3I54A

Crystal structure of mtbcrp in complex with camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
224
Chain Sequence
b'LYFQSHMDEILARAGIFQGVEPSAIAAQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 66
structure length 224
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i54A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i54A01
1J58A 4LFUA 2PG4A 3LAJA 3I59B 1TW2A 3D82A 1ON2A 1CAUB 4KMFA 3GYHX 1ZG5A 2KKOA 2O0YA 4P9FA 1UD1A 4FX4A 2D45A 2Y75A 2COMA 3BP8A 3KLOA 5HLGA 3ZN1A 3HUGA 1A04A 3LAPA 5CLSA 1BN5A 4MTDA 4I0AA 2PHLA 2W84A 1KU3A 1JXSA 2BNNA 2DK8A 4NQWA 1DPUA 4AVPA 5J3UA 2PBIA 2VT3A 4HX7A 3IRRA 1K78B 4KNYA 1IXRC 5CVJA 3L2HA 1FOKA 4M73A 3GO5A 3IC7A 2FBIA 4L9NA 5CJ9A 2VPVA 2V1UA 2H09A 3T8TA 1H1MA 1O4TA 2ZNZA 1YUDA 4Q0QA 4G9YA 3RNSA 3KP7A 1B1BA 1JGSA 3BZ6A 1ZZ7A 1LDJA 4R8HA 2XAJA 3I4PA 1S3JA 4IRHA 3V7RA 2UWMA 3NVCA 3DEUA 4RGXA 4A0ZA 1CF7B 1W5TA 4KU8A 3V8LA 4BHPA 2HFHA 2WTEA 4MGIE 3KGLA 5FB2A 4WX9A 2RV8A 1NHAA 5E20A 5CU1A 5FPZA 3I53A 4GCVA 1XE8A 1WWXA 4LTAA 3V7SA 3GVAA 2PN6A 3QACA 1KA8A 1U78A 1SAXA 1G3WA 4HX8A 4L0ZB 2W25A 1ZH5A 1Z9CA 4BQAA 4MEYF 1XSVA 3WTUC 4UBGA 4Z2YA 2WWYA 2DCTA 1FP1D 4QM8A 4PJYA 4M9XA 3CF6E 2LSOA 5D6FA 3EHKA 4XF0A 3WTXC 4HN1A 1FI2A 2GQQA 3HTSB 2EVXA 1U8RA 3EETA 4L5JA 3G73A 3TDZC 2ISYA 1I6XA 5LGUA 5I8TA 2PEXA 5C8WA 2QWWA 1MJ9A 3R61A 4IEQA 2CW0F 2HOEA 5FPXA 4HOBA 4HV5A 4Z07A 2QNKA 4A0YA 3ZMUA 3MYXA 1OFNA 4ESFA 1YQAA 2EV6A 2NYXA 5DCMB 1ULYA 4HBLA 3TNQA 4S05A 2ZO4A 1ODDA 3SHRA 1R1UA 2XGXA 4LJZF 5E16A 2W57A 5JSOA 5J6XA 3RPQA 2E9QA 4EJTA 2CQKA 3M7GA 2H94A 1QPMA 4D0PA 2DO7A 1BBYA 4IESA 4YYOA 1QO0D 3V8KA 2A07F 4EJVA 3JAMK 3WGGA 3CDHA 5FLIA 2EV0A 1GQHA 5T3NA 2W24A 5JSRA 1LNWA 5ICGA 1FPQA 5FD5A 3FFQA 5LBQA 2IA1A 3RJPA 2EFNA 2GA2A 5DUIA 3F23A 2R3SA 1NXMA 3F6OA 5A2QK 4Q4ZF 3KGZA 3EQLF 2ET7A 2E7WA 4I02A 4I98B 4E70A 2GXBA 2KJBA 3BJAA 4K2EA 4HVRA 4A0XA 2OZUA 4HF1A 2DTRA 1TBXA 1X7NA 1ZRDA 2CAUA 5KK1A 4HDVA 5BS6A 3QOPA 2STTA 5L3CA 3NW4A 1EH6A 3UKVA 3GZ5A 5IT9Z 2FXAA 3GW2A 1ZGJA 4EM1A 5LHHA 2CFXA 3MZYA 1CAWA 1BC8C 1OD5A 4YIFA 3S0MA 4ESBA 2XL9A 3I71A 3W6KB 3UKTA 3WTWC 4ENKA 3E6BA 4U0VA 2K4JA 3RYPA 5BPDA 5AIQA 2XAFA 3VFZA 5I91A 4BYYA 2DW4A 4MH0E 4Q48A 4WBBA 1UPIA 4I09A 4A12A 4KMUX 3HTUA 3F21A 2VN2A 3TKYA 3TO6A 3RIRA 3OF1A 2CGPA 2HYGD 1O3TA 5I0SA 4EGYA 4IEWA 1YO5C 1ZHFA 3O14A 4UV9A 3N97A 1FX7A 3ZMZA 1P6RA 3EUHA 3KLNA 1QZZA 3WTTC 3WW4A 1KQ9A 2PI0A 1CGPA 4ORFA 2PAKA 2E1NA 5I8YA 2EA4A 3GX4X 1YS7A 2FMYA 1QWRA 1XMKA 2ETEA 4OIOF 1SEFA 4OINF 1TQMA 2JZYA 3D5LA 2M87A 2F5FA 2XLAA 3HT1A 3EYIA 3KMHA 3I5UA 4U0YA 3KP3A 4O5VA 1EV7A 4LLNA 5HS7A 4M6YA 2Y0MA 4HBNA 4A5MA 3ES4A 2A69F 2VBXA 4UVBA 4L0YB 3E5UA 2BE5F 1U2WA 2PFBA 5K1YA 3ZPLA 2E7XA 4HDUA 5BV6A 5JSPA 3H92A 1EH7A 4UNOA 2GIVA 1T98A 3ZDSA 3QPHA 1VP6A 2WC2A 3GYDA 1PUEE 3DKWA 3L00A 2L01A 2FBKA 3SCGA 4YG2F 3J81K 2ETHA 5EEGA 4BH9A 4HA8A 4OFGA 1G3SA 3LA7A 4X6QB 3VEPA 4E2SA 5BPXA 2CV6A 5F6FA 4XFBA 3CJXA 2HS5A 1PP7U 3FHIB 4EWEA 4XEZA 1X8MA 4HYEA 2Y0OA 4AQ2A 5I93A 2F5EA 3FXQA 2UZKA 3IBMA 1R7JA 3L2CA 2O6GE 3E5QA 5E1XA 4M72A 4N9HA 4QX5A 4IRIA 2BGCA 4PDKA 4LULA 3ELKA 4AVBA 2P7CB 1DDNA 3WU0A 4FT8A 3P9IA 1XE7A 1K78A 4JTNA 3R0JA 3WE2A 5KHIA 1J59A 4UXNA 2GWRA 4XSZF 1G3YA 2IXCA 2YPRA 2P6SA 2XROA 1XD7A 3DP7A 2XAHA 2YU3A 1YS6A 1P4WA 1IF1A 1OYYA 4CGZA 3CEWA 3HHHA 4ENJA 3BPZA 2DT5A 4KWKA 2PYTA 1U3EM 1CF7A 3ST7A 5LGNA 1QBJA 2Q0OA 1YFUA 2VC0A 1REPC 2BNMA 4ZYHA 3IL2A 2XV4S 2UXNA 2EJRA 1RZ4A 4OIRF 4GYIA 4BHBA 3EYYA 2KRFA 3TDUC 1S6LA 2BBYA 2XL7A 4HF0A 2LDUA 3EO6A 4XBFA 3LWCA 1U5TA 4QMAA 5I0UA 4HSJA 4XF9A 4G7ZF 2MLKA 3BROA 4B09A 5FQ0B 1F1ZA 1P4XA 3PQKA 3KP6A 2GA1A 1X82A 4NVPA 2IXKA 1XGSA 3WTYC 5KBFA 1MJBA 3HRTA 3E5XA 4MUVA 3E6MA 3M3IA 3H3ZA 1FYMA 1Q3EA 1XN7A 3EBRA 1LJ9A 3E97A 1J3QA 4WVZA 4HMZA 5FDBA 4KDPA 1T0FA 4Q0UA 1BJAA 5EZWA 3NRVA 2XLFA 2GAUA 2OZ6A 3MZHA 5FLXZ 1E2XA 4FBFA 5DCMA 4XLPF 4OMZA 2O8QA 2H27A 2DLLA 4UXAA 2D1VA 2IXIA 4HQEA 3BY6A 5L3GA 2JT1A 3BU7A 1UHWA 3HT2A 4HVQA 1XB4A 5D6EA 2HGCA 5JFRA 2M1BA 2XRNA 1LB2A 5H6RA 4LLOA 4EMSA 1R1TA 1RTVA 2GC0A 3V7CA 3QPTA 3SFZA 1QXRA 3PLQA 2D2WA 5K5RA 4P55A 4B8XA 1RL3A 1OI6A 1IN5A 2KIUA 2EAAA 2VE8A 2G7HA 2MD5A 4ZU4A 4QLCU 4Q0SA 1DUXC 3LWFA 4XF1A 2P8TA 2HKXA 4FHTA 1Q1HA 1IN7A 2VONA 2HR3A 2D40A 2G9WA 2IVMA 1O3QA 3V8JA 4EJWA 4IJAA 3U0ZA 4Q5SF 4O3MA 3S2WA 4ETSA 1WLTA 3C3VA 3LA3A 2JRTA 5HS8A 1R00A 2ZFWA 2MH9A 1ON1A 4TLFA 2A6HF 2Z2SB 5BMZA 1IW7F 4Y15A 4QGNA 2QLZA 4XLNF 1YHFA 4KIBA 1FSHA 5HLIA 1O3RA 4PGHA 3LFKA 1RGSA 4PCQA 2FE3A 2OQGA 3QU6A 1YFYA 3TOAA 1LEAA 2LNBA 1Z7UA 4MGZE 2XAQA 2ZMEB 1R5GA 1MGTA 3FHZA 2PA7A 1G4DA 3KSCA 4HLXA 2LF7A 3KETA 2FNAA 4OU0A 5DDGA 4NB5A 2L4MA 3GFIA 4ENMA 4AVAA 3E6DA 1Q43A 1O7FA 1H9GA 3JW4A 3BCWA 3WGIA 2A68F 1R58A 2QBYA 3WE3A 4IETA 1IAWA 3F8NA 1HW5A 2K4BA 1FBQA 1IN4A 2FU4A 1T39A 2C6YA 1MD0A 3P7NA 4X6RB 2IA0A 5CVUA 5CVRA 3S7EA 4DNCA 1JHFA 5CVVA 2P5VA 4EQQA 5BOXA 3FXUA 2OU2A 4LMYA 2P17A 4D7TA 3KEQA 3SMHA 4Q47A 3CL1A 2ZKLA 3RTRA 1L0OC 2H6CA 1VR3A 4LB6B 3SHFA 1FC3A 1XMAA 4N0BA 5D5VB 3HSFA 1OMIA 5I0RA 1R22A 1HW1A 3IWFA 