3I54A

Crystal structure of mtbcrp in complex with camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
224
Chain Sequence
LYFQSHMDEILARAGIFQGVEPSAIAAQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
total genus 66
structure length 224
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i54A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i54A01
4PGGA 3R6SA 3GX4X 4D7SA 1YW8A 4L5IA 3BU7A 2EFPA 1RTVA 4UV8A 1P6RA 5J6XA 2XUBA 2QDRA 2GXGA 1TW2A 4OMYA 2XL7A 3D0JA 1D8KA 1K7AA 5D1IA 1XSVA 1XE8A 2DK8A 3N4MA 2K4BA 4ZZLA 3ES4A 2L4AA 2FBHA 1R5HA 4MNUA 2MH2A 5HS7A 3GZ6A 2O03A 1FOKA 3HOSA 3CUQB 2D93A 3DN7A 1OYIA 3ZMUA 1ZVFA 2MH9A 3K1NA 1R22A 4OFGA 1YFUA 2RQPA 3HRSA 2KJBA 2F5EA 2FXAA 2JSCA 3FFQA 3WW2A 2V9VA 2HDCA 1W4MA 2DAOA 4BH9A 1W7PD 1IN7A 3U10A 4TLFA 2WC2A 2ZKZA 3I59B 2QVOA 3F22A 4MQ9F 1DUXC 2ET1A 3PLQA 2IA0A 4META 1VP6A 1KU9A 4L5JA 2Z69A 3GUDA 2IXHA 4XSXF 1F1ZA 4JTOA 4N0BA 4O3MA 4Y15A 1QQIA 4LK1F 5CVIA 1F4KA 4MGKE 4WF2A 4S04A 1ZYRF 4LA2A 1P2FA 4DQ2A 4K8FA 2YSRA 3VB2A 3SCHA 2O0YA 1FYKA 1CAUB 2PG4A 4L2NA 3ACLA 4HF2A 3CLPA 4LJZF 3S0MA 3M7GA 4LLOA 4KMUX 2RDPA 1O7LA 3K1MA 2O61A 4UBHA 4IRHA 2TDXA 3KP4A 4IF4A 5J7MA 1X82A 5D8KB 3JTGA 2EV0A 3ECHA 4HDVA 4AXOA 3H3UA 4OMZA 1CAVA 3J80Z 4IESA 3SHFA 2ZO4A 4U88A 1MKMA 1LR5A 2H94A 3ROUA 2D1HA 4EVIA 1IAWA 3IHUA 5K8SA 5BY5A 1D5VA 4HLYA 1KQ8A 2PQ8A 1C0WA 4AWXB 4ONUA 5BOXA 3E5XA 4RGXA 1ZX5A 2OPKA 2OA2A 1XMKA 2CYYA 3EDPA 3V8LA 2V79A 5LRSA 2CAUA 4A0XA 4XEZA 5HS8A 3F8NA 3I58A 1WA4A 4I98B 3H7YA 1J59A 2JTVA 4KL1A 4GYGA 3NKTA 5LBQA 5K5OA 4F7ZA 1Y3TA 3BJAA 5HLGA 4Q0PA 1B59A 2R7FA 2R3SA 3ABUA 4HF0A 2L4MA 3ZQ7A 5CVRA 3LAGA 1HSTA 2A68F 1HW1A 2P5LC 2X0LA 1RGSA 2YU3A 1FYLA 2B5HA 4HQEA 1ON2A 3HT2A 2VBWA 5L3GA 4BAYA 4HW0A 2PEXA 5E8IA 3BDDA 4LB6B 3ZMDA 3CF6E 2NRAC 1EH6A 5D4SA 5I0RA 3UKTA 1TNTA 2IA1A 3R0AA 1SAXA 3LWFA 1BI1A 3CL1A 4MTEA 2XAJA 3CJXA 3SXYA 3ULQB 1FZPB 2K9ZA 1SFXA 1P4XA 2BNMA 3KZYA 4MEXF 4WWCA 1G3TA 1YWKA 3WTVC 3QU6A 2BV6A 1J2XA 4J1XA 3ELKA 2Q1ZB 2GWRA 4QGMA 4I0BA 2ACJA 5FPZA 5ERIA 2IVMA 2DW4A 2GC1A 4L11A 1DPRA 3H3ZA 2KIMA 3WG9A 4R8HA 3IWFA 1HQCA 5KK1A 1TQPA 4MUVA 5K1YA 4HN1A 1TW3A 1R1UA 4EGZA 2DPDA 3PVBB 4IRIA 3KP5A 1GXQA 1F9NA 5H20A 2EA2A 2EV6A 1KYZA 1OPCA 2IXLA 1ZZCA 4I7HA 2QUFA 4A5NA 4IEVA 3USSA 2HS5A 1LRHA 5FLXZ 2CGPA 5BPIA 2CQKA 1TTYA 1P4WA 4HLTA 2F5DA 1WLTA 5ICGA 1FBQA 4MZUA 4U0WA 3IC7A 2CW0F 2J5OA 4XF1A 1GXPA 5EEHA 5IT9K 5BV6A 4ZYGA 1I6XA 3WGGA 3BALA 2P5VA 1U12A 4FAHA 1S8NA 3MYXA 5DD8A 3F23A 2DTRA 3VHRA 2QQAA 2EFWA 1Z1DA 3KCCA 2W25A 2OYZA 5I93A 1T6SA 4XBFA 4L9VA 4GGGA 2Z2SB 5E17F 3I7DA 3IIAA 2YX7A 3BJOA 4JTNA 3GWZA 2J5PA 1FX7A 1U5TB 2HOEA 2GC3A 3GFJA 5ED4A 1HW5A 2LKPA 4MGRA 3E6CC 2DO7A 4TV7A 1LJ9A 2B8MA 4IHTA 4O9GA 4XRFA 4XSZF 1FBUA 3ELNA 1ZZ8A 5FD5A 4XF9A 3CO2A 2D5HA 4IEYA 3WGHA 3M9AA 3FMQA 3IWZA 1FPQA 4LK0F 3WU0A 4EM1A 3J7AO 3FM3A 2XKPA 2PI0A 1VR3A 3IKTA 2VBYA 3BPVA 1OYWA 4U7DA 4XFHA 4WXHA 2HEOA 5JSRA 2B9UA 3WTYC 2STTA 1O3TA 4KU8A 2GQQA 1SFUA 1XGMA 2KXLA 1FLIA 2K02A 3P9KA 3WW3A 5BQTA 1Y0UA 2I45A 2ELHA 2MPFA 3CUQA 1J3PA 1YTYA 1EH8A 4EV0A 3WGIA 4OIQF 1NYWA 2EVXA 5FFXA 4LUKA 3U11A 4LLNA 4OIRF 4UBGA 3ST7A 4UHTA 3KFWX 1PP7U 1CF7A 1LQ1A 5EEGA 3SCFA 3KZZA 2JT1A 2DLLA 5CVVA 2HYGD 4ZU5A 4IHSA 2M8EA 4Q29A 2QQBA 5E16A 5I8TA 4BYYA 1YHFA 5KBFA 4Q0VA 1RI7A 1O3RA 1BC8C 1UCXA 1T38A 1Z6TA 4P9UA 2GU9A 3E5QA 4AVBA 4LLLA 4OU0A 1J1LA 5FLHA 4YFKF 2M30A 1QO0D 5E1ZB 4WCGA 5BUVA 2YR2A 2H27A 3R0JA 3GFLA 1T98A 4UUVA 2OZJA 4HX8A 3WW4A 1FC3A 4YYOA 1Y9QA 3KMHA 4YARA 3NJZA 4OIOF 1MZBA 2PFBA 4LGWA 5ILSA 4E2QA 3GXOA 4BHPA 5IT3A 2VBZA 1QZZA 3EBRA 2HKOA 3VOEA 4XFIA 1CAVB 1NXMA 1OR7A 4YSFA 2P6TA 1YLLA 5FQ0B 1BI0A 1RUOA 2M5WA 4JV4A 2ISZA 2CWEA 1QGPA 3FHZA 3EJKA 1XDSA 4CYDA 1FT9A 2ESNA 3UKNA 4WX9A 2RVCA 3FHIB 5D6FA 3V7SA 2DU9A 1VTNC 4ZU4A 1PM7A 3ES1A 3QOPA 2FQ3A 3RDIA 4P5OA 2EA7A 3D0SA 1I1SA 2PAMA 4HOBA 3OD0A 4LA3A 5BPXA 4X6RB 4IETA 4GXOA 2F5FA 4YNIA 3BB6A 1BOAA 2XROA 1KA8A 1WSUA 3WTXC 2QJVA 3I5UA 1K78B 4MTDA 2A07F 2WFPA 2XAQA 3U0ZA 2XLAA 4HZFA 3RZZA 2ZXJA 4L9TA 4S05A 5KHKA 1OI6A 2A5YB 1FWZA 5I0SA 3O3KA 2C0ZA 2ISYA 1L0OC 2EFNA 4YIFA 3FMSA 5LHIA 3QAHA 5C6CA 2Q0AA 3G73A 4CICA 2WWYA 3GLXA 3P9CA 1EY2A 3G3ZA 3OGJA 3HTSB 2W24A 1RL3A 3SQNA 2BYVE 3E97A 3KP7A 3I53A 4G94A 4AVCA 1ZG5A 4ZYEA 3C1DA 4FHTA 1XGNA 2KIFA 4YRDA 2NYXA 2PN6A 2IC1A 4MGYE 1FXZA 3VEPA 1XCVA 1ZAOA 2EV5A 3I71A 3R61A 2IJLA 3GEZA 1QNTA 4D7TA 2FBKA 4U0YA 1KU3A 3RI4A 1ONVA 1JGSA 2IRFG 4NQWA 4GO1A 5D5WB 4XF3A 2L3DA 1ZARA 4ORFA 4KN7X 2XAFA 3QP6A 5D4RA 3FE5A 2K7LA 4RB2C 1ZGAA 4R79A 1ZZ6A 3WODF 4QGLA 3QPTA 2DI3A 2F4PA 1PP8F 1GQGA 2HQRA 2V6CA 4GCVA 1YFWA 4DINB 2HFHA 3IBMA 1RUNA 4IEZA 2H6BA 2E7WA 3MZHA 1ZN2A 5CADA 4UXAA 2IT0A 2ETEA 4ENKA 2EK5A 3LQRA 1KU2A 3OCPA 3TDZC 3I54A 2VC0A 4WXDA 2ZMEA 2R7DA 2P4WA 4EJUA 2PAEA 5J8CA 3JAMZ 3H9AA 1QXRA 4LLGF 5J8FA 1YW9A 2Q2EA 4M72A 3K0LA 4NB5A 1X8MA 4RAYA 3HOTA 1LEBA 1Z6RA 1J58A 5E20A 4LEJA 3BP8A 4EJVA 4FBFA 2ZNYA 5D8LB 1EH7A 4G7ZF 3DF8A 4O6JA 2HKXA 3J81K 4EWAA 4O9EA 3C18A 2PLYA 1E2XA 1V4RA 3TNQA 3PNAA 2ZMEB 3WE2A 