3I54A

Crystal structure of mtbcrp in complex with camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
224
Chain Sequence
LYFQSHMDEILARAGIFQGVEPSAIAAQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
total genus 66
structure length 224
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i54A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i54A01
3IKTA 3F23A 4L5JA 5FLIA 2EK5A 4LLLA 1FLIA 3FHZA 2M5WA 5HOOA 4LJZF 1FPQA 4P55A 3DPLC 3JTGA 5JSRA 1KYZA 1GXQA 5ILUA 1P6RA 5EEGA 3O3KA 4HVRA 1BI0A 3RNSA 5I91A 1PP8F 1SAXA 4PJYA 4FAGA 2B9UA 2EV5A 1ZZ8A 3GF2A 2HYGD 1FI2A 4MHGA 3HYIA 1ZNPA 5DCMA 4E70A 1T2KA 2LNBA 3OGJA 3W6KB 3GFIA 1G3SA 5L3BA 5LGUA 2QJVA 2XLGA 3EBRA 1CF7A 2YU3A 4MGIE 1ZGJA 3QP6A 5E16A 3WTYC 4Z82A 2MC3A 2E1CA 2VOOA 4NQWA 3ZPLA 3EHKA 1KU9A 1YUDA 4WXDA 4UNOA 1HBXG 3ZMZA 2HEOA 3L9FA 5I0RA 3MFKA 3JW4A 4UVCA 4KL1A 3K69A 4OIOF 4NHJA 3FX3A 4GCVA 4U7BA 3F8NA 3CDHA 2LF8A 1AOYA 2PEXA 4AIHA 4AIKA 3KP7A 1TQMA 4UVBA 1REPC 4RAYA 1SFEA 2UXNA 2GIVA 3LAPA 1IN4A 1U78A 4BXUA 2ZCWA 1U2WA 3TOBA 3JTHA 4KMFA 2H94A 2PHDA 3TKYA 1YLLA 1FOKA 2PA7A 4MTEA 1O3SA 3FE5A 4HZFA 2BV6A 2JPBA 3VODA 2HQNA 1FSEA 2A6HF 2H09A 1FYLA 2F5DA 1XGMA 2Z69A 4ZYDA 1YFWA 1TQIA 2EV0A 4G8XA 3HHGA 2CAVA 4U0YA 2FBHA 3CLOA 1MDMA 3I58A 4KN7X 1ZREA 3C3WA 2P4WA 4HLXA 4EWDA 1JHHA 4UV9A 4LGWA 5E8IA 1QY4A 1MJ9A 4G6DA 1L0OC 2PFWA 3ZP5A 4KICA 4IEOA 3RI4A 1KQ0A 1PMIA 3JZVA 3U0ZA 3E6MA 1X8EA 2A07F 1XB4A 1QO0D 3TO6A 5FO5A 2RDPA 2Z5UA 1Y3TA 3ECOA 3F8FA 1R5HA 5D5XB 1TQ5A 3SCGA 1RNLA 1EH8A 2VBZA 1IZ1A 2IPQX 2P8TA 2PN6A 2DQLA 3FFQA 1BIBA 1BM9A 5DUIA 5E17F 5JR3A 2CG4A 4YFXF 4G7ZF 5D1IA 3K1PA 1ZX5A 2AXLA 3LWFA 2N7GA 1BIAA 2EA7A 1K78B 2FA5A 5EFUA 4Y15A 5KHHA 1FBQA 4UHTA 5J6XA 1SMTA 2OZUA 1ZAOA 4LG0B 1ZGAA 1VR3A 4I02A 2A3SA 4B8XA 2OA2A 1O3TA 3CTAA 1H9TA 3F8BA 3CEWA 1O57A 1J3RA 1DZTA 1CX4A 1G3WA 3O2PE 5CJ9A 1CAXB 2CGPA 4LK0F 3UKTA 1YQAA 4LB6B 4KWLA 4L18B 2PG4A 3CO2A 1DPRA 1LB2A 5L3EA 4I0AA 4WBBA 2TDXA 1HSTA 4P5OA 4L0YB 4AVBA 2DK8A 5HI0A 1WKMA 4KNYA 2PAMA 4CDGA 1XDUA 1KQ8A 2P7VB 2BYVE 4BQAA 4LLGF 2KXLA 3ERED 3H9AA 3JAMZ 5D5WB 4RB0A 4LB5A 3ZMDA 2B5HA 4QM9A 4PGGA 5TRDA 4XF3A 5CVJA 1TW2A 3R60A 2BBYA 4PGHA 3V4GA 4HMZA 5CU1A 4R52A 3J7AO 1U3EM 2EV6A 1O5UA 1O7FA 4EJTA 4I0BA 2NNYA 1VTNC 1OI6A 2HQRA 2EFNA 2QVOA 3RPUA 1EP0A 2E1NA 3CJXA 4IJAA 2QCSB 5CVUA 4AVPA 3V7RA 4UUVA 5DDGA 1F4KA 5IT9K 4LLOA 2D5HA 4YRDA 3QU6A 3MYXA 4HW0A 4KU8A 2P5KA 4RS8A 2HTJA 2EA2A 4XF0A 3WW2A 4WCGA 5KHKA 4EJUA 4B09A 2HGCA 3W6JB 2IW5A 3WE3A 1CF7B 3EQEA 3T0YA 2EVXA 5JI6A 2GU9A 3C1DA 1X8MA 1CAWA 2OAZA 1KU2A 2XAGA 3L00A 2DFIA 3N97A 1P4AA 2O03A 1Q3EA 1Q43A 4MGKE 3HOTA 2PYTA 1F5TA 4XFCA 3S7IA 3ULQB 5E1WA 3SQNA 1WI9A 5BPIA 4FT8A 1QNTA 2QDRA 1OKRA 4I7HA 2J5PA 1X3UA 1R5GA 5HS8A 1F9NA 2O1QA 2MHFA 1EH7A 2FMLA 4Q47A 4EVIA 3I5UA 3IBMA 2CAUA 4I01A 5I93A 4A5MA 4QX5A 4AIJA 5KHJA 2GZWA 2UXXA 4J1WA 1WRJA 1STZA 3EUHA 3ROUA 2VC1A 3KP2A 1HW2A 1FNNA 3S7EA 5I8SA 1Z91A 2G7UA 2M87A 3HTSB 1NYWA 4U88A 2CO5A 3WGHA 4IHSA 1G3TA 4HV5A 2DU9A 3CL1A 3TOAA 3R0JA 3SMHA 4LA3A 1B4AA 3HRSA 2EFOA 4CICA 3WU0A 3Q9VA 2M8EA 5BQTA 3CLPA 3J80K 1DGRA 4ZZDA 3K1MA 3HUGA 4A2UA 2GXBA 3E6DA 3GO5A 3BU7A 4G7HF 3U10A 3CUQB 3J81K 1YS6A 3QPHA 3WTVC 3EYIA 1XMKA 2L02A 1XRUA 2XV4S 1YYVA 1UHWA 2XASA 2GWRA 3KETA 2QBYB 1RTVA 1B6AA 2P5LC 2V79A 5FPZA 2XRNA 4IEQA 4HDVA 2HKOA 1IXCA 5K1YA 4MV2A 4PIZA 2VPVA 4D7TA 1KGSA 2A6EF 3PFIA 4PCQA 1LDDA 3BJ6A 2PQQA 2YSRA 3FM5A 4M6YA 2MD5A 1EYBA 1FZPB 2XKOA 2MH2A 1ON1A 3BPXA 3H7YA 5LLQA 3S0MA 3WTTC 3LQRA 2UYBA 4QGLA 4Q0PA 1BI3A 1BJAA 3G73A 3M8EA 2ZKZA 1R1UA 4HVOA 5K8SA 4XLNF 3ES1A 5JCTA 4N9HA 4Y13A 1I6XA 3K9TA 2XHKA 3V7CA 4E2QA 2UZKA 2Z2SB 3SCHA 2J5OA 5FLXZ 4P9GA 3I0TA 5ICGA 4EMSA 1MJAA 1HW5A 4F7ZA 3ZMVA 4MUVA 2JSCA 3COAC 3USSA 5T3NA 2FNAA 4HV6A 3M9AA 2H27A 2IRFG 1Y9QA 1WQ2A 2PFBA 2R7DA 2ADUA 1X82A 3NQOA 5FQ0A 2XROA 1TNTA 4LG0A 3IL2A 3IKVA 5BPDA 5E20A 1DZRA 4Q0VA 4AQ6A 4F8AA 3BJAA 1WGPA 3KP5A 1Z05A 3MCZA 3E5UA 5HS9A 5TJJA 1D8JA 2O8QA 1TW3A 4AVCA 2Y75A 2HS5A 1W5TA 2FSWA 1TLHB 2ZO4A 3J80Z 3QP5A 3ZMUA 1IN8A 4L2NA 1HQCA 1W5SA 4EWAA 4XLPF 1T0FA 3P9IA 3KFWX 2IT0A 2KIUA 3EO6A 2XAFA 1H1IA 4JBAA 3R0AA 2VXZA 3OOPA 1ZZ7A 3P7NA 2VE9A 5EZWA 3QOPA 1KU7A 2FEZA 4LLNA 1MJBA 4XETA 2KJCA 4EV0A 2K02A 2WFPA 3TNPB 3WTSC 3I4PA 2VBWA 1SFNA 1P2FA 4META 4XF1A 3LA2A 1FXZA 1F1ZA 4MX3A 2P6SA 1V4RA 2XKPA 1XN7A 5HDGA 4HLTA 3CF6E 2K86A 1J9IA 1QWRA 4BHPA 4N9IA 4LUMA 2WC2A 4XF9A 5AVPA 1XSVA 5HLGA 4L0ZB 3CUOA 1UD1A 3IDCB 1R7JA 4IESA 2L3DA 4A0YA 5DUKA 3DFGA 3MAJA 4A12A 3KEOA 4GO1A 1OPCA 3ISPA 3S2WA 1X7NA 2QLZA 5K5RA 1GXPA 2BNMA 4LUKA 2CSOA 4L11A 1NHAA 4OIRF 1T39A 2ZNYA 1V3FA 4Q0QA 4KT5C 1I1GA 3SZPA 5D8KB 4BIFA 4EGZA 3DKWA 2DTRA 1T38A 1R1VA 2IVMA 4Z2YA 2Z33A 3V8LA 3BROA 4YFKF 2JT1A 2XUBA 1SQ4A 4ZYEA 4MGZE 2YX7A 1JE8A 2V6CA 2Q4SA 3O6BB 4ENJA 2ESHA 4TLFA 3ZDSA 1USSA 5EEHA 2HTSA 2W25A 1T98A 1OD5A 2FOKA 4JVAA 2KIFA 1LEBA 1JHFA 1YFYA 4MQVA 3QRFF 2GA2A 4HQEA 1ZRCA 2M45A 4TV7A 5FB2A 2XGXA 1S7AA 3LA7A 3BDDA 2P6TA 1PDNC 5H6RA 4P96A 1JGSA 4GYGA 4IEWA 3F72A 3OD0A 4FX4A 2IXJA 