1SMTA 3BDDA 2QQ9A 4R1HA 1RI7A 3T8RA 2CYYA 4WK8F 4EVIA 3FM5A 3CUQA 2EA7A 2GC2A 3R6SA 2JPCA 4R52A 4P96A 4YARA 1U6GA 2DFIA 3OD0A 2ZKZA 1KYZA 4ASNA 4AIKA 1V3FA 2ACJA 2D93A 2CO5A 5EEHA 2XKPA 3LOIA 2PMUA 1BOAA 3FZ3A 4H7LA 4HW0A 2X4HA 5D8LB 3GXOA 4Z82A 1S7AA 1YFXA 1B4AA 5ILSA 5CADA 5D4SA 4DQ2A 2YR2A 3E3VA 2V6CA 1H9TA 2VBYA 1LDDA 4HLTA 4JTOA 2DQLA 5JR3A 2DAOA 1UIKA 2A5YB 1LKNA 3FWEA 3K1MA 2VOOA 3R60A 3Q9VA 1I1GA 1FY7A 2F5DA 4MZUA 4LG0B 3P9KA 2H0VA 2VBZA 4RB2C 5K8SA 4BAYA 4EM0B 5AONA 2FEZA 2OPKA 2HJIA 1L3JA 4QXKA 3ROUA 1G6NA 5F1RA 3H7YA 5AIPA 2CAVA 1LQ1A 2A6EF 2GXGA 3U9GA 2Q1ZB 2MC3A 3M8FA 2M5WA 5FLJA 3U1DA 2GC3A 3ELNA 1BM9A 4MQ9F 2IT0A 4WXCA 5DUKA 3NEUA 4WWCA 5I0TA 3BJ6A 3TO7A 3JTHA 3LSTA 2DBBA 2F5CA 4L9TA 2Z69A 2ZXJA 1LVAA 1U12A 4YNIA 2ZNYA 3SQNA 3JZVA 4AQ6A 3Q9SA 2FBHA 5FO5A 3H7JA 4O6JA 4I01A 1V70A 4U0WA 1T6SA 1RIOH 4M9ZA 1OYWA 1BIBA 3KCCA 5CYVA 3ETQA 3P9CA 1TQPA 3IKVA 2ZBKA 5L3FA 1GVJA 1O3SA 1LR5A 3F3XA 4GO1A 2D5FA 1UHMA 3ECOA 5KHKA 2O1QA 5D5WB 4XFHA 3GF2A 2QQBA 3HHGA 4ESJA 2BV6A 5KHJA 4OMYA 5FQ0A 4U88A 2N7GA 3D0SA 4G8XA 3IKTA 1KYWA 3EDPA 3ZMVA 4CZZA 3KP2A 5DEQA 1MJAA 1X3UA 1AOYA 1Z6RA 2FNPA 3EJKA 4ZU5A 2E1CA 4UHTA 1J1LA 2L02A 2L54A 5HVQC 1P92A 2ATFA 2PQ8A 4LA3A 4IRGA 1T38A 2A61A 3HRMA 1SQ4A 2Z99A 4Y13A 5HS9A 1ZX5A 4LK0F 4RGUA 2O61A 3HSEA 2IC1A 3W6JB 1I27A 1TNSA 2UYAA 3O6BB 2ISZA 1DGWA 2MNGA 3K69A 5D5XB 4E2GA 1KQ8A 1D8KA 5E1WA 5HI0A 5E1RA 1UW8A 4LLGF 4LUMA 3JAMZ 4KUMA 2IXJA 1DZRA 2EFOA 1IRFA 1XGOA 3WU1B 4CICA 3LA2A 5BQTA 4ZZLA 4ZZDA 5A2QZ 1FLIA 2K02A 1J75A 1DZTA 2A3SA 4ZU7A 4PIXA 1ZAOA 1OR7A 5LEKA 1STZA 1FWZA 3ERED 3T0YA 1WQ2A 3VOEA 4Y17A 3AAFA 2XUBA 4BIFA 1Z6TA 2GH2A 4IEZA 4EV0A 3QP6A 2WV0A 2J5OA 3K2ZA 2PJPA 4UV8A 3HRSA 1BI2A 2MLGA 3IDCB 3I59A 1ZZ8A 3ZMDA 4RGSA 2VBWA 4I0BA 4XFGA 4HSLA 1H1IA 3ISPA 4E2QA 2VQAA 1CAUA 2K86A 1LDKB 1YWKA 4WXHA 3I64A 1HBXG 3CUOA 4UBHA 3C7JA 1MDMB 2AS5F 4XSXF 1IPJA 3D0JA 2YSRA 3WODF 1IN6A 2QQAA 2ZJ2A 4M9SA 5CVIA 4EWAA 5LLQA 3KZZA 5ED4A 4AXOA 5DV5A 2XASA 5JR7B 3K0LA 4RB0A 1B9NA 4WF2A 5JI6A 4XFAA 5E8IA 3H50A 1YIOA 1FYLA 1I1SA 1L3LA 3SXWA 5LHIA 2RKHA 5ILUA 1BC7C 1Y9QA 4IEYA 2VE9A 2RQPA 1HKQA 1R1VA 1TNTA 2R7FA 1EYBA 3FMSA 4ZYGA 1HKSA 4GXOA 4WCGA 4I3PA 3FXRA 3ES1A 3CO6C 1UFMA 3REOA 1LRHA 4CYDA 1ZGAA 4META 3CLPA 3DL3A 2ELHA 3IHUA 1QQIA 4YRDA 2K27A 3B73A 1FBUA 4HLYA 4L9JA 1S29A 2EFQA 3M8EA 3L9FA 4XETA 4KYWA 3GLXA 4P9GA 1XCBA 4G7HF 2JSCA 2EK5A 2QVOA 4EM2A 2PFWA 3FF5A 3U2RA 1ZRCA 2UYBA 3BB6A 1KQ0A 4RB3C 5K5QA 3H9AA 2OBPA 4RB1A 2W85A 1GHCA 1LEBA 1V4RA 4XRFA 1QZYA 4BNCA 4MTEA 4FAHA 1CAVB 1SD7A 4AIHA 1OKRA 3ACLA 4LLLA 1RC6A 3F8CA 4YIIA 4PGGA 4Q29A 4IEXA 4RD7A 2BEOA 1I5ZA 3N4MA 4CHUA 3LZZA 1MZBA 1QGPA 1R36A 3J81Z 6PAXA 1R23A 4RS8A 3DF8A 4OIQF 5FFXA 5HLHA 1WSUA 3J80K 1W7PB 1CAWB 4KIGA 4IXAA 5L3DA 2NNNA 4H0EA 4IVNA 3M70A 1SFEA 1O7LA 1DP7P 4UVCA 4QGLA 2HTJA 3FX3A 3NSTA 1ZZ9A 3VODA 4YSFA 1ZZ6A 3RI4A 3H1MA 5FGMA 3SCHA 1HQCA 2HWVA 3ECHA 4P9UA 3ZP5A 3FZVA 2H6BA 2YX7A 5KVRA 2Z33A 1XDSA 2FF4A 3MEXA 5LEJA 3DV8A 1J3PA 4F7ZA 4AIJA 1D8JA 3WTVC 4MGRA 4U7BA 2OD5A 2Q8KA 2NAZA 2DPUA 2PAEA 3UKNA 3RDIA 3WTSC 5HDKA 1PM7A 4LG0A 4KWLA 5ICEA 1KU7A 3DQVC 3G7DA 4IEOA 1IUYA 2Q30A 1AWCA 3CLOA 2KIMA 1NYWA 4MGKE 3U10A 3WG9A 5LRSA 2FSWA 4J1WA 2FRHA 1FP2A 4KN7X 3MQ0A 4LA2A 1XRUA 4JVAA 3H3UA 2CG4A 1QNTA 4GULA 1O57A 4OOIA 4MHGA 2ADUA 1VTNC 1YFHA 4L11A 1Q5OA 4D7SA 4IEUA 4A2UA 2IXLA 1ZLJA 3T5XA 1USTA 1WGPA 2Z5UA 1TLHB 5BPIA 3KP5A 2FQ3A 2KXLA 1B9MA 1EP0A 4M71A 1YYVA 2YX4A 1D5VA 3WTZA 3ABUA 1KU2A 3J80Z 3Q5FA 1W4MA 1HW2A 3FJSA 2QYOA 2L3DA 1ZLKA 3NKTA 4IHSA 1DGRA 5ERIA 2OYZA 2P4WA 1B6AA 5FLHA 4IEVA 5J48A 2FA5A 2UY9A 1YW8A 3OOPA 3DFGA 1ONVA 3PVBB 5BY5A 4WZCA 5FFZA 5IT3A 2DK5A 3I7DA 5E1ZB 3MPBA 2HKOA 5TJJA 1J2XA 5HOOA 3KZYA 1ZARA 2EFPA 4A6DA 1H0MA 1FSEA 1FZPB 3LAGA 2QENA 1CAXB 3GFJA 4P5OA 4G6QA 3RPUA 1XGMA 1FYKA 3RZZA 1ZG3A 2XIGA 4G7OF 5EFUA 1SD6A 3OV8A 2BYVE 3C3WA 2VODA 3COAC 3HOSA 3RKXA 1QXJA 1R5HA 2FMLA 5J8CA 4RGRA 1QY4A 3H8UA 1IPKA 2XLGA 5F64A 4Q0VA 5LRRA 1D3YA 2JPBA 2HQNA 5JVTA 2F2EA 3C18A 5HDGA 3O3KA 4IF4A 3NJZA 3TO9A 5KHGA 1WI9A 2DQRA 2PTMA 1SFXA 1F5TA 3ZN0A 2M8EA 1G3TA 4KICA 1J5YA 3B02A 3MCZA 5H6QA 1UCXA 2P5LC 2IRFG 2MHFA 5FCCA 3GFLA 3R4KA 1K79A 3SXYA 4CXFA 3USSA 1SFNA 1FT9A 5IT9K 2QDRA 1U5TB 2EFWA 5JAXA 2QUFA 4AD9A 3R0AA 1C0WA 1JHHA 1HSJA 2UXXA 1JE8A 1YW7A 4L5IA 1MDMA 3HYIA 4IHTA 4OLLA 3LQQA 1T2KA 5HDNA 1TQIA 4KWJA 3V4GA 2DPDA 4KL1A 2PQQA 2L4AA 3MWMA 3OCPA 2B8MA 1XSXA 3MFKA 4F8AA 2XKOA 2IA2A 1P4AA 1BI1A 1BI0A 5FD6A 1IRGA 4JBAA 4J1XA 5KHHA 1FBSA 4LD5A 5L3BA 5DD4A 1SD5A 2R7DA 3GWZA 2AXLA 1ZRRA 1U5TC 2IPQX 4NHJA 2K9ZA 3VHRA 5LGTA 1HKTA 5DD8A 2QZ8A 2Z3YA 4HX4A 4JK1X 3IWZA 5L3EA 2XHKA 5D5UB 4MV2A 3MAJA 3DN7A 2KIFA 2HZTA 1RUNA 4XFIA 1IN8A 1W5SA 2QJVA 1W7PD 3IDBB 1IXSB 2V9VA 2V1XA 4M6XA 3OTFA 3U11A 4ZYEA 4TV7A 4Q0PA 4HN0A 1EH8A 3S7IA 2V79A 1CAVA 3SCFA 1ZZCA 5E17F 2OAZA 4KU7A 3GEZA 1Z05A 3I58A 3KFWX 3RKWA 4MNUA 5BXXA 2ESNA 2PMHA 3ML6A 5LHGA 1IZ1A 4QGMA 3VB2A 2Q4SA 1BIAA 2V1DA 1ZNPA 3BJOA 2C0ZA 3HSRA 5ILVA 1YLFA 3F8BA 3ZQ7A 1K6OA 