA 2NP0A 3C7EA 1BJQA 4XQFA 4NHYA 4UFIA 1LULA 4Q0QA 1A04A 2WNVA 2PA7A 3UKTA 2PEXA 3KZIC 3L00A 2A61A 1LFBA 1T33A 1VBC3 5CJ9A 5KXCA 1AVBA 1OCCH 1NLRA 3MDPA 1VRBA 4LBLA 3S7IA 1A36A 1WMEA 2JT1A 5L3BA 3WF1A 3T0YA 1RVF1 4PJLA 3SDGA 2DMUA 2GH8A 2IS6A 2RG4A 1PP8F 1UXXX 3K77A 1I39A 4DY5A 4OI2A 4FVVA 5CADA 1T39A 2JVHA 2HWF1 1YHQI 1PGSA 4DXRA 1YW8A 3FXJA 1VB2A 4N43B 2DCKA 2JE9A 2XVCA 4LLLA 2J1VA 1FOKA 3ZO0B 3ZN6B 2R16A 4GB32 5FREA 3HOWJ 2JICA 5FFZA 2DWRA 1FIAA 1CAXA 4BQAA 2Y38A 1QA6A 3UETA 3WQ0A 3K4AA 3RYRA 3ETPA 3I4PA 4E7JA 3F8MA 4H14A 2P2KA 2H8RA 1LOAA 5BNOC 2VUCA 4YIRX 3FMRA 5FJKA 4OIOF 5J6XA 2YYOA 3ZQ7A 1GSLA 3SZGA 1D4M3 1XGOA 4QGNA 2BTVC 3POWA 2R93J 5BYNA 2ADUA 2BNOA 1ND2A 4L2NA 3H42B 5IT3A 3JB8A 2NS0A 3ZFGB 4RL7A 1VBB3 3RRDA 3RTRA 2ZEZA 4BQ2A 2R071 4IW3A 1LRHA 3TOJA 5AC93 1QQP2 4K21A 2JSPA 4P96A 2C1FA 3AL0C 4YM1A 4ET7A 3THPA 1BR4A 1W36C 3VKFC 1ETQA 2RV9A 4DB5A 2PHTA 1UG0A 2HYGD 2XJQA 4OZXA 3LWCA 2O8QA 3U37A 1YJWI 1UHSA 2JG9A 2ZO4A 3M7GA 4L0PA 4NN0A 5FROA 5FZEA 2FDGA 2R7FA 1K4TA 2OPKA 1J3RA 2FUG2 4E70A 3BPVA 1LCLA 3ZSJA 5C8WA 4ZDLA 2QQLA 4ETSA 3O7OA 5FUPA 3HC7A 1LOGA 3LSTA 2HBTA 2J42A 1HSJA 1ZBA3 5HBAA 4PIZA 1PP7U 3Q0VA 1OOPA 3O1SA 3IUOA 3H3UA 3JW4A 2WZEA 2XGEA 1UMIA 3ZDVA 2CW0F 3O8GA 4PF5A 1JE8A 3G1MA 4XMYA 4DZPA 2COMA 2VZTA 2XKOA 4XZUG 4NPLA 5E8IA 4HV6A 2JX9A 4ESFA 2R0QC 1EH8A 1P7IA 2DA6A 3TEDA 2CWSA 3H7YA 4W6WA 4AEDC 1QXRA 2D98A 1OFSA 2EA7A 3C2HA 1FMVA 4EZHA 4NHXA 1RUG3 2HWE1 5JIAA 5IP9J 4BA6A 2Z79A 3NKGA 3PUFA 3KVBA 2IVMA 3J26N 4E7IA 3KIOA 4CDUB 3S2WA 4GKXA 4HSRA 4XF4A 1ALYA 3D4KA 5FKKA 2WV0A 3WF3A 3WG3A 3MBWA 5D6FA 2Z5WA 3VBOC 4Z8BA 4ESJA 4FFGA 3CUOA 4A44A 1R23A 2VXDA 2BNNA 1RMU1 3POGA 1XSXA 5C3QA 3KHBA 3ZYPA 3IDAA 1X4OA 2JUGA 4BH9A 2BHZA 2B45X 1NT0A 1V9U2 1JYTA 2ZCWA 3V42A 2LMDA 1YLLA 2EV5A 2VBYA 3GTPJ 1UL9A 5FZ8A 5IVCA 1A6IA 4M71A 1L7RA 1S4CA 3H8XA 5LW9A 1PMIA 2M2EA 2AACA 4QQHA 1W99A 5CKQA 4UV9A 1F43A 2QQNA 2HJIA 1QHGA 1O8SA 3KQ4B 4Z07A 2QQBA 2VW2A 1OA4A 1HN1A 2CWMA 4YM2A 4META 3HNMA 1VBC1 3K0LA 4JGYB 2R043 1PO13 3B5LB 1S55A 5FZOB 4KWJA 2EZKA 3I49A 4QM8A 4N4NB 1N1YA 1TNSA 2HWB2 1ZGWA 3VODA 3BR6A 3V0BA 5FPZA 1OYYA 3C2UA 3OGGA 4NRPA 3G73A 4KITB 3QD6A 2J5OA 3GW2A 1GLNA 4CEWA 1VFCA 1W6QB 2Y0OA 3PO2J 3U21A 4B8XA 1P8JA 4DMIA 4MXWB 4W6XA 1W6MB 2WYFA 4X6AJ 3AXDA 4PK4A 3DUIA 5FCCA 