3HRMA 1Z7UA 1DGWA 4HDUA 1QPMA 3KSCA 3REOA 1KGSA 4XFGA 3TO6A 3EYYA 5F6FA 4BHBA 4RB1A 2C6YA 4EWEA 1NE4A 1QBJA 3QRFF 3Q9VA 2GA1A 1QXJA 4PIXA 1CX4A 5FPXA 1S7AA 4I0AA 3F3XA 1HKTA 3I64A 3RYRA 3WTUC 1BN5A 4KUMA 5DCMA 3KP3A 4BIFA 1CAWA 4ESBA 2P8TA 4MEYF 1R23A 1IZ1A 2Z9OA 1MGTA 4RB0A 4JQFA 4OINF 1GQHA 3M8EA 4PIZA 2PHLA 5AIPA 3WU1B 4Y13A 3L2HA 5EFUA 3M1EA 3HHHA 4EJOA 3ABTA 3LFKA 1SFNA 1PUEE 1J3RA 2O8QA 4QM8A 3CO6C 4ON0A 1ZRFA 5AVPA 2KJCA 5FLJA 4AQ6A 5HLIA 4BNCA 2WV0A 4ENJA 4LULA 3QP5A 1O5UA 2A61A 4K2EA 4KN4X 2QLZA 1MDMB 3L7WA 3WTSC 1G3SA 3IL2A 1WGPA 3SCGA 1U78A 1WWXA 5D5UB 3GF2A 3QACA 5DEQA 4B09A 2PA7A 2VECA 4LMYA 5KHJA 1YFHA 4XLPF 1WKMA 2QBYB 2VXZA 2XAHA 2GC0A 2VN2A 2XGXA 2MHFA 4IXAA 4AIKA 3KE2A 4YFNF 2RNJA 1K78A 4AIHA 4RAZA 4N9IA 1H1IA 4QGNA 3RYKA 1HSJA 2XIGA 3RPQA 1L3LA 2V1DA 5FD6A 1UIKA 5FFZA 1OD5A 4UXNA 1Q3EA 3BZ6A 2HJIA 2UZKA 1RNLA 3GBFA 2FQPA 3ZPLA 4M9ZA 1PDNC 4L0YB 3DQVC 2XKOA 2VODA 3CLOA 4WXCA 2E1NA 1YG2A 2STWA 5H6RA 2FRHA 1EV7A 2P6SA 2BNNA 3E3VA 4DNCA 4KDPA 1BI3A 5CJ9A 5E1XA 4HF1A 4UVBA 2XV4S 1CAWB 2MBFA 3CO7C 2VT2A 3EQEA 2RGVA 4XFBA 4OOIA 2UYAA 2A69F 5I0UA 4EJTA 1SFEA 3MDPA 2F2EA 4HMZA 5TJJA 3SZPA 4A2UA 2HGCA 3OTFA 4G9YA 5JI6A 1NZCA 1O3QA 4XFCA 1YS7A 3E6MA 3W6JB 1W7PA 1IXRC 4ETSA 3HRTA 3EHKA 4G6QA 4FAGA 3GFIA 2CG4A 3HTUA 4L9JA 4PDKA 5CU1A 3KP2A 5I0TA 3KP6A 3WTZA 1CAXA 2XRNA 2OZ6A 1R7JA 4YIIA 1FSEA 2Y75A 3LAPA 5DDGA 2WTEA 2H09A 1MD0A 4P96A 2MA3A 5JHUA 4KWJA 1IW7F 5FLXK 1GVJA 5DUKA 2FE3A 4JBAA 3RJPA 1J9IA 2QQ9A 4RS8A 3FMRA 3SXWA 3I4PA 2RV8A 4O5VA 3T8RA 3RKWA 3QU3A 3SFZA 1KYWA 3BY6A 2ZJ2A 5LLQA 2EB7A 1BJAA 5JR7B 3L09A 4HX7A 5HDGA 4AVAA 2PAKA 5CYVA 2ZFWA 4FX0A 2KIUA 3MEXA 2IXCA 1BC7C 1B1BA 1UHWA 5DYMA 5K5RA 3ZMVA 1R00A 5L3FA 3FXRA 3FWEA 3H1WA 4IERA 1Q1HA 1H9TA 1Q5OA 2XHKA 2VQAA 3E6DA 4HSLA 2ETHA 1R58A 2LSOA 1UCRA 3COAC 2GZWA 3NL1A 1S3JA 2K86A 1OKRA 2QM3A 1ZZBA 1IUYA 3ZN0A 4WVZA 4IEUA 1UD1A 1YFYA 3M3IA 2HR3A 1O3SA 4G7OF 3FXQA 3C7JA 4N9HA 2OA4A 3FJSA 4IEQA 1JE8A 4D0PA 3L2CA 2P7CB 1SMYF 4Y17A 4KIFA 2UY8A 4BHCA 3HQXA 3F8CA 2NAZA 1J75A 3HT1A 2OQGA 4XETA 3T0YA 1JHHA 3DEUA 1G6NA 2PMUA 3K1PA 1SMTA 4GYIA 4IRGA 4IEPA 2V09A 4HBLA 3MWMA 3FZ3A 1ZNPA 2GXBA 4M73A 3JZVA 3NVCA 1USSA 4A5MA 2UXNA 4J1WA 2DQRA 4CHUA 3GZ5A 1XRUA 3FZVA 2PTMA 4M71A 3SZTA 2P5KA 4IPAA 1YUDA 3CUOA 5HDNA 3F8BA 5BXXA 4HV6A 2MC3A 2Y0OA 4HAMA 3V4GA 4QX5A 1J7KA 4ESFA 1L3JA 3MPBA 2PQQA 1XGOA 2DCTA 4Q48A 3CEWA 5FLIA 5ICCA 2D40A 5DD4A 1LB2A 4PIYA 3GVAA 3OOPA 3KGZA 5L3BA 5LHHA 1UPIA 2ZCWA 5K5QA 3IRRA 1B6AA 1I5ZA 4Q47A 2PYTA 2V1UA 3S7EA 4RB3C 1TLHB 5CVJA 4U7BA 4ZU7A 1IN8A 1YO5C 1H9GA 3WTTC 1OYYA 5HDKA 1CAXB 2Q30A 1T2KA 3TOAA 1EPZA 2PJPA 1FNNA 3G7DA 5HVQC 1XGSA 2A6HF 2H6CA 3T8TA 2IPQX 3TGNA 3D5LA 4CZZA 4A6EA 2FSWA 4MH0E 1YS6A 3U2RA 4M6YA 1A04A 2PMHA 5E18F 2P7VB 1PMIA 2XAGA 5LGTA 2PFWA 3LSTA 4XFAA 2EFQA 3ZN1A 4HLXA 3LWCA 4HYEA 1IPJA 4MQVA 1IXCA 1J3QA 3KLOA 4HN0A 1VJ2A 1JUHA 1ZZ9A 3S2WA 1AOYA 1ZG3A 4M6XA 1TQ5A 2RC4A 4JK1X 3S7IA 3ZMSA 3RPUA 3LA2A 4MHGA 3EETA 3N97A 1X8EA 3ZP5A 2A6EF 4Q0SA 2O6GE 1BM9A 2D5FA 3V7RA 3F6VA 4G8XA 1XSXA 2QCSB 3F8MA 3JTHA 2FA5A 2VE8A 4HQMA 3TO9A 4ZZDA 5HI0A 2VC1A 3JSPA 3JAMK 2HQNA 3DPTA 4UVAA 4I01A 4KA4A 3ZDSA 3H7JA 3PQKA 1AWCA 3P7NA 1YQAA 4AVPA 2LF8A 3FXUA 4CGZA 2COMA 2EAAA 2XLFA 3IKVA 1LDDA 4EQQA 2W84A 3CJNA 1X7NA 3H50A 2ADUA 2MNGA 2OD5A 5JSOA 2UWMA 2M87A 3RTRA 3O6BB 1XMAA 1P92A 1U6GA 4LTAA 3E6BA 2QYOA 1YLFA 1LVAA 5JCTA 2PBIA 3GYHX 4CO8A 1IN4A 4EROA 2E1CA 1TQIA 1IN6A 1XCBA 1SEFA 2Y48A 3BCWA 2Q4SA 1ZRCA 1YFXA 4WK8F 2LF7A 3L9FA 4HX4A 2QVSB 5ICEA 2FMLA 3ZMZA 5FGMA 3TO7A 2AXLA 1DP7P 2ZBKA 1WRJA 4X6QB 2VOPA 3EO6A 4MX3A 4QWQA 1ODDA 2RN7A 5HOOA 1DGRA 5FB2A 1TQMA 1IRGA 4I3PA 2IA2A 2O8XA 2MLKA 4E2GA 3V8KA 5I91A 1FI2A 3K69A 4PGHA 3F6OA 3KEOA 3M8FA 2LNBA 1W5SA 4P9FA 1KU7A 3NRVA 1XN7A 1IXSB 5JAXA 1Q43A 1B4AA 3H92A 1K79A 1NHAA 2CFXA 1BBYA 3O14A 1UFMA 1TBXA 3H1YA 1XB4A 2VE9A 3SHRA 2V1XA 4ZYHA 5T3NA 1V3FA 4GULA 3VODA 2EWNA 4MGZE 2DK5A 2G9WA 4ZYDA 5JVTA 2O3FA 1J5YA 2JPBA 4KWLA 2DBBA 1FP2A 1LDJA 5DCFA 1Z91A 2L02A 3EUHA 1XE7A 1H1MA 4HVRA 5LGNA 2K27A 2D45A 1DPUA 3WW1A 4BXUA 5F64A 1R5GA 2MLGA 1FBSA 3KLNA 5ILUA 2DT5A 3M70A 1SD7A 3GO5A 2VONA 4UNOA 3ECOA 2XL9A 4Q0QA 1BIBA 5I8YA 2XVCA 2BEOA 2D2WA 2JPCA 5C8WA 4NVPA 4PJYA 5I8SA 2G7UA 4B29A 5E1WA 4HBNA 3QPHA 4ZH4F 3CUQC 3U9GA 1OMIA 2N7GA 4HA8A 1XDUA 3HSFA 1ZLJA 2EA4A 2OQRA 1UW8A 4LUMA 2DFIA 2OU2A 1G4DA 2XASA 4KFCA 6PAXA 2XLGA 1ZH5A 1KQ9A 3BOQA 3RYPA 1HXDA 5JSPA 2YX4A 1ZRDA 4LD5A 1MDMA 5FCCA 5FO5A 2QZ8A 2Z5UA 3PFIA 3HUGA 5L3CA 4Z2YA 1STZA 5DCMB 4M74A 4Q5SF 1OFNA 3LQQA 3V7CA 5L3DA 1ZREA 4FT8A 2FNAA 4RD7A 3E5UA 1X3UA 2VPVA 4G7HF 2OZUA 2VT3A 4P55A 4A6DA 3R4KA 5KVRA 3W6KB 2HTJA 2HZTA 2FOKA 3IRQA 3ML6A 2ZKLA 3LA3A 4A0YA 5ICFA 1HKQA 3SMHA 4QXKA 5JR3A 2UXXA 1U2WA 3Q5FA 1J0RA 2ZNZA 4KICA 4EJWA 3GW2A 4QLCU 3U1DA 4KYWA 4IEXA 5KHIA 5BMZA 1S6LA 2BE5F 3RNSA 2DQLA 1SQ4A 4KNYA 3NQOA 2Z99A 4P9GA 2K4JA 2VOOA 2KKOA 1ZGJA 3CTAA 3OF1A 3FF5A 1IF1A 2BNOA 2QBYA 1ZLKA 5A2QZ 3V8JA 3H1MA 4OLLA 3NEUA 3HHGA 2H0VA 2AS5F 2B0LA 5FDBA 1O57A 1DZRA 