2P6TA 1W7PA 2IJLA 4ON0A 1NE6A 2EV5A 3CTAA 3FMQA 1E17A 1J7KA 3BWGA 1S7OA 2EA2A 1TQ5A 3LQRA 4A6EA 4JQFA 1O5LA 4KT5C 3RYKA 2P7VB 2IXHA 5K5OA 1EY2A 2XVCA 1ZN2A 2O8XA 4EJOA 2V09A 4DINB 1YW9A 2VECA 1RNLA 3SZPA 3I54A 2NRAC 4S04A 2LKPA 4UUVA 2Z9OA 3L7WA 5ICFA 1YLLA 1ZRFA 2GU9A 2HTSA 4O9EA 4GGGA 3PQJA 4KA4A 3CO2A 2IP2A 4I2OA 2Q0AA 4KN4X 2HEOA 1NE4A 2QBYB 1KU9A 4HV6A 2P5KA 3QAHA 3F8FA 1TW3A 1VJ2A 4L18B 1GXQA 2OA2A 4QM9A 4YFXF 5H20A 3DPTA 1HXDA 4PIZA 4FAGA 1BI3A 3G3ZA 1XGNA 2QVSB 4HVOA 3M1EA 1KGSA 4CO8A 1TTYA 1Z91A 3JSPA 4G6DA 5AVPA 3BALA 1K7AA 2XAGA 1GQGA 4BXUA 4YFNF 3HRUA 3DXJF 3DPLC 4IPAA 1X8EA 4RAZA 5J8FA 4LEJA 3H1WA 3FE5A 3CJNA 2NS0A 3K9TA 5D4RA 2PHDA 3CUQB 4WXDA 3WW3A 4MX3A 5BUVA 2B5HA 1ZG1A 4AWXB 4B29A 5E18F 1YG2A 3E6CC 2UY8A 3SZTA 4AVCA 1GXPA 4ZYDA 2STWA 1FNNA 1XCVA 3FM3A 2PAMA 1UCRA 2HQRA 2I45A 4EWDA 3TGNA 3K1NA 2J5PA 2VXZA 3O2PE 5ICCA 3TQNA 2CSOA 2K7LA 3IIAA 3WGHA 4L2NA 3WW1A 5C6CA 3QP5A 2OQRA 2ZMEA 1PDNC 2ET1A 4ZH4F 3ZMTA 2O3FA 2KJCA 4MGYE 2DI3A 2EB7A 4XF4A 5JCTA 3CUQC 4I7HA 3T1BA 1O5UA 2ZCWA 2DU9A 1F9NA 5FLXK 4R79A 3HQXA 2RC4A 3L09A 4EGZA 1CAXA 4LB5A 4MEXF 4QWQA 1ZZBA 2HYFA 2OA4A 2RNJA 4A5NA 4K8FA 5E8GA 4XFFA 1DPRA 4ENNA 3RKYA 5D8KB 3KP4A 2TDXA 1SD4A 1ZREA 4HF2A 1UB9A 1UIJA 2IW5A 4FX0A 4KFCA 1XDUA 2RGVA 4IEPA 3I0TA 2O03A 1B59A 1XSDA 4G94A 1ZYRF 4BHCA 2VT2A 2QCSB 4O9GA 4CDGA 2MH2A 1FXZA 2RDPA 2RVCA 2X0LA 1SMYF 2JTVA 1WA4A 3OGJA 1CX4A 1HSTA 4U7DA 3RYRA 4XFCA 2MPFA 2GZWA 3K1PA 1SFUA 3TOBA 2EWNA 3EQEA 4HAMA 4YFKF 3TNPB 1RUOA 1USSA 3F72A 2HDCA 1Y3TA 5JHUA 3JSOA 4GYGA 2NNYA 1J9IA 2RN7A 4N9IA 4PIYA 2OZJA 4HQMA 2WFPA 2D1HA 3ULQB 4XF3A 3GZ6A 2BNOA 1Z1DA 3HOTA 1EPZA 4EJUA 1WKMA 1P2FA 1OPCA 4LK1F 2G7UA 3F6VA 4UVAA 1WRJA 4MQVA 4IERA 1PP8F 4PZJA 3QRFF 4KIFA 2QM3A 4JV4A 4ONUA 5TRDA 2D5HA 2B9UA 4LGWA 3WW2A 3FMRA 4HZFA 3J7AO 3BPVA 1ZVFA 3HIFA 3QU3A 1S8NA 3NQOA 3GBFA 2K0GA 1IXCA 3KEOA 3BPXA 1J0RA 2LF8A 2M30A 3CO7C 1Y0UA 3JTGA 3NL1A 1NZCA 3BOQA 1OYIA 3PFIA 3MDPA 3H1YA 2GC1A 5I8SA 2MBFA 3C1DA 2Q2EA 2FOKA 5J7MA 3ZMSA 3PNAA 3GUDA 1YFWA 2M45A 3M9AA 2F4PA 5DCFA 3ABTA 1PMIA 4OIPF 4M74A 1YTYA 2ESHA 1J3RA 2FQPA 1MKMA 3IRQA 1F4KA 5DYMA 3F8MA 4LUKA 2CWEA 2Y48A 4L9VA 2MA3A 2VC1A 3F22A 2PLYA 4EROA 1JUHA 3KE2A 5D1IA 3GFMA 4RAYA 2B0LA 2VOPA
chains in the Genus database with same CATH superfamily
3VWBA 3S17J 5LFAA 3K4MA 2HNHA 1OA2A 3I59B 5FYTA 4AZZA 1AF9A 1LOBA 1AX0A 5C70A 4EYUA 2QQLA 5FMCA 4BQOA 1EAH2 3GTMJ 4TXWA 4DUXA 4FXGB 1A04A 3A0BC 3SH3A 1MQTC 3N9MA 4MTDA 1MS5A 4I0AA 1XOYA 3D1NI 2W84A 2WNUC 1ND2B 1JXSA 5BNGA 1GQPA 1DF0A 4PHZA 4NQWA 1GV5A 2FDHA 4QPIA 5FUNA 4A4AA 2CTVA 4QKBA 4HPQA 1K78B 4L9NA 3PIOF 3T8TA 2HDDA 5ABJA 1G9CA 1YUDA 3A22A 4CZSA 4R8HA 1DP3A 3LMMA 4FCAA 1A6CA 4EN8B 2JG8C 2LK2A 4NPMA 3MVPA 3OL4A 4RGXA 4A0ZA 1R1A2 1DQ5A 4MGIE 4ZC3A 2P6CA 1B8IA 3KGLA 2X5IA 2RR12 5B1BH 5FB2A 3LB9A 2RV8A 2IVIB 4UUSB 1UZWA 1N3OA 1QOOA 2QSFX 5FPZA 1B35C 4GCVA 4OCTA 3ZMNA 2QQNA 5FIXA 3GVAA 5FY5A 2PN6A 4XBQA 3M4FA 2IS1A 1U78A 1IRZA 1S0FA 1Z9CA 2YFZA 1XS9A 1XSVA 2DDAA 4UBGA 2E31A 4CYCA 3RZJA 2DCTA 4KNCA 5F5AA 2HWE1 3FXKA 5FY9A 2DF7A 3V0BB 1MBJA 2LSOA 4XF0A 3AL0B 1FI2A 2GQQA 3ZQLA 3HTSB 2Y38A 2R042 5HNHA 2DMTA 4BPZA 5ANNA 1ODMA 3RS6A 4L5JA 3G73A 3TDZC 3AMNA 3CCLI 4IQ4A 5C8WA 1B09A 4DMIA 2IZWA 1MJ9A 4E7JA 2CW0F 5C8CA 4XC9A 5T54A 3AP5A 4LBNA 2DUOA 4AI9A 3MYXA 2NYXA 2A05A 4HBLA 3SISA 3D5SC 3WT3A 4AFCA 5F1JA 4BJ5C 3ZXSA 4N4NB 2C6SA 2LW8A 5FMDA 4B3AA 4M0NA 2PELA 1QJU3 1I1EA 1COV3 3M7GA 4W97A 2J42A 3LFMA 2DO7A 1BBYA 4IESA 5JXIA 3GLLA 2DFBA 3U75A 1W0UA 5FYMA 3PHMA 3SH5A 2EV0A 3BQZA 2XJSA 1FPQA 2D98A 2G19A 3G1OA 5DUIA 5A2QK 4Q4ZF 5LASA 4CDWA 2GM4A 2QQJA 2E7WA 4GXLA 2KJBA 3ASNH 4A0XA 3HNBM 3BC8A 1TBXA 3HOZJ 4FE4A 3QOPA 4NO4A 1RVF1 1V6LA 3K3NA 3GZ5A 4YM3A 3GW2A 1LESA 2CFXA 4QSHA 3OBAA 1OD5A 1K61A 1G2HA 2LOOA 1MS0A 4M3CB 2KRHA 4ISQA 1YI7A 2LC2A 1ND3B 3I71A 1LEDA 2CDPA 1OCZH 3W6KB 3UKTA 1JGGA 4ENKA 3E6BA 1XMXA 5JVVA 4AFBA 3NAPC 1W2AX 5BPDA 4MVTA 5J3LA 2QQKA 4P9LA 4BYYA 2DW4A 3N9QA 5FZHA 2ZX3A 3UT0A 2C5DA 1F4AA 2R1DA 3HTUA 3B93A 5A3WA 1EA3A 2ZJQF 4XRSG 3OF1A 2CGPA 2HYGD 1O3TA 4ES9A 3H3LA 4QIWN 2WT0A 1KJLA 1OH3A 4IV1C 1KFUL 3WTTC 3KV9A 1HCRA 3RZOJ 1YIJI 1WH7A 5EXOA 2UUZA 1VBD2 4IZZA 4A3JJ 5JOWA 3G6EI 1QNYA 1XMKA 1BJQA 3MI8A 4Y20B 2CW7A 1FMD2 3AKTA 1JBCA 1ASJ1 1HDDC 2XLAA 1JHJA 3BU0A 3NNFA 1MVQA 3I5UA 4U0YA 1NY72 2NOJB 3N9NA 3VDDA 5HS7A 2Y0MA 4BL0B 3DKYA 3BZCA 2A69F 1A6IA 4C1XA 4UVBA 2E7XA 5BV6A 2GIVA 4UFJA 3ZDSA 3QPHA 4IHYA 3GYDA 1FOD3 1LNSA 3L00A 4MYEA 1NOVA 1REDA 1VRBA 3ZVXA 3GBGA 2ILMA 4LR4A 2JDAA 3VEPA 1T2XA 2CV6A 2IFWA 2VJJA 4XFBA 1PP7U 3OGGA 1UO9A 4AQ2A 4C8DA 3WNPA 2WYSA 5I93A 4QPGA 3LD8A 2UZKA 3IBMA 4NMIA 1RUI1 3ILFA 5APAA 2AO9A 5BNOB 3MMYB 3CC2I 4N9HA 4QX5A 1YE9A 2BGCA 2AYHA 3FK7A 1PO21 1VBC3 1SLCA 4AVBA 3HVDA 5F5QA 1PK6C 2P7CB 5FZOB 4BXFA 1QNWA 4OULA 3WU0A 4AWDA 4PQ9A 3SITA 4CDQA 1A5JA 1SPPA 4FPKA 2RMU1 2O0OA 5KHIA 3CMEI 3VBRB 4XOPA 3MIBA 2P6SA 3U07A 2G9GA 1W3VA 2EIKH 3GTPJ 1YS6A 3W3CA 1W1WE 1XU2A 5GM0A 2VD7A 5A6ZA 5FP3A 1YEWA 3L2YA 3LPFA 2KD7A 1OQ1A 