2IEKA 3VZKA 1HW1A 5E3LA 5A1LA 3CLQA 5I8YA 1GT0C 3KVAA 1UD1A 2M5WA 1R36A 2BW3A 4A3LJ 3GXOA 2QFEA 1WD3A 2XJSA 4NMIA 3I2DA 3S30A 1EA3A 1OHFA 3BR1A 4P9GA 2OBPA 4JQRA 5D5XB 1XSRA 3ES4A 1JZ7A 2R92J 4LE4A 3WNXA 1AF9A 2VQTA 4LG0B 1D4M1 1IKPA 4XFBA 4QWNA 4KNYA 1CN1A 4XF3A 1IXCA 1AWCA 2VB6A 1IN6A 2DK5A 4E7LA 2VOPA 2WY8Q 2XUMA 2VOOA 2RDSA 4XVHA 4IE6A 1HRV3 1K5MC 3K6GA 2X0LA 1JTZX 1Z6TA 1VBB1 1E0EA 4NBQA 1B6AA 1VBE2 5AC91 1X9TA 3TWIA 1Z3XA 1UY4A 2XAFA 2GC1A 3G71I 4Q5OA 3VHRA 1RXGA 2HNHA 2VKVA 1PVXA 4NC6A 4C3HJ 3E1F1 4JTNA 4ORFA 4AGRA 5I93A 3ZYGA 1LEBA 1O3SA 1YI7A 4CPBA 2FDFA 3E5UA 2FJ1A 5LFAA 3D5RC 1MQTB 3FK6A 3ZQCA 1GV9A 3WNPA 3VBRC 4WVWA 3GTJJ 2RS52 2FD5A 2R30A 4M9ZA 4X8PA 4MG2A 1OURA 1CF7A 4RGXA 5C5UA 4YG2F 2E6VA 1I50J 3BCAA 4AQSA 1FSHA 2MLKA 2IXKA 1ZBA1 4QU2A 1WGXA 4L8QA 3I58A 1C3HA 4KQ7A 2VL4A 1DQ1A 1HC8A 1P4XA 2O5RA 2PQ8A 3T2OA 3F0CA 2OAZA 3LSIA 5HS9A 2JA2A 2E26A 1VBD3 5LY1A 1BIAA 5BNPA 2QCOA 1JZ8A 4AIHA 5EYRA 1EUTA 3JXSA 2VXZA 3T1LA 4IJAA 1UMZA 3PNTA 2A6YA 4ASKA 2EH3A 4XXAA 1AKHA 1S0FA 1KA8A 2P0WA 1XBFA 3K4ZA 5FXXA 3NRUA 2EA2A 1MVQA 1RUG1 3WF2A 1R082 1S6LA 1W0PA 3LIGA 4XR6A 3T09A 1IXSB 1H9WA 4P9XA 3JBG3 4PLOA 4IV1C 1A3KA 3T0BA 2OZ6A 4EM1A 1ETOA 3OIOA 2IA1A 1REEA 4MOAA 1YS6A 1GVDA 1G3WA 1MJAA 1UJ8A 1RUE3 1NKGA 1C57A 3U4SA 2G9WA 5EGOA 1TEIA 4IHSA 2JKBA 5FZLA 2VR4A 3HHGA 4AFDA 4X0GA 5CG9A 3BB6A 4BQ1A 3S32A 5IP7J 1P92A 4XUPA 4I0AA 4Q4V3 1USSA 2XOMA 1TNFA 2NN8A 4ASNA 2PLYA 2P1BA 1NQDA 2IGMA 2VT2A 3CCJI 4MHGA 3N7LA 5CIRA 3WSOA 3GHNA 5FYZA 1QQIA 1QXJA 3AFGA 3H8UA 5BXXA 1N1TA 2ZGLA 4XPVA 1PYVA 3V0AA 1BKZA 3B93A 4YNIA 2ZBKA 3L1PA 2JK3A 4RYDA 3I2IA 4MGZE 4YVWA 1K7AA 2PG4A 4AVVA 1PVC2 3MN2A 5AVAA 5JSPA 4JK1X 2ZGTA 3GTOJ 5E1WA 3ZYJB 5DAQA 2R041 3S1RJ 1UY2A 3W59A 4HEA2 1YW7A 1PO11 1N77A 5TRDA 2ZHNA 2JDHA 4BDYA 3DEEA 1ZN2A 1RUF2 3UK9A 3BN6A 4DINB 4FPGA 3OPWA 2VQHA 1U5ZA 2HTJA 4S2HA 2FXAA 2OKXA 4MTDA 5DUKA 1K79A 4PBOA 4IO9F 5HXVA 1W8NA 4A7YA 4BWOA 4PJMA 1D0ZA 2LY9A 2RM22 2RQQA 4JOMA 3AK0A 4G6TB 4W1UA 2FNAA 1POQA 3T4VA 3CQOA 5FP8A 4BY7J 3NEUA 3UKNA 2DCTA 2L4AA 3L7WA 1NYWA 3PU3A 1OISA 3K10A 3NAUA 4AGGA 4RQPC 5M3FJ 2EA4A 3I2GA 1YHFA 3O1TA 3VEPA 5A32A 2XJRA 5GZCA 1Y39A 1B8IA 3R4KA 5C3PA 2LBFB 1XTAA 2D1VA 2E7TA 1BMV2 4OLLA 2XBO2 4QQOA 5CFCA 2VZVA 2FDKA 1VBA3 3CJIA 3AC0A 5JXIA 1MBHA 1SAXA 1USTA 