4NHJA 2W57A 4AIJA 3L00A 5D5VB 1G3WA 3DFGA 3GFMA 5H6QA 3NW4A 5KHGA 2UY9A 1TNSA 1UHMA 2HYFA 2Y0MA 2W85A 4KIGA 1U3EM 5LRRA 4HVQA 3R60A 2F5CA 1W7PB 2IW5A 4E70A 2IXJA 2EFOA 4WBBA 3TDUC 1QY4A 4Z07A 1WQ2A 4M9SA 5HS9A 3J81Z 4EM2A 2NNNA 3WTWC 2LDUA 1ON1A 5E1RA 4Q0UA 2D1VA 2CV6A 1FP1D 4JVAA 3KETA 4IEOA 5KHHA 1JXSA 4L0ZB 1NE6A 3RKYA 3MZYA 1U5TA 1D3YA 2Z33A 3FM5A 1S29A 2YPRA 2ESHA 1ZZ7A 4XFFA 2L54A 3DL3A 4QMAA 4FX4A 2BBYA 3LOIA 2IP2A 3J80K 4AQ2A 2JZYA 1XD7A 3I59A 3F21A 1FYMA 2GIVA 1SD6A 2G7HA 5J3UA 1R1VA 3C3VA 3BROA 1DZTA 5AIQA 3K2ZA 3DV8A 4EGYA 1MJ9A 3MAJA 5JFRA 2OAZA 3NSTA 1H0MA 2VBXA 1EP0A 1R1TA 3Q9SA 4XF4A 1UIJA 3T5XA 3HYIA 1YIOA 1O7FA 4CXFA 1B9NA 2FU4A 2QENA 2FF4A 1W5TA 1O4TA 3JSOA 4RGUA 1LKNA 2E9QA 4CDGA 2IXKA 1DDNA 5L3EA 1RIOH 3MQ0A 5D5XB 4UV9A 2M45A 2P17A 1FY7A 1P4AA 1I1GA 5FQ0A 1ULYA 1YW7A 4I02A 4A12A 3OV8A 4ESJA 2QNKA 1USTA 3MFKA 4YG2F 3HIFA 4G6DA 4WZCA 1LDKB 5DV5A 1MJAA 4KT5C 2FMYA 2ET7A 3PQJA 4EWDA 4I2OA 1XSDA 5IT9Z 3VFZA 5BPDA 5CVUA 4IEWA 4LG0A 2Z3YA 3BPZA 4H0EA 1E17A 3MCZA 3C3WA 1ZHFA 4ASNA 5A2QK 1G3YA 4ENNA 3LZZA 2M1BA 1O5LA 4MGIE 1IPKA 4YFXF 3B02A 2PHDA 1U5TC 3IDCB 3O2PE 3RKXA 3I0TA 2CAVA 3GYDA 1ZRRA 2CO5A 3JW4A 4M9XA 2HWVA 3T1BA 5BS6A 4L9NA 2QWWA 1U8RA 1Z05A 4ENMA 4AD9A 4LFUA 3HRUA 5J48A 4MV2A 3DP7A 2GC2A 1CAUA 1CF7B 4Z82A 4RGSA 4R52A 5ILVA 5DUIA 1QZYA 3P9IA 1IN5A 4I09A 3LAJA 3BJ6A 2EJRA 2GAUA 3ERED 2UYBA 3EYIA 1LNWA 1UB9A 2E7XA 3BWGA 1S7OA 1RZ4A 3IDBB 3ISPA 4Q4ZF 4HV5A 1CGPA 5TRDA 1R36A 1IRFA 2FBIA 1T0FA 3EQLF 4HVOA 1YYVA 1D8JA 4A0ZA 1WI9A 4IVNA 3B73A 1RC6A 2KRFA 3HSRA 2IXIA 4LG0B 1SD5A 4PCQA 4IJAA 4B8XA 4R1HA 1V70A 3TNPB 2CSOA 3HSEA 4PZJA 3F8FA 2X4HA 3DXJF 3CDHA 4U0VA 4KMFA 5LHGA 3UKVA 1ZG1A 3AAFA 1GHCA 4KIBA 4LB5A 3K9TA 4KU7A 1B9MA 3DKWA 1F5TA 2K0GA 1Z9CA 5AONA 2O1QA 2A3SA 1LEAA 2BGCA 1HKSA 2Q8KA 1K6OA 1MJBA 1EYBA 4EMSA 2NNYA 2L01A 2ATFA 4OIPF 4BQAA 3D82A 1QWRA 4KWKA 3ZMTA 1BI2A 5HLHA 1HBXG 1HW2A 5LEKA 2HTSA 1REPC 3WE3A 1SD4A 2OBPA 5E8GA 3KGLA 3KEQA 3F72A 5D6EA 5EZWA 2NS0A 3TKYA 4EM0B 2Q0OA 4L18B 1FSHA 5LGUA 4RGRA 1JHFA 3ETQA 4F8AA 3DPLC 4XF0A 2GH2A 2DPUA 1I27A 1T39A 3FX3A 4E2SA 5F1RA 4QM9A 3TQNA 3RIRA 4UVCA 3LA7A 2GA2A 2RKHA 5LEJA 1BIAA 2FNPA 3BPXA 3TOBA 1KQ0A 2JRTA 2FEZA 4XLNF 4HSJA 2MD5A 3H8UA 5CLSA 4H7LA
chains in the Genus database with same CATH superfamily
3JB4C 4D7SA 3BC8A 3AZZA 1DHKB 3BU7A 3OGSA 5HXMA 2JK3A 2VZRA 3POJA 1MEC3 3H1CA 2XUBA 2QDRA 2UURA 1IGNA 2XL7A 3D0JA 1D8KA 2K4BA 1E57A 3ES4A 2A5ZA 5T54A 4MNUA 3FBYA 5F6LB 1FOKA 4BL0B 4Q26A 1UOJA 4FISA 2A6VA 3LFMA 4RM3A 2MH9A 1PO22 2WV1A 1R22A 1D0XA 4OFGA 3JD73 1YFUA 2RM22 2F5EA 1NH3A 2JSCA 4Q4V2 5HNHA 4MFDA 2EIMH 4FPFA 2HDCA 1W4MA 3SKJE 4BH9A 1IN7A 3W2AA 3PTYA 4TLFA 2OXBA 2QQJA 3HMYA 4CP1A 4JKLA 4F92B 1KU9A 3GUDA 5IPAA 2WZPP 4XSXF 1AR82 3Q0WA 4JTOA 4O3MA 2IGOA 1OKQA 4LK1F 1WJAA 2E7QA 1OVPA 2YGMA 1ZYRF 2KFDA 2BDRA 1P2FA 1WD4A 4DQ2A 2NZ9A 5CIRA 4K8FA 4AYUA 2YSRA 4CZSA 1FYKA 2XPVA 1DYPA 1SACA 2XRLA 2C9AA 1WZ2A 3ACLA 4HF2A 1K6YA 4LJZF 4BQYA 3S0MA 4ZZ5A 2R1BA 3RZHA 3CZ6A 2PMWB 4LT5A 1A36A 3K1MA 2O61A 4UBHA 3LL7A 2Y0SN 2XF7A 3DPUA 5T5OA 1X82A 2WA0A 1W1WE 4AXOA 2EV0A 3ECHA 2ZJQF 2DA2A 2UUZA 3NAUA 2VUCA 1SDWA 1WJFA 2W9XA 1PZ7A 3SHFA 2KL4A 1LR5A 2XONA 3ROUA 1YXWA 4BLIA 1OH3A 4HT1T 3DPRA 3HL2A 3HB9A 3IHUA 3MHZA 1BXHA 4NRQA 1D5VA 3CHXA 2PXJA 2MEV2 1VBA3 4QB1A 3EUHC 4XZPA 2HNHA 1ZX5A 1N3OA 3BT9A 3DEWA 3LOCA 4S2DA 1SDDB 2X8KA 5FKMA 3EDPA 1V6OA 4RAFA 4XR6A 4BE1A 2E5NA 3BLYA 4LBLA 3T08A 4A0XA 1AXYA 4QPIB 1Y56A 2Y31A 1OURA 3OGRA 4S0HB 3H7YA 1J59A 1YI9A 2ELJA 1XBFA 5LBQA 5K5OA 2BVLA 3ZYIB 1M1EB 2R7FA 5A1FA 1NLQA 1ACIA 4M4RA 1WLWA 3LAGA 2WT2A 1HSTA 4Z2AA 3BG9A 5LA1A 1ON2A 5JZGB 2BVMA 3ZFGA 3W20A 1UY1A 4Q4X3 3BDDA 1EH6A 5D4SA 5I0RA 5CFCA 2YMZA 4QX3A 2XAJA 3CJXA 2EXJA 2EIEA 3ULQB 2K9ZA 5DN2A 3HC7A 1TWFJ 3MKLA 2BNMA 3KZYA 4RQPA 3QU6A 3VD4A 1J2XA 4UI9L 4LG3A 3G4SI 2OS2A 1UY0A 1UOFA 4Y24A 4AHWA 1VBE2 3BZCA 3O1VA 4AM3A 4MUVA 1TQPA 2XJTA 4ZTFA 4MHUA 1R1UA 1W05A 3ETPA 2DPDA 4XORA 2Y6HA 5EYYA 4IRIA 1V00A 1F9NA 4BB3A 5BNPC 2NS7A 1OPCA 3PIJA 2VZ3A 2QUFA 4A5NA 4IEVA 3USSA 1LRHA 2NP0A 1JH5A 3CBNA 4HLTA 3TBDA 1IHMA 4U0WA 2ZGPA 5CAZA 2W0XA 5LD2C 4YVWB 3JRIA 1SPPB 3BALA 1ERDA 2J1AA 3MYXA 2HVRA 1FPN3 2R7WA 3VHRA 5FZIA 3QH6A 3KCCA 2OYZA 1T6SA 2I2SA 4GGGA 5E17F 3IIAA 3GWZA 3JQXA 1RRJA 4TYSA 4C3IJ 3ZRGA 3KLSA 4GJZA 4TV7A 2ZHNA 4WVMA 1QIQA 4CU8A 5CA6A 2B8MA 4IHTA 4XZUG 4OAZA 2BOJA 5T5PA 3AC0A 3ELNA 4FPYA 5FD5A 5GLWA 4BK5A 2D5HA 1AYN1 3WGHA 1BW6A 2JXAA 3FMQA 3IWZA 2D3PA 4CCOA 3KCXA 1FPQA 4RN5A 3WNMA 1FNYA 1MMDA 4NIHA 2XKPA 3DYPA 2VBYA 4XCBA 3BPVA 3THPA 3I3LA 3O1PA 1UG0A 4U7DA 1I50J 4WXHA 2WNUB 2STTA 1O3TA 1B35A 3NJYA 2GQQA 4XNFA 4XLCA 1GZWB 1Y39A 1XGMA 2ZSIB 4ZC3A 2KXLA 5EJZB 1RMU3 5KAFC 5JHFA 3WW3A 5BQTA 1UMHA 3ZPOA 5LBBA 1QA6A 1XSRA 1YTYA 5GTHC 4EV0A 3G6JB 3BG7A 2FJ1A 4XKBA 5JUVA 2GSYA 5FFXA 4LUKA 3B94A 4LLNA 3WG3A 5DQ0A 4RYDA 4UBGA 4UHTA 2ZXQA 4LOCA 3BR3A 3KYDB 2WADA 2JJ6A 2JT1A 4A41A 5CVVA 2HYGD 4RR3C 4UW5A 1Z3YA 4AVVA 2M8EA 3NAPC 3POBA 3VBHC 2QQBA 1W5CC 4LIUA 1RI7A 5DAQA 