2W92A 2J1EA 1U3EM 1U5IA 2HQ5A 3WP4A 4YZ5A 3ST7A 2IEKA 2P3IA 4FPCA 1F8VA 5FYZA 3VZKA 2R0FA 3L9JT 1DG6A 2K9SA 1N3PA 5L36A 4ZYHA 3IL2A 2IGMA 2VZQA 3PNYA 1BR1A 4GYIA 4BHBA 1RINA 2JKXA 2HWC3 2KRFA 2YU2A 2VUCA 5JI7A 4I30A 3ZXKA 2WY7Q 2RJ2A 3LWCA 4IXLA 1OT5A 1V9U3 4HSJA 1PVXA 1VALA 4RR3A 1I3HA 1G86A 1JKOC 3PQKA 2TEPA 1WJFA 4NNJA 1YITI 1X82A 3R4UA 1JH5A 3MEPA 2VTFA 4PDWB 1MJBA 3WUCA 1X36A 2ADEA 3MIDA 3C2BA 3E6MA 4IE5A 2FDFA 1QKQA 4WVZA 3KD4A 4NRPA 3P3PA 1S5LC 3HR9A 3OSFA 2DOFA 3ZXJA 1T0FA 1BK0A 3G1LA 2OZ6A 5FLXZ 1LKXA 5FUIA 4IUGA 2OQ7A 2F4LA 1MNEA 4XONA 4OMZA 3J7YJ 2DLLA 4DOZA 2D1VA 4YW7A 2HVRA 1VFCA 5J98B 1RUG3 4XR6A 4GFBA 1IS4A 2J7MA 4HVQA 5D6EA 5FP7A 2XRNA 2M1BA 5H6RA 3DU5A 1YRNA 2HOTA 1RTVA 4ABZA 5FYSA 2GC0A 2VMHA 2PHWA 4XLFA 1OA3A 3IUOA 1CWPA 3QPTA 1QH7A 4XABA 4Z1VA 2KA3A 4AEDB 2AZ5A 2B46X 1RUD1 2GIZA 5GP9A 4QLCU 2DA7A 4R9DA 3K4AA 1HRV2 1DUXC 2P8TA 4ZKTB 4DXTA 2HKXA 4FHTA 3EXUA 2ZHKA 5C3QA 3PUHA 5HXMA 3AL6A 3U0ZA 4UUTA 4DRRA 1IQDC 3NV1A 4O3MA 2J1TA 1VI0A 3QBQA 5T50A 4CPBA 4J00A 4TLFA 2A6HF 1WCQA 1IW7F 3CKHA 4Y15A 4XJWA 1LU1A 4BKXA 2A5WA 2W52A 2YUSA 4AGVA 1V0AA 4KIBA 2MC4A 2LREA 4BDYA 4PGHA 5DAPA 2FE3A 2OQGA 3VZLA 5LY2A 5CBLA 2MG4A 3TOAA 1RXGA 1LEAA 1Z7UA 4CEYC 1R5GA 1MGTA 3AXEA 1ETKA 2E26A 2PA7A 3CIHA 4LMFA 4XQFA 3KETA 1V5FA 2FNAA 4OU0A 4LK6A 3GFIA 4ENMA 1US2A 1O7FA 1GWKA 3WHTA 1R58A 1W03A 2LTPA 5FPBA 3F8NA 1VQOI 1W6OA 3ZKYA 3I56I 1RUH3 2PMZN 1QZEA 4PBOA 3HNYM 1QRYA 2WJSA 2P5VA 4HK9A 3FXUA 3M1CA 3TYJA 4D7TA 5AC92 2GMPA 1W2NA 5C9AC 2E6VA 2VO5A 4Q47A 2ZKLA 5KXCA 3RTRA 1L0OC 2H6CA 1FC3A 3TBDA 4M6VA 5BNPC 1MS8A 1DQ2A 3ME2A 3ZSKA 2NMNA 1OF4A 3BDDA 3FLPA 2QQ9A 1I6HJ 2CYYA 5IVVA 1K42A 4XKCA 3J8F3 3CCQI 1W9SA 5GAHJ 3C2UA 4QU2A 5GLWA 4PK4A 2JPCA 3HOYJ 1B72B 3V0AB 4YARA 1ZTRA 2DFIA 2VMFA 3OD0A 4FASD 5IK4A 1KYZA 2M7BA 4DY3A 1PUFB 2GP5A 3HGGA 5FXWA 4OUMA 3CZUA 5IK5A 3GXOA 2D6NA 4XRSA 2HLEA 3S16J 2E2IJ 4IV3A 1NLRA 2VPLA 4DQ2A 2YR2A 1H9TA 2VBYA 1TMF3 2R7QA 3RSNA 2OVUA 1US3A 3NQHA 3DXTA 5DUUA 3OWTA 4CDXC 5F7UA 2DAOA 3C2GA 3IDEA 1U9NA 2E36A 4OAZA 4Q4W1 3K1MA 2VOOA 3R60A 1I1GA 3S8PA 5F5CA 4LITA 4Z8BA 3ALQA 3PSIA 2F5DA 1XYOA 4DOUA 1JW6A 2ZA9A 1A34A 4LG3A 3DPRA 2H0VA 3K4BA 3K4DA 3KT1A 4XLCA 4P5HA 3KX2A 2K46A 3QODA 4AIDA 1DCSA 4WM7B 3WD5A 4AR2A 1UYYA 3MF6A 5AONA 2KDOA 1CQ9A 3O12A 5JIAA 1KD7A 1E0EA 1JYXA 1LQ1A 1OUXA 2GXGA 2X53S 1X9PA 1W04A 3VKFC 2M5WA 5FYUA 2MGQA 1BM9A 5I0TA 1ZBE2 4FVVA 2DBBA 1MBHA 1LVAA 4LE4A 2HWD3 4V2VA 2QQIA 1Y43B 3JZVA 4A3BJ 2JD4A 4A3EJ 5EP9A 5C33A 3BTCA 2EPFA 4U0WA 4Y22B 1T6SA 3CCUI 2WLQA 3RZMA 1BIBA 4BM8A 4SBVA 5KHDA 3OGVA 3IKVA 1ORKA 1KONA 4OAYA 1SDDB 2D43A 1GVJA 4R9AA 2D5FA 3F3XA 3A0KA 1LPQA 5D5WB 2FQ4A 1XNDA 2BV6A 2OUJA 5EIYB 2N7GA 2V4VA 3ZMVA 4JCKA 1Z6RA 3ACHA 2W00A 4XKWA 1LAJA 2W47A 1VMJA 5HVQC 5FV3A 4AGRA 2F48A 1T38A 2K9NA 1SQ4A 2Z99A 1ULOA 3ZQFA 2IC1A 5JLVA 3FN9A 2VXDA 4IDZA 2MNGA 5D5XB 3GHNA 1YHQI 1R9TJ 3K4LA 2BWAA 2RS31 4M4PA 2DMPA 1TME2 2XG3A 4Y24A 3BUCA 5EDNA 1UG0A 2IXJA 2P1BA 1UU5A 4YVWB 4FPEA 3UJQA 1IRFA 2RREA 1RHI2 1Y4WA 2BERA 3FIWA 2JDMA 3BTJA 1LHNA 3DYOA 3W2AA 3BVCA 2MEV1 4ZZLA 1AR72 3AVSA 4LQRA 5BNNA 4M01A 1BHGA 5JVGF 5IVYA 1LVKA 1OR7A 5LEKA 4AM3A 5DDJ1 3I9V2 4Y33A 2WNVB 5FOBB 4Y17A 1D2SA 5CISA 1Z6TA 4N53B 4EV0A 4WVMB 2WN2A 4HNVA 2M9HA 2MLGA 3MLLA 2G9FA 1Y8RB 1T8IA 3IDCB 1ZZ8A 3ZMDA 2O14A 4NIDA 2VBWA 4HPKB 4I0BA 4YZ1A 4JP0A 2IS4A 4E2QA 4XURA 3CUOA 4PLOA 1MZFA 1RUF2 1UOGA 4IEJA 4XSXF 2YSRA 3TAYA 4JOMA 4EWAA 1UY2A 2F4MB 1Y1VJ 4ZS2A 5F3IA 4AXOA 3FLTA 5DV5A 4LO4B 1K5MB 5C3PA 3ZYRA 1JU3A 4L0PA 3K0LA 3ILNA 4RB0A 1B9NA 3HEFA 5E8IA 5A7WA 3SXWA 1LHUA 4YZ2A 4Y5Z0 1TNTA 1XNTA 3FMSA 4ZYGA 3S3OA 5JMCA 2V72A 1E5SA 4C3JJ 2BOLA 3REOA 4FISA 1LRHA 1GOGA 5F0CA 1N1TA 2HPIA 5FAXA 4YRDA 3B73A 1FBUA 4L9JA 4GJZA 1Z0XA 1S29A 3LDRA 3L9FA 5AFBA 3OR2C 5FKCA 1VQ8I 1RUJ2 2PFWA 2WV1A 4DNYA 3U2RA 1ZRCA 1X4PA 4NN0A 2NQYA 2W85A 1W99A 5C8CC 3ZQHA 1V4RA 1BOBA 4WM8C 2DA1A 4BNCA 2VL4A 3JU9A 1IDYA 4UI9L 1CAVB 1F4HA 5HLTA 2DYCA 5A1LA 1GV9A 2UWCA 4PGGA 4IEXA 1XNAA 5GADJ 4OZOA 3UNGC 2VUJA 3I2IA 4RD7A 4YG6A 2XB6C 3V42A 2CV0A 3K6GA 3T09A 2GDFA 4GIQA 5DUWA 2LY1A 2ID4A 3H3VK 2JEMA 2WN3A 1W28A 3KHBA 4DYCA 2WDBA 1O7LA 3OR1C 4QGLA 1W39A 1V5GA 2E1MB 4YSFA 2BJSA 3SCHA 2NZ9A 3ECHA 4UFLA 1QOSA 4UW5A 2OQ6A 4QKNA 4NIAA 3ASIA 3LNQA 3VKLA 2YX7A 4CDWC 5KVRA 3FLRA 3MEXA 2ZGKA 3O0WA 3WTVC 4MGQA 4X0GA 2DPUA 5IY5H 5CQEA 1PVC1 1JUSA 1ULCA 3WCSA 3VBUC 1IS3A 3RDIA 3HDDA 3WTSC 3UKNA 4LG0A 4KWLA 2YPDA 1U9OA 4C2MJ 3MLKA 1PZ9A 2C4XA 5FYVA 4IEOA 1LHWA 3CLOA 2TCTA 4ZY9A 2WS93 3JRAA 1NLSA 5G05L 3LOBA 2E7AA 4YVSC 3JB4C 4CCLA 3SNMA 3K2AA 4LBQA 5IWFA 3O1OA 2A6XA 2CG4A 1FTZA 3UKGA 3Q8CA 2ME0A 1VTNC 2H8WA 5B3SH 3AX4A 1T95A 4M3BA 3U1KA 4A2UA 2IXLA 1NG6A 5J37A 3T5XA 4NIIA 2VKHA 1O4YA 2WFF3 1GU3A 4CU8A 3POSA 4RYDA 2KXLA 2DN0A 1EP0A 2YX4A 2KHMA 5F6KA 1RMU3 4ZTJA 1BA5A 4PCRA 3RZKA 1TG7A 1UMIA 1YQ5A 3OG2A 1HW2A 1QHGA 4Q2FA 2QYOA 5ERIA 3K2OA 2E7TA 1WLWA 2OYZA 1EUTA 1B6AA 3BIWE 4I76A 3IPVA 5J48A 5T5LA 1YW8A 5FFZA 3LSRA 2JA7J 1PO12 4B43A 2DK5A 3SH4A 5FYYA 1J2XA 4JDNA 