3KM5A 3LFIA 1VRH3 1OXCA 4PLMA 1RUC2 4CDQC 2X6XA 1HRV1 1OLQA 4ZTFA 3SFZA 4Y22A 2XIGA 2P3KA 4E2SA 4F8AA 3BIEA 2E71A 4EN6B 1VF9A 2P3JA 5AONA 4UT5A 1TBXA 4QB1A 3VBHC 2DUOA 1OPMA 2V4JC 3AZXA 4CH7A 1UYZA 3LAJA 4N90A 4XCAA 3I3QA 1U5YA 5K0UB 2BYVE 1JOJA 1JUPA 2Q5TA 5T3NA 3EYIA 4LBQB 3JRCA 4UFKA 2VW1A 2WZR3 2MEV2 2O03A 3SKJE 2FCVA 4DEVA 5FY4A 1GZ9A 1ZTRA 5K7ZA 2L02A 4QWQA 1VBD1 4KU7A 1LFUP 1UZ0A 3WGHA 2CQ7A 1ZGAA 4ZZ8A 2L7KA 3HT1A 2YC2A 1OCRH 1IJWC 3KHCA 2WT2A 5J1UA 1UOGA 3PURA 1B72A 1WMDA 1R1A2 5I8TA 4A6DA 1DU6A 5H6QA 4BIFA 1QJX3 4RB0A 2FDHA 3FM5A 3ISPA 1I1EA 1WBFA 4XQWA 3JBG1 3NL1A 5T5OA 4XBLA 1IS6A 3ESWB 3CESA 2WUHA 2OUMA 3N4MA 3VHOA 2P4EA 3ZR8X 4AI2A 3U1XA 1GWMA 1RUE1 4MEXF 3IBMA 2JG8C 3MFAA 2KZVA 1HCRA 1D2SA 1FEXA 1M1EB 3MEPA 3OYLA 3DL3A 3DPRB 3HRMA 1DHKB 3MQ0A 4J1XA 5FYIA 5IHRA 2Y75A 3VSKA 4Q4V1 4EQVA 5F2SA 1ULDA 3CCSI 2WO2A 3UGHA 4A3EJ 3ULQB 3VDDA 1CONA 3LE0A 1KU2A 1SMTA 2Z5UA 4HAMA 5J3UA 3DPUA 3W5MA 3K4CA 4DOZA 5IJRA 5K5QA 2EICA 1SD7A 2CUJA 4HVOA 1IQDC 4QPIC 3KF5A 3I2JA 5L7OC 3CL1A 1H1IA 2KPMA 5E18F 2XJUA 2IXSA 3DEMA 4ASMB 1DP3A 3W9AA 3KCXA 1ZG5A 3IDEA 2UY8A 1GXPA 2A3XA 1W6OA 4TYSA 4ARXA 3D0SA 2FCUA 2JQ7A 1UZWA 1AYM2 1URXA 2LFBA 1NCRC 1FY7A 1YI9A 3W5NA 5C4JJ 3DPTA 2XGDA 1V55H 5D8AC 2X6YA 3KQRA 2V5YA 4D94A 4AYBN 4Y5TA 2AO9A 1ZG1A 2YPDA 1MKMA 5J47A 3VN4A 1LESA 3CLPA 4QKFA 2HOSA 3MUY1 3H1YA 1Z0HA 3I56I 1ENSA 1FC3A 1YIJI 3NAPC 4PT6A 1JYNA 2DCEA 3CJRB 2EAKA 4KG0A 3AP4A 1TVGA 1UHWA 5ICEA 3MF9A 4XUTA 3KLNA 3J81K 4HF1A 1T38A 5FLVA 1ULOA 2YXSA 4NQWA 1KGYA 1DGLA 1YYVA 2BGPA 3D6EA 2Y31A 1GV5A 1N1VA 4J19A 5DCMA 2K9SA 1QH6A 2PN5A 3UJOA 5CLSA 2M9HA 3ACLA 1H2MA 2YY1A 1ZZ9A 2UXXA 1A8MA 1VBA1 2CV1A 3EDPA 1Y43B 3DU6A 2X6OA 1JZ5A 2ETEA 2JB4A 2W46A 2K40A 2R7WA 2QBYB 3NV2A 4HPKB 1VRH1 1RUI2 3NJVA 5JPNB 2PJRB 1CIWA 1DQ4A 1U8BA 1D0GA 2CY6A 5E3OA 2YS9A 1S0DA 3AFKA 4P5HA 2IC1A 1QBJA 2WRAA 1HB2A 3MUZ1 3GBFA 1RGSA 3HD8B 4OU0A 4XHBA 2PFBA 4Y26A 2J7MA 4CCDA 3HPGA 2ID6A 3KE2A 4UUVA 2CDOA 3DQVC 1LOBA 1HBXG 4S0HB 1Z7LA 1ULFA 3RI4A 1BL0A 2NXNB 4JP0A 3ZFEA 2ZJRF 3HGGA 2DV9A 3WINE 1VQ4I 2VCCA 5E6HA 4CDXA 1LU2A 4KIGA 4HXCA 2C24A 4YW1A 1DGRM 3RYPA 3V8JA 2WZR1 2FD8A 4AOCA 1AOYA 1J2XA 2CS3A 5DAXA 5E8GA 1G8XA 3PL0A 3J7NA 1QZYA 4BXUA 2E35A 2CMPA 1N1SA 3F8NA 1EV13 3ASOH 1KITA 1ETXA 3K4KA 2QYOA 3I3LA 4RR3C 4UXNA 