3I54A

Crystal structure of mtbcrp in complex with camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
224
Chain Sequence
LYFQSHMDEILARAGIFQGVEPSAIAAQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
total genus 66
structure length 224
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i54A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i54A01
3E3VA 1QGPA 3UKTA 2BNMA 2G7UA 2PG4A 4UV8A 4Z2YA 3H7YA 3N97A 5BY5A 3TNPB 2PMUA 3ZMDA 3WW2A 4S04A 3HSEA 2O8XA 2D45A 2KIFA 3VODA 1FLIA 4CHUA 3SQNA 4G7OF 3ACLA 2HQNA 2Q0OA 1XGSA 4TV7A 1OD5A 1BI2A 1IUYA 3FM5A 1U5TA 2PAKA 5CJ9A 2JT1A 4GO1A 4L18B 1FX7A 1SQ4A 4HN0A 2Z69A 3F8CA 4JTOA 3JTGA 3H50A 3GBFA 2TDXA 3U11A 3OD0A 4UBHA 4KU7A 3PFIA 4OMZA 1W5SA 1NE6A 2JPCA 4YIIA 1DPRA 3VB2A 4UXAA 4PIZA 1FZPB 3WTVC 3GVAA 4XEZA 3E5QA 2MH9A 3HRTA 5ICCA 4JBAA 4LLNA 3RIRA 4J1XA 1FYKA 3MWMA 4M9SA 2FRHA 1PMIA 1FWZA 5DV5A 3BPXA 2N7GA 2FF4A 4M72A 5LRRA 2Q8KA 3ES4A 1IN4A 3COAC 1V70A 3FHZA 1ZYRF 2PEXA 1B6AA 4QM8A 1T38A 3CLOA 5D4SA 2EFPA 1IW7F 2IJLA 5JHUA 4PZJA 2Z99A 1CF7A 1KU9A 1OR7A 4PCQA 3WE2A 1JE8A 3U10A 1QZZA 2V1UA 1RUOA 3FJSA 5I8YA 4OMYA 3EQLF 5D8KB 2PYTA 2K4JA 4HLTA 4IETA 4EGZA 1SFXA 4OLLA 4QXKA 5KK1A 1Z05A 2GQQA 1S29A 5DD4A 1XB4A 3EHKA 4EQQA 5J6XA 2IXCA 3WTUC 3REOA 5FPXA 4N9IA 3WTYC 1ZZ6A 1YS6A 2EV0A 1NHAA 1YFWA 3H1WA 2O8QA 3RJPA 4KIGA 1HW5A 1IXRC 5CVJA 3F72A 5H20A 2UWMA 3TGNA 4LB5A 3G7DA 2MLGA 2Z5UA 2W84A 4WX9A 2EFNA 3BPZA 3D5LA 3I0TA 4PGGA 4OOIA 3I59A 4Z07A 1YTYA 4KWLA 4NHJA 2FQ3A 4Q0PA 2EA4A 3GXOA 3K1MA 5BPXA 1QXJA 5I0TA 3RDIA 5D6FA 4L9VA 3CUQC 1EPZA 1X3UA 4FAGA 3DKWA 1DPUA 3FM3A 4WXDA 3ABTA 3L2CA 1IPJA 4IEXA 4I0AA 2DPDA 2XAJA 4B29A 1SD5A 4HVRA 4YNIA 5ICEA 2QNKA 3S0MA 1UIKA 4IF4A 3QU3A 3TOBA 2FA5A 4UV9A 3V4GA 1O3RA 1IRGA 4HW0A 2QDRA 3C18A 3EYYA 2XLAA 3GZ6A 4EWDA 1FSHA 4ESBA 5F64A 3DEUA 1T6SA 2FNPA 2RNJA 2E7WA 2VOOA 2CG4A 5DD8A 1J59A 2MD5A 5JAXA 3QP5A 5E1WA 2VE9A 1Z9CA 4UNOA 2NAZA 3Q9SA 2XRNA 5FD6A 3K1NA 4DINB 1MKMA 2WWYA 2OQGA 4Q5SF 1IN7A 4XLNF 3T5XA 2D2WA 3FXRA 4UVCA 5KBFA 2QLZA 2QBYA 3LA3A 1DDNA 3GYHX 4Q29A 4OINF 5KHJA 2F5FA 2UYBA 2Z9OA 2OU2A 1YFHA 5BQTA 3TDUC 1U5TC 2FBIA 1W7PD 3IRQA 3NEUA 1PP7U 4ZYHA 4RB2C 3EDPA 5LHHA 1LKNA 3F8NA 3O6BB 3TOAA 1Z1DA 3LWCA 3OOPA 3OCPA 1MJ9A 3W6KB 2HGCA 4G8XA 2PFWA 1YO5C 3WTSC 2EV5A 2Z3YA 1HKTA 2ET7A 3EQEA 2IXJA 5DYMA 3HIFA 5BPIA 2M30A 1MDMA 1I6XA 2ZO4A 4HAMA 1GXPA 5JFRA 3FXQA 1FOKA 4X6QB 5D8LB 1IAWA 2O61A 3NVCA 3S2WA 3SHRA 4WZCA 2VONA 1UPIA 1B4AA 2ZKLA 3ES1A 2NS0A 5TJJA 2CYYA 1IPKA 1QWRA 1BBYA 5HS9A 5JR3A 5HLIA 3IHUA 1FSEA 1G3WA 1U8RA 1U6GA 3HQXA 3ZP5A 4BNCA 2OPKA 3FE5A 4GXOA 1B1BA 2GXBA 2PAEA 1F9NA 2NRAC 3R0AA 3F23A 2Y0MA 4OIOF 1SD4A 1J58A 4KICA 3KEQA 2KKOA 5IT9K 2QWWA 5K8SA 1QNTA 3Q5FA 5K5RA 4ENJA 4HSLA 3ECHA 3PNAA 2EVXA 2OA2A 3RKXA 1K78A 2ZJ2A 5JSRA 1XD7A 1BC7C 2O03A 2A6HF 3EBRA 1X8EA 1F4KA 4KL1A 1O7LA 2EK5A 1XDUA 1Q5OA 4EWEA 2RDPA 5E18F 4IEZA 4P96A 4LEJA 3S7EA 2HKXA 3VHRA 2H09A 5FFZA 4HOBA 3I54A 4ZU7A 1QY4A 4U88A 3GFMA 1CAWA 4KU8A 3U2RA 2GC1A 2ZNYA 3HRUA 2ISZA 2LF7A 3M3IA 4QM9A 2BNOA 1MJAA 3WW1A 4LFUA 2QZ8A 4LUMA 5E8GA 3KMHA 2DK5A 3J81K 1KGSA 3D0JA 1USTA 1YS7A 2QBYB 3KZYA 4BYYA 4ONUA 1EY2A 2IRFG 1EV7A 2P5KA 4AQ2A 3QP6A 2ZXJA 1YW7A 3GF2A 1NE4A 3WW4A 2IW5A 4PGHA 3RZZA 2VXZA 1R5HA 1WQ2A 2DAOA 2GC0A 4YSFA 1UW8A 3M70A 2BV6A 1XMAA 5D5WB 4N0BA 5FFXA 4NVPA 3KP5A 1GQHA 2CAVA 5IT9Z 1SFEA 4E2SA 3F8BA 5DCFA 1GVJA 1YUDA 5L3GA 3HYIA 1LB2A 2PLYA 1IRFA 4M71A 3M9AA 3FF5A 2BE5F 2WTEA 2WC2A 4HDVA 2IXIA 1ODDA 3MQ0A 4U7DA 2HR3A 3H7JA 2CV6A 3ZQ7A 3IRRA 2VQAA 3O3KA 3CF6E 2VT2A 4MGIE 3C3VA 4R8HA 3ERED 2P17A 4EROA 5J8FA 1VP6A 2IXKA 4X6RB 4DQ2A 2L02A 2ISYA 4HQMA 5E17F 4FAHA 4NQWA 2VBXA 4WF2A 3KP3A 3J80K 1KQ9A 2C0ZA 5ILSA 1GXQA 4MH0E 2IXHA 5FLJA 4KNYA 1HBXG 1H1IA 4GCVA 2DU9A 1T2KA 1XCVA 3BPVA 3U9GA 3BY6A 4KFCA 5FQ0B 4QMAA 2XKPA 1RL3A 3MZYA 4Q0SA 1BIBA 2Y48A 4FX4A 1SD7A 2CWEA 4AVPA 4CDGA 3BWGA 3ZDSA 3O2PE 1HW1A 5BMZA 3MYXA 1H0MA 3LA7A 2B9UA 3R6SA 4BHBA 1ZAOA 1X8MA 4KIFA 1P4AA 2PHDA 1PM7A 4AIKA 5C8WA 3ULQB 1FYLA 4WXCA 4Z82A 5CYVA 1SD6A 2V1XA 5I8SA 3HHGA 3WGGA 3MFKA 2COMA 4CICA 1KQ8A 3G3ZA 1XSVA 2H0VA 1K6OA 3FMSA 3WE3A 3M7GA 4L0ZB 4AVCA 5L3BA 3R4KA 3KGLA 1ZZ8A 1FBUA 1RIOH 2DFIA 1ZGJA 1F5TA 2OQRA 2UXNA 3KSCA 4EWAA 5L3CA 4OIRF 1Z6RA 4D7SA 2K02A 3BJAA 5FLXK 3E5UA 2KIMA 5F6FA 4QGMA 2Q2EA 1EH6A 1QPMA 4EJUA 4JVAA 2P8TA 3ZMTA 2ZNZA 4M74A 2EJRA 3IL2A 1FYMA 2GA2A 4ENKA 2D93A 1R7JA 1WRJA 3DF8A 5E1ZB 5AONA 1STZA 3T1BA 4HV5A 1MDMB 3MZHA 3ABUA 4IPAA 3LQQA 3GX4X 5KHIA 3HT1A 4A0XA 2XKOA 5DUKA 4WBBA 1LVAA 1CAXB 1WSUA 1ZRFA 1UIJA 3IIAA 5JSOA 2XGXA 4M73A 5F1RA 2CO5A 5J7MA 5I93A 1FI2A 4HX8A 2H6CA 2GH2A 3F6OA 2ESNA 3FFQA 1TQPA 5KVRA 5LRSA 1W7PB 4Q0UA 1LEAA 5FGMA 1H9GA 3M8EA 4L9NA 1REPC 2C6YA 4CGZA 1U2WA 1YQAA 4LMYA 1B9NA 3TQNA 3BCWA 3B73A 1G3YA 1SFUA 2K0GA 4ZZDA 3CUOA 1I1GA 4Y15A 1VJ2A 3DPLC 3TO6A 3WG9A 4TLFA 3KZZA 2W24A 2BBYA 3KP4A 3QPHA 3UKNA 4LB6B 2FBHA 3CEWA 4AD9A 4HSJA 4KN7X 1E2XA 5JI6A 1FP2A 4CYDA 1LDDA 1XGMA 3OGJA 2EFWA 2MC3A 1IZ1A 3BP8A 4EMSA 1WGPA 3L2HA 3KLOA 4AWXB 4ASNA 