1EKEA 3DPUA 3KM5A 1GZWA 2GNTA 3JBG2 1FSEA 3LAGA 1X1PA 4KISA 1CAXB 1LHVA 1FYKA 3RPUA 1ZG3A 2W82A 3CMAI 1S2EA 3USUB 2P3YA 1TVGA 4JGYB 4MHUA 4KH9A 5J8CA 2VR4A 4RGRA 2JECA 1IPKA 1D3YA 1YJLA 2MABA 4QPGC 4HG6B 5GZGA 3T2OA 4EN6B 2WLPA 3C7GA 3KZIC 1AR83 3TO9A 1C1FA 1OLQA 2Y6KA 2BXZA 4C1WA 2DMQA 5J47A 2PMZA 4D3WA 5EEAA 3I3MA 2VI6A 4A3ZA 2M8EA 1ZR4A 4CDQC 3E7LA 3TN91 3TEXA 5FROA 3I4IA 1UCXA 2Y69H 3M4OJ 4YRVA 4XORA 1FPN2 4CUAA 3N9LA 1JUMA 3H36A 4DUWA 3BCAA 4DIQA 3VHNA 2YXSA 1U5TB 2RM23 1RITA 5DUVA 2V5YA 5CFCB 4XBLA 4PSXA 4PLNA 3CJRB 4L5IA 1HB4A 3MICA 3HYIA 4YWAA 1JZ3A 4XMYA 3LQQA 1SCRA 4DRVA 5HV0A 5HDNA 1TQIA 2EXJA 5DM6F 4QD2A 3ZGKA 2OKXA 5IP9J 2L4AA 1E3PA 3J7MA 2BW3B 3MWMA 3OSGA 4TWTA 3SKJE 3POGA 4NBQA 4CH7A 4K8RB 1BI1A 4IW3A 4JBAA 3VYSB 1AYM1 1DFQA 5DD4A 3BTZA 3NV3A 1UY3A 2QFEA 3WHCA 3GJBA 1ZRRA 4NE9A 4NHJA 4ASLA 4RR3C 1HKTA 4NPRA 2PHRA 3JQXA 2Z3YA 1PX4A 5FWEA 2BRTA 4V19K 1MIJA 1MBEA 4RLQA 2WBMA 2RVAA 1IN8A 4XCAA 1W5SA 2QJVA 2AENA 5EQUA 2V1XA 3DTEA 1AJKA 3U11A 1A36A 4TV7A 2YG0A 3RQ0A 3LL7A 2E19A 1EH8A 3S7IA 2HXOA 4RGAA 3H9JA 1F43A 1X1AA 2P5BA 1D0GA 2UV1A 2OAZA 3O8GA 1Z05A 1K3IA 3RKWA 1NCQB 2R0QC 5BXXA 4BQQA 1EV11 4II3A 1ZBA2 5LHGA 4QGMA 4RQPC 1BIAA 3QD6A 2V1DA 4RA0A 5ILVA 3F8BA 3A0HC 4UW3A 2IJLA 4ON0A 2VMDA 1S4CA 1YCIA 1S7OA 1R6RA 4AYBA 5GZDA 2XPJA 3CJIB 3UJOA 1O5LA 4KT5C 3RYKA 4NIGA 1WMXA 2R072 4LHLA 1FJLA 1ZN2A 4FTBA 3B01A 3ZSLA 2V09A 4DINB 1MBFA 2VECA 5F39A 1RNLA 4BUPA 3SZPA 4QKDA 4NQWB 2XMLA 1MPXA 3S1MJ 4QPIB 5JZGA 1RYYA 1TWCJ 2V26A 3ON7A 3KV4A 5FY4A 4KBBA 3CNAA 1YLLA 1LTEA 4O65A 3PQJA 3CO2A 2CMPA 2ORXA 2QBYB 4GZ9A 2P5KA 4XOTA 5ABJB 1VJ2A 1K45A 1W6MA 3OUHA 3G2BA 2MW8A 1QJX2 2OA2A 1GVDA 4FSJA 2HOAA 4PIZA 1HXDA 1KDMA 3PL0A 1XGNA 1JKQC 4P1WA 3ZFGC 2XJRA 3M1EA 2Y64A 4QB2A 2DBIA 2X5IB 1Z91A 1IGOA 1ZGWA 1LODA 1W8HA 2XAGA 4YFNF 3ZXDA 2LR8A 3X29B 1S0JA 4IPAA 3NKGA 1X58A 1V6OA 5C4WC 3CJNA 5D4RA 4RHV1 4WXDA 4UB6C 4BY7J 2MFZA 2B5HA 2JX9A 5E89A 3KS7A 1YG2A 2UY8A 3SZTA 2WSUA 1CZVA 3QYBA 4PI2A 3FM3A 2ZC2A 4GWIA 1UCRA 1MEC1 4D6SA 4KGGA 2RDNA 1XJAA 3O2PE 4NR1A 2FDIA 2BBAA 1RJ7A 2K7LA 2ELKA 4L2NA 2CH0A 1BMV2 4P9JA 4QXBA 4B4PA 2X10A 2OQRA 2ZMEA 2ET1A 2VH9A 4QX2A 3LSJA 2KT0A 4MGYE 5T5OA 1H2NA 4XF4A 4QPQA 4I7HA 2CUJA 3WDVA 1VQNI 3B6AA 2DU9A 1F9NA 4ET7A 4WVWA 5FLXK 4R79A 3P5BA 1BR4A 1OH4A 4OVEA 4XXPA 1XX5A 1W6QA 4B7EA 3FDYA 5E8GA 5F27A 3S15J 4EZ4A 4M0HA 5E3OA 2ECCA 4HFSA 1V5EA 1JUIA 1UIJA 4FX0A 3U4XA 1XDUA 3RMXA 4IEPA 4IV3C 4XDQA 4G94A 1ZYRF 2VT2A 2LY2A 1F15A 3GALA 2QCSB 4O9GA 2ZXIA 2MH2A 3WDUA 3OL3A 1FXZA 3A01A 3I3DA 1VBD3 1HN0A 2X0LA 1SMYF 1V6NA 2L9RA 3FXJA 3OGJA 4YGBA 2ID6A 1CX4A 1HSTA 4JHZA 3LFUA 3K1PA 4HNUA 3MIFA 1FMD3 1RPWA 1XYPA 2HDCA 1Y3TA 2JQ7A 1GV2A 5JHUA 4X1EA 2W9XA 5CKNA 1JZ7A 1H1AA 2NNYA 2WNOA 1WI3A 1S0EA 3EYPA 3JB8A 3N7MA 2R063 4WV8A 2B39A 3O0XA 3KVBA 1ETWA 3S1NJ 3GZ6A 1EPZA 3ITQA 1P2FA 2G7UA 4B1LA 4C0HA 4JKMA 1HLCA 3HD8B 4MQVA 3ZN4A 3OPWA 3RFRA 1S1AA 2RV9A 4KIFA 4JV4A 1A78A 2D5HA 4FFFA 3S2DJ 1VF9A 1ZVFA 2D3PA 2KR2A 1QJY2 5A7PA 2WINB 4H14A 2E1OA 4NHKA 3CCRI 2BY2A 2ZPXA 2VZOA 2M30A 4RFT0 3NL1A 1OC1A 2PXJA 3MDPA 2YC4A 1YQCA 3Q0VA 5IVJA 2BVLA 1Q56A 5CB7A 2GC1A 3AJZA 1OXCA 5J7MA 4FPHA 3LIHA 2X85A 2M45A 4GB32 5CNAA 1AL21 1PMIA 1EF4A 5B66C 1JJ8C 4CP2A 4M74A 4J19A 5C3OA 5JMOA 3VDDB 1YTYA 2ESHA 1A31A 4LUKA 1RKTA 4O61A 2VC1A 3VL9A 3EUHC 4EROA 1FV3A 3AG1H 4BXXJ 1QGLA 4E7SA 1X19A 2HWB1 2JVGA 1Y7BA 5IHRA 3A23A 2EXHA 1J58A 2BGPA 4YM1A 3PUIA 2PG4A 3GTQJ 1UKRA 4BMBA 1TW2A 3D82A 1ON2A 3VD3A 1CAUB 3AB0A 3GYHX 1ZG5A 1VBA2 3A1YA 3FXOA 2VTXA 3O1PA 2D45A 1OCRH 2JB8A 2COMA 3KLOA 5HLGA 3L2UA 3ZN1A 5BNNC 2GXAA 3I2GA 1OR7C 5F5IA 4SLIA 3S32A 3K70D 4LJHA 4XLEA 1J83A 3R05A 2BNNA 2JE8A 3J7NA 3G4SI 3KPHA 3JQWA 1JMUB 1DPUA 3VB9A 3R0RA 2ZKNA 5E8AA 2XAUA 1E5RA 3GGLA 1SPPB 4AHWA 1R091 1BEV3 5CVJA 2D6LX 2K40A 3IC7A 4F3QA 3VZMA 2KFDA 5CJ9A 2V1UA 2X48A 1PGSA 2XUEA 4C2UA 1H1MA 2E2JJ 1O4TA 2VVDA 3WG2A 4Q0QA 4G9YA 1SHWB 3MF9A 3RNSA 3AL5A 3BZ6A 1LDJA 5JOYA 1O4XA 3J7LA 3I4PA 4LPLA 2CQXA 2DYSH 4QX0A 3V7RA 1RJ8A 4N43B 4NIHA 2UWMA 3NVCA 2HBTA 4ARYA 4KU8A 2NVUB 3AMHA 1U5XA 2L5QA 5E3NA 4CUBA 3HXLA 2BGOA 3H5AA 1KA8A 3ZYJB 1SAXA 1G3WA 4KMQA 2QCOA 1MSEC 4HX8A 4L0ZB 1ZH5A 4YFWA 4BQAA 3WTUC 2R7OA 2JKBA 2WWYA 1FP1D 4QM8A 4CDUB 4AG4A 2R7VA 5EGOA 1R083 3VUOA 4P08A 3EHKA 2DA2A 4HN1A 1R1ZA 4Q4Y2 2CUZA 1U8RA 4AEJA 2W5FA 2QSHX 2ISYA 1I6XA 5LGUA 2GMEA 4HONA 3R61A 1LUJB 2QNKA 4QX3A 4YEJA 4LORA 5F04A 4CEWB 5A3PA 1OFCX 3ENRA 1NKGA 2J22A 5HCBA 1Y1WJ 2ZO4A 2X1CA 3KV6A 1R1UA 2XVLA 1C8NA 3VKMA 5E16A 5DG2A 3SFIA 5FZDA 1S55A 2GOXB 2DUQA 4LT5A 3UK9A 5ISLA 1YJKA 3Q3SA 2CQKA 3AFHA 5K0UC 1QPMA 4D0PA 5GZCA 4YYOA 3MFCA 2ZX0A 3B00A 3V8KA 2VNOA 3B7MA 2LVSA 3UGFA 2PLV1 2ES3A 2M34A 1GQHA 5T3NA 2W24A 5JSRA 3LEMA 5ICGA 5FD5A 3FFQA 5FBZA 2EFNA 1FYUA 3I55I 3BQYA 2GA2A 3VPRA 1FOD2 1WJBA 1G9FA 3KGZA 4QQHA 4S2DA 5C3EJ 4FI9A 5T55A 5H9PA 2F6CA 1N25A 2CUFA 2VAUA 2X1EA 1ZRDA 2CAUA 5FXXA 5AC93 4JQRA 3ZXAC 5L3CA 1EH6A 3UKVA 1P7IA 4YG0A 2FXAA 5LHHA 3T08A 1ETYA 4YIFA 3S5AA 5FKKA 3WSOA 2XL9A 3AP4A 3WTWC 