2A6XA 2Y6LA 4HNTA 1UOFA 3KZYA 3QAHA 1GANA 4HVQA 1UIKA 3OBAA 4AW7A 4YEJA 1IN8A 2OZUA 4RLQA 2WC2A 1QJX1 1VQ5I 5FFXA 1JBCA 3MMYB 2GIVA 3FXUA 4YZ1A 4B7KA 3HQUA 1YRNB 4ES9A 5L73A 2DFEA 3UESA 1WJ5A 1YNAA 3SH4A 4YG6A 4H7LA 3SH3A 5C7GA 1BIBA 1K78A 3TMOA 2E34A 5JAXA 4N53B 2Y6GA 5FY5A 4UAPA 4XMAA 2ECBA 4AVTA 5L3EA 3OYIA 4GMP3 4GH4C 2LP0A 3WTXC 4OQ8A 2VLAA 1JT0A 2VMDA 5M3MJ 2DA2A 1YQ5A 3HRUA 1W7PB 1W6NB 4UFJA 4OWRB 5J40A 4H4KC 2P4WA 4B1LA 3B6CA 2F4PA 1MZFA 4FTEA 1A6CA 4A2UA 1GXQA 3FM3A 3GF6A 2HDCA 2PXJA 5EQUA 4HX7A 2D1HA 1H8TA 5FD6A 1X9PA 2ID4A 4OMCA 5JXJA 2F17A 2DODA 4HSLA 1H9GA 1UHMA 4FTSA 3LSKA 3QBQA 3BVCA 4E4ZA 3LGRA 1UYYA 3BZCA 4RBOA 4V2FA 3TQNA 4XHXA 2VT3A 4TV7A 1UN1A 2ACJA 5EJ1B 2KA3A 2D3PA 4BHBA 2PTMA 4ENKA 1W03A 5FZCA 1B35A 5FMOS 1F1ZA 2VOWA 2KT0A 4KMFA 5EIYB 1TWGJ 5DZGA 1SFOJ 2HQRA 5F5IA 4BISA 2DOFA 2RR12 3WNNA 2OUHA 4XN0A 4CCCA 4COZA 1RKTA 1GZWA 4HN0A 3R61A 4G8XA 1AX0A 4JDNA 1R1TA 2DMQA 5LY2A 4CZZA 2X09A 1CAVB 4M3FA 1ULEA 3SMHA 2E36A 3LAGA 1J09A 3GUDA 2OJED 4YGCA 2E1MB 4QPWA 2PHDA 2PHRA 4HG2A 1OR7C 1J7KA 4EM0B 1POV3 3HIFA 4OHZA 4C0HA 1FYKA 3BIWE 4NR1A 2VZSA 5LATA 4PFOA 2HU9A 4RB3C 1VQKI 1AYN2 2Q8DA 2CH0A 3RZJA 4IV3B 2R7DA 3J7HA 1IRXA 4FT8A 2UZKA 3O1OA 1RESA 2Z42A 1DZRA 4YSFA 2ZC2A 3MICA 1ZR4A 1NY71 2VZRA 4YW3A 4RMNA 1U3EM 3BLYA 4MGKE 2ZHKA 4COYA 1LU1A 3WNLA 2Z69A 4OI1A 3QPTA 5GP9A 4EV0A 5H9RA 3AYAA 1SVMA 3M8EA 5EHDA 2ZGUA 4WXHA 4XLEA 3RZMA 5DYMA 3BJOA 2VJ4A 3BDDA 2JDPA 1RC9A 2L0KA 4EJUA 1T0FA 3NQHA 3BOQA 4QPQA 2L9RA 1QMJA 1AJKA 2F4OB 4EGZA 1DG6A 1QJY3 5GLZA 1PUFB 2X51A 4A6SA 4Q4X3 2L54A 3PFYA 3HYIA 4J01A 1XU1A 4LIVA 3ILFA 2CHHA 3CO7C 1LOEA 4C3JJ 4ZDOA 4PFPA 3S0MA 2E7QA 3CMAI 3HGYA 1GICA 5FZ0A 1S0IA 4XBFA 5CU1A 1WMXA 2FCTA 5CKTA 1QPMA 4EJRA 1LTEA 3K4MA 1EV11 1UAIA 2MBFA 4RAGA 5LA1A 1CAUA 1OQ1A 5FZBA 3DPLC 4NIIA 3S17J 1O59A 2VJXA 1UNBA 2ELKA 1Y9MA 3OIQA 2V5DA 4QX7A 3CJXA 4EE2A 5J37A 3JCIA 1R5ID 5FTTC 1BR1A 5FZIA 2HWVA 3QH7A 2QQ9A 4PQQA 1YJ9I 4KISA 2B5HA 4RS8A 1F5JA 1Y0NA 5EYXA 4AFBA 4LMYA 2SBAA 2H1LA 2LOOA 5FD5A 1OBNA 1X2NA 4B44A 4AI1A 1D8KA 3S3OA 3PFIA 2DYSH 1Z0XA 2VPVA 4B1MA 3SEZA 2Q8KA 1FPN3 1QOTA 4CEYC 3F21A 2IGOA 1BI1A 3HNBM 5FLIA 3SJMA 3QLQA 5IT9K 1IN4A 2XQRA 2A6EF 4IHYA 1AR83 1XNDA 2V73A 4GMP1 2R0FA 3ML6A 1YWKA 2XB0X 3LEGA 3GEZA 3TEZA 3LB9A 4B4CA 5I0SA 3N9OA 1Q8SA 