3I54A

Crystal structure of mtbcrp in complex with camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
224
Chain Sequence
LYFQSHMDEILARAGIFQGVEPSAIAAQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 66
structure length 224
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i54A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i54A01
3TNQA 1IN7A 3MQ0A 4WBBA 5HVQC 5JFRA 2A6HF 5DCMB 3WTYC 1Z7UA 1RTVA 4HA8A 2IRFG 2FBHA 2BNOA 3E5XA 4FAHA 2OAZA 2PG4A 3MDPA 3WTWC 3H1YA 4ENMA 3FMQA 1KYWA 2A3SA 2E1CA 2VODA 4D7SA 2DO7A 2PHLA 4E2GA 1IXSB 4JV4A 3HSEA 1ZZ9A 2YPRA 1YW9A 4ENNA 1XCVA 3ECHA 5L3EA 2HTSA 4EM1A 3BWGA 3BP8A 1SAXA 1B4AA 2XHKA 4PCQA 4WXHA 3R0AA 3SZTA 2HDCA 2KIUA 5LGTA 4HLXA 4JBAA 2IPQX 1ZGAA 1IN8A 4HDUA 4IJAA 3WGHA 4X6QB 4LGWA 3D0SA 3GZ6A 3HUGA 2DU9A 2QLZA 4I98B 3ZPLA 2HR3A 4D7TA 1SMTA 2HQRA 1KU2A 1NHAA 2DFIA 2XVCA 5H6RA 2PMHA 3OOPA 2D45A 4ZYHA 5J48A 2B9UA 3TDUC 4RB3C 5I0TA 1BC8C 3RPUA 4M72A 3HQXA 3MZYA 3HOSA 3EYIA 2EFWA 1NYWA 1FZPB 2V1UA 4B29A 4FX0A 3MCZA 4L9JA 5CU1A 1SFXA 2ZMEA 4OFGA 2XRNA 4ZZLA 3HSRA 1U12A 2P17A 3U2RA 2DAOA 1PM7A 3ES1A 4YFKF 2Z2SB 2JTVA 5IT9K 3TGNA 1ZVFA 1XSDA 2VT3A 1YLFA 2UWMA 3I54A 1FPQA 1XSVA 4PDKA 4LUKA 5A2QK 5EFUA 4KFCA 2G7UA 3JTGA 1D3YA 2FMYA 1J75A 2EFNA 5K8SA 4RGSA 1BIBA 1HKQA 2XKPA 2ZMEB 4N0BA 3V4GA 2IC1A 5I0RA 3W6KB 1U6GA 2CGPA 2A07F 5C6CA 4Q48A 3HIFA 1LNWA 4R52A 2D5HA 2NAZA 5D6EA 3SHFA 4EMSA 5FFZA 2A5YB 3M7GA 1TLHB 1OKRA 3QU3A 3I58A 1MGTA 2K7LA 4WVZA 3D0JA 1SFEA 4ESJA 1HKSA 3LFKA 3WTSC 5BPXA 4M6XA 5JSRA 3SXYA 3R4KA 2IT0A 2P5KA 1WSUA 2V1XA 2O8QA 4HVQA 2OPKA 4I02A 1J7KA 4L9TA 1X7NA 3DP7A 1TNTA 1ZG3A 1VTNC 1SD6A 4JK1X 4RB2C 4IHTA 1FNNA 4CHUA 4XFBA 4LFUA 2RKHA 1R5HA 1SEFA 3CJXA 5JAXA 3IWFA 4I3PA 2DPUA 4ZH4F 1MJAA 5D5WB 1FX7A 2ZO4A 5H6QA 4B09A 4HQMA 1HQCA 2BV6A 1S3JA 1EH7A 2FEZA 4U0WA 2E1NA 4H0EA 4XEZA 3QPHA 4RGXA 2H0VA 5ICCA 3FE5A 3U10A 5F1RA 3WW2A 2PA7A 2ESNA 3OV8A 4HV5A 1D8JA 4G8XA 1GQHA 1T6SA 2K02A 2QNKA 4GCVA 3IRQA 1Q1HA 4RGRA 1H0MA 3OCPA 3SMHA 4KWKA 1UPIA 2O0YA 3DF8A 4YIFA 1WWXA 4GYIA 1LJ9A 5KBFA 1YFYA 5ICGA 3MPBA 2ACJA 3EJKA 2MPFA 4Q0UA 2MLGA 4L9VA 2VC0A 2WTEA 4AIHA 4OIQF 2O03A 2IJLA 1P2FA 4FBFA 1H9GA 1VJ2A 3J81Z 3IHUA 3WE2A 5E1XA 3N97A 4G9YA 4HBLA 1KGSA 4B8XA 4MGYE 4O3MA 3RYKA 1QGPA 2E9QA 4M9XA 1FOKA 2VBWA 5IT3A 5TRDA 4ZYGA 1QZZA 2M45A 3LQRA 1ZYRF 2QQ9A 3JW4A 2Y0MA 2PHDA 1IW7F 2V9VA 5CVVA 3MZHA 3RKWA 2RDPA 4IRGA 3T8TA 1QQIA 1TBXA 1YFUA 1RIOH 2IW5A 1UCRA 3I0TA 3KEOA 1ZRDA 1BN5A 3DPLC 2P5LC 2C6YA 2PMUA 4R1HA 3QOPA 5HLHA 2BNMA 1FSHA 3C1DA 4OMYA 2QVSB 1SFNA 1Q3EA 3IWZA 4P55A 1FYMA 5CVIA 4WCGA 3V7RA 1QBJA 2H09A 2PLYA 2DLLA 4META 5DYMA 4D0PA 3F8MA 3I64A 2EVXA 4PJYA 4M9SA 3LA2A 1R36A 4XSZF 1ZLKA 4AD9A 4LK0F 4E2QA 2PN6A 5LGNA 3RYRA 2QYOA 1TQ5A 2NNYA 1IUYA 2ETEA 3PQKA 4CGZA 1BI1A 3EHKA 3FM5A 2JT1A 1ZG1A 4A5MA 3OGJA 1FXZA 3LZZA 2JPCA 4NVPA 1ON2A 2K4JA 5ICFA 5CADA 3SHRA 4EJTA 4GYGA 2EA2A 1ZGJA 3F8FA 2D1VA 2X4HA 4O5VA 1OYIA 4Z2YA 1V70A 4OU0A 1OPCA 3E6MA 3F8NA 1S7AA 1UW8A 5FFXA 3LA7A 1YFWA 3UKTA 3C18A 1R1UA 2Z9OA 1UFMA 3RIRA 3N4MA 1L0OC 2KIMA 3H9AA 2TDXA 3B02A 2GC2A 1XDSA 3V7CA 4XETA 3GUDA 3E6DA 4UV9A 2EA7A 1J59A 1ONVA 5AONA 3BJ6A 1MD0A 4P5OA 3SCHA 2ZKZA 1G3YA 2CAVA 3M1EA 1STZA 5K5OA 2QUFA 3BU7A 5EEGA 1R58A 3IC7A 2JPBA 3KEQA 3NQOA 1XMAA 3BCWA 4IEZA 2Q30A 3WODF 4XBFA 4Q0VA 4KDPA 4P96A 1IXCA 3RJPA 4WXDA 2HEOA 2P6TA 2EAAA 2DBBA 3JZVA 2PFBA 4HBNA 3CO2A 2DQRA 2F5EA 2JSCA 3CTAA 2HYGD 1G3SA 1WGPA 2UYAA 4MGKE 4NB5A 1ULYA 3L00A 4XF9A 3QU6A 1MJBA 4KT5C 1BJAA 3KP3A 2XKOA 2MHFA 3M8FA 4HMZA 3DPTA 4IEPA 2WFPA 2EWNA 3BOQA 3IDBB 1FY7A 4XFHA 2VBYA 3H1MA 1ZHFA 3GYHX 4ORFA 4HSJA 1IF1A 1CGPA 2PTMA 4MQ9F 1V4RA 1TQIA 3PVBB 2JRTA 3IDCB 4L11A 2EFOA 1IPKA 3KP5A 2MA3A 1E2XA 1YYVA 3RKXA 2GXBA 1S29A 1OFNA 4GULA 1F9NA 5HDGA 3NEUA 5I8TA 3HTUA 2VQAA 5D4RA 2UYBA 4IXAA 4IEXA 2G9WA 1W5TA 1B9MA 1RC6A 5E8GA 1HXDA 5D1IA 4ON0A 5K5QA 1DGRA 3ZMVA 1KA8A 5BPDA 2HOEA 2EFQA 6PAXA 2IA2A 5K5RA 1H9TA 2V6CA 1HSTA 4KYWA 3FHIB 1LRHA 2QBYA 2B5HA 3Q9VA 3J7AO 2XAHA 2MD5A 2WV0A 4LUMA 2L4AA 1W7PA 3GWZA 3PQJA 4LD5A 4RGUA 2RGVA 4A6DA 5LRSA 1BI3A 3ECOA 3ACLA 3OTFA 2PQ8A 4J1XA 2ISZA 5CLSA 1VP6A 3FZVA 2HGCA 2H6BA 5DV5A 5LBQA 1ZZ7A 3FFQA 3Q5FA 2O1QA 1T98A 5FLXZ 2QBYB 3ES4A 2FRHA 2L02A 3H50A 2IXJA 4XFIA 1W7PB 2GA2A 2HJIA 4MUVA 3USSA 2CAUA 1K79A 1K78A 5BQTA 1U5TC 5BV6A 2RC4A 1YFXA 3FZ3A 3COAC 3GFLA 4KL1A 2W57A 2K27A 1AWCA 3C7JA 1ODDA 5F64A 4XFFA 4I0AA 4UXNA 4Z07A 4KMFA 3F3XA 4HX8A 1QNTA 1ZRFA 4IETA 2FQPA 4GXOA 4XF4A 4LB6B 4BH9A 1OYWA 2M87A 3CUQA 4KWLA 2EK5A 3DXJF 3SCGA 4IF4A 1K78B 3NRVA 4NHJA 5E18F 2D93A 1YO5C 4I2OA 3F6OA 4U88A 2Y75A 2ET1A 2HQNA 3ABUA 3SZPA 3VFZA 3GVAA 5E8IA 3IKVA 2BYVE 4MEYF 3K1PA 1FBSA 2ZNYA 4M74A 3CLPA 3U1DA 3F8CA 1WA4A 2VPVA 3JSPA 1I1GA 3F8BA 3KLNA 4XLPF 3CUQB 3ZN1A 3T5XA 1KU7A 2DK5A 4PGHA 1W4MA 1UCXA 2GC0A 4KA4A 5JCTA 1RUNA 5LHHA 4UBHA 3I71A 1WI9A 3F23A 1XMKA 2W85A 1AOYA 3D5LA 3NSTA 4XF3A 2NYXA 5BPIA 1R1TA 1ZZ6A 3FMSA 2ZFWA 1H1MA 3I59A 4KIBA 3U0ZA 2HZTA 4HF0A 3BY6A 2XV4S 1SD7A 1USTA 4MGZE 2IP2A 4IEWA 4ZYEA 1B1BA 