2DA5A 5AIQA 2WWJA 4LO7A 1IC8A 3LDBA 2CFOA 2P81A 4DFSA 2WAEA 1ZR2A 1OFSA 5DABA 2D97A 2VN2A 2R7ZJ 3TO6A 3HBLA 4GH4B 3PJRA 3O14A 4UV9A 2VLAA 4UY8I 5DZFA 1X2MA 2WAQN 1ZQ3P 4E7KA 1QZZA 5DAXA 1R64A 1KQ9A 2PI0A 1VBE1 5I8YA 3RI8A 1G9AA 1ULEA 2EA4A 1GP4A 3U1XA 1ETQA 3GX4X 3K51A 2FMYA 1QWRA 2XF7A 1GWMA 3GTGJ 4OIOF 3LQCA 1SEFA 3DKQA 1TQMA 2LP0A 1G9DA 3IH2A 5FYCA 3WCRA 1X9TA 2F5FA 3B3QE 1WZXA 3HT1A 2ADDA 3S30A 5F2WA 2A73B 4QX7A 5KAIC 3C8XA 2HVQA 1H4GA 1AX2A 4G6TB 2HWC2 4O5VA 1PMHX 3DLLF 4A6SA 3OMYA 4A5MA 2VBXA 1Y0NA 3E5UA 3ZPLA 2ZZJA 1UF2C 3H92A 1MQTA 1EH7A 1YIFA 3GJAA 1OPMA 2LRDA 3F9KA 4K1ZA 2HU9A 1ZBE3 4M3EA 1RUC2 4CCJA 2XR4A 3HOVJ 2XBO2 4GA9A 4YW2A 2M0MA 2ETHA 1Z7S1 1W0OA 1G3SA 3B9CA 4X6QB 3VD9A 5J09A 3VBHA 2HS5A 3CC4I 3FXQA 1DDLA 1E3HA 1ZRIA 2HVSA 3THTA 2JG8A 1L7LA 5E1XA 1HF0A 1R71A 1YIPA 1X3WB 4PDKA 1QJU1 3ELKA 1COV1 1TL8A 1QJFA 3CCEI 1DDNA 3DPRB 4FT8A 2IBDA 1FOXA 2A6YA 3WE2A 1UKGA 1J59A 4UXNA 3LEKA 4XSZF 1E5HA 1JKPC 2XROA 2B7EA 4PQQA 1P4WA 1OYYA 3H5NA 3ZPYA 1JJ6C 5TSWA 4ENJA 4Y5TA 1NG0A 1WMEA 3BPZA 2DT5A 2LS6A 1OCPA 5J40A 2LFBA 3JR9A 4V2GA 4KWKA 2KZGA 2DVBA 3OOXA 3OYBA 1XSQA 4XNFA 3HOUJ 2W68A 1CF7A 2G9ZA 2Q0OA 1BLZA 2B63J 2LROA 4KT6A 3AFGA 1RHI3 5A1FA 1OCCH 2VOXA 2WB1A 1ERDA 1MVEA 3OYWA 3EYYA 1D4M2 4ANJA 4WVVA 1AR73 3TDUC 1S6LA 2UURA 4LOSA 1XPXA 4HF0A 3EO6A 4XBFA 4C3IJ 5J1XA 1AL0G 4QMAA 3MW2A 1S0BA 4G7ZF 4Y1YA 4B09A 2ZEYA 4XZUG 5FR3A 4B44A 3OYEA 1P4XA 1WJCA 3ZMOA 3OSDA 3MO4A 5IT6A 2GA1A 2IXKA 3VBFB 5L7OA 5KBFA 2BZDA 3HRTA 3E5XA 2XF6A 3L2WA 4CP1A 1NA1B 2Q8OA 2ARBA 1XN7A 1LJ9A 3WG7H 1J3QA 2R7XA 2EZKA 1RR7A 3WHUA 1RUF3 5EZWA 2ZHNA 4QTRA 1SG3A 3PVOA 5LBBA 3NWTA 5DCMA 2O8QA 1VNDA 4F83A 3ACIA 2OPWA 2OUHA 2IXIA 3BY6A 4BBRJ 2JT1A 4QPWA 4BJ6C 3H8XA 3VGIA 4NPLA 1UHWA 3RMYA 2HGCA 2V7FA 3ZN6A 3TEDA 4LLOA 3LEIA 4EMSA 1R1TA 3GXUA 5HBAA 4CPBD 3SFZA 3HOWJ 5HCAA 4P9YA 4IO9F 1IN5A 3J8F2 2G7HA 3HBZA 4ZU4A 3WX5A 3NAPA 3CF5F 2RDRA 2UWAA 1QVUA 1RUJ3 5FZFA 2J1RA 1Q1HA 3HL2A 1IN7A 3BG5A 2VONA 1H8TB 2D40A 2IVMA 1O3QA 1CONA 2K3PA 2AHQA 2QZ3A 2X05A 3HPGA 4BE1A 1W6PB 1ACIA 1HXS2 3S2WA 3AYEA 3BT9A 1RVF3 2ZFWA 1KZHA 2MH9A 1PGW1 2Z2SB 5BMZA 4BE2A 5A33A 3E1SA 1R49A 5FP9A 4XLNF 1YHFA 1LFUP 1W2TA 3I2FA 1FSHA 2W91A 4PCQA 1VBC1 2OXBA 1LGCA 5DTDA 4XUTA 1YJ9I 4MGZE 2XAQA 4NUBA 3OIOA 1UJ8A 4K40A 3KSCA 4HLXA 1DQ1A 3LEGA 4NB5A 1W6NA 5JUVA 4AVAA 2IGNA 4XPVA 1Q43A 2DBNA 1H9GA 3C7EA 3VBSB 3LSHA 1HX6A 4AU7A 2BVVA 1IZ3A 2K4BA 1FBQA 1KS5A 2M3AA 4F52A 4CCDA 2C6YA 4D7YA 5FZLA 1MD0A 3P7NA 4X6RB 2YBSA 2J1AA 2HWD2 5CVUA 5FXZA 2X6WA 4UB8C 4Q1RA 3OJBA 3Q9OA 3W58A 2XJQA 3CCJI 3S7EA 1VRH2 2HEWF 5KXBA 2XGDA 2ZMEC 4JGZB 3KEQA 3ZQCA 3CP8A 4OHWA 1Q8PA 4OYUA 1GP6A 4H7MA 1ASJ3 3LDKA 1VR3A 2WYFA 3SHFA 3GTJJ 2HWC1 1YYNA 1XMAA 4N0BA 4LOTA 5D5VB 1S2KA 2OC6A 4PSWA 4R1HA 3T8RA 1V9U1 1RXFA 1WLCA 1HRI1 2F5VA 3R6SA 1XC5A 3G1MA 1U6GA 2D5VA 3RJRA 4A41A 3WR0A 3WXPA 4ATFA 1PK6A 4JKKA 3WF1A 2D93A 4MFDA 2PMUA 3VBOC 4HW0A 2X4HA 2P37A 3W59A 3SEZA 4Z82A 3I4MJ 5IVEA 1S7AA 4XZPA 3M8LA 4FTHA 2NPIA 5CADA 3PVNA 1VBB1 5CKTA 3CQOA 2R5YA 4HLTA 4BB3A 5C3RA 3NWSA 2E53A 2W94A 2A5YB 1RUI3 1LKNA 3NV2A 3WEZA 1RUG1 2X1DA 2VJ4A 4AI3A 3IT8A 1FY7A 2R5ZA 4NRMA 3ZO0B 4LG0B 4YGEA 1PO13 1UMQA 3P9KA 4N7UA 4IL6C 5K8SA 4BAYA 4EM0B 1VMFA 2DU0A 3U78A 5BYNA 1YI9A 2OPKA 2O5RA 3ROUA 1G6NA 4GQ7A 2CW8A 5F1RA 3JBG3 1SFKA 1WD3A 5AIPA 2A6EF 2Q2EB 2ZJRF 2BY0A 1PIV2 4LBQB 4AYUA 1S0CA 1ITYA 2WL1A 2R7UA 5DUKA 3NEUA 2VW0A 2F5CA 2Z69A 1OQYA 2OTLI 2TNFA 2X8KA 3DEWA 2ZX4A 3ZSJA 4GWNA 2YU9J 4R9CA 4AQ6A 1PM4A 5DM7F 1Y56A 5F6LB 2FX0A 4LHNA 2M2EA 1RIOH 1UMZA 2E33A 2RDQA 1GBGA 3HPHA 3QPSA 1CX1A 1BYHA 5K9YA 3RZHA 2P34A 5GTHC 4XE9A 4XW3A 5FLMJ 3ECOA 1NUKA 2NYYA 4QWNA 5FZ8A 4E4ZA 2JDNA 2VQHA 4Q4V2 5EZGA 3HHGA 1H2MA 4OMYA 4XIOA 4KJZA 1KYWA 3KP2A 1X3UA 1DQ6A 1WLDA 4QU1A 2FNPA 3SLIA 4FFIA 4UHTA 1J1LA 2L02A 1GZWB 2PQ8A 4IRGA 2A61A 1TWAJ 1RUH1 5HS9A 4DYRA 1ZX5A 5FKOA 3WF4A 2O61A 3W6JB 4XILA 1TNSA 1W3XA 1DGWA 4BLJA 2BTVC 1KQ8A 3IH4A 1HC8A 2CL2A 3D6EA 3JAMZ 4KUMA 2DV9A 1MBGA 2Q1FA 1XGOA 3WU1B 4CICA 1QDCA 3LA2A 2P4EA 4B1RA 3OS2A 3A4CA 5FYBA 2KM2A 1X3ZB 1FLIA 2K02A 3CMYA 4AEMA 2FMDA 4GD4A 2DFEA 3WQ7A 4CCKA 4LO8A 3SDGA 3ERED 3T0YA 1WCUA 1WQ2A 2WT1A 2WADA 1UNBA 2YU1A 3QP6A 2J5OA 4CEYA 4UV8A 1VQPI 3I59A 1KITA 2RS12 4K3UA 3KT4A 4BK4A 4XJ9A 2GP3A 4HSLA 1P9QC 1LOGA 2VQAA 1VAMA 1HBXG 2VCAA 3A21A 4BQNA 5HNFA 2ZFUA 3DBLB 1TMF1 2AS5F 4OHZA 1IPJA 1W90A 1IN6A 2QQAA 1LENA 2AR6A 5CVIA 5ACA1 5LLQA 3KZZA 3SEEA 3JD71 2FUG2 5E88A 2ERFA 4D5CA 5JI6A 5LD2C 1ND2A 1YIOA 2YV8A 1FYLA 1I1SA 4G9SB 1Y9QA 1HB2A 4LKFA 1ENQA 2E71A 1H30A 2GN7A 5C9AA 2RQPA 1HKQA 2R7FA 1HQNA 1EYBA 2BP6A 3PJQA 1KXGA 1WD4A 1VQ7I 3MIHA 2WS92 3AZXA 5BNPA 3CO6C 3KEYA 4CA9A 4CYDA 4CVUA 4META 2JICA 5A7NA 3L2RA 4HLYA 1XU1A 1JZ5A 3OYJA 4KYWA 4S2FA 1XCBA 1GOFA 2JSCA 3DBHB 1KQ0A 5BNQA 4XL9A 2OBPA 1GSLA 4TZDA 2HZDA 4LBKA 3THCA 2NVTJ 1LEBA 3UGGA 1CZSA 1QZYA 2DVGA 1QJX3 2YROA 2JG9B 4UUSA 3ACLA 2IS6A 1URXA 2QQPA 1RMU2 1OOPC 3F8CA 3GZTB 3Q8BA 1JZ4A 1I5ZA 3LZZA 4CHUA 3ZOBA 2FDKA 2DOEA 2JDPA 3I49A 2AQEA 1QGPA 