1LKNA 4KICA 1DPUA 3I59B 2MD5A 4C1WA 2UURA 5JHFA 2W92A 4LJZF 1H2KA 2HEVF 1WD4A 3H1MA 3LKJA 3OB8A 1VQLI 5GKAC 3L2UA 3CF6E 3S15J 3LEKA 1CD3G 1SC7A 2C26A 2BWAA 2LKSA 2JA6J 3Q8CA 1TQ5A 1QPIA 5L3GA 4HLYA 3K51A 3TEWA 2Q1ZB 2K0GA 4Z2WA 4K6BA 1LOCA 1L7LA 2R1BA 4AZZA 3H5NA 3EYYA 4I3PA 2K27A 1W1WE 2HOEA 4MFEA 4C8DA 3HN1A 5DUVA 1YQ2A 2XJPA 1TTYA 3T4HB 3MW3A 2VECA 2ESNA 1DU3D 1RUH3 3LMMA 4P55A 4XSZF 5F6KA 4Q0UA 5IVVA 4LIUA 1SMVA 4E8DA 1C1FA 4D5FA 1UZZA 4IEVA 4C90A 1NG7A 2Q2EB 3ZIWA 1PNGA 2X53S 2GNDA 3T0AA 3KEOA 3VBFB 2EFWA 2KZGA 4OI0A 3FHAA 1NA1C 3MHZA 3J4UH 3EUAA 3HUGA 2EFOA 4YZ5A 1YIFA 2LY2A 4ABZA 4R79A 2BW8A 1OYWA 4YW4A 5IK8A 2DBIA 2L9SA 1FTZA 2J22A 1O8PA 5LBEA 4U0YA 5LZ6A 3COAC 3ERMA 1KYWA 4JGZB 4BU2A 1POV1 1DQ6A 1Y9QA 1T98A 2JKXA 2R072 1KQ0A 2K02A 2DJNA 4A3GJ 4R4XA 1SCRA 3I8TA 4M0NA 3DLLF 1FV2A 3ZVXA 4BE2A 3AVSA 3JCUC 1W6PB 4GJZA 4BUPA 2GMPA 1FV3A 4EJVA 3IB3A 4XE9A 4UW3A 2LH9A 1RINA 4XJ9A 3WXPA 3NNGA 3PDQA 1PJRA 1LJ7A 4MX3A 1BJAA 2J5PA 1N47A 1W28A 2B4KA 1UO9A 2IZWA 2XV4S 3I3MA 3U4XA 1DU0A 1YW9A 3EYPA 2UWMA 1QJY1 2A3YA 4AVAA 2UXNA 2O3FA 4XZPA 2UYBA 4Q4X1 3AXEA 4AHWA 4LO7A 1W9TA 4XXPA 3G6EI 4CDWB 1VR3A 2XSDC 3HN3A 3VBOA 4NRQA 4DEQA 1UFMA 2I74A 3FBYA 3OGRA 5A1FA 1VIWB 4MYEA 2ZEXA 2XUEA 5C44J 4AYBA 3L9FA 2P3IA 2CDPA 2PAMA 2W85A 5GALA 3LQQA 4IOCF 1S0GA 3OYMA 5CYYA 1ULYA 1A6QA 1JW6A 2F5EA 3MFCA 3BU7A 4S2GA 4O9EA 4A3ZA 4IEXA 1ENQA 2JG9C 2PQQA 3S14J 3HDDA 2OCEA 2R5ZB 4I6ZA 2L9LA 2FZ1A 2C6YA 1ODDA 3AZYA 1TW2A 2QA4I 3D5OA 3HVDA 3KYLA 2YMZA 4YW7A 4AI3A 5LWBA 4GKYA 1G7YA 2AH2A 5BNOB 2GMEA 2FBHA 4CGZA 2ZNYA 1FPN1 3VZNA 2RJLA 4BMBA 4CCKA 2KMUA 3RZGA 3AB0A 1Q1HA 1IRFA 3NW4A 4QB6A 2K9LA 4UW6A 1AR81 5J1XA 5H2FC 4WCGA 3BTLA 1JHJA 4JDOA 1HKDA 4E6KG 3PUSA 3BTXA 1CESA 2VBBA 1A5JA 2BY1A 4O5VA 1AR73 5BNNC 3RJRA 3AL0B 1PZ9A 5A2QK 4AK3A 5C4WA 2P5VA 2GM4A 4XJZA 1KJLA 3WODF 1X3WB 1VBC2 3WUDA 3O8HA 1YO5C 5DEQA 2OX0A 4P9YA 5C8CB 4ZPIA 5J09A 2WO1A 4CRQA 1RJ7A 3GTGJ 2GIZA 1MMGA 2VMHA 1KDKA 1BEV2 3T30A 3OIPA 5HLTA 2E2IJ 1MZ5A 3R0JA 1EAH3 3MW2A 3UNGC 4V19K 2ZHMA 1JU3A 5IYYA 3BPSA 2OV7A 2DK8A 3RZLA 4WK8F 2JD4A 4XBNA 3IIIA 1TT0A 1RUH1 2VBPA 2ZJCA 4ZXEA 4Y1XA 1JHHA 3DCFA 3LCPA 5FLHA 1O3RA 1QNTA 4QXCA 1IQAA 2E1OA 5G04L 1V6KA 2XJTA 1MMNA 3FXMA 1J5YA 2QUFA 3RYKA 2M87A 3VYSB 2E9QA 5FPLA 3GZ5A 3ZKYA 4PI2A 1CAWB 1U6GA 