3I54A

Crystal structure of mtbcrp in complex with camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
224
Chain Sequence
LYFQSHMDEILARAGIFQGVEPSAIAAQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 66
structure length 224
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i54A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i54A01
1TW3A 4EWAA 1IAWA 3EJKA 4LULA 4LEJA 4XFFA 2YSRA 2BV6A 2COMA 1IN7A 3GFIA 1H1IA 4MGRA 3KP4A 2F2EA 3H3UA 3GEZA 2L01A 3EQEA 4PIZA 1LB2A 2EFWA 3Q5FA 3E6CC 3G7DA 2Y75A 1QY4A 4UVCA 3MYXA 3BOQA 4IHSA 3FHZA 5CVJA 1FLIA 4MH0E 4O6JA 1DGRA 1KU7A 2M5WA 1S29A 2NNYA 3RKWA 3BCWA 4META 1QZYA 1D8KA 1F5TA 2OQRA 1R23A 2IXIA 1JE8A 2G9WA 4KIGA 3TNQA 1KQ0A 2FBHA 1PDNC 3KEQA 1AOYA 2PBIA 1R1VA 2QUFA 1UD1A 4YRDA 2A61A 5I91A 1XD7A 1XB4A 1IXRC 4OMYA 3LZZA 3FM3A 3GO5A 1O3QA 3JAMK 3LQQA 1ZGJA 1ZRRA 5DCMA 4MEYF 5ILUA 4FAGA 3KGLA 4UXNA 1IXCA 4EJTA 5CVRA 4LK1F 2ET1A 1YFYA 4ZYGA 1S7AA 1V3FA 4YG2F 4PJYA 1G3YA 4XF9A 3KP2A 5BOXA 5FGMA 3WE3A 4CICA 3QACA 1U5TC 4CO8A 4OINF 2VQAA 3LA7A 3QAHA 2XUBA 2L3DA 4ETSA 1HBXG 2NAZA 3P9KA 1U3EM 5D6FA 3JTHA 4XFAA 2HFHA 3I54A 2PI0A 5DD8A 1EYBA 3HRTA 1YFXA 2D5FA 1PM7A 2PJPA 1TTYA 4WF2A 1U5TB 4N0BA 3LA3A 4DINB 2GC0A 1T0FA 4B09A 1PMIA 2PHDA 4O5VA 4BIFA 1TNTA 1LRHA 3LQRA 3ERED 2JPCA 1DZTA 1KGSA 3G3ZA 3L00A 2XAQA 4UVAA 1FYMA 2ZXJA 4L9TA 4HBNA 4P9FA 4ORFA 2UY9A 2PLYA 4KA4A 1S3JA 1KYZA 1G6NA 5K5QA 5D6EA 3L2CA 2Q4SA 5J3UA 1YIOA 1QQIA 1USSA 3LWFA 1FSHA 1VP6A 4M74A 3F22A 4XFBA 1BJAA 1W7PD 2VBXA 2OQGA 3BP8A 1MD0A 3WTTC 3E5XA 2R3SA 4RB3C 5AONA 1HXDA 3RDIA 3S2WA 4AVAA 2W57A 3JAMZ 2EWNA 1K78B 4L0YB 4A0XA 4BQAA 3IL2A 5E17F 5L3EA 4ZYDA 1KQ8A 4AWXB 4YFKF 3KP6A 3KZYA 1VTNC 3FXUA 2K27A 3BZ6A 3V7SA 5JFRA 1REPC 4QXKA 2ZNZA 2PAEA 2L4MA 2ZMEB 2DU9A 4E2GA 3BDDA 2OAZA 3F8BA 1IN6A 4K8FA 4RB0A 4YNIA 1G3SA 2E7WA 4CXFA 1J7KA 3NVCA 4MQ9F 1QBJA 4HVQA 5FLJA 4MTEA 1QPMA 1Z05A 1Q5OA 4LLOA 4KNYA 3BPXA 3IKTA 4IEZA 1GVJA 3COAC 3MQ0A 5LHIA 4N9HA 1R00A 1B9MA 4EJUA 4Q29A 3SHFA 1S6LA 4XLPF 2D5HA 2B5HA 2LF7A 2HJIA 1IW7F 1FYLA 2UYBA 3IBMA 3HSFA 4BHBA 3MZHA 4NVPA 4AVBA 3GFMA 3ISPA 3M9AA 5JR7B 1F9NA 3FHIB 2MPFA 1BC7C 2PFWA 2CGPA 3F72A 3MAJA 5AIPA 4JTOA 4M6XA 2QENA 4GYIA 1FP2A 1XE8A 5FB2A 4H0EA 5I0TA 2FF4A 3K1MA 3EDPA 2IT0A 4WXCA 4G8XA 3KGZA 3HQXA 5BMZA 1FP1D 3BJ6A 1K6OA 4I01A 4D7TA 3OOPA 5BPDA 3R60A 1XCBA 2D1HA 4KUMA 4OOIA 2KKOA 5ICFA 1WA4A 3F8MA 2UWMA 1FT9A 3V7RA 4YARA 1B6AA 3ULQB 3ES4A 3F8FA 3GZ6A 3T8RA 5DUIA 3HYIA 2MA3A 4HV5A 1CF7B 2RVCA 4UBHA 2FBIA 3V8KA 1R5HA 1FXZA 4PDKA 3J7AO 1TLHB 1SMTA 5HS7A 2V09A 1QZZA 3I58A 2XASA 1B59A 4LD5A 1UW8A 2XL9A 3DEUA 3T1BA 4TV7A 3R4KA 2EV6A 3F21A 3OV8A 1U5TA 4KU7A 2HQRA 1D5VA 4AVCA 3MCZA 2DK8A 2QM3A 4YSFA 4ENKA 3FMQA 1J3QA 5JR3A 1E17A 2O1QA 1KU3A 1I27A 4WXHA 4HOBA 2M30A 3LAJA 1HW5A 1TQMA 3DN7A 1BI2A 2ADUA 3FZVA 2MBFA 3ZMDA 3CO2A 4BH9A 4WWCA 3DP7A 3CLPA 1MJBA 3HSRA 3RPUA 4P9GA 1IN8A 4A6EA 1ZREA 1Z91A 2ET7A 3KE2A 2GC2A 2RKHA 1CAXB 2VE8A 4KWJA 1JHFA 1O7LA 1D8JA 3MZYA 1SQ4A 2H09A 1K78A 2YU3A 4FBFA 2K4JA 3AAFA 1ULYA 3J80K 4WBBA 4FAHA 5E1XA 3IDBB 2N7GA 3C18A 2MC3A 3WGIA 4MNUA 5I0SA 4QGLA 2Z33A 5HDNA 1J58A 2QLZA 1QXRA 2XIGA 5H20A 4Q47A 4ONUA 5ERIA 1SD5A 1O5UA 4CGZA 2QVSB 3M70A 2ZMEA 1FPQA 3HTUA 5CYVA 2J5PA 5JCTA 1D3YA 4L9VA 1GQGA 4PGHA 1EY2A 5ICCA 2EFPA 3IRQA 5JSPA 1HKSA 5H6RA 2L02A 4AIKA 3OF1A 2IC1A 3SMHA 3P9IA 1QO0D 2DO7A 2V9VA 1YQAA 3HRSA 4EV0A 2XLAA 4YYOA 1VR3A 5LGNA 4IEYA 1U12A 5HLGA 1WWXA 4I7HA 5HOOA 5K5RA 4O9GA 1VJ2A 3K1NA 4CYDA 3WU1B 4BNCA 5LBQA 1IZ1A 1ZLKA 4IEUA 4JBAA 2ATFA 1IN5A 1V4RA 4RB2C 3USSA 2ZO4A 3FXQA 4L5IA 3ZPLA 2BE5F 2MD5A 2XL7A 3PLQA 4ZYEA 5KHGA 1RL3A 4O9EA 3E97A 1RC6A 3HRMA 1J3RA 4Z82A 2MLKA 1HSJA 5E16A 1HW1A 5JSOA 2GXGA 1EPZA 3WW3A 3S0MA 1P4AA 5I8TA 2C0ZA 3H7JA 1XE7A 3NL1A 5A2QK 3HRUA 5CVUA 4ESJA 4TLFA 2GIVA 5CJ9A 5KK1A 4Q0PA 4HZFA 4IRIA 3J80Z 1IN4A 5L3BA 1E2XA 1Y9QA 2XVCA 4F7ZA 2F5DA 3RYRA 3H92A 4IPAA 1XN7A 4EWDA 2RDPA 4NQWA 4LB5A 3KP3A 3O14A 1P6RA 1ZG3A 1ZVFA 2KJBA 2DCTA 2ELHA 2HTJA 1K7AA 4J1WA 1CF7A 2HOEA 2OBPA 5I93A 2FQPA 1ZYRF 4ESFA 3EQLF 5CVVA 3U1DA 3I7DA 4EROA 5L3DA 1W5SA 2UZKA 1ZHFA 4UXAA 4BHCA 4M73A 3WU0A 1LR5A 4A6DA 1IUYA 3WGGA 5KVRA 4AVPA 2K7LA 3ECHA 3GX4X 2A68F 2QQ9A 4P5OA 2WV0A 4LA2A 1T98A 3GXOA 2XAHA 1HQCA 2P8TA 2OD5A 1GQHA 3P9CA 2AXLA 5J6XA 3DFGA 1MJAA 4KU8A 3R0AA 5CLSA 4LJZF 4ESBA 2QNKA 3NEUA 5LGUA 5CU1A 2VC0A 3CLOA 4G9YA 1O3TA 3H1WA 3PVBB 2GZWA 4XBFA 3L7WA 1BM9A 1FC3A 1O4TA 3O2PE 2OZJA 5FPZA 4Q0QA 1MDMB 1YHFA 1FSEA 1CAXA 3ETQA 5A2QZ 4HSLA 2XLFA 2VBYA 3LSTA 1Q43A 2ZNYA 2QWWA 2LKPA 3H8UA 5D5WB 1X3UA 2O0YA 2FRHA 3BB6A 4XETA 5LGTA 1UIJA 1XGOA 3KP5A 4RGUA 5K1YA 4MGZE 2A5YB 1Z9CA 2BNNA 3CO6C 4XF1A 4OFGA 4UHTA 2EFNA 1UCXA 1AWCA 1SEFA 2DFIA 3PFIA 4KN4X 4GCVA 3S7EA 3MPBA 4ZU5A 2IJLA 2GA1A 3WTWC 3KMHA 2Z3YA 5LEKA 2DI3A 2O61A 1W4MA 1B1BA 2FU4A 5LHHA 3KCCA 3R6SA 2E1NA 4ASNA 2WC2A 1Z7UA 3RYKA 4UUVA 4LMYA 4F8AA 2DLLA 3EBRA 3ES1A 4JK1X 3RKYA 2LF8A 1EH7A 1EV7A 1NXMA 2IVMA 1K79A 1I6XA 4L9JA 4G7HF 2F4PA 1ZGAA 5DD4A 3BALA 4WZCA 1P2FA 2V6CA 1J2XA 4MQVA 2LSOA 