3J81Z 6PAXA 3IB3A 1JTXA 1R23A 5FKLA 4A3LJ 1NLQA 2W1WA 4KG0A 2VBPA 1SFYA 3J80K 1WJ5A 1CAWB 1S72I 3V0BA 4QHOA 3RSJA 4IVNA 3ZYIB 4GKXA 3HGYA 2P6HA 3ZFFC 4A3FJ 4UVCA 1DP7P 1ULFA 1ZZ9A 3AG3H 3UESA 3H0OA 2O8KA 3CF2A 1N1SA 5FGMA 1Y9GA 2KMUA 1WH5A 3ZP5A 3FZVA 2H6BA 5JZGB 4UFIA 4LBQD 1REEA 1XDSA 1J3PA 1JI6A 4QB1A 3W5NA 3BIEA 4AIJA 2Y8KA 1C57A 4XQWA 1T6GC 4U7BA 3CMGA 1YX3A 2NAZA 1LOFA 4Q4W3 4FETA 3T2QA 1D4VB 1LGBA 2CV2A 5ICEA 3DQVC 1WVRA 3LCPA 1NCRB 1IUYA 3S93A 1NYWA 4MGKE 3U10A 3CC7I 3WG9A 2ARAA 4IOCF 1U0JA 4J1WA 5J1UA 4LHKA 5IUQA 3PU3A 4LA2A 4Y1UA 1XRUA 4JVAA 4Z2AA 3APBA 4QKFA 1O57A 2RJKA 2ADUA 1WA6X 2QQWA 1LFPA 1Q5OA 2CDOA 1MBKA 3NV4A 4B3NA 4XTPA 3RI9A 5EWSA 3AXDA 2FCVA 4HSTA 3L1PA 2VVEA 2FJ1A 3LE0A 5HPOA 3JRBA 5BPIA 1U0AA 4HSRA 3T30A 1K6YA 1B9MA 1HOMA 2X51A 4M71A 4NJ4A 1UYXA 1NZIA 3WTZA 2RG4A 4M3CA 1W4MA 3WINE 3FJSA 1ZLKA 1DGRA 4MOAA 2CU5A 2TRTA 4IEVA 4AI2A 3JRDA 4Y52J 2UY9A 3OOPA 3PVBB 5BY5A 5IT3A 4OQ8A 1A8DA 3I7DA 5E1ZB 3MPBA 4DEQA 2WZ8A 2HKOA 3FMGA 3WUDA 1PZ8A 1ZARA 4UW4A 2EFPA 4Q26A 1APNA 5KC6A 1JYVA 5GKAC 1FZPB 1ZELA 2Y0SA 4P5OA 1W6QB 2IVJA 4B7KA 4G7OF 4QHZA 3OV8A 2YZ4A 4RS5B 2VODA 5EJCA 2EIBA 3ZFEB 3ZSMA 3OYGA 5IAXA 4E27A 1JU4A 1QXJA 3VBHC 5J1YA 4AHZA 1QA6A 4Y20A 3M3YJ 4LKEA 2PN5A 1QJY3 1HQLA 2ZGQA 2RS33 2JPBA 4B1MA 2RE9A 2F2EA 1JTYA 2ECBA 2VXRA 3C18A 4A6OA 3J9SA 4OHVA 5HDGA 2VNRA 3NJZA 2GMMA 3QLQA 5T52A 2DQRA 2PTMA 1D0XA 3RGBA 2H1LA 2AEYA 3B02A 4GB33 5DDJ3 3CLQA 3WF2A 3MKWB 2ZGUA 5FCCA 2BFUS 1VQMI 3K4NA 3GFLA 3WG3A 3R4KA 3SXYA 4A3MJ 3AKZA 1SFNA 3IAM2 1GT0C 4HT1T 3N7JA 1FT9A 1OQDA 3IV5A 4ZXEA 4KITB 4HOOA 1AR92 2EFWA 5JAXA 4AD9A 4E4SA 3R0AA 1C0WA 1HSJA 4OMCA 1JE8A 1MDMA 2VC9A 3O0VA 3VKNA 1VMHA 3CJQB 4KWJA 1MZEA 1O8PA 4KL1A 2PQQA 4MHRA 1RUE2 4N7IA 2Y26A 3OCPA 3MKZA 2VB6A 2M7AA 1VBA3 4IHVA 4J01A 2IA2A 5C44J 4WM8A 1BI0A 5FD6A 5FZOA 4J1XA 1AVBA 3OGSA 4IGOA 4LD5A 2PHTA 1GLNA 1MS1A 2K9ZA 3VHRA 3VBRA 1BBT2 4HG2A 4K7JA 4KWUA 3ATGA 2KIFA 2HZTA 1RUNA 1HA8A 5L7OC 4E6KG 3P1IA 2BQPA 4LK7A 5F0HA 4FFGA 2Z1DA 2XVKA 3J4UH 4PT6A 3KB5A 3OTFA 4Q0PA 2RNGA 2WFF1 4HN0A 1TC3C 1WCMJ 5A80A 4AI1A 2R7EB 1PX3A 4CXWA 1QQP1 2DTYA 5IK7A 3PVEA 2E34A 1ZZCA 1IHMA 5E17F 4XMAA 4C30A 1NX9A 4KU7A 2I10A 4M3CF 1MS4A 3M1HA 4A3KJ 3AMPA 3D8CA 2PMHA 1R4NB 4OQ9A 3HSRA 4XRMA 1YLFA 2P6TA 4BIOA 3VBUA 2EV5A 3CTAA 5H2FC 1E17A 3VDBA 2EA2A 4IKFA 4PDWA 3LQRA 4JQFA 4E7HA 2XVCA 2O8XA 4A45A 3MKYB 4YVSA 1AR61 1YW9A 3GCWA 3P6BA 2ZGLA 5D21A 4OI0A 1AJOA 4UT5A 1VQ5I 2V6EA 2A75A 5ICFA 4Q4Y3 5GZFA 5HODA 2L9NA 4ATEA 2PJRB 4O9EA 4GGGA 4KA4A 4LKDA 2CUEA 2IP2A 2BW8A 4KN4X 1NE4A 3POYA 1W36C 3VYRB 2IGKA 3NJVA 1LECA 1GXQA 1UU6A 2ZHLA 3DPTA 1AR81 4FAGA 5E3MA 5CFDC 4XACA 3ASOH 5JXGA 4AEDA 5FJ8J 2E63A 1QJEA 1AYN1 4CP9B 3V64A 1K7AA 3GCMA 1W0NA 5FUPA 2FOWA 1OISA 3VDCA 2LY9A 5M0TA 1PNFA 1H9WA 3IKWA 3HQUA 4BE0A 1JYWA 2R062 2RM21 3K9TA 3AP7A 3CUQB 2QQMA 4MX3A 1H2LA 4AWXB 5E18F 5IAVA 2OF7A 2COBA 2NVQJ 2DU1A 3I2OA 1FNNA 1XCVA 5FZ4A 3HJRA 3WG4A 2HQRA 3TGNA 2GNBA 2K2SA 3PURA 5ICCA 1UHSA 2WIIB 3IIAA 1EAH1 5C6CA 4AQTA 1C8M2 2XWJB 1ALYA 2JE7A 2O3FA 5JOXA 1DZQA 2K5CA 3O1UA 2RS52 2AEZA 5K7ZA 1O5UA 5D2AA 2DVAA 1VZ0A 4AVSA 5LATA 1K83J 5J36A 4GKYA 4A5NA 4ZZ8A 3RKYA 2PHFA 2RHPA 1CN1A 1OF3A 2TDXA 1SD4A 1ZREA 1UB9A 4KFCA 1BVP1 2RGVA 5F32A 2K9LA 1BQPA 1B59A 3TBIA 2DDUA 1AHDP 2RDPA 5FY1A 3D5OA 3ZM8A 3BCBA 3BLYA 1U5ZA 3MFAA 1A6QA 1R1A1 2I2SA 4GALA 4XFCA 1DLLA 1E3OC 2RR11 1IO2A 5DPNA 5FTTC 3FC0A 1UELB 4YFKF 3AYCA 3TNPB 3CDLA 1USSA 2WQZC 3V0AA 3JSOA 1PGL2 1IV8A 3HG9A 4N9IA 1PUFA 2OZJA 1BK1A 1STMA 1MR5A 3K4CA 1VLNA 3ULQB 4XF3A 5KNLA 2BNOA 1WKMA 3A7QA 1OPCA 4LK1F 1RUC3 2C1FA 2R041 5LA2A 4IERA 1PP8F 2XBO3 4PZJA 3C7FA 1BEV2 2QM3A 4ONUA 3ABLH 5GLUA 4BJ0A 5IJRA 5C3SA 2QKLB 4HZFA 3J7AO 1GWLA 3T0AA 4F92B 5FRMA 2ZZQA 4JAAA 1J0RA 2W39A 4C0BA 3JRFA 3VV1A 5HXVA 4BQ5A 3KVAA 1GUIA 3JTGA 2HWF2 2Q8EA 1OYIA 5DZGA 2M8GX 3LSPA 5FYHA 3TEWA 2H0BA 5GTIC 3POBA 3C1DA 1IS5A 3QOEA 3OS1A 1OKOA 3WNOA 1NH3A 1FTTA 4RQPA 2L9SA 4YLZA 2F4PA 5DCFA 4COWA 3ABTA 3F0CA 3DUIA 2ZBJA 3M3EA 5JOZA 1MKMA 3IRQA 5DYMA 3F8MA 2Y48A 2Y33A 3A2KA 1MQTB 5HCFA 3KE2A 5A7OA 5D1IA 4V2WA 4Y22A 1D0YA 3GFMA 2B0LA 2WNUB 3IAPA 1F31A 1R082 3LSKA 2VKVA 4C91A 1QEXA 4NRQA 4NHXA 2EZHA 1LEMA 1OURA 5FRAA 2KPMA 2BU9A 2C26A 4I6ZA 1EV13 4KMFA 5A32B 3BG6A 3R4SA 2KKOA 1AX1A 5FP8A 1UD1A 1T56A 2Q5TA 3OPZA 4S0HB 1D4M3 4AQSA 3LAPA 5CLSA 2VMEA 4XDPA 2OTJI 2JG8B 5F9TA 3RJ2X 4BE3A 2Y6JA 3WDTA 3ZFGA 1KU3A 4D9JA 4NHMA 2DK8A 5D8AC 4PFOA 1ZM1A 4ZTFA 3VDAA 3KV5A 3KT7A 2VJ5A 4AVPA 4A3CJ 2PBIA 3ZSEA 4HX7A 2WZR2 4UF0B 2K9MA 3IRRA 1B35B 1IXRC 3L2HA 4RSUA 1FOKA 3GO5A 2VPVA 2JA8J 4HKOA 2XJPA 5C4WA 1GNYA 1SLIA 2A3YA 2ZNZA 2ARCA 4COYA 3KP7A 5JLWA 1VBD1 4YVWA 1ZZ7A 2R92J 2XAJA 4E4DX 5IW0A 2A5ZA 2R7RA 3VDXA 5EYRA 2JJ7A 2DDBA 1ND2C 4UOJA 1CF7B 1W5TA 1VAKA 1FMD1 2WTEA 2XC7A 4WX9A 5EYYA 4XJUA 2WNVA 2I74A 5E20A 3IMMA 4XJ8A 3I53A 3ESWB 4N53A 1NY71 1WWXA 3V7SA 3MUY1 4XMIA 1HIXA 2SLIA 1WFXA 3QACA 2QTWB 5C5TA 2JXAA 3RG0A 2W25A 4ZJZA 4HPKA 4RHV3 4Z2YA 4GWJA 4PJYA 2YC0A 4M9XA 5F37A 2NP0A 3WTXC 4LKSA 1SLAA 