4OIPF 2F2EA 2RQPA 5FDBA 2BE5F 5FO5A 3L2CA 1RGSA 4CDGA 5KHJA 1NZCA 2QJVA 1XGOA 4PGGA 4WK8F 3G3ZA 2CO5A 4XF0A 1MZBA 2RVCA 3CF6E 1USSA 4O9GA 2CYYA 3ZMUA 1U8RA 2X0LA 4QLCU 4QM9A 2GZWA 1RL3A 3I59B 4G94A 4P9UA 1O7FA 1TQMA 2DI3A 3UKNA 1XSXA 5ILVA 4F7ZA 3HT2A 4LMYA 4S05A 2QQBA 2VE8A 2PJPA 1R1VA 2EV6A 2HYFA 2P6SA 3BB6A 3I7DA 4QGNA 4ASNA 1KU9A 5HI0A 2JZYA 4YG2F 1BC7C 5ERIA 2B8MA 4UNOA 5AIQA 1MJ9A 5FLIA 1R23A 2YSRA 2M5WA 1FP2A 2ZNZA 3TO7A 2R7DA 2LKPA 2MH2A 4Q5SF 2Q4SA 1I1SA 4Q29A 2F5CA 1DPRA 1K6OA 1Q5OA 3DEUA 3ZN0A 3WTVC 3T0YA 4M71A 1P4AA 1EY2A 5EZWA 3R61A 4LB5A 1GQGA 3CLOA 5D8KB 1EV7A 3TO6A 3KCCA 3M9AA 1RNLA 2E7XA 3MWMA 4U7BA 1EH8A 3O14A 2NNNA 3H1WA 4EM2A 2A69F 2FBKA 3EQLF 1UIJA 3HTSB 5FQ0A 2VBZA 3FHZA 1TNSA 3P9CA 3V7SA 1S6LA 3RYPA 4DINB 3EO6A 3J81K 5E1WA 2J5OA 2DPDA 2ET7A 2XAFA 4CO8A 4DNCA 2A61A 3NVCA 4WX9A 3RPQA 1FT9A 2OZ6A 4BHPA 3CDHA 1IAWA 4BIFA 4IRHA 3LAJA 4R8HA 3HSFA 2XAGA 3K1NA 4EM0B 2IXCA 4HLTA 3O3KA 2HKXA 3O2PE 5BMZA 4G6QA 3HRTA 3L7WA 3PLQA 2O61A 5FQ0B 1E17A 2AS5F 2F4PA 2STWA 3VOEA 2P8TA 1ZX5A 2HKOA 2VC1A 3CUQC 2V79A 3KZZA 3P9KA 3WTZA 1H1IA 4YNIA 5I8SA 1Z91A 4MZUA 1FYKA 1Z1DA 4L0YB 5D6FA 3H7YA 5L3FA 3WW4A 1J5YA 4EROA 2PAEA 3H3ZA 4WXCA 1B9NA 4KIGA 3GFIA 3ULQB 3HT1A 5FGMA 1O57A 5EEHA 4P9GA 2PBIA 4Q47A 4I01A 4MGRA 2L54A 5FB2A 1P6RA 4K8FA 4A0XA 3B73A 4HVOA 1YTYA 2HFHA 3QP5A 4Z82A 1XDUA 1DDNA 3WU0A 3EUHA 2STTA 5HS7A 2RV8A 4QM8A 4OLLA 2H27A 3WTUC 2D1HA 4ENJA 1BI2A 3ROUA 1PDNC 2P4WA 4HDVA 1A04A 1R5GA 3DFGA 2QVOA 2W25A 3S7EA 3CJNA 4XFGA 4ZYDA 2RNJA 2K86A 2K4BA 5KHIA 3ELKA 1CAXA 1NXMA 3E6CC 3P7NA 2ETHA 4JTNA 5BS6A 5F6FA 4BHCA 4RAYA 3BPVA 3KGLA 2YU3A 1HW5A 2L3DA 4IRIA 1FI2A 2ESHA 1X8EA 4G7HF 3OF1A 3WE3A 1R22A 4L5JA 4R79A 4I0BA 3R0JA 2FF4A 4KIFA 5J3UA 4OOIA 5AIPA 3DQVC 2LF8A 1F1ZA 1ON1A 1U5TA 2Q0OA 1BI0A 1LEBA 2Z99A 1CAXB 1YS7A 2QQAA 2MC3A 2CSOA 4HF1A 3EDPA 3ETQA 1SMYF 4NQWA 2EB7A 2IVMA 2AXLA 2FE3A 2IA0A 4ETSA 3FJSA 2ZKLA 3HHGA 2HWVA 1DZTA 4A12A 4YARA 2MLKA 3IBMA 2FNAA 2O6GE 4AQ6A 1EYBA 1QXRA 4EV0A 1U5TB 4L9NA 2XLFA 3GBFA 1J3PA 4FX4A 2XAJA 1OR7A 1JHFA 2FBIA 4IESA 1MKMA 2M8EA 3VB2A 4UVCA 1EP0A 2KKOA 1JE8A 3DN7A 3ZQ7A 4EJVA 3AAFA 4KN4X 4IEOA 4YFXF 2QENA 2HTJA 3EQEA 2NS0A 2P7CB 1HKTA 3UKVA 5DD4A 4IPAA 1UD1A 3WW3A 5TJJA 3ZDSA 2OU2A 1W7PD 1EPZA 3ELNA 4L5IA 3HOTA 2GC3A 4LA2A 5KK1A 1OYYA 1JUHA 2PAMA 3WTTC 2R3SA 3NL1A 1X82A 3PNAA 1V3FA 5D4SA 1YS6A 3I5UA 4AXOA 2R7FA 4CYDA 1LR5A 4Y17A 4XFCA 2QWWA 2FNPA 1CX4A 3KE2A 1XE8A 1JHHA 2OZJA 1ZARA 4MHGA 3V8JA 3IRRA 3FX3A 4A0ZA 1G4DA 5L3DA 3GFMA 3WGGA 2QZ8A 3TQNA 4QXKA 4G7ZF 2CV6A 1ZRRA 1YIOA 4KU7A 3TKYA 5ED4A 4OINF 3IKTA 1G3WA 3O6BB 3KSCA 5KHKA 2M1BA 4OMZA 3ML6A 4LG0A 2V09A 5JR3A 1Y3TA 2G7HA 5D8LB 5JSPA 3V8KA 3KETA 3GYDA 5CVRA 4EVIA 3JAMZ 3ERED 5FLXK 1ZZBA 5HS9A 2DQLA 3VHRA 1MDMA 5J8CA 2P5VA 4BNCA 5DCFA 1ZZCA 2ELHA 4UUVA 1IPJA 3R6SA 4EGYA 4KUMA 3K0LA 4XRFA 4HVRA 3FM3A 2PAKA 4LG0B 1YHFA 1Z9CA 4AVAA 4KN7X 4YSFA 1K7AA 2XLGA 2VECA 5FPXA 1GVJA 2XROA 1XGNA 1MDMB 4H7LA 3TDZC 2J5PA 2FSWA 2DCTA 1DUXC 5E17F 1HSJA 4IERA 3GX4X 3BDDA 3GW2A 4LLNA 2XL9A 2ISYA 5HOOA 1Q43A 1T38A 2UZKA 4EGZA 1T0FA 1QWRA 5L3BA 2OA2A 2CW0F 3FWEA 4G7OF 1JXSA 2MNGA 1SD4A 4K2EA 4EWAA 1TW2A 4QWQA 1ZNPA 3WGIA 4JQFA 4LEJA 2XL7A 1FBQA 2RN7A 4OIOF 3GXOA 2PYTA 1TW3A 3S2WA 1LKNA 2CWEA 3D82A 1OI6A 4G6DA 2L4MA 1XRUA 2A68F 2Z5UA 2LDUA 1CAVB 1RUOA 5I91A 3QAHA 3J80Z 3DL3A 4MV2A 4HLYA 2MH9A 2KRFA 5T3NA 5L3CA 5JVTA 1QPMA 1F4KA 3VEPA 3ST7A 3S0MA 1IRFA 4BXUA 3E6BA 4GO1A 2Y0OA 2FXAA 2C0ZA 2D40A 5HDKA 4FT8A 1OD5A 3GFJA 3LQQA 3RNSA 4UXAA 3IIAA 4ZU7A 1J58A 3HHHA 1LB2A 3KGZA 4IEYA 2EJRA 1UIKA 2NRAC 1ZAOA 1J3RA 2WC2A 1PP7U 4Q0SA 1X8MA 1SD5A 4YRDA 3KP2A 4WZCA 4BHBA 2V1DA 4IEVA 1S7OA 4AVPA 4ESFA 2CG4A 2MBFA 5DUKA 5FD6A 2W84A 2GAUA 3GZ5A 3CO7C 4LA3A 4BQAA 1SQ4A 1S8NA 1ZG5A 2YX4A 1O3SA 4I7HA 4E2SA 2GIVA 3QACA 4UHTA 5CJ9A 2QDRA 4UBGA 3FXQA 4RD7A 2YX7A 4HW0A 1P4XA 2Z69A 1UHMA 2IXHA 5LHIA 4O9EA 1REPC 1Z05A 2GA1A 3NKTA 3F72A 4L2NA 4MQVA 4YFNF 5FLHA 4KU8A 3T8RA 2H94A 1ZN2A 1J9IA 2K0GA 2GC1A 2LSOA 4AVBA 2OD5A 3F22A 1FBUA 5E1RA 5CVJA 1EH6A 1ZRCA 2Q8KA 1B6AA 2XGXA 1PUEE 4Q0PA 2L01A 2UY9A 2A6EF 5JI6A 1IN4A 3CEWA 5E1ZB 3G73A 1XGSA 3C3VA 3E3VA 2CQKA 1QZYA 3KZYA 1O5LA 3JSOA 4L18B 2GU9A 2PEXA 3FF5A 4E70A 3WW1A 1TQPA 2XLAA 1XCBA 4IEUA 3GLXA 3FXUA 4ENKA 1NE6A 3CUOA 4ZU5A 3DV8A 2VN2A 4PIYA 3ISPA 4AIKA 5DEQA 5L3GA 4BAYA 3BJAA 4ZU4A 1YFHA 1DZRA 4AVCA 3BZ6A 4F8AA 3NW4A 5BOXA 3HRUA 5HLIA 1XGMA 1T39A 4IEQA 2P7VB 4S04A 1WKMA 5IT9Z 2FOKA 3MFKA 5ICEA 4EWEA 5J6XA 3K9TA 3OD0A 5BXXA 4JTOA 3E5UA 2IXLA 5FD5A 2E7WA 1YQAA 3ZMDA 4XSXF 5A2QZ 2VONA 2QM3A 3KP4A 4LLOA 5FLJA 2XAQA 3M3IA 4MTEA 1P4WA 2EFPA 3RZZA 4TLFA 2GWRA 1DGWA 4XF1A 4HYEA 3WU1B 1L3LA 3RTRA 5FCCA 4KNYA 2BEOA 3WG9A 2PFWA 4ESBA 3U9GA 1YW8A 2Q0AA 4MX3A 5BY5A 1G3TA 4AIJA 5E16A 2LF7A 4ZZDA 4PIZA 1P92A 2H6CA 3MYXA 4LLGF 3NJZA 5HLGA 3L9FA 2K9ZA 3ZMZA 1G6NA 1R00A 1ZZ8A 2OQRA 2Q2EA 2VXZA 4M9ZA 5CYVA 5JHUA 4MTDA 1IRGA 1KU3A 1Z6TA 5C8WA 3RI4A 4EJWA 5DD8A 3CL1A 3F21A 2IXIA 1KQ9A 4U7DA 4ONUA 2LNBA 5ILSA 2WWYA 4FAGA 3LAGA 3LWFA 