1NHAA 3IWFA 1YW9A 3FFQA 3BPZA 2HWVA 3CO7C 5HVQC 2VBWA 2G7HA 2VODA 5D5UB 2O3FA 3M3IA 4XF3A 3V7CA 1B9NA 1WGPA 2EAAA 2WTEA 2FOKA 2BGCA 3ZN1A 4XFCA 1ZG5A 3I53A 2KIMA 2KJCA 5HS8A 5TRDA 2IA2A 5AVPA 3KFWX 2XV4S 1ODDA 1TBXA 1ZZ6A 5D8LB 5FFXA 3JSOA 1Z6TA 1UCRA 4HMZA 2IW5A 2B9UA 4RS8A 4IRHA 2K4BA 1SD4A 1R1UA 2OZ6A 4L18B 2A3SA 3EYYA 3VOEA 1I1SA 4LUMA 3UKVA 4KFCA 2OU2A 1ZX5A 1TQ5A 2ETEA 4IEWA 1STZA 1WLTA 1J1LA 2F5FA 3HUGA 4HA8A 4AIHA 4CDGA 2GXBA 2PYTA 1OR7A 1U78A 4XFIA 4LTAA 4HLXA 2VOPA 4G7ZF 4P96A 2PG4A 3WTZA 2ETHA 5BQTA 4I0AA 4HVOA 1YW7A 1KQ9A 4KT5C 2PTMA 4XF4A 2OYZA 4EMSA 2K0GA 5EFUA 1OPCA 3KP7A 4QGNA 3ELNA 3E6MA 3DQVC 5KHKA 3H1MA 2W24A 5LEJA 5EZWA 4RGRA 2E9QA 2P5KA 3RTRA 2ISYA 3BY6A 1LQ1A 4M9XA 5T3NA 1G4DA 4OIOF 4HX7A 5BS6A 3U10A 1S8NA 1O5LA 4G7OF 4OU0A 4G94A 1XMAA 3C3VA 1NE4A 2B0LA 2V1UA 3DL3A 4EVIA 1GXQA 3FJSA 3E6DA 4AXOA 3VFZA 3SZPA 1ZRDA 1Q1HA 2RNJA 2IXHA 4OIQF 2CO5A 3TDUC 1MDMA 1RUOA 2XKPA 3CF6E 2H6BA 2GA2A 5E1WA 3HT1A 3NW4A 3HSEA 2M87A 3KLOA 3KLNA 4PZJA 3ZQ7A 4WXDA 2OA4A 4L2NA 4WK8F 3SXYA 3IIAA 3CL1A 5E20A 2W84A 1CGPA 4IEQA 1RIOH 5ILVA 4IEVA 3W6JB 2PQQA 2HEOA 3GFLA 4HDVA 1T6SA 2CFXA 4GYGA 3RJPA 2Z69A 4MGIE 4ENJA 3QOPA 1FOKA 3R61A 3K69A 4ZU4A 2XAFA 3OCPA 5FLXK 4RAYA 4XF0A 2FE3A 1TW2A 5DYMA 3M8FA 4GXOA 1J59A 1ZZ9A 2QQAA 4U0WA 1X8EA 2A07F 3SHRA 4RAZA 4I0BA 2MH2A 2DT5A 3QRFF 5EEHA 3WG9A 2VOOA 5F1RA 3CDHA 2PAKA 5E1RA 4P55A 4GO1A 4M9ZA 3WW2A 4I3PA 4KWKA 2ZCWA 3B73A 2FMLA 4XEZA 1WKMA 3NJZA 1EH6A 2W25A 4KDPA 2A6EF 3ELKA 1OD5A 3FMRA 5L3FA 3TKYA 1ZRFA 2HYGD 3LFKA 4G6QA 1U6GA 2VE9A 4S04A 2UY8A 5E8GA 3BJOA 4EGZA 1OYYA 2B8MA 4HSJA 3FM5A 2G7UA 4EM1A 2V1DA 3TO6A 4HN0A 2O6GE 2QZ8A 3TOBA 1LVAA 2L4AA 2OZUA 3CUQB 1JGSA 1LKNA 2CYYA 4UVBA 3KEOA 5H6QA 3IC7A 3HIFA 1OKRA 4WCGA 4D0PA 1T2KA 5BV6A 4KWLA 2W85A 5KHHA 4XFGA 3ABUA 4P9UA 1H9TA 3ZMUA 2DW4A 3PQJA 1O3RA 2CWEA 1SFUA 1OMIA 4JVAA 1WSUA 4ZH4F 2FNAA 4LLLA 1ZLJA 2ZFWA 5JHUA 3VODA 4A12A 5FLXZ 3GUDA 2KRFA 2ESHA 1BOAA 1OYWA 2K02A 1KU2A 3I59B 2JRTA 4A5MA 1XMKA 1SMYF 1IPJA 3T0YA 4MV2A 3H7YA 3U11A 3KSCA 3LAPA 5D8KB 2XHKA 5D5XB 5I0UA 5TJJA 3M7GA 1RI7A 1IRGA 2HKOA 3FX3A 2YX4A 3QU3A 3RI4A 1BN5A 2QBYB 1ZN2A 2X0LA 2IA0A 4PIXA 3IDCB 3GF2A 2FNPA 4N9IA 2DBBA 3I64A 1KU9A 1T38A 4Y15A 1LDDA 1DPUA 2H0VA 4KMFA 3D0JA 4LA3A 3VB2A 4U7DA 4QX5A 5HDGA 3QP6A 2FSWA 1UB9A 2EB7A 4AIJA 2NNNA 4Q0SA 3M8EA 3DF8A 2VECA 4LLGF 3FZ3A 1TQIA 3VEPA 1Z1DA 2M1BA 5KBFA 4YFNF 3GYDA 2D40A 5J8FA 1PP8F 1IPKA 4AD9A 1SFEA 2XKOA 4HLTA 3GW2A 3PNAA 4IVNA 1CAVB 1FX7A 2GC3A 3KZZA 3J81K 2RC4A 4FX4A 1YS6A 2CQKA 4HX8A 1H0MA 2Q30A 3SFZA 1BBYA 1XDUA 2K9ZA 4OLLA 2VT2A 5FLIA 5K5OA 3F23A 1RZ4A 1MJ9A 4BXUA 4FT8A 2LNBA 4HV6A 4K2EA 4L5JA 1HW2A 2DQRA 3MDPA 3O3KA 1P92A 1XSDA 2XGXA 1UIKA 3C3WA 3L2HA 2JT1A 4U0VA 2IXLA 4IEXA 4M9SA 4EM2A 4E70A 3U2RA 4UNOA 2BNOA 2GWRA 4R79A 3F8NA 1YFHA 2Z9OA 3BWGA 6PAXA 1B4AA 1YWKA 2V79A 4Z07A 4LGWA 3ZMVA 3G73A 2J5OA 3LA2A 4ZU7A 2WFPA 4IERA 4LLNA 1SFNA 2KIFA 3TGNA 3SCGA 2STWA 3CEWA 1YO5C 2Y48A 2KXLA 3NRVA 3TO7A 4R52A 5F6FA 4M72A 5L3GA 3RPQA 1O7FA 3K1PA 3ZP5A 4MZUA 5J8CA 4Q48A 3NQOA 5I8YA 1RTVA 2PA7A 1ONVA 2MHFA 2HTSA 3L09A 4EJWA 1FY7A 3E3VA 1WQ2A 1USTA 1YLLA 1L0OC 5DV5A 5FFZA 4IEPA 4IF4A 3FE5A 4KYWA 2XAGA 3ZMZA 2FQ3A 3CUQA 2ZKZA 3KETA 1KA8A 2PMUA 2P6TA 4U0YA 2VONA 2GC1A 4UBGA 1PP7U 4HVRA 1IRFA 2E1CA 4LG0B 4KIFA 1FBQA 3TDZC 2JPBA 3J81Z 1BIAA 3GYHX 2Q0OA 4M6YA 2Q8KA 5HS9A 4B29A 1UFMA 2C6YA 4ENNA 1P4WA 4IXAA 2ISZA 3ZMSA 3REOA 5E18F 2ZBKA 4YFXF 2AS5F 4OIRF 1I5ZA 2QVOA 4X6QB 4KIBA 4LFUA 2CW0F 1R5GA 3F6VA 4HDUA 3N4MA 5HLIA 1J0RA 3NKTA 4RGSA 4Q0UA 2RV8A 2EFQA 3I59A 2STTA 2PAMA 4HYEA 4JQFA 3JW4A 1J9IA 2V1XA 2HS5A 1ZRCA 4HW0A 2P5VA 4RB1A 3HOTA 3GFJA 2GQQA 3QU6A 3DV8A 5FO5A 2IA1A 4A2UA 3QP5A 2EVXA 3PQKA 4QWQA 3SCHA 1CAWB 3GVAA 1J3PA 3LWCA 2QBYA 4Q0VA 3LOIA 5LRSA 4CHUA 2FXAA 5I0RA 2Y0MA 1ZH5A 3WTUC 4ZYHA 5J48A 1G3TA 1DUXC 4HQEA 3GLXA 3CUOA 2K86A 4OMZA 4YIIA 2D93A 3ST7A 1L3LA 5FPXA 2CV6A 2FEZA 4I2OA 3ABTA 2QCSB 3FWEA 2XLGA 1BI1A 1YS7A 5F64A 2EA4A 1GXPA 2M8EA 1FWZA 1FZPB 1YUDA 3T5XA 1F1ZA 1SD7A 1XGNA 1F4KA 1RGSA 2A6HF 1QWRA 2PQ8A 3SXWA 2EV5A 4HAMA 3I5UA 3I4PA 1CAVA 5ED4A 1TQPA 1XCVA 4KICA 3ACLA 1FI2A 1GHCA 3ML6A 2OPKA 4NHJA 3WTSC 4E2QA 1Q3EA 1CX4A 2CSOA 2YPRA 1HKTA 5FCCA 3HHHA 3I0TA 4HLYA 1U2WA 2FBKA 5DDGA 3T8TA 3P7NA 5I8SA 3FF5A 1FBSA 1XGMA 2ZJ2A 3BROA 2A69F 2GH2A 1DGWA 1LDJA 5IT3A 2IP2A 4GGGA 4IETA 5FD5A 1C0WA 4LB6B 5DCFA 4AQ6A 1ON2A 3RIRA 3F8CA 1J75A 4KL1A 3WW4A 4DQ2A 1RNLA 4QM9A 4KMUX 2XAJA 2NS0A 1BI0A 4HBLA 2FMYA 4BAYA 3TQNA 3VHRA 3Q9SA 3DXJF 4PGGA 1RUNA 4IRGA 1CAUB 2BNMA 4L9NA 4EWEA 2R7DA 4HF2A 1JHHA 4DNCA 1OFNA 2PN6A 4HN1A 1W7PB 5JI6A 1ZARA 3RYPA 2DK5A 1ZZBA 5LLQA 4Q5SF 2QDRA 4H7LA 3H9AA 4ZZLA 1WRJA 5C6CA 3V8LA 3MFKA 4B8XA 4XSXF 2BEOA 3OGJA 4I02A 1UPIA 3L9FA 1X7NA 1LJ9A 5BPXA 3GZ5A 3V4GA 2HYFA 3DKWA 2E7XA 2P6SA 2YR2A 5JSRA 1R7JA 4CZZA 4XSZF 4LG0A 1TNSA 1KYWA 4I98B 4U88A 3TO9A 1YYVA 3ZN0A 3K2ZA 5K8SA 5KHIA 1Y3TA 1H1MA 4HF1A 2UYAA 3QPHA 3H1YA 2OA2A 3DPTA 5HLHA 1LDKB 3HHGA 4MX3A 3HT2A 4MUVA 5J7MA 2BYVE 2IXCA 2EA2A 1I1GA 