4RGGA 4LE4A 5LW9A 4G6TB 4PHZA 4QD2A 1HRV2 1BC8C 1J1LA 4YFKF 2M30A 4LHLA 3OR2C 1PYVA 2EALA 1DP3A 1BJZA 4L92A 2QUOA 1T98A 1PX3A 1AR71 4HX8A 1S2BA 4BE2A 3RJRA 4E7IA 4BBRJ 4CYCB 3CZJA 1XU2A 1FC3A 3RMYA 2ECBA 1ZBE3 3S8PA 4AHYA 3QLQA 4E2QA 4BHPA 1OFSA 3ZXKA 4JX4A 4PFOA 3CP8A 3U21A 1NXMA 1S0JA 5A1AA 2P6TA 3PL8A 1QEXA 4PDWB 3NNJA 2BZDA 1RVF1 2Y0IA 5FQ0B 2VOXA 4OI0A 2A05A 3ALQA 2CWEA 1QGPA 3KD4A 4B1MA 4PLMA 1X58A 1BEV3 5J98B 3KV5A 3INAA 3I2JA 1QJZA 3JBG2 1VTNC 3RCOA 4QX7A 2RJ2A 1HKDA 5L36A 4QDSA 1QDOA 1ZBE1 2FQ3A 2FZ1A 3AJYA 2RAEA 2EA7A 1D4M2 1I1SA 1VQKI 2PAMA 4LA3A 3MICA 3NNMA 1XNCA 2GMPA 5A3LA 2R5YB 3OMYA 4GXOA 4L97A 2FD8A 2BWCA 1OLME 5M5YJ 1WSUA 4H14A 3WTXC 1IPSA 3I5UA 5FZLA 2K9SA 2WFPA 3N05A 4HZFA 5A7WB 4S05A 4L9TA 4Y22A 5KHKA 2HXOA 1G7YA 2IS1A 1OI6A 4NC8A 1PZ8A 3Q8BA 4FFHA 1X3ZB 4A3ZA 1SHWB 1KDKA 3ZXEA 5IP9J 4YIFA 2X09A 2Y34A 4COWA 3QAHA 4PLOA 3SFIA 1V0AA 2B42B 1UQXA 1ZK8A 2LD5A 4HPQA 3P9CA 1DZQA 3KVAA 3JREA 3VLBB 3WDUA 3OPZA 1SBEA 1XG1A 4UY8I 4XBNA 3WF1A 2LVSA 2KLOA 3FLPA 3SQNA 3B01A 3E97A 1SLBA 3I53A 4ZYEA 3C1DA 5HCHA 4FHTA 3GHNA 1STMA 3AK0A 3UGGA 3A4UA 3J9SA 4ASLA 2PN6A 3LSEA 2WUHA 1H2MA 4QX8A 3PDQA 5FWEA 5BNOB 1DFQA 1VBE3 4RHV3 2IJLA 2P3JA 3AVSA 3OUIA 1VQ6I 3RI4A 4A42A 3PUSA 3RSJA 1NZIA 2IRFG 4NQWA 2O8KA 2NVTJ 3DLAA 4FOWA 1PGW1 4WVVA 4KN7X 1GR3A 3DXTA 2ARCA 3S5QA 1COV2 1AR81 2DI3A 2F4PA 5FRNA 4AFAA 3AMNA 1ODMA 4DINB 1AKHA 4EYUA 2L9LA 1RUNA 2H6BA 5CPRB 1ZN2A 4LBMA 4Q4X2 4XUOA 2YU2A 1HB1A 2KA3A 2ETEA 4ENKA 5FBJA 3MFCA 3OIPA 3WDWA 5L7OC 1TME1 4LE3A 2NVXJ 1OPOA 5J8CA 3SJMA 5H9PA 3H9AA 1POQA 1QXRA 3THTA 1PGL1 1PX4A 3QPSA 2J1UA 3H9GA 3AZYA 1LEBA 1Z6RA 5E20A 3BP8A 1WBLA 1P7JA 1LPQA 2PLYA 4MG2A 1W3VA 4NMIA 2VMEA 3TNQA 3OS1A 4CEWA 1QPMA 3REOA 2NM1A 2PMZA 3M07A 1VQ7I 4BJ0A 4DXTA 5F6FA 1F5JA 3AG3H 4EWEA 3CKHA 3HPHA 1NE4A 1Z0HA 3Q9VA 3PURA 4AK3A 1BK1A 3LGRA 2YROA 3CMMA 3RYRA 2VNVA 4JRLA 4LK7A 2RS52 4BIFA 4ESBA 4R9DA 3MF9A 2E36A 2LROA 2PHLA 1HB3A 3N7LA 4KT6A 3L2HA 4YGEA 1GU3A 4R4ZA 3HQRA 1DQ4A 1J3RA 2O8QA 1V6LA 4QM8A 1A3KA 4HKOA 4M0HA 3PM1A 5FLJA 4UWDA 4BQOA 1RUD1 4B3AA 1FNZA 1R1A1 1MMNA 2WV0A 2WYSA 3L2UA 3QP5A 3I3MA 1MBJA 4B3NA 1DGRN 1G86A 5IYYA 1LOAA 3WTSC 2JG8B 4BMEA 4DXSA 1G3SA 3VDDA 1U78A 1WWXA 5CG8A 1W6MB 1HV0A 5EEAA 1RUC3 4B09A 2PA7A 1FMWA 5FYHA 5E3LA 2QBYB 3MKYB 4JOMA 2XAHA 4ZYAA 2GC0A 2VN2A 3SEZA 3WUDA 2WBMA 1A5JA 4YFNF 5CFCC 3PU3A 4AIHA 4DOZA 1W6PB 2K9MA 4N9IA 4QGNA 1GICA 4QT6A 2XIGA 2V1DA 3S3OA 4YM0A 5FD6A 3F95A 3BIEA 4H3WA 5CKQA 3BZ6A 1Z7S3 4HPKB 1YJWI 3CMYA 3M3OA 3EB7A 5EJ3A 1P9QC 4QDRA 2ZGRA 1FMD3 1LOEA 2WAEA 4WXCA 5H6RA 4BQQA 2P6SA 4PF1A 2BNNA 3E3VA 1KITA 4X0GA 1Y4WA 2F4LA 2R7RA 1CAWB 1RINA 5LCWL 3CO7C 2QQWA 2LKSA 1H1AA 4FPOB 5I0UA 1CQTA 2XVLA 1DQ0A 2F2EA 2KDOA 2AR6A 3SZPA 4A2UA 1JKQC 1HQLA 5FYZA 5JLXA 1W90A 3E6MA 3LSDA 4ETSA 4NOTA 4ZONA 3AL0C 4MXVA 4IUGA 3ZR8X 1TWCJ 1LEDA 1D4M3 4OHVA 4QB6A 3KP6A 3WQ1A 5GLZA 5FV3A 3HBLA 4HOOA 4C90A 1LFBA 3LSHA 3K10A 2WTEA 4NROA 2H09A 2N8GA 4PSXA 3ZR5A 3M7AA 3ZXGA 1IW7F 2O0OA 5CQGA 5FLXK 2BBVA 3JRFA 1UZ0A 2W94A 5DUKA 1XU1A 2FE3A 3RJPA 3FMRA 5K4LA 2RDSA 2QDNA 4XBQA 2QSGX 3W5NA 2XWBB 2R042 2CW7A 1VAMA 4DMIA 2J7MA 4K8RB 1BJAA 1NUKA 1RESA 4HX7A 5JR7B 2IAIA 2KD7A 5FBZA 4OI1A 5JOWA 1K5MB 4NWWA 2ZFWA 3BTLA 4FX0A 4YGDA 1RHI2 5EZGA 4NHLA 1XMXA 2W48A 1JJ8C 5DYMA 2G19A 5K5RA 2EIKH 1VQNI 3WP5A 2JA5J 1BMV1 3OYDA 2BHZA 5IW0A 5L3FA 1JOJA 2W1UA 2A3WA 2XPJA 4PI2A 4PK4A 3HBZA 2L7ZA 2VASA 4HSLA 3OSFA 2QKLB 4HNVA 1W8OA 1S3JA 1OKRA 2QM3A 2J42A 4KWUA 5J37A 4Y3OA 2HWE3 4AI9A 1MVEA 4JHTA 3M3IA 3CC2I 1YQCA 4G7OF 1F35A 1VMJA 2YU9J 2J1SA 2WT1A 2HWD1 1JXNA 4Q1RA 1SMYF 1WCDJ 2D3SA 4KIFA 2WAOA 4BHCA 1JI8A 2DCZA 1AYM3 3F8CA 1UZVA 3HT1A 5JPNB 4OULA 1W6OB 1YX5A 2YU1A 3OGGA 1G6NA 2PMUA 4GYIA 4HBLA 4ABZA 3MWMA 2QKMB 1ZNPA 4M73A 1USSA 4A5MA 3WP3A 5BNQA 2DQRA 2I74A 2E19A 3RZGA 1XRUA 1YUDA 2P5KA 1K3IA 2VNRA 2A71A 1RUH1 3PIPF 1RUE1 4GFBA 2MC3A 2RE9A 2XGDA 4KGQA 2XPWA 4V2GA 4ESFA 1L3JA 3MPBA 1G9AA 4QPGB 2BXZA 2PQQA 1HRI3 2OF7A 5FYYA 5FJKA 5FLIA 4K3UA 5BYNA 2D40A 1YOVB 3H8XA 3WEZA 3TN93 1ENHA 4COZA 5C4JJ 4MO3M 1B6AA 2X10A 4EATA 2PYTA 2MSYA 5A3OA 3SEEA 5CVJA 1XPXA 4U7BA 1F8VA 1W2UA 1MR5A 3AKZA 4XMAA 4CCNA 5GJ6A 3EUAA 5BNNC 3TOAA 2GOMA 2K9QA 4CDQC 4XTPA 1EPZA 3VYRB 1FNNA 4RL7A 4XUTA 1TMF1 2RDQA 5BNPA 3U2RA 4E7JA 5E18F 2X1CA 1PMIA 2XAGA 2LY1A 3LSTA 1RUD2 2QTWB 1LOFA 4EQVA 1NK2P 4GMP3 4MQVA 1GNZA 2DUQA 4COYA 2VLAA 3VBRA 1JUHA 1AOYA 4M6XA 1OA4A 3K2AA 4JK1X 1RUG2 5BNNB 5A3PA 3A0NA 1T08B 4MHGA 3U4XA 4PQ9A 1X8EA 1WKYA 2DCYA 2WO3A 4QIWN 5JXGA 5IYCJ 2D5FA 1ETQA 3Q8AA 3K4LA 3MEPA 5B1AH 1QJFA 1VBB3 4HQMA 3TO9A 4XURA 4M4PA 5HI0A 1W2OA 2IFRA 2A1XA 1W8TA 3JAMK 2K3FA 3ZDSA 3FN9A 4AI0A 4LORA 4L0PA 1LU2A 1GP4A 4XLFA 1QQP1 2Q2EB 5HPOA 1TL8A 1IQDC 5KC5A 4DEQA 2AEYA 5C8CB 2BW3A 2DTWA 3HOZJ 1LDDA 3ACHA 3BR2A 1CN1A 4CUCA 2M87A 3RTRA 2BOLA 4LTAA 1PVEA 5JCTA 2PBIA 3GYHX 4AI1A 2VUDA 5A80A 4EROA 3VSLA 4EE2A 2WNOA 1T6BX 3U14A 1W0UA 1DQ6A 2LF7A 1OQ1A 2X51A 3TN91 2VQUA 2WQ4A 2DMUA 5FK7A 4E4SA 5IK4A 3ZMZA 5F39A 4QKFA 2H0BA 3TMOA 1RETA 