2AS5F 4ZU4A 2JZYA 4XFAA 1W7PD 5D5VB 2PJPA 4BHCA 2D40A 1IXRC 4ASNA 3CJNA 1RGSA 4I3PA 3F8CA 1ZHFA 3GFLA 4QLCU 2F5FA 4BH9A 1DGWA 1FSHA 1RIOH 5E1ZB 4U0VA 3UKVA 1BC7C 4IEPA 2Y0OA 3SXWA 4IEYA 5HLIA 2QQAA 4HOBA 3GZ5A 4S05A 4EJWA 1RZ4A 4ESFA 3VOEA 4MGYE 1V70A 5LHGA 3MWMA 2E9QA 3EETA 5KHGA 3RKYA 1DP7P 3OF1A 3D82A 5DCMB 3GZ6A 1CAVA 1B59A 2Z99A 2G7HA 3T8TA 1WLTA 2QENA 3D0SA 4IEVA 3LAGA 2O61A 3REOA 5LEKA 3KP6A 3Q9SA 3BCWA 3IC7A 1ZRRA 4L9NA 4RGUA 4O5VA 3L09A 1ZLKA 1B1BA 3GFMA 5IT9Z 4YG2F 1J58A 4X6RB 1QZYA 4QGNA 2MBFA 4MTDA 3RYRA 3WW3A 1J59A 2DLLA 3RKWA 4HLYA 3BPZA 2QWWA 1GQHA 3SZTA 3V8JA 3GFJA 2K4BA 4I2OA 1U6GA 4I98B 2LDUA 2L54A 2A61A 3NRVA 2E7WA 3E5XA 5ICCA 1GHCA 3F6VA 3DEUA 5L3FA 2BNNA 1OR7A 1UW8A 1R22A 3GUDA 3DF8A 1ZRDA 1G3YA 4KN4X 2Z3YA 4IXAA 5FPXA 4HYEA 3PQJA 3M8FA 2VONA 1Q5OA 4XRFA 3DL3A 2VBYA 1RC6A 4HBLA 4LD5A 3PQKA 4WXCA 3AAFA 1JUHA 1TTYA 3DN7A 4YARA 1EH6A 3WE2A 3SHFA 3VFZA 2HWVA 1ZZ9A 1H9GA 3KP4A 5HVQC 4HX8A 2QM3A 1O3QA 4EM2A 2NYXA 5DEQA 2NRAC 2VE8A 1XGSA 5DV5A 3NVCA 4G9YA 5KK1A 3VEPA 4HF0A 5DCFA 4U7DA 4HA8A 1MD0A 2CQKA 4HN1A 1OYIA 1UHMA 3F6OA 2Q0OA 3FMQA 1B9MA 1S29A 2PLYA 2Z9OA 1I1SA 4KU7A 3TGNA 4LULA 3BOQA 5F64A 2JRTA 2FRHA 6PAXA 4L5IA 4A0XA 4HSLA 4RGXA 1NXMA 1ZZCA 2DO7A 5FFXA 4YSFA 1XDSA 3R4KA 3H1MA 2EJRA 1LDKB 5L3GA 1IAWA 2V1UA 4GXOA 2MPFA 5J7MA 3MEXA 5D8LB 3E97A 4AWXB 3EDPA 1PUEE 3NSTA 3DP7A 4BNCA 4ONUA 4AVAA 1YS7A 4ZZLA 1R00A 1E2XA 2FU4A 1SMYF 4QWQA 4P9UA 4HDUA 3P9CA 2XL9A 5AONA 4HQMA 4IRIA 3ZN0A 2WWYA 2D93A 1U12A 4RB2C 2MLKA 1CAVB 3DXJF 1ZG1A 2XAHA 1HXDA 3I53A 4EJOA 4IERA 4IF4A 1W4MA 2IA2A 5CVVA 2VN2A 4IHTA 4CXFA 4ON0A 2NNNA 3GLXA 4A5NA 1T6SA 2K4JA 4IRGA 1IW7F 1LEAA 4GYIA 3FMRA 2GH2A 3R61A 4FX0A 1KQ9A 2A68F 1RI7A 3K0LA 4LMYA 4OLLA 2QVSB 3NEUA 2XVCA 4CO8A 2YR2A 4M74A 4L9JA 4AXOA 4H7LA 2ISZA 3MPBA 2FQPA 3LAJA 3CUQA 1YFUA 3NKTA 3NJZA 5K5QA 2F5CA 4IRHA 5D4RA 2GC2A 5L3CA 3ELNA 4Y17A 2ZMEA 2PI0A 4MNUA 2DI3A 1G6NA 3V8KA 1SD7A 1SD5A 1ZRFA 4UXAA 2PAEA 4Q4ZF 1YFHA 4GULA 1W7PA 1HKQA 1R1TA 1JXSA 1CAUB 1OYYA 3LOIA 3HSFA 4WX9A 4HVQA 1YTYA 3WTXC 4FAHA 3I64A 5HDNA 4B29A 1W7PB 2MNGA 1J0RA 1SD6A 2A69F 1SFUA 3RDIA 2RVCA 4N0BA 4IEXA 4DNCA 3HRTA 4A0ZA 4MQ9F 4ENNA 3B73A 4XFHA 5BV6A 2EWNA 1LQ1A 3HHHA 2XAQA 1NE6A 1D3YA 3DPTA 4O6JA 1FYKA 4FBFA 4U0WA 1J7KA 1IUYA 4PIYA 1SEFA 4OINF 2K0GA 1YG2A 2P5VA 4AD9A 3JAMK 3KEQA 2IA0A 2WTEA 4G94A 2UY9A 3SHRA 4XSXF 5FQ0B 3GWZA 4R1HA 3L2HA 1QBJA 3HRUA 2D1VA 5HLHA 2ET1A 2UYAA 2M30A 5AIQA 3EYYA 2O3FA 4RB1A 3BJOA 1IPKA 2RC4A 4Z07A 3BP8A 3RIRA 2FQ3A 1UPIA 4Q48A 4ZU7A 1FY7A 2O8XA 2V1DA 3KCCA 1QQIA 1Z1DA 5I8TA 3VB2A 2GXGA 2XIGA 1YIOA 2B8MA 3UKNA 5BXXA 3I71A 1K6OA 4EJVA 1Z9CA 2FMYA 2XL7A 3U11A 1EPZA 1FC3A 4ORFA 3KLOA 2QNKA 3TO7A 5FLJA 2KKOA 1S7OA 2ETHA 3J81Z 2OD5A 3LWCA 3GVAA 5AIPA 5C8WA 2W57A 1RUNA 2EB7A 2QZ8A 2BNOA 5E8GA 5LEJA 2GC0A 2XLAA 1BI1A 3ZQ7A 3G3ZA 3RZZA 2CV6A 4LFUA 3U9GA 1MZBA 1XMAA 1ZN2A 2Q1ZB 2IC1A 1FT9A 3P9KA 3C3VA 5K5OA 2OA4A 4RD7A 3E6BA 3FM3A 2K27A 1U5TB 3ELKA 3NL1A 3U1DA 1FX7A 4Q5SF 2COMA 4LEJA 5JSOA 5LRSA 2IXIA 4ZU5A 3GW2A 1PM7A 4ENKA 1WA4A 2VT3A 2FE3A 4JK1X 2L4AA 1D8KA 4K2EA 1LVAA 4MZUA 4JQFA 1Z7UA 5BY5A 1G4DA 1TNSA 2RQPA 2PHLA 1GVJA 4HF2A 3EJKA 3I7DA 4G6QA 1O5LA 1GQGA 2QBYA 2DCTA 4ESJA 4DINB 3F21A 1LJ9A 2F2EA 2DAOA 2YX4A 2ZJ2A 4L9TA 4Q0UA 1U8RA 4ENMA 1DUXC 5H20A 1QXJA 1Z6TA 2ZFWA 2HJIA 2I45A 3F22A 4G7OF 4MEYF 3WW4A 2CYYA 2O6GE 1J5YA 4OMYA 1YW8A 3QAHA 4XFIA 4OOIA 4EM0B 1VJ2A 1HW1A 1XD7A 3GXOA 2QQBA 3PNAA 3ST7A 2P17A 3KGLA 2C0ZA 5CADA 2ET7A 4E2SA 2P7CB 3SCFA 2ZKLA 2OZ6A 4OU0A 3I59A 3H3ZA 2K7LA 5F6FA 2JTVA 5ILVA 5JAXA 5LRRA 3H50A 4OMZA 2LKPA 2ESNA 4NB5A 3ETQA 5JVTA 3QU3A 3SFZA 4KWKA 4ETSA 1BI2A 3M7GA 4BAYA 1FYMA 2IJLA 2PTMA 3NW4A 5J48A 3HOSA 4HN0A 2DK5A 1XSDA 4KIFA 1H0MA 2HZTA 2ACJA 2C6YA 1IN6A 2X4HA 3E5QA 1HKTA 1YWKA 1S6LA 4OIQF 4HX4A 5FCCA 3EQLF 5CVIA 5F1RA 3HSEA 2Q0AA 4M73A 3ES4A 5ICEA 1FBUA 1K7AA 4PDKA 2DPUA 2FF4A 2DQRA 2VBXA 4WXHA 4HSJA 4OFGA 2ZNZA 5JFRA 2Q2EA 2FBIA 4IPAA 4KIGA 2STWA 3E6CC 4BHBA 3GYHX 2DW4A 4FHTA 2Q8KA 2ZBKA 4EWEA 1TQPA 1E17A 3K1NA 1R23A 2LF7A 3GEZA 2NAZA 1R36A 4R79A 3VHRA 1ZG5A 1P92A 1XCBA 2PQ8A 3OV8A 3RTRA 4LTAA 1XSXA 1L3LA 1OMIA 2ATFA 5FD6A 3GBFA 1UB9A 5CYVA 3BWGA 3IRRA 3OTFA 1RUOA 2BGCA 5D6EA 5LBQA 5I0SA 1LKNA 2K9ZA 3H3UA 4HBNA 2GA1A 1LR5A 3WGGA 2HYFA 2IXLA 1O7LA 3HTUA 4EROA 5JSPA 4WK8F 1UIJA 3MDPA 5E1XA 3LQQA 1UCXA 1IN7A 5HS7A 3U2RA 1RL3A 3WTUC 4LA2A 3LA3A 2ISYA 2IXCA 2FBKA 3H8UA 2EA4A 1I27A 2W84A 5KHIA 3K2ZA 2KRFA 3TDZC 2RKHA 2E7XA 2VODA 1IXSB 1HKSA 4D7SA 1SFXA 4UBGA 1L3JA 2QUFA 3BY6A 1NZCA 2L01A 2H6BA 1MKMA 1ZYRF 2YPRA 2PAKA 5FLXK 1DPUA 3KMHA 4KA4A 2IA1A 2HOEA 2QYOA 2X0LA 5CVRA 1FP2A 3QACA 5D6FA 4XBFA 4O9EA 5LHIA 1BOAA 1ZG3A 2VC0A 2PMUA 1LRHA 2UY8A 2A5YB 2DPDA 5J8FA 4L9VA 3FJSA 4XFBA 4QM8A 1I5ZA 2IXKA 4KIBA 4H0EA 3TDUC 1XGNA 2HKXA 2IP2A 2VT2A 4CZZA 3KZZA 3IDBB 3HIFA 3ZN1A 4IVNA 1YW9A 3M1EA 4WF2A 4BYYA 1OYWA 2GQQA 1YO5C 2B0LA 4IEZA 4XEZA 4EQQA 3R6SA 2G9WA 5FFZA 1S3JA 4XFFA 4CYDA 1CAUA 4RGSA 4M9SA 1PP7U 3RJPA 3JSOA 1S8NA 2XAJA 5KBFA 2BE5F 5J8CA 1ON2A 3QPTA 