3W6KB 2VT3A 2HDCA 3K0LA 2Q2EA 5FDBA 2EJRA 3MEXA 2P4WA 1R1TA 3OTFA 1NE6A 4RGXA 3WTXC 1W5TA 4ON0A 2P7VB 4WX9A 4OIPF 1QNTA 1V70A 1FBUA 4EQQA 1J5YA 2JTVA 4NB5A 5FLHA 4LK0F 2LDUA 4MHGA 2JSCA 3H3ZA 4XRFA 1CAWA 2WWYA 5FQ0B 2RGVA 2F5EA 4GULA 3GBFA 4MEXF 1EH8A 2F5CA 1JUHA 2L54A 3WE2A 2VPVA 5BUVA 2DPUA 3N97A 1X82A 4MTDA 4I09A 1IXSB 2H27A 2HR3A 2XRNA 3IHUA 2P17A 4E2SA 3D5LA 3TOAA 1Y0UA 1R36A 3BU7A 3D0SA 3WGHA 1ZNPA 3CUQC 5DUKA 3MWMA 1QXJA 1S7OA 2HGCA 3O6BB 1NZCA 1YW8A 2H94A 4JV4A 3RKXA 3ROUA 1MGTA 4BHPA 4Y13A 1LNWA 2Z99A 2EFOA 4S05A 1O3SA 3GWZA 3D82A 2R7FA 3NSTA 4LUKA 5FD6A 3IWZA 4KN7X 2VXZA 2XROA 4R1HA 1YFUA 3U0ZA 1YLFA 3IKVA 4A5NA 1A04A 2HZTA 5CADA 2RQPA 2Q0AA 2YX7A 5C8WA 2QQBA 2GU9A 2EK5A 2O8XA 2X4HA 1OI6A 1ZZ8A 4XLNF 3H50A 4QLCU 2TDXA 3RNSA 4HF0A 4YIFA 2IXJA 4IESA 2VN2A 3B02A 2H6CA 3EHKA 5BY5A 5ILSA 1O57A 2JZYA 1DZRA 2RN7A 3EO6A 1ZAOA 4MGYE 3SCFA 3F3XA 4WVZA 5L3CA 4X6RB 2UXXA 5DEQA 2CG4A 1R58A 3TNPB 5IT9K 1P4XA 1SAXA 1MKMA 4EGYA 4XFHA 3C1DA 4G6DA 3FMSA 5HDKA 1DDNA 1SFXA 2NYXA 3CJNA 2ZKLA 5DCMB 2FA5A 2UXNA 1CAUA 2O03A 4ZZDA 3EETA 4A0ZA 3ZDSA 3CJXA 2MNGA 5E1ZB 5KHJA 3I71A 3UKTA 1XGSA 3ZMTA 4L11A 3RZZA 3WW1A 4FX0A 1EP0A 1ZZ7A 2CAVA 3EUHA 1W7PA 1XSVA 2ACJA 4Z2YA 3WTYC 1L3JA 4Q4ZF 3R0JA 5JAXA 2PFBA 1T39A 3LAGA 4QGMA 4BYYA 2D2WA 4IHTA 2Y0OA 4EM0B 5LRRA 1WI9A 1PUEE 2M45A 5E8IA 4HQMA 3HOSA 3OD0A 4L0ZB 2EV0A 2D45A 3E5QA 1SD6A 1YG2A 4EJOA 2P5LC 1YFWA 2QJVA 1BC8C 3CTAA 2IRFG 4QM8A 4JTNA 2KIUA 2VC1A 1U8RA 2Q1ZB 1G3WA 1H9GA 4IEOA 3Q9VA 1NYWA 1ON1A 5CVIA 1LEAA 3E6BA 1X8MA 1XSXA 3EYIA 3JTGA 5HI0A 2EA7A 1DPRA 1FNNA 4HX4A 5D1IA 5AIQA 2PHLA 4Y17A 3V8JA 3SZTA 5D4SA 1Z6RA 4AQ2A 2NRAC 1ZG1A 2D1VA 2O8QA 2PMHA 2Z2SB 1OYIA 5ICGA 4D7SA 1XRUA 4A0YA 1IF1A 4QMAA 3HTSB 3DPLC 3BPVA 4U7BA 2QYOA 1ZZCA 1YTYA 3ECOA 2VBZA 5IT9Z 5D5VB 4M71A 5FQ0A 5LHGA 4IJAA 2DQLA 5ICEA 1QGPA 3JZVA 3M1EA 4PCQA 4R8HA 1BIBA 1XDSA 1LEBA 4PIYA 4MGKE 4UV8A 1FYKA 2IPQX 3JSPA 1DP7P 2I45A 1UHMA 3BJAA 1R22A 3C7JA 5BXXA 2IXKA 1JXSA 2DPDA 1MZBA 2DAOA 2MH9A 2PEXA 3U9GA 5JVTA 5EEGA 3WTVC 2BBYA 3FXRA 1HKQA 5BPIA 4O3MA 3SQNA 4UV9A 2HQNA 2MLGA 3QPTA 2GAUA 3K9TA 3WODF 4J1XA 5D4RA 2DTRA 3IRRA 4ENMA 2Z5UA 4EJVA 2ESNA 3F6OA 2HKXA 4FHTA 4RD7A 1BI3A 3S7IA 3UKNA 1HSTA 1UHWA 2CAUA 3E5UA 2P7CB
chains in the Genus database with same CATH superfamily
1TW3A 4EWAA 4LEJA 2VTXA 2BV6A 1YJLA 4YFWA 5F6KA 1IN7A 3O0WA 2HEVF 4CCMA 4MGRA 3KP4A 4HPKB 4M3CA 1DLLA 4PIZA 5FZ6A 3SH3A 5IFTA 4QIWN 3TP0A 2D6KA 1R4MB 2J1UA 4RSUA 4K9SA 3MBWA 1FLIA 1HLCA 1DGRA 4UYBA 3RKWA 1AR91 1B09A 1JE8A 1KRIA 4KIGA 2FBHA 1AOYA 4NROA 5FIXA 5GJ6A 5I91A 3VZOA 5JUVA 3E7LA 1VQ4I 1DP0A 1DQ5A 3LZZA 3LDBA 2WR9A 3I3QA 1ZGJA 1ZRRA 3OBZA 2LBFA 3MLLA 4C9YA 1W8WA 4QXCA 5ILUA 4XORA 4FAGA 4CA9A 4LKDA 4ZS3A 3KGLA 3ITQA 3WSOA 2IVIB 2EZKA 3IZOA 4PCRA 4UFKA 1UYPA 4Z2AA 2ET1A 3QOEA 4NIGA 3LL7A 2WZEA 1JYTA 1F2NA 5CEHA 3CCLI 4ZXKA 1V3FA 4YG2F 4PJYA 4CUGA 2HWB2 1RYYA 2QKDA 4ATEA 3DPRB 5BOXA 5FGMA 3WE3A 4CICA 1CQTA 4CO8A 1D0GA 3V0BB 3N35A 2NOJB 3LA7A 3QAHA 4AQTA 4V2GA 1W6QA 3IP4B 2IEKA 2A73B 4XFAA 5HNHA 3O8GA 2R043 4LE3A 3C2GA 4PUSA 1DGLA 5DD8A 2R072 3I8TA 1B35B 1EYBA 2D5FA 2XDVA 3K3NA 4OHZA 3U78A 1PM7A 1RIRA 3BTCA 1VBC3 5DZFA 2DA6A 5ISLA 3EB7A 2P1BA 4JGYA 4C0BA 1H2LA 4PHZA 3ZN5A 5A3WA 4B09A 2AO9A 1GZ9A 1LRHA 2JPCA 1DZTA 5GAGJ 1O4YA 1QQP1 2QSFX 2XAQA 3ACIA 4UVAA 5KHDA 1HDPA 2JUCA 2X6XA 5A3TA 1YO8A 4C3HJ 1HB1A 2UY9A 2RE9A 1UOJA 1Z21A 5EJ1B 1TEIA 5M5WJ 2VUMJ 4N43A 2M8GX 4DYQA 5J3UA 4W97A 2WQZC 5K7FA 3P5BA 3NARA 1LKXA 4RGGA 2UWCA 2OQGA 4LQRA 3BP8A 3WTTC 3S2WA 1ND2B 2HYJA 2EWNA 1F4AA 1MH4A 4A0XA 1D0YA 5L3EA 2HXOA 1S9HA 3KP6A 2FMDA 2V7FA 4RQPC 4K8RB 3MW3A 1D7PM 3KT1A 2E7AA 5F5QA 2XJSA 1REPC 4QXKA 2ZNZA 2JKBA 5AC91 3GCWA 2PAEA 2WB1N 1BBT3 2ZMEB 3BQZA 4GWMA 1G9AA 3F8BA 3JB4C 1K4TA 1AF9A 1GR3A 4RB0A 1NY72 4MQ9F 1QBJA 4C8DA 4HVQA 5FLJA 2A6VA 1OVPA 3ZOIA 2WY7Q 1DGRM 2ID6A 4LT5A 1JU3A 4KNYA 3BPXA 2YU2A 4LKFA 4IEZA 3TN91 4N9HA 2Z1DA 3PU3A 1B9MA 1G2HA 2D5HA 3VZJA 4XL9A 5L7OA 2XGDA 4A3KJ 2HJIA 2Y9ZA 5DMYA 1MS4A 3W2VA 1FYLA 3KYDB 1HDDC 3GFMA 3M9AA 2HU9A 5JR7B 1F9NA 2DFBA 3FUQA 2WYFA 4BLJA 2VMCA 5AIPA 2YC2A 4C1WA 5I0TA 2IT0A 2BY2A 4WXCA 3OOUA 1YITI 5BMZA 5FRAA 2E31A 5CKNA 1FP1D 3F9KA 3X2QH 5FKBA 4XZUG 1QVUA 3WT3A 5KAIC 2NMNA 3R60A 3WP4A 5CIRA 3C7FA 2D1HA 4KUMA 3ORJA 4CZSA 1ASJ2 5FMCA 4NQWB 3ZXJA 1QMJA 3S14J 4LO5B 3ES4A 4Y4RA 1HA8A 1SCSA 4A4AA 4FASD 3T8RA 4A3EJ 5DUIA 3HYIA 2HEYF 3I4MJ 2P5BA 4CDXB 5GZEA 5HS7A 3I58A 2XASA 1B59A 3IDAA 4WVVA 3F21A 3NNGA 3OV8A 1U5TA 1BR4A 4F3QA 4ARYA 3L2RA 4AVCA 1PJRA 1FOYA 4LNVA 3Q0VA 2WDBA 4ENKA 5JR3A 1AR63 3HM5A 3AMNA 2CUFA 3IMNA 1KU3A 1I27A 2RAEA 2WS93 2QUOA 3LAJA 1CJPA 3D5SC 4BQ4A 2WL1A 1JI6A 3M7AA 2VULA 2XOMA 1W2NA 1BI2A 3FZVA 1C4RA 4IOAF 2XF6A 3ZMDA 4K3UA 1S0DA 2BXZA 4AUXA 3PU8A 2DMQA 1X19A 1VIWB 3ZR8X 4Y5TA 4BQ1A 1ZREA 2ET7A 1CAXB 1ZELA 3IAS2 4JAAA 3CCQI 3AVSA 2H09A 3IPVB 2W92A 4BCUA 4FBFA 2IS6A 4Q4W3 1N3QA 5EYXA 3DYPA 4AAPA 5E1XA 2N7GA 5I0SA 2WNEA 1EV11 1RUC2 5G05L 5HDNA 1AJOA 1QXRA 4ONUA 4Q47A 3WX5A 3T2TA 2L7MP 2JUGA 4CGZA 