3TW6A 2WY8Q 2A3WA 5A3MA 5F8PA 5CQGA 4W6YA 3EETA 1HXS3 3MIEA 5F0FA 2V1NA 3FXLA 2QWWA 2UU8A 1GYKA 4HOBA 4HV5A 4A0YA 4TLGA 3ZMUA 1OFNA 3NNGA 4MXVA 1ETXA 2ZX1A 4EE2A 1IUFA 2EV6A 2BV4A 3BYWA 5DCMB 1CQTA 1WHUA 4F3JA 3TNQA 4S05A 1ODDA 3WP5A 2ZAAA 2XGXA 2XHNA 4QX8A 1JYIA 2V73A 5JSOA 3S1RJ 1O6UA 1TEIA 2QQVA 1W0TA 1MH3A 3RPQA 2E9QA 4EJTA 1NK3P 3E1F1 3AL0C 1QOTA 4D6RA 1W9WA 5FZ1A 2VY0A 1YC61 4GRIA 2H94A 3C2HA 1UWWA 3POWA 1Q8SA 1QO0D 2A07F 4TTGA 4EJVA 3CCMI 3DCQA 5A3OA 3JAMK 3WGGA 3CDHA 3WQBA 3ACFA 3UETA 3LSGA 4L5EA 4BU2A 3RJPA 1YXWA 3NAPB 1UYPA 3ZYGA 4Y1ZA 2LBFA 3H8OA 3F23A 2CQNA 2WO1A 3EQLF 3JRCA 1C3HA 4I02A 1LOFC 2GXBA 1VRH3 1SBDA 3BJAA 4HVRA 4YELA 4HF1A 1H9PA 2DTRA 1X7NA 2R30A 3AFKA 5KK1A 2STTA 4ISRA 2C9AA 2I5UA 2NVXJ 3NW4A 4QDSA 5IT9Z 1ZGJA 1V6JA 1OA4A 3MZYA 4IV1B 4YGCA 5A6XA 1BC8C 3AMQA 5IOZA 3S0MA 3JRHA 4ESBA 5EG0B 5A33B 2YUEA 1H4HA 5LBCA 3GHMA 1H6YA 5CYYA 3K4JA 5FZBA 4AVVA 1IG0A 5IFPA 2QF7A 2XAFA 3VFZA 5I91A 5FKMA 2ZGNA 5JXHA 1P7JA 4MH0E 4Q48A 4WBBA 1UPIA 3DTKA 2X9DA 4I09A 1LHOA 2VOTA 4A12A 4N8MA 4KMUX 3FISA 4DXRA 3TKYA 2H1KA 1W6NB 3RIRA 4EGYA 1YO5C 1ZHFA 2XB0X 3QYEA 3PUBA 3VHOA 1YQ6A 2W4SA 3EUHA 3FHAA 3WW4A 1ND3C 2E1NA 4JX5A 2HYXA 3S5QA 4BACA 2WABA 2ETEA 3HAGA 4OINF 2E5NA 2JZYA 3M3CA 3D5LA 4QQPA 2M87A 2Z42A 3IM0A 2ZACA 3FBYA 2VULA 2A6ZA 4DJAA 2IFRA 3K10A 1T33A 2X09A 3KP3A 1EV7A 2DFFA 4LLNA 5IYYA 4M6YA 3OEAA 4HBNA 2JDUA 3SDBA 2R4GA 4L0YB 1YQ2A 2BE5F 1U2WA 2PFBA 1ZKGA 1K4SA 1PIV3 2LKSA 4UNOA 1T98A 3POIA 1HRV1 3T2TA 4Q4X3 1VP6A 2WC2A 2JDHA 3T4VA 3DKWA 5JHFA 2HWE2 2FBKA 1PK6B 5FP4A 4YG2F 3J81K 1HJGA 1JZ8A 2WO7A 4BH9A 1W2OA 3W6VA 1DYOA 5BPXA 3V65A 4EWEA 3FHIB 1X8MA 4HYEA 2VZPA 3CCSI 1R7JA 3L2CA 4RN5A 5A6QA 2XH6A 4M72A 3OS0A 4Q4V3 2WQ4A 2R5ZB 3OBRA 3AJYA 4KQ7A 3BTAA 1R093 3USUA 3CD6I 1Q8VA 1G3YA 3WU2C 1OLMA 3AKQA 5FZ0A 2XAHA 1SMVA 4A3GJ 4I0WB 2JUGA 3CCYA 3ZR8X 1IF1A 3QPLA 4CGZA 3CEWA 3HHHA 1Z7LA 1X1DA 3MZ8A 1BZWA 4B4RA 5BNOC 1RR8C 4JKLA 2DFHA 5FY8A 1SDWA 4PJ0C 4FPFA 2XSDC 1V6IA 5IK8A 2EBIA 5AC91 4YPJA 1ENHA 1XNKA 1I9RA 1REPC 4I3GA 1G7YA 5FZCA 2UXNA 1RVF2 1RZ4A 1RC9A 3B94A 4OIRF 1FEXA 3UGHA 4E7ZA 3VBRC 4Z92B 3CQZJ 4FQZA 3HPNA 4A69C 4O7XA 4HL0A 3UV9A 2NS7A 4ITVA 3VD7A 1U5TA 2R1BA 3BROA 4CU6A 4BDVB 4XAEA 2D44A 5CFCA 4FPLA 3POEA 2X6OA 4L8QA 3KP6A 4NVPA 5K0UA 1XGSA 3WTYC 2EALA 2JWPA 2RS13 2QKDA 3M3IA 3H3ZA 5T5JA 5DS9A 1FYMA 1Q3EA 5IPAA 1LJ7A 3E97A 2P2KA 1Q8QA 4CCOA 2ZXHA 4Q0UA 1BJAA 3NRVA 5FZ7A 3MZHA 3HOBA 4FBFA 1ZYBA 5DAQA 4XLPF 1IS6A 1UAIA 2H27A 4UXAA 3SYTA 2CYFA 2OUMA 5FZIA 1WCSA 2TUNA 2A6TA 4PDWC 3WQ1A 5CPRB 2OCEA 1ASJ2 2LRPA 3J26N 2VUMJ 1SBFA 1OQEA 1N78A 2E5ZA 4WZFA 4P55A 4B8XA 5TISC 1JOJA 2VE8A 1JYTA 3MBWA 4AEKA 5IATA 1ZBE1 4Q0SA 3JXSA 1C5IA 4XF1A 5EJ3A 1CJPA 2EXKA 2A71A 2AACA 4CEYB 2DTWA 3ECQA 4AC0A 2QQUA 3V8JA 4EJWA 1NCQA 2QQOA 1JOBA 2VOVA 1WLTA 2JRTA 5CA6A 2M4GA 5HS8A 1DGWX 3ZYFA 2HBUA 2P0WA 4BA6A 3DLAA 5LBFA 1C4RA 4AEDC 3FFZA 4QGNA 1PYVA 1GLHA 3CJIA 1RUI2 3ORJA 1RGSA 1YJWI 3AMMA 3MHZA 2DCEA 3QU6A 2LNBA 2CJJA 1PO22 5C9AB 3QYFA 3FHZA 1G4DA 4MGSA 3PMSA 2YMZA 1OVSA 1UY1A 5DDGA 1AXYA 1UAAA 1XTAA 5BNPB 2RMU2 1QMJA 3JW4A 3BCWA 2L7ZA 3WGIA 2A68F 4CUCA 2QBYA 5FPVA 4YW4A 3WE3A 1HW5A 1IN4A 2IS2A 4LE3A 3DXUA 3FKIJ 5EJZB 2PHUA 2VZRA 2YGLA 4XHBA 2IA0A 1VBE3 4RM2A 4XCBA 1JN2P 5CVRA 1IRXA 4DNCA 5CVVA 2A3XA 1TME1 3SZGA 1Z21A 1BW5A 4JC1A 2P17A 3S1QJ 1F5FA 3HJEA 1RHI1 3SMHA 2WAOA 5FJHA 1MW7A 4LB6B 1AR71 4PF5A 2Y6FA 3Q0UA 3HEIA 5GAGJ 2FHRA 3HSFA 1OMIA 4G12A 1R22A 5I0RA 1HW1A 4CDXB 1RI7A 2DA3A 1D1AA 4WK8F 3FM5A 4XUQA 5HCHA 3EUKL 1WW5A 2EA7A 2GC2A 2RQQA 2JWTA 4XIKA 2C9KA 2Y6HA 4P96A 4F55A 4UFMA 3BTIA 1DU3D 4S2GA 2ZKZA 3FUQA 1IQAA 4ASNA 4AIKA 2OT7A 2PX9A 3KWVA 4IL7A 5K7HA 5IYCJ 1V3FA 2ACJA 1NK2P 4DZPA 5A3LA 3OY8A 3LOIA 5L19A 1BOAA 1V55H 3FZ3A 2QSGX 1Z7S3 5B4NA 4YZ4A 1AKHA 2W46A 1RUF1 2KRCA 5C5UA 3TMOA 1LGNA 1YFXA 1B4AA 5ILSA 5D4SA 3OY9A 1BL0A 1UXZA 4BGDA 1LDDA 1YOVB 4JTOA 2DQLA 5JR3A 1UIKA 1DQ4A 3Q9VA 4Q5OA 1TZOA 4II2A 3POFA 3RZGA 4MZUA 3ZXLA 5KXEA 5FZMA 2LYCA 3PIGA 2VBZA 3W20A 3FBNB 5M5YJ 3A0NA 3THPA 1I3AA 2ZSIB 1QIQA 2FEZA 1L3JA 2LALA 4QXKA 5EYXA 4XKVA 4ZDPA 2IXSA 2CAVA 2Q1ZB 2MC3A 1RUD2 3M8FA 2Y0IA 5FLJA 1Y8QB 3U1DA 1RUJ1 2IT0A 2EIJH 4MQ9F 1WW7A 1WBFA 5KWRA 3BJ6A 3KYDB 3JTHA 5IVFA 4L9TA 3IAQA 2ZXJA 4ZXKA 2XJTA 5F3EA 1TE1B 2LH9A 4YNIA 1S0DA 2Y9ZA 3Q9SA 2FBHA 5JLXA 2X29A 3H7JA 1QHDA 1RKWA 4I01A 1V70A 4M9ZA 3NO8A 5CYVA 3P9CA 4WM7C 3OEBA 2B4KA 1M4WA 4NAOA 1SCSA 1O3SA 3B5LB 5DG1A 3N9OA 1UHMA 3MV01 4YM0A 5C71A 3WNLA 5KHKA 2O1QA 1AU7A 4BQWA 4XFHA 2A7AA 4FPYA 5IVBA 1KDKA 2Y60A 5FQ0A 3M3QA 4COUA 3WP3A 4G8XA 3IKTA 4CZZA 3HWJA 1EJ9A 3O1TA 1OJLA 1G59A 1AOYA 3EJKA 2A70A 4NOTA 2WR9A 4ZU5A 1JHNA 1AR93 2L54A 2ZGMA 2IUWA 1J84A 4LA3A 5CKMA 5GLZA 3WOGA 3HRMA 3NARA 4Y13A 4MLOA 4RGUA 1I3QJ 3K46A 3DWLE 4LBMA 1WMFA 4XKBA 2UYAA 3O6BB 2ISZA 1RUE3 1D8KA 2ZHMA 5HI0A 5E1RA 1UW8A 1F9KA 4BK5A 4NAMA 1POV3 5EHDA 4JHTA 3SQOA 1DZRA 2ZB9A 2JK3A 1DGWY 4A7ZA 1KGYA 4ZS3A 1CPMA 3PFYA 2BFUL 5EPAA 1BBT3 2W08A 5FO7B 1DZTA 2A3SA 4IE4A 1B8IB 4ZU7A 4PIXA 1ETVA 4NHYA