2WB1N 5FOBB 3UGFA 1EV12 4IGPA 2VULA 1NAEA 3HN3A 3GCWA 5FZ3A 3WP6A 2O8XA 1KGYA 3V8KA 2W92A 1YIPA 3F6OA 3VDBA 3BTXA 2LNBA 1C28A 4P9FA 2VPLA 1R091 3N36A 1HXS2 3QD6A 5ABJA 4W4ZA 3ILNA 4MSVA 5GAHJ 3O14A 4EN6B 5GAGJ 2XUEA 3SDGA 3ZYFA 1UY3A 4IQPA 1ZELA 2G9WA 1T2XA 2GXAA 1CZTA 4UFJA 2JPBA 1YRNB 2E63A 4GZ9A 1FP2A 2SBAA 3Q3SA 1Z91A 1GWLA 3EUHA 3J8F2 1FOWA 2D45A 4FCYA 1PO21 5F64A 4DBRA 1CZVA 3MW3A 3AKTA 1ENSA 1O6UA 2BY2A 1WW6A 2Y6GA 3GO5A 2DTYA 2VL4A 2R7QA 1W9WA 3PIOF 5EG0A 4B1RA 2JPCA 2R7XA 2LTNA 4UUSA 1QQP3 4PJYA 3WU2C 3CDIA 1TG7A 2DFHA 4CDQA 1SPPA 4KH9A 2N7GA 4HA8A 3G71I 5E3MA 2Q8EA 1C8M2 5FY1A 1ASJ3 1V6NA 1ZLJA 2EA4A 2TRTA 1RUF2 2CGNA 3NNLA 4TWTA 4G9SB 2R93J 1UW8A 1G4DA 2XASA 6PAXA 1ZH5A 3VD5A 4DXZA 2LFBA 4ISRA 2YX4A 1ZRDA 2W1SA 5J36A 5EXOA 1T56A 5FCCA 3CP2A 4S2GA 5J47A 2WLQA 3PFIA 4XQFA 4XRMA 5DCMB 1BR4A 2E33A 3KF5A 1W8WA 3ZQGA 4XYXA 4BE3A 2XVGA 5IOYA 4G7HF 1MW7A 1U0AA 3LSPA 3DGTA 5KVRA 5FIXA 2HTJA 1LCLA 2HZTA 5DUWA 3PVOA 4DZJA 1B8IB 3HEIA 5ICFA 2WWJA 1HKQA 1YX3A 3C2BA 3SMHA 1RB8G 4QXKA 3CLQA 2HYXA 3ZXJA 1Y1WJ 1U2WA 2WB1A 5FY5A 5FKOA 4PLNA 1H8TB 1V6KA 1A8MA 3GW2A 1SANA 4QLCU 4XHBA 5FRMA 3AX4A 5KHIA 4RQPC 1AR91 2F17A 4CEWB 3D5OA 2PJRB 5FO9B 4M3FA 2G9GA 3CTAA 5IAXA 3FF5A 1IF1A 4R9AA 2BNOA 2CDOA 1BHGA 4QXHA 5JXIA 2CWMA 2JX9A 3FBNB 1WWYA 1E3PA 3AL6A 5FDBA 1O57A 3M3QA 1DG6A 2CQ7A 3JQWA 4A7ZA 3GFMA 1TNSA 2ZGTA 5LRRA 1NG0A 2CV1A 3R60A 2IW5A 3NWSA 3D1NI 1D2QA 3CNAA 1ETVA 1HDKA 1XQNA 1W36D 3D3AA 1F9KA 4BS9A 4YG6A 1WQ2A 4JDNA 4LK6A 3TRSB 2EZHA 2WT0A 1C1LA 2HXIA 2NNNA 2ZMEC 1ON1A 4GQ7A 2D1VA 1NCQA 1KFXL 3ZIWA 3NV4A 4UAPA 2X29A 3KETA 3UT0A 1OVSA 3ZYBA 2Y64A 1KD7A 1UAIA 2CV2A 1JXSA 4I30A 1QJX1 4K9SA 1WLCA 1D3YA 3BTZA 3FM5A 1VQLI 2BW3B 2DVBA 2GN7A 2BHYA 2VY0A 3AKQA 2FOWA 2O5RA 5FLVA 1REEA 3DL3A 1V9U2 2BBYA 3LOIA 2IP2A 3IH2A 3NNFA 1SAUA 2EZKA 4AQ2A 1TWGJ 1D0GA 3CF2A 3F21A 2GIVA 1A35A 1RR8C 3T0BA 1MIJA 1R1VA 3BROA 3MD2A 2JN6A 1MJ9A 3NSTA 4ZY9A 1NCRB 2VBXA 1EP0A 5F3GA 5IYDJ 3Q9SA 2LW8A 4CP9A 3T5XA 4MGQA 2NQYA 1O7FA 2FF4A 4II2A 4FPLA 2XBO3 4QKNA 3JSOA 4RHV1 3ZKUA 3IPVB 2JG9A 4PSWA 2BJSA 3H8RA 3UR3C 4W6XA 5IUQA 1SLCA 1ORKA 2FDKA 2CWSA 1I1GA 4I02A 2AZ5A 1KJRA 3ZVXA 4G6DA 4EEFG 1MJAA 3HXLA 4KT5C 5EYXA 1OCTC 4GKYA 2DN0A 3FKIJ 4CDXA 1SLLA 3ABMH 1SVMA 2P2KA 3C3WA 3C7EA 3LEGA 1CX1A 3T1MA 2J1EA 2RS33 4AEDB 3CCVI 3VKNA 1IPKA 1GOFA 3U75A 2JDPA 4AE2A 3LDKA 3I2FA 3K4ZA 3JW4A 4Q8LA 2QWWA 4LFUA 1UZYA 2ORZA 1CAUA 1YIFA 2RQQA 3OYIA 4J6GA 1NOVA 4R52A 1Y8RB 3IH3A 3VUOA 2XMLA 1BYHA 5GPAA 5DUIA 1BBT1 3A0KA 1GP6A 1QZYA 4ZDOA 3P9IA 4I09A 3LAJA 2VGDA 2PMZN 1X2NA 2Y69H 5FZBA 3A02A 4QQHA 2XWJB 4UF0A 1UB9A 5A7OA 1S7OA 2E1OA 4YWAA 4ZXKA 3IDBB 2RS11 2FD5A 5A70A 4Q4ZF 4HV5A 2LTPA 1R36A 1FATA 5A6ZA 2WNUA 1HQWA 4CCKA 5J1XA 3EQLF 1AX0A 2OKXA 3S57A 3K4KA 4RBOA 3B73A 1PJRA 1RC6A 3LSGA 2IXIA 4A6OA 2IWGB 4DRVA 1DDLA 3E1SA 1IS6A 5GZGA 1X1PA 5B3SH 3EYPA 4MOAA 4XDQA 3HOBA 4XJZA 4PZJA 1UJ8A 3OUJA 4GJYA 3GJAA 1LECA 4U0VA 5GKAC 1MBKA 4W50A 1GHCA 2EIBA 3VHOA 4DXRA 3WNXA 1B9MA 3DKWA 1F5TA 2V9PA 1LEAA 2BGCA 4PI0A 4HSRA 1K6OA 1EYBA 2NNYA 2ATFA 1QWRA 1SMVA 1RVF3 1EV13 1JYIA 1GFF2 4IE0A 2HTSA 1EAH1 3KGLA 3WNLA 4CPBA 2DUPA 2NS8A 1AYM2 1K5JA 2J22A 3MW4A 2NS0A 1LULA 2OV7A 3TKYA 3KZIC 1TZOA 4L18B 3UESA 2A70A 5IK5A 4C2UA 2WS93 4PJMA 3DPLC 1I27A 3ZFFC 4OYUA 2ZFUA 5F1RA 4K21A 3WY6A 4XIDA 3RIRA 1K4SA 3GZUC 2L9RA 1KQ0A 2BY3A 2X48A 3PJRA 2B9VA 2LRPA 4PGGA 2QQVA 2A6WA 1AYN2 4Q5OA 2EFPA 2XJPA 3OL3A 4D8MA 3KPHA 2DOEA 2DCJA 5K7ZA 3VGIA 5GADJ 3IN9A 5L7OA 2GXGA 3I4NJ 2ZX3A 4OMYA 1K7AA 1DU0A 1YITI 3BTAA 5DABA 1XSVA 1AZDA 2HI3A 4PJJA 2L4AA 2E71A 2GMMA 2MH2A 1NCQB 3K46A 2EIDA 1JKPC 4RS5C 4XABA 2FQ4A 3GZ6A 2W68A 2O03A 3OR1C 3HOSA 3CUQB 4GIQA 4XQDA 1OYIA 3AFKA 2CY6A 1VBA1 4XKVA 1L7LA 2AO9A 4D7NA 1WCUA 4RFT0 1GVDA 2QQLA 2KJBA 1X36A 3ZKYA 1BBT2 2IS2A 3U10A 2DA7A 5F2WA 4FOVA 1O59A 2QVOA 3U37A 1DUXC 4LBQB 1JTXA 1X2MA 2GMEA 4META 1CONA 1LOCA 2W3JA 1R64A 2IEKA 5FY8A 4N0BA 2GP5A 4Y15A 1KONA 1QQIA 2CRGA 1PO13 1F4KA 4LHKA 2NMOA 2VZPA 4MGKE 4WF2A 4S04A 1H30A 5J3LA 3FISA 1VRH1 3MBWA 2O0YA 1U5IA 1UELB 2RR11 3FC0A 3ON7A 2L9NA 4LLOA 5CFDA 2W91A 2RDPA 4BY1J 1LGCA 3A22A 1PUFB 5D21A 1O7LA 3O8GA 1ASJ1 2TDXA 3KP4A 4IF4A 1MNMC 1BCXA 1HC8A 3M1CA 4S2FA 4IESA 3PL0A 2ZO4A 2AH2A 1P8JA 4FPHA 3WD5A 3BG3A 1J83A 1LHOA 3AVRA 3C7HA 2E32A 4EVIA 1A6CA 2C26A 2LK2A 4XPVA 5FZ1A 4I76A 5K8SA 2CHHA 2CTVA 1KQ8A 4YM3A 2PQ8A 1W8HA 4JYKA 2QFEA 4L99A 1LE8A 4B1LA 2ZAHA 2O7OA 4RGXA 2OA2A 4XRSG 3RJ2X 1AR92 1W6QB 5HS8A 4B43A 1WA4A 1QF3A 4KL1A 2BBAA 4GH4A 1Y3TA 2ZZJA 3CMAI 1VB4A 3VBSC 2DFBA 4B8EA 3JRHA 1V6JA 3ABUA 3QQAA 2VBBA 4HF0A 3ZQ7A 5ANQA 5C4WC 2P1BA 4XILA 3J7NA 4COVA 1HW1A 3KT4A 4E8DA 1RGSA 2VBWA 4BPZA 3J7LA 3AP5A 5GZCA 4LB6B 2P5BA 2COBA 4M3CB 5HCFA 2QGUA 4IV3B 3WINE 4D7MA 4CEYB 1JU4A 1WFXA 4AOCA 5TSWA 1SAXA 3LWFA 1BI1A 1OUSA 4MTEA 4DFSA 1SFXA 1P4XA 1G3TA 1YWKA 3WTVC 1JYXA 4IOAF 1O4XA 2I07B 5C4WB 2ARXA 3MUZ1 4LKEA 5ACA1 5B4NA 4I0BA 4NIDA 5HXVA 2R041 1PVC2 5JZGC 1MS1A 5KXDA 2IVMA 2DW4A 1VQMI 3H3ZA 2GNBA 2KIMA 3WG9A 4NIAA 1LNSA 4R8HA 2AXTC 