4QKBA 3HTUA 5CBLA 1V5GA 1GQGA 1LHUA 5K0UA 2Y6KA 3R4UA 1D4VB 1MS0A 3AJZA 2WNUB 2CUEA 2EFPA 5JSPA 1WA6X 1AL23 2HPMA 2WB1A 4PFOA 4HG2A 2JDUA 4MXWB 2OF7A 3SMHA 2DO7A 1YQAA 3HRSA 4FXKB 2JG8C 4EV0A 1VBD3 4GKXA 2PHFA 1BEV2 3DKXA 4I7HA 3FXMA 1A8DA 5LBQA 1WMDA 1ZLKA 4JBAA 1OKOA 4BMBA 1VQ7I 4A3LJ 2ARCA 3ZPLA 1QHGA 1UX7A 1W2UA 3POBA 4RYDA 1OPOA 1Z3YA 2HEWF 1QU0A 2IZWA 2V4VA 3PLQA 5KHGA 1QJZA 1TVGA 3FXOA 2RDRA 2MLKA 3M07A 5E16A 5FZ1A 2X85A 1EPZA 3WW3A 3USUA 2C0ZA 2XC7A 1AR72 1ND3B 1KEXA 2A75A 4DNYA 2OV7A 4OZOA 3BG5A 5CJ9A 3DXTA 4E4DX 5JR2A 1RUG1 3LPFA 3S2DJ 1DZQA 2DUPA 5L3BA 2WINB 1E2XA 1XSQA 2BFUL 4F7ZA 2WO2A 1BQPA 4IPAA 4HNUA 2NVYJ 4AFBA 3J7YJ 3ZPYA 1DU3D 1IJWC 5LZ6A 2XUMA 5FZ0A 1MZEA 5LK7B 4FPOB 2HOEA 4OCTA 2EXIA 2FQPA 4ESFA 1U5ZA 3U1DA 1OFCX 1NT0A 1LJ7A 1V5EA 3I7DA 2R5YA 2QZ2A 2CGOA 3DCQA 3K77A 2DBNA 4Y22A 4M73A 3WU0A 4A6DA 1IUYA 5FMBA 4AG4A 4AVPA 5FPVA 3P1IA 2K7LA 5FZGA 1A6IA 2EXKA 3WDWA 3WNMA 2ZMLA 4D5FA 1KDMA 2HH9A 2X09A 4M4RA 3IAM2 2WV0A 1LNSA 3ON7A 3CP2A 3LE0A 2P8TA 1GQHA 2XONA 5J6XA 1YI9A 3DFGA 4KU8A 3GTMJ 4ESBA 2MEV3 3DECA 5CU1A 3K4NA 3SYTA 3H1WA 3OY9A 1O3TA 1W05A 1JZ4A 3KV4A 4CCEA 1BM9A 3A4UA 1R64A 1FC3A 1O4TA 3O2PE 2QQUA 4GIQA 5FPLA 1YHFA 1OQDA 1FSEA 1Y1VJ 3ETQA 4B4PA 1ZBE2 2XLFA 1QU3A 3LSTA 1UYYA 2VZPA 1MQTA 4Z92B 5A7QA 1Q43A 2ZNYA 2HBTA 1OUSA 3S1NJ 4YG0A 2LKPA 3H8UA 4UWDA 2DMTA 1E3HA 1X3UA 4GJYA 4Y1ZA 4E8CA 1JTZX 3I4IA 5ACA3 2HOSA 3KWVA 5LGTA 3ZYPA 4MGZE 1LHOA 3QWLA 2LD5A 3UV9A 3TAYA 3WCSA 1OLTA 1Z9CA 3ASNH 2BNNA 2SLIA 4XF1A 1VB4A 3HL2A 1AWCA 2DXIA 1RUE1 2DFIA 2JVHA 3VN4A 4XIOA 5B1AH 4E8DA 3SDBA 5F0CA 1JTXA 1GU3A 4XILA 1B35C 5IVVA 2ORXA 1W4MA 5LY2A 2WC2A 4LBOA 3LSRA 4QXBA 3HWJA 1W6MA 2WAQN 4JK1X 1PZ9A 1YRZA 3ZIXA 1EV7A 4JP0A 1ERDA 1CJDA 2NZ9A 4ZZ8A 3MIEA 1I6XA 2HLEA 3CC2I 2VNGA 4YW3A 4B47A 3F0CA 5DD4A 3BALA 4WZCA 3IIIA 1NUKA 1J2XA 3UESA 4MQVA 4CDQA 1ITYA 4LIUA 1H8TA 4O65A 1SPPA 4XKWA 5GTIC 3I2JA 2G7HA 1T95A 5FPUA 4BXXJ 4LMFA 1JUIA 2DYRH 2OJED 3CCVI 5FXVA 2BGCA 4HG6B 5FP8A 1MMNA 3I53A 5HS8A 4HKLA 5AVPA 3D5OA 1ODDA 4AHZA 5KCMA 1Z6TA 1UCRA 1K45A 2DVDA 4YIRX 2Y34A 2IW5A 3N9LA 5LA2A 2QQPA 2I07B 4ZC3A 2XVGA 1JKPC 3KZIC 3RKQA 1XYOA 1VQKI 2A3SA 5CQEA 3VOEA 1AXKA 5LCWL 2JDHA 3NJXA 1TQ5A 5HCHA 1PGW2 3QODA 2ETEA 4IEWA 3N9NA 1WLTA 1BR1A 2A6YA 3ZSEA 4CDGA 4XC9A 1U78A 4HLXA 3VWBA 2RR13 5C3PA 3SDGA 2Y2ZA 3S8PA 1HRV2 4QPGB 3OY8A 1K61A 1ST8A 2DT7B 4KT5C 3WUDA 5FFOC 3S32A 4KI5M 1JZ8A 1HV1A 3KP7A 1R092 1SFPA 3AZXA 4XBLA 3PDQA 4DRVA 5KHKA 3S17J 2HYXA 2YZ4A 5LEJA 5D2AA 5GAHJ 4AGRA 4B4RA 3RTRA 1WMEA 5L9RA 4D69A 3BY6A 1CPNA 2M9HA 1W2AX 2ARBA 1F35A 5DG1A 3A22A 4KBBA 3MFCA 4YG6A 4QHBA 3WP6A 1U5IA 2ZGNA 1AX2A 3GJBA 1IV6A 4G94A 2JA5J 1HQWA 1AYN2 1DQ2A 2RDSA 3OYEA 2V1UA 4EVIA 1NLSA 3NO8A 3VFZA 1Q1HA 2ZEXA 3AKPA 2CO5A 2WZR3 1MDMA 3PNYA 1IKPA 1YEWA 1UOBA 4BL0B 5J3LA 3LSPA 2ID3A 3NW4A 2M87A 1XXNA 2D3PA 3MLKA 4U36A 3ABLH 4IHVA 2OA4A 1JUSA 2EINH 4L2NA 4WK8F 3SITA 1WZ2A 4FPKA 2HWB1 5E20A 2OVUA 1IV8A 1RIOH 1UY1A 4CEYA 4IEVA 3W6JB 1WBLA 5JZGB 3LFIA 1E3OC 4ES8A 2ZFUA 3RJPA 3TW7A 5FYUA 2EPFA 4ENJA 5DXDA 5LD2C 1FOKA 3CJIB 4HKWA 1DYPA 4CDWB 4CDXC 2XAFA 1SAUA 3Q0UA 4IKFA 3VZKA 4D1QA 3VDDA 1KJLA 4PDWB 4RAYA 3ZX7A 4IV1A 4B44A 4FOWA 2KLOA 3C7OA 2ZGOA 2LYCA 2EIGA 2ZX2A 3THCA 1UU6A 4A7YA 2DT5A 2WN3A 5EEHA 5GALA 1BKZA 1F36A 2ERFA 4GH4C 4NPLA 2X1EA 1NZIA 4CSWA 4KWKA 2ILMA 2ZCWA 3IB3A 2WAQA 2FMLA 2Y0SN 3NJZA 4KDPA 3DYMA 3ZN6A 5L3FA 4COYA 3TKYA 4FQZA 1ZRFA 2LTPA 4G6QA 4D7YA 5IAXA 4JGZA 3KIOA 3BJOA 1LOFA 2VZOA 4HSJA 1VBA1 2GOXB 4EM1A 4A6SA 4XKVA 3QD6A 3JB8A 2K46A 3B3QE 3CUQB 3FBNB 1LKNA 1HIXA 3GDBA 2Y0IA 3CC7I 3KEOA 5H6QA 3POYA 3E1SA 1JGGA 4NAOA 2BVVA 4D0PA 4QSHA 1JZ7A 2WV1A 2LY9A 4XFGA 3ABUA 4P9UA 2WNVC 1H9TA 3OYHA 4PSXA 1O3RA 3BOWA 2CWEA 1SFUA 3CP8A 2WNUC 2F48A 1WSUA 4JVAA 4ZH4F 4AHYA 2R042 1ZLJA 5JHUA 3URFA 5F3EA 1VBC2 1Y4WA 4N7IA 4V2VA 5FKNA 1BOAA 1OYWA 2K02A 4MIMA 3VZLA 4GAZA 2CQQA 4WM7A 3OYBA 4A5MA 1SMYF 5A6QA 3RZJA 2AGSA 5IOYA 3LAPA 4D94A 5B4XA 4GFBA 3M7GA 4KG0A 2HKOA 3ZXFA 3GTPJ 2YX4A 5GZDA 3VZMA 2XGCA 1XJAA 1Y0NA 4N9IA 2DBBA 1POV3 1KU9A 4Y15A 5B1BH 3VDCA 2H0VA 2RM23 3KPHA 2VBDA 1SVLA 2BFUS 2FX0A 2R1DA 2VJIA 4QX5A 4FPHA 5DN2A 4Y33A 2FSWA 1UAAA 3K10A 2B9VA 3RQ4A 1KXGA 4RHV1 1GWMA 1ND3C 1NXD1 2BZDA 2VECA 4B3AA 4QKDA 4EN6B 2B45X 1Z1DA 3H3VK 2M1BA 5J8FA 1PGSA 1IPKA 4B8EA 2JDNA 3CZJA 4YLZA 5EGOA 4HLTA 3PNAA 1HF0A 4TLGA 1FX7A 3KZZA 4FX4A 4P02B 1YS6A 2CQKA 1BBT2 4HX8A 1PIV1 4FOYA 2K9ZA 3F23A 1RZ4A 2JB4A 4B7KA 3GXUA 1T08B 2NS8A 3PIPF 2WBKA 3LEGA 5L9VA 1ENSA 5FR3A 1V6KA 4L5JA 4TN7A 1SBDA 4FTBA 2XGXA 3WDVA 3L2HA 1K5MA 1D0XA 1NG0A 3W20A 1C57A 1TE1B 5IOZA 3OL4A 3VKLA 1LGBA 1YFHA 2Z9OA 6PAXA 1X4PA 1UMZA 1OVSA 2FDGA 4JHZA 4Z07A 4LGWA 4ZU7A 4YM3A 2VZRA 3TGNA 2YG0A 3INAA 5FWJA 4TTGA 2WSUA 1GV2A 4M72A 3RPQA 1BOBA 2YBKA 5T5PA 3K1PA 3ZP5A 3X29B 4JDMA 1YJKA 3RSJA 5I8YA 1ZR2A 4ZTJA 3SH5A 3ZYRA 5FPBA 2PA7A 4UFHA 2MHFA 4IGPA 1VRH1 4JCKA 4EJWA 3NV3A 3E3VA 1ETYA 1UZCA 1MS5A 5IYYA 2Y0SA 3U4SA 4A3BJ 1USTA 2VMFA 4FTHA 4KISA 4JC1A 3JD72 2K9LA 4IEPA 4Y3OA 3FE5A 4XQ4A 