2D2WA 4Q29A 2Y0MA 1K78A 5ILSA 2OQGA 2IXHA 3TNQA 3WTZA 1AWCA 3H1YA 5FDBA 3I54A 1QXRA 1DDNA 3ABTA 1YFXA 2ELHA 4LK1F 2OYZA 4MEXF 4YIIA 5I0UA 5I8YA 5LGNA 1A04A 3HQXA 1SD4A 5L3DA 2JPCA 2W85A 2OZJA 3WU1B 3RPQA 3F3XA 4A6DA 5ED4A 2HFHA 1CAXA 2GC3A 1Q1HA 4M9XA 3LZZA 3SXYA 5I0TA 1XE8A 1YHFA 1IF1A 3IWFA 3T1BA 2MH9A 1J1LA 3BZ6A 3KGZA 1TBXA 2DT5A 5BUVA 3OCPA 5KVRA 3ML6A 2Q30A 2VECA 2EFPA 2D45A 2L4MA 3WG9A 4WWCA 3ECHA 4CGZA 5IT3A 3B02A 4YIFA 5H6QA 5BPXA 5JR7B 4KFCA 3CO6C 2MA3A 3WTWC 3I59B 1UIKA 1H1MA 1WWXA 1K79A 2ZMEB 4YNIA 5LGTA 3F8MA 1ZZ6A 4M6XA 2CFXA 4D0PA 3LSTA 4JTOA 4ZYGA 3KE2A 2GC1A 4IEUA 2LSOA 1P4WA 4HX7A 1WSUA 1P4XA 1CAWB 3ZMSA 5FLHA 4M72A 5DD8A 1ONVA 2V1XA 3CUQC 1YLFA 2V09A 4WZCA 4O3MA 1USTA 4PZJA 1C0WA 1QPMA 5A2QZ 2WV0A 1EY2A 3BALA 3KZYA 1YW7A 5DYMA 3Q5FA 3IWZA 1VP6A 3C7JA 4YYOA 3D5LA 2KIMA 3L2CA 2QQ9A 3RKXA 2F4PA 1UCRA 3JSPA 3MZHA 1IN5A 4KWJA 3PVBB 5CLSA 3FXUA 4KMUX 2R3SA 2D5FA 3FXQA 3WODF 2RGVA 4MH0E 2HR3A 4XFGA 1ZVFA 3HSRA 4AQ2A 1O4TA 3PLQA 3L7WA 1B9NA 5E1RA 3HRMA 4QGMA 2W24A 5FGMA 4ZH4F 4EGYA 5BMZA 1OFNA 3FHIB 2KJBA 4ZYHA 1U5TA 5D4SA 3IRQA 4OIPF 2ZXJA 1BC8C 2H0VA 4EM1A 4R8HA 5ERIA 3RYKA 4MGRA 1IRFA 1J3QA 2NS0A 2FNPA 4UV8A 5DD4A 1XE7A 3FXRA 5J3UA 4DQ2A 4JV4A 1XGOA 3FWEA 1UFMA 4ESBA 3DV8A 1ZARA 3KLNA 1MDMB 2OPKA 1D5VA 2MLGA 2OU2A 2PMHA 3FZVA 3T8RA 3G7DA 4M9ZA 4NVPA 3TO9A 1BBYA 1J75A 4X6QB 4J1XA 5ICFA 3MQ0A 1J3PA 3D0JA 2EFQA 1FBSA 3HT2A 2M1BA 1MGTA 4GGGA 3TQNA 3H92A 2VQAA 3DQVC 3GX4X 1LNWA 2RNJA 4XF4A 1R58A 1IRGA 1FP1D 1Y0UA 4QMAA 1O3RA 3IHUA 5FD5A 5JHUA 4YFNF 2VOPA 2XLFA 4RGRA 1KYWA 5C6CA 3LFKA 2D1HA 4KDPA 1LDJA 3CO7C 4QXKA 4UVAA 3RYPA 3BB6A 3WGIA 4P9FA 3BPVA 1EV7A 3IIAA 3KSCA 1ZZBA 3M3IA 4HF1A 2STTA 1ULYA 2HDCA 3H1WA 1KA8A 3M70A 2GAUA 4M71A 5BS6A 3ABUA 2R7FA 4S04A 5E18F 2OQRA 2PBIA 1ZLJA 5D5UB 1KU3A 4I09A 2EFWA 1QGPA 3FF5A 1Z6RA 1HSJA 4PIXA 3ACLA 3ZMTA 3HT1A 1QZZA 4E2GA 2DBBA 4JTNA 2V9VA 3H7JA 1ZH5A 2OBPA 2F5EA 2BEOA 1CGPA 2ETEA 3GYDA 4IETA 1U5TC 2O0YA 1XCVA 3V7SA 3T5XA 3O14A 4Q0SA 3MZYA 1IPJA 1ODDA 1BN5A 4KUMA 4CHUA 5LHHA 4UBHA 3KP3A 4WVZA 2CWEA 5HDKA 3N4MA 5BOXA 2Y48A 2FXAA 3E3VA 4RB3C 4K8FA 1J2XA 2H6CA 1FWZA 2CW0F 4UXNA 3FMSA 2EAAA 3WW1A 2RN7A 1NE4A 2UWMA 4A6EA 2RV8A 3C18A 5A2QK 3FZ3A 4O9GA 4XSZF 4HAMA 4KYWA 4RAZA
chains in the Genus database with same CATH superfamily
3IKTA 3IAQA 2WA4A 5D8AC 3DEWA 2GNMA 5FLIA 1YIFA 3FHZA 1VALA 3DKYA 1O8PA 1U0JA 5ILUA 1P6RA 5EEGA 4R9DA 2WINB 1A3KA 2HOTA 3O3KA 2B9VA 4QSHA 1BI0A 2EXHA 4XUPA 4A3XA 3G2BA 1MZFA 1SAXA 4PJYA 4FAGA 4B4CA 3B7MA 1NTCA 3HYIA 1LKXA 3HN3A 5LGUA 4II3A 2YU1A 3GTQJ 4CXYA 3QP6A 2AEYA 5FRAA 1BW5A 1FV3A 2XQRA 2M4KA 2WZR2 3JD71 3IH4A 3EHKA 1F35A 4B4PA 4WXDA 3CJIA 1BEV2 3AM2A 2R0QC 3KT1A 1UZWA 1R082 4OHVA 1EUTA 1P7JA 4OIOF 5L73A 5CKTA 3N9MA 2LF8A 2PEXA 3ZKYA 3BTJA 3LEIA 2MEV3 5A70A 1F36A 2BY3A 3GCWA 2M7AA 1MMSA 2UXNA 2R7WA 4E7IA 2KZGA 1SFOJ 3LAPA 1ZRIA 2LMDA 4L5EA 4RSUA 2DDUA 2VXRA 5IYDJ 3BR3A 3JUUA 3FE5A 2JPBA 2HQNA 2A6HF 2WV1A 2W1OA 3VL8A 5M5YJ 4DPNA 1FPN1 2Z69A 5DQ0A 4NJ4A 2W00A 5F5IA 4FCYA 2XWJB 3IKWA 5CZKA 1MDMA 1GMMA 4CU7A 1QJZA 2K85A 2D97A 3C7EA 4AFDA 3C3WA 1BMV1 3S30A 4QPQA 4UV9A 4LGWA 4BZ4A 3ZIWA 4D7NA 5IWFA 3OS0A 4G6DA 1L0OC 1T2XA 5BNQA 2ZX0A 5IVBA 3UGGA 4P02B 1VBC1 1XB4A 4QTRA 1QJY1 3M1CA 5FO5A 2RDPA 4BE0A 2IGMA 3F8FA 1TQ5A 3SCGA 1RNLA 1EH8A 3BIEA 2PN6A 3VBRA 1W9SA 5FMBA 5E17F 3UL2A 2VMHA 5JR3A 4YFXF 2IGKA 4F83A 1BK0A 4WM7B 3PL0A 2EA7A 3H5RA 3K4CA 1RR7A 3RSNA 4CP9B 5L9BA 1FBQA 4UHTA 5J6XA 1ZAOA 5A33A 4O65A 2VAUA 1JTXA 4FO9A 3LB9A 2DF7A 2FDFA 2JEMA 5L36A 2FX0A 4X6AJ 3WU2C 1H9TA 3CEWA 1O57A 1DZTA 1UAIA 1YJLA 3CMEI 5LWBA 2CGPA 5LZ6A 3CO2A 1DPRA 1QJY3 5L3EA 4I0AA 1ULGA 1HSTA 1ULOA 4PQQA 5HI0A 1WKMA 2XPVA 2W2IA 2PAMA 1UY4A 4CDGA 1AX1A 1YI7A 4MVTA 2P7VB 1CJPA 4W6WA 4LLGF 2JIGA 2KXLA 5CYYA 1AR92 3H9AA 5JIAA 3JAMZ 3F95A 5D5WB 3FXMA 4PGGA 5ACA3 3KHCA 3JXSA 4PFOA 3Q8AA 5KC6A 1R093 3OYEA 5IVCA 5DAPA 2N8GA 3R60A 4PGHA 4CDUA 3V4GA 4XDPA 2VBPA 1NA1C 3C7FA 1O5UA 4XORA 1DGRN 4I0BA 4C2MJ 2OJED 1OI6A 2DVAA 5A80A 4QXCA 4DYQA 4BDVB 3JRIA 4E4ZA 4HK8A 2VZQA 2O0OA 3WCRA 3V7RA 4UUVA 2BERA 5A6XA 1A78A 3HBKA 3HOBA 1K12A 2O14A 4QD2A 1C28A 1V6MA 4RS8A 4IE0A 3B69A 3IM0A 2BBVA 1PK6A 3FHQA 4EJUA 4B09A 4H55A 5FKLA 4YW5A 1UXZA 3EQEA 3HDDA 3WUCA 5JI6A 3H3VK 2GU9A 3C1DA 3WP3A 1LCLA 2RS51 1MBFA 2PHRA 2WAOA 4COUA 1JBCA 2O03A 2BZTA 1Q43A 2TEPA 5B4NA 3RJRA 3T30A 4XTMA 3ULQB 3ILFA 1WI9A 3DKXA 2JJ7A 2VW1A 5CQGA 1EV13 2DUOA 2EZHA 1N1SA 2ZGMA 2RS33 3CMMA 1U8BA 1LOAA 2QGUA 4RM3A 2MHFA 4EVIA 1MPXA 1X9TA 2J7MA 2CAUA 2WS91 4BDZA 2Q5TA 1TVGA 4AIJA 4V2WA 2QZ3A 1STZA 3EUHA 1ERDA 1E5HA 4WZFA 4BQXA 1HW2A 1UMHA 3NNLA 2RS53 1FNNA 3S7EA 4FXKB 2YPJA 2MABA 2V4JC 2G7UA 1AR91 3JR9A 1NYWA 4W1UA 5F5AA 5A3PA 1MQTA 1CESA 1G3TA 2DU9A 2TUNA 5JZGB 1J1TA 1B4AA 3HRSA 4CICA 1QJU2 3CLPA 3VBOB 4ZZDA 2QQUA 4A2UA 4OUMA 3MHZA 3FFZA 2P0WA 5C7GA 5DG1A 3NJXA 4CCKA 3VLBB 1MACA 5J4YA 1FYUA 2A3WA 4AYBN 5E3NA 4MYEA 1US3A 3S57A 4CCDA 4UOJA 3VHOA 2QBYB 2YUSA 3EB7A 1B6AA 1K61A 1W90A 3N9LA 2V79A 3I8TA 1XYOA 5A3LA 4IEQA 2KMUA 