4RGRA 5DUIA 4QX5A 5HDNA 1CAXA 3HHHA 4YRDA 2LNBA 3T0YA 1RGSA 2UY9A 5BS6A 1ZZ9A 3I71A 1WKMA 4ON0A 3H1MA 2AXLA 1CAVB 1MGTA 4HLXA 4MNUA 1EYBA 3BU7A 1G3TA 3F6VA 2BEOA 5LLQA 5KHGA 1AWCA 2EFOA 2GWRA 2QUFA 1IXCA 4GGGA 1EH7A 3CJXA 2VT3A 2JRTA 1J3PA 2P6SA 5FDBA 3GFLA 4A6EA 1R23A 3TKYA 1XRUA 4E2GA 1UD1A 3MDPA 4L9TA 5T3NA 1L3LA 3L00A 2ZFWA 4E70A 3D0SA 4XSZF 2JPBA 4IEVA 2VBYA 2PMHA 2IVMA 2YSRA 1R1VA 3SCGA 4LJZF 2XVCA 1RI7A 5J8CA 3U0ZA 1JHHA 2V1DA 4WWCA 2PA7A 3DQVC 4QGNA 4I09A 4IJAA 2F5DA 4FHTA 4Q48A 3WTWC 2HQRA 3SXYA 3I58A 1IN5A 2FOKA 2P6TA 4EJTA 1G3SA 3MAJA 3JTHA 3K9TA 2H27A 1TBXA 2XASA 4HX4A 3J81Z 2X4HA 1JUHA 5FCCA 3RYKA 1PUEE 4OFGA 3V8LA 1I1SA 1X82A 4U7BA 2ACJA 5AVPA 2DTRA 1R36A 3SZTA 1Y3TA 1XGNA 2LSOA 1YW9A 2VBWA 3BB6A 3L9FA 1TQMA 1WA4A 3CUQA 5KHKA 3KE2A 3HTSB 1I27A 3ML6A 4R52A 4GULA 2ETEA 2DW4A 2JZYA 2VOPA 2HS5A 3I5UA 3H3UA 2XL7A 4Q0QA 4YFXF 1UHMA 1BM9A 5EEHA 3BJ6A 2R7FA 4YG2F 5HLHA 2GC2A 3IWZA 5BUVA 2Q30A 3V7RA 4AVAA 3ELKA 4UHTA 4JQFA 1O4TA 3EO6A 4A0YA 3C7JA 3CO7C 2OBPA 5HLGA 4AVBA 4ETSA 1BJAA 2XLFA 4Q47A 1TQ5A 3K1PA 2P7VB 4BAYA 4EGYA 2PJPA 3PLQA 1SFNA 2UZKA 4ZU4A 4O3MA 3USSA 4KN4X 1D5VA 3E97A 3HOTA 2K7LA 1O5LA 1IN8A 4LTAA 4IXAA 2MBFA 3SHFA 3AAFA 4META 4O5VA 1ZN2A 3BROA 2HEOA 1YWKA 1S6LA 4WK8F 4HYEA 4M6XA 2P4WA 1RC6A 4A0ZA 5H6RA 2QQ9A 1XDSA 5I0RA 3DP7A 3HSRA 3GUDA 3L09A 1P4WA 1U78A 4D0PA 4XFFA 1YW8A 5LGTA 3LSTA 3GFIA 2YX7A 4RAYA 1MJBA 2MLKA 1RZ4A 3ISPA 1ZZBA 2MPFA 4HBLA 4KUMA 3NL1A 3S7IA 3RPQA 2ZKZA 4RGXA 2IT0A 5CLSA 5ERIA 3ZMSA 2FEZA 3FZ3A 4HF2A 5E16A 1OYYA 2YR2A 3H9AA 3IWFA 3LAJA 4MEXF 2Z2SB 4MV2A 2FNAA 4K2EA 1FC3A 4CZZA 4XFCA 2L4MA 1TW2A 3SFZA 3OV8A 1Z91A 4EJOA 4H0EA 1ZRRA 5D1IA 2M1BA 4I02A 4RAZA 3TO9A 3BDDA 2WFPA 1FPQA 2XAHA 2JSCA 4P9GA 4RB3C 2FE3A 2E7XA 1O3QA 3LFKA 3LAPA 2PTMA 2X0LA 2M45A 2QQBA 5DDGA 3DN7A 1OFNA 5L3DA 5LEKA 4EM1A 3N4MA 4IEWA 2RKHA 1O3SA 5EFUA 3SCHA 3BJOA 3HTUA 4M9XA 4L2NA 1XE8A 2K4BA 4RB0A 1D8JA 1Z7UA 5CU1A 2STWA 4BIFA 3C3WA 3E6CC 4OU0A 3PQKA 3CO6C 1KU7A 5L3EA 4PDKA 2DQRA 4R1HA 5CVUA 3RYRA 1ZLKA 3WGIA 2VE8A 3SZPA 4KT5C 1K79A 2CAUA 2PHLA 4LG0A 4A12A 5HS8A 4I01A 5LGUA 2H94A 4ZYGA 3KP6A 2RVCA 1KU2A 2A69F 1Z6TA 3WTTC 1XSXA 3E6MA 4LA3A 2FBKA 4U0YA 3L7WA 1DGRA 5EZWA 1SMTA 1I5ZA 3DV8A 2YX4A 1P6RA 1HW2A 4Q0VA 1V3FA 4MEYF 3IDBB 4O9EA 1XE7A 1YIOA 5HDKA 4YIFA 1CGPA 3GO5A 4F7ZA 1HKSA 4EM0B 2A07F 3PVBB 2KRFA 1ZARA 4JK1X 1V4RA 2GA1A 1R58A 5CVIA 2STTA 1U5TB 1BOAA 3NSTA 3ZMZA 4LULA 2IPQX 4MGRA 2EA7A 1ZRCA 4A5NA 2PQQA 1IN6A 4MQVA 3DFGA 4KWKA 2HYGD 1LNWA 5FD5A 4AIHA 5ED4A 3KP2A 4IEUA 3J80Z 3SCFA 2R7DA 4I98B 4HF1A 1J75A 1RTVA 3JAMZ 4B8XA 1FY7A 2OZUA 1NZCA 1O7FA 4QWQA 1TW3A 2W85A 5JVTA 1ZG3A 1ZZ7A 3FMRA 3F8MA 4U0WA 4LLGF 1DP7P 2HTJA 4RD7A 4XETA 2RV8A 4Q4ZF 3E6BA 5DEQA 1YFYA 2OAZA 3BOQA 4XRFA 5AIQA 1DUXC 1J5YA 3HSFA 2FMLA 3R0JA 4HLYA 1HSJA 3ZPLA 2R3SA 1OPCA 2A5YB 3NJZA 4E2QA 1X7NA 1GHCA 5ICFA 4G6QA 3VFZA 4PIXA 3I64A 3ZN1A 2VBZA 2XL9A 5JSPA 1B59A 4ZYDA 4HF0A 3KGZA 2HKOA 1QO0D 3QACA 3MCZA 3RKYA 2PFBA 1WWXA 4IRIA 3LZZA 2CW0F 4CO8A 4IEQA 4IEPA 4G7ZF 3RNSA 2HYFA 3FHIB 3QPTA 5FB2A 5FLHA 1UHWA 5TRDA 1ZNPA 4ENNA 1JHFA 3CLPA 4XSXF 1FNNA 4MQ9F 3RYPA 3KLNA 3FWEA 3CTAA 4HX7A 2A3SA 1QXRA 1AOYA 1MD0A 1XN7A 3K69A 2L54A 2ET1A 2XIGA 2QENA 1W5TA 4XF3A 2V09A 1CAVA 2ATFA 5JR7B 2PAMA 1KQ0A 2A68F 5D5UB 1ZGAA 2IXLA 2LKPA 2FSWA 2UYAA 4YYOA 4LLOA 2GAUA 2EWNA 3R60A 3P7NA 3H3ZA 5JCTA 1YG2A 3FXUA 2KJCA 3QU6A 1Q1HA 2QVSB 1A04A 3LOIA 3EETA 5CADA 3F21A 3RKWA 2EFQA 3JSOA 1H1MA 1O5UA 1LDJA 2IA2A 2D5FA 3WTXC 2XAGA 3ROUA 1S3JA 3B02A 1R5GA 2KXLA 3E6DA 3ETQA 1CAUA 2WV0A 2K86A 2DCTA 4H7LA 1O57A 2O1QA 3SMHA 4NB5A 2DO7A 3EJKA 4IRHA 2RQPA 3QAHA 4G6DA 1GQGA 4XF4A 1KA8A 1G4DA 1BI1A 2VODA 3GZ5A 2V79A 4HZFA 1F1ZA 2E1NA 3TDZC 2RGVA 1P2FA 3C1DA 4EV0A 4BXUA 1YYVA 3IKTA 4P9UA 1TTYA 1XGOA 3ZMUA 1TLHB 2F5CA 2QQAA 2ESHA 1RNLA 3BALA 6PAXA 5BPDA 1BC8C 5L3FA 4WVZA 4IVNA 1OMIA 3K0LA 4G7HF 4S05A 1ZX5A 4UBGA 1E17A 2IP2A 3M1EA 2F4PA 4EJVA 5E1RA 5K5QA 5E8IA 1LRHA 1TNTA 2ADUA 3LWFA 2AS5F 3NW4A 1KU3A 4KWJA 1S8NA 2XAFA 4UUVA 4XFHA 1ZZCA 1R1UA 1EP0A 2Y75A 1G6NA 5D5XB 4MTEA 3R61A 5LGNA 4OIPF 3CUQB 2QVOA 4LK0F 2MNGA 3KP7A 2DT5A 5AIPA 5CVRA 5HVQC 1CF7B 4KYWA 4WCGA 2HWVA 4LLLA 1R00A 1KYZA 2P5LC 1LEBA 2QJVA 2Q0AA 4AQ6A 2RC4A 5FO5A 2G7HA 1Y0UA 4A5MA 4MGKE 2QYOA 1UCXA 1J9IA 2M8EA 1ON2A 3HOSA 3GLXA 2NNYA 4A2UA 2HDCA 3WODF 4FX0A 1ZRDA 2ZCWA 2E9QA 5J48A 3P9KA 4L5JA 1ONVA 3P9CA 2RN7A 3ZN0A 3MEXA 3EUHA 4B09A 1YLLA 1ZREA 1RUNA 1ZLJA 4IESA 4BHPA 1ZHFA 2VPVA 4O9GA 3NKTA 1XMKA 1T98A 4UVAA 1WLTA 2F5EA 2K9ZA 2HFHA 4L0YB 2IA0A 1ZG1A 4PJYA 2PQ8A 4IEOA 2XLGA 4XF9A 2DQLA 4ENMA 3QRFF 4WXHA 3H8UA 1BI3A 3CL1A 4XFGA 1TQIA 5I91A 3HRMA 3F22A 2EV6A 2Q1ZB 4IHTA 5FLIA 2J5PA 5BV6A 4HA8A 2ELHA 4YFNF 1XCBA 3FX3A 5D6EA 1OI6A 4U0VA 2D1HA 3I7DA 4JTNA 1R22A 2MH2A 4KA4A 2XV4S 1DGWA 2IC1A 2LDUA 2PI0A 4DNCA 3HUGA 4EM2A 2FU4A 2QCSB 4XFBA 4LA2A 4HMZA 4ZYEA 1J0RA 4FBFA 1T39A 2ZBKA 4I2OA 2L4AA 5LHGA 1SEFA 2PBIA 2DPUA 2H6BA 4R79A 3OF1A 2J5OA 3JSPA 4G9YA 2XUBA 1FP1D 4JV4A 2VECA 2OD5A 4N9HA 2CGPA 3HT2A 3TNQA 5ILUA 4OIQF 