4KYWA 2ARXA 2XAGA 1GZTA 4B7EA 2ZKZA 4QQLA 2PMUA 2HXIA 2GC1A 4LO4B 3H0DA 4FFHA 4HVRA 2ZGQA 1WHUA 4CZCA 1FBQA 1RUC1 2JPBA 1BIAA 3JRAA 1YIFA 3SKJE 4XHXA 2HWC3 1UJ8A 3LFUA 1GP4A 4YFXF 1S4CA 4OIRF 5FAXA 1NCQC 4XN3A 1R5GA 3I2IA 5DAVA 5L9BA 3N7KA 4RGSA 4QX3A 3DTEA 3HZJA 4WVMB 3T1MA 1OA2A 3ZRGA 3FFZA 4QDSA 2I2SA 3ASOH 4MVTA 4U2AA 4HW0A 1AR62 4RB1A 4QPQA 3IN9A 3QU6A 5C5UA 2WS92 1RB8G 4A2UA 4GWJA 4QWQA 3SCHA 3GVAA 1J3PA 4DGWB 2QBYA 4A44A 2ZGMA 2ZGSA 1F5FA 2FXAA 2WAEA 2Y0MA 1ZH5A 2WO3A 4PBPA 5J48A 4A3XA 3E1F1 3KB5A 3CUOA 4OMZA 2DT6A 3ST7A 1L3LA 5FPXA 3NWKA 1ETXA 3D8CA 2FEZA 2QCSB 2X5IA 5C4XJ 5HNFA 1AR71 1WPKA 1X3WB 1F31A 1UYXA 3MICA 1PVXA 1FZPB 1F1ZA 2JDAA 1XPWA 1F4KA 2VQTA 1UMQA 5F2WA 2FDFA 2Z16A 3I5UA 2TEPA 3WQ1A 3WNKA 3ZFEA 5FOBB 1FPN3 1CR7A 3FLTA 3C7HA 1FI2A 3OS0A 3WTSC 4E2QA 1CX4A 5FXZA 2YPRA 1HKTA 4WM8C 3SEZA 2O7OA 1ORKA 4A42A 1AL22 2ZGRA 2FBKA 3K7AJ 1M06G 4CXYA 5DDGA 3T8TA 4QPGC 5I8SA 1RPWA 3BG6A 2ZJ2A 1W9YA 4HETA 3OS1A 1SEUA 2GH2A 1LDJA 1OA3A 2X1CA 4XQWA 1FIPA 2IP2A 4LBKA 1VBD2 2VR4A 5FD5A 4K6BA 1C0WA 2VZ1A 1GANA 5DCFA 2DV9A 5A33A 4YVSB 2ZXWH 5E6HA 2YROA 4LPLA 4KL1A 3HDDA 3ZDVA 2E36A 2YDEA 5IK7A 2XVLA 1YQ8A 3AP5A 3OGSA 3CF5F 4NC6A 4IRGA 4FP2A 4LBQD 1SFKA 2WRAA 4LOCA 2BNMA 1B8IA 2HWD3 5A7WA 1HJFA 4EWEA 4L8QA 3LSDA 1JHHA 4PJLA 2D6OX 2VE1A 4HEA2 2BVMA 3A01B 3BTZA 3BKZA 3VSKA 5LLQA 1GP6A 1XNBA 3H9AA 4IV3B 4ZZLA 3ZOBA 3V8LA 4B8XA 4O7XA 3IV5A 1MS8A 2BEOA 3OGJA 3WQ7A 5BPXA 4CYCA 3V4GA 4H14A 2E7XA 5JSRA 4XSZF 4LG0A 2X05A 4U88A 4I98B 5A6YA 3TO9A 5JZGC 2L0KA 4AYBN 2XJPA 1TWCJ 2XB5A 4A41A 3K2ZA 5KHIA 3R0RA 4QB6A 1H1MA 4C90A 4CDWC 3DEEA 4HF1A 5FUNA 4PDWC 3Q0WA 4M4PA 5HLHA 1UU5A 4ZYAA 4YVWB 2EA2A 3VL9A 2AACA 2Q2EA 5FDBA 2F4MB 4XYXA 1RINA 1UXXX 2EJRA 2XWBB 4RGXA 1W5TA 4ON0A 4LK6A 5E79C 2Y30A 1V70A 4EQQA 1RESA 5LBEA 3WD5A 2DVAA 5D21A 2FQ4A 4A3JJ 5BNNA 2LDUA 2VUCA 4MHGA 2DFCA 5FQ0B 2MEV2 4E4ZA 1F43A 2ZSHB 5F1JA 3CKHA 4MEXF 3NJVA 2F5CA 1JUHA 2ZHMA 4MTDA 1IXSB 2H27A 3S1QJ 1I9RA 3Q8EA 1R1A1 2HR3A 2XRNA 4E2SA 3GNEA 4E7ZA 1R36A 2OTLI 3WGHA 3K4DA 4G9SB 3CUQC 1PMJX 1S7OA 2HGCA 3O6BB 3L2WA 4D8MA 5CFCA 5GPAA 3K4MA 4RAFA 4Y13A 2EXHA 4BEHA 3I3DA 4S05A 3N9OA 1LTEA 1OCZH 2W9XA 1EAH1 3D82A 1WCUA 2R7FA 4Y20A 1Y8QB 4P14A 2QBXA 2ICWG 2QQMA 1PGW1 5FZCA 4X8NA 3U0ZA 2ZABA 3IKVA 5DQ0A 2HZTA 4KBZA 1QOSA 3GZEA 4FPLA 1F9KA 1MVEA 2X1DA 5J98B 5FY5A 1RVF2 2VNOA 5C8WA 2EK5A 1MBJA 1R6RA 1JYXA 2IXJA 4IESA 4Q8LA 5F0FA 1QIQA 1DZRA 3EO6A 1PHMA 3HMYA 4P1WA 3SCFA 4BDZA 5JI7A 5GKAC 2VVEA 1HKDA 3PM1A 1H4HA 2CG4A 1R58A 5IVEA 5IT9K 3J7MA 3WG4A 4IZZA 2FCUA 4JKKA 2XBO3 1P9QC 1HC8A 5J47A 1SFXA 2NYXA 5T5OA 4QPIA 2ZKLA 4NE9A 2DYSH 4QD2A 3S1RJ 2PQSA 3CJXA 5T55A 5IAVA 5KHJA 3I71A 3UKTA 3ZMTA 1S2KA 3T0AA 4FX0A 1ZZ7A 2CAVA 1XSVA 4XXAA 4OUMA 3PUFA 5C71A 3LAGA 1DYOA 1UKGA 2JWTA 4RQPA 4N4NB 1S72I 1WI9A 2EIDA 5E8IA 3OD0A 2TUNA 2D45A 1Z3XA 1JOBA 3E5QA 1SD6A 1N1VA 2NLRA 3ZYBA 2R0QC 4EJOA 1ALYA 4XUQA 3RZHA 1UX6A 2QJVA 3CTAA 2DUQA 2DOAA 1RUD3 1U8RA 2VL8A 1OF4A 3KEYA 4PF1A 1OT5A 3FHQA 3H5NA 3AL5A 1X8MA 1XSXA 3JTGA 1QNWA 4LBMA 4AYBA 1COV3 3DU6A 3SZTA 1WH5A 5F8PA 1ZG1A 4FE4A 3ZXGA 5A6ZA 4BJ5C 4IL7A 2ZBJA 1JYIA 2EBIA 2ZGUA 3W21A 5H9RA 5F39A 1IF1A 4Y1VA 5C8CB 4QMAA 3HTSB 1AU7A 1YQ2A 3CIHA 3BPVA 4UUTA 3RQIA 1HRI3 2TCTA 1ZZCA 2X9DA 2D6PA 2VLAA 3HBKA 1AKHA 4XJUA 1R1ZA 1XYNA 1YNAA 5D5VB 2FJ1A 4M71A 2W39A 2R7VA 5LHGA 2R32A 4YM1A 5FY1A 5D8AB 4N53B 1APLC 2JEMA 1XDSA 1HXS3 1OKQA 3WHCA 2WZR2 1NG7A 3L2VA 2KPMA 3WU2C 1VQ5I 2D3RA 1WVRA 2VKDA 1R22A 2IXKA 1W28A 3UNGC 1J09A 3OBRA 4BISA 1CESA 1F5JA 3AFHA 4NJ4A 4O3MA 2HQNA 2MLGA 5FJKA 4BBRJ 1V6MA 4NRQA 2C9KA 1PVC1 1QRYA 3F6OA 5F32A 1W0NA 5L7OC 4HPQA 1HSTA 1YX5A 2CAUA 1YQ6A 3ILRA 3KYCB 3BIWE 3RFRA 1OQYA 2GH8A 3PIGA 4XFFA 2YSRA 3ABKH 4AM3A 5C9AB 5SV5A 2R041 2F2EA 2OCEA 3H3UA 2EFWA 1VBC1 3Q5FA 2W00A 1ZBA3 2XG3A 3AFKA 3G7DA 4Z8BA 3L9JT 3ENRA 3BOQA 4E7JA 2LC2A 4MH0E 2DA1A 2Y33A 4HRIA 3NWSA 2M5WA 2MSYA 5DAQA 3R4SA 3BCWA 2HOAA 2Y26A 5HCBA 1W99A 4XR6A 4UW6A 2G9WA 5DAPA 5A1AA 1RUF3 2PBIA 2QUFA 1UD1A 4YRDA 1XD7A 4XLAA 2K40A 3ZXLA 1UOFA 3FM3A 4LKEA 3KV9A 4BQWA 3OUJA 1ULGA 1VQOI 2NMOA 3FUOA 4XM3A 2C9AA 4XUPA 4MGSA 4XJZA 4EJTA 3UR3C 1KQRA 2KR2A 3NWTA 3H35A 5EJ3A 1G3YA 3OIOA 2KIQA 3H5RA 4XF9A 1STMA 4AFCA 1WBFA 3ZYFA 1X1DA 2FDHA 1U5TC 4OINF 4D7MA 3POFA 1XTAA 2HWF1 1QHHD 4RR3A 2M4GA 2B7YA 4COUA 5D6FA 3GTQJ 2HFHA 2PI0A 2NN8A 1W9FA 4YZ3A 3NV1A 1FV2A 2PJPA 4BOWA 5FZ3A 4DINB 2GC0A 2HWE3 1TNTA 3LQRA 2J1EA 1FV3A 1KGSA 3L00A 1Z67A 4DOZA 2P81A 4L9TA 4XZPA 4ZTFA 4HBNA 5FYVA 3ZSKA 3PUIA 1S3JA 4QDQA 1KYZA 2KM2A 1TWAJ 5K5QA 2Q4SA 2K3FA 3LWFA 4II2A 3G1MA 4CPBA 5IHRA 1LU1A 4XFBA 5C7GA 1W7PD 3KV5A 5ERLA 1JYWA 1VMFA 2RM22 3AP7A 3A0NA 5IK5A 4AVAA 4L0YB 3FMGA 1FYUA 1GMMA 2OPWA 1W06A 1KQ8A 2KDOA 2ZSIB 4ZYDA 2JDKA 4PJ0C 4YFKF 3KZYA 2DU1A 1VTNC 2P3YA 3BZ6A 3JD71 1LOCA 3ILNA 1WW4A 2E6VA 1TC3C 2G1MA 1SVOA 5IVYA 1KONA 3OIPA 4E2GA 3BDDA 1UWWA 1GT0C 1MPXA 1GBGA 4AFMA 4K8FA 1G3SA 1OISA 4H4KC 4CXFA 1IS3A 1VQ8I 1OLRA 3FBMA 5L73A 1BR2A 4UB8C 3AYEA 1KFUL 1E5HA 3D6EA 2JB8A 4ZONA 3IKTA 1MSEC 