1Z78A 1G9AA 4A3CJ 2VPVA 1NOVA 5F8PA 1KGSA 4MGQA 4QAWA 3ZFGB 1IO2A 2XXZA 3BJ6A 2YSRA 4M6YA 2E1MC 4ISQA 2IS4A 1FZPB 2XKOA 5EG0B 1VBC2 3BG3A 3BPXA 3AKPA 3CJIB 5IVEA 1D0XA 4N53B 2D43A 3CCMI 4Q0PA 1G9FA 4R9CA 1BI3A 3MKYB 3BODA 4HVOA 1V6LA 2CUZA 4XJ9A 4A42A 3OR2C 1RESA 3DTEA 2BQPA 3T0AA 4XLNF 3R4DB 3K9TA 2PX9A 2J5OA 4NHYA 4FTEA 2IFWA 1WH5A 5J47A 5FYVA 3LCPA 2MEV1 4QPWA 4HV6A 1TZLA 1WQ2A 4IHXA 1X82A 3NQOA 3KV9A 4PF5A 1Z7S2 3VBUB 3JQWA 1ENQA 2JG8A 4QXHA 1D7PM 1IHMA 5BPDA 4AQ6A 2RHPA 2C9AA 3MLLA 1CPMA 1DGRM 4GRIA 2AH2A 3DKQA 5HS9A 1UXXX 2XF6A 5TJJA 1D0GA 2O8QA 4XOPA 5FP3A 1W5TA 4OYUA 2Q8EA 1TLHB 3QP5A 4D6RA 4JP0A 4L2NA 1OSGA 1U5IA 3RG0A 1DGWX 1W8HA 2I10A 4Y33A 5DAXA 1YJ9I 2XAFA 3S2DJ 1SAUA 3R0AA 2VXZA 3WNMA 1GUUA 4YM0A 5EZWA 3FIWA 2WNVB 2XSDC 1A5JA 2V9KA 2EF6A 2NXNB 3HD8B 2KJCA 1OCPA 2K02A 1K45A 4F3QA 1W2UA 1XNAA 3JD72 5HPOA 4HPKB 3ZOIA 2IVIB 3TNPB 3WTSC 2VBWA 3TEWA 1X50A 4XF1A 2D6NA 1ZELA 4MX3A 1NH3A 5FY0A 3R0RA 1IZ3A 4XR6A 2K86A 1J9IA 3CF6E 2JKXA 4E7ZA 2VIXA 1AJOA 4GA9A 5FBZA 2COBA 4IESA 3JRBA 2MD0A 1S72I 5FWEA 3I2KA 4JGZC 1WZ2A 5A7PA 3U14A 1X33A 1RMU2 5CFDC 4A12A 1LOFC 2QLZA 3ZYFA 1VBD2 3OGVA 5CG8A 1NHAA 4RA2A 1S0FA 4COYA 4AFBA 5KR7A 4KT5C 3L2UA 1PIV3 3SZPA 5D8KB 4BIFA 4XK4A 2WSUA 1OURA 3WX5A 3CDLA 4EGZA 1OCRH 3X2QH 2DTRA 3FC0A 1R1VA 5L7OB 5FZ8A 3BR5A 1U0AA 2JT1A 1L7QA 5C44J 3GMEA 2Q4SA 3O6BB 4ENJA 1GV2A 2ESHA 4TLFA 5DZGA 4J00A 1T98A 1CONA 2FOKA 1QEXA 3NNGA 3PUIA 2R5ZA 3TL4X 2H0BA 3OGGA 3NV3A 4OHYA 3QRFF 3FDYA 2ZX2A 3NMBA 2GA2A 1RMU3 4LO5B 4CCMA 1S7AA 2CDOA 1YYNA 4Z92B 3CJIC 4P96A 3HKZN 4COZA 1JGSA 4IEWA 2R1DA 3FHNA 3OD0A 1AR71 2HLEA 2W1SA 2B42B 4XFAA 5D5VB 3I3DA 2PJPA 4BHCA 2D40A 4JQTA 2YHJA 4BH9A 2OCEA 1OUSA 2WAEA 4XLCA 4A4AA 3QLQA 1IG0A 4IEYA 4CP9A 2LTNA 1CZTA 3GZ5A 4S05A 3NAPB 3UJQA 4EJWA 4AVTA 4ESFA 2NVUB 4MGYE 2VMCA 1GWKA 3FKIJ 3RKYA 4DUWA 2BHYA 3D82A 3GZ6A 1CAVA 1B59A 1FMD1 5IYCJ 5D8AA 3D6EA 2CV2A 2QENA 3D0SA 5HCAA 4M3FA 1JYXA 5JLWA 3CJQB 4WV8A 2V26A 5LK5A 2JICA 2GN7A 3KP6A 3KYLA 1H8TC 3BCWA 3IC7A 4RGUA 4O5VA 3VSLA 2RJKA 2K3FA 1NY72 3ZN6B 4ZS3A 4BKXA 4YG2F 1J58A 1U5YA 4X6RB 5BNPA 1QZYA 1OHFA 4MTDA 5FXXA 1Z21A 1JUIA 3JREA 4ATEA 2AACA 2JSPA 4YGBA 4DUXA 3SFIA 3RQ0A 4Y22B 2Y6KA 2BVVA 1DQ1A 1XNDA 5B3SH 3E5XA 5ICCA 2HNHA 5DUVA 3AFGA 1VMJA 1S55A 3AJZA 2Z3YA 2KDZA 4IXAA 3EUHC 5FPXA 2A5ZA 3K4ZA 4PDWA 4Y1VA 2BU9A 2IEKA 2VONA 4UW5A 2ZEZA 1XG1A 4TXWA 2E19A 3VZNA 3PQKA 4WXCA 5GTIC 1PZ8A 3DN7A 4N90A 3WE2A 4IDZA 4YG3A 2HWVA 1KONA 2Y30A 4HX8A 4RAGA 1FJLA 2DFCA 4DB5A 1N3OA 1A35A 4BIOA 2DURA 5TISC 3A03A 3ZGKA 1ST8A 5FZMA 1XGSA 1VBE3 3OWTA 5DV5A 2Y33A 5KK1A 2WWUA 3EUAA 4A3LJ 1MD0A 1JI8A 2VJIA 2HWD1 3O8GA 5JI9A 3I2OA 2CQKA 4HN1A 4A3GJ 4MGTA 4AE2A 1OYIA 3F6OA 3KHBA 3ZXSA 1OCCH 2PLYA 1I1SA 2HBUA 4KU7A 3TGNA 2SLIA 2VNGA 4AEMA 3BOQA 3C7HA 6PAXA 3A01B 4RGXA 1ZZCA 3NNFA 2ORXA 2HQ5A 2OVUA 4CSWA 2EJRA 5L3GA 1LE8A 1S2EA 3IDEA 2V1UA 1TE1B 1SHWB 5J7MA 4A45A 1VBA2 3E97A 1BEV3 1VPHA 3I2FA 2WFF2 1E3OC 1TZOA 3EDPA 4ONUA 2L7KA 3FMGA 2FU4A 1SMYF 1F8VA 3BOWA 2JDNA 5BNNA 4QPIC 2VU9A 4RS5A 4PF1A 4N7UA 2D93A 1YIPA 1V00A 3DXJF 4IERA 4IF4A 2IA2A 3D4KA 2VN2A 4ON0A 1IW7F 1LEAA 3CQOA 3QQAA 3FMRA 2GH2A 4IE5A 1KQ9A 1VQ6I 4AAPA 4LMYA 1H4GA 1H6XA 4CO8A 2YR2A 4M74A 3QH7A 5GTHC 4FPFA 1G59A 3H1CA 2XJUA 4RN5A 2R93J 2IS1A 1YFUA 3NJZA 4M3DA 5K5QA 2HWE1 4IRHA 2QSHX 4BJ5C 2GC2A 4MNUA 1Y39A 3OD4A 4QX0A 4UXAA 1H2MA 2V5DA 1HKQA 3QYBA 5L9VA 1LEDA 3RVHA 1UYPA 3HSFA 1WMFA 1YTYA 4FAHA 4Y5SA 4X1EA 5HDNA 1J0RA 1SD6A 5DM6F 3JD73 4CPBA 2QQJA 4N0BA 3LSEA 1VQ9I 3I97A 2XPUA 1RIRA 5F3GA 4AZZA 2K9SA 4XUNA 5BV6A 4XFHA 4IOAF 4XKWA 3HHHA 1NE6A 3FLRA 2GOXB 3AVSA 4FBFA 3THDA 4FASD 2Y9ZA 2LK2A 2KLOA 2LLKA 4UFHA 4YW2A 5BNOB 1XSRA 2ET1A 4FPEA 4RB1A 2F4LA 4Z07A 2EILH 1WCQA 3RIRA 2FQ3A 1V6NA 3N05A 4P00B 1SLTA 3I2GA 1GT0C 1FY7A 2W48A 2VTFA 1PHMA 1QQIA 4A69C 1SACA 2YC4A 3JU9A 2OW4A 1WJDA 3VB2A 2CW8A 5BXXA 3X29B 1OA2A 3I71A 5FYMA 1K6OA 1QMJA 2FMYA 2WQ4A 4ZTJA 4UUSA 1EPZA 2H8WA 1RJ8A 4I76A 4IV3A 2KKOA 5EIYB 2VOKA 2ICWG 4H14A 4YVSA 3BYWA 3LWCA 1RUNA 2RDQA 2GM4A 2QZ8A 5E8GA 5LBBA 1JYTA 4E9KA 1X36A 3M4FA 2J1UA 2Q1ZB 3P9KA 3AB0A 3WSOA 5FYCA 1XTAA 2OA4A 4RD7A 2XGCA 5G04L 3ELKA 2KD7A 1FX7A 2COMA 5E3OA 4AYBA 3IN9A 4N43C 4KG8A 4ENKA 4Z2WA 1WA4A 3CD6I 3I3BA 4A7ZA 1D2QA 4JK1X 2L4AA 5IVYA 2DCYA 1D8KA 3PMSA 1MS3A 2DTYA 2XJTA 3GDBA 3TEDA 3B93A 1LJ7A 5IJRA 4LOTA 1W8NA 4Z2AA 2GNTA 1LJ9A 2DAOA 2LBFA 5GP9A 2JE8A 4H4KC 5BNGA 1NXD1 4CA0A 4ENMA 2RG4A 3O8HA 2X51A 1PVXA 4YM1A 3FLTA 2I45A 3G1LA 3RZHA 1S0GA 1W0UA 2CYYA 2XR4A 2WLPA 2WNEA 3VSKA 4EM0B 3BR2A 2R7EB 4CUAA 4AQSA 1LGCA 3WV6A 1GWLA 4PLNA 3ZR6A 3PJQA 5CADA 1W8WA 2ET7A 4BQNA 2DFFA 3SCFA 3T1MA 1RUI1 2ZKLA 5EPAA 3I59A 3H50A 2LKPA 4RGKA 2JG9B 1DYOA 4NB5A 3ETQA 4RGAA 1VBE1 4XKCA 1IS5A 1RVF1 2QBXA 4LHNA 1BHGA 2A6WA 4BAYA 3ZN4A 4CP2A 4LIVA 3NW4A 3HOSA 2NVQJ 4HN0A 2DK5A 3OOXA 4DEVA 2DDAA 1IN6A 3E5QA 3OL3A 5F1RA 1MSEC 5K7FA 4XAEA 1KS5A 3RFRA 1BBT2 2FF4A 1X1CA 2ZNZA 5JFRA 1LOFA 4KIGA 3KEYA 4X8NA 2YBKA 5J40A 4NWWA 4XCBA 4FHTA 2CRGA 2Q8KA 4CYCB 2L9NA 1TQPA 3DTKA 