3W6JB 4HV6A 2N7GA 3MEXA 1FLIA 5AVPA 4UVBA 4FHTA 4OIRF 2PI0A 2BGCA 3SXWA 4A2UA 1XB4A 3LSTA 2Z3YA 3QPTA 4U0YA 4YYOA 3K69A 1YLLA 2KXLA 5E20A 2PQQA 3ABTA 5J8FA 3H3UA 4MEXF 4AQ2A 1FP1D 3BROA 4RB1A 3I4PA 1LQ1A 3E97A 1U78A 5LLQA 2Z33A 5D5VB 1WRJA 5LHGA 1W5SA 4Q0QA 1WLTA 2O3FA 2IA1A 1PMIA 5I93A 1GXQA 4Y15A 5DDGA 4HSLA 1KQ8A 1HW1A 3EETA 3K2ZA 4QX5A 1TTYA 5HS8A 3L2HA 2M30A 4HF2A 2QCSB 2ZBKA 1IN6A 4LTAA 2Y48A 2BBYA 3VODA 1CF7A 4UV8A 1XD7A 4LJZF 2VBXA 4YIIA 5I8YA 3SFZA 2KJCA 3QP6A 1L3JA 3BALA 3KFWX 2F5DA 3ZMSA 3F6VA 4WF2A 1ZREA 4AWXB 3LWCA 1KYZA 2UXXA 2I45A 3REOA 1XE7A 4WWCA 3ZMTA 5JR7B 4M6YA 1J3QA 1ZLJA 4LLLA 2XIGA 2YR2A 2FU4A 1YW7A 2XASA 4XLNF 1D8KA 3M70A 1X3UA 1CF7B 3WTXC 4XFAA 1O7LA 4A5NA 3JTHA 4BYYA 1GHCA 2FQ3A 2VOPA 2UY8A 2DTRA 1JGSA 4HX4A 4HX7A 4JVAA 4M73A 5I0SA 3IL2A 3QRFF 1QY4A 4HQEA 1I27A 1YUDA 4MH0E 3T1BA 1FWZA 1I6XA 2KIFA 3I53A 1LDDA 2W24A 1D5VA 4HZFA 5HDNA 4EJUA 3DKWA 4RAZA 1T2KA 2VOOA 5H20A 5BUVA 1IXRC 2DW4A 3C3WA 3H92A 3Q9SA 3HRMA 2D5FA 2KJBA 1O3TA 2F5FA 4HOBA 3LAPA 1J2XA 3M8EA 3HRSA 4EJOA 2VE9A 2HS5A 3G7DA 1CAUA 4J1WA 2ZXJA 4QMAA 1OMIA 4EWDA 1LEAA 4RB0A 4A6EA 4HN1A 3JAMK 3GF2A 4HAMA 1C0WA 4O6JA 5LRRA 4LULA 4LK1F 1GXPA 3GEZA 2OZUA 1O4TA 1PP8F 2OA4A 1O3QA 2UXNA 3ZP5A 3SCFA 1I5ZA 3BJOA 1B59A 1HBXG 4EQQA 5I0UA 3CO6C 3MAJA 1DP7P 1ZH5A 2ADUA 4U0VA 2B0LA 3GO5A 1CAUB 3HYIA 3EYYA 5FPZA 4UVAA 4MNUA 1LVAA 5DUIA 2OQGA 1SFUA 2GXGA 4GGGA 5LEJA 2XUBA 2IXKA 2DT5A 3LA3A 5D5XB 3BPXA 1DPUA 1J1LA 4KMUX 1VR3A 3TNPB 3BPZA 1BIAA 2FA5A 1NE4A 1O5UA 2DK8A 1UB9A 2BNNA 2GQQA 3PFIA 2FMLA 3FMRA 5ILUA 3FXRA 3H7JA 2EA4A 5KHGA 3KLOA 3SQNA 3R60A 1IN5A 2ZJ2A 2CFXA 1HW2A 1LDJA 1YWKA 4PZJA 4TV7A 4CZZA 1QXJA 3K1MA 3KP7A 2COMA 3E5QA 3KP6A 4IVNA 3P9IA 3TO9A 1Y0UA 3S7IA 4CICA 1BBYA 3TOBA 5LGUA 1U3EM 5D5UB 5J7MA 3J80K 3V8LA 4Q4ZF 4KWJA 1KQ0A 4KICA 4QGLA 1RI7A 4N9IA 4MGIE 1FSEA 4RS8A 2D2WA 1FYLA 1FC3A 4I09A 1XN7A 3KMHA 1CAVA 4CXFA 5K1YA 1CAWA 3LOIA 2ZCWA 2OBPA 4A0YA 2GH2A 1F5TA 2Q1ZB 2VT2A 1BM9A 4N9HA 2EV0A 4QGMA 1J0RA 5DCMA 1IZ1A 4L0ZB 3RKYA 3RDIA 3EBRA 2EV5A 1YG2A 3H8UA 1QO0D 1LDKB 3U11A 5KHHA 5LEKA 2O8XA 1WQ2A 5JSOA 5CVUA 1Z6RA 1O3RA 1UHWA 1U2WA 4X6RB 2ATFA 1Y9QA 1BOAA 4IHSA 1CAWB 4P9FA 4PIXA 5KVRA 4HN0A 4DQ2A 4Y13A 2OYZA 1RZ4A 1R7JA 3TOAA 3L09A
chains in the Genus database with same CATH superfamily
4OQ8A 1IN7A 5HVQC 5JFRA 2BERA 1UY3A 4LIVA 5JMOA 5GZGA 4JQTA 2ZGMA 4FAHA 3E5XA 1B8IB 1UOJA 4HOOA 3WTWC 1IPSA 3ZIXA 1AU7A 5IVYA 1GOFA 4PI2A 2E1CA 3VBHA 2OQ7A 5T54A 3OIQA 1V55H 2X29A 1X36A 4AYBA 3FXJA 4HK9A 1YW9A 3GCMA 3PIJA 4M3EA 4ZTJA 2V72A 4QXCA 2RM21 5F0HA 1WMEA 2V73A 4XICA 3AYDA 1BMV2 1X2MA 4CH7A 4DPNA 4NIGA 1KDMA 2XHKA 4WXHA 2YY1A 3LNQA 1DQUA 4NC8A 3SZTA 4X1EA 2O14A 1PVEA 3SEPA 2LD5A 3VBHB 3MIDA 4TXWA 1E3PA 2BHZA 4Y1YA 4I98B 5M0TA 2QQJA 5H9QA 5IYCJ 2HQRA 3ZR6A 5A3UA 3OEBA 4F3JA 5H6RA 2D45A 3I8TA 4A45A 3TDUC 1WCQA 3I2HA 4M72A 5M5XJ 1M1EB 3AL0B 1JYCA 1S0FA 3HOSA 2V6EA 4XDPA 4FX0A 1V6MA 3VZLA 2KL4A 3S8PA 5IVJA 2DT6A 2KLOA 4W50A 4FPCA 5FZ7A 4NMIA 2K2SA 3NJVA 1PM7A 3ES1A 2Z2SB 2JTVA 5E3OA 5IT9K 2RMU2 1O8SA 2CQ7A 3MKWB 3BIEA 3PL0A 4PDKA 1D7PM 3EUAA 5DG1A 2UUZA 4JKKA 5EFUA 3S32A 2FQ4A 2G7UA 3JTGA 1J75A 1PO13 3SZGA 3F2ZA 4RA0A 1BIBA 2XKPA 5I0RA 4PJLA 1RUH1 4MOAA 4WVVA 2CGPA 5C6CA 2A07F 1TL8A 1DGWX 5FK8A 1QA6A 2XJVA 2W39A 4QKDA 2NM1A 4J19A 5D6EA 5FKCA 2CWSA 1GWMA 2JDZA 4EMSA 1KZHA 1RHI2 2QQLA 3R0RA 1QJU2 2K7LA 4ESJA 5FJKA 2JIJA 3IH3A 1L7QA 3R4KA 2IT0A 4L0PA 2YS9A 1W05A 2P5KA 2V1XA 1GWLA 1BK0A 2IS4A 3FKIJ 1V6NA 1JZ5A 2LMDA 5CAZA 1NLSA 2YBPA 1JH5A 1SD6A 1KONA 3GTGJ 4CHUA 2HDWA 4UW4A 2X6XA 2RKHA 1FPN2 1R5HA 1LULA 3CJXA 2LALA 2VVDA 4ZH4F 1MJAA 3VB9A 3UNGC 4HXCA 3TMOA 4B09A 3CCJI 2P3KA 1HQCA 2D6NA 5D2AA 2RHPA 3H0OA 3J7MA 4H0EA 1RINA 4XEZA 4CCNA 1MBEA 3ABMH 3WG7H 4Q4W1 1YX5A 5ICCA 5EZGA 1UAAA 1ODMA 2ZXQA 3OV8A 4WM8A 3IH2A 2YC4A 2WT0A 3SJMA 3Q0UA 3HNYM 2VPRA 2B63J 3SFIA 4K6BA 2IWGB 3DF8A 2LP0A 4K40A 5A32A 3MPBA 3DXUA 3VPRA 5KCMA 3C7OA 4DIQA 2MLGA 3I2FA 1REDA 4L9VA 2R7OA 2WTEA 2GH8A 4HNVA 1P2FA 3FN9A 5FZ9A 4QU2A 1VJ2A 2WZEA 3IHUA 4YVWA 3ACFA 5E1XA 1HN0A 3N97A 1JZ8A 3ZPOA 4WM8B 1KGSA 1QGPA 1FOKA 2P5BA 2F6CA 5IAXA 1T6GC 4OHVA 5DAXA 1H6XA 3WUDA 1XSQA 5A32B 3HGYA 2Y0MA 3POJA 2PHDA 4AEDC 3AX4A 3BN6A 1TBXA 3GBWA 4YVWB 4RHV3 2P5LC 3DPLC 4P08A 2C6YA 2PMUA 4CDWC 1MS3A 4Q1RA 5G05L 5HCHA 2WYSA 3IWZA 1SAUA 3FUOA 5BNNC 4YGBA 2H09A 2PLYA 2DLLA 5DYMA 4YM2A 4D0PA 4F93B 4PJYA 4EATA 2NZ9A 1LOEA 3I4IA 4E2QA 2PN6A 3BCBA 1GICA 1AYM1 1A6IA 3EHKA 3FM5A 1K83J 2JT1A 4HSTA 3MICA 1IG0A 4RN5A 1EPWA 3RQ0A 1IUFA 2GP5A 2R043 3F8FA 1T56A 1MBHA 3LDBA 4Y1XA 4Z2YA 1V70A 3O8HA 1S7AA 4JX4A 1UW8A 3AKSA 4G12A 4E4DX 1C1FA 2VTXA 3O0XA 5HCBA 1UFMA 1AL21 2A73B 3X29B 2K9SA 1NOVA 4OMCA 3WDWA 2QQPA 2GC2A 3V7CA 4GA9A 4XIDA 4GKYA 4XETA 1DGRN 1WJ5A 3S5QA 4YW2A 5AONA 3ZQIA 3LFUA 1ND3A 2D6PA 2XF5A 3C7EA 3WDYA 1EV12 1YNAA 2DJNA 3SCHA 1TNFA 4L8QA 1OPMA 1QQP3 1R092 2ZXWH 4IHYA 3K4KA 5K5OA 2WBMA 2QUFA 5FREA 4Y7NJ 2KQRA 4MXWA 3KEQA 1AX0A 3WR0A 4Y4YA 1D4VB 3IN9A 2D97A 3MIHA 4KDPA 3V56A 5FY4A 4Y4RA 3RJPA 2B7EA 