3WU0A 3PQJA 2BGCA 2B5HA 2VN2A 4LK1F 4RB1A 2OYZA 1T0FA 4Y17A 4O6JA 3F8FA 4I0BA 5LEJA 2YPRA 4RS8A 5I0UA 3I53A 1UB9A 3LA2A 4Y13A 2E1CA 4L5IA 2O6GE 1KYWA 5DCMA 1LQ1A 5A2QK 2O0YA 3WGHA 4QGLA 1FBQA 3DPTA 2P5VA 4LD5A 5EEGA 5HS7A 5FLXZ 2OZ6A 2V9VA 2KJBA 2PN6A 4A6DA 2HTSA 2FQPA 2Q4SA 3O14A 5K5OA 5I0SA 4I3PA 4IEYA 3MPBA 5LHIA 1ZG5A 1J2XA 2JTVA 5HI0A 4HQEA 4LG0B 1JXSA 4MX3A 3NQOA 4FT8A 3KEOA 3GFJA 3FZVA 1ZVFA 2D1VA 4MHGA 4RGSA 3I59B 2VC1A 2D40A 3QOPA 4HN1A 2B0LA 1J3QA 2FXAA 5D4RA 5LBQA 3JZVA 4K8FA 5D5VB 1FT9A 1W7PA 2HOEA 2GXGA 1IXSB 4L11A 2DK8A 2Z33A 2HJIA 3OTFA 4BHCA 4HDUA 1QZYA 2M87A 1FBSA 2XROA 4ZZLA 3GW2A 4CXFA 3UKVA 1SAXA 1QBJA 3ECOA 4UVBA 2V6CA 2VC0A 4XBFA 4XFIA 2NYXA 3G73A 2P7CB 2CFXA 1MZBA 2BYVE 3CDHA 1ULYA 4P55A 4YARA 2XAQA 1PDNC 1DZTA 5C6CA 4XFAA 4F8AA 2NNNA 3IC7A 4GYGA 3DXJF 1OYIA 4HVQA 1IF1A 4ESJA 4MZUA 4AIJA 1CAUB 4KMFA 3IDCB 4IERA 1LR5A 4YFKF 2IA1A 1EH8A 3WTZA 4MGZE 2ZMEA 2I45A 2EB7A 2GC3A 1TNSA 1ON1A 1R1TA 2LF8A 1CAWB 2BNNA 1NYWA 1JGSA 2O3FA 3GEZA 5E1XA 1USSA 4HBNA 4I7HA 3K2ZA 4BH9A 2UY8A 1HQCA 5E20A 2CQKA 4KIBA 3V7CA 4QLCU 2K27A 3KETA 1D3YA 1O3TA 4J1WA 3ST7A 2QM3A 2XHKA 3V8KA 2GZWA 3J7AO 3LAGA 1OYWA 2B8MA 1P92A 1WI9A 3GYDA 5FPZA 5H6QA 2L3DA 3IBMA 4MUVA 5ILVA 4LGWA 1OKRA 2M5WA 1J1LA 1Q43A 5I8TA 1HXDA 1UCRA 2W57A 3BZ6A 3CJNA 5FQ0A 1BIAA 2DI3A 5BOXA 4P9FA 3RPUA 5IT3A 2A6EF 2D5HA 3V8JA 4EVIA 3HRSA 3U1DA 2Y0OA 4M9ZA 5K1YA 1U3EM 4ZU5A 4IHSA 1LJ9A 3H1YA 4EJWA 4KMUX 4ZH4F 3I4PA 1K7AA 1YFUA 1NXMA 1W4MA 1J7KA 3RTRA 2OZJA 2UXXA 1PP8F 4UXNA 5ICGA 3W6JB 4HVOA 4M6YA 1YFXA 1K78B 2HZTA 3SXWA 1VR3A 1ZH5A 2MHFA 3T8RA 1YLFA 4L9JA 4P5OA 3NRVA 4LUKA 5HDGA 3M8FA 4D7TA 3CO2A 3IKVA 1L3JA 3ZMVA 1SMYF 2GU9A 4ORFA 3D82A 1YHFA 3VOEA 1U12A 2EA2A 1Q3EA 1L0OC 1S7AA 2DLLA 4BQAA 2CSOA 2W25A 1DZRA 1BI0A 1LDKB 3KFWX 3KCCA 1QQIA 2A61A 3WW3A 2F2EA 1C0WA 3FMQA 4HV6A 3Q9VA 3F3XA 2MA3A 2FMYA 1UFMA 1P4XA 2EAAA 1VTNC 1Y9QA 5KHHA 1B9MA 3VEPA 4G94A 2KIUA 3H92A 4ESFA 3LQRA 1H9TA 4AXOA 1S7OA 1D8KA 2DBBA 3E5XA 1HKQA 4MGYE 2G9WA 1J3RA 3V7SA 1XSDA 3TO7A 4KDPA 3WU1B 1FXZA 3JW4A 3DL3A 5J3UA 3GWZA 4IRGA 5DCMB 3ELNA 2YU3A 5BXXA 5A2QZ 3RI4A 5HOOA 3EYIA 5CVVA 4PIYA 4XLPF 3T8TA 2ETHA 4MTDA 2OA4A 4XF1A 3P9IA 2L01A 2GIVA 1HSTA 3JAMK 1BN5A 1CX4A 4XF0A 4GYIA 4RGUA 2ZMEB
chains in the Genus database with same CATH superfamily
1JTYA 5JMCA 4CDWA 4XVHA 3E3VA 2GBYA 4IGPA 4COUA 2G7UA 2PG4A 5GZGA 1K4TA 3N97A 3CC7I 2PMUA 1QJU1 4S04A 4JDOA 1OURA 1NA1C 1WW6A 3LL7A 5BYNA 1OD5A 5A3OA 4BE2A 1DHKB 1SQ4A 1YEWA 3WQBA 4EE2A 4WVMA 5FZEA 2Z69A 3F8CA 2WL1A 5B1AH 1D2QA 2HI3A 1VAKA 1U5YA 4NHLA 5ABJA 2XC7A 4UBHA 1WZXA 1W5SA 5FZ9A 1S0DA 4UXAA 4ATEA 1TZLA 5EHDA 3GVAA 4XEZA 4OI4A 4KJZA 4BIOA 2R071 3H1CA 1OF3A 4HOOA 3RS6A 1RUC1 3C2GA 2B4KA 1AR91 2BVMA 1PVEA 3DU6A 1FYKA 2K9QA 1UY1A 4M9SA 1F36A 5DV5A 1LNSA 3BPXA 3KM5A 2A6YA 1V70A 4LT5A 2WB1N 1R1A3 1FNZA 2XONA 1B6AA 1YIPA 4QX0A 2EFPA 1TL8A 3KT4A 3CCLI 4YLZA 1KU9A 4M4PA 1ZGWA 3AG3H 2BFUL 1QZZA 1W8WA 2A3WA 2K9MA 4FPOB 1B35C 4CU8A 2K4JA 4HLTA 4EGZA 2CDPA 3UR3C 4EQQA 2IXCA 1W6PA 5FZOA 3REOA 3BR2A 5TGTA 3FXJA 2AEYA 1NG6A 3H1WA 4DNYA 5CVJA 1UELB 1XSRA 1LPQA 1ETOA 3I0TA 2X51A 2VJ5A 2XGDA 2ERFA 2DA7A 4OOIA 5J4YA 4EYUA 4Z07A 3W2VA 3G1MA 4Q0PA 1ENRA 1CJPA 3T08A 2AO9A 3K1MA 1DCSA 5I0TA 5J3LA 5D6FA 1H9WA 4BGDA 1EPZA 1ND2B 4L5EA 2CU7A 5CFDA 4FAGA 5CQGA 2E1MC 2JD4A 1YITI 1X4PA 4AF9A 2OTLI 3OMYA 3GCMA 3OBRA 3MKZA 3N9PA 3LPFA 4RLQA 2R5YA 3DEEA 1UIKA 3QU3A 5G04L 3TOBA 3BG3A 3A02A 4LOCA 4HW0A 1YX5A 1OOPB 5EEAA 4FISA 3WD5A 5CPRB 3C18A 4AI3A 4BXSV 3NJVA 3A4CA 2NP0A 1SMVA 3GZ6A 2ES3A 1F31A 3S93A 2D6KA 3ZQGA 2RNJA 4KWUA 2VOOA 4UB6C 5DD8A 2MD5A 4NJ4A 5E1WA 2NAZA 3ZR6A 2VULA 3HBZA 2OQGA 1CR7A 3T5XA 5KBFA 3DEMA 4M3FA 2ZGNA 4OINF 2Z9OA 5F0HA 2GNTA 3ZSMA 3TDUC 2ZZJA 3KV9A 2WLQA 5HCAA 1CN1A 1NA1A 3IRQA 5IK8A 4RB2C 4RR3C 3O6BB 1SPPB 1MJ9A 1HRV3 3ESWB 2VZVA 2LVSA 1FJLA 1V6OA 3CCJI 4ANJA 3U1KA 5FP4A 5DYMA 5BPIA 2M30A 1D0GA 4EJRA 2ZO4A 4HAMA 1GXPA 5JFRA 2HWF3 1FOKA 4X6QB 1IAWA 5FJHA 1AR72 3JRBA 3NVCA 5HCBA 2CUZA 3AKZA 2C9KA 2VONA 2ZEWA 1B4AA 5TJJA 2CYYA 3WF3A 4NPLA 1IPKA 2WZR2 3GBGA 1VRBA 2ZGUA 1GQPA 1FSEA 1U8RA 3ZP5A 4BNCA 2OPKA 2VZQA 2WNEA 1B1BA 4QX3A 4W6XA 3IAQA 5CZKA 1RUI1 2NRAC 1IJWC 3MLKA 1C57A 3DBLB 4OIOF 3ZXJA 1SD4A 2CTVA 1I3AA 2KKOA 5FXVA 2A6WA 2F4IA 1QNTA 3VBFA 1ZR2A 3ECHA 4KT6A 2MEV1 1K78A 3VBHA 5JSRA 1LTEA 2O03A 2MW8A 4LO8A 1HV0A 1F4KA 1ZYBA 4TN7A 4PDWB 3B69A 2R7XA 2G9ZA 2Y6JA 2Q8OA 4YVWB 5GAEJ 2QE3A 4DJAA 2VZTA 4A3IJ 3UETA 2AACA 4DZPA 3J8F1 2D6NA 2G9FA 3CJIA 3VV1A 1R083 2VKHA 3K48A 5E18F 2Y69H 3K4BA 2X29A 1SC7A 5FFZA 5IAXA 5JHFA 1IS4A 1HJGA 4HOBA 3A03A 4ZU7A 5K0UB 2CHHA 4A7ZA 3HRUA 3ASNH 3M3IA 1RYYA 1QJU2 4GMP1 1OQDA 5K4LA 1MJAA 1XYPA 3WW1A 1W9FA 1VB4A 3SC7X 1OFSA 2DFBA 2DDUA 2CWSA 2O14A 4PHZA 1MBGA 2I2SA 2P5BA 4AQ2A 1POV1 4P9XA 3QP6A 3JBG2 3JRHA 2ZXJA 3WW4A 2BQPA 4XMAA 3RZZA 2VXZA 3BTXA 1WQ2A 3OY8A 4UUSB 5BNNA 1V5FA 3BCBA 3CF2A 1SFEA 3LFMA 1F8VA 1OA3A 2ZJPF 5DPNA 1W2TA 1YUDA 1WD4A 3ORJA 2RDRA 3NKGA 2B63J 2R0QC 4LE4A 4XC9A 4HDVA 3LSDA 3WLUA 3MQ0A 5FZ4A 