1BXHA 2BOJA 3K1NA 5IT6A 4FTHA 2LF7A 3ZYPA 5IYBJ 4NHXA 4R79A 3VHRA 1ZG5A 2P81A 2PQ8A 2ZXIA 3RTRA 1ULEA 3POWA 4LTAA 1U9OA 3DBLB 2ATFA 1UB9A 4B7KA 3RI8A 5CYVA 2XGEA 3VKLA 2NOGA 3BWGA 1RUOA 2BWAA 5D6EA 4FOWA 4JKLA 1B35A 2VOXA 4AC0A 2JDAA 2A71A 4ZDOA 2RM22 3OPTA 1MNMC 5E1XA 2J1EA 2DBNA 5A3NA 2GN3A 4LA2A 3LA3A 2ISYA 4LOCA 3H8UA 2W84A 4E7KA 5FZIA 3K2ZA 2KRFA 4ZC3A 2EICA 1SFXA 3DU6A 4IV1B 1AX2A 3PVEA 3BY6A 4PDWB 2L01A 2JA2A 3PUQA 1LU2A 4QQPA 1ZYRF 2ZGSA 3HNYM 2M0MA 2LALA 3OBAA 4QX3A 2IA1A 1PJRA 3AMNA 4BQ4A 2X0LA 5CVRA 2JG9A 3SEPA 3POGA 3Q8BA 4HK9A 1IQDC 1O59A 5C3RA 1BOAA 4JGYC 2W9XA 4IE7A 2Z1DA 2PHWA 5C9AA 2BZDA 1JOPA 2PMUA 2UY8A 3TW7A 4OI2A 1RUC3 2VZTA 3HJRA 5AFBA 4PSWA 4EJRA 4KIBA 4NNJA 3KQRA 3TDUC 1SLBA 3CDZB 1MBEA 3KZZA 4QQOA 4ZPIA 4E6KG 3CC4I 4IVNA 1BR1A 2E35A 3VDBA 1UX7A 4GWIA 5CAZA 4BYYA 4XCAA 1OYWA 1MEC3 2B0LA 4P9IA 4XW3A 2KR2A 4F91B 4GJZA 4XEZA 1AHDP 1S3JA 1AUYA 4IV1C 3GZUC 3JBG1 3K4AA 5FUIA 3LSRA 2XAJA 2NVTJ 1ZR4A 3UGHA 2BE5F 5J4VA 2X8KA 4D94A 3QPTA 5L7OC 3L1PA 2BOLA 1E5RA 1EKEA 2RNGA 2OQGA 2IXHA 2XJPA 5LY1A 5FDBA 4PHZA 4NC8A 4M6VA 1QU3A 1GNYA 4S2GA 4B4QA 1VIWB 4OUEA 4XM3A 2ELHA 3BG9A 3POJA 4YIIA 1DHKB 5LGNA 3JRGA 1SD4A 1PGL2 2EPFA 4ZXKA 3G71I 4CVUA 2OZJA 2W1QA 3VBFB 3TWIA 1NG7A 5FZFA 3RPQA 3BI3A 3PL8A 5ED4A 2JUCA 4M9XA 4MO3M 3SXYA 2YY1A 4D3WA 1IF1A 1E57A 5ANQA 4AI8A 2VR4A 4NMIA 3I9V2 3KGZA 2DA7A 4XLFA 1SPPA 5F6KA 2DT5A 4AIDA 3ML6A 2WADA 4C9YA 1B09A 2BY1A 1SANA 2K9NA 2F48A 1LEMA 4DBQA 2D45A 3ZR5A 1A34A 4CEYB 3JBG2 3LFMA 2JB4A 3ZO0B 5H6QA 2JX9A 4KFCA 3CO6C 2ZXHA 1RXGA 2E7QA 4NC6A 3OY8B 4YNIA 3I3QA 3F8MA 2L9LA 1E3PA 2J1SA 2VKHA 4HG6B 1GZWA 5A3UA 4PT6A 1RUF1 4ZYGA 4BY1J 3ESWB 3V56A 3KE2A 4IEUA 1SLCA 1P4WA 4Q1RA 5C5TA 3AMQA 2RR13 3LE0A 3FBIB 3WG1A 1P4XA 2HDDA 4IQPA 3O0WA 3ZMSA 2E26A 4CXXA 1QNWA 1YLFA 2V09A 4U87A 1C5HA 1QPMA 1RUH3 2WV0A 1XNTA 5J98B 2ADEA 4NRMA 2E53A 2ARXA 4OI4A 2G1MA 1R092 2VJXA 5LK7B 4GIQA 5M3FJ 2LVSA 2XG3A 2F4PA 3JSPA 5C8CB 1ETXA 1KFUL 3DLLF 3BQYA 3PVBB 5CLSA 2R3SA 2Y26A 2XSJC 2L9RA 3IZOA 2HR3A 3HSRA 5FZEA 3L7WA 1B9NA 5E1RA 4BWOA 1AR61 3HRMA 1KRIA 2PXJA 2A70A 4YGEA 1MMGA 3DLAA 5FGMA 5GLWA 3ILNA 3J7YJ 4M3CF 5DDJ3 4YFZA 5T55A 2KJBA 4ZYHA 2F4MB 4OIPF 1CN1A 3H3LA 4PBOA 1SVOA 2RMU1 4R8HA 2WN3A 2XJSA 2RM21 3VBSC 3CCSI 1PGL1 1WI3A 2JE7A 1Z77A 5ERIA 1JKOC 2R0FA 1FMWA 1T6BX 4XIKA 4FI9A 3RCOA 5JUVA 4AW7A 2CV1A 4DQ2A 5SV8A 2LH9A 2YC0A 4JV4A 4QB1A 1PUFB 3DV8A 1SDWA 5HXVA 4XONA 5C4WA 3N9QA 1D5VA 4DXTA 1REDA 4FPKA 2OU2A 3FZVA 1JZ6A 3VD5A 3G7DA 2ZJRF 3TO9A 1BBYA 4X6QB 4CDWB 1NCRC 1BVP1 2AC1A 3D0JA 3TN92 2RR12 3NQHA 3HT2A 4YVWA 1MGTA 2DYSH 1WD4A 2OT7A 1HLVA 1I1EA 1G8XA 4UF0A 4JZRA 3H42B 2LY1A 3Q8CA 2M34A 2VQAA 1AA7A 3WOGA 1LNWA 1R58A 3K10A 1AXKA 1LTEA 3BTCA 2HWB2 3PUAA 4YFNF 3SNMA 3V64A 4RGRA 2XRLA 5JI7A 5C6CA 4KDPA 4MHUA 5FP9A 3OJBA 4YGCA 4AU7A 3WGIA 3TYJA 2LKSA 3BPVA 1AXZA 1EV7A 3AZVA 2WZPP 4E7JA 1DFQA 3KSCA 3M3IA 5FYHA 2K9LA 4QHZA 1AR93 3DUIA 4GMP3 1JYCA 4DY5A 3B01A 3BKZA 2R7FA 4S04A 5E18F 2OQRA 2PBIA 1CJDA 5D5UB 3P6BA 4EN0A 1Z6RA 3TB0A 3H5AA 1S0DA 3VL9A 3K4DA 4KQ7A 3H9JA 1Y4WA 3ZMTA 2K2SA 3CMYA 3WZ1A 2D6KA 4ZONA 1LENA 3EUKL 1GV9A 4E2GA 1G2HA 1QHHD 1M4WA 3U1KA 3VBHB 4PUSA 2EXJA 1ZR2A 5GAHJ 2BEOA 2BJSA 3VBHC 4J19A 2O0YA 4XRSA 1XCVA 2R043 3T5XA 4Q0SA 4UUTA 3ZLIA 1ODDA 5A1FA 4KUMA 3MVPA 3VDDA 3WNKA 3B9IA 1BL0A 3KP3A 1ODMA 1W6NB 2XVKA 1W6MA 4UF0B 3OSFA 3N4MA 5J09A 1IUFA 5EYYA 2H6CA 1FWZA 4JHZA 2CW0F 5FY8A 2RN7A 1SFKA 1W03A 3I3EA 1NE4A 4TN7A 2UWMA 3OS1A 5F5CA 1R1A1 2CGOA 4O9GA 4FFGA 2AO9A 1FOD3 2HYJA 1HXS2 4KYWA 4RAZA 3VZJA 3N9NA 1MS0A 3F23A 3W2AA 1UY0A 1T8IA 3FK7A 2R042 1FLIA 3ZVXA 2M5WA 5HOOA 4OAZA 2VQ0A 3DPLC 3S16J 2QSGX 3VZKA 3RNSA 1PP8F 4ASKA 3WLUA 5F6LB 2NS8A 4KMQA 2E5ZA 4FFIA 3ZFFA 4BXFA 5DCMA 1YHQI 4QKFA 5ACA1 1T2KA 4LBLA 3OGJA 1G3SA 2QJVA 4AI1A 2YU3A 4MGIE 4XMAA 4NHMA 4CA9A 4CU6A 3NWSA 4GMP1 1AYM3 3AG2H 4NQWA 4RQPB 3ZPLA 1KU9A 1JHNA 2R16A 1MQTC 1ULFA 3S1QJ 5G05L 1O4XA 4QKDA 4KL1A 4FPHA 4NHJA 3FX3A 3GTKJ 4Q4V3 4U7BA 1ZBA1 4KH9A 3F8NA 3CDHA 1VQKI 1WW4A 4D5FA 1LFUP 4X0GA 3KP7A 2NQYA 4BK5A 1X4OA 3R05A 1REPC 1BQPA 4Z8BA 4KBZA 3M3QA 2GIVA 2WB1A 4AYUA 2E2JJ 3LL7A 3TOBA 3N3HA 4G9SB 5GKAC 1HRI2 2BFUS 1MMNA 1OBNA 5FZ4A 1FOYA 3TKYA 2EZIA 3TEZA 1TG7A 2PA7A 1O3SA 3KD4A 2BVLA 1JW6A 1TT5B 2H09A 5FRNA 2VUCA 2VI6A 2F5DA 1WJEA 4NROA 5CKQA 2XF7A 1EF4A 2QDNA 4XUOA 1OR7C 2EV0A 4G8XA 2XC7A 1KQRA 3E1SA 2FBHA 3RZGA 1K5MB 4AI0A 4KN7X 3BG6A 1ZREA 1C4RA 2IZWA 2P4WA 4HLXA 1SDDB 1H8VA 4AVSA 3RZKA 1W6PB 5AVAA 2VVFA 3C2HA 2UUZA 4NR1A 4L99A 5FREA 1MBHA 2VNRA 2XBO2 4XAAA 2EIMH 3GTLJ 2PFWA 3KV6A 4KICA 1GWMA 3CHXA 3U0ZA 4GAZA 1HX6A 3E6MA 4OWRB 4MGSA 1QO0D 4UAPA 1A31A 1DIWA 2ILMA 5D5XB 3I4NJ 1W28A 2VBZA 3OYIA 2QQPA 3S3NA 1AVBA 2CG4A 3SEEA 4G7ZF 2RR11 4QPOA 3LWFA 5FKNA 1BIAA 4B3XA 1UPSA 3ZSEA 2FA5A 1W2AX 4Y15A 3K46A 5KHHA 2WNUB 2HWF1 1SMTA 2KA3A 1VR3A 3MN2A 1YRZA 1XSQA 4B8XA 3CTAA 3ACIA 2EIJH 1QJX2 1J3RA 2WFF1 4NPLA 1CX4A 1LHNA 2BFUL 3UKTA 1YQAA 3VBSA 4LB6B 4KWLA 2JDUA 4L18B 4QB6A 1WH7A 1LB2A 5JLXA 4BQ5A 3HL2A 2CUFA 1IPSA 1S9HA 4L0YB 