1ND3B 4XL9A 3OL3A 3V0AA 2MGQA 3FDYA 4CSWA 1I3AA 3JZVA 3H9JA 3JRIA 2TEPA 4MXWB 1X4OA 2RAEA 1WD4A 2VOXA 4MGKE 1OD3A 4NB5A 1ULYA 1U8BA 4DYRA 4RSUA 4XRSG 1QJX3 2UV1A 4MHUA 1VBC1 5T5LA 4E4SA 3KF3A 4KT5C 1TZLA 3M8FA 4HMZA 2UU8A 5GKAC 1FY7A 1C8M1 2VBYA 2DUOA 3V0AB 4LK7A 2Q8EA 4NWVA 1IF1A 2HOTA 1SEUA 4MQ9F 2ENRA 3PVBB 4NPLA 2EFOA 3MGUA 5C4XJ 1IPKA 3T30A 3CDIA 2X5IA 2MA3A 1YYVA 2GXBA 5LY1A 5KC6A 1F9NA 4YEJA 4RGAA 1UZYA 2SBAA 2VQAA 2VE1A 2UYBA 4IXAA 2JQ7A 1W5TA 2RVAA 5JLWA 4ZHNA 1FOYA 3OBAA 2M0MA 5BPDA 6PAXA 2IA2A 2HPMA 5K5RA 5FIXA 4KYWA 1V00A 2DU1A 5CBLA 1PK6C 4EQVA 4IOCF 2BOIA 4AEJA 4CDQA 3Q9VA 1H2NA 2LK2A 2W87A 2X5IB 1RUF3 4Z92B 3GWZA 4FOVA 5LRSA 1BI3A 4AI9A 1EUUA 4XTPA 3RZGA 4A3LJ 4NBQA 2MEV1 2R072 2FX0A 2HGCA 2W95A 1W03A 1XNKA 4Z2AA 2VJXA 4QQOA 3Q5FA 2O1QA 5FLXZ 1UL9A 3RKQA 4GALA 1V6LA 1YO8A 4CDQB 2FRHA 3VL9A 4G6TB 4CCLA 1RR8C 1CZSA 3B00A 2ZB9A 2RC4A 3COAC 1J83A 5EPAA 2W57A 1ULDA 2K27A 5EHDA 1F15A 4XFFA 1TC3C 3TEDA 3ASIA 3ORJA 1TZOA 2CW8A 5DM7F 5FZOA 4NHKA 4GXOA 2VI6A 4LB6B 4BH9A 1E0EA 2M87A 3CCMI 5C3PA 2IS6A 4AFDA 4KWLA 2EK5A 3DXJF 4X8PA 3ACGA 4IF4A 3NRVA 3H1CA 1GT0C 2Q1FA 4HONA 4I2OA 3H9QA 3IDEA 2Y75A 3ABUA 4BB3A 3PNYA 1C5HA 2BYVE 5FP3A 5A1AA 1QPIA 1RPWA 1NG6A 3L2UA 3CLPA 3U1DA 3F8CA 2JG9C 3BPSA 5FZOB 1PO21 2AGSA 4GRIA 4XLPF 3T1MA 2DA3A 3T5XA 4A3FJ 3HR9A 2WUHA 2BXYA 2CHHA 3ZQFA 3WUCA 1UCXA 1RUNA 3FMGA 2P4EA 3I71A 1WI9A 3TEZA 5FZ6A 1SMVA 2W85A 5CFCA 1UG2A 1R5ID 1GZWA 2PXJA 2NYXA 3ZFEA 3DKQA 1H1MA 2C9KA 3HEIA 2IZWA 4OI0A 2WV1A 1H2MA 3SDGA 4HF0A 1LHNA 3OYGA 1K5MA 1BBT1 1H4HA 3CESA 1OH3A 2IP2A 3LEGA 3WP4A 5K0UA 3J8F3 5FO5A 2JVHA 1RGSA 4BQXA 3JRGA 5FOJB 2CO5A 3J7NA 5CFCB 4MIMA 1GZWB 3ZFEB 2RVCA 2CYYA 4I0WB 1U8RA 1ASJ2 2V5YA 4QM9A 2GZWA 1AYN3 4FFGA 2RREA 1TQMA 2V5DA 1XSXA 2VVFA 1UZZA 3S1QJ 1K5MB 4S05A 4Q8KA 1RUC1 3ZKUA 1NT0A 4AQTA 4QWNA 3I7DA 3BB6A 5K0UB 5FKKA 1KU9A 2JZYA 1BC7C 1JOPA 3DPRC 3BYWA 3OIOA 2BW8A 3C2UA 5AIQA 1JUMA 2M5WA 1F35A 4IV1A 1TMF1 1E3HA 3SKJE 4M3CA 3WVJA 2ZGTA 2WT1A 4NN0A 4CXWA 1Q5OA 3CP8A 3DEUA 4KGQA 2Y38A 3WTVC 1A8MA 1KS4A 3T0YA 2VZQA 2HYJA 2QQWA 1P4AA 1GSLA 2VGDA 4PJMA 4HKOA 2X48A 2ZGLA 4YZ4A 4QQ2A 2KT0A 3OIPA 3KCCA 3M9AA 4CUAA 4E7ZA 3A22A 2NNNA 3H1WA 3HTSB 4JX0A 3N35A 4YLZA 4IV1B 4FQZA 2YFZA 4DINB 4Q4X2 1Z7LA 3J81K 1G9CA 5E1WA 1HKDA 4M3CB 1XS9A 2PX9A 2XAFA 5FFOC 2MABA 1NXD1 2OZ6A 1JYIA 1VNDA 1ERDA 1VF9A 2RDSA 3HQUA 4C91A 2I74A 4PK4A 3K1NA 4AL9A 2DWRA 5F2WA 2H1KA 3ZMOA 4G6QA 5KR7A 5C33A 3PLQA 3AG4H 2R7RA 2QKMB 1W0NA 1I50J 4II2A 1ZX5A 1PZ9A 3CUQC 1H1IA 4YNIA 3GHMA 4IGOA 1FYKA 1OUSA 1U5YA 2DFCA 4N4OB 2B9VA 4PI0A 3H7YA 3WW4A 1SCRA 4XMYA 1RUG1 5GPCA 2JICA 2VC9A 4BISA 3GFIA 3ULQB 3PMEA 3N9MA 5FGMA 1O57A 5IYBJ 1FIPA 3VD3A 1RVF3 1ONAA 3ESWB 4GJYA 4A44A 2ORZA 2YZ4A 2D7FA 1XC5A 2BOLA 2RS33 3B73A 5F32A 1YTYA 1XDUA 3WU0A 2XG3A 4MVTA 2EALA 5HS7A 3VHNA 2JVGA 4OLLA 3WTUC 2D1HA 3NKGA 3HOUJ 5A6ZA 2DYRH 3FUQA 4HDVA 1A04A 4UWDA 3GTJJ 4XK4A 1GVDA 2OS2A 1D0YA 2E31A 5C44J 1QOOA 2RNJA 3Q3SA 3NNMA 2VUMJ 2VQ0A 3ZN5A 3J9SA 5GLZA 2HWE2 3LSRA 2BJSA 1RMU1 1ZRIA 2VVEA 3PSFA 1ST8A 1ZBE3 4PLOA 3BCAA 4BE1A 2WADA 2YU3A 1QMJA 3VDDA 4AEKA 2WO3A 2BPA2 2M7AA 3QYEA 4IDZA 2FF4A 5FBJA 4BLJA 1TME3 5FO7B 3DQVC 3MBWA 1Y39A 1ON1A 4IX7A 2Z99A 4S2GA 1PIV1 2QQAA 2CSOA 3K4JA 3LL7A 4FPFA 5FZ3A 5FRAA 4BE2A 1CX1A 3EDPA 1UO9A 4Q4V1 1VBD1 1SMYF 1W36C 3VGIA 2IVMA 1NK3P 3U75A 2AXLA 1CR7A 3VDDB 3OEAA 2FCVA 4ETSA 2W52A 2X1DA 3FJSA 4MSVA 4A12A 4CEYA 2RE9A 4L5EA 1FOD2 2RR13 2O6GE 3WF4A 5DQ0A 2F4LA 1T2XA 2BTVC 1U0JA 4GIQA 2W92A 2XLFA 3TW7A 3GBFA 1HRI1 4FX4A 2NPIA 3DXTA 1OR7A 3O1RA 5B2GB 1MKMA 1LOCA 2XVKA 3WG4A 1IG3A 2B46X 2EXKA 3VB2A 3VKFC 2KKOA 3FHNA 3BG5A 3DN7A 4RS5A 2BRTA 2QZ2A 3AAFA 4ES8A 3N36A 1ODNA 2HTJA 3VD4A 2P7CB 1IV6A 4CEYB 3AZWA 2SLIA 1YI7A 3HD8B 2DCJA 4W6XA 1BR2A 5TJJA 5EGOA 2CS3A 3ZDSA 3DEWA 2ARXA 3JD71 2GC3A 5KK1A 1OYYA 2JENA 4CU9A 3LSIA 2PMZN 3PNAA 1X1BA 3S57A 4RS5B 1ENXA 5AC93 4Y17A 4N53C 1NAEA 3MMYB 4QAWA 2OZJA 5FO8B 2J42A 3W59A 3FX3A 2WNOA 4WV8A 3PJYA 1G4DA 1AR92 2HWB2 3GFMA 3WGGA 5EGOB 2JB4A 1NCRC 1C5IA 2BVVA 1YIOA 4KU7A 3MLLA 3EXUA 1AR63 3AVRA 1G3WA 5KHKA 4BQYA 1SACA 2M1BA 2CWMA 2JDNA 1FOWA 3ML6A 2V09A 2IFWA 3TL4X 3ACHA 1ULFA 1XU2A 1Y3TA 1MS4A 1JYWA 3OSDA 3V8KA 3GYDA 1GNHA 3JAMZ 2L9LA 1ACIA 2DQLA 3THTA 1LUJB 2P5VA 1AXYA 1SFPA 2RNGA 1F4AA 1SVLA 2ELHA 4UUVA 1UELB 1R083 1WVRA 3I49A 4A3DJ 3R6SA 2Y64A 5C4WA 4XRFA 2L9RA 1VQ5I 5FY8A 3H3LA 5D8AA 3FM3A 2PAKA 1JKOC 4AVAA 4PSXA 4YSFA 2XLGA 5FPXA 5IT6A 2XROA 4OI1A 5CEHA 4XQWA 5GLUA 2FSWA 1D5YA 5A7SA 1HSJA 2BWAA 4CDXA 3BDDA 5HOOA 1POV3 4EGZA 1QWRA 5L3BA 4Q4Y2 2OA2A 4BQOA 3N9OA 5C4WB 3FWEA 4G7OF 2D6KA 5D8AB 2ZX2A 3LQCA 1C1LA 4QWQA 1ZK8A 2A70A 1IO2A 1LE8A 4C90A 4YVSA 2QQOA 1TG7A 5H9RA 4OIOF 3GXOA 4NWWA 2HXOA 3O8GA 4CCDA 3QBQA 2L4MA 1SLTA 2VIXA 4CDXB 1V9U1 2ZEYA 1YI2I 3J80Z 3DL3A 4HLYA 2MH9A 4UI9L 3WG2A 2BBVA 5JVTA 1DU3D 3VEPA 2VJIA 2JA7J 4BK4A 3S0MA 4BXUA 5GLTA 3DCFA 1LE8B 1D1BA 4URAA 1Y6IA 3AP6A 2ADDA 4YVSB 2CW7A 1Q8VA 4GH4A 4UW5A 1CIYA 2YGLA 1PX3A 4ZY9A 3LQQA 3ALQA 1J58A 1X9PA 2XJPA 1TNRA 