2Z16A 3AFHA 4NWVA 4CEWC 2M9HA 1Z3YA 1CZVA 2VT2A 2AGSA 2YHJA 1TT5B 2P17A 5J8FA 2ORXA 5A3LA 3ZM8A 2CDOA 2ISYA 4HQMA 2NOGA 3T1MA 1BOBA 4FAHA 2GMMA 2VBXA 4WF2A 4D6QA 4EN6B 3HVDA 3BTLA 4RSUA 1KQ9A 3PUHA 3T0DA 3O0XA 3ON7A 2N8GA 2IXHA 5FLJA 1Z7LA 5FZKA 4CCLA 2VQTA 2J1RA 3K6GA 2DU9A 4ZDPA 2LH9A 4AFMA 4KFCA 2XKPA 4BCUA 1IRZA 1QDCA 1DGWY 4JKLA 2R7SA 3MLJA 1RUD1 1MMSA 2Y48A 1P8JA 2P1BA 4OHZA 3HD8B 4MO3M 4FX4A 1EF4A 2CWEA 4AVPA 4IGOA 4PF5A 3K2AA 3ZDSA 4AHYA 3HZJA 1HW1A 3Q8CA 3OY9A 5BMZA 4HNVA 4URAA 2AQFA 2Y6GA 1P4AA 5T5JA 2FDIA 2PHDA 4PLOA 3ZSKA 3ZQLA 2W1UA 4AIKA 4DS0A 3DKXA 4C90A 4A3ZA 4Z82A 5CYVA 1SD6A 2V1XA 1PK6C 3HHGA 3NV4A 2MFZA 1BW5A 1KQ8A 3NO8A 5IP6A 2E2IJ 1EAH2 2A7AA 2H0VA 2WQ8A 1K6OA 2OV7A 1YXWA 2M3AA 4HT1T 3WE3A 2VUJA 5L7OA 3DXUA 2PHRA 1ODNA 5GAHJ 1NG0A 3SH4A 3MIGA 1ZGJA 3PSIA 3BTAA 2UXNA 5F3CA 5L3CA 2V4JC 3PM1A 4XDOA 1S0FA 3A4UA 4FPJA 2K02A 5FLXK 3WG3A 3KB5A 1UMHA 3MICA 2RR11 1QPMA 1DQ5A 2Y38A 4JVAA 1OF4A 5FKCA 2ZNZA 4M74A 2BPA2 2HWF2 1QU0A 3KCXA 5KC5A 2D93A 5E1ZB 1QPIA 1MQTB 1Z77A 3A23A 1JYXA 5FP8A 2LALA 3ABUA 1V9U3 4IKFA 1WZ2A 3K4JA 3LQQA 3GX4X 3HJRA 3HT1A 4PDWA 5DUKA 1JKQC 1LVAA 1G9FA 3OIPA 3WQ7A 2XGXA 4M73A 5I93A 3BI3A 1FOWA 1IGNA 2JMWA 1D5YA 3JD71 3FFQA 4FPYA 2ZXIA 3N9OA 5LRSA 1YO8A 4D6RA 3ACFA 4N53C 1H9GA 3VLBB 1REPC 3AM2A 1U2WA 1YQAA 4DYRA 2WA3A 3O1OA 5FBJA 1G3YA 2LYCA 1VJ2A 2WLPA 5FRAA 1G7YA 3TO6A 4COVA 3B9IA 3BYWA 3CMAI 5FXZA 1LULA 2BBYA 4WVWA 2FDFA 4LB6B 3WX5A 3RJ2X 5ACA2 4HSJA 1E2XA 1REEA 3QYFA 4DY3A 2DTWA 1LDDA 1G8WA 3VBRB 3HOBA 1QJX1 2EFWA 1UZCA 2PJRA 4AAXA 4NC7A 3UNGC 3CQZJ 1CPMA 2R32A 1QHDA 2R063 4RGRA 4Y4RA 5DUIA 2CQXA 1JHNA 1G9BA 1JYIA 3LDRA 4BMEA 3MN2A 2BRTA 4QX5A 1XS9A 5APAA 1MQTC 1BR4A 4QPWA 1NY71 3N9MA 4JQRA 2VMGA 2JUGA 4GZ9A 4W6YA 1DGRN 4X1EA 1LEDA 2WB1A 2AXLA 1CAVB 2OQ6A 5KXEA 1GOHA 1PGW2 3BU7A 2BEOA 3S16J 2CS3A 3AKPA 2QUFA 2VJXA 2JD9A 5JDBA 5F37A 3TEDA 4RHV1 4P5HA 3CJXA 2VT3A 2P6SA 3VBOB 3GFLA 1VQMI 1CQTA 1GOGA 3V64A 4E2GA 2ELKA 4LORA 1L3LA 3L00A 4E70A 2M4GA 5A33A 2PMHA 5JI7A 2IVMA 2YSRA 3RRDA 4LJZF 2NQYA 1RI7A 1H30A 2ZSIB 2VCBA 5HXVA 3U0ZA 4MO7A 1UU6A 3ACIA 3DQVC 2E5NA 3I58A 3K4MA 2VQLA 2P6TA 3POGA 3MAJA 3QPSA 4J19A 2OF7A 1TBXA 1JUHA 4V19K 4OFGA 4D8MA 1I1SA 3CJQB 1GMMA 2JK3A 4ARYA 2QSFX 4FPFA 1MVEA 1K42A 2AR6A 4UF0B 1MBEA 1Y3TA 1P7IA 5FYCA 2BHYA 4NC8A 3FL7A 1UMIA 4AWDA 4RQPB 1WA4A 3CUQA 4IZZA 1VBC3 3ZMOA 4GULA 2YU9J 2VOPA 2DOFA 1W04A 3KV4A 2WNUA 1BM9A 4JRAA 5EEHA 1WMXA 5HLTA 2YPDA 1WCUA 3V7RA 1UQXA 4AVAA 3ELKA 4D0QA 4UHTA 4A0YA 3C7JA 3LIHA 1JZ5A 4FP3A 1TMF2 1BBT1 2XLFA 3K1PA 1ND3C 4M0NA 3PUAA 3U07A 2DOAA 2V4AA 3VBOC 1ZTRA 2GNMA 4Y22B 2BP6A 4E7JA 2K7LA 2IVJA 1O5LA 3RFRA 4CUGA 1R081 1IN8A 1XPXA 1WCKA 4LTAA 4IXAA 2VZUA 1ZN2A 2KRCA 1I1EA 4WK8F 1JJ8C 2R7RA 4M6XA 3OSDA 3PU8A 4A0ZA 5H6RA 1IO2A 1XDSA 2TCTA 1AX2A 1UY0A 1Y4WA 2Q8DA 1P4WA 1U78A 3FC0A 2EH3A 2HNHA 1BVVA 2QQNA 3P6BA 1YW8A 1ENQA 2YX7A 3QWLA 4RAYA 1HC8A 1WW5A 1RZ4A 4OI0A 3NV2A 4ASKA 1ZZBA 2MPFA 4CYCB 2PJRB 2E19A 1KD7A 5IJRA 1E57A 1ZRIA 2ZKZA 4BL0B 4RGXA 2Q2EB 1VAVA 1WI3A 2HWC1 1OYYA 3O1UA 3IWFA 4K2EA 2LTPA 1W05A 3NWKA 1U5XA 2YZ4A 2L4MA 4YM1A 4HXCA 4YZ4A 3PDQA 1IV8A 4FI9A 1UU5A 3AKQA 3TO9A 5E8AA 3GTLJ 2WFPA 2FHRA 5JWPA 2JSCA 4V2WA 4E7HA 2FJ1A 2E7XA 3LFKA 3S6PA 2PTMA 5CAZA 3QH6A 1OFNA 1W6PB 2EIKH 5EP9A 1H8TC 1GDTA 4CA0A 3FN9A 1JU3A 1O3SA 1XXNA 4M9XA 3CCUI 4L2NA 4OHYA 2LY2A 2XPWA 3VDDC 1D8JA 5CU1A 2STWA 1ZBE2 3HMYA 4QXBA 3ERMA 3LOCA 3ZKUA 4DXSA 3CO6C 1QF3A 3DCQA 4WM8A 4PDKA 2DQRA 1X33A 2QQKA 2VE8A 5ACA3 1X3WB 2Y2ZA 4KT5C 2NOJB 1BR1A 3T0AA 4A3GJ 3E7LA 2VLAA 1EUUA 5HS8A 1OOPC 4ITVA 4I01A 3M4OJ 4ZYGA 1A78A 3AX4A 1KU2A 1C4RA 3V0AB 1W8FA 3M8LA 1Y1WJ 2VZOA 1W3VA 2RAEA 4QU1A 2KR2A 2DOEA 1LOFC 2G0EA 1V3FA 4O9EA 3WG2A 1B09A 2Y0SA 2WZEA 3GO5A 4F7ZA 1HKSA 2A07F 2KRFA 3CJRB 4BUPA 1ZARA 4NIHA 1V4RA 1R58A 1DLCA 2VUMJ 5L7OB 2JRMA 4ZHNA 2IPQX 4HL0A 2EA7A 3J8F2 3N7MA 3N35A 3VBSA 3H42B 1T33A 2GALA 2DYSH 4P08A 1WHUA 1OKOA 2DDBA 1VQ7I 1LNWA 2E5ZA 1UZVA 4HK9A 2WAEA 4PFPA 1B72A 4I98B 1RETA 3ZXLA 2PN5A 4I76A 4HF1A 1J75A 1RTVA 4RGAA 2EIGA 4Y4YA 4B8XA 1FY7A 4E6KG 4XHXA 2OZUA 1E5HA 1AJOA 2CQQA 1TW3A 1POGA 5JVTA 1ZZ7A 2BXYA 3F8MA 2UV1A 4EATA 3PUQA 1DP7P 2HTJA 1RUH3 4D7MA 3TW6A 3CCYA 1SVLA 3K3OA 2GNDA 2J7MA 3BIEA 3HSFA 3AP4A 3KF5A 2DYRH 2YU2A 1V5EA 2A5YB 3NJZA 3POJA 2EZHA 3PNTA 3UL2A 5ICFA 2KL4A 2QF7A 4RA2A 2ZJQF 1AKHB 4ITCA 2AUYA 2OCEA 1KFUL 2VU9A 5GZFA 4YVSB 1LOCA 1MSFC 2XJQA 3S57A 3IH2A 2RREA 2R1DA 2HKOA 2IGOA 2DFCA 3QACA 3BN6A 3RKYA 3IKWA 3WHBA 2PX9A 2JDYA 3K2OA 1D0XA 2KDZA 4XDQA 4G7ZF 2O7OA 3RNSA 2HYFA 3OYCA 2XB6C 2H8WA 3TWIA 1ZNPA 2HDDA 5F08A 4CSWA 1JHFA 4K9SA 4MQ9F 1RESA 3CTAA 1OLME 4BE0A 2A3SA 1AOYA 5F9TA 2JDKA 3PMEA 3A7QA 3NMBA 2XIGA 3AZVA 4XF3A 2V09A 2ATFA 1GANA 3OB8A 3DKQA 4Q4W3 4XRSA 5FZAA 5T55A 3VD3A 4YYOA 4XKCA 1X1PA 2GAUA 2F48A 4LITA 1Y9MA 1KITA 3AYEA 1YG2A 4CEWA 5LD2C 3GCWA 4RGKA 1LU1A 3EETA 5C3RA 3PO2J 1OUSA 2OIIA 2NS7A 2DUOA 3JSOA 4JCKA 5A1FA 3OUJA 1A6QA 1FTTA 2E71A 1LGBA 2XAGA 4YZ5A 2GM4A 2DA3A 3E6DA 4S2FA 1Z0XA 4YZ3A 2HBTA 3U14A 3GZTB 