3KF5A 2WY7Q 1K6YA 1QJU3 4AVBA 1MS8A 4OAYA 2F4OB 4Y3OA 5APAA 4KNYA 4LKDA 2VASA 1AR82 1HB2A 4XACA 4RBOA 1S0EA 5DAWA 1UL9A 2XB5A 3OEAA 4XLEA 4BQAA 2LD5A 5HNFA 4Y4YA 4AHYA 3T0BA 3ERED 1RR8C 1EAH1 1OA4A 4YGDA 4AHZA 1UZYA 2MYSA 4BQ1A 4RB0A 4WVWA 3ZMDA 5GLVA 4QM9A 2VVDA 5TRDA 3MUY1 3BLYA 3PNTA 2A6ZA 3RMYA 4C2UA 4HMZA 3WXPA 4NC7A 4R52A 3J7AO 4EJTA 2RJLA 4ZDLA 1VTNC 3NAPC 2WB1N 3RPUA 1C8NA 1EP0A 1PVC1 4AOCA 2QCSB 2RMU2 5CVUA 5GZEA 1F4KA 4IE4A 2JA6J 3P5BA 3ASNH 3WNLA 2Q8CA 5GZCA 5K0UB 3QU6A 3S1RJ 3MYXA 1IS6A 4KU8A 5DM7F 5FP7A 4V2GA 3A0NA 3QPLA 4QHOA 2ZKNA 2HGCA 3W6JB 1UOFA 4GWMA 2IW5A 3J9SA 2EVXA 1X8MA 4NN0A 4LMFA 1CAWA 1S0IA 1IKPA 1KU2A 4QQ2A 2XAGA 2VZRA 1MSFC 1P4AA 1Q3EA 4IGOA 4Q4V2 2R4GA 5E1WA 3TP0A 1PVC3 5BPIA 4FT8A 1HB3A 5H2FC 1NK2P 3BOPA 2LREA 1QIQA 1GR3A 5CPRB 2HZDA 2NMNA 1R5GA 5HS8A 2O1QA 1EH7A 4LR4A 3I5UA 3J7LA 2XF5A 3ZFGC 3OUIA 5I93A 3VB9A 5K0UC 1GOFA 4FVVA 1WRJA 5F0FA 1W06A 1OF3A 5LA9A 1RUJ3 3WEZA 2B46X 1WBFA 2JD9A 5I8SA 4CU8A 1WHUA 1WJAA 3WGHA 4HV5A 1I9RA 4XTPA 2WZ8A 2KZVA 4YVWC 3SMHA 5TGTA 2EFOA 1BLZA 2M8EA 1W9FA 3USUA 3OGRA 5H9QA 2V1NA 3ZQLA 3O0XA 2O7OA 2XGDA 3CUQB 3VHNA 4AWDA 3WTVC 3EYIA 3VZOA 1XMKA 4JOMA 1XRUA 2XV4S 3OS2A 2WO1A 1A8DA 4E7LA 3SKVA 3KETA 1RTVA 4PQ9A 1YCIA 5FPZA 4MFEA 2R32A 1DLCA 2E63A 4FPOB 2HKOA 1IXCA 1J83A 4PIZA 1UY3A 3ZXGA 3LDRA 4D7TA 3PFIA 3WHUA 2ZACA 4A41A 4NOTA 2UV1A 2MD5A 4Q27A 3MIBA 1C1FA 3B6CA 3S0MA 3WTTC 4EZ4A 2ZGLA 4QGLA 1BJAA 1AXYA 2ZGRA 2JVHA 3M8EA 1R1UA 3ES1A 2ZAHA 5JCTA 1I6XA 2M4GA 4E2QA 1H4HA 2Z2SB 1VQMI 4P9GA 1MJAA 4P9JA 3HOXJ 4F7ZA 3ZMVA 3DEMA 5A1AA 2GBYA 4MUVA 3TBDA 3K7AJ 1PZ9A 3BTXA 3M9AA 4PJ0C 4CEWC 4HEA2 4A6SA 4PJJA 1COV1 1PUFA 4DO0A 2X29A 2ZFUA 5LBFA 2P3IA 3CP8A 1KEXA 3IL2A 2DA2A 2AQEA 3PVNA 2KL4A 3OYCA 4Q0VA 3KP5A 1ETYA 1R6RA 1F5JA 3M7AA 2BY0A 3PDQA 2VM9A 3LOBA 2FSWA 3J80Z 1FOWA 5J96B 1N3QA 1T0FA 4E8DA 1G9DA 2JG8B 3KFWX 2KIUA 2LKXA 1UYXA 1JT0A 1H1IA 4JBAA 3K2OA 1RUD1 3P7NA 3LF7A 4B43A 5EYXA 4LLNA 2YC2A 3WNNA 3U4XA 2R5ZB 3QWLA 2WFPA 3I4PA 1D4M2 4SBVA 4NBQA 1YNAA 5KHDA 4QU2A 2Q1FA 3MO4A 2P6SA 2B63J 1XN7A 2VPLA 3RQ4A 3OIOA 1QWRA 3QYFA 2W92A 5A3WA 2WC2A 1T56A 1QHDA 5JR2A 5HLGA 2VXJA 4FETA 3CUOA 1AL0G 3OB8A 1PNFA 4L8QA 4XJWA 1RMU1 3B3QE 3CF2A 4YVSC 1Z67A 3DFGA 2UURA 5B66C 5IW0A 1OXCA 2WJSA 3ISPA 1X7NA 3LSKA 5HNHA 1RKWA 1NLRA 2BNMA 1KZHA 3VBUC 2CSOA 2X6WA 1T39A 5GM0A 3HWJA 1I1GA 2WO7A 1UYZA 2ZS6B 4NRPA 2X5IA 2ZHMA 1CZSA 3SEQA 2XMLA 4QB2A 3DKWA 1T38A 2PMZN 1W0TA 1AJKA 3BG7A 4YFKF 4YVWB 1SFPA 4F93B 4K1ZA 1USSA 2W25A 4CDWC 5J3LA 2KIFA 1BEV1 5L9RA 4LO7A 5LD2C 1ZRCA 3HAGA 3LA7A 3LIHA 3K2AA 4IW3A 5DZFA 2F17A 3T4VA 1EJ9A 3S32A 2HH9A 4QPIA 2IXJA 2X85A 5IAXA 1XNBA 4INDA 4ASNA 4I3PA 1ZHFA 2F5FA 4A3JJ 4IQJA 2XWBB 1FSHA 1RIOH 5E1ZB 4WM8C 2CWSA 2KFDA 3UKVA 1BC7C 1W8OA 5HLIA 2XJVA 3F2ZA 1Q8SA 2DOEA 4DOUA 2ELJA 1V70A 4LKSA 2QKDA 2IGNA 2KT0A 2JVGA 5DCMB 3ZKUA 3K77A 2X6XA 3IAPA 1ORKA 3T8TA 1B35C 2PMWB 4UFMA 2OXBA 3DECA 1R5ID 4IEVA 1VMFA 2I5UA 3GJBA 3REOA 4RHV2 3VBOC 1I3AA 2Z16A 2ZTNA 3SH3A 2XQXA 1W0PA 5DN2A 2DU0A 2CUEA 3FN9A 3NV4A 5ABJB 2LM3A 3GFMA 2QQKA 5FUPA 3K3NA 3O5SA 4QGNA 5C4WB 2DLLA 3U78A 4EEFG 3BPZA 1GQHA 3SZTA 4FPLA 2X10A 3GFJA 3VYSB 4NPMA 5A6YA 3V0AA 4LJHA 3NRVA 2NMOA 2E7WA 1GHCA 3F6VA 3DEUA 5L3FA 2BNNA 2VMIA 5F39A 4ES9A 1R22A 2VL8A 3DCQA 5BNPB 1DQ6A 5FMOL 3USUB 3MZ8A 1QVTA 3D1NI 4CDUB 3DL3A 5GADJ 2OV7A 1DYKA 4UB8C 1WW6A 4HBLA 4LD5A 3UESA 2E7TA 2DBIA 1MS5A 1IRZA 1V9U1 4YARA 3RPUD 3PUHA 3ZMNA 3K4KA 3SHFA 2KDOA 5FZKA 4QX8A 2P6CA 3KP4A 4EM2A 2NYXA 2JKBA 2O9LA 1D1AA 2NRAC 5FZ9A 2X1EA 1UWWA 3EMRA 3RZJA 3NVCA 4FPJA 3VEPA 3OYLA 4HF0A 5DCFA 3OOUA 3M1HA 3WP5A 1PX4A 1SBEA 3AFKA 2DN0A 3ASOH 1UHMA 2BGPA 3MW4A 4GMP0 2A1XA 3DU5A 1Y56A 2YUEA 2ZGOA 2Z9OA 4PSXA 1KJRA 1GICA 4LK7A 3WHBA 1F4HA 1XXNA 2M0CA 1IGNA 3UR3C 1UOGA 1ETVA 4YVSB 1G9CA 3H1MA 3OUHA 2ZC2A 1QF3A 4GXOA 2X1DA 1N1VA 2MPFA 2GALA 3LD8A 3LFUA 3S17J 3OGSA 2VUDA 4YRVA 4M00A 5LY2A 3OIPA 1PUEE 4BNCA 4FP2A 4N53A 1YS7A 1NY71 5FZCA 3LEKA 2CTVA 4YWAA 4P9UA 3WDWA 2BXZA 3P9CA 2XL9A 1UZVA 3WF4A 1U12A 1VB2A 1TWGJ 3IUOA 1HXDA 3MD2A 3I53A 4EJOA 4WM7A 3VYUB 2PLV3 4CXFA 4JGYB 3GLXA 5J1UA 3L2QA 2K4JA 3MICA 4RFT0 3EPZA 2Y8KA 4AI2A 3GZTB 2A68F 1IC8A 2ZHKA 2QVSB 3I4MJ 2ZGQA 4C0BA 5KXCA 2XVCA 3HM5A 4AXOA 3FUQA 1GVDA 4RQPC 4F92B 2ISZA 4D8MA 3SKJE 4XOTA 4JQRA 2F5CA 2D98A 1V5FA 2B7EA 5L3CA 2ZMEA 2PI0A 2ZJQF 1SEUA 4UFKA 4DY3A 1ASJ3 1G6NA 3V8KA 2PAEA 1DG6A 1CZVA 3PTRB 3LSPA 1JXSA 2DT7B 5B1AH 1LHOA 3LOIA 4EN8B 1B35B 1DYPA 4HVQA 3ZSLA 1BKZA 1AYM2 3I64A 2VQGA 4BQ2A 1ZM1A 1N75A 3WVJA 2WRAA 1ETKA 4IEXA 5F2WA 1NA1B 4DNCA 2RS32 1QDCA 1NQJA 4A0ZA 3B73A 1FX5A 5EQUA 2BVBA 3LEGA 5JPNB 1D3YA 4O6JA 4U0WA 3RMXA 1OD3A 5FYZA 4PIYA 3DPRB 4OINF 4ZTFA 2P5VA 3JAMK 3OYAA 4XDOA 3ZM8A 5IP6A 2C5DA 4G94A 2UY9A 5A33B 4XSXF 1IRXA 1B8IA 4R1HA 1QBJA 2WNUC 2AENA 4NQWB 3BIWE 1URXA 5F3IA 2O3FA 1JYIA 5JMOA 1UU5A 5IVJA 3BJOA 1WKYA 3VZLA 5EF6A 1F43A 3DYMA 4KGGA 1Q1VA 1JT6A 2Y6HA 1JUMA 5DG2A 4CCCA 4Q48A 4XVHA 3PJRA 5T50A 2HVQA 4Q4Y1 1SVMA 4GWJA 3QPSA 1YIOA 2B8MA 3D5OA 4RAFA 1GLNA 4D5CA 