1FNYA 1BK1A 2YU2A 1UX7A 2JK3A 3ZSLA 2FHRA 2KRHA 1DU0A 1QJY3 4XN3A 1E3OC 2V1DA 3BR1A 4JCKA 2A3WA 1DQ6A 5JPMB 4GH4B 4ASLA 2MBFA 5DUKA 1XSRA 5F5CA 1E5SA 1V0AA 1DYKA 4N4NB 1IRZA 5DXDA 2E53A 1K6YA 1O3SA 4JP0A 2MD0A 4UBGA 3FXQA 3RQ4A 4LG3A 4RD7A 2YX7A 1A8DA 4QPGC 3LFMA 5CKQA 1P4XA 4XORA 2ZMLA 2IXHA 4XKVA 1FATA 3M3YJ 4L2NA 3JRHA 4UY8I 4WVMA 3VKMA 1NH3A 2GC1A 2VNVA 3LDRA 2OD5A 1FBUA 2DF7A 1ZRCA 4Y1VA 2Q8KA 1N1VA 4QQLA 2JDUA 1X1DA 4JDMA 1PUEE 4HG6B 2L01A 3U4SA 5JI6A 2B9SA 3CQZJ 1XGSA 4AI8A 3E3VA 2DJIA 2CQKA 1QZYA 3FBMA 1IRXA 2L2OA 3CMGA 3FF5A 4WVMB 3KHBA 4BUPA 1WJAA 3S16J 3FXUA 2F5VA 2WO2A 4JRLA 2XJUA 5L3GA 2O8OA 2VMHA 1HXS2 5K4LA 4ZU4A 3OYLA 3DLLF 1YFHA 5FYVA 2JSPA 3MUY1 4YWAA 4AVCA 1ENHA 2VCMA 4F8AA 3NW4A 2QQVA 2WQ4A 1UPSA 1W9YA 3HRUA 4Y5TA 2QTWB 2HPIA 1GBGA 2P7VB 4D5CA 2FOKA 5FLVA 4B7EA 2YXSA 1HQWA 4RYDA 4MG2A 4LPLA 5BXXA 4OZXA 2IXLA 1YQAA 3GXUA 5A2QZ 5F6KA 3BR6A 3MIFA 1UN1A 4LLOA 4PT6A 4CCCA 3SH4A 2EFPA 4FVVA 2BXZA 3CJRB 3RZZA 4HYEA 5FCCA 1JBCA 4KNYA 2MYSA 3AMHA 1RUI2 4C2MJ 2PFWA 2VM9A 2LROA 1ZBA3 1YW8A 4MX3A 4AIJA 1R1A3 4PSWA 3AMPA 3ZYHA 3ZR5A 4I3GA 5H9PA 4FCYA 5LWBA 3ZMZA 1OLTA 2XBO2 1R00A 3K10A 4CEWA 2OQRA 3INAA 4DXTA 4XYXA 1R49A 4M9ZA 2IVIB 3HAGA 5C8WA 4ZPIA 2DUPA 2DVBA 1GV9A 2IXIA 3CDZB 3AJYA 2ZKNA 1VQ9I 4AF9A 2LNBA 3MLKA 2GSYA 2DCYA 1W3XA 3LWFA 4QPWA 4IKFA 3MEXA 2UWAA 2YG0A 2WNVB 2B4KA 1QDCA 4UVBA 2BGCA 4Q4X3 2RS11 1BVVA 3ZYBA 4CEWB 1F36A 3NNJA 2NP0A 4DEQA 3K69A 4P9LA 2KXLA 1LJ7A 1W9FA 3R05A 3H3UA 3AL0C 2R061 1U78A 2F4IA 2VJ5A 5IVVA 1W5SA 2E51A 4XABA 3O1OA 4AM3A 1I6HJ 3O1PA 3G4SI 2OW4A 2IA1A 4BPZA 3DTIA 5J1XA 4NO4A 3CCVI 2VULA 4PJJA 3LSEA 4IW3A 3JB4C 2K40A 3MZ8A 1TTYA 3L2HA 4GXLA 1BOBA 2ZBKA 3HBLA 3LEMA 5HODA 1CF7A 5JOXA 3R4SA 3T0AA 3SFZA 4ZJZA 2KJCA 2D3RA 3MIGA 1AR81 5JXJA 1AF9A 4LO7A 3KFWX 2F5DA 4AFBA 3N9PA 3MI8A 4HT1T 4BEHA 1C57A 3MO4A 3LWCA 2UXXA 2I45A 3G6EI 3H5RA 2W0XA 4NHLA 3DBRB 4M6YA 1PZ8A 3ENRA 4DZPA 4A3BJ 2RM23 2ZHNA 4ISRA 2VXJA 2XASA 5J37A 4KG8A 1CF7B 2VXDA 4GZ9A 4A5NA 1DQ1A 2E1MB 2FCUA 1BJQA 2E6VA 1X1PA 2VOPA 2UY8A 2DTRA 1JGSA 2AC1A 5DDJ2 2E2HJ 4M73A 2P34A 4BEHB 3ZIWA 1CJDA 5LBBA 1QOSA 4HQEA 1YUDA 4MH0E 1FWZA 1I6XA 5A7QA 1D5VA 1YITI 2VY0A 3GTPJ 3PUAA 4M3GA 2VOOA 3AMMA 5H20A 4YRVA 3C3WA 3L2QA 4AGGA 1IQDC 2WZPP 2G19A 2CU7A 3AP4A 5AFEA 3J7AY 1LOFA 1HLCA 2AQEA 4JGYC 5G04L 4EJOA 2HS5A 3G7DA 2VZTA 5BNQA 1JN2P 1ZA4A 1BR4A 1W9TA 4EWDA 3K4ZA 1VBE1 2W08A 1C0WA 4SLIA 3HZJA 4QXHA 4OHXA 2R6QA 4LJHA 1TP4A 1O4TA 2OA4A 1O3QA 2UXNA 3ZP5A 5F27A 3WNLA 4BQNA 3SCFA 1B59A 5LK5A 5I0UA 1HV1A 4XNFA 1XNCA 2BP6A 1MEC2 3BTZA 1PNFA 4IQJA 2XPWA 4WM8C 1RUH3 2QQ8A 4UVAA 5C71A 1LVAA 1PVC1 4BK5A 4QIWN 4XHBA 1XXNA 2A5WA 5LEJA 5FR3A 2DT5A 3LA3A 1SC7A 2HWD2 1JJ6C 3SNMA 4B43A 2YMZA 1R6RA 3KYLA 1RUG2 5ANQA 1NE4A 5IYYA 4XAEA 4YVWC 5SV8A 5GADJ 2BNNA 1UOFA 4F83A 5F3EA 3H7JA 1IN5A 4AYBN 2GBYA 2P3IA 1YWKA 1YEWA 3BTYA 4BACA 4CZZA 5D21A 1S55A 2C6SA 1Y56A 3B9CA 3GNEA 3ZR8X 4YPJA 5IWFA 3M3CA 1CD3G 3TOBA 5LGUA 4FFHA 3NRUA 4Q4W3 5A7WA 4A3MJ 5J7MA 4Q4ZF 5CZKA 2WFF2 3ZXJA 4KWJA 4QGLA 3BODA 4HFSA 4ARXA 2ZHLA 3KMHA 3WINE 4CXFA 1S1AA 1X50A 4ZONA 5JR2A 3B69A 2GH2A 2IVJA 3M3OA 1TWCJ 2EV0A 3O5SA 4GB32 2FDFA 2XC7A 3TBDA 1W8OA 3AG2H 5HBAA 1A6QA 5A7WB 1LDKB 3O1VA 4BDVB 5IYDJ 3KVBA 1VAMA 5A6QA 1POQA 2O8XA 1EAH2 1UHWA 1U2WA 2ATFA 4HRIA 4IHSA 5KXBA 2XQXA 2R5YA 1STMA 4DQ2A 2OYZA 1DQ0A 1V6OA 3NJYA 1RZ4A 4FPEA 1VE0A 5TSWA 4V1PA 1RUD2 1Z7UA 5IK4A 3CC7I 4HA8A 1JTZX 1DYOA 2FBHA 2BNOA 2EF6A 1MMSA 1U5IA 2OAZA 3MDPA 5EF6A 4ENMA 4QB1A 3F9KA 5C3QA 2A3SA 1ND3C 2VODA 1LHVA 3WDTA 2DO7A 2R5YB 4JDOA 2VCAA 2OT7A 4H3WA 2WR9A 4HSRA 4JV4A 3KV5A 1PGW2 4QKBA 2C1FA 3NV4A 1AYM3 3C2HA 3R4DB 4C9YA 1LAJA 3O1MA 4EM1A 1ZYBA 1N3PA 4FO9A 3PURA 1RJ8A 4MFEA 1W6QA 4OUEA 3R0AA 1Y1WJ 3BOWA 2HDCA 3BR0A 2QA4I 3FIWA 5B4XA 3GLLA 3AMQA 5FJHA 1IN8A 2YGMA 1FMWA 4HDUA 1JI8A 5I0DA 3WGHA 1UZCA 2ZAAA 3GZ6A 2QDNA 3LOBA 2VO5A 1KU2A 1NHAA 2XVCA 4UB8C 2KHMA 3OOPA 4DXSA 3BTXA 1LENA 5J48A 2VQHA 2B9UA 1IS5A 4RB3C 1AL23 5I0TA 1TWGJ 1GR3A 1VB4A 5FZAA 3WD5A 1IV8A 1Z7S2 3H5AA 3EYIA 1W6QB 1JUIA 4B29A 3MCZA 4L9JA 1H88C 5CU1A 5LD2C 2XRNA 5IK8A 1NQDA 3UESA 2P17A 3U07A 3U2RA 4LKSA 4CUBA 2DAOA 2WA0A 3TGNA 2DMQA 1XSVA 1D0XA 2X5IC 2J1VA 5APAA 4KFCA 3D5RC 3H5NA 3AB0A 2WSUA 5K8SA 1SFOJ 3CF2A 3TN92 3V4GA 3IUOA 3IMMA 3BTCA 4DOZA 5HV4A 1F9KA 4Q48A 2C4XA 3PO3J 2WLQA 1WKYA 4GMP1 3LGRA 2D5HA 1BQPA 4YGCA 1AZDA 4CDQC 1XYOA 4COUA 2DTZA 1TLHB 2E5ZA 1XTAA 3I58A 3QU3A 1COV2 3OS1A 4WVZA 3LSPA 4M6VA 4H14A 3SKVA 3BR3A 3WTSC 1VBC3 4M6XA 5JSRA 2KIQA 5IPAA 4B1RA 2RDRA 3SEQA 2TBVA 3NV1A 1GP4A 1MBFA 3AZXA 1C8M3 4I02A 1VRH2 3DP7A 1DBNA 1VTNC 2NYYA 1WPKA 1FNNA 2C9AA 1AVBA 3IWFA 4I3PA 2DPUA 5D5WB 2ZO4A 1UYXA 5T55A 3M8LA 4HQMA 4LBOA 2DFBA 2BV6A 2HYKA 3MF6A 3ZXKA 1UMQA 5FMBA 5GJ6A 3O0WA 3FE5A 3O1UA 5F1RA 2EAKA 2ESNA 1HDDC 4DJAA 4DUXA 1YJNI 2K02A 4UFMA 3IRQA 2AQFA 1Q1HA 4RGRA 1H0MA 4M01A 4XMAA 4P9YA 3OYHA 3QPSA 1UPIA 3BTJA 2O0YA 4YIFA 4GYIA 4LHNA 3OOXA 5KBFA 1LGCA 4IQ4A 1YFYA 2ACJA 2RJLA 3M1HA 4AIHA 2IJLA 3VZOA 1H9GA 1OA4A 2Z79A 4A93J 4BDYA 