4UY8I 4FO9A 2WFF3 1O57A 1C1FA 3HNBM 4XHBA 3JCUC 5LA1A 4B1LA 2ZHMA 4L92A 5H9PA 4Q4V3 4YM0A 4IRHA 3AMMA 4G6DA 4AAPA 1MNDA 5K0UC 2V79A 1F1ZA 2P81A 2E1NA 4PBOA 2GH8A 2NVTJ 3PVNA 2X85A 4IV3C 4EV0A 3S3NA 5GLTA 2VZRA 4UFMA 3ZMUA 1TLHB 3AVSA 1RHI1 2ESHA 4BK5A 1RNLA 1UY4A 6PAXA 2R4GA 2OC6A 1H8TB 1GZWA 3W58A 4IVNA 1OMIA 1ZKGA 2R5ZA 1W5CC 4E27A 2YU1A 4DFSA 3KS7A 5EXOA 1J1TA 4UWDA 4E7LA 4CDUA 3LWFA 2AS5F 3NW4A 1Y9GA 2RG4A 1JN2P 4XFHA 2DODA 3CCMI 1MPXA 3RWNA 4MTEA 4XQ4A 1Q1VA 1NCRB 4LK0F 2VIXA 2CY6A 2MNGA 4JGYC 4ZKTB 1WCMJ 5CVRA 5HVQC 1CF7B 4KYWA 2DWRA 3C7HA 1HB2A 4WCGA 4JGYA 1R00A 4LLLA 2AC1A 4B1RA 2R49A 2VJJA 5FO5A 1XTAA 2P2KA 4MGKE 2L9NA 2UWCA 4PUSA 4GH4C 1ON2A 3KQ4B 3HR9A 5A7PA 3WODF 5DM6F 2ZCWA 2E9QA 5J48A 3P9KA 1W0PA 2WWSA 3MHZA 3ZN0A 4CP9B 4YWAA 3K4CA 2CW8A 2VW0A 4B09A 2HWB3 1ZREA 1RUNA 4IESA 2WABA 1JKRC 2DJIA 3NKTA 1XMKA 4HKWA 1T98A 4UVAA 4ZXKA 3FUQA 4CDQB 4L0YB 4COWA 4PJYA 2RE9A 2WZ8A 4BA6A 2X48A 4WXHA 1LCLA 3NJYA 2D5VA 1TQIA 1HA8A 3GJAA 4PF1A 1NQDA 5FP7A 3WHUA 2EV6A 4DIQA 4C2TA 4IHTA 5DDJ3 3DGTA 3LPGA 4XN0A 5C4WA 4YFNF 1XCBA 5D6EA 1D1AA 3JQXA 2DXIA 2D1HA 3BQZA 4HKOA 5K9YA 4XMIA 5BNOA 3H8XA 2MEV3 1Y0NA 5H9QA 3I2KA 4NIGA 4DNCA 3LSMA 3HUGA 2HLEA 3KT7A 4XFBA 4CEWB 3BZKA 4ZYEA 3VBFB 2L7KA 1J0RA 3V0BA 3M7AA 4FBFA 1R4NB 3VPRA 2L4AA 4S2GA 1HOMA 1ALYA 2LP0A 4QHOA 3WQ1A 2P3KA 2PBIA 1V00A 2DPUA 2J5OA 4ZONA 1V6JA 2VECA 4B3AA 1W0UA 2R7ZJ 2G1MA 2DCKA 4BQXA 1V9U2 3ZXKA 1O59A 3TNQA 1JYWA 1OUXA 1T0FA 5LEJA 1WUVA 3RVHA 4Y22A 3CESA 2OTJI 3Q3SA 1RIRA 4O7XA 1UB9A 3UV9A 4B1MA 1ETXA 2YB7A 1Z21A 1STMA 2E1CA 3J4UH 4R9AA 1PZ7A 1KYWA 3LEMA 1SFKA 5FZIA 2L0KA 1O8SA 2O0YA 3OIOA 2IGMA 1YI9A 5FMBA 4AK3A 4OAZA 2WADA 4NMIA 5FLXZ 3K7AJ 2OZ6A 1H8AC 3KWVA 4N4NB 4XOPA 1UF2C 2JA5J 2XF7A 1QGLA 4BJTA 5K5OA 4RBOA 5FZOB 4I3PA 2XXZA 3MPBA 1SDDB 4LBNA 3VBFC 4GB31 4HQEA 3K10A 3MD2A 3CZJA 4FT8A 4AEDC 3GFJA 2ZJCA 1OT5A 2Y30A 4OVEA 1ZVFA 2LREA 2D1VA 4MHGA 1US3A 2XB0X 2VXJA 1UL9A 5JXHA 1J3QA 2FXAA 4AEJA 1W36C 3LF7A 5D4RA 3JZVA 4Q26A 2JQ7A 5CFCC 2W9XA 1IXSB 2TRTA 4IV1C 1M06G 4GQ7A 5ABJC 3ABLH 1WH7A 1UG0A 2M87A 4UYBA 2XRLA 3IT8A 2VC0A 4XBFA 4BJ5C 4XFIA 4YFWA 1H6XA 3I97A 1MZBA 1GUUA 1X1DA 3KQRA 2J42A 3IH3A 3RQ0A 4BB3A 5CEHA 2NNNA 1OYIA 1IF1A 2NVYJ 5DDJ2 4AIJA 1CAUB 2WQZC 3G1LA 5A3WA 4DUWA 2IA1A 2ZMEA 4PT6A 4DMIA 4AR2A 4CEYC 2P6CA 2RJKA 4P02B 5J1UA 1NCQA 3ZVXA 3MLLA 1N3QA 4LXLA 4D7NA 2O3FA 2JE7A 5E1XA 4XXAA 3TAYA 3FFZA 4HBNA 2GIZA 2JN6A 3K2ZA 4BH9A 2UY8A 1HQCA 1UZZA 2BGPA 5C5UA 2W3JA 3OYMA 4KNCA 1NH3A 5FROA 1X1CA 4GJYA 4XQWA 4LQRA 3V7CA 4QLCU 3IAS2 4J1WA 1VBD1 3ST7A 2XHKA 5F8PA 4A93J 2XR4A 4Z2AA 2QDNA 2WJSA 1OYWA 1AKHA 3X29B 4X8NA 1V0AA 2XF6A 3ASIA 3IBMA 2E31A 2HPMA 2QQUA 3HNMA 3O1PA 1RB8G 1ZA7A 4AHWA 5I8TA 2EQRA 1HXDA 4LOSA 1JKOC 4AEDA 1GNYA 3O7OA 4P9FA 2QQ8A 1AYN1 4EN9B 1DQ1A 2D5HA 3V8JA 3HGGA 1BQPA 3U1DA 4QX2A 1LHWA 2ZS6B 4EJWA 4KMUX 1N1SA 1AJKA 3WV6A 4IQJA 2C6SA 1PP8F 5ICGA 4HVOA 4L9JA 1RJ8A 3NRVA 4H4KC 4LUKA 1YC61 3OYKA 3M8FA 4CU6A 2D3RA 1PIV2 3L2WA 2G9GA 1POV0 2RDNA 4FFFA 2H1LA 1YHFA 1JTZX 4A45A 1Q3EA 1S7AA 2CSOA 3MKLA 2HVQA 1QQIA 1C0WA 1EV12 2FBEA 2EXKA 2R1BA 1Y39A 1OJLA 2FMDA 4YW5A 1RMU1 3VEPA 4G94A 3AG4H 3H92A 1H9TA 1D8KA 2DBBA 1QJU3 5C8CB 4AU7A 2P34A 1J3RA 3TO7A 4KDPA 1KXGA 5J3UA 5DG1A 3GWZA 2FUG2 4XUQA 1JI6A 4J6GA 5A2QZ 2ZOEB 3RI4A 5HOOA 3EYIA 1QRYA 2P3YA 4D5FA 2CRGA 4NIIA 4IE5A 4FQ4A 2OA4A 3JAMK 1BN5A 3EYPA 2ZMEB 3BTCA 1CX1A 1CZTA 1QGPA 3UKTA 4CXYA 3N05A 1W2OA 1UU4A 1LGCA 4Z2YA 4U36A 3WU2C 3DUIA 1ZR4A 1G9CA 4IOCF 4IGQA 5AC92 3WW2A 3ZMDA 4F3QA 5CKQA 2ZGOA 2RMU2 2KIFA 1FLIA 3OG2A 2VUCA 3ACLA 3VZJA 2HQNA 2Q0OA 1BI2A 1PGL2 1AR81 2JT1A 1QJFA 1QOTA 3T4VA 2YPJA 1E0EA 3GBFA 5JMOA 4ES9A 4M0HA 3U11A 1FEXA 3HEFA 3FKJA 4FPEA 4OMZA 4XORA 4GIQA 4YIIA 1DPRA 3JR9A 4PIZA 1AVBA 3WTVC 2QEXI 5J4VA 2PHUA 1RUC3 3L2UA 3IPVA 3E5QA 5E3MA 2H8RA 4IHXA 3M3YJ 3AXEA 2NVQJ 4J1XA 3MWMA 3FLRA 1XX5A 2LD5A 2FRHA 3WG7H 1PMIA 2VJ4A 3M4FA 2N7GA 1ND2C 5LRRA 5EWSA 1AYN3 2W94A 3IN9A 1H89C 3AG1H 3MW4A 5KAFC 4AGVA 3CLOA 1IW7F 2IJLA 4UW5A 1OR7A 3WE2A 1JE8A 3U10A 3S32A 4R9CA 1QJY1 1WFXA 4W65A 3ZR5A 2XH6A 3NAUA 1LOFA 5KK1A 1SLLA 2GQQA 1S29A 2ZXHA 2YC4A 3WTUC 5FPXA 3WTYC 4FCAA 3SEQA 1UHSA 1NHAA 4KIGA 1HW5A 2WT0A 1IXRC 2O0OA 3F72A 4H55A 4LB5A 2MLGA 3VHOA 2W84A 3P1IA 4M3DA 2W52A 3BVCA 1W8UA 4PGGA 5A1LA 4KWLA 3WDVA 1HRI2 4NHJA 2FQ3A 5C5TA 2WT2A 3POSA 4RLFA 5BPXA 4AFAA 1QXJA 3RDIA 4QQPA 4L9VA 1JZ4A 3FHNA 1LAJA 3CUQC 2WWJA 1DPUA 3FM3A 4WXDA 4L8QA 3OOXA 1TE1B 5IP9J 4RDUA 3VDXA 3ABKH 3ZYFA 3L2CA 4CDXC 4AEKA 5B4NA 4HVRA 4YNIA 5FZGA 3S0MA 3UYJA 4IF4A 2LK2A 3IMMA 4J01A 4A69C 1UKRA 4UV9A 1O3RA 1IRGA 1WBLA 1X9TA 4B4PA 5CFDB 4UFLA 2VXDA 2JA7J 1FSHA 5M5WJ 2V7FA 4ESBA 5F64A 2X1EA 2CG4A 3FBNB 3FXLA 2DUPA 5JAXA 3GZUC 3V65A 3APBA 1JOPA 3ZSJA 2VE9A 4UNOA 3Q9SA 2XRNA 2FQ4A 3K1NA 1K5JA 1MKMA 2WWYA 4E7IA 3CMGA 1IN7A 3FXRA 4UVCA 2QLZA 2QBYA 1HB4A 1W8ZA 1WLCA 3GYHX 1TNRA 3PL0A 5KHJA 2F5FA 2OU2A 1YFHA 5BQTA 1U5TC 2FBIA 1VMHA 2DVAA 4KI5M 1W7PD 5GTHC 1OC1A 2Z5WA 3EDPA 5LHHA 4XJUA 1Z1DA 2X9DA 3OOPA 1WMDA 2R072 2WS91 3KX2A 