2XL7A 2VCBA 3JRDA 1W6OA 1UX6A 2ETHA 1FAYA 2I07B 2OD5A 2CY6A 5C8WA 2QKMB 2XH6A 2W57A 5FY4A 5J36A 1AR62 2UWCA 4NWVA 1XU2A 5LEJA 2XLAA 5E88A 3G3ZA 3RZZA 4BMEA 2CV6A 4LFUA 4ZXEA 4DYRA 1W0NA 2KHMA 5HLTA 5IUQA 5EP9A 1U5TB 1Y0NA 3NL1A 1BW6A 2EIKH 5LRSA 2JDPA 2NYYA 1UOJA 3ZRGA 1PM7A 4V19K 3N7LA 2FE3A 5B2GB 3VYTB 5LASA 3CBNA 4KT6A 1I3QJ 4MZUA 1R64A 1HXS1 3GNEA 5JIUA 3GZNB 2QQMA 1DU3D 4FOVA 1TNSA 3MW3A 3EJKA 1GVJA 3I7DA 1W2NA 3FUOA 1GQGA 2I8DA 2R7XA 1V9U2 4C3JJ 3F21A 1IV6A 1AR83 2ZJ2A 2FOWA 4L9TA 3ZSJA 1MZEA 2K5CA 4Q0UA 2BPA2 3LDBA 1K42A 4D7MA 2W4SA 1Z6TA 3F22A 2JQ7A 4IQ4A 5JMCA 3ZOBA 3PIGA 4URAA 5C70A 4OMYA 3QAHA 3PM1A 2C24A 4WVMA 4MHRA 5FZ3A 3VKFC 5CQEA 1D0HA 1O8SA 5DUXA 3AG3H 1KS4A 3PNAA 2WUHA 5EZHA 1N3PA 2C0ZA 2WZR3 3GTOJ 1XNCA 2IS6A 4E2SA 2P7CB 2R7VA 3C7OA 3I3MA 4M4RA 1S0JA 3BPSA 5JAXA 2YFZA 2P2KA 4XRSG 3NJVA 3QU3A 4KWKA 2QQIA 4ETSA 1BI2A 3T4HB 2DTWA 3M7GA 2FCVA 5FROA 1VFCA 2JRMA 4HXCA 3W3CA 4HX4A 3AP9A 5D8AB 2Q0AA 2OUMA 3ES4A 1JYVA 5ICEA 1VBD1 4DGWB 4EZHA 1DQ0A 2A5WA 4BGDA 3A2KA 2Q2EA 2DCKA 2FBIA 1YI9A 4Q4W2 2QQ8A 5DDJ1 5CKNA 3WG7H 3JQXA 1SLIA 4TTGA 4OZXA 3SH5A 2X6YA 1QOOA 4EN9B 4NUBA 4E7SA 3AZYA 1LVKA 1ND2A 4N43B 2NAZA 4BL0B 2QZ2A 2VW2A 1XCBA 4UW6A 1XSXA 1H6YA 1L3LA 2WAFA 2UWAA 5FBJA 5C4WC 3GBFA 4HT1T 4CH7A 4RA0A 3FHAA 3OTFA 1O4ZA 5I0SA 4DJAA 2VZ1A 3WHCA 2E2HJ 2HYFA 4ES8A 1RUE2 3T3YA 1C8M2 4EQVA 4OULA 4AHWA 4WK8F 1UIJA 3JRFA 1L7RA 1XMXA 3LQQA 2JDHA 4FOYA 1IN7A 5FY1A 3U2RA 3IAS2 3WTUC 4RFRB 4QPIB 3GCXA 4FTBA 2FBKA 2HEWF 2EA4A 2OPTA 1I27A 2Q1MA 4IHWA 3ZFFC 4ABZA 3TDZC 2VODA 4M3EA 3C7GA 3LPFA 4BQYA 1LHWA 2W68A 1PO23 2H6BA 1AKHA 4OCTA 5JVVA 2PAKA 3W6VA 2XJQA 3NJYA 3KMHA 5FYUA 1RUG2 3A0KA 3BN6A 2QYOA 1NAEA 3JBG3 3SITA 5D6FA 4XBFA 1FMD2 1S4CA 4EYUA 5A3OA 4W4ZA 3VBRC 5LHIA 2JG9C 1ZG3A 2VC0A 3WT3A 3KZ4C 2R49A 2X5IB 4V2VA 1PO22 4CEWB 4O61A 2DPDA 2LS6A 5FZ1A 1GKBA 3MIGA 4L9VA 4QM8A 1I5ZA 4EN6B 3J26N 5DAVA 1G9BA 3PO2J 4MFDA 5DAQA 3ILRA 5HODA 1NCQA 3TBIA 1DF0A 1YO5C 5GZFA 3ZR8X 4JCKA 1Y6IA 3NO8A 1OCOH 4EQQA 1MH3A 3R6SA 5A7SA 5FFZA 2J1VA 3VN4A 2TCTA 1AL23 5J1RA 2AZ5A 4M9SA 1PP7U 5BNNC 2WT0A 1S8NA 3ZQFA 2RJ2A 4C91A 5J8CA 4Q4X3 1ON2A 3JCIA 2DTZA 1MR5A 4Q29A 1RINA 2O8OA 2VO5A 1RHI2 1AWCA 2VUAA 3H1YA 2KM2A 3S2HJ 3VGIA 4ZY9A 1Y9GA 4LK1F 2OYZA 4IGQA 3KQ4B 2Q2EB 3U75A 2ERFA 2W85A 3HOWJ 5CA6A 5H9SA 3WY6A 3WU1B 3F3XA 2JD4A 3WCSA 2HFHA 2GC3A 2DMPA 4JGZA 4M0NA 3LZZA 4XUTA 1V6OA 1YHFA 3OYNA 4KNCA 4FPYA 2FDIA 1HIXA 1W6QB 1H88C 2ZZQA 5CKMA 1W39A 5GZGA 4LKEA 4CYCA 4XOGA 1H8TB 2V5YA 2Q30A 2EFPA 3SDGA 2L4MA 3WG9A 3ECHA 4CGZA 5IT3A 2YG0A 1UIKA 1H1MA 1N1YA 3HOVJ 2ZMEB 2DFEA 1ZZ6A 1GOHA 4QPGC 4D0PA 3HNBM 5F1JA 4JTOA 4LE3A 1VQLI 2JN6A 1X9PA 3ZYJB 2NZ9A 1QJY2 5CEHA 2JMWA 3S3MA 4CZSA 3CUQC 1ETOA 3U07A 4PZJA 5AFEA 1C0WA 5A2QZ 1EY2A 2BY2A 4BJ6C 1YW7A 3HG9A 5DYMA 1UMZA 4JC1A 3Q5FA 3IWZA 3L2YA 3C7JA 1Z7S3 4BJ0A 2VJ4A 1AYN3 3RKXA 4W65A 1UCRA 5JXJA 1UMIA 3RS6A 1VRBA 2ORZA 5CFDB 3FLPA 4KWJA 4KMUX 1PIV2 3UGFA 2RGVA 1HF0A 5A3MA 1OOPB 3WF3A 1OQYA 1T95A 4CEYA 1O4TA 3KV4A 4BQ3A 4IL6C 4HSRA 5CBLA 1IG3A 5AC92 2ME0A 2W24A 1F2NA 2YU9J 4OI1A 4LKFA 2LBFB 2EIEA 3LSHA 1Q56A 3FHIB 1ULPA 1K5JA 3I2IA 5IAVA 1JZ8A 4RQPA 3KV5A 3ACHA 4FISA 4K21A 1IRFA 1AU7A 1J3QA 5BNOA 2NS0A 2HYKA 2FNPA 3GBGA 2PMZA 3Q9OA 1B8IB 1YJKA 4L97A 1XE7A 5C4JJ 3OYGA 1XGOA 2ZSHB 3FWEA 1UFMA 5KAFC 1WZXA 1JS9A 5A7NA 1HRI1 3KLNA 5LA2A 2OPKA 2MLGA 2PMHA 1W36D 4IE6A 4NVPA 4BA6A 5FKBA 1ZBA3 1J3PA 4J01A 4GZ9A 2YS9A 2M1BA 1HV0A 3MW2A 1W9WA 5J37A 2GH8A 1YQ8A 5HBAA 4A3MJ 4GGGA 4S2DA 2MGQA 2EXKA 3MKWB 1Z7S1 3GX4X 4B1MA 4XF4A 1IRGA 3N7KA 3CZ6A 2EALA 1FP1D 2VMDA 1WCSA 4LQRA 2CHHA 3VD4A 3PIPF 2XVLA 3R4SA 1OH4A 4UVAA 3RYPA 3BB6A 4B7EA 5JXIA 2M2EA 4Q26A 1VE0A 3IIAA 3HGYA 1D4M1 1Q8VA 2STTA 1GZTA 4DS0A 3H1WA 4M71A 1C57A 4F3JA 3NRUA 5ANNA 4BS9A 2EFWA 2AQFA 3FF5A 1AKHB 2R7UA 1P9QC 3PUFA 5FPUA 4PBPA 2PHUA 5JDBA 2WKKA 4RGGA 1LUJB 3HT1A 4NIIA 1QZZA 3JRHA 3NAUA 2GP5A 2V9VA 3IH3A 2W87A 3H7JA 3O1RA 1GU3A 4U2AA 2V7FA 2A05A 4I3GA 3CMGA 1CGPA 2ETEA 3GYDA 2J1RA 1HQNA 3V7SA 3MZYA 1WJFA 4CUCA 4BLIA 2IXSA 2E34A 2C9KA 3WD5A 3K4JA 5D21A 2CWEA 3MFAA 4AUXA 2Y48A 2JB8A 2FXAA 3PIOF 4K8FA 1J2XA 1FPN2 1GUIA 4UXNA 3KX2A 2GLOA 4NHKA 3WW1A 2PELA 3MIEA 3H8OA 2RV8A 3DWLE 4BACA 3HOUJ 2EAKA 1JTZX 1EA3A 4HFSA 2R7SA 1PIV1 3WQ1A 4HAMA 2RE9A 1UHSA 5JHFA 3MBWA 1IS3A 4IV3C 1XE0A 1FIAA 4LHKA 4D7YA 4L5JA 4D69A 3ZN5A 4DXRA 2EK5A 5CIRA 4LLLA 2BHZA 4LJZF 4AFAA 4P55A 4WM8A 5JSRA 1QU0A 1UU6A 1GXQA 4XKVA 5DZEA 4N53C 3QOEA 4HVRA 4K9SA 2VTXA 5I91A 2D44A 4HRIA 2LOOA 1KD7A 2W46A 4LO4B 1HN1A 2EV5A 2JDZA 3GF2A 1FI2A 4MHGA 2W1UA 1TMF2 1VLNA 3W6KB 3GFIA 2XLGA 1OKQA 1RXFA 1ZGJA 5E16A 4D1QA 2W39A 3WTYC 1ZA7A 4Z82A 2MFZA 2MC3A 5FV3A 2MSYA 1ACCA 2IS2A 2H8RA 3ZMZA 2R5YA 3L9FA 2HEOA 2B7YA 1O6UA 1O91A 5C3SA 3POBA 2BRTA 4UVCA 2E31A 4CXWA 4IKFA 1AOYA 5FPLA 4PJMA 1TQMA 5JOWA 4D0QA 4UVBA 2CQNA 4RAYA 4DOZA 3CCYA 2DYRH 2Y9YA 1IN4A 1SMVA 4CDXA 2ZCWA 4AGRA 2DJIA 1U2WA 3E0JB 4DIQA 3AP5A 3JTHA 4HONA 4TSVA 1HB1A 2FDJA 1QH7A 1FOKA 4I30A 3LEMA 1QJX3 2Z42A 3GTPJ 5IOZA 5FZ6A 4GH4B 