2MEV3 4HBLA 2QFEA 5F7UA 4B8XA 3FL7A 4MGYE 1ND2C 4O3MA 2E9QA 1NKGA 4AWDA 3LMMA 4A3ZA 2WZR1 5GZCA 3FHAA 1QZZA 3N9LA 1MSFC 2QQ9A 1T6BX 2V9VA 1QQIA 1RIOH 2IW5A 1UCRA 1YJWI 5CFCC 4XKWA 1EJ9A 2ELJA 2X9DA 1C4RA 2BNMA 5GAEJ 4BQQA 1D4M2 2NVUB 1SFNA 4P55A 1FYMA 3DCQA 4ITCA 1K5MC 3I64A 2EVXA 3VDXA 3DYMA 3ZFGA 1G59A 4YGDA 3LA2A 1R36A 1FMD2 1ZLKA 5K0UC 2ZMEC 4KWUA 4LK0F 4DUVA 5JZGA 1APLC 4AIDA 3RYRA 1V6KA 2OCEA 2QYOA 2ETEA 4CGZA 1GZCA 2KDZA 2LFBA 1BI1A 4H2AA 4LE3A 4Y5Z0 5A70A 4ZXEA 2FZ2A 2J7MA 4NIAA 3RJRA 2XR4A 3RRDA 5FLMJ 3VZMA 4AG4A 1ON2A 2PQSA 4L9BA 3SHRA 2Y0IA 5E89A 2CV1A 4QDQA 2EA2A 1ZGJA 1QH7A 2D1VA 1WCKA 2CUZA 2CYFA 4QQHA 1DGRM 1ULCA 1PO23 4OVEA 4DYQA 3ZFGB 3E6MA 3F8NA 3HNBM 3BG9A 2CV2A 3D6EA 5JZGB 4CCOA 3CZUA 3C18A 2Z9OA 4B47A 4IV1C 3N4MA 1L0OC 3H9AA 5JOWA 4FI9A 1EUTA 5ANNA 1OVSA 3GTLJ 3CCEI 3K4LA 3ZXGA 1J59A 4WZFA 1ONVA 2XRLA 4K1ZA 1BBT3 2NMNA 1ETWA 3S15J 1QJEA 4P5OA 3VHOA 5GPAA 3FXOA 2X6OA 2MW8A 4C8DA 4GAZA 4M3BA 2IGOA 1NCQA 1QJZA 2WY7Q 1IKPA 3BU7A 3HNMA 5EEGA 2YU1A 4NHYA 2E36A 1VZ0A 4IEZA 1BEV1 5FZDA 5EEAA 5C5TA 2XB0X 2LW8A 1IXCA 2HEYF 1NY71 4V2GA 2JDKA 1WCUA 1RUC3 3UGGA 2EAAA 4GKXA 5A3MA 2UWCA 4MLOA 2YPDA 3MV01 3I4MJ 2WA4A 2DBBA 3L1PA 2PFBA 1NCQB 3CO2A 2DQRA 2F5EA 2JSCA 1LODA 4NPMA 2D6OX 2ILMA 1TMF3 1G3SA 1WGPA 2UYAA 2YUEA 5M3FJ 3PNTA 3K4MA 2PN5A 5FKNA 4XQ4A 1MJBA 3B5LB 2NLRA 2GXAA 2MHFA 2ZFUA 4P5HA 3NAPA 2EWNA 4U36A 3AFKA 1GP5A 1Z78A 3PMSA 5F0FA 4ORFA 4H7MA 1N1SA 2O0OA 2VUDA 1CGPA 4ASKA 1TQIA 1IJWC 4B48A 1VBA1 1AR71 3J7ZI 2WN2A 5DZEA 1GNYA 4L11A 3K3OA 2Q8CA 4B3XA 1OFNA 4Q27A 5E88A 2JD4A 3G1OA 4XE9A 3RGBA 3QLQA 5I8TA 3HTUA 3VBRA 3RJ2X 5E3LA 1QVUA 4R9AA 2BU9A 4FOWA 2Y6KA 3A0NA 4YG6A 3GZUC 5L9BA 5E8GA 3NAPB 1HXDA 4QPIA 4ON0A 4IXLA 2LH9A 2RS51 5KHDA 2HOEA 5J47A 3WSOA 2O7OA 4QX7A 4JRAA 2VZRA 2CMPA 2BGPA 1LRHA 2QBYA 1QNWA 4K3UA 2LTNA 2WV0A 4FETA 2WAOA 2L4AA 2ZGSA 1SBEA 2TNFA 2M34A 3PQJA 3VBRB 2RGVA 4A6DA 3RZJA 3ACLA 3JXSA 2PQ8A 2YPJA 4AUXA 5IFTA 3OYAA 2ISZA 1JYNA 1VP6A 4K8RB 5JIAA 1I5PA 4QPIB 2NMOA 2P1BA 1WJDA 3WQ1A 3BG7A 2J1UA 1YE9A 2H6BA 1OLRA 5DV5A 5LBQA 1QVTA 2QBYB 1RUG3 3C8XA 5FPLA 2QCOA 1SFYA 3AKPA 2IXJA 4A3CJ 2HJIA 1K79A 5M3MJ 1OSGA 4IE0A 4FTEA 5BQTA 5BV6A 1GWKA 4COWA 4E4HA 5FZBA 4KL1A 3M07A 2VQCA 4BJ5C 1AWCA 3MW2A 3C7JA 3E1F1 5F64A 4I0AA 2XAUA 1YIJI 1QNTA 5CQEA 3QODA 3V0BA 4AHYA 3MFCA 2JEMA 4BZ4A 3KCXA 2PHRA 4CEYC 2DA1A 3CUQA 1JZ3A 1CQ9A 5FYZA 3TOJA 3ZLIA 3SCGA 5LZ6A 4O65A 3PVOA 3UV9A 3CCSI 3U14A 1RMU3 2CV0A 5JUVA 3U4XA 3GVAA 5E8IA 5EJ1B 3IKVA 5EZHA 1OR7C 1IKQA 1ULGA 2A75A 1QH6A 2ZNYA 2DN0A 4M74A 5BNOA 4RS5C 3V0BB 2X09A 2VPVA 3JSPA 3I56I 2VZ3A 1U9OA 2ZXIA 3FFZA 3KLNA 2DMUA 3CUQB 3AC0A 2ECCA 1N1YA 1PO12 2GC0A 4A6OA 2YV8A 1LKXA 2VJJA 2JG8A 1PIV3 5C3OA 1KFXL 3T1LA 5BPIA 4LORA 1G86A 4Q4V3 2QSGX 2UURA 3DUIA 4YW5A 1VBD3 3RMXA 2YROA 3I59A 1LFBA 5BNOB 3U0ZA 3LPFA 2XV4S 2RDNA 2GDFA 1SD7A 2HXIA 2WLPA 4MGZE 3MKLA 3B93A 4IEWA 3PTRB 2RQPA 1AKHB 5FDBA 4LMFA 3B3QE 4YG3A 3T0DA 5FYCA 4MXVA 2VPLA 3VSKA 1D1AA 1NZCA 2JG8B 1XGOA 1HRI3 1WH5A 5B4NA 2L7KA 4UFLA 2VW0A 4XF0A 1RXFA 3CF6E 1USSA 4BS9A 4O9GA 3ZMUA 1UXXX 1RL3A 3I59B 4G94A 1O7FA 1F2NA 1VQ4I 1WLDA 4QPOA 5ILVA 1Y1VJ 4LMYA 4KMQA 2QQBA 3WDUA 5KXCA 3HDDA 2PJPA 1MS1A 2ARBA 2EV6A 2WNUC 3KYCB 2B8MA 3VYSB 3ASNH 3SDBA 4AVVA 3ZXDA 5LATA 1JT6A 2DTYA 3JD73 3BR2A 3MHZA 1FP2A 2JJ6A 2XJSA 4YM1A 5CKNA 2Q4SA 3CC2I 4Q29A 5D8AC 1AHDP 5FOBB 2VMDA 1ULPA 4M71A 1WZ2A 1EY2A 5IOYA 5EZWA 2BQPA 3R61A 1GQGA 3CLOA 1EV7A 4LK6A 2ZGOA 1FMVA 1CQTA 4PUSA 1EH8A 5KXEA 5LA0A 1UIJA 3EQLF 2G4IA 3ETPA 2VBZA 2K46A 4DO0A 3VBOA 3W9AA 4CDXC 2E32A 2FCTA 3JRDA 4CO8A 4DNCA 1R64A 2A61A 3DYOA 2VW1A 2HZDA 4WX9A 4N90A 3O7OA 4IV3C 4BIFA 2DYSH 4IRHA 3AJZA 2XB5A 4R8HA 3HSFA 4LNVA 3D1NI 4XHXA 1P7JA 1OF3A 3POWA 1WJEA 3KT1A 3O3KA 2F48A 4DMIA 4Z2WA 2O61A 5K7PA 4RHV2 1UY4A 3VBOB 4BE3A 2AS5F 2IGMA 2EIDA 4LHSA 2F4PA 3VOEA 1TWFJ 2P8TA 3NQHA 1H0BA 1S7EA 2XHNA 2NQYA 3P9KA 3WTZA 1B35A 5I8SA 2D43A 1Z91A 3N7JA 4Y22A 1Z1DA 5C3RA 4D7NA 2NOGA 3MKZA 2A5ZA 3K77A 5E6HA 3GDBA 1UOBA 4LOTA 1J5YA 5IK5A 4GH4C 2PAEA 4IHVA 5FZKA 3WCSA 3ZQQA 1QRYA 4Z8BA 4KIGA 3BIWE 2VCBA 3VBSA 3ZN4A 1BCXA 3CJQB 1P6RA 2R042 1B35B 1POV0 4BMBA 1WH7A 4HVOA 4Y22B 4Z82A 3WXPA 4DB5A 2J1RA 5JXIA 4JHZA 1H1AA 2R30A 2H27A 3B6CA 4TYSA 3VLBB 1BW6A 3ROUA 2OV7A 1PDNC 2OF7A 2P4WA 1OCOH 1R5GA 4OHZA 4BA6A 2QVOA 2W25A 1V9U3 5JXGA 3VBSB 3CJNA 4Y24A 4XFGA 1MS9A 4ZYDA 5F2SA 2K86A 2V4VA 4MYEA 1CAXA 2W91A 1NXMA 2JDAA 1WZXA 4CTEA 1Z3XA 2R7ZJ 4GDFA 3GTKJ 5TGTA 2GNTA 1QQP2 3IM0A 3AKRA 1NLRA 1R22A 3CLQA 2HVSA 3S93A 1VBB1 2C24A 3HEFA 4I0BA 2ZEWA 4OOIA 2JB8A 2LF8A 3WP6A 2Q0OA 4QHBA 1BI0A 1LEBA 1CAXB 1YS7A 1MPXA 1GDTA 1REFA 3TP3A 4FXGB 3OYEA 3LDKA 5GZEA 3K7AJ 1RITA 1OBNA 1VQ6I 3AP9A 1V5FA 3CNAA 4MHRA 4E7IA 2EB7A 3B6AA 1POGA 3URFA 1GNZA 1ENQA 4M3CE 4TSVA 3RI8A 4AOCA 3HHGA 5HPOA 2HWVA 2OUJA 2B42B 2MLKA 4C2UA 3IBMA 2FNAA 3OD4A 3CDLA 4FE4A 2LBFA 2HH9A 4EV0A 2PLV1 1QJX2 2G1MA 1HRV1 1XYPA 3JCIA 1GOGA 2XONA 3LSMA 2XAJA 1OISA 4UFIA 1JHFA 2WZ8A 3AKTA 2M8EA 4ANJA 4W1UA 1EP0A 5J09A 3ZQ7A 2CUFA 4EJVA 