4BQ4A 1W6MA 3CZUA 3ZRGA 3WTSC 1IGOA 3I56I 1K4SA 3CDIA 1YQCA 1WLWA 4KH9A 1SLCA 2K3PA 3S2WA 1S7EA 1JXNA 3PIGA 3VZKA 5EJCA 1BA5A 2DMUA 3GTQJ 3DTIA 2ZEXA 5HS9A 3HDDA 1K5MB 5JR3A 4OAYA 3MKWB 1RXGA 5HLIA 3IHUA 1C1LA 1G3WA 2EIEA 4YIRX 3FXOA 1C8M1 1S0EA 3TN92 3NWTA 1W36D 2GXBA 1N3OA 2RM22 1T95A 1RPWA 4PSWA 5SV8A 2A5WA 3OR1C 3WG4A 1AR61 4QAWA 4KICA 1HB1A 3THDA 3NNGA 3KEQA 3LE0A 1JZ3A 1U0AA 4OHVA 1FPN2 5JXJA 2JECA 4ENJA 2XJRA 3CF5F 2V6EA 2LBFA 2GN7A 2ZJ2A 4PJJA 1BC7C 4LLFA 1E3HA 3EBRA 1ENSA 3K51A 4II2A 1HXS1 1O7LA 1KDMA 1RUG2 2VMIA 3MEPA 2EK5A 1I6HJ 1QHHD 3J26N 2BOIA 4CDWB 1MBKA 4CP0A 1K3IA 2BY3A 4EWEA 4NE9A 2VQUA 5DM7F 1M1EB 4LK7A 3VHRA 2H09A 3OY8B 3ZN5A 3G2BA 1QY4A 5KWRA 4U88A 1CAWA 3U2RA 1YYNA 1K45A 2LF7A 2HWD2 2ZGLA 3VHNA 4QM9A 2BNOA 5IT6A 1PVC2 2MG4A 1X2NA 1LECA 4LFUA 4LUMA 5E8GA 4XTPA 5FYZA 2DK5A 3J81K 1KGSA 5LBBA 2QBYB 3KZYA 4BYYA 1QJEA 3WCRA 2BWAA 4C0HA 3SDGA 1MMDA 4CDWC 3VDDA 1GZTA 3ZIWA 4OUSA 3SEPA 1ZA4A 1NE4A 3JQWA 3U37A 1LHUA 4E7KA 4M4RA 4YW3A 2GC0A 1V5GA 5L7OC 1Z0HA 1B72B 2BV6A 5D5WB 3JRDA 4NVPA 3KP5A 1GQHA 2ECCA 1OQYA 1TG7A 3MV11 1ETYA 2XWJB 5IT9Z 1YIFA 3ZX7A 3O1MA 2W1SA 1GVJA 5L3GA 1ENHA 4QSHA 3HYIA 4FVVA 5GLWA 2PLYA 4M71A 3FF5A 3M9AA 3BUCA 2WC2A 2IXIA 3URFA 1W3XA 3HXLA 4U7DA 4XURA 3H7JA 5BNNC 3IRRA 1SDWA 2PLV2 4COZA 4F93B 4MGIE 1D0ZA 1IKPA 3ERED 4EROA 2ORZA 4DQ2A 2XWBB 4XUPA 2L02A 4C9YA 4AQSA 3CZ6A 1C28A 2MGQA 3WF4A 3BG5A 5E17F 1HRI3 2BXZA 4AHZA 4NQWA 4RS5A 1GT0C 2WYFA 3KP3A 3RCOA 2UU8A 4JGZA 3CCVI 1W9WA 3K4LA 3TP0A 1S2BA 1GXQA 2DMQA 1VIWB 4KNYA 1HBXG 1H1IA 4HEA2 2E7QA 3WQ0A 1VRH1 3AK0A 2W00A 4XILA 5JXIA 1HV1A 1PX4A 4Y1ZA 1RL3A 4A3MJ 5A7QA 1W0OA 2CGOA 1AHDP 3BODA 2W5FA 3A21A 4CDGA 1X1BA 3O2PE 1OVPA 4KQ7A 1RUF3 3LA7A 3IAM2 4BHBA 1ZAOA 5A3UA 5GKAC 2FDHA 3GM8A 4LE3A 1PM7A 1T08B 1UYZA 4QPIA 3KIOA 2QBXA 5C8WA 9ANTA 4WXCA 5LY2A 1IQDC 1X1AA 4NOTA 3MFKA 4CICA 3AMQA 3AZXA 2JX9A 4JYKA 4YM2A 3FMSA 1FMD3 4DZGA 2K9SA 3M7GA 4L0ZB 2HYJA 1Q8VA 5L3BA 3GF6A 3R4KA 4RM2A 2XUEA 2R16A 1AF9A 1F5TA 1KGYA 3J7HA 5GJ6A 1VZ0A 2XMLA 4JX5A 5DAXA 5IVFA 2E51A 2Q2EA 2VOWA 4XCBA 2P8TA 1JMUB 5C8CA 3PHMA 3OJBA 1W90A 4Q8LA 4NPMA 4PI0A 3KYCB 3GZEA 4Q4Y1 5FY1A 1WRJA 3NNLA 3VD5A 1STZA 1GBGA 4BQYA 4EZHA 4HV5A 4HNUA 4FE7A 3OBAA 4IPAA 2ZHKA 1HX6A 5KHIA 4A0XA 2XKOA 1LFPA 3PNYA 1HXS2 1RUG1 1CAXB 1WSUA 2BW3A 4CRQA 1ZRFA 4E7ZA 1YRZA 5F1RA 2CO5A 1N47A 4XL9A 4Q1RA 2VQHA 2C9AA 3JXSA 4L9BA 2ESNA 2YDEA 1FNYA 1QOSA 1UXXX 4CCDA 5CG9A 4Q0UA 2F4OB 2ID6A 1LEAA 2W47A 2Y9ZA 3BIWE 4L9NA 3THCA 4UUSA 3MIBA 2MD0A 3P3NA 3ZFGB 3WEZA 2TEPA 3CUOA 1I1GA 4Y15A 3TEYA 1RUJ1 1E3OC 2WIIB 2EICA 4B3XA 4JP0A 3KZZA 2VKEA 3ZIXA 1DFQA 3KP4A 4HNTA 1MS3A 5C9AC 3QPHA 3HOZJ 1DYKA 5FPAA 2LW8A 3OYDA 5FKOA 2Y6LA 1W2UA 2A70A 5JI6A 1R1A2 3KVBA 3MI8A 3LSJA 2RS31 5DABA 2M8GX 1XYOA 2W48A 3FKIJ 3OGJA 2WV1A 2O8KA 2MC3A 1IZ1A 2G4IA 5GZEA 5JOYA 1OXCA 3Q8EA 1W8HA 3KLOA 1AUYA 3L2HA 3VL9A 2XPJA 5B3SH 3NARA 4ASNA 1ND2A 1ONAA 4N53B 1RUF2 3ITQA 2WS92 2TUNA 5K0UA 1XJAA 2WYSA 3HHHA 3OUIA 1BJQA 2R0HA 3HKZA 3W6VA 3T0YA 2D98A 3OIQA 3SJMA 1LGNA 1K6YA 5EG0A 3I71A 1WKMA 2KDOA 4P1WA 1W8NA 5E88A 5BNQA 1MGTA 3KZ4C 4FTSA 1G3TA 3F6VA 5LLQA 4XABA 2F5VA 3S1NJ 3MVPA 1IXCA 4GGGA 3OL3A 2YS9A 3I49A 5ANQA 3J7NA 2VPLA 5DZFA 5FDBA 4A6EA 2RV9A 3ZXAC 3WCSA 5A7NA 2E1OA 2ZFWA 4XMYA 2WZPP 3D0SA 1X58A 3ZN4A 2WWUA 3FBMA 3AC0A 2VOXA 3RGBA 3SCGA 1MQTA 4V2VA 1GWKA 3RWKX 1WJ5A 3U1XA 5TISC 1JHHA 2V1DA 4WWCA 2OUHA 4QGNA 2F5DA 4FHTA 4Q48A 3WTWC 1IN5A 2FOKA 1ASJ3 1G3SA 3K9TA 4P14A 2XASA 2WSUA 1HXS3 4Y26A 5FCCA 4U7BA 2ACJA 3ZCOA 1S4CA 1R36A 3SZTA 4BQ2A 1S9HA 2JWPA 4LKDA 2QSHX 1ULCA 3BB6A 2Z42A 1S0JA 5BNGA 4C3IJ 1TQMA 5KHKA 3T4HB 2WKKA 3HTSB 5I0DA 2PMZN 4WM7A 1GNHA 4R52A 2ETEA 2DW4A 3I5UA 5EDNA 5IYDJ 2EXJA 2AYHA 1W0NA 2EAKA 2XL7A 4LBQB 4MYEA 4YFXF 1UHMA 3BJ6A 1WJEA 3OS1A 4Y3OA 4RQPA 2GC2A 3FISA 1G59A 4AOCA 2VVDA 5AC93 3ZFEA 3OYJA 3H0DA 1MH3A 2DN0A 2R043 4Y24A 1H4GA 3C7GA 2JICA 4G12A 4ETSA 3VZLA 3LSKA 1KJRA 2VASA 4EGYA 1SFNA 1J09A 5FMOL 4EN0A 3SLIA 1ND3A 4KN4X 1D5VA 4S2HA 2ZGTA 5EZHA 2DCEA 1JS9A 5IVVA 2PMZA 4FOYA 3HOTA 5CA6A 4XUTA 2Y60A 3OGRA 5C3QA 1S6LA 2ZMEC 3JRFA 4Q4X2 1RC6A 2E60A 4HANA 2WNUC 1WCDJ 2JIGA 1N1YA 5I0RA 3HSRA 2HWE3 2L9RA 5FZ6A 4ZS3A 4NHXA 1MSEC 1RUJ3 4D0PA 2V1NA 2QA4I 4Q1PA 1H88C 4E7SA 3VYSB 4QU2A 3ISPA 1LHNA 2IT0A 4CH7A 1MIJA 3BTJA 1WA6X 3PTRB 2FEZA 3UESA 1NLQA 2ZX3A 2P0WA 4XACA 3P5JA 2Z2SB 1GUIA 2M7BA 4XKWA 5IFPA 4CZZA 4RAFA 4RYDA 2ZXWH 5B66C 3CJIB 4LKSA 1A36A 3BCAA 1AL23 3SFZA 3LSPA 3OV8A 4NQWB 1UZWA 2OW4A 2YBPA 1AL0G 4H0EA 2M1BA 4RAZA 1O8PA 3NAPB 3ZXSA 1C5IA 1HN0A 1VQ9I 2PHFA 2XAHA 2W68A 3OYGA 2DVDA 4BJ0A 3HL2A 2LKSA 2J22A 4RB3C 2FE3A 1NX9A 3V0BB 4K3UA 2KZVA 4DOZA 5IVCA 5J36A 2BY1A 5F32A 2X0LA 4CCKA 4OQ8A 2QQBA 1SG3A 2VQCA 1ASJ2 2VL8A 3WOGA 4QHZA 3N4MA 4NBQA 2VR4A 4IEWA 2RKHA 3BR1A 1PO12 4RM3A 1TME3 2CYFA 3WF0A 4XLCA 5A6QA 4XIKA 2ZJRF 1Z7UA 1JYNA 1W28A 3C3WA 2D3PA 5IVYA 3H8OA 4OU0A 5JIAA 2A71A 3HC7A 5JI9A 3OL4A 5CVUA 3I3LA 5JLXA 1K79A 3ZDVA 4DOUA 2PHLA 4CDQC 3T09A 1OCPA 2QQOA 3KP6A 2RVCA 2A6ZA 2WN3A 3AP5A 4IW3A 