4AWDA 1GVJA 3COAC 3CQOA 3MQ0A 1FTTA 4YVWC 1R00A 4Q29A 4HPKA 1LEMA 3LEKA 2WA4A 3B7MA 4XLPF 4FXGB 4FPEA 2LF7A 2C26A 3LSMA 3O1TA 1IW7F 3ACGA 2E5ZA 3KLSA 2R0HA 3QQAA 5IK4A 2OXBA 5FP3A 1BC7C 3OYAA 3F72A 3ZYJB 4ZDOA 1DGWX 4JTOA 2CDOA 1KS4A 1IPSA 1LGCA 3K1MA 2QQOA 4XK4A 3KGZA 2E71A 3HQXA 4YZ2A 4XONA 3P3PA 1XPXA 3BJ6A 1K6OA 3DKQA 2NVQJ 4D7TA 4PBOA 5BPDA 5DAXA 4E27A 3Q8CA 1AR81 2DJIA 1W9SA 2VM9A 5GLWA 1WWYA 3ESWB 5ICFA 4KMQA 1WA4A 1VMHA 1KD7A 4C3JJ 4QX7A 2UWMA 3DPRA 2PJRB 3V7RA 3MIFA 4YARA 3V0BA 3W2WA 3ULQB 2AYHA 4E7HA 4RFRB 1W8OA 2WAAA 3BQYA 2FBIA 4D7NA 2HWC2 5JMCA 2D43A 3FXKA 1D4M3 1TLHB 1MH3A 1WD3A 2YU1A 4QWNA 4QDRA 1B35A 1YCIA 2JKXA 2XL9A 3DEUA 3JREA 5FZFA 2EV6A 4TXWA 3J7HA 3B9CA 1AL21 3WDUA 3OYFA 4KU7A 2FZ2A 2ZGKA 3MCZA 2QM3A 4BACA 4X8PA 4YSFA 2F4IA 4AAXA 1AL0G 2P6HA 1E17A 3VDAA 4ASMB 2YFUA 4WXHA 4HOBA 1RUH3 3LFMA 2BOJA 3BGAA 5DTDA 3DN7A 3S5QA 2ADUA 1HB4A 2GDFA 3APBA 5BYNA 2M0MA 4BH9A 4PK4A 1FNZA 4XLEA 4R9AA 3OG2A 3HSRA 1IN8A 3AMMA 1Z91A 3KE2A 2VE8A 3KVBA 1TME3 1S0GA 2PHWA 4KWJA 1JHFA 3GF6A 1ND2A 2QKMB 1SQ4A 2VI6A 2CS3A 1JOJA 3ZFFB 2RDQA 3AAFA 1E5RA 1UNBA 2W82A 4AVTA 5AFBA 2DMNA 3FISA 4BJ6C 4OI1A 3QYBA 1ETKA 1GOHA 4AHWA 1W8NA 5KXBA 1X9TA 1J58A 2QLZA 4G3YC 1D1CA 5ERIA 1SD5A 2K9MA 4ABZA 1O5UA 4DQAA 2ZMEA 4M3FA 3H8RA 1FPN2 3JRIA 2MABA 5JCTA 2HBUA 4XRSA 4PGHA 2X8KA 2DF7A 4EEFG 4ZZ5A 3POSA 4FETA 2CU5A 1IDZA 2J1VA 4ITVA 2EIKH 1W8ZA 3V65A 3OF1A 4CDQC 3P9IA 1TNRA 3AXEA 4IL6C 1H8TC 1VBE3 2WIIB 4WV8A 4AI0A 5IYDJ 4QTRA 3K1NA 4CYDA 4BNCA 1MMSA 2NPIA 1VPHA 3PJRA 1J1TA 4EYUA 1GICA 4IEUA 2HDWA 5C8CC 5FZ8A 4K21A 3D4KA 3USSA 2ZO4A 5HV4A 3QPLA 1VLNA 3UJQA 1Q1VA 3UETA 1RL3A 4O9EA 1RC6A 3HRMA 1J3RA 5LK5A 5IJRA 5D8AC 2MEV1 3UYJA 1HW1A 2VZTA 2PLV3 2HWD2 2YUSA 3H7JA 3NL1A 4TWTA 4KT6A 4UUSB 3HRUA 4A3CJ 2HDDA 2VXJA 4ESJA 4MOAA 3O1RA 3N7LA 4TLFA 2QSGX 5HPOA 5C3OA 4Q0PA 1C1LA 4HZFA 2A6XA 2LP0A 3J80Z 5GZCA 4BXSV 2MD0A 2DCZA 2XVCA 2F5DA 3BTYA 4RGAA 2IXSA 5LB6A 3KD4A 3H92A 5CKMA 4RDUA 2DMUA 3ASIA 2RDPA 4NQWA 2E51A 3MV01 1ZG3A 2EZLA 3VD9A 4COZA 2XF5A 3J4UH 1Y1WJ 2EILH 3THTA 3B93A 2OBPA 3AMPA 4CDXA 5C9AC 1KS5A 4L5EA 2UZKA 1W5SA 2NP0A 4CDUB 1RVF1 1LR5A 3KT4A 3ZQCA 3GX4X 1KITA 2OUMA 2A68F 1UN1A 2VZVA 5APAA 2QQ9A 4P5OA 1WMFA 3BI3A 1W03A 4BXFA 2Y6GA 3TEWA 3LF7A 1WCMJ 2AXLA 1U9NA 3HJEA 4C2TA 5EG0B 3CLOA 4G9YA 3PVBB 1W0UA 2GZWA 3L7WA 1O8SA 2OZJA 2XPWA 3LD8A 3W5NA 1RUJ3 1CAXA 1LODA 2DWRA 2Z4FA 4IHWA 2FD5A 3UGFA 4HSRA 3IPVA 2BY1A 2HYKA 2XVKA 4XIDA 2AXTC 1W8TA 2QWWA 3EMRA 2FRHA 4IV1C 2ZX1A 1MBHA 1UIJA 1XGOA 3KP5A 4RGUA 5K1YA 4F91B 1OQ1A 4FVVA 4IOCF 4OFGA 1UCXA 3SKVA 3CZ6A 3PFIA 4KN4X 3ZSMA 4GCVA 1OHFA 3MPBA 2BXYA 2O8KA 2BTVC 1U8BA 2GA1A 1C5HA 2FD8A 2WNUA 3KV6A 4DIQA 3M4OJ 3IM0A 2XUEA 3KMHA 5BNPB 5JXIA 3ZYGA 4OWRB 1D2SA 4MXWA 2E1NA 1IC8A 4AFDA 4UUVA 1H2MA 5IP7J 2YUEA 4A6OA 3O1OA 5A7OA 3PSFA 4YM0A 4JGZC 1K79A 1OC1A 5FZ9A 1Z0HA 1QJY3 4G7HF 4BDVB 1JBCA 3ABMH 2RMU1 1P2FA 2V6CA 1AXYA 1YE9A 4BWOA 5GM0A 3VBRB 1PO13 1OLMA 1FMD1 2HWVA 2VODA 2XBO2 2R7TA 5D5UB 4MSVA 2JIGA 4BZ4A 3MW4A 2CRGA 3V7CA 3WF2A 2CH0A 2EAAA 2WTEA 4XFCA 1ZG5A 1ND3A 2W48A 5TRDA 3AK0A 5E3LA 2XV4S 1ZZ6A 5D8LB 1PNFA 4HMZA 2E2HJ 2WZR1 2B9UA 4RS8A 3DBLB 4F83A 5F04A 1ETQA 3NQHA 3WEZA 1VF9A 2OZ6A 1TL8A 2WLQA 2D44A 4WM7C 3UKVA 4AQSA 2VCCA 1ZX5A 4A69C 5L19A 4RLFA 4GMP3 1W6OB 3AM2A 2ADDA 2GXBA 1OR7A 1IGNA 1RUD2 4XFIA 4LTAA 3CCYA 4TZDA 4LBNA 4G7ZF 4G6TB 4W6XA 1Y9MA 2ETHA 3WG3A 4I0AA 4DMIA 3MUY1 1YW7A 2BRTA 4D0QA 1ACIA 1COV2 2W7NA 4NNJA 2OYZA 4EMSA 1ODMA 4GKYA 1OPCA 4QGNA 3LQCA 4AI9A 3E6MA 3OYIA 3DQVC 4JX6A 3H1MA 3RVHA 3HQUA 2H1KA 1CZSA 3K2AA 1US3A 1WW5A 1SDDB 5IPAA 3OGGA 2ISYA 4M3BA 1QQP3 1HRI2 1UZYA 5DABA 4M9XA 5T3NA 4CCCA 2OUHA 1G4DA 3H42B 2J42A 1WZXA 3VGIA 4G7OF 3M1HA 4DBQA 2GP5A 2WNOA 1GXQA 2OCCH 3SZPA 2IXHA 3AYAA 3TDUC 2E35A 2XKPA 1VBB3 1HXS2 3CF6E 4LBQB 1OH4A 2CTVA 3HSEA 4C1XA 3KLOA 1DLCA 3ZLIA 4K1YA 5GLZA 4WXDA 3HOZJ 4EJRA 1HQLA 3AFGA 1GUUA 4F3JA 1K5MC 2W84A 4IEQA 4QKNA 1DQ4A 2HEOA 1LPQA 3VHOA 3ZN4A 5FTTC 3N7JA 4YW1A 3VYTB 4ZU4A 3V64A 3K48A 1REDA 3HN3A 2ELJA 2A6TA 1N25A 2R7EB 3MKWB 2R16A 2VTXJ 1GNYA 4U0WA 4B1RA 3ACFA 2XQXA 3SHRA 4RAZA 1ZBA2 4DY3A 2MH2A 2AQFA 4P5YA 1NK2P 3WG9A 3TN93 4BU2A 3DLLF 4BMEA 5E1RA 4P55A 3PJYA 1UG2A 3W6VA 3DTIA 2FCTA 3B73A 4XEZA 5IK8A 1EH6A 1R49A 1RUF2 3ZO0B 3S2HJ 1ULDA 1AA7A 1R4NB 2HYGD 1POV1 2VE9A 4S04A 4JKMA 2DMPA 2XGEA 3IH2A 4BQQA 2RM21 3G4SI 3E0JB 4XICA 1QEXA 4NHYA 3GBWA 2UWBA 2V1DA 3TO6A 3TOBA 5KC6A 3ZFFC 2L4AA 2FHRA 2OZUA 1JGSA 4NO4A 4W1UA 5FBZA 2CYYA 4UVBA 1YRNB 3JRDA 3M3EA 4WCGA 1T2KA 5BV6A 4RS5B 4I6ZA 2VZUA 2M3AA 2V6EA 4XDPA 2XAUA 2W1SA 4H7MA 3PQJA 5JDBA 1JMUB 3WCRA 2LOOA 4AI8A 1Y8RB 1DCSA 5FYTA 2FNAA 2R92J 4ISQA 4LLLA 1S1AA 1BJQA 2ZFWA 5FOJB 1HN0A 1VE0A 4Y1UA 3IUOA 3FBIB 5EQUA 4QPGA 1IPJA 4MFEA 5BNGA 5KXCA 3T0YA 1C8M1 1W9TA 3AYDA 3H7YA 3CD6I 3KSCA 3S3NA 3H3LA 5D5XB 5TJJA 1SLIA 2VKVA 3FX3A 1NA1B 4LITA 3ETPA 4XCBA 5C44J 1JYVA 1BN5A 2ZJPF 1ZN2A 2XJQA 2IA0A 5FWEA 3IDCB 2ZJCA 2W46A 3HOBA 1B72B 4KMFA 2JG9B 3D0JA 3ZSJA 3LSGA 2JMWA 5HDGA 1UB9A 1WJAA 2NNNA 5FZMA 