1U9NA 4KN4X 4YFXF 2QENA 4AAPA 5DUVA 2ZX3A 2XJRA 3EQEA 2NS0A 2JDPA 3P6BA 5DD4A 4IPAA 2IEKA 3VSLA 1CVNA 5SV5A 3WW3A 2LBFB 1LCLA 3NMBA 2OU2A 1W7PD 3WHTA 2WAEA 2BVMA 3HOTA 4LA2A 5ACA1 3WG1A 1JUHA 3Q0WA 2PAMA 2YBSA 2XUMA 2R3SA 3NL1A 2WO1A 3A1YA 2JA2A 2AYHA 3HBZA 3ON7A 1BKZA 2WS91 4COYA 4WM7C 4IL7A 5KC5A 3AYCA 3KE2A 2GLOA 4MHGA 4YW7A 2JWPA 3VD9A 3WCRA 3AP5A 2QZ8A 1K42A 2KMUA 3TQNA 3M4FA 4QXKA 4CRQA 5T5PA 4CEWC 3ABZA 1WCSA 5ED4A 4OINF 2CTVA 3I3QA 4BWOA 3MKYB 2OPTA 3KSCA 1KD7A 4OMZA 2YHJA 3OBTA 5JSPA 3JBG1 3KETA 1S0JA 1UX6A 2E2JJ 2DDBA 5HS9A 2P81A 3V65A 3VHRA 1RETA 1JZ7A 2VB6A 1JU3A 2TUNA 3JRBA 1IPJA 3A4UA 4NHXA 4LE4A 3JB8A 1S9HA 2VKHA 3KM5A 4BIOA 3J7LA 4HVRA 5IVBA 3MV11 3ABLH 4PJ0C 1Y8QB 1ETVA 1N3QA 4R9CA 1PX4A 2MSYA 3CCLI 2AACA 1I39A 3GZTB 1GVJA 5EV7A 2EZHA 4C2TA 1JUSA 4UUTA 4OHWA 4BKXA 1W9WA 3Q8EA 1UOGA 3ZQHA 4H7LA 4HETA 1V5GA 3HMYA 4IERA 3GX4X 1FNZA 2XL9A 1Q43A 3Q8AA 1UJ8A 1E5HA 5GALA 2DV9A 1A5JA 5CNAA 1SD4A 2E1MC 2ZBJA 2VOKA 1IZ3A 3CJTB 3T2QA 3WGIA 3FISA 4CA0A 2QBXA 3PUIA 4PDWC 2Y69H 4Z6YA 1RUE1 2RS13 4UF0A 1TW3A 3S2WA 1A78A 2CWEA 4O61A 2W3JA 3NWKA 2A68F 2Z5UA 2LDUA 1CAVB 1RUOA 2RV9A 2WINB 2R063 4UW3A 2KRFA 5T3NA 1MS8A 2HQAA 5L3CA 1QPMA 3ZQGA 1IRFA 3E6BA 1VI0A 3Q0VA 3GM8A 4GO1A 2Y0OA 2FXAA 3J8F2 5JWPA 2VUAA 3N9QA 2CL2A 4FT8A 1LHWA 3QH6A 5EWSA 4UF0B 3RNSA 4UXAA 1OCPA 4LKEA 4CU7A 3HHHA 1QIQA 3KGZA 4P5YA 1XX5A 2EJRA 2DTWA 1SFKA 1AYN2 2Y0SN 2E2IJ 1J3RA 3M3QA 1LOFC 3I2IA 3A0HC 1AR83 4PF5A 4Q0SA 1X8MA 1SD5A 1Q8QA 4D69A 1S0GA 3IZOA 3OUHA 4WZCA 3PDQA 2EIMH 4DEVA 4QXBA 5FD6A 2DFFA 4AVZA 1LPQA 4BQAA 1KJRA 4D8MA 1PYVA 4E2SA 3QACA 1YIFA 5GLWA 2DBIA 2AEYA 3OOUA 2XSJC 5GAHJ 4XC9A 4HKLA 2FDIA 3GGLA 1IS6A 2LY1A 1REPC 3GTMJ 2GM4A 3GHNA 3F72A 4MQVA 1RUJ1 4CDUA 2ZJQF 2H94A 1MH3A 5FWEA 1L7LA 4AVBA 4A4AA 2Y6GA 2LTPA 4QB6A 5CVJA 1XU1A 1EH6A 2A71A 1B6AA 2VCCA 2X1EA 1AR72 2XGXA 2ZHMA 3CEWA 5E1ZB 3C3VA 1Z0XA 3KZYA 4LT5A 1O5LA 3JSOA 2X05A 5FP4A 4HNUA 2GU9A 3SH5A 3VBUA 1VBE3 4JKMA 1JHJA 1JYVA 3T0BA 4CDUB 2XLAA 1XCBA 4EJRA 5LFAA 4IEUA 2HEVF 2L5QA 1AXKA 5B5EC 1A6CA 4FSJA 1SPPA 4ENKA 3KWVA 4N7UA 4E7HA 4AIKA 4XOPA 2ZMNA 5ABJC 4BAYA 4RBOA 5E3NA 5BOXA 4XURA 4R4ZA 1PVC3 4QKFA 1XGMA 3VBUB 1T39A 2A3YA 5IT9Z 3MFKA 2NS8A 3H0DA 4PHZA 4EWEA 4XLCA 4JGZC 3PUQA 4JGYA 2BHYA 3NV2A 4JTOA 1GANA 1W8UA 1SPPB 4FPYA 1P7IA 1RVF2 4M4PA 1OQYA 4FOQA 1OT5A 3KCYA 2VONA 2QM3A 3KP4A 2RS32 1JHNA 4MTEA 2HQ5A 1Z67A 2GWRA 1DGWA 2NS7A 5L7OA 3RTRA 3DU6A 4CZCA 2RG4A 4IGPA 4B4RA 3ZSJA 2X1CA 4QX0A 5BY5A 2M3AA 1Y43B 2KD7A 1R71A 1AA7A 4JGYB 4LLGF 2K9ZA 1JT0A 1RIRA 3BOPA 2R32A 1G6NA 3N05A 5JLXA 2Q2EA 5KWRA 2JX9A 1H8AC 3ILRA 5JHUA 1KU3A 5LK7B 1ZBE2 2NXNB 3RI4A 2XJQA 5L7OB 4C1WA 3F21A 3LIGA 1UY0A 2ES3A 3M4OJ 4O7XA 3IT8A 4FAGA 2ZGRA 2J22A 3W6JB 4BQ5A 3L9JT 1TME2 5AVPA 4YIRX 4CXYA 4RR3A 3IPVA 1Q8OA 5C5UA 3K48A 4A2UA 3CMAI 4A3XA 2Q2EB 5J8FA 3OY9A 1FV2A 3PIOF 2WQZC 3I4PA 1LQ1A 5FYUA 1MIJA 2Z33A 4XLHA 1WRJA 1ZELA 2ARAA 5LHGA 1JU4A 5A33A 2RR12 2VNOA 1WLTA 1SBDA 5DDGA 4RR3B 3AVSA 3IPVB 4RAFA 3ZYRA 2DFEA 3T4VA 4FQGA 4LTAA 2HWF1 2JN6A 3GJAA 2I5UA 2VBXA 1DLCA 2G9FA 3QP6A 2CUJA 4WF2A 5A33B 1G8XA 1A34A 4AWXB 1A35A 5J96B 4OI4A 5JR7B 2ZZQA 1J3QA 4LLLA 5A7OA 1YW7A 1D8KA 4Z1VA 3KZ4C 3M70A 3SH3A 1O7LA 4BYYA 1UF2C 1GKBA 2OQ6A 1UYPA 5AC92 2JDHA 3WP3A 2WO7A 2DA2A 5DUWA 4HX4A 4HX7A 2CDPA 4I76A 2P3JA 3KF5A 4PLMA 3IL2A 3QRFF 4LO6B 1QY4A 3T1BA 2KIFA 2RQQA 2EQRA 5HDNA 2E5NA 1T2KA 4YW4A 4XUQA 2QQIA 3OYCA 4H4KC 1AR62 1YQ6A 2D5FA 2A6TA 4AC0A 1QU0A 2QGUA 3ZXLA 1J2XA 1XBFA 3HRSA 1BMV1 4J1WA 2ZXJA 3SEEA 1NQJA 1V5EA 3GZNB 1OMIA 1LEAA 2VKDA 4RB0A 1TE1B 3GF2A 4V2VA 1NUKA 1R082 4II3A 1MZ6A 2OZUA 1KRIA 5LCWL 3BJOA 2CGOA 1HBXG 3NNLA 3L2YA 1G2HA 4XBQA 2DMNA 1FYUA 1MBJA 2WSVA 3GO5A 3HYIA 5FPZA 4MNUA 3ABKH 2R7VA 4GMP3 2OQGA 2E19A 3DEEA 3A0KA 4PLNA 2XUBA 3QPLA 3ZPYA 3KLSA 1J1LA 1ORKA 2ZOEB 4KMUX 2AUYA 3IP4B 2PHXA 4FCAA 2RMU1 4D6QA 1LHUA 1MNEA 2Z4FA 1QU3A 3P3NA 5FZ1A 1QZEA 2FA5A 1PNGA 1O5UA 1SVOA 2V4JC 2GQQA 1QHGA 3RZDJ 4PCRA 3FMRA 3FXRA 3KLOA 4IOAF 2P6CA 1S0BA 4E9KA 2ZJ2A 3OYDA 4K20A 4RDUA 5IP7J 1YQ2A 2DXIA 2QZ3A 1YXWA 4XRSA 1ZQ3P 4TV7A 4HPQA 1ZR2A 1Y8RB 3KQ4B 2OX0A 2JA6J 5KXDA 1MZFA 4IVNA 2EXHA 3S7IA 2L7FP 3VYUB 4CICA 1BBYA 2VZVA 1ULEA 1OA2A 1RHI1 2Y6LA 1QJU1 1RI7A 3JQWA 3LCPA 2W68A 3DKYA 1UU5A 1FYLA 1FC3A 3UK9A 3K2OA 2VOWA 4OHYA 2L0KA 1CAWA 4KQ7A 3LOIA 2OBPA 4A0YA 3ZFGC 1F5TA 5DAPA 4V19K 2QKLB 3ZYPA 4DZJA 5JZGC 1VBB2 1J0RA 5DCMA 3BG6A 1FPN1 1PGL2 1QO0D 5F3GA 1QJY2 3E7LA 3OWTA 5FZHA 4B3NA 5KHHA 2ZPXA 5LEKA 1WQ2A 2W1UA 2DA7A 4X6RB 2WZR3 1CAWB 4PIXA 3RPUD 1KGYA 1R1ZA 2QSFX 3TOAA 5IJRA 1WW7A 5CKTA 3L09A 2F4MB 3EMRA 3DLAA 4WBBA 2A6HF 5EJ3A 5DCMB 2IRFG 3QWLA 5IVFA 4BE0A 2Y33A 3L2WA 4W4ZA 2ORXA 5FRNA 5FYBA 3H1YA 3FMQA 1KYWA 4AK3A 2F6BA 4D7SA 1W8HA 2HEWF 3KPHA 3BR5A 4C1XA 2PHLA 4E2GA 4Q8LA 2R0FA 1IXSB 3HSEA 2YPRA 3EB7A 1ULOA 3S1RJ 3WX5A 1H30A 4ENNA 1NCQC 1ND2A 2TRTA 2CJJA 3ECHA 4JYKA 4XKBA 5L3EA 2EH3A 1HLVA 4NNJA 5CG8A 2EBIA 1QHDA 3MW4A 3BWGA 3U78A 1VRBA 4PCQA 2HBUA 2D6MA 1JGGA 1MVQA 3WP5A 5LGTA 4HLXA 1URXA 5LASA 3OS2A 2ID4A 