1HQCA 4JGYB 4P9WA 5K1YA 4BACA 4NNJA 4HN1A 1TW3A 4Q4Y3 4EGZA 5FMOS 3PVBB 2GNMA 4NJ4A 3RVHA 5ANNA 2EV6A 5DAVA 4M6VA 3JU9A 2VBPA 1JUSA 1AR73 2CQKA 1MZ5A 1TTYA 1P4WA 3D8CA 3W21A 1FBQA 3HOWJ 1NQDA 2WDBA 3IC7A 1HB2A 1SVOA 9ANTA 1GXPA 2WQZC 1UO9A 5BV6A 1FMD1 1I6XA 3R0RA 4W1UA 2P5VA 3BTCA 2G0EA 2JA2A 1U9OA 3E1F1 2R7UA 3W58A 2VUAA 4FAHA 2L7KA 2GM4A 4I99C 4EJRA 4JX0A 2QQAA 2K9NA 1YJNI 2Z2SB 5B5EC 3VBRC 2YX7A 4CU9A 5GALA 1FX7A 1U5TB 5ED4A 3KM5A 4JQTA 2DO7A 5IYBJ 3CESA 4O9GA 4XRFA 4XSZF 1FBUA 5FPUA 1ZZ8A 2V4AA 4IXLA 4BGDA 3I3EA 3CO2A 1F31A 5A33B 1NKGA 1Z67A 1CESA 1UU4A 2I5UA 3FM3A 3M3CA 1VR3A 1RITA 2E1MC 3VL8A 3GZAA 1S5LC 4P9JA 2W00A 1OYWA 4XE9A 4RGAA 1LODA 2HEOA 5DUXA 3R4SA 4KU8A 2KQRA 3SITA 1U0JA 1W6NA 4OQ8A 5GLUA 1FLIA 4Y1UA 4PBPA 3FXOA 4DZGA 2ELHA 2VQHA 3CUQA 1J3PA 3VZLA 1PK6B 4AUXA 3WGIA 1WZXA 1UF2C 5FYCA 4AHZA 4OIQF 2VXDA 1DGWX 2HPMA 3JD72 1NYWA 1XTAA 2VMDA 3ZSJA 1GZTA 5FLMJ 4OIRF 4BJ5C 4YW3A 1OH4A 4NAMA 3USUA 1CF7A 5EEGA 4ZXEA 2VJXA 3JRCA 4LITA 4ZU5A 1QU0A 1G2HA 1E5RA 4FETA 4ZDLA 2WN3A 5APAA 3CCQI 5KBFA 3UV9A 3LPFA 4A3XA 1B72B 1ZA4A 1T38A 1QRYA 1Z6TA 3UKGA 2D5VA 4AVBA 4LLLA 1FOD2 5FLHA 3GBGA 3MIBA 3B93A 2X1DA 4WCGA 2G4IA 2H27A 3GFLA 3RQIA 4UUVA 1QHHD 5F3CA 2OIIA 5GLTA 4M3BA 4A4AA 3SH4A 3HG9A 5CBLA 2JECA 2VMGA 4OIOF 4K40A 4ET7A 1BEV2 2W1QA 4B7KA 3LSJA 2R49A 1EAH3 2HKOA 1D5YA 1DLCA 4NHKA 1TE1B 4IL7A 1Y1VJ 4IL6C 3TP3A 1WMXA 1YLLA 3QOEA 1BI0A 2J1RA 1OD3A 1VMFA 1FTZA 2WNEA 3HM5A 1SFYA 1QJU2 4BE0A 1H2LA 2VTFA 2ESNA 3T0AA 4UFIA 1JZ2A 3FHIB 3F0CA 1UG2A 2DU9A 4D1QA 2ZSHB 3ASOH 1Z7LA 2L7FP 4SBVA 4G12A 2JE7A 2FCUA 2WAAA 2YBKA 2VR4A 3RZLA 3K77A 3D0SA 4DUXA 4CRQA 3RKQA 4HOBA 3OD0A 3LB9A 2BXYA 1QHDA 2L2OA 5F0HA 5DDJ3 5JDBA 3P1IA 4OHZA 1UYXA 3ZXFA 2XROA 1KA8A 3CCJI 4LLFA 3ZSEA 3OG2A 2B63J 2WYFA 4HONA 2A07F 3OIQA 5FKLA 2IFWA 2VL8A 2VQTA 2EXKA 4JZRA 1SLTA 2A5YB 1FWZA 2H8WA 1S72I 1SFKA 4XL9A 2OJED 4AEMA 1F4AA 5C6CA 2Q0AA 3G73A 4BISA 5FZ4A 4IQ4A 2LMDA 4CUAA 4QPGC 1RUG1 1OJLA 1RYYA 4UW6A 1KDMA 4YW5A 4NC6A 4P9XA 2BYVE 3KP7A 1ZG5A 3DU6A 5FROA 1XGNA 2OPTA 2P81A 4FQ4A 1FXZA 1I3QJ 4FXGB 2NN8A 1Z7S2 2EV5A 3FHAA 3I71A 4PJ0C 3RWKX 3K3OA 4OHWA 3DTIA 4D7TA 3VL9A 1IOAA 5FOJB 2XXZA 3K70D 1NA1B 4GO1A 1LGNA 3VKLA 4XF3A 1JTYA 3VB9A 2L3DA 4ORFA 1C8M3 3PUQA 5FMCA 1BZWA 2K7LA 1VBC3 2XHNA 1ZZ6A 2JEMA 2R071 3QPTA 1XXNA 5G05L 1UMIA 2HQRA 3QBQA 2Q8CA 2VCCA 3K4MA 1TEIA 3C7FA 2HDWA 2W4SA 2PJRA 1UNBA 1JT0A 1AYM1 1VAVA 4XCAA 3OYKA 3TDZC 2VC0A 4CE8A 4IE5A 2JB4A 3FXLA 5HNFA 2ZJRF 2WBKA 5M3MJ 2Y6FA 4AZZA 4N53C 2Q2EA 2ZPXA 3WR0A 3FKJA 3AG4H 1X8MA 4RAYA 1TC3C 2BW8A 2XGEA 1J58A 2R073 1EUUA 4G7ZF 3DF8A 3J81K 4EWAA 1AX1A 1RXFA 1ONAA 1RVF2 2GOXB 1UN1A 1V4RA 2LBFA 1C5IA 3ZN4A 5LK7B 2P4EA 1QJU1 1DGWA 1JS9A 4UB8C 4XFGA 5C9AB 2Y33A 4XW3A 4E27A 3AFHA 4UFKA 1S2EA 3FBIB 3OYWA 3MV11 4RSUA 4RB1A 2C6YA 1XYOA 2HWB3 3I4IA 2VO5A 4MLOA 3D5SC 4FCAA 1UX6A 1GV2A 3WTUC 2JKBA 1K61A 4KUMA 2WINB 4Y4RA 2RREA 1CAWA 3U07A 4MEYF 1R23A 5EYRA 3ZYGA 3WDVA 4CP9B 3KCYA 2DJNA 1GYKA 4JQFA 3WZ1A 1GQHA 4KISA 4PIZA 3K70C 1TMF3 5G04L 3HHHA 4EJOA 4PFPA 1N1VA 4IE4A 5C33A 1W9TA 3LFKA 1SFNA 2R7OA 1KS5A 5F8PA 3U4SA 1V55H 1PUEE 5C9AC 1TMF2 3LEKA 5DZEA 1ETWA 4C3JJ 3ZXLA 5IFTA 4AQ6A 5HLIA 1IRXA 2BZTA 1C8NA 3WG1A 1S0FA 2HVSA 4YW6A 4K2EA 3VV1A 1MDMB 3LFIA 1YRZA 3H0GJ 1AL21 3NNGA 4GB31 2X05A 3GF2A 3QACA 5DEQA 3Q0UA 2ZXHA 2LREA 1YI2I 3C7OA 4A3LJ 2FBEA 5KHJA 5IVYA 3AMQA 3X2QH 2XF6A 1UWWA 3ZQCA 5DAXA 3SKVA 5FO8B 3CCEI 3IM0A 1H1IA 1HSJA 1VPHA 3RPQA 3I49A 3L2WA 2NOGA 2CFOA 4AEJA 3GF6A 4ZPIA 4DBQA 3LFUA 1Q8OA 5DPNA 3WF4A 1VBB1 1OSGA 1PGW2 2HJIA 5FP3A 2B7EA 3GBFA 3GJBA 2XOMA 3ZPLA 2DYSH 4Y5Z0 3DQVC 5ABJB 1ETXA 2ZJPF 3CLOA 2YUEA 2E1NA 1WJ5A 1YG2A 5C71A 1EV7A 1JTZX 4WM8A 4GD4A 1BI3A 5E1XA 5HV0A 2ME0A 5EGOB 4L8QA 2UYAA 1V6IA 2DYRH 4EJTA 4J19A 4HMZA 2WSUA 3VKMA 1O3QA 3S2HJ 2CS3A 2F6BA 1W7PA 3HWJA 1MBHA 1FV3A 1KZHA 4FFIA 4NR1A 1HF0A 4JX6A 2ES3A 3KQRA 4FI9A 2LLKA 4L9JA 2PLV1 3DCFA 1RPWA 2KP6A 5I0TA 1UYYA 1CAXA 5SV8A 3WUCA 3LAPA 1POGA 3KT1A 2VMIA 2VQLA 1GV5A 1VALA 1DU3D 2KZVA 3H3VK 1MD0A 4P96A 1PVC3 2MA3A 3BVCA 2WL1A 1CIYA 5C7GA 1GVJA 1UYZA 1WVRA 1JYCA 2CV0A 3IAQA 3JRGA 5KNLA 4JBAA 4XJUA 4RS8A 3ZSKA 3THDA 4D6QA 4NPLA 3RKWA 4WM7C 2QQKA 4YZ4A 4PF5A 1Z7S1 4CEWC 2ZGNA 2EB7A 1WCQA 4Y20B 3G1LA 5CYVA 4KNCA 3S16J 2A6YA 3MEXA 1Z3XA 4AVTA 2IXCA 4CDUC 1MS8A 1NLSA 1AR62 4P5YA 3H1WA 3I56I 5HCAA 4ZZ8A 4IERA 4WVMB 3L1PA 1Q1HA 1DCSA 4KITB 2VQAA 2H1KA 3ZIXA 3WNNA 2GZWA 3T4VA 2K86A 1ZZBA 1WBFA 1IUYA 1OLTA 1IZ3A 2WS91 4WVZA 1UD1A 3J7ZI 1OLMA 3FXQA 4XJAA 4Q4X1 2R061 3ZPYA 2Z42A 4IEQA 2W1WA 4MFEA 4QPOA 4BBSJ 3DPRB 3L2CA 4NO4A 3IAM2 2IVJA 4Y17A 4LO6B 5DAWA 4RHV2 2CUZA 4RFRB 1WI3A 1UXXX 4JQRA 4XRSA 2A5WA 2NAZA 1J75A 1Y7BA 5JOZA 4BXFA 4UYBA 3HPNA 1JHHA 3AG2H 3K1PA 4IKFA 1SMTA 2V09A 2OX0A 2IGMA 2UXNA 4J1WA 4YZ3A 2A3YA 3GZ5A 3FZVA 3TP0A 2XVKA 4UFHA 5HDNA 4HAMA 2OUHA 1XNTA 3SC7X 5JR2A 4E6KG 1VRH3 3P3NA 2DCTA 3I2IA 1JT6A 1M4WA 4Q48A 4QHZA 5L9BA 2YDEA 5DD4A 2JA6J 3PNTA 1BJQA 3GVAA 3BQZA 3BQYA 3OOPA 3JBG1 3KGZA 5IP7J 1EAH2 4N43C 3ZXSA 3ZFGB 3RZOJ 