4C8DA 5C44J 2MSYA 1MS8A 3WTTC 1WBFA 5FPUA 3IDAA 3AZYA 3WVJA 1VI0A 3E6MA 3LFIA 2X8KA 5EZWA 3I2FA 1SMTA 3DV8A 2LFBA 1W9SA 5FKNA 1XE7A 1C5HA 3LKJA 5FK8A 3QBQA 2ILMA 4EM0B 2WBKA 2LS6A 2Y64A 1S0CA 1R71A 1VBA1 5CVIA 3OGVA 2JDUA 1U5TB 1I50J 3AYAA 3ETPA 4XICA 1JUPA 1ZRCA 3I8TA 2PQQA 1FX5A 1IN6A 1W0TA 1VQKI 3POEA 1BR2A 1RUE1 4Q4X3 4YRVA 5FD5A 2F4LA 1F43A 3J80Z 2YGLA 3SCFA 4BQWA 5JPMB 4F55A 1R64A 3BTZA 2HWE2 4Y33A 4BBSJ 4P9LA 2VZ1A 3U75A 4QWQA 3ZQHA 2WO7A 2EALA 4OMCA 3GMEA 4U0WA 5H2FC 1YQ5A 4RD7A 5A3PA 1B35B 4XETA 2E26A 4NWWA 5FMDA 1YFYA 2ZEZA 1W6OA 5AIQA 1DUXC 4KGGA 3G6EI 1CPNA 3IM0A 1YJLA 2FMLA 5F3GA 2R5YB 1C8NA 4Q8KA 1B35A 3P5BA 5FYMA 2ECBA 2YMZA 2XDVA 4E2QA 4N90A 1AL22 4AUXA 3FLTA 4CZSA 1GHCA 1OLTA 2DVBA 3I2IA 4DXZA 2M4KA 4ZZ8A 1Y8QB 2DVGA 4PIXA 1R091 3I64A 3ZN1A 5J1XA 3TEWA 2XL9A 2IS2A 3QD6A 2VXRA 3VBUA 1WWXA 3LZZA 4GWIA 2CW0F 4IEQA 2HEYF 2A3YA 3HOVJ 3O0VA 3LOBA 5EGOA 3FHIB 5FB2A 1IG0A 3Q8BA 4CP1A 2X1CA 3CLPA 3OYAA 4IX7A 1JOJA 1ULGA 4AVSA 3T0BA 3K69A 3AP9A 1W5TA 4UUTA 2RNGA 2HOAA 5J98B 3LCPA 1UOBA 2A05A 2VOKA 4GFBA 3TBIA 2A68F 3I9V2 1ZGAA 2FSWA 2XGCA 2UYAA 1TMF1 5J40A 1RC9A 1U5ZA 5A7OA 4E8DA 3R60A 2MYSA 5JCTA 3FXUA 2KJCA 4Y1XA 4QQOA 2FZ2A 3T2OA 2JA2A 2RS11 2QVSB 2V73A 5F1JA 1S55A 2EFQA 1H1MA 1MNEA 2R041 1XU2A 3LD8A 2LTNA 1S3JA 1Z7S1 3K4NA 2B7EA 3ETQA 2WO2A 2VGDA 4ZS2A 2WV0A 2D6LX 2O1QA 5A7WB 2DO7A 5DMYA 1W9TA 3EJKA 1V6MA 1KA8A 1G4DA 3CKHA 1BI1A 3E1SA 2CW7A 3GZ5A 1RUE2 3SISA 4LIUA 4IL7A 2DTYA 3KV5A 3BLYA 4PBPA 4QB2A 2W87A 1NA1B 3ZQIA 3ZQCA 3ZLIA 3TEZA 3N9LA 1EUTA 4UOJA 5DUUA 1BMV1 4NO4A 4YVWC 4Q4W2 1BMV2 1F2NA 3J7MA 1H2LA 4WVZA 2ZAAA 3K0LA 4G7HF 1YJWI 1V54H 4S05A 1CZSA 1DU6A 3Q9OA 2IP2A 3M1EA 2F4PA 5FBZA 1LJ7A 5E8IA 4Q4Y2 1LRHA 2ADUA 2XAFA 4XJAA 2YGMA 2QSGX 4HSTA 1R1UA 2R93J 2Y75A 1LHOA 1IUFA 2LRDA 2AREA 5J96B 2DT5A 4XJZA 4DYCA 1GZ9A 3F95A 1PZ9A 1KYZA 1Z7S2 5CBLA 2G7HA 3RQIA 4X6AJ 2Y8KA 1OFCX 4Q27A 1J9IA 1M4WA 3GLXA 2NNYA 2HDCA 4FX0A 3VWBA 1DQ4A 5FIXA 3C2UA 4KG8A 1ZQ3P 5C71A 3J9SA 4L5JA 2RQQA 1ONVA 1NG7A 4BLJA 2PHWA 1UOFA 3MEXA 4GMP3 1UOGA 3EUHA 3JREA 3ZKYA 1YLLA 4TZDA 1P9QC 1ZLJA 3H5RA 1ZHFA 2W1OA 2RJ2A 5FZ8A 3DU5A 2FDJA 2RDSA 2A6XA 2XF5A 3OOUA 4O9GA 5B4XA 2RMU3 1JGGA 4Q5OA 4CCMA 1W06A 2IZWA 1AR73 2EZIA 2L7ZA 4UFHA 2PQ8A 1ETQA 4IEOA 3AMHA 4D3WA 5IW0A 3A22A 4WM7C 1GVDA 3H8UA 4ISQA 1BI3A 1TC3C 4AEMA 4AL9A 5I91A 4KMQA 3EB7A 5FP9A 2Q1ZB 1VRH2 5FLIA 2J5PA 4HA8A 3FX3A 4U0VA 1YHQI 1PYVA 2VH9A 5EJ1B 3WUDA 1R22A 1H8VA 1A8DA 4GA9A 3DPRC 4HK8A 2MH2A 4KA4A 3BQYA 5K7HA 3UT0A 3T30A 2PI0A 5C4XJ 2JE9A 1VBC1 3DECA 2E2HJ 1R092 1VQOI 2PELA 1RUI3 2QCSB 5C4JJ 3GTPJ 2YFUA 4IHYA 5LA9A 3WF2A 4M3BA 1AYN2 2K3FA 4LR4A 5C9AA 2H6BA 3JSPA 1Q8OA 2E1MB 4IEJA 4MIMA 1EKEA 4NHKA 3S5QA 2CGPA 5E79C 5J09A 2KP6A 4KITB 4LK1F 4AVTA 3B3QE 1TNFA 4Y17A 4I0BA 2C4XA 1G9DA 5I0UA 5BNPC 2R30A 3I53A 3OYFA 3U21A 2ZFUA 2AXTC 3VBHB 3FLPA 1LQ1A 2VTXJ 2RS52 3ME2A 4DXRA 4QGLA 4CPBD 3DPTA 4A3XA 1U8BA 3ATGA 4LD5A 5HS7A 1PGSA 3M3EA 2V9VA 3PIPF 2WUHA 1DU0A 2X5IC 4I30A 2KJBA 4KGQA 1AYM1 4A6DA 2FQPA 2JA8J 1XNKA 3I3BA 3O14A 3W5MA 1V6IA 3MUY1 2KHMA 1Y6IA 1F4HA 5HI0A 4Y5Z0 5J47A 1WCQA 3O1SA 4Y20B 1EAH1 1JXSA 4LJHA 4BOWA 4UW6A 3JBG3 3L9JT 4X0GA 3A0NA 4PJMA 2V26A 2AHQA 4RGSA 4QKBA 3I59B 2QQLA 3WUCA 2VC1A 2D40A 1TP4A 1E5IA 3QOPA 3HB9A 4HN1A 2B0LA 1NZIA 4A3FJ 4TSVA 1TWHJ 4QKNA 5FWJA 3LSRA 1CESA 1QJZA 3CJTB 3FK6A 1FT9A 4MGTA 1W7PA 2HOEA 2GXGA 4L11A 4LK6A 2DK8A 2Z33A 4AEDB 2ZX0A 1J83A 3UGFA 3U4XA 4I99C 4HDUA 4DZJA 3KCYA 4YW4A 3GW2A 3UK9A 4CXFA 5T5OA 3UKVA 4HETA 3ECOA 3LDKA 5JOZA 2NYXA 3RSJA 4QPGA 1OCCH 1E3PA 1ULYA 4AI0A 4P55A 1DLLA 1QA6A 4F8AA 4K20A 3DKYA 2ZX2A 5LASA 4YZ1A 3IC7A 2XB5A 4IHVA 3H9QA 4GYGA 3GHMA 3AYDA 4ESJA 1VRH3 4FP2A 1EH8A 2I45A 2GC3A 1R1TA 1LOBA 3ZPYA 1GV9A 3HOYJ 2CUFA 4CDQA 1NOVA 1JGSA 1USSA 1VPHA 1OKQA 1HQNA 3GDBA 5E20A 4LHLA 3QYEA 3VYTB 2L7MP 3OSFA 2ME0A 2K27A 3KETA 3DBRB 2GZWA 3LAGA 2R7QA 1WI9A 5FPZA 2QZ2A 1ETVA 4LGWA 2VC9A 2VNGA 3BZ6A 4II3A 1BIAA 3B01A 5IP7J 4QB6A 3AG2H 4MG2A 5A70A 2A6EF 1QMJA 1UY3A 4AYBA 1HLVA 4A3DJ 1CWPA 3H1YA 4Q4V1 3DLAA 1W2NA 4U87A 2A3XA 5FYVA 4Q4X1 5FP3A 2OZJA 4AYBN 3W6JB 1YFXA 1VR3A 1ZH5A 1YLFA 3KEYA 3N7KA 4A3EJ 4D7TA 1R1ZA 4UFIA 1NKGA 2ZKNA 3IKVA 2DU1A 2GU9A 2YUSA 5JIUA 3VOEA 2R042 3KV6A 2YROA 1U12A 3B7MA 4LBJA 4R4ZA 1D4M3 1HDDC 1JTXA 3B93A 5EZGA 1DZRA 1LDKB 5FY4A 4BQQA 3FMQA 3Q9VA 4XBQA 1PZ8A 4GWMA 3LEKA 2R6QA 1IQAA 1Y9QA 1BVP1 4S0HB 1GLNA 2KM2A 2KIUA 4ZDLA 1B8IA 1GZCA 5CKTA 5FZDA 2BTVC 3HPNA 4LHKA 3DEWA 1PVC3 2LMDA 3JW4A 3CDZB 5F7UA 2BVVA 4M3GA 5DAQA 5DCMB 5BXXA 3USUB 1S2EA 2X53S 2B46X 2OJED 2O5RA 3C8XA 1TME1 4HSRA 3S1QJ 1UMQA 4XLPF 3VDCA 2VQ0A 2K2SA 1COV3 4MTDA 3H36A 5GLVA 1ZBA3 1HSTA 1Y1VJ 3W5NA 4QWNA 4XF0A 4GYIA 3VN4A 3H35A 1JU4A 2J1AA 1CVNA 2DYCA 1A31A 4UV8A 1XSQA 1AXZA 3C2BA 1NAEA 3TNPB 5IAVA 4M00A 2D45A 3IP4B 1DP3A 1UZYA 3VL8A 1QJY2 2Z1DA 4CHUA 3SQNA 4G7OF 3VDAA 2B42B 1IUYA 3FM5A 2XJUA 5CJ9A 2ZB9A 5L36A 4HN0A 1F35A 4BDVB 3JTGA 4OQ9A 2TDXA 3OD0A 4RL7A 5HCHA 4FPKA 1ETKA 3TRSB 2CMPA 5CG8A 1IC8A 3VB2A 1TME2 4W97A 2C24A 1F15A 