3A7QA 4AXOA 2B0LA 4IUGA 1EP0A 1AUYA 1UCRA 4EROA 1JZ2A 5GJ6A 4AEDB 2LTNA 3AJYA 2DA3A 3WDUA 4UBGA 5FJHA 1WJAA 2DA1A 4HLTA 3H8RA 2R4GA 1HXDA 4CP9B 3JTGA 5L19A 4P1WA 1NH3A 1S29A 1GWKA 5FZ7A 1QDOA 1GHCA 4FXKB 1ZARA 1HN0A 2HEOA 4DBQA 1BBT3 2YC0A 4NAMA 3GHMA 3M3QA 4SLIA 5LEJA 5KWRA 4L18B 2A73B 2NMOA 2M34A 4QT6A 4FTBA 1W8HA 1L0OC 3VZOA 5F3GA 1AL22 1IG3A 2ZTNA 2HOAA 1ND3B 4GQ7A 4CEWC 2DU0A 5IK5A 5ACA2 3VUOA 4BBRJ 1PMHX 2KJCA 3IL2A 2VQCA 4BJ5C 4BACA 5L9RA 4BK4A 4ZJZA 1FNYA 1BI0A 3ZLIA 2ZXJA 3VD4A 2CNAA 5ILSA 4FPEA 2V6CA 3CJQB 2B7EA 4JHZA 4PJNA 3KYCB 4PJ0C 5AFBA 2LKXA 3RKWA 1SLLA 4TZDA 1F2NA 1IXRC 5DDJ3 3HTUA 1BM9A 2BFUS 1FOD3 5LRRA 2B39A 2YFUA 2D5HA 3X29B 1LNSA 3FXOA 2VQLA 5AVPA 5JIUA 3JSOA 1HDPA 1UX7A 4QXKA 1SFNA 3U2RA 4UW4A 4F93B 4CCJA 4KBZA 5FZ3A 3JRIA 2E2JJ 2NOJB 1LB2A 3DCQA 2DVAA 1EJ9A 3OR2C 1SVOA 2WAOA 4HW0A 1FLIA 1OH3A 3IDBB 4AHYA 5JVVA 4EN0A 4OIRF 4IE0A 3I54A 3P9KA 3I97A 1S5LC 1RITA 3K70D 3WDTA 2DBBA 2BGOA 2C0ZA 2EZLA 2XGCA 1ETYA 3WP4A 5IK7A 2ZMEA 5T50A 1H2NA 4UUSA 1BBYA 2DFIA 1YOVB 4LUKA 2ELJA 4XETA 2CUEA 1SANA 3Q0WA 4PJJA 1U5TC 4RHV3 1T2KA 2RNGA 2YBSA 2CAUA 1BLZA 1S7EA 3PUBA 4WVMA 1MNEA 1FPQA 4RA0A 3BJAA 2ADEA 4WM8A 4CUAA 2XPJA 2MNGA 4HBNA 3LSJA 1O5LA 1E5SA 3Q8AA 4BS9A 5JXHA 5CBLA 3L2HA 2IXHA 2EPFA 1K5MB 2DPUA 1W39A 2HEYF 3H50A 1ZHFA 1IN5A 2M7AA 1LODA 1GR3A 1W8TA 1AR71 1SPPB 2HBUA 4PGGA 3IWZA 4IVNA 5BNPC 2NM1A 3I2FA 3AL6A 1UXZA 5JVGF 1YRNA 3PNYA 2VCMA 3FXKA 2CTVA 2R042 3OYEA 3KV4A 5BQTA 1PNFA 1H8VA 1AR93 4TLGA 2FNPA 5FMDA 2UYAA 1Z3YA 4BQQA 3J7LA 3VBRB 3ZN0A 3BALA 3HOBA 1F5FA 2W08A 1OQDA 1HRI2 3GLLA 1LOFA 3PL8A 4N9HA 4R9DA 5DUWA 1MS3A 5H9SA 1O4XA 1SAUA 1EAH1 3USUB 5A3NA 4NOTA 4QPOA 5FLMJ 2FEZA 2JENA 1WGPA 3WGIA 2R5YA 5B2GB 2K86A 1C1LA 3AP7A 1VQ8I 2CRGA 2XL9A 4XOGA 2RMU3 4FO9A 5I0TA 2M4GA 3VD7A 4Y24A 3LA3A 3CDHA 4CA0A 3LQRA 2RVAA 4LBNA 5KBFA 2M7BA 1MSFC 4LK6A 4I0BA 1XC6A 2CQNA 4OQ9A 1BCXA 1RUJ3 3WW1A 5FPXA 4DYQA 3CC4I 1FP2A 1PIV3 5JSRA 3PJYA 1K45A 3VBHA 4JZRA 1KQ9A 3DTEA 2Y6HA 3S1QJ 5A7OA 2RS13 3WW3A 4YVWC 4OINF 3F2ZA 3WTSC 1KDMA 4MGIE 1JGSA 1PHMA 1SFKA 2BJSA 1ORKA 2ZZQA 2YBKA 3HBLA 2AYHA 2X4HA 2BP6A 3RQ4A 4IV1B 5DS9A 2K3FA 4F7ZA 2IT0A 2P5KA 4D5CA 2FQ4A 1W90A 1WSUA 2CFXA 1U12A 1BBT1 1HV0A 2XH6A 2B8MA 5FY1A 4XQ4A 1VAVA 3WNMA 2VKDA 3S8PA 1UKRA 5EJ3A 2CL2A 4MNUA 3KCYA 5CVUA 