1TWHJ 1H88C 1AU7A 2WAQN 2IZWA 1OYYA 1X3WB 1QJU3 1T2KA 2Z79A 1DF0A 3UNGC 5LB6A 2A6HF 2H6CA 3K6GA 3T8TA 4Y33A 2IPQX 3ZDVA 3D5LA 4A6EA 2FSWA 3CMGA 1YS6A 2HWE1 2D6PA 2WWSA 1UU6A 1A04A 1BBT3 2GBYA 5CG9A 2P7VB 4B47A 4HNTA 4XFAA 2KPMA 5CNAA 2JE9A 4R4XA 1D1AA 4HYEA 1IXCA 3KLOA 1JYWA 4O7XA 1WJCA 4BQ5A 1RMU1 2LR8A 1PO11 2ZHLA 2A6EF 4QHOA 4FTHA 1BM9A 2WNUC 1WCKA 3V7RA 1D4VB 2P3YA 1N78A 1VBA2 2FA5A 1COV3 2ZGSA 4ZZDA 3L9JT 1UHSA 2HQNA 3GTJJ 4QTRA 1ETYA 4I01A 1HDPA 1Q1VA 3H7JA 4AIDA 3UJOA 1BOBA 3H5RA 2ARBA 2R4GA 5T5LA 5F5QA 1SLIA 4AAXA 2CQNA 2JUCA 1ZYBA 2COMA 2EAAA 1D0ZA 5BNOA 4FP3A 4XIOA 3WOGA 1QXPA 1OF3A 2W84A 1I6HJ 4AHXA 3ZGKA 3H50A 2PELA 5EGOA 2UWMA 3O6BB 1XMAA 1P92A 4BKXA 4B44A 2QYOA 2RDNA 1R1ZA 1OUXA 1IN4A 5E79C 2E1CA 1IN6A 1SEFA 1VRH2 1T0FC 4FPKA 1OLQA 3VBUA 1YFXA 4WK8F 3L9FA 2XJUA 1PMHX 2QVSB 1GT0C 4G3YC 1R9TJ 2WA4A 1LEMA 5IY5H 1D4M1 4RGKA 3USUB 2ZBKA 3SNMA 2ZBJA 2VOPA 4DY5A 4QWQA 1ODDA 3CJTB 1TQMA 2ADDA 4I3PA 2C4XA 1FV2A 5KCMA 1ND3A 3HJRA 3KEOA 3M8FA 3VDCA 1VE0A 1RUH2 1RUE2 2R92J 1KU7A 1S0IA 5HV4A 2GDFA 5FYSA 4OZOA 1IXSB 2J1TA 4JP0A 3GMEA 4A6SA 1B4AA 2QE3A 4XONA 1UY2A 2WWUA 5A6XA 1S0EA 5FUIA 1W8UA 1UFMA 1TBXA 2Y26A 1XB4A 1YC61 3H1YA 3KVBA 2V1XA 3IP4B 4GULA 3V64A 5C5UA 3T09A 3OY9A 2Y60A 2EWNA 1IDYA 4OUEA 2JB8A 2DK5A 1S0CA 4JDOA 2W95A 3OPWA 5DM6F 4ZS2A 3B00A 1H1MA 4HVRA 2QQMA 5LGNA 3WDXA 3WW1A 2W2IA 4CXWA 2VOTA 4CP2A 1G8WA 5ILUA 1ULFA 1N77A 4Y1YA 2GIZA 2K46A 1RJ8A 3FFZA 3ZN5A 4BXXJ 2B45X 3WQ0A 4IHYA 2WNVC 3MPPG 1HQNA 2XB5A 5FKKA 3B9CA 4FE7A 2VPRA 4NVPA 3CDLA 4LOSA 2YBPA 2G7UA 4B29A 5E1WA 3M2MA 4ZH4F 2K2SA 2VOKA 4P14A 4NAOA 3U9GA 3HSFA 3H36A 3CDZB 3AYEA 4FFGA 3CCLI 4LUMA 4OHXA 3POIA 3NV1A 2KR2A 2VBDA 1UOBA 1NCQC 3J4UH 1D2SA 5L3CA 4AGGA 4Z2YA 2A3XA 4Q5SF 3LQQA 3K3NA 3V7CA 4K6BA 3G6EI 5BNOC 4FT8A 2FNAA 4RD7A 3E5UA 1IJWC 3GLLA 2R0QC 2VQCA 2OZUA 2VT3A 4V2WA 4XACA 3W6KB 2VMFA 1Q8PA 2GN3A 5JVGF 3I9V2 3IRQA 2WO7A 4KJZA 4A0YA 3AM2A 3DEMA 2R0HA 3PU8A 3ILFA 3O7OA 3RI9A 5FK8A 2IXSA 3PJYA 5IOZA 1TNRA 3EPZA 4BOWA 1MNEA 2VD7A 3O5SA 1XC5A 2JA7J 3MO4A 5GP9A 1JMUB 4JC1A 3U1DA 2VE1A 3HBKA 3T30A 1SC7A 3BCAA 4N43A 5BMZA 3HOUJ 1MEC2 2NOJB 3RNSA 2VC9A 2VKEA 3NQOA 4LBNA 1OPMA 3CJRB 1WH5A 3ESWB 3KWVA 2VAUA 4QPYA 4DPNA 2QBYA 2YFZA 5A2QZ 3V8JA 2RS32 3H1MA 4AFBA 1K4TA 4TXWA 2K85A 2B0LA 3NQHA 1JUIA 5J1UA 1DZRA 1WUVA 2Y6JA 4MVTA 2W57A 4AIJA 2HWB2 5A1LA 5H6QA 3NW4A 3O12A 3FIWA 1UHMA 3H0OA 1MMGA 1U3EM 2YGLA 2X53S 4HVQA 2CUJA 4Y1XA 2X5IB 4E70A 4LBQA 1DU6A 3LKJA 2WZR2 4OUMA 4WBBA 4Z07A 5IVVA 2ZTNA 4FTEA 3GM8A 3LCPA 5B2GB 1G9DA 3J81Z 4CCLA 4XLAA 3WTWC 2VMCA 1W36C 3B7MA 3ZQHA 1UX7A 4JAAA 3HOXJ 2WLPA 4NUBA 4GWIA 3MFAA 3ZYHA 1OA3A 4KQ7A 3WF2A 2ERFA 4NPRA 4L0ZB 4EZHA 1HJGA 3WCRA 1IG7A 1GZCA 2FZ2A 2FMDA 3W59A 2DCEA 2R043 1AKHB 5KC6A 4XFFA 2L54A 3VZOA 2ZXWH 1CJPA 2OUMA 1NLRA 3J80K 3CQOA 3I59A 4R9BA 1FYMA 2EXHA 2R063 3MF6A 5FYUA 1JHNA 5J3UA 3ZSMA 5E3NA 1OOPC 3RSNA 4AG4A 5GAEJ 5IHRA 5AIQA 1W0PA 1GUUA 3BTIA 2OAZA 1MPXA 1AJKA 3AL5A 1UIJA 4E7KA 4PCRA 2JIGA 1H4HA 1YIOA 1AR63 2M4KA 2E51A 4CXFA 3GTKJ 2QENA 4INDA 1W5TA 3J7YJ 1XNKA 1O4TA 2JG8C 4NIGA 5FKNA 1A6QA 2HWD3 3LEIA 2AHQA 1WMEA 5KXBA 4OCTA 1HRI2 2JWPA 3BR5A 1R093 4Y5SA 2ZGLA 2VUMJ 2EIGA 3BGAA 5H9SA 2FDIA 3OV8A 3KV6A 3S17J 4AGVA 1CQ9A 2QNKA 1R49A 1LDKB 5DV5A 1ETKA 3ABLH 1OISA 2ET7A 4YVWC 2VG9A 3OJBA 3M8LA 5FRAA 3VFZA 2ZB9A 1X50A 4IEWA 1FYUA 2Z3YA 1W0OA 4DYCA 2IS6A 1E17A 3MCZA 2O14A 1G3YA 2W5FA 2DURA 4CDWB 4P5HA 2M1BA 4GWJA 3WQBA 1RUJ2 3GZNB 1OCRH 1O5LA 4XN0A 4DQAA 3LDRA 2D6NA 1ZRRA 4IQJA 2CO5A 1WD3A 2XSJC 2Y9YA 4M9XA 3J7MA 2YY1A 3T1BA 4NHMA 5BS6A 4XBLA 2A6TA 4ENMA 5J48A 4ZDPA 1ZBA1 4R9CA 4A45A 4RGSA 2ZGKA 3MLLA 3FUOA 4CDWA 2Q1MA 4LKDA 2BUKA 4FSJA 1CPNA 2HWC1 2GAUA 2ECCA 5T5JA 4B4PA 2IVIB 1WGXA 3ZX7A 2XJRA 5A3WA 2YC4A 1WJDA 4ATFA 2BRTA 2KDZA 2QQOA 5LA2A 1U5YA 2IGKA 1EJ9A 5DAPA 5FPAA 1S55A 5TRDA 2YHJA 5CKTA 1C8M1 4YPJA 2DA4A 1T0FA 2WAFA 1S0GA 5L7OB 5TGTA 2R6QA 2RR12 2DA3A 1KFUL 1J84A 5A3UA 2TBVA 1I3AA 3HSRA 2LKXA 3A7QA 2DMPA 2EINH 2M2EA 4IJAA 2EBIA 3I3DA 1V70A 3TNPB 1XC6A 1DIWA 1N1YA 2ZABA 1VMHA 4RR3B 1YE9A 3F8FA 4COUA 3DXJF 3NAPB 4KMFA 3HDDA 2XBO1 3UKVA 1REDA 1LAJA 4LB5A 3K4DA 3HKZA 2DVFA 5A3MA 3BCBA 3P5BA 3PIGA 4HKLA 2PN5A 2Q8KA 2R7SA 2L01A 2FCVA 3A4CA 3HOVJ 1F2NA 3ZMTA 1HIXA 1BI2A 4QQ2A 1C5HA 5D8AA 5LEKA 5FTTC 1VZ0A 1W6PA 5FKCA 2JDHA 4F52A 5KHDA 5A6YA 3DF0A 1MEC1 1FMVA 2Q0OA 4LMFA 3J7HA 5LGUA 4XOPA 2D3RA 5FUNA 4HNUA 3QWLA 4NE9A 4QM9A 4X8PA 3URFA 2WR9A 3ZQQA 3TOBA 2JRTA 2FEZA 1OHFA 4XLNF 4HSJA 2D44A 5FZDA 2F48A 2HWE2 3VZKA 5CLSA 3OB8A 1YW8A 4L5IA 1KS4A 4I3GA 3BOWA 1AVBA 1RTVA 4TLGA 4UV8A 1P6RA 5IVCA 4AQTA 3CMEI 2EF6A 2C24A 2HQAA 2OVUA 2DK8A 1JJ6C 4ZZLA 4D5CA 5LFAA 2XJQA 2VJJA 2R16A 2JDNA 1W9FA 1CWPA 4FOQA 5C5TA 2AEZA 3ZMUA 1ZVFA 5FZOA 1QJX3 4K7JA 1J09A 4ES8A 2RQPA 3AJZA 3S5AA 2RNGA 1IS3A 2V9VA 4ZS3A 2VXJA 1W7PD 4QU2A 4BXSV 4PUSA 4LBQD 2DOAA 4KBZA 3F22A 1ULPA 2BOIA 3PLQA 4B48A 2IA0A 2XDVA 3A01A 1W6QA 1COV1 2K40A 1M06G 3FLRA 4LQRA 1HRV1 4Y52J 2D98A 1W9SA 1V6MA 1ULCA 3W2WA 4A3FJ 4W65A 2PHUA 2CUFA 3SCHA 