4Q0SA 1SVMA 1GV9A 5F6LB 4YFNF 4RM2A 5F08A 2G0EA 1Z7S1 1PP8F 4UF0B 1E57A 4NHXA 1W2OA 3GM8A 1CIYA 1CAVB 1XB9A 4KG8A 4QXHA 2AZ5A 3K6GA 4F52A 1LOAA 1QDOA 5C33A 5H9PA 2RC4A 4YW6A 2XF7A 2OX0A 4YW2A 2Q30A 3SFZA 1BBYA 5FKMA 4OLLA 1JXNA 5JZGA 5FLIA 1EV13 3HPHA 3ME2A 4FT8A 2UURA 3CJIA 5DUXA 4CDWA 3LDKA 4K2EA 3FHNA 3A03A 2E2IJ 4PDWA 3MDPA 1UF2C 3ZGKA 3K4BA 3C3WA 4NAMA 3LDRA 3MVPA 5F7UA 4M9SA 3VBOB 2ADEA 2BBVA 4PJNA 4CCNA 2BNOA 4R79A 4S0HB 1LEDA 2P4EA 3BWGA 1B4AA 3DEWA 1BA5A 3G73A 3LA2A 1KZHA 4IERA 1VQPI 4LLNA 1LFPA 2JWPA 2Y48A 2KXLA 2WSVA 4S2GA 2JK3A 5L3GA 1O7FA 4B48A 2XB6C 4IQPA 4MZUA 5J8CA 5GP9A 4Q48A 1OXCA 4DUWA 1PX4A 5DZGA 3CMGA 1ONVA 3L09A 1TMF1 3VKFC 1GNHA 1L0OC 3HB9A 4XBQA 4I30A 2FQ3A 3CUQA 1V55H 4NIDA 4FOQA 1DU0A 3HR9A 1V9U1 1LECA 1S55A 4U0YA 2R49A 1W90A 2E1CA 4KIFA 2BPA2 3QYFA 3J81Z 3K70D 3IKWA 5ABJB 2YYOA 2X51A 4B29A 2C6YA 2B7EA 1FPN1 4NOTA 5E18F 5A7NA 4KH9A 2AS5F 1I5ZA 4Y7NJ 1MR5A 2QVOA 2ZHKA 1D4M2 2W1WA 2WUHA 4X6QB 3CESA 3K4AA 4LFUA 2BP6A 5BNNC 2CW0F 4PT6A 3U07A 2Y31A 1H1AA 3NKTA 2RV8A 3RJRA 1MZ6A 2CDPA 4CU8A 3ZQLA 2E19A 1J9IA 2L2OA 1ZRCA 2CJJA 4ZY9A 3HOTA 3GFJA 4L92A 3DV8A 4K1ZA 2EXJA 1RUH2 2EVXA 1Z77A 2WZ8A 2LREA 1XNTA 4Q0VA 3HPGA 2DVBA 5CFCC 5LRSA 3MN2A 3POIA 3A0HC 2VQ0A 3AB0A 5I0RA 1D0HA 3GLXA 2G4IA 1CWPA 2VXRA 5KXDA 1PYVA 5E8AA 4YIIA 2Y6JA 4XUOA 2CV6A 1XSRA 4CVUA 2LMDA 4I2OA 2VD7A 2GOMA 1TME2 3ABTA 2HWD1 3FWEA 1BI1A 5CNAA 2EA4A 2Q1FA 1TNFA 1M1EB 2M8EA 5BNOB 2F6BA 5A32B 5EV7A 1SLTA 2DODA 1YUDA 4XQFA 2W4SA 2TBVA 2OQ7A 4W50A 1O6UA 3QCWA 2JICA 2PQ8A 3DXUA 4IW3A 1R5ID 4ZXEA 1S0BA 3KCXA 5FY7A 2XMLA 4YGEA 2C5DA 4WZFA 2OPKA 3BTXA 1Q3EA 2CSOA 3SC7X 3OOXA 3HOYJ 5FCCA 3HHHA 3RZKA 3I0TA 4HLYA 1G8XA 4BB3A 2NXNB 3JBG3 1RUE3 3OYLA 1V6OA 3BROA 4KGGA 2GP3A 4LO6B 2Z42A 5LA1A 3BG3A 4X1EA 5IFPA 4AOCA 2PN5A 3MGUA 1VBE2 3N7MA 4QPIC 4XACA 2EAKA 4E7LA 4QX0A 5IVFA 2PMZN 2P37A 1UZVA 2F6CA 4YFZA 4LB6B 3WP3A 4AQ6A 2H8WA 1ON2A 4CCDA 1OOPB 3A0KA 1RNLA 5CKTA 2NS0A 3HKZN 1BI0A 4HSTA 4BAYA 1DYKA 1GNZA 5FYSA 5A1LA 3DXJF 3SZGA 1J84A 4LHKA 4PGGA 5LA0A 1RUNA 2VOKA 1CAUB 3WP5A 1ZKGA 4NPMA 3GTLJ 4DNCA 2PLV2 5T54A 2W5FA 5LBBA 1W7PB 4HL0A 3HC7A 2WFF3 3NNMA 3CBNA 3LSHA 2QDRA 1ZZBA 3P5JA 4Q4Y2 2VOXA 1H9PA 3L9FA 1LJ9A 1OF3A 2F4LA 4C2MJ 2HYFA 4EATA 4XCAA 4RLQA 5FJ8J 1R7JA 3PO3J 4HANA 1H0BA 1TNSA 1YYVA 4JOMA 1NG6A 3MI8A 3ZFGB 1Y3TA 3MZ8A 2CUZA 3SEPA 4XOPA 4JDNA 3NAPB 3QPHA 4OHXA 2WKKA 3DPTA 1QOOA 2VL4A 1IG3A 3HHGA 4A3MJ 3KS7A 4JRAA 5LA9A 2VT3A 3T1LA 2HDCA 5FROA 4R4XA 3VBSB 4WVMA 5F5IA 3OTFA 2B46X 3GBGA 1TZOA 4V2WA 1JUPA 1OA4A 1CN1A 3QLQA 1J5YA 3VYRB 1AYM3 1DGWY 1SFOJ 2DA5A 3J7ZI 1IG7A 3H3ZA 2JDMA 2RGVA 2X6YA 4GULA 1LULA 2L54A 3BR2A 3JU9A 4BK5A 1MIJA 3N97A 1X82A 2P17A 2BZTA 3D5LA 3TOAA 1RUJ2 1S0EA 1A34A 4XMAA 3PL8A 5J40A 1DP3A 1IQAA 2RHPA 1SDWA 3NRUA 3OD4A 4UFMA 4BQ3A 4JV4A 3RKXA 4AFAA 3AL0C 3ROUA 3CJTB 1VRBA 4AEDB 2Z99A 1BHGA 4RS5C 3KCYA 4IE5A 2ZJQF 5GPCA 1TG7A 1JTYA 3CMAI 4AR2A 4LUKA 1PM4A 1GSLA 1Q8SA 5EJZB 4KN7X 4ANJA 2XROA 1XX5A 4R1HA 2BERA 2AHQA 1A5JA 1A04A 1PGL2 5CADA 4YRVA 2RQPA 2JIJA 1CVNA 2Q0AA 1RUD1 2XR4A 1P7IA 2QQBA 2SBAA 2YB7A 3VBHB 2O8XA 4PQ9A 3H50A 4XLNF 2TDXA 3QH6A 4HF0A 3GZTB 3GJAA 4L97A 5CFDB 3B02A 1COV1 3EHKA 5BY5A 2OTJI 5ILSA 2RN7A 1VMJA 3B00A 2E1OA 1QJY2 1OSGA 1YXWA 4YVSA 3RZDJ 2UXXA 5DEQA 1WGXA 3TNPB 1P4XA 2R7RA 4XFHA 3C1DA 2L9LA 4JZRA 4LBJA 2LFBA 2PMZA 4G6DA 2W0XA 3FMSA 4GWIA 1PO12 3ZQQA 2JG9C 3MIGA 4QX2A 1DDNA 2RJKA 3WHTA 1IHMA 5DCMB 2C4XA 5LWBA 2FA5A 2O03A 2M4KA 3OS2A 2BUKA 2L5QA 4A0ZA 4R4ZA 2E7QA 3ZDSA 4LHSA 1CZVA 3HKZA 3JQWA 4RR3C 3PHMA 1I3AA 3ZKUA 2CQNA 2MG4A 3Q8FA 2G9ZA 5EYRA 2DA4A 3TEYA 1L3JA 3I2HA 4Q4ZF 2HOTA 3A01A 1HXS1 5KNLA 4QGMA 1VBA3 4IV3A 2BVLA 2M45A 4A45A 4HQMA 3HOSA 1W6NB 3HAGA 4H2AA 4DY5A 1D2QA 4U87A 3H8XA 5G04L 1BC8C 1ACCA 2IRFG 1RUI1 1T2XA 4KWUA 1I39A 4Z6YA 3L2QA 3LOBA 1GV5A 1H9GA 3O5SA 1QJU3 2R063 1NYWA 2ZPXA 3MKZA 2D6MA 3I55I 5HI0A 1FNNA 5J1RA 3MD2A 5D1IA 5JXJA 5L36A 1URXA 4YM2A 3V8JA 1O59A 1Z6RA 4YVWA 1OH3A 4AQ2A 1ZTRA 3C2UA 1LOBA 2CQ7A 4A7KA 2BDRA 5ICGA 2ZACA 3J7NA 4LOTA 3K51A 4D7SA 1WJFA 1QHDA 1XRUA 4A0YA 9ANTA 1Y39A 1CPMA 2VG9A 3VBFB 4CA0A 5B3SH 2WYSA 4A7ZA 3BTIA 4U7BA 3A0BC 1L7LA 1YTYA 1QQP2 1JJ8C 2IBDA 3KX2A 5T52A 3KQ4B 5FQ0A 3ERMA 2XJVA 2FZ1A 1RUF1 2DQLA 2K9SA 1C8NA 1BMV2 3M1EA 3VD3A 4PCQA 2EALA 1MBEA 5F3CA 1WUVA 3AG3H 1LEBA 1YJWI 1CX1A 1FYKA 4MLOA 1NCRB 4CU6A 3JSPA 2BBAA 2E33A 1VBB2 3C7EA 4RHV3 1JXSA 4II3A 4AZZA 2PEXA 4QPOA 1MMAA 3BU0A 5EEGA 3WTVC 1FX5A 2L9NA 2BBYA 4UOJA 3FXRA 5BPIA 1VI0A 4CRQA 4UV9A 3QPTA 1GZWB 4P00B 4RGKA 3K9TA 3LSEA 3I3LA 2VQUA 2DTRA 4EJVA 3AKRA 3BZKA 4FHTA 1ENQA 2QQVA 4HK9A 3SJMA 4YGBA 3S7IA 3HBZA 1WCKA 4AVSA 2KMUA 2ORZA 1IAWA 3Q8AA 4AK3A 1PIV3 1VQ6I 3GFIA 4D3WA 3HEIA 3WF0A 3GEZA 2FDKA 2L01A 2D98A 4SBVA 2Y75A 2Q8EA 3VLBB 4CP9B 2E63A 4UVCA 2R93J 2L9RA 3U4XA 3FHZA 5CVJA 4O6JA 2MYSA 2DDUA 1HB2A 3TN92 4META 1QZYA 1D8KA 1Y6IA 3J7LA 3W2AA 2VOVA 4LLFA 1NK3P 1R23A 1XNDA 5GLTA 2HZDA 3Q3SA 5E88A 1KQ0A 1PDNC 1GP5A 2JA2A 2A61A 2KZGA 1JW6A 4IE7A 1Q8PA 2YC0A 2DFFA 4YPJA 4NHKA 2DTZA 5IYCJ 