1C28A 3CMGA 2V1DA 1L7QA 4O3MA 1OLTA 3LDRA 5HCFA 4A3CJ 4UNOA 4GGGA 4AEKA 1LEDA 3BWGA 2LD5A 5L9VA 4LO4B 2GNTA 1P7JA 4BQWA 4JTOA 4PIYA 2HTSA 4WM7B 3NNJA 3KB5A 4AYUA 2EVXA 2MPFA 2VUMJ 1SLCA 2BBAA 2DI3A 2KLOA 3CF2A 2F6CA 3W58A 2TBVA 1JTXA 1K3IA 3O12A 4PDKA 3DLAA 1JI6A 1JYIA 3OPZA 5DG2A 3ABTA 5DDJ1 3EXUA 2NVUB 1FOD1 2O61A 5F08A 4BXXJ 3FIWA 3IPVB 1QOSA 5KXBA 2J1AA 1JKPC 1CX4A 3JQXA 1FYLA 1VMJA 4URTA 3J7AO 2QEXI 2JDNA 1CIYA 3S6PA 3OYAA 3RS6A 1H9PA 4U36A 5CFCC 2QZ3A 1KS5A 4PDWC 4XRFA 4RGSA 3CJIC 2FRHA 3TRSB 2DBNA 1AA7A 4Q8KA 3EQLF 3Q9VA 5JZGC 4BQOA 3MZ8A 1X58A 2HWC3 1G3SA 4BIOA 1RTVA 2JUCA 1I3AA 3PUAA 2V1XA 4IRIA 4R9AA 2XAUA 4Y4RA 3WR0A 1S7OA 3DU5A 3MLJA 4XFCA 4QDSA 2EALA 4BQ3A 2IS2A 1ONVA 1TWHJ 5EXOA 1P4AA 3SYTA 3HEIA 4QAWA 3DBHB 2X85A 2PMUA 1COV3 2VUJA 2PMZN 1GNYA 4DY3A 2G1MA 3CUQC 3S1NJ 4RQPB 5FZ4A 4QPIA 1WVRA 1FMD3 1PGL2 4FOYA 4C2MJ 5L7OA 1MGTA 3CCEI 3T1MA 2IW5A 5JSOA 3CKHA 4W8JA 3ECQA 4WVZA 1R1UA 1I3QJ 2ZNZA 2XJVA 3R4UA 4G7ZF 5E20A 1BOBA 3HEFA 2IXCA 4ZYDA 4IL7A 2F5FA 2D6LX 2R063 1D1BA 3A03A 4FPHA 1R4MB 2L9NA 2J1SA 1KEXA 1NCRA 1QWRA 4XQDA 4XK4A 1Z77A 5LHIA 3X2QH 4GRIA 1GWLA 2WS93 3ZXAC 5D8AA 2WAQN 2E1NA 4CDQB 3H9GA 1W0TA 4WX9A 2WWYA 1TMF2 2W3JA 3HSFA 3E6DA 4ZU4A 3HOYJ 3K4JA 2RNJA 1B09A 4JKMA 3U10A 2X05A 3OMYA 5BNGA 3AKPA 4M3CA 4B4RA 5IYBJ 2DJIA 4XTMA 2PLV2 4Q5SF 4A6OA 1AR91 5FXWA 3TEXA 4A3IJ 1J0RA 4B43A 3FMQA 5CISA 3KP2A 3RZKA 4AVPA 4CZSA 1RC6A 1W5TA 1PO22 3A0NA 3M8JA 3A2KA 3WTWC 4RM2A 5FWJA 2NAZA 4HSJA 4XCBA 3ZFFC 2IVIB 3I59A 4BQXA 1EY2A 2BUKA 1H9TA 3BTZA 1SQ4A 2RMU1 3IZOA 1JYXA 3HXLA 3OOUA 4OHVA 4O6JA 3P6BA 2Q8CA 4L9BA 1H88C 2D97A 4BLIA 3BY6A 4OUEA 2OQ7A 1MS1A 4DRVA 4MH0E 2K9MA 5A6YA 2VJ5A 3BG3A 1J84A 1RUJ1 1PIV1 2BU9A 4A0YA 4GB33 1UMQA 1O6UA 4J25A 4L0ZB 2RS11 1RI7A 2P6HA 3ACGA 3E6CC 1B9NA 4E8CA 2MC3A 4A12A 2W0XA 3MPPG 2HDDA 3BG6A 3CDLA 2G4IA 4LITA 1GZTA 1BYHA 1VRH2 1C8NA 2DT7B 4Z6YA 1YYNA 3QACA 3SLIA 5IVJA 3PSFA 4X1EA 1N3PA 2QQKA 4I0WB 3WQBA 4KU8A 3VLBB 2JG8B 3O1RA 2AQEA 3F3XA 2VUAA 3GBGA 4M3GA 3ABZA 2JDKA 2YU3A 3Q5FA 3WUCA 5CVRA 2A6ZA 3HQRA 4MLOA 3UNPA 1J3QA 3EPZA 3GBWA 2ME6A 2L5QA 4RR3A 2BGCA 2CGPA 5LK5A 1T6SA 3G4SI 1VP6A 1HJGA 3ROUA 1QQP3 2WT0A 1FYMA 1OCPA 2X5IA 4YFNF 1U0JA 3TL4X 2W94A 4DOUA 2NYXA 3ZXDA 2QKMB 1X1BA 3P7NA 2VKEA 2DQRA 1WW4A 5HLGA 1CJPA 1W7PD 2QVOA 2VE9A 