3PSFA 3MFCA 5FK7A 1SEUA 2L9SA 3HRTA 5ICCA 1MBHA 5DZEA 1VMJA 1VAMA 1D0HA 3AVRA 4GAZA 5FUPA 2X5IB 3EPZA 4IV1B 2FF4A 1QXPA 5HNHA 1IN4A 3COAC 2B9VA 2E2JJ 3HPHA 1T38A 4CCJA 4AHXA 5D4SA 2ZTNA 2E6VA 2Z99A 1CF7A 4QXCA 2H1KA 1SAUA 2V5YA 5I8YA 3KT1A 2WN2A 4OMYA 2VBPA 3EQLF 2RS32 2PYTA 1L7LA 4IETA 5J37A 1F5JA 4RR3B 5FY8A 4QXKA 5F39A 3ZYGA 1W03A 1D4M2 2A6TA 1Z05A 5DD4A 1XB4A 3EHKA 4D9JA 3V56A 2L7FP 1GFF2 5FZBA 3ONQA 4N9IA 4D94A 1YS6A 3IV5A 4N7UA 1T6GC 2BVLA 4YW2A 1SCRA 2CQ7A 1X4OA 4W1UA 3G7DA 1SBEA 4WX9A 2EFNA 3BPZA 1JUIA 4QD2A 2NZ9A 4BQ5A 4QPQA 1IOAA 1UYYA 2EA4A 3GXOA 5LA2A 3WDTA 2E7TA 5FLMJ 3WNOA 2BZDA 1VBC2 1X3UA 2BU9A 3DKWA 2D6OX 1W99A 3VKFC 2JKXA 4PDWC 2W1WA 1JYVA 4IEXA 3MFAA 2MC4A 2DPDA 1ULEA 1SD5A 1UO9A 1KRIA 2QNKA 3E0JB 1PVC1 3D5SC 1OCTC 2VL4A 2HWB2 3OR2C 3V4GA 3C7OA 4CDUB 1SLBA 3NNFA 4ZZ5A 2AENA 3EYYA 1ZK8A 2XLAA 4EWDA 4K1YA 1D0YA 1MS1A 5LCWL 1K5MC 3DEUA 5JPNB 4C30A 4Y7NJ 3QP5A 4Q2FA 2HQAA 1W8OA 2BERA 4XLAA 5FD6A 4DINB 2JKBA 4Q5SF 4YGEA 1DDNA 3M3CA 3WT3A 2ZX4A 3POBA 2UYBA 3B6CA 3LSGA 4RN5A 5EYRA 5FYTA 4RGGA 1SLTA 3NEUA 1OR7C 4ZPIA 4ZYHA 1R6RA 4WV8A 3F8NA 1YI2I 1LUJB 1AR62 2DFHA 5HODA 4CA9A 5F3IA 4AG4A 4G8XA 1YO5C 3MW3A 2JJ6A 4YPJA 2Z3YA 1HKTA 3KVAA 3EQEA 3DYPA 3JRIA 2IXJA 2WBMA 2VNRA 3HIFA 5C8CC 1I6XA 1MZ6A 1T6BX 2NVUB 5D8LB 2E32A 1VBD2 5A3MA 3VD4A 2YY1A 1FATA 4WZCA 1UPIA 3ES1A 4OYUA 4NN0A 4K7JA 2WSVA 4IUGA 4LBMA 3WP6A 4PJ0C 1D7PM 1QNYA 3OS2A 5DG2A 3LEGA 3WNKA 2JG8A 4BACA 2HU9A 4JRLA 3HQXA 1U6GA 1ULOA 2E34A 4GXOA 3OYLA 2WO1A 2J1UA 2PAEA 3MIDA 2E7AA 1F9NA 4P9IA 3R0AA 4YM3A 1L7QA 2Y0MA 3HN3A 5GADJ 5DAWA 3PURA 4FXGB 1W8TA 3BU0A 1WD3A 5K8SA 1FOD2 1UNBA 5K5RA 2EPFA 4HSLA 5M0TA 3VYUB 3PNAA 2EVXA 1RUE3 3POYA 3RKXA 2WR9A 4Z92B 2RS51 5ANNA 2WQ4A 2PMWB 2CGNA 1X8EA 5IHRA 2VVFA 4XBNA 4KL1A 1XDUA 3LNQA 5B5EC 4G9SB 2W82A 2WRAA 5FJ8J 1IRXA 3H0GJ 2A73B 5GM0A 4KISA 3VBSB 2ZGRA 1VQ6I 4P96A 3D3AA 1TWGJ 3S7EA 2W92A 3IZOA 5IY5H 3GFMA 4KU8A 2GC1A 3LFUA 2ZAHA 2ISZA 2IS6A 2ZABA 5FZHA 5A7WA 2XBO2 2QZ8A 4LO6B 3ZO0B 3KMHA 3USUA 4EQVA 1LESA 3D0JA 1USTA 1YS7A 4ONUA 1EAH3 2NS8A 1EV7A 4BQOA 1NT0A 5FO7B 1SANA 3GF2A 4WM8B 1R5HA 4YSFA 3AKRA 4RA0A 3T1LA 1UW8A 3A0KA 4B7KA 3VSKA 1XMAA 1RR8C 2CAVA 4XLFA 1Y43B 4E2SA 3B94A 2OPWA 5DCFA 2VY0A 3TBDA 2JG8B 1RUH2 1IRFA 2BE5F 5F6KA 3L2QA 4CPBA 1VBD3 4B3NA 1ODDA 2OUMA 2ELJA 5KC6A 2VQAA 5HV0A 3O3KA 3C3VA 2BOLA 1FPN1 2Y6HA 4NHMA 1VP6A 5FAXA 5C4WC 4X6RB 2QFEA 4UW4A 4GD4A 3IB3A 2BV4A 3TOJA 1RKWA 2CU5A 3AJYA 2XVGA 1SHWB 1OPOA 1FV3A 2C0ZA 4QX7A 4UT5A 5ILSA 2ZMLA 3AMNA 1MR5A 1W9YA 5D2AA 3FBYA 4GCVA 4ASLA 1GP6A 3PIOF 1T2KA 2R5ZB 1XCVA 4XBLA 3BY6A 3AJZA 3DXTA 3MZYA 2YBSA 2KT0A 4FETA 4HRIA 4JDMA 5EQUA 3DYMA 4AVVA 1X3ZB 4A3KJ 3BWGA 4A6SA 3PJYA 2WAOA 3MYXA 1S0GA 3TW7A 3R6SA 1X8MA 3ZGKA 1BW6A 4XJWA 1VBA2 1V9U1 4JKMA 3PVEA 3WDWA 2VCAA 4PLMA 1PGL1 3ULQB 1FYLA 4IE0A 4Z2WA 2ME6A 3BT9A 3C7EA 2VZ3A 5I8SA 2RMU1 1R1A1 3I4MJ 3HBKA 2KPMA 4AI1A 3U4SA 3PL8A 1MBJA 2UWAA 4NHYA 1FAYA 2KZGA 2F4MB 2VNVA 2BJSA 4LBOA 2FCVA 3ZFEB 2RR13 3AZZA 5LK5A 1UJ8A 1OLMA 1PO13 1ZZ8A 1FBUA 4OWRB 1RIOH 1AXYA 2DFIA 3BR6A 1ULPA 4QDRA 5FYIA 1OQ1A 3KSCA 2NN8A 4EWAA 1QVTA 4GB33 4OIRF 2QQWA 3BJAA 3VHPA 4FPGA 3FBIB 4H2AA 5B1BH 2X6OA 4BXFA 4C91A 3W2AA 4Q4V2 2DMPA 4FPHA 4WVVA 4A3BJ 3E1F1 3MZ8A 1FYMA 3VBRA 1YJNI 5JZGA 3GTMJ 5FZ7A 2VBBA 5AONA 2QQJA 3QCWA 3T1BA 1TVGA 3DF0A 1NCQC 1MDMB 2BVBA 5J1YA 4DQAA 1WGXA 2JA6J 3ECQA 2QQPA 2DJNA 2FZ1A 3VD7A 1RMU2 3IIAA 5JSOA 1ORKA 3H9JA 3RZOJ 3A2KA 1ENXA 4JC1A 4HX8A 2H6CA 1G86A 1K83J 5KVRA 1D2SA 3ILNA 1YIJI 1T0FC 4LMYA 5A3NA 3N7JA 3TQNA 2K0GA 4JZRA 2VVEA 1MACA 3RQ4A 2VMFA 4A6OA 4TLFA 2EINH 5A6YA 3QLQA 5F2SA 3UKNA 1Q56A 1GP5A 2FBHA 3HGYA 4AD9A 1VMFA 2KIQA 4IE6A 1JZ7A 1FP2A 5C7GA 4CZCA 1HJFA 1TWCJ 3CCSI 5IK5A 1HCRA 1RXFA 5C3PA 3AXDA 2X10A 3BP8A 4EMSA 1JYCA 5FMOS 1JZ2A 5T54A 1MS9A 4AWXB 3AFKA 5H9RA 3ZXGA 1XPWA 4ZTJA 1X36A 4K1ZA 1TMF3 2M0MA 5F27A 5HDNA 4XKBA 1CAXA 4IOAF 5ABJB 2M2EA 1REDA 4YRDA 2XBO3 4XYXA 3O0WA 4AVZA 4C3HJ 5JVGF 5D8AB 2VKDA 2UY9A 1VF9A 2ARXA 3ZYHA 5BS6A 1VQPI 4DGWB 1ZZ9A 2YXSA 5EJZB 3ABZA 3S15J 4HLXA 1JUSA 2E36A 4MNUA 1EYBA 2KRHA 5KHGA 4YG0A 1FOD1 5C3OA 1AWCA 2GWRA 5D8AA 2D43A 1XG1A 2Y0IA 1W6QB 2K5CA 4XTMA 3BC8A 2VNOA 4HPKB 2JRTA 2I5UA 2EIDA 3TKYA 3S30A 3AB0A 3RZJA 5T3NA 2ZHNA 2JPBA 2EIBA 4QPOA 1R5ID 2A5ZA 2XVCA 2PXJA 3J7ZI 2D6PA 2Y6FA 3ZSEA 1H4HA 4R9DA 3GZNB 2QQIA 1H1AA 3W59A 2GN3A 4I09A 4IJAA 2HQRA 2M34A 1XU1A 3AL5A 4IO9F 3JTHA 2CFOA 5DTDA 3HWJA 3VYRB 2X4HA 3W9AA 3PUFA 3KF3A 4RFT0 3ZPOA 2NXNB 5GPCA 2XAUA 3CP2A 3S1RJ 4H3WA 3S17J 1XGNA 2JDPA 4GH4B 4XRSG 2TNFA 2WA0A 4Y1VA 5EGOB 2CUEA 4JX4A 3K46A 4JGYB 3ALQA 4P9JA 1YJKA 3H3UA 4AW7A 4S2DA 2W91A 2DCJA 4Q0QA 4E4SA 2R7FA 4DUVA 4JQTA 4YG2F 5HLHA 3TN91 3IWZA 5GPAA 5BUVA 5IUQA 4GMP0 3HOXJ 3HOUJ 1O4TA 3CO7C 4GALA 4E4ZA 5HLGA 5E3NA 3RI9A 4AVBA 3I2GA 4HG6B 1VBA3 4Q47A 1TQ5A 1UYPA 2P7VB 4BK4A 2EBIA 1JOBA 2DT6A 2UZKA 4TTGA 1MEC1 3ZSLA 3BZCA 1OA4A 2HWB1 1RUF1 2P3JA 5DZGA 1D4VB 4DEQA 4IV3B 3SHFA 3AAFA 4META 2VMCA 4NUBA 3BROA 2HEOA 1YWKA 2P4WA 2O8OA 4XDPA 2QQ9A 1OQEA 2Y33A 3GUDA