2MC4A 4BQ2A 3DPRC 3NNLA 1O3QA 3LQQA 4ZJZA 4XHBA 3DCFA 1W6PB 3NV4A 4MEYF 1N75A 1S5LC 1JHJA 1IXCA 3OYGA 3GZNB 2VKEA 5CVRA 4LK1F 4ES9A 2QQWA 1VRH3 1T56A 5LFAA 2AUYA 3KP2A 1IG0A 3LKJA 1FOD3 2AENA 2VUAA 4XMIA 2ME6A 2XUBA 4XJWA 5JOXA 1MEC3 2ELKA 1HCRA 2PELA 4OUEA 3KZ4C 1HBXG 1U3EM 3JTHA 4LR4A 4LO7A 3I54A 2WADA 3RPUD 1RUC3 4AGVA 1IZ3A 2VIXA 1JKOC 4IQJA 1TTYA 2GNBA 3HOVJ 3PIOF 4N0BA 3LA3A 1JYCA 1I6HJ 1JH5A 1PMIA 2PHDA 4O5VA 4BIFA 2CQXA 2AR6A 2JE8A 3G3ZA 5FP4A 1FYMA 5GLUA 2VW0A 2ZXJA 4UT5A 2UWAA 1LFBA 4ORFA 5GAEJ 2PLYA 1ND2C 1G6NA 3K46A 4EN7B 3SLIA 1OOPC 4EE2A 5C8CA 2ZEWA 4M00A 1IS6A 1UOGA 1YIOA 1VP6A 3FC0A 4OVEA 4YGDA 1BJAA 2QGUA 1T6BX 2RQQA 3E5XA 2R3SA 4MYEA 3WOGA 1FIAA 5D8AA 4N53A 1GVDA 2A7AA 2ZMEC 3S93A 2W57A 3JAMZ 3GCXA 4V19K 3S1MJ 1K78B 2MW8A 4PLMA 2ZOEB 1EJ9A 2M34A 4BQAA 3IL2A 3D3AA 4GXLA 2Y64A 1WCQA 2W68A 2XRLA 3I3EA 3OYKA 2LY1A 4HKOA 4MADA 5FZ4A 3I49A 3I2GA 5JFRA 3HNBM 3IT8A 4IE4A 2D5VA 5FZEA 1AR73 4XTMA 2DU9A 5JLVA 3AXDA 1A8MA 1MS1A 4YNIA 2E7WA 1J7KA 2Y9YA 3NVCA 4RL7A 3WV6A 2ENRA 1EV12 1QPMA 4PI2A 4HOOA 5DM7F 5EZHA 2YY1A 4LLOA 1SZBA 2A70A 2AEZA 2JVGA 1D4M1 5C9AA 4ATFA 4GD4A 4EJUA 4JQTA 3HPNA 3SHFA 1S6LA 4WVWA 2B5HA 3QH7A 2V9PA 2UYBA 3PUSA 3IBMA 3HSFA 3OPWA 3MZHA 4NVPA 3VUOA 3ISPA 3FHIB 3LGRA 2E26A 2CGPA 3AZYA 4OAZA 3WNNA 4FO9A 5K7ZA 2VMGA 2QENA 4GYIA 1FJLA 3JUUA 4Q8KA 5FB2A 4HFSA 1VAKA 2XSJC 4N7UA 4H0EA 2EICA 1OUXA 1FTZA 2VW2A 1AJKA 1UAIA 2R7WA 2DOEA 1W36D 1Q8OA 3FKIJ 1H6XA 4DYRA 4I01A 3VB9A 2JN6A 5FUPA 2CWMA 1T8IA 1XCBA 4MHUA 3TRSB 1IGOA 1W39A 2KKOA 2R071 4N4OB 4AL9A 2VPRA 4NMIA 3BCAA 1X58A 1E0EA 4FTSA 1POGA 4NWWA 5A80A 4HV5A 1CF7B 2RVCA 4FPYA 3V8KA 1FXZA 4G4FA 4PDKA 1WLCA 3A21A 2MGQA 1UW8A 3CJQB 3T1BA 4TV7A 4LXLA 3M3YJ 4GJZA 5KXEA 3VBHC 2HQRA 1X1CA 1D5VA 2DK8A 1OCRH 5JIUA 4HNTA 3FMQA 3ACHA 5CFDC 2P3IA 1LVKA 1IOAA 1VBE1 2O1QA 4EQVA 2M30A 3OPTA 3H36A 2V72A 4Q4X3 1DGRN 5JWPA 1TQMA 2ZEZA 1UY0A 5C3QA 2ZTNA 2DFHA 3CO2A 1KFXL 1Y56A 3O0VA 1U0JA 1VZ0A 2LKSA 1US2A 1W1WE 4NIIA 1MJBA 3MKYB 3RPUA 3U75A 3DBHB 4B3XA 4Y1XA 4HXCA 2X10A 1S0FA 2RKHA 4UFIA 1MNEA 3ZVXA 3A02A 1D8JA 3MZYA 4M0HA 1RJ8A 5EDNA 2K4JA 1P8JA 1S7EA 1T6GC 4MFDA 3J80K 2H0BA 4WBBA 4XTPA 4FAHA 3A7QA 4Z1VA 3C18A 1NY71 1R1A3 1RKTA 3WGIA 2DOFA 1JJ6C 2Z33A 4Q4Y1 1MVQA 1X33A 2WQ8A 2QVSB 1SLCA 5CYVA 1JKQC 1D3YA 2AEYA 4GALA 1EY2A 5ICCA 2A71A 2O5RA 1EAH3 2L02A 3AMHA 3AG4H 2XJUA 1YIPA 1T0FC 4XABA 3JBG2 1RUE2 1QO0D 2V9VA 4GZ9A 3NNFA 2ZHNA 4XIKA 4DFSA 2XLAA 5LGNA 1U12A 2RS33 4EN0A 1WWXA 5HOOA 5K5RA 1DQ0A 4FOVA 4O9GA 1AXZA 1S2BA 3WU1B 2UV1A 5IATA 1JZ3A 3UT0A 2ATFA 3VBFC 2YBSA 4K40A 1V4RA 3FXQA 4L5IA 1FMVA 2TRTA 4L99A 2JG8B 2QA4I 3UK9A 4ZYEA 3E97A 4XRMA 4Z82A 1VQLI 1HSJA 2IS4A 5JSOA 2GXGA 3S0MA 1P4AA 2LS6A 3WF3A 5I8TA 4C91A 3FXLA 2JDYA 5FKKA 4BS9A 1ASJ1 2DFEA 3DYOA 1OR7C 2WFF2 3VHPA 2VMHA 1UU4A 4YEJA 3ZQHA 2BV4A 1YI7A 1IN4A 1QPIA 2QCOA 1Y9QA 4IDZA 2RREA 3RYRA 1TT0A 2RV9A 1UY4A 2PJRA 3RWNA 1QA6A 3KP3A 1P6RA 1IS5A 3RWKX 3HUGB 3AKZA 3BCBA 2KJBA 2DCTA 2HTJA 1K7AA 2YMZA 4XJAA 5I93A 4NRPA 1ZYRF 3EQLF 5CVVA 1K12A 3H5AA 5L3DA 1XNAA 3OR1C 4BHCA 1BYHA 1LU2A 4A3FJ 3B5LB 2QQJA 5T50A 4ZHNA 5FY0A 5DPNA 3ECHA 4AU7A 1DU6A 3D5RC 5IP9J 3RCOA 1T98A 1HQCA 4GB33 2CY6A 5IW0A 3JR9A 1EUTA 5FY9A 1LUJB 3P9CA 3U14A 1MJAA 2VOWA 1QJY1 3R0AA 2QNKA 4LJZF 1AYM2 5FZOB 3NEUA 5LGUA 2HI3A 3LB9A 2DBIA 5M0TA 2RG4A 1NQDA 4E7IA 1PO11 1C1FA 3DUIA 3OPZA 4GDFA 3CLQA 1VQNI 4OI0A 5A2QZ 2VBBA 3AG1H 4XDOA 3AKSA 4AI2A 3FDYA 3ZFFA 3UGGA 5D5WB 2O0YA 2ZJRF 2KRHA 1N1TA 3BB6A 4L0PA 4XETA 3W59A 1MACA 2ZAHA 4XJ9A 2A5YB 2VOTA 1YX3A 4FI9A 3ZXDA 3CO6C 3MEPA 3LMMA 4UHTA 2RS53 1YJ9I 3OB8A 2ZGPA 4FP3A 3ZXAC 3S7EA 3AL6A 4BA6A 1C3HA 3OUIA 1BEV1 4AF9A 4COWA 4GMP1 2KQRA 2B4KA 3WTWC 1PVC3 2Z3YA 5LEKA 3PSIA 2O61A 1B1BA 2FU4A 2NYYA 3PJQA 5LHHA 3KCCA 1XC6A 4ASNA 1RXFA 5E3MA 2DLLA 3EBRA 3PNVA 3O0XA 5JHFA 1OLME 1Z78A 2XPVA 3ZXEA 1EH7A 3F2ZA 3DEMA 3AMQA 1WJDA 1F8VA 3BN6A 5CISA 2IGOA 3WXPA 5JVVA 2F4PA 1W3VA 1ZGAA 2P6CA 3RJ2X 1SG3A 4GA9A 2ZZJA 2LSOA 4R9BA 4DOUA 2D7FA 2WWJA 4Q4W2 3FFQA 1HX6A 1A78A 1BLZA 5IUQA 1BZWA 5KC5A 1WGPA 2IAIA 1QJX3 2ARAA 4MHRA 2FOKA 3ZN1A 2NM1A 1BMV1 2IA2A 3C7GA 4DRRA 4UUSA 5FFXA 3KQRA 3JSOA 5EYYA 5F5AA 2HQ5A 1ULFA 4RA2A 1DQ6A 3WHUA 1VBB1 4FFFA 4IRHA 2K4BA 5EEAA 1SD4A 1VBA2 3VKOA 4L18B 3HD8B 3EYYA 1I1SA 1I3QJ 2V1NA 3MLJA 2OU2A 4D6RA 5A3MA 3HGGA 3PFYA 3AYCA 3W9AA 1J1LA 2F5FA 5E3NA 1YC61 3A23A 4HA8A 5E89A 2LRPA 3PIJA 3OGVA 5C3RA 2VOPA 2XJRA 4Y1YA 1QJU2 2R062 2Z79A 4Y52J 2HWF3 5FYZA 5JXHA 2PG4A 3WTZA 2WT0A 3BYWA 5FYHA 1BK0A 5BQTA 4HVOA 2RDNA 2DTYA 1XG1A 1NQJA 1CONA 2BQPA 3BLYA 1YQ5A 4CDUA 4XF4A 4CUCA 3V0AB 2K0GA 1G86A 2O0OA 4CU9A 4URTA 3NV2A 5HCAA 1PNGA 2I8DA 4PI0A 2W24A 5EZWA 4RGRA 2E9QA 2P5KA 3FL7A 1ETWA 2XQRA 4UY8I 3CCEI 1LQ1A 3OSGA 2NVTJ 4BKXA 1PK6B 1ZBE1 4OIOF 1G7YA 1AZDA 4HX7A 5EG0A 2FCVA 1REFA 3ZR5A 1O5LA 4I76A 4CCOA 2LALA 3C3VA 3NKGA 2B0LA 4OAYA 4AXOA 2HVSA 2O8OA 5FYCA 5JMOA 3EUAA 2LM3A 1HV0A 2H6BA 5LW9A 5E1WA 3HT1A 1QKQA 3CJIC 3MF9A 3KLNA 4PZJA 3T2PA 3ZQ7A 4PQQA 4RHV2 2W1UA 3TEZA 4P9LA 4V2FA 5JLWA 1BVVA