1JKOC 1Y7BA 2Q1MA 1D8JA 3N3HA 2P3YA 1X8MA 3H9AA 1HJFA 3OSDA 5FLXK 1W9WA 1DP0A 4GWNA 2OQGA 1PGW1 4N43C 2HWC1 4CA9A 2CGNA 4GH4A 2VU9A 1ULGA 1A8DA 2B63J 2Z4FA 5FXVA 2ZMNA 3FBIB 2GWRA 2V6EA 2K5CA 1T95A 3AKRA 4L5JA 1J9IA 1O91A 3QQAA 1RYYA 1XYPA 5B4XA 1COV1 1OKRA 3NMBA 3NAPB 2DVDA 4INDA 5L36A 1LQ1A 1RUD2 5FQ0A 1FMD1 2XPVA 1MIJA 1GKBA 4QU1A 3FBNB 1DQ2A 5M5XJ 1OPCA 3OEAA 2FBEA 5H9PA 1ZZBA 2GNBA 4R8HA 1SLAA 3ZFGC 5C5TA 2GC3A 2OC6A 1FP1D 1R1VA 2VC0A 5IY5H 2R061 2M45A 2XRLA 2PJPA 2R49A 3AAFA 1RRJA 3MEXA 5GZGA 4CTEA 2WJSA 2WS91 1R58A 4QQPA 1F8VA 3GDBA 4CCLA 3BZKA 1LHOA 4QX8A 1Q8QA 2NPIA 5DAVA 4GWJA 3CJNA 1V9U3 1UMHA 3HNYM 3OY8A 2PQSA 3FE5A 2R5ZA 3VOEA 2QDRA 4B7EA 2VBDA 2JIGA 3TAYA 1PDNC 4YGBA 1DZTA 4BDVB 4E2GA 4ZY9A 1XB9A 1R22A 4DFSA 4H55A 1CGPA 1JUIA 4LHSA 1UX6A 3Q3SA 3OPTA 1GUUA 2D7FA 5KK1A 2HQAA 4CUGA 4XTPA 4JVAA 3OGJA 1UIJA 2YHJA 4OZOA 1LGBA 3OY9A 3FHIB 3J9SA 3NRVA 3KS7A 2M1BA 2X8KA 5FO7B 1OUXA 4AD9A 3RKQA 1K12A 3TP3A 5IK4A 4GALA 1Z91A 1TLHB 1LR5A 2JA7J 2UV1A 1PK6B 1QO0D 2MFZA 2HWB3 3FMSA 3DXTA 3SEPA 1UU6A 4KGGA 4M0HA 2PELA 5E16A 4PBPA 3LDKA 3RWNA 2VTXJ 2UY9A 1JZ6A 1QZZA 1V00A 3QPSA 1OD3A 5FP3A 2C6SA 4AFAA 1VZ0A 3QH6A 2V7FA 2P34A 5LA0A 5HDKA 4YFWA 3I71A 5E17F 1YX5A 4GB31 2QQPA 1HDDC 4YIIA 3ZYRA 5ABJB 3QP6A 3W6KB 1YFHA 4V2VA 3WDYA 4H2AA 3RZHA 4BMEA 2ISYA 3WP6A 1WA6X 3GTQJ 4DS0A 5LB6A 3WU1B 2LUWA 1NCQA 3TP0A 3VGIA 3HG9A 3TGNA 2H94A 4RB1A 3GYDA 5B66C 2VJIA 2NYYA 3GFLA 3JAMK 1IG7A 4FOVA 2DTZA 2W1WA 2P37A 4QXBA 2IXIA 4NVPA 1TZLA 4XOTA 3B73A 3K7AJ 3LA7A 5BPXA 3R0AA 1TME2 2W1QA 3F95A 1VBE3 1KQRA 3OOXA 1IV6A 1QQP1 2JECA 4CXYA 2BOJA 2GN3A 2K46A 1R5GA 2VVDA 5DXDA 4QHBA 4BEHB 1AJOA 4DO0A 4XLAA 3T8TA 3VKMA 3Q9OA 4OIPF 2WNOA 4XMIA 5KHKA 5A3LA 1RKWA 3DTKA 4XF0A 1ST8A 2RS53 3THTA 2BWCA 4JX5A 5FWEA 3ORJA 4LXLA 2TRTA 1YLFA 1PX3A 3QRFF 4LO5B 1EV12 5B3SH 4FXGB 4CEYA 1XMKA 5LBQA 1UYXA 5JR3A 3PVNA 4CXFA 1E5HA 4I2OA 3ZSEA 4OMDA 4HKWA 2JIJA 1S0JA 2XGXA 4ZZLA 3TDUC 3ZMZA 1MMAA 1G9AA 2Y0SA 2LRPA 1SLTA 4XURA 5KC5A 2M0MA 2PHWA 2BVVA 3A1YA 3THCA 3MAJA 2YR2A 5A3OA 5J8FA 4QDQA 4AI9A 3UL2A 4NE9A 4NNJA 3Q8EA 3O3KA 2ENRA 3LPFA 4LG3A 3CD6I 3KSCA 1G4DA 4K8FA 4A3DJ 1VAMA 3NARA 4CU9A 1W0OA 1IPKA 2PMHA 1R083 2XAGA 5F32A 2VMIA 4AE2A 2AXLA 2KJBA 1ERDA 1N75A 5F1JA 4L9NA 3M3IA 3LEIA 4CVUA 4M3BA 2ZGNA 4KYWA 1VQNI 2LM3A