4A3BJ 5F0CA 4QX0A 1CAUB 3MIHA 2BERA 2PG4A 4JGZA 3V0AA 1CIWA 4L2NA 4OHYA 3CLPA 2YG0A 4IV1C 1QJY1 4KMUX 1B72A 2RVAA 4M3GA 5J7MA 3FUQA 1HJFA 1EV11 3UNPA 5J4VA 3JTGA 1BEV1 5LA0A 4PJNA 1CAVA 3J80Z 1UZZA 3W6VA 2E7AA 1ZR2A 3S6PA 1Z77A 2L9VA 3CCMI 2D1HA 3RWNA 1IAWA 1YIJI 5FMBA 5A7NA 4NHYA 1X1BA 4WZFA 5JIUA 5BY5A 1QNWA 1KQRA 1ND2C 4AWXB 2JG9C 4ONUA 2YBSA 1US2A 5BOXA 4A3GJ 2AREA 2OPKA 4DZPA 1XMKA 3KYLA 2KM2A 2EQRA 4Y26A 1A8DA 2ZOEB 2V79A 5LRSA 1ULOA 2CAUA 4X6AJ 4XEZA 2AACA 3F8NA 3WSOA 3I58A 1ULEA 5IK7A 2BQPA 2JTVA 2TCTA 4GYGA 3UL2A 3NKTA 4AFMA 5HLGA 2HEYF 5I0DA 1WCSA 1B59A 5J1YA 2ZGOA 5F7UA 1RKTA 4Q4W3 5CVRA 2RS13 1EF4A 3T2QA 4AGRA 2DMNA 1AUYA 2YU3A 1RUF3 4HQEA 4N53B 3HT2A 4J01A 1QOTA 4HW0A 2PEXA 5E8IA 3CF6E 1TP4A 3GCXA 2VXRA 1LKXA 5FZ8A 3DECA 3KV4A 1TNTA 2IA1A 3R0AA 1VBD2 5FZ6A 3CL1A 4FXKB 1WW4A 1UMQA 1FZPB 4AR2A 1MZFA 2VTXJ 1XSQA 3VBSB 3KB5A 2HWC3 2MFZA 4YZ5A 2E2IJ 2BV6A 4CCDA 3M8JA 1WHUA 3O1RA 4LIVA 4QGMA 2Y30A 2AUYA 1EKEA 5L73A 3G1OA 1DPRA 4L11A 1BR2A 3FK6A 2V26A 1IG3A 3MIDA 2O9LA 4OI4A 3IWFA 2CDPA 1OCZH 1AR83 4BJTA 2VVDA 1FOD3 2VTXA 1UYPA 1OT5A 1AR61 4E7SA 3KP5A 1GXQA 2EA2A 3DKXA 4CYCA 2C9KA 3CD6I 3PUAA 1IS4A 2HS5A 4CTEA 5FLXZ 2CGPA 2YV8A 1C4RA 5BPIA 4FPEA 2F5DA 1UPSA 5ICGA 3UGHA 4XF1A 4BLJA 4QPQA 3J8F3 5IT9K 2VCBA 3PJQA 4ZYGA 1ULDA 4JGYC 3WGGA 1B35C 4PDWA 3PMSA 2L7MP 2EZLA 3WDYA 1S8NA 5AC91 3F23A 2DTRA 2EFWA 4LBKA 3FDYA 2W25A 5JLWA 1U5ZA 5I93A 3S2DJ 3IH4A 1Y0NA 3NWTA 1QDCA 4URAA 1HRI1 3BJOA 3VBHA 2J5PA 3JXSA 1OCPA 2HOEA 2GC3A 3HUGB 1N1SA 2RS53 3E6CC 1E0EA 1VQ8I 4JDMA 4N4NB 1NTCA 1AF9A 4FPJA 3E0JB 3WDTA 3WV6A 3T2PA 4OMDA 4LHSA 1APNA 4IEYA 2LH9A 1SCRA 3LDBA 3WU0A 4EM1A 1W8NA 2PI0A 1VF9A 3IKTA 3WG4A 3K75B 2JUGA 2PHWA 4GH4B 5J40A 3PTRB 1WJEA 4XFHA 1AXZA 3WTYC 3ZM8A 1H8TC 1POV0 4DO0A 3AL0B 2MW8A 2K02A 2HDDA 2RS51 2I45A 5J4YA 4E4ZA 1ZBA2 4CPBD 1EH8A 4YM2A 4FVVA 5C3QA 3DYOA 3CCUI 1S0DA 1W0NA 3AZVA 2RMU1 1AYN3 2EVXA 2BY1A 2QQPA 3U11A 3RZKA 1S4CA 3GCMA 1FOYA 3ST7A 2CQQA 2D6OX 1RUC1 3PO3J 3SCFA 3T2OA 2DLLA 4IHSA 2XB6C 1R1A2 3CC4I 1X9PA 5E16A 5I8TA 2QSHX 5FXWA 4FP2A 5KWRA 3O1TA 2FX0A 3ZQIA 1UCXA 4V2VA 2WZEA 2VKDA 1CZSA 1ND3B 1VQOI 4P9UA 3E5QA 4EN8B 4QKBA 2Y6KA 1QO0D 5DUVA 2ZS6B 4P9LA 3M3EA 4CA0A 3R0JA 1Z21A 1TME2 5DG2A 3D5RC 2Z16A 4JGZB 2AGSA 3WW4A 3ZN6B 5AVAA 4N7UA 4YYOA 1Y9QA 5AC93 2I8DA 3S93A 3KMHA 3NJZA 1HA8A 1HRV3 1MZBA 2PFBA 4LGWA 5IT3A 2IBDA 2WFF2 2VBZA 1QZZA 3HZJA 3EBRA 1UY4A 4BU2A 2V73A 1ND3C 3VOEA 1CAVB 1OR7A 5LWBA 2DU0A 4ZTJA 4S2HA 2M9HA 2D97A 4JV4A 2ISZA 3IIIA 1XDSA 3I2GA 4CYDA 3UKNA 2RVCA 1LE8B 3ES1A 3QOPA 5J09A 3WP4A 2KIQA 5AC92 4O65A 3PSIA 3TN92 2DDBA 1ND2A 2DDUA 2DMQA 1URXA 3OIOA 5BPXA 2FDHA 4XAEA 4QSHA 4YNIA 1H89C 1O4YA 2XR4A 1BOAA 3H9JA 1SFOJ 4F3JA 1K78B 4MTDA 3VBOA 3Q8EA 3U0ZA 1MZ6A 2XLAA 2ZXJA 2EICA 3UYJA 4K1ZA 2C0ZA 2ISYA 1L0OC 3OOXA 2EFNA 2ZGMA 2XH6A 3MKWB 4L9BA 5LHIA 1JHJA 3SH5A 4BY7J 4IEJA 2WWYA 3GLXA 1PIV2 3ABZA 3T4HB 1EY2A 3OGJA 1GNYA 1W99A 2QF7A 3HTSB 3CU7A 1RL3A 3NJXA 5A7PA 4AVCA 3B3QE 4P00B 4YRDA 3K7AJ 1PVC1 4RLQA 2IC1A 2ZXIA 3VZMA 3PUHA 1ITYA 3WHBA 2HU9A 3J7AY 4P08A 3R61A 1MMAA 2RG4A 3GEZA 2Y6LA 1TME3 2FBKA 5FZGA 1KRIA 1T8IA 1ONVA 5T50A 4ZHNA 3BUCA 2DBNA 5JI9A 1ZARA 3H35A 3WVJA 2BGOA 3QP6A 4BCUA 1SBDA 1DQUA 3FE5A 5D4RA 4RB2C 4R79A 3WODF 5DS9A 4QGLA 3VD7A 1PP8F 1D0HA 4Z92B 2UWAA 3ENRA 1YFWA 2HFHA 3HNBM 4IEZA 2E7WA 3HD8B 4UXAA 3WG7H 4YLZA 1MH4A 1IC8A 1N1TA 2IT0A 4HRIA 4A3DJ 3ABKH 3OCPA 2R32A 5F2SA 3VYSB 2ZMEA 2R7DA 3T2TA 2P37A 4XXPA 2ZGQA 3N7KA 3GGLA 2P4WA 3JAMZ 3OYHA 5DXDA 5E6HA 1YW9A 5EPAA 5JOYA 4M72A 5CQEA 4NB5A 2HWF3 2DT6A 4Y1VA 4QPIC 5A7SA 3SZGA 2DXIA 3BG6A 4JRAA 4U2AA 1EH7A 4O6JA 3DWLE 2HKXA 3OYJA 3DU5A 4O9EA 1S7EA 1E2XA 1V9U3 2JQ7A 2OQ7A 2XGCA 2ZMEB 1JU3A 5EF6A 2P6HA 3O1UA 4HDUA 2XJVA 1T33A 3TO6A 2MEV1 3EYYA 4IDZA 3T1LA 4GRIA 4IHWA 3FLTA 4IV3C 4PIXA 3RQ4A 4UF0B 1CX4A 3S1NJ 1S7AA 4I0AA 1HKTA 2EILH 5K0UA 2VIXA 2ADEA 3NWKA 4XUNA 2P8TA 1ZR4A 1POV1 4XOTA 2Z9OA 1MGTA 1I39A 4OINF 3M8EA 3CJIB 1W9YA 3WU1B 5EFUA 1VBC1 3JUUA 5FYTA 3RZMA 5EJCA 1XX5A 3CO6C 3OUHA 1ZRFA 1JOBA 5AVPA 2R7ZJ 3BR6A 4FTBA 4BNCA 1WW7A 4ENJA 4D69A 5K0UB 1UKRA 2CGOA 2A61A 2JVGA 4KN4X 2QLZA 1PIV1 1LFUP 1WPKA 1RUF1 3SCGA 4QQOA 5D5UB 1FOD1 1LESA 2HBUA 5ACA3 4HG6B 2VECA 4DYQA 4LMYA 3I8TA 2L5QA 1YFHA 3R05A 5IWFA 5ACA2 2VXZA 2PQSA 3PFYA 1WCMJ 2XGXA 2MHFA 3I2OA 2ZC2A 4AIKA 3KE2A 2RNJA 3ATGA 4RAZA 4AI3A 2QKDA 1L3LA 5A7WA 3ECQA 4CDXC 5HODA 5FFZA 2ILMA 1W06A 1OD5A 3MGUA 4BZ4A 4UXNA 2NYYA 1W39A 3TB0A 1YJKA 2MABA 4P9YA 1RNLA 2WNVB 3FXKA 4YELA 3KV9A 4WM7A 3M3YJ 4GH4C 5C4XJ 3HNYM 2XKOA 2VODA 2B46X 5GZFA 2DJIA 5DG1A 1GWMA 2FRHA 1RIRA 3H0DA 4YW7A 1Y8QB 3BZKA 4KDPA 4HF1A 3MKZA 3JB8A 5CB7A 2AYHA 1FOXA 1D0YA 2MBFA 3I55I 2VT2A 3EQEA 3VDDC 4BA6A 1OQYA 3MDPA 3N35A 5TJJA 3WHUA 4V1PA 2HGCA 3OTFA 5JI6A 1NZCA 1K42A 4XFCA 1YS7A 3T0DA 3OL4A 3P5JA 3W6JB 1IXRC 2VZUA 3K4NA 2LUWA 3EHKA 5ABJC 4G6QA 4FAGA 3GFIA 2CG4A 1FPN1 2M3AA 2E31A 1ZM1A 3MW2A 4CSWA 2WRAA 4DEVA 3WTZA 1B8IA 2H8RA 5C3RA 1R7JA 4YIIA 2Y75A 2E5ZA 3NV2A 5DDGA 2Y38A 4KGGA 4YFWA 3DTEA 1DBNA 2P34A