2HXIA 4HZFA 3VODA 1RUC1 2AR6A 3M3YJ 1FSEA 3HQRA 5KXBA 1SC7A 1FYLA 1XGMA 5EG0A 2JENA 2Y6FA 1ULCA 5C3QA 5FZ0A 3HHGA 1H2KA 2CAVA 1S0BA 2ZEWA 1D1BA 1VAVA 3CLOA 5ABJC 5DTDA 4ITCA 4N4OB 1JHHA 5E8IA 3DBRB 5A7WB 1QY4A 5IATA 1RUF2 4FQZA 1MJ9A 2VNVA 5JWPA 5C33A 3AMMA 3ZP5A 3IMNA 1KQ0A 1PMIA 5EEAA 2HVRA 2WBKA 1MVEA 2VE1A 1GDTA 2JK3A 1P7IA 3ECOA 1R5HA 1IZ1A 2IPQX 1BIBA 2Y0SN 5DUIA 4R4XA 1ZX5A 1MNDA 3IT8A 2AXLA 2JA8J 1CD3G 2N7GA 3Q8FA 3ZMOA 5EFUA 2DMTA 4CDUC 4AEDB 5GZDA 4LG0B 1FTTA 2ID6A 1Y43B 3ABLH 5F3CA 2YB7A 2GMEA 1G3WA 3O2PE 1UZCA 4LK0F 5JOXA 1F5FA 2PG4A 3I49A 4WBBA 2YFUA 4V1PA 4P5OA 5F37A 1U9NA 3LSJA 4JRLA 3WR0A 5E6HA 2VMFA 3SDBA 1R49A 1OJLA 1XDUA 3B94A 2BYVE 3P5JA 1V9U3 4YIRX 2P6HA 2X1CA 4GB33 4KGQA 3CIHA 4YZ3A 2G9FA 1H9PA 4ITVA 1A6QA 2BGOA 4PLOA 2IWGB 3LFIA 4A6OA 5LCWL 2P3YA 2BBYA 5CU1A 3OBRA 5ISLA 1U3EM 2DT6A 1OC1A 1V6JA 2BW8A 1O7FA 2NNYA 3OSDA 2EFNA 2QVOA 3P3PA 2E1NA 3CJXA 4IJAA 4XMIA 2QKLB 2B45X 2V72A 2XUEA 4XDQA 5DDGA 2ZMEC 2P3JA 2D5HA 4YRDA 3VDDC 4HW0A 3MIFA 1LGNA 2P5KA 2HTJA 3P1IA 5A6ZA 1D1CA 4FE4A 5KHKA 1H2LA 3BTYA 3WE3A 3T0YA 4GKXA 5F0CA 2FD5A 4YW7A 4QKBA 3CZUA 3L00A 1CQTA 3T1LA 2DFIA 2Y69H 3H9QA 4FSJA 2IBDA 4LBMA 2HPMA 1GP4A 1MS4A 2PYTA 1YQ5A 1TME2 3ZYIB 2B39A 3AK0A 2DVBA 2Y64A 4FFFA 1AZDA 1QNTA 1D4M3 2A73B 1TWAJ 2QDRA 1VZ0A 3D8CA 2E1OA 4I7HA 2PLV1 2J5PA 1XX5A 3H8RA 1X3UA 2OIIA 2Y0SA 4A5MA 4QX5A 4M3GA 1LECA 2GZWA 3J7AY 2VVEA 4J1WA 2PHTA 1H30A 5K0UA 2VC1A 3KP2A 5IVFA 2WNOA 1PYVA 3GHNA 4JGZB 3VBFC 1Z91A 2M87A 1LOEA 3LSDA 4U88A 2CO5A 5I0DA 2G9ZA 1Z0XA 1LOBA 3IV5A 3CL1A 3TOAA 3R0JA 2BUKA 4LA3A 1SBFA 3LOCA 3WU0A 4XXPA 4DQAA 3J7NA 3J80K 1DGRA 3ZXEA 1TL8A 1YQ6A 4NIDA 3K1MA 1WLDA 3HUGA 3VHPA 2ENRA 4CCNA 1ALYA 1STMA 2GXBA 2VZOA 1Y8RB 2ZHLA 3E6DA 4Y52J 2VOVA 4G7HF 3BGAA 1TWCJ 3J81K 1UY1A 2JXAA 5JZGA 3MEPA 2L02A 5LBEA 5CNAA 1J09A 3AG4H 1YYVA 3GBWA 4YLZA 2XASA 1MQTB 2OTJI 2GWRA 5GLZA 1RUI3 2CQQA 1BOBA 4KJZA 4BUPA 2IAIA 2WLQA 4KISA 2XRNA 2BWCA 2OF7A 4NAMA 3LPGA 4FOQA 4RM2A 2YDEA 1EAH2 4BY7J 3THTA 1ZYBA 5K1YA 3GTJJ 4MV2A 1H89C 2R7RA 1TNRA 3DPRA 4L0PA 2VKEA 1LDDA 1W36C 1AR72 3FM5A 2TBVA 3WF2A 2CQ7A 4CUBA 1IQAA 3LQCA 1GNHA 2MH2A 1ON1A 1TEIA 1TWFJ 1N77A 5LLQA 3LQRA 1TNFA 2VOTA 1VBA3 2JDKA 3OL4A 1RUI2 2ZKZA 5CISA 1LOGA 2ECBA 2ARBA 2JWTA 3MV11 3OYWB 2WS92 1WJCA 4N9HA 4Y13A 3V7CA 3C8XA 4E8CA 5CFCB 2RV9A 3SCHA 4BM8A 3SQOA 2W7NA 5FLXZ 3I0TA 2W91A 3K48A 4EMSA 4NDLA 4XABA 3USSA 5T3NA 2FNAA 1GP5A 2YGMA 2ADUA 1SVLA 2DFHA 3MF6A 5FQ0A 2XROA 2HWE2 4ZHNA 1TNTA 3HPGA 3PIJA 4UB6C 3BR1A 2WBMA 2QQNA 1JKQC 1DZRA 3IB3A 3JCUC 4DXZA 1F4AA 2MC4A 3MCZA 1VBA1 4Y1UA 1Y1VJ 4CDQB 1TW3A 5BYNA 2Y75A 3IH2A 2HS5A 1POV0 5L19A 1REFA 1DCSA 2ZO4A 3ZMUA 1IN8A 1HQCA 4XLPF 1MBGA 1OLME 1YX5A 5CFDA 5F3EA 5T5PA 3N7MA 3OOPA 1ZZ7A 2AEZA 1LFBA 1KU7A 2FEZA 4QHBA 4XN3A 1VQ8I 4TYSA 4XETA 4EV0A 2R063 5D2AA 5HCBA 2QUOA 1NKGA 4FE7A 3SISA 4META 3LA2A 1F1ZA 1V4RA 2XKPA 4BHPA 2R071 4N9IA 3O1PA 4XF9A 5K4LA 1XSVA 4IOCF 5CB7A 5KCMA 4L0ZB 1R7JA 1VNDA 4A0YA 2XPWA 2HWB1 3AKRA 1UQXA 2XBO1 1E0EA 4D6SA 2ZGPA 4GO1A 1OPCA 5FK7A 3S2WA 5FY9A 5K5RA 2D3PA 3ASIA 4LUKA 3W20A 4L11A 1WCUA 1OLTA 3VD7A 1V3FA 5EJZB 1CIYA 1MEC1 2VBBA 2P3KA 2GP3A 4XBNA 1OPOA 4Z2YA 3SLIA 5KAIC 2Z33A 1YJWI 2XUBA 3I3LA 1SQ4A 4ZYEA 1VBD3 4MGZE 2YX7A 2V6CA 4ANJA 3ZDSA 5LFAA 3ZYGA 1X4PA 1OD5A 4CTEA 4JVAA 2EBIA 1GLHA 1YFYA 3VBFA 4MQVA 3L2RA 3ZXKA 1TMF3 4HQEA 2M45A 4CCJA 1H8TA 4B1RA 1HDDC 3ACGA 4DYCA 2J22A 3C2BA 4XJ8A 4XRMA 1AHSA 3F72A 2QQWA 4FX4A 2DV9A 4ZU4A 2DDBA 4AEKA 1I39A 1IXRC 3CJNA 2VOWA 2YBPA 5JZGC 3AZXA 4U0VA 2Y0OA 5BNNB 3SXWA 3PMEA 3G4SI 4LBNA 1RZ4A 4GWNA 3VOEA 4NIHA 2OCCH 1A6CA 3T2TA 5LHGA 4Y1YA 3MWMA 2DCZA 3EETA 5KHGA 3OF1A 1Y7BA 2WA3A 2Z99A 3A4UA 3POFA 2WA0A 1DQ5A 1WLTA 2HDWA 3ABKH 3GGLA 4AFCA 2FDGA 1WCKA 2QQLA 2O61A 3IMMA 4F52A 2CL2A 1LULA 5F27A 3JB4C 2OX0A 3Q9SA 2NVYJ 4L9NA 4OMDA 1QOSA 1WVRA 1ZBE2 3K4MA 3L09A 1ZLKA 3GXUA 2XBO3 4OQ9A 1VRH1 5IT9Z 3VBHA 2WWJA 1MIJA 3WW3A 2MBFA 3ECQA 4A7YA 5K9YA 1BBT1 1J59A 4HLYA 4RHV3 1RUD3 4RYDA 2CU5A 1JZ5A 3V8JA 2K4BA 3W21A 4I98B 2D3RA 1WWYA 2L54A 2VCAA 2VQLA 2ECCA 1HJGA 2HWD2 4I6ZA 1OR7A 1UW8A 1KITA 1S5LC 2NVXJ 1IDYA 1W8UA 3M8FA 1Q5OA 2EINH 1W9YA 4XJAA 2VBYA 1RC6A 5AC91 3AAFA 1JUHA 1UKRA 2MG4A 1JKPC 1HXS3 1XBFA 2OKXA 1EH6A 1F31A 4ZDPA 2OS2A 4MO7A 1DLLA 4LOSA 1BK1A 3MLJA 3O1MA 2HWC2 4K8RB 1NA1A 1QQP1 5DEQA 2W0XA 3HVDA 2VE8A 5C8CA 5DUWA 4JX0A 1YIJI 4R4ZA 3ZDVA 4U7DA 2R1BA 1WMXA 2YGLA 3N36A 1F15A 2ZGUA 2G19A 1XU1A 4C8DA 5E3MA 2PJRA 3APBA 2W94A 2ZAAA 3TN91 2FCTA 5F2SA 1QNYA 4FP3A 4M3CE 4LULA 4FQGA 3CKHA 4YZ1A 2JRTA 2FRHA 4JRAA 3WP4A 4A0XA 2WWSA 2A7AA 3BG5A 5FFXA 3KCXA 3R4KA 2WZR1 5HXMA 3MEXA 2GIZA 2R6QA 2ARAA 3LMMA 4DFSA 4QX2A 3NSTA 3DP7A 5DMYA 4AVAA 3CCLI 4E7HA 5C71A 1E2XA 1RUH2 2UU8A 1IOAA 2CNAA 3K70C 4YM3A 4PI0A 4IL7A 4N4NB 4HDUA 1AYM1 5GLUA 5AONA 3ZYHA 4HQMA 4BQOA 5HV0A 4QT6A 1CAVB 4BBRJ 5C9AB 5E3LA 5AC93 1DP3A 4TWTA 1W4MA 5CVVA 4IHTA 1C1LA 3Q3SA 4A5NA 4V2FA 3WP6A 3CCRI 4IEJA 4GYIA 3A4CA 3BC8A 2W5FA 4QXBA 2HQAA 3R61A 4FX0A 5FXWA 1RI7A 3K0LA 4PI2A 4OLLA 1QQP3 2ELKA 3OYDA