1ZGAA 1JYXA 4RL7A 2JDMA 1S72I 1GQPA 2ECBA 9ANTA 1RESA 4LO8A 2E60A 5E3MA 1W8ZA 4LQRA 1ETYA 3ZPLA 2HR3A 4D7TA 3ZM8A 3OPZA 2DFIA 2PMHA 2M7BA 1ND2B 3PUBA 4UB6C 3RPUA 1VIWB 1X3WB 3MZYA 1NYWA 5DUUA 1W6MA 1SFXA 2ZMEA 5AFBA 3NAPC 4BQ4A 1U12A 5FJ8J 2V9PA 4YFKF 2V26A 4RQPC 1ZVFA 1XSDA 2J1TA 2VT3A 2UWMA 4E8CA 4E7JA 3I54A 1FPQA 4LUKA 4E7KA 2A6VA 4DXZA 4NUBA 1BEV3 4BQ3A 5IOZA 1D3YA 3VBRC 2FMYA 2EFNA 4CP2A 4LBMA 5FZGA 4RGSA 4JKLA 3BQZA 3BTLA 3WU2C 1HKQA 1W6MB 4DRRA 3T3YA 3PU8A 2XB6C 2ZMEB 1ZBA2 2IC1A 4ATEA 3K75B 4QPIC 1R1A2 1JKQC 2UWBA 3W6KB 5JI7A 2LKSA 3C2BA 2VOTA 3HIFA 3ATGA 3WG3A 4R52A 3O12A 2NAZA 2OTJI 1GUUA 3HOYJ 4RGGA 2DODA 5FFZA 3M7GA 1EV11 3M2MA 4PJNA 3D0JA 4XPVA 1SFEA 2DVAA 2M9HA 4FPLA 4UAPA 1SCSA 1R091 1HKSA 5BPXA 4YGEA 3SXYA 1MS5A 5T52A 3W2WA 2OPKA 2DFHA 1U5ZA 3CQOA 1ENSA 4A7YA 1X7NA 1TNTA 1ZG3A 2A3XA 4JK1X 4RB2C 4IHTA 1AHSA 4EN0A 4LFUA 1VBA3 1AR73 5JAXA 1FX7A 5H6QA 5IY5H 4CP9A 1S3JA 2XVLA 5FPVA 3PL8A 2KZGA 5LB6A 2ZGUA 4U0WA 2E1NA 1YC61 2G0EA 3U10A 3WW2A 2PA7A 2M8GX 4SBVA 4G8XA 2LG4A 1DP0A 2RS53 3WF1A 4AI2A 3I3EA 3G71I 5DZFA 2VR4A 4ZZ5A 3HN3A 4BM8A 2EILH 4QX3A 4KWKA 2A05A 2VBDA 1WWXA 4BQWA 3EJKA 4CP9B 5F1JA 2MPFA 2QF7A 4FBFA 3TW6A 1N75A 3J81Z 3W58A 3WE2A 1OLQA 2MFZA 4XOGA 1FJLA 1Q56A 2B39A 5BNOC 3RYKA 4M9XA 2VBWA 1W9SA 3HC7A 1G9AA 1WW5A 4D9JA 4ZYGA 2RM22 5T5JA 2M45A 3WDXA 1ZYRF 5GZFA 3JW4A 3S30A 4LO5B 5CVVA 1K5JA 3RKWA 1VQLI 4IRGA 3T8TA 1C28A 1W2AX 1YFUA 4FTHA 2JG8C 3CZJA 3I0TA 3KEOA 3HB9A 1ZRDA 3NAUA 1BN5A 4R1HA 4QPQA 1FSHA 2QVSB 4CE8A 1Q3EA 3RWKX 5DMYA 4J00A 4BGDA 2VKEA 3V7RA 1YJLA 1QBJA 3F8MA 4P02B 1GLHA 2OUHA 2J1SA 2R071 4LXLA 2NVTJ 4XSZF 2DYCA 4AD9A 4MO3M 2BGOA 1IUYA 3PQKA 3LOCA 1O6UA 3SQOA 2WB1N 3RG0A 1VAKA 4AI1A 4A5MA 3OGJA 5EYYA 1LNSA 4IO9F 1XPWA 2K4JA 5ICFA 2KPMA 4GYGA 2HNHA 5GP9A 3N9NA 1BYHA 5B3SH 4B1MA 2YUSA 3MIBA 4C0BA 2VQLA 3LA7A 5FMOS 3UKTA 4FP3A 1R1UA 3RIRA 2V1NA 2EIBA 3QYFA 2KIMA 1RUH2 2TDXA 1PMJX 2LRPA 4TWTA 5HCAA 3H0GJ 3GUDA 1G8WA 4J25A 1MBKA 1JMUB 1PZ7A 3I3DA 1MD0A 4G4FA 2ZKZA 1S0EA 1I9RA 1U0AA 1G3YA 3M1EA 1M4WA 2BY0A 1STZA 4A7KA 2WJSA 3IC7A 1VQPI 2JPBA 1OC1A 3BCWA 1XMAA 3VBOC 3DTEA 1JTYA 2Q30A 3HGGA 2LRDA 3PO2J 3FK6A 4Q0VA 4XLAA 2VNRA 2GIZA 1PMHX 5J1YA 3HBKA 1U5XA 2CDOA 3TRSB 2HEOA 5C8CC 4ZDPA 5F5QA 2JKBA 2VZ1A 3UJQA 5K7HA 1TWHJ 1BR1A 1DZQA 3AXEA 3KEYA 3IMNA 4Q4W2 4NPRA 5IATA 5E79C 3OMYA 3QU6A 1F5FA 1BJAA 3OGSA 2Y6HA 3KP3A 1B35C 1UKRA 3DPTA 2WFPA 5FZLA 4DBRA 4XFHA 1ZHFA 1ASJ1 2VBBA 4XJZA 4I6ZA 5J4YA 3WNXA 1V4RA 1FV3A 4LBQD 2JRTA 3LSJA 4MGSA 3IDCB 5F8PA 3KP5A 4W6YA 1E2XA 1S29A 1YHQI 4C0HA 3NEUA 2Z1DA 3VBSC 1T95A 3OJBA 5D4RA 5GTIC 2WNUA 1B9MA 1RC6A 1W2UA 4XOTA 5D1IA 5FZMA 4YM0A 5K5QA 4N8MA 3NNGA 3ZMVA 5CKMA 1H9TA 1HSTA 1AJKA 3FHIB 3ITQA 2B5HA 2XF7A 1H8TA 3TBIA 2BBAA 3GZEA 2PMWB 2DDAA 2MD5A 4LUMA 4F52A 5FXVA 3S3OA 3W20A 2AREA 1XOYA 1AJOA 4LD5A 2YYOA 5HXVA 3ECOA 5J3LA 2WNUB 3VD7A 2XPUA 3FXMA 5CLSA 3FZVA 1BZWA 3AFHA 1G9BA 2JKXA 3ZN6A 3OYFA 1ZZ7A 4LOSA 4IQPA 1T98A 4PBPA 1AYM2 1H8TB 4P9IA 3H50A 5FMDA 4YELA 2ZJPF 3CJIC 4MUVA 2GA2A 1J1TA 4IV3A 4OUMA 2CAUA 3RVHA 1K78A 4NRPA 4BQ1A 3IDAA 5A3OA 5C3SA 1YFXA 3FZ3A 3HKZA 4LBQA 2OVUA 3WEZA 4XUPA 4BQ2A 2X51A 4BXFA 2XMLA 5DM6F 4XZPA 3A02A 2DA6A 4KMFA 3F3XA 3ZN6B 4CCEA 3HM5A 4IETA 4HNTA 3OPTA 3W5NA 3MN2A 4ZC3A 1IQAA 1OYWA 1AL22 4FPOB 4IV3B 1K78B 3QQAA 2D93A 1YO5C 3KS7A 4V2FA 2ET1A 2HQNA 1E5RA 2W7NA 3VFZA 1S0CA 4LBQB 1QJFA 2WWSA 2DCKA 2VQUA 2XOMA 1S5LC 3MUZ1 3I3BA 1RYYA 1DCSA 2HLEA 3POGA 4NRQA 1WA4A 1SVMA 3D4KA 5DAWA 1IC8A 1VBB3 4K7JA 1H6YA 3HQRA 1W0UA 1LU2A 1KU7A 2R7QA 1YQ5A 2DK5A 4A3JJ 3K4DA 5JVGF 3K70D 4X6AJ 4KA4A 2PELA 5LHHA 4UBHA 4QB2A 3D5LA 3WHCA 2WAQA 4XF3A 5DZGA 1SZBA 3LD8A 3OY8A 2DOFA 4G9SB 5EJZB 1E57A 4KIBA 2EZIA 1UG0A 2HWE1 2HZTA 2ZGPA 3PJRA 1USTA 1B1BA 3S3MA 3MPPG 2WBKA 3A21A 4ATFA 2BE5F 2PLV3 3F95A 3L2CA 1HRV3 1VBC2 4N7IA 4OMDA 4J6GA 3G3ZA 4H55A 1MZBA 2XXZA 2AXTC 1C8M2 2FMDA 2EIEA 3OY8B 4F55A 4CUGA 1Q8SA 3GMEA 4I99C 2KA3A 3LSKA 1W5CC 4F7ZA 1YCIA 3OGGA 2DDUA 2VE8A 1R1VA 2VJ4A 4QGNA 4RFRB 5HI0A 2R49A 1MQTC 5ERIA 3QD6A 5FLIA 1R23A 2WWUA 2ZAHA 4A3KJ 5ACA3 3P5BA 5B1BH 3GALA 1FOD1 3WNNA 3FC0A 2R7DA 4LBNA 2LKPA 3K2AA 2H1LA 2MH2A 1I1SA 2WS93 3S5AA 1DPRA 1K6OA 2LR8A 2YBKA 2GP3A 3WHBA 3J7YJ 4EN7B 2V9KA 2GOXB 5FXWA 1RNLA 3O14A 3ILNA 5FTTC 3K51A 1WWYA 3FHZA 3NARA 1S6LA 3RYPA 2MEV2 2ET7A 2DPDA 5B66C 4GQ7A 4QHOA 5DAVA 2TCTA 3RPQA 1FT9A 3F0CA 3JBG3 3CDHA 4XJ8A 4ZYAA 5CFDA 4EM0B 3V64A 4C30A 3I2OA 1ZKGA 1D2QA 2HKXA 5BMZA 3HRTA 3T4HB 3BT9A 3L7WA 1E17A 3RFRA 4WM7A 4BXXJ 4YM3A 2W94A 3J26N 3ZFFC 3L2VA 2STWA 2VZPA 1AR91 2HWB1 1QDOA 2R7XA 1JXNA 1R4MB 3APBA 3KZZA 3KVAA 5FYSA 1SLAA 3G2BA 5FUPA 4MZUA 2CSGA 5D6FA 5H2FC 4Y33A 5FYYA 5CFDB 1W0OA 5JHFA 1HQLA 3SITA 5L3FA 3ZDVA 4EROA 4M3CF 3UNPA 4R9DA 4WXCA 1W8WA 2ZSHB 4WM7B 2XWJB 5EEHA 3VKOA 4Q47A 1WGXA 4MGRA 2R92J 1GYKA 2L54A 5FB2A 2D3PA 3WNKA 3WV6A 2XVGA 4UUSA 2LLKA 1PO22 3DU5A 3QP5A 3EUHA 3PUFA 1VQNI 2STTA 3FXKA 4S2HA 5IP9J 5A3TA 4IE5A 1OOPC 1RUE3 1BI2A 1XNTA 3I2JA 1OLME 3K4AA 4NIDA 3DFGA 4UFKA 5EYXA 3S7EA 2LKXA 3KT4A